4AQYJ

Structure of ribosome-apramycin complexes
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4aqyJ00
2MTLA 4DV1J 4LF9J 1N33J 4V1Ak 3OTOJ 5BR8J 4DR1J 2HHHJ 2UXBJ 4GKJJ 4DR2J 4DV7J 4NXNJ 4AQYJ 3T1YJ 4K0KJ 3JAMU 1IBLJ 4LF5J 4KY3A 1N36J 4DR6J 1N34J 5A2QU 5LMUJ 4X66J 4JI2J 1IBKJ 4JYAJ 4DUYJ 1HR0J 5AJ3J 2UUCJ 1IBMJ 4X64J 4JI0J 4JI8J 2UXDJ 4LFBJ 3J81U 3J80U 1XMQJ 4B3RJ 1FJGJ 4HHUA 1XMOJ 1XNRJ 1HNZJ 3R2DJ 4KHPJ 2E5LJ 4JI3J 2KVQE 2VQFJ 4LF7J 4NXMJ 2UUBJ 5IWAJ 3J7AN 4LF6J 3W1YC 4DV3J 4JI5J 4PWWA 4GKKJ 4DR3J 4JV5J 4JI6J 4YHHJ 4YY3J 2MEWA 2VQEJ 4JI1J 2MQ8A 5LM7E 3D3CJ 4DV4J 2UU9J 4NEZA 4LFCJ 4B3SJ 4OX9J 2F4VJ 3T1HJ 2ZM6J 4NEYA 5IT9U 4DR7J 2UXCJ 1XNQJ 5FLXU 5LMNJ 4B3MJ 3IMQJ 4LF8J 4DR5J 2KL8A 3R2CJ 4B3TJ 4DUZJ 4DV0J 1HNWJ 1HNXJ 4DV2J 4RJVA 4JI4J 3D3BJ 4DV6J 4X62J 4KYZA 2UUAJ 4DR4J 4LFAJ 1J5EJ 4LF4J 1I94J 1N32J 4DV5J 4X65J 4JI7J
chains in the Genus database with same CATH superfamily
2E44A 4K4YA 4R0EA 1NSKL 1FXRA 4CIOA 1ZS6A 4Y2CA 3US5A 3OVAA 2OEJA 4G1QB 3OR2B 1T9XA 1WI8A 1YWXA 4F4ZA 2O66A 2YQ1A 3CJ4A 2GIQA 2KT3A 3CJSA 2V9KA 3AXMA 3JAMY 4RNMA 1S0OA 2QC3A 4DZ6A 4KGXB 4GMKA 3RW6A 2MQPA 1LWEB 4F0HA 3OFGA 5DLFA 1RAIB 3R7SB 3ZZYA 1RT6B 4AE5A 4H54A 5A0YB 2XSFA 2VB6A 4ZIWA 1TKXA 1TU0B 2MGZA 3T5KA 4YB6A 5DQHA 2HRYA 2Q1LA 3MFHA 1FESA 2W7PA 1VQMS 5DQIA 2W2OP 1BXNA 9RUBA 3D6TB 3FSXA 2VHGA 2VBYA 1RKJA 3Q8SB 4HKQA 1GX6A 4ICLB 2E1PA 2OUGA 4IFVB 1YSJA 4Z37A 2B9WA 2A18A 4OI6A 4DSIA 1OPZA 1H6KX 4FYDA 2XMWA 2FVRA 3SEOA 1KFDA 5E41A 5J2MA 1VQLS 2XLKA 3KOAA 3ZZUA 1PC4A 3H20A 3CCVS 2V8DA 1SC1B 3BSAA 4K4VA 2BKOA 1U7LA 2AGPA 1DTTB 2FYXA 2FHJD 3VAJA 1JMTA 1S5ZA 1WC0A 4O4RA 1J27A 2F5GA 3UDVA 5HVGA 1FEHA 4J9VA 4JI3J 1KEKA 4I2PA 3VAGA 2DNHA 2XO6A 4C11B 1H2TZ 4F7VA 4NLSA 3IRXA 5DRKA 2GQ2A 2ZOMA 4C3MA 1UTAA 2E5JA 3KK2B 3HO1A 1AFJA 2E9RX 4AXJA 2DISA 2RMLA 1JKHB 4QYZJ 4CLLA 2RQ4A 4C7QA 1X7VA 4IOAQ 1VQ4S 3KKFA 4Q8FA 4CLSA 2V0NA 4DPYA 2HPUA 3K5NA 2BMBA 1AFIA 1RU2A 3QT7A 2VPWB 4ZLLA 4ZP8A 2V50A 3PW7A 3WDOA 4MKBA 1CBKA 3G6YA 3TUZC 3MMBB 4OZ1A 5I3QA 2DH7A 4KHRA 1EARA 5HJYA 2EPIA 1U0HB 3RBEA 2ADCA 2EI5A 4B3RF 1XNRF 1FRHA 3V2UC 3MMJA 1M1HA 1WORA 3PYGA 3HSZA 2YNFA 3BSOA 4P10A 2HLTA 1HQ2A 2JH3A 3SFUA 2RDIA 2BJ7A 1UW9A 2OPRB 3CD7A 4W98A 1Q7YT 5K14B 3HHLA 2VQEF 4DV6F 1U24A 1U49A 5CYMA 2HMIA 5L1IA 5FJ4A 3OPKA 1WOOA 1NEEA 1NHUA 2F65A 4DCOB 3FZBA 3JSRA 1FF2A 5L1JA 3T1YF 2DNYA 2HHSA 1M5PC 2F9DA 3GCXP 1CVJA 4NA2A 1S9EA 2CPFA 3BEGB 1RU1A 4JI2F 4U6PA 3UDLA 2H1YA 4N5SA 3EGWB 4OJHA 2FJAB 2GV1A 3AH6A 3DRSB 2CADA 2GC8A 2I9SA 2W4DA 5KT2A 3UNGC 1IBLF 3LWLA 3FMBA 2NYHA 4WKRA 2AP6A 1K9MT 5DGBA 5EX3A 3PR5B 1HNVA 4JYAJ 4LFBF 1T9YA 3VV2B 3CC4S 1XMOF 4OYAA 5ETRA 4NMLA 1T8EA 2W9CB 1NH8A 1SKUB 4DQSA 2OLWA 1J5OA 1VR6A 2CJXB 2IPOB 1K1QA 2JZ5A 3CPWR 5KOXA 2AJ4A 4QR0A 2KHCA 3BGRA 3QRPA 2AT1B 3EZ5A 1X9MA 2YNIB 5J1EB 1HNIB 4ERDA 1WG1A 5KFCA 4NASA 3CJ2A 4QWDA 3U7JA 4DPWA 2DITA 3WIUA 4CM2A 3RRKA 2DIUA 2FZKB 2R2RA 3M2VB 2MTLA 2VBXA 3HT0A 4KIAA 3KK3B 3DCAA 3BZQA 2GHWA 1UCNA 3THPA 3H25A 1X60A 2OEKA 1GH8A 2ZOGA 2DNLA 2HVZA 4ED5A 2CPDA 5B0AA 2ZJQQ 2ZFHA 4R8UA 4G3IA 1AW0A 2E9ZA 4YR3A 3K8WA 1EETB 4R5PA 1OY9A 1BUXA 3I0SB 3FK4A 4WK3A 4FS2A 2XYGB 2RDJA 3MTJA 5T7LB 2DBBA 3AQOA 1S12A 2Z2LA 4FKXA 4U8VA 2WSCC 3KHHA 5D0EA 2E5IA 3AA8A 2DO4A 4ZIVA 4B3SF 4B9NA 1Q4RA 3KJFB 1JIHA 1X4GA 4KSEB 4B3MF 2DNNA 2H65B 3HXMA 3HHLC 2JX2A 1X5SA 4DR7J 1FJ7A 2LQ5A 3CW2C 4DF8A 2VD3A 4DSKA 4OYWA 2QE5A 3M8YA 3NBPB 2F4FA 2Y1LB 3NOGA 4LVOP 3S01A 1RE1B 2ZE2A 1VRQC 3QPIA 2O01C 4FXVA 3RU0A 4RBTA 1PYSB 4DR2J 4ID5B 2ZH8A 1UVIA 4L72B 2AZ1A 4IH5A 2MKHA 4NLQA 4EBCA 3QO9A 2DPIA 4PQAA 2X3DA 3AQPA 1N6QB 2VA2A 1QTMA 1PAEX 2DGOA 1FJGF 2AYGA 1H2VZ 3LH2S 2XB2D 4FF4A 2J76E 4LF7F 4QIVA 4O44A 1W26A 2C2DA 2DKOB 4OHYA 4YB7A 4QW8A 4BC7A 1F9FA 1LFWA 5AT1B 4A8SA 2HFVA 4I2QB 1RAHB 4JI1J 2CVEA 5DG9A 1NZ8A 2BQUA 1UJ6A 1S9GA 1NJIT 2W9AA 1XNQJ 3TAMB 1OS5A 3MEGA 4Y34A 1IR0A 3VF0B 1TK8A 5HL7Q 2MB0B 1YTYA 1IBMF 3JQMA 4OHWA 2V63A 5IS2A 4OHZA 2RAQA 2H54B 1SIWB 3ONQA 1YRUA 1VIXA 1RHQB 2GMJA 1N5YB 3PFOA 2OIHA 3MZIA 3DKDA 3MM7A 4DV7J 4FBUA 1I5OB 5KFXA 1DARA 3OR1B 5L9NA 3GG0A 5JUMA 3PRBA 2LDIA 2NXJA 2QSFA 1CULB 3FMWA 2JJ4D 2FJVA 2WOMB 3HHNB 2XLIA 2C2KB 2J9EA 1RBLA 4CT9A 3G71S 1P8GA 2BE2B 2MGZB 1S6PA 3T9ZA 2BRKA 3FKBA 1WD6A 5GADI 1RZMA 3UCZP 3IG1B 4YQWA 1D8ZA 4PZVA 2KN4A 3G87A 2PA8D 3K0JA 4MKYA 1T9VA 4L3NA 2E1CA 4OX9J 5F8MA 1WC3A 1RT3A 1RHMB 5HSPA 2CPIA 2CFXA 5I42A 3I56S 3KUHA 4RWWA 5DS7A 4CNYA 3DGPB 1TR0A 4ZPBA 2V4RA 4BHQA 1QY7A 5H9FK 2FJDB 2EC2A 1T3OA 4N7TA 3DLGB 3W2WB 4P72A 4GKJJ 2IDLA 3ULHA 1GT8A 4DF4A 3HPOA 5KT3A 1LFPA 2AKWB 2MZJA 4FPIA 1RAEB 1TQLA 3EXCX 3KUGA 1ACMB 3TQ1A 5B0DA 2C3PA 2ZZTA 2GGPB 1P1LA 3DMJA 5A8KB 1GTHA 2J6UA 2GO8A 3KJQB 4DLEA 3ITHB 4ECTA 3A3OB 4B9SA 2GX8A 1WDDA 1RBOB 3Q8YA 1JXEA 1RWPB 4HEA9 3G86A 4JV5J 2IA0A 5B7WA 3UR0A 1KQFB 4URGA 2MLZA 4YR2A 2M2BA 2HBZB 2HZAA 2BE9B 2JDJA 1JLBB 3MR7A 1S6UA 1X4AA 1ZYQA 3OD2A 3QZ8A 4ZPAA 1HNWJ 4QCLA 4J7CA 4B9VA 3JYTA 4PUOA 3QBCA 1HQEA 3CO0P 3TUIC 2CNKB 1TUWA 2UZAA 4DPTA 3THVA 1HKAA 3QGGA 4ENOA 2MSTA 1MWQA 2CAJA 1HBMA 2YWEA 2V2QA 2B9XA 3M8ZA 2JOQA 1K8AT 4Y3CA 1U2CA 1K47A 1OYDA 1RTZA 1X0PA 4KFBB 5KG1A 3KHLA 1ITPA 1Q8KA 4ZA1A 1S79A 5E3AA 3NP5A 2RF2B 4RW8B 4B3TF 2IM3A 5C24A 2C3OA 3CJQA 3IBCB 2AYMA 1ZAWA 2DH9A 3TEHB 2RKIA 2WW4A 5T41A 4P73A 3VVTA 5IV3A 3OFFA 5J2NB 2E9TA 3R5AA 5KFQA 4DR5J 1TUVA 4MIWA 5A8RA 5GAGI 1OSDA 1V3RA 2H4WB 1HNXJ 4WFZA 1C0UA 3QGPA 3U02A 4DL4A 5M2RA 1ZM3A 3VVUA 3MEKA 3KNAA 1HI1A 4X65J 5IM0B 4JI8F 2RT3A 4ED0A 4NL5A 3H8YA 2BVZA 1VQYA 1P1TA 3KLFA 4RNFA 2GAGC 1HNVB 1BD6A 3M32A 4DL6A 1CJUB 2CWXA 3F0NA 2BJEA 3DGVA 1HPZA 2B9EA 2ZOFA 4M5KA 4N8OA 4F4XA 2QO3A 4JI3F 2PN6A 1CJKB 3J80U 1FKPB 3HJFA 1RT1B 1H7XA 3M8PA 2JLGA 4EO6A 4F4YA 2JVRA 4DV2F 2VZ9A 3M4XA 2AJQA 4IOCQ 3JQKA 5BXIA 2IRXA 2EK6A 4LF9F 2MHNA 2CQIA 5JMNA 2AHOB 3DLEA 3R3TA 3O1LA 3I4HX 5ETOA 1M5HA 2VIHA 3GWCA 4A48A 1Q82T 2R7WA 1U2FA 2AD9A 1FJCA 3MUVP 2OFHX 3O3LA 3A1YG 3GTYX 1NM2A 1RTDB 2YVSA 4KHPF 4C48A 2OO4A 2RVJA 4X4PA 1FVQA 3VTIA 4ES1A 4RPFA 2YKNB 4X66J 1HW8A 5KFOA 1XN9A 1YK9A 1HMVA 3V81B 4OZ2A 2FPHX 2FJXA 2K1RA 3D6MB 4LVNP 1RUSA 1HWKA 2W7AA 5DGAA 4NMXA 1DAXA 3MEDB 4O0IA 1UFKA 3DYAB 3OUYB 3CJ8A 4EYIB 4DN9A 1F1BB 3FEZA 3BKUA 2UXCJ 2OJ3A 4QPTA 4ETXA 5FLXY 3EGNA 3A12A 3L9ZA 1U1OA 3J7ZT 2CXEA 2AYBA 4PG4A 1RISA 3LALA 5E3QA 2ASDA 1FX4A 1RWNB 3Q23A 3OW2R 4RU9A 1U0SA 3GR0A 5FDLB 2D3OR 3VGSA 1JLFB 4IDKB 1VJWA 1Q95G 3ZZZA 5HMWA 3MR2A 2R7TA 2CJYB 2Z0GA 4NXMF 4JYAF 1U1RA 4WIQA 2WCXA 1ELOA 1KTVA 5KFNA 3TUJC 2OPSB 4Q2MA 4I56A 1ZA2B 4MK9A 1UVJA 4J9LA 1SL1A 2QMXA 3SFGA 3AXKA 5DZ6A 4J9NA 3T5HA 2KT5A 5DDOC 1R8AA 2VG6B 2Y1RI 1U2RA 1M5KC 3DNCA 2HNDB 3OFEA 1NAQA 1SJ1A 2XGPA 5HMZA 4LF4F 3M9MB 3QYYA 2RJZA 4LSNB 1TFYA 4RNNA 1VQ9S 3BDPA 2V94A 1GAOA 4CYUA 4LFCJ 4K4XA 4N76A 5KFLA 4NE9C 1NBEB 1ZAVA 4EBEA 1E6VB 2DR5A 1KVIA 3HDSA 5GMKa 1OSCA 2RS8A 2H3EB 1WOPA 4DSLA 2ZNZA 2AJ2A 2AIRB 3VAKA 5LSRA 1N33J 5EHHA 4ZS6A 2OMLA 5GAEU 2ROPA 3H2LA 3CCES 1K0TA 1FD8A 4NYPA 2HK2A 2IA6A 4DI6A 2HQDA 1EKRA 5C5JA 1ZPWX 2C2NA 3L7UA 5HVFA 5D78A 5EDWA 4OI4A 1RK8A 4J9PA 1YGYA 2CJQA 1B0TA 2XSJA 2DO0A 4DUZF 3ENVA 2K2PA 4XK8C 5IOLA 3PW2A 4NCGB 2DHSA 4JI6J 4KO0B 2BR0A 4K4UA 3D6FB 1A9NB 3JTPA 2B6AA 4DJBA 4Q2LA 4MMOA 2I5JA 1RWUA 3VHQA 4I69A 1RTIA 3CB4A 1WF1A 2ZDOA 3NS5A 1T02A 1MROB 5L9XA 2KXFA 4X2BA 1JNZB 3SCJE 3J81j 3RB3A 1KC8T 3IGVA 2MZQA 2C2RA 4UF4A 3BDEA 4IKAA 5K8MA 3M2UA 2E7WA 3G82A 4DR2F 1Q78A 4DMZA 3OHBA 5H9EK 3NWRA 4ZVGA 1CJVA 2XTJP 2MZ1A 4J9UE 2AWZA 3TZYA 3N6MA 3DOMB 2ZNYA 3FDSA 3H5UA 4ZPTR 4NWBA 2MQQA 4KC5A 3I55S 4P7TA 3V4MA 3U27A 1Q8IA 3W65A 1IN0A 1HNZJ 1SQEA 3V4IA 2KVQE 2XI3A 4ZVOB 2I1RA 1TL7A 2KYZA 3QLHA 2R8IA 4PWWA 4U67Q 4CO4A 3C15B 2QFIA 1N56A 1YBAA 1XNQF 2EBEA 3P3DA 4OLPA 1EB0A 4U9RA 2FY1A 2J7WA 2VOOA 2OTJS 2G0JA 2Z57B 1HQEB 2OSRA 3MMAB 1JJCB 1RWWB 3PCOB 4LR9A 2RRAA 3DOKA 2J7UA 2JNJA 5F8GA 4JP8A 1C1CA 2W8KA 3OLAA 1R6YA 4DV7F 1NHVA 4QPXA 2LXIA 4IR9A 2DXEA 1TKZB 4PYAA 4C98A 2F1FA 2ZDPA 1A6LA 1TAUA 1C0TA 1MMDA 3ZZRA 4LF5J 2AYEA 4CLZA 2FZCB 2YKMB 3J7YU 3GCWP 1FE0A 1KTQA 2BX6A 4QOTA 2W9BA 3Q83A 4BBYA 2XLJA 1DFDA 1Y10A 2C1EB 4OZNA 2YWHA 3KFWX 4LJMA 1PC5A 5LJ5Y 1WF2A 1SUQB 3D3CJ 2B9YA 2WONA 5A8RB 3JSMB 4OV6A 1NKCA 2YNHB 2BYCA 3MPYA 4PRFA 5J1NA 2CNLB 3WC2A 1ZM9A 3X3UA 3OXLA 4LRDA 4WU3A 1NK4A 2EFGA 1OO0B 3R5BA 2BJ8A 4GKJF 5I3PA 5KFUA 3OVSA 2OP5A 3R5DA 1NLKL 2B51A 4ZCIA 1UAWA 4I7FA 3TZWA 2GVDB 1Q8LA 1TV6A 1H38A 3HK2A 4N41A 2UV8A 4QZVB 3KUEA 1IKXA 1VJQA 2KZMA 2CQBA 3GLJA 4PQUA 2RRNA 3R1HA 3N79A 1RYSA 2A2DA 1HD0A 1VYAA 2YWWA 4WXWA 3F44A 2FUG9 1NPPA 1NPKA 3TYTA 4IO9Q 3ILIA 1BWEA 4DV3J 1Y5LB 3M6XA 2HWIA 3EDRB 5ETPA 4NLDA 3ZZTA 1EP4A 1TELA 1HHTP 1RHUB 3CCMS 1L3TA 2FTRA 1MMLA 1HNWF 2WTFA 4CLYA 4ED3A 3L09A 2H5IB 3BPDA 1WOSA 4EBDA 4DL0C 4ER8A 3LWMA 5DG7A 2EW9A 4CO5A 1WSVA 4DL7A 2RHSB 4NZ6A 2EFQA 1OQ3A 4IUFA 1TL3B 4ZVHA 5AE1A 1HBOB 4RZRA 2W4PA 2EK1A 3EVMA 4JBCA 1Q5YA 3TA2A 3SZ2A 4CH1A 1NO8A 3D68A 3EUNA 3AY0A 1T94A 1LWCB 2KO1A 3Q8PB 3HVRA 3MM5A 5CAAA 3NY0A 1G3OA 1W25A 2V4JB 3K17A 2DTJA 4M63A 3D67A 1YJTA 3RRGA 2HWHA 3NAIA 1QSYA 1G1XA 2KT2A 2AW0A 1B64A 1V6HA 5CZXA 3HVTB 3UWTA 4A8KA 1YJVA 4DV4J 1S6OA 1RP5A 4DR5F 2HSEB 3C6UB 1RT7B 3IWLA 3BN7A 3T19A 4X65F 4FP9A 2ZZNA 1RAOA 1S76D 1R7IA 3DI6B 2P5VA 1J5EJ 3CIMA 1JLEB 2BBEA 5HAOA 4WF9Q 1YVFA 1FWKA 2ZJPQ 3C14B 2VDIA 4FBTA 5CYQB 4CO3A 4A8QA 4JI5F 1FDBA 5HN0A 1KR4A 1Q7LB 3DM2B 2PMHA 4ZHRB 2B5JB 2DHHA 1MG7A 2XZDB 5KFVA 2PIIA 2JVOA 1X8DA 1H2UX 2FIUA 3QSIA 3A4TA 4TVAB 4FXWA 5K20B 4CYUB 2ZHBA 1R8PA 2DR8A 1AYEA 2ZBRA 1UFWA 4NLPA 2AZ3A 2WBRA 4IYQA 2VASA 1HWUA 4IG3A 2HNZB 1WF0A 1JQGA 3P5BP 4BC9A 4NXNF 3QRQA 1NK9A 5HI7A 3GB0A 1B3TA 1QTNB 2J0QD 3KWMA 1XEZA 1VQPS 3W63A 3QIPA 2D69A 3FEYB 1B7FA 3VCDA 2X51A 1S59A 1UVLA 4FYVB 5E0OA 2QV6A 3LOUA 1CQMA 4TKTA 3E51A 4WFNQ 3F73A 1CS4B 1X9SA 1JLAA 1LEOA 1NXIA 2UUBF 4OYPA 2HZCA 1NB7A 3R6GB 1BGXT 4IR1A 3H90A 4M5NA 1LXJA 2VG7A 5L1LA 2V9WA 4V19J 4WYLA 1BQXA 2XSJB 3I0RA 1QD1A 1FKOB 1YJ9S 4ED6A 3L4BC 3W5XA 3FVYA 2DGWA 2UVUA 1JNRB 4X62F 3C8YA 2I5JB 3IAS9 2UXCF 3M30B 3MAQA 3HD2A 1QUVA 2R7UA 2C42A 5HROA 1WJ9A 4K0KF 1WNEA 1RDRA 4M5MA 3DN9A 3PDNA 5RUBA 3W5YA 4CDIA 3D5MA 1R8CA 5G4DA 4C97A 2J9DA 1GMWA 2XHWA 3N5FA 4HDHA 1WHXA 2NR0A 4TY9A 2CNNB 4PXEA 4KV8B 3CJKA 3AB4B 4OZ3A 1EHWA 2W2PP 2BJ1A 4RUCA 4ZLPA 3RR7A 1O0PA 1ZTWA 4OIXA 3C46A 1S0MA 2V2VA 