2MQPA

Structural investigation of hnrnp l bound to rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
QKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Protein Hnrnpl
publication title Structural Investigation of hnRNP L bound to RNA
rcsb
source organism Rattus norvegicus
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11835 RRM_8 RRM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mqpA01
4Y0FA 1PO6A 2FHOB 2OSRA 1VBXA 1D9AA 2CQBA 4UQTA 2WBRA 1X4AA 2DH8A 4EGLA 2J0SD 2J0QD 1DRZA 5DM6Q 2ZJPQ 1R8HA 2DHSA 4QU6A 4Y00A 5CXTA 2DNHA 2DGWA 3BS9A 2ZJRQ 1M1KT 1WELA 1VQ5S 4CH0S 3I55S 1UW4A 2LXUA 2MYFA 2RQCA 1G2EA 5ITHA 2KFYA 2HYIB 3P3DA 3H2VE 4YOEA 1WHYA 5IFMA 3CCUS 4IO9Q 3FEYB 1A9NB 1WG1A 3PIPQ 1L3KA 2M8DB 2QEXS 4TU7A 4QU7A 3SMZA 2B0GA 5DETA 2XB2D 3NNAA 3S8SA 1WWHA 1QM9A 4C7QA 2LKZA 5IM0B 2DHAA 3G6ES 3VAMA 1XN9A 2UP1A 1P1TA 2U1AA 3MURP 3CCJS 1YJNS 4QQBA 4QPTA 4WFAQ 1FJEB 2HGNA 2M0GB 4BS2A 1M5KC 1K73T 2DHGA 2NZ4A 2QA4S 3BO4A 2MZJA 2CPYA 1U1QA 1WTBA 3UCGA 1Q82T 2E5HA 1VBYA 2KRRA 3D2WA 1UP1A 2DGSA 3S6EA 1FNXH 5DDOC 2X1FA 2E44A 2MZRA 1JMTA 2L08A 2L41A 4FXWA 1BY9A 1WF2A 5D77A 3EGZA 2RT3A 2MMYA 3VAGA 1R8PA 3CC7S 2KT5A 1X5SA 2F9DA 2OJ3A 5LXYA 2RVJA 1SJ4P 5FJ4A 2E5IA 1YWXA 2MZSA 1CVJA 1X4EA 2DO0A 2LYVA 3NS6A 1U1MA 2DGQA 2KXNB 2X1AA 2GHPA 1W2BR 3CCMS 2OTJS 1WEZA 2CPXA 4WIIA 2KXHA 2KM8C 1HD1A 3SXLA 3BEGB 3MD1A 2DHXA 2DNZA 1HL6A 4WCEQ 2CPJA 2JRSA 3VAHA 3MUTP 1SJRA 4W90B 1FJCA 1KOHA 2CQ2A 2MZQA 1X4HA 4F02A 3UWTA 2KH9A 2LA6A 2NLWA 2RS2A 4OZ1A 3CCES 2MB0B 4W92B 4J5OA 4IUFA 2CPFA 2KM8B 1DBDA 2LXIA 3TYTA 2LEAA 3MDFA 2HVZA 5H1SV 1H2TZ 2MQLA 2M52A 1DHMA 2MKCA 2MY8A 3CMES 2YTCA 4CH1A 3SDEB 5GAGU 2RRAA 4U67Q 1VQ6S 3THPA 5DM7Q 3S01A 1QVFR 4P6QA 1U6FA 3CCVS 1WHWA 5DDPC 3RW6A 5GVQA 2DGXA 2RRBA 5DDRC 1YITS 1ZH5A 3CCSS 1VQMS 3HHNB 1M90T 2DNPA 2CPDA 2N3LA 2DITA 2MJUA 2LA4A 3US5A 4IOCQ 1SJFA 3TO8A 2OTLS 3VAJA 2KRBA 2G4BA 1A7GE 4WFBQ 2MQPA 1JJHA 2CJKA 4Z2XA 3VF0B 2MGZA 2DIUA 1KC8T 3EX7B 2DNMA 1VQPS 3G8SA 1H2VZ 1M5VC 1VQKS 5LJ5Y 4F25A 2DNYA 3NS5A 3R1HA 3CULA 1VC5A 5LJ3Y 1N8RT 2M9KA 1VC0A 2EK6A 1ZZNA 2OIHA 2LCWA 5GAHU 1N52B 2N82B 1FHTA 2DGVA 1X4BA 2DH9A 5IQQA 1YIJS 2MKKA 2JX2A 3HI9A 4PR6A 4OZ0A 2RUGA 2RU3A 3PIOQ 2O3DA 3CCQS 2QFJA 2JWNA 3VAIA 2D9PA 1SJQA 2MSTA 2CQ0A 2Q79A 2MKIA 1VQLS 4RU2A 2J76E 3FEXB 1D8ZA 1N54B 3DXBA 2I38A 2MY7A 2ERRA 1UAWA 3UD4P 2MQNA 1YI2S 3UCZP 4PRFA 2V94A 2YH0A 2DNRA 2DISA 2MZ1A 2MSSA 2JVRA 1Q81T 5EN1A 1WF1A 2LECA 1X5TA 2CQ3A 2DNLA 1K9MT 3BO2A 1VQ8S 3NNHA 2CQPA 3I56S 2DIVA 2M7SA 2DGOA 2DB1A 2EK1A 2DGTA 1WHVA 1X4DA 3P6YC 2M8HA 2F9JA 3R27A 1JJ2R 2VOOA 3L3CA 2F3JA 2YH1A 1OIAA 3G8TA 3CC2S 3IWNC 5LSOA 2GO9A 3J7ZT 5GADU 1VQNS 1X4CA 2CQ1A 2FC9A 2X1GA 2PEHA 4CQ1A 3CPWR 1U1OA 2XS2A 4A8XA 5LSLA 4ED5A 1U2FA 1X5PA 5IM0A 2X1BA 4TU8A 4TLQA 3V4MA 1N88A 4FXVA 1U1NA 1Q7YT 2XSFA 1KQSR 3B4MA 1YJ9S 3R1LA 5D78A 3MOJB 3G71S 1FXLA 1JJ4A 5HL7Q 2XNQA 1U1KA 2AYBA 2PE8A 4YUDA 1NJIT 3LQVA 2CPHA 2HZCA 1WI6A 2CQCA 2MJNA 2KI2A 1VQ9S 4F26A 5DDQC 1NU4A 1U1RA 3B4DA 2ZJQQ 2MQQA 3VAKA 3OW2R 2K8GA 1OO0B 5HO4A 1M5PC 4C4WA 1NO8A 3EGNA 1U1PA 2E5JA 1X4FA 3CMAS 3K0JA 2VODA 3MI7X 2AYMA 2DK2A 2MKHA 5LXRA 2LEBA 2L9WA 2M4MA 1VQOS 3MUVP 3CXCR 1O0PA 2MKJA 1FJ7A 2EVZA 1VBZA 2LQ5A 1YHQS 4WKRA 2XS5A 1HA1A 2LMIA 3UD3P 4CIOA 1SXLA 3G96A 3G9CA 2MKSA 4WFNQ 2KG1A 1WF0A 3DLLQ 4ZKAA 1PGZA 1P27B 3U1LA 1URNA 1WHXA 2I2YA 1YJWS 2XS7A 3MUMP 2N3OA 3CCLS 2MHNA 2G1DA 2VONA 2BZ2A 2KHCA 1YTYA 1FT8A 3VALA 4V19X 4WF9Q 2D9OA 1U6BA 3CF5Q 2DNNA 2M88A 2N7CA 1FO1A 4M5DB 5GAEU 5JVGQ 2HGLA 3NMRA 4TU9A 2U2FA 1VC6A 1WG4A 2BOPA 2KG0A 2DGUA 2K3KA 2SXLA 1IQTA 2CQHA 2FPHX 2KYXA 5JVHQ 1RK8A 2ADCA 2VOPA 3SDEA 2AD9A 1F9FA 1OPIA 1ZZFA 3THTA 1UFWA 2DNKA 3H2UB 1WEXA 3TP2A 3ZZYA 1WEYA 2M2BA 2M70A 2DNOA 3G4SS 2CPZA 4UY8T 1M5OC 3RW7A 2J8AA 2DO4A 3UCUP 4PKDB 1WI8A 2RQ4A 3NNCA 2RNEA 3UE2A 2MZTA 1X4GA 2JVOA 3MD3A 2ADBA 2DH7A 4C0OC 2E5GA 5GMKa 1B7FA 3P49B 2G0CA 2XNRA 3S7RA 2HGMA 2CPEA 1DZ5A 3J7YU 3CD6S 3CC4S 4LMZA 2OSQA 1H2UX 3Q2TC 5MLCV 2CQGA 1VQ4S 4IOAQ 2FC8A 2YKAA 4LIRA 1X0FA 2RS8A 2KU7A 2YWKA 1Q86T 2MGZB 1SJ3P 3ZZZA 3ULHA 5BJRA 2MXYA 3CUNA 3MXHP 5CA5A 1H6KX 2CQ4A 3IRWP 1KD1T 2CQIA 2KVIA 1WG5A 2D3OR 2DNQA 3VAFA 2KXFA 4ERDA 3CTRA 3JB9k 1OWXA 2KN4A 1AUDA 2DNGA 3BO3A 1S79A 2FY1A 3N9UC 3P5TL 2MQMA 5CYJA 1X5OA 1U1LA 1HD0A 2CQDA 3Q2SC 1VQ7S 2CPIA 2MQOA 2AYGA 2A3JA 1QVGR 1S72S 1K8AT 4YB1P 3LPYA 3U1MA 1KOOA 4LJMA 2AYEA 3CCRS 2MPUA 1RKJA
chains in the Genus database with same CATH superfamily
