1M5OC

Transition state stabilization by a catalytic rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords RNA SUBSTRATE
publication title Transition state stabilization by a catalytic RNA
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5oC00
2B0GA 1DRZA 1VQKS 1M5VC 1PO6A 1K73T 1PGZA 2DH8A 2XB2D 2JWNA 1WEXA 3P49B 3CCRS 1KQSR 2CPDA 2YH1A 3EGZA 2DIUA 1X5SA 3DXBA 4QU7A 2D9PA 2MQQA 1H2VZ 2YH0A 3IRWP 2E5JA 1WF1A 2LEAA 4WFNQ 2JRSA 4EGLA 2CQGA 1SJ4P 1BY9A 2MGZA 3THTA 2CQHA 3CPWR 2F9DA 2X1AA 2LMIA 1U1NA 3MD3A 2HZCA 2MKSA 4J5OA 2FHOB 3HI9A 4P6QA 1YJ9S 4TU8A 2CQDA 1VQ9S 3CCSS 2UP1A 2CQ1A 3S6EA 2KG1A 2MHNA 2M2BA 1UFWA 3R27A 3CCES 3HHNB 2KRBA 1IQTA 4WFAQ 2LQ5A 4ZKAA 1U1MA 2D9OA 2EVZA 2AD9A 2CQPA 1AUDA 3OW2R 1VQ5S 4WKRA 1P27B 1FO1A 2JVOA 2X1BA 3V4MA 2LECA 2KXFA 2LEBA 1OWXA 4CIOA 2M52A 3NNCA 2CPEA 1Q81T 3CD6S 2DNMA 1VC0A 3L3CA 3B4MA 3H2UB 1Q7YT 2CQBA 3LQVA 4LMZA 1U6BA 5LJ5Y 2XSFA 1DHMA 2DGWA 2MZJA 2J0QD 4FXWA 2MZTA 5GAHU 1U1RA 2I2YA 3G6ES 4TU9A 2EK6A 2BOPA 4CQ1A 3FEXB 1X5PA 4ED5A 5JVGQ 3MXHP 1Q82T 2KM8B 1JMTA 2M4MA 2DGOA 2DO0A 2OSRA 1W2BR 1YHQS 1X4EA 1VBZA 2RU3A 4W90B 5ITHA 3CC4S 4W92B 3RW7A 1SXLA 3G8SA 1X4DA 2FPHX 1S79A 1WG5A 1VQ7S 2DNQA 1WG4A 2M70A 1HD1A 1S72S 3CCVS 2MXYA 5BJRA 2AYEA 2MSTA 1X4BA 3MDFA 5DM6Q 2KH9A 3K0JA 1X4AA 2MKHA 2G0CA 1FT8A 4Y00A 1WI6A 1U1KA 2CPZA 2E5IA 3G4SS 1P1TA 2MMYA 2DNGA 2LYVA 3CMES 4UQTA 1VQ6S 1WWHA 3R1HA 1ZZFA 2RS8A 4WFBQ 1H6KX 3PIPQ 4PRFA 1YWXA 2CQ3A 3JB9k 5DM7Q 1G2EA 2LXIA 3NS5A 1RK8A 2G4BA 1H2UX 5LSOA 1A9NB 5GAGU 1YJWS 3VAHA 3DLLQ 2DGQA 1VQOS 5HL7Q 2QEXS 3P5TL 4BS2A 1UAWA 1FNXH 2L9WA 2NLWA 1X4HA 2VODA 3G9CA 4F02A 2KN4A 3UD3P 2KG0A 3NNAA 1D9AA 2DO4A 2FC9A 1U1QA 5D77A 3FEYB 2A3JA 3MURP 2OTJS 1H2TZ 4CH1A 1WEZA 1D8ZA 4C4WA 1VQNS 3VALA 2KHCA 1M1KT 1N8RT 3G8TA 2AYMA 3THPA 1SJFA 3VAKA 2KRRA 1YIJS 1JJ4A 3VAGA 2HYIB 2MJNA 3U1LA 2N3LA 2OSQA 2RRAA 4IOAQ 2CPYA 3US5A 2DNYA 2M8HA 2KVIA 3CUNA 2MSSA 4IO9Q 1NJIT 1FJEB 1QVFR 5DDOC 5H1SV 3CC7S 1WHWA 5D78A 1B7FA 3SMZA 2Q79A 1YJNS 2MQNA 2KXNB 3H2VE 4Y0FA 2EK1A 4PR6A 1VQ4S 1X4FA 5DDQC 2V94A 4V19X 3D2WA 2XNQA 2DHXA 2J8AA 2CQCA 2PE8A 4LIRA 3ULHA 5FJ4A 3BO3A 4A8XA 3MI7X 5IM0B 1F9FA 4QPTA 3J7YU 2ADCA 4C0OC 1FJ7A 2DGTA 3LPYA 2DNNA 4IOCQ 1YITS 4WF9Q 1VQMS 2YWKA 3CXCR 2E5GA 1FHTA 1VBXA 1WHYA 3S8SA 4Z2XA 3UCGA 2AYGA 3VAMA 2K3KA 3RW6A 2DNLA 4YB1P 2MZ1A 3BO2A 5EN1A 2JVRA 2HVZA 2DITA 2MZRA 1U2FA 2HGLA 4QQBA 5DDRC 1KD1T 1WHVA 2MY7A 2MGZB 2XNRA 5DDPC 1WF0A 2GO9A 2X1GA 1A7GE 5GVQA 2O3DA 1M90T 3P6YC 2SXLA 2HGMA 3Q2SC 2QFJA 4YUDA 4F26A 3J7ZT 2MKIA 2KYXA 1ZZNA 2ADBA 3CC2S 4IUFA 1JJHA 1X4GA 1WEYA 1OIAA 5CA5A 3MUMP 2RQ4A 3CCJS 3VAIA 4PKDB 2L08A 3NNHA 2DH9A 5CYJA 2MY8A 2DGVA 3TYTA 5LXYA 4QU6A 1M5OC 2FC8A 2J76E 2DNOA 2ZJPQ 1XN9A 2YTCA 1N88A 2CQIA 5LXRA 2QA4S 2E5HA 1UP1A 3MUTP 3PIOQ 1R8HA 3UE2A 4FXVA 2CQ2A 5MLCV 4WCEQ 3CCQS 4U67Q 2VOOA 2OJ3A 2F9JA 1VQLS 2RUGA 1L3KA 2DHGA 1NU4A 3G96A 2M0GB 2ZJRQ 2M88A 2KT5A 3EGNA 4UY8T 3UD4P 1WG1A 3MD1A 1DZ5A 2D3OR 1X5TA 1KOHA 1FJCA 1N54B 4TLQA 2L41A 5GADU 2CPIA 4WIIA 3SDEB 2JX2A 1JJ2R 2MPUA 3NMRA 1KOOA 5IM0A 2MQOA 1KC8T 1SJQA 2DHSA 2RS2A 5IFMA 3CMAS 5JVHQ 2DNPA 2VONA 2J0SD 2XS2A 2LA4A 2MZSA 3VAJA 1OO0B 2G1DA 1U6FA 2YKAA 2RQCA 2DGUA 2VOPA 3N9UC 1QM9A 1X5OA 2M7SA 3SXLA 4YOEA 1SJRA 1CVJA 1URNA 2CPXA 2DNKA 3BS9A 2LXUA 2BZ2A 2DNZA 2MQMA 4F25A 3U1MA 1YTYA 5GMKa 4M5DB 2MB0B 4CH0S 2MKCA 3EX7B 4OZ1A 3S7RA 2RVJA 2WBRA 2MQPA 4OZ0A 1WHXA 2PEHA 1OPIA 5DETA 3MUVP 5CXTA 1M5KC 2HGNA 2NZ4A 3I55S 2CQ0A 1WELA 1WI8A 1M5PC 2DGXA 2U2FA 3CF5Q 3CULA 4ERDA 3I56S 2KI2A 2MKKA 5LJ3Y 2RT3A 3VF0B 1NO8A 2CPJA 3NS6A 5GAEU 1SJ3P 2DH7A 2M8DB 1U1OA 2CPFA 2CQ4A 3BO4A 4TU7A 1FXLA 3G71S 3CCMS 2N3OA 1VC5A 1Q86T 3R1LA 2DB1A 2AYBA 1HL6A 2DIVA 3VAFA 2OTLS 2KM8C 2XS5A 1RKJA 2MJUA 2CPHA 3Q2TC 3P3DA 2LKZA 3UWTA 1K9MT 3UCUP 1N52B 3S01A 2XS7A 1X0FA 1O0PA 3ZZZA 1VBYA 3SDEA 2K8GA 3ZZYA 2CJKA 1ZH5A 1X4CA 3TP2A 1R8PA 3CTRA 2RNEA 1K8AT 2KXHA 3UCZP 2ZJQQ 2DNRA 2E44A 2F3JA 2I38A 1QVGR 1VQ8S 2KU7A 2GHPA 2MKJA 2DNHA 1YI2S 2LA6A 1DBDA 2MZQA 1U1LA 4RU2A 2DGSA 2M9KA 2DISA 2DHAA 1VC6A 2N82B 2RRBA 2N7CA 1HA1A 2U1AA 3MOJB 2KFYA 1VQPS 5HO4A 3CCUS 5LSLA 2MYFA 2LCWA 5IQQA 1WTBA 2DK2A 4LJMA 1WF2A 1U1PA 2FY1A 1HD0A 3IWNC 3CCLS 2X1FA 1UW4A 4C7QA 2OIHA 3B4DA 2ERRA 3TO8A 2MQLA 3BEGB
chains in the Genus database with same CATH superfamily
