1IM6A

Crystal structure of unligated hppk(r82a) from e.coli at 1.74 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGAVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1im6A00
5ETSA 3ILLA 4M5HA 1TMJA 3KUGA 3HT0A 3QBCA 5ETMA 2F65A 3UDEA 4CYUB 5ETNA 3UD5A 2QX0A 1RAOA 2BMBA 3HCXA 3MCNA 1RB0A 4AD6A 5ETLA 4M5LA 3UDVA 4PZVA 1F9HA 1KBRA 4M5IA 1TMMA 4M5JA 4M5NA 4CWBA 1IM6A 1RU2A 3KUEA 1DY3A 2F63A 5ETQA 1RU1A 3KUHA 4M5KA 4M5MA 1G4CA 5ETRA 5ETTA 1EQ0A 5ETPA 3ILOA 3HSDA 3HSJA 4M5GA 1EX8A 4CRJA 1Q0NA 3ILJA 5ETKA 1CBKA 3HD2A 3ILIA 3HSZA 1EQMA 2CG8A 4CYUA 1HQ2A 3HSGA 3MCOA 1RTZA 5ETVA 3MCMA 3HD1A 3IP0A 4F7VA 5ETOA 1HKAA
chains in the Genus database with same CATH superfamily
1EETA 3N79A 4LR8A 2HNDB 3AY0A 2FVRA 1S76D 1F5CA 1U7LA 3M2RB 3HHLB 3N9UC 2W8KA 3QJPA 2RUGA 4RBUA 4YHHJ 1DRZA 2GQQA 3DOMA 2HQCA 2H51B 1XR5A 3GFXA 4DG1A 2QYGA 1JLGB 2G9OA 3A12A 5KG2A 1NKCA 5FJ4A 5IWAF 4PG7A 4HEA9 2E66A 2LU2A 2VPZB 3CEDA 3GMGA 3QWPA 2CQGA 3D6FB 2WBMA 1F5BA 4Y6IA 4OZ0A 3NL0A 1OY9A 2XLJA 1PO6A 1P27B 3BR8A 2CQ4A 4KB7A 3E51A 4TY8B 1Q53A 5KFMA 4Q43A 3J80U 2HK3A 1IBLJ 2YKMA 2VPXB 1Q82T 4JV5J 1GXUA 1Q8LA 1V6HA 2OKQA 1I94F 2YNGA 1DJ0A 4OI4A 2EFNA 1SV5B 1WDTA 2MKHA 2ABYA 3ZZUA 5K8OA 3GSIA 2KKHA 4N41A 3QRRA 1RBAA 2DRBA 3AH6A 4G6VB 2E1MC 4OX7A 2VC0A 4F04B 1JQGA 1FKPA 3LWMA 2HBYB 4KHPF 1W25A 1IR2A 3I87A 4KGXB 4BCAA 4XPCA 1SCJB 3F44A 2F9DA 3R5BA 4WYLA 4EMDA 4CH1A 2CJKA 4ZLPA 5I3PA 3I9V9 3B78A 5E3AA 4ZVPB 5HMWA 4RUBA 1BQXA 4H4MB 2L41A 3L95X 4NXMJ 5IZHA 4Q44A 4USMA 1FF2A 2F63A 3O8WA 2ASJA 2E1RA 4GVBB 4DL6A 2GAGC 2NPIA 4YDXA 2FHJA 4TY9A 5JUMA 5KT6A 1QAYA 1KLMA 2BBEA 1GMWA 4ZPDA 1AB8A 2CVEA 2DNYA 4D3HA 2CAJA 3DDNA 3CJ8A 3CTRA 5IFMA 4LF4F 1UFWA 2CQ3A 5KTQA 1X4DA 4USKA 4R25A 2QA4S 3HT0A 4FF2A 1R8AA 2VFTA 4PKDB 5KFQA 2EFVA 2IFXA 4RZRA 2NR0A 2E5LF 1XNRF 2J76E 2HBRB 1FJGF 2FIUA 3BGRB 2GIQA 2ZJRQ 1EARA 2AF6A 4A8KA 3MTKA 2EXUA 4NZ6A 1VBKA 1FRXA 1S9EB 2CJQA 2FD2A 3OD2A 4RPFA 1J5OA 2UUAJ 1JLGA 2K3IA 4KO0B 1T02A 2B7CB 5EX0A 1D8ZA 5AE1A 4YOEA 1C1CB 2WAQD 3AJ2A 2PI5A 2J9CA 4JI3F 2CJ9A 2HWHA 2AZ3A 2RRNA 2XWYA 5LSOA 2VG6B 4O3SA 1FRHA 1SKWA 1YJTA 2XI2A 4I2PA 2DO0A 5G0RA 4PG8A 3KFWX 5LJ3Y 3GYNA 1SQFA 2ZH8A 1OPZA 2QV6A 2E1CA 2C2DA 1RTIB 1UWAA 1WHYA 4DSLA 2BE2B 5D0HA 4OV6A 2O67A 4LUBA 1GEHA 1XEZA 2YY3A 3BGLA 2DNNA 2CVIA 3OT9A 5DGBA 2CZVC 1RB0A 5HI7A 2D41A 4CLWA 2M5YA 2VL1A 2LQ5A 4N77A 1NK7A 5B0GA 1FI4A 3IG1B 3L09A 3FZ2A 3TA2A 2AX1A 5L1KA 3PR4A 3QGGA 2DNLA 2W2PP 4K59A 2DNQA 4QW8A 4X2BA 3AOBA 4ILLA 1OY6A 1Y4ZB 1KHVA 3UN5A 3W5ZA 2DEJA 2V4RA 4CDIA 5KG7A 4ICLB 3UVJB 2VHGA 1ZYQA 3ILJA 4Y2KA 5EDWA 2H4WB 1APSA 2ALZA 1S1XB 3PYDA 3SCLE 1WDDA 2JL9A 4DUTA 4LFAF 4KT0C 2HG4A 1X60A 3SMZA 3OBIA 2RH3A 4UZCA 4ECVA 2ZBPA 2ASLA 2H3EB 4FYVB 3GJTB 3M30B 3IA0A 2UUWA 3WZ0A 5AXLA 9ATCB 3QFHA 3OUYB 4P7VA 1WOSA 4P75A 2WVCA 2A1BA 4ZVSB 4OZ2A 2EFOA 4PXEA 1XC9A 4NASA 1IKXB 2C22A 3P6YC 3QAEA 2XSFA 4RWXA 3GFZA 4P9SA 5B0FA 2PMHA 2R8IA 3BKUA 1HWKA 1SH0A 4IFVA 2B51A 3A8IA 1Y9OA 4YB1P 1X4CA 5DM7Q 5HQ8A 1J27A 3GIMA 3JSBA 4JI0F 2ZH3A 2A2CA 2LVWA 2V8HA 1KKHA 1C4AA 3BZQA 2IRUA 1J5EF 4ILMA 2E44A 3WBZA 5B09A 5L39A 3PW5A 5L38A 3NGRA 3BH6B 4Y28C 5F41A 4DU8A 3IR6B 5HJYA 3RRHA 4S0MA 4MFBA 1WC0A 1ZZFA 3BGOP 4OLOA 5LOQA 3NS7B 3T1HF 1WF2A 1NJIT 1S9GB 1GMUA 3M2UA 5J1EB 3MM7B 1KD1T 2RB7A 2DR8A 3CJ3A 2QLXA 4CCHA 3HKZD 4QBUA 3MMCB 2DK2A 1VR6A 5A6WA 5C5JA 2CJBA 1VJQA 3HKWA 2FTRA 4IO1A 5BYQA 4F3MA 2MKIA 4CLUA 3CCVS 2XB2D 1RYSA 1JLBA 2ZKUA 3R5GA 4IDKB 5CYMB 2OHDA 1U6BA 3H2UB 2H4YB 2HFNA 3I32A 3MURP 3SYZA 4U6PA 1B7FA 3LA0A 1X0FA 3CJ2A 3KHLA 2VODA 2A2DA 4K5RA 3U7JA 2WOMA 3CJ0A 1VRUA 2CWXA 4Y2MA 2OFHX 3HK2A 3J7AN 2QL9B 3HFVA 4B3MJ 4X4VA 5GAEI 3KJVA 3NMRA 3DCAA 3VQTA 3ELHA 3ZXWA 2AGPA 3PX4A 1SJRA 3R2DJ 3RB3A 3JTPA 2XCPA 3KLHB 3H5XA 2AEMA 3K7RA 2B9XA 2MEWA 1IR1A 1XJWB 3FCHA 4WTYA 4O3NA 3UN3A 4ZCMA 5L9NA 3VR1A 3G82A 3DRRB 2YVSA 3V4IB 4NI2A 5F8JA 4H54A 4ZP6A 2BUNA 4IKAA 3EDQB 1T9UA 4ZPAA 4KV8B 4B9SA 4YDDB 2R2TA 4YR2A 4TQSA 1TL1A 1HFEL 1WF0A 3OTCA 4DPYA 1KVIA 2CJXB 4U7CA 5A8WA 2JLEA 4PWWA 1RT4B 2V4JA 5DZ7A 4DFJA 3ZTSA 3RBEA 3K0JA 3EUNA 3QJJA 2E7VA 4N47A 4DU7A 1VQ4S 4ZLJA 4K4VA 4B3MF 2BJ7A 5M2PA 4USIA 5J2MA 1JWWA 3PW4A 4HI2A 1UJ4A 4J9PA 1SKUB 5KT5A 1SB6A 3KXDA 3MM6A 1VQMS 3TUZC 2FJDB 2OPPB 3EGWB 3W2WA 4MIBA 1N34J 5D8HB 4IH6A 4F4XA 3MM9A 1H3DA 2IC3A 4DV7F 2F8MA 1XMOJ 2J7UA 3ITHB 3TX8A 4DPWA 3LOUA 2I5JA 1U25A 2ADCA 4NXMF 1NM2A 3EE3A 2VG7A 3FDSA 5IT4A 2VG5A 3G6VA 1PGZA 2OELA 4FP9A 4BLGA 4M5NA 1VQ5S 4FYDA 4W90B 5CAAA 1S6PB 3GE9A 1LW2A 4GRSA 2CQHA 4CM0A 4ETZA 1DY3A 1R43A 1VDHA 3MMAA 2B6AB 1D09B 5D4LA 4OX9F 5DDOC 4TU8A 5KG1A 2GQCA 2L9NA 1F3FA 3D3CJ 3ADAC 5IQQA 3OLAA 2VA2A 1AZSA 4BC9A 1S4EA 3OTEA 5KFGA 4V19X 1SKRA 2HRUA 1QTMA 1AFJA 2R4FA 2GS8A 2R7QA 4LRFA 1I94J 3OL7A 5KOWA 1YHQS 4RKUC 2QYCA 2V68A 3HHEA 2C2RA 3CD0A 3NEKA 1VJWA 3RTVA 1UEVA 1PILA 3UDEA 3VZHA 2VBXA 3QT5A 1X8DA 5HROB 3CCES 3FQKA 1NJXA 2M8DB 4DR5J 2MKJA 3N28A 2DR5A 1FJCA 1LW0B 2H1YA 3AOAA 4I4BA 5DRKA 3GJSB 3Q22A 3J7A1 3JSMA 4A8QA 2JEJA 3DM2A 2K8GA 4ECYA 1YZ6A 2N7CA 2KB2A 2HHWA 1C0UB 5SZTA 2HLTA 3KG4A 3B6BA 3D0GE 1RT5B 3OXGA 3EGNA 3CMQA 2ZVIA 2DGXA 2ZOMA 5JVGQ 4J5OA 2LECA 4LF6J 2DCUB 4DFMA 1M5VC 3D6HB 4J9OA 4FF3A 1FJGJ 4IG0B 4J9UE 5DG9A 2AJ2A 4O4GA 1LFPA 4ZP8A 1QAJA 4ZJQA 4DV1F 2UUBF 1QE1B 2PA3A 4CLTA 3QJLA 4Q8FA 2NXCA 3LP2A 2LXUA 4DX8H 2JX2A 3GYXB 4KKOA 2Q43A 3I9ZA 2DKOB 2UUTA 4PRFA 3CSKA 1HBMB 4FF1A 2QT7A 5IM0A 2FGOA 2Y1JA 4EBCA 2RS2A 2PGCA 1RWNB 4DN9A 1FVSA 2ZD1A 3QGHA 3ZZ0A 4DCPB 4DV2F 3T3FA 3IGNA 1DFDA 1WKJA 4LQ9A 2LYVA 1RUSA 3R2CJ 1QE1A 1AUSL 1RWUA 4WP8A 1B4SA 3OVBA 1FDAA 4O23A 5T7LB 1RKJA 5IQ6A 3QAUA 2LKZA 3D1HA 5GADU 1UVNA 2G2ZA 2BJ8A 3W61A 2HPUA 5KFOA 4DR7F 2FZCB 2LA4A 2GJFA 4NA2A 3Q8VA 4NLPA 1YZ7A 1IBKJ 3PHEA 5AE2A 1ULRA 3D6TB 2F4FA 2OD6A 1RTZA 2G0JA 1IWGA 2D1CA 2Z58B 4LJMA 4YB7A 1FFSB 3SSSA 1TFYA 2DNRA 2O1PA 2RQKA 2IA6A 2BACA 4DFPA 4C4WA 3L7PA 3K5OA 3DLKB 3FBBA 1S6UA 4CIOA 4ZPBA 3EJMA 2X3DA 3CULA 1A6LA 3M8ZA 1LW0A 4USWA 2C3YA 4ZJLA 2F4VJ 1I1GA 3MPUB 2VQFF 2RRAA 4M95A 2KXHA 1UVJA 4ECWA 2AYMA 1JIHA 2HBQB 4UTGA 1BWEA 2UVVA 4E98A 2XNRA 4DPOA 1NSPA 1QLNA 1MG7A 1OQ6A 4TLRA 1FE0A 1TFWA 1O0PA 2P6SA 1G4CA 2ZZTA 3MPDA 1SJ3P 3I4PA 1RAEB 4JV1A 3AT1B 3S01A 3TUIC 3QT8A 1NDCA 5FDLB 5DETA 2XLIA 4C3LA 4YN3B 1FTRA 3BPDA 3IFEA 4AXIA 3PV8A 3SDEB 1RWXB 1RT6A 1U6ZA 5GAGU 4ELVA 1FVQA 1CJKA 4G3IA 3AODA 4C48A 2A18A 2ZBCA 3DGVA 3K2YA 4EZ6A 1LW2B 3TAPA 2UXDJ 4NA1A 2BJEA 3TUJC 4AT1B 2F65A 2F8HA 3FFIA 3MEDB 3C16A 5ETNA 1UW4A 5LXYA 2GHPA 3M6VA 4CLZA 2GJIA 1SUQA 2FHOB 4NLWA 3D28A 2FJXA 2Z2LA 1B7YB 3VAMA 1QAIA 2QLWA 1WSRA 4LRAA 3VF0B 2MZTA 3G8TA 3W2WB 1IM6A 1RAGB 4MIAA 4Z7CA 4F36A 2CPZA 1WC6A 3W7BA 3NNAA 1K1SA 4U8YA 3CNQP 3MAAA 4UUWA 2GO9A 3HVWA 4CT8A 1UWBA 3ZZYA 1X5PA 2AP6A 4CO3A 3J7Z5 1KC8T 2DNHA 3HX9A 2RHSB 2FUG9 1QDUB 1SIWB 1S48A 2CPHA 2XHCA 3MM8B 4BC7A 3OJUA 2FZGB 4QW9A 3MR6A 2CNLB 4ZLLA 2LQBA 4M5HA 3CD7A 2HWTA 2XI3A 1RAJA 4MK9A 2RQ4A 5L1IA 1RQ0A 3CE8A 2GVZB 4WE1A 4I69A 4WKRA 4OYOA 3KLGB 1RLDA 2YQ0A 2DPIA 3H90A 4HHUA 3M7VA 4FYXB 3V4IA 4JI1F 1P9YA 2GZOA 4OYXA 5AJ3F 1VQ6S 1WD6A 4KFBB 2Z2ZA 3VAIA 1RTDB 5H9EJ 4WFAQ 4W92B 3JQMA 5KFNA 1HA1A 4WP3A 3RAXA 2UUBJ 1JLFA 1BHNA 1IXKA 4QYZK 2AEFA 2C3UA 4U67Q 4RNHA 3BSAA 4EI2A 1TUGB 3CIMA 2W9CB 2YXLA 4KIAA 2BE9B 1TL4A 1D8YA 1RACB 4LMZA 4X4NA 4ZPVR 1EQMA 2OEMA 2DITA 3PNIA 2W7PA 2D69A 3IAM9 1ZETA 2JLFA 2K1RA 2QFIA 1RZMA 3EVOA 1IBMJ 2Z30B 3M4XA 4L73A 2J6TA 3PHTA 1VIOA 9RUBA 3LGNA 4DR2F 1B99A 4WIQA 3ZTOA 1YWXA 1ZPVA 2C2EA 2KHDA 2VF3A 2JJ4D 4NXNF 1N54B 1PG5B 3I0RA 3IRXB 3MEEB 4DDFA 4YR0A 2KG1A 3CC4S 2KTQA 3BYPA 3PFEA 4NLQA 5DJBA 4WFNQ 2EK1A 5A8RA 2P2CB 1F0XA 4C3KA 3HVTB 4QR0A 2AX0A 5DG8A 1GAOA 2B5JB 1W2IA 1IWAA 3KLFA 5HSPA 3HPOA 3K57A 3HSDA 4ZCIA 1HMVB 3M2VB 1CLFA 4CO5A 1URRA 2EPIA 2JC1A 4LF1A 4ZN3A 2G1DA 3ETOA 1PIEA 1PSDA 1MU2A 4XK8C 2ZNYA 3A4TA 3AA9A 1XK8A 2H65B 4C97A 4WBFA 2YX7A 5DGAA 3B82A 3LTOA 2IDLA 5EX3A 2AQ4A 4RW6A 1NRKA 2BM1A 2ZC4A 3OFGA 4ECQA 2IM1A 3R7BB 4USVA 4O3OA 3DN9A 4Q5VA 5IT9Y 3O1LA 4ATNA 3T9NA 4DV3F 3M6XA 4J9QA 3LPEA 3FC9A 1R8BA 4OYZA 1ICEB 2YBVA 3CVKA 1IKVA 5T14A 2JWNA 4N56A 2HVEA 1FRMA 3OQ2A 3MGJA 2XMVA 4JI2F 5D0EA 1MU2B 3T6BA 4DL4A 2ERRA 5EWFA 4Y2CA 4DX6A 1XIQA 5A0YB 3BDEA 2MKKA 2AV5A 4HYKA 3A3OB 2RS8A 4MKAA 5CHCB 3MEGB 2RDJA 4PUOB 2KH9A 5C25A 2E5GA 5GAEU 5KFLA 1QVFR 5KT3A 4X62J 4F2SA 1IN0A 3LO3A 4C0OC 2AYEA 2IVFB 3CIZA 5J2PB 2GO8A 2PD1A 2AJQA 2RILA 1YLXA 3LAMA 4RNMA 3FSIA 3B8HA 1QSSA 2CIMA 3OR1A 4NRUA 4FXVA 4ELUA 5E3QA 2HFZA 3PFOA 2EBGA 4MK8A 3J81Y 1RAIB 1R27B 5LJ5Y 4Q0BB 4P2MA 3LF0A 1SBRA 2QIFA 3DRYA 1S7IA 3K8WA 4YQWA 2B9YA 2OPSA 2ASYA 1CJUA 4L6V3 2WK4A 3P4UB 1U48A 3RW6A 1BC6A 2ZH9A 2NZ4A 1UJ6A 2HHPA 1NU4A 1B0PA 4ZKAA 3UNGC 2LEPA 4HI1A 2LCWA 2DHXA 3NS6A 3TOQA 3OHBA 2DGWA 1P9QC 2W9CA 1NK5A 1RYRA 3I55S 3C14A 4QQBA 2ZOGA 1JK9B 1YRTA 4X66J 2FY8A 1OJ4A 2I6WA 3THPA 1IM4A 4KO0A 1U0HB 4HDHA 3PZPA 2E1PA 2V8DA 4OZ3A 5GMKa 4DLGA 3EM1A 1U0SA 3OJSA 4EU0A 3HT3A 3BO4A 2EVZA 3TQEA 3BGFA 4DL3A 3W65A 2ZH7A 4E0DA 4EZ9A 1BE4A 4B17A 4I64A 4M1KA 3PEJA 2RRBA 3I0SB 2HK2A 4LF8F 1JLCB 3TAMA 2DNZA 1X5OA 3U27A 4UY8T 3A8EA 3IS9B 4Q7AA 4UQTA 2ACYA 2DT9A 2QMXA 5E7OB 5F8HA 5LMUF 1TK8A 1FJEB 3IS9A 4BDPA 5I42B 3TARA 1ZTTA 5FD1A 3GCWP 4DQIA 3MUMP 4GVLA 2CZ4A 2ZJQQ 1KLMB 3RGIA 2XZDB 4GKKJ 2MKYA 2RT3A 2F4VF 2HNYA 2BKPA 4PG6A 2D9PA 3KDNA 2RE1A 4GVBA 3TEHB 3W63A 1QVGR 4ZIVA 3PY8A 1U0HA 2YQ3A 1RWOB 2ZUAA 4QIVA 1NHUA 2V6AA 1DQ9A 2HHUA 2CKWA 5EUHA 1JMTA 2HQFA 3V4MA 2EK6A 4OZJA 4RW4B 2D3O1 1VLYA 5D0GA 2GC8A 5JXSA 1CJKB 3UI3A 1B64A 1F2GA 3LP0A 4X64F 2FLPA 1R8HA 2C3MA 3SEOA 2C3PA 3CJRA 4GO7X 1S1WA 3ZC4A 2HHSA 4DQQA 5I3QA 4DV7J 1TL5A 2YNGB 3DGPB 4DV2J 2OMOA 3HHLC 4MKYA 4U8VA 1Y5NB 4N5SA 4LBHA 1GH8A 1FTCA 1JNRB 1VK8A 4F4AA 3MMJA 2ZH5A 4NLGA 2E9TA 1MN7A 1H2UX 2R2RA 1UETA 3D66A 3KMSA 3HLUA 4DV6F 3W3SA 3W62A 1S0OA 5EHHA 1WG4A 4EYIB 2NXJA 1K73T 4LQ3A 3GIIA 2HLUA 4DR4J 1TELA 2BW2A 3FKBA 4LRCA 1TAUA 1KN6A 3PEHA 2OD4A 3DLKA 4H4OA 4D3GA 1RCOB 2W8LA 2AT1B 4DG1B 3GV7B 1QSYA 1TK5A 1FDDA 3JTOA 3QT7A 4N8OA 1VBZA 1EKSA 2XSJA 3TQ1A 1S99A 4IQXA 1CVJA 1FNMA 7FD1A 1BWVA 2HEKA 3E01B 5MLCV 1EETB 3ETMA 1SC1B 2XO7A 3HZGA 3GP9A 4WXOA 