5EUHA

Crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
AATDALTGVANRRMLDQSLRHEWFRAQRSGKPLSLLMIDADHFKAFNDRHGHQAGDQALRELARVITTNVRRPADLVARYGGEEFSVILAETDSVGAQQIAEHIRAAVEQLSSVNEDQSPMTVSIGISTWTATSEISLEQLLFAADKALYQAKEGGRNRVVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative GGDEF domain membrane protein
publication title Contribution of Physical Interactions to Signaling Specificity between a Diguanylate Cyclase and Its Effector.
pubmed doi rcsb
source organism Pseudomonas fluorescens (strain pf0-1)
molecule tags Membrane protein
total genus 50
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5euhA00
4J9NA 5DG9A 2WCXA 1EETB 2YNGB 3LAKA 5DLGA 3FQLA 4K4XA 2YNHA 1T3NA 3RBDA 3PJXA 5DGAA 3MFHA 1FK9A 4H4OA 4RW6B 3NBPA 4I2QB 1YVFA 4RUCA 1TV6A 5F8HA 2AU0A 5F8JA 3KLGB 2HAIA 4LSNA 3OLBA 2W9CA 1RT2A 4NRTA 3DOKB 3MR6A 1QUVA 2C2EA 4IRDA 4RNHA 4MK7A 4DL3A 5KFPA 4Q45A 2DPIA 3HVTB 4KE5A 5KFGA 2ILYA 1SH0A 5F8IA 4ICLA 1JLGB 3MEGA 4MKAA 1S1VB 4ZVFA 4H4OB 1GX5A 3I0SB 4I2PB 3M8PA 4Q43A 4XO0A 3UR0A 4WFYA 3EZUA 4RW9B 4ED8A 4EBEA 2R8GA 2EC0A 3BQ1A 1TKXB 2JEJA 4NLGA 2JEIA 3PR5B 4F50A 2OPSA 2UVVA 5J2MA 5KT3A 3I0RA 1SV5B 4PQUA 4ZHRA 5KFEA 3QLHA 1R0AA 4YR0A 2IAJB 1S1UB 5KFHA 1S1TB 2AGOA 4PWDB 3BR9A 1VRUA 3LANA 3OHBA 3KK2A 4K4SA 1IKXA 2YKNA 4QWBA 4FS1A 2R2UA 4WE1A 4DEZA 5C42B 4ED3A 2OPSB 4WFZA 4TLRA 4JV1A 5J2MB 2XGQA 4RNOA 4J9LA 3I0RB 1HNVA 5DQHA 4ZHRB 1BQNA 3QLHB 4ZP7A 5KFKA 4X2BA 4ECVA 3IGVA 1RTIB 3TQ1A 3KMQA 1IKWB 3MR2A 3C6UA 4G1QB 4ZPBA 1N5YA 1D0EA 3PJWA 5KFYA 2OPRA 3GV7B 4TN2A 4MK9A 1CSJA 2D3UA 2HNYA 2HNZA 2YNFB 1LWFA 2JC1A 1RTJA 3EPIA 2C2RA 4KV8B 1JXLA 3QIPB 3KMSA 3QIDA 2ZKUA 4DL5A 4YQWA 1D1UA 1C1CA 2ASDA 3C6UB 3Q8SB 5L1IA 4G3IA 1N5YB 2FJVA 3IS9A 1KHWA 4I7FA 4ZP8A 3KLHB 5KG6A 2HNZB 5F8MA 1RT4B 4RW4B 1LWCA 1GX6A 2GC8A 4FBUA 4PUOB 4WYWA 5KT7A 3H5XA 4K4VA 1HQEA 3PHEA 4NCGA 3IG1B 5FDLB 1C1CB 3QGIA 4WYLA 4EO6A 1JLCA 4U6PA 5KFXA 4JUZA 3NGDA 3KHHA 2XC9A 4I7FB 4FS2A 5DG7A 5KT4A 3RAQA 4IR1A 2FVCA 1S10A 3G86A 1LWCB 4R8UA 2VG7B 5J1EA 1UWBA 3CJ0A 1TL1A 3T5LA 4ECQA 4J9SA 2UUTA 2ZE2B 3ITHB 4IG3A 2QV6A 1DLOA 3PW4A 1S48A 4O4GA 3M9MB 3G6XA 2IA6A 2R8KA 2V4RA 5T14A 1T03B 3OL9A 3V6KA 2UVWA 1JLCB 1C2PA 1TVRB 3LALA 5I42A 5CYMA 2B5JA 1IKYA 5EWEA 2OPQA 3GIMA 1LW0A 2RKIA 3LP1A 1S1WB 2UVUA 3BGRA 1XR5A 1TL1B 4J9KA 3OL7A 4RW8A 4F4ZA 4DL6A 1QAJA 5KFTA 2E9RX 4IG3B 1JLQB 3V4IA 1RT7B 3IN5A 4RW7A 3DDKA 1DLOB 3E01A 3GIKA 2W7OA 2AGQA 1S0NA 3DRPA 2ASLA 3C6TB 3MECB 2BR0A 3D28A 4KFBA 3BSCA 3DM2A 3IGNA 3N6MA 5C25A 5I42B 2B5JB 1IKYB 3GIIA 1DTQB 4ZPDA 2OPQB 5KG2A 5KFQA 1LW0B 5KFSA 2RKIB 3G6VA 4Q0BB 4DG1A 1EP4B 1RT6A 3OSNA 2WOMA 2ILZA 4RW8B 3MR3A 3BSNA 2FLPA 5KG0A 5KG4A 3KHRA 4WZQA 1C0UB 3QGGA 3DRPB 3M8QA 4Y34A 4K4ZA 3RBEA 4KFBB 4ECYA 3DM2B 4NLOA 1HPZA 3FFIA 5F9LA 1RYRA 3T5HA 2HMIB 2BRLA 4O3NA 1JLFA 4WFXA 4ECXA 3CJ4A 4KBIA 4O3RA 1HMVA 4IDKA 1RT6B 2R2SA 2OH2A 1S9GA 2WOMB 4URGA 4QWEA 3CVKA 1K1QA 2B6AA 2IM0A 2IMWP 1SH3A 3OSPA 3NMAA 1JLEA 3M8QB 5F8LA 5HP1A 3QYYA 1TKTB 1SH2A 5F9NA 1J5OA 3FFIB 4GC7A 4NZ0A 1JLBB 1JLFB 3DYAA 4NLDA 2WONA 3MF5A 3KJVB 2YKMA 3DLEA 1REVA 4YR3A 2YNHB 2B6AB 3ICLA 1FK9B 1JLEB 3SI8A 3HVWA 3M9NB 4NLWA 5EWGA 4ECWA 5HP1B 3NBPB 4YMEA 2HWIA 1TV6B 3H59A 5DQIA 1FKOA 1NHVA 5KFJA 2IM2A 4LSNB 4Y3CA 1JKHA 1RT2B 2W9CB 3RB3A 1S6QA 5HLFA 4IFYA 4ECZA 1C1BA 5EWFA 4O3SA 4RZRA 1REVB 5KFAA 2D41A 4ICLB 3MEGB 1NHUA 4QWCA 1JLAA 5KFFA 4QW9A 3M8PB 5L9XA 2W9AA 1RA7A 4ZP9A 2JC0A 3V6JA 5KT6A 4F4WA 3OLAA 4IFYB 3PW2A 2R8JA 3NAIA 2WK4A 4ZPAA 5KFMA 3GIJA 4NRUA 3KLIA 2FLNA 2IBKA 1KLMA 4ZVEA 4PQUB 1R0AB 4KHRA 4WZMA 2AGPA 3KLFA 1FKPA 4EBDA 3MFIA 5HROA 1VRUB 1IM4A 3KK2B 3N6LA 1IKXB 4NYZA 3CJ2A 4ZVGA 2YKNB 4IFVA 3T19A 3KK1A 4WE1B 3NKYA 1N6QA 3MR5A 4WXWA 4TYAA 5CYQA 2WHOA 3KLIB 5HBMA 3BJYA 1HNVB 1KLMB 1QE1A 1BQNB 2V0NA 3CIZA 3CJ5A 3OL6A 2C28A 5KT2A 2FJWA 3T1AA 3GV5B 2FVSA 4ZMMA 4QPXA 2VG6A 4O3PA 2OPRB 4IFVB 5KFUA 5KFNA 3KLVA 3KK1B 3V6DA 2HNYB 1N48A 1LWFB 1HARA 1RTJB 4NLVA 1N6QB 4ED7A 4J9MA 1T05A 5CYQB 5KFVA 4QW8A 1QE1B 1LWEA 4TY8A 1RTHA 3UQSA 3KNAA 4NLSA 2YNIA 3CDEA 3SFUA 2IC3A 2R2TA 4K4WA 4KAIA 4KHMA 5KFLA 4EEYA 2FVRA 3V6HA 1XR7A 2F8EX 4MFBA 2CKWA 3IS9B 3UDLA 3RB0A 2JEGA 3V6DB 2UUWA 4OL8A 2VG5A 1T05B 1SUQA 3DLGA 4IRKA 2AX0A 4MKBA 4IQXA 1LWEB 4NLRA 4TY8B 1HQEB 4WXOA 3H4DA 3KOAA 3BSOA 4NCGB 3H98A 3CO9A 3PZPA 4Q8FA 4ZP6A 2CJQA 4MFBB 5DLFA 3GQCA 2VG5B 2XWYA 4R8UB 3T5KA 2V4QA 2ZD1A 5J1EB 1UWBB 4IOBA 5C5JA 2GIQA 3MTKA 3BQ0A 5EDWA 2JLEA 4LQ9A 3Q8QB 4K4TA 3GYNA 2UVRA 4O4GB 1JIHA 3PR4A 1ZTTA 4NLTA 1HNIA 3H4BA 4NLUA 3KLEA 2QE5A 3CDWA 5CYMB 3CWJA 2FVPA 4URQU 3KHGA 3LP1B 2R8IA 5J2QA 3LP0A 1I6JA 3I5BA 3LAMA 3KK3A 3BGRB 4KSEB 1RAJA 1S0OA 3RB4A 2FJXA 4ID5A 4KO0A 3IRXA 3V4IB 3I5AA 4O44A 2FVQA 4RW7B 3E01B 4O4RA 4TQRA 3JSMA 1S97A 4TYBA 2C2DA 4B3OA 2WTFA 4YP3A 1S0MA 5J2NA 5C25B 5EUHA 4JV0A 3LP2A 2W8KA 5L1JA 1U09A 2R8HA 3BREA 4R0EA 4RU9A 4DG1B 2BANA 3LP0B 3MEEA 3H5UA 4NLXA 4U7CA 3G6YA 2E9ZA 4LSLA 4J9OA 3TVKA 2RDJA 4EO8A 4K4YA 3QO9A 1TL3A 3MEDA 1HQUA 5KFBA 3JSMB 3GV8B 2ATLA 4B3OB 2XI3A 1EETA 2YNGA 1HPZB 5J2NB 4RNMA 3BQ2A 4TQSA 3LP2B 4QWAA 3DRRA 