4AQYJ

Structure of ribosome-apramycin complexes
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4aqyJ00
5AJ3J 4PWWA 1IBLJ 4K0KJ 2VQFJ 1XMOJ 4DV3J 4DV7J 4DR5J 4JI0J 1XNQJ 2UXCJ 4LF8J 4X62J 4DR3J 4B3SJ 4V1Ak 4LF5J 4X64J 4KY3A 5FLXU 4GKJJ 1J5EJ 3J81U 4OX9J 4JYAJ 2UXBJ 4AQYJ 4DV6J 4LF6J 4DV4J 4GKKJ 2MEWA 4DV2J 2ZM6J 5LM7E 5LMUJ 4JI4J 1IBKJ 3JAMU 2KL8A 4HHUA 2UXDJ 4X65J 2UUBJ 3OTOJ 4KHPJ 2UUAJ 1IBMJ 4DV1J 4DR2J 4RJVA 4KYZA 1N32J 4DV5J 1XMQJ 1I94J 1HNWJ 4JV5J 2MTLA 2F4VJ 5BR8J 4LF7J 4LF9J 4JI1J 3D3BJ 1N36J 4JI7J 3R2DJ 5IT9U 4B3RJ 4DR4J 4DV0J 3J80U 4LFBJ 4YY3J 4JI6J 1N33J 4B3MJ 1XNRJ 4NEYA 3T1HJ 4LFAJ 5IWAJ 3W1YC 5LMNJ 4DR1J 1HR0J 2UUCJ 4JI8J 3J7AN 4DR6J 3R2CJ 1HNXJ 3D3CJ 4DUZJ 2VQEJ 4X66J 4JI2J 1FJGJ 1HNZJ 2HHHJ 4NXNJ 4JI3J 4NEZA 2E5LJ 2UU9J 4JI5J 3IMQJ 4YHHJ 5A2QU 1N34J 4DUYJ 4B3TJ 3T1YJ 4LFCJ 4LF4J 4NXMJ 2KVQE 4DR7J 2MQ8A
chains in the Genus database with same CATH superfamily
3WHIA 5AJ3J 3NEKA 3M8WA 3DXSX 4B9UA 2OGUA 4B08A 2XULA 4IQXA 4PUOA 4RBVA 1HFEL 3CDAA 1VOMA 4DR5J 4Y2IA 3IR7B 1ZTWA 1SH0A 2R8HA 5HQLA 1WF1A 4FF2A 1IKYB 2CFXA 2JRSA 4QPTA 4TYAA 1R8HA 4N76A 1MMLA 3CJRA 4DR3J 3OHBA 3MI7X 2XO7A 3FBCA 3ZZZA 4LF5J 5HI7A 4OZ1A 3PJXA 3T9ZA 4ES3A 2F7VA 4USVA 1CBKA 2H48B 4ECQA 4GKJF 4GKJJ 2RS8A 3HPOA 3IRWP 5J2QB 2JOQA 5E3AA 2D9OA 5IT4A 2G0JA 3DLEA 3C2PA 3N79A 3I0RB 2ZNYA 2UUAF 2UXBJ 3KYLA 5EWEA 5A8WA 3VAIA 2X3GA 5H9FJ 4K4WA 2Y9HA 1L3KA 3SV4A 3M32B 1XR6A 2G1DA 1S9EB 2C3YA 2Z58B 4XAKA 5F3TA 3P5BP 2ALZA 1NB7A 2IIHA 1IBKF 4E0DA 3UDVA 5HBMA 4K59A 5KT4A 3TUPA 3HJFA 1TUGB 4ZN1A 1VBZA 2VFRA 3QT6A 2MKYA 3UR0A 4YUDA 3MUTP 3F0NA 4DX8H 3FKBA 4DV1J 4LVNP 2W8KA 1QSLA 3C14A 1KTVA 4IH5A 2JFKA 1RTIB 4O4RA 3CVKA 2Y1IA 4DPXA 4NLPA 3DDKA 5D0HA 1RT1A 3VV2B 4C2MA 4NYPA 1JB0C 3I96A 4LRDA 3M8ZA 4W92B 2B4VA 3CJ5A 1JMTA 3HSJA 2Y8WA 4L72B 1WEYA 4LRFA 3PX4A 1N5YA 3R5DA 3TWZA 2KXNB 2HFZA 1KRPA 1T03B 3IBCB 2QRRA 3W8GA 5A8RB 4MKAA 5BR8J 2FYXA 4DG1B 2UVUA 3GMGA 1ZETA 4KO0A 2J6SA 1PC5A 4DN0A 5IXUA 2IA6A 4P2MA 1J5OB 2FY8A 3QZ8A 1U1NA 1M5VC 2XLKA 3PKYA 3FRYA 1RT2A 4DR4J 4G3IA 1I5OB 3QFHA 2WSFC 5DO2A 3QSYB 4U95A 3RRKA 4Q2MA 1U49A 5A0YB 4QU6A 1D9FA 4HI2A 4WJBA 3BN7A 1FNMA 3OL8A 3CCJS 3I87A 4KE5A 4RZRA 2C2EA 4ZK7M 2HQDA 1VQ6S 1U1PA 1G2EA 3L95X 1CJVA 1N33F 5DQIA 3LA0A 4LFCF 1ZOTA 3WBZA 5IV3A 5GAHI 4NXNF 5C24A 3QJLA 4OJHA 4M5HA 3A3OB 4Y2MA 1X5PA 4LFAJ 1VDHA 3TVKA 1T03A 2E9RX 1NXIA 1PJ6A 1UVMA 2KU7A 2AT1B 1RZMA 1WSRA 2C3OA 3HDSA 2F63A 2HLTA 3NGUA 2NXJA 3LPYA 9RUBA 4U67Q 4DPTA 4RW6B 4TKTA 1K0TA 2CJXB 4NLOA 5A0YA 4DPWA 3RGIA 3RTVA 3NY0A 3OFFA 4JI2J 4DUTA 3QRPA 4Q0BA 3ZZRA 1BGXT 3CJTA 4NLWA 1H74A 5DQHA 1Y0HA 2R8JA 2IAJB 3CO0P 3VF0B 2MQOA 1UKUA 4KAIA 1S1TA 2I5JB 2UU9J 4JI5J 4DL2A 5IV4A 2BE2A 2P6SA 3PR5B 4K4UA 3GYXB 2CNKB 3MMJA 1CQNA 4DUYJ 1RAAB 3ENAA 1VIXA 4PG6A 3MEGB 5KG7A 3MM6A 3GJSB 4LFAF 3MEKA 2YNHA 1UJ5A 2V50A 1LOUA 7AT1B 4QW9A 3EMTA 1Z1ZA 3D68A 1FRHA 3PFOA 1MWQA 1TL1B 1VCTA 5GAGU 1B7FA 1KC8T 1S1XB 2XC9A 2BJDA 1SBRA 3I32A 1U1QA 1DTTA 3FBBA 4ZOSA 3LP2A 5BJRA 4U7UD 2V67A 1WG1A 2HK3A 4OZNA 3N01A 2ZH7A 1RK8A 2M52A 4M5DA 2DY9A 4UOHA 4PG7A 1WKLA 2D69A 1NLKL 1GXTA 1S6OA 3HHKA 5HBMB 3NGRA 2HQGA 4MIBA 4N41A 3AJ1A 2DEIA 1RADB 3NP5A 1WI6A 3QFWA 3R27A 4KGKA 4QZVB 2RH3A 2KG0A 1PO6A 4I7FA 5ETPA 1YX2A 1RBOB 2FC8A 2POKA 2O01C 2D3UA 1HLWA 2IC3B 3G8TA 4DN9A 5KFGA 3P45B 5D4OA 4O3OA 2V8VA 3A3PB 2NLWA 2E5IA 4QYZJ 3SQGA 4PWDB 2CZ9A 3SFGA 4JV1A 1QVFR 2AEJA 3M2VA 1LW2B 3W63A 2HQCA 2UV8A 1VI7A 3CEDA 3S01A 2XGPA 2CQIA 2DITA 2OPQB 1VFJA 3LGNA 4A8OA 5I3QA 2E5LF 4FF1A 1WC1A 2QFIA 2MSTA 3FMWA 4JI7F 1DAXA 1V3ZA 2CPXA 2DHSA 2C2ZB 1SQFA 3L7PA 4H4OB 4F0MA 1R8AA 1S0NA 1U24A 4C9DA 1FWKA 3H2UB 2ROGA 2IBKA 4O3NA 3LQVA 4M1KA 3NCRA 4KBIA 4QJVA 5E0OA 3TOQA 1FKOB 2R8IA 1HBNA 1SJ4P 4WTOB 4CH0S 1LNQA 1D09B 4O3PA 2YX7A 3SDEB 1XMQJ 2FZKB 4EYHB 2L3MA 3EUNA 2AYBA 5EUHA 2CPFA 2MZ1A 4OYOA 1ZBTA 2NS1B 4QQBA 2A6OA 3V6JA 1TL4A 2CWXA 2W7AA 3FDSA 3BSOA 4LF9J 4Q0BB 1HQEA 2DB1A 4LF1A 1VQ4S 2CQBA 3NS7B 2MXYA 2SXLA 1VR6A 3H20A 3FCVA 2VFUA 1TL5A 4HDGA 4NYOA 1JLFB 3KK1B 1H0HB 1T9TA 2M4MA 4U7UK 5KT5A 1RA7A 2FZCB 4DOZA 5I3UA 3DC2A 3ZNJ1 1R0AA 3IS9B 3CWJA 5C24B 3RB6A 2NREA 3EXYA 3NCPA 4U7CA 2OH2A 1GQEA 1VHFA 3DFEA 3DHWC 4NRTA 4A8KA 3IR6B 8AT1B 2ASJA 1CPZA 4URQU 3H5UA 2AJQA 2NSBA 2QC3A 2OPPA 3VGUA 4QBUA 5KFNA 1XK8A 2R2UA 3DYAA 3HFVA 4J9SA 4OZ2A 1UZDA 3EX7B 4RNFA 4A8QA 1UJ6A 1UL3A 3TQEA 1YZ6A 4NXMF 4HTIA 1X9MA 1Q7YT 2HVHA 2DNRA 3NGTA 1HNXF 1HNXJ 2VA2A 2V8GA 5HSPA 1HYSA 4M5IA 5KT3A 1ZM4A 3SSRA 5KFRA 2C3UA 4CIOA 4K4YA 5ADZA 1Q5VA 4DCOB 4DFKA 3OJSA 3ZZOA 2DGWA 3QYYA 1KVKA 1TKDA 4U8YA 2WCXA 1VYAA 1IKXA 2VG5B 3NCQA 1N0VC 1R6YA 1LEOA 1TUWA 2FLOA 5KFTA 3ZC4A 2EG2A 2LA6A 3ADAC 4RW7B 4DL0C 3CMAS 3DI6A 1PIEA 4WK3A 5IM0A 2B9EA 3CD7A 4OYWA 4KKOA 4B9NA 5CYQB 4ZPVR 2VPYB 3F44A 4WK1A 3WX4A 3HM9A 3M2RA 1SJ3P 1T3OA 1TAQA 2N3LA 3GYGA 3C15B 3H4BA 2B6AB 2ZE2B 2B0GA 2H3EB 1SQEA 2DXFA 2VBZA 1FK9B 3CJ8A 3IRXB 4IOBA 1IBLJ 3AJ2A 3VR1A 3KTQA 3CD0A 1Q86T 1MU2A 1M90T 1V5VA 2E1PA 1NBEB 3FCHA 4KV8B 4C11B 4EK2A 2HHXA 5C2GA 1R3NA 5HL7Q 1WHVA 4Y34A 2CDRB 1DFDA 2BZ2A 2MJNA 4YY3F 1E6VB 2DH7A 4NLSA 4CT9A 3ETOA 3OR2B 1IR0A 1XMQF 4V1Ak 1UETA 2XYPB 5K14B 3CTRA 3IG1A 3GP9A 4M5KA 1RHUB 2JEGA 3H5YA 3QGIA 4KY3A 5FLXU 4WE1B 4J9MA 4TQRA 2KT5A 3CW2C 1M5OC 4ILRA 4ICLB 3QWUA 4YB6A 4Z2XA 4A8SA 4B9VA 1RTHA 5KG1A 4TNOA 1DLOA 3CD5A 5LJ5Y 2CNNB 2XO6A 2E1AA 4C97A 1TK8A 2M8DB 2CQ4A 2VG6A 2LP4A 2YWKA 1OPZA 3C16A 3R3TA 3EGNA 2K3KA 4KGVB 4OYPA 5E3RA 4UZBA 3RBEA 4ELTA 2HQFA 2LYVA 3GIRA 3H40A 3VGVA 3O5TB 2GC8A 3WIVA 4O0IA 2GO9A 4DQQA 3O2IA 4ZJQA 1NJYA 3POTA 2PC6A 4MK8A 4USHA 5HMYA 4ZVEA 4DL6A 4WKRA 1S4EA 2KTQA 3VZIA 2ZWPA 2WONB 2XSJA 4ENOA 4J9RA 3T5HA 4B3MF 1WNEA 3BM7A 5G4DA 2E44A 1U2FA 1Y7PA 3CCWA 3BPDA 4TLRA 2KI2A 1R31A 4JI2F 2BVZA 1I94J 4CCHA 4IRKA 1EARA 3CSKA 1HNWJ 2MTLA 3A1YG 2ATLA 4MK9A 5IC6B 2VOOA 2KO1A 3RZAA 4MKYA 4X84A 2RF2A 2D3ZA 3KK3A 4MFBB 1ZS6A 4J9LA 3FC9A 2Y8YA 2FHJD 3WC2A 1ZAWA 2Y3YA 1UP1A 2PT0A 3LWMA 1JJ2R 4KTQA 7FD1A 1U2RA 1VQYA 1HYSB 1X60A 1P9QC 3J7ZT 3KK2A 2ASLA 4DSEA 2CA9A 4J9UE 3JQJA 3I0SB 4NCGB 2NZCA 3D1OA 1BUXA 4GVBB 4Q2LA 4ZVSB 1D1UA 5DJBA 2HZCA 1JJCB 1JJ4A 4DL5A 4I2PA 2JC0A 5DLGA 2IMOA 1AYEA 1U0HA 2GAGC 2HBQB 4ZHRB 5HMZA 3M2RB 4QWCA 2R7UA 5K8NA 2YX4A 3N5FA 1RWWB 2XY6A 2BQUA 2GQQA 3POTB 2R9LA 5JXSA 4R8UA 4DSKA 2HG4A 1ACMB 3V4IA 2HHVA 3EPGA 3QO9B 4KGZB 4QIFA 3GV8B 1Q8KA 3M8QA 1N8RT 1UFLA 3BR8A 2M7SA 3VVUA 3R1HA 1WC3A 3D3CJ 1KLMA 4KGXB 1NH8A 1QM9A 4DFMA 1EAYC 2OD6A 4L3KA 3F56A 4RNOA 1VJWA 2QSFA 2YVSA 5L8RC 5KT6A 3AY0A 1BHNA 2C2MB 4WZQA 3MUMP 2KFZA 1X4EA 3D0HE 1FKAF 2QEXS 2HNZA 1SC4B 5DLFA 3PW0A 1T8EA 2ILYA 4CLYA 2N4CA 2MLXA 2DR5A 3IG1B 4NX9A 2OPQA 1Y5NB 2Q6BA 4DDFA 4RW4A 3CF5Q 4DS4A 3P49B 3M6WA 3OR2A 4ZPCA 3KXDA 4C8OA 3F41A 2C1EB 1EX8A 1P9YA 2YWWA 3O1LA 4LF2A 3DU6A 2WSCC 4IR9A 2HHSA 4LFCJ 2OPPB 4OI4A 1NU4A 3W65A 4XK8C 4H4OA 4NWBA 3CCLS 1HI0P 1KSPA 1YVFA 2A1BA 2P5VA 2YKQA 2AIRB 4LSLB 4NOHA 5HMWA 5DDOC 1JXVA 4CLZA 1KTQA 2EK6A 4M95A 3FJ2A 2BE2B 4OV1A 4ELVA 2KDOA 1DARA 1WC4A 2B56A 3NOCA 2IVMA 3AXMA 3DM2B 5D0EA 3AJDA 2DHHA 2CJQA 2XG8A 2L08A 3CCZA 3SQGB 4ES1A 2EFOA 3IC1A 4P52A 3DLJA 1HHQA 2WAQD 3DRXA 3ENWA 1R0BG 4RW7A 2XM3A 3GV5B 1JLBB 3OW2R 1ZA1B 1IJEB 3NLCA 4RW8A 5LSRA 2K1RB 2XNQA 3M6UA 1TV6B 4GO7X 3UNYA 1FJEB 2PI4A 1Q5YA 4ID8A 4OX9J 4N47A 3OFGA 5D6GA 1REVB 3KUHA 2WVCA 4MTPA 3AQOA 1X31C 4MKVA 2W4PA 2ZD1B 4M8LA 4DV2J 2C42A 4FKXA 1HMVA 3TZWA 3BQ0A 1U1MA 2R42A 2WSEC 1HBNB 4R0JA 3UDLA 4I6WA 1IBKJ 1JLEA 2BANB 1BY9A 4UY8T 4JI3F 2E7VA 3BSNA 5HANA 4XPEA 4IUFA 5J2PA 3R5AA 3OTOJ 3TW0A 4FPIA 4G6VB 1XTZA 3R7SB 5RUBA 2YY3A 4F8RA 4X4UA 2ZDPA 3UCUP 3KK2B 2VODA 1IBCB 3MPDA 3JSYA 4C0OC 4ED4A 3H5XA 2YXLA 4YR3A 3H5SA 2KJVA 4UY85 3D67A 3G6ES 2JEFA 1RWUA 1YJNS 1UA0A 3IFEA 4ZPWR 4FN5A 2HNZB 2AJFE 3HXMA 2DTJA 2VC0A 1JLFA 3NMRA 4OHXA 3W5XA 3ZNUA 1OY8A 2F4VJ 4ZITA 1FXRA 3PW2A 3C6TA 2FPHX 3TX0A 1QVGR 2ACMA 4I67A 4HYKA 1XQIA 2W2QP 3E3XA 3GYNA 3ETMA 2PEHA 4GVLA 2X1AA 2JEJA 4DUZF 2YKNA 4BS2A 1EHWA 3KUGA 3OL9A 5BYSA 4E2FB 3RB4A 2GVZB 1K8AT 2DJWA 2FJEB 2JFDA 4G1QB 2JSXA 3J80Y 4DV4F 4RL1A 2VIHA 4FXDA 3DRPA 2FD2A 1HI1A 2VPWB 4P6QA 3WC0A 3WX8A 2NYIA 3P96A 5C5JA 1JKHA 4DU7A 2RNEA 1C0UB 4WYLA 3UO0A 2PMWA 2E7WA 4KT0C 2LDYA 2A2CA 2JHEA 4YMEA 3EYZA 4ECSA 4FBTA 5L9NA 2GZOA 2UVRA 2J0SD 1S79A 3DKDA 4G65A 4GVBA 2KZMA 3MURP 4A8YA 5DDQC 1FVQA 3MM6B 4M5GA 3W2WA 5LMNJ 1B0PA 5KOXA 1YJ7A 3CB4A 3FK4A 2IDEA 4DR1J 1RTJB 1U25A 2UZAA 1U1OA 2ATCB 1R89A 2CVEA 2EG1A 4I2QA 2DVIA 5ITHA 4ZKAA 3I55S 1DRZA 2ZM6F 1VQ7S 1NDLA 2DNYA 4GMKA 3Q8PB 2IRUA 4IFVB 3PHTA 5K14A 4OYIA 3KHHA 2ZH9A 3U1LA 3G82A 4UUXA 1Q78A 5SUHA 2YQ1A 5F8GA 1N34F 2GQCA 4JYAF 1FNXH 1RWOB 1E6VA 2HVDA 3NGKA 4P75A 2ZJPQ 4OMFG 3PEJA 1GK8A 1NHKL 2EI5A 1RU2A 4YHHJ 2CG8A 1SVDA 3G6VA 4KGMA 2R7TA 1FERA 5E3QA 2CJ9A 4QIGA 4O44A 3DLGB 2P9GA 3KLEB 1RKIA 2YWEA 4WP3A 4WPAA 2HAFA 1NK7A 1RUSA 5D4NA 1KNZA 1BWEA 3MEEA 2EEYA 1KHWA 2KVQE 4DX5A 2FLPA 1QUPA 2V8PA 1FFGB 2PGCA 1PKUA 3D6FB 3DLHA 1ZZNA 4K4SA 4J90A 4WFYA 1SKSA 5KFJA 2RHQB 1LWEA 3HHEA 3TEHB 4IG3A 1JJHA 2NUUG 2JVOA 2RIJA 2XEXA 3A8KA 2R7QA 2CQPA 3S6EA 3G6XA 4KFBA 4USIA 3W2VA 5G0RA 5EWFA 5GAHU 1YJ9S 2W7PA 3ISZA 4F4XA 1N5YB 4F0KA 1BWVA 2BW7A 3CCRS 2AYGA 2LQ5A 3OUYB 1N5QA 5IC4B 3G86A 2G0IA 4AQYF 4B3SF 3EGZA 2VU5A 4LIWA 1CULB 1EKRA 1WDTA 4P74A 5E2QA 3SXLA 2V63A 2ZNZA 4L3NA 3W66A 4ZLLA 4XPCA 4X64J 5F8LA 2FJXA 1QD1A 3BGFA 1L3UA 2DGOA 3OBIA 3NBPA 3BN4A 2ZC4A 2HS3A 1NJXA 1PYOB 1KLNA 2B7CB 2ZFHA 4RW9A 2AJ0A 5KFWA 5L46A 3ENQA 5EDWA 3CCMS 4LFBF 2GIRA 1O0PA 2M9KA 2PFFB 3R6GB 2A6MA 1M5HA 3EXCX 1K1QA 1JWWA 4DV3F 2DH9A 1YLXA 3N28A 5M2UA 1CJKA 4QYZK 3W60A 3JSBA 4G1IA 2PDAA 1C4CA 2VFTA 3JSRA 4TYBA 2MQNA 1CQMA 1X4AA 1JNRB 1MG7A 2JWNA 3MMBA 5U47A 3V5RA 3B4MA 4EBDA 1XNRF 1FJ7A 1RYRA 1FX2A 1TKXA 3L7UA 3FSYA 4CH1A 1MW7A 1CG2A 5IQ6A 1CLFA 1NSPA 3GIKA 2AWZA 1G4CA 3FRZA 3TVYA 2ADCA 1B70B 3MAAA 2BA9A 2VUGA 2XWXA 1N56A 1IKXB 1FD8A 4K2JA 3CGIA 5B7WA 1KQKA 4UQGA 3MMAB 1GNKA 1OYDA 2VG7A 4ED7A 3U02A 5J2MA 4ZA1A 1RT3A 2Y1JA 1WELA 1TVRB 4LJMA 3K5NA 2J8AA 2ZBQA 5A8KA 1P1LA 2HIYA 2YBVA 1V5IB 2BV3A 3R8YA 2LU1A 3MPUB 4WTYA 4E8UA 5HROA 2VZ9A 2NXNA 4V19X 4CZCA 1H3DA 4UT4A 4DV0J 4DR1F 2JC1A 3VGSA 3IO1A 2YKAA 2VG7B 3GPAA 5HK4A 1TFWA 2MZRA 1XBWA 2QA1A 3MM5A 4ZIWA 2DR6A 1NSQA 2OAUA 4L76A 2VHGA 2IBOA 2HS0A 2B4UA 2UU9F 4OZ5A 4B3MJ 3SI8A 2UVVA 3TJAA 2AJ2A 