4AQYJ

Structure of ribosome-apramycin complexes
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4aqyJ00
2MEWA 4LF8J 1J5EJ 1N33J 4DR2J 3R2DJ 4GKJJ 3IMQJ 1XMOJ 2MTLA 4LF9J 4OX9J 3T1YJ 3R2CJ 4JI5J 4NEZA 3J80U 1IBKJ 2UXBJ 2KL8A 2VQFJ 1IBLJ 4NXNJ 1HNWJ 4DV6J 5BR8J 4LFAJ 5A2QU 1XMQJ 5LMUJ 4DV4J 4AQYJ 1XNRJ 5AJ3J 2ZM6J 4X64J 4JI8J 4DR6J 3OTOJ 2F4VJ 4JI3J 1XNQJ 5FLXU 4NXMJ 4YHHJ 4LF4J 4V1Ak 4KYZA 4KY3A 2HHHJ 4HHUA 3D3CJ 4DV2J 4DR5J 4JI2J 1HR0J 4JI6J 4B3TJ 1N34J 5IWAJ 4LFCJ 2KVQE 4GKKJ 3D3BJ 4B3SJ 1FJGJ 4KHPJ 2UUAJ 4B3RJ 4LFBJ 2MQ8A 5LM7E 3W1YC 4B3MJ 1N36J 1HNZJ 4NEYA 4DV1J 4LF5J 4PWWA 4JI7J 4DR7J 4DV7J 4DV3J 4DR3J 4DV5J 2UUCJ 5IT9U 4JI0J 4DUYJ 4X66J 3JAMU 4JI1J 4DR1J 4YY3J 2UXCJ 4X62J 4JI4J 3J7AN 4JV5J 1N32J 1IBMJ 2VQEJ 4DUZJ 4K0KJ 2E5LJ 4LF6J 2UUBJ 1HNXJ 4DV0J 4X65J 3T1HJ 2UXDJ 1I94J 2UU9J 4JYAJ 4LF7J 4RJVA 3J81U 5LMNJ 4DR4J
chains in the Genus database with same CATH superfamily
3JQMA 3NEKA 1NXIA 4C11B 5KFUA 2KYZA 2RUSA 5KOXA 2LFVA 4BC9A 4F4ZA 2JHEA 3I56S 3LGNA 1C4AA 4M5DB 3VCDA 1MN7A 4TVAB 2KFYA 2BBEA 4FNIA 2CAJA 3PYFA 3US5A 3I0RB 1XR7A 1BHNA 5AJ3J 2UUAF 5FDLA 4JI8J 2FZKB 2JEJA 4P2SA 4DFKA 2XMTA 3M1VB 3QLHB 1R7IA 3DDIA 2XGPA 4DR1F 3J81Y 2F7VA 2ZWPA 4U7UK 5J2QB 1HMVA 4ZJQA 2PD1A 3P5TL 1SKWA 1RKIA 3LALA 3FBFA 1IWAA 3BM7A 4PEOA 1FEHA 3H2VE 3M6VA 2XS7A 1WOPA 1J5EF 4KO0A 4J9QA 2C2NA 4DDFA 4FYWB 1X4BA 4TU8A 4CP5A 2IM0A 3TARA 3MOJB 2CPHA 1HHQA 3KJFB 3KLGB 1K0VA 4K8RA 1VJWA 5F9LA 5F0WA 3D5MA 1I3OB 2YX7A 1L3UA 2GNKA 3V81B 4LF9J 1U09A 3RB4A 3HSJA 5HQLA 3EPIA 2VICA 2XCPA 4HEA9 2AEFA 4UZCA 2BRKA 3ZTPA 3DU5A 5I3QA 3OSNA 3D6FB 5BYRA 1H73A 2IFXA 4U95A 2AZ3A 2E7XA 1CJVA 4HVZA 2NYHA 3T9ZA 3N01A 2BXJA 3R6LB 1VCTA 1MWZA 4KY3A 3M30B 3R3TA 1F9EB 3ZZPA 1XK8A 4J9RA 3J7YU 4QPTA 4FKYA 1KLMA 1HIYA 3BSNA 1RTDA 2WRMA 2I8EA 4LBHA 2C28A 1FKOB 4KBIA 1GXUA 3H98A 4CZCA 3PEJA 3PO5A 1SKUB 1R89A 4F3OA 2P2CB 1MMNA 4C11A 4DPUA 1TTHB 3HFZB 3PIPQ 1F2GA 2MY7A 2NSBA 1RHQB 4M5DA 3JSBA 3WX4A 4QR0A 1PYTA 3GV8B 2MTLA 4Y2MA 2PDAA 2P5VA 3I0RA 1IBLF 4OL8A 3TQEA 2GMLA 2Z2YB 1S9FA 2R7WA 1WC4A 2M4MA 4V19X 3CJ8A 1N34F 3AXKA 5CZXA 1KTVA 3M1VA 3QLHA 2WBMA 1TELA 1FFWB 4WPAA 2GQCA 5J2QA 1T94A 3KJNB 1UETA 3D1OA 4USWA 1RE1B 2WHOA 5L1KA 1WACA 2QZ8A 3SZ2A 2E29A 4A48A 3M6UA 5MAOA 2L48A 4CLSA 1BC6A 2QLJB 2Z4PA 4K50A 3P5BP 3AT1B 2NLWA 5KFJA 4X4QA 4JI7J 1UW4A 4ED6A 2LQ5A 3KLGA 1IBMJ 3IWNC 5CD4H 3CJKB 1S7HA 3HVAA 3RAMA 9RUBA 4MK9A 2ZD1B 2C2OB 3I5BA 3BN7A 5BYSA 2XY6A 2AX0A 3V81A 1TL1B 4F8RA 1HQEB 4YB7A 1H6KX 2ZNZA 1R27B 1FRXA 3OD2A 4C3KA 4P7VA 1HW8A 2FLLA 1ZPVA 5KFQA 4YR2A 2A1BA 1WKLA 3DGVA 4NA2A 3OL8A 2EFQA 3M30A 2UUTA 3GIRA 1Y5NB 5E0OA 2DITA 1KONA 2B51A 2C3OA 4ZP9A 1GNKA 3CF5Q 3GE9A 1PKUA 4R8UB 4DL5A 3RBXA 1F5CA 1FKOA 3ETOA 3NL0A 3IWLA 4FBTA 4LREA 1TAUA 2F1FA 1VHIA 4QWAA 2XHWA 5EWFA 2VU5A 3BR9A 1UFWA 2OJ3A 2JOQA 1XMOF 3DN9A 4OJ3A 1URRA 3IC1A 2Q66A 1SI9A 2AT1B 3T19A 2RRNA 2DCUB 1C1CB 4XTTA 5EHHA 4DR4F 3L7OA 1UEUA 3H5XA 4L73A 3IM8A 5DG7A 2ZOMA 3OSPA 4U8YA 3ELHA 2HHXA 4WFZA 2EC2A 1L3KA 5A8RB 1PYOB 1PJ5A 2R2SA 3KHLA 5M2PA 3M8ZA 2GHPA 2RRBA 4FPRA 3RAXA 2R8HA 3DRSB 2XNQA 3AB2B 1UKUA 1RHRB 4NZ7A 4YHHJ 4DV5F 3SQGB 3GG1A 1FERA 4PYDA 3A4TA 1WSRA 2EFOA 1Y5LB 3EX7B 2F9JA 1EX8A 2KVQE 4JV2A 4KPCA 3JTNA 4KKOB 3IGNA 2MKSA 2QLBB 2QG9B 1S57A 2N4DA 4F67A 2D74B 4YQWA 2HHSA 2JEGA 2H1YA 5B0EA 1LWFB 3CJKA 1ZBTA 2UUCJ 2ZD1A 1HHSA 2HHUA 3CCES 2DNYA 1HARA 2V69A 1X4EA 2ATLA 2O66A 1TL1A 3PX6A 1MG7A 3QQCD 1HQEA 5CABA 4XAKA 2WW4A 2BMBA 4LFAF 3JQKA 3H2UB 5LMNJ 2MSTA 2KHCA 4J9NA 1XNRF 2NYIA 2K7KA 4WP9A 3C66A 3GMGA 1GEHA 2CYYA 2OUGA 2VPYB 1R6VA 1A7GE 3LOUA 4IG0B 1LXJA 3PXGa 1H2UX 2Y8YA 4DU8A 3IRXB 4D3GA 1CEZA 1Q86T 3MMJA 1AA1B 2G2ZA 1S5ZA 1YKWA 1S7IA 4NLTA 4R8UA 1R8CA 1GX5A 3MM9B 1PJ7A 3NBPB 3O3LA 4BBYA 5C2GA 3NXZA 3MPVA 3NMRA 5DETA 1HNVB 4TQRA 4OX7A 3T6BA 1YJ7A 2UXDF 2FY1A 4H4OB 1U24A 1VRQC 1GX6A 2XMAA 2Q43A 4RNOA 2IJNA 2ZKTA 4F0MA 1VHFA 4KV8B 2W4DA 3A13A 4NLWA 2W4PA 3UR3C 1Q7YT 2VIHA 4ICLB 1YG0A 3MCSA 3CIZA 4OZ0A 4WFYA 1RP5A 4KPYA 1F5AA 3CXCR 3W8PA 2QL5B 3P4UB 2CQDA 2R3VA 3PX0A 5A8RA 4RNNA 2GVZB 2HHHF 3M2VB 4NLOA 3M6WA 1M1GA 3DRSA 5LSRA 3J7A1 4MKYA 2BKPA 2H9ZA 2XULA 1KOOA 4A8YA 4WFAQ 4A4JA 2Y1LB 3SQGA 2POKA 1YK9A 4IO9Q 2Q1LA 4K4WA 3JQJA 5F9NA 3VAIA 5E3PA 5GAHU 1KHWA 4DUYF 4KKOA 3AJDA 1KNZA 2J76E 2J9DE 1GTEA 1SVDA 4BLGA 4AXIA 4LF6F 1YX2A 3EDRB 2DNNA 1Q79A 3AA9A 1GT8A 1HI0P 3KHHA 4DV1J 2A2DA 1UVIA 1S0OA 4WIIA 3A8KA 4HTJA 2ADBA 3E8OA 1FTRA 2JWNA 3CW2C 1KKHA 3ZTQA 3EDQB 2IM3A 2I0XA 1CS4B 3OTDA 2BYCA 2ZBRA 2GIQA 3JSRA 5F8LA 2N4CA 3DMJB 4DCJB 1IM6A 3OQ2A 1RT4B 4IG0A 1WG1A 2W2QP 2OD6A 2ASYA 1VRUB 4NX9A 3IRXA 1IXKA 1I51B 4J37A 4I69A 3LGHA 1KTQA 4MKBA 5J2MB 3MM9A 4X64J 3NBPA 5CCMA 3R7BB 6FDRA 3TO8A 4Z2XA 5GADU 3U1MA 3L7PA 1HNVA 3U1NA 2ZH7A 4HKQA 2F3JA 3TP2A 4H4OA 4OI6A 1FF2A 7FD1A 2L08A 4YDXA 2W7OA 2XS5A 5CCLA 1S72S 5D3GB 2OPRB 1PYSB 3LF0A 3FVYA 4DQQA 4KV8A 3W1YC 3N4WA 3EVWA 2WK4A 4RNMA 3BSCA 4UUXA 2C2RA 2ZDPA 4ICLA 1YI2S 5DDPC 3OJSA 1D3WA 3QMQA 1LFWA 3PKMA 4N47A 4C8NA 2W8LA 1E6YB 3K8VA 2YNGB 1VQ8S 2GVZA 3M2VA 4FNHA 2JL9A 4CQ1A 3C8YA 3UN3A 3BS9A 2AQ4A 1NK7A 1S0VA 4UW2A 5L9XA 1X5PA 3PTWA 3DRYA 4MIBA 5H9EK 2OLWA 2XYHB 2FGOA 1W26A 3Q8SB 2CQCA 1NHKL 4LT6A 2F4VJ 4C8KA 2MZSA 1OQ6A 3DLLQ 3GCWP 3IN5A 4ED2A 1VC6A 1CPZA 1WC3A 2J0SD 4I2QB 4FXDA 2DIUA 5JXSA 4OI3A 2LQJA 3HZGA 1JK9B 2C22A 2DT9A 2GQ2A 3GR0A 3RZAA 2G1DA 2DYAA 1CS4A 2AW0A 4UQGA 4DQSA 3J7YI 3MDFA 1X5OA 2HEKA 4ZPAA 2DY1A 4IG3A 3DMJA 1X9WA 1ITPA 1FXRA 1RT4A 2R7UA 2KHDA 3Q2SC 5LMUF 2CVEA 1WC1A 1K0TA 5JJBA 1KWMA 5GAEI 2HVEA 2KYXA 4OX9J 3CO0P 3O2IA 1UTAA 4EMDA 4Q45A 1YQHA 3W9IA 1FRMA 5J2MA 4DV2F 4CI0B 1X5SA 1W7WA 3QT8A 1Y00A 3CJQA 4PAAA 1FA0A 4QWCA 2MQMA 3LA0A 5D3GA 2OPRA 2E5HA 3LAMA 2CQBA 1LFPA 3SXLA 3JXOA 1RKJA 4LFCF 1WHVA 2L9WA 3IFEA 1UEKA 2QMWA 3GV5B 5RUBA 2I2YA 4USHA 4DLGA 1X8DA 2B6AB 1N56A 3PACA 3KLEB 1P1TA 1E6YA 4YFUA 1QVGR 2DXEA 1EZZB 4GO7X 3HD2A 3K57A 1RISA 2YNGA 4JI5F 1U47A 3M4XA 1KFSA 1DTTB 1HNWF 2RQ4A 2GZOA 4NMXA 1Q53A 4KGXB 1NO8A 3DGPB 1OYEA 1RU2A 4DHVA 3H7HB 4E8UA 3MEGB 4GRSA 3DXBA 2C3YA 2AF6A 1EAYC 2FJXA 4FF3A 3CTRA 3ENWA 1NSQA 4I68A 4N56A 4O44B 4RUBA 3NLCA 3HK2A 5ETNA 4L72B 4I2QA 5CQGA 3I9V9 3DLEB 3OXFA 3R27A 1QSLA 2QE5A 1RAFB 3BGFA 3MR6A 4EO6A 2Y8WA 2V63A 1UPPA 3ENQA 1FX4A 4K4UA 4ELUA 2VB6A 3HMJG 3DFEA 2CPYA 2BX6A 4ELVA 2M8DB 3MD1A 1VBKA 1RJJA 4K0KJ 2EWHA 4NWBA 1U1PA 1QTNB 4OYOA 4Y2IA 3BKUA 2YTCA 3MECB 1XR6A 1VISA 3QT6A 2OELA 1SC3B 3Q8UA 4A8OA 1QTMA 3DLBA 4QR2A 4ED0A 2MSSA 8RUCA 4IOBA 3K5MA 2V4JB 2V94A 1SJFA 4EYIB 2Q3PA 4I2PB 3I87A 4AD6A 1TKXB 2HK3A 4EBEA 3RR7A 1F0XA 4PKDB 3DNCA 1UWAA 4X66F 1EHWA 1FK9B 4JI2J 3H2LA 1KVIA 2B6AA 2MKHA 1H2VZ 5IZHA 1WKJA 1U26A 3KLEA 1H98A 1RTJB 3PFEA 2MHNA 1ICEB 3TQ1A 1M5HA 4TU7A 3PRBA 5M2UA 4RZRA 4MH8A 4FDFA 1DTTA 3W61A 4LRAA 3HM9A 4AL7A 2PSZA 2J8SA 1NJZA 1RADB 1T3OA 3DGPA 4PPDA 3TJ9A 5F3ZA 2MZTA 2XY7A 3MEGA 4WZQA 3NG8A 1LWEB 4LF2A 4ED4A 3PG9A 1BY9A 4RWXA 4J9SA 2DR8A 4ES2A 4O44A 4FPIA 4HL9A 3NGTA 1OS5A 3NKYA 2OI2A 2W9CB 2HBZB 4GKKF 4B3RF 3DLEA 5E7OB 1N36F 1FWKA 3AD7C 4A8XA 4O3NA 2R9LA 4F3MA 4IR9A 4U9RA 3ISZA 1GMWA 1RHUB 3D3CJ 3FMBA 2B9YA 4P7TA 2BJDA 4RW9B 2LMIA 3SCLE 3QJLA 2X3DA 1R8AA 4MFBB 1U1QA 4U8VA 2WZ1A 3CCQS 2BDPA 1M5PC 1VBYA 2Q6BA 3MECA 4DUZJ 2HNYB 1FRLA 3GIMA 4HTIA 3W2WB 3UR0A 1VQ5S 4NXNF 2UU9J 4F50A 1RYSA 4O3SA 4DL6A 2RS2A 2D69A 1F3FA 3JYTB 3KNGA 3A3NB 3MAAB 4QQBA 2NZCA 1BGXT 1WG4A 2PE8A 4YMEA 2V4JA 2VBYA 1JLAB 1RHKB 3H4DA 3KXDA 3DCAA 2J9DA 1FNMA 3L9ZA 4EBCA 2FHJD 5DG8A 5C2CA 4WTOB 4ED8A 3CD6S 4XK8C 1HWKA 2QA2A 4I2PA 3UN2A 1SL2A 1TKXA 1IWGA 1NM2A 4F4XA 3KLVA 1S4FA 2O5DA 4PWUA 1FDDA 1RAIB 3OTOJ 1FK9A 1V5VA 2DH7A 5FLXU 3NMAA 4PWDB 1VQOS 2LDYA 1JLCB 4Y6IA 1RTJA 1RABB 2YWFA 4HDHA 4BHQA 3T5LA 3Q2TC 3HHLB 1N32F 5DLFA 4QIFA 4OV6A 1FVSA 3GQCA 5GAHI 2GIFA 1PBUA 1IQZA 1X60A 3UQSA 3I31A 1TAQA 2RT3A 3LANA 1XEZA 2IM1A 2ZEJA 1O0PA 1Z2LA 1EJ7L 2FJDB 4X84A 3MFHA 1LWEA 1IVZA 4MK8A 3IP0A 2YY3A 1B99A 1U0HB 1X5TA 2MEWA 2DKOB 3K5LA 4L75A 2GFFA 3OTCA 2WCXA 4FXWA 4RW4B 3FUYA 5IS2A 3OXLA 1NRKA 2W9CA 3AHPA 2F65A 2XLKA 4UZBA 4UOFA 3R1LA 2CQ4A 1VMBA 2BQUA 5M2RA 2AEJA 2CA9A 2WSFC 4NLPA 4C3MA 1F5BA 4JBCA 3AB4B 4MAKA 4RW9A 3I0SB 3SSRA 3SIPB 5DQIA 1C4CA 1X4GA 1OPIA 2HHTA 4MFBA 4JV1A 3B54A 1N8RT 2HFZA 5KFDA 3VALA 2PMHA 2M8HA 1VS3A 5DQHA 3OFGA 1G7CB 1Q8BA 5EGYA 2VV5A 5DZ7A 2HQGA 2HNYA 3DHXA 3RW6A 3Q83A 5LSLA 3W2WA 4YUDA 4QWBA 3G6YA 1TFYA 3KLFB 4YY3J 3W2VB 1YRUA 2BKNA 4U67Q 3JYTA 1MLAA 3RAQA 4FKXA 3MAAA 4CO0A 1QJHA 3ZTSA 2CNOB 2MJUA 4DFMA 1JLAA 2ATCB 2XMMA 4TY8B 3BO4A 1FE4A 2PO4A 1UZDA 4G65A 5EX3A 3W64A 3MUMP 3LUYA 1H7WA 4IUFA 2G0JA 3WX8A 5B0AA 2LU2A 3CJ4A 1F6TA 3UWTA 1WWHA 3I96A 2KH9A 1S9EB 4Q0BB 4WZMA 3CCWA 1U02A 2ILYA 3OFEA 2NXJA 4PWDA 2XO7A 3KMQA 2R42A 3Q23A 1JLCA 4I64A 2Y0BB 2EBEA 3HHLA 4DR3F 4ECQA 1BUXA 4N77A 4O3PA 4J9MA 1SJQA 2HNZB 4F2RA 3EGZA 2DNGA 4EZ6A 1YHQS 2G13A 2DEIA 5IT0A 3J80Y 4DF4A 3UCZP 2R7SA 3FCWA 4M5NA 4B9SA 2JFKA 4X62J 1U0HA 4NASA 2MKCA 2O67A 4ZCKA 2JVOA 2OMOA 4RW4A 3D66A 5F0UA 1K73T 4UOHA 4OLPA 5L1IA 5DDQC 1TP7A 2ZVIA 2BOAA 3SSSA 4TKTA 2DHGA 1XNQF 2B0GA 3EE3A 3O6QA 2HVHA 3A8EA 1P1LA 5HANA 3HVWA 1HR0F 3D68A 4LIWA 5T41A 4B17A 4AYBD 3I0SA 2Y1IA 4MMOA 4J5OA 2I9SA 3PR5B 1D8YA 2ZBIA 3TYTA 3OL6A 2BJ1A 4DX8H 3DXSX 1NJWA 4WXOA 3D9BA 4OI2A 2UUAJ 2GMJA 2OTJS 5B0CA 4KR0B 2QL7B 2GGPB 3KLFA 3W2VA 1I6JA 3CCUS 4LRCA 1HBMB 1XC9A 4MIAA 2V0NA 2VA2A 4GC6A 4KGZB 4DR1J 1KS2A 4NLSA 2VC1A 4TY8A 4TN2A 5ETMA 2PA8D 1IBCB 3DM2B 4YN3B 2LVWA 2QLXA 3MOZA 3EXYA 1J5EJ 2GAGC 1S9EA 2Z58B 4Q0BA 2K3IA 2OGUA 3MF5A 2R2UA 3TOQA 3ZZYA 3NAHA 5KT7A 1AXQA 2KT2A 2CQ0A 4OX8A 1DQ9A 3HKWA 2EKNA 2CRLA 4USTA 1FXDA 2ZITA 1HWUA 2HNZA 2ROGA 4KFBB 4B08A 1FTCA 2HHQA 1JLGB 4PG4A 2DNQA 1CJUB 1DJ0A 1VFJA 4RW6B 3CCJS 1NBEB 3CJ0A 2MQPA 3D1QA 5DS7A 5LM7E 2YX4A 1S10A 2C1EB 5H1SV 2XLJA 2KFNA 3LPEA 3CJTA 1T0TV 1U1OA 1AFIA 5ADZA 4MYUA 3DU6A 4A8WA 2CJKA 3SCKE 2J0XA 5KFKA 1I1GA 4GVBB 3OLBA 2VFRA 2CJQA 1EKRA 3SCIE 3EGVA 4IH6A 2XMJA 2OTLS 1N0UA 1EIYB 2XY5A 1J5OB 1HWLA 3I55S 1EETB 3EM1A 2DO0A 3RW7A 5HK4A 1RI7A 2F8HA 4UQTA 1DFDA 3TAPA 3T1AA 2WAQD 3AD9C 3IAS9 3FSIA 2DGOA 2J9CA 1R6YA 1N34J 2GGPA 1S0MA 2DCLA 2YBVA 3R5JB 2IRYA 1VJQA 1HBMA 1RBOB 3QRRA 1M0SA 2MQ8A 4NLYA 2YWHA 3K89A 4XDCA 2F4FA 5KFLA 1P27B 2W2PP 1OO0B 3KUHA 1ZH5A 1RBLA 3FEZA 4C3LA 1SKSA 1YWXA 2YPZA 4EU0A 2QYCA 2QSFA 1DHMA 3DM2A 