2FHJD

Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
296
structure length
295
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
publication title The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Transferase
total genus 82
structure length 295
sequence length 296
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2005-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
D PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD01
2FHKA 1M5SA 1M5HA 2FHJD 1FTRA 2FHJA
chains in the Genus database with same CATH superfamily
4DCPB 2C22A 2HPUA 3CC2S 1WC1A 3THVA 1K0VA 3NGRA 2MHEA 2XY7A 3Q8YA 3E8OA 2OUGA 3TI0A 2BJ7A 2CPYA 2GAGC 2AJQA 4NA2A 1ZM2A 4ED8A 1U0HB 1ITPA 5F8GA 2QSWA 3P4UB 3W2VB 2COLA 4N56A 2OSRA 4MIWA 5CAAA 3Q8UA 4P52A 4IQXA 2C3MA 1TZ0A 2RDJA 1WNEA 4NLXA 2DY9A 3KJQB 3QO9B 4PCQA 3MTJA 2DGXA 2IC3A 3NLCA 3OTBA 1VOMA 5LMNF 2YKNB 4O0IA 1Z1ZA 3F44A 2JH3A 1QAJA 4C9DA 3HLUA 2PI5A 1RTIB 4J9SA 2Z0GA 2YH1A 3QRRA 2VQEF 1YBAA 4RUHA 5MAOA 1CULB 3NNCA 2ZC4A 2PN6A 3RR8A 4ED0A 1FDNA 2ZOMA 5GAHU 4G65A 4U7UK 2GQ2A 3QRQA 4BHQA 1HNXF 2EEYA 3ZZOA 3CJ2A 2W9BB 2BJ1A 2F9DA 4CLPA 1FDBA 5B0AA 3D2WA 1X5OA 4EU0A 2H3EB 2QA2A 3JXOA 3AXMA 2M8HA 3C15A 4IYQA 3T9ZA 4CIOA 1REVB 1C2PA 2HNZB 1S10A 1UVNA 4ALZA 3MUMP 3HSJA 1F5BA 1XJWB 2NLWA 2E1CA 3M7VA 2DH9A 1MWQA 2OPPA 4PXCA 4X4OA 5KFEA 4DR2J 2YWWA 2GO9A 4Q5VA 5LT5A 3PEJA 3PRVA 4URQU 1SL2A 3EWGA 2XS5A 1NDKA 5J1EB 4EMDA 3QSYB 1EP4A 2EFNA 4EBEA 3R8YA 1J2VA 1NK0A 5J1NA 3HHLC 1Q7YT 1N32F 1KQFB 2G4BA 1YJWS 3ILLA 1IKXA 3HZEA 1GNKA 4ZS6A 9ATCB 4QCLA 2A0FB 4YMEA 4FNIA 5EHHA 2D3O1 2NYHA 4N5SA 4GKJJ 4CLYA 2B6AB 2VD3A 3BGRA 3VWSA 1WG1A 1U0HA 1K9MT 1TL4A 1B7FA 1RLDA 3W2VA 1CPZA 1BQNB 2OEJA 3R5AA 3BDPA 1UCNA 3VVUA 3PW2A 1HQUB 2FJEB 4B08A 4CLFA 4CLZA 4W4MA 1TL7B 3GONA 3W65A 5CCMA 4CH7A 2O3DA 2CPHA 3QO9A 4ZPAA 3HJVA 2X1AA 2Z30B 3HM9A 1IBKF 2FB0A 3THTA 3TJ8A 3MR3A 1DJ0A 2YKNA 4IRCA 4DUYF 4NCAA 5A76A 4NLVA 2B3TB 1RTIA 2VBYA 2RQ4A 1F9EB 2YWFA 4JUZA 4CTAB 2KI2A 3OQ2A 3JYTB 3MD3A 1I6JA 1CULA 4LF9F 3PVXA 4NEZA 4RU2A 2ZBRA 3MM5B 4R25A 2EFPA 1Y0HA 1M1KT 1NPKA 1WF0A 4I2PB 5HP1A 1RU1A 4DSJA 2XZDB 3P5BP 1S79A 3PHTA 2W9BA 1IBMJ 2YKPA 4JI0F 2CNOB 1V3SA 3LH2S 1TAQA 4PXBA 3R7SB 2O5DA 3SQOP 5F41A 3HVTB 1HPZB 2MKYA 4Q45A 2MEWA 1YQHA 2F63A 1REVA 2HNZA 3OV7A 5HQMA 3BPSP 1ZTWA 3GZ7A 1F2GA 3EZUA 1UL3A 2LCWA 2XI2A 2OTJS 3PKYA 2HRYA 3PRBA 5DQGA 2Y1LB 4QW8A 2LXIA 2VODA 1S9EB 4NLOA 3SCIE 3RBZA 4J9LA 1H2UX 2HZCA 4CDIA 4ZMMA 3CD0A 3JB9k 1WHWA 5F9NA 4J91A 2NXCA 5JXSA 5IT0A 3JTPA 1N34F 2AW0A 3I55S 5J1EA 5IV4A 5C5JA 2R8KA 1RAGB 4QIGA 2W9CB 1MU2B 2KG0A 2BRLA 4LRAA 3TO8A 4HT7A 4J9PA 3J80Y 4FVCA 1F60B 4OJ1A 2HLTA 2GNKA 2CPJA 3ZZYA 3MWBA 4NLDA 1R31A 3KOAA 3GWCA 1S1XB 1A6LA 2ZH9A 3KLEA 3LANA 1KVKA 1UWBA 3PJ9A 3CNQP 2K06A 3R7NB 1HQUA 4RO0A 4IKAA 3RZAA 2BZ2A 4ZOSA 1TL7A 1IQZA 4WK3A 5KFTA 4TU7A 1CJVB 3N6MA 4A8FA 1NM2A 3QPIA 4P72A 1UW9A 2POKA 2QMUB 3KJVB 5HMXA 3ENQA 3DOKB 2DNLA 4UTGA 4LT6A 4Z2XA 3T1YJ 4CTAA 3JYTA 2HVHA 1UEUA 4A8OA 3FBFA 3QWUA 2Z2LA 4B9SA 1X4BA 3TZWA 5KG0A 5KFBA 2UUTA 2V2VA 4I2PA 1D8ZA 2A2DA 2R7SA 2XM3A 1APSA 2GAHC 3W66A 1CVJA 1ZZFA 2BM0A 1NKEA 3M1VB 4DXLA 5I3UA 3OTOJ 3BQ0A 5HLFB 4DQIA 3HVTA 1VHIA 2YWHA 3SEOA 3HPOA 2RRNA 3WIVA 4O3NA 3M8ZA 3GILA 3LAMA 5AT1B 2GVZA 2UXBJ 3FQLA 2HFOA 3MM7B 1N33F 1KNZA 4PG6A 4MYTA 4CO3A 3D0IE 1S9EA 2MQLA 5F9LA 1TKTA 3IFEA 2W1BA 3B82A 4OI4A 1TK8A 1H98A 4TN2A 4CNZA 5KFSA 4OLOA 3M2VB 1RWOB 1N52B 1LOUA 3NKYA 2AJ0A 4ES3A 1P9YA 4USWA 4WFZA 4LBHA 5D4LA 1MU2A 3FBEA 3JSMB 4TLQA 2CG4A 3DLEA 5LMUJ 1UFKA 2YNFB 1SQFA 2ROEA 1OQ3A 4RW9B 4JI7F 3J7Z5 3IRXB 2BQ3A 3R5DA 5DDQC 2AMCB 1OO0B 1LWXA 2MKHA 4J9VA 3BN4A 3C6TB 2V2QA 4EZ9A 1S1XA 2V69A 2RU3A 4X4PA 4YHHJ 5HVHA 2QL7B 2FHKA 3WHIA 3RB0A 5KT3A 1FI4A 1XR6A 5HMZA 2B4UA 2C28A 5A8WB 3GR0A 1S6UA 1CJVA 1WKLA 2HHHJ 1DHMA 5D4OA 4U67Q 2KZZA 5L1IA 3T19A 3RYLA 2UZAA 2ROGA 3M2RA 2PE8A 1Y5NB 3EUNA 4ECQA 2DPIA 3KJVA 1LWEA 1VK8A 5BYSA 3DOKA 2DNOA 3J7AN 4ZN1A 1NHKL 1W7WA 3FCWA 1IKWA 4R8UB 1WC5A 4NLYA 4CT8A 2HHWA 1FJ7A 2E29A 1VQMS 3H4BA 3SXLA 2XYHB 2OD4A 2R7XA 5F0WA 1OYDA 1RUSA 3M1VA 2BOAA 2YTCA 4NA1A 4ZP6A 5KFFA 4QYZJ 1U1KA 3NMRA 5HLFA 2ERRA 2PFDA 2KFYA 1YRXA 1YX2A 1FDDA 2OJ3A 1J5OB 5IT9U 4AL5A 1AT1B 4WKRA 3GG0A 2XGPA 2MKKA 4NASA 4ID5B 5H1SV 2XNQA 1AUSL 1S1VB 2V0NA 1FRLA 3UCUP 2XS7A 3B4DA 2QV6A 4F2SA 5C25B 5E3AA 4X64F 2JWNA 4TKTA 2HMIA 3MEGB 3SIPB 3JSMA 2V8PA 1UEKA 2YNFA 4RW9A 3SV3A 2E7WA 3IRXA 4WPAA 2HVEA 3UNYA 1N5TA 3HVWA 2PEBA 3CO0P 3C6TA 2NZCA 1RKJA 2JSXA 3KK2B 2HBQB 3SZ2A 4M5NA 1R8PA 1CJTB 4ZVEA 3TA1A 3EM1A 3QT5A 4IG0B 5ITHA 3AHPA 5L38A 2C3OA 2R2RA 3M8QB 2AF6A 3V6KA 1Y5IB 4F67A 3VGUA 3EDQB 2MKJA 4M1KA 2MLZA 3GLJA 5H9EJ 1HWUA 3QT6A 4GC6A 1S97A 5A8WA 2ZVSA 4WFNQ 1FKOB 3LUYA 3BSNA 1T03B 3HFVA 3D1HA 5DS7A 4Y2IA 2VA2A 2M0GB 1HW9A 5DQIA 2YKAA 4KB7A 2E7VA 4FPIA 3JQJA 2ZKUA 3GV7B 2QLJB 4DR2F 1U2RA 1MROB 4RU9A 1N5QA 4JI2J 1PBAA 4G1IA 1EX8A 2BACA 1VHFA 3H7HB 3UVJB 3EXYA 4DV4J 4Q0BA 3DRYA 3AQOA 3R5GA 4OYMA 1BC6A 3QT7A 3NGDA 2OIHA 3D66A 2H4YB 3J81U 3VQTA 3CC4S 1TKZB 4K2XA 1RHJB 4KTQA 