5EUHA

Crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
AATDALTGVANRRMLDQSLRHEWFRAQRSGKPLSLLMIDADHFKAFNDRHGHQAGDQALRELARVITTNVRRPADLVARYGGEEFSVILAETDSVGAQQIAEHIRAAVEQLSSVNEDQSPMTVSIGISTWTATSEISLEQLLFAADKALYQAKEGGRNRVVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative GGDEF domain membrane protein
publication title Contribution of Physical Interactions to Signaling Specificity between a Diguanylate Cyclase and Its Effector.
pubmed doi rcsb
source organism Pseudomonas fluorescens (strain pf0-1)
molecule tags Membrane protein
total genus 50
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5euhA00
3DRSB 3G6XA 5KFPA 3QZ8A 3IRXB 3N6MA 3GQCA 5JXSA 3EPIA 4O44A 2YNFA 3KLIB 4MH8A 2IC3A 1QAIA 4IRKA 2UVUA 4EYHB 1JLEB 2XCAA 5L1JA 2ZE2B 2VA3A 4R5PA 1S6QB 2V0NA 1RTDB 4K4YA 5FDLA 3H59A 4ID5A 3DOLB 4RNNA 1ZTTA 1SH0A 4RU9A 1RT3A 4MK9A 4FS2A 3DOKA 1N5YB 3PW5A 3PW7A 5J2QB 4J9OA 4ZVHA 3I0RA 5D3GA 2RDJA 2UUTA 1QE1B 3QZ7A 1RT6B 4NRUA 5KT4A 5EWFA 3V6DB 2BR0A 3FDSA 2CKWA 4RNHA 1EETA 5EWEA 4LSNB 3M8QA 1RA6A 1SH2A 2JC1A 3GIJA 2ATLA 2DPIA 1RTHB 3QIPB 4IRCA 2FVRA 5DLGA 2I5JA 5HROA 1S6PB 2UUWA 1SUQA 1DTQB 2HNZB 2OPQA 3ITHB 3EZUA 1RYRA 1C0TA 1S49A 2VG7A 4ICLB 1TKZA 1D1UA 3V4IB 3MEDB 5KT2A 3DRSA 3JSMB 3OLBA 1JLQB 4Y2AA 4K4VA 5F8JA 1FKOA 2ZD1B 3KLIA 1RDRA 3NMAA 4RW4B 4RUAA 4KAIA 4RW7B 2R8HA 1JKHB 1JLEA 3UPFA 3M8PB 4ED7A 3G86A 3KK1A 3QO9B 2ZE2A 1NNDA 2AGOA 2QV6A 1JIHA 3KLFB 3H5UA 5KG7A 2YKMA 3GV8B 3V81B 3RAXA 1N4LA 2BRLA 3MEEB 4IQXA 4RW6B 2B43A 3DOLA 2YNIB 1LWEB 1T05A 4ZPDA 3KHGA 1RT7B 3HKWA 4KBIA 2RF2A 2RKIB 4WFYA 1S9GB 5J2QA 5KFSA 2VG6A 2R8KA 5KFAA 2BE2B 1RT4B 3IGVA 1HQEB 2I1RA 3HVTB 2XGPA 4TY9A 3V6HA 3V6DA 2E9ZA 1LW2B 3D5MA 2IM3A 5KFFA 5L1KA 2C22A 3H4BA 5K14A 3BSOA 1HQUB 5F9NA 2BANB 4MKBA 1IKYB 5KG0A 4DG1B 3QIPA 2BQUA 2WOMB 3DLKA 3MEGB 5I42A 3CJ3A 1BQNB 1DTQA 2AWZA 2HNZA 4KHMA 5J2NB 3PJXA 3ITHA 4NLPA 4O3RA 4WFXA 2D7SA 4K4WA 3T5HA 5CYQB 1S9EA 5DLFA 1S1XA 4ICLA 4R8UB 3V4IA 2YNGA 3JSMA 1QUVA 5C25A 3KLEB 3SI8A 4HKQA 3CJ5A 1JLCA 4IH5A 5F8NA 2ZD1A 4EEYA 3IG1B 3MR3A 1RTIB 1TL3A 2YNHB 2R2TA 2FJXA 2WONA 5JUMA 3OSNA 2V4RA 3CJ0A 3ISNC 4WYLA 3TAMB 1N6QB 2JEFA 3M8PA 2AU0A 3CVKA 4J9NA 1IKXA 1UWBB 4KSEB 5EDWA 3KLFA 4ED3A 3V81A 4K4XA 2XWYA 3CWJA 3FQLA 3LAKA 5HLFB 3BSAA 3QIDA 4RUCA 5DGAA 2RKIA 4WYWA 2YNFB 3DLGB 1S9GA 3MR2A 4ZP8A 3OLAA 3OHAA 2UVWA 2BE2A 1LWFB 1RT4A 1RT5A 1BQMB 4Q8EA 3N6NA 5KFXA 4MFBB 5KFTA 4JV1A 3MTKA 3CJ4A 1C2PA 4F4XA 5FDLB 5KFJA 4ID5B 1HQUA 4ECRA 4WZMA 4DG1A 3KMQA 5KFUA 2BQRA 3I0SA 3IN5A 1BQNA 4ED1A 4PWDB 4OL8A 5J2NA 1N56A 3BQ0A 4GC7A 3I0RB 4GC6A 5D3GB 2CJQA 3PW2A 2XI3A 1U09A 3BGRB 5CYQA 2FJVA 3GIKA 3TQ1A 1HNIB 4RNOA 2JEIA 3PHEA 1IKVA 1C0UA 3BSCA 3KLEA 4ED8A 2OPPA 4YQWA 2R2SA 1VRUA 4EO6A 2W7OA 3UR0A 3OL7A 4I2QA 4TLRA 2I5JB 1LWCB 2YNHA 3CJ2A 5CYMA 4YR3A 3MECB 3GV7B 3GIIA 2DPJA 2B5JB 1JLAA 1FKPA 1XR5A 3BREA 4EBCA 1N6QA 3SFUA 5KFCA 1C0TB 1UWBA 3DLEA 3GILA 3MFHA 1S9FA 5HLFA 2YKNA 5KFYA 3C6UA 4ZPBA 2J6SA 1S1TB 1JX4A 4LSLA 5KG3A 1FKOB 4IR1A 5DQGA 1REVB 3DLGA 3MR6A 1LW0A 2EC0A 4J9LA 4DEZA 2XGQA 3HVWA 1LWFA 3QGIA 4QW8A 1BQMA 2JLEA 3KK1B 3T5LA 4MFBA 5L1IA 2VA2A 2WK4A 5KFOA 2HWHA 2YKMB 4Q8FA 4URQU 3Q8QB 4ECYA 1MU2A 4ZVGA 4RW8B 3GYNA 3NBPA 1T05B 2WTFA 3OL6A 2RF2B 5F8GA 4PWDA 3NGDA 2R8IA 2VG6B 4K4SA 4MIAA 2W9CA 5DGBA 3I5BA 3UQSA 3H40A 5J2PB 1QAJA 3KNAA 4I2PA 3BGRA 3H5SA 1N48A 4ECSA 1HNIA 4KKOB 4WXOA 1WNEA 4NLSA 4O3PA 4RNFA 4QWDA 5K14B 3Q8PB 4NZ0A 3BJYA 4MIBA 2IBKA 3BQ2A 4NLVA 3DLKB 1LWCA 5I42B 1JXLA 4J9RA 1TKTA 3MECA 1S0MA 3G6YA 2B5JA 1C1BA 5C5JA 5KFIA 4F4WA 2D3UA 4YMEA 2W8KA 4Y3CA 1S9EB 5KG4A 1S1XB 2C2DA 1XR6A 2W9BB 4ED0A 2YNGB 3PR5B 2BRKA 4JV0A 3G6VA 5C25B 4IRDA 1S1TA 4O3NA 3PZPA 3KJVA 1JLCB 4NLWA 4Q45A 3PR4A 3H98A 5KT7A 3PVXA 4EO8A 1REVA 1TL3B 5HP1B 3QLHA 2WONB 3T5KA 3LP2A 1S97A 4PUOB 4EYIB 3KLVA 4NLUA 1IKXB 1S4FA 5C24B 5F8LA 4X2BA 4MK7A 4WXWA 1D0EA 4RW8A 2UVVA 3DRPB 4TN2A 1S0OA 1RT1A 3IGNA 4ECUA 2C2RA 2FVQA 2O5DA 4DL6A 1RT5B 1XR7A 4EBDA 3I5AA 2ILZA 5J2PA 4FBUA 4KKOA 4KO0A 4IOBA 3OL8A 3CIZA 2C2EA 3Q8RB 3NL0A 3RB3A 4TYBA 2HWIA 2RDIA 3V6JA 4ECTA 2B6AB 3BR9A 4RZRA 1R0AB 3I0SB 4J9QA 5F8HA 2IM1A 1TV6A 3T19A 3T5JA 1JLGB 5J1EA 1JLFA 3T1AA 3I5CA 2ASLA 2HNYA 1IKVB 1C0UB 1MMLA 3D28A 2W9BA 3V6KA 2OPPB 3LP1A 4ZHRA 1VRUB 4XPEA 4Q0BA 5HP1A 4TQRA 3OHBA 4I2QB 4M94A 1TKXB 4H54A 4WFZA 5KG6A 4ED2A 1S0NA 5CYMB 4DL5A 5KFHA 1FKPB 1JLAB 2W7PA 4PUOA 1TVRA 4NLTA 3KK2A 3RAQA 1JLBA 1S1UA 4IR9A 4F4ZA 3DLEB 5DQIA 4U6PA 5C24A 4ECWA 2HNDA 3N6LA 1VRTA 4J9PA 2YKNB 5KFBA 3C6UB 4B3OB 4LSLB 1RAJA 3DRPA 3DYAB 2AX0A 1TQLA 3H5YA 2ILYA 3RBEA 1S10A 4WZQA 1LW0B 4K4TA 1SH3A 3NAHA 5C42A 2IA6A 2OH2A 4IH6A 3LALA 5HBMA 3M9NB 5KT3A 2IM0A 3UDLA 3C6TA 3DI6B 2HMIB 1HARA 2ZKUA 1GX6A 2OPRA 4NRTA 1MU2B 4RW9B 5L1LA 2B6AA 3NBPB 4IG3B 1K1SA 5F9LA 4XPCA 1R0AA 1TL1A 2IM2A 4H4OB 3KLGB 4IKAA 2JEJA 3RB6A 4YR2A 1C1CA 5F8IA 2W9CB 4ECQA 1DLOB 1JLGA 3BQ1A 1T03A 4JV2A 1KLMB 5EUHA 4QWCA 4I2PB 3DM2A 3GIMA 2E9RX 4TY8A 4MKAA 3QGHA 4MK8A 1RTJB 2C28A 4R0EA 4K4UA 4ZVFA 5DQHA 4H4MB 1TKXA 4IG0B 4QWEA 1W25A 1TKTB 1CSJA 1C1BB 3PW0A 4QPXA 1I6JA 2D41A 