5EUHA

Crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
b'AATDALTGVANRRMLDQSLRHEWFRAQRSGKPLSLLMIDADHFKAFNDRHGHQAGDQALRELARVITTNVRRPADLVARYGGEEFSVILAETDSVGAQQIAEHIRAAVEQLSSVNEDQSPMTVSIGISTWTATSEISLEQLLFAADKALYQAKEGGRNRVVVAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative GGDEF domain membrane protein
publication title Contribution of Physical Interactions to Signaling Specificity between a Diguanylate Cyclase and Its Effector.
pubmed doi rcsb
source organism Pseudomonas fluorescens (strain pf0-1)
molecule tags Membrane protein
total genus 50
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5euhA00
1C2PA 2OPQB 2YNFA 2UVRA 4H4MA 3UDLA 2IC3B 3UR0A 2BQ3A 1FKPB 4RUAA 5CYQA 2AU0A 4KB7A 4O3RA 3LANA 3UQSA 2FVQA 4NYZA 1S9EA 3JYTA 4M94A 5KG0A 1N48A 2IBKA 4O4GB 5F9NA 2D41A 4KV8A 1RTIB 5KFZA 3LP1A 1QAIA 1C1CB 2ILYA 1TL1B 2ZD1B 1T94A 3M8PA 3OL7A 1S6QA 4J9PA 2YNIA 4LSLA 4O3PA 4RNNA 4IDKB 3M9MB 4KO0B 4DG1A 4K4XA 1IM4A 4LSNB 4JV2A 4R8UA 1TKTA 3HVAA 4YR0A 4MFBA 4RW9B 4K4WA 5CYMB 3DM2B 3V6JA 1N5YB 4X2BA 1NHVA 4F50A 1RT6A 4RW4A 3LP2B 5KFYA 5KFUA 3MR3A 3NMAA 3T5KA 1W25A 2D3ZA 3FSIA 4KKOB 5EWFA 1RTJA 3TVKA 2HNDB 2IMWP 3BJYA 1LWFA 1QE1A 1N6QA 3QLHB 1HMVB 1LW2A 3NL0A 5C25B 5KFAA 3I0SA 2ASJA 1EETA 1EP4B 4QWEA 1C0TB 1S4FA 3LAKA 4PWDB 4ZPBA 3MR5A 4TYAA 3M8QA 4TQRA 1S6PB 3D5MA 3T5JA 3KK2B 2FJVA 5J1EA 4IFYA 4ZPCA 3V6DA 4XO0A 4TLRA 3EZUA 1JLQB 2B6AB 3H5UA 1T05B 2HMIA 5KFWA 3H5YA 3MFHA 2C28A 4OL8A 2JEGA 3V6HA 2RDJA 2FLPA 3E01B 2OPSB 2UVUA 3SI8A 2I1RA 2JC1A 2OPRB 3QIPB 4O3SA 1S1UB 1S1TB 2ZE2B 2AWZA 2GIQA 4QWDA 1IKWA 4XPEA 1IKYA 3DRPB 1S9FA 2R8KA 4ECYA 2WK4A 1WNEA 5EWEA 5KFSA 1LWEA 1NHUA 3V4IA 3NBPA 5DQGA 4RW8A 4IG0B 5KFBA 3FFIB 3PR5B 1J5OA 1UWBA 2WONB 4RU9A 5KG7A 3IRXA 1JLCB 3KLEA 2JEIA 4RUCA 5KT3A 1IKVB 2YNHB 4ZP9A 1S97A 3MEEA 3NKYA 3Q8QB 2FVCA 2RKIA 2UUWA 3DOLB 4JUZA 4ZHRA 3TAMB 4EO6A 3IS9A 5C24A 1TP7A 5JUMA 3GIKA 1HNIB 2BE2A 1SH3A 1TKXA 3DLKB 1FK9A 2RF2B 4WXOA 3GYNA 3PR4A 3PW0A 2ATLA 5KFJA 1LW0B 2BANB 4Q43A 4DL5A 4IFVB 4TY8B 1BQNB 4KHRA 4GC6A 1RT3B 3KLGA 4YR2A 3E51A 2IJFA 1HQEB 2YKNA 5KFMA 4ECXA 2VG7A 3BSOA 5KT7A 5I42A 3KOAA 2IC3A 3KLFB 4F4YA 1FKPA 3ISND 4ECWA 2WHOA 1R0AA 4DL4A 3PHEA 5L9XA 1VRUB 2HWIA 5KFDA 2I5JB 5F8GA 3OHAA 1KLMA 1D1UA 2YNGB 4I2QB 4O4GA 5DQHA 4QWCA 3DI6A 5L1KA 1C1CA 5D3GB 1TL1A 3N6MA 5DG9A 4J9QA 5KFEA 4K4ZA 5I3UA 4MIAA 3PZPA 4DL7A 4MH8A 1JLAB 4NLSA 2J6SA 2C2EA 4ZPAA 3OLBA 4KSEB 3MFIA 4O44B 2IAJB 3TQ1A 1JKHB 2JC0A 4G1QB 2FVPA 2VG6B 3DM2A 2J6TA 2YKMA 5EDWA 3MTKA 1S9GB 3DYAB 3LP2A 5KFIA 3KHRA 4IH6A 3KHHA 4IOBA 3OL9A 2HNYB 4RNOA 3C6UB 4IG3B 3IN5A 3JSMA 3D28A 4NLGA 3I5AA 4TYBA 1TKZB 3QLHA 2IJNA 2JEJA 1HMVA 1TL3B 3PW4A 5C42B 5C25A 4HYKA 5KFXA 3GIJA 5JXSA 5KFNA 2RDIA 4PWDA 1DTTB 3RB4A 4ECZA 3T5LA 3FQLA 2ASLA 5C5JA 2AQ4A 5HBMA 3H4BA 1S6PA 4NCGB 5FDLB 5K14B 3KK2A 3H40A 3BSCA 4F4WA 1JLBB 3NGDA 3PW5A 4H4OA 3RB3A 1T05A 3H2LA 1JLQA 3GILA 2ASDA 2UVVA 1HNVA 3RB6A 3T19A 1HQUB 2W7OA 3DMJB 4EBDA 3E01A 4MK7A 2HAIA 4ECUA 2OPSA 3HKWA 2IA6A 3KLVA 4KFBB 5KFHA 3CDWA 5F8HA 2OPRA 5KFCA 2E9TA 3OHBA 1S1UA 1S1TA 4URGA 2ZE2A 4FBTA 3KMQA 1RT2A 4B3OB 4EEYA 3DRPA 3MR6A 2ALZA 3RB0A 3RAXA 1HPZA 4U7CA 1D0EA 3KLIB 2HNZA 5J2MB 4ED3A 2VA3A 5J2PA 3CDUA 3M9NB 2J6UA 2R8GA 4IR1A 1QUVA 3FFIA 1CSJA 3BREA 2OPPA 1SUQB 4I2PB 1DLOA 4ZP8A 1S1XB 1JLCA 5J2QB 1RT5A 1YVFA 4J9KA 1IKXA 1IKVA 2CJQA 2YNHA 3QGGA 3CJ0A 2XI2A 1GX5A 3BGRA 3T5HA 1TV6B 2ILZA 3H4DA 2IM1A 4PUOB 1JXLA 1JLGB 1HNIA 2XGPA 1JIHA 2RF2A 3MECA 3V81B 3QYYA 3BQ2A 1LW0A 2BANA 4MK8A 3EPIA 2WCXA 4TY8A 1BQNA 2ZKUA 2WRMA 1RAJA 1RT3A 3HVTB 4I7FB 4R5PB 2R8IA 1U09A 1JX4A 1HQEA 1XR7A 4WFXA 5KT5A 2W9BA 2W9CB 4KE5A 2E9RX 3FDSA 4QW8A 3KLHB 4K4YA 3DRRB 1I6JA 3KMSA 1RTHA 4IH5A 2FVRA 4QWAA 2B5JB 4NLXA 1JLFA 3VQSA 1TQLA 2I5JA 3QZ7A 3GV8B 1TVRA 3ITHB 1FKOB 2FLNA 4J9SA 1IKYB 1RT1B 3IGNA 2W9BB 3GV5B 1VRTA 2DPIA 5CYQB 1HYSB 3DLEB 3BQ1A 1K1QA 2W8KA 4F4XA 1JLAA 2AX0A 4KV8B 1S49A 5F8IA 5DG7A 3LP1B 5J2NA 3CVKA 3V6KA 2WB4A 4DL3A 5F8NA 2IAJA 1GX6A 1MU2B 4G1QA 5EWGA 1S1WA 3DLGA 4KBIA 4NLPA 4YR3A 3H59A 2YNIB 3MR2A 3CDEA 4RZRA 3DYAA 3LALA 4Y34A 2AX1A 2WOMA 4NLOA 4K4SA 4WE1B 4DG1B 3I5CA 3G6XA 4ED0A 2HNYA 4KAIA 4EBEA 4IG3A 4ED2A 4IR9A 3OL6A 5T14A 1OS5A 1XR6A 3OSNA 3G6VA 4PQUB 4ICLB 4K50A 2BRLA 3FRZA 3KK1B 1TL3A 4QWBA 5C42A 3PW2A 2QV6A 2D3UA 3MF5A 3KLIA 2OPQA 3QO9B 5HROA 5HLFB 1RTJB 5DLFA 1N6QB 4NCGA 5K14A 5KFKA 2R2SA 1RTDB 1Z4UA 3I0SB 1S10A 3LP0B 3SFUA 1RTIA 4RW6B 2R8HA 1DTQB 2ZD1A 3DMJA 4URSA 4EYHB 3G6YA 4KFBA 5J1EB 2XI3A 4IFYB 1C0UB 4IDKA 1BQMB 4NLUA 3OLAA 4M95A 3BSNA 4IH7A 2XCAA 4KO0A 5KG2A 1ZETA 4LSNA 2JLEA 2OH2A 3IGVA 1SH2A 4RW9A 4Y3CA 1KHWA 1RT4B 5CYMA 3PVXA 1N5YA 5J2MA 4FBUA 3QGIA 4I2PA 4NLTA 3Q8SB 3DOKB 4WFZA 1QAJA 4TXSA 4KKOA 1RT7B 1LWEB 2HNDA 4QPXA 3V4IB 1TV6A 5KG1A 4NLWA 4PUOA 1J5OB 2V4RA 1JLGA 2AGOA 2VA2A 1EP4A 1C0TA 4NLVA 3V81A 1T03B 3MEEB 2R2TA 4O3OA 4NLQA 4ZHRB 4YQWA 4MKAA 5KFRA 4RNMA 4J9MA 4I7FA 4IQXA 2R2UA 2UUTA 2XWYA 3CIZA 2BE2B 2B6AA 4H54A 4Y2AA 4RW7B 1TKXB 2XC9A 1FK9B 4TY9A 2XCPA 3KLHA 2W7PA 2W9CA 2UVWA 4WYWA 5DGAA 2VG5B 3HVWA 3BR9A 4NZ0A 5KT6A 