4AQYJ

Structure of ribosome-apramycin complexes
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4aqyJ00
4DR7J 5A2QU 2KL8A 4V1Ak 4DV5J 2E5LJ 4LF7J 3J7AN 5LMNJ 2VQFJ 4JI8J 2UXDJ 4JI1J 1J5EJ 4GKJJ 4JYAJ 4B3RJ 1N33J 4GKKJ 4OX9J 4YY3J 4LF9J 4PWWA 4KY3A 4DR1J 1IBMJ 4JI6J 2VQEJ 4JV5J 5LMUJ 3IMQJ 1XNQJ 1I94J 4YHHJ 4LF8J 1N32J 4X65J 4X62J 4X64J 1XNRJ 1XMOJ 4DV0J 4DV6J 4NEZA 4LFBJ 4K0KJ 4B3SJ 2MQ8A 3R2CJ 4DV1J 4DR4J 4LF4J 4LF6J 4DR2J 2MTLA 3T1HJ 1HR0J 4NXNJ 4RJVA 2UXCJ 5BR8J 4KYZA 1N34J 5FLXU 1IBLJ 4JI3J 2UUCJ 3J81U 3OTOJ 3D3BJ 3J80U 1HNWJ 4JI2J 3W1YC 5IWAJ 4LFCJ 3JAMU 4NEYA 2UUAJ 4JI4J 2UXBJ 4DR6J 4DV4J 4X66J 1HNZJ 2HHHJ 3D3CJ 4DUZJ 4LF5J 2F4VJ 4HHUA 4JI7J 3R2DJ 4LFAJ 2MEWA 2UU9J 4DR3J 4DV2J 4B3TJ 4KHPJ 4DV7J 1FJGJ 1N36J 5LM7E 1XMQJ 4AQYJ 4B3MJ 4JI5J 1IBKJ 4DR5J 4DUYJ 2ZM6J 4DV3J 5IT9U 2KVQE 4JI0J 3T1YJ 4NXMJ 1HNXJ 5AJ3J 2UUBJ
chains in the Genus database with same CATH superfamily
4URQU 2ASYA 4FF2A 1ZZNA 2FJWA 3VZIA 4DPXA 2HVZA 3VVUA 2KI2A 3AA9A 1WDTA 1XNRF 1S6QA 1U6BA 4R0JA 1N8RT 2OTLS 3RBXA 2BMBA 4NLGA 2HVEA 3PRBA 2E7VA 4KHRA 1EJ7L 3D6MB 1KHWA 4DX8H 1UWAA 3BR8A 1S76D 2L9WA 1FJGF 3JTPA 2O5DA 2EEYA 2LEPA 2ZH1A 2EW9A 1S1VB 3CO9A 1FWKA 1GX6A 4LSNB 3HVRA 1JK9B 1HBNA 1HNZJ 2HRTA 1RQ0A 5B0FA 4Z7YA 2V8VA 1IM4A 4HACB 2QMWA 1VBYA 1J5EF 1Y5NB 1JLBB 1IKXB 2DGWA 2W9BA 2XTJP 2V4JA 4DQQA 4C2MA 1O0PA 3ENWA 3K57A 1VRTB 1Y7PA 4DFJA 1F3VA 2JVRA 3UFCX 4DUTA 1R8AA 4C4WA 2LEAA 1D0EA 5GAGU 2N7YA 2E44A 4LF8J 4X65J 2MKYA 4A8WA 5KG7A 3BGUA 5DM7Q 1VQSA 4IRCA 4H4OA 4EI2A 5BYSA 2ZBPA 3HD1A 1TKDA 4FXVA 3H5SA 1CJTA 4QW9A 5F9NA 3PKYA 2LFVA 2FY1A 5F8NA 3K58A 4HDHA 5E3CA 2XS2A 1SKRA 3RB4A 4P10A 1KFSA 2E5GA 2OSQA 3D6FB 3T19A 2Z2LA 2E29A 1TL7B 2OJ3A 7FDRA 5IT0A 2F8EX 3DOLB 1NDLA 3HI9A 4Z2XA 4C97A 1EARA 1XMQF 1M5SA 2VQEF 5DJBA 4LVNP 3I0SB 1X5PA 1JLGB 5LOQA 3V5RA 4LIRA 1JLEA 1VC6A 2BR0A 4CH1A 1HKAA 2MQQA 4CLKA 2KVIA 4ANCA 4DL5A 3ITHB 2RH3A 3PRDA 4I7FB 1IR2A 4K4YA 2IA0A 1RDRA 4J9SA 3PYEA 4JI6J 1IJFB 2XNRA 4RO0A 1N32J 5C42A 2ALZA 4CRJA 2DIUA 4JI4F 3GILA 2B8PA 2VICA 4ZLNA 2BANB 2HHPA 3KLVA 3TAMA 5HVGA 4WE1A 2CQDA 1QAXA 4H4KA 2OUGA 3W1YC 2V94A 3M8QB 2BKNA 4ECRA 2DHSA 2C2EA 2IAJA 5HL7Q 1H98A 1VDHA 1OYEA 1TKXB 2WVEA 1Q7LB 4P2MA 2FLNA 1S59A 5E0OA 1NPPA 5E41A 4JV2A 4A8QA 2AJ2A 1G2EA 3MUVP 1Q82T 3HO1A 3HZGA 3LA0A 3IC1A 1R31A 1B0PA 2MJNA 3K5PA 3CJ3A 3BQ2A 4IG3B 4B02A 3R5AA 1WNEA 1FFWB 4QJVA 3DM2A 5KT5A 3ENAA 3S8SA 3J7AN 1TELA 4O3OA 1Y5IB 3MM7B 3D0HE 3BEGB 1J5OB 1KQKA 4H4KC 3FVYA 1SC1B 3RU0A 3HF5A 3BGLA 4C0HA 3NNCA 1EZZB 4ZVTB 1VQOS 2WVDA 2Q6CA 1S6QB 4HT7A 4LF6J 4NRTA 2DGOA 2DH8A 3M8WA 4NYOA 3FCVA 2MLYA 3GONA 3GV8B 2IVFB 2K2PA 1TFYA 3QAEA 2OMOA 2AMCB 3LWLA 2KXHA 2MKJA 3NCPA 2FGOA 1CQNA 2CVIA 4LR8A 2C1EB 1K73T 4P7VA 1HBNB 4DBQA 4DR1F 1SV5A 3AJ2A 4JI5J 2K3KA 4A8YA 2PT0A 5ETNA 3CMQA 2RSQA 3CJ2A 4Y2AA 4V1Ak 2I6WA 4L3NA 1TU0B 1U1OA 3NAIA 2VA3A 1RAFB 4PWWA 2AEFA 5J1NA 5BYRA 2QN6B 4O44A 3QNWB 5D0EA 3ULHA 2BDPA 1DTTA 4DI6A 1DQ9A 3EZUA 1X7VA 2DNQA 2FJEB 4FVCA 2B4VA 4H4OB 3J81U 3J80U 3ZZRA 3HHNB 1PILA 1CJTB 1V3SA 2FLOA 3A12A 3H7HB 3KK2A 4EFAC 2ILYA 2F4VJ 4HHUA 3CC7S 4WK3A 3FFIB 4CLUA 5DLFA 1HWLA 4Z7CA 3BF4A 2KB2A 3GG1A 6AT1B 1VC5A 2O67A 4YEAA 5KFJA 2KXFA 4CH7A 3BDEA 4RZRA 2VF3A 5LMNJ 1LWEA 4TU7A 2JL9A 1JLEB 2DGSA 2V34A 2QRRA 1LKZA 5DZ6A 4ZLJA 3BSOA 3FSXA 4CYUA 4DCOB 4M5DA 1WHXA 4F26A 4DV4F 5THWA 1H3DA 1T3OA 1LXNA 4LFAF 3RRKA 2EK1A 5HK4A 4DZ6A 1Y5LB 1P6TA 3D0IE 3NL0A 3MHYA 2CQHA 2YNFA 3HFZB 2JEGA 1RU1A 3TAMB 2O1PA 4WE1B 5KG2A 3U1MA 2FQQB 2D7SA 2MZQA 3VQSA 4CWBA 3CC2S 2DO0A 2JSXA 1VYAA 2D9PA 2RD5C 2QSWA 4WPAA 3N6LA 5A8WA 1BWEA 3CULA 4DUYJ 2NQPA 1HHQA 3NCQA 4RW6A 3MMCB 5L1KA 4F8RA 5A6WA 2XB2D 4WF9Q 1NAQA 3J7YU 1LEOA 1QD1A 1WHWA 4DSFA 1A0OB 3LH2S 1UCNA 2WAQD 4DOZA 3H40A 3IBCB 3PG9A 4NASA 3DRSA 3HHEA 1VISA 3OR2A 3M05A 1ZTTA 3Q8SB 2AQ4A 1BMQB 3C16A 2CPFA 5L46A 3CNQP 3SEOA 2GC8A 2HGLA 4G6VB 3KK3A 4CH0S 1RA7A 2FHMA 3B54A 3KLHA 3EICA 2M0GB 5CYJA 5KFAA 3PR5B 4TY8B 2OTJS 2VPZB 2W2NP 3M1VB 3B82A 3A8JA 2DB1A 4NEYA 4PWDA 2CPDA 1NHUA 2I2YA 1VQMS 3BPDA 4DPUA 4B9TA 1NZAA 2ZUAA 4MIBA 3WIUA 5SUHA 4B3TJ 3FZ2A 5KG3A 3A8IA 3PHTA 7FD1A 3H5UA 3V81A 3MUTP 1UVJA 1N5SA 2WB1D 4ZVQB 2J0XA 4DV0F 2EWHA 4F3QA 4AXIA 3S7RA 4QR1A 2OP5A 2F3JA 3EGVA 4OL8A 1SKWA 5KG5A 4H54A 4RX6A 3D7SB 2JLFA 2BJ9A 4TYBA 4LQ3A 3IFEA 3NOGA 1R0AB 2J5AA 3DLGA 2XLKA 1DTQA 2IC3A 3TJAA 4B9SA 4YR3A 2FC9A 1Q78A 2ZHOA 4ZPCA 2CXEA 2PEHA 1VQNS 3DYAB 5L8RC 1DTTB 3OTEA 1NKBA 4BS2A 4MYTA 2FZGB 3KHHA 2KJVA 4JI2F 4CLPA 3FGVA 1HNWJ 2NXJA 2XQCA 2Y1LB 2HPUA 2XMTA 2B6AB 4UY8T 1TV6A 5B08A 3G6VA 1TKTA 3CJ8A 2B4OA 1UEUA 5D4PA 1F3FA 1ZS6A 1VQLS 2KT2A 3Q2SC 2N4DA 4RNHA 1UVIA 3QJJA 1VIXA 2HG4A 2ADCA 5K8OA 8AT1B 3TP2A 1M1KT 1S1TA 4MAKA 4DR4F 4WIQA 4JP8A 4L6V3 3C6TB 3LWMA 1MG7A 4FKYA 4ZPAA 4ZVFA 2J6UA 3W60A 2GW8A 4FS2A 6FD1A 1XBWA 2YWKA 3QBCA 3OVBA 1LWEB 5HROA 4PYAA 5F9LA 3CSKA 1G3OA 2UUAF 5J2PB 4LIWA 4DV1F 4DR6F 1ITPA 3BSCA 2ZH6A 4M5IA 1RGVA 1KN6A 2BACA 5EWGA 5GAEI 3EYZA 3CCES 2B5JA 4M5DB 3K8VA 2DD8S 2NXUA 3I96A 1KD1T 2QLXA 1C0TA 2DY1A 1V9OA 4KHPF 4I6YA 3NAHA 1OQ6A 3PYDA 5A8RA 4G1IA 5L9XA 1B3TA 1RT4A 5DQHA 2YNFB 1P9YA 4WCEQ 4IOCQ 2X1FA 1S9GA 1UVNA 5IT4A 1RYSA 4FDFA 3UCGA 3T3FA 1Q95G 1S1XA 3VALA 4LF9F 1FJGJ 3HJFA 4IFVB 3L4BC 3PW0A 2PA8D 3TUZC 2ZD1B 2F1FA 3HVWA 3PXGa 4USJC 4DPTA 2W2OP 2ZBRA 3RGIA 1KQSR 3N6NA 4IQMA 1U2RA 2A6OA 3BGFA 2SXLA 1J5EJ 5M2RA 4KB7A 2J0WA 4RW6B 3DXBA 2BM0A 3OTOF 1TK5A 3VV2B 1FD2A 4ZPDA 2KXNB 5K14A 1YBAA 3CJTA 2JEIA 2XWXA 4LSZB 4KC5A 2YX4A 1GMVA 4A8KA 3MR7A 2QLJB 1KVJA 2M8HA 1LW0B 2FJDB 2K06A 2BJ7A 1QM9A 1NO8A 3ILLA 4I64A 3UWTA 1YZ7A 2VH7A 3UPFA 1ZETA 4KGKA 3KK3B 3PKMA 1HI0P 4PPDA 5B0GA 4UOHA 5ETOA 2WVBA 1SL0A 3NP5A 3THTA 3IR5B 3OBIA 3QATA 4QPXA 2C3OA 1H74A 4TLRA 3VGUA 3ZC4A 4B9VA 2OPRA 3I5AA 2AYEA 2FVCA 4F36A 2DNKA 4JB8B 1OMSA 1X5SA 3V81B 3O5TB 3H59A 1FTCA 4O3NA 1NJWA 1NK9A 4EYHB 1I5OB 1HBUA 2MSSA 2DNLA 2VQEJ 2HLUA 4LVOP 2XMKA 5GAGI 5A0YA 1FESA 3BJYA 3A8EA 1QTNB 1TFWA 5DZ7A 3DRRA 3DLGB 1RP5A 1WF1A 1DTQB 4WFZA 4Y65A 4AYBD 2J7KA 3NCRA 2YQ3A 4DR3F 3PX0A 1N5VA 1SQGA 2GGPA 3LGHA 4YB5A 2DGUA 3NEKA 2NZCA 4JI4J 2H4YB 1VQ5S 1BUXA 2YXLA 3E2EA 1S1UB 4QWDA 1K1SA 2LA4A 1MU2B 5I3UB 4UTGA 2DYAA 4C8LA 1Z2LA 1TV6B 1YSJA 2C3PA 2J0SD 2MZTA 1TKTB 2KZMA 1Y4ZB 3TI0A 2B9WA 3T1YF 1VK8A 5B7WA 3BO4A 5DDPC 1V3ZA 1XWLA 4DR2F 2OIHA 1SH0A 2E1CA 2MSTA 3GMGA 1AB8A 4OZ5A 2VG7A 2R7XA 3DU6A 2QSFA 4C3MA 4FNIA 2NPIA 4ECZA 1XIQA 1VQ4S 3GTYX 3RG6A 2C3UA 5IZHA 4TU9A 3GFZA 2JHEA 4LQ9A 1JLCB 5GADU 3R2CJ 2QA1A 2XNQA 3NLCA 3US5A 2DXDA 5HROB 2J9DE 3GJQB 1F2HA 4UZBA 3ELHA 5CHCB 5FLXU 2LKZA 1GMUA 3AOAA 2GX8A 1Y10A 3RRGA 5F3TA 2M7SA 2HQGA 3FBFA 2NSBA 1C0TB 5M2UA 2VJUA 3OD2A 1WC0A 2GJFA 4CO5A 2GMJA 3R1HA 4EEYA 4DLGA 1RCXB 4K5RA 3H42A 4YR2A 5HATA 3AA8A 2PFFB 4X64F 2K7KA 2VODA 1HQUB 2ZH9A 4DL3A 3TUJC 2EFNA 3M7VA 1UJ4A 2PEBA 1Y3JA 1PCAA 3HT3A 2UVVA 2KT5A 4DR1J 5L1LA 2D3OR 2CDQA 2F5GA 3C2PA 2DNZA 2RRNA 1H6KX 3F41A 3PW7A 2IM2A 2J8AA 3V4MA 4F0KA 2RDIA 1RHQB 2RS2A 4TLQA 5K14B 1RISA 3DOKA 3EDQB 2ASJA 4HVZA 5DG9A 2IVMA 2HNDB 1HR0J 3A3OB 2NUUG 4HYKA 2A1BA 3CD5A 2V68A 1RCOB 3LOUA 3D66A 4OI6A 4FF3A 2H5EA 3DHXA 4CO4A 4F2RA 1XR6A 1QSLA 2ALYB 4MKYA 2XS7A 1MMDA 1LXJA 3OL9A 3NGSA 1R8HA 4KIAA 5HQMA 4ELUA 4CP5A 2W01A 2YWGA 2VBZA 1AFJA 3FEYB 2DHGA 1U09A 2CQ3A 5F8HA 1LWFA 3BDPA 3ZZUA 4LF1A 3ONQA 3R5BA 1OO0B 1RWNB 3VWSA 3F56A 2JDJA 3DMJB 3MFHA 3NG8A 5KFWA 2BM1A 1N56A 2HFVA 4DQRA 1NCLA 3HVTA 1FF2A 2GS8A 2B9EA 3ZZ0A 3W9IA 3JSBA 1GK8A 4WU3A 3MD3A 3BO3A 2IRUA 3AXMA 4AUKA 4I2PB 4NA1A 2CZ4A 2MJUA 3FBEA 4XPCA 1S4FA 4U96A 2X3DA 3MF5A 2MHNA 1RAHB 3W8GA 2OO4A 3TZXA 2D74B 4DV4J 3NBPA 3CMAS 1KLNA 1N5TA 2LQJA 2GGPB 5GAHU 1RYRA 4LFAJ 1O6XA 2FIUA 4WTYA 1B7YB 2CQCA 4P73A 1JJHA 3HZEA 3C15A 2R4FA 1V3RA 2ILZA 1ZYQA 2CJQA 2KZZA 1QSYA 4WXOA 1U0HB 1PO6A 1PBUA 3HFVA 4OI2A 3M6UA 1WOOA 1M1GA 3MURP 3POTA 1VQYA 5LMUF 1SJQA 1RJJA 3FSYA 2OFGX 5ADZA 2AGQA 3QZ8A 3OFGA 3C3LA 4RUHA 3HHLD 3NXZA 4ZP9A 3LTOA 4JOUA 2MDAA 4KE5A 2VG7B 3EDRB 1P8GA 3CJ5A 4AD6A 2OPSA 3DRYA 5KFLA 1RWKB 4KO0A 1NEEA 4QBUA 2DKOB 3HXMA 3V6KA 3BGOP 3LGNA 4J5OA 4MH8A 4J9KA 2DGVA 2UU9F 1SJFA 1RHJB 2AWZA 3MEGA 1N36F 4KPYA 2JNJA 2GVDA 4PQAA 4X4RA 1RADB 3N79A 4GRSA 4RW9A 2DHXA 1TL3A 5H9FK 4DFPA 2ZDPA 1NKCA 1HARA 4O3QA 5IT9Y 4USTA 2R2TA 3V2UC 1BE4A 3CD7A 1CS4A 1TUGB 3BKTA 2N7CA 4X62F 2WCXA 2UV8G 3ETOA 2KG1A 4A46A 2AU0A 3RAQA 2EFGA 2FTRA 1ZM3A 4WFAQ 2R42A 2JH3A 1Y11A 4GVBA 3A3PB 5CD4A 3GIJA 3J7YI 1IBLF 1RWUA 1CBKA 4LREA 2VPWB 3IRXB 2JWNA 4DV0J 4DF8A 4I2QA 4ECWA 2QLWA 5CZXA 1U4BA 3H20A 3ZNJ1 5IM0A 5CXTA 3RRHA 3BR9A 4M95A 4GO5X 1U47A 4ZA1A 5JUMA 2HQ3A 3L95X 3QAUA 1MMNA 1FRHA 3KLEA 1TMMA 4F4WA 1VIOA 2YKMB 1J27A 3OXLA 2CPHA 2GQQA 2XSFA 4ZCIA 4OYIA 1MWYA 2DNYA 2JRSA 2VA2A 4Y0FA 4ECUA 2G1DA 2XHWA 2DR7A 3HD2A 3KLIB 1AA1B 1NPKA 1T3NA 4PQUB 5AT1B 2OFHX 3DGPA 3QSIA 2VBWA 1LWFB 4GMKA 3UD5A 3IO1A 2V2ZA 1EX8A 1QY7A 4OJHA 4C0BA 2DNGA 4BBYA 4PWUA 4HI2A 4QR2A 1HWJA 2RJZA 3NY0A 2DNMA 3D0GE 2AJ1A 2VD3A 4J91A 3P5BP 9ATCB 1OYDA 3GIRA 1HYSA 4DR4J 2CA9A 2VG5B 2DEIA 2EI5A 2YX1A 1JJ2R 4L72B 4XIUA 3MXHP 4RU9A 4OHYA 3AFGA 2ASDA 2UUAJ 3LQVA 4DR6J 2OEJA 1TL4A 3L7PA 5HANA 2PMHA 3CVKA 4QWEA 2H9ZA 3IG1B 1FWPA 2XSJA 2VQFF 3K2YA 1L3KA 3HULA 1KTQA 4KHPJ 1UZHA 1WHYA 2C22A 2JVOA 3JSMB 5E3RA 4CTAA 2R7VA 1WC6A 3C15B 3G71S 4ZPBA 3MAQA 1TR0A 1RHUB 1ZM4A 5F8IA 1IBCB 1QVFR 4LF9J 1S48A 3EJMA 3SFUA 4DSEA 3IGNA 2ZH7A 1FEEA 3OXGA 3ISND 1YRTA 5IV3A 3TZWA 2JLEA 1HI1A 3POTB 3BB5A 2ATCB 3G6ES 3KJFB 5J1PA 3UDVA 1U1PA 2CZVC 5A8KA 2MKHA 5ETMA 3OTOJ 2HYIB 2OPSB 1FXLA 3GR1A 5IXUA 1XR7A 2H48B 5HQLA 1RT2A 5ETQA 3W2VA 3JAMU 5IOLA 4UUWA 3PEHA 4K4SA 3NRBA 3LAMA 4AL6A 3WDOA 3D4JA 4NOHA 1G4CA 4K4TA 2GVDB 1S77D 4B9NA 1S0VA 3M4XA 4XDCA 4M8LA 3VTIA 2JX2A 2V0NA 1RBLA 4RW9B 5HSPA 1TL3B 2OEMA 1YVFA 5JMNA 1S1WA 3THPA 1TMJA 1ROFA 4QWAA 2RIJA 1RU2A 4F4YA 4WK1A 1CS4B 2DHHA 3GU0A 3TANA 1R7IA 2IMWP 1U1KA 3CJRA 1WG1A 2HLTA 5KG0A 5KFMA 4J9PA 4WZQA 1QAYA 4NA3A 4FPIA 2JJ4D 3KK1A 5D4OA 1R6VA 4GVBB 3QZ7A 2FHJA 2B0GA 2QG9B 1JNZB 3ZTOA 2IIHA 2P9GA 2R7QA 2HHXA 2FZKB 4DQSA 2CVEA 4I2QB 1AUDA 4R25A 1WG5A 1S6PA 1U25A 4U7UD 1SJRA 1DURA 4FYWB 4J9NA 4Q0BA 4RNNA 3BYRA 3PFOA 2UZAA 1L3SA 4KGXB 1T8EA 2HNZA 2WK4A 3CO0P 1P9QC 2VFUA 1F5CA 2HS4A 2BKPA 4DR3J 5D77A 3FEZA 1X8DA 1FKOA 2POKA 2CPZA 1UJ6A 1CULA 1M5PC 2M4MA 3A1YG 1N5YB 2IBOA 5KOXA 1P1LA 4EBCA 1K47A 