2FHJD

Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
296
structure length
295
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Transferase
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
total genus 82
structure length 295
sequence length 296
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2005-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
D PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD01
2FHJD 1M5SA 2FHKA 1M5HA 2FHJA 1FTRA
chains in the Genus database with same CATH superfamily
5A8WA 1X60A 2VPZB 4B3RF 1FA0A 5G0RB 3LGMA 1ZPVA 2ZWOA 2CPZA 3HHLA 3VGVA 3R7BB 1UEVA 2N3LA 1S1VA 5CD4H 1B3TA 4A48A 2P9EA 1NK4A 1IQTA 3HLUA 3L7PA 2AD9A 4P2FA 1Y4ZB 1NSAA 3UCUP 1ZM9A 3ICLA 1BD6A 1GX6A 5J2NA 3R5GA 1YI2S 1Q81T 3JSBA 3ZTQA 3M8PB 5EN1A 3GIRA 3BBFA 3LAMA 3T5KA 5KFEA 3MMCB 4LR7A 3UE2A 1YJVA 5BYSA 2YNIA 3L95X 1RYRA 3IWXA 2VASA 2RUGA 4KGZB 2A6OA 4UY85 1FK9A 4J37A 2FVRA 1OY6A 2LCWA 2VFUA 2DNNA 1U47A 2W8KA 4RW7A 2UVRA 4IG3B 2BM1A 3CCRS 2LU1A 1N6QA 3NEKA 4QIGA 3R2DJ 5H9FK 1WHXA 3LOUA 3PYGA 2CUYA 5IS2A 4PCQA 3CD6S 5F8NA 1LW2B 2FUG9 1KHVA 1V5VA 1J2VA 1NSKL 1TMJA 1N56A 1GFWB 2ADBA 2H4WB 3MAAB 3WDOA 9RUBA 3IBWA 1EETB 1SQFA 3CIMA 2DD8S 2QEXS 1EQ0A 1DBDA 2Z2YB 5MAOA 2G1DA 1RT1B 2HURA 2WSEC 4NLTA 2XS5A 4DOZA 2W9BB 3IC1A 1TVRB 3LW5C 2ROEA 4CO4A 5IM0A 2W25A 1NXIA 2ZBIA 3M2RB 4FF3A 2QL9B 3C16B 2N82B 4WF9Q 3DI6A 4BDPA 5HJXA 3K58A 5A2QY 2ZJRQ 3D7SB 4ERDA 4F3QA 2FZCB 3UDCA 5D78A 1HBNA 1XMQF 5HLFA 5JVGQ 4YR0A 2DEJA 5D6GA 3Q83A 3FCVA 2BBEA 4ED1A 2LKZA 4B3TF 1UFLA 4Z2XA 4B9MA 5CZXA 4O3RA 1UVNA 2HWIA 4LF4J 4U96A 1IWAA 2ZZMA 5ETTA 3DLKB 2RQCA 1AYEA 1C0TA 1GMWD 5IT0A 1V3SA 4I6YA 4F4YA 2AT1B 1RHQB 2IYGA 3ETOA 4DUYF 1TV6A 3MM8A 4WP9A 5LL6d 3HT3A 1RT4A 1JJCB 2OPRB 4RKUC 4I2PA 1GH8A 2BKOA 4G1QB 4RUHA 2MMYA 3TQ1A 5EX3A 5FDLA 3KJVA 2FVSA 3QRRA 1O51A 1RHUB 1T0TV 1U24A 4B9UA 1O5JA 3PRBA 3VGUA 4ED2A 3NP5A 3EZOA 1WDTA 3H2UB 4DPYA 3ZXWA 5C25B 2MQNA 1WWHA 3PX4A 2E5LJ 4LFCF 1KN6A 3CJ2A 3MD3A 4DR6J 3D6TB 2BE2A 2V8GA 4LQ3A 1URRA 4GMKA 5HAOA 4U7CA 4DSLA 2DR6A 3MDFA 1YKWA 4NRUA 2EW9A 4LR9A 2BOAA 3KFWX 3K0JA 1IKXB 3BF4A 3MWBA 3QAEA 3CJ8A 1WC3A 1R8HA 2XSJA 3NS5A 4AQYJ 3OTOF 3MECA 1T95A 2V2KA 2LQ8A 3MM7B 4NPOA 4USTA 5HVHA 2JEFA 1FHTA 2VPXB 2KXNB 4QWCA 2HQDA 4YHHJ 2MGZA 3VGTA 4I2QB 3GPAA 2R7SA 5B0DA 5EWEA 2HNDA 3QLHA 4ZLNA 3KG0A 5BYQA 3GCXP 1HYSB 1N5TA 1RKJA 4YR3A 2DPJA 3HVTA 3CJSA 2D9OA 3DRRA 3I5BA 4I7FB 4M5DB 3W2WA 4FNIA 2XCAA 2B3TB 2VPWB 3W61A 1TL5A 1UVKA 4F4WA 1DRZA 3VVTA 5K8MA 1FXDA 2CYYA 2QFIA 3ZC4A 1V3ZA 3P5TL 3TX8A 3AXKA 2Q3PA 2YWKA 2GQCA 1J5OA 2HVEA 2N7CA 3MTKA 2ASJA 3PCOB 3NL0A 3DLGB 1VQ6S 3I4HX 3VAMA 1LQ9A 2NXEA 2ZOMA 4QR2A 4GKKF 4LF8J 2HBRB 4U95A 1S10A 3LQVA 1MNEA 4I4BA 1BXNA 1R0CB 3A3PB 1LFPA 3VQTA 4U6PA 3CMAS 2VUGA 4KO0A 5HBMB 3N28A 2QT7A 1Q86T 1SKUB 2CFXA 2EKNA 3EE3A 3O1LA 5U47A 5D3GA 1MWYA 5LSLA 2FJVA 4X4PA 1AW0A 2Y8WA 4QYZJ 2UZAA 2FJAB 3FEYB 2EI5A 3J7ZT 2AIRB 4ZVPB 1FESA 1P1LA 3F73A 4YDDB 1FRXA 2DGXA 1HBOA 2VBXA 1TP7A 4IFVA 3GIMA 3LP2A 2KL8A 5BXIA 2R2SA 1P8GA 5KFAA 1TFYA 5DDRC 1T94A 3PJWA 4ZVSB 3D2WA 2Y3YA 3VZIA 1SJFA 1FRMA 1NDCA 4DR1J 2YNHB 2MQ8A 1EB0A 3BPSP 2WBRA 3J80Y 2V4JB 4OQJA 1RDRA 1FDAA 1F3FA 5A8WB 3GV8B 1RT3B 5HQLA 2QGFB 4RX6A 2CQIA 3BSOA 1F5BA 3J7YU 4ZP8A 1IKWA 2EC0A 2BJ8A 2FD2A 4ZVEA 3DU6A 4FN5A 2AYMA 4B3RJ 3AJ2A 4OI6A 3W8PA 3ZZZA 5HMWA 5BJRA 1LWEA 5F0WA 1K0TA 1F1BB 4ILRA 2J6SA 1N0UA 3C2PA 2Q79A 4O4RA 4ZVRB 2VV5A 5CZVA 3MFHA 2DNRA 4ECTA 5A0YB 1HHTP 3WC2A 3ET6B 3PYDA 2C2EA 1GXTA 3DC2A 3U27A 2QLBB 5E7OB 3NKYA 1QSSA 3DOLB 3MMCA 1NSQA 2BANA 2XMKA 3VAGA 2C2NA 5KFCA 3IWLA 4CNYA 3ISZA 2RRAA 3KUHA 2P8IA 1C2PA 2FJEB 2JZ5A 4E8UA 3S8SA 2VG7A 3GV7B 1NB2A 1RT6B 2HBQB 4OYMA 3MF5A 1APSA 5C42B 2R7TA 1QTMA 1S59A 4ELUA 2CJBA 4FVMA 3THVA 3OTOJ 4RUCA 1Q7YT 1YJTA 4U8VA 4LF7F 2OHDA 1E6YB 2CJXB 2QLWA 3SQOP 2A0FB 1YJ7A 4TQSA 1YIJS 4D3GA 1M1KT 2IIHA 2K8GA 4ATNA 3CMES 4RW4A 4N8OA 2DGVA 1LKZA 2GQ2A 5DRKA 3QYYA 2PO4A 2GVDB 3HDSA 4PXCA 2CPHA 3D66A 1HQEA 3FKBA 5HJYA 3H25A 1WUUA 3WIUA 2WOMB 4IQMA 4USIA 1U8SA 1FKOA 3RGIA 3W63A 2VQEJ 5J2QA 3QMQA 4KH1B 4ITSA 3T1YF 3PO5A 4O4GB 5KG3A 2Q6BA 2E66A 2BR0A 1C1BA 1YBUA 3NGUA 1MG7A 5ETMA 2XC9A 1ZH5A 2NQPA 1YJWS 2N7YA 4CM2A 5FIIA 1D9DA 2J9DE 1Y3KA 3H5SA 3MM5B 4IH7A 4RJVA 1S1XA 4IH5A 3M30A 2PD1A 2DITA 3FCWA 4OX6A 4O3OA 2H51B 2ZH8A 2OD4A 3NRBA 1U49A 1VBYA 4C9DA 4TVAB 1N5VA 4PYDA 3GMGA 4PWDB 1VRTB 4XAKA 4DBQA 3AJ1A 3NGDA 2GJ2A 1AXQA 3ITHB 3M7VA 3BR8A 3NGSA 4NOHA 5J1NA 1VRTA 2KHDA 3HFKA 4JUZA 5BR8J 4A8WA 2BQUA 1HR0F 1AZSA 1NK5A 1FERA 5MLCV 3HHDA 3MD1A 4UZBA 1KR4A 2HK3A 2O1PA 3CW2C 3KKFA 1T05B 5THWA 1FWPA 2B7BB 2XMJA 3D0GE 4DF4A 4TU7A 1RTIB 4RWWA 4KAIA 4Y28C 3K5PA 3FZBA 2YKMB 2W4DA 3KK2B 3IO1A 3W60A 4HH0A 3WX4A 5KT6A 3MTJA 2VHGA 4LF1A 2XMTA 1F9FA 4TU9A 1JMTA 5ITHA 1O0PA 2YKNB 4UQGA 5E33A 1HQEB 4JB8B 2IM0A 4HLBA 4UW2A 2W9CA 1HD1A 2RDDA 4I56A 2B51A 4DR7J 1T9UA 2HGLA 3E8OA 3TRGA 5C2GA 2CG8A 2BJEA 3BH6B 3GONA 3ZTPA 2XMUA 3I9ZA 3LO3A 4C7QA 1FDDA 4CLTA 4UTGA 3UD3P 1JQGA 3LGHA 2GNKA 1T9XA 1KHWA 5B0FA 1RGVA 5M2RA 