5EUHA

Crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
AATDALTGVANRRMLDQSLRHEWFRAQRSGKPLSLLMIDADHFKAFNDRHGHQAGDQALRELARVITTNVRRPADLVARYGGEEFSVILAETDSVGAQQIAEHIRAAVEQLSSVNEDQSPMTVSIGISTWTATSEISLEQLLFAADKALYQAKEGGRNRVVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Putative GGDEF domain membrane protein
publication title Contribution of Physical Interactions to Signaling Specificity between a Diguanylate Cyclase and Its Effector.
pubmed doi rcsb
source organism Pseudomonas fluorescens (strain pf0-1)
total genus 50
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5euhA00
1LW2A 2HNDA 1IKXB 3DLKA 1IKWB 1S1XA 5KFQA 4ZHRA 4Q0BB 3TAMB 1RAJA 2CJQA 3BSOA 2ILZA 4DEZA 2YKMA 1EETA 1ZTWA 2YNGB 1N48A 1RTHA 4PQUA 5C25B 2FVRA 4FBTA 4ECSA 5D3GB 3RB4A 4ZP9A 1RA6A 3E51A 4LSLA 2BANB 1MU2B 5EWFA 5KFTA 3FRZA 3DRRB 4NLPA 5KT7A 4ID5A 3CVKA 3HHKA 2V4QA 2W9CB 1JLBA 2ZD1B 3MEGB 1FKOA 2R2RA 4K4UA 2YKNA 4RZRA 4NLSA 1GX5A 4J9RA 4RNNA 1S0NA 4B3OB 2IJFA 3T5LA 2IC3B 1HNVB 4NYZA 3V81A 3PR5B 5KFIA 1KLMA 5JXSA 4YMEA 3M8QB 3V6DB 4HKQA 1RT7A 2WOMA 2CKWA 2YNHB 3MFIA 4IDKB 3DRRA 1SV5B 3OLBA 4RW9B 3C6UB 2ASJA 4KSEB 4F4WA 4NLVA 2RDIA 2ZE2B 3BQ1A 3EZUA 3IGVA 4R0EA 2FVSA 2BQUA 2OPRA 3ICLA 5HROA 4O4GA 2FVPA 4Y2AA 3BREA 4NLYA 1S1VA 4XPEA 4ECWA 5F8HA 3ITHB 4DL3A 3DM2A 1EP4B 1R0AB 3PR4A 1JKHA 2IM1A 5KFEA 1BQNA 1NHVA 3CJ4A 5J1EA 1SV5A 3LP0A 3TQ1A 4ED8A 2OPPB 4MKAA 4NRTA 1N6QB 4KFBA 4ED7A 1LW0B 4IFYA 3NKYA 3LAMA 4DL4A 5J2NB 5I42B 2E9TA 2WK4A 4TQSA 3BQ2A 5J2QA 1DTQA 3V6JA 4ZPDA 2FJVA 3CO9A 1UWBA 3NMAA 3MR2A 4WXWA 3QO9A 4ICLB 1TVRB 2XI3A 1TV6B 4ECXA 4WZQA 5FDLA 4WE1A 3T5KA 4URGA 2R8JA 3FFIB 4KO0A 1DTTB 4OL8A 1ZTTA 1TKTA 5DLGA 5KFGA 1HQUA 5L9XA 1IKVA 1TKZB 3TVKA 4NCGB 4YP3A 3KHHA 4R8UB 2B5JA 3I0SB 4U6PA 2HNZA 4MK8A 1S6PA 3G6VA 4ECVA 4TY8B 4LQ3A 2R2SA 5F9LA 2IJNA 3C6TB 3QLHA 2IAJA 4ZP8A 3LP1B 1LWCB 3KLHB 5HLFB 3QGIA 1BQMA 1TL3B 5DQHA 1JX4A 4KHMA 3MR3A 3KMQA 4IFVB 2R8KA 2IM0A 3KLFB 4NLRA 5EDWA 3IS9A 1JLAB 5EWEA 5HP1A 1N5YA 4KAIA 4RW6A 4TYBA 3KLEB 3OL9A 2C2DA 2OH2A 1XR6A 3KMSA 1S48A 4RW8A 3H4DA 3GIMA 5KFKA 4IKAA 3RBDA 1LWCA 5DQGA 5EUHA 3VQSA 3GIJA 5DQIA 1FKPA 4O3QA 1TL3A 2D7SA 2V0NA 3FQKA 4QPXA 5KFNA 2XC9A 4WYLA 1T03A 5J2PA 3OHBA 4IG0A 1HQEB 1HMVB 5CYQB 2C2EA 4I2QB 2R8IA 1S0OA 3LALA 4Q8EA 3BSCA 3IRXA 4NLWA 3DRSB 2D41A 4RW7B 4EBDA 2UVRA 3CDEA 2AWZA 4MK7A 2BQRA 1C0UB 3KLEA 4KE5A 3H98A 3KK1B 3MEDB 4KV8B 4K4SA 1LW2B 2HNDB 2FLNA 3DLKB 4FS2A 1S1XB 4ED0A 4ZHRB 3KLGB 4YR2A 3DYAA 1ZETA 2RF2A 1RT2A 3Q8PB 3HVAA 2YKMB 1EETB 1HMVA 1HQEA 4QW8A 1RTHB 4QWBA 5F8LA 3BJYA 4PQUB 4EO8A 1RT6A 3Q8RB 2VG6A 3DOKB 4LSLB 1N56A 2WTFA 4O4RA 4ED6A 4PWDB 4Q43A 1T3NA 1OS5A 4Y34A 1W25A 4ID5B 4J9KA 1JLBB 1RT3A 4JUZA 3DMJA 4ECQA 3KLGA 1FKOB 2YKNB 3M8PA 2UVUA 3QIDA 3N6NA 1S9EA 3LAKA 3KK2A 1QE1B 3DOKA 5C42A 3V81B 3DDKA 1KLMB 1RT7B 2WOMB 4KHRA 2BQ3A 1JLEA 3V6HA 1QUVA 4FBUA 4PWDA 1S6QB 3KHLA 5K14A 4F4YA 3IGNA 4ECTA 5DLFA 3V4IA 4IH7A 3BGRB 2AQ4A 2ASDA 1TL1A 3LANA 3G86A 4F4XA 1C1BA 2OPRB 5KFWA 5HROB 4IRDA 4O4GB 3MR5A 3CDWA 4RW4A 1RYRA 1S1VB 3OLAA 2VG7A 5KG4A 1QE1A 3PJWA 4QWDA 3OL6A 3DM2B 3KK3A 1QAIA 4ED1A 3RAXA 3SFUA 1U09A 1JKHB 1JLFA 5F9NA 1BQNB 3RBEA 1S6QA 5J1EB 1HPZA 3LP0B 2ALZA 2AX1A 2R8GA 3BGRA 4KFBB 1NNDA 3DOLA 3H2LA 3N6MA 2I5JB 4IFYB 3NAIA 4NLGA 4KBIA 4JV1A 2XCPA 3GV8B 3I5BA 3KHRA 4X2BA 5J2QB 2VA3A 1DTQB 4R5PA 2UVWA 4ZVEA 2RKIA 5J2MA 4K4ZA 5KFZA 5F8JA 1UWBB 2GC8A 4I2PA 2BRLA 2BRKA 3LP2A 5KFVA 4RU9A 4KB7A 4QWCA 4J9NA 3QO9B 5F8IA 4O44A 4QW9A 2R8HA 3M9OB 1XR7A 4YR3A 4HYKA 4DL6A 4H4OA 4ZVFA 1JXLA 5KFMA 5FDLB 2UUTA 4WE1B 4ZMMA 3QZ8A 4EO6A 3EPGA 2I5JA 3CJ0A 4KO0B 3D28A 1TKTB 2FJXA 3KOAA 1HQUB 4U7CA 1IKVB 4LSNA 4URQU 1XR5A 3IG1B 1VRTA 4Y2CA 3GIKA 4IQXA 5KG3A 2B5JB 3UDLA 3JSMA 1GX6A 1RA7A 2HNZB 3H59A 1S6PB 1T94A 3QLHB 1QAJA 2IAJB 5C5JA 1K1SA 3E01B 1REVA 1BQMB 1DLOA 4NLDA 2DPJA 5KFYA 5KT6A 1RYSA 2W8LA 1RT4A 4K4TA 4K4WA 4TYAA 3IS9B 4DL2A 3KHGA 3IG1A 5HP1B 1N5YB 4O3NA 4RW6B 1RTDA 1TKXA 2ZKUA 3MFHA 3BR9A 4GC6A 3I0RA 3FDSA 4IG3A 5F8NA 4RW8B 2B43A 2FLLA 1RT1A 5KFHA 5KG0A 3E01A 1FKPB 2J6UA 1T03B 5J2PB 3GQCA 4EYHB 4Q8FA 3DLGA 4IG0B 5KFLA 2XGPA 1JLQA 3KJVA 3UR0A 2O5DA 4KKOA 2GIQA 3JYTA 4FS1A 3HVTA 3IRXB 5KG1A 4ZPCA 2W9BB 4JV2A 1C1CA 1RTJA 4IH5A 4I7FA 1S97A 3OL8A 2RDJA 5KT2A 3ISND 2WONA 3KLIA 3MR6A 1LWFA 1SUQA 3OHAA 3QGHA 2V4RA 4F50A 4MKBA 1T05A 4IOBA 4DG1A 1HYSA 5KFXA 3DYAB 3PW4A 2RF2B 1RT2B 1IKYA 2OPQA 3MEEB 3DRPA 1J5OA 2B6AA 4NLUA 2YNFA 2DPIA 5EWGA 1HARA 1RT6B 3Q8SB 2VG6B 3FQLA 3CJ5A 4K4YA 1HNIB 3ISNC 4RNHA 2ATLA 1S9GA 1SH2A 2IMWP 2AGOA 3H5UA 1SH3A 1LWEB 2W7PA 3MECA 5JUMA 5KFUA 1RT3B 5F8GA 2W9AA 3DMJB 3PJXA 2VA2A 4EBEA 1S1WB 3M8PB 2JEGA 3MEEA 4ECUA 4J9MA 2IA6A 5DG8A 1Z4UA 5KG7A 1S9EB 4G3IA 3M9NB 2XI2A 3T1AA 3KK2B 4IRKA 5C42B 1HNIA 5DGBA 3DI6A 4H4MA 2VG5A 1JLEB 2BE2A 2HNYA 5L1LA 5K14B 1LWEA 4MIBA 4ZP6A 3V4IB 2BR0A 1TL1B 3NBPA 3QYYA 1JLCB 3RB6A 2J6TA 4URSA 1RTIA 3I5CA 1S1WA 4IR1A 1C1BB 4RW4B 4RNOA 2VG7B 3RB0A 3PW7A 4NLTA 2JEJA 2F8EX 5KFPA 1C0TA 3BSAA 5L1IA 3KK3B 3H4BA 1JLFB 4ZPBA 4G1QA 3RAQA 2W7OA 5CYMA 1HPZB 3QIPA 4J9PA 4DL5A 5F8MA 2AU0A 