2FHJD

Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
296
structure length
295
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Transferase
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
total genus 82
structure length 295
sequence length 296
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2005-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
D PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhjD01
1M5HA 2FHJD 1FTRA 2FHKA 2FHJA 1M5SA
chains in the Genus database with same CATH superfamily
4RW4A 2V2VA 2VFRA 1N5SA 2YX1A 4BC9A 3GJSB 1GMWA 2XZTB 3B6BA 3ENVA 3MMCA 1WKJA 3D9BA 4HT5A 5J2PA 2MYFA 1MLAA 1ZA2B 4N47A 2QA4S 2HHSA 4J9RA 1KSPA 3FSXA 3TUJC 5IV3A 1S6QB 5KFPA 1X4FA 3K17A 1FERA 4AXIA 3GZ7A 4WKYA 3EDQB 3CWJA 2VZ9A 3W61A 2HMIB 2DR5A 4WXOA 2WSFC 1L3KA 2IA6A 3NNCA 2RRNA 1H6KX 4ZP7A 5LMUF 4ETZA 5HO4A 2ZBPA 1ZAVA 2HG4A 1HNXJ 2Y0BB 3VV2B 3QRRA 4ALZA 3T9ZA 1JLCB 2HVZA 2G2OA 1B7YB 4HLBA 2F4FA 2O5DA 4U96A 2LU1A 3I31A 1FRHA 3P6YC 3T1HF 3KOAA 4P75A 4JOUA 2RE1A 5C2GA 2X1GA 2GIRA 1R31A 3CCRS 2J8SA 1F60B 2DISA 1M1KT 4NYOA 1JJ2R 2DO0A 1NSKL 1PILA 1HD0A 2KVIA 4K8RA 4KIAA 1RQ0A 4V19J 3NNAA 1OYDA 3J81U 2XC9A 1HNXF 2KN4A 3QATA 4LRFA 2WSCC 4USIA 1F6TA 2AJ2A 1PJ6A 4ZCMA 4FXVA 2MKCA 4WFAQ 4Y2MA 3J81Y 4LF6J 4OYZA 2E1PA 1HKAA 3LAKA 3UCGA 1C4AA 3C6UB 1EIYB 4LSNB 2YKQA 1ZBTA 2N4CA 4LRAA 4U95A 3ITHA 3U7JA 2Z30B 3POTA 1JJ4A 2HQ3A 2M0GB 2IM1A 3BH7B 5L1JA 1R6YA 4CWBA 4CM0A 3FMBA 3W9HA 5H9EJ 3IRWP 2RRBA 3CF5Q 4QZVB 2HSEB 5ITHA 4M5LA 3MM7B 4URSA 4F4KA 3DLBA 1N6QA 3KFWX 3RAMA 2LXUA 4HEA9 4HH0A 2X1AA 1RLDA 3CJSA 3GP9A 3IS9B 1R8PA 5HMWA 1DQ8A 2XZDB 2R7WA 3MMCB 1U25A 4FPRA 2UU9J 3G82A 3UE2A 3IO1A 3QFHA 2BZ2A 2J9DE 5DG9A 5BR8J 2HWTA 2J8AA 4B3MJ 3HJFA 4CO3A 3BJYA 4I67A 3WDOA 1AUSL 1U6BA 1RP5A 4WE1B 1SUQB 5FDLB 1KS2A 2FGCA 3R8YA 1VISA 2G0IA 3NCQA 4EK2A 3D54A 3S1TA 2BQ3A 2XCAA 4DV3J 2LU2A 1I1GA 3L7OA 1UWAA 3A8IA 1SCJB 4DR4F 2N3LA 1NJIT 2EFQA 4O23A 4O0IA 2B4UA 1VQ5S 2UVVA 1FKPA 2U2FA 3FNNA 1SJ4P 4XAKA 4USHA 2VQFJ 2HQGA 1RU1A 2AQ4A 5FJ4A 1X9SA 2VBXA 5IT0A 3MPYA 4ZHRB 3ZZUA 1UPPA 1NK0A 4IQXA 4KTQA 4XPEA 5GAGU 5A6PA 2YNHB 3UD5A 3ZZ0A 2XMWA 3HSZA 4WYWA 5I4MA 1MG7A 1U1KA 4Q45A 1JIHA 4F7VA 2LQ5A 2YNHA 3WX8A 3K5NA 5J2QB 2XTJP 3PW0A 3CEDA 4PWUA 2VIHA 1L5UA 4PQUB 1J5OA 2M8HA 1K73T 4ED7A 4USUA 4PWDB 2HFNA 3W5ZA 4DU8A 3D3BJ 1SB6A 4J9UE 4PXDA 1CS4B 3IAM9 1FE4A 4TYBA 5KFTA 4P10A 1JNRB 1HNIA 1RT2A 1YQHA 2PSZA 2QTWA 3QSYB 4LFCF 2OO4A 3HX9A 1HD1A 4C8MA 1W26A 5J2PB 2FUG9 2XB2D 1SPBP 3QJPA 3I6PA 4DR6F 2CPJA 5B0AA 4A46A 2V4JA 1BWVA 2XY7A 1XMOJ 1U47A 3BREA 1FK9A 2GX8A 2YVSA 3M30A 3TVZA 4AUKA 1TL3A 3UN2A 4RW6A 1HPZA 2IPOB 3B4DA 3W2VB 2ERRA 2IAJB 4HH1A 2GJFA 1G1XA 3P96A 1SC1B 1R7IA 1WF1A 4LRBA 4F67A 1F3VA 4K4ZA 2LQ8A 5H9FJ 3ZTRA 1XNQJ 1S1XA 1RI7A 2IAJA 5JJBA 4JI3F 1M5SA 3BGOP 2FVCA 1TL3B 1NEEA 2ROPA 1SV5A 4QIGA 2VODA 1M5HA 2J76E 4NE9C 2VKZG 4X4PA 5ETKA 1RYRA 1RTIA 2HFVA 1YWXA 2M2BA 4YR0A 4DR3F 4C8OA 2P8IA 5HMYA 4DG1B 1QAXA 3FRZA 4OIXA 4WTYA 2XGPA 4JI8J 4TY8B 4HTJA 3KMSA 1NNDA 4LBPA 3JXOA 1X31C 5HATA 4EEYA 1WG4A 4K5RA 4FS2A 4OI0A 4KGKA 4PYAA 3QT8A 7FD1A 4OZLA 1XC9A 1FVQA 4URQU 2L3MA 2FIUA 1RWNB 4CO2A 3HFZB 3M8QB 4DV2J 4NLTA 2YWHA 4PR6A 5A6WA 3JTPA 3MR7A 4QR2A 3T9NA 3ZFVA 3W8PA 4CQ1A 4IYQA 1VQ7S 2W9CB 2UUCJ 1VRQC 1WELA 3CCMS 3CCVS 1FDNA 3U1MA 2IBOA 2KJWA 2RB7A 2C2DA 2KDOA 4WZMA 1RBAA 3MEGB 4MYUA 4M5IA 4A8XA 1LNQA 2HBQB 1OSDA 2PMZD 3TAMB 2DPJA 2K2PA 4RW9B 1B0PA 4PKDB 2HRTA 4KH0B 2ZBCA 5C25B 3R7NB 2NUHA 3HVAA 1YITS 3FUYA 1FHTA 2H3EB 1RGVA 1U24A 4IG0A 3PXGa 1NH8A 2DK2A 2YQ1A 2HGMA 5ETMA 2MZQA 2EFOA 5D4OA 2ZH4A 1CC7A 3V5RA 1HL6A 2FVRA 4B3SF 3RW6A 2HHWA 1LWXA 1ACMB 3HPOA 2MLZA 1CJUA 5LMNJ 2YKOA 2ILZA 3EX7B 2VPYB 4ECZA 4JI4F 3V4IB 3NL0A 2HNYB 2QFJA 3J7A1 1BY9A 3AXMA 4K50A 3W2WA 3VF0B 4ES2A 2LQJA 3M4XA 4H4MB 3WX4A 4CT8A 1LW0A 2VJVA 4PG6A 1YRXA 3CSKA 4Q2MA 4TY9A 4EYHB 3V6DA 2JRSA 2HEKA 4HL9A 1U1MA 3R5DA 1LFWA 1D3WA 1HYSB 2NSBA 3FBEA 2BW2A 3NGTA 3KG0A 3QPIA 3MAQA 4LFBJ 4OI4A 1FKOA 2MHEA 2V2KA 1R8HA 2R42A 1HHQA 2WONB 3ETMA 5JXSA 2W8LA 3GIIA 3THTA 1OSCA 4YY3F 3D7SB 4B9MA 3UPFA 3E2EA 1UWBA 2ACMA 1ZETA 4RU9A 4OYOA 4P2FA 2AYBA 2GV1A 3CJKB 2R7UA 2C2MB 1GFWB 2DNPA 2UV8G 1JLQA 3C16A 3IWNC 3BQ0A 2WONA 1HBNB 1LWCA 5KG2A 1VBXA 1RT6A 3KLHB 4E2FB 2J6SA 2XMUA 1F5AA 2RDJA 1JXVA 2UP1A 2G2ZA 3HVTB 1N5QA 1VRUA 1SKWA 4UUWA 1MU2A 5CXTA 1GTEA 3FZ2A 5DM6Q 5ETTA 4CRJA 4YY3J 3TOQA 2DY1A 1TL1B 4PEOA 1U1QA 3SMZA 5IM0A 1X9MA 2B8PA 4JI6J 3TJAA 4ED1A 5F8GA 4NLSA 2JNJA 2MKHA 5CCLA 1KRPA 3UDEA 5IZHA 1N48A 3WBZA 3MF5A 3WZ0A 2OEMA 3US5A 4KPCA 5IOLA 1K0VA 1BQMB 3BSCA 2RMLA 4M5NA 2B51A 4Y34A 5C42A 4ZITA 3GYXB 3Q2SC 1S1WA 1UMJA 4HI2A 3ISND 2J0WA 1NLKL 1S99A 1SIZA 2NXCA 4YR3A 5HP1A 3J7AN 4GKKJ 2EI5A 2V8VA 1HHSA 3A3PB 4RUBA 1B7FA 2QLWA 2PT0A 1T9VA 1VRTB 4JI6F 4ZP9A 2MEWA 3GIMA 1TAQA 5DGBA 1RT7B 4ED8A 2W9BB 4B3OA 2GHPA 5I42B 4KBIA 4I2PA 4TN2A 5CZVA 4OYIA 2YWEA 4N7TA 5GADI 4NOHA 1NMEB 2AEFA 4QOTA 3T1YJ 5ADZA 3OLAA 2ROEA 4DQSA 3OV7A 2W7PA 1VQ6S 3KK3B 1UEVA 3KK2A 2HURA 8AT1B 1P6TA 2NUUG 4G1PA 1C0UA 