1XR6A 3GV7B 3GV8B 3RR7A 3D6FB 4A8WA 4OX8A 2BBEA 4HEA9 4KO0A 2CQGA 1BY9A 2ZBPA 5KFMA 2MLYA 4AQYF 3QGPA 2M2BA 2DT9A 3C15B 4DR4F 3TOQA 4C0HA 2NS1B 2B9WA 4B9SA 4WKRA 3MHYA 4TQSA 4LREA 4WFYA 4B3OA 3MCNA 1BQMA 1RZMA 2M52A 5KG1A 1R27B 3H2UB 3VQSA 4LMZA 3BGOP 1HR0F 5DGBA 3RB6A 2BOPA 2F4VJ 3H4BA 3HFKA 2IY5B 2YKMA 2CRLA 3CO0P 1UPMB 1WKKA 3ISNC 2RU3A 3NRBA 1SXLA 1VQ7S 3R7SB 2IMWP 4DL2A 5BJRA 3PRDA 2AYEA 4QWBA 2BQRA 4DFKA 3HSZA 2QO3A 1FT8A 4Y00A 4M95A 1KHWA 3T9ZA 2ALYB 1FJGF 2LYVA 3CMES 1HWJA 4YB7A 4PRFA 3RBEA 1ZM9A 5DM7Q 1WORA 2JNJA 3K17A 1RTJA 3I0SB 1TFYA 2IPOB 3QRQA 4NLWA 1S1TB 2KN4A 4LQ9A 4EYHB 3GCWP 4RBUA 1UJ4A 1SCJB 3PX0A 5JUMA 2HQ3A 3OQ2A 3OFGA 4OFZA 3MOZA 4WXOA 3OFEA 3OXGA 4CO2A 1IWAA 5L9NA 1KVJA 3HJFA 4CYUA 3C6UB 1S12A 2QYGA 1WC0A 1GX5A 1RBOB 2W7PA 3N01A 3QMQA 3TQ1A 3OPKA 4JI1F 4OV6A 1H3DA 1J5EF 3P96A 2IC3A 4AD6A 3DLKA 1VRTA 3P5BP 1U48A 3D9BA 1GTEA 2RMLA 2DEIA 2ZBRA 4KO0B 2JLGA 4B08A 2AZ3A 2IYGA 4FPRA 4CLUA 3UD5A 3H2LA 3CGIA 4YUDA 5A2QU 2F63A 4LFAF 5JJBA 2XG8A 2HEKA 2FC8A 1CQMA 3O8WA 2IJFA 4B3OB 1JKHB 4C11B 1GMWA 2HHSA 2DPIA 2GMLA 1R8HA 3BN4A 4QIVA 4MKAA 1B70B 1Q78A 3OL6A 3RGIA 3EGNA 3FC9A 1X8DA 1T11A 4NL5A 2C3PA 4DSEA 4UOHA 2YKMB 5IC6B 1HWIA 5AXNA 1OQ3A 5JVHQ 2MZSA 4UUXA 2DBBA 5FD1A 3CCZA 1X5OA 4KIAA 1NEEA 4J9KA 4EO8A 2DNZA 2MQMA 4QJVA 2EFVA 5B08A 2D69A 1H74A 3NEKA 1WHXA 4JI5J 2L9DA 1TK0A 4ILMA 1RTJB 1ZETA 3W1YC 2U2FA 2BACA 5B0CA 2JEJA 4RUCA 1S9EA 3CD0A 1HQEB 1SQEA 1TKXA 1SPBP 1JXLA 2YWHA 3BO4A 2Y1LB 1TMJA 1BWVA 4G1IA 5KFYA 3R1LA 5J2QB 1HL6A 4O4RA 4CYUB 3NWGA 1UWBB 3Q2TC 3SCKE 1O0PA 1LK7A 1RLDA 2ZJQQ 1RKIA 2FYXA 1RWUA 2IC3B 3SIPB 3DLKB 1VRTB 5I3UA 2X3DA 3PVXA 3AT1B 1IVZA 2WVDA 1U24A 2X1FA 5BYSA 4ECWA 4MT1A 1VGYA 3OR2A 3FSXA 3HSGA 3RJMB 1I94F 4URSA 1PO6A 2HS0A 2VIHA 5A8KA 4OI0A 3AJ1A 2DR7A 2VBYA 4ZN1A 1KP6A 4WYLA 4OX6A 2DIUA 3NMAA 3R5GA 2LEPA 3PW7A 4JBCA 3CJKB 1IKVA 4EMDA 2FZGB 5KFNA 3K5PA 4P6QA 2VU5A 4KJIA 4JI0J 3HHKA 2R8HA 1ZPVA 4WP9A 3R7BB 1QSSA 4DPOA 3BSOA 4QR1A 2EFOA 1F1BB 4D3HA 4DV0F 2E7WA 2P6SA 3MCSA 3OTDA 3B4MA 5SUHA 3FFIA 2JLFA 5J2PA 2YVSA 2BKPA 1OSDA 4OZ2A 1W2BR 5BYQA 4O44A 2ZWPA 1CPZA 4EO6A 1S72S 3CCVS 4IR9A 2B4PA 2F4VF 1GXTA 2XCPA 5ADZA 2G0CA 1N36J 3MFIA 1JNRB 1WWHA 1VQ6S 1S9EB 2DHHA 2J9CA 1UA1A 1Y4ZB 1TKXB 5ETRA 2KZMA 2G4BA 5U47A 1A9NB 5KFVA 5HI7A 1VQOS 1RAAB 1XNRJ 1J2VA 2ZC4A 2NLWA 4HT5A 1RTIA 2HWHA 1EKRA 4M1KA 3CIZA 2PI5A 3RRGA 1WDDA 5IOLA 4LSNA 4ZJLA 2AYMA 2HNYB 4Q45A 2HQDA 3FRYA 2YXLA 1RHKB 4FN5A 4XPCA 2AF6A 3DHXA 5KFJA 2BDPA 3QYYA 3D66A 2WONB 3CC7S 4OYMA 5I3UB 5FDLA 2WB1D 2LFVA 4ZOSA 2KXNB 2CIMA 2ILZA 2BUNA 2EK1A 1IN0A 2RKIA 2V94A 2UVWA 1TL3A 2CKWA 3BKFA 4LIRA 3OR2B 5JMNA 5E33A 2XYPB 1YG0A 4C0OC 5A8KB 3LPYA 3MCOA 2V4JB 2C2DA 3EPGA 3SQOP 3GJTB 1KQGB 3N6NA 5F8NA 2QLBB 4WTYA 3BKUA 1HHTP 5E3PA 5DDRC 1IKVB 3A12A 2XNRA 1B3TA 1FCAA 1WDTA 1NK7A 3LH2S 5GVQA 1S5ZA 5D3GA 1CS4A 4H4KC 3OTCA 2KYXA 2VG6A 2IM0A 1RAFB 4QU6A 1X60A 2ZDPA 5HLFA 4RBTA 3FCVA 1R31A 1CBKA 2YKOA 3NGTA 4I69A 1XERA 1Z1ZA 1FFWB 3D6MB 1VQLS 3I5AA 3N6LA 3GR0A 3I4HX 3AJDA 3FFIB 5J2PB 3GFXA 3WX8A 4WIIA 4IKAA 3NOCA 4NX9A 5I3QA 2JX2A 2W25A 3Q83A 3CMAS 2J0SD 2OI2A 4CLSA 3IAS9 4UOFA 2V8GA 3TUJC 1SC1B 1QDUB 2YQ1A 4F25A 4QIGA 4JYAJ 1WKLA 3MM9A 3O3LA 4RW9A 4PQUA 2RVJA 4A48A 3D1QA 3BH6B 1UVJA 2AW0A 1I3OB 2YNHB 4HR2A 1AA1B 1FX2A 4ZJOA 3ZTOA 1QUPA 1RTIB 3KLIA 1PILA 4LSNB 1SB6A 2IVFB 3AHPA 3EXYA 4JI5F 1WC3A 3VVTA 2H51B 2RB7A 1Q86T 1VDHA 1JLAB 3KUGA 3KK2A 2J6SA 1RT4A 1RI7A 4DZDA 5FDLB 3ZZZA 5KFXA 5CABA 2RKIB 4CCHA 1TL3B 2J8SA 4G1PA 1IBKJ 1LXJA 4CLTA 4B9NA 4KE5A 2DK2A 3VR1A 3SZ2A 2VQEJ 4ZLNA 1AROP 3K7RA 1IKYB 4KPYA 1DRZA 4P52A 1K73T 3HKZD 3JXOA 1FFGB 3TW0A 5D3GB 4DQSA 1CS4B 1FKAF 4ECTA 3HKWA 3B8HA 3A13A 4DR3J 1URRA 2CQHA 3HI9A 3LOUA 4NLYA 2E1PA 1K1SA 1N4LA 2IJNA 4GO5X 3LGHA 2HZAA 3R27A 1NHUA 3LP1A 1J27A 2XCAA 2CQPA 1OQ6A 1NJYA 4DPTA 3F0NA 4LF5J 1KR4A 4TXSA 2IM1A 5HP1A 1LW0A 4K4WA 1N33J 2DNMA 2HS4A 4HTIA 4CLLA 3NGDA 2E9RX 4MTPA 4U6PA 4ZMMA 3W61A 5K5MA 4OZNA 3ZZ0A 4QWDA 3AJ2A 3E8OA 3M8WA 3MM9B 3IG1A 1D9FA 4PQUB 4KTQA 4RW9B 5BR8J 1SI9A 4F2SA 1WG4A 2I5JA 2MXYA 1FRHA 4LRFA 1X4AA 1K44A 1IKWA 3MFHA 2H1YA 3G86A 3HVAA 1P1TA 4UQTA 2BV3A 2P9GA 3PTWA 1T9WA 3LGMA 3LP0A 3FNNA 1TUWA 4DUZF 4F4XA 1V5VA 5KFUA 3W64A 3M8ZA 3DOMA 3VCDA 4WE1A 4Q0BA 4X62F 3IP0A 4KBIA 2L9WA 4JOUA 2KJWA 4NCGA 3HF5A 3KK2B 2AQ4A 4ZLJA 3RR8A 1RT4B 2AJ0A 3M8PB 1Q8IA 3OVBA 2J7UA 1SL2A 4QZVB 4UTGA 3T6JA 1QAYA 3RBDA 1LWXA 2N3LA 1YJTA 3US5A 4YY3J 3BBFA 3CT9A 4ECYA 4NLUA 4C2MA 1FJEB 5DDOC 4N76A 5FLXY 2Q79A 2VG5A 4I6YA 1WOOA 4L3KA 1M5HA 3MM6A 2D7SA 3WIUA 2FJXA 2PE8A 2KB2A 3H40A 1AFIA 4J9OA 1NDPA 2ADCA 4G65A 5ETSA 1VQMS 2WTFA 1YGYA 4DFJA 4RNFA 5B0GA 4R8UA 3GZ7A 4WKYA 2R2TA 2OH2A 3QT6A 1MMLA 2GO9A 1HPZA 4B9TA 3OHAA 3GJRB 4LF9F 4KV8B 3NG8A 2BOAA 3M7VA 2RILA 2DRAA 4NMXA 5HN0A 3NNHA 2OD4A 3O1LA 1UP1A 1LW0B 4NXNJ 2LDYA 3DN9A 4LF6F 3EPIA 2O5DA 1EQ0A 2M0GB 2A1BA 3H5SA 3T41A 3UD4P 1AB8A 2C3OA 1KFSA 1ZTWA 2LQBA 3SSQA 3ITHB 1NK4A 3IG1B 4LFCF 1OO0B 3PO4A 5KFZA 3ZFVA 1IKWB 3EDQB 4M5MA 4Q8EA 3HMJG 1FE0A 3QWPA 4CLZA 4QW9A 4OZ0A 5AE3A 1UL3A 3DOMB 4F4YA 2Y0BB 3RAQA 4WE1B 4Q0BB 3G6YA 1VR6A 2CQ0A 2Y1RI 4Y2KA 4NCGB 1UW9A 1FRJA 