3U1MA

Structure of the mrna splicing complex component cwc2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
226
structure length
221
Chain Sequence
TSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLALRTEVLDCFGREKFADYREDMGGKKNKTLYVGGIDGALNSKHLKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDDRREGTGLLVKWAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Pre-mRNA-splicing factor CWC2
publication title Structure of the mRNA splicing complex component Cwc2: insights into RNA recognition
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 71
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF16131 Torus Torus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3u1mA02
2JVOA 3G96A 1VQMS 2WBRA 1WHXA 2K8GA 2MQNA 2D9PA 1VC6A 1VQNS 2A3JA 5D77A 2RS2A 1WEZA 1QVFR 3MXHP 3H2UB 2MJNA 5LXRA 5DETA 1U1PA 2RQ4A 1N88A 1R8PA 1WTBA 3CCVS 4F26A 1DZ5A 4Y0FA 2DNZA 2HYIB 1D9AA 1X4HA 2CQIA 3B4DA 3JB9k 1WG5A 1U1MA 3CMES 5EN1A 3VALA 3ZZYA 2M8HA 2UP1A 2DO0A 3PIOQ 2MKHA 3HHNB 5DM7Q 2ADBA 2KG0A 1KOHA 4C0OC 3PIPQ 1JJ2R 2VODA 1WWHA 3VF0B 1VC0A 4F02A 3ZZZA 2CPZA 1SJFA 4C4WA 3VAKA 2CPXA 2CQ2A 4PRFA 2PE8A 1U1KA 2DGSA 3S7RA 2DNGA 1NJIT 1UAWA 1P1TA 3IRWP 1KC8T 3MOJB 1H2VZ 3CCSS 1HD0A 2KXHA 2Q79A 2MKIA 4Y00A 3MI7X 1HL6A 1VQ7S 3CC7S 2AYBA 2DNOA 5GVQA 3U1LA 2BZ2A 1R8HA 1SJ3P 2DHSA 2M0GB 2KM8C 5MLCV 2YWKA 1HD1A 2BOPA 1X5TA 5GAGU 2HVZA 2CPDA 4M5DB 3ULHA 1X5OA 3BO4A 3I55S 2OIHA 3J7ZT 2KVIA 2M9KA 4TU8A 1SJ4P 2JX2A 3R1LA 2CPJA 1VQ5S 1N54B 3MUVP 1DBDA 2J0QD 2CQPA 2KXNB 1NO8A 4CH1A 2MB0B 1Q82T 3P49B 1S79A 5DDPC 3Q2SC 2CQHA 2CQ1A 2MJUA 5GADU 1YJWS 2YKAA 1PGZA 2KYXA 5DDQC 2PEHA 2JWNA 2MMYA 2U2FA 5JVHQ 1U1QA 4QQBA 4OZ0A 1VBXA 2DNHA 2HZCA 2AYEA 1X4AA 1QVGR 3CC4S 1WF1A 2M8DB 2GHPA 4LJMA 2DGXA 4U67Q 1OWXA 2EK1A 2LQ5A 2M2BA 3US5A 4W92B 3IWNC 2MQQA 2CQDA 1DRZA 2KT5A 3CF5Q 2DK2A 2O3DA 3BS9A 2XS2A 4TU7A 1M5VC 1FXLA 3CPWR 5GAHU 1UFWA 1ZZFA 1JMTA 3VAMA 5LJ5Y 2N7CA 4ZKAA 2N82B 1FNXH 1H2UX 1VC5A 1O0PA 1YWXA 2DGOA 2ZJQQ 1U6BA 2NZ4A 4Z2XA 3RW7A 1X4FA 1FJCA 5IM0A 5GAEU 3VAJA 4ED5A 4V19X 1M90T 4YB1P 2DGTA 2LA4A 3S6EA 3UD4P 3CCLS 3LQVA 3DLLQ 1JJHA 2LYVA 3UWTA 4ERDA 1K73T 5LSOA 1N8RT 1WHVA 2L08A 1BY9A 4CQ1A 2I38A 3S8SA 3CTRA 3I56S 1FJ7A 2G1DA 1X4EA 1FO1A 2CQCA 1KOOA 2KH9A 2X1FA 2KN4A 5CA5A 3NNHA 4WFNQ 2CPEA 3CCES 3CCUS 2RRBA 1OIAA 2MSTA 1VBYA 2XB2D 4WCEQ 2MQLA 3G4SS 2OTJS 3VAFA 5DDOC 2DO4A 4IUFA 3NNCA 3SDEB 4PR6A 2QFJA 3SXLA 3CXCR 2MKSA 2SXLA 3VAIA 1SJQA 1WG4A 2E44A 3MD3A 3S01A 3G9CA 3THTA 1WEXA 3NNAA 2KRBA 4IOAQ 2E5GA 2U1AA 2ZJRQ 5CYJA 4LIRA 2CPYA 2KRRA 1NU4A 2XS5A 2DHAA 5LSLA 2RT3A 2FC8A 2MKCA 3CCJS 4UY8T 5HL7Q 1Q81T 1KD1T 2MZ1A 4YUDA 1VQLS 2ADCA 2VOOA 1W2BR 1YJ9S 3SDEA 2KU7A 2DGVA 2X1GA 3NMRA 2K3KA 4CH0S 1QM9A 2MHNA 1P27B 2DIUA 2RS8A 2MXYA 2E5JA 3CD6S 1M5KC 4RU2A 3P3DA 4A8XA 4P6QA 3CMAS 3U1MA 2OSQA 2MYFA 1M5OC 2MY7A 1VQPS 1M5PC 5IM0B 5H1SV 3R1HA 3VAHA 2VOPA 1XN9A 2CQBA 2DNLA 1YJNS 1ZH5A 3BO2A 2MZQA 1G2EA 2DGWA 4LMZA 4FXVA 1YTYA 2N3OA 1RK8A 3LPYA 3Q2TC 1RKJA 1U6FA 3TYTA 4OZ1A 1WEYA 2DISA 2D9OA 4WFAQ 4CIOA 1Q7YT 1U1OA 2QEXS 2J76E 1A7GE 2EVZA 1Q86T 2LA6A 3N9UC 2MKKA 2LCWA 3HI9A 2KFYA 1VQKS 1WELA 1U1LA 2MSSA 2N3LA 2DH8A 2MZSA 1H2TZ 2DNYA 3EGZA 2RQCA 2D3OR 3L3CA 2DHXA 2VONA 1VQOS 2MZTA 3UD3P 4WKRA 3UCUP 2YH1A 2DNMA 1X0FA 2DGUA 2MZRA 2XSFA 5ITHA 2RUGA 3CCMS 2KM8B 3THPA 2DNKA 2DITA 3OW2R 1URNA 1H6KX 2CPFA 2MQMA 3EX7B 5IQQA 2DB1A 4TU9A 2KI2A 3UCGA 2LEAA 1JJ4A 3FEYB 2RRAA 2AYGA 5D78A 1X4DA 3CULA 3D2WA 3NS6A 2FHOB 5CXTA 5LXYA 2DH7A 1SXLA 2F9DA 2YH0A 3UCZP 3CCRS 4QU6A 1YITS 2M4MA 2YTCA 4WF9Q 3NS5A 2KHCA 1WF0A 1VQ4S 2J0SD 2GO9A 4IO9Q 5BJRA 2MY8A 2M52A 2DH9A 1DHMA 3UE2A 2MQPA 2ZJPQ 3CC2S 4IOCQ 1U1NA 2F9JA 4EGLA 2DGQA 3G71S 2OJ3A 1AUDA 1UW4A 5LJ3Y 2CQ4A 3MD1A 4TLQA 2OTLS 1VQ8S 3R27A 2HGLA 4PKDB 2MPUA 2I2YA 3DXBA 1FT8A 2JRSA 5DDRC 4F25A 5GMKa 2CJKA 1WI6A 3MUTP 1D8ZA 2MKJA 3BO3A 3VAGA 4QU7A 4WFBQ 1FHTA 3SMZA 3V4MA 2FY1A 1YIJS 1SJRA 1S72S 3FEXB 5IFMA 2EK6A 5FJ4A 2M7SA 1X4GA 5DM6Q 1OO0B 2M88A 2CQ0A 1M1KT 1F9FA 4WIIA 3RW6A 1A9NB 2LMIA 2OSRA 1X4CA 3EGNA 2MGZB 2E5HA 1ZZNA 1VQ9S 4C7QA 2FC9A 2AD9A 2CQ3A 1U2FA 1HA1A 1WHYA 1FJEB 2KG1A 1X5PA 3CUNA 2G0CA 1WG1A 2CPIA 2LKZA 2LXIA 2AYMA 1PO6A 2ERRA 1YHQS 1N52B 2M70A 3B4MA 1X5SA 1K8AT 4UQTA 2LEBA 1X4BA 3MDFA 3TO8A 3K0JA 1KQSR 4FXWA 1U1RA 2FPHX 2HGMA 1WHWA 1L3KA 3MUMP 1YI2S 2DNRA 3G8SA 2MQOA 4W90B 2L41A 2RVJA 3P5TL 2NLWA 3CCQS 2CPHA 2LXUA 2RU3A 2LECA 2J8AA 2XNRA 2L9WA 2CQGA 2MGZA 3G6ES 2RNEA 4YOEA 2F3JA 2JVRA 1UP1A 2QA4S 2XS7A 5HO4A 1K9MT 3G8TA 4QPTA 3TP2A 2KXFA 3J7YU 1OPIA 1WF2A 1IQTA 2X1AA 3BEGB 3MURP 2X1BA 2DNQA 3P6YC 1B7FA 4BS2A 2MZJA 2G4BA 1CVJA 3H2VE 2DHGA 5JVGQ 2HGNA 2XNQA 2V94A 1VBZA 4J5OA 2DIVA 1VQ6S 1WI8A 2DNPA 2DNNA 2E5IA 2B0GA
chains in the Genus database with same CATH superfamily