1FCAA 4YQWA 3GSIA 4I68A 1HBMB 3QJJA 2DGVA 4J7CA 5CZVA 2EKYA 2PIIA 3HD2A 1UCNA 3D6TB 2BJ1A 1DZ5A 2N7CA 3BQ1A 2WOMA 1YDLA 3PRDA 4A46A 2KYZA 3MM7B 5CYJA 1HNVB 3GG1A 1FDAA 1U02A 1A0OB 2FHOB 2VDIA 3VVTA 2FB0A 2X1GA 2ZH3A 3RW6A 2HNDB 3AODA 1Q4RA 3DM2A 3B4DA 5D0RA 2RRBA 4H4KA 2EXUA 3W9IA 1SL1A 4USJC 1VC6A 4OI2A 2FVQA 4W98A 4BBYA 1UW9A 5F0UA 4PPDA 1WTBA 4LT6A 3HVRA 3DN9A 1U8SA 1S1XA 4IOCQ 4LRCA 3RAQA 1RBLA 4NLVA 4C8NA 4CNZA 4WCEQ 2B51A 1YRUA 4NYZA 2ASDA 4IG0A 1I1GA 2JJ4D 3HHLB 2QX0A 2HMIB 4M5LA 4RNHA 1D0EA 2Z56B 5AJ3F 1YJWS 2B9WA 2QA4S 1T02A 3HMJG 3DRSA 3I9V9 3SCIE 5J2MB 4LF8F 4LF8J 2KHDA 3GFYA 2W2PP 1F5AA 3K8WA 3Q22A 1D9DA 2VBXA 4PYAA 1URNA 2HQ3A 2M88A 4H4MA 2DGXA 4ED5A 2IC3A 2RD5C 4DR3F 5KFYA 4OYBA 5ETVA 1VRTA 4X4NA 1EJ7L 1FNOA 4TLQA 3UN5A 2QFJA 4Z37A 2DNHA 1OPIA 1PJ5A 4OYXA 4O44B 1LWCA 4QR0A 1KEKA 1PYTA 2P9CA 3HHLC 1GX6A 3Q24A 2VV5A 3MR2A 2MEWA 2Z0GA 3LUYA 4DQIA 3ILOA 2E1CA 2WVEA 3D0GE 3MD1A 4HKQA 3B8HA 4K2XA 2Z2YB 2X7IA 3MTJA 4ZHRA 1UVNA 3PW5A 3HK2A 4GKKF 3MECB 2GCFA 3BGRA 3THTA 4KPYA 1NK8A 5EN1A 4HH0A 4MIAA 2UUAJ 5J1EA 2Z30B 5HVFA 3A4TA 4WWSA 5B0CA 1LXJA 3N6MA 3GIIA 2VQEF 3E2EA 1FTCA 3L9ZA 4NE9C 5DGAA 1QAJA 2YNHB 3ELHA 4OX6A 4AFFA 1HBOA 3JTPA 2YX1A 5C7PA 3BQ2A 1FE0A 2U2FA 3OTBA 4MMOA 5L1JA 4NLGA 3MCSA 1C0UA 2HKEA 2HFVA 3TEGA 3G9CA 2DNQA 2QLXA 4NA1A 3UCGA 3AA9A 1H38A 4JV5J 2WB4A 1FFWB 2GJ2A 5LOQA 4HH1A 2O1PA 3OFEA 5L1LA 2I0XA 2V9WA 4F3OA 4FDFA 3GJRB 2XMWA 2LQ8A 4PG5A 1ELOA 1P1TA 1Q8BA 1AZSB 3MCOA 5K9FA 1RACB 2J7WA 2W1BA 1N52B 1NO8A 1S6UA 2LXIA 4PG4A 2NR0A 2CADA 4FBUA 2IM2A 1TK0A 3HT3A 1WTFA 3J80U 4YDXA 4LFBJ 4USKA 4X62J 5EWGA 1WKJA 4F50A 1T11A 1IVZA 1FRMA 4PQUB 3OT9A 2PI5A 3T5LA 1RAIB 2BABA 1OQ3A 3KLHA 4C3KA 1UW4A 2UUCF 1Z4UA 3A8JA 1MWYA 3MFIA 9ATCB 2EBGA 1HIYA 1CSJA 1Y5LB 3W1YC 4Q45A 3MEDB 1C2PA 2B9XA 2FHKA 3HI9A 3M7VA 4L6V3 4P9SA 5KFXA 4OZLA 2HRYA 4CI0B 1UEVA 3DMJB 2GGPA 3PR4A 1VQ8S 2ZC3A 3GFZA 1FK9A 1SH2A 2L9DA 1WJ9A 4KO0B 3E01A 2IDLA 3CE8A 4P73A 4YB5A 1S0OA 2FLNA 3PKMA 1KQGB 3CT9A 3ZTSA 2X1BA 3KDOA 3PYDA 2LVWA 4DCPB 1HMVB 1VQPS 3V6DA 4XDDA 2ASYA 4K50A 3OJUA 1PSDA 1WC0A 2FJAB 3OR1A 1XR5A 2LCWA 3G87A 1IBMF 4YEAA 2EFVA 1ULRA 2VKZG 4RX6A 4ECVA 2Y0SD 3FEZA 1RA6A 4RUAA 3IRXA 1GMUA 3C6UA 1F60B 2IJNA 3L7OA 4CO3A 3PIOQ 2OO4A 1UAWA 2MMYA 3HVWA 3HP6A 1LK5A 1KN6A 4I1TA 4X4QA 2YWHA 2IRXA 1A7GE 2IYGA 2M2BA 3M30A 5F0WA 2LKZA 3TX8A 1ROFA 1AB8A 2OD4A 2O5DA 1BQMA 2CPIA 2JNJA 1F5BA 3OFHA 4NASA 3TA0A 2DK2A 4TU7A 4QWEA 2GGPB 2AU0A 2ZOMA 1X4DA 2X3DA 1TL3B 2MQQA 1QTNB 1FEHA 1NMEB 5FD1A 3CDWA 3M32A 2MGZA 3KHRA 3C6TB 1SQGA 2ZVIA 4FVMA 4EO8A 4PG8A 5KFOA 3JSMA 4Z7CA 4LUBA 5MLCV 2ZH1A 2QN6B 4HLBA 4R0EA 1RU1A 4JI8F 5J1EB 1QAXA 3DLEB 3BGRB 2OPRA 4CO1A 4C11A 1WG4A 2XMMA 3HD1A 3HKWA 4GRSA 2GAHC 1NJWA 4DSIA 2GA7A 1SV5B 2ZUGA 3ZZPA 4QW8A 3TR5A 1M0SA 3WQPA 5KG4A 4R5PB 3BSCA 1LWXA 3FVYA 3JXOA 5FJ4A 1Y4ZB 4N77A 3KLFA 2V0NA 1TL3A 3N0VA 1U4BA 4KKOB 1BMQB 3I5BA 4TXSA 1R43A 4WXWA 2ROPA 1FWPA 1TKZB 3KKFA 4M5NA 1UWAA 2HFNA 3AD8C 4ZPAA 2R7RA 4ZVRB 3H90A 3UN3A 3OTOF 2XI3A 2FJWA 1XN9A 2CJBA 3M8QB 1ITPA 2G2ZA 4JOUA 1JXLA 3LW5C 4LREA 2MKIA 1YIJS 2FGCA 2XMJA 4C0HA 4QYRA 4F4ZA 1GXLA 2OSQA 1SL2A 1JLQB 4M63A 4BHQA 4L75A 1O5JA 2ILZA 2WW8A 1FT8A 2BACA 3OXLA 4EI2A 3D0IE 3DLKA 4EWTA 4ECWA 4C6AA 1X4BA 1Y5IB 2EFQA 3R7BB 5M2RA 1JK9B 1VQ5S 1TUVA 2RHSB 2Z2MA 2ZITA 3I0SA 3LTOA 2A0FB 3OTEA 4WFAQ 1N36F 1VISA 1WHXA 4PXCA 1DJ0A 1F3FA 5DG7A 4JI7J 3IWLA 4B9TA 1SV5A 5LJ3Y 2C2NA 4FYWB 4DMZA 2PD1A 4ZLPA 3IA0A 5AT1B 4OYZA 1QUVA 1UEUA 4C8LA 4ZMMA 3SV3A 4ED1A 3KLHB 2NZ4A 3KJVB 3FQLA 4B9LA 1SI9A 3DGPB 1XMBA 1VQLS 5C42B 3MM9A 1FXDA 2VASA 5HLFA 2GV1A 2WBRA 1U6ZA 2WOMB 4FXVA 4QIVA 4CRJA 4U6PA 4OL8A 1N88A 2ZZMA 2DBBA 1VC0A 5HQ8A 1UVKA 1PG5B 2ZVSA 2UUWA 2CXEA 2D7SA 4NEYA 1MSWD 2XZTB 5KOWA 3H7HB 3ZTRA 1C1BA 2ZOFA 2YNFB 1S1VB 3G96A 1U0SA 3DRSB 1D8YA 4NZ0A 1TV6A 3PHEA 1Z2LA 2FVPA 3LP2B 1S10A 1UPMB 2K06A 2WZ1A 2WTFA 3HT0A 3MM8B 3JTOA 1NH7A 3KJVA 4ED8A 2MYFA 4B3TF 1AFJA 1FA0A 2UXBF 1S5ZA 5KFBA 4BC7A 1QSSA 3Q86A 1DTQB 5HATA 4ITSA 3TA1A 4Y28C 2QMUB 1NPKA 2DNLA 2E5LJ 3LALA 1ZAXA 4C7QA 1N54B 2QGFB 2LXUA 3FSXA 4R5PA 1U0HB 4USTA 1JLAB 1NDKA 4ECUA 1NDCA 3BO3A 1GX5A 3EZUA 3E01B 3MPVA 4LF5F 1YK9A 1Q16B 3TZZA 1PJ7A 4DV5F 1U6FA 4FNIA 3D54A 4OX8A 4ED3A 4JI5F 2EBEA 3LAKA 3PRBA 2HIQA 2KXHA 3ICLA 3ZZYA 2GNKA 4WF9Q 3HKZD 3KG1A 3MAAB 3MD3A 3BB5A 2ADBA 2UUBF 2WRMA 1V6HA 3HX9A 4NLDA 2XY7A 1SKWA 1RTDB 4FS1A 2H4WB 3J7Z5 5H9EJ 1RABB 2DGQA 4P72A 2MQLA 1C1CA 1XEZA 3VAMA 2V2ZA 1DY3A 4BWJA 1WSVA 4F67A 1OSCA 5KG5A 2IM1A 2DNZA 3MUVP 2J6UA 1DTTB 1FKPB 1QDUB 2W9CA 1TAUA 1YITS 3DGVA 4RNNA 2W7OA 2CPZA 3DI6B 5IM0B 4ZP6A 3OLAA 4YOEA 1PAEX 1YWXA 1IM4A 2RU9A 3B6BA 4M5JA 1N6QA 1HWIA 2NXUA 2HHHF 3I5AA 3GILA 2QLWA 2RUSA 4KHRA 3RBDA 4B9SA 2AX1A 4RUBA 2FJBB 3AXKA 1V9OA 1N32F 1HW9A 1FO1A 2R7WA 1RLCL 1L5UA 4IO9Q 1RBAA 1PCAA 2VF3A 1T95A 3A8EA 4K8RA 1H72C 3C16B 3IM8A 3P8BB 1G6BA 1R0AB 3GJQB 1FJGF 1CJTB 4ERDA 3GWCA 5IFMA 1O8BA 2CZ4A 3RAMA 3VQTA 1OSDA 1RISA 1IWGA 1MMNA 4RJVA 2DNMA 2Q43A 4KYZA 3AD7C 3NL0A 5I3PA 3HLUA 4C4WA 4F3QA 2AGOA 1UZHA 4K7QA 1RQ0A 4DQPA 4DF4A 2GMHA 1RAFB 1S72S 3DDIA 3CCQS 1JLGA 1N5VA 2QA4G 4O3QA 1F3VA 4JB8B 4K5RA 2F3JA 2AKWB 2OP5A 3NS6A 4DCJB 4P7TA 3PEHA 3DLBA 1L3SA 3FUYA 4DQRA 1N4LA 3BPSP 3H2LA 4ZVGA 1S76D 3SFUA 2E5JA 5E3CA 3M9NB 1SXLA 1SJQA 2KVIA 4DR4F 1ZM2A 5LMUF 2UXCF 4F04B 3SYZA 1Q1KA 4N56A 3C14B 3SIPB 4AXJA 4Y2AA 3M1VB 1U2CA 4H54A 4NA3A 3KUEA 2I6WA 5DDRC 4CLKA 3J81j 2FIUA 3MR3A 3J7YI 3Q23A 5ETLA 5HMXA 2ZBCA 5KT2A 5DGBA 5HP1A 4ZVHA 2PMHA 1N33J 2JL9A 3JAMY 3TZXA 4X4TA 1HHTP 1FHTA 4OI6A 2OFGX 5A8RA 4ZJLA 4QIEA 1CJTA 2C2KB 2XY5A 1TKTB 2CPDA 4GC7A 4LF7F 4CM0A 2BJEA 2AEMA 3DRYA 4YB1P 4EO6A 2NUHA 2FDNA 2B7BB 5GMEA 3SBMA 1TVRA 3EVWA 1HPZA 1RHKB 1RKJA 1TK5A 2R4FA 3PCOB 1KD1T 2RJZA 3GCWP 2H5IB 2R7VA 2AX0A 2GS8A 4JV2A 3MEDA 1L3TA 2CQGA 2HFUA 3OPKA 3R5GA 4AXIA 1FF2A 1S48A 3MMCA 1TMMA 4ECXA 2YKNB 4NEZA 2YWFA 3AQPA 5DETA 3MECA 1IKYA 5A2QU 2CQHA 3MM7A 1XR7A 2DRAA 2B6AA 1RT6B 4RLEA 1NUEA 1VS3A 3D66A 5D4PA 1HARA 5A8WB 2DGTA 5I42A 2Q1LA 2DEJA 2HHPA 1VQSA 5EX3A 3H4DA 1HBMA 4OV6A 3KWMA 3N6NA 1A6LA 2DIUA 4ZJOA 4U96A 1RCXB 3OLBA 4B3OB 3NGSA 3RBZA 4R25A 3W9JA 4F2RA 1RYSA 2KYXA 2MJUA 2W4DA 3K17A 3AB4B 1DHMA 3LP1A 3Q0AA 2IHR1 4X4SA 3C8YA 3HHLD 2O67A 4J9VA 1NM2A 2BXJA 3I9ZA 5CHCB 5T7LA 1ZM9A 3QWPA 4ETXA 2AGPA 2EC0A 2B8QA 1GFWB 1F0XA 1YRXA 4FS2A 3K0JA 3UR3C 4QWDA 1FEEA 2W2NP 2OI2A 2V9KA 3R1LA 2CNOB 1KFSA 5GADU 3AOBA 1JLEB 2BANA 3I6PA 2BRLA 4IQMA 4MYUA 2BR0A 3UD3P 3THPA 4DPOA 4NZ6A 3TQ1A 4I69A 1B64A 5D0GA 4ID5B 1F6TA 3I31A 4DV6J 4GKKJ 3E51A 3BS9A 1RAHB 3K5OA 3T1HJ 4UOCA 5KFMA 2R2RA 2BDPA 1S0MA 4LMZA 1Y3KA 1FKPA 2GJIA 3BH7B 4I56A 1EETA 5CYMA 1FE4A 1RT5B 1RP5A 1GAOA 4CLWA 3RYLA 3FSIA 1VMBA 4MH8A 4C3MA 2RU3A 3D5MA 2HNYA 2J6TA 1C1CB 1AROP 4LVOP 2CQ0A 3SEOA 3O6QA 3DLGA 5F8JA 2DH8A 4ZVTB 5KFVA 4YR2A 1H7XA 1WDDA 3NGDA 1HNVA 3CXCR 3N6LA 4FYVB 4N5SA 4URSA 2G9OA 3FGVA 3PO5A 1SC3B 3GB0A 1Q8IA 2YH0A 3M6XA 5K8PA 5DG8A 2KH9A 2OHDA 1WEXA 2XMVA 1BLUA 5AXMA 3QZ7A 5IT9Y 2ZH2A 1KQSR 1K73T 1IKWA 3OV7A 2CWKA 4J9NA 3UNGC 4UOGA 2AZ3A 4B3RF 2HGNA 3GR1A 3FEYB 2FVCA 3OD2A 4M5DB 5JVGQ 3GFHA 3D3BJ 4FP9A 3OTDA 3V81B 1IUJA 1JLAA 1N36J 1TELA 6FD1A 1S6PA 3H0PA 3JYTB 1VC5A 2RB7A 3HF5A 4CM2A 3KMQA 3NNCA 3LAMA 3QRRA 4BWMA 3CCSS 3DXBA 2HMIA 1IKWB 4NMLA 2EKNA 3D2WA 3CIZA 4Y00A 1YHQS 4NLTA 1SJFA 2QTWA 1RWKB 4GO5X 4OYMA 3UQSA 5KFKA 3LH2S 5ETRA 2XCPA 1F1BB 1NSKL 2VBYA 1R27B 3DOKA 3PV8A 1HQUA 1HQ2A 1QE1B 2CPYA 2MKJA 2OLWA 3P4UB 4Y65A 5GMDA 4LRBA 2ZJRQ 5J2NA 1U45A 4G1PA 3TZYA 2QL7B 2IM3A 5A6PA 5HQMA 1BE4A 4WFXA 4ER8A 2KRBA 3MF5A 3W61A 3EGVA 4LR8A 1S6QA 2CIMA 1HBUA 1S59A 1MNEA 3BKFA 3QT5A 3W7BA 3BBBA 3HVTB 3M1VA 2E1MC 5F8HA 3HHNB 5KFQA 4LSLA 3SZ2A 2YNGA 4I7FB 5LT5A 1FRIA 4UW2A 4DXLA 5B0DA 3PX6A 4PQAA 1U6BA 2KHCA 2DKOB 2B5JA 4F4YA 3CJ3A 3GU0A 3TA2A 4N8NA 2QSWA 2CPEA 3EWGA 3O8WA 3Q8SB 3CMQA 2BKOA 3CCTA 1RT7B 4Q44A 2KM8B 2AHOB 1BQXA 4KRWA 5ETQA 3BDEA 3VTIA 4DS5A 3PW7A 4ZCMA 2APOA 2H5JB 1GMWD 2JDJA 2DYAA 3ET6B 1GT8A 1Y10A 2OPRB 3WZ0A 4LSZB 4HACA 3IN5A 1RTJA 2HK2A 7FDRA 4LSNA 5K8OA 1CEZA 4JP8A 1JX4A 3BH6B 2KT3A 5E7OB 2MGZB 3NRBA 3EPIA 3DLKB 1RWNB 4PWWA 4NCAA 5GMKa 1KLMB 3W62A 1F9EB 3KG4A 3BO2A 2DNKA 3B78A 4I6YA 1TZ0A 3VAHA 3T1HF 1XMOJ 2HZVA 5D3GA 1OMSA 2CPHA 1XNQJ 3QO9A 4WZMA 4TQSA 4MAKA 2MZQA 4IDKA 1ZPVA 4C0BA 3MMAA 4QIWD 5DG9A 4X4RA 2KM8C 2PSZA 4F7VA 1IR2A 2BKPA 1N5SA 2FZGB 3BBFA 3ISNC 2BM0A 3P5TL 1YBAA 4CT8A 1R0CB 3MR6A 2LQBA 1RT1B 1ZYQA 1R8CA 2W9BB 2JZ5A 2KXFA 2EFGA 3P6YC 1QAIA 1HNWF 1D8ZA 3V6DB 1IKVB 4NPOA 5H1SV 4Q5VA 1YKWA 1RHRB 3G8QA 2ZM6J 1RT6A 5AXNA 4ICLA 3IGNA 2Z4PA 5A2QY 3DU5A 3M2UA 3RW7A 5KG3A 3OUYA 4DZ6A 2V5HG 2UUBJ 2ZDOA 4HT7A 5E3PA 1KVJA 3LGMA 4ECTA 1NJZA 5G0RB 1X9SA 2MLYA 3FMBA 2IM0A 5LXYA 3JSMB 3TI0A 2HYIB 1T9VA 2OJ3A 4OLOA 2C28A 4LF4F 3GR0A 1TP7A 2LA4A 3PACA 4FYXB 2VC1A 5HN0A 2CG4A 2DXDA 4KH1B 4DV5J 4EZ6A 5HJYA 1HPZB 1RTZA 1EKSA 3QQCD 5KG6A 2BJ9A 3TNVA 5M2PA 3G2XA 4ZLJA 2YNIB 3OXFA 3OSNA 1WOSA 4YR0A 2QV6A 2WONA 2XSJB 1T0TV 3FFIA 3RRHA 5CCLA 3CIMA 1BQNA 3H98A 4N7TA 3MXHP 4AL5A 1VHIA 1JIHA 4LR9A 1J27A 4MIWA 2LEPA 2RRNA 2GHVC 4L73A 5L39A 3OHAA 3MR5A 2E66A 5SZTA 1X4GA 2IFXA 2J7UA 2N4DA 2DCUB 1VRQC 2W2MP 3R5BA 2J0QD 1SCJB 4KHMA 3NOGA 3GLJA 2GO8A 4DEZA 1Q0NA 2ZKUA 1X7VA 5BYRA 3AA8A 3OXGA 2CRLA 5DQGA 3KFWX 1BQNB 4MJKA 3QT8A 3GIMA 2J5AA 3SSSA 2GVDB 3GSDA 2EW9A 1RTHB 4DV6F 2VA3A 1NK9A 1J2VA 2MKSA 4AYBD 2MLZA 4ECYA 2RQ4A 4QR2A 1Q79A 5B0FA 4P2XA 4YHHF 1IBLF 2X1FA 2L9NA 4DF8A 1IJFB 1Y9OA 3VAKA 5L1IA 4BDPA 4QWBA 3C46A 3IBFB 4KQZA 4O3RA 4ZP7A 2CAJA 4LQ9A 3QLHB 2AQ4A 1B0VA 2MKKA 4IOAQ 1JXEA 1N0UA 2ZHAA 2FHMA 3Q8VA 3TP2A 4PPZA 1SJRA 2V2KA 2ZZNA 1VLOA 3JYTA 1Q7LB 2RILA 3ZZUA 5T14A 1HHSA 4C48A 1YJUA 2XI2A 4DV1F 4UUWA 4NLUA 2CDQA 2KG1A 2QYGA 2ZH5A 1VBYA 4J9OA 2GVZA 1N6QB 1K47A 1VLYA 1VQMS 1A9NB 2B43A 3JQMA 3A13A 5ETNA 4RNMA 3B54A 1CS4B 3TANA 3T6BA 3BO4A 2CYYA 1Y00A 1HNZF 3PM9A 3LPEA 2K1RA 3C3LA 1AXQA 2IJRA 2V4JA 3RUBL 1YSJA 1YGYA 2LFVA 4GC6A 2CQCA 5JUMA 1FRXA 2BM1A 4PXBA 1REVA 2KKHA 1RTDA 1S1WB 4RO0A 4RKUC 5IWAF 3VAFA 2BQ3A 2MQ8A 4RWXA 2DISA 3RB3A 3M9MB 4DV3J 1LV5A 3U1MA 4IR1A 2UXDF 3DOMA 3M8RA 1X4HA 3BV8A 4I2PB 1RHQB 4RR5A 3PJ9A 1GTEA 1XWLA 2A10A 2DT9A 3BGLA 2QE5A 6FDRA 5KFZA 3M8SA 1RT4A 4ILMA 1WHYA 3IM9A 3T19A 2AGQA 1C0TB 1T05A 2IVYA 1VQKS 4Q8EA 2CNLB 3MAQA 1S0VA 3IXQA 3F73A 