3TZYA 2Y1RI 4DEZA 3HFZB 1HR0J 1TZ0A 1LWFA 2XQCA 1FO1A 4OZ1A 4BBYA 1T03B 2WW4A 2ZD1B 5AXMA 3D2WA 3RUBL 3HF5A 4RW7A 1KHWA 2VICA 4ED1A 2R8KA 4NLUA 4B3TJ 1LWCA 4TNOA 1RT3B 4JV0A 1F3VA 3DYAB 1U47A 1N33F 3CCUS 2ZH6A 2KT3A 1CJTB 4IH7A 2N82B 4HT5A 5BYRA 3W8PA 2ILZA 5DQIA 2MGZB 4P7TA 2WW8A 3R6LB 4LSNB 3H5YA 1WG5A 2HGNA 2UXBF 3QLHB 2B5JA 2JC0A 2DGVA 3PG9A 5SUHA 4K4XA 1X5SA 3ICLA 2QLFB 3AD7C 3OL8A 5JVHQ 3PKMA 5KFWA 2V9KA 1FERA 3IRXA 1HQEB 5B0DA 5DLGA 4DV5F 5JMNA 2HRTA 1XERA 3ULHA 1N48A 4PR6A 1TTHB 1A9NB 2VFVA 3GYGA 1FD8A 3IN5A 4PABA 1AXQA 4I7FA 4QWAA 5J2QB 2G4BA 1VCTA 3N6NA 1JJHA 1NEEA 4KPCA 4L76A 1I51B 2EFQA 2PFDA 2BVZA 3MCNA 4ED3A 1Q8IA 4ZS6A 5K8PA 4DS5A 1VLOA 4G65A 4CO4A 3VAHA 1F9FA 1H72C 1WI6A 2WZ1A 4OIXA 4ZVUB 3DMJB 3FNNA 2XGQA 1V3RA 4RUHA 3BDPA 1RBLA 1IBMF 3CCZA 1LXJA 1RT2B 1S57A 3MOZA 1AZSB 2MKCA 3NY0A 4DQPA 4G1IA 2R8HA 2KT2A 2YQ1A 4IQMA 1HD1A 4KFBA 1RAAB 3MR2A 3OVSA 2UUCF 4O0IA 2CDRB 2FJBB 4KR0B 1XNQJ 4DR6F 2CPDA 1S6PA 2CA9A 1FRJA 3K89A 5LMUJ 2NUUG 4KY3A 5J2NB 2GVZA 1ZOTA 3T5HA 1NBEB 4FPIA 5DM6Q 3OFFA 5C24B 1KOOA 4YR3A 4ED6A 4HACB 2H9ZA 3T6JA 1DAXA 1RADB 1K1QA 2CFXA 5F9LA 5CXTA 3QRPA 4QR2A 3SV3A 4AE5A 2LP4A 3M32B 3NBPB 4YY3F 3OTDA 2OPPA 3SI8A 3CCJS 1CEZA 4XPEA 3SCJE 3M8PB 1WOOA 4M5IA 1TK0A 3PO5A 2KT5A 2APOA 4L72B 5IOLA 3PRVA 1JLEA 4MH8A 3VALA 5E2QA 1KS2A 4DV3J 1VYAA 4PYDA 4U7UD 4Z2XA 3AB2B 5D4NA 1N5VA 3Q24A 5KG3A 2CG8A 5LMNF 3BKFA 1EIYB 1UVMA 3MPWA 1NJYA 5J2NA 4F8RA 2EWHA 1NZAA 2YNHA 3HHDA 4DPTA 4M5DB 4CLKA 1V3ZA 2VONA 3SCIE 3T19A 3DRRA 2QA2A 4NE9C 2HVDA 3DMJA 4ANDA 4Q2LA 3CJKB 2RKIB 3SDEA 2FJVA 3R1HA 2VBYA 1RT2A 3H0PA 4ES1A 3J80Y 5FDLA 1SQGA 2Z8QA 4CO0A 3VVTA 1TUVA 2WB1D 2MQOA 4ID8A 4KBIA 2WTFA 1VC6A 1M5OC 4RNOA 4DCOB 3CJQA 3CO0P 5ETRA 1N5TA 3M1VB 3CCWA 4XDCA 1GX5A 2OO4A 3OR2A 4L75A 2ZM6J 2KYXA 3M9NB 2HS4A 4O44A 1HQEA 4R5PA 1LWEA 3BQ1A 3TVZA 1OSCA 2HQGA 4I2QA 3DRSB 2QMWA 4TN2A 3DNCA 2B4PA 4ZVHA 1NXIA 3TVKA 4UT4A 5D78A 3CCLS 3GIKA 2R7VA 5IT0A 3JTNA 4FNIA 1KWMA 4LSNA 5GMEA 2GA7A 3ZZPA 4AUKA 4DX5A 1Q7YT 1R6YA 2RSQA 2J6SA 2J5AA 1NDPA 2YKPA 3HFKA 4LFAJ 5H9FK 3EDRB 1RHUB 3TO8A 1RTJB 1U6FA 2M70A 2XYPB 3CGIA 3WX4A 2MHNA 3FBFA 1U1RA 1R8CA 1NSQA 3OL6A 3EPGA 5KFJA 1RI7A 2QG9B 2B9EA 4FXDA 2MSTA 3KUHA 1UVIA 1U1OA 2QGFB 1T03A 4USHA 3BR9A 5K8MA 1NB7A 2G1HA 4M5GA 4NEYA 4JI5J 1GK8A 2YKAA 2R7XA 1LWFB 4FYYB 4URGA 5B0EA 3ILIA 1T0TV 3TEGA 4IFVB 1ZAXA 3DXSX 3PTWA 1H74A 2XS2A 2HVZA 2BJ3A 4USJC 1GXTA 3MWBA 2DHHA 4B3SF 3ILLA 4UF4A 3E01A 2MQQA 4ITSA 2M4MA 2AGOA 1WKKA 2IYGA 2V2VA 4O4GB 3PDNA 3VTIA 3IWXA 2F1FA 2J0XA 1FEEA 1REVB 3BREA 4DPUA 2NYIA 3OTOJ 2BYCA 1X9SA 4I0WA 4RU9A 4K4ZA 4JP8A 4RBTA 3U02A 4FN5A 1JKHB 2DNMA 1N32F 1H2TZ 3H2VE 2AHOB 2QEXS 1SXLA 1YG0A 2B8PA 3I31A 5CYJA 2MTLA 3I5AA 3OW2R 5KG4A 3UR3C 2BQRA 5DDQC 3K8VA 2DRDA 2WVDA 4F0MA 2V34A 1TKZB 3BYRA 4RLEA 3UCZP 1VC0A 2Q1LA 1WKLA 2N4CA 3O5TB 2FJEB 4U9RA 1CBKA 3HD2A 2GMLA 3EPIA 1N5QA 1JX4A 2IY5B 4OL8A 1DQAA 1UZDA 4J9NA 2ASDA 4A8MP 3JSRA 3CCTA 1HBOA 4L3KA 4Y65A 4WCEQ 3CW2C 1VQOS 2ZBRA 4KRWA 4C9DA 3LP0B 2KYZA 2Q3PA 1BQNA 1AT1B 2RIJA 4J7CA 4DL0C 3OV7A 1YGYA 2ZDPA 3F56A 4NX9A 1VBYA 2CPIA 2DRAA 2FGCA 4IOBA 1HWLA 2C2OB 3LAKA 1FRLA 5THWA 2XYGB 3VHQA 1HWIA 2E1AA 1PJ6A 1SJ1A 4PG4A 4DHVA 1ZAVA 1F1BB 1PYOB 1FEHA 2MB0B 1SJQA 1E6VB 2ZBIA 2NSBA 3WX8A 2VG5B 5KOXA 3Q2SC 2HNYB 4K8RA 4LF5F 2Y9HA 4K0KF 2HHVA 1QUPA 5D3GB 3ITHA 5M2RA 3R5AA 1WOPA 1T9TA 5DLFA 2LA6A 3MD1A 2F9JA 5I42A 3SIPB 2LEAA 2V69A 1DTTB 2FHKA 2HFUA 4PXCA 3AD8C 4OHVA 3MM6B 4DR7J 2R2UA 2U1AA 2GVDB 4NZ0A 4RL1A 4QWCA 3H4BA 3KLIB 2BMBA 3MECA 2XY7A 2ATLA 4LF5J 3D0IE 5BYSA 5E41A 3NCRA 2XTJP 1B70B 1YJVA 3IBFB 3MR5A 2K3KA 1JLCA 3TAMB 3L3CA 3SV4A 4MK7A 1VC5A 3CDAA 3AXKA 1X5TA 2AJ4A 2VBWA 1YSJA 3QMQA 4PAAA 2IDEA 4P52A 1UZHA 3T1YJ 2VKZG 3Q89A 4KV8A 1FWPA 3TJ9A 1E6VA 3L7UA 5MAOA 2Y3YA 3RB0A 3VGVA 2QTWA 4C8NA 3CCMS 3C15B 3BSNA 1NLKL 2D7SA 2XEXA 2DNOA 2YNIA 1MW7A 1YJ9S 2YX4A 1LOUA 3Q23A 4YB5A 1P1LA 5B0AA 4C2MA 4DUZF 2R7TA 2COLA 4LFBF 1FD2A 5HN0A 4PQAA 1M5KC 2XMTA 3CUNA 2XS7A 1RABB 1CJUB 5EGYA 2HZVA 4B9NA 5KFDA 4J9MA 1PC4A 4X65J 4ZVOB 2Q6BA 4CLLA 1KQGB 3RJMB 2KVQE 3KOAA 2C2KB 5EWEA 1VRUB 3G8SA 4ZP7A 1X9MA 1HBOB 4DV0J 1UFKA 1SV5A 2L08A 2OPSB 3GU0A 3L7OA 3OR1B 4OI2A 3TRGA 4YS2A 4C7QA 3J81U 4QWEA 3KLVA 4OI1A 4XAKA 3UR0A 1REGX 2NLWA 3DDKA 2VU5A 2Z57B 4CTAB 2XMUA 2J9EA 1FXDA 3G86A 1FDBA 1IQZA 3NS5A 3VAGA 2DCLA 5CCLA 5KG0A 1UFLA 2ZITA 3M8WA 1Q86T 5EN1A 1K0VA 3S6EA 2BQ3A 4ZOSA 4NOHA 1NNDA 3MM7A 3S1TA 1OYDA 1SQEA 2M52A 3IMQJ 1HKAA 1Y3KA 2YH0A 3NAIA 4IH5A 4FKXA 2QA4G 4MFBB 3THVA 2WONB 3BV8A 2FHMA 1MLAA 3V6JA 1YX2A 1IKVB 1ZM2A 2R7OA 2B8QA 3MEGA 4I6YA 3ZZOA 1M5SA 2CQBA 4ZA1A 4C11B 1LK5A 5A0YA 2HBZB 1XR6A 4YY3J 1S49A 3CCRS 3THTA 3W5XA 4ECTA 3KHHA 2MZJA 2MLYA 4KSEB 2RQMA 1TV6B 3AA8A 4CP5A 1RA6A 2B43A 2L48A 2A6MA 2ZBQA 4LREA 3GG0A 2MLZA 2W2NP 5KAKA 1HNIB 2IPOB 5H1SV 1YI2S 4NWBA 2IYIA 3P3DA 4FYWB 1JLAB 3RBXA 1HWJA 1PAUB 1DZ5A 1U09A 4C11A 2YWKA 3E3XA 2KHCA 1EQ0A 1HL6A 4B3TF 3W5YA 1QJHA 2UV8A 4HH1A 4A4JA 2CG4A 3H8YA 1U2FA 4Z37A 2C2NA 4ED8A 4QIWD 1SI9A 4CNZA 1S1XA 2JEIA 4CLYA 3VCDA 4LF9F 2ZJPQ 3KLFB 3TJ8A 2LQ9A 1KNZA 3UVJA 1XWLA 5BR8J 5LSRA 3WIVA 1KR4A 3HVTA 1FJ7A 1B0VA 4LSLA 1TL7A 1HNZF 2UVUA 4B3RF 4CTAA 2GX8A 4Q8EA 3I0RB 3MEEA 2RDIA 4R5PB 1Y5IB 2K1RB 1U1QA 1WJ9A 3A1YG 4F67A 3FJ2A 3NRBA 4KQZA 1KRPA 1T7PA 2OPQB 2EW9A 1K8AT 4EFAC 4DS4A 2RJZA 3VQSA 4GC6A 5IV4A 1N56A 2E5HA 5K8NA 3PX0A 3TANA 2AKWB 2OAUA 4RJVA 2C2ZB 4F2RA 4OMFG 3KJFB 2XWXA 4I6AA 1JXVA 3EGVA 3H2LA 1EP4B 2MY7A 3PYEA 3CC2S 4Y2AA 4QWBA 2ATCB 3SZ2A 2P8IA 2G13A 3CJKA 3C15A 2YWEA 4NCGA 3NP5A 2MDAA 2VPYB 3FSXA 5HLFB 2IM2A 2Z0GA 4FVMA 4M5DA 5KFXA 2YNHB 2A0FB 1WTBA 4B08A 1C1CA 2V67A 1OWXA 3DLEB 1XN9A 1R31A 2E29A 3SFUA 4HVZA 5HQLA 1FKAF 2DHGA 8ATCB 4P72A 2ZEJA 1SH2A 2PT0A 3D68A 4DF4A 1ZAWA 5KT7A 2J0QD 3KK1B 1EJ7L 4HDGA 2W9BB 4K50A 4ALZA 4TVAB 3FQLA 2OIHA 5L46A 1FFGB 2GVDA 3O44A 1RXOB 3MF5A 3NWGA 3T1HJ 2B4UA 3M8PA 3HZEA 1DTTA 1NSAA 3FVYA 1TL3A 1CS4A 3SCKE 1S9FA 2J0SD 3DHWC 4OFZA 4ZVTB 1BD6A 3DRPA 2CZ9A 5B08A 1NKBA 2I2YA 1JXEA 1WC4A 4DSIA 4MKVA 1M0SA 4C0BA 1HNXF 5BR8F 2BABA 2R42A 4RUCA 3C16B 1Y00A 3G6XA 1D9FA 2X1GA 3G71S 3TAQA 2N3LA 4J9KA 3RR7A 1RU2A 1VIXA 3DU6A 1FXLA 3GPAA 2HQDA 1N52B 5ETQA 2FQQB 1MMNA 3P96A 3HHKA 1RT6B 1RA7A 2ROEA 4OI0A 3T1YF 1HBUA 1VGYA 1DTQA 2EFGA 2KRBA 1M1HA 4WYWA 1I6JA 2XZTB 4CNYA 1QTNB 2D9OA 1FKPB 2DXDA 4CM2A 1V9OA 4HL9A 2R9LA 1ZH5A 2KDOA 1S6QA 2YWFA 5CH7B 1S6OA 3UQSA 1XMQJ 3NAHA 4F4WA 3PR5B 1R0CB 4LF2A 5DZ6A 5ETMA 4CH7A 4XDDA 1U49A 1LWXA 5HP1B 4X4SA 4IG3B 3K5LA 1K47A 1SL2A 4AL5A 2EFPA 2MZQA 1PYSB 3FEYB 1TKZA 3UPFA 4ANCA 3TI0A 3JQJA 4FBUA 1MMLA 3J7YU 4C6AA 1TU0B 3UD4P 2FVCA 1L3KA 2FB0A 2E5JA 3PIPQ 2I8EA 3LPYA 1FXRA 5ETPA 4IUFA 1T3OA 1N33J 1UA1A 3DXBA 3L9ZA 4JI0J 1JKHA 2J7KA 5KFUA 1FKOB 4MJKA 2GMHA 4GKKF 2HHQA 2HAFA 3IO1A 4ER8A 1REVA 2W1BA 5F8LA 3BN4A 1LXNA 3HI9A 3D3BJ 1W26A 3QNWB 2PI4A 2PSZA 4AL7A 1ZM3A 2QSFA 4PXDA 4RX6A 1GTHA 2P5VA 4BWJA 4TU7A 2XS5A 2GIFA 4X62F 2IVMA 3UO0A 4DOZA 2VDIA 1HR0F 2LFVA 3LUYA 5KFAA 1F5AA 3D5MA 1UEKA 2WRMA 5CA5A 3MOJB 1VHFA 4NYOA 2EC0A 4YUDA 4URSA 4USTA 4HKQA 2VV5A 1HLWA 5AXKA 3HVRA 1WORA 2JFDA 3CDBA 5KFEA 1YK9A 3QGPA 2ACMA 3POTB 4KKOB 3NOCA 3H5UA 1ELOA 4A48A 4ZP9A 1VRTA 1V5VA 3PM9A 1DHMA 2OSRA 5IM0B 3MZIA 4G1QB 2IJRA 3OSNA 3I5CA 3TNVA 3LALA 2YH1A 2DPJA 1RTJA 2NSCA 3MMBB 1HW8A 1Z2ZA 5AE3A 4K4UA 2KL8A 2GIRA 4P2FA 2CQ0A 2KN4A 4KGKA 2C28A 1RT5A 2A3JA 4A8OA 4IG0A 3RB6A 2MZRA 4FF4A 4H4KA 1FKOA 3QYYA 4I2QB 4C8LA 1LWEB 2QL5B 2BRKA 1U02A 3DRXA 2IBKA 3QZ7A 3OR2B 2VFSA 3GR1A 2DHSA 3OTBA 3HO1A 3K5NA 4DJBA 3JSMB 2N4DA 2HHTA 2HQ3A 1VQ7S 5C7PA 4KYZA 2DYAA 4WTOB 1C0TA 1WHXA 2VIHA 1Q81T 2AGQA 2CQIA 4M94A 3DGPA 4OHWA 4QYZJ 1QY7A 3BH7B 5L1JA 1VRQC 3QIDA 1RWVB 2C2MB 1S1WB 1Q4RA 8AT1B 4K4TA 4F3OA 1S6QB 1Y5LB 1HPZA 2DGSA 1SVDA 3T5KA 5ETOA 1HNWJ 3DLLQ 3BBCA 4RW4A 1TKXA 2CQDA 2DXFA 3R5DA 4N7TA 2KG0A 1UVKA 2WVFA 2IBOA 2FLNA 1HBUB 2UZAA 4ED7A 2VG7B 2DVIA 1S10A 2B0GA 2C42A 3JB9k 1HHQA 1HI8A 4U7UK 3MMAB 3RYLA 5AXNA 1O8BA 3EGZA 2GGPA 1Q78A 1S12A 2PEBA 3ET6A 3V2UC 2ZKTA 4TU9A 1VS3A 2OTLS 3ZZZA 2VH7A 4I68A 1JXLA 4OZ5A 5IS2A 5HBMB 3TA0A 4M5KA 4ZVGA 4QYRA 3KLEB 1NPKA 2W2QP 3RAQA 2CPJA 3CJTA 3GCXP 1BMQB 2AEJA 2IC3B 2IRXA 3PACA 4YHHF 5J2MB 3L4BC 2Q66A 1TR0A 3H25A 1YKWA 5JJBA 2VJVA 4GKJF 1CS4B 3TUPA 4I56A 4LRDA 4CLPA 4CYUA 4EGLA 5F9NA 4B9LA 3HD1A 2HFSA 3MAHA 1XTZA 2MQLA 4I1TA 4K7QA 2V4QA 4KPYA 2JVRA 3LANA 1RP5A 1GT8A 4JB8B 2GJ2A 3PX6A 3IR5B 4WFXA 3SXLA 5CYQB 5A8WB 1NPPA 4DX7A 1HWUA 4QWDA 3KJNB 2ZH2A 1TUWA 1MN9A 3OTOF 3B54A 2IA0A 4WJBA 4M5JA 2CJYB 2VOPA 1U2RA 3Q8YA 3C14B 4NI2B 1RU1A 2K7JA 1U1MA 4NLXA 2HSEB 3G82B 2XHWA 3VAFA 4F02A 2MQMA 3I96A 5DS7A 1WEYA 2R7WA 1Q8KA 1N88A 1RAFB 2ZOFA 4JI7J 2M9KA 5KFFA 3R6GB 3DC2A 2VFRA 1X4BA 3G96A 2R2SA 1AYEA 2BEFA 2L3MA 3D6MB 4A46A 2KXNB 2ROPA 4JYAF 5CYMA 3HJVA 1A7GE 1NHVA 1PJ7A 1WELA 3JAMY 2WOMB 1FX2A 5IV3A 1OO0B 4WWSA 1TP7A 2K2PA 3QO9A 4RNNA 2B7BB 4PZVA 3TZZA 1IKYB 2J7WA 4OJGA 5J2PA 1TL7B 2Z2YB 1CC8A 4DSJA 3M2UB 4EO6A 4P74A 2JH3A 5J1EA 3QZ8A 1HD0A 3GR0A 2YX1A 2MHEA 1NO8A 4JI8F 2H5IB 2MGZA 2RVJA 1O51A 2VQFJ 1UPPA 2W2OP 4KTQA 2MZSA 1HNWF 1P8GA 2KFNA 4DL5A 4QPTA 3US5A 5CQGA 2J6UA 3JAMU 1R0AA 2X1BA 1IR0A 4P6QA 3QATA 3M8QA 1Q16B 2HZAA 2UXCF 1H38A 4WP9A 5FIIA 2HYIB 1JLAA 1VOMA 4WZMA 4KHRA 2W7OA 4FVCA 4EBDA 1VQ8S 3MXHP 2CNNB 1FHTA 1PYTA 2D3ZA 1T05A 4DF8A 4JUZA 3PRBA 2B4OA 3ZFVA 4DWIA 3OLBA 1ZM9A 4DLEA 1RHRB 4ILRA 4J9RA 1N5YB 1RJJA 1U1NA 2QL7B 4V1Ak 2UXDF 1M5HA 2LXIA 3BEGB 4OX6A 4DCJB 1IKXA 1FFWB 3W9IA 4MYTA 3PYFA 3G6YA 1EX8A 3OUYA 2P9EA 3TR5A 3BO3A 5KFCA 3DKDA 4C98A 4ELTA 1LV5A 4H4OB 3KHRA 2LLZA 3AQPA 2UXBJ 4PYAA 4QIEA 3BJYA 2W25A 2CQ1A 4JI8J 4ECUA 3DOLA 3R7NB 1ZM4A 2VDHA 4DR3J 2OEKA 4F0KA 1NDKA 1AA1B 3G6ES 4BWMA 3J7YI 3UD5A 2DH8A 1G6BA 2RU3A 3UNYA 3T1AA 4OX8A 1AFIA 1GMVA 3SQGA 2FC8A 1X4GA 2J8SA 2YWGA 4NLDA 2K7KA 3F73A 4DR1J 4GKJJ 3VGUA 3CWJA 2BE2A 1RHMB 1NH8A 3GFHA 1ZS6A 4K2XA 2LMIA 3ISNC 5J1NA 4OJ1A 2DHAA 3JSYA 2BJDA 2MQ8A 5G0RB 2IMWP 1DBDA 1HI1A 2WCXA 3M9OB 1T9XA 1C2PA 1RLCL 3R9LA 2X51A 1NK9A 1YBAA 3EMTA 5D15A 3FRZA 5A6PA 4B3SJ 1O5JA 1T9WA 2HWIA 4RR5A 2VG6A 4B02A 3DLHA 4JI6J 5HMZA 2DR6A 2XNQA 1H98A 