4DUZJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4duzJ00
4YHHJ 4X64J 2UXDJ 5IT9U 1I94J 4JYAJ 3J7AN 2ZM6J 4DV0J 4DUZJ 4LFCJ 4LFBJ 5AJ3J 4NEZA 4JI2J 2VQEJ 3W1YC 2UXBJ 4B3SJ 4KHPJ 3J81U 4NXNJ 1XMOJ 4DR7J 1HNXJ 2UXCJ 3IMQJ 3D3BJ 5LMNJ 4X65J 4DUYJ 2UUCJ 4DR4J 2MEWA 4JI6J 1HR0J 2KL8A 4KY3A 4RJVA 3OTOJ 4HHUA 5IWAJ 1XMQJ 4DR6J 3R2DJ 1HNWJ 4JI4J 1XNRJ 4V1Ak 3J80U 2UUBJ 2MQ8A 1N32J 5BR8J 2UU9J 3JAMU 4DR5J 4DV6J 4JI8J 4LFAJ 2KVQE 1J5EJ 4LF6J 4DV5J 4YY3J 5LMUJ 4LF4J 4JI3J 4JI1J 4JI0J 4B3RJ 3R2CJ 4DR3J 4OX9J 4DR2J 4LF5J 2F4VJ 4JV5J 5FLXU 4AQYJ 4GKJJ 4LF9J 4K0KJ 1N36J 4KYZA 4JI5J 3T1YJ 1IBKJ 4DV3J 4JI7J 4X62J 4DV1J 1HNZJ 4B3TJ 4GKKJ 2HHHJ 5LM7E 5A2QU 4DV7J 4DV4J 4LF8J 1FJGJ 3T1HJ 2MTLA 4DR1J 1IBLJ 4LF7J 2VQFJ 4DV2J 1XNQJ 4X66J 4NEYA 2UUAJ 4B3MJ 2E5LJ 1N33J 3D3CJ 4PWWA 1N34J 1IBMJ 4NXMJ
chains in the Genus database with same CATH superfamily
4CNYA 5CAAA 5KG3A 2LU1A 3T6JA 3JSMB 4LFCJ 4HEA9 4JI2J 2FGOA 2HLTA 3JTNA 3W5YA 2XGQA 2LXIA 3PJ9A 3ZXWA 3WHIA 4DFKA 2RQ4A 2XMJA 2GQCA 5CCMA 5FLXY 3H0PA 2HHPA 2E5JA 2B9XA 1HMVB 1LOUA 4OHVA 3N79A 4G1PA 3PYEA 2E1MC 4WP9A 1RBLA 3BJYA 3THTA 3CMES 3HHDA 3WDOA 2XCAA 2UVUA 1XC9A 4KC5A 5HVHA 1C4AA 4DSEA 2RSQA 2E29A 2QT7A 4HR2A 2HS4A 4DZ6A 3KLVA 2ILYA 2MKKA 2GNKA 4TY9A 3M4XA 1FK9A 1LEOA 3SCLE 1N48A 1FJCA 3KUGA 2DNPA 3M8PA 1A9NB 3UDLA 4LVNP 5D15A 3SQGA 3EGZA 3QAEA 3MR2A 1FE4A 4RUAA 4DX8H 2MDAA 1GMUA 1NSKL 3IAS9 3PRVA 2IMWP 1IN0A 4EBEA 4IFYB 1T9XA 3U1LA 5B0EA 2AEFA 3MEGA 2H5JB 4MK9A 3R2DJ 3GV7B 1H38A 5B08A 3MPYA 2P8IA 4DV5J 4IDKA 4Q45A 3F41A 8ATCB 2GMLA 2L9DA 4LRDA 3MM7B 2B6AB 4DR2J 1TV6A 1HW9A 3WZ0A 2YNHA 1Y5IB 2IIHA 5J2MB 1Q16B 2UUCF 3FEYB 2HZVA 4OL8A 3MEEB 2DHXA 4U7UD 3KG4A 4PR6A 4DR6F 1U4BA 3M32A 4K4UA 1NO8A 3ZZOA 3W63A 3SMZA 4OI0A 5DG7A 3OUYA 2KHDA 5L1KA 3CO0P 3PW7A 1Q78A 1YRXA 5D6GA 1M0SA 3IAM9 3J7AN 2IVYA 2XO7A 1YBUA 5KFZA 1YI2S 4XO0A 3TA0A 3MCNA 4KV8A 3KK1A 3TNVA 3BR9A 4O3RA 3ELHA 2PDAA 3B4MA 4CCHA 3UW1A 1HBMA 4DCJB 1NKCA 1RQ0A 3FCVA 3AAWB 4LF7F 4A46A 4LT6A 5RUBA 1UVIA 3UVJA 1JXEA 2HRTA 2J9EA 4F3OA 2MKYA 5ADZA 1EB0A 1HD0A 1ZAWA 3HSJA 4F3MA 5CYQB 4ED2A 4KFBA 2AGQA 1S7HA 3EZUA 4C0OC 2ZH5A 4BWMA 1LWXA 2CG8A 3PR5B 3AQOA 3P5BP 1OQ3A 1YBTA 2XMWA 3HP6A 3OSNA 3ZTQA 3G8SA 4G3IA 1SV5B 2ZNYA 4F7VA 3CD0A 1FK9B 4B9LA 2G2ZA 4AL5A 1RT4A 3M8PB 2A0FB 2VDHA 3I4HX 3DN9A 1FRHA 1FDDA 3CVKA 3QZ7A 2UXBJ 1Y9OA 1VJQA 3MEGB 1WOOA 2KB2A 2JL9A 1M5PC 2CQ4A 4J91A 2AYGA 3A3NB 4KH0B 4P2SA 1XNRJ 3IRXA 4IDKB 1T9VA 2UUBJ 4RNHA 4ZVQB 3KXDA 1PO6A 4YEAA 1WC6A 1PJ7A 3NS7B 4DXLA 2YNHB 2YVSA 3EVMA 4O3NA 3RZAA 2AYMA 3NNAA 1CULA 1X5TA 4O3OA 2C1EB 3G8TA 3M32B 2OEMA 4JI6F 1R7IA 2F7VA 5ITHA 2RIJA 2HGNA 4RW8B 2L08A 1X9MA 3OUYB 5M2RA 2JEGA 1XR5A 2V2KA 1BC6A 2OKQA 3HZEA 3R1LA 1UPPA 3QWUA 2OELA 4FNHA 5GAHU 4KV8B 4ZPDA 3KK1B 3TAMA 1F5CA 3QIPA 3R7BB 4RU2A 2DTJA 3PO4A 4YB6A 1X9SA 3H8YA 2CQIA 1HBMB 3SV4A 3IMQJ 4WK1A 2CJQA 3PRDA 5IXUA 1DTTB 5AXLA 3LWMA 4EGLA 4UOFA 1TKXA 3UVJB 3ADAC 3FGVA 4I2PA 2VIHA 3N5BA 4KFBB 3C6TB 1Y10A 3GIMA 2KRRA 2HFUA 3G9CA 4JV5J 2B9EA 1TP7A 1W25A 1KBRA 2FZGB 3GTYX 1IR2A 1KLMB 3QT8A 2A2CA 4QR1A 3BGLA 3MMBB 5FJ4A 1HQEA 5L1JA 3D28A 3MPDA 4NX9A 2VA3A 5HMWA 1OY8A 1FWLA 1RT4B 2HK3A 4UQTA 3PX6A 3AD8C 4IFVB 4DUYF 1GTEA 2MLXA 4ZPCA 2F4VF 5LSOA 1JNZB 1OWXA 4OYBA 5DDPC 3DXBA 2DY9A 3DLHA 3VZHA 3IRXB 2X7IA 1X9WA 2RKIA 3TUIC 3JS9A 1J2VA 3NNHA 3PO5A 3B4DA 5ETPA 3PM9A 4DL2A 3RBZA 5GADU 3MR6A 2WTFA 4LR8A 1LWFA 1U47A 3ULHA 1VBXA 4TLRA 4LF5J 1RWXB 3UE2A 2XO6A 4RNOA 1FERA 2LDYA 2ASLA 5A6WA 1NB7A 4Y2AA 3BBBA 1U25A 1TFYA 1HNWF 3MD3A 3J80Y 2CPYA 1NAQA 1U1RA 3LW5C 1CBKA 1OJ4A 3TAMB 1HL6A 1RAJA 3QIPB 4EWTA 4FBUA 1EJ7L 1P9QC 3HVAA 4O0NA 3P49B 2P6SA 4YDXA 2FJAB 2VHGA 5CXTA 2DNMA 4A48A 1NK0A 7FD1A 5GAGI 1Z4UA 1TKXB 2DHHA 2V8HA 3DDNA 2OGUA 4C98A 4I2PB 1YITS 3OTOJ 4AL6A 1XK8A 4NOHA 4DN9A 4V1Ak 2IBOA 2M52A 4KT0C 4K4YA 2Q1LA 1URNA 3IR5B 1AXQA 1TZ0A 2ABYA 1RXOB 5ETOA 4WFNQ 4DV4F 1WSVA 3MFIA 2WVBA 2J5AA 3TEGA 1HQEB 5KG4A 3A8IA 2QJ3A 4LIRA 4A8WA 4WFXA 1A0OB 3SBMA 5LMNF 3OXLA 2HHXA 3X3UA 1CLFA 4F2SA 3SSQA 1UAWA 1TL5A 3FNNA 1R89A 3E8OA 2V5HG 1D0EA 2M8DB 5LXRA 1RT1A 2RDIA 1PBUA 3HDSA 1PYOB 1IBCB 3UN5A 2FJWA 2W4DA 4QWDA 4ELUA 1WJ9A 2RKIB 3A13A 4ZKAA 1VQ5S 4CQ1A 1X4AA 1HQUB 3QT5A 1AUDA 4XPEA 3MTJA 4PWDA 4R5PA 1Q79A 2B5JA 3MEKA 2VICA 1LWFB 2P5VA 4L6V3 4WYLA 2BOPA 3NS6A 3V4MA 4JI7F 2ZEJA 3MOZA 3US5A 3GYGA 2KVQE 2Y1IA 2MJUA 1TL1A 3LWLA 1C4CA 4IRDA 2DBBA 1KEKA 4OLOA 2HFZA 3VGUA 1IKYA 1P9YA 1S4EA 5KT4A 3UN2A 2BJ8A 4ES2A 4CLZA 5M2PA 3H42A 5ETRA 5EHHA 1WOPA 1FFWB 2QIFA 4MKYA 2VBYA 4CH0S 4K4WA 4F50A 2UVRA 1FJGJ 1ACMB 3HFZB 3LF0A 1LFPA 2LU2A 2XMMA 3L9ZA 1ZETA 2HNZA 4NMXA 5E33A 3NGTA 3T9ZA 4NEZA 4LRFA 1U2FA 2EFNA 2Y1RI 1WC1A 1OYDA 1UPMB 2EVZA 3I9ZA 2FQQB 4MH8A 2B4UA 5J2PA 1TELA 5B7WA 1FE0A 3ETOA 2Z2LA 3I5BA 5THWA 3B78A 3UNGC 5IV4A 2OH2A 3MPWA 1S9EA 1U24A 3DGVA 3L3CA 2VFRA 1LWEA 2D69A 3HMJG 2J9DE 4HHHA 2JDJA 4P9SA 2YKNA 4P72A 1N32F 1FT8A 3N5FA 3CGIA 2KM8C 3A3OB 5D0GA 2HVHA 5B0AA 4CYUA 4CO3A 1S6QA 4MIAA 4NLVA 3GIRA 1GTHA 2VASA 3BH7B 3NAIA 5DM7Q 2E7WA 5KOXA 3CIZA 1RWKB 2XQCA 4ZLJA 5KFCA 4R5PB 1W26A 1FNMA 1KRPA 1FJEB 5GMEA 1VQYA 2M4MA 4O44A 4DUYJ 1VHFA 4DR4J 2FB0A 3K89A 4A8YA 1X31C 2EFPA 4AXIA 3OFFA 4WCEQ 2WZ1A 1S1XA 1TK8A 1TL1B 3EJMA 2U1AA 4O0IA 3A8EA 3TA1A 1YJRA 1IKYB 4YUDA 1NB2A 1ZM3A 2HHQA 3GMGA 1BXNA 3D66A 1IWGA 2SXLA 4F4ZA 3BM7A 1Y3JA 2IM1A 4X66F 4RX6A 1KS2A 4PG8A 3NOGA 3GU0A 4NLOA 1SC6A 3HHNB 1SC3B 2HVIA 3N4WA 2XSFA 2FY8A 1WOSA 1WC3A 3WC0A 4XDDA 5KFGA 5KFRA 4M5KA 3UN3A 3R27A 1TU0B 1NSQA 1UETA 2ASYA 4C48A 1RLDA 4H4OB 3TJAA 3OLAA 2CPIA 3DXSX 4UQGA 3MMCB 2D7SA 5HL7Q 1Q0NA 2PA3A 3J81U 1NPPA 3ZZUA 2HAFA 2YNIA 5J2PB 4FYYB 2RUSA 4DPXA 3RB3A 4LREA 3O8WA 5SZTA 4FXWA 2BRKA 3GG1A 1U1QA 3MR5A 4Y3CA 4F3QA 4LSNA 1S9EB 1LWEB 5KFAA 2R8HA 2DR8A 5AJ3F 3FFIA 3OL9A 3P8BB 2N82B 4YP3A 3BEGB 3GJQB 3JQMA 2ACYA 2MKJA 1RHRB 4C8NA 1SKWA 2AJ0A 3M1VA 4DV4J 2Z56B 4CYUB 1S6QB 3JQKA 2JZ5A 2H4WB 2DGUA 2VQFJ 2H1YA 1M5OC 1HHTP 3LGMA 1RA6A 2P9EA 2V8DA 3CCWA 2A6OA 4FF4A 1VCTA 4O44B 3CF5Q 2DPIA 3W2VA 2IY5B 4ZCKA 1YJ9S 2X1FA 4JI8F 3UDEA 3EGNA 2K7JA 1V6HA 1Q8IA 4KY3A 1Q7YT 1KKHA 2J9CA 3GYXB 2CJYB 3C16A 3MI7X 3FCWA 5HSPA 4PQUA 4O3QA 3ZNJ1 3CXCR 3OSPA 4NE9C 1GT8A 3QGGA 4OJ3A 4B9SA 2KO1A 4Z37A 3B8HA 1VQ7S 3HFKA 4NZ7A 4JI7J 4U6PA 4M95A 1BGXT 3UR0A 2GO8A 1LW0B 5C24B 2M3DA 3EGVA 3AA9A 1KSPA 1ZZNA 1K73T 2VPYB 2WAQD 2JEFA 4HVZA 1TL4A 2CNKB 2AX0A 4ECXA 3SQOP 3J7A1 3I31A 4DL4A 2R7OA 3C8YA 4OMFG 1PIEA 1KOHA 2XMKA 2CUYA 5DDOC 3B82A 3W1YC 4R8UA 3A4TA 1FNOA 2NXJA 4ED5A 4A4JA 3SEOA 4B3RF 4WPAA 2AT1B 4OHXA 4LF1A 3W65A 5KFEA 4HT7A 3FFIB 1TAQA 4DCOB 1WEYA 3QO9A 5LT5A 2HVZA 3NNCA 1OMSA 2R2SA 5DDQC 4NL5A 2DGOA 4B3OA 3G87A 1PAEX 1T03A 1X4EA 3BDPA 1Q5YA 1T9YA 2QFIA 2OUGA 2HHVA 4KAIA 3PZPA 1T3NA 3PTWA 1ULRA 2DNLA 2EC0A 2ZUAA 2X1AA 1FHTA 1FEEA 2HFNA 3G6XA 2Z4PA 3ZC4A 1N5TA 3MF5A 4NA1A 4ZJQA 2CPEA 3RTVA 1SJRA 4LJMA 4DSJA 3J81j 3BSNA 4USMA 1DBDA 3H5YA 3C14A 1JNRB 4DQPA 3W60A 5JMNA 2E1AA 5HO4A 3VQSA 1VMBA 4CO5A 3C16B 4PQUB 3DRRA 2CVEA 4WTYA 4J9LA 2K3KA 2R9LA 3CIMA 3HT0A 3TYTA 3WIVA 3BYPA 3ILJA 2X1BA 3MXHP 4O4RA 4QQBA 2Z58B 3OW2R 2IA6A 4ALZA 4LF9J 2K7KA 3IWNC 2DITA 2IDLA 2NYIA 2KG0A 1FKPB 4USJC 4CLPA 1RAGB 1FFSB 4XTTA 2D9PA 3J7Z5 3AJ2A 4X66J 3LPEA 3K57A 5D4OA 1IBMJ 5DZ6A 1U0HB 4R8UB 2HZAA 2ZHBA 1V5VA 3J7ZT 1T9UA 4LVOP 5I3PA 3ZZTA 4KKOA 2EKNA 4UZCA 1I5OB 4C8OA 2C3OA 5D8HB 2XSJA 4ANEA 3NXZA 1HNXJ 3QRQA 1XN9A 3QT7A 1RU1A 4BC9A 2XY7A 5K20B 1XMQJ 2F1FA 3RB4A 2XYHB 1ZPVA 2JWNA 3CULA 3QO9B 1BWEA 3IR6B 2UUAF 4I7FA 1SPBP 1CJTB 3K58A 1VC5A 3NGKA 4YHHF 1Y00A 4B3OB 3SCKE 4DR3J 1T03B 1FFGB 2ZNZA 4Z7CA 3ISND 5FLXU 2EXUA 4X84A 2RU3A 2EK1A 4F0KA 1XR7A 3EPGA 3CCZA 4HDHA 5KOWA 4UW2A 1F3FA 1FXDA 4OZ5A 1EZZB 2QX0A 2OTLS 1WWHA 5GVQA 5DGBA 1HNVA 4HH1A 3KLHB 5IC6B 3IA0A 4MYUA 3D3CJ 1RAIB 4JI3F 1VOMA 2AJ1A 3C14B 5DO2A 1YJVA 4F4AA 3H2VE 3M6UA 3FBEA 4M5LA 1SJFA 1VQ9S 4NI2B 1O0PA 3L7UA 1REGX 2VOOA 5GMDA 3IXQA 4PG4A 1Q81T 1HPZA 1RTJB 2RD5C 3O44A 1YG0A 1FDAA 1XBWA 2C2OB 4JI8J 1M1GA 2U2FA 1OPIA 1I1GA 2CYYA 1RWOB 1JIHA 1UTAA 1M5HA 2HQIA 5C25A 3CJSA 2R2UA 3TQ1A 2NXEA 1GQEA 4OI4A 3DLLQ 3HM9A 3AH6A 3VQTA 4WF9Q 1PGZA 2F40A 2YWEA 2O1PA 3BKFA 5ETVA 3M30A 1LXNA 2H4YB 5KT7A 4KKOB 5G0RB 1QSSA 2NUUG 2W2MP 2CNOB 4PEOA 1FD2A 2XSJB 1U1NA 2FZKB 2EFQA 2CJAA 2BJ9A 2A10A 4RWXA 4JOUA 2C3PA 2LA4A 2EW9A 2W1BA 2XY5A 2DH9A 1RSCA 5JXSA 4DV1F 4B3TF 1VGYA 2RNEA 5K8NA 5G4DA 5LOQA 4C8MA 2XZWA 4O4GB 3EXCX 2HHHF 5K14A 1YTYA 4X4SA 4I7FB 1XWLA 3OTEA 3DI6A 5E3QA 1DFDA 1L3UA 3I96A 4J9KA 5AT1B 1C1CA 2Z8QA 1S76D 4F4YA 2DR9A 3DU6A 3Q83A 3M05A 1Q8LA 2F4FA 1H73A 1QAYA 5J1NA 2DXEA 4CH7A 4B3RJ 1U26A 4WTOB 2RQKA 2OPQA 4KHPF 2XHWA 2R8JA 4X62J 2CJBA 2C2MB 7AT1B 1QLNA 4FP9A 1BQNA 1FTCA 2HFVA 4DV7J 4OZNA 2V8VA 5A8RA 2JFKA 4DUZF 5K9FA 3EGWB 3JSRA 1RWMB 2PMWA 4CLUA 2CQPA 2BW7A 2AX1A 5H9EK 4ZA1A 2JH3A 1LV5A 2V4RA 4UOCA 1IR0A 4AQYF 2DNZA 2WBRA 3H5UA 3OR2A 2RE1A 3TP2A 5C2GA 1HPZB 4EBCA 2UXCJ 2VPXB 3H59A 2EK6A 4ZVTB 1TUWA 2NXNA 2MYFA 1T95A 4QU7A 2HG4A 3D68A 5I4MA 4F8RA 3UCZP 3QRPA 3QQCD 3LOUA 1X4BA 3MHYA 1XQIA 4MAKA 5C25B 3CCUS 3E01A 1RHUB 4DV0F 3UCGA 3VVTA 3CJ4A 4FNIA 4MYTA 1WI6A 4GKJJ 1EQMA 3IBWA 4JBCA 4TQRA 5KFSA 3P4UB 2ASDA 3ITHA 3TX8A 2QZ8A 3K5NA 1LNQA 3HSZA 3MR3A 4DSIA 2XS7A 3HX9A 3M30B 3M9NB 2L41A 1T9WA 4X4QA 4DR5F 3L09A 3R5CA 4NYOA 5BYRA 5K8PA 1XNQJ 2WCXA 4X4PA 2LFVA 4DSKA 4MKAA 3NAHA 3NWRA 3OLBA 2YKMA 2PI5A 2ZM6J 5B0GA 5K14B 3P96A 4WK3A 3DI6B 4J9OA 1R6YA 4CH1A 4GKKF 4O3PA 2V0NA 5HVFA 1C1CB 3QJJA 1B0PA 4Q0BA 4KGMA 5FIIA 1PJ6A 4ZOSA 3TJ8A 4NLRA 3KLIA 1EX8A 4Q7AA 2OPQB 1SKUB 1R0AA 4IH5A 2WBMA 1SL1A 3QPIA 1S6PA 2QFJA 3BO2A 1RTHA 1C0UA 4IH6A 2IM2A 5L1LA 1IBKJ 1BQNB 5JUMA 3HHKA 3GIIA 4GC6A 1YK9A 4I6AA 3PFOA 1ICEB 5A8RB 5HVGA 3OQ2A 4EYIB 1HW8A 3C19A 4ZVFA 4DR1J 3DLJA 1QAIA 3RUBL 2PO4A 1JJHA 4PWUA 2UVVA 5HI7A 4BC7A 4OZ3A 2HNYA 2K2PA 4FKYA 1BE4A 2O5DA 1HBUA 3D6HB 1N6QA 1YJWS 2ADBA 4ECQA 2ZH9A 2KT3A 1VRTA 1DQ9A 2FD2A 3HJVA 3D67A 3KUHA 4FN5A 2ASJA 2MMYA 3BQ0A 2VPZB 2IM0A 3T1HF 1R8AA 5KFUA 3CO9A 2O66A 1MLAA 3D6TB 2OIHA 4DV2F 3E01B 3M8SA 3MPUB 3PX4A 3N9UC 2C2DA 3FRZA 2ZH3A 2Z2YB 3ZFVA 2ROEA 1TTHB 2JEIA 2LCWA 3AD9C 1MG7A 1SQGA 4N76A 2GVZA 2ZJRQ 1VDHA 3FMWA 3HHLD 5AXMA 4DPOA 5EN1A 3NG8A 1P27B 2AGOA 2ZDOA 3LPYA 2V94A 3HKZD 3GILA 1YZ6A 5LM7E 3HJFA 4M5HA 4PCQA 1N5VA 3SYZA 2NSCA 2YX1A 2YKMB 2ZH8A 1GX5A 