3I5AA 1URNA 1B99A 3TJAA 1JK9B 3TZZA 2ASYA 4GKJF 3L95X 5K20B 3T5HA 3HHDA 4IQMA 4CM0A 1PYTA 3QIDA 3PNIA 2VQFJ 3RBEA 4MT1A 3RAMA 3W62A 4QIWD 2CJAA 3C6UB 1J5OA 3W9HA 5L39A 2OELA 4L73A 4LRCA 5B09A 5H9FK 5D15A 5HATA 2CQ1A 5CYMB 3OVSA 3OFFA 5BXIA 2JEGA 5DLFA 2UU9J 4ID5A 2HKEA 3KLFA 1X7VA 1RT1B 3IMQJ 2UXDJ 3LAKA 5C25A 2A6MA 3FUYA 3EGZA 3Q8VA 4KHMA 2RS2A 4JI6J 2CYYA 4K0KF 3IM9A 4DL2A 3KUGA 3MD1A 2ZH8A 3A1YG 1DLOB 2FUG9 4ELUA 3S01A 2V9WA 4LBIA 3KK2A 3EGVA 1U26A 1IBMF 2WZ1A 4JYAJ 2HQDA 2WK4A 3CIZA 4JI5F 1NSQA 4IG0A 1RWVB 3M8QA 1WEZA 2VFUA 2R7RA 1EETB 2DHHA 1TU0B 1B70B 1QSLA 2BKNA 4RWWA 1SH2A 5B0DA 2YX7A 2K3KA 4ZCLA 1T03A 1K8AT 1K1SA 4OYXA 3UPFA 3HD1A 2W8KA 2OLWA 4K50A 1VJWA 1L3SA 4OHVA 2CJKA 3CSKA 3FEYB 1MROA 3K58A 4ZJQA 1Q95G 2W8LA 1RCXB 3HSZA 2WBRA 1VBYA 4KGXB 3UVJA 1KTVA 3H40A 4KFBB 5LJ5Y 1FWPA 3PM9A 3DRSB 4GKKJ 4NXMJ 2KVIA 4USTA 4JOUA 3CCUS 3G2XA 4FDFA 5ETMA 2IM3A 3BGFA 3NXZA 1HWIA 3D0HE 1Q8LA 2F5GA 1TKZA 1D8YA 4ECWA 1HWLA 2KU7A 5C42B 1JLEB 1RCOB 2CXEA 2HFZA 1GT8A 1T9TA 2MB0B 1U6BA 3PJWA 4DS5A 3IG1B 1LWCB 3HSDA 4LIRA 3C6UA 3IO1A 1S77D 1S49A 5AE2A 1N36J 4CP5A 4O3RA 1GX5A 4WFXA 5CYMA 5DDPC 1XQIA 1VS3A 1B4SA 4ZLNA 4ILRA 3WDOA 2M3DA 2BDPA 1RT1A 1RWXB 2J9DA 2CVEA 4NL5A 5IC4B 1HI0P 2RHQB 1RT6B 1Q5VA 3K7RA 4OZ3A 1XMBA 2HRUA 4OJ3A 2H65B 1JKHB 2VICA 1S1WA 3MAQA 3D6FB 3ILOA 2C2DA 1FXRA 1PAUB 2K1RB 3T1YF 2E7XA 3I6PA 5DETA 4PQUB 4ZP8A 1DLOA 2ZJQQ 2CJYB 4ZPCA 4GVLA 3UN2A 3DU6A 3B4MA 3R6GB 5ETNA 2Y0SD 4Q7AA 2VF3A 1C1BB 3OTOF 1EETA 1S0VA 2JHEA 1N0UA 1NKCA 2YY3A 3J7ZT 2WAQD 5J2MB 1G7CB 4B02A 1TR0A 3EJMA 1BQMB 4QWAA 2IM1A 2Q3PA 4QU7A 4AT1B 3EYZA 2OKQA 3THPA 1NZAA 2ZH6A 2DRAA 5DQHA 2J0QD 7FDRA 2LEAA 4DMZA 2W7AA 2QYCA 2JJ4D 5B7WA 2FJDB 2QC3A 4PR6A 3ISND 1TKDA 1RABB 2ASDA 2DNRA 2V8DA 3NCQA 4Q2MA 3VAKA 3HFZB 4WTYA 4YR0A 4B3OB 5LMUF 1ZAXA 2XBPA 2YNIB 4JBCA 2M9KA 2ACYA 1RHQB 2LQ5A 5DG8A 4F4AA 3L7PA 1PYSB 2BOPA 1DARA 3RB6A 3FGVA 3PV8A 1OY8A 4RW7B 3IG1A 4YHHF 1LWCA 2MKCA 2CAJA 4KV8B 2JLEA 4ID8A 3E2EA 2GJ2A 4J9OA 2HFSA 4JI1J 3H2LA 1WKKA 5K8OA 3T1AA 3I82A 2A18A 4P7VA 3US5A 2RAQA 2KYXA 2EXUA 5A6PA 2CQ4A 4QR0A 1F0XA 2H1YA 3L7OA 4C97A 1YDLA 1A9NB 2KJVA 4A48A 4ENOA 5CD4H 1X31C 4RL1A 3UCGA 2MGZB 3KHRA 3CGIA 2HAIA 3MM6A 2J8SA 3RR7A 1NJXA 4DFKA 3N28A 1HIYA 3U1LA 2RRBA 3ZTQA 5IXUA 2K1RA 4ZCMA 1A7GE 2GVDB 1DQ8A 4OZ5A 4PQUA 2KXHA 3AA8A 3OXFA 4OHZA 2ZUAA 3FEXB 1VQ8S 2F40A 1RZMA 1RAJA 3IN5A 3EGWB 3D3BJ 4A8SA 2QMXA 3M9NB 4FPRA 4JI4F 4C2MA 3R1LA 1FXLA 3T5KA 4IR1A 5L1LA 3CC7S 4E98A 2MJNA 1C1BA 2AIRB 4FF4A 1RHUB 1T8EA 3TEGA 1LW2B 2DGQA 5IT9Y 2Q79A 3BN7A 4AFFA 5DG9A 1R8CA 4LMZA 1PO6A 4Y6IA 1ULRA 1S6PA 2GGPA 1I5OB 2N7CA 1YK9A 4FF1A 3GPAA 2QL5B 5KFQA 1IBLJ 3FMWA 4PABA 3RU0A 4O4GB 1CS4B 3R6LB 2DGWA 5KFMA 3BYRA 3CVKA 2XG8A 3I32A 5KT2A 3AJDA 4OHXA 4HI1A 4I2QB 3VZHA 2WRMA 2MZ1A 1JLFB 3TARA 4YDDB 4NE9C 5FDLA 3RRHA 1N56A 2M52A 5HANA 1IR2A 3MR6A 4B3OA 2AP6A 2YNIA 1SKWA 1RAHB 4ZN3A 3R3TA 1Z2ZA 3HZGA 3LGNA 4ZLPA 4I69A 4WXOA 3A3OB 1PKUA 1U8WA 2OI2A 3CDBA 5AE1A 4OHYA 4IOAQ 4KV8A 1CEZA 2YVSA 5M2UA 3SCKE 3GJTB 2IPOB 4M5HA 4OX7A 4Y65A 3O44A 1M5OC 2E1AA 4WWSA 4OV1A 4K7QA 1R3NA 2O1PA 2YKQA 4ZKAA 2MGZA 4XPEA 1I1GA 3N6NA 3V2UC 4DG1A 3UNGC 4P2FA 2GVDA 2J7UA 3HHLD 4JI2F 4ES2A 2Q6CA 2KH9A 3M8RA 5CA5A 1NK8A 4DV4F 1CLFA 4KJIA 1RAAB 3C46A 1Q5YA 1KOHA 5A8KB 2HNDB 3HKZD 2CVIA 1EKSA 3U02A 2R9LA 1C4AA 5ETVA 3VVTA 2WVFA 4HTIA 3MUTP 1OQ6A 1RYSA 4OYAA 4CLTA 4IH7A 3V81A 3MEDB 2OHDA 2QFIA 1FVQA 4QW9A 3TA0A 2MHNA 2EG2A 1YJVA 2XWXA 4O3PA 2KO1A 4UY8T 3RRKA 2BJ3A 1EAYC 4H4OB 1RAOA 3I31A 1X9MA 2E5JA 3EE3A 4B17A 2Q66A 2W7PA 4K59A 5EX0A 3HVRA 1FJGJ 2I0XA 2FTRA 3CJRA 1KONA 4N76A 4DPUA 1FNMA 1VBKA 4A8XA 1CS4A 2Z8QA 2UU9F 3WBZA 2F8MA 2ILZA 4X66J 5HJXA 2UVRA 2BABA 3PYFA 5GADU 2UXDF 4I2QA 2ZKTA 2X3GA 2QA1A 5F8HA 1JLFA 2NSBA 3IWNC 4JI6F 4QWBA 1WTBA 4PAAA 3CCJS 3R5CA 1U09A 3MPYA 5M2RA 3X3UA 4DQRA 3JAMU 1TP7A 3CDWA 2EWHA 3VV2B 1UPMB 4V1Ak 3W5XA 4JYAF 1MG7A 4M5MA 1NH7A 1KS2A 1S4EA 4RWXA 4AL7A 2NR0A 4IG3B 4WFAQ 1RDRA 1PGZA 3ZXWA 1I94J 1FERA 2BX6A 1FXDA 1X4CA 3DXSX 4TY8B 1N5YA 1KRPA 1FX4A 3RAQA 4LQ9A 3G4SS 2SXLA 2AX1A 1MWYA 2XCAA 2BYCA 3NAIA 2DXFA 3G87A 3CEDA 2D3UA 4J9MA 4LSLB 3Q0AA 1AYEA 5E2QA 1YBTA 2GMHA 3BGUA 3KLHB 1SL1A 2VC1A 4XO0A 5B0CA 1RHKB 4RUCA 2LLZA 1Q0NA 2BUNA 3PYDA 2GA7A 1MMNA 3CULA 3HCXA 4V19X 4LQ3A 4CYUA 1K44A 1U0SA 5A8KA 2HNDA 3RW7A 1VQ4S 1KFSA 4NXMF 2HGLA 2UUBJ 4DPWA 3RJMB 4V19J 2RJZA 2CRLA 2WVDA 3QAEA 1U1QA 3MEDA 4LRFA 2BJ9A 2DEJA 2EVZA 3K57A 5IM0B 3MM9B 4OZJA 1RT3A 2N3OA 3AAWB 4QIEA 2QLWA 1Q4RA 1RXOB 2WSEC 4R0JA 4DN0A 3DDNA 1N36F 2AD9A 3ETOA 5HO4A 4R5PA 2LXFA 1XNQF 2CUYA 1WJ9A 4KKOA 1ZBTA 1BXNA 3TRGA 4NI2B 4DR3J 2HQIA 2ASJA 3M6XA 3DHWC 1T94A 1WHVA 4DV2J 3HSGA 4FF3A 4JB8B 1NK4A 2CA9A 3KWMA 3T6BA 1TMJA 1RADB 2RUSA 4F2RA 5B0GA 3B8HA 2WW8A 2MQQA 3MZIA 2EW9A 1NCLA 3EDRB 3R97A 2G13A 4JV5J 3QGPA 3PIOQ 3LGHA 1HD1A 4EYHB 3KDOA 2FJXA 2OFHX 1GQEA 4JI8J 1U6ZA 4Q44A 4DL7A 1VISA 5DM6Q 1SKRA 2NREA 1RT7B 3E01B 2IA6A 4IG3A 2BQUA 3IRWP 5KG6A 4I7FA 4YB6A 2WSCC 5E41A 2EG1A 2HLUA 4BWMA 4TY8A 2ZITA 1R89A 5KFGA 3GIMA 1Q1KA 5D4NA 