3OXGA 2CAJA 2YKOA 5J1PA 1YQHA 4F2SA 4YY3J 1HBUB 3TZYA 3CCMS 4CRJA 2B5JA 2XZDB 3D1OA 1WEZA 2J8SA 4C6AA 4I67A 3R5CA 5DM7Q 3PX6A 2D41A 4RR5A 5CH7B 2L3MA 1LNQA 3BO2A 1HQUA 2YX7A 5IV3A 1RAJA 1PYTA 4O44B 2ZOFA 2HSEB 4C8ZA 2B6AA 4QWEA 4DLEA 3TZXA 2OH2A 2XWYA 4EBEA 1IWGA 1X0PA 3PACA 3K5MA 1FJ7A 4DR3J 1OPZA 3K8WA 3M32B 1TZ0A 1SJ3P 2JHEA 5A6WA 2LVWA 2EPIA 3MI7X 2OPPA 5DLGA 1KFSA 4CH1A 2KZZA 3CCJS 3OV7A 1DFDA 1JKHA 1MN9A 2A6MA 3HHEA 1FEHA 5AE2A 1CVJA 1P6TA 1X5OA 5LSOA 2MQOA 3H4DA 3D5MA 1RTZA 2XBPA 3NOCA 2WW8A 2HFSA 2QSFA 3TA1A 4EZ9A 1YZ7A 3MCSA 2IC3B 1OQ6A 3JQJA 5CABA 4ED8A 3B78A 3R2CJ 1OMSA 1HNXJ 1S1UA 1RWOB 4ECYA 3P45B 3IG1B 1VS3A 2AQ4A 2JEJA 1SIWB 1BLUA 4OYAA 4USVA 4J9VA 1RWKB 3PTWA 1XERA 4MTPA 2PN6A 2AP6A 1R89A 4GKKJ 2JH3A 2KXHA 3DYAB 3KUEA 2CQGA 2KI2A 3EUNA 4DPWA 4IFYA 4F7VA 4ZLPA 3Q8YA 1H73A 2XGPA 1YBAA 1FNMA 2B8PA 3EXCX 2XYGB 4NLGA 2QL5B 3QGGA 1KONA 5DJBA 1ZBTA 2F9JA 1FXLA 1FJGJ 1T9WA 3UN3A 1S6UA 1JB0C 2EBGA 2DNYA 3HSDA 1NK0A 4OJHA 4JI2J 3D4JA 3CCTA 3OR1A 1U1OA 2DPIA 2W01A 3HX9A 3KLIB 4OHWA 2COLA 5AXLA 3X1LB 2NR0A 4O3SA 1K44A 3HHNB 1Q8KA 3CVKA 3HULA 4YQWA 1IM4A 1HNIB 4DR5F 4RL1A 2RILA 1K1QA 4X64J 1S9GA 4NASA 4K4VA 2GO9A 4IR1A 2FHJA 5ETRA 3HVRA 4EBCA 4NXMF 1AB8A 2RE1A 1U09A 1VIXA 3RU0A 3QRPA 4JI7F 4B3SF 1KOHA 4X4TA 1OS5A 4ICLA 4KYZA 4F8RA 2OELA 2IFXA 1S4EA 1U02A 3GFZA 5DM6Q 4ZVQB 4DR2F 1VI7A 4JOUA 4J5OA 4ZCKA 2D3OR 4QBUA 2ZD1B 2CWXA 2CQPA 3H20A 2HHVA 5KFVA 3G8QA 4C0OC 5KTQA 2GS8A 1NDPA 1Q8IA 4P6QA 1WC5A 2HVDA 2EXUA 4NLWA 3M9MB 2CQHA 4TYBA 3ZZPA 4FYXB 3IRXA 2ASDA 3GFYA 2B4OA 2J0XA 1TKZA 1NJIT 1DQ8A 4EUVA 3GILA 4DG1B 3OW2R 4UY8T 1F9EB 3AB4B 4ZVTB 4ZLJA 3G6ES 1F0XA 2ZHBA 3AA8A 2J6TA 3MCNA 1N0VC 4G65A 3M9NB 3MEKA 4MK7A 4ELVA 3IM8A 3OHBA 1IXKA 1AUSL 1F9HA 4EGLA 2ATLA 3PEHA 3KDOA 5FDLB 2CZ9A 4RUBA 3KJVB 1WG5A 4CWBA 4LRAA 2EFVA 1N4LA 1G7CB 4TN2A 3WZ0A 2F7VA 4DX7A 3M6VA 2MKKA 3M8RA 1CJKA 2IJNA 4UOFA 3NBPB 2YH1A 2PGCA 2BJDA 3DRRB 3W2WB 3NCPA 3THTA 2MZJA 2KXFA 2MY8A 2RT3A 1UP1A 2AZ3A 5CHCB 4C98A 2I2YA 3DLKA 2XHCA 4K4WA 4F0HA 2I38A 2NZCA 3F41A 4NCBA 1TK8A 1QAJA 3EZ5A 4ZK7M 2E9ZA 4JV1A 1M1GA 3N6LA 4B9SA 3MECB 4DV3F 2OPQA 4YB7A 1Q0NA 2L9WA 1OSCA 3C6UA 4QYRA 4JI5J 1FRHA 2WBMA 4KFBA 2MHEA 1U45A 3F0NA 1Q5VA 1QDUB 1ZPWX 4P2XA 1Q95G 3SSSA 1HARA 4DCPB 1IBMF 3PR5B 4E0DA 1RYSA 2VONA 1WC1A 4RW6A 1AROP 1S6PB 3M2RA 4I1TA 2L9NA 2KT2A 3OXFA 3VHQA 4QQBA 4ES2A 1R6VA 2CNKB 4QR1A 5ETPA 4HTJA 5EHHA 1HNZF 4LF9F 3J7A1 3O44A 3BDEA 3QIDA 2HMIA 4AE5A 4N7TA 4YHHF 1RT1A 4PPDA 3C15A 1SCJB 2HWTA 1FVSA 1HBUA 1PJ5A 1KS2A 3PNIA 4MKAA 4B02A 2G4BA 2RHQB 4O3QA 1FE4A 3M8WA 1NRKA 4NA1A 3S7RA 3KK1B 2OFGX 2O5DA 3BJYA 4BBYA 2DHGA 2XZWA 1WI8A 2QE5A 3PY8A 2EFPA 2KN4A 3IRXB 2LEAA 4X4SA 3SCJE 1NKCA 2HHQA 1N6QB 3AA9A 3PW4A 3GZ7A 2PEHA 2FLNA 2HVZA 3A8JA 1D9FA 2JOQA 3RYLA 2YKPA 2MJNA 2W9CB 3QSYB 4RO0A 2H5IB 2DR7A 1KSPA 3MEEA 4LF6F 2HHHF 3BSNA 5HMXA 2Z30B 2F63A 4HDGA 3QJLA 3BYRA 3HKZD 3N6NA 5DQHA 5LMNJ 1YWXA 3ILJA 1PJ7A 1ULRA 4HL9A 1S79A 5LSRA 5KG5A 4J9RA 4ICLB 1SQEA 4G1PA 3EYZA 1QSLA 4B3TJ 4B3MJ 1I1GA 4FYDA 3FK4A 3KJQB 3CMQA 4NA2A 5HVGA 3NAIA 3VAHA 1QTNB 2CPDA 5DGAA 1YRXA 3OVAA 2D3O1 1KEKA 1S1VB 1YITS 1EKSA 4JI5F 4YB1P 4WKRA 3DRSA 3ISND 4GVBB 1REGX 1VQLS 4UZCA 3D6HB 1FRJA 1KKHA 5KFTA 3FDSA 2GGPB 3DKDA 2OEMA 4F4AA 1WI6A 3DOKA 3EGWB 2MSTA 2RRBA 3R5DA 4ZCLA 1RWPB 3MAAA 3W7BA 2RS2A 3CJKB 2GVZA 2NSCA 2JSXA 5IWAJ 3KLFB 3OPKA 5KFNA 5DG9A 4DPTA 3KUGA 4CO0A 1DLOB 1NHKL 1VYAA 3AQPA 4ZJOA 1X4BA 1NO8A 1R8BA 2YKQA 1PO6A 3H5UA 1X4EA 1SKSA 1N5YA 1N36F 5IFMA 1VBXA 4B9VA 3R9LA 1RCOB 2HLUA 2POKA 3G82A 3KG1A 4IDKA 5BR8F 3MR5A 2CDQA 2YH0A 2J76E 3V6DB 2OAUA 3D6FB 5HP1B 1SJ4P 3WBZA 2RKIA 1REVA 2ZVSA 5KFYA 2RNEA 2KG0A 1YSJA 4DUTA 2P6SA 3GJSB 3U7JA 1FTRA 4ZJQA 3NCRA 3T5HA 1MROA 1S0VA 1CS4B 3SI8A 1R8PA 2DB1A 4KPYA 4Z7YA 4BHQA 1LWFA 1R0AA 1RK8A 2DR5A 1IKYA 3OHAA 4X4UA 1R0AB 1H38A 3BKUA 1RI7A 1RXOB 2OMLA 3GYGA 4H4MA 4OZ3A 4ZS6A 3M8SA 4H4OA 1TUWA 2FJWA 4OI1A 4ECQA 3OR2B 4LFBF 3Q8QB 3PHEA 2MB0B 3DOMB 1GX5A 2PA8D 1EZZB 1HBMB 2VBYA 4IDKB 4IRKA 4YP3A 5CAAA 4C8NA 1IJFB 2MZQA 1T8EA 2DEIA 1P1TA 3HCXA 3GWCA 3PRDA 1Q78A 4USWA 3LF0A 3FUYA 2OP5A 3GU0A 3TYTA 2YQ3A 3UNGC 5B0GA 2IJRA 3DRPA 4X62F 2R4FA 4LSNB 1UA0A 3V4MA 1QAIA 2IVFB 2VA2A 2GZOA 2FHKA 5CD4A 4DQIA 1RCXB 1BQMA 3DN9A 2VQEF 2QX0A 3UVJB 2ZC3A 2RU3A 3I31A 5A8KB 2R2UA 1ZETA 1BGXT 1TUVA 4NMLA 4TYAA 2UUCF 3VQSA 2B5JB 2DXDA 2HRYA 1I51B 1SC4B 3L4BC 4LR8A 1T03B 5EUHA 1LWFB 1N32F 4KGVB 3ZTSA 3UD5A 2UXBF 3K59A 1RKIA 4A8OA 2J7UA 1KWMA 4O3NA 4FXVA 1FD8A 3M2UB 1NU4A 4ZHRB 4OYBA 3C66A 1OJ4A 4L76A 3KLGB 2JX2A 2AYEA 2I0XA 4EYHB 1HIYA 3SFUA 2IVYA 1KTQA 1LXJA 3H5XA 1CULA 2C28A 3F44A 2DRAA 2LMIA 3HM9A 3VALA 2F8EX 1SI9A 2WVEA 3HI9A 4OLOA 2VFTA 3ZFVA 2DNGA 1Y5LB 1U48A 2QZ8A 1JWWA 4K4ZA 5F0UA 2EK1A 3RW6A 2R2TA 4JYAF 2YKMA 3KLFA 3RR8A 4PQUB 3NXZA 2HPUA 4MKBA 4OI4A 4URGA 3N01A 5LOQA 2ZH6A 2ZE2A 3E3XA 4PQAA 4C97A 1I5OB 1B70B 1IUJA 2L08A 2Q66A 2GIFA 1FRKA 2FY1A 4LBIA 2V67A 4J9LA 1U1PA 2LLZA 5L9NA 4ED6A 2BOPA 3Q86A 5D15A 1RTDA 4AL5A 1F60B 1X4DA 2P9CA 4YB5A 1Q79A 3L3CA 1SPBP 2R7WA 2DO0A 