5AE1A 4Y2KA 5CXTA 1T02A 3MEEB 5DM6Q 3S8SA 3EWGA 2JEFA 1X4FA 5DJBA 1NJIT 3MMAB 2NUHA 3TZYA 2GC8A 1NB7A 4F4YA 5AXLA 3OUYB 5CZVA 4NMLA 5KTQA 1NKCA 5CD4A 1NU4A 2WBRA 5KFPA 2ACYA 2IVMA 2QFJA 1IKVB 4ZVHA 4KFBA 2YQ0A 2ZBPA 4KHPF 4WP3A 1JLGA 2WTFA 4LMZA 3MM8B 2LQ9A 1CJUA 2PGCA 4RW6A 4FN5A 2E9ZA 2DGQA 2AJQA 1OIAA 3HVTB 1HI1A 5EUHA 2M70A 5HSPA 2C2DA 2HSEB 1WTBA 1HNXF 3R5BA 1VLYA 4F7VA 3NS5A 4DV0F 4I56A 5HROB 1QAJA 2MLYA 3THTA 4AE5A 1VQ4S 4GVBA 2ZWOA 4GMKA 3A1YG 5HAOA 2VPWB 3PYDA 3OTEA 4ENOA 2UP1A 3EYZA 5BR8F 2R4FA 2BJ7A 1AZSB 3F56A 4NCGB 2IAJB 4ZS6A 4B02A 1J5OA 1RCOB 4KGVB 1AT1B 2K06A 1EETA 4ECZA 1L5UA 1XMOJ 4TNOA 1UWBB 4WFBQ 3V6DB 4NXMF 2EG1A 3BDPA 1TKZA 3QJJA 1Y10A 2DEJA 3W60A 4KH0B 4PABA 2VG6B 1FJGF 3JAMY 3UI3A 4ITSA 2P6SA 2Y0SD 4HHUA 3FZBA 4NYOA 1S6QB 1NUEA 3HT3A 2E7WA 2CFXA 1QUVA 1KLNA 1M5VC 3LP1B 4KGMA 4M5IA 1RYRA 1TL7B 1Q5VA 4JV0A 5IXUA 1LWCB 2W1BA 4DV5J 4B9NA 4M8LA 4I4BA 4C48A 2FB0A 5A2QY 3MEEA 3EGNA 3ZC4A 5DZ6A 1RGVA 2VF3A 3MMAA 2VG7B 1XMQF 2ROEA 1NSAA 3ZNJ1 3OUYA 4DV4F 1PG5B 3CJSA 5F8GA 3FMWA 2ZM6F 3UD4P 1FX2A 1C0UB 2JX2A 2Z57B 2K2PA 1IKWB 1IKVA 3HXMA 4NI2B 3TUZC 4DPWA 3TVKA 2EK6A 1RA7A 1VLOA 3MM8A 4RBVA 2KKHA 3QJPA 4LFAJ 2OD4A 3LW5C 4ZPBA 3KYLA 5IT9Y 1PAEX 3QZ7A 2FGCA 5EX0A 1XNRJ 1VBXA 3HVTA 2HKEA 4OHZA 2V8DA 2MY8A 3V6JA 3NS7B 3CCSS 4V1Ak 2KI2A 2KN4A 4FF1A 5HROA 3HO1A 2G9OA 1YTYA 2OSQA 2YPYA 2VQEF 2B4PA 2BQRA 1NH8A 2FJEB 4QOTA 4CT9A 3W5YA 3CWJA 4IKAA 4Q43A 1AZSA 4NCGA 2IAJA 4ZCLA 2HZCA 4LF1A 2VQFF 2QFIA 2UXDJ 1IJEB 1U8WA 2EFNA 3K5PA 1UWBA 2DGTA 3V6DA 1P9QC 1CG2A 5A76A 3V5RA 2JLFA 3CVKA 2G4BA 4MKVA 2J6TA 4WIQA 4AL6A 1C1BB 2VG6A 3TUJC 3JTOA 3V6HA 2KT3A 5EWEA 2FVPA 1J27A 4CLTA 1S6QA 3SSQA 4OYAA 3H25A 3GB0A 1FJEB 1AUSL 4ZVFA 5F8IA 2L41A 2HHHJ 1N0VC 3O8WA 4P74A 3LP1A 2ZVSA 5E41A 2VFUA 3DLHA 1TL7A 4M5MA 1LWCA 3TA2A 4LSNB 2B4VA 4UF4A 1RBAA 2CXEA 2HBYB 2FTRA 2ASJA 1DQ8A 3HD1A 4PG7A 1U2CA 4DUYJ 4KE5A 4F4AA 2VG7A 3MCOA 2RE1A 4PUOB 2OSRA 4LF6J 4CM0A 1NCLA 3D0IE 1C0UA 1NLKL 3K59A 1T03B 3D0HE 2DRBA 1IKWA 4NI2A 1E6VB 2ILZA 2JZ5A 4OZJA 4PG5A 1Y3KA 1RLCL 4LF4F 4DX6A 3VTIA 3VAHA 2RB7A 2QL9B 4U7CA 3BF4A 3BPSP 3TJ8A 1YRXA 2BW7A 4M94A 3P3DA 4CO2A 1LEOA 4YP3A 4H4KA 3L95X 3KJQB 5J2PB 2DVIA 4DSIA 5K8PA 1HBUB 1KD1T 4Y2AA 2AX1A 2UV8A 3CUNA 1JNZB 2HFSA 3D4JA 3QIPB 4I67A 4DQRA 1LW2B 2GHWA 2FHOB 5GAGU 1F60B 1Q8LA 4CLZA 3DOLB 4GKJF 1S4EA 2BE7D 2C2KB 2N7YA 3OR2B 4JV5J 2YKOA 2FJVA 5KFEA 2ZHOA 1WOOA 3R6GB 3GIKA 1C1BA 4IH7A 1YZ6A 3M9NB 2CQIA 2E5JA 5K8OA 3O5TB 3RG6A 3M05A 3CDUA 1NDPA 2CUYA 2KT5A 1DTQB 3OPKA 5I42B 3C15B 1A0OB 3VGTA 2DR6A 4KHRA 4ZVGA 2G0CA 2W2NP 4LBPA 3RJMB 4NLQA 1MMDA 2CJ9A 1VQLS 4DV3F 2ZHAA 2ZOGA 3AQPA 3SQOP 4J9OA 4IRCA 4FS2A 4LSNA 1WOSA 4WF9Q 3ULHA 5IWAJ 3GFXA 4CRJA 1ZPWX 1QUPA 2F5GA 1NZ8A 2ZH9A 2N3OA 2QA4S 2GW8A 1FRIA 4PUOA 2FVQA 3HLUA 2D3UA 3NOCA 2R7TA 4BC7A 1T03A 3PRVA 1E6VA 4QYRA 1RK8A 4OI4A 2ZHBA 3VGVA 1X4HA 3CCMS 4PQAA 3LWMA 4RU9A 3JSYA 3DLGB 2MHEA 5KG6A 4LSZB 1S6PA 5L8RC 3UD3P 1B70B 2RMLA 1PGZA 1R0BG 3TR5A 3OHBA 1KR4A 5J2PA 1APSA 2CJXB 5LMUJ 2RSQA 3QZ8A 2VFSA 2BV3A 1X9MA 1S1VB 2IDLA 2XGQA 1HBUA 5IQ6A 1ELOA 1L3TA 2M9KA 4H54A 5BJRA 4ZCMA 1TKTB 1W2BR 2JLEA 2QX0A 4DV2J 3QIPA 1LW2A 3BBBA 1S77D 2W4CA 4IH5A 3DOLA 4RPFA 3G9CA 2IM2A 1OSDA 2B8PA 2X1AA 1YVFA 5L39A 4QYZK 2VBWA 3OR2A 1S97A 2UUCF 4KH1B 5EWGA 1RHJB 2JRSA 3M32B 3FGVA 1MSWD 3GILA 2MZRA 2KJVA 2IY5B 2CPXA 3EZ5A 3HHLC 1FRKA 3AH6A 1JB0C 3BQ0A 3FBCA 3VVTA 3E51A 4OQJA 4DL7A 1IR1A 1SC4B 3BYPA 1DTQA 2VH7A 5I42A 2ZC3A 2IBKA 2UZAA 3C15A 4CO5A 4JI5J 2CADA 4ECRA 3GJRB 2C3UA 3DLJA 2M7SA 3SBMA 4UOGA 1HNWJ 5BXIA 1XJWB 2OMLA 1VIOA 3MTKA 1QLNA 4RO0A 1N5YB 1T3NA 2VUGA 1XN9A 5LOQA 1M1KT 3NY0A 3CSKA 5ETVA 2QLWA 4OHYA 2LLZA 3W5XA 4CO4A 4Y65A 1FHTA 5HVHA 2KFZA 2AYEA 3E2EA 1Y0HA 2BM1A 4X4NA 3MZIA 2QIFA 2DIVA 2LCWA 4LF8F 3L4BC 2VC0A 2BQ3A 4JB8B 1LKZA 5KG2A 2VBZA 3NP5A 1U8SA 3LH2S 4KC5A 2ZDOA 2AJ0A 4BS2A 2VL1A 3DLGA 3CPWR 5D0EA 3J7ZT 3H59A 4F4KA 4HT7A 3J81U 1WC5A 3U7JA 4NYZA 2A0FB 3CULA 2WB4A 1PAUB 1XWLA 3AFGA 4FYDA 3GIIA 2O1PA 3CMQA 1VQYA 2YKNB 4TLRA 4AL5A 1MW7A 1U1NA 1CC7A 1S1VA 1H3DA 2YH1A 3FEYB 5IT4A 3BSOA 1Y3JA 1NK5A 5HQ8A 1TKTA 1P9YA 2XC9A 2ERRA 1V3ZA 1HNZF 3IBFB 6AT1B 4K5RA 2Y3YA 4S0MA 2BJ9A 3BDEA 3MAQA 4JI1F 1OYDA 3R9LA 1U1LA 1D9DA 3IG1B 4DS5A 2C2ZB 1WEXA 3TRGA 3RGIA 5D4NA 4X4UA 1XTZA 1CLFA 2WOMB 4D3HA 2NXUA 1RUSA 3PW5A 2JJ4D 3LP0B 3M32A 2F63A 4H4MB 3S1TA 1O8BA 2WVBA 3ET6B 4X66J 1DQAA 3DYAB 3LAKA 2WVCA 4LSLB 4ZPCA 3UNYA 2N7CA 4HLBA 4OMFG 4ES3A 3BYRA 4LUBA 3K7RA 2FQQB 4ZCIA 2HK2A 4P71A 4O23A 4DSLA 1TKDA 5HMWA 4A8FA 2OIHA 1N5YA 4DPTA 1UMJA 5D78A 4X64F 2XI3A 5D0GA 3M8YA 2JDJA 3MWBA 3DRRB 5KG4A 3MR5A 2DNZA 3VZIA 3LGMA 2AKWB 2IVYA 1OY9A 1YZ7A 4GKKJ 3GSIA 1Q0NA 4B3RJ 1AROP 4C0HA 1N36J 4NEYA 2HBQB 3ZZZA 3VAJA 2DNKA 2AMCB 3QIDA 5JUMA 1Q95G 3IR7B 2F9DA 2EKYA 1BQMB 2F8MA 3ENAA 2AYBA 3ENVA 4DSFA 4C8OA 3CDEA 2RQKA 5FD1A 2YKNA 5J1PA 1YGYA 4FVCA 2ZNYA 1T9XA 3G71S 2MKYA 1RT2B 2IC3B 2CQGA 4X2BA 1QAYA 3AA8A 3T5KA 1TVRB 3M8SA 4NXNJ 1B3TA 1PILA 4DFPA 4XO0A 3CIMA 4J9LA 1CJTB 1RWUA 1IQTA 4WP8A 2G2YA 4ZLLA 2VD3A 2W7AA 3ISND 3IG1A 3A3PB 4IQXA 5D4PA 3NNCA 3HULA 3ILJA 4IDKB 1UJ4A 2VODA 2WOMA 5HMZA 1U1RA 4NLRA 3LP0A 3CC2S 3ZXWA 4H4MA 2V2VA 3ET6A 5K20B 3DYAA 4DN9A 4DPYA 4ZVQB 1YITS 2BRLA 4LSLA 4YB1P 3LQVA 3I4PA 2HLUA 4ILLA 1RTHB 2GIRA 4ZA1A 3OFFA 1FKAF 2AJ2A 5B0BA 4UT4A 1N32J 4R25A 3R97A 1KQKA 1O6XA 4WTYA 3CD0A 3HFVA 3BH6B 3MMCB 1TL5A 1F2HA 2H54B 1T11A 1WDDA 2R8KA 2K3KA 3BGRB 3WZ0A 4RWWA 3GWCA 3WHIA 4IFVB 1XERA 1SQFA 2DGXA 4ZK7M 1T9YA 1OY6A 2X3GA 3DRRA 4ZVUB 1S99A 2XG8A 2ZH2A 2YKAA 5CYJA 3BN4A 3ONQA 3TA0A 3L09A 4CLKA 2M88A 1HWJA 4OLOA 3HSZA 5IFMA 3TX0A 4N41A 3DC2A 2KG1A 1RT3B 2YKPA 3RBZA 2PEBA 4QW8A 5KAKA 1ZA2B 1GXTA 2FHJA 2ALZA 1RSCA 1BQMA 3MTJA 5HQMA 3BV8A 4X4SA 4PXCA 1HQ2A 1URNA 5KOWA 2LEPA 2RDIA 1U4BA 4W90B 5KFAA 3MXHP 2D3ZA 3MPUB 1RT2A 2IC3A 3GTYX 4PCQA 4Q44A 2JFDA 4MTPA 1TVRA 2J9EA 4OYIA 3ZZTA 3FEXB 4J9PA 1I5OB 2ZJQQ 3FDSA 1IKXB 4IQMA 1CJTA 3SI8A 3J81j 3QAUA 3QBCA 4F36A 4LIRA 4B3SF 3IGVA 4ZVOB 4L3KA 1U48A 3UDVA 3BB5A 4IDKA 3HX9A 2DRAA 4DG1B 4USUA 4JI0F 3SFUA 3N79A 4XPEA 2CJYB 4ES1A 1H7XA 2A10A 4IO1A 2UVWA 2J0WA 2A18A 1RTHA 5DDOC 5L38A 2MZ1A 2ASDA 4DR3J 1QD1A 1UL3A 3R5GA 3PCOB 5IOLA 3MMCA 1SCJB 2M0GB 1GTHA 3WQPA 2H3EB 3K5OA 2QC3A 1Z2ZA 3BGRA 2XTJP 4RJVA 3NGKA 1GH8A 2Q6CA 4IFVA 2AJ1A 2M2BA 1QDUB 2U2FA 2AGOA 3PHEA 1JXEA 1D1UA 2ZH3A 4JI3F 2CNLB 1NEEA 4DLEA 5KFFA 4WK1A 1JLQB 2QGFB 3BQ2A 4QWEA 2MLZA 3PNIA 1FJCA 4GO5X 3GJQB 4EGLA 2PT0A 2FC9A 3KG1A 1V5IB 2YX1A 3V4MA 2PFDA 4ZN3A 2EK1A 1P8GA 4IR1A 4RBTA 2HQCA 1ULRA 1XNQJ 2R8JA 1RT3A 4CH0S 2LEBA 2AHOB 4KYZA 3UDCA 4WFXA 3D28A 1C1CA 2JEIA 5HATA 1HR0J 4CT8A 4RX6A 4YOEA 3T6JA 4JI4F 5E5NA 3Q89A 4C2MA 2W01A 1U6ZA 4OFZA 3OVSA 2XM3A 1D8ZA 4L6V3 1SJRA 4DR2F 2DO4A 2Z30B 4PXDA 2DH8A 1X31C 3MR7A 1WG5A 3FCVA 2IHR1 2DHSA 4K2XA 4CO3A 3W5ZA 1HBNB 1WJ9A 5HO4A 1N5SA 4QU7A 1IKXA 3NWGA 3GP9A 3VZHA 5C7PA 3PIOQ 1WF2A 2V50A 3J7Z5 4RW7B 2XZDB 4KAIA 4DX5A 2W8KA 5E3AA 2H5IB 4C0OC 3UFCX 1Q81T 3GR1A 3MURP 2HQFA 3G4SS 4NLGA 2NUUG 2CJBA 3C46A 4DG1A 2WVEA 1LWFA 1RWPB 1GK8A 1FFSB 3KUEA 2GHVC 1CSJA 5ETRA 3UD5A 3CD5A 2WB1D 1C0TB 1VQSA 1VK3A 2XCAA 2CWKA 5F3TA 1M1HA 3TANA 4ECVA 3PFOA 4KGKA 4MYTA 2NPFA 1FDBA 1VR6A 2VONA 2QA1A 4LF7F 5ETSA 3CT9A 1N33F 3M2RB 1VI7A 5D4LA 1BWVA 2XMUA 5KFHA 2OO4A 2CPZA 3R1HA 1WHXA 3B8HA 2DK2A 5D15A 4BWJA 1FXLA 2HFNA 1YDLA 4CH1A 4H4KC 2K1RB 4BDPA 1FD2A 2KM8C 2V9KA 4ED1A 3K8WA 4C7QA 2IBOA 3KK3B 1TR0A 1JLQA 4PXBA 1TL4A 4A8MP 2Y1RI 3BKTA 2UV8G 2V8HA 3NGRA 4LVOP 2HFUA 1R0AB 1PO6A 1HPZB 4UY8T 1G1XA 3E3XA 1TL3B 5IV4A 1F3VA 4DN0A 2RIJA 2R8GA 1WF1A 4HH0A 3ZNUA 3HVRA 3BBCA 4OYPA 3GFZA 2BE2B 3PJWA 3N5FA 3G6XA 3CJRA 2B4OA 1YJWS 3PYEA 1JLFB 2DPIA 2ZBCA 4F26A 1HD1A 4WE1B 5KFMA 1MNEA 2VOPA 2HFOA 2LYVA 2PI5A 5C25B 3PRDA 1FJ7A 4IFYB 4OYXA 3EZOA 1JJHA 3CB4A 1SJ4P 2FYXA 3FSXA 4PR6A 1WNEA 2XSFA 3KTQA 5D0HA 1HBNA 4N8NA 2ZH6A 2Z2MA 3G96A 5HLFB 2RILA 2AIRB 4QJVA 2P9CA 4RW7A 2EPIA 4X4PA 2MMYA 3O1LA 1NJYA 1T9TA 3CC7S 5IC4B 3M6XA 4P9SA 4Y00A 4NYPA 2KVIA 4C4WA 1UJ5A 1FRHA 4FF4A 3VHQA 1FT8A 4B3TF 1S1XB 3IO1A 3G87A 1JQGA 1C0TA 3CJ3A 3UW1A 1C2PA 4TU9A 4LFBF 4LF5F 2KXHA 3D0GE 1CC8A 4FZVA 3PEHA 3VF0B 1KFDA 2DTJA 2VFVA 3U1LA 2KG0A 1K1SA 1JLBB 4KHPJ 4K5SA 2V4RA 3POTB 3M2RA 4JYAF 4F25A 1FE0A 2W24A 3CJ2A 3TW0A 4UTGA 1VRUA 2H5EA 2K1RA 4ZKAA 3ADAC 1RTZA 3KK3A 2W2MP 1HNXJ 2DD8S 4DV0J 2UXBF 1TMJA 2HURA 4ANDA 3AD8C 2J6SA 2UVVA 3D7SB 3NCRA 2RAQA 1R0AA 4RW8B 4N8OA 1RQ0A 1HPZA 1TL3A 2G2OA 2L3MA 3OL9A 1NPRA 4B9UA 4ZN1A 2HHVA 1LW0B 3S01A 2BE2A 2JVRA 4ZVRB 1YIJS 5BR8J 1OSCA 1SIZA 2CZVC 4ZP7A 2ZC4A 1JLFA 2FD2A 3LTOA 2V8PA 3VGUA 1X7VA 2HRYA 4WE1A 2I6WA 4KSEB 3UE2A 3KOAA 4NXMJ 5ETOA 4ZHRB 5C25A 1V9OA 4PG6A 4IFYA 4K4YA 2RQMA 2IIHA 3UDLA 2IA0A 2MZQA 3OW2R 3L7UA 2B9XA 1FJGJ 2GO9A 3T1HF 3QO9B 3ILOA 4P2XA 5HLFA 4P75A 1NSKL 1RCXB 4G1IA 4USMA 3RUBL 4LRBA 4LQ3A 4ZPWR 3T5JA 2WONB 1SJ3P 4NRTA 3N0VA 2Z0GA 4DL3A 5GVQA 1U45A 2OP5A 3PM9A 3GYGA 2AEMA 2OKQA 2E9RX 4DR6F 3FBEA 3I82A 1S1XA 2LXFA 1V6HA 2D3OR 3H0PA 3I6PA 1IM4A 3GSDA 4OV1A 3AQOA 4MIWA 3IRWP 4JI6F 4E2FB 2JLGA 1XMQJ 1CJKB 2M3DA 4NCAA 3VAKA 4DV4J 2ZM6J 2RU9A 1B4SA 3KDNA 1JLBA 1SC6A 2ZFHA 4N5SA 2MQNA 4PPZA 2AGPA 1NK9A 4P73A 3NGSA 1Q8KA 3POTA 5HN0A 2LECA 5J1EB 2ZJPQ 2K7JA 3WC0A 1U6FA 1I94F 5IM0B 3PJXA 4F02A 1NNDA 5LXYA 2V8VA 4N7TA 2FLPA 4NZ6A 1NK8A 1DZ5A 4G6VB 3GIJA 2FZCB 2VQEJ 4EYHB 4M95A 1B0TA 4RW8A 1Q78A 1R3NA 1LW0A 2XO6A 2OHDA 3ZZRA 3JS9A 1YBTA 4OZ2A 3GONA 1W25A 1CULB 5CAAA 1SPBP 3S6EA 4OI1A 4ECTA 2VQFJ 4DR5F 1JWWA 4EBDA 4O3OA 1XBWA 2H4WB 4ID8A 2A6OA 4ZHRA 1GQEA 1S1TB 2KZZA 5JVHQ 4Z37A 4ZITA 4ED5A 1PSDA 3ZZUA 3PDNA 3QO9A 4FVMA 4ERDA 4RU2A 4OI0A 1ZETA 3FSYA 4C98A 2FLOA 5F8JA 3TI0A 3TNVA 5K8NA 2W9AA 4V19J 2L9DA 2LKZA 2C2EA 2BJEA 2WONA 3B4MA 3PX4A 1XQIA 4IRKA 1SH0A 1VQMS 2CPIA 4ZJLA 1IBKF 3AOBA 1SXLA 4EZ9A 4WYWA 1HLWA 4ZP8A 5C5JA 3R7NB 4K4VA 5E33A 4OHVA 4ILRA 1CJKA 5GAEU 4W92B 1JJ4A 2PI4A 3K17A 4ANEA 1EKSA 1Z4UA 4HHJA 1RXOB 3VAGA 4A47A 2BJ3A 5C24B 4J9UE 5J1EA 5B08A 4LF4J 2XSJB 2N3LA 5SUHA 3EZUA 5IM0A 4AXJA 1FDAA 4WBFA 5IQQA 5A0YB 1F1BB 1HD0A 1SC1B 3HFKA 1PIEA 4U7UD 2NS1B 4DJBA 2IVFB 1UW9A 1NPKA 3HDSA 1N52B 2EFGA 4AUKA 3BEGB 2YKMB 3NGUA 5B7WA 4Q2MA 4XPCA 1BQNB 3F41A 2OPSB 4ED3A 2IYGA 2FLNA 1DY3A 1CULA 1B0PA 2ZBQA 2OAUA 5U47A 1NDLA 1T9UA 3P49B 4J9KA 4GKJJ 4TYAA 2YXLA 4USIA 