1WSRA 4RLEA 1QAJA 4CLLA 3DRXA 3UW1A 2Y3YA 2OIHA 1H3DA 4PPDA 4C8NA 2QSFA 2LECA 3BV8A 3KUHA 5KG3A 1JLBA 3EVOA 3T5KA 4B9UA 4OJHA 3BDEA 3QAEA 5FIIA 5KTQA 1RT3A 4MT1A 5K8MA 5DDOC 2JEFA 2VPWB 3CCQS 3M8WA 5A0YB 2VJUA 1LKZA 2V68A 2BQRA 1U1NA 4IDKB 1Y0HA 5C24A 3LP0A 4OZ3A 2GIQA 4UF4A 3VR1A 4CO5A 4YMEA 2HFZA 3LWMA 1Y7PA 2MZRA 1B0TA 4LR8A 3QQCD 2KFYA 2EWHA 3VVUA 1JLBB 3DOKA 2CJXB 4ID5B 1KOHA 1OMSA 2B7CB 1RWOB 2V8HA 4B08A 5DGAA 3I9ZA 3KLIB 2VH7A 3PYDA 3R27A 4ATNA 3G82B 1JKHB 3K5PA 3IN5A 2XNQA 4MIWA 1KN6A 2ASLA 2PMWA 4O4GB 3ZC4A 3IRXB 2GVZA 1ZS6A 5D4NA 2B0GA 2RKIA 1HI1A 3DOLA 3KNGA 3DMJA 3QIDA 1Y5IB 4FDFA 4UQGA 3DLGA 2G1HA 2KH9A 4HVZA 2NSCA 4C4WA 4B3TJ 2E44A 4M5KA 2WSEC 4PPZA 1FKAF 1CLFA 5D0GA 1RT5A 2K1RB 1HNWF 2BR0A 1RHJB 1BC6A 2MPUA 1FT8A 2YWKA 2VQFF 3M6UA 3WQPA 2Y1JA 2V8PA 3Q86A 3PNIA 5D0RA 1N36J 3V4MA 3BM7A 2D69A 2V94A 3V4IA 1RTJA 4NI2B 1FXLA 3QZ8A 3BEGB 4HDGA 3RYLA 3T5JA 2ZUAA 3TZZA 5DQGA 3QLHB 1HMVA 4YFUA 3KYLA 2VPZB 3DM2B 1NZAA 1VLOA 1Q82T 3NWGA 1TKZA 1WC5A 1WF0A 2H65B 2JZ5A 4OZ1A 2HS3A 4A48A 4F0KA 1N5YB 3IWXA 3GSIA 2OEJA 4M5DB 4P7VA 4A8KA 2ADBA 3B82A 3G71S 1TTHB 2W2NP 4DUYF 5LSOA 4MK9A 2E7XA 2O1PA 2OKQA 2ZD1A 3TAMA 3P3DA 1FDBA 2DHXA 3N6LA 1RTJB 2MKYA 2VFVA 2XYHB 2DHHA 3JS9A 2COLA 1VHIA 2ZBIA 4NXNJ 4K4SA 3PX6A 2UXBF 1T3OA 2A1BA 4H4OB 3PIPQ 3RB4A 4OZ0A 1XMQJ 1JMTA 5GMDA 2DTJA 5J1NA 2WW8A 3AY0A 5KG5A 5SZTA 3C66A 1BUXA 2VHGA 5L1IA 2MB0B 3UDVA 3JQMA 3M32A 2OMLA 4GRSA 2RKIB 1R0CB 2YWWA 3DOLB 3WIVA 2W9AA 1T9UA 4O44B 3Q8RB 3MCNA 2OPPA 3UR3C 4I69A 2AJQA 4DV2F 3J7YU 1J2VA 1LW0B 1TMJA 2AJ0A 1EARA 2CNLB 3CGIA 3M1VB 4RW4B 4UQTA 1RISA 4X65J 1H74A 3M30B 4UOFA 5J2NA 2PA3A 4X66F 4P74A 1TL4A 3C6UA 1YBAA 3C8YA 1C2PA 3QSIA 1SBRA 3TEGA 2HAIA 3KLGA 2KG1A 4WU3A 1GAOA 3BF4A 4QWDA 3QYYA 2CPEA 2CZVC 3BBFA 1KFSA 3MAAA 3M2RB 3VAMA 4CCHA 2J9DA 2DGUA 3RGIA 1SXLA 5KFUA 3AT1B 4DL5A 2N7YA 3QJLA 3O6QA 3JB9k 1RDRA 2YNFA 3PFEA 3NNHA 2HZVA 1VK8A 3DKDA 4NMLA 1NDPA 4A4JA 2H4WB 1WC1A 2B3TB 4Y0FA 4F4AA 1OS5A 1Y10A 1UKUA 4QWEA 2AZ3A 2VBWA 4Y28C 2F8EX 2QYCA 2R7QA 1SC4B 1JK9B 3F56A 5EUHA 5F9NA 3TW0A 1V5VA 1Y4ZB 2AJ1A 4LREA 1J27A 1U1RA 3GV8B 3KUGA 3ZZRA 1TU0B 3BDPA 1BWEA 1F9EB 2E5JA 4TQRA 2Z0GA 2XNRA 3CNQP 2ZWOA 5KFKA 2OLWA 2L41A 4X4VA 5E3PA 5HQLA 2V9WA 1WTBA 4A8OA 2FLPA 1UVNA 1TKXB 5EX3A 5B0EA 5IC4B 4ZPTR 3LPEA 5K14B 3W1YC 4ES3A 5EHHA 2Y9HA 3KDNA 4USJC 1R0AA 1CVJA 3ZNUA 2KRRA 3K58A 2HZCA 1R8BA 4OV1A 2C3UA 2DNGA 2ZDOA 1Q79A 3AQOA 3DHXA 1KWMA 5C42B 1KDNA 1LWEA 1RBOB 1VBKA 4X4QA 2ZZMA 5ETPA 4WFZA 1LXJA 4ZVSB 4RNOA 4MKVA 4C11A 4KPYA 2CZ9A 3GQCA 4J91A 4YDXA 2RUGA 1K44A 2R8JA 1VC6A 3M1VA 3T6JA 3A8KA 5FLXU 1R3NA 1BQNB 3BN4A 4K0KJ 4M1KA 3GWCA 3S8SA 5MLCV 3I5CA 1EHWA 2D9OA 5F3ZA 4L3KA 1RKIA 2KM8B 1RTDB 4FF2A 5D4PA 3CJTA 1RT6B 1MWYA 2PN6A 2JEIA 2MSTA 1X9WA 3HKZD 3M8ZA 4LVNP 4PG7A 3J7YI 1RLCL 4DJBA 4DPOA 5KFNA 2E9RX 1X0PA 2CPHA 4DL0C 4JB8B 3CJ8A 5HROA 4X4OA 3PM9A 3HMJG 2FC9A 3OVSA 1SL0A 1YJ9S 1TR0A 2UXCF 4CLUA 1XQIA 1Y5NB 2F65A 3QIPA 2ROGA 3V2UC 2ZHBA 4JV1A 2E5IA 3A8EA 5LOQA 3CCUS 1F2GA 4QPTA 1R89A 4AL6A 2KKHA 2VICA 2CJQA 5E0OA 4ZDNA 4YR2A 3NY0A 4F4WA 1PYSB 3TA0A 3MEKA 2HZAA 4WPAA 2MY8A 2AJFE 1NSQA 2MMYA 1B99A 3DYAA 2CQPA 2EW9A 4DUZJ 1XK8A 4P2MA 5IC6B 1RWWB 3LO3A 5CAAA 3PJ9A 2DD8S 1HW8A 2Q3PA 2CPXA 2ZITA 2Z4PA 2ASDA 4C8KA 4J9NA 2R8GA 5AXLA 1GXLA 3ISZA 3CMAS 2CQBA 2YKMA 2F8MA 1RAHB 2YKNB 3MMAA 2MZTA 4PQAA 3N5BA 5AJ3J 1YJTA 1LOUA 3K7RA 1HNZF 2C22A 3W66A 3LF0A 4PWWA 3E3XA 2BKOA 3TO8A 1AFJA 3DGPB 1IM4A 3H5SA 4O4GA 1FD2A 2KM8C 1XR5A 5F41A 2G1DA 4DL7A 1GXTA 3QMQA 3HKWA 3I55S 1S7IA 1FWKA 1G3OA 3PW2A 5U47A 2MGZA 4LF2A 2MHNA 2FLNA 2HPUA 4X64F 1VQ9S 2QL9B 2OPSA 3D67A 2D3ZA 2IRYA 2DNRA 1S1UB 3B54A 3LANA 4YB1P 5L9NA 1KQKA 1CJTB 2CPDA 5HVFA 2HKEA 3CD6S 5DS7A 2N3OA 1FRMA 4PZVA 1JQGA 2E29A 4P7TA 1JLAB 3FKBA 3BO4A 2B4OA 4KT0C 1S48A 2DXEA 1NJWA 3EXCX 4JI7J 3K2YA 3HLUA 4F26A 3CCZA 3LAMA 4NXMJ 2XY6A 1HBNA 1LWCB 4ZVFA 1FCAA 4NLPA 4M5DA 3R7BB 1RWUA 3P5TL 4AL7A 1KHVA 3FMWA 5M2RA 2M7SA 2IC3A 3EGNA 5EWEA 4J37A 1EP4A 1M1GA 2MQNA 1K47A 1SH3A 2I0XA 4CIOA 1HBOA 2FD2A 4F3MA 3VAHA 3TARA 4WP3A 3WC2A 1EB0A 4IOCQ 5KFGA 2R4FA 2HNDB 2CNKB 1RTZA 2OI2A 1JLCA 1PAEX 2PEBA 3RRKA 2QEXS 3R9LA 4ES1A 5KAKA 3EM1A 2K7JA 4Y65A 3I96A 3UN5A 4BS2A 1X4CA 1Q0NA 4HACA 4F02A 3H4DA 2XI3A 3EXYA 4X66J 1Z2LA 1L3VA 3IGVA 1GK8A 5ETSA 5KFCA 1ZZNA 3EVMA 4OI2A 2HNYA 3OTOF 4JI5F 5ETNA 3I5AA 1WG5A 1IXKA 2CJYB 1RWVB 5GAEU 1PBUA 3MM6A 4U8VA 4C6AA 4TQSA 2YPZA 2CVIA 4OJ3A 3MUMP 4Y00A 2MXYA 1L3UA 2OPRB 2Z56B 1QE1A 1FWPA 3PEHA 4DQPA 1U2RA 2H4YB 5J2NB 4DR2J 1KFDA 2V67A 1IKXA 2IJRA 4I6YA 4Z37A 3T1HJ 3NRBA 4X4RA 1RWPB 1FEHA 3O5TB 3R5JB 1NDKA 4QYRA 2BUNA 1S0MA 1HARA 1QSLA 1DRZA 1RB0A 3RW7A 1TV6A 4L73A 2FVQA 4MKBA 4LSLB 2KHDA 2QLFB 1ULRA 1Z2ZA 4N56A 1WNEA 4O3OA 1Q86T 2AX0A 3C16B 5DRKA 1M5VC 3QNWB 2LQ9A 2W2OP 1NPPA 1K1SA 1WEXA 4ZPCA 2CJKA 5FDLA 3NXZA 2CIMA 2LEPA 1AFIA 1ZYQA 3F0NA 3VAJA 4PG4A 4DLGA 3TI0A 2FHJD 1QUPA 2BX6A 1OY9A 5G0RA 4X4SA 1KHWA 3FEZA 3PRVA 2FY8A 4KV8A 2W7OA 1I94J 4M5MA 2BABA 2MQMA 4DFMA 5DDRC 4DV7J 1UJ6A 4FZVA 5CYQB 4F8RA 1H2UX 2CPZA 