5DGBA 5KG3A 1RDRA 4H54A 1HMVB 3MEEB 4IDKB 4TXSA 3M9OB 1S9GB 2D7SA 4KKOA 4Q44A 1DTTA 4LSLB 3KLGA 4F4YA 4ECRA 1WNEA 3RB6A 2I1RA 2IJFA 3QZ8A 5L1KA 3QO9B 3DOKA 2GIRA 3MEDB 5K14A 5D3GA 4LQ3A 5KFOA 4ECSA 1J5OB 3HVTA 3Q8PB 3HKWA 2XCAA 2I5JA 5KG1A 1MU2A 2R2RA 4ED2A 1JLGA 3NL0A 3DRRB 3DYAB 5KFCA 1S1VA 2WONB 4DL4A 2YKMB 2C22A 3I0SA 4I2PA 3BSAA 4KKOB 1OS5A 3VQSA 1DTTB 3E51A 3DLEB 4RW9A 1Z4UA 2J6UA 1TKXA 3PW7A 2E9TA 1NNDA 1S1XA 5K14B 5D3GB 3QGHA 2FLLA 1FKOB 4DL2A 1SV5A 4ECUA 4ED0A 2I5JB 3ISND 1MU2B 4MH8A 3Q8RB 1JKHB 2IAJA 1W25A 1S6QB 1S1UA 5HLFB 4DL7A 1C1BB 1S1TA 3SFGA 4Y2AA 3HVAA 4PWDA 3HHKA 1BQMA 4J9PA 1IKVA 3RAXA 1S1XB 4NLYA 4R5PA 2BQUA 2BQ3A 5C42A 1JLAB 2J6TA 4ZVHA 2OPPA 2V9WA 4RNNA 4JV2A 2DPJA 4IKAA 1RTIA 4IH5A 5J2PA 1S4FA 3EPGA 1IKWA 5KT5A 1BQMB 1JX4A 4G1QA 5KG5A 1IKVB 3TAMA 4URSA 4R5PB 2HNDA 2YNFA 1FKPB 5KFWA 3OHAA 3KLFB 3NAHA 4KV8A 5HROB 4F4XA 3V81A 3PVXA 1RTDA 1S6PA 2OPPB 3H40A 3QIPA 2ASJA 4IRCA 4FBTA 5KFIA 4EBCA 1TKZA 4IH7A 2AX1A 5J2PB 3FRZA 2XI2A 5HBMB 2VA2A 4RUAA 3TAMB 4EYHB 1RT1A 1TQLA 2HWHA 3KLHA 4HKQA 2HNDB 5KFDA 1C0TA 2WRMA 1RT4A 3CDUA 4RW4A 5JXSA 3I5CA 3V81B 5I3UA 4ECTA 2BQRA 3T5JA 1RTDB 4PUOA 1S6PB 2VG6B 3D5MA 5C24A 1TKZB 3IG1A 4TY9A 1N4LA 5FDLA 1K1SA 3PW0A 5KFZA 4Y2CA 1RTHB 1RT5A 2IM3A 2YNIB 1RT1B 4GC6A 4MIAA 3PW5A 1C0TB 2IC3B 2WB4A 4QWDA 1RA6A 2VG7A 4NLPA 1S9FA 5I3UB 3FQKA 3H5YA 2D3ZA 1S9EA 4MIBA 2ZE2A 3ITHA 4RNFA 5C24B 2ALZA 1RT3A 4IR9A 4K50A 4NLQA 3H2LA 1N56A 1T03A 1SUQB 3DLGB 3DMJA 1TVRA 2XCPA 4O3OA 1RT5B 1VRTA 4ED1A 4IG0A 3OL8A 1MMLA 3JYTA 3GILA 1S1WA 1TP7A 5L1LA 1HYSA 4XPCA 5F8GA 1S9EB 2BRKA 1JLQA 2RDIA 1RT7A 3FDSA 4J9RA 1RT3B 1LW2A 3CJ3A 1ZETA 2VA3A 3C6TA 3MECA 2ZD1B 2IJNA 3DMJB 3DLKA 3ISNC 2W9BA 3UPFA 3DI6A 1VRTB 2RF2A 4XPEA 1DTQA 3QZ7A 4IG0B 1KHVA 5DQGA 3JYTB 1HYSB 4Q0BA 1QAIA 1EP4A 4H4MA 5F8NA 2AQ4A 1HNIB 2O5DA 5DG8A 4YR2A 3KLEB 4ED6A 1RYSA 1C0UA 1LW2B 2XGPA 3H5SA 2J6SA 1T94A 3DRSA 5J2QB 4K4UA 3DLKB 3N6NA 3KK3B 1ZTWA 2W9BB 4J9QA 3FSIA 4ID5B 3DI6B 4KO0B 5JUMA 2RF2B 3IRXB 4EYIB 4O44B 4HYKA 1XR6A 2BE2A 2HMIA 4MK8A 1S49A 2JEFA 4ZPCA 2IM1A 3DOLA 4H4MB 2AWZA 2W8LA 4IH6A 2B43A 3KHLA 5KG7A 4RW6A 2BANB 3DRSB 4O3QA 1TKTA 4I2QA 5KFRA 4Q8EA 4M94A 2W7PA 1JLBA 4M95A 2BE2B 3KJVA 1TL3B 1HQUB 3DOLB 4KB7A
chains in the Genus database with same CATH superfamily
3FQLA 1T3NA 7FDRA 2AU0A 1YSJA 2C2EA 2B9YA 2QLBB 2RD5C 1M1GA 1U02A 5D0HA 1VQ5S 1S1VB 4H4OB 4C97A 1RHQB 2I2YA 2CYYA 4WFYA 1RAEB 2H5IB 4F3OA 3U7JA 2QLJB 3B4DA 4PG7A 1GTHA 2YKNA 2VASA 1TFWA 5F0WA 1H98A 5IM0A 4UOGA 1M0SA 4ECVA 2GS8A 4M5GA 1X4EA 3GCXP 4ZPBA 4FN5A 3FBCA 4CT8A 4CCHA 2POKA 5SZTA 4DV2J 1FTCA 1P27B 4KH1B 4WFAQ 1K44A 2DO4A 1VLOA 2MZSA 2BMBA 3MMCA 5HVGA 1REGX 1VQPS 2VPZB 3QGIA 3R3TA 4FS2A 4I7FB 2VDHA 1F1BB 5J1EA 4ECQA 1RWKB 4J9SA 1DLOA 3RR7A 4O4GA 3M9MB 4B3MF 1TVRB 4CLTA 5I42A 1IKYA 3TR5A 3E01A 3GIKA 2NXUA 1VISA 3DM2A 3OQ2A 3BPSP 2J8AA 1EP4B 2KHCA 2WVCA 5DO2A 1T9YA 4F7VA 1B0PA 4NLOA 3T5HA 2D3O1 4KGKA 2R2SA 2WOMB 4M5MA 2IMWP 3FCHA 5HP1A 2Q3PA 3AA9A 1S7HA 4IYQA 3BDEA 2BW7A 4ELUA 5EWGA 4GKJF 2VONA 2HWIA 1NHVA 1HBOA 3DLLQ 4B9TA 4ZVPB 4DPOA 4TU8A 2OAUA 2C2ZB 3A3OB 2HAFA 1RWPB 1N5VA 2V94A 4YDXA 4X64F 8RUCA 3OUYB 1R0AB 1B3TA 3PJ9A 2R7XA 4EBDA 2NZ4A 3DRYA 2DGQA 2KTQA 5D4PA 3QSYB 3D1QA 1S7IA 3TA2A 4NLVA 1A7GE 3EGNA 4C11B 1QE1B 1X9SA 4OYPA 4AL5A 3LWLA 4IQXA 2A6OA 5E7OB 1RCOB 1M5OC 3GJQB 1KSPA 2KFZA 3QSIA 5C5JA 1JB0C 4OLOA 1RI7A 2HQFA 3K8WA 3PR4A 3CD0A 1OSCA 5A2QY 4DV4F 3NNCA 1RAJA 3MAHA 3L9ZA 1HL6A 5C25B 2L9DA 3M30B 5L1JA 2IMOA 2BANA 2XWXA 2DO0A 3A8JA 4HEA9 4LVNP 3EUNA 2XI3A 3TZXA 4RNMA 1RDRA 3N4WA 4L3KA 1WNEA 1HBUB 5K14A 3MEDB 2WONB 4DL4A 4C4WA 2B4OA 2QIFA 3E51A 5HN0A 5K8MA 2CPYA 5HO4A 4ECUA 5GMEA 2WVBA 4UT4A 2LA6A 2OSRA 4OX9J 4DV0F 1JXVA 4Y2AA 2J8SA 3R6GB 1X4DA 2R7WA 3A4TA 4CLWA 2IYGA 2ZJQQ 3FZ2A 1RTIA 1NDLA 2NPIA 4HI2A 1SI9A 3R5CA 3AJ1A 3SXLA 1UFLA 3OVAA 3OHAA 3NGUA 3PVXA 1Y5LB 4IRCA 4EBCA 2DNHA 3PIOQ 5HATA 2XI2A 3PO5A 1KQKA 4RW4A 2ZZTA 3HZEA 4PUOA 5HVFA 1S6PB 3IRWP 3OXLA 3RRKA 3RW6A 3S8SA 4OI1A 2L9NA 5JJBA 4LMZA 4X4UA 1S0VA 4IR9A 1N56A 1TUVA 3E8OA 2HIYA 1FRLA 3ILLA 5F8GA 4PWUA 2NUHA 3QZ7A 4IG0B 3AQPA 2YH0A 2P9GA 5ETNA 2L3MA 3N6NA 5DZ7A 2RDDA 4O44B 4OHWA 2HMIA 1FFGB 3QJLA 1SVDA 3DRSB 3ILIA 2VOPA 2W7PA 3R5GA 2CPFA 2K1RA 4KB7A 3OLBA 4JI3F 2CQ3A 1EETB 2YNGB 4DUZJ 3RBDA 1Y0HA 4H4OA 3NBPA 3DN9A 3MM7A 1GMVA 3ZNJ1 3CO0P 1CJKB 5GAEU 2VBXA 2DH9A 3J7YI 2FUG9 2CJ9A 4XO0A 3UR0A 2JEIA 2AW0A 1SV5B 1PIEA 2JRSA 4FS1A 1TTHB 2V69A 1RABB 2DCLA 1PAEX 5A6WA 1CSJA 3HPOA 3EPIA 3ZZZA 1D09B 1IM6A 1ZM3A 2HVEA 1JJHA 4CO2A 1N5YB 2FJVA 4JV5J 4Q7AA 4JOUA 1KHWA 4I7FA 5KG6A 4RO0A 5B7WA 3CCVS 3NXZA 3AHPA 3B8HA 4P2XA 3IG1B 1MWQA 1WG4A 1WC5A 2F3JA 4A8FA 1SQEA 4NI2A 2B9WA 5KT4A 4F26A 3T5LA 4FYXB 4LF5J 4C8KA 4K5SA 4MMOA 4CZCA 4AQYJ 3MOZA 2Y0BB 5IV4A 3BS9A 1V5VA 2CPJA 5EWEA 4B9SA 1YRTA 1WF2A 4IG3B 2AGQA 1Y3KA 2G13A 4LSZB 2B5JB 2VZ9A 5ETSA 4OJGA 2A2CA 5F3TA 3EDQB 2WOMA 4M63A 5E33A 5F9LA 3U02A 3JQMA 4ECXA 2BX6A 3CJ4A 1YIJS 1R89A 1FJCA 1T9WA 2MQNA 1SL1A 2KXHA 1Y5NB 5D0GA 1JLEB 5A8RB 3M9NB 4YFUA 1HR0J 2QMUB 3OUYA 4ICLB 2MLXA 2W9AA 2BKOA 3W1YC 