4NLXA 4J9MA 1EP4A 1HMVA 1RYSA 3GV5B 3DDKA 2W8LA 4ZPAA 4B3OA 2AQ4A 2GIRA 3DYAA 3KJVB 4HYKA 3HVAA 1T94A 3QYYA 3QLHB 2D3ZA 4XO0A 3LP2B 1HPZB 4YR0A 3JYTA 2AGPA 1NHVA 4ZP9A 1OS5A 2WHOA 3DI6A 2VG5A 2HMIA 4RW9A 4IFVA 4IG3A 1GX5A 4URSA 3NKYA 4H4OA 3KLGA 1RT1B 4TQSA 5KG2A 1DLOA 3TVKA 1KLMA 1KHVA 4IDKB 4KO0B 5KFDA 4QWBA 3KK3A 3RBDA 1RTJA 1SV5A 4H4MA 3KMSA 2FLNA 1DTTA 4IG0A 2V4QA 3CDWA 4EBEA 5KG1A 2IJFA 3KLHB 2JC0A 5J2MB 2AGQA 1TV6B 1FK9A 2OPSB 4G1QA 3IS9A 2E9TA 4LQ9A 1JLFB 5J1EB 3RB0A 1HNVB 3MR5A 1ZETA 2HNYB 2WB4A 4NYZA 3LP1B 4ZHRB 3ICLA 4Q0BB 2GIQA 3DMJB 4QW9A 2XCPA 3FSIA 2FJWA 3LP0B 5I3UA 1HPZA 4DL7A 5L9XA 2J6TA 5KFWA 4KV8B 3ISND 3EPGA 1TVRB 3E01A 3KK2B 1ZTWA 1JLBB 1S1UB 2FVCA 4JUZA 4I7FB 4ECVA 5KT5A 4QWAA 1YVFA 4NCGA 4IFYB 2HNDB 4Q43A 1VRTB 3KHRA 3FFIA 1S1VB 3DRRA 4NLDA 4Y34A 4K50A 4KFBA 4TXSA 4O3QA 4WE1B 5KG5A 5C42B 4PQUB 5T14A 4KE5A 3IRXA 1Z4UA 4IDKA 5HBMB 5KFKA 3KHHA 2WRMA 4ZPCA 3C6TB 2R2RA 4ECZA 2ALZA 2W9AA 2OPRB 4O4RA 5DG7A 4F50A 4NLQA 4ZP6A 5KFQA 2BQ3A 1TL1B 2FVPA 3KLHA 3OL9A 5J2MA 1IM4A 1S6QA 1IKWB 2IAJB 1RTDA 1C1CB 2XC9A 2OPSA 1T03B 2FLLA 3H5XA 1TP7A 1T3NA 3MF5A 1HNVA 2IMWP 1RT2B 3DM2B 4IH7A 4TY8B 1N5YA 4LQ3A 4FBTA 3DMJA 2ASJA 1QE1A 1RT6A 4NLOA 5KFEA 1J5OB 5KT6A 3LP0A 4G3IA 3SFGA 4KV8A 5KFNA 3M9MB 4LSNA 2R8GA 2HAIA 3LAMA 4KHRA 1EP4B 2R2UA 1RTHA 4I7FA 5KFZA 1HMVB 1KHWA 4DL2A 4M95A 4IFYA 1S6PA 1K1QA 4U7CA 3VQSA 4ZVEA 2J6UA 2AX1A 4DL3A 1S1VA 3NAIA 1HYSB 1S1WB 1RA7A 4ZMMA 4WE1A 4FS1A 2FLPA 4PQUA 3CO9A 3MEDA 3JYTB 4J9KA 1JLQA 4O3OA 4Y2CA 4DL4A 2VG5B 4RW4A 4RW7A 4IFVB 1JKHA 2QE5A 4O4GB 3QO9A 3Q8SB 3KHLA 2IJNA 5EWGA 3MFIA 1IKWA 2IAJA 3MEEA 4RW6A 3FQKA 2YNIA 1LWEA 1RT2A 4YP3A 1RT7A 3KK3B 4O44B 5KFLA 4NLGA 2IC3B 3LANA 4F4YA 3PJWA 1SV5B 4ED6A 2JEGA 1DTTB 1HQEA 3HVTA 3BSNA 3E51A 5KFMA 4J9SA 3RB4A 1LW2A 1J5OA 1NHUA 4R5PB 5F8MA 2F8EX 2ASDA 2R8JA 4NLRA 1FK9B 4G1QB 3IS9B 4RNMA 2BANA 1IKYA 5KFRA 3FRZA 2WCXA 3CDUA 1RT3B 2WOMA 3MEGA 3DOKB 4ECXA 3HHKA 1HYSA 1S1WA 2UVRA 2FVSA 3PW4A 5I3UB 2V9WA 4R8UA 4K4ZA 1EETB 3H2LA 3E01B 3QGGA 5DG9A 3M8QB 4O3SA 4TYAA 4URGA 4KB7A 3IG1A 5HROB 1RTIA 4NCGB 5KFGA 3KOAA 1SUQB 1S48A 2OPQB 5KFVA 3TAMA 3FFIB 4O4GA 4ZP7A 3H4DA 3DRRB 2GC8A 2XI2A 4KFBB 3M9OB 3CDEA 4NLYA 2VG7B 4Q44A 3OSPA 1TKZB 5DG8A
chains in the Genus database with same CATH superfamily
4M5NA 4O44A 4MH8A 4IRKA 4DPUA 2ZM6F 2CJBA 2V2KA 2KXHA 1LV5A 2OUGA 2AW0A 1M5KC 4X84A 1SH0A 4BWJA 3M2VB 2E5IA 3HJVA 3QZ7A 2QMUB 5EWFA 1KNZA 1SH2A 4OZ0A 3QIPB 3KJQB 4IQMA 1V5VA 1Q95G 1S49A 3PCOB 1HBUB 3DLHA 1VJQA 3D6MB 3CDAA 5AE3A 3SZ2A 3CD6S 2R8HA 1HNWF 1FJ7A 2HQDA 4HHHA 2AZ3A 2JLFA 2BX6A 2RF2A 2RKIB 4WFYA 3S1TA 2VG6A 4OX8A 4CRJA 2E9ZA 4F3MA 2C22A 3H4BA 1X4CA 4P2SA 1NK8A 2RRBA 2HNZA 2QLXA 4JV5J 5A8KB 1H3DA 4DFPA 2DB1A 2UU9F 1Y4ZB 1YZ6A 1L3KA 3B4MA 4ZKAA 1P6TA 3M8PA 4DR3F 2D74B 1JJ4A 3KLFA 2HHHF 1HHSA 3A3NB 4OFZA 2BYCA 1TKDA 4RUCA 2J0WA 3ZTSA 4MYTA 1S9GA 2GO8A 3MR7A 4ZITA 3FBCA 2AD9A 5DDQC 3N6NA 5KFTA 2RS2A 2C2NA 4NPOA 1L3TA 4NXNJ 4K5RA 1DFDA 2JEIA 4EO6A 3R2CJ 1FKPA 3W9JA 1N6QA 2I0XA 1S57A 3DLEA 1WI8A 3FBBA 3C2PA 1S1TB 3SQGA 5IS2A 3R5DA 2X1GA 3BDPA 1FJEB 1QSYA 5DM7Q 3T9NA 5D4OA 4CO3A 5DGBA 3BGRA 4ECSA 3BR8A 3LW5C 2QC3A 3IR7B 4Q2MA 3BJYA 1PBAA 1IWGA 2ZNYA 2DY1A 4DDFA 2K7JA 2QFIA 3K2YA 1M0SA 4NLWA 1VQ6S 1REVA 1TL3B 2IBOA 4AFFA 3MM9A 1S4FA 1J5EF 4W98A 3DRPB 1YJ9S 4KGMA 3P6YC 2CJ9A 1JWWA 5J2PA 3MPUB 1VOMA 4KKOA 3OL8A 3RYLA 1U6ZA 5GAHI 3BKFA 5F8HA 2IM1A 4QIEA 1M5VC 3I5CA 3FZ2A 1CJTB 1C0UB 1S0NA 2KG0A 3IC1A 2DNPA 4IR9A 1F6TA 4PXBA 3N6LA 4Y0FA 3MWBA 2GNKA 1T0TV 1JJCB 3Q22A 1UZDA 3NWGA 1DURA 3SCIE 3FK4A 3SDEB 1U2CA 1U26A 1TFYA 4ECQA 1DLOB 1KSPA 1WKLA 4QWCA 1CPZA 4TY8A 4MKAA 4UQGA 1W25A 1OWXA 2DIUA 4EZ9A 4CYUB 2GCFA 2RSQA 1LOUA 4WIIA 2GIRA 4YR0A 2VPZB 4FYVB 1F9EB 4OJHA 3Q24A 2DNRA 2LA6A 4W92B 3QT5A 3KLGA 2G2ZA 3RR7A 3AFGA 3TVKA 1XBWA 3EX7B 3BGOP 4KH1B 2MZTA 2F9DA 1VLYA 2CNKB 1U0HA 1H72C 1PYOB 2R3VA 3MM6A 4DR1J 1VRTB 5ETOA 1NKEA 3FEYB 3A3PB 3OFFA 3KHHA 4ANEA 2W4DA 2HIQA 4L72B 1PKUA 3OL9A 1C1CB 4F0HA 1RT2B 3BEGB 1FDDA 3DCAA 1ZS6A 2CPDA 4XAKA 2HAIA 2VQFJ 3JQKA 2M2BA 3M2UB 1RA7A 2Y0BB 4KR0B 1OPIA 4MIWA 4IFVB 1U0SA 1FESA 1V6HA 3SQOP 4A8WA 4OIXA 2IC3B 1WC4A 3LANA 2RNEA 3HVTA 1H2UX 1VRQC 3R5CA 2GGPB 1HNXJ 3LPYA 4O0IA 2V8PA 2LECA 5I3UB 3W1YC 3I9V9 3QGGA 4LRDA 2LQJA 3HHEA 2E44A 1WOSA 4C8NA 2KH9A 4FF2A 2WBRA 2XI2A 4KFBB 4TLQA 3N6MA 1CJUB 1VK3A 5L1JA 4R5PA 1SI9A 3JQJA 2ZZNA 4DV5F 1U1MA 3D6HB 3VAMA 1HBOB 4DR7F 1M5OC 1N33F 3IR5B 3RRHA 3BDEA 4LSZB 4KY3A 4ED5A 1FRXA 1SL0A 2E1PA 2ZC3A 4M8LA 1FKOA 2GVZA 1SB6A 4CP5A 1N4LA 3UI3A 1AXQA 4B9NA 2CQCA 1BC6A 2VD3A 1ZZNA 1HQEB 2B7CB 4OI1A 2XMVA 5F9NA 2X1AA 3OVAA 5GAHU 4K4WA 2PEBA 3QJJA 5DLFA 3QT8A 1EQMA 2VQEJ 4HKQA 4IH5A 1DQAA 1UFWA 3ZZUA 2JEFA 2OFHX 3FSYA 2IHR1 4I1TA 1VQ4S 2XYHB 2Q6CA 4V1Ak 1WOPA 4DUTA 3QIDA 2BE2A 4JV1A 2W1BA 4ECRA 3TEHB 4CO2A 2YKOA 4F8RA 1NZAA 3BQ0A 4FVCA 4DX7A 2NUUG 3M2RB 2W7OA 3K17A 2E5LJ 5CYMA 2ZJRQ 4CTAA 1HWIA 2QTWA 2EC0A 1UAWA 1NK7A 4RWWA 4E8UA 2RF2B 2KO1A 2VG6B 4AXIA 3GZ7A 4OYXA 4CLUA 4DV0J 4X4OA 2CPIA 5IWAJ 2O67A 4C8ZA 2VBXA 3Q0AA 3MPWA 3P8BB 4ILRA 3THTA 3FEXB 