5DGBA 3CJ3A 4Q44A 3IG1B 3QIPA 4ID5B 2YKNB 2HWHA 3ITHA 1FKOA 4XPCA 1C1BB 2IM2A 4URQU 1SV5B 5KG3A 3KNAA 4Q0BB 1XR5A 5KG6A 5KT4A 4IRDA 5I42B 3GV7B 4ECQA 1N56A 3G86A 3ISNC 3MEGB 4QW9A 1R0AB 1HYSA 2GIRA 3NAIA 4IG0A 3DLEA 4J9NA 1REVB 3I0RB 3KHGA 2WONA 4EYIB 1KLMB 2W9AA 4MIBA 1T3NA 4JV0A 3DI6B 2W8LA 2XGQA 4TQSA 3CJ2A 1MU2A 3DOLA 2IM3A 3CJ5A 5HROB 4WFYA 5I3UB 3TAMA 4IRKA 3HHKA 5KFQA 3H5SA 2BQRA 3SFGA 2BR0A 1LWCB 3DLKA 4WE1A 1S0MA 4O3QA 5L1JA 2JEFA 3KHLA 5F8JA 1HARA 5L1IA 4PQUA 4IFVA 2YKMB 4ICLA 1N4LA 4YP3A 3BSAA 4LQ9A 4F4ZA 3N6NA 3KK1A 2FVSA 4O3NA 4ED8A 3MEDB 1S1VB 3QO9A 4NLDA 5HLFA 3C6TB 5KFGA 5HP1B 1JLEB 3JSMB 1KHVA 3KLFA 2F8EX 3DRSB 3M9OB 4K4VA 3KK3B 3N6LA 3UPFA 1VRUA 3KJVB 4Q8FA 4J9RA 3RBEA 1RTDA 2R8JA 3LP0A 4ED7A 4R0EA 2C2RA 2YNGA 4I2QA 5KFLA 4ZP7A 2YNFB 3I5BA 5F9LA 4K4TA 2FJWA 4LQ3A 4WXWA 2BQUA 2V0NA 4H4MB 4RNHA 5D3GA 4RW6A 1DTQA 5HBMB 2FJXA 4JV1A 5KFPA 1S9EB 4ZP6A 1C0UA 5KFFA 1BQMA 4H4OB 4MK9A 4ZVEA 3JYTB 3PW7A 3GIIA 5L1LA 1HNVB 4IKAA 4O44A 3RBDA 2O5DA 1JKHA 3M8PB 1ZTWA 1RT4A 2VG6A 1S6QB 4LSLB 1S9GA 1K1SA 2D7SA 4KHMA 4DL6A 2DPJA 2EC0A 1RT2B 3DOKA 5KFVA 4R8UB 4TN2A 1TKTB 1HPZB 3C6UA 4MFBB 4J9LA 1RT7A 2HNZB 4ZMMA 5J2PB 1RT6B 1S0NA 5F8LA 1TKZA 4RW4B 4ED1A 3QIDA 4HKQA 2OPPB 1DLOB 4ZVGA 3H98A 1RT5B 3CJ4A 3QZ8A 1IKXB 3QGHA 1DTTA 4FS2A 1T03A 5DG8A 3PJXA 4J9OA 3BGRB 1LWFB 1QE1B 2B43A 3T1AA 3OL8A 3FQKA 5FDLA 2WTFA 3EPGA 1LW2B 1JLBA 3Q8PB 3GQCA 1EETB 4NLRA 5KG4A 4RW7A 1RDRA 2QE5A 3MECB 1SH0A 1HQUA 2VG5A 3M8QB 3RAQA 2V4QA 4YMEA 3DDKA 5KT2A 1RYSA 4Q8EA 4WYLA 3IG1A 4U6PA 3V6DB 4B3OA 4ID5A 1RA6A 2HMIB 1NNDA 1C1BA 4ECVA 1SV5A 5KG5A 4Q0BA 5KFTA 4FS1A 2BRKA 4G3IA 2V9WA 4IRCA 1RTHB 3MEGA 4DEZA 4EBCA 4WZMA 1JLFB 1REVA 3I0RA 1SUQA 1TVRB 2C22A 1S1XA 1IKWB 4ECSA 5J2QA 3CWJA 5KFOA 1S0OA 4MKBA 4EO8A 1VRTB 2FLLA 3CO9A 4Y2CA 3NBPB 3NAHA 4RW8B 4Q45A 3ICLA 1UWBB 4ECRA 3IRXB 3KLEB 4NRTA 2R2RA 4DL2A 1LWCA 3Q8RB 1S48A 5J2NB 4ZVFA 2CKWA 5F8MA 1RYRA 3GIMA 4K4UA 2RKIB 4O4RA 1S1WB 3DLGB 5EUHA 3IS9B 4WZQA 3OSPA 4R5PA 5C24B 3HVTA 4RNFA 2C2DA 1ZTTA 2WOMB 4ZVHA 3MEDA 5DLGA 3PJWA 1S1VA 2AGPA 3H5XA 3LAMA 3DRRA 2IM0A 4ED6A 3C6TA 5HP1A 2AGQA 1JLEA 3DRSA 3BQ0A 3KK3A 2E9ZA 2B5JA 4NLYA 4NRUA 5DQIA 3KLGB 1MMLA 2GC8A 3KJVA 4ZPDA 4GC7A 4ECTA 1RT1A 1RA7A 2VG7B
chains in the Genus database with same CATH superfamily
3M8ZA 3SDEB 4FXWA 1K44A 2Q79A 4IYQA 4I69A 4F36A 4X4NA 2N82B 3ZO7A 3M8PA 4JV5F 3LA0A 4JV2A 4PCQA 4WU3A 3HXMA 2R7XA 3MDFA 4DWIA 3BYRA 3FUYA 1MN7A 1KRPA 1YIJS 1HMVB 2XSJA 2ZDPA 3MR5A 2QSFA 3M2UB 1ITPA 2QLJB 1SKRA 4TLRA 2B6AB 3OV7A 3EDQB 3MD3A 2LU1A 3QIPB 2BJDA 1NKCA 1OO0B 3L3CA 3DRPB 2DR7A 1NJZA 4RW8A 1U47A 4OZ3A 2YNHB 1S97A 2AYGA 4OI3A 5ETOA 4ZHRA 2UUWA 3DOLB 2PI5A 4EO6A 2EVZA 2QGFB 4G65A 5FJ4A 3PYFA 3E3XA 1WWHA 3ZZTA 2QN6B 3VZHA 5BJRA 1HQEB 3TAPA 2VKRA 5U47A 3TYTA 2P8IA 1YJRA 2QL7B 5D3GB 3N6MA 4ZS6A 3BDPA 1DQAA 1AW0A 4FNIA 2FVPA 3OVBA 3JSMA 4ELTA 3R5AA 2G1HA 2Z0GA 1S7IA 3H4BA 2IRUA 1WNEA 3BSCA 1LOUA 4G6VB 3GILA 4EBDA 3EXCX 4KFBB 2UU9F 2DGOA 4B3OB 3OHBA 2ZE2A 3THPA 2FD2A 2ALZA 4DFMA 4U7CA 5HQMA 3W8PA 2OGUA 2V2VA 1U0HB 1SUQB 1AFIA 3LQVA 1YVFA 2EFGA 2XI2A 2B4OA 2Y0SD 4N47A 3TX0A 2RT3A 2XBPA 2PMZD 3GLJA 2XS7A 3CCQS 1WHXA 1XR7A 3DRRB 1I6JA 5DRKA 3FEXB 4Y65A 1B0PA 3QGPA 5CABA 3IAS9 2XNQA 5DG7A 3SIPB 3LP1B 3WX8A 2WB4A 1RI7A 3CE8A 4DI6A 4U96A 2KZZA 5BYRA 4K4SA 1PC4A 2W25A 4DV5J 3FRZA 3M1VB 1XQIA 1NJYA 5KFKA 2NREA 2KG1A 4YUDA 2LQBA 3H0PA 4M95A 4IH7A 2JH3A 3WQPA 1HNWJ 3LWMA 2I2YA 3IGVA 2OMOA 2SXLA 2EK1A 2D9PA 1UW9A 3G2XA 3U1MA 2HFZA 2XO7A 3OR1A 1N32F 2AF6A 4RNMA 2K1RA 1N36J 1XNRF 2Z30B 4Y2AA 9ATCB 1AZSB 4FVMA 4DV3F 1ZZNA 3JQMA 3KHGA 1YITS 4OYOA 1YLXA 4PKDB 3S01A 1T02A 1LWCB 3B6BA 4WE1A 1QDUB 1UETA 3W61A 1S1VB 4Y2IA 2QFJA 3N6LA 3FEZA 1RCOB 2KYXA 3N01A 2FJWA 1P1TA 2GO8A 2ZUAA 5HBMB 1BLUA 2HVDA 1BQMA 5HL7Q 5L1LA 3QWPA 1CJTA 1HNVB 1YG0A 3NCRA 1K1SA 2CPZA 3R2CJ 1O0PA 5L8RC 3HZGA 3F0NA 3UVJB 1RT7A 2J76E 4QIWD 5E33A 3D1OA 2FZCB 2V8PA 3F73A 5ETTA 2HBQB 3BGRB 2QC3A 3MAAA 1FJGF 3MECB 2AJ4A 1LQ9A 4JI0F 2CNLB 2XMKA 1R43A 3MEGA 4DEZA 2ROPA 4I67A 1YDLA 4JI1F 4Y2CA 4NYPA 1SQEA 3GIMA 2P2CB 3M4XA 3NRBA 4F3QA 3HVTA 2ZZTA 1VISA 2MEWA 4MKVA 4HDGA 2O1PA 4NZ6A 4O23A 2YNFA 2E1PA 1FT8A 3JTNA 4RUAA 2IBKA 1FJCA 4DF4A 1SVDA 1X31C 3Q23A 8ATCB 1ZOTA 2CJ9A 4LSLA 4O3PA 1T11A 4DG1A 4LSNB 4NEYA 1RAAB 4MFBA 4F50A 2DNPA 1FTRA 4CLPA 1W25A 2GS8A 2PIIA 2HFVA 3EVMA 2CIMA 1P8GA 4C3LA 3G82A 2FGCA 4TQRA 3KK2B 1M5HA 2FJVA 4IFYA 2FPHX 4LRCA 4O3SA 1S1UB 5E41A 3W9IA 4RUCA 1N52B 4FYDA 3PW0A 3UFCX 2YX4A 1UJ4A 2HRYA 2LA4A 2W24A 4KHRA 4LRAA 4LFAF 3KOAA 3KLFB 1FKPA 2DNMA 1FRLA 3CD0A 1YTYA 1VQMS 5KFDA 1S59A 3A4TA 5KFEA 5I3UA 1X4EA 5GAHU 2J9DA 1CULA 1T9VA 2HHSA 2C3OA 4ATNA 3DYAB 4C8YA 2H5IB 2K06A 4OI0A 4IG3B 1X4AA 5DZ7A 3D28A 1ZA1B 3B4DA 1KSPA 4B3TF 4J9VA 4ZJQA 4BWJA 1UJ6A 1JLBB 1SC4B 4DR4J 2MKJA 2C3MA 1VIOA 1Y00A 2GMLA 2XLKA 1YZ7A 1EZZB 2AT1B 2X1BA 5D78A 2MZRA 2YPZA 3HLUA 3EGWB 2J9CA 2HNZA 4IR1A 1CPZA 3BREA 2GA7A 3M2RA 2ILZA 3H7HB 2XYHB 3QYYA 5H9EJ 4PPZA 1LW0A 3KLHB 2ZZMA 2XTJP 4FKXA 2EEYA 2KM8B 1QAXA 3OD2A 2CZ9A 4DCOB 3TJ9A 4F4KA 1M1GA 2DD8S 4ZVOB 4PXCA 