2ALYB 1VI7A 2QLBB 1UFKA 4WJBA 2Y3YA 2JVOA 4CLWA 3MAAA 2MQMA 3KWMA 3MDFA 4AXJA 2WOMA 4WE1A 1VJWA 3DDIA 2O3DA 2JC0A 3C6UA 4A8FA 2ZH2A 2ZHAA 2M9KA 3OHBA 4K4SA 4X65J 3RYLA 4J90A 3EYZA 1CEZA 1S1TA 1AB8A 1H3DA 4ZVRB 5E41A 3V6DA 4OX8A 3KLIB 4AUKA 1F3VA 4IUFA 1NDCA 1R0AB 5DG8A 1SCJB 4ZPVR 5L9XA 1K1SA 1S6PB 3OD2A 2F9DA 3ZZYA 1C0UB 3BN4A 4TVAB 4M63A 4WIIA 4XK8C 4RW9A 4PG5A 4OYZA 3JYTB 1BWVA 4TYAA 1KVJA 1FF2A 2ZOGA 2EBGA 4ID8A 2FJDB 3I4PA 3TR5A 1S1WA 2E7VA 2D1CA 4WZQA 2KDOA 2E1PA 1VRQC 2HNYB 2VJVA 5KFXA 4EU0A 4IKAA 2GQ2A 1HBUB 3MM6B 1N0VC 5CH7B 4JI0F 1N6QB 1R43A 1WG1A 4C7QA 3CUNA 4DJBA 2DR5A 4JUZA 3CJ3A 1JLFA 2Y8WA 3TI0A 4PYAA 3CC2S 4N8NA 4DUZJ 1JKHA 4XDCA 2UU9F 4ILMA 2DR7A 1C1BA 1B0TA 4C8ZA 1KC8T 2JJ4D 2BM1A 2IJRA 2C22A 4KSEB 2MZSA 3TQEA 2GS8A 1LWCA 2BKPA 5HLFA 3LTOA 2XYPB 4USTA 4ILRA 1TUVA 3KK2A 1UWAA 4OI3A 2HKEA 2ZH7A 2QO3A 5E3RA 1UJ5A 4RW6A 4BS2A 4NCAA 4Y6IA 4HH0A 2VJUA 4ZP6A 2GJ2A 3AY0A 5DM6Q 1HWKA 2ZH1A 4ICLA 1NLKL 1H2TZ 4ED3A 3IS9A 5LSRA 1ZZFA 5L1IA 1R8BA 5A2QU 2QL5B 3BS9A 3W62A 1R0BG 2LEAA 3FBBA 2CJKA 2YQ3A 3H98A 2RRAA 2IVFB 2ZJPQ 4YY3F 3OVAA 2WOMB 4WE1B 3FDSA 5H9FK 1HBNA 2QLFB 3C6UB 2DY1A 1R31A 2DGQA 4OYIA 1JLGA 4Y0FA 2R7RA 4P73A 3CCRS 5KFKA 1S1TB 1TVRA 3V6DB 1YRTA 1HNZF 1OYEA 3I32A 1HNIB 3BBFA 2R7TA 2QEXS 4HI1A 1HBOA 4ZCIA 3MM5A 3QJPA 3KLGB 3KJVA 4AL7A 3CCJS 2EFOA 2JX2A 1OPZA 2XHCA 2E5LF 2MZRA 3JTOA 5KG0A 1GFWB 3MM9A 4NYZA 1XMBA 3K17A 3HD1A 2CQBA 4LFCF 4JI2F 3K0JA 1K9MT 4IG3A 4NRTA 2BJ1A 2QA4S 2DEIA 1S1WB 5CD4H 1BY9A 4KHRA 4ECVA 1RUSA 2KFNA 4PYDA 3PYFA 4DHVA 2DEJA 3SV3A 2X3DA 3BQ1A 1KVKA 3A1YG 1ITPA 1S49A 1JLFB 4Y2KA 5D4LA 4ECWA 5KT3A 1OSDA 2W01A 1JKHB 1U1KA 5HROA 1C1BB 1S9GA 1YIJS 3R5GA 1UEKA 4X64J 2GIRA 3Q8UA 9ATCB 1ZTWA 4AT1B 5K8OA 1RT2B 3FMBA 4QZVB 2KN4A 2IC3A 1PILA 2DNNA 1LWCB 2CADA 5HLFB 2FC9A 4X4OA 3CDWA 2K3IA 3KK2B 1EP4B 4QBUA 3TUZC 3ENAA 3MWBA 4RW6B 4ZIWA 2POKA 1RTDA 3CDUA 4ICLB 4DFJA 1WHWA 1Q5VA 1S99A 2RQMA 3IS9B 4QPTA 1HA1A 3WIUA 1R3NA 5J1PA 1AFIA 3SFGA 1E6VA 4F0MA 2VFUA 5IQQA 3GV5B 1OS5A 3MECA 1EIYB 3Q0AA 2BJ7A 2OD6A 1NZ8A 2B7BB 4I68A 4G1IA 3TUPA 2Z0GA 1HBNB 2EG2A 4DV5F 1JLGB 1N34J 2GW8A 4USKA 4DR2F 3SSRA 1TVRB 2AV5A 2WVDA 1HIYA 3WQPA 3KK3B 5DDRC 4ECRA 2N7YA 3Q8VA 2VG7A 3KLEA 3DLEA 1M1HA 3H90A 1FXLA 2C2KB 1HBOB 3MM5B 3KJVB 5L39A 3X1LB 2CPJA 3PHTA 2LDIA 4YR3A 2HVEA 3CW2C 2QA4G 3MM9B 2PA8D 3A12A 4CI0B 2NYHA 4FPRA 3GV8B 2XMAA 1VC6A 3S01A 5KFDA 1RBAA 2XEXA 2JOQA 2P6TA 5E3PA 4B08A 1SL0A 2OEKA 3OHAA 3G2XA 2GHPA 2Q43A 4YN3B 2LECA 2V8PA 2PSZA 2DYAA 2LLZA 1RAOA 1TL7A 2HIQA 5KT2A 5HROB 1S9GB 2V8GA 1PJ5A 1P8GA 1UJ4A 4HACA 1QDUB 3BZQA 3V5RA 2MQNA 4P2XA 1CQNA 2IC3B 2QA1A 4NLSA 4DL5A 4QJVA 4E2FB 2IM3A 4U7CA 5BR8F 3I0SA 4C11A 1T9TA 4I67A 1SQEA 4FS1A 2H48B 1QD1A 4NLGA 1KFDA 5I3UA 2XY6A 1RK8A 3RBDA 1RTDB 3ILIA 2JLEA 1SKRA 2HSEB 1LW2A 4TY8A 1VQSA 5ETTA 2CJ9A 2UU9J 3VWSA 4LFAJ 5F8IA 4URSA 3BO3A 1QAXA 2W9BA 1T94A 4LF6J 1NXIA 2XI2A 1EETA 2X51A 3AOAA 3FUYA 3RU0A 4UTGA 2FHJD 2I8EA 2UXBF 3MECB 4YOEA 2N4DA 1UW4A 2R42A 1NK7A 2CQ3A 4J9UE 3O6QA 1N5YA 1AT1B 3O2IA 3KLFA 1XNRF 3CCSS 2UUBF 1HARA 1CPZA 4MT1A 2HPUA 1GMVA 4DL6A 3H2LA 5CABA 4NYPA 4B9UA 5H9EJ 1S97A 2VG7B 3DLEB 2VC0A 2DH8A 1HD1A 2YWHA 5HANA 4K4VA 2CDRB 3HHLA 4NLUA 3GSDA 4DQIA 4C0BA 1Q8KA 4L73A 1TMMA 4ECYA 2VZ9A 1PYTA 4F26A 4NLPA 3DM2A 2OPRA 4ANDA 4JI1F 2DKOB 2DPJA 4WU2A 2W2PP 4DDFA 5KFBA 4ED6A 2QMUB 1KN6A 4RBUA 3RG6A 3KDOA 3TAQA 4QR0A 4YR0A 1DY3A 1DQAA 3ENQA 1G6BA 4ZLPA 1RYRA 4FPIA 1VK3A 5ETSA 5BYSA 3HCXA 2Y8YA 1KR4A 3I6PA 1PYSB 3GIKA 5ETNA 2EC2A 2KZMA 3AT1B 3N6MA 2VH7A 2DK2A 3HULA 2AW0A 4OZ2A 3M6XA 1ZA2B 3JB9k 4IQMA 2PN6A 5E2QA 4ZS6A 3AD7C 4HACB 2MQPA 1D1UA 2MLZA 5FDLA 2ZWPA 1Y0HA 3MM8A 4KGXB 5D3GB 3NMRA 3QSYB 1S9FA 3CJ0A 4RW7A 4ELTA 3I0SB 3DRPA 4DX7A 2J0QD 5F3TA 3KKFA 4JV5F 4TU8A 5I3UB 1F9FA 1K0VA 2NXCA 4ZJLA 2W7AA 2YPZA 5MLCV 1O6XA 3CDAA 2R7UA 1LW2B 4TY8B 2RRNA 4CLYA 2NREA 2HWTA 2ZKUA 2W9BB 2QSFA 1UFWA 3HVWA 3MUMP 3W2WA 4KJIA 1EETB 2M88A 1SB6A 2DR6A 1VQOS 1DTQA 3DRSB 5HMZA 3CJQA 1J5EJ 1LQ9A 1KQKA 1RT3A 1YJTA 3C46A 4KO0A 2E5HA 4YS2A 2HURA 3CB4A 4K2JA 2VDIA 4LR7A 1SQFA 4MFBB 1S57A 3KLFB 3IM9A 4F0HA 5F41A 1CS4A 3Q8SB 3G6VA 4EBDA 4PUOA 4KGKA 1Q86T 3DLKB 2Z2MA 3RAMA 3C66A 1D9DA 2FIUA 2KRBA 5KFJA 5B0FA 3DNCA 1PCAA 3UFCX 3OFEA 4DF8A 2PC6A 3HHLB 1NK6A 1MSWD 1M1KT 4Q8EA 2HWHA 3PEHA 3KJNB 2AEMA 2RF2A 4LF5F 2YQ0A 4TLQA 4OYPA 4C3KA 1BHNA 3DM2B 3S1TA 2OPRB 3L7PA 4USVA 2F5GA 5EX3A 1WTBA 4DPTA 2ROPA 4NWBA 4YB5A 2MJNA 3IGVA 2QA2A 4WKYA 1K0TA 2CRLA 1QTNB 1L5UA 4IOBA 3MCOA 4CLKA 2J7KA 1JJ4A 1IKWA 1TMJA 5B09A 3K8WA 4K5SA 1U49A 2RDDA 4ZVPB 3BDEA 3M8YA 2H5IB 3BN7A 2V9KA 4DLEA 5FDLB 2DHAA 2NCKL 3OTOF 1Q8BA 1FX4A 5F8LA 1YJ7A 1VRUA 2RU9A 1NK4A 2CWXA 3MTKA 3DRPB 1X4FA 3B54A 4QU6A 2FC8A 1MN9A 1QUVA 4B17A 2DB1A 4ZITA 5KFYA 3CTRA 4HDGA 4EO6A 1SH2A 4JYAJ 4ANCA 4ZP9A 3LUYA 3AJ1A 3BPDA 3CD7A 1SIWB 3W2WB 4P74A 5T41A 4Q2LA 2QLXA 1NRKA 1JJ2R 4WFZA 1MWQA 3I87A 1S0VA 3AB2B 1B7FA 3O1LA 1X5SA 1UKUA 1RT3B 4RKUC 5BR8J 1BMQB 2AP6A 1RZMA 2DNHA 3MZIA 4JP8A 2C2ZB 1RAEB 3BYRA 2VG5A 1CS4B 2J9DA 3GJSB 1KNZA 2C3UA 4PUOB 3HSGA 2D3OR 1G3OA 1FRMA 2AU0A 1WACA 3V4IA 3T5HA 2HQGA 4NA2A 3SQGB 2R7QA 2V2VA 2HQCA 5KFTA 2RF2B 4P2MA 5F0UA 5J1EA 1TFWA 4R0JA 3LP1A 4B3MJ 2G1DA 3Q89A 2KU7A 1IQTA 2PFDA 3GFYA 1V5IB 1FXRA 3UD4P 2Z30B 2D3O1 2BANA 2G9OA 3M9OB 4ELVA 1TV6B 1KONA 3DOLA 1RISA 3PIPQ 2CNNB 1ZBTA 2H5EA 1FJGF 1RCOB 2LQJA 4WXOA 1IKWB 1WDTA 3SDEA 1R8CA 5C7PA 1JLBA 2PGCA 3M2RA 5IC4B 1L3VA 4JI1J 2J0SD 1Q1KA 2Q6CA 1RHMB 5SUHA 5KTQA 3PX0A 1S5ZA 2A1BA 4H4KA 3QIDA 3W9HA 4DLGA 1ZA1B 1VRUB 3GWCA 1FESA 3HVRA 1RWUA 4UUWA 3QZ8A 1LFWA 2QC3A 3V6HA 2QLWA 3LANA 4Y2IA 2AD9A 2R2TA 1GNKA 4IYQA 4UT4A 4DFPA 1F9EB 1VBKA 4M5MA 3GB0A 5KFFA 5H9FJ 1S0MA 2V63A 1U0SA 1RKIA 1FEHA 4PQAA 6FD1A 4FXVA 2QG9B 1T3OA 4RW4A 3T5JA 1AW0A 2E5GA 3HI9A 4CT8A 4RJVA 2B3TB 1U7LA 1RWWB 3MMAA 2V67A 4QW9A 5BJRA 2CWKA 3D0IE 4KGZB 1VQPS 1U48A 5HAOA 2B9YA 2VG5B 3FCHA 1NU4A 2EFGA 2HBZB 3R2CJ 2AF6A 3V4IB 3FK4A 2GC8A 3EVOA 2ZJQQ 2ZBRA 3UR3C 1SVDA 2GHWA 4ZCMA 5IQ6A 2YH1A 3UPFA 4DR4F 2I38A 2G1HA 4DG1A 4Y2MA 3TJ9A 2V9WA 4DEZA 2GJIA 4MKBA 1AA1B 2W8LA 5J1EB 3LP1B 4LF8J 3IG1A 3DOMA 5U47A 1RHKB 4NCBA 2EKYA 4B3SF 2BR0A 1UFLA 2BANB 3FQKA 3T19A 3KJFB 2OFGX 4ZVSB 3DOLB 3W5XA 4E8UA 5IT9U 2FHJA 3ISNC 5MAOA 3ZZ0A 1XR6A 1DZ5A 1HYSA 2HBRB 4RO0A 1D09B 3SDEB 3DHWC 1RLCL 1CULB 1LXJA 2E9RX 1JLBB 4ZN3A 3M2RB 5C5JA 2JNJA 3VAFA 1I3OB 2DNGA 4Z7YA 1T7PA 3R5BA 5KFWA 1KHVA 3M7VA 4I6WA 1UVMA 2LXUA 4GVLA 2V2QA 4DS5A 3OVBA 2PFFB 3NY0A 1PC4A 4DSFA 2V4JA 3AFGA 1DAXA 3UWTA 4OX7A 2HHWA 4CWBA 1X4CA 3LAMA 1RWVB 3FKBA 1NK8A 4UUXA 2DRAA 3CD6S 2Q66A 1S6OA 3QNWB 2BMBA 1U1LA 2MSTA 4LBIA 3B6BA 2MTLA 3N6LA 5DLFA 3QFHA 2ZWOA 1B70B 1JLAA 3ISZA 2XG8A 2IJFA 2MSSA 3TA2A 1P6TA 4RW4B 1RDRA 2DRDA 3CCES 4TNOA 2ERRA 1WEZA 5E3AA 3EPIA 3MMAB 2DT9A 4NRUA 3PHEA 3K59A 1VIXA 5IT0A 4J9PA 4E0DA 2MZQA 4DU8A 2VQFF 4YFUA 2IJNA 2FVPA 3TANA 2CFXA 2N3OA 1NCLA 1U1OA 3LQVA 3OTCA 4DG1B 2AWZA 3RR7A 2VFSA 2ZDPA 3QFWA 5DJBA 3I5CA 2NPFA 4JI5J 1ZOTA 4ILLA 4C3LA 1WC4A 3PCOB 2R8IA 1ZM2A 1X4HA 2I5JA 3IG1B 3DOMB 3PJWA 1GK8A 2OP5A 4DOZA 2UP1A 3TEHB 1S77D 2DH7A 2WW4A 1FRJA 4OI1A 4LMZA 3KDNA 4PG7A 4IOCQ 3NEKA 4OQJA 3M6VA 2YXLA 1HYSB 4F02A 2XULA 2DISA 5KG7A 1QE1A 2DGVA 3RRKA 5A8WA 1SI9A 3ILOA 4CO1A 1RJJA 1PSDA 1F5BA 1H7XA 3HZGA 1BQMA 5A2QY 2R3VA 3CCLS 3H7HB 1N4LA 1UEUA 1RACB 3AXKA 3D5MA 3GR1A 3QGIA 4F36A 2ZITA 4NPOA 3T1YF 1QVFR 2V4JB 3EM1A 4USHA 5AE3A 4Y34A 3MCSA 2OPPA 2NPIA 1RWNB 4K50A 2DNQA 2WVCA 1RYSA 1XJWB 3EDQB 3DRXA 4N56A 5DQIA 1VQKS 4OI2A 5KG6A 3PACA 1A6LA 2DIVA 2LEBA 2IVMA 2Y9HA 3IBCB 3G96A 3PJXA 2B7CB 3OL7A 1EHWA 3IR7B 3R5JB 1CQMA 4IG0A 4PPZA 3KOAA 1VHIA 3VCDA 2B0GA 5LSLA 1DRZA 5KT5A 1H7WA 3WX4A 1RHQB 4FF2A 2QMWA 4DQSA 3R7NB 4IO9Q 4LFBJ 2R8KA 3DHXA 1AUSL 2NSBA 2OPSA 2JLFA 2LYVA 2M0GB 3DDKA 3D9BA 4F4KA 1U02A 4CO2A 2AMCB 3PFEA 3P5TL 2BACA 1RCXB 1U2RA 3CD5A 3THPA 2PMHA 3JSMA 2RS2A 3PY8A 4YMEA 3S8SA 3MPVA 1RT1B 4E98A 1SKSA 2DGSA 1ZS6A 2CZ4A 2R4FA 5EWGA 4UY8T 1V3RA 4ERDA 4PWDB 1X7VA 4DF4A 2B5JB 2IDEA 2W2NP 3ZTSA 2LEPA 2WB4A 2XTJP 1EQ0A 2RHQB 2W8KA 1TKTA 5DRKA 2AHOB 1UW9A 1N33J 1QE1B 1RTIA 2WVEA 2BW2A 4Z2XA 5A8WB 2Q79A 3NGRA 3RBXA 2DO0A 3RJMB 3R6GB 2OEJA 1IVZA 2C28A 3Q8YA 5CZVA 3F73A 1VQ6S 1FRKA 5A8KA 2J6SA 4LF9F 1WHVA 4ZHRA 1BQMB 4B3SJ 1REVA 3L95X 3MAHA 5EDWA 4S0MA 3FBFA 2I1RA 1FRLA 3OT9A 1J27A 3RRGA 4HHUA 5D0EA 2MY8A 2QV6A 2MQQA 2OPPB 2JC1A 1ZH5A 2I0XA 1IBMF 3OJUA 4CDIA 1NEEA 5LMUJ 2A6MA 3FVYA 3A8KA 1KVIA 2HNZB 1F6TA 4IFYA 4LSZB 1HNXF 4IR1A 4YB1P 2FLNA 1TKZA 3ZNUA 4IG0B 1RBOB 1BUXA 4QW8A 2HHTA 1XMQF 4URGA 1AROP 1JMTA 2JHEA 5ETKA 3MURP 2DVIA 2W24A 3CDEA 3EXYA 2LVWA 1NKEA 4YQWA 4DR3F 3OJSA 2J6UA 5DS7A 2OPSB 5D78A 3MEEA 2VQEJ 3HHLC 4NZ0A 2NQPA 2VF3A 1NH7A 3N0VA 4DR7J 9RUBA 4ECTA 4C8KA 4LF4F 1HR0J 3HO1A 2K1RA 2FVCA 4L3NA 3AA8A 4DX5A 4M5JA 2CNLB 2YKNB 2CKWA 2ZC4A 4EI2A 3UQSA 2XI3A 5IM0A 3FJ2A 2LQ5A 4LIWA 2J0WA 4QWBA 3TWZA 1N36J 5KT6A 1IM4A 2DNYA 4XIUA 4OZJA 2DNRA 1WG5A 3KHGA 1TKTB 3Q22A 3LO3A 4DMZA 1RTIB 2HIYA 2DO4A 2KTQA 1S1XB 5A8KB 4NLDA 2IRXA 5CYQA 1H2VZ 4ZHRB 4FZVA 3D6MB 3HVTA 2HNDA 1REVB 1TR0A 1I94J 1WF0A 4ZLNA 2CAJA 4ENOA 1NPRA 2G2YA 2CDQA 4M8LA 4X4UA 2FYXA 3JAMY 2BM0A 2Y0BB 2AIRB 2HBQB 2DHGA 1NH8A 3D0GE 1U2CA 2RJZA 3H25A 1SV5A 3BKUA 2D41A 5LJ5Y 4A8QA 5HN0A 3T5KA 3EVWA 3HPOA 4W4MA 4D3HA 1FVSA 5JJBA 4N41A 2L9NA 5HQLA 1UZDA 2VD3A 4ED4A 4LBHA 3D6FB 3CCQS 1YVFA 1TKZB 2ZD1A 3AOBA 1QSYA 3T1YJ 2YWFA 3FBCA 4F2RA 2BA9A 4DBQA 4PXEA 2FJEB 1QM9A 4FS2A 2YNIB 1SJ4P 2ILZA 1KWMA 2IMOA 1S4FA 4CRJA 2OAUA 3KG1A 4QYRA 1Y4ZB 4N7TA 1T0TV 5DZ7A 2PE8A 1RAHB 4L75A 2UZAA 1RAAB 2LA6A 3M2UA 2ROGA 4CLSA 3VAGA 1P1LA 4LSNB 2AYBA 1GXUA 3OR1A 4Q43A 3NOCA 1G4CA 4HTJA 2XCPA 1H72C 2PIIA 2UUWA 3JSBA 4ZP8A 4X62F 1F60B 2YWKA 2K1RB 4RW8A 3K2YA 2I2YA 5GAEI 4JV0A 3LGNA 2DHSA 4DV7F 3M8ZA 1R8PA 4OHYA 1JLQA 3BR8A 1VQ8S 2BJ3A 5IM0B 2J8SA 3GYNA 4LQ3A 2CPDA 4DFMA 4K0KF 5L46A 1KP6A 3M1VB 4DWIA 4DV6J 2NR0A 2LQBA 2GIQA 2Z57B 2VFVA 4WXWA 4ES3A 2HS0A 1VR6A 4QIFA 3VGSA 3GJRB 1I51B 2KHCA 3KMSA 2FVRA 1YZ7A 1DTTA 3ONQA 3CJRA 2UXCF 2WRMA 2E1RA 1O5JA 2Y0SD 4LBPA 1ZM4A 3W2VB 1X5PA 4DL3A 4DQQA 1B99A 1VFJA 4QIGA 5F0WA 4FXDA 5F9NA 2W25A 2C42A 1F9HA 2GVDA 3HVTB 2UVWA 3C6TA 2HNDB 1XMOF 2P2CB 2AJ2A 1X0PA 3PR4A 4FYXB 4CM0A 4ZJOA 3KHRA 1KLMA 3TZZA 2EG1A 4OZ1A 4F25A 3MMBA 1O8BA 4GKJF 2NXUA 5GMKa 1URRA 3W8GA 