2UU9J 4AE5A 5KFBA 4NX9A 3MM9A 2XCAA 2GIQA 2MQNA 1VC6A 1UETA 2WSCC 1QTMA 2R8HA 2UUBJ 4MH8A 2RQ4A 4CNZA 3CIMA 2KTQA 2OLWA 2ZWOA 1VQYA 3SQGB 4USMA 1OPZA 5KFQA 3PIOQ 3D0HE 2KG0A 2RQMA 3VCDA 3D0IE 1FFWB 5CD4A 4DV2F 2VG6B 4LREA 3MM5A 2DHSA 3M2RB 1NKBA 3DGPB 1JXVA 2ATLA 4KRWA 1GK8A 3DRRB 2V4QA 3PW5A 3ZNUA 2V34A 2A6OA 1UPPA 4IQMA 5L1IA 2J0QD 3TX8A 4U7UD 2FVSA 1IUJA 3M8WA 1ROFA 1S79A 1CEZA 1R0CB 1HQUA 5M2UA 1WC5A 1X4AA 1HNWF 4O44A 4PG5A 5KG0A 3TVYA 1RKIA 4IDKB 5DZ6A 1GX5A 4NLQA 3EVMA 4A47A 4J9UE 2NZ4A 2BVZA 3RW7A 2GVZA 2AJQA 2A2CA 1AYEA 4OMFG 2LYVA 5LSOA 4F4AA 2XMTA 3OR1A 1G7CB 1VHIA 4LSNB 1LWXA 2KH9A 1B3TA 3NNHA 2WSFC 2CNKB 1SV5A 1OIAA 2LU1A 3DRPA 4M63A 5K8MA 3OL8A 3GPAA 2XI2A 2W2NP 4RBUA 1GFWB 3QSYB 3FMBA 5LL6d 1KLNA 3LGNA 5J2PB 3OL6A 2SXLA 4DCOB 4QIWD 1TL7B 4ZMMA 3LGMA 4WFZA 2E5GA 1YRTA 4K4YA 2JNJA 2XMWA 4I68A 2WAQD 1M5HA 3OV7A 4P2XA 2YNIB 1SIZA 2FHJD 5I42A 5KFGA 5J1PA 4ZHRB 1YK9A 4TYAA 3SDEA 2KHDA 3M30A 4RW8B 1UVMA 3A1YG 5KFWA 5KT6A 2ROGA 4M5HA 4A8XA 4GO7X 2MDAA 2ZH2A 3RJMB 2RAQA 2W7PA 5D15A 2B56A 5CD4H 1RK8A 5F0WA 3UQSA 3HPOA 4DFKA 4XK8C 2W9BA 2QEXS 5M2RA 2MKKA 4Z37A 3MEEA 1XC9A 1KVKA 4ZIVA 1DAXA 1YVFA 1IKWA 1TL4A 4RNNA 4WKRA 3W2VB 2VDIA 1QUPA 2MZRA 2XSFA 5BR8J 2RUGA 3HLUA 1Q95G 1H6KX 4NLOA 1MU2B 1V5IB 2DB1A 3PFOA 2KI2A 2BX6A 1NPKA 2Y0SD 3TJAA 3W8GA 2UUCF 2FHOB 4TY9A 4FNHA 4JB8B 4DSKA 5LMNJ 5H9FK 2QN6B 3DOLA 2IJNA 3AQPA 1YKWA 1UW4A 5LJ3Y 4JI0F 2UUAF 1JLGA 1TUVA 4M94A 1RJJA 2E1MC 2YQ1A 1A0OB 4KH1B 4JI2F 3RB6A 2HQCA 2WSEC 3V4MA 4CLUA 1X4GA 3Q83A 3BGUA 1FRKA 4PEOA 4Z7YA 4OHZA 4WIIA 1C1CA 3UDEA 1P6TA 2QMUB 2KJVA 5D0GA 2YX7A 1HNXJ 1X5SA 4DR5F 1SVDA 2VFUA 2JC1A 1IJFB 2DNRA 3G8SA 3L7PA 2MQOA 2LQJA 5KFZA 3V6KA 4HTJA 2LECA 3OT9A 1NB2A 2HNZA 1HFEL 2UXBJ 3EM1A 4DV3J 5CH7B 4A8WA 4P74A 3GYXB 3TP2A 2FVQA 3DOKB 3ZC4A 3QWPA 4CLTA 3BN4A 1SJ1A 4D3GA 5C24A 4M5NA 2HHHF 3P6YC 1X31C 1TL3B 2RILA 3IBFB 3P45B 1RTIB 4ED3A 2DNNA 4OLOA 1JLBA 1I94J 1WC1A 4XO0A 5E41A 2XMMA 3HHKA 3TOQA 3OLAA 1AFIA 2P2CB 3C2PA 1PJ6A 4TNOA 4ELVA 1UVIA 2YX4A 2VC1A 3E51A 4GRSA 3QMQA 4H4OB 3O1LA 5ETPA 4K0KJ 2O67A 1NZ8A 3EVWA 1WWHA 4HHUA 4HDGA 1NK7A 1NJZA 2KFZA 1BQMB 3ZZZA 1SJFA 1UWBB 2PD1A 4DWIA 4PXBA 3LP0B 5L39A 3MOJB 2AX0A 2NREA 4HVZA 4NL5A 2CRLA 5KFOA 1Q8IA 1DQAA 2IM0A 2BOPA 5MAOA 1ZS6A 4DBQA 4J7CA 3A12A 3I55S 5HVGA 3J7ZT 4YY3F 3KK1B 3CDWA 2BANA 2H54B 4CLFA 1FK9A 5A2QY 3TI0A 2Y1LB 3MUVP 4B9TA 2YNGA 5D4OA 3HD1A 3BQ1A 2CWKA 4PUOA 1FX2A 4EO6A 4LF8F 1FKAF 2CQHA 4NLRA 2DPJA 2KYXA 2QA4G 3NBPA 3KG1A 3R7NB 3GG0A 4C11A 5BYRA 2HNYB 2DNHA 4DR7F 1T7PA 3US5A 5KFMA 4W92B 1AT1B 5KFVA 1HPZA 1C0TA 4QR0A 1YQHA 4YDDB 4ZKAA 2N82B 1T11A 2IRXA 1RZMA 1J27A 5KFHA 2HAIA 5L8RC 2DHHA 3C6UB 1TU0B 5LMUJ 3I4HX 1TL5A 2UVWA 2NUHA 4ETXA 2I1RA 4H4MB 2HS4A 3OR2B 3V5RA 2Y1JA 4KFBA 1LW2B 3CCES 4ZP9A 1CJVB 5ADZA 4IG0A 3G4SS 2EFOA 2BE9B 1HLWA 3CGIA 3SXLA 1JLAB 2VA2A 4TQRA 1HW8A 2HVEA 1WEXA 4IOAQ 2ZBRA 3TZWA 2IA6A 2J9EA 2UV8G 3NOGA 3BDPA 4P10A 2OMOA 1W2BR 2MLYA 3OHBA 2GHWA 2JOQA 2V69A 1N34F 1C1BB 3A8JA 4IFYA 2OEMA 3HMJG 3T6BA 1ZA2B 5KT7A 1HNZF 4LSLB 1ZH5A 2F8EX 5KG3A 5C25B 4LMZA 4JI6J 2R8GA 4IRKA 1XNRJ 2D9OA 2EVZA 1S9EB 3DKDA 2KFYA 4RX6A 4DV5J 2MSSA 2MTLA 4XDCA 4ZVEA 3RBXA 2RQCA 3L3CA 3BREA 2CG8A 1FD2A 2L9DA 3LOUA 4ANEA 3CJ2A 3QRPA 1R0AB 4ECTA 3PCOB 3MPUB 1S1XA 1NHUA 4GVBA 1HBOB 2YTCA 4FF4A 5ETTA 5BJRA 4K4UA 5HLFB 3IP0A 4NZ7A 3PVXA 1TKXA 2AMCB 2LQBA 2OTLS 4ED8A 3KHGA 2QL7B 2QV6A 3R27A 3BGRA 3VVUA 3AA9A 4DV7J 4TY8B 3QAUA 4ZLPA 4YHHF 3VAGA 4C3MA 3SMZA 1IVZA 4OX8A 3LP2A 3IM8A 4FP9A 3QT5A 5KFDA 1HHTP 1C4AA 4PQUB 4RUCA 1R27B 4NLXA 4JI5F 2OFHX 3OTEA 4NYZA 3C46A 1RU1A 3GYGA 5F8LA 1X5PA 1S1VA 2LKZA 5BXIA 2YNFB 2HQIA 1O5JA 2LEBA 1DJ0A 1T03B 3WC0A 1WHWA 2YKPA 4LRDA 3ZZOA 4CLKA 1KVJA 5A0YB 4F67A 3T5JA 3CDBA 4C8LA 2XLJA 2C2NA 2MGZA 1QAJA 4S0MA 2NR0A 3RB3A 1RT1A 2B9EA 2QA4S 2KB2A 4KC5A 5HO4A 1HIYA 2EKNA 2ZOFA 4HYKA 3KLVA 1BHNA 3CD0A 2HFZA 3MWBA 3W8PA 1RWPB 1OS5A 1QJHA 2J0XA 1WI8A 3DI6A 2FHKA 3B78A 3UNYA 1WORA 3CW2C 2R7UA 2UV8A 1IWAA 2V4RA 3SV4A 2P6SA 3W3SA 3QIDA 4F4XA 1H74A 4LF2A 2IVYA 1VQSA 2KJWA 1S9FA 5IWAF 4LRFA 2YKNA 1UZHA 3V4IB 4Y0FA 4AQYF 3IBCB 1S49A 2R9LA 1S0MA 4TN2A 3VALA 2ZD1A 2DO0A 3IRXA 2I5JA 1KR4A 5CAAA 4Y2KA 4F02A 1WJ9A 4C4WA 2EFPA 2ZC4A 2O5DA 3Q89A 3IA0A 1TKZA 3EZUA 1V3RA 1UAWA 5HROB 4EBDA 2C1EB 1Y5IB 2LDIA 5L38A 2MKIA 3EXYA 4I69A 1WDDA 1RBOB 3LF0A 3E01B 2W8LA 4TU8A 5DQIA 1RTJB 1SCJB 2AKWB 2DYAA 2IHR1 3MM7B 3L09A 7FDRA 2VG6A 2NXCA 1QUVA 4DQIA 1JLEB 3KKFA 3IBWA 5DDQC 3M2RA 3DU5A 2HS3A 3DGPA 2HVHA 3MR6A 2GFFA 2YKMB 5B0FA 3A4TA 3ZTQA 3MR7A 4FPRA 1M5VC 4O3PA 3K5LA 2XGQA 2WTFA 1FFSB 3PDNA 4DEZA 5GAEU 1HNVB 2AF6A 3UD4P 2B8PA 5GAGI 2G1HA 5IQ6A 4KGZB 1R8CA 4IDKA 4ZP6A 1R6VA 4RW4B 4WFNQ 1SH3A 2Q6CA 2M3DA 3AD8C 4WCEQ 1CBKA 3MMJA 4G3IA 3NLCA 2QFJA 1ACMB 4OHVA 3VAIA 2VFVA 3KK3A 4LBHA 4MFBB 3QQCD 5B08A 3M8ZA 5C42B 3HFZB 2UU9F 2POKA 2ACMA 5AXNA 4OYPA 2V2VA 5KFEA 4LSNA 3TUPA 5F8NA 1EQMA 4F7VA 4JYAJ 5D4PA 2H51B 3QNWB 4F4YA 3EYZA 1D8YA 2V68A 1TL7A 2HFNA 1M0SA 1XN9A 4LFBJ 2ASYA 3WZ0A 2YNIA 3ISNC 4WFAQ 4ZHRA 1Q86T 1YBAA 2HHXA 1TP7A 4RW8A 2OPQB 2N3LA 4CO5A 2V2QA 4RW9B 3QJJA 4ZA1A 2R7XA 2V0NA 5U47A 3N79A 2E1CA 1F2HA 1Y5LB 2UXCJ 1F6TA 3CULA 4ELUA 4ZDNA 2HQFA 2QE5A 4ZPVR 3GFZA 5CYQB 2HIQA 1TKTB 3W2VA 1U1NA 3TEHB 1YJVA 1QE1B 4EYHB 4WPAA 1MU2A 2AGPA 3BGFA 3MCOA 2LQ9A 3NMAA 5J2QB 2E29A 5K5MA 1HWJA 1IJEB 3CWJA 2MKJA 3FCWA 3IAS9 2J9DA 1RTHB 1WC4A 3FBEA 