2FHJD

Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
296
structure length
295
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
publication title The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
pubmed doi rcsb
source organism Methanopyrus kandleri
total genus 82
structure length 295
sequence length 296
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2005-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
D PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD01
2FHJA 1M5HA 1M5SA 2FHJD 1FTRA 2FHKA
chains in the Genus database with same CATH superfamily
4P74A 3TUPA 2CNOB 3QGPA 3PCOB 2AYBA 2LDYA 3RR8A 1REVB 2D3OR 2XY6A 3T1YF 4ID5A 4OHXA 3J81Y 2ZH5A 2C2ZB 4IRCA 2NXJA 2YWGA 3HVTB 1DAXA 2QG9B 1XMBA 2D7SA 1YJNS 4JI2J 1IBLJ 3I9ZA 1YDLA 1RWVB 1WOSA 3MEGB 4DR2F 1Y3KA 3HSGA 2B6AA 2HNYA 3DLGA 3OFFA 2RU3A 4FS1A 5D0GA 1ZYQA 1YJUA 5DDOC 1S97A 4LF1A 4O3PA 1Y4ZB 2DGSA 3GR1A 3CCTA 4M5DB 1U6BA 2VQEJ 4L3KA 1TL1B 2HVHA 2QC3A 1X0PA 2X3GA 3R5BA 2J7UA 4HT5A 4NEYA 5ETTA 2HQ3A 1WF1A 3NMAA 2DNMA 4R8UA 1WOPA 4F4AA 1F5BA 2J7WA 1F2GA 3EZUA 1S9EB 2RQCA 1DRZA 3E3XA 3QGGA 2UXBF 3MCOA 4Y3CA 2V9KA 3JTOA 2MSSA 2DBBA 1QD1A 2DHHA 1OYDA 2E1PA 2CVEA 4FYYB 4WU3A 4ECVA 5K20B 2LEBA 2I38A 4LFCF 1WDTA 2L9WA 4JI8F 4J9NA 1PYTA 3A8JA 3OLAA 3KDOA 4ZPDA 1YRXA 3TO8A 1NDPA 4DJBA 3EYZA 2ZBPA 1WJ9A 1C1CA 1XNQJ 2HVDA 2JJ4D 4J9PA 4I7FA 4Q8EA 3NAHA 4OL8A 2UV8A 2XSJB 1NB2A 4LF6J 5LMUF 1NJXA 2IDLA 5D3GB 2F4VJ 3GYXB 1XMQJ 4M1KA 2F8HA 1Q82T 3OFGA 5F3ZA 4USWA 1JJHA 2YKPA 3AJDA 2H65B 2HBYB 3KUHA 1BWEA 4F4KA 3AAWB 1YIJS 3GG0A 1H3DA 2AP6A 2HS4A 4KE5A 3GPAA 2MZQA 2R7QA 4LBPA 2GVDA 3EPGA 1TKTA 4Q7AA 2CWKA 3BKFA 1X31C 2FZKB 3W2VA 2J6UA 1JNRB 1D9DA 4BWMA 4WFNQ 2EEYA 1F3VA 4F3MA 3HT3A 3MEEA 4ZVTB 3V81B 4Y65A 4A48A 4P2SA 2KFNA 1U1RA 4CWBA 2AYEA 2BANB 2HRUA 1X4FA 4NLYA 4H4KA 3BGLA 4FVMA 1XIQA 1C1BB 1RAGB 1NK4A 4RW6B 2OFHX 2DH9A 3J7YU 4BCAA 3TUIC 1NJZA 3D54A 4EFAC 1HBUB 2HHTA 3VAHA 2Z2YB 5LSOA 3MXHP 4C8LA 1CJVB 3C6UA 2IFXA 2LKZA 1TKZB 2ERRA 4PYDA 1L3TA 3OUYA 3Q86A 3KLGB 2LP4A 1RT4A 2WRMA 1S57A 2ZHAA 2HNZA 1VC6A 3C14B 1FKOA 4LRDA 3RW7A 4LF4F 1CEZA 5D0RA 1D3WA 4FP9A 2DPIA 1LKZA 4KFBA 1PAEX 5IV4A 3N0VA 4HL9A 5D77A 4O44B 1REVA 4X4RA 2RT3A 2JFKA 1B4SA 2EG1A 3EWGA 3K5PA 4JV5J 2GQCA 1RE1B 3HVTA 2ZBCA 4EZ9A 1N5SA 2HHWA 1OY6A 2FJBB 4LF2A 3W2WA 3VZIA 4PR6A 3BGUA 3CMES 4MIWA 2Q1LA 1PBUA 3D67A 4FPRA 3OD2A 4E8UA 4WK3A 4JI5F 2XO6A 2BQUA 4DSLA 3R27A 4DV0F 1LW2A 3ET6B 2OIHA 4I2PA 1DLOB 3RBDA 1JIHA 3PM9A 1HBOA 4NA3A 4IOBA 5CYMA 5E3AA 4DV2J 3GJTB 4QCLA 5DG7A 2J0SD 4TY9A 3CO9A 2OFGX 4LQ3A 3NWRA 3KG1A 3PW4A 1L3VA 3PYEA 4NZ6A 1DY3A 5ETNA 4V19J 1IUJA 2H9ZA 3O3LA 3TQ1A 4RWWA 2EBEA 2B56A 1EB0A 2GMLA 1QAXA 1VFJA 2QLXA 2PN6A 3MI7X 5KFUA 4ZKAA 2F9DA 3FC9A 3W61A 3D1HA 5C2CA 3ICLA 2AZ1A 1U1MA 2ZUAA 1R43A 2W2NP 3MEKA 2EW9A 1NJWA 2F3JA 4ZVEA 3FGVA 4ER8A 5AT1B 1TK5A 5C42B 3TW0A 1MWQA 2DR5A 3AQOA 4U7UK 3R97A 3HHNB 1TK0A 4ZIWA 5JXSA 1HR0J 1HBNA 4P52A 1H74A 2EFGA 2BE2B 3VF0B 1FRKA 3D6MB 1K1QA 3H25A 3VAFA 1HD0A 3K8WA 1HMVB 3LP1A 3HVAA 3V6JA 1ELOA 3W8GA 1HIYA 3B54A 4DL5A 3BDPA 2BACA 5L1JA 2PEHA 3KMSA 3MCMA 2VG5B 3SBMA 3UNYA 1V5IB 3DDKA 1UW9A 2WTFA 1TK8A 1WC4A 2B4UA 4OZ2A 2HVEA 1R8CA 4OQJA 4LF8F 5DETA 1U0HB 3DRXA 1Q8IA 4ATNA 4KKOA 2BX6A 2CJKA 3NMRA 2HZVA 3EJMA 4Z37A 4ZP6A 2ATCB 1RYSA 2RDIA 4WPAA 1S6QB 4RW6A 2XB2D 3GJRB 1H72C 1P6TA 5CYQA 1YRUA 1YRTA 4JBCA 4B3RF 1RHUB 4MTPA 2VBYA 2QZ8A 2JNJA 3NNHA 1YI2S 5E3PA 4YHHJ 2PSZA 4PG6A 4ECZA 1VRQC 3DI6A 3CC4S 1VGYA 3CJQA 4J9VA 3KLGA 4DLEA 4WYWA 1XWLA 4PQUA 3IAM9 3C14A 1LK5A 1EZZB 4DS5A 4NZ0A 2L48A 2HNDA 1GQEA 3G9CA 1GH8A 1CPZA 4FN5A 1QSLA 1C0TA 3MZIA 1E6YA 1F9HA 1KP6A 5MAOA 2VA3A 2LA4A 1HPZB 1PAUB 2E9TA 2W4DA 1FVQA 2XC9A 3FSXA 3H5SA 2C3YA 2J8AA 3OHAA 4B3OA 4X4OA 3O44A 4TU7A 2N7YA 1KKHA 1BQXA 4ZJQA 2P6SA 2DNRA 3KLIB 4DG1A 1N4LA 3NG8A 1VIXA 4CM0A 4P10A 4L3NA 2WVCA 3FQLA 1C0UB 2OPQA 4ZVSB 5KG7A 3ET6A 3W63A 2NPIA 1IBMJ 2R3VA 1TUWA 2KYZA 1QE1A 4ED3A 1ITPA 2LXUA 5J2MB 1TTHB 5E2QA 1RAIB 3G8TA 3VAJA 1VQ7S 4HACB 3DC2A 5AJ3J 1RWKB 2HEKA 2QMXA 1ICEB 5GAHI 2C2NA 3MUVP 3H40A 4DL6A 3HD1A 3QRPA 1FD2A 1L5UA 3IRWP 1VYAA 2V67A 4ZVFA 2NXCA 3PKYA 3JYTA 2FJVA 3PG9A 2DISA 3DDNA 1YJTA 4RNNA 3IBFB 4TKTA 1SH2A 2CDQA 3SV3A 3TUZC 3IP0A 4XPEA 4LBHA 1PG5B 1NUEA 2I5JB 1FXDA 4LSZB 3KLVA 2MYFA 4H4MB 2MQOA 5L1KA 1MNEA 1VHIA 2FVQA 1KBRA 1WC5A 2MKYA 5C42A 1ZA1B 3MMAB 1ZTTA 2UUAF 2HFUA 3QRQA 3A8IA 5DS7A 5JVHQ 4FDFA 3U1NA 3FCHA 1JLAB 1M1HA 4K0KJ 3LALA 3IGNA 2FIUA 3C46A 5KOXA 1ACMB 3ZZRA 1HMVA 4U8VA 1SUQB 1T94A 1SIWB 4EWTA 3SMZA 2DB1A 1RT5B 2AEFA 2LU2A 2HHSA 2Z2LA 5DM6Q 4LSNB 3UN5A 2X1BA 2E29A 3MWBA 2J9DA 1GX6A 3ZZUA 3MUMP 3P6YC 1Q78A 4CLWA 5D0EA 3VQTA 4IH7A 1UW4A 1A7GE 1K47A 5HLFB 2GV1A 3GWCA 4EO8A 1ZA2B 1KTVA 2ZC3A 2CADA 3Q22A 2AJFE 1WC0A 2ZBIA 1RADB 4ECWA 1KVIA 1WTBA 2CJAA 3V6KA 5C2GA 1FESA 1UVNA 1EX8A 2WB1D 5IWAF 1LQ9A 2O3DA 4UUWA 2P9EA 3M30B 2ZZTA 2KXFA 3ZXWA 1XJWB 2VPYB 3UVJA 1I94F 4J91A 2XM3A 1B99A 3Q2SC 4PEOA 3W9HA 1WD6A 3DOMA 3P5TL 1R27B 1TR0A 4M8LA 4B9NA 3UDCA 2KJWA 3SCKE 2CXEA 2EFNA 4KSEB 