3OPKA 1NU4A 3I55S 2VFVA 1J2VA 2KFYA 3GWCA 1OPZA 5C24A 4DU8A 1YHQS 1N48A 3GJRB 4OZNA 2ASLA 5KFDA 4B3RJ 1VOMA 4MFBA 1FD8A 3OSPA 1YI2S 2MZJA 3DGPB 5G4DA 2E66A 4MTPA 3QSYB 3PX4A 3TVZA 4C8NA 3EGNA 3MMAA 4LF4J 5AXKA 4DR2J 3KXDA 1T7PA 2ZFHA 3W66A 2ZWOA 1RLCL 1DRZA 1HYSB 1KEKA 2R8IA 3LP2B 3QT5A 1VMBA 3D1OA 2RQMA 1RT1A 5KFZA 1NM2A 4DUZF 3KYLA 2ZM6F 4LF5F 3FBBA 3E51A 4NWBA 1RHMB 3N4WA 2WTFA 3NS5A 4MKAA 3U1LA 3CCZA 1YK9A 4NLQA 1NK4A 3NS7B 2E5JA 3PW4A 4TQRA 2FYXA 1WSRA 3O3LA 2RQ4A 3ADAC 4O4GA 2XSJB 3NGUA 3HHLC 1YJWS 4H4MA 3GCXP 2CQ1A 4HLBA 2LDYA 4NXNF 4C3LA 1BD6A 1SUQB 3R7BB 2BW7A 4ZVOB 2W7PA 3CJ4A 3UR0A 2QT7A 3TUPA 5KFIA 4X64J 4LBIA 3GLJA 5AE2A 4PXCA 3S01A 5GADI 1REGX 1YBUA 2I38A 2W8KA 4RBTA 3DLEA 5I4MA 3PM9A 1U1MA 1T9TA 1WI8A 1U0SA 5A8KB 4K2XA 1D8ZA 3EXCX 4IR9A 2V8GA 1C1CA 4DL0C 3B4MA 1YG0A 4O23A 4ETZA 2IJRA 1RT2B 3W2VB 4KJIA 2V8HA 5KFVA 3QFHA 4RNOA 3EE3A 1SKSA 1E6VA 2RQCA 2QA4S 2ZC3A 4ED0A 3K5OA 3MOZA 4NLUA 1SIWB 4K0KF 3I9ZA 2BE2A 4I4BA 4ZJQA 2XG8A 1S1WB 3QO9A 2A6MA 1SI9A 4C8KA 1T03A 3DKDA 1IVZA 2DR6A 3OW2R 2QJ3A 3P96A 4OLOA 3N5BA 3RR7A 3ET6A 2XULA 2GQ2A 5F0UA 2IM0A 1YJVA 1SC6A 5KFBA 1RAIB 4OHWA 5L39A 3S1TA 3N6MA 2HNYA 3A4TA 5K8MA 1MROB 4TYAA 3M8PA 2ZZNA 5T7LA 1JLAA 5KG4A 3VF0B 4ZJLA 4IUFA 1EKSA 4ELVA 4OI0A 1R0BG 2FJBB 1KONA 5CD4H 1KTVA 5EHHA 2MGZB 2LVWA 1M5VC 1D3WA 3PFEA 5HLFB 4OJ1A 2D3O1 4UT4A 2DH9A 3IM8A 1R27B 1Z1ZA 1NPRA 2HAIA 1CULB 2RF2A 2BJEA 1T05B 3HSJA 4AT1B 4NMXA 5ETPA 3JQJA 3ILOA 1RT7B 1RTZA 2XI2A 5F41A 2X3GA 2IHR1 4EUVA 5DQIA 4MFBB 4JV0A 5KG1A 3VVTA 3TVYA 2ZJRQ 4N47A 1HBMA 2XGPA 2NREA 2ZC4A 3U02A 1TUWA 1H2TZ 2LQ5A 3HHLB 4FYXB 3MMAB 2V63A 4K7QA 1AZSA 1RHKB 1YQHA 2KN4A 1UKUA 4OQJA 3MMJA 4WZMA 3PJWA 3D3CJ 5G0RA 1UWBA 4WP9A 1YKWA 1H7XA 4YQWA 1ZAVA 3QIPA 2X1AA 2UU9J 2P6SA 2W2PP 3EUNA 5D0GA 2HHQA 2F8MA 3GZ7A 1N36J 4IO9Q 3BKUA 4PXEA 4FVMA 1S97A 4JI0J 1PG5B 1JLQB 3ISNC 2A18A 3VHQA 5A2QU 4O4GB 2DNOA 1B4SA 2M3DA 3FCWA 1UPMB 1GXLA 4GKKJ 3PW2A 4KFBB 3R6LB 4H4MB 3TRGA 3P49B 4DV6F 1X4FA 4X62J 1BGXT 2M2BA 5L38A 1NJIT 3QGGA 1B64A 4R8UA 2RILA 3BREA 3PTWA 2XZDB 1E6YA 2GHWA 3JQKA 3CGIA 1IBLJ 1KQGB 1RAOA 1LW2A 3UW1A 2OPQA 2W1BA 3TA2A 4RW4B 1C1BA 2IA6A 4F4AA 4U67Q 5HN0A 3V4IA 3DRPA 2RVJA 1L3VA 1BY9A 4OHXA 3RBZA 2MEWA 3TW0A 2Q6BA 1QUPA 5C7PA 3K7RA 1JLFA 4YY3F 4O3SA 3CCWA 3SSSA 2Y8YA 4C11A 3KNAA 1QDUB 1NDPA 2R3VA 4ICLA 4WXWA 2Z2YB 4ZDNA 1I51B 2I1RA 3ZXWA 5KFHA 4C8YA 2AJ0A 5F8LA 1RTJB 2XHCA 1E6VB 2YWHA 1D09B 4ZITA 1YJ9S 1HPZB 3CC4S 3BGRB 3M2UB 2YQ1A 1PYSB 4P6QA 2ZVSA 2R8HA 1T03B 1AROP 5J2QA 3BBFA 1GQEA 3EPGA 8ATCB 2AYBA 4ZS6A 2MTLA 2FJAB 2KHDA 4LSLA 3DLHA 5CH7B 2DGQA 2EXUA 2VKRA 3UDCA 4ER8A 1TK0A 4YDDB 3L3CA 3IBFB 1GEHA 4PR6A 2K7JA 2BXJA 2GAGC 3KJNB 1DLOA 1ZA2B 3F44A 3M8PB 5T7LB 3W2WB 1EP4A 2U2FA 4K4XA 3UVJB 2BE7D 4ZVEA 4PUOA 4NMLA 4N76A 4YOEA 2CFXA 3D1HA 4DFKA 4J9LA 1GH8A 3O1LA 4LFBF 1VQKS 2UV8A 1HNXJ 1MNEA 3DFEA 2ZHAA 3ENVA 5KFTA 2VQFJ 2FVQA 3M2RB 2FJXA 3TZZA 2NXEA 3NGDA 2EFQA 2PIIA 3DRXA 2HSEB 2AP6A 4Y3CA 1GNKA 3T5LA 3FK4A 3QQCD 1NK6A 1K1QA 4LT6A 2KFNA 4DFMA 1S7HA 5T14A 1S72S 1XEZA 1BHNA 2OD6A 1FNOA 5D0HA 4KGVB 3AD8C 3U7JA 3DGVA 1FFSB 4F7VA 4FKXA 2G0CA 5D3GA 1OJ4A 4KV8A 3TNVA 1MN9A 4FBUA 4D3GA 4P72A 1HNVB 4RW8A 2ZH8A 5FJ4A 1DQ8A 2ZNZA 4LFCF 3KMSA 1Q5YA 2Q1LA 1HWUA 2AD9A 4AQYF 4KBIA 1HHSA 2RT3A 4AXJA 5D4NA 5ETLA 3M9OB 4X4OA 2ZKTA 2UXDF 4ZP7A 4JYAF 3IS9A 3MM9A 3P8BB 2ZHBA 3DLLQ 5ETRA 4K4UA 1IBMF 1JB0C 4NCGB 3ILIA 1GXUA 3Q83A 3KLFA 4W90B 4WP3A 4WYLA 3FRYA 1GT8A 4FZVA 2W4CA 3SFGA 1KP6A 3B8HA 4HT5A 2C3MA 1HQEB 2HZCA 2GIQA 2MQLA 4WFXA 2F40A 1OS5A 3JTOA 5LXYA 4UF4A 2UUCF 4RW7B 3TEHB 1R8CA 3TO8A 4TXSA 3MZIA 4J9OA 1RTIA 1DZ5A 4OX6A 2EC2A 2M5YA 2UXBF 2AX0A 5HBMA 3CIZA 2ROPA 3R7SB 3MCMA 4ZVGA 2DHAA 2YWEA 2ZVIA 3SCLE 2V2KA 4R8UB 3ZZPA 4WIIA 1NSKL 4IDKA 3KJQB 4PZVA 4ETXA 4B17A 1DHMA 2CZ9A 1NH8A 4RPFA 1U6FA 1ZOTA 2UUBF 4LRBA 3HHDA 1DFDA 4QZVB 5HQ8A 1SC3B 1FDNA 1C1BB 5E3AA 2KH9A 3ISZA 4J9RA 1X31C 1FDBA 3DRPB 1FRIA 3O6QA 4MIWA 3PHEA 4B08A 5ETSA 1F1BB 1S10A 5K20B 1UL3A 1FNMA 4UY85 1JLFB 1T9YA 4Z37A 3VR1A 3O8WA 1ICEB 4C11B 4L73A 4DL2A 1SH2A 4M5LA 4C0OC 4Y6IA 1DAXA 4J9UE 1YRXA 4I6AA 1FI4A 4OYXA 4ID8A 3R7NB 3QRQA 3JTNA 3SCJE 1FVSA 1O5JA 3H25A 4CLTA 1H38A 2L9NA 3RB6A 3C6UA 3AD9C 4DHVA 3UD3P 4RL1A 4JI3F 3QT8A 1X9WA 1Q79A 3CCQS 2QYCA 2B9YA 2AKWB 3MECA 4ECTA 4OI1A 5D4LA 2E9ZA 3QT7A 2J9DA 3TAQA 2C2MB 4ILMA 3CF5Q 5C5JA 3R9LA 5CABA 2YNGB 4UW2A 4LSLB 1NDCA 2XLJA 1S9EA 3G82A 3MEKA 1WACA 3PO5A 2WW4A 1HNIB 3D6HB 2V8DA 2E5LF 2GHVC 1F9FA 2DH7A 4N56A 2GIFA 3CJKA 3EZOA 2YX7A 5BYQA 2ZH4A 3EWGA 3BYPA 3PDNA 3EMTA 3G6YA 3GIMA 1MWQA 2ZM6J 5KT7A 2A10A 2MY8A 2IBKA 4ZLPA 2WB4A 1UVLA 4ZVSB 4CM0A 3WBZA 4C9DA 2XS5A 3MAHA 1NMEB 4QOTA 4I6WA 3UNYA 1O51A 4B9UA 4QR0A 4NLWA 5GMDA 1NSAA 3SQGA 1M5OC 4MJKA 2EPIA 1HBOB 1FDDA 3KMQA 1RAEB 3QGIA 3Q0AA 2FHKA 3BN4A 3OUYB 3KG4A 4NXNJ 2X51A 2YNHB 5GVQA 1VRUA 3NGRA 1N54B 2DO4A 1FHTA 1OSCA 4KV8B 3CEDA 2H5IB 2HHSA 5IWAJ 4PKDB 1I3OB 1CJKA 3Q89A 2QFJA 2FY8A 4GKJF 3FZBA 1YJUA 2GVZB 3KUEA 1MLAA 1S49A 4PXDA 4ANDA 4ED3A 3MM9B 4ED2A 4Q8EA 2YKNB 1T9UA 4X4QA 1ZZFA 4RBUA 3C14A 3UE2A 4OFZA 4ZVRB 5U47A 1L3TA 4BWMA 2XC9A 3AJ1A 3PVXA 2GNKA 3MR6A 3DHWC 3NNHA 3M8RA 3FBCA 4MMOA 2Z4PA 1U1NA 4K0KJ 2RAQA 3J81Y 2DISA 3J80Y 2LP4A 2I5JA 2WVFA 1UMJA 1RTIB 1UTAA 3GQCA 2XMMA 4DV2F 4PG5A 1FKPA 3TYTA 1U02A 5J1EA 2C2RA 1DQAA 2HMIB 1FEHA 1KFDA 3OLBA 1NB7A 1Q4RA 4NZ0A 5SZTA 1PSDA 1V5IB 3H5YA 5FDLB 4ZK7M 3Q23A 2XY5A 2XGQA 4CLSA 5KT2A 4C98A 4JV5F 3EGZA 1SB6A 3K59A 3CCTA 2E1RA 1EQMA 4IG0A 1D9FA 2IDLA 2ROEA 3GIKA 1IKWA 3KUHA 3MEDA 1OSDA 2CNOB 2UXCF 2E7XA 3MAAA 3OV7A 4YN3B 3OXFA 5IV4A 5HJXA 4OZLA 2HEKA 3I31A 1CJVA 2V50A 4F4XA 4O0NA 5KFRA 4CCHA 1U7LA 2JFDA 2BJDA 2BOAA 1UA0A 3NOCA 8RUCA 5MAOA 3CD0A 3RTVA 2KU7A 1C0UA 3MR3A 3AB2B 3N0VA 5L9NA 3BZQA 5D6GA 4NXMF 2V8PA 4F3OA 1VC0A 1S9EB 3G82B 2W9BB 2CJXB 4P9SA 3BBBA 2RE1A 2AJQA 2BBEA 3PRVA 3E01A 3OT9A 2V4JB 3WIVA 1XNQF 2BW2A 2OAUA 1O8BA 4HKQA 3TVKA 3GYNA 3D67A 4DU7A 1X0FA 1XMOF 4P7TA 3CJKB 2W2QP 1EIYB 3PYGA 1PC5A 3DC2A 5A76A 3F0NA 2FVPA 2CPIA 1ZBTA 1B70B 2OD4A 2XLIA 1QTMA 4PXBA 1FRJA 3SSRA 1Q0NA 4YUDA 5K9FA 2Z57B 4DSLA 3SQGB 3KJVA 3Q8VA 5J2NA 4J90A 1X0PA 4ZCLA 4KAIA 2QL7B 5H9EK 4FP9A 2B3TB 2VC1A 4EMDA 2CG8A 2ZE2A 3OFHA 3CPWR 2W8LA 2DVIA 2HQCA 1WKKA 3RYLA 3AT1B 2IM3A 3LUYA 4XK8C 2V4RA 3OJSA 5DDQC 1TKZA 1U2FA 2IPOB 2OLWA 4KGZB 3M9NB 2CNLB 1LNQA 1QE1A 4DCJB 1BQNA 1VQ8S 1U49A 2VOOA 1CJKB 3TUIC 5K8NA 1FCAA 2VV5A 1F6TA 5DM6Q 3O44A 2MLZA 3C19A 1RT5A 3SV3A 2RU3A 2CPJA 4ECQA 5C42B 4Y2CA 4YY3J 4DL6A 4G1PA 2ZOGA 3ZZZA 4QIVA 3JSYA 1F9HA 3C14B 3NGTA 5E7OB 2DRDA 4LF6F 4DSKA 2A2DA 3T5HA 1UPPA 3MWBA 1WUUA 4QWCA 2YKPA 3KKFA 3A3NB 1EB0A 2DPJA 4QIGA 1PJ5A 2I5JB 2IAJB 2YQ0A 2MYFA 4R5PA 1Y0HA 3RB3A 1TVRA 2QFIA 3QRRA 1T0TV 1UA1A 3MR2A 2N82B 1WC3A 1FKPB 4PCQA 3PJ9A 4M5KA 1KWMA 1NSPA 4WU2A 5JJBA 3BSNA 2K8GA 1C4CA 2RQKA 1S7IA 3WX4A 4JI5F 2C2KB 2J8SA 4ALZA 3DM2B 2MKKA 2LYVA 4Y34A 4TY9A 2DBBA 3BN7A 5KFUA 2Y1IA 1VHIA 2GFFA 5BJRA 1WKLA 1V5VA 2U1AA 1FT8A 1RKIA 5KFEA 2M52A 4IG0B 4WWSA 1NRKA 1Q8IA 3RAXA 2R2UA 3GPAA 3DOMA 3L7UA 3MEDB 1B7FA 1JJCB 1X4GA 2FHOB 4LFBJ 2FLPA 3MAAB 2WONA 2JFKA 1KOOA 2FUG9 2EKYA 4LJMA 1ZAWA 1AUSL 2H4WB 3DLKA 2PFDA 5JVGQ 3QMQA 5KAKA 3VGVA 3MOJB 4ERDA 2PMWA 3PEJA 3GCWP 1URRA 5KTQA 1AT1B 1BQMA 2Z0GA 4UOFA 4GVLA 2CPXA 2K1RA 3AB4B 1IWAA 2AYGA 1EKRA 1SV5B 2NYHA 1YTYA 3G4SS 2ZBCA 3W5YA 3OFFA 2XY7A 5B0AA 1X4EA 4AQYJ 1IWGA 1ZAXA 3MFIA 1C2PA 1NH7A 3OL8A 3MUMP 4O44B 1D9AA 2UXDJ 4DPYA 4MKBA 4JYAJ 1PJ7A 2MB0B 3MPVA 1WF0A 5ITHA 2O66A 3VAFA 1IBMJ 2UVWA 2CG4A 3AOBA 3SZ2A 5IC6B 3VGTA 1OIAA 2OGUA 3CDAA 3UN3A 2CADA 3TA1A 2VFRA 1YZ6A 2ZUGA 3DDIA 3Q86A 3HK2A 3KJVB 2UUCJ 4DL4A 2B7CB 3NKYA 4ZPWR 2G0IA 3KK2B 3M2VA 4XAKA 4K2JA 2UXBJ 4OYBA 1F0XA 4RUBA 3AQOA 1I1GA 4RU2A 2DITA 1MMLA 2ZE2B 1XERA 1C4AA 1S1VA 4LSNA 4ED4A 2AZ1A 1S79A 5C25A 4EZ9A 3UO0A 2J9EA 1TKZB 4HACA 4ID5A 3HHKA 2Q79A 2G13A 3ZTPA 3GG0A 3PV8A 1RABB 4YHHF 3HJVA 4PG8A 1QE1B 2BUNA 3EGWB 4F25A 4CO3A 1RWXB 4YB1P 1JLBA 1IKXA 4NYPA 2UUBJ 3I9V9 2FB0A 4KHMA 3T1HF 3PX6A 2DNHA 2V9WA 1RT5B 4CYUB 1W2BR 1VRTA 1SPBP 3PR4A 5CAAA 3M8YA 1XNRJ 2Q3PA 3TQ1A 4CIOA 2D3ZA 4FXDA 3DDNA 4YB6A 1IQTA 3DU5A 4K4WA 1CSJA 1R8BA 2C28A 4M5GA 4IRDA 3TR5A 2CRLA 1UETA 3W64A 2G9OA 2HBYB 1KHVA 3QIDA 5HAOA 2IRYA 4R5PB 5ETTA 1RBAA 5A8WB 1WD6A 3NMAA 3BO2A 4QU6A 1JNRB 2PI4A 4GC7A 2EG1A 2PD1A 2R9LA 2XZTB 1LK5A 2QE5A 3DRSB 1JLGA 1Z4UA 1FJCA 2E5LJ 3OR2B 4CLLA 4ZIWA 4B9MA 4MIAA 3I4HX 4QQBA 3OVSA 4KY3A 3C16B 1T94A 2YH1A 4IH7A 2G0JA 2R8KA 3H90A 4BLGA 3IWLA 5LJ3Y 4I7FA 1CPZA 4USUA 3H2LA 2IYGA 2GQCA 2WSEC 3KLHB 1PGZA 1WOPA 3QJPA 2ZWPA 5FLXY 2WHOA 3DN9A 2B9XA 2NPFA 3HMJG 1VQPS 1NK8A 3DOMB 2IRXA 3M8ZA 2HZVA 2AF6A 2WBRA 1B0TA 2WONB 2NCKL 1HNWF 3EVOA 2R2SA 3HDSA 3CCVS 4PWDB 1NK5A 5C2CA 1XN9A 3D28A 4UZCA 4ED1A 4X2BA 4NRUA 4PAAA 5GAEU 1YIJS 2VOPA 3RAMA 3OTDA 1RT3A 4LF7F 1RWMB 1HA1A 4NZ6A 4BCAA 1H72C 2IJFA 1BQMB 1CQMA 5DG7A 1XMQJ 4DXLA 1H2UX 1VLYA 5DETA 2HHVA 3M30A 2BRLA 2CQGA 4M94A 4GO7X 4DL7A 1SH3A 2RRAA 4GKJJ 4DDFA 2IC3B 3X3UA 1PAEX 4HTIA 3UN2A 2LQ9A 3MM7A 2DGTA 1J5OA 3VAIA 2AEMA 3OLAA 4D3HA 2XMJA 1ACMB 1H73A 2LU1A 2BZ2A 1Y3KA 4J9VA 4FPRA 1G7CB 4WYWA 3KG0A 4KH1B 1I6JA 2IYIA 2YKQA 2J6SA 2JC0A 3KNGA 3MGJA 2YH0A 3OJUA 5E2QA 2XYGB 4UOCA 4KPCA 4NE9C 4AE5A 2HQDA 3LAKA 2I8EA 3M2VB 1DARA 5AJ3F 4NLVA 1S12A 4CT8A 3HFKA 2MZ1A 1AYEA 2ADBA 4DV2J 1WC5A 1RSCA 3QGPA 1SQEA 1LV5A 4TKTA 1S1TB 2QX0A 5H1SV 3T9NA 4KTQA 4LRCA 1TAQA 5C25B 2DNNA 5M2PA 2Y1JA 4NX9A 1BLUA 4M5MA 4ID5B 3RB0A 3IWXA 2DR5A 4CNYA 3SCKE 5DS7A 1Q7YT 2F9JA 2X1BA 1N0UA 2D41A 1U2CA 4ILRA 3M6VA 4JV5J 1VHFA 5D78A 1V6HA 1CEZA 2QLBB 3AHPA 4HTJA 2YKOA 3PCOB 2B5JB 4CI0B 1WORA 1ZTWA 2BABA 2XWYA 5I3QA 1G1XA 4FF1A 2UXCJ 5HMYA 5A8RB 1NJYA 2NXNA 1RT4B 4AL7A 1PBAA 2PMZD 1TL5A 2NLWA 5E3QA 4MK7A 2NS1B 4BHQA 4YP3A 4USMA 3W62A 3Q8QB 4W4MA 2NYIA 3BV8A 1UFLA 1OY9A 1S9GB 2BQ3A 1SQFA 4RWWA 1S1XB 2Y3YA 2NZ4A 3IM9A 4HEA9 4F2SA 1SJ4P 1RHRB 2NXCA 2E1AA 3BH7B 3GR0A 3FFIA 2IM1A 4PG7A 1VQ9S 1VFJA 3EPIA 3W5ZA 4UQGA 3KOAA 2F63A 4NXMJ 2WSCC 1W2IA 1SVDA 3G8TA 2UUTA 3OTBA 3FMWA 4M5JA 3EVMA 3T1AA 2QEXS 2J0QD 2DXEA 5KFNA 1XNQJ 4QPTA 5AE3A 2B8QA 3RW6A 3BQ1A 3H0PA 4CM2A 3PIPQ 3OTCA 3OVAA 1XMOJ 4PRFA 2XBPA 2V67A 2HIYA 1KLMA 1SIZA 3LPYA 1NK7A 2NR0A 1X4AA 2MY7A 3SBMA 3KDOA 2W9AA 1RWPB 4A8SA 3GFHA 2P6TA 3H5XA 3K5LA 2QMUB 2KHCA 3G6XA 2RUGA 3HM9A 