1JJ2R 1HHTP 4FNHA 4B9LA 4MK7A 4YUDA 2C3YA 2AF6A 3BYPA 4ECUA 4DL6A 4DPTA 3OTOF 4EMDA 2RE1A 4Y00A 2A3JA 1TV6A 1HW9A 1GQEA 4YEAA 3OHBA 5KFHA 2E1MC 1FKPB 2CRLA 2LLZA 1MROA 1RSCA 3DLEB 4TVAB 3SQGB 4OYPA 3E3XA 1SH3A 2V8HA 1WSVA 1RU1A 2OH2A 3U02A 1JNRB 3J7YI 2ADCA 1X4DA 2XSFA 3WX4A 3DOMA 2BJ7A 3PFOA 2GX8A 1T03A 4G6VB 4JI8J 3PKYA 3HSJA 2DNZA 1QAYA 4B9TA 2Q66A 4HYKA 3IBCB 2COLA 1DHMA 1OS5A 1WEYA 3KXDA 3P49B 4KGZB 3L7PA 4URSA 2DHHA 3KG1A 4TQSA 4K7QA 2BJ3A 5KFDA 3A1YG 1FD2A 3RBDA 3IWLA 4WBFA 2PE8A 2WSFC 2JC0A 3M30B 1IBLF 4KC5A 1UVIA 2P9CA 3MUVP 2FY8A 1WC1A 1U47A 2VODA 3CJKA 1UEUA 3NGKA 1RGVA 1YBTA 4YOEA 3P5BP 5E3QA 3KHRA 2XNRA 1VC6A 4HTIA 4CIOA 3IRXA 1ZM2A 3R2DJ 1UJ4A 4DV7J 1ITPA 1S6QA 3H5XA 2YWWA 4TY8B 5KOXA 2JX2A 4QR2A 3SBMA 2BABA 1P8GA 4JI2F 1T9TA 1TR0A 2V8GA 2R2UA 1FT8A 4U7CA 2J6UA 2QMWA 4C7QA 3K58A 3CCMS 3JSYA 1JXVA 4C8LA 4FS1A 3UVJA 5EGYA 3AOCA 3RW7A 4X66J 2W01A 2GVDA 3H90A 2Q1LA 2RILA 3O2IA 2C2OB 3X3UA 1NSKL 3NNCA 4NLRA 2KI2A 1KD1T 3TNVA 5KFRA 1U0HB 2XYPB 5GMDA 2HHVA 2UVRA 2FVSA 2DGWA 2XY7A 1UA0A 1EETB 2LXUA 1L3VA 3MM6B 5KFGA 3B78A 3ZO7A 1RADB 2X3DA 4Q44A 3N0VA 4NLYA 1CC8A 3KLIB 1HNZJ 3VGVA 4NI2A 5ETRA 4ANDA 4AXJA 2DR7A 1RWPB 2CJAA 5K8MA 4A8OA 4FS2A 2JWNA 3FDSA 1KOOA 4DQIA 1VBXA 3C3LA 1SUQA 1C0TA 1HR0J 2FHJD 3A8IA 3EXCX 4DS5A 5F8JA 2ZD1B 4XK8C 1OYDA 3WIVA 2VBWA 2HHXA 2JFKA 5HVHA 2M8HA 3HHLD 5CQGA 3MM7B 2CZVC 2VDIA 2POKA 2R8KA 1WWHA 3IGVA 3HVTB 1AA1B 3R5GA 2J9EA 5ADZA 3P5TL 3I31A 2U2FA 4NLPA 4LFAJ 2RD5C 2D7SA 3CSKA 3N79A 2CA9A 4M5KA 3QJLA 1H7WA 3VGTA 4U96A 2WONA 2V4RA 2BM0A 5D78A 1GXLA 3CWJA 4ZP8A 2KFZA 1BQMB 1Y5IB 2GO9A 3VHQA 5B7WA 3KUEA 1U8SA 1HQUA 3IAM9 4DG1A 3J7YU 5KFUA 5BYRA 2DNOA 4H4KC 4OL8A 5J2NA 3PRBA 2FJVA 2DKOB 4ED8A 1NK4A 1MN9A 5EX3A 2YNHA 3RJMB 3FCVA 2ZVSA 5AXMA 1B0PA 1FJGJ 4LSLA 1FKOB 2XGQA 4DFJA 1LWFA 1U1LA 3CTRA 4ZVGA 5DM6Q 2LXFA 1MLAA 3NGDA 2QL9B 3QT6A 4C3LA 4NCBA 3H40A 3ILJA 1ULRA 4O3PA 3JAMU 3AD8C 1N5TA 1LWCA 1N5VA 3UD4P 1WKJA 2PI5A 2QG9B 1JK9B 4L73A 4I56A 1OQ3A 4PUOB 4WF9Q 2E66A 2DD8S 3AQPA 4WWSA 4UUXA 3I6PA 3GB0A 1KVKA 3MMAB 4B17A 3CCRS 3MZIA 4ECTA 3DDNA 1IR0A 3Q83A 2H5IB 4KIAA 4J90A 2W9BA 5HP1A 3OR1B 5CYMB 4X62F 4LF9F 5A6PA 4F7VA 4CTAB 2HNDA 4HT7A 2K1RA 2XMWA 3NGRA 3M9NB 2HZVA 1GX6A 5C7PA 5F9LA 3VAJA 4H4OB 4CH1A 4DU7A 1QUPA 1G7CB 4C9DA 1RTJB 4OYZA 4CO1A 1NPPA 2E7VA 1U1QA 1SVDA 2VQFF 1IVZA 2P9GA 4F67A 3AA8A 2ZWOA 3GE9A 1VLOA 3DKDA 2OEMA 3DGPA 4USUA 3OBIA 4UY85 2ZUGA 1HPZB 4LF7J 1RBOB 1M5SA 3VTIA 3MMJA 2YH1A 2DEJA 1FWPA 2GJFA 2U1AA 2VBYA 3NKYA 4PQAA 1VQNS 4EU0A 3W8PA 2FJBB 5J1NA 3GG0A 3AA9A 4LIRA 3KLHB 4LVNP 5J2MB 4M5GA 1TV6B 2DH8A 3MCNA 3LP0B 2HURA 1QLNA 2HGNA 2HLTA 3ETMA 3G6ES 1WG1A 2KL8A 3DLJA 1VBYA 1X8DA 4TXSA 1VQYA 3W5ZA 5KFKA 2GFFA 2N3LA 3HDSA 4BWMA 2W9AA 2WVBA 2BQ3A 1RUSA 3DOMB 2XO6A 1T03B 4NEYA 3G96A 2B4OA 5KFEA 3N01A 1S99A 2DNMA 2AJFE 4KV8A 3DC2A 1S6PA 3L3CA 5L46A 1VQKS 4KGXB 3JS9A 2HQ3A 4Y2CA 5HMWA 2RAQA 1IKWA 1NUEA 3BBFA 2HEKA 2N7CA 2RH3A 1X9WA 1RT7A 3PJWA 2RRAA 1NHUA 2JL9A 3DXSX 2F8EX 1IKYA 2RVJA 3CDUA 2WOMA 3MEGA 3DOKB 4W4MA 1RHKB 2VQEF 3CJKB 3M7VA 3PO4A 4DOZA 5AXNA 2A2DA 2XMAA 2OPQB 5KFVA 5HAOA 4ZVOB 1WG5A 1D1UA 3IRXB 3GQCA 4QYZK 4ZPVR 3EJMA 2PMZD 4BDPA 1NCLA 1I5OB 1RWXB 2FHKA 1S6QB 3GYXB 3VVUA 4K4YA 3PRVA 4KTQA 3G8TA 3I0RA 3ENWA 3M8YA 2W2PP 2EWHA 2EK6A 4F0KA 2DPIA 2MJNA 4IRCA 5F0WA 4M5MA 1DTQB 4BBYA 1K44A 2X1BA 4DV6F 3MDFA 4ZVSB 3UVJB 1R8HA 3V4IB 3DRSA 1QSSA 3NG8A 4RUAA 4U9RA 2GVDB 2MZJA 2DXFA 3T6BA 3AY0A 3PIOQ 2UUAF 3V6DA 2PEHA 3BSOA 5KG0A 4DV0F 4YY3F 2XZDB 1S9EA 1RAGB 4OV1A 1XQIA 1YBUA 3T41A 3EGWB 2CNOB 2JH3A 1OY6A 1IKXA 4QIGA 3V81A 2E5JA 1RE1B 3ISZA 5DGAA 1B7YB 2AYEA 4NI2B 5IM0A 1Q8IA 4V19X 4WKRA 1X9SA 4A8SA 4GC7A 4USWA 1U09A 5DETA 4RNOA 2EVZA 2QIFA 1DY3A 1C0TB 1IM6A 1S9FA 5HLFA 2XLJA 5M2RA 3RGIA 4IR1A 3D2WA 4B3RF 2H1YA 4J9LA 2H9ZA 2EFGA 2Y1RI 1D9FA 3ZTRA 4IO1A 1FEHA 4UUWA 1X5SA 2V8DA 4PXCA 4PWDA 2OFGX 2R8IA 4G1IA 1XN9A 2IDLA 1S7HA 2LMIA 1C1BA 2EG2A 4DSJA 2QLWA 2HG4A 2VL1A 1AW0A 4DLGA 3PZPA 3ZNJ1 3PEJA 2AMCB 2WONB 3LP2A 1KWMA 1O6XA 1H0HB 1RISA 3WHIA 3OTBA 1Q7YT 2B4UA 4OV6A 3HXMA 4C0BA 3LA0A 4LRBA 3UR3C 4K2XA 1W7WA 1FDBA 3LP1A 3QJPA 3PX4A 1TKXB 4Y2MA 2E7WA 4F4ZA 1YIJS 5C24A 2DNGA 2RQKA 3CPWR 4LSLB 2W2OP 2K06A 5C42A 3QATA 2M52A 4DV7F 2DGSA 1EB0A 2HHTA 2DBBA 2MQMA 5F8IA 1VGYA 5EUHA 3JXOA 2F4VF 4ZVFA 4H4MB 2CQDA 4DX6A 1WJ9A 4I6YA 3DXBA 1GTEA 4QPXA 3QFWA 2W2MP 5KTQA 3UE2A 4F3OA 1ICEB 4XO0A 2DCUB 2Y8WA 3ZTPA 2MZRA 4RW9A 1GX5A 2NSCA 1IQZA 5H9FJ 1KLMA 2BKOA 3KYLA 3E8OA 3HK2A 4FF1A 4K0KJ 5BR8J 1KVIA 3RB0A 3HD2A 4YB5A 4B3TJ 2WW4A 3CF5Q 3EGNA 3BN7A 2ADBA 1GMVA 4JUZA 1VISA 1UPPA 2HNDB 2K1RB 5H9EK 4NMLA 1DBDA 4QCLA 4WE1B 1WI6A 3FC9A 4J9VA 1HNZF 4O4RA 2K3KA 4UF4A 4Y6IA 1TP7A 1HNVA 1SC3B 1M1HA 2Z8QA 2RIJA 1QE1A 4F4AA 4DV2J 3SFGA 3EVMA 4I64A 4DZDA 3DGPB 1S1VA 4Y2IA 5CABA 3FJ2A 2RQ4A 4RW4A 5J1PA 2MKIA 1X60A 2NXUA 4C97A 4KPCA 4JI5F 2EEYA 2FHJA 2I8EA 1PYTA 3DLLQ 2HBQB 2AJQA 1OJ4A 2BANA 2NYHA 2JHEA 2JZ5A 3UN2A 4K4ZA 3MCOA 2VIHA 3QSYB 3TZWA 4J9MA 1BUXA 1AZSB 2GJ2A 2XSJA 4ZCLA 2NZCA 2PGCA 1IBKJ 2ZE2B 4DSEA 6FD1A 3DOLB 2V5HG 3PW7A 2J9CA 2RDJA 