4I1TA 2V4JA 1N0VC 4C3KA 2K2PA 3KLHA 3CCVS 1SCJB 4ZLJA 4M94A 4KH1B 4X4UA 4ED7A 1REGX 2AZ3A 4L74A 2EI5A 1QY7A 1MW7A 2DB1A 5DZ7A 2D74B 4PYDA 1Z4UA 2IBOA 4DCOB 3S1TA 3UI3A 1OY9A 1XNRJ 2B56A 2BE9B 2X1FA 2VFVA 4RBVA 5D4PA 3POTB 4LF1A 1L3UA 1SH0A 3TA2A 1C1CB 3BR8A 1M5PC 1U47A 4P73A 5AXLA 5F8MA 5IS2A 2VBXA 3RG6A 2A1BA 1KVJA 1VBZA 2CJBA 3SSSA 1BD6A 2I38A 2V94A 4HDGA 1FF2A 4F50A 1F3FA 2QLBB 4F3QA 3CCTA 3CPWR 5IM0A 3MM9A 4LF8F 4ED6A 2CPXA 3C3LA 3Q2SC 4J90A 3JQMA 5HMWA 4KGKA 4H4KC 2R8JA 2UP1A 4JI1F 2CWKA 2WVEA 3W9IA 4KHPJ 4WIQA 1XC9A 4QU6A 1KQSR 3H8YA 3TUZC 1RACB 4F02A 3PO4A 1J5EJ 3WC0A 2GMJA 1NSKL 5D3GB 3E3XA 5A2QU 3I5CA 4EI2A 2D7SA 1FRJA 4TXSA 5I3PA 2V50A 2B9XA 3SBMA 1CJKA 5CZVA 1VYAA 4O44B 5DJBA 3KJNB 3H20A 2FHJA 1WWHA 3R5JB 4RNHA 5KFPA 3BBCA 4DF8A 3D7SB 4TLRA 2QSFA 1VRUB 2M5YA 4NYZA 4AL6A 2YNHB 2OFGX 3GB0A 1HARA 3B78A 2V2ZA 3H0PA 1QVGR 1JNZB 3QJPA 5CYQB 1AFIA 4B3MJ 1R0AB 1WI8A 3MURP 1RA6A 2LA4A 4RBTA 2VG6B 4GC7A 4YY3F 4NLTA 1XERA 4CO0A 3M6WA 4PWUA 4EO8A 2H5IB 2XC9A 1QUPA 3TJ9A 1R0CB 1Q86T 5FIIA 1IBLF 2IDLA 3D9BA 1IR1A 2DT9A 3W8GA 2C2NA 4YDXA 3K89A 2BE2B 5LXYA 3U1NA 3V6HA 1HQ2A 2IDEA 3ZZPA 2L9DA 1KVIA 2J9DE 2DJWA 5HAOA 5SUHA 2MSSA 4F4WA 4LF9J 4X4SA 1H0HB 3D28A 3POTA 1C1CA 4NCGA 2P5VA 5L46A 2RU9A 2GHWA 2LQ8A 4ECZA 4J9UE 4JI0J 1NHVA 4OI0A 3W1YC 7FD1A 3ZZUA 3MMBB 4EK2A 3QNWB 3UW1A 1FEEA 1F5CA 2ATCB 4ILMA 2W7OA 1FWKA 1IJEB 1UVLA 3BV8A 2VG7A 3ZTSA 4USVA 4DL6A 3OTDA 3OUYB 1WC6A 2LDYA 4NLQA 2JOQA 4C8KA 2CJXB 5D3GA 1VRTB 3SSRA 3U27A 3OFEA 1JWWA 1GMUA 3TOQA 4J7CA 4OI3A 3KNAA 3V6JA 4N8NA 2XZWA 4I6WA 3DDIA 3PEHA 2IVFB 1FFGB 2HWIA 5ETQA 3JS9A 2G0CA 1B0PA 2B4PA 2DEIA 3K8WA 3KG1A 3M32B 3DU5A 2Y3YA 2ZHOA 1YJUA 1JMTA 2ZH1A 2HG4A 1VRUA 4DI6A 1TKXB 3TQEA 2B7BB 1K1QA 3KLVA 2VZ9A 2CDRB 2V8VA 1JLBB 1GX6A 1M5SA 2R2TA 1R0AA 2NXEA 2I5JA 1WF1A 2ZHAA 4O3OA 2NS1B 2X3DA 2VG6A 3HX9A 4KGZB 2X51A 4HT5A 2WVCA 5ETPA 3DGVA 2VPYB 1H2VZ 4BS2A 3A12A 4I67A 2KM8C 2VONA 1ZM9A 3FCHA 1BLUA 2Y9HA 2P8IA 2C2ZB 2QIFA 2W25A 2BE2A 3ZZZA 4X66F 3BEGB 2ZZMA 3GCXP 5C24B 2P9CA 5IZHA 3NS7B 4D3HA 4HI2A 1PILA 3MF5A 1NNDA 1S7HA 1VFJA 5KTQA 5IV3A 1FRIA 1SC1B 4G1PA 1T7PA 2EFVA 1UWAA 5BYRA 2XY6A 2DTJA 2L9WA 4BCAA 2JL9A 4P6QA 3I96A 3JAMY 2DPJA 2G2ZA 2DNGA 4F0KA 3RTVA 4C8MA 4KQZA 4NOHA 1UA1A 4XDDA 1H38A 3FJ2A 4PWWA 1H3DA 1FVSA 3MMBA 4UOFA 1GMVA 5DZ6A 2YX1A 4K5SA 3CDEA 1LV5A 2GS8A 3HO1A 3N5BA 4MTPA 3DLKB 4Y2KA 3AODA 1NJZA 2GV1A 3I4PA 1M90T 2Y0BB 3GYXB 1FNXH 3OUYA 1Q53A 1I94F 2W2NP 9RUBA 5HQ8A 2KXFA 3MMCA 1RWWB 1S76D 1VRTA 4URGA 4FS2A 1WD6A 4ZVTB 3CJ5A 3W8PA 2D41A 2F8EX 3VGVA 2H5JB 1GXTA 4P10A 2HFUA 3KUEA 2C1EB 5DRKA 2J5AA 1Y10A 3Q2TC 2FJWA 4CO2A 5BJRA 2EK1A 2DGTA 5RUBA 3ISNC 4UW2A 1HL6A 1S99A 1M5KC 3DLLQ 2VC0A 3J7YI 1TKXA 1ZA1B 2ZE2B 5DG7A 3GP9A 2FLNA 3F56A 4P74A 2UUBF 2HWHA 4RPFA 4HL9A 1JLBA 5IC6B 1O6XA 2AV5A 4LREA 3CE8A 4F26A 1FA0A 2RSQA 1FJCA 3O1LA 2M2BA 1U7LA 2AJ2A 4KHRA 4QWCA 1YVFA 5SZTA 8RUCA 2HURA 1TVRA 1U2CA 5HK4A 3OL8A 1RKIA 1ZH5A 1P6TA 1RTHB 1B3TA 2C3PA 2JEJA 3DHXA 1ACMB 2DNYA 5C24A 4DR3F 3VGSA 3Q8RB 4W98A 2VOOA 2N3LA 5HJYA 4LR7A 5D0EA 4ZPVR 1RBAA 4DV2F 1NK6A 3CCSS 4ECTA 3P6YC 1RBLA 5A8RA 1YGYA 3QWPA 4YP3A 1R8AA 3BBFA 2ROPA 2VPXB 1S59A 1HHSA 1KKHA 5KT4A 3E51A 5K14A 1V5IB 1QUVA 4B9UA 3BH7B 3MFIA 4NXNJ 1R8BA 4XTTA 1SV5A 4JI8F 4DSLA 2DK2A 2XHWA 3BGRB 3DLKA 1KR4A 1RTJA 1Q7LB 3AJ2A 3H5XA 3LO3A 4C6AA 2HHQA 1RT2B 2OEMA 1GFWB 2QT7A 4DV3J 2JRSA 3ZZTA 2HRTA 1GTEA 4RW8A 3P8BB 1QD1A 2VB6A 3UFCX 1TUVA 3N4WA 2E5IA 1B64A 3HT3A 1GEHA 4KGMA 3CJKB 1YITS 2R7TA 1RGVA 1T3NA 2MPUA 3HI9A 4X64J 3NGUA 3GSDA 1RK8A 4ZVGA 2FY1A 2ZH7A 1RAEB 1WC0A 2HQFA 2F1FA 4PWDA 4MFBA 2DRDA 5THWA 2AGQA 1WDDA 4J9KA 1ZOTA 2VUGA 2ZE2A 3NL0A 4TQRA 2QL9B 1XNRF 4MH8A 4I6AA 4FNHA 3SQGB 5KT5A 5DDOC 2IBKA 1CSJA 5HP1B 3HKWA 2MZJA 4DSKA 2K7KA 1F9HA 4K4VA 4CLWA 5J2PB 2CQCA 1GXUA 2QMWA 3PXGa 4OFZA 1YKWA 3A8IA 1LK7A 2IY5B 2ZNZA 3MPDA 2WOMB 3KHHA 2JFKA 4Z37A 1K47A 2HK3A 2CNKB 1SXLA 1BY9A 4USKA 2PIIA 2VJUA 1F5AA 1RTHA 4IFVA 4ECXA 5A2QY 1KN6A 3LWLA 1CC8A 4QZVB 4KHPF 3HD2A 3QRPA 4WFBQ 1FHTA 2ADCA 3DLJA 2DXDA 1J5EF 4X84A 1HBOA 2OP5A 4Q2LA 2RE1A 3CJ0A 3FCVA 1G1XA 2AJ4A 2GJFA 2OPRB 5C2GA 1ZM4A 3G9CA 3MEEB 3GCWP 1T9WA 4XPCA 1P1LA 2XHCA 2CQ3A 4M95A 2AKWB 2DR6A 1VMBA 3EZ5A 4HACA 1XK8A 2OMLA 2ZH4A 3G8QA 2IAJA 4WZQA 1IR0A 4DV5J 3TW0A 1N88A 3BYPA 2FLPA 2J0XA 1ZAWA 1GXLA 4ZIVA 4P9SA 2LQBA 3DXBA 3OJSA 1QTMA 3G6VA 1LKZA 4B3MF 2LU2A 2OGUA 2X1GA 2FVSA 1RQ0A 2QEXS 4B9TA 1RT2A 3KLEB 1UWBB 4P2MA 4EBDA 4NZ6A 2D3ZA 3LA0A 1AZSB 4PUOA 4ZHRB 3CMQA 2DR7A 2VIHA 2UUAJ 1KDNA 3UDCA 1VQNS 3BO2A 1VR6A 2AHOB 3NP5A 1RBOB 3CJKA 4Y28C 1FKPA 3R2DJ 4LVNP 2R8IA 2F7VA 4LF2A 4A8KA 2G0IA 2GHVC 5T41A 2PA3A 1W2BR 4CZCA 1EARA 2MTLA 4K0KJ 4YFUA 2P9EA 3ZNJ1 1IXKA 2LP4A 1VLOA 5GADI 4FXVA 3BSOA 5BYQA 2KXNB 3GG1A 1VQ5S 3CT9A 1HI8A 3DNCA 3C14A 3SQGA 4IO1A 4ECRA 2WONB 4DR5J 2R7QA 3AJ1A 1WHXA 4LJMA 1DURA 5J2PA 4NRUA 4JI5J 3QZ8A 3CCRS 3U7JA 5I3UB 1JJHA 2WOMA 4HLBA 1NHUA 3DYAA 3ENWA 5HQLA 2KDOA 3SMZA 1DRZA 3I56S 3FZ2A 4DL3A 3OT9A 1RWPB 4USUA 2GVZB 1IM6A 4ELVA 1UFLA 2QA4G 2CPDA 4OYWA 1FRXA 