2XQCA 4CLFA 2FHMA 1K9MT 1S1TA 5B0GA 3TAMB 2HHWA 4CH7A 3IM9A 3CMAS 4UY85 3DLKB 3PV8A 2HGMA 1D09B 1LWXA 4J7CA 2VBXA 3C16B 1FWPA 2JSXA 2HNDB 3F73A 4QCLA 4J90A 4CTAB 4DI6A 3DKDA 4JP8A 1H0HB 2Z2LA 1A6LA 4E0DA 2VKZG 3VVUA 4DV3J 4PG8A 2DPJA 1Y11A 4K4TA 3V4IB 5KT6A 3I5AA 1UZHA 3R7SB 3DRXA 1FNOA 1RAHB 2OPPB 2QEXS 2RJZA 2FUG9 4HI2A 5I3UB 3CGIA 3RB6A 3W3SA 2XWYA 2QMXA 2XEXA 1NMEB 3OR1B 1REGX 1VQPS 4FXVA 1MMLA 1YJRA 4ETZA 3AAWB 1R8HA 1BQXA 8ATCB 3M7VA 2W2OP 5C24A 2NZ4A 3SV3A 3H42A 2FDNA 2DRDA 3HPOA 5GADI 1Y7PA 3QNWB 2XSJA 1NHUA 5K9FA 1WHWA 2KRBA 5BYQA 2FVRA 5J2NB 1RWVB 5A0YA 4TLQA 2IRUA 2UXCF 1CQMA 3EVOA 3HHKA 3RR8A 1SQEA 2GVDB 3MM7B 2PMWA 4X4RA 2FIUA 5KG1A 2YKMA 5F8NA 4QPXA 4ETXA 5DDRC 2PC6A 1BQNA 3NRBA 1F9FA 2KO1A 2OPSA 3NAIA 3A8IA 3Q86A 3T1YF 1JNRB 2QT7A 1WC0A 4WU2A 5DLGA 5KFNA 2RDJA 2AP6A 4C0BA 4DV6F 4RUCA 1KSPA 2P9GA 4IYQA 4I0WA 5KFXA 3E01B 3A3OB 1VC0A 3CDAA 3MPWA 3HHNB 1ZM3A 3TAMA 2J0QD 4MKAA 3CCLS 2I5JB 3J80U 3DLKA 5D8HB 2Z56B 1JX4A 1WTFA 5KG0A 3C16A 2HFVA 2HNDA 2L9NA 5KFIA 4CTAA 2BABA 4KQZA 2ZZMA 2EEYA 3PKYA 2ZH8A 4OHXA 5KG5A 5KFBA 5SZTA 4ZPTR 2UUBF 4W4MA 1QSSA 5D6GA 2RUGA 4P6QA 4O3RA 1A9NB 3V4IA 5H9EJ 5H9FK 2ZH4A 2XWXA 1EP4B 3TUIC 3NWRA 1F9HA 2OPPA 1UVLA 3V6KA 4KRWA 1YBUA 3MUVP 2IJFA 4LR8A 4FS1A 2HGNA 3VQSA 3M8PB 5I3UA 3W63A 3TEHB 3OR1A 3C3LA 2CQ3A 3D2WA 1LK7A 4LF8J 2H48B 1VYAA 4N76A 2MYFA 1RWMB 5GMKa 1FI4A 2NXNA 4USVA 2COLA 5DQGA 5I3PA 1SL1A 3TAQA 3FBBA 2AU0A 2FJBB 5ETQA 2Y9HA 3VR1A 1R43A 5J2NA 4YR0A 1VQKS 4C97A 1RTIB 1H72C 3D54A 1WEZA 4XDDA 2GCFA 4DV7F 2CQPA 2YQ3A 1X4DA 2GVDA 3MM7A 2HVZA 4M5HA 3PZPA 2HBRB 2NPIA 4ZIVA 1RZMA 2XYPB 1HHTP 1QE1B 5HP1B 4U96A 3O44A 2D9OA 2HHPA 1HNZJ 2NXCA 2QRRA 2HLTA 2MLXA 2C2MB 4YB5A 1LQ9A 1NK6A 4HR2A 3OTBA 4JI1J 1RT6B 4URQU 5KFSA 3BH7B 1VQ9S 2QO3A 2KZMA 2DNLA 2O01C 3E01A 2DHAA 3SYZA 4ATNA 1FCAA 1SKRA 3H90A 1KQSR 2E1PA 2I5JA 3FC9A 3QSYB 3R2DJ 2J7KA 1U7LA 1NKBA 1S6OA 2J7UA 4ZDNA 1ZZFA 1T05B 4L76A 2FVCA 2LP4A 9ATCB 2H65B 3ZTOA 1RAOA 2CIMA 5AXKA 4IG3B 5AXNA 2IPOB 5CYMB 3MEDB 4QZVB 2W7PA 3TVZA 1WUUA 4URSA 5KT2A 4DR7F 1SQGA 1XMBA 4NLVA 4NRUA 2CPDA 4CIOA 1M5SA 2MQLA 2BOPA 2HQ3A 4QIVA 2CG4A 1EP4A 1LXNA 5ETLA 4DCPB 4DSJA 5I4MA 1UA0A 3M8PA 4HYKA 4K7QA 1ZAWA 1SL0A 3AJ2A 3OJUA 1ZS6A 1N54B 3G8SA 1B7FA 4JV5F 4IRDA 3CO9A 3M8RA 2KDOA 4ZPDA 1FEEA 4K2JA 2NCKL 1UVKA 3RBEA 1PC5A 1JKHB 1S0NA 4AQYF 1YJ9S 4M5GA 3CDWA 1WD6A 3PVXA 4RNFA 5A6PA 4B3OB 1KBRA 2QLFB 2R7XA 1VOMA 1IBLJ 1RTIA 5THWA 2IMWP 1BXNA 3FKBA 4KT0C 2IJRA 3MPYA 5HMXA 4G1QB 1VQNS 3RTVA 1IN0A 1QE1A 4OZLA 3CD7A 4DBQA 5HP1A 4ER8A 4G1PA 5IWAF 3ETMA 1Y4ZB 4WKRA 2VA3A 4OZ1A 3I32A 5KFTA 3QAEA 1VC5A 2DY9A 2E5LF 1EB0A 1NSPA 3QT7A 5ITHA 5LJ3Y 1DRZA 2X7IA 1ZTTA 3N5BA 3RB3A 1RT6A 2V2QA 2QYGA 3OHAA 2PMZD 1VIXA 2DR9A 1JLEB 2DGVA 4I6WA 3LWLA 1WKKA 2HGLA 2U1AA 4DL0C 2P9EA 2DNMA 4OYWA 1FKPB 3FCHA 3BQ1A 1RDRA 2BE9B 1FESA 3S7RA 2PFFB 1U1KA 1QVFR 3HCXA 1T05A 2BW2A 3Q8YA 4EK2A 5LJ5Y 2DNHA 3CDBA 2RRAA 4DL2A 3I4HX 4PXEA 4K4XA 5CYMA 3A12A 1NZAA 3MEDA 3DDKA 3WDOA 2YNFB 5E3QA 3U27A 1VK8A 2CDQA 1K1QA 5D77A 2DNPA 3W62A 1RT1B 2GA7A 1O51A 2LQ8A 1B64A 1M5OC 4W98A 3PW2A 3FK4A 2R8IA 3I5CA 3MI7X 3R5DA 3F44A 1WORA 3BBFA 5D0RA 2VOOA 3QWUA 1X4CA 3JTPA 3W7BA 4X65F 5C42B 1M90T 4WJBA 3R5CA 4CCHA 3G2XA 1X0PA 3SV4A 1TK0A 4ZVSB 3JAMU 2QSWA 1GMVA 3KG4A 1JKHA 1SIWB 2J6UA 2DISA 3CCRS 1G6BA 1Q4RA 4ALZA 4B3OA 5AE2A 1ZAVA 4DR4J 6FD1A 2HW3A 3D67A 3QWPA 3N28A 3HJFA 2ROPA 5JMNA 3OVAA 1TQLA 2YNHB 3IS9B 2CPJA 1ZAXA 2YVSA 2MXYA 1H38A 4FYYB 2XMVA 1NJXA 2ACMA 4G1QA 3OBIA 1ZM2A 5A2QU 4CLLA 2AZ1A 4B3MF 1WEYA 2CZ9A 4ID5B 2CPEA 1T95A 1OMSA 2HS3A 2MJNA 2IMOA 2N82B 1LK5A 4K59A 1OY8A 2QJ3A 2E7VA 3BR8A 4B3SJ 2MB0B 1Q5YA 1JLEA 2AGQA 3IR5B 4J91A 1RAEB 3GYXB 3EGWB 3HKZD 3OLAA 4XIUA 5IT9U 1FKPA 4CLYA 4JI0J 2V67A 4P10A 1N5VA 3VAMA 4DWIA 3J7AN 4M5KA 2DR5A 3V2UC 1PC4A 3UNGC 1SV5B 2KXFA 4M63A 4ECUA 7AT1B 4E98A 5AJ3F 2YNFA 4JI8F 1TK8A 2Y1JA 2OEMA 1TUGB 1RT1A 1UVNA 4DSKA 1HYSB 2KRRA 4YEAA 5HVFA 4FP9A 5MLCV 3T3FA 2KM8B 1BE4A 1KN6A 3CCZA 4JI3J 2H5JB 3H5SA 2CQHA 5KFRA 2HMIB 5C42A 2RD5C 1J2VA 1M5KC 1R31A 2B7BB 2IYIA 2HWTA 4NOHA 5LT5A 1S12A 1U1MA 3VGSA 5CA5A 1ZOTA 2MDAA 3HF5A 4A8KA 2ZH1A 2ZUGA 3BKFA 2DXDA 5KFVA 4LF9F 3AJ1A 5KFYA 4DFJA 2KU7A 4JI4J 4EEYA 3QFHA 2GJFA 2GJIA 3MD3A 2G1HA 1K47A 3MUTP 2YNHA 1HL6A 3IS9A 1V3SA 4BWMA 4DR2J 2CWXA 2ZOFA 4KB7A 3Q0AA 3KG0A 2OFGX 2YWWA 3R2CJ 2V6AA 1NKEA 5CH7B 3C6TB 3MFIA 3WBZA 4ID5A 4DOZA 2CG8A 2G0IA 3UPFA 4DZ6A 3Q24A 4Z7YA 3CMES 2MQQA 4WU3A 4DX7A 4ANCA 4M5JA 1KDNA 2AJFE 4OJ1A 1PBAA 2P6TA 5EDWA 4BCAA 1TV6B 2H51B 4GVLA 2RF2B 2V2ZA 3BGOP 4MT1A 4KIAA 1CQNA 1WI8A 2RH3A 3JB9k 4PRFA 4OYMA 5T14A 1S59A 1SV5A 2LEAA 3AOCA 3PW7A 3W65A 3IR6B 3H5UA 2GQQA 1TUWA 3HP6A 3BO2A 4LF7J 5ETTA 1R0CB 3MAHA 1N33J 4P2FA 1HYSA 3IWXA 2VG5B 4CLWA 5IV3A 2CPFA 2FHKA 5J1NA 4RLEA 5H9FJ 2HQIA 2E5IA 2BJ8A 3OT9A 2NSCA 3UCUP 2HMIA 3BGLA 4CNYA 3C14B 1GAOA 4JI7F 3IXQA 3FRZA 2DNOA 3TJAA 3M9MB 4OIXA 2V5HG 3FFIB 2MPUA 4LRDA 1IBMF 4CM2A 1Q7LB 3KFWX 5B09A 2B9EA 4RUHA 1KHVA 2YKQA 2EVZA 1RWWB 2XI2A 4AFFA 4F0HA 3DOKB 3PW0A 1RT7B 1NB2A 3Q8QB 3BZQA 1Y5IB 2HZVA 3W9JA 2LXIA 1EQMA 4MK7A 3H5YA 3N6LA 3PW4A 5FLXY 4I6AA 1U49A 2GX8A 1NK0A 2OH2A 2B4UA 3C6TA 4EI2A 4USJC 2MKKA 5E3RA 2D9PA 1BWEA 1MWQA 4HDGA 3ZZOA 1X9SA 3AODA 2HS4A 4DSEA 4FF2A 3WIVA 4OHWA 4DQIA 3SFGA 1FWLA 1TV6A 1VRTB 2RF2A 2AJ4A 1GXLA 1JXLA 4PYAA 1H2TZ 4B3TJ 2ABYA 1L3VA 3K5NA 3QSIA 1NH7A 3W66A 4R0JA 2MKJA 2ZH5A 1U2FA 4LFBJ 3W8GA 4LF5J 4I7FB 3G86A 2RQCA 3FRYA 3KUGA 4HACB 1IR0A 2HQDA 2UUWA 4TXSA 1S79A 4Y3CA 8AT1B 4WXWA 2ZKUA 2M52A 1REVB 4JYAJ 2WW8A 2VG5A 3QGGA 2LA6A 1H74A 3N6MA 3DOMB 2HYIB 4WKYA 3BPDA 4ZMMA 1MROB 3HI9A 2XLIA 5GMEA 2WSCC 4YHHF 4NA3A 4TQSA 5DGAA 3SDEB 2UXBJ 3Q8RB 3L3CA 3C14A 4NZ0A 4DPOA 4Q5VA 1HQUB 3CCTA 4ZPVR 3A8JA 2PIIA 3RRKA 1V3RA 1X4AA 4USKA 4R5PB 4Q2LA 3FFIA 1RT5B 3NCPA 2GS8A 2AD9A 3KLHB 1YJTA 4RR5A 2DNRA 1VQ7S 2J7WA 2YWEA 4LFCJ 2R7OA 4RUAA 1FFGB 2QN6B 3DOKA 1RT7A 4LR9A 2D1CA 1T9WA 5LMNF 3P8BB 1YLXA 3BO3A 2OPQB 5G4DA 3K0JA 2NR0A 2EW9A 4ECXA 3AXMA 2GAHC 1S49A 4Q8FA 4DS4A 3F0NA 3G82B 1R8BA 3T1HJ 1UPMB 2HAIA 2BEFA 5HI7A 5KT4A 3KHRA 3CC4S 2D7SA 1ACMB 1IKYB 2F40A 3G6VA 4EFAC 1QSYA 4OYBA 5ETPA 3UCGA 3DRPB 3PJ9A 2GJ2A 5A8WB 2A6MA 5KG7A 3NNHA 2B5JB 2PA3A 1RAGB 3HJVA 2KB2A 1VRTA 4ZIWA 2MGZB 2RHSB 2Q79A 4DR6J 1JMTA 4TY9A 2IDEA 1AUDA 3AOAA 1JXVA 4JI6J 2ZZNA 2KXNB 2PN6A 4I7FA 4K4SA 3GZ7A 2X1BA 5KFZA 4DEZA 4QR1A 4HACA 3VWSA 4NLUA 3DI6B 1WHYA 2VDHA 3GYNA 1REVA 4LVNP 4PZVA 4NL5A 4DMZA 2W9BB 4X4OA 4GC7A 3T5HA 3DOMA 1K8AT 2DGUA 1I94J 1MROA 3TZWA 5D4OA 4QIWD 4ELTA 2E1MC 2OEKA 3UN5A 3SDEA 2MKIA 4QW9A 2VPXB 3IMQJ 3RYLA 1VQ6S 3THVA 1HQUA 4O0IA 2FVSA 2LXUA 5B0FA 3HHEA 3OL7A 4Q7AA 2X51A 4R5PA 1D9FA 3CJ5A 3U02A 1RT5A 4QU6A 4IOCQ 1N5TA 3GJSB 3KLHA 2H4YB 4EUVA 1OWXA 4O3QA 3FJ2A 4CO1A 4DV1F 4UOCA 2CNNB 2HWHA 2E5GA 3CEDA 3TUPA 4DR5J 1N48A 2HS0A 2E1AA 2APOA 2LA4A 4O4GB 2QTWA 1UJ6A 4DL4A 4X4TA 3QRQA 2OPQA 3GFYA 4HT5A 4ZVTB 2FC8A 2BR0A 3TEGA 3SEOA 4O0NA 4QWDA 4P72A 4LR7A 3G82A 1RWNB 4KJIA 3RU0A 5KFOA 3GCXP 4G3IA 2E1RA 4A8SA 4LJMA 2VJVA 1S9GB 1IKYA 4C8ZA 2P8IA 1EARA 4ECYA 1JIHA 3DRPA 3HT0A 5A8WA 2B5JA 2K8GA 5HVGA 1OJ4A 2ZZTA 3HZEA 2X1GA 1YJUA 2MGZA 3EJMA 2D3O1 1IBKJ 3KK2B 1PCAA 1UEVA 1VDHA 4NE9C 4Y34A 2V68A 5HBMB 4ECWA 3QATA 2B3TB 3KNAA 1SB6A 2FPHX 3HSDA 3NNAA 4URGA 1DARA 1ZA1B 3DI6A 2W25A 4NPOA 1TKZB 3MR2A 1YJVA 5F8HA 4P2MA 3C2PA 2W9BA 3Q8VA 2C3PA 3T9NA 2I1RA 1ZTWA 4NCBA 4OYZA 3GFHA 1BMQB 5JVGQ 3MMBB 4EO8A 2B43A 1B0VA 3WIUA 3JSMB 1WELA 3EVMA 4OZNA 2F4VF 1GFWB 3EICA 4DUTA 1K44A 3MCNA 2Z2ZA 4NEZA 1T8EA 2V4QA 3BJYA 2BM0A 4M5LA 2V8GA 3WC2A 4X4VA 1WDTA 3MCMA 4UUWA 1U2RA 4C8MA 2VHGA 1IUJA 1KP6A 5KFWA 3G8QA 4WFNQ 1KQGB 4CNZA 1AW0A 1KOHA 1RWOB 1P6TA 2DXFA 4O4GA 4KTQA 2E1CA 4OJGA 4L74A 1B7YB 2PEHA 1KVJA 2HZAA 1TFWA 1D0EA 4YB6A 1S76D 4YS2A 3H8YA 1X0FA 3SCJE 2HG4A 4QIGA 2BVZA 1S9GA 2A2CA 3X1LB 4ZLJA 1Z1ZA 3IA0A 2XMKA 4OX9F 2R2TA 3HSGA 2XYGB 4LBIA 2JC1A 1WF0A 2DHXA 1RHMB 1YJNS 4F3QA 2JH3A 3PO4A 1Y9OA 3EPGA 4YR3A 3QFWA 1S6UA 1S1WB 2QA4G 2RHQB 3CNQP 5IC6B 3KK2A 3GG0A 4ZJOA 4HH1A 3C19A 1XIQA 2E66A 2WVFA 5AT1B 2VFTA 5HBMA 1QAXA 1QM9A 2XBPA 4OX6A 4CDIA 1NPPA 3QYYA 5KFCA 4ECSA 2YWGA 4RL1A 1ZM4A 2EFVA 1NAQA 3PR4A 2Z8QA 3MM5B 1PJ6A 4F04B 3TZZA 5L46A 3ISNC 5DRKA 1OPZA 2XNRA 1XR5A 2DGSA 5GAGI 4ZVPB 5DO2A 2ZUAA 2OFHX 3T41A 3D6TB 3NOGA 4PQUB 1RAJA 3OV7A 5K8MA 4Y28C 4WK3A 3MMBA 2UXCJ 4WWSA 2BANB 1NDKA 1CBKA 2J8AA 2YNIB 1SJ1A 3JSMA 1VBZA 1TK5A 2VPZB 2CQ2A 4EWTA 1DLOB 2WVDA 3B82A 1ZYQA 2QV6A 2EBGA 5FIIA 3BGUA 3BSAA 4Y0FA 5L1JA 1UVMA 3PYGA 2AWZA 3P96A 5CYQB 4OZ5A 2NQPA 3T1YJ 2KTQA 1Q16B 2DHHA 3LP2B 4ILMA 1SUQB 2CVIA 2MQOA 4DV6J 4KHMA 3P45B 4Q8EA 2FJAB 3IBCB 4I6YA 1FDNA 5LSOA 1WI6A 1LNQA 3C6UB 1G4CA 2VKRA 3FNNA 5HJXA 2CQ1A 2I38A 2C42A 3LPYA 2FY8A 3GJTB 4IOAQ 3D1HA 2B9WA 4B9VA 3OVBA 5KFGA 2RKIB 2R2RA 1RWXB 4DZDA 4K0KF 5G0RB 2GMHA 3BREA 2OEJA 4F0KA 2HVDA 2B8QA 2DBBA 4QIEA 4K4ZA 4HI1A 2JNJA 3QGIA 1RA6A 3MHYA 3KDOA 3EUNA 2HRUA 3H4BA 4ZVEA 3ZTRA 1SH2A 3QGPA 4WCEQ 1TUVA 4U6PA 1S1WA 3IBWA 2UUBJ 5A6WA 1GMWD 2DR7A 3TZXA 4CLUA 1YRTA 1KQFB 4HHHA 2CKWA 2V34A 2EG2A 1O5JA 1S1UB 2SXLA 3THPA 3TX8A 1HW9A 1ROFA 3RB0A 2A3JA 1TMMA 3FZ2A 5K14B 3M8QB 2BKOA 4JI2F 1JJ2R 3VV2B 5ETKA 1DAXA 2VASA 3MM5A 1BLUA 1NK4A 3KJVB 4F4WA 4ZOSA 2XS2A 2NXEA 5E2QA 4LQ9A 4R0EA 4A8QA 1RB0A 2IA6A 1KVKA 3KK1B 3GLJA 2YH0A 2VJUA 4DU7A 4PQUA 2VDIA 4C6AA 5EN1A 1RACB 2IRXA 2XHCA 4DF8A 2DJWA 1WC6A 3QRPA 2BANA 4DV7J 3ILLA 2YQ1A 1N6QB 4F2SA 5K5MA 2YNIA 2ZE2B 3KHGA 1HNIB 4FBUA 1DLOA 3MR3A 2BUNA 3D6MB 1FNXH 3VQTA 4CYUB 5DGBA 3UVJB 2BA9A 4FYXB 4ZLPA 1YBAA 2NREA 1U0SA 5CYQA 1TU0B 4CWBA 4JOUA 3LP2A 3MPDA 4QYZJ 1SUQA 4B9MA 2BACA 4DQPA 2DH9A 2DGWA 2FZGB 2V2KA 3C6UA 1Q82T 4LRFA 2CZ4A 1ZM9A 2CDRB 2HAFA 2ZJRQ 1GMUA 4C8YA 2WSEC 1FRJA 1CVJA 1RWKB 2RKIA 1RAAB 2EI5A 2GV1A 1ZZNA 3D6HB 5G0RA 3KWMA 3VAFA 2R7VA 1S6PB 2DB1A 3DHWC 4ZLNA 4DUZF 5GMDA 4QBUA 1MU2B 2RVJA 3W9HA 1OQ3A 7FDRA 2EXUA 2UU9F 4OZ3A 1T9VA 3QGHA 5HL7Q 2LU1A 2KJWA 4DR7J 3Q22A 2D41A 5A8KB 2XZWA 3GPAA 5B0DA 3RBDA 4ZP6A 3B78A 3N9UC 4DCOB 2UVRA 1HFEL 3QPIA 2XB2D 1HBOB 1S1UA 1RU1A 5F8MA 3H20A 3CE8A 1L3SA 3ITHB 4DPXA 1NDCA 4P52A 1HKAA 3GU0A 1SBRA 2RNEA 1UAWA 5K14A 2R7RA 4NA1A 3M8QA 3UDEA 3OTOF 1R8PA 4O4RA 2J5AA 4Z7CA 2KL8A 5FJ4A 3KJVA 1UVJA 3EMTA 3ZZ0A 4I1TA 3M2UB 3MM6B 2HVIA 1SH3A 3QT5A 2XZTB 5KT3A 4AQYJ 1AFJA 3ICLA 4Y2CA 1FD8A 1KRPA 3PY8A 1IJFB 4MJKA 3I9ZA 3KK1A 2GO8A 5KT5A 1VGYA 3R5AA 3K2YA 4AT1B 5DG9A 2AYMA 2EC0A 3OXGA 5DM7Q 4B9TA 4L3NA 5AE3A 1N6QA 3MGJA 3D3BJ 2ASLA 2ZE2A 5CHCB 1HNIA 1U25A 2RDDA 4FYVB 3ZO7A 4CYUA 3NGDA 1Q8IA 1UFLA 3UVJA 1UP1A 1N88A 1KC8T 2HIYA 2EFPA 1W2IA 2B7CB 2E5LJ 3H40A 4YDDB 3HHLD 4JUZA 5AXMA 4OJHA 5LXRA 1NHVA 5T7LB 3KLIB 2FJWA 4J9VA 2YWKA 1N5QA 3RRHA 1QAIA 2XMWA 4B9LA 5HMYA 3K58A 2X1FA 3KMSA 1JJCB 4RBUA 2RS8A 2QMUB 3B4DA 4ED7A 1HA1A 5E3CA 3CCVS 2RU3A 4RNHA 2M5YA 3M9OB 5L9NA 3ILIA 1DBDA 2CJAA 3LO3A 4NLDA 1DURA 3IAM9 4M1KA 1HI8A 2JC0A 1MU2A 2HPUA 5FDLB 5HJYA 3Q8PB 3NS6A 4YY3F 5LL6d 4CLPA 1S48A 2HWIA 5A8KA 2MZJA 2AV5A 1D9AA 4TYBA 1G2EA 1HBOA 1HMVB 3PHTA 1UCNA 1TZ0A 1RLDA 1FVQA 1AB8A 3FQLA 3GV7B 3ITHA 1T7PA 2CNKB 5L1LA 3X3UA 3MEKA 4KO0B 3TVYA 4X65J 1G3OA 5F41A 3TWZA 4WYLA 4C9DA 3M8WA 3B6BA 1U6BA 1UFKA 1MWYA 3G8TA 1BD6A 3M2UA 3MM6A 2R7QA 2HRTA 1YSJA 3G6ES 3SMZA 3P6YC 2LDIA 1UA1A 1WSVA 4NLXA 3UO0A 3ZFVA 1N4LA 2BZ2A 2O3DA 2ADCA 1FO1A 2HIQA 5KG3A 1CJVB 4A46A 2V9WA 1LV5A 3RRGA 3N6NA 3FQKA 1IR2A 3OFHA 3DDNA 2B56A 4X62F 2VZ9A 2F8EX 3EXCX 1AYEA 4B3MJ 4PWWA 1EQ0A 2LQBA 3HHDA 2AYGA 1KLMB 4RKUC 2E44A 1KEKA 1RTDB 3AY0A 5T7LA 3KLIA 3KKFA 2E9TA 2ALYB 3TA1A 1QY7A 2C3MA 2UVUA 1LOUA 4DXLA 3NCQA 4C8LA 1HWIA 1Q1KA 3R8YA 1MN9A