2XQCA 4DF4A 2W24A 2JC1A 5CCMA 2FVRA 5HROA 1K0VA 1S6PB 2UUWA 2WW8A 3M6VA 4FZVA 3EZUA 1YTYA 3VGUA 1VQLS 2B4VA 2IYGA 3NGUA 1Y3KA 4QIWD 3JTPA 2HBRB 5I3PA 1UW9A 3ZTQA 1YRXA 2Z2MA 1RT7B 1NK5A 5JVGQ 5F41A 4DFKA 2HZAA 2GA7A 4TY9A 2HHQA 4FKYA 1IKYB 3M6WA 2RUSA 2WOMB 3MEGB 2Z30B 3HX9A 3IO1A 3FSXA 1RWWB 3NCPA 2MQ8A 1Q86T 4ICLA 4P7VA 5E3PA 4B9VA 1JLCA 2L9WA 2Z2YB 3JAMY 3PG9A 4J9NA 1G6BA 3FQLA 4WYWA 2ZFHA 4DPXA 4MFBB 3N5BA 1F9FA 4UZBA 4QOTA 2FIUA 1BQNA 1Y0HA 3I0RB 3LF0A 4OI0A 5HMZA 2KXFA 3BSCA 4XDDA 3MECB 1H74A 4NX9A 1FXRA 2M3DA 2QN6B 2L3MA 2KM8B 4DV3J 1CULA 1PAEX 2PMHA 3HVWA 1KEKA 1LFWA 4F02A 3DDIA 2WB1D 1EHWA 1M1GA 3TA0A 2PFFB 2J7KA 3UQSA 2ZKTA 1HNIA 4CCHA 2VU5A 1SXLA 4L6V3 5THWA 3BQ2A 2J7WA 2BE7D 2CPFA 1Z1ZA 2OMLA 4ZDNA 2HQFA 1S9EB 3HFKA 1MMNA 2C1EB 1RWMB 2KXNB 1Q16B 1IBCB 4ES2A 2YVSA 1S97A 5LSRA 5I3QA 1QSLA 4LBPA 1IKXB 2FDNA 2YWGA 2ABYA 4GKKJ 1RACB 5FLXY 5JMNA 5IM0B 4FBUA 4USKA 4U8VA 2B6AB 3BR9A 1RHUB 1RAEB 2YPZA 2BJEA 1JLFA 3F56A 2NR0A 1U48A 4WFZA 4DWIA 2V63A 4LFCJ 2IFXA 2CPZA 3O1LA 1FO1A 5HMYA 4J7CA 3LALA 3UDLA 3DI6B 5LSLA 4GMKA 2GMLA 1R0AA 2MQOA 2LA4A 1NSQA 3RB6A 2VPWB 2V34A 3MXHP 2KJWA 2HVIA 2ZEJA 4JI6J 4IG0B 5C2CA 1C1BB 1NHKL 5LXRA 2MPUA 3BKTA 2JDJA 3KJFB 4QR0A 1GNKA 3QYYA 4NMXA 2D3ZA 1FXDA 3LP2B 1P9QC 2PMWA 2IDEA 1PGZA 2MY7A 4PRFA 2NQPA 3GR0A 5AJ3F 1S5ZA 4C48A 5ETVA 4E98A 1ZETA 3LP1B 4IOCQ 2AKWB 3HSGA 2J6TA 1IJFB 2XTJP 1YVFA 4DQRA 1O8BA 3RRGA 3PEHA 3DRRA 4Y34A 4O3QA 5KG5A 5C42B 4PQUB 3D0HE 5HMXA 1P9YA 1YRTA 2MHNA 2WVDA 3HD1A 4DV4J 2QA4S 3VQTA 2IAJB 3HPOA 3NOGA 2ZWPA 2Z2ZA 3MMBA 5AXKA 2JVOA 1YDLA 1YX2A 3BS9A 3S01A 3D68A 3LAMA 1RTHA 1Q81T 4ZLPA 1VQSA 2AEJA 1B64A 4O3OA 2UXCJ 2V68A 1SJ1A 3R5AA 1RAFB 9ATCB 2IJNA 5EWGA 3CCLS 1JNZB 5GMKa 3W60A 4RW6A 5BXIA 4KHPF 4WFAQ 2Y1IA 3NMRA 4ED6A 3CD7A 4PYDA 1N8RT 2M9KA 3GLJA 3AAWB 2HRYA 1QDUB 2WCXA 1RT3B 4LREA 2PO4A 4ZJQA 3NWRA 4LBIA 3ULHA 1P1LA 3OFEA 2DTJA 4P71A 3KG4A 1XK8A 7FDRA 1J2VA 2NUHA 4DV1J 4RU9A 1DQ8A 3QPIA 1NEEA 1QE1B 3M1VB 4CH0S 2OHDA 2WVFA 2ZH7A 4LJMA 4DR5J 2B51A 4DR4J 1TKZA 2Q6BA 5A8WB 2RUGA 4RW4B 2UUBJ 3KK1A 1I51B 3AJ1A 5J2QA 5KFSA 4DSLA 2B0GA 2HPUA 3ONQA 2BANB 1P27B 4O3RA 2BM1A 2V9KA 4WFXA 4TKTA 3HHLB 1FX2A 2CUYA 3JSMA 2W2NP 2CQBA 4EEYA 3ILOA 3MGJA 2AU0A 1UWBB 3QFHA 1SKRA 4DX5A 2XSJB 3DLGB 1PG5B 4LFBJ 3LWLA 3R27A 1UMJA 3KMQA 1S59A 4M5DA 1RAIB 2VICA 5IOLA 1IKVA 1NXIA 2QL7B 3KLEA 2OPPA 3OVBA 3EICA 4I67A 4YR3A 3HMJG 3GILA 4QYRA 4PG8A 1WDDA 5ETPA 4ANCA 1P1TA 4CLLA 5E3RA 3LGNA 2A10A 1RZMA 1URRA 2HWHA 4ECYA 1IQTA 2A1BA 4ZVUB 2K3IA 2W9CA 3EZOA 1N48A 1WHVA 1U49A 4RNFA 4MIBA 3US5A 4A4JA 1S0VA 2MKYA 2MLYA 2W8KA 3PTWA 4I68A 4Y28C 1N52B 1G1XA 3KJVA 1JLCB 2R7UA 2HQCA 1TUGB 2DH7A 2ALYB 3IGNA 4EGLA 2MKKA 1WEZA 3I5AA 4AE5A 3GG1A 5D15A 5IC6B 1NK9A 4B3TF 5HSPA 2ASLA 1R27B 2LQ9A 2YH0A 4NLTA 5IT4A 3KK2A 1JLBA 3UDCA 5BJRA 2LCWA 1CULB 2GJIA 3K5LA 1VR6A 3PM9A 2HBZB 2ZKUA 2OPRA 1WF2A 4XPCA 1Q8BA 1TFWA 2MSSA 5L9NA 1NK0A 5BYSA 3BQ1A 1T02A 3B82A 4DV2F 3DRYA 4AQYF 1KP6A 1VK8A 3FKBA 1ROFA 3UNYA 3GV5B 2RU3A 5DZ6A 1SC4B 1K73T 1E6VB 2BVZA 2IRUA 3CB4A 2E5GA 4RBTA 2MKHA 3DU6A 1RXOB 2MXYA 3CDBA 2QFJA 1KHVA 4IDKB 1L3UA 4AT1B 2H51B 2I38A 2O01C 3CT9A 1SQFA 3W2WB 2F5GA 2FZGB 4G1QA 1JLFB 4B3SJ 5HQMA 1V5IB 3DMJB 1Y7PA 3FSIA 2ZH6A 4CLSA 4JI3J 4Q2LA 3ZZZA 4ECVA 1MG7A 4IFYB 3EVWA 4OJGA 5HVGA 4RLEA 3ETOA 2QX0A 4ECZA 1ZAVA 2ALZA 3K0JA 2M7SA 4RUHA 1N36J 5KAKA 3GSIA 1SQGA 1WHXA 1F5AA 2CQGA 2QGFB 4YDXA 2D1CA 2VKRA 4A47A 5KFZA 4DL3A 4DCPB 4Z37A 1HYSB 3FEZA 3MEDA 2QSWA 2P6TA 2QE5A 3KHLA 1T9UA 3OW2R 5GADI 2VDHA 3P4UB 4RR5A 2CNLB 1D3WA 5IC4B 5HI7A 4F4YA 2LKZA 2JEGA 3E51A 2XS7A 4FF3A 3NRBA 4OZLA 3ZZRA 4L75A 2YKQA 4QZVB 1EZZB 1RJJA 4K5SA 1QTNB 2HIYA 3DRRB 1OQ6A 3LWMA 3MM8B 2YNFA 1X7VA 1YJVA 3BGLA 2ZBCA 1T9YA 3B6BA 3MMBB 2LU2A 3VV2B 3QQCD 3CJTA 2WBMA 2BR0A 1KQGB 2ACMA 1RTHB 1H2TZ 5D4NA 1D9AA 3D6TB 4Y2KA 2R7OA 1RYRA 4DV3F 5ETKA 4DLEA 4OX9J 4Y2AA 3L9ZA 1JLEA 2E29A 2FB0A 4RW6B 1FNXH 3HKWA 1M5HA 3N5FA 2R7TA 4CQ1A 1RT4B 2DRBA 1FRHA 2MGZA 5E7OB 3DLKA 5M2PA 4UQTA 2WAQD 4I6WA 2B9EA 4CZCA 2OEKA 4DUYJ 2F63A 5C25A 1HFEL 4E2FB 1XMOF 3PYDA 2DHSA 1WTBA 4OX6A 1NH7A 4GKKF 1PAUB 2AIRB 5L39A 3OHAA 3PY8A 1M5PC 3BM7A 2BQRA 2N82B 1HWKA 2F1FA 3I0SA 4OHXA 5CYQA 4NA1A 2HHUA 1VRUA 3R1HA 4TLRA 2DPJA 3A3OB 2CVIA 2EPIA 4OHYA 4W90B 1XMQF 3FMBA 1JX4A 1NMEB 5CHCB 3KK1B 2ERRA 2WK4A 3C66A 5DDRC 1HWUA 1KLNA 1C4AA 1H7XA 5E3CA 3KNAA 4MYUA 1QAJA 3TVZA 4NZ0A 4J9RA 4B3MJ 5KFIA 2R7QA 2FJEB 2D3UA 3NGTA 5KG4A 2G9OA 4CLTA 4IRDA 3PXGa 2BRKA 4JV0A 5IV4A 2M70A 4WU2A 2YBVA 1R7IA 3DRXA 1D9DA 1KBRA 1E6YB 2V4JA 1AT1B 4LR7A 2ILZA 3NP5A 2XM3A 3GTYX 3V6JA 5LL6d 4RWXA 4M5DB 1KONA 4CLWA 4ZN1A 1IKVB 1MMLA 3ILLA 3OV7A 2OPPB 4OZ3A 3NY0A 4ELVA 2MEWA 2V6AA 4DL5A 1VQ8S 1CG2A 1QM9A 4C98A 1NH8A 3TUPA 2LP4A 4BLGA 4LF6J 1FRLA 4EI2A 4A8FA 1FTRA 1S76D 4FVMA 2MJUA 3CE8A 4DV4F 5L1LA 1TL1A 2JEJA 3K5OA 1NPRA 4YR2A 2EI5A 2W9CB 3TW0A 4A8KA 3GIMA 5GADU 2QRRA 1WHWA 3UCUP 4B9UA 3CCSS 1VMBA 1PILA 1I6JA 1KQKA 2ZH4A 1QTMA 1M1KT 3KJVB 5H9FK 2RMLA 4JI7J 1YJNS 4PKDB 2OJ3A 4Q5VA 3X1LB 2CWXA 4FPIA 3IRWP 1LKZA 3G71S 2L9NA 2HQGA 3G9CA 1W2IA 1Z2LA 