1IM6A

Crystal structure of unligated hppk(r82a) from e.coli at 1.74 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGAVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1im6A00
1RAOA 3ILJA 2F63A 4PZVA 3MCMA 1EX8A 1EQ0A 4F7VA 2F65A 2BMBA 1HQ2A 3QBCA 4M5LA 5ETLA 3KUEA 5ETVA 3HCXA 3UDVA 4CYUB 3MCOA 4CRJA 1RU2A 1G4CA 4CWBA 3HSGA 5ETOA 1RU1A 3HSDA 3HT0A 5ETMA 3HSZA 5ETQA 5ETTA 1F9HA 3KUHA 5ETRA 3ILLA 1RB0A 3HD2A 5ETSA 1KBRA 2CG8A 4M5IA 1DY3A 4M5HA 4M5KA 3IP0A 4M5GA 1TMMA 4CYUA 1RTZA 3HD1A 1HKAA 3KUGA 4M5MA 3ILOA 3HSJA 4M5JA 3UD5A 1IM6A 5ETNA 1TMJA 4AD6A 1Q0NA 1EQMA 1CBKA 3MCNA 4M5NA 5ETPA 3ILIA 5ETKA 2QX0A 3UDEA
chains in the Genus database with same CATH superfamily
3E2EA 3BR8A 2ZD1B 3OFGA 4X4SA 4DFPA 4Q8EA 1DAXA 2BW7A 4NLXA 3FMWA 1CJVB 2GAHC 4ECVA 4ZPVR 3J81Y 3TVZA 3EPIA 1EIYB 3GFXA 5LSRA 4X4PA 4OYZA 1SKUB 1V3RA 2K8GA 3KG4A 2B9XA 2GJ2A 4DFJA 5SUHA 3U1MA 4DV5F 2RQ4A 3D1QA 1G1XA 2VH7A 5BR8J 4P71A 4WYLA 3FRZA 3PYFA 3UW1A 1T03B 2Q66A 4K4ZA 4FXWA 1RBAA 3UFCX 1TELA 3W3SA 4WK3A 1Q8BA 4NCGA 3ETMA 4IH7A 3M8WA 4RW8A 1K0VA 1HPZA 3SBMA 1ZZNA 2QYCA 3GSDA 4NXNF 3GIIA 1RLDA 2LU2A 4RW4A 1TKTB 3ET6A 5G0RA 4ZN1A 4WFZA 2OPQB 3OTEA 3O1LA 2FJVA 5JUMA 1NZ8A 4GVBA 4CH7A 5IT4A 2CJ9A 4KB7A 1DTTA 4RW9B 1QVFR 5CH7B 1ZA2B 4YR0A 3R3TA 3CWJA 2XWYA 1Q7LB 1HMVB 1VHIA 4AL7A 1WEYA 2VICA 3D9BA 3H2UB 4KKOA 4CLZA 4OZNA 3L9ZA 3MD3A 3ISND 1Q79A 1GX6A 4EK2A 1SQGA 3EDQB 1BWVA 1SKSA 4NRUA 3L4BC 6FD1A 4G1IA 1L3UA 4DV1J 1IKWA 4LFAF 3ZNJ1 1SBRA 4M5DB 1BQNB 3CSKA 4ZJLA 3CB4A 4QR2A 4K4VA 1WC4A 1R6YA 4O4GB 3QYYA 1FE0A 2HLTA 5K8MA 4LRDA 5AXKA 2RU9A 1A9NB 1W26A 2RS8A 1WHWA 1UMJA 5DM6Q 2ZWPA 4YS2A 5L39A 2F8EX 5KFHA 3PRDA 1KFDA 2HHSA 4F36A 4EYIB 1GH8A 4QYZK 3CULA 3GIRA 1WUUA 4NOHA 1WEXA 3JXOA 4CLWA 5BYQA 1ZM4A 8AT1B 2RDIA 3V6DA 5A8RA 1JXLA 4LF8J 2HZAA 5F0WA 3TAPA 3M8PB 4CYUA 1P6TA 3J81U 3GWCA 4A8SA 3K17A 1GXLA 4ICLB 5HP1B 3MM6B 4LREA 2VBXA 5F8JA 1QUVA 1CJTA 4K4UA 2MPUA 5RUBA 3HHKA 3QLHB 1RDRA 2WSFC 2Q3PA 2KRRA 5DQIA 1HHSA 2P8IA 4UF4A 4C9DA 3GJRB 2R7QA 3LP1A 4OJ1A 4DR7J 1TKZA 2ZJPQ 3B4DA 5LMNJ 4OYWA 1HQ2A 1P9QC 2FY8A 3RB0A 1RTIA 2VQFF 4J91A 3K8VA 5DETA 1C0UA 1V3ZA 3GCXP 5D3GB 4ILRA 2ZBPA 2ZH6A 2F65A 3C6TB 5AXNA 3HVAA 3GONA 2C2MB 5J1EB 3MOJB 4QYZJ 2UUBJ 4NXMJ 2KXHA 2HGNA 2Z2MA 2HQ3A 2IMOA 3HT3A 3K57A 4QWCA 1LXJA 4X84A 1TUGB 2FHMA 1VQYA 1M5OC 2GMHA 3NG8A 1RA7A 4YHHJ 1Q8LA 1NO8A 3H5XA 4ZMMA 2QJ3A 2ZNYA 3KLFA 4OHYA 4C8NA 1UA0A 4L75A 1X7VA 3CCZA 4ENOA 3KG1A 1K8AT 3AAWB 3MAQA 3C16A 3F44A 1H6KX 1RHQB 2PDAA 1UWBA 1SPBP 3I96A 2AGOA 1NDPA 1PJ7A 2VB6A 3LQVA 4ER8A 2G4BA 5GMDA 2ZDOA 5BYRA 2CRLA 2BVZA 1NDKA 1EX8A 1FXLA 3MM9B 4PG7A 2HBYB 3JTOA 4NLWA 1NJWA 4PABA 3UCUP 4AE5A 3TW0A 1ZPWX 2LA6A 2DO0A 1WF2A 5I3UA 3VCDA 1RAOA 2UVVA 4DV7F 5DDOC 3DOLA 3OQ2A 3PM9A 1U7LA 2WOMB 5BXIA 2E29A 2W9CA 2XS5A 3CNQP 5LJ3Y 2ZH3A 2DGTA 1D8ZA 1T7PA 3KJQB 3TJ9A 4KAIA 3VVTA 2Z2LA 1FF2A 3HO1A 1S6UA 4P7VA 5KFPA 2UUTA 2VG6A 2XCAA 4LBPA 3DRSB 1SIZA 2KXNB 1NK5A 2CQ1A 2EK6A 1BQXA 1UJ6A 4A8XA 5H9FK 5LSLA 1NJXA 4ZPBA 1DTQA 1VGYA 1S1TB 3ENWA 4H54A 3CCVS 2CQBA 3JSMA 4F2RA 4NWBA 2BM0A 1R89A 2KG1A 3K8WA 1PYTA 5F9LA 3M32B 5KFJA 3NGUA 2BE2B 4YMEA 2XS2A 4X62F 1D9FA 3IM9A 1U2FA 3R5BA 1KDNA 4HI2A 2ZUGA 3W9HA 2H54B 4UT4A 4N8NA 1TFWA 3OLAA 1NB2A 1QM9A 2OKQA 4ED1A 1FKPB 1KEKA 3GJQB 1NK6A 2W4DA 2KHDA 1DFDA 1FNXH 1F5CA 5HSPA 1JLFB 2R9LA 1XNRF 1RABB 1QJHA 2QL7B 3PW2A 4M94A 2RKIB 1IKVA 2ADBA 1RT7B 4GO5X 4FDFA 4QIFA 2MQLA 1HL6A 2C1EB 3QAUA 1NM2A 2V0NA 2D3OR 1D3WA 1Q8KA 3KFWX 1ITPA 2GIQA 4ELUA 2BQUA 1T0TV 4CZCA 3R7BB 4GKKJ 2ZH2A 1RAJA 3M30A 3C14A 3W66A 2UUAJ 3RGIA 2XSJB 4HHJA 4UQTA 3AJ1A 4A48A 2F3JA 2UXCJ 4DG1B 2AKWB 3H5SA 5ADZA 5F9NA 4C8LA 1GK8A 4UW2A 3H59A 2VIHA 4QIEA 3KK2A 4OIXA 2CZ9A 3VGUA 4FF2A 2R2TA 3WQPA 2NS1B 4NEZA 2HNDB 2IYGA 1XNQJ 1KQGB 5AXMA 2EVZA 1NJYA 3W8PA 2QLXA 1RACB 1T3OA 4IR9A 1RT5B 3CD5A 2ZHOA 3Q83A 2CNLB 4QJVA 2OFGX 4DZ6A 2CQCA 4JI1F 1K1QA 3MEGA 3T6BA 1ZH5A 4HT7A 2GVDB 2YPYA 2UXBJ 3DMJB 1F3FA 3ENVA 1IN0A 1J27A 1TV6B 1WSVA 2R2SA 3UVJB 1Y0HA 4B3OB 2IC3A 1VQ8S 1DHMA 5J2PB 3BGFA 2CJKA 2J5AA 2FLNA 2P9CA 2YNGB 1RWNB 2DPJA 4ZLLA 2NR0A 4HHHA 4I4BA 1C0TB 2HS3A 4UZCA 3TX8A 1Y5NB 2ZKTA 4B08A 3Q8UA 3PV8A 2BQRA 1R8CA 2AIRB 1AB8A 1OPIA 4ZS6A 4A8MP 3ZZRA 2WZ1A 1FE4A 1YJ7A 3QJJA 4P2MA 2RF2B 1N88A 2G0IA 3MPWA 4QW9A 2OJ3A 2DR8A 3C8YA 2XGPA 1CLFA 3TUJC 4TY8B 1KD1T 3IS9B 2H51B 4C98A 3LUYA 1MWQA 2HBQB 3MEDA 3N5BA 5CYMA 3BEGB 2AF6A 3TO8A 4DX8H 3T5JA 1NJZA 4URSA 1MN9A 2KH9A 3I31A 2G2ZA 3FKBA 3OXLA 4IFVB 1RWMB 4PYAA 1IKYA 4Q8FA 4LF1A 4MIAA 3AB2B 3QSYB 4OJHA 2YKAA 4CLUA 2UVUA 2H48B 1ZA1B 4DPOA 4HTJA 1FD2A 3ILLA 1YKWA 2CQDA 1RAIB 2B3TB 2L9WA 3N6NA 1VC6A 3HI9A 5KFTA 1DJ0A 4YDDB 2DYAA 3J7AN 2OGUA 2P9GA 3CGIA 5HAOA 1B7FA 1SUQA 4HEA9 4E8UA 1I94J 1PILA 1NPRA 4C3KA 4N47A 3ILIA 2F8MA 4OHVA 2E7VA 2OEKA 1GTHA 1FK9B 2PEHA 1REVB 4A8WA 3MPUB 3A8EA 1HI0P 1PAUB 1VRTB 4IRKA 3M8RA 4OLPA 3KLEB 1S1XB 5CYQA 2WSEC 1N33J 2QLFB 3MCMA 3AT1B 3T9ZA 4YR3A 5CD4H 4U95A 3R5AA 1IXKA 4X4TA 2M2BA 4RNMA 2MKYA 4DS4A 2HHHJ 2ALZA 4DV2F 2WONA 3NP5A 4CI0B 3FBFA 3W9IA 1RXOB 3RYLA 1HW9A 1RAGB 2QEXS 2OH2A 3EDRB 3EJMA 3R8YA 4X62J 3V4IB 1YG0A 3P8BB 3BZQA 2BRLA 2ZH7A 3TZZA 2XEXA 3PW5A 3EE3A 2Z30B 3PX4A 2J6TA 5KFEA 2ZKUA 2IMWP 1H7XA 1WF0A 2JEGA 4M63A 1VBZA 2LQJA 4BCAA 2LA4A 2Z0GA 3BBCA 5EWEA 4ZPTR 1Q4RA 1WC6A 2DKOB 4AUKA 1TVRB 1KVIA 4B9UA 3THTA 5KT7A 2ZC3A 3H42A 4CO2A 4DR5J 1O5JA 5E33A 2DH7A 1EZZB 1GMUA 4DV0F 4ZPAA 2CQ2A 2MB0B 3W2VA 3UCZP 4FYDA 5HQLA 1YZ6A 4IOCQ 4C11B 2DK2A 3W9JA 1R0CB 5IS2A 3NGDA 1AUDA 3FEXB 3H4DA 2UVRA 3ZTOA 5F41A 5BYSA 1R0AB 2BV3A 1IVZA 1RLCL 2YH0A 4LF7F 1HWUA 2Y9HA 1MMDA 4ECWA 3G6XA 1S1VA 3PNIA 3DXSX 2H5IB 3OR2A 2ZOGA 1NBEB 3WIVA 2B5JA 2I2YA 2MY7A 3BPDA 1IR1A 2DR5A 4G3IA 4JI2J 1OQ6A 2YKOA 4DUZF 2Z8QA 5KFQA 2R8GA 4RW7B 1TTHB 3A8IA 4C8ZA 1S0MA 3H2LA 4F4WA 2FZKB 1N6QB 2O67A 2YQ3A 2QLJB 9RUBA 4OI3A 4R5PB 3ZXWA 3IBFB 3P6YC 1KOHA 2YXLA 2XY6A 1Q16B 4DR1F 4CLLA 2D3O1 1QAIA 1UJ5A 3AJ2A 2AGPA 2DRDA 4X64F 1IQTA 2E44A 2V4JA 1EP4B 4CNZA 1TR0A 1IJEB 4WP9A 2GAGC 4PZVA 3OFFA 4LSNA 2BYCA 3CJ4A 5KFZA 5GAHU 2FTRA 3Q22A 4NLTA 3MD1A 5DO2A 1T9YA 3NS6A 3PY8A 1TU0B 3DRXA 3DDIA 2UUCF 4OYIA 5JMNA 2COLA 4K7QA 2B9EA 4KFBA 4XAKA 2Y8WA 4DPUA 3A1YG 1ZM9A 2V5HG 5KOWA 2R7UA 1Q0NA 2OEMA 1IJFB 2KHCA 1RI7A 5E41A 2DXDA 2LXUA 1WHYA 3PRVA 2LXIA 5GAHI 4PXCA 4X4OA 3KLIB 5DJBA 4K2JA 5ETSA 3NGKA 5F8IA 5IWAF 2W2MP 3T6JA 3VZHA 2PSZA 3PJ9A 5LMUJ 4DWIA 3P3DA 2OI2A 2R7OA 3FC9A 1RTHA 2VKRA 1HA1A 1KLMA 1RAFB 2ZE2A 3DC2A 3H7HB 3BGUA 2RT3A 2MZSA 4EZ9A 2C3YA 2RQCA 1B3TA 2P9EA 3M1VA 5HBMA 1FO1A 4LBHA 3CJRA 2DY9A 3H5UA 2LQ8A 4DPTA 1NHVA 2H3EB 1FKOA 4PWUA 4NLVA 3CJKB 2YX1A 4B3MJ 2C28A 4PPZA 3VR1A 1RBLA 4I7FA 3HVTA 4RU9A 1FFGB 3U27A 2P6TA 5EHHA 2MQQA 1F60B 4EUVA 4ZLJA 3LWMA 3GILA 2L48A 2R7WA 1N34J 1FDBA 3T1HJ 2W01A 1JLEB 3T19A 3MECB 1NJIT 4NLUA 2M8HA 2VUGA 2I1RA 4R25A 4A8OA 3TARA 3P4UB 3MPYA 2JFKA 3LAMA 1SI9A 2CDQA 1TL3B 1HWJA 5T7LA 2GIFA 3I0SB 2HRUA 4IKAA 3BO3A 2XC9A 4DU7A 2HHPA 1KBRA 4M5GA 3NLCA 1WOSA 2GZOA 1Y5LB 1FEEA 2J8AA 3T5LA 1VIOA 4ZDNA 4XTTA 3DU5A 1OYEA 2G1DA 5ETMA 5DM7Q 2OD4A 4MIBA 4ZIVA 1H98A 1HNWF 4CIOA 4CO5A 4X2BA 4K4YA 4C8MA 1Q5YA 3DLJA 1P1LA 3OJUA 3BQ0A 3QIPB 1TAQA 1GXTA 2Z2YB 2AYEA 3QT5A 4IQMA 4M5IA 1T03A 1VRUA 1VQKS 3C46A 2QIFA 3PVXA 1PC5A 3W8GA 2CPEA 4ID8A 2J8SA 2BE7D 3CCES 3GQCA 2MQMA 3NMAA 4YY3J 2WBMA 2L08A 4PG8A 4I6YA 3OFEA 5KFMA 4KR0B 3Q8VA 1N5TA 2V2QA 3L3CA 2MJUA 3KLGA 3LPYA 3GR1A 2KL8A 1OSDA 4K4XA 5IOLA 4X65J 4WE1B 2MZ1A 3FJ2A 3QWUA 1FJEB 2VA3A 1DARA 3PTWA 1GMWA 4NCGB 1NEEA 4KHMA 1SJRA 4RW8B 4I67A 4Q45A 2HIYA 3DLEA 1HPZB 2C2DA 4WFAQ 1S4FA 2BZ2A 4DLGA 4RW4B 2BABA 2IA6A 3ET6B 5G0RB 1T9WA 1WJ9A 2AHOB 1FX4A 1Q78A 3HZGA 4GVBB 2B56A 4M5JA 3PJWA 1WC5A 3EGVA 4WIIA 3Q8SB 1DTTB 2UZAA 2QFJA 4YUDA 2CZ4A 2N4CA 3B78A 2BKNA 2IM0A 4PQUA 2MKJA 4OLOA 4WYWA 5IC4B 2KVQE 5KT5A 1SL1A 4CO3A 1WKLA 4JI3J 5CABA 2AT1B 4KKOB 5KFLA 3H25A 1RHKB 4C3LA 4OZ2A 4TQSA 2H5EA 1D1UA 2DH8A 2Q1LA 3TQ1A 5KG3A 1IKWB 3CJQA 2QO3A 2K3KA 4W92B 3MFHA 1YDLA 1AFJA 1TL7A 4PWWA 3KDNA 4LF6J 2A2CA 3M8PA 2V9KA 2W7PA 3TWZA 1YTYA 3MM6A 1X4EA 1HKAA 2NPIA 3O6QA 4G6VB 2KFYA 2Z2ZA 1XR5A 3Q8QB 1LWFA 5HI7A 2ZBCA 3FEYB 1W7WA 2CPJA 2KYXA 5F8HA 5C42A 2V69A 3QWPA 4QWBA 1QDUB 5KFWA 3KNGA 3V6DB 3GYXB 5A8RB 4W90B 3PR4A 5AJ3F 4IG3A 4DJBA 2QL5B 3U7JA 4CYUB 5L9NA 4RUAA 4JBCA 4RNOA 2DGQA 2B6AA 2OMLA 2WRMA 1KRPA 1CJTB 3DDKA 1QE1A 1XC9A 2HWHA 1VHFA 1CPZA 4B3RJ 3D6TB 2EG2A 1RTDA 4M8LA 2GGPB 1JJ2R 3H40A 5T14A 3MAAA 4H4KC 4MYUA 3K89A 1UVLA 3I5CA 1VQNS 3I82A 1H72C 4HDGA 3LP1B 2R8IA 3C15A 1TKZB 3EUNA 1L3TA 5KFXA 4DS5A 3W64A 3R7SB 5CYJA 1B99A 1S57A 4DL3A 5AE3A 1RTIB 4KBIA 1BLUA 2JSXA 1QUPA 1SC3B 1C0UB 3T1YF 4DL4A 3W63A 1RWWB 1KLNA 3OVBA 1M1GA 4YB7A 4NYOA 4KO0A 1ZTWA 1GT8A 3UDEA 2FGCA 2FB0A 3H20A 1RUSA 1M0SA 4W4MA 4RWWA 3BGOP 1FESA 1PCAA 4DSLA 4ZVQB 3M8YA 3KHGA 1ROFA 1V5IB 5GVQA 4ZLNA 3KLFB 3KHLA 2DITA 4MMOA 4ED8A 5JXSA 7FDRA 2ZVIA 1EETA 2MHEA 5H1SV 2LYVA 2DXFA 3C16B 2ZZMA 3PEHA 4HDHA 3M6XA 2XO7A 4K0KJ 2XGQA 3NWGA 4P10A 1UWBB 3BPSP 2CWKA 2GVZA 2BMBA 4ZVHA 2F4FA 4USMA 3EMTA 2EFNA 2IFXA 1X9MA 1ZYQA 4TQRA 5KG2A 4XDDA 2FJAB 4CM0A 4HYKA 4HH1A 5ETKA 3LP0A 1GNKA 5DDPC 3KOAA 4NASA 4FBTA 4N8OA 4H4KA 3CJ0A 1G4CA 4F0MA 5I3UB 5J2NA 5A6WA 4CT9A 4L73A 1CSJA 1KFSA 2EFVA 5IFMA 2XMKA 2PE8A 2DHXA 3H8YA 2KYZA 4J5OA 2HFNA 2XMMA 2W9CB 5J2MA 3HJVA 3TAMA 2W25A 5HMZA 3D54A 3DXBA 3AOCA 1KHWA 4MYTA 1Z1ZA 4KIAA 5J2QB 3GV5B 1MNEA 2VG6B 1WSRA 1S0NA 5DQGA 1O0PA 1AFIA 4FYYB 3UN2A 2X3DA 3DDNA 3W1YC 1D0EA 2PIIA 2B8PA 1KQFB 3EGZA 3T1AA 3R6LB 3CMAS 2ZOFA 1DTQB 3LTOA 1S12A 3NCQA 4BS2A 3JSMB 2GW8A 1N4LA 1MN7A 2KDOA 4OI4A 4K4SA 2PI5A 2RKIA 3Q8YA 1S72S 2WW4A 2BJ3A 1F2HA 5E5NA 2E7XA 3MUTP 2DNRA 2R42A 1Q1KA 1XWLA 1HYSA 3CDAA 2FC9A 1HLWA 4OJ3A 1NZAA 3OW2R 1ZBTA 3M2VB 2OPSA 3G8SA 1NK0A 1YGYA 1MLAA 4EBEA 1REGX 3R9LA 1UZDA 2QV6A 3HVWA 4ZN3A 1NSKL 2C3UA 4CH1A 4OJGA 2A18A 1VQPS 3G8TA 3U1LA 4UOGA 3GP9A 1HWKA 1IM6A 2M52A 4QYRA 1VYAA 2OPPA 2IPOB 4Q0BA 4AQYJ 2VPWB 1HW8A 3QT6A 3O5TB 4LR9A 1RQ0A 2G1HA 2UXDF 4CLPA 1SL0A 1DY3A 3TA0A 3S6EA 1OY9A 1NKEA 3K2YA 4USUA 4BLGA 2J9CA 1IBLJ 1UP1A 2QC3A 4FPRA 5LJ5Y 4JV5J 2BJ7A 2GIRA 3M30B 3C14B 1FX2A 4DQRA 