3KLGA 1ZA1B 4BHQA 3BGRA 1YJNS 2CWKA 3BB5A 1UPMB 4P73A 4UY85 2AJ1A 3ZZRA 4ZPCA 4DV6J 2O66A 2UP1A 3H20A 4Y00A 1S9EA 3V6DB 3FCVA 2VA3A 4EWTA 3X1LB 2YKNA 1GQEA 1KQSR 1H6KX 3MM8A 3E2EA 1RSCA 2PDAA 2V2KA 3FBCA 3I0SA 2VD3A 1UWBB 2BZ2A 5KFYA 4ZN1A 5L1LA 2HHHF 1YBUA 3T41A 2CPXA 3MAAB 2V5HG 4HTJA 3LP1A 1FRIA 3HSZA 4UW2A 4KAIA 4AQYJ 2R7SA 2DBBA 1JJ4A 5HATA 5F3ZA 4CO1A 2V0NA 5E0OA 1WG1A 1K9MT 3RB4A 2HQIA 3MI7X 1RK8A 4R0EA 2BQUA 2BW7A 2Q6CA 2L9WA 2HURA 3A13A 4ID5B 4I67A 5D77A 3M8RA 2XMKA 2CQ2A 1MWZA 2JOQA 3FFIB 3MEDA 2OSQA 2PA8D 3IAS9 4HTIA 1KQFB 1N0VC 3P5TL 3M8YA 3PJWA 1G3OA 2RUSA 3RG6A 3S7RA 5KFZA 2ALYB 3GZ7A 1F9HA 5KFBA 4OYIA 4EEYA 3UDLA 2H5EA 2BXJA 1YRXA 1S1TB 1TVRB 4ID5A 3AOCA 4KHMA 2FPHX 1SJFA 4OLPA 4PEOA 3VWSA 2XY5A 4HH0A 3GWCA 4ZHRA 1SH3A 4R0JA 2YWHA 5J1PA 4WFBQ 2XBPA 1FCAA 2MSSA 2UU9F 1CQNA 4QIGA 3PO4A 4OZLA 3VAKA 2OTJS 5B0BA 4M8LA 5CD4H 1Y10A 2V63A 3H4DA 2DH9A 4WIIA 4NCAA 2YKQA 1VFJA 4F4ZA 3LW5C 2F40A 4DMZA 3CD5A 1H73A 1YJUA 4FXWA 4J91A 4Y3CA 3MCSA 4G1PA 3CCQS 3V6DA 3PXGa 3K58A 3CMAS 5G4DA 1T8EA 3D7SB 3VAJA 4AD6A 1XMQF 2OMLA 3OVAA 1X7VA 3DOMB 2LDYA 3ENVA 4QZVB 1U4BA 3QPIA 1CQMA 2DJWA 4PUOA 4IOAQ 1GTEA 2J8AA 1Z4UA 3ONQA 3CJSA 3MR3A 5HMXA 1EZZB 1WTFA 2BANB 2W24A 3BS9A 1N36J 2BOPA 3Q2TC 5KFPA 3QIPA 1CULA 4C8KA 1J2VA 1S97A 3C19A 2JSXA 4DN0A 3PJXA 2V8PA 5CD4A 3MEKA 4ZPWR 3WIUA 3H40A 3M2RA 1OYEA 2HW3A 3FEZA 4MKBA 4NMLA 2DIUA 4IR9A 5IC6B 4A8SA 1SKSA 1OMSA 2IVYA 3MUTP 1Q5VA 2JNJA 3EZ5A 1JJ2R 4RW6B 1O6XA 3C3LA 5K20B 3CXCR 4IR1A 1DARA 2CDQA 4AYBD 3EX7B 4DL2A 4YB6A 1HBMA 2QMUB 4EUVA 4LVNP 2R7RA 3QRQA 3U1LA 4KGVB 1XNQF 2QLJB 1GFWB 1RAOA 3C6TA 4ZVRB 1BQMA 1U8WA 4WKYA 2ZE2B 3GILA 4FKYA 1SL0A 3LP2B 4EK2A 4UOCA 1HMVA 3M2VA 2FLOA 1NJZA 1NAQA 1UKUA 4PPDA 1RBOB 3M6UA 5AT1B 2YKOA 4ED5A 1WUUA 3A3PB 4PWDA 2HVHA 1FESA 4LF7F 4OQJA 5A8RB 3JS9A 3MHYA 2W7AA 4J37A 3HHLD 4L3NA 5KFKA 2NS1B 1YTYA 1DLOB 3CB4A 2DO4A 2RD5C 1OS5A 5L9XA 4BS2A 2FLLA 5I3UB 2IM0A 4DI6A 2XCAA 1T9VA 4QR1A 1IJEB 1YRUA 1KTVA 1K44A 2ZWPA 3DM2B 1R3NA 2LEBA 1S0VA 4DQRA 5ETSA 2FZKB 3NWRA 1PBAA 3K17A 1VQYA 2CNOB 4O44B 2RHQB 3I82A 4Q2MA 1URNA 1T3NA 4ANEA 5HROA 3MFHA 3PW0A 3JYTA 3M1VA 1ACMB 2DISA 4DV5J 1IJFB 2IRYA 3V6KA 5H9EK 3IXQA 1HHTP 2DH7A 3NXZA 1FE4A 1XQIA 4X4OA 3Q0AA 1KQKA 3ENWA 3UN2A 1S1VA 5K9FA 1L5UA 3M8QB 2NPFA 1JLFB 3G2XA 2D3OR 5A8KB 3BN7A 2MQPA 3RZAA 3ILOA 1M1GA 2CPFA 2DXEA 2W4PA 4FZVA 1HW9A 4IYQA 2KM8C 1RTHA 2WSCC 2QSWA 4KE5A 4ZJOA 2WVBA 5KFIA 4X66F 4ECRA 2HIQA 1QD1A 1RWMB 2K06A 1J5EJ 3AJ1A 1UVLA 1GX6A 4NLVA 1VQNS 1NUEA 1X4FA 3HVAA 4C8ZA 3J7ZT 2P9GA 4NLOA 3CT9A 3W66A 3V81B 1RT1B 4RWWA 2EG1A 1EKRA 3NGKA 1IKYA 1BXNA 2BX6A 2GHVC 3WHIA 1WC3A 3MR7A 3EZUA 4JBCA 5D4PA 2WB4A 2MJNA 8RUCA 1DURA 1JLEB 2LQJA 2VASA 5RUBA 4DSFA 1UCNA 4ZIWA 1HNXJ 2AYGA 4UZBA 2HGMA 5DQGA 3P45B 6FDRA 3A8KA 3LGHA 5DDPC 1CJVB 4FBTA 4LFCF 2NYHA 1B3TA 2VJUA 1U2CA 1NDLA 2VUGA 3N01A 4LIRA 3A3NB 4X4UA 4C8MA 3BO2A 1X9WA 1VBXA 4ES3A 2PC6A 1DQ8A 3B4MA 1CG2A 1RT4A 1VK3A 2V4JB 2VBZA 3HSJA 1OIAA 2RAQA 4RBVA 3FGVA 1T95A 3U1MA 4FS2A 3AD9C 4DUZJ 3EZOA 3IP0A 5AJ3J 1KDNA 3QQCD 2GW8A 5HO4A 3O2IA 3Q8PB 3CD6S 3MM5B 2AMCB 1WHWA 2YPYA 2OJ3A 2RDDA 2XMMA 3EVMA 3RW7A 1Y7PA 4DZ6A 1IQTA 2V50A 1YJRA 2DGTA 2IMOA 2NXEA 1RCXB 5CYQA 3R8YA 4HHHA 4ED4A 3MFIA 2F8EX 2H48B 4OHXA 3K59A 2I1RA 2DY9A 5HMYA 4ENOA 1ITPA 3KJVB 1SC6A 3BBBA 2DGUA 2NXUA 3G8QA 3MPYA 2NCKL 2RQCA 3NNCA 1F6TA 5M2UA 4J90A 1CPZA 1N0UA 3KDOA 1S59A 3D1OA 1D3WA 5U47A 4I7FB 4NLTA 5HL7Q 1UEUA 5IXUA 3IGVA 5IT9U 1NK0A 1RKIA 4IDKA 1Z1ZA 1JNZB 4C3MA 1TKTA 2XZWA 5C42B 2XM3A 3GJRB 2UU9J 3H98A 3W8GA 4QCLA 4Q45A 2I9SA 3IM8A 1UW9A 2VZ9A 4DFKA 2CQCA 4W98A 4KHPJ 4N76A 2HMIB 4I6WA 1S72S 5HJXA 2GGPB 2E9ZA 2O01C 2OPRB 7FDRA 2FDNA 3FSYA 3NOGA 1G1XA 2RU9A 4TKTA 2G0CA 2SXLA 3TYTA 4CLFA 3V81A 4NXNJ 1KTQA 2PIIA 1HBNB 2Y0SD 3QLHA 1S4FA 4LF9J 2KI2A 2RNEA 1PKUA 3CCSS 1TKXB 2MMYA 1H7XA 2BKOA 4Y34A 4LF7J 1T11A 1MSWD 2CRLA 5CZVA 1RTHB 3N5BA 1KONA 1XMBA 2NXNA 1F2HA 2X7IA 3DYAA 3W2VA 3HMJG 4K4SA 3FZBA 3W9JA 1RT3A 4IFYB 1IKWA 2V8GA 2W01A 1U1PA 3C66A 5C2GA 1S79A 2IM3A 2M0GB 4F7VA 1VQPS 5E5NA 4DV4F 5T41A 2HIYA 3ZTPA 1OY8A 5EWGA 3UCUP 2KZZA 3KMQA 2HVIA 3G4SS 2KZMA 4MYUA 1S1UA 2EI5A 4F26A 5E3RA 4AQYF 4LBIA 2M88A 4JI4J 2QRRA 3MD3A 4RW9A 4ZK7M 3CPWR 1Z2LA 4WFYA 2XO6A 3KK2A 2JDJA 2OFGX 3WQPA 3N6LA 2HNZA 3HDSA 1N32J 2CNKB 1TMMA 4OYAA 3KK3A 2MJUA 2P9CA 3K5PA 4CWBA 2XSJB 4KC5A 1IBKF 3VGTA 2LDIA 1C0UA 2VPWB 3T5LA 3PW2A 5I3UA 4K0KJ 2H5JB 4F50A 5F3TA 1N5SA 1VHIA 2BJ1A 3ENQA 1KFDA 1VQSA 2Q79A 3GTYX 3SBMA 4OHYA 1MNEA 4Y2IA 1NB2A 4OYWA 3FUYA 1MMDA 5KFSA 1M90T 2BJ9A 3LQVA 4RW9B 2EKYA 3HSGA 3Q8UA 4F0HA 5ITHA 2XY6A 2UVWA 1JB0C 2VFUA 1LQ9A 3DHXA 2PEHA 2MKSA 3D4JA 4FPRA 2XULA 4NLSA 5B0CA 4JI5F 3POTA 3KHGA 4K4WA 2EKNA 2Y8WA 3QBCA 4HT7A 5IWAJ 3AFGA 3NLCA 3R1LA 2Y8YA 3T5JA 5E33A 1L3TA 2IAJB 3HCXA 4B9TA 2QJ3A 1Q1KA 3DU5A 4OJ3A 2XGPA 1TQLA 4NRTA 3W2VB 3TZXA 2GNKA 4DR1F 3WDOA 1RHKB 2P6TA 2V2QA 2N7YA 2XG8A 1S0NA 1ZA2B 4LF6F 2PMWA 4DV4J 1KLNA 4WZQA 3TP2A 2QE5A 1PC5A 2I5JB 1CULB 3AXMA 3KG0A 4ECZA 5KFVA 2OPRA 2DEIA 4PG5A 3C8YA 4ZITA 2BANA 1XR7A 2HZCA 2QC3A 3CDEA 3MCOA 2RF2A 3MM9B 5HVGA 3VGSA 4WK1A 4NEZA 1NZ8A 2J9DE 2EG2A 3H42A 1LKZA 1RT7B 1TMJA 5C42A 4CQ1A 1I3OB 4QOTA 3RRKA 3FEXB 3FMWA 2DR7A 2CQPA 3PYGA 2OP5A 5A2QU 4MTPA 3P8BB 4IG3A 4QJVA 3TJAA 4UQGA 5HVHA 1HARA 2VQEF 1WHVA 1NK8A 3GSDA 4PQUB 4P2SA 5F0UA 3UW1A 4CO2A 2DR9A 1VQLS 2BM0A 2E5IA 2PN6A 2OH2A 3NCQA 1YDLA 2XMJA 2GMJA 1X0PA 4NA3A 4EBEA 1XMOF 2EEYA 2EBEA 3H7HB 3K5MA 4B9MA 2I38A 4U96A 1HNVB 1R0AB 3DOKB 6AT1B 2LXFA 1NCLA 1S1TA 1TVRA 3CJ5A 4WU2A 5GAHU 3MUVP 2IJNA 4F4YA 1SJ4P 4IRCA 3I56S 2VQEJ 3MM5A 3QFWA 3GB0A 2FVSA 3M6WA 1FT8A 5B7WA 4X4PA 4B9UA 4UOHA 2B9WA 1GXLA 3MPVA 1FRKA 1SL1A 2HS3A 1UA0A 1WC1A 1C1BB 1XBWA 1R8PA 3PIOQ 5FLXU 2D74B 2DD8S 3CF5Q 3DLGB 4A8XA 2PE8A 3PVXA 4OYPA 1ZBTA 2MXYA 2KO1A 1Q7LB 1R0BG 1H7WA 3UWTA 3LP1B 3AHPA 4XIUA 1WI8A 2J9DA 3KNAA 3WC2A 2MY8A 2YKMB 4M5MA 4O3RA 4Q0BA 3N0VA 1RWPB 1U1KA 4TY8A 1UP1A 4WK3A 5K14B 4JI1J 4JI4F 2CUYA 2W9BA 2ZZNA 2XMWA 2HRYA 1NSKL 5D6GA 4RW8B 2FY1A 2JFKA 2YKNB 1YIJS 1S9GA 1WF1A 4NCBA 1WC5A 4KH0B 5GADI 4LFCJ 3AJDA 3W60A 5C25B 2B3TB 4J9SA 3ZNUA 4DR3F 3H59A 2CPYA 4XTTA 4ED0A 5F8NA 3RBZA 1Q5YA 2J0WA 3VVUA 5ADZA 2MPUA 2ZH1A 5HLFA 2OUGA 4WFZA 2UVRA 4X84A 3Q86A 1ZZNA 1YQHA 2ZM6F 1K0TA 4URQU 3OXLA 1E6YB 1BUXA 1EP4A 1WACA 1S1VB 4A8FA 3M05A 2PMZD 2W2MP 1PAEX 4PXBA 4NPOA 1NHKL 2VC1A 3MDFA 3EVWA 4O3PA 1L3SA 1YJ7A 3F41A 1G7CB 3JYTB 1FNOA 2MZ1A 2Z2MA 4OYMA 2R3VA 4DUYJ 2ROGA 3D54A 3KG1A 3UDCA 2R8GA 2NREA 4AXJA 3SQGB 4F4KA 4OX9J 4CZCA 4LSLB 5KT4A 4GC7A 1TAQA 1WWHA 2Y0BB 2CADA 2BOAA 3QSIA 2Y1LB 2GCFA 3DFEA 4LBPA 5LMNJ 5ETLA 2WSFC 2LU1A 3DOLB 2DNPA 3ENAA 3X3UA 4XO0A 4TQRA 1VQKS 4V19J 1AROP 4B3OA 3C2PA 2U2FA 2MLXA 3RAMA 2I0XA 4NZ7A 4MMOA 2ZDOA 1W2BR 1N34F 2IHR1 2QZ8A 1UTAA 3N5FA 1LK7A 1OPIA 2O3DA 1P1TA 3D1QA 2LQ8A 2ZHBA 3IG1A 1U26A 4E8UA 1H2VZ 1LFWA 1RAHB 2OI2A 2ZE2A 2KFYA 4J9LA 2ILYA 1R89A 4NL5A 3SFGA 1NK4A 1HNIA 3UDVA 1QM9A 2KU7A 2VKRA 3I5BA 3RRGA 4YEAA 1RTIA 3AAWB 4DSKA 3SSRA 4FNHA 1E6YA 1T05B 2QO3A 4KGZB 3A8JA 4C8YA 4ERDA 2FJWA 3TX0A 1N4LA 1OSDA 4DR6J 4X4TA 3DDIA 4JI7F 4ZVQB 4IRDA 4QU6A 2R7UA 1IUJA 7AT1B 3RR8A 2WONA 1HI0P 3QIPB 2WBRA 2G0IA 3GQCA 1J5OB 4KGMA 1LEOA 1WEZA 4PWUA 1RTDA 1Y3JA 2Z4PA 5LT5A 2M3DA 3WC0A 3HP6A 3HM9A 5D0RA 2F5GA 4WE1B 1IBCB 3H5SA 5ETKA 1M1KT 4J9VA 4OV1A 2CYYA 3PRDA 3BKTA 3D67A 2ZC3A 3GG1A 4LR7A 1Q79A 2PO4A 3W9HA 5KG5A 3QGIA 3Q8QB 5KG6A 2HFVA 1S0MA 2JRSA 3AQOA 4RW8A 4E2FB 3AB4B 3NMAA 2DB1A 3SSQA 4HR2A 1W7WA 5K14A 3DLGA 4DV1J 2GFFA 3ZNJ1 5CCMA 5DDRC 2HFOA 2WSEC 3FCWA 1MWYA 2QX0A 4HHJA 2AJ0A 3R27A 4OI6A 4EO8A 1C1BA 2B56A 1OQ3A 5KFTA 4M5LA 4DXLA 4ZLNA 5FLXY 3M9MB 1ZPWX 2IJFA 4GO5X 1KEKA 4ZHRB 4WU3A 3OSPA 2KM8B 1X4HA 1RE1B 3EXYA 2W4CA 3BSOA 4OYBA 1CC7A 2M8HA 3NGTA 3KJQB 1SUQB 4H4MA 5ETTA 2AZ1A 5F8GA 2KRRA 1RHQB 2YNIB 2M7SA 2VB6A 5GAGI 4ES2A 4DL7A 5D4OA 4DR5F 4P71A 3V5RA 3I4HX 1SC3B 2PFFB 2QLBB 4P10A 3S8SA 3UD3P 1SPBP 2UUCJ 1F9EB 5HANA 1MWQA 1HNZJ 4B3RJ 1JLQB 1V5IB 2YNFB 4RO0A 3DOKA 1WSVA 1HNVA 3R97A 2JEFA 2ZZMA 4GMKA 3TW0A 4NMXA 5HK4A 3T9ZA 4DR4F 1HHSA 4L74A 5GMDA 3I6PA 3KLIA 3MECB 2JVOA 5K5MA 3KWMA 3GIJA 3BQ2A 3UFCX 3U1NA 3V6HA 4PQUA 3UE2A 1VMBA 3OFEA 3GV8B 3CC7S 4NYPA 4Z7YA 4DSEA 3CO9A 2MYFA 2RF2B 1QUVA 1T94A 2ZWOA 3MTJA 5KFHA 3G9CA 1HQUB 3PCOB 5D3GA 4B9VA 1RT7A 2D3UA 5HBMA 3TVYA 4X64J 3DLBA 1I5OB 4USUA 1H0HB 1HQ2A 1U8SA 1FWKA 3W64A 1RISA 2Z56B 1RGVA 1VI7A 3BGUA 3CDWA 3HHLA 1KVKA 3ET6B 3Q83A 1Y11A 3HJFA 2HNDA 4X4QA 2XC9A 3CDUA 3TA1A 1S5ZA 1RHJB 2JHEA 3IM9A 5T7LA 4ZMMA 2ZH4A 6FD1A 1YBTA 3GONA 2FHJD 3OHAA 2MQNA 4UUXA 5C24A 1N6QB 3C6UB 1ROFA 4CLSA 1BQNB 4ECXA 2DIVA 5HAOA 4JV2A 1ZTWA 1X31C 3DLJA 4JV5F 4IRKA 1HPZB 2V2ZA 4OI3A 2NUHA 1SIZA 3LH2S 1RWWB 2IAJA 2RMLA 3R3TA 4JOUA 1S7HA 4LRBA 3LWLA 3ZZTA 4RU2A 1KOHA 5F8MA 1GNKA 2AWZA 2JZ5A 3O3LA 2DNKA 2JLGA 1YJWS 2NQPA 1FX4A 3EXCX 4JI3J 2X1FA 3FMBA 2DY1A 4NLRA 3M8SA 3OXFA 3E8OA 3NCPA 4ZDNA 1B0TA 2UUAF 4FS1A 4O3QA 1C4CA 2XLKA 3GV5B 4OZNA 4R8UB 3CMES 1AUDA 2X1AA 5LXRA 3OPKA 1KP6A 5CABA 2F7VA 3F0NA 4KJIA 1U1LA 3KK3B 2HHXA 2DTJA 1Q8BA 1S1UB 2C3OA 3HULA 1NK6A 2HNZB 4IO9Q 2AJFE 4F25A 3MMBA 4A8WA 3KK2B 4LF4J 2POKA 3IBWA 3LGMA 4LVOP 1N5YA 4G1QA 2N3OA 4K5SA 3SQOP 1VRTB 1IKWB 1U24A 2NZCA 1N8RT 2B4VA 1N36F 5ETVA 3RBDA 2X3GA 3BPSP 5LM7E 3BF4A 3TZWA 4QIFA 3C6UA 3CJ4A 2FJAB 2KJVA 1FA0A 2DNGA 2YWWA 3KUGA 3NGSA 4MAKA 1EAYC 4IFYA 4CH0S 4NLYA 2C1EB 5LL6d 4N8NA 4CI0B 1M5PC 4LR9A 1HBNA 1D1UA 1S77D 2KXFA 3DI6B 5DQHA 2HHHJ 2FVQA 2B6AA 4Y0FA 3IBCB 3P5BP 3OFHA 2GQ2A 3KKFA 1WEXA 1MROA 1R7IA 3GFYA 4CT9A 1PCAA 2HMIA 4MIWA 4MT1A 3GIRA 1WNEA 1QSLA 2EC2A 1TKTB 3Q8RB 4K4YA 2BR0A 2FVPA 3DRSA 1HQUA 2KVIA 2AD9A 4JYAJ 3PKYA 2BDPA 3QO9B 4KH1B 4RUAA 2AU0A 1Q95G 2XYHB 3EWGA 4DQSA 2BV3A 1QAXA 2XMAA 2HAIA 5HQMA 4JI6F 2ZHAA 3PW7A 3MAQA 2E9RX 3NNHA 1IVZA 1P6TA 3KTQA 4O4RA 4ZCKA 4ZPTR 5LSLA 3BBFA 1D9AA 4YMEA 1LNQA 2OEJA 3NG8A 1NJWA 1HIYA 1D0EA 1SC4B 1NMEB 4NYZA 4OJHA 3R5CA 4YFUA 4ED2A 5HP1A 1HYSB 3FK4A 3NGUA 1UAWA 4LF8J 1JJCB 1TKDA 2AYBA 3IWNC 1NPRA 2RKIA 4M63A 1JLQA 2YNFA 1TL1B 2W9AA 1KBRA 3BM7A 4AL6A 5I4MA 2JEGA 1FK9A 4LT6A 4P2XA 4RNFA 4LIWA 1EB0A 4DPXA 4ZVFA 