2C28A 2AGPA 1S1UA 4NLQA 4M94A 3DOLB 2XCAA 2J6SA 1JLCA 2QE5A 1KHVA 4NRUA 4K4VA 4ED3A 2YNIA 5I3UA 2ASLA 5C24A 1S49A 4YR0A 3H40A 2IBKA 4R5PB 1FK9A 1RT5A 2RKIB 5J2MB 4PUOA 5T14A 5KFDA 2W8KA 4I2PB 4MIAA 3LP2B 4TN2A 5HBMA 4O44B 4LQ9A 1VRUA 3GV7B 4H4OB 4MFBA 1JLGA 2JLEA 4M95A 3BQ0A 3UPFA 3DLEA 4RUCA 4WZMA 1IKXA 4Q0BA 1IKWA 4LSNB 2JC1A 1VRTB 1S4FA 3TAMA 3OL7A 3PVXA 3NAHA 4RUAA 3JSMB 4NZ0A 2YNGA 4XO0A 2AGQA 3T5HA 3MTKA 5C25A 5KFFA 4WFXA 3GIIA 2FVQA 3Q8QB 2WHOA 3QGGA 4WFZA 4Q45A 2E9ZA 2HAIA 2FJWA 4Y3CA 5D3GA 1REVB 1DLOB 4ECRA 4H54A 2IM2A 1D1UA 2BANA 5KFJA 1MU2A 1C2PA 2W9CA 1RT4B 4O3SA 4YQWA 2ZD1A 3MEGA 3NL0A 1I6JA 1RTDB 1TKXB 4O3OA 3PW0A 4EBCA 4IH6A 4O3PA 3I0RB 3QZ7A 4IG3B 4B3OA 1RT1B 1JIHA 2IC3A 1HNVA 5KFCA 3GV5B 2FLPA 4O3RA 3V6DA 3M8QA 1S9FA 3DLGB 5KFBA 2YNHA 3PW5A 1JLQB 4IDKA 3KJVB 4J9LA 4KKOB 3JYTB 1TQLA 1YVFA 3C6UA 4RW9A 4DL7A 3H5XA 3HVTB 3D5MA 5KT4A 2HMIB 2JEFA 1C1CB 2ZE2A 3OSNA 3G6YA 1RTJB 1S0MA 4IR9A 4I7FB 5DG9A 3PHEA 2XWYA 1NHUA 2WONB 3KLIB 5KFAA 1LWFB 1SUQB 3ITHA 3T19A 2UUWA 4J9QA 4ED2A 1T05B 1EP4A 4DG1B 1K1QA 1S10A 1HYSB 2D3UA 4QWAA 1R0AA 2OPQB 1IKYB 3M9MB 1N4LA 3DRPB 5KG6A 1J5OB 2AX0A 2B6AB 4GC7A 2OPPA 3CDUA 2YNFB 3RB3A 1N6QA 1LW0A 1CSJA 5KG2A 3OSPA 3CWJA 4EYIB 4EEYA 4J9OA 1KHWA 1S9GB 3BSNA 5J2NA 2ILYA 2WCXA 3MF5A 5I42A 4ZVHA 4JV0A 3KLVA 4K4XA 2QV6A 3GILA 3MECB 3HVWA 3UQSA 4ECYA 2OPSB 4ICLA 1TVRA 1TV6A 1TP7A 2WB4A 3EPIA 3PW2A 3KNAA 3FFIA 2XGQA 3N6LA 1DTTA 2JC0A 3G6XA 4TQRA 3DI6B 4H4MB 4K50A 2VG5B 4NLOA 1TKZA 2WRMA 4NCGA 2R2UA 3SI8A 3IN5A 2BE2B 2HNYB 4R8UA 3SFGA 5L1JA 4F4ZA 3V6KA 3H5SA 1IM4A 3CJ3A 3I0SA 2UVVA 1MMLA 2C22A 3NBPB 2I1RA 4ECZA 4TY8A 4WYWA 2OPSA 1RTIB 3KLHA 3C6TA 3LP1A 5HLFA 4Q44A 5DGAA 5KT3A 4XPCA 3PZPA 2E9RX 5KT5A 4IFVA 1C0TB 3CJ2A 4TLRA 3KLFA 3I5AA 3HKWA 2EC0A 2D3ZA 2R2TA 1JLAA 4G1QB 2C2RA 4MK9A 4TY9A 5CYMB 3QIPB 4ZP7A 2IM3A 3GYNA 4ZPAA 3NGDA 5DG7A 1S1UB 4WXOA 2HWIA 2YNIB 5I3UB 1S1TB 3FSIA 4QWEA 2HMIA 5C24B 2W9BA 2V9WA 1D0EA 4RNMA 4NLXA 4RNFA 5KG5A 4J9SA 1FK9B 1RT5B 2FVCA 1RDRA 2HWHA 4TXSA 4PUOB 5CYQA 4IRCA 4MH8A 4I2QA 5KFRA 3T5JA 5KFOA 2GIRA 3H5YA 5HBMB 1WNEA 3DRSA 4RW7A 1VRUB 5L1KA 4MFBB 5KFSA 1C0UA 4ZVGA 1JLGB 3CIZA 2JEIA 3KK1A 1SH0A 3MEDA 4WFYA 4KV8A 1S1TA 3DLEB
chains in the Genus database with same CATH superfamily
3DLJA 5KFQA 1FE0A 1S1XA 1FEHA 3TA1A 2J0WA 3C2PA 3R7NB 3RBZA 1WG1A 1UVNA 5K8OA 3RB4A 3E51A 4CO5A 3CD5A 2RS2A 2VH7A 5AJ3F 3H8YA 3AD9C 2CZVC 1S0NA 2IJFA 2IC3B 3SQGB 4TU8A 3PR5B 3M8QB 3DHXA 1OSCA 4X66J 3IGVA 1F2GA 3IA0A 4O4GA 2B0GA 4XPEA 4DX8H 3EMTA 3JQKA 2B7CB 1BWEA 2FB0A 5KFEA 1BQNA 4KH0B 3OFHA 1U45A 4TQSA 2CUYA 3V6JA 3EZOA 1UVJA 4URGA 1F5AA 2HVIA 2J76E 1CJVA 5I3QA 4A8KA 4MK8A 2MB0B 2XSJB 3C6TB 1LWCB 3LF0A 4DSFA 4B17A 5HP1A 1N5YA 4TYBA 4OYOA 3B78A 2C2DA 5A0YA 4QR1A 2VHGA 4FYWB 1FKPA 5KFNA 1U1PA 2OUGA 1HMVB 5B0CA 4X4SA 3T9ZA 5BYSA 2ZZTA 3GYXB 2E5LJ 1B99A 1FRLA 3AJDA 1VBZA 1WG4A 2YX1A 2W2PP 1VJQA 2JX2A 5BYRA 1AW0A 3RR8A 4DLGA 3CD6S 2KG1A 3EJMA 4JUZA 3DMJA 2BE7D 3R5GA 1UEVA 2PGCA 2WW8A 1S6QB 2I2YA 2A6MA 2APOA 5HROB 1X5PA 3PJWA 3DM2B 1W26A 1ACMB 4YB1P 1NNDA 1IBLJ 1J5EF 4OZLA 4CLLA 3THTA 3UCUP 2ZWOA 2R7VA 5F8IA 3SYZA 1RUSA 4YR3A 2Y1RI 1RTZA 5FDLB 4EO6A 4M5IA 1LWXA 1LFPA 2Q1LA 4B3TJ 1HQUB 2W2QP 3AQOA 2XWXA 2OIHA 1LQ9A 4WU2A 3GJSB 2MY8A 2HQ3A 2XTJP 5GMKa 2MZSA 3MOJB 4ZLPA 1P6TA 5HATA 1FFGB 5H9FJ 1SC6A 1AZSB 3LWLA 2B43A 2XSFA 3WZ0A 3HMJG 2A18A 4JV2A 1KNZA 1S59A 4FKXA 3MM9B 1U8WA 1DURA 5DDQC 1F3FA 1SH3A 1BHNA 4ANDA 5KG7A 4QPTA 3SDEA 1F3VA 4ALZA 4ES2A 1GXLA 4UT4A 2JJ4D 1JLEB 2VQEF 2IBOA 3ONQA 1NK9A 1U1OA 1DJ0A 1WEYA 4L75A 1LXNA 5MLCV 1ITPA 3P5TL 3KK3B 1IBKJ 1XIQA 3X3UA 2MKKA 4DL5A 2F9DA 4K4VA 3T41A 1QLNA 4UTGA 1IWAA 1H0HB 1IR1A 1FDDA 2DNHA 4A48A 1N34F 1IR0A 4LFCJ 4QYZK 1S4FA 3IWLA 3OL7A 1OMSA 4NZ0A 3G96A 5J1PA 4LREA 2WHOA 4WFZA 3O3LA 2VUGA 2AKWB 1VBYA 4FN5A 3MMCB 2OHDA 2CJXB 5D15A 1VC0A 1HL6A 4KGVB 1IXKA 3KKFA 3M8ZA 4PWUA 2C1EB 2FIUA 3D5MA 2JEFA 1C1CB 3D3CJ 3QATA 4AFFA 2AHOB 2JDJA 5LXRA 2CPYA 5K8MA 4DR6F 2DHHA 1I3OB 1SQGA 2WVDA 2UU9F 5I42A 4OZ0A 4LF4F 2H51B 3HI9A 1ZM3A 2B51A 4X4QA 4KJIA 1R6YA 4ICLA 3W64A 1FX4A 3EGNA 3DI6B 4K50A 1TKZA 3VVUA 3I0SA 2DISA 4HI2A 2VC1A 3NWRA 3E3XA 5KT3A 3PZPA 3K89A 3CJ2A 3MMAA 2C2RA 3RBXA 5DG7A 2A2DA 5HJYA 1D0EA 2V9WA 2L9DA 4YB6A 4RNMA 2AYBA 1S12A 1RWOB 4I2QA 4AE5A 4JYAJ 1RWNB 2MKJA 2HZAA 2YWGA 2HAFA 4X4VA 1IKXB 1RWKB 2YKMA 4X65J 5C25B 1RABB 3A8EA 3AJ1A 2PIIA 5EX3A 2JVRA 2IHR1 4K4UA 3QT8A 2MGZB 3AOCA 3MAAB 1JNZB 1YJWS 1UL3A 1MWQA 5HMXA 2XZWA 4BC9A 3HO1A 1MLAA 4DPOA 2YQ1A 1RB0A 3TUIC 5DM7Q 3NKYA 1L3UA 4ZJOA 2AP6A 1X7VA 3NMAA 3VGVA 3C15B 1M0SA 1IJFB 1U1KA 2R8JA 2B56A 1ZTTA 3TVKA 3M6XA 2Z30B 3TUJC 2Y0SD 4N8NA 3G6VA 3CMQA 2G2OA 2A10A 4KHMA 4IFVB 2IM0A 3TZXA 1KTQA 3HXMA 2XLJA 3TI0A 4M5NA 5KFKA 3KUEA 1D3WA 5EUHA 1EARA 1HWKA 5J2PA 3CTRA 2C2EA 2E5JA 1ZAVA 3C16B 1WWHA 3F0NA 2YKAA 4DI6A 2BV3A 5ITHA 1ZETA 1RISA 2PT0A 2O1PA 9ATCB 4AYBD 3DOKB 4LSLB 4ED5A 1K0VA 1RHQB 2YXLA 1WF2A 4ID5B 4KHPJ 2P9EA 2CA9A 2DGTA 2G2ZA 1ZOTA 4FXDA 4HHHA 5C42A 1QUVA 1GXTA 1P8GA 1TL1A 4AD6A 1CPZA 3HK2A 4PRFA 1IUJA 4DUTA 3BGRA 1VQMS 4NXNJ 