1UAWA 3RBDA 1FT8A 3PIPQ 4FPIA 2BANA 2OTJS 2IVYA 1NNDA 2LQBA 4DCPB 1WKKA 3SMZA 2HS4A 4U9RA 1T05A 2KT5A 5KG1A 5D0RA 3UR3C 3FQLA 3X1LB 4AL6A 2MTLA 1NHKL 4R8UA 4LF9J 2B4PA 5EGYA 3AHPA 3QGPA 3GFHA 1RCXB 2W2QP 3D2WA 2V68A 4G1QA 4LFCJ 4B3OA 4BWMA 3CCLS 3GPAA 1CVJA 1RYRA 2YNGA 4DL7A 5KFRA 2ERRA 3CDWA 1X5SA 5DGBA 3VQSA 2CG4A 2DHHA 4ECTA 4XPCA 5G4DA 4PG4A 1JNZB 1RTJA 1FFSB 1KP6A 3VQTA 2XLKA 3OSNA 1F2GA 2JX2A 1RWVB 3ZO7A 3TANA 2DNHA 4Y2IA 3QO9A 4ED4A 3NAHA 3KK3B 4QU7A 4C0HA 2MZQA 2W2OP 2YNFA 1P8GA 4K4TA 2RUGA 4N76A 3N0VA 4CCHA 3R1HA 1JLGA 3BBBA 4FS1A 1BGXT 4CO0A 1U02A 1AW0A 3BQ2A 3LGHA 2J7WA 2J9EA 3IO1A 2NYIA 3WC2A 2VG5A 4B9VA 2EXUA 4DDFA 1N54B 1U6ZA 1YLXA 1T9XA 4ZVRB 4DR4F 3MMAA 2M4MA 4FXDA 1SKWA 5C24A 4ZVEA 4OHXA 3BJYA 4C8YA 5CHCB 2QT7A 3TUIC 1V3SA 4RNNA 3AY0A 1K73T 2QA2A 1U1QA 3PO5A 1DURA 2XYPB 1JK9B 1PBAA 3GV8B 1RT6A 3MEDB 5CYMB 2N7YA 1X8DA 2UV8A 2RB7A 2IVFB 3V4MA 2MZJA 4ZVGA 4M5LA 3JQKA 1WI8A 4OMFG 4N41A 5GAGU 1IKYB 5ETTA 3OUYA 3E01A 1SV5A 2XHCA 3LP2A 3QGGA 2BKOA 2N3LA 2W2NP 2EKNA 2OSRA 1PYOB 4C4WA 5F8LA 1I3OB 3T41A 4DEZA 3KLEA 1RZMA 1E6VA 1OYDA 2RQKA 2M88A 1J5OA 1GAOA 1OMSA 3TEGA 2X3GA 3OTDA 3QZ8A 4X66J 2HHWA 4JI5F 2CQ4A 5D4LA 3IR7B 2ASJA 1DQ8A 2VJVA 1S0VA 1SUQB 3FDSA 2ZH9A 3OL6A 1U24A 2I6WA 2KZMA 3VTIA 3ISZA 1RU2A 4F50A 1Q5VA 3EZ5A 2FHJD 4DX5A 1U1NA 3BH6B 4OYXA 2K2PA 2JL9A 5B0EA 1XMQJ 3KK1A 3U1NA 1HD0A 2YWGA 3MMJA 1N32F 4TVAB 1L3SA 5CYQB 3ELHA 4RWXA 5DRKA 4U7UK 5KG0A 1G6BA 5L1KA 2V34A 4PEOA 3R2DJ 4URGA 1VQ5S 1URRA 3W61A 4FXVA 1HI8A 2MHNA 2NXJA 4JUZA 4ED0A 2QZ8A 4OFZA 1FVQA 2WONB 2HIQA 1WHVA 4EBDA 2HWIA 2HNZA 1VQ9S 1S7HA 1YWXA 4YDXA 3DGPA 4GO7X 2HSEB 4LUBA 1CS4A 3WZ0A 1HNIA 2C2RA 3DI6A 3M05A 1JXEA 4KGKA 2ZUAA 4L3KA 2E1PA 3QRPA 5BR8F 5CAAA 4MJKA 4KPYA 4CLTA 3O8WA 3Q8PB 1X4CA 4OX7A 2W7OA 1NPKA 4DSJA 1PJ6A 1KOOA 1CBKA 1D8YA 3NNCA 4DCJB 1U0SA 4O3NA 3VAKA 4JI7J 5KFGA 2HZCA 3MTKA 2PFFB 1IKXA 4GC6A 4E0DA 3I5AA 4RBVA 1K0TA 3GG0A 4OYPA 1RADB 3EICA 2YBVA 2EEYA 2QE5A 1FD8A 4JI6J 1G3OA 3JSBA 2ZBIA 2ZM6F 5DG9A 2MXYA 3MMCA 3PFOA 3PHEA 1LW0B 3QATA 1UWAA 4OHZA 1TKDA 4G65A 4J37A 3ZTSA 1IR0A 4YN3B 2FUG9 3D68A 3PIOQ 1BUXA 1D9AA 1R6VA 1YBUA 2ZZTA 4JYAF 5HMYA 4NEYA 4RW7A 3N6LA 3PW0A 4P75A 3HULA 4USKA 4PKDB 1X9SA 1WNEA 2FVRA 3D3CJ 1NH8A 4DSIA 4N56A 2DBBA 2ASLA 1S1VB 1H38A 2BEFA 2Y3YA 3OR2B 1CC8A 5DS7A 4CLFA 4YFUA 3NCPA 2B5JB 1UZHA 3UD5A 3TR5A 3CEDA 4U8YA 2HRYA 2DY1A 2V6AA 4ELTA 2AEMA 3M6VA 3H4BA 4MK8A 1LXNA 4ECUA 3ITHA 2IIHA 3TUPA 2PI4A 3IBCB 1IWAA 4RL1A 3PW7A 4NLPA 2CUYA 3QBCA 1ZZFA 2W4PA 3N01A 1S1WA 5ETQA 3G4SS 2WK4A 2KTQA 1M5PC 4TXSA 2QSWA 3Q89A 2FJWA 3MCNA 1MWYA 2DNLA 4DQSA 3I4HX 3AXMA 3UDVA 3DNCA 2HHQA 3CIZA 1U2CA 1W25A 3OSPA 2VZ9A 2Q6BA 2XZTB 4DUYJ 4LSNB 2CA9A 3BYRA 1OIAA 1T3NA 1WHXA 3L95X 1FTCA 1VR6A 5C2CA 3TZYA 2HAIA 4PXEA 1CULA 4QWDA 3US5A 4IFYA 3DRRA 3UWTA 2J76E 4LIWA 4DR4J 1HNXJ 4DR7F 2MYFA 2XNRA 3QAEA 1Q82T 4KFBB 4IR1A 5LMNF 3VAMA 4WCEQ 2E1MC 2FDNA 1F9FA 4NLGA 2UUWA 3S01A 1GX5A 2K1RA 1SJQA 2AP6A 3KHHA 4YR2A 3DKDA 3DOMA 3KWMA 4FVCA 3FQKA 1YJVA 1HD1A 1DQ9A 4A46A 4RNFA 2DIVA 2HBZB 5HQ8A 3CDBA 3O3LA 1RTHB 2I9SA 4TY9A 3MEEA 4NXMF 1KLMB 2ZE2B 2DR7A 3MAHA 2GFFA 4F04B 2ATCB 3GV7B 2VQEJ 3E8OA 3M9OB 1JLEA 3KNAA 4YHHF 1PC4A 2VFUA 1TKXA 3M1VB 2HQFA 5HBMB 4DSFA 2CQGA 2G13A 3JTNA 3C6UA 3GYGA 4LR7A 5F0UA 4B17A 5HK4A 1FKOB 3I0SA 3HHNB 1IBKJ 3R5JB 1LW2A 2LEPA 4I7FB 2KVIA 3HVTB 1XR6A 1WDTA 1NLKL 3CCQS 1BY9A 1RKJA 1N48A 4ELVA 4IO1A 2OFHX 2FYXA 1U1PA 2HLUA 5IM0A 2A1BA 4RW6B 2PFDA 1Q81T 2CPYA 4CLSA 2DO4A 2QGFB 3EPGA 4ZHRB 4DF8A 4IOAQ 2XI3A 1PKUA 1GFWB 3QIPA 1F6TA 5JJBA 3KKFA 4K59A 5T7LB 3MGJA 1FDNA 1ZOTA 1BQMA 3OXFA 5U47A 4Y28C 2YWKA 2PT0A 4FF3A 2HGMA 4RUCA 3M2UB 3QRQA 1RSCA 5GMKa 3HSJA 3JYTB 3W2WA 1VJQA 2WVBA 4ES3A 3TYTA 1EARA 2VFVA 3BKTA 1SJ1A 1DLOA 2HVZA 1U48A 1R8AA 5A8WA 4NCAA 1SB6A 3KMQA 1F5BA 4DFMA 3EGNA 4TYBA 4LQ9A 5MLCV 2BM1A 1S9GA 1RA6A 2PC6A 2J0QD 5SZTA 1M5KC 2KT2A 1IR2A 4WE1A 4TNOA 3V6KA 1VRUB 5AXLA 4J9LA 2WBRA 1S9FA 1K9MT 4X4UA 4P2SA 3CW2C 4DU8A 1VK8A 5M2UA 3D0HE 1YRTA 4O44B 2H65B 3OTCA 2GCFA 3RBXA 4DBQA 2IM3A 2KG0A 1R27B 4U6PA 2JFDA 2DEJA 2YX7A 2FQQB 3D28A 1WKJA 1XK8A 4QPTA 4NCBA 2ZM6J 3BO4A 2MLZA 4DV4J 3KLGB 4LT6A 3F0NA 4HR2A 4NZ0A 4ATNA 2DGSA 2WB4A 5A0YA 5KG6A 4DL5A 3HMJG 3B8HA 4A8YA 5THWA 2JJ4D 2P6SA 3J80Y 2VONA 4JYAJ 2AEJA 5LXRA 5DLGA 3A3OB 5HVGA 4GKJJ 4Q7AA 3NS5A 3DLEB 2VBWA 1YJNS 2ZHBA 2ATLA 2VC1A 4LFBJ 2DGUA 4RLEA 3HKZD 5HLFA 4MKYA 3BH7B 4ERDA 4DOZA 4TLQA 2HHUA 1RT4A 3VAHA 3PX6A 1URNA 1X5PA 4PQUB 4GKKF 2J6SA 3D1HA 4LRAA 3Q2SC 2UUAF 1KR4A 3I32A 3J7YU 3QFHA 3TX0A 4CTAA 3OTOJ 3CCSS 5A76A 4U96A 3TUZC 2YKNA 2VC0A 3RTVA 1XBWA 2HFUA 3CUNA 2UXCF 5B08A 3TNVA 2DJWA 1VMBA 4JI4J 1NKBA 3TRGA 3NOCA 4NLSA 1TL7B 1YK9A 4DPYA 1ZAXA 5KFCA 2BXJA 1XNQF 3NBPA 1RHJB 1FJGF 4NA3A 3TI0A 2B7CB 1O51A 1XERA 1LWFB 3EZOA 4P7TA 2AJQA 2MKIA 3FZBA 3Q24A 4ED6A 3TP2A 1OS5A 1X4BA 4FZVA 2GGPA 3PHTA 5C42B 1VLYA 2F7VA 3RW6A 2K7KA 4FYXB 2QMUB 3MI7X 2UXBF 1R8HA 4NI2A 1AROP 4FKXA 4IG3B 2D74B 2LQ9A 3BYPA 2C3OA 4U7UD 3RAQA 3WX4A 3H90A 2P5VA 4KV8A 4IQXA 4J90A 2B6AB 2WVFA 2XMJA 2B51A 3X3UA 1OPZA 1QE1B 2LFVA 2MEWA 3W5ZA 3JB9k 1N56A 2LP4A 3WHIA 1M5HA 5K14A 1RTDB 3EVOA 1FNMA 3TJAA 4B9LA 4PWDA 3MAAB 3DHWC 3POTA 2P2CB 3BSAA 2XMUA 2X1BA 1R43A 3C15B 5HJYA 1G7CB 3J80U 3D4JA 4P9SA 4DXLA 2N3OA 2FPHX 4YB5A 2RH3A 5FJ4A 1A7GE 1UPPA 5D6GA 4PR6A 5LSOA 2KO1A 1T9TA 1EKRA 3L7UA 3RRGA 4QIWD 1SKRA 2DR6A 2DNYA 3ZZOA 4LMZA 5MAOA 2E1RA 2KFNA 2Y1IA 4KO0B 3CC7S 4Z7YA 1TL5A 4B9TA 2FVSA 1SCJB 3AOBA 2MGZA 1H7WA 3ZZ0A 4CLYA 4I2PA 2BX6A 3NGTA 5KFNA 2J6UA 1C4AA 2OD6A 2PMHA 3JQJA 3M8QA 4A47A 5H9EK 2QLBB 4RUHA 2I38A 1JX4A 2NLWA 4IYQA 2EWHA 2DR9A 3RAMA 2LXFA 3HCXA 4ZA1A 4EBCA 3IAM9 2D3ZA 3JQMA 1EETB 4AL5A 3R2CJ 1I94F 2WVCA 3BBFA 3LWLA 2YKMA 3LOUA 3NKYA 3ULHA 3DLLQ 2GVZB 4Y2KA 5IZHA 2UU9J 2V2KA 4P52A 3MEKA 3FBEA 4A8QA 1WG1A 3E3XA 4QOTA 2W9AA 5J2QA 3MTJA 1N33F 4DR6J 3QGIA 3RRKA 3LP0B 1BWEA 2JHEA 3TOQA 4DV6F 5J2NB 3IN5A 2Y1RI 1ZPVA 2DIUA 3LO3A 1C2PA 2QTWA 3GCWP 4DCOB 2HHHF 2BDPA 3QPIA 1APSA 3BGLA 3GG1A 4B3SJ 2AZ3A 1ZS6A 5J2MB 1SJFA 1UEKA 3TAMB 1MU2A 3A8KA 2HGLA 4KGXB 5H9EJ 1FHTA 1F5AA 2HYIB 2KM8C 4D3HA 3QFWA 3CVKA 2XG8A 2AYMA 3TA1A 2MLYA 3VAIA 4OX8A 2YNHA 2B4VA 3VAJA 3M2VA 2VG7A 4CRJA 2JLGA 5K20B 3D67A 3FBBA 3FRYA 3PXGa 2AV5A 4DLEA 4UZBA 4ED5A 1QLNA 2DD8S 4I1TA 1YBAA 3VGTA 3UD3P 1NDLA 4DR5F 5B0CA 1CG2A 1A0OB 1HYSB 3AA8A 5L1LA 1RP5A 4ZP7A 4L76A 2NZ4A 4WP3A 2OPSB 2F8HA 3J81j 1KHVA 2UVWA 3HJFA 3SFGA 3CC4S 1S6PA 4QW8A 5H9FJ 2HVHA 4ZVFA 3MM5A 1ZTTA 3UNGC 2OPPB 4Q0BB 5B0GA 2GMJA 4B9MA 2JWNA 4OI6A 2KXFA 2C2KB 2KZZA 1SH2A 1VISA 3RB3A 3PR5B 1FJGJ 2XNQA 5KG7A 1XMBA 4QR0A 2PGCA 2EC2A 1VCTA 2IBOA 4DQIA 1YJUA 4AXJA 4JI2F 3W5XA 4BDPA 1VJWA 3HHLC 3T9NA 2LLZA 4XDCA 2PEBA 2BANB 2EFQA 1FRHA 5E3AA 4IOBA 2HVDA 4DN9A 1T05B 4WJBA 1KKHA 1KN6A 3GIKA 2NYHA 2J7KA 1RWOB 2C2OB 2E1AA 4JV2A 1IWGA 1DZ5A 1T11A 4R8UB 2NXEA 1X4FA 1NK7A 4Q2LA 4BC7A 2CADA 2XTJP 2HQIA 4LF4J 4ZP8A 3KK3A 4A8FA 4G1QB 3QJPA 1C1BA 4R0EA 5K5MA 2D3UA 1Y11A 2V2ZA 4JI8J 3BDPA 4FS2A 2CYYA 3NEKA 3N28A 4J9UE 3R27A 2BQ3A 6AT1B 5D4OA 4MKAA 3K5LA 3DOKA 1EHWA 4Y2AA 3G87A 2IY5B 2RDDA 2CAJA 1HQUA 1QVGR 3MMBA 1B0VA 2DGXA 3PYDA 2KB2A 3CE8A 3BV8A 2R7RA 4M5KA 1RTJB 4I6AA 1TMJA 3VF0B 3V6JA 1VK3A 3SIPB 1PYSB 1Y3KA 1S4EA 3QO9B 4O3PA 4NZ7A 2HHVA 4DL6A 2YNFB 5KFDA 2F4VJ 5FLXY 1JLGB 3GIMA 2FZCB 2EFPA 3HHDA 2NSCA 5L46A 2JRSA 2PN6A 4J9SA 4WXOA 2YX4A 3ENAA 1HQEA 2VG5B 2XYGB 3OFHA 5LMUF 3FSYA 3HSDA 4EZ6A 2RRAA 4NYZA 2OEJA 2HVEA 2M5YA 3MMAB 1MMLA 2EW9A 3SQGB 2CZVC 5C24B 1GXUA 4MT1A 1K47A 4RX6A 1M5SA 3MR3A 3OPKA 4RJVA 2V9WA 5F8GA 3HHLA 1FWKA 4MIWA 2F5GA 4IRDA 3FCWA 3IWXA 2BE9B 2GO9A 1VFJA 1RT6B 2XZWA 1HHTP 2HZVA 3OXGA 3SEOA 2DVIA 2IRYA 4B3MF 4ECRA 1JIHA 3GLJA 1VQOS 1QSLA 1J5EF 2KJWA 3OUYB 3E01B 3ZTQA 4EU0A 1M1HA 1SV5B 3LP2B 4WU3A 3RB4A 4DR2J 3R97A 1N34F 3T1HF 2HFVA 3UNYA 4ECYA 4JV0A 3PO4A 1E6VB 3GR0A 2CJAA 1J5OB 5CQGA 4F0KA 3H0PA 2VBZA 5KG4A 1R8PA 1S99A 1HR0J 4MKBA 3Q8RB 4DV6J 1JB0C 2RILA 3HT0A 4IG0B 1KNZA 3M8ZA 2MQNA 3UO0A 5F3ZA 1MMNA 4F26A 3L7PA 2ROPA 2VL1A 3PCOB 4LRCA 2H1YA 1YHQS 3HVRA 1UVNA 2PA8D 1F9HA 1SH3A 4OI2A 5F3TA 1U2RA 4WXWA 2WCXA 3UN3A 3KK1B 3N4WA 3VHQA 2HFSA 3WX8A 1VQLS 3CDUA 1FRJA 2LMIA 3NXZA 2LVWA 2RHSB 4H4OA 2VPYB 1GTEA 2HURA 2CPHA 2GQCA 4LVOP 1TMMA 2JZ5A 2YY3A 2UV8G 5KFOA 4O3SA 1UVJA 1F9EB 4L6V3 2GMLA 2EG1A 3D0GE 2BUNA 1BE4A 5KFKA 3G8QA 4WFNQ 1HIYA 1S6QA 5HATA 2JVRA 4ES2A 4M1KA 5FLXU 2JOQA 2HNZB 2JVOA 3MOZA 1RWXB 4YY3F 1E6YB 2CPFA 3IWLA 2RIJA 3DGPB 4EO8A 2ZFHA 1CS4B 4PUOA 2V4QA 1C1CA 1HNIB 3A13A 2Y1JA 3DI6B 4F4KA 3L7OA 1LW0A 2FHJA 3L09A 1OJ4A 1S59A 4JP8A 4X65F 3EZUA 2KKHA 5CZXA 4XIUA 4Y6IA 7FD1A 3CJ2A 1HNZJ 1AXQA 4UY8T 4USTA 5EX3A 5EDWA 4OZ3A 1FRLA 4USWA 4DHVA 2I5JA 3CXCR 2C2EA 4J7CA 4BBYA 1SC1B 4OX9J 1IKXB 3W60A 5IT0A 1YX2A 2O01C 3RAXA 3SCJE 1CJKA 2YWEA 4EYHB 3N5FA 1LFPA 1Z2LA 2XBPA 4URQU 2MZTA 3MMCB 1FNOA 2CIMA 1VQ6S 1ACMB 2CQ3A 4C0OC 3S8SA 3HZEA 1KTVA 1YITS 1HI1A 3RR7A 2GQ2A 5A6PA 2XMAA 5C25A 3RG6A 2B0GA 2XI2A 3MM8B 3IC1A 4J9NA 2VPXB 3T5HA 3HKWA 1TUVA 4DQPA 1U1KA 3K5NA 4JI3F 2DNPA 2ZJQQ 4WKRA 1PO6A 4DMZA 3T3FA 4C48A 3I0RA 3M6UA 4DN0A 2RAQA 1XMOF 2FLOA 2PD1A 1JLQB 2HWTA 3LALA 3EVMA 2GJFA 4L72B 2QG9B 2Y8YA 1H2VZ 1PAEX 3BN4A 4LF6F 5HROA 2WSCC 4RO0A 2FHOB 4EFAC 5KFFA 3A3NB 2HNYA 4ZOSA 3KDOA 2QA1A 3M8SA 1NPPA 1QY7A 4F4ZA 2CQHA 1HBNA 2A10A 3D7SB 1ELOA 2OAUA 2D9OA 3I5BA 3MURP 4L74A 3ITHB 2W9BA 2OMOA 2Z4PA 2ZNZA 3DRYA 3DLHA 4ILMA 3SCIE 2WVEA 4EMDA 1S1WB 1V9OA 4LIRA 1BXNA 1IQZA 1XR7A 4RPFA 1V6HA 3RR8A 5B0AA 4MKVA 1YSJA 4NMLA 1UVIA 1LWEA 2D69A 5HO4A 3C66A 3DLKA 3N9UC 2H9ZA 3I56S 4ZVOB 1X9WA 2DPIA 2VOPA 1LEOA 2FLPA 4QR1A 1H3DA 4J9QA 1X5OA 4B3RF 2IVMA 1TP7A 2A6OA 3SCLE 4C8KA 1IBMJ 2KFZA 2PO4A 5KAKA 5LOQA 1FKAF 1CULB 1VQSA 4IFYB 3DRRB 2LKZA 3OHAA 1R8BA 3AQOA 1FXDA 1VQ4S 2ZH4A 3LGMA 4B02A 3AJDA 1VRQC 1Q53A 2C2NA 4HI1A 3BSNA 3R7NB 2JDJA 3KJFB 3KUEA 3LGNA 3HSGA 1YRXA 2K1RB 4QQBA 2VFRA 1S77D 2B4UA 3LH2S 2E5HA 3DOMB 5A8KA 1M90T 4OI1A 1R0BG 5DDRC 3BREA 4LF5J 2DHSA 1UW4A 2RJZA 1RT3A 4QWAA 2BBEA 4F25A 2JEJA 3MEEB 2KRBA 1J5EJ 3G71S 3BDEA 3HK2A 3GZ7A 1X0PA 3CJSA 4ANEA 4QCLA 4RW6A 4ZLPA 3MZIA 4B3TJ 2C2ZB 1NXIA 2EI5A 3CO9A 