4G1QB 3TYTA 3RAQA 5A8RB 4OHYA 1Q4RA 2D1CA 3NBPB 3AXKA 1NDLA 5HVGA 4QIVA 4OZNA 2MKKA 1U1LA 1RTHA 2FJXA 1WEZA 2CQ1A 2E9ZA 3MMBB 4DWIA 4IRKA 1MNEA 1NZ8A 4MH8A 4CI0B 4WFXA 4CTAA 3FCWA 4TU8A 3D6FB 5A8WA 3OTDA 2HVDA 4C8YA 5EX0A 3FC9A 5KFQA 5KOWA 1RT7A 4ED2A 3CC4S 2DHAA 4ZP8A 3TA2A 3DGPA 1KC8T 2F4VF 1ZAXA 1Q8IA 3B78A 5AXKA 2W7AA 5FLXY 3RR8A 2GHVC 2FB0A 3SV3A 1K1QA 1OQ6A 1G6BA 5J1EA 2Q66A 4QCLA 2ZUGA 1S97A 3QAUA 1O5JA 3GCXP 1XN9A 3PYGA 4U9RA 3MM6B 3KDOA 2PIIA 3GV5B 2OUGA 4DXLA 1U6FA 3P45B 1PYTA 2I1RA 4IFVB 2QC3A 3EZOA 2K8GA 2RVJA 3DFEA 4NLOA 3G6YA 1DTQB 4O3RA 2G0CA 1H38A 3RUBL 3P5BP 1HIYA 2KRBA 4DOZA 4PQUA 1OY6A 5BYSA 1K0TA 3QT5A 1X4DA 2WVCA 3K5OA 3QIPB 1XERA 1FJ7A 5HBMA 2DR6A 1AA1B 4DX8H 3T5HA 3MDFA 4DV5J 4DR5F 1QTMA 2XS7A 3KNAA 2QT7A 2EEYA 1RAAB 3MPVA 3TJ8A 5CYQA 3DXBA 1V6HA 4ZLPA 3VAFA 3EMTA 2GAHC 1YI2S 4DN9A 3HHNB 4IH6A 1UFLA 3M9NB 1UVJA 5DETA 1Y9OA 2YNFB 3PR5B 3MM9A 3ULHA 1FDDA 1N0UA 4EO8A 3GJTB 3IAS9 2M5YA 2NPIA 4FXWA 4R5PB 5BYQA 1AYEA 3IR5B 3LP0B 3RJMB 2C1EB 3I9V9 1QJHA 2HQFA 4NCGA 3DHWC 3QO9B 2IDLA 4OHWA 1T94A 4M5GA 4CLKA 4EGLA 4QWAA 4OFZA 1AUDA 2BM1A 2ASJA 2GHWA 5E33A 4C7QA 5CD4H 1T05A 2PI4A 4FVMA 2O67A 3C6TA 3M2VB 3P4UB 3ILJA 1SL1A 2HBZB 1R8CA 5DQIA 4Q8EA 3OSPA 2CG8A 4PXCA 2QN6B 2FJBB 3AFGA 2ZC3A 1WORA 1IR0A 3S01A 3K5MA 3OXGA 4GVBB 2V4JB 1ZTWA 4LVOP 4UUXA 1TKXA 3W65A 4QR0A 1V3RA 2GQCA 4LJMA 5KFBA 2XMTA 5KFRA 5F8MA 2QA2A 2YKPA 4C0OC 2UVRA 3WIUA 1R0AB 2HHHF 4Q44A 2D3O1 1W2IA 2BA9A 2RF2B 3IP0A 5IWAJ 4DUZF 2A18A 2LQBA 3AJDA 3DRRA 5F9LA 2I5JA 1GMVA 1QUVA 1RT2B 3R5BA 4K7QA 4ZVUB 3ZZYA 4AQYF 4A8YA 4DV0J 4KYZA 2R9LA 3I0SB 4ILMA 4PRFA 4PWDA 5B0DA 2NQPA 3DDKA 1NKEA 3ZZOA 3KJQB 4LF9J 2NZCA 4UOHA 2IRXA 4NASA 1EKSA 2F3JA 4P2XA 4JI1J 2E9TA 4O3NA 1JX4A 5KFHA 4USWA 5KT5A 1U0SA 5DLFA 1N36F 3HK2A 2IY5B 2R7XA 1RT4B 3GR1A 4LBIA 5D3GB 1S76D 4PG5A 4BLGA 4KSEB 2LXFA 5K9FA 4RZRA 1DARA 3PJWA 1NUEA 2GVDA 4DN0A 4DV0F 4DFKA 4IO9Q 2JFKA 2JOQA 2R2RA 4ZPVR 2EFPA 1WUUA 5FD1A 3SBMA 1MU2B 3KXDA 2VG6B 4NLDA 4L3NA 1TVRB 3BR9A 4MJKA 1DLOA 1GNKA 3L95X 4GO7X 3MECB 5HQMA 1Y11A 3MPUB 1RHKB 2CFXA 4DV6J 1FF2A 3Q8PB 2C2OB 3MWBA 3CJKA 4QWCA 3R2CJ 4XDCA 5G4DA 2G9OA 3W64A 4DQQA 2J0SD 2BBEA 1X60A 2CPIA 2DT9A 1IBMJ 1RAJA 4A8SA 2OPPB 2WBRA 2J6TA 5D78A 1EETA 1TP7A 3GU0A 4J9QA 2ZZNA 2KTQA 4IKAA 2KVQE 3LOUA 3IR6B 4Q5VA 4HKQA 1T3NA 5A2QY 2H5JB 1WI6A 1WC3A 2RDDA 1T03A 1DY3A 1AT1B 3RZAA 2POKA 2AYEA 4LSNA 4U6PA 3N6NA 3QGGA 4IFYB 1NCLA 3N4WA 3G96A 1CJUB 2HFOA 3RBEA 1R27B 1FFGB 1ROFA 4ANCA 1SQEA 2FTRA 1UL3A 2PD1A 2YNIB 4TLRA 1W7WA 5DZ6A 2Y0SD 4OX6A 3DLKA 1U7LA 2ZVIA 3FSIA 1XNRJ 3GPAA 2UXDJ 1FXDA 2FHMA 3NLCA 3VTIA 4I56A 2Z58B 4BHQA 4ED3A 1Q5VA 3UVJB 4ED4A 2DHSA 1A9NB 4OHXA 2UUWA 3HSJA 3Q24A 3DGVA 2DNZA 5B0BA 4OMFG 2B6AA 2KXHA 1U2FA 3SFUA 4Z2XA 1DURA 2PO4A 3MUTP 1TK0A 4MKYA 3AOAA 1MMDA 3DC2A 4GMKA 3Q8QB 3PYEA 4I64A 1IN0A 4KC5A 4R8UB 1CJKA 1AZSB 1LEOA 1OYEA 2YQ0A 2ZHOA 4Q7AA 2FJWA 1WHXA 3KKFA 4F50A 3D1QA 3VAGA 4WP9A 2XY5A 4KHPF 4WE1A 2QA1A 4O3PA 1X7VA 1Q8LA 5HLFB 2BJ7A 1CQNA 2ZZTA 3GJQB 4K59A 1CBKA 4RW8A 1RACB 3QGIA 4DV1F 3MFHA 1T9WA 1YJ7A 2MKSA 3CDUA 4FYYB 2QJ3A 2EFNA 3HFKA 1TFYA 1UFKA 3PFOA 4UZCA 3PW7A 4GKJJ 5HP1B 3JQKA 2VOOA 1G4CA 1TMMA 1DQAA 1FE0A 3NAIA 4ILRA 1M1HA 1ZA1B 4R0EA 4IR9A 3SSRA 2DR7A 1RWMB 2D41A 2LFVA 3A1YG 2JC0A 3CO9A 3EYZA 2DNNA 1JWWA 5AE2A 4F36A 4C11B 2W4DA 4Q2LA 4LT6A 4RWWA 1S1VA 2GNKA 1DZ5A 1CPZA 3J81j 4Y2KA 1TFWA 3MPDA 2RHQB 4LR7A 3VHQA 2VG5B 3UD4P 2IMOA 4WTOB 1EJ7L 1FK9B 2M9KA 4NEZA 3FZBA 3VGUA 1RWXB 4AYBD 4ELUA 3BYRA 2FJEB 4D3HA 1MN7A 5KFYA 3WC0A 2CQ2A 3ELHA 6FD1A 3DLHA 1T0TV 4GKKF 1U1PA 2BACA 3PYFA 2NCKL 2W1BA 4WFYA 3LWLA 3GYGA 2FQQB 3FCHA 3KUEA 1VGYA 2HIYA 1IKXB 4ICLB 1S6PA 4EO6A 4A8WA 4NCGB 3PRBA 3P8BB 4GC7A 2JWNA 3BQ2A 4R5PA 2HNZA 1UWBB 3G87A 2CJBA 3RB3A 4O0NA 3LW5C 1FTRA 5DQHA 4LF4F 1WDTA 2P6TA 5AXNA 2MGZB 2PDAA 3V81A 1N52B 1RKJA 1JXLA 3J80Y 3ILOA 3UNGC 3O3LA 4OV6A 2ZJRQ 4HHHA 3QT6A 2JVOA 3G86A 1VBYA 3FRYA 3OL8A 4RPFA 4B3SJ 1HQ2A 3DLEA 2UXCJ 1N4LA 2JX2A 3C15A 1U09A 3L09A 3PZPA 2KG0A 1JLFA 4IRDA 4BCAA 2B43A 2XSFA 2ZDPA 3OTEA 4ZJQA 1SKUB 3UCZP 1TL7A 2RH3A 4KO0A 1TAUA 2DH8A 2FZGB 1HWLA 1V5IB 1PGZA 2HVHA 1CULA 3DM2A 2YKNA 3MMAB 3OFGA 3SQGA 4I7FA 3UO0A 2CA9A 5L38A 1RWKB 2GJIA 1IKVA 1SJ3P 4JI1F 2X1FA 4UZBA 3LTOA 3NWRA 3J7ZT 1FNOA 4NRTA 4TVAB 3G8SA 3AAWB 1RZMA 2VD3A 4I7FB 4CO0A 1M5OC 2PFDA 3MAHA 7AT1B 3ZTPA 2VB6A 2DCUB 2CKWA 5DJBA 2R7VA 2L9DA 5A8WB 2C2ZB 1A0OB 2CVEA 4W98A 4WK1A 3CUNA 3HT3A 4ENOA 3SEOA 1RXOB 1RJJA 2NXUA 3G8QA 1NK5A 5HK4A 5CYJA 1D0EA 4A8QA 1GXUA 2RUSA 3FCVA 3HVTA 4I1TA 4OYBA 2VV5A 5RUBA 2KT3A 1OJ4A 3LUYA 2OSRA 3ENQA 4O44A 3RRHA 2I2YA 1NSPA 3DMJB 5AE1A 2YNIA 3QJJA 2EVZA 2Z8QA 2MSSA 5K8OA 3PEJA 2VDIA 5GAHI 1RHMB 4KGVB 4GC6A 2DNOA 1PJ7A 2RQMA 3I5BA 4NA1A 3TWZA 1VOMA 3DI6A 5KFIA 4QYZJ 1FESA 1YLXA 3ZTQA 5E3AA 3QBCA 2MDAA 1QDUB 1O8BA 2XSJB 3EZUA 5J1PA 1HWKA 4X84A 5G0RB 2ZH9A 1HNWJ 2XMVA 4ECVA 2IYGA 1VC5A 1FEEA 1T11A 2HHXA 3SCKE 2F7VA 2VONA 1NHKL 3VAIA 1VC0A 4A8FA 1SV5B 1WHYA 2VASA 1KBRA 1WACA 1RT3B 1RABB 4CDIA 3UN3A 2D3OR 3CCTA 1YRUA 3DRSB 2W2MP 