2DTJA 2OPRB 4RWXA 2JEJA 2Y0BB 5B0DA 1WC4A 2RU9A 4ECSA 1KS2A 4F50A 3EM1A 3ILJA 2FHJD 9RUBA 1RT3B 1N0VC 3PY8A 1FX2A 1KDNA 3B78A 5KFSA 3HSGA 1LK7A 1HBUB 5HMZA 2JEFA 2W24A 3MCSA 1U24A 3M30B 4K8RA 3ZTQA 5EX0A 1T02A 1GTHA 3D68A 5F8GA 3MMCA 1FFGB 5BR8F 4ECYA 2R8GA 2HKEA 2DGXA 5A0YB 3AH6A 4Q5VA 4OMFG 3R97A 1X5TA 2R7RA 3DRRB 2QO3A 4U7UK 3BKFA 1D8YA 3X1LB 3D54A 3T5JA 1CG2A 3UCZP 3P5TL 3I4PA 3QRPA 2G2YA 2HK3A 3TX8A 3TJ8A 4DX6A 4CO2A 3TWZA 4DV3F 4TY8A 2R7UA 4OZ2A 3NWGA 3M1VA 3GFXA 3CD6S 2CNKB 4DR7F 5KOWA 2CWXA 1REVA 5A6PA 1MN7A 2RKIA 3K8WA 2F9DA 1WHVA 3BM7A 2LQBA 4ED8A 4DF4A 2CPYA 2L9DA 1APSA 1R0CB 2GMLA 4DN0A 1VR6A 1YJNS 3IMQJ 4DS5A 3IP0A 4NPOA 3WQPA 1YJTA 5MLCV 1PYOB 2H5JB 1NHVA 1HR0F 2CNNB 1R0AA 1IQZA 1K0TA 5H9EJ 2APOA 2IVYA 2VZ9A 2MPUA 1U8WA 3DYAA 3P4UB 2HVHA 2JOQA 4ITSA 2AZ3A 4DR5F 2ZJPQ 2DNRA 3QPIA 3WX8A 4CLYA 3MTKA 1S4EA 3TAPA 1AW0A 3MM5A 4U9RA 2B6AA 3D2WA 1HI8A 1UVMA 2ZH5A 3W65A 2H65B 3ZNUA 1WOSA 2B4UA 1CJUA 3RUBL 2QC3A 3OHBA 4K50A 2VPYB 4N5SA 4OV6A 3GYXB 1YJRA 4B3SF 3V6JA 5KT4A 3ZTSA 4F4ZA 1YGYA 1NXIA 4MK8A 1K9MT 1WJ9A 1F60B 2XYHB 2WOMA 4KQZA 2FC8A 1B99A 2YPYA 1WSVA 4Y00A 5BXIA 3C6TA 3QWPA 1IJEB 3DOKB 2MKIA 4KR0B 5EX3A 1U6ZA 3IAM9 2E7WA 1WWHA 3CB4A 3N5FA 5J2PA 1Q86T 3JAMY 2XMAA 1A6LA 4UOGA 4BC9A 1KLMB 2XY6A 2BEFA 5AXMA 2CPEA 1VLOA 1CVJA 1URNA 4JI2J 4YFUA 4X4VA 3CCUS 3H98A 4C7QA 2W9CA 2W2MP 3IXQA 2HURA 4ZP6A 5HP1A 3NGKA 3FSIA 1F5BA 4U8YA 2DCUB 2AEJA 5AXLA 1GTEA 1X60A 2VL1A 2EG2A 2ACYA 4N8NA 3T5KA 1S57A 2PC6A 2YVSA 3UD4P 4OJ3A 3FJ2A 1R3NA 5HVFA 1UAWA 3H4BA 4WKRA 4IFVA 3JYTA 2ZD1A 4OX8A 1FK9A 3WHIA 4QIWD 2OSRA 1X4DA 4Q44A 1IUJA 3CW2C 2B4PA 1K44A 3HVTB 4F4KA 4P2SA 2HZAA 4ECVA 1Q8LA 2HGMA 3MMBA 2Z30B 2A3JA 1R8PA 3C46A 4YHHJ 5F8JA 4O3PA 2CQ4A 4QWBA 1R43A 4DV1J 3MEEA 2AX1A 3QWUA 3T1HJ 4LBHA 5HVHA 4N41A 2EFVA 4B9LA 2OKQA 2Q66A 3Q2TC 1Y00A 4ZPVR 4FN5A 2ZKUA 5KFPA 3A8KA 1LW0A 2C2DA 2R7TA 1FDAA 3NBPB 4F0MA 4URGA 1LFWA 1Q81T 2Z2MA 4ZLLA 1X4HA 3EX7B 2YWWA 2DRBA 2PDAA 4OYOA 1AXQA 5KFKA 2HFSA 3W5XA 2DY9A 2AYMA 3MPUB 4ILLA 2BV3A 2N3OA 2E5IA 1YWXA 4A47A 3H4DA 2FGCA 1FVQA 1REVB 1R6YA 2MHEA 2QGFB 4X4PA 1YX2A 3UDEA 3MPDA 2RKIB 3TEGA 3V6HA 1H7WA 4DG1A 2OPPA 1B0VA 5KG6A 4NLXA 3I0RA 4DN9A 3KDNA 2VASA 4DMZA 1XTZA 4K4ZA 3HLUA 1Q8BA 3LGMA 4DX7A 3CJ0A 4KO0B 1SJ1A 2RS8A 2MQ8A 4HHJA 1KR4A 2M88A 2DR9A 4E8UA 3CDWA 4Q8FA 4OYWA 3MEGB 2MQPA 4OHZA 4QYZJ 1YDLA 3DLJA 2LEBA 2M9KA 2RDDA 2ZOMA 2ZDOA 4ZCMA 2HS0A 3K0JA 2HBRB 5DDRC 3PACA 3QT6A 2DR8A 2VKZG 5EN1A 2CYYA 2XMVA 2QZ8A 5JVHQ 4DPOA 5CCMA 5DQGA 3AY0A 1S1UA 1X9MA 1N33F 3QYYA 1MU2A 4ZIVA 5I3UA 3HSZA 3RJMB 3MM5B 1RE1B 2MXYA 3LF0A 1UEVA 1S0NA 2XZWA 4NI2A 4S0MA 2K3IA 4F67A 2XI3A 1XJWB 5EDWA 3TARA 1XMBA 3W61A 4UQTA 4LF7J 1CJUB 3TQEA 3Q8RB 5EWEA 2GAHC 3R8YA 2ATLA 2VBYA 1T9XA 2HVDA 4FBTA 1AFIA 4C48A 2CJKA 2AJFE 2WOMB 2CAJA 1U1LA 5IM0B 1JXVA 1YBTA 1NNDA 4RUCA 3FCHA 2HHHF 1NLKL 4BC7A 4RUAA 4Q7AA 1JLCA 4F02A 3KLEB 1M1HA 1FRKA 2KO1A 2KDOA 2PSZA 3AXKA 1FWLA 1VCTA 3MPYA 2ZH2A 1HD0A 2KRBA 3F73A 5LJ5Y 2A2CA 4Q43A 4TU8A 2W9CB 5HP1B 4JI8F 5F3ZA 3ZZTA 2CQ2A 3LALA 4WFBQ 2QL5B 4N77A 4OYAA 2BRKA 3T1YJ 5AJ3J 3P45B 4HDGA 4TVAB 3E8OA 2BOPA 4GC6A 4ZPTR 1RWWB 4USKA 3SXLA 5HMXA 1HQUA 1RTHA 4XDDA 3CT9A 3JYTB 5KFXA 3TA0A 3CJSA 1FK9B 1YJ7A 4JBCA 4FS1A 2VJVA 3IGVA 3ZO7A 2FVRA 3QJLA 2HIQA 2RUSA 4OYPA 4WFYA 3MMBB 3GSDA 2KT3A 4JI7F 2CQIA 4RNFA 4DQIA 4HH0A 3SSQA 3AODA 2PGCA 3MEEB 1RACB 2HNDA 2ZJQQ 4OYZA 4PEOA 4ES1A 2H1YA 5CCLA 4LBPA 3VAHA 4FYDA 1RZMA 2HHTA 2XEXA 1SJ3P 1SCJB 1NZ8A 2AJ4A 2GV1A 4CTAB 2RDJA 1JXEA 1T11A 2HFZA 3FMBA 4RNMA 1HL6A 5LSRA 3W8PA 1JQGA 4OHVA 2MQNA 1F2GA 4K59A 2MMYA 3AD7C 1ZPVA 4DQPA 5IS2A 3U27A 1RWVB 4X84A 4ATNA 3V6DA 2KYXA 2V2QA 1WDDA 3HKWA 1Q16B 4ZKAA 3DMJA 4DG1B 2OPPB 3HSDA 3I0RB 1WI6A 4J9QA 3LP0A 2LU2A 4QIFA 3R5JB 3MCNA 4UUXA 1N4LA 4I2PA 2L41A 2LQ8A 3VCDA 2F65A 1HD1A 3W9HA 1FO1A 4B3MF 3GB0A 4CZCA 4J9MA 4Y2KA 4WBFA 1LWXA 3IAS9 4LR9A 1RAGB 3R2DJ 4IH6A 5F8MA 2EC0A 2OHDA 3BQ0A 4TNOA 3LPEA 5A2QY 5LL6d 1NKEA 2KFZA 3WC2A 3GJSB 1G6BA 3W7BA 2VBXA 4O4RA 3OSNA 3FC9A 3CJQA 4LRFA 1JKHA 3PO4A 1ELOA 1FTRA 3KFWX 1DJ0A 2G2ZA 3KK1B 3AJDA 4B3RF 4MT1A 1H2VZ 4NI2B 2HHUA 2Z58B 3SQOP 3LO3A 3NNAA 1U0HA 1KQFB 3HP6A 1BC6A 3CTRA 5EWFA 5J2MA 1NSQA 4LF4F 3VQTA 1S0MA 2PE8A 2ZNYA 1S6PB 1RKJA 5BR8J 4DJBA 5RUBA 3UQSA 2LLZA 4I67A 4Q0BB 1YRUA 3DCAA 4DV7F 2LDIA 2HNZB 5DG8A 2QYGA 1IBKF 1IR1A 3T9ZA 5D15A 4WFNQ 1FKOB 1HHTP 1RWOB 1UEKA 5LXRA 2W25A 5LSOA 1I94F 4USHA 2HBQB 3GIIA 1U1QA 4DV3J 5C24B 2R8JA 4ZCKA 3IRWP 4DR7J 4ZVHA 2BX6A 4CQ1A 2L3MA 1Y9OA 1ZPWX 1L3UA 4OYMA 4OIXA 1ZM2A 1ZM9A 1QJHA 5LMUJ 1HWIA 2UP1A 2YKAA 4FF4A 4ECXA 4N8OA 4WTOB 1QAJA 4IOAQ 1RTHB 4NCBA 4X4UA 1KBRA 2J7UA 3IRXA 3MCOA 4KYZA 3W63A 2PA3A 1RTDA 1RT1B 2I0XA 5GAHI 2BJ1A 2WRMA 1WF2A 1UP1A 1FERA 4B3OA 4P52A 2G1HA 4QIEA 2BE9B 1KNZA 4MKVA 4F04B 1FXDA 2DNPA 3ETMA 2YKMA 4OX9F 2E9RX 3IR7B 4L76A 1SL2A 3J7A1 4CDIA 4DR5J 5LSLA 3M6WA 4P75A 1TL1A 3TZYA 3KLIA 3ZZOA 2GJIA 5CA5A 4DWIA 3OHAA 4PQUA 1N34F 3M6XA 4Q2MA 2V69A 2Z8QA 2XCAA 2BKOA 1GFWB 1HWKA 1BQXA 3V6DB 4B3SJ 4C3KA 2BVZA 2G2OA 3GV7B 2R2RA 3DLEB 5KFCA 1JX4A 5DO2A 2HK2A 3JXOA 2VG5A 1C1CB 2VONA 4N7TA 3LP0B 4KKOA 5B0EA 6FDRA 2XO7A 5EUHA 1Q5VA 3FRZA 1Q8KA 4I56A 4NA2A 1QVGR 2CWKA 4DV5F 1HFEL 3IG1A 4JI1F 3IWNC 1RXOB 2W7OA 2BJ3A 5DGAA 4USIA 5KFOA 3PW5A 1D1UA 1VGYA 3KG1A 3T41A 2BE2B 4DSJA 5C2GA 3QO9B 3MR5A 2XYPB 3FQKA 2EVZA 4BWJA 3G87A 1PJ6A 2DK2A 3JSMA 1S6OA 1N88A 4LMZA 3UI3A 3T6JA 1GX5A 5B0CA 2HS3A 1JKHB 1M0SA 3ET6B 4OZ1A 4EU0A 2DIVA 2AGPA 1HW9A 2AGOA 4E0DA 2VU5A 4DZDA 2Y9HA 2HNYB 5J2MB 2V9KA 2ACMA 1JLAB 3R6GB 2CQPA 2D3UA 3CCJS 2GMHA 3I56S 2GJ2A 3I5BA 5FD1A 4TN2A 1M5HA 4E2FB 1NK0A 2AIRB 2B51A 5HJYA 3U1NA 4P71A 2AT1B 3RW7A 2LXUA 2XCPA 1U26A 2VDHA 4LRDA 3MM6A 4JV1A 5AXNA 3PIOQ 3FEXB 1Z2ZA 2CKWA 4JI0F 2RF2B 3I6PA 3HVAA 3B4DA 2CUYA 3SV4A 3SYZA 2GIRA 4GKKF 2HWHA 3JQMA 1FRMA 4ZVPB 3RZAA 2KKHA 3UR3C 1FNXH 3H2VE 3PNIA 1HQ2A 3SI8A 4IH5A 4C8OA 4NL5A 5E3PA 1NUEA 1HBMB 1UW4A 3Q8UA 3G2XA 1F5AA 5B09A 4X66F 2IY5B 2IDEA 3I5CA 4QCLA 1XR5A 5D8HB 4E98A 3IA0A 5CQGA 4LUBA 1AZSB 3J81j 1QUVA 1UVKA 2P5VA 5G0RB 1UWBB 3D5MA 2EFPA 4OZJA 1RTDB 4U7CA 3QIPB 4J7CA 2ZBQA 2P9CA 4EBEA 1TZ0A 2VB6A 3R3TA 4B3OB 5I42A 5KT6A 1T9WA 4ED7A 4PYDA 1VRQC 4HI1A 3PJXA 1JMTA 4IYQA 4YS2A 3NS6A 3E3XA 4Q2LA 2IMOA 2Y8WA 3ENQA 5IC4B 3AOCA 1IN0A 4XO0A 4OV1A 4YB7A 2V4QA 4ZMMA 4NZ7A 2XO6A 4IFYA 1VBKA 1N5YA 1M90T 4C8MA 4RR5A 1N33J 1TL1B 1RA6A 3DDKA 4M1KA 1FX4A 1E6YB 5KFYA 1VBXA 2VG6A 3ZTRA 1KVKA 3VAKA 1LW2B 3RBEA 4L3KA 2OPQB 3JSRA 1VK3A 2EBGA 1VQ7S 1WC1A 1FJEB 4ZP8A 2E1PA 2HQFA 4EWTA 2J76E 3V4IB 3N28A 2UUWA 1GMWD 2EK6A 4G3IA 3LP2A 2C3YA 2JLGA 2HHHJ 2W4DA 2QTWA 2O01C 1KOHA 4KKOB 4PG6A 3LW5C 4KGMA 2OMLA 3KLGA 4ICLB 4USVA 4OI4A 2GO9A 3GSIA 3N9UC 4DEZA 2HAFA 3CDUA 1NJXA 3IBWA 2AW0A 2I9SA 4X4SA 4FYYB 1UFKA 5IT9U 1HNXF 3D1QA 1QSSA 2CJ9A 3ZFVA 4ENOA 3VGSA 1N52B 4W98A 2GA7A 2FLLA 2H54B 4JI8J 4MK9A 1NHKL 4EO6A 5J2QB 2KJWA 1RLDA 4CT9A 4CO0A 1SUQA 3DI6A 4WKYA 4HH1A 3B6BA 3H2UB 2G4BA 4OZ3A 3MTJA 3M32A 5L1IA 7AT1B 2C2NA 1PAUB 2QL9B 5K5MA 2W4PA 4R0EA 1DLOB 2H3EB 2MZSA 1ZH5A 2Y1RI 3VAGA 1EP4B 3IN5A 4DUZJ 4LF5J 5EGYA 1HLWA 4JI7J 2Z2ZA 3CUNA 3GJTB 4EGLA 1FRLA 5I3PA 4PUOB 5E33A 4J37A 2YNIA 3CCLS 1X5OA 5LM7E 4HHHA 1RT6A 3HPOA 3CCSS 2A0FB 4FNHA 1KKHA 3MM6B 1T9VA 1UZDA 2E1MC 4EBDA 1RBOB 3FNNA 4CLZA 2RRBA 1IKYA 3J7Z5 3D6TB 3CIMA 4G1QA 3P6YC 2LECA 2VUGA 4OX7A 2V2VA 4I1TA 5D3GB 2EKNA 1MWZA 2Y0SD 1P1TA 4HR2A 4Y28C 2KM8C 4RW8B 1XK8A 2F7VA 2FD2A 3CXCR 5CYQA 3HKZD 1S6UA 3I32A 2LA6A 1EAYC 2DEJA 1JIHA 2YBVA 5GMKa 3WC0A 2F4FA 4G65A 3L7OA 3G9CA 2BQUA 4TQSA 1MROA 3IS9B 2X7IA 1OWXA 5HMWA 2J7WA 2VDIA 2M70A 5KFQA 2VFSA 3KLFB 3WZ0A 3D9BA 1RUSA 3LANA 4DSIA 5I42B 3S6EA 4DPWA 3VZHA 4B3MJ 3TX0A 1U1RA 1TQLA 3K17A 2UVRA 2LXFA 4ELTA 1VJWA 2MGZA 2L48A 4NCAA 4CO1A 5HLFA 2YY3A 1W25A 4DCPB 3NWRA 2ZEJA 1FE0A 1U48A 2B56A 3FQLA 4MYUA 4IFYB 5HBMB 1T05A 1VJQA 3G86A 2GO8A 5T41A 3ICLA 4CLWA 3K5MA 2RHSB 1HNZF 1RT7A 2QA4G 1S9FA 3BBCA 4DLEA 3NMRA 4RJVA 4IDKB 1TP7A 2VG6B 4A8FA 3SDEA 1U45A 3C8YA 1HIYA 3VAJA 3AQPA 3HHLA 5IQ6A 5AE1A 4OLPA 3DNCA 1P27B 1FA0A 3BS9A 3Q24A 5GMEA 1A7GE 3UDLA 2MLXA 1X4CA 3DLBA 2YTCA 1S99A 3IR6B 1BWVA 4DV7J 1VS3A 4C8ZA 1IBKJ 4LF8F 3KLGB 4X65F 2QMXA 5HI7A 2KVQE 4NLSA 2HRUA 4ZOSA 3HT0A 4NLPA 3Q8YA 1N6QA 2LXIA 4ZN1A 1Q1KA 2J6TA 1JLQA 2D9OA 1OPIA 3R5GA 1YITS 1I94J 4NYZA 2XMWA 3L09A 2HWIA 2VPXB 3C6UB 3EXYA 5IFMA 4X4NA 2OI2A 2GCFA 2VIHA 4KFBA 2CQBA 3A13A 3MECB 4KSEB 2X1GA 2N3LA 3DI6B 2WSFC 3MD1A 4IKAA 4IO1A 2QA2A 5KT3A 3R1LA 4KH0B 5IWAF 2ROGA 3OFEA 3M32B 1H0HB 5DDOC 2PO4A 1NBEB 4ZHRA 1FRXA 3THVA 3QLHA 4M5NA 4A8MP 4RW4A 1EETA 5L1JA 1RB0A 3EZ5A 2HFUA 3KHLA 2ERRA 4IRKA 2KM8B 4U95A 4IOBA 1GXTA 4JI6F 1FXRA 1N32F 2WVCA 1WEXA 1SBRA 3OL6A 2YNIB 1OY8A 3CCMS 1JXLA 1RT6B 3I82A 1RK8A 3CWJA 3G8QA 2J9CA 2CJBA 1XQIA 4OX9J 3DXSX 1RTJA 1SL1A 2HBZB 1R89A 3CDBA 1K8AT 1HPZA 3R5DA 5F0WA 3BGRA 4DV6J 1IKYB 1UW9A 3W3SA 3M2UA 1HMVA 2YWFA 4Y2MA 1D9DA 4G1QB 1VRUB 1A9NB 3R5CA 4ANEA 1VBZA 2ABYA 2O3DA 1N34J 1JJ4A 4URSA 2IFXA 1ZA1B 2RHQB 2D69A 3UNGC 3R27A 5CYQB 2PN6A 2HW3A 1TAUA 4AL5A 1SKUB 1GMWA 1WEYA 3FUYA 4V19J 4X4TA 3FKBA 1XC9A 4M63A 5ETVA 2WBMA 4WJBA 2DPIA 4HL9A 2YPZA 4K5SA 1SXLA 3CMES 3W2WA 1WTBA 1LFPA 2GHPA 3BSAA 3UVJA 3TOQA 1RI7A 2F8HA 2QV6A 4DV5J 2ZZTA 2KTQA 2CJAA 4JI1J 3GP9A 2COLA 4NLYA 2OELA 2L08A 2HQIA 3H8YA 4DS4A 5FIIA 3SIPB 3M2RA 4O3RA 2WW8A 2KYZA 2C2ZB 1MSWD 4PABA 4PG4A 2KG0A 4FYVB 2R7SA 1LOUA 5J1EB 1VQ6S 2CIMA 4I69A 3OR1A 2HGNA 1PYTA 4DX5A 4NLRA 1K0VA 2DXFA 2M8DB 3LP1A 4ED6A 1PKUA 1HNVA 2NUHA 2OH2A 5D0RA 4W92B 4EO8A 1LWCA 1F9EB 3KTQA 3K89A 3SDEB 2C42A 3GYGA 1U8SA 3L9ZA 5DRKA 4Y2IA 5CYMA 4YDXA 2FVSA 4FXWA 3MM8A 1EHWA 1WG4A 2CDRB 4LRAA 2VFTA 1ULRA 1IKVA 4M5HA 3UN5A 3EVWA 2R7OA 1IKWB 2B43A 1NDKA 3VAMA 4NCGA 1IM6A 2BQRA 1QAIA 3G96A 3JB9k 3MPWA 3KWMA 4U8VA 1JWWA 2EFOA 1CJVB 5KFFA 5KFGA 1N6QB 1HQEA 1TTHB 2DJWA 1HW8A 4NLOA 2BJ8A 4NEZA 4RW7A 2RMLA 2KRRA 1YLXA 3TJ9A 2N4CA 2F4VF 1NJZA 4L75A 2VHGA 1C0UB 2ZZMA 5B0BA 4A4JA 4LFCJ 1WELA 1CC8A 4F0HA 4X66J 1DBDA 1Q53A 4XPEA 4Q45A 2WZ1A 3PYFA 1OQ3A 3E01B 5LMNF 2XM3A 4ZHRB 3QLHB 1TUVA 2P2CB 1EETB 4USWA 1X9SA 4RBVA 2KL8A 3HCXA 3OQ2A 3K5NA 4CNZA 3M9MB 3KUGA 3Q22A 2HRYA 3UCUP 4IQXA 4KT0C 3P3DA 4QYZK 5DGBA 4RKUC 2MQOA 2HWTA 2EBEA 1OY6A 1RAAB 5J2NB 2FZCB 2GZOA 1KSPA 1X4BA 2QLFB 3SMZA 3QGHA 3C66A 2HFNA 4CLFA 2DT9A 4L74A 4O0IA 1WTFA 2NSCA 1WKJA 5CZVA 1HMVB 1M5KC 4KRWA 2P9EA 2Q43A 5LT5A 3GFYA 3CDEA 1CLFA 2R7WA 2CJYB 4DUYF 5DLGA 5HO4A 2YNGA 1UJ5A 1BQNB 2ZBIA 2CQ0A 4IR1A 4C6AA 3GV5B 3MDFA 1HNIA 1T95A 4LR7A 2ZH3A 1W7WA 4YMEA 4YR0A 2JZ5A 1CC7A 2XMUA 1W26A 5ETKA 1PIEA 3W9JA 4AFFA 1IR0A 2FJVA 5H9FJ 1S5ZA 2P8IA 4NLTA 3G8SA 1RAJA 1FKAF 2MKSA 3O2IA 4I0WA 1VI7A 1MW7A 1DY3A 2IJNA 2E9TA 2HFOA 5JXSA 5E5NA 3T6BA 3I87A 4OZ0A 1IXKA 1KVIA 3GE9A 1TK8A 1HBOA 4WP8A 4A8OA 4BDPA 4ES3A 4V19X 2D1CA 5K8PA 2QIFA 2MQMA 3Q8PB 2RB7A 2FDNA 4JI3J 1TVRB 4P2XA 4B3TF 4OJGA 3OUYA 4A8XA 4ES2A 4ED5A 2DRAA 1TL7A 3CE8A 3BH6B 4P74A 2YNHA 1L5UA 2MZRA 3J7ZT 3DOLA 3OR1B 3ZZYA 2VC0A 2RNEA 2BYCA 3LP1B 2FPHX 4U6PA 1LWCB 3I0SA 4JUZA 4EYIB 1PC4A 1FJ7A 4OI3A 5CYMB 4F3MA 4EK2A 2LMIA 2GVZA 3ITHA 4EZ6A 3JS9A 3BPSP 3MM8B 4RLEA 1S0OA 1IKVB 4ZVUB 4I68A 4ZJOA 2ZITA 4A48A 4P2FA 1FE4A 2YKNA 2JC1A 4PPZA 2C2OB 2BANA 3FDSA 2ZOFA 1GAOA 3OL7A 2MKCA 1KC8T 3DLKB 4XTTA 4QYRA 4LF2A 4NLDA 2Z56B 1BXNA 2V6AA 3M8QA 2V5HG 3MI7X 3KHRA 3D3BJ 4ZN3A 1QLNA 1N5QA 4QW8A 1TKXA 3HX9A 2OEKA 3PZPA 1KRPA 2PI5A 2HHWA 3M8SA 2K1RB 1WEZA 5IQQA 1UFWA 2B7BB 2AV5A 2HMIA 2DCLA 4K4VA 2E5HA 3AAWB 1SC4B 3QFWA 2UVUA 2H51B 4QU7A 1EQ0A 3RR8A 3N01A 4IG3A 2W7AA 3KHGA 3CCRS 3SCIE 2HVIA 5FDLA 2BA9A 2AHOB 1NB2A 1LQ9A 3RBDA 2LCWA