1TKXB 4ZHRA 4MH8A 1HBUA 2IAJA 1S0OA 2CQIA 4KH1B 1S9EA 3HP6A 3C6UB 3ONQA 4KPCA 2XLJA 4MAKA 4G1PA 1Z2ZA 3AD9C 5E2QA 1NK4A 4P74A 3V6HA 3HF5A 1LW2B 5ETRA 2J7UA 3DM2B 2NCKL 4Y34A 3KUGA 4C97A 1LK7A 2AJ4A 4K0KF 2LECA 3UDCA 5IM0B 3M2UA 3NRBA 3OJSA 4J9MA 3JYTA 1SQFA 2DNOA 4ZPDA 1JJCB 2FLLA 2J9DE 1NB7A 1B70B 1ZAWA 1U1LA 2J0WA 4M5HA 2IRXA 1RAAB 4I2QB 1I1GA 2NUUG 4MFBA 2HK2A 1BQMB 2U1AA 3K5OA 4ETZA 2CVIA 2RRNA 4DUTA 4WFBQ 1D09B 3SQOP 4O44A 2VFSA 2HVIA 3W2WB 2ZVSA 3OTBA 4PPDA 4F67A 5I3QA 4DV3F 1ZAVA 3G9CA 1MSWD 1DLOB 2NREA 4HKQA 5A8WB 1DRZA 4K2XA 2KT3A 3I6PA 2QMWA 3IXQA 1S9GB 3F41A 3A4TA 4ZCLA 5AE1A 1S76D 2YWFA 1J2VA 2DCLA 5M2PA 2LQ5A 3B82A 3W7BA 5HVHA 5JVHQ 1GMVA 2HQDA 3ISNC 2FC8A 2WHOA 4D3GA 2RU3A 3EXCX 5A2QY 4NLYA 1UPMB 4FNIA 1L3VA 3N6MA 1LWXA 3QSIA 1KS2A 3G2XA 3SDEA 1N36J 1UVMA 5DZ6A 2LCWA 4C8OA 5A0YB 2CPXA 3DLGA 3ICLA 2QFIA 4IO9Q 4TU9A 3EXYA 1JLCA 2BOAA 1SJ4P 2GA7A 1PGZA 1O8BA 3IG1A 1NSAA 1OY6A 2YNIA 4OL8A 3AQPA 5E3PA 1N5YA 3CD6S 2E9RX 2W8KA 2B7BB 4RZRA 1XTZA 2O3DA 2AU0A 1JMTA 1XMOJ 5HLFB 4DV5J 3RW7A 4AQYF 2CKWA 4ED2A 2ZZNA 3AD7C 3ZC4A 2CDRB 2IA0A 1H74A 4O23A 3FSIA 4UOCA 5E0OA 1RT4B 3IRXA 3AXKA 2SXLA 2HPUA 3SSQA 1IBLF 2XS7A 4JV5F 1SQEA 3SI8A 2RRBA 3FCVA 3IWNC 3VAGA 5EWGA 5CZVA 1O6XA 4W98A 3BGRA 3UD4P 4NXNJ 4CTAB 3RBEA 2V8HA 3GTYX 1UA1A 2YKNB 1RYSA 2E5GA 1U1MA 2X1FA 4BHQA 3QRRA 4IH6A 2B8QA 3JAMY 4K5SA 4LBIA 2F1FA 4HLBA 2RQMA 5C7PA 4LF9F 3HPOA 5D0HA 3NBPB 4FKYA 4KY3A 4I64A 3HLUA 3B4MA 5J1PA 4O3OA 2N4DA 2IHR1 4LFCF 1I5OB 2FJEB 5I42B 1B0TA 2Z58B 3A3PB 4QPXA 4XPEA 4XK8C 4LFAJ 4OQJA 1RAHB 2GHVC 5CCLA 4EGLA 1S48A 5KOXA 1JLBA 4NI2B 4ED3A 1UW9A 4P6QA 1H2UX 3G96A 5A2QU 4J9PA 4IH5A 4KV8B 2AYGA 4V19J 4OZ1A 3LANA 1TQLA 1WOOA 2WTFA 3QT8A 4F4YA 1RT2B 2ZOMA 1PG5B 1SVDA 2V8GA 2E9ZA 5K14B 5I3PA 3MUVP 4CQ1A 4PWDB 3SSRA 5CXTA 4NLRA 3POTB 3FBCA 3B6BA 2DGVA 3CT9A 2NXNA 2MQ8A 5AT1B 2R7TA 3KJVA 1KVJA 1U25A 4OZLA 1LWCA 4U8VA 4RU2A 4NL5A 3TZWA 5AE2A 3FZ2A 4PG5A 1ZETA 1HWIA 3ZTPA 1P1TA 4KRWA 2GX8A 4ALZA 4ID5A 1X4HA 2VDIA 3PEJA 3EM1A 2OO4A 4OI0A 2G2YA 1U26A 2DNKA 1RT1A 5EN1A 2MGZB 3QT7A 2XM3A 4I2PB 3TVYA 3A12A 2NXCA 3D1OA 3M8QB 3M6WA 4YEAA 3VAFA 1UTAA 2A0FB 3GJTB 4DZDA 2VQFJ 2AYBA 3HX9A 3NCRA 2XULA 4N77A 4ZVSB 1N5VA 1YJTA 3IP0A 2DNNA 2Y0BB 4HL9A 2CNKB 3JAMU 3MUMP 4ZCMA 4X66F 3PKMA 2YH1A 2W1BA 2IJRA 2IRUA 2V8VA 2O1PA 1KWMA 2XB2D 1WG5A 5ETNA 4L3NA 5D4PA 1EAYC 5JVGQ 1T9UA 3V2UC 2YKMB 3D6FB 4ZCKA 4WKYA 3PJXA 4DV3J 2D7SA 1YRUA 3M2RA 2IBKA 2OLWA 3HHEA 3PZPA 4NZ6A 3BS9A 4C3MA 1XMQF 1NDCA 2OP5A 2XWXA 3VWSA 5E7OB 4WFXA 2BJ9A 1B7YB 1LV5A 2DRAA 2QSFA 4X4VA 3PKYA 1U8SA 3CMQA 2DXEA 4KHPF 2HKEA 5DZ7A 3PDNA 3V5RA 4KQZA 3J7Z5 3RB6A 1OSCA 5KFSA 3NL0A 3FK4A 2EFGA 3VGSA 1Q86T 2XLIA 4F7VA 2KU7A 1U1RA 2DHGA 5L9XA 4O3RA 3RZAA 2DNQA 3RU0A 2IJFA 1P27B 1MU2B 5KTQA 2BR0A 1VBXA 1FI4A 4LF2A 2V4RA 2NSBA 4FF1A 2GNKA 5C5JA 3G82A 1TL1A 1ZM2A 3MDFA 3CCRS 3MHYA 1XEZA 2ZJRQ 2OIHA 2YNHB 3HFKA 3Q0AA 4S0MA 2RE1A 3CJ8A 3JS9A 4HTIA 1U1OA 4DV7J 4YQWA 2AEFA 2VG7B 1KQSR 2CPIA 3IA0A 2ACYA 1PSDA 2QN6B 4DPWA 1JXVA 2L41A 1XQIA 1FVSA 1U4BA 1FTRA 1WORA 1TK8A 4UTGA 2M0GB 4WK1A 4JI7F 4TU8A 4NLOA 3G6YA 1HNVA 3ZNUA 1RBOB 2DH9A 4TN2A 3LW5C 4JI6F 3GFYA 4LQ3A 5HANA 3GSIA 5KFVA 3OVSA 1YQHA 4TYAA 1R7IA 1U0HA 4Q43A 1S5ZA 1JLAA 1JQGA 4DR3F 2EPIA 2CJQA 2MDAA 5EUHA 1S6PB 2EK1A 4K5RA 4F4XA 4LSLA 4USIA 3MM5B 2XSFA 1RCOB 3OHBA 2VKZG 2YTCA 5IV3A 1M1KT 3IM8A 2BRKA 2OPRA 2BA9A 3T5KA 3OR1A 1T02A 5F8NA 1S7IA 3R5GA 2AJ2A 2I8EA 2HQGA 1YJRA 3MM7A 3SV4A 3TZXA 1QTNB 1XNRJ 4KSEB 4WP8A 2ZH8A 1BHNA 3DHXA 5KG5A 2EFOA 1YI2S 2JLFA 3CCTA 5IT9Y 3W5YA 1LNQA 5B0DA 1UEUA 1AUSL 4LRFA 2VBYA 4IDKA 1CJUA 5KT6A 4OYOA 2X51A 2KM8B 1FRKA 3S1TA 2R4FA 3K5MA 3D3BJ 1SJ3P 1SIWB 2E7WA 1RHMB 2CWXA 3HFZB 1NAQA 4CO1A 3FFIA 1LQ9A 2FJXA 1C1BB 1H2TZ 2AJ1A 2AWZA 1N0VC 4C2MA 5ETPA 1WD6A 1X31C 4DUYF 4R0JA 2Z57B 1MROA 1KTQA 1NCLA 3DYAA 3DOKB 2R2UA 4HACA 1RE1B 2A6MA 1HQUB 3MMBB 5KT2A 4DPXA 2HFZA 4CDIA 3C3LA 1HNXF 1MWZA 1TK5A 3EWGA 2G0CA 3SQGA 4PXBA 5ETOA 1WF1A 2L9NA 5FDLA 3FEZA 3GYNA 4LJMA 2YKQA 5K8OA 2JNJA 1S1UA 2AX1A 1TK0A 4X4RA 5F8MA 1U6FA 4B9NA 4FYWB 1HBMA 4JI1J 2B43A 1UETA 4HVZA 3H98A 1EB0A 4EWTA 4KGZB 1HQEB 1GEHA 7AT1B 2M7SA 2CVEA 5CCMA 1LFWA 1RK8A 3BKFA 1IM4A 4HH0A 1JKHA 4NMXA 3HD2A 2FVPA 1Y7PA 3CPWR 2YQ0A 4NX9A 2VQEF 1JJ4A 1UVKA 1VIXA 2WB1D 4WTOB 3HHLB 4FVMA 1VC5A 2ZWOA 2DISA 4PXDA 3DRPA 1G2EA 1Y3JA 3FSXA 1WTBA 1AZSA 1SC6A 4IG0A 3J7A1 1IBKF 2CQ0A 1HBOA 4J9OA 4BC9A 5GAGI 3P49B 2LDYA 1Z4UA 3EX7B 4NA2A 5IT9U 2XY7A 2HMIA 3FMBA 1TAUA 1VOMA 3MR6A 2W24A 2DGOA 1SH0A 3O44A 3CD7A 2PMWA 4KHPJ 1WEZA 1IBCB 1U09A 3OT9A 1VQ7S 4C6AA 2CPZA 3PYEA 1OO0B 4F4AA 4RBTA 3VGVA 2XCPA 2L9DA 1RGVA 2RUSA 4M5MA 3F56A 3HDSA 3RRHA 4CH0S 2PA3A 2UP1A 4FP9A 1E6YA 2JEIA 2EKYA 2ZITA 1QTMA 6FDRA 1MG7A 3OVAA 4TLRA 4Q2MA 2DT9A 1JWWA 2V8DA 4H4OB 4GMKA 3MR5A 3ZFVA 4WU2A 3BQ1A 2D41A 3OV7A 2QA4G 4OYBA 4P2XA 3KLHB 5D77A 4UOHA 4TU7A 3Q2TC 2FIUA 4EEYA 1RHRB 2QYGA 1FFWB 1S6QB 4ZP9A 2XMVA 2HEKA 9ATCB 3V81A 3WC0A 2VF3A 1BD6A 2ZDPA 2AW0A 3B54A 4I69A 3FVYA 3BR9A 5I4MA 1QD1A 4PCQA 4KGMA 1SL2A 3CMES 1N5QA 2ABYA 2OUGA 2YWWA 2KJVA 4HT5A 1LKZA 3SSSA 1HWLA 5HMWA 4PUOB 1C1CB 3IMQJ 3BKUA 4DV4F 2W8LA 4X4QA 1D9DA 4ZKAA 5B0BA 5B7WA 2K3IA 5HL7Q 4P72A 3MPDA 2ZD1A 1BMQB 3P45B 5E3QA 1PIEA 4DR3J 2X7IA 4FBUA 4DV2J 3MWBA 2EBEA 1CJVA 2CPDA 1Y9OA 3UI3A 4XO0A 3CIMA 1U47A 3MM8A 2ZHAA 4ZPCA 3TEHB 4O3QA 2I5JB 4GKJF 5FIIA 2NQPA 4DQQA 4ZVTB 5HQMA 2QA4S 2Q43A 2BJEA 3K7RA 4LFBF 3GFZA 2F9DA 1CJKB 4H4MB 1JLQA 4KGVB 4ILLA 1NSPA 2AZ1A 2BKPA 2XY5A 4DFKA 3ILOA 3O2IA 3M9MB 4ZP6A 1WELA 4F8RA 2WVDA 1YVFA 1FJCA 5C25B 3GMGA 2C42A 2AGQA 3AFGA 5KFUA 3NNAA 4NLDA 1LK5A 2VA2A 4K50A 4OYMA 3OTOF 2HFOA 4RNHA 3I0RB 2ZEJA 3R6GB 3I55S 1TKTA 3EYZA 2AQ4A 2ZH1A 2OPQA 4DV0J 4JI4F 1FDAA 5D0EA 4P73A 2G2OA 3IFEA 4RW9A 5KFIA 2MLXA 5HROB 4WZQA 4USJC 3CJTA 2NXUA 2L3MA 5LT5A 3SYZA 1HMVA 3HM9A 2LEAA 2HNYB 4EO6A 2W2PP 3PG9A 3A8JA 1YBTA 3P96A 2YQ1A 1HBNB 1FRXA 5DDQC 3MPVA 4WZMA 4CO4A 4LF7J 1EJ7L 2Q79A 2W9BB 2GQQA 2MY8A 1AT1B 1UCNA 5HVFA 4WIQA 2VASA 4M5DA 1BQNA 1P9YA 5DGAA 4UY85 4O4GA 3DGVA 3I9ZA 3WDOA 1VC0A 1H0HB 2X1GA 3CC2S 1XJWB 3AB4B 4YOEA 5KFBA 2R7SA 5L1IA 1LWEB 2M9KA 4RR5A 5BJRA 4Y2MA 4DUZJ 3DLKB 3KHRA 5LXYA 2VHGA 2XYHB 4OZJA 3CCUS 2N7CA 4PYDA 1V5VA 3THPA 3THVA 1KSPA 1RKIA 3BB5A 2RVJA 2CQPA 1HARA 1FRIA 3EVWA 1KONA 4MTPA 4WPAA 4OZ5A 2G0JA 4DX7A 2AMCB 5B09A 4DR1J 3R5DA 2DGWA 2YKPA 1Y5IB 4OYAA 4X64J 4ICLA 4UUWA 5HP1A 2CNOB 2E5LF 5GAEU 1WC3A 2HHXA 4DL0C 3D66A 3IBWA 3PYGA 1N0UA 1CQMA 2E9TA 3DU6A 3QLHA 2FVQA 3D0IE 2MMYA 5A8KB 1T95A 3GIJA 2V50A 5LM7E 5KFAA 5D4NA 2YVSA 1RT3B 4NA1A 3DM2A 2UUCJ 3GU0A 4K8RA 4QZVB 1MW7A 3W62A 2KN4A 4NE9C 1NHUA 4F3OA 2Y1LB 1NUEA 2APOA 4DF4A 4WF9Q 4WBFA 5GAEI 3K5PA 3U02A 1Q8IA 2GC8A 3ILJA 1WI6A 5IWAJ 1HBUB 2IAJB 2V67A 1S9EB 2OELA 1RWKB 1T8EA 5D3GA 2BJDA 4CNYA 1PJ5A 4I2QA 3NS7B 3QJLA 5M2RA 1OWXA 3C6TA 3SZ2A 2GV1A 3NWRA 5J1EA 3RBZA 2XMTA 3ENQA 2HBRB 3BSOA 2LDIA 4K4WA 2FJBB 5GADU 4ECSA 4AYBD 3AODA 2RHQB 2UU9F 1TZ0A 3NGSA 1ULRA 4P2FA 4DSEA 4C7QA 1VS3A 3HXMA 4USHA 4MFBB 1I6JA 1UJ4A 4DR6F 5IQ6A 4ZPWR 1RISA 2FGOA 2B9YA 2VOOA 4BWJA 3QZ7A 2M70A 3F73A 3VVUA 5GADI 1X0FA 2FVCA 4JI0F 1F3VA 1T94A 2FJDB 2ZH5A 2F63A 4B3SF 3C19A 1EKSA 1WG4A 4F3MA 3PACA 2G9OA 1Y4ZB 3MR2A 2IDEA 5E3CA 1FJ7A 3MM9A 8ATCB 3GJSB 3JTPA 4DSKA 2VDHA 1XN9A 1R31A 1K44A 1NU4A 2R7VA 3WIUA 4JV1A 2FD2A 2VPZB 4ZK7M 2ADCA 3AD8C 4MK7A 3QMQA 2VJUA 3TQEA 4NRTA 1FCAA 3IAS9 5B0FA 2WOMA 4WFYA 3M7VA 4LRBA 5ETLA 4FNHA 1VQMS 1HNWJ 5HMXA 4V19X 3K58A 3P5BP 2J0SD 3LAKA 4OZ0A 1FRMA 3SDEB 4F2SA 4GC7A 2XO6A 2RSQA 3DRSA 4F0HA 2LEBA 3DLGB 1NH7A 3LA0A 3NY0A 3KXDA 1JLCB 3DOLB 2FY1A 1WDDA 4AFFA 2AJ0A 1S1TA 4LSZB 3TA2A 3IG1B 3CCJS 1JJHA 2YNIB 1AA1B 3MR7A 3M32A 1N5YB 2BE2A 2R8HA 1IUJA 1FWPA 4ZVPB 2AJFE 4ZVUB 4CWBA 1RB0A 1FKPA 3IRXB 3PRBA 1PBUA 4KYZA 2MKHA 3E51A 2E5IA 1JLFA 3IGVA 4NPOA 2ACMA 8RUCA 4GVLA 3UQSA 3J7YI 4J9RA 5D0GA 2R3VA 3RJMB 3FNNA 2A3JA 3BGRB 5I42A 4FYVB 4CT8A 1YIJS 3ETOA 1RWUA 5EWFA 4A8KA 5IXUA 2GHWA 1RT7A 4DL2A 3KMSA 3M4XA 5CA5A 3CCWA 2CJYB 2NUHA 2KI2A 2XQCA 2MZRA 4E2FB 2EBGA 2LU1A 3ZZUA 2AD9A 3BF4A 4ECQA 4LF4F 2WAQD 2IM1A 2XSJA 1S79A 1RT2A 5L1JA 4JI8F 1EQMA 4DG1A 1UL3A 1IKVB 3UE2A 3OL8A 4O4RA 2RDJA 4QBUA 1WOPA 1Y00A 1JLBB 4ZJQA 2HNDA 2CXEA 2YWHA 4GRSA 3G86A 2WW8A 4N7TA 3MF5A 4I0WA 1XIQA 5E3RA 4WTYA 5K9FA 2E5LJ 1I51B 4CP5A 1RT5A 3TAQA 1S10A 1U49A 3J7ZT 1T9VA 2F4VF 2F40A 4IRCA 2IJNA 4U7CA 2NZCA 1AYEA 5HJXA 2ALYB 2GVDA 3KK2B 2J9DA 3DMJA 5AJ3J 3CO0P 1N8RT 2CJBA 3KJNB 1FXRA 5CD4A 1NSQA 5FD1A 1Q7YT 2C3PA 4FF4A 3KJVB 2CJXB 2HG4A 1TV6A 2JH3A 1LWCB 1SC4B 2GS8A 3UVJA 5T41A 5J2PA 5J1NA 2POKA 1A6LA 4ID5B 2H4WB 3NNHA 2MQOA 3OL7A 2QRRA 2C22A 2DEIA 5DLFA 1X60A 1YJWS 3MEGB 3G6VA 3UR0A 1W2IA 4ETXA 2W4CA 3KUHA 3OD2A 4HHUA 4Z2XA 3HHLD 1C0TA 2XMWA 1RT1B 3D6MB 1B4SA 1LOUA 1QAYA 2CFXA 2E5JA 1UEVA 3BM7A 4Z37A 4WWSA 4Y65A 4KE5A 2MKKA 3KYLA 4OHWA 4TKTA 5KT3A 2BACA 2RF2A 4DR2F 2IC3B 1W2BR 1HHQA 3CTRA 3CJ3A 5D78A 3T1YJ 2ZBQA 2O5DA 4TY8A 3IS9A 2MSSA 1NKCA 4KC5A 3ZTRA 1ICEB 2CG8A 1HR0F 4KHRA 4PAAA 5ITHA 1F1BB 5HN0A 4ECZA 2QX0A 2QL9B 4IFVA 4LVNP 4O0NA 4JI0J 1Y10A 5LL6d 3AA9A 2M8DB 2YPZA 3M2RB 4EI2A 2HRTA 4LR8A 3CDEA 4PG6A 3QIDA 1NK9A 1L5UA 4USVA 2DNMA 3IR5B 5IQQA 1CEZA 1NRKA 3P5TL 2R8KA 1S49A 2MKSA 2RMLA 3TVKA 4FN5A 5D15A 2QLWA 4OV6A 2XZDB 4KTQA 3RUBL 1FK9A 1REVA 5GMEA 5K8PA 2ILZA 1QAJA 3DLBA 1VRTA 2JC0A 2ROEA 4Y0FA 1B0PA 2HW3A 3KLVA 2JEFA 1NMEB 3UDLA 3S7RA 1S1XA 3SV3A 2OSQA 3G82B 1TL1B 2MSTA 3DFEA 4ES1A 2V94A 4RKUC 2EC0A 4RBUA 3WBZA 3CD0A 2QMXA 2DCUB 3K0JA 1U8WA 2B9WA 3BN7A 1GQEA 3N79A 2JC1A 5D8HB 3AH6A 1B64A 2I0XA 1WC1A 2B4OA 3C2PA 4AD6A 1HNZF 2ZC4A 4Y00A 3M9NB 2ILYA 3FCHA 2DNGA 4UUXA 1OY8A 2X1AA 4KH0B 4KT0C 2HQCA 2JLEA 1FERA 4OX9F 1VI7A 1HNVB 3D5MA 3V4IA 1KVKA 4V1Ak 2MQPA 4ECXA 1RJJA 1FA0A 4E98A 1ZM3A 1TUWA 2AX0A 3VV2B 4Q44A 1N52B 3NOGA 4Q5VA 1K1SA 2N82B 1FEHA 3GE9A 1RU1A 1U0HB 2BOPA 5KFYA 1JLAB 1RTZA 3GB0A 1WACA 4ZJOA 5DG8A 1C4CA 1TVRA 3MCOA 4LSLB 3UCGA 2R8JA 1X4AA 2GHPA 4OX6A 3KTQA 1FDDA 3SFUA 4F3QA 4Z7CA 5KT4A 2OPRB 3ZZPA 2R2RA 5IV4A 1NK8A 3OR1B 4CLKA 1DBDA 5K8NA 3G6ES 4ANDA 2BJ8A 2GO8A 3I87A 2VD3A 3UPFA 1U45A 1F0XA 2FHKA 2FZGB 2OTLS 3IGNA 