3BGLA 4ZPDA 5HP1A 2OSRA 5FIIA 2CQBA 2ZJPQ 4DSIA 4QU6A 1FVQA 1M1KT 5K8NA 2GJFA 3MEEB 3DHWC 3MMCA 1WG1A 1BQMA 2QMXA 2RKIA 2KO1A 1UWAA 4TU7A 3KK1A 1TK5A 4CCHA 1RAEB 4QWAA 4TY9A 3UNYA 4I56A 3R97A 2IBOA 5HK4A 1AROP 1RAAB 4IRDA 1GTEA 3QRQA 3J7Z5 1WTBA 2GVZB 3WZ0A 1LEOA 2W2NP 3D2WA 1TAUA 1RBOB 2X1FA 2JZ5A 2ZOGA 3J7AN 2QE5A 3OHBA 5LMNF 1WOPA 4K59A 3N6NA 4IDKA 2NQPA 2G13A 3C66A 2MZSA 4A8YA 1WDDA 5DG7A 4WBFA 2KM8C 1RT6A 3BEGB 3UN3A 3EPIA 4QWCA 2OUGA 4KHPF 1DBDA 2FJEB 4J9RA 4N41A 1Q78A 2MKCA 4KHRA 3CMES 2MLZA 1VQ6S 3HKZD 1S1WB 1JLBA 4K2JA 3NWGA 4LBIA 1HNZJ 4M5MA 3M2UA 3R3TA 4DBQA 2DITA 2MJUA 4OYZA 3ZZRA 3L95X 1IBKF 3AQPA 4DUYF 2OPQA 4DQSA 3N0VA 3GYGA 3FRZA 1M5VC 1T05A 4NLRA 4MKVA 5GAHU 3NS7B 4URSA 2IM3A 1NNDA 4DR3J 4OHWA 1NPRA 2AU0A 3DFEA 2BDPA 1ZA1B 4ES3A 1T9YA 2WTFA 2BQRA 1VQ8S 5I42B 4DU8A 2GIQA 3DRXA 2M7SA 1T95A 3HXMA 4JI0F 3QO9B 1GX6A 2CZVC 4UF4A 3HT3A 2KDOA 2UUCF 4LR8A 3MPWA 2WVEA 4USVA 3FZBA 3PTWA 1N88A 4DFKA 1LW2A 1HNWJ 1K1QA 4X4QA 4A8SA 1KWMA 2GA7A 5D78A 3U7JA 2LU2A 2UUWA 3CCZA 5EX0A 2HZCA 3HVTA 4A8FA 3L4BC 2V6AA 2DRDA 4Q2MA 3PKYA 1SC3B 4X66F 1NO8A 1SIWB 4O44A 1NH7A 3J7YI 1S6UA 1GX5A 3MR3A 4C97A 4U8VA 2L9WA 5D3GA 1E6YA 3PVXA 2R42A 4ICLB 4HT5A 3BQ1A 4MIWA 4TXSA 5CYQA 2MQ8A 2W9CA 3CJTA 4R5PB 1NXIA 3M05A 3DDNA 2VG7B 2RU9A 3M6XA 2I9SA 4H4MB 2XY5A 2FB0A 1AUSL 3MOZA 4WF9Q 4DPOA 3M30A 2M88A 1TVRA 4DPYA 4JI4J 4D3GA 2DGUA 2HHHJ 3QBCA 3H4DA 1MN7A 3LUYA 2R8IA 4MMOA 3KHHA 2UVVA 1FE4A 3THTA 1G6BA 3NOGA 2I5JB 4X4PA 2VPYB 2YNHB 3DXSX 2ADBA 1WORA 2BACA 4OX9F 4A8WA 1BQXA 1FX4A 2XNRA 4U9RA 3CC4S 3MEEA 4NRUA 2V4JB 2R7OA 2V50A 4YMEA 3L7UA 1IKXB 3I4HX 1URRA 1IVZA 3R5DA 4KBIA 4NYOA 3GIMA 4RKUC 2VG6B 3IRWP 5LMUF 1WG5A 1HHQA 2B4VA 2H3EB 4JI6J 1SUQB 3ETOA 1YX2A 3A12A 1J5EJ 3SSSA 3V81B 1XWLA 5CYJA 4U7CA 1U1LA 4O0NA 1EETB 4MIBA 2MQOA 1CJUB 3HHKA 1DURA 4WU3A 3C14B 3E8OA 4ZJOA 5IV4A 3PJXA 4B3TF 4N5SA 1D9FA 2YNFB 4ZK7M 2UXCF 1WC6A 5D4LA 3ZO7A 4RL1A 2KFYA 2HHPA 3SCJE 2JFDA 5IFMA 1ROFA 2RRNA 1ZYQA 2P2CB 5DETA 2XB2D 1TV6B 3PNIA 1XR5A 3VGTA 4ZITA 5HN0A 4ZVTB 4C7QA 1S9EB 3TW0A 1GEHA 2FJDB 2PMHA 2QC3A 1YJNS 4ZPAA 2Y1LB 1SC1B 1H7WA 2QA1A 4ZN1A 1Q82T 2NREA 2RJZA 2BJ8A 2UV8G 2YKNA 2BBEA 1TKDA 1WKKA 1X5SA 4KR0B 4ITSA 4WJBA 4LSZB 2E7WA 5KG6A 4LF7F 1F5CA 2XYPB 2ILYA 4IOBA 1Q0NA 5FLXU 2OLWA 1U2CA 4ECYA 3R5CA 3T1HJ 2KFNA 2XMMA 1IKWA 4W92B 2C2OB 2EI5A 2BJ3A 3SCLE 4DXLA 3C15A 3QRRA 2EEYA 3JAMU 2D74B 4M5KA 3NOCA 4ECWA 4P6QA 4H4KC 1WHWA 1GXUA 3RW6A 5GVQA 1VIXA 3IR5B 1M90T 1EJ7L 5L9NA 3HP6A 1N34F 2HMIB 2G4BA 2VU5A 3HO1A 4E0DA 1HBMB 2Y3YA 5DZ6A 1KC8T 2H9ZA 4ZCIA 4ANDA 1F1BB 1NPKA 3KXDA 4ILMA 3NS5A 5F0UA 1RAJA 1RAIB 5LJ3Y 2YQ1A 2DR7A 4J9LA 4PEOA 1CEZA 5T7LA 3OSPA 3GJQB 2ZH6A 4P73A 3CCQS 3GFXA 2R7VA 3SV3A 1YSJA 4PPDA 2FHMA 1XNQF 3FCWA 1WKJA 3TZXA 3PW0A 2MY7A 4FYXB 2ZBCA 2J0XA 2JVRA 4G1QB 1X5TA 2PD1A 3E3XA 4ZP7A 5DO2A 2KFZA 2HPUA 4M5JA 2DGOA 2OPRA 3LGHA 5F3TA 1XTZA 5FD1A 3EVOA 1J27A 4R5PA 2GJ2A 2GIFA 1KDNA 4H4MA 1TKXA 1FNMA 2GO9A 2V0NA 2WSEC 4DX6A 3RB6A 3KLHA 1PC4A 4UW2A 3UDCA 4CQ1A 4RU9A 4ED5A 3PZPA 1RA6A 4PPZA 2OAUA 3ETMA 1UJ5A 3QYYA 3F73A 1DTTB 2I5JA 1T9XA 1RBAA 4DV1J 4ZLPA 1RACB 5C5JA 1HW9A 3R6GB 3UDEA 4HI1A 3J81j 4C4WA 4YHHF 1U1PA 2V4JA 3M8QB 3CJ8A 3SFUA 2P9CA 1Y10A 2YX1A 2XMAA 4NLSA 2I1RA 5LOQA 3KJQB 2LVWA 4PQAA 1PGZA 1P27B 3GJRB 3U1LA 1N36F 4ZDNA 1XNRF 1XR6A 4UUWA 3CE8A 3OTOJ 1XERA 4NYZA 2KHCA 1P9YA 2JC1A 4FZVA 4ZPWR 3KDNA 3CF5Q 1RBLA 2BOPA 1GNKA 2GO8A 4M5IA 5BR8F 2IM2A 4KRWA 2CQHA 1RTZA 4DL2A 1PBUA 1B4SA 1F3FA 4P2XA 5F9NA 3QGPA 5HVFA 4UY8T 3W3SA 4HTJA 3RW7A 3WDOA 3PW5A 3PY8A 2JVOA 3JTPA 2EFGA 3KK3B 2XBPA 5D4OA 3CD6S 4JI2F 4TN2A 3M2RB 4LT6A 5G0RA 4X4RA 4LIRA 5BJRA 4USIA 5F8LA 2OD4A 2HHXA 1L3VA 1S9EA 3MCSA 3J80Y 4MFBB 3CJ5A 2QIFA 1TL1B 3QZ7A 2FTRA 1F60B 2XI3A 2HZAA 1G1XA 2FY1A 3N9UC 3GYNA 4Q5VA 4MKBA 1HNVB 1MSWD 1Q8IA 1I1GA 1Q8BA 1RYSA 4URGA 4M94A 1DQAA 3BSCA 3G6VA 5B0AA 2DH8A 5C42A 4U7UK 2DHSA 1VR6A 3EDQB 2VL1A 3K8WA 4YDXA 2NSBA 3GR0A 2C28A 4E98A 2V8PA 1S1XB 3GCXP 2HIYA 3FK4A 1O6XA 5KFZA 1UVNA 4OI6A 3K2YA 4WP3A 2CYYA 2DHAA 2C2MB 1DLOB 3V4IB 2XYHB 2QA4S 1QAJA 1RJJA 1F5BA 4K5SA 3GIRA 2AJQA 2L41A 2E7VA 1MMLA 2HMIA 2IVYA 1CPZA 1N6QA 3O2IA 4I4BA 5AE2A 2B4OA 2OFGX 2F4VJ 3EUNA 4XDCA 2OEJA 2C3YA 3UR0A 1RWNB 4W90B 1LV5A 2IHR1 4DS5A 3KYLA 1SKUB 2RS2A 2CNNB 4ZP6A 3RU0A 2Q66A 1UPMB 4YB6A 4YN3B 5E33A 5IWAJ 1H2TZ 4K50A 4NX9A 1YZ7A 2RE1A 1T8EA 4OZJA 2MKYA 1RAGB 3NGKA 6FDRA 4WU2A 1U2RA 1OPZA 1C0UB 1IR1A 4ZLLA 3FJ2A 3CJ2A 1KLMB 2CJXB 3Q0AA 2AX0A 4F4YA 1V3SA 3LANA 1SI9A 3QT8A 4FYYB 4P74A 1H74A 1HWKA 3M1VB 1FERA 5BYQA 2M9KA 4JI5F 4DSEA 2CVIA 2DR9A 2H4YB 1YIJS 3EXCX 3I31A 5KG0A 1YBAA 4MJKA 3RRKA 2XHCA 5KFLA 2MSTA 1VQLS 5IT0A 2YNIB 4ZPTR 3H8YA 3CGIA 1LWEB 2ERRA 1R0CB 2DVIA 2AJ1A 5F3ZA 3VTIA 5KFGA 2LECA 3VQTA 1PYOB 1W26A 5DZ7A 3IAM9 2CQPA 4E2FB 2EK1A 8RUCA 3ET6A 2M8HA 3BKUA 2DR8A 2CJBA 3P45B 2XC9A 2WVDA 3ILLA 3IWLA 1NZAA 2F8EX 3OV7A 5F8MA 3KJNB 3C6TB 4OJGA 2OD6A 2QRRA 4KFBB 3T9ZA 2W9BB 4C9DA 3KDOA 3K5PA 3PYFA 1NDPA 3HSZA 3TANA 1IN0A 2EW9A 2QMUB 3HFZB 2CZ4A 4U6PA 3EYZA 4ZA1A 1PAEX 1DARA 2R7WA 3EXYA 1YBUA 2MKHA 1S7HA 4WE1A 2DPJA 1SQGA 2XO7A 2QG9B 3M2VA 4CLLA 2ROPA 3G9CA 1FRHA 3ENVA 3DRRB 4RUCA 3T1AA 1F3VA 2GQQA 1OYDA 1NDCA 4DMZA 3K5OA 3C16A 1HNVA 4M5DB 3I0SA 2IYIA 5K8MA 2HS0A 2NR0A 5CAAA 3D9BA 4FYVB 5DLGA 2VBWA 1M5OC 3UCUP 3MR7A 2B9XA 1X4GA 4KIAA 2R4FA 1HPZA 2KZMA 4LF6J 4TYAA 3UI3A 3L7PA 3W62A 4Q43A 3DLKB 4UQGA 3GG1A 1CJKB 2E5LJ 2UUBF 3CUNA 3MXHP 3IN5A 1EKRA 1RZMA 2CA9A 1YJ7A 1RHMB 1AFJA 5I3QA 4CLYA 3AOAA 1KVJA 1MG7A 1S0MA 1TZ0A 5J2PA 5LL6d 1HYSA 2COLA 4DG1B 1RCXB 4C3KA 1XQIA 4JI7J 2V63A 3LO3A 5HQ8A 1HI8A 3CDWA 2GQ2A 2D41A 2DR6A 3BQ0A 1B70B 4FF4A 