4KTQA 3D3BJ 3AODA 3DKDA 3OFHA 2AKWB 1NNDA 4IFVA 1D9AA 1DURA 1XNQF 2ZD1B 1RAFB 1YLXA 1JK9B 2HGLA 3PV8A 3MUVP 4NCGA 2ZM6F 1A7GE 1MU2A 2QYGA 1JXLA 4OYMA 2YY3A 2D74B 2KZZA 3QT6A 1MN7A 4LUBA 4RZRA 3MMJA 2Y1LB 4MK8A 2B4VA 4OLPA 3EMTA 3M2UB 3ZZPA 3OR1B 4ED8A 3A8JA 4ZDNA 2E1CA 4N5SA 1F2HA 2J76E 3PXGa 2VFTA 2ADCA 3H5SA 3GP9A 3GR0A 1IBKF 4IOAQ 3G8QA 1JLQB 2WHOA 4B9TA 5E7OB 4DR1F 2ZFHA 2LP4A 3W8PA 3CJ8A 1FRIA 1NJXA 3WBZA 3K5MA 5J2QA 3F0NA 3Q86A 4TKTA 2J7WA 3PNIA 4LF4J 4RU9A 4KE5A 1NPKA 2APOA 1HI1A 4H4KC 3PEJA 4IQXA 3MUTP 2IPOB 2GVDB 1IJEB 4M5DA 2GGPA 5DQGA 2VL1A 2KJVA 2FZCB 1G7CB 1MWYA 3SCIE 3DLBA 4NLQA 3DRRB 4NEYA 3BGOP 2GX8A 1KFSA 2AJ4A 4WKRA 4FF3A 3HD2A 5JVHQ 1QY7A 3W3SA 3IM8A 1RE1B 3FEZA 3NLCA 4NLTA 2MKIA 2FGCA 3R7SB 1NHUA 4XPCA 2PT0A 1SJ1A 2YWWA 1TAUA 3VALA 3DYAA 5B0BA 4WWSA 2O01C 4QPXA 4QWEA 1T02A 4HHJA 1RTZA 1RABB 1YHQS 4NCGB 1MU2B 2F8HA 3M8RA 2GMHA 2OMOA 2VBZA 2FY1A 2Q3PA 1YDLA 4I64A 1HQUA 1M5KC 1SJQA 4CT9A 4ZPAA 4NA3A 4NLXA 4X65F 4F04B 5IT4A 2BXJA 4KBIA 4WYWA 4U67Q 3QRRA 4A8MP 1ROFA 1RGVA 3QMQA 4XAKA 1PKUA 2GFFA 3KUEA 2YBVA 1NJWA 3ICLA 2KI2A 2FTRA 5D0RA 2IA0A 3T5LA 2JFDA 3DGPA 2X1GA 2HS3A 4MIWA 3EZ5A 3H2UB 4V19X 3HK2A 1DQ8A 4B02A 4UZBA 1UJ6A 3AXMA 2ZVIA 4BDPA 3HHEA 1O51A 4ED7A 2MGZA 2V2ZA 3CE8A 3ENVA 4GO5X 3TUJC 5E5NA 5EWEA 2FJVA 2KXHA 2UUCJ 1VC0A 3K5PA 1HWUA 3U7JA 1AZSA 5J2QB 1SUQA 3FRYA 2J8AA 2XS5A 4DR6J 1CJKA 3UO0A 1PBAA 2XS2A 3UD5A 1QSLA 3I82A 1D9FA 1S6UA 4P2FA 2E44A 2O67A 2BX6A 3K5OA 1FWPA 1HNVB 2V69A 1OSCA 1WKKA 2KFYA 2W7PA 3PW5A 2YPYA 2K06A 4M5DB 4K0KJ 2GGPB 3G82A 1N54B 4TQSA 1VLYA 4IRKA 1I6JA 3H4DA 3AHPA 4QIWD 1X4GA 4RUBA 4LF7J 3GONA 4ZVEA 1IXKA 2BBEA 3DOKA 1F0XA 4WFBQ 2C2EA 3RB6A 2KT2A 2BQUA 5D4PA 3DYAB 4P7VA 4JI4F 1Y5LB 1NKBA 4ZP7A 3RW7A 1XMOJ 2XYGB 3JTPA 5F8HA 3QAUA 3GQCA 1KOOA 3U1NA 2B51A 5HQ8A 1DJ0A 3RGIA 2WSFC 1WD6A 4BCAA 3C15A 4WIQA 3N28A 3NCRA 1VLOA 2YNGA 4CLLA 1KTVA 1S12A 5IT9Y 3CSKA 3NKYA 3POTA 4ID5A 1UA1A 2MKCA 1KQGB 1CSJA 4ZPWR 1MW7A 2ZKTA 1PC5A 4H54A 4MKVA 3F56A 3DGPB 3VAIA 3N01A 4EEYA 1R8HA 1QTMA 3IWLA 2DGXA 2I9SA 3U27A 3DLGA 2QRRA 4WZMA 1VQNS 4NZ6A 3BB5A 2MGZB 1MWZA 2VU5A 4A47A 3GPAA 1KLNA 2BV3A 3IGNA 4LRCA 3NRBA 1AZSB 2LXFA 1SUQB 3CEDA 2FHMA 1CJKB 1CC8A 4F4WA 2NUHA 2W7OA 4JI6J 5CD4A 2DXDA 2RH3A 4K4XA 3E51A 3P6YC 1WNEA 2B4PA 4OHWA 4LRAA 1X60A 4DS4A 4H4OA 4QYZJ 3FZ2A 3TZWA 4X64F 3G82B 2G4BA 3MMCA 1YKWA 5GAEU 2QE5A 2MHEA 4EMDA 3Q2TC 3TVZA 2ZH4A 3KNGA 3PW2A 1EKRA 4RLEA 1JXVA 3OR2B 3PDNA 1SH0A 3VZIA 2MZ1A 2RMLA 5E0OA 3VVUA 2CVIA 1N88A 4CLFA 3DOKB 2B56A 3K5LA 1K47A 1FKOA 2FLOA 1NDPA 3VAJA 3PYGA 2CQ2A 3KJQB 3G71S 3LALA 1DARA 2V6AA 2VV5A 1SL2A 3ZTOA 4MJKA 1NDKA 2YQ1A 4HLBA 3K7RA 1GX6A 4AFFA 4L3KA 1Q4RA 2E5IA 1JLEA 3C15B 3QJLA 3ITHB 1NZAA 4RWWA 3KTQA 2YNGB 5K8MA 1N34F 1L3SA 3HFVA 3I9V9 3POTB 4ID5B 4CZCA 4I2QA 3G6YA 2F4VJ 4PXBA 4OV1A 2I6WA 4ZN1A 4IR9A 2ALZA 3D0HE 5K5MA 5I3QA 4DQRA 2ATLA 4NLYA 1K44A 5HK4A 3D1HA 1AFJA 4ED0A 4P52A 3HXMA 2IBKA 1VISA 1K1QA 1U6ZA 4TN2A 2BUNA 1SJ3P 3SXLA 2YH0A 3DLGB 1W2BR 2OSQA 2AQ4A 2B43A 3MGJA 3PIOQ 4FVCA 4PXCA 3T6BA 3BSAA 3EZOA 4Q0BB 4HYKA 3KFWX 4C9DA 2QMXA 1PAUB 2QYCA 1KQFB 3AB4B 4YDDB 4B9NA 1LW0A 5C24A 3SCJE 1RTHB 5KAKA 3T41A 5F8MA 3KHLA 1HNWJ 1L3KA 2MQ8A 2HQDA 1WC0A 2GHVC 2R8GA 3D7SB 1M5VC 1KHWA 2FJBB 1X0FA 4B9MA 5IFMA 5EUHA 1L3TA 1H74A 3WX8A 4ES1A 3V6JA 5F3ZA 2BYCA 4KYZA 1ZM9A 5DETA 2YKQA 2ZBQA 3TVYA 2WK4A 3VF0B 2PMZD 4ECZA 2M70A 1VRTB 2VKRA 1IWAA 2CQGA 1FKOB 2J7UA 3R3TA 1K8AT 4DU7A 5IV3A 4FDFA 4LFAF 3RB0A 1N8RT 4P10A 1WHYA 4LF6F 3G86A 3BGUA 5KFMA 1MMNA 2FHKA 1MMDA 4CTAA 5BYQA 2XZTB 2HQFA 4DI6A 3NL0A 1MNEA 1UVJA 2DXFA 3IC1A 5HMYA 2ZUGA 4OJHA 1KDNA 1S7IA 2MLYA 2GVZB 1Q95G 1JLEB 2AJFE 2XC9A 2WSCC 5LMNJ 1WF1A 3CNQP 3NBPA 4J5OA 3H4BA 5DLGA 3W64A 4Q8FA 2A18A 3GFZA 4JI4J 1OIAA 4I2QB 1YWXA 2WSEC 4QR2A 1ZTTA 1QUPA 2DGTA 1GH8A 4G6VB 2CPZA 3MAAB 3TZYA 3LA0A 5ETLA 3MD1A 3VAMA 1UCNA 2QL7B 4PKDB 4RUCA 4OYWA 3EX7B 3CC7S 4KRWA 2UUTA 1VK8A 2B8QA 1IKXA 3CC4S 2IYIA 4AD6A 1KQSR 1HKAA 3C3LA 3QGHA 1S1VA 2XWYA 2RQCA 1IUJA 2LQ8A 3OV7A 4PXDA 2GCFA 4LRBA 4KPCA 4ER8A 1U8WA 3TZXA 4BHQA 3MAQA 2ACMA 4C2MA 1OO0B 2GJFA 1FKPA 2FVQA 3T9NA 2MXYA 4U96A 4RW9B 1NHKL 1W2IA 4DUTA 1Q53A 3MFHA 4TXSA 2H51B 2HRUA 3KHHA 3R5AA 3CPWR 1U0HA 3M9MB 3MR7A 4J9QA 1U6FA 4RNMA 1U45A 1W7WA 5LXYA 2GIFA 1SH3A 1Z1ZA 4RUHA 5CA5A 2H9ZA 1YRUA 3FC9A 2HAIA 3G4SS 3TAPA 4ZCLA 4K2XA 1BD6A 5ETQA 4PABA 2FPHX 1JX4A 3N6NA 2ZZNA 2QL9B 5F8JA 4EK2A 2DCUB 3DMJA 1GMWD 1HFEL 4U7UK 5LJ3Y 1UWBA 4DN0A 5D77A 4HTIA 2YNFA 4V19J 1XEZA 5GAGU 4WBFA 4CTAB 1CJTA 1D8YA 2CA9A 3MCMA 3JQJA 3IP0A 1GXLA 2G0IA 3QLHA 2FUG9 1J5EF 3IRWP 2F63A 3ILLA 2ZZTA 2XNQA 4KIAA 3NP5A 4OJ1A 1WSRA 4ITSA 3NBPB 1T05A 1MROA 3GE9A 2LQ9A 1H0HB 2CPFA 4I56A 2CPHA 1S48A 4M5NA 1HI0P 2KG1A 3HSDA 4JV1A 3CDBA 3MEDA 4H4MA 2CG4A 4X4TA 2CJXB 2NZ4A 3EWGA 4JB8B 2BE7D 5HJYA 3J7YI 3KLHA 5DQHA 2ZE2A 4PRFA 2HEKA 1N32J 2NZCA 5KFNA 2Q6BA 5A6PA 2RHSB 4F67A 2W9CA 2XZDB 4NI2A 2F9JA 1FO1A 3G6ES 4R25A 1IKXB 4MMOA 4EYHB 1RTJA 2Z2ZA 3IN5A 1S1VB 5CQGA 2BRLA 1S59A 2CQHA 4L72B 3NS5A 2HGMA 3S6EA 5HMXA 1NSAA 1G1XA 2D3UA 1S72S 2VBWA 4OHZA 2L9WA 5CZXA 1VYAA 2K8GA 2OFHX 2ZHOA 3W61A 1YJNS 3DFEA 4DL0C 3SZ2A 2M7SA 4U8VA 5KFIA 1VQLS 5AE1A 1NJYA 1N56A 4IG3B 4HKQA 4OX9F 1B7YB 5KFVA 4WP3A 1XERA 3RRHA 1KTQA 3VGTA 2IHR1 5G0RA 1WC5A 2NLWA 1NDLA 4P7TA 4CIOA 2WONA 1QJHA 2ZH6A 1FA0A 3V2UC 2XLKA 4JYAF 4CNZA 2XBPA 3DMJB 5KFPA 1UWBB 3BGFA 1RB0A 4Q2MA 2AEJA 2YNFB 2VODA 4O4GA 3VHQA 5KFHA 2M8HA 3QLHB 2OO4A 2RAQA 4P71A 5L9NA 3TOQA 4QWAA 4OZ0A 4N8OA 8RUCA 5HQMA 4L74A 3BGRA 1YSJA 4NXNF 3FSIA 4P6QA 4FYDA 4ZLLA 1T05B 1MROB 1JJCB 3GFXA 4K4ZA 4PAAA 1N52B 1Y7PA 5IWAF 2DJWA 4ECUA 4OYOA 4KB7A 3W7BA 2B9WA 2V4QA 3MEDB 4H4MB 5AJ3J 4QCLA 4X4NA 3OFGA 3V6KA 4GO7X 1CVJA 2ZE2B 3Q24A 5ETMA 3H40A 1G2EA 2BOAA 4UF4A 1E6VB 1N0UA 4R0EA 2ATCB 1EARA 3WC2A 4DCPB 3JAMU 2W9CB 2BJDA 3D1QA 4B3MF 1IKVA 3ENWA 3CCTA 2HMIA 1XIQA 1YBAA 4Y00A 1WF2A 2VUGA 1X8DA 2OD4A 1WORA 3KLEB 1YJUA 1Q82T 1VS3A 2UXDF 2JVRA 1NHVA 1V9OA 1RWPB 4F4XA 3LAKA 1WEXA 2FHOB 4EO8A 2RUGA 3DU5A 1BLUA 1R0CB 2MZTA 2R7XA 4ZVHA 4ZVGA 2VA2A 3H20A 2V50A 3GG0A 1EAYC 2MKHA 2M5YA 2AYEA 4RBTA 4NMLA 2QTWA 2IYGA 3KNAA 7FDRA 2R7SA 1UA0A 3OBIA 1FX2A 2W2OP 4M94A 5EGYA 4N47A 6AT1B 2JLGA 2WONB 1FRXA 5B0DA 5F9LA 3D2WA 4Q44A 5T7LA 5M2UA 4DV3F 4RPFA 1TL7B 1VQ4S 1FD8A 3ETMA 4KGVB 4KQZA 4OIXA 1U1MA 3VV2B 3UDVA 5IZHA 3TW0A 2QLJB 3D4JA 2XLIA 3ZZRA 4K59A 4I4BA 2JRSA 3BV8A 3NGSA 4C11B 3I56S 3BGRB 5HBMA 3I0RA 2UV8G 2XMTA 5AXNA 2F65A 2F8EX 4KPYA 4M1KA 4LSLA 1R6VA 2G0CA 1J5OA 1T8EA 4AE5A 4FBTA 3DRYA 3CJKA 1F2GA 2KXNB 1S1UA 2YKAA 4ZPTR 3NMAA 4Y28C 1U09A 2UV8A 2VPWB 4ATNA 2GO9A 1D8ZA 4AYBD 4P75A 4LF8F 2G13A 4I6YA 4X4RA 4LR9A 5FD1A 6FDRA 1NBEB 1IKVB 1IJFB 1N5YB 1S0OA 4IRCA 4QIEA 2HMIB 2A2DA 1PG5B 3R1HA 2GV1A 3TX0A 3ZTRA 3P45B 2CQ0A 1WHXA 3NCPA 3FSXA 2EBEA 1QVGR 2HQ3A 2BDPA 3CWJA 3PKMA 2CPXA 1U8SA 4Q5VA 2C3MA 4U9RA 4A8KA 5DG9A 1NUEA 4CO4A 3V81A 4C6AA 5D0HA 4J7CA 2HYIB 3JSYA 1R27B 3BQ2A 4C0HA 4RBVA 1CC7A 3SSSA 5JVGQ 1M5SA 3R9LA 5L38A 4OJGA 1TQLA 4C8LA 4KR0B 4O23A 4WP8A 4CO0A 3NGUA 1V3ZA 2CQDA 4BLGA 2CZVC 2D9OA 4J9RA 3TARA 5AXKA 3HLUA 2XM3A 5I42A 3IBFB 4FKXA 4TYBA 5T7LB 3LP2A 2HZCA 1NSPA 1B0VA 3M2VA 5CYMA 4KHMA 2B4OA 3FQLA 1TL3A 4EZ9A 4ZIVA 1B4SA 3MM8B 1E6YA 3FSYA 4DL7A 4OX9J 4USIA 2FLPA 1RI7A 2GQQA 4G1QA 4RW7B 1JQGA 3VTIA 5HBMB 1Z2ZA 3I0RB 1Z2LA 1FVQA 2ZBIA 4LSLB 2BEFA 1J5OB 2DGWA 3D54A 5L8RC 2KH9A 2W4CA 3CJKB 1Y5NB 4I69A 4D3GA 1S1UB 2OJ3A 5LL6d 4OZLA 4GVBA 2UUAJ 4ZPBA 4K8RA 4DX6A 1TK0A 4MIBA 3TRGA 1HWJA 4J9SA 1DTQB 4C97A 4YHHJ 2ZBPA 3GLJA 2BZ2A 4UOGA 3JYTA 1M90T 3OXGA 5T14A 4JI5F 1RT6A 3L7OA 4WFYA 3OTDA 1NK5A 4KO0B 1GMWA 4NXNJ 1RKJA 2RVJA 3LP0A 4USWA 2YKOA 2KJWA 1MMLA 5HJXA 4ECSA 5IWAJ 1SC1B 4ETZA 4WFAQ 3GZ7A 3MM6A 3AQPA 4EUVA 4CP5A 4JI3J 2QGFB 2KXFA 2NS1B 3OL8A 1S79A 2YX4A 2YX7A 2IRYA 4OX6A 3J7YU 4I0WA 3V81B 3S7RA 2EEYA 3QWPA 4LF2A 5CYJA 1HWLA 5HP1A 2RDJA 2FVSA 2HBYB 2HFSA 3PKYA 3CT9A 4ETXA 2EPIA 2EWHA 3LGHA 4LQ9A 5KG5A 3SFUA 2N7CA 5KFLA 2IFXA 4ZVOB 2UXDJ 4X2BA 1EKSA 3BSOA 5I42B 4J9NA 2YWGA 1RADB 4I1TA 4L76A 2HW3A 3LP2B 1RP5A 2YKPA 1YGYA 4HT5A 3M2VB 4RL1A 5CYMB 3R6LB 4MK7A 4OI6A 1CJUA 3CJTA 3PG9A 1TL3B 3IWXA 2GA7A 4ZK7M 3J80U 4GRSA 1E6YB 2L3MA 4TU9A 1IM6A 2GAHC 1TKDA 5CHCB 4G1QB 1UMJA 4FYVB 2VC1A 2VBXA 2QSWA 1RT7A 2OSRA 2AGPA 3K8VA 1WI8A 2HWIA 3Q2SC 4LFBF 1UL3A 3FEXB 3VGVA 1HNIA 2EFVA 2MQOA 2P9CA 3UI3A 3VAHA 3GIJA 2LKZA 4DV3J 4C8YA 2GZOA 4DV1J 3KLGA 2H3EB 4NXMF 2ZVSA 4B3TJ 1C0TA 1HWIA 2HHHJ 3BH6B 2MPUA 3OTBA 4GVBB 3ZZZA 3R8YA 3OXFA 3RAXA 4U95A 3HT3A 1IR1A 1YX2A 4QWCA 4UOHA 1UVLA 4DZDA 1RT6B 4W90B 1ELOA 4OFZA 2WW8A 1RA7A 1DLOA 3LP0B 3IFEA 4YR2A 1B64A 1X4DA 3EDRB 4KHPJ 2G2OA 3E3XA 3DCAA 4RNFA 2COLA 4GMKA 5EWFA 3VAKA 1B3TA 1FNXH 4N77A 2HVDA 1H98A 5J2NA 2DD8S 1SIZA 4JV2A 1N33F 4EFAC 2RILA 2VG6A 1UVNA 1IQZA 4C3MA 3LH2S 1RT2A 4WU3A 2OI2A 2CZ9A 3FZBA 4J37A 2ZBCA 4AQYJ 5HP1B 1IBLF 3Q8RB 2OTJS 1ZAVA 4X4VA 1HHQA 1EP4A 3RR8A 4MTPA 4DPYA 1H2UX 2FJXA 3TO8A 2DCLA 2PD1A 4FYWB 1NJIT 3I5AA 2KYZA 2AZ1A 2HLUA 3BSCA 4PPDA 3QBCA 1HI8A 5LMUF 1C2PA 1V3SA 4ED1A 1YQHA 3P3DA 4K7QA 2CQCA 3UNYA 5HATA 4DV0J 1RT5A 2KVIA 4EZ6A 2VOPA 2GAGC 1CJUB 1FJ7A 2AJQA 2E7XA 1UEVA 2WVFA 2XWXA 3W9JA 5C2CA 3JXOA 2KL8A 2XMVA 2BQ3A 3W9IA 3EE3A 1VBZA 2MKSA 2W2QP 4URQU 3PW0A 3SIPB 1ZPWX 1APSA 1RT7B 4BWJA 2C2NA 2BKOA 2GMJA 4DR5J 1TK5A 1P1TA 2CXEA 5F8NA 2XLJA 3KK3A 2R7VA 3QGPA 4GC7A 1OQ6A 1LK5A 4OV6A 2VQEF 1Y3KA 1C0TB 3T1AA 4W92B 2E9TA 4O3SA 1FI4A 4DR7F 2KT5A 2DNOA 1HR0F 4GKKJ 1ZAXA 3DC2A 1S10A 1JLCA 1UZHA 2ZOMA 4PZVA 3OVSA 2A3JA 1XTZA 4QOTA 1CJVA 2BQRA 1UVKA 2BE9B 3J81Y 4J9MA 1DLOB 2JSXA 2BE2A 2KFZA 4PWWA 2FDNA 3UCUP 1TUGB 3PRBA 1N5SA 4PG6A 1N36F 2VB6A 4RR5A 3CCVS 4A8OA 3M6WA 2E66A 2R2RA 3PVXA 1WUUA 2PEHA 3RW6A 4ZVUB 5J2NB 5IOLA 3L4BC 5BXIA 2VG6B 3CMQA 1SBRA 3BKTA 4KH1B 1FTRA 3KG0A 3HKWA 2E9ZA 1WDDA 4IH7A 4B9VA 3Q23A 3D1OA 1F5AA 2CIMA 1I94F 3BF4A 3GCXP 3RBEA 4OYXA 1FDBA 3AOCA 5A76A 1VBYA 4U8YA 3Q8PB 2V68A 3T1HJ 2ZC3A 2H54B 3PW4A 4TU7A 2FLLA 2HFOA 8AT1B 4DV2J 2VONA 5A0YA 1F1BB 1RT5B 4YB7A 1WG4A 3F44A 5IS2A 4FF1A 3THVA 4K5RA 2BJEA 2ZOFA 3ZTPA 3I55S 4FVMA 1FWKA 3BBCA 5KG1A 3W66A 3M8QA 1DHMA 1RHJB 4ZMMA 3ZO7A 3QATA 2XB2D 2J6TA 3KMQA 2XGPA 2H65B 3U02A 3T3FA 1WKJA 1JB0C 2L48A 1LKZA 4Y65A 1OY9A 4K4TA 3CJ2A 3EUNA 4USUA 3M8WA 4A8SA 1FCAA 4HI2A 1RU2A 2DRBA 4HL9A 3RAQA 1S0NA 3NGDA 1BQXA 1HQ2A 1GXTA 2WB1D 2D3ZA 2MB0B 1LK7A 1ZYQA 1JLAB 1WTFA 2M2BA 1HHSA 1QAJA 5KFQA 5C42A 2W4PA 1JLCB 2KKHA 4NLWA 5GAHI 2JEJA 2MQLA 4IO1A 1CJVB 2IAJA 4BBYA 1GEHA 2VKZG 2BE2B 2CQ1A 2QN6B 2MHNA 2AZ3A 4DV6F 3GSIA 2PI4A 1X5OA 3A3PB 2YTCA 2R7WA 3CCMS 1SC4B 1U1PA 2F8MA 3OPKA 4NXMJ 2RT3A 5KFOA 1NJZA 5F8GA 2C2RA 3UDCA 5E3CA 1JWWA 3KYLA 2MZJA 3ET6A 3IO1A 1Q7LB 4Y2CA 3C2PA 4DPUA 2DNKA 2XNRA 3O5TB 2W9AA 1WKLA 3R5DA 2I5JB 5D3GA 2BKNA 4UY85 3QYYA 2BABA 2N3LA 3EICA 2X3GA 2DIUA 3H5XA 2OHDA 3QSIA 1U6BA 4C4WA 3UD3P 1NK9A 4JI0J 4CM2A 5B0CA 2ZZMA 1HMVA 4DPWA 5CCLA 3R97A 4CLTA 2LMIA 3O3LA 3BPSP 2MY7A 1UP1A 3BREA 2BVZA 3AJDA 2HHUA 5A0YB 1WELA 4OYAA 3DRSA 4M5GA 1SXLA 3U1MA 2IRUA 2XMUA 1IBLJ 2EI5A 1Y11A 2N4CA 3M8QB 5EX0A 3SI8A 3BO4A 1KD1T 2KYXA 4MFBA 1FKAF 2C3YA 1VIOA 5GADI 5KG2A 1AYEA 4QYZK 3DLKA 3GFHA 3OL6A 2OLWA 1T11A 4RNNA 2PEBA 1FDNA 2MEWA 5D4NA 2B8PA 1D3WA 4QIVA 5DGAA 3NWGA 1OY6A 3E2EA 4G65A 3PYDA 5AE2A 4M5IA 3W5ZA 2V34A 2P9GA 2J0XA 2HRYA 5H1SV 1N5QA 4A8XA 4YY3J 4J9VA 1NMEB 3GJTB 4DSLA 4W98A 5C42B 3VR1A 3GCWP 3TVKA 3Q8QB 2Y1JA 2OMLA 1HLWA 2IAJB 2G0JA 3MM7A 1H6KX 2B6AA 3MOJB 1HNZJ 2KM8B 1VQMS 3NCQA 1NM2A 1GAOA 5J2MA 2HK2A 2HHSA 2F3JA 1CG2A 2RS8A 3CJ5A 2RB7A 4NASA 2E5LJ 2RRBA 3HF5A 3CMAS 3ET6B
