2MQPA

Structural investigation of hnrnp l bound to rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
QKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Investigation of hnRNP L bound to RNA
rcsb
source organism Rattus norvegicus
molecule tags Rna binding protein/rna
molecule keywords Protein Hnrnpl
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11835 RRM_8 RRM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mqpA01
2E5GA 3H2VE 2JVOA 1U1RA 1ZH5A 2EVZA 1M5VC 3MD1A 2DNNA 1HD1A 2CQPA 1VC0A 2J8AA 2KRBA 2MZJA 2DGXA 3MUTP 2J0SD 5D78A 2KM8B 2KG1A 3Q2TC 2V94A 4WKRA 3NS5A 1KQSR 4OZ0A 2LXUA 3MDFA 2ZJRQ 2HZCA 2DHSA 2LQ5A 2AYGA 1YJWS 2N3OA 2MGZA 5GADU 4F26A 4CH0S 1G2EA 2KFYA 2FC9A 3K0JA 1WHVA 2XNQA 2DIVA 1U1PA 3G71S 3VAKA 2LEBA 2DB1A 2DNPA 4TLQA 5GMKa 2OTJS 4F02A 3VF0B 1WEXA 5GVQA 3UCGA 4TU9A 3H2UB 2F3JA 2BOPA 2WBRA 1VQ4S 1VQ9S 1D9AA 3NNAA 2JVRA 3UCZP 2L9WA 3PIPQ 1K73T 2FY1A 2VODA 2K8GA 1H2TZ 1CVJA 1VQ6S 4V19X 4Y00A 1IQTA 4FXWA 3THPA 2X1AA 3ULHA 3I55S 1OO0B 1U6BA 3CCJS 4U67Q 3VAGA 2DHXA 1S79A 2CQ0A 1X4AA 1ZZFA 5DM6Q 2PE8A 2RU3A 2DNGA 1YI2S 5H1SV 4P6QA 2LYVA 1RK8A 2YTCA 3UE2A 2DNLA 1URNA 5CYJA 4W92B 2DGSA 4Y0FA 1VQPS 2CQ1A 2MSTA 5IQQA 3FEXB 4OZ1A 1WI6A 3ZZZA 1XN9A 2DNOA 3BO3A 2AYBA 2LA6A 1BY9A 5LJ3Y 5D77A 3SDEB 1VBXA 1M1KT 2MQOA 1K9MT 1UW4A 2VONA 3MD3A 1QM9A 3IRWP 2CQIA 2HGLA 2RRBA 4TU8A 1X4EA 2N7CA 3N9UC 4WFAQ 2MKJA 3CMAS 2JWNA 1KD1T 3BEGB 1U1OA 2CQ2A 2DITA 3D2WA 4PRFA 5HO4A 5LSLA 3I56S 2CQCA 3CD6S 3OW2R 2OJ3A 1KOHA 4C7QA 1SJFA 3G8TA 4QPTA 3Q2SC 3LQVA 2D3OR 4J5OA 3U1MA 4WFBQ 4ED5A 3V4MA 3VAMA 2MMYA 2I2YA 4FXVA 3S6EA 2M2BA 3HI9A 2DGWA 4BS2A 3R1HA 2RUGA 2B0GA 1U1KA 3UD3P 3CCVS 1S72S 1A7GE 2N82B 1DRZA 5DDQC 2D9OA 2MZTA 2M7SA 3CCUS 1FNXH 1R8HA 4IOCQ 2MQQA 2M52A 2CPFA 2LXIA 1U1NA 5IM0A 2X1FA 2MGZB 2MKIA 2DGVA 2D9PA 4ERDA 1VC5A 4IOAQ 2X1GA 1WG4A 3IWNC 2RQCA 1SJ4P 3EX7B 1HD0A 3RW7A 4YB1P 2KXNB 1QVGR 2YWKA 2M9KA 5DDRC 2FPHX 3CPWR 2OTLS 2EK6A 1WHWA 2E5JA 1X4CA 2MKCA 1Q86T 2A3JA 2M0GB 2OIHA 1L3KA 2MZ1A 2UP1A 2NZ4A 3VAJA 2CPXA 1M5PC 2KH9A 3ZZYA 2KI2A 2DGUA 1YITS 1WEYA 4Z2XA 2E5IA 3EGNA 2X1BA 1X0FA 1X5OA 5IFMA 1PO6A 2MKKA 2XNRA 1WEZA 1VQLS 5LJ5Y 4IO9Q 1VBZA 2LA4A 4WFNQ 4CQ1A 5JVHQ 2YH0A 3G6ES 5GAGU 3SMZA 2U1AA 2CQ4A 1D8ZA 1SJRA 4QU6A 2L08A 2RS2A 1WHXA 4A8XA 3MURP 2O3DA 4UY8T 1WI8A 1QVFR 3HHNB 5EN1A 1VQMS 2YH1A 1YWXA 2MB0B 3BS9A 5BJRA 4LJMA 1X4DA 1X4GA 2DNHA 3CCES 2F9DA 1X5TA 3UD4P 2KU7A 5LXYA 2RQ4A 2CQHA 1FXLA 4WIIA 2KYXA 2AD9A 4LMZA 3G9CA 1FJCA 2L41A 2M4MA 4ZKAA 3NNHA 5FJ4A 3CCMS 2U2FA 2MKHA 1Q7YT 2DISA 2DNKA 3MOJB 3CCQS 3THTA 2ERRA 3CF5Q 1N52B 3VALA 3J7ZT 3G8SA 4WF9Q 4YOEA 3TO8A 3NMRA 3L3CA 1Q81T 2MXYA 3UCUP 2G0CA 3P6YC 1K8AT 1M5KC 2ZJQQ 4C0OC 3BO2A 2M8HA 2VOPA 2XSFA 4QU7A 1P1TA 2DIUA 1U1MA 2DO0A 2MQLA 1YHQS 1A9NB 1WG5A 1VBYA 4RU2A 1RKJA 3B4DA 1VC6A 1U1QA 1Q82T 5DETA 2CPHA 1U2FA 4UQTA 2CPZA 4W90B 1M90T 1H2UX 3DXBA 3R27A 1VQ5S 5IM0B 4QQBA 1YJNS 1YTYA 5MLCV 1VQKS 2NLWA 2DO4A 2CQ3A 1DHMA 1WG1A 4PKDB 2XS2A 2CQBA 2HVZA 5CA5A 2G4BA 1SJ3P 3CC4S 1WWHA 3J7YU 1ZZNA 2CPDA 1WTBA 2DH8A 2E5HA 1WF0A 3SXLA 2DGQA 2MZRA 1B7FA 2ADBA 3LPYA 2MQMA 5HL7Q 3CCSS 4F25A 1UFWA 1NJIT 1KC8T 3BO4A 3G96A 1AUDA 2MKSA 2VOOA 5LXRA 4WCEQ 3R1LA 3NNCA 1U6FA 2JX2A 3U1LA 1X5SA 5JVGQ 2EK1A 1NU4A 3MUMP 1X4HA 2LEAA 2XS5A 1WELA 1N8RT 3EGZA 2MZQA 1OIAA 2K3KA 2QA4S 2LECA 2HGMA 2YKAA 3VAFA 2CQGA 1O0PA 3S01A 2DH9A 2F9JA 5CXTA 2RVJA 1UAWA 5ITHA 2FHOB 3PIOQ 1YJ9S 3DLLQ 4M5DB 2DNRA 2RS8A 2M8DB 1X4FA 2DHGA 1SXLA 2KHCA 2KM8C 2HYIB 3NS6A 2FC8A 2MZSA 2J0QD 1FO1A 2LKZA 2XB2D 3P5TL 1YIJS 2E44A 3CXCR 1JJ4A 2DNYA 2MSSA 2MQPA 5DDPC 1DZ5A 2LCWA 4YUDA 2KRRA 2KXFA 2MY7A 2Q79A 1FJEB 2PEHA 4IUFA 1R8PA 3MXHP 3US5A 1FT8A 2RT3A 1W2BR 3CUNA 2LMIA 1N54B 2CQDA 2M70A 2KT5A 3TYTA 2CPYA 1WF1A 1WHYA 3CC2S 1H2VZ 2DHAA 1OWXA 2MPUA 2DNZA 2MJUA 3CULA 2GO9A 2KXHA 1DBDA 1F9FA 2MY8A 2GHPA 2JRSA 2QFJA 5LSOA 1X5PA 3MI7X 3S7RA 4TU7A 1VQNS 1VQOS 3RW6A 4EGLA 2J76E 5GAEU 1VQ7S 2DH7A 1HA1A 1PGZA 1JMTA 1SJQA 1FJ7A 2XS7A 2KN4A 1OPIA 3G4SS 3B4MA 2G1DA 3CTRA 3CCLS 1UP1A 2CPIA 2KVIA 3P49B 2I38A 5DDOC 5DM7Q 3MUVP 4CH1A 1VQ8S 2OSQA 1JJHA 1N88A 2DNMA 2SXLA 3CCRS 4C4WA 3CC7S 3FEYB 2CPEA 3VAIA 2RRAA 2DGTA 2MHNA 2ADCA 2M88A 2N3LA 2DGOA 1NO8A 2OSRA 4CIOA 2QEXS 1U1LA 3CMES 2MQNA 5GAHU 3JB9k 1KOOA 1FHTA 2BZ2A 3UWTA 3SDEA 2DNQA 2RNEA 4LIRA 2MJNA 1H6KX 2CJKA 2AYMA 1X4BA 2DK2A 1P27B 2AYEA 1JJ2R 2ZJPQ 3TP2A 1HL6A 3S8SA 1M5OC 1WF2A 2MYFA 4PR6A 3VAHA 3P3DA 2HGNA 2KG0A 2CPJA
chains in the Genus database with same CATH superfamily
