4AQYJ

Structure of ribosome-apramycin complexes
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4aqyJ00
4DR4J 3R2CJ 4X64J 4LF9J 3J7AN 4NEZA 5LM7E 2VQEJ 4X65J 2VQFJ 4DV3J 2HHHJ 4DV0J 1N34J 4PWWA 4LF8J 4B3TJ 4JI2J 4YHHJ 2KL8A 1N36J 4LF6J 4V1Ak 5AJ3J 1XMOJ 2ZM6J 4DV5J 5IWAJ 4DR1J 1IBKJ 2F4VJ 3T1HJ 2MQ8A 3T1YJ 4LF4J 4NEYA 4DR7J 4X66J 3OTOJ 4DUZJ 5IT9U 4X62J 4JI7J 1IBMJ 3R2DJ 4DR6J 2UXBJ 3D3BJ 4HHUA 1XNQJ 2UXCJ 2MEWA 4OX9J 2UUAJ 3J81U 5FLXU 4DV2J 4DV4J 4KYZA 4JI8J 1XNRJ 4LFBJ 4KY3A 4DR2J 2UXDJ 4B3RJ 4B3MJ 4NXNJ 4DV7J 1N32J 4LF7J 4JI0J 2UUCJ 1FJGJ 4JI4J 4KHPJ 4JI6J 4JYAJ 4GKJJ 5BR8J 1HNXJ 4JI5J 5LMNJ 1N33J 2UUBJ 4LFCJ 4DR3J 1HR0J 4JI3J 3IMQJ 3D3CJ 5LMUJ 4JV5J 4DV6J 4DR5J 4JI1J 1IBLJ 1XMQJ 5A2QU 4RJVA 4LFAJ 1HNWJ 1I94J 1J5EJ 4DUYJ 4DV1J 4K0KJ 2MTLA 2E5LJ 3W1YC 4YY3J 3JAMU 1HNZJ 4LF5J 4NXMJ 2KVQE 3J80U 4GKKJ 2UU9J 4AQYJ 4B3SJ
chains in the Genus database with same CATH superfamily
4TYAA 1ZS6A 4MYTA 5C25B 1BD6A 2XZWA 4TU7A 3GCXP 2HWHA 2DGVA 5KFIA 1QM9A 5HATA 5D4OA 4EYIB 3PX0A 3RRHA 2HURA 4WXOA 1F9EB 3M2VA 2JX2A 3MAAA 3DRXA 3WDOA 1U4BA 2OFHX 4R8UB 1H38A 1N34J 4ZLJA 1OSCA 3NBPA 1L3VA 1TMMA 1GEHA 5DDPC 2WOMB 1HIYA 2E1PA 1KLMB 3L7UA 1YIJS 1OPZA 4QR1A 3VAFA 2JVOA 3VCDA 1FWPA 3UCUP 4NZ7A 4CO3A 2HPUA 4LIRA 5IWAJ 1Y3KA 2DRDA 5IFMA 2WRMA 2XCPA 3NOGA 1NHKL 2ZZMA 2XM3A 1F3FA 3OJSA 1J27A 4ZCLA 2KH9A 4ZVUB 1PILA 1JLGA 1FD8A 2HRTA 3MPDA 2W9BA 4K4UA 1RWUA 4RW9B 2B4OA 3SCIE 3ZZPA 3CT9A 2BJ3A 4X62J 2H3EB 1JXEA 1YZ7A 2DJWA 2D3UA 3S6EA 1EHWA 4WFBQ 1R27B 3PVXA 5FJ4A 1CULB 2QLWA 3FK4A 2BA9A 1FE0A 4QOTA 4UOHA 3HZGA 3QPIA 3G82B 2JLGA 3UW1A 6AT1B 4LSNA 4B9LA 1HD0A 3LGHA 4PCQA 2BR0A 3EZUA 3ITHA 3W2WB 4OI6A 2IYIA 3ZZYA 4CZCA 2GMLA 5K8PA 2FVSA 1U6BA 1XNQJ 3EUNA 1QAJA 3PKYA 3ZFVA 1SC6A 4B08A 5HBMB 3HM9A 1X4EA 2YX1A 3Q22A 1OY8A 3HSGA 4DZDA 3CJ5A 4RNFA 2DNPA 2Z58B 2E5HA 4KYZA 2E9RX 1NSPA 2G4BA 3VVTA 2ZZNA 1BC6A 3N79A 1U1KA 4KV8A 4FS2A 1NK4A 4OFZA 1QE1A 2GIQA 4CLTA 3I4HX 2HHSA 4EMDA 2E66A 3ULHA 2CDQA 4J9KA 5A76A 3MPYA 3RB4A 1NXIA 2UVVA 2W4DA 1UVKA 2OEMA 2IC3A 2XMVA 4WZMA 2U2FA 3HVRA 4B3RF 2QLBB 4J9PA 3TUIC 4DX6A 1O6XA 4QYRA 1R8AA 3AB2B 1JLBB 4RUCA 1R8PA 2VFUA 3D1OA 2R2TA 1X5PA 3MUMP 1HR0J 4DCPB 4J9OA 1DURA 3EZOA 3PFOA 2EFVA 2XB2D 1EETA 1YKWA 2FB0A 1BLUA 1JLEA 1ZTWA 3IG1A 2EKYA 4LSLB 1RWWB 1SIZA 1LKZA 2Z56B 3H2UB 6FD1A 2J8SA 4DV1F 2FDNA 3NMAA 1JQGA 2LKZA 2XG8A 4ZPDA 3MD3A 2V2KA 3NCPA 4LREA 5AE1A 3JYTA 4LSLA 4FN5A 4A4JA 4ZIWA 5HJYA 3LGMA 4HL9A 4P2MA 2AEJA 1WOSA 3DRRA 3D0IE 3Q8QB 1YG0A 2CNLB 2VJUA 3GR0A 2CQHA 2NLWA 5D4LA 5KT6A 2AYEA 1O51A 5D77A 2FHMA 2MQOA 2ZH2A 4J9SA 2X1BA 4ED8A 1FTCA 3QJJA 1H73A 3LQVA 5KT5A 4QWDA 3C2PA 1G2EA 4DF4A 1RABB 2CPJA 5FIIA 3QT5A 3GIIA 1Q53A 2GJFA 2RH3A 3CD0A 4FYWB 3V6HA 3J80U 1K73T 4X66F 3T3FA 1V9OA 4DFMA 1VLOA 3TUPA 3PJ9A 1EZZB 4USTA 5ETMA 3HK2A 2VPYB 1MWYA 4M94A 3AJ1A 3FQLA 3CCZA 3U7JA 2ATCB 3TI0A 4PQUA 4OZ5A 3UDLA 1OQ6A 3IA0A 4QPXA 3CCES 2CG4A 2R2SA 4YS2A 1N5YB 2PI5A 3LW5C 3NRBA 2OEJA 3R5AA 4NYOA 2DIUA 3MEEA 2IM1A 2HHWA 1RE1B 2J9EA 1S1UB 4KGKA 2E1AA 3H59A 3KJQB 2CJAA 3DLGB 3QIPB 4IH5A 3Q0AA 2ZOGA 4QIGA 4B3TJ 2CJBA 3CJKA 3M32A 3LGNA 4G6VB 4ZVSB 1U0SA 3GSDA 5L39A 2W01A 1WHWA 1FKOB 5G4DA 4W4MA 4ILMA 4L3KA 2FYXA 2E1MC 2H1YA 5ETPA 5IV3A 1IBKJ 5F41A 5IZHA 4YR3A 1YRTA 3MHYA 3FMBA 1ZBTA 2Z30B 4X66J 4ZJOA 4DUZJ 3HZEA 5B0CA 4KO0B 3PV8A 2FJWA 1ZAWA 1UAWA 2HAFA 2HIYA 2YBVA 4J90A 4JI0F 2LQJA 2YX4A 3MMBA 5ITHA 3BO2A 2HS3A 5F8MA 1WC5A 2DNYA 2I5JB 2DXEA 2GAHC 1X60A 3H2LA 3OXLA 4FYYB 4D3HA 3MPWA 1NSKL 5HP1B 1Q5YA 1M1KT 2DK2A 1WD6A 2FHOB 2MHEA 3EJMA 3O3LA 5H1SV 2ASJA 5D8HB 3JTNA 3CSKA 4M8LA 3S1TA 4ECRA 1RT5B 2WVDA 3R5BA 3ZTSA 4USVA 1S6UA 2M8DB 1FKOA 1S79A 1NDKA 2MEWA 2D3ZA 1IBMF 4NLGA 1RWVB 3CC4S 3KUGA 1CS4A 5AXNA 1CPZA 5CYMA 3KHRA 3CC7S 1RT5A 2Y3YA 1C4AA 3CO0P 1T11A 2IAJA 4DV6F 2XMAA 1UVIA 3CO9A 4M5KA 4AQYF 2UXDJ 1RXOB 5H9EK 2H51B 3CWJA 5C24A 3T1HF 2Q6BA 1TU0B 3CJRA 3H20A 1KRPA 2XS5A 2VV5A 2HQCA 5LJ3Y 1KHWA 2SXLA 2VH7A 4BDPA 1VQKS 4UZBA 2ZFHA 2OPPB 2MLYA 2DT9A 4M5HA 3L7PA 4AD6A 1NBEB 4RW4A 4ECVA 3HX9A 5KT7A 1WOOA 4YHHF 3Q8VA 1WG5A 1F5BA 3N6NA 2D9OA 2JLFA 1S10A 1BMQB 1FRMA 2ZOMA 3CJQA 3MEDA 4FVMA 3KNAA 2V8VA 3BZQA 4OYXA 5D78A 4DFJA 1HYSA 2D1CA 2XZTB 1VQPS 1ZAXA 1U49A 4RPFA 4FYDA 1IKXB 3O5TB 3DRSA 1F9FA 4TY9A 3C14B 3W61A 4DV6J 2Q66A 1JKHB 3FVYA 1L3KA 1WOPA 3I5AA 4HEA9 2XLJA 1IBLJ 3L4BC 4C0OC 1S6OA 4MH8A 2Z0GA 1CJTB 2ADBA 2DIVA 2O67A 1MROA 3GTYX 3BH6B 2RQCA 2ADCA 1NK9A 1L3TA 5C24B 2IMOA 1TK5A 1HHTP 3W62A 3L95X 1WF1A 3D6FB 4JV0A 4DUYJ 3OSPA 2HHTA 3H7HB 2ZJQQ 3KDOA 4WKYA 5LSRA 2IDLA 1P27B 3HHLC 1R31A 3LP1B 3W1YC 2R8HA 1UPMB 2YKAA 2B43A 5DQHA 3VWSA 1JNZB 4Q0BB 3DMJA 1AW0A 4E0DA 2N7CA 3VV2B 1BE4A 2ZDOA 4I69A 5D0RA 4N47A 2WSFC 3M9OB 1HNZJ 2XWYA 2J76E 3D54A 4H54A 1N56A 1IWAA 2B4VA 4KPYA 1S1WB 3H5YA 2HNDA 3OUYB 3PRVA 3QATA 4CP5A 2OKQA 2EK1A 1D8YA 3NLCA 2A10A 3A3OB 3BB5A 2MDAA 2H5EA 1HQ2A 2I5JA 4IDKB 3M2VB 4AQYJ 2DTJA 3QO9A 2R7TA 2CQGA 3TA2A 5CD4H 5D3GB 3A3NB 5E3RA 3HDSA 3DN9A 2VPZB 4L3NA 3I0RA 4LUBA 5IXUA 1KFSA 3O44A 4NLOA 4Z37A 4HTIA 1RHUB 2G0IA 3AOAA 3EZ5A 2ZH8A 3UN5A 5AJ3J 2WK4A 1RSCA 3EXYA 4UUWA 3I32A 4KJIA 3QAUA 3KLEB 2CADA 2ZDPA 4PWWA 5A8WB 2ILYA 1Q7YT 1PG5B 2XMUA 2V9KA 3LANA 4LVOP 1LWFB 4U8VA 3VQSA 2R8IA 2DGWA 1EAYC 3ILOA 1N32F 2YWEA 2BM1A 2V8HA 3MM5B 3TX0A 1FA0A 2GX8A 4O23A 4C3MA 2F4VJ 2C3UA 2ROPA 4OZLA 4NXMF 4HDHA 1UJ5A 3SIPB 1VC6A 1O8BA 1QVFR 2XMMA 2BACA 4J37A 1UVMA 4FF3A 5HVHA 4WU3A 4FBTA 3EVMA 2JSXA 3PEHA 2UUCF 4CCHA 2UP1A 2DGOA 5J1EB 1HQUB 1FRLA 2AMCB 1VQOS 1RBLA 2G9OA 2C3YA 2AX1A 4DSEA 3B4MA 1FESA 1MU2A 1AFJA 2YKNB 3TZXA 4F50A 1FDDA 2Y1JA 4H4MA 5LOQA 1GTHA 4Y2MA 3ZC4A 3UD4P 4QYZJ 1A9NB 4EUVA 2K3KA 3UO0A 4A48A 4HHUA 3TANA 4OI4A 2C2ZB 2VODA 3KK1A 2VL1A 4MKYA 5IM0B 4RNMA 4DV7F 1J5OA 3GFXA 3RGIA 1V3RA 1Q5VA 1EARA 1O5JA 1SV5A 1ZA1B 3ENAA 3HD2A 3I31A 4ZVOB 3HSJA 3W2WA 3N0VA 3W65A 3QZ7A 1C0TB 4DHVA 2DNOA 3TA1A 3VGVA 2R2RA 4C11B 5L1LA 2IMWP 2GHWA 4M95A 1CSJA 1X7VA 2Q1LA 4ED6A 3H42A 2DXFA 4C7QA 1UTAA 2BQUA 2B3TB 4KHPJ 4R25A 5DG7A 1A7GE 2QSFA 3PJXA 2WONA 4X2BA 3VAKA 1CJUA 2ZOFA 5KG3A 4YR0A 1N36F 1S99A 2ZBRA 3K5NA 2LEPA 4GRSA 1WI8A 1VRUA 3DYAA 2BOAA 4KRWA 4YB6A 1Y10A 2KU7A 4BWJA 2AGPA 3H98A 2EG2A 4OX6A 4JI2F 1M5VC 1TAUA 1AA1B 3NMRA 4YB1P 3O2IA 1LFWA 2PMHA 2XI2A 2K7KA 1G3OA 3PO4A 5KFVA 1HWIA 2BJDA 2RSQA 4DCJB 3EGWB 3FBEA 3NG8A 3CJ3A 2EEYA 4GVBB 5D6GA 1CJVB 2MXYA 3GIJA 2POKA 3VTIA 1RWKB 1RADB 1H74A 3G4SS 1UFKA 4UQGA 5A8KB 1C0TA 2RIJA 2C2KB 3CCMS 4ETXA 2RDDA 2HNYA 2FUG9 3MUTP 2PMZD 3THPA 2YWFA 4IG0B 3Q86A 4OJ1A 5EGYA 1HQEB 3HVTA 5HJXA 2B9EA 4RU2A 2GZOA 3LAMA 3OR1B 3M2UA 1TUGB 4GC7A 3TYTA 4NRTA 1WWHA 1JLCB 1X4GA 4Q5VA 4LF5J 1KVJA 1OWXA 1GMVA 4P71A 2HQDA 3IRXA 2JHEA 2ZD1A 2UXDF 3P6YC 4AFFA 4U6PA 2B7CB 1HQUA 3GYNA 5G0RB 3L3CA 2OPRB 2CQPA 2OEKA 3KLGA 1S76D 3IXQA 2JC1A 3EDRB 1YJNS 1WHYA 2OPQB 4GVBA 3TZWA 2E29A 3BQ1A 3VALA 2ALZA 2LQ8A 4RLEA 1XMQF 1URNA 1ITPA 2BXJA 1VI7A 3GCWP 4Q43A 3MAQA 4EI2A 1MG7A 3NNHA 4NYPA 4ZS6A 3VAJA 2HWTA 1YTYA 3C16B 1PJ6A 2CZVC 4OZ1A 3KLIB 2X3GA 4K2XA 3EX7B 4LF6J 2VBWA 2HBYB 4P74A 5B09A 1NNDA 5GADI 1DZ5A 2ZM6J 3GR1A 2HBZB 1FCAA 1K44A 3KTQA 2H9ZA 4DQQA 3M2RB 3W7BA 1HW8A 2MQ8A 4MT1A 1VRUB 4FBUA 2WBMA 1WDTA 3FEZA 1PIEA 1TR0A 2M70A 3TAPA 1KQKA 3HSZA 1SKSA 1VGYA 5EX3A 7FD1A 1HWKA 2AEFA 1H0HB 2YNGB 3J80Y 2XLKA 1Q81T 2I6WA 1UPPA 1XR6A 4RKUC 4WTYA 2ZWOA 5DG9A 3OD2A 4DI6A 4X84A 1W2IA 1U1RA 2GA7A 2VBYA 1VJQA 3CTRA 5KFFA 4TQRA 4DU7A 2RUSA 3M6VA 3HCXA 1RT6B 2QN6B 1HFEL 1HNIB 4YEAA 2OP5A 3AOBA 3LP0A 3JSYA 2WB4A 4M1KA 1Q4RA 1YDLA 3P45B 2LQ9A 2W2MP 2KB2A 2RUGA 3W63A 3OL8A 1ZZNA 2GJ2A 3E2EA 3SBMA 2K3IA 5J1EA 1FNOA 3G8TA 3KLHA 2UVWA 2VA2A 4CNZA 2WCXA 4LT6A 2DB1A 2QT7A 2NUHA 1IKYB 3DU5A 2B5JA 2CPHA 4KH0B 1FKPB 1R89A 1RLDA 3NGDA 2EFOA 4DV7J 1PAUB 1MMLA 2MPUA 4O3QA 2XSFA 3CJSA 4WKRA 1NEEA 2YQ1A 2F4VF 3RBDA 1M90T 1KSPA 1EKRA 2CQ3A 5CCMA 2XYHB 1BWVA 5GVQA 3T6JA 3KLFA 4CH1A 2E5GA 3H5UA 2NYIA 4G1IA 4RO0A 4UZCA 1K47A 4WE1B 4ANDA 4HYKA 4CTAB 3VAMA 5J2NA 5BR8J 4B9MA 1DFDA 2G0CA 2H54B 2RF2A 4YDDB 1BY9A 3MM8B 4OYPA 3QGHA 1HHSA 2XCAA 1T95A 2BM0A 3LTOA 2HNZB 1LK5A 3CJ4A 4IOBA 5L1IA 1JLFA 1CJKB 4NRUA 1RT2B 2IHR1 4C8NA 5M2PA 2KFNA 3PACA 4KT0C 4U7CA 2D41A 1JJ2R 1KTVA 4DR5J 2M2BA 2DEJA 3K89A 2KXHA 2QC3A 2DKOB 5M2UA 5KFGA 2V8GA 1SKRA 1Q1KA 5DZ7A 2MB0B 3DLHA 1IXKA 4F26A 3S8SA 2EK6A 2QYGA 1CBKA 1K1SA 2RVJA 1NJWA 2WSEC 2YNFB 4KC5A 3PW0A 5F8HA 3PYEA 1F5AA 4O3PA 4P10A 3QLHB 3BDEA 1TL5A 5DM7Q 2E5LJ 4MJKA 1D8ZA 1RWOB 4WU2A 5C42B 5KT2A 3KHLA 3N4WA 3T9NA 4ILRA 1ROFA 3I9ZA 5B0BA 1JXLA 2P9EA 4I6YA 2AQ4A 3KYLA 5DO2A 4I2QB 4UQTA 1HBMB 2APOA 3PTWA 4F02A 1C1CB 3UPFA 2RAQA 3DLBA 3LP1A 2J9CA 1DTQA 1VHIA 4IFYA 2W8LA 3UNGC 4EO6A 4PXDA 1UFLA 3GFHA 5D4PA 4LFCF 2ZKTA 1FEEA 4EWTA 3IO1A 4CM2A 3BQ2A 1TV6A 4W92B 2JL9A 4A8OA 3C14A 1X0PA 3ZTOA 5DLGA 4F2SA 4LR9A 1CEZA 1I51B 3VAGA 1WEZA 4PYDA 4NYZA 5LM7E 5KFUA 1N0VC 1PYTA 2AEMA 4YN3B 2V94A 4FDFA 1LWCA 1Q8BA 1RTHA 2Z2YB 2HHHJ 1B64A 2VBZA 4P75A 1KDNA 1RT4B 5CYQA 5H9EJ 1KVIA 4LQ9A 3JSMA 5J2PA 1NK7A 1QTNB 1KN6A 1P6TA 5J1NA 1CJVA 2BVZA 3U02A 1LWEA 1PGZA 2RD5C 1G4CA 3G8SA 4DQIA 3HHLA 3UI3A 3HKWA 4DV0F 3FZ2A 3GV7B 1H2VZ 1ZA2B 4DL3A 2F1FA 3RU0A 5GMKa 2GNKA 4IR9A 2ZC4A 1IQZA 5HL7Q 3KLVA 2CQ4A 3MURP 3KWMA 5EHHA 3NGUA 1RTJA 2QMUB 3W5YA 1URRA 5GAEI 3MR6A 3IC1A 1NZ8A 4RW4B 3X3UA 3G86A 2ZJRQ 2JZ5A 1U1PA 4M5JA 3BO4A 4DLEA 2QL5B 1HNXF 4F0KA 2C3MA 1PC4A 1B4SA 2O66A 3H5SA 3TEHB 4LMZA 2HQFA 2IRYA 1VOMA 2BZ2A 4UW2A 3TP2A 7AT1B 3IBWA 3HT3A 2UXBJ 2J9DE 2PA8D 1P1LA 3POTA 3RRKA 1HBUB 8AT1B 1DRZA 3AQPA 2OSQA 1GXUA 3CDWA 2KFZA 1CQMA 1NM2A 1TKTA 2CNNB 3PEJA 3MR2A 3V6KA 1VQ8S 4IQMA 5J1PA 2JC0A 3MF5A 3QLHA 4QW9A 4EEYA 3C6TA 1LW2B 2K06A 2YH0A 5C42A 2P6SA 4BWMA 1R0BG 4NA3A 5KG4A 2HMIA 4OIXA 3FUYA 1UZDA 4KFBA 2DGXA 1S6QB 3PJWA 4N56A 2HRYA 2MQNA 4IR1A 3IM8A 4ZP8A 3BSNA 2BBEA 1Y5LB 1XC9A 1RU2A 2ASYA 2CIMA 4H4KA 2FJAB 4CI0B 5DDQC 4O3SA 4LBIA 1SCJB 3J7ZT 4YY3F 4QBUA 5F8LA 1F5CA 2F8EX 1PO6A 2GJIA 3Q23A 4F4KA 5FDLA 4JI7F 3P5TL 1HBNB 2E1RA 1Y3JA 3SZ2A 2B9WA 3TVZA 3HFZB 2NPIA 3UFCX 1S9EA 1U6ZA 4I1TA 3LALA 3SDEB 3PDNA 1GMWD 4LRAA 5B0FA 1T9YA 3C6UB 3GJQB 1WKKA 1GXTA 2GVZB 1VQYA 2MZTA 4ES2A 1B0TA 3IBCB 2IA6A 4PQUB 3E01A 3ISND 4XO0A 1N33J 2NSCA 2BOPA 1R0CB 1XNRF 3DLJA 3R7SB 4PZVA 4TU9A 2CQ1A 3DLEA 2CZ9A 2QRRA 4PYAA 4G1PA 1UA0A 1H98A 4TLQA 1YWXA 3N6LA 1QE1B 4JOUA 1DTQB 4IFYB 