5GAEI 3Q2SC 1F9FA 4DQPA 3K58A 2IBKA 2GIFA 2VFSA 3UO0A 3MR7A 3PFEA 4C6AA 2VODA 2F65A 3FEXB 2M88A 3POTA 4C11A 1QE1A 2QJ3A 4QIGA 1NSAA 2GFFA 5GVQA 3EM1A 2VG6A 4NA1A 1LWFB 4ED7A 4J9MA 2VC0A 4QW8A 1AUSL 2YX1A 2N3OA 3SFUA 1XNRF 2QFJA 2HFUA 1T05B 2X1AA 4P7TA 2BW2A 3ZO7A 4YB6A 4K4TA 2AJQA 3Q8QB 3C46A 1ZZNA 4Q2MA 2Z2YB 2IYIA 7AT1B 2KVIA 2FVPA 3OR2B 4ZITA 2W7AA 5DDQC 3J80Y 2C2DA 5J1NA 4J9UE 2PC6A 3I32A 4FP9A 2W2PP 1HBUA 3MEDA 2ATLA 3F44A 3LP2B 1FNXH 4QWAA 4LF8F 2FC9A 2PFFB 1HMVB 3QJJA 1S9GB 3KLGA 4GKKJ 3PG9A 4USWA 4LQ3A 4CLFA 2PMHA 1XWLA 2MDAA 2GJIA 3GMGA 3D67A 2MQOA 2FJEB 3I4HX 4U7UK 1TKXA 5U47A 2B8QA 3ZZPA 5EX0A 4DR5F 4DUYF 2HFNA 5C2GA 3SFGA 4JYAF 4ZVQB 3KJFB 1IKWA 1X9WA 1JX4A 5D4LA 4KV8A 4LT6A 2C3UA 1S6PA 4FBTA 1AFIA 3NY0A 1LK5A 4FPRA 4HACB 3J81U 2OLWA 2LFVA 4HDGA 4QIVA 1H0HB 2DHAA 3TRGA 3KUGA 2ZC4A 1N4LA 3WX4A 1VQ6S 2CADA 2YNIB 2Q1LA 1PJ6A 3UNYA 4WJBA 3FCVA 4CTAB 1X9MA 1RT5B 4IG0A 2X1BA 3TJ8A 3MD3A 3I9ZA 1S1WA 3GILA 1GK8A 3GZ7A 1RP5A 3IA0A 1S9EB 2XNQA 4G1IA 2W24A 2B9XA 4XPEA 4Q0BA 1C0UA 3DRSA 4NXNJ 4K4UA 4C7QA 2RF2B 1Q82T 5LSOA 1XR6A 4MK8A 4YEAA 2B43A 2CNKB 1FERA 1U8SA 4DX5A 2KRBA 2KYZA 3MHYA 1CJKA 1CULA 2HG4A 3H2UB 4K4XA 1R0BG 3RBZA 1PILA 2EBEA 1KN6A 2FZGB 3AJ2A 1TK0A 1IVZA 5KFPA 4DX7A 4DQQA 2H9ZA 5F8IA 1JLGB 3MEGA 4A8KA 4PG5A 1GX5A 1FKAF 3RJMB 2PFDA 4PQUA 2FHJD 3R5JB 1KWMA 4DX6A 4PWDB 1IQZA 4DXLA 2J7WA 2BOAA 3CF5Q 2ATCB 3J81j 2OPSB 2IVFB 4A8SA 1OY9A 5H1SV 4DSEA 1ZH5A 1N5YA 2OELA 2DHXA 3W8PA 3Q8SB 2MJNA 4NA3A 2DKOB 2HRYA 5FDLB 4DQRA 2J0XA 2OHDA 4EO6A 2UVRA 2D74B 4E0DA 2V63A 4IG3A 1MN9A 1JLCB 2B5JA 3W60A 2LECA 2BA9A 2CZVC 3GG0A 4DL6A 4UY85 5L46A 3N5FA 4X4QA 4ZKAA 2B8PA 3H42A 5KG2A 2W4DA 1RACB 4WZQA 4BC7A 4NXMF 1X7VA 5DDPC 3HHEA 4Y34A 3BO4A 4O3NA 4L3NA 2EXUA 1AB8A 2C1EB 4URGA 2IIHA 3DNCA 3CUNA 1JLEA 5A8RA 4QBUA 1JLBB 2CQGA 2BDPA 2GAGC 5HI7A 2EFOA 2YNHB 3IWNC 4WK1A 3CJQA 4B3MJ 4ZVUB 3SCLE 5BJRA 4NPOA 2IDLA 1ICEB 2KYXA 2AYBA 5CZVA 2EBGA 3ENWA 3HT0A 3VVUA 2MKKA 2RHQB 1RK8A 4RUHA 4DV5F 4K2XA 4WE1B 3H25A 5E3AA 1R8PA 2YTCA 5HJXA 5KT2A 2BABA 2DVIA 3NNAA 1T05A 4GKJJ 4KHMA 5IT9Y 4NMLA 3IS9B 3DLHA 2EVZA 2RAQA 1HQEB 4DQSA 3H98A 4HLBA 2V4JB 2IHR1 2Z56B 4OZLA 3T5KA 4X64J 1U8WA 2N4DA 5KAKA 1IBCB 4MIWA 3RUBL 3CWJA 3G2XA 5J2QA 3KK3A 1TU0B 2B51A 1G3OA 4O4RA 1S6UA 1S97A 1Q8LA 3LP2A 2E9ZA 2CXEA 5KFBA 3MAAB 4CP5A 4EFAC 1TMMA 4HHJA 1UVNA 4ECRA 3KYLA 3HP6A 4X4SA 1H7XA 3I82A 5KFOA 2EFNA 2CQIA 3ZFVA 3OPKA 4P9SA 3HULA 1JK9B 2E9TA 3W2VB 1WJ9A 2HHHF 4USIA 2H1YA 2RQKA 4DV4J 1UVLA 1YJRA 4USMA 1M5KC 4ZDNA 2GQ2A 2M9KA 4HACA 1FEEA 1XMOF 2XBPA 1T0TV 4AE5A 4DFKA 3HT3A 1UJ6A 4CT9A 2F1FA 1U1LA 1UJ5A 5KFIA 3HD1A 1YBTA 3TZWA 1F5CA 4JI1F 2EK6A 2XMUA 3MPYA 4DLEA 4OHVA 1NJZA 4P2FA 1UPMB 2O3DA 3D5MA 1SQGA 2O01C 1VI7A 4B9MA 1K1SA 3PTWA 2IPOB 1RT5A 4K59A 4MIAA 2CQPA 1S9FA 2OO4A 3H5YA 1S9EA 5C24B 2ERRA 2ALZA 1O6XA 4DV0J 4C3LA 2KT3A 3DHWC 2G1HA 2FQQB 4XPCA 2QSWA 3MM8A 3A8KA 3TX8A 4IO9Q 2RF2A 3VZHA 3JYTB 1BWVA 5DG8A 1KBRA 1RYSA 2DGVA 2Y0SD 1ZTWA 4A48A 3DI6B 3OTCA 2KI2A 5K8NA 2RS2A 4DLGA 2Z57B 5I3QA 3VAKA 2DNQA 2XEXA 1QAYA 4Q8EA 1RLCL 2CQCA 2MKJA 1WC3A 2QFIA 2QN6B 4OIXA 3MPDA 5F8JA 2HAIA 3KUHA 4LF1A 2W9CA 3A8EA 2BVZA 1X60A 2E5JA 1U0HA 2BJEA 2NUUG 2A1BA 4N8OA 4UW2A 4EBEA 2H5EA 3KNGA 2OPSA 1U4BA 2G0JA 4YR0A 3I31A 1FNMA 2AGOA 4FYDA 1VOMA 4PAAA 3QRRA 1BQNA 1OIAA 1JQGA 2ZH6A 1RWUA 2R7QA 4G1QB 1TMJA 4JI3J 2NPFA 4CDIA 1NUEA 3KMSA 3HF5A 2ZKUA 2KM8B 3L3CA 2ZVIA 1TL7B 2UXCJ 1MMNA 1Q8KA 1RBLA 2G0CA 4LJMA 3BBCA 3CPWR 3RRGA 4NCGA 1IBMF 1RHJB 1JLCA 1DQ9A 5KFXA 4ZCIA 4M5LA 5DG7A 2MZTA 5T7LB 4NYOA 4UZBA 2NQPA 2RRBA 2QV6A 4ZJQA 3G6XA 1KLNA 3UN3A 2OIHA 5B0BA 4QU7A 1KD1T 3OL7A 1U1PA 3MECB 3NCPA 2G0IA 3TUZC 1DTQB 3GFHA 4MJKA 2OPQB 2X51A 3H7HB 1LKZA 1FXRA 3QGGA 1GXUA 3S1TA 3B82A 1HPZA 1RYRA 2MLYA 4O3RA 2OH2A 4IDKA 2JZ5A 3GFXA 4QYRA 1DQ8A 2O66A 2DIUA 2LXUA 3M8QB 1T11A 3IMQJ 4A46A 4TKTA 1OY6A 2KFYA 4LRBA 2ZDPA 3X1LB 1VYAA 1GT8A 3PCOB 1JKHA 3A8IA 1FWKA 1R27B 1REVB 2CZ9A 4ZPVR 1NHUA 5IV3A 4QW9A 1Q81T 1RA7A 4LUBA 1FE4A 4F4WA 2CPEA 5JMNA 4BC9A 3C16A 4FYWB 4I4BA 3UD3P 4N41A 4WXWA 2YQ0A 1NLKL 4U96A 1OQ6A 3CMQA 3AFGA 4OI3A 3M2UB 4K0KF 3PACA 2PDAA 1APSA 5CYQB 3L7PA 4K4WA 2WVFA 2CKWA 1QSSA 5J1PA 4OYZA 1OQ3A 4MFBB 4P52A 5EX3A 3GQCA 2GIQA 2HVDA 4LQ9A 5DRKA 1JIHA 4CLZA 2QE5A 2YWGA 4MKYA 3CD7A 3LAMA 1S0OA 2FJXA 2ZOFA 4HR2A 3MAAA 5A8WA 2CPXA 4OQJA 2W01A 2F8HA 2AT1B 3U1LA 3MUMP 1VBXA 4DHVA 5D6GA 3TA0A 3QT5A 1M5SA 4JI7F 2HHQA 4LFAF 4USKA 1RWXB 5B0GA 1N32F 1PSDA 2MHEA 4CQ1A 2XY5A 3W2VA 2AHOB 1U1KA 1J5OB 4C98A 2FGCA 1FDNA 2YKMB 2KG0A 1H73A 4DV1F 5A2QU 3T1YJ 3CULA 5IOLA 4CO5A 4UF4A 1V5IB 4Y2MA 3RTVA 2AD9A 4D3HA 2CQDA 4NLYA 5AJ3J 3ENAA 4KYZA 4WPAA 1HBMB 1N5SA 4HT7A 4LF9J 5HQ8A 2VFUA 5HBMB 4DV7F 4NWBA 3T5JA 1G2EA 5C24A 3MMAB 2MGZA 2L41A 5CD4A 1SJ3P 2BE9B 1HHSA 2M5YA 2MSSA 2MQQA 1R8HA 4X4TA 4P10A 4PWWA 4JYAJ 3JYTA 2RT3A 1FRKA 3VZIA 1JLQA 1ZETA 1OMSA 3C6TA 4Y6IA 3DI6A 4AYBD 1KFSA 4JI5J 3RBXA 2ROGA 4YR2A 2Y9HA 2FC8A 3W65A 3D2WA 2XYGB 3FSIA 1Y9OA 2MXYA 1S49A 4ID8A 1YHQS 2AWZA 4ZA1A 2JJ4D 4LR8A 5D4OA 1EIYB 3KJVA 1TL3B 1S0MA 3TQ1A 2V8HA 4LREA 1A0OB 3MM9B 