5EX0A 3MM7B 3HD1A 3HFVA 4I68A 4J9VA 4C11A 4M5NA 2DNZA 2VFTA 1RAEB 4ZIWA 2R7XA 1JNRB 3ZZZA 1S6OA 1R0AA 4Y2CA 1BC6A 1QAXA 2ZBRA 3QQCD 4ITSA 2MKCA 4DI6A 4JOUA 4IDKB 1CJUB 4A4JA 3ADAC 2CNNB 3NAIA 4C0BA 1RHUB 2DB1A 3CF5Q 1UFLA 1KQKA 2RS2A 1WTFA 3LF0A 2UXDJ 1FWLA 3HSZA 3VALA 1UFKA 3W2VB 3K59A 3FFIB 1Q95G 1QSSA 1TFYA 3BO2A 3QGHA 2BJ1A 4ZCIA 2ROGA 3Q23A 3Q86A 2E1CA 2F9JA 2HAFA 1MROB 4QU6A 4O0IA 4YB6A 3DYAB 1N6QA 4UQGA 1IBMF 5ETVA 4HACB 3TJ8A 4DV1F 4AT1B 4X4NA 1X5TA 4R5PA 1CQNA 2D1CA 1S97A 4JB8B 3R5CA 3VZIA 1X4GA 2O66A 5FDLB 1U6BA 2DTJA 3DN9A 1EP4A 2MJNA 3BSCA 3UN5A 1S1UB 2V8PA 4B9SA 2Z56B 3CJ5A 1HBMB 3IR6B 3NMRA 4NLQA 3CCMS 3FUYA 2HS0A 2ASDA 4LF5F 3DCAA 4YP3A 3I9V9 3I4PA 4CM2A 2PMZD 3OLBA 4I56A 2NPFA 4QWEA 4OV1A 4LF8F 3IRWP 1JKHB 1KC8T 2VODA 2J0XA 4B3TF 2V4JB 1VBYA 2H4YB 2DHAA 1YZ7A 3R1LA 4KJIA 2D9PA 2V63A 1VBKA 4N5SA 3KLIA 1WWHA 2HK3A 2V2VA 3ZZTA 3OL9A 3DRPB 4MK9A 1L3KA 2IYIA 1AZSB 5DG7A 3W65A 3H2VE 5L38A 2VU5A 1HBOB 2RD5C 2BW2A 4Y3CA 2IM2A 1CC7A 2A2DA 5DQHA 3MCSA 2GJIA 4UOFA 1TL4A 3PFEA 2HMIB 4YB1P 4J9KA 1X4DA 3ZZYA 3FGVA 1QSYA 2HHTA 4QIGA 2H5JB 3PX0A 4PRFA 2Q6CA 4RUBA 3CJKA 2K06A 3JSRA 2XHWA 3KLHA 1YJ9S 2UUBF 2K7JA 3H5YA 2C3MA 1EQ0A 2Y0SD 2IDLA 4DX6A 5IC6B 3NGRA 1VDHA 1UKUA 1UFWA 2OHDA 2W7AA 4PQAA 4F02A 1WC0A 4NYPA 3MECA 3D6HB 2RNEA 1OQ3A 4QIVA 4JI5J 1N5SA 2VV5A 3LPEA 1TL3A 4AXIA 3SXLA 1DQAA 3AOAA 1SXLA 1RWPB 4ED7A 2U2FA 1HFEL 4U67Q 1VLOA 3KG0A 4IUFA 5L8RC 3SCKE 3PW4A 3V81B 3QNWB 1M5VC 1H73A 4I6WA 5C2GA 4M95A 1GMWD 1N32J 3OBIA 3JSYA 2M3DA 2DRBA 4ZITA 2E66A 4ANCA 4H4MA 3MXHP 2ASYA 1N36F 3MFIA 1R3NA 3EGWB
chains in the Genus database with same CATH topology
1RAOA 3ILJA 2F63A 4PZVA 3MCMA 1EX8A 1EQ0A 4F7VA 2F65A 2BMBA 1HQ2A 3QBCA 4M5LA 5ETLA 3KUEA 5ETVA 3HCXA 3UDVA 4CYUB 3MCOA 4CRJA 1RU2A 1G4CA 4CWBA 3HSGA 5ETOA 1RU1A 3HSDA 3HT0A 5ETMA 3HSZA 5ETQA 5ETTA 1F9HA 3KUHA 5ETRA 3ILLA 1RB0A 3HD2A 5ETSA 1KBRA 2CG8A 4M5IA 1DY3A 4M5HA 4M5KA 3IP0A 4M5GA 1TMMA 4CYUA 1RTZA 3HD1A 1HKAA 3KUGA 4M5MA 3ILOA 3HSJA 4M5JA 3UD5A 1IM6A 5ETNA 1TMJA 4AD6A 1Q0NA 1EQMA 1CBKA 3MCNA 4M5NA 5ETPA 3ILIA 5ETKA 2QX0A 3UDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAO A;  3ILJ A;  2F63 A;  4PZV A;  3MCM A;  1EX8 A;  1EQ0 A;  4F7V A;  2F65 A;  2BMB A;  1HQ2 A;  3QBC A;  4M5L A;  5ETL A;  3KUE A;  5ETV A;  3HCX A;  3UDV A;  4CYU B;  3MCO A;  4CRJ A;  1RU2 A;  1G4C A;  4CWB A;  3HSG A;  5ETO A;  1RU1 A;  3HSD A;  3HT0 A;  5ETM A;  3HSZ A;  5ETQ A;  5ETT A;  1F9H A;  3KUH A;  5ETR A;  3ILL A;  1RB0 A;  3HD2 A;  5ETS A;  1KBR A;  2CG8 A;  4M5I A;  1DY3 A;  4M5H A;  4M5K A;  3IP0 A;  4M5G A;  1TMM A;  4CYU A;  1RTZ A;  3HD1 A;  1HKA A;  3KUG A;  4M5M A;  3ILO A;  3HSJ A;  4M5J A;  3UD5 A;  1IM6 A;  5ETN A;  1TMJ A;  4AD6 A;  1Q0N A;  1EQM A;  1CBK A;  3MCN A;  4M5N A;  5ETP A;  3ILI A;  5ETK A;  2QX0 A;  3UDE A; 
#chains in the Genus database with same CATH topology
 3E2E A;  3BR8 A;  2ZD1 B;  3OFG A;  4X4S A;  4DFP A;  4Q8E A;  1DAX A;  2BW7 A;  4NLX A;  3FMW A;  1CJV B;  2GAH C;  4ECV A;  4ZPV R;  3J81 Y;  3TVZ A;  3EPI A;  1EIY B;  3GFX A;  5LSR A;  4X4P A;  4OYZ A;  1SKU B;  1V3R A;  2K8G A;  3KG4 A;  2B9X A;  2GJ2 A;  4DFJ A;  5SUH A;  3U1M A;  4DV5 F;  2RQ4 A;  3D1Q A;  1G1X A;  2VH7 A;  5BR8 J;  4P71 A;  4WYL A;  3FRZ A;  3PYF A;  3UW1 A;  1T03 B;  2Q66 A;  4K4Z A;  4FXW A;  1RBA A;  3UFC X;  1TEL A;  3W3S A;  4WK3 A;  1Q8B A;  4NCG A;  3ETM A;  4IH7 A;  3M8W A;  4RW8 A;  1K0V A;  1HPZ A;  3SBM A;  1ZZN A;  2QYC A;  3GSD A;  4NXN F;  3GII A;  1RLD A;  2LU2 A;  4RW4 A;  1TKT B;  3ET6 A;  5G0R A;  4ZN1 A;  4WFZ A;  2OPQ B;  3OTE A;  3O1L A;  2FJV A;  5JUM A;  1NZ8 A;  4GVB A;  4CH7 A;  5IT4 A;  2CJ9 A;  4KB7 A;  1DTT A;  4RW9 B;  1QVF R;  5CH7 B;  1ZA2 B;  4YR0 A;  3R3T A;  3CWJ A;  2XWY A;  1Q7L B;  1HMV B;  1VHI A;  4AL7 A;  1WEY A;  2VIC A;  3D9B A;  3H2U B;  4KKO A;  4CLZ A;  4OZN A;  3L9Z A;  3MD3 A;  3ISN D;  1Q79 A;  1GX6 A;  4EK2 A;  1SQG A;  3EDQ B;  1BWV A;  1SKS A;  4NRU A;  3L4B C;  6FD1 A;  4G1I A;  1L3U A;  4DV1 J;  1IKW A;  4LFA F;  3ZNJ 1;  1SBR A;  4M5D B;  1BQN B;  3CSK A;  4ZJL A;  3CB4 A;  4QR2 A;  4K4V A;  1WC4 A;  1R6Y A;  4O4G B;  3QYY A;  1FE0 A;  2HLT A;  5K8M A;  4LRD A;  5AXK A;  2RU9 A;  1A9N B;  1W26 A;  2RS8 A;  1WHW A;  1UMJ A;  5DM6 Q;  2ZWP A;  4YS2 A;  5L39 A;  2F8E X;  5KFH A;  3PRD A;  1KFD A;  2HHS A;  4F36 A;  4EYI B;  1GH8 A;  4QYZ K;  3CUL A;  3GIR A;  1WUU A;  4NOH A;  1WEX A;  3JXO A;  4CLW A;  5BYQ A;  1ZM4 A;  8AT1 B;  2RDI A;  3V6D A;  5A8R A;  1JXL A;  4LF8 J;  2HZA A;  5F0W A;  3TAP A;  3M8P B;  4CYU A;  1P6T A;  3J81 U;  3GWC A;  4A8S A;  3K17 A;  1GXL A;  4ICL B;  5HP1 B;  3MM6 B;  4LRE A;  2VBX A;  5F8J A;  1QUV A;  1CJT A;  4K4U A;  2MPU A;  5RUB A;  3HHK A;  3QLH B;  1RDR A;  2WSF C;  2Q3P A;  2KRR A;  5DQI A;  1HHS A;  2P8I A;  4UF4 A;  4C9D A;  3GJR B;  2R7Q A;  3LP1 A;  4OJ1 A;  4DR7 J;  1TKZ A;  2ZJP Q;  3B4D A;  5LMN J;  4OYW A;  1HQ2 A;  1P9Q C;  2FY8 A;  3RB0 A;  1RTI A;  2VQF F;  4J91 A;  3K8V A;  5DET A;  1C0U A;  1V3Z A;  3GCX P;  5D3G B;  4ILR A;  2ZBP A;  2ZH6 A;  2F65 A;  3C6T B;  5AXN A;  3HVA A;  3GON A;  2C2M B;  5J1E B;  3MOJ B;  4QYZ J;  2UUB J;  4NXM J;  2KXH A;  2HGN A;  2Z2M A;  2HQ3 A;  2IMO A;  3HT3 A;  3K57 A;  4QWC A;  1LXJ A;  4X84 A;  1TUG B;  2FHM A;  1VQY A;  1M5O C;  2GMH A;  3NG8 A;  1RA7 A;  4YHH J;  1Q8L A;  1NO8 A;  3H5X A;  4ZMM A;  2QJ3 A;  2ZNY A;  3KLF A;  4OHY A;  4C8N A;  1UA0 A;  4L75 A;  1X7V A;  3CCZ A;  4ENO A;  3KG1 A;  1K8A T;  3AAW B;  3MAQ A;  3C16 A;  3F44 A;  1H6K X;  1RHQ B;  2PDA A;  1UWB A;  1SPB P;  3I96 A;  2AGO A;  1NDP A;  1PJ7 A;  2VB6 A;  3LQV A;  4ER8 A;  2G4B A;  5GMD A;  2ZDO A;  5BYR A;  2CRL A;  2BVZ A;  1NDK A;  1EX8 A;  1FXL A;  3MM9 B;  4PG7 A;  2HBY B;  3JTO A;  4NLW A;  1NJW A;  4PAB A;  3UCU P;  4AE5 A;  3TW0 A;  1ZPW X;  2LA6 A;  2DO0 A;  1WF2 A;  5I3U A;  3VCD A;  1RAO A;  2UVV A;  4DV7 F;  5DDO C;  3DOL A;  3OQ2 A;  3PM9 A;  1U7L A;  2WOM B;  5BXI A;  2E29 A;  2W9C A;  2XS5 A;  3CNQ P;  5LJ3 Y;  2ZH3 A;  2DGT A;  1D8Z A;  1T7P A;  3KJQ B;  3TJ9 A;  4KAI A;  3VVT A;  2Z2L A;  1FF2 A;  3HO1 A;  1S6U A;  4P7V A;  5KFP A;  2UUT A;  2VG6 A;  2XCA A;  4LBP A;  3DRS B;  1SIZ A;  2KXN B;  1NK5 A;  2CQ1 A;  2EK6 A;  1BQX A;  1UJ6 A;  4A8X A;  5H9F K;  5LSL A;  1NJX A;  4ZPB A;  1DTQ A;  1VGY A;  1S1T B;  3ENW A;  4H54 A;  3CCV S;  2CQB A;  3JSM A;  4F2R A;  4NWB A;  2BM0 A;  1R89 A;  2KG1 A;  3K8W A;  1PYT A;  5F9L A;  3M32 B;  5KFJ A;  3NGU A;  2BE2 B;  4YME A;  2XS2 A;  4X62 F;  1D9F A;  3IM9 A;  1U2F A;  3R5B A;  1KDN A;  4HI2 A;  2ZUG A;  3W9H A;  2H54 B;  4UT4 A;  4N8N A;  1TFW A;  3OLA A;  1NB2 A;  1QM9 A;  2OKQ A;  4ED1 A;  1FKP B;  1KEK A;  3GJQ B;  1NK6 A;  2W4D A;  2KHD A;  1DFD A;  1FNX H;  1F5C A;  5HSP A;  1JLF B;  2R9L A;  1XNR F;  1RAB B;  1QJH A;  2QL7 B;  3PW2 A;  4M94 A;  2RKI B;  1IKV A;  2ADB A;  1RT7 B;  4GO5 X;  4FDF A;  4QIF A;  2MQL A;  1HL6 A;  2C1E B;  3QAU A;  1NM2 A;  2V0N A;  2D3O R;  1D3W A;  1Q8K A;  3KFW X;  1ITP A;  2GIQ A;  4ELU A;  2BQU A;  1T0T V;  4CZC A;  3R7B B;  4GKK J;  2ZH2 A;  1RAJ A;  3M30 A;  3C14 A;  3W66 A;  2UUA J;  3RGI A;  2XSJ B;  4HHJ A;  4UQT A;  3AJ1 A;  4A48 A;  2F3J A;  2UXC J;  4DG1 B;  2AKW B;  3H5S A;  5ADZ A;  5F9N A;  4C8L A;  1GK8 A;  4UW2 A;  3H59 A;  2VIH A;  4QIE A;  3KK2 A;  4OIX A;  2CZ9 A;  3VGU A;  4FF2 A;  2R2T A;  3WQP A;  2NS1 B;  4NEZ A;  2HND B;  2IYG A;  1XNQ J;  1KQG B;  5AXM A;  2EVZ A;  1NJY A;  3W8P A;  2QLX A;  1RAC B;  1T3O A;  4IR9 A;  1RT5 B;  3CD5 A;  2ZHO A;  3Q83 A;  2CNL B;  4QJV A;  2OFG X;  4DZ6 A;  2CQC A;  4JI1 F;  1K1Q A;  3MEG A;  3T6B A;  1ZH5 A;  4HT7 A;  2GVD B;  2YPY A;  2UXB J;  3DMJ B;  1F3F A;  3ENV A;  1IN0 A;  1J27 A;  1TV6 B;  1WSV A;  2R2S A;  3UVJ B;  1Y0H A;  4B3O B;  2IC3 A;  1VQ8 S;  1DHM A;  5J2P B;  3BGF A;  2CJK A;  2J5A A;  2FLN A;  2P9C A;  2YNG B;  1RWN B;  2DPJ A;  4ZLL A;  2NR0 A;  4HHH A;  4I4B A;  1C0T B;  2HS3 A;  4UZC A;  3TX8 A;  1Y5N B;  2ZKT A;  4B08 A;  3Q8U A;  3PV8 A;  2BQR A;  1R8C A;  2AIR B;  1AB8 A;  1OPI A;  4ZS6 A;  4A8M P;  3ZZR A;  2WZ1 A;  1FE4 A;  1YJ7 A;  3QJJ A;  4P2M A;  2RF2 B;  1N88 A;  2G0I A;  3MPW A;  4QW9 A;  2OJ3 A;  2DR8 A;  3C8Y A;  2XGP A;  1CLF A;  3TUJ C;  4TY8 B;  1KD1 T;  3IS9 B;  2H51 B;  4C98 A;  3LUY A;  1MWQ A;  2HBQ B;  3MED A;  3N5B A;  5CYM A;  3BEG B;  2AF6 A;  3TO8 A;  4DX8 H;  3T5J A;  1NJZ A;  4URS A;  1MN9 A;  2KH9 A;  3I31 A;  2G2Z A;  3FKB A;  3OXL A;  4IFV B;  1RWM B;  4PYA A;  1IKY A;  4Q8F A;  4LF1 A;  4MIA A;  3AB2 B;  3QSY B;  4OJH A;  2YKA A;  4CLU A;  2UVU A;  2H48 B;  1ZA1 B;  4DPO A;  4HTJ A;  1FD2 A;  3ILL A;  1YKW A;  2CQD A;  1RAI B;  2B3T B;  2L9W A;  3N6N A;  1VC6 A;  3HI9 A;  5KFT A;  1DJ0 A;  4YDD B;  2DYA A;  3J7A N;  2OGU A;  2P9G A;  3CGI A;  5HAO A;  1B7F A;  1SUQ A;  4HEA 9;  4E8U A;  1I94 J;  1PIL A;  1NPR A;  4C3K A;  4N47 A;  3ILI A;  2F8M A;  4OHV A;  2E7V A;  2OEK A;  1GTH A;  1FK9 B;  2PEH A;  1REV B;  4A8W A;  3MPU B;  3A8E A;  1HI0 P;  1PAU B;  1VRT B;  4IRK A;  3M8R A;  4OLP A;  3KLE B;  1S1X B;  5CYQ A;  2WSE C;  1N33 J;  2QLF B;  3MCM A;  3AT1 B;  3T9Z A;  4YR3 A;  5CD4 H;  4U95 A;  3R5A A;  1IXK A;  4X4T A;  2M2B A;  4RNM A;  2MKY A;  4DS4 A;  2HHH J;  2ALZ A;  4DV2 F;  2WON A;  3NP5 A;  4CI0 B;  3FBF A;  3W9I A;  1RXO B;  3RYL A;  1HW9 A;  1RAG B;  2QEX S;  2OH2 A;  3EDR B;  3EJM A;  3R8Y A;  4X62 J;  3V4I B;  1YG0 A;  3P8B B;  3BZQ A;  2BRL A;  2ZH7 A;  3TZZ A;  2XEX A;  3PW5 A;  3EE3 A;  2Z30 B;  3PX4 A;  2J6T A;  5KFE A;  2ZKU A;  2IMW P;  1H7X A;  1WF0 A;  2JEG A;  4M63 A;  1VBZ A;  2LQJ A;  4BCA A;  2LA4 A;  2Z0G A;  3BBC A;  5EWE A;  4ZPT R;  1Q4R A;  1WC6 A;  2DKO B;  4AUK A;  1TVR B;  1KVI A;  4B9U A;  3THT A;  5KT7 A;  2ZC3 A;  3H42 A;  4CO2 A;  4DR5 J;  1O5J A;  5E33 A;  2DH7 A;  1EZZ B;  1GMU A;  4DV0 F;  4ZPA A;  2CQ2 A;  2MB0 B;  3W2V A;  3UCZ P;  4FYD A;  5HQL A;  1YZ6 A;  4IOC Q;  4C11 B;  2DK2 A;  3W9J A;  1R0C B;  5IS2 A;  3NGD A;  1AUD A;  