1QUPA 2EW9A 1LFPA 1VLYA 2E5GA 3BBBA 3ISZA 3N6MA 4BBYA 4KFBB 3KWMA 4C97A 2R8GA 3BV8A 5C5JA 4J90A 1S1XA 2ASYA 2FVRA 1HQUB 3D6TB 2VC1A 5KFLA 2QMWA 3NGDA 1TK0A 4NLYA 3AOCA 4KH1B 1RT2A 4IFYB 1HD1A 2CQPA 1BLUA 2O5DA 2J0SD 3MUTP 4DX6A 1F5BA 2KG1A 1UPPA 4YDXA 1Q4RA 2ZVIA 2ZZNA 3C6UA 2FHJD 2BACA 3T19A 2H65B 2I5JA 2LXUA 3MM8B 4LRDA 4A8KA 4AXIA 1UFKA 5AXNA 3J81U 3IR5B 2KO1A 1IBLJ 2QLWA 1UEKA 4R8UB 2AYGA 5CQGA 1MG7A 3G87A 3CJ4A 3W2WA 5GADU 2W8KA 1T05A 2XLIA 3GQCA 1U49A 1X9MA 1RT6B 1VHFA 2QA4G 4FF1A 1G2EA 4RPFA 4DV5J 2HBQB 3TJ9A 1RAGB 2Q43A 5D0HA 3K0JA 3O6QA 1VOMA 4DV6F 1UJ5A 2XNQA 3IS9B 4OYPA 4KAIA 3V4IA 2OEKA 1D8YA 1FKPA 4I69A 2UUCF 1LWXA 2RDIA 1PBUA 2ZE2B 4RNFA 2A6MA 5KOWA 4ED7A 3G71S 5HATA 4M5HA 2FYXA 3VAKA 1FVQA 2W24A 3CCZA 3I32A 2BE7D 5B09A 5GMKa 4UTGA 1WEXA 1FDBA 1VLOA 1Y5LB 5DLGA 3H2UB 4A48A 2IAJB 3C8YA 4ZJLA 4C11B 3A13A 2VQEJ 1VQ4S 3LA0A 3LAKA 1S57A 5M2RA 1UJ4A 3OD2A 3HP6A 1VQ9S 2DRBA 1B64A 3QMQA 3PZPA 2HQ3A 1JKHA 3DU6A 2HLTA 4QBUA 3WX4A 4DR2J 1BC6A 2ZFHA 2ZH3A 2VODA 2KFNA 2ZBQA 2EFPA 2ZH9A 1KHVA 3TX0A 2HHWA 4ID8A 1CVJA 3ELHA 4H4KA 4ID5B 4QR2A 5MAOA 3CGIA 4P2XA 5CCMA 5D6GA 3LPEA 4W4MA 3EXCX 1DQ8A 3EVOA 4LF2A 1U6BA 2B7CB 5AJ3J 5H9EJ 2V50A 1RAOA 2VL1A 1Y7PA 4LT6A 4TYBA 4OYMA 1KEKA 4NLVA 2F63A 3ISNC 5DM6Q 1ZZFA 2RU3A 2PE8A 2DNGA 4HDGA 4E8UA 2BQ3A 2CNKB 3MOJB 1HI8A 3DHWC 4G1IA 2AZ1A 2IA6A 2PA8D 1U0HA 2AJ4A 2DPIA 2ZZMA 2J9DE 4MH8A 5CYJA 2I0XA 5KOXA 5HLFA 3DLHA 1DURA 4Y2KA 5GAHI 3OXFA 4Y0FA 3DGVA 3RYLA 1S12A 3JAMU 3I0SB 2R8HA 1VQPS 1YZ6A 4H4KC 1RAJA 2MSTA 4RU9A 4YHHF 3ZZZA 3BO3A 2AYBA 2DNOA 3QO9A 4ER8A 4LFAF 5D77A 1HPZA 3SDEB 4PXBA 4WP9A 5I3UA 1EAYC 2F65A 3D6FB 1K9MT 1HI1A 2YX4A 1Y11A 3DFEA 4JI4J 1QM9A 1IJFB 1M0SA 1XWLA 2RRBA 5ETPA 4CLWA 1C1BA 2O1PA 2W25A 5A0YA 3SBMA 3I6PA 4USMA 4K50A 2YNFB 3EVMA 1JLFB 1R27B 3AY0A 3D1HA 3P8BB 1UEVA 4J9RA 1WD6A 1URRA 2BJ7A 3TA2A 5DQIA 3JSMA 4RW9A 1SC6A 2CQCA 2CUYA 3ZO7A 3CD6S 3OW2R 4HKQA 2FTRA 3G8TA 1WC6A 1DLOB 4DI6A 2HRTA 4YS2A 4B08A 2ZUGA 2Z0GA 5K14A 4P73A 4QWDA 2EKNA 3B6BA 4QJVA 4Y3CA 1B7YB 3OQ2A 2UV8G 3QBCA 4I0WA 5FDLA 3W2VA 3U1MA 1LWFA 1C1CA 2E7VA 5KFCA 3I87A 2ZDPA 2XCPA 5ETRA 2OMLA 2CG4A 3V4MA 3VAMA 4B3SF 2I2YA 4FXVA 2ZHBA 1TL3B 4ANDA 2ASDA 1VRUB 3S6EA 4CLSA 4B9LA 5KFYA 2C1EB 2CIMA 3IR7B 4P75A 6AT1B 3C14B 2F8HA 3UW1A 2V68A 4BS2A 4MK7A 4B3RJ 2YKMB 4LRCA 3D0IE 1U1KA 2H9ZA 3CCVS 4X4PA 2YKNA 3H8YA 5CZVA 4J9OA 4DFMA 4K59A 2OI2A 2R4FA 3C6UB 2FB0A 3OUYB 4FYVB 2UUCJ 1HBMA 1PYTA 1R8HA 3SCKE 4IOCQ 4KO0B 4B9TA 4QYZK 2YQ1A 4YR3A 3OR1A 1DTTB 3JXOA 1HNZJ 4KB7A 1U1NA 4KJIA 1LWCA 3K58A 1NRKA 2OFGX 1KTQA 4USHA 2DGVA 4JV5J 2D9PA 2KYZA 4EYIB 3IGVA 1Q16B 2CWKA 2Z58B 4OJ3A 5A76A 3FNNA 1WG4A 1VC5A 1TKXB 4O3RA 3IWNC 4Z7CA 3RW7A 4NYZA 2HRYA 4CLZA 4RZRA 2FHJA 5F8HA 4DFJA 3ENQA 2EXUA 3A8JA 2M9KA 3CJQA 2ZE2A 2A0FB 3PYDA 5KFXA 1WHWA 2GHWA 1PKUA 3QPIA 1I51B 1LW2A 1IR0A 4IYQA 5HBMB 2V8GA 1N6QB 1Q86T 4DV1J 2MZ1A 3QZ8A 1ZTWA 2R2RA 4HI2A 4S0MA 3OHBA 3D5MA 2DHHA 3C46A 2ZITA 5AE3A 3GONA 1U2CA 4ANEA 1RABB 2KI2A 3ILIA 2W7OA 1YITS 1WEYA 3LGHA 2VPZB 3QIDA 3HHLD 3R7BB 2W8LA 2EEYA 1IM4A 1HNIA 1PO6A 5A8RA 4WIQA 2MKKA 1WEZA 4AQYJ 4QYZJ 5LJ5Y 3IWLA 2HAIA 1LV5A 3MMBA 3KLHB 5HJYA 1VRQC 3T9NA 1WDTA 2FQQB 3KDOA 2HK3A 5GMEA 3HPOA 4KGXB 4DDFA 4JI0J 3G6ES 3LP1A 3ZZPA 4ECUA 2VU5A 4F2SA 2L9NA 2G1HA 4NLXA 4DF4A 1WJ9A 5ETMA 3HFZB 1D8ZA 1F5AA 3BQ0A 2D69A 2L08A 3KDNA 2RS2A 4DSKA 1WHXA 2O3DA 2H1YA 5J2NB 1KNZA 2UUTA 1U4BA 1NXIA 2C3MA 1EQ0A 1PC4A 3DOKB 2OPQB 3S1TA 2JFKA 5IXUA 2GIFA 4TXSA 1F9EB 1KP6A 2E1PA 2ZH2A 1MNEA 1JX4A 5EN1A 1VQMS 4XDCA 2GAGC 1R8AA 2VG5B 4J9UE 2Y1JA 2YH1A 1OS5A 3BSNA 4NXNJ 5M2UA 1RT3B 2ROEA 3LWLA 2ILYA 2CAJA 4U7CA 5I3QA 1DY3A 3NXZA 4WE1B 2EG2A 3Q0AA 1NK7A 4B3OA 2F9DA 3BZQA 3CT9A 3FBBA 1CEZA 3NGTA 5GAGI 2CZ9A 1X5TA 4MTPA 1SV5B 2LQBA 4USWA 1UVKA 2WVBA 3CDBA 3POTB 4DSJA 2KYXA 3RB0A 1RP5A 4RR5A 2P9CA 4X4UA 4IH6A 2WCXA 1Z2ZA 2CJQA 4M5MA 4ZKAA 3NNHA 5KFIA 3TR5A 1SIZA 5D4PA 1WOOA 5F8GA 2U2FA 2X7IA 2XEXA 5EDWA 1YQHA 1Q7YT 4QWAA 4HH1A 1NH7A 1XTZA 2DNKA 2GX8A 3QLHB 5DZ7A 4LSNA 4F3MA 1A6LA 4UT4A 2VFVA 3DRPA 3J7AN 3CB4A 3SSQA 3OR2A 5F8NA 3MEEA 1HBUA 2D1CA 5J2MB 1D09B 2OGUA 4DQSA 1X7VA 4TVAB 2C2ZB 2G0CA 2HMIA 1GMUA 4FYXB 1K8AT 3KHRA 2ZJQQ 3M2RA 3OFFA 4C0OC 3ETMA 3MEGB 4PABA 3BO2A 3IBCB 3OXGA 4IKAA 4ICLA 2XSFA 2YKPA 1P1TA 2ZC3A 4B3MF 3GJQB 4LSLB 3HO1A 2DO0A 1IKXA 1RTDB 5ETLA 2NXUA 4ES1A 1L3TA 3TAMB 2VBZA 1H72C 2XY5A 5H9EK 3B4DA 1U1QA 3TW0A 2HFZA 3OUYA 2PMHA 3L9ZA 2CPZA 2PO4A 3E01A 3MMBB 1H2UX 1UMJA 3DXBA 3R27A 5CAAA 4AL7A 4Z7YA 1EJ7L 4RW8A 1HNWJ 4AL6A 1IN0A 3T1YF 3UVJB 5IM0B 2VV5A 4QQBA 4LFCF 2W2OP 4MJKA 2WSFC 1RADB 1TUWA 2XYPB 3U27A 3TRGA 5MLCV 4YY3F 3T1HF 2HZVA 3MAAA 4KHRA 2NLWA 4DV2F 2F4VJ 1JLFA 1VQSA 2QMXA 1N5TA 3IM9A 3MTKA 4N8NA 4EFAC 2FZKB 2UUWA 1N0UA 2QE5A 2AX0A 2BE9B 2J6UA 1MW7A 3NGSA 1KQGB 3MR6A 1CLFA 2G4BA 2Z8QA 1NSQA 4PCQA 1KLNA 5FIIA 4P2SA 2R42A 4I6WA 2CPDA 1WTBA 2OPPA 4QIGA 1RT5A 2AV5A 4X4RA 1CG2A 3I5AA 4DSEA 1WKLA 1HARA 1RAAB 4WWSA 3AT1B 4HEA9 5E33A 4DBQA 1NK0A 1CQMA 1TFYA 4DR4J 1UEUA 1U24A 3PG9A 1S9GA 1O8BA 2K1RA 5HQ8A 4PQAA 4AFFA 3V6DB 3Q22A 1IKYB 4WK3A 3OTCA 3FQLA 5KFMA 2KJWA 3QRPA 1F3VA 3D0GE 2Y1LB 5B0DA 3SQGA 3W9HA 4ED8A 4ZPBA 1SQEA 4M63A 3BO4A 3G96A 1TKDA 1AUDA 4IH5A 4DCOB 2HNDA 4KO0A 5EWEA 2VOOA 4DV7J 3U1LA 1GXLA 1VRTA 2JX2A 4U96A 5C2CA 5JVGQ 2ROPA 3CIMA 2EK1A 1LKZA 2ZD1A 1UZDA 1X4HA 2IDLA 1BHNA 1Q8IA 3GJTB 4KTQA 1N8RT 2IM1A 2EFQA 4I64A 2MZQA 4Y6IA 4ZIWA 5F8JA 1FXRA 5D8HB 3R5JB 4GO5X 3GYGA 3RG6A 2P6TA 4X65J 1IKWB 1S6PA 2IYIA 1U0SA 2E1MC 2HHVA 1AZSB 1HWLA 3TA0A 3TI0A 4ZCLA 5KFNA 3JYTA 1JIHA 1PJ5A 3RBZA 2GNKA 3VAFA 3SSRA 3SZ2A 2NSBA 1C1CB 4A46A 1M1GA 3Q8PB 