1BLUA 4Y6IA 4HYKA 2BVZA 2QV6A 3D7SB 3H25A 5J1NA 3GFHA 2P6TA 1S7IA 5C2CA 2D3O1 4ICLA 5IQ6A 5J2MA 4L72B 1U0SA 2KM8C 4PG6A 2LKZA 3KDNA 5K8MA 2UVUA 3S01A 2PFFB 1H73A 1UEVA 2VG5B 3D54A 1X4CA 2V2QA 3D5MA 3MM6B 2RDJA 4HKQA 4P74A 3DRPA 4DU8A 1JIHA 5DZ6A 1RDRA 4HDGA 4USKA 2RRBA 5K8NA 3MOJB 2K06A 5DG7A 3MEEB 2WHOA 1HMVA 5HMWA 2HIQA 3GLJA 5HATA 4OMFG 3PV8A 3SQGB 1WF2A 1U1PA 3IMQJ 2YKNA 3CCLS 4DSJA 5ETLA 5KG7A 4R8UB 1EJ7L 3KHRA 3V6KA 1EETA 1ITPA 1HPZB 3DM2B 2YPZA 4OLOA 5CYMA 2CPDA 1UKUA 4KKOA 1ZM4A 2KFNA 3AY0A 2VQEF 2VASA 1S1VA 2QMWA 3GG1A 1NPRA 4TU8A 5I42A 3S6EA 9ATCB 2B9EA 1RP5A 3FSYA 3K57A 1TL5A 2HK2A 4DR7F 3UN2A 1P27B 4K8RA 4DR3F 2X1BA 1FWLA 2M3DA 2HFZA 4F3OA 3W5YA 5KFCA 3GMGA 2OPQA 3IS9A 3L7OA 4CH7A 2YWFA 1HFEL 1VC0A 4X4OA 2NYHA 1UETA 3EZ5A 2KT2A 4GMKA 3W2WB 5KFQA 2Z56B 2IIHA 2PA3A 1XIQA 4LF5F 1SKWA 5KFHA 2AP6A 4AL5A 4ED5A 1FEEA 2DGOA 1N33F 1LKZA 3KKFA 3ILJA 5HJXA 2GAGC 3NS7B 3X1LB 4DCOB 3DOKB 4FVMA 2GV1A 4WYWA 1UA0A 5DM6Q 3PRBA 2Z58B 4IFVA 3TA2A 2LQJA 2KJVA 1NK8A 3RAMA 4ANCA 1NK6A 4RR5A 2V9WA 2RS8A 3AFGA 2AU0A 3AAWB 1YWXA 2QLXA 2VH7A 2BJEA 1UJ5A 4DV3F 4YP3A 4DL7A 4LFBJ 4KHMA 4NLOA 3PZPA 1VIOA 3T3FA 2DO4A 2V6AA 3MPUB 2OTJS 1PG5B 3OR1B 3EVOA 4A8FA 1AW0A 2CZ9A 2KHCA 4K4SA 3G8TA 3IM8A 3G82A 3QRRA 1HNXF 4PWWA 3UN3A 4DSLA 2OSQA 3DRPB 2ZH6A 4A8QA 2ZEJA 1A0OB 4DHVA 2W9CA 3TAPA 1RCOB 1EAYC 1NJIT 3QGHA 3M05A 2OFGX 2V4RA 1UVLA 1Y0HA 1C0TA 3CJ4A 2XC9A 3K5OA 4LVOP 4F7VA 4PR6A 4DN9A 2YKNB 2BJ3A 4ECUA 3CJSA 4YY3F 3OHBA 3JYTA 3OL7A 2DNNA 1YITS 4WF9Q 5G0RB 1S10A 2QMXA 4AFFA 1NKBA 3D6TB 4KKOB 2GC8A 3UCGA 2K3KA 2I8EA 3D1OA 4ED6A 2JZ5A 1S1VB 1U2FA 4B9LA 1HQUA 4F0HA 1FNMA 3UN5A 3W62A 4ZPWR 4GC7A 3CC2S 2R7QA 1X9WA 2HZVA 1FD8A 2DH9A 1UFLA 2VZ9A 2CQIA 3M8QA 2OPQB 1ZA2B 3PIOQ 5L1JA 2CNOB 3TJ9A 2RRNA 1SH0A 1U8WA 1QD1A 1AFJA 3D28A 1RTZA 1YQHA 4ZCLA 1L3KA 3RZAA 1RA7A 2ZHBA 4PAAA 3K89A 4CZCA 3UI3A 1N32J 4F4WA 3SDEB 2MPUA 4K4TA 1QLNA 1DLOA 2RS2A 4N47A 1LQ9A 5A76A 5J2NA 3JAMY 1RWNB 1NAQA 4GKJJ 4IRDA 4KFBA 2CPXA 4H4OA 2DNKA 1E6YA 1YVFA 2YWEA 1LOUA 3TNVA 3QGGA 2ZC3A 2FQQB 5KOWA 2D3ZA 2VC1A 2XSJB 1E6VA 1VYAA 3KDOA 1IBLF 2V8PA 2ASDA 4K4ZA 3MR7A 3TJAA 1TFWA 3UQSA 3MPWA 3G82B 1XTZA 1IXKA 1DURA 5KG3A 1S6QB 2ZVIA 4KPCA 4I7FA 4OI4A 4F67A 2W9CB 3UWTA 3A3NB 1N52B 2EFPA 1C0TB 1NZ8A 1V3RA 4NWBA 2E44A 4QYRA 1VQ8S 1TVRA 4YQWA 4X65F 1CG2A 1VISA 1LWCB 2N82B 1VBKA 4JI4F 3C14A 3CCUS 1HD0A 4ZVHA 1S0OA 5F8IA 2HNDA 2OPRA 2Y1IA 4MIBA 2WB4A 3B4DA 4CWBA 1U1MA 1N5SA 1FESA 5F8GA 2CUYA 1HQUB 1Y3JA 3E51A 2MQQA 2YH0A 3RB3A 2HMIA 2R7WA 4B3SJ 2LEAA 1OY9A 2VBZA 2G1HA 2HZCA 4J5OA 1VQ9S 2CQDA 3I96A 3M8QB 2MHNA 1BQNA 1WSRA 3PM9A 1MU2B 1UFWA 3DGPB 1BMQB 2IMOA 4ZIWA 4WFAQ 2D9OA 4ZVTB 4AUKA 2XO7A 3OW2R 1VQ5S 2IAJB 1PJ5A 2VDHA 1JWWA 2ZOFA 2ZE2B 3CE8A 1Q81T 1N56A 3H90A 1DLOB 2KYZA 3TAMA 5J2NB 4BC7A 3C3LA 4FXWA 5GAHU 4UUWA 4RNMA 2EK6A 2FDNA 2BM0A 4KFBB 3UPFA 1E6YB 1RE1B 2ROGA 2W8LA 4OIXA 1RYSA 1UEUA 4KYZA 3L95X 3K0JA 2HLTA 4K4YA 4Q7AA 4UY85 1RTDB 4B9UA 4PUOA 1O51A 1CJKB 4NLRA 4M5DA 2V4QA 4J37A 3EGVA 2E29A 1Y7PA 2LXIA 3KG0A 4YR0A 3HT3A 3DLLQ 3FSIA 4I7FB 2LVWA 3B6BA 2PMZD 1T05A 3CDBA 4NXMJ 2HHTA 2B5JA 3GPAA 1ZTTA 3THPA 3W8PA 4WZQA 4LFBF 1DQAA 5E5NA 2BEFA 2WOMA 1DY3A 2C3UA 5DJBA 1RT1B 4P73A 5M2RA 3CJQA 3EYZA 3HSJA 4AL6A 3QSYB 4B3RJ 1JLEA 1RQ0A 2HNDB 5A8RA 3NY0A 4KQZA 1H72C 3TR5A 4V19X 3C6TA 4NZ6A 2R9LA 5IM0B 3SSSA 1F9FA 4PABA 4PXEA 4AE5A 4BDPA 2GGPA 3MMJA 4HTJA 2E1CA 3TAQA 4HHHA 5KT2A 4ED0A 5K20B 1QE1A 4RPFA 4JV0A 4XIUA 4QQBA 5F3ZA 1DARA 2FVQA 4LRAA 4GO7X 1WF0A 2RIJA 1IWGA 5B0FA 1B4SA 4CO4A 1JLBA 2L08A 2DGVA 1M5OC 4EWTA 2ZOMA 1RAHB 4PCQA 1N88A 5CD4H 5LXRA 3PACA 5MLCV 1X7VA 2WSEC 4NA3A 3IWLA 3PR4A 3KLFA 3ZZPA 3HXMA 2BQUA 2WRMA 3SSRA 1RACB 4PG4A 4CM2A 2V63A 5EX0A 1PYOB 5DS7A 3DGVA 5DQHA 1D0EA 4NCAA 1FRLA 3HP6A 2Z2LA 1JJ2R 2BKOA 2B3TB 2MQOA 1TL1B 2OMLA 2GAHC 4ECZA 3QNWB 2CWKA 2UXDJ 1YBTA 5B0AA 5KG6A 3JSMA 3IM9A 4M5DB 3VZHA 1OYDA 2XMMA 2HHHJ 4E8UA 1NZAA 5DETA 7FD1A 3CJ5A 1VLYA 3MEKA 1T05B 2IRYA 5KFKA 2B7BB 1XMQJ 4KY3A 3W65A 4WFZA 4C8KA 2B5JB 4HI1A 2WAQD 5GAEU 1EQMA 4ID8A 2CQ4A 3T5HA 4FF1A 3IFEA 4F36A 2F8EX 2J5AA 3K5MA 4R0JA 3QAEA 5HSPA 3AXKA 2ABYA 3V6DB 1FI4A 4YDDB 3UCZP 1JLEB 3BGUA 5A8RB 3J81U 4IDKB 1JLFA 1SH2A 3I5BA 2E1AA 1KQKA 5LMNF 2U1AA 2QA4G 3DMJB 2UUBJ 2L3MA 1DJ0A 2GGPB 4DQQA 3J80U 1IUJA 3GSDA 2V8DA 4C7QA 1CJTA 4N7TA 3TO8A 4X4NA 2C2NA 3R6GB 1VQKS 1SC4B 1FXRA 3N4WA 4BC9A 2DH8A 2BRKA 2I9SA 1KQSR 4HHUA 1Y5NB 4WTOB 3GIKA 4KT0C 1VCTA 4QYZJ 1HW8A 2V8HA 4OHVA 2JJ4D 1JLBB 4WFNQ 2XLIA 2CG4A 3ZTPA 4A8YA 5CCLA 1NM2A 2KG1A 3LAKA 4LF4J 1U25A 1F2HA 2DY1A 5DQIA 1YX2A 5AXLA 3KLFB 4B3SF 4K2XA 3CDWA 3U7JA 5EUHA 4F4ZA 3C8YA 3DYAB 4DDFA 1GMUA 4QR0A 1PJ7A 2XY6A 5M2UA 3HHEA 3LTOA 4HDHA 3BQ1A 1U6BA 1T9XA 4J9RA 2UVVA 3AA9A 