4RX6A 2M0GB 4TYBA 4OI1A 1NPRA 1TZ0A 4KV8B 3MMCB 4K2JA 3R1LA 2IBOA 1F1BB 3I6PA 4OJ3A 2K8GA 3PR4A 1S6QA 5F0UA 3J81Y 4DV1J 3CNQP 3MM7A 4R5PA 3MECB 5CYMB 2G1HA 2ZH5A 2BRKA 1ZM3A 2IAJB 1UEUA 2J0XA 4ED4A 2MGZB 5F8IA 4NMLA 4C3LA 2LEAA 1VQ5S 2ZVSA 2NQPA 1UWBA 2RT3A 4ECYA 4KE5A 4ZN1A 3PYGA 2CPFA 1FT8A 3I87A 5KOWA 3TQEA 3ET6B 5ADZA 3IR5B 4LSZB 5HQ8A 1VLYA 2IM0A 2YNGA 4ED3A 3FBCA 2FY1A 4KHMA 1QAYA 5I4MA 2VBXA 2HFNA 5LSOA 2XHWA 1Q78A 3BBCA 1FDNA 4FPIA 2V2QA 1T7PA 3MMBB 4HR2A 3VZHA 1RTJB 2O5DA 1VISA 1G1XA 1EP4B 2WBRA 1NKEA 4DJBA 1RAOA 5E5NA 3M8PA 3UCGA 3OXGA 2I0XA 2R7OA 3JQKA 1TKZB 4LBHA 4JI2J 2MZ1A 2MY7A 2XMJA 2BDPA 1FRJA 1KP6A 2EXUA 3F44A 3NGSA 1PBUA 2XC9A 4DS4A 2HLUA 2MGZA 4DR3F 1A6LA 3I55S 2KM8C 3G6YA 1WELA 4CO2A 1HBOA 1RTDB 1FX4A 4N8NA 1HI1A 2YKMA 4NEYA 4ZPAA 3OLAA 2HS4A 2LQ5A 3CW2C 5AXMA 3S7RA 1N5YA 3UQSA 1NB7A 3IS9A 2X3DA 1S0VA 1F2GA 1YLXA 1Z4UA 2FGCA 4DPXA 2N82B 3I9V9 4DEZA 1MNEA 4ZK7M 2DH9A 5KFBA 4ED0A 1WHVA 3K58A 2XSJA 2NYHA 1SXLA 3CCUS 2RQ4A 3M8YA 3IWLA 1KBRA 3QBCA 4FZVA 2G1DA 2I9SA 2NUUG 3SCLE 4X4TA 3KLHB 5B0GA 3W8GA 4FS1A 1VRTA 3L09A 4PPDA 5HROA 2EW9A 1T03A 2A1BA 2GVDA 3TW0A 5KOXA 3AD7C 4IG0A 4EBEA 1IM6A 1HBNA 4ZIVA 4X4PA 3LA0A 4WF9Q 2K2PA 2ZNZA 3AB4B 2YWKA 1B0PA 1W25A 1XJWB 4JV1A 3X1LB 1YGYA 2H5IB 5A6PA 4N77A 1ZPWX 2FJXA 2R42A 2D9PA 2YXLA 4LJMA 1WSVA 1GT8A 3K2YA 2G2YA 3Q2TC 3BBFA 4MIWA 2DY9A 4N41A 4C0BA 5EN1A 2GQQA 4JI4J 3LPEA 4QQBA 1S1XA 3G71S 2VG6B 1RB0A 1S7HA 1HNXJ 5LMNJ 1S48A 1R43A 3C6TB 2A2CA 3HKZD 3HSDA 3KUEA 3KK3B 2UUBJ 2WW4A 4NLPA 3DKDA 4WP9A 3BJYA 3HI9A 1SJ4P 3HJFA 1TK0A 1W26A 3DOMA 3UE2A 2JFDA 5L38A 3QWPA 1Q95G 2Y0SD 5LMUJ 1UW9A 2MZJA 2HFOA 4CLUA 2OTLS 2A18A 2VOOA 3KHHA 4L76A 1IUJA 5LXYA 4CWBA 2AYMA 4JI1J 1DTTA 4NX9A 2CPIA 1HWJA 4A8SA 4RJVA 1XR7A 4I68A 5IV4A 2P8IA 4A47A 3V5RA 4C98A 4QWAA 4ES1A 2DNZA 4J5OA 4WFNQ 1N6QA 1KD1T 1BQNA 1NDPA 4DXLA 4OMFG 1RGVA 4YP3A 2B5JB 1RHRB 3QYYA 3R6GB 2NXNA 4HI2A 2OPQA 4HLBA 1XEZA 4O4RA 5RUBA 2VG7A 1N5VA 2ROGA 1UETA 2B56A 4FYVB 2KG1A 4MTPA 3FCHA 5SZTA 2XNRA 3ICLA 2KYXA 2VFSA 5IS2A 3BSOA 3T5HA 1YBUA 2CJXB 4G1QA 4ENOA 1WTBA 3SSRA 2M7SA 3RB6A 2DPJA 4JI3F 2C3OA 1M5OC 4GKKJ 3DOLB 4OYBA 3SSSA 1FTRA 2YY3A 1NK6A 3V4MA 4IQXA 3NAIA 2VUGA 2N4CA 3VHQA 1LK7A 4LF7F 3GIRA 1VQ9S 4MK7A 2VFTA 4ES3A 2BJ1A 3DOKA 3MM9B 3GU0A 1R6YA 2CNOB 4AXIA 2W9CB 2OH2A 2XHCA 2FD2A 1TL1A 3Q8YA 3T5LA 3CD6S 2YNHA 4PABA 1EIYB 4WFZA 4X65J 2GQ2A 1RACB 3PCOB 3NGTA 4QW8A 4AT1B 4ZLLA 5IWAF 4B3SF 3WQPA 3QGIA 3M6WA 2KL8A 3LO3A 1HBMA 2BYCA 4NZ0A 3A13A 1U1NA 1N36J 2CJ9A 3LF0A 2HRUA 1XMOJ 1M5HA 1XERA 3EICA 1TQLA 1HPZA 1X4AA 1D09B 3C8YA 1M5KC 4C8KA 1CQNA 2QLXA 1ULRA 3NBPB 4F67A 2MQQA 1LXJA 4E8UA 2B9XA 1AB8A 2RE1A 2DH8A 1SH0A 3ZZRA 4DCOB 5LXRA 2HHVA 1VK3A 3I0SB 2F5GA 3ZTQA 3J7A1 1XMOF 3NS6A 3I0RB 4JP8A 2OUGA 4FNHA 5BYQA 3LWLA 3KOAA 2DHSA 4IDKA 1X9MA 4ECTA 1RDRA 2Q3PA 4I56A 2R2UA 3DRPB 2XMWA 5L9NA 3PHEA 1HMVB 1XK8A 2HWIA 2IJFA 2YPYA 3ENWA 1RTIA 4RNNA 2RS8A 4Q8FA 4LFBF 1M0SA 1CJKA 2I38A 2MHNA 5T7LB 2DVIA 3TARA 4OI3A 4L73A 3MZIA 3L7OA 4OZ3A 2MSTA 5HK4A 5K9FA 1FEHA 2J5AA 2J7UA 3MEGB 3G87A 1IN0A 3NP5A 2QIFA 4ZPBA 2COLA 5K8OA 3J7YI 2OD4A 3EXCX 2Y8YA 1FJGF 4KY3A 3MM6A 4ED7A 1ZH5A 1R7IA 4B9VA 5KFWA 2AGQA 2RHQB 4NXNJ 3DHXA 3A4TA 3GB0A 2QG9B 5LT5A 4X64F 3KMSA 4K4TA 4DF8A 3TAQA 3QT7A 5C2GA 1YBTA 1N32J 4F4AA 4PG4A 1U25A 3LWMA 3H4BA 2FVCA 3BR9A 4DR7F 2G0JA 2LMIA 1M1GA 3E3XA 2MZRA 4O3NA 5ETTA 3TZZA 2FLNA 1SI9A 3AJDA 1ZM4A 3MM9A 3GG0A 2KO1A 1SJ3P 1NDLA 2JEJA 3G9CA 2MQLA 3KJVB 4DR3J 3OJUA 3VGTA 1T3OA 2XEXA 2HG4A 2VG7B 3Q8SB 2W1BA 4WP3A 5T7LA 3ZTRA 2JOQA 4O0IA 5ETLA 2UUWA 3A8EA 3AXMA 2A2DA 4P52A 4G3IA 2OPPA 2UUBF 1KLMA 2HIQA 2XBPA 3SSQA 4ZLNA 4LF1A 4I7FB 2AD9A 3KG4A 3Q8RB 3MFIA 2OJ3A 4URSA 1WKJA 3QT8A 4RW8B 4BS2A 2MYFA 1WNEA 4KQZA 1UJ4A 4OYAA 2LU2A 4OHVA 1PYOB 4DN9A 2P9GA 1RYRA 3FSIA 2HVZA 1FWKA 1Q79A 2BEFA 2H4YB 3DOMB 3HHDA 1XMBA 5C25A 4RZRA 4OL8A 1NLKL 2PFFB 4RU9A 2K7JA 1S1TA 3H0PA 1S6PB 3Q8UA 2PEBA 4I64A 3UN2A 5F9LA 1UVLA 5D4NA 3D4JA 1HL6A 3RBXA 3F0NA 4DR4F 4B9SA 3CCVS 2KVQE 5HLFA 4ELTA 1UWAA 2V8PA 3QRPA 1CLFA 1MROB 2J8AA 4F4ZA 4JI8F 4PRFA 4MKAA 1LW0A 3T41A 4JV5F 1KQGB 1YK9A 2UZAA 4WPAA 5F3TA 8RUCA 2ZEJA 1TL7A 4X4RA 4C97A 4CLYA 3RAXA 4OYOA 2HEKA 3AA9A 3BBBA 3OTEA 3UCZP 3NNCA 3R2CJ 1SQGA 3HJVA 4ZPWR 1AT1B 3W2VA 2YH1A 4MKVA 4ZVGA 3CJ8A 1TL3A 4IG3A 4N5SA 1JMTA 4NA1A 1F60B 1WG1A 5LL6d 3TNVA 5DGBA 2OPRA 3RAQA 1CJTA 2LQBA 3Q83A 2J0QD 2M3DA 2ZH6A 5ETSA 3PFEA 3M8QB 4ZN3A 2HQGA 4F3MA 3SQGA 2H5JB 2L9DA 2X1FA 3M9NB 2OHDA 3IAM9 4KAIA 4DG1B 5EWGA 3IWNC 4IH6A 1K9MT 2HVIA 3TOQA 4C8LA 3EM1A 4TVAB 1LWXA 2OPSB 1SIWB 4ZCMA 2CPZA 5DDRC 4DR1J 3OR1A 3QIPA 4ZJLA 2EPIA 3BGUA 2ILZA 3DFEA 1L5UA 3OTOJ 4IUFA 1BWEA 3DU6A 2D69A 2M88A 3HHEA 1GMUA 3TUJC 3BGOP 4M5LA 5DJBA 2VHGA 1SJFA 3BR8A 1TV6B 5KFHA 2BKPA 3I5BA 2DGUA 3VZIA 1S0MA 4H4OA 1HNVA 2OELA 2CJKA 2MKJA 3MMJA 2BQ3A 3NXZA 1Y11A 2QE5A 2WB1D 3CGIA 1P1TA 3PRDA 1QD1A 4N8OA 4NL5A 2IYGA 3SCJE 3M9MB 1HWLA 1WEYA 3H8YA 3M8QA 5IOLA 3WIVA 4K7QA 3OT9A 3GV5B 1HBOB 5CXTA 2VASA 4B9UA 3K0JA 4K4XA 1SL1A 2BJ8A 1H3DA 1N5TA 3WX4A 1YVFA 2Z8QA 1WG4A 2LEBA 4DR2J 1NH8A 3DGPB 2B6AB 3M7VA 5CHCB 2XY5A 1S1VA 1ZPVA 2CPEA 3Q8PB 1L3SA 3DRYA 1NDCA 1C4CA 1M5SA 3A1YG 2AU0A 2Y8WA 2YNIA 3M8WA 5GAEU 1UEVA 3CULA 4FXDA 3D5MA 1FRIA 4RUBA 1RT1A 5D15A 1MN9A 1V5IB 5B0AA 1S1VB 3JXOA 2V6AA 4OYIA 2L08A 1VJWA 1BGXT 2DISA 2VIHA 1FE4A 1YJRA 5F0WA 1SL0A 3W9JA 1KS2A 1RBOB 3DRSB 4ZLPA 1AZSA 3DXSX 2C2DA 1VC5A 1AYEA 4NLYA 4NOHA 2CYYA 5HN0A 1X4BA 4WIQA 3MECA 5HSPA 3AOCA 1RI7A 5DGAA 2VJVA 2V34A 2HK3A 3MMAA 4J9RA 3GIKA 4OHYA 2BW2A 3F56A 1UWBB 2XMKA 2BX6A 1MU2B 2A6MA 3TZYA 1Z2LA 4Y2AA 4WZQA 3NAHA 1RZMA 1NB2A 3TAMA 1IR2A 2YX7A 2RDJA 4LQ3A 1O0PA 4A8YA 1HI8A 5HMZA 3PW2A 3ELHA 1DAXA 4Z7CA 4ZP9A 5I42B 1UZHA 2F65A 4MFBA 2HK2A 4JUZA 1DHMA 3V2UC 1P9QC 2BE9B 1X4DA 1LWEB 1SJQA 2NXUA 3FCVA 4YFUA 3CJTA 1T9XA 3PKMA 2KXFA 2L48A 2QGFB 2DO0A 4OQJA 3H5XA 3CCTA 2ZITA 4AL7A 4DG1A 1TKZA 2QJ3A 1OJ4A 1PYSB 3OW2R 2ZH1A 3Q89A 4GC6A 4QU6A 2Q43A 1YJVA 4I6WA 3U1NA 5A0YB 2XQCA 2ZHBA 4DR2F 1VBYA 5M2RA 1CVJA 4RL1A 2WVFA 3WZ0A 3PX4A 2XNQA 1IKVB 3HO1A 2CQ2A 1FNXH 1GQEA 4MKBA 5MLCV 2R8GA 4C0HA 4JI4F 5E2QA 4LF9J 1U7LA 3DGPA 3K7RA 5B08A 5CZXA 1H72C 3QAEA 3CCWA 3IAS9 4DUYF 2KTQA 5HVGA 3JYTB 2P2CB 4LIWA 1FXRA 2OD6A 3CJ2A 1X9WA 2NSBA 4LF8J 1KWMA 4I2QA 3HVAA 1TFYA 4KGXB 2NCKL 3HULA 3LUYA 4GO5X 1NHVA 1X4HA 1ZM2A 2FGOA 4C8MA 3BYPA 3MPVA 3NY0A 4J9UE 1ZTTA 2HMIB 3DMJB 2KJVA 1S1TB 3BKUA 1F3VA 3PNIA 2EFGA 4UOCA 4K4YA 1YITS 1JK9B 1WUUA 2GMJA 5K8NA 4F8RA 3CVKA 4OHZA 5KTQA 1YJTA 5KFZA 5IT9U 4TKTA 2IBKA 3W64A 3JSRA 2M4MA 3MM7B 4ZHRA 2RRNA 4R5PB 3CXCR 3KK2A 2GCFA 2QA4S 2QMWA 1I6JA 3I82A 1TFWA 5LMNF 3FCWA 1TVRB 4YUDA 2DR5A 2F9DA 2N3OA 3ETOA 2HVEA 4NCGA 2V2VA 3DXBA 4ZITA 3RB3A 2DH7A 3D3BJ 1GTEA 2HHUA 1JJCB 2HNZA 2GVZA 2E7XA 2F4FA 2DBBA 1TUWA 4ECQA 2HQIA 2HVDA 4H4KC 3E01B 1RA6A 2HZAA 2KZMA 1IBCB 5C5JA 4C2MA 3PRBA 5KFLA 1VQSA 4CTAA 3IBFB 3MR5A 3KJVA 1B70B 3GP9A 3CC2S 2ERRA 4PWUA 4DWIA 3OQ2A 1VDHA 4NASA 2C28A 1KTQA 4YB7A 1TL3B 3CCJS 1C0UB 1WEXA 3R5GA 1KLNA 2CRLA 1EJ7L 3NL0A 2W4CA 4B3MJ 2LXIA 1FX2A 1U8WA 3D1HA 3KFWX 3B8HA 1YHQS 2VPXB 2AZ3A 4C6AA 1K1QA 1RAHB 2ZE2B 3DOLA 4TY8A 2QFIA 1QSLA 4U67Q 4LF5F 3AJ2A 2ZKUA 3BYRA 3QWUA 4JI6J 2JLEA 1T05B 4KGMA 3HXMA 1U26A 5KFOA 4WFXA 2MKKA 4C9DA 2FVPA 4LFCJ 1QVGR 2YKQA 2DEIA 4KPCA 4YDXA 3B4DA 4NLXA 2NXJA 4GMKA 1RT7A 1RUSA 1HBUA 3VGUA 3R5DA 2E7WA 4NLQA 1QUPA 2HGNA 1TKTB 2CUYA 2JJ4D 2WOMA 4IFVB 4ECUA 1ZZFA 3PIPQ 1I3OB 3B82A 3SI8A 1GMWA 2HAIA 2J0WA 3FFIA 5B0EA 3DLKB 4ZVEA 5KG2A 1SQFA 4RBUA 2IC3B 5IC4B 3MCOA 3H25A 4K8RA 1EQ0A 4C11A 2EBGA 1VBZA 1FDBA 1T94A 2CWXA 1J5EJ 1IVZA 1NSAA 2KI2A 2MSSA 1OSDA 5B7WA 2MLZA 3MWBA 2GHPA 2MZSA 4UTGA 4I2PA 4GKKF 3FSXA 4QWCA 3P8BB 3GV8B 2BJ9A 3RR8A 1S77D 2DNKA 3V4IA 4BHQA 1KC8T 3PO5A 1D9FA 2V67A 1OS5A 1G6BA 1SH3A 3C15A 3CJKB 4NXMJ 3OVAA 3JSMB 3U1MA 1WJ9A 2N7YA 1UA1A 2VF3A 3PIOQ 2MKCA 1GNKA 3SFUA 3G8QA 3MEEB 3QMQA 4DMZA 4ELVA 4M5IA 4B3SJ 5HAOA 2IJNA 1CULA 2V63A 5KFAA 1FXDA 1IKWA 1GAOA 3DDNA 2W7PA 4PWDA 1REVA 3H90A 4USHA 1DBDA 3MM6B 4YQWA 2XYGB 3ZNUA 1C1BB 1Y7PA 3QT6A 2VC1A 1B7YB 4RW9A 3QRQA 2AIRB 4DFPA 2V50A 1S9FA 2JVRA 3M8ZA 2Y0BB 1NK5A 2QLJB 2NXEA 2MKSA 1VRTB 4PR6A 3THTA 1QDUB 2E5JA 3DM2B 3W5XA 4EGLA 3OSNA 1T03B 4W90B 4LBPA 4QIFA 1FDAA 3TVYA 2MY8A 3ILIA 2I2YA 2NPFA 4B3OA 1U09A 2KDOA 2DNLA 5KFMA 3G6ES 2EVZA 3IFEA 1RISA 4ELUA 2FJDB 4DSIA 1XBWA 2B7BB 2IFXA 3W5ZA 4RNOA 2RRBA 2YQ0A 2B0GA 2XWXA 5DDOC 5A8RB 3OL7A 3T1YJ 4TN2A 1RU1A 2AV5A 2IA0A 2NREA 4LF6F 4DR7J 3OTCA 1RA7A 4QZVB 4DZ6A 1NJXA 1HNZF 4Y2IA 2EC2A 1U45A 3ADAC 4U7UD 1N5QA 4M5DB 2W2PP 4V19J 2E9TA 1UVNA 2BJ7A 2HVHA 3PW4A 1RWNB 4JI7J 4RW7A 4ICLB 4ILLA 4PUOB 3QNWB 2BMBA 4F04B 2FQQB 2W2NP 3FDSA 1XN9A 3DNCA 2G2ZA 3GZ7A 2DR6A 2WAQD 4RWXA 3HVWA 4XTTA 2DR7A 1G7CB 4F0MA 1S1WA 2BE2B 1W2BR 2E1CA 1HPZB 1T0TV 3O6QA 1FK9B 3HF5A 2GHVC 3M8PB 2B51A 1N8RT 2HKEA 2Q79A 3KJNB 4DPOA 1DQAA 4MAKA 1TMJA 4QWEA 1KNZA 2GMHA 3OL9A 1VIXA 2JNJA 5K8MA 2Z2MA 2BE2A 3P3DA 5F8NA 1S57A 2J9DA 3CMQA 1S12A 4KHRA 3TO8A 2FIUA 3MCNA 2VA3A 5HBMA 3WHIA 1GX6A 1JLQA 3N28A 1TP7A 4LF9F 4PUOA 4LF7J 4FXWA 4X4OA 4RUHA 2C1EB 2RMLA 3CEDA 4LVNP 3ET6A 3EE3A 3JTPA 2VDIA 4O4GA 5GADU 5CH7B 3K5MA 2D3O1 1JIHA 1KONA 2XS2A 4ECWA 4ZDNA 1FKPA 3R97A 3ZNJ1 3PHTA 5HMXA 2VQFF 3R5JB 1IM4A 4K4ZA 4DQPA 3C15B 2VPWB 3OXFA 1VYAA 2P5VA 4G1QB 4K5RA 4MFBB 5IT9Y 2CQBA 2P6TA 2PT0A 3HVTB 3KXDA 4JI6F 4Q8EA 2E5IA 1RT6A 1NJIT 3MOJB 5HROB 1OY9A 1RHKB 3TWZA 1Q8KA 3WIUA 4CLFA 5KFKA 5E3AA 4BC9A 2DR9A 3NWRA 4JV5J 4AUKA 4C8YA 2ACYA 1N6QB 4Q2MA 2MKYA 1OMSA 3ETMA 4IO9Q 1SB6A 4PXCA 2U1AA 2R7XA 1W7WA 4WK3A 2X1GA 3GG1A 1U0HB 5LSLA 2KFYA 3BO3A 4NMXA 5K5MA 4FPRA 4DPYA 5J2QB 1VC0A 4IOAQ 1JJHA 2CAJA 5D0HA 3MMAB 1JLQB 4LF8F 3OR2B 2R8KA 2J7WA 1XTZA 3OTBA 1C2PA 4J9VA 2EI5A 2CQCA 2PN6A 4X4SA 2CWKA 1AXQA 2MQMA 2MTLA 1U1LA 1VK8A 1RT7B 4Z7YA 4QPTA 1IR0A 1LQ9A 3OFGA 3M8SA 2QA4G 1F6TA 2DHGA 3UVJA 1N48A 5DM6Q 1N0UA 3M2RA 4Y28C 4DV5F 4UF4A 4ZPCA 2FPHX 1E6YA 2QX0A 4RR5A 4EFAC 4URGA 3KK3A 2BQRA 4F36A 1YRUA 1WI6A 4OZ2A 1GK8A 3KLIA 5HVFA 1XWLA 3QZ8A 4P2SA 4DL4A 4DUZF 2O3DA 2UUTA 4B02A 5AE2A 3CMES 2V4RA 2OLWA 3OV7A 3GSIA 5HP1A 1PSDA 4DR4J 3AD9C 4L74A 4DQSA 1MMDA 1RAJA 1DQ8A 5DQIA 1RAAB 4CO1A 3DLKA 2W2QP 1R6VA 2W25A 1FHTA 1JJ4A 5H9FJ 2RQMA 4CLLA 3SXLA 3TA0A 1PKUA 1VQNS 4DV0J 5J2QA 4LFAF 2GVDB 3N9UC 4MK9A 3EDQB 