4AQYJ

Structure of ribosome-apramycin complexes
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4aqyJ00
4LF7J 4JI8J 4DV4J 4LF5J 4AQYJ 4RJVA 3D3CJ 4DUYJ 1XMQJ 4LF6J 5AJ3J 2KL8A 2MQ8A 2UUCJ 2MTLA 3R2DJ 4NXNJ 3D3BJ 4YY3J 4X62J 1IBMJ 5FLXU 4DUZJ 1HNZJ 2UXCJ 4DV1J 4GKKJ 2E5LJ 3J7AN 4NXMJ 1J5EJ 4JI0J 4DV6J 3T1YJ 4DV7J 3J80U 2VQEJ 4DR1J 2UUAJ 4LF9J 4JI5J 3T1HJ 4LFAJ 4JI6J 4JV5J 2UXBJ 1N36J 4OX9J 4KHPJ 3W1YC 4X65J 4LF8J 1I94J 5BR8J 1HNWJ 4JI7J 4DR6J 4X66J 4GKJJ 4DV3J 4X64J 4LF4J 2UU9J 1N33J 4LFBJ 4B3MJ 4DR7J 4JYAJ 4JI3J 4DV2J 4NEZA 1HR0J 4K0KJ 4DR4J 4LFCJ 5LMUJ 4JI1J 5IT9U 4DR3J 4JI4J 4DR5J 4V1Ak 2UXDJ 4DV0J 1HNXJ 4B3SJ 4PWWA 5LMNJ 4B3RJ 4HHUA 1N32J 1FJGJ 3JAMU 2F4VJ 3IMQJ 5IWAJ 5LM7E 3J81U 2HHHJ 3R2CJ 4DV5J 1IBKJ 5A2QU 3OTOJ 4DR2J 4KYZA 1XNQJ 2UUBJ 4B3TJ 2ZM6J 4JI2J 4NEYA 4KY3A 2KVQE 2VQFJ 4YHHJ 1N34J 1XNRJ 1XMOJ 1IBLJ 2MEWA
chains in the Genus database with same CATH superfamily
1RTDB 2YKNA 3CJRA 4X62F 4FYYB 3QT8A 2I9SA 3W2VB 4ERDA 1CULA 2VODA 4G3IA 2NXCA 4RZRA 4RUBA 4UZCA 1RAIB 2W9AA 3SSQA 3O44A 3R5CA 4OHXA 3EMTA 2DGTA 1S9GB 1R31A 4DV7F 4X4OA 5EHHA 1Y5LB 3MEEB 4QYZK 3IRXA 3MI7X 1X4FA 2DH9A 4C0HA 1L3KA 2W9BB 2BKNA 1BLUA 2AJ0A 1RU1A 4HT7A 2NREA 1S76D 1E6VA 4FBUA 2J0QD 4CTAB 4M5JA 1RBAA 5IM0B 5F8GA 3EGNA 1M5HA 4ANCA 2EK1A 3F56A 3TAMB 1S1XA 2JEGA 1YZ7A 2KYZA 3TZWA 2GCFA 1W2BR 2QT7A 4NYOA 1OWXA 2LA4A 1HNIB 2D9PA 2XO6A 4F4XA 3D1HA 2YKNB 1NZ8A 3PY8A 1KD1T 4CLUA 2ZH9A 5T7LA 2M5YA 1CULB 1G3OA 5B0FA 2GW8A 2LXIA 3H5XA 4RX6A 1OJ4A 1NPRA 1RWPB 2CQGA 2WONA 1ZETA 2EBEA 3U27A 1SIZA 3G8SA 3JQKA 1V5IB 2DITA 3R5BA 4ILLA 3BSAA 4UQGA 3GSDA 4IR9A 2RRAA 4DR6F 1KONA 4ZS6A 2AYMA 2HFOA 1UKUA 2OLWA 2UXDJ 4G1PA 1X0FA 1S6QA 1P6TA 5CYMB 2HKEA 4DLEA 2YX7A 1X5TA 3IWNC 3DN9A 3IAM9 1U45A 4DV5J 1U47A 2CNOB 1BC6A 3QZ7A 5KT2A 3I96A 4NCAA 2K3IA 1E6VB 1OY9A 1JLBA 1F9FA 3GIIA 3KUHA 4HI1A 2HFZA 2JOQA 1CVJA 2RD5C 4KTQA 1S1XB 1RWVB 5GAGI 2HIQA 4KH0B 2IPOB 3G6ES 5HMZA 1WACA 1NDLA 3GG1A 3HFKA 5I4MA 1PJ5A 3IGVA 1OO0B 2LCWA 2JEFA 1IXKA 1R8AA 1Y3KA 2E1CA 1O5JA 2FHOB 2RKIB 3K17A 2D3OR 2WONB 3R7BB 3EUNA 2PO4A 4B9MA 3CJ4A 1VQYA 1U09A 1HQUA 3MTJA 4JI1J 2N82B 2IAJA 4CNYA 2LKZA 4LFBF 1AW0A 1L3VA 2PA3A 4MIWA 2VL1A 2ZITA 4UW2A 3I31A 3AD9C 5M2UA 2V2QA 1RACB 3DC2A 2QLFB 1KN6A 1TL3A 3VQTA 1BE4A 1S6QB 1VRUA 3W3SA 1PJ6A 4DPWA 4ZIVA 4XO0A 4OYOA 3LWMA 1UL3A 4ZVFA 4DQRA 2W2NP 4R5PA 4ETXA 1WEZA 4YY3J 2V2KA 3BDPA 5HN0A 4QZVB 4JI0F 5A76A 3ZZTA 3AD8C 3J7AN 4NLWA 4Y00A 2HFVA 1JLCA 2HHPA 1Q5VA 5BR8F 4EBDA 2OEKA 1PKUA 4F8RA 5LJ3Y 4O0NA 3SYZA 4CLZA 5K8OA 3TEGA 1WG5A 5ETQA 5DG8A 4DFKA 2WBRA 2XI3A 2GA7A 3MCOA 1VBZA 2A2DA 3V6JA 1C4AA 2RQ4A 3FJ2A 2FJEB 1TUWA 2RE1A 3NMAA 1TKTA 4PABA 1S4EA 2AEMA 3BQ0A 2WBMA 1WDTA 3MUMP 1C0UA 3G2XA 2PI4A 2MKYA 2ZUAA 1HQUB 2IAJB 3NMRA 2DB1A 2AJ2A 2B4PA 3VVTA 3OR2A 4YUDA 3DOMB 3CJ5A 1EQMA 3CJ0A 1S12A 3WIUA 5C5JA 1TL3B 2KJWA 5DDRC 2HZCA 4K7QA 2CNLB 1VRUB 2KZZA 5DGAA 2RDIA 3VAIA 3MAAA 3THTA 3M8WA 4R5PB 2FJXA 3JXOA 1F5CA 4DL4A 1WJ9A 4OI1A 2PGCA 2P6TA 1CSJA 1JLCB 4ZJOA 3GV8B 1NAQA 4OYAA 4MYUA 3V6DB 4U67Q 1KQSR 4WXOA 2ZKTA 2EWHA 5SZTA 2J7WA 2VG7B 4ED1A 3JTNA 2V2ZA 1IR0A 2DPIA 2HZVA 1R8BA 1WF2A 2EEYA 2FLLA 2XLKA 1TKTB 2JL9A 2ZVSA 4WFAQ 2YNGA 1C0UB 1ZZNA 1F9HA 1B0VA 4A8QA 2IC3A 5L9XA 5I3PA 4WZMA 3V4IA 1N34J 2MDAA 1HLWA 2FHJD 5LL6d 3OR2B 1U24A 1N5YB 3PXGa 1HNZF 3MCMA 1NJIT 3D3BJ 4E8UA 3EPGA 1QUVA 1D9AA 4DPTA 3RYLA 3TYTA 3HHLD 4DR1J 3IA0A 3IO1A 3DCAA 3K5OA 1IKXB 2C3OA 4M95A 3QJJA 3W5YA 5CXTA 3HHDA 2RDDA 3UR3C 4A8FA 2FJAB 5ETOA 2GVZA 3OT9A 5L46A 1XR7A 2MY7A 4A46A 1X7VA 1QSYA 1EJ7L 2PD1A 4OX7A 5ETKA 3VTIA 3C6UA 4DI6A 1T9WA 1IVZA 4DCOB 4ZP8A 3DYAB 2KHCA 1FX4A 1FVSA 3UN5A 3H4DA 3C15A 4YR3A 4DQPA 3EX7B 2LU1A 3DLBA 5KAKA 4DZDA 3MHYA 2QYGA 2P8IA 2AGOA 5D4LA 2YNGB 3K7RA 2ZH7A 4ZPBA 3T5JA 4DUZF 2DISA 5KG7A 1FJEB 1SJQA 3TVKA 2B4VA 1NSAA 1JQGA 4M5IA 4YEAA 2V34A 3T1YJ 4N8OA 5KFGA 1HKAA 1FWLA 3GV5B 1J5OA 1RAGB 2ROPA 2BACA 1RHKB 1LFWA 1TELA 3CC4S 3GG0A 3VZHA 4BBYA 2R7TA 1CG2A 5CCLA 2W01A 4O3SA 2FYXA 1NBEB 3A1YG 2DNZA 3POTA 3G4SS 4JV2A 2NUUG 2GV1A 4DFMA 1I5OB 1I6JA 1RBOB 3C6UB 2XB2D 4G6VB 3SIPB 4XIUA 4K59A 1AT1B 2AV5A 1UEKA 2MJNA 1F0XA 2YPZA 5F9NA 5IFMA 4OZ2A 4X4QA 1U2CA 1F60B 3UWTA 3DOLA 2O1PA 3ZC4A 3CCQS 3PX6A 3C15B 4DG1B 3KLHB 2K06A 4C8LA 1ZYQA 1TR0A 4OZJA 1RQ0A 1UMJA 1WHXA 3OBIA 2BQ3A 2UUAF 5GAHI 2W8LA 1N0VC 2DNHA 1CS4B 1FE0A 1PCAA 2UV8A 4LF8J 3AJ2A 5D3GA 1SVDA 2P5VA 2ZOGA 3CCTA 2NLWA 1UVIA 3CJ2A 1KSPA 1NDCA 3AD7C 1J5OB 4QR1A 1EP4A 5CHCB 1SKRA 5JMNA 4DV3F 3LH2S 1S1TB 4M8LA 2Y1LB 4DR3J 1WOSA 4OV1A 1HNXJ 3QGIA 3CC2S 4HHUA 2EW9A 4C2MA 2HHUA 2NXUA 3QPIA 3K59A 4NZ7A 4FNIA 3POTB 3WHIA 2VDHA 2RS2A 4RW6B 4C3KA 3OW2R 4Y6IA 1F5AA 2ZZTA 2BX6A 4WTYA 3CDEA 4CP5A 3A12A 5E7OB 3MUVP 2VC1A 1NPKA 3EJMA 3I87A 2CYYA 1RE1B 1GXTA 4GKKJ 1U02A 2BRLA 1OPIA 3D0HE 4TY8A 1UJ6A 1C0TA 4LREA 4UOHA 3PW2A 5DETA 2KM8C 1HNWJ 4RW9A 1SI9A 4GKJJ 4OYPA 2HURA 3PVXA 2UVVA 3O8WA 5CD4H 2QC3A 4O3RA 1HL6A 4C8NA 5LXRA 1RBLA 2ZC4A 2KI2A 4YR0A 1GT8A 3IR6B 1EP4B 4PCQA 5E41A 4PUOB 2QA1A 2HMIB 3FBEA 4KGVB 1DTQA 3TZYA 3M8PB 5CA5A 2UUBJ 1S5ZA 4F36A 2AYGA 2ZZNA 2AW0A 2ZVIA 1IM4A 2RQKA 2CFXA 2Z2YB 5HQLA 1XNRJ 2LQ5A 1R8HA 1H6KX 2CQ3A 3JS9A 3MM7A 3NGUA 4I2PA 2EFNA 3GV7B 3VAMA 4DV1J 1TV6A 4JI5F 2B43A 3ZTRA 4DQSA 2HQCA 4QIGA 2KU7A 1K8AT 1RABB 4K4TA 3OL9A 2IM0A 4HKQA 1C0TB 3E8OA 5KFMA 1JNRB 4P2FA 1KQFB 3FGVA 2FZGB 4EYHB 1NEEA 2HBRB 3UN2A 4QQBA 4OI3A 2BA9A 3AOBA 2FJBB 2BZ2A 2G0IA 5KFNA 2E66A 3Q0AA 4TY9A 2YKMB 2N4CA 4RBTA 4R8UA 2H5JB 3Q8RB 2BJEA 3KUGA 1MROA 1GFWB 3KKFA 2VC0A 4M5NA 1U0HA 4ALZA 4EUVA 5E33A 2I5JA 2GAGC 1DTQB 1KNZA 2EFPA 4AXJA 2CJYB 1QSSA 1IWAA 4PR6A 2Y9HA 4YHHF 3W9IA 2GS8A 2OMLA 3TJ9A 1B70B 1QM9A 1WKJA 4QJVA 2GO9A 3N6LA 5KG0A 5AXMA 3I0SA 2XS2A 2KM8B 3M2UA 1WTFA 4HHHA 3TAPA 3ET6B 4USIA 1NLKL 3AY0A 2V4QA 2DTJA 4ATNA 1TAUA 4OHVA 2MLYA 4K0KJ 1MNEA 3ZZPA 2KB2A 3NG8A 3VAFA 2QA2A 3M4XA 3N9UC 1S48A 4JI3F 3OVBA 3KK2A 1PBUA 3AA8A 2XMTA 2DXEA 3OTOF 2HHQA 2XMJA 4NLGA 2GVDA 3OL8A 2G0CA 5F0UA 1UPMB 1S9EA 3QO9A 1PAUB 3KNAA 3THPA 3O5TB 4LRFA 5A2QY 2F7VA 2AJ1A 2DEIA 2LQ9A 5ITHA 2KFZA 1H7XA 4R8UB 3D28A 5EDWA 4TU8A 3ISNC 4JI8J 1MROB 4RUAA 2RNEA 5B0CA 3N4WA 3BN7A 2X1GA 3AB4B 1U0HB 1PAEX 2I5JB 2YBVA 1OY8A 3FZBA 1X4EA 3TQ1A 3NCPA 2HVDA 4B02A 1O8BA 1ZA2B 2R7QA 3MFHA 5KTQA 3PW4A 4DUYF 1FHTA 1L3SA 4L73A 3OQ2A 3F44A 1RWWB 2VA2A 2R8JA 1NU4A 1UP1A 3TA2A 3V81A 2B4OA 3BO4A 1GTHA 1OMSA 3M2UB 1W25A 2QA4S 3H8YA 2HAIA 2LXFA 4ICLA 2OPQA 3BSOA 4U8VA 5A6PA 2OPPA 2E29A 1UVMA 3PYEA 3J81U 1H3DA 5AXKA 3DRPB 3H2LA 1WWHA 3ENQA 3KK2B 3RAQA 2MQLA 3LPEA 2GX8A 2WK4A 5L9NA 2GVDB 2Q6BA 2CRLA 3VGUA 3CD5A 4NPOA 3DLEA 1S9EB 3N5FA 3QO9B 2OUGA 1QAYA 4HACA 2OTLS 3AQPA 2MQ8A 4E0DA 2LXUA 2V8DA 4O4GA 2E5LJ 4F0MA 3T6BA 2KXHA 3EM1A 3L09A 4TLQA 2WZ1A 5D77A 1HBOA 4EI2A 3KLGA 5F3TA 1FJCA 2LFVA 1B7YB 1VQLS 3PIPQ 4NXMF 4ZP7A 6AT1B 2KTQA 3GQCA 1MG7A 3UNYA 1OPZA 5J1PA 3CPWR 3QATA 2VPZB 2O01C 3V81B 4ZKAA 3SCKE 4ZLNA 4LR9A 2HEKA 2UU9F 4OJ3A 3RR8A 2NUHA 3CJSA 4PXEA 2XWXA 1X4AA 5LMUF 1GQEA 4F25A 4EWTA 2DIVA 2OPPB 4GVBA 3SSSA 3I32A 1UZDA 1FE4A 1NSPA 2F4VF 2F4FA 2OEJA 2VBWA 2WW4A 3GFYA 4OIXA 3EXCX 3ILOA 2D69A 5SUHA 1FNMA 3IR7B 1LW0A 4DV4J 3PYGA 1G6BA 2VFTA 3JSMA 1HWIA 2Y1RI 2OPRA 1NK9A 3DLEB 5J2PB 1PIEA 3JTPA 3CCWA 2GHWA 3BKFA 4HACB 3D66A 4FZVA 3H5YA 4ZJQA 3KK3A 2UXBJ 1Y9OA 3O3LA 3J80Y 4O4GB 1S0VA 1JX4A 3HXMA 3H98A 1Q7LB 1J5EF 1NO8A 1KRPA 3F41A 3W64A 3UN3A 1HBOB 3KLGB 1P27B 5HI7A 3RB3A 1TKDA 3KDNA 1U1KA 3AAWB 1NK6A 5ETMA 2FJWA 1TAQA 3T5HA 3SQGA 1K9MT 4WKRA 4QWBA 3D67A 1TKZA 3Q86A 3ICLA 4IH5A 4FP9A 3SQOP 5ETLA 5GMDA 3R1HA 4A8OA 3BF4A 1FRLA 1LWFB 3MWBA 4ZCLA 1LWCA 3Q8YA 1LW0B 4ECQA 4ECYA 3KHLA 3JSMB 3G8QA 2OPRB 3GTYX 3DLGA 3A3NB 4OJHA 3NNAA 2Z8QA 3G82B 3CW2C 2BQRA 1PYSB 4P2XA 2XCPA 1T94A 2WRMA 3KG4A 4LJMA 2FHMA 4TNOA 1U6FA 3DRXA 2JJ4D 3BYPA 4MK7A 2E9RX 1CJUA 2FC8A 1RXOB 4Y34A 2CDRB 1R8CA 2BJ9A 1JLEB 1HBMA 2G2ZA 2HHHJ 4K5RA 2PIIA 1RAEB 3S7RA 4WFNQ 4EYIB 1I51B 1FWKA 2AYEA 3RBDA 2VONA 2C2ZB 4H4MB 4B9LA 3SQGB 2KZMA 4CZCA 3MD3A 5GMKa 2R7RA 5KFRA 1TKZB 3ULHA 1R0CB 1XMBA 2PFFB 2C2MB 2GFFA 3H5UA 5H9EK 2HYIB 1B0TA 4C97A 4OX9F 5L1JA 3C6TA 4DBQA 2JEJA 5KT7A 4RO0A 1R89A 1LWCB 2CAJA 3J7A1 3ZXWA 4O4RA 1SJ3P 1RTHB 3DLGB 5KT5A 3LWLA 4L76A 1VR6A 4L75A 2PC6A 4DR4J 2CJKA 3B4DA 3K8VA 2RUGA 1ZAXA 2P9CA 2RQMA 4LBIA 4PWDA 2HHTA 5F8HA 1KHWA 3QSYB 4ZVRB 1DY3A 4MH8A 3TNVA 3TARA 1UVLA 2W7OA 1UW4A 4N5SA 4ZHRA 4J37A 4DR2J 1XQIA 4GVLA 3ZZOA 2ZOMA 3KMSA 4JI2J 4FYWB 1HBMB 4TKTA 1HI8A 4YOEA 2N7CA 4NXNF 2BJ3A 4FXWA 1FTCA 2C2KB 2W24A 3JSYA 4DPOA 2IA0A 3CDAA 5EWEA 2DR7A 2GC8A 5FD1A 1S72S 1DRZA 1HI1A 4UOCA 4FNHA 4NLPA 1C1BB 3MEDB 1TUVA 3IWXA 1IQTA 3K2YA 4ZPAA 3M9OB 1ITPA 2A3JA 2AJFE 1SQGA 1A9NB 3DDIA 2A6OA 2JDJA 1URNA 1QVGR 3DMJA 1FVQA 4Q2MA 4B3SF 2JLGA 1RT1A 2ZWPA 5LMNJ 3R6GB 3IMQJ 5LM7E 1PO6A 4PWDB 4I1TA 3M9MB 3I4PA 2UXDF 3P45B 1CC7A 4KGMA 4OYWA 1XBWA 2HIYA 3L4BC 2Z0GA 2LVWA 4LF7F 3SCLE 2BE7D 4ZHRB 4DV5F 4Y28C 3GE9A 4ECUA 3QIDA 3G6YA 3AQOA 1GMVA 1M5SA 4OZNA 3ZZZA 1N52B 2UXCJ 1TZ0A 2D3UA 3C16A 2DY1A 4CYUA 3S1TA 4XDDA 2UV8G 2KRRA 3I5CA 2J0SD 1DJ0A 1RWUA 3L3CA 1WF0A 4WCEQ 4X64J 2IRUA 4QWEA 1LK7A 1S9FA 2J6TA 2B7CB 1UVNA 2D3ZA 4ECTA 3GFHA 1U1PA 4EZ9A 3MPWA 2DGOA 5KFFA 3AB2B 1TFYA 3RB6A 1S1UA 3M8QA 4NLOA 4UZBA 2AX1A 2M88A 2G9OA 1FNOA 4P71A 3S8SA 1RT1B 1VI7A 1Q8KA 1REVA 4FF1A 1S77D 1OYDA 4CM0A 2XZDB 4M1KA 2BOAA 3IM9A 1F2HA 2WSFC 5F8NA 3W8PA 1IBLJ 4HI2A 1H38A 2XSFA 2V94A 1T11A 4AQYJ 3DU5A 4WK1A 1DHMA 2WB4A 5IV4A 1KC8T 3R2DJ 1L3UA 4V19X 2LYVA 1HW8A 1RT7A 3MURP 1JLQA 1U2RA 1PBAA 2KVIA 4CIOA 4JI6F 3A8KA 3KNGA 3HD2A 3MM9A 3T1HJ 3RU0A 2DCLA 2HS4A 3DRRA 5E3QA 1RA6A 1H2VZ 1Q0NA 3C16B 1GH8A 4CYUB 2DNMA 4LRCA 1ZTWA 2NSCA 3CTRA 3HT0A 2ADCA 5H9FJ 3VAGA 1B99A 4DX6A 4OZ5A 2VFRA 1KS2A 1RYSA 3PKMA 5KFBA 4FDFA 2NZ4A 2IJNA 3ILIA 2MXYA 2O5DA 4Z7YA 1QE1A 2Q79A 4DSEA 2CQ4A 1H0HB 1Q95G 3FFIB 2QL9B 2HSEB 1S1UB 3M8QB 2XY6A 5K14A 2BDPA 4B3TF 3HHNB 2W4DA 3BS9A 4MKAA 2HQ3A 5KFXA 3W61A 3NOCA 3NGKA 3R7NB 1T9TA 3HVTA 5F8LA 5AE2A 3VAKA 1GTEA 3ONQA 1UFLA 3B78A 4QBUA 5JVHQ 2DEJA 5FLXU 2CPXA 3FQLA 2YNIA 4F67A 3MR2A 1NCLA 4M5HA 4Q45A 5L1KA 2UUTA 4LF9J 1RAOA 3TW0A 1N6QA 1RT7B 1XC9A 2N4DA 1JLQB 1KLMA 2NZCA 3A4TA 4WKYA 2DHXA 2C3UA 5IT4A 5D0HA 3DRRB 4DL0C 3BBFA 4MTPA 5GAEU 4WE1A 1RTZA 5AXNA 4F0HA 3IRWP 1N8RT 2IHR1 4AL6A 3UFCX 3RZAA 2VOOA 5IWAF 3HZGA 3MPYA 4KGKA 4EU0A 