chains in the Genus database with same CATH topology
4YHHJ 4X64J 2UXDJ 5IT9U 1I94J 4JYAJ 3J7AN 2ZM6J 4DV0J 4DUZJ 4LFCJ 4LFBJ 5AJ3J 4NEZA 4JI2J 2VQEJ 3W1YC 2UXBJ 4B3SJ 4KHPJ 3J81U 4NXNJ 1XMOJ 4DR7J 1HNXJ 2UXCJ 3IMQJ 3D3BJ 5LMNJ 4X65J 4DUYJ 2UUCJ 4DR4J 2MEWA 4JI6J 1HR0J 2KL8A 4KY3A 4RJVA 3OTOJ 4HHUA 5IWAJ 1XMQJ 4DR6J 3R2DJ 1HNWJ 4JI4J 1XNRJ 4V1Ak 3J80U 2UUBJ 2MQ8A 1N32J 5BR8J 2UU9J 3JAMU 4DR5J 4DV6J 4JI8J 4LFAJ 2KVQE 1J5EJ 4LF6J 4DV5J 4YY3J 5LMUJ 4LF4J 4JI3J 4JI1J 4JI0J 4B3RJ 3R2CJ 4DR3J 4OX9J 4DR2J 4LF5J 2F4VJ 4JV5J 5FLXU 4AQYJ 4GKJJ 4LF9J 4K0KJ 1N36J 4KYZA 4JI5J 3T1YJ 1IBKJ 4DV3J 4JI7J 4X62J 4DV1J 1HNZJ 4B3TJ 4GKKJ 2HHHJ 5LM7E 5A2QU 4DV7J 4DV4J 4LF8J 1FJGJ 3T1HJ 2MTLA 4DR1J 1IBLJ 4LF7J 2VQFJ 4DV2J 1XNQJ 4X66J 4NEYA 2UUAJ 4B3MJ 2E5LJ 1N33J 3D3CJ 4PWWA 1N34J 1IBMJ 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH J;  4X64 J;  2UXD J;  5IT9 U;  1I94 J;  4JYA J;  3J7A N;  2ZM6 J;  4DV0 J;  4DUZ J;  4LFC J;  4LFB J;  5AJ3 J;  4NEZ A;  4JI2 J;  2VQE J;  3W1Y C;  2UXB J;  4B3S J;  4KHP J;  3J81 U;  4NXN J;  1XMO J;  4DR7 J;  1HNX J;  2UXC J;  3IMQ J;  3D3B J;  5LMN J;  4X65 J;  4DUY J;  2UUC J;  4DR4 J;  2MEW A;  4JI6 J;  1HR0 J;  2KL8 A;  4KY3 A;  4RJV A;  3OTO J;  4HHU A;  5IWA J;  1XMQ J;  4DR6 J;  3R2D J;  1HNW J;  4JI4 J;  1XNR J;  4V1A k;  3J80 U;  2UUB J;  2MQ8 A;  1N32 J;  5BR8 J;  2UU9 J;  3JAM U;  4DR5 J;  4DV6 J;  4JI8 J;  4LFA J;  2KVQ E;  1J5E J;  4LF6 J;  4DV5 J;  4YY3 J;  5LMU J;  4LF4 J;  4JI3 J;  4JI1 J;  4JI0 J;  4B3R J;  3R2C J;  4DR3 J;  4OX9 J;  4DR2 J;  4LF5 J;  2F4V J;  4JV5 J;  5FLX U;  4AQY J;  4GKJ J;  4LF9 J;  4K0K J;  1N36 J;  4KYZ A;  4JI5 J;  3T1Y J;  1IBK J;  4DV3 J;  4JI7 J;  4X62 J;  4DV1 J;  1HNZ J;  4B3T J;  4GKK J;  2HHH J;  5LM7 E;  5A2Q U;  4DV7 J;  4DV4 J;  4LF8 J;  1FJG J;  3T1H J;  2MTL A;  4DR1 J;  1IBL J;  4LF7 J;  2VQF J;  4DV2 J;  1XNQ J;  4X66 J;  4NEY A;  2UUA J;  4B3M J;  2E5L J;  1N33 J;  3D3C J;  4PWW A;  1N34 J;  1IBM J;  4NXM J; 
#chains in the Genus database with same CATH topology
 4CNY A;  5CAA A;  5KG3 A;  2LU1 A;  3T6J A;  3JSM B;  4LFC J;  4HEA 9;  4JI2 J;  2FGO A;  2HLT A;  3JTN A;  3W5Y A;  2XGQ A;  2LXI A;  3PJ9 A;  3ZXW A;  3WHI A;  4DFK A;  2RQ4 A;  2XMJ A;  2GQC A;  5CCM A;  5FLX Y;  3H0P A;  2HHP A;  2E5J A;  2B9X A;  1HMV B;  1LOU A;  4OHV A;  3N79 A;  4G1P A;  3PYE A;  2E1M C;  4WP9 A;  1RBL A;  3BJY A;  3THT A;  3CME S;  3HHD A;  3WDO A;  2XCA A;  2UVU A;  1XC9 A;  4KC5 A;  5HVH A;  1C4A A;  4DSE A;  2RSQ A;  2E29 A;  2QT7 A;  4HR2 A;  2HS4 A;  4DZ6 A;  3KLV A;  2ILY A;  2MKK A;  2GNK A;  4TY9 A;  3M4X A;  1FK9 A;  1LEO A;  3SCL E;  1N48 A;  1FJC A;  3KUG A;  2DNP A;  3M8P A;  1A9N B;  3UDL A;  4LVN P;  5D15 A;  3SQG A;  3EGZ A;  3QAE A;  3MR2 A;  1FE4 A;  4RUA A;  4DX8 H;  2MDA A;  1GMU A;  1NSK L;  3IAS 9;  3PRV A;  2IMW P;  1IN0 A;  4EBE A;  4IFY B;  1T9X A;  3U1L A;  5B0E A;  2AEF A;  3MEG A;  2H5J B;  4MK9 A;  3R2D J;  3GV7 B;  1H38 A;  5B08 A;  3MPY A;  2P8I A;  4DV5 J;  4IDK A;  4Q45 A;  3F41 A;  8ATC B;  2GML A;  2L9D A;  4LRD A;  3MM7 B;  2B6A B;  4DR2 J;  1TV6 A;  1HW9 A;  3WZ0 A;  2YNH A;  1Y5I B;  2IIH A;  5J2M B;  1Q16 B;  2UUC F;  3FEY B;  2HZV A;  4OL8 A;  3MEE B;  2DHX A;  4U7U D;  3KG4 A;  4PR6 A;  4DR6 F;  1U4B A;  3M32 A;  4K4U A;  1NO8 A;  3ZZO A;  3W63 A;  3SMZ A;  4OI0 A;  5DG7 A;  3OUY A;  2KHD A;  5L1K A;  3CO0 P;  3PW7 A;  1Q78 A;  1YRX A;  5D6G A;  1M0S A;  3IAM 9;  3J7A N;  2IVY A;  2XO7 A;  1YBU A;  5KFZ A;  1YI2 S;  4XO0 A;  3TA0 A;  3MCN A;  4KV8 A;  3KK1 A;  3TNV A;  3BR9 A;  4O3R A;  3ELH A;  2PDA A;  3B4M A;  4CCH A;  3UW1 A;  1HBM A;  4DCJ B;  1NKC A;  1RQ0 A;  3FCV A;  3AAW B;  4LF7 F;  4A46 A;  4LT6 A;  5RUB A;  1UVI A;  3UVJ A;  1JXE A;  2HRT A;  2J9E A;  4F3O A;  2MKY A;  5ADZ A;  1EB0 A;  1HD0 A;  1ZAW A;  3HSJ A;  4F3M A;  5CYQ B;  4ED2 A;  4KFB A;  2AGQ A;  1S7H A;  3EZU A;  4C0O C;  2ZH5 A;  4BWM A;  1LWX A;  2CG8 A;  3PR5 B;  3AQO A;  3P5B P;  1OQ3 A;  1YBT A;  2XMW A;  3HP6 A;  3OSN A;  3ZTQ A;  3G8S A;  4G3I A;  1SV5 B;  2ZNY A;  4F7V A;  3CD0 A;  1FK9 B;  4B9L A;  2G2Z A;  4AL5 A;  1RT4 A;  3M8P B;  2A0F B;  2VDH A;  3I4H X;  3DN9 A;  1FRH A;  1FDD A;  3CVK A;  3QZ7 A;  2UXB J;  1Y9O A;  1VJQ A;  3MEG B;  1WOO A;  2KB2 A;  2JL9 A;  1M5P C;  2CQ4 A;  4J91 A;  2AYG A;  3A3N B;  4KH0 B;  4P2S A;  1XNR J;  3IRX A;  4IDK B;  1T9V A;  2UUB J;  4RNH A;  4ZVQ B;  3KXD A;  1PO6 A;  4YEA A;  1WC6 A;  1PJ7 A;  3NS7 B;  4DXL A;  2YNH B;  2YVS A;  3EVM A;  4O3N A;  3RZA A;  2AYM A;  3NNA A;  1CUL A;  1X5T A;  4O3O A;  2C1E B;  3G8T A;  3M32 B;  2OEM A;  4JI6 F;  1R7I A;  2F7V A;  5ITH A;  2RIJ A;  2HGN A;  4RW8 B;  2L08 A;  1X9M A;  3OUY B;  5M2R A;  2JEG A;  1XR5 A;  2V2K A;  1BC6 A;  2OKQ A;  3HZE A;  3R1L A;  1UPP A;  3QWU A;  2OEL A;  4FNH A;  5GAH U;  4KV8 B;  4ZPD A;  3KK1 B;  3TAM A;  1F5C A;  3QIP A;  3R7B B;  4RU2 A;  2DTJ A;  3PO4 A;  4YB6 A;  1X9S A;  3H8Y A;  2CQI A;  1HBM B;  3SV4 A;  3IMQ J;  4WK1 A;  2CJQ A;  3PRD A;  5IXU A;  1DTT B;  5AXL A;  3LWM A;  4EGL A;  4UOF A;  1TKX A;  3UVJ B;  3ADA C;  3FGV A;  4I2P A;  2VIH A;  3N5B A;  4KFB B;  3C6T B;  1Y10 A;  3GIM A;  2KRR A;  2HFU A;  3G9C A;  4JV5 J;  2B9E A;  1TP7 A;  1W25 A;  1KBR A;  2FZG B;  3GTY X;  1IR2 A;  1KLM B;  3QT8 A;  2A2C A;  4QR1 A;  3BGL A;  3MMB B;  5FJ4 A;  1HQE A;  5L1J A;  3D28 A;  3MPD A;  4NX9 A;  2VA3 A;  5HMW A;  1OY8 A;  1FWL A;  1RT4 B;  2HK3 A;  4UQT A;  3PX6 A;  3AD8 C;  4IFV B;  4DUY F;  1GTE A;  2MLX A;  4ZPC A;  2F4V F;  5LSO A;  1JNZ B;  1OWX A;  4OYB A;  5DDP C;  3DXB A;  2DY9 A;  3DLH A;  3VZH A;  3IRX B;  2X7I A;  1X9W A;  2RKI A;  3TUI C;  3JS9 A;  1J2V A;  3NNH A;  3PO5 A;  3B4D A;  5ETP A;  3PM9 A;  4DL2 A;  3RBZ A;  5GAD U;  3MR6 A;  2WTF A;  4LR8 A;  1LWF A;  1U47 A;  3ULH A;  1VBX A;  4TLR A;  4LF5 J;  1RWX B;  3UE2 A;  2XO6 A;  4RNO A;  1FER A;  2LDY A;  2ASL A;  5A6W A;  1NB7 A;  4Y2A A;  3BBB A;  1U25 A;  1TFY A;  1HNW F;  3MD3 A;  3J80 Y;  2CPY A;  1NAQ A;  1U1R A;  3LW5 C;  1CBK A;  1OJ4 A;  3TAM B;  1HL6 A;  1RAJ A;  3QIP B;  4EWT A;  4FBU A;  1EJ7 L;  1P9Q C;  3HVA A;  4O0N A;  3P49 B;  2P6S A;  4YDX A;  2FJA B;  2VHG A;  5CXT A;  2DNM A;  4A48 A;  1NK0 A;  7FD1 A;  5GAG I;  1Z4U A;  1TKX B;  2DHH A;  2V8H A;  3DDN A;  2OGU A;  4C98 A;  4I2P B;  1YIT S;  3OTO J;  4AL6 A;  1XK8 A;  4NOH A;  4DN9 A;  4V1A k;  2IBO A;  2M52 A;  4KT0 C;  4K4Y A;  2Q1L A;  1URN A;  3IR5 B;  1AXQ A;  1TZ0 A;  2ABY A;  1RXO B;  5ETO A;  4WFN Q;  4DV4 F;  1WSV A;  3MFI A;  2WVB A;  2J5A A;  3TEG A;  1HQE B;  5KG4 A;  3A8I A;  2QJ3 A;  4LIR A;  4A8W A;  4WFX A;  1A0O B;  3SBM A;  5LMN F;  3OXL A;  2HHX A;  3X3U A;  1CLF A;  4F2S A;  3SSQ A;  1UAW A;  1TL5 A;  3FNN A;  1R89 A;  3E8O A;  2V5H G;  1D0E A;  2M8D B;  5LXR A;  1RT1 A;  2RDI A;  1PBU A;  3HDS A;  1PYO B;  1IBC B;  3UN5 A;  2FJW A;  2W4D A;  4QWD A;  4ELU A;  1WJ9 A;  2RKI B;  3A13 A;  4ZKA A;  1VQ5 S;  4CQ1 A;  1X4A A;  1HQU B;  3QT5 A;  1AUD A;  4XPE A;  3MTJ A;  4PWD A;  4R5P A;  1Q79 A;  2B5J A;  3MEK A;  2VIC A;  1LWF B;  2P5V A;  4L6V 3;  4WYL A;  2BOP A;  3NS6 A;  3V4M A;  4JI7 F;  2ZEJ A;  3MOZ A;  3US5 A;  3GYG A;  2KVQ E;  2Y1I A;  2MJU A;  1TL1 A;  3LWL A;  1C4C A;  4IRD A;  2DBB A;  1KEK A;  4OLO A;  2HFZ A;  3VGU A;  1IKY A;  1P9Y A;  1S4E A;  5KT4 A;  3UN2 A;  2BJ8 A;  4ES2 A;  4CLZ A;  5M2P A;  3H42 A;  5ETR A;  5EHH A;  1WOP A;  1FFW B;  2QIF A;  4MKY A;  2VBY A;  4CH0 S;  4K4W A;  4F50 A;  2UVR A;  1FJG J;  1ACM B;  3HFZ B;  3LF0 A;  1LFP A;  2LU2 A;  2XMM A;  3L9Z A;  1ZET A;  2HNZ A;  4NMX A;  5E33 A;  3NGT A;  3T9Z A;  4NEZ A;  4LRF A;  1U2F A;  2EFN A;  2Y1R I;  1WC1 A;  1OYD A;  1UPM B;  2EVZ A;  3I9Z A;  2FQQ B;  4MH8 A;  2B4U A;  5J2P A;  1TEL A;  5B7W A;  1FE0 A;  3ETO A;  2Z2L A;  3I5B A;  5THW A;  3B78 A;  3UNG C;  5IV4 A;  2OH2 A;  3MPW A;  1S9E A;  1U24 A;  3DGV A;  3L3C A;  2VFR A;  1LWE A;  2D69 A;  3HMJ G;  2J9D E;  4HHH A;  2JDJ A;  4P9S A;  2YKN A;  4P72 A;  1N32 F;  1FT8 A;  3N5F A;  3CGI A;  2KM8 C;  3A3O B;  5D0G A;  2HVH A;  5B0A A;  4CYU A;  4CO3 A;  1S6Q A;  4MIA A;  4NLV A;  3GIR A;  1GTH A;  2VAS A;  3BH7 B;  3NAI A;  5DM7 Q;  2E7W A;  5KOX A;  3CIZ A;  1RWK B;  2XQC A;  4ZLJ A;  5KFC A;  4R5P B;  1W26 A;  1FNM A;  1KRP A;  1FJE B;  5GME A;  1VQY A;  2M4M A;  4O44 A;  4DUY J;  1VHF A;  4DR4 J;  2FB0 A;  3K89 A;  4A8Y A;  1X31 C;  2EFP A;  4AXI A;  3OFF A;  4WCE Q;  2WZ1 A;  1S1X A;  1TK8 A;  1TL1 B;  3EJM A;  2U1A A;  4O0I A;  3A8E A;  3TA1 A;  1YJR A;  1IKY B;  4YUD A;  1NB2 A;  1ZM3 A;  2HHQ A;  3GMG A;  1BXN A;  3D66 A;  1IWG A;  2SXL A;  4F4Z A;  3BM7 A;  1Y3J A;  2IM1 A;  4X66 F;  4RX6 A;  1KS2 A;  4PG8 A;  3NOG A;  3GU0 A;  4NLO A;  1SC6 A;  3HHN B;  1SC3 B;  2HVI A;  3N4W A;  2XSF A;  2FY8 A;  1WOS A;  1WC3 A;  3WC0 A;  4XDD A;  5KFG A;  5KFR A;  4M5K A;  3UN3 A;  3R27 A;  1TU0 B;  1NSQ A;  1UET A;  2ASY A;  4C48 A;  1RLD