2EBGA 3M4XA 1F9HA 1DRZA 1TELA 2AGPA 2DNHA 3GFYA 3KLFA 4DLGA 2Z56B 4AQYJ 2W2PP 1WHYA 5KFIA 1TUWA 4IFVB 3M8PA 3IM9A 4CT8A 5DGBA 3VAMA 5HBMA 2PC6A 1P1TA 2PN6A 2YX4A 4J37A 4BS2A 1WKLA 4RNFA 4OJ3A 2HWTA 1UWBA 2QYGA 3BO4A 2B6AB 1S49A 4F2SA 1CULB 4A8OA 1JLAB 2MZRA 1JMTA 3HFVA 4X4VA 4XTTA 2W4PA 1BY9A 4C3LA 2QLFB 3VAGA 4B9TA 3B78A 2V2VA 2DO0A 1ACMB 4WWSA 1HD1A 3M9MB 4FNIA 2V4QA 4B9UA 2RF2B 2XO6A 2AJ2A 1HBOB 2VKRA 2DRAA 2Z58B 5EX3A 2D3ZA 3ZTPA 2QX0A 5DJBA 3HJFA 1JB0C 2I6WA 3OT9A 4V1Ak 2XY6A 2GX8A 4CO3A 3DU6A 4QIVA 4DR4J 1ZAXA 3TZWA 2I0XA 5IS2A 4ZVQB 2YPZA 4YR2A 1SJFA 3MFHA 3BSOA 4F3MA 6FD1A 1RWWB 4IRKA 2V2ZA 4NI2B 1YQHA 2CJKA 2MGZA 5IQ6A 2W2QP 3CJRA 3G8SA 3X1LB 2LQJA 1SL0A 1FWKA 1N8RT 4TQRA 2OIHA 1RABB 2XMKA 3AODA 4PCQA 5ETNA 5KT2A 4C8NA 3Q23A 4OZ0A 4F04B 2C22A 5F8HA 3MEKA 4FP9A 3V6HA 2FJVA 1SJQA 2WOMA 4P10A 5I3UA 3RR8A 4G3IA 3LH2S 2HNDA 4XAKA 2QSWA 2YKMA 2J7WA 3POTB 1VRTA 1LWCB 2AEFA 1YLXA 4NEYA 4ECZA 3T1YJ 4OI4A 2XZDB 3SEOA 3OL7A 4C0BA 3TA2A 2RSQA 1FE0A 4LVOP 5L9XA 1FX2A 2HAIA 4B02A 5IM0A 4TU8A 4TLQA 2HHHF 2CUYA 2XMUA 1X7VA 2ZNYA 4CTAB 3JTNA 2J9DE 3DYAB 3HHLD 1GMUA 1Q8LA 2BW7A 1KONA 2L9NA 1U1RA 3K58A 3DNCA 5ETTA 5L46A 1NDKA 1BUXA 3QAEA 1JK9B 1D09B 2Z0GA 3K0JA 3D0HE 3NCRA 3DLKA 1N5VA 1KTQA 1HBUB 1TMMA 1VFJA 3MAQA 2EVZA 1BC6A 1YHQS 1QTMA 4WKRA 3KMQA 4EYHB 4IG3B 3LA0A 4DX8H 1M5HA 4JI6F 1XMQJ 4M5NA 2AIRB 1MU2B 1J5EF 2VONA 2HRYA 3TJAA 4U96A 2WK4A 4Y2IA 2DNNA 2YVSA 3J80U 4TU9A 1L5UA 1M1HA 4WFYA 4GKKF 2H5JB 2IMOA 2HW3A 4HTIA 4JI3J 1JQGA 5BXIA 3V6DA 2H54B 4L3KA 4I6WA 3MMAB 1RLCL 1B0PA 5ETPA 3S7RA 1DZ5A 2YNGA 4NMLA 5CD4A 4UUXA 2VFVA 2CQGA 3K8VA 1H7XA 1R6YA 3ZZZA 4XDDA 2VC0A 3SIPB 4LF1A 1Y11A 1MROA 2CZ9A 3RB4A 4K5RA 5D0GA 4H4OA 2Y0SD 3OL8A 4Y2AA 2WVCA 4WFZA 5JXSA 1S12A 4LRCA 3EPGA 2E1MC 2GW8A 2GAHC 4YB1P 4DWIA 1Z2LA 5HI7A 3I32A 2NPIA 2HHQA 1VYAA 3N01A 2DGWA 4WP8A 1HWUA 3LAMA 1HI1A 5J1EA 1RTHB 1WTFA 3H2VE 2BQ3A 2IA0A 4F67A 1LK5A 2OKQA 1GTHA 2CDRB 4LBHA 4X62F 1HHSA 2ZZMA 2OPPB 5DRKA 2APOA 4DR2F 2EWHA 4MYTA 3WQPA 4E8UA 3ILOA 5IT4A 3EGVA 3MURP 3QIPA 3CCWA 4R8UA 4QPTA 4DLEA 1JLCA 5IV3A 3AJ1A 1S1UA 4UOCA 2QSFA 4DS4A 1NKBA 2KRRA 2DGSA 4MT1A 5HMZA 2E44A 4NLVA 3IRXA 5HJYA 2FLNA 1C0TB 4G1IA 2KJWA 4K4ZA 3RGIA 1SL2A 3GFZA 2KT5A 4ZCKA 1S4EA 2LDIA 2AV5A 4DR5F 3D5MA 2HRUA 1N5QA 4N8OA 4USHA 3W5YA 1NRKA 3M8ZA 2ZWOA 2CPXA 2FGCA 2B3TB 2QZ8A 4EBEA 2JRSA 1OYEA 4FS2A 2J9DA 2O67A 4OJ1A 4F4AA 1VQYA 4HHJA 2WVFA 4CNZA 2HVZA 4PG8A 1NB7A 1QAYA 2JH3A 4C8ZA 4FF2A 3JSYA 4PXBA 2KT2A 4ANEA 3IGNA 2IY5B 1GAOA 5DDRC 3HHNB 4CLTA 4F0HA 2N3LA 3US5A 1OSCA 3VAJA 3OJUA 2XLIA 3FNNA 4HLBA 3MAHA 2MQPA 3J81Y 3I6PA 4W98A 4DV3F 1QJHA 4O3RA 1SB6A 4D3HA 3FVYA 3UN5A 3QZ8A 2ZUGA 3R5BA 3H4BA 4RBTA 4O3QA 4F25A 4CP5A 4Q2LA 4JI0J 2IC3B 3KTQA 3EVWA 1EAYC 1T9VA 3W9HA 1YG0A 3ZC4A 2GAGC 1FD8A 3DM2B 2B4UA 2O66A 3IP0A 5CABA 5JJBA 3H0PA 2JX2A 3HI9A 3N4WA 2OI2A 2UUCJ 5DG8A 2DHHA 3MCMA 1LWXA 4ID5B 2ZC4A 3D1HA 1D8ZA 1N54B 2PI4A 2MQNA 2X51A 3ZNJ1 2V94A 1NAQA 1R3NA 4ED2A 1B0VA 1HBUA 3NNHA 1N56A 1NJYA 1U0SA 3HSDA 3MTJA 5KG4A 3BGFA 1GXLA 4X66J 5KT5A 1HQ2A 1S1VB 3TAMA 4K4VA 4EWTA 1MU2A 3IWNC 3BJYA 4RW8B 3W7BA 2B5JB 2OPSA 2FC9A 1K1SA 4LF2A 3CPWR 3BQ2A 3LW5C 1F2HA 2X1BA 3F41A 3ITHA 4KGXB 2P9GA 1C1CA 2XSFA 1N5SA 3NCPA 1NKCA 1YJ9S 3F0NA 2JJ4D 1FXLA 1RTIA 2E29A 2BJDA 4JI8F 3LQVA 3AQOA 1NU4A 4JYAJ 1XMOF 3R5JB 3VGSA 4AYBD 2V2KA 1UA1A 4B3OB 2DTJA 4FXDA 2GVDA 3NG8A 3AY0A 2NSCA 3OL9A 4C3MA 2XMTA 4O4RA 4P71A 1IQZA 2I2YA 1YJWS 1FDAA 3JYTB 2A18A 3HHLB 2KB2A 4RZRA 5J1NA 2D9OA 4AD6A 1YJUA 1FO1A 5B0FA 4KGZB 4WKYA 1LWFB 3CD5A 5E3PA 4C8LA 3MEGB 2AD9A 1F9FA 2DNKA 4I68A 2VA3A 1ICEB 1WEYA 2DNOA 4XIUA 5F8JA 2C1EB 4MK8A 1A0OB 3MD3A 3PV8A 2E5GA 2BRKA 1FWLA 3C19A 5ADZA 3CIMA 4DV0F 4LMZA 3W61A 2F40A 3DOMA 4AL7A 2KU7A 3D68A 4ILLA 1Q86T 4B3TJ 5A0YA 3ULHA 4DF4A 3GSIA 4OJHA 1H6KX 2CQ4A 1RTJB 1T9WA 2UXCJ 4R0JA 4NEZA 4I2QA 3RB0A 2KN4A 3Q8YA 1ZM2A 4K4XA 4PG6A 3BO3A 3WIVA 2IVFB 2P9EA 2HHTA 4LSLA 2YY3A 2EFVA 4PG4A 4X84A 2ASLA 5J2MA 4OYXA 4L72B 1C0TA 3OSNA 2AT1B 2HIQA 3W2WA 1ZPVA 1T3OA 4ZVOB 5J2NB 4B3MJ 1KRPA 2V8VA 2VICA 4UQTA 2R7QA 1JNRB 4NLQA 2PEBA 4FVMA 3DLGA 1VQ5S 4CH0S 3GIJA 3ZZUA 1G2EA 1W2IA 4ECUA 3CCUS 2QTWA 5AE3A 4FPRA 1L3KA 4ED7A 3BYRA 1UZHA 2F8HA 4ZVHA 1RT1B 3KJVB 2HHUA 1TL3B 5IWAF 5KTQA 3QRPA 3AFGA 4Z7YA 2J6UA 3BDPA 4B9MA 3G82B 3D6MB 4DDFA 1FI4A 5EUHA 3ENWA 2L08A 4I6AA 1JKHB 4IRCA 4A47A 2HFNA 1RLDA 1KNZA 3E2EA 3DLHA 2E5IA 1UVIA 1W2BR 3IAS9 3CCMS 1N34J 3SXLA 4RBUA 3HT0A 2P5VA 2J5AA 2DNZA 1E6VA 1Q16B 3VAHA 4EI2A 3H42A 1AZSA 3D3BJ 1KOHA 1N5YB 3PG9A 1EQ0A 4S0MA 1RWOB 3LGNA 2PMZD 3FMWA 2WCXA 4J7CA 4YDDB 2QLXA 2ZE2A 1Q79A 1RT3B 2B4PA 1RHUB 2OEKA 1QVFR 4MH8A 1QE1A 3G8QA 4JV2A 2DXDA 1YRXA 4I0WA 1JLGB 3JS9A 4IOCQ 3U1NA 2XULA 1A7GE 1R7IA 1FKPA 2A2CA 1UL3A 5G4DA 3H5UA 4PYDA 3EX7B 1CG2A 2ZDPA 3QFWA 4QIWD 1HHTP 1S6QA 5C25B 2Z8QA 4CWBA 2C2DA 1REVB 2DGVA 3QIDA 3TI0A 2X3DA 3DMJB 1FA0A 3DCAA 4KKOA 5AXKA 3ZNUA 1VDHA 4DCPB 5E41A 1ZOTA 2Q79A 2R2RA 5L1JA 4GMKA 2MZ1A 2MSSA 1ZAVA 4K0KJ 4RUAA 4J9QA 2WONB 2I8EA 3VZIA 1RT4A 4I7FA 1RA7A 1HQEB 3GG0A 4NCGB 1V9OA 5CD4H 