4ANEA 2LFVA 1DJ0A 1S6PA 1S1XB 1YX2A 3QGHA 4PG5A 4USJC 2BV3A 3SEOA 2AGQA 1A9NB 4LRCA 1XJWB 4DL2A 1FE0A 4DF8A 2DHSA 3L09A 4K2JA 4P75A 2UVWA 3GSIA 3DDNA 4CTAB 4C8LA 4NI2B 4KPCA 4ZP7A 3QZ7A 2RAQA 3OTCA 4Z7CA 4IR9A 2UXBJ 2WOMA 4KGMA 2W9AA 2LEBA 3NMRA 3GTYX 2AJQA 2I5JA 4X4VA 2WRMA 2UXCF 4CLZA 2HHPA 1TKDA 2B9WA 2P2CB 5KFKA 2ERRA 1RHRB 1SC6A 1NM2A 1SUQA 1WG1A 1YGYA 3OFFA 4ID8A 3GP9A 4P72A 4DL4A 2Z2LA 1R3NA 3CEDA 3IBCB 5KFQA 4DL0C 1EX8A 1SV5A 4PXDA 2JFDA 1PC4A 2KVQE 1FEEA 2HK2A 2LXUA 3TVYA 3DFEA 3VAKA 1S97A 4JI1F 4J9QA 3R27A 3LP0A 4G1QA 2G0CA 2HMIB 5HQ8A 1REVB 3SV4A 1VOMA 1WTFA 3I5CA 1O8BA 2LDIA 2JDJA 2QLJB 2DGTA 3H7HB 4PPZA 4Y2CA 2QJ3A 1HNVA 3HHLD 4F0KA 4DLGA 2FTRA 1S7IA 2K1RB 2PMHA 3ET6A 2DH7A 4X4NA 1OY9A 4NCGA 3BGRA 5AXMA 3FBFA 3Q8UA 3CTRA 5LM7E 2UUCJ 3D54A 1N5QA 3I9V9 3QT6A 1WF1A 4A46A 3C46A 3BB5A 3K5NA 4C2MA 3C6TA 4OIXA 4OHVA 3I0SA 5FJ4A 5KFMA 2V34A 2MEWA 1KLMA 2M9KA 4F25A 4RUAA 2K7KA 2LQJA 2ZJPQ 5D8HB 4I6AA 2XYHB 4UOHA 5K14B 3TX0A 1Y9OA 1HPZB 3LPEA 4DQQA 5F8GA 3HVWA 4J9PA 1P9YA 1PSDA 2CVIA 2ZDPA 2DNZA 4OYIA 2VC1A 3V81B 5EGYA 2JEGA 4GVBA 4WTYA 3RAQA 1TVRA 3CJRA 1CLFA 1ZS6A 3EZUA 5SZTA 2ASYA 3PDNA 1PYSB 2GHVC 4WBFA 4WFAQ 3UR0A 4URSA 4I64A 2DHHA 2NXJA 4C4WA 2R42A 4OZ1A 1RBOB 2NPFA 3UN5A 4S0MA 1MU2A 2RQ4A 1S72S 1IBCB 2ZH5A 2R8IA 3OR1B 3A13A 3IR6B 2ACYA 4L3NA 4DG1A 2Q6CA 5L1LA 2NS1B 2RS8A 4ZMMA 2M7SA 5J2PA 3KTQA 1LK7A 2ZNYA 2FC8A 1JK9B 1HW8A 2IRUA 4PKDB 3MUTP 3OSNA 3Q0AA 4LF7J 3PHTA 3RJMB 5D3GB 1K8AT 3SCLE 3PFEA 2HLTA 5LT5A 1HI8A 2CJQA 2DRDA 1G6BA 2ZD1A 2ZUAA 2IHR1 2DGUA 3LTOA 2PI5A 5KT2A 2DYAA 5D0RA 5CYMA 1SIZA 5KFSA 3N79A 3HD2A 3D9BA 3BKTA 1VK3A 3ETMA 3Q8VA 2CJ9A 4OI2A 5K20B 4ZPDA 4A8XA 5K8PA 1QD1A 1X5SA 4M5GA 4ZVFA 2HZVA 1HWIA 4QWBA 3IWNC 3BQ2A 3M1VB 4LUBA 3QWPA 2J0SD 1GQEA 2FDNA 1FJGF 1S0MA 1HFEL 1S0OA 3PX0A 4ILLA 1M1HA 3GFXA 2HGMA 3CNQP 4RW6B 1FNXH 4ILMA 1CJVA 2EK6A 3IAS9 2Y1LB 4UOCA 3KWMA 1NPPA 3LALA 5KFWA 1DTQA 1Q7LB 3DMJB 4K5RA 2Z2ZA 4LSLB 2OPSA 5F41A 3TA0A 1VK8A 2FLPA 2MGZB 1KLMB 4FKXA 3DLLQ 4LF6J 1U6BA 1H72C 1B7FA 2XI2A 1L5UA 4F02A 4RNOA 2Z58B 4OI3A 1Y5IB 2MKCA 1RHJB 3SQGA 5C24A 4RBUA 3TUJC 1R7IA 3H8YA 4L3KA 4C0HA 2K1RA 1VJQA 2BM0A 3EGVA 4QIWD 1XMOF 2CJYB 1TKTA 1Y10A 3D6MB 3GYNA 4IFYB 2C2MB 3MEGA 4K4TA 3GR0A 2YX4A 2ZWPA 4ECRA 5C25A 4L73A 3KHLA 1XN9A 1EIYB 5B0BA 1B7YB 3DLHA 1WHVA 3FBCA 4C8OA 3KLVA 5AJ3F 1IM6A 3EDRB 4E98A 3DXSX 5IQQA 2O3DA 5IT9U 2HFOA 1S1UB 1BQXA 1F2HA 2M0GB 1DTTA 2B0GA 2X3GA 3ENAA 1RE1B 2RMLA 4MYTA 4CDIA 5GAGU 3OL6A 1HNWF 3MM8B 2ZH9A 2HS0A 1QVGR 4RW8A 4C11B 2AJ4A 4KV8B 2YQ0A 1SKRA 4P52A 2GO8A 2BZ2A 2V9KA 2YY3A 4BWJA 4X66J 3PVXA 4N76A 3LUYA 4MFBB 4CT8A 4CH7A 2E1MC 3HK2A 4PG6A 2JLGA 2N4CA 4N47A 2CADA 4G6VB 2ZBPA 2D7SA 2IRYA 4OJ1A 3VVUA 4MYUA 2YNFB 2VD3A 1CULB 3UNYA 4NI2A 4LRFA 1CJTB 1VQ9S 1FO1A 1NK7A 4WFXA 2BJ9A 4ZVGA 1D3WA 1NZ8A 1SKWA 1N32J 2MLYA 1U6ZA 3OVBA 4DX5A 3NMAA 1UWAA 3HFZB 2BACA 1JLCA 3TWZA 3CJ5A 2HBYB 4CM0A 5IM0B 2V8HA 3IS9B 1JLAB 3QQCD 2AYGA 4TNOA 1XQIA 2M4MA 3Q2SC 1IN0A 1S9GB 4WE1B 2ZH2A 3T6JA 3Q8RB 4PWDA 5KG4A 4WZMA 3UVJA 4DV4J 4DV3J 3DM2A 2WZ1A 5K5MA 3T19A 3MAHA 5HO4A 1QAYA 2BVZA 1IQZA 2XG8A 3G6VA 2XNRA 2AF6A 1TKXA 1MMLA 1GTEA 3V6HA 2HHTA 1SVDA 2OKQA 3I4PA 4PG4A 4QWDA 2UUWA 4B3SJ 2KJWA 3CWJA 3IXQA 3J81U 3TZZA 1NMEB 3PYEA 3VWSA 4ZPTR 2YNFA 2HZAA 1VLOA 3AFGA 4IG0B 4L6V3 4FF4A 4RZRA 3H90A 5AE3A 1S0NA 1HBMA 4BC7A 4DUYJ 4FF1A 2GVDA 5HANA 1CBKA 1YJUA 3R8YA 2W2NP 2WTFA 3M8PA 1NCLA 2GJFA 3MMJA 3UR3C 1WTBA 4OZJA 1X8DA 4KB7A 1YG0A 2XEXA 4KV8A 3IGNA 4H4OB 3ZO7A 2IRXA 2V8PA 1FDBA 2MYFA 1JLGB 2C1EB 1RWXB 3BSAA 4XO0A 1Z2LA 4JI4J 2VOPA 5E41A 1BE4A 3IG1A 1VQ5S 2NCKL 3JAMU 4JI2F 3U1NA 2BRKA 1FJEB 3BQ1A 4I0WA 1H7XA 4K7QA 2M3DA 5B0AA 3J81j 2W7PA 3T5LA 2QA4G 2J5AA 4I6WA 1TFWA 1M5PC 5KOWA 4RWXA 2VG7B 4DU7A 5FLXU 3Q22A 1KP6A 4HI1A 4WXOA 1YJNS 1NH7A 3BDPA 1UCNA 1WELA 2RKIB 2KYZA 4UOGA 2CXEA 4RPFA 2DVIA 1M5KC 3SSRA 1S1TA 2Q1LA 3MM5A 2EC2A 2MQMA 3EDQB 3FFIB 4M5NA 4P2SA 4ZP9A 4JI6F 5HN0A 5KAKA 4OX9J 3D3BJ 3CCVS 5C24B 1BWVA 2DGQA 2QIFA 6FDRA 4DV0F 4LF5J 4USUA 1GXUA 2RDJA 3A8KA 4F2RA 2A2CA 4NX9A 2DXEA 1OIAA 3MPUB 1NB7A 4CYUB 1VQ7S 3TUPA 4ZVHA 3E2EA 5LXRA 3FFIA 2HKEA 1ELOA 4M8LA 3TNVA 3BGLA 3BM7A 3W8GA 2H1YA 5C5JA 2VU5A 1M90T 1UWBB 2KHCA 5GVQA 1NJYA 1UVLA 3GFHA 4NLPA 1G1XA 4R5PA 3DOKB 3DM2B 3G2XA 1XTZA 1V5IB 3BSCA 2AX0A 3D67A 3K2YA 3QO9B 5ETQA 1XC9A 2VFRA 2Z2MA 3IN5A 3VCDA 2JC1A 1TMMA 2MSSA 3DRSB 1JLAA 1S9EA 4MIBA 5IQ6A 1WF0A 3MM9B 4ZN3A 5F8LA 1JLEB 2DRBA 2C2KB 2CPJA 2D74B 3QJPA 2XCPA 1ZOTA 5CYMB 1FD2A 5ETVA 3VZHA 3GG0A 1V9OA 4DN0A 4ZKAA 2IAJA 1HBOB 4LF5F 1CJUB 1L3UA 2ZC4A 4K5SA 1SL2A 3MMAB 4HYKA 1YVFA 1LW0A 3V4IB 5CXTA 2AJ2A 4ZCMA 3R5JB 4X64F 2GMLA 4DV1F 2N4DA 4DZDA 1N5YB 3DHWC 2PEBA 4MIWA 2R9LA 2R7QA 3SZ2A 4WIIA 3OL8A 1U1NA 1KVJA 4GKJF 2CPIA 2Z8QA 3IBFB 1Q82T 4Q5VA 2ZHOA 2DNOA 1N52B 2U1AA 4RW8B 2OIHA 3HSZA 3OD2A 3U1LA 2PFFB 1U0HB 1K47A 2DXFA 3EMTA 5L46A 2RH3A 3MEDB 4ZVOB 2FVQA 3T6BA 4NLXA 2XS7A 1RQ0A 2B43A 1WEXA 2D3ZA 2YTCA 2YWFA 5J1EB 3FNNA 4ZIVA 2ZM6F 4M94A 1WORA 2HVIA 5F8HA 2JRSA 1HWUA 2VC0A 2X7IA 2ZOGA 3BH7B 