1GX6A 3DLGA 2YNIB 3MAHA 3IBCB 1U24A 4DJBA 4Y34A 4F0MA 4UQGA 1OIAA 3RG6A 3KLIA 2Y1JA 2BKPA 5CXTA 4AE5A 1Z4UA 2GJFA 1EB0A 4USIA 2UXCJ 1DTQB 1AB8A 3DMJA 2C2NA 2XI3A 4IDKA 3TX8A 4KO0A 3MM6B 1XERA 2DJWA 4OZNA 4QR2A 2FIUA 4I2PA 4PQAA 3BH6B 1KDNA 1KNZA 2VIHA 4FP9A 1LWEB 2G13A 3NWGA 2D1CA 5T7LB 4ZCLA 4DDFA 2HPUA 1SKSA 4J91A 4TY9A 2GMJA 4CCHA 3J81U 2HHXA 1GNKA 2IM2A 3ILIA 2BEFA 2Z2MA 2J0QD 2HIQA 3NAIA 3BZQA 2CQBA 2W9AA 4DR1J 4KGXB 2DGQA 2HQFA 1QJHA 1DQ9A 3MPUB 1FDNA 1FRJA 4H4KA 2JEFA 3NOCA 5L1IA 3MMAA 2FVSA 3GYGA 2ROGA 3QO9A 3DRSB 3UPFA 4EZ9A 4DU8A 5KFLA 2BOAA 1GTHA 4KR0B 2GVDB 3ZTSA 3AJ1A 3RW7A 2LMIA 4OFZA 3UD4P 3RBDA 4PXDA 5BYSA 4QIEA 3K58A 1Q8KA 4DPUA 2ZJPQ 1IKXB 2FJDB 2DNRA 2DIUA 2QLWA 4BHQA 1LW2B 5A2QU 1U7LA 4PPDA 1VR6A 3TVZA 3M32B 3DDKA 4KPCA 2CZVC 3MAQA 4DQIA 5FLXY 1H3DA 3W63A 5K8NA 1S1XA 3RYLA 1NSKL 4K4UA 4PWUA 4O4RA 1JXVA 4DQRA 1NLKL 1RE1B 5HP1A 2OUGA 3P5BP 2VJVA 4X4RA 2RRAA 4ZLPA 2QA4S 3CIMA 5LL6d 4QYZK 4NPOA 4KB7A 5DZ6A 3TRGA 2VASA 4M94A 2DRDA 1FNMA 2NSCA 4J9PA 1HBUA 5A8RA 3OXFA 1IWGA 3QPIA 1N33F 3HVAA 4K59A 2FJAB 4QR0A 2RQ4A 2DT9A 2R42A 3BN4A 5KFUA 4A8OA 3TAQA 1R89A 3N79A 3AT1B 1N6QA 3I0SA 2Q6BA 2N4CA 1RK8A 1DFDA 5J1EA 3PEHA 1R3NA 3EZUA 3H5UA 2MLZA 3H5YA 2C28A 3G96A 3CTRA 4QOTA 5A8KA 4Y00A 1RB0A 2PD1A 3KTQA 1PCAA 1Q95G 5KFSA 3V4IA 1OPZA 1JLCB 3KLEA 4DV5F 4DR5F 5KT3A 3MCMA 3MEEA 3HVRA 4FDFA 2RKIA 4NX9A 1RP5A 1TP7A 2LP4A 5A0YB 2BE2A 2XS5A 1VQ5S 2BANB 4Q43A 1ULRA 1D09B 4Y6IA 1L3UA 4HL9A 4HHHA 5B0DA 1U45A 4WCEQ 3A1YG 2E1MC 2CQCA 4Z7CA 4H4KC 1HLWA 3NLCA 2BKOA 1BWEA 3KG4A 1XMOJ 1FI4A 2HAFA 1XEZA 2IDLA 1KFSA 3D66A 1UA1A 1UVJA 2YKMA 3MTKA 1FDAA 1NZAA 3ILJA 1PO6A 2HNYB 3MPVA 3TQEA 2A0FB 2RDIA 2BUNA 1S6PA 1FWLA 2I38A 3PW5A 3IBWA 3T41A 3ZFVA 1NB2A 1KVIA 3GFHA 5J2MB 1FEHA 4ZPTR 1X60A 4WKRA 2VQEJ 1YJUA 2DO0A 3H4DA 3MOJB 2V2KA 2RF2A 1UVLA 5CAAA 4MMOA 2E9RX 2W9CB 4KE5A 4LF4J 1H73A 3VAJA 4QWAA 4C4WA 1EKSA 3CMQA 2EG2A 5B09A 1QTNB 3NCQA 5ETPA 1FA0A 4IO1A 1SQFA 4PG5A 3POTA 4KBIA 1SCJB 4QJVA 3MPWA 4NLOA 5GAHI 2VF3A 1YRXA 1VQOS 3KWMA 2LXFA 5K8PA 5B0GA 3K8WA 2VQFF 4NCGA 3U7JA 1NPRA 3MXHP 3ETOA 3M8RA 1U1PA 3MR7A 4XIUA 3D1QA 1KBRA 1BMQB 1TTHB 2VA2A 4U8YA 2DNKA 4DUTA 1G2EA 3ISZA 5THWA 3BGUA 4J9MA 4USTA 4DUZF 4C8MA 2XCPA 3FRYA 4DQQA 3I4HX 3LO3A 4ID5B 1FKOA 3F56A 4Q0BB 4MKYA 1XR5A 2E1AA 2GIRA 4FYVB 4EYIB 5LSLA 2CFXA 4B9MA 3CJ2A 4YS2A 4EGLA 1UP1A 3DLKA 2V2QA 2BXJA 2MTLA 3D6MB 2LEAA 2KJWA 2B4PA 4BS2A 3LGMA 2A18A 5HLFA 3W5XA 2XMJA 1RTDA 1WC1A 4ZOSA 3VTIA 2BQUA 1OMSA 4WP3A 4JV1A 1I5OB 1ZTWA 1PYSB 2G0CA 3BKTA 2J7WA 3ZTOA 4JI6J 1QLNA 2F4VJ 4J9LA 4ZMMA 1APSA 1TKZA 3FMBA 4NOHA 2I0XA 4HKQA 2OPPB 3TEGA 2BM0A 5CD4H 1RT5B 2MMYA 2VBXA 1T03A 3PJXA 1KS2A 5M2UA 5I4MA 2Q3PA 4J9UE 4ZCIA 1V3SA 4GVBA 4ZVQB 2M7SA 3OQ2A 2EC2A 2NYIA 4FS1A 4OZJA 1U1RA 2MZQA 1D8ZA 3NAHA 2GHVC 4CLSA 4DL2A 2W1BA 2BACA 4DV0F 1WDTA 1TKDA 3MURP 2IM0A 2AGQA 1XWLA 3OXLA 4DR4F 5K5MA 4ECTA 1Q4RA 5E3AA 3ULHA 4LF8F 3MMBB 3GFXA 2DHSA 2Z2YB 1VQLS 4JBCA 2ZDOA 1NHVA 5ETRA 2KB2A 1RWWB 1RTJA 4HHUA 1U1QA 3RRKA 1LWFA 1QE1A 2MQQA 4DS5A 3RBZA 1B0VA 1N34J 3DCAA 2BA9A 4D3HA 1T05B 4P73A 2JEGA 2J7KA 3PDNA 2VODA 3R97A 2YXLA 2KH9A 1IN0A 1S9FA 1WKLA 1S12A 5KFBA 1J5OA 4RU9A 5ETKA 4JUZA 2ZM6J 4W90B 3NGSA 1L3TA 1YSJA 3US5A 1FK9A 2DH7A 1RKJA 2FHKA 1R8BA 1PBAA 2UXCF 3AA8A 3TUJC 2IC3A 3M8WA 1R0AA 3M30B 4WF9Q 1VRUB 4DCPB 2P9GA 1F60B 3AH6A 3TZXA 3DI6A 5L1KA 4J9QA 2WBMA 2E7VA 4ZPAA 2X1GA 4C7QA 1Q1KA 3LP2A 2MJUA 4IH6A 3CCSS 3BPSP 1HR0J 3AOAA 2Y8YA 3HFVA 2IJNA 1LEOA 1IR1A 5C25A 2MGZB 2VFRA 4PWDA 2L9WA 3RB3A 1JLQA 4QIGA 3AXMA 3HKWA 4DR1F 2HVZA 5F8HA 4OV1A 2FGOA 1D0EA 5IWAJ 2MXYA 4AL5A 3QQCD 3QJLA 3Q89A 2CJQA 1VI7A 2WSCC 1QD1A 2CDRB 1GXTA 3I6PA 4F3OA 2OFGX 3EPIA 4MK8A 2E7XA 2WRMA 4J5OA 3R3TA 3SSRA 2MY7A 2W2MP 1RT1B 1VRTA 4DOZA 4KGVB 1K1QA 4MIWA 4KV8B 4OZLA 2CWKA 3DRXA 4DL3A 3ADAC 2X7IA 1ICEB 3T1HF 1WHWA 1XIQA 5IZHA 4K50A 4LFCJ 4QIVA 2QFIA 2D74B 2GAGC 5LMUF 2B56A 3N9UC 4RW6B 2ZD1A 3OLAA 5GAEU 3U27A 2RRNA 1FVQA 2OH2A 5GAGI 1BUXA 4P52A 1U6FA 1GEHA 1VYAA 1TV6A 1CJKA 5KG1A 2AGOA 1J5EJ 4NLVA 2JSXA 2IPOB 4MKAA 4YN3B 3PV8A 1RWPB 4E0DA 2UUTA 3KUHA 3CDAA 2QSWA 1R0CB 1PYOB 2BZ2A 3D6FB 2YH1A 1C1BB 1JJ2R 1X4BA 3CJRA 2HGMA 2VB6A 1KN6A 2WONA 2W01A 3MM7B 2C1EB 1NO8A 2C2KB 1R8HA 3S6EA 2BR0A 3A13A 4O3QA 5F8JA 1S4EA 5DDQC 2N7CA 2AYMA 3C6TB 3BB5A 1X5SA 5J1NA 5CD4A 3FZ2A 3FBBA 3VZIA 1SC1B 1LXJA 3TUZC 1F3VA 1C0UA 1KTQA 5LT5A 1IBMJ 2HLUA 3M8PB 3LOUA 2D7SA 1BE4A 2EC0A 3DOKA 4TN2A 3HMJG 4CH1A 2DH8A 3D3CJ 1Y5LB 5I3PA 5RUBA 4F4AA 3AOBA 2XSJB 2DXDA 2BJEA 2DK2A 1RWXB 4A8QA 1RISA 4WYLA 1SV5A 2LXIA 4B08A 4CRJA 4DSIA 3I0RA 3QFHA 4DN9A 5AE1A 2AYBA 1TVRB 5KFOA 4I6WA 4OJ1A 2MKYA 4RW8B 3ICLA 2DKOB 3UN2A 4B3MJ 3OFFA 5DO2A 2C2DA 1AT1B 2M2BA 2ZEJA 5DLGA 3H5XA 2Y0BB 3LAMA 1JLEA 3JS9A 1LXNA 3KJVA 1VLYA 4NRUA 3W9JA 2QLFB 3V4MA 2LA6A 2AIRB 3N5BA 2X1FA 2ACMA 4K8RA 2DHXA 1S6QA 3EWGA 1N5VA 4RNNA 4FYYB 2VQEF 4R8UA 5CCMA 4X2BA 1IM6A 4DV2F 3F41A 4N8NA 4Y2KA 3P96A 2UUCJ 4KKOB 1KQFB 2IMWP 4ZVSB 2FUG9 2W7AA 2EXUA 1EP4B 4QWEA 1C0TB 4FF2A 1GAOA 3CDBA 4DV6J 3P8BB 5HO4A 2RILA 3HHLD 3GSDA 2ZE2B 4OI2A 2DNLA 2K2PA 