3HVWA 4USJC 5D4PA 1NK5A 1QAXA 2PEHA 1QE1B 3RAXA 4M5GA 2ZM6J 3SFGA 1IR1A 1YGYA 5KG5A 5K14B 4USHA 2ASDA 4X4RA 3P5BP 3EVMA 5DDQC 3VGVA 4RLEA 4AXIA 1JKHA 1Q81T 3QMQA 3HVTB 4P10A 1CQNA 1WORA 1KVKA 4ILRA 3U1NA 3H20A 2ZH3A 1SL2A 5HL7Q 1H2UX 3CT9A 1S57A 2ZH1A 2DNOA 2JNJA 1UJ4A 5FDLA 3OPKA 3CD0A 2R7OA 5DG9A 2AKWB 2X3GA 2GGPB 4DR1F 4FF3A 4OI4A 3FCVA 2J0XA 2FY8A 1KTVA 2LQ8A 1KLMB 4CM2A 3CIZA 2IYIA 3IBWA 2LEBA 3UCZP 5KFHA 1CJKA 2MJUA 3FNNA 2X1AA 3LGNA 3PW0A 1FXRA 3RW6A 2HVZA 3GIMA 4MJKA 2AGPA 3KOAA 4WE1B 2EFQA 4WYWA 2OGUA 2FLOA 2RIJA 4K4SA 2PT0A 4NI2B 2RS8A 1T03B 1NDKA 4IKAA 5IV3A 1LWEA 3KLEA 2C2OB 2BXJA 1WC0A 2P9GA 1X9MA 3A8EA 3HFVA 1U6ZA 1IBMJ 3W7BA 4ED4A 4Q43A 4USTA 4I56A 1RT2A 1LQ9A 2E5HA 5D0RA 3KJQB 1JKHB 1U8SA 4XTTA 3KLVA 4X66F 4LFAJ 2F8HA 2JWNA 4JBCA 5B0BA 5K8MA 1B7FA 5H1SV 1N48A 2E44A 1F2GA 4ZP6A 4IRDA 3OUYA 5DRKA 1WD6A 3D1OA 1REGX 4F3QA 2ZBQA 4DR7J 5FDLB 1NM2A 4NEZA 4ECZA 4WWSA 3MZIA 2KO1A 5KFSA 3UO0A 1RAFB 2OPSA 2KRBA 4URGA 1UAWA 1BY9A 1JXVA 1U2FA 1CJKB 4EBCA 2QZ8A 1GNKA 2F8EX 1VHIA 1K47A 4KO0A 2V0NA 4NLYA 2VG6A 2MZQA 1YRTA 2RILA 2H4YB 4I6WA 1HD1A 1JJ4A 2U2FA 3OJSA 2QV6A 1TUGB 5E3AA 2XS5A 2HRTA 5J2NB 3CJ8A 1N0UA 1WI8A 2EPIA 3P6YC 1VC6A 4NE9C 1HHSA 3KLEB 4X62J 3TA1A 2CQ2A 2R3VA 1QLNA 3D6MB 3EDRB 4YFUA 3MMCA 2UUWA 1EQ0A 4ED3A 3I82A 2WTFA 5M2RA 1ROFA 2X3DA 4ZA1A 3PTWA 4LF8F 2MYFA 4XPEA 1U1RA 4JI4F 4HR2A 4LQ3A 2R9LA 3SDEB 2V8GA 4BCAA 1NB2A 1U8WA 2NYIA 1SKWA 1M1GA 4DR3F 1P1TA 2OPSB 1IKYA 1Q53A 3JAMY 2IJFA 1HNXF 4CLYA 1FI4A 4IO1A 1RCXB 1EZZB 5BYRA 5KFAA 2VPYB 1R3NA 3LO3A 1RSCA 3NAHA 1MMDA 1WKKA 2POKA 4KO0B 3L7PA 4LMZA 4NA2A 1Q82T 3OR1B 4KB7A 1UJ5A 1G1XA 3LP1B 4NYPA 2XGQA 3WIVA 3BO3A 4BDPA 3DXSX 1RLDA 4YN3B 2H5EA 4FPIA 4K4XA 3VV2B 7AT1B 5HROA 3KJFB 2L48A 3K5LA 4QW8A 4GKKF 2AEJA 4KKOA 3FCHA 3NY0A 2GQCA 3QNWB 3MMCB 2D7SA 1KOHA 3Q2SC 1RP5A 1IKVB 3NLCA 3MMAA 4GKJF 1YRUA 5IXUA 2XYHB 4B3RF 1HHQA 3ADAC 2IVMA 3Q89A 4ZCKA 2DGVA 1HNVA 4K50A 4OJGA 3PKYA 3QIPA 1WF1A 4KC5A 2BR0A 4K4UA 4W92B 2F63A 1MSWD 4DS4A 2IDEA 2W2PP 3BH6B 3PV8A 2HW3A 2MHNA 1IKYB 3RRKA 5A8RA 3TAQA 3MR3A 2B0GA 2DXFA 2UUBF 3DHXA 5C24B 3M6UA 1H2TZ 3W5ZA 3MXHP 2EG1A 2ABYA 2XTJP 4KGXB 2Y1IA 2PN6A 3OXFA 2CQDA 4R0JA 5HSPA 4OX8A 4ZPDA 3X3UA 2DNLA 1EIYB 3GJQB 2HNZB 2KT5A 3BSCA 1F1BB 3HHEA 2IDLA 5G4DA 5FJ4A 4P7VA 4KKOB 4Q8FA 1NK0A 2RAQA 3BPDA 4Q44A 4CLPA 3W62A 3NP5A 3CDWA 4OL8A 3VAHA 1FWPA 1IJEB 3P5TL 2CQ0A 3MEGA 1C4CA 3H2UB 4I6YA 3LPYA 4ZVTB 1KOOA 2VPXB 1HQ2A 5F41A 1X8DA 3I5AA 5CYQA 4NLRA 4QR0A 1S59A 2HZAA 2IJRA 5C7PA 1HNVB 1DBDA 4NCGA 3QIPB 3HSGA 4ZK7M 1X31C 2O3DA 1V3SA 2K3KA 4J9RA 2ACYA 4CT9A 4QIWD 5A8RB 4BC7A 4JI0J 1PSDA 1BGXT 4RW7A 4ED5A 4ID5B 2XY5A 2R8IA 1FRKA 4U7UD 2EI5A 4EFAC 3OTDA 2Z57B 2YTCA 4J9MA 5BXIA 1WI6A 2X1BA 4M5DA 5BR8J 3PX0A 2VG5A 1NKBA 4B3MF 4Y2AA 5I3UA 3AH6A 2RUSA 2IBKA 3OFGA 1VBXA 3NGDA 4KHRA 4I67A 2ZBCA 4NLVA 2OO4A 2RU3A 2XYGB 1U1QA 3UW1A 4QWCA 2R2SA 3QSIA 4A47A 1VHFA 4F0KA 4K0KF 4CWBA 3PG9A 1QUPA 2BM0A 1Q8BA 1VBYA 1TK0A 4TU7A 2E1PA 3SFUA 5A8WA 2OKQA 3MEGB 2AWZA 2D3O1 3M6VA 2W9CA 5IOLA 3FSXA 3LF0A 5KFWA 1PGZA 2DRBA 2MEWA 4K4YA 5CYQB 3QAEA 4F4AA 3PRVA 1UPPA 2C2RA 1EARA 4NCGB 4C48A 2G0JA 2GJ2A 1HWLA 2XHWA 1RDRA 3U1MA 2HQFA 3I56S 5KT3A 4QPXA 1T9VA 1Z1ZA 3T1AA 2R42A 5RUBA 3FEXB 1RT5B 2W1BA 1HPZB 2N3LA 3EGWB 4Q7AA 1SJRA 2U1AA 4RW7B 4LSNA 1TTHB 4U96A 3M2VA 2Y1JA 3Q8QB 2GJIA 3DLJA 3EWGA 1R0BG 4CH7A 2VG5B 1IJFB 3VR1A 4IO9Q 3MOZA 2I6WA 4J91A 4C98A 5GMEA 2R4FA 4AT1B 2ZHOA 1S79A 1NHUA 1V6HA 2B9EA 5DLFA 2XHCA 2ZDPA 1M90T 4X4NA 5KFDA 3OV7A 4CO5A 5HMYA 4X4TA 3MECA 1BWEA 2H4WB 1WUUA 4CRJA 2JLFA 2JLEA 1W26A 1JB0C 1Z4UA 1HIYA 3DNCA 2E7XA 1ELOA 5A8WB 4U6PA 3M30B 4W4MA 2KL8A 3DI6A 3I6PA 2W9CB 3HK2A 3BGRB 2MZJA 1HNZJ 4JV0A 2DNQA 3DDKA 2AJ4A 2LQJA 2YNHB 3NS6A 3MMBA 4JI7F 4Y65A 5J1NA 3OFHA 1FRJA 4YB7A 3HT3A 2E5LF 4NYZA 4LT6A 2MSSA 3W63A 3RW7A 2JRSA 2W7AA 4Q0BB 2BKOA 1RK8A 2CQBA 4OZLA 5HQMA 1KHVA 2DGSA 4C8KA 4D3GA 3MEKA 2RMLA 3MPUB 2BMBA 4LSNB 1EKSA 3D0GE 3KJNB 1ZM2A 1OSCA 1TK8A 2ZE2A 2R8HA 3GMGA 4RUCA 5E0OA 3A13A 4ZP9A 2J7UA 1IBKJ 5A2QU 1RAAB 4F4ZA 2WSEC 1RHQB 1QVFR 4NASA 1OSDA 4CLFA 3Q24A 3I55S 2UVRA 1JJ2R 2KKHA 2B4UA 2Z56B 3MECB 3T19A 3A3OB 3F73A 2ZH4A 4LF6J 3QRPA 3B82A 4A8KA 2OSRA 2JFKA 1EB0A 5HATA 2FVRA 1X4BA 1HD0A 1HBNA 5L39A 4DFJA 1N56A 2UVWA 4DUZJ 1SH0A 1Q78A 3R1LA 3HKWA 3M05A 1K0VA 3DI6B 3D2WA 2IMOA 4IRKA 4P2SA 5J2QA 2AEFA 1WC5A 1R27B 2BW7A 4LF4J 3IRXB 4NLQA 2E5JA 4DL5A 1CJTA 1WNEA 2UVUA 4DL7A 2CVIA 2J9CA 3PFEA 3HX9A 3SCIE 4KSEB 2CQHA 1OIAA 1XEZA 3PIOQ 2XMVA 2L41A 1T3OA 3UDLA 2XCAA 2Z2MA 3PR4A 4H54A 3WQPA 1JMTA 1GK8A 5E3CA 4DDFA 1XN9A 1DQAA 2OEMA 2VPWB 2HVIA 2FTRA 4PKDB 5KFJA 2ZHAA 2ZE2B 4F4WA 2XLJA 4RWXA 2V50A 1TFWA 4WBFA 1LW2A 3VCDA 4OZ3A 4B9TA 4RPFA 5T7LB 4P75A 4HH1A 4WP3A 2BKPA 1NK8A 1SQFA 2UUAJ 4F26A 1N36J 3S6EA 3SSRA 1WC1A 3CEDA 3MF5A 2HLTA 4QYZJ 4ZN1A 3QRRA 3NL0A 1ULRA 1N33J 2R7UA 2ROEA 1HR0J 5J2QB 4XPCA 2W4PA 3BR9A 2CJQA 3UE2A 4MYTA 1CJTB 4C0BA 4PZVA 1SC4B 3BR8A 3FKBA 1IWGA 2WSCC 2QA4G 3HVRA 2DJWA 3NAIA 1C1CA 1FJGJ 3PZPA 2HS3A 1U1NA 1ZZFA 1JLBB 2DCUB 4ZLPA 2MKHA 4LR8A 1XMQF 4C8MA 2QSFA 3G6VA 1T3NA 4HEA9 1S49A 4UUWA 2QL5B 1KBRA 2CZVC 2EBGA 4ZDNA 3S01A 2BBEA 3CC7S 3J80U 3M8ZA 3PW5A 4DN0A 1X4HA 1NPPA 1EKRA 1X5SA 1AXQA 1KR4A 4ZVQB 4DSJA 1BUXA 3BREA 2RT3A 5LSLA 1J2VA 3T9NA 3RGIA 1QD1A 4CO1A 3CULA 3IBFB 1JNZB 1AA1B 1AZSA 5L1IA 2YX1A 1QAJA 2HQIA 1OY6A 4NRUA 5ETVA 2EC0A 1VIXA 2QMWA 3GIKA 1XJWB 1C1CB 2RQCA 5JJBA 2XMAA 3CCVS 1BWVA 3HHLA 1FFSB 2JH3A 4WU2A 4NCBA 4N8NA 2X7IA 5KFLA 4ECWA 1QSLA 4JI2F 2Q43A 4W98A 1JLGA 4DMZA 3CD7A 4ZVSB 4EEYA 3KHHA 3NS5A 4ITSA 3LW5C 4KHPF 4M63A 1D9DA 1HHTP 4JI5J 3QT7A 2J7KA 1NNDA 5I42A 4U7UK 5DM6Q 2Y0SD 5F0WA 3NCQA 4RNMA 1U7LA 1YKWA 2VOPA 2R2TA 3GZ7A 3HPOA 1T95A 1J27A 3KWMA 4PAAA 1YLXA 4MK8A 3C14A 2CQ1A 3U1LA 2QLXA 3PEHA 3AJDA 3UDCA 1Y11A 2QYCA 3OXLA 2PE8A 1MU2A 1RLCL 1YQHA 1SJ1A 2CDQA 4F50A 4QOTA 1S4FA 1JJHA 4ILMA 5DGBA 1BHNA 4DL2A 3D1QA 5LMNF 3NRBA 2MKKA 1WEYA 2HLUA 3N28A 2FLNA 4NA1A 2X1FA 2R8GA 3MAAB 1DURA 1H74A 2DR6A 2CG8A 3NGSA 4OYBA 4LBPA 3BBBA 1BQNA 4DV6F 3SEOA 4PG6A 3BGFA 4CO4A 3H40A 1ZH5A 2E7WA 1E6YA 4D3HA 5KFYA 2NQPA 3FBBA 2IRXA 4QU6A 2B51A 1JLGB 2JVOA 2CUYA 2RU9A 4ZN3A 4ECXA 1X9WA 2OELA 5I42B 3L7UA 4DL6A 8AT1B 2EFGA 1YRXA 1NKEA 1RHRB 2A0FB 1S6UA 1PJ7A 3DGPA 2HBQB 1SL1A 3TVYA 1D9FA 3N6MA 3K57A 4DV0J 4P74A 1FK9A 2PEBA 4Z7CA 5KFPA 1RA7A 3NS7B 5ETTA 4BC9A 2VKRA 2Q3PA 2IC3B 3QRQA 3OTOJ 1M5PC 2MPUA 3V4IB 4DF4A 1MU2B 1V9OA 1WSRA 3OVAA 3M8RA 2LEAA 2I0XA 4IQXA 2MGZA 1N5QA 3JTOA 3HMJG 5KFQA 3VF0B 1FX2A 2V4RA 3UVJA 4PPZA 3MM5A 1G2EA 1F3VA 3B8HA 2YKQA 6FDRA 1PILA 4FS2A 3TVZA 2JHEA 1NHVA 3HI9A 3LUYA 2VQEJ 1WG1A 4J9QA 2ATLA 1BQNB 4R0EA 5K8PA 4WFXA 2GVZB 4FBTA 3ITHA 2MQPA 4WPAA 4DXLA 4MIBA 1VISA 1HYSA 3THVA 5C2CA 2B5JA 5LSRA 2KH9A 1YJVA 3PYFA 2JSXA 4DL3A 3FBCA 5KT4A 3D5MA 2C2DA 1FO1A 2YQ3A 4K4WA 3OLBA 2ZJRQ 2AYBA 4OI6A 1F5BA 2ROGA 1FK9B 1YDLA 2CVEA 2YVSA 1FKAF 5D0GA 4ELUA 4QU7A 1KFDA 1OS5A 1KKHA 3W65A 1XMOJ 2HWHA 5G0RA 2HFUA 2QLWA 1WHYA 3U02A 3TJ8A 2BW2A 2ZWOA 3ENAA 5HK4A 1NHKL 2AHOB 2JVRA 5D4OA 3GJRB 3OHAA 3UVJB 4HL9A 3MM5B 4N56A 1CJVA 5EX0A 3R27A 2B3TB 3SZ2A 2YY3A 3KYLA 4NZ6A 4G65A 2MQOA 4LF9F 4J90A 2AGQA 2ZBIA 1Q7YT 4UF4A 3PHEA 3ITHB 3LANA 3HZEA 3MMJA 1HYSB 1JIHA 3M2RA 2ILYA 3KHGA 2B5JB 3AOCA 5AE1A 2UZAA 1JJCB 1RAHB 2GIFA 4DCPB 2KG0A 2GMHA 3DOLB 4IQMA 4AD6A 4CT8A 4PG4A 2H54B 2FGCA 2C1EB 2VASA 2FJVA 5AJ3F 2VICA 5KOXA 2EG2A 3BDEA 3VWSA 2IMWP 2NR0A 2ZM6F 3KK1A 4KQZA 3NXZA 4ELVA 4JV5F 5D3GB 2YNFA 3OTBA 1MW7A 2DD8S 2MKJA 1S99A 3BN4A 4RU2A 1HW9A 1RT6A 5HO4A 5BJRA 3BYRA 1G4CA 1CJVB 3Q83A 1VC0A 4ZLLA 4RKUC 3M7VA 2XY7A 1Y3JA 4C8YA 2C2NA 1FERA 3QQCD 2ZOFA 4U9RA 4CLWA 1T9UA 3DOKA 4EZ6A 2L9DA 3OSPA 1VQSA 3J7Z5 4YB6A 3H59A 5JXSA 3LAKA 5BYQA 4OQJA 4ED2A 2M3DA 2J5AA 3MCSA 5KG6A 2B8PA 1R6VA 1BQMA 2DGQA 2UUCJ 2I1RA 1TMJA 1M1HA 4DLGA 1GX6A 3E51A 1XR6A 1DLOA 1N4LA 3ENWA 1S6PA 1AB8A 3R6LB 2AP6A 4TY8B 4X65F 5J1EA 4ZPWR 4OYIA 4RW9B 2E5IA 1T02A 3KK1B 1IBMF 2BV3A 2ZJPQ 3KFWX 4EK2A 1YJWS 1TQLA 3TO8A 2YNFB 1U1LA 1SJ4P 1VCTA 4RNFA 3CMES 4LFCF 4CO0A 2F40A 3MEEA 1NK7A 2M7SA 1DAXA 2HK3A 3WC0A 5HJYA 4DR5J 3N0VA 4K2XA 2K1RA 4TQRA 1JK9B 1U48A 4DR7F 3GP9A 3FBFA 4X84A 1SH3A 2ZH5A 2DXDA 3IN5A 4C11A 2ZBRA 4OI0A 3DM2A 2ZH8A 3CCSS 1YSJA 1FKPA 1YVFA 2CNKB 3ZO7A 4FVCA 2RB7A 1FFGB 1LNQA 5E3RA 5IM0A 2CQCA 3MM7B 3PJXA 4I2PB 1NXIA 2QL7B 2BM1A 1TV6B 3RBEA 4K8RA 2BJ7A 1VLYA 3CCLS 4MKYA 2ATCB 4M5LA 1LOUA 3MFIA 1BQMB 1DLOB 1RHUB 4OX9J 1S6PB 1LV5A 1IKWA 3KUEA 1B64A 3AHPA 2KXFA 4F7VA 4WTOB 5J1EB 5KG3A 4J9SA 2W2MP 3CIMA 1Y5NB 2MKIA 2J8AA 1NKCA 1HFEL 3MUTP 2YKPA 1DQ9A 5LJ5Y 3UPFA 3C8YA 3TOQA 1RKIA 4N76A 1IQZA 2R2UA 2AQ4A 1SCJB 2R7WA 1VOMA 5F3ZA 3RB0A 5KFCA 2MB0B 1IBCB 5CYMA 2K1RB 1VBKA 2DR9A 3AXKA 2L9WA 2FD2A 5ADZA 2FZKB 2DPJA 2X51A 4YP3A 4J9NA 3C3LA 2QRRA 2V9KA 3ZZUA 1KQKA 4C11B 4LF5F 2FPHX 3DM2B 1O51A 3IP0A 1GX5A 1FKPB 2QO3A 4PYDA 4O23A 3GJSB 3NEKA 4DX8H 3Q23A 4NXNJ 2D74B 1K44A 3EE3A 1UZHA 3OJUA 2XMMA 3I0SB 3CDBA 3PRDA 4P73A 2FGOA 5F9LA 2HWTA 4DOZA 2FB0A 2CPJA 3W1YC 1SPBP 1YZ6A 5DG7A 4ZPTR 3CJQA 2VFSA 4DQQA 3ZNJ1 2LA6A 2B6AA 4LRAA 2PMHA 1IKWB 4DV2J 2HNDA 5HBMA 3LQVA 1ICEB 2RKIA 5IT9U 2COLA 2J8SA 1IM6A 1G7CB 4Z37A 4B3SJ 2MMYA 2HHSA 4F2RA 4J9UE 4NZ0A 3QWPA 1D0EA 2XLIA 1SQEA 4XAKA 3ETOA 2FDNA 5KFOA 1HQEA 1YJ7A 4ENOA 4Q2LA 1AYEA 2WVDA 1SB6A 2CJBA 4LF7J 1S7HA 1DARA 3FDSA 1QTNB 5KG1A 1FCAA 2FZCB 3PCOB 2HNYA 2OAUA 1GAOA 3BPSP 2E5GA 1EHWA 2GZOA 2QSWA 3M1VA 4EMDA 3LALA 1P1LA 4FN5A 4PXBA 3P49B 3KDOA 2QEXS 5F8IA 2YQ1A 4TQSA 5HVFA 1BD6A 3DRSA 2A1BA 5FLXY 4JYAJ 4LVNP 4ES1A 4ICLB 2OPQB 2Z2ZA 1D3WA 4O3QA 1OQ6A 2XMUA 4H4KC 2DNYA 5T41A 2B6AB 4PPDA 5D8HB 4ED6A 4M5MA 5IQQA 2HNDB 4ETZA 5HBMB 1NUEA 1SV5A 3CUNA 3BEGB 5GAGU 3JAMU 4NMLA 5MLCV 2W2OP 1FRHA 1FESA 2CPYA 2MHEA 2CWXA 2DR8A 3W9JA 1QY7A 1KVIA 2V4JA 4DU8A 2MSTA 4N77A 4BLGA 3KHRA 1A0OB 2RRBA 3DOMA 1OQ3A 3H5SA 4CNZA 5HP1A 1HQEB 2V68A 5DZ6A 2CPHA 5ETPA 7FDRA 5EGYA 1D8YA 1YJRA 2CPFA 2QE5A 2CXEA 1Y4ZB 4QWAA 2HBYB 4WXWA 3TRGA 2OD6A 2JEIA 2LEPA 4JI6J 1YWXA 2HNYB 3MOJB 2KG1A 2FIUA 3KXDA 4KR0B 3UCGA 3M1VB 3QYYA 3FEZA 3RRHA 2VA3A 4H4KA 4ZIWA 3TUIC 3PX4A 3GPAA 4AUKA 3CF5Q 2BEFA 5HAOA 1WTBA 3K5NA 4IG3A 1TP7A 3RB4A 2ZUGA 4DPUA 2VD3A 1FDDA 3V6DA 2XMWA 4PG5A 2NPFA 3DRSB 3CJ3A 4I0WA 2VG7A 3T6JA 3W2WA 3G6XA 4HTIA 4FF4A 1T9XA 1QAIA 2DO0A 4LIWA 4GVBB 4WF9Q 1KVJA 