1FTCA 4QBUA 3MM5B 5LSLA 2PSZA 1U2FA 1T02A 4Z7CA 1K44A 2IBKA 2PI5A 4Q45A 3H5YA 2WAQD 1N36J 1UMJA 4V19J 1DTQA 2LDYA 5HANA 1XNRJ 1CJVA 3GV8B 1I3OB 2AYBA 3QFHA 2HBZB 1VJWA 5AE1A 1SV5B 1RWPB 3M32B 1WI6A 4ETZA 5BR8J 1X9MA 2FDNA 3W2VA 3KLVA 4CLUA 2DT9A 1M5PC 4B9LA 1J5OB 4OHYA 3C6UB 4N76A 2ACMA 5CCMA 2E5LF 2O5DA 5SUHA 2JEFA 2BANB 1RB0A 4HYKA 1RTJA 3SQGB 4JI2J 4F4WA 1QLNA 2VJUA 4USWA 1H3DA 4LF8F 2BZ2A 3BPSP 3OTEA 4BC9A 2DRBA 1HQUB 4B9VA 4CO1A 4CZCA 2RHSB 2XCPA 4ZHRB 4W4MA 2HFOA 1U45A 2D3UA 1HBNB 2M2BA 5K14A 2CPZA 2K3IA 3NLCA 2GGPA 1AFIA 5GMKa 2E1PA 4F4ZA 1RT7B 4I67A 4LSNB 4C8KA 2XLJA 2W7OA 3AXKA 4JP8A 3PACA 3MMBB 4H4KA 3UD5A 1VQSA 1VGYA 5IOLA 3KJVA 3DI6A 2R2TA 3IS9B 2LLZA 4J9SA 1FFGB 1TL3A 3B6BA 1JXLA 3FBBA 1OWXA 2JOQA 2A0FB 2HBQB 2F4FA 3DN9A 1G4CA 1AA1B 1B0TA 3QSYB 1S6PB 4CDIA 5KOXA 3A8IA 3U27A 1LXJA 1SH3A 3EMTA 3CCRS 1VBXA 1D9AA 1CS4B 4RW9B 1VS3A 3KNAA 3ADAC 2FVSA 2V9KA 3ICLA 1QAIA 2ZJRQ 2XEXA 3PO5A 2UUTA 4HKQA 3I55S 4DR1F 5J2QB 4LIWA 1R0AB 3RYLA 1N5YA 4NZ6A 1BWEA 3KHGA 2B0GA 4BHQA 2LKZA 1PAUB 4HHHA 1TAQA 1EP4B 1FFSB 1TL7B 4JB8B 3NP5A 4WFAQ 3HKWA 2VASA 2M0GB 4C2MA 5D8HB 3OXFA 1KBRA 2CDQA 2MZJA 1IBLF 3JSMB 4Z37A 4DR4F 1DQ9A 5DDOC 2F65A 3TZYA 3KJFB 2YQ0A 4KPCA 2BKNA 4ALZA 1IUJA 3BR9A 3CB4A 2F9DA 1UA0A 4FF1A 3CDEA 1L3SA 1U47A 4WFXA 2OELA 4DFJA 1U1MA 2NCKL 5C2GA 1WEZA 2Y1IA 4FBUA 3E01B 4IYQA 2XI2A 3MUTP 3GWCA 2VA2A 1MMDA 2DJWA 1BMQB 1U0HA 4JI5J 4BWJA 2XY7A 1FDBA 2KT3A 5D0HA 2VBZA 1QUVA 4ZIVA 1Y00A 1SKRA 2IJNA 4ZJQA 5KFPA 3EICA 5D6GA 2KL8A 4B3SF 1RAFB 2IM0A 4X2BA 3UPFA 1N5TA 3M7VA 3M8WA 3KLEB 1NSAA 1VC5A 4G1PA 4KV8B 4ED6A 3LF0A 2LCWA 2V68A 3HJVA 4QIEA 4RX6A 4EU0A 3G6YA 1U8SA 1T7PA 2MKKA 5E3AA 1PJ7A 1SV5A 4HVZA 1FKOB 1CC7A 5U47A 3FFIB 1Q53A 4IFYB 2D9PA 1UFLA 4A48A 2CXEA 4N47A 5IT9Y 2E1CA 1F5AA 1J5OA 3MPVA 4P2MA 5A76A 1M1GA 2Y9HA 3UFCX 2VKZG 3IG1B 4X4TA 7AT1B 2GIRA 4DQQA 3GMGA 1XMQF 3L3CA 4KE5A 3FBEA 2XM3A 2WVBA 1S4FA 3T5JA 1OY6A 1CJTB 3HHEA 4N8NA 1VISA 4FXVA 4LR9A 2C2RA 2AGQA 3GQCA 3DRSA 4JI3F 1SPBP 3MOJB 3PEJA 1JJ4A 1G7CB 4J9UE 4QYZK 2CNLB 1NJIT 1BE4A 1QD1A 4J9KA 3N28A 3NY0A 5KFYA 2ZJQQ 3KKFA 3OW2R 4DL7A 2K8GA 2VFSA 1H98A 2A10A 3Q83A 2BUNA 1IKYB 1NB2A 4PQUB 5LXRA 2LEBA 1VQOS 1O0PA 4O3PA 2UU9F 3R7SB 4KGMA 2BKOA 3DOLA 2XQCA 3GIKA 2HHWA 3ONQA 5AXMA 1VRUA 3QGHA 2ZHOA 4NWBA 4Y6IA 2QLBB 3FRYA 1RWXB 1YTYA 4GVBB 2UUBJ 2QA4G 2GS8A 2V34A 2HFSA 1S6PA 3MZIA 3B54A 4TNOA 1IQTA 1U24A 5JVHQ 1H0HB 1R31A 2ZDOA 2BYCA 3SDEA 2VJVA 1RHRB 1JLEB 4RW9A 2FZGB 3NBPB 5LSRA 3FUYA 1RWKB 2G9OA 4DL3A 3MECB 2HGMA 2K1RA 4X64F 3AAWB 3OTDA 4IOAQ 2FC8A 3OFFA 2WSFC 3OQ2A 3SZ2A 2XZTB 2ZBRA 1SJ3P 4UTGA 4CO4A 1WC1A 1SL1A 5M2UA 2D7SA 1REGX 2GQCA 1FK9B 2FVRA 4KQZA 3EGWB 4DV5J 1S79A 3JSMA 1X5OA 1C1BA 1D3WA 1TKTA 3D6TB 4BBYA 1TUVA 2JEIA 3D3CJ 2AJ4A 1Z2ZA 1S48A 3ISZA 4PWWA 1JLFA 2Y0BB 2IPOB 2ATLA 4B9NA 2RUSA 1R8CA 3TEHB 4ED0A 3LP1A 3MHYA 1P6TA 4UT4A 3I96A 3ZXWA 3ISND 1NLKL 2D3O1 3KNGA 3LP0B 4XPEA 1UPPA 3SFGA 5KT3A 5M2PA 2XTJP 2VG5A 4H54A 4DL4A 4TY8A 1NM2A 4XO0A 2Q3PA 1IKVA 1OS5A 3A3PB 4NXNF 3A3NB 3AD9C 3WC2A 3PHTA 4OZLA 3TJ9A 1TK8A 2LYVA 3HFKA 1IWGA 3DGPA 2XHWA 4BLGA 4PG5A 1VK8A 4F8RA 3RJMB 1LK7A 3OR2B 2VHGA 1VCTA 2ZVSA 3MR6A 1Z4UA 3W9IA 1WDTA 3BH7B 3MPUB 4LF5J 1F9EB 1FKOA 1HI0P 4I6YA 3K17A 4KO0A 3OR1B 3TAPA 3FQKA 2Z4PA 2PFDA 4CO5A 4CH1A 5GAGU 2PIIA 3S01A 3JSRA 3DOKB 8ATCB 3HVWA 1SIZA 2KJVA 1QSLA 1BGXT 1U26A 3GB0A 2IVMA 4LBPA 1IM4A 1JJHA 5F0WA 3GTYX 4JI1F 1NMEB 1H2VZ 4NLWA 1CJTA 2DCLA 4IH5A 4O4GA 3VVUA 3A8JA 1EB0A 3OLBA 2F5GA 1QY7A 5E5NA 4OX8A 1BQNB 1YJRA 1SKSA 2BX6A 4ECVA 4GRSA 2FVPA 4KAIA 2H5IB 3RAXA 3C46A 3D67A 4JYAF 3NKYA 4WP9A 3CDUA 2VBXA 3WIUA 4EMDA 1IKYA 1Q8KA 4DPUA 1K9MT 3BO2A 2BABA 3N6LA 3D0GE 3GSDA 1NK0A 2IAJB 3N79A 3DRPB 2XGQA 2MHEA 3QQCD 4KT0C 4DQPA 4NLUA 3ELHA 2X1GA 4GVBA 1Y5LB 2CG4A 2ZH7A 1TKZB 3AA9A 2HSEB 2FVQA 2Q6BA 3MAAB 1HW8A 3EJMA 3OBIA 2B8PA 3D6HB 4DSLA 3G71S 2LU1A 3T6JA 2GVZA 4J9VA 2PE8A 3HMJG 2DD8S 4FYWB 4GKKJ 3QJLA 5KFBA 3OFGA 1OO0B 1HR0F 4OQJA 3CVKA 5KFSA 3PYGA 3HHLC 2WZ1A 4DEZA 5HLFB 2YWFA 3OJSA 3UD3P 3Q22A 1N4LA 5B7WA 4PUOB 4J9OA 2EXUA 1H73A 2NXEA 2R7XA 4ES2A 3H59A 4ZP8A 1R0BG 1RSCA 5DQIA 1DQ8A 1N32J 3O44A 3T19A 4DR7F 3O8WA 2VFRA 2BA9A 2VOPA 4P2SA 1D8YA 4B3MF 4PXDA 1S1WA 4Q8EA 3G4SS 4G65A 3M8YA 4CM2A 2AZ3A 1WI8A 4Q7AA 1X31C 3KLIB 2H48B 2CPEA 4C6AA 5K20B 3MM9B 4C0HA 2JLGA 2LFVA 4OI0A 2QL9B 1QTNB 1W25A 5KFJA 4K4WA 2ZZNA 2R7UA 2HAFA 5ETLA 3V5RA 3D1QA 4PWDB 3KUEA 2J9CA 1VI7A 3R9LA 1KS2A 4NLOA 3QPIA 4X62J 5E3RA 4A4JA 4DR2J 3IR7B 2XMVA 2FD2A 2J0WA 1S72S 3W63A 3U1MA 4P75A 2E9TA 2FZKB 2ZD1B 4RW6B 3H98A 5I42A 3Q8RB 4YQWA 1R8HA 3QWPA 3HX9A 5CXTA 5DLFA 3QO9A 1WELA 4DR6F 2E66A 2RQCA 5KFHA 4RUHA 4DR5J 1KN6A 5T41A 1N0UA 2BJEA 2E7XA 1LW0B 2W1BA 2HRTA 3OR1A 2V9WA 4FDFA 4Y65A 1RT2B 1UEVA 3P96A 4QQBA 1FJEB 3HVAA 3MEDB 4GKJJ 2GMLA 4F36A 1PG5B 2CPYA 1N48A 3OUYB 2EFNA 2FHKA 2HVHA 2M5YA 1HIYA 1RE1B 4WIQA 2C2KB 3EZUA 2V69A 4KGKA 2XMJA 2ZBPA 1SJ1A 2DXFA 3TUJC 2ZC3A 3AH6A 2C3PA 1G3OA 1YWXA 4ICLA 5EWFA 2QN6B 3DLEB 3VV2B 2R8KA 1RT5B 3CDBA 2VG7A 4URQU 1S76D 2V8DA 2IRUA 2VQFF 1SJRA 4DV3J 4GVLA 