chains in the Genus database with same CATH topology
2MEWA 4LF8J 1J5EJ 1N33J 4DR2J 3R2DJ 4GKJJ 3IMQJ 1XMOJ 2MTLA 4LF9J 4OX9J 3T1YJ 3R2CJ 4JI5J 4NEZA 3J80U 1IBKJ 2UXBJ 2KL8A 2VQFJ 1IBLJ 4NXNJ 1HNWJ 4DV6J 5BR8J 4LFAJ 5A2QU 1XMQJ 5LMUJ 4DV4J 4AQYJ 1XNRJ 5AJ3J 2ZM6J 4X64J 4JI8J 4DR6J 3OTOJ 2F4VJ 4JI3J 1XNQJ 5FLXU 4NXMJ 4YHHJ 4LF4J 4V1Ak 4KYZA 4KY3A 2HHHJ 4HHUA 3D3CJ 4DV2J 4DR5J 4JI2J 1HR0J 4JI6J 4B3TJ 1N34J 5IWAJ 4LFCJ 2KVQE 4GKKJ 3D3BJ 4B3SJ 1FJGJ 4KHPJ 2UUAJ 4B3RJ 4LFBJ 2MQ8A 5LM7E 3W1YC 4B3MJ 1N36J 1HNZJ 4NEYA 4DV1J 4LF5J 4PWWA 4JI7J 4DR7J 4DV7J 4DV3J 4DR3J 4DV5J 2UUCJ 5IT9U 4JI0J 4DUYJ 4X66J 3JAMU 4JI1J 4DR1J 4YY3J 2UXCJ 4X62J 4JI4J 3J7AN 4JV5J 1N32J 1IBMJ 2VQEJ 4DUZJ 4K0KJ 2E5LJ 4LF6J 2UUBJ 1HNXJ 4DV0J 4X65J 3T1HJ 2UXDJ 1I94J 2UU9J 4JYAJ 4LF7J 4RJVA 3J81U 5LMNJ 4DR4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEW A;  4LF8 J;  1J5E J;  1N33 J;  4DR2 J;  3R2D J;  4GKJ J;  3IMQ J;  1XMO J;  2MTL A;  4LF9 J;  4OX9 J;  3T1Y J;  3R2C J;  4JI5 J;  4NEZ A;  3J80 U;  1IBK J;  2UXB J;  2KL8 A;  2VQF J;  1IBL J;  4NXN J;  1HNW J;  4DV6 J;  5BR8 J;  4LFA J;  5A2Q U;  1XMQ J;  5LMU J;  4DV4 J;  4AQY J;  1XNR J;  5AJ3 J;  2ZM6 J;  4X64 J;  4JI8 J;  4DR6 J;  3OTO J;  2F4V J;  4JI3 J;  1XNQ J;  5FLX U;  4NXM J;  4YHH J;  4LF4 J;  4V1A k;  4KYZ A;  4KY3 A;  2HHH J;  4HHU A;  3D3C J;  4DV2 J;  4DR5 J;  4JI2 J;  1HR0 J;  4JI6 J;  4B3T J;  1N34 J;  5IWA J;  4LFC J;  2KVQ E;  4GKK J;  3D3B J;  4B3S J;  1FJG J;  4KHP J;  2UUA J;  4B3R J;  4LFB J;  2MQ8 A;  5LM7 E;  3W1Y C;  4B3M J;  1N36 J;  1HNZ J;  4NEY A;  4DV1 J;  4LF5 J;  4PWW A;  4JI7 J;  4DR7 J;  4DV7 J;  4DV3 J;  4DR3 J;  4DV5 J;  2UUC J;  5IT9 U;  4JI0 J;  4DUY J;  4X66 J;  3JAM U;  4JI1 J;  4DR1 J;  4YY3 J;  2UXC J;  4X62 J;  4JI4 J;  3J7A N;  4JV5 J;  1N32 J;  1IBM J;  2VQE J;  4DUZ J;  4K0K J;  2E5L J;  4LF6 J;  2UUB J;  1HNX J;  4DV0 J;  4X65 J;  3T1H J;  2UXD J;  1I94 J;  2UU9 J;  4JYA J;  4LF7 J;  4RJV A;  3J81 U;  5LMN J;  4DR4 J; 
#chains in the Genus database with same CATH topology
 3JQM A;  3NEK A;  1NXI A;  4C11 B;  5KFU A;  2KYZ A;  2RUS A;  5KOX A;  2LFV A;  4BC9 A;  4F4Z A;  2JHE A;  3I56 S;  3LGN A;  1C4A A;  4M5D B;  3VCD A;  1MN7 A;  4TVA B;  2KFY A;  2BBE A;  4FNI A;  2CAJ A;  3PYF A;  3US5 A;  3I0R B;  1XR7 A;  1BHN A;  5AJ3 J;  2UUA F;  5FDL A;  4JI8 J;  2FZK B;  2JEJ A;  4P2S A;  4DFK A;  2XMT A;  3M1V B;  3QLH B;  1R7I A;  3DDI A;  2XGP A;  4DR1 F;  3J81 Y;  2F7V A;  2ZWP A;  4U7U K;  5J2Q B;  1HMV A;  4ZJQ A;  2PD1 A;  3P5T L;  1SKW A;  1RKI A;  3LAL A;  3FBF A;  1IWA A;  3BM7 A;  4PEO A;  1FEH A;  3H2V E;  3M6V A;  2XS7 A;  1WOP A;  1J5E F;  4KO0 A;  4J9Q A;  2C2N A;  4DDF A;  4FYW B;  1X4B A;  4TU8 A;  4CP5 A;  2IM0 A;  3TAR A;  3MOJ B;  2CPH A;  1HHQ A;  3KJF B;  3KLG B;  1K0V A;  4K8R A;  1VJW A;  5F9L A;  5F0W A;  3D5M A;  1I3O B;  2YX7 A;  1L3U A;  2GNK A;  3V81 B;  4LF9 J;  1U09 A;  3RB4 A;  3HSJ A;  5HQL A;  3EPI A;  2VIC A;  2XCP A;  4HEA 9;  2AEF A;  4UZC A;  2BRK A;  3ZTP A;  3DU5 A;  5I3Q A;  3OSN A;  3D6F B;  5BYR A;  1H73 A;  2IFX A;  4U95 A;  2AZ3 A;  2E7X A;  1CJV A;  4HVZ A;  2NYH A;  3T9Z A;  3N01 A;  2BXJ A;  3R6L B;  1VCT A;  1MWZ A;  4KY3 A;  3M30 B;  3R3T A;  1F9E B;  3ZZP A;  1XK8 A;  4J9R A;  3J7Y U;  4QPT A;  4FKY A;  1KLM A;  1HIY A;  3BSN A;  1RTD A;  2WRM A;  2I8E A;  4LBH A;  2C28 A;  1FKO B;  4KBI A;  1GXU A;  3H98 A;  4CZC A;  3PEJ A;  3PO5 A;  1SKU B;  1R89 A;  4F3O A;  2P2C B;  1MMN A;  4C11 A;  4DPU A;  1TTH B;  3HFZ B;  3PIP Q;  1F2G A;  2MY7 A;  2NSB A;  1RHQ B;  4M5D A;  3JSB A;  3WX4 A;  4QR0 A;  1PYT A;  3GV8 B;  2MTL A;  4Y2M A;  2PDA A;  2P5V A;  3I0R A;  1IBL F;  4OL8 A;  3TQE A;  2GML A;  2Z2Y B;  1S9F A;  2R7W A;  1WC4 A;  2M4M A;  4V19 X;  3CJ8 A;  1N34 F;  3AXK A;  5CZX A;  1KTV A;  3M1V A;  3QLH A;  2WBM A;  1TEL A;  1FFW B;  4WPA A;  2GQC A;  5J2Q A;  1T94 A;  3KJN B;  1UET A;  3D1O A;  4USW A;  1RE1 B;  2WHO A;  5L1K A;  1WAC A;  2QZ8 A;  3SZ2 A;  2E29 A;  4A48 A;  3M6U A;  5MAO A;  2L48 A;  4CLS A;  1BC6 A;  2QLJ B;  2Z4P A;  4K50 A;  3P5B P;  3AT1 B;  2NLW A;  5KFJ A;  4X4Q A;  4JI7 J;  1UW4 A;  4ED6 A;  2LQ5 A;  3KLG A;  1IBM J;  3IWN C;  5CD4 H;  3CJK B;  1S7H A;  3HVA A;  3RAM A;  9RUB A;  4MK9 A;  2ZD1 B;  2C2O B;  3I5B A;  3BN7 A;  5BYS A;  2XY6 A;  2AX0 A;  3V81 A;  1TL1 B;  4F8R A;  1HQE B;  4YB7 A;  1H6K X;  2ZNZ A;  1R27 B;  1FRX A;  3OD2 A;  4C3K A;  4P7V A;  1HW8 A;  2FLL A;  1ZPV A;  5KFQ A;  4YR2 A;  2A1B A;  1WKL A;  3DGV A;  4NA2 A;  3OL8 A;  2EFQ A;  3M30 A;  2UUT A;  3GIR A;  1Y5N B;  5E0O A;  2DIT A;  1KON A;  2B51 A;  2C3O A;  4ZP9 A;  1GNK A;  3CF5 Q;  3GE9 A;  1PKU A;  4R8U B;  4DL5 A;  3RBX A;  1F5C A;  1FKO A;  3ETO A;  3NL0 A;  3IWL A;  4FBT A;  4LRE A;  1TAU A;  2F1F A;  1VHI A;  4QWA A;  2XHW A;  5EWF A;  2VU5 A;  3BR9 A;  1UFW A;  2OJ3 A;  2JOQ A;  1XMO F;  3DN9 A;  4OJ3 A;  1URR A;  3IC1 A;  2Q66 A;  1SI9 A;  2AT1 B;  3T19 A;  2RRN A;  2DCU B;  1C1C B;  4XTT A;  5EHH A;  4DR4 F;  3L7O A;  1UEU A;  3H5X A;  4L73 A;  3IM8 A;  5DG7 A;  2ZOM A;  3OSP A;  4U8Y A;  3ELH A;  2HHX A;  4WFZ A;  2EC2 A;  1L3K A;  5A8R B;  1PYO B;  1PJ5 A;  2R2S A;  3KHL A;  5M2P A;  3M8Z A;  2GHP A;  2RRB A;  4FPR A;  3RAX A;  2R8H A;  3DRS B;  2XNQ A;  3AB2 B;  1UKU A;  1RHR B;  4NZ7 A;  4YHH J;  4DV5 F;  3SQG B;  3GG1 A;  1FER A;  4PYD A;  3A4T A;  1WSR A;  2EFO A;  1Y5L B;  3EX7 B;  2F9J A;  1EX8 A;  2KVQ E;  4JV2 A;  4KPC A;  3JTN A;  4KKO B;  3IGN A;  2MKS A;  2QLB B;  2QG9 B;  1S57 A;  2N4D A;  4F67 A;  2D74 B;  4YQW A;  2HHS A;  2JEG A;  2H1Y A;  5B0E A;  1LWF B;  3CJK A;  1ZBT A;  2UUC J;  2ZD1 A;  1HHS A;  2HHU A;  3CCE S;  2DNY A;  1HAR A;  2V69 A;  1X4E A;  2ATL A;  2O66 A;  1TL1 A;  3PX6 A;  1MG7 A;  3QQC D;  1HQE A;  5CAB A;  4XAK A;  2WW4 A;  2BMB A;  4LFA F;  3JQK A;  3H2U B;  5LMN J;  2MST A;  2KHC A;  4J9N A;  1XNR F;  2NYI A;  2K7K A;  4WP9 A;  3C66 A;  3GMG A;  1GEH A;  2CYY A;  2OUG A;  2VPY B;  1R6V A;  1A7G E;  3LOU A;  4IG0 B;  1LXJ A;  3PXG a;  1H2U X;  2Y8Y A;  4DU8 A;  3IRX B;  4D3G A;  1CEZ A;  1Q86 T;  3MMJ A;  1AA1 B;  2G2Z A;  1S5Z A;  1YKW A;  1S7I A;  4NLT A;  4R8U A;  1R8C A;  1GX5 A;  3MM9 B;  1PJ7 A;  3NBP B;  3O3L A;  4BBY A;  5C2G A;  3NXZ A;  3MPV A;  3NMR A;  5DET A;  1HNV B;  4TQR A;  4OX7 A;  3T6B A;  1YJ7 A;  2UXD F;  2FY1 A;  4H4O B;  1U24 A;  1VRQ C;  1GX6 A;  2XMA A;  2Q43 A;  4RNO A;  2IJN A;  2ZKT A;  4F0M A;  1VHF A;  4KV8 B;  2W4D A;  3A13 A;  4NLW A;  2W4P A;  3UR3 C;  1Q7Y T;  2VIH A;  4ICL B;  1YG0 A;  3MCS A;  3CIZ A;  4OZ0 A;  4WFY A;  1RP5 A;  4KPY A;  1F5A A;  3CXC R;  3W8P A;  2QL5 B;  3P4U B;  2CQD A;  2R3V A;  3PX0 A;  5A8R A;  4RNN A;  2GVZ B;  2HHH F;  3M2V B;  4NLO A;  3M6W A;  1M1G A;  3DRS A;  5LSR A;  3J7A 1;  4MKY A;  2BKP A;  2H9Z A;  2XUL A;  1KOO A;  4A8Y A;  4WFA Q;  4A4J A;  2Y1L B;  3SQG A;  2POK A;  1YK9 A;  4IO9 Q;  2Q1L A;  4K4W A;  3JQJ A;  5F9N A;  3VAI A;  5E3P A;  5GAH U;  1KHW A;  4DUY F;  4KKO A;  3AJD A;  1KNZ A;  2J76 E;  2J9D E;  1GTE A;  1SVD A;  4BLG A;  4AXI A;  4LF6 F;  1YX2 A;  3EDR B;  2DNN A;  1Q79 A;  3AA9 A;  1GT8 A;  1HI0 P;  3KHH A;  4DV1 J;  2A2D A;  1UVI A;  1S0O A;  4WII A;  3A8K A;  4HTJ A;  2ADB A;  3E8O A;  1FTR A;  2JWN A;  3CW2 C;  1KKH A;  3ZTQ A;  3EDQ B;  2IM3 A;  2I0X A;  1CS4 B;  3OTD A;  2BYC A;  2ZBR A;  2GIQ A;  3JSR A;  5F8L A;  2N4C A;  3DMJ B;  4DCJ B;  1IM6 A;  3OQ2 A;  1RT4 B;  4IG0 A;  1WG1 A;  2W2Q P;  2OD6 A;  2ASY A;  1VRU B;  4NX9 A;  3IRX A;  1IXK A;  1I51 B;  4J37 A;  4I69 A;  3LGH A;  1KTQ A;  4MKB A;  5J2M B;  3MM9 A;  4X64 J;  3NBP A;  5CCM A;  3R7B B;  6FDR A;  3TO8 A;  4Z2X A;  5GAD U;  3U1M A;  3L7P A;  1HNV A;  3U1N A;  2ZH7 A;  4HKQ A;  2F3J A;  3TP2 A;  4H4O A;  4OI6 A;  1FF2 A;  7FD1 A;  2L08 A;  4YDX A;  2W7O A;  2XS5 A;  5CCL A;  1S72 S;  5D3G B;  2OPR B;  1PYS B;  3LF0 A;  3FVY A;  4DQQ A;  4KV8 A;  3W1Y C;  3N4W A;  3EVW A;  2WK4 A;  4RNM A;  3BSC A;  4UUX A;  2C2R A;  2ZDP A;  4ICL A;  1YI2 S;  5DDP C;  3OJS A;  1D3W A;  3QMQ A;  1LFW A;  3PKM A;  4N47 A;  4C8N A;  2W8L A;  1E6Y B;  3K8V A;  2YNG B;  1VQ8 S;  2GVZ A;  3M2V A;  4FNH A;  2JL9 A;  4CQ1 A;  3C8Y A;  3UN3 A;  3BS9 A;  2AQ4 A;  1NK7 A;  1S0V A;  4UW2 A;  5L9X A;  1X5P A;  3PTW A;  3DRY A;  4MIB A;  5H9E K;  2OLW A;  2XYH B;  2FGO A;  1W26 A;  3Q8S B;  2CQC A;  1NHK L;  4LT6 A;  2F4V J;  4C8K A;  2MZS A;  1OQ6 A;  3DLL Q;  3GCW P;  3IN5 A;  4ED2 A;  1VC6 A;  1CPZ A;  1WC3 A;  2J0S D;  4I2Q B;  4FXD A;  2DIU A;  5JXS A;  4OI3 A;  2LQJ A;  3HZG A;  1JK9 B;  2C22 A;  2DT9 A;  2GQ2 A;  3GR0 A;  3RZA A;  2G1D A;  2DYA A;  1CS4 A;  2AW0 A;  4UQG A;  4DQS A;  3J7Y I;  3MDF A;  1X5O A;  2HEK A;  4ZPA A;  2DY1 A;  4IG3 A;  3DMJ A;  1X9W A;  1ITP A;  1FXR A;  1RT4 A;  2R7U A;  2KHD A;  3Q2S C;  5LMU F;  2CVE A;  1WC1 A;  1K0T A;  5JJB A;  1KWM A;  5GAE I;  2HVE A;  2KYX A;  4OX9 J;  3CO0 P;  