2RB7A 3GV8B 2ZKUA 4U95A 2HURA 5C42B 2ZITA 2AEJA 4USKA 4CLWA 5KFAA 1F5CA 4DBQA 4LFCF 1YX2A 1SB6A 3CF5Q 4KQZA 3NMAA 4TQSA 3CULA 3DU6A 3MFIA 4YS2A 2C2MB 3MM6B 1RAAB 2GMHA 2BW2A 1KBRA 4NCBA 3M8RA 1TUGB 4HDGA 4CRJA 5KFHA 4ZCMA 2J0WA 3PEJA 1JLGA 5U47A 3AOCA 1NDCA 1XIQA 2B43A 2Y0BB 1N32J 2UUWA 5F0WA 4EK2A 3WZ0A 3L95X 5I3UA 4CI0B 2IM0A 3I96A 2FB0A 4L6V3 2APOA 3GU0A 3W62A 1KHWA 3I5CA 2QT7A 4OYIA 4DOZA 2GJFA 3B6BA 4WFYA 3ET6B 4LQ3A 4C4WA 2AQ4A 3W2VA 1HI8A 3VALA 4RBUA 3T5LA 2XQCA 4FPRA 3FFIB 3FZ2A 3B4MA 2V6AA 3VQSA 2V2KA 4DQPA 4XPCA 3AB2B 3IGNA 4CCHA 5EX0A 3KLHB 1PILA 5D3GA 4URSA 2DNQA 2ADBA 4ANDA 5L8RC 2I38A 1S1WA 4NPOA 2DJWA 3M8WA 5ETLA 2GVZB 7AT1B 4M5JA 5HP1B 3G8TA 2A2CA 2DD8S 2YKQA 3PM9A 5KFBA 1S48A 2HQGA 1WI6A 1NJZA 1OYEA 3GILA 4C0OC 3EPGA 1Y9OA 4PPDA 4D3GA 4Z7CA 1NSQA 1WEYA 2HAFA 4QWBA 2R7XA 1Q5VA 3OR2A 2HHWA 2ZH9A 4MT1A 4K2XA 1UWBB 1NKEA 5HBMB 3QATA 3BM7A 3JSBA 1HYSB 3O44A 2CUYA 1NJXA 1FDNA 2WB4A 1LWEA 3GIRA 3EX7B 1HR0J 2YX1A 1HNZF 3M1VB 2KM8C 3MCOA 4PXDA 1U1PA 1RT6A 3J80Y 1XQIA 2CZ4A 5A0YA 5EGYA 1TVRB 2LKZA 1DLOA 3ZC4A 2NCKL 3MAAB 4C8ZA 2FHMA 4OZ0A 3QJPA 1SC4B 2XGQA 1NU4A 4WK1A 4WWSA 3DDIA 2BANB 3MDFA 1APSA 2V8HA 4I1TA 5K5MA 4ICLA 4IFVA 1NDLA 5DDRC 4KAIA 3CNQP 3A8JA 3MPVA 2F8EX 4Y2AA 3G9CA 2B8QA 2OFGX 1FRJA 3BGUA 3S8SA 4ZP6A 3DRXA 4DX7A 2VC1A 6FD1A 5GVQA 4DU7A 1DTTA 4LF5F 3NGKA 4ES2A 4DCPB 5JXSA 2DHXA 3PHTA 4WFXA 1X4FA 4TY8B 5LSLA 4EU0A 4DL5A 1RADB 1FO1A 1KONA 2C2EA 2N7YA 5HVHA 4WJBA 3AAWB 4ZVTB 1JJHA 1EAYC 4C11A 2W2MP 4LF1A 3OTEA 2E1MC 2B8PA 2DNGA 1GMWD 3EMTA 3CJTA 4RW7B 4ZN3A 5MAOA 1QAIA 2F9JA 4DR4F 3DFEA 1JKHA 2IM2A 2DNKA 2G13A 1U02A 1GXUA 2KXHA 1RQ0A 2ILYA 2KJVA 2R9LA 2FY8A 4ECWA 3HSJA 5J1PA 2YWKA 1KP6A 1FRIA 2L08A 5KAKA 1D3WA 4QIWD 5KFIA 2B3TB 2MQMA 1KRPA 2XO7A 3MMCB 3MEEB 3MMBA 4ZVFA 4Q45A 1P27B 3T9NA 2QA1A 5KFPA 2DGQA 1ZH5A 5AXNA 1U0HA 5KG2A 1N8RT 3IM8A 4LMZA 5KFSA 1TKTB 4NYOA 2GIRA 4ZJQA 4J9QA 1B4SA 1M1GA 1S72S 3IN5A 2WK4A 3D6HB 2P6SA 1W2BR 3CJ5A 2MMYA 1JXLA 4J91A 2OPRA 1VGYA 1ULRA 1LK7A 5K14A 2CPJA 1TFWA 3ZTPA 3GYXB 4DV3F 1VQ5S 2JRSA 3EWGA 4YN3B 3LP2B 4J9OA 4IG3B 2NXNA 2M8DB 3J7AN 2HW3A 2MKYA 3CT9A 2DGUA 3RB6A 1Q79A 2W01A 3LF0A 4BWJA 1AB8A 4G1IA 3GFXA 3T1HJ 1TL4A 3TWZA 1R8HA 2R3VA 2BQRA 1VQOS 2AJFE 2VOPA 1R8BA 4D3HA 3W61A 1DHMA 4I4BA 4RUBA 3OTDA 3DRSA 1N88A 1WSRA 4RL1A 5J2PB 2LECA 1R27B 3G6XA 2QMWA 3OTOJ 2RS2A 4DX6A 2IHR1 4LSZB 4DPOA 3TNVA 1DTQB 1JLCB 4P6QA 4IRCA 3CIZA 4H4OB 2QYCA 1D0EA 4UT4A 2YPZA 1R3NA 1OY6A 4MIAA 1T11A 2U1AA 3IRWP 2IBKA 1LW0B 2W9CA 2PFDA 4IRDA 1SBRA 1T95A 3D66A 2BQ3A 3HKZD 1RCXB 4E98A 4C2MA 2OPPB 3G8QA 4Q5VA 4RW4B 4ILLA 1VI7A 4ZPCA 1D8YA 4Y0FA 3R7BB 4AL5A 2G1HA 5F8JA 3THTA 2YNIA 5J1EA 1HNIA 5L1KA 4ZJOA 1T9UA 4NLTA 1TK0A 4JB8B 1U47A 3PKYA 3D1OA 4FS1A 1VLOA 2QIFA 1L5UA 3LP0B 1J5EF 1P6TA 3DDKA 5IQQA 3KMQA 5B0CA 3M2VA 1TZ0A 2V5HG 2V8GA 5IT0A 3KK3A 2XYPB 3I82A 3IBWA 2LQ9A 4ILMA 3A13A 1FK9B 2JEIA 2FHOB 4PXCA 4UY8T 3AHPA 1XK8A 1NK6A 3OXGA 5HK4A 2MDAA 1AUDA 3MM8B 2WSFC 3UNYA 2HWTA 2CQ0A 3SV4A 3W66A 1YJNS 3KJNB 2HGLA 1EETA 3UCGA 5AJ3J 3HF5A 3HHEA 3I0SA 3H5XA 2BE7D 2EFNA 5T7LA 5A8WB 2N82B 1WHYA 1VQ7S 4CLTA 4M5DB 2KFYA 4FVMA 5F0UA 5HQ8A 4GKKJ 4FF1A 2CG4A 4URQU 3SSRA 5A76A 1GXLA 1M5VC 3PIOQ 2HHHF 3SQGB 2HHUA 3NLCA 3BS9A 2F4VJ 1T9WA 2M3DA 1RXOB 4UW2A 5KFRA 4CQ1A 3JTOA 2G0IA 1I51B 3NBPA 4DZDA 1MSWD 3MPWA 1S97A 1FRLA 2DEIA 3DLLQ 2KXNB 2EEYA 3H5YA 4XPEA 4KJIA 3CCWA 4EEYA 2J9DE 1I94J 2B4UA 4M5HA 1NKBA 4ID5A 4X84A 1WKKA 3IFEA 1F0XA 3E2EA 1FTRA 4OZLA 4KGKA 2CWKA 1N6QA 4J9KA 3EICA 3NRBA 5CA5A 3CVKA 4QIFA 1CJTB 2BACA 1WEZA 2NXCA 1FFGB 3GG1A 2J7KA 3PRVA 4DFKA 3BO4A 3Q24A 1L3VA 5C25B 1X0FA 2R4FA 2OD4A 3BBCA 1WELA 3SCIE 4DQQA 5L39A 3TAMA 1KDNA 3AA9A 3UQSA 4X4RA 3SIPB 3P5TL 2D9PA 4YMEA 1U1QA 1Y3JA 4C9DA 2G2YA 2MQOA 3WX4A 4I6AA 5ETTA 2LXFA 2XWXA 1O5JA 6AT1B 2IMWP 3FBBA 1N5YA 4ZPDA 3FCWA 2GJIA 5AE3A 2XEXA 2KB2A 3OR1A 4F0KA 3G96A 4ZPWR 2E5LF 5AXMA 1UJ4A 2VV5A 4CLPA 3BGOP 4O4GB 3DDNA 3RJMB 1AROP 1CULA 4RLEA 2WOMA 1NNDA 1MLAA 1DLOB 4PG6A 1IVZA 1VISA 2BE2A 4YDXA 5LMNF 3EYZA 4HYKA 3IG1A 3I87A 3KG0A 4IG0B 5ADZA 5CCMA 2EFVA 2LA4A 1F5BA 5LOQA 1E6YB 4B17A 3SDEB 5F8HA 2HBQB 2DR9A 2KG1A 3CCLS 5C2GA 3PG9A 1NJWA 1WC1A 1BLUA 2FLPA 3DGPA 4NLOA 2LEAA 4NLVA 4DUYF 5F8IA 3DLGA 3W2WA 1O6XA 2IJFA 2FVPA 1S57A 4LREA 3CDWA 2C3YA 1PJ5A 3BPSP 3V6KA 3EVWA 1JLQB 1QE1B 3DLJA 3BF4A 2GGPA 5L46A 5A8KA 2QL5B 5K9FA 3HVWA 2G9OA 3ITHA 3HFZB 5K8NA 3NS7B 1VBXA 1WWHA 3DRRB 2AMCB 4RR5A 3O5TB 3BGLA 3CUNA 4G1PA 2VQFJ 2RUGA 2FVCA 2VPXB 2HHVA 2ZJRQ 2E1RA 3H2VE 1S10A 1G4CA 1JLBA 4O23A 1TK5A 2HHXA 1MWZA 4MK8A 2ACMA 3P49B 2RD5C 2MLXA 5KFMA 3CD6S 2ZHOA 5SZTA 5F9NA 2NSBA 1C4CA 3P96A 4K4TA 4DV0J 2FZGB 1Z4UA 1HFEL 4HR2A 4IOBA 4LFAJ 3P6YC 4LRBA 1WKJA 3TW0A 3AD7C 2ZD1B 2MLYA 1SQFA 3AT1B 3WBZA 4UOGA 2CDRB 2Z2YB 2KZZA 2ZBCA 3CO9A 4PR6A 4GVLA 3BR9A 2IJNA 4TN2A 2M9KA 1U6FA 1HR0F 1RT5B 1DQ9A 4RW6A 3AD8C 1F3FA 4KFBA 3PIPQ 4HACB 1KLNA 3EGVA 2EKNA 2DK2A 1WEXA 2UUCJ 2H48B 3A3PB 2RF2A 1QJHA 1HHSA 2HVIA 3H5SA 4RW8A 4HHUA 2WB1D 3D0GE 1REVB 3GP9A 4MIBA 1NRKA 1PIEA 1H73A 1DBDA 5E7OB 2DR7A 1UW4A 3GMGA 2WRMA 4C8LA 3W1YC 3QQCD 4DWIA 4M95A 4ECXA 1RAJA 2EBGA 3E01B 5J2NA 2CPYA 4CLFA 3MCSA 1R43A 2E5GA 4E2FB 3ZXWA 4DCJB 2L41A 2HRUA 2MYFA 3OQ2A 1UVMA 3O6QA 2O1PA 3MR6A 3A8IA 1BHNA 4GVBB 2LDYA 5IM0A 2YQ0A 4RJVA 1NDPA 1QSSA 3VGVA 2G2ZA 1LW2B 2VUGA 4KT0C 4OJ1A 3IM9A 2PI5A 3HT3A 1CJUA 5DLGA 3V6DA 3KHRA 4W92B 2JC0A 3Q8QB 3MM9B 1SV5B 2CQ3A 5KFGA 4C3KA 1KN6A 4DUTA 4TU8A 4C8KA 1CJKA 1Q8BA 3N9UC 1FKPA 5HANA 1RT1A 2M8HA 4JOUA 2W24A 2WVFA 3DHWC 4KR0B 4PYDA 2C28A 4LF8F 1X4DA 3GYGA 3QNWB 2BXJA 2RRBA 2CJKA 3BKTA 3JTNA 3VAMA 2EG1A 2PDAA 1FWPA 2LYVA 1IKYB 2EFOA 4MJKA 4FF2A 4DR3J 3D0IE 1EKSA 2A1BA 2YNGB 5BR8F 4I6WA 5M2UA 3OTBA 2VC0A 2HNYB 3LTOA 4TLQA 4F3MA 2E1AA 3RZAA 1BQNB 2RUSA 3DOLB 4G65A 5E3PA 1RTDA 1YHQS 2RQKA 2IVFB 1VRUB 3SYZA 2X1GA 1G2EA 5BYRA 3NGSA 2H9ZA 4IQXA 1MU2B 2YKNA 4X4OA 1CC8A 4QIEA 4DLGA 3V81A 4KE5A 2IVMA 1EX8A 1IBKJ 1QVGR 3ZO7A 2QLFB 1H7WA 3JS9A 2XMMA 4YFUA 1VLYA 5KFDA 1B0PA 1S0VA 4F2SA 3MEDA 2RILA 3FGVA 3BH7B 2BJ3A 4PAAA 1XWLA 1RTJB 3S6EA 1T3NA 3DYAA 3W9IA 1SPBP 3UVJB 3OUYA 1Z1ZA 1RABB 2KYXA 2G2OA 5DM7Q 3HI9A 4NEZA 2R2UA 2UVVA 4Y2KA 3VWSA 1YZ6A 2OAUA 1FRMA 3GZ7A 1M1KT 2DHGA 4MK7A 1F5AA 2X1BA 5DDQC 1RYRA 2BRLA 4DV6J 3HKWA 5FDLA 3OTOF 2A6MA 3RG6A 1IQTA 2QFJA 3IBFB 1JLFA 1RWVB 4IDKA 5HQMA 2ATLA 2G0CA 2Y0SD 4J9SA 3FNNA 2OEMA 4A46A 1WC4A 1C1BB 2W7OA 3T1YJ 2OPSA 4C8OA 4JI2J 1T05B 2L48A 2MKIA 2R8JA 2GFFA 1QAXA 1OJ4A 3WC0A 3PKMA 2VG6A 3UE2A 4DHVA 2HNDA 3UD4P 3M2RB 4UQTA 4OI3A 5B0FA 2HLUA 3HLUA 3NCQA 3PY8A 2CZVC 4LSNA 4ED4A 1FA0A 1PYTA 2GHPA 2ZUGA 3MR3A 2Z2MA 1Y5IB 1X31C 2QJ3A 4C8MA 4U7CA 1E6VA 4KGZB 2UP1A 2ASYA 4A8XA 3B54A 4I67A 2BM1A 5A6PA 5FIIA 5F8NA 2OKQA 3BBFA 1KQGB 4Y2MA 4B9LA 4ITSA 2KFZA 3BO3A 1VBYA 5D4PA 4FF3A 1PBAA 1NH7A 4UZBA 1GMUA 2UXDF 3AFGA 3LW5C 4DSFA 3D28A 3H2UB 3HHKA 3FCHA 4DN0A 1Z2LA 1RI7A 3LA0A 4YEAA 3QSYB 3DLHA 4P2SA 2M7SA 3R97A 3M8QB 2I6WA 2CJBA 2JLFA 3W5ZA 3NGRA 4ZLNA 4F0MA 4PABA 4OI0A 4LR7A 3OFHA 2BOPA 1VK3A 1PJ6A 3KLEB 1VRTB 4IO1A 4NCGA 2P9GA 4KO0A 1X4BA 2RU9A 3CCJS 4HLBA 2Z30B 3TOQA 1LKZA 3ILOA 5D4OA 2MKKA 3LUYA 1UZDA 4A47A 4HHHA 4P71A 1MROA 3ISNC 2R8HA 3E8OA 2CNOB 1N34F 3PXGa 2J9CA 4P9SA 3K5PA 4JI4J 3M05A 1AT1B 3B8HA 1IBCB 1S1VB 2QA4G 1IKWB 2EG2A 1NK8A 3DOMA 1YZ7A 3KXDA 3CCZA 3PJ9A 3IA0A 1TAQA 4JV0A 2DRAA 3OTCA 3R5JB 1KKHA 1OWXA 3MECB 4GRSA 2AGOA 2LU2A 2HQFA 2UU9F 2LXUA 2P9CA 3V6JA 2DPJA 3HCXA 4J90A 1XMQJ 2WVBA 5CYJA 3KK1B 5T14A 2IYIA 1IR1A 2MKCA 4B3OB 3W9JA 3C15A 4RKUC 2B7BB 2AGQA 4N8NA 4DEZA 1DRZA 1RTHB 3MXHP 2F3JA 5DZ7A 2VBZA 2DCLA 9ATCB 3BYPA 2JHEA 2NXEA 2Q43A 2YY3A 4TXSA 3MMAA 1FT8A 3ZNUA 1KOOA 1IQZA 2FGOA 4CO1A 3TA1A 2QLJB 3O2IA 4QYZK 1JXVA 3D4JA 4NOHA 5EWFA 1TKZA 1C2PA 3CC2S 4DQRA 5JVGQ 3T1AA 3H0PA 4M5IA 1VQKS 4IH6A 4RW6B 4JV1A 3PX4A 2HBYB 2QA4S 3M9OB 1IR2A 2CKWA 2POKA 4W4MA 3ISND 2YKMA 3MWBA 1YITS 3Q0AA 2QRRA 2EVZA 4DSJA 4EZ6A 3EPIA 3H59A 4QYRA 1A7GE 2RDDA 1F2HA 4PXBA 4A8MP 1IBMJ 1VFJA 1PAUB 4CZCA 1TP7A 2PT0A 3ETMA 4QBUA 2OELA 3Q2TC 3ELHA 5GADU 4ECYA 2NSCA 4C6AA 1PJ7A 4FYWB 4XAKA 1SUQA 3FJ2A 3JSMA 1FTCA 2YNHA 1HWLA 5L38A 3NNAA 2PE8A 3I4PA 2Y8YA 2HHQA 3NKYA 5EWGA 1R89A 2W1BA 1BY9A 2M88A 1SCJB 2PEHA 3DC2A 3LANA 1DURA 1YDLA 1XR5A 4ZVSB 3PVXA 5JJBA 3V6DB 2VA3A 5EWEA 4ECRA 3OL9A 4CTAB 4CO2A 1RKIA 2FHKA 2GVDA 4ANEA 2AV5A 2W2QP 1NUEA 2CYYA 3Q8UA 5CABA 3D0HE 4BWMA 2FLNA 2KTQA 2ZC4A 3PYDA 5KOWA 4IRKA 3KLIB 3GYNA 1PYOB 2VQFF 2W25A 4TNOA 2OTLS 2UV8G 3T41A 1CEZA 5KT4A 1VC0A 4UY85 4MYUA 2SXLA 5IWAJ 3LAKA 2LEPA 2Z4PA 1GQEA 1YJUA 5BJRA 1HQUB 3SXLA 2G1DA 3RAQA 2DNRA 4TYBA 2DCUB 4NI2A 3RBZA 4DPXA 2L3MA 3LP1B 4OYMA 3TJAA 4DV0F 1Q81T 1S1XB 5LXRA 4MKVA 2M70A 1ZM2A 2NXUA 4OX7A 4CLKA 4LFAF 3KG1A 2XWYA 1SKSA 2ILZA 2JSXA 2DGXA 2N7CA 1TL3A 1HBOA 3LQVA 4YR0A 4NLWA 1VMBA 3NNCA 1SI9A 4UOFA 4X4UA 3CDUA 2DGSA 4F4AA 4C0BA 2VJVA 3VR1A 2CZ9A 3IAM9 4NLUA 2UUCF 4A4JA 1LWCA 1YQHA 3AJ2A 5K8OA 5LMUJ 1VK8A 2V4JA 1UETA 1F6TA 4K59A 5A6WA 4YUDA 1HBNB 3MOZA 2D3ZA 2HVHA 1RJJA 1SQGA 4FXDA 1ZAXA 3N6NA 2J8SA 4RNHA 1K44A 2HQ3A 3HVTA 3I31A 4F50A 1NZAA 4F26A 3IC1A 3OJSA 1V5VA 2BZ2A 1KNZA 3C6UA 5AXLA 1RT7A 1SJ3P 4IFYB 2OHDA 5GAGU 2R7SA 3OL6A 5IT4A 3MF5A 2XMUA 5H9FJ 4R25A 3IMQJ 3DI6A 5DO2A 2HBRB 2DRDA 2IY5B 4PWDB 1U1LA 1JWWA 2R7OA 1FRKA 2KL8A 3N6LA 4B3TJ 4JV2A 1JLEA 4Q8EA 2ZVSA 2GNKA 1I6JA 2MY8A 4F2RA 2VU5A 3SMZA 4DV1J 1UWAA 5BYQA 3C14A 3BV8A 1PKUA 5CYQA 3C6TB 3EXYA 1RA6A 4LSLB 1W2IA 3DM2A 4ZHRA 2B5JA 1KLMB 4WFBQ 4QJVA 3JSYA 2EC0A 1TTHB 4EFAC 5GMDA 4WCEQ 4H4KA 2QTWA 4TU9A 4JI8J 1HBUB 4O0NA 1KQSR 3IP0A 2D3O1 2R7VA 2GJ2A 1LWXA 4DR3F 1YG0A 2K7JA 1SH2A 4USJC 4Q0BB 2AU0A 1S6QB 1RHRB 2B56A 2HNZA 4U96A 3EZOA 1WHVA 2KI2A 2LQBA 1U6BA 3I9V9 3MR5A 4NRTA 1OQ6A 4USUA 2HIQA 3D54A 3ADAC 3NEKA 1ZM4A 3UR3C 2IVYA 4DV2J 2HVEA 1IJEB 1QM9A 4ECVA 1U26A 4USWA 3TEGA 2HRTA 4F3OA 3N4WA 4LF9J 3G6ES 3RB4A 1CS4A 3ZNJ1 5HLFB 2IC3B 3W60A 4HH1A 4XO0A 4OI1A 2IRUA 4ZOSA 1GNKA 2R2TA 4X4VA 1IBKF 1QAYA 1JK9B 4KH0B 4LRCA 2YTCA 4DFJA 4YP3A 3NG8A 2I2YA 3DRPB 4WIIA 1IWAA 1FKOA 5KTQA 3JB9k 1VQNS 1TL1B 1JJ2R 4WE1B 3GPAA 3FSYA 2P6TA 4DR7F 4KHPJ 3UD5A 4WKYA 3ENAA 2AEFA 1SKWA 3H98A 4MFBB 2R7QA 2Q79A 5B0BA 3M30A 2J5AA 3H4DA 4H4MB 3OLBA 1V5IB 5CD4H 2Y1JA 2LCWA 3D1HA 4KPYA 1VOMA 1XERA 4PEOA 3UN2A 4HI1A 2ZH3A 2YH1A 2N3OA 1N48A 1UEUA 3KHGA 3N28A 3QIDA 