5ETOA 3KLIB 5ADZA 3O8WA 4DL5A 1X9WA 2GZOA 3J7A1 2MY8A 5B0EA 2OPRA 1TKTB 5LJ3Y 3BO3A 2BANB 1TK0A 1BQXA 4CWBA 4DFJA 4EWTA 3MEEA 2XLJA 2DNHA 6AT1B 4C8YA 2QJ3A 2R8HA 5J2QB 2HHUA 2KRRA 2DHAA 2UXCJ 5AE3A 4MKVA 3BH6B 2FJVA 3EMTA 3K5OA 3DLEB 2HGMA 2DGSA 1VQ7S 7AT1B 1R6YA 5KFVA 4HYKA 1WI6A 1HR0J 1FE4A 3Q24A 1DTTB 2EKYA 4JV1A 4LUBA 3P96A 3A13A 4U7UD 2ZHBA 2YKMA 4ITSA 4A8QA 3CCES 2YWEA 5GVQA 2HBYB 1AZSA 2NXJA 1SL0A 1QSYA 3K59A 4ZHRA 1S72S 5EUHA 5HROB 4U95A 2XZTB 3NOCA 3NGTA 1ZETA 2L08A 4CO4A 5B08A 1TQLA 3S7RA 4DFPA 3HK2A 1LK5A 2ZZTA 4OZNA 3BREA 4DLGA 3PHEA 3ZTRA 3VAJA 2H9ZA 4DX7A 1YLXA 3M2RB 4QQBA 4CO1A 3KLGB 2BJEA 4MMOA 1LWEB 1SJ3P 2WB1D 4WP9A 2RB7A 4DR4J 3GR1A 5LL6d 1IKWB 4DL4A 3DKDA 2XMVA 1IN0A 1VJQA 2DH8A 1K0TA 2BW7A 2APOA 3GSIA 3L9ZA 1LFWA 1WOOA 2J8AA 1SIWB 1WKJA 3D6TB 2WONA 3NS6A 4ECVA 1PJ5A 1R8HA 3CJ4A 4FBTA 3X1LB 3SI8A 4UUWA 4UQTA 3UDLA 2VJVA 4GO5X 2CNNB 3HVAA 1FO1A 4EEYA 5L9XA 1TELA 4EYIB 2FGOA 5EWFA 5KG5A 3QBCA 1CQNA 4X4QA 3ZC4A 3N9UC 2AYBA 4PQAA 1SQGA 1OPIA 3WQPA 3SCJE 3LOUA 2N4CA 2MKIA 2D69A 3KLIA 5E3RA 5E5NA 2DIVA 2CQ0A 4FXWA 2MZTA 2BANA 2ZOGA 2QO3A 3PIPQ 1X4HA 1HD0A 2DO0A 3LP0B 2V6AA 1PIEA 4ZVFA 2NXUA 5J2QA 2VOPA 3MM8B 4KGVB 4UOHA 3MR5A 2RMLA 3PFEA 2GHPA 2HMIB 4L75A 1TL3B 1ZM3A 1S6OA 3W3SA 1TMMA 2V4QA 2YH0A 4NMXA 2MZQA 3JQKA 3PX4A 1DTTA 1L3TA 2EFOA 2XMWA 1SKUB 1VQ9S 4F4YA 3PDNA 3CDAA 3LP1B 4K2JA 2R2SA 1X4DA 2KN4A 3A4TA 3DGPA 4C7QA 1U4BA 4F0HA 2W01A 3RRGA 1ZPVA 1WUUA 1QM9A 5HROA 3CD5A 1DFDA 1UW4A 2FHOB 1PBUA 1GAOA 4ECSA 3A8EA 4NYOA 5L1JA 1C0TB 3P45B 3F73A 4RJVA 1IJFB 1S1UB 1V6HA 4RKUC 1T05B 2FZKB 2CQDA 3KLGA 1W25A 1IKVB 3G6XA 5KG1A 1FCAA 4BBYA 1RYRA 1RHMB 1DTQB 2YPZA 4YS2A 3BDEA 4BDPA 3BR9A 3TP2A 2FC8A 2E5HA 2R8GA 2MQMA 2OMOA 2B8PA 3DLGB 1KFDA 4Q0BB 2RVJA 5IQ6A 3M30B 4LVOP 1TAUA 2H51B 5D78A 3UN3A 5F3ZA 4JI4J 2QGFB 2LEPA 4NX9A 3BO4A 1URRA 1BWEA 5CYJA 3QFWA 1RSCA 1ZS6A 4RNMA 4YUDA 1XBWA 2BJ8A 2HQ3A 4NXNF 3PFOA 4JP8A 3TEHB 4HDHA 3CJ3A 2XO6A 2GIRA 2PD1A 3PZPA 2OTLS 3IM8A 4DV3F 5KFAA 1XEZA 3PCOB 2HWTA 3ULHA 4OYBA 4DR7J 4I4BA 1G2EA 3KLFB 3MUVP 3EGNA 3MAHA 2IMWP 1FFWB 3OVBA 2JEIA 3LP0A 2DITA 4PKDB 3I0RB 4OJGA 3W64A 1U45A 2CWXA 3MM8A 1R27B 2DGOA 4N77A 3K5MA 4UZCA 1TL3A 2O01C 3UN5A 1IWAA 4LR8A 2V63A 2W2PP 4KPCA 1Y7PA 1FE0A 2CKWA 2E5LJ 4WTOB 2FJAB 1KLNA 2V2KA 4AXJA 4C8LA 2LECA 1QAYA 2Y8YA 2M7SA 1PG5B 2OPSB 3LP1A 4J9QA 3LQVA 1Y3KA 4NLWA 1S0MA 5BR8F 1NDPA 1BGXT 2BMBA 3D6HB 2XEXA 3OXLA 4RR5A 3BKFA 2IA0A 1GH8A 1D9FA 1B0TA 4KYZA 4JV2A 3ENVA 3P3DA 1SKSA 1YJ7A 3OR2B 2DKOB 1C0TA 2XMTA 2B7CB 4XDCA 1S1UA 2UVUA 1T05A 3WIUA 1NDLA 1QJHA 1IKVA 1L3VA 1NJYA 3TR5A 4O4RA 1DTQA 2J7KA 2NSCA 2BM1A 4RW4B 1FKAF 2KYZA 2XCPA 2AEFA 3BPDA 2BXJA 3KK1B 2BR0A 2H4WB 4BWJA 2R4FA 3DLGA 2PI4A 2Z58B 2KFNA 3M30A 4ICLB 2EPIA 2E66A 2YQ1A 3O3LA 2Q1LA 3PW4A 1U2FA 4X62J 2CZVC 4FYWB 1CJUA 1VK3A 4DV5F 1FK9B 2OH2A 4DQQA 3QGGA 3MHYA 3QGIA 4ZPBA 1Q8KA 2AZ1A 2DH7A 2H5EA 4NLGA 5GAGU 5FD1A 4TNOA 1A0OB 4ZDNA 3R1HA 4FN5A 1XWLA 4K4YA 4L3NA 2RD5C 4IRDA 3PO5A 1H73A 1T11A 2VHGA 2UUAF 4H4KA 4Y0FA 1SB6A 1SIZA 3C8YA 3CMES 1I51B 3JSBA 2IFXA 3C2PA 2MSTA 1JJ2R 3MMJA 2CADA 4C0BA 5J2NB 2W4DA 2NQPA 4DUZJ 1FRMA 3G96A 4ZVPB 4KSEB 3I0RA 2V9KA 3G8TA 2L3MA 2XSJB 2ZWPA 1S1WB 2DHSA 3MXHP 1D0EA 2X1BA 4PG4A 2Y1RI 1TUWA 4KAIA 3PTWA 5KFNA 2GIFA 1RTZA 4U8VA 3H5SA 5T7LB 3GTYX 3HDSA 4H4MA 3SSQA 4G1QB 3AB4B 3MMAB 2RKIA 4ZIWA 2B43A 4ER8A 2Z4PA 2OPSA 3GFXA 4J5OA 1HNWJ 1PC4A 2B9EA 4DR5F 3PG9A 5KG7A 2XY5A 3Q8SB 2DNKA 3NAHA 1YZ7A 1M5VC 1LFPA 5KFKA 1U1NA 1U1PA 3PY8A 3TAMB 1WC4A 3MR2A 3OR2A 1YI2S 1FJEB 5F3TA 2EBGA 4K4TA 4DJBA 5E3CA 3TX8A 1NB2A 3BQ2A 4ZVHA 5U47A 1WF2A 1FDAA 3KMSA 2KM8B 1X4GA 3CDUA 2QRRA 4URSA 2GW8A 3PR5B 1FFSB 3M6UA 3D0GE 4RW4A 4IFYB 3R5BA 1D09B 3H5UA 2YWGA 2KHDA 3KK1A 3FSYA 2B4VA 1N54B 2IRUA 3DCAA 4ICLA 1S1TB 4K4SA 3FC9A 3MOJB 2M4MA 2YXLA 2UXCF 2C2MB 5G4DA 3F41A 4W90B 4Q8FA 3S6EA 3CD7A 3ZZRA 2CJ9A 2HIQA 1FK9A 2V8HA 4DCJB 5H9FJ 4FP9A 4NYPA 4C11A 3L4BC 2V5HG 1HR0F 2XNRA 2MXYA 5K8MA 2DCLA 3D68A 2BRKA 3HP6A 2PMWA 3IGVA 5FLXY 4LFCJ 1HBUB 5JVGQ 4YB7A 3U1MA 2XULA 3SYZA 4PXDA 5KG2A 1JXVA 3BKTA 1XNQJ 4OZ2A 3FKBA 3IS9A 4EBCA 5JUMA 5J2NA 2R3VA 4OX9J 3K5PA 3TQ1A 2FZGB 4YR3A 3P5TL 4EZ6A 4FYVB 3GE9A 4ZP9A 2XSJA 4M5JA 3MM6B 1HA1A 3CJSA 3SFUA 2VBWA 2CFXA 1RWMB 4DR4F 2EFQA 5D0HA 5T7LA 1PAEX 3IR6B 5HMYA 4D3GA 4KH0B 1LNQA 2I9SA 1KOOA 4G1QA 2QN6B 1TL1B 5GMKa 2HHPA 2PA8D 4DSIA 1E6VA 3OTEA 4M5GA 4DQSA 3MMAA 5JVHQ 1SBRA 3JSYA 4ZVSB 5LSRA 2HAFA 5KFZA 4AXIA 1F6TA 1TK5A 5K8PA 3GFZA 4TU8A 3I9V9 2HQGA 2P2CB 5KOWA 3TAMA 3AA9A 2XYGB 4DPOA 3GIRA 1UVJA 4A8WA 1QTNB 3OL6A 4MKYA 2RDDA 1S6PB 4CRJA 3FBCA 2GGPB 3KDNA 4CQ1A 4F3OA 3ADAC 3C66A 4TQSA 4LFBF 5KG3A 4IFYA 1JXLA 3L3CA 1X8DA 2LQ9A 5E7OB 3I0SB 4MK7A 1CQMA 1U49A 2V68A 2ZM6F 3J7YU 3LWMA 1S1TA 2Y1JA 5F8NA 1SJFA 2XS2A 3H98A 1UFWA 4CLSA 5FDLB 4DU8A 1HNZF 5KG4A 1WOSA 2DBBA 2IJFA 1P9QC 4F4XA 2AJ1A 2XMMA 1SJ1A 4L6V3 2D3OR 1TFYA 1KHWA 5LM7E 5K8NA 3BF4A 4KIAA 2YBVA 5GAEI 2AEJA 1UETA 2LFVA 4LF8J 4PRFA 1NXIA 3QJLA 1HBUA 3G86A 2YKOA 3VTIA 3UE2A 4ZVRB 3OSPA 4B3SJ 2JEFA 2DYAA 4AD6A 1XMOJ 