5AXKA 1T3OA 4OZLA 3QT6A 2UXCF 3GFZA 4PPZA 2KFZA 2NZ4A 1BMQB 3G86A 1QM9A 2U2FA 1VDHA 1RT3B 2YWFA 1VS3A 1NH7A 3Q0AA 3M9OB 2YKMA 2QSWA 5KG5A 3CJ2A 2GQ2A 4XDDA 1T9WA 2VONA 4AD6A 3GE9A 3S6EA 2M2BA 2OSQA 1K8AT 4YS2A 3PR4A 3BN7A 2HVIA 4F4ZA 3RZAA 2Y3YA 2RUSA 2YVSA 4KGZB 4DL4A 2G0CA 1S1WA 4J9KA 4I4BA 4ITSA 1U1PA 3M8WA 1FVSA 2WVBA 3Q8RB 3PYDA 2I8EA 4WKRA 4W90B 3T1YJ 4N76A 4URQU 1PKUA 3LGMA 2KG1A 1UZHA 4OLPA 4HDHA 3G4SS 4OI4A 4FXVA 2CIMA 2YNHB 4J90A 1R0CB 3GV7B 3IWXA 4NLRA 1B0TA 4HHJA 3KK1B 1O8BA 2RB7A 2EC2A 2VFSA 3VAKA 2W8LA 1RUSA 3TEGA 5CQGA 2OTLS 4RNHA 1K0VA 5J2MA 2WSEC 4YMEA 1R6YA 3I0RB 4HACA 3ETMA 3D6TB 3ENWA 2CNLB 3V6DB 3FFIB 2K2PA 2HBZB 1R0AA 1LK7A 3PFOA 2PO4A 4FBUA 5FLXU 2R2TA 2PDAA 2IHR1 3LWMA 1IQTA 3AA8A 4CO5A 3CIMA 3L7PA 2XG8A 4K4UA 4N5SA 3TJAA 2WONA 3NGUA 1FFWB 4X4UA 2ZM6F 1RT7A 5EGYA 4F26A 4ECUA 1SVDA 5KFVA 3HM9A 2KH9A 1VOMA 4ZHRB 4QR0A 4ECQA 4A8OA 1URNA 2I5JA 4EO6A 3W5ZA 3MAAA 4C0HA 3BO2A 2FHJA 2O5DA 2OSRA 5HVHA 2PEBA 2BW7A 2KL8A 4Q44A 1Y9OA 4DCJB 1UJ4A 4RBTA 2JLFA 2AGQA 4QPXA 2YNGB 4FF1A 4NCGA 2A6MA 3M6VA 3PX6A 1JKHB 4DPTA 2V0NA 5B08A 4OYMA 3PYFA 2DHXA 3TARA 3K8VA 4K2XA 1RT6B 2CPXA 5A8WA 3POTA 4F4WA 3MD1A 1M5SA 1VC5A 1U1QA 2W2QP 4YR0A 2ASYA 3DOKB 3DU6A 2W9CA 5IT9U 3BGRB 5C25B 4QWCA 5HLFA 5KFAA 4MFBB 2OUGA 1S4FA 4JI4J 4YEAA 2D1CA 3VWSA 4ZCMA 4ZS6A 1MLAA 4DUZJ 4DN9A 2O1PA 2QX0A 5E33A 3LANA 3DRRA 5LXRA 4AXJA 2LEAA 4DOZA 2MB0B 4LJMA 3N01A 3TNVA 4IKAA 2K1RB 1TL7B 1ULRA 2DNLA 2XO7A 2QL7B 2MY7A 1QUVA 4BS2A 3D6FB 1EQ0A 1N5QA 2AZ3A 4U9RA 3NOGA 2OPRB 2R8KA 5BJRA 3U1MA 3ENVA 2ILYA 2K7KA 3FK4A 2M8DB 1SV5B 3RRKA 2VG7A 2IRUA 1AT1B 3PV8A 1BUXA 1JLEA 2ZNYA 4KO0B 1KOHA 1P27B 2OP5A 1M1KT 2FJAB 5HN0A 3QLHA 1U2FA 1DHMA 4DR6J 2ZH3A 1XC9A 1X5OA 3HZEA 3KK2B 4PWUA 4EYHB 3DRSB 3W66A 2HSEB 4F36A 5EWFA 1S6PA 2DR9A 2K06A 1CJTB 1T11A 2V50A 4WZQA 1YKWA 1CSJA 3QJPA 1FNXH 4L74A 3ZFVA 2PFDA 3DOLB 4EUVA 4ED7A 1WEYA 5B0DA 1SC6A 4UOHA 1KFSA 5KT4A 3IM8A 5H9EK 4DN0A 3HHLB 1CBKA 4LVNP 1CS4A 2OAUA 1KD1T 3PRBA 2IA6A 3TOQA 4C11B 2B51A 3QIPA 1TFYA 4NRUA 1IKYA 3T5JA 4YDXA 1RAEB 1EKSA 1SJ3P 2JSXA 1IKVB 3CD5A 4JI5J 1U1KA 5H9EJ 2M9KA 3QWPA 3J7YI 3HKWA 1WUUA 3DHXA 4Q2LA 7FDRA 2X3DA 2IVYA 5B09A 2YKNA 1QLNA 5L1LA 4PG7A 3FBEA 1KEKA 2CPFA 2DXFA 2DNQA 2YQ0A 3R8YA 3OXLA 4TU9A 2XYHB 3UD4P 2RD5C 1LWXA 5J1PA 2XMTA 4UQTA 1T05B 1LNQA 1RTHA 2DH8A 3P49B 4WE1A 2YNGA 3BF4A 4TLRA 1VQ9S 1RP5A 1YBUA 2JEJA 3SCJE 2ZD1B 5KT7A 1Q0NA 4L76A 4ES1A 5KAKA 2FJWA 1DZ5A 1X4DA 1WHXA 3TANA 2MKJA 2RNEA 1UEVA 3R5DA 5G0RB 1RT6A 3K17A 4O3OA 5EHHA 1S1XA 2CRLA 1UA0A 3EXYA 3N9UC 1S1UB 2NS1B 5DO2A 2G0JA 2KHCA 5IM0B 5K14A 4ZIVA 1UETA 5IC4B 3M2UB 1HKAA 4P75A 4DV5F 3MR6A 4TXSA 1VR6A 4X84A 1U2CA 4WP3A 1GK8A 1OIAA 1U6FA 3MOJB 5L38A 4LF5F 5CCMA 3KDNA 2FVRA 2ZWOA 1Y11A 4P7VA 4DWIA 3OV7A 4PWWA 1WOOA 2HQGA 1NJYA 4PXBA 5E3RA 3TX8A 1R8PA 1D9FA 3KKFA 4KGXB 5HAOA 1HWKA 2V9WA 4OJGA 1J27A 3CVKA 1J5OB 2L08A 3RUBL 2MKIA 1RABB 1MROB 2BRKA 4ELTA 1YTYA 3QBCA 2CQGA 1LV5A 4EI2A 3PNIA 1ROFA 2XLJA 1VRUA 3Q8QB 3NEKA 3LTOA 1I51B 1UL3A 1LXJA 1SV5A 2CPJA 2ZBRA 4ZPAA 3ZNUA 5ETLA 1HBMA 4B3RJ 3OBIA 3BSCA 1DURA 3J80U 3TX0A 1RLCL 1N0UA 1UMJA 4NCBA 4A8WA 1RTIB 3IA0A 5GVQA 2Q43A 2KDOA 2C3UA 1X5TA 3VHQA 2QFJA 1OPZA 3D3CJ 3HVRA 2JVRA 2W7PA 3FMBA 1NCLA 3IS9A 3DRSA 1YJ7A 3OTOF 3M8PB 3KHRA 3H5XA 3EUNA 1YZ7A 3ZZ0A 1HW8A 4JYAF 5C5JA 4FBTA 2JFDA 3R7NB 3WDOA 2NSBA 4Q8FA 4DR5J 3UPFA 2YNIB 3QGHA 4L73A 1VQ6S 1AB8A 1FE4A 1EETA 2MLZA 3HDSA 5GMEA 2CZVC 2J76E 4DSFA 4UQGA 1RACB 4Q43A 5CHCB 4USUA 4GC7A 3BYPA 3ONQA 2JWNA 2AX1A 3G87A 3AB2B 2AJ1A 4WCEQ 3TVKA 4MT1A 3N6MA 3MTKA 1F1BB 2GNKA 3R7BB 1WACA 1GMUA 4I1TA 5C24B 4URGA 1FDAA 2GO9A 4J37A 3BKUA 3M8YA 3US5A 3ZZYA 4WFYA 4DV1J 2RHSB 3R5GA 5BR8F 2GIFA 2LCWA 5DLGA 4DBQA 2MLYA 3RB6A 4OIXA 2NXUA 1HNVB 2QA1A 4ZVGA 1TL3B 3TA2A 1SJ4P 3GFYA 5E3CA 2GS8A 2JOQA 2E9ZA 2A0FB 1RHQB 1Q7LB 5E0OA 1KTQA 3UD5A 3BJYA 4K5SA 2ZD1A 4JI7J 3VR1A 1VRTA 1QSYA 1A0OB 2H1YA 2BJ7A 4LQ9A 4JUZA 4X4PA 4Y6IA 2R4FA 3UN2A 2OELA 1KS2A 4U6PA 4OJ3A 3CTRA 3SIPB 1S1UA 2IY5B 4K4XA 3MF5A 3MR7A 5M2UA 3AD9C 3V4IB 4JI2F 1U2RA 2RS2A 1H6KX 4F4YA 1IBLF 1B70B 1W26A 2XMWA 3H4DA 1FNMA 3F44A 3ZTQA 5KFMA 3SDEB 3N79A 3MM7B 1F6TA 2ROPA 1VI7A 2C42A 3EZOA 3NCRA 1UFLA 4R5PA 2VQEF 4XTTA 3RTVA 3ZTPA 1Y0HA 1U09A 4Y00A 1HL6A 2BJ1A 2P6TA 2DPJA 3PO4A 1MROA 5IWAJ 3U7JA 2VUGA 4KQZA 4ZVQB 1O6XA 2BZ2A 4X64J 2VASA 2VU5A 2DIUA 2IJRA 2FJDB 1R0BG 1GNKA 3UR3C 5KFHA 1SI9A 1HWJA 1Z1ZA 4J9UE 1RT1B 1WKJA 2B8QA 5JVGQ 1FFSB 1T7PA 1HARA 2IM1A 5AE1A 2NR0A 2CWXA 1RJJA 3QO9B 3AY0A 1BQMA 3GV8B 2OEMA 1VQLS 4DXLA 1RYRA 1DFDA 1JB0C 2C1EB 3D0IE 5IV3A 2UXCJ 1NBEB 3HJVA 2V8GA 2XGPA 4B9LA 5MLCV 5U47A 2PGCA 1UJ6A 4OHVA 2F4VF 5HBMA 2XI3A 2XCAA 4K2JA 2OPSA 5I42B 2E7VA 3AB4B 3QWUA 5L8RC 4CYUB 4NLPA 3W5XA 2QFIA 1IM6A 3AXKA 5I3UB 2DXDA 4OHYA 5KG2A 4CP5A 1NRKA 1KQSR 3CJKB 4OFZA 1VQOS 4ED0A 2QA4G 4QYRA 3D7SB 2YKOA 2MQNA 5KFKA 4WFAQ 3M9MB 2IMWP 2GJIA 2WVFA 4OI6A 2F1FA 2YKQA 3NRBA 3SZ2A 1VIOA 1N56A 4BDPA 1MU2B 4YY3J 4F4XA 2NSCA 3KLHB 3MR5A 4DQPA 4KIAA 3UCUP 1QVFR 1Q8LA 1LXNA 1K9MT 1FWLA 2KFYA 4ICLB 1LWEB 3W8PA 