2AU0A 3I5BA 3I4PA 2NS1B 4KV8B 4DUYJ 3RGIA 3UFCX 2V2QA 3N5FA 3SI8A 1RACB 2XI3A 2BBEA 3NOGA 2VFRA 4P74A 4K4TA 2ASJA 3P96A 2V4QA 2FZGB 4CLYA 2VICA 4N76A 1FF2A 4JI3J 3C14A 3C15A 3GTYX 1SXLA 2OP5A 1NMEB 2H54B 4CLFA 3F0NA 1YG0A 3NS6A 3SV3A 2P6SA 3KLVA 4J9NA 2GC8A 2XBPA 4DR1F 3ZNJ1 4EZ9A 2CJ9A 1PG5B 1FRXA 1FO1A 2J6TA 3HK2A 2WVDA 2E44A 4J9QA 2VG7B 2RQMA 1N5YB 3GIJA 4EBDA 3PEJA 2DNYA 3T3FA 1DZ5A 1L3SA 2LCWA 3H5XA 4YUDA 2AEFA 1RT2B 2Q79A 3HD1A 1RWKB 2NUUG 3K8WA 3F73A 1RHKB 3CNQP 4LR7A 1R8PA 3MR5A 3MXHP 1IKVB 2BVZA 1KQKA 4YOEA 4NE9C 1FT8A 1OY6A 1W2BR 1SH2A 3H5SA 4W98A 4Y28C 1NZ8A 5JXSA 1N54B 1RBOB 4B3MJ 3QIPA 3KLEA 3QSIA 4LBIA 2B6AB 4KQZA 4NLPA 1R31A 1V9OA 3QGPA 2CJYB 2CPYA 2HVHA 2KJVA 3H40A 1RT6A 5J1NA 4LF8F 3CC2S 2IJRA 3BSCA 2YNGB 3Q8QB 1RT7A 2F7VA 4PWUA 1S1WB 2B7BB 3CE8A 4MK8A 3V4IB 2OD4A 4WJBA 3TANA 5B0CA 3VCDA 1HBOA 4L75A 2MPUA 4ZIVA 6FD1A 1B7FA 1N32F 2ZZTA 3QT5A 3CULA 1TV6A 1ZPVA 2ZC4A 3QJJA 2XY7A 3QJLA 1TKZB 5ETNA 3PHTA 4E98A 5K8OA 1FDDA 2JRSA 5L9NA 3EE3A 1YRUA 5A2QY 1M5HA 4C48A 1NSPA 4ECVA 1KTVA 3AQOA 4JBCA 4LRAA 3Q23A 4N41A 2FGCA 4RBUA 2BE2A 2O01C 3DDNA 4JI6J 3RW6A 2Y3YA 4X62J 4EGLA 1RWMB 2K3IA 4X4SA 1RTHB 3IN5A 5RUBA 1EX8A 2AGPA 3DHXA 2DH7A 4ZITA 1O6XA 4ELVA 2BOAA 2JSXA 2NYHA 2AEMA 3EPIA 1X9WA 2NPFA 1FJ7A 4DFPA 3RB3A 2XS7A 2KN4A 2DYAA 2P8IA 2VFSA 3DOKA 3E8OA 5ETTA 1S7IA 1RHMB 2PMZD 5C25B 2VQFF 2UXBJ 5T41A 1HHSA 4USJC 1Y10A 2V4JA 5L46A 3T6JA 2GJFA 1S0NA 1K44A 4J9LA 3OFHA 4LVOP 5E2QA 4RWXA 2W9AA 2DEJA 2OKQA 2XZTB 4KSEB 4DPOA 2DNMA 4K4XA 2WZ1A 1N6QA 3CC7S 1SKRA 4ZPCA 4RUCA 3FGVA 1SV5A 1KLMB 3MMAB 2YKQA 1T03B 4KPYA 1WNEA 2N7YA 2Z2ZA 1HYSA 2GV1A 1NPKA 2HFOA 3VGVA 2OSRA 4F04B 1ZPWX 5KT3A 1WOSA 5GAEI 4QZVB 3QWUA 4FYYB 2VD3A 4ZVHA 3M6VA 3HHKA 3ZTQA 1R7IA 2NREA 4OHYA 3UWTA 1Q8KA 3I0RA 1VK8A 4O3OA 4LF4F 4RUBA 3RBXA 1G6BA 1OY8A 2VFTA 3R6GB 4OV1A 1H6KX 2QSWA 4F36A 2CJKA 2AYMA 1FRLA 1X4BA 3RAXA 3R5BA 3R3TA 4NLSA 2DK2A 2QA1A 4OYZA 1P27B 4AXJA 3BBFA 4ATNA 2QGFB 2YNFA 3DRYA 2BMBA 3AODA 2VBWA 1RHQB 2HS3A 5F8MA 2N4CA 3VGSA 3NRBA 2KL8A 4KV8A 1JNZB 3QATA 2W1BA 2YWHA 5F0WA 4DJBA 2DVIA 2LP4A 1KFDA 3EWGA 1EP4B 1WF2A 2VPWB 2VKZG 2RH3A 3TOQA 4LF4J 2HNZB 1OSCA 5KFAA 1R0AB 2W01A 2AW0A 4R5PB 4WTYA 3P4UB 3P3DA 4PG4A 4NA3A 6FDRA 1FX2A 3SQGB 2CPJA 1V5VA 1RXOB 4DS5A 2C2NA 2DXDA 3IO1A 1B70B 1CS4A 4I7FB 2NR0A 2YQ3A 3UDVA 1ZH5A 2EVZA 4DOZA 3I9V9 4B9SA 4ZDNA 2VF3A 2AGOA 1XNQJ 5KFKA 4EEYA 2UVRA 2VB6A 1VC0A 2KRBA 3H25A 3ETOA 5KTQA 2UUBJ 4ZCKA 1VCTA 1PILA 5D78A 1VJQA 2P5VA 3MM5B 1QTMA 1XMQF 3KLIA 3Q2TC 3M2UA 3HD2A 3N6NA 4ILRA 2OPRA 1NDPA 3T5HA 2C3OA 4GKJJ 1RTZA 3MDFA 1AZSA 1RUSA 1NK8A 3AXMA 5DQHA 4ZVTB 2LQ5A 2N3OA 2MGZA 1V3ZA 5LMUF 2ZBPA 3FZ2A 2DY1A 2FLOA 1J5EF 1PCAA 3CO9A 5B0AA 4KHPJ 1IJEB 5J2PA 3OTBA 4RW9B 1FTCA 1HW9A 1RYSA 1PYOB 5KFRA 2I9SA 3NAIA 2DPJA 4DWIA 3QRRA 5FDLB 2XO6A 5CABA 2HHQA 1P8GA 2HIQA 3MFHA 5A8KB 4TLQA 4IR1A 4F02A 3W62A 4NMLA 1NJYA 4LSLA 5E5NA 4OMFG 3UCGA 2R8JA 1L5UA 1S6OA 5KG0A 2WBRA 4RL1A 1N4LA 3DLGA 4YN3B 1XMOF 4WFYA 4E0DA 5IT9Y 2J9CA 1LWEA 2RIJA 1GX5A 4WKYA 4OZ3A 2E66A 3PIPQ 1K73T 1YJ7A 3D3BJ 4CM0A 3L7UA 2IPOB 1H2TZ 2FZCB 2BKOA 5DGAA 2JEFA 3LOUA 2WK4A 2WBMA 4HHJA 1FJGF 4CT9A 3EXYA 3N28A 4ZLLA 4EMDA 4MKBA 3M8RA 2V8DA 3IG1B 1RTIB 1WORA 3D6MB 1U45A 1XNRF 2IA0A 3ULHA 2DXEA 3Q8SB 1OO0B 2DTJA 1Z4UA 1TL4A 3W7BA 4JOUA 5A2QU 2FLNA 1K1QA 3OL7A 3FFIA 4LSNB 2QJ3A 3OLAA 4FF3A 4PWDA 2DHXA 2IM0A 5C24A 1Q95G 1X4AA 3NKYA 2ILZA 4ED4A 4P6QA 2FY8A 1FDNA 4F8RA 4AT1B 2DNLA 5KG4A 2XYGB 3HMJG 2PI5A 2Q1LA 3AJDA 2FJDB 2FLLA 4W92B 4TYAA 5HN0A 3BR9A 4HHUA 3UDLA 3WHIA 4NEZA 1TMMA 2CQ1A 4X84A 3EGVA 3ITHA 4LBPA 3PV8A 4K4WA 5KG7A 1WI6A 2YPZA 3V6HA 3C2PA 4EO6A 2B9EA 4ZPTR 2F1FA 3KJQB 3TJAA 2QMUB 3D68A 3BH7B 3DOLB 3O2IA 4ZLNA 3TZYA 1Q53A 3GILA 5E7OB 3DLBA 3GIMA 2RE1A 4ENOA 4C8OA 3BKFA 1SCJB 4NRUA 2OHDA 2HNDB 5CH7B 3IRWP 1GXTA 2Z30B 2KDOA 3Q8UA 1SC4B 4KBIA 2ZH4A 1X4EA 4USVA 4B3RF 2N7CA 4DPWA 2C3PA 3FMBA 2MKJA 3BYRA 2EG1A 3N4WA 1GEHA 2JWNA 3H98A 3U7JA 3CDAA 1DTQA 5EX0A 8AT1B 5KFBA 4JV5F 2CDQA 5CYQB 2IRYA 4CLKA 1HHQA 4DG1A 4DL3A 4F4XA 4B3SJ 2G13A 1T3OA 1EHWA 2JZ5A 4FKYA 5JMNA 1RWXB 1W25A 3AAWB 3PVXA 2OJ3A 2GO8A 4DV3F 3LP1B 4QPTA 3Q2SC 4R5PA 3OL6A 2XG8A 2CG8A 2NXCA 4J5OA 4O4GA 1HBUB 1RQ0A 4DV3J 4NRTA 4C6AA 4EU0A 2QYCA 4ED2A 3QJPA 4MFBA 1I3OB 2NSCA 3A8IA 4ZOSA 4YFUA 1N5VA 3TVYA 2ALZA 5KG2A 1H74A 4K4YA 3ZZOA 4URGA 1TKZA 2PEBA 1NCLA 1S6QB 3C15B 4OYWA 3R1HA 5CHCB 3FJ2A 3RAMA 1RT3A 3TEGA 3GR1A 3UD3P 2BJ9A 3VZIA 3J81Y 1A7GE 5KFTA 3VGTA 4IG3A 1S72S 3OL9A 1X8DA 4K0KF 4B3OB 2A6OA 5HVHA 1J27A 4ZA1A 3E01B 4IDKA 3BGRB 3MR2A 1UZHA 3K5LA 1OSDA 2MLYA 4CNZA 4ECZA 4KR0B 3OVAA 3W5ZA 2E9RX 2HBZB 2KVQE 5IV3A 4CO5A 3GWCA 1HNVB 5KFWA 4I2PA 4RNHA 4RBVA 4ZPVR 4EBEA 1ICEB 3HVAA 4R0JA 5KFOA 1HD0A 1NSKL 1RT4A 3W8GA 3N79A 2GQCA 2HWHA 2LQ8A 3T5LA 1QVGR 1QAIA 2W2QP 2B8PA 2R7OA 2B6AA 2IVYA 4ZHRB 5SZTA 2DRAA 2JHEA 1YJRA 2AJ1A 2E5JA 1M1HA 2BABA 4FNIA 3GSIA 3PO4A 1JK9B 1X4CA 2MKCA 2FHMA 4KFBA 3MR3A 2R7WA 3NCRA 1UFLA 4X4NA 3AA8A 2HVDA 2ACYA 2GVDA 2CPXA 3AB4B 4IG0A 4DV0F 2HVEA 4NLWA 5HP1B 3JTOA 4PWWA 1M5PC 2GGPB 3R9LA 3CDEA 