3PW7A 2CADA 4KSEB 2KH9A 4OZ1A 5CYMB 5DQGA 5F8NA 1HNXF 1NSPA 4CO0A 4ZLJA 3R7BB 2LEAA 3MDFA 1NK8A 1K47A 4MTPA 2M52A 5B0GA 3TUZC 4K0KF 1I94J 2FJWA 2YNHA 1C4AA 1U6FA 5DDPC 4LFAF 4ATNA 5HVHA 4CH7A 1HKAA 1ZH5A 5IT9U 4M8LA 2AWZA 3DRPA 1OSDA 3ZZOA 1WSRA 2QL7B 1IKXA 5IC6B 3T5LA 3BREA 4NL5A 2HVDA 2VG6A 2FQQB 3GJSB 5C7PA 3CULA 4J9MA 5ETOA 1T9UA 1SUQA 2FGOA 1O51A 1BWVA 5K8PA 4WTYA 3VHQA 5IQQA 2NZCA 3V81A 3PIOQ 2QFJA 1EETA 5HMWA 2MLYA 1CJUA 3ZZTA 4ELTA 3C14A 2J76E 1WNEA 1YI2S 5I4MA 4GC6A 1BLUA 4YY3J 3QLHB 4M63A 1RCOB 2DNLA 5HP1B 1RUSA 4KB7A 2HEKA 4JI8J 4OI2A 2YNFA 2PGCA 4PG7A 4JOUA 1Y0HA 5HQMA 3R27A 2ZOMA 1XMOJ 4PUOA 3HSJA 1U8WA 2YH1A 2AW0A 4XK8C 3MMCB 1PYTA 4ZPCA 3J7ZT 1BQMB 2RKIB 2CWXA 2PEHA 3KK1B 2FYXA 1KKHA 2GJIA 1TV6A 1NJXA 4JUZA 3D1OA 2JC0A 4Q8FA 3Q86A 2WHOA 4ECRA 3BBFA 5HL7Q 4TYBA 4GC7A 2IYGA 3D28A 3QGGA 1FRMA 2HFVA 3KWMA 3KK2B 3PDNA 3KLIA 5AXNA 1W7WA 4KY3A 7FDRA 3BBBA 1X60A 3EGNA 4Y2KA 4M5HA 4MIAA 2R7SA 1NEEA 3IGVA 3RBXA 2FUG9 2BJ1A 2MKJA 4QW9A 3BKFA 1HNIB 4NMXA 4KH1B 3PRBA 1YZ6A 1RT6B 4ECTA 1TUGB 4DV0J 5E7OB 2WW8A 3ILJA 2XS7A 2VD3A 3OD2A 3MUMP 2MHNA 4O3OA 3HK2A 2VB6A 4ED8A 3NWRA 1F6TA 2K3KA 4PXEA 3H20A 4B9SA 4R0EA 1EARA 3CCTA 3RR7A 4LVNP 2AKWB 2ZD1A 1JLBB 1O5JA 2J8AA 2HK2A 2RQ4A 2EFOA 2GFFA 1UW9A 3CO9A 1B7FA 3M2UB 3P49B 4Y34A 1Q5YA 4NLXA 2OSQA 4OI1A 1V6HA 1S10A 1HBMA 1D9DA 3LOUA 2VDIA 1BD6A 2OPQB 4DJBA 1OJ4A 3Q8SB 5FDLB 5KFAA 1LW0A 2YWGA 4EYIB 1T05B 1EX8A 2CQIA 3FBFA 3W5XA 4C8MA 4M95A 2EC0A 3T5HA 4CLFA 3S1TA 2ZM6J 4OHZA 2M3DA 4DL5A 3TARA 1GH8A 2VQEF 2YPYA 4LFBF 2HVIA 3TRGA 3TA0A 3Q8QB 1PYSB 2FZCB 4G1QA 2BE2B 3G2XA 2J0SD 2CRLA 1S9GB 4P52A 4Y00A 3DLEA 1DAXA 4NE9C 4P7VA 2Y8WA 1PILA 4ZVRB 4YOEA 2XMWA 4TVAB 1A9NB 2QEXS 3NXZA 5KFVA 4RNMA 3PX6A 3SMZA 2WW4A 2BR0A 4J90A 2YKOA 4DSJA 4NYPA 1DTTA 2ROGA 2VBYA 2V5HG 3AOBA 2XWXA 2Z57B 1FNXH 2G0IA 2F63A 3HVTB 3UN2A 2BRLA 1NK4A 3HM9A 3MR2A 4FF3A 5KFUA 2R7TA 3M8QA 4O44B 3W5ZA 3H5XA 5D3GB 1E6YB 2IFXA 1X4EA 5A8KB 3K57A 2GHPA 2ASDA 2UVUA 3GV5B 3I87A 2VZ9A 4NPOA 3NGTA 2JEJA 1UVLA 5CYQB 2W9CB 2DHXA 3V6JA 4PZVA 1UKUA 2ZVIA 3M30B 1U25A 2MB0B 2UXDF 1TVRB 2CPFA 2FJAB 1GK8A 3TYTA 3HHDA 4ED4A 2L3MA 2X3GA 1T94A 4X4NA 1RHKB 3FDSA 3G6XA 3KK3A 3VCDA 5F9LA 1OQ6A 3PRVA 3FZ2A 5CH7B 1FF2A 3M2RA 3D0IE 1SH0A 3RG6A 1KFDA 3FKBA 3QSIA 4UY85 5DGAA 4QWBA 1VQKS 2RIJA 5LJ5Y 2XYGB 5L1KA 4MFBA 4O0IA 1TL1A 3GU0A 3OLAA 2P8IA 1Y3JA 5L1IA 2ASJA 5THWA 3HZEA 2AEMA 2W24A 1KHWA 3IBCB 2N7YA 3KK2A 5T14A 4RU2A 4DV4F 3UD4P 4KYZA 2YH0A 1P9QC 4QIFA 3OFEA 2DISA 2WB1D 1WF1A 1AW0A 4AFFA 2DB1A 1HNIA 4ELUA 4WYWA 1ZTTA 1UZDA 1S1XA 1DFDA 1VQNS 1QDUB 4DZDA 1SQFA 4YB5A 1UJ6A 3TNVA 5A6PA 3AJDA 3IO1A 1V3RA 4FKYA 1DLOA 2NUUG 1U1NA 1KLNA 3TEGA 4I2PB 3R1LA 3V4IA 1EHWA 4OYBA 4LF8J 2YWWA 3ILIA 4O23A 3A13A 4KGVB 4QR1A 3JSBA 3T3FA 3W66A 2O1PA 2CQCA 4IH6A 1U09A 3QJJA 2YKNB 1U4BA 5A8WB 5IC4B 5FDLA 1TK0A 4F3QA 2YKPA 1HA1A 3G96A 1RU2A 3GLJA 2QL5B 4I1TA 3N6MA 2L48A 3M9NB 5B0BA 1F2GA 4DV5F 3A8KA 1FT8A 3KG4A 2N7CA 1IKWB 2Q1LA 1WG4A 4L3NA 1HWJA 2JDJA 3W64A 5L8RC 4LREA 3UVJB 4RLEA 3UQSA 1OPIA 3CCVS 3C15B 4RNOA 1JX4A 4L74A 1ELOA 4AL6A 2BE2A 2NUHA 1S9GA 2RQKA 1C0UA 2MZTA 3V2UC 3MPDA 2XWYA 1KLMA 3HCXA 2KTQA 5H9EJ 1IBMF 1TL5A 2JEGA 1WOSA 2ZH5A 1GMVA 2RS8A 1SH2A 2YWKA 3OXLA 4YS2A 4ZCLA 1ZM4A 4OLOA 3OVSA 3M1VA 5ETVA 2KVIA 1FJGJ 4DR1J 5CZXA 4PXCA 2QMWA 3JB9k 2RDIA 4X65F 1B3TA 5T7LB 1HD0A 2EG2A 2L9DA 1Q4RA 2YNIA 1LWEA 2CJQA 4QIGA 3BV8A 4HH1A 3FSYA 1IBLJ 1T9TA 5A8KA 3GIIA 3PKMA 3RAMA 3DLBA 2FLPA 2DBBA 2RH3A 2OPRB 1U48A 2Z2ZA 1U02A 4HACB 1FEHA 2LXUA 4QYZJ 1OY9A 1TKXB 3DHXA 3F56A 3FEYB 5GMDA 1VK3A 3C6TA 4LF5F 3KLHB 1S59A 3NNAA 3G6ES 4KFBA 3W9JA 2W9BA 1SKWA 4CI0B 3VQSA 3CCJS 4NLDA 2HGNA 4HDGA 4LFCJ 3UCGA 3GE9A 2UZAA 5L38A 3RTVA 1FD2A 1FESA 1PKUA 2A6OA 1UCNA 5CQGA 1WF2A 4EK2A 3BSAA 1U6ZA 2DCUB 2BJ9A 1Y4ZB 2LEPA 2RVJA 2UVRA 3DDKA 3UW1A 5KT4A 2B43A 2DPIA 3R2CJ 1NK6A 2ZHAA 3DRRA 4OX6A 4B3SJ 1IR2A 1VLOA 5EDWA 2EFPA 1HL6A 1PJ5A 5EWGA 3PYEA 5HQLA 2ZH2A 2UUAF 4PYAA 2ZBQA 2NLWA 4M5DA 3KHRA 2PO4A 8AT1B 3KUGA 2J6TA 3SV4A 2EG1A 2Y1JA 4WZQA 3CJ3A 2YTCA 4U67Q 2CFXA 3MFIA 2KHDA 2DGXA 1YITS 2DNPA 1R89A 2HNZB 2CPDA 2LA4A 1NH8A 1PBAA 4GO7X 2IA6A 2ILZA 4RBVA 5G0RB 1CJKA 3FEZA 2DIUA 2B9EA 2H65B 1WSVA 3BB5A 3PXGa 1HLWA 4EBCA 4OYWA 5L39A 4DUTA 1KEKA 2EPIA 4RR5A 1TFWA 3GPAA 1OQ3A 4RW7B 4I2PA 4L73A 2N82B 4DG1A 5C24B 4CLKA 3UNGC 1CSJA 2VDHA 2AF6A 4YP3A 1N33J 3CWJA 3I0RB 1K0VA 5A8WA 3K5LA 5B08A 2DNRA 2CAJA 3R5AA 5C42B 3I56S 2G2OA 1C2PA 2R8JA 3RRGA 2IRYA 4EBDA 3JQMA 5F8GA 5BYSA 2RMLA 4P72A 2HWIA 3BPDA 1HFEL 4EFAC 4IFVA 1PJ6A 1UETA 2UU9J 1N32F 3TUIC 3OL6A 1U1OA 1RDRA 1TL4A 1KQSR 3UVJA 4F0MA 4TLRA 3QWUA 2JNJA 2LXFA 2B6AA 3SI8A 2XNQA 1NHKL 1CULA 2J7UA 1JLAA 2CPHA 2C3UA 2MJNA 1UFKA 2FHJD 4F26A 4OYMA 4NXMJ 5AXLA 2YBVA 3CEDA 4LF9F 3VVTA 1X4FA 3MI7X 2AYMA 2DK2A 2VV5A 1N6QB 4ER8A 5KFWA 1RHJB 1VJQA 2KZZA 1NK5A 2B9WA 4K7QA 2F8MA 4DX5A 3GONA 4KC5A 6AT1B 2C2ZB 3KUHA 3DLLQ 4X64J 2RF2A 5KAKA 1HBOA 5HROB 5CCLA 4ZN3A 2AQ4A 3TUPA 5JVGQ 2HGLA 2U2FA 2ZWPA 4ZVFA 3RBEA 4OYAA 4QW8A 4YR3A 1RK8A 1FRIA 3IC1A 2FY8A 2M70A 3RB3A 1CLFA 5BYRA 