4BS2A 8AT1B 2HQGA 4KQZA 3Q86A 4PG6A 1YJRA 3G8TA 2BRKA 3M9OB 5KFMA 4A8WA 2I5JA 5H9EK 1UVMA 1XNRJ 2HNZB 3TP2A 2CPXA 3OFEA 2AYEA 2CPEA 4QIWD 1PCAA 4QJVA 2VASA 4QU6A 4WK3A 1RXOB 2PEHA 2VFVA 3GQCA 3TX8A 3N9UC 2HBRB 1S97A 2M0GB 4I7FA 4LBHA 1RWUA 3BKTA 2DVIA 2PI4A 3BN4A 4KYZA 1NK6A 4MKBA 2J9EA 2DR5A 2RF2B 3W5ZA 2JRSA 2RAQA 4KH1B 5LL6d 4DR5J 4DV4F 2Y1JA 3MECA 4NMLA 5F8GA 5HL7Q 2IA6A 1JQGA 2NXJA 3DLBA 2R7QA 2HGMA 4DS4A 1SL2A 1F9EB 3FSXA 2DHXA 1JLCB 4OV6A 2XQCA 4C0BA 2EK1A 3EXCX 4NZ7A 5KTQA 3H4BA 5CYMA 2PI5A 2XYPB 3QRRA 3VAIA 2DNRA 2EBGA 1NK7A 4C2MA 4MIAA 4PXBA 1HD1A 4O44B 1NO8A 5I3PA 2QL7B 1A9NB 3OTOJ 5THWA 4CNYA 1GMWD 3M6WA 3RGIA 4Y3CA 4J37A 4P74A 3M6UA 1TUWA 2ZC3A 1F6TA 3ZTOA 3H25A 2ZH7A 1FD2A 2DNQA 1N0VC 1YTYA 2YNHA 3D68A 1XERA 2XWYA 3BDEA 2W4DA 4B9UA 3ITHA 4JV5F 2ZOFA 2XHWA 3HHLA 2AX0A 3OSPA 2ZITA 1S9GB 3P49B 4C11B 3FGVA 2B8PA 3TAPA 1HHSA 2OSRA 5IQ6A 3FMBA 1U47A 3KNAA 2JC0A 3EGZA 4NCGA 4N7TA 2LU1A 3FBFA 4UY8T 4WYWA 1NKEA 4FF2A 4G65A 3GTYX 2V63A 4P71A 4X62J 2DEJA 2XZDB 3CCTA 2KU7A 5HBMB 2VPWB 1NB2A 2JEIA 3ZC4A 2RRNA 1PGZA 3DDIA 4CI0B 1LFWA 2C3PA 4LF8J 5BR8F 3DGPB 2FHJA 4B3SF 2R3VA 1HBNB 1M90T 5HVHA 1GK8A 1QTNB 2V2VA 2UXBJ 2CNLB 2WVEA 2RJZA 4F7VA 2F9JA 1RU2A 3NCPA 2B3TB 3OLBA 4JI8J 4RW9B 4N76A 4F4WA 3P45B 2ZE2B 3PXGa 1P27B 3NS6A 2M88A 3U27A 4ECWA 3PR4A 3AAWB 1LK5A 4JB8B 4UZCA 3LP0A 1N6QB 4CTAA 2YWWA 1UW4A 3GPAA 4DL4A 3UD5A 2RB7A 2VDIA 5A6PA 5EGYA 5CZXA 3R27A 2JL9A 3VVTA 2P6SA 1NM2A 1IKVA 4OZ2A 1WHVA 5IWAF 4OZ3A 2IAJA 4FYVB 4JI0J 1R0CB 3DHWC 1BQMA 3Q89A 3O44A 3TUPA 3VALA 5U47A 5AE3A 3GSDA 1RJJA 2Y0BB 3OXFA 3U7JA 3CGIA 4F0MA 4UUXA 4KIAA 4Z7CA 2EKNA 3H90A 3AA8A 1GTEA 4YR2A 3CJ8A 1RT6A 1UEUA 4NYOA 4ZS6A 1H72C 3M2UA 1U25A 3ZZPA 1B4SA 1NJWA 3DLLQ 3W62A 2VBXA 2UUCJ 3PYEA 2LYVA 2K3IA 2N4CA 4PYAA 3KDNA 3AFGA 2GHWA 3PIOQ 2YX4A 5KFWA 5F8JA 1S1VB 1M1HA 3OLAA 2BUNA 3RAXA 4NEZA 3CB4A 3H2LA 1NU4A 1DRZA 1XMOJ 3I5BA 2UVWA 4DCJB 1UWBB 3LP2A 4HYKA 3W60A 1JXLA 2CG4A 2UXCF 1TKTB 3FKBA 4URQU 1TAUA 1RQ0A 2AYMA 2RD5C 5C5JA 2C3OA 2ZM6F 3IWNC 4N5SA 4P72A 1EQ0A 1GMVA 2VQFF 4RW6B 2DR8A 2QA4G 5K20B 3UWTA 1S77D 1UA0A 1GTHA 3AQPA 1T03B 4J91A 4P7TA 2GIQA 1VOMA 3OVAA 3SCIE 4WWSA 2HHVA 3MM5A 5CHCB 4F67A 2HHPA 4DX6A 4F50A 1T05A 3PHTA 2B6AA 2YNFA 2EI5A 3ISNC 3PACA 3CJSA 4RWWA 1CVJA 1SJFA 2IIHA 4ANCA 4DUYJ 4DR1J 3D66A 1NBEB 2DO4A 5IT9U 2NXCA 3M9NB 3MXHP 1NSKL 4YY3J 2HVZA 1LWEA 5IC4B 2VKZG 3I56S 4NX9A 4RNOA 2VG7B 3K2YA 1YG0A 4HVZA 4DX7A 3BSAA 4LRCA 1JLFB 4MJKA 4WPAA 2N3LA 5GAEU 3BN7A 4DN9A 4USWA 1S49A 3FSYA 1LEOA 2MKIA 4K8RA 4I2PB 4PKDB 4G6VB 1SQFA 2CVEA 2J0SD 4MTPA 3BQ0A 1N36J 4GRSA 3MWBA 4OZ5A 4LVNP 2CFXA 1BGXT 4RJVA 2YNGA 4XO0A 2RT3A 2QMXA 3Q8QB 2PMZD 5D3GA 2E1AA 2FD2A 4A8SA 1UKUA 3TA2A 1RTDB 1RT1B 3DLGB 2HBZB 1HBMA 1YVFA 3IM9A 1E6YA 5AT1B 4EZ6A 3PHEA 2VFRA 1SUQB 4J9QA 1S7IA 1UJ4A 1NDCA 4CLWA 3M7VA 2M9KA 1PC5A 4FF4A 2ZOMA 3MF5A 3M6VA 4ZVHA 4JV0A 3T6BA 2UXDJ 8RUCA 2CZ4A 4Y0FA 1TP7A 2M3DA 2OD6A 3M8RA 4UUWA 2WRMA 4R8UA 5L1JA 4DV6J 2QO3A 1RCXB 2JOQA 2RQMA 2C22A 4ZCLA 3IO1A 5D0HA 3BBFA 3HULA 2WVFA 4OX9F 4F04B 1WEXA 5LM7E 2R2TA 1U6FA 4ZPAA 3NS7B 3US5A 1RWXB 4DPYA 4NLXA 4LF6J 5G0RB 1B0PA 4TXSA 3R5JB 2KZMA 2GIRA 2IDLA 3W5YA 3KXDA 1VRUB 1YLXA 3EZ5A 2HRUA 1C0UA 1HNXF 1LW2A 2HW3A 4FBTA 3H2VE 1BE4A 3PFOA 5ETKA 5A2QY 4DV5F 1VK8A 4F4KA 2RQCA 4USVA 1HNVB 3V6DB 3BR8A 2ASJA 2FJAB 3PO5A 2ZVSA 4NLYA 1HW9A 2Z2LA 4OJHA 5A8RB 4HR2A 3A4TA 5D4OA 3W1YC 1NHVA 3BB5A 4CYUB 3G8SA 2GAGC 2JFDA 1S6UA 1YBUA 1QSSA 4USIA 4PZVA 3M32B 3KJNB 3UD4P 1SJRA 2OEMA 3FFIB 2UZAA 2DH8A 5L9XA 1RCOB 3TEGA 4LF9F 3BPDA 4QR0A 4ECVA 4OI2A 2IJNA 4J7CA 3DFEA 5DQHA 4NCBA 4J9VA 5LMUF 5EN1A 3LQVA 3FMWA 2ZUGA 4OYIA 1S99A 4I64A 1XR6A 1S48A 2VPXB 1HBUA 4WFNQ 3VQSA 3ZTQA 4WYLA 2X1FA 5ETRA 2FC8A 3LTOA 3EVWA 4NYPA 3DRSB 4RW7B 3RW7A 1UA1A 1PO6A 2JZ5A 1TK8A 2CQ1A 1FEEA 3RR7A 4GKJJ 4ZVUB 2W2NP 5M2UA 1ZBTA 1H74A 5F8LA 3AA9A 5FIIA 4ZIVA 3IRWP 4Q2LA 4LF7F 3Q8RB 2VG6A 4ED6A 3POTB 1F9FA 4USKA 3QIDA 5IT4A 4KGZB 5HO4A 1PC4A 1G3OA 1KLMB 4ERDA 1T02A 1NHKL 3V4IA 1VQNS 1ULRA 4C8LA 1WSRA 4IRDA 3VCDA 2FZCB 2CPDA 4P2MA 5SUHA 1Y11A 4FNIA 5LSLA 4DV2J 1ZAWA 3CJKB 5J1EB 1WKJA 3SBMA 4DR7J 2ZH2A 4ILRA 3M8SA 4DN0A 1HI8A 3GLJA 2XB2D 3N5FA 2QFJA 2B5JB 2W1BA 3H59A 5CD4A 1GMUA 3QLHB 3LW5C 1RT4A 1DZ5A 4C0OC 2D69A 4O3NA 3PTWA 2HQCA 2ZKUA 2N7CA 3MM7B 3CCUS 1R7IA 1VGYA 2ZBQA 3NWGA 1HHTP 3JSYA 1RACB 1JLQA 3UR0A 2MZJA 4KKOA 2NREA 4ZPCA 2GMLA 2RH3A 1YBAA 2WONA 1NJZA 2HHWA 5KFXA 2AJFE 2KM8B 1XTZA 3QFWA 1Q86T 4Z7YA 5GAHU 3TJ9A 2W9AA 1FNOA 2L9NA 1ZPWX 5B0FA 7FD1A 2K3KA 1QAYA 2J7UA 1SB6A 1NPPA 2J6TA 4GKKJ 1F9HA 3SQOP 2KRBA 2C2KB 1NK0A 3MMBB 2CADA 2XCAA 2J6SA 2QE5A 2CNKB 5D0EA 1V5IB 1FK9A 5J2MB 1FWPA 1OWXA 2OTJS 5IM0B 2H5IB 4H4OB 1Y7PA 3EUNA 2MKHA 3MPDA 4WIQA 1R8PA 3MTKA 2M52A 2G9OA 2E9ZA 4ECRA 3TRGA 3ZNJ1 2GCFA 3K58A 2PE8A 2WSEC 3QAEA 3BF4A 1TKDA 3I0RB 2H5EA 1TMJA 2IC3A 3SQGA 3PYGA 2FLPA 4E0DA 3M8QA 1S9FA 1BWVA 2CPFA 2K1RB 3HVTB 2UUWA 5KOXA 2OPQB 1IKYB 2ALYB 3UI3A 1UWAA 3TJ8A 3FNNA 2MKSA 3UR3C 4K4XA 1EHWA 1FXLA 1WC3A 4DR2J 1R8AA 1FRJA 3N6LA 4P52A 3MMAB 3FZBA 2UVVA 1RHJB 4ECZA 3BH7B 2XSJA 2L48A 