1I94J 3EUNA 5F8IA 3CJSA 1MSWD 4NCAA 4Z2XA 2AX1A 2EFGA 2C2RA 3EGNA 1X0FA 1X5OA 5IFMA 5H9FJ 4NZ0A 1HBNB 4RNMA 1SI9A 4IO9Q 2OPRB 1NAQA 2Q6BA 2ZWOA 1WSVA 1RTIA 1F0XA 5CYMA 1IBMF 4QWBA 4EWTA 3IC1A 4NOHA 2L3MA 3IAS9 4IFVB 3NLCA 1DLOA 3GJSB 2BEFA 4QU6A 4F0MA 3H5YA 3NMAA 3VTIA 3MURP 3PACA 4NXNF 4UY8T 3GZ7A 1EP4A 4X64F 1WI8A 3MTJA 1XNQF 3F41A 1VRUA 4DS4A 1F2GA 2JLEA 3D3CJ 4NMXA 2GW8A 4TLRA 5HSPA 3PDNA 5CZXA 5B7WA 1P6TA 4QIVA 4V1Ak 4ZVGA 3PX4A 3TEHB 2BJ8A 2IM3A 3QFHA 1X4DA 4PG7A 3OXLA 5BXIA 2K1RB 1GQEA 4A8FA 1W26A 2D3UA 5LXYA 2CQHA 4QIWD 4ETXA 3PW0A 3H7HB 2LXFA 1TK5A 4WIIA 1FXLA 4ECRA 3TUPA 4U6PA 2PMWA 4LMZA 2XSJB 1CULA 2RKIB 3KLIB 3G9CA 4L73A 2V8PA 2RMLA 5F0UA 1NHVA 1SH0A 5L1JA 5LMUJ 1K0VA 1RA7A 3MECA 5DGBA 4U8VA 3WX8A 2V2KA 5E3QA 2XYHB 3LP2B 2C2EA 1JLBB 3MCNA 3KFWX 4TN2A 1T8EA 3VALA 2LLZA 3M30B 1TP7A 2A10A 5K14B 1G7CB 1HW8A 3NMRA 3W9IA 3F56A 3PFEA 3L3CA 1OMSA 2NXEA 2OPSB 3SCIE 1SB6A 1U0HB 2GCFA 3HZEA 4NLDA 4ZVEA 5F3ZA 2VQFJ 3PW2A 4LR8A 3P6YC 3TUJC 1IM6A 5K9FA 1M5KC 3EYZA 4LIWA 3M1VA 2M8HA 3UDEA 1VIOA 1U1MA 2AT1B 1SVDA 3FZBA 4TY9A 1JLEB 1RWWB 2MQLA 5B0GA 1S97A 2IY5B 4RJVA 3KHGA 1WG5A 1IQZA 2C3YA 4NYPA 1HNIB 2GMLA 4RU2A 1Q82T 3SIPB 3M6WA 4UQTA 3SEOA 5HMXA 4HTJA 2KTQA 3QT8A 1GH8A 4DR5F 1TTHB 3OTOJ 4N5SA 5KFUA 4JV0A 3MCOA 1JQGA 2B5JB 4RW6A 3GIKA 4OQJA 1VQKS 1R0BG 2QSFA 1T9WA 2DO4A 3MM6A 2H48B 4KGMA 2XGPA 2Y0BB 1WG1A 3BJYA 4DL4A 4GO7X 4Y2CA 4DU8A 1UWBA 4C8MA 1ACMB 5LSRA 4RNNA 2XQCA 2QYGA 4FS2A 5CA5A 2A2CA 1FRHA 1VS3A 5A6WA 3HF5A 4WZQA 1D1UA 2QLFB 3OVSA 4R8UA 3IA0A 4B9NA 4RW4B 5LM7E 1T05B 1LWFB 3AFGA 4FF4A 4DF8A 3TUIC 3AD9C 1OJ4A 2GJ2A 2MZRA 3AXKA 1R8BA 1K0TA 3PR4A 1ZA2B 4WE1A 4Y2IA 3K2YA 3WC0A 4NLGA 2ADBA 1ZS6A 3LPYA 1GMVA 1S5ZA 1DJ0A 3ITHB 5HL7Q 2DEIA 2P9EA 4NLUA 3CD5A 3ENVA 5HQMA 2VHGA 3POTA 4JI1F 3HHDA 4PPZA 3V6KA 1TVRA 2F40A 2ZOFA 1F60B 1RBAA 5DRKA 3NBPA 2AWZA 1U2RA 1KC8T 2H5EA 1QAXA 4HI1A 5KFJA 1XMBA 2AJQA 4EI2A 1FJGJ 3IXQA 3CMAS 2QL5B 4RBTA 1U6FA 1S4EA 2ZBIA 4IRKA 1GXUA 2XMVA 5IV4A 4F4YA 3CJ3A 4IFYA 8RUCA 5GADI 2HSEB 3MUMP 2LEAA 2E5LJ 5IT0A 2Z2LA 2XS5A 2OFHX 3W5XA 3HHLB 4F4AA 3C3LA 3FSIA 1N32J 3MHYA 4DG1B 2L9DA 3U1NA 5B0BA 3BPSP 3B82A 3BN4A 3V5RA 5J2NA 1FE4A 1C0UA 2DKOB 1AYEA 5L1IA 2HGMA 1E6YA 1JLGB 3CD0A 3BF4A 2YKAA 1GTEA 3OPKA 3GLJA 2H4YB 2W4CA 3GV8B 4DV2J 2F4VF 3S01A 2DH9A 3M1VB 5A8WA 1JXVA 4J9VA 4N47A 1RTJA 2QC3A 4PWDB 3BGUA 1IXKA 4FZVA 4P7VA 3PIOQ 4DR1J 1BUXA 3DLLQ 2GMJA 5L1KA 1B0PA 3N0VA 2XMMA 2M8DB 3AD8C 1T3NA 1Q78A 1X4FA 2PN6A 4Q0BB 4FKXA 3KMSA 4ECQA 1RT1A 2E29A 2DHGA 3MZIA 3KNAA 3KK3B 2KM8C 1FNMA 2W9CA 4PEOA 4YMEA 4OLPA 4ES3A 1UWAA 3H4BA 2XB2D 2A2DA 3ZC4A 1UVNA 2GS8A 1YIJS 1FWKA 2BQRA 4DR2F 3OR1B 1HQUA 3DN9A 2FJVA 3AD7C 3RBEA 2QZ8A 2Y8YA 2UXCJ 3LP2A 1PJ7A 5C42B 2ZH5A 3BGFA 2MY7A 2DR5A 3CJKA 1SQGA 4OX6A 4BLGA 1I6JA 4JI1J 5DS7A 1FJEB 2PEHA 1EIYB 4M94A 3BQ2A 3J7A1 3CJ8A 4JI3F 2WW8A 3L09A 3CCWA 2RDDA 1WC5A 1NNDA 4C3MA 3WC2A 3EMTA 4RKUC 2LVWA 4Q2LA 3HHLC 2E5LF 4NPOA 1FD8A 3MPYA 4DR4F 3DC2A 3UR3C 2CQDA 1H0HB 1IR2A 4LRBA 2GVZB 1S9GB 4QWEA 2ZOMA 1LW2B 1RWUA 2BUNA 2FDNA 3HJVA 2WVEA 3IGNA 1WHYA 1YBAA 4K2JA 4KHMA 1GK8A 2QO3A 4USUA 2CKWA 4CRJA 4F50A 1K1SA 4CYUA 1XR7A 2ROGA 1RCXB 5HI7A 5IC6B 5U47A 4H4OB 3HCXA 3KLFB 1QTNB 2P2CB 2VG6A 2YNIA 3NBPB 4A47A 4Q44A 2GVDB 4JYAF 3J81j 4NXMF 4KPCA 3RU0A 2PI4A 2MJUA 3NCQA 2I6WA 2YWEA 1SKUB 1SC1B 2J9EA 4OHWA 2DR7A 1F9FA 1OYEA 2W2PP 3GMGA 2XSJA 4KGKA 1RCOB 2ASLA 2YBVA 4L74A 2ZD1B 3K17A 2NZCA 2R3VA 4GVBA 2M5YA 3FQKA 3MPWA 4YQWA 2AMCB 2G9OA 3MI7X 4CLUA 5L1LA 2FJWA 1VQNS 1GMWD 2VUGA 2ZNYA 3DLKA 3I4HX 3R5DA 3TVZA 3CDUA 4Q45A 4FPRA 5DO2A 1RISA 3J7YI 5HVFA 1VJWA 5KFDA 3GV5B 4QR1A 1MWYA 3IM8A 4FYDA 2RILA 1UPMB 4ZVQB 3W1YC 5FLXY 2IDEA 4DV4F 1VQ7S 4JI7J 2DCLA 1HA1A 1JMTA 4P7TA 1IBLF 5KG5A 4BWMA 4CO4A 1D0EA 4OYBA 3K5PA 4LF6F 4M5KA 3EDRB 2JLGA 3B4MA 4IRCA 4IRDA 4HTIA 1S77D 1RT4B 1FKOB 3BGOP 1FK9A 2NXNA 1UP1A 3WQPA 4DR5J 3SQOP 2NXJA 3P45B 2XHWA 1Z1ZA 2Q66A 5KFGA 1TL5A 4LR9A 2C28A 2VG5A 4O44B 4OZJA 4OHZA 4ZHRA 2W9CB 4CH1A 1RAEB 5IC4B 2AF6A 2OSQA 3A12A 4MIBA 5AT1B 2UU9F 1Y00A 4LUBA 1KONA 5D0EA 4HVZA 2YNHB 3VAIA 3FC9A 2XCAA 2AJFE 3PYFA 2XY6A 2DGTA 2MHNA 4OYAA 3M8QA 2ADCA 2BV3A 2M88A 4C3KA 5I4MA 3THVA 3GJRB 4BDPA 3V81B 4DQPA 1U1LA 4DV1F 5HP1A 5T7LB 4ZVRB 2IJFA 3KJFB 1KOOA 1OYDA 1XBWA 3SFGA 3D1QA 2IAJA 4C11A 2GQQA 4K7QA 4G1PA 3SDEA 4GMKA 4ILLA 2DNQA 3R5CA 4X4TA 2GHVC 1KS2A 2H3EB 2MJNA 3CDWA 4L6V3 1JLGA 1Y5NB 3BGRA 1R89A 2B8QA 4FP9A 2YY3A 3RZAA 4X2BA 2IVMA 1HR0J 4DUZF 2QL7B 1D9DA 1FRKA 2HWTA 3FK4A 3L95X 5LL6d 5DG8A 3VV2B 3FCVA 5KFFA 1U25A 3DOMA 1WTFA 5G0RB 1HL6A 1JXEA 4OZ2A 3DRXA 4EUVA 2YWFA 4LFCJ 1BD6A 1I5OB 4NCGA 4X64J 3TA1A 3NG8A 3TUZC 2XO7A 3Q86A 1RHRB 3BYPA 4A8OA 3VAHA 1YKWA 3FBEA 1YX2A 4DR3F 3M8ZA 1EARA 3D67A 3U02A 4ZCMA 3D1OA 1W2IA 1TKTA 2XMUA 1RWOB 1TVRB 2QLXA 4RW7A 1C4CA 2FVSA 3H2VE 2QFIA 2JVOA 2V9KA 4O0IA 5IT9U 4U9RA 1M5VC 3MD1A 4CWBA 2LQ9A 3UN5A 1NDCA 2DNNA 2ACMA 2LDIA 4X62F 4I6YA 5C42A 2BM1A 4NWBA 3QGIA 5SUHA 4OX9F 3JTNA 5HMYA 4ILMA 1T9VA 4K4ZA 2IJNA 1XQIA 2MZJA 2O67A 1PSDA 2HQCA 1ZOTA 1HMVB 2E1AA 2BRKA 2E7WA 3MAAB 2KM8B 