2F1FA 2OUGA 3P5BP 4LJMA 4DHVA 1T9VA 4EYIB 1XR7A 3MEGB 4DR6F 3AOCA 4RW9A 1GMUA 2G9OA 4ANCA 2ZITA 5CYJA 1MN7A 3QIPA 2GW8A 5K14A 3EGNA 4TXSA 2MJUA 1ZAWA 1ZZNA 2HAFA 2O67A 1JJ2R 1K0VA 3V5RA 1FRLA 4DDFA 2DK2A 1VCTA 1WG4A 3P6YC 3VTIA 2BABA 2VG6B 2R8KA 1D9AA 1DQ9A 3ZNUA 2BJ1A 2BMBA 3R5AA 1D8ZA 1R43A 3UPFA 2P6TA 7FDRA 2KG1A 2W2MP 4LF4F 2OFHX 3MM6B 4OI0A 1OYEA 2K3IA 4JBCA 3THPA 2M70A 1FKPA 1XBWA 1LOUA 3NLCA 2CRLA 3RW7A 3HKWA 3DLGA 1T11A 4MK8A 1N34F 3AB2B 1XNRJ 4Q8EA 4M5HA 5KFGA 1RWVB 1KC8T 4GKJJ 4WK1A 4USHA 1RT4B 2OPRA 2GC8A 3R1LA 5DG8A 1X5PA 2GFFA 3Q23A 4B3OB 4PXBA 3T1AA 2VQFJ 2FYXA 3KHRA 1C0TB 4QOTA 1HYSA 1E6VB 3SDEB 2X1BA 2LA4A 4KR0B 2WAQD 2KM8C 4CLYA 4YFUA 3R1HA 4A8FA 1S6OA 4JI3F 4HHUA 1YLXA 3EVOA 4C8MA 5DG7A 1RT7A 3QGIA 1CEZA 2SXLA 4B9LA 4AL6A 1WSVA 2LQ5A 4C8KA 4Y0FA 1HBNB 2EBEA 1IKXA 4CTAA 3WHIA 4YDXA 2KFYA 1HWKA 5I3UB 1EQMA 2ZH7A 1F5AA 4DSIA 1UPPA 4P71A 3VGSA 2E5HA 4NLVA 4TY8B 4U67Q 3CUNA 1X4HA 5KG2A 4DR4J 4QIFA 1SL0A 4WFNQ 5DZ6A 3WX8A 2J7KA 2C22A 3W2VB 2EEYA 3GB0A 2E1CA 2XMVA 4NLQA 4WTOB 2QL7B 3BGFA 1QVFR 5T14A 2KT5A 1RBAA 2E7WA 3CO0P 4QYZK 1S99A 2DH8A 4LFAF 1NBEB 5KFOA 1D1UA 4FXDA 4HEA9 1SH3A 1VRQC 5AXKA 4AFFA 4R8UA 1RHKB 2DGOA 3QAUA 1U1QA 1LEOA 3R7NB 4IO1A 1IJEB 1PKUA 4BCAA 1LV5A 1HR0J 4IG3A 3JSMA 5L8RC 5D4PA 5E3AA 2WHOA 9ATCB 2M8HA 4LF2A 4OZNA 1R27B 1HWLA 3I56S 2ZH4A 3OTEA 3H2VE 4R8UB 5HLFB 4OZLA 2OJ3A 4W92B 2FZKB 4J9NA 4FF2A 1P9QC 2YNGA 3V2UC 1VHIA 3M9OB 2C3OA 2EG2A 1ICEB 2BKPA 2X1FA 2W4PA 1S12A 2B4VA 2WVCA 4W98A 1A6LA 2AEJA 3ZZ0A 2UUAJ 1U2CA 3QT8A 1JLEA 2ZNZA 3U1MA 3FZ2A 5IWAF 4DZ6A 3GIIA 4DS4A 1J5OB 2FJXA 2E9RX 2KH9A 1S9EB 4Z37A 4NLYA 2G0IA 1FX4A 2OD6A 2IPOB 1VRUB 5G0RA 1EP4B 1JJHA 1RAEB 3CE8A 5EX0A 3D28A 1N36J 4LSZB 3PW2A 1NDKA 1Q5YA 1U1RA 1NZAA 1K1SA 1GK8A 2HQ3A 1SUQB 1RB0A 1HPZA 3JTOA 2GJIA 3Q89A 4R5PB 3HJFA 1Q16B 1QE1A 2J8AA 2RVJA 1RWNB 3HT0A 3MCMA 3POTB 2J0WA 3LANA 3OFHA 3DRPB 2I5JB 4DL3A 3C6TB 3MM7A 3KXDA 1JLFB 5D0GA 4ZDNA 3PW0A 4A8QA 1SJQA 1BWEA 1FT8A 1H0HB 4WK3A 2LYVA 4USMA 2NXNA 7FD1A 4NXNF 1XNRF 2EVZA 2F8HA 3M8QA 4F4XA 1Y11A 4UT4A 2N3OA 5AXNA 4DSJA 2B6AB 3D1HA 1RACB 1FCAA 1ZYQA 4B3OA 1S49A 2HZCA 2J9CA 3DOMA 1WKJA 3KNAA 5ETNA 2AJFE 4PUOA 1KQKA 4OX7A 1TTHB 1BHNA 1MW7A 4HR2A 4MH8A 5FD1A 4X4RA 1X4GA 3ILIA 3U02A 2M88A 3DXBA 3KNGA 2QFJA 2IYIA 2VF3A 2DY1A 4JYAJ 3KDNA 1DY3A 4CLUA 4ZCIA 2YPZA 1I94J 3R6LB 2NUHA 2H48B 2HS4A 2ZBQA 2BXJA 2WB1D 1IR0A 4M5IA 2X1GA 1H2TZ 3CCLS 2CZ4A 2JVRA 4OHYA 4PQUA 1HL6A 1RISA 2ZUGA 3BGUA 2Z57B 2C42A 3GG1A 3SFGA 1QY7A 2K06A 4PG8A 4A8YA 1HNXF 1XNQJ 3UDEA 1AFJA 1CC8A 3CJ0A 4H4KC 2EFOA 3GYXB 4KHRA 5E3RA 1QSYA 1WACA 1FWKA 2F4VF 3DGVA 1Y00A 1YRTA 4IG0A 5CCLA 2CNLB 3IM9A 3E01B 3RAMA 2LP4A 4ZIWA 3OL7A 4ECSA 2HFVA 3UN2A 5IT9Y 4IRDA 2HQCA 3EJMA 4FYWB 5F9NA 1AA1B 2KB2A 2OI2A 5K9FA 1MMDA 3TVKA 5T41A 3GV5B 4AD6A 1CSJA 1UZHA 1Y3JA 1OSDA 2XNQA 5CYQB 1TKXB 5DDOC 1HNZJ 4HH1A 4P9SA 1AZSB 2IJFA 4PZVA 2E9TA 4K8RA 2GIQA 2CQ1A 1Y0HA 1NPKA 1HHSA 1QAXA 4LIRA 3B4DA 5CQGA 2XMMA 1YBTA 3W5XA 1M5HA 3DLEB 4KRWA 3I32A 4MAKA 2K2PA 3KHGA 1EETA 1SJRA 2CWKA 2Y1JA 1SB6A 2HIQA 5GAGI 3I96A 3MFIA 1VQYA 1DZ5A 1NHVA 3CO9A 4Q2LA 2JFKA 4EFAC 1IVZA 1UJ6A 4KIAA 5KFHA 3LP1B 4U9RA 2ACMA 1SC1B 2K7JA 1LW0B 2CQCA 4N5SA 4I69A 1S6QB 5LMUJ 4WFYA 3MEEB 4XIUA 1VQNS 3GLJA 1BUXA 1CJUA 5D0EA 4HHHA 3GJTB 4EWTA 1CC7A 5GMKa 3MHYA 4MFBA 5D4OA 4NL5A 3M2VB 3O6QA 4N77A 4Q43A 4DU8A 3PW7A 4YUDA 2V8VA 2AJ0A 2V50A 3D3CJ 4IRCA 1Q4RA 3HSGA 2UVUA 1DTTB 2H5EA 1RA6A 1G4CA 2E29A 2RD5C 2ZFHA 4F3MA 3CF5Q 1TK0A 2PI4A 5JJBA 2PA3A 1TL1A 2XHWA 3C15B 3C14B 3GCWP 1S7HA 2IBKA 1MROB 2E44A 2HG4A 2HAIA 5A8KA 4WKYA 2F3JA 2FZGB 4DUZJ 4DV6F 3CULA 1I3OB 1BQMB 4WU2A 4NXMJ 3PIOQ 4XPEA 1NJWA 1ZAVA 3CCES 4CT9A 2R8JA 5C7PA 2AEMA 4LFBJ 3JQKA 2DNKA 2BQRA 4CNZA 2WVFA 2VOOA 3IR5B 4O4GA 4OYOA 3OUYB 3TOQA 2MKJA 1O6XA 3JAMY 1T9YA 2OPQB 5EDWA 3RTVA 1JLFA 1R8CA 1QUVA 5ETSA 2IY5B 1WEYA 3HF5A 2GVZB 2AZ1A 2HYIB 1MWZA 4MMOA 4DV2F 4Y2MA 8RUCA 2J9DA 3H0PA 1RAHB 1DTQB 4MK9A 4RU2A 2R8GA 1XR6A 2R7VA 1KVKA 2BE9B 5JVHQ 2RDIA 4F4ZA 1N88A 2QA1A 5H9EJ 3QGPA 5DDQC 1CJKB 1NJZA 1KOOA 4EU0A 2MQPA 1C1CB 4NLOA 1HI0P 3RB4A 2X51A 2HHUA 2G13A 3QPIA 5C42A 4FBUA 3IP0A 1HA1A 2NXUA 2HFNA 3DDIA 1D09B 3EWGA 3FBBA 1JLGA 3FRZA 2L41A 4ECZA 3G6YA 4Y2IA 3K5OA 3N4WA 3AOAA 2FLOA 1FX2A 4PUOB 3OQ2A 2UUTA 4DJBA 2CKWA 2FGCA 4HDHA 3E51A 2XGQA 4OJGA 4JI0J 3MPVA 2R7RA 3NWRA 5KG7A 2UU9F 2FIUA 1HQ2A 2UUBJ 1JXLA 1TL4A 1NHUA 2CPEA 3WQPA 3US5A 4Y2AA 3CT9A 3TUZC 3N0VA 2JVOA 4KGXB 2DHAA 3A3OB 2DKOB 1UETA 4HI2A 5E3PA 3S6EA 1IBKF 3G86A 5F8JA 3CJKA 3F56A 4CCHA 2B9EA 5KFDA 1FNOA 4F50A 3P4UB 4EEYA 5A8RB 1YJ9S 1JNRB 2CA9A 2CQBA 4WWSA 1X0FA 3T1HF 1UPMB 1H2VZ 2VFSA 2BJ7A 3T41A 3OLBA 3CDAA 4ZPWR 2IM1A 1VRUA 3OBIA 1UFKA 3BQ0A 5B0CA 2V4JA 1T3NA 2YKAA 1RLCL 2AV5A 2QLFB 4L74A 4M1KA 3EVMA 4X65F 2ALZA 4DPUA 1XNQF 1RP5A 5L9XA 2VDIA 4AUKA 1VQ8S 2MXYA 3W62A 1UW4A 2CIMA 2VL1A 2V0NA 5KFFA 5D4NA 3BBBA 1HMVA 4OZ5A 2I6WA 1K73T 3H42A 3W1YC 1OYDA 1FFSB 2BYCA 1XIQA 2AHOB 3C19A 2HGNA 2MY7A 1H7WA 1F2GA 1JLQB 3UW1A 3N9UC 2VH7A 4QWAA 3DGPB 1YK9A 3H40A 1JIHA 1HWJA 