4U95A 3JQKA 1DTQB 1FK9B 1FWLA 5BJRA 5BXIA 2ZVSA 4HLBA 2W4DA 2GAHC 5CZXA 4CRJA 1Q0NA 1U45A 1L3VA 3KLHA 2ADBA 3HHNB 2QA1A 2YTCA 4ZCLA 3ZTQA 2ZUGA 1HYSA 2KJWA 3GLJA 5F0WA 3Q8SB 1L3UA 2A10A 3IR7B 2DGOA 4YP3A 4H4KC 3OL9A 1CJVA 3P49B 4PCQA 3FBEA 5DO2A 2E7WA 4CYUB 3QWUA 3DRPB 3R7SB 4OHZA 3M32A 3N4WA 2F3JA 3NBPA 3B4DA 1TL3B 4PPZA 4A8YA 2M2BA 2HKEA 3D9BA 3J81j 2HGLA 1A0OB 4DV0F 1KFSA 4HACA 1JLBB 3RU0A 3KLEA 5DG7A 3IC1A 1RT1A 5GVQA 5H9FJ 4TXSA 2VOOA 1RWKB 2YPZA 2UV8G 5KT2A 4DZDA 3MMCA 4X65F 2WHOA 3KK1A 2ZNZA 1EHWA 1MROB 1NKEA 1BY9A 4O0NA 2WVEA 5A76A 1T9YA 4WXWA 5HVFA 2QN6B 4UOFA 2KFZA 4ZVEA 2E5LJ 4X4RA 3KYLA 1XNRJ 3DI6A 4LFBJ 1Y0HA 1R6VA 3O6QA 3UCGA 3VV2B 2AIRB 3QSYB 5IC4B 1G2EA 3DLEA 5A8KA 2BA9A 4IOCQ 4DR2J 1AW0A 3G87A 4AFFA 3EICA 2BKNA 4EYHB 4NCGB 4JI2J 1KSPA 4TYBA 3NKYA 4LSZB 4C0HA 3ZTRA 5F8IA 3BSCA 3FRYA 1V3SA 2L9DA 3C46A 2A6OA 3ISZA 1X4EA 3N6MA 2HS0A 1C0TB 2G2YA 3R5JB 5A2QY 5J2QA 2BE7D 3ZO7A 1PBUA 3ISND 2FYXA 3KUEA 2ZFHA 2FC9A 3VZIA 4WPAA 2GV1A 3EYZA 1CSJA 2Y1IA 2OPQA 3PJ9A 1FDNA 3IRWP 2AW0A 1BGXT 1VQ9S 3M30A 1YVFA 3IWLA 2E7XA 4R8UA 2G2OA 1UJ5A 3D0HE 2CPEA 2OGUA 4DUYF 4B3OB 5C2CA 3KNGA 2OLWA 2BRLA 2QFJA 2CXEA 1FNXH 4PWDB 3W1YC 1X4AA 2V8VA 1N6QA 2V9WA 4ICLA 1DLOA 2ZHOA 1F60B 2GHWA 4W4MA 4ETXA 4TLQA 1UL3A 3TWZA 5L8RC 2IIHA 3NGDA 4C8OA 1CJTA 1BQMB 3BQ0A 1IBLF 5E3CA 1RDRA 2H54B 4A47A 2UXCJ 4UOGA 1VISA 4DBQA 3QT6A 2R8JA 1LWCB 5E3PA 2CJAA 1KVJA 2DGQA 4QPXA 4FDFA 1PJ5A 4QU7A 3HXMA 4RW7B 4ECSA 4WF9Q 3C6TB 4K2JA 3JXOA 5KFRA 1NH7A 1YITS 1GMWD 2V94A 1UMJA 2O5DA 5GAHI 4TYAA 4F3QA 3GJQB 1TV6A 1D9DA 1BLUA 3MCMA 4I2PB
chains in the Genus database with same CATH topology
5ETSA 3ILLA 4M5HA 1TMJA 3KUGA 3HT0A 3QBCA 5ETMA 2F65A 3UDEA 4CYUB 5ETNA 3UD5A 2QX0A 1RAOA 2BMBA 3HCXA 3MCNA 1RB0A 4AD6A 5ETLA 4M5LA 3UDVA 4PZVA 1F9HA 1KBRA 4M5IA 1TMMA 4M5JA 4M5NA 4CWBA 1IM6A 1RU2A 3KUEA 1DY3A 2F63A 5ETQA 1RU1A 3KUHA 4M5KA 4M5MA 1G4CA 5ETRA 5ETTA 1EQ0A 5ETPA 3ILOA 3HSDA 3HSJA 4M5GA 1EX8A 4CRJA 1Q0NA 3ILJA 5ETKA 1CBKA 3HD2A 3ILIA 3HSZA 1EQMA 2CG8A 4CYUA 1HQ2A 3HSGA 3MCOA 1RTZA 5ETVA 3MCMA 3HD1A 3IP0A 4F7VA 5ETOA 1HKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETS A;  3ILL A;  4M5H A;  1TMJ A;  3KUG A;  3HT0 A;  3QBC A;  5ETM A;  2F65 A;  3UDE A;  4CYU B;  5ETN A;  3UD5 A;  2QX0 A;  1RAO A;  2BMB A;  3HCX A;  3MCN A;  1RB0 A;  4AD6 A;  5ETL A;  4M5L A;  3UDV A;  4PZV A;  1F9H A;  1KBR A;  4M5I A;  1TMM A;  4M5J A;  4M5N A;  4CWB A;  1IM6 A;  1RU2 A;  3KUE A;  1DY3 A;  2F63 A;  5ETQ A;  1RU1 A;  3KUH A;  4M5K A;  4M5M A;  1G4C A;  5ETR A;  5ETT A;  1EQ0 A;  5ETP A;  3ILO A;  3HSD A;  3HSJ A;  4M5G A;  1EX8 A;  4CRJ A;  1Q0N A;  3ILJ A;  5ETK A;  1CBK A;  3HD2 A;  3ILI A;  3HSZ A;  1EQM A;  2CG8 A;  4CYU A;  1HQ2 A;  3HSG A;  3MCO A;  1RTZ A;  5ETV A;  3MCM A;  3HD1 A;  3IP0 A;  4F7V A;  5ETO A;  1HKA A; 
#chains in the Genus database with same CATH topology
 1EET A;  3N79 A;  4LR8 A;  2HND B;  3AY0 A;  2FVR A;  1S76 D;  1F5C A;  1U7L A;  3M2R B;  3HHL B;  3N9U C;  2W8K A;  3QJP A;  2RUG A;  4RBU A;  4YHH J;  1DRZ A;  2GQQ A;  3DOM A;  2HQC A;  2H51 B;  1XR5 A;  3GFX A;  4DG1 A;  2QYG A;  1JLG B;  2G9O A;  3A12 A;  5KG2 A;  1NKC A;  5FJ4 A;  5IWA F;  4PG7 A;  4HEA 9;  2E66 A;  2LU2 A;  2VPZ B;  3CED A;  3GMG A;  3QWP A;  2CQG A;  3D6F B;  2WBM A;  1F5B A;  4Y6I A;  4OZ0 A;  3NL0 A;  1OY9 A;  2XLJ A;  1PO6 A;  1P27 B;  3BR8 A;  2CQ4 A;  4KB7 A;  3E51 A;  4TY8 B;  1Q53 A;  5KFM A;  4Q43 A;  3J80 U;  2HK3 A;  1IBL J;  2YKM A;  2VPX B;  1Q82 T;  4JV5 J;  1GXU A;  1Q8L A;  1V6H A;  2OKQ A;  1I94 F;  2YNG A;  1DJ0 A;  4OI4 A;  2EFN A;  1SV5 B;  1WDT A;  2MKH A;  2ABY A;  3ZZU A;  5K8O A;  3GSI A;  2KKH A;  4N41 A;  3QRR A;  1RBA A;  2DRB A;  3AH6 A;  4G6V B;  2E1M C;  4OX7 A;  2VC0 A;  4F04 B;  1JQG A;  1FKP A;  3LWM A;  2HBY B;  4KHP F;  1W25 A;  1IR2 A;  3I87 A;  4KGX B;  4BCA A;  4XPC A;  1SCJ B;  3F44 A;  2F9D A;  3R5B A;  4WYL A;  4EMD A;  4CH1 A;  2CJK A;  4ZLP A;  5I3P A;  3I9V 9;  3B78 A;  5E3A A;  4ZVP B;  5HMW A;  4RUB A;  1BQX A;  4H4M B;  2L41 A;  3L95 X;  4NXM J;  5IZH A;  4Q44 A;  4USM A;  1FF2 A;  2F63 A;  3O8W A;  2ASJ A;  2E1R A;  4GVB B;  4DL6 A;  2GAG C;  2NPI A;  4YDX A;  2FHJ A;  4TY9 A;  5JUM A;  5KT6 A;  1QAY A;  1KLM A;  2BBE A;  1GMW A;  4ZPD A;  1AB8 A;  2CVE A;  2DNY A;  4D3H A;  2CAJ A;  3DDN A;  3CJ8 A;  3CTR A;  5IFM A;  4LF4 F;  1UFW A;  2CQ3 A;  5KTQ A;  1X4D A;  4USK A;  4R25 A;  2QA4 S;  3HT0 A;  4FF2 A;  1R8A A;  2VFT A;  4PKD B;  5KFQ A;  2EFV A;  2IFX A;  4RZR A;  2NR0 A;  2E5L F;  1XNR F;  2J76 E;  2HBR B;  1FJG F;  2FIU A;  3BGR B;  2GIQ A;  2ZJR Q;  1EAR A;  2AF6 A;  4A8K A;  3MTK A;  2EXU A;  4NZ6 A;  1VBK A;  1FRX A;  1S9E B;  2CJQ A;  2FD2 A;  3OD2 A;  4RPF A;  1J5O A;  2UUA J;  1JLG A;  2K3I A;  4KO0 B;  1T02 A;  2B7C B;  5EX0 A;  1D8Z A;  5AE1 A;  4YOE A;  1C1C B;  2WAQ D;  3AJ2 A;  2PI5 A;  2J9C A;  4JI3 F;  2CJ9 A;  2HWH A;  2AZ3 A;  2RRN A;  2XWY A;  5LSO A;  2VG6 B;  4O3S A;  1FRH A;  1SKW A;  1YJT A;  2XI2 A;  4I2P A;  2DO0 A;  5G0R A;  4PG8 A;  3KFW X;  5LJ3 Y;  3GYN A;  1SQF A;  2ZH8 A;  1OPZ A;  2QV6 A;  2E1C A;  2C2D A;  1RTI B;  1UWA A;  1WHY A;  4DSL A;  2BE2 B;  5D0H A;  4OV6 A;  2O67 A;  4LUB A;  1GEH A;  1XEZ A;  2YY3 A;  3BGL A;  2DNN A;  2CVI A;  3OT9 A;  5DGB A;  2CZV C;  1RB0 A;  5HI7 A;  2D41 A;  4CLW A;  2M5Y A;  2VL1 A;  2LQ5 A;  4N77 A;  1NK7 A;  5B0G A;  1FI4 A;  3IG1 B;  3L09 A;  3FZ2 A;  3TA2 A;  2AX1 A;  5L1K A;  3PR4 A;  3QGG A;  2DNL A;  2W2P P;  4K59 A;  2DNQ A;  4QW8 A;  4X2B A;  3AOB A;  4ILL A;  1OY6 A;  1Y4Z B;  1KHV A;  3UN5 A;  3W5Z A;  2DEJ A;  2V4R A;  4CDI A;  5KG7 A;  4ICL B;  3UVJ B;  2VHG A;  1ZYQ A;  3ILJ A;  4Y2K A;  5EDW A;  2H4W B;  1APS A;  2ALZ A;  1S1X B;  3PYD A;  3SCL E;  1WDD A;  2JL9 A;  4DUT A;  4LFA F;  4KT0 C;  2HG4 A;  1X60 A;  3SMZ A;  3OBI A;  2RH3 A;  4UZC A;  4ECV A;  2ZBP A;  2ASL A;  2H3E B;  4FYV B;  3GJT B;  3M30 B;  3IA0 A;  2UUW A;  3WZ0 A;  5AXL A;  9ATC B;  3QFH A;  3OUY B;  4P7V A;  1WOS A;  4P75 A;  2WVC A;  2A1B A;  4ZVS B;  4OZ2 A;  2EFO A;  4PXE A;  1XC9 A;  4NAS A;  1IKX B;  2C22 A;  3P6Y C;  3QAE A;  2XSF A;  4RWX A;  3GFZ A;  4P9S A;  5B0F A;  2PMH A;  2R8I A;  3BKU A;  1HWK A;  1SH0 A;  4IFV A;  2B51 A;  3A8I A;  1Y9O A;  4YB1 P;  1X4C A;  5DM7 Q;  5HQ8 A;  1J27 A;  3GIM A;  3JSB A;  4JI0 F;  2ZH3 A;  2A2C A;  2LVW A;  2V8H A;  1KKH A;  1C4A A;  3BZQ A;  2IRU A;  1J5E F;  4ILM A;  2E44 A;  3WBZ A;  5B09 A;  5L39 A;  3PW5 A;  5L38 A;  3NGR A;  3BH6 B;  4Y28 C;  5F41 A;  4DU8 A;  3IR6 B;  5HJY A;  3RRH A;  4S0M A;  4MFB A;  1WC0 A;  1ZZF A;  3BGO P;  4OLO A;  5LOQ A;  3NS7 B;  3T1H F;  1WF2 A;  1NJI T;  1S9G B;  1GMU A;  3M2U A;  5J1E B;  3MM7 B;  1KD1 T;  2RB7 A;  2DR8 A;  3CJ3 A;  2QLX A;  4CCH A;  3HKZ D;  4QBU A;  3MMC B;  2DK2 A;  1VR6 A;  5A6W A;  5C5J A;  2CJB A;  1VJQ A;  3HKW A;  2FTR A;  4IO1 A;  5BYQ A;  4F3M A;  2MKI A;  4CLU A;  3CCV S;  2XB2 D;  1RYS A;  1JLB A;  2ZKU A;  3R5G A;  4IDK B;  5CYM B;  2OHD A;  1U6B A;  3H2U B;  2H4Y B;  2HFN A;  3I32 A;  3MUR P;  3SYZ A;  4U6P A;  1B7F A;  3LA0 A;  1X0F A;  3CJ2 A;  3KHL A;  2VOD A;  2A2D A;  4K5R A;  3U7J A;  2WOM A;  3CJ0 A;  1VRU A;  2CWX A;  4Y2M A;  2OFH X;  3HK2 A;  3J7A N;  2QL9 B;  3HFV A;  4B3M J;  4X4V A;  5GAE I;  3KJV A;  3NMR A;  3DCA A;  3VQT A;  3ELH A;  3ZXW A;  2AGP A;  3PX4 A;  1SJR A;  3R2D J;  3RB3 A;  3JTP A;  2XCP A;  3KLH B;  3H5X A;  2AEM A;  3K7R A;  2B9X A;  2MEW A;  1IR1 A;  1XJW B;  3FCH A;  4WTY A;  4O3N A;  3UN3 A;  4ZCM A;  5L9N A;  3VR1 A;  3G82 A;  3DRR B;  2YVS A;  3V4I B;  4NI2 A;  5F8J A;  4H54 A;  4ZP6 A;  2BUN A;  4IKA A;  3EDQ B;  1T9U A;  4ZPA A;  4KV8 B;  4B9S A;  4YDD B;  2R2T A;  4YR2 A;  4TQS A;  1TL1 A;  1HFE L;  1WF0 A;  3OTC A;  4DPY A;  1KVI A;  2CJX B;  4U7C A;  5A8W A;  2JLE A;  4PWW A;  1RT4 B;  2V4J A;  5DZ7 A;  4DFJ A;  3ZTS A;  3RBE A;  3K0J A;  3EUN A;  3QJJ A;  2E7V A;  4N47 A;  4DU7 A;  1VQ4 S;  4ZLJ A;  4K4V A;  4B3M F;  2BJ7 A;  5M2P A;  4USI A;  5J2M A;  1JWW A;  3PW4 A;  4HI2 A;  1UJ4 A;  4J9P A;  1SKU B;  5KT5 A;  1SB6 A;  3KXD A;  3MM6 A;  1VQM S;  3TUZ C;  2FJD B;  2OPP B;  3EGW B;  3W2W A;  4MIB A;  1N34 J;  5D8H B;  4IH6 A;  4F4X A;  3MM9 A;  1H3D A;  2IC3 A;  4DV7 F;  2F8M A;  1XMO J;  2J7U A;  3ITH B;  3TX8 A;  4DPW A;  3LOU A;  2I5J A;  1U25 A;  2ADC A;  4NXM F;  1NM2 A;  3EE3 A;  2VG7 A;  3FDS A;  5IT4 A;  2VG5 A;  3G6V A;  1PGZ A;  2OEL A;  4FP9 A;  4BLG A;  4M5N A;  1VQ5 S;  4FYD A;  4W90 B;  5CAA A;  1S6P B;  3GE9 A;  1LW2 A;  4GRS A;  2CQH A;  4CM0 A;  4ETZ A;  1DY3 A;  1R43 A;  1VDH A;  3MMA A;  2B6A B;  1D09 B;  5D4L A;  4OX9 F;  5DDO C;  4TU8 A;  5KG1 A;  2GQC A;  2L9N A;  1F3F A;  3D3C J;  3ADA C;  5IQQ A;  3OLA A;  2VA2 A;  1AZS A;  4BC9 A;  1S4E A;  3OTE A;  5KFG A;  4V19 X;  1SKR A;  2HRU A;  1QTM A;  1AFJ A;  2R4F A;  2GS8 A;  2R7Q A;  4LRF A;  1I94 J;  3OL7 A;  5KOW A;  1YHQ S;  4RKU C;  2QYC A;  2V68 A;  3HHE A;  2C2R A;  3CD0 A;  3NEK A;  1VJW A;  3RTV A;  1UEV A;  1PIL A;  3UDE A;  3VZH A;  2VBX A;  3QT5 A;  1X8D A;  5HRO B;  3CCE S;  3FQK A;  1NJX A;  2M8D B;  4DR5 J;  2MKJ A;  3N28 A;  2DR5 A;  1FJC A;  1LW0 B;  2H1Y A;  3AOA A;  4I4B A;  5DRK A;  3GJS B;  3Q22 A;  3J7A 1;  3JSM A;  4A8Q A;  2JEJ A;  3DM2 A;  2K8G A;  4ECY A;  1YZ6 A;  2N7C A;  2KB2 A;  2HHW A;  1C0U B;  5SZT A;  2HLT A;  3KG4 A;  3B6B A;  3D0G E;  1RT5 B;  3OXG A;  3EGN A;  3CMQ A;  2ZVI A;  2DGX A;  2ZOM A;  5JVG Q;  4J5O A;  2LEC A;  4LF6 J;  2DCU B;  4DFM A;  1M5V C;  3D6H B;  4J9O A;  4FF3 A;  1FJG J;  4IG0 B;  4J9U E;  5DG9 A;  2AJ2 A;  4O4G A;  1LFP A;  4ZP8 A;  1QAJ A;  4ZJQ A;  4DV1 F;  2UUB F;  1QE1 B;  2PA3 A;  4CLT A;  3QJL A;  4Q8F A;  2NXC A;  3LP2 A;  2LXU A;  4DX8 H;  2JX2 A;  3GYX B;  4KKO A;  2Q43 A;  3I9Z A;  2DKO B;  2UUT A;  4PRF A;  3CSK A;  1HBM B;  4FF1 A;  2QT7 A;  5IM0 A;  2FGO A;  2Y1J A;  4EBC A;  2RS2 A;  2PGC A;  1RWN B;  4DN9 A;  1FVS A;  2ZD1 A;  3QGH A;  3ZZ0 A;  4DCP B;  4DV2 F;  3T3F A;  3IGN A;  1DFD A;  