3H4DA 4F4ZA 1B99A 7FD1A 1S1VB 3J80Y 1MN7A 1KQSR 1O51A 1HBMB 5KFHA 2UXBF 1TK8A 2ZJRQ 2G0JA 4X66F 4K4UA 1BMQB 2DHSA 4CO3A 4JB8B 4IFVA 1JLBA 2EWHA 1X0PA 1RAHB 5A8WB 2KFYA 3HT3A 2XHCA 3LP0B 4ZP6A 4HYKA 1FNOA 2VZ9A 5CYQA 3HFVA 3G8QA 4C0HA 4C8YA 4JI6F 1ZYQA 1WHVA 1RT7B 4G1QB 4ES2A 4ECWA 3ZZTA 4LF6J 5BYQA 1TUVA 2DIVA 3DLEA 3IBFB 3MM9B 3CW2C 1U1PA 2HMIB 2Z2MA 1FERA 4A8MP 1TV6B 1NB7A 5D15A 3PY8A 2LEBA 2DB1A 5IS2A 1AROP 1U02A 5HBMA 3TAQA 1T94A 1T9UA 3IAM9 3KK2A 4PYAA 4TU9A 2JL9A 3O8WA 4MFBB 4MKAA 2KT2A 2RQKA 1PYSB 2B9WA 2RSQA 3MM7A 3QAUA 3ICLA 1RB0A 3M6XA 4AYBD 3FEZA 3DI6B 3UNGC 4NLOA 1GNKA 2JVRA 3OFEA 5K8PA 3UCZP 3HDSA 3IR6B 4J37A 4WYWA 1YGYA 3DRSA 2L9WA 5LT5A 4KGZB 3GYXB 2XMWA 1QE1B 3ZTPA 2K8GA 4A8QA 2VA2A 3LUYA 4WYLA 5A8RB 4DR7F 2HQIA 1VQ6S 4Y00A 5C7PA 2X1AA 3D4JA 4CCHA 3DOMB 1VDHA 4NZ6A 3KLHA 2VDHA 3D66A 1TL1B 4TY8A 3JYTB 1WC3A 4K5RA 4P2FA 3I55S 1MU2B 3D7SB 1LEOA 5C2GA 1RKIA 2V63A 1LWCB 3CCJS 1C0TB 4IQMA 4QIEA 4U67Q 3M30A 5G4DA 1F3FA 5KT5A 4ZVFA 4CYUB 4CO2A 1E6VB 2RU9A 4KKOB 2FY1A 1KQFB 3ENWA 1Y9OA 4OFZA 2R8IA 4Q8FA 1WKJA 3PYEA 3CD7A 5H1SV 1RK8A 1AT1B 2YTCA 1KDNA 2XM3A 1SQFA 3UE2A 1BWEA 1YVFA 4LSZB 3PCOB 5HMWA 2C42A 3MCMA 4EBCA 1T03A 5D3GB 1HYSB 4Q7AA 4J91A 4QPXA 1CJVA 1YBTA 2XGQA 4OJ1A 2NCKL 3M05A 2CA9A 2AJ2A 1YRXA 5CCLA 4Q5VA 1RJJA 4OZ1A 1S48A 1XN9A 3QZ7A 3PKYA 4ZK7M 2AP6A 3MFIA 5LJ3Y 2G0IA 3DM2A 1TQLA 2DR9A 1VBXA 1V5IB 2BKNA 2BYCA 3PW4A 1LK5A 1M1KT 2CJBA 4YB5A 3B78A 4UQGA 3CCTA 3MMCA 3MD3A 3C16B 1NK4A 2CQIA 1C4AA 4H4MA 4QW9A 3HX9A 1G3OA 4WFAQ 1TAQA 2HS0A 4LF5F 2GA7A 1CJKA 3Q89A 3ZTSA 3KG1A 2FVQA 4LBHA 5K8MA 3Q8VA 2BDPA 5KG1A 2CQ2A 1U1OA 2HW3A 2DITA 4L72B 2Z2YB 5CYMB 3RUBL 3ZZUA 1S7HA 2Y1RI 3LTOA 4WP3A 1PAEX 4DUTA 5HO4A 2EFOA 3KHHA 4QWCA 1KOHA 1S4FA 4C7QA 1SJFA 4JI4F 3MCSA 4C0BA 2D3OR 3OV7A 4R0EA 2DBBA 2CNNB 5ADZA 4ED5A 2ZM6J 1IUJA 2H4WB 1YSJA 3LGMA 1QAJA 1MWZA 2EFNA 3I82A 4ZVSB 2JEJA 2CFXA 1KLMA 1RA6A 1ROFA 1UJ6A 4OV6A 1BXNA 2ZKTA 7AT1B 1F1BB 2JOQA 2EPIA 3MEGA 1TELA 1IKYA 4WU2A 2DGWA 3K5OA 4KE5A 1RDRA 1KVKA 4RO0A 4XAKA 2CRLA 2VC0A 1T11A 2N82B 4ECSA 1Y4ZB 2XMKA 4LFBF 5HROB 1Q81T 2V6AA 1NB2A 3GCWP 2V0NA 1NDKA 2BXJA 1BGXT 2M7SA 3R7NB 2A1BA 4MYTA 4LFAJ 3KHLA 3CCUS 1FNXH 1RTHA 2M52A 2LXIA 3H90A 5IM0A 3PRBA 2MKIA 1C0TA 3W9JA 2YX1A 3NL0A 1C2PA 4MK9A 4R25A 3M32B 2RQCA 4J9SA 4P2MA 4NA2A 1N34F 2KXNB 1J5OB 1IBKJ 2HHSA 1WUUA 3NCPA 2HLUA 4UZBA 4M8LA 2GFFA 2YWKA 4UOCA 1UVLA 5DDRC 3MM9A 3CPWR 1N5QA 3UI3A 3GFYA 3QSYB 2C2KB 3VVTA 2MTLA 3KUGA 4ELUA 3KJVA 3LWMA 2OIHA 2HK2A 4GVLA 1NHUA 1QAYA 4I2QB 4DSIA 3HLUA 4USIA 2CDRB 3QRQA 2IMOA 3W66A 3PRDA 5J1EB 5DG7A 2Z4PA 4KH0B 1RAFB 4ICLB 2KH9A 2ZNZA 4DLGA 3DYAA 1ZM4A 3KK3A 1REVA 5B08A 3T9ZA 3MPDA 4ZCIA 2X1BA 3G86A 2HHHJ 4NYOA 1XMQJ 1CBKA 2Q6CA 3Q83A 2XNRA 1QSYA 1JWWA 4ZPDA 1DTQB 5F3TA 3BSAA 3OSNA 2NQPA 2PFFB 3DGPA 1VBZA 1TL1A 4PG6A 2LA4A 4ZP7A 4WFNQ 4ECTA 1B4SA 3DDKA 1TFWA 3W2WB 5JVHQ 2YH0A 2HNYA 5GAGU 4GKKJ 3QYYA 4C8KA 3EM1A 1WACA 3ILLA 3M8YA 4OX8A 3KYLA 4O4GB 1RLCL 5G0RA 4A8XA 3H20A 1LQ9A 4BCAA 5JJBA 3IMQJ 4EYHB 2UUBF 4DQIA 2XC9A 1YJVA 5AE2A 1T7PA 1FKPB 2EI5A 3DLEB 4ZP8A 5C25A 1RWVB 3BN7A 1SL0A 1FKOA 2IBKA 2V8VA 1PIEA 2J9DA 3K5MA 4LF7J 3R5GA 4URQU 5IT4A 4NLRA 4Y2MA 3R8YA 4ZVUB 1EQMA 2LEPA 4UZCA 1RTJB 2HFUA 3JSBA 2VJUA 1Q0NA 2ZBCA 5ETSA 2MB0B 4OI6A 2UVWA 4LJMA 1LW0B 1TUGB 4BHQA 1DFDA 2DNHA 4NZ7A 2CNOB 3CCES 4DUZJ 4FS1A 3FRZA 1R43A 3UD4P 3QGHA 4OL8A 3ZTOA 2ZUAA 4U7UK 3AH6A 5KG3A 2J8SA 2FLPA 1CPZA 1KN6A 1LOUA 1Q5VA 2F8MA 2ATCB 2ZKUA 3H42A 1YLXA 4GRSA 4ECYA 1FJCA 2L41A 4OJGA 2M4MA 2QT7A 3CCMS 3MM8A 2MKHA 4F67A 2DISA 1UTAA 3C6TA 4OHVA 2CWXA 3AJ1A 4ZJQA 4E2FB 1JLCB 1N52B 3MMJA 3UPFA 2ERRA 4DX7A 5KG6A 3G82B 3PHEA 1EZZB 3G8SA 4DV4J 2VASA 3TO8A 1IKVA 3RRKA 3VVUA 4JI7F 4M95A 3IFEA 4WF9Q 2CVEA 1N33F 3FUYA 1SC3B 1IKWA 1S6PB 2POKA 4Z37A 2XMJA 2ZH1A 3UCUP 4CH7A 9ATCB 2RUSA 4QYRA 4B9MA 1DQ9A 5IWAF 3JSYA 2BKPA 4X4QA 4J9MA 2VOPA 4YB6A 3DYAB 3FKBA 4I67A 3AOAA 2RRNA 3M2VB 4V19J 1MMLA 4FPIA 5HANA 2PFDA 3PNIA 4CLPA 1RWNB 1VBYA 1Y5IB 2VG6B 1CC7A 2YNIB 2K7JA 1IWAA 1U2FA 2GMHA 3BBCA 4D3HA 5EWFA 4M5GA 3DRRA 3GP9A 1FE0A 3EZUA 3DGPB 4YR0A 4AD6A 2HHHF 1FXDA 1S1UB 4KYZA 4UF4A 2CZ4A 2UXCF 3TQ1A 1GX6A 3EICA 4DL7A 4LF9F 1YTYA 3AA9A 4Q43A 3NP5A 4KIAA 2HNYB 3ZFVA 1KFSA 1AA1B 3GIRA 2V34A 1HMVA 3M32A 1DHMA 5LMNF 1TKXA 3ILJA 3DMJB 4OI1A 3HVTB 1HI0P 4PKDB 2XS2A 2JJ4D 4DL5A 3H0PA 2HEKA 1SJ3P 3BGLA 3J7YU 3WIVA 1HQ2A 1XERA 2KKHA 4NXMJ 1Q79A 3GPAA 4DL6A 2DH8A 2E5HA 1WF0A 2FJBB 4HT7A 2DGQA 1N5SA 3OTDA 1NH8A 1VMBA 1AB8A 5FD1A 2R7QA 3HVRA 1KSPA 4JI2J 1VGYA 1U6ZA 2FGOA 4ZP9A 4DN0A 3X1LB 3LH2S 1NKEA 2MQMA 4OI0A 2XWXA 4X4OA 3CCSS 4WXWA 3E3XA 4O44A 2UZAA 1FI4A 4I4BA 4XPCA 3AHPA 1R3NA 1KHWA 3GFHA 5KFEA 5A8KA 2HS4A 3DM2B 3GB0A 3CMQA 1NJIT 3KK2B 4DSFA 4PYDA 9RUBA 1U8WA 3JSRA 1ZAXA 3MMAA 2MKSA 2JLFA 5LXRA 1XC9A 4IDKB 2JEIA 4XO0A 3PKMA 4N7TA 2WONB 3NNCA 4PPDA 4OZLA 3NWRA 3BREA 1AFJA 2DCUB 4N8OA 4RUAA 3A3PB 5ETVA 1YRTA 4YDDB 1NLKL 2OUGA 2QIFA 2IRUA 3MEKA 1P9YA 3CWJA 3MPUB 4U95A 1OIAA 2AJ0A 3O3LA 2QA4S 3JQJA 2GQ2A 1Q1KA 4RUHA 5KFPA 4IQXA 2LECA 1NK9A 2ZM6F 1JLAA 3R7SB 