4KKOB 3CCSS 1FJEB 4KV8A 1S9FA 2VKZG 4V1Ak 2VG5B 1HLWA 4KRWA 4QR2A 1L3UA 8RUCA 5HMXA 2IAJB 1YJ7A 4ZCLA 3UI3A 2YWFA 2UVWA 2MSSA 4Z7YA 5D0HA 4WYWA 4JI1F 2Q66A 2RSQA 3AD9C 4UOCA 4Y65A 2HQCA 2ZKTA 5C42A 2DNZA 2KHDA 4O3SA 2A3JA 5B08A 2NZ4A 1RT2B 1B7YB 4NXMJ 4H4KC 3A3NB 5B09A 1URRA 2ASLA 2HS0A 5KT7A 2FC8A 4YY3J 3DLKB 1LV5A 3MM6A 2OI2A 3D7SB 1R0BG 3FCVA 1EIYB 1NSPA 4V19X 4I0WA 1RT4B 2V4QA 4UTGA 2JL9A 1RCOB 3SCLE 4M1KA 5M2PA 4QW9A 2HZVA 2UUAJ 3H7HB 4LF4J 7FDRA 3RBDA 1WKLA 2G4BA 3SSQA 1BQMB 3EGZA 3X1LB 4WTYA 3BN4A 3LAMA 1TMJA 3ET6A 2W2NP 3K5MA 5G0RB 1FEEA 3BJYA 4FKYA 1IKVB 3FFIA 5A2QU 1LWFB 2J6TA 4OX9F 2NYIA 4EYHB 3KLHA 1FNOA 2X7IA 2XY5A 1RB0A 4FDFA 3T3FA 4BDPA 1I3OB 2IFXA 4A8OA 4ZVQB 2FJWA 1LXNA 2GVZA 3JQJA 2F63A 5HP1A 2C2OB 1Y4ZB 3GIKA 2HFUA 1XR7A 1RHJB 1UPPA 2CQGA 2O3DA 3CJ3A 4JI4F 3POTB 4XDCA 4DUZJ 1PBUA 3RW7A 2DY1A 4P2XA 1XMBA 5F8LA 3OBIA 1UWBA 2GAHC 5HBMA 5KG3A 3TA0A 1RAGB 4L76A 4RNOA 1UVNA 1S77D 5FD1A 3Q2SC 4YB5A 1U1KA 1F9HA 2QLWA 3G2XA 4LBHA 1PO6A 2Q6CA 4NLRA 1HYSA 3QT6A 4QWCA 4J5OA 3B78A 4JV5F 1BE4A 1VS3A 3M1VA 1URNA 1SH3A 1XMQF 1C4AA 1TVRA 3GJTB 4HT7A 4I64A 2FLOA 2V67A 3MGJA 4A8WA 5D77A 3SI8A 3MAAA 3ILJA 1RSCA 4UUWA 4O3RA 4NI2B 1FXDA 4N47A 2GA7A 5KG5A 3HX9A 4DFPA 2BANA 2ABYA 2OH2A 2IM1A 1Q1KA 3R9LA 4WZQA 3W9HA 3QT8A 5IC4B 4WXOA 1NK0A 4B9TA 4WBFA 1N54B 3C16B 4S0MA 4RW9B 2DEJA 1NK7A 2B4OA 3NOCA 3VAFA 3CGIA 4M94A 1LK5A 3GR1A 2XMJA 1D1UA 3K7RA 1D9DA 4JI7J 3DU5A 5AE2A 3W64A 5JVHQ 4TY8A 4ZK7M 2FC9A 3BH6B 3GFHA 4DDFA 4ZVPB 4C8NA 4MKAA 1WTFA 3HHLD 4N56A 4RX6A 2DGTA 2ZWOA 4JI0J 3HD1A 2YXLA 4RW7A 1UEVA 5KG7A 3WX8A 2LQ8A 4ELVA 2GO9A 5HATA 4NA3A 1HNXF 2VODA 3W7BA 2QN6B 3LGNA 1DZ5A 3OXFA 3AOAA 1AA1B 2BA9A 3TR5A 3Q8VA 1JJ4A 5KFKA 3A8KA 1TKXB 2XY6A 4F4WA 4K4ZA 1X4EA 3OT9A 1KHVA 3HFKA 3ZTQA 2LU1A 2H51B 4Q7AA 5F41A 5H9EJ 3MMCA 3TZZA 3PJWA 3MEEA 4IQMA 2VFRA 3ILLA 3TANA 1WG4A 5LXYA 1TKTA 2ZH6A 2DT9A 2JLEA 4LBPA 3CDBA 3F41A 3Q22A 3CMAS 2VBWA 2XC9A 5J2MB 1N36J 3PNIA 4CP5A 4LRFA 4BLGA 1UEKA 2QLBB 2XNQA 3LP2A 5IWAF 1N0UA 2JEFA 3HP6A 4I2PB 1GMVA 5DQGA 4YHHJ 2HHPA 4DPUA 3DRYA 1VQ8S 1YRTA 2QA2A 4MH8A 1N5VA 3IRXB 3ZZOA 5SUHA 2OMOA 4A8FA 2IIHA 3LO3A 4C8YA 5CXTA 2QL7B 2UUTA 1VC5A 5J2PA 1UA0A 1AZSA 4WZMA 4X66F 1T0TV 4DS5A 2HGNA 2DXDA 1DTQA 2R7RA 2ASJA 2A6OA 3CWJA 1JLCA 2DNPA 3NXZA 1NDKA 4QU7A 4H4OA 3QWUA 2PSZA 1S4EA 3OVBA 1T7PA 5LMUF 2RH3A 1LW0A 2VPZB 3GSIA 4B02A 3GIJA 2RNEA 1SC6A 2OPPA 4UZCA 2QL9B 4RW4A 2FD2A 5B0GA 3TP2A 1UZHA 4RBVA 2I8EA 1ZPVA 2YH0A 2BJ9A 3CCRS 3KNGA 1S4FA 2PGCA 1OPIA 4J9MA 5CH7B 2YNFB 2VJUA 2KJWA 3PO5A 2BEFA 4LUBA 4PG5A 3HHLB 5IV4A 5E5NA 4MAKA 5CYMB 2HMIB 3LP0A 1LQ9A 1XJWB 2NS1B 4USMA 5IT9U 3IR7B 1HHQA 3OL7A 1FK9A 3QGIA 3CCTA 4DV1F 4ZMMA 3TVZA 2FLLA 3ZTOA 3PFEA 2D74B 2WHOA 1ZTTA 4K4WA 1S9EB 2MPUA 3KYLA 3MM8A 4OV1A 4ZCKA 3M6WA 2YPYA 2XMTA 4HH0A 4FVCA 1XR6A 1NMEB 2BKPA 3NL0A 3C2PA 5GAHU 4CNZA 4L3KA 2RIJA 2F40A 4BS2A 3UW1A 5A8WA 1DQAA 3L3CA 2HIYA 3UN3A 3SBMA 1D9FA 3OV7A 3TJ8A 4M5DA 3HZEA 3QRRA 1O51A 3W8GA 1NSAA 2LP4A 1BC6A 1VDHA 1FHTA 2OD6A 3KTQA 2IYGA 5LJ3Y 1J5OB 2PMZD 3TZXA 1ZA1B 4JI5J 1F3VA 2DR6A 3SQGA 4E0DA 1VCTA 3FQKA 1N33F 3CJRA 4OZ5A 2RQCA 1KQKA 4WP3A 4AFFA 3EE3A 1NK5A 3BGRB 3U1LA 4WPAA 5I4MA 1XTZA 4JUZA 2P8IA 2OPQA 3NS6A 2M4MA 4K4SA 2DB1A 3L7OA 1K73T 3CMES 3QAEA 4P52A 1RHKB 2DXFA 4O3OA 3UO0A 1UA1A 3I32A 4ATNA 4QQBA 1FNXH 2E5HA 1AXQA 1TKDA 1S99A 2LFVA 4TYAA 1U09A 1CJTA 2AX1A 2YX7A 4NXNJ 4G6VB 3DHXA 3NCPA 2YWGA 4DR6J 5MLCV 3MI7X 2CPXA 4JI6F 3IO1A 5GAEI 2V8PA 2NZCA 4OYZA 1U4BA 4X64J 2N3LA 1L3KA 4R8UB 1B70B 2MZRA 2VKRA 3FBCA 3R5GA 3OSPA 1PCAA 1M0SA 3BB5A 4L75A 5KFZA 5C25A 1Z2ZA 1CQNA 2J0XA 1EJ7L 4CM0A 4ED8A 4R5PB 2UUBJ 1RA7A 5KFJA 4O3QA 1MMNA 4F04B 3D2WA 4Q44A 2MXYA 1EQ0A 2KG0A 1DY3A 1YBUA 3GJRB 2JFKA 3I5AA 4X62J 4FNIA 1P9YA 3R8YA 1X4HA 4OZJA 5C7PA 3BGFA 3K57A 4ECQA 1RGVA 3VAHA 3WQPA 1UVKA 3CMQA 2ZBQA 4O4GA 3DXBA 2UVRA 3BSNA 1Y11A 2ZE2B 4ALZA 4CH7A 4N77A 5BYSA 1YBTA 4K0KJ 3VGUA 1CLFA 4NCAA 4Y00A 1QUPA 1RLCL 3QO9B 4B9MA 5CD4A 2X1FA 2XCAA 2AEMA 2LLZA 3RB0A 3PV8A 4R0JA 2AJ0A 4F25A 4IG0A 3HVAA 1FKAF 1HWIA 3N0VA 3M7VA 4DU8A 1WC5A 4X4QA 2KRRA 4GO5X 4EO8A 3HSDA 1E6YA 3SDEA 3U1NA 2W4CA 4O44B 4YY3F 3IXQA 1N0VC 4LF6J 1QLNA 1W7WA 1A0OB 3WIVA 3IWNC 3FC9A 4DL2A 3AJDA 2Q6BA 2K8GA 4RO0A 4LF2A 3Q89A 4OX6A 4F67A 2R8KA 2N4DA 5E2QA 4NEYA 1SKRA 3NWGA 4U7UD 2ZBIA 2UUAF 1S9GB 2NREA 1XBWA 3MEGB 3CD5A 3C3LA 1U1MA 2DGVA 3P8BB 2L9WA 2HS4A 3SCKE 4DR1J 1JLQA 2MY7A 1QE1A 2CIMA 2GHVC 3TI0A 4YB1P 3LGMA 1YKWA 4U8YA 1HWJA 1IUJA 5KT5A 2LMIA 3MM7B 2XMAA 4P75A 4F8RA 2A0FB 2CQ4A 1GFWB 3DRRA 2CQHA 2VDHA 1N5TA 5D0GA 1S0NA 3ISZA 5DDPC 2WVEA 5DETA 3J81U 3N01A 1FD2A 3J7YI 4F36A 1U8WA 3P4UB 1U1NA 2BJDA 2XBPA 5DM6Q 3CJ0A 1S6PB 5CZVA 4M5GA 2EFPA 1KVKA 4KGMA 4KH1B 2QLXA 2QSWA 5KG6A 3IR5B 1RT3B 2V2ZA 4PWUA 3BO2A 2YX4A 2ZD1A 2CJAA 3NAHA 5I42B 5KG0A 2MJNA 1K0VA 2JFDA 1YLXA 4FYXB 1RT5A 1CSJA 1IWGA 4HACA 4HVZA 1X4CA 3TVKA 2VONA 2GS8A 4IH7A 3BQ0A 2LEBA 4CLUA 2WW8A 4J37A 2WSEC 3PJXA 1GXTA 3PZPA 1REVA 1F9EB 3CE8A 5D6GA 4O3PA 3U1MA 3JXOA 2YKOA 1RACB 4DL3A 3DMJB 3MUMP 5D4NA 2F7VA 4QIGA 3E01A 4NA1A 2KKHA 5F3ZA 3S1TA 5K8PA 3M6VA 5KT6A 1SJQA 1AZSB 3MOJB 4GVBA 1Y00A 2E7VA 3T5JA 1U45A 2X3GA 3H4BA 2DH8A 4XDDA 2ZC3A 2K3KA 3IWXA 1LW2A 2RU3A 1KFSA 1ZOTA 4JI7F 2CQPA 4U7UK 1S1UA 5KFEA 2FVSA 3AOBA 3GQCA 2JEJA 4ANCA 3PYFA 3MM9A 4AXIA 4K7QA 4PUOB 1SV5A 3JYTB 3PO4A 2UXBJ 2X1AA 1WTBA 5KFFA 2W8LA 2V68A 4AQYJ 1L3SA 1BMQB 4OL8A 2ZZMA 4JI0F 3GIMA 1EZZB 2HFNA 4PG8A 5EN1A 1ZZNA 1HBMB 1HA1A 2NPIA 2FQQB 4DV4F 4FNHA 4LQ9A 3QAUA 1YJRA 1IKYA 3CTRA 4ECSA 1UJ5A 3KLGA 1IXKA 3ZZ0A 2YNGA 3VGTA 4USIA 3M9NB 1JB0C 5D0RA 4NYZA 4KGVB 5C24B 5LM7E 2HNYA 4NZ0A 4GC7A 4ZKAA 1JX4A 1BQNA 4B9UA 3C66A 3DOLA 1FDDA 4F3QA 2RKIB 4L74A 4O3NA 2CPHA 2GQQA 2U2FA 3QGHA 2I0XA 2L9DA 5KFTA 3QT5A 1FNMA 4DR4J 4K50A 1VRUA 1MW7A 2BDPA 4USVA 3RAMA 4AL6A 1C0UB 1MU2A 4X4SA 1U48A 3PX6A 1N36F 2KH9A 2F8HA 3A8EA 3GFYA 3KLFB 2C22A 3JAMU 1VQSA 4CT8A 4MYTA 3M32B 4HTJA 2XZTB 2Y1IA 1HPZB 2GZOA 5KFWA 3MUTP 3PW5A 4OI2A 1RTJA 3UN5A 3NMRA 3QWPA 3UVJA 2VFTA 2NLWA 2A10A 3RAXA 2KU7A 4YHHF 1H74A 4AYBD 5CHCB 2HQIA 3M8PB 8ATCB 2OPQB 3Q86A 1REGX 4K5SA 3FSIA 4ZP9A 1RWOB 4OQJA 3B4DA 1MNEA 1VQ6S 4NLGA 3FUYA 5CCLA 1SL0A 4Q43A 2XULA 3TJ9A 2Y9HA 3DLEB 3PW4A 3QZ7A 4ELUA 3H40A 3NGDA 1R0AA 1DJ0A 2ALYB 1C1BA 1U8SA 2GIFA 1FI4A 3HULA 2ROGA 2HKEA 3BR8A 2QGFB 1SC3B 4OJGA 5ETMA 1T05A 1NB2A 4LRAA 2OGUA 4DX8H 3GONA 3LPYA 5A2QY 2Q3PA 3GFZA 5DG8A 3M2RA 3B82A 1WDTA 2ZH7A 2HHTA 5E3RA 3TUPA 1HD1A 1HMVB 3EM1A 1N4LA 2HS3A 1SJ4P 1RBAA 2K1RB 2WVDA 4USTA 1IJFB 4ZDNA 5LSOA 1S1TA 3KDNA 4DQIA 3GSDA 3HJVA 1MN9A 4L73A 4EGLA 2HYIB 2XMKA 1Y0HA 2P9EA 4ETZA 1B99A 4PG7A 2DNOA 3PYEA 4C3LA 1SIZA 4DS4A 2HFZA 1P9QC 5D4LA 3D3BJ 2M5YA 2R2SA 1PGZA 1Y5NB 1AUSL 4EI2A 3VAIA 3LGHA 2MKSA 3CD0A 3OJUA 2CQDA 4ZLJA 1ROFA 5LT5A 2H4YB 3M8QA 1FFWB 2XCPA 4EWTA 3OL8A 1Y3KA 4LT6A 2AF6A 2D41A 2DVIA 3VZHA 5J2QA 3PRDA 4DX5A 3KLEA 4ED7A 2Z58B 1VRTA 2EKYA 3D9BA 4ZITA 3CCUS 4K8RA 3TO8A 1B0VA 1PSDA 5ETQA 1H72C 1VBZA 1N52B 1N32F 5GAHI 2CPEA 4WP8A 2MEWA 3W3SA 3QMQA 3N5BA 1GEHA 1SXLA 3K5LA 3IR6B 3OHAA 1TMMA 2XS7A 1S1VA 1IKWA 5IXUA 2PC6A 4F4KA 3QJLA 4NX9A 1FCAA 3MTKA 2BW7A 3TRGA 2XNRA 2QZ8A 2HHHJ 1NHKL 2WVCA 1TL5A 2XMVA 7FD1A 4DR6F 1HW9A 3MECA 3MPUB 2Z2ZA 1Q0NA 2HFOA 2L9NA 2MJUA 1T03A 1UMJA 4X64F 3R1LA 2OSQA 2CPZA 4A8YA 2C3UA 1WG5A 1SH0A 4CH0S 3ZFVA 3FQLA 3R6LB 3KK1A 3GE9A 2HGMA 1FERA 3UCUP 4B3OA 4AT1B 3MCMA 4C0HA 3OSNA 4ZVEA 2C3MA 1RTHA 2VH7A 2CQCA 4ZPVR 3TVYA 4ECUA 1NJYA 2RQMA 1R0CB 4ECZA 1KOHA 1G7CB 1Q16B 4HI2A 1T9TA 2GCFA 2MQ8A 2CRLA 3ZTRA 1FFSB 2ZM6J 3FEXB 4YOEA 2B6AB 1WACA 3EJMA 3G6VA 4I6YA 2XS2A 1K1SA 1RTIB 4NZ7A 1I1GA 1IM4A 1ZETA 4WP9A 1VHFA 4DV5J 1BWVA 1D09B 1ZZFA 1VIOA 5HQLA 4DG1A 3CSKA 5IQ6A 3BBBA 3M2UB 3G82B 2QMUB 5D8HB 1X5OA 5HMYA 4ED2A 4KHMA 1CJVB 3TX8A 1WUUA 2ROEA 3FRZA 3I5BA 3R7NB 3G4SS 3RTVA 2MZSA 4BCAA 2PI4A 5GMEA 3MPDA 3GJQB 4TLRA 3R2DJ 3ZTSA 4WU2A 2E5LJ 4LF6F 4HHJA 4UQGA 2O5DA 3V4IB 2AJ1A 3KDOA 5E3CA 1TL7B 3ETOA 3QLHB 2XZWA 3MCNA 1S1UB 5D15A 3ZZPA 1FWLA 5LMNJ 2K7KA 3ICLA 2BOAA 3J7A1 3PX0A 1X9WA 4AUKA 1ZBTA 2NPFA 1M5OC 4CTAA 2E7XA 2VFSA 2Z56B 5KFYA 3PTWA 2GMLA 4DR1F 4TU7A 2B4VA 3IS9A 3KJVA 2J0SD 3M6UA 2GQCA 1FE4A 2D9OA 3W8PA 4W90B 2NQPA 3DOKB 2DYAA 1C1CB 2WBMA 2BM0A 3ENWA 3NGUA 2XI2A 3K8VA 2CDQA 2DIVA 2HG4A 5IFMA 3QFHA 3KLIA 2ACYA 4QWAA 1C0TB 4DUYJ 4XTTA 2ZHAA 4HL9A 1OMSA 1SJRA 3KLGB 2ZH2A 4ES3A 5THWA 1J2VA 1HQUA 4HT5A 5F3TA 2W9BB 2XG8A 1V3ZA 2HK3A 3LP1A 3FRYA 2LA6A 2FGCA 1S1XA 2N4CA 1S7HA 3CCQS 4XIUA 5IT9Y 2E29A 2WONB 5F9LA 2ATCB 3DLBA 4RUAA 1OY8A 3R2CJ 5ETNA 2XYHB 2VL1A 4RUHA 4LIRA 1F2GA 1H0HB 3S7RA 5IC6B 2F8MA 2VF3A 1V3SA 2FVQA 2D7SA 1VHIA 1V9OA 4B08A 2ZEJA 1KVJA 2IJRA 3E3XA 3CDEA 2ZH4A 3FBFA 2EWHA 1UFLA 3G8SA 4ZJLA 2KVIA 1HBNA 4G1QA 3RRHA 4I7FB 1G6BA 2V8VA 2LQJA 1TV6B 1IKXB 3T1HF 1GK8A 4PQUB 5DJBA 1RWXB 4B3RJ 1XNRJ 4KBIA 3V6HA 3DXSX 3SV3A 4Y6IA 2M0GB 1KSPA 2R42A 2K06A 4HTIA 1GTEA 2KRBA 4IFYA 3T6BA 3C19A 2VQEJ 1MN7A 3K89A 2PEBA 1M5SA 2NUHA 1QSLA 1YIJS 2COLA 1FVSA 2XM3A 3K58A 1N5SA 4PWDA 2JEGA 4UUXA 1R0AB 1EP4B 2EXUA 4ELTA 4DSEA 3HFVA 2DRBA 2DY9A 2VFVA 1HARA 3C6TA 2UXBF 3PR4A 4LSLA 3TAQA 2MHEA 2ERRA 2DHAA 2PO4A 4AQYF 3HMJG 1HIYA 1KLMA 1FDAA 4QR1A 4PCQA 2VFUA 1LOUA 3HHDA 1IBLJ 4KY3A 1XC9A 4KPCA 4YDDB 2O67A 1RLDA 1HBUA 4Y28C 3RR8A 1FRXA 4K2JA 4LFBJ 1YJWS 1S1TB 4LR8A 1XMOJ 2IRYA 2CJ9A 3MM5B 3GV5B 4Q0BA 1HI0P 1S6QA 1H98A 4I68A 5IZHA 3J7Z5 2IMOA 1UKUA 2AX0A 3KLVA 2DNMA 4OHXA 4WTOB 4RWXA 3UDEA 3KK2A 2D3UA 1KWMA 2CQ1A 2RE1A 4LF8J 3NCRA 4K5RA 3PACA 3SSSA 3BKFA 1WHWA 2CVIA 3ENQA 5ETKA 4ZVUB 4KYZA 5AJ3F 2H5EA 5HLFA 2IC3A 4OX8A 4AD6A 3MURP 1F60B 3TQEA 3BSCA 4UOHA 5BR8J 2ZBPA 4CWBA 1U6ZA 2K3IA 4DFMA 3DRPA 4QU6A 5J2QB 2FJBB 1R6VA 1QAJA 4J9RA 1U25A 2J6SA 1TL1A 4GKKF 4WE1A 2RHQB 1KS2A 4P74A 3MHYA 3D1QA 1SVDA 2MQLA 3M8SA 1CPZA 2F4VF 2P2CB 2JWNA 4MFBA 2KDOA 2XS5A 2IDEA 3GJSB 1YI2S 5KG4A 3CXCR 4ILRA 1M90T 2MKJA 4H4MA 1RWKB 2FDNA 4QWEA 1I94F 2PFFB 4ZN1A 3V5RA 4OHVA 3K2YA 1VBKA 3BQ1A 2ZUAA 3TARA 3RBXA 1R31A 3AJ1A 2BUNA 4B3SJ 2YQ3A 1UP1A 4B3MJ 2J8AA 3KG4A 1SL2A 1SJFA 4OYBA 3CC7S 4KKOA 4AL7A 3UPFA 2VG5A 3F56A 3SQOP 5LL6d 5B0EA 1S7IA 3I9ZA 3QIPB 2ALZA 2IAJA 4KTQA 1T03B 3I6PA 4NLYA 3FBEA 3P45B 2CA9A 3CEDA 4M5LA 3VZIA 4EMDA 3UD3P 1NPRA 2CG8A 2HFSA 3PHEA 4KB7A 1JLAB 4LIWA 2QG9B 2D1CA 3L7PA 4MTPA 4ZVRB 1H3DA 2C2ZB 1WC6A 1QVFR 2VG7B 3J81Y 1FJGJ 1RT2A 2LVWA 4E8UA 3I0RB 1IM6A 4USHA 1ICEB 5ITHA 4P2MA 4LF7J 4Z2XA 3DLKA 1O8BA 3RYLA 2FJEB 4NRUA 1RT4A 4ED1A 6FDRA 3KMSA 4FYYB 2VICA 4Y2IA 1GX5A 1HL6A 2KFNA 3QFWA 4PPZA 2XHCA 3HZGA 1PG5B 4OFZA 2IBOA 3MD3A 3EZUA 3R5CA 2FHJA 3TX0A 3BYRA 3UDCA 3H42A 4P2FA 2ZH1A 3CDAA 2Z8QA 2PD1A 4DG1B 5HROB 5HO4A 2MZTA 1BQMA 4FZVA 5ETSA 2R8GA 2H5JB 3MAHA 5H1SV 1RAFB 1FX2A 5G0RA 3LPEA 4NLXA 1IKVA 1YRXA 4OLOA 5HJXA 2ZH5A 5C2CA 2V34A 1LWFA 2Y3YA 3CJKB 4ID8A 2ZVIA 1Q86T 2Y8WA 4TQRA 2KM8B 1Y7PA 2UXDJ 1DQ8A 3K5OA 2WAQD 2HEKA 3EVOA 3BQ2A 1RWMB 4EZ9A 2BV3A 2HVDA 2V69A 4GO7X 4WFAQ 5CQGA 3GIIA 2YKAA 3BREA 2QYGA 2YBVA 2NUUG 2B0GA 3POTA 3NGTA 2QX0A 3UFCX 4FN5A 5FLXU 2BABA 5AXKA 3IS9B 1QDUB 2ZWPA 3KJVB 2M52A 2YKPA 1MWYA 1FXLA 4PKDB 2CQ2A 1VC6A 1EQMA 3EDQB 2WZ1A 1JLGB 2QEXS 3HM9A 4X4NA 5I3UB 4X4TA 2PMWA 3AODA 1UL3A 3MD1A 3GV7B 3PEHA 1Q53A 2BKNA 1N34J 3NNHA 3PW0A 3O8WA 1NCLA 4ZP7A 4P7VA 3K59A 4OMFG 1X5PA 3W2VB 1S49A 4OYXA 4M8LA 4RU2A 2VPYB 3TAPA 4F02A 4GC6A 4DXLA 2E66A 5E33A 4EUVA 2XY7A 1N5QA 5ETVA 2JC1A 1CC7A 1KD1T 5D3GB 3C16A 2ZM6F 1OIAA 1X5TA 3R27A 1LNQA 1D9AA 4RW9A 2UU9J 4OYOA 3VQTA 1S1WB 3Q8RB 4CO0A 8AT1B 3T6JA 4LBIA 1CG2A 2MQNA 4OJ3A 4I2QA 2HAIA 1UPMB 4DV5F 3HSGA 2PA3A 2B7CB 3RUBL 2B4PA 3WHIA 3RGIA 2GW8A 3QJJA 5EUHA