4OHZA 3DRYA 4C11A 2Y9HA 2UV8A 3P3DA 3L9ZA 4LVNP 4CQ1A 1W26A 3L7UA 1KQGB 2FC9A 2GIRA 4K4XA 2K3KA 3BREA 3FC9A 3BKFA 2W4CA 3JXOA 2LXFA 3W64A 2R3VA 4HVZA 1JXEA 3I0RA 4YN3B 1F3VA 3W2VA 3VAIA 3AD8C 4MKYA 1M5SA 2DR8A 4IOBA 3W5ZA 1KBRA 1SV5B 5AT1B 4YOEA 4XPCA 2UXCJ 4DV1J 4ECXA 3PJ9A 3MM6A 2KFZA 5L1KA 1TKTB 2Q43A 1H3DA 4DEZA 4UUWA 3G87A 5KFPA 2XLJA 3MOJB 3QRQA 2ADCA 2WW4A 4CLWA 4Q8FA 5I4MA 4IYQA 3MUVP 4FXWA 3SCKE 3DU5A 4P7VA 4P7TA 4P10A 3IMQJ 3ZTRA 4IO9Q 4M95A 4WU3A 5AJ3J 3MR3A 2J0QD 4LVOP 2HQFA 3BN4A 3ILOA 3QIPB 4R25A 4BLGA 2E1PA 3GIKA 4K4YA 1B0TA 1CJVB 3NAHA 1YHQS 5B09A 4BS2A 2KRBA 3NNAA 4CP5A 1ITPA 5KFBA 2B9YA 4QU7A 1LFWA 4Y00A 4KKOB 5DETA 3W65A 1NK8A 3M1VA 5F8IA 5D4LA 2LA6A 3MZIA 4GC6A 3ZNJ1 2FHOB 2VKRA 4K4UA 1WOSA 3VV2B 1HNIA 1TAQA 1U2FA 2VODA 3MEDA 1L3VA 2HBZB 1KRPA 3S01A 5A2QU 1U7LA 2MDAA 2ZE2B 3KLIA 4Q44A 3BZQA 4UUXA 3G71S 3CC2S 3TP2A 4DL6A 1M5OC 2PC6A 3TJ8A 4A8SA 1ROFA 2QN6B 3DGPA 1OPIA 3PG9A 3G6XA 2VQFF 1J5EJ 1CQNA 5KT5A 4WFBQ 2E1RA 4WCEQ 3HZGA 2VA3A 4OHXA 3JTNA 5M2UA 2AEFA 4OMFG 4K0KJ 5JMNA 4PYAA 4TQRA 2D69A 5B08A 3CPWR 1M5VC 3O8WA 4DR1F 2UVVA 3K57A 3QFHA 3W9IA 3G96A 3TEGA 1N8RT 1FVQA 4X62J 2XULA 3FMWA 4ECWA 4GO5X 4QJVA 2QSWA 5LMNF 4E2FB 3R6GB 1T05A 5EWFA 1VBKA 3BS9A 3A1YG 4OYXA 3RRHA 2YXLA 1J27A 3KHHA 2QO3A 3D0HE 3TA2A 4DR7F 4OJ3A 1VC0A 5J1EA 2A10A 2QLXA 3OVSA 5GMDA 1S1WB 2W2QP 5KOXA 2CVEA 2V2ZA 5D0HA 1VC5A 3W9JA 1GEHA 2HS3A 1JLBA 4ZPBA 2ZVIA 5E5NA 3CC7S 1UJ4A 4CO2A 5H9EK 4K2XA 5F3TA 4YB6A 2BRLA 2XMAA 2X3DA 4OYZA 4LFAJ 3NNCA 3FEXB 3I0SB 3AXMA 2AW0A 5HMZA 3HMJG 2ROGA 4OV1A 3RB0A 1B0VA 3IA0A 2BW2A 4UQTA 2HRTA 3LWLA 3VAFA 2R7UA 2WCXA 2B56A 3QBCA 4FZVA 4R0EA 3KJNB 4JP8A 3C8YA 4LREA 4B9NA 4FBTA 2EWHA 1QUPA 3CD5A 3CDWA 2BJ3A 1DQAA 1HNVB 2VBWA 2Z4PA 4WYWA 3EX7B 3DRXA 5IXUA 2NXCA 3HJVA 2G2ZA 2IAJB 3TZWA 4NZ6A 2F65A 2VZ9A 2XY7A 1PGZA 1WC6A 4QCLA 2KT3A 3SIPB 4P2MA 2AX1A 4ER8A 2OO4A 3HHKA 4DFJA 1UA1A 1FRIA 2QYCA 3RR7A 2P9GA 4QPXA 2HFZA 3JB9k 4LF8F 4AQYF 4QZVB 1RT6A 1G3OA 2V4RA 3KMQA 4PWUA 3I6PA 1NJXA 4EK2A 3QNWB 1UWBA 2V2QA 2BANB 3QT7A 4MJKA 2C2OB 2XB2D 2ZM6J 5HI7A 2B4UA 2KJVA 3CJ4A 3TR5A 4ALZA 4DMZA 2ZZTA 3JYTB 4W90B 3D1QA 1R8AA 2XO6A 2CQ2A 4LF9J 4IOCQ 3OTDA 5H1SV 4G3IA 2F4VJ 5DO2A 3RB6A 2RF2B 3MXHP 3M32A 1P27B 3BO4A 1RU1A 2GQQA 3HPOA 3OJSA 1NNDA 2OGUA 2KVIA 4DCOB 3H98A 2FJDB 4KJIA 2NUUG 1GMVA 5HK4A 3FSIA 1JLBB 1YZ6A 1HW9A 1RT3A 3CC4S 2PE8A 4WE1A 1FF2A 1TL1B 3C14A 2OEKA 3CJTA 4QW8A 1NK6A 4YMEA 3AD9C 3IS9A 4IKAA 4CIOA 4FVCA 2WONA 1JNZB 2UXDF 4K0KF 2F5GA 2KU7A 2HNYB 1TL3B 1PIEA 3AQOA 2H54B 3LP2B 3AH6A 3ENQA 3M2VA 3O2IA 4IFVB 2WSFC 2XSFA 4QIEA 3GQCA 3K5LA 3BR9A 3JQMA 4M63A 3UQSA 1FDNA 1FKOB 3MPYA 4ES3A 1Z4UA 4CLPA 2KM8B 1XMBA 2C3YA 2MKIA 4LMZA 2PDAA 4ZHRA 2MTLA 2VKZG 3T1HJ 2Y1IA 2V9WA 3EVWA 1XR5A 5KG6A 5K8OA 5F9LA 2AKWB 4Q2MA 3A8EA 2ZHAA 2XY6A 1UJ5A 5JXSA 3KK1A 1YRUA 3JTPA 3Q24A 1PAUB 1VGYA 1T03A 2CQDA 2DY9A 2CQ3A 2RU9A 2DCLA 4RBVA 5HATA 5GADI 3DLJA 3VAJA 2IDEA 3DLBA 5I3QA 3J7Z5 3NOGA 2OMOA 3ZZTA 1QM9A 3SYZA 4ED0A 3HXMA 2CQ4A 1WKLA 3B8HA 2RJZA 2OSQA 4LRBA 3H59A 4OX8A 3NG8A 7AT1B 1J5EF 2IMOA 4DV5F 3TJ9A 2KTQA 3KLHB 5IOLA 2YWWA 2YWEA 3M8QB 3M6WA 2HNDB 3QLHB 4QR0A 3SV3A 3UCZP 4DV5J 4J7CA 1OO0B 3Q8PB 2ZKUA 1GNKA 3MCOA 3KK3A 3G8TA 1U25A 3C6UB 1MWQA 2E7VA 2HW3A 1VC6A 5M2PA 4ZPVR 1IR2A 1UVJA 1W2BR 1VLYA 3CJQA 3RBXA 1RTJB 2FY8A 3RB3A 2QYGA 3DMJA 1QE1B 2ATCB 3BBCA 4NRTA 3DHXA 2E1AA 3ZZOA 5KG0A 4ES1A 1Z2ZA 3EGZA 4EO8A 1IBLF 1H2UX 3H2LA 3LA0A 2ILYA 3PYFA 2VJVA 2XO7A 2IA6A 4Y2KA 3PKYA 4BWMA 4DV7J 1EP4A 4M5MA 4RNFA 1Z1ZA 1LWCA 2O66A 2B9XA 1V3RA 1URNA 2DIUA 2GX8A 4XTTA 1ZTWA 4NZ0A 1NLKL 5GADU 5KFZA 3HFVA 1RUSA 1X31C 4LBHA 1SL1A 1FFGB 1VJWA 2PSZA 3JS9A 2GAGC 2A18A 4NMXA 2YNGB 4DXLA 4JI6J 1IKVB 2XMWA 4XK8C 3AAWB 3HHLC 1PILA 3CSKA 1SJ1A 4ZPCA 4ED4A 2EFGA 1KTVA 4KT0C 4X4QA 2Y8YA 4TKTA 1CPZA 2F4FA 5E2QA 3BV8A 2NPIA 4DR4F 3H5YA 2VJUA 3OJUA 3X3UA 3R7SB 1WC0A 3UO0A 3CDUA 2V2VA 2M2BA 2JNJA 5LXYA 2HQGA 3K7RA 2CZVC 4W4MA 4FYVB 3BO3A 1MU2B 3CB4A 1VBZA 3POTA 2RQKA 3HP6A 3OLAA 2IBOA 3LPYA 4JV5J 1RWUA 3P49B 2DGSA 1UEUA 4F4KA 3I87A 3SSQA 3AOBA 2JLEA 3BN7A 2HHHJ 2VDHA 5KFJA 4DFPA 2E5JA 4F26A 2FVPA 2ZEJA 1KVIA 3RBDA 2MKYA 2A1BA 4YR2A 4CLKA 3FQKA 4DCJB 2V5HG 4CO3A 1B4SA 3OXLA 4J9MA 2FVCA 3IFEA 3VF0B 5I3UA 3NCQA 4PRFA 3ZTOA 5KT7A 3KLEB 3RUBL 1RBLA 1AUDA 1KQSR 4Y6IA 1LW2A 2VFVA 3RAXA 1B0PA 3UDLA 1VISA 2XLIA 5IV4A 1I94F 2VICA 3BYPA 1RT7B 1TUGB 4DV4F 3TAPA 2AU0A 2MLZA 1RAFB 2XSJB 2ZBRA 3RBZA 2AWZA 4CH0S 2VIHA 1UVIA 1BC6A 2AGOA 1FTCA 5B0EA 4FPRA 2MPUA 3AT1B 3FSYA 4NLDA 3DNCA 4ETXA 1XMOJ 4M5JA 3EXYA 5HBMA 3ULHA 5GAHI 4ZVUB 4DPXA 4J91A 4ID5B 1NKBA 1UFWA 2GAHC 2VG5A 1D8YA 8AT1B 4AT1B 1BMQB 3FBEA 3TARA 2RIJA 3J7YI 1UEKA 4FYYB 4MT1A 8ATCB 1S5ZA 3FMBA 2WK4A 4PAAA 5ADZA 2I9SA 3K17A 3CXCR 1VMBA 2AYBA 2Y0BB 3C3LA 4I2PB 5CA5A 1QLNA 1C1CA 2MZSA 1FKPB 1TQLA 1WOPA 4RNNA 4KKOA 3PO4A 2G1HA 1F5CA 2Y1RI 3H4BA 3PR4A 2BA9A 4X66F 2J7WA 3HZEA 4KY3A 4QU6A 3EM1A 5KFUA 2IM2A 3GR1A 3ZZUA 4H4MB 2YBVA 3A12A 3J80U 3OL9A 2E7XA 4I2QA 2HEKA 4KFBB 2KO1A 4IH6A 4EMDA 1JKHB 2BUNA 1BQNA 3CGIA 3MR6A 