chains in the Genus database with same CATH topology
4DR7J 5A2QU 2KL8A 4V1Ak 4DV5J 2E5LJ 4LF7J 3J7AN 5LMNJ 2VQFJ 4JI8J 2UXDJ 4JI1J 1J5EJ 4GKJJ 4JYAJ 4B3RJ 1N33J 4GKKJ 4OX9J 4YY3J 4LF9J 4PWWA 4KY3A 4DR1J 1IBMJ 4JI6J 2VQEJ 4JV5J 5LMUJ 3IMQJ 1XNQJ 1I94J 4YHHJ 4LF8J 1N32J 4X65J 4X62J 4X64J 1XNRJ 1XMOJ 4DV0J 4DV6J 4NEZA 4LFBJ 4K0KJ 4B3SJ 2MQ8A 3R2CJ 4DV1J 4DR4J 4LF4J 4LF6J 4DR2J 2MTLA 3T1HJ 1HR0J 4NXNJ 4RJVA 2UXCJ 5BR8J 4KYZA 1N34J 5FLXU 1IBLJ 4JI3J 2UUCJ 3J81U 3OTOJ 3D3BJ 3J80U 1HNWJ 4JI2J 3W1YC 5IWAJ 4LFCJ 3JAMU 4NEYA 2UUAJ 4JI4J 2UXBJ 4DR6J 4DV4J 4X66J 1HNZJ 2HHHJ 3D3CJ 4DUZJ 4LF5J 2F4VJ 4HHUA 4JI7J 3R2DJ 4LFAJ 2MEWA 2UU9J 4DR3J 4DV2J 4B3TJ 4KHPJ 4DV7J 1FJGJ 1N36J 5LM7E 1XMQJ 4AQYJ 4B3MJ 4JI5J 1IBKJ 4DR5J 4DUYJ 2ZM6J 4DV3J 5IT9U 2KVQE 4JI0J 3T1YJ 4NXMJ 1HNXJ 5AJ3J 2UUBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 J;  5A2Q U;  2KL8 A;  4V1A k;  4DV5 J;  2E5L J;  4LF7 J;  3J7A N;  5LMN J;  2VQF J;  4JI8 J;  2UXD J;  4JI1 J;  1J5E J;  4GKJ J;  4JYA J;  4B3R J;  1N33 J;  4GKK J;  4OX9 J;  4YY3 J;  4LF9 J;  4PWW A;  4KY3 A;  4DR1 J;  1IBM J;  4JI6 J;  2VQE J;  4JV5 J;  5LMU J;  3IMQ J;  1XNQ J;  1I94 J;  4YHH J;  4LF8 J;  1N32 J;  4X65 J;  4X62 J;  4X64 J;  1XNR J;  1XMO J;  4DV0 J;  4DV6 J;  4NEZ A;  4LFB J;  4K0K J;  4B3S J;  2MQ8 A;  3R2C J;  4DV1 J;  4DR4 J;  4LF4 J;  4LF6 J;  4DR2 J;  2MTL A;  3T1H J;  1HR0 J;  4NXN J;  4RJV A;  2UXC J;  5BR8 J;  4KYZ A;  1N34 J;  5FLX U;  1IBL J;  4JI3 J;  2UUC J;  3J81 U;  3OTO J;  3D3B J;  3J80 U;  1HNW J;  4JI2 J;  3W1Y C;  5IWA J;  4LFC J;  3JAM U;  4NEY A;  2UUA J;  4JI4 J;  2UXB J;  4DR6 J;  4DV4 J;  4X66 J;  1HNZ J;  2HHH J;  3D3C J;  4DUZ J;  4LF5 J;  2F4V J;  4HHU A;  4JI7 J;  3R2D J;  4LFA J;  2MEW A;  2UU9 J;  4DR3 J;  4DV2 J;  4B3T J;  4KHP J;  4DV7 J;  1FJG J;  1N36 J;  5LM7 E;  1XMQ J;  4AQY J;  4B3M J;  4JI5 J;  1IBK J;  4DR5 J;  4DUY J;  2ZM6 J;  4DV3 J;  5IT9 U;  2KVQ E;  4JI0 J;  3T1Y J;  4NXM J;  1HNX J;  5AJ3 J;  2UUB J; 
#chains in the Genus database with same CATH topology
 4URQ U;  2ASY A;  4FF2 A;  1ZZN A;  2FJW A;  3VZI A;  4DPX A;  2HVZ A;  3VVU A;  2KI2 A;  3AA9 A;  1WDT A;  1XNR F;  1S6Q A;  1U6B A;  4R0J A;  1N8R T;  2OTL S;  3RBX A;  2BMB A;  4NLG A;  2HVE A;  3PRB A;  2E7V A;  4KHR A;  1EJ7 L;  3D6M B;  1KHW A;  4DX8 H;  1UWA A;  3BR8 A;  1S76 D;  2L9W A;  1FJG F;  3JTP A;  2O5D A;  2EEY A;  2LEP A;  2ZH1 A;  2EW9 A;  1S1V B;  3CO9 A;  1FWK A;  1GX6 A;  4LSN B;  3HVR A;  1JK9 B;  1HBN A;  1HNZ J;  2HRT A;  1RQ0 A;  5B0F A;  4Z7Y A;  2V8V A;  1IM4 A;  4HAC B;  2QMW A;  1VBY A;  1J5E F;  1Y5N B;  1JLB B;  1IKX B;  2DGW A;  2W9B A;  2XTJ P;  2V4J A;  4DQQ A;  4C2M A;  1O0P A;  3ENW A;  3K57 A;  1VRT B;  1Y7P A;  4DFJ A;  1F3V A;  2JVR A;  3UFC X;  4DUT A;  1R8A A;  4C4W A;  2LEA A;  1D0E A;  5GAG U;  2N7Y A;  2E44 A;  4LF8 J;  4X65 J;  2MKY A;  4A8W A;  5KG7 A;  3BGU A;  5DM7 Q;  1VQS A;  4IRC A;  4H4O A;  4EI2 A;  5BYS A;  2ZBP A;  3HD1 A;  1TKD A;  4FXV A;  3H5S A;  1CJT A;  4QW9 A;  5F9N A;  3PKY A;  2LFV A;  2FY1 A;  5F8N A;  3K58 A;  4HDH A;  5E3C A;  2XS2 A;  1SKR A;  3RB4 A;  4P10 A;  1KFS A;  2E5G A;  2OSQ A;  3D6F B;  3T19 A;  2Z2L A;  2E29 A;  1TL7 B;  2OJ3 A;  7FDR A;  5IT0 A;  2F8E X;  3DOL B;  1NDL A;  3HI9 A;  4Z2X A;  4C97 A;  1EAR A;  1XMQ F;  1M5S A;  2VQE F;  5DJB A;  4LVN P;  3I0S B;  1X5P A;  1JLG B;  5LOQ A;  3V5R A;  4LIR A;  1JLE A;  1VC6 A;  2BR0 A;  4CH1 A;  1HKA A;  2MQQ A;  4CLK A;  2KVI A;  4ANC A;  4DL5 A;  3ITH B;  2RH3 A;  3PRD A;  4I7F B;  1IR2 A;  4K4Y A;  2IA0 A;  1RDR A;  4J9S A;  3PYE A;  4JI6 J;  1IJF B;  2XNR A;  4RO0 A;  1N32 J;  5C42 A;  2ALZ A;  4CRJ A;  2DIU A;  4JI4 F;  3GIL A;  2B8P A;  2VIC A;  4ZLN A;  2BAN B;  2HHP A;  3KLV A;  3TAM A;  5HVG A;  4WE1 A;  2CQD A;  1QAX A;  4H4K A;  2OUG A;  3W1Y C;  2V94 A;  3M8Q B;  2BKN A;  4ECR A;  2DHS A;  2C2E A;  2IAJ A;  5HL7 Q;  1H98 A;  1VDH A;  1OYE A;  1TKX B;  2WVE A;  1Q7L B;  4P2M A;  2FLN A;  1S59 A;  5E0O A;  1NPP A;  5E41 A;  4JV2 A;  4A8Q A;  2AJ2 A;  1G2E A;  3MUV P;  1Q82 T;  3HO1 A;  3HZG A;  3LA0 A;  3IC1 A;  1R31 A;  1B0P A;  2MJN A;  3K5P A;  3CJ3 A;  3BQ2 A;  4IG3 B;  4B02 A;  3R5A A;  1WNE A;  1FFW B;  4QJV A;  3DM2 A;  5KT5 A;  3ENA A;  3S8S A;  3J7A N;  1TEL A;  4O3O A;  1Y5I B;  3MM7 B;  3D0H E;  3BEG B;  1J5O B;  1KQK A;  4H4K C;  3FVY A;  1SC1 B;  3RU0 A;  3HF5 A;  3BGL A;  4C0H A;  3NNC A;  1EZZ B;  4ZVT B;  1VQO S;  2WVD A;  2Q6C A;  1S6Q B;  4HT7 A;  4LF6 J;  4NRT A;  2DGO A;  2DH8 A;  3M8W A;  4NYO A;  3FCV A;  2MLY A;  3GON A;  3GV8 B;  2IVF B;  2K2P A;  1TFY A;  3QAE A;  2OMO A;  2AMC B;  3LWL A;  2KXH A;  2MKJ A;  3NCP A;  2FGO A;  1CQN A;  2CVI A;  4LR8 A;  2C1E B;  1K73 T;  4P7V A;  1HBN B;  4DBQ A;  4DR1 F;  1SV5 A;  3AJ2 A;  4JI5 J;  2K3K A;  4A8Y A;  2PT0 A;  5ETN A;  3CMQ A;  2RSQ A;  3CJ2 A;  4Y2A A;  4V1A k;  2I6W A;  4L3N A;  1TU0 B;  1U1O A;  3NAI A;  2VA3 A;  1RAF B;  4PWW A;  2AEF A;  5J1N A;  5BYR A;  2QN6 B;  4O44 A;  3QNW B;  5D0E A;  3ULH A;  2BDP A;  1DTT A;  4DI6 A;  1DQ9 A;  3EZU A;  1X7V A;  2DNQ A;  2FJE B;  4FVC A;  2B4V A;  4H4O B;  3J81 U;  3J80 U;  3ZZR A;  3HHN B;  1PIL A;  1CJT B;  1V3S A;  2FLO A;  3A12 A;  3H7H B;  3KK2 A;  4EFA C;  2ILY A;  2F4V J;  4HHU A;  3CC7 S;  4WK3 A;  3FFI B;  4CLU A;  5DLF A;  1HWL A;  4Z7C A;  3BF4 A;  2KB2 A;  3GG1 A;  6AT1 B;  1VC5 A;  2O67 A;  4YEA A;  5KFJ A;  2KXF A;  4CH7 A;  3BDE A;  4RZR A;  2VF3 A;  5LMN J;  1LWE A;  4TU7 A;  2JL9 A;  1JLE B;  2DGS A;  2V34 A;  2QRR A;  1LKZ A;  5DZ6 A;  4ZLJ A;  3BSO A;  3FSX A;  4CYU A;  4DCO B;  4M5D A;  1WHX A;  4F26 A;  4DV4 F;  5THW A;  1H3D A;  1T3O A;  1LXN A;  4LFA F;  3RRK A;  2EK1 A;  5HK4 A;  4DZ6 A;  1Y5L B;  1P6T A;  3D0I E;  3NL0 A;  3MHY A;  2CQH A;  2YNF A;  3HFZ B;  2JEG A;  1RU1 A;  3TAM B;  2O1P A;  4WE1 B;  5KG2 A;  3U1M A;  2FQQ B;  2D7S A;  2MZQ A;  3VQS A;  4CWB A;  3CC2 S;  2DO0 A;  2JSX A;  1VYA A;  2D9P A;  2RD5 C;  2QSW A;  4WPA A;  3N6L A;  5A8W A;  1BWE A;  3CUL A;  4DUY J;  2NQP A;  1HHQ A;  3NCQ A;  4RW6 A;  3MMC B;  5L1K A;  4F8R A;  5A6W A;  2XB2 D;  4WF9 Q;  1NAQ A;  3J7Y U;  1LEO A;  1QD1 A;  1WHW A;  4DSF A;  1A0O B;  3LH2 S;  1UCN A;  2WAQ D;  4DOZ A;  3H40 A;  3IBC B;  3PG9 A;  4NAS A;  3DRS A;  3HHE A;  1VIS A;  3OR2 A;  3M05 A;  1ZTT A;  3Q8S B;  2AQ4 A;  1BMQ B;  3C16 A;  2CPF A;  5L46 A;  3CNQ P;  3SEO A;  2GC8 A;  2HGL A;  4G6V B;  3KK3 A;  4CH0 S;  1RA7 A;  2FHM A;  3B54 A;  3KLH A;  3EIC A;  2M0G B;  5CYJ A;  5KFA A;  3PR5 B;  4TY8 B;  2OTJ S;  2VPZ B;  2W2N P;  3M1V B;  3B82 A;  3A8J A;  2DB1 A;  4NEY A;  4PWD A;  2CPD A;  1NHU A;  2I2Y A;  1VQM S;  3BPD A;  4DPU A;  4B9T A;  1NZA A;  2ZUA A;  4MIB A;  3WIU A;  5SUH A;  4B3T J;  3FZ2 A;  5KG3 A;  3A8I A;  3PHT A;  7FD1 A;  3H5U A;  3V81 A;  3MUT P;  1UVJ A;  1N5S A;  2WB1 D;  4ZVQ B;  2J0X A;  4DV0 F;  2EWH A;  4F3Q A;  4AXI A;  3S7R A;  4QR1 A;  2OP5 A;  2F3J A;  3EGV A;  4OL8 A;  1SKW A;  5KG5 A;  4H54 A;  4RX6 A;  3D7S B;  2JLF A;  2BJ9 A;  4TYB A;  4LQ3 A;  3IFE A;  3NOG A;  1R0A B;  2J5A A;  3DLG A;  2XLK A;  1DTQ A;  2IC3 A;  3TJA A;  4B9S A;  4YR3 A;  2FC9 A;  1Q78 A;  2ZHO A;  4ZPC A;  2CXE A;  2PEH A;  1VQN S;  3DYA B;  5L8R C;  1DTT B;  3OTE A;  1NKB A;  4BS2 A;  4MYT A;  2FZG B;  3KHH A;  2KJV A;  4JI2 F;  4CLP A;  3FGV A;  1HNW J;  2NXJ A;  2XQC A;  2Y1L B;  2HPU A;  2XMT A;  2B6A B;  4UY8 T;  1TV6 A;  5B08 A;  3G6V A;  1TKT A;  3CJ8 A;  2B4O A;  1UEU A;  5D4P A;  1F3F A;  1ZS6 A;  1VQL S;  2KT2 A;  3Q2S C;  2N4D A;  4RNH A;  1UVI A;  3QJJ A;  1VIX A;  2HG4 A;  2ADC A;  5K8O A;  8AT1 B;  3TP2 A;  1M1K T;  1S1T A;  4MAK A;  4DR4 F;  4WIQ A;  4JP8 A;  4L6V 3;  3C6T B;  3LWM A;  1MG7 A;  4FKY A;  4ZPA A;  4ZVF A;  2J6U A;  3W60 A;  2GW8 A;  4FS2 A;  6FD1 A;  1XBW A;  2YWK A;  3QBC A;  3OVB A;  1LWE B;  5HRO A;  4PYA A;  5F9L A;  3CSK A;  1G3O A;  2UUA F;  5J2P B;  4LIW A;  4DV1 F;  4DR6 F;  1ITP A;  3BSC A;  2ZH6 A;  4M5I A;  1RGV A;  1KN6 A;  2BAC A;  5EWG A;  5GAE I;  3EYZ A;  3CCE S;  2B5J A;  4M5D B;  3K8V A;  2DD8 S;  2NXU A;  3I96 A;  1KD1 T;  2QLX A;  1C0T A;  2DY1 A;  1V9O A;  4KHP F;  4I6Y A;  3NAH A;  1OQ6 A;  3PYD A;  5A8R A;  4G1I A;  5L9X A;  1B3T A;  1RT4 A;  5DQH A;  2YNF B;  1P9Y A;  4WCE Q;  4IOC Q;  2X1F A;  1S9G A;  1UVN A;  5IT4 A;  1RYS A;  4FDF A;  3UCG A;  3T3F A;  1Q95 G;  1S1X A;  3VAL A;  4LF9 F;  1FJG J;  3HJF A;  4IFV B;  3L4B C;  3PW0 A;  2PA8 D;  3TUZ C;  2ZD1 B;  2F1F A;  3HVW A;  3PXG a;  4USJ C;  4DPT A;  2W2O P;  2ZBR A;  3RGI A;  1KQS R;  3N6N A;  4IQM A;  1U2R A;  2A6O A;  3BGF A;  2SXL A;  1J5E J;  5M2R A;  4KB7 A;  2J0W A;  4RW6 B;  3DXB A;  2BM0 A;  3OTO F;  1TK5 A;  3VV2 B;  1FD2 A;  4ZPD A;  2KXN B;  5K14 A;  1YBA A;  3CJT A;  2JEI A;  2XWX A;  4LSZ B;  4KC5 A;  2YX4 A;  1GMV A;  4A8K A;  3MR7 A;  2QLJ B;  1KVJ A;  2M8H A;  1LW0 B;  2FJD B;  2K06 A;  2BJ7 A;  1QM9 A;  1NO8 