3O2I A;  1UTA A;  4EMD A;  4Q45 A;  1YQH A;  3W9I A;  1FRM A;  5J2M A;  4DV2 F;  4CI0 B;  1X5S A;  1W7W A;  3QT8 A;  1Y00 A;  3CJQ A;  4PAA A;  1FA0 A;  4QWC A;  2MQM A;  3LA0 A;  5D3G A;  2OPR A;  2E5H A;  3LAM A;  2CQB A;  1LFP A;  3SXL A;  3JXO A;  1RKJ A;  4LFC F;  1WHV A;  2L9W A;  3IFE A;  1UEK A;  2QMW A;  3GV5 B;  5RUB A;  2I2Y A;  4USH A;  4DLG A;  1X8D A;  2B6A B;  1N56 A;  3PAC A;  3KLE B;  1P1T A;  1E6Y A;  4YFU A;  1QVG R;  2DXE A;  1EZZ B;  4GO7 X;  3HD2 A;  3K57 A;  1RIS A;  2YNG A;  4JI5 F;  1U47 A;  3M4X A;  1KFS A;  1DTT B;  1HNW F;  2RQ4 A;  2GZO A;  4NMX A;  1Q53 A;  4KGX B;  1NO8 A;  3DGP B;  1OYE A;  1RU2 A;  4DHV A;  3H7H B;  4E8U A;  3MEG B;  4GRS A;  3DXB A;  2C3Y A;  2AF6 A;  1EAY C;  2FJX A;  4FF3 A;  3CTR A;  3ENW A;  1NSQ A;  4I68 A;  4N56 A;  4O44 B;  4RUB A;  3NLC A;  3HK2 A;  5ETN A;  4L72 B;  4I2Q A;  5CQG A;  3I9V 9;  3DLE B;  3OXF A;  3R27 A;  1QSL A;  2QE5 A;  1RAF B;  3BGF A;  3MR6 A;  4EO6 A;  2Y8W A;  2V63 A;  1UPP A;  3ENQ A;  1FX4 A;  4K4U A;  4ELU A;  2VB6 A;  3HMJ G;  3DFE A;  2CPY A;  2BX6 A;  4ELV A;  2M8D B;  3MD1 A;  1VBK A;  1RJJ A;  4K0K J;  2EWH A;  4NWB A;  1U1P A;  1QTN B;  4OYO A;  4Y2I A;  3BKU A;  2YTC A;  3MEC B;  1XR6 A;  1VIS A;  3QT6 A;  2OEL A;  1SC3 B;  3Q8U A;  4A8O A;  1QTM A;  3DLB A;  4QR2 A;  4ED0 A;  2MSS A;  8RUC A;  4IOB A;  3K5M A;  2V4J B;  2V94 A;  1SJF A;  4EYI B;  2Q3P A;  4I2P B;  3I87 A;  4AD6 A;  1TKX B;  2HK3 A;  4EBE A;  3RR7 A;  1F0X A;  4PKD B;  3DNC A;  1UWA A;  4X66 F;  1EHW A;  1FK9 B;  4JI2 J;  3H2L A;  1KVI A;  2B6A A;  2MKH A;  1H2V Z;  5IZH A;  1WKJ A;  1U26 A;  3KLE A;  1H98 A;  1RTJ B;  3PFE A;  2MHN A;  1ICE B;  3TQ1 A;  1M5H A;  4TU7 A;  3PRB A;  5M2U A;  4RZR A;  4MH8 A;  4FDF A;  1DTT A;  3W61 A;  4LRA A;  3HM9 A;  4AL7 A;  2PSZ A;  2J8S A;  1NJZ A;  1RAD B;  1T3O A;  3DGP A;  4PPD A;  3TJ9 A;  5F3Z A;  2MZT A;  2XY7 A;  3MEG A;  4WZQ A;  3NG8 A;  1LWE B;  4LF2 A;  4ED4 A;  3PG9 A;  1BY9 A;  4RWX A;  4J9S A;  2DR8 A;  4ES2 A;  4O44 A;  4FPI A;  4HL9 A;  3NGT A;  1OS5 A;  3NKY A;  2OI2 A;  2W9C B;  2HBZ B;  4GKK F;  4B3R F;  3DLE A;  5E7O B;  1N36 F;  1FWK A;  3AD7 C;  4A8X A;  4O3N A;  2R9L A;  4F3M A;  4IR9 A;  4U9R A;  3ISZ A;  1GMW A;  1RHU B;  3D3C J;  3FMB A;  2B9Y A;  4P7T A;  2BJD A;  4RW9 B;  2LMI A;  3SCL E;  3QJL A;  2X3D A;  1R8A A;  4MFB B;  1U1Q A;  4U8V A;  2WZ1 A;  3CCQ S;  2BDP A;  1M5P C;  1VBY A;  2Q6B A;  3MEC A;  4DUZ J;  2HNY B;  1FRL A;  3GIM A;  4HTI A;  3W2W B;  3UR0 A;  1VQ5 S;  4NXN F;  2UU9 J;  4F50 A;  1RYS A;  4O3S A;  4DL6 A;  2RS2 A;  2D69 A;  1F3F A;  3JYT B;  3KNG A;  3A3N B;  3MAA B;  4QQB A;  2NZC A;  1BGX T;  1WG4 A;  2PE8 A;  4YME A;  2V4J A;  2VBY A;  1JLA B;  1RHK B;  3H4D A;  3KXD A;  3DCA A;  2J9D A;  1FNM A;  3L9Z A;  4EBC A;  2FHJ D;  5DG8 A;  5C2C A;  4WTO B;  4ED8 A;  3CD6 S;  4XK8 C;  1HWK A;  2QA2 A;  4I2P A;  3UN2 A;  1SL2 A;  1TKX A;  1IWG A;  1NM2 A;  4F4X A;  3KLV A;  1S4F A;  2O5D A;  4PWU A;  1FDD A;  1RAI B;  3OTO J;  1FK9 A;  1V5V A;  2DH7 A;  5FLX U;  3NMA A;  4PWD B;  1VQO S;  2LDY A;  1JLC B;  4Y6I A;  1RTJ A;  1RAB B;  2YWF A;  4HDH A;  4BHQ A;  3T5L A;  3Q2T C;  3HHL B;  1N32 F;  5DLF A;  4QIF A;  4OV6 A;  1FVS A;  3GQC A;  5GAH I;  2GIF A;  1PBU A;  1IQZ A;  1X60 A;  3UQS A;  3I31 A;  1TAQ A;  2RT3 A;  3LAN A;  1XEZ A;  2IM1 A;  2ZEJ A;  1O0P A;  1Z2L A;  1EJ7 L;  2FJD B;  4X84 A;  3MFH A;  1LWE A;  1IVZ A;  4MK8 A;  3IP0 A;  2YY3 A;  1B99 A;  1U0H B;  1X5T A;  2MEW A;  2DKO B;  3K5L A;  4L75 A;  2GFF A;  3OTC A;  2WCX A;  4FXW A;  4RW4 B;  3FUY A;  5IS2 A;  3OXL A;  1NRK A;  2W9C A;  3AHP A;  2F65 A;  2XLK A;  4UZB A;  4UOF A;  3R1L A;  2CQ4 A;  1VMB A;  2BQU A;  5M2R A;  2AEJ A;  2CA9 A;  2WSF C;  4NLP A;  4C3M A;  1F5B A;  4JBC A;  3AB4 B;  4MAK A;  4RW9 A;  3I0S B;  3SSR A;  3SIP B;  5DQI A;  1C4C A;  1X4G A;  1OPI A;  2HHT A;  4MFB A;  4JV1 A;  3B54 A;  1N8R T;  2HFZ A;  5KFD A;  3VAL A;  2PMH A;  2M8H A;  1VS3 A;  5DQH A;  3OFG A;  1G7C B;  1Q8B A;  5EGY A;  2VV5 A;  5DZ7 A;  2HQG A;  2HNY A;  3DHX A;  3RW6 A;  3Q83 A;  5LSL A;  3W2W A;  4YUD A;  4QWB A;  3G6Y A;  1TFY A;  3KLF B;  4YY3 J;  3W2V B;  1YRU A;  2BKN A;  4U67 Q;  3JYT A;  1MLA A;  3RAQ A;  4FKX A;  3MAA A;  4CO0 A;  1QJH A;  3ZTS A;  2CNO B;  2MJU A;  4DFM A;  1JLA A;  2ATC B;  2XMM A;  4TY8 B;  3BO4 A;  1FE4 A;  2PO4 A;  1UZD A;  4G65 A;  5EX3 A;  3W64 A;  3MUM P;  3LUY A;  1H7W A;  4IUF A;  2G0J A;  3WX8 A;  5B0A A;  2LU2 A;  3CJ4 A;  1F6T A;  3UWT A;  1WWH A;  3I96 A;  2KH9 A;  1S9E B;  4Q0B B;  4WZM A;  3CCW A;  1U02 A;  2ILY A;  3OFE A;  2NXJ A;  4PWD A;  2XO7 A;  3KMQ A;  2R42 A;  3Q23 A;  1JLC A;  4I64 A;  2Y0B B;  2EBE A;  3HHL A;  4DR3 F;  4ECQ A;  1BUX A;  4N77 A;  4O3P A;  4J9M A;  1SJQ A;  2HNZ B;  4F2R A;  3EGZ A;  2DNG A;  4EZ6 A;  1YHQ S;  2G13 A;  2DEI A;  5IT0 A;  3J80 Y;  4DF4 A;  3UCZ P;  2R7S A;  3FCW A;  4M5N A;  4B9S A;  2JFK A;  4X62 J;  1U0H A;  4NAS A;  2MKC A;  2O67 A;  4ZCK A;  2JVO A;  2OMO A;  4RW4 A;  3D66 A;  5F0U A;  1K73 T;  4UOH A;  4OLP A;  5L1I A;  5DDQ C;  1TP7 A;  2ZVI A;  2BOA A;  3SSS A;  4TKT A;  2DHG A;  1XNQ F;  2B0G A;  3EE3 A;  3O6Q A;  2HVH A;  3A8E A;  1P1L A;  5HAN A;  3HVW A;  1HR0 F;  3D68 A;  4LIW A;  5T41 A;  4B17 A;  4AYB D;  3I0S A;  2Y1I A;  4MMO A;  4J5O A;  2I9S A;  3PR5 B;  1D8Y A;  2ZBI A;  3TYT A;  3OL6 A;  2BJ1 A;  4DX8 H;  3DXS X;  1NJW A;  4WXO A;  3D9B A;  4OI2 A;  2UUA J;  2GMJ A;  2OTJ S;  5B0C A;  4KR0 B;  2QL7 B;  2GGP B;  3KLF A;  3W2V A;  1I6J A;  3CCU S;  4LRC A;  1HBM B;  1XC9 A;  4MIA A;  2V0N A;  2VA2 A;  4GC6 A;  4KGZ B;  4DR1 J;  1KS2 A;  4NLS A;  2VC1 A;  4TY8 A;  4TN2 A;  5ETM A;  2PA8 D;  1IBC B;  3DM2 B;  4YN3 B;  2LVW A;  2QLX A;  3MOZ A;  3EXY A;  1J5E J;  2GAG C;  1S9E A;  2Z58 B;  4Q0B A;  2K3I A;  2OGU A;  3MF5 A;  2R2U A;  3TOQ A;  3ZZY A;  3NAH A;  5KT7 A;  1AXQ A;  2KT2 A;  2CQ0 A;  4OX8 A;  1DQ9 A;  3HKW A;  2EKN A;  2CRL A;  4UST A;  1FXD A;  2ZIT A;  1HWU A;  2HNZ A;  2ROG A;  4KFB B;  4B08 A;  1FTC A;  2HHQ A;  1JLG B;  4PG4 A;  2DNQ A;  1CJU B;  1DJ0 A;  1VFJ A;  4RW6 B;  3CCJ S;  1NBE B;  3CJ0 A;  2MQP A;  3D1Q A;  5DS7 A;  5LM7 E;  2YX4 A;  1S10 A;  2C1E B;  5H1S V;  2XLJ A;  2KFN A;  3LPE A;  3CJT A;  1T0T V;  1U1O A;  1AFI A;  5ADZ A;  4MYU A;  3DU6 A;  4A8W A;  2CJK A;  3SCK E;  2J0X A;  5KFK A;  1I1G A;  4GVB B;  3OLB A;  2VFR A;  2CJQ A;  1EKR A;  3SCI E;  3EGV A;  4IH6 A;  2XMJ A;  2OTL S;  1N0U A;  1EIY B;  2XY5 A;  1J5O B;  1HWL A;  3I55 S;  1EET B;  3EM1 A;  2DO0 A;  3RW7 A;  5HK4 A;  1RI7 A;  2F8H A;  4UQT A;  1DFD A;  3TAP A;  3T1A A;  2WAQ D;  3AD9 C;  3IAS 9;  3FSI A;  2DGO A;  2J9C A;  1R6Y A;  1N34 J;  2GGP A;  1S0M A;  2DCL A;  2YBV A;  3R5J B;  2IRY A;  1VJQ A;  1HBM A;  1RBO B;  3QRR A;  1M0S A;  2MQ8 A;  4NLY A;  2YWH A;  3K89 A;  4XDC A;  2F4F A;  5KFL A;  1P27 B;  2W2P P;  1OO0 B;  3KUH A;  1ZH5 A;  1RBL A;  3FEZ A;  4C3L A;  1SKS A;  1YWX A;  2YPZ A;  4EU0 A;  2QYC A;  2QSF A;  1DHM A;  3DM2 A;  5AE1 A;  4Y2K A;  5CXT A;  1T02 A;  3MEE B;  5DM6 Q;  3S8S A;  3EWG A;  2JEF A;  1X4F A;  5DJB A;  1NJI T;  3MMA B;  2NUH A;  3TZY A;  2GC8 A;  1NB7 A;  4F4Y A;  5AXL A;  3OUY B;  5CZV A;  4NML A;  5KTQ A;  1NKC A;  5CD4 A;  1NU4 A;  2WBR A;  5KFP A;  2ACY A;  2IVM A;  2QFJ A;  1IKV B;  4ZVH A;  4KFB A;  2YQ0 A;  2ZBP A;  4KHP F;  4WP3 A;  1JLG A;  2WTF A;  4LMZ A;  3MM8 B;  2LQ9 A;  1CJU A;  2PGC A;  4RW6 A;  4FN5 A;  2E9Z A;  2DGQ A;  2AJQ A;  1OIA A;  3HVT B;  1HI1 A;  5EUH A;  2M70 A;  5HSP A;  2C2D A;  2HSE B;  1WTB A;  1HNX F;  3R5B A;  1VLY A;  4F7V A;  3NS5 A;  4DV0 F;  4I56 A;  5HRO B;  1QAJ A;  2MLY A;  3THT A;  4AE5 A;  1VQ4 S;  4GVB A;  2ZWO A;  4GMK A;  3A1Y G;  5HAO A;  2VPW B;  3PYD A;  3OTE A;  4ENO A;  2UP1 A;  3EYZ A;  5BR8 F;  2R4F A;  2BJ7 A;  1AZS B;  3F56 A;  4NCG B;  2IAJ B;  4ZS6 A;  4B02 A;  1J5O A;  1RCO B;  4KGV B;  1AT1 B;  2K06 A;  1EET A;  4ECZ A;  1L5U A;  1XMO J;  4TNO A;  1UWB B;  4WFB Q;  3V6D B;  4NXM F;  2EG1 A;  3BDP A;  1TKZ A;  3QJJ A;  1Y10 A;  2DEJ A;  3W60 A;  4KH0 B;  4PAB A;  2VG6 B;  1FJG F;  3JAM Y;  3UI3 A;  4ITS A;  2P6S A;  2Y0S D;  4HHU A;  3FZB A;  4NYO A;  1S6Q B;  1NUE A;  3HT3 A;  2E7W A;  2CFX A;  1QUV A;  1KLN A;  1M5V C;  3LP1 B;  4KGM A;  4M5I A;  1RYR A;  1TL7 B;  1Q5V A;  4JV0 A;  5IXU A;  1LWC B;  2W1B A;  4DV5 J;  4B9N A;  4M8L A;  4I4B A;  4C48 A;  2FB0 A;  5A2Q Y;  3MEE A;  3EGN A;  3ZC4 A;  5DZ6 A;  1RGV A;  2VF3 A;  3MMA A;  2VG7 B;  1XMQ F;  2ROE A;  1NSA A;  3ZNJ 1;  3OUY A;  4DV4 F;  1PG5 B;  3CJS A;  5F8G A;  3FMW A;  2ZM6 F;  3UD4 P;  1FX2 A;  1C0U B;  2JX2 A;  2Z57 B;  2K2P A;  1IKW B;  1IKV A;  3HXM A;  4NI2 B;  3TUZ C;  4DPW A;  3TVK A;  2EK6 A;  1RA7 A;  1VLO A;  3MM8 A;  4RBV A;  2KKH A;  3QJP A;  4LFA J;  2OD4 A;  3LW5 C;  4ZPB A;  3KYL A;  5IT9 Y;  1PAE X;  3QZ7 A;  2FGC A;  5EX0 A;  1XNR J;  1VBX A;  3HVT A;  2HKE A;  4OHZ A;  2V8D A;  2MY8 A;  3V6J A;  3NS7 B;  3CCS S;  4V1A k;  2KI2 A;  2KN4 A;  4FF1 A;  5HRO A;  3HO1 A;  2G9O A;  1YTY A;  2OSQ A;  2YPY A;  2VQE F;  2B4P A;  2BQR A;  1NH8 A;  2FJE B;  4QOT A;  4CT9 A;  3W5Y A;  3CWJ A;  4IKA A;  4Q43 A;  1AZS A;  4NCG A;  2IAJ A;  4ZCL A;  2HZC A;  4LF1 A;  2VQF F;  2QFI A;  2UXD J;  1IJE B;  1U8W A;  2EFN A;  3K5P A;  1UWB A;  2DGT A;  3V6D A;  1P9Q C;  1CG2 A;  5A76 A;  3V5R A;  2JLF A;  3CVK A;  2G4B A;  4MKV A;  2J6T A;  4WIQ A;  4AL6 A;  1C1B B;  2VG6 A;  3TUJ C;  3JTO A;  3V6H A;  2KT3 A;  5EWE A;  2FVP A;  1J27 A;  4CLT A;  1S6Q A;  3SSQ A;  4OYA A;  3H25 A;  3GB0 A;  1FJE B;  1AUS L;  4ZVF A;  5F8I A;  2L41 A;  2HHH J;  1N0V C;  3O8W A;  4P74 A;  3LP1 A;  2ZVS A;  5E41 A;  2VFU A;  3DLH A;  1TL7 A;  4M5M A;  1LWC A;  3TA2 A;  4LSN B;  2B4V A;  4UF4 A;  1RBA A;  2CXE A;  2HBY B;  2FTR A;  2ASJ A;  1DQ8 A;  3HD1 A;  4PG7 A;  1U2C A;  4DUY J;  4KE5 A;  4F4A A;  2VG7 A;  3MCO A;  2RE1 A;  4PUO B;  2OSR A;  4LF6 J;  4CM0 A;  1NCL A;  3D0I E;  1C0U A;  1NLK L;  3K59 A;  1T03 B;  3D0H E;  2DRB A;  1IKW A;  4NI2 A;  1E6V B;  2ILZ A;  2JZ5 A;  4OZJ A;  4PG5 A;  1Y3K A;  1RLC L;  4LF4 F;  4DX6 A;  3VTI A;  3VAH A;  2RB7 A;  2QL9 B;  4U7C A;  3BF4 A;  