2ACMA 3J7Z5 3MM5A 4P2FA 1S0MA 4ZPAA 3T19A 4TN2A 2JFDA 3FEXB 3JSMB 2QGFB 1JX4A 4AXIA 1T0TV 3Q22A 1QTMA 4H54A 5ETQA 4HHJA 3GCXP 4I56A 2M70A 5ETVA 4KSEB 2ZNYA 3TQEA 2L9NA 1WI6A 2W1BA 1N5VA 1N5YA 2FGCA 4TY9A 5HAOA 1A6LA 4KH0B 4OJ1A 1P1LA 2LQ9A 5F0WA 3C66A 4CO5A 3RB0A 1IKXA 4DX6A 1RBLA 2W4CA 3P5TL 2AZ1A 2Z30B 1FNXH 3PJWA 2CZVC 4A46A 5L1KA 2VODA 4F02A 3UD3P 2KG0A 3GIMA 4L6V3 3FBFA 3MURP 1T94A 4OX9J 3PHTA 1WEZA 4LBPA 3K5NA 3LF0A 4Q5VA 2RRAA 1ULRA 1S97A 4L73A 1KWMA 1EARA 1TAUA 2QL9B 4N5SA 4J9VA 4WZMA 4CO3A 3KG1A 1I51B 2GNKA 3FUYA 3GIJA 1GEHA 2R7XA 2Z2MA 1FVQA 4WK3A 4B3MJ 2QJ3A 1VJQA 5FJ4A 1RHMB 1LV5A 5EWFA 3OJSA 4M5LA 2C22A 4UW2A 4DFMA 3DLBA 1VBXA 4FXDA 5GMEA 4Z2XA 1RHQB 4QIFA 4JB8B 2HVZA 1KD1T 4ZP9A 2ZD1A 5GAHI 4LSLA 1CJUA 3HVTA 3PW0A 4Z37A 4I67A 4K50A 4CLFA 5KT4A 3E3XA 4U7UD 3JQKA 2ADBA 3IXQA 3MMBA 1BD6A 4USVA 2RQ4A 1HQ2A 3PYGA 1MWQA 2HG4A 3JSYA 5HVFA 1BQXA 3FBCA 4I4BA 2LLZA 3MF5A 3DFEA 1NU4A 1S1UA 2J7WA 4LR8A 4KHPJ 2M88A 3PW2A 4BBYA 3MM5B 2QA2A 4M5KA 2D3OR 3CSKA 3RUBL 4C8NA 2BXJA 5B09A 2NUUG 1XNQJ 2CPIA 3AOBA 2AEMA 4NLQA 2BE7D 1B0TA 1T03A 1KC8T 3DLJA 1Q95G 2DNPA 5KFAA 2VPWB 2HBQB 2G1DA 1HYSA 1S9FA 2DR9A 1FNOA 3MM7A 2W4PA 4ZHRA 1SKSA 3BS9A 2O01C 1N5YB 3GSIA 3TA0A 2OELA 3CWJA 2B51A 3KMQA 4AL7A 3WC2A 2NCKL 1Z2LA 3OTEA 4Y2CA 2UXDF 1HIYA 1WELA 3NKYA 3ILOA 1IBMF 2KT3A 5D4NA 3IN5A 2CPJA 2HHHF 4M5HA 1FERA 4RLEA 1WOPA 2BJDA 4DV1J 2OTLS 2BJ8A 3AH6A 1YZ7A 3NP5A 2B6AA 3LA0A 4DUTA 2CVEA 2ZDOA 2YPYA 1V3ZA 1U09A 2LCWA 3BBCA 3C16A 1OYEA 4ALZA 5IT0A 3KTQA 1YK9A 3IWNC 3O2IA 2XZTB 2X51A 3BEGB 2ZD1B 2B0GA 1TL7A 3HVTB 2UUBF 2O67A 1RCXB 3BGRA 1O6XA 4RUHA 2DR8A 3CJ2A 3W63A 4DL3A 5KOXA 2W7OA 3MMBB 1H2VZ 4CM0A 4O3RA 1QAIA 4RW7A 1S1XB 3HO1A 3Q8SB 2XWXA 3GFYA 3MTJA 1Z4UA 2CQ1A 1RLCL 4C8ZA 2AT1B 2UXBJ 4WXWA 4TNOA 3SCLE 4OLPA 1S1UB 3HJVA 4OZ3A 1B7YB 1FO1A 2KHDA 5CD4A 1HNVB 1S4EA 1T03B 1NSAA 3MEDA 3F41A 4DR2J 1Q7YT 2CQBA 3LQVA 1DHMA 2ZH8A 3OBIA 4DSIA 1VLOA 1HYSB 2ATCB 5I3PA 2HK3A 5GAEI 3MM7B 1NCLA 2ZM6J 4DPUA 1K1QA 3R5JB 3C46A 3JTPA 4ZVUB 2CA9A 2AJFE 5CQGA 4A8MP 2QL7B 5L46A 2W8KA 1MNEA 2MKHA 4OL8A 3ZZOA 3Q8YA 1CSJA 2YWGA 3R1HA 4DX5A 2ZWOA 5L8RC 4WFBQ 2ILYA 3Q86A 4NRTA 2XWYA 1LFWA 3NS5A 2AKWB 3PG9A 3AD9C 2QZ8A 1X4HA 1CULB 3NNAA 3FEYB 4OYWA 2A3JA 1KKHA 1H2TZ 5IT9U 2I0XA 4DL0C 1D8ZA 3ZNJ1 1SJFA 2B6AB 2GJ2A 1YIJS 3QZ7A 4JUZA 4DFPA 2VHGA 3R5DA 1U45A 4GKKF 1SIWB 4CT8A 2C2RA 4J7CA 1D3WA 1RWWB 4OX9F 2XMTA 4P7TA 1KHVA 1GXUA 4Y0FA 4ELTA 2GO8A 3VTIA 2P9CA 2V2KA 2QL5B 3R9LA 4KGKA 3OSPA 4KAIA 4CO0A 2JC1A 4O3NA 3RRHA 2K1RB 1T3NA 1H7WA 2YX1A 3OD2A 3UDLA 5HQLA 1RA6A 2FJEB 4WP8A 1JLCA 4RW7B 3KK1B 1HI1A 4DV6J 2V9KA 1NHVA 2HBRB 3RAXA 1XEZA 2XMVA 1N6QA 1KTVA 2KTQA 4MYUA 4NLGA 4M94A 4QWCA 4J9UE 3VAIA 3KHGA 2MQ8A 2R7SA 2MY8A 3P8BB 5E3CA 4HL9A 2CJ9A 4W4MA 4X64J 5A2QY 1TKDA 3ET6B 3MEDB 1TK5A 1XWLA 2RSQA 2APOA 3IBFB 2QE5A 3MD1A 3C19A 3HK2A 1M0SA 5F41A 3R8YA 2V50A 1H98A 5HMXA 1KOOA 2V69A 5AJ3J 3VAJA 4ED2A 5GADI 3KMSA 2CYYA 3HHLA 1QM9A 3GIIA 1SJRA 3PW4A 1XNQF 3QQCD 1QY7A 4P2MA 1FFSB 5CYQA 4F0KA 2MB0B 1NJZA 6FDRA 4X66J 5HANA 5KFRA 5D0HA 4NI2B 1KVKA 3ZZUA 1G6BA 2HGNA 4Y65A 4B02A 1ROFA 1XJWB 2R7TA 2GIQA 1NB7A 9RUBA 1JKHA 4C11A 4PG7A 4JI2F 3VF0B 2BRLA 2M8DB 1HNIA 3PEHA 1RAOA 3QT7A 2N3OA 3KLVA 4ECVA 2C1EB 2B7CB 5DG9A 2JL9A 3W8GA 1D9DA 1X0FA 3ZNUA 3WHIA 5H9EJ 5KG5A 2LXFA 5IV4A 2KXHA 2W01A 4ZCMA 3DI6B 2R8GA 4CLYA 4ES1A 4RU2A 4EK2A 4DV1F 2JHEA 1H7XA 2ZHAA 4DR1J 1WSVA 1L3SA 1R43A 4IOBA 4A47A 1Y00A 3N6MA 2JOQA 3GB0A 1W25A 2W9AA 5L1IA 2VKRA 1F5BA 1JLCB 2ZFHA 2UVRA 1Q8BA 4K7QA 4RX6A 2HWIA 1NSKL 2NXEA 3IO1A 1WEXA 3VVUA 2BA9A 4USTA 1RT3A 1N6QB 1FRKA 4U7UK 1HQEA 2D9PA 1X9SA 2H3EB 3TEHB 2ZZTA 2EEYA 1R8AA 4K4XA 4P71A 2EG1A 2DXDA 1VHFA 1LWEA 1U1NA 2GHWA 2BMBA 1YJVA 2XEXA 1EKSA 1YJ9S 5J2QA 2UP1A 2ZBIA 2BR0A 4OJ3A 1IJEB 1UWBA 2E5LJ 3HHNB 5A6WA 2EVZA 2AX0A 3HULA 4U8VA 3NGKA 3QAUA 3CDEA 3PJ9A 3PEJA 4PG8A 2LECA 2OP5A 2LQ8A 2B43A 1F6TA 3A4TA 2CPEA 1SL1A 1LFPA 4ER8A 3TUZC 4YFUA 4J9PA 1T9VA 4LIWA 1SBRA 3L3CA 2FJAB 2QSWA 4IH6A 3UDVA 3H20A 2ZVSA 2I2YA 4TU9A 5MAOA 1HNWJ 1FA0A 4DU7A 1J5OA 3HHLB 1PYTA 4PXBA 4ECSA 1CC7A 2ZITA 2CNLB 2HPUA 2QLJB 5CYQB 2VICA 5F8JA 3BREA 3BR8A 2W9BA 1QSLA 5E0OA 4JI8J 3EDRB 3CJKA 2R7OA 3FKBA 1OY8A 3CO9A 3B54A 1SIZA 3CJRA 2WBMA 4K4UA 1U49A 1G2EA 5AXKA 1HNIB 3OTOJ 3PX4A 2J9EA 3AODA 2WVEA 2HQGA 3R97A 4PXCA 4ITSA 3MAQA 1Y5LB 4C4WA 4DR5F 3JTNA 2IYIA 1T3OA 3GJQB 2VBWA 4EFAC 4J91A 3EUNA 4F0MA 1R8CA 5ETPA 2KFZA 3I87A 4WIQA 1B7FA 4FVCA 4DL4A 2PA8D 3GIRA 2IJRA 4S0MA 2EFNA 4JI3F 3DRXA 3BV8A 3ULHA 2P9EA 4UQGA 5IWAF 1NJWA 4ILLA 3IR6B 3PFOA 1U0HB 1GK8A 3BN7A 1RT3B 4ZPTR 1GQEA 4MH8A 1WHYA 2RF2B 2AYGA 3RW6A 4Y2MA 2AJ1A 1S77D 3T1AA 1UVIA 1VHIA 4KB7A 1LWEB 5DDPC 4OYAA 4MK8A 5HJYA 4DV4J 1A7GE 4BLGA 4ZJQA 