1MWZA 5HQMA 3BQ0A 1FF2A 2ZD1B 3PYDA 4TNOA 1WC6A 2CJYB 4W98A 3K5LA 4IRKA 4ECXA 4ED1A 2IRXA 3D6MB 3JSBA 4H4OB 4USWA 3BS9A 4Y2KA 5D0GA 3FNNA 4C48A 4USJC 5KFJA 1NHUA 4F4WA 4DLGA 2CNKB 1KHVA 1YI2S 2HW3A 2GAGC 3BPDA 3CD5A 2R7UA 4BLGA 2FVRA 1J5OB 3K17A 1PC5A 4XDDA 3MFHA 1K8AT 2KM8B 1UP1A 4B17A 1ZYQA 2J6TA 1Q7LB 1FFWB 1NPPA 3WC0A 1OQ3A 3GIMA 1U02A 4AL5A 2IM3A 4KGZB 4LRBA 5E3QA 4AYBD 2W7OA 3WBZA 1N88A 3CD7A 1KQSR 2GV1A 4N76A 4M5NA 4CYUA 2C42A 5CAAA 2HHXA 4O4GB 5JVHQ 4KGVB 3U1LA 9RUBA 4P7VA 2W8KA 5LMUF 1J5EF 2X1AA 4FYXB 4CDIA 5F9NA 1E6VA 2O01C 4LRDA 2DNHA 1KKHA 1RT4A 2XI3A 3C6UA 4ID8A 2YKMB 5JMNA 3KLEA 1RTHB 5IC6B 1RT3B 5FDLB 2KT3A 2F3JA 1FNMA 3DYAB 3NEKA 5AT1B 3RUBL 5BJRA 4J9QA 2BKOA 3BGLA 2H4WB 2W4PA 2YWWA 1PAEX 2YKOA 1YRXA 2GO8A 2VC0A 3AODA 5GMDA 2DRAA 4ZVFA 2VDHA 2IIHA 4JB8B 2J6SA 3FBBA 4RW6B 3C3LA 1S97A 2RB7A 4IRCA 4NLWA 2VQEF 1R8HA 1FRKA 3NOCA 4NA2A 1FJGJ 4ZHRB 5E7OB 3EGVA 3N01A 1QTMA 3CE8A 1HW9A 4USIA 3BGRB 4AXJA 1WDDA 1H7WA 1PBAA 1Q8LA 3T5KA 1BUXA 1RCOB 5D3GA 1CG2A 4JI5J 2AJ2A 3UNYA 4UY8T 1AFIA 3O1LA 4P9SA 1Q86T 2VG5A 1S4FA 3IMQJ 4TQSA 2F9JA 3BGRA 4K59A 4OLPA 3R9LA 1BXNA 1VBKA 4EBDA 3HFVA 3AXKA 3HFKA 4TXSA 2ZM6F 1RJJA 4RW8A 3K8VA 1RWXB 3MMCA 4DR1F 7FDRA 1NCLA 1OO0B 3I56S 2RS2A 1T3NA 3PW5A 3UD3P 3CIZA 3CDAA 4A8QA 3ISNC 1A0OB 1F0XA 2EBEA 4EU0A 4OV1A 4FF2A 3D0HE 3OFEA 5DZ6A 4DPUA 4C8ZA 1AROP 5EWEA 3P5BP 5I3UB 2ZBIA 3BREA 4BCAA 3MUVP 1I94J 2LA6A 5JUMA 4DUTA 3ILLA 2L9WA 3L9ZA 2QL7B 1FO1A 2AJFE 5DRKA 4LF4F 4L6V3 3MM5A 3M6XA 4KTQA 2AZ1A 1RTDA 2IVYA 4WE1A 1ZM9A 2BJEA 1ICEB 1JNRB 3D68A 2NR0A 1AZSB 2EKNA 3K59A 1R8CA 1X8DA 2C2NA 4LR7A 1DJ0A 2CPXA 5E3PA 3HP6A 3B78A 3MEKA 5J2PB 3OTOF 1S9EB 5KG0A 2FVQA 1HYSB 4NWBA 5K14A 4B3MF 2XTJP 2AGOA 3NCRA 3V4IB 1NO8A 5KFTA 2DXDA 1JLAB 1SUQB 2F7VA 3BGFA 2Y1IA 3VVUA 2HGMA 2CPDA 3OPKA 3MDFA 3ZZTA 2ALYB 4X64J 4K4SA 1U6FA 2XO6A 3RW7A 4CLPA 1RKJA 3TVKA 2UU9F 3SDEA 2JWNA 2VQEJ 4USUA 5F8JA 1JLGB 1FWLA 4DL0C 4DR5F 4RNHA 2VQFJ 1RWMB 4DV3J 9ATCB 5GAGU 1CS4B 2KYZA 1HNIA 1UVJA 5KFXA 3MXHP 5IQ6A 2AJ4A 3JTOA 1VCTA 1X5TA 1FVQA 3TJAA 3DGVA 4ZVHA 4ZVQB 1VR6A 4BBYA 2CPYA 5T14A 1S6PA 2W7AA 1YJUA 3R6LB 5E41A 4K4VA 5KFEA 2E44A 2LDYA 2AJ1A 2QFJA 3T1HJ 2RILA 3I5CA 1M5PC 3FMWA 5KG6A 4QYZK 1TTHB 3GPAA 1FJ7A 1DLOB 2C2OB 2CVEA 4WJBA 1H7XA 2GIFA 3AAWB 4QU7A 1Q0NA 1UMJA 5SUHA 3NKYA 3IR7B 4OX7A 4B9NA 4KHPF 1BQMB 1X9SA 1IBMJ 1S59A 3C19A 1SC1B 5J2MA 4DX5A 1RYSA 4DSJA 2R7VA 3FEXB 4DR6J 1I1GA 5L1KA 4CH7A 2LXUA 1VQ6S 3DLEB 2ACMA 5E33A 2VICA 1JLFB 2YTCA 5A2QY 1YJ7A 2V68A 1IKXA 2QL9B 2V9WA 2OPSA 2PFDA 5KFDA 3C16A 4GVLA 4QIWD 4NLSA 2DHHA 2IJRA 4WTOB 3CF5Q 4ER8A 3M1VB 1S1UA 3W9HA 1MWQA 1AUDA 2HHHF 1FJEB 3DLLQ 2Z2LA 4K4WA 4CO0A 4NLTA 4WIIA 1ZAVA 3T1AA 4ANCA 1Y5NB 3B6BA 3MGJA 3OR2A 4ZPTR 4ERDA 2NS1B 3ZZUA 2FC8A 2JFKA 2QYCA 5ETVA 4I0WA 4MMOA 4A46A 2GW8A 1QSYA 2QEXS 3T6BA 3ENQA 3KG0A 1J2VA 4J9NA 4MK8A 3SV4A 1SPBP 4C8OA 4ECSA 1XIQA 2DY1A 1NUEA 3Q24A 1U2CA 3P96A 4PAAA 1TUVA 2W2OP 2Y9HA 5DG8A 4GKJJ 2AJQA 4HKQA 2P9CA 3I96A 2HFUA 1RLCL 2DPIA 4OI2A 3CJ0A 2XLIA 2R9LA 5ETOA 3GE9A 4OYWA 4Q45A 1DQ9A 1B99A 1V3SA 2W24A 3BN4A 4MIBA 5A6WA 2RQKA 3HMJG 3IM9A 5AXLA 3OVBA 3R7NB 3GLJA 1K0TA 3FKBA 4HDGA 2QZ8A 2B8PA 1U1OA 4Y00A 3TJ9A 3RR7A 4P73A 5A2QU 2ZWPA 4LFAJ 2FLPA 2FLOA 4Y6IA 5EX0A 1ZETA 3D1QA 5EDWA 3PY8A 2BE7D 3CDEA 1X5OA 2CA9A 3DDKA 4XAKA 1DY3A 1S49A 2RKIB 3FGVA 4YR2A 1U48A 4KO0A 4O44B 1E6YB 5U47A 4A8MP 1HI0P 3FJ2A 2RHSB 2PEHA 1IBLF 2VZ9A 1EB0A 2LDIA 2ZBPA 2Q6CA 3ZXWA 1N5SA 5KFRA 2ZH9A 2H48B 2M9KA 2OSRA 3R27A 5KFYA 1Q82T 1RQ0A 2DNRA 4NLUA 1RK8A 5A0YA 2VFVA 2VB6A 5J2NB 2VG6A 4DU8A 5KFNA 2R4FA 2G13A 3HHKA 3OHAA 2W9AA 2VOPA 1U8SA 5T41A 4C3KA 1IR1A 1OYEA 1NH7A 4FXVA 4JYAF 4Z2XA 3IWXA 2FJVA 3M32B 2ATLA 5GMEA 3HD1A 1WC0A 3EGNA 4M63A 3UVJB 4CLSA 4Q44A 2DO4A 3RAMA 5HI7A 2NZ4A 3M30B 1XR5A 1BQXA 3A8JA 4RBVA 3NGRA 4UUXA 1WC3A 3EGZA 4ED5A 3ZZZA 3GILA 3QJLA 1XNQF 5KT3A 1U0HA 4OZNA 3GFYA 2XMTA 3PX6A 4XDCA 3RZAA 1REGX 1JX4A 1YQHA 4NLRA 2LFVA 3GJTB 2OO4A 5GAGI 2EG1A 4CH0S 2JRSA 5L1JA 1M1HA 3RRGA 1H2UX 3D9BA 4P2XA 1ZOTA 2LU1A 2GIRA 3DCAA 4V19X 1YSJA 3AH6A 3MEGA 2RU9A 3ONQA 2YVSA 1KVKA 2HFVA 4CLWA 2XY6A 3JB9k 3AY0A 3MOZA 3UD5A 2XYPB 3OHBA 2CZ4A 2WHOA 1VQ7S 2BANB 2KHCA 2CQ0A 2KRBA 2MLXA 3KG1A 3VAHA 1FRHA 2I1RA 3KKFA 2FZCB 4WP8A 4ZVTB 4LF4J 4X4UA 2Z2ZA 3AT1B 2B4UA 3DRPA 4IYQA 4DOZA 4HT5A 5IT0A 1FXLA 3GMGA 3N5FA 1B3TA 4X4NA 3QFHA 3VR1A 4QJVA 4P7TA 2LYVA 5ETNA 4YMEA 2DGQA 5ETRA 3PXGa 4QIVA 5ETQA 3R2DJ 2RNEA 3M30A 4HH1A 3UDCA 2OFGX 1DTTB 2Y1RI 5I3PA 5KFPA 2DCUB 1WF0A 1FI4A 2ABYA 4FKXA 5IQQA 4RBTA 1RP5A 1JLEB 4U9RA 3AD8C 4CIOA 2OMOA 1S72S 4OX9J 2GS8A 3IG1B 3PYFA 5FLXU 2E9ZA 4DV4J 1SKUB 2DD8S 4R8UA 1N54B 2AKWB 3BH7B 4E98A 2KXNB 3CCLS 4DV3F 1U1MA 4JI8J 3TR5A 2C2MB 3ZO7A 3DDIA 2IM2A 4U7UK 1NMEB 2B9YA 3G6XA 3EPGA 4B3RJ 3ISZA 4ID5B 3VGSA 2PE8A 2PD1A 3OLBA 3ZZOA 3FRYA 3R3TA 2JH3A 3SFGA 4QR2A 2UV8A 8ATCB 2HNDB 3OUYA 2XO7A 3MTKA 2JEFA 4F4XA 2UUCJ 1VBXA 1HNWF 1DARA 1VIOA 1YBAA 4RWWA 4PG8A 4XK8C 5CCLA 3PZPA 2C22A 1N34F 1RAGB 2DGSA 3GJSB 3CCQS 3ZZ0A 1YJWS 2GGPA 1R8BA 3V81B 3LH2S 4TLRA 1T9TA 1SV5B 5BYRA 2YQ3A 1YZ6A 2GFFA 1RBAA 3G6VA 1IBKF 1T05A 3MD1A 1SH2A 4F7VA 2ZNYA 4WWSA 3H4DA 2DRBA 2J6UA 3HLUA 2PSZA 3MR7A 4NPOA 4ED2A 3M4XA 3V81A 3D6HB 2MKIA 2DGTA 3QJPA 3JQJA 2DNMA 2N4DA 2A3JA 1BHNA 2HQ3A 2YWHA 1XMQJ 4OHXA 3F41A 1V6HA 1OY6A 5EWFA 4A8WA 1HQEA 3NWGA 1EX8A 3BPSP 3KNGA 4ZCIA 4B3TF 2BW7A 3MPUB 1UJ6A 4MIAA 3RW6A 1HKAA 1H2TZ 2HBQB 2IDEA 3BF4A 2IVFB 1X5SA 2ZBCA 3GYGA 3IGNA 2W9BB 4K0KJ 1EKSA 4A8KA 3HHLD 2UXCF 3SEOA 1U24A 3PM9A 4ECZA 3D6TB 4KSEB 2QA2A 4WFAQ 2D3OR 4DL2A 2KJWA 3W3SA 4J9LA 5A8WA 4X4VA 1HA1A 2BRLA 2V0NA 4AL6A 2AF6A 1RHJB 2OAUA 3FSYA 3FZBA 2DNNA 4I2PB 5I3QA 2GO9A 1NK8A 2X51A 1VFJA 1D3WA 1HARA 5FD1A 1RCXB 5KFCA 2HLTA 2FTRA 2A6OA 4DX8H 1S1XB 3SYZA 1NSQA 1RHQB 4UOFA 1EP4A 3P4UB 4B9TA 1BQNB 1BQMA 1LNQA 2WVCA 3EVWA 3GFZA 4OX8A 3R8YA 2V4QA 1K0VA 4O44A 1LOUA 5THWA 4QWBA 2MKHA 3I0SA 1OPIA 2IPOB 5E0OA 3DI6B 4OI0A 1SL2A 3W60A 2FLLA 1FJCA 1GXLA 3OVSA 2XULA 4A8XA 5IM0A 1S4EA 4GKJF 2WTFA 4V1Ak 3OFFA 3QSYB 1IJFB 4TU8A 1Y00A 2PC6A 1T8EA 1X31C 4OYMA 4CT8A 4F2RA 4DV5J 2VFRA 1SC3B 2JDJA 1OIAA 2QSWA 1SKWA 4XIUA 3KK1B 2E7VA 4U96A 3T19A 1V3ZA 4CQ1A 3UR0A 3E51A 4WFYA 5CD4A 2LP4A 3LP2B 1MN7A 3KDNA 1C1BA 1VRQC 1C0UA 2ZC3A 3K8WA 1JLAA 3BSAA 3O8WA 4PG6A 5JXSA 4DPTA 2Z4PA 1X0FA 2AWZA 2BABA 2CFXA 1TELA 4I4BA 3C66A 5HANA 3M1VA 3Q2SC 2HZCA 5IT4A 2QMXA 4ZVPB 4NLVA 5BR8F 2AYBA 5DLFA 1Y4ZB 1S0OA 1LWFA 3VQTA 4ZA1A 4ATNA 5C7PA 3MCSA 2UXCJ 4EBCA 2AHOB 3AHPA 4O0NA 3S01A 4A8FA 4QIEA 5CYQB 4X65F 3UDEA 1T9VA 2K1RB 1OYDA 4ZP7A 2BKNA 3CMAS 3W8PA 4DV2J 4IOCQ 1R0AA 1Y0HA 1X4FA 2WSCC 2C2RA 1GH8A 2F63A 5BYSA 3ENVA 2AT1B 2XGQA 1XNRJ 4LFBJ 4DL5A 3GWCA 5DQGA 3KMQA 2B8QA 3NS7B 2J7KA 4J7CA 1RKIA 4Q7AA 1NK0A 2QTWA 3QGPA 1RTIB 5HO4A 3K5OA 1SJRA 2C2EA 4U95A 3D2WA 3FFIB 3ZTPA 2PMWA 3IS9B 3W9IA 4LRCA 1GX5A 2HYIB 2UVUA 4RW7B 3CDUA 3M8RA 1PJ5A 4JYAJ 1P8GA 4CT9A 3EMTA 1KOHA 2V69A 2CQDA 3FEYB 4DSFA 3B54A 3UDVA 4EK2A 4I6AA 5HQLA 4ZCKA 5DETA 5CYJA 1QAXA 4NI2B 4FKYA 4PG7A 3PG9A 4WYWA 2XGPA 2DNQA 1HWUA 2EWHA 4FP9A 2KZZA 1R3NA 4OHWA 2Y1LB 1Y9OA 5H9FK 4DDFA 2KG0A 1SVDA 4B3OB 1TK8A 4TY8B 3QGGA 4IRDA 1LFPA 2V2ZA 5K14B 3OTDA 4ITSA 3E8OA 4M5GA 4OZJA 1KEKA 1P9YA 1IKVA 4MYUA 4C4WA 2FZGB 1JKHA 3RB0A 1NJYA 1D1UA 2EC0A 1TL1B 2NZCA 1RWPB 1REVB 5KFQA 1WACA 2AJ0A 1D9DA 3BDPA 4CM0A 2HZVA 1QY7A 1YX2A 2BANA 3T1YF 2ZH7A 5AJ3F 1ACMB 4ZKAA 2KT5A 3CIMA 2RDIA 3HHLB 4EO8A 3CCRS 3A12A 4EYHB 1LV5A 2HSEB 4F3OA 4KB7A 1S9GA 2HBRB 5L8RC 4XPCA 1NKBA 1I94F 1HNVB 1WORA 3SQOP 4CLKA 3N6MA 1FFSB 1S7IA 1TAQA 4X4QA 2V4JA 2UU9J 2JEGA 3TAMB 4NCGB 5F8GA 4PXEA 2OGUA 4UT4A 1LWCB 2MZQA 2BV3A 3AFGA 4WXWA 4CO4A 2DHXA 3EWGA 5L9XA 1QAIA 2XS7A 3C46A 2CVIA 4FNIA 4IO1A 4CLZA 2V5HG 5MAOA 3J7AN 1MMNA 3K57A 2LLZA 4NEZA 5CABA 5HMYA 3HHNB 3K5PA 4KH1B 2DR8A 3LAKA 3KK2B 1NAQA 1V5VA 4DL7A 5GAHU 3HT0A 1DLOA 3NCQA 1NRKA 2VG5B 4ZOSA 5EUHA 3JQMA 4JI1F 2AP6A 3LP0B 3QO9B 4DX7A 1UKUA 1N33F 4Y65A 2ZUGA 3A8IA 1LW2A 2L41A 2OI2A 1TKXB 2R7WA 1CC8A 3IGVA 2FJEB 4LSNB 1C1CA 3M6UA 4YOEA 2DNGA 3CB4A 1T9WA 1F9HA 4U8YA 4QCLA 4I67A 1SC4B 3MCMA 3AQOA 1TL4A 1PJ7A 3IRWP 2O1PA 4P72A 4YB5A 1IJEB 2YNIB 4OZ0A 2WVBA 1NU4A 3OBIA 3W2VB 3PW7A 3CPWR 1MLAA 3DRRB 5HMWA 2YWGA 3DI6A 4DBQA 4DFKA 2LECA 5BXIA 4USMA 2B6AA 5E3CA 4DL6A 2A0FB 4XPEA 4KR0B 2CXEA 4F3QA 1VQ4S 4L75A 3MI7X 3BN7A 2HFZA 1RT3A 5GAHI 1NKCA 2AW0A 4PXBA 1WHXA 1SQEA 2PA3A 4J9MA 2DITA 3CDBA 4HHHA 4N7TA 4ZPVR 4O3OA 3SCKE 2ZH4A 2E5LF 4P2FA 4HACB 1RT2A 4KBIA 4WYLA 1EETB 3NNAA 2R8JA 2UUAJ 4KKOA 2B4PA 2R3VA 3DLGA 3LPYA 3MAAB 5CQGA 4CYUB 2R7RA 2VONA 3BV8A 4R0EA 4CNYA 2YKPA 4LRFA 2D74B 2X7IA 3A3PB 3GJRB 3BKTA 3MM8A 3QQCD 4HI1A 1GFWB 1WKLA 2WZ1A 3N5BA 2WW8A 4JBCA 1E6VB 4ANEA 5I3UA 3G2XA 2HGLA 2HHPA 1MW7A 1HD1A 4JI0J 2N3LA 3DC2A 2XSJB 4IKAA 1SBRA 1U1QA 4F0HA 1L3UA 3EVOA 2F8HA 3FBFA 2LXFA 3H2VE 3RBZA 1KOOA 4ZJQA 2VKZG 1UL3A 3LOUA 4ZVRB 2OIHA 4EZ9A 1TVRA 3QIDA 1T02A 1B0VA 4LR8A 3NS5A 3UR3C 2EFPA 1JLCA 2IRUA 1JXVA 4DN0A 4PWDB 4L72B 4RUAA 3FRZA 4DPWA 1S5ZA 4URQU 3G96A 2ZUAA 5K20B 3F73A 1LXNA 1VHFA 2C3PA 1VMBA 2EFQA 1FFGB 6FDRA 2VU5A 4HACA 4E2FB 1WF2A 1Z1ZA 1D0EA 2RRAA 1RHMB 4KKOB 1S0NA 5A8KA 3D0GE 1QSSA 1S9GB 1WTFA 2MJUA 5ETKA 3TJ8A 4K50A 1RT1B 4PPZA 3KHGA 3TRGA 2XY7A 4IG3B 1FERA 3D7SB 1LW0B 3MAHA 3JS9A 3GONA 2NXCA 4ZMMA 2M8HA 4KFBB 3BM7A 5KG1A 5B0DA 2HHQA 3HPOA 4RW6A 2QLFB 4ID5A 4S0MA 2CQIA 4OV6A 4USKA 4ZP6A 5CZVA 1Q16B 5KAKA 1Z2ZA 3J7YU 1WSRA 4NXNF 4UOGA 2QO3A 2FHJD 3WC2A 3OL6A 1QLNA 4BC7A 4DR6F 2KN4A 2UXBF 5HLFB 4YY3J 1QJHA 2FJBB 3QFWA 4OJHA 4OJGA 3KJFB 3JAMU 1VQLS 1CJUB 3UWTA 2OTJS 1JLBA 2WONB 3TEGA 2ZH3A 4OYZA 2RJZA 2DHAA 3R7BB 4WBFA 2RF2B 2MQPA 1TKXA 2FY8A 3OFHA 4DV2F 3KUHA 3BSCA 1T9UA 4NI2A 2KHDA 3CUNA 4ICLA 2WVEA 4IH7A 3GYXB 5AXKA 3SMZA 3KLFB 4NCBA 4R0JA 2PDAA 1FVSA 2RU3A 1FKAF 2KT2A 2LA4A 1UFWA 2L9NA 2CKWA 3ILJA 2MJNA 3T5JA 3TQ1A 5I42A 2ZHOA 1WC1A 3I4PA 4K5SA 5JVGQ 3IN5A 4PQAA 4OX9F 4I7FA 1SUQA 2FZKB 3RG6A 5KFSA 5FLXY 2QV6A 1NJZA 1R0AB 2ASLA 4EZ6A 1FD2A 2FHJA 2K1RA 4HH0A 2R7QA 3VF0B 4YHHJ 1HR0F 4J91A 3H40A 2V4JB 3D67A 2KVIA 4H4MB 1TKDA 3U27A 1KR4A 4Q2LA 3VAIA 4DQRA 1AUSL 4O3RA 1F2HA 1KQFB 2VD3A 4NLDA 4CRJA 5KG5A 1HLWA 1APSA 3ITHB 4F25A 2J0SD 3DM2A 3SQGB 2R7SA 1XQIA 3AA8A 4DS5A 3D66A 2W9CA 2QA1A 2IVMA 4M5MA 3WX8A 2CJQA 3J7Z5 3PR5B 2VKRA 2CDRB 2Z57B 4JI5F 1TL7B 5C2CA 3R1HA 3W66A 1QUVA 2ZHAA 2IY5B 1JB0C 1VQMS 4FF1A 3T9ZA 1MSWD 2F8MA 3JAMY 1SJ1A 2FC9A 5KT4A 3R5CA 4GO7X 2M52A 1U47A 4Q0BA 1WC4A 3RJMB 1B7FA 4D3GA 4UY85 3P49B 2ZBQA 3A8KA 4Y2CA 3J81U 2HFSA 2GGPB 4ALZA 4PEOA 1IQTA 3RYLA 3V6JA 4G65A 5AE3A 4FF4A 1FK9A 1RAIB 4WCEQ 4QR0A 4M5DA 2YNFA 3IR6B 4F4YA 4PKDB 1CC7A 2KRRA 2GC8A 2RKIA 4LF2A 3RBEA 2UV8G 1HMVA 5CA5A 2JEIA 2I8EA 4NE9C 3POTB 4JV2A 5DS7A 5A8RA 2M5YA 4FVCA 3GQCA 4IFVA 4HTJA 4OLOA 2CG8A 1UCNA 5G0RA 5L46A 1RTZA 1NPKA 4Y0FA 3RTVA 3M05A 4K0KF 2AX0A 4HT7A 1HHQA 3MTJA 1I5OB 3IRXB 1KFDA 1ELOA 2HS0A 1H6KX 3V6DB 4JI3J 3QSIA 4CO5A 1D9AA 2YPZA 1N52B 1PCAA 1N4LA 3M2UB 5JJBA 1RAFB 2V8DA 3D3CJ 2DYAA 1RAEB 2FHKA 2PO4A 1EQMA 2BUNA 3QRRA 3TX8A 3DHWC 1IKWB 1IWGA 1UW4A 1VS3A 1LEOA 2PGCA 2ZE2A 3DOKB 4Y3CA 3UN3A 3IP0A 1UEKA 2YKNA 2ASDA 2PI4A 4DSLA 5KG7A 2KKHA 2YNHB 3G82A 4X62F 1X4CA 2UVRA 4ETZA 3BKFA 3CCSS 4DSKA 1IKYA 2G2OA 4Y34A 3D28A 2LVWA 1U2RA 2ZVIA 4HVZA 3KLGB 1HNWJ 2GQCA 1Q8IA 2ZZTA 1U2FA 2F40A 3TUZC 3LP2A 1Y5IB 3MR3A 3MEDB 1FRXA 2MMYA 3V6DA 3BEGB 1YJ9S 2UUAF 4NZ6A 1JWWA 2EFNA 3FQKA 4KIAA 4P6QA 4HHJA 2ROEA 2XZDB 3EPIA 2OMLA 3NGKA 3THVA 2PIIA 3US5A 5LJ5Y 2DCLA 3J81j 3EYZA 4NCAA 2LCWA 4DV4F 2D7SA 5F3ZA 2H65B 3SV3A 3FC9A 5D0EA 2AYGA 4PG5A 2ZJPQ 1NZAA 2L3MA 2HNYB 4AE5A 4WK1A 5J2MB