2VICA 1V3SA 3QJJA 1SC1B 5C24A 3FJ2A 2OI2A 4IFVB 2B9WA 2ILZA 2KT2A 2W4PA 3CEDA 3JTNA 4O3SA 4O3QA 2H3EB 3B82A 3A3NB 2XMUA 4S0MA 3ILIA 2W9BB 1OS5A 3VVTA 4CRJA 4WWSA 4RW7A 1YITS 4CLTA 1I1GA 4RX6A 4C3KA 3VQSA 5K5MA 1W7WA 2DITA 1FCAA 3M8ZA 4FXDA 2IYIA 1U26A 4DR4F 4A8SA 3AD7C 3NL0A 1JXEA 3H42A 2EFQA 3KG0A 3DYAB 3S1TA 2ZM6J 4KTQA 2JC0A 1QY7A 2QEXS 1TKDA 1KFDA 3TZZA 4QIGA 4A47A 3T1HF 2AEMA 1PSDA 1NEEA 2MKKA 5BXIA 2MZ1A 1BE4A 2KVIA 4WP9A 3IO1A 2NYHA 2ALZA 2N4CA 3Q23A 1C4AA 4RNFA 3CPWR 4K4VA 1O0PA 4RBVA 5CD4A 3CDEA 2QYCA 1BQNB 3R6LB 1BXNA 2V4JA 2I1RA 2IAJB 3SQGB 2ZH8A 2RSQA 2APOA 1M5PC 2QLWA 2ZDPA 4ELVA 2Z2MA 4P72A 5J2QB 3BGOP 2M0GB 1XTZA 1FK9B 3MM7A 2Z4PA 2DH7A 1RLDA 3MM6A 2UUBF 4K50A 1WHWA 1IVZA 2HYIB 3MAHA 4F0HA 4KGMA 2G2ZA 2KXNB 2DGUA 4UW2A 1S4EA 2EFOA 4LMZA 1TVRB 2JX2A 3M6UA 1RHJB 3UW1A 4CLSA 4JI6F 3JSBA 4J9SA 4N7TA 2GMJA 2FB0A 1UVJA 2GAGC 1WF0A 4DQQA 4NLQA 2YQ1A 1ZM9A 4USJC 4F7VA 2CJBA 4HHUA 4LFBF 1Z2ZA 4HTJA 1P1LA 3AOBA 1RT2B 3C66A 3PJWA 7FD1A 2RRBA 2BJ9A 1RHRB 2IJNA 1UVLA 3W1YC 4GC6A 3ADAC 1SXLA 4NXNF 3LP0A 3ENAA 3M8RA 4KV8B 3A3PB 1RGVA 4TQSA 2JLEA 1T9YA 2RF2B 3DLKB 1L3SA 4R0JA 4WYLA 4IG3B 5GAEU 4FF4A 4B9UA 1YQHA 1NHVA 2QA2A 1KRPA 1KHWA 3KWMA 3G2XA 1SKUB 2BOPA 1I3OB 1UFWA 3NGTA 3FSYA 3T5HA 1FA0A 1DARA 5DZ7A 5J2NB 1JWWA 5FLXY 3JAMU 4IUFA 1TU0B 3MUTP 4GRSA 1HD1A 2EKNA 2W25A 4NLVA 1AUDA 3DM2A 4NYOA 2ATLA 3MPDA 2LFVA 2NQPA 4OV1A 1SKWA 1DTQB 3AJ1A 4RW8B 3WX8A 4L72B 1HYSB 2BA9A 5FIIA 1YSJA 1FXRA 2GIRA 1WELA 2DR8A 4UY85 4Q0BA 4C98A 3CCRS 4LUBA 3SI8A 2GX8A 1NPPA 2HVZA 5DG8A 1IWAA 3M32B 4IFVA 3OT9A 2O66A 3Q8VA 1DBDA 1U0SA 3HFKA 2VJUA 3EXCX 1JX4A 2W9BA 4N47A 2VD3A 4OYWA 5J2PA 2DGVA 2DYAA 4O0IA 5KT3A 2XQCA 3AODA 4MJKA 4G6VB 5IC6B 4QIEA 4M5IA 1S9GA 3BN4A 4I67A 1P9YA 1Q79A 1HI8A 1WHVA 2ZJPQ 4Y2KA 5KFJA 1KLMA 3HHDA 4A46A 2FLPA 2CDRB 5IT9Y 1VQPS 1EP4A 2DXEA 1KOOA 3VGSA 2R2SA 3HP6A 4ZA1A 1T03B 4AT1B 5EUHA 3MCSA 4R25A 2B5JB 3G71S 4LF7J 2IC3A 1WEXA 1QAJA 1KONA 2DCUB 4Z7YA 1G7CB 2DRAA 2PFFB 2KT3A 2KZMA 3C15A 5KFRA 5A8KA 4X65F 2VKRA 2YX7A 2V34A 4HH1A 1NHUA 3OR2B 3ELHA 1LWCB 4KPCA 2RQ4A 1U25A 1RKIA 2F9JA 3BZQA 1XR6A 5L1IA 3JTPA 2VC1A 3N28A 3ITHB 4WXOA 2FC9A 1RHMB 2UXDF 9RUBA 2RKIA 4PYAA 5J2QA 1UEKA 1NK8A 1NO8A 3L4BC 1A6LA 1SPBP 2MKCA 1Y5NB 2NREA 3PDNA 2CPEA 3DNCA 3TA0A 4Y2CA 4C3LA 1IBMF 4V1Ak 3D1QA 1FDNA 4DV5J 2FGCA 1U49A 2EWHA 2N3OA 4WBFA 3CCVS 3H8YA 4LF5J 4DLGA 4IQXA 1T9TA 1WG1A 4F25A 3HO1A 4LR7A 5AJ3F 2B6AB 2HNYB 3DLGB 2HHHF 1JLCA 3OTEA 3LGHA 2XS5A 4ELUA 2MQMA 4U8YA 3T3FA 2HRYA 3OHBA 1X9MA 2DR7A 2VL1A 4OYBA 3A4TA 5RUBA 3K58A 3QSYB 1TFWA 1UWBA 2CQ3A 1YX2A 1TV6B 4ZMMA 3LF0A 3EVWA 2G1DA 3OPKA 1HNXF 3U1LA 3WC2A 4R8UB 1SL0A 3NGKA 3QZ8A 5KG3A 4IH6A 3TAMA 8ATCB 2JEFA 2WK4A 2RF2A 1CJUB 5DJBA 2UU9J 2XEXA 4WJBA 2H4YB 3N6LA 1IBKJ 3CD7A 2G1HA 4AQYF 1HNIA 1AUSL 4IO9Q 5FD1A 3K5NA 1C1CB 4RL1A 2AMCB 3LGNA 4I7FB 1BY9A 2XI2A 4CO1A 3FCWA 1F3FA 2CUYA 3OTOJ 3KJVA 1KR4A 2HMIA 2RHQB 1TUVA 4DQRA 3HKZD 1TKXA 2RAQA 3CF5Q 1NZ8A 2OKQA 3JQMA 4ZCKA 2M8HA 4NZ7A 4RW8A 4FNHA 4KGVB 1IR1A 1OMSA 5AXLA 4FNIA 2G4BA 3NGRA 2O01C 4DQIA 2LXFA 4DPOA 2V69A 3KHHA 1V5VA 2EFVA 1OQ6A 3LW5C 2GVDB 3MD3A 5F9LA 2YPYA 2FJEB 1X60A 3CCJS 2YWEA 3BO3A 2HK2A 4MKYA 4FVCA 4KYZA 3MEEB 3D4JA 2MQQA 4ANEA 4LSLA 4ED6A 2HS3A 4TYBA 6FDRA 1JK9B 3MM9A 4I56A 3MAQA 5HMZA 1C4CA 3M6XA 2AIRB 2AV5A 3LQVA 2DKOB 4LBIA 3BQ0A 3N5FA 3CCWA 2QO3A 1MMNA 1NSPA 2GHVC 2UUCJ 3QZ7A 2J0QD 1RCOB 2CNKB 2HHUA 4DV4J 4EBCA 2V4RA 3C6UB 1VLYA 4NI2B 4YOEA 4C8NA 4JOUA 3ZZPA 4LT6A 3OUYB 3RAQA 3THPA 2YQ3A 3W60A 1GX5A 1RT4B 3OR2A 4DV3J 3HK2A 3A1YG 3IR7B 2WW8A 4MK8A 1FKOB 3ZNJ1 3HFVA 4KFBB 4DSEA 1RU1A 3R5CA 4ZP9A 3ITHA 4M95A 4USHA 1UPMB 2VDHA 4LIWA 2IDEA 4UOGA 2PA8D 2DNPA 3ZTSA 2BJ3A 2BMBA 3DRYA 3IWLA 4TY8B 1CVJA 2XY7A 5F0UA 4X4SA 2R2RA 2HBQB 3J80Y 3W2WB 2PMWA 2CQBA 2R9LA 3J7Z5 4IO1A 5D78A 2VPWB 1NPRA 3GJSB 1UA1A 4HYKA 4DEZA 4GO5X 1IN0A 2G2OA 5D4OA 3JSRA 2RQKA 1LW2B 4C48A 5L9NA 5KG4A 4I2PB 1MG7A 2ZWPA 4IG0A 1PBAA 3R5AA 4IYQA 3MPWA 4N8NA 4I64A 2BOAA 3UCGA 1HBOB 3UDLA 2XHCA 5CYMB 1LEOA 3KJNB 1TV6A 4IFYA 3I5BA 4IR1A 1UP1A 2LYVA 1NKEA 1JLBA 2C2RA 2VBXA 1BD6A 3HCXA 1JJ2R 1S72S 2IM2A 5CXTA 4NOHA 2MHEA 4LRBA 1CJUA 2DJWA 3M05A 2XNQA 3FSIA 1NU4A 4RLEA 2BKNA 2BXJA 2DIVA 2IVMA 1RTDA 3HZGA 1H38A 5ETVA 4HLBA 3HXMA 3NS7B 4ZVPB 3BPSP 3OXGA 1DQAA 2YX1A 2DRBA 3QFWA 1FKPA 4USTA 2DGOA 1PJ5A 1N36J 5GAGU 2CPYA 3M1VB 1E6VA 2XMMA 5HMYA 4B3TF 2IBKA 5KFYA 3ENQA 4AL7A 5F8NA 4ILLA 2XHWA 4YP3A 1RK8A 1VBXA 1HBNB 2DNYA 4GKKF 1N54B 3GZ7A 3D5MA 4JI4F 4R0EA 2B7BB 1F60B 4I2QB 4CM2A 3G6VA 2D3O1 2VG6B 3O8WA 3LP1B 1FRHA 3BYRA 3EGWB 5HROA 1NK0A 3DRPA 1JLGA 4DUZF 3CCQS 4Y2AA 2KJVA 3W64A 2XULA 1JLQB 2ZH9A 1KQFB 2QYGA 4NLTA 2P9GA 2COLA 2MKSA 3T9NA 3GFHA 2A10A 4M5JA 1Q53A 1ZZFA 3IGVA 4M5LA 3FBCA 2DEIA 5ITHA 4OZ5A 2V8DA 4DPYA 1QTMA 3DXSX 4KKOB 3CMQA 1CQNA 5KFPA 3GCXP 4UZBA 1R6VA 1G3OA 2CVIA 2EI5A 4ZN3A 2MQ8A 3NY0A 2L41A 4K8RA 5CYQB 2W1BA 5J1NA 1AA1B 2YNFA 1S7IA 4ED1A 5A0YB 4OYIA 4RZRA 4ZJOA 4KBIA 4HKQA 4NI2A 3DI6B 5KFOA 4DR6F 2XS7A 1X4GA 2XWYA 4DR4J 1Z4UA 2RRNA 1PJ7A 4N41A 4PUOA 3S01A 3K0JA 