2C3UA 2MZ1A 3VHQA 4B3SJ 1ZAVA 2K7JA 1DAXA 2R7UA 1NK9A 2CXEA 5KFJA 2RB7A 2YX1A 1Q86T 1RHQB 3HJVA 1F9HA 3CCLS 1RU2A 2O67A 5I42A 4FF4A 4X84A 4F4YA 2B0GA 2VFUA 5L9XA 5C2GA 3RRHA 4ZVRB 2UP1A 4KTQA 4CNYA 2DR5A 1TAUA 2JDJA 3G8TA 1NHKL 4J7CA 2J6TA 5EDWA 3GPAA 2PO4A 1EAYC 4RNOA 1JJHA 2MZTA 1SBRA 3KJFB 2Y1LB 3EGZA 1RGVA 2M0GB 3RB4A 2HRUA 2MSSA 1SL0A 2VV5A 2BV3A 3H40A 2N7YA 5B0EA 2EW9A 1TFWA 2OEMA 2Q43A 5DDPC 3UCGA 3PEJA 1HPZA 2YTCA 5M2PA 1AXQA 1FWPA 1QTMA 2JLGA 3T5HA 1BGXT 1RUSA 4NA1A 2XGPA 3OR1B 1HD1A 2AKWB 2IRXA 1B64A 2JWNA 2K1RB 1T9UA 4C11A 1FXRA 3PO5A 2FHJA 3GV8B 1R31A 3GJSB 2DRBA 4JI6F 1FDDA 1FE4A 3TZWA 3ZZ0A 1DZ5A 4RPFA 4DR3F 2F4VF 4F4XA 2QIFA 1H0HB 5F8NA 1S1WA 3Q0AA 4WE1B 1FFSB 1WOSA 3GG0A 2EBEA 3D6HB 3MF5A 4A8MP 3FMWA 1RHUB 4FN5A 1EQ0A 1VFJA 1H98A 1WKKA 3PYDA 3TEHB 3OTCA 3O6QA 4UZCA 1BQMB 3OTBA 5KG2A 2DISA 5IM0B 5L46A 1HBOA 2K3IA 2JJ4D 5LM7E 1QAJA 4L76A 2M8DB 3T9ZA 2A6OA 1RT7B 4ANCA 1MLAA 2VDHA 1M5SA 4NLWA 4DX8H 4KHPF 2V50A 2FJBB 4JB8B 4XTTA 3V81A 1HHQA 2P9EA 3IAM9 4H54A 2CPJA 3PXGa 2UUBJ 2WZ1A 3CJ3A 4OZ5A 1C4CA 4XPCA 4URQU 1P9YA 1CS4B 3AJ2A 3MEGB 2XYGB 1WI6A 2M9KA 3GYXB 1TFYA 2NXEA 2IM3A 4IRKA 2HHWA 3HHKA 5HJXA 1T3OA 1MSWD 1W2BR 2ZNYA 3HT3A 1HNZF 1KTVA 1FCAA 1YJNS 1S76D 4F2RA 4PAAA 5HMYA 4ED7A 4LR7A 1KWMA 2YNGA 4R0EA 2YNFB 1V3RA 3MM9B 4ZVEA 4X4UA 3P3DA 4Q2MA 4LSLB 3MMCA 3ZXWA 4X64F 1S9GA 2ZM6F 1YI2S 3BKFA 1R8AA 4MFBB 2ZWPA 2R3VA 2CPDA 4ED1A 3S1TA 1WELA 2G0IA 2ZBPA 5H9FK 1PKUA 3N28A 3Q8PB 2HIYA 5GMEA 3G82B 4ILMA 2CVEA 2H4WB 2ZJRQ 3EYZA 2DH9A 4ECSA 1WTBA 1P9QC 3TO8A 4ECRA 4NCBA 1WD6A 3NXZA 4CO5A 3RW6A 5F8MA 1HNXF 2K7KA 2E5HA 1ZZFA 4USKA 2NUHA 3T1YJ 3K5MA 3K5NA 4OYMA 1RXOB 1IKYA 1HBMA 2OPQB 2BQ3A 1FKPB 3JSBA 4DV4J 5B08A 4OHZA 3UQSA 1WJ9A 1IBCB 1RHJB 1RTIB 2HG4A 3A8IA 1CULB 3OTEA 2M52A 1GFWB 4K4WA 1N5YB 1VQ7S 4RW4A 4OIXA 2KU7A 3FSIA 1NSQA 5EWFA 4C0BA 1LFWA 2DXEA 3N5FA 2K8GA 3H2VE 2LQ9A 5L38A 4E98A 1VLOA 1ZPWX 3DFEA 4MYUA 1KEKA 2HMIA 4ILLA 5JVHQ 5LJ3Y 2VFSA 2UVUA 2JC1A 4LF1A 4IG0B 1R27B 2J9DE 2VU5A 4LFCF 2CJAA 1WC5A 2M4MA 1LWXA 2G2OA 2GVZB 1TKXA 2BJ3A 1LW0B 4GC6A 2MLYA 5K9FA 2V8HA 2JNJA 3PYGA 3OHAA 4W98A 2HW3A 3GJRB 1Q7YT 4N56A 5L9NA 4OYAA 4F0HA 4DPWA 3TUPA 2DYAA 4JI8F 2VG6B 1J5EF 2EWHA 3JAMY 2H3EB 2ASYA 1YKWA 3GTYX 1ZYQA 1RCXB 2JEJA 2OAUA 3T5LA 4GKJJ 5FDLB 4OYXA 1CC7A 3NG8A 3DMJB 1IUJA 2E5JA 1TL7A 3ENVA 4OX8A 3O3LA 2YH0A 1RT2A 3RAXA 2BVZA 1E6VB 1DQ8A 2GCFA 1HWKA 4ZPWR 4I2PB 1DLOA 4JI3F 4J9KA 3MCSA 1GX5A 1PAUB 2IM1A 4YHHJ 2QMUB 2VPZB 5AJ3J 2HQDA 3B78A 4TY8A 4L75A 3D0HE 1VBZA 1XC9A 1NK0A 2AJ2A 4FXVA 2DGUA 1IBMF 5AE3A 3C16B 3Q24A 4LRFA 2DPIA 4PABA 1Y5NB 3DLJA 5J2NA 2CJYB 3IRWP 1AUDA 1KVKA 2DTJA 2WOMA 1Y10A 3AQPA 3MMAB 1NJXA 2IYIA 1M1KT 3MD1A 1WUUA 3QO9B 4M5KA 3U02A 1NXIA 1CBKA 4LF9F 1S10A 3OR2B 1X5PA 3QJPA 4U7UD 2PMWA 2AP6A 4KH1B 3MWBA 5D6GA 3W62A 4GVLA 4FZVA 2NR0A 3QGIA 3Q8SB 2B9YA 4AT1B 4ZA1A 4QPXA 5D8HB 1HFEL 2BJ8A 1IJFB 1JLGA 2QL9B 5EX0A 3W9HA 4Y0FA 5KFRA 4XDCA 2B6AA 4NA3A 3K2YA 5GADI 2YWWA 4Q44A 4USMA 3QIPA 3UI3A 1QSYA 3QT8A 4X62F 2OLWA 5KG6A 4I64A 3CGIA 4ECQA 3G86A 5F0UA 2IA0A 4HT7A 3M2VA 1KLMB 4CLWA 4MIBA 3R1HA 3UW1A 2AEJA 3DOLA 4DSEA 5IS2A 4WFAQ 4OYPA 1O51A 3EGNA 2C3YA 4BCAA 1L3SA 1EJ7L 3BSAA 1E6YA 4DV6F 4B9NA 5HP1B 1KHVA 3M9OB 1VJQA 2GJ2A 5CCLA 4I4BA 3CT9A 4Q2LA 4ZJOA 2XY5A 5D3GA 1U1MA 1H2VZ 4WP9A 1RAOA 4MK9A 2CZ4A 2B7BB 4CH0S 1HBUB 1WSRA 4KHMA 2XY7A 2CPEA 2ADCA 4B17A 3LF0A 2LQ8A 2RAQA 1F0XA 3THTA 4Q5VA 2VBYA 3R6GB 4M8LA 3LTOA 3T1AA 2XY6A 4DV7J 3UDVA 1RJJA 2KFZA 4A8FA 1PIEA 5CHCB 2KT5A 1NK8A 1Q82T 2QTWA 1WC6A 4B3OA 4LJMA 1KVJA 2VBZA 2B4UA 1U02A 2DR6A 1OYDA 5A8KB 1SUQA 2JL9A 1XNQJ 4ENOA 2FLLA 4UOGA 3KLEB 4I68A 4NRTA 1D9FA 5D0GA 4HACA 2Z58B 2BW7A 3G9CA 1RYRA 1NB7A 1JMTA 4LIRA 2RKIB 3CW2C 7AT1B 3V5RA 3PJWA 3DRRA 4GKKJ 1NK7A 4NXNJ 3UDLA 2I9SA 2ZH2A 5HMWA 2RIJA 5KFZA 3LP1A 3TA1A 2HBRB 4OZ1A 4WK3A 2LCWA 4DR2J 5AXLA 3WC2A 2VBWA 4YR0A 3V6JA 1TK8A 3NMAA 1MMDA 2HNDB 1KQKA 1QAYA 2HQ3A 1IBKJ 3EGVA 2M8HA 1MNEA 3I82A 3DOMA 5F3TA 1S6PB 2Z2LA 2CUYA 2XLJA 3MFHA 2V4JA 1S6OA 2A1BA 2WK4A 4CLTA 3D54A 1NHUA 3CSKA 2XQCA 1GMWD 1Q7LB 4CLYA 4CIOA 3TAMB 2J8SA 2PN6A 1UFWA 4WXOA 2RF2B 3VF0B 2CQIA 1AZSA 4YR2A 4F25A 2B51A 5SUHA 4ECXA 2XMVA 5KT7A 1VQ8S 1XBWA 1LFPA 3GU0A 1XJWB 1UEKA 2HWIA 1P1LA 1G7CB 1UPPA 1HA1A 4DS4A 5D77A 4ANEA 4MH8A 4DUYF 2C2EA 4DN0A 3JXOA 3OTOJ 3OBIA 4O44B 2JC0A 3DM2A 5IT9Y 4L72B 3PYEA 1VC0A 4ITSA 1LK7A 2QYCA 3C6UB 4K0KJ 4TYBA 1QVFR 5KFXA 2PA3A 5HI7A 4O0IA 3CULA 1K0VA 5C7PA 3LW5C 5HBMA 2Z4PA 4NCGB 2XMTA 2WB1D 3ENAA 2NYHA 1ZM3A 2MY8A 1HNVA 3CB4A 4PZVA 3JQKA 2W7OA 5B0CA 1UEUA 4P2MA 2Y3YA 3CDWA 3D0GE 2DHAA 4URGA 1TR0A 2D9OA 3UVJA 3MOZA 5IC4B 3MM8A 1KD1T 3K5LA 3GMGA 3BGRA 3GCXP 1HNIA 3J7YU 1UKUA 3MECA 2NZCA 2ERRA 1M0SA 2VUGA 2H4YB 2BJ1A 3LGNA 5CA5A 1IQTA 1Y3KA 5SZTA 5DM7Q 4QW8A 5LSOA 2V2ZA 2FZKB 4JI4J 2B5JB 3QZ7A 2I5JA 2EFVA 1FKOB 2V9KA 3I87A 2OO4A 3CCES 2XS2A 2V67A 5GMDA 4PXBA 2NXNA 1JLAA 3QJJA 3V6KA 2G1DA 5EWGA 5IFMA 4KGKA 4I6AA 2HZCA 3G6XA 4NMLA 1HIYA 3OL6A 2CJBA 4DR7J 3WBZA 4HTIA 3PW2A 1V6HA 3CO0P 5HLFB 3SQOP 4F67A 2MKIA 3FCWA 5BYQA 1VJWA 4M63A 4F26A 1RTDB 2AJ1A 1I94J 