chains in the Genus database with same CATH topology
4DR4J 3R2CJ 4X64J 4LF9J 3J7AN 4NEZA 5LM7E 2VQEJ 4X65J 2VQFJ 4DV3J 2HHHJ 4DV0J 1N34J 4PWWA 4LF8J 4B3TJ 4JI2J 4YHHJ 2KL8A 1N36J 4LF6J 4V1Ak 5AJ3J 1XMOJ 2ZM6J 4DV5J 5IWAJ 4DR1J 1IBKJ 2F4VJ 3T1HJ 2MQ8A 3T1YJ 4LF4J 4NEYA 4DR7J 4X66J 3OTOJ 4DUZJ 5IT9U 4X62J 4JI7J 1IBMJ 3R2DJ 4DR6J 2UXBJ 3D3BJ 4HHUA 1XNQJ 2UXCJ 2MEWA 4OX9J 2UUAJ 3J81U 5FLXU 4DV2J 4DV4J 4KYZA 4JI8J 1XNRJ 4LFBJ 4KY3A 4DR2J 2UXDJ 4B3RJ 4B3MJ 4NXNJ 4DV7J 1N32J 4LF7J 4JI0J 2UUCJ 1FJGJ 4JI4J 4KHPJ 4JI6J 4JYAJ 4GKJJ 5BR8J 1HNXJ 4JI5J 5LMNJ 1N33J 2UUBJ 4LFCJ 4DR3J 1HR0J 4JI3J 3IMQJ 3D3CJ 5LMUJ 4JV5J 4DV6J 4DR5J 4JI1J 1IBLJ 1XMQJ 5A2QU 4RJVA 4LFAJ 1HNWJ 1I94J 1J5EJ 4DUYJ 4DV1J 4K0KJ 2MTLA 2E5LJ 3W1YC 4YY3J 3JAMU 1HNZJ 4LF5J 4NXMJ 2KVQE 3J80U 4GKKJ 2UU9J 4AQYJ 4B3SJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 J;  3R2C J;  4X64 J;  4LF9 J;  3J7A N;  4NEZ A;  5LM7 E;  2VQE J;  4X65 J;  2VQF J;  4DV3 J;  2HHH J;  4DV0 J;  1N34 J;  4PWW A;  4LF8 J;  4B3T J;  4JI2 J;  4YHH J;  2KL8 A;  1N36 J;  4LF6 J;  4V1A k;  5AJ3 J;  1XMO J;  2ZM6 J;  4DV5 J;  5IWA J;  4DR1 J;  1IBK J;  2F4V J;  3T1H J;  2MQ8 A;  3T1Y J;  4LF4 J;  4NEY A;  4DR7 J;  4X66 J;  3OTO J;  4DUZ J;  5IT9 U;  4X62 J;  4JI7 J;  1IBM J;  3R2D J;  4DR6 J;  2UXB J;  3D3B J;  4HHU A;  1XNQ J;  2UXC J;  2MEW A;  4OX9 J;  2UUA J;  3J81 U;  5FLX U;  4DV2 J;  4DV4 J;  4KYZ A;  4JI8 J;  1XNR J;  4LFB J;  4KY3 A;  4DR2 J;  2UXD J;  4B3R J;  4B3M J;  4NXN J;  4DV7 J;  1N32 J;  4LF7 J;  4JI0 J;  2UUC J;  1FJG J;  4JI4 J;  4KHP J;  4JI6 J;  4JYA J;  4GKJ J;  5BR8 J;  1HNX J;  4JI5 J;  5LMN J;  1N33 J;  2UUB J;  4LFC J;  4DR3 J;  1HR0 J;  4JI3 J;  3IMQ J;  3D3C J;  5LMU J;  4JV5 J;  4DV6 J;  4DR5 J;  4JI1 J;  1IBL J;  1XMQ J;  5A2Q U;  4RJV A;  4LFA J;  1HNW J;  1I94 J;  1J5E J;  4DUY J;  4DV1 J;  4K0K J;  2MTL A;  2E5L J;  3W1Y C;  4YY3 J;  3JAM U;  1HNZ J;  4LF5 J;  4NXM J;  2KVQ E;  3J80 U;  4GKK J;  2UU9 J;  4AQY J;  4B3S J; 
#chains in the Genus database with same CATH topology
 4TYA A;  1ZS6 A;  4MYT A;  5C25 B;  1BD6 A;  2XZW A;  4TU7 A;  3GCX P;  2HWH A;  2DGV A;  5KFI A;  1QM9 A;  5HAT A;  5D4O A;  4EYI B;  3PX0 A;  3RRH A;  2HUR A;  4WXO A;  1F9E B;  3M2V A;  2JX2 A;  3MAA A;  3DRX A;  3WDO A;  1U4B A;  2OFH X;  4R8U B;  1H38 A;  1N34 J;  4ZLJ A;  1OSC A;  3NBP A;  1L3V A;  1TMM A;  1GEH A;  5DDP C;  2WOM B;  1HIY A;  2E1P A;  1KLM B;  3L7U A;  1YIJ S;  1OPZ A;  4QR1 A;  3VAF A;  2JVO A;  3VCD A;  1FWP A;  3UCU P;  4NZ7 A;  4CO3 A;  2HPU A;  4LIR A;  5IWA J;  1Y3K A;  2DRD A;  5IFM A;  2WRM A;  2XCP A;  3NOG A;  1NHK L;  2ZZM A;  2XM3 A;  1F3F A;  3OJS A;  1J27 A;  4ZCL A;  2KH9 A;  4ZVU B;  1PIL A;  1JLG A;  1FD8 A;  2HRT A;  3MPD A;  2W9B A;  4K4U A;  1RWU A;  4RW9 B;  2B4O A;  3SCI E;  3ZZP A;  3CT9 A;  2BJ3 A;  4X62 J;  2H3E B;  1JXE A;  1YZ7 A;  2DJW A;  2D3U A;  3S6E A;  1EHW A;  4WFB Q;  1R27 B;  3PVX A;  5FJ4 A;  1CUL B;  2QLW A;  3FK4 A;  2BA9 A;  1FE0 A;  4QOT A;  4UOH A;  3HZG A;  3QPI A;  3G82 B;  2JLG A;  3UW1 A;  6AT1 B;  4LSN A;  4B9L A;  1HD0 A;  3LGH A;  4PCQ A;  2BR0 A;  3EZU A;  3ITH A;  3W2W B;  4OI6 A;  2IYI A;  3ZZY A;  4CZC A;  2GML A;  5K8P A;  2FVS A;  1U6B A;  1XNQ J;  3EUN A;  1QAJ A;  3PKY A;  3ZFV A;  1SC6 A;  4B08 A;  5HBM B;  3HM9 A;  1X4E A;  2YX1 A;  3Q22 A;  1OY8 A;  3HSG A;  4DZD A;  3CJ5 A;  4RNF A;  2DNP A;  2Z58 B;  2E5H A;  4KYZ A;  2E9R X;  1NSP A;  2G4B A;  3VVT A;  2ZZN A;  1BC6 A;  3N79 A;  1U1K A;  4KV8 A;  4FS2 A;  1NK4 A;  4OFZ A;  1QE1 A;  2GIQ A;  4CLT A;  3I4H X;  2HHS A;  4EMD A;  2E66 A;  3ULH A;  2CDQ A;  4J9K A;  5A76 A;  3MPY A;  3RB4 A;  1NXI A;  2UVV A;  2W4D A;  1UVK A;  2OEM A;  2IC3 A;  2XMV A;  4WZM A;  2U2F A;  3HVR A;  4B3R F;  2QLB B;  4J9P A;  3TUI C;  4DX6 A;  1O6X A;  4QYR A;  1R8A A;  3AB2 B;  1JLB B;  4RUC A;  1R8P A;  2VFU A;  3D1O A;  2R2T A;  1X5P A;  3MUM P;  1HR0 J;  4DCP B;  4J9O A;  1DUR A;  3EZO A;  3PFO A;  2EFV A;  2XB2 D;  1EET A;  1YKW A;  2FB0 A;  1BLU A;  1JLE A;  1ZTW A;  3IG1 A;  2EKY A;  4LSL B;  1RWW B;  1SIZ A;  1LKZ A;  2Z56 B;  3H2U B;  6FD1 A;  2J8S A;  4DV1 F;  2FDN A;  3NMA A;  1JQG A;  2LKZ A;  2XG8 A;  4ZPD A;  3MD3 A;  2V2K A;  3NCP A;  4LRE A;  5AE1 A;  3JYT A;  4LSL A;  4FN5 A;  4A4J A;  4ZIW A;  5HJY A;  3LGM A;  4HL9 A;  4P2M A;  2AEJ A;  1WOS A;  3DRR A;  3D0I E;  3Q8Q B;  1YG0 A;  2CNL B;  2VJU A;  3GR0 A;  2CQH A;  2NLW A;  5D4L A;  5KT6 A;  2AYE A;  1O51 A;  5D77 A;  2FHM A;  2MQO A;  2ZH2 A;  4J9S A;  2X1B A;  4ED8 A;  1FTC A;  3QJJ A;  1H73 A;  3LQV A;  5KT5 A;  4QWD A;  3C2P A;  1G2E A;  4DF4 A;  1RAB B;  2CPJ A;  5FII A;  3QT5 A;  3GII A;  1Q53 A;  2GJF A;  2RH3 A;  3CD0 A;  4FYW B;  3V6H A;  3J80 U;  1K73 T;  4X66 F;  3T3F A;  1V9O A;  4DFM A;  1VLO A;  3TUP A;  3PJ9 A;  1EZZ B;  4UST A;  5ETM A;  3HK2 A;  2VPY B;  1MWY A;  4M94 A;  3AJ1 A;  3FQL A;  3CCZ A;  3U7J A;  2ATC B;  3TI0 A;  4PQU A;  4OZ5 A;  3UDL A;  1OQ6 A;  3IA0 A;  4QPX A;  3CCE S;  2CG4 A;  2R2S A;  4YS2 A;  1N5Y B;  2PI5 A;  3LW5 C;  3NRB A;  2OEJ A;  3R5A A;  4NYO A;  2DIU A;  3MEE A;  2IM1 A;  2HHW A;  1RE1 B;  2J9E A;  1S1U B;  4KGK A;  2E1A A;  3H59 A;  3KJQ B;  2CJA A;  3DLG B;  3QIP B;  4IH5 A;  3Q0A A;  2ZOG A;  4QIG A;  4B3T J;  2CJB A;  3CJK A;  3M32 A;  3LGN A;  4G6V B;  4ZVS B;  1U0S A;  3GSD A;  5L39 A;  2W01 A;  1WHW A;  1FKO B;  5G4D A;  4W4M A;  4ILM A;  4L3K A;  2FYX A;  2E1M C;  2H1Y A;  5ETP A;  5IV3 A;  1IBK J;  5F41 A;  5IZH A;  4YR3 A;  1YRT A;  3MHY A;  3FMB A;  1ZBT A;  2Z30 B;  4X66 J;  4ZJO A;  4DUZ J;  3HZE A;  5B0C A;  4KO0 B;  3PV8 A;  2FJW A;  1ZAW A;  1UAW A;  2HAF A;  2HIY A;  2YBV A;  4J90 A;  4JI0 F;  2LQJ A;  2YX4 A;  3MMB A;  5ITH A;  3BO2 A;  2HS3 A;  5F8M A;  1WC5 A;  2DNY A;  2I5J B;  2DXE A;  2GAH C;  1X60 A;  3H2L A;  3OXL A;  4FYY B;  4D3H A;  3MPW A;  1NSK L;  5HP1 B;  1Q5Y A;  1M1K T;  2DK2 A;  1WD6 A;  2FHO B;  2MHE A;  3EJM A;  3O3L A;  5H1S V;  2ASJ A;  5D8H B;  3JTN A;  3CSK A;  4M8L A;  3S1T A;  4ECR A;  1RT5 B;  2WVD A;  3R5B A;  3ZTS A;  4USV A;  1S6U A;  2M8D B;  1FKO A;  1S79 A;  1NDK A;  2MEW A;  2D3Z A;  1IBM F;  4NLG A;  1RWV B;  3CC4 S;  3KUG A;  1CS4 A;  5AXN A;  1CPZ A;  5CYM A;  3KHR A;  3CC7 S;  1RT5 A;  2Y3Y A;  1C4A A;  3CO0 P;  1T11 A;  2IAJ A;  4DV6 F;  2XMA A;  1UVI A;  3CO9 A;  4M5K A;  4AQY F;  2UXD J;  1RXO B;  5H9E K;  2H51 B;  3CWJ A;  5C24 A;  3T1H F;  2Q6B A;  1TU0 B;  3CJR A;  3H20 A;  1KRP A;  2XS5 A;  2VV5 A;  2HQC A;  5LJ3 Y;  1KHW A;  2SXL A;  2VH7 A;  4BDP A;  1VQK S;  4UZB A;  2ZFH A;  2OPP B;  2MLY A;  2DT9 A;  4M5H A;  3L7P A;  4AD6 A;  1NBE B;  4RW4 A;  4ECV A;  3HX9 A;  5KT7 A;  1WOO A;  4YHH F;  3Q8V A;  1WG5 A;  1F5B A;  3N6N A;  2D9O A;  2JLF A;  1S10 A;  1BMQ B;  1FRM A;  2ZOM A;  3CJQ A;  3MED A;  4FVM A;  3KNA A;  2V8V A;  3BZQ A;  4OYX A;  5D78 A;  4DFJ A;  1HYS A;  2D1C A;  2XZT B;  1VQP S;  1ZAX A;  1U49 A;  4RPF A;  4FYD A;  1IKX B;  3O5T B;  3DRS A;  1F9F A;  4TY9 A;  3C14 B;  3W61 A;  4DV6 J;  2Q66 A;  1JKH B;  3FVY A;  1L3K A;  1WOP A;  3I5A A;  4HEA 9;  2XLJ A;  1IBL J;  3L4B C;  4C0O C;  1S6O A;  4MH8 A;  2Z0G A;  1CJT B;  2ADB A;  2DIV A;  2O67 A;  1MRO A;  3GTY X;  3BH6 B;  2RQC A;  2ADC A;  1NK9 A;  1L3T A;  5C24 B;  2IMO A;  1TK5 A;  1HHT P;  3W62 A;  3L95 X;  1WF1 A;  3D6F B;  4JV0 A;  4DUY J;  3OSP A;  2HHT A;  3H7H B;  2ZJQ Q;  3KDO A;  4WKY A;  5LSR A;  2IDL A;  1P27 B;  3HHL C;  1R31 A;  3LP1 B;  3W1Y C;  2R8H A;  1UPM B;  2YKA A;  2B43 A;  5DQH A;  3VWS A;  1JNZ B;  4Q0B B;  3DMJ A;  1AW0 A;  4E0D A;  2N7C A;  3VV2 B;  1BE4 A;  2ZDO A;  4I69 A;  5D0R A;  4N47 A;  2WSF C;  3M9O B;  1HNZ J;  2XWY A;  2J76 E;  3D54 A;  4H54 A;  1N56 A;  1IWA A;  2B4V A;  4KPY A;  1S1W B;  3H5Y A;  2HND A;  3OUY B;  3PRV A;  3QAT A;  4CP5 A;  2OKQ A;  2EK1 A;  1D8Y A;  3NLC A;  2A10 A;  3A3O B;  3BB5 A;  2MDA A;  2H5E A;  1HQ2 A;  2I5J A;  4IDK B;  3M2V B;  4AQY J;  2DTJ A;  3QO9 A;  2R7T A;  2CQG A;  3TA2 A;  5CD4 H;  5D3G B;  3A3N B;  5E3R A;  3HDS A;  3DN9 A;  2VPZ B;  4L3N A;  3I0R A;  4LUB A;  5IXU A;  1KFS A;  3O44 A;  4NLO A;  4Z37 A;  4HTI A;  1RHU B;  2G0I A;  3AOA A;  3EZ5 A;  2ZH8 A;  3UN5 A;  5AJ3 J;  2WK4 A;  1RSC A;  3EXY A;  4UUW A;  3I32 A;  4KJI A;  3QAU A;  3KLE B;  2CAD A;  2ZDP A;  4PWW A;  5A8W B;  2ILY A;  1Q7Y T;  1PG5 B;  2XMU A;  2V9K A;  3LAN A;  4LVO P;  1LWF B;  4U8V A;  3VQS A;  2R8I A;  2DGW A;  1EAY C;  3ILO A;  1N32 F;  2YWE A;  2BM1 A;  2V8H A;  3MM5 B;  3TX0 A;  1FA0 A;  2GX8 A;  4O23 A;  4C3M A;  2F4V J;  2C3U A;  2ROP A;  4OZL A;  4NXM F;  4HDH A;  1UJ5 A;  3SIP B;  1VC6 A;  1O8B A;  1QVF R;  2XMM A;  2BAC A;  4J37 A;  1UVM A;  4FF3 A;  5HVH A;  4WU3 A;  4FBT A;  3EVM A;  2JSX A;  3PEH A;  2UUC F;  4CCH A;  2UP1 A;  2DGO A;  5J1E B;  1HQU B;  1FRL A;  2AMC B;  1VQO S;  1RBL A;  2G9O A;  2C3Y A;  2AX1 A;  4DSE A;  3B4M A;  1FES A;  1MU2 A;  1AFJ A;  2YKN B;  3TZX A;  4F50 A;  1FDD A;  2Y1J A;  4H4M A;  5LOQ A;  1GTH A;  4Y2M A;  3ZC4 A;  3UD4 P;  4QYZ J;  1A9N B;  4EUV A;  2K3K A;  3UO0 A;  4A48 A;  4HHU A;  3TAN A;  4OI4 A;  2C2Z B;  2VOD A;  3KK1 A;  2VL1 A;  4MKY A;  5IM0 B;  4RNM A;  4DV7 F;  1J5O A;  3GFX A;  3RGI A;  1V3R A;  1Q5V A;  1EAR A;  1O5J A;  1SV5 A;  1ZA1 B;  3ENA A;  3HD2 A;  3I31 A;  4ZVO B;  3HSJ A;  3W2W A;  3N0V A;  3W65 A;  3QZ7 A;  1C0T B;  4DHV A;  2DNO A;  3TA1 A;  3VGV A;  2R2R A;  4C11 B;  5L1L A;  2IMW P;  2GHW A;  4M95 A;  1CSJ A;  1X7V A;  2Q1L A;  4ED6 A;  3H42 A;  2DXF A;  4C7Q A;  1UTA A;  2BQU A;  2B3T B;  4KHP J;  4R25 A;  5DG7 A;  1A7G E;  2QSF A;  3PJX A;  2WON A;  4X2B A;  3VAK A;  1CJU A;  2ZOF A;  5KG3 A;  4YR0 A;  1N36 F;  1S99 A;  2ZBR A;  3K5N A;  2LEP A;  4GRS A;  1WI8 A;  1VRU A;  3DYA A;  2BOA A;  4KRW A;  4YB6 A;  1Y10 A;  2KU7 A;  4BWJ A;  2AGP A;  3H98 A;  2EG2 A;  4OX6 A;  4JI2 F;  1M5V C;  1TAU A;  1AA1 B;  3NMR A;  4YB1 P;  3O2I A;  1LFW A;  2PMH A;  2XI2 A;  2K7K A;  1G3O A;  3PO4 A;  5KFV A;  1HWI A;  2BJD A;  2RSQ A;  4DCJ B;  3EGW B;  3FBE A;  3NG8 A;  3CJ3 A;  2EEY A;  4GVB B;  5D6G A;  1CJV B;  2MXY A;  3GIJ A;  2POK A;  3VTI A;  1RWK B;  1RAD B;  1H74 A;  3G4S S;  1UFK A;  4UQG A;  5A8K B;  1C0T A;  2RIJ A;  2C2K B;  3CCM S;  4ETX A;  2RDD A;  2HNY A;  2FUG 9;  3MUT P;  2PMZ D;  3THP A;  2YWF A;  4IG0 B;  3Q86 A;  4OJ1 A;  5EGY A;  1HQE B;  3HVT A;  5HJX A;  2B9E A;  4RU2 A;  2GZO A;  3LAM A;  3OR1 B;  3M2U A;  1TUG B;  4GC7 A;  3TYT A;  4NRT A;  1WWH A;  1JLC B;  1X4G A;  4Q5V A;  4LF5 J;  1KVJ A;  1OWX A;  1GMV A;  4P71 A;  2HQD A;  3IRX A;  2JHE A;  2ZD1 A;  2UXD F;  3P6Y C;  4AFF A;  4U6P A;  2B7C B;  1HQU A;  3GYN A;  5G0R B;  3L3C A;  2OPR B;  2CQP A;  2OEK A;  3KLG A;  1S76 D;  3IXQ A;  2JC1 A;  3EDR B;  1YJN S;  1WHY A;  2OPQ B;  4GVB A;  3TZW A;  2E29 A;  3BQ1 A;  3VAL A;  2ALZ A;  2LQ8 A;  4RLE A;  1XMQ F;  1URN A;  1ITP A;  2BXJ A;  1VI7 A;  3GCW P;  4Q43 A;  3MAQ A;  4EI2 A;  1MG7 A;  3NNH A;  4NYP A;  4ZS6 A;  3VAJ A;  2HWT A;  1YTY A;  3C16 B;  1PJ6 A;  2CZV C;  4OZ1 A;  3KLI B;  2X3G A;  4K2X A;  3EX7 B;  4LF6 J;  2VBW A;  2HBY B;  4P74 A;  5B09 A;  1NND A;  5GAD I;  1DZ5 A;  2ZM6 J;  3GR1 A;  2HBZ B;  1FCA A;  1K44 A;  3KTQ A;  2H9Z A;  4DQQ A;  3M2R B;  3W7B A;  1HW8 A;  2MQ8 A;  4MT1 A;  1VRU B;  4FBU A;  2WBM A;  1WDT A;  3FEZ A;  1PIE A;  1TR0 A;  2M70 A;  3TAP A;  1KQK A;  3HSZ A;  1SKS A;  1VGY A;  5EX3 A;  7FD1 A;  1HWK A;  2AEF A;  1H0H B;  2YNG B;  3J80 Y;  2XLK A;  1Q81 T;  2I6W A;  1UPP A;  1XR6 A;  4RKU C;  4WTY A;  2ZWO A;  5DG9 A;  3OD2 A;  4DI6 A;  4X84 A;  1W2I A;  1U1R A;  2GA7 A;  2VBY A;  1VJQ A;  3CTR A;  5KFF A;  4TQR A;  4DU7 A;  2RUS A;  3M6V A;  3HCX A;  1RT6 B;  2QN6 B;  1HFE L;  1HNI B;  4YEA A;  2OP5 A;  3AOB A;  3LP0 A;  3JSY A;  2WB4 A;  4M1K A;  1Q4R A;  1YDL A;  3P45 B;  2LQ9 A;  2W2M P;  2KB2 A;  2RUG A;  3W63 A;  3OL8 A;  1ZZN A;  2GJ2 A;  3E2E A;  3SBM A;  2K3I A;  5J1E A;  1FNO A;  3G8T A;  3KLH A;  2UVW A;  2VA2 A;  4CNZ A;  2WCX A;  4LT6 A;  2DB1 A;  2QT7 A;  2NUH A;  1IKY B;  3DU5 A;  2B5J A;  2CPH A;  4KH0 B;  1FKP B;  1R89 A;  1RLD A;  3NGD A;  2EFO A;  4DV7 J;  1PAU B;  1MML A;  2MPU A;  4O3Q A;  2XSF A;  3CJS A;  4WKR A;  1NEE A;  2YQ1 A;  2F4V F;  3RBD A;  1M90 T;  1KSP A;  1EKR A;  2CQ3 A;  5CCM A;  2XYH B;  1BWV A;  5GVQ A;  3T6J A;  3KLF A;  4CH1 A;  2E5G A;  3H5U A;  2NYI A;  4G1I A;  4RO0 A;  4UZC A;  1K47 A;  4WE1 B;  4AND A;  4HYK A;  4CTA B;  3VAM A;  5J2N A;  5BR8 J;  4B9M A;  1DFD A;  2G0C A;  2H54 B;  2RF2 A;  4YDD B;  1BY9 A;  3MM8 B;  4OYP A;  3QGH A;  1HHS A;  2XCA A;  1T95 A;  2BM0 A;  3LTO A;  2HNZ B;  1LK5 A;  3CJ4 A;  4IOB A;  5L1I A;  1JLF A;  1CJK B;  4NRU A;  1RT2 B;  2IHR 1;  4C8N A;  5M2P A;  2KFN A;  3PAC A;  4KT0 C;  4U7C A;  2D41 A;  1JJ2 R;  1KTV A;  4DR5 J;  2M2B A;  2DEJ A;  3K89 A;  2KXH A;  2QC3 A;  2DKO B;  5M2U A;  5KFG A;  2V8G A;  1SKR A;  1Q1K A;  5DZ7 A;  2MB0 B;  3DLH A;  1IXK A;  4F26 A;  3S8S A;  2EK6 A;  2QYG A;  1CBK A;  1K1S A;  2RVJ A;  1NJW A;  2WSE C;  2YNF B;  4KC5 A;  3PW0 A;  5F8H A;  3PYE A;  1F5A A;  4O3P A;  4P10 A;  3QLH B;  3BDE A;  1TL5 A;  5DM7 Q;  2E5L J;  4MJK A;  1D8Z A;  1RWO B;  4WU2 A;  5C42 B;  5KT2 A;  3KHL A;  3N4W A;  3T9N A;  4ILR A;  1ROF A;  3I9Z A;  5B0B A;  1JXL A;  2P9E A;  4I6Y A;  2AQ4 A;  3KYL A;  5DO2 A;  4I2Q B;  4UQT A;  1HBM B;  2APO A;  3PTW A;  4F02 A;  1C1C B;  3UPF A;  2RAQ A;  3DLB A;  3LP1 A;  2J9C A;  1DTQ A;  1VHI A;  4IFY A;  2W8L A;  3UNG C;  4EO6 A;  4PXD A;  1UFL A;  3GFH A;  5D4P A;  4LFC F;  2ZKT A;  1FEE A;  4EWT A;  3IO1 A;  4CM2 A;  3BQ2 A;  1TV6 A;  4W92 B;  2JL9 A;  4A8O A;  3C14 A;  1X0P A;  3ZTO A;  5DLG A;  4F2S A;  4LR9 A;  1CEZ A;  1I51 B;  3VAG A;  1WEZ A;  4PYD A;  4NYZ A;  5LM7 E;  5KFU A;  1N0V C;  1PYT A;  2AEM A;  4YN3 B;  2V94 A;  4FDF A;  1LWC A;  1Q8B A;  1RTH A;  2Z2Y B;  2HHH J;  1B64 A;  2VBZ A;  4P75 A;  1KDN A;  1RT4 B;  5CYQ A;  5H9E J;  1KVI A;  4LQ9 A;  3JSM A;  5J2P A;  1NK7 A;  1QTN B;  1KN6 A;  1P6T A;  5J1N A;  1CJV A;  2BVZ A;  3U02 A;  1LWE A;  1PGZ A;  2RD5 C;  1G4C A;  3G8S A;  4DQI A;  3HHL A;  3UI3 A;  3HKW A;  4DV0 F;  3FZ2 A;  3GV7 B;  1H2V Z;  1ZA2 B;  4DL3 A;  2F1F A;  3RU0 A;  5GMK a;  2GNK A;  4IR9 A;  2ZC4 A;  1IQZ A;  5HL7 Q;  3KLV A;  2CQ4 A;  3MUR P;  3KWM A;  5EHH A;  3NGU A;  1RTJ A;  2QMU B;  3W5Y A;  1URR A;  5GAE I;  3MR6 A;  3IC1 A;  1NZ8 A;  4RW4 B;  3X3U A;  3G86 A;  2ZJR Q;  2JZ5 A;  1U1P A;  4M5J A;  3BO4 A;  4DLE A;  2QL5 B;  1HNX F;  4F0K A;  2C3M A;  1PC4 A;  1B4S A;  2O66 A;  3H5S A;  3TEH B;  4LMZ A;  2HQF A;  2IRY A;  1VOM A;  2BZ2 A;  4UW2 A;  3TP2 A;  7AT1 B;  3IBW A;  3HT3 A;  2UXB J;  2J9D E;  2PA8 D;  1P1L A;  3POT A;  3RRK A;  1HBU B;  8AT1 B;  1DRZ A;  3AQP A;  2OSQ A;  1GXU A;  3CDW A;  2KFZ A;  1CQM A;  1NM2 A;  1TKT A;  2CNN B;  3PEJ A;  3MR2 A;  3V6K A;  1VQ8 S;  4IQM A;  5J1P A;  2JC0 A;  3MF5 A;  3QLH A;  4QW9 A;  4EEY A;  3C6T A;  1LW2 B;  2K06 A;  2YH0 A;  5C42 A;  2P6S A;  4BWM A;  1R0B G;  4NA3 A;  5KG4 A;  2HMI A;  4OIX A;  3FUY A;  1UZD A;  4KFB A;  2DGX A;  1S6Q B;  3PJW A;  4N56 A;  2HRY A;  2MQN A;  4IR1 A;  3IM8 A;  4ZP8 A;  3BSN A;  2BBE A;  1Y5L B;  1XC9 A;  1RU2 A;  2ASY A;  2CIM A;  4H4K A;  2FJA B;  4CI0 B;  5DDQ C;  4O3S A;  4LBI A;  1SCJ B;  3J7Z T;  4YY3 F;  4QBU A;  5F8L A;  1F5C A;  2F8E X;  1PO6 A;  2GJI A;  3Q23 A;  4F4K A;  5FDL A;  4JI7 F;  3P5T L;  1HBN B;  2E1R A;  1Y3J A;  3SZ2 A;  2B9W A;  3TVZ A;  3HFZ B;  2NPI A;  3UFC X;  1S9E A;  1U6Z A;  4I1T A;  3LAL A;  3SDE B;  3PDN A;  1GMW D;  4LRA A;  5B0F A;  1T9Y A;  3C6U B;  3GJQ B;  1WKK A;  1GXT A;  2GVZ B;  1VQY A;  2MZT A;  4ES2 A;  1B0T A;  3IBC B;  2IA6 A;  4PQU B;  3E01 A;  3ISN D;  4XO0 A;  1N33 J;  2NSC A;  2BOP A;  1R0C B;  1XNR F;  3DLJ A;  3R7S B;  4PZV A;  4TU9 A;  2CQ1 A;  3DLE A;  2CZ9 A;  2QRR A;  4PYA A;  4G1P A;  1UA0 A;  1H98 A;  4TLQ A;  1YWX A;  3N6L A;  1QE1 B;  4JOU A;  1DTQ B;  4IFY B;  4RX6 A;  2M0G B;  4TYB A;  4OI1 A;  1NPR A;  1TZ0 A;  4KV8 B;  3MMC B;  4K2J A;  3R1L A;  2IBO A;  1F1B B;  3I6P A;  4OJ3 A;  2K8G A;  3PR4 A;  1S6Q A;  5F0U A;  3J81 Y;  4DV1 J;  3CNQ P;  3MM7 A;  4R5P A;  3MEC B;  5CYM B;  2G1H A;  2ZH5 A;  2BRK A;  1ZM3 A;  2IAJ B;  1UEU A;  2J0X A;  4ED4 A;  2MGZ B;  5F8I A;  4NML A;  4C3L A;  2LEA A;  1VQ5 S;  2ZVS A;  2NQP A;  1UWB A;  2RT3 A;  4ECY A;  4KE5 A;  4ZN1 A;  3PYG A;  2CPF A;  1FT8 A;  3I87 A;  5KOW A;  3TQE A;  3ET6 B;  5ADZ A;  3IR5 B;  4LSZ B;  5HQ8 A;  1VLY A;  2IM0 A;  2YNG A;  4ED3 A;  3FBC A;  2FY1 A;  4KHM A;  1QAY A;  5I4M A;  2VBX A;  2HFN A;  5LSO A;  2XHW A;  1Q78 A;  3BBC A;  1FDN A;  4FPI A;  2V2Q A;  1T7P A;  3MMB B;  4HR2 A;  3VZH A;  1RTJ B;  2O5D A;  1VIS A;  1G1X A;  1EP4 B;  2WBR A;  1NKE A;  4DJB A;  1RAO A;  5E5N A;  3M8P A;  3UCG A;  3OXG A;  2I0X A;  2R7O A;  3JQK A;  1TKZ B;  4LBH A;  4JI2 J;  2MZ1 A;  2MY7 A;  2XMJ A;  2BDP A;  1FRJ A;  1KP6 A;  2EXU A;  3F44 A;  3NGS A;  1PBU A;  2XC9 A;  4DS4 A;  2HLU A;  2MGZ A;  4DR3 F;  1A6L A;  3I55 S;  2KM8 C;  3G6Y A;  1WEL A;  4CO2 A;  1HBO A;  1RTD B;  1FX4 A;  4N8N A;  1HI1 A;  2YKM A;  4NEY A;  4ZPA A;  3OLA A;  2HS4 A;  2LQ5 A;  3CW2 C;  5AXM A;  3S7R A;  1N5Y A;  3UQS A;  1NB7 A;  3IS9 A;  2X3D A;  1S0V A;  1F2G A;  1YLX A;  1Z4U A;  2FGC A;  4DPX A;  2N82 B;  3I9V 9;  4DEZ A;  1MNE A;  4ZK7 M;  2DH9 A;  5KFB A;  4ED0 A;  1WHV A;  3K58 A;  2XSJ A;  2NYH A;  1SXL A;  3CCU S;  2RQ4 A;  3M8Y A;  3IWL A;  1KBR A;  3QBC A;  4FZV A;  2G1D A;  2I9S A;  2NUU G;  3SCL E;  4X4T A;  3KLH B;  5B0G A;  3W8G A;  4FS1 A;  1VRT A;  3L09 A;  4PPD A;  5HRO A;  2EW9 A;  1T03 A;  2A1B A;  2GVD A;  3TW0 A;  5KOX A;  3AD7 C;  4IG0 A;  4EBE A;  1IM6 A;  1HBN A;  4ZIV A;  4X4P A;  3LA0 A;  4WF9 Q;  2K2P A;  2ZNZ A;  3AB4 B;  2YWK A;  1B0P A;  1W25 A;  1XJW B;  4JV1 A;  3X1L B;  1YGY A;  2H5I B;  5A6P A;  4N77 A;  1ZPW X;  2FJX A;  2R42 A;  2D9P A;  2YXL A;  4LJM A;  1WSV A;  1GT8 A;  3K2Y A;  2G2Y A;  3Q2T C;  3BBF A;  4MIW A;  2DY9 A;  4N41 A;  4C0B A;  5EN1 A;  2GQQ A;  4JI4 J;  3LPE A;  4QQB A;  1S1X A;  3G71 S;  2VG6 B;  1RB0 A;  1S7H A;  1HNX J;  5LMN J;  1S48 A;  1R43 A;  3C6T B;  2A2C A;  3HKZ D;  3HSD A;  3KUE A;  3KK3 B;  2UUB J;  2WW4 A;  4NLP A;  3DKD A;  4WP9 A;  3BJY A;  3HI9 A;  1SJ4 P;  3HJF A;  1TK0 A;  1W26 A;  3DOM A;  3UE2 A;  2JFD A;  5L38 A;  3QWP A;  1Q95 G;  2Y0S D;  5LMU J;  1UW9 A;  2MZJ A;  2HFO A;  4CLU A;  2OTL S;  2A18 A;  2VOO A;  3KHH A;  4L76 A;  1IUJ A;  5LXY A;  4CWB A;  2AYM A;  4JI1 J;  1DTT A;  4NX9 A;  2CPI A;  1HWJ A;  4A8S A;  4RJV A;  1XR7 A;  4I68 A;  5IV4 A;  2P8I A;  4A47 A;  3V5R A;  4C98 A;  4QWA A;  4ES1 A;  2DNZ A;  4J5O A;  4WFN Q;  1N6Q A;  1KD1 T;  1BQN A;  1NDP A;  4DXL A;  4OMF G;  1RGV A;  4YP3 A;  2B5J B;  1RHR B;  3QYY A;  3R6G B;  2NXN A;  4HI2 A;  2OPQ A;  4HLB A;  1XEZ A;  4O4R A;  5RUB A;  2VG7 A;  1N5V A;  2ROG A;  1UET A;  2B56 A;  4FYV B;  2KG1 A;  4MTP A;  3FCH A;  5SZT A;  2XNR A;  3ICL A;  2KYX A;  2VFS A;  5IS2 A;  3BSO A;  3T5H A;  1YBU A;  2CJX B;  4G1Q A;  4ENO A;  1WTB A;  3SSR A;  2M7S A;  3RB6 A;  2DPJ A;  