1SV5B 1YX2A 3OTEA 1Z2ZA 4B3TJ 3US5A 2WAQD 3NKYA 1RWXB 4FXDA 4YB5A 5A6WA 2HQDA 4OFZA 3ZZYA 4JP8A 1FXLA 4OZ0A 2HQGA 3NWGA 2V4JB 1TK5A 2VZ9A 1TU0B 4O44A 1ZS6A 3X1LB 1N5YA 4ED7A 3KK3B 5HP1B 4DPYA 1S6OA 3GR1A 1OYEA 3CVKA 2QMXA 2DGUA 1VK8A 1IKXA 2P6SA 3HULA 4I7FA 4C7QA 1FD8A 1ZAVA 3G71S 1VRQC 4F3MA 3SI8A 2VDIA 2YQ0A 5C42A 4DCJB 3P3DA 3W9HA 2L3MA 4IG3B 3TZXA 1RAJA 3H0PA 4XK8C 4NWBA 1Q79A 1UWAA 4KHMA 5IWAJ 5B0EA 3W2WB 3DYAA 4KFBA 3BJYA 3DDNA 2IYGA 2VBZA 3MTKA 3KJVA 5EX3A 2XEXA 1UA1A 1NH8A 3Q8PB 2QMUB 2GJFA 2KJVA 2OI2A 3OFEA 2GIQA 1S97A 4V19J 3PFOA 4L3NA 4YQWA 1PYOB 4DF8A 3T41A 4URSA 1GXUA 4HT5A 2C42A 4ANEA 4DSLA 4O44B 2VF3A 4K4VA 3ISZA 4NA3A 2BANA 1AUDA 2XSJA 1K1SA 1I94J 4FKXA 1R6YA 1HWUA 1T7PA 3V2UC 2V8VA 2JFDA 1RWNB 4I68A 1CJUB 2YWKA 4OJ1A 2HVHA 4NLXA 3PRBA 3DXBA 3DFEA 2F1FA 3UDVA 2DRDA 4I7FB 3PW7A 1WC4A 3W60A 4UTGA 2DRAA 3GWCA 3J81j 5C42B 1TVRA 4S0MA 4FYDA 3FRYA 5LXYA 4EO6A 1KFSA 4X4PA 1ZM9A 5KFUA 2M4MA 3C2PA 2CJXB 4NEYA 1X4DA 3ZNUA 3MAHA 1IBKF 4QWDA 4AL5A 4KFBB 2PSZA 4ZLJA 3KJVB 3SBMA 3TEHB 4DJBA 2QFJA 3C6TB 4QW9A 2A10A 4DG1A 3KLHA 5DJBA 1N5SA 4LF6F 5DS7A 1Y7PA 1KLNA 3A8IA 1YJNS 4X66J 1CS4A 1Y5IB 3GILA 4RNNA 1U0SA 3GLJA 4DSIA 2Q1LA 2BANB 4FS1A 2DK2A 2XSJB 3NGRA 4J9KA 2V9WA 1M5KC 1L3TA 3FMBA 2G4BA 2L08A 4LF4F 3H2VE 2RVJA 3OLAA 2ZC3A 2MQMA 1S1TA 4IOBA 4RR5A 1NSKL 1N32J 3CNQP 4MAKA 4A8MP 2FVPA 3NBPA 1JWWA 4DS5A 2FVQA 1TVRB 4LSZB 4BS2A 2F8MA 2K7JA 2VQFJ 4RW6A 4P52A 3IBCB 2V5HG 4ZJLA 5H9EJ 1X4CA 1Q86T 4ES3A 3LA0A 3FCWA 4B17A 3O1LA 2WVCA 2VJUA 1RZMA 2MZTA 1VK3A 4QR2A 3FVYA 4RNHA 4LR7A 3IG1A 2YKAA 2DR5A 3RBZA 4PXDA 1I1GA 1WELA 2IY5B 3RTVA 4AE5A 1WHWA 2E7VA 2IIHA 3GONA 2GMJA 2EK6A 4N7TA 2FVSA 2C28A 3T3FA 1N36F 3DMJB 2V2VA 4JI1F 2XS7A 3CGIA 3HLUA 3T5KA 5C2GA 3DHWC 4JI4J 1N33F 4PYAA 3VQSA 1HR0F 3HSJA 4YMEA 1M5OC 3PHTA 5GAHU 1KDNA 1SKUB 4GRSA 1FRIA 4PUOA 2HMIA 3OHBA 2OIHA 1APSA 4X2BA 3CO9A 1K73T 2H9ZA 3M8PA 1VLOA 1FJGF 1EX8A 1ZA1B 5D4NA 4LVOP 3EVOA 4P6QA 3NBPB 2GIRA 2EFOA 4YY3F 1KQGB 4OX6A 3FQKA 1ZOTA 5KFEA 4X4UA 2ADBA 2M8DB 4OMFG 4IFYA 2XULA 3OL7A 2D1CA 1NJYA 4B9VA 4C3MA 4I4BA 4ZCIA 4DFPA 2DY9A 5KFVA 4Y0FA 4YB1P 1U1OA 1D1UA 1VGYA 3K5PA 2D9OA 3GYNA 2ZZMA 3QAUA 3IG1B 4OYZA 4C8ZA 2DH8A 3Q2TC 5LSOA 1R7IA 5HVGA 4USWA 2Z4PA 2ZD1A 1M1KT 1URRA 4GO5X 4Y2MA 2VBXA 4K2JA 2DNPA 3J7ZT 4R25A 1JXEA 2L9NA 3F0NA 1UW9A 1XERA 1WEXA 5IQ6A 4ECRA 4RWWA 3BB5A 3P96A 4B3RJ 1REVB 4ZVUB 2GO8A 5J2MA 4DHVA 3CMAS 1NSQA 1FFWB 2ZFHA 1XNQJ 2YKMA 3P4UB 4KPYA 3UQSA 2KN4A 2WHOA 3V6HA 4KT0C 4IRCA 5GAEI 5CAAA 1T8EA 1NK4A 2WVEA 2BABA 3OL6A 2LDIA 3GCWP 1D8ZA 4NLUA 3BO2A 3MM9B 3Q8UA 5DDOC 5AE3A 2HFSA 1RWKB 1ZBTA 5U47A 5B0DA 2HGLA 2CWKA 2ZHBA 4IFYB 3MDFA 5IT0A 2MKCA 4IFVA 1U4BA 2KFNA 4ZITA 3ET6A 1SJFA 2ZDOA 3ZZRA 4ECVA 4MFBA 1K1QA 2DH7A 4J9VA 1DFDA 4OYMA 2ALZA 4WP8A 1Q16B 4JOUA 1B4SA 1VRTA 4U7CA 2ZD1B 3K0JA 2QLJB 2C3PA 2CQPA 4RW4A 1FTRA 3UDEA 3PO5A 4OYXA 3ILJA 1N34F 2XMKA 5L38A 4G1QA 5J2MB 4OLPA 2DBBA 5KT6A 4M94A 1VQMS 3KLFA 2YNIB 1KP6A 3GR0A 2W4CA 1LXJA 1K0TA 1FD2A 3CCRS 3BZQA 1N6QB 2GMLA 1YJ9S 3FK4A 3OVSA 1C2PA 3H7HB 1VJWA 3WZ0A 3LGHA 4RU9A 8RUCA 1VMBA 3BV8A 4A8XA 1VC5A 4ED8A 2DHHA 5B0AA 4B3MJ 4LSLA 3LAMA 3M8YA 4HHJA 2GQQA 2SXLA 2J6SA 4YDDB 4IFVB 2M52A 4DZ6A 2IM1A 1MWZA 4IYQA 4MFBB 4TYAA 1N5TA 1SUQA 4BWJA 4A8WA 3IC1A 4WJBA 3M9NB 3QT5A 1VRTB 2LECA 3T9ZA 1L5UA 4DV0F 5HANA 3ZTSA 3DRPA 4RW4B 4LQ9A 3G87A 3N01A 4ER8A 4ECSA 4OV6A 2KVQE 5IC4B 1W2IA 1NJXA 4MMOA 1NJWA 3VVUA 5KOWA 3LOUA 4IH6A 3AXMA 4MT1A 4QCLA 4G1QB 1ZPWX 2MTLA 4NLSA 4WFBQ 3IAS9 3T1YF 3BBCA 2RSQA 2PDAA 3L95X 6FD1A 3RRGA 5DZ7A 3ELHA 2OMOA 3KLFB 4RNOA 2IVFB 4MKVA 3TA0A 4KRWA 1U25A 2CNNB 1VS3A 3CJTA 2FVCA 2CPIA 2FJDB 4DQIA 4RBVA 1UFWA 3OSNA 2A18A 3HSDA 2VQEF 3I0RA 1V3ZA 2C22A 3CE8A 1MN7A 4J9PA 2KXNB 4Z2XA 2QX0A 2D41A 2HG4A 4Y3CA 2MLZA 3PDNA 2PI5A 4DX7A 1R8PA 1VQ6S 4B9UA 1MMLA 2CJAA 2NXJA 4LSLB 2LMIA 2VHGA 2Y8WA 2WVFA 1BMQB 2O67A 2G2OA 4F02A 1LWEB 2XO7A 1SUQB 2B7BB 2KT3A 1I3OB 1MMNA 1RYRA 3BGOP 4C8OA 4KY3A 3M6WA 3VHQA 4ZVHA 4LF1A 4P7TA 4HYKA 1RB0A 2I8EA 3A8JA 3D3CJ 1U26A 4L3KA 2QTWA 1RT2B 1WKLA 5A8KA 3SXLA 3TR5A 1S10A 1XMOF 1XWLA 1QJHA 2MLXA 3B54A 3HKZD 2B56A 3SMZA 4DV7J 1YI2S 3GIRA 5J2PA 3QWUA 1PYTA 2H51B 2Q6CA 3LGMA 4NLTA 3OUYB 2V69A 3VAJA 2YWHA 2CQIA 4DSKA 2BUNA 4JI7J 3CXCR 3GU0A 4HH0A 1YTYA 2OFHX 2J76E 5HLFA 3D9BA 3NNCA 3PACA 1YBUA 4QIEA 3FZ2A 3I0RB 2XNRA 4KIAA 3NWRA 1F3FA 2NYHA 4L72B 3KLIA 4N41A 3CB4A 5ETSA 1VYAA 3EYZA 3MR5A 2VG6B 3LP0A 4USMA 2QG9B 2OJ3A 1X5OA 1Y0HA 4KAIA 1KWMA 1UEUA 1SC6A 4F4KA 3P8BB 1NJZA 1WDDA 4CH1A 2R8KA 3J7YI 2Z2LA 4ID8A 2HFNA 4PEOA 2VKZG 3ETMA 5THWA 1Q4RA 4Q8EA 4QIFA 1PC4A 1LWFA 1LWXA 3A3PB 1YIJS 1VFJA 4HTJA 1RADB 2DIUA 4GMKA 1HNWF 1P9QC 4KV8A 3J7YU 5A8KB 1CC8A 4DR6J 2H3EB 1HARA 4E2FB 3G82A 3C66A 4LIRA 2KFYA 2VB6A 3H25A 3KMQA 3BGUA 5AT1B 2DNGA 4KJIA 2VBYA 4RL1A 2FHKA 4KPCA 4IOAQ 2ALYB 5HLFB 1GMWA 4PWUA 4CO2A 5CABA 4PRFA 4FXVA 1HI0P 2ZJQQ 2YH1A 1VQ8S 3UD5A 2N7YA 1JLEA 3KLIB 2G1HA 4UY85 3R5GA 3D6TB 1XNRF 3KG0A 1FDAA 2R7SA 3LP0B 2BOPA 2QN6B 2WW8A 1VIOA 2J0WA 2H5IB 2AMCB 4H4MA 1NH7A 3HHKA 2DGXA 2DHGA 1ZTTA 4DV1F 2CIMA 3D4JA 2RDJA 4WIIA 3D7SB 5HROB 2AT1B 3BKTA 3RBXA 2MZSA 2F9DA 5ETNA 2UUCF 3WC2A 4AFFA 1LFPA 2J9EA 5CD4A 4ZVPB 3IWLA 1KEKA 3G86A 3OFFA 3MMAB 4KV8B 4LFBJ 2E1MC 3TWZA 1R0AA 2RHSB 1WOOA 4EGLA 3I9V9 5KFIA 2A6MA 1RTHA 5HJXA 3D54A 4FKYA 5B09A 4CLLA 2FQQB 5JUMA 5L1LA 3DGVA 3H4BA 5CYJA 1KTQA 2GHVC 5KFZA 3EDQB 3FMWA 4L6V3 4DR5F 3BH7B 3MGJA 2K7KA 3I4HX 2H48B 1JXLA 2J6UA 3N79A 3OTCA 5F8MA 2XNQA 1BQXA 1XMQJ 1P8GA 1Q8IA 3DKDA 3FRZA 4TVAB 1AFJA 9RUBA 2MQQA 2BYCA 2QIFA 2BVZA 4LRBA 3T5LA 4JB8B 2ERRA 1AROP 1TL1A 3IFEA 2XZWA 1C1BA 3MEDA 1JLFA 1RT4A 3Q22A 3PO4A 4A8YA 3VGTA 4A4JA 1T05A 4TU9A 1LXNA 3RJMB 4GC6A 3QFWA 3ZZ0A 3CD6S 4ZVGA 1R0AB 1UVJA 2H65B 2HRUA 4P2MA 1YBAA 3OXGA 4WP9A 5KFKA 4DX5A 4YS2A 1CQMA 2YWFA 1O0PA 2LLZA 1UCNA 1UFKA 3HP6A 4HVZA 4ZCMA 4IR1A 2MY8A 4JI8F 4WFYA 4NRTA 3EPIA 4BHQA 1XIQA 4PG8A 2OD4A 3NOGA 3H90A 3IR5B 3PR5B 3V4MA 3QLHA 5IC6B 3KG1A 2V63A 4J9OA 3DLKA 3EICA 2RRNA 2AIRB 4M5DB 3U7JA 5HQ8A 3FC9A 5I3UB 5L8RC 4KHPJ 1SIWB 4C0OC 3CSKA 4KH1B 3M32A 2OSQA 3E01A 1EAYC 5B08A 1ACMB 2E9ZA 1MN9A 5M2PA 3PNIA 2JC1A 3AODA 1TL1B 4B08A 1YBTA 4F3OA 4JUZA 3R5AA 1JLFB 5H9FK 1RT4B 2CPDA 4GC7A 2BJ1A 5KG2A 2MQNA 1T05B 4DV2F 4PWWA 4C9DA 1XTZA 4J7CA 1CLFA 4USKA 2RH3A 2E1RA 3UR0A 1TMMA 3EXYA 4I2QA 1N88A 3WX4A 3TP2A 1FRMA 1RT3A 5K20B 1DZ5A 2YKOA 4CH0S 3TUPA 1NB7A 2VFVA 5K8NA 2EKNA 4PQUA 1LEOA 2V67A 2K8GA 2ZEJA 2HHWA 3AA9A 4DV6J 3W8GA 1Y00A 5K9FA 2ASYA 4KBIA 4DUTA 3QLHB 2HGMA 3GJTB 4AYBD 3M2VB 5KG4A 3DLKB 4E98A 2ZBPA 1XR5A 2Z58B 5K5MA 1FA0A 2F3JA 2XI2A 2CPEA 2W2QP 3RG6A 3RR7A 4C6AA 4LBHA 4QYRA 3M32B 3W5XA 3E01B 3FSYA 4Y2CA 3E3XA 2XG8A 2LDYA 3HO1A 4OHYA 4HDHA 4JYAF 3ZTQA 3R2CJ 2XQCA 3EZOA 3GCXP 1RHMB 3FFIA 4TXSA 3UD4P 4LF2A 2KT2A 3JSRA 1FEHA 3PEJA 1S1VA 4IUFA 5DDPC 4DV4F 1DTTA 4I2QB 2CJ9A 4CLSA 4ZMMA 2BQUA 4JV1A 2IM3A 2M2BA 1RT3B 2DNNA 5HMXA 5GVQA 3JB9k 3MMBB 2FUG9 1H7WA 2UXBF 4NMXA 2JC0A 4USUA 2YWGA 3HF5A 4PQUB 2NXNA 4O3PA 2EC2A 1FXDA 1Z2LA 4YDXA 3MAQA 4ZVEA 4U95A 1W7WA 5ETRA 2HRYA 4EBEA 1NDPA 4P72A 1HA1A 3SV4A 1WHVA 3MCNA 4AL7A 2W8KA 2B9XA 2OTJS 1RKJA 2DKOB 1VQKS 5FIIA 3C46A 4H4OA 5CCMA 2RHQB 3JSBA 4F4YA 1FDNA 5DQIA 2EKYA 3QGGA 4QPTA 1DQ8A 4FPRA 2PMWA 3LP2A 4KYZA 4DU7A 1UA0A 3QFHA 7FD1A 2P9EA 5D6GA 4HDGA 3V6KA 3AT1B 2G2YA 3AOAA 1HBNB 2LU2A 3MM8A 1N54B 3IS9A 1UWBA 4CI0B 2HAFA 1S1VB 2GHPA 2HWIA 2CKWA 4TN2A 3NNHA 2AJQA 3DLHA 5A0YA 1DTTB 2P2CB 1RWMB 2MZRA 3BKUA 4IH7A 1NMEB 2R7VA 5D15A 3MD1A 2QJ3A 5HMWA 1A7GE 8ATCB 2IRYA 4NLDA 4CO3A 1A6LA 2FLPA 4DV3J 4PG7A 2IFXA 1GEHA 3ZTOA 3PJWA 2IA6A 3WBZA 2GGPA 5E5NA 3CCES 3TX8A 4O3NA 3CWJA 3HJVA 1FRXA 2YPYA 2B9WA 1HWJA 4X4SA 4V1Ak 3TQEA 2AU0A 1WSVA 3QZ8A 2HHHF 4H4OB 4WIQA 4RBUA 3E2EA 4J5OA 2DHAA 1X5PA 3HHLC 2I2YA 1XK8A 1TL7A 3D6FB 2DO4A 3HD1A 1LW2B 4NI2A 2B8QA 1BXNA 1T03A 1FJ7A 3LP2B 4L74A 4O3OA 4Y2KA 5AJ3J 2C2EA 2Y8YA 2ZNYA 4PXCA 5D78A 3MM8B 5C25A 1WC6A 5B7WA 3IS9B 1UWBB 1VQNS 1PC5A 3CJKA 2M0GB 3GB0A 4JV5J 1YJTA 3MR7A 4G1IA 5A0YB 1D09B 3DU6A 5LT5A 3K89A 2FHJA 2HHVA 2VV5A 3GFZA 4UOGA 4DR4F 1RJJA 9ATCB 1I94F 3MPDA 2GQ2A 1UTAA 1X60A 2W7PA 2XZTB 3HJFA 3B6BA 4HLBA 5E2QA 3R8YA 2HVEA 4OZ1A 2OP5A 1EETA 4ZVOB 3C19A 3GFXA 3QGPA 1X4GA 2C3YA 5GADI 2YXLA 2DHSA 5EWFA 4DR2F 2VFUA 2XM3A 3JQJA 4OHZA 2XGPA 1M0SA 3VZIA 1S0MA 4B9NA 3QT6A 1IR2A 1WG4A 4B9SA 1Q8LA 2ACMA 2G1DA 4DN9A 5GADU 2GAHC 3BQ1A 1TL7B 5J2NA 2DGWA 2M8HA 4DPXA 4ES2A 4P9SA 1FEEA 1TL4A 1U6BA 1YK9A 4X65J 1MWQA 2NS1B 1V3RA 2E1AA 3TX0A 5C25B 1FKOA 1UEVA 3CJKB 1AZSB 4WU3A 1QTMA 2BRKA 3IGNA 5KFTA 2C3MA 4C4WA 3R5JB 3VGSA 3H42A 2WVBA 4LFCJ 2WCXA 1YITS 1HMVA 3CDUA 5D0EA 2V8HA 2F9JA 3R97A 1S1WA 2KHDA 1Q1KA 4MIAA 3PYDA 4LUBA 3ZTPA 2MKSA 3BM7A 2ZH2A 3SDEA 2AD9A 2EVZA 3QBCA 3TI0A 1ZM4A 4TLRA 1EETB 5DQGA 3HHLB 1CBKA 3J81Y 3BQ2A 5CQGA 3CCMS 1VJQA 1N32F 2WOMA 5IT9Y 1T9YA 4YHHJ 4NOHA 5LOQA 5BYSA 2XWYA 3EGVA 3UD3P 3IM8A 5CH7B 1VQ5S 4IG0A 2AF6A 5EN1A 3TUJC 2VUGA 4FYXB 5IZHA 2UXCF 2GNKA 2G13A 2VQFF 3CO0P 3OR1A 4DEZA 3LP1A 3R5DA 4IDKA 1CEZA 5EWGA 3W66A 3JQMA 5IS2A 3I5BA 3GIJA 1AFIA 2BJ8A 4X64F 2YWWA 3HCXA 3Q8VA 4M5KA 4EO8A 3N5BA 3G9CA 3TZZA 2IBOA 4DSFA 3O2IA 3C14B 4IOCQ 2EXUA 4JI3J 2QLBB 3SCJE 1FKOB 2R2RA 1SXLA 1UVKA 1YG0A 5EUHA 1O6XA 2LQBA 1IKVA 4CCHA 1RISA 1RWOB 4ANDA 2W25A 2AZ3A 3M8SA 1NZAA 3L9ZA 3BGLA 2ILZA 2H1YA 1HMVB 4CLKA 4QIVA 3HVAA 1S1WB 3LTOA 2CG4A 1MLAA 3QJPA 4USVA 2O66A 1VQPS 3NCRA 2ASLA 3SV3A 1NRKA 1IBLF 5HVHA 4AQYF 2Z30B 2MZ1A 3GYXB 2ASJA 4LF5J 5DLGA 4DUYJ 5CZXA 1SL0A 2QFIA 3CCUS 3UNGC 2WOMB 1X9SA 5F8JA 1E6YB 3K5MA 3B4MA 2HS0A 4CDIA 4KGZB 2CADA 1GXLA 4I64A 2DNRA 5C24A 4IG0B 3T1HF 2HPUA 3QGHA 4UT4A 5CZVA 1IN0A 4UUXA 2AZ1A 1H72C 1B0PA 1X0PA 1H73A 4IDKB 3R3TA 2ZNZA 3WX8A 2CPZA 1YJUA 3FUYA 2I38A 3DGPB 3R7SB 2HNZA 1WC3A 1TKXA 3K58A 5I3QA 1PG5B 3ZFVA 2V8PA 2QGFB 4TYBA 1HBUA 4MKBA 4UY8T 2ZH6A 2M9KA 3ISND 2XBPA 4WK3A 3M6XA 3WDOA 2JX2A 2J9DE 4J9LA 4K4ZA 4PQAA 1VQ7S 1S7IA 1RHJB 1LKZA 1UETA 3G96A 5DO2A 1M5VC 1FF2A 3CCZA 3ENVA 2MGZB 2IM2A 2KYXA 1ZPVA 2RJZA 2PFDA 1JLAA 2CZ4A 2YH0A 2EFVA 3V5RA 4UOFA 2NSBA 2NPIA 4NX9A 4OI2A 3D0IE 1XNQF 3R9LA 4XDCA 2A2CA 3QJLA 4ZOSA 4WZQA 2OH2A 3DRYA 4DWIA 4OHWA 4NXMJ 2OHDA 1YHQS 1RCOB 3VALA 3FEYB 4WFZA 3RAMA 2Y0BB 1RI7A 4ID5A 3NGTA 4I6AA 1F9EB 2HBZB 4FYVB 2FC9A 2UU9J 3JYTA 5AXLA 2J9DA 3UCUP 2APOA 4K5SA 2BE2A 1V5VA 2F65A 4I69A 5LMUJ 3GYGA 1RUSA 1ZAWA 1TKXB 4B3OA 2VH7A 1GMUA 4C3LA 1FNXH 2Y3YA 2F4VJ 3K8WA 5MAOA 1RTJA 2LP4A 1HBUB 1Y10A 1S0OA 1FDBA 1LK5A 4Q5VA 1RTIA 5DM7Q 2DNKA 1CPZA 4UQTA 4URQU 5G0RB 2DVIA 3G8TA 3AFGA 2E9TA 1SC3B 4X4VA 1JLAB 4LRDA 2NCKL 2VIHA 2VJVA 4OLOA 1AUSL 1IUJA 2RF2A 4MK9A 4RW8A 1J5EJ 4CQ1A 5E3PA 2JZ5A 1GMWD 2VU5A 3TJAA 3KTQA 3Q8SB 2OFGX 2PMZD 4F04B 1RU2A 4ED0A 2WB1D 4WYLA 1RT5A 3BSNA 1SKSA 1HPZA 4N47A 1MWYA 2HGNA 4CLTA 4O0IA 5B0GA 1WOPA 3M2RB 3RUBL 2AX0A 3JYTB 1VQ9S 3FSIA 4W90B 4KE5A 3EGZA 3MM6A 3N6NA 2BE2B 1B3TA 2B9YA 2HK2A 3MPVA 1VDHA 3PJ9A 4A48A 1SC1B 3L7OA 1U49A 3MR6A 4B3OB 1RTDA 3AJ1A 3W2VA 5T14A 4F2SA 3HDSA 3EVWA 3EZUA 3EZ5A 2BE9B 2KDOA 2FY1A 1RTJB 3OD2A 1RGVA 3IXQA 2K2PA 3UI3A 4FVMA 3O6QA 1RTIB 1U1MA 4RJVA 3HSZA 3DLLQ 4GO7X 4ZPCA 3ILLA 4BWMA 2XYPB 3M30A 2ZKUA 3GSIA 2NXEA 1S9GA 3BGRA 2V6AA 3HFZB 4LFAF 1RT6B 2YNHA 4NL5A 1Q5YA 1TL5A 2RF2B 4RW8B 5DQHA 1H98A 3I9ZA 2IVYA 1S0NA 2W9BA 1HWKA 5JVGQ 2DT9A 2DYAA 4Q0BA 1VQ4S 4Y2IA 1F6TA 2CZ9A 2XC9A 3DOKB 3CMQA 3HM9A 1QDUB 3D6HB 3CCJS 1VQOS 3TUZC 2PA8D 4CTAA 2YX4A 2M70A 1R43A 1SBRA 4YR2A 4ELTA 4U8YA 2Q66A 2CA9A 3TAMA 3MM6B 4ZPVR 2N3OA 2HHXA 2F5GA 2YWEA 3PM9A 3D68A 4A8SA 4FF2A 2R7XA 1ZM3A 3TANA 2UP1A 2BJDA 4RUHA 1P9YA 1HNIA 1T0TV 1FT8A 1N5VA 1SH2A