4JV1A 1FKAF 3L9ZA 2HQIA 1UVJA 4WZMA 4FVCA 3CMQA 1T3NA 3J7YU 3SSRA 4HACA 5ETSA 4K8RA 4NI2A 5SZTA 1S6OA 2OMLA 2W4CA 1HARA 2MXYA 1S9FA 3CD0A 1CBKA 3CIZA 4ZPVR 5KFDA 2HBYB 2HQDA 2AGOA 2DEJA 4GKJF 4K4UA 4F50A 1FRKA 4CLSA 2RHQB 1B7YB 4LR7A 3T41A 1JIHA 4NOHA 1PSDA 3Q89A 4X4OA 3TAQA 1VHIA 2AMCB 4LJMA 2V8HA 2IDEA 3H90A 1RKJA 4Y0FA 2FHOB 3POTA 1LWCA 1X4AA 2WBRA 2DEIA 3SSQA 1RI7A 3ET6B 2ROEA 1PCAA 1RWMB 2OHDA 2DXEA 4ECQA 2E1AA 1VBKA 4NXNJ 2B8QA 3EZ5A 4HT7A 4QU7A 1VLYA 4OLPA 1B64A 2B9YA 2CVEA 2JLFA 5C2CA 2IDLA 1NK7A 4DV7F 4CTAA 1M5KC 3BGOP 3PRDA 1I94F 5H9FK 4OV6A 3D66A 1X9SA 3DYAA 3PCOB 1A6LA 2JLEA 4OYPA 3S6EA 4DUZF 1V3ZA 1XBWA 2HNZA 3GJTB 1ZM9A 3ISNC 3EGZA 2RT3A 2MMYA 4YEAA 2OJ3A 3HPOA 5LXYA 1KP6A 4QZVB 4DOZA 2ACYA 1SJ4P 1TQLA 2AEJA 4P9SA 2NXUA 4WE1B 2HWHA 2X1AA 4ETXA 3H25A 3M2VB 4RWXA 4DN9A 4IG3A 5ETQA 4RW7A 1OY8A 5A2QY 3VGVA 5C24A 4JI1J 4UOGA 5D0RA 4F02A 5KG2A 2NYIA 3C16B 4IUFA 3I0SB 2LQ9A 1NJWA 3I0RA 1SQEA 5KFRA 3PW4A 4DPXA 2FJXA 3GYXB 2Z2YB 2UV8A 4OL8A 4YY3F 1QAXA 1LQ9A 4USUA 3KFWX 3MMAA 1IJEB 1VQMS 4QOTA 1FRLA 3MPYA 2OTLS 2VFUA 1CQNA 2IM1A 1HPZB 2YKQA 3OHAA 1XK8A 2HVEA 1FFWB 5M2RA 1XMBA 3VR1A 5D15A 1M0SA 2MLXA 1VQPS 2W01A 3C2PA 2QO3A 1OMSA 3BKTA 3BR8A 4NA3A 2JHEA 4DFPA 5L1LA 1AXQA 4AXIA 3CJ0A 1TMJA 1R8AA 1KQFB 3CDAA 5J2PB 1HYSB 1FWPA 1Q1KA 4B08A 2RU3A 4A46A 2JWNA 1HWLA 4DU7A 3TR5A 2BE7D 1SVDA 2RAQA 1R27B 1RWVB 1EQMA 4ZVEA 5AT1B 1Y5IB 2G2YA 2F9JA 3KLFB 1JJ2R 1JXVA 1RTHA 1HR0J 2VOOA 2OFHX 3ENAA 3I9ZA 2OGUA 5JMNA 5HROA 4CLPA 4USJC 3FSXA 3QAUA 3MF5A 3M8PB 4C8OA 1S0OA 2OPPA 4OX7A 1YRTA 4OIXA 5HBMB 4P2FA 1T03B 4PAAA 4JV5J 2B56A 3OTCA 2Y1RI 1UWBB 4KPYA 3FQLA 1NSKL 4DR7J 3AJ2A 5DDQC 5JUMA 3B4DA 2HS3A 2G1HA 1JLQB 5ETKA 2DKOB 1YK9A 1VHFA 3MM7B 1MWYA 1FJ7A 1VBZA 2E1RA 3M8RA 5GADI 2ATCB 2ZKUA 2G1DA 3DGVA 4V19X 4LRDA 5IXUA 2ZM6F 2CG8A 2XLKA 3W1YC 2OP5A 3HD2A 5KFMA 1RKIA 1JJCB 3PFEA 4C0OC 2PMWA 3L09A 4FYDA 2WSCC 1JXEA 1H2UX 5MLCV 5D4NA 4OZ5A 2NPFA 2A2DA 1X0FA 3TZZA 2MGZB 4JV0A 2RDDA 1H72C 4NLPA 2IC3A 4DR6J 2J8SA 3HLUA 2DNQA 2V67A 3VAFA 3DM2A 4AXJA 1NZ8A 3AXMA 4AT1B 2XGPA 2BV3A 2DNGA 5KG5A 1U7LA 1ZAWA 4DSKA 2MQMA 4OHVA 2HNYB 2CQDA 2GCFA 4ID5A 4X4UA 2J6SA 3K59A 2AYGA 2HBRB 4NA1A 2GZOA 2WOMB 5I3UB 2QGFB 3FBCA 3FSIA 4I69A 4QWEA 2HNDB 2YKMB 2GV1A 1VRTB 1MLAA 3D4JA 4WPAA 2BM1A 1KQKA 4ANCA 2ALYB 4RW4B 3BZQA 4OHXA 4ECSA 1S1VA 2HYIB 3P3DA 1KR4A 1RWUA 4IO9Q 4RW8A 2GMJA 2YWHA 2B5JA 3DKDA 3LTOA 4TQSA 4TKTA 3KG0A 2CWKA 3S8SA 5IM0B 2UP1A 3SQOP 4P7TA 2VQFJ 4BWMA 2NS1B 2ASYA 2E5HA 2HLTA 1VIOA 1IJFB 1HNXJ 2HQ3A 1NDLA 2BMBA 5D77A 3SBMA 4ID8A 3CC7S 3CO0P 3EVMA 1KHVA 4B3OA 3KHLA 4FKXA 4LFAJ 3B8HA 2KXNB 3QJPA 3VGUA 2XSJB 1P1LA 4UZBA 3IBWA 2ZNZA 2CPJA 3JYTA 3DRYA 3HHLA 4MK7A 1BXNA 4B17A 3H5SA 1X4HA 4B3RJ 2Z2MA 2LA6A 3KMSA 1LWFA 3H40A 2LXIA 3MEGA 1DHMA 1H38A 2K7KA 3QT6A 2RRAA 1KFSA 3CNQP 2BQUA 3BH6B 3V6DB 1UTAA 2EC2A 1CQMA 1R8BA 3N5FA 3IBFB 3K5NA 3Q8PB 2DR5A 2YNGB 5F41A 2FLOA 4WFBQ 2R7RA 2VPZB 2WRMA 4Z2XA 2HK3A 1FXRA 1NHUA 3DU5A 3R1HA 1VOMA 4OI3A 1XEZA 4CRJA 1T03A 1MROB 1FHTA 2B7BB 4H4OB 3I5AA 2BE9B 3PFOA 2P6SA 2DH9A 5ETRA 3SCKE 3VAIA 1HNZF 3R5GA 4F3OA 1TTHB 2JSXA 2MKIA 1M5SA 3DXBA 2CJ9A 2I38A 4NCAA 5J2NA 3UCZP 4PRFA 1JLQA 5EN1A 1YDLA 2CQ3A 2VPWB 4NLTA 1X9WA 3MM7A 2IMWP 1AYEA 2QA2A 2Z2LA 1NBEB 3P6YC 4OFZA 3MCNA 2FVCA 5J1EB 1OIAA 3G8TA 4ZVGA 2HURA 5LSOA 1FCAA 5GADU 4M5GA 2FHJA 1UEKA 4CM0A 1RT1A 4A8XA 4DR3F 4NLGA 4USMA 4DV6J 3CW2C 2W9AA 1V5VA 1UJ4A 2AJ0A 3IM8A 3GP9A 4BDPA 3QIPB 4RO0A 4R8UB 1JLCB 3MGJA 1S1UB 2V2QA 3G82A 4J91A 3VZHA 3LWLA 1UVMA 4U95A 2KI2A 1VQ9S 2ZH3A 3IRXB 5KT7A 5A6WA 1JKHA 1YKWA 3OVBA 3PX4A 1ZM3A 5EHHA 3HZGA 2DYAA 1KTVA 1K0TA 3K7RA 2M4MA 3UDVA 2Q43A 2MDAA 2A1BA 5KFXA 2QLWA 1XR7A 1S99A 1N0VC 3QT7A 4KH0B 1SXLA 2W7AA 1FJGF 2MKSA 2RDJA 1HNWF 2AJFE 5A8RB 1F0XA 2H5EA 1TP7A 3OXGA 2UXBJ 5DQHA 2HNYA 2GC8A 3IWXA 2LQ8A 4EUVA 4WXWA 3BDEA 3H7HB 1FVSA 2KYXA 2C3MA 4HH0A 1RT3A 4QWDA 4L76A 4DL0C 2FIUA 1GMWD 1YRUA 4PKDB 1YJVA 1JLGA 2DH7A 2VQEJ 3T5KA 4LFBJ 3QGIA 4RW4A 4WXOA 3K5MA 3PW2A 4NCBA 3T9NA 3A8EA 3NGRA 2R2SA 1VQ4S 4DQIA 4O3SA 3HVRA 3R6LB 2D69A 3ENQA 3W65A 3Q8UA 3UR3C 4RWWA 4EO8A 4X4SA 1O8BA 3TQ1A 4JI4F 1FEEA 2GMHA 1LXNA 3O6QA 2OEMA 1BHNA 5C25A 9ATCB 1REVA 4LFCF 4ZS6A 3P5TL 3M8SA 3IFEA 3DMJA 3PHEA 4EZ9A 1YBTA 1DJ0A 3Q2SC 2RB7A 5I3PA 4A8MP 1VQ7S 2CPIA 4FPIA 1ZTWA 1EIYB 4EZ6A 2OH2A 5AJ3J 1QVGR 1FXDA 2VFTA 5HATA 1PO6A 1KVIA 4ENOA 2J0QD 2QT7A 2WONA 5KT6A 2F1FA 2B7CB 1HQEA 1J2VA 2XSJA 2ZOFA 5B0CA 2CJYB 2W2OP 2MYFA 1RADB 4NCGA 5ITHA 2QV6A 4LF4J 3TAMB 3FCVA 1UEUA 1FRJA 4RJVA 5E3CA 2OPSB 3MM5A 4N56A 3JXOA 3TQEA 3NGDA 1AT1B 1WWHA 1QM9A 4U8YA 5A2QU 4HL9A 1KSPA 1XN9A 3ITHB 4GO5X 5K5MA 1RAHB 1C1CB 3BYPA 2DHGA 2NZ4A 5LM7E 4DV2J 2N4CA 5GAGI 5H9EK 4C98A 1VBYA 4QJVA 2PT0A 3M32A 1UP1A 1RTIB 2UXDJ 4LQ9A 1VMBA 5GMEA 2Y8YA 1ZA2B 1S57A 1T11A 4F4KA 3WX4A 3C6UA 2ALZA 4ELVA 4QPXA 2C3OA 3ZTOA 2BANA 2GVDB 1CVJA 2OTJS 2IRXA 3SQGA 1ZPWX 2KXHA 5K9FA 1S7IA 4MKAA 2C2NA 2BKPA 4O3NA 4WCEQ 3CT9A 2XG8A 3U02A 5CHCB 4K4SA 2CQ2A 1LKZA 4OYIA 1HQUA 4ZVUB 3DDIA 3V6KA 1P8GA 2KM8B 3FC9A 1N33F 4ZHRA 5H1SV 1D0EA 