3Q8YA 4OX7A 1FDAA 1MU2A 4ED1A 3W64A 1Q8BA 1U09A 2CQGA 2ZH6A 2F9JA 5CXTA 2RVJA 5ITHA 1TAUA 3R2CJ 2B51A 3ILOA 5J2PB 3H59A 1YJ9S 1RI7A 1X31C 1EKRA 1J5EJ 4LRFA 2RS8A 3JTPA 1NHKL 2DT9A 2HQDA 1UW9A 1CJTA 4JV2A 4ECXA 5D3GA 4ZJOA 1L3VA 4IO1A 2HYIB 1WSRA 1CJVB 1EKSA 3I0SA 3RRGA 3MAHA 4YP3A 1HNZF 1Q5YA 2JDJA 5L38A 3FBFA 5JUMA 1S10A 1H7WA 1CSJA 1S1TB 2LKZA 2RD5C 1BQNB 2DXFA 2R7SA 3NEKA 2HBRB 1JJ4A 3GIIA 4DR6J 1VBKA 1G1XA 4K8RA 3OTOF 1ZETA 2HG4A 2KRRA 2KXFA 5E3RA 5BYSA 3QLHA 5THWA 1BWVA 1JKHB 1M5SA 4ITSA 1RKJA 3DRSB 1S9EA 4NI2A 1D9FA 4IUFA 2IRXA 5KT4A 3TQEA 3US5A 1KVIA 4PG8A 2CVIA 1S1VA 3UO0A 2HRUA 4DR7J 3CUNA 2LMIA 2ZH7A 4RLEA 4QIFA 5E0OA 3LAMA 3FBCA 2M70A 4DR6F 4PG5A 2KT5A 1N56A 3M8PA 2VKRA 4U8YA 2E1RA 1Y0HA 3MAQA 3ZNUA 2GAHC 1NK6A 4PUOA 1F9HA 5I3PA 4K4SA 3ET6B 3KG4A 2UV8A 3PEHA 4MMOA 5F9NA 3TAMA 2DHAA 2QA2A 4KY3A 2WOMB 1VHIA 1RAIB 1OWXA 1TR0A 3HT0A 5L39A 3DRRB 4M5JA 2DNZA 2WONA 3RR8A 2KXHA 3ZXWA 2QRRA 3AOBA 3UQSA 4CTAB 1CS4B 1G4CA 2GHPA 3HSGA 3QFWA 4I7FA 2QFJA 5LSOA 2VPYB 1H3DA 4FBUA 2FVPA 2V2ZA 4QR0A 3S7RA 4DL2A 2EBEA 4IG3B 3MECB 2FIUA 3UD5A 5K20B 1VQOS 1UWBB 2Y9HA 1FFGB 4A8SA 2W4DA 5A6PA 3LW5C 5IZHA 4Y65A 3A3NB 5GAEU 1DTTA 3RJMB 2J0WA 1GT8A 1S99A 3OL8A 2UVVA 4UY85 1T9YA 4RX6A 4ZS6A 5J2MA 1SJQA 5HAOA 2ZVSA 5E3PA 5EWGA 4MKVA 1S59A 4RWWA 1OPIA 1HKAA 2I5JB 3CEDA 3CJ2A 5EGYA 3OSPA 2G1DA 1QDUB 1N36J 1O5JA 3CTRA 4XPEA 1A0OB 4MIAA 1ITPA 2EC2A 2CPIA 4ZLJA 1FTRA 2WTFA 5DDOC 4B9VA 5F41A 1VQYA 2WHOA 2XTJP 2ZWPA 3MUVP 1VQ8S 4NX9A 4CZCA 1N88A 1S0MA 3OTEA 2OELA 2SXLA 3CCRS 4F4KA 1KRPA 3FMWA 2R7VA 1S1TA 3PX6A 2B9YA 1SBRA 2YWGA 2ZOGA 3ISND 3T1AA 1TL3A 2DD8S 2KB2A 2VG7A 2DGOA 1SKWA 1N5YA 1NO8A 2M3DA 3CJ0A 4CIOA 1FRIA 4QOTA 4FDFA 3Q8RB 1TL7A 2K7KA 4MIWA 5E41A 2RKIA 4OX9J 4ZPWR 5AXMA 1FEHA 2B5JA 3FDSA 2XZDB 3QNWB 4RW6B 2AEJA 3LO3A 2VFUA 4KHPF 3DOLA 3CJRA 3DLGB 5E3AA 2B9XA 1FESA 2RNEA 4LIRA 3R97A 2J5AA 2V69A 2VQEF 1HNXJ 2KZZA 4L3KA 2UUAF 3DRPB 3GE9A 4QW8A 4OLOA 4GC7A 1CJUA 1RT5B 3HVWA 3MPVA 3RRHA 2V2VA 4ID5A 4OYXA 1CJKB 3FRYA 1VR6A 5L9XA 1SPBP 3VWSA 3UDCA 3HHEA 3W65A 5IWAJ 1JJ2R 1NKBA 4WBFA 1H38A 2PD1A 3TP2A 2YNGA 1PBAA 1SIWB 4H4OA 4CT8A 4MYUA 3JSMB 1HNXF 2ZHOA 2MYFA 3W61A 5GMDA 4PR6A 1SH3A 3M9MB 2HHTA 1H7XA 2EC0A 2HGNA 2JC1A 1JLEA 1RYRA 2YVSA 2LDYA 2BX6A 4O3PA 2HVIA 4DV0J 2YWWA 2MEWA 4GVBB 3K59A 3OT9A 2P9GA 1GAOA 4WP8A 1U1RA 2HURA 3PTWA 1BQNA 5HLFB 4GKJF 4ZPAA 3KOAA 3DLKB 3N6LA 4PUOB 3Q24A 2GZOA 2WW4A 2F8EX 2BJEA 4P71A 2Z57B 1T9TA 3UVJA 2BM0A 2DR6A 2PA3A 1RWPB 2IYGA 2MLXA 1VK3A 3CJKB 5IQ6A 2J8AA 1N33J 4O3QA 3D28A 2DGXA 2AGQA 1SUQA 1WC1A 3OLBA 1REGX 2V5HG 4C9DA 4C98A 2V94A 4WKRA 3NS5A 2R7UA 1FWLA 4OZ0A 2HHXA 3IRXB 2BANA 1XJWB 1JLAB 3EDQB 3NWGA 2HZCA 3BM7A 4HHHA 3FSYA 5I42B 1FK9B 1N34J 4ELTA 1TZ0A 3B54A 2BRLA 3T6BA 1YJWS 2OPPB 4B3TF 3BR8A 1UETA 4CH0S 4F26A 1JLCA 4J9KA 4LF5J 4FF2A 2BR0A 2FC9A 1SKSA 1F5CA 4LF7F 3H5UA 1UA1A 4NASA 4LQ3A 3MGJA 2HHPA 1YK9A 1HIYA 2AIRB 1AXQA 3KLGA 2FJAB 4TQSA 2MKYA 4A4JA 2OLWA 2JNJA 4FN5A 3TX8A 4H54A 4LFBJ 2PC6A 3KG0A 2XULA 4M5IA 4FNHA 4PXCA 3LANA 5L8RC 2B4PA 4P72A 4OIXA 1OPZA 2DNPA 1OY9A 3A8EA 2OTJS 3CJTA 1HWKA 3VF0B 3M2VA 5GVQA 3D54A 1IKXB 2F3JA 1RTDA 1LXJA 5T14A 4UOHA 2R8KA 2BOPA 1ZM9A 1B0VA 3PRVA 5FLXU 1LW0A 1NSAA 3ENAA 4DN9A 4BC9A 2FD2A 1D9AA 2BE2B 3NNAA 3N5BA 3PFOA 3WZ0A 2LQJA 4PXEA 8ATCB 4IR9A 1NJZA 3VQSA 3KUEA 2GJIA 1CJUB 1QD1A 3PX0A 4V19X 3RB4A 2NPIA 2PIIA 3BKUA 3TAPA 3G6XA 2AQ4A 4NLQA 4FXWA 3THPA 2BQUA 4GKKF 1IQTA 1SJ1A 1PC5A 1XEZA 3RB6A 1IWGA 1RLDA 4A8YA 1R8CA 2GVZA 4FVMA 2R2UA 3SYZA 2OMOA 2V4JB 3E2EA 1HNVA 3VAGA 3NGRA 3K8VA 1WOPA 2YQ0A 4IH7A 1RHJB 2RF2B 3G82A 4J7CA 1S79A 2CQ0A 2HIYA 3MEEB 4FYWB 3TNVA 5CD4A 1ZTTA 1YI2S 3IBWA 3QQCD 4YB7A 4C8LA 2WRMA 2CNLB 3VZHA 4DV7F 2LYVA 1FVSA 1MN9A 1FCAA 2QTWA 3GCXP 2B43A 2BA9A 1HBOB 1H98A 1URNA 4WU3A 1H73A 3J80U 4DCPB 2BW2A 2DGSA 2IBOA 1RGVA 2QN6B 2HZAA 3CSKA 2AZ3A 3M4XA 4B17A 2PSZA 4FXDA 1S6UA 5J2QA 4JP8A 1HQEB 4OI3A 2G2OA 5IQQA 3FEXB 3DCAA 5KFZA 1UVMA 4QCLA 2LA6A 1BY9A 2VIHA 4UW2A 3LGNA 5HMZA 2Y8WA 3I0RB 5HQLA 4UOFA 1GTHA 1KR4A 3RAQA 3KMQA 1UCNA 2MQOA 1X60A 1UW4A 4NLTA 2VONA 5DZ6A 3ZZRA 2PDAA 4RNOA 2MQ8A 2HGLA 2D41A 1REVB 4RW8B 4TU8A 3A4TA 4DQRA 2B4OA 2W4PA 3KNGA 5ETKA 1HNWF 3N9UC 1UVJA 3D0HE 2G2YA 1KD1T 3BEGB 3C66A 4OJHA 1ZM3A 2NUHA 1SL2A 3HHLA 3O5TB 3MM6B 2E1CA 1EETA 4OYIA 1FX4A 1GFWB 5D4NA 4PRFA 3M8SA 2V8HA 1UA0A 5LSLA 3I56S 4NCGB 2C2OB 3C6TB 3IS9A 3QGGA 4DUYF 3BDPA 3SCJE 1E6YB 2ZDOA 1UKUA 2BJ3A 2IIHA 1MMNA 1PAUB 3HSDA 3LQVA 4HACB 3L7OA 3OR2B 4NA1A 4RW4A 1AW0A 2WSCC 2QL9B 3FSXA 3GSDA 3OFGA 3K57A 4YR2A 4WFBQ 1XR6A 3TZWA 3M9NB 2C2DA 4UUWA 4DX8H 2MMYA 1HFEL 2K2PA 2OAUA 4OZ5A 2X51A 4DZDA 5AJ3F 1NKCA 4HR2A 4L3NA 4F7VA 2M2BA 1HWJA 3DDIA 3CJ5A 2FVCA 3GU0A 5AXLA 3HI9A 1S0OA 1S0VA 2HKEA 2MHEA 3NAHA 4XIUA 2RUGA 3I31A 2B0GA 2F5GA 2FUG9 3B8HA 3PXGa 3M9OB 1HWUA 2W7PA 1DRZA 3GV7B 1Z2LA 5DDQC 4WFXA 2XMAA 2YKOA 2D9OA 2VPXB 2FJXA 1TMJA 2CJAA 2MZTA 4M5NA 3PW5A 3IG1A 3GFXA 2MQQA 4Q2MA 2CPFA 3JQKA 4HL9A 1U48A 1QUVA 4USTA 2X1FA 4KT0C 5K5MA 2MGZB 1CULB 1RZMA 1JLQB 1MROB 2B4VA 3FFIB 3ZTRA 1IVZA 2CJXB 1S9EB 