1FWPA 3W9IA 2HNYA 3QT8A 1S1WA 1U7LA 5LXYA 2OKQA 2ZJPQ 2Q66A 3AXMA 3O5TB 2E5HA 1BE4A 2A2CA 1S49A 2G9OA 3WDOA 4MJKA 2MDAA 4LF8F 2WONA 1N34F 3BGLA 4DX7A 2RUGA 4B3TJ 1Y5IB 2WVFA 1J5OB 1O8BA 2CZ4A 1PC4A 1HBUB 2QN6B 5H9FK 3L9ZA 4I1TA 1DAXA 3MEGA 2W9BB 4NA1A 2IDLA 3MPVA 5A8WB 2V4JA 3SFUA 3HD2A 3EXCX 1F0XA 2FJVA 5EWGA 4WFXA 1GH8A 1C1BB 2BZ2A 4ZCKA 2DRBA 1D8YA 2GMHA 1WKJA 4CH0S 5KFWA 5AJ3F 2PEHA 3PNIA 2E9TA 3EZUA 3N0VA 4IRKA 3R5BA 3CD7A 5LJ3Y 2PDAA 4DL6A 2PI4A 4ENOA 2MLZA 1NH7A 3DLEB 1HBNB 2BANA 2GIRA 3B82A 3K5LA 1LNQA 3FBEA 4I64A 1MWZA 3TI0A 3FQKA 1S0NA 3T1HJ 3HHLD 4M5NA 1R8PA 4NZ7A 1RWVB 5L39A 2N7CA 3KK3B 2HQIA 1F5CA 3TZZA 4IH7A 3N5BA 4O4GA 3MR2A 4CLKA 4OYPA 2XMAA 4MFBA 3MM8B 4ED8A 2VUGA 3GG0A 4FDFA 2OO4A 4DR1F 1PBUA 2YNHA 2EC0A 4Z7YA 3MAAA 2EW9A 2MKYA 1RAIB 3QATA 2E7VA 4ED3A 4X4UA 3DXBA 4CP5A 2ZH1A 3BR9A 2AWZA 3PKYA 4NOHA 2NR0A 2K2PA 2GX8A 2VKZG 1S1WB 2DRDA 4DPYA 2X1AA 3CIMA 2W2MP 1JLAA 4CO1A 4QW8A 4GVBA 1RHJB 5C25A 3NAIA 4RUBA 1U6ZA 1RWKB 1KDNA 2UV8G 2LEBA 1DFDA 4CIOA 5DGAA 1Q1KA 4EU0A 1PAUB 5KT6A 3MEGB 5DLGA 4RO0A 5LJ5Y 2XSFA 4C3MA 4J9QA 5EGYA 3OFFA 5KFFA 2ZUGA 4FYYB 4PYDA 3IC1A 1IKYA 1Q82T 2KM8B 4W90B 2OUGA 5ITHA 1APSA 3RW7A 1S57A 1KVIA 4DG1A 2COLA 2Y0SD 1HNWF 3QPIA 3KJFB 4K5SA 2MMYA 2EBEA 5FIIA 3A3OB 2PC6A 3GV5B 3IWXA 4DWIA 1HBOB 5B0EA 4ID5A 2EKYA 3MGJA 4A8OA 2BANB 1NDKA 3F44A 4ZCIA 4JI8F 2PO4A 3QT5A 5HL7Q 5KT7A 1UAWA 3RYLA 4DEZA 3M9MB 4AQYJ 4FS1A 3G9CA 2N4DA 4I2PA 3M4XA 4DR4J 1P8GA 1OSCA 1NPPA 2UUAJ 2Y8WA 3ZC4A 5HVGA 3GONA 2KL8A 3OTOF 2HYIB 2MJNA 2WK4A 2AV5A 2DNYA 4B9MA 2XLKA 1QVFR 2G2OA 2WW8A 3PRVA 4F3QA 4X4PA 1OMSA 1NUEA 1RT2B 4O4GB 3TEGA 1HR0J 1VQ4S 4USJC 4MFBB 3M8RA 2YKPA 4NA2A 5IZHA 4C97A 2CQCA 4ZPBA 3RU0A 1GMWD 2IRXA 3PCOB 5E3QA 3MAAB 2Q3PA 2YWKA 4ED4A 5IS2A 4ZP8A 3VAMA 2DR6A 2HIYA 5A0YB 2MZRA 2HGLA 1FJGJ 4RW6B 1SVDA 1Y11A 1MROA 2O3DA 4GVBB 4YHHJ 1G4CA 1LWFB 2QFJA 5C25B 1ZZNA 4RWXA 3M8PA 1M1HA 3MUMP 1EZZB 3ADAC 3W7BA 4IFYB 1R0BG 4ZITA 1YRTA 3IR5B 3POTB 1XN9A 4NEYA 2JSXA 3BSCA 1C2PA 3S1TA 3BDPA 5EDWA 4Q44A 1DZ5A 3M9NB 3OXFA 1KTQA 2X3GA 1SJQA 1R6VA 4QIWD 5CAAA 4IQMA 3MR6A 1V3SA 2BQ3A 4B3TF 1R89A 4DG1B 1J5EJ 1IM4A 1U6FA 2YKAA 1YBAA 4JV1A 5HQMA 3HDSA 3SXLA 4YOEA 4WBFA 4MKYA 4G3IA 4F04B 4ECRA 5KFOA 5DRKA 1XBWA 1FDAA 3I5CA 1L3VA 4K0KJ 5ETKA 3EX7B 4ID5B 1OPIA 1WNEA 1Q16B 4ZLPA 2EFGA 2FJDB 1EP4A 4KV8A 4ES2A 2HHXA 4QOTA 4UOCA 2XHWA 3T9NA 2AX1A 4I2PB 4ERDA 3BPSP 2MKKA 3VQTA 1JXVA 4RW4A 4L3NA 2DH7A 2ZBQA 3MECB 4WP3A 4JI0F 1PC5A 4DPWA 5CZVA 2YBVA 4KRWA 1IQZA 2FLLA 4O3SA 2XS5A 2MJUA 2R7RA 2CPHA 3P3DA 1X9MA 4FYVB 2CDRB 4TLRA 2JEFA 2V68A 3ZZYA 3ITHA 2Y9HA 5HBMA 1KFDA 1S6UA 1Q53A 1W26A 4UT4A 4NLDA 5L38A 3KUEA 1VMBA 2GVZA 3T1HF 3P45B 3TUPA 4OI1A 2FVCA 2Z57B 4PWUA 1HI0P 2JC0A 1VK3A 5KFLA 3KLGB 1L3TA 5F8MA 1TK8A 3PXGa 3P49B 1NNDA 3QLHA 2HVHA 1N36F 2YNFA 8RUCA 1MROB 1VI7A 2XHCA 3EGZA 1RTHA 3Q0AA 4LBIA 4YN3B 1VRQC 3RTVA 3HVWA 1RB0A 4EBEA 2LMIA 3JSRA 1DTTA 4ZIVA 4ZDNA 2UU9J 1XNRF 2V5HG 2FHOB 3CCSS 2OAUA 2Z4PA 5M2PA 2XZWA 1DQ9A 3M6WA 2HVDA 2KRBA 2HRUA 2LQ5A 4ZKAA 3VHQA 2E9ZA 2OD6A 4YMEA 5J1PA 3TVZA 3T5LA 1Z2ZA 3DRRB 4XO0A 2BE2A 1RADB 3BQ0A 3QFWA 4RNHA 2BW2A 4UF4A 4FPIA 4ELUA 3MEEA 3ZTRA 1RWMB 2IVMA 4BWJA 2JDJA 5CZXA 3SQGA 4WWSA 3GQCA 2YQ0A 4OYZA 3IR7B 2QSFA 4FNHA 2DO0A 3QSIA 1SV5A 3GYGA 1HWUA 1VBZA 2B4VA 2BJ1A 3W5ZA 1S6PA 3DM2A 2VDIA 5HROA 3HT0A 4N56A 4BHQA 4FKYA 2VC0A 3BH7B 1EP4B 1HLWA 3PY8A 4EUVA 2CPZA 3G4SS 1YDLA 1SQFA 5EWEA 2VB6A 3WIVA 4C8YA 3HZEA 4OHZA 1H6KX 4P2XA 2PIIA 4ZVPB 4RW4B 2XO6A 1G3OA 1JXEA 5LSOA 2OHDA 3VAHA 1TV6B 5K8PA 2C2OB 4P75A 1U47A 1TKTB 4DXLA 1ZA1B 1LW2A 2AJQA 2RUSA 4Y34A 2HWTA 4NLXA 2HS3A 1RT6A 2KDOA 3W2VA 5HBMB 3TZWA 3VGUA 3R2CJ 3W2WA 1VIXA 3LANA 4DV0J 1MW7A 3CVKA 4KGMA 2E1RA 2UUAF 2GVZB 2MQNA 2C28A 1TP7A 3UDCA 2QT7A 3UNGC 5DDQC 3LGNA 3DOKA 2DVIA 1ZYQA 1IR2A 3UVJB 4YDXA 3BO3A 4QPTA 3QLHB 4X2BA 3NOGA 2YNFB 4LR9A 2OLWA 4Q2MA 4ZK7M 2CNNB 4JYAF 1RTHB 5KFBA 3X3UA 1R7IA 1UVKA 1T02A 4PXDA 3QRPA 2E1MC 2MZ1A 1MMNA 4URGA 4B17A 1DTTB 2X1GA 3NCQA 1X31C 1JLGA 2HGMA 3Q2SC 4F26A 4MK9A 3OR1A 3C2PA 3ENQA 2F4FA 2RHQB 2BE2B 2NXCA 2CG8A 2C42A 3LALA 2NXUA 4O23A 5HVHA 4YHHF 4OI3A 3CCTA 3SV4A 1REVA 2A6OA 2Q6BA 3NGUA 3SCJE 5DO2A 2KT5A 3PW5A 4RNNA 1O5JA 2VPYB 4HH0A 1Q8KA 1MMDA 1FEHA 1SV5B 1IBKF 4H4MA 1S6PB 4IRCA 1AZSA 5HROB 5G0RA 4YS2A 1NLKL 1TUVA 2DKOB 3RRKA 4X4QA 1BHNA 2QMUB 1YTYA 5GMKa 2AEFA 4G6VB 1RSCA 1RAEB 4P7VA 3QIPB 2PGCA 1NDLA 2WBRA 2AHOB 2MQPA 2IM3A 3QJPA 4R5PA 3CEDA 4DF8A 3HSDA 3FCHA 3I9V9 5E2QA 1LW2B 1S99A 4K0KF 3NGRA 3GP9A 2W2PP 1KBRA 5DZ7A 1LEOA 3ILIA 1F3FA 4K4VA 4L76A 1VK8A 3H5XA 1RT6B 3W2VB 3BSNA 3G71S 3PYEA 3CB4A 2WZ1A 1FD2A 5C2GA 3BZQA 2DIVA 2PMHA 1RKJA 2IFXA 4RU9A 2YY3A 1K9MT 3UCUP 3IGNA 5LMUJ 3SDEA 1ZH5A 1ZBTA 5B7WA 2RH3A 3AD8C 