3LOUA 2EVZA 2HWHA 2Z2LA 4DR7F 1M1GA 1G1XA 3MR7A 2YKOA 1LW2A 4JI6F 4KC5A 2EWHA 4YS2A 2VQFF 2XZWA 5CD4H 1H2TZ 1FFSB 2P8IA 4WBFA 2KFYA 4DFJA 1V3SA 3NG8A 4C8ZA 2BKNA 3DRRA 1CC7A 3CCVS 2XSFA 4P2SA 2COLA 4CYUB 3OVSA 3R6LB 4IKAA 4OJ1A 5LMUJ 1UVJA 1NRKA 1RHJB 2ZE2A 3TVZA 4ZVOB 3SCKE 4JI0F 4DV7F 1H7WA 1Q95G 2LEAA 2RDDA 1JLQA 1NKEA 4USMA 4FZVA 1VIOA 2QO3A 1UWBA 3PJWA 5CYQA 4NMXA 2RAQA 1YG0A 2IVFB 3HULA 2BE9B 2XGQA 2P9EA 4FVCA 1NK4A 2HRTA 2D1CA 2DCLA 3C19A 1F9FA 2V68A 2GIFA 3CJKA 3I56S 2LEBA 1EIYB 3MM9B 1F2GA 1HQUB 5KFUA 4EYIB 1OQ6A 1RWMB 1FX4A 2HWIA 3MM5B 1NK5A 2ALYB 2FTRA 3T9NA 2HVEA 5KFDA 2BUNA 2ZBPA 3OR1B 3M8PB 4D3GA 1N5TA 1SPBP 2W25A 1X5OA 2QIFA 1JNZB 4PUOB 3PO4A 1I3OB 1WKKA 2IPOB 1E6YA 5F8IA 3AOAA 2BJ7A 3GTYX 5B0AA 1DURA 4ANCA 1S1TB 2I5JA 4LIRA 5C42A 1H6KX 2OUGA 2OTLS 2RKIB 3QATA 4HVZA 2BQRA 3SMZA 4MFBA 3TJ8A 1FRLA 2C2DA 4LF6F 2CJKA 1KBRA 1TR0A 2MZSA 3C66A 1KFDA 4PYDA 2WW4A 3MPYA 3ONQA 4NRUA 4Y2KA 3CJKB 3KDNA 3B82A 2HBYB 4OHWA 5L9XA 5FIIA 3ZTPA 4YDDB 4XIUA 2RDJA 1NZAA 1S1WA 1SKRA 1XNRJ 1PYSB 1QLNA 4DJBA 2LU2A 1KONA 2K2PA 4YFUA 4NLXA 4ETZA 5I3UB 3KK1A 3KNAA 3T6JA 4F26A 2DGUA 3ZTOA 3R9LA 5BR8F 3VZHA 4ECZA 1RWPB 2UUCJ 2BX6A 4RUCA 3RR8A 4WP8A 2GX8A 1MN7A 2K7JA 3R2CJ 2H5EA 2ZH6A 2JVRA 2R7XA 5JVHQ 4NLYA 5ETKA 2QL9B 2VQEJ 1AZSA 3DRRB 2XCAA 4K4VA 1FJGJ 2ZWOA 1S1UA 2HEKA 4ED6A 2DRBA 5HVGA 2MZJA 4OYAA 3CC7S 2XLJA 1LW0A 1WG5A 4O4GB 1NKCA 3NBPB 4ZDNA 3LWLA 1EB0A 3IMQJ 4QPXA 2XQCA 2R7SA 4CTAB 2DNPA 5A8KB 2DPJA 4B3TJ 4IFYB 1C0TA 4LBPA 2O66A 3QIPA 1G7CB 3EICA 3EDQB 5CCMA 3QLHA 3TRGA 3DCAA 4B9MA 3BF4A 2AD9A 3OQ2A 3DOMB 1RE1B 3E8OA 1NHVA 4J5OA 4LBIA 4OHVA 3NS5A 4KB7A 4C8KA 2YQ3A 2OPSB 3CPWR 4FKYA 4ELUA 4K0KJ 4MT1A 1R8PA 2VQFJ 2RS2A 2I2YA 2KFNA 1X5SA 3D4JA 3R97A 5GAEI 2O3DA 5FDLA 2DO0A 3VALA 3DLLQ 2QJ3A 4K4XA 4C8MA 4QR1A 3W9HA 4ZIVA 3MOJB 5KFLA 3TAMB 3K5LA 2HLUA 4N8OA 1M1HA 1IXKA 1PBUA 2DY1A 3CJ0A 3BKUA 2FUG9 5LL6d 4CLFA 5GAGI 1KHVA 2HAIA 2CJAA 4I0WA 3RJMB 1PGZA 1YBTA 3LP0B 3N5BA 1YI2S 4JYAJ 3ZTQA 2VDHA 3FFIB 4JI1F 3QRQA 1APSA 2UVWA 4H4MB 5CZXA 4IYQA 5LM7E 2HGMA 2MY7A 5FDLB 3SCJE 5D8HB 4ATNA 3IAM9 3G8SA 3FZ2A 3JAMU 1B99A 4J91A 3ILIA 5D78A 3K5MA 1NK6A 2AF6A 3BDPA 2LQ9A 3TAPA 1RT7A 2IY5B 1KDNA 4DG1A 5H9FK 4EU0A 1B7YB 4OJGA 4KHPJ 4FNHA 4KH0B 4DR2J 4IG0B 2PFDA 5DZ6A 4RPFA 3ZFVA 3GQCA 2HHWA 3CJQA 3EJMA 1AA1B 3MAHA 3S1TA 1GTHA 3PY8A 1Y11A 4CH7A 1QY7A 1BQMB 3M8YA 2QL5B 3WIUA 1ZH5A 2WVBA 2YNGB 2YPYA 3MCMA 1G3OA 1IWAA 4WXOA 4DSFA 4AE5A 3L09A 2V69A 2NSCA 3MOZA 1RAJA 1VK8A 1RHMB 4W90B 1RWXB 3V6KA 1X0FA 4ANDA 2B4PA 4NCBA 1TL7B 3ILLA 3MHYA 3T1AA 4DLEA 1HKAA 4P2FA 1M5PC 4DWIA 2DXEA 4OLPA 4CWBA 2F8HA 2H65B 2E9TA 3PIPQ 3CC2S 5KFFA 3UI3A 5IQQA 2G2YA 2NYHA 4J9QA 5CA5A 2RQCA 3K8VA 2XS7A 4AD6A 1EP4A 4QOTA 1UVIA 3OTCA 1W25A 5MAOA 2EK1A 2FGOA 4IFVA 2CVIA 3G71S 5HLFB 5CXTA 5KTQA 2ZBIA 1VBXA 1FD2A 4UOFA 3H42A 1LWFA 4I2QB 4HI1A 2RVJA 1OY6A 4XDCA 3H25A 5CYMB 1FRJA 3KHLA 4DR2F 4QCLA 3D1HA 2N82B 2XS5A 3S8SA 1AT1B 2M8HA 2RKIA 2M70A 4F4WA 2XHWA 3RG6A 1WUUA 3U7JA 3ET6A 4JI8J 1TQLA 3ZZTA 4JUZA 1NJIT 1IR1A 4YB7A 1FJCA 2E29A 5LXRA 4UZCA 5HROB 2J7KA 2BRKA 3QSIA 2CJYB 1BD6A 3IS9A 5ETOA 4EEYA 4J37A 2B4OA 2VFSA 5CD4A 3Q83A 1WEZA 1XIQA 4ZPBA 2XS2A 2RQMA 2M0GB 3P3DA 4PWDA 4UQTA 1LWCB 2V6AA 5ETMA 3OL7A 2FVSA 3T41A 1XJWB 4DL7A 4USUA 3HVAA 4RU2A 1DQAA 3H59A 3PDNA 3UPFA 5D77A 2RUGA 5GVQA 2ZHOA 4DLGA 1U47A 4DR6F 1HWJA 3FQKA 3WDOA 1WOOA 1GXUA 3AHPA 5D4LA 5DM7Q 4C8YA 3HCXA 1OO0B 3D6HB 3PFEA 4ZVPB 1J5EF 2HZAA 2BJ8A 1X4FA 4FXWA 4ID5A 5DZ7A 4DQSA 1XNQF 1TFYA 2EFPA 5F41A 2HPUA 3LO3A 3SDEA 3DOKB 3JB9k 4M94A 1S9EA 1LQ9A 4I64A 5KFEA 4A8MP 1CJVB 1PAUB 2ZBRA 2NXCA 1YBUA 3KJQB 3PYFA 4NL5A 3PXGa 4A48A 1CS4A 5K8MA 2G2OA 2ZJQQ 2UXCJ 5KFSA 1NKBA 2QT7A 4Y0FA 1F5CA 2QLFB 4A4JA 5IS2A 1NCLA 3BBCA 3MMCB 5BXIA 1F9HA 1DQ9A 3GJTB 1RAEB 1AFIA 1MROA 1SKUB 3BGUA 5F9LA 2HVZA 4WYWA 4CLSA 1HD0A 1VGYA 4RW4B 1LFPA 3V2UC 4Q8FA 2K3IA 3BGOP 3BSAA 3W3SA 3MTKA 1SIWB 1IN0A 2QMWA 4CO2A 3HFZB 3J81Y 1J5EJ 1FKOA 2OEJA 5ETTA 1LK7A 2B5JB 4PWUA 5AE1A 4JV5F 5KAKA 4AQYJ 2I1RA 4BLGA 2L48A 3G4SS 1LKZA 2QYCA 2E5HA 3AFGA 1FXLA 1FESA 2YTCA 3PYEA 3FEXB 3MFHA 3BREA 1WF2A 4KIAA 4RW8B 2F1FA 4AL7A 2UXDJ 3RRGA 2BBEA 2JH3A 4LRAA 4DPUA 3HVTA 2F8MA 1S1VA 2R8KA 3AD9C 2GVDA 3CDEA 3ZZ0A 4R8UB 2AP6A 4CP5A 3MEEB 3OL6A 2DHAA 3BR9A 2RQKA 1N32J 3X1LB 1FDNA 1VK3A 2C2OB 3PX0A 1U8WA 1VRUA 2BW2A 3HHLA 1S49A 4OI3A 4MKBA 3FBEA 3DGPA 2AJ4A 2DO4A 5KG0A 3D6MB 1UFWA 4CLTA 4X65F 4PZVA 2GMLA 1TKTA 3BEGB 3SCLE 4NCGA 4W4MA 3PW4A 2HHTA 1MWZA 4EBCA 3UWTA 4ED0A 1OYEA 1U1KA 2LDIA 1ZTTA 2HHQA 4JBCA 3I0RA 3G82B 2HSEB 2V94A 5B0BA 3M6VA 1NSAA 2MZTA 4RBTA 4ZP9A 2H1YA 1PILA 3VGTA 1K0VA 1HW8A 2R7OA 1H2VZ 3RR7A 1B4SA 5K20B 3MCNA 4IRDA 1UVLA 1H2UX 5DRKA 3QT7A 2W24A 4OFZA 5CH7B 4WU2A 2GJFA 2Y1RI 2HS4A 4DX6A 4P10A 1Q82T 3CNQP 4C3LA 1AW0A 2MQPA 4B3OA 2DHGA 2AW0A 4OX9F 2F65A 4OJ3A 4A47A 1FWLA 1RAGB 4PKDB 3CUNA 2MB0B 4WU3A 5EHHA 1VRUB 2JX2A 3PVXA 1VBKA 1YJRA 5DS7A 4U8VA 3Q2SC 1KWMA 3X3UA 1SC1B 4DL4A 2J8SA 2FC9A 4RU9A 4IH6A 1RT5A 4G1QA 3CJSA 3V4MA 2QG9B 1F2HA 1HR0J 4LQ3A 5E41A 1S7HA 4FPRA 5KFHA 4TVAB 4NI2A 4O23A 3R7NB 2WB1D 3NAIA 4DUZJ 2IJFA 2DRDA 4PR6A 1SH3A 3PYGA 2D3OR 3W64A 4X66J 1QJHA 2YPZA 3DDNA 2VG6B 2RDIA 1VJQA 3CDBA 3K2YA 1NPPA 3RBXA 3MZIA 4CLLA 2ZH8A 3CC4S 3CULA 2VD3A 4NXNJ 4ZVUB 2L9WA 3CMES 5C2CA 2HURA 1AUDA 3IR5B 3TAMA 4JI3J 1NB2A 2F4VF 3QIDA 1CJKB 3SSQA 3NAHA 2IMWP 2DNNA 3BKTA 1CULA 5KFCA 1W26A 4ED2A 4PABA 3UD5A 2HHUA 2DNGA 4HHHA 2RT3A 1Q81T 3UW1A 2ZEJA 4FYDA 2HRUA 5T7LB 4Z7YA 4V19J 1U26A 3IWNC 2ZH4A 4LF4J 5KG2A 1UEKA 2MY8A 1CVJA 2YKMB 4JV0A 2ACYA 2HBZB 2ROEA 4K5SA 1MLAA 3RU0A 5L1KA 5HP1B 1S77D 1FVSA 2XBPA 2NQPA 1UTAA 3R5CA 4U9RA 3TAQA 3GG0A 2HGLA 1JLCA 5JJBA 1AUSL 4EZ9A 2Y1LB 1FTRA 1Q8LA 4DL3A 3RB0A 4HEA9 3CDUA 2VKRA 2MPUA 4PXEA 2XMTA 4IO1A 5KFIA 5F9NA 2J0WA 5LSLA 2X51A 3Q8QB 4IG3B 4X2BA 1TL7A 2H4YB 2IYIA 2XMAA 3M05A 4DZDA 2JLGA 1JLGB 4KPCA 2HFSA 2XTJP 4NA2A 1B3TA 1FDDA 3TO8A 1EQ0A 1MN9A 1WHWA 4DU8A 3ITHA 5DDPC 1RJJA 4LF6J 4XO0A 2P6TA 1U48A 3UFCX 3EVMA 3KLEA 3UVJA 4JI4J 4AUKA 4DHVA 3IBWA 3GZ7A 4WFZA 4X65J 1RWVB 4KSEB 1S9GB 3ZXWA 4K4ZA 3G6YA 4E98A 1HWKA 2XZDB 4WKYA 2XYHB 2KRRA 4WFNQ 4AL6A 4O0NA 1IBMJ 2GQ2A 1T7PA 2ZZTA 3CO9A 2NPFA 1I6JA 2PE8A 1S7IA 2F40A 2J9DE 2XMUA 1H73A 3CCES 2V2VA 1Q53A 1WC5A 3FNNA 2BEFA 3HHDA 3DRPB 1S9FA 3T5KA 1FRKA 1I94F 2M3DA 5B09A 1X8DA 4CDIA 2Q6CA 2ZKTA 4DUYF 5AXKA 4WFBQ 1NAQA 4X62F 4CO0A 1P8GA 2KB2A 3J7YU 3D7SB 5C25B 5HO4A 3OVBA 4A8XA 5AXLA 4LF7J 1K44A 4FF3A 5F3ZA 4Y2CA 5CAAA 2R2TA 1M5SA 3OSPA 4OIXA 1JKHB 1RLDA 2WK4A 2AZ1A 3NWGA 3J7A1 5IT9U 1ZM3A 3MM8A 3Q89A 1D3WA 2VG5A 3VWSA 1JLBA 2YQ0A 1GMVA 2OELA 3QGPA 3ENVA 1C1BB 2FY1A 4LR7A 3T1YF 3CJ2A 1SJ1A 2HWTA 2KN4A 1ZZFA 1CC8A 2OPSA 5FLXY 3KLIA 1RB0A 4JI6J 1HBOB 2CUYA 3K5PA 1NNDA 3W5ZA 2VJVA 5F8NA 4J9PA 1O51A 4S0MA 3A8IA 3QJPA 2I8EA 2VJUA 4EMDA 3LF0A 2XB2D 1HWLA 2CZVC 2GW8A 1QTMA 3J7AN 3JQKA 4F0HA 2RRAA 3TARA 1REGX 1S4FA 1HWUA 2MKHA 3KJFB 5E33A 1U1LA 2DGSA 3V81A 4O4GA 3IP0A 4TY8B 5HAOA 3UCZP 4EUVA 3TUZC 4ILLA 3AB2B 4B02A 1RT3B 1MROB 3D28A 5J1PA 2HHHJ 1T3NA 5IT0A 4CLUA 2JLEA 3KK3B 1WWHA 2OMOA 4QU7A 2AYEA 2EPIA 2NCKL 3LP1B 3Q8RB 4F2SA 3QBCA 2R2SA 1U1RA 1N34J 1IM6A 2J0XA 3OVAA 1P27B 2NPIA 1LWFB 4USWA 4OX7A 5B0GA 2YNFA 1HQEB 3BYRA 3VCDA 1TU0B 4CYUA 3DOLB 2ZHBA 1V3RA 4PQUA 2ERRA 1K9MT 2Z8QA 1EQMA 2VPXB 3U27A 4F02A 2BYCA 4HR2A 2PO4A 2E9ZA 5A6WA 2W2OP 5GADI 1XC9A 1NDPA 4DR7J 4UTGA 2GFFA 2G1HA 4YP3A 4PAAA 4BCAA 2PEBA 3R5JB 2G0CA 4CLPA 4A8FA 2D74B 1D9AA 2PN6A 3QGGA 5DM6Q 1RGVA 1RXOB 5F8MA 2VOPA 2Z2ZA 3L4BC 1LXNA 2EC2A 2QMXA 1R8BA 2XLIA 5LMNF 1OWXA 3FCWA 4P71A 2EFNA 5A76A 2DR9A 1PBAA 3EZ5A 1E6YB 1UMJA 2HQIA 3NNAA 2HW3A 3D1QA 3Q8UA 3S7RA 2VBWA 2F8EX 1ZAVA 2W4CA 3GIJA 3HO1A 2A2DA 3NKYA 4DI6A 1GMWA 2ZD1A 1DTQA 3EGWB 3M8PA 4IFYA 1MMDA 2WVDA 3UVJB 3M30B 1T05B 1X9WA 3J81U 3IGVA 1DQ8A 2F5GA 8ATCB 1UPPA 2UUTA 1OS5A 3QNWB 2IAJA 4HHJA 1SUQB 1KOOA 2PA3A 4MYTA 2V4QA 3O44A 4DV4J 1VQNS 2Q3PA 2I9SA 2V4JB 4CQ1A 3HSDA 2F9JA 2IA0A 2QZ8A 2CQ3A 3KLVA 5ETSA 4ES2A 2KL8A 4BC9A 4HHUA 4KV8A 1LWEB 2KT2A 3EDRB 4DR5F 3CCUS 2MHNA 3DHXA 3V4IB 3VAJA 3MWBA 1LFWA 4F3MA 1W2IA 4KHPF 4QWAA 2D3O1 1UA1A 3FZBA 4LF9F 2YH1A 3CJ4A 4HL9A 1WC6A 1QAYA 1W7WA 4B17A 3GV7B 4TU8A 1KS2A 2FHJA 2H51B 3IWXA 1TKZA 4JI4F 1U09A 3K7RA 3VQSA 2B8PA 3N9UC 4WIQA 4ZN3A 1Y3JA 4X66F 3KLGB 3AH6A 3MDFA 3QGHA 2OFHX 3JS9A 2KJWA 2KZZA 5KT7A 2GHPA 5GAEU 2OSRA 2VPZB 1NZ8A 1DBDA 1FI4A 2MSSA 2DR7A 4B3SJ 4ZCIA 2OTJS 5EX0A 2OKQA 2C3PA 1CJUB 4ZPDA 2LQJA 3BYPA 1RCOB 2R3VA 3NWRA 5EGYA 4JI1J 4ZLNA 1M5KC 2W8LA 2B9YA 1N48A 1HNIA 4L74A 3R2DJ 1WACA 4NLRA 3GFXA 3O3LA 4OZ3A 2PMZD 1T9WA 4B3RJ 4NZ7A 3KNGA 4CO5A 4DV7J 3THVA 4DV2F 2XYGB 1EZZB 3FBFA 5K5MA 2V4RA 3QIPB 2E5GA 4ZCLA 1KQFB 2BOAA 3PTWA 4YN3B 6AT1B 1HNIB 1OJ4A 8RUCA 5B08A 4CTAA 1MU2B 3M2UB 1RTIA 2MQMA 1U7LA 2AMCB 2HFOA 2PA8D 2ZOGA 4TN2A 4XTTA 5HVHA 4IRCA 1Z2ZA 3NMAA 1ZA2B 3C6UB 2RF2B 3NNHA 1KP6A 1BC6A 1WORA 1H98A 2BMBA 2H54B 2N3OA 3US5A 2R8GA 3PRVA 1S1UB 4NLQA 4DSLA 1YZ7A 1UWBB 3LP0A 3W8PA 1S12A 2W9CB 2C3MA 2OMLA 3EE3A 3Q8YA 1SIZA 3QAUA 5B0EA 5J1NA 3KLFB 2HBRB 2C2RA 2OEKA 1B0TA 3DNCA 1VRTB 1DLOB 2B3TB 1R6VA 4PXDA 1WOPA 3QAEA 4F36A 2AV5A 2E7XA 3GCXP 3BJYA 2QA2A 1NEEA 2YNIA 3AOCA 4IH7A 4EGLA 3ZO7A 3NXZA 1KR4A 4DBQA 3TUJC 1KOHA 3HSGA 3MGJA 3D9BA 2QLJB 3DMJA 4IDKB 4PRFA 3A3NB 1T9UA 5D15A 1SB6A 4TY8A 2FJDB 4UF4A 2J9CA 3H8YA 4ZP8A 3Q2TC 2OIHA 1YJVA 4DV0F 3UN2A 4ECRA 2H9ZA 2XNRA 4CNYA 2VONA 1IKVA 1JQGA 2VICA 3MPWA 4J9KA 4P7VA 1HR0F 1WD6A 4DX7A 3AAWB 3LANA 2MDAA 4KFBB 3W2VB 1YJTA 3KLGA 3I82A 4MK7A 5I4MA 2LXFA 2LLZA 2QLBB 3VAGA 1S57A 3L3CA 1T9XA 4ZS6A 2GIQA 4NI2B 4WE1A 3N4WA 5IOLA 4O3SA 4ANEA 3I4PA 2DHXA 1K1SA 1URRA 2GHWA 2IRYA 2VFVA 4WP9A 4ZVFA 3UDEA 1CJUA 2UP1A 1YRTA 2G4BA 4OI0A 1IQTA 2K8GA 4KR0B 1LW0B 1HBUB 2AYMA 3ISND 2BE7D 2Q79A 2ZUAA 1T9YA 4ZVQB 3HZEA 2W9BA 2HNDA 4I4BA 4URGA 1XMOF 5KFAA 2J9DA 3IAS9 2L41A 1QSYA 2DPIA 4K0KF 1UFKA 2UV8G 4RWWA 3UD4P 5D3GB 1YTYA 4FF4A 1TTHB 4K4TA 2ABYA 2F4FA 1YQHA 1IQZA 1WF0A 1S97A 2J76E 3C15A 4EFAC 4LSNB 1I51B 2MHEA 2LECA 4KJIA 4M5MA 3KMSA 2JLFA 5T41A 3T3FA 1HI8A 2CQ1A 3JTNA 5C25A 2V2QA 3AT1B 3DOLA 2Z57B 5LSOA 2MKCA 4F4AA 5J2QA 2OEMA 4OQJA 2YKMA 2W9AA 1L3VA 4Q43A 4Y6IA 2V8HA 1UJ4A 3W2WB 3VHQA 2M5YA 3EZOA 5HJXA 4Q7AA 2A18A 4ZPTR 2BJ3A 1SUQA 1O6XA 1TL1A 3HFKA 4OZJA 3GE9A 3HZGA 3K89A 2FVRA 5L38A 4X64F 2K7KA 4AT1B 2W01A 2JEIA 4I6AA 4X4VA 1RI7A 1S6PB 3QMQA 3M4XA 4HDHA 4DPYA 4EBEA 2YKPA 1GEHA 3U1NA 4OZ0A 5CQGA 2AJ1A 4LBHA 3ULHA 5THWA 1P6TA 3EM1A 4A8WA 4FYYB 4OHYA 1RT4B 2E1RA 4PCQA 1KVIA 3KHGA 3H2VE 4TY9A 3KOAA 3DYAB 4PEOA 3M9OB 2V8DA 2XWYA 3UE2A 2V34A 2BOPA 2VH7A 4OHZA 1EETB 3HJVA 1X0PA 2NXEA 1QE1A 5J2NB 4DSJA 5JMNA 2I38A 2CQDA 2N7YA 4RW6A 4F25A 2DD8S 2C22A 1R7IA 1SC6A 2RE1A 4RBUA 4JI0J 2G13A 2WHOA 3I5CA 3KG0A 3HSZA 3PNIA 1X5TA 5CABA 1OY9A 2F9DA 1M1KT 1NK0A 3K59A 2FQQB 3MMBB 3K58A 3GONA 3KJNB 1SL0A 1NHUA 2AEFA 4YY3J 1GH8A 1KKHA 5AE2A 1JLCB 3V6HA 2HVIA 2Q66A 3PZPA 3TUIC 3T5JA 1X4CA 2DNOA 5BYQA 2Y0BB 3BZQA 4HT5A 4OI1A 5E5NA 3CD6S 1WI8A 1HD1A 3I4HX 2CKWA 4HACB 5H9EK 4TU9A 1TMJA 1S99A 3QPIA 2WVFA 5IWAJ 5J2PB 4DR6J 2CPJA 1VQOS 1HL6A 1RT2B 2A3JA 3LGHA 5IZHA 3TJ9A 1J5OA 2YWGA 1RAOA 3MEGA 2D41A 4Y3CA 1ZPWX 1NPRA 1XERA 4X4PA 4DFPA 2DR8A 2GMJA 4ZCKA 3SQOP 2J9EA 3PG9A 1BXNA 4ALZA 1HNZJ 2FJVA 1EP4B 1RDRA 2VB6A 3ILJA 5I42B 1VQ9S 1FDBA 2XHCA 4RUHA 2LMIA 4H4KC 4C98A 2U1AA 2CQ2A 4HTJA 4WIIA 1RSCA 1S9GA 2D9PA 3UDCA 3EVOA 4X4OA 2RSQA 2WBMA 2VL1A 5AE3A 3A12A 3KLIB 3T1YJ 1C4AA 4CO4A 5KFPA 1T94A 1OIAA 3M2VB 1S6QB 4D3HA 2FLLA 2HNYB 2RMLA 1TKXB 2XMKA 3K57A 3ITHB 1W2BR 1HA1A 1ICEB 2DIVA 2P2CB 4RW9B 4F4KA 4NXMJ 3TYTA 3W5YA 3RAXA 1PC4A