2X3DA 3GSIA 1OO0B 1M1KT 3BYRA 1F9FA 1X4CA 4USTA 2BUNA 1L3TA 2E5HA 2FC9A 1FDBA 1ZPWX 1FJEB 4OL8A 1JQGA 4KT0C 3MMBA 1KQSR 4FXWA 3GJQB 1S6QB 1KBRA 1B7YB 4P52A 2P9EA 5EDWA 4QYZJ 3KHRA 4FYVB 4WTOB 3T1YJ 3A3OB 2ACYA 4OI3A 4URQU 1HMVB 2NYIA 1Q16B 2XYGB 4K4VA 1WOPA 3DM2B 3J81U 5KTQA 3CCWA 2BA9A 2Z8QA 3QWUA 4A4JA 4XPCA 3CJ0A 2DNPA 4X65J 2E5IA 3O2IA 2WBRA 5K14B 3EDQB 1KLMA 3DOKA 2P5VA 1N88A 2ASJA 2V5HG 1DTQB 3JAMU 3GWCA 3T19A 5BR8F 2GJFA 3BSCA 5KFLA 2B7CB 2VODA 1H73A 3W62A 2J8SA 1QAYA 2CPZA 4NI2A 3FSYA 4DV0J 2IFXA 2HK2A 1JKHB 2AV5A 2NS1B 2FHJA 3K8WA 3PEHA 1VOMA 5T14A 1KQGB 4H4OA 4HT7A 2ASDA 1H0HB 4FN5A 2AU0A 2NSBA 1NEEA 1UWBA 3LP0A 3D3CJ 2A2DA 2ZUAA 3EJMA 1SKRA 3DGVA 3H42A 3VVTA 5DG9A 3ILJA 4WFYA 1WF1A 3KK1A 3KYLA 3OL7A 4U8VA 1JLCA 1CG2A 3BS9A 4DR3J 1HNXF 1N36J 1RI7A 4O3OA 3PJ9A 2OUGA 3OBIA 5L1LA 4NXNF 5LJ5Y 2GGPB 4CP5A 1VC5A 1N6QB 2DGOA 1TV6B 1PAEX 2V63A 1Q1KA 1ICEB 3S6EA 2VA3A 2HNYA 1N8RT 4HR2A 1URRA 1BY9A 4RJVA 3BM7A 3CTRA 4IRCA 2G2ZA 4AXJA 3EZ5A 5EUHA 4DV3F 1SH0A 5KG1A 2ROEA 3D67A 3SFGA 4YR3A 3ETOA 2W9CB 1UEVA 4DFJA 2KFNA 3UR3C 3C6UA 2V67A 3BDEA 2ASLA 3D1OA 3VV2B 1KP6A 1I94F 4H4MA 5CYJA 3OR2A 4QW8A 3M6XA 4KGXB 3T5KA 3PXGa 4F3MA 3DDKA 1LW2A 3BPDA 2XTJP 4F04B 1LEOA 1AUSL 4KKOA 1S99A 1VQLS 2ADCA 1TFYA 2ZNYA 1PBAA 3W66A 3UO0A 1JLAA 1CJKB 4RW7A 4Y2IA 4UW2A 3P3DA 4MT1A 5KOXA 1EAYC 1YSJA 4XIUA 1QD1A 1D3WA 1GMVA 3H40A 4NZ6A 2C2RA 1S5ZA 5KFTA 4ILMA 3D4JA 1XEZA 3TAMB 1Q78A 1RHKB 3T5LA 2LA6A 1RLDA 1HI0P 1C1BA 2BDPA 1NKEA 4HH0A 2DRAA 3G6YA 2D1CA 4LSLA 4OI1A 3MCSA 2PT0A 3OL9A 5C25A 3H25A 2MQMA 3H5SA 1YZ7A 3KJFB 4MKYA 2WZ1A 3QFWA 2YH0A 1S9EA 3H8YA 1UVLA 4QU6A 4O23A 2XEXA 1IBCB 4ANCA 5M2PA 2PMZD 1YX2A 5D0RA 4DPOA 2JC0A 4X4UA 4KHRA 1R0AA 2XWYA 2A6MA 5GMKa 1HBOA 2DXDA 2GW8A 3GIMA 3K57A 1ZPVA 4C6AA 2W25A 3FCVA 3V81B 3NP5A 5LMUF 4DLEA 3CJ4A 5SUHA 3I4PA 2BKOA 4JBCA 4A8SA 5HLFA 2E66A 1U49A 5J1EB 2FVCA 1WSRA 1WG1A 2LXIA 4DL2A 5L9XA 3HXMA 4ZVSB 4ICLB 3R3TA 3KNGA 3MDFA 2QZ8A 4TY8A 5A8KA 2FPHX 2DR5A 1L3KA 1RWUA 2WK4A 4R0EA 2M5YA 4ECWA 3BH7B 3KMQA 3GFHA 1VIXA 3PNIA 4PQUA 4NWBA 4GVLA 4O3QA 3G6ES 2YPZA 4DUTA 3D1HA 4IRDA 2YNFA 4PG6A 4C3LA 1S1UB 2ATCB 2CJ9A 2X1BA 5KFJA 2DRBA 5A0YA 3A8KA 1FTCA 2GMLA 3HT0A 3PYGA 2FLPA 3TZXA 1XNRF 1J2VA 2A3JA 2BOAA 2BKNA 2CG4A 5A76A 3NGTA 1U1PA 1R8PA 1DZ5A 1D9AA 1VRTA 4J9VA 3TQEA 3NG8A 5EN1A 4DZ6A 3T1AA 2DCLA 5HBMB 1S0NA 3PIPQ 3MHYA 1SI9A 3PYFA 2VD3A 4UF4A 3TUIC 4FPIA 4ZOSA 3BQ2A 1J5EJ 3UR0A 3J7YI 4LR9A 1BQXA 2QX0A 3FBCA 2A18A 3CC7S 2AYBA 2OMLA 3V4IA 3M8PB 4K5SA 4DX8H 2EFNA 3QT7A 3MGJA 4LF5J 3KK2B 2ZOGA 2FTRA 3KNAA 4O0IA 4DL5A 3JYTB 4DLGA 3M6VA 2CPJA 3AAWB 5HROA 1RHRB 2MB0B 4HI2A 4JI8J 4TKTA 4DPWA 2EEYA 4DV7F 3P49B 3HHEA 4FBTA 4ZLJA 2W8KA 2UXDJ 3Q2SC 4PG8A 3HO1A 1LFPA 1XBWA 4AD6A 3I82A 4FF1A 3HKZD 3B8HA 4ANDA 2R42A 3E01A 4BHQA 3M32B 4DV1F 1FXLA 1ZZFA 1JMTA 3OXGA 2BQRA 2E1PA 1RWNB 3MM7A 2C2OB 1I5OB 2FIUA 2D7SA 4B9VA 1MSWD 1JLEA 2ZBIA 1FEHA 3NWGA 4LF4J 4U8YA 2Y9HA 3LQVA 3DLLQ 1SH2A 4G65A 1RT7B 1HBMB 3MAAB 4CQ1A 3AB4B 3I56S 2ZH5A 1BLUA 2EWHA 1C4CA 2KN4A 3PJWA 3DNCA 4EEYA 1R89A 1FJGF 4OYIA 1HNVA 4ZLLA 1EZZB 2ZH6A 2HBRB 3TR5A 4DHVA 1GXLA 4K4WA 4Y2CA 4ZVRB 5E3CA 2KVQE 1RWOB 2KRBA 1RT2B 4LIRA 3M9OB 3RAMA 1H72C 4IR1A 2CPYA 3OLBA 4RW4A 2XS5A 1NLKL 4ED1A 2FC8A 4JI4F 4ZVQB 1HNWJ 3D68A 1KFDA 3QGHA 3CJKB 2IDLA 1YJRA 1X7VA 2Z58B 1LK7A 3EGWB 2MLXA 3LGHA 4MFBA 2QLWA 4ZJQA 2DNLA 4ID5A 4E0DA 2H48B 2JL9A 2OEKA 3OTDA 2CUYA 2N3OA 4FYDA 2LVWA 3TYTA 4DXLA 3TZZA 2R7QA 2LCWA 1IKVB 3ENWA 4WP9A 1F2GA 3SIPB 5IT9U 2Y1IA 2J9CA 2EPIA 2DNKA 3OW2R 5ETMA 3N4WA 3FNNA 3ETMA 4EUVA 2FHMA 2C2ZB 2BJ9A 5D3GA 4R8UB 3CJTA 2OPQA 1NHVA 2P9CA 2QLXA 4NEYA 3NS5A 4QR1A 4ATNA 2P6TA 4RW9A 4IO9Q 2BE2B 2AX1A 4IG3A 2F40A 2XBPA 3G82A 3KXDA 3KJQB 1G3OA 5C5JA 1D9FA 4C97A 1AUDA 1GMWD 1UJ6A 2HNDA 4HTIA 4FS2A 2Z2ZA 3DXBA 3BO3A 1E6VA 4PWUA 2FY1A 4ZCMA 1SL1A 3Q0AA 2VBWA 3W1YC 2UVUA 1VRQC 2H4YB 5HI7A 1WHYA 2KG1A 3DRSB 5A6WA 4DPUA 2ERRA 2ALZA 4BWJA 5J2QA 4KH0B 4CLYA 1NSQA 2WB1D 5CYMB 1MWYA 1T9TA 1RTHA 1PCAA 1RWMB 4W90B 2WW4A 3A8IA 2NLWA 4ECVA 5IS2A 4Q5VA 3K5OA 5KT3A 4DL0C 4JYAF 4Y65A 2R7VA 3OXFA 1LXNA 1K0TA 5K8NA 2GS8A 2OD4A 2FZKB 3W5XA 1S6QA 1MROB 4JI0J 2UUAJ 1S0OA 2DRDA 2B0GA 4DX6A 3R2DJ 1WACA 1HQEB 4JI2J 4PYDA 2JLFA 2K8GA 3KLHB 1HMVA 2XZWA 2CDRB 4MK9A 3TARA 2LP4A 2E9ZA 2D3O1 2IM1A 3HHNB 3PYEA 4DR5J 4U96A 1VBKA 5K14A 4QWDA 2P8IA 1U26A 1HHQA 4I6YA 3W61A 2FJVA 3DFEA 4UTGA 2FDNA 1NKCA 3NL0A 5DJBA 3UDCA 3AD9C 3PY8A 2OKQA 1PBUA 2GNKA 4Q7AA 1LNQA 3HHLD 3VGSA 4Q45A 4MIAA 2V2KA 1ELOA 2ZH7A 4I0WA 2HHHJ 1JKHA 2LQ8A 2YBVA 4R0JA 2AJFE 1Q5VA 2XZDB 4USHA 3FZBA 2MMYA 5DG7A 2JLGA 6AT1B 4QYZK 2BJDA 2HRTA 3VQSA 3PR5B 3R5AA 3DC2A 2M2BA 3BSOA 4NLGA 1HBUA 4IH6A 4K4TA 2CJQA 1I1GA 1KTQA 3CPWR 3H7HB 4WP8A 1TUWA 4KYZA 1LV5A 3TJ9A 1X4FA 4ZN1A 5B0CA 1HBNB 2IYGA 3GLJA 1G6BA 3BGOP 2DGTA 3LO3A 3NOCA 4P2FA 2CAJA 2EKYA 2Z2LA 4QW9A 4ZN3A 3NXZA 2BW2A 4MMOA 2G1DA 1Y9OA 3MAHA 2X1FA 2E9TA 2J6TA 2BE7D 4LF6F 2GGPA 2R3VA 4MIBA 5HQLA 1FDNA 1N6QA 1TV6A 3GJRB 3ISZA 3W5ZA 1DLOB 2J7WA 4YY3J 1VI7A 2H5JB 2H5EA 3DU6A 3J81Y 3LAMA 4X65F 1NJXA 2ZJRQ 4D3HA 4J37A 4IKAA 