1U48A 3U1LA 1XMQJ 1MW7A 4LSNA 2RMLA 1KHWA 5LMNF 2K3KA 5DJBA 3KNGA 4WFZA 2DO4A 4DU7A 3S7RA 4LRBA 2GNKA 4QU6A 3KKFA 2V4RA 4AD6A 3P6YC 3T1YF 1T03B 1NDLA 2PFFB 1WEXA 2YWEA 4NZ0A 2ZVSA 2YQ3A 4C3KA 2YKNB 1H74A 1UVMA 1Y9OA 4BWMA 3KNAA 4L73A 1QM9A 3K7RA 1N56A 4UTGA 3EXYA 3X3UA 1MU2A 3SEOA 3QRPA 2DGTA 2ZOMA 4YEAA 1WG5A 2FTRA 2DIVA 3DHWC 3KK1A 2ADBA 1HQ2A 1ACMB 1ZAWA 2MKSA 3KLFA 1AYEA 1RWVB 2R8JA 3QWUA 4R0JA 2Z56B 4K4TA 1NK6A 4H4OB 3AA9A 4S0MA 1F2GA 4DSLA 1M5PC 2DPJA 2F8HA 3CF5Q 2KT3A 2RNEA 1S0NA 1X0FA 4ZVGA 3D4JA 3EVOA 1JJCB 1LWFB 1QE1B 1K9MT 4ID8A 1JLBA 4B3RJ 4FNHA 2V4QA 3EMTA 3IG1A 3CC7S 2HK2A 2CQ2A 1RSCA 4UUXA 4RU2A 1RTHB 1REVA 1I3OB 1N54B 4QCLA 3FVYA 3C3LA 2ZOGA 2PC6A 3C46A 1RAGB 1QSLA 3MI7X 4P75A 3I32A 3AHPA 2GC8A 2GW8A 1PG5B 4LF7F 5HROB 1C2PA 2NUUG 2IC3B 1FERA 3W7BA 5HAOA 1S77D 5KOXA 5AXKA 1IR0A 2CG4A 1RWNB 2YNIA 2MZSA 1BWVA 4YHHF 4DMZA 3R5JB 4C6AA 2VONA 4CDIA 3LP2B 5B0BA 2H51B 3MM5A 2ZNZA 1YJTA 2P9CA 5C25B 2MKKA 5D4PA 3QRRA 4PWDB 1Q8IA 4P7TA 4I6YA 3V6DA 5LXRA 1JLQB 5KFWA 3LH2S 2F1FA 2BM1A 1IKWA 2XMAA 1LWEA 1HWLA 3GCWP 3NBPA 4UOHA 5DDOC 5T7LA 2FVCA 3R5CA 1HI1A 1TZ0A 2V5HG 3CMES 2R7VA 2V94A 4BC9A 2KVQE 1X4HA 2XMWA 2ZHAA 3ISND 2B3TB 4I2QB 1VS3A 1OQ6A 2MQPA 4MIAA 4NLSA 3MGJA 3C2PA 3CD6S 2DNHA 2HURA 3KHRA 4UOFA 2CJKA 2CPIA 1VQKS 3I5AA 5HVHA 4PXEA 2RHSB 5JXSA 4QPTA 2OTJS 2ACYA 2KHDA 4NASA 1FRKA 3VAMA 2GVDA 1VK8A 4OI4A 4ZCMA 4ELUA 2V69A 1IBLF 3TI0A 3HFKA 2YKPA 1SPBP 4ED3A 2VA3A 2R8GA 4K2JA 2J6UA 3FFIA 2IHR1 1IKXA 4JI5J 3GZ7A 1TV6B 1CJKB 2W2PP 4UW2A 5D0EA 1NJIT 4L6V3 2ZFHA 3CJ8A 3M32A 2WVEA 1GH8A 3ZZYA 2AJFE 2WCXA 2R8IA 1TQLA 1FVSA 2M70A 4WKYA 5CYQB 1VMBA 3G6ES 2W8KA 4RBUA 5JMNA 4DZ6A 2IAJA 1T3NA 2KM8C 1HWJA 4J90A 4KGZB 2NCKL 2GGPA 5FIIA 4IR9A 4RL1A 2UXDJ 2YWKA 3NNHA 3HHEA 1X0PA 5AXMA 2XB2D 1V5IB 1C0UB 2QA4G 7FDRA 4AQYJ 5E5NA 1FX2A 3SCLE 5GVQA 3DOKB 5HVFA 3MZIA 2PMHA 3HSJA 1S6UA 1YRUA 2F9JA 4CTAA 4YQWA 4ELVA 1LK5A 2OP5A 4NXNF 1VQPS 2XWYA 4YOEA 2ZH8A 1L3VA 5DDRC 3OVAA 3J7YI 5DGAA 1AROP 4CO0A 3K5PA 3R5DA 4DBQA 1SV5B 1HL6A 3DLBA 2B4VA 3ISNC 3I0RB 1HI0P 3CCVS 4UOCA 1UL3A 1GMVA 2VKZG 1VIXA 2IJRA 1WOOA 2QO3A 1U1OA 5A0YA 2CQ3A 2ROEA 1S0MA 2VPXB 3AD8C 5ETSA 1IBKF 1NMEB 2ZUGA 2HRTA 3W5YA 3QBCA 1U2CA 2KDOA 1U2FA 2IIHA 6FDRA 1JLEB 2F8EX 3KJVB 4ZVPB 2C2RA 4RNHA 4KT0C 3FC9A 2GQQA 1WC4A 1X9MA 4YY3F 1KKHA 1S6QB 5DM6Q 1Q5VA 5KFVA 4R8UB 3SZ2A 1WHVA 1UA0A 5E3RA 3HD2A 4JI2F 3G71S 3CJ4A 3HHLB 3G8SA 3TJAA 2HS4A 1RDRA 2QE5A 2CQ0A 1S99A 4B02A 3J7A1 5KG5A 3IO1A 1T9TA 2R7SA 2ZH3A 1NK4A 2KFNA 3OTOF 1FFGB 4N77A 1U25A 1S0OA 2X3DA 1GT8A 2G2YA 3E2EA 2EFQA 4PG8A 4ZVFA 4N8OA 1M5OC 1Q0NA 5F3ZA 3ZZPA 1ZTTA 2KHCA 4TU8A 4ED6A 2DNZA 4ZVTB 5HQLA 2HGLA 1R0BG 1J27A 1D9DA 5B0AA 3EUNA 3KHLA 4QYZJ 4NCAA 2UV8G 1WOPA 1H72C 3AY0A 2KI2A 4X4VA 2VOOA 2UU9J 2DNNA 1MMNA 1YWXA 3HZEA 1T94A 4A8SA 2ZBQA 3M9MB 4F2SA 1UFKA 4LMZA 2HHUA 5IT9U 1MN9A 2H5EA 1NKEA 1WDDA 4IOCQ 3P49B 2MDAA 4JI4F 2ASJA 1U8WA 2LXUA 4PYDA 2J8AA 3ENQA 4A46A 2A3JA 2QZ8A 3QT7A 2JOQA 3V6HA 3W1YC 1Y7PA 3CNQP 2LFVA 2UUAF 3Q8UA 3SCIE 4TVAB 4MT1A 1U26A 1XTZA 3PR5B 2MHEA 2HFOA 3K59A 3NEKA 2RQCA 4DR7F 3PRDA 3GIKA 2RD5C 3PR4A 2HYIB 5A8WB 4IFVB 4KGMA 4UF4A 4C11B 1FF2A 4C2MA 2YVSA 2L08A 1I94F 2VG7A 1XMQF 1EX8A 2GAHC 3EDRB 2C2ZB 3FBFA 2ZITA 2A2DA 3VAKA 3ELHA 2LDIA 1IR2A 3J7Z5 4ZIWA 4M5HA 1URRA 3CCZA 3I96A 4X66J 3HULA 3J7ZT 1QY7A 3OL9A 3BGFA 4P72A 3VV2B 2N4DA 3DU5A 2JFDA 4OX9J 4FKYA 3L7OA 4CO3A 1H6KX 1U8SA 2FDNA 2V8GA 3NGDA 3F44A 2RHQB 3ZTPA 3J81j 4CLFA 4DV3J 4UUWA 4P10A 2E9TA 3BR8A 1TELA 2N3LA 1CSJA 2OPPA 1HWUA 3Q86A 5J2QB 1ZA2B 1RT5A 1FD8A 3QFWA 3V81B 1WTFA 1BQNA 1RT3A 5E7OB 2ZWOA 1CJVA 5G0RB 2HHTA 3OFEA 1EHWA 1NDPA 3SCJE 2W9BB 3GV5B 2AZ3A 1SI9A 2HVEA 4A4JA 1T7PA 3BBFA 4WIIA 3MR2A 2O3DA 2QG9B 4KQZA 1YQHA 4DV1J 5LJ5Y 3LPYA 2U1AA 3A8KA 1FJGJ 3HSZA 2CNOB 4JI0J 4EYHB 2OELA 3VGSA 3L7PA 3AB2B 3I9V9 2CA9A 5CZXA 4JI1J 3A3NB 4RBVA 1RLCL 1Y4ZB 4KIAA 2HQIA 3BKUA 4AXJA 1NM2A 2D3OR 2GV1A 1EQMA 2RE1A 1NUEA 4N7TA 1BD6A 3W64A 4YB7A 1BC6A 4C0OC 3IC1A 3CIZA 4EFAC 2DCUB 2W7PA 2E5IA 3T6JA 4DFKA 2WAQD 4J37A 2EBGA 3VGTA 1V3ZA 1PILA 4A8YA 2F65A 4QR1A 4WFNQ 3HK2A 2VFTA 2KJVA 4ED5A 1WSVA 2V8DA 3KYLA 5MLCV 3H2UB 4MAKA 2XGQA 3H42A 1TU0B 1MROA 3H5SA 2BQRA 1UW4A 4FPIA 3AD7C 1JK9B 1HARA 1VDHA 1ROFA 4LQ9A 3OUYB 3ET6A 3I31A 3HJFA 4K4VA 4F8RA 3M30A 1VRUA 4Q8FA 4J9RA 2XEXA 2LQJA 3LP0A 4LQ3A 5F9LA 1HBMB 4ZP7A 1TUVA 2W4DA 2BJ7A 1WHYA 5E3QA 2ZBIA 3L7UA 3M8YA 2G2ZA 2ZC4A 2IVMA 1F3FA 5F0WA 4C8LA 1QUPA 2E5GA 4RW4B 3NGRA 3NS5A 4DF8A 2R4FA 3RRGA 3T6BA 3FCVA 2B43A 2W2QP 2HZAA 2A10A 4M5DA 2J7UA 1RYSA 2ZBRA 4LFAJ 4AXIA 2HMIB 2BRKA 1HNWF 2C3PA 1FRIA 3LWLA 4AFFA 2HVHA 3OVSA 3PX4A 2ZH4A 3EVWA 4LVOP 2H1YA 1LNQA 2AGPA 4CWBA 4NXMJ 3NMRA 3HSGA 1N36F 4B3TJ 3KK3A 5DQIA 2UZAA 1RT1A 2UVRA 2AU0A 2ALYB 3PTWA 2MQNA 4NYZA 1S9EA 1X4DA 4KV8A 1EIYB 2EI5A 3OFHA 4NWBA 3OL7A 2RQMA 5GAGU 4LF2A 1SJQA 4U95A 3BPDA 2JFKA 3B8HA 4RW9B 5CYMB 3T9NA 3UO0A 3H20A 4G1IA 1S79A 3WIUA 2HK3A 2IBOA 1N5TA 3WX4A 4ZIVA 2DB1A 3QAEA 3LAKA 1RBLA 4ZPCA 4ILRA 4HHJA 5IV4A 2C2OB 3FSYA 1RTZA 3UD3P 3SBMA 2V68A 2LU2A 1KOHA 3TA0A 1GMUA 2AWZA 2RUSA 5HMXA 