3FEX B;  3H4D A;  2UVR A;  3ZTO A;  5F41 A;  5BYS A;  1R0A B;  2BV3 A;  1IVZ A;  1RLC L;  2YH0 A;  4LF7 F;  1HWU A;  2Y9H A;  1MMD A;  4ECW A;  3G6X A;  1S1V A;  3PNI A;  3DXS X;  2H5I B;  3OR2 A;  2ZOG A;  1NBE B;  3WIV A;  2B5J A;  2I2Y A;  2MY7 A;  3BPD A;  1IR1 A;  2DR5 A;  4G3I A;  4JI2 J;  1OQ6 A;  2YKO A;  4DUZ F;  2Z8Q A;  5KFQ A;  2R8G A;  4RW7 B;  1TTH B;  3A8I A;  4C8Z A;  1S0M A;  3H2L A;  4F4W A;  2FZK B;  1N6Q B;  2O67 A;  2YQ3 A;  2QLJ B;  9RUB A;  4OI3 A;  4R5P B;  3ZXW A;  3IBF B;  3P6Y C;  1KOH A;  2YXL A;  2XY6 A;  1Q16 B;  4DR1 F;  4CLL A;  2D3O 1;  1QAI A;  1UJ5 A;  3AJ2 A;  2AGP A;  2DRD A;  4X64 F;  1IQT A;  2E44 A;  2V4J A;  1EP4 B;  4CNZ A;  1TR0 A;  1IJE B;  4WP9 A;  2GAG C;  4PZV A;  3OFF A;  4LSN A;  2BYC A;  3CJ4 A;  5KFZ A;  5GAH U;  2FTR A;  3Q22 A;  4NLT A;  3MD1 A;  5DO2 A;  1T9Y A;  3NS6 A;  3PY8 A;  1TU0 B;  3DRX A;  3DDI A;  2UUC F;  4OYI A;  5JMN A;  2COL A;  4K7Q A;  2B9E A;  4KFB A;  4XAK A;  2Y8W A;  4DPU A;  3A1Y G;  1ZM9 A;  2V5H G;  5KOW A;  2R7U A;  1Q0N A;  2OEM A;  1IJF B;  2KHC A;  1RI7 A;  5E41 A;  2DXD A;  2LXU A;  1WHY A;  3PRV A;  2LXI A;  5GAH I;  4PXC A;  4X4O A;  3KLI B;  5DJB A;  4K2J A;  5ETS A;  3NGK A;  5F8I A;  5IWA F;  2W2M P;  3T6J A;  3VZH A;  2PSZ A;  3PJ9 A;  5LMU J;  4DWI A;  3P3D A;  2OI2 A;  2R7O A;  3FC9 A;  1RTH A;  2VKR A;  1HA1 A;  1KLM A;  1RAF B;  2ZE2 A;  3DC2 A;  3H7H B;  3BGU A;  2RT3 A;  2MZS A;  4EZ9 A;  2C3Y A;  2RQC A;  1B3T A;  2P9E A;  3M1V A;  5HBM A;  1FO1 A;  4LBH A;  3CJR A;  2DY9 A;  3H5U A;  2LQ8 A;  4DPT A;  1NHV A;  2H3E B;  1FKO A;  4PWU A;  4NLV A;  3CJK B;  2YX1 A;  4B3M J;  2C28 A;  4PPZ A;  3VR1 A;  1RBL A;  4I7F A;  3HVT A;  4RU9 A;  1FFG B;  3U27 A;  2P6T A;  5EHH A;  2MQQ A;  1F60 B;  4EUV A;  4ZLJ A;  3LWM A;  3GIL A;  2L48 A;  2R7W A;  1N34 J;  1FDB A;  3T1H J;  2W01 A;  1JLE B;  3T19 A;  3MEC B;  1NJI T;  4NLU A;  2M8H A;  2VUG A;  2I1R A;  4R25 A;  4A8O A;  3TAR A;  3P4U B;  3MPY A;  2JFK A;  3LAM A;  1SI9 A;  2CDQ A;  1TL3 B;  1HWJ A;  5T7L A;  2GIF A;  3I0S B;  2HRU A;  4IKA A;  3BO3 A;  2XC9 A;  4DU7 A;  2HHP A;  1KBR A;  4M5G A;  3NLC A;  1WOS A;  2GZO A;  1Y5L B;  1FEE A;  2J8A A;  3T5L A;  1VIO A;  4ZDN A;  4XTT A;  3DU5 A;  1OYE A;  2G1D A;  5ETM A;  5DM7 Q;  2OD4 A;  4MIB A;  4ZIV A;  1H98 A;  1HNW F;  4CIO A;  4CO5 A;  4X2B A;  4K4Y A;  4C8M A;  1Q5Y A;  3DLJ A;  1P1L A;  3OJU A;  3BQ0 A;  3QIP B;  1TAQ A;  1GXT A;  2Z2Y B;  2AYE A;  3QT5 A;  4IQM A;  4M5I A;  1T03 A;  1VRU A;  1VQK S;  3C46 A;  2QIF A;  3PVX A;  1PC5 A;  3W8G A;  2CPE A;  4ID8 A;  2J8S A;  2BE7 D;  3CCE S;  3GQC A;  2MQM A;  3NMA A;  4YY3 J;  2WBM A;  2L08 A;  4PG8 A;  4I6Y A;  3OFE A;  5KFM A;  4KR0 B;  3Q8V A;  1N5T A;  2V2Q A;  3L3C A;  2MJU A;  3KLG A;  3LPY A;  3GR1 A;  2KL8 A;  1OSD A;  4K4X A;  5IOL A;  4X65 J;  4WE1 B;  2MZ1 A;  3FJ2 A;  3QWU A;  1FJE B;  2VA3 A;  1DAR A;  3PTW A;  1GMW A;  4NCG B;  1NEE A;  4KHM A;  1SJR A;  4RW8 B;  4I67 A;  4Q45 A;  2HIY A;  3DLE A;  1HPZ B;  2C2D A;  4WFA Q;  1S4F A;  2BZ2 A;  4DLG A;  4RW4 B;  2BAB A;  2IA6 A;  3ET6 B;  5G0R B;  1T9W A;  1WJ9 A;  2AHO B;  1FX4 A;  1Q78 A;  3HZG A;  4GVB B;  2B56 A;  4M5J A;  3PJW A;  1WC5 A;  3EGV A;  4WII A;  3Q8S B;  1DTT B;  2UZA A;  2QFJ A;  4YUD A;  2CZ4 A;  2N4C A;  3B78 A;  2BKN A;  2IM0 A;  4PQU A;  2MKJ A;  4OLO A;  4WYW A;  5IC4 B;  2KVQ E;  5KT5 A;  1SL1 A;  4CO3 A;  1WKL A;  4JI3 J;  5CAB A;  2AT1 B;  4KKO B;  5KFL A;  3H25 A;  1RHK B;  4C3L A;  4OZ2 A;  4TQS A;  2H5E A;  1D1U A;  2DH8 A;  2Q1L A;  3TQ1 A;  5KG3 A;  1IKW B;  3CJQ A;  2QO3 A;  2K3K A;  4W92 B;  3MFH A;  1YDL A;  1AFJ A;  1TL7 A;  4PWW A;  3KDN A;  4LF6 J;  2A2C A;  3M8P A;  2V9K A;  2W7P A;  3TWZ A;  1YTY A;  3MM6 A;  1X4E A;  1HKA A;  2NPI A;  3O6Q A;  4G6V B;  2KFY A;  2Z2Z A;  1XR5 A;  3Q8Q B;  1LWF A;  5HI7 A;  2ZBC A;  3FEY B;  1W7W A;  2CPJ A;  2KYX A;  5F8H A;  5C42 A;  2V69 A;  3QWP A;  4QWB A;  1QDU B;  5KFW A;  3KNG A;  3V6D B;  3GYX B;  5A8R B;  4W90 B;  3PR4 A;  5AJ3 F;  4IG3 A;  4DJB A;  2QL5 B;  3U7J A;  4CYU B;  5L9N A;  4RUA A;  4JBC A;  4RNO A;  2DGQ A;  2B6A A;  2OML A;  2WRM A;  1KRP A;  1CJT B;  3DDK A;  1QE1 A;  1XC9 A;  2HWH A;  1VHF A;  1CPZ A;  4B3R J;  3D6T B;  2EG2 A;  1RTD A;  4M8L A;  2GGP B;  1JJ2 R;  3H40 A;  5T14 A;  3MAA A;  4H4K C;  4MYU A;  3K89 A;  1UVL A;  3I5C A;  1VQN S;  3I82 A;  1H72 C;  4HDG A;  3LP1 B;  2R8I A;  3C15 A;  1TKZ B;  3EUN A;  1L3T A;  5KFX A;  4DS5 A;  3W64 A;  3R7S B;  5CYJ A;  1B99 A;  1S57 A;  4DL3 A;  5AE3 A;  1RTI B;  4KBI A;  1BLU A;  2JSX A;  1QUP A;  1SC3 B;  1C0U B;  3T1Y F;  4DL4 A;  3W63 A;  1RWW B;  1KLN A;  3OVB A;  1M1G A;  4YB7 A;  4NYO A;  4KO0 A;  1ZTW A;  1GT8 A;  3UDE A;  2FGC A;  2FB0 A;  3H20 A;  1RUS A;  1M0S A;  4W4M A;  4RWW A;  3BGO P;  1FES A;  1PCA A;  4DSL A;  4ZVQ B;  3M8Y A;  3KHG A;  1ROF A;  1V5I B;  5GVQ A;  4ZLN A;  3KLF B;  3KHL A;  2DIT A;  4MMO A;  4ED8 A;  5JXS A;  7FDR A;  2ZVI A;  1EET A;  2MHE A;  5H1S V;  2LYV A;  2DXF A;  3C16 B;  2ZZM A;  3PEH A;  4HDH A;  3M6X A;  2XO7 A;  4K0K J;  2XGQ A;  3NWG A;  4P10 A;  1UWB B;  3BPS P;  2CWK A;  2GVZ A;  2BMB A;  4ZVH A;  2F4F A;  4USM A;  3EMT A;  2EFN A;  2IFX A;  1X9M A;  1ZYQ A;  4TQR A;  5KG2 A;  4XDD A;  2FJA B;  4CM0 A;  4HYK A;  4HH1 A;  5ETK A;  3LP0 A;  1GNK A;  5DDP C;  3KOA A;  4NAS A;  4FBT A;  4N8O A;  4H4K A;  3CJ0 A;  1G4C A;  4F0M A;  5I3U B;  5J2N A;  5A6W A;  4CT9 A;  4L73 A;  1CSJ A;  1KFS A;  2EFV A;  5IFM A;  2XMK A;  2PE8 A;  2DHX A;  3H8Y A;  2KYZ A;  4J5O A;  2HFN A;  2XMM A;  2W9C B;  5J2M A;  3HJV A;  3TAM A;  2W25 A;  5HMZ A;  3D54 A;  3DXB A;  3AOC A;  1KHW A;  4MYT A;  1Z1Z A;  4KIA A;  5J2Q B;  3GV5 B;  1MNE A;  2VG6 B;  1WSR A;  1S0N A;  5DQG A;  1O0P A;  1AFI A;  4FYY B;  3UN2 A;  2X3D A;  3DDN A;  3W1Y C;  1D0E A;  2PII A;  2B8P A;  1KQF B;  3EGZ A;  3T1A A;  3R6L B;  3CMA S;  2ZOF A;  1DTQ B;  3LTO A;  1S12 A;  3NCQ A;  4BS2 A;  3JSM B;  2GW8 A;  1N4L A;  1MN7 A;  2KDO A;  4OI4 A;  4K4S A;  2PI5 A;  2RKI A;  3Q8Y A;  1S72 S;  2WW4 A;  2BJ3 A;  1F2H A;  5E5N A;  2E7X A;  3MUT P;  2DNR A;  2R42 A;  1Q1K A;  1XWL A;  1HYS A;  3CDA A;  2FC9 A;  1HLW A;  4OJ3 A;  1NZA A;  3OW2 R;  1ZBT A;  3M2V B;  2OPS A;  3G8S A;  1NK0 A;  1YGY A;  1MLA A;  4EBE A;  1REG X;  3R9L A;  1UZD A;  2QV6 A;  3HVW A;  4ZN3 A;  1NSK L;  2C3U A;  4CH1 A;  4OJG A;  2A18 A;  1VQP S;  3G8T A;  3U1L A;  4UOG A;  3GP9 A;  1HWK A;  1IM6 A;  2M52 A;  4QYR A;  1VYA A;  2OPP A;  2IPO B;  4Q0B A;  4AQY J;  2VPW B;  1HW8 A;  3QT6 A;  3O5T B;  4LR9 A;  1RQ0 A;  2G1H A;  2UXD F;  4CLP A;  1SL0 A;  1DY3 A;  3TA0 A;  3S6E A;  1OY9 A;  1NKE A;  3K2Y A;  4USU A;  4BLG A;  2J9C A;  1IBL J;  1UP1 A;  2QC3 A;  4FPR A;  5LJ5 Y;  4JV5 J;  2BJ7 A;  2GIR A;  3M30 B;  3C14 B;  1FX2 A;  4DQR A;  1UAW A;  3RBD A;  1FT8 A;  3PIP Q;  4FPI A;  2BAN A;  2OTJ S;  2IVY A;  1NND A;  2LQB A;  4DCP B;  1WKK A;  3SMZ A;  2HS4 A;  4U9R A;  1T05 A;  2KT5 A;  5KG1 A;  5D0R A;  3UR3 C;  3FQL A;  3X1L B;  4AL6 A;  2MTL A;  1NHK L;  4R8U A;  4LF9 J;  2B4P A;  5EGY A;  3AHP A;  3QGP A;  3GFH A;  1RCX B;  2W2Q P;  3D2W A;  2V68 A;  4G1Q A;  4LFC J;  4B3O A;  4BWM A;  3CCL S;  3GPA A;  1CVJ A;  1RYR A;  2YNG A;  4DL7 A;  5KFR A;  2ERR A;  3CDW A;  1X5S A;  5DGB A;  3VQS A;  2CG4 A;  2DHH A;  4ECT A;  4XPC A;  5G4D A;  4PG4 A;  1JNZ B;  1RTJ A;  1FFS B;  1KP6 A;  3VQT A;  2XLK A;  3OSN A;  1F2G A;  2JX2 A;  1RWV B;  3ZO7 A;  3TAN A;  2DNH A;  4Y2I A;  3QO9 A;  4ED4 A;  3NAH A;  3KK3 B;  4QU7 A;  4C0H A;  2MZQ A;  2W2O P;  2YNF A;  1P8G A;  4K4T A;  2RUG A;  4N76 A;  3N0V A;  4CCH A;  3R1H A;  1JLG A;  3BBB A;  4FS1 A;  1BGX T;  4CO0 A;  1U02 A;  1AW0 A;  3BQ2 A;  3LGH A;  2J7W A;  2J9E A;  3IO1 A;  2NYI A;  3WC2 A;  2VG5 A;  4B9V A;  2EXU A;  4DDF A;  1N54 B;  1U6Z A;  1YLX A;  1T9X A;  4ZVR B;  4DR4 F;  3MMA A;  2M4M A;  4FXD A;  1SKW A;  5C24 A;  4ZVE A;  4OHX A;  3BJY A;  4C8Y A;  5CHC B;  2QT7 A;  3TUI C;  1V3S A;  4RNN A;  3AY0 A;  1K73 T;  2QA2 A;  1U1Q A;  3PO5 A;  1DUR A;  2XYP B;  1JK9 B;  1PBA A;  3GV8 B;  1RT6 A;  3MED B;  5CYM B;  2N7Y A;  1X8D A;  2UV8 A;  2RB7 A;  2IVF B;  3V4M A;  2MZJ A;  4ZVG A;  4M5L A;  3JQK A;  1WI8 A;  4OMF G;  4N41 A;  5GAG U;  1IKY B;  5ETT A;  3OUY A;  3E01 A;  1SV5 A;  2XHC A;  3LP2 A;  3QGG A;  2BKO A;  2N3L A;  2W2N P;  2EKN A;  2OSR A;  1PYO B;  4C4W A;  5F8L A;  1I3O B;  3T41 A;  4DEZ A;  3KLE A;  1RZM A;  1E6V A;  1OYD A;  2RQK A;  2M88 A;  1J5O A;  1GAO A;  1OMS A;  3TEG A;  2X3G A;  3OTD A;  3QZ8 A;  4X66 J;  2HHW A;  4JI5 F;  2CQ4 A;  5D4L A;  3IR7 B;  2ASJ A;  1DQ8 A;  2VJV A;  1S0V A;  1SUQ B;  3FDS A;  2ZH9 A;  3OL6 A;  1U24 A;  2I6W A;  2KZM A;  3VTI A;  3ISZ A;  1RU2 A;  4F50 A;  1Q5V A;  3EZ5 A;  2FHJ D;  4DX5 A;  1U1N A;  3BH6 B;  4OYX A;  2K2P A;  2JL9 A;  5B0E A;  1XMQ J;  3KK1 A;  3U1N A;  1HD0 A;  2YWG A;  3MMJ A;  1N32 F;  4TVA B;  1L3S A;  5CYQ B;  3ELH A;  4RWX A;  5DRK A;  4U7U K;  5KG0 A;  1G6B A;  5L1K A;  2V34 A;  4PEO A;  3R2D J;  4URG A;  1VQ5 S;  1URR A;  3W61 A;  4FXV A;  1HI8 A;  2MHN A;  2NXJ A;  4JUZ A;  4ED0 A;  2QZ8 A;  4OFZ A;  1FVQ A;  2WON B;  2HIQ A;  1WHV A;  4EBD A;  2HWI A;  2HNZ A;  1VQ9 S;  1S7H A;  1YWX A;  4YDX A;  3DGP A;  4GO7 X;  2HSE B;  4LUB A;  1CS4 A;  3WZ0 A;  1HNI A;  2C2R A;  3DI6 A;  3M05 A;  1JXE A;  4KGK A;  2ZUA A;  4L3K A;  2E1P A;  3QRP A;  5BR8 F;  5CAA A;  4MJK A;  4KPY A;  4CLT A;  3O8W A;  3Q8P B;  1X4C A;  4OX7 A;  2W7O A;  1NPK A;  4DSJ A;  1PJ6 A;  1KOO A;  1CBK A;  1D8Y A;  3NNC A;  4DCJ B;  1U0S A;  4O3N A;  3VAK A;  4JI7 J;  5KFG A;  2HZC A;  3MTK A;  2PFF B;  1IKX A;  4GC6 A;  4E0D A;  3I5A A;  4RBV A;  1K0T A;  3GG0 A;  4OYP A;  1RAD B;  3EIC A;  2YBV A;  2EEY A;  2QE5 A;  1FD8 A;  4JI6 J;  1G3O A;  3JSB A;  2ZBI A;  2ZM6 F;  5DG9 A;  2MXY A;  3MMC A;  3PFO A;  3PHE A;  1LW0 B;  3QAT A;  1UWA A;  4OHZ A;  1TKD A;  4G65 A;  4J37 A;  3ZTS A;  1IR0 A;  4YN3 B;  2FUG 9;  3D68 A;  3PIO Q;  1BUX