3C6TA 1AFIA 3NMRA 2DNMA 1YJVA 1X5SA 4UOCA 3K0JA 4UOFA 3FSIA 4DV1F 4J9SA 1RDRA 3TEHB 1XK8A 4MH8A 3MUTP 5L1KA 2VODA 1X4FA 3PRVA 4ZVGA 3CIZA 1M5OC 3PCOB 1IKWB 4OX7A 1IQZA 3HSJA 5AJ3J 3PRDA 2ILZA 1OPZA 1KTVA 3CPWR 1ZA2B 4I1TA 2FVRA 2D3OR 1EB0A 3FRZA 2EFVA 3R5AA 2KXNB 2XS5A 3K17A 3H7HB 3KFWX 2VONA 4OZ1A 4CM0A 4YB5A 2Q3PA 3DRRA 2RNEA 2FTRA 2HHHF 5HROA 3GB0A 2VPYB 3DM2A 5HQMA 4UZBA 3Q2SC 5D4PA 1SV5A 2BOAA 1LW0B 2WK4A 2YKPA 5IS2A 1RHKB 3BGLA 3DDNA 2B9YA 3I55S 3QNWB 3MR2A 4C8NA 3VF0B 5FDLA 4ECXA 4DHVA 3JTOA 1HQUA 1XNRF 2DKOB 2R2SA 2JHEA 4L76A 5HLFB 4W4MA 5BXIA 1TTHB 3OFFA 5E41A 5DJBA 1AZSA 2NXNA 1TUGB 2VJVA 4OYBA 3GIJA 2HMIB 3FQKA 2DTJA 4YDXA 4ID8A 2CAJA 3QJPA 2BQRA 3RU0A 5E0OA 1BQXA 4YOEA 4I6YA 3DLKB 4PYDA 1RHMB 3HVAA 2H5JB 3MM9A 4U96A 2CQBA 4U8YA 3K59A 2CXEA 2GFFA 4J5OA 1REGX 5A8KA 3CF5Q 4WCEQ 1HFEL 4AXIA 3G9CA 3ZZZA 2G4BA 2Z2YB 3W66A 3OUYB 2FGOA 1EX8A 1JLEA 3CULA 4DJBA 5KOWA 1QUPA 3BGRB 1FJCA 2XO7A 1J5EJ 3VAMA 3KK3A 2HS0A 1JKHB 5F9NA 4JP8A 4HT7A 2OGUA 1VJWA 4KFBB 2I5JB 4AUKA 1VQ5S 2XCPA 5E3PA 2IVFB 5B09A 3GWCA 4MMOA 1R8BA 2VZ9A 3SMZA 4CO0A 3CJTA 3A3NB 2FZGB 2XS7A 1RA7A 3BYPA 1T94A 5HJXA 2VFTA 3MMCA 1MMDA 4GC6A 4TNOA 1Q8LA 2DRDA 1AA1B 3AH6A 4DFJA 2LLZA 2QLFB 1C1CA 2A1BA 2AEJA 4LF5F 3MR6A 2HBYB 2V4RA 1ICEB 3D9BA 3PW4A 3ZTRA 3Q8SB 2ZBCA 4RNHA 1SH2A 1WACA 2VQEJ 1M5PC 2F63A 2RIJA 3M8PB 2JEGA 3NG8A 4B9VA 3QT5A 1S9EB 4Y2MA 3DI6A 3ENVA 4XTTA 3AT1B 1UFWA 5CZVA 1MSWD 3QYYA 3C3LA 4CLKA 1NSPA 2JEJA 2F8EX 2V8PA 4USUA 2DT9A 4ZPBA 1N34J 4J9PA 1URRA 4CH7A 2CIMA 1EIYB 1UVLA 2RSQA 1NB7A 2KFYA 2DHAA 1Q0NA 4P10A 4M5DB 2KI2A 3ZFVA 1IKXA 3K5PA 1VRTB 4RUAA 1K9MT 4USJC 1VFJA 3JSMB 2E7VA 3TZZA 5C25A 4Q45A 2KVIA 2AIRB 2Z57B 1NDKA 4ZK7M 1X9WA 1T8EA 3SEOA 2MGZA 4IG3B 3L7PA 3HPOA 1JIHA 3ISZA 3MAAA 4LRDA 5KFBA 4DR6J 2O3DA 3T3FA 4DF8A 1O8BA 2UU9J 2PN6A 1JNRB 1VIOA 4LF4J 3O6QA 2IMOA 2CNOB 3LPEA 2XY5A 1HYSB 5KG6A 3QGPA 1KOOA 4RWXA 2ILYA 4DSKA 3GILA 2DNZA 2VD3A 3GONA 3C15A 1WKKA 4ES3A 3HHNB 3IWXA 2B9XA 1KFDA 1APSA 3FBBA 3SCJE 4JI0F 4LRBA 2E1RA 4IFVA 4K5RA 3I5AA 3MUMP 4ELTA 2MXYA 1YGYA 2GO9A 3TQEA 3OR2B 3T1YF 2M4MA 4Y2KA 2BOPA 2KZZA 1IJEB 3C16A 3G82B 9RUBA 1JLGB 1Y5LB 4Q0BB 4X4RA 1ZM2A 2JLFA 5CH7B 3BSOA 4UW2A 4V19J 1LOUA 4LSLA 1C4AA 5D6GA 1WDDA 4ID5A 2ZD1B 5B0AA 2OAUA 1FA0A 1NKCA 1KLNA 1YJ7A 4J9RA 3IBWA 2QEXS 2HGNA 2RUSA 1M5HA 3C6UB 2RDDA 3ICLA 4Y2AA 2MHNA 2IDEA 5I4MA 1TL7B 1NSAA 1U2FA 4CIOA 1FRHA 4F8RA 2NXEA 1QDUB 2XI3A 2ACYA 1A6LA 1PBAA 2HNZA 2QGFB 1YJUA 1FNMA 2KHCA 4WK1A 4ZP8A 3J81U 3O1LA 4QR2A 5HI7A 4F25A 3PNIA 1PJ5A 4EUVA 4KAIA 2E1PA 3UDEA 5ETPA 1BY9A 4J9OA 4O3QA 3HHLD 3OHBA 4CH0S 1NH7A 5CYQB 2R8IA 1EAYC 4EBDA 4MK7A 3KLEA 3KUHA 3H98A 1FXDA 3MGJA 1SL1A 4KV8B 1BD6A 2HNDB 3M2UB 2YPZA 4ZHRB 2RF2A 4LRFA 1KONA 4ZN1A 1HLWA 2PA8D 1FERA 4W90B 4L72B 3MI7X 4KHRA 4ES1A 1AFJA 5F8NA 1TELA 2ZHAA 1QE1A 1FRKA 3MPWA 1X5OA 3HDSA 1WOOA 2ZKTA 4IFYB 2W2MP 4KBIA 3OT9A 1CEZA 4MT1A 1RSCA 4ZVEA 3ZO7A 1DY3A 4O44A 2F8HA 4KO0B 5A6WA 3W61A 3GCXP 5CA5A 3J7YU 3TAQA 4U7CA 1N36F 5FLXU 1RAEB 2W7AA 2BM0A 2NYIA 2XMWA 3TO8A 5D77A 2NXUA 4DL2A 2BKOA 4TKTA 4ATNA 3E01A 5DDOC 1O0PA 3UFCX 5KFLA 3G4SS 3AB2B 3EDRB 2OJ3A 2AJQA 4FS1A 1BUXA 2LQ8A 3L4BC 2BJ3A 3QMQA 4K2XA 4AL5A 2LKZA 1KWMA 3GJTB 5EWGA 2FGCA 2H1YA 1S9GA 3UE2A 1Z1ZA 2MZTA 3NOGA 1NXIA 4C11A 1LWEB 5KFUA 4DBQA 2MEWA 2P9GA 1VHIA 5H9FK 4NL5A 3D0HE 1CC7A 1NUEA 4RBTA 1HWLA 5K14B 2BW7A 4ZP6A 5GMDA 2J8SA 1SIZA 1NK5A 2KO1A 1C4CA 4C8MA 2W7OA 1VBKA 2C28A 4LR8A 5HQLA 3VAHA 4CLPA 1U1QA 2V8HA 4B08A 2KB2A 4XAKA 3VAFA 2LDIA 5HBMA 2RQ4A 5AXKA 2PEBA 1HBOB 5CCLA 4ILMA 2GV1A 5DDRC 4YUDA 1WELA 2UP1A 3DGPA 1HBNA 2OELA 2HHSA 4HTIA 4C4WA 2ACMA 4DSLA 2H48B 1O5JA 2GA7A 4JV5J 3MAQA 3NGTA 2KRRA 1AUDA 1NJXA 4IOAQ 4ZLJA 3H5XA 4RW9A 4DL7A 3ZZYA 3B4DA 2ZE2A 4JI6J 2BJEA 1WOSA 1ZPVA 4RU2A 3T19A 2PFFB 2ABYA 3CD0A 2D3UA 1UJ5A 2WVCA 1T3OA 1N6QA 2ADCA 3KLVA 3GR1A 1B0TA 3AOAA 3ZTPA 2CJBA 3HVWA 2HLUA 4K5SA 1TU0B 5DDPC 2QIFA 3SFGA 2MZRA 1RTIB 3BZQA 5LSRA 3UW1A 2CQ3A 3K8WA 5KT5A 1PIEA 4B9LA 1B7YB 4WFAQ 3GYNA 3L7UA 2GHVC 1SKSA 2HWIA 4OHWA 4B3RJ 3T5JA 1PKUA 5BR8J 1J2VA 4B3SJ 4MFBB 1ZAXA 2V9KA 3DLEB 4F36A 3DCAA 3L09A 4Z2XA 3MHYA 2DGXA 3W2VB 2XLKA 2DGSA 4FVCA 3BM7A 2KYZA 1HNWF 3MEGB 3RUBL 4RZRA 3U02A 4YMEA 5J1NA 4F26A 4NLVA 3OW2R 2RDIA 3M05A 4CLFA 3BQ1A 4R0EA 3CMES 1S1VA 2EG2A 2X3GA 3FBCA 1LXJA 4P2SA 4CQ1A 5C7PA 4QU7A 3IR5B 3CCRS 2H65B 5L39A 1NK4A 1QVGR 5DZ7A 5GAHI 5B0DA 2DNYA 1UWBA 5IWAJ 4HACB 3EM1A 1DTTB 1TKTA 1KN6A 2E7WA 2CQGA 5L8RC 3UN3A 4OI4A 4LQ3A 3H2UB 2J0QD 1CJTB 3S6EA 3PIPQ 2QLWA 2W24A 3P96A 1WI6A 1JLAB 4Q5VA 2WSFC 2F7VA 4RW6A 3BPSP 3G71S 4L6V3 4FVMA 4IKAA 3U1MA 4JI3F 2D7SA 1U0SA 1T03A 3I6PA 1S0OA 4LT6A 1S76D 2M7SA 2MJNA 2UVRA 1F0XA 2YY3A 4PG5A 4XDDA 5D8HB 2IVYA 1YDLA 4FS2A 3VZIA 2V8DA 3GG1A 3IXQA 5DO2A 2DR9A 4PQUB 3TNVA 4YDDB 1SC3B 1W25A 3GE9A 3MDFA 3PKYA 4U7UK 2DNKA 3JTNA 1RWMB 2M5YA 4AXJA 1RT7B 3BGUA 5DLFA 2I38A 1V9OA 2MQPA 3MR5A 2BJDA 2VG7A 1KVJA 4WIIA 3PX6A 5B7WA 2DITA 1JLFA 2UXCJ 2UV8G 5IFMA 1N5TA 4I2PA 5BYQA 2ZM6J 4ZVPB 4QW9A 2XMKA 2H54B 4ZMMA 4ENOA 2VQFJ 1GEHA 3J80U 3TR5A 1OYDA 4ZKAA 1FD8A 3IBCB 