chains in the Genus database with same CATH topology
4LF7J 4JI8J 4DV4J 4LF5J 4AQYJ 4RJVA 3D3CJ 4DUYJ 1XMQJ 4LF6J 5AJ3J 2KL8A 2MQ8A 2UUCJ 2MTLA 3R2DJ 4NXNJ 3D3BJ 4YY3J 4X62J 1IBMJ 5FLXU 4DUZJ 1HNZJ 2UXCJ 4DV1J 4GKKJ 2E5LJ 3J7AN 4NXMJ 1J5EJ 4JI0J 4DV6J 3T1YJ 4DV7J 3J80U 2VQEJ 4DR1J 2UUAJ 4LF9J 4JI5J 3T1HJ 4LFAJ 4JI6J 4JV5J 2UXBJ 1N36J 4OX9J 4KHPJ 3W1YC 4X65J 4LF8J 1I94J 5BR8J 1HNWJ 4JI7J 4DR6J 4X66J 4GKJJ 4DV3J 4X64J 4LF4J 2UU9J 1N33J 4LFBJ 4B3MJ 4DR7J 4JYAJ 4JI3J 4DV2J 4NEZA 1HR0J 4K0KJ 4DR4J 4LFCJ 5LMUJ 4JI1J 5IT9U 4DR3J 4JI4J 4DR5J 4V1Ak 2UXDJ 4DV0J 1HNXJ 4B3SJ 4PWWA 5LMNJ 4B3RJ 4HHUA 1N32J 1FJGJ 3JAMU 2F4VJ 3IMQJ 5IWAJ 5LM7E 3J81U 2HHHJ 3R2CJ 4DV5J 1IBKJ 5A2QU 3OTOJ 4DR2J 4KYZA 1XNQJ 2UUBJ 4B3TJ 2ZM6J 4JI2J 4NEYA 4KY3A 2KVQE 2VQFJ 4YHHJ 1N34J 1XNRJ 1XMOJ 1IBLJ 2MEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 J;  4JI8 J;  4DV4 J;  4LF5 J;  4AQY J;  4RJV A;  3D3C J;  4DUY J;  1XMQ J;  4LF6 J;  5AJ3 J;  2KL8 A;  2MQ8 A;  2UUC J;  2MTL A;  3R2D J;  4NXN J;  3D3B J;  4YY3 J;  4X62 J;  1IBM J;  5FLX U;  4DUZ J;  1HNZ J;  2UXC J;  4DV1 J;  4GKK J;  2E5L J;  3J7A N;  4NXM J;  1J5E J;  4JI0 J;  4DV6 J;  3T1Y J;  4DV7 J;  3J80 U;  2VQE J;  4DR1 J;  2UUA J;  4LF9 J;  4JI5 J;  3T1H J;  4LFA J;  4JI6 J;  4JV5 J;  2UXB J;  1N36 J;  4OX9 J;  4KHP J;  3W1Y C;  4X65 J;  4LF8 J;  1I94 J;  5BR8 J;  1HNW J;  4JI7 J;  4DR6 J;  4X66 J;  4GKJ J;  4DV3 J;  4X64 J;  4LF4 J;  2UU9 J;  1N33 J;  4LFB J;  4B3M J;  4DR7 J;  4JYA J;  4JI3 J;  4DV2 J;  4NEZ A;  1HR0 J;  4K0K J;  4DR4 J;  4LFC J;  5LMU J;  4JI1 J;  5IT9 U;  4DR3 J;  4JI4 J;  4DR5 J;  4V1A k;  2UXD J;  4DV0 J;  1HNX J;  4B3S J;  4PWW A;  5LMN J;  4B3R J;  4HHU A;  1N32 J;  1FJG J;  3JAM U;  2F4V J;  3IMQ J;  5IWA J;  5LM7 E;  3J81 U;  2HHH J;  3R2C J;  4DV5 J;  1IBK J;  5A2Q U;  3OTO J;  4DR2 J;  4KYZ A;  1XNQ J;  2UUB J;  4B3T J;  2ZM6 J;  4JI2 J;  4NEY A;  4KY3 A;  2KVQ E;  2VQF J;  4YHH J;  1N34 J;  1XNR J;  1XMO J;  1IBL J;  2MEW A; 
#chains in the Genus database with same CATH topology
 1RTD B;  2YKN A;  3CJR A;  4X62 F;  4FYY B;  3QT8 A;  2I9S A;  3W2V B;  4ERD A;  1CUL A;  2VOD A;  4G3I A;  2NXC A;  4RZR A;  4RUB A;  4UZC A;  1RAI B;  2W9A A;  3SSQ A;  3O44 A;  3R5C A;  4OHX A;  3EMT A;  2DGT A;  1S9G B;  1R31 A;  4DV7 F;  4X4O A;  5EHH A;  1Y5L B;  3MEE B;  4QYZ K;  3IRX A;  3MI7 X;  1X4F A;  2DH9 A;  4C0H A;  1L3K A;  2W9B B;  2BKN A;  1BLU A;  2AJ0 A;  1RU1 A;  4HT7 A;  2NRE A;  1S76 D;  1E6V A;  4FBU A;  2J0Q D;  4CTA B;  4M5J A;  1RBA A;  5IM0 B;  5F8G A;  3EGN A;  1M5H A;  4ANC A;  2EK1 A;  3F56 A;  3TAM B;  1S1X A;  2JEG A;  1YZ7 A;  2KYZ A;  3TZW A;  2GCF A;  1W2B R;  2QT7 A;  4NYO A;  1OWX A;  2LA4 A;  1HNI B;  2D9P A;  2XO6 A;  4F4X A;  3D1H A;  2YKN B;  1NZ8 A;  3PY8 A;  1KD1 T;  4CLU A;  2ZH9 A;  5T7L A;  2M5Y A;  1CUL B;  1G3O A;  5B0F A;  2GW8 A;  2LXI A;  3H5X A;  4RX6 A;  1OJ4 A;  1NPR A;  1RWP B;  2CQG A;  2WON A;  1ZET A;  2EBE A;  3U27 A;  1SIZ A;  3G8S A;  3JQK A;  1V5I B;  2DIT A;  3R5B A;  4ILL A;  3BSA A;  4UQG A;  3GSD A;  4IR9 A;  2RRA A;  4DR6 F;  1KON A;  4ZS6 A;  2AYM A;  2HFO A;  1UKU A;  2OLW A;  2UXD J;  4G1P A;  1X0F A;  1S6Q A;  1P6T A;  5CYM B;  2HKE A;  4DLE A;  2YX7 A;  1X5T A;  3IWN C;  3DN9 A;  3IAM 9;  1U45 A;  4DV5 J;  1U47 A;  2CNO B;  1BC6 A;  3QZ7 A;  5KT2 A;  3I96 A;  4NCA A;  2K3I A;  1E6V B;  1OY9 A;  1JLB A;  1F9F A;  3GII A;  3KUH A;  4HI1 A;  2HFZ A;  2JOQ A;  1CVJ A;  2RD5 C;  4KTQ A;  1S1X B;  1RWV B;  5GAG I;  2HIQ A;  4KH0 B;  2IPO B;  3G6E S;  5HMZ A;  1WAC A;  1NDL A;  3GG1 A;  3HFK A;  5I4M A;  1PJ5 A;  3IGV A;  1OO0 B;  2LCW A;  2JEF A;  1IXK A;  1R8A A;  1Y3K A;  2E1C A;  1O5J A;  2FHO B;  2RKI B;  3K17 A;  2D3O R;  2WON B;  3R7B B;  3EUN A;  2PO4 A;  4B9M A;  3CJ4 A;  1VQY A;  1U09 A;  1HQU A;  3MTJ A;  4JI1 J;  2N82 B;  2IAJ A;  4CNY A;  2LKZ A;  4LFB F;  1AW0 A;  1L3V A;  2PA3 A;  4MIW A;  2VL1 A;  2ZIT A;  4UW2 A;  3I31 A;  3AD9 C;  5M2U A;  2V2Q A;  1RAC B;  3DC2 A;  2QLF B;  1KN6 A;  1TL3 A;  3VQT A;  1BE4 A;  1S6Q B;  1VRU A;  3W3S A;  1PJ6 A;  4DPW A;  4ZIV A;  4XO0 A;  4OYO A;  3LWM A;  1UL3 A;  4ZVF A;  4DQR A;  2W2N P;  4R5P A;  4ETX A;  1WEZ A;  4YY3 J;  2V2K A;  3BDP A;  5HN0 A;  4QZV B;  4JI0 F;  5A76 A;  3ZZT A;  3AD8 C;  3J7A N;  4NLW A;  4Y00 A;  2HFV A;  1JLC A;  2HHP A;  1Q5V A;  5BR8 F;  4EBD A;  2OEK A;  1PKU A;  4F8R A;  5LJ3 Y;  4O0N A;  3SYZ A;  4CLZ A;  5K8O A;  3TEG A;  1WG5 A;  5ETQ A;  5DG8 A;  4DFK A;  2WBR A;  2XI3 A;  2GA7 A;  3MCO A;  1VBZ A;  2A2D A;  3V6J A;  1C4A A;  2RQ4 A;  3FJ2 A;  2FJE B;  1TUW A;  2RE1 A;  3NMA A;  1TKT A;  4PAB A;  1S4E A;  2AEM A;  3BQ0 A;  2WBM A;  1WDT A;  3MUM P;  1C0U A;  3G2X A;  2PI4 A;  2MKY A;  2ZUA A;  1HQU B;  2IAJ B;  3NMR A;  2DB1 A;  2AJ2 A;  2B4P A;  3VVT A;  3OR2 A;  4YUD A;  3DOM B;  3CJ5 A;  1EQM A;  3CJ0 A;  1S12 A;  3WIU A;  5C5J A;  1TL3 B;  2KJW A;  5DDR C;  2HZC A;  4K7Q A;  2CNL B;  1VRU B;  2KZZ A;  5DGA A;  2RDI A;  3VAI A;  3MAA A;  3THT A;  3M8W A;  4R5P B;  2FJX A;  3JXO A;  1F5C A;  4DL4 A;  1WJ9 A;  4OI1 A;  2PGC A;  2P6T A;  1CSJ A;  1JLC B;  4ZJO A;  3GV8 B;  1NAQ A;  4OYA A;  4MYU A;  3V6D B;  4U67 Q;  1KQS R;  4WXO A;  2ZKT A;  2EWH A;  5SZT A;  2J7W A;  2VG7 B;  4ED1 A;  3JTN A;  2V2Z A;  1IR0 A;  2DPI A;  2HZV A;  1R8B A;  1WF2 A;  2EEY A;  2FLL A;  2XLK A;  1TKT B;  2JL9 A;  2ZVS A;  4WFA Q;  2YNG A;  1C0U B;  1ZZN A;  1F9H A;  1B0V A;  4A8Q A;  2IC3 A;  5L9X A;  5I3P A;  4WZM A;  3V4I A;  1N34 J;  2MDA A;  1HLW A;  2FHJ D;  5LL6 d;  3OR2 B;  1U24 A;  1N5Y B;  3PXG a;  1HNZ F;  3MCM A;  1NJI T;  3D3B J;  4E8U A;  3EPG A;  1QUV A;  1D9A A;  4DPT A;  3RYL A;  3TYT A;  3HHL D;  4DR1 J;  3IA0 A;  3IO1 A;  3DCA A;  3K5O A;  1IKX B;  2C3O A;  4M95 A;  3QJJ A;  3W5Y A;  5CXT A;  3HHD A;  2RDD A;  3UR3 C;  4A8F A;  2FJA B;  5ETO A;  2GVZ A;  3OT9 A;  5L46 A;  1XR7 A;  2MY7 A;  4A46 A;  1X7V A;  1QSY A;  1EJ7 L;  2PD1 A;  4OX7 A;  5ETK A;  3VTI A;  3C6U A;  4DI6 A;  1T9W A;  1IVZ A;  4DCO B;  4ZP8 A;  3DYA B;  2KHC A;  1FX4 A;  1FVS A;  3UN5 A;  3H4D A;  3C15 A;  4YR3 A;  4DQP A;  3EX7 B;  2LU1 A;  3DLB A;  5KAK A;  4DZD A;  3MHY A;  2QYG A;  2P8I A;  2AGO A;  5D4L A;  2YNG B;  3K7R A;  2ZH7 A;  4ZPB A;  3T5J A;  4DUZ F;  2DIS A;  5KG7 A;  1FJE B;  1SJQ A;  3TVK A;  2B4V A;  1NSA A;  1JQG A;  4M5I A;  4YEA A;  2V34 A;  3T1Y J;  4N8O A;  5KFG A;  1HKA A;  1FWL A;  3GV5 B;  1J5O A;  1RAG B;  2ROP A;  2BAC A;  1RHK B;  1LFW A;  1TEL A;  3CC4 S;  3GG0 A;  3VZH A;  4BBY A;  2R7T A;  1CG2 A;  5CCL A;  2W01 A;  4O3S A;  2FYX A;  1NBE B;  3A1Y G;  2DNZ A;  3POT A;  3G4S S;  4JV2 A;  2NUU G;  2GV1 A;  4DFM A;  1I5O B;  1I6J A;  1RBO B;  3C6U B;  2XB2 D;  4G6V B;  3SIP B;  4XIU A;  4K59 A;  1AT1 B;  2AV5 A;  1UEK A;  2MJN A;  1F0X A;  2YPZ A;  5F9N A;  5IFM A;  4OZ2 A;  4X4Q A;  1U2C A;  1F60 B;  3UWT A;  3DOL A;  2O1P A;  3ZC4 A;  3CCQ S;  3PX6 A;  3C15 B;  4DG1 B;  3KLH B;  2K06 A;  4C8L A;  1ZYQ A;  1TR0 A;  4OZJ A;  1RQ0 A;  1UMJ A;  1WHX A;  3OBI A;  2BQ3 A;  2UUA F;  5GAH I;  2W8L A;  1N0V C;  2DNH A;  1CS4 B;  1FE0 A;  1PCA A;  2UV8 A;  4LF8 J;  3AJ2 A;  5D3G A;  1SVD A;  2P5V A;  2ZOG A;  3CCT A;  2NLW A;  1UVI A;  3CJ2 A;  1KSP A;  1NDC A;  3AD7 C;  1J5O B;  4QR1 A;  1EP4 A;  5CHC B;  1SKR A;  5JMN A;  4DV3 F;  3LH2 S;  1S1T B;  4M8L A;  2Y1L B;  4DR3 J;  1WOS A;  4OV1 A;  1HNX J;  3QGI A;  3CC2 S;  4HHU A;  2EW9 A;  4C2M A;  2HHU A;  2NXU A;  3QPI A;  3K59 A;  4NZ7 A;  4FNI A;  3POT B;  3WHI A;  2VDH A;  2RS2 A;  4RW6 B;  4C3K A;  3OW2 R;  4Y6I A;  1F5A A;  2ZZT A;  2BX6 A;  4WTY A;  3CDE A;  4CP5 A;  3A12 A;  5E7O B;  3MUV P;  2VC1 A;  1NPK A;  3EJM A;  3I87 A;  2CYY A;  1RE1 B;  1GXT A;  4GKK J;  1U02 A;  2BRL A;  1OPI A;  3D0H E;  4TY8 A;  1UJ6 A;  1C0T A;  4LRE A;  4UOH A;  3PW2 A;  5DET A;  2KM8 C;  1HNW J;  4RW9 A;  1SI9 A;  4GKJ J;  4OYP A;  2HUR A;  3PVX A;  2UVV A;  3O8W A;  5CD4 H;  2QC3 A;  4O3R A;  1HL6 A;  4C8N A;  5LXR A;  1RBL A;  2ZC4 A;  2KI2 A;  4YR0 A;  1GT8 A;  3IR6 B;  1EP4 B;  4PCQ A;  5E41 A;  4PUO B;  2QA1 A;  2HMI B;  3FBE A;  4KGV B;  1DTQ A;  3TZY A;  3M8P B;  5CA5 A;  2UUB J;  1S5Z A;  4F36 A;  2AYG A;  2ZZN A;  2AW0 A;  2ZVI A;  1IM4 A;  2RQK A;  2CFX A;  2Z2Y B;  5HQL A;  1XNR J;  2LQ5 A;  1R8H A;  1H6K X;  2CQ3 A;  3JS9 A;  3MM7 A;  3NGU A;  4I2P A;  2EFN A;  3GV7 B;  3VAM A;  4DV1 J;  1TV6 A;  4JI5 F;  2B43 A;  3ZTR A;  4DQS A;  2HQC A;  4QIG A;  2KU7 A;  1K8A T;  1RAB B;  4K4T A;  3OL9 A;  2IM0 A;  4HKQ A;  1C0T B;  3E8O A;  5KFM A;  1JNR B;  4P2F A;  1KQF B;  3FGV A;  2FZG B;  4EYH B;  1NEE A;  2HBR B;  3UN2 A;  4QQB A;  4OI3 A;  2BA9 A;  3AOB A;  2FJB B;  2BZ2 A;  2G0I A;  5KFN A;  2E66 A;  3Q0A A;  4TY9 A;  2YKM B;  2N4C A;  4RBT A;  4R8U A;  2H5J B;  3Q8R B;  2BJE A;  3KUG A;  1MRO A;  1GFW B;  3KKF A;  2VC0 A;  4M5N A;  1U0H A;  4ALZ A;  4EUV A;  5E33 A;  2I5J A;  2GAG C;  1DTQ B;  1KNZ A;  2EFP A;  4AXJ A;  2CJY B;  1QSS A;  1IWA A;  4PR6 A;  2Y9H A;  4YHH F;  3W9I A;  2GS8 A;  2OML A;  3TJ9 A;  1B70 B;  1QM9 A;  1WKJ A;  4QJV A;  2GO9 A;  3N6L A;  5KG0 A;  5AXM A;  3I0S A;  2XS2 A;  2KM8 B;  3M2U A;  1WTF A;  4HHH A;  3TAP A;  3ET6 B;  4USI A;  1NLK L;  3AY0 A;  2V4Q A;  2DTJ A;  4ATN A;  1TAU A;  4OHV A;  2MLY A;  4K0K J;  1MNE A;  3ZZP A;  2KB2 A;  3NG8 A;  3VAF A;  2QA2 A;  3M4X A;  3N9U C;  1S48 A;  4JI3 F;  3OVB A;  3KK2 A;  1PBU A;  3AA8 A;  2XMT A;  2DXE A;  3OTO F;  2HHQ A;  2XMJ A;  4NLG A;  2GVD A;  3OL8 A;  2G0C A;  5F0U A;  1UPM B;  1S9E A;  3QO9 A;  1PAU B;  3KNA A;  3THP A;  3O5T B;  4LRF A;  5A2Q Y;  2F7V A;  2AJ1 A;  2DEI A;  2LQ9 A;  5ITH A;  2KFZ A;  1H7X A;  4R8U B;  3D28 A;  5EDW A;  4TU8 A;  3ISN C;  4JI8 J;  1MRO B;  4RUA A;  2RNE A;  5B0C A;  3N4W A;  3BN7 A;  2X1G A;  3AB4 B;  1U0H B;  1PAE X;  2I5J B;  2YBV A;  1OY8 A;  3FZB A;  1X4E A;  3TQ1 A;  3NCP A;  2HVD A;  4B02 A;  1O8B A;  1ZA2 B;  2R7Q A;  3MFH A;  5KTQ A;  3PW4 A;  4DUY F;  1FHT A;  1L3S A;  4L73 A;  3OQ2 A;  3F44 A;  1RWW B;  2VA2 A;  2R8J A;  1NU4 A;  1UP1 A;  3TA2 A;  3V81 A;  2B4O A;  3BO4 A;  1GTH A;  1OMS A;  3M2U B;  1W25 A;  2QA4 S;  3H8Y A;  2HAI A;  2LXF A;  4ICL A;  2OPQ A;  3BSO A;  4U8V A;  5A6P A;  2OPP A;  2E29 A;  1UVM A;  3PYE A;  3J81 U;  1H3D A;  5AXK A;  3DRP B;  3H2L A;  1WWH A;  3ENQ A;  3KK2 B;  3RAQ A;  2MQL A;  3LPE A;  2GX8 A;  2WK4 A;  5L9N A;  2GVD B;  2Q6B A;  2CRL A;  3VGU A;  3CD5 A;  4NPO A;  3DLE A;  1S9E B;  3N5F A;  3QO9 B;  2OUG A;  1QAY A;  4HAC A;  2OTL S;  3AQP A;  2MQ8 A;  4E0D A;  2LXU A;  2V8D A;  4O4G A;  2E5L J;  4F0M A;  3T6B A;  2KXH A;  3EM1 A;  3L09 A;  4TLQ A;  2WZ1 A;  5D77 A;  1HBO A;  4EI2 A;  3KLG A;  5F3T A;  1FJC A;  2LFV A;  1B7Y B;  1VQL S;  3PIP Q;  4NXM F;  4ZP7 A;  6AT1 B;  2KTQ A;  3GQC A;  1MG7 A;  3UNY A;  1OPZ A;  5J1P A;  3CPW R;  3QAT A;  2VPZ B;  2O01 C;  3V81 B;  4ZKA A;  3SCK E;  4ZLN A;  4LR9 A;  2HEK A;  2UU9 F;  4OJ3 A;  3RR8 A;  2NUH A;  3CJS A;  4PXE A;  2XWX A;  1X4A A;  5LMU F;  1GQE A;  4F25 A;  4EWT A;  2DIV A;  2OPP B;  4GVB A;  3SSS A;  3I32 A;  1UZD A;  1FE4 A;  1NSP A;  2F4V F;  2F4F A;  2OEJ A;  2VBW A;  2WW4 A;  3GFY A;  4OIX A;  3EXC X;  3ILO A;  2D69 A;  5SUH A;  1FNM A;  3IR7 B;  1LW0 A;  4DV4 J;  3PYG A;  1G6B A;  2VFT A;  3JSM A;  1HWI A;  2Y1R I;  2OPR A;  1NK9 A;  3DLE B;  5J2P B;  1PIE A;  3JTP A;  3CCW A;  2GHW A;  3BKF A;  4HAC B;  3D66 A;  4FZV A;  3H5Y A;  4ZJQ A;  3KK3 A;  2UXB J;  1Y9O A;  3O3L A;  3J80 Y;  4O4G B;  1S0V A;  1JX4 A;  3HXM A;  3H98 A;  1Q7L B;  1J5E F;  1NO8 A;  1KRP A;  3F41 A;  3W64 A;  3UN3 A;  1HBO B;  3KLG B;  1P27 B;  5HI7 A;  3RB3 A;  1TKD A;  3KDN A;  1U1K A;  3AAW B;  1NK6 A;  5ETM A;  2FJW A;  1TAQ A;  3T5H A;  3SQG A;  1K9M T;  4WKR A;  4QWB A;  3D67 A;  1TKZ A;  3Q86 A;  3ICL A;  4IH5 A;  4FP9 A;  3SQO P;  5ETL A;  5GMD A;  3R1H A;  4A8O A;  3BF4 A;  1FRL A;  1LWF B;  3MWB A;  4ZCL A;  1LWC A;  3Q8Y A;  1LW0 B;  4ECQ A;  4ECY A;  3KHL A;  3JSM B;  3G8Q A;  2OPR B;  3GTY X;  3DLG A;  3A3N B;  4OJH A;  3NNA A;  2Z8Q A;  3G82 B;  3CW2 C;  2BQR A;  1PYS B;  4P2X A;  2XCP A;  1T94 A;  2WRM A;  3KG4 A;  4LJM A;  2FHM A;  4TNO A;  1U6F A;  3DRX A;  2JJ4 D;  3BYP A;  4MK7 A;  2E9R X;  1CJU A;  2FC8 A;  1RXO B;  4Y34 A;  2CDR B;  1R8C A;  2BJ9 A;  1JLE B;  1HBM A;  2G2Z A;  2HHH J;  4K5R A;  2PII A;  1RAE B;  3S7R A;  4WFN Q;  4EYI B;  1I51 B;  1FWK A;  2AYE A;  3RBD A;  2VON A;  2C2Z B;  4H4M B;  4B9L A;  3SQG B;  2KZM A;  4CZC A;  3MD3 A;  5GMK a;  2R7R A;  5KFR A;  1TKZ B;  3ULH A;  1R0C B;  1XMB A;  2PFF B;  2C2M B;  2GFF A;  3H5U A;  5H9E K;  2HYI B;  1B0T A;  4C97 A;  4OX9 F;  5L1J A;  3C6T A;  4DBQ A;  2JEJ A;  5KT7 A;  4RO0 A;  1R89 A;  1LWC B;  2CAJ A;  3J7A 1;  3ZXW A;  4O4R A;  1SJ3 P;  1RTH B;  3DLG B;  5KT5 A;  3LWL A;  4L76 A;  1VR6 A;  4L75 A;  2PC6 A;  4DR4 J;  2CJK A;  3B4D A;  3K8V A;  2RUG A;  1ZAX A;  2P9C A;  2RQM A;  4LBI A;  4PWD A;  2HHT A;  5F8H A;  1KHW A;  3QSY B;  4ZVR B;  1DY3 A;  4MH8 A;  3TNV A;  3TAR A;  1UVL A;  2W7O A;  1UW4 A;  4N5S A;  4ZHR A;  4J37 A;  4DR2 J;  1XQI A;  4GVL A;  3ZZO A;  2ZOM A;  3KMS A;  4JI2 J;  4FYW B;  1HBM B;  4TKT A;  1HI8 A;  4YOE A;  2N7C A;  4NXN F;  2BJ3 A;  4FXW A;  1FTC A;  2C2K B;  2W24 A;  3JSY A;  4DPO A;  2IA0 A;  3CDA A;  5EWE A;  2DR7 A;  2GC8 A;  5FD1 A;  1S72 S;  1DRZ A;  1HI1 A;  4UOC A;  4FNH A;  4NLP A;  1C1B B;  3MED B;  1TUV A;  3IWX A;  1IQT A;  3K2Y A;  4ZPA A;  3M9O B;  1ITP A;  2A3J A;  2AJF E;  1SQG A;  1A9N B;  3DDI A;  2A6O A;  2JDJ A;  1URN A;  1QVG R;  3DMJ A;  1FVQ A;  4Q2M A;  4B3S F;  2JLG A;  1RT1 A;  2ZWP A;  5LMN J;  3R6G B;  3IMQ J;  5LM7 E;  1PO6 A;  4PWD B;  4I1T A;  3M9M B;  3I4P A;  2UXD F;  3P45 B;  1CC7 A;  4KGM A;  4OYW A;  1XBW A;  2HIY A;  3L4B C;  2Z0G A;  2LVW A;  4LF7 F;  3SCL E;  2BE7 D;  4ZHR B;  4DV5 F;  4Y28 C;  3GE9 A;  4ECU A;  3QID A;  3G6Y A;  3AQO A;  1GMV A;  1M5S A;  4OZN A;  3ZZZ A;  1N52 B;  2UXC J;  1TZ0 A;  2D3U A;  3C16 A;  2DY1 A;  4CYU A;  3S1T A;  4XDD A;  2UV8 G;  2KRR A;  3I5C A;  2J0S D;  1DJ0 A;  1RWU A;  3L3C A;  1WF0 A;  4WCE Q;  4X64 J;  2IRU A;  4QWE A;  1LK7 A;  1S9F A;  2J6T A;  2B7C B;  1UVN A;  2D3Z A;  4ECT A;  3GFH A;  1U1P A;  4EZ9 A;  3MPW A;  2DGO A;  5KFF A;  3AB2 B;  1TFY A;  3RB6 A;  1S1U A;  3M8Q A;  4NLO A;  4UZB A;  2AX1 A;  2M88 A;  2G9O A;  1FNO A;  4P71 A;  3S8S A;  1RT1 B;  1VI7 A;  1Q8K A;  1REV A;  4FF1 A;  1S77 D;  1OYD A;  4CM0 A;  2XZD B;  4M1K A;  2BOA A;  3IM9 A;  1F2H A;  2WSF C;  5F8N A;  3W8P A;  1IBL J;  4HI2 A;  1H38 A;  2XSF A;  2V94 A;  1T11 A;  4AQY J;  3DU5 A;  4WK1 A;  1DHM A;  2WB4 A;  5IV4 A;  1KC8 T;  3R2D J;  1L3U A;  4V19 X;  2LYV A;  1HW8 A;  1RT7 A;  3MUR P;  1JLQ A;  1U2R A;  1PBA A;  2KVI A;  4CIO A;  4JI6 F;  3A8K A;  3KNG A;  3HD2 A;  3MM9 A;  3T1H J;  3RU0 A;  2DCL A;  2HS4 A;  3DRR A;  5E3Q A;  1RA6 A;  1H2V Z;  1Q0N A;  3C16 B;  1GH8 A;  4CYU B;  2DNM A;  4LRC A;  1ZTW A;  2NSC A;  3CTR A;  3HT0 A;  2ADC A;  5H9F J;  3VAG A;  1B99 A;  4DX6 A;  4OZ5 A;  2VFR A;  1KS2 A;  1RYS A;  3PKM A;  5KFB A;  4FDF A;  2NZ4 A;  2IJN A;  3ILI A;  2MXY A;  2O5D A;  4Z7Y A;  1QE1 A;  2Q79 A;  4DSE A;  2CQ4 A;  1H0H B;  1Q95 G;  3FFI B;  2QL9 B;  2HSE B;  1S1U B;  3M8Q B;  2XY6 A;  5K14 A;  2BDP A;  4B3T F;  3HHN B;  2W4D A;  3BS9 A;  4MKA A;  2HQ3 A;  5KFX A;  3W61 A;  3NOC A;  3NGK A;  3R7N B;  1T9T A;  3HVT A;  5F8L A;  5AE2 A;  3VAK A;  1GTE A;  3ONQ A;  1UFL A;  3B78 A;  4QBU A;  5JVH Q;  2DEJ A;  5FLX U;  2CPX A;  3FQL A;  2YNI A;  4F67 A;  3MR2 A;  1NCL A;  4M5H A;  4Q45 A;  5L1K A;  2UUT A;  4LF9 J;  1RAO A;  3TW0 A;  1N6Q A;  1RT7 B;  1XC9 A;  2N4D A;  1JLQ B;  1KLM A;  2NZC A;  3A4T A;  4WKY A;  2DHX A;  2C3U A;  5IT4 A;  5D0H A;  3DRR B;  4DL0 C;  3BBF A;  4MTP A;  5GAE U;  4WE1 A;  1RTZ A;  5AXN A;  4F0H A;  3IRW P;  1N8R T;  2IHR 1;  4AL6 A;  3UFC X;  3RZA A;  2VOO A;  5IWA F;  3HZG A;  3MPY A;  4KGK A;  4EU0 A;  3HVW A;  4USJ C;  5D4P A;  1NK5 A;  1QAX A;  2PEH A;  1QE1 B;  3RAX A;  4M5G A;  2ZM6 J;  3SFG A;  1IR1 A;  1YGY A;  5KG5 A;  5K14 B;  4USH A;  2ASD A;  4X4R A;  3P5B P;  3EVM A;  5DDQ C;  3VGV A;  4RLE A;  4AXI A;  1JKH A;  1Q81 T;  3QMQ A;  3HVT B;  4P10 A;  1CQN A;  1WOR A;  1KVK A;  4ILR A;  3U1N A;  3H20 A;  2ZH3 A;  1SL2 A;  5HL7 Q;  1H2U X;  3CT9 A;  1S57 A;  2ZH1 A;  2DNO A;  2JNJ A;  1UJ4 A;  5FDL A;  3OPK A;  3CD0 A;  2R7O A;  5DG9 A;  2AKW B;  2X3G A;  2GGP B;  4DR1 F;  4FF3 A;  4OI4 A;  3FCV A;  2J0X A;  2FY8 A;  1KTV A;  2LQ8 A;  1KLM B;  4CM2 A;  3CIZ A;  2IYI A;  3IBW A;  2LEB A;  3UCZ P;  5KFH A;  1CJK A;  2MJU A;  3FNN A;  2X1A A;  3LGN A;  3PW0 A;  1FXR A;  3RW6 A;  2HVZ A;  3GIM A;  4MJK A;  2AGP A;  3KOA A;  4WE1 B;  2EFQ A;  4WYW A;  2OGU A;  2FLO A;  2RIJ A;  4K4S A;  2PT0 A;  4NI2 B;  2RS8 A;  1T03 B;  1NDK A;  4IKA A;  5IV3 A;  1LWE A;  3KLE A;  2C2O B;  2BXJ A;  1WC0 A;  2P9G A;  1X9M A;  3A8E A;  3HFV A;  1U6Z A;  1IBM J;  3W7B A;  4ED4 A;  4Q43 A;  4UST A;  4I56 A;  1RT2 A;  1LQ9 A;  2E5H A;  5D0R A;  3KJQ B;  1JKH B;  1U8S A;  4XTT A;  3KLV A;  4X66 F;  4LFA J;  2F8H A;  2JWN A;  4JBC A;  5B0B A;  5K8M A;  1B7F A;  5H1S V;  1N48 A;  2E44 A;  1F2G A;  4ZP6 A;  4IRD A;  3OUY A;  5DRK A;  1WD6 A;  3D1O A;  1REG X;  4F3Q A;  2ZBQ A;  4DR7 J;  5FDL B;  1NM2 A;  4NEZ A;  4ECZ A;  4WWS A;  3MZI A;  2KO1 A;  5KFS A;  3UO0 A;  1RAF B;  2OPS A;  2KRB A;  4URG A;  1UAW A;  1BY9 A;  1JXV A;  1U2F A;  1CJK B;  4EBC A;  2QZ8 A;  1GNK A;  2F8E X;  1VHI A;  1K47 A;  4KO0 A;  2V0N A;  4NLY A;  2VG6 A;  2MZQ A;  1YRT A;  2RIL A;  2H4Y B;  4I6W A;  1HD1 A;  1JJ4 A;  2U2F A;  3OJS A;  2QV6 A;  1TUG B;  5E3A A;  2XS5 A;  2HRT A;  5J2N B;  3CJ8 A;  1N0U A;  1WI8 A;  2EPI A;  3P6Y C;  1VC6 A;  4NE9 C;  1HHS A;  3KLE B;  4X62 J;  3TA1 A;  2CQ2 A;  2R3V A;  1QLN A;  3D6M B;  3EDR B;  4YFU A;  3MMC A;  2UUW A;  1EQ0 A;  4ED3 A;  3I82 A;  2WTF A;  5M2R A;  1ROF A;  2X3D A;  4ZA1 A;  3PTW A;  4LF8 F;  2MYF A;  4XPE A;  1U1R A;  4JI4 F;  4HR2 A;  4LQ3 A;  2R9L A;  3SDE B;  2V8G A;  4BCA A;  1NB2 A;  1U8W A;  2NYI A;  1SKW A;  1M1G A;  4DR3 F;  1P1T A;  2OPS B;  1IKY A;  1Q53 A;  3JAM Y;  2IJF A;  1HNX F;  4CLY A;  1FI4 A;  4IO1 A;  1RCX B;  1EZZ B;  5BYR A;  5KFA A;  2VPY B;  1R3N A;  3LO3 A;  1RSC A;  3NAH A;  1MMD A;  1WKK A;  2POK A;  4KO0 B;  3L7P A;  4LMZ A;  4NA2 A;  1Q82 T;  3OR1 B;  4KB7 A;  1UJ5 A;  1G1X A;  3LP1 B;  4NYP A;  2XGQ A;  3WIV A;  3BO3 A;  4BDP A;  3DXS X;  1RLD A;  4YN3 B;  2H5E A;  4FPI A;  4K4X A;  3VV2 B;  7AT1 B;  5HRO A;  3KJF B;  2L48 A;  3K5L A;  4QW8 A;  4GKK F;  2AEJ A;  4KKO A;  3FCH A;  3NY0 A;  2GQC A;  3QNW B;  3MMC B;  2D7S A;  1KOH A;  3Q2S C;  1RP5 A;  1IKV B;  3NLC A;  3MMA A;  4GKJ F;  1YRU A;  5IXU A;  2XYH B;  4B3R F;  1HHQ A;  3ADA C;  2IVM A;  3Q89 A;  4ZCK A;  2DGV A;  1HNV A;  4K50 A;  4OJG A;  3PKY A;  3QIP A;  1WF1 A;  4KC5 A;  2BR0 A;  4K4U A;  4W92 B;  2F63 A;  1MSW D;  4DS4 A;  2IDE A;  2W2P P;  3BH6 B;  3PV8 A;  2HW3 A;  2MHN A;  1IKY B;  3RRK A;  5A8R A;  3TAQ A;  3MR3 A;  2B0G A;  2DXF A;  2UUB F;  3DHX A;  5C24 B;  3M6U A;  