A;  1D9A A;  1R6V A;  1YBU A;  2ZZT A;  4JYA F;  5HMY A;  4NEY A;  4RW7 A;  3N6L A;  3PW0 A;  4P75 A;  3HUL A;  4USK A;  4PKD B;  1X9S A;  1WNE A;  2FVR A;  3D3C J;  1NH8 A;  4DSI A;  4N56 A;  2DBB A;  2ASL A;  1S1V B;  1H38 A;  2BEF A;  2Y3Y A;  3OR2 B;  1CC8 A;  5DS7 A;  4CLF A;  4YFU A;  3NCP A;  2B5J B;  1UZH A;  3UD5 A;  3TR5 A;  3CED A;  4U8Y A;  2HRY A;  2DY1 A;  2V6A A;  4ELT A;  2AEM A;  3M6V A;  3H4B A;  4MK8 A;  1LXN A;  4ECU A;  3ITH A;  2IIH A;  3TUP A;  2PI4 A;  3IBC B;  1IWA A;  4RL1 A;  3PW7 A;  4NLP A;  2CUY A;  3QBC A;  1ZZF A;  2W4P A;  3N01 A;  1S1W A;  5ETQ A;  3G4S S;  2WK4 A;  2KTQ A;  1M5P C;  4TXS A;  2QSW A;  3Q89 A;  2FJW A;  3MCN A;  1MWY A;  2DNL A;  4DQS A;  3I4H X;  3AXM A;  3UDV A;  3DNC A;  2HHQ A;  3CIZ A;  1U2C A;  1W25 A;  3OSP A;  2VZ9 A;  2Q6B A;  2XZT B;  4DUY J;  4LSN B;  2CA9 A;  3BYR A;  1OIA A;  1T3N A;  1WHX A;  3L95 X;  1FTC A;  1VR6 A;  5C2C A;  3TZY A;  2HAI A;  4PXE A;  1CUL A;  4QWD A;  3US5 A;  4IFY A;  3DRR A;  3UWT A;  2J76 E;  4LIW A;  4DR4 J;  1HNX J;  4DR7 F;  2MYF A;  2XNR A;  3QAE A;  1Q82 T;  4KFB B;  4IR1 A;  5LMN F;  3VAM A;  4WCE Q;  2E1M C;  2FDN A;  1F9F A;  4NLG A;  2UUW A;  3S01 A;  1GX5 A;  2K1R A;  1SJQ A;  2AP6 A;  3KHH A;  4YR2 A;  3DKD A;  3DOM A;  3KWM A;  4FVC A;  3FQK A;  1YJV A;  1HD1 A;  1DQ9 A;  4A46 A;  4RNF A;  2DIV A;  2HBZ B;  5HQ8 A;  3CDB A;  3O3L A;  1RTH B;  2I9S A;  4TY9 A;  3MEE A;  4NXM F;  1KLM B;  2ZE2 B;  2DR7 A;  3MAH A;  2GFF A;  4F04 B;  2ATC B;  3GV7 B;  2VQE J;  3E8O A;  3M9O B;  1JLE A;  3KNA A;  4YHH F;  1PC4 A;  2VFU A;  1TKX A;  3M1V B;  2HQF A;  5HBM B;  4DSF A;  2CQG A;  2G13 A;  3JTN A;  3C6U A;  3GYG A;  4LR7 A;  5F0U A;  4B17 A;  5HK4 A;  1FKO B;  3I0S A;  3HHN B;  1IBK J;  3R5J B;  1LW2 A;  2LEP A;  4I7F B;  2KVI A;  3HVT B;  1XR6 A;  1WDT A;  1NLK L;  3CCQ S;  1BY9 A;  1RKJ A;  1N48 A;  4ELV A;  4IO1 A;  2OFH X;  2FYX A;  1U1P A;  2HLU A;  5IM0 A;  2A1B A;  4RW6 B;  2PFD A;  1Q81 T;  2CPY A;  4CLS A;  2DO4 A;  2QGF B;  3EPG A;  4ZHR B;  4DF8 A;  4IOA Q;  2XI3 A;  1PKU A;  1GFW B;  3QIP A;  1F6T A;  5JJB A;  3KKF A;  4K59 A;  5T7L B;  3MGJ A;  1FDN A;  1ZOT A;  1BQM A;  3OXF A;  5U47 A;  4Y28 C;  2YWK A;  2PT0 A;  4FF3 A;  2HGM A;  4RUC A;  3M2U B;  3QRQ A;  1RSC A;  5GMK a;  3HSJ A;  3JYT B;  3W2W A;  1VJQ A;  2WVB A;  4ES3 A;  3TYT A;  1EAR A;  2VFV A;  3BKT A;  1SJ1 A;  1DLO A;  2HVZ A;  1U48 A;  1R8A A;  5A8W A;  4NCA A;  1SB6 A;  3KMQ A;  1F5B A;  4DFM A;  3EGN A;  4TYB A;  4LQ9 A;  5MLC V;  2BM1 A;  1S9G A;  1RA6 A;  2PC6 A;  2J0Q D;  5SZT A;  1M5K C;  2KT2 A;  1IR2 A;  4WE1 A;  4TNO A;  3V6K A;  1VRU B;  5AXL A;  4J9L A;  2WBR A;  1S9F A;  1K9M T;  4X4U A;  4P2S A;  3CW2 C;  4DU8 A;  1VK8 A;  5M2U A;  3D0H E;  1YRT A;  4O44 B;  2H65 B;  3OTC A;  2GCF A;  3RBX A;  4DBQ A;  2IM3 A;  2KG0 A;  1R27 B;  4U6P A;  2JFD A;  2DEJ A;  2YX7 A;  2FQQ B;  3D28 A;  1WKJ A;  1XK8 A;  4QPT A;  4NCB A;  2ZM6 J;  3BO4 A;  2MLZ A;  4DV4 J;  3KLG B;  4LT6 A;  3F0N A;  4HR2 A;  4NZ0 A;  4ATN A;  2DGS A;  2WB4 A;  5A0Y A;  5KG6 A;  4DL5 A;  3HMJ G;  3B8H A;  4A8Y A;  5THW A;  2JJ4 D;  2P6S A;  3J80 Y;  2VON A;  4JYA J;  2AEJ A;  5LXR A;  5DLG A;  3A3O B;  5HVG A;  4GKJ J;  4Q7A A;  3NS5 A;  3DLE B;  2VBW A;  1YJN S;  2ZHB A;  2ATL A;  2VC1 A;  4LFB J;  2DGU A;  4RLE A;  3HKZ D;  5HLF A;  4MKY A;  3BH7 B;  4ERD A;  4DOZ A;  4TLQ A;  2HHU A;  1RT4 A;  3VAH A;  3PX6 A;  1URN A;  1X5P A;  4PQU B;  4GKK F;  2J6S A;  3D1H A;  4LRA A;  3Q2S C;  2UUA F;  1KR4 A;  3I32 A;  3J7Y U;  3QFH A;  3TX0 A;  4CTA A;  3OTO J;  3CCS S;  5A76 A;  4U96 A;  3TUZ C;  2YKN A;  2VC0 A;  3RTV A;  1XBW A;  2HFU A;  3CUN A;  2UXC F;  5B08 A;  3TNV A;  2DJW A;  1VMB A;  4JI4 J;  1NKB A;  3TRG A;  3NOC A;  4NLS A;  1TL7 B;  1YK9 A;  4DPY A;  1ZAX A;  5KFC A;  2BXJ A;  1XNQ F;  3NBP A;  1RHJ B;  1FJG F;  4NA3 A;  3TI0 A;  2B7C B;  1O51 A;  1XER A;  1LWF B;  3EZO A;  4P7T A;  2AJQ A;  2MKI A;  3FZB A;  3Q24 A;  4ED6 A;  3TP2 A;  1OS5 A;  1X4B A;  4FZV A;  2GGP A;  3PHT A;  5C42 B;  1VLY A;  2F7V A;  3RW6 A;  2K7K A;  4FYX B;  2QMU B;  3MI7 X;  2UXB F;  1R8H A;  4NI2 A;  1ARO P;  4FKX A;  4IG3 B;  2D74 B;  2LQ9 A;  3BYP A;  2C3O A;  4U7U D;  3RAQ A;  3WX4 A;  3H90 A;  2P5V A;  4KV8 A;  4IQX A;  4J90 A;  2B6A B;  2WVF A;  2XMJ A;  2B51 A;  3X3U A;  1OPZ A;  1QE1 B;  2LFV A;  2MEW A;  3W5Z A;  3JB9 k;  1N56 A;  2LP4 A;  3WHI A;  1M5H A;  5K14 A;  1RTD B;  3EVO A;  1FNM A;  3TJA A;  4B9L A;  4PWD A;  3MAA B;  3DHW C;  3POT A;  2P2C B;  3BSA A;  2XMU A;  2X1B A;  1R43 A;  3C15 B;  5HJY A;  1G7C B;  3J80 U;  3D4J A;  4P9S A;  4DXL A;  2N3O A;  2FPH X;  4YB5 A;  2RH3 A;  5FJ4 A;  1A7G E;  1UPP A;  5D6G A;  4PR6 A;  5LSO A;  2KO1 A;  1T9T A;  1EKR A;  3L7U A;  3RRG A;  4QIW D;  1SKR A;  2DR6 A;  2DNY A;  3ZZO A;  4LMZ A;  5MAO A;  2E1R A;  2KFN A;  2Y1I A;  4KO0 B;  3CC7 S;  4Z7Y A;  1TL5 A;  4B9T A;  2FVS A;  1SCJ B;  3AOB A;  2MGZ A;  1H7W A;  3ZZ0 A;  4CLY A;  4I2P A;  2BX6 A;  3NGT A;  5KFN A;  2J6U A;  1C4A A;  2OD6 A;  2PMH A;  3JQJ A;  3M8Q A;  4A47 A;  5H9E K;  2QLB B;  4RUH A;  2I38 A;  1JX4 A;  2NLW A;  4IYQ A;  2EWH A;  2DR9 A;  3RAM A;  2LXF A;  3HCX A;  4ZA1 A;  4EBC A;  3IAM 9;  2D3Z A;  3JQM A;  1EET B;  4AL5 A;  3R2C J;  1I94 F;  2WVC A;  3BBF A;  3LWL A;  2YKM A;  3LOU A;  3NKY A;  3ULH A;  3DLL Q;  2GVZ B;  4Y2K A;  5IZH A;  2UU9 J;  2V2K A;  4P52 A;  3MEK A;  3FBE A;  4A8Q A;  1WG1 A;  3E3X A;  4QOT A;  2W9A A;  5J2Q A;  3MTJ A;  1N33 F;  4DR6 J;  3QGI A;  3RRK A;  3LP0 B;  1BWE A;  2JHE A;  3TOQ A;  4DV6 F;  5J2N B;  3IN5 A;  2Y1R I;  1ZPV A;  2DIU A;  3LO3 A;  1C2P A;  2QTW A;  3GCW P;  4DCO B;  2HHH F;  2BDP A;  3QPI A;  1APS A;  3BGL A;  3GG1 A;  4B3S J;  2AZ3 A;  1ZS6 A;  5J2M B;  1SJF A;  1UEK A;  3TAM B;  1MU2 A;  3A8K A;  2HGL A;  4KGX B;  5H9E J;  1FHT A;  1F5A A;  2HYI B;  2KM8 C;  4D3H A;  3QFW A;  3CVK A;  2XG8 A;  2AYM A;  3TA1 A;  2MLY A;  3VAI A;  4OX8 A;  2YNH A;  2B4V A;  3VAJ A;  3M2V A;  2VG7 A;  4CRJ A;  2JLG A;  5K20 B;  3D67 A;  3FBB A;  3FRY A;  3PXG a;  2AV5 A;  4DLE A;  4UZB A;  4ED5 A;  1QLN A;  2DD8 S;  4I1T A;  1YBA A;  3VGT A;  3UD3 P;  1NDL A;  4DR5 F;  5B0C A;  1CG2 A;  1A0O B;  1HYS B;  3AA8 A;  5L1L A;  1RP5 A;  4ZP7 A;  4L76 A;  2NZ4 A;  4WP3 A;  2OPS B;  2F8H A;  3J81 j;  1KHV A;  2UVW A;  3HJF A;  3SFG A;  3CC4 S;  1S6P A;  4QW8 A;  5H9F J;  2HVH A;  4ZVF A;  3MM5 A;  1ZTT A;  3UNG C;  2OPP B;  4Q0B B;  5B0G A;  2GMJ A;  4B9M A;  2JWN A;  4OI6 A;  2KXF A;  2C2K B;  2KZZ A;  1SH2 A;  1VIS A;  3RB3 A;  3PR5 B;  1FJG J;  2XNQ A;  5KG7 A;  1XMB A;  4QR0 A;  2PGC A;  2EC2 A;  1VCT A;  2IBO A;  4DQI A;  1YJU A;  4AXJ A;  4JI2 F;  3W5X A;  4BDP A;  1VJW A;  3HHL C;  3T9N A;  2LLZ A;  4XDC A;  2PEB A;  2BAN B;  2EFQ A;  1FRH A;  5E3A A;  4IOB A;  2HVD A;  4DN9 A;  1T05 B;  4WJB A;  1KKH A;  1KN6 A;  3GIK A;  2NYH A;  2J7K A;  1RWO B;  2C2O B;  2E1A A;  4JV2 A;  1IWG A;  1DZ5 A;  1T11 A;  4R8U B;  2NXE A;  1X4F A;  1NK7 A;  4Q2L A;  4BC7 A;  2CAD A;  2XTJ P;  2HQI A;  4LF4 J;  4ZP8 A;  3KK3 A;  4A8F A;  4G1Q B;  3QJP A;  1C1B A;  4R0E A;  5K5M A;  2D3U A;  1Y11 A;  2V2Z A;  4JI8 J;  3BDP A;  4FS2 A;  2CYY A;  3NEK A;  3N28 A;  4J9U E;  3R27 A;  2BQ3 A;  6AT1 B;  5D4O A;  4MKA A;  3K5L A;  3DOK A;  1EHW A;  4Y2A A;  3G87 A;  2IY5 B;  2RDD A;  2CAJ A;  1HQU A;  1QVG R;  3MMB A;  1B0V A;  2DGX A;  3PYD A;  2KB2 A;  3CE8 A;  3BV8 A;  2R7R A;  4M5K A;  1RTJ B;  4I6A A;  1TMJ A;  3VF0 B;  3V6J A;  1VK3 A;  3SIP B;  1PYS B;  1Y3K A;  1S4E A;  3QO9 B;  4O3P A;  4NZ7 A;  2HHV A;  4DL6 A;  2YNF B;  5KFD A;  2F4V J;  5FLX Y;  1JLG B;  3GIM A;  2FZC B;  2EFP A;  3HHD A;  2NSC A;  5L46 A;  2JRS A;  2PN6 A;  4J9S A;  4WXO A;  2YX4 A;  3ENA A;  1HQE A;  2VG5 B;  2XYG B;  3OFH A;  5LMU F;  3FSY A;  3HSD A;  4EZ6 A;  2RRA A;  4NYZ A;  2OEJ A;  2HVE A;  2M5Y A;  3MMA B;  1MML A;  2EW9 A;  3SQG B;  2CZV C;  5C24 B;  1GXU A;  4MT1 A;  1K47 A;  4RX6 A;  1M5S A;  3MR3 A;  3OPK A;  4RJV A;  2V9W A;  5F8G A;  3HHL A;  1FWK A;  4MIW A;  2F5G A;  4IRD A;  3FCW A;  3IWX A;  2BE9 B;  2GO9 A;  1VFJ A;  1RT6 B;  2XZW A;  1HHT P;  2HZV A;  3OXG A;  3SEO A;  2DVI A;  2IRY A;  4B3M F;  4ECR A;  1JIH A;  3GLJ A;  1VQO S;  1QSL A;  1J5E F;  2KJW A;  3OUY B;  3E01 B;  3ZTQ A;  4EU0 A;  1M1H A;  1SV5 B;  3LP2 B;  4WU3 A;  3RB4 A;  4DR2 J;  3R97 A;  1N34 F;  3T1H F;  2HFV A;  3UNY A;  4ECY A;  4JV0 A;  3PO4 A;  1E6V B;  3GR0 A;  2CJA A;  1J5O B;  5CQG A;  4F0K A;  3H0P A;  2VBZ A;  5KG4 A;  1R8P A;  1S99 A;  1HR0 J;  4MKB A;  3Q8R B;  4DV6 J;  1JB0 C;  2RIL A;  3HT0 A;  4IG0 B;  1KNZ A;  3M8Z A;  2MQN A;  3UO0 A;  5F3Z A;  1MMN A;  4F26 A;  3L7P A;  2ROP A;  2VL1 A;  3PCO B;  4LRC A;  2H1Y A;  1YHQ S;  3HVR A;  1UVN A;  2PA8 D;  1F9H A;  1SH3 A;  4OI2 A;  5F3T A;  1U2R A;  4WXW A;  2WCX A;  3UN3 A;  3KK1 B;  3N4W A;  3VHQ A;  2HFS A;  3WX8 A;  1VQL S;  3CDU A;  1FRJ A;  2LMI A;  3NXZ A;  2LVW A;  2RHS B;  4H4O A;  2VPY B;  1GTE A;  2HUR A;  2CPH A;  2GQC A;  4LVO P;  1TMM A;  2JZ5 A;  2YY3 A;  2UV8 G;  5KFO A;  4O3S A;  1UVJ A;  1F9E B;  4L6V 3;  2GML A;  2EG1 A;  3D0G E;  2BUN A;  1BE4 A;  5KFK A;  3G8Q A;  4WFN Q;  1HIY A;  1S6Q A;  5HAT A;  2JVR A;  4ES2 A;  4M1K A;  5FLX U;  2JOQ A;  2HNZ B;  2JVO A;  3MOZ A;  1RWX B;  4YY3 F;  1E6Y B;  2CPF A;  3IWL A;  2RIJ A;  3DGP B;  4EO8 A;  2ZFH A;  1CS4 B;  4PUO A;  2V4Q A;  1C1C A;  1HNI B;  3A13 A;  2Y1J A;  3DI6 B;  4F4K A;  3L7O A;  1LW0 A;  2FHJ A;  3L09 A;  1OJ4 A;  1S59 A;  4JP8 A;  4X65 F;  3EZU A;  2KKH A;  5CZX A;  4XIU A;  4Y6I A;  7FD1 A;  3CJ2 A;  1HNZ J;  1AXQ A;  4UY8 T;  4UST A;  5EX3 A;  5EDW A;  4OZ3 A;  1FRL A;  4USW A;  4DHV A;  2I5J A;  3CXC R;  2C2E A;  4J7C A;  4BBY A;  1SC1 B;  4OX9 J;  1IKX B;  3W60 A;  5IT0 A;  1YX2 A;  2O01 C;  3RAX A;  3SCJ E;  1CJK A;  2YWE A;  4EYH B;  3N5F A;  1LFP A;  1Z2L A;  2XBP A;  4URQ U;  2MZT A;  3MMC B;  1FNO A;  2CIM A;  1VQ6 S;  1ACM B;  2CQ3 A;  4C0O C;  3S8S A;  3HZE A;  1KTV