4A8MP 2C2ZB 3FVYA 3ZZYA 4NYOA 2OPPB 3W9HA 1BQNB 4ZLLA 4ED7A 3RBEA 1L3TA 4DV7F 2EKYA 3OUYA 3GSDA 3BPDA 4MKVA 5KFIA 6FD1A 5EWGA 5FLXY 4DSFA 2ZZNA 3KOAA 2P5VA 2LU2A 2QG9B 1S57A 1SH2A 4JV0A 2O01C 4DQRA 3TUIC 3DI6B 4IQXA 3C16A 4ZITA 1A0OB 1IKVA 1T02A 1ZM4A 2H5JB 2QMUB 4GVLA 4NE9C 4O44A 4DR5J 4GC7A 2BQ3A 1JX4A 1PG5B 2KZMA 5DQGA 3N6MA 1NEEA 2B4PA 2ASLA 1VQMS 5LMUF 1RT5B 2W2OP 2ZH1A 3LP0B 1UAWA 4A4JA 3KYLA 3SCIE 1U26A 2QTWA 2B8QA 4KSEB 2GHPA 3GE9A 5CCMA 3HD1A 2MQQA 4O0IA 5GAEU 1R6YA 2FJBB 3P96A 2VG5B 4P73A 2DNLA 4XDDA 1PAEX 2ROPA 4CLFA 3MPWA 2NZ4A 1DARA 1RAIB 4ZOSA 4QPTA 3TJAA 4RNHA 4Y3CA 1FJCA 1RHMB 4PXEA 3EPGA 3NWGA 3NNHA 2UP1A 4DX8H 2OTLS 3MMAA 2BDPA 4J9UE 1RAAB 1N5SA 1RWMB 2YKNA 3FGVA 2YPYA 3L7OA 4DV6J 4OYWA 2Y0SD 1VQ4S 5KFRA 3I5AA 4NA3A 4LRDA 1UTAA 2WVBA 3AJDA 1T7PA 3KLEA 1RA7A 2VPYB 4N41A 4N56A 1CQMA 4KTQA 3M2UA 3AODA 1OQ3A 1EARA 2HNYA 4JI4F 2H4YB 3TO8A 4ANDA 1VQPS 5T7LB 2NYHA 4FP9A 1FWLA 2GA7A 4KHMA 2Z56B 4KHPJ 1PCAA 1ZM2A 2W9BA 1SQGA 2R7OA 3MPDA 3FRYA 2XQCA 3A4TA 2ZDOA 3ITHA 4LT6A 3T3FA 3OSPA 5I3PA 2ZBCA 3QFWA 1U2RA 2DNPA 1U0HA 2FGOA 5B7WA 2R8HA 4U7UK 3MMBA 3M30B 4PABA 3UDVA 4A8KA 1XMQJ 5GMEA 1S76D 1F6TA 3AHPA 2F40A 5F3ZA 3CCSS 2DNMA 4X2BA 4NCAA 2CDRB 3B54A 1N33F 3FSXA 2D9PA 1EHWA 1C0UB 2D1CA 4K4SA 3E01A 3ENWA 1WHYA 4Q7AA 3V4IA 1K9MT 1Q1KA 5ETLA 1VIOA 3UWTA 4R0JA 1FK9B 2QV6A 3ENVA 3PV8A 1QJHA 4C48A 3ISNC 2V8DA 3I82A 5D77A 2CPYA 3K89A 3ZZRA 5L1IA 1RADB 4RW4B 4NEZA 2CPXA 1FXRA 2XWXA 1NUEA 3OR2A 3MR2A 2RSQA 3NGRA 2GV1A 1E6YA 3B4MA 4FNHA 2IVMA 3TI0A 2DHXA 4B3MF 3MM9A 3PJXA 1VQOS 1IKYB 2KKHA 1RLDA 4J90A 1CG2A 2PMWA 1W7WA 1CS4A 1TR0A 2YX1A 3QO9A 3TQEA 2V63A 4ECVA 2DH9A 1U1KA 1PYOB 4J9OA 3V6DA 4LSNA 3IRWP 1X4AA 5C2CA 2R7XA 3CDBA 4CYUA 2C3PA 4EI2A 5ETKA 5AE1A 2HQIA 2HHXA 4K59A 4H4KA 1LWEB 4D3HA 1RZMA 3UFCX 4CLLA 3TANA 2RUSA 4DPOA 3JYTA 3TW0A 4N8NA 2BKNA 2G2OA 2I1RA 1WDDA 2U2FA 3CCWA 3MOZA 4CI0B 4AL7A 4V19X 4AYBD 2E5IA 4F67A 1WF2A 4K50A 2HVHA 4O0NA 2PMZD 2LXIA 2AJ1A 3PEJA 4NLRA 5A76A 4TU8A 2L48A 2VBZA 1S1WA 1YJRA 2JJ4D 1C4CA 2OEJA 4HTIA 1SH0A 1TL7A 2WVDA 5F8MA 3MAQA 2FQQB 4OFZA 4QW9A 3MUMP 2UU9J 1GXLA 1MMNA 3K8VA 3MURP 3SXLA 3P8BB 5GAEI 2BEFA 4DQPA 2UUBF 2YNHA 4WP3A 5KT4A 4H54A 1Q53A 2VB6A 2W2PP 1Q8BA 1ZZFA 3M05A 1H98A 4JI7J 1CJTA 2ABYA 2FPHX 3WIVA 1UW9A 3O5TB 2DR9A 1HD0A 3G82B 4YS2A 1IBLJ 5KFLA 2H3EB 1PBAA 2XTJP 4KHPF 4NLUA 4FPIA 3N5BA 1UVMA 3AY0A 3Q2TC 4LFCJ 2HHWA 4KBIA 1KDNA 1DLOA 2OLWA 2BW7A 1LK5A 2UUAF 1JXVA 4KO0B 4NEYA 1RTHB 3MGJA 1PJ6A 1RTIA 1RU2A 1D0EA 5IT4A 4V19J 1XWLA 4PEOA 3IGVA 2WONB 5LJ5Y 3PZPA 4WZQA 3NS7B 4C3LA 1WHWA 1GTHA 4DV0J 2MZ1A 3TEHB 3J7AN 3CD7A 5E3CA 2GGPA 2RQMA 2CPFA 3PRVA 3CCUS 3TAQA 2QRRA 2GMJA 2YVSA 2A2DA 4EBDA 4HHJA 1RT5A 2KYXA 4LBPA 1UL3A 2V69A 2DNHA 1JLCB 1X4CA 4P74A 3TAMB 4JI0F 3V6KA 1LWXA 4C3MA 4ZPAA 1S77D 4DR2J 1G2EA 2MKSA 4OV6A 2BE7D 3NGTA 4RBTA 4FDFA 2PT0A 1UMJA 2D3UA 3SQGB 5L1JA 1DAXA 4LIWA 4DS5A 1SXLA 5A6PA 4DFKA 2DTJA 4Y65A 1WKKA 1WOOA 4HACB 5J2MB 2IDLA 4OX9F 2FHMA 5IZHA 4IUFA 3T5JA 2WB4A 4DUZF 4DL7A 1DURA 1RAOA 3PIPQ 2XS2A 4DL5A 2RRNA 2J6UA 2QA4S 4LSLA 2RB7A 3DDKA 5HSPA 5KT3A 3HO1A 2HIYA 4ZN1A 3CCQS 4X4OA 4FS1A 1U4BA 3LGNA 4NWBA 1VR6A 3NBPA 1NKEA 2FLLA 2DISA 4HT5A 4JI8F 3LH2S 2QC3A 3V6JA 4OZ2A 2R2RA 2GMHA 2C3MA 3RZAA 3M8YA 1RJJA 2YWHA 4BC9A 2NREA 1U1MA 3SBMA 4ETZA 4ELTA 2UXDJ 1RT2A 4CZCA 2NLWA 2V94A 1TV6B 4F36A 5HMYA 1L3KA 3DOLA 2I8EA 2ALYB 4ID5A 4OLPA 5G4DA 2XM3A 4PG7A 5SUHA 1TKZB 5A0YA 3PM9A 1YDLA 3R97A 2MZRA 2IM3A 5KFXA 3UI3A 2JL9A 2VG6A 2CNNB 1TK5A 1VDHA 3W5YA 1HNWJ 4Y34A 4B17A 5K8NA 4RLEA 4WYLA 1X9MA 2BX6A 2W8LA 4X84A 2WSCC 1M0SA 3FQLA 1PC5A 2F9DA 1HMVB 2HRUA 3CIZA 3FCHA 4NYPA 3W66A 3VR1A 2OSRA 1IBKJ 2QA2A 3EPIA 2NYIA 2UV8G 2YQ1A 3NY0A 5L38A 1WD6A 4RW9B 3S1TA 1Y5NB 5HVFA 5BYRA 1X4FA 1KQFB 2DGWA 3QT5A 3TAMA 1HKAA 2DIVA 2QMXA 3T9ZA 4CO1A 3KMSA 3V81A 3T9NA 4DR3F 4KQZA 3G9CA 5I42B 5HQMA 4J9SA 2DBBA 3R3TA 4DFMA 1NH8A 1NK9A 6AT1B 3KJFB 3SMZA 5KG1A 1FKAF 3QATA 2YWGA 3LAKA 4EO6A 3M4XA 2HWHA 4PWWA 4F3OA 3JSYA 4IOAQ 1X9WA 3TVZA 2M5YA 3ILLA 5HROB 3UD4P 2G0JA 4C8YA 4ECUA 3JSMB 3WC0A 5HROA 4KE5A 5J2PB 4NCGB 4ED5A 1AT1B 1PBUA 1W2IA 3B6BA 3EICA 1IR1A 1T9TA 4NLSA 5H9FJ 3PKMA 3HVAA 4KGKA 2B7CB 4YEAA 4WIQA 3DYAA 1FFWB 4YY3F 1H74A 1IBMJ 1WSRA 2GCFA 1ACMB 2PFDA 4GRSA 5I42A 3D68A 2X1AA 3QWUA 4DN9A 1NDLA 2J9EA 1NPRA 4QIVA 1WNEA 1N48A 1LWCB 3BGOP 3HHLB 4V1Ak 3G4SS 1JJ4A 5HL7Q 5GAHU 3D0IE 4TY8A 1RSCA 2KDOA 4LQ9A 1N54B 1VQKS 1W25A 3HVTB 4I7FA 1V6HA 4M5DA 4U7UD 1HI1A 2V68A 3NS6A 4RNMA 2E5LF 2ZKTA 1U0SA 1S48A 4B08A 1U8WA 1EAYC 3RG6A 4FS2A 3JSRA 1ZAXA 2G2YA 2DT9A 2Z0GA 4M5KA 5DZ7A 5LJ3Y 2LDYA 1KFDA 2DO4A 2ILZA 4OYPA 4DX6A 5DQIA 3M8ZA 4USKA 2FB0A 4C3KA 3O3LA 4JV5F 4CO5A 3A3NB 1Y7PA 4JI8J 3A8IA 4HACA 4ZP6A 4ENOA 2MLXA 3PXGa 4ZJLA 3BGRB 3MR7A 4Q45A 1E6VA 2CQ0A 4NZ7A 1R31A 3SDEA 4TLQA 2KRRA 4DSEA 1GAOA 2BE2B 2MZTA 3M6UA 2LQBA 1NAQA 1HLWA 2LEPA 3OTBA 2AGPA 1KNZA 1RAGB 1U1LA 4URQU 1H6KX 2M52A 1GMWA 1RT2B 1YTYA 2MKHA 2W7AA 4RU9A 2EG1A 2EFQA 3I0RB 2XY5A 4PR6A 1FI4A 3OFGA 1KLNA 1N33J 3QJJA 2HFUA 3UCGA 3IAM9 4F04B 2PIIA 