A;  4H4O B;  3TJA A;  3OLA A;  2CPI A;  3DXS X;  4UQG A;  3MMC B;  2D7S A;  5HL7 Q;  1Q0N A;  2PA3 A;  3J81 U;  1NPP A;  3ZZU A;  2HAF A;  2YNI A;  5J2P B;  4FYY B;  2RUS A;  4DPX A;  3RB3 A;  4LRE A;  3O8W A;  5SZT A;  4FXW A;  2BRK A;  3GG1 A;  1U1Q A;  3MR5 A;  4Y3C A;  4F3Q A;  4LSN A;  1S9E B;  1LWE B;  5KFA A;  2R8H A;  2DR8 A;  5AJ3 F;  3FFI A;  3OL9 A;  3P8B B;  2N82 B;  4YP3 A;  3BEG B;  3GJQ B;  3JQM A;  2ACY A;  2MKJ A;  1RHR B;  4C8N A;  1SKW A;  2AJ0 A;  3M1V A;  4DV4 J;  2Z56 B;  4CYU B;  1S6Q B;  3JQK A;  2JZ5 A;  2H4W B;  2DGU A;  2VQF J;  2H1Y A;  1M5O C;  1HHT P;  3LGM A;  1RA6 A;  2P9E A;  2V8D A;  3CCW A;  2A6O A;  4FF4 A;  1VCT A;  4O44 B;  3CF5 Q;  2DPI A;  3W2V A;  2IY5 B;  4ZCK A;  1YJ9 S;  2X1F A;  4JI8 F;  3UDE A;  3EGN A;  2K7J A;  1V6H A;  1Q8I A;  4KY3 A;  1Q7Y T;  1KKH A;  2J9C A;  3GYX B;  2CJY B;  3C16 A;  3MI7 X;  3FCW A;  5HSP A;  4PQU A;  4O3Q A;  3ZNJ 1;  3CXC R;  3OSP A;  4NE9 C;  1GT8 A;  3QGG A;  4OJ3 A;  4B9S A;  2KO1 A;  4Z37 A;  3B8H A;  1VQ7 S;  3HFK A;  4NZ7 A;  4JI7 J;  4U6P A;  4M95 A;  1BGX T;  3UR0 A;  2GO8 A;  1LW0 B;  5C24 B;  2M3D A;  3EGV A;  3AA9 A;  1KSP A;  1ZZN A;  1K73 T;  2VPY B;  2WAQ D;  2JEF A;  4HVZ A;  1TL4 A;  2CNK B;  2AX0 A;  4ECX A;  3SQO P;  3J7A 1;  3I31 A;  4DL4 A;  2R7O A;  3C8Y A;  4OMF G;  1PIE A;  1KOH A;  2XMK A;  2CUY A;  5DDO C;  3B82 A;  3W1Y C;  4R8U A;  3A4T A;  1FNO A;  2NXJ A;  4ED5 A;  4A4J A;  3SEO A;  4B3R F;  4WPA A;  2AT1 B;  4OHX A;  4LF1 A;  3W65 A;  5KFE A;  4HT7 A;  3FFI B;  1TAQ A;  4DCO B;  1WEY A;  3QO9 A;  5LT5 A;  2HVZ A;  3NNC A;  1OMS A;  2R2S A;  5DDQ C;  4NL5 A;  2DGO A;  4B3O A;  3G87 A;  1PAE X;  1T03 A;  1X4E A;  3BDP A;  1Q5Y A;  1T9Y A;  2QFI A;  2OUG A;  2HHV A;  4KAI A;  3PZP A;  1T3N A;  3PTW A;  1ULR A;  2DNL A;  2EC0 A;  2ZUA A;  2X1A A;  1FHT A;  1FEE A;  2HFN A;  3G6X A;  2Z4P A;  3ZC4 A;  1N5T A;  3MF5 A;  4NA1 A;  4ZJQ A;  2CPE A;  3RTV A;  1SJR A;  4LJM A;  4DSJ A;  3J81 j;  3BSN A;  4USM A;  1DBD A;  3H5Y A;  3C14 A;  1JNR B;  4DQP A;  3W60 A;  5JMN A;  2E1A A;  5HO4 A;  3VQS A;  1VMB A;  4CO5 A;  3C16 B;  4PQU B;  3DRR A;  2CVE A;  4WTY A;  4J9L A;  2K3K A;  2R9L A;  3CIM A;  3HT0 A;  3TYT A;  3WIV A;  3BYP A;  3ILJ A;  2X1B A;  3MXH P;  4O4R A;  4QQB A;  2Z58 B;  3OW2 R;  2IA6 A;  4ALZ A;  4LF9 J;  2K7K A;  3IWN C;  2DIT A;  2IDL A;  2NYI A;  2KG0 A;  1FKP B;  4USJ C;  4CLP A;  1RAG B;  1FFS B;  4XTT A;  2D9P A;  3J7Z 5;  3AJ2 A;  4X66 J;  3LPE A;  3K57 A;  5D4O A;  1IBM J;  5DZ6 A;  1U0H B;  4R8U B;  2HZA A;  2ZHB A;  1V5V A;  3J7Z T;  1T9U A;  4LVO P;  5I3P A;  3ZZT A;  4KKO A;  2EKN A;  4UZC A;  1I5O B;  4C8O A;  2C3O A;  5D8H B;  2XSJ A;  4ANE A;  3NXZ A;  1HNX J;  3QRQ A;  1XN9 A;  3QT7 A;  1RU1 A;  4BC9 A;  2XY7 A;  5K20 B;  1XMQ J;  2F1F A;  3RB4 A;  2XYH B;  1ZPV A;  2JWN A;  3CUL A;  3QO9 B;  1BWE A;  3IR6 B;  2UUA F;  4I7F A;  1SPB P;  1CJT B;  3K58 A;  1VC5 A;  3NGK A;  4YHH F;  1Y00 A;  4B3O B;  3SCK E;  4DR3 J;  1T03 B;  1FFG B;  2ZNZ A;  4Z7C A;  3ISN D;  5FLX U;  2EXU A;  4X84 A;  2RU3 A;  2EK1 A;  4F0K A;  1XR7 A;  3EPG A;  3CCZ A;  4HDH A;  5KOW A;  4UW2 A;  1F3F A;  1FXD A;  4OZ5 A;  1EZZ B;  2QX0 A;  2OTL S;  1WWH A;  5GVQ A;  5DGB A;  1HNV A;  4HH1 A;  3KLH B;  5IC6 B;  3IA0 A;  4MYU A;  3D3C J;  1RAI B;  4JI3 F;  1VOM A;  2AJ1 A;  3C14 B;  5DO2 A;  1YJV A;  4F4A A;  3H2V E;  3M6U A;  3FBE A;  4M5L A;  1SJF A;  1VQ9 S;  4NI2 B;  1O0P A;  3L7U A;  1REG X;  2VOO A;  5GMD A;  3IXQ A;  4PG4 A;  1Q81 T;  1HPZ A;  1RTJ B;  2RD5 C;  3O44 A;  1YG0 A;  1FDA A;  1XBW A;  2C2O B;  4JI8 J;  1M1G A;  2U2F A;  1OPI A;  1I1G A;  2CYY A;  1RWO B;  1JIH A;  1UTA A;  1M5H A;  2HQI A;  5C25 A;  3CJS A;  2R2U A;  3TQ1 A;  2NXE A;  1GQE A;  4OI4 A;  3DLL Q;  3HM9 A;  3AH6 A;  3VQT A;  4WF9 Q;  1PGZ A;  2F40 A;  2YWE A;  2O1P A;  3BKF A;  5ETV A;  3M30 A;  1LXN A;  2H4Y B;  5KT7 A;  4KKO B;  5G0R B;  1QSS A;  2NUU G;  2W2M P;  2CNO B;  4PEO A;  1FD2 A;  2XSJ B;  1U1N A;  2FZK B;  2EFQ A;  2CJA A;  2BJ9 A;  2A10 A;  4RWX A;  4JOU A;  2C3P A;  2LA4 A;  2EW9 A;  2W1B A;  2XY5 A;  2DH9 A;  1RSC A;  5JXS A;  4DV1 F;  4B3T F;  1VGY A;  2RNE A;  5K8N A;  5G4D A;  5LOQ A;  4C8M A;  2XZW A;  4O4G B;  3EXC X;  2HHH F;  5K14 A;  1YTY A;  4X4S A;  4I7F B;  1XWL A;  3OTE A;  3DI6 A;  5E3Q A;  1DFD A;  1L3U A;  3I96 A;  4J9K A;  5AT1 B;  1C1C A;  2Z8Q A;  1S76 D;  4F4Y A;  2DR9 A;  3DU6 A;  3Q83 A;  3M05 A;  1Q8L A;  2F4F A;  1H73 A;  1QAY A;  5J1N A;  2DXE A;  4CH7 A;  4B3R J;  1U26 A;  4WTO B;  2RQK A;  2OPQ A;  4KHP F;  2XHW A;  2R8J A;  4X62 J;  2CJB A;  2C2M B;  7AT1 B;  1QLN A;  4FP9 A;  1BQN A;  1FTC A;  2HFV A;  4DV7 J;  4OZN A;  2V8V A;  5A8R A;  2JFK A;  4DUZ F;  5K9F A;  3EGW B;  3JSR A;  1RWM B;  2PMW A;  4CLU A;  2CQP A;  2BW7 A;  2AX1 A;  5H9E K;  4ZA1 A;  2JH3 A;  1LV5 A;  2V4R A;  4UOC A;  1IR0 A;  4AQY F;  2DNZ A;  2WBR A;  3H5U A;  3OR2 A;  2RE1 A;  3TP2 A;  5C2G A;  1HPZ B;  4EBC A;  2UXC J;  2VPX B;  3H59 A;  2EK6 A;  4ZVT B;  1TUW A;  2NXN A;  2MYF A;  1T95 A;  4QU7 A;  2HG4 A;  3D68 A;  5I4M A;  4F8R A;  3UCZ P;  3QRP A;  3QQC D;  3LOU A;  1X4B A;  3MHY A;  1XQI A;  4MAK A;  5C25 B;  3CCU S;  3E01 A;  1RHU B;  4DV0 F;  3UCG A;  3VVT A;  3CJ4 A;  4FNI A;  4MYT A;  1WI6 A;  4GKJ J;  1EQM A;  3IBW A;  4JBC A;  4TQR A;  5KFS A;  3P4U B;  2ASD A;  3ITH A;  3TX8 A;  2QZ8 A;  3K5N A;  1LNQ A;  3HSZ A;  3MR3 A;  4DSI A;  2XS7 A;  3HX9 A;  3M30 B;  3M9N B;  2L41 A;  1T9W A;  4X4Q A;  4DR5 F;  3L09 A;  3R5C A;  4NYO A;  5BYR A;  5K8P A;  1XNQ J;  2WCX A;  4X4P A;  2LFV A;  4DSK A;  4MKA A;  3NAH A;  3NWR A;  3OLB A;  2YKM A;  2PI5 A;  2ZM6 J;  5B0G A;  5K14 B;  3P96 A;  4WK3 A;  3DI6 B;  4J9O A;  1R6Y A;  4CH1 A;  4GKK F;  4O3P A;  2V0N A;  5HVF A;  1C1C B;  3QJJ A;  1B0P A;  4Q0B A;  4KGM A;  5FII A;  1PJ6 A;  4ZOS A;  3TJ8 A;  4NLR A;  3KLI A;  1EX8 A;  4Q7A A;  2OPQ B;  1SKU B;  1R0A A;  4IH5 A;  2WBM A;  1SL1 A;  3QPI A;  1S6P A;  2QFJ A;  3BO2 A;  1RTH A;  1C0U A;  4IH6 A;  2IM2 A;  5L1L A;  1IBK J;  1BQN B;  5JUM A;  3HHK A;  3GII A;  4GC6 A;  1YK9 A;  4I6A A;  3PFO A;  1ICE B;  5A8R B;  5HVG A;  3OQ2 A;  4EYI B;  1HW8 A;  3C19 A;  4ZVF A;  4DR1 J;  3DLJ A;  1QAI A;  3RUB L;  2PO4 A;  1JJH A;  4PWU A;  2UVV A;  5HI7 A;  4BC7 A;  4OZ3 A;  2HNY A;  2K2P A;  4FKY A;  1BE4 A;  2O5D A;  1HBU A;  3D6H B;  1N6Q A;  1YJW S;  2ADB A;  4ECQ A;  2ZH9 A;  2KT3 A;  1VRT A;  1DQ9 A;  2FD2 A;  3HJV A;  3D67 A;  3KUH A;  4FN5 A;  2ASJ A;  2MMY A;  3BQ0 A;  2VPZ B;  2IM0 A;  3T1H F;  1R8A A;  5KFU A;  3CO9 A;  2O66 A;  1MLA A;  3D6T B;  2OIH A;  4DV2 F;  3E01 B;  3M8S A;  3MPU B;  3PX4 A;  3N9U C;  2C2D A;  3FRZ A;  2ZH3 A;  2Z2Y B;  3ZFV A;  2ROE A;  1TTH B;  2JEI A;  2LCW A;  3AD9 C;  1MG7 A;  1SQG A;  4N76 A;  2GVZ A;  2ZJR Q;  1VDH A;  3FMW A;  3HHL D;  5AXM A;  4DPO A;  5EN1 A;  3NG8 A;  1P27 B;  2AGO A;  2ZDO A;  3LPY A;  2V94 A;  3HKZ D;  3GIL A;  1YZ6 A;  5LM7 E;  3HJF A;  4M5H A;  4PCQ A;  1N5V A;  3SYZ A;  2NSC A;  2YX1 A;  2YKM B;  2ZH8 A;  1GX5 A;  2ALY B;  1VI7 A;  2QLB B;  1UFK A;  4WJB A;  2Y3Y A;  2JVO A;  4CLW A;  3MAA A;  2MQM A;  3KWM A;  3MDF A;  4AXJ A;  2WOM A;  4WE1 A;  1VJW A;  3DDI A;  2O3D A;  2JC0 A;  3C6U A;  4A8F A;  2ZH2 A;  2ZHA A;  2M9K A;  3OHB A;  4K4S A;  4X65 J;  3RYL A;  4J90 A;  3EYZ A;  1CEZ A;  1S1T A;  1AB8 A;  1H3D A;  4ZVR B;  5E41 A;  3V6D A;  4OX8 A;  3KLI B;  4AUK A;  1F3V A;  4IUF A;  1NDC A;  1R0A B;  5DG8 A;  1SCJ B;  4ZPV R;  5L9X A;  1K1S A;  1S6P B;  3OD2 A;  2F9D A;  3ZZY A;  1C0U B;  3BN4 A;  4TVA B;  4M63 A;  4WII A;  4XK8 C;  4RW9 A;  4PG5 A;  4OYZ A;  3JYT B;  1BWV A;  4TYA A;  1KVJ A;  1FF2 A;  2ZOG A;  2EBG A;  4ID8 A;  2FJD B;  3I4P A;  3TR5 A;  1S1W A;  2E7V A;  2D1C A;  4WZQ A;  2KDO A;  2E1P A;  1VRQ C;  2HNY B;  2VJV A;  5KFX A;  4EU0 A;  4IKA A;  2GQ2 A;  1HBU B;  3MM6 B;  1N0V C;  5CH7 B;  4JI0 F;  1N6Q B;  1R43 A;  1WG1 A;  4C7Q A;  3CUN A;  4DJB A;  2DR5 A;  4JUZ A;  3CJ3 A;  1JLF A;  2Y8W A;  3TI0 A;  4PYA A;  3CC2 S;  4N8N A;  4DUZ J;  1JKH A;  4XDC A;  2UU9 F;  4ILM A;  2DR7 A;  1C1B A;  1B0T A;  4C8Z A;  1KC8 T;  2JJ4 D;  2BM1 A;  2IJR A;  2C22 A;  4KSE B;  2MZS A;  3TQE A;  2GS8 A;  1LWC A;  2BKP A;  5HLF A;  3LTO A;  2XYP B;  4UST A;  4ILR A;  1TUV A;  3KK2 A;  1UWA A;  4OI3 A;  2HKE A;  2ZH7 A;  2QO3 A;  5E3R A;  1UJ5 A;  4RW6 A;  4BS2 A;  4NCA A;  4Y6I A;  4HH0 A;  2VJU A;  4ZP6 A;  2GJ2 A;  3AY0 A;  5DM6 Q;  1HWK A;  2ZH1 A;  4ICL A;  1NLK L;  1H2T Z;  4ED3 A;  3IS9 A;  5LSR A;  1ZZF A;  5L1I A;  1R8B A;  5A2Q U;  2QL5 B;  3BS9 A;  3W62 A;  1R0B G;  2LEA A;  3FBB A;  2CJK A;  2YQ3 A;  3H98 A;  2RRA A;  2IVF B;  2ZJP Q;  4YY3 F;  3OVA A;  2WOM B;  4WE1 B;  3FDS A;  5H9F K;  1HBN A;  2QLF B;  3C6U B;  2DY1 A;  1R31 A;  2DGQ A;  4OYI A;  1JLG A;  4Y0F A;  2R7R A;  4P73 A;  3CCR S;  5KFK A;  1S1T B;  1TVR A;  3V6D B;  1YRT A;  1HNZ F;  1OYE A;  3I32 A;  1HNI B;  3BBF A;  2R7T A;  2QEX S;  4HI1 A;  1HBO A;  4ZCI A;  3MM5 A;  3QJP A;  3KLG B;  3KJV A;  4AL7 A;  3CCJ S;  2EFO A;  2JX2 A;  1OPZ A;  2XHC A;  2E5L F;  2MZR A;  3JTO A;  5KG0 A;  1GFW B;  3MM9 A;  4NYZ A;  1XMB A;  3K17 A;  3HD1 A;  2CQB A;  4LFC F;  4JI2 F;  3K0J A;  1K9M T;  4IG3 A;  4NRT A;  2BJ1 A;  2QA4 S;  2DEI A;  1S1W B;  5CD4 H;  1BY9 A;  4KHR A;  4ECV A;  1RUS A;  2KFN A;  4PYD A;  3PYF A;  4DHV A;  2DEJ A;  3SV3 A;  2X3D A;  3BQ1 A;  1KVK A;  3A1Y G;  1ITP A;  1S49 A;  1JLF B;  4Y2K A;  5D4L A;  4ECW A;  5KT3 A;  1OSD A;  2W01 A;  1JKH B;  1U1K A;  5HRO A;  1C1B B;  1S9G A;  1YIJ S;  3R5G A;  1UEK A;  4X64 J;  2GIR A;  3Q8U A;  9ATC B;  1ZTW A;  4AT1 B;  5K8O A;  1RT2 B;  3FMB A;  4QZV B;  2KN4 A;  2IC3 A;  1PIL A;  2DNN A;  1LWC B;  2CAD A;  5HLF B;  2FC9 A;  4X4O A;  3CDW A;  2K3I A;  3KK2 B;  1EP4 B;  4QBU A;  3TUZ C;  3ENA A;  3MWB A;  4RW6 B;  4ZIW A;  2POK A;  1RTD A;  3CDU A;  4ICL B;  4DFJ A;  1WHW A;  1Q5V A;  1S99 A;  2RQM A;  3IS9 B;  4QPT A;  1HA1 A;  3WIU A;  1R3N A;  5J1P A;  1AFI A;  3SFG A;  1E6V A;  4F0M A;  2VFU A;  5IQQ A;  3GV5 B;  1OS5 A;  3MEC A;  1EIY B;  3Q0A A;  2BJ7 A;  2OD6 A;  1NZ8 A;  2B7B B;  4I68 A;  4G1I A;  3TUP A;  2Z0G