1WKJ A;  4LQ9 A;  2LYV A;  1RUS A;  3R2C J;  1QE1 A;  1AUS L;  1RWU A;  4WP8 A;  1B4S A;  3OVB A;  1FDA A;  4O23 A;  5T7L B;  1RKJ A;  5IQ6 A;  3QAU A;  2LKZ A;  3D1H A;  5GAD U;  1UVN A;  2G2Z A;  2BJ8 A;  3W61 A;  2HPU A;  5KFO A;  4DR7 F;  2FZC B;  2LA4 A;  2GJF A;  4NA2 A;  3Q8V A;  4NLP A;  1YZ7 A;  1IBK J;  3PHE A;  5AE2 A;  1ULR A;  3D6T B;  2F4F A;  2OD6 A;  1RTZ A;  2G0J A;  1IWG A;  2D1C A;  2Z58 B;  4LJM A;  4YB7 A;  1FFS B;  3SSS A;  1TFY A;  2DNR A;  2O1P A;  2RQK A;  2IA6 A;  2BAC A;  4DFP A;  4C4W A;  3L7P A;  3K5O A;  3DLK B;  3FBB A;  1S6U A;  4CIO A;  4ZPB A;  3EJM A;  2X3D A;  3CUL A;  1A6L A;  3M8Z A;  1LW0 A;  4USW A;  2C3Y A;  4ZJL A;  2F4V J;  1I1G A;  3MPU B;  2VQF F;  2RRA A;  4M95 A;  2KXH A;  1UVJ A;  4ECW A;  2AYM A;  1JIH A;  2HBQ B;  4UTG A;  1BWE A;  2UVV A;  4E98 A;  2XNR A;  4DPO A;  1NSP A;  1QLN A;  1MG7 A;  1OQ6 A;  4TLR A;  1FE0 A;  1TFW A;  1O0P A;  2P6S A;  1G4C A;  2ZZT A;  3MPD A;  1SJ3 P;  3I4P A;  1RAE B;  4JV1 A;  3AT1 B;  3S01 A;  3TUI C;  3QT8 A;  1NDC A;  5FDL B;  5DET A;  2XLI A;  4C3L A;  4YN3 B;  1FTR A;  3BPD A;  3IFE A;  4AXI A;  3PV8 A;  3SDE B;  1RWX B;  1RT6 A;  1U6Z A;  5GAG U;  4ELV A;  1FVQ A;  1CJK A;  4G3I A;  3AOD A;  4C48 A;  2A18 A;  2ZBC A;  3DGV A;  3K2Y A;  4EZ6 A;  1LW2 B;  3TAP A;  2UXD J;  4NA1 A;  2BJE A;  3TUJ C;  4AT1 B;  2F65 A;  2F8H A;  3FFI A;  3MED B;  3C16 A;  5ETN A;  1UW4 A;  5LXY A;  2GHP A;  3M6V A;  4CLZ A;  2GJI A;  1SUQ A;  2FHO B;  4NLW A;  3D28 A;  2FJX A;  2Z2L A;  1B7Y B;  3VAM A;  1QAI A;  2QLW A;  1WSR A;  4LRA A;  3VF0 B;  2MZT A;  3G8T A;  3W2W B;  1IM6 A;  1RAG B;  4MIA A;  4Z7C A;  4F36 A;  2CPZ A;  1WC6 A;  3W7B A;  3NNA A;  1K1S A;  4U8Y A;  3CNQ P;  3MAA A;  4UUW A;  2GO9 A;  3HVW A;  4CT8 A;  1UWB A;  3ZZY A;  1X5P A;  2AP6 A;  4CO3 A;  3J7Z 5;  1KC8 T;  2DNH A;  3HX9 A;  2RHS B;  2FUG 9;  1QDU B;  1SIW B;  1S48 A;  2CPH A;  2XHC A;  3MM8 B;  4BC7 A;  3OJU A;  2FZG B;  4QW9 A;  3MR6 A;  2CNL B;  4ZLL A;  2LQB A;  4M5H A;  3CD7 A;  2HWT A;  2XI3 A;  1RAJ A;  4MK9 A;  2RQ4 A;  5L1I A;  1RQ0 A;  3CE8 A;  2GVZ B;  4WE1 A;  4I69 A;  4WKR A;  4OYO A;  3KLG B;  1RLD A;  2YQ0 A;  2DPI A;  3H90 A;  4HHU A;  3M7V A;  4FYX B;  3V4I A;  4JI1 F;  1P9Y A;  2GZO A;  4OYX A;  5AJ3 F;  1VQ6 S;  1WD6 A;  4KFB B;  2Z2Z A;  3VAI A;  1RTD B;  5H9E J;  4WFA Q;  4W92 B;  3JQM A;  5KFN A;  1HA1 A;  4WP3 A;  3RAX A;  2UUB J;  1JLF A;  1BHN A;  1IXK A;  4QYZ K;  2AEF A;  2C3U A;  4U67 Q;  4RNH A;  3BSA A;  4EI2 A;  1TUG B;  3CIM A;  2W9C B;  2YXL A;  4KIA A;  2BE9 B;  1TL4 A;  1D8Y A;  1RAC B;  4LMZ A;  4X4N A;  4ZPV R;  1EQM A;  2OEM A;  2DIT A;  3PNI A;  2W7P A;  2D69 A;  3IAM 9;  1ZET A;  2JLF A;  2K1R A;  2QFI A;  1RZM A;  3EVO A;  1IBM J;  2Z30 B;  3M4X A;  4L73 A;  2J6T A;  3PHT A;  1VIO A;  9RUB A;  3LGN A;  4DR2 F;  1B99 A;  4WIQ A;  3ZTO A;  1YWX A;  1ZPV A;  2C2E A;  2KHD A;  2VF3 A;  2JJ4 D;  4NXN F;  1N54 B;  1PG5 B;  3I0R A;  3IRX B;  3MEE B;  4DDF A;  4YR0 A;  2KG1 A;  3CC4 S;  2KTQ A;  3BYP A;  3PFE A;  4NLQ A;  5DJB A;  4WFN Q;  2EK1 A;  5A8R A;  2P2C B;  1F0X A;  4C3K A;  3HVT B;  4QR0 A;  2AX0 A;  5DG8 A;  1GAO A;  2B5J B;  1W2I A;  1IWA A;  3KLF A;  5HSP A;  3HPO A;  3K57 A;  3HSD A;  4ZCI A;  1HMV B;  3M2V B;  1CLF A;  4CO5 A;  1URR A;  2EPI A;  2JC1 A;  4LF1 A;  4ZN3 A;  2G1D A;  3ETO A;  1PIE A;  1PSD A;  1MU2 A;  4XK8 C;  2ZNY A;  3A4T A;  3AA9 A;  1XK8 A;  2H65 B;  4C97 A;  4WBF A;  2YX7 A;  5DGA A;  3B82 A;  3LTO A;  2IDL A;  5EX3 A;  2AQ4 A;  4RW6 A;  1NRK A;  2BM1 A;  2ZC4 A;  3OFG A;  4ECQ A;  2IM1 A;  3R7B B;  4USV A;  4O3O A;  3DN9 A;  4Q5V A;  5IT9 Y;  3O1L A;  4ATN A;  3T9N A;  4DV3 F;  3M6X A;  4J9Q A;  3LPE A;  3FC9 A;  1R8B A;  4OYZ A;  1ICE B;  2YBV A;  3CVK A;  1IKV A;  5T14 A;  2JWN A;  4N56 A;  2HVE A;  1FRM A;  3OQ2 A;  3MGJ A;  2XMV A;  4JI2 F;  5D0E A;  1MU2 B;  3T6B A;  4DL4 A;  2ERR A;  5EWF A;  4Y2C A;  4DX6 A;  1XIQ A;  5A0Y B;  3BDE A;  2MKK A;  2AV5 A;  4HYK A;  3A3O B;  2RS8 A;  4MKA A;  5CHC B;  3MEG B;  2RDJ A;  4PUO B;  2KH9 A;  5C25 A;  2E5G A;  5GAE U;  5KFL A;  1QVF R;  5KT3 A;  4X62 J;  4F2S A;  1IN0 A;  3LO3 A;  4C0O C;  2AYE A;  2IVF B;  3CIZ A;  5J2P B;  2GO8 A;  2PD1 A;  2AJQ A;  2RIL A;  1YLX A;  3LAM A;  4RNM A;  3FSI A;  3B8H A;  1QSS A;  2CIM A;  3OR1 A;  4NRU A;  4FXV A;  4ELU A;  5E3Q A;  2HFZ A;  3PFO A;  2EBG A;  4MK8 A;  3J81 Y;  1RAI B;  1R27 B;  5LJ5 Y;  4Q0B B;  4P2M A;  3LF0 A;  1SBR A;  2QIF A;  3DRY A;  1S7I A;  3K8W A;  4YQW A;  2B9Y A;  2OPS A;  2ASY A;  1CJU A;  4L6V 3;  2WK4 A;  3P4U B;  1U48 A;  3RW6 A;  1BC6 A;  2ZH9 A;  2NZ4 A;  1UJ6 A;  2HHP A;  1NU4 A;  1B0P A;  4ZKA A;  3UNG C;  2LEP A;  4HI1 A;  2LCW A;  2DHX A;  3NS6 A;  3TOQ A;  3OHB A;  2DGW A;  1P9Q C;  2W9C A;  1NK5 A;  1RYR A;  3I55 S;  3C14 A;  4QQB A;  2ZOG A;  1JK9 B;  1YRT A;  4X66 J;  2FY8 A;  1OJ4 A;  2I6W A;  3THP A;  1IM4 A;  4KO0 A;  1U0H B;  4HDH A;  3PZP A;  2E1P A;  2V8D A;  4OZ3 A;  5GMK a;  4DLG A;  3EM1 A;  1U0S A;  3OJS A;  4EU0 A;  3HT3 A;  3BO4 A;  2EVZ A;  3TQE A;  3BGF A;  4DL3 A;  3W65 A;  2ZH7 A;  4E0D A;  4EZ9 A;  1BE4 A;  4B17 A;  4I64 A;  4M1K A;  3PEJ A;  2RRB A;  3I0S B;  2HK2 A;  4LF8 F;  1JLC B;  3TAM A;  2DNZ A;  1X5O A;  3U27 A;  4UY8 T;  3A8E A;  3IS9 B;  4Q7A A;  4UQT A;  2ACY A;  2DT9 A;  2QMX A;  5E7O B;  5F8H A;  5LMU F;  1TK8 A;  1FJE B;  3IS9 A;  4BDP A;  5I42 B;  3TAR A;  1ZTT A;  5FD1 A;  3GCW P;  4DQI A;  3MUM P;  4GVL A;  2CZ4 A;  2ZJQ Q;  1KLM B;  3RGI A;  2XZD B;  4GKK J;  2MKY A;  2RT3 A;  2F4V F;  2HNY A;  2BKP A;  4PG6 A;  2D9P A;  3KDN A;  2RE1 A;  4GVB A;  3TEH B;  3W63 A;  1QVG R;  4ZIV A;  3PY8 A;  1U0H A;  2YQ3 A;  1RWO B;  2ZUA A;  4QIV A;  1NHU A;  2V6A A;  1DQ9 A;  2HHU A;  2CKW A;  5EUH A;  1JMT A;  2HQF A;  3V4M A;  2EK6 A;  4OZJ A;  4RW4 B;  2D3O 1;  1VLY A;  5D0G A;  2GC8 A;  5JXS A;  1CJK B;  3UI3 A;  1B64 A;  1F2G A;  3LP0 A;  4X64 F;  2FLP A;  1R8H A;  2C3M A;  3SEO A;  2C3P A;  3CJR A;  4GO7 X;  1S1W A;  3ZC4 A;  2HHS A;  4DQQ A;  5I3Q A;  4DV7 J;  1TL5 A;  2YNG B;  3DGP B;  4DV2 J;  2OMO A;  3HHL C;  4MKY A;  4U8V A;  1Y5N B;  4N5S A;  4LBH A;  1GH8 A;  1FTC A;  1JNR B;  1VK8 A;  4F4A A;  3MMJ A;  2ZH5 A;  4NLG A;  2E9T A;  1MN7 A;  1H2U X;  2R2R A;  1UET A;  3D66 A;  3KMS A;  3HLU A;  4DV6 F;  3W3S A;  3W62 A;  1S0O A;  5EHH A;  1WG4 A;  4EYI B;  2NXJ A;  1K73 T;  4LQ3 A;  3GII A;  2HLU A;  4DR4 J;  1TEL A;  2BW2 A;  3FKB A;  4LRC A;  1TAU A;  1KN6 A;  3PEH A;  2OD4 A;  3DLK A;  4H4O A;  4D3G A;  1RCO B;  2W8L A;  2AT1 B;  4DG1 B;  3GV7 B;  1QSY A;  1TK5 A;  1FDD A;  3JTO A;  3QT7 A;  4N8O A;  1VBZ A;  1EKS A;  2XSJ A;  3TQ1 A;  1S99 A;  4IQX A;  1CVJ A;  1FNM A;  7FD1 A;  1BWV A;  2HEK A;  3E01 B;  5MLC V;  1EET B;  3ETM A;  1SC1 B;  2XO7 A;  3HZG A;  3GP9 A;  4WXO A;  3TZY A;  2Y1R I;  4DEZ A;  3HFZ B;  1HR0 J;  1TZ0 A;  1LWF A;  2XQC A;  1FO1 A;  4OZ1 A;  4BBY A;  1T03 B;  2WW4 A;  2ZD1 B;  5AXM A;  3D2W A;  3RUB L;  3HF5 A;  4RW7 A;  1KHW A;  2VIC A;  4ED1 A;  2R8K A;  4NLU A;  4B3T J;  1LWC A;  4TNO A;  1RT3 B;  4JV0 A;  1F3V A;  3DYA B;  1U47 A;  1N33 F;  3CCU S;  2ZH6 A;  2KT3 A;  1CJT B;  4IH7 A;  2N82 B;  4HT5 A;  5BYR A;  3W8P A;  2ILZ A;  5DQI A;  2MGZ B;  4P7T A;  2WW8 A;  3R6L B;  4LSN B;  3H5Y A;  1WG5 A;  2HGN A;  2UXB F;  3QLH B;  2B5J A;  2JC0 A;  2DGV A;  3PG9 A;  5SUH A;  4K4X A;  1X5S A;  3ICL A;  2QLF B;  3AD7 C;  3OL8 A;  5JVH Q;  3PKM A;  5KFW A;  2V9K A;  1FER A;  3IRX A;  1HQE B;  5B0D A;  5DLG A;  4DV5 F;  5JMN A;  2HRT A;  1XER A;  3ULH A;  1N48 A;  4PR6 A;  1TTH B;  1A9N B;  2VFV A;  3GYG A;  1FD8 A;  3IN5 A;  4PAB A;  1AXQ A;  4I7F A;  4QWA A;  5J2Q B;  2G4B A;  1VCT A;  3N6N A;  1JJH A;  1NEE A;  4KPC A;  4L76 A;  1I51 B;  2EFQ A;  2PFD A;  2BVZ A;  3MCN A;  4ED3 A;  1Q8I A;  4ZS6 A;  5K8P A;  4DS5 A;  1VLO A;  4G65 A;  4CO4 A;  3VAH A;  1F9F A;  1H72 C;  1WI6 A;  2WZ1 A;  4OIX A;  4ZVU B;  3DMJ B;  3FNN A;  2XGQ A;  1V3R A;  4RUH A;  3BDP A;  1RBL A;  1IBM F;  3CCZ A;  1LXJ A;  1RT2 B;  1S57 A;  3MOZ A;  1AZS B;  2MKC A;  3NY0 A;  4DQP A;  4G1I A;  2R8H A;  2KT2 A;  2YQ1 A;  4IQM A;  1HD1 A;  4KFB A;  1RAA B;  3MR2 A;  3OVS A;  2UUC F;  4O0I A;  2CDR B;  2FJB B;  4KR0 B;  1XNQ J;  4DR6 F;  2CPD A;  1S6P A;  2CA9 A;  1FRJ A;  3K89 A;  5LMU J;  2NUU G;  4KY3 A;  5J2N B;  2GVZ A;  1ZOT A;  3T5H A;  1NBE B;  4FPI A;  5DM6 Q;  3OFF A;  5C24 B;  1KOO A;  4YR3 A;  4ED6 A;  4HAC B;  2H9Z A;  3T6J A;  1DAX A;  1RAD B;  1K1Q A;  2CFX A;  5F9L A;  5CXT A;  3QRP A;  4QR2 A;  3SV3 A;  4AE5 A;  2LP4 A;  3M32 B;  3NBP B;  4YY3 F;  3OTD A;  2OPP A;  3SI8 A;  3CCJ S;  1CEZ A;  4XPE A;  3SCJ E;  3M8P B;  1WOO A;  4M5I A;  1TK0 A;  3PO5 A;  2KT5 A;  2APO A;  4L72 B;  5IOL A;  3PRV A;  1JLE A;  4MH8 A;  3VAL A;  5E2Q A;  1KS2 A;  4DV3 J;  1VYA A;  4PYD A;  4U7U D;  4Z2X A;  3AB2 B;  5D4N A;  1N5V A;  3Q24 A;  5KG3 A;  2CG8 A;  5LMN F;  3BKF A;  1EIY B;  1UVM A;  3MPW A;  1NJY A;  5J2N A;  4F8R A;  2EWH A;  1NZA A;  2YNH A;  3HHD A;  4DPT A;  4M5D B;  4CLK A;  1V3Z A;  2VON A;  3SCI E;  3T19 A;  3DRR A;  2QA2 A;  4NE9 C;  2HVD A;  3DMJ A;  4AND A;  4Q2L A;  3CJK B;  2RKI B;  3SDE A;  2FJV A;  3R1H A;  2VBY A;  1RT2 A;  3H0P A;  4ES1 A;  3J80 Y;  5FDL A;  1SQG A;  2Z8Q A;  4CO0 A;  3VVT A;  1TUV A;  2WB1 D;  2MQO A;  4ID8 A;  4KBI A;  2WTF A;  1VC6 A;  1M5O C;  4RNO A;  4DCO B;  3CJQ A;  3CO0 P;  5ETR A;  1N5T A;  3M1V B;  3CCW A;  4XDC A;  1GX5 A;  2OO4 A;  3OR2 A;  4L75 A;  2ZM6 J;  2KYX A;  3M9N B;  2HS4 A;  4O44 A;  1HQE A;  4R5P A;  1LWE A;  3BQ1 A;  3TVZ A;  1OSC A;  2HQG A;  4I2Q A;  3DRS B;  2QMW A;  4TN2 A;  3DNC A;  2B4P A;  4ZVH A;  1NXI A;  3TVK A;  4UT4 A;  5D78 A;  3CCL S;  3GIK A;  2R7V A;  5IT0 A;  3JTN A;  4FNI A;  1KWM A;  4LSN A;  5GME A;  2GA7 A;  3ZZP A;  4AUK A;  4DX5 A;  1Q7Y T;  1R6Y A;  2RSQ A;  2J6S A;  2J5A A;  1NDP A;  2YKP A;  3HFK A;  4LFA J;  5H9F K;  3EDR B;  1RHU B;  3TO8 A;  1RTJ B;  1U6F A;  2M70 A;  2XYP B;  3CGI