A;  3ILL A;  4I64 A;  3UWT A;  1YZ7 A;  2VH7 A;  3UPF A;  1ZET A;  4KGK A;  3KK3 B;  3PKM A;  1HI0 P;  4PPD A;  5B0G A;  4UOH A;  5ETO A;  2WVB A;  1SL0 A;  3NP5 A;  3THT A;  3IR5 B;  3OBI A;  3QAT A;  4QPX A;  2C3O A;  1H74 A;  4TLR A;  3VGU A;  3ZC4 A;  4B9V A;  2OPR A;  3I5A A;  2AYE A;  2FVC A;  4F36 A;  2DNK A;  4JB8 B;  1OMS A;  1X5S A;  3V81 B;  3O5T B;  3H59 A;  1FTC A;  4O3N A;  1NJW A;  1NK9 A;  4EYH B;  1I5O B;  1HBU A;  2MSS A;  2DNL A;  2VQE J;  2HLU A;  4LVO P;  2XMK A;  5GAG I;  5A0Y A;  1FES A;  3BJY A;  3A8E A;  1QTN B;  1TFW A;  5DZ7 A;  3DRR A;  3DLG B;  1RP5 A;  1WF1 A;  1DTQ B;  4WFZ A;  4Y65 A;  4AYB D;  2J7K A;  3NCR A;  2YQ3 A;  4DR3 F;  3PX0 A;  1N5V A;  1SQG A;  2GGP A;  3LGH A;  4YB5 A;  2DGU A;  3NEK A;  2NZC A;  4JI4 J;  2H4Y B;  1VQ5 S;  1BUX A;  2YXL A;  3E2E A;  1S1U B;  4QWD A;  1K1S A;  2LA4 A;  1MU2 B;  5I3U B;  4UTG A;  2DYA A;  4C8L A;  1Z2L A;  1TV6 B;  1YSJ A;  2C3P A;  2J0S D;  2MZT A;  1TKT B;  2KZM A;  1Y4Z B;  3TI0 A;  2B9W A;  3T1Y F;  1VK8 A;  5B7W A;  3BO4 A;  5DDP C;  1V3Z A;  1XWL A;  4DR2 F;  2OIH A;  1SH0 A;  2E1C A;  2MST A;  3GMG A;  1AB8 A;  4OZ5 A;  2VG7 A;  2R7X A;  3DU6 A;  2QSF A;  4C3M A;  4FNI A;  2NPI A;  4ECZ A;  1XIQ A;  1VQ4 S;  3GTY X;  3RG6 A;  2C3U A;  5IZH A;  4TU9 A;  3GFZ A;  2JHE A;  4LQ9 A;  1JLC B;  5GAD U;  3R2C J;  2QA1 A;  2XNQ A;  3NLC A;  3US5 A;  2DXD A;  5HRO B;  2J9D E;  3GJQ B;  1F2H A;  4UZB A;  3ELH A;  5CHC B;  5FLX U;  2LKZ A;  1GMU A;  3AOA A;  2GX8 A;  1Y10 A;  3RRG A;  5F3T A;  2M7S A;  2HQG A;  3FBF A;  2NSB A;  1C0T B;  5M2U A;  2VJU A;  3OD2 A;  1WC0 A;  2GJF A;  4CO5 A;  2GMJ A;  3R1H A;  4EEY A;  4DLG A;  1RCX B;  4K5R A;  3H42 A;  4YR2 A;  5HAT A;  3AA8 A;  2PFF B;  4X64 F;  2K7K A;  2VOD A;  1HQU B;  2ZH9 A;  4DL3 A;  3TUJ C;  2EFN A;  3M7V A;  1UJ4 A;  2PEB A;  1Y3J A;  1PCA A;  3HT3 A;  2UVV A;  2KT5 A;  4DR1 J;  5L1L A;  2D3O R;  2CDQ A;  2F5G A;  3C2P A;  2DNZ A;  2RRN A;  1H6K X;  3F41 A;  3PW7 A;  2IM2 A;  2J8A A;  3V4M A;  4F0K A;  2RDI A;  1RHQ B;  2RS2 A;  4TLQ A;  5K14 B;  1RIS A;  3DOK A;  3EDQ B;  2ASJ A;  4HVZ A;  5DG9 A;  2IVM A;  2HND B;  1HR0 J;  3A3O B;  2NUU G;  4HYK A;  2A1B A;  3CD5 A;  2V68 A;  1RCO B;  3LOU A;  3D66 A;  4OI6 A;  4FF3 A;  2H5E A;  3DHX A;  4CO4 A;  4F2R A;  1XR6 A;  1QSL A;  2ALY B;  4MKY A;  2XS7 A;  1MMD A;  1LXJ A;  3OL9 A;  3NGS A;  1R8H A;  4KIA A;  5HQM A;  4ELU A;  4CP5 A;  2W01 A;  2YWG A;  2VBZ A;  1AFJ A;  3FEY B;  2DHG A;  1U09 A;  2CQ3 A;  5F8H A;  1LWF A;  3BDP A;  3ZZU A;  4LF1 A;  3ONQ A;  3R5B A;  1OO0 B;  1RWN B;  3VWS A;  3F56 A;  2JDJ A;  3DMJ B;  3MFH A;  3NG8 A;  5KFW A;  2BM1 A;  1N56 A;  2HFV A;  4DQR A;  1NCL A;  3HVT A;  1FF2 A;  2GS8 A;  2B9E A;  3ZZ0 A;  3W9I A;  3JSB A;  1GK8 A;  4WU3 A;  3MD3 A;  3BO3 A;  2IRU A;  3AXM A;  4AUK A;  4I2P B;  4NA1 A;  2CZ4 A;  2MJU A;  3FBE A;  4XPC A;  1S4F A;  4U96 A;  2X3D A;  3MF5 A;  2MHN A;  1RAH B;  3W8G A;  2OO4 A;  3TZX A;  2D74 B;  4DV4 J;  3NBP A;  3CMA S;  1KLN A;  1N5T A;  2LQJ A;  2GGP B;  5GAH U;  1RYR A;  4LFA J;  1O6X A;  2FIU A;  4WTY A;  1B7Y B;  2CQC A;  4P73 A;  1JJH A;  3HZE A;  3C15 A;  2R4F A;  1V3R A;  2ILZ A;  1ZYQ A;  2CJQ A;  2KZZ A;  1QSY A;  4WXO A;  1U0H B;  1PO6 A;  1PBU A;  3HFV A;  4OI2 A;  3M6U A;  1WOO A;  1M1G A;  3MUR P;  3POT A;  1VQY A;  5LMU F;  1SJQ A;  1RJJ A;  3FSY A;  2OFG X;  5ADZ A;  2AGQ A;  3QZ8 A;  3OFG A;  3C3L A;  4RUH A;  3HHL D;  3NXZ A;  4ZP9 A;  3LTO A;  4JOU A;  2MDA A;  4KE5 A;  2VG7 B;  3EDR B;  1P8G A;  3CJ5 A;  4AD6 A;  2OPS A;  3DRY A;  5KFL A;  1RWK B;  4KO0 A;  1NEE A;  4QBU A;  2DKO B;  3HXM A;  3V6K A;  3BGO P;  3LGN A;  4J5O A;  4MH8 A;  4J9K A;  2DGV A;  2UU9 F;  1SJF A;  1RHJ B;  2AWZ A;  3MEG A;  1N36 F;  4KPY A;  2JNJ A;  2GVD A;  4PQA A;  4X4R A;  1RAD B;  3N79 A;  4GRS A;  4RW9 A;  2DHX A;  1TL3 A;  5H9F K;  4DFP A;  2ZDP A;  1NKC A;  1HAR A;  4O3Q A;  5IT9 Y;  4UST A;  2R2T A;  3V2U C;  1BE4 A;  3CD7 A;  1CS4 A;  1TUG B;  3BKT A;  2N7C A;  4X62 F;  2WCX A;  2UV8 G;  3ETO A;  2KG1 A;  4A46 A;  2AU0 A;  3RAQ A;  2EFG A;  2FTR A;  1ZM3 A;  4WFA Q;  2R42 A;  2JH3 A;  1Y11 A;  4GVB A;  3A3P B;  5CD4 A;  3GIJ A;  3J7Y I;  1IBL F;  1RWU A;  1CBK A;  4LRE A;  2VPW B;  3IRX B;  2JWN A;  4DV0 J;  4DF8 A;  4I2Q A;  4ECW A;  2QLW A;  5CZX A;  1U4B A;  3H20 A;  3ZNJ 1;  5IM0 A;  5CXT A;  3RRH A;  3BR9 A;  4M95 A;  4GO5 X;  1U47 A;  4ZA1 A;  5JUM A;  2HQ3 A;  3L95 X;  3QAU A;  1MMN A;  1FRH A;  3KLE A;  1TMM A;  4F4W A;  1VIO A;  2YKM B;  1J27 A;  3OXL A;  2CPH A;  2GQQ A;  2XSF A;  4ZCI A;  4OYI A;  1MWY A;  2DNY A;  2JRS A;  2VA2 A;  4Y0F A;  4ECU A;  2G1D A;  2XHW A;  2DR7 A;  3HD2 A;  3KLI B;  1AA1 B;  1NPK A;  1T3N A;  4PQU B;  5AT1 B;  2OFH X;  3DGP A;  3QSI A;  2VBW A;  1LWF B;  4GMK A;  3UD5 A;  3IO1 A;  2V2Z A;  1EX8 A;  1QY7 A;  4OJH A;  4C0B A;  2DNG A;  4BBY A;  4PWU A;  4HI2 A;  4QR2 A;  1HWJ A;  2RJZ A;  3NY0 A;  2DNM A;  3D0G E;  2AJ1 A;  2VD3 A;  4J91 A;  3P5B P;  9ATC B;  1OYD A;  3GIR A;  1HYS A;  4DR4 J;  2CA9 A;  2VG5 B;  2DEI A;  2EI5 A;  2YX1 A;  1JJ2 R;  4L72 B;  4XIU A;  3MXH P;  4RU9 A;  4OHY A;  3AFG A;  2ASD A;  2UUA J;  3LQV A;  4DR6 J;  2OEJ A;  1TL4 A;  3L7P A;  5HAN A;  2PMH A;  3CVK A;  4QWE A;  2H9Z A;  3IG1 B;  1FWP A;  2XSJ A;  2VQF F;  3K2Y A;  1L3K A;  3HUL A;  1KTQ A;  4KHP J;  1UZH A;  1WHY A;  2C22 A;  2JVO A;  3JSM B;  5E3R A;  4CTA A;  2R7V A;  1WC6 A;  3C15 B;  3G71 S;  4ZPB A;  3MAQ A;  1TR0 A;  1RHU B;  1ZM4 A;  5F8I A;  1IBC B;  1QVF R;  4LF9 J;  1S48 A;  3EJM A;  3SFU A;  4DSE A;  3IGN A;  2ZH7 A;  1FEE A;  3OXG A;  3ISN D;  1YRT A;  5IV3 A;  3TZW A;  2JLE A;  1HI1 A;  3POT B;  3BB5 A;  2ATC B;  3G6E S;  3KJF B;  5J1P A;  3UDV A;  1U1P A;  2CZV C;  5A8K A;  2MKH A;  5ETM A;  3OTO J;  2HYI B;  2OPS B;  1FXL A;  3GR1 A;  5IXU A;  1XR7 A;  2H48 B;  5HQL A;  1RT2 A;  5ETQ A;  3W2V A;  3JAM U;  5IOL A;  4UUW A;  3PEH A;  4K4S A;  3NRB A;  3LAM A;  4AL6 A;  3WDO A;  3D4J A;  4NOH A;  1G4C A;  4K4T A;  2GVD B;  1S77 D;  4B9N A;  1S0V A;  3M4X A;  4XDC A;  4M8L A;  3VTI A;  2JX2 A;  2V0N A;  1RBL A;  4RW9 B;  5HSP A;  1TL3 B;  2OEM A;  1YVF A;  5JMN A;  1S1W A;  3THP A;  1TMJ A;  1ROF A;  4QWA A;  2RIJ A;  1RU2 A;  4F4Y A;  4WK1 A;  1CS4 B;  2DHH A;  3GU0 A;  3TAN A;  1R7I A;  2IMW P;  1U1K A;  3CJR A;  1WG1 A;  2HLT A;  5KG0 A;  5KFM A;  4J9P A;  4WZQ A;  1QAY A;  4NA3 A;  4FPI A;  2JJ4 D;  3KK1 A;  5D4O A;  1R6V A;  4GVB B;  3QZ7 A;  2FHJ A;  2B0G A;  2QG9 B;  1JNZ B;  3ZTO A;  2IIH A;  2P9G A;  2R7Q A;  2HHX A;  2FZK B;  4DQS A;  2CVE A;  4I2Q B;  1AUD A;  4R25 A;  1WG5 A;  1S6P A;  1U25 A;  4U7U D;  1SJR A;  1DUR A;  4FYW B;  4J9N A;  4Q0B A;  4RNN A;  3BYR A;  3PFO A;  2UZA A;  1L3S A;  4KGX B;  1T8E A;  2HNZ A;  2WK4 A;  3CO0 P;  1P9Q C;  2VFU A;  1F5C A;  2HS4 A;  2BKP A;  4DR3 J;  5D77 A;  3FEZ A;  1X8D A;  1FKO A;  2POK A;  2CPZ A;  1UJ6 A;  1CUL A;  1M5P C;  2M4M A;  3A1Y G;  1N5Y B;  2IBO A;  5KOX A;  1P1L A;  4EBC A;  1K47 A;  3OPK A;  1NU4 A;  3I55 S;  2VFV A;  1J2V A;  2KFY A;  3GWC A;  1OPZ A;  5C24 A;  4DU8 A;  1YHQ S;  1N48 A;  3GJR B;  4OZN A;  2ASL A;  5KFD A;  4B3R J;  1VOM A;  4MFB A;  1FD8 A;  3OSP A;  1YI2 S;  2MZJ A;  3DGP B;  5G4D A;  2E66 A;  4MTP A;  3QSY B;  3PX4 A;  3TVZ A;  4C8N A;  3EGN A;  3MMA A;  4LF4 J;  5AXK A;  4DR2 J;  3KXD A;  1T7P A;  2ZFH A;  3W66 A;  2ZWO A;  1RLC L;  1DRZ A;  1HYS B;  1KEK A;  2R8I A;  3LP2 B;  3QT5 A;  1VMB A;  3D1O A;  2RQM A;  1RT1 A;  5KFZ A;  1NM2 A;  4DUZ F;  3KYL A;  2ZM6 F;  4LF5 F;  3FBB A;  3E51 A;  4NWB A;  1RHM B;  3N4W A;  2WTF A;  3NS5 A;  4MKA A;  3U1L A;  3CCZ A;  1YK9 A;  4NLQ A;  1NK4 A;  3NS7 B;  2E5J A;  3PW4 A;  4TQR A;  2FYX A;  1WSR A;  3O3L A;  2RQ4 A;  3ADA C;  4O4G A;  2XSJ B;  3NGU A;  3HHL C;  1YJW S;  4H4M A;  3GCX P;  2CQ1 A;  4HLB A;  2LDY A;  4NXN F;  4C3L A;  1BD6 A;  1SUQ B;  3R7B B;  2BW7 A;  4ZVO B;  2W7P A;  3CJ4 A;  3UR0 A;  2QT7 A;  3TUP A;  5KFI A;  4X64 J;  4LBI A;  3GLJ A;  5AE2 A;  4PXC A;  3S01 A;  5GAD I;  1REG X;  1YBU A;  2I38 A;  2W8K A;  4RBT A;  3DLE A;  5I4M A;  3PM9 A;  1U1M A;  1T9T A;  1WI8 A;  1U0S A;  5A8K B;  4K2X A;  1D8Z A;  3EXC X;  4IR9 A;  2V8G A;  1C1C A;  4DL0 C;  3B4M A;  1YG0 A;  4O23 A;  4ETZ A;  2IJR A;  1RT2 B;  3W2V B;  4KJI A;  2V8H A;  5KFV A;  3QFH A;  4RNO A;  3EE3 A;  1SKS A;  1E6V A;  2RQC A;  2QA4 S;  2ZC3 A;  4ED0 A;  3K5O A;  3MOZ A;  4NLU A;  1SIW B;  4K0K F;  3I9Z A;  2BE2 A;  4I4B A;  4ZJQ A;  2XG8 A;  1S1W B;  3QO9 A;  2A6M A;  1SI9 A;  4C8K A;  1T03 A;  3DKD A;  1IVZ A;  2DR6 A;  3OW2 R;  2QJ3 A;  3P96 A;  4OLO A;  3N5B A;  3RR7 A;  3ET6 A;  2XUL A;  2GQ2 A;  5F0U A;  2IM0 A;  1YJV A;  1SC6 A;  5KFB A;  1RAI B;  4OHW A;  5L39 A;  3S1T A;  3N6M A;  2HNY A;  3A4T A;  5K8M A;  1MRO B;  4TYA A;  3M8P A;  2ZZN A;  5T7L A;  1JLA A;  5KG4 A;  3VF0 B;  4ZJL A;  4IUF A;  1EKS A;  4ELV A;  4OI0 A;  1R0B G;  2FJB B;  1KON A;  5CD4 H;  1KTV A;  5EHH A;  2MGZ B;  2LVW A;  1M5V C;  1D3W A;  3PFE A;  5HLF B;  4OJ1 A;  2D3O 1;  4UT4 A;  2DH9 A;  3IM8 A;  1R27 B;  1Z1Z A;  1NPR A;  2HAI A;  1CUL B;  2RF2 A;  2BJE A;  1T05 B;  3HSJ A;  4AT1 B;  4NMX A;  5ETP A;  3JQJ A;  3ILO A;  1RT7 B;  1RTZ A;  2XI2 A;  5F41 A;  2X3G A;  2IHR 1;  4EUV A;  5DQI A;  4MFB B;  4JV0 A;  5KG1 A;  3VVT A;  3TVY A;  2ZJR Q;  4N47 A;  1HBM A;  2XGP A;  2NRE A;  2ZC4 A;  3U02 A;  1TUW A;  1H2T Z;  2LQ5 A;  3HHL B;  4FYX B;  3MMA B;  2V63 A;  4K7Q A;  1AZS A;  1RHK B;  1YQH A;  2KN4 A;  1UKU A;  4OQJ A;  3MMJ A;  4WZM A;  3PJW A;  3D3C J;  5G0R A;  1UWB A;  4WP9 A;  1YKW A;  1H7X A;  4YQW A;  1ZAV A;  3QIP A;  2X1A A;  2UU9 J;  2P6S A;  2W2P P;  3EUN A;  5D0G A;  2HHQ A;  2F8M A;  3GZ7 A;  1N36 J;  4IO9 Q;  3BKU A;  4PXE A;  4FVM A;  1S97 A;  4JI0 J;  1PG5 B;  1JLQ B;  3ISN C;  2A18 A;  3VHQ A;  5A2Q U;  4O4G B;  2DNO A;  1B4S A;  2M3D A;  3FCW A;  1UPM B;  1GXL A;  4GKK J;  3PW2 A;  4KFB B;  3R6L B;  4H4M B;  3TRG A;  3P49 B;  4DV6 F;  1X4F A;  4X62 J;  1BGX T;  2M2B A;  5L38 A;  1NJI T;  3QGG A;  1B64 A;  4R8U A;  2RIL A;  3BRE A;  3PTW A;  2XZD B;  1E6Y A;  2GHW A;  3JQK A;  3CGI A;  1IBL J;  1KQG B;  1RAO A;  