4MK8A 3ONQA 4IOBA 2K8GA 5M2PA 1CC7A 3O5TB 5D0GA 2LEBA 4UQGA 4KC5A 2HYIB 2M70A 1PJ6A 2XWYA 3GJRB 2QG9B 3KG4A 4RUBA 2C2EA 3TYTA 2LA6A 1T02A 2HW3A 3NBPB 1G3OA 3OR1B 4DG1B 2PGCA 4CCHA 3BGLA 3D1QA 2BJDA 2KZMA 1TL1A 5J1PA 2ZNYA 4CH1A 3KKFA 2J0SD 3FZBA 2VG5B 3OLBA 5IWAJ 1BWVA 1UMJA 3GIKA 3GYGA 1H7WA 3CB4A 5KFIA 2R7VA 2RDIA 3LTOA 2ZC3A 3RUBL 3IP0A 1PC5A 5DM7Q 3PW5A 2FJBB 2GJIA 4OMFG 2F8HA 2GO8A 5GMEA 3LW5C 2HK2A 3FFIB 1HLWA 4WYLA 2QFJA 4NRTA 3V81B 2KJWA 4DLEA 4YY3J 4MKAA 5G0RB 2IVMA 3QGHA 3FSXA 2E9ZA 2B6AA 4B3TJ 4LRDA 5AXMA 3HHEA 1RP5A 2CIMA 2ZOFA 4RUAA 2QA4S 4DR7F 1BQNA 1RLCL 1UPPA 3AXKA 4DEZA 4B9MA 4ANCA 2CQHA 3HHNB 3I0SA 1TFWA 3AOBA 1EQMA 1S0NA 3A3PB 5E0OA 1FESA 1MNEA 2WHOA 3NGKA 1AXQA 1LEOA 3PW7A 1KWMA 2JLFA 4OZ0A 2G1DA 4FKXA 5D6GA 3CD6S 1YTYA 4QBUA 2E5LF 1S9GB 5HSPA 3HHLB 4UOGA 3T5LA 1HKAA 2JZ5A 2R7OA 5KFLA 4USJC 3MM5A 2W9AA 4LF7J 5CZXA 4DZ6A 3IWXA 2CPZA 1LXJA 2KT5A 1NPRA 1YJNS 2IJRA 2HZAA 1OSCA 3FRYA 3RB4A 1N4LA 5EN1A 1N5YB 1NK9A 1ICEB 4LBPA 2DR5A 1HPZA 1JLQB 3VAMA 3W5ZA 1EB0A 3EVMA 4DX5A 1RAIB 5DLGA 1RT4B 2LDIA 2HSEB 1T9XA 4RNOA 2NPFA 4DN9A 3DLBA 3NBPA 4QYZK 2F4VF 3MAAB 2FC9A 3OR1A 3ILIA 2YQ0A 2CNLB 2DHGA 2YPYA 2IRXA 1NKBA 1DY3A 4KBIA 4O3SA 3VAHA 3NWRA 4IH5A 3Q23A 4U96A 2VG5A 1OMSA 1IKYB 2DR9A 4CYUB 4IR9A 5KT6A 4WK1A 1DQ9A 4DSEA 2MJUA 4M5DB 4OYIA 4X62F 2HGNA 4HKQA 3C16B 3CCMS 4NLSA 2CPIA 2W9CA 3M05A 3FFIA 2KKHA 3QJJA 2XI3A 2N4DA 2FVPA 1VDHA 2W24A 1N8RT 3NGSA 4FKYA 3PYEA 1VC5A 3VZIA 2OPQB 2AX0A 2AWZA 2FLOA 5G0RA 1RT3B 4UOCA 3M8WA 4LSZB 4K4XA 4OZLA 1U1MA 3PRDA 1UJ6A 3DRRB 4LF4J 2FPHX 4R5PB 3VF0B 4Y34A 2XMKA 3M9MB 1UVMA 1HNVB 1NH8A 4KKOB 2V4RA 2ASLA 4LRBA 5KOXA 1QVFR 4DUZF 5LXRA 2RRAA 3T3FA 1R7IA 1MMLA 3AT1B 3EPIA 1NU4A 1R43A 2U2FA 1DBDA 2OD6A 3KFWX 2WVBA 5CABA 2O67A 4QPTA 5H9EK 4QWEA 1S9GA 5CXTA 4LR9A 2IYGA 3HHLA 2X7IA 2L41A 4Y00A 5AJ3J 1NMEB 3VAGA 3Q22A 1LXNA 3AH6A 4N7TA 2B5JB 1HNWF 2YWKA 4U7CA 4C8ZA 1ZTTA 4BLGA 1P27B 2LQJA 4PXEA 3V6DB 2MQPA 4EUVA 2FQQB 2UUWA 3TVYA 4HH1A 1Y5LB 1XTZA 4NZ0A 1KD1T 4I7FB 2F3JA 4HHJA 3UDEA 1H74A 4P75A 3N6LA 1JLQA 3V4IB 2A6OA 1OWXA 1RWKB 2V4JB 1RT4A 1UAWA 3GIJA 2XMAA 4N8OA 1Q8IA 2DD8S 3TUPA 2WBMA 3MAAA 3MM7A 1F2HA 1RI7A 4Y3CA 1Q8BA 2EC0A 4PEOA 2EC2A 1ZPWX 2VL1A 3A8KA 3OTCA 1NJWA 4DSFA 1P8GA 2UVVA 2KT2A 3IA0A 1IKYA 3UD4P 4RNNA 4IH6A 3M2VA 4M5DA 1YWXA 2HVDA 2ALYB 3BM7A 2OEKA 3NMAA 3C16A 2GQCA 3IBFB 2IVYA 2HFNA 3FQKA 1V9OA 3CXCR 2HHXA 1JLGB 2DIUA 2IMOA 1VQKS 2G2OA 2OPQA 3LGMA 1QSSA 4A8YA 2WB4A 4U8YA 1U24A 3KK3B 2ZBPA 1HWJA 5IFMA 4LFCF 1VIOA 1SPBP 5I3QA 2JC1A 2XSFA 2YQ3A 3N79A 1I3OB 1WG4A 3DRRA 1YBUA 3AQPA 3OL9A 5DDRC 3D5MA 5AXNA 3RBDA 1HNVA 3NCRA 2JX2A 4PZVA 4ELTA 3OJUA 4MYUA 4FVMA 4OX9F 1BE4A 3ZZ0A 1F9FA 1CJKB 4ZITA 4GO7X 3G82B 3D6MB 4AE5A 2Q43A 4CO5A 3K2YA 3KMQA 4F0MA 4HVZA 5B0BA 4R8UA 3QAUA 4ZK7M 4M63A 2MQNA 2BEFA 3TNVA 3B6BA 1F3VA 2A2CA 6FDRA 2JLGA 4WYWA 1VRQC 1X60A 2B5JA 4C48A 4EO6A 1FX2A 2R2UA 2DXEA 1PJ7A 1ZYQA 3V6DA 5C2CA 1NO8A 3MOZA 1VIXA 4LF6J 1T95A 3TAPA 4F36A 2A3JA 5CH7B 3A3NB 1OY6A 2HVZA 1ZZNA 3V4IA 2N82B 3AD9C 3H4DA 1VQYA 1AUDA 1LW0B 2RS8A 4DWIA 1O51A 2ZUGA 3Q89A 2E1RA 2QLFB 1VQPS 4OJHA 4YN3B 1EJ7L 2ZJPQ 3SV4A 1S1VA 5MLCV 1KBRA 5KFDA 4K4ZA 1B0VA 3QIPB 4HHHA 3TVZA 4NCGB 3VALA 3MEGA 2P6SA 2B8QA 1JLGA 4OQJA 1K73T 3UD3P 2K7JA 2HBZB 1D9DA 3K0JA 4UY85 1YHQS 1VQSA 2GC8A 1HNIB 4LSNB 1YJ9S 4GVBB 3KK3A 1NSPA 3GFHA 3ELHA 4ZP7A 1FTRA 3H90A 1CJTA 3MR7A 3OHBA 3W61A 4B3SF 2VG7B 1XMOF 4TVAB 3O2IA 3PACA 1S4FA 4OZ1A 2P9GA 4ES1A 4B3RJ 3NNHA 4OHWA 3CWJA 3FNNA 2VKRA 3EVWA 1YJRA 2CQGA 4QR2A 2K3IA 1FKOA 2XMJA 2B51A 4DV6J 2KFZA 3M2UB 1FRKA 2XYPB 1Q78A 1NBEB 1TL5A 3G82A 2PMZD 4C3MA 3BQ1A 2F65A 3NY0A 1HW8A 2IM0A 1MSWD 3QQCD 3AB2B 5CHCB 5KFXA 4R0EA 3UR0A 3SFGA 1WOPA 5IWAF 1UEVA 3BSAA 1M1GA 1R6VA 3DRPB 3QMQA 2JNJA 4P2XA 5EDWA 3OXGA 3IR5B 2ACMA 3KXDA 5KFRA 5HBMB 1HBNB 5F0UA 3FK4A 2I5JB 3K8VA 1SJ4P 3LPEA 3M4XA 1VLYA 2G1HA 4M5KA 1X9SA 2OAUA 2XMUA 4B3TF 2RH3A 1FNOA 1TV6B 4XAKA 5GAGI 4Q43A 4OI6A 1LW0A 2ZH5A 4MK9A 3ZTOA 4O0NA 4OLPA 1J27A 2WSFC 5IOLA 4QR1A 3QATA 5IT4A 1FD2A 2Y1IA 4RBUA 2ATLA 1U8SA 3SCLE 3VQSA 4K4UA 1XMQJ 1EZZB 1WEYA 4DPYA 1PSDA 2KG1A 3HT0A 1AB8A 3QIPA 1W26A 3W5YA 1H2TZ 1AA1B 2ZBCA 2XB2D 2ZEJA 1L5UA 1N5VA 2Q6BA 2D1CA 3W63A 2VPZB 1KC8T 4WBFA 1UZHA 1OIAA 5DGBA 2PT0A 3BBBA 4O3QA 5KFOA 1HNIA 4LSNA 4GVBA 2AT1B 3PX0A 1WDTA 3MECB 4DZDA 2J9CA 4LF7F 4XK8C 1O0PA 2J7WA 4B9VA 2J76E 3HHKA 4CLLA 2N7YA 1U1OA 4LF5J 2GIQA 1KQGB 2UUCJ 1SJQA 1FT8A 3MMCB 4PYAA 3WZ0A 4TYAA 1RU2A 1UZDA 3KHLA 5LSLA 3KHGA 2AYEA 4C0OC 4K5RA 3KNGA 4WU2A 3M2UA 2VA3A 5KAKA 3CF5Q 4I6YA 4ZA1A 2UXBF 1OJ4A 1ELOA 1NUEA 5HVGA 1RA7A 4KY3A 4X65J 3T6JA 2RUGA 1S6QB 4USHA 3OL7A 1NEEA 3QSIA 4C8OA 2AGOA 4RZRA 1WEXA 2J6TA 1HFEL 2JC0A 4DL0C 2O66A 2B0GA 2YX4A 4KFBA 2VFRA 3DRPA 4LIWA 1O5JA 2RQMA 3DRSA 4Y2MA 4ZJOA 1HWKA 2Y8WA 1VBXA 5HBMA 1HBNA 1AROP 3MFHA 3H59A 3NNAA 2C42A 5F8JA 2WCXA 4WF9Q 5C42A 2DNZA 1JLEA 2VFTA 2UVWA 1TVRB 2HBRB 5GAHI 1TV6A 2VV5A 2DO4A 4WJBA 2CZ4A 3CJ8A 4QYRA 5I4MA 4OX8A 5HI7A 3NRBA 3LP2B 4LF4F 1MWZA 1S48A 4QOTA 4NEYA 2E1MC 2FDNA 3IAS9 1U25A 4F8RA 