3GSIA 2CQDA 3WDOA 1KBRA 5E7OB 1W2BR 1WORA 4FYYB 1RTDA 2U1AA 3FDSA 1RT1A 3UD3P 3LA0A 1NK8A 2CPIA 3DLGA 2IRXA 2VU5A 2RU3A 2R7WA 2ZH6A 3OL8A 3DGVA 1SUQA 4CLUA 2BKPA 3CJRA 4CO1A 4DOZA 5G4DA 3BYRA 5BJRA 2IMWP 3TANA 3H5UA 2Y1IA 2P8IA 4PXCA 1X9MA 1FE4A 1KQKA 4OFZA 5DGBA 2GMHA 4LF1A 2LEBA 4PEOA 2DH7A 3C66A 2GJFA 4ELUA 3RB6A 5B0EA 1ELOA 1C1BB 2P6TA 4NOHA 1XMBA 4XK8C 2UUBF 2VV5A 2XULA 5AXNA 4HLBA 3BBBA 1HI0P 1QTMA 3DOLB 3WX8A 2RKIB 3FCVA 5G0RA 5T14A 3ETOA 1VRUA 3GV7B 3GZ7A 1Y4ZB 4RUCA 3MPVA 3HD1A 1R31A 3TZYA 1N8RT 3T5HA 1WJ9A 2ROGA 2F3JA 2CQPA 3N0VA 2IFXA 4LFBF 3BDPA 4WU3A 4IH6A 1VCTA 2EFOA 1UEKA 1HNVA 4I6WA 2WW4A 3V6DA 3QWUA 4DUZF 1TAQA 4F02A 1TQLA 1FESA 1H7WA 1NJIT 1XMQF 4OI6A 4DG1B 5A8RA 2CWKA 4CYUA 4GC7A 3OJUA 1JXEA 2Q43A 3M32A 4OX9J 3I4PA 4RKUC 3FFIA 4A8OA 1V6HA 3G6XA 4U95A 3A1YG 2VG5B 3EGVA 2BE2B 2HNYB 1Q7YT 2BYCA 3CJ3A 1MMLA 5GADU 1FDNA 4NEYA 2KXFA 3RRHA 4LR7A 1YZ7A 2EXUA 3G8QA 4MK9A 4IO9Q 1HNXJ 4RO0A 1F5CA 4UF4A 4OYMA 3ZZRA 1HNZF 5KG5A 3GCWP 2DB1A 3NRBA 1M5VC 3TOQA 3H5YA 3DRSA 4RW7A 1WC1A 3TWZA 3NGRA 2NUHA 4RBVA 4DV5J 2X1AA 4ZCKA 4FYXB 4AT1B 1NZAA 2FC9A 4OZJA 3DRRB 3POTA 2KFZA 5ETQA 2PSZA 5F3ZA 1KLMA 2KKHA 1SV5B 3CT9A 1OY8A 4JI5F 1X5TA 2DNPA 4RBUA 3Q0AA 4CWBA 5T41A 2RU9A 2J7WA 1EP4B 2NZCA 3CJKA 4OHVA 4C97A 5J1EA 3JS9A 2HSEB 4MKAA 3K7RA 3LAMA 1KFSA 5CXTA 4ZVRB 4LF9J 3SSRA 3CC4S 4B02A 5LMUJ 5DETA 3T5KA 2RE1A 5IT9Y 4YP3A 2B5JA 3BBCA 3KTQA 3QLHA 4P9SA 2DXDA 3EYZA 5HVFA 1MWZA 2VFSA 1UCNA 2DY9A 2BA9A 3MM7A 5D0RA 2GMJA 3H4DA 5DQIA 4TLQA 4QPXA 1VIXA 4LF7J 2Z58B 3HHDA 3CDEA 5A8KB 2KXHA 3KWMA 4Y28C 4X4TA 1KVKA 4K7QA 2G1HA 4QWBA 4EO8A 3CCZA 2I8EA 4O4RA 2V8VA 4Q43A 3LGNA 2CQIA 2HFUA 3KLGA 2YKNB 1RAAB 2ATCB 3FUYA 4NA2A 4EWTA 2HGLA 3V81B 4USTA 4PWDA 2QSFA 2Y9HA 2PMWA 4OYPA 3G86A 5FJ4A 4KGMA 1X0PA 3L7OA 2KN4A 3SFUA 2K7JA 4JI1F 3MMBA 5AXMA 3W2WB 2BW2A 3NAIA 1V5VA 3SSQA 3HFZB 3JSBA 5J2MA 1Z2LA 2OKQA 5IM0A 1RGVA 4H4OA 1CJUB 3CCLS 3BO2A 3QAUA 4DV3F 2HZCA 2LFVA 5KG3A 4DSJA 3MTJA 2LQ9A 4NLDA 2DPJA 4M5MA 3RYLA 3I0RA 4OX8A 1MROB 4NZ6A 4PPZA 4IG0B 2QRRA 2K1RA 3HVTA 4WJBA 3VTIA 2CPHA 4TU9A 2GGPB 4ZIWA 5KT2A 1VRQC 1RT2B 1IKYA 2OPQA 3F41A 6AT1B 3CC2S 1KVIA 4CO3A 4DX5A 3QT7A 2F1FA 2F4VF 4CO2A 1H38A 3OR1B 3MEEA 1S57A 2MJUA 4GVBB 3T1AA 2KT3A 4YN3B 2WZ1A 3UCZP 1VQ9S 4ZDNA 1WOPA 2NYHA 1AB8A 1LV5A 4RW4B 2MQMA 3E2EA 1MN7A 1L5UA 3GJQB 1M5KC 3RAQA 3JSRA 2VIHA 4R5PB 2AW0A 2XO6A 1K47A 2VKRA 1FJEB 1SJ1A 4F2RA 3KG1A 3CXCR 3B8HA 1IKWA 2CQ2A 1SVDA 2F8MA 4DLEA 1KS2A 2FJWA 1D1UA 1XEZA 2HQFA 1OJ4A 4DPXA 4O3SA 2DNLA 4O3OA 4WBFA 2POKA 3ILOA 2E5GA 3QZ7A 1SJ4P 1F2HA 3G2XA 3GV5B 3Q8YA 1DFDA 8ATCB 2B4UA 3VQTA 4IUFA 3G6YA 1U2RA 3QPIA 1JJ2R 1RWPB 3M1VB 3DKDA 2JNJA 1N88A 3KLIB 1LWFB 1S10A 2BJ7A 3DRPB 3LGHA 4Y6IA 1LW0A 3WC2A 4E8UA 3FZ2A 3P6YC 1VQ4S 2QV6A 3RRKA 1VQYA 4C0HA 1RLDA 5EHHA 2Y8WA 4DV1J 5HLFA 2J5AA 3A3PB 3GMGA 2DO0A 3GP9A 4G1QB 3N4WA 2NR0A 4ZP7A 4TY9A 1S1UB 2HMIA 5C24B 1WC5A 4FYDA 3CCSS 4WKYA 1N54B 4OQJA 4C98A 1VLOA 1WNEA 1AROP 3FJ2A 2V4JB 3D4JA 3LOUA 3S7RA 1RK8A 3J7YI 3D67A 2V8GA 3DLKA 5F0WA 2ZH5A 2BBEA 2B4VA 5KFTA 2HHHJ 1RHUB 1UZDA 2ZHBA 1UP1A 2DCLA 4B3OB 3OUYA 4DU8A 5F41A 3MFIA 4DSIA 3EZUA 2HHQA 3BREA 4I4BA 5IC6B 3DU5A 2HYIB 1JKHA 1N5SA 1RBOB 1JK9B 4ED8A 2IPOB 4KFBA 2U2FA 1EZZB 7AT1B 2FPHX 2YKOA 5K5MA 3OBIA 3CO9A 3LGMA 2F40A 2FYXA 1SBRA 2EFGA 4FXWA 3TJAA 5LJ5Y 1VQ8S 2DGOA 3LP1B 4B3MF 3SV4A 2CPZA 4QIEA 2A2CA 3D3BJ 3IAS9 2M8DB 3MAHA 3KLEB 5F3TA 3OL9A 2OH2A 1FJGF 1S7HA 2XC9A 3LWMA 1NSQA 2HPUA 4K59A 5D4LA 1RAIB 3QRPA 2DNGA 4ZCIA 1EETB 1TK0A 2K06A 2DHSA 3EGWB 3UDVA 1N0UA 4Y34A 1U1RA 2V69A 4ECQA 2CWXA 3M8PA 2UVUA 2H3EB 3BO4A 3N6NA 1PILA 3FEYB 4O23A 1S9EA 1QE1B 2XM3A 3IMQJ 4LSZB 2AJ1A 2BQ3A 4FBUA 3IGNA 4ECTA 4H4KA 4P73A 1P9YA 3HZGA 2V6AA 3CDWA 2FHKA 3OL6A 4PG4A 2DXEA 3B54A 1Y3JA 3N6MA 2DBBA 1YBTA 4QQBA 2HHTA 4NLGA 4HDGA 1DTQB 1U48A 4JBCA 1XR7A 1FHTA 4RR5A 1U0HB 2XEXA 4M5DA 2FJXA 3AODA 3KOAA 4A8QA 4CZCA 1VRTA 4IQXA 3JSMA 2M8HA 3WBZA 3E01B 3R5CA 4K4WA 1EKRA 3I82A 3KHGA 4DCPB 1VQPS 3OJSA 4LF5J 2D3O1 3MFHA 4IG3A 3VGSA 3MCNA 3CEDA 5KG0A 4CLYA 4DU7A 6FDRA 2XMJA 2CYYA 3M8YA 1NKBA 4B9MA 1WI8A 3H20A 4JI6F 5AXLA 3Q8VA 5LMNF 3QGHA 3WIUA 1HYSA 3DYAB 3GU0A 3NGSA 4NLUA 2K2PA 2HIQA 2E1MC 4K4YA 3CDAA 4YHHF 2AZ1A 4X84A 2AGOA 3A13A 4U7UD 4DCOB 2KH9A 1VK3A 4A4JA 2IA0A 3U1NA 4LUBA 2GVZB 3NNCA 2SXLA 1S1WA 4A8XA 4TU7A 3MMJA 3RB0A 5IV4A 5GAGU 4NLQA 2B9WA 2OLWA 1DBDA 2C42A 3OR2A 4B3RF 4I69A 3Q8UA 1QY7A 2HWTA 3G82A 1JLGA 2V94A 4KTQA 3UPFA 4WZMA 1P1LA 4ZA1A 4Q0BA 3MPYA 3L95X 1Z2ZA 3NAHA 1TK5A 1SKUB 2KYXA 4GO7X 1REVB 1Y5NB 1E6VB 2EPIA 2G1DA 3O2IA 2ZD1A 2AMCB 2C3MA 1TKXB 1RKIA 2OO4A 2Z4PA 3T9NA 1RP5A 2RUGA 3T1HF 3C6UA 2GQQA 1S0MA 2CDRB 2O66A 1NDLA 3PX0A 1J5OB 2CJ9A 1VQKS 1TL7A 3CIMA 3CWJA 4ELVA 2B8QA 3MZIA 3IP0A 2LVWA 3UQSA 4RPFA 3KJQB 1KRPA 4FXVA 4TQRA 4I0WA 4DFPA 4C8YA 3V6KA 3H5SA 3T1YJ 2QLBB 1XC9A 1C0TB 4WTOB 3EE3A 1H3DA 1CS4B 2Z56B 1NDPA 1RAHB 5CYQA 4IRCA 2N3OA 4JI2F 4M5LA 1CQMA 1WTFA 2QYGA 4KV8A 1S1TA 1Q4RA 2HNDA 4ZHRA 3TAMB 2GS8A 3C19A 1Q82T 2LECA 1YRXA 2RVJA 3BGFA 4P7VA 2WBRA 2XMAA 2JLGA 3R3TA 5KFIA 5JXSA 4EGLA 2OI2A 2R7OA 