4OZ2A 3UD5A 1JQGA 1UPMB 1VHFA 4LQ9A 4LF2A 1X4FA 4QYZJ 4QW9A 2XCPA 2GMHA 3E01A 3KK2B 4UW2A 1JLBB 3CJRA 2C2KB 3KFWX 4NLDA 4PPZA 1RAOA 4K50A 1EAYC 4HEA9 2C3PA 4ZPCA 2OPRB 2W7AA 3BO2A 4RUBA 4DV1F 1RTDA 2H4YB 1VIXA 1XTZA 4C0OC 4AL7A 4ES1A 3HVRA 1HHQA 4CLFA 2QMXA 4DR5F 4DR4F 3W63A 4P72A 1S1WB 2P6SA 3IXQA 4P74A 4LRCA 4GO7X 4LR8A 2FGOA 2NXCA 1Y3JA 3TO8A 6AT1B 4FP9A 1HA1A 4OYIA 3K89A 4M5LA 2H65B 3T1HJ 3BSNA 3TVYA 1YG0A 2V2VA 4G1QB 3FRZA 4H4KA 2AYMA 2J0SD 2OIHA 5DG9A 4O3SA 4URGA 1VQ7S 4DJBA 3KOAA 1VQMS 2VG7B 3I32A 1LK5A 5JXSA 2Q43A 3POTA 2NPFA 4NASA 9RUBA 2XMTA 4I4BA 5AT1B 2V0NA 4ID5A 3TARA 2HSEB 2VZ9A 4OQJA 4PYAA 4ZVHA 1QJHA 5EN1A 2DR8A 3I9ZA 2IRXA 3M8QA 2KVQE 3B54A 1S12A 1DRZA 1WSRA 4OYOA 4A48A 4MJKA 4PG5A 1RBLA 1UEKA 2EK1A 3MEDB 3OLBA 3CUNA 4C11A 3M4XA 2BBEA 4EUVA 1VQOS 3P3DA 1L3SA 3G86A 5HL7Q 1T05A 1LWXA 4ZPDA 4ATNA 3OJSA 4PXEA 5K14A 4ZIWA 2BQUA 5DO2A 2MQLA 3FGVA 3ITHA 2ZNZA 2BE9B 3SXLA 5RUBA 4OI3A 3H8YA 3D54A 3R9LA 3THPA 2ZBQA 1FI4A 5FD1A 4K4XA 2CZ9A 2YNFB 2MTLA 1ZOTA 3I96A 1HIYA 3MM5B 1C2PA 3D6FB 3U1MA 1V9OA 5ETSA 2QJ3A 2PA3A 3CMAS 3BV8A 4CM2A 3THVA 3RR8A 5IT0A 3MHYA 3HT0A 4P52A 4ERDA 3I87A 3H20A 3R5BA 4PABA 1VFJA 3NEKA 2UXBJ 4RW8B 3LOUA 2D69A 4G1PA 3G8SA 2FZKB 3DLKB 1TKTA 2UXDF 2YKPA 3M8ZA 2B5JA 3MOZA 4WU3A 2W25A 3QNWB 3AOBA 1W2BR 5C25B 4ELUA 2JNJA 2UVVA 5CD4A 2CIMA 4IOBA 4UTGA 1AFIA 2HWIA 3I0SB 5H9EJ 1UJ5A 4DBQA 3WBZA 3UCGA 4B3SF 5J1EA 4AYBD 3V6KA 1VRUB 3R7BB 1I94F 4JI3F 1U25A 2OO4A 1F60B 1SJFA 1U1NA 4B3OB 5G0RB 5KFBA 3UNGC 3H5YA 2HAFA 5D8HB 3FUYA 3NAHA 2HQIA 3HM9A 1WF1A 2ZM6J 1EIYB 1N36F 3BH6B 1NU4A 5A2QU 3BGFA 2IM2A 4P2FA 2IVYA 1JLGA 3EZ5A 1ACMB 3DM2A 2C28A 1UFLA 3GJQB 4I6AA 1PJ5A 3H0PA 4U7UK 1EP4A 2GQCA 3MAQA 3GCXP 2G2YA 1PO6A 1F3VA 3DYAA 4O0NA 2AGPA 3B8HA 1NHVA 3J7AN 1HNWJ 1X4GA 1QAXA 2V4JB 3UO0A 2HMIA 2BKNA 4FPRA 4IG3A 4DU8A 5KG2A 4G65A 1U24A 1OSCA 2KHCA 2HFSA 2VJVA 1DTTA 2AGQA 2BOAA 4HHJA 5ETQA 4WJBA 3EVOA 4AL6A 2WB4A 4NYZA 2LQBA 2VFTA 3BBCA 1ZTWA 4DR3J 4LRFA 2HHHJ 1WEXA 2FZCB 2GMJA 2DXEA 3BH7B 1APSA 3O44A 3R8YA 2P9EA 3EYZA 1TL1B 3A12A 5K8OA 2XC9A 2OPSA 1F5BA 2EKYA 3MF5A 4ZLJA 1QY7A 3OUYB 1CVJA 4UY8T 4BC9A 2PN6A 1Y10A 4I7FA 4ZVEA 5AE2A 3TRGA 2LXIA 3R7NB 4OX9F 2ZH8A 1JLQA 3CD5A 2Z58B 4I0WA 4YS2A 3QO9A 2ZBPA 2HFVA 4O44B 1WOOA 4ETXA 3HSZA 2RHSB 1YITS 1DZ5A 1J5OA 4NL5A 4P6QA 3D7SB 3DU5A 2DNHA 4PZVA 3R1LA 4Q7AA 4DUYF 2F9JA 3JTNA 1X5PA 3E01B 2NREA 5U47A 3PACA 1J5EJ 3TAMA 4ZP7A 4O4GA 2XYGB 2IJRA 3EDQB 2MY8A 2XZWA 3EPIA 1TZ0A 1BWVA 2CDRB 1X4BA 2JRSA 1RTDB 3C16A 4N8NA 1ZTTA 1YGYA 3GR1A 2MQNA 5CAAA 2HNZB 4X65F 3CC4S 2YY3A 3UFCX 1UL3A 5EX0A 4KAIA 2AJ0A 2AEFA 2QA1A 3M8PB 1T9WA 2DO0A 3KLFB 5KG7A 3FCWA 2Z4PA 2CQ1A 2M5YA 4KBIA 3NCQA 4PEOA 1X5TA 1S9GB 4DSKA 3QIPA 2D9OA 5I42A 1AYEA 2G13A 2XMKA 1S77D 2YWFA 4BC7A 3C14A 4ZS6A 1KTQA 4HLBA 4FNIA 3K8VA 2FJXA 3OSNA 3I56S 3CJ0A 1N6QB 2CQPA 2OAUA 1WHYA 1D8YA 1WC6A 1ZAXA 3JTOA 2RKIA 3MR2A 1EKSA 4LUBA 4J91A 5CH7B 3QRQA 2H4WB 3FBEA 4ID5B 2PD1A 2HK3A 4C3KA 2CWKA 3BGRB 2HWTA 3NNHA 2R2SA 4UOCA 3UR0A 8RUCA 1GMUA 3M8WA 1R31A 1XR5A 4K2JA 5KFCA 3U27A 7AT1B 4C11B 2HGMA 3RZAA 1REVB 2KU7A 4ALZA 3MM9B 5E33A 4RJVA 5D0EA 4RPFA 1T05B 4LR9A 1VQ9S 5J2PB 1HI8A 4KKOB 1WNEA 3GYGA 4QWDA 1HI1A 5K14B 2IBKA 2FC8A 4N7TA 1LNQA 2AP6A 4YMEA 4Y3CA 1R8CA 4ED0A 3PR5B 1S1TA 4MKYA 2JFDA 1VQPS 4JI0F 1WF0A 2BJDA 1SJRA 3D0GE 3DN9A 2MLZA 1Q8KA 3OFHA 4C2MA 2O3DA 4CM0A 3I4HX 1NKCA 3FMWA 1Q53A 1X0FA 2Q79A 3QAEA 1S0OA 2VFVA 4JYAJ 1U8WA 1GK8A 1RB0A 3G4SS 4KO0A 2C2EA 4ILMA 3SCJE 3RG6A 1Q0NA 3L95X 1NDLA 2VUGA 3T5JA 4KH0B 4Q0BA 4H54A 2L08A 2DJWA 2CNNB 2JSXA 1Q5YA 2DR6A 3G82A 3BKUA 3BPDA 3DRPA 4DZ6A 3PYEA 2Z0GA 3GFHA 3MMCA 3FZBA 3HLUA 3KLGB 4XIUA 4USTA 1NLKL 2KYZA 3HHLC 2MQPA 1K9MT 1CJTA 4MK8A 4QIVA 4DR7J 4QWEA 3ZTOA 1TKTB 2MZSA 2UV8G 3D67A 1TL5A 3DDKA 4JV5F 2HS0A 1RHMB 3EM1A 2DISA 2JLGA 1FRJA 5CZXA 3SDEA 1BGXT 5IV3A 1EQ0A 2ROGA 4D3HA 4V19J 1DLOA 1WC3A 1SQEA 1BXNA 4NZ6A 2ROPA 1UTAA 2RU9A 3IS9A 2XULA 5J1EB 4NXNF 3AXMA 3D1QA 2YX4A 3ISND 3EPGA 3ILIA 2A0FB 2V67A 3J81U 4KE5A 2RQMA 3TA2A 2KJVA 2DHAA 3NXZA 3U1LA 3DM2B 2MZ1A 3QBCA 4G3IA 3M9MB 1EP4B 2AX1A 3QRPA 2ZZTA 3WDOA 2V8VA 2DNNA 2FLPA 5HJXA 2J5AA 1X5OA 2VC1A 2KYXA 5JJBA 1UW4A 5HQ8A 3OTCA 2YNIA 1LWEA 1RT2A 2CJXB 1GFWB 2LVWA 4A8MP 2XMJA 1DTTB 4R5PB 3OXGA 1SBRA 1IBMJ 2A6OA 2EC2A 3AD9C 3M2UA 2D3OR 3KNGA 3IWNC 4TYAA 1RTIA 1RU2A 4WK3A 4KQZA 2QL5B 4USVA 3CDEA 5CXTA 4MAKA 1FRKA 2GVZB 2IC3A 2ZVIA 4EYHB 3C19A 3EMTA 3C46A 2VA3A 4X64J 5FDLA 4U7UD 3GCWP 1N54B 2HVEA 4FYWB 4CO0A 3BGUA 3PIPQ 4WP3A 4P73A 4OHWA 2LEBA 1TMMA 3O8WA 4OYWA 3KTQA 1JLQB 4K4VA 3PX0A 3AXKA 3PYFA 5B0FA 2VHGA 3QO9B 4FF4A 1JIHA 3BPSP 4IQXA 1MNEA 1ZBTA 2EFOA 2BE2B 2XGPA 1PIEA 5L1KA 1HBOA 1EKRA 4MKBA 3BZQA 2BJ9A 2UUCJ 4ZLLA 3CULA 2PT0A 2FJDB 3SI8A 3AT1B 3CJ5A 4OI4A 4ZJOA 3TAMB 3R7SB 2NPIA 4DR1F 1FVQA 1X9MA 2XWYA 3A8JA 2Z56B 1VCTA 1S79A 2L41A 1T8EA 4UZCA 2UVWA 1FFSB 5KFXA 2GW8A 1WTFA 3C16B 1YSJA 1IBLJ 3CGIA 2KVIA 1N56A 1AUDA 2R42A 4EWTA 1RWVB 4WP9A 2HFOA 2P8IA 5FLXU 2BDPA 2OTJS 2F4FA 2VBZA 1LW0A 3AB4B 4IOAQ 2JLEA 5A6WA 4C3MA 5F8GA 4K4SA 3N4WA 5IZHA 4I2PA 3RAMA 4JI2J 2FYXA 