1HBNA 2MY8A 4BC7A 1TU0B 2BVZA 1WUUA 2VC1A 4CLZA 4OYOA 1ZBTA 3O1LA 1WC4A 3CCSS 2PDAA 3GZ7A 4DV4J 1RT7A 2ZITA 5LMNJ 4LSNA 4Q44A 1NKEA 3MMBA 3DOMB 4L6V3 2V4RA 1I51B 4HR2A 4PABA 3RRHA 2WBMA 1X0PA 3VF0B 3T1HF 5A0YB 2W25A 2DNYA 3IS9A 5RUBA 3MM8B 4DN0A 1VC0A 1GXTA 4HDHA 4I2QB 1S1TB 4USTA 1N52B 4ZLNA 4EO6A 5KFKA 4R25A 2O3DA 3P4UB 4LSLB 3CJKB 4EEYA 1ITPA 4KHPJ 5J2MB 4NXMF 1FTRA 3MM6B 4G6VB 3W2WB 4DL6A 1Q81T 2EKNA 4LUBA 1NSQA 1CS4A 9RUBA 5D0EA 3DLGB 5J2QA 5A8RA 3GILA 1R0AA 1FDNA 3AHPA 1IBKJ 4DUYJ 2NXCA 1X4CA 4RPFA 2NXJA 1Y3KA 3LGMA 1JWWA 3HDSA 3PR4A 4LRAA 1EP4A 4AL5A 4LRFA 1TL7A 2ZHBA 3LPEA 3KOAA 3I9V9 3B4MA 4IG0B 2HFUA 2YX7A 5MAOA 3CD7A 3TVKA 4MKYA 2ZEJA 4ES1A 4YUDA 3BGUA 3PM9A 4ED1A 4ZVPB 3GFHA 2JFKA 4DQRA 2PA8D 3TX0A 2R9LA 5F8IA 5HO4A 2BEFA 2G0JA 2QLJB 3MUVP 3TVYA 3EZOA 5KG1A 2LQ5A 2XS5A 4DSFA 4FS1A 3SYZA 4ZCMA 3NCQA 3M9OB 2W4DA 3ZTQA 1WF0A 3E01A 4I64A 4ZKAA 4YB7A 4LQ3A 2ZBIA 2EBEA 1E6VB 1IBMJ 4FNHA 1AZSB 1QUPA 4ECXA 3VALA 4DV1F 4FBTA 3F44A 3OPKA 5E2QA 1WACA 4OZ2A 1IM6A 2ZH1A 3HULA 2SXLA 3AB4B 2GHVC 2ZE2B 4X65J 3PYDA 1Q7LB 1RU1A 2DO4A 1QE1B 3UE2A 3BM7A 4HEA9 2HQGA 4UOHA 3EE3A 3OTOF 3D54A 4WYLA 1FKPB 1NJZA 4XPCA 2YKAA 3TWZA 1NUEA 4KJIA 3KLEA 2CJAA 1KD1T 4Y3CA 3MMJA 2D3OR 4KV8A 2KXFA 4ERDA 3RBDA 1S6QB 2HHVA 3UDLA 3AA8A 7FD1A 2K2PA 3LALA 3BN4A 4Y28C 3OTBA 4KKOB 3FFIA 5B09A 4IFYA 4QCLA 3BBCA 1S0VA 2IJFA 1K8AT 1KOOA 2MPUA 4EGLA 1HWIA 1WJ9A 4RNNA 3BS9A 3IG1A 1RT4B 2YWEA 4I7FB 4C48A 4OX9J 2ABYA 1XC9A 3BGRB 1IWAA 1Y7PA 1Q95G 3PIPQ 4K4YA 4M1KA 3D6FB 4IO1A 4YFUA 2H51B 1L3TA 4DPTA 3AT1B 2QJ3A 3M6UA 3IA0A 4MK9A 5LMUJ 3B82A 2IIHA 2X7IA 2U1AA 2AZ1A 5ETMA 1DTQB 1CJVB 1U1QA 2J9EA 4ZVSB 2UUAJ 2FJBB 3I5CA 3J7A1 4IH7A 3W2VB 1SC4B 1R8PA 4DX7A 4PQUA 4IKAA 2HS4A 3ZTRA 1S5ZA 4HI2A 3QT5A 4IQMA 1IBCB 3NS6A 2EFQA 5HSPA 3MM8A 2HKEA 1T0TV 1S1TA 3SCIE 1R6VA 2BM0A 1D1UA 2QYCA 2YXLA 2GNKA 1CC8A 3AB2B 3CCES 3CJKA 1S77D 1MMNA 3ZFVA 3THVA 1MWQA 4NA2A 3MM6A 1RTDB 3ZTSA 4ZPBA 3THPA 1JLEA 4WK3A 4Y2CA 5K14B 3W8GA 3NBPA 4YR0A 1C4CA 2RRBA 2GGPB 3PO4A 3MECA 3MWBA 3CJSA 2Q6CA 3Q24A 2R8GA 3TO8A 2F4VF 5KFOA 5EWEA 3HF5A 1X8DA 2AX1A 1LOUA 2HLUA 4DFMA 4LF7J 2DNMA 3TJ8A 4UOFA 1RISA 1IR0A 1Q5VA 4NZ7A 3X3UA 4ZIWA 3N5BA 3DI6B 5KG3A 1FK9A 1MWZA 1V5IB 2XCAA 2OMOA 5HAOA 4JV5F 4IG0A 4ILRA 2GHWA 5CZVA 3OFHA 1X4BA 4M5LA 3MCOA 1IXKA 4PR6A 3QMQA 2RUGA 3W8PA 1HMVB 3P5BP 3BN7A 3QATA 3FEXB 1UAWA 3HD1A 2UVWA 4MYUA 3TVZA 2CIMA 5HMYA 3GV7B 3OVAA 4USKA 4RNHA 3QNWB 5H9FJ 4LF9J 1RXOB 1RP5A 2N4DA 2F3JA 3CC2S 2K06A 4KTQA 3DC2A 2XS2A 2Z30B 1ULRA 1KQGB 3LP2B 4ZOSA 5HMXA 1Q7YT 3LP0A 3E51A 3FGVA 2ZH4A 3JQJA 1NK9A 3TOQA 3VWSA 2KYZA 2MTLA 5KFCA 4OZ3A 1U1KA 4WTOB 1AB8A 1XIQA 3ZZPA 4ED3A 1LFWA 1DY3A 1XNQJ 4Y2MA 3VAKA 4DCOB 3BF4A 2E5JA 1S0NA 2VODA 4NASA 5D4PA 4IQXA 3CXCR 2B51A 2PFFB 3FMBA 2LMIA 2D1CA 2EKYA 5KFFA 4F0KA 1Y9OA 4WFNQ 1URNA 4Q0BB 1WHXA 3OR2A 1YVFA 3A4TA 2N3OA 1GMWA 3MR5A 1I5OB 1FRXA 3WBZA 1SBRA 4HHUA 1S97A 5LT5A 3M6WA 1VRQC 1U6BA 1PC5A 4FN5A 1MNEA 4WK1A 3NMRA 2R8HA 1U0HB 4IR1A 3DLJA 2FPHX 2ADCA 3G87A 4AUKA 4PWUA 3IR6B 3O5TB 1ZZFA 3TP2A 3H2UB 1WEXA 1GFWB 1WC0A 4F7VA 3DOKA 3NNCA 4J9NA 3PJWA 2E9ZA 4CYUB 4C11B 2VPXB 2HQCA 4DPWA 4JBCA 3BGRA 5J1PA 4YHHJ 3MTKA 3Q2TC 2VIHA 2ZH9A 1SCJB 3CJ4A 1I6JA 2HHSA 5CA5A 5GAEI 2ZFHA 3CTRA 4RUBA 1BQNA 1AUDA 2NYHA 3IMQJ 4AE5A 2NXNA 1GQEA 5DS7A 2A3JA 2XZWA 3GCWP 2JL9A 4DV7J 4LF6F 2BOAA 3R2DJ 3TX8A 5DM6Q 5HVGA 4DUZJ 3O3LA 2LQBA 3R7NB 4DZ6A 5E0OA 5KFNA 3LAKA 2IAJA 1UW4A 2A6MA 2HFZA 2RD5C 2M8DB 4B3RF 4ZP9A 4JI7F 1APSA 5K8OA 1TKZA 1KVKA 2VF3A 5HJXA 1EKSA 3I5BA 1NPPA 3MAAA 2OO4A 4L75A 3RUBL 3NGSA 1RTDA 3DRSB 3KLGB 3H2LA 1K73T 4CO2A 1MW7A 1ZETA 5E3QA 3RAQA 4OZNA 2R3VA 3WC0A 1R43A 4FXWA 3P8BB 4DHVA 2C42A 2CNOB 4AQYF 2MEWA 4C8YA 1LFPA 2BW2A 5FJ4A 2HG4A 3NAIA 5HLFA 4A8QA 2DGQA 4DI6A 3DOLB 3RZAA 4WIIA 4QYRA 2ZH8A 1VRUB 3A3OB 3AD8C 3MD1A 2ZZTA 2RQMA 3UO0A 3PR5B 1FJCA 3GR1A 2MZQA 4F2RA 3UWTA 4F4XA 3W60A 1HMVA 2VH7A 4J5OA 2HQFA 3I4PA 2MQLA 3WX8A 3EM1A 3SDEB 5B0DA 3T6BA 5DM7Q 4ZJLA 1RGVA 3WHIA 3AOCA 3G86A 1RHQB 1Z1ZA 3IXQA 3MM9A 3NRBA 2K1RB 2KRBA 4IDKB 5FLXY 4MAKA 4CLWA 2R2UA 3ZZ0A 2V8GA 3JTOA 1YGYA 2W7PA 4DV6F 4IR9A 3LP2A 2EK6A 1ZZNA 5KFQA 3KG1A 1NHVA 4PWDA 3RBZA 4A8KA 3NMAA 4K2XA 3C8YA 3JAMY 3LWMA 2O01C 2LP4A 1C1BB 1TKTB 2AHOB 2CQ0A 2W8KA 3L7OA 2CNKB 1TR0A 4NRTA 4RW6A 4N7TA 5KFTA 3NEKA 2DIVA 3NAHA 1YJTA 2WB4A 2DGTA 4N77A 1WHVA 1X4DA 4BCAA 2YQ3A 4Q0BA 1JLFB 3J81U 3CSKA 2BXJA 2VUGA 5GAHI 1U49A 2UXBF 2CQ1A 3PJ9A 4UZCA 3LP1B 3C3LA 5EGYA 2DY9A 1X5PA 3V4MA 1RT2A 2P6TA 2J7KA 2ZKTA 1LNQA 3MEDA 1GT8A 2C2EA 3NL0A 3OUYA 2BJ7A 2E9RX 4CT9A 4LRBA 2CKWA 2VG5B 4CYUA 4C11A 1QSYA 4ZMMA 2POKA 4QR2A 3T1YF 4KHMA 2MQQA 4TY8B 1TFYA 1SC6A 1IKVB 3CMAS 4K4TA 4NZ0A 1QSSA 3Q8VA 2AP6A 1PIEA 1WC5A 3A1YG 1EZZB 3DGPB 4CIOA 3EWGA 1RYRA 1RT5A 2KG1A 4U7UD 1L3UA 3CCLS 1NCLA 2KKHA 4QR0A 5CYMA 1WC3A 5GAEU 4OV1A 2PA3A 2H1YA 1VC6A 3AD7C 2KG0A 2H4WB 2RILA 5AJ3F 4KO0B 2W8LA 1LW2B 3PX0A 1FNOA 3BSNA 4CNYA 1WD6A 1UFWA 3ZZYA 4J9PA 5KOWA 4DF8A 1FDDA 5KFEA 4NLYA 3NGUA 4OMFG 2RNEA 5KG7A 3K89A 2G0CA 3FCHA 1MN9A 1B99A 5IZHA 4LF4F 3D7SB 1ZS6A 5B0EA 2DY1A 1XJWB 1JNZB 4O4GB 4DCJB 1WOOA 3HSGA 2QFIA 3PEHA 2IJRA 1RQ0A 3KLGA 2HZVA 2KVQE 3M6VA 2G2ZA 4DV2F 5DG9A 2K7JA 2F7VA 2ZUAA 3TA1A 1UVKA 2W2MP 3R8YA 3JQKA 3LPYA 2FLLA 3I82A 1RAOA 3EDRB 2AYEA 3CJQA 3QLHA 1Y5NB