1FERA 4PQUB 4F3OA 3LH2S 2Z8QA 4CO3A 4I6AA 2HNDB 3HULA 4V19X 3T1HJ 1RAJA 3M8QB 4B3SJ 4HH0A 1HHQA 1C0TB 1E6YB 1RKJA 2GW8A 1PO6A 4K4ZA 2G13A 3CDUA 3D9BA 2ASDA 4UY8T 4DFPA 4MYUA 4B3OB 2CQCA 9ATCB 4CI0B 4CQ1A 1NDKA 2XMAA 3S8SA 5CAAA 4HDGA 2AJ4A 1HQUA 4TY8A 5H9FK 4FZVA 2N7CA 4FKXA 3ULHA 3KLEB 2R8HA 4DG1B 2FC8A 2W2MP 2EFPA 1WDDA 4RR5A 2ZJRQ 3TI0A 3M6WA 4TNOA 2HURA 4AFFA 2FVPA 3EDQB 3BQ2A 4J9MA 3HD2A 4PPDA 2DO4A 1SL1A 1JJ4A 2JH3A 2ZE2A 1XNRF 5IQ6A 2UUBJ 5KFLA 2OPQB 1Q95G 1RQ0A 1FX2A 1J2VA 5H9FJ 1FJ7A 2R7VA 1QE1B 1M5HA 3PEHA 2WB4A 2ZEJA 4Y0FA 1YJRA 3O1LA 2RU9A 2DNZA 4PAAA 4IRDA 2IRXA 5KFNA 4JI6J 3QSIA 2RQMA 2E1AA 1VQ5S 3FCVA 4YR2A 5JJBA 5IT4A 4H4OA 3JQJA 1T9XA 1FWPA 3H5UA 2M3DA 3JYTB 4K4SA 5KT2A 1GXLA 3T1AA 4M5MA 5HANA 4LFBJ 3DLJA 4B08A 1PCAA 2XCPA 2FHMA 3MM8A 2IVFB 4CIOA 3HPOA 3R7SB 3CNQP 4PCQA 2CQDA 3FQKA 3EX7B 1L3KA 3G82A 4NXNJ 5DG9A 3MURP 3M1VA 1NKCA 1RWMB 3CIZA 3CJSA 1NPKA 3PW7A 2IA0A 3OSPA 3J7A1 2IIHA 2ZKUA 5B0CA 4TU8A 2QE5A 1KVJA 3B6BA 4PKDB 4I2QA 2VDIA 2Y8YA 2VG6A 3CDWA 1JQGA 1NH8A 2AF6A 4CO2A 1FI4A 4DX6A 5E7OB 1N5VA 1DTTA 3RAMA 1JLQA 1UEUA 5D4NA 1NDCA 4JI0F 1F2HA 1FE0A 4TN2A 2AJ2A 2M4MA 3MEDA 2DK2A 2B8PA 1N0VC 4QR2A 1R8AA 3C6TA 1RSCA 3EPIA 5HVFA 5GADU 3KYLA 1T9UA 2FTRA 2MZRA 4LRAA 3UVJB 3CT9A 1WWHA 1F5AA 1EKRA 2J9EA 3BQ1A 1B0VA 2KYXA 1KN6A 1U48A 3HT0A 4JI1F 2MGZA 5A0YA 3DOMB 1TAUA 1N33F 2V68A 5KOWA 1KC8T 4DSKA 2R7OA 4WXWA 1Y7PA 2V94A 3A13A 4YDDB 2R7RA 4CZCA 2WOMB 1V3ZA 2ROGA 3CE8A 5BYRA 4ERDA 2ROEA 1GXTA 4FYWB 5GAEI 2E66A 2B9EA 4ZPVR 3M8QA 2V2ZA 1HLWA 1KSPA 5DRKA 3EVOA 1UKUA 3HSJA 3GMGA 1S59A 1XQIA 4X65J 2HQCA 2YKMB 4DR5F 1AYEA 4I6WA 5A2QU 1UJ5A 5DQHA 5K9FA 2AKWB 3EM1A 3MOZA 3OVAA 2V8HA 2DTJA 3VAGA 2K3IA 1D8YA 5CZXA 1MMLA 4EEYA 3KLEA 1S1WB 3QATA 4B02A 4KC5A 2K3KA 3I0SA 1FRLA 2FVSA 3TZWA 4EU0A 2R2UA 2UXDJ 3UDVA 3DGVA 4XPCA 1S77D 4PG5A 4I0WA 3KJFB 4USIA 2ZH1A 4C8ZA 1TUGB 5L9XA 2A1BA 2Z58B 4O4RA 3NBPA 2FZGB 4YUDA 4ZLJA 2QJ3A 4CCHA 4EBDA 4U95A 4NE9C 2ZH6A 4NYPA 2H4WB 3R2CJ 4NX9A 1RTZA 5CZVA 4NLOA 3MHYA 3NCPA 4HR2A 1H7WA 1BGXT 1IKXA 2B9XA 4B9MA 1QJHA 4QQBA 3FVYA 3PW0A 2HHHJ 4DV1F 4WU2A 2KB2A 3JAMY 4KAIA 4E0DA 1R0AB 2KO1A 3PW2A 2CQ1A 2QT7A 2WONB 3CWJA 1M5OC 4F0KA 2R7SA 2VFVA 3FBBA 3KHLA 1RT7B 1OJ4A 1KLNA 4DUYF 2C3MA 3BH7B 3D66A 1KHVA 3R9LA 4JI7F 3RYLA 4RW9A 3PO5A 2AQ4A 3Q8YA 3MAAB 2XTJP 1HNXJ 2DHAA 3R1HA 5E5NA 2VF3A 2L9DA 3QFHA 2LLZA 2NCKL 1S49A 2C28A 4NCGB 2BBEA 4KHPJ 3HSZA 4BC9A 2ZJQQ 4QIFA 5HJYA 4AQYJ 1NM2A 2VBWA 1N5TA 1V3RA 4CTAB 4LRFA 2QLJB 5I3QA 2JC1A 4ZCLA 3OW2R 3R5JB 1SH3A 4G1PA 2YPZA 3DN9A 2LA6A 5A8WB 3POTB 2MKHA 5KFGA 3QNWB 3GFXA 1WKLA 2W9CB 1Q1KA 3SCLE 3EE3A 2R8JA 4USMA 4OYOA 1URRA 2A6OA 3RW6A 2WSFC 4CDIA 4RWXA 2CPDA 3CCSS 3HHEA 2AT1B 2YH0A 3H98A 1SJ1A 5T41A 1PC5A 1S76D 2EC0A 2XMVA 3DRRB 1VQMS 2NUHA 1FRJA 1NXIA 4ZPBA 4X64F 5F8MA 1YLXA 4DFJA 1GXUA 4NEZA 2Y9HA 3TP2A 4OZ0A 4DL3A 1X4EA 3QAEA 1IJFB 1P9QC 2K8GA 4BLGA 1TL5A 2ZKTA 2BR0A 1JXLA 4B17A 1J5EJ 4XK8C 1YGYA 2WOMA 2RS8A 1W25A 4MKAA 1HW9A 3SYZA 4DPWA 1FEHA 4RU2A 2HKEA 2VG7B 1U45A 4JB8B 4F04B 2EK6A 2XZDB 3PRDA 2C3PA 1JLEB 4ED8A 2ZOFA 5ETKA 2FQQB 4DX8H 2CNNB 1YHQS 2DRDA 4CLPA 2G9OA 4PABA 2E5JA 3CXCR 2CJQA 4DZDA 2DNNA 3I4PA 3QLHB 3H0PA 1REGX 1K44A 2Z2ZA 4N56A 2YWHA 2PC6A 3QPIA 3T6JA 4RUHA 4WIQA 5HMXA 3SV4A 2G2YA 5DGBA 1S6PB 2V63A 2ABYA 1IQZA 3OSNA 1HI1A 2R7WA 4Q5VA 2H5JB 3BSAA 3MDFA 1YWXA 2WBMA 5F3TA 4YY3F 1XN9A 1FHTA 1RB0A 4QPTA 3MM5B 1S5ZA 2W8KA 2DD8S 2F65A 1VQKS 3OR1A 4IOAQ 1CS4B 4ETZA 1UPPA 5F0WA 4PWDA 1HQEB 3HX9A 4DV6J 4UOCA 2HGMA 2GCFA 5KFFA 1LFPA 3QIPB 4Y28C 5DDQC 1IKYB 4PQAA 4NLXA 2C2DA 4C9DA 3BPDA 1OSDA 1T0TV 4RPFA 3GIJA 5LL6d 4NLGA 1VC0A 3V6HA 3ISND 2HWIA 1OO0B 3IMQJ 3RGIA 4ZITA 2YKNB 4HVZA 4N77A 2VOPA 2OMOA 2OHDA 4I6YA 2QL9B 2VOOA 3THTA 2CPIA 3CC7S 2CG8A 2OTJS 3VVUA 2MZSA 3U02A 4FKYA 1RTHB 3GLJA 8RUCA 2MDAA 5KFWA 4WE1B 4X4QA 2IMOA 2VA2A 2ZHBA 3NKYA 3ZO7A 3L09A 2HLUA 4CTAA 4CH7A 3A3OB 3AOAA 3BGFA 1HHSA 2VV5A 2J8SA 5LMNJ 4ILMA 3GP9A 5D0HA 1EJ7L 1YZ6A 3OJUA 2GIQA 3FMWA 3WQPA 3QJLA 1Q4RA 1S1XB 4B3TJ 1CJKA 5JUMA 3NP5A 2GFFA 2Q6BA 2LU1A 3PRVA 4NRTA 1N5YB 2IBOA 4GKKJ 5K14B 2A3JA 2BDPA 1UVMA 3ILLA 4C97A 2WZ1A 1HFEL 2DY9A 2W7AA 4WZMA 2JDJA 2DNGA 1N8RT 1RU2A 2FZCB 1NB7A 3QIDA 4Q2MA 3CDAA 3E01A 3OFEA 4WK1A 5LJ5Y 4RJVA 3DLBA 2ADBA 1RWUA 4X62F 4KR0B 1WF2A 3BBBA 5EDWA 4M94A 1VLOA 1BLUA 3QMQA 3C19A 4M5HA 5LXYA 2BQRA 2IJFA 4ENOA 1H2VZ 1RAAB 2BRLA 3H7HB 4ED4A 5BYQA 3CCZA 5K8NA 1VRUB 4OLOA 2UUWA 4ZVRB 2XNRA 1RTJA 2N4DA 1VK8A 3DXBA 2D41A 2GAHC 1HBMB 3R3TA 5A6WA 4CT9A 5H1SV 4C3MA 1GMVA 2ZZMA 4ZVOB 5BYSA 4KPYA 2AYMA 3M9NB 5LSRA 3OTDA 3IN5A 2RMLA 3VAMA 1CULB 1JXVA 5GAGI 3I5AA 4DL2A 3GB0A 2JL9A 2LQBA 4MIBA 4WFZA 2Y1JA 3IS9B 3DGPA 1W2IA 3O5TB 2J9CA 4M63A 2NZCA 1S9FA 3HHKA 4O4GA 1TZ0A 2BE7D 4H54A 3T9ZA 4X2BA 4ANCA 3MCNA 2W9AA 3TAPA 1KQGB 4UF4A 4AUKA 4CLZA 2YWWA 3MM5A 2QGFB 3M2VB 1EETB 2JEIA 1HNZJ 2CYYA 2OO4A 1FD8A 2QN6B 3BSNA 1HQEA 4G3IA 4AL5A 2FD2A 2VH7A 1YBAA 2R7UA 1QAYA 4CLKA 3KNAA 1TMMA 4YB5A 1XNRJ 4HI2A 2F7VA 1B3TA 2PMZD 1WG4A 2V2QA 2JVOA 3KK3A 4W98A 4WIIA 3NNCA 4TQRA 2ZOGA 2BYCA 