4Y65A 2QT7A 3Q8PB 3J81j 2MDAA 1Q5VA 3M2RA 3MAHA 4RX6A 5I42B 3G6YA 2J8SA 2WSCC 5A2QY 3C14B 1HNXF 4DS4A 2OP5A 2GZOA 4Q45A 4EO8A 4DCOB 2G0CA 3KJNB 3CW2C 4QIFA 1A0OB 1VI7A 1MROB 1BHNA 1FWKA 1YLXA 5ETNA 1U4BA 1JXEA 2BW7A 3VZIA 2C2RA 2O5DA 3EUNA 2CAJA 4Z7CA 3VF0B 4OLPA 4C4WA 2RJZA 3U1NA 4XPEA 5ETLA 2DHXA 5KG6A 4RU2A 2B56A 1WDTA 1YI2S 2HGLA 4CLKA 5IFMA 2CZ4A 2IA6A 4OI6A 2SXLA 2IM0A 3ZFVA 4IYQA 1WORA 1S6UA 2AEMA 4KGKA 4F25A 4UT4A 3PO5A 3CC2S 3GJTB 3PW0A 1LXJA 1URNA 4ZPAA 2DO4A 3PJ9A 1T94A 2VKZG 2QYCA 1OPZA 4DL0C 1UFKA 4WTOB 4NZ7A 2VV5A 1KKHA 1TUVA 1NAQA 3C15A 4KO0B 1U6BA 4EBEA 1YZ7A 1V3ZA 2J7UA 1FF2A 1FK9A 2OD4A 1GAOA 3GFXA 4DMZA 5DDPC 3MR5A 4WCEQ 2VFUA 1PYSB 4Q0BB 3J7ZT 4DL7A 2E5LF 4R0JA 3M6UA 1ZH5A 3G82B 2UP1A 1FNOA 7FD1A 2E1RA 3MMCB 3SCKE 4L76A 5KFQA 5E5NA 3NS5A 4WFBQ 3M30A 2Y1LB 4IH7A 1YJUA 3MEKA 3G87A 3CJSA 5B0BA 5KT6A 5KFNA 2HVHA 5CD4H 1SJ3P 2QA2A 4DL2A 1JMTA 3GWCA 3WX8A 2OEJA 3OJUA 2N7YA 3MUMP 1R43A 5IWAF 3MI7X 2G0JA 4DL4A 1VBKA 3CIMA 2HKEA 4RW7A 4JP8A 4RBVA 4CT9A 3MFIA 2B9WA 3HT3A 3MTJA 2P2CB 3W66A 5KFLA 5EHHA 4NLGA 1KR4A 4M5IA 4F26A 1IR1A 2GV1A 5GAEI 3IS9B 2XB2D 2OKQA 2CG8A 2VB6A 1GTHA 1SCJB 5LJ3Y 5D0GA 2HBYB 4R8UA 4J37A 3RTVA 2FHOB 1NBEB 1SUQB 2EFVA 3R6GB 2HK2A 4U8YA 4ZCIA 1KOHA 3H42A 4N56A 2HS4A 1VC0A 3H59A 3TOQA 4A8YA 4JI8F 4NRUA 2E7XA 4RNHA 2R7SA 1EETA 4KRWA 4X62J 4LF9J 2ATLA 4LF4J 4TU7A 2FC9A 2ZH3A 5L38A 3LO3A 2H48B 2N4CA 2PC6A 5KT2A 4PR6A 4WP8A 2CG4A 3KLIA 2XS2A 3UPFA 1CJVA 3K59A 2YNIB 3SIPB 1REGX 1LWEB 4LF1A 2KT3A 3NGSA 1KRPA 4QQBA 2R7VA 2VONA 1UVKA 3EE3A 1HQUB 4DG1B 2ZDPA 4WPAA 2ZC4A 1YJTA 5J2NB 2FD2A 1YJ7A 3R97A 2MSTA 1R8BA 1HBNA 2ZD1A 3MR3A 1RTIB 2YNHB 3VALA 5JUMA 3N9UC 3HKZD 8ATCB 4KSEB 3TP2A 5EDWA 3TUIC 4JYAF 3MPVA 3TAQA 3MM7A 4HH1A 1LWFB 1RWNB 2A6MA 1S6OA 5FDLB 5KFJA 2JJ4D 1WC5A 1OO0B 2OSQA 2YWKA 2D3O1 3MPYA 3TI0A 3TQ1A 2APOA 2C42A 4BS2A 1R0BG 5LMNJ 1LWCB 3GV7B 3QT7A 3GIIA 3BREA 4NXMJ 3ZZTA 3WC2A 4FXDA 4CI0B 5KFYA 3VGSA 5DQGA 5CZVA 3UN3A 1BQMA 4P10A 5L1IA 1CQMA 2VPYB 4Q8FA 5HANA 4X66F 1MU2A 3QMQA 4GKJJ 1NJYA 1N34J 2DGUA 2NS1B 5DDOC 2QA4G 3HO1A 5C5JA 4F4WA 4FN5A 5IQ6A 2W9BB 5HP1B 3AD7C 4OZJA 4FDFA 2FJAB 4WXWA 4FYDA 1RAHB 1D0EA 4TN2A 1RT1A 2ASYA 2FVQA 2PIIA 1Y00A 4LF5J 2K2PA 2D9PA 1YWXA 1K8AT 1Q79A 3F0NA 3OTDA 2MMYA 3TANA 4PG7A 3K5PA 1OSDA 4ZHRA 1DARA 1A6LA 4ED2A 4PUOA 1TVRA 3MOJB 3IA0A 3RRKA 4U6PA 2V50A 1RAJA 3AQOA 2ILYA 1HR0F 1LW0B 4K4TA 2GHVC 3MMAA 1NJZA 5KT3A 2DRAA 3HULA 3SEOA 4F0MA 2BA9A 2HHSA 3CCES 4JV2A 5B08A 4I2PB 3WQPA 1RABB 4R0EA 3J81Y 2FHMA 2J0XA 2V2ZA 3PFEA 3OR1A 1CSJA 4LMZA 2BW2A 2D41A 4DV6J 1T9VA 5GAEU 4LFAF 5LOQA 2DK2A 2AQ4A 3OXFA 1JB0C 2H3EB 1AUSL 2EFNA 4FXVA 4H4OA 4ER8A 2DGTA 3KUHA 2UUAJ 4QWBA 3VZHA 1RTJA 2BXJA 4ENOA 1UA1A 1H73A 3M8SA 1IWAA 2WSEC 2FLNA 2V4QA 4ZVQB 2FGCA 1NM2A 1KS2A 4CLPA 1IBMF 4DXLA 1HWLA 4YY3J 3RBZA 2GIQA 3IWXA 3W9IA 2XEXA 1K0TA 2XY6A 1MMDA 1HPZA 4KV8B 2CXEA 4OI2A 1VBZA 1LXNA 4OJ1A 4DPYA 1H6KX 1FJGF 4K59A 3D1HA 1UEVA 4NLQA 4X64F 3KLHA 5J2MA 1IKWB 4HL9A 3D3BJ 1H2VZ 4NLOA 2NCKL 3LP0A 2VH7A 1WUUA 4OJ3A 1KHWA 4FYXB 2LYVA 3NAIA 5T7LA 1LEOA 3W64A 3WZ0A 1X4HA 1ZZFA 4AD6A 4B3RJ 3JSBA 5DS7A 2KT2A 1FRIA 3C15B 3IMQJ 2DGXA 2LEAA 2DYAA 4L3NA 1ZYQA 4CO5A 3TEGA 1FK9B 4ECXA 3D9BA 2UUCF 3NS6A 2ZJQQ 3QGPA 1U2FA 1Q8LA 3IG1A 2DHGA 1TK8A 3BYRA 1WG4A 2VPXB 4X4QA 5DG8A 3DRSB 4DR6J 3BB5A 3MD3A 1SC1B 4R25A 4HT5A 2BACA 3CCTA 3DOKA 3PW5A 3IM9A 3DGVA 5KT4A 1H98A 3V6DB 4BHQA 5GAGI 1LQ9A 3CO0P 3KDNA 2CPJA 2OPQA 1WC0A 2AV5A 4CNYA 2CYYA 4IUFA 4LF7F 3Q89A 4PAAA 3NMAA 3A4TA 1QVGR 4RW7B 2MKSA 2OI2A 5B09A 2F8HA 1G3OA 1T9XA 3V81B 5IQQA 3RAXA 3W62A 4DHVA 3KHGA 5HVFA 4MMOA 5KFAA 4YB7A 2MLXA 2F4VJ 2VFRA 3D5MA 4CLYA 1QVFR 1HL6A 1DTQA 4KHMA 2CPYA 3KDOA 3T5HA 3A8EA 5ETTA 4R8UB 3V4IA 2YNGA 1QUVA 1R8PA 3GSDA 2R2TA 1T11A 4ZCMA 3UDVA 4ED3A 2CQ2A 1FDAA 5HLFB 2OTLS 3LGHA 2PFDA 1RHRB 4GVBA 4A8QA 3J7Z5 3MTKA 1IJEB 4PWDB 2XI3A 1FHTA 2VJUA 1UVJA 1D09B 3UDEA 2KFYA 1U1OA 1HW8A 4B9MA 2N4DA 4FXWA 2NLWA 4OYBA 3H2UB 2YKNA 1NB7A 3C6UA 4ZPBA 2CJYB 2J6SA 3V5RA 1CJVB 2DNQA 1D8ZA 3Q8QB 2IYIA 3GYNA 1OY9A 3OL6A 2VOOA 5LSOA 3D4JA 4MIAA 3H5SA 2FY1A 2YWEA 2IVFB 1EX8A 4M5HA 2ZH1A 2O1PA 2HLUA 4OMFG 1HBNB 3PR4A 1BLUA 5KT7A 2R9LA 5DJBA 3T5KA 3ZC4A 4JB8B 1NDCA 3WC0A 3K7RA 5E3AA 5C24B 2VFSA 3AODA 3IR6B 1UJ6A 2KDOA 3HI9A 4JI5J 1RLDA 3CIZA 3Q8RB 4QBUA 3RB3A 4AUKA 4TYBA 2R7RA 2YX1A 3ENQA 3T19A 3I82A 2V94A 2G1DA 2OD6A 3D28A 2RT3A 4HR2A 4TQRA 5K9FA 2W7PA 3OT9A 4HACA 1S1UA 1B0VA 3U7JA 3W2VA 3FVYA 1NJXA 2ZJPQ 1S10A 2XHWA 5HBMA 4F2SA 2WVEA 1FKAF 1MU2B 4RW9B 1FCAA 3EDRB 5LM7E 1N5SA 1KLMB 1U7LA 3P45B 4CLZA 1R6YA 1TKXA 2IRYA 2B7BB 1UCNA 1SKWA 2M0GB 1HMVA 1RYSA 5E0OA 2XNQA 3GIRA 2W4CA 1RTZA 2HHWA 1PBUA 4HTJA 4ZP9A 4KJIA 2AYGA 1ZM9A 3OXLA 5FIIA 1ZM3A 2QLJB 5SZTA 3Q86A 1RT1B 1GXTA 3NOCA 2X7IA 4X4SA 4N41A 1OIAA 2J76E 2X3GA 2ZH2A 1SV5A 4H4MA 3KMSA 4M1KA 5A0YA 3CDWA 2IJFA 1F1BB 3HCXA 1SJQA 1HNVB 1X4EA 4ZHRB 1F3FA 1YBAA 2FJWA 1TVRB 5GAGU 3DHXA 3OPKA 1S1VB 2HW3A 3CMES 2G4BA 2WRMA 4HDGA 1TL4A 4LIWA 2FVPA 3O6QA 2XBPA 1IUJA 1RT6A 4LSNA 1TTHB 1EJ7L 1HKAA 4LF4F 1UVLA 2EKNA 4TU9A 4HDHA 4ZMMA 2MHEA 4WE1A 