4M8LA 3M8SA 2K3KA 1N0VC 1KLMB 5CZXA 3CCLS 4JYAJ 1MWZA 1HWUA 1LWFB 4A47A 1Q81T 3MECA 3FBBA 4NA3A 2MZ1A 4EBDA 2XWYA 3O1LA 3SI8A 4NA2A 4YB5A 1XEZA 2VG6A 1LWFA 1FVSA 2E7VA 2HQIA 3JQJA 5F0UA 5H1SV 4B9SA 2KJVA 1RHQB 1X4AA 2JL9A 3GV7B 4DSKA 1F9FA 2HK2A 5IXUA 3N01A 3HCXA 5IQ6A 5JVGQ 4CT9A 3TAQA 4KHMA 2RILA 1J5OB 4FF4A 1UW9A 3M05A 2W25A 4QIFA 4Y6IA 4OLOA 4ECQA 1NBEB 3C14A 2YX4A 4PCQA 2MQPA 5D4LA 2G13A 1U0HB 4QJVA 3C19A 4ER8A 1MWQA 1JLGA 2GMHA 4LF5J 3SSQA 3R1LA 4TNOA 1MW7A 4CLZA 2YX7A 1QM9A 1S6PB 1D9FA 1NXIA 2XSJA 1VJQA 2WCXA 3HT0A 2ZM6F 1FRIA 2LLZA 2B4PA 4FNIA 2AGOA 1SL2A 5E3QA 2C2EA 2I5JB 2AYMA 3BKFA 3HHLC 4C2MA 3KWMA 2JVRA 1Q5YA 1RADB 2QMUB 2VG7B 3MCSA 2CWKA 1OQ3A 3M2RA 5D6GA 3LP1B 2DR9A 2J7UA 3TZYA 1S5ZA 4I68A 4F3OA 5ETRA 4I6AA 3O44A 4AL5A 1TV6B 1VS3A 2YBVA 2MY7A 3GR0A 3SFGA 2BM0A 2DKOB 4DUTA 1VQ4S 2VL1A 4Y2IA 2AYGA 5L39A 1YK9A 4WIIA 1Z1ZA 1JLQB 4KRWA 2XGQA 3PX0A 1ZTTA 1S1XB 2ZKUA 1OPZA 5KG7A 4FYDA 4O3SA 2YH0A 2YWGA 1CJVA 4USTA 4CLTA 3NP5A 2GFFA 1I94F 1RAEB 2CQHA 3CDEA 3G2XA 3MTKA 4O3QA 2CXEA 3D1HA 1IM6A 1IBCB 5B09A 2ZH7A 1VQOS 2OP5A 2J0QD 1EETB 1MN9A 1UETA 2OFGX 3R6LB 4OYWA 2H5IB 2HHUA 3MM8A 2XLJA 3BH6B 5GVQA 5I42A 4ECTA 4WBFA 4MK7A 2XO6A 1W2BR 2DVIA 2ZBRA 1R6VA 1OWXA 2DJWA 1HNIB 2K3IA 4HACB 3U1NA 1A7GE 1YGYA 1RCXB 4FS1A 5HVHA 4X4NA 2ASYA 2RSQA 4EZ9A 4K2XA 4AT1B 4FBUA 2H54B 1YDLA 4JP8A 1J5EF 2QFIA 3VVTA 2KYZA 3CC2S 3N5FA 2JEGA 1PG5B 1PIEA 3VQTA 4EWTA 2Z2MA 3CJQA 4ZMMA 3EWGA 9ATCB 4PAAA 1S9EA 2BJ3A 1KVIA 3OTBA 1V3ZA 1RSCA 5B7WA 4LF4J 4ICLA 2LCWA 1IKYA 5A8KB 5IT9U 2P9GA 3UVJA 4X4TA 4NLQA 2KXNB 3EPIA 4RO0A 3U1LA 3FSYA 1DHMA 4WP8A 3G6ES 4Q43A 2DR8A 3PRDA 2OELA 4NZ7A 4WK3A 1B4SA 2BYCA 3MR2A 2XO7A 2EC2A 1YIJS 7FDRA 3VZIA 1HA1A 1OY8A 2CPYA 2DEIA 4NX9A 3VALA 4DR5J 1VK3A 1JLEB 5HROB 1XTZA 4DF8A 3HJVA 2CQDA 3K0JA 2HQDA 4ZN1A 3MM8B 2RS2A 4CLFA 3OJUA 2Y8WA 3FBCA 2UZAA 2WW4A 1QVFR 2OEKA 1U1OA 1AXQA 3IRXA 4K4UA 4WXWA 3BQ1A 4X2BA 1HI8A 4UOGA 3NBPA 1WEYA 3AOCA 5M2PA 4CH7A 4ANEA 1N34J 1IBLF 3NS7B 3QFWA 4KH1B 2V5HG 1D8ZA 4C3MA 4LF8F 4OI6A 3MXHP 1FNXH 4ID5A 3BSNA 2UUBF 2NZ4A 1BE4A 1ZM4A 4EBEA 1KEKA 1TVRA 5F8HA 1VCTA 1BMQB 4RU2A 3HM9A 1TUVA 4IOBA 2NYHA 1C0TB 1IKYB 5A8KA 3H2LA 3JSYA 5EWGA 2HW3A 1U49A 4C0HA 1S49A 1S9GB 2MQ8A 3M6XA 4DX5A 1S77D 4CO1A 1RT4A 3FK4A 1HNZJ 3T1YF 3AA8A 5D3GA 2WVBA 2RQCA 3GIRA 4JV0A 2HHHJ 3I4HX 1IJEB 4ZVQB 1PJ5A 2N82B 1S7HA 2B7BB 4U67Q 4RNNA 4OHZA 3QWUA 4RUAA 2R8KA 3P49B 1JLGB 2W4CA 3W60A 1SC6A 2P9EA 1PYOB 1S6UA 1ZH5A 2QRRA 2BMBA 1SIWB 4WFNQ 1APSA 2RU3A 2BE7D 2W9BA 2WHOA 4B3OB 4K4VA 3T3FA 3TNVA 4DU7A 2D3UA 4DF4A 1WHVA 2CNOB 4EYIB 1UFWA 1KP6A 3V6JA 4OL8A 3AH6A 3HHLD 1M90T 1C1BA 2XI2A 4OI3A 1QAIA 4JI5J 3H8YA 4EMDA 3OL6A 4TKTA 5DO2A 3UCUP 4LR9A 5LSRA 3UQSA 2LEBA 1VHFA 3KHLA 2IHR1 3N28A 5E5NA 2F1FA 1RE1B 3HO1A 1D1UA 2VKRA 3CJ5A 2WVFA 2B5JA 3D1OA 3RAXA 2E5LF 3G8TA 2ZNZA 3BKTA 3KTQA 2H5EA 1EQ0A 2ZBQA 4URGA 4DV6F 3K89A 4ECYA 1UCNA 2H48B 4C8ZA 3DCAA 5AXMA 2R7TA 5HAOA 5KFXA 2XYPB 2M8DB 4HYKA 3BBBA 2ZWPA 1HW9A 1TUGB 1UP1A 4RX6A 4DZDA 2J6UA 5LSLA 4NLXA 1YJRA 3Q8UA 3HHLA 3CCSS 3JSMA 5F8JA 1WG1A 3PDNA 4CYUA 2DNHA 1KQSR 4JYAF 2CZ4A 3MM7A 4Q0BA 1B64A 2MZSA 4QPXA 4MMOA 4MKAA 4YS2A 3UDCA 2ZH1A 1K9MT 1M0SA 1NPKA 1YTYA 1RU2A 5HJXA 1IQTA 1H0HB 4RNMA 1KQFB 2BDPA 3H59A 3C2PA 3GCWP 2QL7B 1SQGA 4IG3A 2V4QA 4KB7A 1TKTB 2OJ3A 4RNHA 3I56S 2MJNA 2Y1LB 2QV6A 2FZKB 3OBIA 2ZD1B 3Q89A 4IFVA 3CMQA 4L74A 5HBMB 3NGUA 4DLEA 5LT5A 4H4KC 5B08A 1NB7A 3MHYA 4FXDA 3D0GE 2H1YA 1YSJA 3W63A 4AFFA 2OH2A 3I0RA 4NPOA 1RUSA 4ELVA 1OIAA 4LF5F 3SYZA 4HDHA 3VGVA 1PKUA 3GLJA 1X4BA 4P72A 3MM5B 2DIUA 4DSJA 2CPFA 2GIFA 2AMCB 1RHUB 4USKA 4CNZA 4F3QA 5KFOA 1X5SA 2DGOA 5D8HB 1FTCA 1TUWA 1VQKS 3TVKA 2YY3A 1XMQF 4NMXA 3KHGA 3DYAB 4PXBA 1D9DA 2DYAA 1TL7B 4KO0B 1UVKA 2ZH2A 3BPDA 1TL1A 3TAPA 1HR0F 3NAHA 4DV4F 4B3RJ 4DZ6A 1GMWD 3LP2B 1M5PC 3HD1A 4KHPJ 1UA1A 4ECSA 1G7CB 3K8VA 3JSBA 5AT1B 3CIMA 1U2CA 3IC1A 4ZVRB 4ZVTB 5C7PA 4K4YA 2GQ2A 2JLEA 2RT3A 5CD4A 4YQWA 4IR1A 4CNYA 2VC0A 3NOGA 1YJNS 1FA0A 1IJFB 3H5UA 3VAKA 2W9CA 5E2QA 3T19A 3I32A 4X65F 2JLGA 4IO1A 5KT3A 4DPWA 2WB4A 2IC3B 3MGJA 5F3TA 5F8NA 3OVAA 1YZ6A 3DI6B 2Y1RI 5IQQA 4EFAC 1KR4A 1SC3B 4PYDA 6FDRA 2AWZA 4LFAJ 1D8YA 1QLNA 2F4VJ 1EAYC 2FPHX 5EWFA 1F3FA 3ITHB 1YBTA 3JYTA 4LQ3A 4QBUA 2QE5A 2VFTA 2ZHAA 3PO5A 3W3SA 3BZQA 2Q43A 2ZOMA 1XR6A 1NO8A 2CQIA 1P8GA 1SH2A 2E7WA 2GO9A 4MFBA 4RNFA 5M2UA 3CCWA 1YZ7A 4FF3A 2D7SA 4KJIA 3OQ2A 3IBFB 1N5YA 1X4HA 3RG6A 5BJRA 2KI2A 3RBXA 2ZJPQ 2XZWA 1HMVB 1J5EJ 4OZ2A 3MEDA 3R1HA 3OR1B 4C8LA 2FDNA 1IKWB 1H7WA 1I51B 1GX6A 3Q8YA 3T1AA 3TJ9A 2IVYA 4YDDB 4V19X 3IBWA 4P2SA 3ILLA 4AE5A 2XM3A 1JNZB 5L1KA 5KFAA 3RBDA 2ZC4A 3A8JA 1HNVA 3R2DJ 1PC5A 1HWJA 3MI7X 4NLYA 2BANA 4KY3A 4DSFA 2KFNA 3MZIA 1ZM2A 3E01B 3H42A 1WKKA 1JLFB 3TQEA 4LQ9A 2DGWA 1U02A 2X1BA 4Y3CA 2KZZA 3V6HA 3FJ2A 3OD2A 3TZWA 4KHRA 2UUBJ 1ZM3A 2V2QA 5KFVA 3R5AA 4WCEQ 3BGFA 2X51A 2YWFA 4V1Ak 4OI1A 1T9TA 3QZ7A 2BOAA 1QD1A 2EFGA 2IM3A 2VPXB 3CW2C 3GG1A 3N79A 2GVZB 3KG4A 3MR6A 2ZM6J 4FVCA 3CPWR 4QQBA 2L9WA 4J9KA 3OL9A 3MD3A 4XDDA 4PABA 2ZOGA 4KFBB 1EP4B 