4NI2B 3LP0A 5F8LA 4I56A 5LMNJ 2VDIA 2UVUA 2X1GA 4ERDA 3HULA 4IOAQ 1SJ4P 3EX7B 4F3OA 1NBEB 4YB1P 1IBCB 4DV6J 4WPAA 3K5NA 1OQ6A 2HNZA 1R0AA 2XLKA 2FPHX 4EZ6A 2OTLS 2EK6A 4YEAA 1PJ6A 2RAQA 3PO5A 1P9QC 4G6VB 5ETOA 5J2QB 4BC7A 1S9FA 2A3JA 2M0GB 3GFZA 3EZ5A 1L3KA 1VISA 1YJUA 2AHOB 3L7PA 2JFDA 4DPXA 1HPZB 3MEDB 3HKZD 3M8QB 1LK7A 2UP1A 5I3UB 2Y1IA 2NZ4A 3VAJA 2ATLA 4JI5J 1LWEB 2CZVC 1GMWA 4XTTA 3QWPA 3ZZYA 2DGUA 2EFVA 2E7XA 3K7RA 4ED3A 2E5IA 3VHQA 3BPDA 4B02A 4K4VA 1ZAVA 5HJXA 4L76A 1VQLS 4GC6A 2ZBRA 1AUSL 3GYNA 1BQMA 2IHR1 3BSOA 2HQFA 2BANB 3DU5A 3EVWA 3SSSA 2Q3PA 4AL5A 1WC0A 1RU1A 1B3TA 4CQ1A 2KHDA 2ABYA 1XR5A 4OYOA 3A1YG 3SMZA 2U1AA 3D9BA 2CQ4A 3I96A 3SFUA 1SJRA 3X3UA 3TWZA 4DU7A 3G2XA 4M5LA 2XMTA 3TZZA 3G6YA 1QSLA 4N56A 3C19A 1WKKA 1RBLA 1ZAWA 2D7SA 4MT1A 4DQQA 2JC0A 3VGUA 4UUXA 2QG9B 1JXLA 4MKYA 3A8KA 3TZXA 1QVFR 2A18A 3CIZA 4Y2AA 3HHNB 3M8PB 3KK1B 1V3SA 2EKYA 1DQAA 1YWXA 3EGWB 3JS9A 3BB5A 2DY9A 3QO9B 2BW7A 2IC3A 5EX3A 3BS9A 5BJRA 5KT7A 1QSSA 2V9WA 2VH7A 3MM7B 2HFVA 1X4GA 5HROA 3BH6B 1YDLA 2WVCA 2OO4A 3ADAC 1N0VC 4TQRA 2PT0A 3OBIA 2KU7A 2RQ4A 3K89A 2UU9J 4H4MB 3EJMA 4CI0B 1R0CB 3T5KA 2AD9A 1SUQB 5B0FA 5J1PA 2IFXA 1TL7B 2Z56B 3I9ZA 3MM5A 2HBYB 4C3LA 2IMWP 2DRDA 4CO1A 4C8ZA 3UN3A 2C3UA 2WVFA 1I1GA 1CC8A 2B3TB 3AQPA 3PJXA 3G6VA 1UVIA 5FJ4A 4I1TA 2XLJA 2BJ1A 1ZBTA 4AUKA 1X9SA 1OQ3A 2XWYA 5F9LA 2WB4A 3CCQS 3THTA 4N77A 4ZMMA 3CF5Q 1FFSB 4TNOA 4ALZA 4OI4A 5HK4A 3N01A 3J7ZT 1T9XA 5D0GA 1FEEA 4MAKA 4DL0C 4M1KA 3KKFA 2IVFB 2X3GA 4JI8J 4G1QA 1NK5A 1Q8LA 2J7KA 1Q7LB 3TARA 2CYYA 1VYAA 4ZVPB 2MXYA 4LF8J 2RJZA 2K06A 2YX7A 2KZMA 1N48A 2D3O1 1UL3A 3MEDA 3HJFA 1DAXA 2VA3A 3V2UC 4IG0B 1LNQA 5EHHA 4QU7A 2GGPA 4OZNA 2V4RA 1DARA 2DIUA 2J7WA 3M7VA 4G65A 2OEJA 4CM2A 4F4WA 3RTVA 1YHQS 1TKTB 4Y34A 1T02A 2R7RA 1FA0A 4JI5F 3KLFA 3W3SA 1S1WA 2N4DA 3SCLE 3UNYA 4DXLA 1WDDA 3JAMY 2CPHA 5DETA 1P1LA 1IR1A 1VC6A 3FVYA 1S76D 2X3DA 5D0RA 4W90B 1RT1B 2DJWA 3PM9A 3KXDA 1VQ5S 3PR5B 1VIXA 4O3NA 3V81A 1QE1A 3VR1A 2EBGA 1YJNS 4CTAA 1K47A 4EO8A 3HXMA 3J7Z5 1R6VA 3CVKA 4K5SA 2V67A 4BWJA 2W2NP 3LALA 2CQ3A 3M8WA 3GG1A 2IM2A 1HR0F 2PGCA 1IBKF 1FD2A 2CQBA 2HVZA 1FRJA 2KT3A 3MOZA 4JI0F 3CC4S 1WWHA 3EPGA 3HKWA 1IBMJ 2VBXA 3MR7A 1ZZNA 3PJ9A 1HHTP 1FFWB 4WTOB 4AQYF 1U47A 3SXLA 4XK8C 3KTQA 1XK8A 4X4VA 1KVJA 4CP5A 2C22A 1F2HA 4I6AA 2JEGA 3D2WA 1N36F 2WSEC 1I94F 1A9NB 2LU2A 1LXNA 3HSZA 2RB7A 3HFKA 2RDJA 3OVBA 5K8NA 1HQEA 2XI2A 3SV4A 1B0TA 5BYRA 4F25A 3W8PA 2QX0A 3ET6A 4YHHJ 2W9BA 1UFWA 3LF0A 4X65F 1MLAA 1ELOA 2E9TA 2MLZA 2HFSA 3NGKA 4OI2A 1NM2A 3OHAA 1RHUB 2J7UA 4ZN1A 3RBDA 4B9UA 2UXDJ 2R7XA 3ZZ0A 1TU0B 5ETQA 2LFVA 3C16A 3P5BP 4NL5A 1S1XB 4PAAA 2GIQA 3QT6A 4WCEQ 3R1LA 3TVKA 1CQNA 4IOBA 4LF1A 1X5SA 5CD4H 5T7LA 2H5JB 2ZH8A 4ZLPA 2JH3A 4NEYA 2ZHAA 1NU4A 4DLEA 4DFKA 1T95A 4I2PB 2CXEA 2RHQB 4G3IA 5LOQA 1AFIA 3KUHA 4F0KA 4WXOA 3HSJA 1WELA 1EETB 4HDHA 1RSCA 4DZ6A 1J5OA 2WAQD 3EGZA 2K3KA 3VQTA 4JYAJ 4EK2A 4DPYA 4WK1A 2HAFA 1NUEA 1D3WA 4PQUB 1Y3KA 1BE4A 1O0PA 3WBZA 3OJSA 2WB1D 1UAWA 4JUZA 5M2PA 4P52A 5D4LA 3KJVB 4K0KJ 2FHOB 2RF2A 3DXSX 5DLFA 4I2QA 2COLA 4M5DB 2HFNA 3F44A 4ED0A 1ULRA 3DLJA 2DNRA 1QJHA 1ZM2A 2CADA 5J1EA 4P10A 3O1LA 1WC4A 2R2TA 4ED6A 3PW7A 5EUHA 1MWQA 1EB0A 3E51A 2KHCA 2YKMA 5AE1A 2FC8A 2MZSA 5IOLA 5HVGA 4RW7B 5D4OA 5DG9A 1NZAA 2J0QD 1SL1A 4F2RA 2YNHA 4A8WA 3NS7B 3P5TL 1J2VA 1NPRA 3CXCR 1RU2A 3HVTA 3IWXA 2QLBB 1YZ7A 2MSSA 3DI6A 5KFQA 2XZWA 3H2LA 1HLWA 5E3CA 2MQPA 3T41A 5DDPC 3T1YJ 1QLNA 3WDOA 2E9ZA 1XNRJ 3DNCA 1KWMA 1JNRB 2QV6A 1NPPA 3O44A 4D3GA 1C1BB 5B0EA 2O66A 3M6UA 1VFJA 5A0YB 5DQGA 2J6SA 2UXDF 2RT3A 2R7TA 2ALYB 2MDAA 4URSA 4KRWA 2APOA 4JI2F 3R2DJ 3CO0P 3FCWA 4ETZA 3R5AA 5I42A 3A3OB 3AB2B 4DPTA 3EZOA 5KFSA 1U26A 2YPYA 3TYTA 4YY3J 5KAKA 2KFZA 2B4UA 1WF1A 3KK1A 5KT2A 1FKAF 4Q8EA 1S49A 4C2MA 3NOCA 3QAEA 4PZVA 5C24B 2IC3B 4KC5A 4WFZA 2W7AA 4LVNP 2HHUA 1H2VZ 1KBRA 2FHKA 3KLGB 2NYIA 2F4FA 3W60A 4P9SA 4DCJB 4DX5A 3D6HB 3KJNB 4ANCA 2GO9A 4X66J 1ZA1B 2QLJB 3W5YA 4AE5A 3FCHA 1DBDA 2MY8A 4F3QA 4LF9J 1S6QA 2ZEJA 3R6LB 4OHXA 4PXDA 2DR8A 1NJXA 2GIRA 1APSA 1X5PA 2RHSB 2R2SA 3T1HJ 3GR0A 1M90T 1KKHA 1BQMB 4TU7A 2YKNB 1XMOJ 3DMJA 3RR7A 2W2MP 3NGUA 1R6YA 3HZGA 3MMCB 3TJ8A 2J76E 2C2MB 4PQUA 2D74B 1NDLA 4B3TJ 2FJEB 5KT6A 1JLQA 1MROA 1PGZA 3M2UB 4CO0A 4HT5A 1YJTA 4HH0A 4CLTA 4DHVA 4FBTA 3IRXA 4HLBA 4KGVB 1VI7A 3G4SS 4U7UD 1XIQA 3DKDA 2I8EA 4DEZA 5BR8J 1V3RA 1Y3JA 2D3ZA 2L48A 3CCLS 1V6HA 3NY0A 2KVIA 2H5IB 3AJ2A 4I68A 4K2XA 1NJWA 4FVCA 2I38A 1U8SA 3QT7A 4NCBA 2G2ZA 3P49B 5DM7Q 3W63A 1NEEA 3MF5A 3PYGA 1L3UA 1LFWA 2B56A 1E6VA 4KKOA 4CNYA 3W2VB 1JJHA 1YBUA 4J9PA 3UN2A 3GG0A 4C4WA 2VBYA 2HWIA 3UR0A 3FEYB 2CPEA 3HM9A 4CLLA 2Y0SD 2RRAA 3L4BC 2LU1A 3V6JA 4DPUA 2N3LA 2BJDA 1S1UA 1RE1B 4O23A 1VRTB 4TKTA 2QEXS 2UUAJ 1FWPA 2MQNA 5GAHU 2AKWB 3JB9k 3CMES 3OJUA 4DR3J 1FHTA 5H9FK 3PJWA 1T0TV 4XDDA 2OD6A 4JI8F 2BZ2A 2OEMA 4DV5F 2R9LA 4USKA 1QY7A 4JV1A 1JJCB 1HBNA 3MWBA 5BR8F 2VJVA 1C0UB 1F6TA 5KFVA 1JB0C 1BQXA 2YXLA 3QIPB 3KLEB 7FDRA 4CDIA 5AXKA 1U7LA 2AYEA 4O0NA 1HWIA 1FRMA 4ZVOB 5DJBA 4F0HA 2ZJPQ 2HPUA 3JQMA 2OPSA 4LQ9A 4LREA 3WIUA 4DSLA 3IP0A 4TY8B 4M5DA 4ZN3A 3S8SA 1M5OC 2HQGA 2WOMA 3BKTA 1W7WA 3M2RB 3BQ1A 3V6DA 1MMDA 4C8NA 4Q0BA 2OPQA 2J0XA 4O4RA 4DMZA 1CJTB 4UOGA 4HACA 4O3SA 3BDEA 2I1RA 2H51B 3I5CA 2W9BB 3T5JA 2OH2A 2KG0A 4WZMA 3ONQA