3I55S 2C2RA 3T1YJ 2IC3A 1HHQA 2DCUB 2W24A 5ETOA 5DS7A 4AXIA 5DLFA 3PW5A 3FEZA 1NSPA 1RTHA 2HNZB 1X5TA 1S9FA 4OL8A 5RUBA 2IMWP 4MIAA 1JLQA 1RTJA 1KD1T 2XI3A 2HHSA 3J81Y 3CD0A 2CJAA 4AXJA 4L75A 1UZDA 4WP8A 4HKQA 3KK3B 5J2MA 1MSWD 1X9SA 4WJBA 3LP1A 1VHFA 2IA0A 5DGBA 3KK2A 4GO7X 3KLGA 3OT9A 1ZM3A 3W3SA 4XDCA 3KLHA 2M8DB 2XLKA 2OTJS 4WFZA 1ZA1B 2RHSB 4O3PA 3MMBB 2MQLA 3QSIA 4FKYA 4A47A 4F0MA 1HQUB 2W7OA 3DLEA 2H9ZA 2JLFA 1T3OA 1XK8A 2F8MA 3ONQA 4G1IA 2A3JA 1A7GE 4KC5A 4TY9A 2DNQA 5E0OA 1RTDB 4B9TA 4I68A 2APOA 2ZH3A 2CG4A 1WC4A 5L39A 5T7LA 1BY9A 5A8RA 3CJ3A 3RRKA 3CCZA 1I6JA 2ZJQQ 1EKRA 3DCAA 4JI3J 3G8SA 1ZTTA 1R0BG 4JI1J 2QMWA 1C1BB 2CNOB 1LXNA 4RW7B 2RF2A 1EJ7L 4X65J 4M5LA 3R5BA 1C4AA 2LECA 1S6QA 1S4FA 4DI6A 2YNIB 3NGKA 1WJ9A 1AFIA 1XEZA 4C0BA 1VQSA 1B64A 3OFEA 2MHNA 5J2NB 2JEIA 1RABB 3GJQB 2HNZA 2XZTB 1TL3A 2AMCB 2E5GA 3B82A 4HT7A 3GJRB 4TLRA 1SC3B 2LQ9A 3M6XA 2V4QA 3HSJA 1GT8A 4WXWA 1TL7B 2JC0A 5JUMA 1UKUA 5E3QA 2H65B 2V6AA 3ADAC 4L72B 4J9KA 4ED3A 1TAUA 4NXNJ 5HP1A 1X7VA 3N5FA 5CYQA 2DJWA 4OZ0A 2FHJD 1MLAA 1DHMA 4WPAA 2C2DA 3RRGA 1ZA2B 4EZ6A 2L9DA 3BEGB 1U6FA 1VFJA 4KH0B 4NYZA 4UF4A 4DQSA 2NSBA 4ZA1A 3PFOA 1OY8A 2CJKA 4DWIA 4Q0BA 1C0UA 1B99A 2W1BA 3ELHA 3QZ8A 2C3UA 3Q8SB 3GIJA 5J2QB 1L3SA 4Q0BB 1TELA 2EFNA 3AD7C 2KFNA 4CLSA 4DSKA 4O23A 4U8YA 4JV2A 1S1TB 1Q8LA 3CDEA 5IC4B 2OPSB 1IKWB 3LWMA 1TU0B 1SBRA 3FJ2A 2GHWA 1OWXA 5DDPC 2JWNA 2XYPB 3IR7B 4DV2J 1RWWB 3KG4A 5IC6B 1N34J
chains in the Genus database with same CATH topology
5A8WA 2VPZB 1FA0A 5G0RB 3LGMA 1ZPVA 3HHLA 2CPZA 1UEVA 2N3LA 1S1VA 5CD4H 4A48A 2P9EA 1NK4A 1IQTA 3HLUA 3L7PA 2AD9A 1Y4ZB 3UCUP 1ZM9A 3ICLA 1BD6A 1GX6A 5J2NA 1YI2S 1Q81T 5EN1A 3JSBA 3M8PB 3LAMA 1AFIA 3T5KA 5KFEA 3MMCB 3UE2A 1YJVA 5BYSA 2YNIA 3L95X 1RYRA 3IWXA 2VASA 2RUGA 4UY85 1FK9A 4J37A 2FVRA 2LCWA 2VFUA 2DNNA 1U47A 2W8KA 4RW7A 4IG3B 2BM1A 3CCRS 2LU1A 1N6QA 4QIGA 5F8NA 1WHXA 3LOUA 5IS2A 3CD6S 4PCQA 1LW2B 2FUG9 1KHVA 1J2VA 1N56A 2ADBA 3WDOA 3IBWA 1EETB 3CIMA 2DD8S 2QEXS 1DBDA 5MAOA 2G1DA 1RT1B 2WSEC 4NLTA 2XS5A 4DOZA 2W9BB 3IC1A 1TVRB 3LW5C 2ROEA 4CO4A 5IM0A 2W25A 2ZBIA 3M2RB 4FF3A 4WF9Q 2N82B 3DI6A 4BDPA 3K58A 5A2QY 2ZJRQ 4ERDA 4F3QA 3UDCA 5D78A 1HBNA 1XMQF 5HLFA 5JVGQ 4YR0A 5D6GA 2BBEA 4ED1A 2LKZA 1UFLA 4Z2XA 4B9MA 5CZXA 4O3RA 1UVNA 2HWIA 2ZZMA 3DLKB 2RQCA 1C0TA 5IT0A 4F4YA 1V3SA 4I6YA 2IYGA 3ETOA 4DUYF 1TV6A 3MM8A 5LL6d 3HT3A 1RT4A 2OPRB 4RKUC 4I2PA 1GH8A 4RUHA 4G1QB 2FVSA 2MMYA 5EX3A 5FDLA 3KJVA 1O51A 4B9UA 1U24A 1O5JA 3PRBA 4ED2A 3NP5A 3H2UB 5C25B 1KN6A 3PX4A 2MQNA 1WWHA 4LFCF 3CJ2A 3MD3A 2BE2A 2V8GA 4LQ3A 1URRA 4GMKA 4U7CA 4DSLA 2KZZA 3MDFA 4NRUA 2EW9A 3KFWX 3K0JA 1IKXB 3BF4A 3MWBA 3QAEA 1R8HA 2XSJA 3NS5A 3OTOF 3MECA 1T95A 2V2KA 3MM7B 1FHTA 4NPOA 2JEFA 2VPXB 2KXNB 4QWCA 2MGZA 4I2QB 2R7SA 5B0DA 5EWEA 2HNDA 3QLHA 3KG0A 5BYQA 1HYSB 1N5TA 4YR3A 2DPJA 3HVTA 3I5BA 2D9OA 3DRRA 4I7FB 4M5DB 3W2WA 2XCAA 4FNIA 2B3TB 2VPWB 1TL5A 1UVKA 4F4WA 1DRZA 5K8MA 1FXDA 2CYYA 3ZC4A 1V3ZA 3P5TL 3TX8A 2Q3PA 2YWKA 2GQCA 1J5OA 2N7CA 3MTKA 3NL0A 3DLGB 1VQ6S 3I4HX 3VAMA 1LQ9A 2ZOMA 4QR2A 4GKKF 1S10A 3LQVA 1MNEA 4I4BA 1LFPA 3VQTA 4U6PA 3CMAS 2VUGA 4KO0A 5HBMB 3N28A 2QT7A 1Q86T 2CFXA 3O1LA 5U47A 5D3GA 1MWYA 5LSLA 2FJVA 4X4PA 1AW0A 4QYZJ 2UZAA 2FJAB 3FEYB 2EI5A 3J7ZT 1FESA 1P1LA 3F73A 4YDDB 1FRXA 2DGXA 1HBOA 2VBXA 1TP7A 4IFVA 3GIMA 3LP2A 1TFYA 2R2SA 1P8GA 5KFAA 5DDRC 1T94A 3PJWA 3D2WA 3VZIA 1SJFA 1FRMA 2YNHB 2WBRA 3J80Y 2V4JB 4OQJA 1RDRA 1FDAA 5A8WB 3GV8B 1RT3B 3BSOA 4RX6A 2CQIA 1F5BA 3J7YU 4ZP8A 1IKWA 2EC0A 2FD2A 4ZVEA 3DU6A 4FN5A 2AYMA 3AJ2A 4OI6A 3ZZZA 5HMWA 5BJRA 1LWEA 5F0WA 1K0TA 4ILRA 2J6SA 1N0UA 3C2PA 2Q79A 4O4RA 2VV5A 5CZVA 3MFHA 2DNRA 4ECTA 5A0YB 1HHTP 3WC2A 2C2EA 2VONA 1GXTA 3DC2A 3U27A 5E7OB 1QSSA 3NKYA 3DOLB 3MMCA 2BANA 2XMKA 3VAGA 5KFCA 3IWLA 4CNYA 3ISZA 2RRAA 1C2PA 2FJEB 2JZ5A 4E8UA 3S8SA 2VG7A 3GV7B 1RT6B 1APSA 3MF5A 5C42B 2R7TA 1QTMA 4ELUA 2CJBA 4FVMA 3THVA 4RUCA 1Q7YT 1YJTA 4LF7F 1E6YB 4TQSA 2QLWA 1YIJS 4D3GA 1M1KT 2K8GA 3CMES 4ATNA 4RW4A 4N8OA 2DGVA 1LKZA 2GQ2A 5DRKA 3QYYA 2PO4A 3HDSA 4PXCA 2CPHA 3H25A 1HQEA 2PFFB 2WOMB 4IQMA 4USIA 1U8SA 1FKOA 5J2QA 3T1YF 3PO5A 3QMQA 4ITSA 4O4GB 5KG3A 2Q6BA 2E66A 2BR0A 1C1BA 1ZH5A 2XC9A 2NQPA 1YJWS 2N7YA 5FIIA 1D9DA 2J9DE 1Y3KA 3H5SA 3MM5B 4IH7A 4X4NA 1S1XA 4IH5A 3M30A 2PD1A 2DITA 4OX6A 4O3OA 2ZH8A 3CCVS 1U49A 2OD4A 3NRBA 1VBYA 1N5VA 3GMGA 4PWDB 1VRTB 4XAKA 4DBQA 3AJ1A 3NGDA 2GJ2A 1AXQA 3ITHB 4NOHA 3BR8A 4JUZA 2UVUA 5J1NA 1VRTA 2KHDA 3HFKA 2BQUA 4DSKA 4A8WA 1HR0F 1NK5A 1FERA 5MLCV 3HHDA 3MD1A 1KR4A 1NB7A 2O1PA 3KKFA 1T05B 5THWA 4DF4A 2B7BB 2XMJA 3D0GE 4TU7A 1RTIB 4RWWA 4KAIA 4Y28C 3K5PA 3FZBA 2YKMB 2W4DA 3KK2B 3IO1A 3WX4A 4HH0A 5KT6A 3MTJA 2XMTA 1F9FA 4TU9A 1JMTA 5ITHA 1O0PA 2YKNB 4UQGA 5E33A 1HQEB 4UW2A 2IM0A 4HLBA 2W9CA 1HD1A 4I56A 2B51A 2HGLA 3E8OA 3TRGA 2BJEA 4C7QA 4B3TF 2XMUA 3I9ZA 3LO3A 1FDDA 3UD3P 2GNKA 1KHWA 5B0FA 1RGVA 5M2RA 3OXGA 2YKOA 5J1PA 1YQHA 4F2SA 1HBUB 3CCMS 2B5JA 3D1OA 4I67A 1WEZA 3R5CA 5DM7Q 3PX6A 2D41A 5CH7B 2L3MA 3BO2A 1HQUA 2YX7A 1RAJA 4O44B 2ZOFA 4C8ZA 