A;  1HBN B;  2EG2 A;  4DV5 F;  1JLG B;  1N34 J;  2GW8 A;  4USK A;  4DR2 F;  3SSR A;  1TVR B;  2AV5 A;  2WVD A;  1HIY A;  3WQP A;  3KK3 B;  5DDR C;  4ECR A;  2N7Y A;  3Q8V A;  2VG7 A;  3KLE A;  3DLE A;  1M1H A;  3H90 A;  1FXL A;  2C2K B;  1HBO B;  3MM5 B;  3KJV B;  5L39 A;  3X1L B;  2CPJ A;  3PHT A;  2LDI A;  4YR3 A;  2HVE A;  3CW2 C;  2QA4 G;  3MM9 B;  2PA8 D;  3A12 A;  4CI0 B;  2NYH A;  4FPR A;  3GV8 B;  2XMA A;  1VC6 A;  3S01 A;  5KFD A;  1RBA A;  2XEX A;  2JOQ A;  2P6T A;  5E3P A;  4B08 A;  1SL0 A;  2OEK A;  3OHA A;  3G2X A;  2GHP A;  2Q43 A;  4YN3 B;  2LEC A;  2V8P A;  2PSZ A;  2DYA A;  2LLZ A;  1RAO A;  1TL7 A;  2HIQ A;  5KT2 A;  5HRO B;  1S9G B;  2V8G A;  1PJ5 A;  1P8G A;  1UJ4 A;  4HAC A;  1QDU B;  3BZQ A;  3V5R A;  2MQN A;  4P2X A;  1CQN A;  2IC3 B;  2QA1 A;  4NLS A;  4DL5 A;  4QJV A;  4E2F B;  2IM3 A;  4U7C A;  5BR8 F;  3I0S A;  4C11 A;  1T9T A;  4I67 A;  1SQE A;  4FS1 A;  2H48 B;  1QD1 A;  4NLG A;  1KFD A;  5I3U A;  2XY6 A;  1RK8 A;  3RBD A;  1RTD B;  3ILI A;  2JLE A;  1SKR A;  2HSE B;  1LW2 A;  4TY8 A;  1VQS A;  5ETT A;  2CJ9 A;  2UU9 J;  3VWS A;  4LFA J;  5F8I A;  4URS A;  3BO3 A;  1QAX A;  2W9B A;  1T94 A;  4LF6 J;  1NXI A;  2XI2 A;  1EET A;  2X51 A;  3AOA A;  3FUY A;  3RU0 A;  4UTG A;  2FHJ D;  2I8E A;  2UXB F;  3MEC B;  4YOE A;  2N4D A;  1UW4 A;  2R42 A;  1NK7 A;  2CQ3 A;  4J9U E;  3O6Q A;  1N5Y A;  1AT1 B;  3O2I A;  3KLF A;  1XNR F;  3CCS S;  2UUB F;  1HAR A;  1CPZ A;  4MT1 A;  2HPU A;  1GMV A;  4DL6 A;  3H2L A;  5CAB A;  4NYP A;  4B9U A;  5H9E J;  1S97 A;  2VG7 B;  3DLE B;  2VC0 A;  2DH8 A;  1HD1 A;  2YWH A;  5HAN A;  4K4V A;  2CDR B;  3HHL A;  4NLU A;  3GSD A;  4DQI A;  4C0B A;  1Q8K A;  4L73 A;  1TMM A;  4ECY A;  2VZ9 A;  1PYT A;  4F26 A;  4NLP A;  3DM2 A;  2OPR A;  4AND A;  4JI1 F;  2DKO B;  2DPJ A;  4WU2 A;  2W2P P;  4DDF A;  5KFB A;  4ED6 A;  2QMU B;  1KN6 A;  4RBU A;  3RG6 A;  3KDO A;  3TAQ A;  4QR0 A;  4YR0 A;  1DY3 A;  1DQA A;  3ENQ A;  1G6B A;  4ZLP A;  1RYR A;  4FPI A;  1VK3 A;  5ETS A;  5BYS A;  3HCX A;  2Y8Y A;  1KR4 A;  3I6P A;  1PYS B;  3GIK A;  5ETN A;  2EC2 A;  2KZM A;  3AT1 B;  3N6M A;  2VH7 A;  2DK2 A;  3HUL A;  2AW0 A;  4OZ2 A;  3M6X A;  1ZA2 B;  3JB9 k;  4IQM A;  2PN6 A;  5E2Q A;  4ZS6 A;  3AD7 C;  4HAC B;  2MQP A;  1D1U A;  2MLZ A;  5FDL A;  2ZWP A;  1Y0H A;  3MM8 A;  4KGX B;  5D3G B;  3NMR A;  3QSY B;  1S9F A;  3CJ0 A;  4RW7 A;  4ELT A;  3I0S B;  3DRP A;  4DX7 A;  2J0Q D;  5F3T A;  3KKF A;  4JV5 F;  4TU8 A;  5I3U B;  1F9F A;  1K0V A;  2NXC A;  4ZJL A;  2W7A A;  2YPZ A;  5MLC V;  1O6X A;  3CDA A;  2R7U A;  1LW2 B;  4TY8 B;  2RRN A;  4CLY A;  2NRE A;  2HWT A;  2ZKU A;  2W9B B;  2QSF A;  1UFW A;  3HVW A;  3MUM P;  3W2W A;  4KJI A;  1EET B;  2M88 A;  1SB6 A;  2DR6 A;  1VQO S;  1DTQ A;  3DRS B;  5HMZ A;  3CJQ A;  1J5E J;  1LQ9 A;  1KQK A;  1RT3 A;  1YJT A;  3C46 A;  4KO0 A;  2E5H A;  4YS2 A;  2HUR A;  3CB4 A;  4K2J A;  2VDI A;  4LR7 A;  1SQF A;  4MFB B;  1S57 A;  3KLF B;  3IM9 A;  4F0H A;  5F41 A;  1CS4 A;  3Q8S B;  3G6V A;  4EBD A;  4PUO A;  4KGK A;  1Q86 T;  3DLK B;  2Z2M A;  3RAM A;  3C66 A;  1D9D A;  2FIU A;  2KRB A;  5KFJ A;  5B0F A;  3DNC A;  1PCA A;  3UFC X;  3OFE A;  4DF8 A;  2PC6 A;  3HHL B;  1NK6 A;  1MSW D;  1M1K T;  4Q8E A;  2HWH A;  3PEH A;  3KJN B;  2AEM A;  2RF2 A;  4LF5 F;  2YQ0 A;  4TLQ A;  4OYP A;  4C3K A;  1BHN A;  3DM2 B;  3S1T A;  2OPR B;  3L7P A;  4USV A;  2F5G A;  5EX3 A;  1WTB A;  4DPT A;  2ROP A;  4NWB A;  4YB5 A;  2MJN A;  3IGV A;  2QA2 A;  4WKY A;  1K0T A;  2CRL A;  1QTN B;  1L5U A;  4IOB A;  3MCO A;  4CLK A;  2J7K A;  1JJ4 A;  1IKW A;  1TMJ A;  5B09 A;  3K8W A;  4K5S A;  1U49 A;  2RDD A;  4ZVP B;  3BDE A;  3M8Y A;  2H5I B;  3BN7 A;  2V9K A;  4DLE A;  5FDL B;  2DHA A;  2NCK L;  3OTO F;  1Q8B A;  1FX4 A;  5F8L A;  1YJ7 A;  1VRU A;  2RU9 A;  1NK4 A;  2CWX A;  3MTK A;  3DRP B;  1X4F A;  3B54 A;  4QU6 A;  2FC8 A;  1MN9 A;  1QUV A;  4B17 A;  2DB1 A;  4ZIT A;  5KFY A;  3CTR A;  4HDG A;  4EO6 A;  1SH2 A;  4JYA J;  4ANC A;  4ZP9 A;  3LUY A;  3AJ1 A;  3BPD A;  3CD7 A;  1SIW B;  3W2W B;  4P74 A;  5T41 A;  4Q2L A;  2QLX A;  1NRK A;  1JJ2 R;  4WFZ A;  1MWQ A;  3I87 A;  1S0V A;  3AB2 B;  1B7F A;  3O1L A;  1X5S A;  1UKU A;  1RT3 B;  4RKU C;  5BR8 J;  1BMQ B;  2AP6 A;  1RZM A;  2DNH A;  3MZI A;  4JP8 A;  2C2Z B;  1RAE B;  3BYR A;  2VG5 A;  1CS4 B;  2J9D A;  3GJS B;  1KNZ A;  2C3U A;  4PUO B;  3HSG A;  2D3O R;  1G3O A;  1FRM A;  2AU0 A;  1WAC A;  3V4I A;  3T5H A;  2HQG A;  4NA2 A;  3SQG B;  2R7Q A;  2V2V A;  2HQC A;  5KFT A;  2RF2 B;  4P2M A;  5F0U A;  5J1E A;  1TFW A;  4R0J A;  3LP1 A;  4B3M J;  2G1D A;  3Q89 A;  2KU7 A;  1IQT A;  2PFD A;  3GFY A;  1V5I B;  1FXR A;  3UD4 P;  2Z30 B;  2D3O 1;  2BAN A;  2G9O A;  3M9O B;  4ELV A;  1TV6 B;  1KON A;  3DOL A;  1RIS A;  3PIP Q;  2CNN B;  1ZBT A;  2H5E A;  1FJG F;  1RCO B;  2LQJ A;  4WXO A;  1IKW B;  1WDT A;  3SDE A;  1R8C A;  5C7P A;  1JLB A;  2PGC A;  3M2R A;  5IC4 B;  1L3V A;  4JI1 J;  2J0S D;  1Q1K A;  2Q6C A;  1RHM B;  5SUH A;  5KTQ A;  3PX0 A;  1S5Z A;  2A1B A;  4H4K A;  3QID A;  3W9H A;  4DLG A;  1ZA1 B;  1VRU B;  3GWC A;  1FES A;  3HVR A;  1RWU A;  4UUW A;  3QZ8 A;  1LFW A;  2QC3 A;  3V6H A;  2QLW A;  3LAN A;  4Y2I A;  2AD9 A;  2R2T A;  1GNK A;  4IYQ A;  4UT4 A;  4DFP A;  1F9E B;  1VBK A;  4M5M A;  3GB0 A;  5KFF A;  5H9F J;  1S0M A;  2V63 A;  1U0S A;  1RKI A;  1FEH A;  4PQA A;  6FD1 A;  4FXV A;  2QG9 B;  1T3O A;  4RW4 A;  3T5J A;  1AW0 A;  2E5G A;  3HI9 A;  4CT8 A;  4RJV A;  2B3T B;  1U7L A;  1RWW B;  3MMA A;  2V67 A;  4QW9 A;  5BJR A;  2CWK A;  3D0I E;  4KGZ B;  1VQP S;  1U48 A;  5HAO A;  2B9Y A;  2VG5 B;  3FCH A;  1NU4 A;  2EFG A;  2HBZ B;  3R2C J;  2AF6 A;  3V4I B;  3FK4 A;  2GC8 A;  3EVO A;  2ZJQ Q;  2ZBR A;  3UR3 C;  1SVD A;  2GHW A;  4ZCM A;  5IQ6 A;  2YH1 A;  3UPF A;  4DR4 F;  2I38 A;  2G1H A;  4DG1 A;  4Y2M A;  3TJ9 A;  2V9W A;  4DEZ A;  2GJI A;  4MKB A;  1AA1 B;  2W8L A;  5J1E B;  3LP1 B;  4LF8 J;  3IG1 A;  3DOM A;  5U47 A;  1RHK B;  4NCB A;  2EKY A;  4B3S F;  2BR0 A;  1UFL A;  2BAN B;  3FQK A;  3T19 A;  3KJF B;  2OFG X;  4ZVS B;  3DOL B;  3W5X A;  4E8U A;  5IT9 U;  2FHJ A;  3ISN C;  5MAO A;  3ZZ0 A;  1XR6 A;  1DZ5 A;  1HYS A;  2HBR B;  4RO0 A;  1D09 B;  3SDE B;  3DHW C;  1RLC L;  1CUL B;  1LXJ A;  2E9R X;  1JLB B;  4ZN3 A;  3M2R B;  5C5J A;  2JNJ A;  3VAF A;  1I3O B;  2DNG A;  4Z7Y A;  1T7P A;  3R5B A;  5KFW A;  1KHV A;  3M7V A;  4I6W A;  1UVM A;  2LXU A;  4GVL A;  2V2Q A;  4DS5 A;  3OVB A;  2PFF B;  3NY0 A;  1PC4 A;  4DSF A;  2V4J A;  3AFG A;  1DAX A;  3UWT A;  4OX7 A;  2HHW A;  4CWB A;  1X4C A;  3LAM A;  1RWV B;  3FKB A;  1NK8 A;  4UUX A;  2DRA A;  3CD6 S;  2Q66 A;  1S6O A;  3QNW B;  2BMB A;  1U1L A;  2MST A;  4LBI A;  3B6B A;  2MTL A;  3N6L A;  5DLF A;  3QFH A;  2ZWO A;  1B70 B;  1JLA A;  3ISZ A;  2XG8 A;  2IJF A;  2MSS A;  3TA2 A;  1P6T A;  4RW4 B;  1RDR A;  2DRD A;  3CCE S;  4TNO A;  2ERR A;  1WEZ A;  5E3A A;  3EPI A;  3MMA B;  2DT9 A;  4NRU A;  3PHE A;  3K59 A;  1VIX A;  5IT0 A;  4J9P A;  4E0D A;  2MZQ A;  4DU8 A;  2VQF F;  4YFU A;  2IJN A;  2FVP A;  3TAN A;  2CFX A;  2N3O A;  1NCL A;  1U1O A;  3LQV A;  3OTC A;  4DG1 B;  2AWZ A;  3RR7 A;  2VFS A;  2ZDP A;  3QFW A;  5DJB A;  3I5C A;  2NPF A;  4JI5 J;  1ZOT A;  4ILL A;  4C3L A;  1WC4 A;  3PCO B;  2R8I A;  1ZM2 A;  1X4H A;  2I5J A;  3IG1 B;  3DOM B;  3PJW A;  1GK8 A;  2OP5 A;  4DOZ A;  2UP1 A;  3TEH B;  1S77 D;  2DH7 A;  2WW4 A;  1FRJ A;  4OI1 A;  4LMZ A;  3KDN A;  4PG7 A;  4IOC Q;  3NEK A;  4OQJ A;  3M6V A;  2YXL A;  1HYS B;  4F02 A;  2XUL A;  2DIS A;  5KG7 A;  1QE1 A;  2DGV A;  3RRK A;  5A8W A;  1SI9 A;  3ILO A;  4CO1 A;  1RJJ A;  1PSD A;  1F5B A;  1H7X A;  3HZG A;  1BQM A;  5A2Q Y;  2R3V A;  3CCL S;  3H7H B;  1N4L A;  1UEU A;  1RAC B;  3AXK A;  3D5M A;  3GR1 A;  3QGI A;  4F36 A;  2ZIT A;  4NPO A;  3T1Y F;  1QVF R;  2V4J B;  3EM1 A;  4USH A;  5AE3 A;  4Y34 A;  3MCS A;  2OPP A;  2NPI A;  1RWN B;  4K50 A;  2DNQ A;  2WVC A;  1RYS A;  1XJW B;  3EDQ B;  3DRX A;  4N56 A;  5DQI A;  1VQK S;  4OI2 A;  5KG6 A;  3PAC A;  1A6L A;  2DIV A;  2LEB A;  2IVM A;  2Y9H A;  3IBC B;  3G96 A;  3PJX A;  2B7C B;  3OL7 A;  1EHW A;  3IR7 B;  3R5J B;  1CQM A;  4IG0 A;  4PPZ A;  3KOA A;  1VHI A;  3VCD A;  2B0G A;  5LSL A;  1DRZ A;  5KT5 A;  1H7W A;  3WX4 A;  1RHQ B;  4FF2 A;  2QMW A;  4DQS A;  3R7N B;  4IO9 Q;  4LFB J;  2R8K A;  3DHX A;  1AUS L;  2NSB A;  2OPS A;  2JLF A;  2LYV A;  2M0G B;  3DDK A;  3D9B A;  4F4K A;  1U02 A;  4CO2 A;  2AMC B;  3PFE A;  3P5T L;  2BAC A;  1RCX B;  1U2R A;  3CD5 A;  3THP A;  2PMH A;  3JSM A;  2RS2 A;  3PY8 A;  4YME A;  3S8S A;  3MPV A;  1RT1 B;  4E98 A;  1SKS A;  2DGS A;  1ZS6 A;  2CZ4 A;  2R4F A;  5EWG A;  4UY8 T;  1V3R A;  4ERD A;  4PWD B;  1X7V A;  4DF4 A;  2B5J B;  2IDE A;  2W2N P;  3ZTS A;  2LEP A;  2WB4 A;  2XTJ P;  1EQ0 A;  2RHQ B;  2W8K A;  1TKT A;  5DRK A;  2AHO B;  1UW9 A;  1N33 J;  1QE1 B;  1RTI A;  2WVE A;  2BW2 A;  4Z2X A;  5A8W B;  2Q79 A;  3NGR A;  3RBX A;  2DO0 A;  3RJM B;  3R6G B;  2OEJ A;  1IVZ A;  2C28 A;  3Q8Y A;  5CZV A;  3F73 A;  1VQ6 S;  1FRK A;  5A8K A;  2J6S A;  4LF9 F;  1WHV A;  4ZHR A;  1BQM B;  4B3S J;  1REV A;  3L95 X;  3MAH A;  5EDW A;  4S0M A;  3FBF A;  2I1R A;  1FRL A;  3OT9 A;  1J27 A;  3RRG A;  4HHU A;  5D0E A;  2MY8 A;  2QV6 A;  2MQQ A;  2OPP B;  2JC1 A;  1ZH5 A;  2I0X A;  1IBM F;  3OJU A;  4CDI A;  1NEE A;  5LMU J;  2A6M A;  3FVY A;  3A8K A;  1KVI A;  2HNZ B;  1F6T A;  4IFY A;  4LSZ B;  1HNX F;  4IR1 A;  4YB1 P;  2FLN A;  1TKZ A;  3ZNU A;  4IG0 B;  1RBO B;  1BUX A;  4QW8 A;  2HHT A;  1XMQ F;  4URG A;  1ARO P;  1JMT A;  2JHE A;  5ETK A;  3MUR P;  2DVI A;  2W24 A;  3CDE A;  3EXY A;  2LVW A;  1NKE A;  4YQW A;  4DR3 F;  3OJS A;  2J6U A;  5DS7 A;  2OPS B;  5D78 A;  3MEE A;  2VQE J;  3HHL C;  4NZ0 A;  2NQP A;  2VF3 A;  1NH7 A;  3N0V A;  4DR7 J;  9RUB A;  4ECT A;  4C8K A;  4LF4 F;  1HR0 J;  3HO1 A;  2K1R A;  2FVC A;  4L3N A;  3AA8 A;  4DX5 A;  4M5J A;  2CNL B;  2YKN B;  2CKW A;  2ZC4 A;  4EI2 A;  3UQS A;  2XI3 A;  5IM0 A;  3FJ2 A;  2LQ5 A;  4LIW A;  2J0W A;  4QWB A;  3TWZ A;  1N36 J;  5KT6 A;  1IM4 A;  2DNY A;  4XIU A;  4OZJ A;  2DNR A;  1WG5 A;  3KHG A;  1TKT B;  3Q22 A;  3LO3 A;  4DMZ A;  1RTI B;  2HIY