chains in the Genus database with same CATH topology
5AJ3J 4PWWA 1IBLJ 4K0KJ 2VQFJ 1XMOJ 4DV3J 4DV7J 4DR5J 4JI0J 1XNQJ 2UXCJ 4LF8J 4X62J 4DR3J 4B3SJ 4V1Ak 4LF5J 4X64J 4KY3A 5FLXU 4GKJJ 1J5EJ 3J81U 4OX9J 4JYAJ 2UXBJ 4AQYJ 4DV6J 4LF6J 4DV4J 4GKKJ 2MEWA 4DV2J 2ZM6J 5LM7E 5LMUJ 4JI4J 1IBKJ 3JAMU 2KL8A 4HHUA 2UXDJ 4X65J 2UUBJ 3OTOJ 4KHPJ 2UUAJ 1IBMJ 4DV1J 4DR2J 4RJVA 4KYZA 1N32J 4DV5J 1XMQJ 1I94J 1HNWJ 4JV5J 2MTLA 2F4VJ 5BR8J 4LF7J 4LF9J 4JI1J 3D3BJ 1N36J 4JI7J 3R2DJ 5IT9U 4B3RJ 4DR4J 4DV0J 3J80U 4LFBJ 4YY3J 4JI6J 1N33J 4B3MJ 1XNRJ 4NEYA 3T1HJ 4LFAJ 5IWAJ 3W1YC 5LMNJ 4DR1J 1HR0J 2UUCJ 4JI8J 3J7AN 4DR6J 3R2CJ 1HNXJ 3D3CJ 4DUZJ 2VQEJ 4X66J 4JI2J 1FJGJ 1HNZJ 2HHHJ 4NXNJ 4JI3J 4NEZA 2E5LJ 2UU9J 4JI5J 3IMQJ 4YHHJ 5A2QU 1N34J 4DUYJ 4B3TJ 3T1YJ 4LFCJ 4LF4J 4NXMJ 2KVQE 4DR7J 2MQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 J;  4PWW A;  1IBL J;  4K0K J;  2VQF J;  1XMO J;  4DV3 J;  4DV7 J;  4DR5 J;  4JI0 J;  1XNQ J;  2UXC J;  4LF8 J;  4X62 J;  4DR3 J;  4B3S J;  4V1A k;  4LF5 J;  4X64 J;  4KY3 A;  5FLX U;  4GKJ J;  1J5E J;  3J81 U;  4OX9 J;  4JYA J;  2UXB J;  4AQY J;  4DV6 J;  4LF6 J;  4DV4 J;  4GKK J;  2MEW A;  4DV2 J;  2ZM6 J;  5LM7 E;  5LMU J;  4JI4 J;  1IBK J;  3JAM U;  2KL8 A;  4HHU A;  2UXD J;  4X65 J;  2UUB J;  3OTO J;  4KHP J;  2UUA J;  1IBM J;  4DV1 J;  4DR2 J;  4RJV A;  4KYZ A;  1N32 J;  4DV5 J;  1XMQ J;  1I94 J;  1HNW J;  4JV5 J;  2MTL A;  2F4V J;  5BR8 J;  4LF7 J;  4LF9 J;  4JI1 J;  3D3B J;  1N36 J;  4JI7 J;  3R2D J;  5IT9 U;  4B3R J;  4DR4 J;  4DV0 J;  3J80 U;  4LFB J;  4YY3 J;  4JI6 J;  1N33 J;  4B3M J;  1XNR J;  4NEY A;  3T1H J;  4LFA J;  5IWA J;  3W1Y C;  5LMN J;  4DR1 J;  1HR0 J;  2UUC J;  4JI8 J;  3J7A N;  4DR6 J;  3R2C J;  1HNX J;  3D3C J;  4DUZ J;  2VQE J;  4X66 J;  4JI2 J;  1FJG J;  1HNZ J;  2HHH J;  4NXN J;  4JI3 J;  4NEZ A;  2E5L J;  2UU9 J;  4JI5 J;  3IMQ J;  4YHH J;  5A2Q U;  1N34 J;  4DUY J;  4B3T J;  3T1Y J;  4LFC J;  4LF4 J;  4NXM J;  2KVQ E;  4DR7 J;  2MQ8 A; 
#chains in the Genus database with same CATH topology
 3WHI A;  5AJ3 J;  3NEK A;  3M8W A;  3DXS X;  4B9U A;  2OGU A;  4B08 A;  2XUL A;  4IQX A;  4PUO A;  4RBV A;  1HFE L;  3CDA A;  1VOM A;  4DR5 J;  4Y2I A;  3IR7 B;  1ZTW A;  1SH0 A;  2R8H A;  5HQL A;  1WF1 A;  4FF2 A;  1IKY B;  2CFX A;  2JRS A;  4QPT A;  4TYA A;  1R8H A;  4N76 A;  1MML A;  3CJR A;  4DR3 J;  3OHB A;  3MI7 X;  2XO7 A;  3FBC A;  3ZZZ A;  4LF5 J;  5HI7 A;  4OZ1 A;  3PJX A;  3T9Z A;  4ES3 A;  2F7V A;  4USV A;  1CBK A;  2H48 B;  4ECQ A;  4GKJ F;  4GKJ J;  2RS8 A;  3HPO A;  3IRW P;  5J2Q B;  2JOQ A;  5E3A A;  2D9O A;  5IT4 A;  2G0J A;  3DLE A;  3C2P A;  3N79 A;  3I0R B;  2ZNY A;  2UUA F;  2UXB J;  3KYL A;  5EWE A;  5A8W A;  3VAI A;  2X3G A;  5H9F J;  4K4W A;  2Y9H A;  1L3K A;  3SV4 A;  3M32 B;  1XR6 A;  2G1D A;  1S9E B;  2C3Y A;  2Z58 B;  4XAK A;  5F3T A;  3P5B P;  2ALZ A;  1NB7 A;  2IIH A;  1IBK F;  4E0D A;  3UDV A;  5HBM A;  4K59 A;  5KT4 A;  3TUP A;  3HJF A;  1TUG B;  4ZN1 A;  1VBZ A;  2VFR A;  3QT6 A;  2MKY A;  3UR0 A;  4YUD A;  3MUT P;  3F0N A;  4DX8 H;  3FKB A;  4DV1 J;  4LVN P;  2W8K A;  1QSL A;  3C14 A;  1KTV A;  4IH5 A;  2JFK A;  1RTI B;  4O4R A;  3CVK A;  2Y1I A;  4DPX A;  4NLP A;  3DDK A;  5D0H A;  1RT1 A;  3VV2 B;  4C2M A;  4NYP A;  1JB0 C;  3I96 A;  4LRD A;  3M8Z A;  4W92 B;  2B4V A;  3CJ5 A;  1JMT A;  3HSJ A;  2Y8W A;  4L72 B;  1WEY A;  4LRF A;  3PX4 A;  1N5Y A;  3R5D A;  3TWZ A;  2KXN B;  2HFZ A;  1KRP A;  1T03 B;  3IBC B;  2QRR A;  3W8G A;  5A8R B;  4MKA A;  5BR8 J;  2FYX A;  4DG1 B;  2UVU A;  3GMG A;  1ZET A;  4KO0 A;  2J6S A;  1PC5 A;  4DN0 A;  5IXU A;  2IA6 A;  4P2M A;  1J5O B;  2FY8 A;  3QZ8 A;  1U1N A;  1M5V C;  2XLK A;  3PKY A;  3FRY A;  1RT2 A;  4DR4 J;  4G3I A;  1I5O B;  3QFH A;  2WSF C;  5DO2 A;  3QSY B;  4U95 A;  3RRK A;  4Q2M A;  1U49 A;  5A0Y B;  4QU6 A;  1D9F A;  4HI2 A;  4WJB A;  3BN7 A;  1FNM A;  3OL8 A;  3CCJ S;  3I87 A;  4KE5 A;  4RZR A;  2C2E A;  4ZK7 M;  2HQD A;  1VQ6 S;  1U1P A;  1G2E A;  3L95 X;  1CJV A;  1N33 F;  5DQI A;  3LA0 A;  4LFC F;  1ZOT A;  3WBZ A;  5IV3 A;  5GAH I;  4NXN F;  5C24 A;  3QJL A;  4OJH A;  4M5H A;  3A3O B;  4Y2M A;  1X5P A;  4LFA J;  1VDH A;  3TVK A;  1T03 A;  2E9R X;  1NXI A;  1PJ6 A;  1UVM A;  2KU7 A;  2AT1 B;  1RZM A;  1WSR A;  2C3O A;  3HDS A;  2F63 A;  2HLT A;  3NGU A;  2NXJ A;  3LPY A;  9RUB A;  4U67 Q;  4DPT A;  4RW6 B;  4TKT A;  1K0T A;  2CJX B;  4NLO A;  5A0Y A;  4DPW A;  3RGI A;  3RTV A;  3NY0 A;  3OFF A;  4JI2 J;  4DUT A;  3QRP A;  4Q0B A;  3ZZR A;  1BGX T;  3CJT A;  4NLW A;  1H74 A;  5DQH A;  1Y0H A;  2R8J A;  2IAJ B;  3CO0 P;  3VF0 B;  2MQO A;  1UKU A;  4KAI A;  1S1T A;  2I5J B;  2UU9 J;  4JI5 J;  4DL2 A;  5IV4 A;  2BE2 A;  2P6S A;  3PR5 B;  4K4U A;  3GYX B;  2CNK B;  3MMJ A;  1CQN A;  4DUY J;  1RAA B;  3ENA A;  1VIX A;  4PG6 A;  3MEG B;  5KG7 A;  3MM6 A;  3GJS B;  4LFA F;  3MEK A;  2YNH A;  1UJ5 A;  2V50 A;  1LOU A;  7AT1 B;  4QW9 A;  3EMT A;  1Z1Z A;  3D68 A;  1FRH A;  3PFO A;  1MWQ A;  1TL1 B;  1VCT A;  5GAG U;  1B7F A;  1KC8 T;  1S1X B;  2XC9 A;  2BJD A;  1SBR A;  3I32 A;  1U1Q A;  1DTT A;  3FBB A;  4ZOS A;  3LP2 A;  5BJR A;  4U7U D;  2V67 A;  1WG1 A;  2HK3 A;  4OZN A;  3N01 A;  2ZH7 A;  1RK8 A;  2M52 A;  4M5D A;  2DY9 A;  4UOH A;  4PG7 A;  1WKL A;  2D69 A;  1NLK L;  1GXT A;  1S6O A;  3HHK A;  5HBM B;  3NGR A;  2HQG A;  4MIB A;  4N41 A;  3AJ1 A;  2DEI A;  1RAD B;  3NP5 A;  1WI6 A;  3QFW A;  3R27 A;  4KGK A;  4QZV B;  2RH3 A;  2KG0 A;  1PO6 A;  4I7F A;  5ETP A;  1YX2 A;  1RBO B;  2FC8 A;  2POK A;  2O01 C;  2D3U A;  1HLW A;  2IC3 B;  3G8T A;  4DN9 A;  5KFG A;  3P45 B;  5D4O A;  4O3O A;  2V8V A;  3A3P B;  2NLW A;  2E5I A;  4QYZ J;  3SQG A;  4PWD B;  2CZ9 A;  3SFG A;  4JV1 A;  1QVF R;  2AEJ A;  3M2V A;  1LW2 B;  3W63 A;  2HQC A;  2UV8 A;  1VI7 A;  3CED A;  3S01 A;  2XGP A;  2CQI A;  2DIT A;  2OPQ B;  1VFJ A;  3LGN A;  4A8O A;  5I3Q A;  2E5L F;  4FF1 A;  1WC1 A;  2QFI A;  2MST A;  3FMW A;  4JI7 F;  1DAX A;  1V3Z A;  2CPX A;  2DHS A;  2C2Z B;  1SQF A;  3L7P A;  4H4O B;  4F0M A;  1R8A A;  1S0N A;  1U24 A;  4C9D A;  1FWK A;  3H2U B;  2ROG A;  2IBK A;  4O3N A;  3LQV A;  4M1K A;  3NCR A;  4KBI A;  4QJV A;  5E0O A;  3TOQ A;  1FKO B;  2R8I A;  1HBN A;  1SJ4 P;  4WTO B;  4CH0 S;  1LNQ A;  1D09 B;  4O3P A;  2YX7 A;  3SDE B;  1XMQ J;  2FZK B;  4EYH B;  2L3M A;  3EUN A;  2AYB A;  5EUH A;  2CPF A;  2MZ1 A;  4OYO A;  1ZBT A;  2NS1 B;  4QQB A;  2A6O A;  3V6J A;  1TL4 A;  2CWX A;  2W7A A;  3FDS A;  3BSO A;  4LF9 J;  4Q0B B;  1HQE A;  2DB1 A;  4LF1 A;  1VQ4 S;  2CQB A;  3NS7 B;  2MXY A;  2SXL A;  1VR6 A;  3H20 A;  3FCV A;  2VFU A;  1TL5 A;  4HDG A;  4NYO A;  1JLF B;  3KK1 B;  1H0H B;  1T9T A;  2M4M A;  4U7U K;  5KT5 A;  1RA7 A;  2FZC B;  4DOZ A;  5I3U A;  3DC2 A;  3ZNJ 1;  1R0A A;  3IS9 B;  3CWJ A;  5C24 B;  3RB6 A;  2NRE A;  3EXY A;  3NCP A;  4U7C A;  2OH2 A;  1GQE A;  1VHF A;  3DFE A;  3DHW C;  4NRT A;  4A8K A;  3IR6 B;  8AT1 B;  2ASJ A;  1CPZ A;  4URQ U;  3H5U A;  2AJQ A;  2NSB A;  2QC3 A;  2OPP A;  3VGU A;  4QBU A;  5KFN A;  1XK8 A;  2R2U A;  3DYA A;  3HFV A;  4J9S A;  4OZ2 A;  1UZD A;  3EX7 B;  4RNF A;  4A8Q A;  1UJ6 A;  1UL3 A;  3TQE A;  1YZ6 A;  4NXM F;  4HTI A;  1X9M A;  1Q7Y T;  2HVH A;  2DNR A;  3NGT A;  1HNX F;  1HNX J;  2VA2 A;  2V8G A;  5HSP A;  1HYS A;  4M5I A;  5KT3 A;  1ZM4 A;  3SSR A;  5KFR A;  2C3U A;  4CIO A;  4K4Y A;  5ADZ A;  1Q5V A;  4DCO B;  4DFK A;  3OJS A;  3ZZO A;  2DGW A;  3QYY A;  1KVK A;  1TKD A;  4U8Y A;  2WCX A;  1VYA A;  1IKX A;  2VG5 B;  3NCQ A;  1N0V C;  1R6Y A;  1LEO A;  1TUW A;  2FLO A;  5KFT A;  3ZC4 A;  2EG2 A;  2LA6 A;  3ADA C;  4RW7 B;  4DL0 C;  3CMA S;  3DI6 A;  1PIE A;  4WK3 A;  5IM0 A;  2B9E A;  3CD7 A;  4OYW A;  4KKO A;  4B9N A;  5CYQ B;  4ZPV R;  2VPY B;  3F44 A;  4WK1 A;  3WX4 A;  3HM9 A;  3M2R A;  1SJ3 P;  1T3O A;  1TAQ A;  2N3L A;  3GYG A;  3C15 B;  3H4B A;  2B6A B;  2ZE2 B;  2B0G A;  2H3E B;  1SQE A;  2DXF A;  2VBZ A;  1FK9 B;  3CJ8 A;  3IRX B;  4IOB A;  1IBL J;  3AJ2 A;  3VR1 A;  3KTQ A;  3CD0 A;  1Q86 T;  1MU2 A;  1M90 T;  1V5V A;  2E1P A;  1NBE B;  3FCH A;  4KV8 B;  4C11 B;  4EK2 A;  2HHX A;  5C2G A;  1R3N A;  5HL7 Q;  1WHV A;  4Y34 A;  2CDR B;  1DFD A;  2BZ2 A;  2MJN A;  4YY3 F;  1E6V B;  2DH7 A;  4NLS A;  4CT9 A;  3ETO A;  3OR2 B;  1IR0 A;  1XMQ F;  4V1A k;  1UET A;  2XYP B;  5K14 B;  3CTR A;  3IG1 A;  3GP9 A;  4M5K A;  1RHU B;  2JEG A;  3H5Y A;  3QGI A;  4KY3 A;  5FLX U;  4WE1 B;  4J9M A;  4TQR A;  2KT5 A;  3CW2 C;  1M5O C;  4ILR A;  4ICL B;  3QWU A;  4YB6 A;  4Z2X A;  4A8S A;  4B9V A;  1RTH A;  5KG1 A;  4TNO A;  1DLO A;  3CD5 A;  5LJ5 Y;  2CNN B;  2XO6 A;  2E1A A;  4C97 A;  1TK8 A;  2M8D B;  2CQ4 A;  2VG6 A;  2LP4 A;  2YWK A;  1OPZ A;  3C16 A;  3R3T A;  3EGN A;  2K3K A;  4KGV B;  4OYP A;  5E3R A;  4UZB A;  3RBE A;  4ELT A;  2HQF A;  2LYV A;  3GIR A;  3H40 A;  3VGV A;  3O5T B;  2GC8 A;  3WIV A;  4O0I A;  2GO9 A;  4DQQ A;  3O2I A;  4ZJQ A;  1NJY A;  3POT