3X1LB 1LK7A 4KSEB 2VFUA 4NXMF 1RE1B 4ED4A 1X4GA 1XJWB 2QZ8A 2X1BA 3D6HB 5F8HA 1U02A 3G87A 4EI2A 4NRTA 2BXJA 4N47A 4IFYA 3D54A 2BEFA 1U49A 2FLOA 2AJ0A 4KO0A 1FWLA 1EJ7L 2QT7A 3HCXA 1AUSL 1OSDA 3D0GE 1HR0F 4TY8B 1EQMA 5F9LA 3KLHB 4CO4A 3QGIA 5A8WB 1XNQF 5ETVA 1UVKA 2RQKA 4DR3F 1G4CA 3ILIA 3SV3A 1TL3A 2HVDA 4K2JA 4F3MA 4WTYA 1PG5B 1TR0A 5JVHQ 3HHLC 3I4HX 3FBEA 4KPCA 2HVHA 3WHIA 4JI7J 3S8SA 2ZNYA 3BO3A 3FRYA 2W4CA 1Q5YA 1KR4A 1KKHA 1RAFB 2IYGA 3KUGA 2V2QA 3Q23A 4NASA 1FTRA 5K14A 2AQ4A 3IC1A 3FC9A 4ZVTB 1H2VZ 2MSSA 4ED1A 1WDTA 4HT5A 2R8GA 3QJJA 2KHDA 4X2BA 2VA3A 2CNNB 2QN6B 4KB7A 2LMIA 4P2XA 4UOHA 1FWKA 3SCLE 1D8ZA 4KY3A 2BMBA 2ZEJA 1HBOA 5GADI 3D6FB 1S6PB 2BE9B 4MIWA 2PA3A 3IS9B 4QCLA 5ETTA 4HHUA 2MLZA 4WFBQ 2LP4A 2XGPA 3D6MB 3V5RA 4X4UA 2RDJA 1Q78A 3MPUB 1FX2A 4IOBA 2VJUA 4QIFA 4E2FB 4DQSA 2YQ3A 3CJ5A 2XMMA 1F60B 1SJQA 3PY8A 5JUMA 1R6VA 4EBEA 2FJEB 4IRKA 2DRAA 5HMWA 4PR6A 3FVYA 1RADB 2IVMA 1L3KA 1RTIA 3CE8A 4C6AA 5HK4A 2NSCA 1P9QC 5KFPA 1D09B 3IAM9 2AGPA 1QSLA 2V34A 2O67A 3BS9A 3IR6B 3H40A 4ANEA 4F0HA 3K5MA 3AXMA 2HK3A 3NNHA 4DZDA 2MSTA 3GR0A 4MFBA 4CCHA 3DLEA 4LBIA 1DAXA 3MEKA 2R42A 4NA3A 5KFFA 3NCQA 2HAIA 3W2VA 3J81Y 4H54A 4L3KA 1FCAA 1C2PA 1JMTA 1YRTA 3MEGA 1VMBA 3HFVA 1YIJS 4DL0C 5LXYA 3S1TA 4C3LA 3WIVA 3KJVB 2V68A 3OTDA 2OFGX 5HSPA 1YJTA 2RS8A 2DY1A 4A8YA 4FPIA 1AYEA 5LJ3Y 5LOQA 1X31C 2R7SA 4HACA 3P3DA 3JAMU 1RBLA 2NLWA 1DTTA 1RWVB 4NWBA 4NCAA 3IN5A 3UVJB 3GYGA 1N33F 4Q44A 1BLUA 4XPCA 1CJTA 1B70B 1T9TA 3HKWA 2Q6BA 3VAGA 1JLAA 2E1CA 4P75A 5F0UA 1VISA 2C2NA 1U1NA 3CNQP 4UQGA 3HZEA 3DRXA 3CUNA 3NGUA 1U24A 5KFSA 1DQAA 3EWGA 1HNWJ 1Y00A 4DPTA 1RAJA 3VZHA 4PQUA 5FLXY 2OMOA 1YHQS 3EVOA 1VQOS 5HN0A 1MU2B 3ILJA 5KT7A 2V4QA 1WD6A 1NRKA 2ZDPA 1U1MA 2X51A 1OQ3A 2PC6A 4NYZA 5L9NA 1RT7A 3HFKA 3RJMB 5HMZA 4C7QA 2FVSA 3CSKA 2BQUA 2EG1A 3KDOA 1G1XA 1R0AB 4DS5A 4NA1A 3MOZA 4HL9A 2X3DA 3UO0A 2EFQA 4ZCMA 1B7FA 2FJVA 2XBPA 4DV7F 3J7Z5 4BLGA 3NGKA 1L3SA 1HWUA 4U6PA 4JI3J 3C46A 5ETMA 2J9DE 4DV0F 3MR3A 2JH3A 1FTCA 1TL5A 2V2ZA 4CRJA 1HQ2A 2ZH1A 3RBDA 4YS2A 3MM8B 2VBYA 4ILLA 2HK2A 3R5DA 5IT0A 4D3GA 5C2CA 3M4XA 4KE5A 3KK1B 2DJWA 1HA1A 4K4SA 3KLGB 3SIPB 3HX9A 2E44A 1WKLA 5B08A 2XHCA 1U2CA 1FDAA 3KG0A 1HHQA 4OJ1A 3AHPA 4PWDB 3VGUA 4F4AA 4J9KA 1SL0A 3R9LA 1FKOB 5LT5A 3AXKA 3PX4A 3VHQA 3D1HA 2LXIA 2WOMB 1X0FA 1A0OB 2GVDB 4IH7A 3LANA 4HI1A 1Q5VA 1C1BA 2OPRB 1B64A 3KJFB 1X4CA 2DGVA 5E2QA 2CDQA 2G0IA 1GH8A 2VOPA 1SI9A 3AOBA 4QYRA 3DOLA 4I6AA 4JV1A 3CCJS 2RKIA 4K4ZA 4OV1A 2UUTA 3QZ8A 2BJ9A 2MKCA 3O8WA 3J7A1 3PFEA 3DOMA 1UFLA 2DK2A 1K1SA 3MR7A 4QOTA 3IG1A 1TZ0A 1OY6A 4NMXA 4RW8B 3HVRA 2FLLA 4OMFG 3W9JA 4EYHB 2HIYA 2UUAF 2PO4A 3FEZA 3AY0A 1XWLA 2AYGA 2MLYA 1PBUA 4DG1A 3MEEB 3C8YA 2B4OA 2AJ4A 4J9MA 2LU2A 2UUBJ 4OYZA 2BKNA 1HNIA 3H42A 4ZPTR 2VG5A 1FT8A 2BE2A 2HNYA 1RBAA 1SXLA 2ZBIA 2XNRA 3PW7A 4NLTA 1CJKB 3VAKA 1K44A 3A3OB 2OTLS 2R7TA 3UNGC 2YQ0A 4A46A 3MM6B 5CABA 5KFDA 1YITS 2HLTA 2YKQA 2OD4A 4LQ9A 4LFBJ 4IQMA 4LSNB 1QM9A 4OLPA 4B9TA 3NEKA 1DLOB 4DUZJ 1R0BG 3PYFA 1WC6A 2CQ0A 4KRWA 3NL0A 2YWEA 1XMQJ 4P2FA 2NCKL 4O3PA 1A7GE 1WG5A 3U1LA 3KYLA 1D9AA 2HHUA 3W63A 4X4OA 4J9LA 3JYTB 2DNNA 1N32F 1QJHA 5DG9A 4YFUA 4OYAA 1NHUA 3HM9A 3MCMA 4JOUA 1EP4A 1Q95G 1N4LA 2QFIA 4IO1A 3PKMA 4N77A 4EYIB 2FY1A 2LEAA 4ECYA 3K5OA 3EPIA 3PW2A 5D78A 4DXLA 3SI8A 4RLEA 2GO8A 1IM4A 3F44A 4LBPA 4B9NA 1PYOB 2AEFA 2P5VA 4A8MP 1HNZJ 1CQNA 4F3OA 1U6ZA 1TUVA 3QIPB 2YNIB 5I3UB 3M30B 2NSBA 3LUYA 4RNFA 2AV5A 4R0JA 3MUVP 5KFRA 4V19X 3PRBA 1T95A 4ZPVR 2FJBB 2RILA 3UCGA 1T7PA 3R6LB 1IWGA 4PXDA 2KJVA 2CJQA 2CJAA 3J80Y 1VC5A 1U4BA 3MURP 3ZXWA 5EWFA 2W9CB 1RI7A 3R7SB 4JI5J 3ELHA 2YKNA 5IV3A 3JQMA 5B0GA 3V81A 1VQ6S 2GQCA 1M5SA 2CQHA 5M2RA 3QT6A 2XLIA 4MAKA 3HSGA 2W4PA 2GZOA 5IOLA 3CJ4A 1ZM4A 3W2WA 5E3CA 2HFNA 3L9ZA 1IQTA 5J2NB 3BQ2A 2YWFA 1YI2S 1TVRB 1TV6B 2QG9B 1CJUA 2DRBA 7FDRA 3KHHA 1UPMB 3MCOA 3ILLA 5GAGI 1X4AA 1H7XA 1MROA 5DQGA 2W9BB 2V0NA 4GO5X 1KSPA 4IG0A 3LALA 4NLWA 1V3RA 3RRGA 2BDPA 2GGPA 2DYAA 1MWYA 2WSCC 1U1LA 1RT2A 1HQEA 3HT3A 1RTHB 4FZVA 4N41A 2IY5B 2P2CB 1JLBB 4E98A 1Q1KA 1R43A 3OR1A 4PABA 4GVBA 2ASYA 1FRMA 3PJ9A 4JI1J 1VLYA 4KT0C 4FP9A 3E8OA 2LA4A 4RW4A 6FD1A 4X64F 3EVMA 2AX1A 4DV3J 1TMMA 3HLUA 1H73A 2AD9A 5J2QB 4R5PA 5FD1A 2L9WA 1QD1A 4ZITA 2KT5A 4FF1A 4QWCA 3QO9B 5CCMA 4N8OA 5L38A 1I94F 1LNQA 5AE2A 4WE1B 1YJ9S 3FK4A 5T7LB 3EPGA 1SQEA 1XN9A 3A8JA 2MZQA 2ZDOA 4M5HA 4BHQA 5KT6A 3K5NA 1RYSA 1WTBA 2ZJRQ 3GFYA 4LR9A 4OIXA 3UN5A 1X4BA 1VQLS 4I56A 1B3TA 3TA0A 2O5DA 3I31A 3IRXB 3N79A 4ZVSB 2DGWA 2DCUB 4IH5A 3M1VA 3KLIA 1LWFA 2F4VJ 1HKAA 4YB7A 3DRPA 4ER8A 3FQLA 1CULB 4CLTA 1X4EA 1RT3B 4CT9A 1S1WB 1R8CA 5DG8A 1FJ7A 4QYZJ 3KK2B 1SIWB 1FRIA 4L74A 2LXFA 1OPIA 1PAUB 2MQLA 3W9HA 1MMNA 1VBXA 3EICA 4RX6A 2ZJQQ 5LSOA 5HANA 2CZ9A 4G1QA 1HPZB 2DIUA 2AU0A 1S1UA 2HBQB 4LIRA 5C24A 2IBKA 1GAOA 1ZZNA 2W8KA 4DR4F 2QLJB 3D0IE 2HFSA 2V4JA 4O0NA 4M95A 3PEJA 3THPA 3JQJA 1PSDA 2PD1A 4IYQA 2JC1A 1FI4A 5HAOA 4G1IA 3DC2A 4ITSA 3JB9k 2DR7A 4MKYA 3Q2TC 4EBCA 4BWMA 4B3OA 4O3RA 2XY6A 3ET6B 3C14B 3R97A 5KT4A 1RTJB 1KP6A 1IM6A 4IR9A 4M5KA 4BDPA 3NXZA 