3BPS P;  3TJ8 A;  1YRX A;  2BW7 A;  4M94 A;  3P3D A;  4CO2 A;  1LEO A;  4YP3 A;  4H4K A;  3L95 X;  3KJQ B;  5J2P B;  2DVI A;  4DSI A;  5K8P A;  1HBU B;  1KD1 T;  4Y2A A;  2AX1 A;  2UV8 A;  3CUN A;  1JNZ B;  2HFS A;  3D4J A;  3QIP B;  4I67 A;  4DQR A;  1LW2 B;  2GHW A;  2FHO B;  5GAG U;  1F60 B;  1Q8L A;  4CLZ A;  3DOL B;  4GKJ F;  1S4E A;  2BE7 D;  2C2K B;  2N7Y A;  3OR2 B;  4JV5 J;  2YKO A;  2FJV A;  5KFE A;  2ZHO A;  1WOO A;  3R6G B;  3GIK A;  1C1B A;  4IH7 A;  1YZ6 A;  3M9N B;  2CQI A;  2E5J A;  5K8O A;  3O5T B;  3RG6 A;  3M05 A;  3CDU A;  1NDP A;  2CUY A;  2KT5 A;  1DTQ B;  3OPK A;  5I42 B;  3C15 B;  1A0O B;  3VGT A;  2DR6 A;  4KHR A;  4ZVG A;  2G0C A;  2W2N P;  4LBP A;  3RJM B;  4NLQ A;  1MMD A;  2CJ9 A;  1VQL S;  4DV3 F;  2ZHA A;  2ZOG A;  3AQP A;  3SQO P;  4J9O A;  4IRC A;  4FS2 A;  4LSN A;  1WOS A;  4WF9 Q;  3ULH A;  5IWA J;  3GFX A;  4CRJ A;  1ZPW X;  1QUP A;  2F5G A;  1NZ8 A;  2ZH9 A;  2N3O A;  2QA4 S;  2GW8 A;  1FRI A;  4PUO A;  2FVQ A;  3HLU A;  2D3U A;  3NOC A;  2R7T A;  4BC7 A;  1T03 A;  3PRV A;  1E6V A;  4QYR A;  1RK8 A;  4OI4 A;  2ZHB A;  3VGV A;  1X4H A;  3CCM S;  4PQA A;  3LWM A;  4RU9 A;  3JSY A;  3DLG B;  2MHE A;  5KG6 A;  4LSZ B;  1S6P A;  5L8R C;  3UD3 P;  1B70 B;  2RML A;  1PGZ A;  1R0B G;  3TR5 A;  3OHB A;  1KR4 A;  5J2P A;  1APS A;  2CJX B;  5LMU J;  2RSQ A;  3QZ8 A;  2VFS A;  2BV3 A;  1X9M A;  1S1V B;  2IDL A;  2XGQ A;  1HBU A;  5IQ6 A;  1ELO A;  1L3T A;  2M9K A;  4H54 A;  5BJR A;  4ZCM A;  1TKT B;  1W2B R;  2JLE A;  2QX0 A;  4DV2 J;  3QIP A;  1LW2 A;  3BBB A;  1S77 D;  2W4C A;  4IH5 A;  3DOL A;  4RPF A;  3G9C A;  2IM2 A;  1OSD A;  2B8P A;  2X1A A;  1YVF A;  5L39 A;  4QYZ K;  2VBW A;  3OR2 A;  1S97 A;  2UUC F;  4KH1 B;  5EWG A;  1RHJ B;  2JRS A;  3M32 B;  3FGV A;  1MSW D;  3GIL A;  2MZR A;  2KJV A;  2IY5 B;  2CPX A;  3EZ5 A;  3HHL C;  1FRK A;  3AH6 A;  1JB0 C;  3BQ0 A;  3FBC A;  3VVT A;  3E51 A;  4OQJ A;  4DL7 A;  1IR1 A;  1SC4 B;  3BYP A;  1DTQ A;  2VH7 A;  5I42 A;  2ZC3 A;  2IBK A;  2UZA A;  3C15 A;  4CO5 A;  4JI5 J;  2CAD A;  4ECR A;  3GJR B;  2C3U A;  3DLJ A;  2M7S A;  3SBM A;  4UOG A;  1HNW J;  5BXI A;  1XJW B;  2OML A;  1VIO A;  3MTK A;  1QLN A;  4RO0 A;  1N5Y B;  1T3N A;  2VUG A;  1XN9 A;  5LOQ A;  1M1K T;  3NY0 A;  3CSK A;  5ETV A;  2QLW A;  4OHY A;  2LLZ A;  3W5X A;  4CO4 A;  4Y65 A;  1FHT A;  5HVH A;  2KFZ A;  2AYE A;  3E2E A;  1Y0H A;  2BM1 A;  4X4N A;  3MZI A;  2QIF A;  2DIV A;  2LCW A;  4LF8 F;  3L4B C;  2VC0 A;  2BQ3 A;  4JB8 B;  1LKZ A;  5KG2 A;  2VBZ A;  3NP5 A;  1U8S A;  3LH2 S;  4KC5 A;  2ZDO A;  2AJ0 A;  4BS2 A;  2VL1 A;  3DLG A;  3CPW R;  5D0E A;  3J7Z T;  3H59 A;  4F4K A;  4HT7 A;  3J81 U;  1WC5 A;  3U7J A;  4NYZ A;  2A0F B;  3CUL A;  2WB4 A;  1PAU B;  1XWL A;  3AFG A;  4FYD A;  3GII A;  2O1P A;  3CMQ A;  1VQY A;  2YKN B;  4TLR A;  4AL5 A;  1MW7 A;  1U1N A;  1CC7 A;  1S1V A;  1H3D A;  2YH1 A;  3FEY B;  5IT4 A;  3BSO A;  1Y3J A;  1NK5 A;  5HQ8 A;  1TKT A;  1P9Y A;  2XC9 A;  2ERR A;  1V3Z A;  1HNZ F;  3IBF B;  6AT1 B;  4K5R A;  2Y3Y A;  4S0M A;  2BJ9 A;  3BDE A;  3MAQ A;  4JI1 F;  1OYD A;  3R9L A;  1U1L A;  1D9D A;  3IG1 B;  4DS5 A;  2C2Z B;  1WEX A;  3TRG A;  3RGI A;  5D4N A;  4X4U A;  1XTZ A;  1CLF A;  2WOM B;  4D3H A;  2NXU A;  1RUS A;  3PW5 A;  2JJ4 D;  3LP0 B;  3M32 A;  2F63 A;  4H4M B;  3S1T A;  1O8B A;  2WVB A;  3ET6 B;  4X66 J;  1DQA A;  3DYA B;  3LAK A;  2WVC A;  4LSL B;  4ZPC A;  3UNY A;  2N7C A;  4HLB A;  4OMF G;  4ES3 A;  3BYR A;  4LUB A;  3K7R A;  2FQQ B;  4ZCI A;  2HK2 A;  4P71 A;  4O23 A;  4DSL A;  1TKD A;  5HMW A;  4A8F A;  2OIH A;  1N5Y A;  4DPT A;  1UMJ A;  5D78 A;  4X64 F;  2XI3 A;  5D0G A;  3M8Y A;  2JDJ A;  3MWB A;  3DRR B;  5KG4 A;  3MR5 A;  2DNZ A;  3VZI A;  3LGM A;  2AKW B;  2IVY A;  1OY9 A;  1YZ7 A;  4GKK J;  3GSI A;  1Q0N A;  4B3R J;  1ARO P;  4C0H A;  1N36 J;  4NEY A;  2HBQ B;  3ZZZ A;  3VAJ A;  2DNK A;  2AMC B;  3QID A;  5JUM A;  1Q95 G;  3IR7 B;  2F9D A;  2EKY A;  1BQM B;  2F8M A;  3ENA A;  2AYB A;  3ENV A;  4DSF A;  4C8O A;  3CDE A;  2RQK A;  5FD1 A;  2YKN A;  5J1P A;  1YGY A;  4FVC A;  2ZNY A;  1T9X A;  3G71 S;  2MKY A;  1RT2 B;  2IC3 B;  2CQG A;  4X2B A;  1QAY A;  3AA8 A;  3T5K A;  1TVR B;  3M8S A;  4NXN J;  1B3T A;  1PIL A;  4DFP A;  4XO0 A;  3CIM A;  4J9L A;  1CJT B;  1RWU A;  1IQT A;  4WP8 A;  2G2Y A;  4ZLL A;  2VD3 A;  2W7A A;  3ISN D;  3IG1 A;  3A3P B;  4IQX A;  5D4P A;  3NNC A;  3HUL A;  3ILJ A;  4IDK B;  1UJ4 A;  2VOD A;  2WOM A;  5HMZ A;  1U1R A;  4NLR A;  3LP0 A;  3CC2 S;  3ZXW A;  4H4M A;  2V2V A;  3ET6 A;  5K20 B;  3DYA A;  4DN9 A;  4DPY A;  4ZVQ B;  1YIT S;  2BRL A;  4LSL A;  4YB1 P;  3LQV A;  3I4P A;  2HLU A;  4ILL A;  1RTH B;  2GIR A;  4ZA1 A;  3OFF A;  1FKA F;  2AJ2 A;  5B0B A;  4UT4 A;  1N32 J;  4R25 A;  3R97 A;  1KQK A;  1O6X A;  4WTY A;  3CD0 A;  3HFV A;  3BH6 B;  3MMC B;  1TL5 A;  1F2H A;  2H54 B;  1T11 A;  1WDD A;  2R8K A;  2K3K A;  3BGR B;  3WZ0 A;  4RWW A;  3GWC A;  3WHI A;  4IFV B;  1XER A;  1SQF A;  2DGX A;  4ZK7 M;  1T9Y A;  1OY6 A;  2X3G A;  3DRR A;  4ZVU B;  1S99 A;  2XG8 A;  2ZH2 A;  2YKA A;  5CYJ A;  3BN4 A;  3ONQ A;  3TA0 A;  3L09 A;  4CLK A;  2M88 A;  1HWJ A;  4OLO A;  3HSZ A;  5IFM A;  3TX0 A;  4N41 A;  3DC2 A;  2KG1 A;  1RT3 B;  2YKP A;  3RBZ A;  2PEB A;  4QW8 A;  5KAK A;  1ZA2 B;  1GXT A;  2FHJ A;  2ALZ A;  1RSC A;  1BQM A;  3MTJ A;  5HQM A;  3BV8 A;  4X4S A;  4PXC A;  1HQ2 A;  1URN A;  5KOW A;  2LEP A;  2RDI A;  1U4B A;  4W90 B;  5KFA A;  3MXH P;  2D3Z A;  3MPU B;  1RT2 A;  2IC3 A;  3GTY X;  4PCQ A;  4Q44 A;  2JFD A;  4MTP A;  1TVR A;  2J9E A;  4OYI A;  3ZZT A;  3FEX B;  4J9P A;  1I5O B;  2ZJQ Q;  3FDS A;  1IKX B;  4IQM A;  1CJT A;  3SI8 A;  3J81 j;  3QAU A;  3QBC A;  4F36 A;  4LIR A;  4B3S F;  3IGV A;  4ZVO B;  4L3K A;  1U48 A;  3UDV A;  3BB5 A;  4IDK A;  3HX9 A;  2DRA A;  4DG1 B;  4USU A;  4JI0 F;  3SFU A;  3N79 A;  4XPE A;  2CJY B;  4ES1 A;  1H7X A;  2A10 A;  4IO1 A;  2UVW A;  2J0W A;  2A18 A;  1RTH A;  5DDO C;  5L38 A;  2MZ1 A;  2ASD A;  4DR3 J;  1QD1 A;  1UL3 A;  3R5G A;  3PCO B;  5IOL A;  3MMC A;  1SCJ B;  2M0G B;  1GTH A;  3WQP A;  2H3E B;  3K5O A;  2QC3 A;  1Z2Z A;  3BGR A;  2XTJ P;  4RJV A;  3NGK A;  1GH8 A;  2Q6C A;  4IFV A;  2AJ1 A;  2M2B A;  1QDU B;  2U2F A;  2AGO A;  3PHE A;  1JXE A;  1D1U A;  2ZH3 A;  4JI3 F;  2CNL B;  1NEE A;  4DLE A;  5KFF A;  4WK1 A;  1JLQ B;  2QGF B;  3BQ2 A;  4QWE A;  2MLZ A;  3PNI A;  1FJC A;  4GO5 X;  3GJQ B;  4EGL A;  2PT0 A;  2FC9 A;  3KG1 A;  1V5I B;  2YX1 A;  3V4M A;  2PFD A;  4ZN3 A;  2EK1 A;  1P8G A;  4IR1 A;  4RBT A;  2HQC A;  1ULR A;  1XNQ J;  2R8J A;  1RT3 A;  4CH0 S;  2LEB A;  2AHO B;  4KYZ A;  3UDC A;  4WFX A;  3D28 A;  1C1C A;  2JEI A;  5HAT A;  1HR0 J;  4CT8 A;  4RX6 A;  4YOE A;  3T6J A;  4JI4 F;  5E5N A;  3Q89 A;  4C2M A;  2W01 A;  1U6Z A;  4OFZ A;  3OVS A;  2XM3 A;  1D8Z A;  4L6V 3;  1SJR A;  4DR2 F;  2DO4 A;  2Z30 B;  4PXD A;  2DH8 A;  1X31 C;  3MR7 A;  1WG5 A;  3FCV A;  2IHR 1;  2DHS A;  4K2X A;  4CO3 A;  3W5Z A;  1HBN B;  1WJ9 A;  5HO4 A;  1N5S A;  4QU7 A;  1IKX A;  3NWG A;  3GP9 A;  3VZH A;  5C7P A;  3PIO Q;  1WF2 A;  2V50 A;  3J7Z 5;  4RW7 B;  2XZD B;  4KAI A;  4DX5 A;  2W8K A;  5E3A A;  2H5I B;  4C0O C;  3UFC X;  1Q81 T;  3GR1 A;  3MUR P;  2HQF A;  3G4S S;  4NLG A;  2NUU G;  2CJB A;  3C46 A;  4DG1 A;  2WVE A;  1LWF A;  1RWP B;  1GK8 A;  1FFS B;  3KUE A;  2GHV C;  1CSJ A;  5ETR A;  3UD5 A;  3CD5 A;  2WB1 D;  1C0T B;  1VQS A;  1VK3 A;  2XCA A;  2CWK A;  5F3T A;  1M1H A;  3TAN A;  4ECV A;  3PFO A;  4KGK A;  4MYT A;  2NPF A;  1FDB A;  1VR6 A;  2VON A;  2QA1 A;  4LF7 F;  5ETS A;  3CT9 A;  1N33 F;  3M2R B;  1VI7 A;  5D4L A;  1BWV A;  2XMU A;  5KFH A;  2OO4 A;  2CPZ A;  3R1H A;  1WHX A;  3B8H A;  2DK2 A;  5D15 A;  4BWJ A;  1FXL A;  2HFN A;  1YDL A;  4CH1 A;  4H4K C;  2K1R B;  4BDP A;  1FD2 A;  2KM8 C;  2V9K A;  4ED1 A;  3K8W A;  4C7Q A;  2IBO A;  3KK3 B;  1TR0 A;  1JLQ A;  4PXB A;  1TL4 A;  4A8M P;  2Y1R I;  3BKT A;  2UV8 G;  2V8H A;  3NGR A;  4LVO P;  2HFU A;  1R0A B;  1PO6 A;  1HPZ B;  4UY8 T;  1G1X A;  3E3X A;  1TL3 B;  5IV4 A;  1F3V A;  4DN0 A;  2RIJ A;  2R8G A;  1WF1 A;  4HH0 A;  3ZNU A;  3HVR A;  3BBC A;  4OYP A;  3GFZ A;  2BE2 B;  3PJW A;  3N5F A;  3G6X A;  3CJR A;  2B4O A;  1YJW S;  3PYE A;  1JLF B;  2DPI A;  2ZBC A;  4F26 A;  1HD1 A;  4WE1 B;  5KFM A;  1MNE A;  2VOP A;  2HFO A;  2LYV A;  2PI5 A;  5C25 B;  3PRD A;  1FJ7 A;  4IFY B;  4OYX A;  3EZO A;  1JJH A;  3CB4 A;  1SJ4 P;  2FYX A;  3FSX A;  4PR6 A;  1WNE A;  2XSF A;  3KTQ A;  5D0H A;  1HBN A;  4N8N A;  2ZH6 A;  2Z2M A;  3G96 A;  5HLF B;  2RIL A;  2AIR B;  4QJV A;  2P9C A;  4RW7 A;  2EPI A;  4X4P A;  2MMY A;  3O1L A;  1NJY A;  1T9T A;  3CC7 S;  5IC4 B;  3M6X A;  4P9S A;  4Y00 A;  4NYP A;  2KVI A;  4C4W A;  1UJ5 A;  1FRH A;  4FF4 A;  3VHQ A;  1FT8 A;  4B3T F;  1S1X B;  3IO1 A;  3G87 A;  1JQG A;  1C0T A;  3CJ3 A;  3UW1 A;  1C2P A;  4TU9 A;  4LFB F;  4LF5 F;  2KXH A;  3D0G E;  1CC8 A;  4FZV A;  3PEH A;  3VF0 B;  1KFD A;  2DTJ A;  2VFV A;  3U1L A;  2KG0 A;  1K1S A;  1JLB B;  4KHP J;  4K5S A;  2V4R A;  3POT B;  3M2R A;  4JYA F;  4F25 A;  1FE0 A;  2W24 A;  3CJ2 A;  3TW0 A;  4UTG A;  1VRU A;  2H5E A;  2K1R A;  4ZKA A;  3ADA C;  1RTZ A;  3KK3 A;  2W2M P;  1HNX J;  2DD8 S;  4DV0 J;  2UXB F;  1TMJ A;  2HUR A;  4AND A;  3AD8 C;  2J6S A;  2UVV A;  3D7S B;  3NCR A;  2RAQ A;  1R0A A;  4RW8 B;  4N8O A;  1RQ0 A;  1HPZ A;  1TL3 A;  2G2O A;  2L3M A;  3OL9 A;  1NPR A;  4B9U A;  4ZN1 A;  2HHV A;  1LW0 B;  3S01 A;  2BE2 A;  2JVR A;  4ZVR B;  1YIJ S;  5BR8 J;  1OSC A;  1SIZ A;  2CZV C;  4ZP7 A;  2ZC4 A;  1JLF A;  2FD2 A;  3LTO A;  2V8P A;  3VGU A;  1X7V A;  2HRY A;  4WE1 A;  2I6W A;  4KSE B;  3UE2 A;  3KOA A;  4NXM J;  5ETO A;  4ZHR B;  5C25 A;  1V9O A;  4PG6 A;  4IFY A;  4K4Y A;  2RQM A;  2IIH A;  3UDL A;  2IA0 A;  2MZQ A;  3OW2 R;  3L7U A;  2B9X A;  1FJG J;  2GO9 A;  3T1H F;  3QO9 B;  3ILO A;  4P2X A;  5HLF A;  4P75 A;  1NSK L;  1RCX B;  4G1I A;  4USM A;  3RUB L;  4LRB A;  4LQ3 A;  4ZPW R;  3T5J A;  2WON B;  1SJ3 P;  4NRT A;  3N0V A;  2Z0G A;  4DL3 A;  5GVQ A;  1U45 A;  2OP5 A;  3PM9 A;  3GYG A;  2AEM A;  2OKQ A;  2E9R X;  4DR6 F;  3FBE A;  3I82 A;  1S1X A;  2LXF A;  1V6H A;  2D3O R;  3H0P A;  3I6P