chains in the Genus database with same CATH topology
3BGLA 2YKMB 2ZD1B 4RW6B 4ZPDA 2OSRA 3H98A 3I32A 2GV1A 2CQBA 5FIIA 5HP1A 5I42A 3Q8RB 4YQWA 2NPIA 1VRTB 2ZJPQ 1R8HA 3QWPA 2HHQA 4DSIA 4QU6A 3HX9A 1KQKA 2BM1A 5CXTA 3N01A 5DLFA 2DGWA 1FVQA 1HWUA 1M1KT 3LAMA 3QO9A 4RW4B 1WELA 1HI1A 4DR6F 3BZQA 4OHXA 2E66A 5K8NA 2RQCA 4ECSA 1S1VA 5J1EA 3MEEB 1RTHB 2HYIB 5KFHA 1WTFA 3P3DA 4RUHA 3DHWC 1KR4A 1RWUA 3H2VE 3MMCA 2BQ3A 4IO9Q 1KN6A 4RW8A 2GMJA 5T41A 2IA0A 1WG1A 2B5JA 2YWHA 4F67A 1BQMA 1LK5A 1N0UA 2BJEA 2OKQA 2QMXA 2RKIA 2KO1A 1GTHA 4TU7A 3KK1A 1TK5A 4CCHA 4QWAA 4X62F 2E7XA 4TQSA 1LW0B 4TKTA 1HHSA 2ZZMA 3KG0A 2OPPB 5DRKA 2APOA 4TY9A 3S8SA 4DR2F 2EWHA 4MYTA 3OR1A 5IM0B 4I56A 2UP1A 2V9WA 4Y65A 4E8UA 5IT4A 1RT2B 1UEVA 2IBOA 3P96A 3QIPA 3MURP 3CCWA 4R8UA 4QQBA 4QPTA 4P7TA 3HVAA 4DLEA 1FJEB 1JLCA 1AROP 3MEDB 4IRDA 3AJ1A 1S1UA 1GTEA 4UOCA 2QSFA 2GMLA 2CPYA 3J7Z5 4BWMA 1WTBA 4DS4A 1N48A 2NS1B 3OUYB 1NKBA 2ASYA 2E5HA 2EFNA 3WZ0A 2KRRA 2HLTA 2FHKA 2HVHA 3D2WA 1TAUA 2DGSA 1VIOA 5HMZA 2E44A 2JZ5A 2M5YA 2X1FA 4NLVA 1IJFB 3IRXA 2ZOGA 3EZUA 2HQ3A 2QE5A 4KGKA 5D77A 1C0TB 2XMJA 3OHBA 4G1IA 4ID8A 1SJ1A 5LMNF 2FLNA 4K59A 3TUJC 2KJWA 3N6NA 4K4ZA 2ZC3A 1SL2A 3CC7S 4IDKA 3AH6A 2C3PA 2KT5A 3GFZA 4ZCKA 2NQPA 2LDIA 1KHVA 2AV5A 4DR5F 3D5MA 2G13A 3C66A 1G3OA 4B3OA 2MZSA 1YWXA 2HRUA 1N5QA 3KHLA 4A8YA 5DG7A 4N8OA 4USHA 3B8HA 4ICLA 5EWFA 1NRKA 2KXNB 3QJPA 3DLEB 2CPXA 2XSJB 1P1LA 2KM8C 3IBWA 2FGCA 1RT6A 2ZNZA 3BEGB 2R8KA 2B3TB 1RT5B 2QZ8A 3CDBA 4EBEA 2VG7A 4URQU 2CPJA 2JRSA 2V8DA 3JYTA 3DRYA 2IRUA 2VQFF 3HHLA 1S76D 1SJRA 4MK7A 4B17A 3EPIA 2J9DA 4FS2A 2O67A 3H5SA 4QWCA 1X4HA 3PW7A 4OJ1A 4KSEB 2Z2MA 2KH9A 2LA6A 4OZ1A 5CYMB 5DQGA 1VQYA 5F8NA 4HHJA 3KMSA 4KHPF 1LWFA 1DBDA 3H40A 1HNXF 2LXIA 2FJEB 4CO0A 4CNZA 2LEAA 3MDFA 2HVZA 4J9RA 4N41A 1NK8A 1Q78A 3MEGA 2M52A 1DHMA 4MTPA 4PG8A 1H38A 2MKCA 1NB7A 1QAYA 2K7KA 4KHRA 5B0GA 3CMES 2JH3A 3TUZC 2RRAA 4C8ZA 1KFSA 1VQ6S 3HKZD 4K0KF 2FJWA 4FF2A 1S1WB 1JLBA 3JSYA 2YNHA 2BQUA 4PXBA 1C4AA 1U6FA 3V6DB 3NWGA 5DDPC 2KT2A 4LFAF 4ATNA 3IGNA 4CH7A 1GAOA 5DDRC 1ZH5A 3HHNB 1CQMA 3M2UA 1R8BA 3N5FA 3R3TA 2N3LA 4DBQA 2DITA 2MJUA 4M8LA 3US5A 3K5NA 1OSCA 3VAJA 3Q8PB 3OJUA 2YNGB 2XLIA 2AWZA 3DRPA 2DR5A 5F41A 1OSDA 2FLOA 3FNNA 4HLBA 3ZZRA 3ZZOA 3MAHA 4WFBQ 3L95X 2MQPA 2R7RA 2VPZB 1IBKF 3J81Y 3AQPA 3I6PA 4DV3F 1QJHA 4DUYF 2OPQA 4DQSA 4O3RA 1IKXA 3N0VA 2WRMA 1SB6A 3T5LA 4D3HA 4Z2XA 3BREA 3FVYA 3QZ8A 4NL5A 2ZUGA 3FRZA 3R5BA 3H4BA 1M5VC 4RBTA 2VG6A 4O3QA 1T05A 1FXRA 4F25A 1NHUA 4NLRA 3DU5A 4Q2LA 2IC3B 3R1HA 3KTQA 1VOMA 3CULA 4J9MA 1YG0A 4OI3A 3ZC4A 5GAHU 1SUQA 2FGOA 1XEZA 1FD8A 1O51A 4URSA 1T03A 3DM2B 1MROB 1FHTA 2B4UA 2B7BB 2IM3A 4H4OB 4WTYA 3I5AA 5K8PA 2O66A 5JJBA 3PFOA 2P6SA 2DH9A 5IQQA 1NNDA 2JX2A 3HI9A 3V81A 3N4WA 3PIOQ 5DG8A 2QFJA 1EETA 3SCKE 5HMWA 3DLBA 3VAIA 1HNZF 4F3OA 4OHWA 2JSXA 4ID5B 3ZZTA 4ELTA 2ZC4A 2MKIA 3D1HA 2J76E 1M5SA 1D8ZA 1N54B 3DXBA 2CJ9A 2I38A 1WNEA 2PI4A 2MQNA 4NCAA 1YI2S 2X51A 5J2NA 3UCZP 2AU0A 5I4MA 4PRFA 2V94A 1NAQA 3DFEA 1R3NA 4GC6A 4ED2A 2BDPA 1B0VA 1JLQA 4ES3A 1BLUA 5EN1A 3QLHB 4M63A 2CQ3A 2DNLA 2WTFA 5HP1B 1HBUA 2VPWB 4NLTA 2BQRA 1X9WA 1VQ8S 4KB7A 3MM7A 5I42B 3NNHA 1N56A 2GIQA 1NJYA 3DRXA 2M7SA 1T95A 4OI2A 2YNFA 2IMWP 2QA2A 2Z2LA 2PGCA 4PG7A 4JOUA 3MTJA 3P6YC 3HXMA 5KG4A 1Y0HA 4JI0F 3R27A 3QO9B 4OFZA 2ZOMA 1GX6A 2CZVC 3BGFA 4PUOA 1GXLA 5KT5A 2FVCA 1S1VB 3TAMA 5J1EB 2YH1A 4K4VA 1OIAA 3G8TA 2AW0A 4XK8C 4EWTA 1MU2A 3HT3A 4ZVGA 3IWNC 3MMCB 3BJYA 5LSOA 4RW8B 4ZPCA 3J7ZT 3W7BA 1FCAA 5GADU 2B5JB 1BQMB 2RKIB 2OPSA 2FC9A 2FHJA 2PEHA 2KDOA 3KK1B 1K1SA 2UUCF 3CPWR 3MPWA 3BQ2A 3LW5C 2GJIA 1RT1A 4A8XA 1TV6A 4DR3F 4NLGA 1NJXA 3FZBA 2X1BA 3F41A 1N88A 2W9AA 4DFKA 3ITHA 1LW2A 1UJ4A 2AJ0A 4JUZA 1K1QA 2P9GA 1C1CA 4X4QA 2XSFA 1N5SA 3NCPA 4A8SA 1NKCA 4BDPA 3D1OA 3QIPB 1YJ9S 2JC0A 4Q8FA 4R8UB 2GA7A 5D78A 2JJ4D 3U7JA 1JLCB 3MGJA 1FXLA 2WHOA 1S1UB 2LU2A 4ECRA 5HL7Q 4TYBA 4GC7A 2IYGA 3D28A 2UUWA 3QGGA 3CCZA 1RTIA 5EX0A 2E29A 3VZHA 2BJDA 3LWLA 4JI8F 3LQVA 3AQOA 1UVMA 2HZCA 3HVTA 4A8FA 1FRMA 2KI2A 3KWMA 1VQ9S 3KK2B 2ZH3A 1NU4A 3IRXB 5KT7A 3PDNA 3KLIA 5A6WA 1JKHA 3OVBA 5AXNA 4Q2MA 7FDRA 1XMOF 3PX4A 3PKYA 1ZM3A 4X66F 5EHHA 1NO8A 1SIWB 4O44A 3EGNA 3HZGA 4Y2KA 4AYBD 1NH7A 3J7YI 1S6UA 1KTVA 1GX5A 3MR3A 4C97A 2V2KA 4MIAA 1UA1A 2R7SA 1K0TA 1NEEA 3K7RA 2L9WA 2M4MA 5D3GA 1E6YA 3IGVA 2DTJA 3PVXA 4B3OB 4FXDA 2Q43A 2FUG9 2MDAA 2A1BA 2MKJA 5KFXA 2QLWA 1XR7A 3NG8A 4ICLB 4QW9A 1HNIB 1S99A 4HT5A 3AY0A 1N0VC 1SXLA 2NSCA 3OL9A 3BQ1A 3PRBA 2W7AA 1FJGF 2MKSA 4MIWA 4C3MA 2RDJA 4TXSA 2XMTA 5CYQA 2W9CA 4O4RA 1RT6B 1HNWF 1IQZA 4ECTA 2AJFE 2I2YA 5E7OB 2WW8A 4R5PB 1YJWS 2VD3A 2XS7A 5A8RB 1FDAA 3M05A 3MUMP 3DDNA 2VG7B 2RU9A 3M6XA 1F0XA 2H5EA 2I9SA 4H4MB 1TP7A 3JYTB 2A18A 2MHNA 2XY5A 3HHLB 4O3OA 2FB0A 3OXGA 2KB2A 3MOZA 4RZRA 5DQHA 4WF9Q 5J1NA 3M30A 4DPOA 2D9OA 3HK2A 1YJUA