A;  3WX4 A;  2MHN A;  3FBF A;  1U1R A;  1R8C A;  1NSQ A;  3OL6 A;  3EPG A;  5KFJ A;  1RI7 A;  2QG9 B;  2B9E A;  4FXD A;  2MST A;  3KUH A;  1UVI A;  1U1O A;  2QGF B;  1T03 A;  4USH A;  3BR9 A;  5K8M A;  1NB7 A;  2G1H A;  4M5G A;  4NEY A;  4JI5 J;  1GK8 A;  2YKA A;  2R7X A;  1LWF B;  4FYY B;  4URG A;  5B0E A;  3ILI A;  1T0T V;  3TEG A;  4IFV B;  1ZAX A;  3DXS X;  3PTW A;  1H74 A;  2XS2 A;  2HVZ A;  2BJ3 A;  4USJ C;  1GXT A;  3MWB A;  2DHH A;  4B3S F;  3ILL A;  4UF4 A;  3E01 A;  2MQQ A;  4ITS A;  2M4M A;  2AGO A;  1WKK A;  2IYG A;  2V2V A;  4O4G B;  3PDN A;  3VTI A;  3IWX A;  2F1F A;  2J0X A;  1FEE A;  1REV B;  3BRE A;  4DPU A;  2NYI A;  3OTO J;  2BYC A;  1X9S A;  4I0W A;  4RU9 A;  4K4Z A;  4JP8 A;  4RBT A;  3U02 A;  4FN5 A;  1JKH B;  2DNM A;  1N32 F;  1H2T Z;  3H2V E;  2AHO B;  2QEX S;  1SXL A;  1YG0 A;  2B8P A;  3I31 A;  5CYJ A;  2MTL A;  3I5A A;  3OW2 R;  5KG4 A;  3UR3 C;  2BQR A;  5DDQ C;  3K8V A;  2DRD A;  2WVD A;  4F0M A;  2V34 A;  1TKZ B;  3BYR A;  4RLE A;  3UCZ P;  1VC0 A;  2Q1L A;  1WKL A;  2N4C A;  3O5T B;  2FJE B;  4U9R A;  1CBK A;  3HD2 A;  2GML A;  3EPI A;  1N5Q A;  1JX4 A;  2IY5 B;  4OL8 A;  1DQA A;  1UZD A;  4J9N A;  2ASD A;  4A8M P;  3JSR A;  3CCT A;  1HBO A;  4L3K A;  4Y65 A;  4WCE Q;  3CW2 C;  1VQO S;  2ZBR A;  4KRW A;  4C9D A;  3LP0 B;  2KYZ A;  2Q3P A;  1BQN A;  1AT1 B;  2RIJ A;  4J7C A;  4DL0 C;  3OV7 A;  1YGY A;  2ZDP A;  3F56 A;  4NX9 A;  1VBY A;  2CPI A;  2DRA A;  2FGC A;  4IOB A;  1HWL A;  2C2O B;  3LAK A;  1FRL A;  5THW A;  2XYG B;  3VHQ A;  1HWI A;  2E1A A;  1PJ6 A;  1SJ1 A;  4PG4 A;  4DHV A;  1ZAV A;  1F1B B;  1PYO B;  1FEH A;  2MB0 B;  1SJQ A;  1E6V B;  2ZBI A;  2NSB A;  3WX8 A;  2VG5 B;  5KOX A;  3Q2S C;  2HNY B;  4K8R A;  4LF5 F;  2Y9H A;  4K0K F;  2HHV A;  1QUP A;  5D3G B;  3ITH A;  5M2R A;  3R5A A;  1WOP A;  1T9T A;  5DLF A;  2LA6 A;  3MD1 A;  2F9J A;  5I42 A;  3SIP B;  2LEA A;  2V69 A;  1DTT B;  2FHK A;  2HFU A;  4PXC A;  3AD8 C;  4OHV A;  3MM6 B;  4DR7 J;  2R2U A;  2U1A A;  2GVD B;  4NZ0 A;  4RL1 A;  4QWC A;  3H4B A;  3KLI B;  2BMB A;  3MEC A;  2XY7 A;  2ATL A;  4LF5 J;  3D0I E;  5BYS A;  5E41 A;  3NCR A;  2XTJ P;  1B70 B;  1YJV A;  3IBF B;  3MR5 A;  2K3K A;  1JLC A;  3TAM B;  3L3C A;  3SV4 A;  4MK7 A;  1VC5 A;  3CDA A;  3AXK A;  1X5T A;  2AJ4 A;  2VBW A;  1YSJ A;  3QMQ A;  4PAA A;  2IDE A;  4P52 A;  1UZH A;  3T1Y J;  2VKZ G;  3Q89 A;  4KV8 A;  1FWP A;  3TJ9 A;  1E6V A;  3L7U A;  5MAO A;  2Y3Y A;  3RB0 A;  3VGV A;  2QTW A;  4C8N A;  3CCM S;  3C15 B;  3BSN A;  1NLK L;  2D7S A;  2XEX A;  2DNO A;  2YNI A;  1MW7 A;  1YJ9 S;  2YX4 A;  1LOU A;  3Q23 A;  4YB5 A;  1P1L A;  5B0A A;  4C2M A;  4DUZ F;  2R7T A;  2COL A;  4LFB F;  1FD2 A;  5HN0 A;  4PQA A;  1M5K C;  2XMT A;  3CUN A;  2XS7 A;  1RAB B;  1CJU B;  5EGY A;  2HZV A;  4B9N A;  5KFD A;  4J9M A;  1PC4 A;  4X65 J;  4ZVO B;  2Q6B A;  4CLL A;  1KQG B;  3RJM B;  2KVQ E;  3KOA A;  2C2K B;  5EWE A;  1VRU B;  3G8S A;  4ZP7 A;  1X9M A;  1HBO B;  4DV0 J;  1UFK A;  1SV5 A;  2L08 A;  2OPS B;  3GU0 A;  3L7O A;  3OR1 B;  4OI2 A;  3TRG A;  4YS2 A;  4C7Q A;  3J81 U;  4QWE A;  3KLV A;  4OI1 A;  4XAK A;  3UR0 A;  1REG X;  2NLW A;  3DDK A;  2VU5 A;  2Z57 B;  4CTA B;  2XMU A;  2J9E A;  1FXD A;  3G86 A;  1FDB A;  1IQZ A;  3NS5 A;  3VAG A;  2DCL A;  5CCL A;  5KG0 A;  1UFL A;  2ZIT A;  3M8W A;  1Q86 T;  5EN1 A;  1K0V A;  3S6E A;  2BQ3 A;  4ZOS A;  4NOH A;  1NND A;  3MM7 A;  3S1T A;  1OYD A;  1SQE A;  2M52 A;  3IMQ J;  1HKA A;  1Y3K A;  2YH0 A;  3NAI A;  4IH5 A;  4FKX A;  2QA4 G;  4MFB B;  3THV A;  2WON B;  3BV8 A;  2FHM A;  1MLA A;  3V6J A;  1YX2 A;  1IKV B;  1ZM2 A;  2R7O A;  2B8Q A;  3MEG A;  4I6Y A;  3ZZO A;  1M5S A;  2CQB A;  4ZA1 A;  4C11 B;  1LK5 A;  5A0Y A;  2HBZ B;  1XR6 A;  4YY3 J;  1S49 A;  3CCR S;  3THT A;  3W5X A;  4ECT A;  3KHH A;  2MZJ A;  2MLY A;  4KSE B;  2RQM A;  1TV6 B;  3AA8 A;  4CP5 A;  1RA6 A;  2B43 A;  2L48 A;  2A6M A;  2ZBQ A;  4LRE A;  3GG0 A;  2MLZ A;  2W2N P;  5KAK A;  1HNI B;  2IPO B;  5H1S V;  1YI2 S;  4NWB A;  2IYI A;  3P3D A;  4FYW B;  1JLA B;  3RBX A;  1HWJ A;  1PAU B;  1DZ5 A;  1U09 A;  4C11 A;  2YWK A;  3E3X A;  2KHC A;  1EQ0 A;  1HL6 A;  4B3T F;  3W5Y A;  1QJH A;  2UV8 A;  4HH1 A;  4A4J A;  2CG4 A;  3H8Y A;  1U2F A;  4Z37 A;  2C2N A;  4ED8 A;  4QIW D;  1SI9 A;  4CNZ A;  1S1X A;  2JEI A;  4CLY A;  3VCD A;  4LF9 F;  2ZJP Q;  3KLF B;  3TJ8 A;  2LQ9 A;  1KNZ A;  3UVJ A;  1XWL A;  5BR8 J;  5LSR A;  3WIV A;  1KR4 A;  3HVT A;  1FJ7 A;  1B0V A;  4LSL A;  1TL7 A;  1HNZ F;  2UVU A;  4B3R F;  4CTA A;  2GX8 A;  4Q8E A;  3I0R B;  3MEE A;  2RDI A;  4R5P B;  1Y5I B;  2K1R B;  1U1Q A;  1WJ9 A;  3A1Y G;  4F67 A;  3FJ2 A;  3NRB A;  4KQZ A;  1KRP A;  1T7P A;  2OPQ B;  2EW9 A;  1K8A T;  4EFA C;  4DS4 A;  2RJZ A;  3VQS A;  4GC6 A;  5IV4 A;  1N56 A;  2E5H A;  5K8N A;  3PX0 A;  3TAN A;  2AKW B;  2OAU A;  4RJV A;  2C2Z B;  4F2R A;  4OMF G;  3KJF B;  2XWX A;  4I6A A;  1JXV A;  3EGV A;  3H2L A;  1EP4 B;  2MY7 A;  3PYE A;  3CC2 S;  4Y2A A;  4QWB A;  2ATC B;  3SZ2 A;  2P8I A;  2G13 A;  3CJK A;  3C15 A;  2YWE A;  4NCG A;  3NP5 A;  2MDA A;  2VPY B;  3FSX A;  5HLF B;  2IM2 A;  2Z0G A;  4FVM A;  4M5D A;  5KFX A;  2YNH B;  2A0F B;  1WTB A;  4B08 A;  1C1C A;  2V67 A;  1OWX A;  3DLE B;  1XN9 A;  1R31 A;  2E29 A;  3SFU A;  4HVZ A;  5HQL A;  1FKA F;  2DHG A;  8ATC B;  4P72 A;  2ZEJ A;  1SH2 A;  2PT0 A;  3D68 A;  4DF4 A;  1ZAW A;  5KT7 A;  2J0Q D;  3KK1 B;  1EJ7 L;  4HDG A;  2W9B B;  4K50 A;  4ALZ A;  4TVA B;  3FQL A;  2OIH A;  5L46 A;  1FFG B;  2GVD A;  3O44 A;  1RXO B;  3MF5 A;  3NWG A;  3T1H J;  2B4U A;  3M8P A;  3HZE A;  1DTT A;  1NSA A;  3FVY A;  1TL3 A;  1CS4 A;  3SCK E;  1S9F A;  2J0S D;  3DHW C;  4OFZ A;  4ZVT B;  1BD6 A;  3DRP A;  2CZ9 A;  5B08 A;  1NKB A;  2I2Y A;  1JXE A;  1WC4 A;  4DSI A;  4MKV A;  1M0S A;  4C0B A;  1HNX F;  5BR8 F;  2BAB A;  2R42 A;  4RUC A;  3C16 B;  1Y00 A;  3G6X A;  1D9F A;  2X1G A;  3G71 S;  3TAQ A;  2N3L A;  4J9K A;  3RR7 A;  1RU2 A;  1VIX A;  3DU6 A;  1FXL A;  3GPA A;  2HQD A;  1N52 B;  5ETQ A;  2FQQ B;  1MMN A;  3P96 A;  3HHK A;  1RT6 B;  1RA7 A;  2ROE A;  4OI0 A;  3T1Y F;  1HBU A;  1VGY A;  1DTQ A;  2EFG A;  2KRB A;  1M1H A;  4WYW A;  1I6J A;  2XZT B;  4CNY A;  1QTN B;  2D9O A;  1FKP B;  2DXD A;  4CM2 A;  1V9O A;  4HL9 A;  2R9L A;  1ZH5 A;  2KDO A;  1S6Q A;  2YWF A;  5CH7 B;  1S6O A;  3UQS A;  1XMQ J;  3NAH A;  4F4W A;  3PR5 B;  1R0C B;  4LF2 A;  5DZ6 A;  5ETM A;  4CH7 A;  4XDD A;  1U49 A;  1LWX A;  5HP1 B;  4X4S A;  4IG3 B;  3K5L A;  1K47 A;  1SL2 A;  4AL5 A;  2EFP A;  2MZQ A;  1PYS B;  3FEY B;  1TKZ A;  3UPF A;  4ANC A;  3TI0 A;  3JQJ A;  4FBU A;  1MML A;  3J7Y U;  4C6A A;  1TU0 B;  3UD4 P;  2FVC A;  1L3K A;  2FB0 A;  2E5J A;  3PIP Q;  2I8E A;  3LPY A;  1FXR A;  5ETP A;  4IUF A;  1T3O A;  1N33 J;  1UA1 A;  3DXB A;  3L9Z A;  4JI0 J;  1JKH A;  2J7K A;  5KFU A;  1FKO B;  4MJK A;  2GMH A;  4GKK F;  2HHQ A;  2HAF A;  3IO1 A;  4ER8 A;  1REV A;  2W1B A;  5F8L A;  3BN4 A;  1LXN A;  3HI9 A;  3D3B J;  1W26 A;  3QNW B;  2PI4 A;  2PSZ A;  4AL7 A;  1ZM3 A;  2QSF A;  4PXD A;  4RX6 A;  1GTH A;  2P5V A;  4BWJ A;  4TU7 A;  2XS5 A;  2GIF A;  4X62 F;  2IVM A;  3UO0 A;  4DOZ A;  2VDI A;  1HR0 F;  2LFV A;  3LUY A;  5KFA A;  1F5A A;  3D5M A;  1UEK A;  2WRM A;  5CA5 A;  3MOJ B;  1VHF A;  4NYO A;  2EC0 A;  4YUD A;  4URS A;  4UST A;  4HKQ A;  2VV5 A;  1HLW A;  5AXK A;  3HVR A;  1WOR A;  2JFD A;  3CDB A;  5KFE A;  1YK9 A;  3QGP A;  2ACM A;  3POT B;  4KKO B;  3NOC A;  3H5U A;  1ELO A;  4A48 A;  4ZP9 A;  1VRT A;  1V5V A;  3PM9 A;  1DHM A;  2OSR A;  5IM0 B;  3MZI A;  4G1Q B;  2IJR A;  3OSN A;  3I5C A;  3TNV A;  3LAL A;  2YH1 A;  2DPJ A;  1RTJ A;  2NSC A;  3MMB B;  1HW8 A;  1Z2Z A;  5AE3 A;  4K4U A;  2KL8 A;  2GIR A;  4P2F A;  2CQ0 A;  2KN4 A;  4KGK A;  2C28 A;  1RT5 A;  2A3J A;  4A8O A;  4IG0 A;  3RB6 A;  2MZR A;  4FF4 A;  4H4K A;  1FKO A;  3QYY A;  4I2Q B;  4C8L A;  1LWE B;  2QL5 B;  2BRK A;  1U02 A;  3DRX A;  2IBK A;  3QZ7 A;  3OR2 B;  2VFS A;  3GR1 A;  2DHS A;  3OTB A;  3HO1 A;  3K5N A;  4DJB A;  3JSM B;  2N4D A;  2HHT A;  2HQ3 A;  1VQ7 S;  5C7P A;  4KYZ A;  2DYA A;  4WTO B;  1C0T A;  1WHX A;  2VIH A;  1Q81 T;  2AGQ A;  2CQI A;  4M94 A;  3DGP A;  4OHW A;  4QYZ J;  1QY7 A;  3BH7 B;  5L1J A;  1VRQ C;  3QID A;  1RWV B;  2C2M B;  1S1W B;  1Q4R A;  8AT1 B;  4K4T A;  4F3O A;  1S6Q B;  1Y5L B;  1HPZ A;  2DGS A;  1SVD A;  3T5K A;  5ETO A;  1HNW J;  3DLL Q;  3BBC A;  4RW4 A;  1TKX A;  2CQD A;  2DXF A;  3R5D A;  4N7T A;  2KG0 A;  1UVK A;  2WVF A;  2IBO A;  2FLN A;  1HBU B;  2UZA A;  4ED7 A;  2VG7 B;  2DVI A;  1S10 A;  2B0G A;  2C42 A;  3JB9 k;  1HHQ A;  1HI8 A;  4U7U K;  3MMA B;  3RYL A;  5AXN A;  1O8B A;  3EGZ A;  2GGP A;  1Q78 A;  1S12 A;  2PEB A;  3ET6 A;  3V2U C;  2ZKT A;  4TU9 A;  1VS3 A;  2OTL S;  3ZZZ A;  2VH7 A;  4I68 A;  1JXL A;  4OZ5 A;  5IS2 A;  5HBM B;  3TA0 A;  4M5K A;  4ZVG A;  4QYR A;  3KLE B;  1NPK A;  2W2Q P;  3RAQ A;  2CPJ A;  3CJT A;  3GCX P;  1BMQ B;  2AEJ A;  2IC3 B;  2IRX A;  3PAC A;  4YHH F;  5J2M B;  3L4B C;  2Q66 A;  1TR0 A;  3H25 A;  1YKW A;  5JJB A;  2VJV A;  4GKJ F;  1CS4 B;  3TUP A;  4I56 A;  4LRD A;  4CLP A;  4CYU A;  4EGL A;  5F9N A;  4B9L A;  3HD1 A;  2HFS A;  3MAH A;  1XTZ A;  2MQL A;  4I1T A;  4K7Q A;  2V4Q A;  4KPY A;  2JVR A;  3LAN A;  1RP5 A;  1GT8 A;  4JB8 B;  2GJ2 A;  3PX6 A;  3IR5 B;  4WFX A;  3SXL A;  5CYQ B;  5A8W B;  1NPP A;  4DX7 A;  1HWU A;  4QWD A;  3KJN B;  2ZH2 A;  1TUW A;  1MN9 A;  3OTO F;  3B54 A;  2IA0 A;  4WJB A;  4M5J A;  2CJY B;  2VOP A;  1U2R A;  3Q8Y A;  3C14 B;  4NI2 B;  1RU1 A;  2K7J A;  1U1M A;  4NLX A;  2HSE B;  3G82 B;  2XHW A;  3VAF A;  4F02 A;  2MQM A;  3I96 A;  5DS7 A;  1WEY A;  2R7W A;  1Q8K A;  1N88 A;  1RAF B;  2ZOF A;  4JI7 J;  2M9K A;  5KFF A;  3R6G B;  3DC2 A;  2VFR A;  1X4B A;  3G96 A;  2R2S A;  1AYE A;  2BEF A;  2L3M A;  3D6M B;  4A46 A;  2KXN B;  2ROP A;  4JYA F;  5CYM A;  3HJV A;  1A7G E;  1NHV A;  1PJ7 A;  1WEL A;  3JAM Y;  2WOM B;  1FX2 A;  5IV3 A;  1OO0 B;  4WWS A;  1TP7 A;  2K2P A;  3QO9 A;  4RNN A;  2B7B