4N47A 5IT9U 1Q1KA 4M5JA 3K8WA 3FQKA 3VWSA 1V3SA 5D0HA 3FBFA 4MKVA 1LW2A 5D4LA 4CH7A 3HHKA 1TAUA 2DY9A 2NXJA 5K8NA 4DSIA 4KB7A 4X4NA 5HROB 1KC8T 4KGVB 3M9OB 1FD8A 2BUNA 1QAIA 2XZTB 1XWLA 1KFSA 3HZGA 2XG8A 2DITA 2YX7A 4MK9A 3TQEA 2UUTA 4ETZA 4F04B 1VJWA 4CO4A 1J27A 3CC7S 3GIJA 5LMNF 2I5JA 1GMWD 3VAIA 3HSDA 1R89A 4NXMF 1U1PA 3PNIA 5T7LB 4OLOA 4ICLB 4USJC 1AZSA 2BMBA 3OTEA 1W26A 1BY9A 2ZE2A 1NNDA 3GV8B 3VAFA 1XNRJ 2BRLA 4GKJF 3DOLA 2W2QP 1N34F 4NCAA 1YK9A 3V6HA 1TELA 1Z2ZA 2KZZA 4LT6A 1YRUA 5B0EA 1LFPA 4K0KF 1BQNB 2AWZA 3JSRA 5BR8F 2H54B 1TUWA 1YJWS 2VASA 3L4BC 3V2UC 5HQLA 5F8NA 3IG1B 1FE4A 2HS3A 3W7BA 3LAKA 3A8KA 2LQ5A 4KT0C 2LU1A 4WFNQ 3OFGA 3RUBL 4UOFA 3OLAA 4LF5F 3MCMA 5AJ3J 4Q8EA 3F44A 2EFQA 4WZMA 1NO8A 4ED1A 3EWGA 4GC6A 1HNIB 1NSPA 4B9SA 2B8PA 4I2QA 1RWUA 1JLAA 2HVDA 3T3FA 4U95A 5ITHA 4ZJLA 1WELA 3QGIA 1TU0B 4MFBA 2VA2A 2FPHX 5KFOA 1BWEA 3NBPA 4UOGA 2Q3PA 1L5UA 3I5BA 4WXOA 3MAAA 4NLSA 4ZVTB 1FJCA 1PJ6A 3MECA 1MSWD 4EK2A 4QU7A 3HJFA 2YNGB 4C8YA 1UVNA 4YN3B 4OHVA 1NZ8A 4NLUA 4J9UE 1SL2A 3TJAA 4KHPJ 4ZN3A 2PSZA 2QYGA 1TK5A 4GVBB 1XR7A 3MURP 4EBDA 1VDHA 4DQQA 1IBKF 2DR5A 4JI1J 3PX6A 2GHPA 4IO9Q 1R0AB 2DRDA 1GT8A 4ELTA 4NWBA 1X0PA 5M2UA 4M94A 1PC4A 2YKNB 3C6UB 4J5OA 1TQLA 1YQHA 4DUZJ 3RBEA 4WZQA 1ZPVA 2KN4A 4L74A 3PV8A 4NA2A 5A8RA 1RBAA 4JI4J 2J9DE 2B6AA 3FCHA 1N5QA 4IKAA 4HVZA 2W4PA 2Y3YA 2YQ1A 2ZBRA 3QWUA 1HI0P 5F3ZA 3QRRA 4B08A 2CQHA 3SSSA 2CQ3A 5F0UA 1CEZA 3UD3P 2H5JB 3T6JA 4YHHJ 1FEEA 1FX4A 3DI6A 1S7IA 4CT8A 1VYAA 2KT5A 3B4DA 2BJ1A 2R4FA 3Q23A 2AHOB 3DHWC 1SPBP 4IG0A 2BEFA 5KG1A 5DRKA 2B4PA 2EBGA 2OMOA 4N77A 5HO4A 3ICLA 5KFWA 4HACB 1S1UB 2E5HA 4QWAA 4NCGA 3W2VB 5CA5A 1F9HA 2YWHA 1ZA1B 4DR6F 3SV4A 2F8MA 2HYIB 1HBMA 5HBMB 3SSQA 5DG7A 1IM4A 2CQ0A 3CD0A 1RKIA 1T3NA 2IMWP 3PYGA 4NA3A 2V69A 2ASJA 3GONA 1HMVB 1NSAA 4M95A 1U02A 1K1QA 1FERA 3DNCA 2PA8D 3GJRB 2O66A 1T95A 4PQUA 3SMZA 2I6WA 2RB7A 3PHTA 1JKHA 2JOQA 3Q8SB 2IAJA 1CLFA 2CPXA 3HP6A 4YP3A 1PSDA 1SV5B 5A0YB 3QAUA 4JBCA 5KFMA 4J9SA 4EZ6A 5F8MA 4OYAA 2BZ2A 1NJWA 1CQNA 2DGOA 4ZIVA 3VAHA 4F4KA 3M6XA 3TZZA 2V9WA 2J9DA 3H2LA 3W3SA 3ZXWA 2IVMA 2PDAA 1R0CB 1Q82T 4LFCF 3PRDA 2LFVA 3OSPA 1TKZB 2GAHC 5AE1A 2DNLA 2B9XA 4ILLA 4ZOSA 5D6GA 4WTYA 4RNNA 1RT3A 2YQ0A 5J2QB 1B99A 5D3GA 3BF4A 1RT6B 2CKWA 2RHQB 4JI6F 5LJ5Y 2KB2A 4LSNB 3OR2A 5DLGA 4CWBA 3O5TB 2AJ1A 3AH6A 5E2QA 3JSMB 2MYFA 3CXCR 1RDRA 1TAQA 2CPEA 5D4PA 4F36A 3BO4A 3KG0A 4NYOA 3ENAA 4DN0A 1RI7A 2B43A 1V3RA 1CS4A 1NDKA 3UCZP 1VHIA 2CADA 4NOHA 3F41A 3M1VA 1TL7A 1LW2B 4P75A 4P2XA 4AQYJ 4O23A 3PJXA 4ZK7M 2DCLA 2XLIA 1RQ0A 1S1XA 4OX7A 1WD6A 5A8WA 3KLEB 3K5MA 3L09A 4B02A 2YTCA 3Q8YA 1N88A 3BSAA 2E1AA 5LMUJ 5T41A 3TA1A 2DNYA 1NK6A 4F4XA 5B0GA 2A2CA 3IN5A 3Q8UA 3HHLA 4TNOA 2C2MB 3SSRA 4ED4A 2AZ1A 1Q7LB 2HZCA 2I5JB 4F3QA 1UWBA 2DR9A 4PWUA 3DLGA 3S7RA 4DEZA 2J0QD 1M90T 4QW8A 3T5LA 2UXCF 1EARA 2KG1A 3AHPA 4URQU 2G2OA 4QR1A 1KFDA 1BD6A 1UP1A 1OMSA 3EXYA 1MW7A 1GH8A 2KHDA 1SL1A 2RQCA 2C3OA 2KTQA 2QSFA 3GPAA 4O3NA 1MWQA 3P96A 4EYIB 3KLVA 1X31C 2KKHA 2FTRA 1SIZA 2C3MA 5F8LA 2GQ2A 3J80U 1QD1A 4HH0A 5IXUA 4GO5X 4ZCKA 2DT9A 4QPTA 3NL0A 4LRAA 3TWZA 3LTOA 4RZRA 5AXLA 3T1AA 1LK7A 3HHDA 2HNYA 4I2QB 3NNAA 3IM8A 1JLAB 2I9SA 3RAQA 2KFNA 3CMQA 4N8OA 1N32J 4ECWA 2RS8A 1AFJA 2XHCA 3TX8A 3CCUS 1T7PA 1X4AA 4LF8J 4DPWA 3H7HB 1HARA 2UUBF 3NBPB 1K1SA 3J7A1 3R3TA 3AB2B 2VC0A 1B70B 3ET6A 5I4MA 1FFWB 3MAAB 3QGHA 4K4UA 3QWPA 5H1SV 5DQHA 1FFGB 4GVLA 3I4PA 2N3OA 3BN4A 1ZAWA 3CCJS 1HWJA 2FLOA 1DAXA 3KUGA 3L7UA 3JYTA 2VG5A 4AL5A 3LQVA 1I1GA 2FUG9 5LXYA 1PCAA 5K20B 2OGUA 1U45A 3KK3A 1RCOB 4C0HA 2G1HA 4LFBF 2UZAA 5D0RA 1Y11A 5IT9Y 1SJ4P 1XJWB 6FDRA 3SYZA 3G2XA 1C4CA 5L9XA 1E6VA 3T9ZA 1XMOJ 2FVCA 5KT5A 1XEZA 1KDNA 3M05A 3VCDA 1BMQB 1SC6A 1FWLA 1HD0A 4IDKA 1R8AA 5A8RB 2R2RA 2MB0B 3W2WA 5MLCV 4ZP6A 2Y1JA 3PDNA 1MN7A 1KVJA 1TK0A 4DQPA 1N5YA 3NCRA 2EXUA 2X1FA 3DMJA 2ZHBA 4U67Q 3LH2S 1G2EA 3TUJC 1S4EA 4X4RA 1A9NB 5LT5A 4IFYA 2ACYA 2M88A 2IPOB 2QZ8A 1Q78A 1UWAA 1XMQJ 2K7KA 1IXKA 1S72S 4ITSA 3HFVA 4PG4A 3T1YJ 2BKPA 5MAOA 3GU0A 2DIVA 4GRSA 1XNRF 1OYEA 1NRKA 1GMWA 1NKBA 3MEEA 3UN5A 3MCSA 2XS5A 2ZOMA 2R8JA 4ZVRB 4LVOP 3CEDA 3JB9k 2BJ8A 4NEZA 5FJ4A 2FQQB 1HYSA 4Z7YA 2ROEA 4Z2XA 2E1CA 2HFZA 4NCGB 2ZH9A 2DGVA 4P9SA 4DR2J 3IBWA 1NDPA 3G6XA 1HBMB 1CBKA 2UVUA 2C3UA 4C8KA 3HFZB 3SCLE 1JLEB 5L8RC 4EFAC 3FRYA 1VS3A 2HRTA 3S6EA 4J9OA 3CCZA 2CFXA 4PCQA 3IFEA 5EWEA 5HN0A 1RA6A 2MGZB 1WACA 3RW6A 3WIUA 1ZA2B 1XNQJ 1UZHA 4DN9A 4YB1P 5CYJA 3H2VE 3MM8A 3DLBA 5A76A 3ENVA 1JKHB 2PI4A 2YKMA 2CJKA 1FDNA 1KQFB 5KFFA 2IM3A 1U1KA 3MD1A 3CJ3A 2CVEA 3CNQP 2NXNA 5CYQB 1RHQB 4M63A 3W61A 4WYLA 2DEIA 1F2HA 2ATCB 1RT4A 1RT5A 3ZZ0A 4JI1F 2ZUAA 2QLBB 3IP0A 2DVIA 2L48A 1KQSR 3RU0A 5D3GB 3HHNB 4F2RA 2CJQA 3GIKA 2ZH5A 1FXLA 2Z2LA 3PHEA 3OL7A 3OR2B 1UKUA 3CJ2A 3O3LA 1IN0A 4OHZA 4ZVPB 3SFUA 2QO3A 4UOHA 3MFHA 2B3TB 4DUZF 1UVMA 1DJ0A 2Y0SD 2AJ4A 3MR6A 2WZ1A 3LUYA 2I2YA 3E2EA 4JI4F 3A13A 4CNZA 1O0PA 2QEXS 3TJ8A 3V4MA 1U6FA 3ADAC 2GQQA 1CS4B 5G4DA 2KRBA 2IY5B 3N28A 3JQMA 1CJKA 4WIQA 1TL7B 4DSFA 3CJQA 3OVSA 1UETA 2AJ2A 3CCWA 3GP9A 1RLCL 1U1RA 1FTCA 2YQ3A 