A;  1YIT S;  1HI1 A;  3RR7 A;  2GQ2 A;  5A6P A;  2XMA A;  5C25 A;  3RG6 A;  2B0G A;  2XI2 A;  3MM8 B;  3IC1 A;  4J9N A;  2VPX B;  3T5H A;  3HKW A;  1TUV A;  4DQP A;  1U1K A;  3K5N A;  4JI3 F;  2DNP A;  2ZJQ Q;  4WKR A;  1PO6 A;  4DMZ A;  3T3F A;  4C48 A;  3I0R A;  3M6U A;  4DN0 A;  2RAQ A;  1XMO F;  2FLO A;  2PD1 A;  1JLQ B;  2HWT A;  3LAL A;  3EVM A;  2GJF A;  4L72 B;  2QG9 B;  2Y8Y A;  1H2V Z;  1PAE X;  3BN4 A;  4LF6 F;  5HRO A;  2WSC C;  4RO0 A;  2FHO B;  4EFA C;  5KFF A;  3A3N B;  2HNY A;  4ZOS A;  3KDO A;  2QA1 A;  3M8S A;  1NPP A;  1QY7 A;  4F4Z A;  2CQH A;  1HBN A;  2A10 A;  3D7S B;  1ELO A;  2OAU A;  2D9O A;  3I5B A;  3MUR P;  4L74 A;  3ITH B;  2W9B A;  2OMO A;  2Z4P A;  2ZNZ A;  3DRY A;  3DLH A;  4ILM A;  3SCI E;  2WVE A;  4EMD A;  1S1W B;  1V9O A;  4LIR A;  1BXN A;  1IQZ A;  1XR7 A;  4RPF A;  1V6H A;  3RR8 A;  5B0A A;  4MKV A;  1YSJ A;  4NML A;  1UVI A;  1LWE A;  2D69 A;  5HO4 A;  3C66 A;  3DLK A;  3N9U C;  2H9Z A;  3I56 S;  4ZVO B;  1X9W A;  2DPI A;  2VOP A;  1LEO A;  2FLP A;  4QR1 A;  1H3D A;  4J9Q A;  1X5O A;  4B3R F;  2IVM A;  1TP7 A;  2A6O A;  3SCL E;  4C8K A;  1IBM J;  2KFZ A;  2PO4 A;  5KAK A;  5LOQ A;  1FKA F;  1CUL B;  1VQS A;  4IFY B;  3DRR B;  2LKZ A;  3OHA A;  1R8B A;  3AQO A;  1FXD A;  1VQ4 S;  2ZH4 A;  3LGM A;  4B02 A;  3AJD A;  1VRQ C;  1Q53 A;  2C2N A;  4HI1 A;  3BSN A;  3R7N B;  2JDJ A;  3KJF B;  3KUE A;  3LGN A;  3HSG A;  1YRX A;  2K1R B;  4QQB A;  2VFR A;  1S77 D;  2B4U A;  3LH2 S;  2E5H A;  3DOM B;  5A8K A;  1M90 T;  4OI1 A;  1R0B G;  5DDR C;  3BRE A;  4LF5 J;  2DHS A;  1UW4 A;  2RJZ A;  1RT3 A;  4QWA A;  2BBE A;  4F25 A;  2JEJ A;  3MEE B;  2KRB A;  1J5E J;  3G71 S;  3BDE A;  3HK2 A;  3GZ7 A;  1X0P A;  3CJS A;  4ANE A;  4QCL A;  4RW6 A;  4ZLP A;  3MZI A;  4B3T J;  2C2Z B;  1NXI A;  2EI5 A;  3CO9 A;  1TKX B;  4ZHR A;  4MH8 A;  1HBU A;  2IAJ A;  1S0O A;  2CQI A;  4KH1 B;  1S9E A;  3HP6 A;  3C6U B;  3ONQ A;  4KPC A;  2XLJ A;  4MAK A;  4G1P A;  1Z2Z A;  3AD9 C;  5E2Q A;  1NK4 A;  4P74 A;  3V6H A;  3HF5 A;  1LW2 B;  5ETR A;  2J7U A;  3DM2 B;  2NCK L;  4Y34 A;  3KUG A;  4C97 A;  1LK7 A;  2AJ4 A;  4K0K F;  2LEC A;  3UDC A;  5IM0 B;  3M2U A;  3NRB A;  3OJS A;  4J9M A;  3JYT A;  1SQF A;  2DNO A;  4ZPD A;  1JJC B;  2FLL A;  2J9D E;  1NB7 A;  1B70 B;  1ZAW A;  1U1L A;  2J0W A;  4M5H A;  2IRX A;  1RAA B;  4I2Q B;  1I1G A;  2NUU G;  4MFB A;  2HK2 A;  1BQM B;  2U1A A;  3K5O A;  4ETZ A;  2CVI A;  2RRN A;  4DUT A;  4WFB Q;  1D09 B;  3SQO P;  4O44 A;  2VFS A;  2HVI A;  3W2W B;  2ZVS A;  3OTB A;  4PPD A;  4F67 A;  5I3Q A;  4DV3 F;  1ZAV A;  3G9C A;  1MSW D;  1DLO B;  2NRE A;  4HKQ A;  5A8W B;  1DRZ A;  4K2X A;  2KT3 A;  3I6P A;  2QMW A;  3IXQ A;  1S9G B;  3F41 A;  3A4T A;  4ZCL A;  5AE1 A;  1S76 D;  2YWF A;  1J2V A;  2DCL A;  5M2P A;  2LQ5 A;  3B82 A;  3W7B A;  5HVH A;  5JVH Q;  1GMV A;  2HQD A;  3ISN C;  2FC8 A;  2WHO A;  4D3G A;  2RU3 A;  3EXC X;  5A2Q Y;  4NLY A;  1UPM B;  4FNI A;  1L3V A;  3N6M A;  1LWX A;  3QSI A;  1KS2 A;  3G2X A;  3SDE A;  1N36 J;  1UVM A;  5DZ6 A;  2LCW A;  4C8O A;  5A0Y B;  2CPX A;  3DLG A;  3ICL A;  2QFI A;  4IO9 Q;  4TU9 A;  3EXY A;  1JLC A;  2BOA A;  1SJ4 P;  2GA7 A;  1PGZ A;  1O8B A;  3IG1 A;  1NSA A;  1OY6 A;  2YNI A;  4OL8 A;  3AQP A;  5E3P A;  1N5Y A;  3CD6 S;  2E9R X;  2W8K A;  2B7B B;  4RZR A;  1XTZ A;  2O3D A;  2AU0 A;  1JMT A;  1XMO J;  5HLF B;  4DV5 J;  3RW7 A;  4AQY F;  2CKW A;  4ED2 A;  2ZZN A;  3AD7 C;  3ZC4 A;  2CDR B;  2IA0 A;  1H74 A;  4O23 A;  3FSI A;  4UOC A;  5E0O A;  1RT4 B;  3IRX A;  3AXK A;  2SXL A;  2HPU A;  3SSQ A;  1IBL F;  2XS7 A;  4JV5 F;  1SQE A;  3SI8 A;  2RRB A;  3FCV A;  3IWN C;  3VAG A;  5EWG A;  5CZV A;  1O6X A;  4W98 A;  3BGR A;  3UD4 P;  4NXN J;  4CTA B;  3RBE A;  2V8H A;  3GTY X;  1UA1 A;  2YKN B;  1RYS A;  2E5G A;  1U1M A;  2X1F A;  4BHQ A;  3QRR A;  4IH6 A;  2B8Q A;  3JAM Y;  4K5S A;  4LBI A;  2F1F A;  4HLB A;  2RQM A;  5C7P A;  4LF9 F;  3HPO A;  5D0H A;  3NBP B;  4FKY A;  4KY3 A;  4I64 A;  3HLU A;  3B4M A;  5J1P A;  4O3O A;  2N4D A;  2IHR 1;  4LFC F;  1I5O B;  2FJE B;  5I42 B;  1B0T A;  2Z58 B;  3A3P B;  4QPX A;  4XPE A;  4XK8 C;  4LFA J;  4OQJ A;  1RAH B;  2GHV C;  5CCL A;  4EGL A;  1S48 A;  5KOX A;  1JLB A;  4NI2 B;  4ED3 A;  1UW9 A;  4P6Q A;  1H2U X;  3G96 A;  5A2Q U;  4J9P A;  4IH5 A;  4KV8 B;  2AYG A;  4V19 J;  4OZ1 A;  3LAN A;  1TQL A;  1WOO A;  2WTF A;  3QT8 A;  4F4Y A;  1RT2 B;  2ZOM A;  1PG5 B;  1SVD A;  2V8G A;  2E9Z A;  5K14 B;  5I3P A;  3MUV P;  4CQ1 A;  4PWD B;  3SSR A;  5CXT A;  4NLR A;  3POT B;  3FBC A;  3B6B A;  2DGV A;  3CT9 A;  2NXN A;  2MQ8 A;  5AT1 B;  2R7T A;  3KJV A;  1KVJ A;  1U25 A;  4OZL A;  1LWC A;  4U8V A;  4RU2 A;  4NL5 A;  3TZW A;  5AE2 A;  3FZ2 A;  4PG5 A;  1ZET A;  1HWI A;  3ZTP A;  1P1T A;  4KRW A;  2GX8 A;  4ALZ A;  4ID5 A;  1X4H A;  2VDI A;  3PEJ A;  3EM1 A;  2OO4 A;  4OI0 A;  2G2Y A;  1U26 A;  2DNK A;  1RT1 A;  5EN1 A;  2MGZ B;  3QT7 A;  2XM3 A;  4I2P B;  3TVY A;  3A12 A;  2NXC A;  3D1O A;  3M8Q B;  3M6W A;  4YEA A;  3VAF A;  1UTA A;  2A0F B;  3GJT B;  4DZD A;  2VQF J;  2AYB A;  3HX9 A;  3NCR A;  2XUL A;  4N77 A;  4ZVS B;  1N5V A;  1YJT A;  3IP0 A;  2DNN A;  2Y0B B;  4HL9 A;  2CNK B;  3JAM U;  3MUM P;  4ZCM A;  4X66 F;  3PKM A;  2YH1 A;  2W1B A;  2IJR A;  2IRU A;  2V8V A;  2O1P A;  1KWM A;  2XB2 D;  1WG5 A;  5ETN A;  4L3N A;  5D4P A;  1EAY C;  5JVG Q;  1T9U A;  3V2U C;  2YKM B;  3D6F B;  4ZCK A;  4WKY A;  3PJX A;  4DV3 J;  2D7S A;  1YRU A;  3M2R A;  2IBK A;  2OLW A;  3HHE A;  3PZP A;  4NZ6 A;  3BS9 A;  4C3M A;  1XMQ F;  1NDC A;  2OP5 A;  2XWX A;  3VWS A;  5E7O B;  4WFX A;  2BJ9 A;  1B7Y B;  1LV5 A;  2DRA A;  2QSF A;  4X4V A;  3PKY A;  1U8S A;  3CMQ A;  2DXE A;  4KHP F;  2HKE A;  5DZ7 A;  3PDN A;  3V5R A;  4KQZ A;  3J7Z 5;  3RB6 A;  1OSC A;  5KFS A;  3NL0 A;  3FK4 A;  2EFG A;  3VGS A;  1Q86 T;  2XLI A;  4F7V A;  2KU7 A;  1U1R A;  2DHG A;  5L9X A;  4O3R A;  3RZA A;  2DNQ A;  3RU0 A;  2IJF A;  1P27 B;  1MU2 B;  5KTQ A;  2BR0 A;  1VBX A;  1FI4 A;  4LF2 A;  2V4R A;  2NSB A;  4FF1 A;  2GNK A;  5C5J A;  3G82 A;  1TL1 A;  1ZM2 A;  3MDF A;  3CCR S;  3MHY A;  1XEZ A;  2ZJR Q;  2OIH A;  2YNH B;  3HFK A;  3Q0A A;  4S0M A;  2RE1 A;  3CJ8 A;  3JS9 A;  4HTI A;  1U1O A;  4DV7 J;  4YQW A;  2AEF A;  2VG7 B;  1KQS R;  2CPI A;  3IA0 A;  2ACY A;  1PSD A;  2QN6 B;  4DPW A;  1JXV A;  2L41 A;  1XQI A;  1FVS A;  1U4B A;  1FTR A;  1WOR A;  1TK8 A;  4UTG A;  2M0G B;  4WK1 A;  4JI7 F;  4TU8 A;  4NLO A;  3G6Y A;  1HNV A;  3ZNU A;  1RBO B;  2DH9 A;  4TN2 A;  3LW5 C;  4JI6 F;  3GFY A;  4LQ3 A;  5HAN A;  3GSI A;  5KFV A;  3OVS A;  1YQH A;  4TYA A;  1R7I A;  1U0H A;  4Q43 A;  1S5Z A;  1JLA A;  1JQG A;  4DR3 F;  2EPI A;  2CJQ A;  2MDA A;  5EUH A;  1S6P B;  2EK1 A;  4K5R A;  4F4X A;  4LSL A;  4USI A;  3MM5 B;  2XSF A;  1RCO B;  3OHB A;  2VKZ G;  2YTC A;  5IV3 A;  1M1K T;  3IM8 A;  2BRK A;  2OPR A;  2BA9 A;  3T5K A;  3OR1 A;  1T02 A;  5F8N A;  1S7I A;  3R5G A;  2AJ2 A;  2I8E A;  2HQG A;  1YJR A;  3MM7 A;  3SV4 A;  3TZX A;  1QTN B;  1XNR J;  4KSE B;  4WP8 A;  2ZH8 A;  1BHN A;  3DHX A;  5KG5 A;  2EFO A;  1YI2 S;  2JLF A;  3CCT A;  5IT9 Y;  3W5Y A;  1LNQ A;  5B0D A;  1UEU A;  1AUS L;  4LRF A;  2VBY A;  4IDK A;  1CJU A;  5KT6 A;  4OYO A;  2X51 A;  2KM8 B;  1FRK A;  3S1T A;  2R4F A;  3K5M A;  3D3B J;  1SJ3 P;  1SIW B;  2E7W A;  1RHM B;  2CWX A;  3HFZ B;  1NAQ A;  4CO1 A;  3FFI A;  1LQ9 A;  2FJX A;  1C1B B;  1H2T Z;  2AJ1 A;  2AWZ A;  1N0V C;  4C2M A;  5ETP A;  1WD6 A;  1X31 C;  4DUY F;  4R0J A;  2Z57 B;  1MRO A;  1KTQ A;  1NCL A;  3DYA A;  3DOK B;  2R2U A;  4HAC A;  1RE1 B;  2A6M A;  1HQU B;  3MMB B;  5KT2 A;  4DPX A;  2HFZ A;  4CDI A;  3C3L A;  1HNX F;  1MWZ A;  1TK5 A;  3EWG A;  2G0C A;  3SQG A;  4PXB A;  5ETO A;  1WF1 A;  2L9N A;  5FDL A;  3FEZ A;  3GYN A;  4LJM A;  2YKQ A;  5K8O A;  2JNJ A;  1S1U A;  2AX1 A;  1TK0 A;  4X4R A;  5F8M A;  1U6F A;  4B9N A;  4FYW B;  1HBM A;  4JI1 J;  2B43 A;  1UET A;  4HVZ A;  3H98 A;  1EB0 A;  4EWT A;  4KGZ B;  1HQE B;  1GEH A;  7AT1 B;  2M7S A;  2CVE A;  5CCM A;  1LFW A;  1RK8 A;  3BKF A;  1IM4 A;  4HH0 A;  1JKH A;  4NMX A;  3HD2 A;  2FVP A;  1Y7P A;  3CPW R;  2YQ0 A;  4NX9 A;  2VQE F;  1JJ4 A;  1UVK A;  1VIX A;  2WB1 D;  4WTO B;  3HHL B;  4FVM A;  1VC5 A;  2ZWO A;  2DIS A;  4PXD A;  3DRP A;  1G2E A;  1Y3J A;  3FSX A;  1WTB A;  1AZS A;  1SC6 A;  4IG0 A;  3J7A 1;  1IBK F;  2CQ0 A;  1HBO A;  4J9O A;  4BC9 A;  5GAG I;  3P49 B;  2LDY A;  1Z4U A;  3EX7 B;  4NA2 A;  5IT9 U;  2XY7 A;  2HMI A;  3FMB A;  1TAU A;  1VOM A;  3MR6 A;  2W24 A;  2DGO A;  1SH0 A;  3O44 A;  3CD7 A;  2PMW A;  4KHP J;  1WEZ A;  1IBC B;  1U09 A;  3OT9 A;  1VQ7 S;  4C6A A;  2CPZ A;  3PYE A;  1OO0 B;  4F4A A;  4RBT A;  3VGV A;  2XCP A;  2L9D A;  1RGV A;  2RUS A;  4M5M A;  3F56 A;  3HDS A;  3RRH A;  4CH0 S;  2PA3 A;  2UP1 A;  4FP9 A;  1E6Y A;  2JEI A;  2EKY A;  2ZIT A;  1QTM A;  6FDR A;  1MG7 A;  3OVA A;  4TLR A;  4Q2M A;  2DT9 A;  1JWW A;  2V8D A;  4H4O B;  4GMK A;  3MR5 A;  3ZFV A;  4WU2 A;  3BQ1 A;  2D41 A;  3OV7 A;  2QA4 G;  4OYB A;  4P2X A;  3KLH B;  5D77 A;  4UOH A;  4TU7 A;  3Q2T C;  2FIU A;  4EEY A;  1RHR B;  2QYG A;  1FFW B;  1S6Q B;  4ZP9 A;  2XMV A;  2HEK A;  9ATC B;  3V81 A;  3WC0 A;  2VF3 A;  1BD6 A;  2ZDP A;  2AW0 A;  3B54 A;  4I69 A;  3FVY A;  3BR9 A;  5I4M A;  1QD1 A;  4PCQ A;  4KGM A;  1SL2 A;  3CME S;  1N5Q A;  2ABY A;  2OUG A;  2YWW A;  2KJV A;  4HT5 A;  1LKZ A;  3SSS A;  1HWL A;  5HMW A;  4PUO B;  1C1C B;  3IMQ J;  3BKU A;  4DV4 F;  2W8L A;  4X4Q A;  1D9D A;  4ZKA A;  5B0B A;  5B7W A;  2K3I A;  5HL7 Q;  4P72 A;  3MPD A;  2ZD1 A;  1BMQ B;  3P45 B;  5E3Q A;  1PIE A;  4DR3 J;  2X7I A;  4FBU A;  4DV2 J;  3MWB A;  2EBE A;  1CJV A;  2CPD A;  1Y9O A;  3UI3 A;  4XO0 A;  3CIM A;  1U47 A;  3MM8 A;  2ZHA A;  4ZPC A;  3TEH B;  4O3Q A;  2I5J B;  4GKJ F;  5FII A;  2NQP A;  4DQQ A;  4ZVT B;  5HQM A;  2QA4 S;  2Q43 A;  2BJE A;  3K7R A;  4LFB F;  3GFZ A;  2F9D A;  1CJK B;  4H4M B;  1JLQ A;  4KGV B;  4ILL A;  1NSP A;  2AZ1 A;  2BKP A;  2XY5 A;  4DFK A;  3ILO A;  