A;  2PC6 A;  4MK8 A;  4USH A;  5HMY A;  4ZVE A;  4DL6 A;  4WKR A;  1S4E A;  2KTQ A;  3VZI A;  2ZWP A;  2WON B;  2XSJ A;  4ENO A;  4J9R A;  3T5H A;  4B3M F;  1WNE A;  3BM7 A;  5G4D A;  2E44 A;  1U2F A;  1Y7P A;  3CCW A;  3BPD A;  4TLR A;  2KI2 A;  1R31 A;  4JI2 F;  2BVZ A;  1I94 J;  4CCH A;  4IRK A;  1EAR A;  3CSK A;  1HNW J;  2MTL A;  3A1Y G;  2ATL A;  4MK9 A;  5IC6 B;  2VOO A;  2KO1 A;  3RZA A;  4MKY A;  4X84 A;  2RF2 A;  2D3Z A;  3KK3 A;  4MFB B;  1ZS6 A;  4J9L A;  3FC9 A;  2Y8Y A;  2FHJ D;  3WC2 A;  1ZAW A;  2Y3Y A;  1UP1 A;  2PT0 A;  3LWM A;  1JJ2 R;  4KTQ A;  7FD1 A;  1U2R A;  1VQY A;  1HYS B;  1X60 A;  1P9Q C;  3J7Z T;  3KK2 A;  2ASL A;  4DSE A;  2CA9 A;  4J9U E;  3JQJ A;  3I0S B;  4NCG B;  2NZC A;  3D1O A;  1BUX A;  4GVB B;  4Q2L A;  4ZVS B;  1D1U A;  5DJB A;  2HZC A;  1JJC B;  1JJ4 A;  4DL5 A;  4I2P A;  2JC0 A;  5DLG A;  2IMO A;  1AYE A;  1U0H A;  2GAG C;  2HBQ B;  4ZHR B;  5HMZ A;  3M2R B;  4QWC A;  2R7U A;  5K8N A;  2YX4 A;  3N5F A;  1RWW B;  2XY6 A;  2BQU A;  2GQQ A;  3POT B;  2R9L A;  5JXS A;  4R8U A;  4DSK A;  2HG4 A;  1ACM B;  3V4I A;  2HHV A;  3EPG A;  3QO9 B;  4KGZ B;  4QIF A;  3GV8 B;  1Q8K A;  3M8Q A;  1N8R T;  1UFL A;  3BR8 A;  2M7S A;  3VVU A;  3R1H A;  1WC3 A;  3D3C J;  1KLM A;  4KGX B;  1NH8 A;  1QM9 A;  4DFM A;  1EAY C;  2OD6 A;  4L3K A;  3F56 A;  4RNO A;  1VJW A;  2QSF A;  2YVS A;  5L8R C;  5KT6 A;  3AY0 A;  1BHN A;  2C2M B;  4WZQ A;  3MUM P;  2KFZ A;  1X4E A;  3D0H E;  1FKA F;  2QEX S;  2HNZ A;  1SC4 B;  5DLF A;  3PW0 A;  1T8E A;  2ILY A;  4CLY A;  2N4C A;  2MLX A;  2DR5 A;  3IG1 B;  4NX9 A;  2OPQ A;  1Y5N B;  2Q6B A;  4DDF A;  4RW4 A;  3CF5 Q;  4DS4 A;  3P49 B;  3M6W A;  3OR2 A;  4ZPC A;  3KXD A;  4C8O A;  3F41 A;  2C1E B;  1EX8 A;  1P9Y A;  2YWW A;  3O1L A;  4LF2 A;  3DU6 A;  2WSC C;  4IR9 A;  2HHS A;  4LFC J;  2OPP B;  4OI4 A;  1NU4 A;  3W65 A;  4XK8 C;  4H4O A;  4NWB A;  3CCL S;  1HI0 P;  1KSP A;  1YVF A;  2A1B A;  2P5V A;  2YKQ A;  2AIR B;  4LSL B;  4NOH A;  5HMW A;  5DDO C;  1JXV A;  4CLZ A;  1KTQ A;  2EK6 A;  4M95 A;  3FJ2 A;  2BE2 B;  4OV1 A;  4ELV A;  2KDO A;  1DAR A;  1WC4 A;  2B56 A;  3NOC A;  2IVM A;  3AXM A;  3DM2 B;  5D0E A;  3AJD A;  2DHH A;  2CJQ A;  2XG8 A;  2L08 A;  3CCZ A;  3SQG B;  4ES1 A;  2EFO A;  3IC1 A;  4P52 A;  3DLJ A;  1HHQ A;  2WAQ D;  3DRX A;  3ENW A;  1R0B G;  4RW7 A;  2XM3 A;  3GV5 B;  1JLB B;  3OW2 R;  1ZA1 B;  1IJE B;  3NLC A;  4RW8 A;  5LSR A;  2K1R B;  2XNQ A;  3M6U A;  1TV6 B;  4GO7 X;  3UNY A;  1FJE B;  2PI4 A;  1Q5Y A;  4ID8 A;  4OX9 J;  4N47 A;  3OFG A;  5D6G A;  1REV B;  3KUH A;  2WVC A;  4MTP A;  3AQO A;  1X31 C;  4MKV A;  2W4P A;  2ZD1 B;  4M8L A;  4DV2 J;  2C42 A;  4FKX A;  1HMV A;  3TZW A;  3BQ0 A;  1U1M A;  2R42 A;  2WSE C;  1HBN B;  4R0J A;  3UDL A;  4I6W A;  1IBK J;  1JLE A;  2BAN B;  1BY9 A;  4UY8 T;  4JI3 F;  2E7V A;  3BSN A;  5HAN A;  4XPE A;  4IUF A;  5J2P A;  3R5A A;  3OTO J;  3TW0 A;  4FPI A;  4G6V B;  1XTZ A;  3R7S B;  5RUB A;  2YY3 A;  4F8R A;  4X4U A;  2ZDP A;  3UCU P;  3KK2 B;  2VOD A;  1IBC B;  3MPD A;  3JSY A;  4C0O C;  4ED4 A;  3H5X A;  2YXL A;  4YR3 A;  3H5S A;  2KJV A;  4UY8 5;  3D67 A;  3G6E S;  2JEF A;  1RWU A;  1YJN S;  1UA0 A;  3IFE A;  4ZPW R;  4FN5 A;  2HNZ B;  2AJF E;  3HXM A;  2DTJ A;  2VC0 A;  1JLF A;  3NMR A;  4OHX A;  3W5X A;  3ZNU A;  1OY8 A;  2F4V J;  4ZIT A;  1FXR A;  3PW2 A;  3C6T A;  2FPH X;  3TX0 A;  1QVG R;  2ACM A;  4I67 A;  4HYK A;  1XQI A;  2W2Q P;  3E3X A;  3GYN A;  3ETM A;  2PEH A;  4GVL A;  2X1A A;  2JEJ A;  4DUZ F;  2YKN A;  4BS2 A;  1EHW A;  3KUG A;  3OL9 A;  5BYS A;  4E2F B;  3RB4 A;  2GVZ B;  1K8A T;  2DJW A;  2FJE B;  2JFD A;  4G1Q B;  2JSX A;  3J80 Y;  4DV4 F;  4RL1 A;  2VIH A;  4FXD A;  3DRP A;  2FD2 A;  1HI1 A;  2VPW B;  4P6Q A;  3WC0 A;  3WX8 A;  2NYI A;  3P96 A;  5C5J A;  1JKH A;  4DU7 A;  2RNE A;  1C0U B;  4WYL A;  3UO0 A;  2PMW A;  2E7W A;  4KT0 C;  2LDY A;  2A2C A;  2JHE A;  4YME A;  3EYZ A;  4ECS A;  4FBT A;  5L9N A;  2GZO A;  2UVR A;  2J0S D;  1S79 A;  3DKD A;  4G65 A;  4GVB A;  2KZM A;  3MUR P;  4A8Y A;  5DDQ C;  1FVQ A;  3MM6 B;  4M5G A;  3W2W A;  5LMN J;  1B0P A;  5KOX A;  1YJ7 A;  3CB4 A;  3FK4 A;  2IDE A;  4DR1 J;  1RTJ B;  1U25 A;  2UZA A;  1U1O A;  2ATC B;  1R89 A;  2CVE A;  2EG1 A;  4I2Q A;  2DVI A;  5ITH A;  4ZKA A;  3I55 S;  1DRZ A;  2ZM6 F;  1VQ7 S;  1NDL A;  2DNY A;  4GMK A;  3Q8P B;  2IRU A;  4IFV B;  3PHT A;  5K14 A;  4OYI A;  3KHH A;  2ZH9 A;  3U1L A;  3G82 A;  4UUX A;  1Q78 A;  5SUH A;  2YQ1 A;  5F8G A;  1N34 F;  2GQC A;  4JYA F;  1FNX H;  1RWO B;  1E6V A;  2HVD A;  3NGK A;  4P75 A;  2ZJP Q;  4OMF G;  3PEJ A;  1GK8 A;  1NHK L;  2EI5 A;  1RU2 A;  4YHH J;  2CG8 A;  1SVD A;  3G6V A;  4KGM A;  2R7T A;  1FER A;  5E3Q A;  2CJ9 A;  4QIG A;  4O44 A;  3DLG B;  2P9G A;  3KLE B;  1RKI A;  2YWE A;  4WP3 A;  4WPA A;  2HAF A;  1NK7 A;  1RUS A;  5D4N A;  1KNZ A;  1BWE A;  3MEE A;  2EEY A;  1KHW A;  2KVQ E;  4DX5 A;  2FLP A;  1QUP A;  2V8P A;  1FFG B;  2PGC A;  1PKU A;  3D6F B;  3DLH A;  1ZZN A;  4K4S A;  4J90 A;  4WFY A;  1SKS A;  5KFJ A;  2RHQ B;  1LWE A;  3HHE A;  3TEH B;  4IG3 A;  1JJH A;  2NUU G;  2JVO A;  2RIJ A;  2XEX A;  3A8K A;  2R7Q A;  2CQP A;  3S6E A;  3G6X A;  4KFB A;  4USI A;  3W2V A;  5G0R A;  5EWF A;  5GAH U;  1YJ9 S;  2W7P A;  3ISZ A;  4F4X A;  1N5Y B;  4F0K A;  1BWV A;  2BW7 A;  3CCR S;  2AYG A;  2LQ5 A;  3OUY B;  1N5Q A;  5IC4 B;  3G86 A;  2G0I A;  4AQY F;  4B3S F;  3EGZ A;  2VU5 A;  4LIW A;  1CUL B;  1EKR A;  1WDT A;  4P74 A;  5E2Q A;  3SXL A;  2V63 A;  2ZNZ A;  4L3N A;  3W66 A;  4ZLL A;  4XPC A;  4X64 J;  5F8L A;  2FJX A;  1QD1 A;  3BGF A;  1L3U A;  2DGO A;  3OBI A;  3NBP A;  3BN4 A;  2ZC4 A;  2HS3 A;  1NJX A;  1PYO B;  1KLN A;  2B7C B;  2ZFH A;  4RW9 A;  2AJ0 A;  5KFW A;  5L46 A;  3ENQ A;  5EDW A;  3CCM S;  4LFB F;  2GIR A;  1O0P A;  2M9K A;  2PFF B;  3R6G B;  2A6M A;  1M5H A;  3EXC X;  1K1Q A;  1JWW A;  4DV3 F;  2DH9 A;  1YLX A;  3N28 A;  5M2U A;  1CJK A;  4QYZ K;  3W60 A;  3JSB A;  4G1I A;  2PDA A;  1C4C A;  2VFT A;  3JSR A;  4TYB A;  2MQN A;  1CQM A;  1X4A A;  1JNR B;  1MG7 A;  2JWN A;  3MMB A;  5U47 A;  3V5R A;  3B4M A;  4EBD A;  1XNR F;  1FJ7 A;  1RYR A;  1FX2 A;  1TKX A;  3L7U A;  3FSY A;  4CH1 A;  1MW7 A;  1CG2 A;  5IQ6 A;  1CLF A;  1NSP A;  3GIK A;  2AWZ A;  1G4C A;  3FRZ A;  3TVY A;  2ADC A;  1B70 B;  3MAA A;  2BA9 A;  2VUG A;  2XWX A;  1N56 A;  1IKX B;  1FD8 A;  4K2J A;  3CGI A;  5B7W A;  1KQK A;  4UQG A;  3MMA B;  1GNK A;  1OYD A;  2VG7 A;  4ED7 A;  3U02 A;  5J2M A;  4ZA1 A;  1RT3 A;  2Y1J A;  1WEL A;  1TVR B;  4LJM A;  3K5N A;  2J8A A;  2ZBQ A;  5A8K A;  1P1L A;  2HIY A;  2YBV A;  1V5I B;  2BV3 A;  3R8Y A;  2LU1 A;  3MPU B;  4WTY A;  4E8U A;  5HRO A;  2VZ9 A;  2NXN A;  4V19 X;  4CZC A;  1H3D A;  4UT4 A;  4DV0 J;  4DR1 F;  2JC1 A;  3VGS A;  3IO1 A;  2YKA A;  2VG7 B;  3GPA A;  5HK4 A;  1TFW A;  2MZR A;  1XBW A;  2QA1 A;  3MM5 A;  4ZIW A;  2DR6 A;  1NSQ A;  2OAU A;  4L76 A;  2VHG A;  2IBO A;  2HS0 A;  2B4U A;  2UU9 F;  4OZ5 A;  4B3M J;  3SI8 A;  2UVV A;  3TJA A;  2AJ2 A;  1FCA A;  4YQW A;  3GSI A;  4I68 A;  1HBM B;  3QJJ A;  2DGV A;  4J7C A;  5CZV A;  2EKY A;  2PII A;  3HD2 A;  1UCN A;  3D6T B;  2BJ1 A;  1DZ5 A;  2N7C A;  3BQ1 A;  2WOM A;  1YDL A;  3PRD A;  4A46 A;  2KYZ A;  3MM7 B;  5CYJ A;  1HNV B;  3GG1 A;  1FDA A;  1U02 A;  1A0O B;  2FHO B;  2VDI A;  3VVT A;  2FB0 A;  2X1G A;  2ZH3 A;  3RW6 A;  2HND B;  3AOD A;  1Q4R A;  3DM2 A;  3B4D A;  5D0R A;  2RRB A;  4H4K A;  2EXU A;  3W9I A;  1SL1 A;  4USJ C;  1VC6 A;  4OI2 A;  2FVQ A;  4W98 A;  4BBY A;  1UW9 A;  5F0U A;  4PPD A;  1WTB A;  4LT6 A;  3HVR A;  3DN9 A;  1U8S A;  1S1X A;  4IOC Q;  4LRC A;  3RAQ A;  1RBL A;  4NLV A;  4C8N A;  4CNZ A;  4WCE Q;  2B51 A;  1YRU A;  4NYZ A;  2ASD A;  4IG0 A;  1I1G A;  2JJ4 D;  3HHL B;  2QX0 A;  2HMI B;  4M5L A;  4RNH A;  1D0E A;  2Z56 B;  5AJ3 F;  1YJW S;  2B9W A;  2QA4 S;  1T02 A;  3HMJ G;  3DRS A;  3I9V 9;  3SCI E;  5J2M B;  4LF8 F;  4LF8 J;  2KHD A;  3GFY A;  2W2P P;  1F5A A;  3K8W A;  3Q22 A;  1D9D A;  2VBX A;  4PYA A;  1URN A;  2HQ3 A;  2M88 A;  4H4M A;  2DGX A;  4ED5 A;  2IC3 A;  2RD5 C;  4DR3 F;  5KFY A;  4OYB A;  5ETV A;  1VRT A;  4X4N A;  1EJ7 L;  1FNO A;  4TLQ A;  3UN5 A;  2QFJ A;  4Z37 A;  2DNH A;  1OPI A;  1PJ5 A;  4OYX A;  4O44 B;  1LWC A;  4QR0 A;  1KEK A;  1PYT A;  2P9C A;  3HHL C;  1GX6 A;  3Q24 A;  2VV5 A;  3MR2 A;  2MEW A;  2Z0G A;  3LUY A;  4DQI A;  3ILO A;  2E1C A;  2WVE A;  3D0G E;  3MD1 A;  4HKQ A;  3B8H A;  4K2X A;  2Z2Y B;  2X7I A;  3MTJ A;  4ZHR A;  1UVN A;  3PW5 A;  3HK2 A;  4GKK F;  3MEC B;  2GCF A;  3BGR A;  3THT A;  4KPY A;  1NK8 A;  5EN1 A;  4HH0 A;  4MIA A;  2UUA J;  5J1E A;  2Z30 B;  5HVF A;  3A4T A;  4WWS A;  5B0C A;  1LXJ A;  3N6M A;  3GII A;  2VQE F;  3E2E A;  1FTC A;  3L9Z A;  4NE9 C;  5DGA A;  1QAJ A;  2YNH B;  3ELH A;  4OX6 A;  4AFF A;  1HBO A;  3JTP A;  2YX1 A;  5C7P A;  3BQ2 A;  1FE0 A;  2U2F A;  3OTB A;  4MMO A;  5L1J A;  4NLG A;  3MCS A;  1C0U A;  2HKE A;  2HFV A;  3TEG A;  3G9C A;  2DNQ A;  2QLX A;  4NA1 A;  3UCG A;  3AA9 A;  1H38 A;  4JV5 J;  2WB4 A;  1FFW B;  2GJ2 A;  5LOQ A;  4HH1 A;  2O1P A;  3OFE A;  5L1L A;  2I0X A;  2V9W A;  4F3O A;  4FDF A;  3GJR B;  2XMW A;  2LQ8 A;  4PG5 A;  1ELO A;  1P1T A;  1Q8B A;  1AZS B;  3MCO A;  5K9F A;  1RAC B;  2J7W A;  2W1B A;  1N52 B;  1NO8 A;  1S6U A;  2LXI A;  4PG4 A;  2NR0 A;  2CAD A;  4FBU A;  2IM2 A;  1TK0 A;  3HT3 A;  1WTF A;  3J80 U;  4YDX A;  4LFB J;  4USK A;  4X62 J;  5EWG A;  1WKJ A;  4F50 A;  1T11 A;  1IVZ A;  1FRM A;  4PQU B;  3OT9 A;  2PI5 A;  3T5L A;  1RAI B;  2BAB A;  1OQ3 A;  3KLH A;  4C3K A;  1UW4 A;  2UUC F;  1Z4U A;  3A8J A;  1MWY A;  3MFI A;  9ATC B;  2EBG A;  1HIY A;  1CSJ A;  1Y5L B;  3W1Y C;  4Q45 A;  3MED B;  1C2P A;  2B9X A;  2FHK A;  3HI9 A;  3M7V A;  4L6V 3;  4P9S A;  5KFX A;  4OZL A;  2HRY A;  4CI0 B;  1UEV A;  3DMJ B;  2GGP A;  3PR4 A;  1VQ8 S;  2ZC3 A;  3GFZ A;  1FK9 A;  1SH2 A;  2L9D A;  1WJ9 A;  4KO0 B;  3E01 A;  2IDL A;  3CE8 A;  4P73 A;  4YB5 A;  1S0O A;  2FLN A;  3PKM A;  1KQG B;  3CT9 A;  3ZTS A;  2X1B A;  3KDO A;  3PYD A;  2LVW A;  4DCP B;  1HMV B;  1VQP S;  3V6D A;  4XDD A;  2ASY A;  4K50 A;  3OJU A;  1PSD A;  1WC0 A;  2FJA B;  3OR1 A;  1XR5 A;  