2VPXB 1QUPA 2PIIA 4YB1P 2H51B 2V2VA 4EGLA 4OI2A 3D28A 1TMJA 3CO0P 4K59A 3BDEA 2YH1A 1GTHA 4C8YA 4ANDA 5HSPA 5F8LA 4RNMA 1WEZA 4DU8A 3JSMB 2BM1A 2KVQE 4LF7F 4Z7CA 3TZYA 4BHQA 4LF9F 1MWZA 2ZITA 1S7HA 4LR9A 1BC6A 4QIWD 1Q7YT 4LFAF 3AOCA 2CJYB 2R8IA 4BC7A 4DR7F 4DCOB 4RNOA 2KT5A 1VRTB 4DFKA 3W9JA 2HIQA 2E44A 4F67A 3MEGA 3D3BJ 3LPEA 1ZM2A 3UDEA 1XEZA 2RILA 3Q8PB 3HHLD 2BJ8A 3SSQA 2XBPA 1JLFB 4M5DA 3IM9A 1TL1A 2C2OB 1N5YA 3ISNC 2J5AA 1U4BA 2UVUA 3MGJA 1GMWD 2VFRA 2DGQA 2H5IB 4Y2IA 3NCQA 2Z30B 3MR3A 4X66F 1WKKA 5B7WA 5B0EA 3K5OA 4QZVB 3IBCB 2DY1A 3N5BA 5A6PA 5F8IA 1U1NA 3CB4A 5L46A 1Q8KA 3T5LA 1S9EA 2OD4A 8AT1B 2FY1A 5DDRC 4JI0J 3K7RA 4R5PB 4C4WA 1C2PA 3Q83A 1U47A 2DVIA 1SC3B 3F0NA 3L9ZA 2XLKA 3PX0A 3AQPA 4EYIB 2D69A 2XSJA 2E7WA 3H2UB 5D3GA 2YTCA 3DHWC 2AYGA 4JI1J 3PJXA 4N8OA 2MQPA 1U8WA 2DEJA 1FNOA 2UU9F 4Y2MA 4RKUC 1IBKF 1DJ0A 1N33J 2V6AA 3ZZTA 3FKBA 2HFNA 1SKRA 1CULA 1RISA 3RAXA 3M7VA 2CAJA 3JQKA 4EMDA 1BQMB 1W2BR 1M1GA 4ID8A 5SZTA 3C3LA 2UVWA 3OFHA 1YVFA 1Q5YA 1FX4A 5HBMB 2E1RA 2LQJA 2L3MA 4P71A 2OPSB 3LP2B 2A18A 5A76A 2VQFF 1ZM3A 3V81A 2X1FA 4NA1A 3JS9A 2HHXA 3CJTA 4ZDNA 2BANA 4WF9Q 3M2VA 2CKWA 2GHPA 3V5RA 3CJ4A 1Y00A 3QT5A 1C1BA 3CD0A 4QU7A 4UUXA 1XMOF 4G65A 2RJZA 1HBUA 1U6ZA 3AH6A 1PIEA 1CJVA 2X1AA 1N32J 3JXOA 2LXIA 5GADI 2HG4A 1TKZA 1DQ9A 4USVA 1LOUA 2MQLA 2HK3A 1P8GA 2HQDA 4B3MJ 3IAS9 2OGUA 3ETOA 5D8HB 3DFEA 1OY9A 4O3RA 1G2EA 1ZH5A 1RWPB 5IT0A 4D3GA 3LAKA 4UTGA 4C7QA 3IG1B 3PACA 2UUCF 3TAQA 2HFSA 4UZCA 4RW7B 3I32A 3JSMA 4DV4F 4OJ1A 1LW0B 2ZVIA 2OPPB 3UFCX 4O44A 4AYBD 3H2LA 3VV2B 3SSSA 1FF2A 5CYJA 5D4PA 5EN1A 1ZETA 3ZZOA 5CCLA 1NSKL 4KT0C 2C2MB 4DV3F 3IXQA 4DUYJ 2EVZA 4QIVA 4OMFG 3P5BP 5KT6A 1Q81T 3BBCA 1SBRA 1CC8A 5KFBA 1VJQA 5KFXA 2MPUA 1NJIT 1A9NB 3G6XA 1LFWA 3BREA 2NLWA 3L7OA 3MR2A 2B4VA 1JLFA 1RI7A 1R7IA 3N6NA 4QWEA 2HGLA 1DLOA 1RDRA 2YX4A 5A8RB 1NKBA 5KFTA 2V4JB 5ETQA 2MSTA 4FF3A 2BQ3A 2QIFA 3I9V9 3CDBA 5D6GA 1RAFB 3WHIA 1GTEA 4DV7F 3NOCA 5ADZA 4JI3J 3HMJG 4ALZA 1AFIA 2KZZA 4NXMF 2Q6CA 1ZBTA 3WZ0A 3FUYA 3KMQA 2V8PA 5HK4A 3MM6B 4PRFA 1CQMA 5F8GA 2BV3A 3PZPA 3TRGA 5M2PA 5IOLA 4RBUA 2GQQA 3J81j 2W01A 4U7UD 5ETRA 5FJ4A 2FHKA 3MPUB 5A2QY 3PJ9A 4NLDA 4IDKB 1YG0A 3I82A 1VBKA 2Z57B 3FRZA 1OYEA 4NLWA 2DT9A 2NXNA 3G6YA 1SQGA 5K8PA 3HHLC 3UN3A 2R8GA 2Z56B 3GYGA 3OL8A 1B7YB 3GG1A 3QAUA 5KFCA 2E1CA 4DDFA 4ZP7A 5L39A 2ZH4A 3L7UA 5DDPC 1FXLA 1X9WA 2ZNZA 5HP1B 2QV6A 4MYTA 2BE2A 3E2EA 4CLYA 4QWBA 2MY8A 2HHPA 4USKA 4F50A 4GMKA 2C2EA 3ISZA 2XLIA 5CA5A 3LP0B 3FEYB 4OV6A 1KDNA 1N36F 2VG5A 1ZAVA 2D3UA 1N88A 3VALA 1HWLA 2GJFA 2GHWA 4C8KA 2HW3A 2IM0A 3NWGA 1S1VB 4F8RA 2W4CA 4KJIA 4G1IA 3LP2A 3TWZA 1QAIA 2XWXA 4NLUA 1U0HA 2VPZB 4XO0A 3H90A 2GVZB 3P4UB 3F56A 2M5YA 1Q16B 2ZC4A 3DM2B 1S6QA 3GCWP 2KTQA 1FDDA 3BR9A 1Y3JA 1M5KC 3AD8C 5KFZA 4OI0A 4CLLA 2Y1RI 1I5OB 3BR8A 3DLEB 2ZH2A 1O51A 2HFZA 2JEGA 2M88A 4GKJJ 2PD1A 3PHEA 4Q0BB 3OTBA 2VIHA 4ZP8A 1K1SA 1FTRA 1HI0P 2BE9B 3RBXA 4PXEA 1SH0A 1FTCA 3QT7A 5DQIA 3G96A 4K4YA 4DZ6A 2ZZNA 2UUTA 3IG1A 4AL6A 5J2PB 1LW0A 2OPPA 5HVGA 2E9RX 3GYNA 3A12A 4AE5A 1SQEA 1S9GB 1HPZA 3V4MA 2KRBA 1HNWF 2YBVA 2EBGA 4TYAA 3KNGA 1KLMB 1FRMA 3AFGA 4J7CA 1EP4B 4C0OC 3NAIA 4P2MA 4AXIA 3J7AN 3KLIA 4JP8A 2J7KA 2EKYA 3BKTA 5KFEA 3PIOQ 5KG0A 3ZTOA 1ZZNA 4B3SF 2FVCA 2IC3B 5HI7A 1X4AA 1U1OA 3CSKA 3C15B 5A8KB 3BBFA 4QYZK 3HF5A 2OMLA 3KHGA 1C0UA 2UZAA 1NZAA 1N34F 3DLLQ 1MWYA 5A8RA 4LRCA 3QT8A 1FRXA 2XS2A 4U67Q 3M2RB 2ZVSA 1KNZA 3L3CA 4ECXA 4DR2J 3TVZA 1SJFA 3Q89A 4OI3A 2Y0SD 2JZ5A 2AX0A 2RKIB 1FJEB 2OH2A 4QYZJ 1FRIA 4P73A 2J0WA 2WVEA 1MW7A 3PW5A 1N6QB 3OTCA 2LEPA 1Q5VA 5KFIA 5HJXA 4M5NA 1RBAA 2VFTA 1NK7A 1R89A 5ETPA 2AHOB 3ZTRA 2PI4A 1QTNB 4ECYA 2V5HG 4H4MA 4EBEA 4IDKA 1JLCB 4NPOA 1U8SA 5DGAA 2ZDOA 2RUGA 3CCUS 3LOUA 5K8OA 2UXBJ 4X62J 3MPYA 3OQ2A 3MMAA 2MTLA 3EGVA 4LFCJ 1JLAA 4JI8J 2JLGA 1UWBB 5HP1A 1IJEB 3HI9A 5M2RA 3X3UA 3GILA 2EK1A 1FJCA 3BB5A 1S0VA 2VKZG 1SUQA 2I9SA 2VODA 1RT5A 3DMJB 5LMUJ 4LSNA 1ZM4A 3UWTA 2R42A 3TAMB 3I5CA 4IRKA 2QL5B 4OI1A 3OLBA 2BKPA 4YQWA 5HO4A 1S1VA 3GONA 1YJWS 1FFGB 1PILA 1HQ2A 3CJ5A 3KFWX 2C2KB 1HNIB 4GVBB 3TQEA 2E5IA 2DNKA 2GVZA 1GT8A 3CUNA 4M5KA 4FYDA 3M30A 2CPZA 2J9DE 1D0EA 3KJVB 2HMIB 5HQ8A 3AT1B 3CJ0A 4ECRA 3MMJA 3OVBA 3NGDA 1TKXB 1PC4A 1I6JA 1IXKA 4HEA9 2RDJA 2I2YA 1Q8BA 3PTWA 4NMLA 1FWKA 3KLFB 1UVKA 3DLEA 5F8HA 4XIUA 4GVLA 5G4DA 4F3QA 1WSVA 3GQCA 3TR5A 4P9SA 4HI1A 2XGQA 5E41A 4IH5A 3MPVA 3RB4A 1JNZB 2ZUGA 5JMNA 3SFGA 1ZTWA 1RT3A 4LSLB 4WP8A 1D09B 1TL4A 3B4MA 4NASA 2FLLA 1Q86T 3MM9B 2CQHA 2DNOA 1N48A 2PE8A 2CZ4A 1SL2A 3TJ9A 3GTYX 1IWGA 3RG6A 2MMYA 3GSIA 4DL7A 4NL5A 2F5GA 4P2XA 4LF4J 2FYXA 2FPHX 4QWDA 3I6PA 5B0FA 3CCES 3UD3P 1MSWD 1VK3A 3K59A 2A2CA 4EK2A 5KTQA 1RWWB 2KG0A 1FJGF 2HHVA 3D68A 4DMZA 1AXQA 4KHRA 2B0GA 2LVWA 4LF9J 3QRRA 1RAOA 3F41A 3O2IA 3H20A 3VCDA 1S0MA 1B7FA 1MN7A 3QGIA 3PY8A 3PEJA 4NMXA 4J9QA 4LFAJ 2YNHA 2J0XA 3A8EA 3KK1A 4U96A 4DR7J 3GV5B 3C16B 1AW0A 4OHZA 1SC4B 1RWNB 1S99A 3SQOP 2HZAA 3M2RA 3I0RA 2B9YA 4OX7A 2EXUA 2P2CB 3PVXA 4MK7A 2MZTA 4P7TA 3CULA 3V6DA 3FFIA 5EX0A 4DV0J 1OPIA 1RBOB 