3O2I A;  3M9M B;  4ZP6 A;  1WEL A;  4F8R A;  2WVD A;  1YVF A;  1FJC A;  5C25 B;  3GMG A;  2C42 A;  2AGQ A;  3AFG A;  5KFU A;  3NNA A;  4NLD A;  1LK5 A;  2VA2 A;  4K50 A;  4OYM A;  3OTO F;  2HFO A;  4RNH A;  3I0R B;  2ZEJ A;  3R6G B;  3I55 S;  1TKT A;  3EYZ A;  2AQ4 A;  2ZH1 A;  2OPQ A;  4DV0 J;  4JI4 F;  1FDA A;  5D0E A;  4P73 A;  2G2O A;  3IFE A;  4RW9 A;  5KFI A;  2MLX A;  5HRO B;  4WZQ A;  4USJ C;  3CJT A;  2NXU A;  2L3M A;  5LT5 A;  3SYZ A;  1HMV A;  3HM9 A;  2LEA A;  2HNY B;  4EO6 A;  2W2P P;  3PG9 A;  3A8J A;  1YBT A;  3P96 A;  2YQ1 A;  1HBN B;  1FRX A;  5DDQ C;  3MPV A;  4WZM A;  4CO4 A;  4LF7 J;  1EJ7 L;  2Q79 A;  2W9B B;  2GQQ A;  2MY8 A;  1AT1 B;  1UCN A;  5HVF A;  4WIQ A;  2VAS A;  4M5D A;  1BQN A;  1P9Y A;  5DGA A;  4UY8 5;  4O4G A;  3DGV A;  3I9Z A;  3WDO A;  1VC0 A;  1H0H B;  2X1G A;  3CC2 S;  1XJW B;  3AB4 B;  4YOE A;  5KFB A;  2R7S A;  5L1I A;  1LWE B;  2M9K A;  4RR5 A;  5BJR A;  4Y2M A;  4DUZ J;  3DLK B;  3KHR A;  5LXY A;  2VHG A;  2XYH B;  4OZJ A;  3CCU S;  2N7C A;  4PYD A;  1V5V A;  3THP A;  3THV A;  1KSP A;  1RKI A;  3BB5 A;  2RVJ A;  2CQP A;  1HAR A;  1FRI A;  3EVW A;  1KON A;  4MTP A;  4WPA A;  4OZ5 A;  2G0J A;  4DX7 A;  2AMC B;  5B09 A;  4DR1 J;  3R5D A;  2DGW A;  2YKP A;  1Y5I B;  4OYA A;  4X64 J;  4ICL A;  4UUW A;  5HP1 A;  2CNO B;  2E5L F;  5GAE U;  1WC3 A;  2HHX A;  4DL0 C;  3D66 A;  3IBW A;  3PYG A;  1N0U A;  1CQM A;  2E9T A;  3DU6 A;  3QLH A;  2FVQ A;  3D0I E;  2MMY A;  5A8K B;  1T95 A;  3GIJ A;  2V50 A;  5LM7 E;  5KFA A;  5D4N A;  2YVS A;  1RT3 B;  4NA1 A;  3DM2 A;  2UUC J;  3GU0 A;  4K8R A;  4QZV B;  1MW7 A;  3W62 A;  2KN4 A;  4NE9 C;  1NHU A;  4F3O A;  2Y1L B;  1NUE A;  2APO A;  4DF4 A;  4WF9 Q;  4WBF A;  5GAE I;  3K5P A;  3U02 A;  1Q8I A;  2GC8 A;  3ILJ A;  1WI6 A;  5IWA J;  1HBU B;  2IAJ B;  2V67 A;  1S9E B;  2OEL A;  1RWK B;  1T8E A;  5D3G A;  2BJD A;  4CNY A;  1PJ5 A;  4I2Q A;  3NS7 B;  3QJL A;  5M2R A;  1OWX A;  3C6T A;  3SZ2 A;  2GV1 A;  3NWR A;  5J1E A;  3RBZ A;  2XMT A;  3ENQ A;  2HBR B;  3BSO A;  2LDI A;  4K4W A;  2FJB B;  5GAD U;  4ECS A;  4AYB D;  3AOD A;  2RHQ B;  2UU9 F;  1TZ0 A;  3NGS A;  1ULR A;  4P2F A;  4DSE A;  4C7Q A;  1VS3 A;  3HXM A;  4USH A;  4MFB B;  1I6J A;  1UJ4 A;  4DR6 F;  5IQ6 A;  4ZPW R;  1RIS A;  2FGO A;  2B9Y A;  2VOO A;  4BWJ A;  3QZ7 A;  2M70 A;  3F73 A;  3VVU A;  5GAD I;  1X0F A;  2FVC A;  4JI0 F;  1F3V A;  1T94 A;  2FJD B;  2ZH5 A;  2F63 A;  4B3S F;  3C19 A;  1EKS A;  1WG4 A;  4F3M A;  3PAC A;  2G9O A;  1Y4Z B;  3MR2 A;  2IDE A;  5E3C A;  1FJ7 A;  3MM9 A;  8ATC B;  3GJS B;  3JTP A;  4DSK A;  2VDH A;  1XN9 A;  1R31 A;  1K44 A;  1NU4 A;  2R7V A;  3WIU A;  4JV1 A;  2FD2 A;  2VPZ B;  4ZK7 M;  2ADC A;  3AD8 C;  4MK7 A;  3QMQ A;  2VJU A;  3TQE A;  4NRT A;  1FCA A;  3IAS 9;  5B0F A;  2WOM A;  4WFY A;  3M7V A;  4LRB A;  5ETL A;  4FNH A;  1VQM S;  1HNW J;  5HMX A;  4V19 X;  3K58 A;  3P5B P;  2J0S D;  3LAK A;  4OZ0 A;  1FRM A;  3SDE B;  4F2S A;  4GC7 A;  2XO6 A;  2RSQ A;  3DRS A;  4F0H A;  2LEB A;  3DLG B;  1NH7 A;  3LA0 A;  3NY0 A;  3KXD A;  1JLC B;  3DOL B;  2FY1 A;  1WDD A;  4AFF A;  2AJ0 A;  1S1T A;  4LSZ B;  3TA2 A;  3IG1 B;  3CCJ S;  1JJH A;  2YNI B;  1AA1 B;  3MR7 A;  3M32 A;  1N5Y B;  2BE2 A;  2R8H A;  1IUJ A;  1FWP A;  4ZVP B;  2AJF E;  4ZVU B;  4CWB A;  1RB0 A;  1FKP A;  3IRX B;  3PRB A;  1PBU A;  4KYZ A;  2MKH A;  3E51 A;  2E5I A;  1JLF A;  3IGV A;  4NPO A;  2ACM A;  8RUC A;  4GVL A;  3UQS A;  3J7Y I;  4J9R A;  5D0G A;  2R3V A;  3RJM B;  3FNN A;  2A3J A;  3BGR B;  5I42 A;  4FYV B;  4CT8 A;  1YIJ S;  3ETO A;  1RWU A;  5EWF A;  4A8K A;  5IXU A;  2GHW A;  1RT7 A;  4DL2 A;  3KMS A;  3M4X A;  5CA5 A;  3CCW A;  2CJY B;  2NUH A;  2KI2 A;  2XQC A;  2MZR A;  4E2F B;  2EBG A;  2LU1 A;  3ZZU A;  2AD9 A;  3BF4 A;  4ECQ A;  4LF4 F;  2WAQ D;  2IM1 A;  2XSJ A;  1S79 A;  1RT2 A;  5L1J A;  4JI8 F;  1EQM A;  4DG1 A;  1UL3 A;  1IKV B;  3UE2 A;  3OL8 A;  4O4R A;  2RDJ A;  4QBU A;  1WOP A;  1Y00 A;  1JLB B;  4ZJQ A;  2HND A;  2CXE A;  2YWH A;  4GRS A;  3G86 A;  2WW8 A;  4N7T A;  3MF5 A;  4I0W A;  1XIQ A;  5E3R A;  4WTY A;  5K9F A;  2E5L J;  1I51 B;  4CP5 A;  1RT5 A;  3TAQ A;  1S10 A;  1U49 A;  3J7Z T;  1T9V A;  2F4V F;  2F40 A;  4IRC A;  2IJN A;  4U7C A;  2NZC A;  1AYE A;  5HJX A;  2ALY B;  2GVD A;  3KK2 B;  2J9D A;  3DMJ A;  5AJ3 J;  3CO0 P;  1N8R T;  2CJB A;  3KJN B;  1FXR A;  5CD4 A;  1NSQ A;  5FD1 A;  1Q7Y T;  2C3P A;  4FF4 A;  3KJV B;  2CJX B;  2HG4 A;  1TV6 A;  2JH3 A;  1LWC B;  1SC4 B;  2GS8 A;  3UVJ A;  5T41 A;  5J2P A;  5J1N A;  2POK A;  1A6L A;  4ID5 B;  2H4W B;  3NNH A;  2MQO A;  3OL7 A;  2QRR A;  2C22 A;  2DEI A;  5DLF A;  1X60 A;  1YJW S;  3MEG B;  3G6V A;  3UR0 A;  1W2I A;  4ETX A;  2W4C A;  3KUH A;  3OD2 A;  4HHU A;  4Z2X A;  3HHL D;  1C0T A;  2XMW A;  1RT1 B;  3D6M B;  1B4S A;  1LOU A;  1QAY A;  2CFX A;  2E5J A;  1UEV A;  3BM7 A;  4Z37 A;  4WWS A;  4Y65 A;  4KE5 A;  2MKK A;  3KYL A;  4OHW A;  4TKT A;  5KT3 A;  2BAC A;  2RF2 A;  4DR2 F;  2IC3 B;  1W2B R;  1HHQ A;  3CTR A;  3CJ3 A;  5D78 A;  3T1Y J;  2ZBQ A;  2O5D A;  4TY8 A;  3IS9 A;  2MSS A;  1NKC A;  4KC5 A;  3ZTR A;  1ICE B;  2CG8 A;  1HR0 F;  4KHR A;  4PAA A;  5ITH A;  1F1B B;  5HN0 A;  4ECZ A;  2QX0 A;  2QL9 B;  4IFV A;  4LVN P;  4O0N A;  4JI0 J;  1Y10 A;  5LL6 d;  3AA9 A;  2M8D B;  2YPZ A;  3M2R B;  4EI2 A;  2HRT A;  4LR8 A;  3CDE A;  4PG6 A;  3QID A;  1NK9 A;  1L5U A;  4USV A;  2DNM A;  3IR5 B;  5IQQ A;  1CEZ A;  1NRK A;  3P5T L;  2R8K A;  1S49 A;  2MKS A;  2RML A;  3TVK A;  4FN5 A;  5D15 A;  2QLW A;  4OV6 A;  2XZD B;  4KTQ A;  3RUB L;  1FK9 A;  1REV A;  5GME A;  5K8P A;  2ILZ A;  1QAJ A;  3DLB A;  1VRT A;  2JC0 A;  2ROE A;  4Y0F A;  1B0P A;  2HW3 A;  3KLV A;  2JEF A;  1NME B;  3UDL A;  3S7R A;  1S1X A;  3SV3 A;  2OSQ A;  3G82 B;  1TL1 B;  2MST A;  3DFE A;  4ES1 A;  2V94 A;  4RKU C;  2EC0 A;  4RBU A;  3WBZ A;  3CD0 A;  2QMX A;  2DCU B;  3K0J A;  1U8W A;  2B9W A;  3BN7 A;  1GQE A;  3N79 A;  2JC1 A;  5D8H B;  3AH6 A;  1B64 A;  2I0X A;  1WC1 A;  2B4O A;  3C2P A;  4AD6 A;  1HNZ F;  2ZC4 A;  4Y00 A;  3M9N B;  2ILY A;  3FCH A;  2DNG A;  4UUX A;  1OY8 A;  2X1A A;  4KH0 B;  4KT0 C;  2HQC A;  2JLE A;  1FER A;  4OX9 F;  1VI7 A;  1HNV B;  3D5M A;  3V4I A;  1KVK A;  4V1A k;  2MQP A;  4ECX A;  1RJJ A;  1FA0 A;  4E98 A;  1ZM3 A;  1TUW A;  2AX0 A;  3VV2 B;  4Q44 A;  1N52 B;  3NOG A;  4Q5V A;  1K1S A;  2N82 B;  1FEH A;  3GE9 A;  1RU1 A;  1U0H B;  2BOP A;  5KFY A;  1JLA B;  1RTZ A;  3GB0 A;  1WAC A;  4ZJO A;  5DG8 A;  1C4C A;  1TVR A;  3MCO A;  4LSL B;  3UCG A;  2R8J A;  1X4A A;  2GHP A;  4OX6 A;  3KTQ A;  1FDD A;  3SFU A;  4F3Q A;  4Z7C A;  5KT4 A;  2OPR B;  3ZZP A;  2R2R A;  5IV4 A;  1NK8 A;  3OR1 B;  4CLK A;  1DBD A;  5K8N A;  3G6E S;  4AND A;  2BJ8 A;  2GO8 A;  3I87 A;  2VD3 A;  3UPF A;  1U45 A;  1F0X A;  2FHK A;  2FZG B;  2OTL S;  3IGN A;  5EX0 A;  3MM7 B;  3HD1 A;  3HFV A;  4I68 A;  4J9V A;  4C11 A;  4M5N A;  2DNZ A;  2VFT A;  1RAE B;  4ZIW A;  2R7X A;  1JNR B;  3ZZZ A;  1S6O A;  1R0A A;  4Y2C A;  1BC6 A;  1QAX A;  2ZBR A;  3QQC D;  4ITS A;  2MKC A;  4DI6 A;  4JOU A;  4IDK B;  1CJU B;  4A4J A;  3ADA C;  2CNN B;  3NAI A;  4C0B A;  1RHU B;  2DB1 A;  3CF5 Q;  1UFL A;  1KQK A;  2RS2 A;  1WTF A;  3LF0 A;  2UXD J;  1FWL A;  3HSZ A;  3VAL A;  1UFK A;  3W2V B;  3K59 A;  3FFI B;  1Q95 G;  1QSS A;  1TFY A;  3BO2 A;  3QGH A;  2BJ1 A;  4ZCI A;  2ROG A;  3Q23 A;  3Q86 A;  2E1C A;  2F9J A;  2HAF A;  1MRO B;  4QU6 A;  4O0I A;  4YB6 A;  3DYA B;  1N6Q A;  4UQG A;  1IBM F;  5ETV A;  4HAC B;  3TJ8 A;  4DV1 F;  4AT1 B;  4X4N A;  1X5T A;  4R5P A;  1CQN A;  2D1C A;  1S97 A;  4JB8 B;  3R5C A;  3VZI A;  1X4G A;  2O66 A;  5FDL B;  1U6B A;  2DTJ A;  3DN9 A;  1EP4 A;  2MJN A;  3BSC A;  3UN5 A;  1S1U B;  2V8P A;  4B9S A;  2Z56 B;  3CJ5 A;  1HBM B;  3IR6 B;  3NMR A;  4NLQ A;  3CCM S;  3FUY A;  2HS0 A;  2ASD A;  4LF5 F;  3DCA A;  4YP3 A;  3I9V 9;  3I4P A;  4CM2 A;  2PMZ D;  3OLB A;  4I56 A;  2NPF A;  4QWE A;  4OV1 A;  4LF8 F;  3IRW P;  1JKH B;  1KC8 T;  2VOD A;  2J0X A;  4B3T F;  2V4J B;  1VBY A;  2H4Y B;  2DHA A;  1YZ7 A;  3R1L A;  4KJI A;  2D9P A;  2V63 A;  1VBK A;  4N5S A;  3KLI A;  1WWH A;  2HK3 A;  2V2V A;  3ZZT A;  3OL9 A;  3DRP B;  4MK9 A;  1L3K A;  2IYI A;  1AZS B;  5DG7 A;  3W65 A;  3H2V E;  5L38 A;  2VU5 A;  1HBO B;  2RD5 C;  2BW2 A;  4Y3C A;  2IM2 A;  1CC7 A;  2A2D A;  5DQH A;  3MCS A;  2GJI A;  4UOF A;  1TL4 A;  3PFE A;  2HMI B;  4YB1 P;  4J9K A;  1X4D A;  3ZZY A;  3FGV A;  1QSY A;  2HHT A;  4QIG A;  2H5J B;  3PX0 A;  4PRF A;  2Q6C A;  4RUB A;  3CJK A;  2K06 A;  3JSR A;  2XHW A;  3KLH A;  1YJ9 S;  2UUB F;  2K7J A;  3H5Y A;  2C3M A;  1EQ0 A;  2Y0S D;  2IDL A;  4DX6 A;  5IC6 B;  3NGR A;  1VDH A;  1UKU A;  1UFW A;  2OHD A;  2W7A A;  4PQA A;  4F02 A;  1WC0 A;  4NYP A;  3MEC A;  3D6H B;  2RNE A;  1OQ3 A;  4QIV A;  4JI5 J;  1N5S A;  2VV5 A;  3LPE A;  1TL3 A;  4AXI A;  3SXL A;  1DQA A;  3AOA A;  1SXL A;  1RWP B;  4ED7 A;  2U2F A;  1HFE L;  4U67 Q;  1VLO A;  3KG0 A;  4IUF A;  5L8R C;  3SCK E;  3PW4 A;  3V81 B;  3QNW B;  1M5V C;  1H73 A;  4I6W A;  5C2G A;  4M95 A;  1GMW D;  1N32 J;  3OBI A;  3JSY A;  2M3D A;  2DRB A;  4ZIT A;  2E66 A;  4ANC A;  4H4M A;  3MXH P;  2ASY A;  1N36 F;  3MFI A;  1R3N A;  3EGW B; 
#chains in the Genus database with same CATH homology
 1RAO A;  3ILJ A;  2F63 A;  4PZV A;  3MCM A;  1EX8 A;  1EQ0 A;  4F7V A;  2F65 A;  2BMB A;  1HQ2 A;  3QBC A;  4M5L A;  5ETL A;  3KUE A;  5ETV A;  3HCX A;  3UDV A;  4CYU B;  3MCO A;  4CRJ A;  1RU2 A;  1G4C A;  4CWB A;  3HSG A;  5ETO A;  1RU1 A;  3HSD A;  3HT0 A;  5ETM A;  3HSZ A;  5ETQ A;  5ETT A;  1F9H A;  3KUH A;  5ETR A;  3ILL A;  1RB0 A;  3HD2 A;  5ETS A;  1KBR A;  2CG8 A;  4M5I A;  1DY3 A;  4M5H A;  4M5K A;  3IP0 A;  4M5G A;  1TMM A;  4CYU A;  1RTZ A;  3HD1 A;  1HKA A;  3KUG A;  4M5M A;  3ILO A;  3HSJ A;  4M5J A;  3UD5 A;  1IM6 A;  5ETN A;  1TMJ A;  4AD6 A;  1Q0N A;  1EQM A;  1CBK A;  3MCN A;  4M5N A;  5ETP A;  3ILI A;  5ETK A;  2QX0 A;  3UDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...