chains in the Genus database with same CATH topology
2MTLA 4DV1J 4LF9J 1N33J 4V1Ak 3OTOJ 5BR8J 4DR1J 2HHHJ 2UXBJ 4GKJJ 4DR2J 4DV7J 4NXNJ 4AQYJ 3T1YJ 4K0KJ 3JAMU 1IBLJ 4LF5J 4KY3A 1N36J 4DR6J 1N34J 5A2QU 5LMUJ 4X66J 4JI2J 1IBKJ 4JYAJ 4DUYJ 1HR0J 5AJ3J 2UUCJ 1IBMJ 4X64J 4JI0J 4JI8J 2UXDJ 4LFBJ 3J81U 3J80U 1XMQJ 4B3RJ 1FJGJ 4HHUA 1XMOJ 1XNRJ 1HNZJ 3R2DJ 4KHPJ 2E5LJ 4JI3J 2KVQE 2VQFJ 4LF7J 4NXMJ 2UUBJ 5IWAJ 3J7AN 4LF6J 3W1YC 4DV3J 4JI5J 4PWWA 4GKKJ 4DR3J 4JV5J 4JI6J 4YHHJ 4YY3J 2MEWA 2VQEJ 4JI1J 2MQ8A 5LM7E 3D3CJ 4DV4J 2UU9J 4NEZA 4LFCJ 4B3SJ 4OX9J 2F4VJ 3T1HJ 2ZM6J 4NEYA 5IT9U 4DR7J 2UXCJ 1XNQJ 5FLXU 5LMNJ 4B3MJ 3IMQJ 4LF8J 4DR5J 2KL8A 3R2CJ 4B3TJ 4DUZJ 4DV0J 1HNWJ 1HNXJ 4DV2J 4RJVA 4JI4J 3D3BJ 4DV6J 4X62J 4KYZA 2UUAJ 4DR4J 4LFAJ 1J5EJ 4LF4J 1I94J 1N32J 4DV5J 4X65J 4JI7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTL A;  4DV1 J;  4LF9 J;  1N33 J;  4V1A k;  3OTO J;  5BR8 J;  4DR1 J;  2HHH J;  2UXB J;  4GKJ J;  4DR2 J;  4DV7 J;  4NXN J;  4AQY J;  3T1Y J;  4K0K J;  3JAM U;  1IBL J;  4LF5 J;  4KY3 A;  1N36 J;  4DR6 J;  1N34 J;  5A2Q U;  5LMU J;  4X66 J;  4JI2 J;  1IBK J;  4JYA J;  4DUY J;  1HR0 J;  5AJ3 J;  2UUC J;  1IBM J;  4X64 J;  4JI0 J;  4JI8 J;  2UXD J;  4LFB J;  3J81 U;  3J80 U;  1XMQ J;  4B3R J;  1FJG J;  4HHU A;  1XMO J;  1XNR J;  1HNZ J;  3R2D J;  4KHP J;  2E5L J;  4JI3 J;  2KVQ E;  2VQF J;  4LF7 J;  4NXM J;  2UUB J;  5IWA J;  3J7A N;  4LF6 J;  3W1Y C;  4DV3 J;  4JI5 J;  4PWW A;  4GKK J;  4DR3 J;  4JV5 J;  4JI6 J;  4YHH J;  4YY3 J;  2MEW A;  2VQE J;  4JI1 J;  2MQ8 A;  5LM7 E;  3D3C J;  4DV4 J;  2UU9 J;  4NEZ A;  4LFC J;  4B3S J;  4OX9 J;  2F4V J;  3T1H J;  2ZM6 J;  4NEY A;  5IT9 U;  4DR7 J;  2UXC J;  1XNQ J;  5FLX U;  5LMN J;  4B3M J;  3IMQ J;  4LF8 J;  4DR5 J;  2KL8 A;  3R2C J;  4B3T J;  4DUZ J;  4DV0 J;  1HNW J;  1HNX J;  4DV2 J;  4RJV A;  4JI4 J;  3D3B J;  4DV6 J;  4X62 J;  4KYZ A;  2UUA J;  4DR4 J;  4LFA J;  1J5E J;  4LF4 J;  1I94 J;  1N32 J;  4DV5 J;  4X65 J;  4JI7 J; 
#chains in the Genus database with same CATH topology
 2E44 A;  4K4Y A;  4R0E A;  1NSK L;  1FXR A;  4CIO A;  1ZS6 A;  4Y2C A;  3US5 A;  3OVA A;  2OEJ A;  4G1Q B;  3OR2 B;  1T9X A;  1WI8 A;  1YWX A;  4F4Z A;  2O66 A;  2YQ1 A;  3CJ4 A;  2GIQ A;  2KT3 A;  3CJS A;  2V9K A;  3AXM A;  3JAM Y;  4RNM A;  1S0O A;  2QC3 A;  4DZ6 A;  4KGX B;  4GMK A;  3RW6 A;  2MQP A;  1LWE B;  4F0H A;  3OFG A;  5DLF A;  1RAI B;  3R7S B;  3ZZY A;  1RT6 B;  4AE5 A;  4H54 A;  5A0Y B;  2XSF A;  2VB6 A;  4ZIW A;  1TKX A;  1TU0 B;  2MGZ A;  3T5K A;  4YB6 A;  5DQH A;  2HRY A;  2Q1L A;  3MFH A;  1FES A;  2W7P A;  1VQM S;  5DQI A;  2W2O P;  1BXN A;  9RUB A;  3D6T B;  3FSX A;  2VHG A;  2VBY A;  1RKJ A;  3Q8S B;  4HKQ A;  1GX6 A;  4ICL B;  2E1P A;  2OUG A;  4IFV B;  1YSJ A;  4Z37 A;  2B9W A;  2A18 A;  4OI6 A;  4DSI A;  1OPZ A;  1H6K X;  4FYD A;  2XMW A;  2FVR A;  3SEO A;  1KFD A;  5E41 A;  5J2M A;  1VQL S;  2XLK A;  3KOA A;  3ZZU A;  1PC4 A;  3H20 A;  3CCV S;  2V8D A;  1SC1 B;  3BSA A;  4K4V A;  2BKO A;  1U7L A;  2AGP A;  1DTT B;  2FYX A;  2FHJ D;  3VAJ A;  1JMT A;  1S5Z A;  1WC0 A;  4O4R A;  1J27 A;  2F5G A;  3UDV A;  5HVG A;  1FEH A;  4J9V A;  4JI3 J;  1KEK A;  4I2P A;  3VAG A;  2DNH A;  2XO6 A;  4C11 B;  1H2T Z;  4F7V A;  4NLS A;  3IRX A;  5DRK A;  2GQ2 A;  2ZOM A;  4C3M A;  1UTA A;  2E5J A;  3KK2 B;  3HO1 A;  1AFJ A;  2E9R X;  4AXJ A;  2DIS A;  2RML A;  1JKH B;  4QYZ J;  4CLL A;  2RQ4 A;  4C7Q A;  1X7V A;  4IOA Q;  1VQ4 S;  3KKF A;  4Q8F A;  4CLS A;  2V0N A;  4DPY A;  2HPU A;  3K5N A;  2BMB A;  1AFI A;  1RU2 A;  3QT7 A;  2VPW B;  4ZLL A;  4ZP8 A;  2V50 A;  3PW7 A;  3WDO A;  4MKB A;  1CBK A;  3G6Y A;  3TUZ C;  3MMB B;  4OZ1 A;  5I3Q A;  2DH7 A;  4KHR A;  1EAR A;  5HJY A;  2EPI A;  1U0H B;  3RBE A;  2ADC A;  2EI5 A;  4B3R F;  1XNR F;  1FRH A;  3V2U C;  3MMJ A;  1M1H A;  1WOR A;  3PYG A;  3HSZ A;  2YNF A;  3BSO A;  4P10 A;  2HLT A;  1HQ2 A;  2JH3 A;  3SFU A;  2RDI A;  2BJ7 A;  1UW9 A;  2OPR B;  3CD7 A;  4W98 A;  1Q7Y T;  5K14 B;  3HHL A;  2VQE F;  4DV6 F;  1U24 A;  1U49 A;  5CYM A;  2HMI A;  5L1I A;  5FJ4 A;  3OPK A;  1WOO A;  1NEE A;  1NHU A;  2F65 A;  4DCO B;  3FZB A;  3JSR A;  1FF2 A;  5L1J A;  3T1Y F;  2DNY A;  2HHS A;  1M5P C;  2F9D A;  3GCX P;  1CVJ A;  4NA2 A;  1S9E A;  2CPF A;  3BEG B;  1RU1 A;  4JI2 F;  4U6P A;  3UDL A;  2H1Y A;  4N5S A;  3EGW B;  4OJH A;  2FJA B;  2GV1 A;  3AH6 A;  3DRS B;  2CAD A;  2GC8 A;  2I9S A;  2W4D A;  5KT2 A;  3UNG C;  1IBL F;  3LWL A;  3FMB A;  2NYH A;  4WKR A;  2AP6 A;  1K9M T;  5DGB A;  5EX3 A;  3PR5 B;  1HNV A;  4JYA J;  4LFB F;  1T9Y A;  3VV2 B;  3CC4 S;  1XMO F;  4OYA A;  5ETR A;  4NML A;  1T8E A;  2W9C B;  1NH8 A;  1SKU B;  4DQS A;  2OLW A;  1J5O A;  1VR6 A;  2CJX B;  2IPO B;  1K1Q A;  2JZ5 A;  3CPW R;  5KOX A;  2AJ4 A;  4QR0 A;  2KHC A;  3BGR A;  3QRP A;  2AT1 B;  3EZ5 A;  1X9M A;  2YNI B;  5J1E B;  1HNI B;  4ERD A;  1WG1 A;  5KFC A;  4NAS A;  3CJ2 A;  4QWD A;  3U7J A;  4DPW A;  2DIT A;  3WIU A;  4CM2 A;  3RRK A;  2DIU A;  2FZK B;  2R2R A;  3M2V B;  2MTL A;  2VBX A;  3HT0 A;  4KIA A;  3KK3 B;  3DCA A;  3BZQ A;  2GHW A;  1UCN A;  3THP A;  3H25 A;  1X60 A;  2OEK A;  1GH8 A;  2ZOG A;  2DNL A;  2HVZ A;  4ED5 A;  2CPD A;  5B0A A;  2ZJQ Q;  2ZFH A;  4R8U A;  4G3I A;  1AW0 A;  2E9Z A;  4YR3 A;  3K8W A;  1EET B;  4R5P A;  1OY9 A;  1BUX A;  3I0S B;  3FK4 A;  4WK3 A;  4FS2 A;  2XYG B;  2RDJ A;  3MTJ A;  5T7L B;  2DBB A;  3AQO A;  1S12 A;  2Z2L A;  4FKX A;  4U8V A;  2WSC C;  3KHH A;  5D0E A;  2E5I A;  3AA8 A;  2DO4 A;  4ZIV A;  4B3S F;  4B9N A;  1Q4R A;  3KJF B;  1JIH A;  1X4G A;  4KSE B;  4B3M F;  2DNN A;  2H65 B;  3HXM A;  3HHL C;  2JX2 A;  1X5S A;  4DR7 J;  1FJ7 A;  2LQ5 A;  3CW2 C;  4DF8 A;  2VD3 A;  4DSK A;  4OYW A;  2QE5 A;  3M8Y A;  3NBP B;  2F4F A;  2Y1L B;  3NOG A;  4LVO P;  3S01 A;  1RE1 B;  2ZE2 A;  1VRQ C;  3QPI A;  2O01 C;  4FXV A;  3RU0 A;  4RBT A;  1PYS B;  4DR2 J;  4ID5 B;  2ZH8 A;  1UVI A;  4L72 B;  2AZ1 A;  4IH5 A;  2MKH A;  4NLQ A;  4EBC A;  3QO9 A;  2DPI A;  4PQA A;  2X3D A;  3AQP A;  1N6Q B;  2VA2 A;  1QTM A;  1PAE X;  2DGO A;  1FJG F;  2AYG A;  1H2V Z;  3LH2 S;  2XB2 D;  4FF4 A;  2J76 E;  4LF7 F;  4QIV A;  4O44 A;  1W26 A;  2C2D A;  2DKO B;  4OHY A;  4YB7 A;  4QW8 A;  4BC7 A;  1F9F A;  1LFW A;  5AT1 B;  4A8S A;  2HFV A;  4I2Q B;  1RAH B;  4JI1 J;  2CVE A;  5DG9 A;  1NZ8 A;  2BQU A;  1UJ6 A;  1S9G A;  1NJI T;  2W9A A;  1XNQ J;  3TAM B;  1OS5 A;  3MEG A;  4Y34 A;  1IR0 A;  3VF0 B;  1TK8 A;  5HL7 Q;  2MB0 B;  1YTY A;  1IBM F;  3JQM A;  4OHW A;  2V63 A;  5IS2 A;  4OHZ A;  2RAQ A;  2H54 B;  1SIW B;  3ONQ A;  1YRU A;  1VIX A;  1RHQ B;  2GMJ A;  1N5Y B;  3PFO A;  2OIH A;  3MZI A;  3DKD A;  3MM7 A;  4DV7 J;  4FBU A;  1I5O B;  5KFX A;  1DAR A;  3OR1 B;  5L9N A;  3GG0 A;  5JUM A;  3PRB A;  2LDI A;  2NXJ A;  2QSF A;  1CUL B;  3FMW A;  2JJ4 D;  2FJV A;  2WOM B;  3HHN B;  2XLI A;  2C2K B;  2J9E A;  1RBL A;  4CT9 A;  3G71 S;  1P8G A;  2BE2 B;  2MGZ B;  1S6P A;  3T9Z A;  2BRK A;  3FKB A;  1WD6 A;  5GAD I;  1RZM A;  3UCZ P;  3IG1 B;  4YQW A;  1D8Z A;  4PZV A;  2KN4 A;  3G87 A;  2PA8 D;  3K0J A;  4MKY A;  1T9V A;  4L3N A;  2E1C A;  4OX9 J;  5F8M A;  1WC3 A;  1RT3 A;  1RHM B;  5HSP A;  2CPI A;  2CFX A;  5I42 A;  3I56 S;  3KUH A;  4RWW A;  5DS7 A;  4CNY A;  3DGP B;  1TR0 A;  4ZPB A;  2V4R A;  4BHQ A;  1QY7 A;  5H9F K;  2FJD B;  2EC2 A;  1T3O A;  4N7T A;  3DLG B;  3W2W B;  4P72 A;  4GKJ J;  2IDL A;  3ULH A;  1GT8 A;  4DF4 A;  3HPO A;  5KT3 A;  1LFP A;  2AKW B;  2MZJ A;  4FPI A;  1RAE B;  1TQL A;  3EXC X;  3KUG A;  1ACM B;  3TQ1 A;  5B0D A;  2C3P A;  2ZZT A;  2GGP B;  1P1L A;  3DMJ A;  5A8K B;  1GTH A;  2J6U A;  2GO8 A;  3KJQ B;  4DLE A;  3ITH B;  4ECT A;  3A3O B;  4B9S A;  2GX8 A;  1WDD A;  1RBO B;  3Q8Y A;  1JXE A;  1RWP B;  4HEA 9;  3G86 A;  4JV5 J;  2IA0 A;  5B7W A;  3UR0 A;  1KQF B;  4URG A;  2MLZ A;  4YR2 A;  2M2B A;  2HBZ B;  2HZA A;  2BE9 B;  2JDJ A;  1JLB B;  3MR7 A;  1S6U A;  1X4A A;  1ZYQ A;  3OD2 A;  3QZ8 A;  4ZPA A;  1HNW J;  4QCL A;  4J7C A;  4B9V A;  3JYT A;  4PUO A;  3QBC A;  1HQE A;  3CO0 P;  3TUI C;  2CNK B;  1TUW A;  2UZA A;  4DPT A;  3THV A;  1HKA A;  3QGG A;  4ENO A;  2MST A;  1MWQ A;  2CAJ A;  1HBM A;  2YWE A;  2V2Q A;  2B9X A;  3M8Z A;  2JOQ A;  1K8A T;  4Y3C A;  1U2C A;  1K47 A;  1OYD A;  1RTZ A;  1X0P A;  4KFB B;  5KG1 A;  3KHL A;  1ITP A;  1Q8K A;  4ZA1 A;  1S79 A;  5E3A A;  3NP5 A;  2RF2 B;  4RW8 B;  4B3T F;  2IM3 A;  5C24 A;  2C3O A;  3CJQ A;  3IBC B;  2AYM A;  1ZAW A;  2DH9 A;  3TEH B;  2RKI A;  2WW4 A;  5T41 A;  4P73 A;  3VVT A;  5IV3 A;  3OFF A;  5J2N B;  2E9T A;  3R5A A;  5KFQ A;  4DR5 J;  1TUV A;  4MIW A;  5A8R A;  5GAG I;  1OSD A;  1V3R A;  2H4W B;  1HNX J;  4WFZ A;  1C0U A;  3QGP A;  3U02 A;  4DL4 A;  5M2R A;  1ZM3 A;  3VVU A;  3MEK A;  3KNA A;  1HI1 A;  4X65 J;  5IM0 B;  4JI8 F;  2RT3 A;  4ED0 A;  4NL5 A;  3H8Y A;  2BVZ A;  1VQY A;  1P1T A;  3KLF A;  4RNF A;  2GAG C;  1HNV B;  1BD6 A;  