1TAQA 1N6QA 4QOTA 1R3NA 4NA2A 1KWMA 2R7XA 3MECB 2EPIA 2XYPB 3LUYA 2JRSA 3CJ8A 4ZJLA 4YFUA 2UVVA 2BM0A 3B4DA 4X66J 1X8DA 2CG4A 1VBYA 1YK9A 4ZHRA 5ETMA 3EZ5A 5DQGA 3V2UC 3CMAS 5HMWA 4MAKA 4ED2A 4DFMA 2Y8WA 3B8HA 2ASLA 1RA6A 4IG0B 2H5EA 1JKHA 1VJWA 3MFHA 3T5KA 3AHPA 5K8MA 3BS9A 3TYTA 3UQSA 2PA3A 1S1TB 2IRYA 2IYGA 4IFYB 3I4HX 5AXNA 4ZLLA 2HPUA 3HVWA 1T3NA 2ZFHA 2PT0A 1JLBB 4DR3F 3I31A 1G1XA 4DF8A 1X5PA 5D4LA 3DMJA 1X4BA 3DOKA 4ILRA 2GZOA 2E5HA 2V4QA 4F2RA 4NWBA 2ACYA 3BGRA 5C25A 4ZK7M 5AE2A 4MFBA 2CZ9A 4A8FA 5IZHA 4KHPF 4K7QA 1RTDB 5AXMA 1S6UA 2DHSA 2J6TA 4GVBA 2Y1IA 3G6ES 5CABA 2DGWA 4QBUA 3KUEA 1IKWB 1WI8A 3K5LA 4FS2A 1FKPB 4OZ1A 3W62A 4CNYA 3CCLS 1E6VB 3HJFA 3ZC4A 1VISA 1S10A 2LECA 3W9IA 3GIIA 2YWKA 1WC3A 3P96A 1OSCA 2BW2A 2K1RA 1XK8A 2YXLA 1TL7A 1YJVA 4WKYA 2VQFJ 3W5YA 1ZPWX 4LF8J 3KLFA 2NXEA 1WHYA 4B9SA 4DUTA 2OPRA 5IQQA 4CT8A 3MMCB 2AD9A 5HROB 3DRPB 1JLGB 3I56S 2O67A 3Q8UA 4CNZA 4DL0C 3WBZA 3J81U 4G1QB 4DR1F 3FNNA 1XMOJ 4OX8A 2CQ0A 2CJXB 4OX9F 5HQMA 1BHNA 4KO0A 3KTQA 1XBWA 1AFJA 5E3QA 2D3ZA 3NNAA 1DQ8A 3CCMS 2QLBB 4E98A 2HGNA 2FUG9 4NLSA 5KFDA 1J5EF 3KK2A 3UNGC 2WVDA 4YB6A 2MJUA 2RIJA 1RHKB 1RZMA 3JSYA 4DSJA 4K4WA 1H2UX 1U24A 2Q66A 1CJTA 2YNFB 2MZJA 3FEZA 1F9EB 3GJQB 5J1EB 1FDBA 4W92B 2UP1A 4C8MA 3DOLA 3KOAA 3G8QA 3BSOA 3HHLA 4QWAA 5ETSA 4TLQA 4PUOB 1EQMA 2G0IA 5EWEA 3CD6S 4PG8A 1V6HA 2VJVA 2NUUG 1UWAA 3C16A 4C11A 2KHDA 2XMJA 3NS6A 4ZN1A 1VQ8S 1GMWA 4FYVB 1WTFA 3SEOA 3AJ2A 2WCXA 4ED5A 3PIPQ 1IKVA 3EVMA 2ADCA 2FGOA 3H59A 2BJEA 1H0HB 2PI5A 2OJ3A 3MMBB 5F41A 3A8KA 5THWA 3MECA 4A8XA 1HQUB 3D1OA 4CLUA 3GIMA 1VQNS 4DV6F 4DV7J 2PMHA 2XY5A 1IBCB 3TEHB 4J5OA 3RR7A 2RRAA 2E1MC 1AROP 4NXMJ 3IFEA 2ACMA 2KU7A 4BBYA 2WAQD 5DLFA 1UAWA 2ZE2B 3IWNC 2E5LF 3SXLA 1T05A 1SKSA 4OX6A 2EG2A 1VMBA 2HIYA 3R6GB 1SB6A 2SXLA 2HWHA 5IFMA 2Q79A 1TQLA 4KY3A 2B4PA 3JB9k 1RA7A 3PYGA 1NDLA 5KFSA 1S1TA 4U7CA 5G0RA 5D15A 1FO1A 4UT4A 2KN4A 1UZDA 1GFWB 3OVSA 3E51A 1XR5A 4H4OB 3MTJA 1N52B 2UUAJ 3BH6B 5GMKa 1OY8A 1TELA 5DZ6A 4MMOA 5IM0A 4CH0S 3UCZP 2LQ9A 1QVGR 5DM7Q 3M2UA 4HT7A 1APSA 1GEHA 4J9OA 3GSDA 2B3TB 4C0BA 3MM8B 1RWOB 5KG6A 5LMNF 1KVKA 4L6V3 3I55S 4F02A 1IKWA 1HWUA 3G82B 3FDSA 5ETOA 4OZ3A 3ZZZA 2XSFA 1VQSA 1O5JA 2MXYA 3B78A 4ZLPA 4A8YA 2CQ4A 2W24A 1M90T 4B9VA 1IR2A 1ZOTA 3RRHA 4Q45A 1QDUB 2UV8G 4C2MA 2IM3A 2L9NA 1Z2LA 1BWVA 1J5OA 3NS5A 2H54B 2I0XA 3BM7A 1JJCB 4YB7A 3MMCA 3L95X 2NPFA 4ETXA 3EGZA 1NK9A 2MEWA 3KG4A 6FD1A 1ZPVA 1B64A 2P5VA 3BV8A 4G1QA 4NCAA 1DTTB 2HAFA 3PFEA 1I94J 1F9FA 1FEEA 1R8HA 2K7JA 3MEDB 2M7SA 5SUHA 4KGKA 2Z0GA 3OL9A 1S48A 2VHGA 2Y1LB 2QLFB 4ZVUB 3CGIA 1K73T 2Q3PA 3MFIA 3H4BA 2A2DA 3ILJA 1WORA 2N3LA 3T6BA 1RTIA 1T8EA 1CG2A 2D9OA 3C6TB 1WI6A 1XNQF 1XR7A 2QMUB 5KG1A 4ZPWR 2D74B 3D0GE 4LF6F 3M8PA 5B0BA 3P8BB 3LWLA 2VBZA 1XMQF 2AEJA 2W7OA 2MGZB 1PYOB 1SIZA 5J1EA 1YJ9S 2RVJA 3VTIA 2YNIA 1HNWJ 4IOCQ 5I3PA 3DCAA 1R8BA 3NXZA 2C3OA 1EAYC 3F73A 4Z2XA 5C7PA 4WFXA 2CJ9A 3GIRA 3OJSA 5KT5A 1R31A 4DU7A 2X51A 2HRTA 2HZCA 2V2KA 4MH8A 4DS4A 1EARA 4E2FB 1T9VA 1S12A 2MHNA 3IR6B 2GA7A 2AJQA 2B43A 2DGXA 2P9CA 2X7IA 3D6HB 1N34J 4KHMA 2MLXA 2FJXA 3MMBA 2J6SA 4URSA 4OHWA 1HA1A 1HNZF 2WBRA 3WX4A 3UR0A 2C22A 3LAMA 3HSDA 1G6BA 3I0SB 4MKBA 3Q2TC 5HL7Q 5B0AA 2DHGA 4Y34A 1NK5A 2CPHA 2BEFA 4I69A 1VHFA 3SSRA 3EICA 2YKAA 1HNVA 1LWFB 1TL3A 5CD4H 3TUJC 1TP7A 3NBPB 3I96A 3LO3A 1WG5A 4JV2A 1HHTP 5EX3A 1WC6A 1IKXB 4IR9A 2GMHA 4P6QA 2DR6A 5I4MA 2W2PP 4FYXB 2GGPB 3FRYA 2NYIA 4QR1A 2OLWA 4JV5F 4X4VA 4PXCA 4DX7A 3D2WA 3V4IA 2W2OP 3FBFA 3I87A 4A8QA 1U7LA 4RW9B 4IQMA 3SFUA 1IM4A 2OEJA 4RUCA 4FPIA 2H48B 4DQSA 2HS0A 3T41A 4XDCA 2FDNA 2KM8C 3SDEA 3Q24A 4CH1A 4H4KC 4RO0A 4XAKA 4KB7A 3CJRA 3K2YA 7AT1B 3M8SA 2FLOA 4ES3A 4O23A 2ASJA 1RCXB 1PGZA 2OD6A 4DV2F 2HLTA 2VC0A 3BEGB 4RW4B 1VCTA 3K89A 4BWJA 2B4OA 3RBZA 4ZPCA 3C2PA 4F0MA 1X9SA 2ZBQA 4JV1A 1VBZA 3W7BA 3M4XA 4UOFA 1RT1A 2E7XA 2V8VA 2XMKA 4PG4A 2I6WA 5EWGA 4ZVHA 4M5GA 2FLNA 3C8YA 5IXUA 4CO0A 1UFKA 2KKHA 2KI2A 2Y0BB 3DDIA 5HATA 1OWXA 3QO9A 3H2VE 1T02A 1OQ3A 5LOQA 3U27A 2HBRB 1H7XA 4X4NA 5CH7B 5T14A 2P8IA 3VGUA 3LA0A 2F63A 3NLCA 3WIUA 2ZH7A 1QSSA 5I42A 2XZWA 1V9OA 5LT5A 1HR0F 3FEXB 1NSAA 5IS2A 4CYUA 3KUGA 2CFXA 1S6OA 4LR8A 3CJ3A 5I3UA 1D8ZA 4OZNA 4J9LA 3PX4A 2GC8A 3PR5B 4OYAA 4P2FA 1WC1A 4QU6A 3CJKA 2F40A 3T19A 4MIAA 4QW9A 1AZSB 2AJ0A 2ZHOA 2KRRA 1FJGJ 3WC0A 1F0XA 1Y10A 1G4CA 1MU2A 1SCJB 1D1UA 2AU0A 3RRGA 2AWZA 3KLHA 1X0FA 1FKAF 1X4HA 2GO8A 4F2SA 2VFUA 2CA9A 4KRWA 4ICLA 1LWEA 3TVYA 4YR3A 3RB0A 3QYYA 4DHVA 3FZ2A 2XYGB 5B0GA 1M0SA 3EGNA 2HWTA 4B9TA 1S79A 3FZBA 3AXMA 1H2TZ 2UVRA 3G8SA 4OYZA 2RDDA 2QTWA 3KXDA 3UO0A 4C6AA 1Y5IB 1NSQA 1NHKL 1EHWA 2D9PA 1UVIA 5GAHU 2F8EX 1N32F 1H73A 4ZOSA 2MJNA 4YHHF 3OR1B 2AGOA 1LWFA 1GAOA 2BKOA 2N82B 3BO4A 2JHEA 5T7LB 4B3MF 5FDLB 4PWDB 3DYAA 4ES2A 4X4TA 2CQPA 3UI3A 3IRXB 4RUAA 2RH3A 3VAIA 3E8OA 1EIYB 2DNHA 1RBLA 4J9RA 3DLHA 4YN3B 2FY8A 2F8MA 3IBWA 1K0TA 2GGPA 4DI6A 4PZVA 4CO4A 2LQ5A 3ILOA 3VZHA 1X5SA 3HFZB 2WHOA 3QQCD 3RJMB 1B0PA 1BQNA 5F9NA 4QJVA 1PYSB 1VQ4S 1YBTA 2RE1A 2IAJA 3RBEA 3IC1A 3SQGA 1XERA 1UTAA 