1RAGB 1QTNB 2LXIA 2A3JA 2GVZB 2VU5A 3MMBA 2ZVSA 3UWTA 4P2SA 2XO7A 4ZVFA 4ANEA 4C0BA 1WHWA 4I6WA 2K8GA 3ELHA 3UVJA 4ANDA 2MQLA 4ZLLA 4UOHA 1WC0A 2CQ1A 3KK2A 3CC2S 4USUA 5D4NA 4UY8T 1PG5B 4RNOA 2EFVA 3ZTRA 4ZN3A 3MR2A 1WOOA 2NSCA 2JC1A 2C2RA 2LEPA 3M32B 2CZ4A 1HW9A 4P2MA 4DX8H 4C8ZA 2UUAF 5T7LA 4DS5A 2AJ4A 1UW4A 4TU9A 2VG7B 1UWBA 3SQOP 2AP6A 3KUEA 1R3NA 2RS8A 3FGVA 2WVDA 1NK6A 3M8WA 1C2PA 4A8YA 1SPBP 2OPQA 3LP1A 3WDOA 3BGRA 2GQQA 3IN5A 4YDDB 1Q8BA 1VQ9S 1OPIA 3OVBA 3G71S 3MEKA 3CJSA 3HZGA 4LFCF 3DRPB 3M8QA 2LVWA 3ET6A 2QA4G 4CLKA 1UL3A 5F8LA 2CPHA 2HHXA 3NCQA 4GC7A 2VOOA 2DGOA 1XQIA 3I96A 1REVA 1YI2S 3W62A 1FK9B 2CNLB 4A47A 4DJBA 4DS4A 1RT2B 2FZCB 5HLFA 4FXDA 2RMLA 3THTA 2QTWA 3MWBA 4QWCA 4B3SJ 5AE2A 5E5NA 2MKIA 4ZVSB 1XMQF 2D69A 4NXMJ 4KHRA 2HEKA 4WZMA 1YJWS 1FKPA 3AD7C 3HD2A 1VRUB 2HSEB 4ZVRB 2ZNZA 4DN0A 2DRAA 2R7VA 3UCZP 1CJUB 1N36F 4TYAA 5CYQA 1SJ4P 3PM9A 3HDSA 2WSFC 2FVSA 3NWGA 2HNYB 2Y1RI 3SYZA 2XTJP 4KRWA 1Q7LB 2Z2MA 5E2QA 2GZOA 1F0XA 4MFBA 5LOQA 3K7RA 1CG2A 2UUWA 1LNQA 3DLGA 3M6UA 3K5MA 3KOAA 3T6JA 5CHCB 1NHKL 1IR1A 2A10A 2CFXA 1MN7A 2M3DA 3GU0A 1BD6A 2XWYA 4R8UB 4PYDA 1G4CA 1RE1B 4DV5J 1U2CA 3KLEA 1TK5A 5CYMB 4URQU 3VCDA 4ID5A 5B0EA 1Q4RA 4YN3B 2BJ9A 1RBOB 1MG7A 3JTPA 5BYRA 4DPWA 1U09A 3O3LA 4RU9A 3IAM9 3H5UA 2KFNA 1U6FA 5B09A 3ULHA 2FPHX 3HHLD 1NB2A 4DR3F 3TQEA 1GAOA 2ZEJA 4QPTA 1YJTA 2OD4A 3BGOP 2EFGA 4JI4J 2H65B 4RR5A 2VV5A 4AUKA 4CNZA 3DLEB 3O6QA 4RW9A 3M2RA 2KXNB 4CI0B 1FKOB 5IS2A 3BV8A 4OYIA 1W25A 1DFDA 5HMZA 2E5GA 2R7OA 1FX4A 5DM7Q 3CIMA 2OI2A 4NCAA 4J91A 1HI1A 4IH5A 2JHEA 1TFYA 3RU0A 5KFWA 1P8GA 4F4XA 3BN7A 1O5JA 3MMAA 3IWXA 3WX8A 1SIWB 4EYHB 1TQLA 3KLHA 1B7YB 9ATCB 3MM5A 2HGMA 3GE9A 5M2PA 2J9DA 2NYHA 1XMBA 2RIJA 4CRJA 2EG1A 2UU9F 1C0TB 1RA6A 2X1GA 4RNFA 3ITHA 1F5AA 4I6YA 1JJ4A 3M7VA 1AROP 4O3OA 4ED5A 5EGYA 3FMBA 2XYPB 3FUYA 1LFPA 3ILJA 1ZS6A 4V1Ak 4A8XA 1HWKA 3DMJB 1N5TA 1SKUB 3HHNB 5DQGA 2B3TB 1HNIB 1U25A 4ED6A 2H4YB 5CQGA 4JI1J 4EYIB 3IRXB 5D15A 4NCBA 2WSCC 3QWUA 2E44A 2N82B 2DHGA 3MM9A 4IH6A 1Q5VA 1CQNA 1I51B 2JLFA 1RWOB 2HHVA 4LF2A 2MSTA 2NZCA 3VGTA 5F3ZA 1YVFA 5F8HA 1B4SA 4Q45A 3SCKE 5A76A 1UVIA 1SH0A 3I0SB 4UQTA 3LW5C 1MSWD 1KDNA 5K9FA 3OFGA 1UAWA 4HHHA 3W9HA 2XMKA 4ETXA 4O23A 4JV1A 1WSVA 2CDRB 3I0RB 2ZJPQ 4FVCA 3M32A 4ZP7A 5IC6B 5KFKA 3EYZA 3B4MA 1XNQJ 1FRXA 3GG1A 2J9CA 1Q0NA 2AMCB 3GR0A 3HI9A 1U26A 3I55S 2GGPB 1RHRB 1NK9A 3EZOA 4FNIA 1ULRA 5ETQA 1TAUA 1QM9A 1X4BA 2KT5A 2EC2A 2ZBCA 4U95A 4I1TA 2HS4A 1CC7A 4JUZA 2XC9A 1S76D 3KG0A 3OFFA 3ZTPA 1KEKA 3TZZA 3VGUA 1QUPA 2KL8A 3KJQB 2V9KA 5E3QA 3AD8C 1S0NA 3DRPA 1PGZA 1BE4A 2MZJA 3HJFA 2V8VA 3BSNA 4YOEA 5KG4A 2B0GA 4WFBQ 3CJKB 2LA4A 1LEOA 1WG1A 1CJTB 4W92B 2GX8A 5FIIA 2KRRA 9RUBA 3MM6A 4ZPWR 3CVKA 1FA0A 3PFOA 1JWWA 1JNRB 2IM0A 1SH3A 4M8LA 1IBMJ 4DR1F 4NLDA 1V3RA 3P5TL 1YJ7A 2JOQA 3LWMA 3J81Y 3HFZB 1L3TA 2LCWA 4C8NA 1KTVA 1S6QA 5D0RA 5CA5A 3K17A 4CO4A 2IDEA 3HX9A 4M1KA 5KFFA 4OJ3A 3M8PB 4OZNA 4XDCA 4DSLA 2JC0A 4CM2A 3M2VA 5KT6A 3ILOA 2R8JA 3VGVA 1IUJA 4C48A 3P3DA 1IM4A 1Q5YA 2JX2A 4B02A 5G0RA 1IBLF 1NK8A 2FB0A 2DEIA 2VFTA 1HNVB 3CIZA 1VC6A 4OI4A 3FCWA 1OO0B 1N48A 2ZZMA 4NLSA 2R2TA 2EWHA 4OL8A 2XQCA 1SUQA 3C15B 4IRKA 1U2FA 2BUNA 1WOPA 3IWLA 1U6ZA 3PZPA 3EGWB 1B70B 3BBFA 2KB2A 1VRQC 2V4QA 1QAXA 2HLTA 2QLFB 3GYNA 2J7UA 1ZPWX 3QAUA 3RB4A 1VBKA 4RW7B 2HBQB 4K0KJ 3SZ2A 2W8KA 2HW3A 1FJEB 5CYJA 5IT9U 1WG5A 2ZOGA 2DY9A 5J2NB 2RH3A 2B7CB 2MHNA 1H74A 3MEEB 3VR1A 1UCNA 1GXTA 3Q8PB 3EVWA 3DRRB 4UTGA 4P71A 1W7WA 1RKIA 3TARA 2CQ0A 1I94F 4MAKA 5D3GB 4I68A 2COLA 2FLLA 2V67A 1N0UA 1UVKA 2R3VA 2IAJA 3JQKA 1RB0A 1BXNA 1VLYA 1N34F 2BQUA 4TNOA 5B08A 2ADCA 3KXDA 3MCNA 4JV2A 1Q78A 2GHPA 1TL5A 1F9HA 4HHUA 2YNFA 2I9SA 4L76A 2OPPB 1KP6A 2GHWA 4YHHF 1VC5A 1N32J 1Y5IB 4RUAA 1TL4A 2P8IA 2HGNA 1C0TA 1RT4A 1YBAA 3D0HE 1RCXB 1VCTA 4DV1J 1RTHB 3LUYA 1ZZFA 1ELOA 1K0VA 4NLQA 3DMJA 4KT0C 5HVHA 3CCJS 2D9PA 3ZZRA 1P1TA 1T9UA 3FDSA 2IJNA 4A8MP 5LT5A 2HQCA 4H4KC 2FHJA 1LW2B 4X62J 1MLAA 2DITA 1RU2A 3RW7A 4OI0A 1WWHA 2NYIA 4N5SA 5F0UA 3FNNA 3BR8A 4O3QA 1TKTA 4QU6A 3NNHA 3BM7A 1HQUB 5DLGA 3C3LA 4Q2LA 1YQHA 2DNLA 4BS2A 3MAQA 1UPPA 1F6TA 4KR0B 4NX9A 3U27A 4DR2F 3LF0A 3DC2A 2X7IA 4NMXA 4U8YA 4RU2A 4I2PB 1UEKA 3ZXWA 2G1DA 4HVZA 5E41A 3R27A 4F50A 3I0RA 3JSBA 5KFHA 1S1TB 2OMOA 3AAWB 3LANA 3OHBA 4PG8A 2VQEF 3G87A 2YX7A 4QWBA 1MWYA 2V34A 2GGPA 4X2BA 3IGVA 3PJWA 3GV7B 3CTRA 3KG1A 3RAMA 1WC6A 1WEYA 2HFSA 4ZP8A 3CJTA 2YWKA 4RKUC 1HI0P 4I64A 2AEJA 2BZ2A 3SQGB 1UVMA 3PHEA 2GMJA 1C1CB 4FXVA 4IR1A 4N7TA 1N33J 2ZH4A 2CAJA 1PBAA 2UVWA 5C2CA 3FZBA 2Z8QA 3Q22A 4F4ZA 2PO4A 1RT7B 3KG4A 2BR0A 3IGNA 1CJTA 3GIIA 1AYEA 1HI8A 4ER8A 3PKYA 2RKIB 3DU6A 2F8MA 2RVJA 3GSDA 1T9XA 2ZKTA 4RW8B 3MR3A 3VALA 4ZVOB 4ECYA 2Y3YA 2DCUB 4DR6F 2VFRA 2GJFA 2XMJA 3TYTA 2VFVA 4KPCA 3BH7B 3CCSS 4EI2A 5I4MA 2YPYA 2CJKA 1BY9A 1WEXA 1YX2A 3DDNA 4ECZA 4K7QA 2QA4S 3MPWA 4E2FB 1JLAA 1WDDA 5L9XA 4B3TJ 2L08A 4LFCJ 3KLFA 3NG8A 4KGVB 1IKXB 4ZVGA 3J7AN 2HZVA 2Z0GA 3UDEA 2H48B 1HLWA 3B6BA 3NLCA 1UVJA 1FT8A 1SC1B 3AOAA 2VPXB 1YITS 3RB0A 1FRMA 3PXGa 1LWEB 3EVMA 3H4DA 1Q95G 2V8GA 2WZ1A 1UFKA 