3M32 A;  4DL6 A;  1CJU B;  2CWX A;  3F0N A;  2BJE A;  3DGV A;  1HPZ A;  2B9E A;  2ZOF A;  4M5K A;  4N8O A;  4F4X A;  2QO3 A;  4JI3 F;  2PN6 A;  1CJK B;  3J80 U;  1FKP B;  3HJF A;  1RT1 B;  1H7X A;  3M8P A;  2JLG A;  4EO6 A;  4F4Y A;  2JVR A;  4DV2 F;  2VZ9 A;  3M4X A;  2AJQ A;  4IOC Q;  3JQK A;  5BXI A;  2IRX A;  2EK6 A;  4LF9 F;  2MHN A;  2CQI A;  5JMN A;  2AHO B;  3DLE A;  3R3T A;  3O1L A;  3I4H X;  5ETO A;  1M5H A;  2VIH A;  3GWC A;  4A48 A;  1Q82 T;  2R7W A;  1U2F A;  2AD9 A;  1FJC A;  3MUV P;  2OFH X;  3O3L A;  3A1Y G;  3GTY X;  1NM2 A;  1RTD B;  2YVS A;  4KHP F;  4C48 A;  2OO4 A;  2RVJ A;  4X4P A;  1FVQ A;  3VTI A;  4ES1 A;  4RPF A;  2YKN B;  4X66 J;  1HW8 A;  5KFO A;  1XN9 A;  1YK9 A;  1HMV A;  3V81 B;  4OZ2 A;  2FPH X;  2FJX A;  2K1R A;  3D6M B;  4LVN P;  1RUS A;  1HWK A;  2W7A A;  5DGA A;  4NMX A;  1DAX A;  3MED B;  4O0I A;  1UFK A;  3DYA B;  3OUY B;  3CJ8 A;  4EYI B;  4DN9 A;  1F1B B;  3FEZ A;  3BKU A;  2UXC J;  2OJ3 A;  4QPT A;  4ETX A;  5FLX Y;  3EGN A;  3A12 A;  3L9Z A;  1U1O A;  3J7Z T;  2CXE A;  2AYB A;  4PG4 A;  1RIS A;  3LAL A;  5E3Q A;  2ASD A;  1FX4 A;  1RWN B;  3Q23 A;  3OW2 R;  4RU9 A;  1U0S A;  3GR0 A;  5FDL B;  2D3O R;  3VGS A;  1JLF B;  4IDK B;  1VJW A;  1Q95 G;  3ZZZ A;  5HMW A;  3MR2 A;  2R7T A;  2CJY B;  2Z0G A;  4NXM F;  4JYA F;  1U1R A;  4WIQ A;  2WCX A;  1ELO A;  1KTV A;  5KFN A;  3TUJ C;  2OPS B;  4Q2M A;  4I56 A;  1ZA2 B;  4MK9 A;  1UVJ A;  4J9L A;  1SL1 A;  2QMX A;  3SFG A;  3AXK A;  5DZ6 A;  4J9N A;  3T5H A;  2KT5 A;  5DDO C;  1R8A A;  2VG6 B;  2Y1R I;  1U2R A;  1M5K C;  3DNC A;  2HND B;  3OFE A;  1NAQ A;  1SJ1 A;  2XGP A;  5HMZ A;  4LF4 F;  3M9M B;  3QYY A;  2RJZ A;  4LSN B;  1TFY A;  4RNN A;  1VQ9 S;  3BDP A;  2V94 A;  1GAO A;  4CYU A;  4LFC J;  4K4X A;  4N76 A;  5KFL A;  4NE9 C;  1NBE B;  1ZAV A;  4EBE A;  1E6V B;  2DR5 A;  1KVI A;  3HDS A;  5GMK a;  1OSC A;  2RS8 A;  2H3E B;  1WOP A;  4DSL A;  2ZNZ A;  2AJ2 A;  2AIR B;  3VAK A;  5LSR A;  1N33 J;  5EHH A;  4ZS6 A;  2OML A;  5GAE U;  2ROP A;  3H2L A;  3CCE S;  1K0T A;  1FD8 A;  4NYP A;  2HK2 A;  2IA6 A;  4DI6 A;  2HQD A;  1EKR A;  5C5J A;  1ZPW X;  2C2N A;  3L7U A;  5HVF A;  5D78 A;  5EDW A;  4OI4 A;  1RK8 A;  4J9P A;  1YGY A;  2CJQ A;  1B0T A;  2XSJ A;  2DO0 A;  4DUZ F;  3ENV A;  2K2P A;  4XK8 C;  5IOL A;  3PW2 A;  4NCG B;  2DHS A;  4JI6 J;  4KO0 B;  2BR0 A;  4K4U A;  3D6F B;  1A9N B;  3JTP A;  2B6A A;  4DJB A;  4Q2L A;  4MMO A;  2I5J A;  1RWU A;  3VHQ A;  4I69 A;  1RTI A;  3CB4 A;  1WF1 A;  2ZDO A;  3NS5 A;  1T02 A;  1MRO B;  5L9X A;  2KXF A;  4X2B A;  1JNZ B;  3SCJ E;  3J81 j;  3RB3 A;  1KC8 T;  3IGV A;  2MZQ A;  2C2R A;  4UF4 A;  3BDE A;  4IKA A;  5K8M A;  3M2U A;  2E7W A;  3G82 A;  4DR2 F;  1Q78 A;  4DMZ A;  3OHB A;  5H9E K;  3NWR A;  4ZVG A;  1CJV A;  2XTJ P;  2MZ1 A;  4J9U E;  2AWZ A;  3TZY A;  3N6M A;  3DOM B;  2ZNY A;  3FDS A;  3H5U A;  4ZPT R;  4NWB A;  2MQQ A;  4KC5 A;  3I55 S;  4P7T A;  3V4M A;  3U27 A;  1Q8I A;  3W65 A;  1IN0 A;  1HNZ J;  1SQE A;  3V4I A;  2KVQ E;  2XI3 A;  4ZVO B;  2I1R A;  1TL7 A;  2KYZ A;  3QLH A;  2R8I A;  4PWW A;  4U67 Q;  4CO4 A;  3C15 B;  2QFI A;  1N56 A;  1YBA A;  1XNQ F;  2EBE A;  3P3D A;  4OLP A;  1EB0 A;  4U9R A;  2FY1 A;  2J7W A;  2VOO A;  2OTJ S;  2G0J A;  2Z57 B;  1HQE B;  2OSR A;  3MMA B;  1JJC B;  1RWW B;  3PCO B;  4LR9 A;  2RRA A;  3DOK A;  2J7U A;  2JNJ A;  5F8G A;  4JP8 A;  1C1C A;  2W8K A;  3OLA A;  1R6Y A;  4DV7 F;  1NHV A;  4QPX A;  2LXI A;  4IR9 A;  2DXE A;  1TKZ B;  4PYA A;  4C98 A;  2F1F A;  2ZDP A;  1A6L A;  1TAU A;  1C0T A;  1MMD A;  3ZZR A;  4LF5 J;  2AYE A;  4CLZ A;  2FZC B;  2YKM B;  3J7Y U;  3GCW P;  1FE0 A;  1KTQ A;  2BX6 A;  4QOT A;  2W9B A;  3Q83 A;  4BBY A;  2XLJ A;  1DFD A;  1Y10 A;  2C1E B;  4OZN A;  2YWH A;  3KFW X;  4LJM A;  1PC5 A;  5LJ5 Y;  1WF2 A;  1SUQ B;  3D3C J;  2B9Y A;  2WON A;  5A8R B;  3JSM B;  4OV6 A;  1NKC A;  2YNH B;  2BYC A;  3MPY A;  4PRF A;  5J1N A;  2CNL B;  3WC2 A;  1ZM9 A;  3X3U A;  3OXL A;  4LRD A;  4WU3 A;  1NK4 A;  2EFG A;  1OO0 B;  3R5B A;  2BJ8 A;  4GKJ F;  5I3P A;  5KFU A;  3OVS A;  2OP5 A;  3R5D A;  1NLK L;  2B51 A;  4ZCI A;  1UAW A;  4I7F A;  3TZW A;  2GVD B;  1Q8L A;  1TV6 A;  1H38 A;  3HK2 A;  4N41 A;  2UV8 A;  4QZV B;  3KUE A;  1IKX A;  1VJQ A;  2KZM A;  2CQB A;  3GLJ A;  4PQU A;  2RRN A;  3R1H A;  3N79 A;  1RYS A;  2A2D A;  1HD0 A;  1VYA A;  2YWW A;  4WXW A;  3F44 A;  2FUG 9;  1NPP A;  1NPK A;  3TYT A;  4IO9 Q;  3ILI A;  1BWE A;  4DV3 J;  1Y5L B;  3M6X A;  2HWI A;  3EDR B;  5ETP A;  4NLD A;  3ZZT A;  1EP4 A;  1TEL A;  1HHT P;  1RHU B;  3CCM S;  1L3T A;  2FTR A;  1MML A;  1HNW F;  2WTF A;  4CLY A;  4ED3 A;  3L09 A;  2H5I B;  3BPD A;  1WOS A;  4EBD A;  4DL0 C;  4ER8 A;  3LWM A;  5DG7 A;  2EW9 A;  4CO5 A;  1WSV A;  4DL7 A;  2RHS B;  4NZ6 A;  2EFQ A;  1OQ3 A;  4IUF A;  1TL3 B;  4ZVH A;  5AE1 A;  1HBO B;  4RZR A;  2W4P A;  2EK1 A;  3EVM A;  4JBC A;  1Q5Y A;  3TA2 A;  3SZ2 A;  4CH1 A;  1NO8 A;  3D68 A;  3EUN A;  3AY0 A;  1T94 A;  1LWC B;  2KO1 A;  3Q8P B;  3HVR A;  3MM5 A;  5CAA A;  3NY0 A;  1G3O A;  1W25 A;  2V4J B;  3K17 A;  2DTJ A;  4M63 A;  3D67 A;  1YJT A;  3RRG A;  2HWH A;  3NAI A;  1QSY A;  1G1X A;  2KT2 A;  2AW0 A;  1B64 A;  1V6H A;  5CZX A;  3HVT B;  3UWT A;  4A8K A;  1YJV A;  4DV4 J;  1S6O A;  1RP5 A;  4DR5 F;  2HSE B;  3C6U B;  1RT7 B;  3IWL A;  3BN7 A;  3T19 A;  4X65 F;  4FP9 A;  2ZZN A;  1RAO A;  1S76 D;  1R7I A;  3DI6 B;  2P5V A;  1J5E J;  3CIM A;  1JLE B;  2BBE A;  5HAO A;  4WF9 Q;  1YVF A;  1FWK A;  2ZJP Q;  3C14 B;  2VDI A;  4FBT A;  5CYQ B;  4CO3 A;  4A8Q A;  4JI5 F;  1FDB A;  5HN0 A;  1KR4 A;  1Q7L B;  3DM2 B;  2PMH A;  4ZHR B;  2B5J B;  2DHH A;  1MG7 A;  2XZD B;  5KFV A;  2PII A;  2JVO A;  1X8D A;  1H2U X;  2FIU A;  3QSI A;  3A4T A;  4TVA B;  4FXW A;  5K20 B;  4CYU B;  2ZHB A;  1R8P A;  2DR8 A;  1AYE A;  2ZBR A;  1UFW A;  4NLP A;  2AZ3 A;  2WBR A;  4IYQ A;  2VAS A;  1HWU A;  4IG3 A;  2HNZ B;  1WF0 A;  1JQG A;  3P5B P;  4BC9 A;  4NXN F;  3QRQ A;  1NK9 A;  5HI7 A;  3GB0 A;  1B3T A;  1QTN B;  2J0Q D;  3KWM A;  1XEZ A;  1VQP S;  3W63 A;  3QIP A;  2D69 A;  3FEY B;  1B7F A;  3VCD A;  2X51 A;  1S59 A;  1UVL A;  4FYV B;  5E0O A;  2QV6 A;  3LOU A;  1CQM A;  4TKT A;  3E51 A;  4WFN Q;  3F73 A;  1CS4 B;  1X9S A;  1JLA A;  1LEO A;  1NXI A;  2UUB F;  4OYP A;  2HZC A;  1NB7 A;  3R6G B;  1BGX T;  4IR1 A;  3H90 A;  4M5N A;  1LXJ A;  2VG7 A;  5L1L A;  2V9W A;  4V19 J;  4WYL A;  1BQX A;  2XSJ B;  3I0R A;  1QD1 A;  1FKO B;  1YJ9 S;  4ED6 A;  3L4B C;  3W5X A;  3FVY A;  2DGW A;  2UVU A;  1JNR B;  4X62 F;  3C8Y A;  2I5J B;  3IAS 9;  2UXC F;  3M30 B;  3MAQ A;  3HD2 A;  1QUV A;  2R7U A;  2C42 A;  5HRO A;  1WJ9 A;  4K0K F;  1WNE A;  1RDR A;  4M5M A;  3DN9 A;  3PDN A;  5RUB A;  3W5Y A;  4CDI A;  3D5M A;  1R8C A;  5G4D A;  4C97 A;  2J9D A;  1GMW A;  2XHW A;  3N5F A;  4HDH A;  1WHX A;  2NR0 A;  4TY9 A;  2CNN B;  4PXE A;  4KV8 B;  3CJK A;  3AB4 B;  4OZ3 A;  1EHW A;  2W2P P;  2BJ1 A;  4RUC A;  4ZLP A;  3RR7 A;  1O0P A;  1ZTW A;  4OIX A;  3C46 A;  1S0M A;  2V2V A;  2RB7 A;  3GV8 B;  2ZKU A;  4U95 A;  2HUR A;  5C42 B;  2ZIT A;  2AEJ A;  4USK A;  4CLW A;  5KFA A;  1F5C A;  4DBQ A;  4LFC F;  1YX2 A;  1SB6 A;  3CF5 Q;  4KQZ A;  3NMA A;  4TQS A;  3CUL A;  3DU6 A;  3MFI A;  4YS2 A;  2C2M B;  3MM6 B;  1RAA B;  2GMH A;  2BW2 A;  1KBR A;  4NCB A;  3M8R A;  1TUG B;  4HDG A;  4CRJ A;  5KFH A;  4ZCM A;  2J0W A;  3PEJ A;  1JLG A;  5U47 A;  3AOC A;  1NDC A;  1XIQ A;  2B43 A;  2Y0B B;  1N32 J;  2UUW A;  5F0W A;  4EK2 A;  3WZ0 A;  3L95 X;  5I3U A;  4CI0 B;  2IM0 A;  3I96 A;  2FB0 A;  4L6V 3;  2APO A;  3GU0 A;  3W62 A;  1KHW A;  3I5C A;  2QT7 A;  4OYI A;  4DOZ A;  2GJF A;  3B6B A;  4WFY A;  3ET6 B;  4LQ3 A;  4C4W A;  2AQ4 A;  3W2V A;  1HI8 A;  3VAL A;  4RBU A;  3T5L A;  2XQC A;  4FPR A;  3FFI B;  3FZ2 A;  3B4M A;  2V6A A;  3VQS A;  2V2K A;  4DQP A;  4XPC A;  3AB2 B;  3IGN A;  4CCH A;  5EX0 A;  3KLH B;  1PIL A;  5D3G A;  4URS A;  2DNQ A;  2ADB A;  4AND A;  5L8R C;  2I38 A;  1S1W A;  4NPO A;  2DJW A;  3M8W A;  5ETL A;  2GVZ B;  7AT1 B;  4M5J A;  5HP1 B;  3G8T A;  2A2C A;  2DD8 S;  2YKQ A;  3PM9 A;  5KFB A;  1S48 A;  2HQG A;  1WI6 A;  1NJZ A;  1OYE A;  3GIL A;  4C0O C;  3EPG A;  1Y9O A;  4PPD A;  4D3G A;  4Z7C A;  1NSQ A;  1WEY A;  2HAF A;  4QWB A;  2R7X A;  1Q5V A;  3OR2 A;  2HHW A;  2ZH9 A;  4MT1 A;  4K2X A;  1UWB B;  1NKE A;  5HBM B;  3QAT A;  3BM7 A;  3JSB A;  1HYS B;  3O44 A;  2CUY A;  1NJX A;  1FDN A;  2WB4 A;  1LWE A;  3GIR A;  3EX7 B;  1HR0 J;  2YX1 A;  1HNZ F;  3M1V B;  2KM8 C;  3MCO A;  4PXD A;  1U1P A;  1RT6 A;  3J80 Y;  1XQI A;  2CZ4 A;  5A0Y A;  5EGY A;  1TVR B;  2LKZ A;  1DLO A;  3ZC4 A;  2NCK L;  3MAA B;  4C8Z A;  2FHM A;  4OZ0 A;  3QJP A;  1SC4 B;  2XGQ A;  1NU4 A;  4WK1 A;  4WWS A;  3DDI A;  2BAN B;  3MDF A;  1APS A;  2V8H A;  4I1T A;  5K5M A;  4ICL A;  4IFV A;  1NDL A;  5DDR C;  4KAI A;  3CNQ P;  3A8J A;  3MPV A;  2F8E X;  4Y2A A;  3G9C A;  2B8Q A;  2OFG X;  1FRJ A;  3BGU A;  3S8S A;  4ZP6 A;  3DRX A;  4DX7 A;  2VC1 A;  6FD1 A;  5GVQ A;  4DU7 A;  1DTT A;  4LF5 F;  3NGK A;  4ES2 A;  4DCP B;  5JXS A;  2DHX A;  3PHT A;  4WFX A;  1X4F A;  4TY8 B;  5LSL A;  4EU0 A;  4DL5 A;  1RAD B;  1FO1 A;  1KON A;  2C2E A;  2N7Y A;  5HVH A;  4WJB A;  3AAW B;  4ZVT B;  1JJH A;  1EAY C;  4C11 A;  2W2M P;  4LF1 A;  3OTE A;  2E1M C;  2B8P A;  2DNG A;  1GMW D;  3EMT A;  3CJT A;  4RW7 B;  4ZN3 A;  5MAO A;  1QAI A;  2F9J A;  4DR4 F;  3DFE A;  1JKH A;  2IM2 A;  2DNK A;  2G13 A;  1U02 A;  1GXU A;  2KXH A;  1RQ0 A;  2ILY A;  2KJV A;  2R9L A;  2FY8 A;  4ECW A;  3HSJ A;  5J1P A;  2YWK A;  1KP6 A;  1FRI A;  2L08 A;  5KAK A;  1D3W A;  4QIW D;  5KFI A;  2B3T B;  2MQM A;  1KRP A;  2XO7 A;  3MMC B;  3MEE B;  3MMB A;  4ZVF A;  4Q45 A;  1P27 B;  3T9N A;  2QA1 A;  5KFP A;  2DGQ A;  1ZH5 A;  5AXN A;  1U0H A;  5KG2 A;  1N8R T;  3IM8 A;  4LMZ A;  5KFS A;  1TKT B;  4NYO A;  2GIR A;  4ZJQ A;  4J9Q A;  1B4S A;  1M1G A;  1S72 S;  3IN5 A;  2WK4 A;  3D6H B;  2P6S A;  1W2B R;  3CJ5 A;  2MMY A;  1JXL A;  4J91 A;  2OPR A;  1VGY A;  1ULR A;  1LK7 A;  5K14 A;  2CPJ A;  1TFW A;  3ZTP A;  3GYX B;  4DV3 F;  1VQ5 S;  2JRS A;  3EWG A;  4YN3 B;  3LP2 B;  4J9O A;  4IG3 B;  2NXN A;  2M8D B;  3J7A N;  