B;  4PZV A;  3TZZ A;  1IKY B;  2J7W A;  4OJG A;  5J2P A;  1TL7 B;  2Z2Y B;  1CC8 A;  4DSJ A;  3M2U B;  4EO6 A;  4P74 A;  2JH3 A;  5J1E A;  3QZ8 A;  1HD0 A;  3GR0 A;  2YX1 A;  2MHE A;  1NO8 A;  4JI8 F;  2H5I B;  2MGZ A;  2RVJ A;  1O51 A;  2VQF J;  1UPP A;  2W2O P;  4KTQ A;  2MZS A;  1HNW F;  1P8G A;  2KFN A;  4DL5 A;  4QPT A;  3US5 A;  5CQG A;  2J6U A;  3JAM U;  1R0A A;  2X1B A;  1IR0 A;  4P6Q A;  3QAT A;  3M8Q A;  1Q16 B;  2HZA A;  2UXC F;  1H38 A;  4WP9 A;  5FII A;  2HYI B;  1JLA A;  1VOM A;  4WZM A;  4KHR A;  2W7O A;  4FVC A;  4EBD A;  1VQ8 S;  3MXH P;  2CNN B;  1FHT A;  1PYT A;  2D3Z A;  1T05 A;  4DF8 A;  4JUZ A;  3PRB A;  2B4O A;  3ZFV A;  4DWI A;  3OLB A;  1ZM9 A;  4DLE A;  1RHR B;  4ILR A;  4J9R A;  1N5Y B;  1RJJ A;  1U1N A;  2QL7 B;  4V1A k;  2UXD F;  1M5H A;  2LXI A;  3BEG B;  4OX6 A;  4DCJ B;  1IKX A;  1FFW B;  3W9I A;  4MYT A;  3PYF A;  3G6Y A;  1EX8 A;  3OUY A;  2P9E A;  3TR5 A;  3BO3 A;  5KFC A;  3DKD A;  4C98 A;  4ELT A;  1LV5 A;  4H4O B;  3KHR A;  2LLZ A;  3AQP A;  2UXB J;  4PYA A;  4QIE A;  3BJY A;  2W25 A;  2CQ1 A;  4JI8 J;  4ECU A;  3DOL A;  3R7N B;  1ZM4 A;  2VDH A;  4DR3 J;  2OEK A;  4F0K A;  1NDK A;  1AA1 B;  3G6E S;  4BWM A;  3J7Y I;  3UD5 A;  2DH8 A;  1G6B A;  2RU3 A;  3UNY A;  3T1A A;  4OX8 A;  1AFI A;  1GMV A;  3SQG A;  2FC8 A;  1X4G A;  2J8S A;  2YWG A;  4NLD A;  2K7K A;  3F73 A;  4DR1 J;  4GKJ J;  3VGU A;  3CWJ A;  2BE2 A;  1RHM B;  1NH8 A;  3GFH A;  1ZS6 A;  4K2X A;  2LMI A;  3ISN C;  5J1N A;  4OJ1 A;  2DHA A;  3JSY A;  2BJD A;  2MQ8 A;  5G0R B;  2IMW P;  1DBD A;  1HI1 A;  2WCX A;  3M9O B;  1T9X A;  1C2P A;  1RLC L;  3R9L A;  2X51 A;  1NK9 A;  1YBA A;  3EMT A;  5D15 A;  3FRZ A;  5A6P A;  4B3S J;  1O5J A;  1T9W A;  2HWI A;  4RR5 A;  2VG6 A;  4B02 A;  3DLH A;  4JI6 J;  5HMZ A;  2DR6 A;  2XNQ A;  1H98 A;  3KLG A;  1ZA1 B;  4BHQ A;  3BGR A;  1YJN S;  2CWK A;  3BB5 A;  1UPM B;  4P73 A;  4UY8 5;  2AJ1 A;  3ZZR A;  4ZPC A;  4DV6 J;  2O66 A;  2UP1 A;  3H20 A;  4Y00 A;  1S9E A;  3V6D B;  3FCV A;  2VA3 A;  4EWT A;  3X1L B;  2YKN A;  1GQE A;  1KQS R;  1H6K X;  3MM8 A;  3E2E A;  1RSC A;  2PDA A;  2V2K A;  3FBC A;  3I0S A;  2VD3 A;  1UWB B;  2BZ2 A;  5KFY A;  4ZN1 A;  5L1L A;  2HHH F;  1YBU A;  3T41 A;  2CPX A;  3MAA B;  2V5H G;  4HTJ A;  3LP1 A;  1FRI A;  3HSZ A;  4UW2 A;  4KAI A;  4AQY J;  2R7S A;  2DBB A;  1JJ4 A;  5HAT A;  5F3Z A;  4CO1 A;  2V0N A;  5E0O A;  1WG1 A;  1K9M T;  3RB4 A;  2HQI A;  3MI7 X;  1RK8 A;  4R0E A;  2BQU A;  2BW7 A;  2Q6C A;  2L9W A;  2HUR A;  3A13 A;  4ID5 B;  4I67 A;  5D77 A;  3M8R A;  2XMK A;  2CQ2 A;  1MWZ A;  2JOQ A;  3FFI B;  3MED A;  2OSQ A;  2PA8 D;  3IAS 9;  4HTI A;  1KQF B;  1N0V C;  3P5T L;  3M8Y A;  3PJW A;  1G3O A;  2RUS A;  3RG6 A;  3S7R A;  5KFZ A;  2ALY B;  3GZ7 A;  1F9H A;  5KFB A;  4OYI A;  4EEY A;  3UDL A;  2H5E A;  2BXJ A;  1YRX A;  1S1T B;  1TVR B;  4ID5 A;  3AOC A;  4KHM A;  2FPH X;  1SJF A;  4OLP A;  4PEO A;  3VWS A;  2XY5 A;  4HH0 A;  3GWC A;  4ZHR A;  1SH3 A;  4R0J A;  2YWH A;  5J1P A;  4WFB Q;  2XBP A;  1FCA A;  2MSS A;  2UU9 F;  1CQN A;  4QIG A;  3PO4 A;  4OZL A;  3VAK A;  2OTJ S;  5B0B A;  4M8L A;  5CD4 H;  1Y10 A;  2V63 A;  3H4D A;  2DH9 A;  4WII A;  4NCA A;  2YKQ A;  1VFJ A;  4F4Z A;  3LW5 C;  2F40 A;  4DMZ A;  3CD5 A;  1H73 A;  1YJU A;  4FXW A;  4J91 A;  4Y3C A;  3MCS A;  4G1P A;  3CCQ S;  3V6D A;  3PXG a;  3K58 A;  3CMA S;  5G4D A;  1T8E A;  3D7S B;  3VAJ A;  4AD6 A;  1XMQ F;  2OML A;  3OVA A;  1X7V A;  3DOM B;  2LDY A;  3ENV A;  4QZV B;  1U4B A;  3QPI A;  1CQM A;  2DJW A;  4PUO A;  4IOA Q;  1GTE A;  2J8A A;  1Z4U A;  3ONQ A;  3CJS A;  3MR3 A;  5HMX A;  1EZZ B;  1WTF A;  2BAN B;  2W24 A;  3BS9 A;  1N36 J;  2BOP A;  3Q2T C;  5KFP A;  3QIP A;  1CUL A;  4C8K A;  1J2V A;  1S97 A;  3C19 A;  2JSX A;  4DN0 A;  3PJX A;  2V8P A;  5CD4 A;  3MEK A;  4ZPW R;  3WIU A;  3H40 A;  3M2R A;  1OYE A;  2HW3 A;  3FEZ A;  4MKB A;  4NML A;  2DIU A;  4IR9 A;  5IC6 B;  4A8S A;  1SKS A;  1OMS A;  2IVY A;  3MUT P;  1Q5V A;  2JNJ A;  3EZ5 A;  1JJ2 R;  4RW6 B;  1O6X A;  3C3L A;  5K20 B;  3CXC R;  4IR1 A;  1DAR A;  2CDQ A;  4AYB D;  3EX7 B;  4DL2 A;  4YB6 A;  1HBM A;  2QMU B;  4EUV A;  4LVN P;  2R7R A;  3QRQ A;  3U1L A;  4KGV B;  1XNQ F;  2QLJ B;  1GFW B;  1RAO A;  3C6T A;  4ZVR B;  1BQM A;  1U8W A;  4WKY A;  2ZE2 B;  3GIL A;  4FKY A;  1SL0 A;  3LP2 B;  4EK2 A;  4UOC A;  1HMV A;  3M2V A;  2FLO A;  1NJZ A;  1NAQ A;  1UKU A;  4PPD A;  1RBO B;  3M6U A;  5AT1 B;  2YKO A;  4ED5 A;  1WUU A;  3A3P B;  4PWD A;  2HVH A;  1FES A;  4LF7 F;  4OQJ A;  5A8R B;  3JS9 A;  3MHY A;  2W7A A;  4J37 A;  3HHL D;  4L3N A;  5KFK A;  2NS1 B;  1YTY A;  1DLO B;  3CB4 A;  2DO4 A;  2RD5 C;  1OS5 A;  5L9X A;  4BS2 A;  2FLL A;  5I3U B;  2IM0 A;  4DI6 A;  2XCA A;  1T9V A;  4QR1 A;  1IJE B;  1YRU A;  1KTV A;  1K44 A;  2ZWP A;  3DM2 B;  1R3N A;  2LEB A;  1S0V A;  4DQR A;  5ETS A;  2FZK B;  3NWR A;  1PBA A;  3K17 A;  1VQY A;  2CNO B;  4O44 B;  2RHQ B;  3I82 A;  4Q2M A;  1URN A;  1T3N A;  4ANE A;  5HRO A;  3MFH A;  3PW0 A;  3JYT A;  3M1V A;  1ACM B;  2DIS A;  4DV5 J;  1IJF B;  2IRY A;  3V6K A;  5H9E K;  3IXQ A;  1HHT P;  2DH7 A;  3NXZ A;  1FE4 A;  1XQI A;  4X4O A;  3Q0A A;  1KQK A;  3ENW A;  3UN2 A;  1S1V A;  5K9F A;  1L5U A;  3M8Q B;  2NPF A;  1JLF B;  3G2X A;  2D3O R;  5A8K B;  3BN7 A;  2MQP A;  3RZA A;  3ILO A;  1M1G A;  2CPF A;  2DXE A;  2W4P A;  4FZV A;  1HW9 A;  4IYQ A;  2KM8 C;  1RTH A;  2WSC C;  2QSW A;  4KE5 A;  4ZJO A;  2WVB A;  5KFI A;  4X66 F;  4ECR A;  2HIQ A;  1QD1 A;  1RWM B;  2K06 A;  1J5E J;  3AJ1 A;  1UVL A;  1GX6 A;  4NLV A;  1VQN S;  1NUE A;  1X4F A;  3HVA A;  4C8Z A;  3J7Z T;  2P9G A;  4NLO A;  3CT9 A;  3W66 A;  3V81 B;  1RT1 B;  4RWW A;  2EG1 A;  1EKR A;  3NGK A;  1IKY A;  1BXN A;  2BX6 A;  2GHV C;  3WHI A;  1WC3 A;  3MR7 A;  3EZU A;  4JBC A;  5D4P A;  2WB4 A;  2MJN A;  8RUC A;  1DUR A;  1JLE B;  2LQJ A;  2VAS A;  5RUB A;  4DSF A;  1UCN A;  4ZIW A;  1HNX J;  2AYG A;  4UZB A;  2HGM A;  5DQG A;  3P45 B;  6FDR A;  3A8K A;  3LGH A;  5DDP C;  1CJV B;  4FBT A;  4LFC F;  2NYH A;  1B3T A;  2VJU A;  1U2C A;  1NDL A;  2VUG A;  3N01 A;  4LIR A;  3A3N B;  4X4U A;  4C8M A;  3BO2 A;  1X9W A;  1VBX A;  4ES3 A;  2PC6 A;  1DQ8 A;  3B4M A;  1CG2 A;  1RT4 A;  1VK3 A;  2V4J B;  2VBZ A;  3HSJ A;  1OIA A;  2RAQ A;  4RBV A;  3FGV A;  1T95 A;  3U1M A;  4FS2 A;  3AD9 C;  4DUZ J;  3EZO A;  3IP0 A;  5AJ3 J;  1KDN A;  3QQC D;  2GW8 A;  5HO4 A;  3O2I A;  3Q8P B;  3CD6 S;  3MM5 B;  2AMC B;  1WHW A;  2YPY A;  2OJ3 A;  2RDD A;  2XMM A;  3EVM A;  3RW7 A;  1Y7P A;  4DZ6 A;  1IQT A;  2V50 A;  1YJR A;  2DGT A;  2IMO A;  2NXE A;  1RCX B;  5CYQ A;  3R8Y A;  4HHH A;  4ED4 A;  3MFI A;  2F8E X;  2H48 B;  4OHX A;  3K59 A;  2I1R A;  2DY9 A;  5HMY A;  4ENO A;  1ITP A;  3KJV B;  1SC6 A;  3BBB A;  2DGU A;  2NXU A;  3G8Q A;  3MPY A;  2NCK L;  2RQC A;  3NNC A;  1F6T A;  5M2U A;  4J90 A;  1CPZ A;  1N0U A;  3KDO A;  1S59 A;  3D1O A;  1D3W A;  5U47 A;  4I7F B;  4NLT A;  5HL7 Q;  1UEU A;  5IXU A;  3IGV A;  5IT9 U;  1NK0 A;  1RKI A;  4IDK A;  1Z1Z A;  1JNZ B;  4C3M A;  1TKT A;  2XZW A;  5C42 B;  2XM3 A;  3GJR B;  2UU9 J;  3H98 A;  3W8G A;  4QCL A;  4Q45 A;  2I9S A;  3IM8 A;  1UW9 A;  2VZ9 A;  4DFK A;  2CQC A;  4W98 A;  4KHP J;  4N76 A;  2HMI B;  4I6W A;  1S72 S;  5HJX A;  2GGP B;  2E9Z A;  2O01 C;  2OPR B;  7FDR A;  2FDN A;  3FSY A;  3NOG A;  1G1X A;  2RU9 A;  4TKT A;  2G0C A;  2SXL A;  3TYT A;  4CLF A;  3V81 A;  4NXN J;  1KTQ A;  2PII A;  1HBN B;  2Y0S D;  3QLH A;  1S4F A;  4LF9 J;  2KI2 A;  2RNE A;  1PKU A;  3CCS S;  1TKX B;  2MMY A;  1H7X A;  2BKO A;  4Y34 A;  4LF7 J;  1T11 A;  1MSW D;  2CRL A;  5CZV A;  1RTH B;  3N5B A;  1KON A;  1XMB A;  2NXN A;  1F2H A;  2X7I A;  3DYA A;  3W2V A;  3HMJ G;  4K4S A;  3FZB A;  3W9J A;  1RT3 A;  4IFY B;  1IKW A;  2V8G A;  2W01 A;  1U1P A;  3C66 A;  5C2G A;  1S79 A;  2IM3 A;  2M0G B;  4F7V A;  1VQP S;  5E5N A;  4DV4 F;  5T41 A;  2HIY A;  3ZTP A;  1OY8 A;  5EWG A;  3UCU P;  2KZZ A;  3KMQ A;  2HVI A;  3G4S S;  2KZM A;  4MYU A;  1S1U A;  2EI5 A;  4F26 A;  5E3R A;  4AQY F;  4LBI A;  2M88 A;  4JI4 J;  2QRR A;  3MD3 A;  4RW9 A;  4ZK7 M;  3CPW R;  1Z2L A;  4WFY A;  2XO6 A;  3KK2 A;  2JDJ A;  2OFG X;  3WQP A;  3N6L A;  2HNZ A;  3HDS A;  1N32 J;  2CNK B;  1TMM A;  4OYA A;  3KK3 A;  2MJU A;  2P9C A;  3K5P A;  4CWB A;  2XSJ B;  4KC5 A;  1IBK F;  3VGT A;  2LDI A;  1C0U A;  2VPW B;  3T5L A;  3PW2 A;  5I3U A;  4K0K J;  2H5J B;  4F50 A;  5F3T A;  1N5S A;  1VHI A;  2BJ1 A;  3ENQ A;  1KFD A;  1VQS A;  2Q79 A;  3GTY X;  3SBM A;  4OHY A;  1MNE A;  4Y2I A;  1NB2 A;  4OYW A;  3FUY A;  1MMD A;  5KFS A;  1M90 T;  2BJ9 A;  3LQV A;  4RW9 B;  2EKY A;  3HSG A;  3Q8U A;  4F0H A;  5ITH A;  2XY6 A;  2UVW A;  1JB0 C;  2VFU A;  1LQ9 A;  3DHX A;  2PEH A;  2MKS A;  3D4J A;  4FPR A;  2XUL A;  4NLS A;  5B0C A;  4JI5 F;  3POT A;  3KHG A;  4K4W A;  2EKN A;  2Y8W A;  3QBC A;  4HT7 A;  5IWA J;  3AFG A;  3NLC A;  3R1L A;  2Y8Y A;  3T5J A;  5E33 A;  1L3T A;  2IAJ B;  3HCX A;  4B9T A;  2QJ3 A;  1Q1K A;  3DU5 A;  4OJ3 A;  2XGP A;  1TQL A;  4NRT A;  3W2V B;  3TZX A;  2GNK A;  4DR1 F;  3WDO A;  1RHK B;  2P6T A;  2V2Q A;  2N7Y A;  2XG8 A;  1S0N A;  1ZA2 B;  4LF6 F;  2PMW A;  4DV4 J;  1KLN A;  4WZQ A;  3TP2 A;  2QE5 A;  1PC5 A;  2I5J B;  1CUL B;  3AXM A;  3KG0 A;  4ECZ A;  5KFV A;  2OPR A;  2DEI A;  4PG5 A;  3C8Y A;  4ZIT A;  2BAN A;  1XR7 A;  2HZC A;  2QC3 A;  3CDE A;  3MCO A;  2RF2 A;  3MM9 B;  5HVG A;  3VGS A;  4WK1 A;  4NEZ A;  1NZ8 A;  2J9D E;  2EG2 A;  3H42 A;  1LKZ A;  1RT7 B;  1TMJ A;  5C42 A;  4CQ1 A;  1I3O B;  4QOT A;  3RRK A;  3FEX B;  3FMW A;  2DR7 A;  2CQP A;  3PYG A;  2OP5 A;  5A2Q U;  4MTP A;  3P8B B;  4IG3 A;  4QJV A;  3TJA A;  4UQG A;  5HVH A;  1HAR A;  2VQE F;  1WHV A;  1NK8 A;  3GSD A;  4PQU B;  4P2S A;  5F0U A;  3UW1 A;  4CO2 A;  2DR9 A;  1VQL S;  2BM0 A;  2E5I A;  2PN6 A;  2OH2 A;  3NCQ A;  1YDL A;  2XMJ A;  2GMJ A;  1X0P A;  4NA3 A;  4EBE A;  1XMO F;  2EEY A;  2EBE A;  3H7H B;  3K5M A;  4B9M A;  2I38 A;  4U96 A;  1HNV B;  1R0A B;  3DOK B;  6AT1 B;  