2VL1A 3L95X 5HMZA 2QA2A 3PKYA 4C9DA 1W7WA 2HLTA 1CJUB 4OI6A 3KDNA 2UXDF 2BE9B 2PEBA 2MQLA 5C24A 2CPYA 2RS2A 4K5RA 3NP5A 3HF5A 3W2VB 1WI8A 4TY8B 3KLGA 2CNKB 3RBXA 3TR5A 3MM7A 4OZ2A 4B9VA 2Y9HA 4CM0A 1C1CA 1TL1A 5BR8J 1Q16B 1B70B 4OI1A 2ZH9A 4DPXA 3IR5B 4JOUA 3QLHA 3PW4A 5D15A 4HTJA 1VHIA 4EZ6A 3FNNA 1N8RT 2ASDA 3B4MA 1HQUB 1F5CA 2IA6A 1S1TA 1G1XA 4N76A 3C19A 3RB0A 1BXNA 3M9NB 4HLBA 2UXBJ 3G4SS 1JJ4A 3DU6A 1W2IA 5A2QY 3DDNA 1FXDA 2YWGA 2BW2A 2LYVA 1JLGB 3MUVP 3EZOA 5ADZA 2KRRA 4USHA 1JX4A 5HK4A 1GXUA 3SQGB 1X9SA 2MZJA 2B8PA 2BBEA 3VQSA 4OLPA 2FLNA 1TVRA 4LR9A 3DN9A 1ZS6A 1PC5A 4NEZA 3BO3A 2KXNB 3M2VB 4LIWA 3M05A 5F8IA 1R6VA 3CDEA 1IWAA 2HS0A 3I5CA 4ED0A 3SXLA 1RHRB 3OSNA 5J1PA 1FXLA 1NAQA 1E6YB 4Y2MA 2D3O1 4B9TA 4F04B 1NCLA 1N5SA 5IT4A 4DLEA 2FHOB 3ILOA 5LXYA 4ER8A 2W4CA 4QQBA 1ZETA 4IQMA 4FBUA 4OX7A 3VAGA 1DY3A 4KKOA 2BMBA 1T9YA 4XDDA 5T41A 2JLFA 4ZITA 1S0VA 1SQGA 2FZGB 5D4LA 1EP4A 1YJVA 1C0TA 1Y11A 3C14B 2PI4A 2R2TA 1F9FA 1R8CA 1RBOB 1V5VA 3ITHA 5GMKa 4J9NA 1X8DA 1N33J 4HACB 4QZVB 4NI2A 4F4ZA 2E1RA 1I51B 5LSRA 3TZZA 3JTPA 3OXGA 4R25A 2RQKA 2V0NA 4USVA 2GO9A 3PFEA 3W60A 2HHQA 1HBNB 3HM9A 1KOOA 2PDAA 4LBHA 3R7NB 4DR5J 5J2PB 3ZC4A 3QIDA 4ALZA 1UZHA 3UNYA 4J9OA 1TAQA 3GFZA 3OL8A 4DQPA 4W4MA 4P2SA 2VG5A 3DOMB 4Q8EA 5KT2A 4U6PA 1NNDA 1SJ3P 2YWHA 1KP6A 4HT5A 3IMQJ 2V4JB 1JLFB 2FYXA 1UMJA 1BHNA 4YDDB 4X66F 1FNOA 1R6YA 3NCPA 1RAEB 4OJGA 2R2RA 1VCTA 4OX9F 1Z1ZA 4TU9A 1S48A 2QL5B 3GSIA 2E1CA 4TU7A 1WC0A 3VAFA 1U4BA 4NLYA 2AW0A 2I8EA 5E3PA 3LANA 3GP9A 3TOQA 1QAIA 4P2FA 2VC0A 4RWXA 4PEOA 2U2FA 2CADA 3DM2B 1RT6A 2B8QA 1RABB 1U6ZA 2JHEA 3S8SA 1FEEA 2DITA 2WVBA 1L5UA 4NA2A 3BM7A 4DL0C 3M8QA 2OJ3A 1PJ6A 1RADB 3D5MA 4E2FB 2XMUA 1Q5YA 5IM0A 1HI8A 1MWYA 2BKNA 2E7WA 1L3KA 2VFVA 4W92B 5EWEA 2BDPA 2EFPA 3EZ5A 4DV1F 1UWBA 5KG7A 4ZLNA 2JEIA 3MM8B 1DJ0A 2OMLA 3CPWR 3NY0A 1HNIB 4Q7AA 2VZ9A 1GK8A 1O6XA 3GYNA 4ZKAA 4OZ0A 1MWZA 1S7HA 2IJFA 5KFMA 2VQFJ 5KOWA 3TZYA 1CS4A 3AOCA 2LQ5A 1LKZA 2I5JB 2KXHA 4X65J 3O44A 5CH7B 4QWCA 4TLQA 2HWTA 3PZPA 2UV8A 1JLAB 1JKHB 4N41A 2FQQB 1H7WA 5KFIA 4LFBJ 1FESA 4NLGA 4OV6A 4CYUB 1W26A 2W4PA 1RWOB 2X3GA 1DTTB 4DUZJ 5ETLA 4BDPA 3MM9A 4MJKA 3IBFB 2UVVA 4K2XA 4YB5A 4ANDA 2MHNA 3E01A 4MK7A 2HAIA 4ECUA 3KLVA 5ITHA 4QU7A 1OY6A 2AD9A 3PRVA 1YJ9S 1UZDA 1H38A 1RAIB 5FLXU 2GFFA 2NPIA 3D0IE 2ZHOA 1VK3A 1JIHA 3R8YA 1PYTA 1ZM4A 2ZKUA 4R5PB 5KT5A 4A8KA 4C8NA 1D3WA 4IH5A 2AJ0A 3HD1A 4J9SA 2F7VA 2MPUA 2AZ1A 4I56A 3R5GA 1JB0C 3UR3C 1P6TA 5K8OA 2R7RA 3GWCA 4YFUA 5EGYA 4LBIA 4CZCA 1MU2B 4NLPA 3GE9A 5ETQA 2Q66A 3ENWA 1NSPA 1PJ5A 2QLXA 2ZH6A 2YQ1A 1SL1A 4ED2A 2XHCA 1RHMB 3DLHA 3KK1B 4XAKA 2OPQA 4DPOA 4DFPA 1X5OA 5K14A 3BF4A 3SFUA 1RTIA 1X5TA 4FXDA 1T9XA 4NYOA 1TK0A 1N5YA 1XMOF 3PVXA 3AODA 5IT0A 1RAFB 4ERDA 5BXIA 5B7WA 5IXUA 4PUOA 3VVUA 4NXMF 4DV0J 1PSDA 3RZAA 1OYEA 3CJKA 4ZHRB 3HCXA 3PHTA 4I7FA 4U67Q 4WPAA 4WYWA 3OW2R 5KT6A 4P2XA 3IG1B 3HDSA 4JYAJ 4LF8J 5D0RA 4IG0A 1REVB 1UAWA 2W8LA 1FJ7A 4TQSA 1FD2A 3SV3A 2GVZA 2XO6A 2IDEA 5L1JA 1YX2A 2QA1A 4PQUA 4AYBD 4ED8A 4EUVA 4LT6A 3I4PA 3JSMB 2HZVA 4Y28C 3RUBL 2V6AA 4LF4F 4WTOB 5D4OA 1FHTA 2J0SD 4WXWA 1DURA 5CYJA 3R2DJ 2BOPA 2FLOA 4OJ3A 2Y1RI 5HATA 2CWXA 4OHVA 2VG6A 2HHVA 2X1AA 3CCJS 1HKAA 1YK9A 4WU2A 3BYPA 4D3GA 5B0FA 3H98A 3MM5B 2CQ1A 2DEJA 1EKRA 3CCWA 2ZZNA 3CJQA 5H9FJ 3N4WA 1Y0HA 5FDLA 1U0SA 5MAOA 2H48B 4NLRA 2VH7A 3V6DB 1FRMA 5BR8F 1E6VA 1IKWB 5IQ6A 3NBPB 3OT9A 3NNCA 3P5TL 1CG2A 4EU0A 2CRLA 4KY3A 4ZVHA 4KH0B 3RU0A 1S72S 4DHVA 1JNRB 1RA7A 3C16A 4ZK7M 4DFJA 3FBCA 4LBPA 2VPWB 1URNA 3NNAA 1XK8A 3ILLA 3E8OA 2UXBF 2APOA 1IM4A 4F0KA 1SL2A 3JSRA 3NWRA 5KFYA 1RAHB 1KFDA 5F41A 3FSXA 3BJYA 2IVFB 5KFAA 1EETA 3OR2A 3R5BA 1FDBA 5GADU 3PCOB 1J2VA 4LRDA 2CDQA 3N0VA 1EARA 1T8EA 3PNIA 4OYIA 2GMHA 2RDDA 2WW8A 4KPYA 2JZ5A 3HI9A 2POKA 4QWDA 2WSEC 3CCUS 3MTJA 2DY1A 3PG9A 3FFIB 1Z2ZA 1ZBTA 3AAWB 3Q8VA 4DXLA 1TUGB 2FHJD 1FNXH 3IS9A 3T1HJ 3CC4S 4OX6A 2ATLA 3M6XA 5C2CA 3MPYA 5DS7A 4YDXA 3T3FA 5LMUJ 1JNZB 2WHOA 3PHEA 4FPRA 1KLMA 3MCNA 2KG0A 4O4GA 1KLNA 3R9LA 4LVNP 5G4DA 2CQDA 1CJTB 4KSEB 3MFIA 2MYFA 2IAJB 2E66A 1K47A 3KHHA 2GGPB 3O2IA 3BDEA 4TNOA 2HFSA 2Z57B 4CO4A 4YB6A 1B4SA 4LF5J 2AQ4A 3FQLA 2G4BA 3MAAB 2ZH7A 3OTDA 1OSCA 2YY3A 3H2LA 3T19A 1OJ4A 2OPSA 2OPRA 5KFCA 1F5AA 3ONQA 1VOMA 3C8YA 4FF3A 3GR1A 1OQ3A 4C8ZA 2HS3A 1IKVA 4ZPVR 4M5GA 1RHKB 4P6QA 5EHHA 3X1LB 5H9EK 4CTAB 4C97A 3J80Y 1NH8A 2FHMA 3HVTB 1U09A 4WFXA 1N34F 1MWQA 4CLLA 2GIFA 3HX9A 3BBBA 4U9RA 2CPFA 3BQ1A 3UWTA 3W65A 1T9WA 2ZC3A 3BGOP 4G1QA 4CI0B 4GMKA 3H59A 2XULA 3LALA 5ETNA 4DG1B 2BYCA 2WVCA 1TL3A 4QWBA 5C42A 2L9DA 5DLFA 2MLXA 4C8KA 1F2HA 4EWTA 2FY8A 3A3PB 1WF2A 1PJ7A 2RVJA 2VDIA 3I9ZA 3G6YA 4IFYB 2ZBCA 3HHDA 2JLEA 1CQMA 3NS6A 2ZHBA 2HBZB 2RSQA 4NLTA 1ZPVA 2PSZA 3MEKA 3VGUA 3IA0A 2HNDA 2EG1A 5A6WA 1HR0F 2IRYA 4O3OA 3L4BC 1VQSA 3IM8A 4IRDA 1H2TZ 1HYSA 1Q78A 3L09A 3DLEA 3PKMA 5IWAF 1RWKB 3PM9A 4ZDNA 1UVIA 4FF1A 4PG7A 2L3MA 5I3UB 3TAMA 2O01C 4DV2J 3DGPA 1HW8A 2VICA 4ICLA 1N4LA 4YP3A 3W2WA 2HFUA 1IQZA 1WF1A 4WTYA 4ZVUB 3OPKA 2NZ4A 1SKWA 1OY8A 3OJSA 3TANA 4RWWA 1FRXA 2BE7D 4GO7X 2G9OA 2Z8QA 4O44A 