2HW3 A;  2MKY A;  3CT9 A;  2DGU A;  3RB6 A;  1Q79 A;  2W01 A;  3LF0 A;  4BWJ A;  1AB8 A;  4G1I A;  3GFX A;  3T1H J;  1TL4 A;  3TWZ A;  1R8H A;  2R3V A;  2BQR A;  1VQO S;  2AJF E;  2VOP A;  1R8B A;  4D3H A;  3W61 A;  1DHM A;  4I4B A;  4RUB A;  3OTD A;  3DRS A;  1N88 A;  1WSR A;  4RL1 A;  5J2P B;  2LEC A;  1R27 B;  3G6X A;  2QMW A;  3OTO J;  2RS2 A;  4DX6 A;  2IHR 1;  4LSZ B;  4DPO A;  3TNV A;  1DTQ B;  1JLC B;  4P6Q A;  4IRC A;  3CIZ A;  4H4O B;  2QYC A;  1D0E A;  4UT4 A;  2YPZ A;  1R3N A;  1OY6 A;  4MIA A;  1T11 A;  2U1A A;  3IRW P;  2IBK A;  1LW0 B;  2W9C A;  2PFD A;  4IRD A;  1SBR A;  1T95 A;  3D66 A;  2BQ3 A;  3HKZ D;  1RCX B;  4E98 A;  4C2M A;  2OPP B;  3G8Q A;  4Q5V A;  4RW4 B;  4ILL A;  1VI7 A;  4ZPC A;  1D8Y A;  4Y0F A;  3R7B B;  4AL5 A;  2G1H A;  5F8J A;  3THT A;  2YNI A;  5J1E A;  1HNI A;  5L1K A;  4ZJO A;  1T9U A;  4NLT A;  1TK0 A;  4JB8 B;  1U47 A;  3PKY A;  3D1O A;  4FS1 A;  1VLO A;  2QIF A;  1L5U A;  3LP0 B;  1J5E F;  1P6T A;  3DDK A;  5IQQ A;  3KMQ A;  5B0C A;  3M2V A;  1TZ0 A;  2V5H G;  2V8G A;  5IT0 A;  3KK3 A;  2XYP B;  3I82 A;  3IBW A;  2LQ9 A;  4ILM A;  3A13 A;  1FK9 B;  2JEI A;  2FHO B;  4PXC A;  4UY8 T;  3AHP A;  1XK8 A;  1NK6 A;  3OXG A;  5HK4 A;  2MDA A;  1AUD A;  3MM8 B;  2WSF C;  3UNY A;  2HWT A;  2CQ0 A;  3SV4 A;  3W66 A;  1YJN S;  3KJN B;  2HGL A;  1EET A;  3UCG A;  5AJ3 J;  3HF5 A;  3HHE A;  3I0S A;  3H5X A;  2BE7 D;  2EFN A;  5T7L A;  5A8W B;  2N82 B;  1WHY A;  1VQ7 S;  4CLT A;  4M5D B;  2KFY A;  4FVM A;  5F0U A;  5HQ8 A;  4GKK J;  4FF1 A;  2CG4 A;  4URQ U;  3SSR A;  5A76 A;  1GXL A;  1M5V C;  3PIO Q;  2HHH F;  3SQG B;  2HHU A;  3NLC A;  3BS9 A;  2F4V J;  1T9W A;  2M3D A;  1RXO B;  4UW2 A;  5KFR A;  4CQ1 A;  3JTO A;  2G0I A;  1I51 B;  3NBP A;  4DZD A;  1MSW D;  3MPW A;  1S97 A;  1FRL A;  2DEI A;  3DLL Q;  2KXN B;  2EEY A;  3H5Y A;  4XPE A;  4KJI A;  3CCW A;  4EEY A;  2J9D E;  1I94 J;  2B4U A;  4M5H A;  1NKB A;  4ID5 A;  4X84 A;  1WKK A;  3IFE A;  1F0X A;  3E2E A;  1FTR A;  4OZL A;  4KGK A;  2CWK A;  1N6Q A;  4J9K A;  3EIC A;  3NRB A;  5CA5 A;  3CVK A;  4QIF A;  1CJT B;  2BAC A;  1WEZ A;  2NXC A;  1FFG B;  3GG1 A;  2J7K A;  3PRV A;  4DFK A;  3BO4 A;  3Q24 A;  1L3V A;  5C25 B;  1X0F A;  2R4F A;  2OD4 A;  3BBC A;  1WEL A;  3SCI E;  4DQQ A;  5L39 A;  3TAM A;  1KDN A;  3AA9 A;  3UQS A;  4X4R A;  3SIP B;  3P5T L;  2D9P A;  4YME A;  1U1Q A;  1Y3J A;  4C9D A;  2G2Y A;  2MQO A;  3WX4 A;  4I6A A;  5ETT A;  2LXF A;  2XWX A;  1O5J A;  6AT1 B;  2IMW P;  3FBB A;  1N5Y A;  4ZPD A;  3FCW A;  2GJI A;  5AE3 A;  2XEX A;  2KB2 A;  3OR1 A;  4F0K A;  3G96 A;  4ZPW R;  2E5L F;  5AXM A;  1UJ4 A;  2VV5 A;  4CLP A;  3BGO P;  4O4G B;  3DDN A;  3RJM B;  1ARO P;  1CUL A;  4RLE A;  2WOM A;  1NND A;  1MLA A;  1DLO B;  4PG6 A;  1IVZ A;  1VIS A;  2BE2 A;  4YDX A;  5LMN F;  3EYZ A;  4HYK A;  3IG1 A;  3I87 A;  3KG0 A;  4IG0 B;  5ADZ A;  5CCM A;  2EFV A;  2LA4 A;  1F5B A;  5LOQ A;  1E6Y B;  4B17 A;  3SDE B;  5F8H A;  2HBQ B;  2DR9 A;  2KG1 A;  3CCL S;  5C2G A;  3PG9 A;  1NJW A;  1WC1 A;  1BLU A;  2FLP A;  3DGP A;  4NLO A;  2LEA A;  4NLV A;  4DUY F;  5F8I A;  3DLG A;  3W2W A;  1O6X A;  2IJF A;  2FVP A;  1S57 A;  4LRE A;  3CDW A;  2C3Y A;  1PJ5 A;  3BPS P;  3V6K A;  3EVW A;  1JLQ B;  1QE1 B;  3DLJ A;  3BF4 A;  2GGP A;  5L46 A;  5A8K A;  2QL5 B;  5K9F A;  3HVW A;  2G9O A;  3ITH A;  3HFZ B;  5K8N A;  3NS7 B;  1VBX A;  1WWH A;  3DRR B;  2AMC B;  4RR5 A;  3O5T B;  3BGL A;  3CUN A;  4G1P A;  2VQF J;  2RUG A;  2FVC A;  2VPX B;  2HHV A;  2ZJR Q;  2E1R A;  3H2V E;  1S10 A;  1G4C A;  1JLB A;  4O23 A;  1TK5 A;  2HHX A;  1MWZ A;  4MK8 A;  2ACM A;  3P49 B;  2RD5 C;  2MLX A;  5KFM A;  3CD6 S;  2ZHO A;  5SZT A;  5F9N A;  2NSB A;  1C4C A;  3P96 A;  4K4T A;  4DV0 J;  2FZG B;  1Z4U A;  1HFE L;  4HR2 A;  4IOB A;  4LFA J;  3P6Y C;  4LRB A;  1WKJ A;  3TW0 A;  3AD7 C;  2ZD1 B;  2MLY A;  1SQF A;  3AT1 B;  3WBZ A;  4UOG A;  2CDR B;  2Z2Y B;  2KZZ A;  2ZBC A;  3CO9 A;  4PR6 A;  4GVL A;  3BR9 A;  2IJN A;  4TN2 A;  2M9K A;  1U6F A;  1HR0 F;  1RT5 B;  1DQ9 A;  4RW6 A;  3AD8 C;  1F3F A;  4KFB A;  3PIP Q;  4HAC B;  1KLN A;  3EGV A;  2EKN A;  2DK2 A;  1WEX A;  2UUC J;  2H48 B;  3A3P B;  2RF2 A;  1QJH A;  1HHS A;  2HVI A;  3H5S A;  4RW8 A;  4HHU A;  2WB1 D;  3D0G E;  1REV B;  3GP9 A;  4MIB A;  1NRK A;  1PIE A;  1H73 A;  1DBD A;  5E7O B;  2DR7 A;  1UW4 A;  3GMG A;  2WRM A;  4C8L A;  3W1Y C;  3QQC D;  4DWI A;  4M95 A;  4ECX A;  1RAJ A;  2EBG A;  3E01 B;  5J2N A;  2CPY A;  4CLF A;  3MCS A;  1R43 A;  2E5G A;  4E2F B;  3ZXW A;  4DCJ B;  2L41 A;  2HRU A;  2MYF A;  3OQ2 A;  1UVM A;  3O6Q A;  2O1P A;  3MR6 A;  3A8I A;  1BHN A;  4GVB B;  2LDY A;  5IM0 A;  2YQ0 A;  4RJV A;  1NDP A;  1QSS A;  3VGV A;  2G2Z A;  1LW2 B;  2VUG A;  4KT0 C;  4OJ1 A;  3IM9 A;  2PI5 A;  3HT3 A;  1CJU A;  5DLG A;  3V6D A;  3KHR A;  4W92 B;  2JC0 A;  3Q8Q B;  3MM9 B;  1SV5 B;  2CQ3 A;  5KFG A;  4C3K A;  1KN6 A;  4DUT A;  4TU8 A;  4C8K A;  1CJK A;  1Q8B A;  3N9U C;  1FKP A;  5HAN A;  1RT1 A;  2M8H A;  4JOU A;  2W24 A;  2WVF A;  3DHW C;  4KR0 B;  4PYD A;  2C28 A;  4LF8 F;  1X4D A;  3GYG A;  3QNW B;  2BXJ A;  2RRB A;  2CJK A;  3BKT A;  3JTN A;  3VAM A;  2EG1 A;  2PDA A;  1FWP A;  2LYV A;  1IKY B;  2EFO A;  4MJK A;  4FF2 A;  4DR3 J;  3D0I E;  1EKS A;  2A1B A;  2YNG B;  5BR8 F;  4I6W A;  5M2U A;  3OTB A;  2VC0 A;  2HNY B;  3LTO A;  4TLQ A;  4F3M A;  2E1A A;  3RZA A;  1BQN B;  2RUS A;  3DOL B;  4G65 A;  5E3P A;  1RTD A;  1YHQ S;  2RQK A;  2IVF B;  1VRU B;  3SYZ A;  2X1G A;  1G2E A;  5BYR A;  3NGS A;  2H9Z A;  4IQX A;  1MU2 B;  2YKN A;  4X4O A;  1CC8 A;  4QIE A;  4DLG A;  3V81 A;  4KE5 A;  2IVM A;  1EX8 A;  1IBK J;  1QVG R;  3ZO7 A;  2QLF B;  1H7W A;  3JS9 A;  2XMM A;  4YFU A;  1VLY A;  5KFD A;  1B0P A;  1S0V A;  4F2S A;  3MED A;  2RIL A;  3FGV A;  3BH7 B;  2BJ3 A;  4PAA A;  1XWL A;  1RTJ B;  3S6E A;  1T3N A;  3DYA A;  3W9I A;  1SPB P;  3UVJ B;  3OUY A;  1Z1Z A;  1RAB B;  2KYX A;  2G2O A;  5DM7 Q;  3HI9 A;  4NEZ A;  2R2U A;  2UVV A;  4Y2K A;  3VWS A;  1YZ6 A;  2OAU A;  1FRM A;  3GZ7 A;  1M1K T;  2DHG A;  4MK7 A;  1F5A A;  2X1B A;  5DDQ C;  1RYR A;  2BRL A;  4DV6 J;  3HKW A;  5FDL A;  3OTO F;  2A6M A;  3RG6 A;  1IQT A;  2QFJ A;  3IBF B;  1JLF A;  1RWV B;  4IDK A;  5HQM A;  2ATL A;  2G0C A;  2Y0S D;  4J9S A;  3FNN A;  2OEM A;  4A46 A;  1WC4 A;  1C1B B;  2W7O A;  3T1Y J;  2OPS A;  4C8O A;  4JI2 J;  1T05 B;  2L48 A;  2MKI A;  2R8J A;  2GFF A;  1QAX A;  1OJ4 A;  3WC0 A;  3PKM A;  2VG6 A;  3UE2 A;  4DHV A;  2HND A;  3UD4 P;  3M2R B;  4UQT A;  4OI3 A;  5B0F A;  2HLU A;  3HLU A;  3NCQ A;  3PY8 A;  2CZV C;  4LSN A;  4ED4 A;  1FA0 A;  1PYT A;  2GHP A;  2ZUG A;  3MR3 A;  2Z2M A;  1Y5I B;  1X31 C;  2QJ3 A;  4C8M A;  4U7C A;  1E6V A;  4KGZ B;  2UP1 A;  2ASY A;  4A8X A;  3B54 A;  4I67 A;  2BM1 A;  5A6P A;  5FII A;  5F8N A;  2OKQ A;  3BBF A;  1KQG B;  4Y2M A;  4B9L A;  4ITS A;  2KFZ A;  3BO3 A;  1VBY A;  5D4P A;  4FF3 A;  1PBA A;  1NH7 A;  4UZB A;  1GMU A;  2UXD F;  3AFG A;  3LW5 C;  4DSF A;  3D28 A;  3H2U B;  3HHK A;  3FCH A;  4DN0 A;  1Z2L A;  1RI7 A;  3LA0 A;  4YEA A;  3QSY B;  3DLH A;  4P2S A;  2M7S A;  3R97 A;  3M8Q B;  2I6W A;  2CJB A;  2JLF A;  3W5Z A;  3NGR A;  4ZLN A;  4F0M A;  4PAB A;  4OI0 A;  4LR7 A;  3OFH A;  2BOP A;  1VK3 A;  1PJ6 A;  3KLE B;  1VRT B;  4IO1 A;  4NCG A;  2P9G A;  4KO0 A;  1X4B A;  2RU9 A;  3CCJ S;  4HLB A;  2Z30 B;  3TOQ A;  1LKZ A;  3ILO A;  5D4O A;  2MKK A;  3LUY A;  1UZD A;  4A47 A;  4HHH A;  4P71 A;  1MRO A;  3ISN C;  2R8H A;  3E8O A;  2CNO B;  1N34 F;  3PXG a;  2J9C A;  4P9S A;  3K5P A;  4JI4 J;  3M05 A;  1AT1 B;  3B8H A;  1IBC B;  1S1V B;  2QA4 G;  1IKW B;  2EG2 A;  1NK8 A;  3DOM A;  1YZ7 A;  3KXD A;  3CCZ A;  3PJ9 A;  3IA0 A;  1TAQ A;  4JV0 A;  2DRA A;  3OTC A;  3R5J B;  1KKH A;  1OWX A;  3MEC B;  4GRS A;  2AGO A;  2LU2 A;  2HQF A;  2UU9 F;  2LXU A;  2P9C A;  3V6J A;  2DPJ A;  3HCX A;  4J90 A;  1XMQ J;  2WVB A;  5CYJ A;  3KK1 B;  5T14 A;  2IYI A;  1IR1 A;  2MKC A;  4B3O B;  3W9J A;  3C15 A;  4RKU C;  2B7B B;  2AGQ A;  4N8N A;  4DEZ A;  1DRZ A;  1RTH B;  3MXH P;  2F3J A;  5DZ7 A;  2VBZ A;  2DCL A;  9ATC B;  3BYP A;  2JHE A;  2NXE A;  2Q43 A;  2YY3 A;  4TXS A;  3MMA A;  1FT8 A;  3ZNU A;  1KOO A;  1IQZ A;  2FGO A;  4CO1 A;  3TA1 A;  2QLJ B;  3O2I A;  4QYZ K;  1JXV A;  3D4J A;  4NOH A;  5EWF A;  1TKZ A;  1C2P A;  3CC2 S;  4DQR A;  5JVG Q;  3T1A A;  3H0P A;  4M5I A;  1VQK S;  4IH6 A;  4RW6 B;  4JV1 A;  3PX4 A;  2HBY B;  2QA4 S;  3M9O B;  1IR2 A;  2CKW A;  2POK A;  4W4M A;  3ISN D;  2YKM A;  3MWB A;  1YIT S;  3Q0A A;  2QRR A;  2EVZ A;  4DSJ A;  4EZ6 A;  3EPI A;  3H59 A;  4QYR A;  1A7G E;  2RDD A;  1F2H A;  4PXB A;  4A8M P;  1IBM J;  1VFJ A;  1PAU B;  4CZC A;  1TP7 A;  2PT0 A;  3ETM A;  4QBU A;  2OEL A;  3Q2T C;  3ELH A;  5GAD U;  4ECY A;  2NSC A;  4C6A A;  1PJ7 A;  4FYW B;  4XAK A;  1SUQ A;  3FJ2 A;  3JSM A;  1FTC A;  2YNH A;  1HWL A;  5L38 A;  3NNA A;  2PE8 A;  3I4P A;  2Y8Y A;  2HHQ A;  3NKY A;  5EWG A;  1R89 A;  2W1B A;  1BY9 A;  2M88 A;  1SCJ B;  2PEH A;  3DC2 A;  3LAN A;  1DUR A;  1YDL A;  1XR5 A;  4ZVS B;  3PVX A;  5JJB A;  3V6D B;  2VA3 A;  5EWE A;  4ECR A;  3OL9 A;  4CTA B;  4CO2 A;  1RKI A;  2FHK A;  2GVD A;  4ANE A;  2AV5 A;  2W2Q P;  1NUE A;  2CYY A;  3Q8U A;  5CAB A;  3D0H E;  4BWM A;  2FLN A;  2KTQ A;  2ZC4 A;  3PYD A;  5KOW A;  4IRK A;  3KLI B;  3GYN A;  1PYO B;  2VQF F;  2W25 A;  4TNO A;  2OTL S;  2UV8 G;  3T41 A;  1CEZ A;  5KT4 A;  1VC0 A;  4UY8 5;  4MYU A;  2SXL A;  5IWA J;  3LAK A;  2LEP A;  2Z4P A;  1GQE A;  1YJU A;  5BJR A;  1HQU B;  3SXL A;  2G1D A;  3RAQ A;  2DNR A;  4TYB A;  2DCU B;  4NI2 A;  3RBZ A;  4DPX A;  2L3M A;  3LP1 B;  4OYM A;  3TJA A;  4DV0 F;  1Q81 T;  1S1X B;  5LXR A;  4MKV A;  2M70 A;  1ZM2 A;  2NXU A;  4OX7 A;  4CLK A;  4LFA F;  3KG1 A;  2XWY A;  1SKS A;  2ILZ A;  2JSX A;  2DGX A;  2N7C A;  1TL3 A;  1HBO A;  3LQV A;  4YR0 A;  4NLW A;  1VMB A;  3NNC A;  1SI9 A;  4UOF A;  4X4U A;  3CDU A;  2DGS A;  4F4A A;  4C0B A;  2VJV A;  3VR1 A;  2CZ9 A;  3IAM 9;  4NLU A;  2UUC F;  4A4J A;  1LWC A;  1YQH A;  3AJ2 A;  5K8O A;  5LMU J;  1VK8 A;  2V4J A;  1UET A;  1F6T A;  4K59 A;  5A6W A;  4YUD A;  1HBN B;  3MOZ A;  2D3Z A;  2HVH A;  1RJJ A;  1SQG