1H2T Z;  3W5Z A;  3MXH P;  2EG1 A;  2ABY A;  2XTJ P;  4KGX B;  2Y1I A;  2PN6 A;  3OXF A;  2CQD A;  4R0J A;  5HSP A;  4OX8 A;  4ZPD A;  3X3U A;  2DNL A;  1EIY B;  3GJQ B;  2HNZ B;  2KT5 A;  3BSC A;  1F1B B;  3HHE A;  2IDL A;  5G4D A;  5FJ4 A;  4P7V A;  4KKO B;  4Q8F A;  1NK0 A;  2RAQ A;  3BPD A;  4Q44 A;  4CLP A;  3W62 A;  3NP5 A;  3CDW A;  4OL8 A;  3VAH A;  1FWP A;  1IJE B;  3P5T L;  2CQ0 A;  3MEG A;  1C4C A;  3H2U B;  4I6Y A;  3LPY A;  4ZVT B;  1KOO A;  2VPX B;  1HQ2 A;  5F41 A;  1X8D A;  3I5A A;  5CYQ A;  4NLR A;  4QR0 A;  1S59 A;  2HZA A;  2IJR A;  5C7P A;  1HNV B;  1DBD A;  4NCG A;  3QIP B;  3HSG A;  4ZK7 M;  1X31 C;  2O3D A;  1V3S A;  2K3K A;  4J9R A;  2ACY A;  4CT9 A;  4QIW D;  5A8R B;  4BC7 A;  4JI0 J;  1PSD A;  1BGX T;  4RW7 A;  4ED5 A;  4ID5 B;  2XY5 A;  2R8I A;  1FRK A;  4U7U D;  2EI5 A;  4EFA C;  3OTD A;  2Z57 B;  2YTC A;  4J9M A;  5BXI A;  1WI6 A;  2X1B A;  4M5D A;  5BR8 J;  3PX0 A;  2VG5 A;  1NKB A;  4B3M F;  4Y2A A;  5I3U A;  3AH6 A;  2RUS A;  2IBK A;  3OFG A;  1VBX A;  3NGD A;  4KHR A;  4I67 A;  2ZBC A;  4NLV A;  2OO4 A;  2RU3 A;  2XYG B;  1U1Q A;  3UW1 A;  4QWC A;  2R2S A;  3QSI A;  4A47 A;  1VHF A;  4F0K A;  4K0K F;  4CWB A;  3PG9 A;  1QUP A;  2BM0 A;  1Q8B A;  1VBY A;  1TK0 A;  4TU7 A;  2E1P A;  3SFU A;  5A8W A;  2OKQ A;  3MEG B;  2AWZ A;  2D3O 1;  3M6V A;  2W9C A;  5IOL A;  3FSX A;  3LF0 A;  5KFW A;  1PGZ A;  2DRB A;  2MEW A;  4K4Y A;  5CYQ B;  3QAE A;  4F4A A;  3PRV A;  1UPP A;  2C2R A;  1EAR A;  4NCG B;  4C48 A;  2G0J A;  2GJ2 A;  1HWL A;  2XHW A;  1RDR A;  3U1M A;  2HQF A;  3I56 S;  5KT3 A;  4QPX A;  1T9V A;  1Z1Z A;  3T1A A;  2R42 A;  5RUB A;  3FEX B;  1RT5 B;  2W1B A;  1HPZ B;  2N3L A;  3EGW B;  4Q7A A;  1SJR A;  2U1A A;  4RW7 B;  4LSN A;  1TTH B;  4U96 A;  3M2V A;  2Y1J A;  3Q8Q B;  2GJI A;  3DLJ A;  3EWG A;  1R0B G;  4CH7 A;  2VG5 B;  1IJF B;  3VR1 A;  4IO9 Q;  3MOZ A;  2I6W A;  4J91 A;  4C98 A;  5GME A;  2R4F A;  4AT1 B;  2ZHO A;  1S79 A;  1NHU A;  1V6H A;  2B9E A;  5DLF A;  2XHC A;  2ZDP A;  1M90 T;  4X4N A;  5KFD A;  3OV7 A;  4CO5 A;  5HMY A;  4X4T A;  3MEC A;  1BWE A;  2H4W B;  1WUU A;  4CRJ A;  2JLF A;  2JLE A;  1W26 A;  1JB0 C;  1Z4U A;  1HIY A;  3DNC A;  2E7X A;  1ELO A;  5A8W B;  4U6P A;  3M30 B;  4W4M A;  2KL8 A;  3DI6 A;  3I6P A;  2W9C B;  3HK2 A;  3BGR B;  2MZJ A;  1HNZ J;  4JV0 A;  2DNQ A;  3DDK A;  2AJ4 A;  2LQJ A;  2YNH B;  3NS6 A;  3MMB A;  4JI7 F;  4Y65 A;  5J1N A;  3OFH A;  1FRJ A;  4YB7 A;  3HT3 A;  2E5L F;  4NYZ A;  4LT6 A;  2MSS A;  3W63 A;  3RW7 A;  2JRS A;  2W7A A;  4Q0B B;  2BKO A;  1RK8 A;  2CQB A;  4OZL A;  5HQM A;  1KHV A;  2DGS A;  4C8K A;  4D3G A;  3MEK A;  2RML A;  3MPU B;  2BMB A;  4LSN B;  1EKS A;  3D0G E;  3KJN B;  1ZM2 A;  1OSC A;  1TK8 A;  2ZE2 A;  2R8H A;  3GMG A;  4RUC A;  5E0O A;  3A13 A;  4ZP9 A;  2J7U A;  1IBK J;  5A2Q U;  1RAA B;  4F4Z A;  2WSE C;  1RHQ B;  1QVF R;  4NAS A;  1OSD A;  4CLF A;  3Q24 A;  3I55 S;  2UVR A;  1JJ2 R;  2KKH A;  2B4U A;  2Z56 B;  3MEC B;  3T19 A;  3A3O B;  3F73 A;  2ZH4 A;  4LF6 J;  3QRP A;  3B82 A;  4A8K A;  2OSR A;  2JFK A;  1EB0 A;  5HAT A;  2FVR A;  1X4B A;  1HD0 A;  1HBN A;  5L39 A;  4DFJ A;  1N56 A;  2UVW A;  4DUZ J;  1SH0 A;  1Q78 A;  3R1L A;  3HKW A;  3M05 A;  1K0V A;  3DI6 B;  3D2W A;  2IMO A;  4IRK A;  4P2S A;  5J2Q A;  2AEF A;  1WC5 A;  1R27 B;  2BW7 A;  4LF4 J;  3IRX B;  4NLQ A;  2E5J A;  4DL5 A;  1CJT A;  1WNE A;  2UVU A;  4DL7 A;  2CVI A;  2J9C A;  3PFE A;  3HX9 A;  3SCI E;  4KSE B;  2CQH A;  1OIA A;  1XEZ A;  3PIO Q;  2XMV A;  2L41 A;  1T3O A;  3UDL A;  2XCA A;  2Z2M A;  3PR4 A;  4H54 A;  3WQP A;  1JMT A;  1GK8 A;  5E3C A;  4DDF A;  1XN9 A;  1DQA A;  2OEM A;  2VPW B;  2HVI A;  2FTR A;  4PKD B;  5KFJ A;  2ZHA A;  2ZE2 B;  4F4W A;  2XLJ A;  4RWX A;  2V50 A;  1TFW A;  4WBF A;  1LW2 A;  3VCD A;  4OZ3 A;  4B9T A;  4RPF A;  5T7L B;  4P75 A;  4HH1 A;  4WP3 A;  2BKP A;  1NK8 A;  1SQF A;  2UUA J;  4F26 A;  1N36 J;  3S6E A;  3SSR A;  1WC1 A;  3CED A;  3MF5 A;  2HLT A;  4QYZ J;  4ZN1 A;  3QRR A;  3NL0 A;  1ULR A;  1N33 J;  2R7U A;  2ROE A;  1HR0 J;  5J2Q B;  4XPC A;  2W4P A;  3BR9 A;  2CJQ A;  3UE2 A;  4MYT A;  1CJT B;  4C0B A;  4PZV A;  1SC4 B;  3BR8 A;  3FKB A;  1IWG A;  2WSC C;  2QA4 G;  3HVR A;  2DJW A;  3NAI A;  1C1C A;  1FJG J;  3PZP A;  2HS3 A;  1U1N A;  1ZZF A;  1JLB B;  2DCU B;  4ZLP A;  2MKH A;  4LR8 A;  1XMQ F;  4C8M A;  2QSF A;  3G6V A;  1T3N A;  4HEA 9;  1S49 A;  4UUW A;  2QL5 B;  1KBR A;  2CZV C;  2EBG A;  4ZDN A;  3S01 A;  2BBE A;  3CC7 S;  3J80 U;  3M8Z A;  3PW5 A;  4DN0 A;  1X4H A;  1NPP A;  1EKR A;  1X5S A;  1AXQ A;  1KR4 A;  4ZVQ B;  4DSJ A;  1BUX A;  3BRE A;  2RT3 A;  5LSL A;  1J2V A;  3T9N A;  3RGI A;  1QD1 A;  4CO1 A;  3CUL A;  3IBF B;  1JNZ B;  1AA1 B;  1AZS A;  5L1I A;  2YX1 A;  1QAJ A;  2HQI A;  1OY6 A;  4NRU A;  5ETV A;  2EC0 A;  1VIX A;  2QMW A;  3GIK A;  1XJW B;  1C1C B;  2RQC A;  5JJB A;  2XMA A;  3CCV S;  1BWV A;  3HHL A;  1FFS B;  2JH3 A;  4WU2 A;  4NCB A;  4N8N A;  2X7I A;  5KFL A;  4ECW A;  1QSL A;  4JI2 F;  2Q43 A;  4W98 A;  1JLG A;  4DMZ A;  3CD7 A;  4ZVS B;  4EEY A;  3KHH A;  3NS5 A;  4ITS A;  3LW5 C;  4KHP F;  4M63 A;  1D9D A;  1HHT P;  4JI5 J;  3QT7 A;  2J7K A;  1NND A;  5I42 A;  4U7U K;  5DM6 Q;  2Y0S D;  5F0W A;  3NCQ A;  4RNM A;  1U7L A;  1YKW A;  2VOP A;  2R2T A;  3GZ7 A;  3HPO A;  1T95 A;  1J27 A;  3KWM A;  4PAA A;  1YLX A;  4MK8 A;  3C14 A;  2CQ1 A;  3U1L A;  2QLX A;  3PEH A;  3AJD A;  3UDC A;  1Y11 A;  2QYC A;  3OXL A;  2PE8 A;  1MU2 A;  1RLC L;  1YQH A;  1SJ1 A;  2CDQ A;  4F50 A;  4QOT A;  1S4F A;  1JJH A;  4ILM A;  5DGB A;  1BHN A;  4DL2 A;  3D1Q A;  5LMN F;  3NRB A;  2MKK A;  1WEY A;  2HLU A;  3N28 A;  2FLN A;  4NA1 A;  2X1F A;  2R8G A;  3MAA B;  1DUR A;  1H74 A;  2DR6 A;  2CG8 A;  3NGS A;  4OYB A;  4LBP A;  3BBB A;  1BQN A;  4DV6 F;  3SEO A;  4PG6 A;  3BGF A;  4CO4 A;  3H40 A;  1ZH5 A;  2E7W A;  1E6Y A;  4D3H A;  5KFY A;  2NQP A;  3FBB A;  2IRX A;  4QU6 A;  2B51 A;  1JLG B;  2JVO A;  2CUY A;  2RU9 A;  4ZN3 A;  4ECX A;  1X9W A;  2OEL A;  5I42 B;  3L7U A;  4DL6 A;  8AT1 B;  2EFG A;  1YRX A;  1NKE A;  1RHR B;  2A0F B;  1S6U A;  1PJ7 A;  3DGP A;  2HBQ B;  1SL1 A;  3TVY A;  1D9F A;  3N6M A;  3K57 A;  4DV0 J;  4P74 A;  1FK9 A;  2PEB A;  4Z7C A;  5KFP A;  1RA7 A;  3NS7 B;  5ETT A;  4BC9 A;  2VKR A;  2Q3P A;  2IC3 B;  3QRQ A;  3OTO J;  1M5P C;  2MPU A;  3V4I B;  4DF4 A;  1MU2 B;  1V9O A;  1WSR A;  3OVA A;  3M8R A;  2LEA A;  2I0X A;  4IQX A;  2MGZ A;  1N5Q A;  3JTO A;  3HMJ G;  5KFQ A;  3VF0 B;  1FX2 A;  2V4R A;  3UVJ A;  4PPZ A;  3MM5 A;  1G2E A;  1F3V A;  3B8H A;  2YKQ A;  6FDR A;  1PIL A;  4FS2 A;  3TVZ A;  2JHE A;  1NHV A;  3HI9 A;  3LUY A;  2VQE J;  1WG1 A;  4J9Q A;  2ATL A;  1BQN B;  4R0E A;  5K8P A;  4WFX A;  2GVZ B;  4FBT A;  3ITH A;  2MQP A;  4WPA A;  4DXL A;  4MIB A;  1VIS A;  1HYS A;  3THV A;  5C2C A;  2B5J A;  5LSR A;  2KH9 A;  1YJV A;  3PYF A;  2JSX A;  4DL3 A;  3FBC A;  5KT4 A;  3D5M A;  2C2D A;  1FO1 A;  2YQ3 A;  4K4W A;  3OLB A;  2ZJR Q;  2AYB A;  4OI6 A;  1F5B A;  2ROG A;  1FK9 B;  1YDL A;  2CVE A;  2YVS A;  1FKA F;  5D0G A;  4ELU A;  4QU7 A;  1KFD A;  1OS5 A;  1KKH A;  3W65 A;  1XMO J;  2HWH A;  5G0R A;  2HFU A;  2QLW A;  1WHY A;  3U02 A;  3TJ8 A;  2BW2 A;  2ZWO A;  3ENA A;  5HK4 A;  1NHK L;  2AHO B;  2JVR A;  5D4O A;  3GJR B;  3OHA A;  3UVJ B;  4HL9 A;  3MM5 B;  4N56 A;  1CJV A;  5EX0 A;  3R27 A;  2B3T B;  3SZ2 A;  2YY3 A;  3KYL A;  4NZ6 A;  4G65 A;  2MQO A;  4LF9 F;  4J90 A;  2AGQ A;  2ZBI A;  1Q7Y T;  4UF4 A;  3PHE A;  3ITH B;  3LAN A;  3HZE A;  3MMJ A;  1HYS B;  1JIH A;  3M2R A;  2ILY A;  3KHG A;  2B5J B;  3AOC A;  5AE1 A;  2UZA A;  1JJC B;  1RAH B;  2GIF A;  4DCP B;  2KG0 A;  2GMH A;  3DOL B;  4IQM A;  4AD6 A;  4CT8 A;  4PG4 A;  2H54 B;  2FGC A;  2C1E B;  2VAS A;  2FJV A;  5AJ3 F;  2VIC A;  5KOX A;  2EG2 A;  3BDE A;  3VWS A;  2IMW P;  2NR0 A;  2ZM6 F;  3KK1 A;  4KQZ A;  3NXZ A;  4ELV A;  4JV5 F;  5D3G B;  2YNF A;  3OTB A;  1MW7 A;  2DD8 S;  2MKJ A;  1S99 A;  3BN4 A;  4RU2 A;  1HW9 A;  1RT6 A;  5HO4 A;  5BJR A;  3BYR A;  1G4C A;  1CJV B;  3Q83 A;  1VC0 A;  4ZLL A;  4RKU C;  3M7V A;  2XY7 A;  1Y3J A;  4C8Y A;  2C2N A;  1FER A;  3QQC D;  2ZOF A;  4U9R A;  4CLW A;  1T9U A;  3DOK A;  4EZ6 A;  2L9D A;  3OSP A;  1VQS A;  3J7Z 5;  4YB6 A;  3H59 A;  5JXS A;  3LAK A;  5BYQ A;  4OQJ A;  4ED2 A;  2M3D A;  2J5A A;  3MCS A;  5KG6 A;  2B8P A;  1R6V A;  1BQM A;  2DGQ A;  2UUC J;  2I1R A;  1TMJ A;  1M1H A;  4DLG A;  1GX6 A;  3E51 A;  1XR6 A;  1DLO A;  1N4L A;  3ENW A;  1S6P A;  1AB8 A;  3R6L B;  2AP6 A;  4TY8 B;  4X65 F;  5J1E A;  4ZPW R;  4OYI A;  4RW9 B;  2E5I A;  1T02 A;  3KK1 B;  1IBM F;  2BV3 A;  2ZJP Q;  3KFW X;  4EK2 A;  1YJW S;  1TQL A;  3TO8 A;  2YNF B;  1U1L A;  1SJ4 P;  1VCT A;  4RNF A;  3CME S;  4LFC F;  4CO0 A;  2F40 A;  3MEE A;  1NK7 A;  2M7S A;  1DAX A;  2HK3 A;  3WC0 A;  5HJY A;  4DR5 J;  3N0V A;  4K2X A;  2K1R A;  4TQR A;  1JK9 B;  1U48 A;  4DR7 F;  3GP9 A;  3FBF A;  4X84 A;  1SH3 A;  2ZH5 A;  2DXD A;  3IN5 A;  4C11 A;  2ZBR A;  4OI0 A;  3DM2 A;  2ZH8 A;  3CCS S;  1YSJ A;  1FKP A;  1YVF A;  2CNK B;  3ZO7 A;  4FVC A;  2RB7 A;  1FFG B;  1LNQ A;  5E3R A;  5IM0 A;  2CQC A;  3MM7 B;  3PJX A;  4I2P B;  1NXI A;  2QL7 B;  2BM1 A;  1TV6 B;  3RBE A;  4K8R A;  2BJ7 A;  1VLY A;  3CCL S;  4MKY A;  2ATC B;  4M5L A;  1LOU A;  3MFI A;  1BQM B;  1DLO B;  1RHU B;  4OX9 J;  1S6P B;  1LV5 A;  1IKW A;  3KUE A;  1B64 A;  3AHP A;  2KXF A;  4F7V A;  4WTO B;  5J1E B;  5KG3 A;  4J9S A;  2W2M P;  3CIM A;  1Y5N B;  2MKI A;  2J8A A;  1NKC A;  1HFE L;  3MUT P;  2YKP A;  1DQ9 A;  5LJ5 Y;  3UPF A;  3C8Y A;  3TOQ A;  1RKI A;  4N76 A;  1IQZ A;  2R2U A;  2AQ4 A;  1SCJ B;  2R7W A;  1VOM A;  5F3Z A;  3RB0 A;  5KFC A;  2MB0 B;  1IBC B;  5CYM A;  2K1R B;  1VBK A;  2DR9 A;  3AXK A;  2L9W A;  2FD2 A;  5ADZ A;  2FZK B;  2DPJ A;  2X51 A;  4YP3 A;  4J9N A;  3C3L A;  2QRR A;  2V9K A;  3ZZU A;  1KQK A;  4C11 B;  4LF5 F;  2FPH X;  3DM2 B;  1O51 A;  3IP0 A;  1GX5 A;  1FKP B;  2QO3 A;  4PYD A;  4O23 A;  3GJS B;  3NEK A;  4DX8 H;  3Q23 A;  4NXN J;  2D74 B;  1K44 A;  3EE3 A;  1UZH A;  3OJU A;  2XMM A;  3I0S B;  3CDB A;  3PRD A;  4P73 A;  2FGO A;  5F9L A;  2HWT A;  4DOZ A;  2FB0 A;  2CPJ A;  3W1Y