3CDBA 4ZP6A 4BC7A 4YP3A 1OPIA 2VQEF 3LA0A 4GVBA 2BJEA 1S1WB 3KLIA 3GE9A 3OR2A 5BR8F 2HK3A 1ZOTA 2OFHX 1SQFA 4KV8B 4NZ6A 5DG8A 4N41A 1HBMB 4MFBB 1VQNS 2RHSB 4LF7F 1KVJA 2BE2B 2FY1A 3CJ4A 2E1AA 3OHBA 3Q2TC 1IBLJ 2Z2ZA 3JYTB 4LFCJ 4LF8J 3LP1A 3MD1A 3D66A 1YVFA 4GVLA 3KLGB 2LEAA 3OFEA 2FJDB 1KTVA 3HDSA 3PACA 3W8GA 4DR4J 2EBGA 2LDYA 4JV2A 2OPSB 2XBPA 3IFEA 4F4YA 3IG1B 2PEHA 1F0XA 2B9YA 2F63A 2ILYA 2R7OA 4OX7A 4RW6B 5IT4A 4QIWD 4B9VA 1Y3KA 3HP6A 3SCIE 3CXCR 2HGNA 4BWMA 1WI8A 2CJ9A 4DL2A 2HLTA 3IR7B 2C28A 2JDJA 2WTFA 3HVRA 1V9OA 2B56A 3DRPB 1U6ZA 4FYVB 1HQUB 4HTIA 2AX1A 1GQEA 2V50A 2M3DA 3THPA 3M9MB 3IS9A 4OQJA 1NM2A 3M6WA 3KK2B 2ZE2A 1S6OA 4YHHF 3KJVA 1FKOB 3KK3A 2MTLA 3RBZA 5DG7A 2IM2A 2XQCA 4X64J 2UVWA 3GJRB 4LRDA 3GTYX 1URNA 2E5LJ 2LVWA 2APOA 2VBYA 1EQMA 2ZOFA 4Z7YA 2J0XA 4ZCLA 2J5AA 6AT1B 3GILA 5HLFA 2DGQA 4ZJOA 5F8IA 2BKNA 2YNGB 2F5GA 3SXLA 3DLJA 1S4EA 1WOOA 1N5TA 4DL4A 4R8UA 4RBVA 2CQGA 3UWTA 2GAGC 4ZVPB 4CP5A 2DITA 4DR6J 4M95A 3SCJE 4QU7A 5K14A 3CD0A 2E1MC 4DEZA 1XMOF 1CQMA 4I4BA 2UUCF 3PR4A 2GS8A 2B9XA 1IKVB 4NWBA 5MAOA 1VBZA 3OFFA 1NB2A 2J9EA 4TLQA 4DI6A 3EGZA 1G2EA 1BHNA 4I6WA 3LPYA 1FKPB 1PCAA 3PCOB 2FZCB 4IG0B 2PGCA 3KLVA 3O8WA 2F9JA 4IG3B 4HHUA 2A3JA 2YPYA 1UJ4A 2VU5A 3MMBA 5C25A 1SKSA 2UUAF 3ENAA 2WVDA 2N7CA 1MROB 3NEKA 4N8OA 4YB7A 3WHIA 3MR3A 2DY9A 1T02A 4WJBA 3SDEB 3A4TA 2IJNA 2LYVA 2MKJA 1NDCA 5CABA 3ETOA 4DFJA 4ECRA 1FRXA 1LW2B 1NJZA 2W2PP 2CDRB 4FNHA 3HHEA 2XS5A 2HBRB 2MKIA 4ED6A 4P52A 4TU9A 2GCFA 2FC8A 4JI4J 3VWSA 1M5KC 1WJ9A 4QU6A 1YRTA 3BB5A 1XIQA 3ONQA 1SJQA 5KG1A 4ILLA 4DG1A 3PTWA 3FGVA 3L9ZA 4FKXA 3OFHA 2DRDA 1D9AA 1BQNA 3H90A 2CQCA 3OJSA 3KJVB 4NXMF 1WKLA 3A12A 2XLIA 2L9NA 3I82A 4U8YA 4ZPAA 3DRPA 4R25A 1MSWD 3EZ5A 1N5VA 4RJVA 2F9DA 3KK1A 4DR2F 1NKBA 1JLEA 3W5XA 4J9OA 1LXNA 4I2QA 2C3PA 4AXJA 3MOJB 3BGRB 4EBCA 3DOKB 3ENWA 5KFEA 3IGNA 2XWXA 3R7SB 4ZKAA 2HBYB 2KU7A 2YKAA 3GB0A 2WOMB 1JJHA 3I4PA 1JXEA 3NKYA 2QMXA 3VGTA 1C1BB 3C6TB 3CULA 2NXJA 4QIEA 4IUFA 1MMLA 3BPSP 4F2RA 2JH3A 3AB2B 5CH7B 3D4JA 4M5HA 1CS4A 2BEFA 1TL5A 1VQLS 1UAWA 2JEJA 3C46A 1F5BA 3D0IE 1QVGR 3QRPA 3EGWB 2R7SA 2WK4A 1NJXA 4LIWA 1IUJA 3AODA 2OMOA 1VJWA 5H9FK 2MQLA 2QIFA 5K5MA 2FVSA 1NHVA 2L48A 1U4BA 2FHJA 2RQKA 2QMWA 3AD7C 3M8PB 1N54B 2ZH3A 3KHRA 2HFUA 2EPIA 2G0JA 2IRUA 3R5CA 2K06A 4LSZB 1SJRA 3TZXA 4Q8FA 4KFBA 3V6KA 4DX6A 5J2QA 1C0UB 3H98A 3DU6A 3M8PA 4DL3A 1B70B 2VA3A 1UVIA 3V81B 1C1CA 1VR6A 1T9YA 2ACYA 2KYXA 1K8AT 2DIVA 5L9XA 4Z7CA 2RS8A 2BJ9A 4MYTA 2HNZB 4ECUA 5HANA 3BGUA 3EUNA 4I0WA 5KOXA 2DNKA 4F0HA 4LFBF 1SJFA 1V3SA 5KFJA 3PHTA 3UR0A 2IDEA 3QLHA 5EGYA 5HSPA 5D0EA 3CE8A 1VRTA 4OX8A 5KG4A 4TY8A 5JVHQ 4JV5J 3RRGA 2WVEA 1RTDA 2CUYA 2HS0A 1I6JA 2P5VA 3CJRA 2GA7A 4NI2A 4YN3B 3D2WA 1TK5A 3C3LA 1JLAA 3MAAB 3NMRA 4LMZA 2YXLA 4XK8C 5K8NA 3JAMU 3L3CA 4A8MP 1S1TB 3I87A 1CJTA 2XMJA 3ZZTA 1YHQS 1FDAA 2FGOA 2XS2A 2AGQA 2GZOA 4DV7F 1HWIA 1SUQA 4ITSA 3KK1B 2WOMA 4DHVA 3DRSA 2B5JB 4ZCIA 1T7PA 3OW2R 4C97A 4KKOA 4F0MA 3BGRA 1Q53A 1AB8A 1KTQA 1S1TA 2DGXA 4FF1A 4H4KA 4L6V3 1FD8A 3M32B 5EDWA 2BQUA 4FYXB 2NR0A 2RD5C 3FFIA 4XTTA 1VRUB 2A0FB 2H51B 2IVMA 1RCOB 3CTRA 3R3TA 5A8RA 3ZXWA 2JHEA 4M5JA 4EU0A 4ECWA 1B3TA 4PUOB 4DX7A 4J9MA 2B8QA 1EZZB 1F9HA 4OZJA 4ANDA 3CDWA 3OTCA 2W4PA 3POTB 5T7LA 3PO4A 3NOCA 1IR1A 2ZNYA 1CSJA 2C2KB 4ECXA 1RAFB 2CQ3A 1NRKA 2Q1LA 2YKMB 3L7UA 5SUHA 1IWAA 2G4BA 3C14B 3PKMA 4OJ1A 2M52A 3NGKA 1RBLA 2WRMA 4EZ6A 2Z2LA 2DCLA 2H9ZA 4DSEA 2UU9F 2J7KA 3ICLA 2EK1A 2IM0A 3R6GB 2ZH8A 2ATLA 1P1TA 4NRUA 1MROA 3X1LB 2VBZA 3NGRA 1HYSA 4B3MF 4WFBQ 2AKWB 4K4TA 5KFWA 2R2SA 4JI3J 2GVDB 1P1LA 4ZS6A 3ADAC 5HMXA 4DV5F 1S9GA 4B3TF 3CCES 1XBWA 3CIZA 3DLKB 1U8WA 3ZZPA 4TYAA 5KT7A 3PJXA 1YBUA 2QLJB 4CLSA 2IJFA 2AIRB 1KOOA 2HS4A 2AEJA 3Q8SB 1RT5B 1H98A 2YNGA 3HXMA 5H9EK 4IOAQ 3OSNA 3DDNA 1RHRB 1DBDA 3HULA 4HI1A 4ZIVA 2HMIA 4WKRA 3ET6A 3FEYB 1RT1B 3TP2A 4C3KA 3Q0AA 1QSSA 2Q6CA 1Q1KA 3TEHB 3OL7A 3HFVA 2CRLA 5LM7E 2EKNA 5C2CA 1CJVB 3OHAA 4O4RA 1T8EA 1KD1T 3GG0A 5GAGI 3OT9A 2V2ZA 1B0VA 2U1AA 3NCPA 3NGDA 1FWLA 2GGPB 2J9CA 5B0CA 3LQVA 2W2QP 3A3NB 4DR1F 2AD9A 3M8QA 2YH1A 1JKHA 2XG8A 1FJEB 2AP6A 3TANA 3SCLE 3MURP 4XO0A 4ZOSA 3T41A 3BN7A 1S4FA 3PW4A 1LWEB 1URRA 1FRKA 1R43A 2RJZA 4RW7A 5HJYA 4NXNF 1UVMA 1CC8A 4ELTA 2C3MA 4YHHJ 2E66A 4F4XA 2RU9A 1YJWS 4P6QA 2EG1A 1IBKJ 3DU5A 4DSIA 1BQXA 2MLXA 2VG7A 3KLFA 1WOSA 2IFXA 5IWAF 2DNQA 2R8HA 4IH5A 5E3CA 8ATCB 2NREA 2PC6A 4C48A 5CQGA 4NLVA 4UTGA 4AQYJ 1TKDA 3HF5A 4DR1J 2V69A 2VG5A 4M63A 1PAUB 3SV4A 3CD5A 1NHUA 4LUBA 3GIJA 3OPKA 2XULA 2OD4A 1WWHA 3Q8VA 1HI0P 1GT8A 2E5GA 5KG0A 4CLPA 2IYIA 3OUYB 1FRJA 2AV5A 1F5CA 4OYXA 1T95A 3H7HB 4ED0A 4X62F 1OO0B 3AB4B 3CVKA 4DUYJ 3T5LA 5A2QU 3TQ1A 1IBKF 3M2UA 3OXFA 2FLLA 4DR3J 2EXUA 1ZAWA 2VA2A 3IM8A 4JI8F 4OX9J 3D6HB 1NK7A 2UV8A 2SXLA 1CEZA 4YB6A 1IR2A 1WC0A 3CDAA 3EICA 2UUAJ 1REVB 2W24A 3UI3A 2OAUA 3E01A 3EVWA 4RW8B 3GIKA 2EC0A 1FFSB 3KJNB 1A6LA 4PG8A 2HAFA 2KB2A 2QO3A 2BV3A 4J9SA 2OSQA 4NYZA 2DNLA 4JBCA 2NXNA 4OYAA 3KLEA 3MUVP 1NK8A 4B9LA 3TA1A 4RL1A 1BQMA 4D3GA 1DTTA 2LP4A 3W9IA 2HFSA 2UXDF 