4OZ1A 3OR1B 2DNMA 2E5IA 2V2KA 2ZD1A 1XMQJ 4OZ3A 1WKLA 5EDWA 2K7JA 3TUIC 1RADB 3TOQA 1I6JA 3I5BA 3V4IB 2GMLA 1AZSA 4YP3A 5J2NA 2GW8A 2GMHA 2R8HA 3BREA 3VQTA 4DG1B 3MEEA 3R1LA 4K4YA 3JSMB 2DGUA 2G9OA 2GA7A 3JAMY 3DRRA 4ZS6A 4ZCMA 2CPDA 4U8VA 4F4YA 1XC9A 5ADZA 2I1RA 5L1KA 1NK5A 5D3GA 3Q2TC 2ASYA 1UA1A 3LPEA 4CNYA 4F0MA 3QRPA 3BZQA 2LLZA 5CD4H 3C8YA 4BHQA 1S1UA 1C1BB 3HVAA 3MCSA 2XSFA 4ZLJA 5C42A 2LU2A 2HBYB 2OPPA 4OZ2A 3LOUA 3VAIA 3DOMB 2BEFA 1RKJA 5HROB 1Q7YT 4FYVB 4DSJA 2O1PA 3V81B 1FRIA 5H9FJ 1YG0A 2J9EA 3CCWA 3BKTA 2QLXA 2MEWA 4F67A 3PW5A 4B08A 2HQDA 5I3UB 2AJFE 5BYQA 3W3SA 2XSJB 3SV4A 2AF6A 2XCPA 2GQCA 2BJ1A 2FLOA 1LW2A 3GFZA 3GYXB 3WIUA 3P5BP 1HWIA 2JDJA 2J6SA 5ETLA 1U48A 2N7YA 4LF4F 1RAIB 1UKUA 1Z2ZA 2W8LA 3QBCA 3KHLA 4DR4F 1OWXA 2LMIA 2UU9J 5DG9A 2MQ8A 3ZTSA 4PCQA 4IRDA 3ZTQA 1QUVA 4DL3A 5DZ6A 2DNPA 1FXDA 3HVTB 3HFVA 4OMFG 1BUXA 1N8RT 4PZVA 3U1NA 2EC0A 2RSQA 2YKPA 2ZHAA 2JEJA 3EWGA 3PR5B 3AB4B 1H2UX 5KT3A 4BDPA 3VAHA 4LF7F 3ZZ0A 4NEYA 5J2MB 3KMQA 2FHMA 1PAUB 1IJEB 3T1HJ 3P6YC 2OPRA 3P96A 2EKYA 2RHSB 3I9V9 3QIPB 3SQGA 2P9CA 2ZM6J 3UCUP 1CJVA 1C1CA 2ROEA 2RRNA 1WSRA 3EX7B 4FF2A 2U1AA 5F8MA 2B9EA 3T3FA 1D9DA 4WYLA 4OLPA 3EXCX 3CJ0A 4F04B 2PMZD 2R8KA 3OL9A 4QYZJ 1L5UA 3IBCB 1VQLS 1SC4B 2RKIA 4RW8A 1ZM2A 4DWIA 5KFTA 1X31C 5ETVA 1KR4A 5KFQA 1I5OB 1SJRA 3OSNA 4Z7CA 3AB2B 2RUGA 2XMAA 3BBBA 4WFXA 1F2HA 2J9DE 1GEHA 1ZM4A 3FFIB 4NZ0A 3M8RA 1D3WA 2EG2A 3DYAA 4HT5A 4DUTA 3TANA 5CH7B 4LIRA 2B6AB 1SKSA 3ICLA 3AXKA 1TV6B 2RJZA 4LSNB 4Y3CA 2P6SA 2ZUAA 1S59A 1NDCA 2HRTA 3ISZA 3GB0A 1K9MT 2KHDA 4NRUA 1WELA 5A8KA 3MFIA 4DPTA 3NWRA 4S0MA 4HTJA 4YB1P 2EK1A 2I6WA 1NO8A 2YWEA 4QPXA 3GPAA 3L09A 1RTJB 2D1CA 1LWEA 5BXIA 1N54B 1FXLA 2AEMA 2XG8A 2J0WA 3HHLB 1QSYA 2M7SA 4WXOA 2E7XA 5I3PA 2E7VA 2KJVA 2G2OA 1VC0A 3SDEB 3G96A 4UZCA 4FNHA 7FD1A 1PYSB 1IBLJ 1SIZA 2ZBQA 4KO0A 3W5ZA 1WI8A 4P75A 4A8WA 4TQRA 3JSMA 5LXRA 1XERA 2ZH1A 3GIRA 1ZAWA 2W4CA 5RUBA 2DBBA 2VF3A 5DGBA 2ZH5A 3RB6A 2RILA 4PG4A 4P72A 1FJGJ 2HS3A 2M4MA 1YTYA 3PX4A 1RISA 2NXNA 2KO1A 2ZFHA 1S1VA 2XB2D 4OZJA 1WTBA 2MKYA 2W25A 1NNDA 3M8YA 1O51A 1CVJA 1DAXA 3NMRA 4ED0A 1VIXA 2I5JB 5FLXU 1D9FA 3DOMA 5HMYA 3RAXA 4QR2A 3UD4P 2PA8D 3IC1A 5KT5A 1KS2A 1H2TZ 4WP9A 4ZJLA 3V81A 2HZCA 3PKMA 3GLJA 4YS2A 2PI4A 5JXSA 1IR0A 3I5CA 5I3UA 2W2MP 3CEDA 1Y4ZB 1FNOA 2C3PA 2XSJA 4V19J 1I94J 3NCRA 4CH1A 3U1MA 2IC3B 1WOSA 2WB4A 1P6TA 2PIIA 2XMTA 4IUFA 1TVRA 1KOHA 3RZAA 3VGSA 2NS1B 2GO9A 2HFVA 2VA3A 2E29A 2HQIA 1KHVA 2ACMA 4ETZA 1QAIA 1EP4A 5F8NA 1PO6A 3PYGA 3JTOA 1L3SA 1UP1A 3CCMS 4AT1B 2IBOA 4YHHJ 1NEEA 1B0VA 1B7FA 4EUVA 3S6EA 1KNZA 4LRFA 2BE2B 2WB1D 3PEJA 4DU8A 1EKRA 3RGIA 3PJXA 1UEUA 3HSZA 4I2QB 3SCJE 4PEOA 3M8ZA 2J7KA 2PA3A 3DOKB 4RNHA 3IR7B 4FZVA 2DPIA 1HKAA 5KFGA 2XZWA 2K3IA 5ETMA 1M5HA 2W1BA 2R8GA 1Y10A 4NLGA 1DHMA 4QIEA 2IVYA 1QVGR 5J2MA 3UN5A 1R0AA 4X4NA 1NKBA 2L9WA 3FSYA 1ZYQA 5IC4B 2QYCA 4LF6J 2ADBA 3VAJA 5HQLA 4J9LA 3CCTA 3FVYA 2XHWA 5ETKA 4JI8J 2FD2A 4WIIA 2D3UA 3MUTP 4IOAQ 1RWNB 3C6UB 1T9VA 4N8NA 4DR2J 3M1VB 1E6YB 1IN0A 1A6LA 4U6PA 3KHHA 1DRZA 1LWCB 3NGKA 2C2MB 4PXDA 2Q6BA 2ZE2B 2IA6A 1S48A 2PT0A 1T03B 4DSIA 2LYVA 1FDDA 2XM3A 3F56A 2E9RX 1FO1A 3D28A 2W2NP 5C25A 3M30A 3UN2A 3G6VA 1WF0A 4MT1A 4DPXA 3AD9C 2LQBA 3FMWA 4K2JA 5KG0A 1NK7A 4JI6J 4K4ZA 1VQSA 3TJAA 1AUDA 1YJVA 3FFIA 2GJ2A 2JWNA 2B6AA 3NMAA 2DR9A 3GYGA 3DHXA 1SH2A 3DGPB 2ZZNA 3PDNA 1JLFB 2WONA 3PYFA 2GNKA 3J7Z5 1QD1A 4YMEA 3HCXA 2CQHA 3MZIA 3SSRA 5CAAA 3RB3A 4USVA 2Q6CA 2FDNA 4F0KA 4F4AA 2M8DB 3TAPA 1HQ2A 3OLAA 2NREA 3J7A1 4I56A 2HQ3A 1CC8A 4NYZA 1WACA 2YKNB 1RHKB 4UOFA 1R0CB 3TZYA 1KLMB 2YKOA 5E0OA 4X66F 4QOTA 2OP5A 1VQ7S 4EWTA 4O3PA 1HARA 1N6QB 3HHLA 4MKVA 1BLUA 5DDRC 3KNAA 2FJAB 1KFDA 2LXFA 4CLSA 3P4UB 3SDEA 2DR5A 4TY8B 3D6FB 4DQIA 2ZJRQ 3H0PA 4Q8FA 4C0HA 2DEJA 5J1EB 2JLEA 4WU3A 3KFWX 3M6XA 1Q86T 4O4GB 2OUGA 2VBWA 3HO1A 2I0XA 2KVQE 1O8BA 4KSEB 4O44A 2C3OA 3E01B 2C2NA 2XY7A 4XK8C 1QY7A 2XS2A 3D68A 4HL9A 2HS0A 3TVKA 4KGZB 2E1MC 3R9LA 3FBBA 1EETA 2YNGA 5DJBA 2HZAA 2QRRA 3AA8A 4H54A 2D7SA 3H20A 3UW1A 2XY6A 2DHSA 1R8AA 2I5JA 3NL0A 3H90A 2AIRB 1WTFA 1NKEA 3HFKA 2Z58B 3GSIA 1SV5A 5ITHA 1HBOB 3SMZA 3NEKA 3SCIE 3HHKA 4J9PA 3OVSA 3EXYA 1S1XB 1EKSA 2BYCA 5K8OA 3LH2S 1WKJA 1S4FA 3CNQP 1IKVB 3K8VA 1V3SA 1VBYA 4B9VA 3P8BB 1KC8T 3THVA 3CW2C 1L3UA 4WCEQ 5KFDA 4Z7YA 1RTDB 2BQRA 3D1OA 1HBNB 3IG1A 3G8SA 4ZK7M 4Y2CA 1RT1B 4FF4A 2GHVC 3ZTOA 1XN9A 4K50A 2VC1A 2Q43A 2MJUA 4ED1A 4DFJA 1Q79A 3OJSA 3CJ3A 2CA9A 3IR5B 2VHGA 1X4CA 2MPUA 2G2YA 1R31A 3M05A 2AQ4A 2HPUA 1T94A 2ZITA 2BE2A 1UWAA 2IM1A 4AL6A 1M90T 3GFYA 4PXBA 5KG7A 2BANB 2RU3A 4I2QA 5KFRA 2DJWA 3B54A 3BB5A 1VMBA 5LL6d 3F0NA 3GWCA 1KOOA 4USHA 2G2ZA 2W2QP 1ZA2B 5B0AA 1SC3B 4Z2XA 3VAGA 2BJ3A 4ICLA 2DH7A 4RWWA 4KTQA 3H2VE 3AOCA 2UUBF 4R25A 4RL1A 1SCJB 3OV7A 5HQMA 3CD6S 5AXMA 3HVRA 1H3DA 4DR4J 2HQGA 1VQ8S 1RTIB 4UOCA 3T41A 4NXNF 3C6UA 1D0EA 1X0PA 1LWFA 1VHFA 1E6YA 3V2UC 3JB9k 4J9VA 1D1UA 1F3VA 4G3IA 3NOCA 2R7RA 4RW4B 1LWCA 4FBUA 4PUOB 4WYWA 2ZH9A 2DXDA 3NOGA 4DMZA 1OJ4A 4C9DA 4LF7J 3PW4A 2OMLA 1Q16B 2BXJA 3W8GA 3CXCR 3OR2A 4P73A 4Y0FA 2IRUA 4PABA 