C;  1SPB P;  1YZ6 A;  5DG7 A;  4ZPT R;  3CJQ A;  2VFS A;  4DQQ A;  3ZNJ 1;  2LA6 A;  2B6A A;  4LRA A;  2PMH A;  1IKW B;  4DV2 J;  2HND A;  5HBM A;  3LQV A;  1ICE B;  2RKI A;  5IT9 U;  2COL A;  2J8S A;  1IM6 A;  1G7C B;  4Z37 A;  4B3S J;  2MMY A;  2HHS A;  4F2R A;  4J9U E;  4NZ0 A;  3QWP A;  1D0E A;  2XLI A;  1SQE A;  4XAK A;  3ETO A;  2FDN A;  5KFO A;  1HQE A;  1YJ7 A;  4ENO A;  4Q2L A;  1AYE A;  2WVD A;  1SB6 A;  2CJB A;  4LF7 J;  1S7H A;  1DAR A;  3FDS A;  1QTN B;  5KG1 A;  1FCA A;  2FZC B;  3PCO B;  2HNY A;  2OAU A;  1GAO A;  3BPS P;  2E5G A;  1EHW A;  2GZO A;  2QSW A;  3M1V A;  4EMD A;  3LAL A;  1P1L A;  4FN5 A;  4PXB A;  3P49 B;  3KDO A;  2QEX S;  5F8I A;  2YQ1 A;  4TQS A;  5HVF A;  1BD6 A;  3DRS A;  2A1B A;  5FLX Y;  4JYA J;  4LVN P;  4ES1 A;  4ICL B;  2OPQ B;  2Z2Z A;  1D3W A;  4O3Q A;  1OQ6 A;  2XMU A;  4H4K C;  2DNY A;  5T41 A;  2B6A B;  4PPD A;  5D8H B;  4ED6 A;  4M5M A;  5IQQ A;  2HND B;  4ETZ A;  5HBM B;  1NUE A;  1SV5 A;  3CUN A;  3BEG B;  5GAG U;  3JAM U;  4NML A;  5MLC V;  2W2O P;  1FRH A;  1FES A;  2CPY A;  2MHE A;  2CWX A;  2DR8 A;  3W9J A;  1QY7 A;  1KVI A;  2V4J A;  4DU8 A;  2MST A;  4N77 A;  4BLG A;  3KHR A;  1A0O B;  2RRB A;  3DOM A;  1OQ3 A;  3H5S A;  4CNZ A;  5HP1 A;  1HQE B;  2V68 A;  5DZ6 A;  2CPH A;  5ETP A;  7FDR A;  5EGY A;  1D8Y A;  1YJR A;  2CPF A;  2QE5 A;  2CXE A;  1Y4Z B;  4QWA A;  2HBY B;  4WXW A;  3TRG A;  2OD6 A;  2JEI A;  2LEP A;  4JI6 J;  1YWX A;  2HNY B;  3MOJ B;  2KG1 A;  2FIU A;  3KXD A;  4KR0 B;  3UCG A;  3M1V B;  3QYY A;  3FEZ A;  3RRH A;  2VA3 A;  4H4K A;  4ZIW A;  3TUI C;  3PX4 A;  3GPA A;  4AUK A;  3CF5 Q;  2BEF A;  5HAO A;  1WTB A;  3K5N A;  4IG3 A;  1TP7 A;  3RB4 A;  2ZUG A;  4DPU A;  2VD3 A;  1FDD A;  3V6D A;  2XMW A;  4PG5 A;  2NPF A;  3DRS B;  3CJ3 A;  4I0W A;  2VG7 A;  3T6J A;  3W2W A;  3G6X A;  4HTI A;  4FF4 A;  1T9X A;  1QAI A;  2DO0 A;  4LIW A;  4GVB B;  4WF9 Q;  1KVJ A;  1SV5 B;  1YX2 A;  3OTE A;  1Z2Z A;  4B3T J;  3US5 A;  2WAQ D;  3NKY A;  1RWX B;  4FXD A;  4YB5 A;  5A6W A;  2HQD A;  4OFZ A;  3ZZY A;  4JP8 A;  1FXL A;  4OZ0 A;  2HQG A;  3NWG A;  2V4J B;  1TK5 A;  2VZ9 A;  1TU0 B;  4O44 A;  1ZS6 A;  3X1L B;  1N5Y A;  4ED7 A;  3KK3 B;  5HP1 B;  4DPY A;  1S6O A;  3GR1 A;  1OYE A;  3CVK A;  2QMX A;  2DGU A;  1VK8 A;  1IKX A;  2P6S A;  3HUL A;  4I7F A;  4C7Q A;  1FD8 A;  1ZAV A;  3G71 S;  1VRQ C;  4F3M A;  3SI8 A;  2VDI A;  2YQ0 A;  5C42 A;  4DCJ B;  3P3D A;  3W9H A;  2L3M A;  4IG3 B;  3TZX A;  1RAJ A;  3H0P A;  4XK8 C;  4NWB A;  1Q79 A;  1UWA A;  4KHM A;  5IWA J;  5B0E A;  3W2W B;  3DYA A;  4KFB A;  3BJY A;  3DDN A;  2IYG A;  2VBZ A;  3MTK A;  3KJV A;  5EX3 A;  2XEX A;  1UA1 A;  1NH8 A;  3Q8P B;  2QMU B;  2GJF A;  2KJV A;  2OI2 A;  3OFE A;  2GIQ A;  1S97 A;  4V19 J;  3PFO A;  4L3N A;  4YQW A;  1PYO B;  4DF8 A;  3T41 A;  4URS A;  1GXU A;  4HT5 A;  2C42 A;  4ANE A;  4DSL A;  4O44 B;  2VF3 A;  4K4V A;  3ISZ A;  4NA3 A;  2BAN A;  1AUD A;  2XSJ A;  1K1S A;  1I94 J;  4FKX A;  1R6Y A;  1HWU A;  1T7P A;  3V2U C;  2V8V A;  2JFD A;  1RWN B;  4I68 A;  1CJU B;  2YWK A;  4OJ1 A;  2HVH A;  4NLX A;  3PRB A;  3DXB A;  3DFE A;  2F1F A;  3UDV A;  2DRD A;  4I7F B;  3PW7 A;  1WC4 A;  3W60 A;  4UTG A;  2DRA A;  3GWC A;  3J81 j;  5C42 B;  1TVR A;  4S0M A;  4FYD A;  3FRY A;  5LXY A;  4EO6 A;  1KFS A;  4X4P A;  1ZM9 A;  5KFU A;  2M4M A;  3C2P A;  2CJX B;  4NEY A;  1X4D A;  3ZNU A;  3MAH A;  1IBK F;  4QWD A;  4AL5 A;  4KFB B;  2PSZ A;  4ZLJ A;  3KJV B;  3SBM A;  3TEH B;  4DJB A;  2QFJ A;  3C6T B;  4QW9 A;  2A10 A;  4DG1 A;  3KLH A;  5DJB A;  1N5S A;  4LF6 F;  5DS7 A;  1Y7P A;  1KLN A;  3A8I A;  1YJN S;  4X66 J;  1CS4 A;  1Y5I B;  3GIL A;  4RNN A;  1U0S A;  3GLJ A;  4DSI A;  2Q1L A;  2BAN B;  4FS1 A;  2DK2 A;  2XSJ B;  3NGR A;  4J9K A;  2V9W A;  1M5K C;  1L3T A;  3FMB A;  2G4B A;  2L08 A;  4LF4 F;  3H2V E;  2RVJ A;  3OLA A;  2ZC3 A;  2MQM A;  1S1T A;  4IOB A;  4RR5 A;  1NSK L;  1N32 J;  3CNQ P;  4MAK A;  4A8M P;  2FVP A;  3NBP A;  1JWW A;  4DS5 A;  2FVQ A;  1TVR B;  4LSZ B;  4BS2 A;  2F8M A;  2K7J A;  2VQF J;  4RW6 A;  4P52 A;  3IBC B;  2V5H G;  4ZJL A;  5H9E J;  1X4C A;  1Q86 T;  4ES3 A;  3LA0 A;  3FCW A;  4B17 A;  3O1L A;  2WVC A;  2VJU A;  1RZM A;  2MZT A;  1VK3 A;  4QR2 A;  3FVY A;  4RNH A;  4LR7 A;  3IG1 A;  2YKA A;  2DR5 A;  3RBZ A;  4PXD A;  1I1G A;  1WEL A;  2IY5 B;  3RTV A;  4AE5 A;  1WHW A;  2E7V A;  2IIH A;  3GON A;  2GMJ A;  2EK6 A;  4N7T A;  2FVS A;  2C28 A;  3T3F A;  1N36 F;  3DMJ B;  2V2V A;  4JI1 F;  2XS7 A;  3CGI A;  3HLU A;  3T5K A;  5C2G A;  3DHW C;  4JI4 J;  1N33 F;  4PYA A;  3VQS A;  1HR0 F;  3HSJ A;  4YME A;  1M5O C;  3PHT A;  5GAH U;  1KDN A;  1SKU B;  4GRS A;  1FRI A;  4PUO A;  2HMI A;  3OHB A;  2OIH A;  1APS A;  4X2B A;  3CO9 A;  1K73 T;  2H9Z A;  3M8P A;  1VLO A;  1FJG F;  1EX8 A;  1ZA1 B;  5D4N A;  4LVO P;  3EVO A;  4P6Q A;  3NBP B;  2GIR A;  2EFO A;  4YY3 F;  1KQG B;  4OX6 A;  3FQK A;  1ZOT A;  5KFE A;  4X4U A;  2ADB A;  2M8D B;  4OMF G;  4IFY A;  2XUL A;  3OL7 A;  2D1C A;  1NJY A;  4B9V A;  4C3M A;  4I4B A;  4ZCI A;  4DFP A;  2DY9 A;  5KFV A;  4Y0F A;  4YB1 P;  1U1O A;  1D1U A;  1VGY A;  3K5P A;  2D9O A;  3GYN A;  2ZZM A;  3QAU A;  3IG1 B;  4OYZ A;  4C8Z A;  2DH8 A;  3Q2T C;  5LSO A;  1R7I A;  5HVG A;  4USW A;  2Z4P A;  2ZD1 A;  1M1K T;  1URR A;  4GO5 X;  4Y2M A;  2VBX A;  4K2J A;  2DNP A;  3J7Z T;  4R25 A;  1JXE A;  2L9N A;  3F0N A;  1UW9 A;  1XER A;  1WEX A;  5IQ6 A;  4ECR A;  4RWW A;  3BB5 A;  3P96 A;  4B3R J;  1REV B;  4ZVU B;  2GO8 A;  5J2M A;  4DHV A;  3CMA S;  1NSQ A;  1FFW B;  2ZFH A;  1XNQ J;  2YKM A;  3P4U B;  4KPY A;  3UQS A;  2KN4 A;  2WHO A;  3V6H A;  4KT0 C;  4IRC A;  5GAE I;  5CAA A;  1T8E A;  1NK4 A;  2WVE A;  2BAB A;  3OL6 A;  2LDI A;  3GCW P;  1D8Z A;  4NLU A;  3BO2 A;  3MM9 B;  3Q8U A;  5DDO C;  5AE3 A;  2HFS A;  1RWK B;  1ZBT A;  5U47 A;  5B0D A;  2HGL A;  2CWK A;  2ZHB A;  4IFY B;  3MDF A;  5IT0 A;  2MKC A;  4IFV A;  1U4B A;  2KFN A;  4ZIT A;  3ET6 A;  1SJF A;  2ZDO A;  3ZZR A;  4ECV A;  4MFB A;  1K1Q A;  2DH7 A;  4J9V A;  1DFD A;  4OYM A;  2ALZ A;  4WP8 A;  1Q16 B;  4JOU A;  1B4S A;  1VRT A;  4U7C A;  2ZD1 B;  3K0J A;  2QLJ B;  2C3P A;  2CQP A;  4RW4 A;  1FTR A;  3UDE A;  3PO5 A;  4OYX A;  3ILJ A;  1N34 F;  2XMK A;  5L38 A;  4G1Q A;  5J2M B;  4OLP A;  2DBB A;  5KT6 A;  4M94 A;  1VQM S;  3KLF A;  2YNI B;  1KP6 A;  3GR0 A;  2W4C A;  1LXJ A;  1K0T A;  1FD2 A;  3CCR S;  3BZQ A;  1N6Q B;  2GML A;  1YJ9 S;  3FK4 A;  3OVS A;  1C2P A;  3H7H B;  1VJW A;  3WZ0 A;  3LGH A;  4RU9 A;  8RUC A;  1VMB A;  3BV8 A;  4A8X A;  1VC5 A;  4ED8 A;  2DHH A;  5B0A A;  4B3M J;  4LSL A;  3LAM A;  3M8Y A;  4HHJ A;  2GQQ A;  2SXL A;  2J6S A;  4YDD B;  4IFV B;  2M52 A;  4DZ6 A;  2IM1 A;  1MWZ A;  4IYQ A;  4MFB B;  4TYA A;  1N5T A;  1SUQ A;  4BWJ A;  4A8W A;  3IC1 A;  4WJB A;  3M9N B;  3QT5 A;  1VRT B;  2LEC A;  3T9Z A;  1L5U A;  4DV0 F;  5HAN A;  3ZTS A;  3DRP A;  4RW4 B;  4LQ9 A;  3G87 A;  3N01 A;  4ER8 A;  4ECS A;  4OV6 A;  2KVQ E;  5IC4 B;  1W2I A;  1NJX A;  4MMO A;  1NJW A;  3VVU A;  5KOW A;  3LOU A;  4IH6 A;  3AXM A;  4MT1 A;  4QCL A;  4G1Q B;  1ZPW X;  2MTL A;  4NLS A;  4WFB Q;  3IAS 9;  3T1Y F;  3BBC A;  2RSQ A;  2PDA A;  3L95 X;  6FD1 A;  3RRG A;  5DZ7 A;  3ELH A;  2OMO A;  3KLF B;  4RNO A;  2IVF B;  4MKV A;  3TA0 A;  4KRW A;  1U25 A;  2CNN B;  1VS3 A;  3CJT A;  2FVC A;  2CPI A;  2FJD B;  4DQI A;  4RBV A;  1UFW A;  3OSN A;  2A18 A;  3HSD A;  2VQE F;  3I0R A;  1V3Z A;  2C22 A;  3CE8 A;  1MN7 A;  4J9P A;  2KXN B;  4Z2X A;  2QX0 A;  2D41 A;  2HG4 A;  4Y3C A;  2MLZ A;  3PDN A;  2PI5 A;  4DX7 A;  1R8P A;  1VQ6 S;  4B9U A;  1MML A;  2CJA A;  2NXJ A;  4LSL B;  2LMI A;  2VHG A;  2Y8W A;  2WVF A;  1BMQ B;  2O67 A;  2G2O A;  4F02 A;  1LWE B;  2XO7 A;  1SUQ B;  2B7B B;  2KT3 A;  1I3O B;  1MMN A;  1RYR A;  3BGO P;  4C8O A;  4KY3 A;  3M6W A;  3VHQ A;  4ZVH A;  4LF1 A;  4P7T A;  4HYK A;  1RB0 A;  2I8E A;  3A8J A;  3D3C J;  1U26 A;  4L3K A;  2QTW A;  1RT2 B;  1WKL A;  5A8K A;  3SXL A;  3TR5 A;  1S10 A;  1XMO F;  1XWL A;  1QJH A;  2MLX A;  3B54 A;  3HKZ D;  2B56 A;  3SMZ A;  4DV7 J;  1YI2 S;  3GIR A;  5J2P A;  3QWU A;  1PYT A;  2H51 B;  2Q6C A;  3LGM A;  4NLT A;  3OUY B;  2V69 A;  3VAJ A;  2YWH A;  2CQI A;  4DSK A;  2BUN A;  4JI7 J;  3CXC R;  3GU0 A;  4HH0 A;  1YTY A;  2OFH X;  2J76 E;  5HLF A;  3D9B A;  3NNC A;  3PAC A;  1YBU A;  4QIE A;  3FZ2 A;  3I0R B;  2XNR A;  4KIA A;  3NWR A;  1F3F A;  2NYH A;  4L72 B;  3KLI A;  4N41 A;  3CB4 A;  5ETS A;  1VYA A;  3EYZ A;  3MR5 A;  2VG6 B;  3LP0 A;  4USM A;  2QG9 B;  2OJ3 A;  1X5O A;  1Y0H A;  4KAI A;  1KWM A;  1UEU A;  1SC6 A;  4F4K A;  3P8B B;  1NJZ A;  1WDD A;  4CH1 A;  2R8K A;  3J7Y I;  2Z2L A;  4ID8 A;  2HFN A;  4PEO A;  2VKZ G;  3ETM A;  5THW A;  1Q4R A;  4Q8E A;  4QIF A;  1PC4 A;  1LWF A;  1LWX A;  3A3P B;  1YIJ S;  1VFJ A;  4HTJ A;  1RAD B;  2DIU A;  4GMK A;  1HNW F;  1P9Q C;  4KV8 A;  3J7Y U;  5A8K B;  1CC8 A;  4DR6 J;  2H3E B;  1HAR A;  4E2F B;  3G82 A;  3C66 A;  4LIR A;  2KFY A;  2VB6 A;  3H25 A;  3KMQ A;  3BGU A;  5AT1 B;  2DNG A;  4KJI A;  2VBY A;  4RL1 A;  2FHK A;  4KPC A;  4IOA Q;  2ALY B;  5HLF B;  1GMW A;  4PWU A;  4CO2 A;  5CAB A;  4PRF A;  4FXV A;  1HI0 P;  2ZJQ Q;  2YH1 A;  1VQ8 S;  3UD5 A;  2N7Y A;  1JLE A;  3KLI B;  2G1H A;  4UY8 5;  3R5G A;  3D6T B;  1XNR F;  3KG0 A;  1FDA A;  2R7S A;  3LP0 B;  2BOP A;  2QN6 B;  2WW8 A;  1VIO A;  2J0W A;  2H5I B;  2AMC B;  4H4M A;  1NH7 A;  3HHK A;  2DGX A;  2DHG A;  1ZTT A;  4DV1 F;  2CIM A;  3D4J A;  2RDJ A;  4WII A;  3D7S B;  5HRO B;  2AT1 B;  3BKT A;  3RBX A;  2MZS A;  2F9D A;  5ETN A;  2UUC F;  3WC2 A;  4AFF A;  1LFP A;  2J9E A;  5CD4 A;  4ZVP B;  3IWL A;  1KEK A;  3G86 A;  3OFF A;  3MMA B;  4KV8 B;  4LFB J;  2E1M C;  3TWZ A;  1R0A A;  2RHS B;  1WOO A;  4EGL A;  3I9V 9;  5KFI A;  2A6M A;  1RTH A;  5HJX A;  3D54 A;  4FKY A;  5B09 A;  4CLL A;  2FQQ B;  5JUM A;  5L1L A;  3DGV A;  3H4B A;  5CYJ A;  1KTQ A;  2GHV C;  5KFZ A;  3EDQ B;  3FMW A;  4L6V 3;  4DR5 F;  3BH7 B;  3MGJ A;  2K7K A;  3I4H X;  2H48 B;  1JXL A;  2J6U A;  3N79 A;  3OTC A;  5F8M A;  2XNQ A;  1BQX A;  1XMQ J;  1P8G A;  1Q8I A;  3DKD A;  3FRZ A;  4TVA B;  1AFJ A;  9RUB A;  2MQQ A;  2BYC A;  2QIF A;  