4LRBA 1BQMB 2MZQA 4DV7J 2DGSA 2YNIA 2FGOA 3HFVA 4ZLLA 2RAQA 2VV5A 5HO4A 1VQPS 1PKUA 1RXOB 3HPOA 1WTBA 2ASLA 4PZVA 2ZH4A 1JLQA 1WC6A 1QAJA 3A8KA 1MN7A 1UW4A 5BR8F 2OIHA 2N4CA 2CJXB 4YB6A 2HHUA 1PGZA 2XSJA 1PJ6A 1GNKA 2XB2D 5E7OB 2YNGA 5ETNA 2VA3A 2J7KA 1JLGB 4TYAA 4MIAA 3RB4A 3KG4A 2LP4A 4UZCA 4PYAA 1BUXA 2CDQA 3AD7C 1NB2A 3DDNA 4EGLA 3H5UA 1S6QA 3DXSX 1SQGA 4I2QA 1I1GA 1RWPB 5KFSA 5A6PA 5THWA 1REVB 2C2KB 4KC5A 5BXIA 3U02A 4FYWB 2R7VA 4OYIA 2CJAA 1UZHA 2AD9A 3FZ2A 3R3TA 2UU9F 2HFSA 3OVSA 1LWCA 4H4MB 1AZSB 2UUCJ 4HLBA 4Q8FA 2J0QD 3QZ8A 2H5IB 1NSQA 4X4RA 4E98A 5LT5A 1F2GA 1NK0A 3MXHP 5L9XA 3FVYA 1YHQS 4MYTA 4OJGA 2AEJA 4LF2A 3J7A1 4LBHA 4DV2J 1IJFB 1VS3A 3IBCB 2KH9A 4C8OA 4R5PB 1GAOA 2QLWA 4ECQA 4ZPVR 2DNGA 3F73A 2YX4A 3LWLA 1U2CA 3JB9k 3CW2C 2DR5A 2XI2A 1MU2A 5KFEA 3G6XA 3DGPA 2AIRB 3AQPA 1YJWS 2KVQE 2FLOA 1TKZA 1FDBA 3KNAA 2IAJA 1NDCA 2FC9A 1U1QA 3UO0A 1HNZJ 2GZOA 1B99A 1K0VA 1S6OA 4NXNF 1GTHA 2ZE2A 4J90A 2D3UA 3GR1A 2IM2A 3NBPA 1JK9B 2M8HA 3LPEA 3CUNA 2YNIB 2XTJP 2J0XA 3DRYA 4LRCA 5D78A 4B9VA 4RWWA 1JLQB 2CXEA 2UUWA 3D2WA 2G2YA 4ILRA 5D6GA 1ZS6A 3KFWX 2DY9A 4OHWA 3GYNA 1RTDA 2YNGB 2QYCA 4AXJA 1CJKA 3QO9A 1U8SA 2E5GA 4KR0B 3ZXWA 2GA7A 4FF4A 4EZ9A 3BO2A 2MY7A 2HVIA 3HM9A 1FE4A 3CDUA 4I2QB 3WZ0A 1M90T 4DUZJ 2W7AA 2E7XA 4RKUC 4X62J 1WEYA 1OIAA 1NXIA 2NXJA 2YTCA 1RJJA 2CQ2A 1RT1A 1S0VA 3SBMA 2IA6A 4ETXA 2B4UA 2EPIA 5C42A 1F3VA 3D3BJ 4ZN3A 1WG1A 5EX3A 3ZZTA 5F9LA 1ELOA 3ISZA 4N8OA 1VRUA 4V19J 2XQCA 5IM0A 2Z2YB 2HFOA 3K2YA 2VONA 2LA4A 3BB5A 3OT9A 2PEBA 4ZPCA 2AJ2A 5KFGA 2GW8A 2R2RA 3A1YG 2ASJA 2ALZA 5F8LA 3TANA 1F5AA 4ZVGA 1NBEB 3BKTA 3MMAA 1B64A 5KFDA 1Q5VA 3S7RA 3K59A 4ANEA 2EXUA 2VJUA 1TKZB 1FX4A 2NSBA 3VV2B 1VJWA 3DRSA 1P6TA 4LF9J 4KGXB 3EGWB 3VGVA 2QLFB 2DXFA 1FXLA 4IR1A 3NBPB 1N5TA 1KQFB 4CDIA 2J6UA 2KKHA 2PT0A 1YRUA 4LF6J 1C4AA 2BW7A 1K8AT 1TL1A 2POKA 4OX7A 2DNRA 1WC4A 1SH3A 3V2UC 1Q8LA 3ZO7A 2MKJA 1DBDA 1CJVA 3Q8VA 3D6HB 1HA1A 3I4PA 3TUIC 5LMUF 4LFCJ 1KLMA 3D68A 3QO9B 3J81Y 4LJMA 3CJ8A 3NCRA 2HSEB 2NUHA 4DV7F 1UTAA 5KTQA 3LP2A 1M5VC 4O44B 1WUUA 1FTCA 3J80Y 2H5EA 2ZH2A 5CCMA 1HHQA 4DR6J 1S4FA 2WSCC 2B9YA 2E5JA 4KH1B 3O44A 4ES3A 4O0NA 2JRSA 2GJFA 4ELVA 4CNZA 1HW9A 2J9DE 2E66A 3F56A 1C0UA 1WD6A 1TUGB 1GT8A 1TELA 4NPOA 3V6DA 5C42B 1MLAA 3A8EA 3OSNA 3KNGA 5K14A 2KZZA 2RJZA 4M5JA 4IDKA 1VRUB 2R2SA 4LR7A 2FHMA 4QCLA 4DJBA 3CD6S 2RQMA 2FHJA 2ZH9A 2XY7A 3FCWA 2ZZNA 3DMJA 4ZVRB 3KLHA 1N48A 3VGSA 1LXNA 2MZJA 3HHLC 4N8NA 3ELHA 2OPPA 2RU9A 3DDIA 1N5QA 1YBUA 1ZAWA 3AB2B 5JVGQ 1JMTA 3NXZA 2IVYA 3JQJA 2JEIA 2F5GA 3MMAB 4RW8A 2UZAA 2UUCF 1WG5A 3H5YA 1MG7A 3D67A 2NPFA 7FDRA 5AE2A 1U1KA 2E5IA 1FWKA 3OL8A 4U96A 1ZZFA 1RAGB 4MK7A 3DRSB 4IYQA 4DV2F 2IRUA 1VQYA 4ZP6A 3OXLA 3W9JA 4NYOA 4A8KA 4NYPA 1ZAVA 2R8KA 2F65A 3DYAA 4LSZB 1TQLA 1VQNS 2H4WB 4DR7J 1YZ6A 2VG6B 2DPJA 3VAGA 4GVLA 5HLFB 2IBOA 4NCBA 5D15A 3Q8QB 1CJVB 3JS9A 1NPKA 5D8HB 2CAJA 2IHR1 3HD1A 2H5JB 1HNZF 4DV5J 1N32F 3LW5C 3O6QA 2JH3A 2BKNA 3M2RA 1KLMB 3H2VE 2YKQA 4EI2A 2A10A 3M32A 4RL1A 3NCPA 2AJ4A 4N41A 2J8AA 4HVZA 3LP2B 4GKJF 2J0WA 5KG0A 2HHPA 4OYBA 3CJ0A 4MKVA 4ZVSB 2WVCA 1FHTA 1XMBA 1QTNB 3A8JA 4FP9A 2DNLA 4JP8A 4U8YA 2G0IA 5D0GA 4OHYA 3I0RA 5HQ8A 3QJLA 3W5XA 2GQQA 2HHQA 4CI0B 1C0UB 3H8YA 5JXSA 3TA1A 4DV3J 3A3PB 2MKIA 3TJ8A 2FVPA 1JJHA 5CA5A 3CCJS 2YX7A 3I32A 5K14B 3K58A 1U4BA 3KLIB 1S7HA 4PG5A 2J76E 2DNOA 3E01A 2WCXA 4DQPA 3MUTP 3DOLA 2F9JA 2HKEA 3KLHB 4G1QA 1HNXJ 2YQ3A 1GMVA 2OEKA 4UY8T 5IV3A 5KFPA 4NMLA 2OPPB 1X5TA 5LOQA 3OTBA 1KOHA 1FJCA 2V2ZA 2AGPA 4ANDA 5IC4B 2FJBB 1TU0B 2DHSA 2W4DA 5I4MA 4RW8B 3D4JA 4OYXA 2NQPA 2HURA 2C2ZB 2RQCA 3N9UC 2M7SA 1CVJA 4X4SA 3UNYA 3TZXA 1FXDA 3NAHA 2MHEA 1Q5YA 2MKCA 4OZ1A 2Z8QA 4N77A 1UMJA 4TYBA 2V2VA 4WJBA 1EHWA 2NZ4A 3BBBA 2BM1A 1M5PC 3I56S 2RT3A 1FRIA 1Y3KA 1NSPA 3NS6A 1SJ3P 3QJJA 3OVAA 1H0HB 2QG9B 1FRXA 6AT1B 2DB1A 2AYBA 2D41A 1F9HA 3HFZB 3LP1B 2EC2A 1NMEB 4JV5J 1V9OA 1VBYA 3M2RB 3I6PA 1RHUB 3OJUA 3CTRA 4HT7A 2HNZA 2RNEA 3M32B 1VQSA 2VJVA 4R0EA 1YI2S 1Y10A 3PKMA 4DF4A 5HP1B 2M9KA 2DISA 2HQFA 1REGX 3DLHA 5LM7E 4HACA 5LSLA 3ENWA 4QPXA 1YJRA 2JLEA 3W66A 3DHWC 1YRXA 3SEOA 3KLEA 1V5IB 4ZVQB 2FY8A 2XMJA 1S59A 4P9SA 4M63A 2FD2A 2MQLA 4J9SA 3I0RB 1C1CA 3HZGA 3RBXA 3CCRS 3A8IA 2I5JB 3KJNB 4NLPA 4M5IA 1CLFA 4ZS6A 2J6TA 2OGUA 2DEJA 3GE9A 1IBLJ 4DLEA 2F9DA 3E01B 3MD3A 2LDIA 3LP0B 3EVWA 2PMWA 4LT6A 1W2IA 3DOLB 4NXMF 4LUBA 4DR6F 2VFRA 4G1QB 3ETMA 2JVOA 3MZIA 2CVIA 4RUAA 3D0GE 3I9ZA 1UVMA 4LRDA 4USMA 4FS2A 3WBZA 5F8HA 4Z7CA 4X65J 4B3RF 1D09B 1PYSB 2GQ2A 2ZHOA 4W98A 2GQCA 3G6ES 2H54B 1RUSA 2FZCB 2WSFC 3LAMA 4JI4J 3N79A 3FMBA 4E0DA 3R5AA 2M4MA 4PPZA 3CC4S 2GCFA 4DBQA 2ZZMA 4ZA1A 4P10A 2FVRA 1NH8A 2XULA 1RISA 2JEGA 4FKXA 2A6MA 3K8WA 4C3LA 5KFTA 1S1XA 4C8MA 3LO3A 