2C2DA 1S1XB 1B0TA 1XR6A 2KM8C 3G6VA 3AOAA 2UU9J 3QLHA 2DGQA 4YHHF 4P2MA 3NLCA 3MUTP 1FE0A 4DF8A 3W8GA 1SKUB 5E41A 3C8YA 3BBBA 2RDIA 3TZXA 2EBEA 1RKJA 2M4MA 3ZZYA 4TU8A 2BOPA 1KN6A 1E6YA 2EG1A 5F3TA 1PC5A 4MT1A 2OELA 3TYTA 4IH6A 4FKXA 3C6TA 4NRTA 2A18A 3IBFB 3ZNUA 1JJHA 4ZA1A 2E9RX 5K8PA 2Y9HA 1B3TA 3KWMA 2ZZMA 5C2GA 2NXEA 2W8LA 2LQ8A 4PXDA 3FNNA 4N5SA 2AT1B 2VF3A 1ELOA 3D66A 1Q4RA 2F7VA 2E9TA 2AYBA 2HNYB 2GS8A 3OD2A 3H25A 1YHQS 3TR5A 4A8XA 2Z57B 1T3OA 3VR1A 1BQXA 3L7OA 4HHUA 1GEHA 2YPYA 4WKYA 3M32A 3FFIA 5ETMA 1ZPWX 2B8QA 1Z4UA 3S8SA 1Y5LB 4X4VA 4RBUA 1RCXB 1HQ2A 2FLLA 2MKCA 1FRMA 3ET6B 4OYMA 3M2VA 4OZNA 4LQ3A 1GXUA 1N0UA 1A7GE 3ZZPA 2QLFB 3OQ2A 2R8GA 4KHRA 4B3MF 3VQSA 1KTVA 5DZ7A 1U2RA 4KPYA 3JYTB 1HBUA 1NB2A 2VG5B 1HLWA 5B0CA 3KK3B 3POTB 2UXDJ 4RNMA 4L3KA 4C8MA 2V2QA 1S1WA 5A8KA 3PW4A 3DFEA 3M8QB 3UWTA 1S48A 5CCLA 2JVRA 2CQIA 1RWKB 2GC8A 3VVTA 1FA0A 4LF6F 5KFPA 3QZ8A 1NJIT 5LMUF 5JVHQ 2RDDA 2XCAA 1HD1A 4A46A 4JOUA 2EW9A 4NYPA 1N5YB 3CCVS 2YXLA 4MTPA 1I94J 2XO7A 3Q8VA 3R5JB 4OZ5A 1ZM4A 3ITHB 5KOWA 4DPOA 3TUZC 4WK1A 3I55S 2R7XA 2VG7A 4LBHA 5SUHA 4RO0A 4JI7F 4ED7A 2HFUA 2AGOA 2QV6A 3H5UA 3MEEB 3W5XA 2BV3A 2GAGC 5GMEA 3K5NA 3AJDA 2MZQA 3QSIA 4YB6A 2I1RA 1R6VA 1G4CA 2VOPA 4C6AA 4PWWA 3M8RA 3RBXA 3HZEA 4I69A 2R7WA 3TAPA 2MQQA 4X4PA 5HK4A 4N76A 2LDIA 1VC5A 1F5CA 1TL3A 4YDDB 3ISNC 3EGVA 3CVKA 3PKMA 2IIHA 2HVZA 1FNMA 3HF5A 3KKFA 3CJ4A 4QJVA 2WVCA 1H38A 1AROP 4DV5J 3PW2A 1R3NA 3J80Y 1C0UA 4YQWA 2CQ4A 1N33J 2EFPA 2B5JB 2MKJA 4EBCA 1NPKA 1N32F 1F0XA 5KG3A 2UV8A 1XIQA 2F40A 4LF8F 3D0IE 2ZHAA 2ZBIA 3MM5A 4DQSA 2YKMB 4C8OA 2WTFA 1K47A 1O5JA 4BCAA 1YJRA 2H5EA 3T1HF 4E0DA 1XMBA 2IA0A 4NLVA 1JXLA 3TZYA 1S0MA 3ELHA 4CYUA 2XMMA 3Q2TC 3PVXA 1DQ9A 3H98A 1F2GA 4XDCA 2L9DA 2F3JA 3TJ9A 1Y9OA 3NS7B 4USHA 4X2BA 3W9HA 2M8DB 4RW8A 1RT5B 4DCJB 2OLWA 4ZPWR 4YFUA 2B9YA 2HHPA 1SKSA 2C2ZB 3Q2SC 4FYYB 4J9QA 3GMGA 2NSBA 1JLGB 3BO3A 2YKAA 4XTTA 2GHWA 5B0DA 3G8QA 5D77A 2RRNA 1MWZA 5DQIA 3EGZA 3ZZOA 1VRTA 4J9PA 2LEPA 3DYAB 1FVSA 2AX0A 1B4SA 4ZLNA 2DH9A 3R6LB 2KZMA 2DNKA 2HMIB 5B0AA 4D3GA 4IG3B 2ZOFA 1C1CA 3GJSB 1CJKB 1XERA 2NYIA 1N0VC 3UW1A 4X4TA 2Y8YA 4NLXA 4X65J 4DX8H 1Y5NB 2X51A 1B7FA 4B3OA 5G0RA 4QU6A 4ID8A 3HVAA 3QLHB 3GFYA 3T1YF 2WHOA 2F65A 3F73A 1SIWB 2XLKA 4CDIA 4IFVA 1CC7A 3LGMA 2CPHA 4NE9C 4KYZA 3IAS9 1YKWA 4DI6A 2ZOGA 3OTOJ 4K8RA 4DFMA 1RWOB 1O51A 3GFZA 2OPSB 1I3OB 1VIOA 2GGPA 4OZ1A 2G0IA 1AB8A 3D1OA 5I3UA 4ES3A 2KRRA 4I7FB 4Q43A 2NZ4A 4DR2F 4PG6A 1RP5A 2P5VA 4KFBA 4USMA 2ZDOA 5T14A 3C6TB 1CJUA 2XY5A 2XWXA 2GIFA 5GVQA 4F50A 1XC9A 5HJYA 1RK8A 2HRUA 2UXBF 4PPDA 1BE4A 4RKUC 1RAAB 3LPEA 3W65A 4FBTA 3CJ8A 1J5OB 2XMUA 1WKKA 2HFNA 5HATA 3D3CJ 3SV3A 3VAKA 2K8GA 1XNQF 1OY8A 3K57A 2ZHOA 2ZITA 3CO9A 4J9KA 8AT1B 4O4GB 4ZPTR 4P7TA 4HI1A 4S0MA 5K5MA 2J8AA 3TX0A 4USIA 4X4UA 1VQ5S 2CDQA 3OUYA 1HQEA 3W5YA 4RL1A 3RB4A 1PJ7A 2ASDA 2LDYA 3VAGA 1RHJB 1MWYA 3MPDA 5BYQA 2DXDA 4JI0J 1TMJA 2OSRA 2IMOA 3M32B 3FFIB 4HI2A 3H4DA 1IR2A 3CCQS 3AJ2A
chains in the Genus database with same CATH topology
1FD8A 2MY8A 2XZWA 3EPIA 2BUNA 2GJ2A 2XSJA 4ZCLA 1TZ0A 4O44A 4MH8A 1QAIA 2PGCA 4IRKA 2ZM6F 1XWLA 1KFSA 2ZE2B 2CJBA 3HZGA 2V2KA 2KXHA 6FD1A 4DSEA 2XG8A 1X4BA 2JRSA 1LV5A 1RTDB 2DITA 2AW0A 3DOLB 4N8NA 1ZTTA 1M5KC 4X84A 1SH0A 2V5HG 1YGYA 2YX7A 4BWJA 4MK9A 3GR1A 3PW7A 3M2VB 2E5IA 2J9CA 2MQNA 2RDJA 2UUTA 3QZ7A 4ETZA 5EWFA 4DF4A 1KNZA 1VJWA 4CO4A 2W24A 3CC7S 3GIJA 1SH2A 2JC1A 4OZ0A 5CCMA 5LMNF 3QIPB 2FVRA 5HROA 2I5JA 1K0VA 1S6PB 2UUWA 3VAIA 2WW8A 2HNZB 1R89A 4NXMF 4IQMA 3M6VA 1U1PA 4X65F 3CC4S 3PNIA 4FZVA 3EZUA 5T7LB 4OLOA 1YTYA 1S49A 4ICLB 4USJC 2YY3A 1HBUB 1VQLS 3DLHA 2B4VA 2IYGA 3UFCX 3OTEA 3CDAA 1UL3A 5AE3A 1Y3KA 4QIWD 3JTPA 5EX0A 3SZ2A 3CD6S 4KAIA 2R8HA 2AJ0A 1HNWF 2QA1A 1FJ7A 1BY9A 3M8PB 2ZE2A 1NNDA 2DO0A 5I3PA 3KLFB 5KG7A 3GV8B 3VAFA 2BRLA 4GKJF 2JLFA 2Z4PA 2CQ1A 3DOLA 1YRXA 2Z2MA 2M5YA 1N34F 1RT7B 4KBIA 2RF2A 2RKIB 3NCQA 5JVGQ 1X5TA 4WFYA 1S9GB 1NK5A 3S1TA 2VG6A 5F41A 4DFKA 4OX8A 2GA7A 2E9ZA 3V6HA 4TY9A 4F3MA 2HHQA 1Z2ZA 2KZZA 2C22A 3H4BA 4LT6A 1X4CA 1YRUA 4DSKA 1IKYB 3M6WA 4P2SA 5B0EA 3QIPA 2D9OA 1LFPA 1NK8A 2RRBA 2WOMB 3MEGB 4K0KF 5I42A 2G13A 1BQNB 2XMKA 2AWZA 2HNZA 2QLXA 3JSRA 5BR8F 1S77D 3HX9A 2YWFA 4BC7A 3IO1A 3FSXA 3NCPA 5A8KB 1Q86T 4ZS6A 1KTQA 4ICLA 4P7VA 4HLBA 5E3PA 1YJWS 1H3DA 2VASA 4DFPA 3V2UC 2DB1A 2UU9F 4B9VA 1JLCA 4FNIA 5F8NA 1Y4ZB 3IG1B 3K8VA 1L3KA 2L9WA 2FJXA 3JAMY 3B4MA 3OSNA 3I56S 3CJ0A 4ZKAA 1N6QB 1P6TA 3M8PA 4DR3F 2CQPA 4J9NA 2D74B 1G6BA 1JJ4A 1FE4A 2HS3A 2OAUA 1WHYA 3KLFA 2HHHF 1HHSA 3FQLA 3LAKA 1ZAXA 3W7BA 1D8YA 4OFZA 2BYCA 1TKDA 2LQ5A 3JTOA 4KT0C 4RUCA 2J0WA 2LU1A 2RKIA 4WYWA 4WFNQ 4MYTA 1S9GA 2GO8A 2ZFHA 3OFGA 3MR2A 3OLAA 4LUBA 4LF5F 2AD9A 5DDQC 4Q8EA 3N6NA 3F44A 5CH7B 4MFBB 5KFTA 2RS2A 3N5BA 2EFQA 4ID5B 4WZMA 1F9FA 4NPOA 4QOTA 1L3TA 2PD1A 1NO8A 2FIUA 1BQNA 4ED1A 1Y0HA 4GC6A 3I0RB 3LF0A 4K5RA 4C3KA 4OI0A 1DFDA 3BGRB 1HNIB 2JEIA 5HMZA 2KXFA 2HWTA 3BSCA 4B9SA 3NNHA 2R2SA 4UOCA 4EO6A 3UR0A 4XDDA 4I2QA 1RWUA 3MECB 1R31A 1JLAA 1FKPA 1XR5A 1N6QA 4NX9A 1FXRA 3T3FA 5KFCA 2M3DA 2I0XA 2L3MA 3DLEA 2KM8B