2LXF A;  1NCL A;  1S1T A;  1TVR A;  3CJ5 A;  4WU2 A;  5GAH U;  3MUV P;  2IJN A;  4F4Y A;  1SJ4 P;  4IRC A;  3I56 S;  2VQE J;  3MM5 A;  3QFW A;  3GB0 A;  2FVS A;  3M6W A;  1FT8 A;  5B7W A;  4X4P A;  4B9U A;  4UOH A;  2B9W A;  1GXL A;  3MPV A;  1FRK A;  1SL1 A;  2HS3 A;  1UA0 A;  1WC1 A;  1C1B B;  1XBW A;  1R8P A;  3PIO Q;  5FLX U;  2D74 B;  2DD8 S;  3CF5 Q;  3DLG B;  4A8X A;  2PE8 A;  3PVX A;  4OYP A;  1ZBT A;  2MXY A;  2KO1 A;  1Q7L B;  1R0B G;  1H7W A;  3UWT A;  3LP1 B;  3AHP A;  4XIU A;  1WI8 A;  2J9D A;  3KNA A;  3WC2 A;  2MY8 A;  2YKM B;  4M5M A;  4O3R A;  4Q0B A;  3N0V A;  1RWP B;  1U1K A;  4TY8 A;  1UP1 A;  4WK3 A;  5K14 B;  4JI1 J;  4JI4 F;  2CUY A;  2W9B A;  2ZZN A;  2XMW A;  2HRY A;  1NSK L;  5D6G A;  4RW8 B;  2FY1 A;  2JFK A;  2YKN B;  1YIJ S;  1S9G A;  1WF1 A;  4NCB A;  1WC5 A;  4KH0 B;  5GAD I;  4LFC J;  3AJD A;  3W60 A;  5C25 B;  2B3T B;  4J9S A;  3ZNU A;  4DR3 F;  3H59 A;  2CPY A;  4XTT A;  4ED0 A;  5F8N A;  3RBZ A;  1Q5Y A;  2J0W A;  3VVU A;  5ADZ A;  2MPU A;  2ZH1 A;  5HLF A;  2OUG A;  4WFZ A;  2UVR A;  4X84 A;  3Q86 A;  1ZZN A;  1YQH A;  2ZM6 F;  1K0T A;  4URQ U;  3OXL A;  1E6Y B;  1BUX A;  1EP4 A;  1WAC A;  1S1V B;  4A8F A;  3M05 A;  2PMZ D;  2W2M P;  1PAE X;  4PXB A;  4NPO A;  1NHK L;  2VC1 A;  3MDF A;  3EVW A;  4O3P A;  1L3S A;  1YJ7 A;  3F41 A;  1G7C B;  3JYT B;  1FNO A;  2MZ1 A;  2Z2M A;  4OYM A;  2R3V A;  4DUY J;  2ROG A;  3D54 A;  3KG1 A;  3UDC A;  2R8G A;  2NRE A;  4AXJ A;  3SQG B;  4F4K A;  4OX9 J;  4CZC A;  4LSL B;  5KT4 A;  4GC7 A;  1TAQ A;  1WWH A;  2Y0B B;  2CAD A;  2BOA A;  3QSI A;  2Y1L B;  2GCF A;  3DFE A;  4LBP A;  5LMN J;  5ETL A;  2WSF C;  2LU1 A;  3DOL B;  2DNP A;  3ENA A;  3X3U A;  4XO0 A;  4TQR A;  1VQK S;  4V19 J;  1ARO P;  4B3O A;  3C2P A;  2U2F A;  2MLX A;  3RAM A;  2I0X A;  4NZ7 A;  4MMO A;  2ZDO A;  1W2B R;  1N34 F;  2IHR 1;  2QZ8 A;  1UTA A;  3N5F A;  1LK7 A;  1OPI A;  2O3D A;  1P1T A;  3D1Q A;  2LQ8 A;  2ZHB A;  3IG1 A;  1U26 A;  4E8U A;  1H2V Z;  1LFW A;  1RAH B;  2OI2 A;  2ZE2 A;  2KFY A;  4J9L A;  2ILY A;  1R89 A;  4NL5 A;  3SFG A;  1NK4 A;  1HNI A;  3UDV A;  1QM9 A;  2KU7 A;  2VKR A;  3I5B A;  3RRG A;  4YEA A;  1RTI A;  3AAW B;  4DSK A;  3SSR A;  4FNH A;  1E6Y A;  1T05 B;  2QO3 A;  4KGZ B;  3A8J A;  4C8Y A;  4ERD A;  2FJW A;  3TX0 A;  1N4L A;  1OSD A;  4DR6 J;  4X4T A;  3DDI A;  4JI7 F;  4ZVQ B;  4IRD A;  4QU6 A;  2R7U A;  1IUJ A;  7AT1 B;  3RR8 A;  2WON A;  1HI0 P;  3QIP B;  2WBR A;  2G0I A;  3GQC A;  1J5O B;  4KGM A;  1LEO A;  1WEZ A;  4PWU A;  1RTD A;  1Y3J A;  2Z4P A;  5LT5 A;  2M3D A;  3WC0 A;  3HP6 A;  3HM9 A;  5D0R A;  2F5G A;  4WE1 B;  1IBC B;  3H5S A;  5ETK A;  1M1K T;  4J9V A;  4OV1 A;  2CYY A;  3PRD A;  3BKT A;  3D67 A;  2ZC3 A;  3GG1 A;  4LR7 A;  1Q79 A;  2PO4 A;  3W9H A;  5KG5 A;  3QGI A;  3Q8Q B;  5KG6 A;  2HFV A;  1S0M A;  2JRS A;  3AQO A;  4RW8 A;  4E2F B;  3AB4 B;  3NMA A;  2DB1 A;  3SSQ A;  4HR2 A;  1W7W A;  5K14 A;  3DLG A;  4DV1 J;  2GFF A;  3ZNJ 1;  5CCM A;  5DDR C;  2HFO A;  2WSE C;  3FCW A;  1MWY A;  2QX0 A;  4HHJ A;  2AJ0 A;  3R27 A;  4OI6 A;  4EO8 A;  1C1B A;  2B56 A;  1OQ3 A;  5KFT A;  4M5L A;  4DXL A;  4ZLN A;  5FLX Y;  3M9M B;  1ZPW X;  2IJF A;  4GO5 X;  1KEK A;  4ZHR B;  4WU3 A;  3OSP A;  2KM8 B;  1X4H A;  1RE1 B;  3EXY A;  2W4C A;  3BSO A;  4OYB A;  1CC7 A;  2M8H A;  3NGT A;  3KJQ B;  1SUQ B;  4H4M A;  5ETT A;  2AZ1 A;  5F8G A;  2KRR A;  1RHQ B;  2YNI B;  2M7S A;  2VB6 A;  5GAG I;  4ES2 A;  4DL7 A;  5D4O A;  4DR5 F;  4P71 A;  3V5R A;  3I4H X;  1SC3 B;  2PFF B;  2QLB B;  4P10 A;  3S8S A;  3UD3 P;  1SPB P;  2UUC J;  1F9E B;  5HAN A;  1MWQ A;  1HNZ J;  4B3R J;  1JLQ B;  1V5I B;  2YNF B;  4RO0 A;  3DOK A;  1WSV A;  1HNV A;  3R97 A;  2JEF A;  2ZZM A;  4GMK A;  3TW0 A;  4NMX A;  5HK4 A;  3T9Z A;  4DR4 F;  1HHS A;  4L74 A;  5GMD A;  3I6P A;  3KLI A;  3MEC B;  2JVO A;  5K5M A;  3KWM A;  3GIJ A;  3BQ2 A;  3UFC X;  3U1N A;  3V6H A;  4PQU A;  3UE2 A;  1VMB A;  3OFE A;  3GV8 B;  3CC7 S;  4NYP A;  4Z7Y A;  4DSE A;  3CO9 A;  2MYF A;  2RF2 B;  1QUV A;  1T94 A;  2ZWO A;  3MTJ A;  5KFH A;  3G9C A;  1HQU B;  3PCO B;  5D3G A;  4B9V A;  1RT7 A;  2D3U A;  5HBM A;  3TVY A;  4X64 J;  3DLB A;  1I5O B;  4USU A;  1H0H B;  1HQ2 A;  1U8S A;  1FWK A;  3W64 A;  1RIS A;  2Z56 B;  1RGV A;  1VI7 A;  3BGU A;  3CDW A;  3HHL A;  1KVK A;  3ET6 B;  3Q83 A;  1Y11 A;  3HJF A;  2HND A;  4X4Q A;  2XC9 A;  3CDU A;  3TA1 A;  1S5Z A;  1RHJ B;  2JHE A;  3IM9 A;  5T7L A;  4ZMM A;  2ZH4 A;  6FD1 A;  1YBT A;  3GON A;  2FHJ D;  3OHA A;  2MQN A;  4UUX A;  5C24 A;  1N6Q B;  3C6U B;  1ROF A;  4CLS A;  1BQN B;  4ECX A;  2DIV A;  5HAO A;  4JV2 A;  1ZTW A;  1X31 C;  3DLJ A;  4JV5 F;  4IRK A;  1HPZ B;  2V2Z A;  4OI3 A;  2NUH A;  1SIZ A;  3LH2 S;  1RWW B;  2IAJ A;  2RML A;  3R3T A;  4JOU A;  1S7H A;  4LRB A;  3LWL A;  3ZZT A;  4RU2 A;  1KOH A;  5F8M A;  1GNK A;  2AWZ A;  2JZ5 A;  3O3L A;  2DNK A;  2JLG A;  1YJW S;  2NQP A;  1FX4 A;  3EXC X;  4JI3 J;  2X1F A;  3FMB A;  2DY1 A;  4NLR A;  3M8S A;  3OXF A;  3E8O A;  3NCP A;  4ZDN A;  1B0T A;  2UUA F;  4FS1 A;  4O3Q A;  1C4C A;  2XLK A;  3GV5 B;  4OZN A;  4R8U B;  3CME S;  1AUD A;  2X1A A;  5LXR A;  3OPK A;  1KP6 A;  5CAB A;  2F7V A;  3F0N A;  4KJI A;  1U1L A;  3KK3 B;  2HHX A;  2DTJ A;  1Q8B A;  1S1U B;  2C3O A;  3HUL A;  1NK6 A;  2HNZ B;  4IO9 Q;  2AJF E;  4F25 A;  3MMB A;  4A8W A;  3KK2 B;  4LF4 J;  2POK A;  3IBW A;  3LGM A;  4LVO P;  1N5Y A;  4G1Q A;  2N3O A;  4K5S A;  3SQO P;  1VRT B;  1IKW B;  1U24 A;  2NZC A;  1N8R T;  2B4V A;  1N36 F;  5ETV A;  3RBD A;  2X3G A;  3BPS P;  5LM7 E;  3BF4 A;  3TZW A;  4QIF A;  3C6U A;  3CJ4 A;  2FJA B;  2KJV A;  1FA0 A;  2DNG A;  2YWW A;  3KUG A;  3NGS A;  4MAK A;  1EAY C;  4IFY A;  4CH0 S;  4NLY A;  2C1E B;  5LL6 d;  4N8N A;  4CI0 B;  1M5P C;  4LR9 A;  1HBN A;  1D1U A;  1S77 D;  2KXF A;  3DI6 B;  5DQH A;  2HHH J;  2FVQ A;  2B6A A;  4Y0F A;  3IBC B;  3P5B P;  3OFH A;  2GQ2 A;  3KKF A;  1WEX A;  1MRO A;  1R7I A;  3GFY A;  4CT9 A;  1PCA A;  2HMI A;  4MIW A;  4MT1 A;  3GIR A;  1WNE A;  1QSL A;  2EC2 A;  1TKT B;  3Q8R B;  4K4Y A;  2BR0 A;  2FVP A;  3DRS A;  1HQU A;  2KVI A;  2AD9 A;  4JYA J;  3PKY A;  2BDP A;  3QO9 B;  4KH1 B;  4RUA A;  2AU0 A;  1Q95 G;  2XYH B;  3EWG A;  4DQS A;  2BV3 A;  1QAX A;  2XMA A;  2HAI A;  5HQM A;  4JI6 F;  2ZHA A;  3PW7 A;  3MAQ A;  2E9R X;  3NNH A;  1IVZ A;  1P6T A;  3KTQ A;  4O4R A;  4ZCK A;  4ZPT R;  5LSL A;  3BBF A;  1D9A A;  4YME A;  1LNQ A;  2OEJ A;  3NG8 A;  1NJW A;  1HIY A;  1D0E A;  1SC4 B;  1NME B;  4NYZ A;  4OJH A;  3R5C A;  4YFU A;  4ED2 A;  5HP1 A;  1HYS B;  3FK4 A;  3NGU A;  1UAW A;  4LF8 J;  1JJC B;  1TKD A;  2AYB A;  3IWN C;  1NPR A;  2RKI A;  4M63 A;  1JLQ A;  2YNF A;  1TL1 B;  2W9A A;  1KBR A;  3BM7 A;  4AL6 A;  5I4M A;  2JEG A;  1FK9 A;  4LT6 A;  4P2X A;  4RNF A;  4LIW A;  1EB0 A;  4DPX A;  4ZVF A;  4U95 A;  3JQK A;  1DTQ B;  1FK9 B;  1FWL A;  5BJR A;  5BXI A;  2ZVS A;  4HLB A;  2W4D A;  2GAH C;  5CZX A;  4CRJ A;  1Q0N A;  1U45 A;  1L3V A;  3KLH A;  2ADB A;  3HHN B;  2QA1 A;  2YTC A;  4ZCL A;  3ZTQ A;  2ZUG A;  1HYS A;  2KJW A;  3GLJ A;  5F0W A;  3Q8S B;  1L3U A;  2A10 A;  3IR7 B;  2DGO A;  4YP3 A;  4H4K C;  3OL9 A;  1CJV A;  3P49 B;  4PCQ A;  3FBE A;  5DO2 A;  2E7W A;  4CYU B;  3QWU A;  3DRP B;  3R7S B;  4OHZ A;  3M32 A;  3N4W A;  2F3J A;  3NBP A;  3B4D A;  1TL3 B;  4PPZ A;  4A8Y A;  2M2B A;  2HKE A;  3D9B A;  3J81 j;  2HGL A;  1A0O B;  4DV0 F;  1KFS A;  4HAC A;  1JLB B;  3RU0 A;  3KLE A;  5DG7 A;  3IC1 A;  1RT1 A;  5GVQ A;  5H9F J;  4TXS A;  2VOO A;  1RWK B;  2YPZ A;  2UV8 G;  5KT2 A;  4DZD A;  3MMC A;  4X65 F;  2WHO A;  3KK1 A;  2ZNZ A;  1EHW A;  1MRO B;  1NKE A;  1BY9 A;  4O0N A;  2WVE A;  5A76 A;  1T9Y A;  4WXW A;  5HVF A;  2QN6 B;  4UOF A;  2KFZ A;  4ZVE A;  2E5L J;  4X4R A;  3KYL A;  1XNR J;  3DI6 A;  4LFB J;  1Y0H A;  1R6V A;  3O6Q A;  3UCG A;  3VV2 B;  2AIR B;  3QSY B;  5IC4 B;  1G2E A;  3DLE A;  5A8K A;  2BA9 A;  4IOC Q;  4DR2 J;  1AW0 A;  3G87 A;  4AFF A;  3EIC A;  2BKN A;  4EYH B;  4NCG B;  4JI2 J;  1KSP A;  4TYB A;  3NKY A;  4LSZ B;  4C0H A;  3ZTR A;  5F8I A;  3BSC A;  3FRY A;  1V3S A;  2L9D A;  3C46 A;  2A6O A;  3ISZ A;  1X4E A;  3N6M A;  2HS0 A;  1C0T B;  2G2Y A;  3R5J B;  5A2Q Y;  5J2Q A;  2BE7 D;  3ZO7 A;  1PBU A;  3ISN D;  2FYX A;  3KUE A;  2ZFH A;  2FC9 A;  3VZI A;  4WPA A;  2GV1 A;  3EYZ A;  1CSJ A;  2Y1I A;  2OPQ A;  3PJ9 A;  1FDN A;  3IRW P;  2AW0 A;  1BGX T;  1VQ9 S;  3M30 A;  1YVF A;  3IWL A;  2E7X A;  4R8U A;  2G2O A;  1UJ5 A;  3D0H E;  2CPE A;  2OGU A;  4DUY F;  4B3O B;  5C2C A;  3KNG A;  2OLW A;  2BRL A;  2QFJ A;  2CXE A;  1FNX H;  4PWD B;  3W1Y C;  1X4A A;  2V8V A;  1N6Q A;  2V9W A;  4ICL A;  1DLO A;  2ZHO A;  1F60 B;  2GHW A;  4W4M A;  4ETX A;  4TLQ A;  1UL3 A;  3TWZ A;  5L8R C;  2IIH A;  3NGD A;  4C8O A;  1CJT A;  1BQM B;  3BQ0 A;  1IBL F;  5E3C A;  1RDR A;  2H54 B;  4A47 A;  2UXC J;  4UOG A;  1VIS A;  4DBQ A;  3QT6 A;  2R8J A;  1LWC B;  5E3P A;  2CJA A;  1KVJ A;  2DGQ A;  4QPX A;  4FDF A;  1PJ5 A;  4QU7 A;  3HXM A;  4RW7 B;  4ECS A;  4WF9 Q;  3C6T B;  4K2J A;  3JXO A;  5KFR A;  1NH7 A;  1YIT S;  1GMW D;  2V94 A;  1UMJ A;  2O5D A;  5GAH I;  4TYA A;  4F3Q A;  3GJQ B;  1TV6 A;  1D9D A;  1BLU A;  3MCM A;  4I2P B; 
#chains in the Genus database with same CATH homology
 5ETS A;  3ILL A;  4M5H A;  1TMJ A;  3KUG A;  3HT0 A;  3QBC A;  5ETM A;  2F65 A;  3UDE A;  4CYU B;  5ETN A;  3UD5 A;  2QX0 A;  1RAO A;  2BMB A;  3HCX A;  3MCN A;  1RB0 A;  4AD6 A;  5ETL A;  4M5L A;  3UDV A;  4PZV A;  1F9H A;  1KBR A;  4M5I A;  1TMM A;  4M5J A;  4M5N A;  4CWB A;  1IM6 A;  1RU2 A;  3KUE A;  1DY3 A;  2F63 A;  5ETQ A;  1RU1 A;  3KUH A;  4M5K A;  4M5M A;  1G4C A;  5ETR A;  5ETT A;  1EQ0 A;  5ETP A;  3ILO A;  3HSD A;  3HSJ A;  4M5G A;  1EX8 A;  4CRJ A;  1Q0N A;  3ILJ A;  5ETK A;  1CBK A;  3HD2 A;  3ILI A;  3HSZ A;  1EQM A;  2CG8 A;  4CYU A;  1HQ2 A;  3HSG A;  3MCO A;  1RTZ A;  5ETV A;  3MCM A;  3HD1 A;  3IP0 A;  4F7V A;  5ETO A;  1HKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...