4CYUB 1OSDA 3V6JA 4B3OA 1KVIA 5A8RB 3KLFB 4M5MA 1EARA 3WX4A 2RT3A 2MZ1A 2W7OA 3EVOA 1HWIA 1F5CA 1OY8A 2VPZB 2XSJB 2NYHA 4DQPA 4HL9A 4RU2A 2PSZA 5GMEA 2VOPA 3BO2A 2MZQA 8RUCA 3N5FA 3UDLA 1U4BA 3PX4A 1RCXB 4GO5X 1WEYA 2C28A 4UZBA 3KDOA 3JS9A 3HI9A 1CJKA 4DR2J 2RSQA 5KFUA 3IN5A 1NXIA 3DDNA 1XR7A 4LQ9A 4Y6IA 3LPEA 1MLAA 2QYCA 2V8PA 3SSSA 3ZTOA 2VPWB 2FZGB 3FSIA 3JQKA 5KOWA 3D66A 5G0RB 1D9DA 3GU0A 3HVTA 3P96A 3NGKA 5LXYA 3TZYA 3CCRS 1D09B 1HKAA 3FBBA 4ECYA 5C2GA 4AT1B 2MY8A 3IMQJ 4BWMA 3LTOA 2QTWA 2LLZA 1E6YB 5KG5A 1RT3A 4DR3F 2HG4A 2C2DA 3HHLB 3UNGC 1PYTA 5C7PA 3DYAA 3KHLA 1N34J 3AB2B 3W9JA 1FT8A 1HYSB 2JRSA 3BJYA 2VKZG 2R7RA 3L4BC 3RZAA 1RTDB 4OV1A 3BBBA 1HNZJ 1FHTA 1Q8LA 1FX4A 1RAGB 3VZHA 4BDPA 2XO6A 1S72S 2M7SA 5DM6Q 4DOZA 2PFFB 4JV1A 2LMIA 3RAQA 3EGNA 2R2RA 2AEFA 2CQ3A 2PI5A 3I0SB 3FJ2A 2V4JB 3CUNA 5B0GA 5B7WA 5F8HA 1JLQB 3CO9A 4DR1F 2VG5B 1U1RA 1EP4B 5E5NA 3MAQA 3V81A 3UFCX 1RGVA 2XYHB 2IAJB 1NSPA 1S10A 3AJ1A 5ETSA 1MMNA 1RAIB 3O8WA 5J2NB 2HAFA 2RNEA 4K4SA 4YOEA 5J1EA 4OZ3A 4ALZA 1UP1A 2CZ9A 1QSSA 4ZPDA 2YVSA 4ICLA 1HARA 1NZAA 4YN3B 3RUBL 2VFRA 4FF3A 2DNQA 1ZAVA 4ZP8A 4NASA 1CC8A 4ES1A 1FEEA 1S59A 4DDFA 4RUBA 1C2PA 3FRZA 4X4OA 1VGYA 2R8KA 2V9KA 5AXLA 4YHHJ 4OZJA 3P4UB 1FF2A 3DCAA 2K3IA 2C3OA 1JLFB 1IKYB 4KGVB 2ROPA 3TX0A 1N0UA 4JI5J 4E8UA 2WVDA 4UZCA 4EZ6A 3FQKA 1S77D 2CPXA 2CQ2A 3UPFA 4LIWA 2DGSA 5K8PA 3IRWP 1UPMB 4PCQA 3M2UB 2B8QA 4B3TF 2GVDB 1H38A 4ZCLA 2HMIA 4ETZA 3OVSA 1X5TA 5GAGU 3TEGA 3OXLA 2X3GA 2CPDA 3M2VB 1X5OA 5ETLA 3BO4A 2HHUA 5HBMA 1SJ4P 5KFRA 4KB7A 1Y10A 3AQOA 4MKVA 2ZOMA 1V3SA 1VJQA 2HW3A 2PEHA 3M8PA 2IBKA 4WK1A 3KLIA 2V8DA 3FSXA 3KK2A 3W9IA 4L72B 1U24A 1NM2A 5DG8A 3BBFA 5IWAJ 3JYTA 2DBBA 1IBKF 2OP5A 2JZ5A 2H1YA 3KJNB 5DS7A 4V19X 4C8YA 2QL9B 3QRRA 1PJ7A 1BQNA 3K7RA 4M8LA 3AXMA 2Z4PA 4KGMA 1K1SA 3M32A 1DFDA 3PHTA 2IC3B 2HZAA 2W4DA 1L3VA 2XB2D 1S7IA 4HACB 2VJUA 1QDUB 2UVRA 2RU9A 1SL0A 4K50A 5GADI 3K5MA 4ZVOB 4NE9C 2Y0BB 4YS2A 2WOMB 5DLGA 1WOSA 3X1LB 1RT7A 2R7WA 2E44A 3S01A 3G9CA 1HBMA 3MAAA 4USVA 2OFGX 3NCRA 4G1PA 2UUTA 1QAIA 4EZ9A 2B4OA 1UA0A 1S12A 4U95A 1NU4A 4I56A 2DHAA 2HZVA 3QZ7A 1HQ2A 4B9NA 2VOOA 2ZUGA 1CULB 2V50A 1NHKL 4PG4A 3MMCA 2RD5C 1S1TB 3TAPA 2DTJA 1NJYA 4OYXA 3QT6A 4YEAA 2DEIA 4P9SA 5IM0B 2DR6A 1RT2A 4X4NA 2C2EA 2PI4A 3NGSA 5JMNA 3QGIA 1TELA 3LPYA 1J5EF 1XMBA 2HHSA 2DISA 3FKBA 5E3PA 1A7GE 2CVEA 3CJKA 3N9UC 1P9QC 2WVEA 5DZ7A 4LF5F 2F4FA 1U1LA 4ZPWR 2X7IA 3GV7B 1JNRB 4UOFA 1EB0A 4RNFA 1W25A 1FRJA 1CJTB 1UVJA 1NUEA 3UCGA 2F8MA 4N7TA 2UXDF 2E5LJ 2YWEA 3KLGB 5DQGA 1ZM3A 2JSXA 4NXMF 3GSDA 3JSMB 2L48A 3SBMA 2BV3A 2CNNB 3UDVA 3QO9B 3AOBA 5T7LB 3HF5A 2BJ7A 4CRJA 1GEHA 3IG1B 2YWHA 1S9GA 5F9LA 4KQZA 4CO4A 3NWRA 2LEPA 4LF4F 3I5AA 4U7CA 4UQGA 2FJXA 5HVHA 1RYSA 1T02A 1SJRA 3QGGA 5F8MA 1RCOB 4LBIA 4PQAA 4B02A 3A3PB 3GZ7A 2B9YA 4QWEA 4HT5A 3H98A 2HHQA 2G9OA 2Z30B 2C42A 1RAAB 4Q44A 3OQ2A 2GHVC 2YXLA 3LA0A 3MUMP 2JH3A 2ZE2B 1Z4UA 2QLFB 5AE3A 2F1FA 3P5TL 2YWGA 4F0MA 3ZNJ1 1PC4A 3K58A 4LBPA 2JVRA 2Z0GA 4B3MF 2HHWA 3DRSA 2KXFA 1LW0B 1N5TA 1WF2A 3M6WA 4KV8B 5CYMA 3SYZA 4ID8A 1UCNA 3JSYA 3H2VE 2DHGA 2XNQA 2A10A 4YB7A 4A8KA 1NJWA 4WKYA 3NAIA 3OVBA 2BJ8A 3D6FB 2H5IB 8ATCB 3I0RA 3AA8A 1VQNS 3R5CA 2R2TA 2ZFHA 3PRBA 4L74A 1FDDA 4IFVB 2VPXB 2ZZTA 4F3QA 3J80U 3OSNA 4TVAB 2CQIA 3G86A 4U9RA 1MROA 4AL7A 3I9ZA 3H5YA 3BGLA 3HCXA 1EKRA 2C22A 1HQEA 5IT9Y 3IR7B 5HP1B 1A6LA 3K8VA 4NRTA 3KLHA 1HD0A 1B70B 1N56A 4CM2A 4O4GB 3MI7X 4UUWA 1K0VA 4CT9A 4GKJF 3HJVA 2PN6A 4OHYA 1R8HA 1O6XA 2HFOA 1EQ0A 1M1HA 1V3ZA 7AT1B 1VYAA 2ZBCA 4J9MA 3J81j 4I67A 2VZ9A 1XR6A 3FVYA 3M1VB 1TK5A 3AOAA 3EICA 3GMGA 2EXUA 2DJWA 2EFVA 1NCLA 2AYEA 1RE1B 1JXEA 4JOUA 1SC1B 1RT4A 3MEGA 3IWNC 2CQDA 4KO0A 3SCLE 3CB4A 1DRZA 5IC4B 1T94A 1LWCB 1T3OA 1UFWA 5HN0A 2FD2A 3D6MB 1NPPA 2QLJB 4LR8A 3PM9A 1T05B 3T1HF 3C15B 2D41A 1JJHA 1WKKA 1K73T 4ED4A 4DCJB 7FD1A 3S8SA 1H3DA 4DZDA 2R7SA 4OYWA 3MEDA 4FS1A 1GMWA 3I5CA 2DR7A 1HBNA 3EWGA 2WVCA 3QRQA 2PO4A 4ED0A 3CXCR 3J7Z5 2AGOA 3LALA 1X0PA 4DX5A 2AEMA 4JI3F 2QGFB 3PO4A 1NK9A 2RQKA 4OIXA 2MKCA 1Q81T 2EC0A 4J9QA 1I6JA 4K59A 1DLOA 3PKMA 5HATA 2X1GA 3MECB 1QM9A 2MHNA 1XJWB 4EU0A 4NXNJ 2ZVIA 4F50A 3VGUA 2XMVA 2VJVA 4CYUA 5KFPA 2DGWA 2MLZA 5A8RA 1YTYA 3KLFA 3H2LA 3RG6A 1RKJA 4NCBA 1U6FA 3OR1B 4QIGA 4K5RA 4C9DA 3QFHA 1Q7YT 2XSJA 4EBEA 3EGZA 3DRPB 2VONA 1HW9A 3GFYA 2XM3A 3QBCA 1FXRA 3UCUP 4NLUA 2CJYB 1VMBA 3ZZTA 2CPFA 4DU7A 4CO0A 1KEKA 5E7OB 3D2WA 5CXTA 1XTZA 1U02A 1SXLA 4A8MP 5I4MA 2RE1A 4EMDA 4F4ZA 4P71A 2J0SD 1U09A 4WFXA 3C19A 4F0HA 4IOCQ 1W7WA 2DGQA 3G71S 2ZHBA 1X60A 3RBDA 1EETA 4X4PA 5G0RA 3D7SB 3FK4A 4C8NA 3MUTP 1JX4A 4QU7A 4WFBQ 3UW1A 4RL1A 2DXFA 2M88A 1M1GA 1ULRA 4DR6J 1A9NB 1E6YA 4DS4A 5FD1A 5B0BA 5B0EA 3UN3A 4FKXA 1HWKA 1RHMB 4KTQA 1TR0A 1HYSA 4NCGB 2A0FB 5LSRA 5KG6A 1RTDA 2HFUA 1NRKA 1YRUA 1REVB 4X62F 1FESA 2IMOA 2CPHA 2RU3A 3DLKA 8AT1B 5A6PA 4HKQA 5HAOA 4L3KA 1VDHA 1ZA1B 2F3JA 3I0SA 2G2YA 1JLQA 3J7YU 1OPIA 2HWTA 4KY3A 1U7LA 3PEJA 4MYTA 1R3NA 1EP4A 2PA8D 2GV1A 4WXWA 4CO1A 2NPIA 4DUYJ 4NRUA 2BYCA 2MEWA 3ICLA 2Y8WA 2DIVA 5IV3A 2BM0A 2JFDA 4J9LA 1RISA 1R6YA 2I9SA 