2LCW A;  3G87 A;  1IBM F;  4YEA A;  2EFV A;  1ULR A;  2VKZ G;  4RX6 A;  4ECV A;  2Y0S D;  3FEZ A;  1RA6 A;  4RUA A;  3IRX A;  1GMU A;  3C6U A;  1F60 B;  2IJN A;  3L7O A;  4CO3 A;  3PIO Q;  2OO4 A;  1UAW A;  2MMY A;  3HVW A;  3HP6 A;  1LK5 A;  1KN6 A;  4I1T A;  4X4Q A;  2YWH A;  2IRX A;  1A7G E;  2IYG A;  2M2B A;  3M30 A;  5F0W A;  2LKZ A;  3TX8 A;  1ROF A;  1AB8 A;  2OD4 A;  2O5D A;  1BQM A;  2CPI A;  2JNJ A;  1F5B A;  3OFH A;  4NAS A;  3TA0 A;  2DK2 A;  4TU7 A;  4QWE A;  2GGP B;  2AU0 A;  2ZOM A;  1X4D A;  2X3D A;  1TL3 B;  2MQQ A;  1QTN B;  1FEH A;  1NME B;  5FD1 A;  3CDW A;  3M32 A;  2MGZ A;  3KHR A;  3C6T B;  1SQG A;  2ZVI A;  4FVM A;  4EO8 A;  4PG8 A;  5KFO A;  3JSM A;  4Z7C A;  4LUB A;  5MLC V;  2ZH1 A;  2QN6 B;  4HLB A;  4R0E A;  1RU1 A;  4JI8 F;  5J1E B;  1QAX A;  3DLE B;  3BGR B;  2OPR A;  4CO1 A;  4C11 A;  1WG4 A;  2XMM A;  3HD1 A;  3HKW A;  4GRS A;  2GAH C;  1NJW A;  4DSI A;  2GA7 A;  1SV5 B;  2ZUG A;  3ZZP A;  4QW8 A;  3TR5 A;  1M0S A;  3WQP A;  5KG4 A;  4R5P B;  3BSC A;  1LWX A;  3FVY A;  3JXO A;  5FJ4 A;  1Y4Z B;  4N77 A;  3KLF A;  2V0N A;  1TL3 A;  3N0V A;  1U4B A;  4KKO B;  1BMQ B;  3I5B A;  4TXS A;  1R43 A;  4WXW A;  2ROP A;  1FWP A;  1TKZ B;  3KKF A;  4M5N A;  1UWA A;  2HFN A;  3AD8 C;  4ZPA A;  2R7R A;  4ZVR B;  3H90 A;  3UN3 A;  3OTO F;  2XI3 A;  2FJW A;  1XN9 A;  2CJB A;  3M8Q B;  1ITP A;  2G2Z A;  4JOU A;  1JXL A;  3LW5 C;  4LRE A;  2MKI A;  1YIJ S;  2FGC A;  2XMJ A;  4C0H A;  4QYR A;  4F4Z A;  1GXL A;  2OSQ A;  1SL2 A;  1JLQ B;  4M63 A;  4BHQ A;  4L75 A;  1O5J A;  2ILZ A;  2WW8 A;  1FT8 A;  2BAC A;  3OXL A;  4EI2 A;  3D0I E;  3DLK A;  4EWT A;  4ECW A;  4C6A A;  1X4B A;  1Y5I B;  2EFQ A;  3R7B B;  5M2R A;  1JK9 B;  1VQ5 S;  1TUV A;  2RHS B;  2Z2M A;  2ZIT A;  3I0S A;  3LTO A;  2A0F B;  3OTE A;  4WFA Q;  1N36 F;  1VIS A;  1WHX A;  4PXC A;  1DJ0 A;  1F3F A;  5DG7 A;  4JI7 J;  3IWL A;  4B9T A;  1SV5 A;  5LJ3 Y;  2C2N A;  4FYW B;  4DMZ A;  2PD1 A;  4ZLP A;  3IA0 A;  5AT1 B;  4OYZ A;  1QUV A;  1UEU A;  4C8L A;  4ZMM A;  3SV3 A;  4ED1 A;  3KLH B;  2NZ4 A;  3KJV B;  3FQL A;  4B9L A;  1SI9 A;  3DGP B;  1XMB A;  1VQL S;  5C42 B;  3MM9 A;  1FXD A;  2VAS A;  5HLF A;  2GV1 A;  2WBR A;  1U6Z A;  2WOM B;  4FXV A;  4QIV A;  4CRJ A;  4U6P A;  4OL8 A;  1N88 A;  2ZZM A;  2DBB A;  1VC0 A;  5HQ8 A;  1UVK A;  1PG5 B;  2ZVS A;  2UUW A;  2CXE A;  2D7S A;  4NEY A;  1MSW D;  2XZT B;  5KOW A;  3H7H B;  3ZTR A;  1C1B A;  2ZOF A;  2YNF B;  1S1V B;  3G96 A;  1U0S A;  3DRS B;  1D8Y A;  4NZ0 A;  1TV6 A;  3PHE A;  1Z2L A;  2FVP A;  3LP2 B;  1S10 A;  1UPM B;  2K06 A;  2WZ1 A;  2WTF A;  3HT0 A;  3MM8 B;  3JTO A;  1NH7 A;  3KJV A;  4ED8 A;  2MYF A;  4B3T F;  1AFJ A;  1FA0 A;  2UXB F;  1S5Z A;  5KFB A;  4BC7 A;  1QSS A;  3Q86 A;  1DTQ B;  5HAT A;  4ITS A;  3TA1 A;  4Y28 C;  2QMU B;  1NPK A;  2DNL A;  2E5L J;  3LAL A;  1ZAX A;  4C7Q A;  1N54 B;  2QGF B;  2LXU A;  3FSX A;  4R5P A;  1U0H B;  4UST A;  1JLA B;  1NDK A;  4ECU A;  1NDC A;  3BO3 A;  1GX5 A;  3EZU A;  3E01 B;  3MPV A;  4LF5 F;  1YK9 A;  1Q16 B;  3TZZ A;  1PJ7 A;  4DV5 F;  1U6F A;  4FNI A;  3D54 A;  4OX8 A;  4ED3 A;  4JI5 F;  2EBE A;  3LAK A;  3PRB A;  2HIQ A;  2KXH A;  3ICL A;  3ZZY A;  2GNK A;  4WF9 Q;  3HKZ D;  3KG1 A;  3MAA B;  3MD3 A;  3BB5 A;  2ADB A;  2UUB F;  2WRM A;  1V6H A;  3HX9 A;  4NLD A;  2XY7 A;  1SKW A;  1RTD B;  4FS1 A;  2H4W B;  3J7Z 5;  5H9E J;  1RAB B;  2DGQ A;  4P72 A;  2MQL A;  1C1C A;  1XEZ A;  3VAM A;  2V2Z A;  1DY3 A;  4BWJ A;  1WSV A;  4F67 A;  1OSC A;  5KG5 A;  2IM1 A;  2DNZ A;  3MUV P;  2J6U A;  1DTT B;  1FKP B;  1QDU B;  2W9C A;  1TAU A;  1YIT S;  3DGV A;  4RNN A;  2W7O A;  2CPZ A;  3DI6 B;  5IM0 B;  4ZP6 A;  3OLA A;  4YOE A;  1PAE X;  1YWX A;  1IM4 A;  2RU9 A;  3B6B A;  4M5J A;  1N6Q A;  1HWI A;  2NXU A;  2HHH F;  3I5A A;  3GIL A;  2QLW A;  2RUS A;  4KHR A;  3RBD A;  4B9S A;  2AX1 A;  4RUB A;  2FJB B;  3AXK A;  1V9O A;  1N32 F;  1HW9 A;  1FO1 A;  2R7W A;  1RLC L;  1L5U A;  4IO9 Q;  1RBA A;  1PCA A;  2VF3 A;  1T95 A;  3A8E A;  4K8R A;  1H72 C;  3C16 B;  3IM8 A;  3P8B B;  1G6B A;  1R0A B;  3GJQ B;  1FJG F;  1CJT B;  4ERD A;  3GWC A;  5IFM A;  1O8B A;  2CZ4 A;  3RAM A;  3VQT A;  1OSD A;  1RIS A;  1IWG A;  1MMN A;  4RJV A;  2DNM A;  2Q43 A;  4KYZ A;  3AD7 C;  3NL0 A;  5I3P A;  3HLU A;  4C4W A;  4F3Q A;  2AGO A;  1UZH A;  4K7Q A;  1RQ0 A;  4DQP A;  4DF4 A;  2GMH A;  1RAF B;  1S72 S;  3DDI A;  3CCQ S;  1JLG A;  1N5V A;  2QA4 G;  4O3Q A;  1F3V A;  4JB8 B;  4K5R A;  2F3J A;  2AKW B;  2OP5 A;  3NS6 A;  4DCJ B;  4P7T A;  3PEH A;  3DLB A;  1L3S A;  3FUY A;  4DQR A;  1N4L A;  3BPS P;  3H2L A;  4ZVG A;  1S76 D;  3SFU A;  2E5J A;  5E3C A;  3M9N B;  1SXL A;  1SJQ A;  2KVI A;  4DR4 F;  1ZM2 A;  5LMU F;  2UXC F;  4F04 B;  3SYZ A;  1Q1K A;  4N56 A;  3C14 B;  3SIP B;  4AXJ A;  4Y2A A;  3M1V B;  1U2C A;  4H54 A;  4NA3 A;  3KUE A;  2I6W A;  5DDR C;  4CLK A;  3J81 j;  2FIU A;  3MR3 A;  3J7Y I;  3Q23 A;  5ETL A;  5HMX A;  2ZBC A;  5KT2 A;  5DGB A;  5HP1 A;  4ZVH A;  2PMH A;  1N33 J;  2JL9 A;  3JAM Y;  3TZX A;  4X4T A;  1HHT P;  1FHT A;  4OI6 A;  2OFG X;  5A8R A;  4ZJL A;  4QIE A;  1CJT A;  2C2K B;  2XY5 A;  1TKT B;  2CPD A;  4GC7 A;  4LF7 F;  4CM0 A;  2BJE A;  2AEM A;  3DRY A;  4YB1 P;  4EO6 A;  2NUH A;  2FDN A;  2B7B B;  5GME A;  3SBM A;  1TVR A;  3EVW A;  1HPZ A;  1RHK B;  1RKJ A;  1TK5 A;  2R4F A;  3PCO B;  1KD1 T;  2RJZ A;  3GCW P;  2H5I B;  2R7V A;  2AX0 A;  2GS8 A;  4JV2 A;  3MED A;  1L3T A;  2CQG A;  2HFU A;  3OPK A;  3R5G A;  4AXI A;  1FF2 A;  1S48 A;  3MMC A;  1TMM A;  4ECX A;  2YKN B;  4NEZ A;  2YWF A;  3AQP A;  5DET A;  3MEC A;  1IKY A;  5A2Q U;  2CQH A;  3MM7 A;  1XR7 A;  2DRA A;  2B6A A;  1RT6 B;  4RLE A;  1NUE A;  1VS3 A;  3D66 A;  5D4P A;  1HAR A;  5A8W B;  2DGT A;  5I42 A;  2Q1L A;  2DEJ A;  2HHP A;  1VQS A;  5EX3 A;  3H4D A;  1HBM A;  4OV6 A;  3KWM A;  3N6N A;  1A6L A;  2DIU A;  4ZJO A;  4U96 A;  1RCX B;  3OLB A;  4B3O B;  3NGS A;  3RBZ A;  4R25 A;  3W9J A;  4F2R A;  1RYS A;  2KYX A;  2MJU A;  2W4D A;  3K17 A;  3AB4 B;  1DHM A;  3LP1 A;  3Q0A A;  2IHR 1;  4X4S A;  3C8Y A;  3HHL D;  2O67 A;  4J9V A;  1NM2 A;  2BXJ A;  3I9Z A;  5CHC B;  5T7L A;  1ZM9 A;  3QWP A;  4ETX A;  2AGP A;  2EC0 A;  2B8Q A;  1GFW B;  1F0X A;  1YRX A;  4FS2 A;  3K0J A;  3UR3 C;  4QWD A;  1FEE A;  2W2N P;  2OI2 A;  2V9K A;  3R1L A;  2CNO B;  1KFS A;  5GAD U;  3AOB A;  1JLE B;  2BAN A;  3I6P A;  2BRL A;  4IQM A;  4MYU A;  2BR0 A;  3UD3 P;  3THP A;  4DPO A;  4NZ6 A;  3TQ1 A;  4I69 A;  1B64 A;  5D0G A;  4ID5 B;  1F6T A;  3I31 A;  4DV6 J;  4GKK J;  3E51 A;  3BS9 A;  1RAH B;  3K5O A;  3T1H J;  4UOC A;  5KFM A;  2R2R A;  2BDP A;  1S0M A;  4LMZ A;  1Y3K A;  1FKP A;  2GJI A;  3BH7 B;  4I56 A;  1EET A;  5CYM A;  1FE4 A;  1RT5 B;  1RP5 A;  1GAO A;  4CLW A;  3RYL A;  3FSI A;  1VMB A;  4MH8 A;  4C3M A;  2RU3 A;  3D5M A;  2HNY A;  2J6T A;  1C1C B;  1ARO P;  4LVO P;  2CQ0 A;  3SEO A;  3O6Q A;  3DLG A;  5F8J A;  2DH8 A;  4ZVT B;  5KFV A;  4YR2 A;  1H7X A;  1WDD A;  3NGD A;  1HNV A;  3CXC R;  3N6L A;  4FYV B;  4N5S A;  4URS A;  2G9O A;  3FGV A;  3PO5 A;  1SC3 B;  3GB0 A;  1Q8I A;  2YH0 A;  3M6X A;  5K8P A;  5DG8 A;  2KH9 A;  2OHD A;  1WEX A;  2XMV A;  1BLU A;  5AXM A;  3QZ7 A;  5IT9 Y;  2ZH2 A;  1KQS R;  1K73 T;  1IKW A;  3OV7 A;  2CWK A;  4J9N A;  3UNG C;  4UOG A;  2AZ3 A;  4B3R F;  2HGN A;  3GR1 A;  3FEY B;  2FVC A;  3OD2 A;  4M5D B;  5JVG Q;  3GFH A;  3D3B J;  4FP9 A;  3OTD A;  3V81 B;  1IUJ A;  1JLA A;  1N36 J;  1TEL A;  6FD1 A;  1S6P A;  3H0P A;  3JYT B;  1VC5 A;  2RB7 A;  3HF5 A;  4CM2 A;  3KMQ A;  3NNC A;  3LAM A;  3QRR A;  4BWM A;  3CCS S;  3DXB A;  2HMI A;  1IKW B;  4NML A;  2EKN A;  3D2W A;  3CIZ A;  4Y00 A;  1YHQ S;  4NLT A;  1SJF A;  2QTW A;  1RWK B;  4GO5 X;  4OYM A;  3UQS A;  5KFK A;  3LH2 S;  5ETR A;  2XCP A;  1F1B B;  1NSK L;  2VBY A;  1R27 B;  3DOK A;  3PV8 A;  1HQU A;  1HQ2 A;  1QE1 B;  2CPY A;  2MKJ A;  2OLW A;  3P4U B;  4Y65 A;  5GMD A;  4LRB A;  2ZJR Q;  5J2N A;  1U45 A;  4G1P A;  3TZY A;  2QL7 B;  2IM3 A;  5A6P A;  5HQM A;  1BE4 A;  4WFX A;  4ER8 A;  2KRB A;  3MF5 A;  3W61 A;  3EGV A;  4LR8 A;  1S6Q A;  2CIM A;  1HBU A;  1S59 A;  1MNE A;  3BKF A;  3QT5 A;  3W7B A;  3BBB A;  3HVT B;  3M1V A;  2E1M C;  5F8H A;  3HHN B;  5KFQ A;  4LSL A;  3SZ2 A;  2YNG A;  4I7F B;  5LT5 A;  1FRI A;  4UW2 A;  4DXL A;  5B0D A;  3PX6 A;  4PQA A;  1U6B A;  2KHC A;  2DKO B;  2B5J A;  4F4Y A;  3CJ3 A;  3GU0 A;  3TA2 A;  4N8N A;  2QSW A;  2CPE A;  3EWG A;  3O8W A;  3Q8S B;  3CMQ A;  2BKO A;  3CCT A;  1RT7 B;  4Q44 A;  2KM8 B;  2AHO B;  1BQX A;  4KRW A;  5ETQ A;  3BDE A;  3VTI A;  4DS5 A;  3PW7 A;  4ZCM A;  2APO A;  2H5J B;  1GMW D;  2JDJ A;  2DYA A;  3ET6 B;  1GT8 A;  1Y10 A;  2OPR B;  3WZ0 A;  4LSZ B;  4HAC A;  3IN5 A;  1RTJ A;  2HK2 A;  7FDR A;  4LSN A;  5K8O A;  1CEZ A;  4JP8 A;  1JX4 A;  3BH6 B;  2KT3 A;  5E7O B;  2MGZ B;  3NRB A;  3EPI A;  3DLK B;  1RWN B;  4PWW A;  4NCA A;  5GMK a;  1KLM B;  3W62 A;  1F9E B;  3KG4 A;  3BO2 A;  2DNK A;  3B78 A;  4I6Y A;  1TZ0 A;  3VAH A;  3T1H F;  1XMO J;  2HZV A;  5D3G A;  1OMS A;  2CPH A;  1XNQ J;  3QO9 A;  4WZM A;  4TQS A;  4MAK A;  2MZQ A;  4IDK A;  1ZPV A;  4C0B A;  3MMA A;  4QIW D;  5DG9 A;  4X4R A;  2KM8 C;  2PSZ A;  4F7V A;  1IR2 A;  2BKP A;  1N5S A;  2FZG B;  3BBF A;  3ISN C;  2BM0 A;  3P5T L;  1YBA A;  4CT8 A;  1R0C B;  3MR6 A;  2LQB A;  1RT1 B;  1ZYQ A;  1R8C A;  2W9B B;  2JZ5 A;  2KXF A;  2EFG A;  3P6Y C;  1QAI A;  1HNW F;  1D8Z A;  3V6D B;  1IKV B;  4NPO A;  5H1S V;  4Q5V A;  1YKW A;  1RHR B;  3G8Q A;  2ZM6 J;  1RT6 A;  5AXN A;  4ICL A;  3IGN A;  2Z4P A;  5A2Q Y;  3DU5 A;  3M2U A;  3RW7 A;  5KG3 A;  3OUY A;  4DZ6 A;  2V5H G;  2UUB J;  2ZDO A;  4HT7 A;  5E3P A;  1KVJ A;  3LGM A;  4ECT A;  1NJZ A;  5G0R B;  1X9S A;  2MLY A;  3FMB A;  2IM0 A;  5LXY A;  3JSM B;  3TI0 A;  2HYI B;  1T9V A;  2OJ3 A;  4OLO A;  2C28 A;  4LF4 F;  3GR0 A;  1TP7 A;  2LA4 A;  3PAC A;  4FYX B;  2VC1 A;  5HN0 A;  2CG4 A;  2DXD A;  4KH1 B;  4DV5 J;  4EZ6 A;  5HJY A;  1HPZ B;  1RTZ A;  1EKS A;  3QQC D;  5KG6 A;  2BJ9 A;  3TNV A;  5M2P A;  3G2X A;  4ZLJ A;  2YNI B;  3OXF A;  3OSN A;  1WOS A;  4YR0 A;  2QV6 A;  2WON A;  2XSJ B;  1T0T V;  3FFI A;  3RRH A;  5CCL A;  3CIM