2AU0A 4TU9A 1F1BB 3VHQA 2IHR1 2DISA 3GV8B 2HHHF 2MDAA 4YB1P 2HIYA 2HHVA 2W2MP 1RT6A 4DV1J 2DNPA 4FBUA 5A8RB 3TZYA 2YNGB 4WP3A 2BV3A 4L76A 2B9WA 1JB0C 1JKHA 2XQCA 1VQOS 5KFJA 4X4NA 4HR2A 2B4OA 1IWGA 4ILLA 4NZ7A 1FD8A 2R7UA 4G3IA 2KTQA 3IXQA 5KFYA 2V8GA 5AJ3F 1S0OA 3K5LA 1RE1B 5K14B 4OI1A 4QIVA 4NLPA 3ZO7A 3CCLS 5E33A 3TWZA 3QZ7A 2VDHA 3MECA 4X4VA 2XTJP 4DV0J 2R7WA 1SV5B 1FEHA 1YJTA 4DV7J 3F0NA 2DY1A 4CLKA 2DCUB 1RTJB 3ZFVA 4W92B 1MMDA 3TX0A 3PYGA 1UVKA 2KT3A 2DRBA 4ZPDA 2QTWA 1CBKA 5EGYA 2IYIA 1V3RA 2AEMA 2JDJA 3ET6B 3HULA 4RW8B 1O8BA 2LVWA 3DLHA 1HQEB 4YQWA 2DR8A 5J2MA 6FD1A 1IM4A 3H42A 1S12A 1BQMA 4E2FB 4U9RA 1S7IA 2UV8A 1S57A 3DOMB 4ED1A 3AY0A 1H7XA 3WX8A 2Z2YB 2Z57B 4MJKA 2BBEA 4PWDB 4RNFA 4MFBB 1Y9OA 1S6QA 1HI1A 3TAQA 4ZCIA 1YIJS 5GMDA 4AYBD 3Q8QB 3MPVA 1SJRA 5JMNA 4N47A 2J6UA 1Y00A 1ZAVA 1YRUA 2GX8A 4B9NA 3EVOA 3UR3C 2MYFA 1RJJA 4XIUA 5KFUA 3NEKA 4YR2A 5KT7A 1WACA 3BSCA 2XLKA 3NWGA 1XN9A 4OX6A 1EHWA 4I0WA 1NSAA 3T1HJ 4DF4A 4LFAJ 3R2CJ 2NUUG 2JVOA 2EFGA 4ZVOB 1EQ0A 1NDCA 4RW7A 4YOEA 4O23A 1GMWD 2M88A 1T9UA 3LP2A 2VASA 3SDEB 4DQPA 4IFVB 4ED5A 4M8LA 2MLYA 5EWEA 2FLLA 4X4RA 1R0BG 4X4TA 2MMYA 3H2VE 1HBMB 1HBOB 2ILYA 4ETXA 2F9JA 4KPYA 5E3PA 2YNGA 2HZVA 1LWFB 4AQYJ 2CJQA 1Y4ZB 5L1KA 1UKUA 1RISA 4ED4A 2CZ9A 4HACB 4NPOA 4RX6A 2ZDPA 2ZH2A 3M8YA 4ETZA 4C3LA 1S9FA 2G0JA 4PG8A 2IAJB 2V34A 3C19A 3GU0A 4JI3J 2CQIA 3CCZA 1KHVA 3J81Y 1RTDB 4Q8EA 1OPZA 4FXDA 1D3WA 3GQCA 2EKNA 4DHVA 4QIFA 2R42A 2CPEA 4N41A 4F4KA 1DZ5A 2I1RA 1KTQA 4LF6F 2ZZNA 1WORA 4PUOB 2ZFHA 4HH0A 8AT1B 2BW2A 3ET6A 1Y11A 1LW2A 1SC6A 2VFSA 2WW4A 5ETRA 1HQEA 1XIQA 3BZQA 1OYEA 1WC3A 2W2QP 4DR6J 2VQFF 1FKPB 1Q16B 3NCPA 4DBQA 3DOMA 3W60A 1Z2LA 1XR5A 4DPXA 2D9PA 1GMWA 3O6QA 1GK8A 4ECUA 1NPPA 3ISZA 2ZBIA 4O4GA 1WHYA 3V4MA 3TANA 2LXUA 4OYZA 3MDFA 1ZA2B 1C4CA 4J9NA 3CMAS 5F8LA 1NLKL 5GAEU 3I9ZA 4EGLA 5L9NA 2UV8G 4DOZA 3L09A 3C14B 2ZDOA 2CQPA 1VC0A 2CQ2A 1SH3A 2LMIA 5BR8J 2MLXA 3EICA 1OSDA 2IIHA 4WE1B 2IJNA 2VPWB 3OW2R 3PR4A 3DYAB 4OYPA 2E1PA 4PG5A 3FSIA 3S8SA 2XGQA 3J81j 1RB0A 3SDEA 4ZVQB 3H25A 1NAQA 4MIAA 2RF2B 3D1OA 3T41A 4DR1J 3MGJA 3Q8PB 1X5SA 1TTHB 5D77A 5HVFA 4B3RF 4NA3A 4ATNA 4ANDA 1HBMA 3TZXA 4IUFA 2BVZA 4DV6F 4DS4A 2KRBA 3CJQA 4L72B 2KL8A 4WXWA 3IR7B 2PSZA 1VCTA 2WTFA 1H6KX 1EIYB 3IBCB 1QAIA 1LWFA 4BC9A 5AXKA 1WELA 1S5ZA 4Y2AA 4A8MP 1PYOB 1DQAA 4UZBA 4P71A 3PX6A 3M6VA 1VI7A 1JLCB 1RWNB 2ABYA 1BHNA 2U1AA 5K9FA 2XO7A 3R9LA 1U6FA 1Q82T 1XR7A 4M5IA 1RTDA 2C2OB 4I68A 4L3KA 1V5VA 4H54A 4QWDA 2FZCB 1EKRA 4GKKF 4EFAC 3FDSA 4ZPTR 1Y3JA 3G71S 2YKMB 4MIBA 4NWBA 1UJ4A 1SVDA 4FYYB 4U6PA 1JQGA 5HN0A 3BKUA 2NYIA 4MAKA 4FF2A 3GFYA 3PW0A 3G6YA 3GV5B 3KJFB 1JXEA 2DNMA 5DO2A 2J0WA 5EWGA 3QFHA 4H4OA 2FIUA 1U48A 4DX8H 3DDKA 3T9NA 1UA0A 1AFJA 1G6BA 3TUJC 1NZ8A 4F4ZA 4CNYA 2DHXA 2H54B 5LSOA 2PO4A 4DDFA 1TUGB 1XMQF 4FZVA 1RHRB 3L7UA 3OD2A 3MCOA 2JVRA 4DPTA 3IWLA 3CTRA 2BA9A 5B0FA 4UUXA 1VQ6S 2ZJRQ 4DX6A 1BMQB 1SC4B 2AGPA 2LU1A 1X4AA 4WE1A 2ALZA 1JJCB 2G9OA 1P1TA 4CH0S 3OVAA 3RW6A 3DOLB 4Z7CA 4M5LA 5C7PA 3ZTPA 3K17A 3R27A 1N5SA 1OS5A 2ZD1B 4A46A 3P49B 4LF5F 2RF2A 3GIIA 2W2OP 4CM2A 2UUCF 2RQCA 2RHSB 5CD4A 4C4WA 1UTAA 2RNEA 2CDQA 3QT8A 2BKPA 3IGNA 1WSRA 2NCKL 3JSRA 5A0YB 1JIHA 5ETTA 4LSLA 3UQSA 2ZH3A 1QE1B 2XLIA 2FHJD 3BGOP 1YZ6A 4X65F 3CJTA 5LMNJ 1HHQA 2BQRA 5KFHA 2H48B 2J6SA 1JLCA 4J37A 2CQBA 2VKZG 4X2BA 2IRYA 2QZ8A 3V5RA 3AD8C 2VQEJ 4IOCQ 4KR0B 2L9NA 4F04B 3MCNA 1VC6A 5D0RA 2HS0A 3KUHA 4OL8A 1T9VA 2Z2ZA 5ETSA 3OFHA 4IDKB 5I42B 1HNXJ 3IAM9 3B54A 1KP6A 3AOAA 4RW6B 3I4HX 3AOCA 1NK7A 3IBWA 3DGPB 3LALA 2GCFA 3FMBA 3FVYA 4KE5A 5JJBA 5FLXU 3WX4A 1IQTA 3KG0A 2FVQA 3OSNA 1JNRB 3IC1A 1NB7A 4WCEQ 3K5NA 2VBZA 1T0TV 2DNNA 2L48A 2PMHA 1NK5A 3W7BA 3LPYA 2A10A 4ZLLA 4NI2A 2VU5A 4CLUA 2RIJA 4DV1F 1U02A 4I56A 1QLNA 3N5FA 2GFFA 2J9EA 3NG8A 5ETLA 2B9YA 4HTJA 1U1LA 3KTQA 3HJFA 4UT4A 1N32J 2DVIA 4CT9A 3PKMA 2EK6A 4RLEA 3VGTA 5F8IA 4PPZA 1V3ZA 1YG0A 3HMJG 2RQKA 1M5HA 4YB5A 3DOLA 2MKSA 3DFEA 4DV0F 2AJFE 4PPDA 4DV7F 2HNYB 3M9OB 1RT5B 1KSPA 1KLMB 4AUKA 1WSVA 1IUJA 2ZD1A 3Q86A 3FRZA 4FYXB 4TYBA 2FY8A 4OI2A 1RT7A 3CIMA 3OLAA 3W9JA 3E01A 3EXCX 2ZWOA 4P2SA 1BUXA 1YRTA 4LFBJ 3NOGA 2KHCA 3D54A 3QLHB 2FVCA 4USIA 1T9YA 3ENAA 2C3UA 4F7VA 2W4CA 3HXMA 3DN9A 2W4PA 1X4FA 2FGCA 4DUTA 3PJXA 3UCZP 2ZM6J 2NPIA 5A0YA 4JV0A 4NLRA 4NMLA 2G2YA 3M8PB 2ZVIA 1IBKJ 1QE1A 4QJVA 1YSJA 4WP8A 1HNZJ 1FWLA 2OSQA 1UJ5A 4ANEA 4DUYJ 3ITHB 3RBXA 5E3QA 3KYLA 3GJSB 2RT3A 2HS3A 3LF0A 2NZ4A 5D8HB 2E9TA 3UO0A 1DAXA 2E9RX 2OO4A 4WZMA 3EX7B 3H5YA 4IDKA 5I42A 1HYSB 4DU7A 4J9RA 1CG2A 4F3MA 4RW6A 5LOQA 2MQ8A 4PG7A 4A47A 4Z7YA 1SI9A 3T1HF 4LFAF 2C2RA 1B7YB 3DRXA 3EZOA 1L3KA 3M8SA 1KQKA 1X0FA 1SUQB 2Z56B 3RB3A 3UWTA 2DNQA 1X5PA 2MZSA 3G6ES 5FJ4A 4C8NA 3OPKA 3CCWA 3D3CJ 1N48A 3BB5A 3DI6B 3ETMA 3UDVA 2FHMA 2HQCA 1G4CA 2ADBA 2DGUA 2V67A 2QLXA 2AYGA 1IVZA 3OHAA 2BE7D 4AQYF 4O44A 1N34J 1VGYA 2PEHA 2MQOA 4WIIA 1M0SA 2HHTA 1CJUB 4ZJLA 1HMVB 3HFKA 3FEZA 4JI3F 2I6WA 4G6VB 2HHSA 4KO0B 5ETKA 1C0UB 1MN9A 4ED2A 4YEAA 2FD2A 4OIXA 2P6TA 2HNYA 5DGAA 1RT5A 2YNHA 2LKZA 3CCQS 