A;  2DO4 A;  2KTQ A;  1S1X B;  5A8K B;  4NLD A;  2IRX A;  5CYQ A;  1H2V Z;  4ZHR B;  4FZV A;  3D6M B;  3HVT A;  2HND A;  1REV B;  1TR0 A;  1I94 J;  1WF0 A;  4ZLN A;  2CAJ A;  4ENO A;  1NPR A;  2G2Y A;  2CDQ A;  4M8L A;  4X4U A;  2FYX A;  3JAM Y;  2BM0 A;  2Y0B B;  2AIR B;  2HBQ B;  2DHG A;  1NH8 A;  3D0G E;  1U2C A;  2RJZ A;  3H25 A;  1SV5 A;  3BKU A;  2D41 A;  5LJ5 Y;  4A8Q A;  5HN0 A;  3T5K A;  3EVW A;  3HPO A;  4W4M A;  4D3H A;  1FVS A;  5JJB A;  4N41 A;  2L9N A;  5HQL A;  1UZD A;  2VD3 A;  4ED4 A;  4LBH A;  3D6F B;  3CCQ S;  1YVF A;  1TKZ B;  2ZD1 A;  3AOB A;  1QSY A;  3T1Y J;  2YWF A;  3FBC A;  4F2R A;  2BA9 A;  4DBQ A;  4PXE A;  2FJE B;  1QM9 A;  4FS2 A;  2YNI B;  1SJ4 P;  2ILZ A;  1KWM A;  2IMO A;  1S4F A;  4CRJ A;  2OAU A;  3KG1 A;  4QYR A;  1Y4Z B;  4N7T A;  1T0T V;  5DZ7 A;  2PE8 A;  1RAH B;  4L75 A;  2UZA A;  1RAA B;  2LA6 A;  3M2U A;  2ROG A;  4CLS A;  3VAG A;  1P1L A;  4LSN B;  2AYB A;  1GXU A;  3OR1 A;  4Q43 A;  3NOC A;  1G4C A;  4HTJ A;  2XCP A;  1H72 C;  2PII A;  2UUW A;  3JSB A;  4ZP8 A;  4X62 F;  1F60 B;  2YWK A;  2K1R B;  4RW8 A;  3K2Y A;  2I2Y A;  5GAE I;  4JV0 A;  3LGN A;  2DHS A;  4DV7 F;  3M8Z A;  1R8P A;  4OHY A;  1JLQ A;  3BR8 A;  1VQ8 S;  2BJ3 A;  5IM0 B;  2J8S A;  3GYN A;  4LQ3 A;  2CPD A;  4DFM A;  4K0K F;  5L46 A;  1KP6 A;  3M1V B;  4DWI A;  4DV6 J;  2NR0 A;  2LQB A;  2GIQ A;  2Z57 B;  2VFV A;  4WXW A;  4ES3 A;  2HS0 A;  1VR6 A;  4QIF A;  3VGS A;  3GJR B;  1I51 B;  2KHC A;  3KMS A;  2FVR A;  1YZ7 A;  1DTT A;  3ONQ A;  3CJR A;  2UXC F;  2WRM A;  2E1R A;  1O5J A;  2Y0S D;  4LBP A;  1ZM4 A;  3W2V B;  1X5P A;  4DL3 A;  4DQQ A;  1B99 A;  1VFJ A;  4QIG A;  5F0W A;  4FXD A;  5F9N A;  2W25 A;  2C42 A;  1F9H A;  2GVD A;  3HVT B;  2UVW A;  3C6T A;  2HND B;  1XMO F;  2P2C B;  2AJ2 A;  1X0P A;  3PR4 A;  4FYX B;  4CM0 A;  4ZJO A;  3KHR A;  1KLM A;  3TZZ A;  2EG1 A;  4OZ1 A;  4F25 A;  3MMB A;  1O8B A;  4GKJ F;  2NXU A;  5GMK a;  1URR A;  3W8G A;  4KTQ A;  3D3B J;  3AOD A;  3DKD A;  3OFH A;  2AKW B;  1NND A;  4IFV A;  1D9A A;  1DUR A;  1XNQ F;  2ZD1 B;  1RAF B;  1YLX A;  1JK9 B;  2HGL A;  3PV8 A;  3MUV P;  4NCG A;  2ZM6 F;  1A7G E;  1MU2 A;  2QYG A;  1JXL A;  4OYM A;  2YY3 A;  2D74 B;  2KZZ A;  3QT6 A;  1MN7 A;  4LUB A;  4RZR A;  3MMJ A;  2Y1L B;  4MK8 A;  2B4V A;  4OLP A;  3EMT A;  3M2U B;  3ZZP A;  3OR1 B;  4ED8 A;  3A8J A;  4ZDN A;  2E1C A;  4N5S A;  1F2H A;  2J76 E;  3PXG a;  2VFT A;  2ADC A;  3H5S A;  3GP9 A;  3GR0 A;  1IBK F;  4IOA Q;  3G8Q A;  1JLQ B;  2WHO A;  4B9T A;  5E7O B;  4DR1 F;  2ZFH A;  2LP4 A;  3W8P A;  3CJ8 A;  1FRI A;  1NJX A;  3WBZ A;  3K5M A;  5J2Q A;  3F0N A;  3Q86 A;  4TKT A;  2J7W A;  3PNI A;  4LF4 J;  4RU9 A;  4KE5 A;  1NPK A;  2APO A;  1HI1 A;  4H4K C;  3PEJ A;  4IQX A;  3MUT P;  2IPO B;  2GVD B;  1IJE B;  4M5D A;  2GGP A;  5DQG A;  2VL1 A;  2KJV A;  2FZC B;  1G7C B;  1MWY A;  3SCI E;  3DLB A;  4NLQ A;  3DRR B;  4NEY A;  3BGO P;  2GX8 A;  1KFS A;  2AJ4 A;  4WKR A;  4FF3 A;  3HD2 A;  5JVH Q;  1QY7 A;  3W3S A;  3IM8 A;  1RE1 B;  3FEZ A;  3NLC A;  4NLT A;  2MKI A;  2FGC A;  3R7S B;  1NHU A;  4XPC A;  2PT0 A;  1SJ1 A;  2YWW A;  1TAU A;  3VAL A;  3DYA A;  5B0B A;  4WWS A;  2O01 C;  4QPX A;  4QWE A;  1T02 A;  4HHJ A;  1RTZ A;  1RAB B;  1YHQ S;  4NCG B;  1MU2 B;  2F8H A;  3M8R A;  2GMH A;  2OMO A;  2VBZ A;  2FY1 A;  2Q3P A;  1YDL A;  4I64 A;  1HQU A;  1M5K C;  1SJQ A;  4CT9 A;  4ZPA A;  4NA3 A;  4NLX A;  4X65 F;  4F04 B;  5IT4 A;  2BXJ A;  4KBI A;  4WYW A;  4U67 Q;  3QRR A;  4A8M P;  1ROF A;  1RGV A;  3QMQ A;  4XAK A;  1PKU A;  2GFF A;  3KUE A;  2YBV A;  1NJW A;  3ICL A;  2KI2 A;  2FTR A;  5D0R A;  2IA0 A;  3T5L A;  2JFD A;  3DGP A;  2X1G A;  2HS3 A;  4MIW A;  3EZ5 A;  3H2U B;  4V19 X;  3HK2 A;  1DQ8 A;  4B02 A;  4UZB A;  1UJ6 A;  3AXM A;  2ZVI A;  4BDP A;  3HHE A;  1O51 A;  4ED7 A;  2MGZ A;  2V2Z A;  3CE8 A;  3ENV A;  4GO5 X;  3TUJ C;  5E5N A;  5EWE A;  2FJV A;  2KXH A;  2UUC J;  1VC0 A;  3K5P A;  1HWU A;  3U7J A;  1AZS A;  5J2Q B;  1SUQ A;  3FRY A;  2J8A A;  2XS5 A;  4DR6 J;  1CJK A;  3UO0 A;  1PBA A;  2XS2 A;  3UD5 A;  1QSL A;  3I82 A;  1D9F A;  1S6U A;  4P2F A;  2E44 A;  2O67 A;  2BX6 A;  3K5O A;  1FWP A;  1HNV B;  2V69 A;  1OSC A;  1WKK A;  2KFY A;  2W7P A;  3PW5 A;  2YPY A;  2K06 A;  4M5D B;  4K0K J;  2GGP B;  3G82 A;  1N54 B;  4TQS A;  1VLY A;  4IRK A;  1I6J A;  3H4D A;  3AHP A;  4QIW D;  1X4G A;  4RUB A;  4LF7 J;  3GON A;  4ZVE A;  1IXK A;  2BBE A;  3DOK A;  1F0X A;  4WFB Q;  2C2E A;  3RB6 A;  2KT2 A;  2BQU A;  5D4P A;  3DYA B;  4P7V A;  4JI4 F;  1Y5L B;  1NKB A;  4ZP7 A;  3RW7 A;  1XMO J;  2XYG B;  3JTP A;  5F8H A;  3QAU A;  3GQC A;  1KOO A;  3U1N A;  2B51 A;  5HQ8 A;  1DJ0 A;  3RGI A;  2WSF C;  1WD6 A;  4BCA A;  3C15 A;  4WIQ A;  3N28 A;  3NCR A;  1VLO A;  2YNG A;  4CLL A;  1KTV A;  1S12 A;  5IT9 Y;  3CSK A;  3NKY A;  3POT A;  4ID5 A;  1UA1 A;  2MKC A;  1KQG B;  1CSJ A;  4ZPW R;  1MW7 A;  2ZKT A;  1PC5 A;  4H54 A;  4MKV A;  3F56 A;  3DGP B;  3VAI A;  3N01 A;  4EEY A;  1R8H A;  1QTM A;  3IWL A;  2DGX A;  2I9S A;  3U27 A;  3DLG A;  2QRR A;  4WZM A;  1VQN S;  4NZ6 A;  3BB5 A;  2MGZ B;  1MWZ A;  2VU5 A;  4A47 A;  3GPA A;  1KLN A;  2BV3 A;  3IGN A;  4LRC A;  3NRB A;  1AZS B;  2LXF A;  1SUQ B;  3CED A;  2FHM A;  1CJK B;  1CC8 A;  4F4W A;  2NUH A;  2W7O A;  4JI6 J;  5CD4 A;  2DXD A;  2RH3 A;  4K4X A;  3E51 A;  3P6Y C;  1WNE A;  2B4P A;  4OHW A;  4LRA A;  1X60 A;  4DS4 A;  4H4O A;  4QYZ J;  3FZ2 A;  3TZW A;  4X64 F;  3G82 B;  2G4B A;  3MMC A;  1YKW A;  5GAE U;  2QE5 A;  2MHE A;  4EMD A;  3Q2T C;  3TVZ A;  2ZH4 A;  3KNG A;  3PW2 A;  1EKR A;  4RLE A;  1JXV A;  3OR2 B;  3PDN A;  1SH0 A;  3VZI A;  2MZ1 A;  2RML A;  5E0O A;  3VVU A;  2CVI A;  1N88 A;  4CLF A;  3DOK B;  2B56 A;  3K5L A;  1K47 A;  1FKO A;  2FLO A;  1NDP A;  3VAJ A;  3PYG A;  2CQ2 A;  3KJQ B;  3G71 S;  3LAL A;  1DAR A;  2V6A A;  2VV5 A;  1SL2 A;  3ZTO A;  4MJK A;  1NDK A;  2YQ1 A;  4HLB A;  3K7R A;  1GX6 A;  4AFF A;  4L3K A;  1Q4R A;  2E5I A;  1JLE A;  3C15 B;  3QJL A;  3ITH B;  1NZA A;  4RWW A;  3KTQ A;  2YNG B;  5K8M A;  1N34 F;  1L3S A;  3HFV A;  3I9V 9;  3POT B;  4ID5 B;  4CZC A;  4I2Q A;  3G6Y A;  2F4V J;  4PXB A;  4OV1 A;  2I6W A;  4ZN1 A;  4IR9 A;  2ALZ A;  3D0H E;  5K5M A;  5I3Q A;  4DQR A;  2ATL A;  4NLY A;  1K44 A;  5HK4 A;  3D1H A;  1AFJ A;  4ED0 A;  4P52 A;  3HXM A;  2IBK A;  1VIS A;  1K1Q A;  1U6Z A;  4TN2 A;  2BUN A;  1SJ3 P;  3SXL A;  2YH0 A;  3DLG B;  1W2B R;  2OSQ A;  2AQ4 A;  2B43 A;  3MGJ A;  3PIO Q;  4FVC A;  4PXC A;  3T6B A;  3BSA A;  3EZO A;  4Q0B B;  4HYK A;  3KFW X;  4C9D A;  2QMX A;  1PAU B;  2QYC A;  1KQF B;  3AB4 B;  4YDD B;  4B9N A;  1LW0 A;  5C24 A;  3SCJ E;  1RTH B;  5KAK A;  3T41 A;  5F8M A;  3KHL A;  1HNW J;  1L3K A;  2MQ8 A;  2HQD A;  1WC0 A;  2GHV C;  2R8G A;  3D7S B;  1M5V C;  1KHW A;  2FJB B;  1X0F A;  4B9M A;  5IFM A;  5EUH A;  1L3T A;  1H74 A;  3WX8 A;  4ES1 A;  3V6J A;  5F3Z A;  2BYC A;  4KYZ A;  1ZM9 A;  5DET A;  2YKQ A;  2ZBQ A;  3TVY A;  2WK4 A;  3VF0 B;  2PMZ D;  4ECZ A;  2M70 A;  1VRT B;  2VKR A;  1IWA A;  2CQG A;  1FKO B;  2J7U A;  3R3T A;  1K8A T;  4DU7 A;  5IV3 A;  4FDF A;  4LFA F;  3RB0 A;  1N8R T;  4P10 A;  1WHY A;  4LF6 F;  3G86 A;  3BGU A;  5KFM A;  1MMN A;  2FHK A;  1MMD A;  4CTA A;  5BYQ A;  2XZT B;  2HQF A;  4DI6 A;  3NL0 A;  1MNE A;  1UVJ A;  2DXF A;  3IC1 A;  5HMY A;  2ZUG A;  4OJH A;  1KDN A;  1S7I A;  2MLY A;  2GVZ B;  1Q95 G;  1JLE B;  2AJF E;  2XC9 A;  2WSC C;  5LMN J;  1WF1 A;  3CNQ P;  3NBP A;  4J5O A;  3H4B A;  5DLG A;  3W64 A;  4Q8F A;  2A18 A;  3GFZ A;  4JI4 J;  1OIA A;  4I2Q B;  1YWX A;  2WSE C;  4QR2 A;  1ZTT A;  1QUP A;  2DGT A;  1GH8 A;  4G6V B;  2CPZ A;  3MAA B;  3TZY A;  3LA0 A;  5ETL A;  3MD1 A;  3VAM A;  1UCN A;  2QL7 B;  4PKD B;  4RUC A;  4OYW A;  3EX7 B;  3CC7 S;  4KRW A;  2UUT A;  1VK8 A;  2B8Q A;  1IKX A;  3CC4 S;  2IYI A;  4AD6 A;  1KQS R;  1HKA A;  3C3L A;  3QGH A;  1S1V A;  2XWY A;  2RQC A;  1IUJ A;  2LQ8 A;  3OV7 A;  4PXD A;  2GCF A;  4LRB A;  4KPC A;  4ER8 A;  1U8W A;  3TZX A;  4BHQ A;  3MAQ A;  2ACM A;  4C2M A;  1OO0 B;  2GJF A;  1FKP A;  2FVQ A;  3T9N A;  2MXY A;  4U96 A;  4RW9 B;  1NHK L;  1W2I A;  4DUT A;  1Q53 A;  3MFH A;  4TXS A;  2H51 B;  2HRU A;  3KHH A;  3R5A A;  3CPW R;  1U0H A;  3M9M B;  3MR7 A;  4J9Q A;  1U6F A;  4RNM A;  1U45 A;  1W7W A;  5LXY A;  2GIF A;  1SH3 A;  1Z1Z A;  4RUH A;  5CA5 A;  2H9Z A;  1YRU A;  3FC9 A;  2HAI A;  3G4S S;  3TAP A;  4ZCL A;  4K2X A;  1BD6 A;  5ETQ A;  4PAB A;  2FPH X;  1JX4 A;  3N6N A;  2ZZN A;  2QL9 B;  5F8J A;  4EK2 A;  2DCU B;  3DMJ A;  1GMW D;  1HFE L;  4U7U K;  5LJ3 Y;  1UWB A;  4DN0 A;  5D77 A;  4HTI A;  2YNF A;  4V19 J;  1XEZ A;  5GAG U;  4WBF A;  4CTA B;  1CJT A;  1D8Y A;  2CA9 A;  3MCM A;  3JQJ A;  3IP0 A;  1GXL A;  2G0I A;  3QLH A;  2FUG 9;  1J5E F;  3IRW P;  2F63 A;  3ILL A;  2ZZT A;  2XNQ A;  4KIA A;  3NP5 A;  4OJ1 A;  1WSR A;  4ITS A;  3NBP B;  1T05 A;  1MRO A;  3GE9 A;  2LQ9 A;  1H0H B;  2CPF A;  4I56 A;  2CPH A;  1S48 A;  4M5N A;  1HI0 P;  2KG1 A;  3HSD A;  4JV1 A;  3CDB A;  3MED A;  4H4M A;  2CG4 A;  4X4T A;  2CJX B;  2NZ4 A;  3EWG A;  4JB8 B;  2BE7 D;  5HJY A;  3J7Y I;  3KLH A;  5DQH A;  2ZE2 A;  4PRF A;  2HEK A;  1N32 J;  2NZC A;  5KFN A;  2Q6B A;  5A6P A;  2RHS B;  4F67 A;  2W9C A;  2XZD B;  4NI2 A;  2F9J A;  1FO1 A;  3G6E S;  4R25 A;  1IKX B;  4MMO A;  4EYH B;  1RTJ A;  2Z2Z A;  3IN5 A;  1S1V B;  5CQG A;  2BRL A;  1S59 A;  2CQH A;  4L72 B;  3NS5 A;  2HGM A;  3S6E A;  5HMX A;  1NSA A;  1G1X A;  2D3U A;  1S72 S;  2VBW A;  4OHZ A;  2L9W A;  5CZX A;  1VYA A;  2K8G A;  2OFH X;  2ZHO A;  3W61 A;  1YJN S;  3DFE A;  4DL0 C;  3SZ2 A;  2M7S A;  4U8V A;  5KFI A;  1VQL S;  5AE1 A;  1NJY A;  1N56 A;  4IG3 B;  4HKQ A;  4OX9 F;  1B7Y B;  5KFV A;  4WP3 A;  1XER A;  3RRH A;  1KTQ A;  3VGT A;  2IHR 1;  5G0R A;  1WC5 A;  2NLW A;  1NDL A;  4P7T A;  4CIO A;  2WON A;  1QJH A;  2ZH6 A;  1FA0 A;  3V2U C;  2XLK A;  4JYA F;  4CNZ A;  2XBP A;  3DMJ B;  5KFP A;  1UWB B;  3BGF A;  1RB0 A;  4Q2M A;  2AEJ A;  2YNF B;  2VOD A;  4O4G A;  3VHQ A;  5KFH A;  2M8H A;  3QLH B;  2OO4 A;  2RAQ A;  4P71 A;  5L9N A;  3TOQ A;  4QWA A;  4OZ0 A;  4N8O A;  8RUC A;  5HQM A;  4L74 A;  3BGR A;  1YSJ A;  