1LW2 A;  3UW1 A;  2OPQ A;  2W1B A;  3TA2 A;  4RW4 B;  1C1B A;  2IA6 A;  4F4A A;  4U67 Q;  5HN0 A;  3V4I A;  3DRP A;  2RVJ A;  1L3V A;  1BY9 A;  4OHX A;  3RBZ A;  2MEW A;  3TW0 A;  2Q6B A;  1QUP A;  5C7P A;  3K7R A;  1JLF A;  4YY3 F;  4O3S A;  3CCW A;  3SSS A;  2Y8Y A;  4C11 A;  3KNA A;  1QDU B;  1NDP A;  2R3V A;  4ICL A;  4WXW A;  2Z2Y B;  4ZDN A;  1I51 B;  2I1R A;  3ZXW A;  5KFH A;  4C8Y A;  2AJ0 A;  5F8L A;  1RTJ B;  2XHC A;  1E6V B;  2YWH A;  1D09 B;  4ZIT A;  1YJ9 S;  1HPZ B;  3CC4 S;  3BGR B;  3M2U B;  2YQ1 A;  1PYS B;  4P6Q A;  2ZVS A;  2R8H A;  1T03 B;  1ARO P;  5J2Q A;  3BBF A;  1GQE A;  3EPG A;  8ATC B;  2AYB A;  4ZS6 A;  2MTL A;  2FJA B;  2KHD A;  4LSL A;  3DLH A;  5CH7 B;  2DGQ A;  2EXU A;  2VKR A;  3UDC A;  4ER8 A;  1TK0 A;  4YDD B;  3L3C A;  3IBF B;  1GEH A;  4PR6 A;  2K7J A;  2BXJ A;  2GAG C;  3KJN B;  1DLO A;  1ZA2 B;  3F44 A;  3M8P B;  5T7L B;  3W2W B;  1EP4 A;  2U2F A;  4K4X A;  3UVJ B;  2BE7 D;  4ZVE A;  4PUO A;  4NML A;  4N76 A;  4YOE A;  2CFX A;  3D1H A;  4DFK A;  4J9L A;  1GH8 A;  3O1L A;  4LFB F;  1VQK S;  2UV8 A;  1HNX J;  1MNE A;  3DFE A;  2ZHA A;  3ENV A;  5KFT A;  2VQF J;  2FVQ A;  3M2R B;  2FJX A;  3TZZ A;  2NXE A;  3NGD A;  2EFQ A;  2PII A;  3DRX A;  2HSE B;  2AP6 A;  4Y3C A;  1GNK A;  3T5L A;  3FK4 A;  3QQC D;  1NK6 A;  1K1Q A;  4LT6 A;  2KFN A;  4DFM A;  1S7H A;  5T14 A;  1S72 S;  1XEZ A;  1BHN A;  2OD6 A;  1FNO A;  5D0H A;  4KGV B;  3AD8 C;  3U7J A;  3DGV A;  1FFS B;  4F7V A;  4FKX A;  2G0C A;  5D3G A;  1OJ4 A;  4KV8 A;  3TNV A;  1MN9 A;  4FBU A;  4D3G A;  4P72 A;  1HNV B;  4RW8 A;  2ZH8 A;  5FJ4 A;  1DQ8 A;  2ZNZ A;  4LFC F;  3KMS A;  1Q5Y A;  2Q1L A;  1HWU A;  2AD9 A;  4AQY F;  4KBI A;  1HHS A;  2RT3 A;  4AXJ A;  5D4N A;  5ETL A;  3M9O B;  4X4O A;  2ZKT A;  2UXD F;  4ZP7 A;  4JYA F;  3IS9 A;  3MM9 A;  3P8B B;  2ZHB A;  3DLL Q;  5ETR A;  4K4U A;  1IBM F;  1JB0 C;  4NCG B;  3ILI A;  1GXU A;  3Q83 A;  3KLF A;  4W90 B;  4WP3 A;  4WYL A;  3FRY A;  1GT8 A;  4FZV A;  2W4C A;  3SFG A;  1KP6 A;  3B8H A;  4HT5 A;  2C3M A;  1HQE B;  2HZC A;  2GIQ A;  2MQL A;  4WFX A;  2F40 A;  1OS5 A;  3JTO A;  5LXY A;  4UF4 A;  2UUC F;  4RW7 B;  3TEH B;  1R8C A;  3TO8 A;  4TXS A;  3MZI A;  4J9O A;  1RTI A;  1DZ5 A;  4OX6 A;  2EC2 A;  2M5Y A;  2UXB F;  2AX0 A;  5HBM A;  3CIZ A;  2ROP A;  3R7S B;  3MCM A;  4ZVG A;  2DHA A;  2YWE A;  2ZVI A;  3SCL E;  2V2K A;  4R8U B;  3ZZP A;  4WII A;  1NSK L;  4IDK A;  3KJQ B;  4PZV A;  4ETX A;  4B17 A;  1DHM A;  2CZ9 A;  1NH8 A;  4RPF A;  1U6F A;  1ZOT A;  2UUB F;  4LRB A;  3HHD A;  1DFD A;  4QZV B;  5HQ8 A;  1SC3 B;  1FDN A;  1C1B B;  5E3A A;  2KH9 A;  3ISZ A;  4J9R A;  1X31 C;  1FDB A;  3DRP B;  1FRI A;  3O6Q A;  4MIW A;  3PHE A;  4B08 A;  5ETS A;  1F1B B;  1S10 A;  5K20 B;  1UL3 A;  1FNM A;  4UY8 5;  1JLF B;  1T9Y A;  4Z37 A;  3VR1 A;  3O8W A;  1ICE B;  4C11 B;  4L73 A;  4DL2 A;  1SH2 A;  4M5L A;  4C0O C;  4Y6I A;  1DAX A;  4J9U E;  1YRX A;  4I6A A;  1FI4 A;  4OYX A;  4ID8 A;  3R7N B;  3QRQ A;  3JTN A;  3SCJ E;  1FVS A;  1O5J A;  3H25 A;  4CLT A;  1H38 A;  2L9N A;  3RB6 A;  3C6U A;  3AD9 C;  4DHV A;  3UD3 P;  4RL1 A;  4JI3 F;  3QT8 A;  1X9W A;  1Q79 A;  3CCQ S;  2QYC A;  2B9Y A;  2AKW B;  3MEC A;  4ECT A;  4OI1 A;  5D4L A;  2E9Z A;  3QT7 A;  2J9D A;  3TAQ A;  2C2M B;  4ILM A;  3CF5 Q;  5C5J A;  3R9L A;  5CAB A;  2YNG B;  4UW2 A;  4LSL B;  1NDC A;  2XLJ A;  1S9E A;  3G82 A;  3MEK A;  1WAC A;  3PO5 A;  2WW4 A;  1HNI B;  3D6H B;  2V8D A;  2E5L F;  2GHV C;  1F9F A;  2DH7 A;  4N56 A;  2GIF A;  3CJK A;  3EZO A;  2YX7 A;  5BYQ A;  2ZH4 A;  3EWG A;  3BYP A;  3PDN A;  3EMT A;  3G6Y A;  3GIM A;  1MWQ A;  2ZM6 J;  5KT7 A;  2A10 A;  2MY8 A;  2IBK A;  4ZLP A;  2WB4 A;  1UVL A;  4ZVS B;  4CM0 A;  3WBZ A;  4C9D A;  2XS5 A;  3MAH A;  1NME B;  4QOT A;  4I6W A;  3UNY A;  1O51 A;  4B9U A;  4QR0 A;  4NLW A;  5GMD A;  1NSA A;  3SQG A;  1M5O C;  4MJK A;  2EPI A;  1HBO B;  1FDD A;  3KMQ A;  1RAE B;  3QGI A;  3Q0A A;  2FHK A;  3BN4 A;  3OUY B;  3KG4 A;  4NXN J;  2X51 A;  2YNH B;  5GVQ A;  1VRU A;  3NGR A;  1N54 B;  2DO4 A;  1FHT A;  1OSC A;  4KV8 B;  3CED A;  2H5I B;  2HHS A;  5IWA J;  4PKD B;  1I3O B;  1CJK A;  3Q89 A;  2QFJ A;  2FY8 A;  4GKJ F;  3FZB A;  1YJU A;  2GVZ B;  3KUE A;  1MLA A;  1S49 A;  4PXD A;  4AND A;  4ED3 A;  3MM9 B;  4ED2 A;  4Q8E A;  2YKN B;  1T9U A;  4X4Q A;  1ZZF A;  4RBU A;  3C14 A;  3UE2 A;  4OFZ A;  4ZVR B;  5U47 A;  1L3T A;  4BWM A;  2XC9 A;  3AJ1 A;  3PVX A;  2GNK A;  3MR6 A;  3DHW C;  3NNH A;  3M8R A;  3FBC A;  4MMO A;  2Z4P A;  1U1N A;  4K0K J;  2RAQ A;  3J81 Y;  2DIS A;  3J80 Y;  2LP4 A;  2I5J A;  2WVF A;  1UMJ A;  1RTI B;  1UTA A;  3GQC A;  2XMM A;  4DV2 F;  4PG5 A;  1FKP A;  3TYT A;  1U02 A;  5J1E A;  2C2R A;  1DQA A;  2HMI B;  1FEH A;  1KFD A;  3OLB A;  1NB7 A;  1Q4R A;  4NZ0 A;  5SZT A;  1PSD A;  1V5I B;  3H5Y A;  5FDL B;  4ZK7 M;  3Q23 A;  2XY5 A;  2XGQ A;  4CLS A;  5KT2 A;  4C98 A;  4JV5 F;  3EGZ A;  1SB6 A;  3K59 A;  3CCT A;  2E1R A;  1EQM A;  4IG0 A;  1D9F A;  2IDL A;  2ROE A;  3GIK A;  1IKW A;  3KUH A;  3MED A;  1OSD A;  2CNO B;  2UXC F;  2E7X A;  3MAA A;  3OV7 A;  4YN3 B;  3OXF A;  5IV4 A;  5HJX A;  4OZL A;  2HEK A;  3I31 A;  1CJV A;  2V50 A;  4F4X A;  4O0N A;  5KFR A;  4CCH A;  1U7L A;  2JFD A;  2BJD A;  2BOA A;  1UA0 A;  3NOC A;  8RUC A;  5MAO A;  3CD0 A;  3RTV A;  2KU7 A;  1C0U A;  3MR3 A;  3AB2 B;  3N0V A;  5L9N A;  3BZQ A;  5D6G A;  4NXM F;  2V8P A;  4F3O A;  1VC0 A;  1S9E B;  3G82 B;  2W9B B;  2CJX B;  4P9S A;  3BBB A;  2RE1 A;  2AJQ A;  2BBE A;  3PRV A;  3E01 A;  3OT9 A;  2V4J B;  3WIV A;  1XNQ F;  2BW2 A;  2OAU A;  1O8B A;  4HKQ A;  3TVK A;  3GYN A;  3D67 A;  4DU7 A;  1X0F A;  1XMO F;  4P7T A;  3CJK B;  2W2Q P;  1EIY B;  3PYG A;  1PC5 A;  3DC2 A;  5A76 A;  3F0N A;  2FVP A;  2CPI A;  1ZBT A;  1B70 B;  2OD4 A;  2XLI A;  1QTM A;  4PXB A;  1FRJ A;  3SSR A;  1Q0N A;  4YUD A;  5K9F A;  2Z57 B;  4DSL A;  3SQG B;  3KJV A;  3Q8V A;  5J2N A;  4J90 A;  1X0P A;  4ZCL A;  4KAI A;  2QL7 B;  5H9E K;  4FP9 A;  2B3T B;  2VC1 A;  4EMD A;  2CG8 A;  2ZE2 A;  3OFH A;  3CPW R;  2W8L A;  2DVI A;  2HQC A;  1WKK A;  3RYL A;  3AT1 B;  2IM3 A;  3LUY A;  4XK8 C;  2V4R A;  3OJS A;  5DDQ C;  1TKZ A;  1U2F A;  2IPO B;  2OLW A;  4KGZ B;  3M9N B;  2CNL B;  1LNQ A;  1QE1 A;  4DCJ B;  1BQN A;  1VQ8 S;  1U49 A;  2VOO A;  1CJK B;  3TUI C;  5K8N A;  1FCA A;  2VV5 A;  1F6T A;  5DM6 Q;  3O44 A;  2MLZ A;  3C19 A;  1RT5 A;  3SV3 A;  2RU3 A;  2CPJ A;  4ECQ A;  5C42 B;  4Y2C A;  4YY3 J;  4DL6 A;  4G1P A;  2ZOG A;  3ZZZ A;  4QIV A;  3JSY A;  1F9H A;  3C14 B;  3NGT A;  5E7O B;  2DRD A;  4LF6 F;  4DSK A;  2A2D A;  3T5H A;  1UPP A;  3MWB A;  1WUU A;  4QWC A;  2YKP A;  3KKF A;  3A3N B;  1EB0 A;  2DPJ A;  4QIG A;  1PJ5 A;  2I5J B;  2IAJ B;  2YQ0 A;  2MYF A;  4R5P A;  1Y0H A;  3RB3 A;  1TVR A;  2QFI A;  3QRR A;  1T0T V;  1UA1 A;  3MR2 A;  2N82 B;  1WC3 A;  1FKP B;  4PCQ A;  3PJ9 A;  4M5K A;  1KWM A;  1NSP A;  4WU2 A;  5JJB A;  3BSN A;  2K8G A;  1C4C A;  2RQK A;  1S7I A;  3WX4 A;  4JI5 F;  2C2K B;  2J8S A;  4ALZ A;  3DM2 B;  2MKK A;  2LYV A;  4Y34 A;  4TY9 A;  2DBB A;  3BN7 A;  5KFU A;  2Y1I A;  1VHI A;  2GFF A;  5BJR A;  1WKL A;  1V5V A;  2U1A A;  1FT8 A;  1RKI A;  5KFE A;  2M52 A;  4IG0 B;  4WWS A;  1NRK A;  1Q8I A;  3RAX A;  2R2U A;  3GPA A;  3DOM A;  3L7U A;  3MED B;  1B7F A;  1JJC B;  1X4G A;  2FHO B;  4LFB J;  2FLP A;  3MAA B;  2WON A;  2JFK A;  1KOO A;  2FUG 9;  2EKY A;  4LJM A;  1ZAW A;  1AUS L;  2H4W B;  3DLK A;  2PFD A;  5JVG Q;  3QMQ A;  5KAK A;  3VGV A;  3MOJ B;  4ERD A;  2PMW A;  3PEJ A;  3GCW P;  1URR A;  5KTQ A;  1AT1 B;  1BQM A;  2Z0G A;  4UOF A;  4GVL A;  2CPX A;  2K1R A;  3AB4 B;  1IWA A;  2AYG A;  1EKR A;  1SV5 B;  2NYH A;  1YTY A;  3G4S S;  2ZBC A;  3W5Y A;  3OFF A;  2XY7 A;  5B0A A;  1X4E A;  4AQY J;  1IWG A;  1ZAX A;  3MFI A;  1C2P A;  1NH7 A;  3OL8 A;  3MUM P;  4O44 B;  1D9A A;  2UXD J;  4DPY A;  4MKB A;  4JYA J;  1PJ7 A;  2MB0 B;  3MPV A;  1WF0 A;  5ITH A;  2O66 A;  3VAF A;  1IBM J;  2UVW A;  2CG4 A;  3AOB A;  3SZ2 A;  5IC6 B;  3VGT A;  1OIA A;  2OGU A;  3CDA A;  3UN3 A;  2CAD A;  3TA1 A;  2VFR A;  1YZ6 A;  2ZUG A;  3DDI A;  3Q86 A;  3HK2 A;  3KJV B;  2UUC J;  4DL4 A;  2B7C B;  3NKY A;  4ZPW R;  2G0I A;  3KK2 B;  3M2V A;  4XAK A;  4K2J A;  2UXB J;  4OYB A;  1F0X A;  4RUB A;  3AQO A;  1I1G A;  4RU2 A;  2DIT A;  1MML A;  2ZE2 B;  1XER A;  1C4A A;  1S1V A;  4LSN A;  4ED4 A;  2AZ1 A;  1S79 A;  5C25 A;  4EZ9 A;  3UO0 A;  2J9E A;  1TKZ B;  4HAC A;  4ID5 A;  3HHK A;  2Q79 A;  2G13 A;  3ZTP A;  3GG0 A;  3PV8 A;  1RAB B;  4YHH F;  3HJV A;  4PG8 A;  1QE1 B;  2BUN A;  3EGW B;  4F25 A;  4CO3 A;  1RWX B;  4YB1 P;  1JLB A;  1IKX A;  4NYP A;  2UUB J;  3I9V 9;  2FB0 A;  4KHM A;  3T1H F;  3PX6 A;  2DNH A;  2V9W A;  1RT5 B;  4CYU B;  1W2B R;  1VRT A;  1SPB P;  3PR4 A;  5CAA A;  3M8Y A;  1XNR J;  2Q3P A;  3TQ1 A;  4CIO A;  2D3Z A;  4FXD A;  3DDN A;  4YB6 A;  1IQT A;  3DU5 A;  4K4W A;  1CSJ A;  1R8B A;  2C28 A;  4M5G A;  4IRD A;  3TR5 A;  2CRL A;  1UET A;  3W64 A;  2G9O A;  2HBY B;  1KHV A;  3QID A;  5HAO A;  2IRY A;  4R5P B;  5ETT A;  1RBA A;  5A8W B;  1WD6 A;  3NMA A;  3BO2 A;  4QU6 A;  1JNR B;  2PI4 A;  4GC7 A;  2EG1 A;  2PD1 A;  2R9L A;  2XZT B;  1LK5 A;  2QE5 A;  3DRS B;  1JLG A;  1Z4U A;  1FJC A;  2E5L J;  3OR2 B;  4CLL A;  4ZIW A;  4B9M A;  4MIA A;  3I4H X;  4QQB A;  3OVS A;  4KY3 A;  3C16 B;  1T94 A;  2YH1 A;  4IH7 A;  2G0J A;  2R8K A;  3H90 A;  4BLG A;  3IWL A;  5LJ3 Y;  4I7F A;  1CPZ A;  4USU A;  3H2L A;  2IYG A;  2GQC A;  2WSE C;  3KLH B;  1PGZ A;  1WOP A;  3QJP A;  2ZWP A;  5FLX Y;  2WHO A;  3DN9 A;  2B9X A;  2NPF A;  3HMJ G;  1VQP S;  1NK8 A;  3DOM B;  2IRX A;  3M8Z A;  2HZV A;  2AF6 A;  2WBR A;  1B0T A;  2WON B;  2NCK L;  1HNW F;  3EVO A;  2R2S A;  3HDS A;  3CCV S;  4PWD B;  1NK5 A;  5C2C A;  1XN9 A;  3D28 A;  4UZC A;  4ED1 A;  4X2B A;  4NRU A;  4PAA A;  5GAE U;  1YIJ S;  2VOP A;  3RAM A;  3OTD A;  1RT3 A;  4LF7 F;  1RWM B;  1HA1 A;  4NZ6 A;  4BCA A;  1H72 C;  2IJF A;  1BQM B;  1CQM A;  5DG7 A;  1XMQ J;  4DXL A;  1H2U X;  1VLY A;  5DET A;  2HHV A;  3M30 A;  2BRL A;  2CQG A;  4M94 A;  4GO7 X;  4DL7 A;  1SH3 A;  2RRA A;  4GKJ J;  4DDF A;  2IC3 B;  3X3U A;  1PAE X;  4HTI