3JTPA 2ZH8A 2DEIA 4DQRA 4RL1A 4LMZA 5D0GA 2W2OP 1IBMJ 2GJ2A 5EX0A 2KDOA 3BSNA 1SKRA 1Y9OA 2XMTA 3Q22A 3S01A 2K7KA 5E3RA 2HZVA 2C3YA 3CO0P 3DXSX 1UJ6A 4CDIA 4WKRA 4H4MB 5GAEI 2HHXA 2E5IA 2FZKB 3I32A 3NBPB 1NLKL 3LP1A 5DGAA 2H4WB 2KTQA 1GQEA 2RRBA 4TLRA 4NI2B 3ULHA 1FVQA 4DQQA 1S1TB 3ZTSA 2R7UA 3M8WA 2DD8S 1RT5B 4PUOB 2R9LA 1X4DA 1Y0HA 3EXYA 2VB6A 4UQTA 1EETA 1ZTWA 5JVGQ 2Y8YA 1DHMA 5B0BA 5GVQA 4ECSA 5H1SV 4LIWA 2BANB 4JI7F 3FEXB 4K0KF 4NLPA 2L41A 2DGQA 4LFAJ 3MD1A 3M2RB 3T5LA 3SCKE 4HKQA 2CKWA 4IDKB 3QSYB 4C8KA 2FQQB 5ETLA 2G2YA 2KG0A 4A8FA 3M2VB 2FVPA 3DU6A 4DQPA 2JWNA 2OPPB 2YH0A 2CRLA 1URNA 4C3MA 3QBCA 4X66F 2NPFA 3W7BA 1DTQA 2ZJPQ 3G6ES 4B3MJ 1KC8T 2RHSB 4BCAA 1U0HA 2HS3A 1N52B 4OI1A 5KFGA 2BVZA 2QA2A 3A8IA 1FJGJ 2G0JA 2YPYA 3DLHA 1TL3B 1GXUA 3KLFB 1KOHA 4ZVOB 3UNYA 5EWEA 2ZH9A 3KMSA 3GIMA 1TFYA 1RHRB 4JI4J 2KVQE 4AQYJ 2D41A 2QA4S 3MEDB 3NCRA 5JMNA 1S1XB 3DXBA 3DYAA 3Q8PB 3BJYA 4M8LA 3GFXA 2G0CA 2E5LF 2NPIA 2D9PA 3V4MA 5H9EJ 5L46A 4M5JA 2BJ1A 3LAKA 2GVZA 2BACA 3D6TB 3DDKA 2V50A 3V6HA 4F4YA 1IBCB 3DNCA 4F4XA 4O4GB 1T11A 1G7CB 2J7KA 1U09A 1BQNB 1SCJB 2MZ1A 3OVSA 2HKEA 2YWKA 5KFZA 2GC8A 2EFNA 4EU0A 3WC0A 4J9NA 1K0TA 1NAQA 5DM6Q 1KD1T 1IBLF 3D28A 3ENQA 1CJVB 2IYIA 4DFMA 1QAJA 2ZHOA 1REVA 5KFYA 2H4YB 3BH6B 1E6VA 3R2CJ 3SSSA 4B3TF 5HP1B 1N5YB 1TKXA 3BR9A 5A0YB 5LMNJ 2YBVA 1R8HA 1FKPB 4DDFA 2O01C 3OXLA 1KDNA 4YHHJ 1OQ6A 4RUBA 4EMDA 2NS1B 1R3NA 1WHXA 1WF1A 1V3SA 2MQNA 5HVGA 1T0TV 2BABA 1J5OA 2MPUA 1SC1B 4CNZA 1HARA 1FXRA 2ERRA 2FDNA 1M1KT 3H0PA 3DMJB 4I67A 3TUZC 1YJNS 1Z4UA 4DZ6A 2ZVIA 2GJIA 2J9CA 3HSDA 2EBEA 2QA1A 4J9UE 4IR1A 3AJ2A 4L73A 5CYJA 1C0TA 1L3VA 1WSVA 1S4EA 3P4UB 2LQ5A 1KHVA 1S79A 3I96A 1CS4A 4YR0A 4EZ9A 2DIVA 4TN2A 4G1PA 1IBKF 1X4HA 4OYWA 1JJHA 4CLSA 2LDYA 3R2DJ 1VYAA 3TAMA 2AT1B 3ZZTA 2FVQA 4OLOA 3T1HJ 2YWHA 1MG7A 3BGOP 4LFCF 1I6JA 3PW0A 1FRXA 1FVSA 5KFCA 2OEKA 3W8GA 4C8ZA 2P9CA 2QYCA 2OFHX 3I87A 3GJRB 2LQJA 2B9EA 5KFAA 1VDHA 4QWAA 2L3MA 3ZNUA 2VPZB 5KG2A 3CCES 1KHWA 2WCXA 1R89A 4M63A 2QC3A 2FJDB 1I51B 4YEAA 1MN9A 3JXOA 4KPYA 2N82B 2Q79A 3SDEB 2HFZA 2MKYA 2XGQA 2Y1LB 2V2KA 2XS2A 2BJ8A 3F73A 2X1GA 4TY8A 2AJ2A 2OPSA 3KLHA 1KQGB 5A8WA 2E9RX 1S0VA 4JI2J 2D3ZA 2HFOA 2IM3A 3NGDA 1VQSA 1Q8KA 3HJFA 3CCVS 2W25A 2M70A 2AZ3A 2N7YA 3KG4A 1IN0A 1NEEA 2FY8A 1UZHA 1X8DA 4DQIA 4Q2MA 1B0VA 2EEYA 4DEZA 2MHEA 3HJVA 4ZP9A 1RA6A 3KNGA 4JYAF 2GIFA 2HFVA 3VR1A 4NXMJ 3HHKA 1PYSB 3LH2S 2R2RA 4X65F 2QL9B 4PAAA 1QAXA 1ZS6A 2QTWA 5MAOA 1H98A 5ETNA 3MCSA 2IM1A 5RUBA 3TQ1A 5I42B 4FNHA 2ZH3A 1HR0J 4ZPDA 5M2PA 4ICLB 2DXFA 1SJ3P 1XNQJ 4DR3J 1DQ8A 4AL7A 4QIGA 1TKZB 3WX4A 3UDCA 2VF3A 3I0SB 1BXNA 1S6PA 1PYTA 1Q8BA 1D9DA 5EDWA 3IS9A 2CQ4A 2PFDA 1KQSR 1LWCA 1G6BA 4ETXA 4I2QB 3FCHA 1ZZFA 2AWZA 2FHMA 1RAGB 1Q81T 2YKMB 1HMVA 1M1GA 3AD8C 2WTFA 1G2EA 3PO4A 3IBFB 1XQIA 4Q7AA 3ZZOA 1J27A 3GIRA 3OTEA 4KHPF 3EDQB 1VQ7S 1RYRA 4Z37A 1KEKA 1TL4A 4OX6A 4QWDA 3QRQA 3RBEA 1S6QA 2EVZA 3I9V9 3GV8B 3KHRA 2VBWA 1D8YA 2MMYA 1QSYA 5KFVA 2H9ZA 3DOMB 4DL6A 1T9UA 2FHOB 4NXNF 4ZLNA 4C9DA 1XR5A 3IG1B 2DH9A 3GIKA 1YK9A 2C3UA 1KQFB 2OP5A 2D1CA 3QSIA 2W8LA 2RRAA 3TW0A 2XYHB 4X4PA 5J2PB 5D4NA 3KJVA 5KG1A 4HTJA 2YX7A 4O0IA 4QBUA 1JB0C 4CP5A 1MNEA 2DPIA 1HNIB 2ATLA 2ROPA 1WC0A 2CJKA 4DPWA 2HRYA 4C8OA 3R6GB 4MKVA 3N01A 5C42B 4DR5F 5L1LA 3UVJA 4MIBA 1T9WA 1TL1B 5ADZA 4KGXB 3N28A 4URSA 3EX7B 3ETMA 1FFSB 2XYGB 3K8VA 5L1IA 4OJ3A 3OTBA 3NY0A 1I5OB 4ZPWR 1SKWA 3O5TB 4M94A 3IM8A 4ED3A 3QFHA 1T9XA 2I0XA 3W9IA 4ETZA 2EWHA 4TVAB 4U9RA 2HVEA 3TVZA 2DR6A 2JLEA 1Q53A 5K8PA 3R7BB 4BWJA 2L08A 2AGQA 2YVSA 3GIIA 2BZ2A 2J9DA 1MU2A 2VL1A 3GFHA 3OTOF 3PG9A 1X9SA 2XMUA 1U8SA 1Y10A 4M5GA 1UFKA 4I7FB 4W92B 4UY85 1ZA1B 2CG8A 2VC0A 4KR0B 3CW2C 1R0AA 5SZTA 1CSJA 4EEYA 3UN2A 3K57A 3MECB 1N33J 3NP5A 4ZVQB 4OJGA 1P1TA 4FF3A 4HEA9 1UETA 1WUUA 2D74B 4F4ZA 2XG8A 1YZ6A 2ZZNA 2N4DA 2DHGA 2C2MB 4DPUA 5CYMB 4HDHA 1V3ZA 2ZBPA 3RG6A 3K5LA 4QWEA 3MM8A 1RU1A 1FO1A 4PG8A 3B4MA 5KFOA 2C2ZB 2HRTA 3KK1A 1SH0A 2CVIA 1Q16B 4X62F 2R4FA 2BX6A 1OO0B 3QWPA 2NQPA 3VGTA 3R8YA 4U67Q 1U26A 2Z0GA 3RAMA 3CVKA 4FPRA 4OHXA 2QL5B 1FKOA 2Z2MA 1ZM9A 1GX5A 1JJCB 2LEPA 4RNNA 4LF8F 1GFWB 1W7WA 4WP9A 2WOMA 2YNHB 2LQBA 2HQIA 2GVDA 1FDBA 3AD7C 4BBYA 2OPRA 4DV7J 2CPJA 3ITHB 4CH1A 2UXBF 3D2WA 3J81j 3HHLB 1BMQB 4ED7A 4JI8F 2E9TA 5E3AA 1VR6A 2ADBA 4A47A 4PG7A 1U7LA 4DV0J 4OHYA 5IZHA 3R5BA 3QQCD 4WZQA 4NCGB 2GNKA 5E3QA 2G13A 2JFKA 2Z8QA 4NLRA 1SC4B 3SXLA 1MW7A 5ETOA 1YWXA 4RW8A 3J7ZT 2NZ4A 2CQCA 2KT2A 3D1QA 1HQEB 2QSWA 4OI3A 1Q79A 4RUHA 2EW9A 3P5BP 1OYEA 4ZJLA 4ED0A 3P8BB 1RLCL 4PCQA 1N56A 3NLCA 2X7IA 1S6OA 1IR2A 1GMWA 1H2TZ 4MYUA 3DOKA 1H6KX 4C48A 3HP6A 3VV2B 2QX0A 4UOGA 1RZMA 2ASDA 4XDCA 5KG4A 2QLXA 1CJKA 3TYTA 2MY7A 2UUCF 3CCWA 3D1OA 3LP0B 4CTAB 2I9SA 4FDFA 2GX8A 3MM6A 2KFNA 4WP3A 4USMA 2R7XA 3HF5A 2BRLA 4M1KA 1FFWB 4RU9A 2R8HA 4ZVFA 1NPKA 2ZNZA 3JAMY 3PDNA 1FF2A 1HI1A 1YKWA 1IKVB 4LSNA 3VWSA 1N5QA 1O6XA 4Y2CA 1XMOF 3AB4B 3UDLA 1GX6A 3CCQS 3V2UC 2IRUA 2IAJB 2WAQD 1BQMB 1DLOA 3B82A 2UUAJ 1JJ4A 5A2QU 1DQ9A 2GHPA 5IXUA 1W2IA 5CQGA 1NMEB 3HHEA 5KFHA 3QJLA 2J6UA 1CBKA 4Q8FA 4HH1A 3THVA 