4JI3 F;  2C3O A;  1M5O C;  4GKK J;  3DOL B;  4OYB A;  3SSS A;  1FTR A;  2YY3 A;  1NK6 A;  3V4M A;  4IQX A;  3NAI A;  2VUG A;  2N4C A;  3VHQ A;  1LK7 A;  4LF7 F;  3GIR A;  1VQ9 S;  4MK7 A;  2VFT A;  4ES3 A;  2BJ1 A;  3DOK A;  3MM9 B;  3GU0 A;  1R6Y A;  2CNO B;  4AXI A;  2W9C B;  2OH2 A;  2XHC A;  2FD2 A;  1TL1 A;  3Q8Y A;  3T5L A;  3CD6 S;  2YNH A;  4PAB A;  1EIY B;  4WFZ A;  4X65 J;  2GQ2 A;  1RAC B;  3PCO B;  3NGT A;  4QW8 A;  4AT1 B;  4ZLL A;  5IWA F;  4B3S F;  3WQP A;  3QGI A;  3M6W A;  2KL8 A;  3LO3 A;  1HBM A;  2BYC A;  4NZ0 A;  3A13 A;  1U1N A;  1N36 J;  2CJ9 A;  3LF0 A;  2HRU A;  1XMO J;  1M5H A;  1XER A;  3EIC A;  1TQL A;  1HPZ A;  1X4A A;  1D09 B;  3C8Y A;  1M5K C;  4C8K A;  1CQN A;  2QLX A;  1ULR A;  3NBP B;  4F67 A;  2MQQ A;  1LXJ A;  4E8U A;  2B9X A;  1AB8 A;  2RE1 A;  2DH8 A;  1SH0 A;  3ZZR A;  4DCO B;  5LXR A;  2HHV A;  1VK3 A;  3I0S B;  2F5G A;  3ZTQ A;  3J7A 1;  1XMO F;  3NS6 A;  3I0R B;  4JP8 A;  2OUG A;  4FNH A;  5BYQ A;  3LWL A;  3KOA A;  2DHS A;  4IDK A;  1X9M A;  4ECT A;  1RDR A;  2Q3P A;  4I56 A;  2R2U A;  3DRP B;  2XMW A;  5L9N A;  3PHE A;  1HMV B;  1XK8 A;  2HWI A;  2IJF A;  2YPY A;  3ENW A;  1RTI A;  4RNN A;  2RS8 A;  4Q8F A;  4LFB F;  1M0S A;  1CJK A;  2I38 A;  2MHN A;  5T7L B;  2DVI A;  3TAR A;  4OI3 A;  4L73 A;  3MZI A;  3L7O A;  4OZ3 A;  2MST A;  5HK4 A;  5K9F A;  1FEH A;  2J5A A;  2J7U A;  3MEG B;  3G87 A;  1IN0 A;  3NP5 A;  2QIF A;  4ZPB A;  2COL A;  5K8O A;  3J7Y I;  2OD4 A;  3EXC X;  2Y8Y A;  1FJG F;  4KY3 A;  3MM6 A;  4ED7 A;  1ZH5 A;  1R7I A;  4B9V A;  5KFW A;  2AGQ A;  2RHQ B;  4NXN J;  3DHX A;  3A4T A;  3GB0 A;  2QG9 B;  5LT5 A;  4X64 F;  3KMS A;  4K4T A;  4DF8 A;  3TAQ A;  3QT7 A;  5C2G A;  1YBT A;  1N32 J;  4F4A A;  4PG4 A;  1U25 A;  3LWM A;  3H4B A;  2FVC A;  3BR9 A;  4DR7 F;  2G0J A;  2LMI A;  1M1G A;  3E3X A;  2MZR A;  4O3N A;  5ETT A;  3TZZ A;  2FLN A;  1SI9 A;  3AJD A;  1ZM4 A;  3MM9 A;  3GG0 A;  2KO1 A;  1SJ3 P;  1NDL A;  2JEJ A;  3G9C A;  2MQL A;  3KJV B;  4DR3 J;  3OJU A;  3VGT A;  1T3O A;  2XEX A;  2HG4 A;  2VG7 B;  3Q8S B;  2W1B A;  4WP3 A;  5T7L A;  3ZTR A;  2JOQ A;  4O0I A;  5ETL A;  2UUW A;  3A8E A;  3AXM A;  2A2D A;  4P52 A;  4G3I A;  2OPP A;  2UUB F;  1KLM A;  2HIQ A;  2XBP A;  3SSQ A;  4ZLN A;  4LF1 A;  4I7F B;  2AD9 A;  3KG4 A;  3Q8R B;  3MFI A;  2OJ3 A;  4URS A;  1WKJ A;  3QT8 A;  4RW8 B;  4BS2 A;  2MYF A;  1WNE A;  4KQZ A;  1UJ4 A;  4OYA A;  2LU2 A;  4OHV A;  1PYO B;  4DN9 A;  2P9G A;  1RYR A;  3FSI A;  2HVZ A;  1FWK A;  1Q79 A;  2BEF A;  2H4Y B;  3DOM B;  3HHD A;  1XMB A;  5C25 A;  4RZR A;  4OL8 A;  1NLK L;  2PFF B;  4RU9 A;  2K7J A;  1S1T A;  3H0P A;  1S6P B;  3Q8U A;  2PEB A;  4I64 A;  3UN2 A;  5F9L A;  1UVL A;  5D4N A;  3D4J A;  1HL6 A;  3RBX A;  3F0N A;  4DR4 F;  4B9S A;  3CCV S;  2KVQ E;  5HLF A;  4ELT A;  1UWA A;  2V8P A;  3QRP A;  1CLF A;  1MRO B;  2J8A A;  4F4Z A;  4JI8 F;  4PRF A;  4MKA A;  1LW0 A;  3T41 A;  4JV5 F;  1KQG B;  1YK9 A;  2UZA A;  4WPA A;  5F3T A;  8RUC A;  2ZEJ A;  1TL7 A;  4X4R A;  4C97 A;  4CLY A;  3RAX A;  4OYO A;  2HEK A;  3AA9 A;  3BBB A;  3OTE A;  3UCZ P;  3NNC A;  3R2C J;  1SQG A;  3HJV A;  4ZPW R;  1AT1 B;  3W2V A;  2YH1 A;  4MKV A;  4ZVG A;  3CJ8 A;  1TL3 A;  4IG3 A;  4N5S A;  1JMT A;  4NA1 A;  1F60 B;  1WG1 A;  5LL6 d;  3TNV A;  5DGB A;  2OPR A;  3RAQ A;  1CJT A;  2LQB A;  3Q83 A;  2J0Q D;  2M3D A;  2ZH6 A;  5ETS A;  3PFE A;  3M8Q B;  4ZN3 A;  2HQG A;  4F3M A;  3SQG A;  2H5J B;  2L9D A;  2X1F A;  3M9N B;  2OHD A;  3IAM 9;  4KAI A;  4DG1 B;  5EWG A;  3IWN C;  4IH6 A;  1K9M T;  2HVI A;  3TOQ A;  4C8L A;  3EM1 A;  4TVA B;  1LWX A;  2OPS B;  1SIW B;  4ZCM A;  2CPZ A;  5DDR C;  4DR1 J;  3OR1 A;  3QIP A;  4ZJL A;  2EPI A;  3BGU A;  2ILZ A;  3DFE A;  1L5U A;  3OTO J;  4IUF A;  1BWE A;  3DU6 A;  2D69 A;  2M88 A;  3HHE A;  1GMU A;  3TUJ C;  3BGO P;  4M5L A;  5DJB A;  2VHG A;  1SJF A;  3BR8 A;  1TV6 B;  5KFH A;  2BKP A;  3I5B A;  2DGU A;  3VZI A;  1S0M A;  4H4O A;  1HNV A;  2OEL A;  2CJK A;  2MKJ A;  3MMJ A;  2BQ3 A;  3NXZ A;  1Y11 A;  2QE5 A;  2WB1 D;  3CGI A;  1P1T A;  3PRD A;  1QD1 A;  4N8O A;  4NL5 A;  2IYG A;  3SCJ E;  3M9M B;  1HWL A;  1WEY A;  3H8Y A;  3M8Q A;  5IOL A;  3WIV A;  4K7Q A;  3OT9 A;  3GV5 B;  1HBO B;  5CXT A;  2VAS A;  4B9U A;  3K0J A;  4K4X A;  1SL1 A;  2BJ8 A;  1H3D A;  1N5T A;  3WX4 A;  1YVF A;  2Z8Q A;  1WG4 A;  2LEB A;  4DR2 J;  1NH8 A;  3DGP B;  2B6A B;  3M7V A;  5CHC B;  2XY5 A;  1S1V A;  1ZPV A;  2CPE A;  3Q8P B;  1L3S A;  3DRY A;  1NDC A;  1C4C A;  1M5S A;  3A1Y G;  2AU0 A;  2Y8W A;  2YNI A;  3M8W A;  5GAE U;  1UEV A;  3CUL A;  4FXD A;  3D5M A;  1FRI A;  4RUB A;  1RT1 A;  5D15 A;  1MN9 A;  1V5I B;  5B0A A;  1S1V B;  3JXO A;  2V6A A;  4OYI A;  2L08 A;  1VJW A;  1BGX T;  2DIS A;  2VIH A;  1FE4 A;  1YJR A;  5F0W A;  1SL0 A;  3W9J A;  1KS2 A;  1RBO B;  3DRS B;  4ZLP A;  1AZS A;  3DXS X;  2C2D A;  1VC5 A;  1AYE A;  4NLY A;  4NOH A;  2CYY A;  5HN0 A;  1X4B A;  4WIQ A;  3MEC A;  5HSP A;  3AOC A;  1RI7 A;  5DGA A;  2VJV A;  2V34 A;  2HK3 A;  3MMA A;  4J9R A;  3GIK A;  4OHY A;  2BW2 A;  3F56 A;  1UWB B;  2XMK A;  2BX6 A;  1MU2 B;  2A6M A;  3TZY A;  1Z2L A;  4Y2A A;  4WZQ A;  3NAH A;  1RZM A;  1NB2 A;  3TAM A;  1IR2 A;  2YX7 A;  2RDJ A;  4LQ3 A;  1O0P A;  4A8Y A;  1HI8 A;  5HMZ A;  3PW2 A;  3ELH A;  1DAX A;  4Z7C A;  4ZP9 A;  5I42 B;  1UZH A;  2F65 A;  4MFB A;  2HK2 A;  4JUZ A;  1DHM A;  3V2U C;  1P9Q C;  2BE9 B;  1X4D A;  1LWE B;  1SJQ A;  2NXU A;  3FCV A;  4YFU A;  3CJT A;  1T9X A;  3PKM A;  2KXF A;  2L48 A;  2QGF B;  2DO0 A;  4OQJ A;  3H5X A;  3CCT A;  2ZIT A;  4AL7 A;  4DG1 A;  1TKZ A;  2QJ3 A;  1OJ4 A;  1PYS B;  3OW2 R;  2ZH1 A;  3Q89 A;  4GC6 A;  4QU6 A;  2Q43 A;  1YJV A;  4I6W A;  3U1N A;  5A0Y B;  2XQC A;  2ZHB A;  4DR2 F;  1VBY A;  5M2R A;  1CVJ A;  4RL1 A;  2WVF A;  3WZ0 A;  3PX4 A;  2XNQ A;  1IKV B;  3HO1 A;  2CQ2 A;  1FNX H;  1GQE A;  4MKB A;  5MLC V;  2R8G A;  4C0H A;  4JI4 F;  5E2Q A;  4LF9 J;  1U7L A;  3DGP A;  3K7R A;  5B08 A;  5CZX A;  1H72 C;  3QAE A;  3CCW A;  3IAS 9;  4DUY F;  2KTQ A;  5HVG A;  3JYT B;  2P2C B;  4LIW A;  1FXR A;  2OD6 A;  3CJ2 A;  1X9W A;  2NSB A;  4LF8 J;  1KWM A;  4I2Q A;  3HVA A;  1TFY A;  4KGX B;  2NCK L;  3HUL A;  3LUY A;  4GO5 X;  1NHV A;  1X4H A;  1ZM2 A;  2FGO A;  4C8M A;  3BYP A;  3MPV A;  3NY0 A;  4J9U E;  1ZTT A;  2HMI B;  3DMJ B;  2KJV A;  1S1T B;  3BKU A;  1F3V A;  3PNI A;  2EFG A;  4UOC A;  4K4Y A;  1YIT S;  1JK9 B;  1WUU A;  2GMJ A;  5K8N A;  4F8R A;  3CVK A;  4OHZ A;  5KTQ A;  1YJT A;  5KFZ A;  5IT9 U;  4TKT A;  2IBK A;  3W64 A;  3JSR A;  2M4M A;  3MM7 B;  4ZHR A;  2RRN A;  4R5P B;  3CXC R;  3KK2 A;  2GCF A;  2QA4 S;  2QMW A;  1I6J A;  3I82 A;  1TFW A;  5LMN F;  3FCW A;  1TVR B;  4YUD A;  2DR5 A;  2F9D A;  2N3O A;  3ETO A;  2HVE A;  4NCG A;  2V2V A;  3DXB A;  4ZIT A;  3RB3 A;  2DH7 A;  3D3B J;  1GTE A;  2HHU A;  1JJC B;  2HNZ A;  2GVZ A;  2E7X A;  2F4F A;  2DBB A;  1TUW A;  4ECQ A;  2HQI A;  2HVD A;  4H4K C;  3E01 B;  1RA6 A;  2HZA A;  2KZM A;  1IBC B;  5C5J A;  4C2M A;  3PRB A;  5KFL A;  1VQS A;  4CTA A;  3IBF B;  3MR5 A;  3KJV A;  1B70 B;  3GP9 A;  3CC2 S;  2ERR A;  4PWU A;  4DWI A;  3OQ2 A;  1VDH A;  4NAS A;  2C28 A;  1KTQ A;  4YB7 A;  1TL3 B;  3CCJ S;  1C0U B;  1WEX A;  3R5G A;  1KLN A;  2CRL A;  1EJ7 L;  3NL0 A;  2W4C A;  4B3M J;  2LXI A;  1FX2 A;  1U8W A;  3D1H A;  3KFW X;  3B8H A;  1YHQ S;  2VPX B;  2AZ3 A;  4C6A A;  1K1Q A;  1RAH B;  2ZE2 B;  3DOL A;  4TY8 A;  2QFI A;  1QSL A;  4U67 Q;  4LF5 F;  3AJ2 A;  2ZKU A;  3BYR A;  3QWU A;  4JI6 J;  2JLE A;  1T05 B;  4KGM A;  3HXM A;  1U26 A;  5KFO A;  4WFX A;  2MKK A;  4C9D A;  2FVP A;  4LFC J;  1QVG R;  2YKQ A;  2DEI A;  4KPC A;  4YDX A;  3B4D A;  4NLX A;  2NXJ A;  4GMK A;  1RT7 A;  1RUS A;  1HBU A;  3VGU A;  3R5D A;  2E7W A;  4NLQ A;  1QUP A;  2HGN A;  1TKT B;  2CUY A;  2JJ4 D;  2WOM A;  4IFV B;  4ECU A;  1ZZF A;  3PIP Q;  1I3O B;  3B82 A;  3SI8 A;  1GMW A;  2HAI A;  2J0W A;  3FFI A;  5B0E A;  3DLK B;  4ZVE A;  5KG2 A;  1SQF A;  4RBU A;  2IC3 B;  5IC4 B;  3MCO A;  3H25 A;  4K8R A;  1EQ0 A;  4C11 A;  2EBG A;  1VBZ A;  1FDB A;  1T94 A;  2CWX A;  1J5E J;  1IVZ A;  1NSA A;  2KI2 A;  2MSS A;  1OSD A;  5B7W A;  2MLZ A;  3MWB A;  2GHP A;  2MZS A;  4UTG A;  4I2P A;  4GKK F;  3FSX A;  4QWC A;  3P8B B;  3GV8 B;  2BJ9 A;  3RR8 A;  1S77 D;  2DNK A;  3V4I A;  4BHQ A;  1KC8 T;  3PO5 A;  1D9F A;  2V67 A;  1OS5 A;  1G6B A;  1SH3 A;  3C15 A;  3CJK B;  4NXM J;  3OVA A;  3JSM B;  3U1M A;  1WJ9 A;  2N7Y A;  1UA1 A;  2VF3 A;  3PIO Q;  2MKC A;  1GNK A;  3SFU A;  3G8Q A;  3MEE B;  3QMQ A;  4DMZ A;  4ELV A;  4M5I A;  4B3S J;  5HAO A;  2IJN A;  1CUL A;  2V63 A;  5KFA A;  1FXD A;  1IKW A;  1GAO A;  3DDN A;  2W7P A;  4PWD A;  1REV A;  3H90 A;  4USH A;  1DBD A;  3MM6 B;  4YQW A;  2XYG B;  3ZNU A;  1C1B B;  1Y7P A;  3QT6 A;  2VC1 A;  1B7Y B;  4RW9 A;  3QRQ A;  2AIR B;  4DFP A;  2V50 A;  1S9F A;  2JVR A;  3M8Z A;  2Y0B B;  1NK5 A;  2QLJ B;  2NXE A;  2MKS A;  1VRT B;  4PR6 A;  3THT A;  1QDU B;  2E5J A;  3DM2 B;  3W5X A;  4EGL A;  3OSN A;  1T03 B;  4W90 B;  4LBP A;  4QIF A;  1FDA A;  3TVY A;  2MY8 A;  3ILI A;  2I2Y A;  2NPF A;  4B3O A;  1U09 A;  2KDO A;  2DNL A;  5KFM A;  3G6E S;  2EVZ A;  3IFE A;  1RIS A;  4ELU A;  2FJD B;  4DSI A;  1XBW A;  2B7B B;  2IFX A;  3W5Z A;  4RNO A;  2RRB A;  2YQ0 A;  2B0G A;  2XWX A;  5DDO C;  5A8R B;  3OL7 A;  3T1Y J;  4TN2 A;  1RU1 A;  2AV5 A;  2IA0 A;  2NRE A;  4LF6 F;  4DR7 J;  3OTC A;  1RA7 A;  4QZV B;  4DZ6 A;  1NJX A;  1HNZ F;  4Y2I A;  2EC2 A;  1U45 A;  3ADA C;  4U7U D;  1N5Q A;  4M5D B;  2W2P P;  4V19 J;  2E9T A;  1UVN A;  2BJ7 A;  2HVH A;  3PW4 A;  1RWN B;  4JI7 J;  4RW7 A;  4ICL B;  4ILL A;  4PUO B;  3QNW B;  2BMB A;  4F04 B;  2FQQ B;  2W2N P;  3FDS A;  1XN9 A;  3DNC A;  2G2Z A;  3GZ7 A;  2DR6 A;  2WAQ D;  4RWX A;  3HVW A;  4XTT A;  2DR7 A;  1G7C B;  4F0M A;  1S1W A;  2BE2 B;  1W2B R;  2E1C A;  1HPZ B;  1T0T V;  3O6Q A;  1FK9 B;  3HF5 A;  2GHV C;  3M8P B;  2B51 A;  1N8R T;  2HKE A;  2Q79 A;  3KJN B;  4DPO A;  1DQA A;  4MAK A;  1TMJ A;  4QWE A;  1KNZ A;  2GMH A;  3OL9 A;  1VIX A;  2JNJ A;  5K8M A;  2Z2M A;  2BE2 A;  3P3D A;  5F8N A;  1S57 A;  2J9D A;  3CMQ A;  1S12 A;  4KHR A;  3TO8 A;  2FIU