A;  1BQN A;  3H98 A;  4N7T A;  3MXH P;  4AL5 A;  1VHI A;  1JIH A;  4LR9 A;  1J27 A;  4MIW A;  2LEP A;  2RRN A;  2GHV C;  4L73 A;  5L39 A;  3OHA A;  3MR5 A;  2E66 A;  5SZT A;  1X4G A;  2IFX A;  2J7U A;  2N4D A;  2DCU B;  1VRQ C;  2W2M P;  3R5B A;  2J0Q D;  1SCJ B;  4KHM A;  3NOG A;  3GLJ A;  2GO8 A;  4DEZ A;  1Q0N A;  2ZKU A;  1X7V A;  5BYR A;  3AA8 A;  3OXG A;  2CRL A;  5DQG A;  3KFW X;  1BQN B;  4MJK A;  3QT8 A;  3GIM A;  2J5A A;  3SSS A;  2GVD B;  3GSD A;  2EW9 A;  1RTH B;  4DV6 F;  2VA3 A;  1NK9 A;  1J2V A;  2MKS A;  4AYB D;  2MLZ A;  4ECY A;  2RQ4 A;  4QR2 A;  1Q79 A;  5B0F A;  4P2X A;  4YHH F;  1IBL F;  2X1F A;  2L9N A;  4DF8 A;  1IJF B;  1Y9O A;  3VAK A;  5L1I A;  4BDP A;  4QWB A;  3C46 A;  3IBF B;  4KQZ A;  4O3R A;  4ZP7 A;  2CAJ A;  4LQ9 A;  3QLH B;  2AQ4 A;  1B0V A;  2MKK A;  4IOA Q;  1JXE A;  1N0U A;  2ZHA A;  2FHM A;  3Q8V A;  3TP2 A;  4PPZ A;  1SJR A;  2V2K A;  2ZZN A;  1VLO A;  3JYT A;  1Q7L B;  2RIL A;  3ZZU A;  5T14 A;  1HHS A;  4C48 A;  1YJU A;  2XI2 A;  4DV1 F;  4UUW A;  4NLU A;  2CDQ A;  2KG1 A;  2QYG A;  2ZH5 A;  1VBY A;  4J9O A;  2GVZ A;  1N6Q B;  1K47 A;  1VLY A;  1VQM S;  1A9N B;  2B43 A;  3JQM A;  3A13 A;  5ETN A;  4RNM A;  3B54 A;  1CS4 B;  3TAN A;  3T6B A;  3BO4 A;  2CYY A;  1Y00 A;  1HNZ F;  3PM9 A;  3LPE A;  2K1R A;  3C3L A;  1AXQ A;  2IJR A;  2V4J A;  3RUB L;  1YSJ A;  1YGY A;  2LFV A;  4GC6 A;  2CQC A;  5JUM A;  1FRX A;  2BM1 A;  4PXB A;  1REV A;  2KKH A;  1RTD A;  1S1W B;  4RO0 A;  4RKU C;  5IWA F;  3VAF A;  2BQ3 A;  2MQ8 A;  4RWX A;  2DIS A;  3RB3 A;  3M9M B;  4DV3 J;  1LV5 A;  3U1M A;  4IR1 A;  2UXD F;  3DOM A;  3M8R A;  1X4H A;  3BV8 A;  4I2P B;  1RHQ B;  4RR5 A;  3PJ9 A;  1GTE A;  1XWL A;  2A10 A;  2DT9 A;  3BGL A;  2QE5 A;  6FDR A;  5KFZ A;  3M8S A;  1RT4 A;  4ILM A;  1WHY A;  3IM9 A;  3T19 A;  2AGQ A;  1C0T B;  1T05 A;  2IVY A;  1VQK S;  4Q8E A;  2CNL B;  3MAQ A;  1S0V A;  3IXQ A;  3F73 A;  3LOU A;  2EVZ A;  2HWH A;  2Z2L A;  4DR7 F;  1M1G A;  1G1X A;  3MR7 A;  2YKO A;  1LW2 A;  4JI6 F;  4KC5 A;  2EWH A;  4YS2 A;  2VQF F;  2XZW A;  5CD4 H;  1H2T Z;  1FFS B;  2P8I A;  4WBF A;  2KFY A;  4DFJ A;  1V3S A;  3NG8 A;  4C8Z A;  2BKN A;  3DRR A;  1CC7 A;  3CCV S;  2XSF A;  4P2S A;  2COL A;  4CYU B;  3OVS A;  3R6L B;  4IKA A;  4OJ1 A;  5LMU J;  1UVJ A;  1NRK A;  1RHJ B;  2ZE2 A;  3TVZ A;  4ZVO B;  3SCK E;  4JI0 F;  4DV7 F;  1H7W A;  1Q95 G;  2LEA A;  2RDD A;  1JLQ A;  1NKE A;  4USM A;  4FZV A;  1VIO A;  2QO3 A;  1UWB A;  3PJW A;  5CYQ A;  4NMX A;  2RAQ A;  1YG0 A;  2IVF B;  3HUL A;  2BE9 B;  2XGQ A;  2P9E A;  4FVC A;  1NK4 A;  2HRT A;  2D1C A;  2DCL A;  3C19 A;  1F9F A;  2V68 A;  2GIF A;  3CJK A;  3I56 S;  2LEB A;  1EIY B;  3MM9 B;  1F2G A;  1HQU B;  5KFU A;  4EYI B;  1OQ6 A;  1RWM B;  1FX4 A;  2HWI A;  3MM5 B;  1NK5 A;  2ALY B;  2FTR A;  3T9N A;  2HVE A;  5KFD A;  2BUN A;  2ZBP A;  3OR1 B;  3M8P B;  4D3G A;  1N5T A;  1SPB P;  2W25 A;  1X5O A;  2QIF A;  1JNZ B;  4PUO B;  3PO4 A;  1I3O B;  1WKK A;  2IPO B;  1E6Y A;  5F8I A;  3AOA A;  2BJ7 A;  3GTY X;  5B0A A;  1DUR A;  4ANC A;  1S1T B;  2I5J A;  4LIR A;  5C42 A;  1H6K X;  2OUG A;  2OTL S;  2RKI B;  3QAT A;  4HVZ A;  2BQR A;  3SMZ A;  4MFB A;  3TJ8 A;  1FRL A;  2C2D A;  4LF6 F;  2CJK A;  1KBR A;  1TR0 A;  2MZS A;  3C66 A;  1KFD A;  4PYD A;  2WW4 A;  3MPY A;  3ONQ A;  4NRU A;  4Y2K A;  3CJK B;  3KDN A;  3B82 A;  2HBY B;  4OHW A;  5L9X A;  5FII A;  3ZTP A;  4YDD B;  4XIU A;  2RDJ A;  1NZA A;  1S1W A;  1SKR A;  1XNR J;  1PYS B;  1QLN A;  4DJB A;  2LU2 A;  1KON A;  2K2P A;  4YFU A;  4NLX A;  4ETZ A;  5I3U B;  3KK1 A;  3KNA A;  3T6J A;  4F26 A;  2DGU A;  3ZTO A;  3R9L A;  5BR8 F;  3VZH A;  4ECZ A;  1RWP B;  2UUC J;  2BX6 A;  4RUC A;  3RR8 A;  4WP8 A;  2GX8 A;  1MN7 A;  2K7J A;  3R2C J;  2H5E A;  2ZH6 A;  2JVR A;  2R7X A;  5JVH Q;  4NLY A;  5ETK A;  2QL9 B;  2VQE J;  1AZS A;  3DRR B;  2XCA A;  4K4V A;  1FJG J;  2ZWO A;  1S1U A;  2HEK A;  4ED6 A;  2DRB A;  5HVG A;  2MZJ A;  4OYA A;  3CC7 S;  2XLJ A;  1LW0 A;  1WG5 A;  4O4G B;  1NKC A;  3NBP B;  4ZDN A;  3LWL A;  1EB0 A;  3IMQ J;  4QPX A;  2XQC A;  2R7S A;  4CTA B;  2DNP A;  5A8K B;  2DPJ A;  4B3T J;  4IFY B;  1C0T A;  4LBP A;  2O66 A;  3QIP A;  1G7C B;  3EIC A;  3EDQ B;  5CCM A;  3QLH A;  3TRG A;  3DCA A;  4B9M A;  3BF4 A;  2AD9 A;  3OQ2 A;  3DOM B;  1RE1 B;  3E8O A;  1NHV A;  4J5O A;  4LBI A;  4OHV A;  3NS5 A;  4KB7 A;  4C8K A;  2YQ3 A;  2OPS B;  3CPW R;  4FKY A;  4ELU A;  4K0K J;  4MT1 A;  1R8P A;  2VQF J;  2RS2 A;  2I2Y A;  2KFN A;  1X5S A;  3D4J A;  3R97 A;  5GAE I;  2O3D A;  5FDL A;  2DO0 A;  3VAL A;  3DLL Q;  2QJ3 A;  4K4X A;  4C8M A;  4QR1 A;  3W9H A;  4ZIV A;  3MOJ B;  5KFL A;  3TAM B;  3K5L A;  2HLU A;  4N8O A;  1M1H A;  1IXK A;  1PBU A;  2DY1 A;  3CJ0 A;  3BKU A;  2FUG 9;  5LL6 d;  4CLF A;  5GAG I;  1KHV A;  2HAI A;  2CJA A;  4I0W A;  3RJM B;  1PGZ A;  1YBT A;  3LP0 B;  3N5B A;  1YI2 S;  4JYA J;  3ZTQ A;  2VDH A;  3FFI B;  4JI1 F;  3QRQ A;  1APS A;  2UVW A;  4H4M B;  5CZX A;  4IYQ A;  5LM7 E;  2HGM A;  2MY7 A;  5FDL B;  3SCJ E;  5D8H B;  4ATN A;  3IAM 9;  3G8S A;  3FZ2 A;  3JAM U;  1B99 A;  4J91 A;  3ILI A;  5D78 A;  3K5M A;  1NK6 A;  2AF6 A;  3BDP A;  2LQ9 A;  3TAP A;  1RT7 A;  2IY5 B;  1KDN A;  4DG1 A;  5H9F K;  4EU0 A;  1B7Y B;  4OJG A;  4KHP J;  4FNH A;  4KH0 B;  4DR2 J;  4IG0 B;  2PFD A;  5DZ6 A;  4RPF A;  3ZFV A;  3GQC A;  2HHW A;  3CJQ A;  3EJM A;  1AA1 B;  3MAH A;  3S1T A;  1GTH A;  3PY8 A;  1Y11 A;  4CH7 A;  1QY7 A;  1BQM B;  3M8Y A;  2QL5 B;  3WIU A;  1ZH5 A;  2WVB A;  2YNG B;  2YPY A;  3MCM A;  1G3O A;  1IWA A;  4WXO A;  4DSF A;  4AE5 A;  3L09 A;  2V69 A;  2NSC A;  3MOZ A;  1RAJ A;  1VK8 A;  1RHM B;  4W90 B;  1RWX B;  3V6K A;  1X0F A;  4AND A;  2B4P A;  4NCB A;  1TL7 B;  3ILL A;  3MHY A;  3T1A A;  4DLE A;  1HKA A;  4P2F A;  1M5P C;  4DWI A;  2DXE A;  4OLP A;  4CWB A;  2F8H A;  2H65 B;  2E9T A;  3PIP Q;  3CC2 S;  5KFF A;  3UI3 A;  5IQQ A;  2G2Y A;  2NYH A;  4J9Q A;  5CA5 A;  2RQC A;  3K8V A;  2XS7 A;  4AD6 A;  1EP4 A;  4QOT A;  1UVI A;  3OTC A;  1W25 A;  5MAO A;  2EK1 A;  2FGO A;  4IFV A;  2CVI A;  3G71 S;  5HLF B;  5CXT A;  5KTQ A;  2ZBI A;  1VBX A;  1FD2 A;  4UOF A;  3H42 A;  1LWF A;  4I2Q B;  4HI1 A;  2RVJ A;  1OY6 A;  4XDC A;  3H25 A;  5CYM B;  1FRJ A;  3KHL A;  4DR2 F;  4QCL A;  3D1H A;  2N82 B;  2XS5 A;  3S8S A;  1AT1 B;  2M8H A;  2RKI A;  2M70 A;  4F4W A;  2XHW A;  3RG6 A;  1WUU A;  3U7J A;  3ET6 A;  4JI8 J;  1TQL A;  3ZZT A;  4JUZ A;  1NJI T;  1IR1 A;  4YB7 A;  1FJC A;  2E29 A;  5LXR A;  4UZC A;  5HRO B;  2J7K A;  2BRK A;  3QSI A;  2CJY B;  1BD6 A;  3IS9 A;  5ETO A;  4EEY A;  4J37 A;  2B4O A;  2VFS A;  5CD4 A;  3Q83 A;  1WEZ A;  1XIQ A;  4ZPB A;  2XS2 A;  2RQM A;  2M0G B;  3P3D A;  4PWD A;  4UQT A;  1LWC B;  2V6A A;  5ETM A;  3OL7 A;  2FVS A;  3T41 A;  1XJW B;  4DL7 A;  4USU A;  3HVA A;  4RU2 A;  1DQA A;  3H59 A;  3PDN A;  3UPF A;  5D77 A;  2RUG A;  5GVQ A;  2ZHO A;  4DLG A;  1U47 A;  4DR6 F;  1HWJ A;  3FQK A;  3WDO A;  1WOO A;  1GXU A;  3AHP A;  5D4L A;  5DM7 Q;  4C8Y A;  3HCX A;  1OO0 B;  3D6H B;  3PFE A;  4ZVP B;  1J5E F;  2HZA A;  2BJ8 A;  1X4F A;  4FXW A;  4ID5 A;  5DZ7 A;  4DQS A;  1XNQ F;  1TFY A;  2EFP A;  5F41 A;  2HPU A;  3LO3 A;  3SDE A;  3DOK B;  3JB9 k;  4M94 A;  1S9E A;  1LQ9 A;  4I64 A;  5KFE A;  4A8M P;  1CJV B;  1PAU B;  2ZBR A;  2NXC A;  1YBU A;  3KJQ B;  3PYF A;  4NL5 A;  3PXG a;  4A48 A;  1CS4 A;  5K8M A;  2G2O A;  2ZJQ Q;  2UXC J;  5KFS A;  1NKB A;  2QT7 A;  4Y0F A;  1F5C A;  2QLF B;  4A4J A;  5IS2 A;  1NCL A;  3BBC A;  3MMC B;  5BXI A;  1F9H A;  1DQ9 A;  3GJT B;  1RAE B;  1AFI A;  1MRO A;  1SKU B;  3BGU A;  5F9L A;  2HVZ A;  4WYW A;  4CLS A;  1HD0 A;  1VGY A;  4RW4 B;  1LFP A;  3V2U C;  4Q8F A;  2K3I A;  3BGO P;  3BSA A;  3W3S A;  3MTK A;  1SIW B;  1IN0 A;  2QMW A;  4CO2 A;  3HFZ B;  3J81 Y;  1J5E J;  1FKO A;  2OEJ A;  5ETT A;  1LK7 A;  2B5J B;  4PWU A;  5AE1 A;  4JV5 F;  5KAK A;  4AQY J;  2I1R A;  4BLG A;  2L48 A;  3G4S S;  1LKZ A;  2QYC A;  2E5H A;  3AFG A;  1FXL A;  1FES A;  2YTC A;  3PYE A;  3FEX B;  3MFH A;  3BRE A;  1WF2 A;  4KIA A;  4RW8 B;  2F1F A;  4AL7 A;  2UXD J;  3RRG A;  2BBE A;  2JH3 A;  4LRA A;  4DPU A;  3HVT A;  2F8M A;  1S1V A;  2R8K A;  3AD9 C;  2GVD A;  3CDE A;  3ZZ0 A;  4R8U B;  2AP6 A;  4CP5 A;  3MEE B;  3OL6 A;  2DHA A;  3BR9 A;  2RQK A;  1N32 J;  3X1L B;  1FDN A;  1VK3 A;  2C2O B;  3PX0 A;  1U8W A;  1VRU A;  2BW2 A;  3HHL A;  1S49 A;  4OI3 A;  4MKB A;  3FBE A;  3DGP A;  2AJ4 A;  2DO4 A;  5KG0 A;  3D6M B;  1UFW A;  4CLT A;  4X65 F;  4PZV A;  2GML A;  1TKT A;  3BEG B;  3SCL E;  4NCG A;  4W4M A;  3PW4 A;  2HHT A;  1MWZ A;  4EBC A;  3UWT A;  4ED0 A;  1OYE A;  1U1K A;  2LDI A;  1ZTT A;  2HHQ A;  4JBC A;  3I0R A;  3G82 B;  2HSE B;  2V94 A;  5B0B A;  3M6V A;  1NSA A;  2MZT A;  4RBT A;  4ZP9 A;  2H1Y A;  1PIL A;  3VGT A;  1K0V A;  1HW8 A;  2R7O A;  1H2V Z;  3RR7 A;  1B4S A;  5K20 B;  3MCN A;  4IRD A;  1UVL A;  1H2U X;  5DRK A;  3QT7 A;  2W24 A;  4OFZ A;  5CH7 B;  4WU2 A;  2GJF A;  2Y1R I;  2HS4 A;  4DX6 A;  4P10 A;  1Q82 T;  3CNQ P;  4C3L A;  1AW0 A;  2MQP A;  4B3O A;  2DHG A;  2AW0 A;  4OX9 F;  2F65 A;  4OJ3 A;  4A47 A;  1FWL A;  1RAG B;  4PKD B;  3CUN A;  2MB0 B;  4WU3 A;  5EHH A;  1VRU B;  2JX2 A;  3PVX A;  1VBK A;  1YJR A;  5DS7 A;  4U8V A;  3Q2S C;  1KWM A;  3X3U A;  1SC1 B;  4DL4 A;  2J8S A;  2FC9 A;  4RU9 A;  4IH6 A;  1RT5 A;  4G1Q A;  3CJS A;  3V4M A;  2QG9 B;  1F2H A;  1HR0 J;  4LQ3 A;  5E41 A;  1S7H A;  4FPR A;  5KFH A;  4TVA B;  4NI2 A;  4O23 A;  3R7N B;  2WB1 D;  3NAI A;  4DUZ J;  2IJF A;  2DRD A;  4PR6 A;  1SH3 A;  3PYG A;  2D3O R;  3W64 A;  4X66 J;  1QJH A;  2YPZ A;  3DDN A;  2VG6 B;  2RDI A;  1VJQ A;  3CDB A;  3K2Y A;  1NPP A;  3RBX A;  3MZI A;  4CLL A;  2ZH8 A;  3CC4 S;  3CUL A;  2VD3 A;  4NXN J;  4ZVU B;  2L9W A;  3CME S;  5C2C A;  2HUR A;  1AUD A;  3IR5 B;  3TAM A;  4JI3 J;  1NB2 A;  2F4V F;  3QID A;  1CJK B;  3SSQ A;  3NAH A;  2IMW P;  2DNN A;  3BKT A;  1CUL A;  5KFC A;  1W26 A;  4ED2 A;  4PAB A;  3UD5 A;  2HHU A;  2DNG A;  4HHH A;  2RT3 A;  1Q81 T;  3UW1 A;  2ZEJ A;  4FYD A;  2HRU A;  5T7L B;  4Z7Y A;  4V19 J;  1U26 A;  3IWN C;  2ZH4 A;  4LF4 J;  5KG2 A;  1UEK A;  2MY8 A;  1CVJ A;  2YKM B;  4JV0 A;  