4MAKA 2KT3A 5D0EA 3CEDA 2MJNA 5LXRA 5F3TA 2V8VA 4ECQA 1SQEA 4DR2F 4GC7A 1PILA 2LU2A 1U1MA 1TFWA 3ZZRA 2ADBA 1MN9A 3P5BP 1MWZA 3VF0B 5AXMA 4OYAA 2PE8A 1U48A 3IGVA 2JFKA 5H9EJ 3IM9A 5KFSA 3OJUA 2HRYA 1UKUA 2VIHA 4DL6A 1JLFA 1SUQB 4PABA 4DN0A 1VQ7S 4C8OA 2DNOA 1KKHA 3F44A 2XHCA 2BZ2A 1DY3A 2F4VF 3CD7A 4B3SJ 2WONB 2Y8YA 3JTOA 4JI7F 1XERA 3Q86A 2R2SA 2W4CA 1NNDA 4LFAF 3R5BA 4EI2A 4DSLA 2XYPB 1T9VA 2GZOA 1UVKA 3M2UA 4F4WA 3BPSP 2RF2B 4NYOA 1IM6A 2IIHA 1VHFA 1XNQJ 1UJ5A 1X9WA 4W98A 4PZVA 1QVGR 4QJVA 4U67Q 1NAQA 2EK1A 3ET6A 2OELA 2FGOA 2DKOB 1N5QA 5KT4A 3QATA 3CJSA 3DMJB 1CC7A 4DG1B 3ZZPA 1YWXA 3VAJA 3NEKA 2HWIA 3D9BA 1VK3A 3T6JA 2W24A 3TW0A 3CCLS 1SKUB 1KQFB 1PAUB 3KUEA 1HR0F 4NA3A 2ZH9A 2GIFA 3MMAB 1U0HB 1LWEB 1U6ZA 1C0UA 2XMJA 3W60A 1ZAXA 1RAEB 4HHHA 4ITSA 1FD8A 2MQLA 3Q8UA 3K5PA 2JEGA 4YFUA 4DL3A 1FK9B 1N5SA 2MKSA 3W7BA 4ZITA 4DR4J 4KAIA 3NNAA 2OAUA 4Q43A 3NBPB 2IC3A 5GAHI 4C11B 3W2WB 4WWSA 3CCJS 4BC9A 1FXDA 4YQWA 3PX0A 1DQ8A 3MFHA 3POTB 3C16B 2GO8A 3NMRA 3GILA 4DV1J 1V5VA 3CD6S 1M5OC 2QJ3A 2Z56B 3PO5A 1Y5NB 1BE4A 2ZH8A 3G87A 4FXVA 2VC0A 1WC6A 4CIOA 1UEUA 1CULA 5F41A 3KUGA 1TL1B 2VQEJ 4KFBB 4ZVFA 1FNOA 4IG0B 2DHXA 1VQOS 2E1AA 2GMHA 2VU5A 5E0OA 3OSPA 3CCMS 1FJGJ 4OYOA 4DSFA 4WYLA 3DLEB 3EMTA 3PV8A 4DN9A 2Y3YA 1AB8A 4HLBA 4ES3A 1DTTB 2DH7A 3TVZA 2EW9A 1FRMA 6FD1A 1VJWA 2IM3A 3JTPA 2GA7A 4JI4J 3T3FA 3CC2S 3RBZA 2FJDB 4KGKA 4TLQA 1CJTA 3OUYA 3PW2A 1VR6A 2I2YA 1AZSB 3GFXA 3K5NA 5DDRC 1EKSA 4OI0A 4I2PA 3KLGA 4YDXA 1WI6A 2B7BB 3JSMA 1OY6A 5HMZA 3QO9A 3FEXB 4WP3A 3LWMA 3GTYX 4USKA 3ELHA 4WZQA 2FLOA 3IG1A 1ZZNA 1X9SA 5E3QA 2HVDA 3SQGA 4OZNA 5EX3A 2G0CA 2AYMA 2OD6A 1Q79A 1YHQS 4Q8FA 3E8OA 4I7FB 1S1WB 1OYEA 1T9WA 2G0JA 2NXNA 1GTHA 4O0NA 1R7IA 3R6LB 4ZJLA 3CCQS 4B9UA 1S1XB 1S97A 3W5YA 3QLHB 2E7XA 2VDHA 3SCIE 2E7WA 4NLPA 2G2OA 2AEJA 5HQMA 3DRRA 3FQLA 2C3YA 1LWFB 4OJGA 5F8IA 2JEJA 1TKXB 3BEGB 1IKXB 2ZE2A 4AXIA 2MZJA 3ITHB 4OYZA 5F8GA 3CNQP 2WBMA 2K7JA 5KG2A 4FVMA 2J7KA 1VQMS 5BYQA 4CLSA 4NLVA 4O4RA 1WC3A 4OI4A 2IRUA 3ZTRA 4NA2A 4L73A 1PIEA 4YB6A 1LW0A 1Q8BA 2C3MA 2BRKA 4KV8A 1WTBA 3CCVS 3O44A 1S1VB 1SQFA 2XMUA 2P9GA 2XO7A 5DM7Q 3CJQA 4NPOA 1FRIA 1N5VA 3I6PA 1F9HA 4IOBA 1WSVA 3KJVB 3VAKA 1YG0A 3BQ0A 1U1KA 2W1BA 2E5LF 2VPYB 2ZBQA 3D5MA 4NLDA 2Q79A 2XY7A 4M5JA 1KQKA 3AH6A 4OYMA 4BCAA 2YQ3A 1Q0NA 4Y2MA 3AY0A 4I2QB 1KHVA 5ETKA 1RT1B 2RKIB 2HVZA 2JLEA 2W01A 2QO3A 4FNIA 2ZZMA 3QPIA 3O3LA 4CI0B 5J2PA 1NH7A 1TAQA 1VQ5S 5HP1A 3GIJA 2CZVC 2AT1B 2FJEB 3AT1B 2NXEA 3EXCX 3DI6B 1N33J 1ITPA 2YKAA 2OGUA 4ZPAA 3NGUA 1CSJA 3HHLC 3T5HA 2V8HA 1NMEB 4N8OA 3CC4S 5EX0A 1NK5A 4X66J 2LQ5A 3KDNA 4OX9J 1O8BA 4LF7F 2KT5A 2ZBPA 3WIVA 3M1VA 4P7VA 1RADB 1H2UX 4Z2XA 3CIZA 4DV4F 4ZCIA 5KFAA 3U7JA 3D28A 3ZZ0A 4ED7A 2OPSB 1TKZB 2HEKA 2QL5B 1T8EA 2YQ0A 2JEFA 1B64A 3IR5B 2B9WA 1IM4A 2AIRB 1R31A 1LWCA 4TYBA 2CPEA 2MSTA 3Q8QB 1T3NA 4OV6A 3BR9A 1T05A 4PR6A 3C15A 1RT6B 2N4CA 1CPZA 3HSJA 3THTA 4KPYA 2HK3A 4DV6F 1ZM2A 1SL2A 1NSKL 9RUBA 4A8OA 3SSQA 5KFXA 1UL3A 3MPDA 4OQJA 1IN0A 2PEBA 2DPIA 4J9OA 2ZH3A 1YDLA 3BF4A 2B9XA 2RS8A 4G1IA 3HVWA 3DHWC 3J80Y 2GMJA 3CMAS 1XIQA 4X4TA 2OSQA 1Q5YA 1Y4ZB 4LVNP 2BJEA 5A8WB 2CXEA 2EBGA 2L3MA 3R1HA 5CZVA 2CQBA 1BWEA 4QZVB 3KUHA 1U2CA 4ZVGA 2NCKL 1PG5B 4AL5A 3CMQA 4IR9A 4YR0A 3MECA 1WELA 2Q43A 2MZSA 3V6DB 2XMAA 4YR2A 2XGPA 2ZZNA 4LF6J 1TUGB 5ITHA 3GR1A 3ADAC 4BBYA 4RUAA 3I5BA 3MR3A 4DSEA 3KK3B 3C14B 1JJ4A 2AYGA 1X4DA 3AJDA 1LQ9A 2ZM6F 2H4WB 3ZFVA 2M4MA 4O3SA 1WF0A 3TUJC 3QIPB 3FDSA 3KG4A 1N48A 2IJRA 1RLCL 4DI6A 3BB5A 1TL3A 1F3VA 2FYXA 2OPPB 2LXFA 1RTIA 2YPYA 3Q22A 4WK3A 3WBZA 3JSBA 3M8QB 2KKHA 2EK6A 2G13A 2PA3A 3FRYA 3R7SB 2CQ0A 3P8BB 2OSRA 1L3SA 1HA1A 4MJKA 4PG7A 3DOMB 5HSPA 4TXSA 4DL7A 1P1LA 2C3UA 2XC9A 1BQMA 3PJXA 1OY9A 2RHSB 4Z7CA 2HIYA 2VF3A 1JWWA 3K59A 3M7VA 3N0VA 2XNRA 1QY7A 1RQ0A 5EGYA 4W4MA 2DR9A 2LFVA 4QWBA 1B4SA 3O6QA 5LT5A 3RRHA 4NCGA 3SEOA 1HWLA 2Y1RI 1VISA 2QLBB 1REVA 2RHQB 1GT8A 3H0PA 1WKJA 4FDFA 1J5OB 2QMXA 3AOCA 4WJBA 4E2FB 3HZEA 1N4LA 2UZAA 1IR1A 2R7TA 1DQ9A 4X2BA 2LDYA 3AFGA 3JB9k 1QSLA 4PAAA 1T9YA 2WB4A 2MKHA 3MMBB 2BR0A 1UFLA 3IWLA 1XMOJ 4DR1J 1RWXB 2IPOB 1RA7A 1MNEA 2DNGA 2K7KA 3VWSA 2DD8S 4QWAA 1AA1B 4PPDA 4X4RA 4WE1B 4JV5J 1CJVA 3I96A 4QIFA 3CVKA 3D0GE 2CDQA 2R2UA 2XLKA 5AJ3F 1Q82T 2HQ3A 4C2MA 1SUQA 5GADU 2VG7B 4DPTA 2CZ4A 5B0AA 3CO0P 4H4KA 2HPUA 1GX6A 3RBEA 4FZVA 2HZCA 2WONA 1KLMB 2GJIA 4DR6F 3HDSA 2GHPA 2DGXA 2ZDOA 3I32A 2MQQA 4X64F 2DK2A 2XS2A 4DUZJ 1R0BG 1KHWA 4Q8EA 5ETOA 4U7UK 3L7OA 4JUZA 4OX7A 1FNXH 4RU9A 3KOAA 4EO8A 2RF2A 3ZXWA 3M4XA 4EYIB 5FLXY 2Q3PA 4NI2B 4MKAA 4PPZA 3I87A 5DGAA 1K44A 4B3TJ 1FO1A 2CQCA 5CA5A 2BEFA 3DMJA 4DG1A 4KPCA 3SQOP 2DO4A 2B6AB 1B0PA 3BSAA 3NNCA 4DUYF 1T9UA 4UY85 1ZM4A 4KJIA 5D6GA 2BXJA 2ZC3A 1KWMA 3LWLA 2IMWP 4MTPA 4M95A 2HBYB 3MMAA 5FDLB 1U0HA 1LWEA 3ENVA 5H9EK 2QIFA 2PMWA 2HHVA 2DEJA 3HM9A 2MQ8A 4N8NA 1JLCB 1RWVB 3DN9A 4TLRA 2H9ZA 4CH0S 4Q2MA 3CJ8A 4J90A 4JV2A 4KHPJ 4NMLA 1IBKJ 3T41A 2MYFA 2AJ1A 1VQPS 3B6BA 1YJNS 3UVJB 3QAEA 5IOLA 5HJYA 1GAOA 1N32F 3NGDA 3W2WA 3JTNA 2AHOB 3POTA 3C16A 4QWCA 3VR1A 3MEKA 1W26A 4B3SF 1ZTWA 4LRAA 2DNYA 