2B4UA 1ITPA 2DNGA 3EZ5A 3CDAA 5IQ6A 1QDUB 2PSZA 1RAHB 4CO0A 3RBEA 4HDHA 4PYAA 2YQ3A 3TI0A 5AXKA 2HMIB 1JLFA 1ZAXA 1HMVA 1S9GA 1WC4A 2RQMA 3BO2A 3VVTA 3LPYA 5HK4A 2K1RB 3Q24A 3HVWA 4ECWA 3NBPB 3H59A 1NU4A 3MM7B 5KFJA 3RG6A 4X4VA 2LQ5A 2NXEA 1NDPA 5B0CA 2HKEA 1NMEB 3P49B 3E3XA 1S57A 3OFEA 2GAHC 2DISA 1MROB 4IFYB 4UUWA 2WK4A 2FLNA 3G6ES 1KLMA 3D6MB 3M8SA 2DIVA 1LK7A 1FDBA 1X5OA 2BOPA 1N6QA 2EEYA 3N28A 2QL9B 3A12A 4WBFA 2CG8A 1LXJA 5K8PA 2C28A 1YWXA 4B3RF 3JQJA 2H3EB 1MNEA 5KFVA 2AKWB 2XYHB 4TY8A 2YNIA 3CDEA 4GRSA 1R8CA 3TP2A 4KQZA 2KZZA 3MPVA 3V6DB 5CZXA 4BBYA 4CTAA 4RBVA 1UW9A 3BSOA 5KOXA 2CJQA 5THWA 4NI2B 2VG5B 2CIMA 4IOBA 3GJSB 3MTKA 3AXMA 1AA1B 2UXBF 5HANA 3PY8A 1J5EF 3NP5A 3S7RA 1ZBTA 1S99A 2A2DA 2HBZB 5L9NA 4NOHA 2KN4A 2WW8A 5AXLA 2WTFA 1WF1A 4CYUB 1VR6A 4JV0A 3ZZTA 3C2PA 2RDJA 4B3OB 3W64A 2YWHA 4TQSA 2MQMA 2BKPA 3UDVA 1M1HA 4AXIA 5IFMA 2Q79A 2R9LA 2GIRA 4JP8A 5L39A 4BWMA 3HLUA 1JLGA 2WAQD 2KDOA 1OS5A 2YWFA 1S1XA 1TUGB 3ISND 4DL7A 4PWDA 3QQCD 2ZWOA 5LSRA 1H6KX 1IKVA 3BKFA 3CJ8A 4PKDB 1NPPA 3Q86A 2C42A 2PD1A 3Q23A 1M5VC 5H9EJ 4P7VA 2DGSA 1GXLA 5ETTA 4DCOB 4EK2A 4ENOA 3WC2A 4URSA 3JAMU 2CWKA 3NAHA 2OFGX 4USTA 2JL9A 1RTDA 4JBCA 1HBNA 1EHWA 1RJJA 1U1NA 1RWMB 3POTB 2CQ4A 3TAMB 1RT1A 4CLLA 3CDUA 2HIQA 1WUUA 3TUJC 2OTLS 2VG6B 3HHLC 2DR8A 3K0JA 1TKZB 2KKHA 5FDLA 2FIUA 3PW0A 2ZH2A 3IXQA 4ZOSA 2IM3A 1KTQA 4OV1A 4FPIA 4G6VB 2JFKA 2EFPA 5L8RC 2E1CA 1TP7A 2DK2A 3CSKA 4WWSA 4ITSA 3CJRA 1NPKA 1HNZF 4FKYA 3HSJA 3US5A 3SBMA 1HNXF 2IJRA 3Q8VA 1FI4A 1SKWA 4LFBF 1FX2A 4OJHA 2Y1JA 1FDAA 4HYKA 1NDKA 1SKRA 1NKCA 2ZHOA 2O67A 3J7YU 3V5RA 2BBEA 3DLBA 2QC3A 2Y1IA 1JLBA 1T95A 2CJYB 3LAKA 2YNHA 3EE3A 3TX0A 3KLGB 1IJFB 1HD0A 3MR6A 2M2BA 2X3GA 2FGOA 1WC1A 1LWXA 4F3MA 2ILYA 4MKAA 3MPUB 2FZKB 1T9TA 1TKXB 3AOBA 1SL0A 2A6MA 3N01A 5FD1A 3QJPA 2DHHA 4K8RA 3HMJG 1VQKS 3BF4A 1C4CA 4WE1A 5ETRA 4WFZA 4USJC 4WTOB 4OHZA 4ZHRB 3NRBA 1IKWB 3W7BA 1YDLA 4KV8B 1X5PA 3D7SB 3I87A 5D78A 1DBDA 4YQWA 3IS9A 3IFEA 3PRBA 1HQEA 2IRXA 3PIPQ 2V4JA 1NRKA 5D77A 1JMTA 1F3FA 1RHUB 2FVCA 4B9LA 3J7ZT 5HMWA 1F5BA 2ZUGA 3BH6B 1IBKF 2VB6A 1CS4B 1S1WB 2QLWA 3CC7S 2ZH7A 3CMAS 2U2FA 4Q0BB 2HK2A 4DZ6A 1C0UB 5ETPA 4DPUA 2SXLA 1GH8A 2W2OP 4KH0B 5LMUF 3GJTB 1XNRJ 1BGXT 3QRQA 2UXCF 5GAGU 2E5LF 2AYMA 2LQ9A 3MF5A 5GADU 1CULB 4CWBA 1NXIA 2CDQA 4MYTA 3IM8A 3BEGB 2XZDB 1MROA 4IFYA 2KG1A 4DZDA 4O3SA 1GMWD 5KFAA 3A3PB 3MEGB 1EB0A 3MXHP 1SQFA 1NM2A 2QA2A 3GIJA 4RWXA 4PQUB 4CH7A 2XLJA 4LIWA 3CJ2A 3AODA 3T19A 4GVBB 1YGYA 2WHOA 3KLIB 1NJYA 3WZ0A 2HBRB 4NA2A 3OL6A 2FJWA 3T1AA 2F4FA 1YRUA 4LF8J 4IFVB 3KK1B 3V6DA 2UV8G 1Q8IA 3BPDA 3UQSA 3OTDA 4KAIA 1U1RA 2VG5A 2E1PA 4NLRA 3N0VA 1NJWA 4ZP6A 4RPFA 4DR5J 4DUYJ 1FCAA 1OYEA 4ED4A 2XHCA 4KY3A 4NLTA 4DI6A 3H4BA 5MAOA 4CYUA 2AYEA 3TAQA 2ZH8A 1KVJA 2RUSA 4TLQA 3NS7B 2HLUA 2FVQA 3PYDA 4X66J 4OJ1A 4EU0A 4B3OA 2Y1LB 2ZBRA 3DXSX 5EUHA 3D66A 3LO3A 2R7UA 5H9EK 1GFWB 4YB5A 4QIFA 3BQ2A 1SBRA 1YKWA 1H72C 2IJFA 5A6PA 4WKYA 3HKWA 1IR2A 2LQJA 4F36A 2C2KB 2J6UA 5HL7Q 4FDFA 1EARA 3QT7A 5GAGI 5GADI 1V3ZA 1WORA 4F3QA 1K0TA 3R2CJ 4EZ6A 2BQ3A 1Y7PA 4ZVHA 2CNNB 2YH1A 4OX8A 3EPGA 1B64A 4G1QA 5KG5A 1RQ0A 3TAMA 2X3DA 1NPRA 1TKZA 1TL7A 1UJ4A 4LR9A 5J2PB 2WBRA 1W2BR 1UTAA 2F5GA 1NJIT 3QNWB 1XTZA 2WRMA 4G65A 5LM7E 4FKXA 2FY8A 4ECTA 3FEZA 2OTJS 5CABA 4TY9A 2EPIA 2JLGA 4DN9A 5IQQA 1F2GA 2YXLA 4QWDA 4L75A 4M5KA 1ZM9A 4MIBA 4CIOA 4DV6F 3T9NA 4DOZA 4LRDA 5F41A 3T1YF 3R5BA 4OYAA 4J9RA 2OGUA 2RDIA 3D0GE 1R8BA 3MECA 1RU1A 1FVSA 1DTQA 5AJ3F 3CCES 4OFZA 2DNNA 1HW8A 4C8MA 5J2QB 3DLKB 3KK3B 2VPWB 5JUMA 1D8YA 1VQMS 3CT9A 5KTQA 3TWZA 4LF9F 3O44A 3UD5A 3D1HA 4J9NA 1KVKA 2XLIA 2LP4A 4RW6B 3DXBA 4ELVA 2NXCA 1D8ZA 1HD1A 4HTIA 2KU7A 4PPZA 2D3OR 4W4MA 2WBMA 2MZRA 4XDDA 2LEBA 4QJVA 4J37A 1TAQA 2AJ2A 2FHKA 4ZHRA 5T41A 3W9JA 3GJRB 2IFXA 2RU9A 2VL1A 1FEHA 1MWZA 2R2UA 4DEZA 4JI5F 1U2RA 1UZHA 1RTZA 2MYFA 3AJDA 2RQ4A 1VBZA 1S6OA 3M2UA 2Z2ZA 2VIHA 3W63A 2Z4PA 2HVIA 4N77A 2VBZA 4DL5A 2ASDA 4JB8B 2JVRA 3VV2B 4Y00A 2MY7A 1GX6A 2QZ8A 2C3YA 4K4VA 4QIWD 3HHDA 2V50A 1CS4A 2QO3A 2UUBJ 2QL7B 3PX0A 1L3KA 3CGIA 1DZ5A 4NL5A 1UETA 1SJ1A 2OEKA 3GIMA 2M0GB 1TL1B 3MM8B 3Q0AA 2QG9B 2EI5A 4RBUA 3TW0A 2W7OA 5IXUA 1JJ2R 4H4KA 2KXFA 3QFWA 5KFSA 1TR0A 2ILZA 4BCAA 5FLXY 1X4HA 4N76A 1RGVA 3FEYB 3B78A 2MLZA 4CLPA 2RB7A 1RWWB 3QYYA 5F9NA 4P6QA 1J5OA 3MTJA 4ZCKA 1VK3A 2YKMA 1X4FA 1T7PA 2DGXA 5JVHQ 4PRFA 1PJ7A 1P9YA 2BJ7A 2DB1A 1T02A 2IM2A 4WP3A 4OX7A 2W9CB 2YX4A 3A1YG 1U0HB 3TO8A 1QJHA 1FFWB 4GVBA 4AFFA 3PW2A 1K73T 3KLIA 4ZVEA 1HBMA 3MUVP 3L95X 5LMNF 2AGPA 4IFVA 3KK1A 3NKYA 4GVLA 2K3KA 1FD2A 4ES3A 5LJ5Y 5HBMA 1BQNB 2AEFA 5GMDA 4M5DB 2F63A 3Q8YA 2G4BA 4K5RA 3NS5A 3M6VA 1MMDA 3V6HA 2F8EX 3UDLA 2HYIB 2J76E 4DF8A 4MKBA 1VDHA 3JTNA 4NCGB 3ENQA 2HHHJ 4L74A 4FVMA 4NYPA 3PHTA 2UP1A 1LQ9A 3BKUA 3CB4A 3Q8UA 3DLJA 1ZTTA 1KQSR 4B3SF 1VFJA 1U1QA 1AFJA 1XMOJ 4TYBA 4B3RJ 2HHUA 4YB7A 4U7CA 4ZLPA 2VDIA 6AT1B 3T9ZA 1TL3A 3M4XA 1HPZB 2DY1A 2IY5B 2V5HG 3HXMA 2E5HA 4IDKB 4TXSA 4Q44A 1NK0A 2GVZA 4F2SA 1GMUA 3QZ8A 4X84A 4PQAA 1NZAA 3F41A 2I8EA 2P9EA 4KKOB 2NXJA 2UXBJ 1N5QA 2YBVA 4A4JA 1RLDA 1J5EJ 