chains in the Genus database with same CATH topology
1QUPA 2EW9A 1LFPA 1VLYA 2E5GA 3ISZA 3N6MA 4BBYA 4KFBB 3KWMA 4C97A 2R8GA 5C5JA 1S1XA 2ASYA 2FVRA 1HQUB 5KFLA 2VC1A 2QMWA 3NGDA 4NLYA 1RT2A 4IFYB 1HD1A 2CQPA 1BLUA 2O5DA 2J0SD 3MUTP 1F5BA 2KG1A 4YDXA 1Q4RA 2ZZNA 3C6UA 2FHJD 2BACA 3T19A 2I5JA 4A8KA 2LXUA 3MM8B 4AXIA 5AXNA 3IR5B 2KO1A 2AYGA 2QLWA 4R8UB 5CQGA 5GADU 3W2WA 3CJ4A 2W8KA 1T05A 4FF1A 2XLIA 3GQCA 1U49A 1X9MA 1RT6B 1VHFA 2QA4G 1G2EA 2Q43A 3K0JA 3O6QA 1VOMA 4DV6F 1UJ5A 2XNQA 3IS9B 3V4IA 4KAIA 1D8YA 2UUCF 1FKPA 4I69A 2RDIA 2ZE2B 4RNFA 5KOWA 4ED7A 3G71S 3VAKA 1FVQA 2W24A 3CCZA 3I32A 5B09A 5GMKa 1WEXA 1FDBA 1Y5LB 5DLGA 3H2UB 4A48A 2IAJB 3C8YA 4C11B 1VQ4S 3LAKA 5M2RA 1UJ4A 3HP6A 1VQ9S 2DRBA 1B64A 3QMQA 3PZPA 2HQ3A 1JKHA 3DU6A 2HLTA 4QBUA 3WX4A 1BC6A 2ZFHA 2ZH3A 2VODA 2KFNA 2EFPA 2ZH9A 1KHVA 2HHWA 4ID8A 1CVJA 4H4KA 4ID5B 4QR2A 5MAOA 3CGIA 5CCMA 5D6GA 3EXCX 1DQ8A 1U6BA 2B7CB 5H9EJ 4TYBA 2VL1A 1Y7PA 4LT6A 1KEKA 4NLVA 3ISNC 5DM6Q 2RU3A 1ZZFA 2PE8A 2DNGA 4HDGA 4E8UA 2BQ3A 1HI8A 3DHWC 4G1IA 2IA6A 2PA8D 2AJ4A 2ZZMA 2DPIA 2J9DE 4MH8A 5CYJA 2I0XA 5KOXA 5HLFA 3DLHA 1DURA 4Y2KA 5GAHI 3OXFA 4Y0FA 3RYLA 1VQPS 2R8HA 3I0SB 4H4KC 1RAJA 2MSTA 4RU9A 4YHHF 3ZZZA 3BO3A 2AYBA 2DNOA 3QO9A 4LFAF 5D77A 1HPZA 3SDEB 4PXBA 5I3UA 1K9MT 1HI1A 2YX4A 3DFEA 1QM9A 1IJFB 1M0SA 1XWLA 2RRBA 1C1BA 2O1PA 2W25A 5A0YA 3I6PA 4K50A 2YNFB 1JLFB 1R27B 3AY0A 3D1HA 3NMAA 1UEVA 4J9RA 1WD6A 1URRA 3TA2A 5DQIA 3JSMA 4RW9A 1SC6A 2CQCA 3CD6S 3OW2R 4HKQA 2FTRA 3G8TA 1DLOB 4B08A 2ZUGA 2Z0GA 5K14A 4QWDA 5FDLA 4QJVA 4Y3CA 3OQ2A 2UV8G 4I0WA 5KFCA 3W2VA 3U1MA 1LWFA 1C1CA 2XCPA 3I87A 2ZDPA 2OMLA 2CG4A 3V4MA 3VAMA 4B3SF 2I2YA 4FXVA 2ZHBA 1TL3B 2ASDA 1VRUB 3S6EA 4B9LA 5KFYA 2CIMA 3IR7B 2F8HA 3UW1A 4BS2A 4MK7A 2YKMB 3D0IE 1U1KA 2H9ZA 3CCVS 4X4PA 2YKNA 3H8YA 5CZVA 4J9OA 4DFMA 4K59A 2R4FA 3C6UB 2FB0A 3OUYB 5F8NA 1HBMA 1R8HA 3SCKE 4IOCQ 4KO0B 4B9TA 4YR3A 3OR1A 1DTTB 4KB7A 1U1NA 4KJIA 1LWCA 3K58A 1NRKA 2OFGX 1KTQA 4USHA 2DGVA 2D9PA 2KYZA 4EYIB 3IGVA 1Q16B 4OJ3A 1VC5A 3FNNA 1WG4A 4O3RA 1TKXB 3IWNC 3RW7A 4NYZA 2HRYA 4RZRA 2FHJA 5F8HA 4DFJA 3ENQA 2M9KA 2ZE2A 5KFXA 1WHWA 2GHWA 3QPIA 4IYQA 1LW2A 1IR0A 5HBMB 2V8GA 1N6QB 1Q86T 2MZ1A 3QZ8A 1ZTWA 2R2RA 4HI2A 3OHBA 3D5MA 3C46A 2ZITA 5AE3A 2KI2A 2W7OA 1YITS 1WEYA 2VPZB 3QIDA 3HHLD 2W8LA 1IM4A 1HNIA 1PO6A 5A8RA 2MKKA 1WEZA 4QYZJ 5LJ5Y 3IWLA 2HAIA 1LV5A 3MMBA 3KLHB 3T9NA 3HPOA 4DDFA 3G6ES 3LP1A 3ZZPA 4ECUA 4F2SA 2L9NA 4DF4A 4NLXA 3BQ0A 1D8ZA 1F5AA 4DSKA 2L08A 2RS2A 1WHXA 2O3DA 5J2NB 1KNZA 2UUTA 1U4BA 2C3MA 1PC4A 3DOKB 2OPQB 3S1TA 2JFKA 5IXUA 4TXSA 2ZH2A 1MNEA 5EN1A 1VQMS 4XDCA 1R8AA 2VG5B 2Y1JA 2YH1A 1OS5A 3BSNA 5M2UA 1RT3B 2ROEA 3LWLA 2ILYA 4U7CA 5I3QA 3Q0AA 1NK7A 4WE1B 2EG2A 1CEZA 4B3OA 2F9DA 3BZQA 3CT9A 5GAGI 1X5TA 4MTPA 1SV5B 2LQBA 1UVKA 3CDBA 3POTB 4DSJA 2KYXA 3RB0A 1RP5A 2P9CA 4X4UA 4IH6A 2WCXA 1Z2ZA 2CJQA 4ZKAA 3NNHA 5KFIA 3TR5A 1SIZA 5D4PA 5F8GA 5EDWA 2U2FA 2XEXA 1Q7YT 1YQHA 4QWAA 4HH1A 1NH7A 1XTZA 2DNKA 2GX8A 3QLHB 3MOJB 4LSNA 4F3MA 1A6LA 2VFVA 3DRPA 3CB4A 3SSQA 3OR2A 3MEEA 1HBUA 2D1CA 5J2MB 4DQSA 1X7VA 2G0CA 2HMIA 1K8AT 3KHRA 2ZJQQ 3M2RA 3OFFA 4C0OC 3MEGB 3BO2A 3OXGA 4ICLA 4IKAA 3HO1A 2XSFA 2ZC3A 2YKPA 1P1TA 4B3MF 4LSLB 2DO0A 1IKXA 1RTDB 2NXUA 4ES1A 1L3TA 3TAMB 2VBZA 2XY5A 3B4DA 1U1QA 3TW0A 2HFZA 3OUYA 2PMHA 2CPZA 2PO4A 3E01A 3MMBB 1H2UX 1UMJA 3DXBA 3R27A 4AL7A 1M90T 4RW8A 4AL6A 1IN0A 3T1YF 5IM0B 2VV5A 4QQBA 4LFCF 4MJKA 2WSFC 3U27A 3TRGA 5MLCV 4YY3F 3T1HF 4KHRA 4DV2F 2NLWA 1JLFA 1VQSA 2QMXA 1N5TA 4N8NA 3MTKA 4EFAC 2UUWA 1N0UA 2QE5A 2AX0A 2J6UA 1MW7A 3MR6A 1KQGB 1CLFA 2G4BA 2Z8QA 4PCQA 1KLNA 5FIIA 4P2SA 4I6WA 2CPDA 1WTBA 2OPPA 4QIGA 1RT5A 2AV5A 4X4RA 1CG2A 3I5AA 4DSEA 1HARA 4DBQA 4HEA9 5E33A 1NK0A 1CQMA 1TFYA 1UEUA 1U24A 1S9GA 1O8BA 2K1RA 5HQ8A 4PQAA 4AFFA 3V6DB 3Q22A 1IKYB 4WK3A 3OTCA 3FQLA 5KFMA 2KJWA 3D0GE 5B0DA 3SQGA 4ED8A 4ZPBA 1SQEA 4M63A 3BO4A 3G96A 1TKDA 1AUDA 4IH5A 2HNDA 4KO0A 5EWEA 2VOOA 3U1LA 1GXLA 1VRTA 2JX2A 5JVGQ 2ROPA 3CIMA 2EK1A 1LKZA 2ZD1A 1X4HA 1Q8IA 4KTQA 1N8RT 2IM1A 2EFQA 4I64A 2MZQA 4Y6IA 5F8JA 1FXRA 5D8HB 4GO5X 2P6TA 1IKWB 1S6PA 2IYIA 2E1MC 2HHVA 1HWLA 3TA0A 3TI0A 4ZCLA 5KFNA 3JYTA 1JIHA 3VAFA 2GNKA 3SSRA 3SZ2A 2NSBA 1C1CB 4A46A 3Q8PB 2AU0A 3I5BA 3I4PA 2NS1B 4KV8B 3UFCX 3N5FA 3SI8A 2XI3A 2BBEA 2HVIA 2VFRA 4K4TA 2ASJA 4N76A 3P96A 2V4QA 1FF2A 1SXLA 2OP5A 1YG0A 3NS6A 3SV3A 2P6SA 3KLVA 4J9NA 2GC8A 2XBPA 4DR1F 4EZ9A 2CJ9A 1FRXA 1FO1A 2J6TA 3HK2A 2E44A 4J9QA 2VG7B 2RQMA 1N5YB 3GIJA 4EBDA 3PEJA 2DNYA 3T3FA 1DZ5A 1L3SA 2LCWA 3H5XA 4YUDA 1RT2B 2Q79A 2NUUG 3K8WA 3F73A 1R8PA 3MR5A 3MXHP 1IKVB 2BVZA 1KQKA 1FT8A 1W2BR 1SH2A 3H5SA 4Y28C 5JXSA 1N54B 3QIPA 3KLEA 2B6AB 4KQZA 4NLPA 1R31A 1V9OA 3QGPA 2CPYA 2HVHA 2KJVA 3H40A 1RT6A 5J1NA 4LF8F 3CC2S 3BSCA 2YNGB 3Q8QB 1RT7A 2F7VA 4PWUA 1S1WB 2B7BB 3CE8A 4MK8A 3V4IB 2OD4A 4WJBA 3TANA 5B0CA