2O5DA 1RT4A 2X51A 3L9ZA 2CQPA 2GJIA 4B9UA 4I0WA 5IV3A 2E29A 3C6UA 3D1HA 2R7WA 2HNZB 1C4AA 1TL4A 3CD7A 2H65B 4WWSA 3QZ8A 1SIZA 2QYGA 3M2RB 4ZCKA 3FQKA 3GQCA 4RW7A 1SH0A 2P5VA 4X65F 3PY8A 1A7GE 4M5MA 1CC8A 4RBTA 1RA6A 1DRZA 3A3OB 4Z7YA 1X4CA 3CWJA 3Q2SC 4LFBF 4OHXA 3GJQB 2LECA 2CQ4A 5CZVA 3DLGB 5EUHA 1UFLA 4WZQA 3FEYB 3OSPA 4RNFA 1NPKA 3MEDA 1RZMA 4WJBA 3SV4A 4X4PA 3BQ0A 4Z2XA 2M88A 2B5JA 4GC7A 3KLIB 2VG7B 4H4MA 5FD1A 3C15A 1FTCA 3JYTA 1ZH5A 1FKAF 1N0VC 5KG0A 2D41A 1JQGA 2KN4A 3D9BA 4IDKB 2HFNA 4KO0B 4K4XA 1TKTA 1FE0A 5HANA 2YBVA 1JXEA 1RWUA 5K8MA 3DHXA 5E0OA 2JVRA 2NXJA 2DGWA 3NOGA 2B9EA 1NU4A 2WBRA 2B9WA 4WFBQ 4RX6A 4OL8A 2JVOA 4MTPA 3W66A 2J5AA 3BO2A 6AT1B 2VJUA 4DR3J 4K7QA 2P6SA 2XWXA 3MPDA 4KYZA 3IRXA 3QAUA 1DARA 3SSQA 4ZP9A 2J0WA 3WC0A 4M5LA 3NS7B 2ZOFA 2EK6A 2MKCA 4P71A 1BQNB 4CO2A 1RT3B 3H8YA 2YKNA 1RLDA 1CJVB 3BSOA 3SDEA 2AEMA 3QRQA 4K4ZA 1S57A 2CAJA 3I56S 3W5ZA 4DL7A 2HGNA 2DHGA 3TQ1A 2HHHJ 2EKNA 1X9WA 4B3MF 4KHPJ 4JP8A 3O8WA 1HMVA 4X4TA 1AUSL 4X4SA 2M5YA 3BH7B 2CQGA 3OFGA 1TL5A 2KRBA 8AT1B 1MG7A 4JYAF 2R7OA 3M2UA 4H4OA 4LSZB 3UN5A 4F7VA 3RB6A 4CLZA 3UE2A 5KFHA 5D4NA 1VBYA 4EEYA 3DRPA 3IFEA 3CUNA 3TWZA 2PA8D 3CDUA 1QUVA 1S1XB 1YJWS 2M3DA 2YNHA 3QGGA 1P27B 4DSKA 2UUCF 3BGLA 1A6LA 1HNZJ 3CMAS 1HQEA 4K4YA 2YQ0A 3AD9C 1RTHA 2IY5B 3FCHA 1A0OB 4PYAA 3R6LB 3VWSA 4X64J 2AX0A 1S49A 4DX7A 4EK2A 3AQOA 2L48A 3ETMA 4B3SF 5A8RB 1MROB 4EBEA 1PBUA 4TKTA 3D7SB 4L74A 4DR6J 2Y8WA 3PJ9A 5HROA 1M90T 3ET6B 2ZKTA 1N6QB 3TP2A 2DNGA 3I0SB 2F4FA 3LP0B 4EI2A 4V19X 8RUCA 3K0JA 4V1Ak 4KFBA 5J1EB 3LGHA 4AUKA 2NSBA 4QIFA 4RLEA 2YKQA 2ZJQQ 3EX7B 1GTEA 1U0HA 1OY9A 4TXSA 3V4IB 4NE9C 1HNXJ 1U49A 2XYPB 4M1KA 1B99A 3MEEB 4NLQA 4NL5A 4IQXA 2BE2B 4M5DB 4L3KA 3B82A 3BR9A 5DGBA 2GQCA 2CVIA 2DBBA 2ZH5A 1YHQS 2DEIA 4CLUA 4UY85 3KUEA 3UD5A 2AHOB 2WW4A 3MUMP 4ZLLA 1WORA 2VPYB 4UY8T 4M5JA 1NH7A 2XHWA 1KC8T 3CJ5A 1UWAA 1NBEB 5KFQA 1Q8LA 4CNZA 3FGVA 1Y5IB 2YKMB 4ES2A 3PO4A 3QNWB 3M1VA 1AA1B 4DLGA 3KK3B 1X4FA 4MYTA 3DRYA 2L9NA 2E5LJ 4I2QA 3U1NA 1FWKA 1Y3JA 1TMMA 5KFPA 1S9EB 1HWIA 3GIIA 1K8AT 2KO1A 1RU1A 1QSSA 1YZ6A 4X4QA 4IO9Q 4RUBA 4DL6A 2MKHA 3KDOA 1KQGB 4K5SA 2IMOA 4JI7J 1RQ0A 4C48A 5IC6B 3QGHA 5DG8A 3G8QA 3GONA 5KG4A 2AJQA 3R27A 1B3TA 1X4GA 2FC9A 2DR9A 2XM3A 1REGX 2J0XA 3UCUP 2V63A 4ZN3A 4G3IA 4RKUC 2R7TA 2RU9A 2WSFC 1VHFA 4ES3A 4EBCA 4EO8A 2CYYA 3EE3A 2HQGA 3UCZP 3TVYA 1G6BA 4ED4A 1PGZA 4JI8J 1F5BA 1NSAA 4CT9A 1LWCA 1CQNA 3POTB 3IM9A 4OYZA 4LF5F 5C24B 3D2WA 1S1VA 5D0HA 1RWMB 3KLGB 2UUBF 5CYQA 2FVQA 1CLFA 1C1CB 2ILYA 1TL1B 4HR2A 3UDCA 3HPOA 5HSPA 4JI3J 1WG1A 3RJMB 3P45B 3T5KA 4OJHA 2CNNB 3QLHB 4A8XA 1S4FA 4USUA 1Q81T 2OKQA 4PG4A 3CD5A 2RDJA 2I1RA 1S1TB 3QT6A 2GIQA 3TUIC 3KJNB 1H2UX 1TK5A 4DSJA 3PX6A 2KTQA 2YWFA 3HSDA 1SH3A 4AL7A 3DLKB 4OHYA 3UDEA 1NDCA 1YBTA 3LUYA 4GRSA 4QBUA 5E2QA 1VRQC 1VBKA 3BEGB 3J80U 4LF9J 3C66A 4ECWA 1D1UA 4IUFA 4Z37A 4LR8A 2J6SA 2HBYB 2D69A 4N5SA 4IOBA 4ES1A 3BS9A 2WVFA 3IN5A 5K20B 1VGYA 1OWXA 1TKZB 2F8MA 4HYKA 2R9LA 3KG1A 5KFNA 4HEA9 5C5JA 4F4WA 3KK2A 2FY1A 3D67A 1Q8BA 1HHSA 4GVBB 4DV4F 4X62J 1S1UA 3KMQA 1BY9A 3MR6A 1M5VC 4RUHA 2DVIA 3Q22A 1B0TA 2GZOA 5A76A 3HHLA 4DX6A 1FJEB 3BQ2A 1U1NA 4B9LA 4OQJA 3K8VA 1RAJA 3MHYA 3SYZA 2E44A 1NJWA 3DXSX 3KMSA 4LREA 3ITHB 3TARA 4E8UA 2QLBB 3RAMA 2QJ3A 5DETA 4B9SA 3R7SB 1VC5A 3DYAA 4AL6A 2KKHA 2CPHA 4NI2B 4IG3A 5T14A 5AT1B 3G6VA 3QATA 2QV6A 3VCDA 3IR6B 1RTJB 1SB6A 2CQHA 3SMZA 4LF6J 2ATCB 1RKIA 3BSNA 3P4UB 1YBUA 4Y3CA 1M5KC 2ABYA 2H5JB 4P7VA 2LLZA 3GIRA 2XZWA 1J5OB 3GB0A 4HI1A 2HHPA 4GKJF 1FK9B 3KLHA 3Q83A 2VG5B 5M2RA 4CLKA 2OD6A 2CJXB 1KR4A 1UCNA 3GV7B 3NGTA 1R0AB 4DCJB 3R1LA 3FBEA 4PG6A 1R7IA 3DI6B 3B54A 3HKZD 3THVA 5LOQA 1SJFA 2XZDB 4NMXA 4CQ1A 2NPFA 5A8WA 4IFVA 2RS8A 3N6NA 5AJ3F 3JAMU 3IWLA 3Q2TC 1AFJA 3FZBA 4C98A 1DTQA 2FJXA 3TA2A 3PW7A 3DNCA 3MM6A 2GQ2A 4IKAA 3A12A 2V34A 5KAKA 3I55S 4DPTA 2EPIA 1RT6B 4ZJLA 2B7CB 4CM2A 2RJZA 1VQYA 1SJ1A 4O0NA 2PEHA 4M5IA 1VQ6S 3VALA 2DY9A 3FK4A 3M8QB 3RAQA 9RUBA 1TUWA 2DHHA 2QMXA 3JB9k 3HHLC 5KFTA 2V9WA 4IRCA 4HH1A 1WF0A 4WZMA 2R7QA 2Q1LA 4UQTA 5J2QA 2AYEA 4DUYJ 2HHHF 1VRTB 2KYZA 2OI2A 1UWBB 2DXFA 3Q8YA 2CKWA 2W2NP 3VVTA 1N5QA 1RBAA 3PRBA 5G0RA 3DRSA 3AB4B 4ZPDA 3R7BB 2W9BA 3EM1A 2L41A 3UR0A 1FO1A 4O3RA 3IP0A 5IOLA 4ETZA 5F9NA 4WP8A 2ZD1B 2HQCA 1UTAA 2AV5A 3MMJA 1I1GA 1SC3B 3MR3A 2D3ZA 4L3NA 1LW2A 3NL0A 4USWA 5KTQA 1ZM2A 5IQQA 3K17A 4CH7A 1NEEA 2YKAA 3MCOA 2FLPA 3E01B 1B7FA 3SI8A 4BLGA 5GAEI 4ECYA 1YJ7A 1OPIA 2HEKA 5DQGA 3BO4A 2I6WA 2WONB 1N88A 4PRFA 5JJBA 2QX0A 2H9ZA 4DR6F 1YBAA 3HO1A 1SIWB 4A8WA 4F3MA 1B7YB 3CC2S 4DV7F 1R8PA 3WIVA 4DL5A 3BBCA 3VAHA 1CVJA 4DL4A 2JRSA 5F8GA 3CEDA 3UN3A 3M6UA 1PAEX 5DG9A 4HH0A 1XNQF 2FC8A 5LMNJ 2DR8A 3OLBA 2NQPA 2BX6A 3ZZZA 3H90A 2IYGA 1XMBA 4A48A 3OUYA 1Q53A 2KL8A 2DNYA 4RR5A 2QEXS 2ASLA 4GKKF 3QSYB 4DSFA 5K14B 3TW0A 2DRAA 3UNGC 3IXQA 1U1LA 6FD1A 5AE2A 4FBTA 2BJ9A 3D3BJ 3O5TB 2DGVA 1XN9A 2C2MB 4DR2F 2OFHX 2C42A 3QSIA 4WK1A 1JLCA 4JV5J 4DPYA 4PUOB 4FYXB 1UPMB 3CJKB 2E5LF 2BANA 4I7FB 2IFXA 3BV8A 3H25A 2DCLA 3TNVA 1X7VA 2XNRA 2MJNA 3IGNA 4C0HA 2COLA 1ZM9A 2OSRA 