4Y3CA 2MZTA 2AZ1A 4WXOA 2DNMA 1S4FA 1T03A 2VUGA 2NQPA 4DFMA 2GX8A 2KM8B 1Y00A 3SSRA 3MFIA 4TU9A 2RDDA 4ZVPB 1Q8KA 4OHWA 3FEYB 5D78A 1XNQF 4HH1A 3QJPA 4F8RA 1BUXA 1TL1A 4KKOB 1G4CA 4RW7B 1IXKA 3TNVA 4X4VA 1GQEA 3F73A 1S57A 3F56A 4L3NA 3DLEA 3J7A1 4F25A 2XULA 2GIRA 4DJBA 1DTTA 1XMQF 4XPEA 1SB6A 2KO1A 3HSDA 1IR0A 1FKOB 4USUA 2YWFA 2EI5A 4F4KA 5L46A 3DDIA 2VQFF 1FVQA 2NPFA 1VQ9S 4AYBD 3GQCA 5KG4A 1AZSA 2FQQB 3GCWP 2AJ4A 1YI2S 5CHCB 4EBCA 3PR4A 4ED2A 4DR4F 1HI8A 1F5AA 1D1UA 2CA9A 4HDHA 4A8YA 3CDUA 5I3UB 3TANA 3FZ2A 4NXMJ 1HWUA 2B5JB 3TA1A 1VRUB 4QPTA 4P72A 4L6V3 3OFGA 4I7FA 3UI3A 1S1WA 6FDRA 5G4DA 1RTJA 5IZHA 2Q66A 1AROP 4ZP7A 3VGVA 2HHPA 1FFGB 4N76A 2YNHB 1Y11A 3QLHA 1RHJB 2JVOA 3G96A 1V6HA 3FGVA 4HI1A 4KBIA 4J9RA 4LFCF 3U02A 2YKMA 1LWFA 2OPRB 3H2UB 3BYPA 2VQEF 2HYIB 4HHJA 5DO2A 1IKXA 4CTAB 4B3RJ 3B4DA 3Q23A 3ITHA 5A8KB 1FE4A 3MF5A 3SFUA 3THVA 3S7RA 1P1TA 1H2VZ 3CCSS 1ZYQA 2O01C 3A13A 4Y00A 4DQSA 1MW7A 4J9KA 2VASA 1SJ3P 2M0GB 3MM8B 4QPXA 1HD1A 1VIOA 2B51A 1CJUB 4ZVUB 2ZKUA 1QLNA 2RDJA 4M5IA 5HK4A 4B3MJ 1YJTA 4UOGA 2M9KA 1MMDA 4Y28C 3KJVA 3R1LA 2GAHC 2BBEA 2V9WA 3CSKA 5C42A 4LRCA 2J7UA 4CO3A 5D4NA 1RAOA 2JWNA 3K2YA 1FDAA 5IT4A 4I2QA 2RKIA 4KE5A 2BMBA 4F2SA 2L9NA 1VRTB 3K89A 4LF1A 1NB7A 2XZTB 3VAMA 3IFEA 2F8HA 1QAXA 2N4DA 4J9PA 2PMHA 4C0HA 4WYWA 2D3ZA 2ZVSA 1AW0A 4XAKA 1FWPA 2EG2A 4FYWB 3RU0A 2ZHAA 4GKJJ 4NLYA 1Z2ZA 3KLEB 3BKTA 1ZTTA 4JP8A 3BKUA 1YBTA 2R7OA 2R8IA 1BMQB 1R8AA 1XK8A 2OPSA 2CVIA 5I3QA 3MPYA 4CWBA 2VBXA 2HQDA 4O3RA 2IVMA 1NH8A 3RR7A 4OLPA 2HRUA 2VB6A 2CJXB 3Q8SB 5CYQA 1IBLF 1VS3A 2V8GA 5HL7Q 2YY3A 3ZO7A 1Y7PA 1TKTA 2ZHOA 5EWEA 1YJ9S 2VH7A 5L9NA 3GV8B 4EFAC 1SC4B 3PYDA 2UUWA 2DIUA 1QE1A 1LXJA 1RT6A 3WIUA 1RWKB 2QYGA 3JQJA 4JI1F 4I1TA 3CJ5A 4EK2A 3OPKA 3VAHA 3LUYA 3HHDA 4A46A 1FNMA 3T1HJ 2MHEA 4PYAA 3CDEA 1KONA 2CNLB 2D74B 4K8RA 2V6AA 3BZQA 2AW0A 2DH8A 4GKKF 4GC6A 5F3ZA 4F2RA 1GTEA 5A8WA 1X0FA 1WDTA 1S6PB 3M6UA 3GIRA 4H4KC 2JEIA 1OMSA 4ZVHA 2CADA 5C2CA 2GQCA 2LEAA 3MTJA 3RB4A 1N33F 3EE3A 5IT0A 3GR0A 1VFJA 3UCZP 1YITS 2XWXA 4CLLA 3A8EA 3V6DA 3OTOF 4IO1A 4X66F 4JI3J 4OX9F 2BQUA 1SKSA 2ILYA 3RB0A 1MWQA 5CABA 3DM2A 1H98A 4R25A 4DU8A 2PC6A 3C14A 1MMLA 2MKYA 4LT6A 1B99A 1Q4RA 4ZPCA 2AP6A 4ID5B 5JXSA 2RDIA 3M05A 4Q0BB 2UUBF 2QA1A 2JDJA 3IR6B 3QIPA 1TVRB 3OFEA 3R5JB 4ER8A 2E9RX 5EHHA 5I3PA 2GAGC 2OPPA 3T9ZA 1DTQA 1N52B 2M70A 1K8AT 1X4BA 3K0JA 3N5BA 4OJHA 3L7UA 2GC8A 3M8QA 2DT9A 1WOOA 4P73A 1LOUA 2L41A 4OHXA 4CDIA 2KZMA 1GXUA 5D3GB 2CQGA 3FEZA 3ZTSA 3CT9A 1VLOA 2FZCB 2QSWA 3MCNA 3R7BB 3M8RA 3ILLA 4IG3B 3DOMA 4XDDA 2J6SA 1U0SA 2J0WA 4BLGA 3G82B 2VBYA 1K47A 1OSCA 2FB0A 2HNDB 3QT8A 2I5JB 1S6OA 3L9ZA 1LFWA 3TO8A 4RNMA 3X3UA 5DGBA 1E6VB 3JQMA 1CS4B 1SPBP 2PFDA 4V1Ak 4AUKA 3NCQA 2R4FA 1NDPA 2ZKTA 3H90A 1ZETA 1Q53A 4KSEB 4FF2A 1QSYA 1UJ4A 4NEZA 3CMES 3ZZYA 2M8HA 2RJZA 2UP1A 3M9NB 3KWMA 5JUMA 2JHEA 4I4BA 4FKYA 1J5OA 2VICA 5HQ8A 1VC0A 1R8BA 1PSDA 3HFKA 1L5UA 1WC0A 3O5TB 4X62J 1RSCA 3EGVA 4QIVA 4NLSA 3Q8VA 3SCKE 3FBFA 4JV0A 4M5DB 3GE9A 2W9CA 2KVIA 2JX2A 2B43A 4X84A 3BSNA 3QGPA 4FVCA 3PRVA 3BKFA 1N54B 3RR8A 1FE0A 2CIMA 3B82A 2CKWA 2O1PA 1NO8A 5ETVA 2YWWA 3AXKA 4I64A 1GNKA 2VHGA 3HP6A 1V9OA 1YJWS 1PGZA 2AJ0A 2U2FA 4RNOA 4OZ0A 4WE1A 1VBXA 1S48A 1EIYB 2NZCA 2QT7A 4LJMA 3HSGA 1CLFA 2O3DA 2PGCA 3EZOA 3J7AN 5GAHU 3C8YA 2BJ3A 2ZJQQ 3G2XA 1FJCA 4DS5A 1T0TV 2RH3A 2VG7A 2HLTA 3GONA 1KDNA 4ERDA 3TAMA 3Q8RB 2I38A 4RUHA 2AJ2A 4OZ2A 2PIIA 1KOOA 4OYBA 1OYDA 2F4VJ 1VBYA 3KG0A 1UZDA 3FFIB 3DLGB 5AE2A 5DDOC 2KT2A 4JI7J 1AFJA 3H4DA 4LFAJ 1JXLA 4DPXA 3RRGA 3RYLA 1YJUA 2U1AA 3TJ8A 4Q2LA 5LMNF 4YB5A 2KRRA 3GIIA 2I6WA 4YUDA 2B6AA 4CT8A 1HBUB 1OQ6A 1VCTA 4RWWA 1RACB 2NXJA 2XY5A 2KDOA 2Z2MA 3V6HA 4PXDA 3D54A 2NUUG 2HFVA 5H1SV 1XMOF 5FDLA 3UD5A 5KFFA 5BYSA 5HMYA 2DR8A 2AWZA 4AFFA 4OZ1A 4B9SA 1HR0J 1HNIB 4RW6B 5HJXA 2J76E 1RABB 3GG1A 1S76D 2XHWA 4PXCA 4JV5F 2C2KB 1H2TZ 3QSIA 2Q1LA 5J2MB 3DRYA 3MOZA 4NCAA 3UVJA 2DITA 1AXQA 4B17A 1I3OB 4M5GA 2K2PA 4N5SA 2A1BA 2UXBF 3MPVA 4B3OB 1NDLA 2CJBA 5DLFA 4WF9Q 1PKUA 3PW0A 2KHCA 1O51A 3I31A 2DH9A 1RHQB 3UE2A 4DUZF 2F9JA 2NXUA 4EGLA 3F41A 1S1UA 1NBEB 1EX8A 1VQ8S 2MPUA 2FLNA 1IQZA 3HVRA 2WVBA 3VGTA 3FCHA 5FJ4A 2Z2YB 3N6LA 4DQRA 3NKYA 2ZH4A 4K0KF 3G6VA 1WKLA 1TMJA 2W9AA 1IR2A 4WBFA 3PHEA 1EJ7L 3WQPA 3HVTB 4CLWA 4F3OA 5IV4A 1FKOA 4ZVTB 3SI8A 2KL8A 1RT5B 3RAXA 2HWHA 4DPYA 5LM7E 2K1RB 1B0TA 1SQGA 2XS7A 4R5PB 4DQQA 3WX8A 2E1RA 2QRRA 4QR2A 1RT3B 3GJTB 1IQTA 4RPFA 2X1AA 3EPGA 3MURP 1BWVA 4ECZA 1UFKA 4NLTA 4KHPF 3AODA 3DYAB 2G4BA 1CVJA 2HQGA 2IM2A 3HX9A 5JVGQ 4OZ5A 3ONQA 3QZ8A 1X9MA 2X51A 5I3UA 3W65A 1U8SA 3FUYA 2R8JA 2IJFA 4N77A 4E98A 1WHXA 2B5JA 4HEA9 3N28A 3IWXA 2RS2A 1VRUA 3MXHP 4ILRA 2KYZA 3M8YA 4YMEA 1WG5A 1TK0A 4F0KA 1YJ7A 5JJBA 5LOQA 2DY9A 1TK8A 5DRKA 4I6AA 1PC5A 2YNHA 4C0OC 2H65B 4DSJA 2RUSA 2APOA 2W2PP 4C98A 2QG9B 4ZJOA 1NPRA 1NK6A 2NSCA 3OJSA 1NJIT 4A8QA 1H7XA 2WVFA 2KXHA 2OPRA 5K9FA 1B0VA 5GVQA 3G6XA 1LK5A 4CTAA 5MLCV 1JNZB 2YWKA 4MIWA 5KAKA 4RWXA 3UN5A 3ULHA 1PYOB 3PG9A 4LR7A 2BQ3A 3MTKA 2ZWPA 3MM6B 1IBMJ 5DDPC 3LAKA 3ILIA 3MM8A 4QQBA 3TA2A 5K20B 4DMZA 