1KLMA 2GQQA 2NUHA 4OYOA 3D4JA 4S0MA 5CYQA 2Z2MA 3FBBA 3CW2C 3TVKA 3J80U 2CG8A 4HEA9 4K8RA 3DM2B 2FYXA 1JLAB 3W2WB 4KRWA 4K4WA 2PFFB 5CQGA 2AYMA 3QLHA 3QYYA 2MZRA 1N6QB 1D1UA 4DR6F 4KT0C 2QE5A 2F4FA 3BJYA 3N01A 1FJGF 2RILA 3A8JA 3M8PA 2JFDA 8ATCB 4IRKA 2PC6A 1E6YB 3ICLA 3ITHA 1HHTP 5K5MA 1QAXA 3DMJB 5HL7Q 3N0VA 2MY7A 4H4MB 5CCLA 1SQEA 2CPFA 1LQ9A 3OBIA 2RKIB 2BKOA 4WFYA 3G8SA 4B9LA 4USMA 2VH7A 1KEKA 3EPGA 1HYSA 2M8DB 4ZPWR 4TY9A 3MPWA 5KFCA 4HHUA 2C3YA 2ZBQA 3WC2A 3GJQB 3VAFA 4C0HA 1JX4A 2D9OA 3HF5A 4Y2CA 2GMLA 5A6WA 3H2UB 1RWUA 3AFGA 2HVIA 3VCDA 1WTFA 2IM2A 4I64A 1X5TA 3GMGA 4WKYA 1SUQA 4CI0B 4DFMA 3OFGA 4DR1F 4P7TA 2DGVA 4ERDA 4F25A 1W2IA 1U1RA 2F4VJ 3BS9A 3R7BB 1N33J 3UD5A 3DI6A 4NCBA 5L8RC 1GTHA 2HS4A 2HFVA 4NLUA 1IBCB 3MI7X 2I8EA 5EX3A 3JTNA 2KVQE 3MCMA 2IC3B 4GMKA 3VAIA 2QX0A 4E0DA 1MLAA 2AQ4A 2E5GA 3AD7C 4ECYA 4QPXA 4ED3A 3VR1A 1X0PA 5T14A 1HMVA 1SC3B 3M32A 4ZCKA 4KO0A 1T3OA 1C0UA 1AW0A 4JI7J 4C11B 3CO9A 4OV6A 1QDUB 2PDAA 3MPUB 1H72C 2NXNA 3TUIC 1WG5A 4WU3A 2C2KB 2EBEA 3ILJA 1NJIT 3MEKA 4IO9Q 1MN7A 3DM2A 4BC7A 5IQQA 4UF4A 1JLAA 3W2WA 3I5BA 3NS5A 2QYGA 4E8UA 3ZNUA 1JJ4A 1UP1A 2HEKA 3IS9B 4A4JA 1N6QA 5KFWA 3RAXA 1D9AA 2LYVA 4MKBA 2E44A 4FS1A 4FYDA 3C15B 3T5JA 1X4EA 3Q83A 3JTOA 1FRHA 3GYNA 1E6YA 1NRKA 1VQLS 1ROFA 1UVIA 3DMJA 2OPPB 3MCSA 3D67A 1E6VB 1M1HA 1FTCA 3CUNA 1Q81T 3DC2A 4C98A 3I87A 2FVRA 2KB2A 1PCAA 1RAFB 2VDIA 1Q79A 1EP4B 4ZVUB 2I2YA 4GRSA 3RGIA 4JV5F 1IKXB 3MTKA
chains in the Genus database with same CATH topology
4ZKAA 2MGZA 2C22A 2HPUA 1Q78A 3CC2S 3SI8A 4UUWA 4XPEA 4UQTA 1TL5A 1I1GA 2PMZD 3UDLA 3THVA 1K0VA 4C3MA 3BQ1A 2MHEA 2XY7A 3N6NA 4GO5X 1HW8A 3HVAA 2IM0A 3V2UC 1FO1A 3E8OA 4EEYA 5L9XA 4DG1A 3UNGC 2J7UA 4EYIB 1MSWD 2FGOA 5EWFA 3HHLD 5KG5A 3TI0A 4JI2F 2CPYA 2AJQA 3AB2B 5CHCB 4ES2A 5KFXA 4NA2A 2Q6CA 4R0EA 1CQNA 4X4QA 2KH9A 3M8RA 1ZM2A 3ZC4A 3UR0A 4ED8A 3SFGA 5CA5A 1NK8A 5F8GA 2QSWA 3N9UC 5IWAF 4DV4F 2AYBA 4PQAA 1CLFA 4KJIA 1OPIA 1UEVA 3BSAA 3W2VB 3C46A 2COLA 4N56A 2OSRA 1KOHA 3LOUA 4MIWA 3SCJE 3DRPB 5A8KB 3QMQA 2N4CA 2HNDB 3HKZD 2MKIA 3KLIA 2CVIA 5EDWA 3U02A 2R9LA 4IQXA 5E3RA 2C3MA 1TZ0A 5E5NA 2DIVA 3OXGA 3IR5B 1C4AA 2RDJA 2CQ0A 4FXWA 4HTIA 2MZTA 1OQ6A 5KFRA 5HBMB 3MUTP 1HBNB 1RYSA 2BANA 2ZOGA 2QO3A 4NLXA 5F0UA 3PIPQ 1X4HA 1HD0A 3QO9B 2I5JB 4IH7A 2DO0A 4PCQA 3V81A 3K8VA 3MEDB 1SJ4P 3MTJA 3LP0B 3M4XA 1VLYA 1FVQA 2DGXA 2IC3A 3NLCA 4QW9A 5J2QA 4ZVFA 2NXUA 1VOMA 3OTBA 2MHNA 3TA0A 1X9SA 2VOPA 2OAUA 3MM8B 2EG2A 5LMNF 3MR5A 2XMUA 1YJVA 2RMLA 2XWXA 4O3PA 2KO1A 3PFEA 2GHPA 2HMIB 3RRKA 4B3TF 4UY8T 2YKNB 2RH3A 1TL3B 4O0IA 1ZM3A 4H4OB 1Z1ZA 3I31A 3F44A 1FNOA 1X9MA 1TV6B 2E5JA 4XAKA 2JH3A 1S6OA 4B17A 1QAJA 4C9DA 5GAGI 3W3SA 3HLUA 2PI5A 4Q43A 1RTIB 4OI6A 2Q66A 1LW0A 4J9SA 2Z0GA 4MK9A 2W7PA 2V4QA 2ZH5A 2VQEF 2YH1A 4K59A 5EX0A 3HVRA 2YH0A 4OLPA 2I0XA 1YBAA 4RUHA 2WSFC 2FTRA 5MAOA 2MZQA 3NNCA 1KONA 4QR1A 2ZC4A 4N76A 2PN6A 3RR8A 3PX4A 1DTTA 1FNMA 5IT4A 4ED0A 1FD2A 1FDNA 2ZOMA 4A8XA 2EFOA 5GAHU 2Y1IA 1L3TA 2XMWA 4U7UK 1VQ9S 2Z8QA 2GQ2A 4RBUA 3PDNA 4F4YA 2ATLA 3CDAA 4BHQA 1HNXF 2UU9F 3LP1B 3WBZA 2F8MA 2ILZA 1U8SA 2UVRA 3ZZOA 3SCLE 3VQSA 4K4UA 2BABA 2R2SA 1X4DA 5GADU 2UXDF 1WEYA 3CJ2A 4I2QA 2KN4A 2W9BB 3DGPA 2F9DA 2ZKTA 4C7QA 2X3GA 1FDBA 1PSDA 2QA1A 5B0AA 5F8HA 3D2WA 1JLFA 1X5OA 1U4BA 2KG1A 4EU0A 2NSBA 3RRGA 3IWNC 1ZPVA 5HROA 1QM9A 3CD5A 2QA2A 1UW4A 3QIPA 1DFDA 4JI6F 2FHOB 1H2TZ 3KHGA 1GAOA 4ECSA 3A8EA 4NYOA 2ZBCA 5L1JA 1C0TB 4QWBA 2XB2D 2M8HA 3F73A 1WTBA 1L5UA 1IJFB 1N5VA 3CCJS 1S1UB 4IYQA 2Q6BA 3R5CA 1V6HA 2D1CA 4RKUC 2VPZB 3T9ZA 4CIOA 1T05B 1U09A 1KC8T 1REVB 1C2PA 1OIAA 2HNZB 5DGBA 2PT0A 1S10A 2CQDA 3KLGA 1W25A 1IKVB 4O3QA 3G6XA 5KFOA 1HNIA 4LSNA 5KG1A 1UVNA 4ALZA 3MPYA 3MUMP 3PX0A 1FCAA 1F5BA 4BBYA 1RYRA 2NLWA 2E1CA 3MECB 5M2RA 2J9CA 1DTQB 3X3UA 4DQRA 4LF7F 4XK8C 1O0PA 1TP7A 2DH9A 2J7WA 3CDWA 2OPPA 4B9VA 2EWHA 4PXCA 4X4OA 3BDEA 4BDPA 5KFEA 3BR9A 2J76E 3HHKA 4JYAF 3TP2A 2N7YA 2FC8A 1U1OA 2GO9A 4Q5VA 2E5HA 5LT5A 2R8GA 1NH7A 2MQMA 2OMOA 1KS2A 2GIQA 1KQGB 3PEJA 3DLGB 4RWXA 4URQU 4AL7A 1KFDA 2NR0A 1SL2A 4IG3B 4WFAQ 4Q0BB 2RVJA 1RDRA 5IQ6A 1SJQA 3M30B 1PGZA 2XS5A 4LVOP 1TAUA 1FT8A 1FERA 5D78A 3MMCB 5J1EB 3WZ0A 4TYAA 1FXDA 1X4CA 3DXSX 5F3ZA 4TY8B 1N5YA 1KRPA 1EP4A 2EFNA 4EBEA 1J2VA 1NK0A 3RAQA 4LQ9A 3KHLA 3G4SS 2LEPA 5LSLA 5J1NA 2SXLA 2AYEA 2AX1A 1MWYA 1URRA 3HHLC 4NX9A 4C0OC 2XCAA 1KQFB 3BO4A 1Q7YT 4K5RA 5CYJA 1YJWS 2G4BA 1BWEA 3KNGA 2BYCA 3M2UA 4WU2A 1IKXA 2VA3A 3NAIA 4RNMA 3HZEA 1GNKA 4ZS6A 4YUDA 1XBWA 3CEDA 2HQ3A 5KAKA 4QCLA 3CF5Q 4I6YA 2D3UA 4NXNF 4J9MA 4ZA1A 2UXBF 3PFOA 4LSLB 3Q0AA 1ELOA 4YMEA 4FNIA 5E2QA 5EHHA 1RA7A 2GMHA 3BGUA 4N5SA 3KLHB 1SL1A 3T6JA 2B6AB 2VC1A 4XO0A 4HDHA 2RUGA 5B0CA 2VD3A 4RUCA 3BGRA 3VWSA 3CJ3A 2LLZA 1WG1A 1S6QB 2GIRA 2PD1A 2BUNA 4USHA 2GA7A 3OL7A 3PZPA 2OTLS 1MMNA 1NEEA 3CULA 4C8OA 2AGOA 1K9MT 1TL4A 4DV3F 1B7FA 4RZRA 1WEXA 5KFAA 2J6TA 1HFEL 2JC0A 4DL0C 3W2VA 4V19X 1CPZA 1XEZA 4LQ3A 2HWTA 2B0GA 2O66A 3ULHA 1BQNB 2YX4A 3R5AA 4KFBA 2VFRA 3DRPA 4LIWA 5A8KA 1O5JA 3BDPA 2HNDA 4I4BA 3RW7A 1VQ4S 2RQMA 