A;  3UN2 A;  2LQ9 A;  3MM7 A;  2DGT A;  1J5O A;  3VAI A;  2AEM A;  3OLA A;  4D3H A;  2XMJ A;  1ACM B;  1H73 A;  2LU1 A;  2BZ2 A;  1Y3K A;  4J9V A;  4FPR A;  1G7C B;  4WYW A;  3KG0 A;  4KH1 B;  1I6J A;  2IYI A;  2YKQ A;  2J6S A;  2JC0 A;  3KNG A;  3MGJ A;  2YH0 A;  3OJU A;  5E2Q A;  2XYG B;  4UOC A;  4KPC A;  4NE9 C;  4AE5 A;  2HQD A;  3LAK A;  2I8E A;  3M2V B;  1DAR A;  5AJ3 F;  4NLV A;  1S12 A;  4CT8 A;  3HFK A;  2MZ1 A;  1AYE A;  2ADB A;  4DV2 J;  1WC5 A;  1RSC A;  3QGP A;  1SQE A;  1LV5 A;  4TKT A;  1S1T B;  2QX0 A;  5H1S V;  3T9N A;  4KTQ A;  4LRC A;  1TAQ A;  5C25 B;  2DNN A;  5M2P A;  2Y1J A;  4NX9 A;  1BLU A;  4M5M A;  4ID5 B;  3RB0 A;  3IWX A;  2DR5 A;  4CNY A;  3SCK E;  5DS7 A;  1Q7Y T;  2F9J A;  2X1B A;  1N0U A;  2D41 A;  1U2C A;  4ILR A;  3M6V A;  4JV5 J;  1VHF A;  5D78 A;  1V6H A;  1CEZ A;  2QLB B;  3AHP A;  4HTJ A;  2YKO A;  3PCO B;  2B5J B;  4CI0 B;  1WOR A;  1ZTW A;  2BAB A;  2XWY A;  5I3Q A;  1G1X A;  4FF1 A;  2UXC J;  5HMY A;  5A8R B;  1NJY A;  2NXN A;  1RT4 B;  4AL7 A;  1PBA A;  2PMZ D;  1TL5 A;  2NLW A;  5E3Q A;  4MK7 A;  2NS1 B;  4BHQ A;  4YP3 A;  4USM A;  3W62 A;  3Q8Q B;  4W4M A;  2NYI A;  3BV8 A;  1UFL A;  1OY9 A;  1S9G B;  2BQ3 A;  1SQF A;  4RWW A;  1S1X B;  2Y3Y A;  2NZ4 A;  3IM9 A;  4HEA 9;  4F2S A;  1SJ4 P;  1RHR B;  2NXC A;  2E1A A;  3BH7 B;  3GR0 A;  3FFI A;  2IM1 A;  4PG7 A;  1VQ9 S;  1VFJ A;  3EPI A;  3W5Z A;  4UQG A;  3KOA A;  2F63 A;  4NXM J;  2WSC C;  1W2I A;  1SVD A;  3G8T A;  2UUT A;  3OTB A;  3FMW A;  4M5J A;  3EVM A;  3T1A A;  2QEX S;  2J0Q D;  2DXE A;  5KFN A;  1XNQ J;  4QPT A;  5AE3 A;  2B8Q A;  3RW6 A;  3BQ1 A;  3H0P A;  4CM2 A;  3PIP Q;  3OTC A;  3OVA A;  1XMO J;  4PRF A;  2XBP A;  2V67 A;  2HIY A;  1KLM A;  1SIZ A;  3LPY A;  1NK7 A;  2NR0 A;  1X4A A;  2MY7 A;  3SBM A;  3KDO A;  2W9A A;  1RWP B;  4A8S A;  3GFH A;  2P6T A;  3H5X A;  3K5L A;  2QMU B;  2KHC A;  3G6X A;  2RUG A;  3HM9 A;  2DTJ A;  2OPR B;  4RWX A;  2JEJ A;  2Y0B B;  5B0D A;  1WC4 A;  2RU9 A;  4ECS A;  1KS2 A;  4F50 A;  3EM1 A;  3ILJ A;  2FHJ D;  9RUB A;  1RT3 B;  1N0V C;  3PY8 A;  1FX2 A;  1KDN A;  3B78 A;  5KFS A;  3HSG A;  1LK7 A;  1HBU B;  5HMZ A;  2JEF A;  2W24 A;  3MCS A;  1U24 A;  3M30 B;  4K8R A;  3ZTQ A;  5EX0 A;  1T02 A;  1GTH A;  3D68 A;  5F8G A;  3MMC A;  1FFG B;  5BR8 F;  4ECY A;  2R8G A;  2HKE A;  2DGX A;  5A0Y B;  3AH6 A;  4Q5V A;  4OMF G;  3R97 A;  1X5T A;  2R7R A;  3DRR B;  2QO3 A;  4U7U K;  3BKF A;  1D8Y A;  3X1L B;  3D54 A;  3T5J A;  1CG2 A;  3UCZ P;  3P5T L;  3I4P A;  3QRP A;  2G2Y A;  2HK3 A;  3TX8 A;  3TJ8 A;  4DX6 A;  4CO2 A;  3TWZ A;  4DV3 F;  4TY8 A;  2R7U A;  4OZ2 A;  3NWG A;  3M1V A;  3GFX A;  3CD6 S;  2CNK B;  4DR7 F;  5KOW A;  2CWX A;  1REV A;  5A6P A;  1MN7 A;  2RKI A;  3K8W A;  2F9D A;  1WHV A;  3BM7 A;  2LQB A;  4ED8 A;  4DF4 A;  2CPY A;  2L9D A;  1APS A;  1R0C B;  2GML A;  4DN0 A;  1VR6 A;  1YJN S;  3IMQ J;  4DS5 A;  3IP0 A;  4NPO A;  3WQP A;  1YJT A;  5MLC V;  1PYO B;  2H5J B;  1NHV A;  1HR0 F;  2CNN B;  1R0A A;  1IQZ A;  1K0T A;  5H9E J;  2APO A;  2IVY A;  2VZ9 A;  2MPU A;  1U8W A;  3DYA A;  3P4U B;  2HVH A;  2JOQ A;  4ITS A;  2AZ3 A;  4DR5 F;  2ZJP Q;  2DNR A;  3QPI A;  3WX8 A;  4CLY A;  3MTK A;  1S4E A;  3TAP A;  1AW0 A;  3MM5 A;  4U9R A;  2B6A A;  3D2W A;  1HI8 A;  1UVM A;  2ZH5 A;  3W65 A;  2H65 B;  3ZNU A;  1WOS A;  2B4U A;  1CJU A;  3RUB L;  2QC3 A;  3OHB A;  4K50 A;  2VPY B;  4N5S A;  4OV6 A;  3GYX B;  1YJR A;  4B3S F;  3V6J A;  5KT4 A;  3ZTS A;  4F4Z A;  1YGY A;  1NXI A;  4MK8 A;  1K9M T;  1WJ9 A;  1F60 B;  2XYH B;  2WOM A;  4KQZ A;  2FC8 A;  1B99 A;  2YPY A;  1WSV A;  4Y00 A;  5BXI A;  3C6T A;  3QWP A;  1IJE B;  3DOK B;  2MKI A;  4KR0 B;  5EX3 A;  1U6Z A;  3IAM 9;  2E7W A;  1WWH A;  3CB4 A;  3N5F A;  5J2P A;  1Q86 T;  3JAM Y;  2XMA A;  1A6L A;  4UOG A;  4BC9 A;  1KLM B;  2XY6 A;  2BEF A;  5AXM A;  2CPE A;  1VLO A;  1CVJ A;  1URN A;  4JI2 J;  4YFU A;  4X4V A;  3CCU S;  3H98 A;  4C7Q A;  2W9C A;  2W2M P;  3IXQ A;  2HUR A;  4ZP6 A;  5HP1 A;  3NGK A;  3FSI A;  1F5B A;  4U8Y A;  2DCU B;  2AEJ A;  5AXL A;  1GTE A;  1X60 A;  2VL1 A;  2EG2 A;  2ACY A;  4N8N A;  3T5K A;  1S57 A;  2PC6 A;  2YVS A;  3UD4 P;  4OJ3 A;  3FJ2 A;  1R3N A;  5HVF A;  1UAW A;  3H4B A;  4WKR A;  4IFV A;  3JYT A;  2ZD1 A;  4OX8 A;  1FK9 A;  3WHI A;  4QIW D;  2OSR A;  1X4D A;  4Q44 A;  1IUJ A;  3CW2 C;  2B4P A;  1K44 A;  3HVT B;  4F4K A;  4P2S A;  2HZA A;  4ECV A;  1Q8L A;  2HGM A;  3MMB A;  2Z30 B;  2A3J A;  1R8P A;  3C46 A;  4YHH J;  5F8J A;  4O3P A;  2CQ4 A;  4QWB A;  1R43 A;  4DV1 J;  3MEE A;  2AX1 A;  3QWU A;  3T1H J;  4LBH A;  5HVH A;  4N41 A;  2EFV A;  4B9L A;  2OKQ A;  2Q66 A;  3Q2T C;  1Y00 A;  4ZPV R;  4FN5 A;  2ZKU A;  5KFP A;  3A8K A;  1LW0 A;  2C2D A;  2R7T A;  1FDA A;  3NBP B;  4F0M A;  4URG A;  1LFW A;  1Q81 T;  2Z2M A;  4ZLL A;  1X4H A;  3EX7 B;  2YWW A;  2DRB A;  2PDA A;  4OYO A;  1AXQ A;  5KFK A;  2HFS A;  3W5X A;  2DY9 A;  2AYM A;  3MPU B;  4ILL A;  2BV3 A;  2N3O A;  2E5I A;  1YWX A;  4A47 A;  3H4D A;  2FGC A;  1FVQ A;  1REV B;  1R6Y A;  2MHE A;  2QGF B;  4X4P A;  1YX2 A;  3UDE A;  3MPD A;  2RKI B;  3TEG A;  3V6H A;  1H7W A;  4DG1 A;  2OPP A;  1B0V A;  5KG6 A;  4NLX A;  3I0R A;  4DN9 A;  3KDN A;  2VAS A;  4DMZ A;  1XTZ A;  4K4Z A;  3HLU A;  1Q8B A;  3LGM A;  4DX7 A;  3CJ0 A;  4KO0 B;  1SJ1 A;  2RS8 A;  2MQ8 A;  4HHJ A;  1KR4 A;  2M88 A;  2DR9 A;  4E8U A;  3CDW A;  4Q8F A;  4OYW A;  3MEG B;  2MQP A;  4OHZ A;  4QYZ J;  1YDL A;  3DLJ A;  2LEB A;  2M9K A;  2RDD A;  2ZOM A;  2ZDO A;  4ZCM A;  2HS0 A;  3K0J A;  2HBR B;  5DDR C;  3PAC A;  3QT6 A;  2DR8 A;  2VKZ G;  5EN1 A;  2CYY A;  2XMV A;  2QZ8 A;  5JVH Q;  4DPO A;  5CCM A;  5DQG A;  3AY0 A;  1S1U A;  1X9M A;  1N33 F;  3QYY A;  1MU2 A;  4ZIV A;  5I3U A;  3HSZ A;  3RJM B;  3MM5 B;  1RE1 B;  2MXY A;  3LF0 A;  1UEV A;  1S0N A;  2XZW A;  4NI2 A;  4S0M A;  2K3I A;  4F67 A;  2XI3 A;  1XJW B;  5EDW A;  3TAR A;  1XMB A;  3W61 A;  4UQT A;  4LF7 J;  1CJU B;  3TQE A;  3Q8R B;  5EWE A;  2GAH C;  3R8Y A;  2ATL A;  2VBY A;  1T9X A;  2HVD A;  4FBT A;  1AFI A;  4C48 A;  2CJK A;  2AJF E;  2WOM B;  2CAJ A;  1U1L A;  5IM0 B;  1JXV A;  1YBT A;  1NND A;  4RUC A;  3FCH A;  2HHH F;  1NLK L;  4BC7 A;  4RUA A;  4Q7A A;  1JLC A;  4F02 A;  3KLE B;  1M1H A;  1FRK A;  2KO1 A;  2KDO A;  2PSZ A;  3AXK A;  1FWL A;  1VCT A;  3MPY A;  2ZH2 A;  1HD0 A;  2KRB A;  3F73 A;  5LJ5 Y;  2A2C A;  4Q43 A;  4TU8 A;  2W9C B;  5HP1 B;  4JI8 F;  5F3Z A;  3ZZT A;  2CQ2 A;  3LAL A;  4WFB Q;  2QL5 B;  4N77 A;  4OYA A;  2BRK A;  3T1Y J;  5AJ3 J;  3P45 B;  4HDG A;  4TVA B;  3E8O A;  2BOP A;  4GC6 A;  4ZPT R;  1RWW B;  4USK A;  3SXL A;  5HMX A;  1HQU A;  1RTH A;  4XDD A;  3CT9 A;  3JYT B;  5KFX A;  3TA0 A;  3CJS A;  1FK9 B;  1YJ7 A;  4JBC A;  4FS1 A;  2VJV A;  3IGV A;  3ZO7 A;  2FVR A;  3QJL A;  2HIQ A;  2RUS A;  4OYP A;  4WFY A;  3MMB B;  3GSD A;  2KT3 A;  4JI7 F;  2CQI A;  4RNF A;  4DQI A;  4HH0 A;  3SSQ A;  3AOD A;  2PGC A;  3MEE B;  1RAC B;  2HND A;  2ZJQ Q;  4OYZ A;  4PEO A;  4ES1 A;  2H1Y A;  5CCL A;  4LBP A;  3VAH A;  4FYD A;  1RZM A;  2HHT A;  2XEX A;  1SJ3 P;  1SCJ B;  1NZ8 A;  2AJ4 A;  2GV1 A;  4CTA B;  2RDJ A;  1JXE A;  1T11 A;  2HFZ A;  3FMB A;  4RNM A;  1HL6 A;  5LSR A;  3W8P A;  1JQG A;  4OHV A;  2MQN A;  1F2G A;  4K59 A;  2MMY A;  3AD7 C;  1ZPV A;  4DQP A;  5IS2 A;  3U27 A;  1RWV B;  4X84 A;  4ATN A;  3V6D A;  2KYX A;  2V2Q A;  1WDD A;  3HKW A;  1Q16 B;  4ZKA A;  3DMJ A;  4DG1 B;  2OPP B;  3HSD A;  3I0R B;  1WI6 A;  4J9Q A;  3LP0 A;  2LU2 A;  4QIF A;  3R5J B;  3MCN A;  4UUX A;  1N4L A;  4I2P A;  2L41 A;  2LQ8 A;  3VCD A;  2F65 A;  1HD1 A;  3W9H A;  1FO1 A;  4B3M F;  3GB0 A;  4CZC A;  4J9M A;  4Y2K A;  4WBF A;  1LWX A;  3IAS 9;  4LR9 A;  1RAG B;  3R2D J;  4IH6 A;  5F8M A;  2EC0 A;  2OHD A;  3BQ0 A;  4TNO A;  3LPE A;  5A2Q Y;  5LL6 d;  1NKE A;  2KFZ A;  3WC2 A;  3GJS B;  1G6B A;  3W7B A;  2VBX A;  4O4R A;  3OSN A;  3FC9 A;  3CJQ A;  4LRF A;  1JKH A;  3PO4 A;  1ELO A;  1FTR A;  3KFW X;  1DJ0 A;  2G2Z A;  3KK1 B;  3AJD A;  4B3R F;  4MT1 A;  1H2V Z;  4NI2 B;  2HHU A;  2Z58 B;  3SQO P;  3LO3 A;  3NNA A;  1U0H A;  1KQF B;  3HP6 A;  1BC6 A;  3CTR A;  5EWF A;  5J2M A;  1NSQ A;  4LF4 F;  3VQT A;  1S0M A;  2PE8 A;  2ZNY A;  1S6P B;  1RKJ A;  5BR8 J;  4DJB A;  5RUB A;  3UQS A;  2LLZ A;  4I67 A;  4Q0B B;  1YRU A;  3DCA A;  4DV7 F;  2LDI A;  2HNZ B;  5DG8 A;  2QYG A;  1IBK F;  1IR1 A;  3T9Z A;  5D15 A;  4WFN Q;  1FKO B;  1HHT P;  1RWO B;  1UEK A;  5LXR A;  2W25 A;  5LSO A;  1I94 F;  4USH A;  2HBQ B;  3GII A;  1U1Q A;  4DV3 J;  5C24 B;  2R8J A;  4ZCK A;  3IRW P;  4DR7 J;  4ZVH A;  2BX6 A;  4CQ1 A;  2L3M A;  1Y9O A;  1ZPW X;  1L3U A;  4OYM A;  4OIX A;  1ZM2 A;  1ZM9 A;  1QJH A;  5LMU J;  1HWI A;  2UP1 A;  2YKA A;  4FF4 A;  4ECX A;  4N8O A;  4WTO B;  1QAJ A;  4IOA Q;  1RTH B;  4NCB A;  4X4U A;  1KBR A;  2J7U A;  3IRX A;  3MCO A;  4KYZ A;  3W63 A;  2PA3 A;  1RTD A;  1RT1 B;  2I0X A;  5GAH I;  2BJ1 A;  2WRM A;  1WF2 A;  1UP1 A;  1FER A;  4B3O A;  4P52 A;  2G1H A;  4QIE A;  2BE9 B;  1KNZ A;  4MKV A;  4F04 B;  1FXD A;  2DNP A;  3ETM A;  2YKM A;  4OX9 F;  2E9R X;  3IR7 B;  4L76 A;  1SL2 A;  3J7A 1;  4CDI A;  4DR5 J;  5LSL A;  3M6W A;  4P75 A;  1TL1 A;  3TZY A;  3KLI A;  3ZZO A;  2GJI A;  5CA5 A;  4DWI A;  3OHA A;  4PQU A;  1N34 F;  3M6X A;  4Q2M A;  2V69 A;  2Z8Q A;  2XCA A;  2BKO A;  1GFW B;  1HWK A;  1BQX A;  3V6D B;  4B3S J;  4C3K A;  2BVZ A;  2G2O A;  3GV7 B;  2R2R A;  3DLE B;  5KFC A;  1JX4 A;  5DO2 A;  2HK2 A;  3JXO A;  2VG5 A;  1C1C B;  2VON A;  4N7T A;  3LP0 B;  4KKO A;  5B0E A;  6FDR A;  2XO7 A;  5EUH A;  1Q5V A;  3FRZ A;  1Q8K A;  4I56 A;  4NA2 A;  1QVG R;  2CWK A;  4DV5 F;  1HFE L;  3IG1 A;  4JI1 F;  3IWN C;  1RXO B;  2W7O A;  2BJ3 A;  5DGA A;  4USI A;  5KFO A;  3PW5 A;  1D1U A;  1VGY A;  3KG1 A;  3T41 A;  2BE2 B;  4DSJ A;  5C2G A;  3QO9 B;  3MR5 A;  2XYP B;  3FQK A;  2EVZ A;  4BWJ A;  3G87 A;  1PJ6 A;  2DK2 A;  3JSM A;  1S6O A;  1N88 A;  4LMZ A;  3UI3 A;  3T6J A;  1GX5 A;  5B0C A;  2HS3 A;  1JKH B;  1M0S A;  3ET6 B;  4OZ1 A;  4EU0 A;  2DIV A;  2AGP A;  1HW9 A;  2AGO A;  4E0D A;  2VU5 A;  4DZD A;  2Y9H A;  2HNY B;  5J2M B;  2V9K A;  2ACM A;  1JLA B;  3R6G B;  2CQP A;  2D3U A;  