1XQIA 4AL6A 1JB0C 1CJUA 1S4EA 4ES2A 2M8DB 2XCPA 4ECRA 1OWXA 5FIIA 3LP1B 1KSPA 1H7WA 3CF5Q 1NSAA 4TU7A 1L3UA 1FERA 4WTYA 4DCPB 4BC7A 3C6TB 2N7CA 5L1JA 2IYIA 1FVSA 3M8SA 5D4LA 3IS9B 4ED5A 4JI6F 5HANA 2LA4A 3UWTA 4DL4A 3SV3A 2J6UA 3AHPA 2L08A 3FC9A 2W2QP 4NA1A 3WC2A 2HMIB 1FJ7A 4DV5F 1HI1A 1IKVA 1RWWB 3HFVA 1RA6A 3OVAA 4QYRA 2QC3A 3NAHA 3GV5B 2OTJS 2IVFB 5T41A 5B09A 1UWAA 5AE1A 4NYPA 2HBZB 5K8OA 4P2SA 5CCLA 1WG4A 5KFKA 1FKPB 4R8UA 4J9SA 3KLIB 3MZIA 2XI3A 3KLEA 5E3AA 3ZZUA 4URSA 4UY8T 2BE2A 4DFPA 2HURA 3HD2A 2EFQA 2CFXA 3H5UA 4M5KA 2IRYA 4B3RF 1YRXA 3BH6B 1LKZA 4LF7J 1BC6A 3DXSX 4ZS6A 3U1MA 1FRHA 3W63A 2ZITA 4WU3A 4ECSA 4KIAA 4LF9J 3KMSA 1U45A 3HT3A 3GP9A 4DV4J 3R8YA 1T9XA 1BQNB 1RUSA 4ILLA 2I0XA 4KHMA 1F5BA 1VQKS 2IA0A 3V2UC 1WNEA 2D3OR 3D3BJ 1XWLA 2D69A 2B4VA 4DF8A 3THPA 4KR0B 3R5GA 1URNA 1N5YB 2VV5A 4N56A 3TWZA 2HFSA 2RRAA 4PWDB 1TMMA 1FRLA 4DV2J 4DV6J 4CCHA 4XTTA 1EHWA 1F1BB 5HVFA 3C3LA 2UVVA 1S6PA 2MQPA 2ZJPQ 2DXEA 2OJ3A 4C0BA 3MMCB 2CQ4A 3LH2S 1UW9A 1NK8A 4UOHA 2HGLA 4RNHA 4A48A 3G8QA 1UMJA 4G1QB 1Z1ZA 3NCPA 1JK9B 1KNZA 1YIJS 4WZMA 5IFMA 1KN6A 1BGXT 4C8KA 4M5LA 3RW6A 1YZ6A 3HZGA 3CE8A 3TVKA 1X8DA 4FBUA 1D0EA 2V2ZA 3IC1A 1W2IA 4RKUC 3B4MA 5DQHA 1TKDA 2IBOA 5ETQA 5B0DA 4Q0BA 4MK8A 3K17A 4ZK7M 1Z2LA 1F3FA 1TVRA 5SZTA 2AQ4A 4QCLA 2L9WA 1BD6A 1R43A 3N6NA 4RBTA 3Q24A 4P75A 2WW8A 3MM9B 2ZM6J 1F60B 3NY0A 1KFSA 3NGRA 3NRBA 1K9MT 4LQ3A 2N7YA 3OFHA 3M9MB 5KFNA 5F0UA 2BW7A 2RB7A 3RTVA 4MYUA 1S9GB 1B7FA 3ZTPA 4USJC 4RLEA 4DSIA 2D9PA 1FRXA 2VFTA 5HMWA 5D77A 1WEZA 1QVFR 1UVNA 3GCXP 2FGCA 3DLBA 3MM5B 2RRNA 4F26A 1TZ0A 3GB0A 4P2MA 2HBQB 4L76A 5CCMA 2PDAA 1JJ2R 1FI4A 4ECXA 4NMXA 4PRFA 1CS4A 2XLIA 3DLHA 3TA0A 1KC8T 3EPIA 4G6VB 3HKWA 2CYYA 1HQUB 5ETNA 4FXDA 3KHHA 2KM8C 2HKEA 1KTVA 4O44B 1ZOTA 4J91A 2OIHA 1U47A 1DARA 4CZCA 4GMKA 5CQGA 2AGQA 5IC6B 1U8WA 2I8EA 3LW5C 1GXTA 3IGNA 5AXKA 1DBDA 3SZ2A 2KXNB 3PKYA 2B4UA 2GVZB 1U25A 5CZXA 3GIKA 2UUCJ 2DVIA 2HHTA 3I0RB 2EG1A 2GQ2A 3JSRA 4M5DA 3TRGA 4A8FA 4OJ3A 3BV8A 1UTAA 4N41A 2J5AA 1SV5B 2W2MP 3MR2A 5GMDA 1U6BA 3NS7B 4LFBF 2EFGA 3VHQA 1M90T 4YB1P 1N0VC 2D3UA 4IQXA 1VK8A 4PWWA 3DHXA 3QJLA 2DCUB 5E33A 2OO4A 3IO1A 2KZZA 5D8HB 1M5SA 5H9FJ 3TQ1A 1X4EA 1TTHB 1IWGA 1GH8A 2RRBA 1NDKA 5I42B 3PX6A 3VAFA 4C48A 1YLXA 3D6HB 3SDEB 5THWA 3M30B 1FCAA 3IAM9 2UXCF 2VFSA 1P8GA 4H54A 3MD3A 5AJ3J 1ZBTA 4B08A 4Y2AA 1MN7A 1SKWA 1U2RA 1Y3KA 3AJ2A 5LSLA 3D1QA 5RUBA 1KD1T 3FFIA 3DLGA 2W9BB 3ISND 1RT4B 3MEGB 5GAEI 4KO0B 2KU7A 3MEEB 4ENOA 2K3KA 3HHLA 2W7AA 1P27B 4X64J 3BBCA 2MXYA 2E5JA 2C3PA 4QIEA 2XG8A 4M1KA 4UUXA 1IKWB 1M5PC 5FLXU 1WD6A 2XMKA 2JJ4D 3RGIA 1G2EA 2BABA 4USIA 4WU2A 1SBRA 5IXUA 1BXNA 2HLUA 3Q2TC 3PRDA 3H4BA 3OD2A 2WCXA 1U1OA 3A3NB 2ZNZA 1WUUA 1WTFA 3MEDB 2V4JA 2HVIA 3DOLB 1RYRA 1OJ4A 1FA0A 2YH1A 1Q7LB 3QYYA 2VG5A 1QTNB 2F5GA 2VKRA 1ZAWA 1JLGB 5IQQA 2IDEA 2EC2A 2IAJA 3PFEA 1SC6A 2B4PA 2F63A 1HNIA 4RW6A 3NS6A 3T1YF 5J2NA 4K2XA 4URGA 3H59A 1GMUA 1YGYA 1VQ4S 2M52A 3GYNA 1NDCA 5J2MA 3F0NA 1C1CB 5A2QU 1CQMA 1YBUA 2GCFA 3MD1A 1JIHA 4IH7A 4LRBA 3IXQA 4O3NA 3DRXA 4K2JA 4LF8J 1XR5A 4J9NA 2W4PA 1N32J 3OHAA 2F7VA 4DR7J 2AZ3A 1DURA 2C2MB 3ENQA 3W64A 3HK2A 1IKYA 2HNZB 4B9MA 2F65A 3WHIA 1F9EB 2BRLA 5EWFA 4ZIWA 2CPIA 2WRMA 1PO6A 2VBZA 3HVAA 2J9DE 2GJ2A 3JAMY 4DV0F 5C24B 5L1KA 4IYQA 4NOHA 2RVJA 3E3XA 2CNOB 2LXUA 2GVDA 2J8AA 1SIWB 1FWLA 4FYXB 1JLBB 1PJ5A 4CH7A 3MPWA 5D0HA 2VL1A 4RO0A 4ECUA 4X4SA 3G8TA 3M2VA 1NK0A 5KT2A 1Y0HA 2Z57B 1SC3B 3U27A 3R6GB 3AD7C 3KFWX 4N47A 1OQ3A 3OTBA 3CJRA 4RZRA 1EETB 4ELTA 2BKPA 1VBZA 4J5OA 1VQ6S 4OI6A 2YKOA 1RT5A 2ZH1A 4NZ0A 3Q8YA 2K1RA 1NK4A 4QBUA 1XMQJ 4PXEA 2OEJA 4R5PA 3PW7A 2OI2A 5DETA 3JXOA 1N36F 3EDRB 2DNZA 1X4HA 2VQFJ 1MG7A 2XQCA 4I6WA 3FMWA 1TAUA 4RBVA 3LANA 3R5DA 5KFIA 1KOHA 4CNYA 3N01A 2QFIA 2BANB 2B3TB 2OH2A 2CJAA 2YNGB 3CCTA 3ENAA 4PUOB 4YP3A 3TAQA 3DLKB 1HL6A 2QSFA 1S0VA 4DF4A 3N6MA 1CQNA 3U1LA 5AT1B 1RBLA 3HJFA 3VZIA 2O66A 2FVRA 4B9LA 1HHSA 4HACA 3OFFA 3B54A 1HPZB 1C0TB 2WOMA 2CQPA 4K4XA 4CH1A 5KG7A 2CQ1A 2MJUA 2K06A 5E3RA 2RIJA 4ZPTR 3TUZC 2Q6BA 2DY1A 4UOCA 5JVHQ 4C8MA 2FLLA 4LFCJ 3Q8PB 1JJCB 2CWXA 5ETRA 1G1XA 2G0IA 1RAFB 2YKQA 3I9V9 1S1TA 1ZM9A 3MR5A 3MM6A 1O0PA 4F36A 5IM0A 4CM0A 1F0XA 4RR5A 4USWA 1Y3JA 4LSZB 4ZCKA 2ZEJA 3R2CJ 1WHVA 1K1QA 4ED6A 3LP1A 1P9YA 3KTQA 2E7VA 3C6TA 2HSEB 3CCUS 2BM1A 4OJ1A 4TQSA 2ABYA 3IS9A 4IUFA 4UT4A 1RP5A 2GQQA 4IFYB 1SJQA 3VQTA 2FY8A 3CJ3A 4WIQA 2RMLA 1RXOB 3BR8A 4QOTA 5KFYA 3PZPA 5T7LA 5KFCA 5J1NA 2FJWA 1KS2A 3OTCA 3ET6B 2ALYB 3WDOA 9ATCB 2DGVA 1VLYA 3H20A 2FJAB 4LUBA 2YX1A 4CLPA 1M5KC 4P6QA 3W9HA 3CDAA 3DLJA 2MY7A 1TQLA 3EUNA 2ZDPA 4OFZA 3CD5A 1FKPA 2IY5B 3E2EA 4C3KA 4V19J 4X4QA 4K4ZA 4DX7A 3PTWA 2W2OP 4GVBB 5KT5A 1C0UB 2QA2A 1T95A 4AQYJ 1RHUB 4P7TA 3BN7A 1RTZA 3UD3P 5EWGA 2DGUA 5HMXA 2WHOA 1S7HA 4CO2A 3UN2A 1PYSB 3EX7B 1IBMF 3S1TA 3BGRB 1RAJA 3VTIA 4IH5A 2XY6A 2F9DA 3MCMA 2FVPA 3CCZA 3D6TB 2FUG9 4NLWA 4MK7A 2GO9A 3LP2B 4C8ZA 2EBEA 1KRPA 1IBLJ 2ILZA 2COLA 1DHMA 1N5YA 1RBAA 4OI2A 3U1NA 4PKDB 2OHDA 2BACA 1FWKA 1RDRA 4PWDA 2CJKA 3RRKA 4JI1J 3HULA 1D8ZA 4OX6A 5F9NA 3C66A 4ZPBA 3R9LA 4OZLA 1APSA 4IFVA 2MGZB 3L95X 4C7QA 3PACA 2AD9A 1UA1A 3R97A 1U2FA 4Y34A 3GJSB 4FYYB 4GKKJ 1RB0A 2HS0A 2BJ1A 4G1QA 4CLZA 1RAHB 4UQTA 3T9NA 2H3EB 2HGMA 3ILOA 4LVOP 1REGX 4O4GA 1I51B 2FJBB 1RU2A 3HSZA 4EWTA 4U6PA 1FTRA 3H5XA 3OTOJ 4K7QA 5F8JA 4ZLNA 2YKNB 4L75A 1S6UA 4MKBA 3OUYB 1UEKA 4BS2A 4JI8F 2ZD1B 3PW4A 2HGNA 2V94A 4I2PB 4LF9F 3SCJE 3IRXB 2QMWA 5E2QA 1U1QA