4MH8A 1MU2B 1JKHB 3RRHA 2CJBA 2M8HA 1CEZA 3GONA 3UR3C 2CWXA 4WKRA 4QR1A 2HHWA 4RNNA 2VQFF 2DPJA 4WF9Q 4ILMA 5J2PA 2RQCA 3C16B 4EMDA 5FJ4A 4U7UD 3G8QA 4PXEA 2ASJA 4IH7A 3FRZA 4UUXA 2VA2A 1U1MA 2Z2LA 3R1HA 2HRUA 1Z2LA 1WHVA 2L48A 4DFPA 4JI4F 2BM1A 4ILRA 3OJUA 2VG7A 2YY3A 3S01A 1YLXA 4QQBA 3QWPA 1R6VA 3R5DA 4KPYA 3OXFA 4LRCA 3C14B 1AW0A 2BRKA 1GTEA 4BLGA 1YJNS 3DLKA 3UPFA 3W5XA 5C7PA 2Y8WA 2ALYB 2O5DA 2DD8S 1NCLA 3GCWP 4WFNQ 3BGUA 4WK3A 3R7BB 3G82B 5A8WB 1WHXA 4RW6A 3QGPA 1U7LA 3EGVA 3FBEA 4GO7X 3AT1B 4BWJA 2FHOB 3DOLB 2WCXA 3FSXA 3MFHA 1FK9A 1HA1A 3W2WB 4W90B 5LJ3Y 4EGLA 3SSSA 4ERDA 1RT2A 1VS3A 4KE5A 3UCGA 2D9OA 4Q43A 2J0SD 5E3CA 1HNZJ 3WHIA 1HNXJ 2UVVA 5KFEA 3CDBA 4LFBJ 5D8HB 1VRUA 3OTEA 4K4SA 5L38A 1C4AA 1UFWA 2MQPA 5BR8F 4ED3A 1CJUA 2XGQA 1KKHA 2ZBIA 1DQAA 3R97A 4V19X 3JS9A 1PCAA 4JI0F 2HNYA 5EHHA 2APOA 2KM8C 2DYAA 3D54A 1Q1KA 3QIDA 4OZ0A 1K47A 4OI2A 2MGZB 3EVOA 3NGDA 3KKFA 6FDRA 3RAQA 4R8UA 1TL1A 2YKQA 2UUTA 3PEHA 1ZAVA 3V4MA 2HVHA 5CYMA 3D3BJ 1BMQB 1JLQB 3DDKA 2XZTB 1WKKA 3C6TB 4EZ9A 4RX6A 4ZPDA 1Y3JA 2QA1A 4KHPF 4F2RA 2F4VF 3KHRA 3MURP 4C0OC 4KFBB 1XNQF 2AJ0A 4IOCQ 2HGLA 4YUDA 1S4EA 2AYGA 4TVAB 1VK8A 4A8QA 3ETMA 3KJVB 3DDIA 1JJCB 1U45A 3DLEA 3R8YA 1IBKJ 4C2MA 3X3UA 1FKOA 3MMBB 4DV3F 2D41A 5IWAF 2ZDOA 4C8YA 4ZJOA 1R6YA 3BYRA 3UVJB 5KFMA 3ZZYA 1XEZA 3D6TB 3KK2B 3N6LA 4M5DA 3P45B 2XMWA 1HWLA 3MR5A 1S77D 5LMUJ 1X4AA 2V0NA 4JI7J 1CPZA 2N4CA 4LFAJ 2E5LJ 3LGHA 5KFNA 2OFHX 4M5NA 1NJXA 1FRJA 1W26A 4XTTA 4XAKA 3K5OA 1VGYA 4ZPTR 2Y8YA 1ZOTA 1DURA 4IQMA 3IBWA 3CO9A 1EQMA 4M5IA 5DLFA 2BJDA 1D9AA 3EJMA 1UWBB 3JSRA 4ATNA 4NE9C 1WD6A 1HNIA 2BV3A 4OI6A 3LP1B 3QATA 3BGRB 3IRXA 3I5AA 4Y2IA 2B56A 3CCQS 3G6YA 3RYLA 2CVEA 2ZC3A 1SL2A 4DV7J 2CJXB 3TJ9A 3GV8B 1DY3A 3VTIA 3ET6B 2VD3A 4KKOA 3I4PA 4LSLB 2DR6A 1GQEA 2KZMA 1FE0A 3OXGA 1MU2A 2MZ1A 5KFCA 3I0SA 4DPYA 1VQYA 3PRVA 1N0VC 5CXTA 2CNOB 3Q8RB 4L6V3 2BKNA 5HLFB 2OD6A 3Q89A 2CQ2A 3K57A 2XMVA 1EQ0A 1YK9A 4OYOA 5AE3A 1E6VB 1PKUA 1FWLA 4ZN1A 1FKPB 4ANCA 1NAQA 3BO3A 4JI2F 5BYSA 4HH1A 4Q5VA 3K59A 2UXDF 3D4JA 5SUHA 4C3KA 4X4RA 1S5ZA 4FYYB 2D3ZA 1UMJA 3C14A 2OKQA 1G1XA 3DLGB 2ZHBA 2HWTA 2HFZA 1HHQA 3W66A 3DKDA 2F7VA 1RT3B 3F73A 1PBUA 3LTOA 3AQOA 2UUCF 1YJUA 3G82A 2J0QD 6FD1A 1HYSB 2P6TA 2LDIA 3KLEB 3H5SA 3CJKA 2LQ8A 3GP9A 3VAMA 1FJ7A 4ID5B 1PJ5A 2HFOA 4PG6A 3HKZD 2JEFA 4B9NA 3DOLA 4H4MB 4DR7F 4PPDA 4CLYA 2C3MA 3K89A 2DGTA 1FD8A 3CCLS 1EZZB 3W2WA 3IBFB 3CCZA 2V2ZA 4M5HA 1AXQA 2UUAJ 3OBIA 3SEOA 4DV6J 2Z30B 3BN4A 4OX6A 1HFEL 4DCPB 3MCMA 1CLFA 4MK7A 3LGMA 1RZMA 3M8PA 1Y00A 4ED8A 4RW9B 3M2RB 5DS7A 3RR8A 3HSGA 5K5MA 4CO3A 2K06A 1HNVA 1VIOA 1CBKA 3R7NB 3H8YA 2NSBA 4X62F 1NSQA 2KH9A 4TN2A 4MK9A 1VHIA 4N47A 5E3RA 4ZIWA 4KC5A 1JXLA 1CQMA 4ZIVA 3HJVA 2QL5B 2WVEA 5JVGQ 4NASA 2DH8A 3CCRS 3KLHB 2HNZB 1G6BA 3K5NA 3C15A 5KT7A 2RE1A 5KOWA 4ES2A 3MM5B 1UZDA 3TVYA 1QLNA 2AV5A 4RJVA 3G86A 5HSPA 3WIVA 3ITHB 1FF2A 5T14A 3V6KA 2DXEA 4ZCLA 3L4BC 2UVUA 2MTLA 1XR5A 1QAJA 1PYOB 4RW7A 4YY3F 2ASLA 4KFBA 4OYXA 2GVDB 1TZ0A 3QT6A 1N36J 1PC4A 4FF3A 2ROPA 3AH6A 5IT0A 4DFMA 4RLEA 4X65F 5CCLA 3OFHA 1RT6B 1MW7A 4QWEA 1K1QA 2B4PA 4NZ7A 8AT1B 1FVQA 5HMXA 2PGCA 3D3CJ 4YR3A 1WI6A 3SI8A 2EW9A 4QCLA 1NBEB 2DRDA 1NZ8A 1BHNA 3BDPA 1N33F 4OHYA 3TA1A 1FRHA 3WQPA 1O0PA 3W9IA 3V6JA 3SSQA 4ZPAA 3OTOF 3PV8A 2VPYB 3DGVA 2DNZA 2ZWPA 3KWMA 4G1PA 3JSYA 3CJ5A 2H4WB 2DNRA 4DR3J 4C3MA 3BGLA 5KFUA 3KLVA 1BWEA 3TEHB 1QSLA 1RTHA 1S72S 4GMKA 4FXWA 4EEYA 2FVRA 2JEGA 8ATCB 3OT9A 4TU7A 1F9EB 2WW4A 3VF0B 4F4KA 2V68A 5LXYA 5LMNJ 4B3TF 4U9RA 2R8IA 5DDOC 5GAHU 3QAEA 2PI5A 3PRDA 5B0FA 1JNZB 2QMXA 2EFQA 4LSLA 3OW2R 1YZ7A 4EO8A 3D9BA 1HQUA 3VWSA 1BQXA 4F0HA 2AZ3A 1N52B 3MM6B 1UEVA 3N5BA 1NB7A 2QYGA 3NGSA 4ECSA 3G9CA 2BJ8A 2XCAA 4I2PA 3BSAA 1DTTB 3CC4S 3PW7A 1RSCA 1U1OA 1DJ0A 5IT4A 1E6VA 2V8DA 1S6QB 1S1TA 4L72B 1WHYA 3MMJA 3M2VB 4ZVTB 5HJYA 1LOUA 1BQMB 2MMYA 2H51B 3T6BA 4LRAA 3OTBA 3PYEA 1YBUA 1U49A 3O2IA 5G0RB 3UI3A 1M1KT 1JXEA 1RXOB 5AE1A 1KQFB 2F40A 1HNWF 3FKBA 4B9UA 3FC9A 3MDFA 1VJQA 2QX0A 4DU7A 3N9UC 2VBYA 4GC6A 3ENVA 2ZH3A 4P74A 1RT3A 3H2LA 1SUQB 1HYSA 5L1LA 2H54B 3R7SB 2ZOMA 4OV6A 2EKNA 1RT7A 2VQFJ 2DR7A 2P5VA 4IO1A 4H4MA 1U47A 3HM9A 4OYMA 2NR0A 3PNIA 2RRAA 2W9BB 3NGTA 3MI7X 2DNKA 1FWPA 3CMES 5GAHI 2FTRA 3TNVA 3ZC4A 2JFDA 4M95A 2DTJA 1KONA 4DSFA 2E1RA 1RUSA 3NGRA 1ROFA 2QGFB 4LBHA 4DV2F 2MKCA 4NRTA 4I67A 1GNKA 1RAOA 4KGXB 2MZQA 1RWVB 2FYXA 2M52A 2RNEA 3J80U 3EZUA 1RAAB 4A8OA 2R7SA 2PEBA 3FRYA 2VKZG 2XS7A 1QTMA 1H7WA 2IAJB 4KJIA 1V6HA 1IKXA 5K20B 2XS5A 4F8RA 1ZPVA 4TLRA 4Z37A 3QLHB 4LVOP 4ALZA 1S79A 5KFYA 1UA0A 3UE2A 2HNZA 2YNFB 3O5TB 3IAS9 3TUPA 4R0JA 3KDNA 4DR1J 5L1IA 1T3OA 3W61A 4DSKA 1RT4B 5AT1B 2GC8A 1J27A 4M5JA 2MKHA 1PC5A 5AXNA 3KTQA 2VH7A 3PO4A 3OR1A 5A0YB 1P1LA 2JVOA 2H5JB 4NZ6A 2V4RA 2XULA 1LXNA 4OYWA 1GMWA 5BR8J 2GVDA 3GR1A 1V9OA 3SIPB 4J9KA 2A18A 3V4IA 4DF4A 1NH7A 2MY8A 3BSCA 3K5LA 4JI0J 1LW0B 3UNGC 4DG1A 1RT6A 2A0FB 3VHQA 2E7WA 5E3PA 3IP0A 3T1HF 2BRLA 1H38A 1J2VA 4O0NA 3WBZA 1S12A 3OSPA 2GO8A 2ZM6F 2V2VA 2IRYA 1TKTB 5DM6Q 2E1AA 5H9FK 2YKAA 5DQIA 1C1BA 3HSDA 2HVZA 4MTPA 1SXLA 2CVIA 