1KLMA 1HNVB 2BW7A 3FDSA 3FQKA 4MTPA 5KFMA 4ZHRA 2BJ1A 1IWGA 1P9QC 2VFSA 1X4GA 1IKWA 1S9FA 4DCOB 3PY8A 3CJ2A 1TELA 1JJCB 2C3OA 4DBQA 4DR7F 4ZLJA 1RA6A 1LV5A 3CT9A 4H54A 2O66A 1HR0J 1BLUA 4ZK7M 4B3RF 4IDKA 2DEJA 3MTJA 1RAIB 5GAHU 1T05B 2DRBA 4E0DA 3BO3A 4MAKA 5KFSA 5DDQC 1N88A 2G2YA 3MEEA 5LMNF 2KT2A 1UVLA 5HN0A 1FFWB 1VQSA 2HRUA 3QGHA 5B0FA 4G1IA 1WF2A 5IFMA 3KLFB 4IFYA 3ZNJ1 4WU2A 1NPRA 1WSVA 2QX0A 3PIOQ 4N5SA 2CNNB 3JTOA 5F8LA 4IQMA 2P6SA 1UJ5A 2LKZA 4CYUB 2C3YA 2I9SA 2QZ8A 2RQ4A 3FBFA 4RR5A 4NLUA 4QW8A 1S1UA 1XNRF 4TXSA 2BJ8A 5J2MA 1H2TZ 5T14A 1O0PA 4Y2CA 2V63A 2AT1B 4LFAF 3RB0A 4YEAA 4FYWB 4J9VA 2OTLS 4DFPA 3V6DB 5LMUJ 1DJ0A 1UZHA 1HLWA 2R3VA 2GQQA 4LSLA 5CYMB 2AZ1A 2HRYA 3AD8C 4E98A 1ITPA 4QYZK 1FX2A 1TKZB 3GYNA 5KFFA 2JJ4D 2DGSA 2ADCA 1N34F 3G9CA 1FJCA 4OHVA 4WF9Q 2XLKA 1P9YA 2D74B 1BGXT 2GMLA 3B8HA 4H4MA 2BANB 2QYGA 2HYIB 1VMBA 3S7RA 4DDFA 3GFHA 2BRKA 4USVA 3CCJS 1VFJA 2CQ4A 3M6VA 1NK4A 1FJGJ 1NSAA 4RBUA 5JMNA 2V4RA 2JSXA 2ZJQQ 3BO2A 3W62A 4DV1J 3MM5A 1S10A 5KG6A 3MEDB 4NCBA 2N4DA 3O2IA 5GAEI 3JAMY 2ZKTA 3SQGB 4RW9A 4EUVA 3PW5A 4EI2A 1YJUA 3IXQA 1U45A 2DH9A 5I3PA 4LF6F 3GONA 1SJ1A 2XYGB 4CTAB 4LRCA 2CAJA 5K20B 1YKWA 3CD7A 3HSGA 4UOCA 2ZE2B 5CCMA 2HWIA 5DDPC 2C42A 4KQZA 3L7PA 5HQ8A 4K0KF 2KFZA 1GH8A 4IRCA 2B9WA 4G1QA 3MEGA 3AOBA 3HHKA 4UW2A 1FJGF 1DFDA 3KG1A 3VZHA 4Q0BB 2B9EA 2OPQA 1VQ8S 3RR7A 1X5PA 2MQOA 4ZVOB 5IT9Y 4ERDA 2O01C 1HBUA 5D77A 5I3QA 1UPMB 2QGFB 3IG1A 1XJWB 4QR1A 5JUMA 2I8EA 4ZPBA 1EKRA 4ED5A 3TUIC 2FJVA 1VDHA 3H25A 4BBYA 1FRLA 3EPGA 3H20A 1AROP 4L75A 5ETLA 2PI5A 4G3IA 4ZPWR 3SZ2A 4DCPB 1W25A 2HLUA 4GO5X 1HFEL 2BE2A 4FBTA 2ALYB 2YTCA 3IA0A 3IMQJ 4KAIA 2QL5B 5HL7Q 3M8RA 1VIXA 4DS4A 4CO4A 2BOPA 1RYSA 5LJ5Y 2V6AA 3DN9A 3EDRB 2F40A 1N56A 3D0HE 4Y2AA 4C0BA 1KONA 2KXFA 4I2QB 3H5XA 1WDDA 2HVEA 2XMAA 3OVBA 3N9UC 4JI0F 1UEUA 3CB4A 2DRAA 5LXRA 4DMZA 2AEMA 1SVDA 3EGVA 2R2UA 4U7UD 3LGHA 1S57A 3SIPB 1DTTB 2DGVA 1KKHA 4KGMA 4NLRA 4QWBA 3GFZA 4L72B 1ZPWX 2JLFA 3N0VA 1S0VA 3QO9A 2AGPA 1CULB 2FLOA 2AF6A 2EFVA 3LALA 2GW8A 3F44A 1LK5A 4JI7F 5HMZA 3U27A 3HZEA 1N33F 5LL6d 4DQRA 4N8NA 1YX2A 3NS6A 1P27B 4UT4A 2A6OA 3VQSA 1U26A 1RT1A 1WTFA 2X3GA 1AZSA 2CYYA 5ETQA 4JI0J 3TR5A 3BKUA 1UEKA 3HD2A 1TQLA 1Y5LB 1SH0A 4J5OA 4G6VB 2F8HA 1D09B 3Q23A 2PE8A 2QSWA 1S72S 1E6VA 3K5LA 3OUYA 1R0BG 2CDQA 5DM7Q 2CJAA 2BE9B 2MZJA 1E6YB 1YJVA 2V34A 1SKRA 5IM0B 5E7OB 1QTNB 1R8AA 2HHPA 3PVXA 1Y3JA 2PFFB 2M4MA 2QLXA 3JSMB 3G6VA 4K4XA 5KT6A 1N8RT 1PC4A 5GMEA 4ZVEA 2DGTA 4U7CA 3OXLA 4OX9F 3PHEA 3HI9A 3D68A 2VC1A 4J7CA 4NYPA 4LIRA 1WC4A 2CQ0A 1HQEB 1RK8A 2X3DA 2XHWA 3CJ3A 5GMKa 2RRAA 5AE3A 1S1VB 2IIHA 3TX0A 4DQIA 2DHGA 4B02A 1UA0A 3HSDA 4ZVGA 1HPZB 3W2VA 1XR7A 2M70A 4DSLA 2HHVA 3BBCA 1ICEB 3G6XA 4DL6A 3AA9A 4C3LA 1YG0A 1GEHA 2R2TA 1TK8A 2AHOB 5CA5A 8RUCA 1Q7LB 2HQCA 2V8DA 4LF1A 1Q8KA 4ZVHA 3FFIB 3GMGA 4F04B 1RAOA 1Q95G 3BR8A 3MM9B 5A76A 2C2RA 3LP2A 4DS5A 1X8DA 2WAQD 5GADU 4QW9A 4FPIA 2LA4A 3ET6B 4KKOB 4DR7J 3FVYA 3JSRA 5I3UA 1FXRA 5B0GA 4C98A 4OLPA 3OTOJ 2C2NA 3ILIA 2DXFA 4NCAA 3QT7A 2A10A 4W90B 2FHKA 5ETOA 3QGPA 1WD6A 4L76A 3NGSA 2NS1B 4N76A 3RB6A 1C4CA 2WBMA 1E6YA 2AJ4A 1L3SA 3KJFB 1S9EB 1WHWA 2LXIA 3ZO7A 2IVFB 1E6VB 4HR2A 4B9TA 5KT4A 1KQGB 4DV4J 4KR0B 3LGMA 3D5MA 3SQOP 2Z57B 3U02A 3BSOA 2A2DA 2I38A 2VF3A 3TUPA 3DXSX 4X4UA 1WOPA 2OPRA 2XMMA 4G65A 5BXIA 5IV4A 5J1EB 3UNYA 4TU7A 1QSYA 1Z4UA 2K7KA 3LH2S 3AD9C 4IH7A 4W92B 3I0SA 1C1CB 3HZGA 3ZZZA 4NZ0A 4ZA1A 4K4WA 2EK6A 2K1RA 2ALZA 4PXEA 3VCDA 1KVKA 3DRRB 5LXYA 4CH1A 2OGUA 3ZTSA 2UXBJ 2RF2A 4I2PB 3DLGB 1RAGB 1CG2A 4ETXA 4J9PA 2PMHA 2DO4A 5E41A 1NJYA 2DNMA 2B4VA 3BSAA 5T41A 3RU0A 1AW0A 1LQ9A 4K5SA 2RNEA 4ZIWA 1RTIB 3KHHA 5J2MB 2HVIA 3K8WA 4DCJB 3M2UB 1QAYA 4U7UK 4WIQA 1N6QB 2E5HA 3OR1A 2YQ3A 4ID8A 4RKUC 3H2VE 3G4SS 1I3OB 3IWLA 4NEYA 2VQEJ 3PX4A 2DPIA 4NLGA 1UW4A 1XWLA 2PA8D 2XMKA 3MCOA 5D15A 9RUBA 2Y8YA 1Q8BA 5A0YA 1SI9A 1FX4A 5KFDA 1DLOB 3IM9A 2QA4G 3HVWA 2QLBB 2W8KA 2V0NA 1T9XA 3CMES 3M2VA 4JI2F 2RIJA 3ZTOA 4HT7A 3D6TB 5C24B 4F4ZA 1HHTP 3TX8A 1Q16B 4KGZB 1F2HA 3J80U 1DQ9A 1HBMA 1H7XA 5L46A 3KLHA 5KFLA 3CC7S 2HHTA 2OTJS 3FQLA 4P71A 3M9OB 5E3RA 4CLWA 3KMQA 2KHCA 1FNMA 2NPFA 5ETVA 5F0WA 2LDIA 3AQPA 3DDIA 4YUDA 3AJ2A 4OYPA 3H0PA 1HBUB 2BRLA 2ZFHA 3OLBA 2UUTA 1LK7A 3OR2B 2E1CA 2XHCA 5EN1A 1LW2A 2WB1D 4BWJA 3F41A 4JI2J 4YOEA 2GJ2A 3BGLA 3SDEA 3VGSA 1DTQA 5THWA 3T6BA 3BS9A 1IQZA 2CG4A 5L8RC 1U0HA 2FHOB 2BVZA 2HIQA 2NYIA 3DNCA 1H72C 2ZH6A 2RDIA 4N77A 2J7WA 2DNYA 2DXDA 4XIUA 3DLLQ 4UY85 1ZZFA 3K59A 2FJAB 1LFPA 1BXNA 4LF7J 4C9DA 4OZ5A 2GC8A 2MLYA 1L3TA 2WZ1A 1REGX 4P73A 4M94A 5C5JA 1U48A 3NMAA 2XEXA 1H73A 3NS5A 4ZPDA 3A13A 1Y00A 1CJKB 2EG2A 1FO1A 3LGNA 3E8OA 3QWPA 2MQQA 3H5YA 1FI4A 4LF9F 3DOMB 2NXEA 3W7BA 5L1LA 3X3UA 3I0RB 4MK8A 2HWHA 4NLWA 4OYMA 5CYMA 1KLNA 1NAQA 2B6AB 2UVUA 2ZEJA 2I6WA 2HHQA 4ZLLA 3J7Z5 1VI7A 2JFDA 2DH7A 2EKYA 2CADA 2NLWA 1Q78A 3C15B 3M7VA 3K57A 1UZDA 1X5OA 3MR5A 2E1RA 1VIOA 3Q83A 4KE5A 3PV8A 4DPUA 4UY8T 2RAQA 3A3OB 3MPWA 3MFIA 5D0HA 2P9CA 4ZLNA 3RTVA 2AW0A 1VQYA 4J9LA 1RTHB 3AJ1A 2P2CB 3FEXB 