5AXNA 3CVKA 4JI7F 2XZTB 4YR3A 2F5GA 2HNYA 1IXKA 4KAIA 1OS5A 4PQUB 2VD3A 1O8BA 4DZDA 2D3UA 2PGCA 2ZH1A 3OJUA 3ZZUA 3RR8A 4KJIA 1NPPA 2WVDA 4F02A 3SSSA 3CJSA 1HW9A 1VQ4S 2H54B 3M6VA 4BBYA 2GX8A 2FB0A 3ZNJ1 2KT2A 4NLUA 2F63A 2PE8A 2XG8A 4A47A 1SH2A 4RW9A 4FYWB 5CYMA 3GR0A 5J2MA 2LEPA 2RH3A 1OSDA 4YB1P 2JX2A 2HSEB 2YX7A 4P74A 2NLWA 4K0KF 1IJEB 1SKUB 7FD1A 2XC9A 2W9CA 1U2RA 3HVWA 4LF7J 1YRTA 4PWWA 1VBXA 2OSQA 2NXCA 2VOPA 1H7XA 5KG3A 5I42B 3HT0A 1CJUA 2HKEA 2VHGA 4JV0A 1D9AA 4WFYA 3SFGA 4UZBA 2NXUA 3W2VA 2Y1IA 4O3NA 1FFWB 5KFGA 3PIPQ 2HVIA 1S5ZA 1T95A 3RBEA 3I5BA 3AJDA 3CXCR 4OMFG 3ZTRA 2MB0B 4OYBA 1NDKA 3QT5A 3VQTA 2DGXA 1UVKA 4QYRA 1HPZB 3IR7B 5I3QA 5ETVA 1IVZA 4CO1A 2DNQA 4FS2A 4PR6A 4OYWA 1NK5A 2WTFA 1WG4A 1EETB 3AFGA 1HQUA 2F40A 4KC5A 4YMEA 5HVGA 3QMQA 1K0TA 3CCTA 4ID5A 2OHDA 4ECVA 4Q0BA 1N0UA 4UT4A 3KG0A 1Z2LA 1SC6A 2IVYA 4ZLJA 2DNOA 3EICA 1S1WB 2CPXA 2LEBA 3IS9B 3WHIA 4DQSA 3SQGA 4NZ7A 4XK8C 3RR7A 3JTOA 1N32J 1DHMA 3BN7A 5HQ8A 4U7UK 3PFOA 1HD0A 1VQNS 1XNRJ 1O5JA 1JWWA 1WKJA 1N48A 4O4GB 2RU3A 1IBLJ 3LPEA 1LV5A 3RGIA 1BQXA 2O66A 4RO0A 1D8YA 1HBOB 2QT7A 3DXBA 1V9OA 5HJYA 5ETMA 1TMJA 1NRKA 3TVKA 3DLLQ 3DKDA 4U8VA 2DGSA 1SJ4P 4ZPBA 4TYAA 1UVNA 3T5JA 3MUTP 4XO0A 1UEVA 2XMMA 2OPSB 2OPRB 2G0JA 4XPEA 4ZN1A 2R8KA 3A8EA 2EFOA 1F6TA 3WZ0A 2EFNA 1QVGR 3DGVA 3C14A 2MQOA 1IKVB 5A6PA 3NKYA 3K89A 3Q8QB 4HVZA 5JUMA 3FKBA 3VAIA 4CT8A 2W2OP 3DDIA 3AXKA 1NKBA 3E51A 4B3RF 3PIOQ 4LF6F 1GXLA 2EKYA 2ZVIA 2YNGB 5DQHA 3MMBA 2OEKA 4X4OA 2OIHA 2BABA 3VGVA 1YGYA 4G1QB 2Q6CA 1U1KA 3MMCB 1S9GB 2GHPA 5H1SV 3KUGA 1VC6A 1KQSR 4IOAQ 1TL3B 5C42B 3GIJA 4RJVA 4CP5A 3K57A 2LDYA 4ECZA 2XSFA 4LUBA 1T05A 2MQ8A 2MSTA 2B9XA 3RTVA 5HN0A 1HBNA 3HHNB 4WIQA 5J2PA 1K73T 4ZP8A 3IWXA 3CJ0A 3D68A 1DBDA 1JXLA 2QRRA 2V8VA 1SXLA 2FJEB 3CCRS 3FDSA 1WEYA 1GMWA 4OHWA 2P6TA 2FVRA 2NS1B 4NLXA 1JLFA 1IKYB 1FX4A 1HYSB 4YY3J 3DLEB 1HHTP 2PFDA 5EN1A 4V19J 2VC1A 4RZRA 2AX1A 3DGPB 3TJ8A 1F9EB 2KXFA 2PT0A 4JI2J 5CQGA 1XR6A 4ICLB 2BRLA 3W2WB 3ZZOA 1A9NB 3CJTA 2MGZA 4DX5A 3GFYA 2R2SA 2LKZA 1G4CA 2R8HA 4URSA 2F3JA 2AMCB 2XCAA 3KXDA 3VR1A 4OLOA 3PACA 1RT4B 1Q79A 3O1LA 3DC2A 1U6BA 4G1PA 2Z2ZA 3PX0A 3M7VA 5E3CA 4HI2A 1ELOA 2N3OA 2R2UA 2MQMA 4RW7B 1TKXB 2UVWA 3NGKA 3ZZRA 2GHWA 4BC7A 4FVCA 1SJRA 2HWHA 4WBFA 3HFZB 2YKOA 5KT4A 4M5NA 3K5OA 4QW9A 3NGUA 2KFYA 1RACB 1WC3A 1WACA 3HP6A 4EMDA 1GQEA 1ZAXA 4JI5F 3IWNC 2RRBA 1F1BB 3FJ2A 3ZTQA 4GO5X 2A2CA 5JVGQ 2RUGA 3MEDB 4NLDA 4I1TA 2KZMA 5L39A 3SCKE 1UJ5A 4ETXA 2F9DA 3KFWX 4H4MB 4RW6A 3C15B 3JYTB 4ZP6A 5KFFA 3JSYA 2UUAJ 1JKHA 2KVIA 1TL7B 3KJQB 2CG8A 1RT2B 1NZ8A 1TKTB 2QMWA 3J7AN 4CYUA 5F8LA 5EX3A 1DLOB 1FRHA 3V2UC 1DTTA 3D6TB 2OTLS 2AEFA 2XLIA 3M8SA 3EPGA 2J9EA 4P9SA 3W3SA 3J81Y 2YPYA 3A8JA 3GG1A 3CCMS 3EJMA 1C1BA 1G3OA 2OEJA 4AQYF 3M6WA 2C22A 4MKBA 4C3MA 3JQJA 2A6MA 3CO9A 4USJC 2OD4A 3ZNUA 4Q45A 3IRXB 4KRWA 3WDOA 3Q8RB 4HDHA 5J2NB 1CEZA 4R5PA 2LVWA 3GJTB 1VQ9S 3W8GA 2WOMB 1M1HA 1WEZA 3C6TA 3G87A 1MMLA 1T0TV 1KONA 2E9ZA 4C8OA
chains in the Genus database with same CATH topology
3V4MA 2LA6A 4H4MA 4QYZJ 4NCAA 2UV8G 5FD1A 3SDEB 1FTCA 3AY0A 3JYTA 4FXWA 1ZH5A 3N5BA 1FKAF 1N0VC 2KI2A 2Q79A 4IYQA 5KG0A 4X4VA 4I69A 2D41A 2X1FA 2VOOA 4X4NA 2N82B 2DNNA 2DHXA 1MMNA 1YWXA 2KN4A 1T94A 3HZEA 3M8PA 4A8SA 4JV5F 1S6QA 1N5VA 4RNNA 4IDKB 3M9MB 4F2SA 2VQEF 2HFNA 4KO0B 4K4XA 4JV2A 4R8UA 4LMZA 5CCMA 1TKTA 2HHUA 1FE0A 4PCQA 4WU3A 4X2BA 3HXMA 2R7XA 1JXEA 1RWUA 3MDFA 4DWIA 4DV2F 5K8MA 3DHXA 3F41A 5E0OA 4N8NA 4Y2KA 3P96A 4KKOB 1KQFB 2H5EA 1NKEA 2IMWP 2JVRA 1KRPA 1YIJS 4IOCQ 3P49B 1HMVB 2MDAA 2XSJA 4JI4F 2ASJA 2FUG9 2W7AA 1EP4B 2LXUA 1C0TB 2DGWA 4QWEA 2J8AA 4FF2A 3ENQA 1GAOA 4A46A 2ZDPA 3MR5A 3CDBA 1NU4A 2QSFA 2WBRA 2A3JA 3M2UB 2QZ8A 1SKRA 2B9WA 4TLRA 5HO4A 2B6AB 2JOQA 4WFBQ 4RX6A 2RILA 3OV7A 4OL8A 3HHLD 2JVOA 3V6HA 4MTPA 3GSDA 1Y7PA 2J5AA 3MD3A 3BO2A 2LU1A 3QIPB 2BJDA 1NKCA 2ZE2B 2UUAF 1OO0B 3SCIE 3L3CA 3DRPB 4OI2A 2DNLA 2K2PA 2DR7A 2P6SA 2XWXA 1U26A 2C3UA 1NJZA 1XTZA 4RW8A 1U47A 3PR5B 2MHEA 2MZ1A 2HFOA 3K59A 3IRXA 3QAUA 2RQCA 1ZAVA 1DARA 2YNHB 3SSQA 4ZP9A 1S97A 2AYGA 4DR7F 2J0WA 4OI3A 3WC0A 4ZHRA 2UUWA 3DOLB 2PI5A 3PRDA 2ZOFA 4EO6A 2K7JA 1DAXA 2EK6A 2EVZA 3GIKA 2MKCA 2RD5C 2R7UA 3PR4A 5FJ4A 1NK9A 3E3XA 2HYIB 5A8WB 5KFJA 1WWHA 3ZZTA 2RB7A 2YX1A 1BQNB 4IFVB 4KGMA 1RT3B 4CO2A 3H8YA 4C11B 3VZHA 5BJRA 1FF2A 4C2MA 1HQEB 2YKNA 2YVSA 2L08A 3TAPA 1I94F 2VKRA 5U47A 3CCLS 2VG7A 3BSOA 2O67A 5I42A 1XMQF 4FF4A 4X84A 4F4YA 2B0GA 3TYTA 2VFUA 5L9XA 3SDEA 3RRHA 1YJRA 2UP1A 4KTQA 5D3GB 2ZITA 3N6MA 4ZS6A 4K4ZA 2A2DA 3I56S 4DL7A 4CNYA 3VAKA 2DR5A 2HGNA 3BDPA 2LDIA 1DQAA 2DHGA 3J7Z5 1TAUA 2JDJA 3G8TA 1AW0A 4FNIA 3TQ1A 2FVPA 1URRA 3CCZA 2J6TA 5EDWA 3I96A 3OVBA 2PO4A 1X9WA 3J7ZT 3OL9A 1QY7A 3BGFA 4RNOA 1JJHA 2MZTA 4B3MF 1SBRA 3JSMA 4ELTA 2N4DA 3R5AA 3DU5A 2JFDA 3L7OA 3O8WA 4CO3A 2Z0GA 1HMVA 3EGZA 4X4TA 1RGVA 2M0GB 4X4SA 2M5YA 3RB4A 2HRUA 2CQGA 2MSSA 1TL5A 2KRBA 3OFGA 1H6KX 1SL0A 3H4BA 2IRUA 2BV3A 2VV5A 1U8SA 2R7OA 2FDNA 2N7YA 3H40A 2V8GA 3BSCA 3NGDA 1WNEA 3M2UA 1LOUA 4H4OA 4G6VB 5B0EA 2EW9A 3GILA 3F44A 3RB6A 4EBDA 3EXCX 3UE2A 1TFWA 4KFBB