A;  4FXD A;  1ZAX A;  3N6N A;  2J8S A;  4RNH A;  1K44 A;  2HQ3 A;  3HVT A;  3I31 A;  4F50 A;  1NZA A;  4F26 A;  3IC1 A;  3OJS A;  1V5V A;  2BZ2 A;  1KNZ A;  3C6U A;  5AXL A;  1RT7 A;  1SJ3 P;  4IFY B;  2OHD A;  5GAG U;  2R7S A;  3OL6 A;  5IT4 A;  3MF5 A;  2XMU A;  5H9F J;  4R25 A;  3IMQ J;  3DI6 A;  5DO2 A;  2HBR B;  2DRD A;  2IY5 B;  4PWD B;  1U1L A;  1JWW A;  2R7O A;  1FRK A;  2KL8 A;  3N6L A;  4B3T J;  4JV2 A;  1JLE A;  4Q8E A;  2ZVS A;  2GNK A;  1I6J A;  2MY8 A;  4F2R A;  2VU5 A;  3SMZ A;  4DV1 J;  1UWA A;  5BYQ A;  3C14 A;  3BV8 A;  1PKU A;  5CYQ A;  3C6T B;  3EXY A;  1RA6 A;  4LSL B;  1W2I A;  3DM2 A;  4ZHR A;  2B5J A;  1KLM B;  4WFB Q;  4QJV A;  3JSY A;  2EC0 A;  1TTH B;  4EFA C;  5GMD A;  4WCE Q;  4H4K A;  2QTW A;  4TU9 A;  4JI8 J;  1HBU B;  4O0N A;  1KQS R;  3IP0 A;  2D3O 1;  2R7V A;  2GJ2 A;  1LWX A;  4DR3 F;  1YG0 A;  2K7J A;  1SH2 A;  4USJ C;  4Q0B B;  2AU0 A;  1S6Q B;  1RHR B;  2B56 A;  2HNZ A;  4U96 A;  3EZO A;  1WHV A;  2KI2 A;  2LQB A;  1U6B A;  3I9V 9;  3MR5 A;  4NRT A;  1OQ6 A;  4USU A;  2HIQ A;  3D54 A;  3ADA C;  3NEK A;  1ZM4 A;  3UR3 C;  2IVY A;  4DV2 J;  2HVE A;  1IJE B;  1QM9 A;  4ECV A;  1U26 A;  4USW A;  3TEG A;  2HRT A;  4F3O A;  3N4W A;  4LF9 J;  3G6E S;  3RB4 A;  1CS4 A;  3ZNJ 1;  5HLF B;  2IC3 B;  3W60 A;  4HH1 A;  4XO0 A;  4OI1 A;  2IRU A;  4ZOS A;  1GNK A;  2R2T A;  4X4V A;  1IBK F;  1QAY A;  1JK9 B;  4KH0 B;  4LRC A;  2YTC A;  4DFJ A;  4YP3 A;  3NG8 A;  2I2Y A;  3DRP B;  4WII A;  1IWA A;  1FKO A;  5KTQ A;  3JB9 k;  1VQN S;  1TL1 B;  1JJ2 R;  4WE1 B;  3GPA A;  3FSY A;  2P6T A;  4DR7 F;  4KHP J;  3UD5 A;  4WKY A;  3ENA A;  2AEF A;  1SKW A;  3H98 A;  4MFB B;  2R7Q A;  2Q79 A;  5B0B A;  3M30 A;  2J5A A;  3H4D A;  4H4M B;  3OLB A;  1V5I B;  5CD4 H;  2Y1J A;  2LCW A;  3D1H A;  4KPY A;  1VOM A;  1XER A;  4PEO A;  3UN2 A;  4HI1 A;  2ZH3 A;  2YH1 A;  2N3O A;  1N48 A;  1UEU A;  3KHG A;  3N28 A;  3QID A;  4KKO B;  3CCS S;  1FJE B;  4KV8 A;  1S9F A;  2VKZ G;  4V1A k;  2VG5 B;  1HLW A;  4KRW A;  4QR2 A;  1L3U A;  8RUC A;  5HMX A;  2IAJ B;  1YJ7 A;  4ZCL A;  3UI3 A;  2YWF A;  2UVW A;  2MSS A;  4Z7Y A;  5D0H A;  4WYW A;  4JI1 F;  2Q66 A;  2RSQ A;  3AD9 C;  4UOC A;  4Y65 A;  2HQC A;  2ZKT A;  5C42 A;  2DNZ A;  2KHD A;  4O3S A;  2A3J A;  5B08 A;  2NZ4 A;  1RT2 B;  1B7Y B;  4NXM J;  4H4K C;  3A3N B;  5B09 A;  1URR A;  2ASL A;  2HS0 A;  5KT7 A;  2FC8 A;  4YY3 J;  3DLK B;  1LV5 A;  3MM6 A;  2OI2 A;  3D7S B;  1R0B G;  3FCV A;  1EIY B;  1NSP A;  4V19 X;  4I0W A;  1RT4 B;  2V4Q A;  4UTG A;  2JL9 A;  1RCO B;  3SCL E;  4M1K A;  5M2P A;  4QW9 A;  2HZV A;  2UUA J;  3H7H B;  4LF4 J;  7FDR A;  3RBD A;  1WKL A;  2G4B A;  3SSQ A;  1BQM B;  3EGZ A;  3X1L B;  4WTY A;  3BN4 A;  3LAM A;  1TMJ A;  3ET6 A;  2W2N P;  3K5M A;  5G0R B;  1FEE A;  3BJY A;  4FKY A;  1IKV B;  3FFI A;  5A2Q U;  1LWF B;  2J6T A;  4OX9 F;  2NYI A;  4EYH B;  3KLH A;  1FNO A;  2X7I A;  2XY5 A;  1RB0 A;  4FDF A;  3T3F A;  4BDP A;  1I3O B;  2IFX A;  4A8O A;  4ZVQ B;  2FJW A;  1LXN A;  2GVZ A;  3JQJ A;  2F63 A;  5HP1 A;  2C2O B;  1Y4Z B;  3GIK A;  2HFU A;  1XR7 A;  1RHJ B;  1UPP A;  2CQG A;  2O3D A;  3CJ3 A;  4JI4 F;  3POT B;  4XDC A;  4DUZ J;  1PBU A;  3RW7 A;  2DY1 A;  4P2X A;  1XMB A;  5F8L A;  3OBI A;  1UWB A;  2GAH C;  5HBM A;  5KG3 A;  3TA0 A;  1RAG B;  4L76 A;  4RNO A;  1UVN A;  1S77 D;  5FD1 A;  3Q2S C;  4YB5 A;  1U1K A;  1F9H A;  2QLW A;  3G2X A;  4LBH A;  1PO6 A;  2Q6C A;  4NLR A;  1HYS A;  3QT6 A;  4QWC A;  4J5O A;  3B78 A;  4JV5 F;  1BE4 A;  1VS3 A;  3M1V A;  1URN A;  1SH3 A;  1XMQ F;  1C4A A;  1TVR A;  3GJT B;  4HT7 A;  4I64 A;  2FLO A;  2V67 A;  3MGJ A;  4A8W A;  5D77 A;  3SI8 A;  3MAA A;  3ILJ A;  1RSC A;  4UUW A;  4O3R A;  4NI2 B;  1FXD A;  4N47 A;  2GA7 A;  5KG5 A;  3HX9 A;  4DFP A;  2BAN A;  2ABY A;  2OH2 A;  2IM1 A;  1Q1K A;  3R9L A;  4WZQ A;  3W9H A;  3QT8 A;  5IC4 B;  4WXO A;  1NK0 A;  4B9T A;  4WBF A;  1N54 B;  3C16 B;  4S0M A;  4RW9 B;  2DEJ A;  1NK7 A;  2B4O A;  3NOC A;  3VAF A;  3CGI A;  4M94 A;  1LK5 A;  3GR1 A;  2XMJ A;  1D1U A;  3K7R A;  1D9D A;  4JI7 J;  3DU5 A;  5AE2 A;  3W64 A;  5JVH Q;  4TY8 A;  4ZK7 M;  2FC9 A;  3BH6 B;  3GFH A;  4DDF A;  4ZVP B;  4C8N A;  4MKA A;  1WTF A;  3HHL D;  4N56 A;  4RX6 A;  2DGT A;  2ZWO A;  4JI0 J;  3HD1 A;  2YXL A;  4RW7 A;  1UEV A;  5KG7 A;  3WX8 A;  2LQ8 A;  4ELV A;  2GO9 A;  5HAT A;  4NA3 A;  1HNX F;  2VOD A;  3W7B A;  2QN6 B;  3LGN A;  1DZ5 A;  3OXF A;  3AOA A;  1AA1 B;  2BA9 A;  3TR5 A;  3Q8V A;  1JJ4 A;  5KFK A;  3A8K A;  1TKX B;  2XY6 A;  4F4W A;  4K4Z A;  1X4E A;  3OT9 A;  1KHV A;  3HFK A;  3ZTQ A;  2LU1 A;  2H51 B;  4Q7A A;  5F41 A;  5H9E J;  3MMC A;  3TZZ A;  3PJW A;  3MEE A;  4IQM A;  2VFR A;  3ILL A;  3TAN A;  1WG4 A;  5LXY A;  1TKT A;  2ZH6 A;  2DT9 A;  2JLE A;  4LBP A;  3CDB A;  3F41 A;  3Q22 A;  3CMA S;  2VBW A;  2XC9 A;  5J2M B;  1N36 J;  3PNI A;  4CP5 A;  4LRF A;  4BLG A;  1UEK A;  2QLB B;  2XNQ A;  3LP2 A;  5IWA F;  1N0U A;  2JEF A;  3HP6 A;  4I2P B;  1GMV A;  5DQG A;  4YHH J;  2HHP A;  4DPU A;  3DRY A;  1VQ8 S;  1YRT A;  2QA2 A;  4MH8 A;  1N5V A;  3IRX B;  3ZZO A;  5SUH A;  2OMO A;  4A8F A;  2IIH A;  3LO3 A;  4C8Y A;  5CXT A;  2QL7 B;  2UUT A;  1VC5 A;  5J2P A;  1UA0 A;  1AZS A;  4WZM A;  4X66 F;  1T0T V;  4DS5 A;  2HGN A;  2DXD A;  1DTQ A;  2R7R A;  2ASJ A;  2A6O A;  3CWJ A;  1JLC A;  2DNP A;  3NXZ A;  1NDK A;  4QU7 A;  4H4O A;  3QWU A;  2PSZ A;  1S4E A;  3OVB A;  1T7P A;  5LMU F;  2RH3 A;  1LW0 A;  2VPZ B;  3GSI A;  4B02 A;  3GIJ A;  2RNE A;  1SC6 A;  2OPP A;  4UZC A;  2QL9 B;  4RW4 A;  2FD2 A;  5B0G A;  3TP2 A;  1UZH A;  4RBV A;  2I8E A;  1ZPV A;  2YH0 A;  2BJ9 A;  3CCR S;  3KNG A;  1S4F A;  2PGC A;  1OPI A;  4J9M A;  5CH7 B;  2YNF B;  2VJU A;  2KJW A;  3PO5 A;  2BEF A;  4LUB A;  4PG5 A;  3HHL B;  5IV4 A;  5E5N A;  4MAK A;  5CYM B;  2HMI B;  3LP0 A;  1LQ9 A;  1XJW B;  2NS1 B;  4USM A;  5IT9 U;  3IR7 B;  1HHQ A;  3OL7 A;  1FK9 A;  3QGI A;  3CCT A;  4DV1 F;  4ZMM A;  3TVZ A;  2FLL A;  3ZTO A;  3PFE A;  2D74 B;  2WHO A;  1ZTT A;  4K4W A;  1S9E B;  2MPU A;  3KYL A;  3MM8 A;  4OV1 A;  4ZCK A;  3M6W A;  2YPY A;  2XMT A;  4HH0 A;  4FVC A;  1XR6 A;  1NME B;  2BKP A;  3NL0 A;  3C2P A;  5GAH U;  4CNZ A;  4L3K A;  2RIJ A;  2F40 A;  4BS2 A;  3UW1 A;  5A8W A;  1DQA A;  3L3C A;  2HIY A;  3UN3 A;  3SBM A;  1D9F A;  3OV7 A;  3TJ8 A;  4M5D A;  3HZE A;  3QRR A;  1O51 A;  3W8G A;  1NSA A;  2LP4 A;  1BC6 A;  1VDH A;  1FHT A;  2OD6 A;  3KTQ A;  2IYG A;  5LJ3 Y;  1J5O B;  2PMZ D;  3TZX A;  1ZA1 B;  4JI5 J;  1F3V A;  2DR6 A;  3SQG A;  4E0D A;  1VCT A;  3FQK A;  1N33 F;  3CJR A;  4OZ5 A;  2RQC A;  1KQK A;  4WP3 A;  4AFF A;  3EE3 A;  1NK5 A;  3BGR B;  3U1L A;  4WPA A;  5I4M A;  1XTZ A;  4JUZ A;  2P8I A;  2OPQ A;  3NS6 A;  2M4M A;  4K4S A;  2DB1 A;  3L7O A;  1K73 T;  3CME S;  3QAE A;  4P52 A;  1RHK B;  2DXF A;  4O3O A;  3UO0 A;  1UA1 A;  3I32 A;  4ATN A;  4QQB A;  1FNX H;  2E5H A;  1AXQ A;  1TKD A;  1S99 A;  2LFV A;  4TYA A;  1U09 A;  1CJT A;  2AX1 A;  2YX7 A;  4NXN J;  4G6V B;  3DHX A;  3NCP A;  2YWG A;  4DR6 J;  5MLC V;  3MI7 X;  2CPX A;  4JI6 F;  3IO1 A;  5GAE I;  2V8P A;  2NZC A;  4OYZ A;  1U4B A;  4X64 J;  2N3L A;  1L3K A;  4R8U B;  1B70 B;  2MZR A;  2VKR A;  3FBC A;  3R5G A;  3OSP A;  1PCA A;  1M0S A;  3BB5 A;  4L75 A;  5KFZ A;  5C25 A;  1Z2Z A;  1CQN A;  2J0X A;  1EJ7 L;  4CM0 A;  4ED8 A;  4R5P B;  2UUB J;  1RA7 A;  5KFJ A;  4O3Q A;  1MMN A;  4F04 B;  3D2W A;  4Q44 A;  2MXY A;  1EQ0 A;  2KG0 A;  1DY3 A;  1YBU A;  3GJR B;  2JFK A;  3I5A A;  4X62 J;  4FNI A;  1P9Y A;  3R8Y A;  1X4H A;  4OZJ A;  5C7P A;  3BGF A;  3K57 A;  4ECQ A;  1RGV A;  3VAH A;  3WQP A;  1UVK A;  3CMQ A;  2ZBQ A;  4O4G A;  3DXB A;  2UVR A;  3BSN A;  1Y11 A;  2ZE2 B;  4ALZ A;  4CH7 A;  4N77 A;  5BYS A;  1YBT A;  4K0K J;  3VGU A;  1CLF A;  4NCA A;  4Y00 A;  1QUP A;  1RLC L;  3QO9 B;  4B9M A;  5CD4 A;  2X1F A;  2XCA A;  2AEM A;  2LLZ A;  3RB0 A;  3PV8 A;  4R0J A;  2AJ0 A;  4F25 A;  4IG0 A;  3HVA A;  1FKA F;  1HWI A;  3N0V A;  3M7V A;  4DU8 A;  1WC5 A;  4X4Q A;  2KRR A;  4GO5 X;  4EO8 A;  3HSD A;  1E6Y A;  3SDE A;  3U1N A;  2W4C A;  4O44 B;  4YY3 F;  3IXQ A;  1N0V C;  4LF6 J;  1QLN A;  1W7W A;  1A0O B;  3WIV A;  3IWN C;  3FC9 A;  4DL2 A;  3AJD A;  2Q6B A;  2K8G A;  4RO0 A;  4LF2 A;  3Q89 A;  4OX6 A;  4F67 A;  2R8K A;  2N4D A;  5E2Q A;  4NEY A;  1SKR A;  3NWG A;  4U7U D;  2ZBI A;  2UUA F;  1S9G B;  2NRE A;  1XBW A;  3MEG B;  3CD5 A;  3C3L A;  1U1M A;  2DGV A;  3P8B B;  2L9W A;  2HS4 A;  3SCK E;  4DR1 J;  1JLQ A;  2MY7 A;  1QE1 A;  2CIM A;  2GHV C;  3TI0 A;  4YB1 P;  3LGM A;  1YKW A;  4U8Y A;  1HWJ A;  1IUJ A;  5KT5 A;  2LMI A;  3MM7 B;  2XMA A;  4P75 A;  4F8R A;  2A0F B;  2CQ4 A;  1GFW B;  3DRR A;  2CQH A;  2VDH A;  1N5T A;  5D0G A;  1S0N A;  3ISZ A;  5DDP C;  2WVE A;  5DET A;  3J81 U;  3N01 A;  1FD2 A;  3J7Y I;  4F36 A;  1U8W A;  3P4U B;  1U1N A;  2BJD A;  2XBP A;  5DM6 Q;  3CJ0 A;  1S6P B;  5CZV A;  4M5G A;  2EFP A;  1KVK A;  4KGM A;  4KH1 B;  2QLX A;  2QSW A;  5KG6 A;  3IR5 B;  1RT3 B;  2V2Z A;  4PWU A;  3BO2 A;  2YX4 A;  2ZD1 A;  2CJA A;  3NAH A;  5I42 B;  5KG0 A;  2MJN A;  1K0V A;  2JFD A;  1YLX A;  4FYX B;  1RT5 A;  1CSJ A;  1IWG A;  4HAC A;  4HVZ A;  1X4C A;  3TVK A;  2VON A;  2GS8 A;  4IH7 A;  3BQ0 A;  2LEB A;  4CLU A;  2WW8 A;  4J37 A;  2WSE C;  3PJX A;  1GXT A;  3PZP A;  1REV A;  1F9E B;  3CE8 A;  5D6G A;  4O3P A;  3U1M A;  3JXO A;  2YKO A;  1RAC B;  4DL3 A;  3DMJ B;  3MUM P;  5D4N A;  2F7V A;  4QIG A;  3E01 A;  4NA1 A;  2KKH A;  5F3Z A;  3S1T A;  5K8P A;  3M6V A;  5KT6 A;  1SJQ A;  1AZS B;  3MOJ B;  4GVB A;  1Y00 A;  2E7V A;  3T5J A;  1U45 A;  2X3G A;  3H4B A;  2DH8 A;  4XDD A;  2ZC3 A;  2K3K A;  3IWX A;  1LW2 A;  2RU3 A;  1KFS A;  1ZOT A;  4JI7 F;  2CQP A;  4U7U K;  1S1U A;  5KFE A;  2FVS A;  3AOB A;  3GQC A;  2JEJ A;  4ANC A;  3PYF A;  3MM9 A;  4AXI A;  4K7Q A;  4PUO B;  1SV5 A;  3JYT B;  3PO4 A;  2UXB J;  2X1A A;  1WTB A;  5KFF A;  2W8L A;  2V68 A;  4AQY J;  1L3S A;  1BMQ B;  4OL8 A;  2ZZM A;  4JI0 F;  3GIM A;  1EZZ B;  2HFN A;  4PG8 A;  5EN1 A;  1ZZN A;  1HBM B;  1HA1 A;  2NPI A;  2FQQ B;  4DV4 F;  4FNH A;  4LQ9 A;  3QAU A;  1YJR A;  1IKY A;  3CTR A;  4ECS A;  1UJ5 A;  3KLG A;  1IXK A;  3ZZ0 A;  