4ZP9A 4LR7A 3KDOA 3IM9A 1X0FA 1IQTA 1HIYA 4KHPJ 2BM0A 1IWGA 2UV8A 2F4VJ 1H2VZ 3E2EA 2JH3A 5GMKa 2OEMA 5HROA 1TUWA 1KQGB 3BJYA 3VAFA 5LSLA 4J5OA 1OPZA 3C66A 2CQBA 2CJAA 1X5TA 4UQGA 4AL7A 4WTYA 2GCFA 3QFHA 1U6BA 4X4OA 4DV3J 1NK4A 1VQNS 2PEHA 5IWAJ 1X4GA 2J5AA 4QZVB 4WU2A 1N34J 5CCMA 4ILLA 3N79A 1NSKL 4NLUA 4C8OA 1FFSB 3R6LB 4OYBA 4OX9F 2BACA 1YJ9S 1G7CB 3THPA 4F02A 2KJWA 3LP0B 5D0EA 2CPZA 4AD6A 2LU1A 2HHSA 1DTTA 3GTYX 3QO9B 3MOJB 2ABYA 1BC6A 3HVTA 3FK4A 4ED2A 2R2RA 3BYPA 1QVFR 1SC6A 1KVIA 3QGHA 1SJFA 1X8DA 4I6AA 4DL2A 1EJ7L 1IXKA 2BE7D 3G8TA 1BQMA 1TK8A 1NSPA 1YRXA 4I69A 2NCKL 1JLAB 1RAFB 2J6TA 2QEXS 3W5YA 3O1LA 3R5AA 2V9WA 2V8PA 2C2OB 4QYZK 2QMWA 4IKAA 4R5PB 3KLFB 1DARA 2FJBB 4QR0A 2DRBA 4KGMA 3QIPA 3ZZOA 1URRA 2AX1A 2N7CA 4KIAA 2HK3A 4HKQA 2HNDB 1ACMB 2HURA 3LA0A 4U67Q 3L7OA 1PYTA 2VICA 2X1FA 1FJGF 3I56S 4NLPA 1FTRA 2Q66A 3AY0A 4X4PA 2ZBPA 4DUZF 1URNA 3IR6B 3ETOA 4CLUA 2JNJA 4LBPA 4LBIA 1MMLA 3OD2A 4FF1A 1XIQA 4DDFA 2ZD1B 1L3VA 3ISNC 2W9BA 2PE8A 2VQEJ 1N88A 1VRTB 4JI2J 2DNYA 2YQ1A 2ACYA 3TEGA 3EDRB 1NH8A 2K7KA 2DT9A 2IVMA 3QT8A 4ZPCA 1AZSB 2UXDJ 2HHTA 3R2DJ 4M94A 4OHXA 1HWUA 3CCUS 2XNRA 2QT7A 1HWJA 5DGAA 4RUCA 1TV6A 2DNOA 4LSNA 4JV5F 2VUGA 2UUCJ 2MB0B 3BQ1A 2AZ1A 3TVZA 2YPZA 4LF5F 3EICA 3QLHA 2M70A 1S1UB 1OY8A 3BR9A 4AQYF 1AT1B 2CG4A 1IWAA 3DCAA 1R43A 1WDTA 5C42B 4L73A 3ADAC 4DR7J 1B0TA 2DXFA 5DQHA 2FJDB 2FY1A 2K2PA 4I0WA 4DBQA 3A3NB 1OYDA 2B4VA 3CE8A 4Y65A 1RTJA 4E8UA 2PMWA 4DR6J 5IM0B 1TELA 1HHTP 4RBTA 2V6AA 5A0YA 3H5XA 1EAYC 3NS6A 4J7CA 4ZLNA 1VQOS 3K2YA 2ZNYA 1R7IA 1S10A 2XMMA 3ZZUA 2XO6A 3MMCB 2P2CB 2F9JA 2LDYA 1M5PC 3QPIA 3LALA 1K8AT 1LW0A 4F25A 2AJ1A 1HR0F 1Y11A 1DLOB 2R42A 3UFCX 4CM0A 4ELTA 3N6MA 5I42B 1IKYB 4B17A 4WIQA 3PX6A 4LF6F 2FLPA 2JSXA 3LQVA 1WEZA 1Z1ZA 3DM2B 4JI8F 2UZAA 1LV5A 4KBIA 3G4SS 3ZNUA 5M2RA 1OSDA 3DRXA 1Q53A 4NLWA 5HP1B 1RHMB 3M6WA 3SV3A 3C19A 4PXCA 2PN6A 2N3LA 2NLWA 5EWFA 4PR6A 4RZRA 4C8LA 4YY3J 2E66A 3O8WA 3CD5A 2OSQA 2YWWA 1FHTA 1FESA 3NAIA 5MLCV 4X65J 5B0DA 5HAOA 3JXOA 3DU5A 2B7BB 4D3GA 3EGZA 2MKSA 2I38A 1A9NB 2W4PA 4MYUA 4JI6F 2YVSA 3GV5B 2CRLA 4OZ5A 4ZMMA 2OPRB 2LEAA 5ETOA 1TKDA 3FJ2A 2QSFA 3MCOA 1CJVB 2IC3A 4W98A 1F60B 5KFLA 5M2UA 1XR7A 2WSEC 1XK8A 5G4DA 4WP8A 2AX0A 1B99A 1P9QC 2F9DA 4GKKF 4CO1A 4CH0S 2R4FA 4RUBA 3KJNB 2OJ3A 2GV1A 1X5SA 4ES1A 3OTOJ 3BQ0A 4DCJB 2R7TA 1SJQA 3CDWA 4O0IA 1LFWA 3KHGA 3FBFA 3Q83A 2HHPA 3LP0A 4R0EA 4NLXA 1ZA1B 4J9OA 3QO9A 1T8EA 1YZ6A 3LGNA 2XLKA 2V2QA 5KG3A 3M9OB 5EN1A 3DOKA 5DETA 5KG1A 3DYAB 2C22A 4J90A 3VQSA 3A13A 4N56A 1Z4UA 5K14B 4GO5X 1RBAA 1W2IA 1VQ4S 4DL0C 3L7UA 2VKRA 4R5PA 2CUYA 1U0SA 4HH0A 4LF4J 4HI1A 2HNDA 5A8KB 3MGJA 1XBWA 3H40A 1VJWA 1I1GA 3HK2A 5IZHA 3M1VA 2HWHA 2VJVA 3UDCA 3DFEA 3IO1A 3EMTA 1U24A 3BGFA 5KFZA 2CPIA 3FQKA 4E98A 2ZE2A 2DGWA 2KT2A 1T03A 3MD1A 1VRTA 2VJUA 3OL8A 4AXJA 2LKZA 4NEZA 1XJWB 3QMQA 4XIUA 1SB6A 3ONQA 3K5PA 1I3OB 2XGPA 4J9QA 4KO0B 1HNWJ 3I6PA 2IA0A 1KRPA 3D0IE 3D6HB 2OEJA 3WC0A 4Y28C 4Y2KA 3DGPA 1EX8A
chains in the Genus database with same CATH topology
2V8HA 2WCXA 3FSXA 3MM9B 3FQLA 1T3NA 3PJXA 3MFHA 1FK9A 1HA1A 1UEUA 7FDRA 4I2QB 3SCJE 2AU0A 2LXIA 3W2WB 2A3JA 1YSJA 4W90B 2J7KA 5LJ3Y 4EGLA 3SSSA 4ERDA 2PA3A 1RT2A 3MMBA 3DOKB 2C2EA 2ZVSA 2B9YA 4RNHA 2RD5C 3UWTA 3IR7B 1VS3A 4FZVA 2DPIA 4KE5A 5KFGA 2XZWA 2K3IA 4P2SA 2XO7A 3UCGA 2D9OA 1VQ5S 1S1VB 4ZVFA 4H4OB 1M5HA 4C97A 4Q43A 2I2YA 2CYYA 4WFYA 2R8GA 2J0SD 4C0BA 1WHWA 4NLGA 1DHMA 4QIEA 4I6WA 2IVYA 2K8GA 5E3CA 1QVGR 2UVVA 5J2MA 4F3OA 3U7JA 5KFEA 1R0AA 3CDBA 4X4NA 1NKBA 2L9WA 2MQLA 5D8HB 1VRUA 3FSYA 3OTEA 2CQ1A 3B4DA 4PG7A 3KK2A 1GTHA 1C4AA 1UFWA 5L38A 1ZYQA 2YKNA 2MQPA 5BR8F 2QYCA 3CC2S 2VASA 1TFWA 4ED3A 5F0WA 1H98A 2ADBA 5D4NA 3VAJA 4UY8T 2XGQA 4RNOA 5IM0A 4J9LA 2EFVA 2ZBIA 1DQAA 3CCTA 3FVYA 1M0SA 4ECVA 4V19X 2XHWA 1X4EA 3MR2A 2FD2A 4ZPBA 4WIIA 4JI0F 2D3UA 2HNYA 2NSCA 2JC1A 5EHHA 2C2RA 3MUTP 4FN5A 4IOAQ 2APOA 2KM8C 2LEPA 3D54A 1Q1KA 3M32B 2CZ4A 3QIDA 1HW9A 4CT8A 4CCHA 3C6UB 4N8NA 2POKA 4OZ0A 5SZTA 3M1VB 4DX8H 1FTCA 4C8ZA 1P27B 4WFAQ 1E6YB 4OI2A 2UUAF 5T7LA 4DS5A 2DO4A 2MGZB 2MZSA 3MMCA 1IN0A 1VQPS 2VPZB 3QGIA 2AJ4A 1A6LA 4U6PA 3R3TA 3KHHA 3NGDA 4FS2A 1UW4A 3KKFA 4I7FB 1DRZA 6FDRA 3RAQA 4TU9A 1LWCB 4R8UA 2VG7B 3NGKA 5J1EA 1UWBA 1TL1A 2AP6A 2YKQA 4ECQA 4PXDA 4J9SA 2Q6BA 2UUTA 2ZE2B 3PEHA 1R3NA 1ZAVA 1DLOA 2RS8A 1S48A 3FGVA 4O4GA 3V4MA 3M9MB 1NK6A 2IA6A 2PT0A 1T03B 3RR7A 4B3MF 4DSIA 2HVHA 1C2PA 1TVRB 2LYVA 4A8YA 5CYMA 5I42A 1IKYA 1FDDA 2OPQA 3LP1A 3WDOA 3F56A 3BGRA 2E9RX 2GQQA 1JLQB 3IN5A 3DDKA 3TR5A 3E01A 3GIKA 2NXUA 1FO1A 3C6TB 4YDDB 3D28A 1Q8BA 3DM2A 5C25A 4EZ9A 3OQ2A 4RX6A 4ZPDA 3M30A 1Y3JA 1VQ9S 1OPIA 3OVBA 3G6VA 3G71S 2J8AA 2QA1A 1EP4B 2KHCA 1WF0A 4KHPF 3MEKA 4F2RA 2LQBA 3FMWA 2F4VF 5KG0A 1NK7A 3KHRA 5DO2A 3HZGA 3MURP 4LFCF 3DRPB 3M8QA 4K4ZA 1B0PA 4C0OC 4KFBB 1VQSA 1AUDA 1XNQF 1YJVA 4NLOA 3FFIA 2GJ2A 2LVWA 2JWNA 3T5HA 2AJ0A 2QA4G 4IOCQ 2HGLA 4KGKA 4YUDA 2R2SA 2WOMB 1UL3A 2B6AA 2IMWP 3FCHA 3NMAA 2DR9A 5F8LA 5HP1A 3DHXA 2CPHA 2AYGA 1SH2A 2Q3PA 3NCQA 1VK8A 2HHXA 4A8QA 3AA9A 4GC7A 2VOOA 2ZZNA 3PDNA 1JLFB 1S7HA 4IYQA 2WONA