A;  1IM4 A;  3GSD A;  4OV1 A;  3AQO A;  4MIW A;  3IRW P;  4JI6 F;  4E2F B;  2JLG A;  1XMQ J;  1CJK B;  2M3D A;  4NCA A;  3VAK A;  4DV4 J;  2ZM6 J;  2RU9 A;  1B4S A;  3KDN A;  1JLB A;  1SC6 A;  2ZFH A;  4N5S A;  2MQN A;  4PPZ A;  2AGP A;  1NK9 A;  4P73 A;  3NGS A;  1Q8K A;  3POT A;  5HN0 A;  2LEC A;  5J1E B;  2ZJP Q;  2K7J A;  3WC0 A;  1U6F A;  1I94 F;  5IM0 B;  3PJX A;  4F02 A;  1NND A;  5LXY A;  2V8V A;  4N7T A;  2FLP A;  4NZ6 A;  1NK8 A;  1DZ5 A;  4G6V B;  3GIJ A;  2FZC B;  2VQE J;  4EYH B;  4M95 A;  1B0T A;  4RW8 A;  1Q78 A;  1R3N A;  1LW0 A;  2XO6 A;  2OHD A;  3ZZR A;  3JS9 A;  1YBT A;  4OZ2 A;  3GON A;  1W25 A;  1CUL B;  5CAA A;  1SPB P;  3S6E A;  4OI1 A;  4ECT A;  2VQF J;  4DR5 F;  1JWW A;  4EBD A;  4O3O A;  1XBW A;  2H4W B;  4ID8 A;  2A6O A;  4ZHR A;  1GQE A;  1S1T B;  2KZZ A;  5JVH Q;  4Z37 A;  4ZIT A;  4ED5 A;  1PSD A;  3ZZU A;  3PDN A;  3QO9 A;  4FVM A;  4ERD A;  4RU2 A;  4OI0 A;  1ZET A;  3FSY A;  4C98 A;  2FLO A;  5F8J A;  3TI0 A;  3TNV A;  5K8N A;  2W9A A;  4V19 J;  2L9D A;  2LKZ A;  2C2E A;  2BJE A;  2WON A;  3B4M A;  3PX4 A;  1XQI A;  4IRK A;  1SH0 A;  1VQM S;  2CPI A;  4ZJL A;  1IBK F;  3AOB A;  1SXL A;  4EZ9 A;  4WYW A;  1HLW A;  4ZP8 A;  5C5J A;  3R7N B;  4K4V A;  5E33 A;  4OHV A;  4ILR A;  1CJK A;  5GAE U;  4W92 B;  1JJ4 A;  2PI4 A;  3K17 A;  4ANE A;  1EKS A;  1Z4U A;  4HHJ A;  1RXO B;  3VAG A;  4A47 A;  2BJ3 A;  5C24 B;  4J9U E;  5J1E A;  5B08 A;  4LF4 J;  2XSJ B;  2N3L A;  5SUH A;  3EZU A;  5IM0 A;  4AXJ A;  1FDA A;  4WBF A;  5IQQ A;  5A0Y B;  1F1B B;  1HD0 A;  1SC1 B;  3HFK A;  1PIE A;  4U7U D;  2NS1 B;  4DJB A;  2IVF B;  1UW9 A;  1NPK A;  3HDS A;  1N52 B;  2EFG A;  4AUK A;  3BEG B;  2YKM B;  3NGU A;  5B7W A;  4Q2M A;  4XPC A;  1BQN B;  3F41 A;  2OPS B;  4ED3 A;  2IYG A;  2FLN A;  1DY3 A;  1CUL A;  1B0P A;  2ZBQ A;  2OAU A;  5U47 A;  1NDL A;  1T9U A;  3P49 B;  4J9K A;  4GKJ J;  4TYA A;  2YXL A;  4USI A;  2XQC A;  4CLF A;  2FHM A;  1K9M T;  1S1T A;  5B0G A;  3TAM B;  2HHW A;  4CH7 A;  3IM9 A;  3CMA S;  4UY8 5;  3DLK B;  3PV8 A;  2HGM A;  1D09 B;  1LWX A;  4J7C A;  2VBX A;  3C16 B;  1FWP A;  2JSX A;  2HND B;  3F73 A;  4QCL A;  4J90 A;  4CTA B;  4DI6 A;  3DKD A;  4JP8 A;  1H0H B;  2Z2L A;  1A6L A;  4E0D A;  2VKZ G;  3VVU A;  4DV3 J;  4PG8 A;  2DPJ A;  1Y11 A;  4K4T A;  3V4I B;  5KT6 A;  3I5A A;  1UZH A;  3R7S B;  3DRX A;  1FNO A;  1RAH B;  2OPP B;  2QEX S;  2RJZ A;  2FUG 9;  4HI2 A;  5I3U B;  3CGI A;  3RB6 A;  3W3S A;  2XWY A;  2QMX A;  2XEX A;  1NME B;  3OR1 B;  1REG X;  1VQP S;  4FXV A;  1MML A;  1YJR A;  4ETZ A;  3AAW B;  1R8H A;  1BQX A;  8ATC B;  3M7V A;  2W2O P;  5C24 A;  2NZ4 A;  3SV3 A;  3H42 A;  2FDN A;  2DRD A;  3HPO A;  5GAD I;  1Y7P A;  3QNW B;  2XSJ A;  1NHU A;  5K9F A;  1WHW A;  2KRB A;  5BYQ A;  2FVR A;  5J2N B;  1RWV B;  5A0Y A;  4TLQ A;  2IRU A;  2UXC F;  1CQM A;  3EVO A;  3HHK A;  3RR8 A;  1SQE A;  2GVD B;  3MM7 B;  2PMW A;  4X4R A;  2FIU A;  5KG1 A;  2YKM A;  5F8N A;  4QPX A;  4ETX A;  5DDR C;  2PC6 A;  1BQN A;  3NRB A;  1F9F A;  2KO1 A;  2OPS A;  3NAI A;  3A8I A;  3Q86 A;  3T1Y F;  1JNR B;  2QT7 A;  1WC0 A;  4WU2 A;  5DLG A;  5KFN A;  2RDJ A;  2AP6 A;  4C0B A;  4DV6 F;  4RUC A;  1KSP A;  2P9G A;  4IYQ A;  4I0W A;  5KFX A;  3E01 B;  3A3O B;  1VC0 A;  3CDA A;  3MPW A;  3HHN B;  1ZM3 A;  3TAM A;  2J0Q D;  4MKA A;  3CCL S;  2I5J B;  3J80 U;  3DLK A;  5D8H B;  2Z56 B;  1JX4 A;  1WTF A;  5KG0 A;  3C16 A;  2HFV A;  2HND A;  2L9N A;  5KFI A;  4CTA A;  2BAB A;  4KQZ A;  2ZZM A;  2EEY A;  3PKY A;  2ZH8 A;  4OHX A;  5KG5 A;  5KFB A;  5SZT A;  4ZPT R;  2UUB F;  4W4M A;  1QSS A;  5D6G A;  2RUG A;  4P6Q A;  4O3R A;  1A9N B;  3V4I A;  5H9E J;  5H9F K;  2ZH4 A;  2XWX A;  1EP4 B;  3TUI C;  3NWR A;  1F9H A;  2OPP A;  1UVL A;  3V6K A;  4KRW A;  1YBU A;  3MUV P;  2IJF A;  4LR8 A;  4FS1 A;  2HGN A;  3VQS A;  3M8P B;  5I3U A;  3W63 A;  3TEH B;  3OR1 A;  3C3L A;  2CQ3 A;  3D2W A;  1LK7 A;  4LF8 J;  2H48 B;  1VYA A;  4N76 A;  2MYF A;  1RWM B;  5GMK a;  1FI4 A;  2NXN A;  4USV A;  2COL A;  5DQG A;  5I3P A;  1SL1 A;  3TAQ A;  3FBB A;  2AU0 A;  2FJB B;  5ETQ A;  2Y9H A;  3VR1 A;  1R43 A;  5J2N A;  4YR0 A;  1VQK S;  4C97 A;  1RTI B;  1H72 C;  3D54 A;  1WEZ A;  4XDD A;  2GCF A;  4DV7 F;  2CQP A;  2YQ3 A;  1X4D A;  2GVD A;  3MM7 A;  2HVZ A;  4M5H A;  3PZP A;  2HBR B;  2NPI A;  4ZIV A;  1RZM A;  2XYP B;  1HHT P;  1QE1 B;  5HP1 B;  4U96 A;  3O44 A;  2D9O A;  2HHP A;  1HNZ J;  2NXC A;  2QRR A;  2HLT A;  2MLX A;  2C2M B;  4YB5 A;  1LQ9 A;  1NK6 A;  4HR2 A;  3OTB A;  4JI1 J;  1RT6 B;  4URQ U;  5KFS A;  3BH7 B;  1VQ9 S;  2QO3 A;  2KZM A;  2DNL A;  2O01 C;  3E01 A;  2DHA A;  3SYZ A;  4ATN A;  1FCA A;  1SKR A;  3H90 A;  1KQS R;  2E1P A;  2I5J A;  3FC9 A;  3QSY B;  3R2D J;  2J7K A;  1U7L A;  1NKB A;  1S6O A;  2J7U A;  4ZDN A;  1ZZF A;  1T05 B;  4L76 A;  2FVC A;  2LP4 A;  9ATC B;  2H65 B;  3ZTO A;  1RAO A;  2CIM A;  5AXK A;  4IG3 B;  5AXN A;  2IPO B;  5CYM B;  3MED B;  4QZV B;  2W7P A;  3TVZ A;  1WUU A;  4URS A;  5KT2 A;  4DR7 F;  1SQG A;  1XMB A;  4NLV A;  4NRU A;  2CPD A;  4CIO A;  1M5S A;  2MQL A;  2BOP A;  2HQ3 A;  4QIV A;  2CG4 A;  1EP4 A;  1LXN A;  5ETL A;  4DCP B;  4DSJ A;  5I4M A;  1UA0 A;  3M8P A;  4HYK A;  4K7Q A;  1ZAW A;  1SL0 A;  3AJ2 A;  3OJU A;  1ZS6 A;  1N54 B;  3G8S A;  1B7F A;  4JV5 F;  4IRD A;  3CO9 A;  3M8R A;  2KDO A;  4ZPD A;  1FEE A;  4K2J A;  2NCK L;  1UVK A;  3RBE A;  1PC5 A;  1JKH B;  1S0N A;  4AQY F;  1YJ9 S;  4M5G A;  3CDW A;  1WD6 A;  3PVX A;  4RNF A;  5A6P A;  4B3O B;  1KBR A;  2QLF B;  2R7X A;  1VOM A;  1IBL J;  1RTI A;  5THW A;  2IMW P;  1BXN A;  3FKB A;  4KT0 C;  2IJR A;  3MPY A;  5HMX A;  4G1Q B;  1VQN S;  3RTV A;  1IN0 A;  1QE1 A;  4OZL A;  3CD7 A;  4DBQ A;  5HP1 A;  4ER8 A;  4G1P A;  5IWA F;  3ETM A;  1Y4Z B;  4WKR A;  2VA3 A;  4OZ1 A;  3I32 A;  5KFT A;  3QAE A;  1VC5 A;  2DY9 A;  2E5L F;  1EB0 A;  1NSP A;  3QT7 A;  5ITH A;  5LJ3 Y;  1DRZ A;  2X7I A;  1ZTT A;  3N5B A;  3RB3 A;  1RT6 A;  2V2Q A;  2QYG A;  3OHA A;  2PMZ D;  1VIX A;  2DR9 A;  1JLE B;  2DGV A;  4I6W A;  3LWL A;  1WKK A;  2HGL A;  2U1A A;  4DL0 C;  2P9E A;  2DNM A;  4OYW A;  1FKP B;  3FCH A;  3BQ1 A;  1RDR A;  2BE9 B;  1FES A;  3S7R A;  2PFF B;  1U1K A;  1QVF R;  3HCX A;  1T05 A;  2BW2 A;  3Q8Y A;  4EK2 A;  5LJ5 Y;  2DNH A;  3CDB A;  2RRA A;  4DL2 A;  3I4H X;  4PXE A;  4K4X A;  5CYM A;  3A12 A;  1NZA A;  3MED A;  3DDK A;  3WDO A;  2YNF B;  5E3Q A;  3U27 A;  1VK8 A;  2CDQ A;  1K1Q A;  5D77 A;  2DNP A;  3W62 A;  1RT1 B;  2GA7 A;  1O51 A;  2LQ8 A;  1B64 A;  1M5O C;  4W98 A;  3PW2 A;  3FK4 A;  2R8I A;  3I5C A;  3MI7 X;  3R5D A;  3F44 A;  1WOR A;  3BBF A;  5D0R A;  2VOO A;  3QWU A;  1X4C A;  3JTP A;  3W7B A;  4X65 F;  5C42 B;  1M90 T;  4WJB A;  3R5C A;  4CCH A;  3G2X A;  1X0P A;  3SV4 A;  1TK0 A;  4ZVS B;  3JAM U;  2QSW A;  1GMV A;  3KG4 A;  1JKH A;  1SIW B;  2J6U A;  2DIS A;  3CCR S;  1G6B A;  1Q4R A;  4ALZ A;  4B3O A;  5AE2 A;  1ZAV A;  4DR4 J;  6FD1 A;  2HW3 A;  3D67 A;  3QWP A;  3N28 A;  3HJF A;  2ROP A;  5JMN A;  3OVA A;  1TQL A;  2YNH B;  3IS9 B;  2CPJ A;  1ZAX A;  2YVS A;  2MXY A;  1H38 A;  4FYY B;  2XMV A;  1NJX A;  2ACM A;  4G1Q A;  3OBI A;  1ZM2 A;  5A2Q U;  4CLL A;  2AZ1 A;  4B3M F;  1WEY A;  2CZ9 A;  4ID5 B;  2CPE A;  1T95 A;  1OMS A;  2HS3 A;  2MJN A;  2IMO A;  2N82 B;  1LK5 A;  4K59 A;  1OY8 A;  2QJ3 A;  2E7V A;  3BR8 A;  4B3S J;  2MB0 B;  1Q5Y A;  1JLE A;  2AGQ A;  3IR5 B;  4J91 A;  1RAE B;  3GYX B;  3EGW B;  3HKZ D;  3OLA A;  4XIU A;  5IT9 U;  1FKP A;  4CLY A;  4JI0 J;  2V67 A;  4P10 A;  1N5V A;  3VAM A;  4DWI A;  3J7A N;  4M5K A;  2DR5 A;  3V2U C;  1PC4 A;  3UNG C;  1SV5 B;  2KXF A;  4M63 A;  4ECU A;  7AT1 B;  4E98 A;  5AJ3 F;  2YNF A;  4JI8 F;  1TK8 A;  2Y1J A;  2OEM A;  1TUG B;  1RT1 A;  1UVN A;  4DSK A;  1HYS B;  2KRR A;  4YEA A;  5HVF A;  4FP9 A;  5MLC V;  3T3F A;  2KM8 B;  1BE4 A;  1KN6 A;  3CCZ A;  4JI3 J;  2H5J B;  3H5S A;  2CQH A;  5KFR A;  2HMI B;  5C42 A;  2RD5 C;  1J2V A;  1M5K C;  1R31 A;  2B7B B;  2IYI A;  2HWT A;  4NOH A;  5LT5 A;  1S12 A;  1U1M A;  3VGS A;  5CA5 A;  1ZOT A;  2MDA A;  3HF5 A;  4A8K A;  2ZH1 A;  2ZUG A;  3BKF A;  2DXD A;  5KFV A;  4LF9 F;  3AJ1 A;  5KFY A;  4DFJ A;  2KU7 A;  4JI4 J;  4EEY A;  3QFH A;  2GJF A;  2GJI A;  3MD3 A;  2G1H A;  1K47 A;  3MUT P;  2YNH A;  1HL6 A;  3IS9 A;  1V3S A;  4BWM A;  4DR2 J;  2CWX A;  2ZOF A;  4KB7 A;  3Q0A A;  3KG0 A;  2OFG X;  2YWW A;  3R2C J;  2V6A A;  1NKE A;  5CH7 B;  3C6T B;  3MFI A;  3WBZ A;  4ID5 A;  4DOZ A;  2CG8 A;  2G0I A;  3UPF A;  4DZ6 A;  3Q24 A;  4Z7Y A;  3CME S;  2MQQ A;  4WU3 A;  4DX7 A;  4ANC A;  4M5J A;  1KDN A;  2AJF E;  4OJ1 A;  1PBA A;  2P6T A;  5EDW A;  4BCA A;  1TV6 B;  2H51 B;  4GVL A;  2RF2 B;  2V2Z A;  3BGO P;  4MT1 A;  4KIA A;  1CQN A;  1WI8 A;  2RH3 A;  3JB9 k;  4PRF A;  4OYM A;  5T14 A;  1S59 A;  1SV5 A;  2LEA A;  3AOC A;  3PW7 A;  3W65 A;  3IR6 B;  3H5U A;  2GQQ A;  1TUW A;  3HP6 A;  3BO2 A;  4LF7 J;  5ETT A;  1R0C B;  3MAH A;  1N33 J;  4P2F A;  1HYS A;  3IWX A;  2VG5 B;  4CLW A;  5IV3 A;  2CPF A;  2FHK A;  5J1N A;  4RLE A;  5H9F J;  2HQI A;  2E5I A;  2BJ8 A;  3OT9 A;  2NSC A;  3UCU P;  2HMI A;  3BGL A;  4CNY A;  3C14 B;  1GAO A;  4JI7 F;  3IXQ A;  3FRZ A;  2DNO A;  3TJA A;  3M9M B;  4OIX A;  2V5H G;  3FFI B;  2MPU A;  4LRD A;  1IBM F;  4CM2 A;  1Q7L B;  3KFW X;  5B09 A;  2B9E A;  4RUH A;  1KHV A;  2YKQ A;  2EVZ A;  1RWW B;  2XI2 A;  4AFF A;  4F0H A;  3DOK B;  3PW0 A;  1RT7 B;  1NB2 A;  3Q8Q B;  3BZQ A;  1Y5I B;  2HZV A;  3W9J A;  2LXI A;  1EQM A;  4MK7 A;  3H5Y A;  3N6L A;  3PW4 A;  5FLX Y;  4I6A A;  1U49 A;  2GX8 A;  1NK0 A;  2OH2 A;  2B4U A;  3C6T A;  4EI2 A;  4USJ C;  2MKK A;  5E3R A;  2D9P A;  1BWE A;  1MWQ A;  4HDG A;  3ZZO A;  1X9S A;  3AOD A;  2HS4 A;  4DSE A;  4FF2 A;  3WIV A;  4OHW A;  4DQI A;  3SFG A;  1FWL A;  1TV6 A;  1VRT B;  2RF2 A;  2AJ4 A;  1GXL A;  1JXL A;  4PYA A;  1H2T Z;  4B3T J;  2ABY A;  1L3V A;  3K5N A;  3QSI A;  1NH7 A;  3W66 A;  4R0J A;  2MKJ A;  2ZH5 A;  1U2F A;  4LFB J;  3W8G A;  4LF5 J;  4I7F B;  3G86 A;  2RQC A;  3FRY A;  3KUG A;  4HAC B;  1IR0 A;  2HQD A;  2UUW A;  4TXS A;  1S79 A;  4Y3C A;  8AT1 B;  4WXW A;  2ZKU A;  2M52 A;  1REV B;  4JYA J;  2WW8 A;  2VG5 A;  3QGG A;  