4NXN F;  3FSI A;  4P6Q A;  4FYD A;  4ZLL A;  1T05 B;  1MRO B;  1JJC B;  3GFX A;  4K4Z A;  4PAA A;  1N52 B;  1Y7P A;  5IWA F;  2DJW A;  4ECU A;  4OYO A;  4KB7 A;  3W7B A;  2B9W A;  2V4Q A;  3MED B;  4H4M B;  5AJ3 J;  4QCL A;  4X4N A;  3OFG A;  3V6K A;  4GO7 X;  1CVJ A;  2ZE2 B;  3Q24 A;  5ETM A;  3H40 A;  1G2E A;  2BOA A;  4UF4 A;  1E6V B;  1N0U A;  4R0E A;  2ATC B;  1EAR A;  3WC2 A;  4DCP B;  3JAM U;  2W9C B;  2BJD A;  3D1Q A;  4B3M F;  1IKV A;  3ENW A;  3CCT A;  2HMI A;  1XIQ A;  1YBA A;  4Y00 A;  1WF2 A;  2VUG A;  1X8D A;  2OD4 A;  1WOR A;  3KLE B;  1YJU A;  1Q82 T;  1VS3 A;  2UXD F;  2JVR A;  1NHV A;  1V9O A;  1RWP B;  4F4X A;  3LAK A;  1WEX A;  2FHO B;  4EO8 A;  2RUG A;  3DU5 A;  1BLU A;  1R0C B;  2MZT A;  2R7X A;  4ZVH A;  4ZVG A;  2VA2 A;  3H20 A;  2V50 A;  3GG0 A;  1EAY C;  2MKH A;  2M5Y A;  2AYE A;  4RBT A;  4NML A;  2QTW A;  2IYG A;  3KNA A;  7FDR A;  2R7S A;  1UA0 A;  3OBI A;  1FX2 A;  2W2O P;  4M94 A;  5EGY A;  4N47 A;  6AT1 B;  2JLG A;  2WON B;  1FRX A;  5B0D A;  5F9L A;  3D2W A;  4Q44 A;  5T7L A;  5M2U A;  4DV3 F;  4RPF A;  1TL7 B;  1VQ4 S;  1FD8 A;  3ETM A;  4KGV B;  4KQZ A;  4OIX A;  1U1M A;  3VV2 B;  3UDV A;  5IZH A;  3TW0 A;  2QLJ B;  3D4J A;  2XLI A;  3ZZR A;  4K59 A;  4I4B A;  2JRS A;  3BV8 A;  3NGS A;  4C11 B;  3I56 S;  3BGR B;  5HBM A;  3I0R A;  2UV8 G;  2XMT A;  5AXN A;  2F65 A;  2F8E X;  4KPY A;  4M1K A;  4LSL A;  1R6V A;  2G0C A;  1J5O A;  1T8E A;  4AE5 A;  4FBT A;  3DRY A;  3CJK A;  1F2G A;  2KXN B;  1S1U A;  2YKA A;  4ZPT R;  3NMA A;  4Y28 C;  1U09 A;  2UV8 A;  2VPW B;  4ATN A;  2GO9 A;  1D8Z A;  4AYB D;  4P75 A;  4LF8 F;  2G13 A;  4I6Y A;  4X4R A;  4LR9 A;  5FD1 A;  6FDR A;  1NBE B;  1IKV B;  1IJF B;  1N5Y B;  1S0O A;  4IRC A;  4QIE A;  2HMI B;  2A2D A;  1PG5 B;  3R1H A;  2GV1 A;  3TX0 A;  3ZTR A;  3P45 B;  2CQ0 A;  1WHX A;  3NCP A;  3FSX A;  2EBE A;  1QVG R;  2HQ3 A;  2BDP A;  3CWJ A;  3PKM A;  2CPX A;  1U8S A;  4Q5V A;  2C3M A;  4U9R A;  4A8K A;  5DG9 A;  1NUE A;  4CO4 A;  3V81 A;  4C6A A;  5D0H A;  4J7C A;  2HYI B;  3JSY A;  1R27 B;  3BQ2 A;  4C0H A;  4RBV A;  1CC7 A;  3SSS A;  5JVG Q;  1M5S A;  3R9L A;  5L38 A;  4OJG A;  1TQL A;  4C8L A;  4KR0 B;  4O23 A;  4WP8 A;  4CO0 A;  3NGU A;  1V3Z A;  2CQD A;  4BLG A;  2CZV C;  2D9O A;  4J9R A;  3TAR A;  5AXK A;  3HLU A;  2XM3 A;  5I42 A;  3IBF B;  4FKX A;  4TYB A;  5T7L B;  3LP2 A;  2HZC A;  1NSP A;  1B0V A;  3M2V A;  5CYM A;  4KHM A;  2B4O A;  3FQL A;  1TL3 A;  4EZ9 A;  4ZIV A;  1B4S A;  3MM8 B;  1E6Y A;  3FSY A;  4DL7 A;  4OX9 J;  4USI A;  2FLP A;  1RI7 A;  2GQQ A;  4G1Q A;  4RW7 B;  1JQG A;  3VTI A;  5HBM B;  1Z2Z A;  3I0R B;  1Z2L A;  1FVQ A;  2ZBI A;  4LSL B;  2BEF A;  1J5O B;  2DGW A;  3D54 A;  5L8R C;  2KH9 A;  2W4C A;  3CJK B;  1Y5N B;  4I69 A;  4D3G A;  1S1U B;  2OJ3 A;  5LL6 d;  4OZL A;  4GVB A;  2UUA J;  4ZPB A;  4K8R A;  4DX6 A;  1TK0 A;  4MIB A;  3TRG A;  1HWJ A;  4J9S A;  1DTQ B;  4C97 A;  4YHH J;  2ZBP A;  3GLJ A;  2BZ2 A;  4UOG A;  3JYT A;  1M90 T;  3OXG A;  5T14 A;  4JI5 F;  1RT6 A;  3L7O A;  4WFY A;  3OTD A;  1NK5 A;  4KO0 B;  1GMW A;  4NXN J;  1RKJ A;  2RVJ A;  3LP0 A;  4USW A;  2YKO A;  2KJW A;  1MML A;  5HJX A;  4ECS A;  5IWA J;  1SC1 B;  4ETZ A;  4WFA Q;  3GZ7 A;  3MM6 A;  3AQP A;  4EUV A;  4CP5 A;  4JI3 J;  2QGF B;  2KXF A;  2NS1 B;  3OL8 A;  1S79 A;  2YX4 A;  2YX7 A;  2IRY A;  4OX6 A;  3J7Y U;  4I0W A;  3V81 B;  3S7R A;  2EEY A;  3QWP A;  4LF2 A;  5CYJ A;  1HWL A;  5HP1 A;  2RDJ A;  2FVS A;  2HBY B;  2HFS A;  3PKY A;  3CT9 A;  4ETX A;  2EPI A;  2EWH A;  3LGH A;  4LQ9 A;  5KG5 A;  3SFU A;  2N7C A;  5KFL A;  2IFX A;  4ZVO B;  2UXD J;  4X2B A;  1EKS A;  3BSO A;  5I42 B;  4J9N A;  2YWG A;  1RAD B;  4I1T A;  4L76 A;  2HW3 A;  3LP2 B;  1RP5 A;  2YKP A;  1YGY A;  4HT5 A;  3M2V B;  4RL1 A;  5CYM B;  3R6L B;  4MK7 A;  4OI6 A;  1CJU A;  3CJT A;  3PG9 A;  1TL3 B;  3IWX A;  2GA7 A;  4ZK7 M;  3J80 U;  4GRS A;  1E6Y B;  2L3M A;  4TU9 A;  1IM6 A;  2GAH C;  1TKD A;  5CHC B;  4G1Q B;  1UMJ A;  4FYV B;  2VC1 A;  2VBX A;  2QSW A;  1RT7 A;  2OSR A;  2AGP A;  3K8V A;  1WI8 A;  2HWI A;  3Q2S C;  4LFB F;  1UL3 A;  3FEX B;  3VGV A;  1HNI A;  2EFV A;  2MQO A;  2P9C A;  3UI3 A;  3VAH A;  3GIJ A;  2LKZ A;  4DV3 J;  4C8Y A;  2GZO A;  4DV1 J;  3KLG A;  2H3E B;  4NXM F;  2ZVS A;  4B3T J;  1C0T A;  1HWI A;  2HHH J;  3BH6 B;  2MPU A;  3OTB A;  4GVB B;  3ZZZ A;  3R8Y A;  3OXF A;  3RAX A;  4U95 A;  3HT3 A;  1IR1 A;  1YX2 A;  4QWC A;  4UOH A;  1UVL A;  4DZD A;  1RT6 B;  4W90 B;  1ELO A;  4OFZ A;  2WW8 A;  1RA7 A;  1DLO A;  3LP0 B;  3IFE A;  4YR2 A;  1B64 A;  1X4D A;  3EDR B;  4KHP J;  2G2O A;  3E3X A;  3DCA A;  4RNF A;  2COL A;  4GMK A;  5EWF A;  3VAK A;  1B3T A;  1FNX H;  4N77 A;  2HVD A;  1H98 A;  5J2N A;  2DD8 S;  1SIZ A;  4JV2 A;  1N33 F;  4EFA C;  2RIL A;  2VG6 A;  1UVN A;  1IQZ A;  4C3M A;  3LH2 S;  1RT2 A;  4WU3 A;  2OI2 A;  2CZ9 A;  3FZB A;  4J37 A;  2ZBC A;  4AQY J;  5HP1 B;  1IBL F;  3Q8R B;  2OTJ S;  1ZAV A;  4X4V A;  1HHQ A;  1EP4 A;  3RR8 A;  4MTP A;  4DPY A;  1H2U X;  2FJX A;  3TO8 A;  2DCL A;  2PD1 A;  4FYW B;  1NJI T;  3I5A A;  2KYZ A;  2AZ1 A;  2HLU A;  3BSC A;  4PPD A;  3QBC A;  1HI8 A;  5LMU F;  1C2P A;  1V3S A;  4ED1 A;  1YQH A;  3P3D A;  4K7Q A;  2CQC A;  3UNY A;  5HAT A;  4DV0 J;  1RT5 A;  2KVI A;  4EZ6 A;  2VOP A;  2GAG C;  1CJU B;  1FJ7 A;  2AJQ A;  2E7X A;  1UEV A;  2WVF A;  2XWX A;  3W9J A;  5C2C A;  3JXO A;  2KL8 A;  2XMV A;  2BQ3 A;  3W9I A;  3EE3 A;  1VBZ A;  2MKS A;  2W2Q P;  4URQ U;  3PW0 A;  3SIP B;  1ZPW X;  1APS A;  1RT7 B;  4BWJ A;  2C2N A;  2BKO A;  2GMJ A;  4DR5 J;  1TK5 A;  1P1T A;  2CXE A;  5F8N A;  2XLJ A;  3KK3 A;  2R7V A;  3QGP A;  4GC7 A;  1OQ6 A;  1LK5 A;  4OV6 A;  2VQE F;  1Y3K A;  1C0T B;  3T1A A;  4W92 B;  2E9T A;  4O3S A;  1FI4 A;  4DR7 F;  2KT5 A;  2DNO A;  1HR0 F;  4GKK J;  1ZAX A;  3DC2 A;  1S10 A;  1JLC A;  1UZH A;  2ZOM A;  4PZV A;  3OVS A;  2A3J A;  1XTZ A;  4QOT A;  1CJV A;  2BQR A;  1UVK A;  2BE9 B;  3J81 Y;  4J9M A;  1DLO B;  2JSX A;  2BE2 A;  2KFZ A;  4PWW A;  2FDN A;  3UCU P;  1TUG B;  3PRB A;  1N5S A;  4PG6 A;  1N36 F;  2VB6 A;  4RR5 A;  3CCV S;  4A8O A;  3M6W A;  2E66 A;  2R2R A;  3PVX A;  1WUU A;  2PEH A;  3RW6 A;  4ZVU B;  5J2N B;  5IOL A;  3L4B C;  5BXI A;  2VG6 B;  3CMQ A;  1SBR A;  3BKT A;  4KH1 B;  1FTR A;  3KG0 A;  3HKW A;  2E9Z A;  1WDD A;  4IH7 A;  4B9V A;  3Q23 A;  3D1O A;  1F5A A;  2CIM A;  1I94 F;  3BF4 A;  3GCX P;  3RBE A;  4OYX A;  1FDB A;  3AOC A;  5A76 A;  1VBY A;  4U8Y A;  3Q8P B;  2V68 A;  3T1H J;  2ZC3 A;  2H54 B;  3PW4 A;  4TU7 A;  2FLL A;  2HFO A;  8AT1 B;  4DV2 J;  2VON A;  5A0Y A;  1F1B B;  1RT5 B;  4YB7 A;  1WG4 A;  3F44 A;  5IS2 A;  4FF1 A;  3THV A;  4K5R A;  2BJE A;  2ZOF A;  3ZTP A;  3I55 S;  4FVM A;  1FWK A;  3BBC A;  5KG1 A;  3W66 A;  3M8Q A;  1DHM A;  1RHJ B;  4ZMM A;  3ZO7 A;  3QAT A;  2XB2 D;  2J6T A;  3KMQ A;  2XGP A;  2H65 B;  3U02 A;  3T3F A;  1WKJ A;  1JB0 C;  2L48 A;  1LKZ A;  4Y65 A;  1OY9 A;  4K4T A;  3CJ2 A;  3EUN A;  4USU A;  3M8W A;  4A8S A;  1FCA A;  4HI2 A;  1RU2 A;  2DRB A;  4HL9 A;  3RAQ A;  1S0N A;  3NGD A;  1BQX A;  1HQ2 A;  1GXT A;  2WB1 D;  2D3Z A;  2MB0 B;  1LK7 A;  1ZYQ A;  1JLA B;  1WTF A;  2M2B A;  1HHS A;  1QAJ A;  5KFQ A;  5C42 A;  2W4P A;  1JLC B;  2KKH A;  4NLW A;  5GAH I;  2JEJ A;  2MQL A;  4IO1 A;  1CJV B;  2IAJ A;  4BBY A;  1GEH A;  2VKZ G;  2BE2 B;  2CQ1 A;  2QN6 B;  2MHN A;  2AZ3 A;  4DV6 F;  3GSI A;  2PI4 A;  1X5O A;  3A3P B;  2YTC A;  2R7W A;  3CCM S;  1SC4 B;  1U1P A;  2F8M A;  3OPK A;  4NXM J;  2RT3 A;  5KFO A;  1NJZ A;  5F8G A;  2C2R A;  3UDC A;  5E3C A;  1JWW A;  3KYL A;  2MZJ A;  3ET6 A;  3IO1 A;  1Q7L B;  4Y2C A;  3C2P A;  4DPU A;  2DNK A;  2XNR A;  3O5T B;  2W9A A;  1WKL A;  3R5D A;  2I5J B;  5D3G A;  2BKN A;  4UY8 5;  3QYY A;  2BAB A;  2N3L A;  3EIC A;  2X3G A;  2DIU A;  3H5X A;  2OHD A;  3QSI A;  1U6B A;  4C4W A;  3UD3 P;  1NK9 A;  4JI0 J;  4CM2 A;  5B0C A;  2ZZM A;  1HMV A;  4DPW A;  5CCL A;  3R97 A;  4CLT A;  2LMI A;  3O3L A;  3BPS P;  2MY7 A;  1UP1 A;  3BRE A;  2BVZ A;  3AJD A;  2HHU A;  5A0Y B;  1WEL A;  4OYA A;  3DRS A;  4M5G A;  1SXL A;  3U1M A;  2IRU A;  2XMU A;  1IBL J;  2EI5 A;  1Y11 A;  2N4C A;  3M8Q B;  5EX0 A;  3SI8 A;  3BO4 A;  1KD1 T;  2KYX A;  4MFB A;  1FKA F;  2C3Y A;  1VIO A;  5GAD I;  5KG2 A;  1AYE A;  4QYZ K;  3DLK A;  3GFH A;  3OL6 A;  2OLW A;  1T11 A;  4RNN A;  2PEB A;  1FDN A;  2MEW A;  5D4N A;  2B8P A;  1D3W A;  4QIV A;  5DGA A;  3NWG A;  1OY6 A;  3E2E A;  4G65 A;  3PYD A;  5AE2 A;  4M5I A;  3W5Z A;  2V34 A;  2P9G A;  2J0X A;  2HRY A;  5H1S V;  1N5Q A;  4A8X A;  4YY3 J;  4J9V A;  1NME B;  3GJT B;  4DSL A;  4W98 A;  5C42 B;  3VR1 A;  3GCW P;  3TVK A;  3Q8Q B;  2Y1J A;  2OML A;  1HLW A;  2IAJ B;  2G0J A;  3MM7 A;  1H6K X;  2B6A A;  3MOJ B;  1HNZ J;  2KM8 B;  1VQM S;  3NCQ A;  1NM2 A;  1GAO A;  5J2M A;  2HK2 A;  2HHS A;  2F3J A;  1CG2 A;  2RS8 A;  3CJ5 A;  2RB7 A;  4NAS A;  2E5L J;  2RRB A;  3HF5 A;  3CMA S;  3ET6 B; 
#chains in the Genus database with same CATH homology
 4YHH J;  4X64 J;  2UXD J;  5IT9 U;  1I94 J;  4JYA J;  3J7A N;  2ZM6 J;  4DV0 J;  4DUZ J;  4LFC J;  4LFB J;  5AJ3 J;  4NEZ A;  4JI2 J;  2VQE J;  3W1Y C;  2UXB J;  4B3S J;  4KHP J;  3J81 U;  4NXN J;  1XMO J;  4DR7 J;  1HNX J;  2UXC J;  3IMQ J;  3D3B J;  5LMN J;  4X65 J;  4DUY J;  2UUC J;  4DR4 J;  2MEW A;  4JI6 J;  1HR0 J;  2KL8 A;  4KY3 A;  4RJV A;  3OTO J;  4HHU A;  5IWA J;  1XMQ J;  4DR6 J;  3R2D J;  1HNW J;  4JI4 J;  1XNR J;  4V1A k;  3J80 U;  2UUB J;  2MQ8 A;  1N32 J;  5BR8 J;  2UU9 J;  3JAM U;  4DR5 J;  4DV6 J;  4JI8 J;  4LFA J;  2KVQ E;  1J5E J;  4LF6 J;  4DV5 J;  4YY3 J;  5LMU J;  4LF4 J;  4JI3 J;  4JI1 J;  4JI0 J;  4B3R J;  3R2C J;  4DR3 J;  4OX9 J;  4DR2 J;  4LF5 J;  2F4V J;  4JV5 J;  5FLX U;  4AQY J;  4GKJ J;  4LF9 J;  4K0K J;  1N36 J;  4KYZ A;  4JI5 J;  3T1Y J;  1IBK J;  4DV3 J;  4JI7 J;  4X62 J;  4DV1 J;  1HNZ J;  4B3T J;  4GKK J;  2HHH J;  5LM7 E;  5A2Q U;  4DV7 J;  4DV4 J;  4LF8 J;  1FJG J;  3T1H J;  2MTL A;  4DR1 J;  1IBL J;  4LF7 J;  2VQF J;  4DV2 J;  1XNQ J;  4X66 J;  4NEY A;  2UUA J;  4B3M J;  2E5L J;  1N33 J;  3D3C J;  4PWW A;  1N34 J;  1IBM J;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...