5IS2A 2VOPA 3R97A 1S79A 4RW7B 3TVYA 3MMJA 1HQUA 4CH0S 4DV3F 2KZMA 3SSSA 1U8SA 1QY7A 2GO8A 4ZN3A 5DZ7A 2XCPA 4H4OA 1X4EA 5I3UB 3W5YA 3GSDA 2KO1A 1ELOA 3D28A 2GGPA 4WYLA 3CO0P 4R0JA 2D9PA 2ATCB 3EJMA 3MEEB 2OPQB 4FN5A 5KFZA 3H40A 2A2CA 2LMIA 3HHLB 1ZM9A 3IBCB 2IA0A 2L08A 2A6MA 4RUCA 2FYXA 2FVPA 4KGXB 2R7RA 4HHJA 2VFUA 3N6MA 4F2SA 1NU4A 3NG8A 5KT2A 3F73A 1N33J 4FP9A 3E51A 2VUGA 2QG9B 1PSDA 5K8PA 2IBKA 4MIAA 4RUHA 4DPYA 3GFYA 1VQMS 2ABYA 4LBHA 4XPCA 4F25A 1I5OB 1HQEA 2VDHA 3THVA 1DAXA 4RWXA 2BKPA 3M8YA 4J90A 1H2VZ 4AD6A 1O51A 3GFXA 3S6EA 4DPTA 4E8UA 5LJ3Y 3B4MA 3W2WB 3KLEB 1QE1B 1KNZA 2BJDA 3DOMA 1N32J 5BYRA 4USMA 5AJ3F 4B9NA 3MCMA 4W4MA 3UFCX 2LA6A 4X62J 1TZ0A 2W01A 3D3CJ 1S0OA 4MIBA 1PBAA 1REVA 4ZCKA 3H4BA 2KL8A 1S12A 1PO6A 1NK9A 1GTHA 2GMJA 4OJGA 1BD6A 1GMUA 2Q79A 3DLEB 4CLYA 1TKTA 5DLGA 1F1BB 3QRQA 1ZPVA 2Z2YB 1IBMF 1XNQF 4WZQA 1S6QA 1S0NA 2M88A 1UTAA 1X0FA 3DRYA 2MJUA 1XMBA 1HBOB 3JTNA 1Q7YT 3H2UB 1N32F 4CZCA 3R5GA 1VYAA 2R8IA 4ZJLA 3UD3P 2HNDA 4B17A 4P9SA 2V8GA 4S0MA 3UDLA 1O6XA 3CJ0A 5CHCB 5T7LB 2BXJA 3AHPA 1RA7A 2EBEA 2DBBA 1NK6A 2JC1A 1JB0C 3TRGA 3PKYA 2HGLA 3MOZA 2ZH5A 1X5TA 3ISNC 1NKCA 3D6MB 4PUOA 1IVZA 1VLYA 3TUZC 4FKYA 3HHDA 4CM2A 2CWXA 1EX8A 2DB1A 3Q22A 3W9JA 2AU0A 1C0TA 2V9KA 2OD6A 3L4BC 4JV5F 1NH7A 4RBTA 4GKJF 2KT5A 1MMNA 5HI7A 1VQPS 4DPXA 2IMWP 2ZVSA 1S59A 4K2JA 4BDPA 2OHDA 3PG9A 4WWSA 2O3DA 2X7IA 1WC6A 2Q6BA 4JUZA 3NCRA 4NL5A 1GX5A 2Y1IA 1T03B 3EE3A 3BYPA
chains in the Genus database with same CATH topology
4RW4A 2VFRA 1N5SA 2YX1A 4BC9A 3ENVA 3MMCA 4HT5A 5J2PA 2MYFA 2QA4S 4N47A 2HHSA 4J9RA 1KSPA 3FSXA 3TUJC 1S6QB 5KFPA 1X4FA 4AXIA 1FERA 4WKYA 3GZ7A 3CWJA 2VZ9A 2HMIB 2IA6A 2DR5A 4WXOA 2WSFC 1L3KA 3NNCA 2RRNA 1H6KX 4ZP7A 5LMUF 4ETZA 5HO4A 1ZAVA 2HG4A 4ALZA 3T9ZA 1JLCB 2HVZA 4HLBA 2O5DA 2LU1A 3I31A 1FRHA 3T1HF 3KOAA 4JOUA 2RE1A 2X1GA 2GIRA 1R31A 3CCRS 1M1KT 1F60B 2DISA 1JJ2R 4NYOA 4B3SF 2DO0A 4KIAA 1PILA 1HD0A 2KVIA 4V19J 3NNAA 1RQ0A 4F02A 2XC9A 1HNXF 2KN4A 2WSCC 4USIA 4ZCMA 4FXVA 2MKCA 4WFAQ 4Y2MA 3J81Y 3LAKA 3UCGA 1C4AA 3C6UB 4LSNB 2YKQA 1ZBTA 2N4CA 3ITHA 3U7JA 1JJ4A 3POTA 2HQ3A 2M0GB 2IM1A 5L1JA 1R6YA 3FMBA 5H9EJ 3IRWP 2RRBA 3CF5Q 4QZVB 5ITHA 3MM7B 4URSA 4F4KA 3DLBA 1N6QA 3KFWX 3RAMA 2LXUA 4HEA9 4HH0A 2X1AA 3IS9B 1R8PA 5HMWA 1DQ8A 2R7WA 3MMCB 1U25A 4FPRA 3UE2A 3IO1A 5DG9A 2BZ2A 2J9DE 2HWTA 2J8AA 3HJFA 4CO3A 3BJYA 4I67A 3WDOA 1U6BA 1RP5A 4WE1B 1SUQB 5FDLB 1KS2A 2FGCA 3NCQA 3D54A 3S1TA 2BQ3A 2XCAA 2LU2A 1I1GA 3L7OA 4DR4F 2N3LA 1NJIT 2EFQA 4O23A 4O0IA 2B4UA 1VQ5S 2UVVA 1FKPA 2U2FA 3FNNA 1SJ4P 4XAKA 4USHA 2AQ4A 5FJ4A 1X9SA 2VBXA 5IT0A 3MPYA 4ZHRB 3ZZUA 1NK0A 4IQXA 4KTQA 4XPEA 5GAGU 5A6PA 2YNHB 3ZZ0A 2XMWA 4WYWA 5I4MA 1U1KA 4Q45A 1JIHA 5J2QB 2LQ5A 2YNHA 3K5NA 3PW0A 1L5UA 3CEDA 4PWUA 4PQUB 1J5OA 2M8HA 1K73T 4ED7A 4PWDB 2HFNA 1SB6A 4PXDA 3IAM9 1FE4A 4TYBA 5KFTA 4LFCF 1JNRB 1HNIA 1RT2A 1YQHA 2PSZA 4OL8A 2OO4A 3HX9A 1HD1A 4C8MA 2XB2D 5J2PB 2FUG9 3QJPA 4DR6F 3I6PA 2CPJA 5B0AA 4A46A 2V4JA 1U47A 2XY7A 3BREA 1FK9A 2GX8A 2YVSA 3M30A 3TVZA 4AUKA 1TL3A 4RW6A 1HPZA 3B4DA 3W2VB 2ERRA 2IAJB 4HH1A 1G1XA 3P96A 1R7IA 1WF1A 4F67A 4K4ZA 5H9FJ 1S1XA 1RI7A 2IAJA 5JJBA 1M5SA 2FVCA 1TL3B 1NEEA 2ROPA 1SV5A 4QIGA 2VODA 1M5HA 2J76E 4X4PA 2VKZG 1RYRA 1RTIA 2M2BA 1YWXA 4YR0A 4DR3F 4C8OA 5HMYA 4DG1B 1QAXA 3FRZA 4OIXA 4WTYA 2XGPA 4TY8B 4HTJA 3KMSA 1NNDA 4EEYA 1WG4A 4K5RA 4FS2A 4OI0A 4KGKA 7FD1A 4OZLA 1XC9A 1FVQA 4URQU 2L3MA 2FIUA 4CO2A 3M8QB 4NLTA 2YWHA 4PR6A 5A6WA 3JTPA 4QR2A 3T9NA 3ZFVA 4CQ1A 4IYQA 1VQ7S 2W9CB 1WELA 3CCMS 3CCVS 1FDNA 3U1MA 2IBOA 2KJWA 2RB7A 2C2DA 2KDOA 4WZMA 3MEGB 4MYUA 4A8XA 1OSDA 2PMZD 3TAMB 2DPJA 2K2PA 4RW9B 1B0PA 4PKDB 1YITS 2ZBCA 5C25B 2NUHA 3HVAA 1FHTA 1RGVA 1U24A 4IG0A 3PXGa 1NH8A 2DK2A 2HGMA 2MZQA 2EFOA 5D4OA 2ZH4A 1CC7A 3V5RA 1HL6A 2FVRA 3RW6A 2HHWA 3HPOA 2YKOA 2ILZA 3EX7B 2VPYB 3NL0A 4JI4F 3V4IB 2HNYB 2QFJA 3J7A1 1BY9A 4K50A 3W2WA 3VF0B 4ES2A 2LQJA 3M4XA 4H4MB 3WX4A 4CT8A 1LW0A 4PG6A 1YRXA 3CSKA 4Q2MA 4TY9A 4EYHB 3V6DA 2JRSA 1U1MA 4HL9A 3R5DA 1LFWA 1D3WA 1HYSB 2NSBA 2BW2A 3KG0A 3QPIA 3MAQA 4OI4A 1FKOA 2MHEA 2V2KA 1R8HA 2W8LA 2ZJQQ 2WONB 5JXSA 3GIIA 3THTA 1OSCA 4YY3F 4B9MA 3UPFA 3E2EA 1UWBA 1ZETA 4RU9A 2AYBA 2GV1A 3CJKB 2R7UA 2DNPA 2UV8G 1JLQA 3IWNC 3BQ0A 2WONA 1HBNB 1LWCA 5KG2A 1VBXA 1RT6A 3KLHB 2J6SA 2XMUA 1F5AA 2RDJA 2UP1A 3HVTB 1N5QA 1VRUA 1SKWA 4UUWA 1MU2A 5CXTA 1GTEA 3FZ2A 5DM6Q 3TOQA 1TL1B 1U1QA 1X9MA 3SMZA 5IM0A 4ED1A 5F8GA 4NLSA 2MKHA 5CCLA 1KRPA 5IZHA 3WBZA 3MF5A 3WZ0A 3US5A 1K0VA 1BQMB 3BSCA 2RMLA 4A8SA 2B51A 4Y34A 5C42A 3GYXB 3Q2SC 1S1WA 1UMJA 4HI2A 3ISND 2J0WA 1S99A 1SIZA 5HP1A 4YR3A 2EI5A 2V8VA 1HHSA 1B7FA 2QLWA 2PT0A 1VRTB 4JI6F 4ZP9A 3GIMA 1TAQA 5DGBA 1RT7B 4ED8A 2W9BB 4B3OA 2GHPA 5I42B 4KBIA 4I2PA 4TN2A 5CZVA 2YWEA 5GADI 4NOHA 4QOTA 5ADZA 3OLAA 2ROEA 4DQSA 3OV7A 2W7PA 1VQ6S 3KK3B 1UEVA 3KK2A 1P6TA 2NUUG 4G1PA 1C0UA 4RLEA 1QAJA 3DRXA 3UW1A 2OIHA 1H3DA 4PPDA 4C8NA 2QSFA 2LECA 5KG3A 1JLBA 3T5KA 4B9UA 4OJHA 3BDEA 3QAEA 5FIIA 5KTQA 1RT3A 5K8MA 5DDOC 2JEFA 2VPWB 3CCQS 5A0YB 1LKZA 2BQRA 1U1NA 4IDKB 