4X4VA 2C3MA 4ZPDA 4NEZA 2RDIA 5GAGU 2QEXS 4DMZA 3V4IA 2FHJD 3M8SA 2BJ9A 5D77A 4J9NA 4USIA 5E3AA 2NXNA 2LU2A 3FQLA 1HNVA 4ED1A 3TZYA 5FLXU 2HNZB 2HQCA 3UW1A 3H4DA 3CJTA 5LSRA 4FBTA 3QWUA 2KVIA 4EEYA 5IT9Y 3SCIE 4C98A 4A4JA 4HACB 1YJNS 2ACYA 3TRGA 1ZOTA 3KLEB 2EBGA 2DHXA 4USWA 1C1CB 1VFJA 2ZH3A 4DV5F 3M30A 2OPSA 2NPIA 4OZ5A 4PWDA 2R2UA 3R5CA 1YSJA 1W7WA 1U26A 5KT3A 2R8JA 5EN1A 2DITA 3W9HA 2ZKUA 3AB4B 1UCNA 4C3KA 1XMQF 1CULA 4XTTA 1IR1A 1KN6A 3FBBA 4Y3CA 2Z2ZA 3J7ZT 3WC0A 4IUFA 2VG7A 2EG2A 2H9ZA 3TYTA 5D4OA 1PBAA 4QBUA 1UZDA 4WCEQ 4ICLB 3RG6A 5J2MB 3PHEA 3N5FA 2W2NP 1GX6A 4OZLA 4EBCA 2F7VA 4A8SA 3NMRA 3MCMA 2HVEA 2XS2A 4NLTA 4Y2IA 2K1RA 3MTKA 3M6VA 3EMTA 2DXEA 2BJ7A 3ENVA 2O1PA 3EE3A 2RE1A 2LXUA 1HMVB 3KK1A 3U1MA 1HWLA 2Z0GA 5BYRA 2UUTA 1TMMA 4DOZA 2FVSA 3AOCA 2XGQA 2FZKB 5CXTA 1EETB 3V4IB 3OV7A 4E2FB 1WI8A 2DGXA 3PYFA 3OUYA 5CYMB 5CH7B 1PSDA 2GS8A 4Q43A 5C5JA 4R25A 4LF4F 2UV8A 3MR3A 3ET6A 2RD5C 4NRUA 4TU7A 2VPZB 3KXDA 1WC1A 1RWXB 1VC5A 2A2DA 2K3IA 5I42B 2X7IA 4OHXA 2HAIA 3ZTQA 3H0PA 1FK9A 1TZ0A 2FUG9 3L4BC 3UR0A 3IS9B 3ISND 4JV5F 3M30B 5IQQA 3DU6A 2ATLA 3IAM9 4DCJB 2OPSB 2FY1A 5HMYA 4PWDB 3E2EA 2F8MA 1RGVA 3OL9A 4NI2A 2R42A 1ZM3A 5IXUA 4QR2A 2HFUA 2PN6A 2KO1A 1WOSA 3EJMA 3IA0A 4QU7A 4IFVB 2R7UA 4WU2A 1RU1A 4J9LA 2VG7B 1RBAA 3I82A 3AQOA 2CWXA 3EICA 1JNZB 1IQTA 1M1GA 5CHCB 2D1CA 2A0FB 2IDEA 2UXCJ 4AT1B 4H4KA 1AUDA 3AOAA 1FDDA 3MWBA 2KXFA 3NWRA 3DI6A 3TX0A 1OWXA 2VL1A 3NNCA 4EZ6A 5E41A 3ETOA 2GJIA 2FJWA 1GXLA 1SUQA 5L1LA 3OLAA 3G8QA 1HWKA 5LMNJ 3R2DJ 3FRZA 1JQGA 2CJBA 3N28A 4LQ3A 3BYPA 1XMOJ 1UVNA 4B3MF 3TWZA 4QYZK 2O66A 1YKWA 4ZVEA 3H59A 4W92B 3DNCA 3PO5A 2XI3A 3H42A 3Q89A 2DNQA 1D1UA 1X4BA 2FLNA 2ZH5A 3VWSA 2C3YA 3JYTB 2W2QP 3KYLA 3OUYB 2HW3A 1NK5A 2VFVA 2QTWA 2DJWA 1F60B 1C4CA 2YWWA 1SKRA 2XZDB 1RK8A 1H2UX 2VQFJ 2NSCA 2GVDA 3EVMA 1MN9A 2F1FA 2DGQA 1AXQA 3QGIA 2C2MB 4URQU 1ACMB 4OJHA 5KFIA 3DDKA 4FYXB 4CH1A 2MLXA 4F4AA 3VALA 3QBCA 4JI6J 1FK9B 4WK1A 4CLPA 3G2XA 4HH1A 4KHPF 1RT5A 3RBZA 4LF7J 3Q8UA 4ATNA 1V6HA 2G13A 4O3PA 1SJ1A 3OFHA 2PSZA 3MPYA 2D74B 4YR2A 1Q7LB 3IGVA 3T5JA 2XNQA 4X84A 4DI6A 4A8XA 3PJXA 1N0VC 3D0IE 2DCLA 3Q8RB 2GIFA 2R8IA 4IOCQ 1R0AA 4ZP7A 2CJQA 3FDSA 4LVNP 1Q79A 3CCWA 1VOMA 1NKCA 1AYEA 2HFVA 4H4OB 1X0PA 4ECXA 3KHHA 2ZKTA 2HAFA 5J1EA 1NRKA 2DCUB 1X4GA 1E6VB 3PYDA 1CC8A 4PKDB 4ETZA 1KRPA 4M8LA 5C24A 4Y28C 2I6WA 4FF3A 3CCQS 4U67Q 1MSWD 2VOOA 5RUBA 1SUQB 2JFKA 4C9DA 2HRTA 3PDNA 2DHGA 2OFHX 4P2SA 4K2JA 4M5GA 2ZJRQ 3Q23A 1F9EB 3ENAA 3JAMU 4IG0A 1N54B 4V1Ak 5GAGI 5HMZA 4OI6A 4C8LA 4F8RA 4TQRA 2B4OA 4X4TA 3D1HA 1U0HA 1TVRB 2AMCB 3EWGA 3T5KA 4JI7J 3M2VA 2RF2A 1KS2A 3C14B 3VGTA 2VFTA 4BCAA 3EZOA 3TARA 2VFUA 4GRSA 1U02A 2OPRB 3TVKA 4NZ0A 3R7NB 1IM6A 1S9GA 2QX0A 2GVDB 5DQGA 1RABB 1P9YA 6FD1A 2XMWA 3CULA 2HRYA 4Q2LA 2F8HA 2KI2A 5AT1B 1UFKA 1XQIA 3GJSB 1NO8A 2HMIB 2RHSB 4OYOA 2UXBF 3DU5A 2GFFA 4MIWA 3BDEA 2B8PA 1FVSA 1RT5B 1NJXA 1P9QC 4OZJA 1BQNB 2P8IA 4YR3A 4FBUA 1JJCB 2P5VA 3CDAA 1CQNA 1HBUA 3BF4A 2K7KA 2CJKA 2K8GA 4DSFA 4DLGA 4TY8A 2MEWA 4DR2F 2XMUA 3DLGA 5A8WA 2DNHA 5T41A 5D4LA 2XM3A 1U1LA 2VBXA 5KG2A 1VC6A 2IA0A 2ZM6F 4L75A 3THVA 2KFYA 1TAQA 1C1BA 4USUA 3TAMB 1OY6A 4RZRA 1R0AB 3EM1A 2DD8S 1R0CB 5IT4A 1NKEA 3WX4A 3G6VA 3M1VA 2FHKA 2R3VA 1FKOA 3TVYA 4MMOA 3BYRA 3M6XA 4WPAA 4FZVA 5F9NA 1I6JA 3JTOA 5J1EB 3ZTSA 2ZNZA 3M2UA 3DLEA 1HBNA 3V6HA 4XK8C 4PUOB 2K7JA 1SJ4P 1JB0C 2ZOGA 1XR7A 2MGZA 3ILLA 1IBMJ 4IO1A 4TKTA 1NHKL 2MKSA 4MKBA 5C24B 4O3OA 4U7CA 2XBPA 1TTHB 5B0BA 4DZ6A 1U2RA 2VA2A 1B0VA 4IG0B 4XDCA 4O3QA 4C6AA 4XAKA 4DCPB 1WC5A 1OS5A 3KK3A 3J7AN 1TL4A 3Q8PB 4F2RA 2WOMB 4I6WA 4NLVA 2DGWA 3ONQA 4QWAA 2UXCF 2MZTA 4FF2A 1U1RA 3M2VB 3BJYA 4CQ1A 1SKUB 4DS5A 3MM8A 2XLJA 1X5PA 2FB0A 2Q1LA 1FDNA 1X4EA 4UZBA 4NASA 1S79A 1KLNA 1G1XA 3M9OB 3C6TB 3LUYA 1S9GB 3FK4A 3QIDA 2MSTA 3M8YA 2FLPA 4F50A 1XMOF 2LU1A 1Q4RA 1Q0NA 1WTFA 3AA8A 3BPDA 3WQPA 1WACA 1XR5A 2P2CB 4DV6F 2CQ3A 1QE1B 3KJVA 3BQ2A 2AGOA 3GILA 3FJ2A 3LWMA 3M6UA 3KOAA 3BSAA 4FYDA 3IBWA 3NL0A 4X64F 1Y9OA 3CD5A 1M1KT 3QFHA 4EBDA 3VAKA 4TY8B 2VQFF 3T1YJ 1JJ4A 2Q6CA 1FRMA 3DLGB 4USHA 3U1LA 5K9FA 4NE9C 1BWEA 1YJUA 4IO9Q 2EWHA 1UPPA 5H1SV 3SMZA 3G87A 5KAKA 2XYHB 4JI6F 2H48B 1B0PA 1X4FA 2EI5A 2ROPA 3W60A 3M1VB 3UR3C 5E3RA 1FKOB 2HBYB 3MI7X 4IG3A 4LF7F 1K47A 3GU0A 3J7YU 1FJ7A 2DGTA 2VPXB 4IH5A 2CJYB 2XMKA 3CXCR 1QUVA 5K8OA 4X66F 3M2UB 1ZPWX 1HBOA 4YB1P 4O0IA 1T8EA 1WHVA 2MGZB 1HARA 5GMDA 8AT1B 5DG8A 3P6YC 2SXLA 2V0NA 1L3UA 1L5UA 3KUHA 2L48A 2QRRA 3TX8A 3PR5B 1T9TA 1SC6A 2I1RA 4I68A 3HCXA 3PFEA 4CTAA 2HHVA 4CT9A 4KGVB 3UE2A 1ICEB 2OJ3A 3NGSA 2PD1A 3HLUA 1T95A 1RT2A 4GKKJ 3MMCA 1R3NA 1MWYA 4DQIA 3U1NA 2L41A 5GADU 1T9UA 2OMOA 4F4KA 1JLFB 1CEZA 3VZIA 5G4DA 2VD3A 2VOPA 3SFGA 3FGVA 1BXNA 2QIFA 