3JYTA 2MTLA 3FCWA 2LXUA 1CLFA 4OYXA 1ZH5A 5KAKA 3ISND 1X60A 3OHAA 4PXEA 1RT6B 1IBMF 1Q8IA 1U6BA 5DZ6A 2VA2A 2E7XA 1F1BB 4G3IA 1BC6A 2XI2A 2GQ2A 4IOCQ 4DF4A 1VS3A 4XIUA 5IQQA 3OQ2A 2Q6CA 2BR0A 4DUYF 1VI7A 2ZZMA 2FUG9 4DR1F 5JJBA 2KJWA 4YY3F 3QIPA 5F8MA 1JLCA 4NRUA 2YNIA 5I3UA 3PYDA 3M30A 2VICA 1N5VA 2MDAA 1WC4A 1FNXH 3LP2B 1NH8A 3TX0A 4P6QA 1Y5IB 3VAJA 4WP8A 4CM2A 2KM8C 1HW8A 2I6WA 4AL6A 3A8KA 3R1LA 4F3QA 4WFXA 4DMZA 3QGGA 2FHJD 2VOOA 4U8VA 5KFJA 1N32J 1LKZA 2W9CA 4ZJQA 2EK6A 2F4FA 4YQWA 1NJYA 4FKYA 4LFAF 1HIYA 1UMJA 1WEZA 3BKUA 1UAWA 4LVOP 1GT8A 4S0MA 1OY9A 4USHA 5CD4H 4HH0A 3MM5B 3RW6A 2ROEA 4ED2A 1T05B 1K1QA 2B6AB 2YNFB 3Q83A 3R1HA 2E29A 2A6OA 1HWJA 4DV4J 5K8NA 5J2NA 2J8AA 2XNQA 4OZNA 2DGUA 3HT0A 1TVRA 1TV6A 1NPRA 1FKAF 2HEKA 3TVYA 5HMYA 4NLOA 1WF0A 3TARA 2UXDF 3OXGA 1QVFR 4N56A 1VC6A 2K8GA 2EC0A 3OV7A 4WF9Q 4KGKA 4DV6F 3ZZ0A 2W9BA 1WHWA 2M2BA 2XZTB 2FVCA 1XBWA 3ENAA 3RZAA 5GMEA 3BEGB 4JI4F 4PQAA 4AQYF 5K9FA 1RAOA 2ZFHA 2XMVA 2YTCA 3ENWA 1N48A 2YNGB 2KL8A 1RTHA 4LF6F 1AT1B 3OFGA 4OHZA 5D3GB 4PWWA 2HQDA 4NPOA 3GG0A 3BV8A 3SZ2A 3MD3A 1CG2A 2IJRA 1JLBA 5A76A 3OTCA 1JWWA 2F65A 4NLSA 3DN9A 2JVOA 2OSQA 3OPKA 2ZH4A 3PEHA 3OD2A 2EC2A 1HBMB 1E6YB 3HD2A 3PV8A 2Y3YA 4GMKA 3N5BA 4DL3A 3Q24A 2B4PA 1UPPA 3DRYA 4W98A 3TZWA 1I1GA 2V67A 4CT8A 2C2OB 5J2QA 2MYFA 4Y00A 1CC8A 4WXWA 2NUUG 3QO9A 4D3HA 4DWIA 3W3SA 1PAEX 4NE9C 1RKJA 5C2GA 2WVBA 4WE1A 4OI0A 2JSXA 4HHJA 2UV8A 5T7LA 4B9SA 1HD0A 2QMUB 4OL8A 5DLGA 2ZBRA 4R8UB 5HQ8A 2ZC4A 3PM9A 2PDAA 1R27B 1Y3KA 5AE1A 1JX4A 1L3TA 4LJMA 3KMQA 2R8KA 2MQ8A 3W65A 1DARA 4EK2A 1NZ8A 4LF2A 4Q8EA 3BSCA 3IRXA 2A0FB 1HWIA 2A3JA 2HURA 1C0UB 4BC7A 1LW2B 3NOCA 2FLNA 3A12A 3CMAS 4QW8A 4X4NA 1OIAA 3CJQA 4F0KA 1YX2A 1CULA 2RHQB 3CDBA 1ZYQA 1T3NA 4QIVA 1OS5A 2R7RA 3LPYA 4ZN3A 4GKJF 1RT3A 2WB1D 2DNOA 3F56A 3CC7S 1YRUA 2W01A 4DFKA 4X64J 3D7SB 1S5ZA 3KK2A 4R25A 3IR7B 3W5XA 2OMLA 3KHLA 5CAAA 1S72S 2ZOGA 3LO3A 4C3KA 2Z2ZA 2J0XA 4MYTA 2QJ3A 1YSJA 3NS5A 1QAIA 1I94J 2ALZA 1HPZA 1TFWA 4Y2IA 2D9OA 1NCLA 3IFEA 1UTAA 1PJ7A 2VDHA 3ADAC 3L3CA 4DV2F 2E66A 3CCMS 3CJ0A 4ZOSA 1D9FA 4DR7F 5E33A 3RTVA 1IVZA 2WBMA 4L3NA 4K4TA 1T9YA 4TYAA 4QZVB 5DS7A 2AF6A 3CD7A 1HBUB 1Q7LB 3ET6A 4CLZA 3C14A 1RTJA 2OEJA 2MLXA 3W8PA 1GNKA 4V1Ak 2GAHC 2BM1A 1VHFA 2VG6B 3OVBA 2XY7A 4Y65A 2W7PA 2PMHA 3PJXA 1K8AT 2V5HG 4ECUA 2ZWPA 3B6BA 4H4MA 1O51A 4EFAC 3V4IB 3NBPA 3I5CA 3HKZD 4DR4J 3BKFA 1T9VA 4NI2A 1AXQA 1UVIA 2ASLA 5E5NA 4GKKF 1RT5A 4PUOA 2VBZA 1UW9A 3I9ZA 1RWWB 2AEMA 1K73T 4KC5A 3ZZUA 2HS4A 3PVXA 2IRYA 3J7AN 5ETSA 1YQHA 2IM2A 2BANA 2HG4A 3GFZA 1RT4B 2F5GA 1ROFA 3M2RA 4GVLA 3NNAA 4H4KC 2E5HA 3PW5A 1JLQB 1H2UX 4IDKA 4KKOB 4LRAA 3OSNA 3T6JA 2YH1A 3M2VA 4I68A 2RMLA 2WONB 1SPBP 1WHYA 3M9MB 2OPPA 3CDUA 3RB3A 2Q66A 2CJYB 3WQPA 3HSZA 2ZUAA 1EKSA 2OPSB 2B7BB 4J90A 2WB4A 2GW8A 2LA6A 2R2UA 1PJ6A 2I1RA 2QMWA 2MQQA 4DR2F 2EKYA 4ZLLA 3KLFA 4DSEA 4WXOA 2MQOA 5DRKA 4F2SA 1FK9B 2HWHA 1F5BA 1JXVA 2LCWA 2EFPA 2COLA 4PPDA 4K0KJ 3MEDA 4WFYA
chains in the Genus database with same CATH topology
3DLJA 2V8GA 5KFQA 3DLKA 1IKWB 1FE0A 1S1XA 1Y0HA 3EXYA 1IQZA 4OX7A 2VB6A 3PRDA 1FEHA 2ILZA 4UQTA 5F0WA 1EETA 3TA1A 2ZH5A 1OPZA 5JVGQ 2J0WA 1ZTWA 1KTVA 3C2PA 1DHMA 3CPWR 4I1TA 2FVRA 1WG1A 2BBEA 5B0BA 2D3OR 5GVQA 4ECSA 1UVNA 5H1SV 5K8OA 3RB4A 3E51A 4LIWA 4CO5A 2BANB 4JI7F 3FEXB 2B4VA 3FRZA 4NLPA 5KFTA 2L41A 4K0KF 3CD5A 2EFVA 2RS2A 2DGQA 2VH7A 3R5AA 2ZHBA 1UP1A 2KXNB 2XS5A 3MD1A 5AJ3F 2DCLA 3H8YA 3M2RB 3KFWX 2CZVC 1S0NA 2IJFA 3T5LA 2IC3B 3SCKE 3SQGB 3OUYA 4TU8A 3PR5B 2VONA 3M8QB 4HKQA 4OZ1A 2CKWA 5F41A 3MFIA 3DHXA 4IDKB 4YB5A 2Q3PA 3DRRA 2RNEA 2FTRA 1OSCA 2HHHF 4DSIA 3EZUA 3IGVA 4C8KA 1F2GA 3IA0A 2KG0A 5HROA 4A8FA 3M2VB 2B0GA 4O4GA 3BREA 4I4BA 3GB0A 4DX8H 4XPEA 2VPYB 2FVPA 3DU6A 2B7CB 4DQPA 3DU5A 1BWEA 3DM2A 2JWNA 2FB0A 2HYIB 3Q2SC 1JKHA 5KFEA 1BQNA 5D4PA 1N5SA 1SV5A 1JK9B 4ED8A 2OPPB 2YH0A 3OFHA 4KFBA 1LW0B 2U2FA 2CRLA 1URNA 1U45A 4C3MA 2FPHX 2WK4A 2YKOA 2NPFA 2YKPA 4X66F 5IS2A 4TQSA 5K5MA 3W7BA 1DTQA 3OBIA 3V6JA 3BGLA 3DDNA 3CO9A 3LGMA 2B9YA 3I55S 3MR2A 2ZJPQ 3G6ES 1UVJA 2F40A 4C8NA 5FDLA 3VF0B 1SBRA 4URGA 4ECXA 1KC8T 1F5AA 2HVIA 4DHVA 4BCAA 2J76E 2HS3A 1N52B 4OI1A 2EFGA 3JTOA 5KFGA 1HQUA 4FXWA 1XNRF 2BVZA 5I3QA 4A8KA 2QA2A 4MK8A 5LJ5Y 1VQ8S 2DGOA 2R2SA 2MB0B 2JHEA 2XSJB 3C6TB 3LP1B 1LWCB 5HLFB 3DLHA 1TL3B 4B3MF 3SV4A 2CPZA 1GXUA 3LF0A 3OFFA 4QIEA 3KLFB 4DSFA 1KOHA 2A2CA 3IAS9 5E41A 4B17A 5EWEA 2M8DB 5DJBA 5HP1A 1N5YA 3MAHA 2ZH9A 4TYBA 3KLEB 3B78A 5F3TA 2C2DA 5A0YA 2OH2A 3OL9A 3KMSA 4QR1A 3GIMA 1FJGF 2HMIB 3GIJA 1S7HA 1FKPA 2XC9A 3LWMA 3FQKA 5KFNA 1U1PA 1TFYA 1HMVB 2DTJA 2HPUA 4YDXA 5B0CA 4X4SA 4ID8A 3T9ZA 4K59A 5D4LA 2D41A 5BYSA 3GYXB 3QJPA 2QA4S 2BQRA 3RU0A 5E0OA 3MEDB 1BQXA 2DNGA 4YOEA 1FRLA 4I6YA 3NCRA 1VBZA 3DLKB 1S1XB 3DXBA 4ZCIA 3DYAA 1WG4A 3Q8PB 3HVAA 3BJYA 1EETB 2YX1A 3MM9A 4M8LA 2CQBA 3K59A 1TK0A 2GFFA 2JX2A 3GFXA 2DHSA 5BYRA 1AW0A 3EGWB 4J5OA 5A8KA 2G0CA 3RR8A 2E5LF 3CF5Q 4WCEQ 1HFEL 4AXIA 4DLGA 1N0UA 2KG1A 4Y34A 3CD6S 1U1RA 3G9CA 2NPIA 3ZZZA 4JUZA 2D9PA 2G4BA 3DMJA 3V4MA 4ECQA 3M8PA 2UVUA 5H9EJ 3BO4A 3N6NA