2B6AA 4QWEA 4DLEA 2OH2A 2XWYA 4EBEA 1X0PA 3PACA 3K5MA 1OPZA 3K8WA 3M32B 1TZ0A 1SJ3P 2JHEA 5A6WA 2LVWA 2EPIA 3MI7X 2OPPA 5DLGA 1KFSA 4CH1A 3CCJS 3OV7A 1DFDA 1JKHA 3HHEA 5AE2A 1FEHA 1CVJA 1P6TA 1X5OA 5LSOA 2MQOA 3H4DA 3D5MA 2XBPA 2WW8A 2QSFA 3TA1A 4EZ9A 3MCSA 2IC3B 1OQ6A 4ED8A 3B78A 1S1UA 4ECYA 3IG1B 1VS3A 2AQ4A 2JEJA 1SIWB 1BLUA 1XERA 4MTPA 2PN6A 2AP6A 1R89A 2JH3A 2KXHA 3DYAB 2CQGA 2KI2A 3EUNA 4ZLPA 4IFYA 2XGPA 4NLGA 1YBAA 1FNMA 3EXCX 3QGGA 1KONA 5DJBA 1ZBTA 2F9JA 1FXLA 1S6UA 1JB0C 2EBGA 2DNYA 1NK0A 4OJHA 3CCTA 3OR1A 1U1OA 4OHWA 3HX9A 3KLIB 3X1LB 2COLA 5AXLA 2NR0A 4O3SA 3HHNB 3CVKA 4YQWA 1IM4A 1HNIB 4DR5F 2RILA 1K1QA 1S9GA 2GO9A 4IR1A 2FHJA 3HVRA 4EBCA 4NXMF 2RE1A 1U09A 1VIXA 3RU0A 4JI7F 4B3SF 1KOHA 4X4TA 1OS5A 4ICLA 4F8RA 2IFXA 3GFZA 5DM6Q 4DR2F 1VI7A 4JOUA 4J5OA 4ZCKA 2D3OR 4QBUA 2ZD1B 2CQPA 3H20A 2HHVA 5KFVA 3G8QA 4C0OC 5KTQA 1Q8IA 4P6QA 3M9MB 4NLWA 2CQHA 4TYBA 3ZZPA 3IRXA 2ASDA 3GFYA 2B4OA 2J0XA 1TKZA 1NJIT 1DQ8A 4EUVA 3GILA 4DG1B 3OW2R 4UY8T 3AB4B 2ZHBA 3G6ES 1F0XA 3AA8A 2J6TA 1N0VC 3M9NB 3MEKA 4MK7A 4ELVA 3OHBA 1IXKA 4EGLA 2ATLA 3PEHA 5FDLB 3KJVB 1WG5A 1N4LA 2EFVA 1G7CB 4TN2A 3WZ0A 2F7VA 3M6VA 2MKKA 3M8RA 2IJNA 3NBPB 2YH1A 2PGCA 2BJDA 3DRRB 3W2WB 3NCPA 3THTA 2MZJA 2KXFA 2MY8A 2RT3A 1UP1A 5CHCB 4C98A 2I2YA 3DLKA 4K4WA 2I38A 3F41A 4NCBA 1TK8A 1QAJA 3EZ5A 4ZK7M 2E9ZA 4JV1A 3N6LA 4B9SA 3MECB 4DV3F 2OPQA 4YB7A 2L9WA 4QYRA 1OSCA 3C6UA 1FRHA 2WBMA 4KFBA 2MHEA 1U45A 1ZPWX 3SSSA 1IBMF 1HARA 3PR5B 4E0DA 1RYSA 4RW6A 1AROP 1S6PB 3M2RA 4I1TA 2L9NA 2KT2A 3OXFA 4ES2A 4QQBA 5EHHA 3H5XA 4LF9F 4QR1A 4HTJA 3J7A1 1HNZF 3O44A 3BDEA 3QIDA 2HMIA 4AE5A 4YHHF 1RT1A 4PPDA 2HWTA 1FVSA 1HBUA 3PNIA 1KS2A 4MKAA 4B02A 2G4BA 4O3QA 1FE4A 3KK1B 1NRKA 4NA1A 3S7RA 2OFGX 2O5DA 3BJYA 4BBYA 2DHGA 2XZWA 1WI8A 2QE5A 3PY8A 2EFPA 2KN4A 3IRXB 2LEAA 4X4SA 3SCJE 1NKCA 2HHQA 1N6QB 3AA9A 3PW4A 3GZ7A 2PEHA 2FLNA 2HVZA 1D9FA 2JOQA 3RYLA 2YKPA 2MJNA 2W9CB 2DR7A 1KSPA 4LF6F 3MEEA 2HHHF 3BSNA 5HMXA 4HDGA 3QJLA 3HKZD 3N6NA 5DQHA 1YWXA 4HL9A 5LSRA 1ULRA 5KG5A 1S79A 4J9RA 4ICLB 1SQEA 4G1PA 3EYZA 1QSLA 1I1GA 4FYDA 5DGAA 4NA2A 3NAIA 3VAHA 2CPDA 1YRXA 3OVAA 1KEKA 1S1VB 4JI5F 4YB1P 4WKRA 3DRSA 3ISND 1VQLS 1FRJA 5KFTA 3FDSA 2GGPB 1WI6A 3DOKA 3EGWB 2MSTA 2RRBA 3R5DA 4ZCLA 3W7BA 2RS2A 3CJKB 2NSCA 2JSXA 3KLFB 3OPKA 5KFNA 5DG9A 4CO0A 1DLOB 3AQPA 1X4BA 1NO8A 1R8BA 2YKQA 1PO6A 3H5UA 1X4EA 1SKSA 1N5YA 1N36F 5IFMA 1VBXA 4B9VA 2POKA 2HLUA 3KG1A 3MR5A 4IDKA 5BR8F 2CDQA 2YH0A 2J76E 3V6DB 2OAUA 5HP1B 1SJ4P 3WBZA 2RKIA 2ZVSA 1REVA 5KFYA 2RNEA 2KG0A 1YSJA 2P6SA 3U7JA 1FTRA 3NCRA 3T5HA 1MROA 1S0VA 3SI8A 1R8PA 2DB1A 4KPYA 4BHQA 1R0AA 1LWFA 1RK8A 2DR5A 1IKYA 3OHAA 4X4UA 1R0AB 1H38A 1RI7A 2OMLA 3M8SA 4H4MA 4ZS6A 4H4OA 2FJWA 4OI1A 4ECQA 3OR2B 4LFBF 3Q8QB 3PHEA 2MB0B 1GX5A 2PA8D 1HBMB 2VBYA 4IDKB 4IRKA 4YP3A 4C8NA 1IJFB 2MZQA 1T8EA 1P1TA 3PRDA 3GWCA 1Q78A 3LF0A 3UNGC 2OP5A 4DL2A 3TYTA 2YQ3A 5B0GA 3DRPA 4X62F 2R4FA 4LSNB 1UA0A 3V4MA 1QAIA 2IVFB 2VA2A 2FHKA 4DQIA 1BQMA 3DN9A 2VQEF 2ZC3A 2RU3A 3I31A 5A8KB 2R2UA 1ZETA 1BGXT 1TUVA 4NMLA 4TYAA 2UUCF 3VQSA 2B5JB 2HRYA 1T03B 5EUHA 1LWFB 1N32F 2UXBF 3K59A 1RKIA 4A8OA 2J7UA 4O3NA 4FXVA 1FD8A 3M2UB 1NU4A 4ZHRB 3C66A 3KLGB 2JX2A 2AYEA 2I0XA 4EYHB 3SFUA 2IVYA 1KTQA 1LXJA 2C28A 3F44A 2LMIA 3HM9A 3VALA 2F8EX 1SI9A 4OLOA 3HI9A 3ZFVA 2VFTA 1U48A 2DNGA 1Y5LB 2QZ8A 1JWWA 4K4ZA 5F0UA 2EK1A 3RW6A 2R2TA 4JYAF 2YKMA 3KLFA 3RR8A 4PQUB 2HPUA 4MKBA 4OI4A 4URGA 3N01A 2ZH6A 2ZE2A 3E3XA 4PQAA 4C97A 2Q66A 1IUJA 2L08A 1FRKA 2FY1A 1U1PA 4J9LA 2LLZA 5L9NA 4ED6A 2BOPA 1RTDA 4AL5A 1F60B 1X4DA 2P9CA 4YB5A 1Q79A 3L3CA 2R7WA 2DO0A 1DJ0A 1S6PA 1S1XB 3QGHA 4PG5A 4USJC 3SEOA 2BV3A 2AGQA 1A9NB 4DF8A 1FE0A 2DHSA 3L09A 2UVWA 3DDNA 4CTAB 4C8LA 4ZP7A 3QZ7A 4IR9A 3OTCA 2WOMA 4KGMA 2W9AA 2LEBA 3NMRA 4X4VA 2I5JA 2WRMA 2UXCF 2HHPA 1TKDA 2B9WA 5KFKA 2ERRA 1SC6A 4ID8A 1WG1A 1SUQA 3OFFA 1YGYA 4DL4A 2Z2LA 1R3NA 3CEDA 5KFQA 4DL0C 1SV5A 4PXDA 2JFDA 1PC4A 2LXUA 1FEEA 3VAKA 3TVYA 4JI1F 3DFEA 4C9DA 1S97A 4J9QA 3R27A 3LP0A 4G1QA 2G0CA 2HMIB 5HQ8A 1REVB 3SV4A 1VOMA 1WTFA 3I5CA 1O8BA 2LDIA 2JDJA 4PPZA 2DGTA 4Y2CA 1FJ7A 4DLGA 1HNVA 3HHLD 2FTRA 2K1RB 2PMHA 2DH7A 4NCGA 5AXMA 3BGRA 3CTRA 3D54A 1N5QA 3I9V9 4A46A 1WF1A 3C46A 3BB5A 3K5NA 4C2MA 3C6TA 4OIXA 4OHVA 3I0SA 5FJ4A 5KFMA 1KLMA 2M9KA 4F25A 4RUAA 2K7KA 2LQJA 2ZJPQ 5D8HB 4I6AA 5K14B 1Y9OA 1HPZB 4DQQA 5F8GA 3HVWA 4J9PA 1PSDA 2CVIA 2ZDPA 2DNZA 3V81B 2VC1A 2JEGA 5EGYA 4WTYA 3RAQA 1TVRA 1CLFA 3EZUA 5SZTA 2ASYA 3PDNA 2GHVC 4WFAQ 3UR0A 4URSA 4I64A 4C4WA 4OZ1A 2NPFA 1MU2A 2RQ4A 1S72S 2ZH5A 2R8IA 3OR1B 2DRAA 3IR6B 2ACYA 4L3NA 4DG1A 2Q6CA 5L1LA 2NS1B 2RS8A 4ZMMA 2M7SA 5J2PA 3KTQA 1LK7A 2ZNYA 2FC8A 1JK9B 1HW8A 2IRUA 4PKDB 3MUTP 3OSNA 3Q0AA 5D3GB 3SCLE 3PFEA 2HLTA 5LT5A 1HI8A 2CJQA 2ZD1A 1G6BA 2IHR1 2DGUA 2PI5A 5KT2A 5CYMA 1SIZA 5KFSA 3N79A 4K4VA 2AJQA 1VK3A 4OI2A 2CJ9A 4ZPDA 4A8XA 5K8PA 4ZVFA 1X5SA 1HWIA 4QWBA 3IWNC 3BQ2A 3M1VB 4LUBA 3QWPA 2J0SD 1GQEA 2FDNA 1FJGF 1S0MA 1HFEL 1S0OA 3PX0A 4ILLA 3GFXA 2HGMA 4RW6B 1FNXH 2EK6A 3IAS9 4UOCA 3KWMA 3LALA 5KFWA 1DTQA 1Q7LB