3PKMA 4JV0A 2BVZA 2M52A 1RXOB 1CC7A 3D0HE 3K5MA 4DR3J 4FXWA 5AE3A 4ID5B 2DO0A 1SQFA 1FK9A 3EDRB 3R2DJ 3GR0A 4K5RA 4CLFA 1ZS6A 4A8KA 5LM7E 3UE2A 3P3DA 4NYZA 1NK6A 2F4FA 2HQIA 1NNDA 3J7ZT 1JMTA 2ZOMA 1RWXB 2IPOB 1NLKL 3EMTA 1CLFA 4JI3F 1X4CA 3X1LB 1TVRA 2AGPA 3OL6A 2U1AA 3AA9A 4RW4A 1CJKB 4OJHA 2OEKA 5GMDA 4ECSA 4A4JA 1ZAWA 3PHTA 4EZ6A 1SJRA 3KJQB 1S0OA 3K57A 4L75A 4KH0B 4QW8A 3W3SA 3W65A 1S0NA 1NAQA 1P1TA 2DCLA 1RT2A 4ZLNA 1ZAXA 4OYXA 2WW4A 1IR0A 3E01B 5KFQA 3CW2C 2AW0A 4DR1J 3P45B 4KV8A 1NMEB 2VB6A 3GIKA 3THVA 4OX9J 1U1LA 3DLKA 4C8OA 1D9AA 4LIRA 2LQ8A 4IG3A 1MN9A 2DGTA 4K0KF 5HQLA 3VGVA 2BJDA 1L3UA 4ECTA 3DKDA 1T95A 2FHJD 4DPXA 1HWIA 4MKVA 5J2NA 2HHQA 4W4MA 2POKA 1RTJB 3N4WA 4ZPTR 2QRRA 4D3HA 2E5GA 3GU0A 1KQKA 2BABA 2QA4S 1RAHB 1AZSA 2LMIA 4KH1B 4JYAJ 4DSIA 2VZ9A 2WSCC 3O6QA 4RUBA 4O3NA 4A8MP 1U02A 2CQIA 5LJ3Y 1SJQA 1DTQA 2M70A 2ALYB 1HYSA 3RB3A 2HQFA 4DX5A 5LSLA 3IR5B 4WFBQ 2CQ2A 4OYPA 4HTIA 3NGSA 1H98A 5F8JA 3H5YA 3M32A 4LREA 4DCPB 4WTYA 3HLUA 1Y5LB 3DGPB 1TKTB 3R1LA 3W2VB 1WNEA 4O4GB 2LDIA 1WSRA 2HFVA 4I68A 1PJ6A 2FHOB 2YY3A 4PXDA 3RU0A 2XZTB 2HAIA 2KXHA 4MK9A 3DU5A 2HFOA 2KM8B 3TA1A 4GKJF 3S7RA 4TVAB 2R7TA 1X7VA 3LPYA 3OXFA 5T7LA 2QSFA 5FDLA 3VGTA 3PXGa 2QMWA 1M5VC 3IRXA 2B7CB 2BUNA 1T03A 4O0NA 3SCIE 5BR8J 4K4TA 2B5JA 4DF4A 3WIVA 4FF2A 2GJ2A 4HHHA 1MMDA 1F5CA 2E5LJ 6AT1B 1VQYA 3OL7A 3TZXA 3KK3B 4RU9A 4LVOP 1FT8A 2X1GA 4OZJA 3Q8SB 1LWCA 2HNZB 4WTOB 3CC2S 4GO7X 4ZCIA 4DPUA 3TJ8A 1UCNA
chains in the Genus database with same CATH topology
1FE4A 3LOUA 5K8OA 2DK2A 1EETA 1N0VC 3QGPA 3MPYA 3OQ2A 3HDSA 3MMAA 2AYBA 2LDYA 3RR8A 1REVB 2CZVC 2D3OR 2XY6A 2J76E 4QR2A 4DSFA 4UQGA 3T1YF 4ID5A 5CHCB 1R8AA 4Q43A 3C6TA 1JLAA 4GC7A 2JLGA 3EPIA 4OHXA 3J81Y 1UWBB 5GADU 3KYLA 2ZH5A 5HP1A 1IJEB 3ONQA 4IRCA 2JWNA 2YWGA 3HVTB 1DAXA 3HI9A 2FTRA 5M2RA 3X3UA 2MZRA 2AX1A 1XMBA 3GILA 2EK1A 3CT9A 1WWHA 1F5AA 2D7SA 1YJNS 1FJCA 3BB5A 1S0VA 2J9EA 3BQ1A 1B0VA 2KYXA 3AB2B 2VKZG 2AJ1A 1SUQA 1KN6A 4WCEQ 2I9SA 3TVKA 1U48A 2VODA 1RT5A 3I9ZA 4JI1F 3DMJB 4LSNA 3N6MA 1ZM4A 3UWTA 2MGZA 5A0YA 3MTKA 3TAMB 3I5CA 2GNKA 4IRKA 1WACA 1TAUA 4OI1A 4I1TA 5C24B 3OLBA 4URGA 1N33F 1FDAA 3MEGB 5KOWA 4YQWA 1KC8T 4DR2F 1Y3KA 4DSKA 2R7OA 2B6AA 2HNYA 3DLGA 4WXWA 1Y7PA 3OFFA 2GO9A 4J37A 2V94A 5HO4A 2RU3A 1S1VA 1YJWS 4FS1A 3US5A 4YDDB 3ZZYA 1PILA 4CZCA 2R7RA 1ZYQA 1YJUA 5DDOC 3CJ5A 4WFYA 1S97A 2WOMB 3KFWX 4O3PA 1V3ZA 1Y4ZB 2DGSA 2ROGA 1HNIB 3CE8A 3GR1A 5BYRA 4ERDA 2ROEA 3CCTA 4M5DB 1U6BA 5BR8F 2LCWA 1TL1B 5DLGA 1GXTA 2HVHA 4DBQA 2E5IA 5GAEI 2E66A 2DNKA 1GT8A 4ZPVR 3CUNA 4FYDA 1X0PA 3RB6A 2X3GA 4OIXA 3M30A 3M8QA 3R5BA 2NXUA 1HNVB 2QA1A 4ZVGA 2J7UA 4HT5A 1TL3B 2CPZA 3TA2A 1KSPA 2J9DE 1SJ4P 1D0EA 3KJVB 3GFYA 5E3CA 2HMIB 5DRKA 5HQ8A 2HQ3A 2JOQA 1UKUA 2E9ZA 1WF1A 3CJ0A 4ECRA 1Q7LB 5E0OA 1KTQA 3MMJA 3GMGA 3OVBA 3NGDA 3BJYA 1TKXB 1PC4A 2YKMB 4K5SA 4DR5F 1I6JA 4I6WA 1UJ5A 1IXKA 5DQHA 3NMAA 2DNMA 2ZD1A 4HEA9 4R8UA 2RDJA 5K9FA 1F5BA 2J7WA 2I2YA 1Q8BA 1F2GA 3MOZA 3EZUA 3OVAA 3VR1A 1VRTA 1S9EB 2V8HA 4NMLA 2DTJA 1QSYA 3KLFB 2RQCA 3VAGA 2K3IA 1DRZA 3E3XA 1UVKA 3QGGA 3DLEA 5F8HA 4XIUA 4LQ9A 4Y3CA 2V9KA 4JUZA 3JTOA 2MSSA 2UXBF 2DBBA 4X4PA 1D8YA 5CZXA 4Y6IA 1MMLA 5G4DA 2R4FA 4F3QA 4EEYA 2CVEA 3GQCA 3KLEA 3TR5A 4WU3A 1MSWD 1S1WB 4HI1A 1KS2A 2XGQA 4B02A 4KC5A 4U6PA 2K3KA 3I0SA 1FRLA 4ECVA 2LEBA 2I38A 2FVSA 4OJ3A 5E41A 4LFCF 3CTRA 4JI8F 2L9WA 4J9NA 4EU0A 2R2UA 3OLAA 4ZPDA 1YRXA 4IH5A 1S1UA 3TO8A 4XPCA 1S77D 4DJBA 3EYZA 4PG5A 4K4XA 1C1CA 3MF5A 3MPVA 3RB4A 1JNZB 5M2UA 3V4IB 2JJ4D 4I0WA 4J9PA 4USIA 4JI2F 1U2RA 4I7FA 4Q8EA 3NAHA 2ZH1A 2ZUGA 2RS2A 1H6KX 4C8ZA 4OL8A 3SFGA 5L9XA 2UV8A 4F4YA 1IBLF 2XSJB 2A1BA 1RT3A 4LSLB 1ZTWA 5LMUF 4O4RA 3NBPA 4YUDA 1TL4A 1NJXA 3B4MA 4CCHA 2XMWA 2FLLA 4EBDA 5D3GB 3GYXB 2ZH6A 1Q86T 3MM9B 3H4DA 1FNMA 4M1KA 4NYPA 2F8HA 2CQHA 2DNOA 1N48A 3F44A 3OFGA 5F3ZA 2PE8A 1Q82T 4NX9A 2CZ4A 5CZVA 1SL2A 4NLOA 3MHYA 3NCPA 3SDEB 1H7WA 5KFMA 3N79A 3MM7B 1BGXT 1JJHA 1IKXA 2YKPA 2ROPA 2B9XA 1VI7A 2C42A 4B9MA 1QJHA 4QQBA 3FVYA 1BWEA 2MMYA 4DL7A 3PW0A 4DV1F 4F4KA 4NL5A 3NCRA 4WU2A 1UFLA 4R5PA 3AAWB 2KB2A 2FPHX 3JAMY 2VQEF 1YIJS 3GG0A 4KAIA 4E0DA 1H3DA 3RTVA 4QWDA 3I6PA 5B0FA 1R0AB 2AP6A 1Y0HA 1VK3A 1U09A 2HS4A 2KO1A 4Y00A 3K59A 3CCES 1HL6A 2A2CA 3PW2A 4KE5A 5KTQA 2P6TA 2DPJA 2KG0A 3PO4A 2MZQA 1FJGF 2R7QA 2CQ1A 2QT7A 2HHVA 3EPGA 1TKTA 1MROA 2WONB 4DMZA 1AXQA 4KHRA 3U7JA 2B0GA 4Q7AA 3CWJA 2LVWA 1M5OC 2VUGA 4KQZA 3W2VA 2J6UA 2R7SA 1JNRB 1D9DA 3F41A 4BWMA 3O2IA 3H20A 2VFVA 4WFNQ 3VCDA 1S0MA 1B7FA 3QGIA 3KHLA 3PY8A 1RT7B 2BZ2A 3PEJA 4F3MA 3HT3A 4J9QA 1KLNA 3MEEA 4DUYF 2C3MA 2VASA 1KHVA 2YNHA 4JI7F 3RYLA 2DIUA 3V81B 4RW9A 4Y65A 4A48A 4P2SA 3PO5A 2J0XA 2KFNA 2AQ4A 2FJDB 1U1RA 3A8EA 3KK1A 2DHAA 1GNKA 3UR3C 3R1HA 2AYEA 3GV5B 5KFHA 1SI9A 2BANB 1HWJA 1Z1ZA 2HRUA 5E5NA 1RT1B 1AW0A 1X4FA 4OHZA 4NLYA 2L9DA 1S99A 3M2RA 3I0RA 2B9YA 4H4KA 4OX7A 5JVGQ 3BGLA 2LLZA 4FVMA 1S49A 2C28A 1C1BB 3PVXA 4NCGB 4MK7A 4RW6B 1NK4A 2MZTA 2OFHX 1T7PA 1HARA 4P7TA 2BBEA 3CULA 3V6DA 2DH9A 3J7YU 2IM1A 4BCAA 3FFIA 4BC9A 2ZJQQ 3TUIC 5AE1A 1NJZA 