2BVZ A;  4LRB A;  3T5L A;  4JB8 B;  2ERR A;  1ARO P;  1TL1 A;  3IFE A;  2XZW A;  1C1B A;  3MED A;  1JLF A;  1RT4 A;  3Q22 A;  3PO4 A;  4A8Y A;  3VGT A;  4A4J A;  1T05 A;  4TU9 A;  1LXN A;  3RJM B;  4GC6 A;  3QFW A;  3ZZ0 A;  3CD6 S;  4ZVG A;  1R0A B;  1UVJ A;  2H65 B;  2HRU A;  4P2M A;  1YBA A;  3OXG A;  4WP9 A;  5KFK A;  4DX5 A;  4YS2 A;  1CQM A;  2YWF A;  1O0P A;  2LLZ A;  1UCN A;  1UFK A;  3HP6 A;  4HVZ A;  4ZCM A;  4IR1 A;  2MY8 A;  4JI8 F;  4WFY A;  4NRT A;  3EPI A;  4BHQ A;  1XIQ A;  4PG8 A;  2OD4 A;  3NOG A;  3H90 A;  3IR5 B;  3PR5 B;  3V4M A;  3QLH A;  5IC6 B;  3KG1 A;  2V63 A;  4J9O A;  3DLK A;  3EIC A;  2RRN A;  2AIR B;  4M5D B;  3U7J A;  5HQ8 A;  3FC9 A;  5I3U B;  5L8R C;  4KHP J;  1SIW B;  4C0O C;  3CSK A;  4KH1 B;  3M32 A;  2OSQ A;  3E01 A;  1EAY C;  5B08 A;  1ACM B;  2E9Z A;  1MN9 A;  5M2P A;  3PNI A;  2JC1 A;  3AOD A;  1TL1 B;  4B08 A;  1YBT A;  4F3O A;  4JUZ A;  3R5A A;  1JLF B;  5H9F K;  1RT4 B;  2CPD A;  4GC7 A;  2BJ1 A;  5KG2 A;  2MQN A;  1T05 B;  4DV2 F;  4PWW A;  4C9D A;  1XTZ A;  4J7C A;  1CLF A;  4USK A;  2RH3 A;  2E1R A;  3UR0 A;  1TMM A;  3EXY A;  4I2Q A;  1N88 A;  3WX4 A;  3TP2 A;  1FRM A;  1RT3 A;  5K20 B;  1DZ5 A;  2YKO A;  4CH0 S;  3TUP A;  1NB7 A;  2VFV A;  5K8N A;  2EKN A;  4PQU A;  1LEO A;  2V67 A;  2K8G A;  2ZEJ A;  2HHW A;  3AA9 A;  4DV6 J;  3W8G A;  1Y00 A;  5K9F A;  2ASY A;  4KBI A;  4DUT A;  3QLH B;  2HGM A;  3GJT B;  4AYB D;  3M2V B;  5KG4 A;  3DLK B;  4E98 A;  2ZBP A;  1XR5 A;  2Z58 B;  5K5M A;  1FA0 A;  2F3J A;  2XI2 A;  2CPE A;  2W2Q P;  3RG6 A;  3RR7 A;  4C6A A;  4LBH A;  4QYR A;  3M32 B;  3W5X A;  3E01 B;  3FSY A;  4Y2C A;  3E3X A;  2XG8 A;  2LDY A;  3HO1 A;  4OHY A;  4HDH A;  4JYA F;  3ZTQ A;  3R2C J;  2XQC A;  3EZO A;  3GCX P;  1RHM B;  3FFI A;  4TXS A;  3UD4 P;  4LF2 A;  2KT2 A;  3JSR A;  1FEH A;  3PEJ A;  1S1V A;  4IUF A;  5DDP C;  4DV4 F;  1DTT A;  4I2Q B;  2CJ9 A;  4CLS A;  4ZMM A;  2BQU A;  4JV1 A;  2IM3 A;  2M2B A;  1RT3 B;  2DNN A;  5HMX A;  5GVQ A;  3JB9 k;  3MMB B;  2FUG 9;  1H7W A;  2UXB F;  4NMX A;  2JC0 A;  4USU A;  2YWG A;  3HF5 A;  4PQU B;  2NXN A;  4O3P A;  2EC2 A;  1FXD A;  1Z2L A;  4YDX A;  3MAQ A;  4ZVE A;  4U95 A;  1W7W A;  5ETR A;  2HRY A;  4EBE A;  1NDP A;  4P72 A;  1HA1 A;  3SV4 A;  1WHV A;  3MCN A;  4AL7 A;  2W8K A;  2B9X A;  2OTJ S;  1RKJ A;  2DKO B;  1VQK S;  5FII A;  3C46 A;  4H4O A;  5CCM A;  2RHQ B;  3JSB A;  4F4Y A;  1FDN A;  5DQI A;  2EKY A;  3QGG A;  4QPT A;  1DQ8 A;  4FPR A;  2PMW A;  3LP2 A;  4KYZ A;  4DU7 A;  1UA0 A;  3QFH A;  7FD1 A;  2P9E A;  5D6G A;  4HDG A;  3V6K A;  3AT1 B;  2G2Y A;  3AOA A;  1HBN B;  2LU2 A;  3MM8 A;  1N54 B;  3IS9 A;  1UWB A;  4CI0 B;  2HAF A;  1S1V B;  2GHP A;  2HWI A;  2CKW A;  4TN2 A;  3NNH A;  2AJQ A;  3DLH A;  5A0Y A;  1DTT B;  2P2C B;  1RWM B;  2MZR A;  3BKU A;  4IH7 A;  1NME B;  2R7V A;  5D15 A;  3MD1 A;  2QJ3 A;  5HMW A;  1A7G E;  8ATC B;  2IRY A;  4NLD A;  4CO3 A;  1A6L A;  2FLP A;  4DV3 J;  4PG7 A;  2IFX A;  1GEH A;  3ZTO A;  3PJW A;  2IA6 A;  3WBZ A;  2GGP A;  5E5N A;  3CCE S;  3TX8 A;  4O3N A;  3CWJ A;  3HJV A;  1FRX A;  2YPY A;  2B9W A;  1HWJ A;  4X4S A;  4V1A k;  3TQE A;  2AU0 A;  1WSV A;  3QZ8 A;  2HHH F;  4H4O B;  4WIQ A;  4RBU A;  3E2E A;  4J5O A;  2DHA A;  1X5P A;  3HHL C;  2I2Y A;  1XK8 A;  1TL7 A;  3D6F B;  2DO4 A;  3HD1 A;  1LW2 B;  4NI2 A;  2B8Q A;  1BXN A;  1T03 A;  1FJ7 A;  3LP2 B;  4L74 A;  4O3O A;  4Y2K A;  5AJ3 J;  2C2E A;  2Y8Y A;  2ZNY A;  4PXC A;  5D78 A;  3MM8 B;  5C25 A;  1WC6 A;  5B7W A;  3IS9 B;  1UWB B;  1VQN S;  1PC5 A;  3CJK A;  2M0G B;  3GB0 A;  4JV5 J;  1YJT A;  3MR7 A;  4G1I A;  5A0Y B;  1D09 B;  3DU6 A;  5LT5 A;  3K89 A;  2FHJ A;  2HHV A;  2VV5 A;  3GFZ A;  4UOG A;  4DR4 F;  1RJJ A;  9ATC B;  1I94 F;  3MPD A;  2GQ2 A;  1UTA A;  1X60 A;  2W7P A;  2XZT B;  3HJF A;  3B6B A;  4HLB A;  5E2Q A;  3R8Y A;  2HVE A;  4OZ1 A;  2OP5 A;  1EET A;  4ZVO B;  3C19 A;  3GFX A;  3QGP A;  1X4G A;  2C3Y A;  5GAD I;  2YXL A;  2DHS A;  5EWF A;  4DR2 F;  2VFU A;  2XM3 A;  3JQJ A;  4OHZ A;  2XGP A;  1M0S A;  3VZI A;  1S0M A;  4B9N A;  3QT6 A;  1IR2 A;  1WG4 A;  4B9S A;  1Q8L A;  2ACM A;  2G1D A;  4DN9 A;  5GAD U;  2GAH C;  3BQ1 A;  1TL7 B;  5J2N A;  2DGW A;  2M8H A;  4DPX A;  4ES2 A;  4P9S A;  1FEE A;  1TL4 A;  1U6B A;  1YK9 A;  4X65 J;  1MWQ A;  2NS1 B;  1V3R A;  2E1A A;  3TX0 A;  5C25 B;  1FKO A;  1UEV A;  3CJK B;  1AZS B;  4WU3 A;  1QTM A;  2BRK A;  3IGN A;  5KFT A;  2C3M A;  4C4W A;  3R5J B;  3VGS A;  3H42 A;  2WVB A;  4LFC J;  2WCX A;  1YIT S;  1HMV A;  3CDU A;  5D0E A;  2V8H A;  2F9J A;  3R97 A;  1S1W A;  2KHD A;  1Q1K A;  4MIA A;  3PYD A;  4LUB A;  3ZTP A;  2MKS A;  3BM7 A;  2ZH2 A;  3SDE A;  2AD9 A;  2EVZ A;  3QBC A;  3TI0 A;  1ZM4 A;  4TLR A;  1EET B;  5DQG A;  3HHL B;  1CBK A;  3J81 Y;  3BQ2 A;  5CQG A;  3CCM S;  1VJQ A;  1N32 F;  2WOM A;  5IT9 Y;  1T9Y A;  4YHH J;  4NOH A;  5LOQ A;  5BYS A;  2XWY A;  3EGV A;  3UD3 P;  3IM8 A;  5CH7 B;  1VQ5 S;  4IG0 A;  2AF6 A;  5EN1 A;  3TUJ C;  2VUG A;  4FYX B;  5IZH A;  2UXC F;  2GNK A;  2G13 A;  2VQF F;  3CO0 P;  3OR1 A;  4DEZ A;  3LP1 A;  3R5D A;  4IDK A;  1CEZ A;  5EWG A;  3W66 A;  3JQM A;  5IS2 A;  3I5B A;  3GIJ A;  1AFI A;  2BJ8 A;  4X64 F;  2YWW A;  3HCX A;  3Q8V A;  4M5K A;  4EO8 A;  3N5B A;  3G9C A;  3TZZ A;  2IBO A;  4DSF A;  3O2I A;  3C14 B;  4IOC Q;  2EXU A;  4JI3 J;  2QLB B;  3SCJ E;  1FKO B;  2R2R A;  1SXL A;  1UVK A;  1YG0 A;  5EUH A;  1O6X A;  2LQB A;  1IKV A;  4CCH A;  1RIS A;  1RWO B;  4AND A;  2W25 A;  2AZ3 A;  3M8S A;  1NZA A;  3L9Z A;  3BGL A;  2ILZ A;  2H1Y A;  1HMV B;  4CLK A;  4QIV A;  3HVA A;  1S1W B;  3LTO A;  2CG4 A;  1MLA A;  3QJP A;  4USV A;  2O66 A;  1VQP S;  3NCR A;  2ASL A;  3SV3 A;  1NRK A;  1IBL F;  5HVH A;  4AQY F;  2Z30 B;  2MZ1 A;  3GYX B;  2ASJ A;  4LF5 J;  5DLG A;  4DUY J;  5CZX A;  1SL0 A;  2QFI A;  3CCU S;  3UNG C;  2WOM B;  1X9S A;  5F8J A;  1E6Y B;  3K5M A;  3B4M A;  2HS0 A;  4CDI A;  4KGZ B;  2CAD A;  1GXL A;  4I64 A;  2DNR A;  5C24 A;  4IG0 B;  3T1H F;  2HPU A;  3QGH A;  4UT4 A;  5CZV A;  1IN0 A;  4UUX A;  2AZ1 A;  1H72 C;  1B0P A;  1X0P A;  1H73 A;  4IDK B;  3R3T A;  2ZNZ A;  3WX8 A;  2CPZ A;  1YJU A;  3FUY A;  2I38 A;  3DGP B;  3R7S B;  2HNZ A;  1WC3 A;  1TKX A;  3K58 A;  5I3Q A;  1PG5 B;  3ZFV A;  2V8P A;  2QGF B;  4TYB A;  1HBU A;  4MKB A;  4UY8 T;  2ZH6 A;  2M9K A;  3ISN D;  2XBP A;  4WK3 A;  3M6X A;  3WDO A;  2JX2 A;  2J9D E;  4J9L A;  4K4Z A;  4PQA A;  1VQ7 S;  1S7I A;  1RHJ B;  1LKZ A;  1UET A;  3G96 A;  5DO2 A;  1M5V C;  1FF2 A;  3CCZ A;  3ENV A;  2MGZ B;  2IM2 A;  2KYX A;  1ZPV A;  2RJZ A;  2PFD A;  1JLA A;  2CZ4 A;  2YH0 A;  2EFV A;  3V5R A;  4UOF A;  2NSB A;  2NPI A;  4NX9 A;  4OI2 A;  3D0I E;  1XNQ F;  3R9L A;  4XDC A;  2A2C A;  3QJL A;  4ZOS A;  4WZQ A;  2OH2 A;  3DRY A;  4DWI A;  4OHW A;  4NXM J;  2OHD A;  1YHQ S;  1RCO B;  3VAL A;  3FEY B;  4WFZ A;  3RAM A;  2Y0B B;  1RI7 A;  4ID5 A;  3NGT A;  4I6A A;  1F9E B;  2HBZ B;  4FYV B;  2FC9 A;  2UU9 J;  3JYT A;  5AXL A;  2J9D A;  3UCU P;  2APO A;  4K5S A;  2BE2 A;  1V5V A;  2F65 A;  4I69 A;  5LMU J;  3GYG A;  1RUS A;  1ZAW A;  1TKX B;  4B3O A;  2VH7 A;  1GMU A;  4C3L A;  1FNX H;  2Y3Y A;  2F4V J;  3K8W A;  5MAO A;  1RTJ A;  2LP4 A;  1HBU B;  1Y10 A;  1S0O A;  1FDB A;  1LK5 A;  4Q5V A;  1RTI A;  5DM7 Q;  2DNK A;  1CPZ A;  4UQT A;  4URQ U;  5G0R B;  2DVI A;  3G8T A;  3AFG A;  2E9T A;  1SC3 B;  4X4V A;  1JLA B;  4LRD A;  2NCK L;  2VIH A;  2VJV A;  4OLO A;  1AUS L;  1IUJ A;  2RF2 A;  4MK9 A;  4RW8 A;  1J5E J;  4CQ1 A;  5E3P A;  2JZ5 A;  1GMW D;  2VU5 A;  3TJA A;  3KTQ A;  3Q8S B;  2OFG X;  2PMZ D;  4F04 B;  1RU2 A;  4ED0 A;  2WB1 D;  4WYL A;  1RT5 A;  3BSN A;  1SKS A;  1HPZ A;  4N47 A;  1MWY A;  2HGN A;  4CLT A;  4O0I A;  5B0G A;  1WOP A;  3M2R B;  3RUB L;  2AX0 A;  3JYT B;  1VQ9 S;  3FSI A;  4W90 B;  4KE5 A;  3EGZ A;  3MM6 A;  3N6N A;  2BE2 B;  1B3T A;  2B9Y A;  2HK2 A;  3MPV A;  1VDH A;  3PJ9 A;  4A48 A;  1SC1 B;  3L7O A;  1U49 A;  3MR6 A;  4B3O B;  1RTD A;  3AJ1 A;  3W2V A;  5T14 A;  4F2S A;  3HDS A;  3EVW A;  3EZU A;  3EZ5 A;  2BE9 B;  2KDO A;  2FY1 A;  1RTJ B;  3OD2 A;  1RGV A;  3IXQ A;  2K2P A;  3UI3 A;  4FVM A;  3O6Q A;  1RTI B;  1U1M A;  4RJV A;  3HSZ A;  3DLL Q;  4GO7 X;  4ZPC A;  3ILL A;  4BWM A;  2XYP B;  3M30 A;  2ZKU A;  3GSI A;  2NXE A;  1S9G A;  3BGR A;  2V6A A;  3HFZ B;  4LFA F;  1RT6 B;  2YNH A;  4NL5 A;  1Q5Y A;  1TL5 A;  2RF2 B;  4RW8 B;  5DQH A;  1H98 A;  3I9Z A;  2IVY A;  1S0N A;  2W9B A;  1HWK A;  5JVG Q;  2DT9 A;  2DYA A;  4Q0B A;  1VQ4 S;  4Y2I A;  1F6T A;  2CZ9 A;  2XC9 A;  3DOK B;  3CMQ A;  3HM9 A;  1QDU B;  3D6H B;  3CCJ S;  1VQO S;  3TUZ C;  2PA8 D;  4CTA A;  2YX4 A;  2M70 A;  1R43 A;  1SBR A;  4YR2 A;  4ELT A;  4U8Y A;  2Q66 A;  2CA9 A;  3TAM A;  3MM6 B;  4ZPV R;  2N3O A;  2HHX A;  2F5G A;  2YWE A;  3PM9 A;  3D68 A;  4A8S A;  4FF2 A;  2R7X A;  1ZM3 A;  3TAN A;  2UP1 A;  2BJD A;  4RUH A;  1P9Y A;  1HNI A;  1T0T V;  1FT8 A;  1N5V A;  1SH2 A; 
#chains in the Genus database with same CATH homology
 4LF7 J;  4JI8 J;  4DV4 J;  4LF5 J;  4AQY J;  4RJV A;  3D3C J;  4DUY J;  1XMQ J;  4LF6 J;  5AJ3 J;  2KL8 A;  2MQ8 A;  2UUC J;  2MTL A;  3R2D J;  4NXN J;  3D3B J;  4YY3 J;  4X62 J;  1IBM J;  5FLX U;  4DUZ J;  1HNZ J;  2UXC J;  4DV1 J;  4GKK J;  2E5L J;  3J7A N;  4NXM J;  1J5E J;  4JI0 J;  4DV6 J;  3T1Y J;  4DV7 J;  3J80 U;  2VQE J;  4DR1 J;  2UUA J;  4LF9 J;  4JI5 J;  3T1H J;  4LFA J;  4JI6 J;  4JV5 J;  2UXB J;  1N36 J;  4OX9 J;  4KHP J;  3W1Y C;  4X65 J;  4LF8 J;  1I94 J;  5BR8 J;  1HNW J;  4JI7 J;  4DR6 J;  4X66 J;  4GKJ J;  4DV3 J;  4X64 J;  4LF4 J;  2UU9 J;  1N33 J;  4LFB J;  4B3M J;  4DR7 J;  4JYA J;  4JI3 J;  4DV2 J;  4NEZ A;  1HR0 J;  4K0K J;  4DR4 J;  4LFC J;  5LMU J;  4JI1 J;  5IT9 U;  4DR3 J;  4JI4 J;  4DR5 J;  4V1A k;  2UXD J;  4DV0 J;  1HNX J;  4B3S J;  4PWW A;  5LMN J;  4B3R J;  4HHU A;  1N32 J;  1FJG J;  3JAM U;  2F4V J;  3IMQ J;  5IWA J;  5LM7 E;  3J81 U;  2HHH J;  3R2C J;  4DV5 J;  1IBK J;  5A2Q U;  3OTO J;  4DR2 J;  4KYZ A;  1XNQ J;  2UUB J;  4B3T J;  2ZM6 J;  4JI2 J;  4NEY A;  4KY3 A;  2KVQ E;  2VQF J;  4YHH J;  1N34 J;  1XNR J;  1XMO J;  1IBL J;  2MEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...