A;  3MCN A;  2VA3 A;  5HBM A;  3WHI A;  1GX6 A;  1JLQ A;  3N28 A;  1TP7 A;  4LF9 F;  4PUO A;  4LF7 J;  4FXW A;  4X4O A;  4RUH A;  2C1E B;  2RML A;  3CED A;  4LVN P;  3ET6 A;  3EE3 A;  3JTP A;  2VDI A;  4O4G A;  5GAD U;  5CH7 B;  3K5M A;  2D3O 1;  1JIH A;  1KON A;  2XS2 A;  4ECW A;  4ZDN A;  1FKP A;  3R97 A;  3ZNJ 1;  3PHT A;  5HMX A;  2VQF F;  3R5J B;  1IM4 A;  4K4Z A;  4DQP A;  3C15 B;  2VPW B;  3OXF A;  1VYA A;  2P5V A;  4G1Q B;  4K5R A;  4MFB B;  5IT9 Y;  2CQB A;  2P6T A;  2PT0 A;  3HVT B;  3KXD A;  4JI6 F;  4Q8E A;  2E5I A;  1RT6 A;  1NJI T;  3MOJ B;  5HRO B;  1OY9 A;  1RHK B;  3TWZ A;  1Q8K A;  3WIU A;  4CLF A;  5KFK A;  5E3A A;  4BC9 A;  2DR9 A;  3NWR A;  4JV5 J;  4AUK A;  4C8Y A;  2ACY A;  1N6Q B;  4Q2M A;  2MKY A;  1OMS A;  3ETM A;  4IO9 Q;  1SB6 A;  4PXC A;  2U1A A;  2R7X A;  1W7W A;  4WK3 A;  2X1G A;  3GG1 A;  1U0H B;  5LSL A;  2KFY A;  3BO3 A;  4NMX A;  5K5M A;  4FPR A;  4DPY A;  5J2Q B;  1VC0 A;  4IOA Q;  1JJH A;  2CAJ A;  5D0H A;  3MMA B;  1JLQ B;  4LF8 F;  3OR2 B;  2R8K A;  2J7W A;  1XTZ A;  3OTB A;  1C2P A;  4J9V A;  2EI5 A;  2CQC A;  2PN6 A;  4X4S A;  2CWK A;  1AXQ A;  2MQM A;  2MTL A;  1U1L A;  1VK8 A;  1RT7 B;  4Z7Y A;  4QPT A;  1IR0 A;  1LQ9 A;  3OFG A;  3M8S A;  2QA4 G;  1F6T A;  2DHG A;  3UVJ A;  1N48 A;  5DM6 Q;  1N0U A;  3M2R A;  4Y28 C;  4DV5 F;  4UF4 A;  4ZPC A;  2FPH X;  1E6Y A;  2QX0 A;  4RR5 A;  4EFA C;  4URG A;  3KK3 A;  2BQR A;  4F36 A;  1YRU A;  1WI6 A;  4OZ2 A;  1GK8 A;  3KLI A;  5HVF A;  1XWL A;  3QZ8 A;  4P2S A;  4DL4 A;  4DUZ F;  2O3D A;  2UUT A;  4B02 A;  5AE2 A;  3CME S;  2V4R A;  2OLW A;  3OV7 A;  3GSI A;  5HP1 A;  1PSD A;  4DR4 J;  3AD9 C;  4L74 A;  4DQS A;  1MMD A;  1RAJ A;  1DQ8 A;  5DQI A;  1RAA B;  4CO1 A;  3DLK A;  2W2Q P;  1R6V A;  2W25 A;  1FHT A;  1JJ4 A;  5H9F J;  2RQM A;  4CLL A;  3SXL A;  3TA0 A;  1PKU A;  1VQN S;  4DV0 J;  5J2Q A;  4LFA F;  2GVD B;  3N9U C;  4MK9 A;  3EDQ B;  1MWZ A;  5HQM A;  3BQ0 A;  1FF2 A;  2ZD1 B;  3PYD A;  4TNO A;  1WC6 A;  2CJY B;  4W98 A;  3K5L A;  4IRK A;  4ECX A;  4ED1 A;  2IRX A;  3D6M B;  3JSB A;  4H4O B;  4USW A;  3BS9 A;  4Y2K A;  5D0G A;  3FNN A;  4C48 A;  4USJ C;  5KFJ A;  1NHU A;  4F4W A;  4DLG A;  2CNK B;  1KHV A;  1YI2 S;  2HW3 A;  2GAG C;  3BPD A;  3CD5 A;  2R7U A;  4BLG A;  2FVR A;  1J5O B;  3K17 A;  1PC5 A;  4XDD A;  3MFH A;  1K8A T;  2KM8 B;  1UP1 A;  4B17 A;  1ZYQ A;  2J6T A;  1Q7L B;  1FFW B;  1NPP A;  3WC0 A;  1OQ3 A;  3GIM A;  1U02 A;  4AL5 A;  2IM3 A;  4KGZ B;  4LRB A;  5E3Q A;  4AYB D;  2W7O A;  3WBZ A;  1N88 A;  3CD7 A;  1KQS R;  2GV1 A;  4N76 A;  4M5N A;  4CYU A;  2C42 A;  5CAA A;  2HHX A;  4O4G B;  5JVH Q;  4KGV B;  3U1L A;  9RUB A;  4P7V A;  2W8K A;  5LMU F;  1J5E F;  2X1A A;  4FYX B;  4CDI A;  5F9N A;  1E6V A;  2O01 C;  4LRD A;  2DNH A;  1KKH A;  1RT4 A;  2XI3 A;  3C6U A;  4ID8 A;  2YKM B;  5JMN A;  3KLE A;  1RTH B;  5IC6 B;  1RT3 B;  5FDL B;  2KT3 A;  2F3J A;  1FNM A;  3DYA B;  3NEK A;  5AT1 B;  3RUB L;  5BJR A;  4J9Q A;  2BKO A;  3BGL A;  2H4W B;  2W4P A;  2YWW A;  1PAE X;  2YKO A;  1YRX A;  2GO8 A;  2VC0 A;  3AOD A;  5GMD A;  2DRA A;  4ZVF A;  2VDH A;  2IIH A;  4JB8 B;  2J6S A;  3FBB A;  4RW6 B;  3C3L A;  1S97 A;  2RB7 A;  4IRC A;  4NLW A;  2VQE F;  1R8H A;  1FRK A;  3NOC A;  4NA2 A;  1FJG J;  4ZHR B;  5E7O B;  3EGV A;  3N01 A;  1QTM A;  3CE8 A;  1HW9 A;  4USI A;  3BGR B;  4AXJ A;  1WDD A;  1H7W A;  1PBA A;  1Q8L A;  3T5K A;  1BUX A;  1RCO B;  5D3G A;  1CG2 A;  4JI5 J;  2AJ2 A;  3UNY A;  4UY8 T;  1AFI A;  3O1L A;  4P9S A;  1Q86 T;  2VG5 A;  1S4F A;  3IMQ J;  4TQS A;  2F9J A;  3BGR A;  4K59 A;  4OLP A;  3R9L A;  1BXN A;  1VBK A;  4EBD A;  3HFV A;  3AXK A;  3HFK A;  4TXS A;  2ZM6 F;  1RJJ A;  4RW8 A;  3K8V A;  1RWX B;  3MMC A;  4DR1 F;  7FDR A;  1NCL A;  1OO0 B;  3I56 S;  2RS2 A;  1T3N A;  3PW5 A;  3UD3 P;  3CIZ A;  3CDA A;  4A8Q A;  3ISN C;  1A0O B;  1F0X A;  2EBE A;  4EU0 A;  4OV1 A;  4FF2 A;  3D0H E;  3OFE A;  5DZ6 A;  4DPU A;  4C8Z A;  1ARO P;  5EWE A;  3P5B P;  5I3U B;  2ZBI A;  3BRE A;  4BCA A;  3MUV P;  1I94 J;  2LA6 A;  5JUM A;  4DUT A;  3ILL A;  2L9W A;  3L9Z A;  2QL7 B;  1FO1 A;  2AJF E;  5DRK A;  4LF4 F;  4L6V 3;  3MM5 A;  3M6X A;  4KTQ A;  2AZ1 A;  1RTD A;  2IVY A;  4WE1 A;  1ZM9 A;  2BJE A;  1ICE B;  1JNR B;  3D68 A;  2NR0 A;  1AZS B;  2EKN A;  3K59 A;  1R8C A;  1X8D A;  2C2N A;  4LR7 A;  1DJ0 A;  2CPX A;  5E3P A;  3HP6 A;  3B78 A;  3MEK A;  5J2P B;  3OTO F;  1S9E B;  5KG0 A;  2FVQ A;  1HYS B;  4NWB A;  5K14 A;  4B3M F;  2XTJ P;  2AGO A;  3NCR A;  3V4I B;  1NO8 A;  5KFT A;  2DXD A;  1JLA B;  1SUQ B;  2F7V A;  3BGF A;  2Y1I A;  3VVU A;  2HGM A;  2CPD A;  3OPK A;  3MDF A;  3ZZT A;  2ALY B;  4X64 J;  4K4S A;  1U6F A;  2XO6 A;  3RW7 A;  4CLP A;  1RKJ A;  3TVK A;  2UU9 F;  3SDE A;  2JWN A;  2VQE J;  4USU A;  5F8J A;  1JLG B;  1FWL A;  4DL0 C;  4DR5 F;  4RNH A;  2VQF J;  1RWM B;  4DV3 J;  9ATC B;  5GAG U;  1CS4 B;  2KYZ A;  1HNI A;  1UVJ A;  5KFX A;  3MXH P;  5IQ6 A;  2AJ4 A;  3JTO A;  1VCT A;  1X5T A;  1FVQ A;  3TJA A;  3DGV A;  4ZVH A;  4ZVQ B;  1VR6 A;  4BBY A;  2CPY A;  5T14 A;  1S6P A;  2W7A A;  1YJU A;  3R6L B;  5E41 A;  4K4V A;  5KFE A;  2E44 A;  2LDY A;  2AJ1 A;  2QFJ A;  3T1H J;  2RIL A;  3I5C A;  1M5P C;  3FMW A;  5KG6 A;  4QYZ K;  1TTH B;  3GPA A;  1FJ7 A;  1DLO B;  2C2O B;  2CVE A;  4WJB A;  1H7X A;  2GIF A;  3AAW B;  4QU7 A;  1Q0N A;  1UMJ A;  5SUH A;  3NKY A;  3IR7 B;  4OX7 A;  4B9N A;  4KHP F;  1BQM B;  1X9S A;  1IBM J;  1S59 A;  3C19 A;  1SC1 B;  5J2M A;  4DX5 A;  1RYS A;  4DSJ A;  2R7V A;  3FEX B;  4DR6 J;  1I1G A;  5L1K A;  4CH7 A;  2LXU A;  1VQ6 S;  3DLE B;  2ACM A;  5E33 A;  2VIC A;  1JLF B;  2YTC A;  5A2Q Y;  1YJ7 A;  2V68 A;  1IKX A;  2QL9 B;  2V9W A;  2OPS A;  2PFD A;  5KFD A;  3C16 A;  4GVL A;  4QIW D;  4NLS A;  2DHH A;  2IJR A;  4WTO B;  3CF5 Q;  4ER8 A;  3M1V B;  1S1U A;  3W9H A;  1MWQ A;  1AUD A;  2HHH F;  1FJE B;  3DLL Q;  2Z2L A;  4K4W A;  4CO0 A;  4NLT A;  4WII A;  1ZAV A;  3T1A A;  4ANC A;  1Y5N B;  3B6B A;  3MGJ A;  3OR2 A;  4ZPT R;  4ERD A;  2NS1 B;  3ZZU A;  2FC8 A;  2JFK A;  2QYC A;  5ETV A;  4I0W A;  4MMO A;  4A46 A;  2GW8 A;  1QSY A;  2QEX S;  3T6B A;  3ENQ A;  3KG0 A;  1J2V A;  4J9N A;  4MK8 A;  3SV4 A;  1SPB P;  4C8O A;  4ECS A;  1XIQ A;  2DY1 A;  1NUE A;  3Q24 A;  1U2C A;  3P96 A;  4PAA A;  1TUV A;  2W2O P;  2Y9H A;  5DG8 A;  4GKJ J;  2AJQ A;  4HKQ A;  2P9C A;  3I96 A;  2HFU A;  1RLC L;  2DPI A;  4OI2 A;  3CJ0 A;  2XLI A;  2R9L A;  5ETO A;  3GE9 A;  4OYW A;  4Q45 A;  1DQ9 A;  1B99 A;  1V3S A;  2W24 A;  3BN4 A;  4MIB A;  5A6W A;  2RQK A;  3HMJ G;  3IM9 A;  5AXL A;  3OVB A;  3R7N B;  3GLJ A;  1K0T A;  3FKB A;  4HDG A;  2QZ8 A;  2B8P A;  1U1O A;  4Y00 A;  3TJ9 A;  3RR7 A;  4P73 A;  5A2Q U;  2ZWP A;  4LFA J;  2FLP A;  2FLO A;  4Y6I A;  5EX0 A;  1ZET A;  3D1Q A;  5EDW A;  3PY8 A;  2BE7 D;  3CDE A;  1X5O A;  2CA9 A;  3DDK A;  4XAK A;  1DY3 A;  1S49 A;  2RKI B;  3FGV A;  4YR2 A;  1U48 A;  4KO0 A;  4O44 B;  1E6Y B;  5U47 A;  4A8M P;  1HI0 P;  3FJ2 A;  2RHS B;  2PEH A;  1IBL F;  2VZ9 A;  1EB0 A;  2LDI A;  2ZBP A;  2Q6C A;  3ZXW A;  1N5S A;  5KFR A;  2ZH9 A;  2H48 B;  2M9K A;  2OSR A;  3R27 A;  5KFY A;  1Q82 T;  1RQ0 A;  2DNR A;  4NLU A;  1RK8 A;  5A0Y A;  2VFV A;  2VB6 A;  5J2N B;  2VG6 A;  4DU8 A;  5KFN A;  2R4F A;  2G13 A;  3HHK A;  3OHA A;  2W9A A;  2VOP A;  1U8S A;  5T41 A;  4C3K A;  1IR1 A;  1OYE A;  1NH7 A;  4FXV A;  4JYA F;  4Z2X A;  3IWX A;  2FJV A;  3M32 B;  2ATL A;  5GME A;  3HD1 A;  1WC0 A;  3EGN A;  4M63 A;  3UVJ B;  4CLS A;  4Q44 A;  2DO4 A;  3RAM A;  5HI7 A;  2NZ4 A;  3M30 B;  1XR5 A;  1BQX A;  3A8J A;  4RBV A;  3NGR A;  4UUX A;  1WC3 A;  3EGZ A;  4ED5 A;  3ZZZ A;  3GIL A;  3QJL A;  1XNQ F;  5KT3 A;  1U0H A;  4OZN A;  3GFY A;  2XMT A;  3PX6 A;  4XDC A;  3RZA A;  1REG X;  1JX4 A;  1YQH A;  4NLR A;  2LFV A;  3GJT B;  2OO4 A;  5GAG I;  2EG1 A;  4CH0 S;  2JRS A;  5L1J A;  1M1H A;  3RRG A;  1H2U X;  3D9B A;  4P2X A;  1ZOT A;  2LU1 A;  2GIR A;  3DCA A;  4V19 X;  1YSJ A;  3AH6 A;  3MEG A;  2RU9 A;  3ONQ A;  2YVS A;  1KVK A;  2HFV A;  4CLW A;  2XY6 A;  3JB9 k;  3AY0 A;  3MOZ A;  3UD5 A;  2XYP B;  3OHB A;  2CZ4 A;  2WHO A;  1VQ7 S;  2BAN B;  2KHC A;  2CQ0 A;  2KRB A;  2MLX A;  3KG1 A;  3VAH A;  1FRH A;  2I1R A;  3KKF A;  2FZC B;  4WP8 A;  4ZVT B;  4LF4 J;  4X4U A;  2Z2Z A;  3AT1 B;  2B4U A;  3DRP A;  4IYQ A;  4DOZ A;  4HT5 A;  5IT0 A;  1FXL A;  3GMG A;  3N5F A;  1B3T A;  4X4N A;  3QFH A;  3VR1 A;  4QJV A;  4P7T A;  2LYV A;  5ETN A;  4YME A;  2DGQ A;  5ETR A;  3PXG a;  4QIV A;  5ETQ A;  3R2D J;  2RNE A;  3M30 A;  4HH1 A;  3UDC A;  2OFG X;  1DTT B;  2Y1R I;  5I3P A;  5KFP A;  2DCU B;  1WF0 A;  1FI4 A;  2ABY A;  4FKX A;  5IQQ A;  4RBT A;  1RP5 A;  1JLE B;  4U9R A;  3AD8 C;  4CIO A;  2OMO A;  1S72 S;  4OX9 J;  2GS8 A;  3IG1 B;  3PYF A;  5FLX U;  2E9Z A;  4DV4 J;  1SKU B;  2DD8 S;  4R8U A;  1N54 B;  2AKW B;  3BH7 B;  4E98 A;  2KXN B;  3CCL S;  4DV3 F;  1U1M A;  4JI8 J;  3TR5 A;  2C2M B;  3ZO7 A;  3DDI A;  2IM2 A;  4U7U K;  1NME B;  2B9Y A;  3G6X A;  3EPG A;  4B3R J;  3ISZ A;  4ID5 B;  3VGS A;  2PE8 A;  2PD1 A;  3OLB A;  3ZZO A;  3FRY A;  3R3T A;  2JH3 A;  3SFG A;  4QR2 A;  2UV8 A;  8ATC B;  2HND B;  3OUY A;  2XO7 A;  3MTK A;  2JEF A;  4F4X A;  2UUC J;  1VBX A;  1HNW F;  1DAR A;  1VIO A;  1YBA A;  4RWW A;  4PG8 A;  4XK8 C;  5CCL A;  3PZP A;  2C22 A;  1N34 F;  1RAG B;  2DGS A;  3GJS B;  3CCQ S;  3ZZ0 A;  1YJW S;  2GGP A;  1R8B A;  3V81 B;  3LH2 S;  4TLR A;  1T9T A;  1SV5 B;  5BYR A;  2YQ3 A;  1YZ6 A;  2GFF A;  1RBA A;  3G6V A;  1IBK F;  1T05 A;  3MD1 A;  1SH2 A;  4F7V A;  2ZNY A;  4WWS A;  3H4D A;  2DRB A;  2J6U A;  3HLU A;  2PSZ A;  3MR7 A;  4NPO A;  4ED2 A;  3M4X A;  3V81 A;  3D6H B;  2MKI A;  2DGT A;  3QJP A;  3JQJ A;  2DNM A;  2N4D A;  2A3J A;  1BHN A;  2HQ3 A;  2YWH A;  1XMQ J;  4OHX A;  3F41 A;  1V6H A;  1OY6 A;  5EWF A;  4A8W A;  1HQE A;  3NWG A;  1EX8 A;  3BPS P;  3KNG A;  4ZCI A;  4B3T F;  2BW7 A;  3MPU B;  1UJ6 A;  4MIA A;  3RW6 A;  1HKA A;  1H2T Z;  2HBQ B;  2IDE A;  3BF4 A;  2IVF B;  1X5S A;  2ZBC A;  3GYG A;  3IGN A;  2W9B B;  4K0K J;  1EKS A;  4A8K A;  3HHL D;  2UXC F;  3SEO A;  1U24 A;  3PM9 A;  4ECZ A;  3D6T B;  4KSE B;  2QA2 A;  4WFA Q;  2D3O R;  4DL2 