3CCJ S;  2GMH A;  3I56 S;  2GJ2 A;  3I5B A;  5FD1 A;  4TN2 A;  1M5H A;  4E2F B;  1NK0 A;  2AIR B;  2B51 A;  5HJY A;  3U1N A;  4P71 A;  2AT1 B;  3RW7 A;  2LXU A;  2XCP A;  1U26 A;  2VDH A;  4LRD A;  3MM6 A;  4JV1 A;  5AXN A;  3PIO Q;  3FEX B;  1Z2Z A;  2CKW A;  4JI0 F;  2RF2 B;  3I6P A;  3HVA A;  3B4D A;  2CUY A;  3SV4 A;  3SYZ A;  2GIR A;  4GKK F;  2HWH A;  3JQM A;  1FRM A;  4ZVP B;  3RZA A;  2KKH A;  3UR3 C;  1FNX H;  3H2V E;  3PNI A;  1HQ2 A;  3SI8 A;  4IH5 A;  4C8O A;  4NL5 A;  5E3P A;  1NUE A;  1HBM B;  1UW4 A;  3Q8U A;  3G2X A;  1F5A A;  5B09 A;  4X66 F;  2IY5 B;  2IDE A;  3I5C A;  4QCL A;  1XR5 A;  5D8H B;  4E98 A;  3IA0 A;  5CQG A;  4LUB A;  1AZS B;  3J81 j;  1QUV A;  1UVK A;  2P5V A;  5G0R B;  1UWB B;  3D5M A;  2EFP A;  4OZJ A;  1RTD B;  4U7C A;  3QIP B;  4J7C A;  2ZBQ A;  2P9C A;  4EBE A;  1TZ0 A;  2VB6 A;  3R3T A;  4B3O B;  5I42 A;  5KT6 A;  1T9W A;  4ED7 A;  4PYD A;  1VRQ C;  4HI1 A;  3PJX A;  1JMT A;  4IYQ A;  4YS2 A;  3NS6 A;  3E3X A;  4Q2L A;  2IMO A;  2Y8W A;  3ENQ A;  5IC4 B;  3AOC A;  1IN0 A;  4XO0 A;  4OV1 A;  4YB7 A;  2V4Q A;  4ZMM A;  4NZ7 A;  2XO6 A;  4IFY A;  1VBK A;  1N5Y A;  1M90 T;  4C8M A;  4RR5 A;  1N33 J;  1TL1 B;  1RA6 A;  3DDK A;  4M1K A;  1FX4 A;  1E6Y B;  5KFY A;  1VBX A;  2VG6 A;  3ZTR A;  1KVK A;  3VAK A;  1LW2 B;  3RBE A;  4L3K A;  2OPQ B;  3JSR A;  1VK3 A;  2EBG A;  1VQ7 S;  1WC1 A;  1FJE B;  4ZP8 A;  2E1P A;  2HQF A;  4EWT A;  2J76 E;  3V4I B;  3N28 A;  2UUW A;  1GMW D;  2EK6 A;  4G3I A;  3LP2 A;  2C3Y A;  2JLG A;  2HHH J;  2W4D A;  2QTW A;  2O01 C;  1KOH A;  4KKO B;  4PG6 A;  3LW5 C;  4KGM A;  2OML A;  3KLG A;  4ICL B;  4USV A;  4OI4 A;  2GO9 A;  3GSI A;  3N9U C;  4DEZ A;  2HAF A;  3CDU A;  1NJX A;  3IBW A;  2AW0 A;  2I9S A;  4X4S A;  4FYY B;  1UFK A;  5IT9 U;  1HNX F;  3D1Q A;  1QSS A;  2CJ9 A;  3ZFV A;  4ENO A;  3VGS A;  1N52 B;  4W98 A;  2GA7 A;  2FLL A;  2H54 B;  4JI8 J;  4MK9 A;  1NHK L;  4EO6 A;  5J2Q B;  2KJW A;  1RLD A;  4CT9 A;  4CO0 A;  1SUQ A;  3DI6 A;  4WKY A;  4HH1 A;  3B6B A;  3H2U B;  2G4B A;  4OZ3 A;  3MTJ A;  3M32 A;  5L1I A;  7AT1 B;  2C2N A;  1PAU B;  2QL9 B;  5K5M A;  2W4P A;  4R0E A;  1DLO B;  2H3E B;  2MZS A;  1ZH5 A;  2Y1R I;  3VAG A;  1EP4 B;  3IN5 A;  4DUZ J;  4LF5 J;  5EGY A;  1HLW A;  4JI7 J;  2Z2Z A;  3CUN A;  3GJT B;  4EGL A;  1FRL A;  5I3P A;  4PUO B;  5E33 A;  4J37 A;  2YNI A;  3CCL S;  1X5O A;  5LM7 E;  4HHH A;  1RT6 A;  3HPO A;  3CCS S;  2A0F B;  4FNH A;  1KKH A;  3MM6 B;  1T9V A;  1UZD A;  2E1M C;  4EBD A;  1RBO B;  3FNN A;  4CLZ A;  2RRB A;  1IKY A;  3J7Z 5;  3D6T B;  3CIM A;  4G1Q A;  3P6Y C;  2LEC A;  2VUG A;  4OX7 A;  2V2V A;  4I1T A;  5D3G B;  2EKN A;  1MWZ A;  2Y0S D;  1P1T A;  4HR2 A;  4Y28 C;  2KM8 C;  4RW8 B;  1XK8 A;  2F7V A;  2FD2 A;  3CXC R;  5CYQ A;  3HKZ D;  1S6U A;  3I32 A;  2LA6 A;  1EAY C;  2DEJ A;  1JIH A;  2YBV A;  5GMK a;  3WC0 A;  2F4F A;  4G65 A;  3L7O A;  3G9C A;  2BQU A;  4TQS A;  1MRO A;  3IS9 B;  2X7I A;  1OWX A;  5HMW A;  2J7W A;  2VDI A;  2M70 A;  5KFQ A;  2VFS A;  3KLF B;  3WZ0 A;  3D9B A;  1RUS A;  3LAN A;  4DSI A;  5I42 B;  3S6E A;  4DPW A;  3VZH A;  4B3M J;  3TX0 A;  1U1R A;  1TQL A;  3K17 A;  2UVR A;  2LXF A;  4ELT A;  1VJW A;  2MGZ A;  2L48 A;  4NCA A;  4CO1 A;  5HLF A;  2YY3 A;  1W25 A;  4DCP B;  3NWR A;  2ZEJ A;  1FE0 A;  1U48 A;  2B56 A;  3FQL A;  4MYU A;  4IFY B;  5HBM B;  1T05 A;  1VJQ A;  3G86 A;  2GO8 A;  5T41 A;  3ICL A;  4CLW A;  3K5M A;  2RHS B;  1HNZ F;  1RT7 A;  2QA4 G;  1S9F A;  3BBC A;  4DLE A;  3NMR A;  4RJV A;  4IDK B;  1TP7 A;  2VG6 B;  4A8F A;  3SDE A;  1U45 A;  3C8Y A;  1HIY A;  3VAJ A;  3AQP A;  3HHL A;  5IQ6 A;  5AE1 A;  4OLP A;  3DNC A;  1P27 B;  1FA0 A;  3BS9 A;  3Q24 A;  5GME A;  1A7G E;  3UDL A;  2MLX A;  1X4C A;  3DLB A;  2YTC A;  1S99 A;  3IR6 B;  1BWV A;  4DV7 J;  1VS3 A;  4C8Z A;  1IBK J;  4LF8 F;  3KLG B;  4X65 F;  2QMX A;  5HI7 A;  2KVQ E;  4NLS A;  2HRU A;  4ZOS A;  3HT0 A;  4NLP A;  3Q8Y A;  1N6Q A;  2LXI A;  4ZN1 A;  1Q1K A;  2J6T A;  1JLQ A;  2D9O A;  1OPI A;  3R5G A;  1YIT S;  1I94 J;  4NYZ A;  2XMW A;  3L09 A;  2HWI A;  2VPX B;  3C6U B;  3EXY A;  5IFM A;  4X4N A;  2OI2 A;  2GCF A;  2VIH A;  4KFB A;  2CQB A;  3A13 A;  3MEC B;  4KSE B;  2X1G A;  2N3L A;  3DI6 B;  2WSF C;  3MD1 A;  4IKA A;  4IO1 A;  2QA2 A;  5KT3 A;  3R1L A;  4KH0 B;  5IWA F;  2ROG A;  3OFE A;  3M32 B;  1H0H B;  5DDO C;  2PO4 A;  1NBE B;  4ZHR A;  1FRX A;  3THV A;  3QLH A;  4M5N A;  4A8M P;  4RW4 A;  1EET A;  5L1J A;  1RB0 A;  3EZ5 A;  2HFU A;  3KHL A;  2ERR A;  4IRK A;  2KM8 B;  4U95 A;  4IOB A;  1GXT A;  4JI6 F;  1FXR A;  1N32 F;  2WVC A;  1WEX A;  1SBR A;  3OL6 A;  2YNI B;  1OY8 A;  3CCM S;  1JXL A;  1RT6 B;  3I82 A;  1RK8 A;  3CWJ A;  3G8Q A;  2J9C A;  2CJB A;  1XQI A;  4OX9 J;  3DXS X;  1RTJ A;  1SL1 A;  2HBZ B;  1R89 A;  3CDB A;  1K8A T;  1HPZ A;  3R5D A;  5F0W A;  3BGR A;  4DV6 J;  1IKY B;  1UW9 A;  3W3S A;  3M2U A;  1HMV A;  2YWF A;  4Y2M A;  1D9D A;  4G1Q B;  1VRU B;  1A9N B;  3R5C A;  4ANE A;  1VBZ A;  2ABY A;  2O3D A;  1N34 J;  1JJ4 A;  4URS A;  2IFX A;  1ZA1 B;  2RHQ B;  2D69 A;  3UNG C;  3R27 A;  5CYQ B;  2PN6 A;  2HW3 A;  1TAU A;  4AL5 A;  1SKU B;  1GMW A;  1WEY A;  3FUY A;  4V19 J;  4X4T A;  3FKB A;  1XC9 A;  4M63 A;  5ETV A;  2WBM A;  4WJB A;  2DPI A;  4HL9 A;  2YPZ A;  4K5S A;  1SXL A;  3CME S;  3W2W A;  1WTB A;  1LFP A;  2GHP A;  3BSA A;  3UVJ A;  3TOQ A;  1RI7 A;  2F8H A;  2QV6 A;  4DV5 J;  2ZZT A;  2KTQ A;  2CJA A;  4JI1 J;  3GP9 A;  2COL A;  4NLY A;  2OEL A;  2L08 A;  2HQI A;  3H8Y A;  4DS4 A;  5FII A;  3SIP B;  3M2R A;  4O3R A;  2WW8 A;  2KYZ A;  2C2Z B;  1MSW D;  4PAB A;  4PG4 A;  2KG0 A;  4FYV B;  2R7S A;  1LOU A;  5J1E B;  1VQ6 S;  2CIM A;  4I69 A;  3OR1 A;  2HGN A;  1PYT A;  4DX5 A;  4NLR A;  1K0V A;  2DXF A;  2M8D B;  3LP1 A;  4ED6 A;  1PKU A;  1HNV A;  2NUH A;  2OH2 A;  5D0R A;  4W92 B;  4EO8 A;  1LWC A;  1F9E B;  3KTQ A;  3K89 A;  3SDE B;  2C42 A;  3GYG A;  1U8S A;  3L9Z A;  5DRK A;  4Y2I A;  5CYM A;  4YDX A;  2FVS A;  4FXW A;  3MM8 A;  1EHW A;  1WG4 A;  2CDR B;  4LRA A;  2VFT A;  1ULR A;  1IKV A;  4M5H A;  3UN5 A;  3EVW A;  2R7O A;  1IKW B;  2B43 A;  1NDK A;  3VAM A;  4NCG A;  1IM6 A;  2BQR A;  1QAI A;  3G96 A;  3JB9 k;  3MPW A;  3KWM A;  4U8V A;  1JWW A;  2EFO A;  1CJV B;  5KFF A;  5KFG A;  1N6Q B;  1HQE A;  1TTH B;  2DJW A;  1HW8 A;  4NLO A;  2BJ8 A;  4NEZ A;  4RW7 A;  2RML A;  2KRR A;  1YLX A;  3TJ9 A;  2N4C A;  2F4V F;  1NJZ A;  4L75 A;  2VHG A;  1C0U B;  2ZZM A;  5B0B A;  4A4J A;  4LFC J;  1WEL A;  1CC8 A;  4F0H A;  4X66 J;  1DBD A;  1Q53 A;  4XPE A;  4Q45 A;  2WZ1 A;  3PYF A;  1OQ3 A;  3E01 B;  5LMN F;  2XM3 A;  4ZHR B;  3QLH B;  1TUV A;  2P2C B;  1EET B;  4USW A;  1X9S A;  4RBV A;  2KL8 A;  3HCX A;  3OQ2 A;  3K5N A;  4CNZ A;  3M9M B;  3KUG A;  3Q22 A;  2HRY A;  3UCU P;  4IQX A;  4KT0 C;  3P3D A;  4QYZ K;  5DGB A;  4RKU C;  2MQO A;  2HWT A;  2EBE A;  1OY6 A;  1RAA B;  5J2N B;  2FZC B;  2GZO A;  1KSP A;  1X4B A;  2QLF B;  3SMZ A;  3QGH A;  3C66 A;  2HFN A;  4CLF A;  2DT9 A;  4L74 A;  4O0I A;  1WTF A;  2NSC A;  1WKJ A;  5CZV A;  1HMV B;  1M5K C;  4KRW A;  2P9E A;  2Q43 A;  5LT5 A;  3GFY A;  3CDE A;  1CLF A;  2R7W A;  2CJY B;  4DUY F;  5DLG A;  5HO4 A;  2YNG A;  1UJ5 A;  1BQN B;  2ZBI A;  2CQ0 A;  4IR1 A;  4C6A A;  3GV5 B;  3MDF A;  1HNI A;  1T95 A;  4LR7 A;  2ZH3 A;  1W7W A;  4YME A;  4YR0 A;  2JZ5 A;  1CC7 A;  2XMU A;  1W26 A;  5ETK A;  1PIE A;  3W9J A;  4AFF A;  1IR0 A;  2FJV A;  5H9F J;  1S5Z A;  2P8I A;  4NLT A;  3G8S A;  1RAJ A;  1FKA F;  2MKS A;  3O2I A;  4I0W A;  1VI7 A;  1MW7 A;  1DY3 A;  2IJN A;  2E9T A;  2HFO A;  5JXS A;  5E5N A;  3T6B A;  3I87 A;  4OZ0 A;  1IXK A;  1KVI A;  3GE9 A;  1TK8 A;  1HBO A;  4WP8 A;  4A8O A;  4BDP A;  4ES3 A;  4V19 X;  2D1C A;  5K8P A;  2QIF A;  2MQM A;  3Q8P B;  2RB7 A;  2FDN A;  4JI3 J;  1TVR B;  4P2X A;  4B3T F;  4OJG A;  3OUY A;  4A8X A;  4ES2 A;  4ED5 A;  2DRA A;  1TL7 A;  3CE8 A;  3BH6 B;  4P74 A;  2YNH A;  1L5U A;  2MZR A;  3J7Z T;  3DOL A;  3OR1 B;  3ZZY A;  2VC0 A;  2RNE A;  2BYC A;  3LP1 B;  2FPH X;  4U6P A;  1LWC B;  3I0S A;  4JUZ A;  4EYI B;  1PC4 A;  1FJ7 A;  4OI3 A;  5CYM B;  4F3M A;  4EK2 A;  2LMI A;  2GVZ A;  3ITH A;  4EZ6 A;  3JS9 A;  3BPS P;  3MM8 B;  4RLE A;  1S0O A;  1IKV B;  4ZVU B;  4I68 A;  4ZJO A;  2ZIT A;  4A48 A;  4P2F A;  1FE4 A;  2YKN A;  2JC1 A;  4PPZ A;  2C2O B;  2BAN A;  3FDS A;  2ZOF A;  1GAO A;  3OL7 A;  2MKC A;  1KC8 T;  3DLK B;  4XTT A;  4QYR A;  4LF2 A;  4NLD A;  2Z56 B;  1BXN A;  2V6A A;  3M8Q A;  2V5H G;  3MI7 X;  3KHR A;  3D3B J;  4ZN3 A;  1QLN A;  1N5Q A;  4QW8 A;  1TKX A;  3HX9 A;  2OEK A;  3PZP A;  1KRP A;  2PI5 A;  2HHW A;  3M8S A;  2K1R B;  1WEZ A;  5IQQ A;  1UFW A;  2B7B B;  2AV5 A;  2HMI A;  2DCL A;  4K4V A;  2E5H A;  3AAW B;  1SC4 B;  3QFW A;  2UVU A;  2H51 B;  4QU7 A;  1EQ0 A;  3RR8 A;  3N01 A;  4IG3 A;  2W7A A;  3KHG A;  3CCR S;  3SCI E;  2HVI A;  5FDL A;  2BA9 A;  2AHO B;  1NB2 A;  1LQ9 A;  3RBD A;  2LCW A; 
#chains in the Genus database with same CATH homology
 4DR7 J;  5A2Q U;  2KL8 A;  4V1A k;  4DV5 J;  2E5L J;  4LF7 J;  3J7A N;  5LMN J;  2VQF J;  4JI8 J;  2UXD J;  4JI1 J;  1J5E J;  4GKJ J;  4JYA J;  4B3R J;  1N33 J;  4GKK J;  4OX9 J;  4YY3 J;  4LF9 J;  4PWW A;  4KY3 A;  4DR1 J;  1IBM J;  4JI6 J;  2VQE J;  4JV5 J;  5LMU J;  3IMQ J;  1XNQ J;  1I94 J;  4YHH J;  4LF8 J;  1N32 J;  4X65 J;  4X62 J;  4X64 J;  1XNR J;  1XMO J;  4DV0 J;  4DV6 J;  4NEZ A;  4LFB J;  4K0K J;  4B3S J;  2MQ8 A;  3R2C J;  4DV1 J;  4DR4 J;  4LF4 J;  4LF6 J;  4DR2 J;  2MTL A;  3T1H J;  1HR0 J;  4NXN J;  4RJV A;  2UXC J;  5BR8 J;  4KYZ A;  1N34 J;  5FLX U;  1IBL J;  4JI3 J;  2UUC J;  3J81 U;  3OTO J;  3D3B J;  3J80 U;  1HNW J;  4JI2 J;  3W1Y C;  5IWA J;  4LFC J;  3JAM U;  4NEY A;  2UUA J;  4JI4 J;  2UXB J;  4DR6 J;  4DV4 J;  4X66 J;  1HNZ J;  2HHH J;  3D3C J;  4DUZ J;  4LF5 J;  2F4V J;  4HHU A;  4JI7 J;  3R2D J;  4LFA J;  2MEW A;  2UU9 J;  4DR3 J;  4DV2 J;  4B3T J;  4KHP J;  4DV7 J;  1FJG J;  1N36 J;  5LM7 E;  1XMQ J;  4AQY J;  4B3M J;  4JI5 J;  1IBK J;  4DR5 J;  4DUY J;  2ZM6 J;  4DV3 J;  5IT9 U;  2KVQ E;  4JI0 J;  3T1Y J;  4NXM J;  1HNX J;  5AJ3 J;  2UUB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...