2NR0A 1RJJA 3QO9B 3AY0A 1BQMA 4QIFA 3GV8B 5EX0A 3D54A 1VQLS 1OPIA 1N5TA 1V3RA 2VBWA 1JB0C 1TAQA 1HBUB 4CTAB 4EFAC 1RYRA 3D0IE 2HHTA 5I3QA 2JC1A 4ZCLA 3OW2R 3VAHA 1N6QA 4QOTA 1R3NA 5LSOA 4NA2A 3MXHP 2XGPA 2V8GA 4B9LA 1SH3A 2R7XA 4G1PA 5U47A 3C6UA 5MLCV 3MECB 2IFXA 2PGCA 3DN9A 4C8LA 2LA6A 2EPIA 1UJ6A 2LKZA 4OHVA 5A8WB 3POTB 5HBMA 1TKZB 2XI3A 2F4VF 2MKHA 3LUYA 2XCAA 2ERRA 5KFGA 2JRSA 4YFUA 1L3TA 3OUYA 2UVVA 2BM0A 2OPSA 3B4DA 5I42B 3GFXA 3AB4B 3QWUA 3KLGB 1X8DA 5L8RC 1RT4A 2CG4A 2WRMA 2W9CB 1Q1KA 3SCLE 1VBYA 4NLPA 4ZHRA 2R8JA 2ZHAA 2HNZA 1VC6A 3EZ5A 1FKOA 1URRA 5I3UB 5DQGA 3V2UC 3CMAS 5HMWA 3RW7A 3RW6A 4LF4F 2WSFC 4MAKA 1CEZA 1D3WA 4FP9A 4OHYA 5KG2A 1KQSR 1NRKA 2DPIA 3CJKB 4ED2A 1LKZA 4DFMA 4KFBA 4OFZA 1VQOS 4RWXA 2CPDA 3B8HA 2ASLA 3CCSS 3HHEA 3N0VA 4HL9A 1RA6A 2QA4G 5D77A 4ED0A 4QYRA 2YKOA 4O44B 2MQNA 1REVA 5KFKA 4WFAQ 4IG0B 2H5EA 4X4RA 3M9MB 2RT3A 2JFKA 2IMWP 1JKHA 1VJWA 3MFHA 2YH0A 3H98A 3AHPA 5K8MA 2EG1A 2GJIA 3BS9A 3T5KA 1SJ1A 4OI6A 3TYTA 2F1FA 2YKQA 3NRBA 1PC5A 5T41A 1S76D 3K5PA 2EC0A 3SZ2A 2XMVA 3UQSA 2GQCA 1VIOA 3DRRB 1VQMS 2NUHA 1N56A 4BDPA 1MU2B 4F4XA 2PA3A 1FRJA 1S1TB 2NSCA 4X64F 4ZPBA 3HVTA 3KLHB 3MR5A 4DQPA 4KIAA 2ZBCA 2IRYA 3UCUP 2IYGA 4IFYB 5F8MA 4EZ9A 1Q8LA 1N5SA 3I4HX 1QVFR 2HHWA 1LXNA 1GXUA 5AXNA 4DFJA 3TP2A 2HPUA 3HVWA 4OZ0A 1K9MT 2FJBB 4DL3A 1T3NA 2KFYA 2ZFHA 1X4EA 3QAEA 2PT0A 3W2WA 1JLBB 4ICLB 1LWEB 1IJFB 3VZIA 1P9QC 4DR3F 3I31A 4PR6A 3BGUA 1G1XA 4DF8A 1X5PA 5D4LA 3DMJA 3CMES 4MIWA 1V3SA 1X4BA 3QJJA 2K8GA 3DOKA 2Q1LA 4ILRA 1TL5A 2ZKTA 5C24A 2E5HA 3FJ2A 2V4QA 4IFVB 2B9WA 2ILZA 2BR0A 4FPRA 4F2RA 2KT2A 4NWBA 2W4PA 2ACYA 3BGRA 4E8UA 5C25A 4WK3A 1JXLA 3CEDA 4ZK7M 4B17A 5AE2A 3JTNA 4MFBA 4XK8C 4A8FA 4O3QA 3B82A 5IZHA 4O3SA 1YGYA 4JI5F 4KHPF 2XMUA 2W9BB 2WOMA 1OS5A 2BQUA 4DSLA 2RS8A 1RTDB 5AXMA 1W25A 4MKAA 1HW9A 1S6UA 3R27A 2DHSA 4DV0F 4RW7A 2J6TA 1LW2A 3SYZA 1YITS 2Y1IA 1FEHA 3G6ES 2OIHA 4RU2A 1I1GA 2DGWA 2VG7B 4I2PA 4RX6A 4QBUA 1U45A 4C3KA 1IKWB 3VQSA 1DLOB 5K5MA 1WI8A 2EK6A 3K5LA 3PRDA 4FS2A 1FKPB 2C3PA 1JLEB 4ED8A 2ZOFA 4OZ1A 2DITA 4DX8H 1YHQS 4CNYA 3RBDA 2G9OA 1FCAA 1JIHA 3PM9A 1HBOA 3CCLS 4FXDA 4NA3A 1E6VB 2IYIA 2E5JA 4IOBA 1U26A 5CYMA 5E3AA 3HJFA 3CXCR 4DR4F 4A8SA 3ZC4A 2CJQA 3NL0A 1S10A 2DNNA 3I4PA 2LECA 3QLHB 1JXEA 3S1TA 2EFQA 3KG0A 3DYAB 3GIIA 2YWKA 4QCLA 5DG7A 3P96A 4KTQA 1OSCA 2BW2A 2JC0A 2K1RA 1XK8A 2J0SD 1YJVA 3CO9A 4TY9A 4WKYA 1QY7A 2OFGX 2QEXS 4LQ3A 3KG1A 1TKDA 3PW4A 1L3VA 1KFDA 4NZ6A 1ZPWX 4QIGA 4A47A 4N56A 3T1HF 3KLFA 2YWHA 2PC6A 3QPIA 1WHYA 3T6JA 4V19J 4RUHA 1PSDA 1IUJA 1NEEA 2MKKA 2H9ZA 3O3LA 4B9SA 3TQ1A 5HMXA 2OPRA 2MZ1A 5IQQA 2KVIA 3SV4A 4RWWA 4CT8A 5DGBA 2EBEA 3MMCB 2AD9A 1S6PB 2B56A 3IO1A 2GMLA 5HROB 3DRPB 1JLGB 2ALZA 1QAXA 1VFJA 3I56S 2N4CA 2O67A 2PN6A 2QLXA 3Q23A 1C4AA 3MI7X 2ABYA 5KFUA 4RNFA 1IQZA 3CPWR 4K4VA 1O0PA 4ZKAA 2F9DA 4CNZA 1HI1A 3D1HA 3OSNA 4DL0C 2R7WA 4Q5VA 4RBVA 3BSAA 3MDFA 3WBZA 4G1QB 1YWXA 3CDEA 2WBMA 5F3TA 2QYCA 3ICLA 4YY3F 1XN9A 1BQNB 1FHTA 4DR1F 1U1MA 3FNNA 1R43A 4QPTA 3MM5B 3MEKA 4OX8A 2W8KA 2EW9A 2CQ0A 2V4JA 1NJWA 2I1RA 4OX9F 2DD8S 2IAJB 1VQKS 4KO0A 3SQGB 3OR1A 3KTQA 2F3JA 4IOAQ 1XBWA 1AFJA 4ZVEA 5E3QA 3FGVA 2ZH8A 1TK5A 2D3ZA 2RSQA 2APOA 5C42B 3NNAA 3TW0A 4ETZA 1M5PC 2QLWA 2ZDPA 4ELVA 2Z2MA 2DR5A 3AQOA 5F0WA 4PWDA 4U7UK 1HQEB 3HX9A 1DQ8A 3CCMS 4UOCA 5J2QB 4E98A 3HHNB 2HGMA 1TK0A 2M0GB 2GCFA 5JXSA 1LFPA 5KFFA 1HBNA 1XTZA 2HGNA 1FK9B 2FUG9 3MM7A 3QIPB 4NLSA 4Y28C 2Z4PA 5KFDA 5DDQC 3KK2A 1J5EF 2EFGA 2BE2B 3UNGC 3VF0B 4YB6A 1IKYB 1FRKA 4PQAA 2DH7A 1K1QA 3H25A 3VAFA 2MJUA 3MM6A 1HD0A 2RIJA 2UUBF 4K50A 1WHWA 4NLXA 2C2DA 4C9DA 1OSDA 3K8WA 2HYIB 1HMVB 3LP1A 3MAHA 3JSYA 3HVAA 3V6JA 4DSJA 4K4WA 1ELOA 1H2UX 1U24A 2Q66A 2YNFB 4DL5A 3BDPA 4KGMA 2MZJA 2BACA 5L1JA 2PEHA 2KXNB 3FEZA 3GIJA 3KMSA 2VG5B 2DGUA 4UW2A 5J1EB 1FDBA 5LL6d 4NLGA 1VC0A 4W92B 2EFOA 3V6HA 2UP1A 4C8MA 3DOLA 3KOAA 3ISND 3DDKA 2HWIA 3G8QA 4LMZA 1OO0B 1TVRB 2WTFA 2JX2A 3M6UA 2YKNB 3BSOA 4HVZA 3UW1A 1TK8A 4JI6F 4N77A 3JSBA 4J9SA 3HHLA 2B4UA 2VOPA 4QWAA 1R8CA 2GMJA 2OMOA 4TLQA 4PUOB 4I6YA 4OQJA 4LF8F 2VOOA 2FB0A 5DETA 3THTA 2CPIA 3DRXA 1UVJA 1Q8IA 5EWEA 3CD6S 1WF0A 4KKOA 4ATNA 4PG8A 4DQQA 3CC7S 1V6HA 2CJKA 3NMRA 2OTJS 4NLQA 2NUUG 4C11A 2MZSA 2KHDA 1ZM9A 4ZP6A 4Z37A 4USJC 2XMJA 3U02A 3NS6A 2CJBA 1RTHB 1VQ8S 1WTFA 1RYSA 2MDAA 5KFWA 4WE1B 4LFBF 1Z2ZA 4HTJA 1P1LA 2RDIA 1RT2B 3C66A 3SEOA 4X4QA 1S6QB 3AJ2A 2WCXA 4RW6A 2IMOA 2XB2D 4ED5A 3PIPQ 1IKVA 1P6TA 3PJWA 2VA2A 5CYQA 7FD1A 2ZHBA 2ADCA 2RRBA 3NKYA 3L09A 2FGOA 3H59A 2IJNA 1UVLA 2BJEA 1YRUA 1H0HB 2HLUA 4GC6A 1YRTA 1SXLA 4JBCA 4B3RF 4CTAA 2PI5A 4NXNF 4CH7A 3LP0A 4MTPA 2VBYA 3BGFA 1HHSA 2OJ3A 2VV5A 2QZ8A 3M8RA 3MMBB 5F41A 4KV8B 3NNHA 1RGVA 4TQSA 2JLEA 4ILMA 1YI2S 5E3PA 5THWA 3MECA 2GIQA 3OJUA 4A8XA 1HQUB 2RF2B 3FMWA 3D1OA 3DLKB 1L3SA 2PSZA 4R0JA 4PG6A 4ECZA 3QJLA 3DI6A 3GIMA 3CC4S 1Q4RA 4WYLA 1VQNS 1VGYA 1S1XB 4DV6F 4IG3B 5JUMA 5GAEU 2PMHA 3NP5A 3KLGA 4B9UA 4FF4A 1YQHA 2GFFA 1NHVA 2XY5A 2QA2A 1KRPA 4DLEA 4J5OA 3RR7A 2Q6BA 2LU1A 4WYWA 1XWLA 1KHWA 3KWMA 2RRAA 2BOPA 2E1MC 4NRTA