1KFSA 4NXMF 3PW2A 1HQUB 3DRSA 2HGLA 4Y2MA 1HWKA 2FJEB 4B08A 1G2EA 4V19J 1VBXA 5CCMA 3KLFB 2RJZA 5HBMA 2CRLA 3EGNA 4CH7A 3MUVP 1HBNA 3MAHA 1AROP 3MFHA 3H59A 2IMWP 2O3DA 2CPHA 3QO9A 3OVBA 2JEIA 3QAEA 1U1QA 3NNAA 2C42A 4ZPAA 3MEDA 5F8JA 2WCXA 4WF9Q 3LP0A 2DITA 4PKDB 2X1AA 3I0RB 3HM9A 1IBKF 4OJGA 5C42A 2FB0A 2DNZA 1U45A 3MM8A 1JLEA 2EVZA 1R27B 2DGOA 4N77A 3THTA 3MR3A 3K57A 1DJ0A 2VFTA 2YKNA 3K5MA 5IM0B 1TL3A 3MM9B 4OZJA 4IRCA 1RT3A 2N3OA 2UVWA 4DUYF 1TVRB 5GAHI 1TV6A 4NCAA 3AAWB 2VV5A 2O01C 2DO4A 4QIEA 4NLVA 4WJBA 2B3TB 1RTIA 2CZ4A 2VBYA 2QLWA 2RQ4A 4QYRA 1Y7PA 5I4MA 4OX8A 1FE0A 2CKWA 2YWFA 5HI7A 3NRBA 4JUZA 1Q4RA 3LP2B 2KI2A 2FJAB 3OQ2A 2WSEC 4CTAB 3JYTB 4R0JA 3MD3A 4DN0A 1KLNA 1MWZA 1S48A 1I6JA 3DDNA 2V2KA 1N36F 2AD9A 3ETOA 5HO4A 4QOTA 4AXJA 4R5PA 2E1MC 2LXFA 4C8LA 4LF9F 2FDNA 2LECA 1QAYA 3PVXA 4RU2A 1XNQF 3IAS9 2M7SA 3MM5B 1U25A 4R25A 2OPSB 4KKOA 2EFPA 1ZBTA 3LP1A 4J9QA 3LQVA 1Y0HA 1M1KT 3TRGA 1Y3KA 4NLWA 1WF0A 2HQIA 4I2PB 2ASJA 4F8RA 2AU0A 3M6XA 4TU9A 5HP1A 3DHWC 2IHR1 1T94A 1S0MA 4DSJA 2DISA 3GV8B 5BR8F 2MDAA 2HHHF 1BGXT 1S79A 4YB1P 2W9BA 2HHVA 2YKPA 4JI0F 1RT6A 2XEXA 3OXLA 1GH8A 2IA0A 1V3SA 1WHVA 1D9FA 2DNPA 1B0TA 3LH2S 5A8RB 2YNGB 4FBUA 1NK4A 4JV2A 4FF3A 2BV3A 2B9WA 3KWMA 1JB0C 1JKHA 1TAQA 3ENVA 3T6BA 4PXBA 1VQOS 5KFJA 4X4NA 3P3DA 1SKSA 4F2RA 2B4OA 3OR2B 5B0GA 2O5DA 1C0TA 4NZ7A 4ILLA 2XMTA 5F41A 3B8HA 1FD8A 2WW8A 2R7UA 2MQQA 2B7CB 3HVTB 4XDCA 3MZIA 1HPZB 4G3IA 2EW9A 4Q45A 1S1UA 2KTQA 3IXQA 5KFYA 2V8GA 2UVUA 1YQHA 2G13A 1T05A 5AJ3F 3QGPA 1S0OA 1REVA 2HNZA 3K5LA 3OV7A 1QJHA 3PIOQ 1HD1A 5K14B 1IKVA 4QIVA 4OI1A 1L3VA 4NLPA 1ZTWA 3GZ7A 3CCLS 3EZUA 1NJYA 1F2GA 1UL3A 2LCWA 2XI2A 5E33A 3QZ7A 3TR5A 4O4RA 2HRYA 3PRBA 5DQGA 3PKYA 3MECA 4EYHB 2OTJS 1DTQA 2J7KA 2NSCA 4X4VA 2R7WA 2FJXA 1SV5B 1FEHA 1YJTA 2OFHX 4QW8A 1GQEA 2BM1A 4RW4B 1U6ZA 2DCUB 1FKAF 2KYZA 1RTJB 4Q44A 2LXIA 2XCPA 4DL7A 3ZFVA 4W92B 5DM6Q 1SKRA 2VODA 1S9EB 4NLOA 1MMDA 2NREA 3SCIE 1RT7B 4J9LA 2BXJA 3KK1B 2BR0A 1H2UX 1UVKA 2HZCA 2KT3A 4BWJA 2R4FA 3DLGA 2DRBA 2PI4A 3E01B 2IA6A 4ZPDA 5EGYA 2KFNA 4IG3A 4ZMMA 2IYIA 3CD0A 3M30A 3JB9k 1WHWA 1V3RA 5F9NA 4ICLB 3IRWP 2EPIA 5KG6A 2BQUA 5JXSA 4I7FA 4YB6A 2E66A 5IT0A 3JTPA 2JDJA 3O3LA 1N34F 2AW0A 2WSCC 3I55S 5E41A 5J1EA 4RW8B 2Q1LA 3PW4A 2EG1A 1O8BA 2HLUA 4BWMA 2LVWA 5C5JA 4TY8A 2R8KA 1HQEB 3DLHA 4YQWA 1U2FA 5J2MA 6FD1A 2DR8A 1IM4A 2ZITA 1R89A 5KFGA 3GIMA 2CZVC 1Q1KA 4QIGA 2W9CB 1MU2B 5D4NA 1BQMA 2KG0A 4U9RA 2BRLA 4I1TA 3TO8A 2V4JA 4HT7A 2UV8A 1VK3A 4DV5F 4J9PA 1FK9B 1N0VC 3J80Y 4ED1A 2OH2A 4DQQA 4FVCA 3AY0A 3QGGA 4C3KA 1H7XA 1F60B 2K2PA 3MHYA 3QGIA 4ZPBA 4OJ1A 2HLTA 3KLHA 3CCVS 2GNKA 4MJKA 2CPJA 2BBEA 4M94A 3ZZYA 3MWBA 4NLDA 1R31A 2DH7A 3KOAA 3GWCA 1S1XB 2H5EA 4MFBB 1Y9OA 5GAGU 4RNFA 4NLGA 4PWDB 4X4UA 1S6QA 1A6LA 2ZH9A 1HI1A 3TAQA 4ED7A 4ZCIA 2EI5A 1YIJS 5FD1A 4AYBD 3KLEA 1QY7A 1MW7A 2DB1A 3LANA 4TNOA 3Q8QB 3MPVA 1SJRA 1UWBA 4ZDNA 2D74B 3R1HA 1Z4UA 2IBOA 4FN5A 1XWLA 3S1TA 4K4YA 3UI3A 4N47A 2J6UA 1Y00A 1ZAVA 4L3NA 2RD5C 4IRDA 1YRUA 2GX8A 3PO5A 4B9NA 2UUAF 1HQUA 2B56A 4H4KA 4IKAA 4Y0FA 2X1FA 3RZAA 1SB6A 1SIZA 2VFVA 3C8YA 3UR3C 3CMES 2MYFA 1RJJA 4XIUA 2BZ2A 4RBVA 3JSBA 2IFXA 3POTB 5D4PA 3C2PA 4ZOSA 2MSTA 5KFUA 1IQZA 1L3UA 1JJ2R 1SH0A 3MMJA 3TA2A 1C1CB 3BR8A 4C0BA 4YR2A 1M5PC 5J2NB 1U47A 5KT7A 1WACA 2W4DA 3BSCA 4WK3A 5AXLA 2NQPA 5F8MA 5KFTA 2VBXA 5IS2A 4TU7A 2A1BA 1FRMA 3N6MA 1KVJA 3G96A 2XLKA 1VBZA 3NWGA 4KSEB 2CJBA 3I0RA 3SSSA 2V9KA 1XN9A 1BD6A 4OX6A 3G8TA 4A8FA 2L3MA 2I38A 2V94A 3QPIA 4HDGA 2XSJB 1FF2A 4F50A 4I0WA 1S1WB 2DHSA 4DF4A 3MXHP 4F3QA 2POKA 2NUUG 3CCTA 2JVOA 2EFGA 3CPWR 5IM0A 1D0EA 3MM9A 3KJVB 2X1BA 4PG4A 2Y1RI 4LF8F 4ED6A 5HMXA 2CPXA 3ENQA 4KAIA 4RW7A 3DOKB 2DNLA 5KFNA 4Z2XA 4LT6A 2ZH2A 3H5SA 5T7LB 4O23A 3C3LA 4YOEA 2M88A 4CTAA 3LP2A 3HDSA 3Q2SC 4H4MA 3SSQA 3JYTA 2VASA 2HVHA 3SDEB 4G1QB 4DQPA 5HMWA 3AB4B 1UEUA 4KGKA 4IFVB 4ED5A 4M8LA 4H4KC 4A8OA 5EWEA 2R8JA 2UP1A 4JI1F 3MMAB 3QWUA 2FLLA 2Z2LA 2RKIA 2B43A 1XC9A 4X4RA 4B9SA 4QU6A 1X4BA 2Z4PA 1KQSR 2OPSA 5KG0A 3H8YA 3TUZC 5KFBA 4X4TA 3GFXA 4J5OA 2UUTA 2MMYA 3H2VE 4I2PA 1HBMB 1PC4A 1D8ZA 2A2DA 2R7SA 4F02A 4DR5F 1HBOB 2ILYA 3PO4A 5KG7A 2XY5A 3WC0A 4ETXA 2GMJA 2F9JA 5D3GB 3Q8SB 1APSA 2DNKA 3E3XA 3NAHA 4KPYA 1CVJA 5E3PA 3I5CA 1M5VC 1LFPA 2D7SA 1ZZFA 2BM0A 5KFKA 1FRJA 1U1NA 1U1PA 3PY8A 4TXSA 5I3PA 2YNGA 1NKEA 3M1VB 5I3UA 2B9XA 1LWFB 3TAMB 5CZVA 3BQ0A 2CJQA 4O44B 1Y4ZB 3MR2A 3OR2A 1YI2S 1FJEB 5F3TA 5L1KA 1UKUA 5HLFB 2EBGA 1RISA 5DJBA 4K4TA 4DQIA 4DJBA 5E3CA 3H20A 3HVTA 3TX8A 4NPOA 2YWHA 3SEOA 3HPOA 3BQ2A 2FHJA 1WWHA 4RX6A 2ZDPA 2RRNA 4ZVHA 5U47A 4O3NA 4RNHA 4C3LA 4ETZA 5KFPA 3GILA 4PG8A 1S9FA 2IAJB 1WF2A 4DF8A 1FDAA 3KMSA 3LAMA 2CQIA 3CCZA 1KHVA 2KM8B 1X4GA 4TLRA 3J81Y 3CDUA 1RTDB 2QRRA 3FQLA 2QSFA 4URSA 4Q8EA 1OPZA 1VRUB 4FXDA 1D3WA 2GW8A 2M5YA 2HFOA 3MM7B 4NYZA 3PR5B 3GQCA 4AL6A 1N33F 1KNZA 4PG6A 2YNHB 3M6UA 2OFGX 4DHVA 3D0GE 4QIFA 3GB0A 4RW4A 2CPEA 4IFYB 4MYTA 1HARA 3R5BA 4CO3A 4F4KA 3H5UA 3B78A 1DZ5A 4N41A 3QJPA 1QVGR 1JNZB 2YWGA 5CYQB 1AFIA 2I1RA 1S9EA 3D0IE 2MQLA 2KHDA 5F9LA