1Y0HA 5C24A 3LP0A 2GIQA 3VR1A 4CO5A 4YMEA 2HFZA 3LWMA 1Y7PA 2MZRA 1B0TA 4FS1A 2KFYA 2EWHA 1JLBB 3DOKA 4ID5B 1KOHA 2B7CB 2V8HA 4B08A 5DGAA 3I9ZA 3KLIB 2VH7A 3R27A 4ATNA 1JKHB 3K5PA 3IN5A 2XNQA 4MIWA 1KN6A 2ASLA 4O4GB 3ZC4A 3IRXB 5D4NA 2B0GA 2RKIA 1HI1A 3DOLA 3KNGA 3DMJA 3QIDA 1Y5IB 3TX8A 4UQGA 3DLGA 2KH9A 4HVZA 2NSCA 4C4WA 2E44A 1FKAF 2WSEC 4PPZA 1CLFA 1RT5A 2K1RB 1HNWF 2BR0A 1BC6A 2MPUA 1FT8A 2YWKA 2Y1JA 3M6UA 3PNIA 3V4MA 3BM7A 2V94A 3V4IA 1RTJA 1FXLA 3QZ8A 3BEGB 4HDGA 3RYLA 3T5JA 5DQGA 3QLHB 1HMVA 4YFUA 3KYLA 2VPZB 3DM2B 1NZAA 1Q82T 3NWGA 1TKZA 1WF0A 2JZ5A 4OZ1A 1N5YB 2HS3A 4A48A 3IWXA 4M5DB 4P7VA 4A8KA 2ADBA 3B82A 3G71S 4DUYF 5LSOA 4MK9A 2E7XA 2O1PA 2OKQA 2ZD1A 3TAMA 3P3DA 1FDBA 2DHXA 3N6LA 1RTJB 2VFVA 2COLA 2ZBIA 4K4SA 3PX6A 2UXBF 1T3OA 2A1BA 4H4OB 3PIPQ 3RB4A 4OZ0A 1JMTA 5J1NA 2DTJA 5KG5A 2WW8A 3AY0A 5SZTA 5L1IA 3C66A 2MB0B 3M32A 2OMLA 2RKIB 3DOLB 2W9AA 4O44B 3Q8RB 2OPPA 3UR3C 4I69A 2AJQA 4DV2F 3J7YU 1J2VA 1LW0B 2AJ0A 4UQTA 4RW4B 3CGIA 3M1VB 1RISA 3M30B 5J2NA 2PA3A 4X66F 1TL4A 3C6UA 3C8YA 1YBAA 1C2PA 1SBRA 2HAIA 3KLGA 2KG1A 4WU3A 1GAOA 3BF4A 4QWDA 3QYYA 2CPEA 2CZVC 1KFSA 3M2RB 3VAMA 4CCHA 2J9DA 2DGUA 5KFUA 1SXLA 3QJLA 4DL5A 2N7YA 3O6QA 3JB9k 1RDRA 2YNFA 3PFEA 3NNHA 1VK8A 4NMLA 4A4JA 2B3TB 4Y0FA 1OS5A 1UKUA 4QWEA 2VBWA 4Y28C 2R7QA 2QYCA 2F8EX 1JK9B 3F56A 5EUHA 5F9NA 3TW0A 1Y4ZB 2AJ1A 1U1RA 3GV8B 3ZZRA 1BWEA 3BDPA 2E5JA 4TQRA 2Z0GA 2XNRA 5KFKA 2OLWA 2L41A 5E3PA 2V9WA 1WTBA 4A8OA 2FLPA 1UVNA 1TKXB 5EX3A 5B0EA 5K14B 4ZPTR 4ES3A 5EHHA 4USJC 1CVJA 1R0AA 2KRRA 3K58A 2HZCA 1R8BA 4OV1A 3AQOA 2C3UA 2DNGA 1Q79A 3DHXA 2ZDOA 5C42B 2FVQA 1LWEA 4X4QA 2ZZMA 4WFZA 1LXJA 4RNOA 4C11A 4KPYA 3GQCA 4YDXA 2RUGA 2R8JA 1VC6A 3M1VA 3T6JA 1R3NA 1BQNB 3BN4A 4M1KA 3GWCA 3S8SA 5MLCV 3I5CA 2D9OA 5F3ZA 1RTDB 1RKIA 4FF2A 2JEIA 5D4PA 1RT6B 1MWYA 2PN6A 2MSTA 1X9WA 3HKZD 4PG7A 4LVNP 3J7YI 4DJBA 4DPOA 5KFNA 2E9RX 1X0PA 2CPHA 4DL0C 5HROA 4X4OA 3PM9A 3HMJG 2FC9A 3OVSA 1SL0A 1YJ9S 1TR0A 2UXCF 1Y5NB 3QIPA 2ROGA 3V2UC 2ZHBA 4JV1A 2E5IA 3A8EA 3CCUS 1F2GA 4QPTA 1R89A 4AL6A 2KKHA 2CJQA 5E0OA 4ZDNA 4YR2A 4F4WA 3TA0A 3MEKA 2MY8A 2AJFE 2MMYA 3DYAA 2CQPA 2EW9A 1XK8A 3LO3A 2DD8S 1HW8A 2Q3PA 2CPXA 2ZITA 2Z4PA 2ASDA 4C8KA 4J9NA 2R8GA 5AXLA 1GXLA 3ISZA 3CMAS 2CQBA 2YKMA 2F8MA 2YKNB 3MMAA 2MZTA 4PQAA 3N5BA 1YJTA 1LOUA 3K7RA 1HNZF 2C22A 3LF0A 3E3XA 3TO8A 1AFJA 1IM4A 3H5SA 4O4GA 1FD2A 2KM8C 1XR5A 5F41A 2G1DA 4DL7A 1GXTA 3QMQA 3HKWA 3I55S 1G3OA 5U47A 2MGZA 2MHNA 2FLNA 2HPUA 4X64F 1VQ9S 2OPSA 2D3ZA 2IRYA 2DNRA 1S1UB 3LANA 4YB1P 5L9NA 1KQKA 2CPDA 3CD6S 5DS7A 2N3OA 1FRMA 2E29A 4P7TA 1JLAB 3BO4A 2B4OA 4KT0C 1S48A 1NJWA 3EXCX 3K2YA 3HLUA 4F26A 3CCZA 3LAMA 2XY6A 1HBNA 1LWCB 4ZVFA 1FCAA 4NLPA 4M5DA 1RWUA 3P5TL 4AL7A 1KHVA 3FMWA 5M2RA 2M7SA 2IC3A 3EGNA 5EWEA 4J37A 1EP4A 2MQNA 1SH3A 2I0XA 4LQ3A 1HBOA 2FD2A 4F3MA 3VAHA 3TARA 3WC2A 4IOCQ 5KFGA 2R4FA 2HNDB 3RRKA 1JLCA 2QEXS 5KAKA 4ES1A 4Y65A 2K7JA 4BS2A 3I96A 1X4CA 3H4DA 2XI3A 3EXYA 1Z2LA 1L3VA 3IGVA 5KFCA 1ZZNA 4OI2A 3OTOF 2HNYA 4JI5F 3I5AA 1WG5A 1IXKA 5GAEU 3MM6A 4TQSA 2CVIA 4OJ3A 3MUMP 4Y00A 2MXYA 2OPRB 1QE1A 3PEHA 4DQPA 1U2RA 5J2NB 1KFDA 1IKXA 4I6YA 4Z37A 3NRBA 4X4RA 1FEHA 3O5TB 4QYRA 1QSLA 1S0MA 2BUNA 1HARA 1DRZA 3RW7A 1TV6A 4MKBA 4LSLB 2KHDA 1ULRA 1Z2ZA 4N56A 1WNEA 4O3OA 1Q86T 2AX0A 5DRKA 1M5VC 4ZPCA 2LQ9A 2CJKA 1K1SA 1WEXA 1AFIA 5FDLA 2CIMA 2LEPA 1ZYQA 3VAJA 4PG4A 4DLGA 3TI0A 2FHJD 1QUPA 4X4SA 5G0RA 1KHWA 3FEZA 4KV8A 2W7OA 4DFMA 2BABA 2MQMA 5DDRC 1UJ6A 4FZVA 5CYQB 4F8RA 1H2UX 2CPZA 4G1QB 3TYTA 3RAQA 5A8RB 4OHYA 1Q4RA 2D1CA 3NBPB 4QIVA 4OZNA 2MKKA 1U1LA 1RTHA 2FJXA 1WEZA 2CQ1A 2E9ZA 3MMBB 4DWIA 4IRKA 1MNEA 4MH8A 4CI0B 4WFXA 4CTAA 4TU8A 5A8WA 3OTDA 4C8YA 5EX0A 5KFQA 5KOWA 1RT7A 4ED2A 3CC4S 2DHAA 4ZP8A 3TA2A 3DGPA 1KC8T 2F4VF 1ZAXA 1Q8IA 3B78A 5AXKA 2W7AA 5FLXY 3RR8A 2GHVC 2FB0A 3SV3A 1K1QA 1OQ6A 1G6BA 5J1EA 2Q66A 4QCLA 2ZUGA 1S97A 3QAUA 1O5JA 1XN9A 4U9RA 3MM6B 2PIIA 3GV5B 1U6FA 2I1RA 4IFVB 2K8GA 2RVJA 3DFEA 4NLOA 3G6YA 1DTQB 4O3RA 2G0CA 1H38A 4PQUA 4DOZA 2KRBA 1K0TA 5BYSA 1X4DA 3K5OA 1FJ7A 3QIPB 1XERA 5HBMA 3T5HA 4DX8H 3MDFA 1QTMA 4DR5F 2XS7A 3KNAA 2QT7A 3MPVA 5CYQA 3DXBA 1V6HA 4ZLPA 3VAFA 3HHNB 1YI2S 4DN9A 4IH6A 1UFLA 3M9NB 1UVJA 5DETA 1Y9OA 2YNFB 3PR5B 3MM9A 3ULHA 1FDDA 1N0UA 4EO8A 3IAS9 2M5YA 2NPIA 4FXWA 4R5PB 5BYQA 3IR5B 3LP0B 3I9V9 1QJHA 4NCGA 1VQNS 3DHWC 3QO9B 2ZM6F 4OHWA 1T94A 4Q8FA 4EGLA 4QWAA 4OFZA 1AUDA 2BM1A 2ASJA 2GHWA 5E33A 4C7QA 5CD4H 1T05A 2PI4A 4FVMA 2O67A 3C6TA 3M2VB 1SL1A 1R8CA 5DQIA 4Q8EA 3OSPA 4PXCA 2FJBB 2ZC3A 1IR0A 3S01A 3K5MA 3OXGA 2V4JB 1ZTWA 4LVOP 4UUXA 1TKXA 4QR0A 1V3RA 2GQCA 4LJMA 5KFBA 2XMTA 5KFRA 5F8MA 2QA2A 2YKPA 4C0OC 2UVRA 1R0AB 2HHHF 4Q44A 1W2IA 2BA9A 2RF2B 4DUZF 2A18A 2LQBA 3DRRA 5F9LA 2I5JA 1QUVA 1RT2B 3R5BA 3ZZYA 4AQYF 4A8YA 2R9LA 3I0SB 4ILMA 4PRFA 4PWDA 5B0DA 2NQPA 3DDKA 1NKEA 3ZZOA 2IRXA 2F3JA 2E9TA 4O3NA 1JX4A 5KFHA 5KT5A 5DLFA 1N36F 3HK2A 2R7XA 1RT4B 3GR1A 5D3GB 1S76D 4PG5A 4KSEB 2LXFA 5K9FA 4RZRA 1DARA 3PJWA 4DN0A 4DV0F 4DFKA 4IO9Q 2JFKA 2JOQA 2R2RA 4ZPVR 2EFPA 5FD1A 1MU2B 2VG6B 4NLDA