2YNG A;  3VGT A;  4USI A;  3M9N B;  1JB0 C;  5D0R A;  4NYZ A;  4KGV B;  5C24 B;  5LM7 E;  2HNY A;  4NZ0 A;  4GC7 A;  4ZKA A;  1JX4 A;  1BQN A;  4B9U A;  3C66 A;  3DOL A;  1FDD A;  4F3Q A;  2RKI B;  4L74 A;  4O3N A;  2CPH A;  2GQQ A;  2U2F A;  3QGH A;  2I0X A;  2L9D A;  5KFT A;  3QT5 A;  1FNM A;  4DR4 J;  4K50 A;  1VRU A;  1MW7 A;  2BDP A;  4USV A;  3RAM A;  4AL6 A;  1C0U B;  1MU2 A;  4X4S A;  1U48 A;  3PX6 A;  1N36 F;  2KH9 A;  2F8H A;  3A8E A;  3GFY A;  3KLF B;  2C22 A;  3JAM U;  1VQS A;  4CT8 A;  4MYT A;  3M32 B;  4HTJ A;  2XZT B;  2Y1I A;  1HPZ B;  2GZO A;  5KFW A;  3MUT P;  3PW5 A;  4OI2 A;  1RTJ A;  3UN5 A;  3NMR A;  3QWP A;  3UVJ A;  2VFT A;  2NLW A;  2A10 A;  3RAX A;  2KU7 A;  4YHH F;  1H74 A;  4AYB D;  5CHC B;  2HQI A;  3M8P B;  8ATC B;  2OPQ B;  3Q86 A;  1REG X;  4K5S A;  3FSI A;  4ZP9 A;  1RWO B;  4OQJ A;  3B4D A;  1MNE A;  1VQ6 S;  4NLG A;  3FUY A;  5CCL A;  1SL0 A;  4Q43 A;  2XUL A;  3TJ9 A;  2Y9H A;  3DLE B;  3PW4 A;  3QZ7 A;  4ELU A;  3H40 A;  3NGD A;  1R0A A;  1DJ0 A;  2ALY B;  1C1B A;  1U8S A;  2GIF A;  1FI4 A;  3HUL A;  2ROG A;  2HKE A;  3BR8 A;  2QGF B;  1SC3 B;  4OJG A;  5ETM A;  1T05 A;  1NB2 A;  4LRA A;  2OGU A;  4DX8 H;  3GON A;  3LPY A;  5A2Q Y;  2Q3P A;  3GFZ A;  5DG8 A;  3M2R A;  3B82 A;  1WDT A;  2ZH7 A;  2HHT A;  5E3R A;  3TUP A;  1HD1 A;  1HMV B;  3EM1 A;  1N4L A;  2HS3 A;  1SJ4 P;  1RBA A;  2K1R B;  2WVD A;  4UST A;  1IJF B;  4ZDN A;  5LSO A;  1S1T A;  3KDN A;  4DQI A;  3GSD A;  3HJV A;  1MN9 A;  4L73 A;  4EGL A;  2HYI B;  2XMK A;  1Y0H A;  2P9E A;  4ETZ A;  1B99 A;  4PG7 A;  2DNO A;  3PYE A;  4C3L A;  1SIZ A;  4DS4 A;  2HFZ A;  1P9Q C;  5D4L A;  3D3B J;  2M5Y A;  2R2S A;  1PGZ A;  1Y5N B;  1AUS L;  4EI2 A;  3VAI A;  3LGH A;  2MKS A;  3CD0 A;  3OJU A;  2CQD A;  4ZLJ A;  1ROF A;  5LT5 A;  2H4Y B;  3M8Q A;  1FFW B;  2XCP A;  4EWT A;  3OL8 A;  1Y3K A;  4LT6 A;  2AF6 A;  2D41 A;  2DVI A;  3VZH A;  5J2Q A;  3PRD A;  4DX5 A;  3KLE A;  4ED7 A;  2Z58 B;  1VRT A;  2EKY A;  3D9B A;  4ZIT A;  3CCU S;  4K8R A;  3TO8 A;  1B0V A;  1PSD A;  5ETQ A;  1H72 C;  1VBZ A;  1N52 B;  1N32 F;  5GAH I;  2CPE A;  4WP8 A;  2MEW A;  3W3S A;  3QMQ A;  3N5B A;  1GEH A;  1SXL A;  3K5L A;  3IR6 B;  3OHA A;  1TMM A;  2XS7 A;  1S1V A;  1IKW A;  5IXU A;  2PC6 A;  4F4K A;  3QJL A;  4NX9 A;  1FCA A;  3MTK A;  2BW7 A;  3TRG A;  2XNR A;  2QZ8 A;  2HHH J;  1NHK L;  2WVC A;  1TL5 A;  2XMV A;  7FD1 A;  4DR6 F;  1HW9 A;  3MEC A;  3MPU B;  2Z2Z A;  1Q0N A;  2HFO A;  2L9N A;  2MJU A;  1T03 A;  1UMJ A;  4X64 F;  3R1L A;  2OSQ A;  2CPZ A;  4A8Y A;  2C3U A;  1WG5 A;  1SH0 A;  4CH0 S;  3ZFV A;  3FQL A;  3R6L B;  3KK1 A;  3GE9 A;  2HGM A;  1FER A;  3UCU P;  4B3O A;  4AT1 B;  3MCM A;  4C0H A;  3OSN A;  4ZVE A;  2C3M A;  1RTH A;  2VH7 A;  2CQC A;  4ZPV R;  3TVY A;  4ECU A;  1NJY A;  2RQM A;  1R0C B;  4ECZ A;  1KOH A;  1G7C B;  1Q16 B;  4HI2 A;  1T9T A;  2GCF A;  2MQ8 A;  2CRL A;  3ZTR A;  1FFS B;  2ZM6 J;  3FEX B;  4YOE A;  2B6A B;  1WAC A;  3EJM A;  3G6V A;  4I6Y A;  2XS2 A;  1K1S A;  1RTI B;  4NZ7 A;  1I1G A;  1IM4 A;  1ZET A;  4WP9 A;  1VHF A;  4DV5 J;  1BWV A;  1D09 B;  1ZZF A;  1VIO A;  5HQL A;  4DG1 A;  3CSK A;  5IQ6 A;  3BBB A;  3M2U B;  3G82 B;  2QMU B;  5D8H B;  1X5O A;  5HMY A;  4ED2 A;  4KHM A;  1CJV B;  3TX8 A;  1WUU A;  2ROE A;  3FRZ A;  3I5B A;  3R7N B;  3G4S S;  3RTV A;  2MZS A;  4BCA A;  2PI4 A;  5GME A;  3MPD A;  3GJQ B;  4TLR A;  3R2D J;  3ZTS A;  4WU2 A;  2E5L J;  4LF6 F;  4HHJ A;  4UQG A;  2O5D A;  3V4I B;  2AJ1 A;  3KDO A;  5E3C A;  1TL7 B;  3ETO A;  3QLH B;  2XZW A;  3MCN A;  1S1U B;  5D15 A;  3ZZP A;  1FWL A;  5LMN J;  2K7K A;  3ICL A;  2BOA A;  3J7A 1;  3PX0 A;  1X9W A;  4AUK A;  1ZBT A;  2NPF A;  1M5O C;  4CTA A;  2E7X A;  2VFS A;  2Z56 B;  5KFY A;  3PTW A;  2GML A;  4DR1 F;  4TU7 A;  2B4V A;  3IS9 A;  3KJV A;  2J0S D;  3M6U A;  2GQC A;  1FE4 A;  2D9O A;  3W8P A;  4W90 B;  2NQP A;  3DOK B;  2DYA A;  1C1C B;  2WBM A;  2BM0 A;  3ENW A;  3NGU A;  2XI2 A;  3K8V A;  2CDQ A;  2DIV A;  2HG4 A;  5IFM A;  3QFH A;  3KLI A;  2ACY A;  4QWA A;  1C0T B;  4DUY J;  4XTT A;  2ZHA A;  4HL9 A;  1OMS A;  1SJR A;  3KLG B;  2ZH2 A;  4ES3 A;  5THW A;  1J2V A;  1HQU A;  4HT5 A;  5F3T A;  2W9B B;  2XG8 A;  1V3Z A;  2HK3 A;  3LP1 A;  3FRY A;  2LA6 A;  2FGC A;  1S1X A;  2N4C A;  1S7H A;  3CCQ S;  4XIU A;  5IT9 Y;  2E29 A;  2WON B;  5F9L A;  2ATC B;  3DLB A;  4RUA A;  1OY8 A;  3R2C J;  5ETN A;  2XYH B;  2VL1 A;  4RUH A;  4LIR A;  1F2G A;  1H0H B;  3S7R A;  5IC6 B;  2F8M A;  2VF3 A;  1V3S A;  2FVQ A;  2D7S A;  1VHI A;  1V9O A;  4B08 A;  2ZEJ A;  1KVJ A;  2IJR A;  3E3X A;  3CDE A;  2ZH4 A;  3FBF A;  2EWH A;  1UFL A;  3G8S A;  4ZJL A;  2KVI A;  1HBN A;  4G1Q A;  3RRH A;  4I7F B;  1G6B A;  2V8V A;  2LQJ A;  1TV6 B;  1IKX B;  3T1H F;  1GK8 A;  4PQU B;  5DJB A;  1RWX B;  4B3R J;  1XNR J;  4KBI A;  3V6H A;  3DXS X;  3SV3 A;  4Y6I A;  2M0G B;  1KSP A;  2R42 A;  2K06 A;  4HTI A;  1GTE A;  2KRB A;  4IFY A;  3T6B A;  3C19 A;  2VQE J;  1MN7 A;  3K89 A;  2PEB A;  1M5S A;  2NUH A;  1QSL A;  1YIJ S;  2COL A;  1FVS A;  2XM3 A;  3K58 A;  1N5S A;  4PWD A;  2JEG A;  4UUX A;  1R0A B;  1EP4 B;  2EXU A;  4ELT A;  4DSE A;  3HFV A;  2DRB A;  2DY9 A;  2VFV A;  1HAR A;  3C6T A;  2UXB F;  3PR4 A;  4LSL A;  3TAQ A;  2MHE A;  2ERR A;  2DHA A;  2PO4 A;  4AQY F;  3HMJ G;  1HIY A;  1KLM A;  1FDA A;  4QR1 A;  4PCQ A;  2VFU A;  1LOU A;  3HHD A;  1IBL J;  4KY3 A;  1XC9 A;  4KPC A;  4YDD B;  2O67 A;  1RLD A;  1HBU A;  4Y28 C;  3RR8 A;  1FRX A;  4K2J A;  4LFB J;  1YJW S;  1S1T B;  4LR8 A;  1XMO J;  2IRY A;  2CJ9 A;  3MM5 B;  3GV5 B;  4Q0B A;  1HI0 P;  1S6Q A;  1H98 A;  4I68 A;  5IZH A;  3J7Z 5;  2IMO A;  1UKU A;  2AX0 A;  3KLV A;  2DNM A;  4OHX A;  4WTO B;  4RWX A;  3UDE A;  3KK2 A;  2D3U A;  1KWM A;  2CQ1 A;  2RE1 A;  4LF8 J;  3NCR A;  4K5R A;  3PAC A;  3SSS A;  3BKF A;  1WHW A;  2CVI A;  3ENQ A;  5ETK A;  4ZVU B;  4KYZ A;  5AJ3 F;  2H5E A;  5HLF A;  2IC3 A;  4OX8 A;  4AD6 A;  3MUR P;  1F60 B;  3TQE A;  3BSC A;  4UOH A;  5BR8 J;  2ZBP A;  4CWB A;  1U6Z A;  2K3I A;  4DFM A;  3DRP A;  4QU6 A;  5J2Q B;  2FJB B;  1R6V A;  1QAJ A;  4J9R A;  1U25 A;  2J6S A;  1TL1 A;  4GKK F;  4WE1 A;  2RHQ B;  1KS2 A;  4P74 A;  3MHY A;  3D1Q A;  1SVD A;  2MQL A;  3M8S A;  1CPZ A;  2F4V F;  2P2C B;  2JWN A;  4MFB A;  2KDO A;  2XS5 A;  2IDE A;  3GJS B;  1YI2 S;  5KG4 A;  3CXC R;  4ILR A;  1M90 T;  2MKJ A;  4H4M A;  1RWK B;  2FDN A;  4QWE A;  1I94 F;  2PFF B;  4ZN1 A;  3V5R A;  4OHV A;  3K2Y A;  1VBK A;  3BQ1 A;  2ZUA A;  3TAR A;  3RBX A;  1R31 A;  3AJ1 A;  2BUN A;  4B3S J;  2YQ3 A;  1UP1 A;  4B3M J;  2J8A A;  3KG4 A;  1SL2 A;  1SJF A;  4OYB A;  3CC7 S;  4KKO A;  4AL7 A;  3UPF A;  2VG5 A;  3F56 A;  3SQO P;  5LL6 d;  5B0E A;  1S7I A;  3I9Z A;  3QIP B;  2ALZ A;  2IAJ A;  4KTQ A;  1T03 B;  3I6P A;  4NLY A;  3FBE A;  3P45 B;  2CA9 A;  3CED A;  4M5L A;  3VZI A;  4EMD A;  3UD3 P;  1NPR A;  2CG8 A;  2HFS A;  3PHE A;  4KB7 A;  1JLA B;  4LIW A;  2QG9 B;  2D1C A;  3L7P A;  4MTP A;  4ZVR B;  1H3D A;  2C2Z B;  1WC6 A;  1QVF R;  2VG7 B;  3J81 Y;  1FJG J;  1RT2 A;  2LVW A;  4E8U A;  3I0R B;  1IM6 A;  4USH A;  1ICE B;  5ITH A;  4P2M A;  4LF7 J;  4Z2X A;  3DLK A;  1O8B A;  3RYL A;  2FJE B;  4NRU A;  1RT4 A;  4ED1 A;  6FDR A;  3KMS A;  4FYY B;  2VIC A;  4Y2I A;  1GX5 A;  1HL6 A;  2KFN A;  3QFW A;  4PPZ A;  2XHC A;  3HZG A;  1PG5 B;  4OFZ A;  2IBO A;  3MD3 A;  3EZU A;  3R5C A;  2FHJ A;  3TX0 A;  3BYR A;  3UDC A;  3H42 A;  4P2F A;  2ZH1 A;  3CDA A;  2Z8Q A;  2PD1 A;  4DG1 B;  5HRO B;  5HO4 A;  2MZT A;  1BQM A;  4FZV A;  5ETS A;  2R8G A;  2H5J B;  3MAH A;  5H1S V;  1RAF B;  1FX2 A;  5G0R A;  3LPE A;  4NLX A;  1IKV A;  1YRX A;  4OLO A;  5HJX A;  2ZH5 A;  5C2C A;  2V34 A;  1LWF A;  2Y3Y A;  3CJK B;  4ID8 A;  2ZVI A;  1Q86 T;  2Y8W A;  4TQR A;  2KM8 B;  1Y7P A;  2UXD J;  1DQ8 A;  3K5O A;  2WAQ D;  2HEK A;  3EVO A;  3BQ2 A;  1RWM B;  4EZ9 A;  2BV3 A;  2HVD A;  2V69 A;  4GO7 X;  4WFA Q;  5CQG A;  3GII A;  2YKA A;  3BRE A;  2QYG A;  2YBV A;  2NUU G;  2B0G A;  3POT A;  3NGT A;  2QX0 A;  3UFC X;  4FN5 A;  5FLX U;  2BAB A;  5AXK A;  3IS9 B;  1QDU B;  2ZWP A;  3KJV B;  2M52 A;  2YKP A;  1MWY A;  1FXL A;  4PKD B;  2CQ2 A;  1VC6 A;  1EQM A;  3EDQ B;  2WZ1 A;  1JLG B;  2QEX S;  3HM9 A;  4X4N A;  5I3U B;  4X4T A;  2PMW A;  3AOD A;  1UL3 A;  3MD1 A;  3GV7 B;  3PEH A;  1Q53 A;  2BKN A;  1N34 J;  3NNH A;  3PW0 A;  3O8W A;  1NCL A;  4ZP7 A;  4P7V A;  3K59 A;  4OMF G;  1X5P A;  3W2V B;  1S49 A;  4OYX A;  4M8L A;  4RU2 A;  2VPY B;  3TAP A;  4F02 A;  4GC6 A;  4DXL A;  2E66 A;  5E33 A;  4EUV A;  2XY7 A;  1N5Q A;  5ETV A;  2JC1 A;  1CC7 A;  1KD1 T;  5D3G B;  3C16 A;  2ZM6 F;  1OIA A;  1X5T A;  3R27 A;  1LNQ A;  1D9A A;  4RW9 A;  2UU9 J;  4OYO A;  3VQT A;  1S1W B;  3Q8R B;  4CO0 A;  8AT1 B;  3T6J A;  4LBI A;  1CG2 A;  2MQN A;  4OJ3 A;  4I2Q A;  2HAI A;  1UPM B;  4DV5 F;  3HSG A;  2PA3 A;  2B7C B;  3RUB L;  2B4P A;  3WHI A;  3RGI A;  2GW8 A;  3QJJ A;  5EUH A; 
#chains in the Genus database with same CATH homology
 2MTL A;  4DV1 J;  4LF9 J;  1N33 J;  4V1A k;  3OTO J;  5BR8 J;  4DR1 J;  2HHH J;  2UXB J;  4GKJ J;  4DR2 J;  4DV7 J;  4NXN J;  4AQY J;  3T1Y J;  4K0K J;  3JAM U;  1IBL J;  4LF5 J;  4KY3 A;  1N36 J;  4DR6 J;  1N34 J;  5A2Q U;  5LMU J;  4X66 J;  4JI2 J;  1IBK J;  4JYA J;  4DUY J;  1HR0 J;  5AJ3 J;  2UUC J;  1IBM J;  4X64 J;  4JI0 J;  4JI8 J;  2UXD J;  4LFB J;  3J81 U;  3J80 U;  1XMQ J;  4B3R J;  1FJG J;  4HHU A;  1XMO J;  1XNR J;  1HNZ J;  3R2D J;  4KHP J;  2E5L J;  4JI3 J;  2KVQ E;  2VQF J;  4LF7 J;  4NXM J;  2UUB J;  5IWA J;  3J7A N;  4LF6 J;  3W1Y C;  4DV3 J;  4JI5 J;  4PWW A;  4GKK J;  4DR3 J;  4JV5 J;  4JI6 J;  4YHH J;  4YY3 J;  2MEW A;  2VQE J;  4JI1 J;  2MQ8 A;  5LM7 E;  3D3C J;  4DV4 J;  2UU9 J;  4NEZ A;  4LFC J;  4B3S J;  4OX9 J;  2F4V J;  3T1H J;  2ZM6 J;  4NEY A;  5IT9 U;  4DR7 J;  2UXC J;  1XNQ J;  5FLX U;  5LMN J;  4B3M J;  3IMQ J;  4LF8 J;  4DR5 J;  2KL8 A;  3R2C J;  4B3T J;  4DUZ J;  4DV0 J;  1HNW J;  1HNX J;  4DV2 J;  4RJV A;  4JI4 J;  3D3B J;  4DV6 J;  4X62 J;  4KYZ A;  2UUA J;  4DR4 J;  4LFA J;  1J5E J;  4LF4 J;  1I94 J;  1N32 J;  4DV5 J;  4X65 J;  4JI7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...