2LA6 A;  1H74 A;  3N6M A;  3DOM B;  2HYI B;  4WKY A;  3BPD A;  4ZMM A;  1MRO B;  3HI9 A;  2XLI A;  5GME A;  2WSC C;  4YHH F;  4NA3 A;  4TQS A;  5DGA A;  3SDE B;  2UXB J;  3Q8R B;  3L3C A;  3C14 A;  4NZ0 A;  4DPO A;  4Q5V A;  1HQU B;  3CCT A;  4ZPV R;  3A8J A;  2PII A;  3RRK A;  1V3R A;  1X4A A;  4USK A;  4R5P B;  4Q2L A;  3FFI A;  1RT5 B;  3NCP A;  2GS8 A;  2AD9 A;  3KLH B;  1YJT A;  4RR5 A;  2DNR A;  1VQ7 S;  2J7W A;  2YWE A;  4LFC J;  2R7O A;  4RUA A;  1FFG B;  2QN6 B;  3DOK A;  1RT7 A;  4LR9 A;  2D1C A;  1T9W A;  5LMN F;  3P8B B;  1YLX A;  3BO3 A;  2OPQ B;  5G4D A;  3K0J A;  2NR0 A;  2EW9 A;  4ECX A;  3AXM A;  2GAH C;  1S49 A;  4Q8F A;  4DS4 A;  3F0N A;  3G82 B;  1R8B A;  3T1H J;  1UPM B;  2HAI A;  2BEF A;  5HI7 A;  5KT4 A;  3KHR A;  3CC4 S;  2D7S A;  1ACM B;  1IKY B;  2F40 A;  3G6V A;  4EFA C;  1QSY A;  4OYB A;  5ETP A;  3UCG A;  3DRP B;  3PJ9 A;  2GJ2 A;  5A8W B;  2A6M A;  5KG7 A;  3NNH A;  2B5J B;  2PA3 A;  1RAG B;  3HJV A;  2KB2 A;  1VRT A;  4ZIW A;  2MGZ B;  2RHS B;  2Q79 A;  4DR6 J;  1JMT A;  4TY9 A;  2IDE A;  1AUD A;  3AOA A;  1JXV A;  4JI6 J;  2ZZN A;  2KXN B;  2PN6 A;  4I7F A;  4K4S A;  3GZ7 A;  2X1B A;  5KFZ A;  4DEZ A;  4QR1 A;  4HAC A;  3VWS A;  4NLU A;  3DI6 B;  1WHY A;  2VDH A;  3GYN A;  1REV A;  4LVN P;  4PZV A;  4NL5 A;  4DMZ A;  2W9B B;  4X4O A;  4GC7 A;  3T5H A;  3DOM A;  1K8A T;  2DGU A;  1I94 J;  1MRO A;  3TZW A;  5D4O A;  4QIW D;  4ELT A;  2E1M C;  2OEK A;  3UN5 A;  3SDE A;  2MKI A;  4QW9 A;  2VPX B;  3IMQ J;  3RYL A;  1VQ6 S;  3THV A;  1HQU A;  4O0I A;  2FVS A;  2LXU A;  5B0F A;  3HHE A;  3OL7 A;  4Q7A A;  2X51 A;  4R5P A;  1D9F A;  3CJ5 A;  3U02 A;  1RT5 A;  4QU6 A;  4IOC Q;  1N5T A;  3GJS B;  3KLH A;  2H4Y B;  4EUV A;  1OWX A;  4O3Q A;  3FJ2 A;  4CO1 A;  4DV1 F;  4UOC A;  2CNN B;  2HWH A;  2E5G A;  3CED A;  3TUP A;  4DR5 J;  1N48 A;  2HS0 A;  2E1A A;  2APO A;  2LA4 A;  4O4G B;  2QTW A;  1UJ6 A;  4DL4 A;  4X4T A;  3QRQ A;  2OPQ A;  3GFY A;  4HT5 A;  4ZVT B;  2FC8 A;  2BR0 A;  3TEG A;  3SEO A;  4O0N A;  4QWD A;  4P72 A;  4LR7 A;  3G82 A;  1RWN B;  4KJI A;  3RU0 A;  5KFO A;  3GCX P;  4G3I A;  2E1R A;  4A8S A;  4LJM A;  2VJV A;  1S9G B;  1IKY A;  4C8Z A;  2P8I A;  1EAR A;  4ECY A;  1JIH A;  3DRP A;  3HT0 A;  5A8W A;  2B5J A;  2K8G A;  5HVG A;  1OJ4 A;  2ZZT A;  3HZE A;  2X1G A;  1YJU A;  2MGZ A;  3EJM A;  2D3O 1;  1IBK J;  3KK2 B;  1PCA A;  1UEV A;  1VDH A;  4NE9 C;  4Y34 A;  2V68 A;  5HBM B;  4ECW A;  3QAT A;  2B3T B;  3KNA A;  1SB6 A;  2FPH X;  3HSD A;  3NNA A;  4URG A;  1DAR A;  1ZA1 B;  3DI6 A;  2W25 A;  4NPO A;  1TKZ B;  3MR2 A;  1YJV A;  5F8H A;  4P2M A;  3C2P A;  2W9B A;  3Q8V A;  2C3P A;  3T9N A;  2I1R A;  1ZTW A;  4NCB A;  4OYZ A;  3GFH A;  1BMQ B;  5JVG Q;  3MMB B;  4EO8 A;  2B43 A;  1B0V A;  3WIU A;  3JSM B;  1WEL A;  3EVM A;  4OZN A;  2F4V F;  1GFW B;  3EIC A;  4DUT A;  1K44 A;  3MCN A;  2Z2Z A;  4NEZ A;  1T8E A;  2V4Q A;  3BJY A;  2BM0 A;  4M5L A;  2V8G A;  3WC2 A;  4X4V A;  1WDT A;  3MCM A;  4UUW A;  1U2R A;  4C8M A;  2VHG A;  1IUJ A;  1KP6 A;  5KFW A;  3G8Q A;  4WFN Q;  1KQG B;  4CNZ A;  1AW0 A;  1KOH A;  1RWO B;  1P6T A;  2DXF A;  4O4G A;  4KTQ A;  2E1C A;  4OJG A;  4L74 A;  1B7Y B;  2PEH A;  1KVJ A;  2HZA A;  1TFW A;  1D0E A;  4YB6 A;  1S76 D;  4YS2 A;  3H8Y A;  1X0F A;  3SCJ E;  2HG4 A;  4QIG A;  2BVZ A;  1S9G A;  2A2C A;  3X1L B;  4ZLJ A;  1Z1Z A;  3IA0 A;  2XMK A;  4OX9 F;  2R2T A;  3HSG A;  2XYG B;  4LBI A;  2JC1 A;  1WF0 A;  2DHX A;  1RHM B;  1YJN S;  4F3Q A;  2JH3 A;  3PO4 A;  1Y9O A;  3EPG A;  4YR3 A;  3QFW A;  1S6U A;  1S1W B;  2QA4 G;  2RHQ B;  3CNQ P;  5IC6 B;  3KK2 A;  3GG0 A;  4ZJO A;  4HH1 A;  3C19 A;  1XIQ A;  2E66 A;  2WVF A;  5AT1 B;  2VFT A;  5HBM A;  1QAX A;  1QM9 A;  2XBP A;  4OX6 A;  4CDI A;  1NPP A;  3QYY A;  5KFC A;  4ECS A;  2YWG A;  4RL1 A;  1ZM4 A;  2EFV A;  1NAQ A;  3PR4 A;  2Z8Q A;  3MM5 B;  1PJ6 A;  4F04 B;  3TZZ A;  5L46 A;  3ISN C;  5DRK A;  1OPZ A;  2XNR A;  1XR5 A;  2DGS A;  5GAG I;  4ZVP B;  5DO2 A;  2ZUA A;  2OFH X;  3T41 A;  3D6T B;  3NOG A;  4PQU B;  1RAJ A;  3OV7 A;  5K8M A;  4Y28 C;  4WK3 A;  3MMB A;  2UXC J;  4WWS A;  2BAN B;  1NDK A;  1CBK A;  2J8A A;  2YNI B;  1SJ1 A;  3JSM A;  1VBZ A;  1TK5 A;  2VPZ B;  2CQ2 A;  4EWT A;  1DLO B;  2WVD A;  3B82 A;  1ZYQ A;  2QV6 A;  2EBG A;  5FII A;  3BGU A;  3BSA A;  4Y0F A;  5L1J A;  1UVM A;  3PYG A;  2AWZ A;  3P96 A;  5CYQ B;  4OZ5 A;  2NQP A;  3T1Y J;  2KTQ A;  1Q16 B;  2DHH A;  3LP2 B;  4ILM A;  1SUQ B;  2CVI A;  2MQO A;  4DV6 J;  4KHM A;  3P45 B;  4Q8E A;  2FJA B;  3IBC B;  4I6Y A;  1FDN A;  5LSO A;  1WI6 A;  1LNQ A;  3C6U B;  1G4C A;  2VKR A;  3FNN A;  5HJX A;  2CQ1 A;  2I38 A;  2C42 A;  3LPY A;  2FY8 A;  3GJT B;  4IOA Q;  3D1H A;  2B9W A;  4B9V A;  3OVB A;  5KFG A;  2RKI B;  2R2R A;  1RWX B;  4DZD A;  4K0K F;  5G0R B;  2GMH A;  3BRE A;  2OEJ A;  4F0K A;  2HVD A;  2B8Q A;  2DBB A;  4QIE A;  4K4Z A;  4HI1 A;  2JNJ A;  3QGI A;  1RA6 A;  3MHY A;  3KDO A;  3EUN A;  2HRU A;  3H4B A;  4ZVE A;  3ZTR A;  1SH2 A;  3QGP A;  4WCE Q;  1TUV A;  4U6P A;  1S1W A;  3IBW A;  2UUB J;  5A6W A;  1GMW D;  2DR7 A;  3TZX A;  4CLU A;  1YRT A;  1KQF B;  4HHH A;  2CKW A;  2V34 A;  2EG2 A;  1O5J A;  1S1U B;  2SXL A;  3THP A;  3TX8 A;  1HW9 A;  1ROF A;  3RB0 A;  2A3J A;  1TMM A;  3FZ2 A;  5K14 B;  3M8Q B;  2BKO A;  4JI2 F;  1JJ2 R;  3VV2 B;  5ETK A;  1DAX A;  2VAS A;  3MM5 A;  1BLU A;  1NK4 A;  3KJV B;  4F4W A;  4ZOS A;  2XS2 A;  2NXE A;  5E2Q A;  4LQ9 A;  4R0E A;  4A8Q A;  1RB0 A;  2IA6 A;  1KVK A;  3KK1 B;  3GLJ A;  2YH0 A;  2VJU A;  4DU7 A;  4PQU A;  2VDI A;  4C6A A;  5EN1 A;  1RAC B;  2IRX A;  2XHC A;  4DF8 A;  2DJW A;  1WC6 A;  3QRP A;  2BAN A;  4DV7 J;  3ILL A;  2YQ1 A;  1N6Q B;  4F2S A;  5K5M A;  2YNI A;  2ZE2 B;  3KHG A;  1HNI B;  4FBU A;  1DLO A;  3MR3 A;  2BUN A;  3D6M B;  1FNX H;  3VQT A;  4CYU B;  5DGB A;  3UVJ B;  2BA9 A;  4FYX B;  4ZLP A;  1YBA A;  2NRE A;  1U0S A;  5CYQ A;  1TU0 B;  4CWB A;  4JOU A;  3LP2 A;  3MPD A;  4QYZ J;  1SUQ A;  4B9M A;  2BAC A;  4DQP A;  2DH9 A;  2DGW A;  2FZG B;  2V2K A;  3C6U A;  1Q82 T;  4LRF A;  2CZ4 A;  1ZM9 A;  2CDR B;  2HAF A;  2ZJR Q;  1GMU A;  4C8Y A;  2WSE C;  1FRJ A;  1CVJ A;  1RWK B;  2RKI A;  1RAA B;  2EI5 A;  2GV1 A;  1ZZN A;  3D6H B;  5G0R A;  3KWM A;  3VAF A;  2R7V A;  1S6P B;  2DB1 A;  3DHW C;  4ZLN A;  4DUZ F;  5GMD A;  4QBU A;  1MU2 B;  2RVJ A;  3W9H A;  1OQ3 A;  7FDR A;  2EXU A;  2UU9 F;  4OZ3 A;  1T9V A;  3QGH A;  5HL7 Q;  2LU1 A;  2KJW A;  4DR7 J;  3Q22 A;  2D41 A;  5A8K B;  2XZW A;  3GPA A;  5B0D A;  3RBD A;  4ZP6 A;  3B78 A;  3N9U C;  4DCO B;  2UVR A;  1HFE L;  3QPI A;  2XB2 D;  1HBO B;  1S1U A;  1RU1 A;  5F8M A;  3H20 A;  3CE8 A;  1L3S A;  3ITH B;  4DPX A;  1NDC A;  4P52 A;  1HKA A;  3GU0 A;  1SBR A;  2RNE A;  1UAW A;  5K14 A;  2R7R A;  4NA1 A;  3M8Q A;  3UDE A;  3OTO F;  1R8P A;  4O4R A;  2J5A A;  4Z7C A;  2KL8 A;  5FJ4 A;  3KJV A;  1UVJ A;  3EMT A;  3ZZ0 A;  4I1T A;  3M2U B;  3MM6 B;  2HVI A;  1SH3 A;  3QT5 A;  2XZT B;  5KT3 A;  4AQY J;  1AFJ A;  3ICL A;  4Y2C A;  1FD8 A;  1KRP A;  3PY8 A;  1IJF B;  4MJK A;  3I9Z A;  3KK1 A;  2GO8 A;  5KT5 A;  1VGY A;  3R5A A;  3K2Y A;  4AT1 B;  5DG9 A;  2AYM A;  2EC0 A;  3OXG A;  5DM7 Q;  4B9T A;  4L3N A;  5AE3 A;  1N6Q A;  3MGJ A;  3D3B J;  2ASL A;  2ZE2 A;  5CHC B;  1HNI A;  1U25 A;  2RDD A;  4FYV B;  3ZO7 A;  4CYU A;  3NGD A;  1Q8I A;  1UFL A;  3UVJ A;  1UP1 A;  1N88 A;  1KC8 T;  2HIY A;  2EFP A;  1W2I A;  2B7C B;  2E5L J;  3H40 A;  4YDD B;  3HHL D;  4JUZ A;  5AXM A;  4OJH A;  5LXR A;  1NHV A;  5T7L B;  3KLI B;  2FJW A;  4J9V A;  2YWK A;  1N5Q A;  3RRH A;  1QAI A;  2XMW A;  4B9L A;  5HMY A;  3K58 A;  2X1F A;  3KMS A;  1JJC B;  4RBU A;  2RS8 A;  2QMU B;  3B4D A;  4ED7 A;  1HA1 A;  5E3C A;  3CCV S;  2RU3 A;  4RNH A;  2M5Y A;  3M9O B;  5L9N A;  3ILI A;  1DBD A;  2CJA A;  3LO3 A;  4NLD A;  1DUR A;  3IAM 9;  4M1K A;  1HI8 A;  2JC0 A;  1MU2 A;  2HPU A;  5FDL B;  5HJY A;  3Q8P B;  3NS6 A;  4YY3 F;  5LL6 d;  4CLP A;  1S48 A;  2HWI A;  5A8K A;  2MZJ A;  2AV5 A;  1D9A A;  4TYB A;  1G2E A;  1HBO A;  1HMV B;  3PHT A;  1UCN A;  1TZ0 A;  1RLD A;  1FVQ A;  1AB8 A;  3FQL A;  3GV7 B;  3ITH A;  1T7P A;  2CNK B;  5L1L A;  3X3U A;  3MEK A;  4KO0 B;  3TVY A;  4X65 J;  1G3O A;  5F41 A;  3TWZ A;  4WYL A;  4C9D A;  3M8W A;  3B6B A;  1U6B A;  1UFK A;  1MWY A;  3G8T A;  1BD6 A;  3M2U A;  3MM6 A;  2R7Q A;  2HRT A;  1YSJ A;  3G6E S;  3SMZ A;  3P6Y C;  2LDI A;  1UA1 A;  1WSV A;  4NLX A;  3UO0 A;  3ZFV A;  1N4L A;  2BZ2 A;  2O3D A;  2ADC A;  1FO1 A;  2HIQ A;  5KG3 A;  1CJV B;  4A46 A;  2V9W A;  1LV5 A;  3RRG A;  3N6N A;  3FQK A;  1IR2 A;  3OFH A;  3DDN A;  2B56 A;  4X62 F;  2VZ9 A;  2F8E X;  3EXC X;  1AYE A;  4B3M J;  4PWW A;  1EQ0 A;  2LQB A;  3HHD A;  2AYG A;  1KLM B;  4RKU C;  2E44 A;  1KEK A;  1RTD B;  3AY0 A;  5T7L A;  3KLI A;  3KKF A;  2E9T A;  2ALY B;  3TA1 A;  1QY7 A;  2C3M A;  2UVU A;  1LOU A;  4DXL A;  3NCQ A;  4C8L A;  1HWI A;  1Q1K A;  3R8Y A;  1MN9 A; 
#chains in the Genus database with same CATH homology
 2MEW A;  4LF8 J;  1J5E J;  1N33 J;  4DR2 J;  3R2D J;  4GKJ J;  3IMQ J;  1XMO J;  2MTL A;  4LF9 J;  4OX9 J;  3T1Y J;  3R2C J;  4JI5 J;  4NEZ A;  3J80 U;  1IBK J;  2UXB J;  2KL8 A;  2VQF J;  1IBL J;  4NXN J;  1HNW J;  4DV6 J;  5BR8 J;  4LFA J;  5A2Q U;  1XMQ J;  5LMU J;  4DV4 J;  4AQY J;  1XNR J;  5AJ3 J;  2ZM6 J;  4X64 J;  4JI8 J;  4DR6 J;  3OTO J;  2F4V J;  4JI3 J;  1XNQ J;  5FLX U;  4NXM J;  4YHH J;  4LF4 J;  4V1A k;  4KYZ A;  4KY3 A;  2HHH J;  4HHU A;  3D3C J;  4DV2 J;  4DR5 J;  4JI2 J;  1HR0 J;  4JI6 J;  4B3T J;  1N34 J;  5IWA J;  4LFC J;  2KVQ E;  4GKK J;  3D3B J;  4B3S J;  1FJG J;  4KHP J;  2UUA J;  4B3R J;  4LFB J;  2MQ8 A;  5LM7 E;  3W1Y C;  4B3M J;  1N36 J;  1HNZ J;  4NEY A;  4DV1 J;  4LF5 J;  4PWW A;  4JI7 J;  4DR7 J;  4DV7 J;  4DV3 J;  4DR3 J;  4DV5 J;  2UUC J;  5IT9 U;  4JI0 J;  4DUY J;  4X66 J;  3JAM U;  4JI1 J;  4DR1 J;  4YY3 J;  2UXC J;  4X62 J;  4JI4 J;  3J7A N;  4JV5 J;  1N32 J;  1IBM J;  2VQE J;  4DUZ J;  4K0K J;  2E5L J;  4LF6 J;  2UUB J;  1HNX J;  4DV0 J;  4X65 J;  3T1H J;  2UXD J;  1I94 J;  2UU9 J;  4JYA J;  4LF7 J;  4RJV A;  3J81 U;  5LMN J;  4DR4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...