chains in the Genus database with same CATH topology
1RISA 1R6YA 2I9SA 4AE5A 5KFBA 1FTCA 2GMLA 4MAKA 4NX9A 3X3UA 5DGBA 1E6VB 3MM9A 2KT3A 2XCAA 2FLPA 4AUKA 2GIQA 2MQNA 1VC6A 1UETA 2WSCC 1XNRF 1J2VA 2A3JA 3NCQA 1QTMA 3CEDA 2R8HA 2R4FA 4MH8A 2ZKTA 1ZETA 2CG4A 2MJNA 5LXRA 5F3TA 2V8VA 1U1PA 2RQ4A 1Q53A 1R8PA 4KSEB 3CIMA 1SQEA 4CNZA 4ECQA 4DR2F 1DZ5A 2KTQA 2OLWA 1D9AA 4FF2A 1VRTA 4GC7A 1PILA 1VQYA 1QSYA 2LU2A 1UJ4A 1U1MA 3SQGB 3NG8A 3CMES 5EN1A 3ZZYA 1OPZA 5KFQA 2M8HA 2RJZA 2UP1A 1TFWA 3PIOQ 3T1AA 3D0HE 3ZZRA 2DCLA 5HBMB 3M9NB 3KWMA 1S0NA 5JUMA 2ADBA 2KG0A 2JHEA 3PIPQ 4I4BA 3MHYA 1J5OA 5HQ8A 1SI9A 1MWZA 3VF0B 1VC0A 2VD3A 5AXMA 2RQMA 3VCDA 1R8BA 1PSDA 3D0IE 3TUIC 3HFKA 2PE8A 1L5UA 4ZOSA 1U48A 3IGVA 3BQ2A 2JFKA 5H9EJ 5KFSA 3OJUA 3O5TB 2HRYA 4DV2F 2VG6B 1UKUA 3UR0A 3J7YI 4DL6A 1BQXA 4QIVA 1JLFA 1SUQB 4DN0A 2A18A 3MM5A 1VQ7S 3CC7S 2AYBA 4C8OA 2DNOA 2OMLA 3V4IA 3F44A 3M8PB 2BZ2A 4K5SA 4DX8H 2DHSA 3M2RB 1NKBA 4NLSA 2F4VF 3CD7A 2EFNA 3MGJA 3SCKE 2ATLA 4KRWA 4JV0A 2WONB 3DRRB 3KK2B 4M5DB 3GE9A 2V4QA 2ZOGA 3PW5A 3JTOA 4JI7F 1XERA 2W9CA 2FTRA 3KNAA 2KVIA 2JX2A 2B43A 4O0IA 4X84A 3BSNA 4DL5A 2R2SA 3JYTB 3QGPA 2W4CA 1NNDA 4IQMA 4DLGA 3M6VA 4FVCA 4LFAF 3R5BA 5L1IA 2CPJA 1N54B 3RR8A 1FE0A 3TX8A 2J0QD 2CIMA 3B82A 4DSLA 2CKWA 2FVSA 2O1PA 3AAWB 5HROA 1NO8A 1UVKA 1IUJA 2MB0B 4HI2A 3M2UA 4TKTA 4F4WA 2RF2B 4DV7F 3P49B 3HHEA 4FBTA 4I64A 1ROFA 1S79A 1GNKA 1CEZA 2W8KA 3HP6A 1V9OA 3Q2SC 4NYOA 1YJWS 1PGZA 1VHFA 4PG8A 1HQUA 2AJ0A 3HO1A 1UJ5A 2U2FA 5M2UA 1LFPA 1XBWA 1X9WA 3I82A 4RNOA 3HKZD 4FF1A 4OZ0A 4WE1A 1VBXA 1S48A 1QVGR 1X4AA 3B8HA 1HNWF 4O44A 4PG5A 2QT7A 4LJMA 4QJVA 5KG0A 4U67Q 3E01A 3TVYA 1NAQA 2EK1A 4BHQA 1RKIA 3M32B 1CLFA 4DV1F 4IDKB 2O3DA 2FGOA 1N5QA 2PGCA 1FXLA 5KT4A 5GAHU 1ZZFA 1JMTA 3OXGA 2BQRA 1GX5A 3C8YA 3MM7A 3DMJB 1CC7A 4DG1B 4NLQA 4A47A 2FIUA 3ZZPA 2NZ4A 1YWXA 2ZJQQ 2BVZA 3RW7A 2D7SA 3VAJA 4B9VA 1FJCA 4DS5A 2RH3A 2HWIA 1MSWD 2AJQA 1VK3A 1JLEA 2VG7A 2ZBIA 3T6JA 1FEHA 2A2CA 3NWGA 2HLTA 2W24A 3TW0A 4OMFG 3CCLS 3LQVA 3DLLQ 1SH2A 2LYVA 1KQFB 4ERDA 5LSOA 3TAMA 1HR0F 4NA3A 1RT7B 3Q8RB 2XMTA 2ZH9A 3OR1A 1HBMB 4CQ1A 2I38A 4RUHA 3AB4B 3I56S 2ZH5A 1G7CB 2PIIA 1BLUA 3MMAB 1LWEB 4LSNB 2EWHA 1KOOA 1U6ZA 1C0UA 2KH9A 1C4CA 2XMJA 2KN4A 3NNHA 1ZAXA 2WSFC 1SV5A 1OIAA 4ITSA 1VBYA 3PJWA 3KG0A 2LU1A 3DRPA 4M63A 3DNCA 1FD8A 5K8MA 2MQLA 3OL8A 4EEYA 3FFIB 3DLGB 1R89A 5AE2A 5DDOC 2XI2A 2KT2A 1FJGF 4RBUA 1HNVA 3FMBA 5LL6d 3K5PA 3LGNA 4YFUA 5J2PB 4DL3A 1KLNA 1FK9B 2ZH6A 2JEGA 3OL6A 1AFJA 3TR5A 1N5SA 2MKSA 2SXLA 3H4DA 4DHVA 1JXLA 4QIWD 1GXLA 4K4WA 4Y2CA 3W7BA 3RRGA 5E3CA 3RYLA 1YJUA 4KAIA 4ZMMA 3LGMA 2OAUA 2KRBA 4WFZA 3NNAA 1RT2B 2E5GA 2U1AA 4Q2LA 1YRTA 4LIRA 4K4YA 2XMWA 4I68A 4Q43A 3M9OB 2WAQD 5LMNF 3RAMA 4YB5A 1M5HA 3NBPB 3OV7A 2CPYA 2IC3A 3OLBA 4IR1A 2KRRA 4RW4A 5GAHI 4C11B 2XS5A 2YNIB 3GIIA 3W2WB 4ED1A 1SIZA 2FC8A 2FHJD 4JI4F 5I42A 3CCJS 5KFGA 4BC9A 5J1PA 1FXDA 4YQWA 3PX0A 4YUDA 1DQ8A 4ZHRB 3MFHA 3QGHA 1KFDA 4TYAA 2B6AA 3POTB 1HBUB 4CT8A 3CJKB 3SDEA 1OQ6A 2GO8A 2KHDA 3M30A 4RWWA 3NMRA 4RW8B 1UVMA 3A1YG 3GILA 5KFWA 1YJRA 1X7VA 2XY5A 2KDOA 5KT6A 2Z2MA 3CD6S 2ROGA 3V6HA 4A8XA 1LK7A 3EGWB 4MFBA 4PXDA 3D54A 2NUUG 1M5OC 4GO7X 2MDAA 2QLWA 5H1SV 1XMOF 2ZH2A 3PO5A 1Y5NB 2DNLA 5FDLA 2W7PA 4ID5A 5KFFA 4E0DA 5BYSA 2B56A 2ZH8A 2JL9A 5CD4H 3OTDA 4FXVA 5HMYA 2DR8A 2N3OA 2VC0A 1RK8A 5F0WA 2AWZA 3UQSA 3HPOA 4FYDA 2LVWA 3TYTA 4AFFA 4OZ1A 4XK8C 4DFKA 4B9SA 4CIOA 1HNIB 1UEUA 4RW6B 2W9BA 2QEXS 2J76E 2R7QA 3GG1A 5M2RA 2MKKA 2LCWA 4Z37A 3MEEA 1IKVB 3ENWA 1XC9A 5F41A 1S76D 1F2GA 1TL1B 2XHWA 4PXCA 4JV5F 1H2TZ 4KFBB 4ZVFA 1FNOA 1DAXA 1YVFA 1IKWA 4IG0B 2DHXA 1VQOS 1TL4A 2E1AA 2GMHA 2Q1LA 4RNNA 5J2MB 4WKRA 3DRYA 3W2VB 3MOZA 2Y1IA 1QUPA 2MZRA 2XSFA 2J9CA 4NCAA 5E0OA 3OSPA 2EPIA 2RUGA 3CCMS 3HLUA 2DNKA 2DITA 3OW2R 1AXQA 3FNNA 3N4WA 4NLOA 1H6KX 4B17A 1MU2B 4DSFA 4WYLA 2DB1A 3DLEB 4EUVA 3PFOA 2KI2A 3PV8A 2FHMA 4DN9A 2K2PA 4N5SA 2Y0SD 4HLBA 2A1BA 2UUCF 2UXBF 4ES3A 2FHOB 4TY9A 1DTTB 2DH7A 5D3GA 3TVZA 2EW9A 4R8UB 1FRMA 3MPVA 4B3OB 4FNHA 4DSKA 2OPQA 1NHVA 2CJBA 2P9CA 5DLFA 4WF9Q 6FD1A 2QLXA 3PW0A 3NS5A 2KHCA 4QR1A 1VJWA 4ATNA 2P6TA 4RW9A 2IM3A 4IO9Q 3DOLA 2BE2B 1O51A 2AX1A 2IJNA 2GA7A 3I31A 3JTPA 2F40A 2DH9A 2XBPA 4IG3A 3T3FA 3UE2A 3AQPA 3CC2S 4DUZF 1G3OA 5C5JA 2F9JA 1D9FA 2NXUA 4EGLA 3F41A 2FJDB 4C97A 1AUDA 1UW4A 1S1UA 4KGKA 5LJ3Y 4TLQA 4JI0F 2UUAF 1JLGA 1TUVA 1UJ6A 3OUYA 2HNDA 4HTIA 4M94A 1VQ8S 4FS2A 3PW2A 1RJJA 2E1MC 2MPUA 2I2YA 3DXBA 3GFXA 3K5NA 5DDRC 4OI0A 4I2PA 3KLGA 4YDXA 2FLNA 1WI6A 1IQZA 2B7BB 3HVRA 3JSMA 4JI2F 3RB6A 3BO3A 1E6VA 4PWUA 5HMZA 3FCHA 2WSEC 3V4MA 2FY1A 3QO9A 3FEXB 5FJ4A 1X4GA 3LWMA 3BGUA 4ZCMA 1FRKA 3N6LA 1SL1A 3Q0AA 2VBWA 4WIIA 1C1CA 4OHZA 4WZQA 4DQRA 1P6TA 2KJV