2ACY A;  2HBZ B;  2ROE A;  4K5S A;  1MLA A;  3RU0 A;  5L1K A;  5HP1 B;  1S77 D;  1FVS A;  2XBP A;  2NQP A;  1UTA A;  3R5C A;  4U9R A;  3TAQ A;  3GG0 A;  2HGL A;  1JLC A;  5JJB A;  1AUS L;  4EZ9 A;  2Y1L B;  1FTR A;  1Q8L A;  4DL3 A;  3RB0 A;  4HEA 9;  3CDU A;  2VKR A;  2MPU A;  4PXE A;  2XMT A;  4IO1 A;  5KFI A;  5F9N A;  2J0W A;  5LSL A;  2X51 A;  3Q8Q B;  4IG3 B;  4X2B A;  1TL7 A;  2H4Y B;  2IYI A;  2XMA A;  3M05 A;  4DZD A;  2JLG A;  1JLG B;  4KPC A;  2HFS A;  2XTJ P;  4NA2 A;  1B3T A;  1FDD A;  3TO8 A;  1EQ0 A;  1MN9 A;  1WHW A;  4DU8 A;  3ITH A;  5DDP C;  1RJJ A;  4LF6 J;  4XO0 A;  2P6T A;  1U48 A;  3UFC X;  3EVM A;  3KLE A;  3UVJ A;  4JI4 J;  4AUK A;  4DHV A;  3IBW A;  3GZ7 A;  4WFZ A;  4X65 J;  1RWV B;  4KSE B;  1S9G B;  3ZXW A;  4K4Z A;  3G6Y A;  4E98 A;  1HWK A;  2XZD B;  4WKY A;  2XYH B;  2KRR A;  4WFN Q;  4AL6 A;  4O0N A;  1IBM J;  2GQ2 A;  1T7P A;  2ZZT A;  3CO9 A;  2NPF A;  1I6J A;  2PE8 A;  1S7I A;  2F40 A;  2J9D E;  2XMU A;  1H73 A;  3CCE S;  2V2V A;  1Q53 A;  1WC5 A;  3FNN A;  2BEF A;  3HHD A;  3DRP B;  1S9F A;  3T5K A;  1FRK A;  1I94 F;  2M3D A;  5B09 A;  1X8D A;  4CDI A;  2Q6C A;  2ZKT A;  4DUY F;  5AXK A;  4WFB Q;  1NAQ A;  4X62 F;  4CO0 A;  1P8G A;  2KB2 A;  3J7Y U;  3D7S B;  5C25 B;  5HO4 A;  3OVB A;  4A8X A;  5AXL A;  4LF7 J;  1K44 A;  4FF3 A;  5F3Z A;  4Y2C A;  5CAA A;  2R2T A;  1M5S A;  3OSP A;  4OIX A;  1JKH B;  1RLD A;  2WK4 A;  2AZ1 A;  3NWG A;  3J7A 1;  5IT9 U;  1ZM3 A;  3MM8 A;  3Q89 A;  1D3W A;  2VG5 A;  3VWS A;  1JLB A;  2YQ0 A;  1GMV A;  2OEL A;  3QGP A;  3ENV A;  1C1B B;  2FY1 A;  4LR7 A;  3T1Y F;  3CJ2 A;  1SJ1 A;  2HWT A;  2KN4 A;  1ZZF A;  1CC8 A;  2OPS A;  5FLX Y;  3KLI A;  1RB0 A;  4JI6 J;  1HBO B;  2CUY A;  3K5P A;  1NND A;  3W5Z A;  2VJV A;  5F8N A;  4J9P A;  1O51 A;  4S0M A;  3A8I A;  3QJP A;  2I8E A;  2VJU A;  4EMD A;  3LF0 A;  2XB2 D;  1HWL A;  2CZV C;  2GW8 A;  1QTM A;  3J7A N;  3JQK A;  4F0H A;  2RRA A;  3TAR A;  1REG X;  1S4F A;  1HWU A;  2MKH A;  3KJF B;  5E33 A;  1U1L A;  2DGS A;  3V81 A;  4O4G A;  3IP0 A;  4TY8 B;  5HAO A;  3UCZ P;  4EUV A;  3TUZ C;  4ILL A;  3AB2 B;  4B02 A;  1RT3 B;  1MRO B;  3D28 A;  5J1P A;  2HHH J;  1T3N A;  5IT0 A;  4CLU A;  2JLE A;  3KK3 B;  1WWH A;  2OMO A;  4QU7 A;  2AYE A;  2EPI A;  2NCK L;  3LP1 B;  3Q8R B;  4F2S A;  3QBC A;  2R2S A;  1U1R A;  1N34 J;  1IM6 A;  2J0X A;  3OVA A;  1P27 B;  2NPI A;  1LWF B;  4USW A;  4OX7 A;  5B0G A;  2YNF A;  1HQE B;  3BYR A;  3VCD A;  1TU0 B;  4CYU A;  3DOL B;  2ZHB A;  1V3R A;  4PQU A;  2ERR A;  1K9M T;  2Z8Q A;  1EQM A;  2VPX B;  3U27 A;  4F02 A;  2BYC A;  4HR2 A;  2PO4 A;  2E9Z A;  5A6W A;  2W2O P;  5GAD I;  1XC9 A;  1NDP A;  4DR7 J;  4UTG A;  2GFF A;  2G1H A;  4YP3 A;  4PAA A;  4BCA A;  2PEB A;  3R5J B;  2G0C A;  4CLP A;  4A8F A;  2D74 B;  1D9A A;  2PN6 A;  3QGG A;  5DM6 Q;  1RGV A;  1RXO B;  5F8M A;  2VOP A;  2Z2Z A;  3L4B C;  1LXN A;  2EC2 A;  2QMX A;  1R8B A;  2XLI A;  5LMN F;  1OWX A;  3FCW A;  4P71 A;  2EFN A;  5A76 A;  2DR9 A;  1PBA A;  3EZ5 A;  1E6Y B;  1UMJ A;  2HQI A;  3NNA A;  2HW3 A;  3D1Q A;  3Q8U A;  3S7R A;  2VBW A;  2F8E X;  1ZAV A;  2W4C A;  3GIJ A;  3HO1 A;  2A2D A;  3NKY A;  4DI6 A;  1GMW A;  2ZD1 A;  1DTQ A;  3EGW B;  3M8P A;  4IFY A;  1MMD A;  2WVD A;  3UVJ B;  3M30 B;  1T05 B;  1X9W A;  3J81 U;  3IGV A;  1DQ8 A;  2F5G A;  8ATC B;  1UPP A;  2UUT A;  1OS5 A;  3QNW B;  2IAJ A;  4HHJ A;  1SUQ B;  1KOO A;  2PA3 A;  4MYT A;  2V4Q A;  3O44 A;  4DV4 J;  1VQN S;  2Q3P A;  2I9S A;  2V4J B;  4CQ1 A;  3HSD A;  2F9J A;  2IA0 A;  2QZ8 A;  2CQ3 A;  3KLV A;  5ETS A;  4ES2 A;  2KL8 A;  4BC9 A;  4HHU A;  4KV8 A;  1LWE B;  2KT2 A;  3EDR B;  4DR5 F;  3CCU S;  2MHN A;  3DHX A;  3V4I B;  3VAJ A;  3MWB A;  1LFW A;  4F3M A;  1W2I A;  4KHP F;  4QWA A;  2D3O 1;  1UA1 A;  3FZB A;  4LF9 F;  2YH1 A;  3CJ4 A;  4HL9 A;  1WC6 A;  1QAY A;  1W7W A;  4B17 A;  3GV7 B;  4TU8 A;  1KS2 A;  2FHJ A;  2H51 B;  3IWX A;  1TKZ A;  4JI4 F;  1U09 A;  3K7R A;  3VQS A;  2B8P A;  3N9U C;  4WIQ A;  4ZN3 A;  1Y3J A;  4X66 F;  3KLG B;  3AH6 A;  3MDF A;  3QGH A;  2OFH X;  3JS9 A;  2KJW A;  2KZZ A;  5KT7 A;  2GHP A;  5GAE U;  2OSR A;  2VPZ B;  1NZ8 A;  1DBD A;  1FI4 A;  2MSS A;  2DR7 A;  4B3S J;  4ZCI A;  2OTJ S;  5EX0 A;  2OKQ A;  2C3P A;  1CJU B;  4ZPD A;  2LQJ A;  3BYP A;  1RCO B;  2R3V A;  3NWR A;  5EGY A;  4JI1 J;  4ZLN A;  1M5K C;  2W8L A;  2B9Y A;  1N48 A;  1HNI A;  4L74 A;  3R2D J;  1WAC A;  4NLR A;  3GFX A;  3O3L A;  4OZ3 A;  2PMZ D;  1T9W A;  4B3R J;  4NZ7 A;  3KNG A;  4CO5 A;  4DV7 J;  3THV A;  4DV2 F;  2XYG B;  1EZZ B;  3FBF A;  5K5M A;  2V4R A;  3QIP B;  2E5G A;  4ZCL A;  1KQF B;  2BOA A;  3PTW A;  4YN3 B;  6AT1 B;  1HNI B;  1OJ4 A;  8RUC A;  5B08 A;  4CTA A;  1MU2 B;  3M2U B;  1RTI A;  2MQM A;  1U7L A;  2AMC B;  2HFO A;  2PA8 D;  2ZOG A;  4TN2 A;  4XTT A;  5HVH A;  4IRC A;  1Z2Z A;  3NMA A;  1ZA2 B;  3C6U B;  2RF2 B;  3NNH A;  1KP6 A;  1BC6 A;  1WOR A;  1H98 A;  2BMB A;  2H54 B;  2N3O A;  3US5 A;  2R8G A;  3PRV A;  1S1U B;  4NLQ A;  4DSL A;  1YZ7 A;  1UWB B;  3LP0 A;  3W8P A;  1S12 A;  2W9C B;  2C3M A;  2OML A;  3EE3 A;  3Q8Y A;  1SIZ A;  3QAU A;  5B0E A;  5J1N A;  3KLF B;  2HBR B;  2C2R A;  2OEK A;  1B0T A;  3DNC A;  1VRT B;  1DLO B;  2B3T B;  1R6V A;  4PXD A;  1WOP A;  3QAE A;  4F36 A;  2AV5 A;  2E7X A;  3GCX P;  3BJY A;  2QA2 A;  1NEE A;  2YNI A;  3AOC A;  4IH7 A;  4EGL A;  3ZO7 A;  3NXZ A;  1KR4 A;  4DBQ A;  3TUJ C;  1KOH A;  3HSG A;  3MGJ A;  3D9B A;  2QLJ B;  3DMJ A;  4IDK B;  4PRF A;  3A3N B;  1T9U A;  5D15 A;  1SB6 A;  4TY8 A;  2FJD B;  4UF4 A;  2J9C A;  3H8Y A;  4ZP8 A;  3Q2T C;  2OIH A;  1YJV A;  4DV0 F;  3UN2 A;  4ECR A;  2H9Z A;  2XNR A;  4CNY A;  2VON A;  1IKV A;  1JQG A;  2VIC A;  3MPW A;  4J9K A;  4P7V A;  1HR0 F;  1WD6 A;  4DX7 A;  3AAW B;  3LAN A;  2MDA A;  4KFB B;  3W2V B;  1YJT A;  3KLG A;  3I82 A;  4MK7 A;  5I4M A;  2LXF A;  2LLZ A;  2QLB B;  3VAG A;  1S57 A;  3L3C A;  1T9X A;  4ZS6 A;  2GIQ A;  4NI2 B;  4WE1 A;  3N4W A;  5IOL A;  4O3S A;  4ANE A;  3I4P A;  2DHX A;  1K1S A;  1URR A;  2GHW A;  2IRY A;  2VFV A;  4WP9 A;  4ZVF A;  3UDE A;  1CJU A;  2UP1 A;  1YRT A;  2G4B A;  4OI0 A;  1IQT A;  2K8G A;  4KR0 B;  1LW0 B;  1HBU B;  2AYM A;  3ISN D;  2BE7 D;  2Q79 A;  2ZUA A;  1T9Y A;  4ZVQ B;  3HZE A;  2W9B A;  2HND A;  4I4B A;  4URG A;  1XMO F;  5KFA A;  2J9D A;  3IAS 9;  2L41 A;  1QSY A;  2DPI A;  4K0K F;  1UFK A;  2UV8 G;  4RWW A;  3UD4 P;  5D3G B;  1YTY A;  4FF4 A;  1TTH B;  4K4T A;  2ABY A;  2F4F A;  1YQH A;  1IQZ A;  1WF0 A;  1S97 A;  2J76 E;  3C15 A;  4EFA C;  4LSN B;  1I51 B;  2MHE A;  2LEC A;  4KJI A;  4M5M A;  3KMS A;  2JLF A;  5T41 A;  3T3F A;  1HI8 A;  2CQ1 A;  3JTN A;  5C25 A;  2V2Q A;  3AT1 B;  3DOL A;  2Z57 B;  5LSO A;  2MKC A;  4F4A A;  5J2Q A;  2OEM A;  4OQJ A;  2YKM A;  2W9A A;  1L3V A;  4Q43 A;  4Y6I A;  2V8H A;  1UJ4 A;  3W2W B;  3VHQ A;  2M5Y A;  3EZO A;  5HJX A;  4Q7A A;  2A18 A;  4ZPT R;  2BJ3 A;  1SUQ A;  1O6X A;  1TL1 A;  3HFK A;  4OZJ A;  3GE9 A;  3HZG A;  3K89 A;  2FVR A;  5L38 A;  4X64 F;  2K7K A;  4AT1 B;  2W01 A;  2JEI A;  4I6A A;  4X4V A;  1RI7 A;  1S6P B;  3QMQ A;  3M4X A;  4HDH A;  4DPY A;  4EBE A;  2YKP A;  1GEH A;  3U1N A;  4OZ0 A;  5CQG A;  2AJ1 A;  4LBH A;  3ULH A;  5THW A;  1P6T A;  3EM1 A;  4A8W A;  4FYY B;  4OHY A;  1RT4 B;  2E1R A;  4PCQ A;  1KVI A;  3KHG A;  3H2V E;  4TY9 A;  3KOA A;  3DYA B;  4PEO A;  3M9O B;  2V8D A;  2XWY A;  3UE2 A;  2V34 A;  2BOP A;  2VH7 A;  4OHZ A;  1EET B;  3HJV A;  1X0P A;  2NXE A;  1QE1 A;  5J2N B;  4DSJ A;  5JMN A;  2I38 A;  2CQD A;  2N7Y A;  4RW6 A;  4F25 A;  2DD8 S;  2C22 A;  1R7I A;  1SC6 A;  2RE1 A;  4RBU A;  4JI0 J;  2G13 A;  2WHO A;  3I5C A;  3KG0 A;  3HSZ A;  3PNI A;  1X5T A;  5CAB A;  1OY9 A;  2F9D A;  1M1K T;  1NK0 A;  3K59 A;  2FQQ B;  3MMB B;  3K58 A;  3GON A;  3KJN B;  1SL0 A;  1NHU A;  2AEF A;  4YY3 J;  1GH8 A;  1KKH A;  5AE2 A;  1JLC B;  3V6H A;  2HVI A;  2Q66 A;  3PZP A;  3TUI C;  3T5J A;  1X4C A;  2DNO A;  5BYQ A;  2Y0B B;  3BZQ A;  4HT5 A;  4OI1 A;  5E5N A;  3CD6 S;  1WI8 A;  1HD1 A;  3I4H X;  2CKW A;  4HAC B;  5H9E K;  4TU9 A;  1TMJ A;  1S99 A;  3QPI A;  2WVF A;  5IWA J;  5J2P B;  4DR6 J;  2CPJ A;  1VQO S;  1HL6 A;  1RT2 B;  2A3J A;  3LGH A;  5IZH A;  3TJ9 A;  1J5O A;  2YWG A;  1RAO A;  3MEG A;  2D41 A;  4Y3C A;  1ZPW X;  1NPR A;  1XER A;  4X4P A;  4DFP A;  2DR8 A;  2GMJ A;  4ZCK A;  3SQO P;  2J9E A;  3PG9 A;  1BXN A;  4ALZ A;  1HNZ J;  2FJV A;  1EP4 B;  1RDR A;  2VB6 A;  3ILJ A;  5I42 B;  1VQ9 S;  1FDB A;  2XHC A;  4RUH A;  2LMI A;  4H4K C;  4C98 A;  2U1A A;  2CQ2 A;  4HTJ A;  4WII A;  1RSC A;  1S9G A;  2D9P A;  3UDC A;  3EVO A;  4X4O A;  2RSQ A;  2WBM A;  2VL1 A;  5AE3 A;  3A12 A;  3KLI B;  3T1Y J;  1C4A A;  4CO4 A;  5KFP A;  1T94 A;  1OIA A;  3M2V B;  1S6Q B;  4D3H A;  2FLL A;  2HNY B;  2RML A;  1TKX B;  2XMK A;  3K57 A;  3ITH B;  1W2B R;  1HA1 A;  1ICE B;  2DIV A;  2P2C B;  4RW9 B;  4F4K A;  4NXM J;  3TYT A;  3W5Y A;  3RAX A;  1PC4 A; 
#chains in the Genus database with same CATH homology
 5AJ3 J;  4PWW A;  1IBL J;  4K0K J;  2VQF J;  1XMO J;  4DV3 J;  4DV7 J;  4DR5 J;  4JI0 J;  1XNQ J;  2UXC J;  4LF8 J;  4X62 J;  4DR3 J;  4B3S J;  4V1A k;  4LF5 J;  4X64 J;  4KY3 A;  5FLX U;  4GKJ J;  1J5E J;  3J81 U;  4OX9 J;  4JYA J;  2UXB J;  4AQY J;  4DV6 J;  4LF6 J;  4DV4 J;  4GKK J;  2MEW A;  4DV2 J;  2ZM6 J;  5LM7 E;  5LMU J;  4JI4 J;  1IBK J;  3JAM U;  2KL8 A;  4HHU A;  2UXD J;  4X65 J;  2UUB J;  3OTO J;  4KHP J;  2UUA J;  1IBM J;  4DV1 J;  4DR2 J;  4RJV A;  4KYZ A;  1N32 J;  4DV5 J;  1XMQ J;  1I94 J;  1HNW J;  4JV5 J;  2MTL A;  2F4V J;  5BR8 J;  4LF7 J;  4LF9 J;  4JI1 J;  3D3B J;  1N36 J;  4JI7 J;  3R2D J;  5IT9 U;  4B3R J;  4DR4 J;  4DV0 J;  3J80 U;  4LFB J;  4YY3 J;  4JI6 J;  1N33 J;  4B3M J;  1XNR J;  4NEY A;  3T1H J;  4LFA J;  5IWA J;  3W1Y C;  5LMN J;  4DR1 J;  1HR0 J;  2UUC J;  4JI8 J;  3J7A N;  4DR6 J;  3R2C J;  1HNX J;  3D3C J;  4DUZ J;  2VQE J;  4X66 J;  4JI2 J;  1FJG J;  1HNZ J;  2HHH J;  4NXN J;  4JI3 J;  4NEZ A;  2E5L J;  2UU9 J;  4JI5 J;  3IMQ J;  4YHH J;  5A2Q U;  1N34 J;  4DUY J;  4B3T J;  3T1Y J;  4LFC J;  4LF4 J;  4NXM J;  2KVQ E;  4DR7 J;  2MQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...