A;  2KJW A;  3W3S A;  4J9L A;  5A8W A;  4X4V A;  1HA1 A;  2BRL A;  2V0N A;  4AL6 A;  2AF6 A;  1RHJ B;  2OAU A;  3FSY A;  3FZB A;  2DNN A;  4I2P B;  5I3Q A;  2GO9 A;  1NK8 A;  2X51 A;  1VFJ A;  1D3W A;  1HAR A;  5FD1 A;  1RCX B;  5KFC A;  2HLT A;  2FTR A;  2A6O A;  4DX8 H;  1S1X B;  3SYZ A;  1NSQ A;  1RHQ B;  4UOF A;  1EP4 A;  3P4U B;  4B9T A;  1BQN B;  1BQM A;  1LNQ A;  2WVC A;  3EVW A;  3GFZ A;  4OX8 A;  3R8Y A;  2V4Q A;  1K0V A;  4O44 A;  1LOU A;  5THW A;  4QWB A;  2MKH A;  3I0S A;  1OPI A;  2IPO B;  5E0O A;  3DI6 B;  4OI0 A;  1SL2 A;  3W60 A;  2FLL A;  1FJC A;  1GXL A;  3OVS A;  2XUL A;  4A8X A;  5IM0 A;  1S4E A;  4GKJ F;  2WTF A;  4V1A k;  3OFF A;  3QSY B;  1IJF B;  4TU8 A;  1Y00 A;  2PC6 A;  1T8E A;  1X31 C;  4OYM A;  4CT8 A;  4F2R A;  4DV5 J;  2VFR A;  1SC3 B;  2JDJ A;  1OIA A;  2QSW A;  1SKW A;  4XIU A;  3KK1 B;  2E7V A;  4U96 A;  3T19 A;  1V3Z A;  4CQ1 A;  3UR0 A;  3E51 A;  4WFY A;  5CD4 A;  2LP4 A;  3LP2 B;  1MN7 A;  3KDN A;  1C1B A;  1VRQ C;  1C0U A;  2ZC3 A;  3K8W A;  1JLA A;  3BSA A;  3O8W A;  4PG6 A;  5JXS A;  4DPT A;  2Z4P A;  1X0F A;  2AWZ A;  2BAB A;  2CFX A;  1TEL A;  4I4B A;  3C66 A;  5HAN A;  3M1V A;  3Q2S C;  2HZC A;  5IT4 A;  2QMX A;  4ZVP B;  4NLV A;  5BR8 F;  2AYB A;  5DLF A;  1Y4Z B;  1S0O A;  1LWF A;  3VQT A;  4ZA1 A;  4ATN A;  5C7P A;  3MCS A;  2UXC J;  4EBC A;  2AHO B;  3AHP A;  4O0N A;  3S01 A;  4A8F A;  4QIE A;  5CYQ B;  4X65 F;  3UDE A;  1T9V A;  2K1R B;  1OYD A;  4ZP7 A;  2BKN A;  3CMA S;  3W8P A;  4DV2 J;  4IOC Q;  1R0A A;  1Y0H A;  1X4F A;  2WSC C;  2C2R A;  1GH8 A;  2F63 A;  5BYS A;  3ENV A;  2AT1 B;  2XGQ A;  1XNR J;  4LFB J;  4DL5 A;  3GWC A;  5DQG A;  3KMQ A;  2B8Q A;  3NS7 B;  2J7K A;  4J7C A;  1RKI A;  4Q7A A;  1NK0 A;  2QTW A;  3QGP A;  1RTI B;  5HO4 A;  3K5O A;  1SJR A;  2C2E A;  4U95 A;  3D2W A;  3FFI B;  3ZTP A;  2PMW A;  3IS9 B;  3W9I A;  4LRC A;  1GX5 A;  2HYI B;  2UVU A;  4RW7 B;  3CDU A;  3M8R A;  1PJ5 A;  4JYA J;  1P8G A;  4CT9 A;  3EMT A;  1KOH A;  2V69 A;  2CQD A;  3FEY B;  4DSF A;  3B54 A;  3UDV A;  4EK2 A;  4I6A A;  5HQL A;  4ZCK A;  5DET A;  5CYJ A;  1QAX A;  4NI2 B;  4FKY A;  4PG7 A;  3PG9 A;  4WYW A;  2XGP A;  2DNQ A;  1HWU A;  2EWH A;  4FP9 A;  2KZZ A;  1R3N A;  4OHW A;  2Y1L B;  1Y9O A;  5H9F K;  4DDF A;  2KG0 A;  1SVD A;  4B3O B;  1TK8 A;  4TY8 B;  3QGG A;  4IRD A;  1LFP A;  2V2Z A;  5K14 B;  3OTD A;  4ITS A;  3E8O A;  4M5G A;  4OZJ A;  1KEK A;  1P9Y A;  1IKV A;  4MYU A;  4C4W A;  2FZG B;  1JKH A;  3RB0 A;  1NJY A;  1D1U A;  2EC0 A;  1TL1 B;  2NZC A;  1RWP B;  1REV B;  5KFQ A;  1WAC A;  2AJ0 A;  1D9D A;  3BDP A;  4CM0 A;  2HZV A;  1QY7 A;  1YX2 A;  2BAN A;  3T1Y F;  2ZH7 A;  5AJ3 F;  1ACM B;  4ZKA A;  2KT5 A;  3CIM A;  2RDI A;  3HHL B;  4EO8 A;  3CCR S;  3A12 A;  4EYH B;  1LV5 A;  2HSE B;  4F3O A;  4KB7 A;  1S9G A;  2HBR B;  5L8R C;  4XPC A;  1NKB A;  1I94 F;  1HNV B;  1WOR A;  3SQO P;  4CLK A;  3N6M A;  1FFS B;  1S7I A;  1TAQ A;  4X4Q A;  2V4J A;  2UU9 J;  2JEG A;  3TAM B;  4NCG B;  5F8G A;  4PXE A;  2OGU A;  4UT4 A;  1LWC B;  2MZQ A;  2BV3 A;  3AFG A;  4WXW A;  4CO4 A;  2DHX A;  3EWG A;  5L9X A;  1QAI A;  2XS7 A;  3C46 A;  2CVI A;  4FNI A;  4IO1 A;  4CLZ A;  2V5H G;  5MAO A;  3J7A N;  1MMN A;  3K57 A;  2LLZ A;  4NEZ A;  5CAB A;  5HMY A;  3HHN B;  3K5P A;  4KH1 B;  2DR8 A;  3LAK A;  3KK2 B;  1NAQ A;  1V5V A;  4DL7 A;  5GAH U;  3HT0 A;  1DLO A;  3NCQ A;  1NRK A;  2VG5 B;  4ZOS A;  5EUH A;  3JQM A;  4JI1 F;  2AP6 A;  3LP0 B;  3QO9 B;  4DX7 A;  1UKU A;  1N33 F;  4Y65 A;  2ZUG A;  3A8I A;  1LW2 A;  2L41 A;  2OI2 A;  1TKX B;  2R7W A;  1CC8 A;  3IGV A;  2FJE B;  4LSN B;  1C1C A;  3M6U A;  4YOE A;  2DNG A;  3CB4 A;  1T9W A;  1F9H A;  4U8Y A;  4QCL A;  4I67 A;  1SC4 B;  3MCM A;  3AQO A;  1TL4 A;  1PJ7 A;  3IRW P;  2O1P A;  4P72 A;  4YB5 A;  1IJE B;  2YNI B;  4OZ0 A;  2WVB A;  1NU4 A;  3OBI A;  3W2V B;  3PW7 A;  3CPW R;  1MLA A;  3DRR B;  5HMW A;  2YWG A;  3DI6 A;  4DBQ A;  4DFK A;  2LEC A;  5BXI A;  4USM A;  2B6A A;  5E3C A;  4DL6 A;  2A0F B;  4XPE A;  4KR0 B;  2CXE A;  4F3Q A;  1VQ4 S;  4L75 A;  3MI7 X;  3BN7 A;  2HFZ A;  1RT3 A;  5GAH I;  1NKC A;  2AW0 A;  4PXB A;  1WHX A;  1SQE A;  2PA3 A;  4J9M A;  2DIT A;  3CDB A;  4HHH A;  4N7T A;  4ZPV R;  4O3O A;  3SCK E;  2ZH4 A;  2E5L F;  4P2F A;  4HAC B;  1RT2 A;  4KBI A;  4WYL A;  1EET B;  3NNA A;  2R8J A;  2UUA J;  4KKO A;  2B4P A;  2R3V A;  3DLG A;  3LPY A;  3MAA B;  5CQG A;  4CYU B;  2R7R A;  2VON A;  3BV8 A;  4R0E A;  4CNY A;  2YKP A;  4LRF A;  2D74 B;  2X7I A;  3A3P B;  3GJR B;  3BKT A;  3MM8 A;  3QQC D;  4HI1 A;  1GFW B;  1WKL A;  2WZ1 A;  3N5B A;  2WW8 A;  4JBC A;  1E6V B;  4ANE A;  5I3U A;  3G2X A;  2HGL A;  2HHP A;  1MW7 A;  1HD1 A;  4JI0 J;  2N3L A;  3DC2 A;  2XSJ B;  4IKA A;  1SBR A;  1U1Q A;  4F0H A;  1L3U A;  3EVO A;  2F8H A;  3FBF A;  2LXF A;  3H2V E;  3RBZ A;  1KOO A;  4ZJQ A;  2VKZ G;  1UL3 A;  3LOU A;  4ZVR B;  2OIH A;  4EZ9 A;  1TVR A;  3QID A;  1T02 A;  1B0V A;  4LR8 A;  3NS5 A;  3UR3 C;  2EFP A;  1JLC A;  2IRU A;  1JXV A;  4DN0 A;  4PWD B;  4L72 B;  4RUA A;  3FRZ A;  4DPW A;  1S5Z A;  4URQ U;  3G96 A;  2ZUA A;  5K20 B;  3F73 A;  1LXN A;  1VHF A;  2C3P A;  1VMB A;  2EFQ A;  1FFG B;  6FDR A;  2VU5 A;  4HAC A;  4E2F B;  1WF2 A;  1Z1Z A;  1D0E A;  2RRA A;  1RHM B;  4KKO B;  1S0N A;  5A8K A;  3D0G E;  1QSS A;  1S9G B;  1WTF A;  2MJU A;  5ETK A;  3TJ8 A;  4K50 A;  1RT1 B;  4PPZ A;  3KHG A;  3TRG A;  2XY7 A;  4IG3 B;  1FER A;  3D7S B;  1LW0 B;  3MAH A;  3JS9 A;  3GON A;  2NXC A;  4ZMM A;  2M8H A;  4KFB B;  3BM7 A;  5KG1 A;  5B0D A;  2HHQ A;  3HPO A;  4RW6 A;  2QLF B;  4ID5 A;  4S0M A;  2CQI A;  4OV6 A;  4USK A;  4ZP6 A;  5CZV A;  1Q16 B;  5KAK A;  1Z2Z A;  3J7Y U;  1WSR A;  4NXN F;  4UOG A;  2QO3 A;  2FHJ D;  3WC2 A;  3OL6 A;  1QLN A;  4BC7 A;  4DR6 F;  2KN4 A;  2UXB F;  5HLF B;  4YY3 J;  1QJH A;  2FJB B;  3QFW A;  4OJH A;  4OJG A;  3KJF B;  3JAM U;  1VQL S;  1CJU B;  3UWT A;  2OTJ S;  1JLB A;  2WON B;  3TEG A;  2ZH3 A;  4OYZ A;  2RJZ A;  2DHA A;  3R7B B;  4WBF A;  2RF2 B;  2MQP A;  1TKX A;  2FY8 A;  3OFH A;  4DV2 F;  3KUH A;  3BSC A;  1T9U A;  4NI2 A;  2KHD A;  3CUN A;  4ICL A;  2WVE A;  4IH7 A;  3GYX B;  5AXK A;  3SMZ A;  3KLF B;  4NCB A;  4R0J A;  2PDA A;  1FVS A;  2RU3 A;  1FKA F;  2KT2 A;  2LA4 A;  1UFW A;  2L9N A;  2CKW A;  3ILJ A;  2MJN A;  3T5J A;  3TQ1 A;  5I42 A;  2ZHO A;  1WC1 A;  3I4P A;  4K5S A;  5JVG Q;  3IN5 A;  4PQA A;  4OX9 F;  4I7F A;  1SUQ A;  2FZK B;  3RG6 A;  5KFS A;  5FLX Y;  2QV6 A;  1NJZ A;  1R0A B;  2ASL A;  4EZ6 A;  1FD2 A;  2FHJ A;  2K1R A;  4HH0 A;  2R7Q A;  3VF0 B;  4YHH J;  1HR0 F;  4J91 A;  3H40 A;  2V4J B;  3D67 A;  2KVI A;  4H4M B;  1TKD A;  3U27 A;  1KR4 A;  4Q2L A;  3VAI A;  4DQR A;  1AUS L;  4O3R A;  1F2H A;  1KQF B;  2VD3 A;  4NLD A;  4CRJ A;  5KG5 A;  1HLW A;  1APS A;  3ITH B;  4F25 A;  2J0S D;  3DM2 A;  3SQG B;  2R7S A;  1XQI A;  3AA8 A;  4DS5 A;  3D66 A;  2W9C A;  2QA1 A;  2IVM A;  4M5M A;  3WX8 A;  2CJQ A;  3J7Z 5;  3PR5 B;  2VKR A;  2CDR B;  2Z57 B;  4JI5 F;  1TL7 B;  5C2C A;  3R1H A;  3W66 A;  1QUV A;  2ZHA A;  2IY5 B;  1JB0 C;  1VQM S;  4FF1 A;  3T9Z A;  1MSW D;  2F8M A;  3JAM Y;  1SJ1 A;  2FC9 A;  5KT4 A;  3R5C A;  4GO7 X;  2M52 A;  1U47 A;  4Q0B A;  1WC4 A;  3RJM B;  1B7F A;  4D3G A;  4UY8 5;  3P49 B;  2ZBQ A;  3A8K A;  4Y2C A;  3J81 U;  2HFS A;  2GGP B;  4ALZ A;  4PEO A;  1IQT A;  3RYL A;  3V6J A;  4G65 A;  5AE3 A;  4FF4 A;  1FK9 A;  1RAI B;  4WCE Q;  4QR0 A;  4M5D A;  2YNF A;  3IR6 B;  4F4Y A;  4PKD B;  1CC7 A;  2KRR A;  2GC8 A;  2RKI A;  4LF2 A;  3RBE A;  2UV8 G;  1HMV A;  5CA5 A;  2JEI A;  2I8E A;  4NE9 C;  3POT B;  4JV2 A;  5DS7 A;  5A8R A;  2M5Y A;  4FVC A;  3GQC A;  4IFV A;  4HTJ A;  4OLO A;  2CG8 A;  1UCN A;  5G0R A;  5L46 A;  1RTZ A;  1NPK A;  4Y0F A;  3RTV A;  3M05 A;  4K0K F;  2AX0 A;  4HT7 A;  1HHQ A;  3MTJ A;  1I5O B;  3IRX B;  1KFD A;  1ELO A;  2HS0 A;  1H6K X;  3V6D B;  4JI3 J;  3QSI A;  4CO5 A;  1D9A A;  2YPZ A;  1N52 B;  1PCA A;  1N4L A;  3M2U B;  5JJB A;  1RAF B;  2V8D A;  3D3C J;  2DYA A;  1RAE B;  2FHK A;  2PO4 A;  1EQM A;  2BUN A;  3QRR A;  3TX8 A;  3DHW C;  1IKW B;  1IWG A;  1UW4 A;  1VS3 A;  1LEO A;  2PGC A;  2ZE2 A;  3DOK B;  4Y3C A;  3UN3 A;  3IP0 A;  1UEK A;  2YKN A;  2ASD A;  2PI4 A;  4DSL A;  5KG7 A;  2KKH A;  2YNH B;  3G82 A;  4X62 F;  1X4C A;  2UVR A;  4ETZ A;  3BKF A;  3CCS S;  4DSK A;  1IKY A;  2G2O A;  4Y34 A;  3D28 A;  2LVW A;  1U2R A;  2ZVI A;  4HVZ A;  3KLG B;  1HNW J;  2GQC A;  1Q8I A;  2ZZT A;  1U2F A;  2F40 A;  3TUZ C;  3LP2 A;  1Y5I B;  3MR3 A;  3MED B;  1FRX A;  2MMY A;  3V6D A;  3BEG B;  1YJ9 S;  2UUA F;  4NZ6 A;  1JWW A;  2EFN A;  3FQK A;  4KIA A;  4P6Q A;  4HHJ A;  2ROE A;  2XZD B;  3EPI A;  2OML A;  3NGK A;  3THV A;  2PII A;  3US5 A;  5LJ5 Y;  2DCL A;  3J81 j;  3EYZ A;  4NCA A;  2LCW A;  4DV4 F;  2D7S A;  5F3Z A;  2H65 B;  3SV3 A;  3FC9 A;  5D0E A;  2AYG A;  4PG5 A;  2ZJP Q;  1NZA A;  2L3M A;  2HNY B;  4AE5 A;  4WK1 A;  5J2M B; 
#chains in the Genus database with same CATH homology
 4DR4 J;  3R2C J;  4X64 J;  4LF9 J;  3J7A N;  4NEZ A;  5LM7 E;  2VQE J;  4X65 J;  2VQF J;  4DV3 J;  2HHH J;  4DV0 J;  1N34 J;  4PWW A;  4LF8 J;  4B3T J;  4JI2 J;  4YHH J;  2KL8 A;  1N36 J;  4LF6 J;  4V1A k;  5AJ3 J;  1XMO J;  2ZM6 J;  4DV5 J;  5IWA J;  4DR1 J;  1IBK J;  2F4V J;  3T1H J;  2MQ8 A;  3T1Y J;  4LF4 J;  4NEY A;  4DR7 J;  4X66 J;  3OTO J;  4DUZ J;  5IT9 U;  4X62 J;  4JI7 J;  1IBM J;  3R2D J;  4DR6 J;  2UXB J;  3D3B J;  4HHU A;  1XNQ J;  2UXC J;  2MEW A;  4OX9 J;  2UUA J;  3J81 U;  5FLX U;  4DV2 J;  4DV4 J;  4KYZ A;  4JI8 J;  1XNR J;  4LFB J;  4KY3 A;  4DR2 J;  2UXD J;  4B3R J;  4B3M J;  4NXN J;  4DV7 J;  1N32 J;  4LF7 J;  4JI0 J;  2UUC J;  1FJG J;  4JI4 J;  4KHP J;  4JI6 J;  4JYA J;  4GKJ J;  5BR8 J;  1HNX J;  4JI5 J;  5LMN J;  1N33 J;  2UUB J;  4LFC J;  4DR3 J;  1HR0 J;  4JI3 J;  3IMQ J;  3D3C J;  5LMU J;  4JV5 J;  4DV6 J;  4DR5 J;  4JI1 J;  1IBL J;  1XMQ J;  5A2Q U;  4RJV A;  4LFA J;  1HNW J;  1I94 J;  1J5E J;  4DUY J;  4DV1 J;  4K0K J;  2MTL A;  2E5L J;  3W1Y C;  4YY3 J;  3JAM U;  1HNZ J;  4LF5 J;  4NXM J;  2KVQ E;  3J80 U;  4GKK J;  2UU9 J;  4AQY J;  4B3S J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...