2ZH7A 5A0YA 4DUYJ 3MPDA 4RW6A 4GC6A 3KJVB 1CJTB 1K0TA 4JI7F 3FMWA 1LWFA 3P4UB 3MUVP 3I55S 4DQRA 2NZCA 1S76D 5B0DA 4IFYA 3CF5Q 3POTA 5D0RA 1YJ7A 4YEAA 5C7PA 3HX9A 3U27A 4C48A 1OJ4A 2XGPA 2Y1JA 2E5LF 1U1OA 2CPFA 3I31A 2RDDA 2H4YB 2RQKA 2EKNA 5AE1A 3IRXA 3T6BA 3KWMA 3CJ3A 1KEKA 2XS7A 1QAXA 1T7PA 1H38A 3TP2A 1YLXA 1M5SA 3BM7A 3HHDA 4XPEA 2Y3YA 3HVRA 2ROEA 4DS4A 2FIUA 1AUSL 5KT5A 4IG3B 4OQJA 3OLBA 1HHSA 4DPXA 2B8QA 5D0EA 5F3TA 3KJQB 1HBMA 4F3MA 4MAKA 2VFSA 3ZZRA 2W24A 2BABA 1BGXT 3DKDA 4JV2A 4D3GA 3J81j 2NREA 1GFWB 2F40A 2JWNA 1KONA 2OEMA 3H7HB 3L7PA 3V5RA 4DSKA 2V34A 2YH1A 3GWCA 1X5SA 3IRWP 1WF1A 2VF3A 3MECA 2V8VA 5H9EK 3THTA 3CPWR 1QJHA 3DC2A 4JI2J 2MTLA 4CTAB 2HBZB 2W2OP 1IKXB 3CCES 2ZBCA 1PCAA 5F0UA 5ETMA 2PFDA 1XC9A 3MMCB 3V4MA 2A18A 1S48A 2BYCA 3ICLA 3JQMA 1G7CB 3B78A 4ED7A 2R4FA 5AXMA 1HKAA 3K8VA 1SC3B 3Q24A 3D0HE 3FZBA 1KSPA 2XYGB 3KLGA 2V67A 2OSRA 3R6LB 1FKPA 1HI8A 4AYBD 8ATCB 3G8SA 1X4DA 2FPHX 4DL5A 1HD1A 4QIEA 3MDFA 4J9MA 1LK5A 1XK8A 1RT7A 2GHVC 1EB0A 1UJ6A 4PQAA 2Y8YA 1R8BA 2M5YA 4CNYA 4DV4F 3PIPQ 3GFZA 4RBVA 5KG4A 3W3SA 2C2EA 3L09A 2B56A 2B9XA 4LSLB 1CJUB 2G2ZA 4BS2A 1RU2A 5DLFA 3IRXB 2J9DA 3DRRA 1D9AA 1DQ8A 4Y2AA 1DTQA 4L74A 3V6JA 1OPZA 2QFIA 1RWOB 4RNOA 5SZTA 1N8RT 2QA1A 1RHRB 2KRRA 1TR0A 2HLUA 4JI1J 3MAHA 4IOAQ 4P72A 2CPYA 2N7YA 2MSSA 4FNIA 2BX6A 4HI2A 4WU3A 1SL0A 1WHWA 2GMJA 5D4PA 3GYXB 5ETOA 4I6AA 3SYZA 1N0UA 1HBMB 2CFXA 5EHHA 3T1YF 4ZVFA 2WW4A 3CMQA 3V81A 4BWMA 2HHWA 1BC6A 1UEKA 5T7LA 5T14A 2ASYA 4K59A 5ETTA 4UOGA 4XDDA 1IBCB 4ZVOB 4ZHRB 1RYRA 5H9FJ 3S8SA 4LFAJ 1T9YA 2JVRA 2NYIA 4C0BA 4U9RA 1EIYB 2AGQA 1TV6A 1TKTA 1ZM2A 4NYZA 7AT1B 3PX6A 2G0JA 3GTYX 3UFCX 4PEOA 5CYJA 4IQXA 1I5OB 2HFNA 2QA4S 4DR5J 3C15A 4FXVA 3D3CJ 1UWAA 3DCAA 4CRJA 3G96A 3UDEA 4TLQA 3UVJA 4U95A 1NK9A 1FKPB 1KNZA 1EX8A 5IFMA 4KGZB 1WJ9A 4JI3J 1RAJA 4TVAB 2EFQA 4I0WA 5IWAJ 2Q43A 4OI2A 2DGUA 3KHLA 4NLSA 1RT7B 1URNA 5LL6d 2ZUAA 4KHRA 4EYIB 3C16B 4K5RA 1PIEA 3SI8A 4DN0A 3FEZA 4DX8H 2CADA 4QWEA 4PPDA 1M5KC 5HK4A 1TL7B 2WVBA 3BGRB 4DUYF 4YB5A 1DTQB 2CNKB 2FTRA 4LF1A 2QC3A 3MR5A 3J7YI 2H65B 3I0SA 3CCMS 1S1TA 3VAFA 1QSYA 3L7UA 1R6YA 4LF8J 1N34J 1FF2A 2DYAA 2DTJA 2IBKA 4CLWA 2F3JA 2I38A 1IR0A 1QVGR 3NLCA 4OV1A 2KU7A 2GHPA 1ZAXA 2XY5A 2LA6A 3BGFA 3CNQP 3V81B 3SV3A 3C6UA 2DHAA 1I94J 2OEJA 4RJVA 5T7LB 2MYFA 1PAEX 3H98A 3JSBA 3QIPA 2BE9B 1FTRA 2ERRA 1AT1B
chains in the Genus database with same CATH topology
1C1CA 2OO4A 4DR1F 3HZGA 1N5SA 2YNHA 2EC0A 1FESA 5F8GA 1XR6A 3GV7B 2EW9A 1HQUB 3GV8B 3CCRS 3RR7A 2I5JB 1Y3JA 4ED3A 4A8WA 4X4UA 4NLPA 3E51A 4OX8A 2BBEA 3DXBA 2ZH1A 3BR9A 2AWZA 2YH0A 2MQQA 3PKYA 1CLFA 3RB3A 4ZS6A 4HEA9 4NOHA 2HMIA 2NR0A 2J6TA 2R7WA 2K2PA 4KO0A 2GX8A 2LEAA 2VKZG 2CQGA 1S1WB 1BY9A 3GE9A 5KFMA 4DLEA 2F9DA 2VBZA 2X1AA 3E01B 3MD3A 2HZCA 4J5OA 2LDIA 3CIMA 3LP0B 1VQ9S 2CQDA 4AQYF 3I96A 3M8QB 1JLAA 3QGPA 4LT6A 1W2IA 4QW8A 4CO1A 2MHNA 1BQNA 2M2BA 2DT9A 3DOLB 3PM9A 4NXMF 4DR4F 4LUBA 3TOQA 1MU2B 1UFWA 4C0HA 4DR6F 2VFRA 4G1QB 2IMOA 5C25A 4WFAQ 3NAIA 2NS1B 2B9WA 4B9SA 2D9OA 1U6ZA 4AUKA 2XO7A 3OW2R 1VQ5S 4WKRA 2IAJB 2JVOA 3MHYA 3MZIA 2CVIA 4TQSA 1JWWA 4RUAA 2UV8G 3D0GE 4WFYA 4B3OA 2LEBA 1DFDA 3I9ZA 1BQMA 4CIOA 1UVMA 2M52A 2ZOFA 2ZE2B 5DGAA 3CE8A 5KG1A 1R27B 1Q81T 4FS2A 1Q1KA 1N56A 4EU0A 1DLOB 2KYZA 3WBZA 5F8HA 5KT6A 3H2UB 3TAMA 3MEGB 5DLGA 5J2NB 3VQSA 4BC7A 4LMZA 5LJ5Y 2XSFA 4C3MA 3C3LA 4FXWA 4J9QA 4B3RF 5GAHU 2GQ2A 2ZHOA 4UUWA 5EGYA 2GQCA 5DGBA 4RNMA 3G6ES 3RB6A 1HR0F 2EK6A 3OFFA 2BOPA 2FDNA 5KFFA 2ZUGA 3H4BA 2WSFC 3HFKA 3LAMA 2BM0A 4KFBB 3N79A 3IC1A 3FMBA 1IKYA 4E0DA 2YKMA 2CRLA 3R5AA 3UPFA 1E6YB 2KM8B 1Q82T 2M4MA 2ROGA 4PPZA 2W8LA 3ISNC 2RU3A 4W90B 5ITHA 3CC4S 1APSA 3RW7A 3NRBA 4OIXA 1SXLA 1RYSA 1UEUA 1VQ7S 2GCFA 1KVIA 4DG1A 2COLA 2IMWP 4DL2A 4DBQA 5BJRA 2ZZMA 2Y0SD 3PRDA 2AYEA 4ZA1A 3L95X 4QWBA 2BQRA 4DFKA 2FVRA 2HLTA 1NH8A 3QPIA 1HNWF 3K0JA 2XULA 1RISA 4K4YA 4Q7AA 2QO3A 2JEGA 4UY85 1FT8A 4Y00A 1RTDB 4M95A 1KHWA 2MMYA 3K8WA 4K5SA 3T9ZA 4C3LA 5KFTA 4B9UA 1O51A 4PUOA 1FJGF 2LYVA 3CMES 1HWJA 1S1XA 4NLRA 4M5DA 2EBEA 2V4QA 5FIIA 2PC6A 3GV5B 3IWXA 4YB7A 4PRFA 4C8MA 4J37A 2E29A 1Y7PA 3LO3A 4DWIA 4X4VA 3RBEA 1HBOB 1ZM9A 2C3MA 5DM7Q 2LXIA 4ID5A 5B0EA 2EKYA 3MGJA 4ZPDA 4A8OA 2BANB 2RDIA 3F44A 3KG0A 4ZCIA 1RTJA 5GAGU 4JI8F 4YR0A 3HT3A 3DLLQ 3FSIA 2PO4A 4I7FB 2LVWA 3I0SB 4DMZA 2FHJD 5HL7Q 5KT7A 3V4IA 2PMZD 2QEXS 1UAWA 3M8SA 3RYLA 4DEZA 1T05A 3M9MB 4NLWA 4FS1A 3G9CA 1S1TB 2KN4A 2N4DA 3CDBA 4I2PA 3M4XA 4LQ9A 5D77A 4J9NA 4EYHB 4USIA 2HHTA 1P8GA 5E3AA 1OSCA 4RBUA 1UJ4A 2LU2A 2B5JA 3PX0A 3FQLA 1HNVA 1ZTTA 5JUMA 4ED1A 3THPA 3ZC4A 4WZQA 2HQ3A 2HNZB 3OFGA 3OQ2A 4OFZA 3MOZA 3OTOF 3UW1A 4WXOA 3H4DA 3OFEA 3OXGA 1DQAA 5E5NA 2HYIB 4LFBF 4CO2A 2MJNA 2WK4A 5LSRA 4FBTA 2WOMA 3QWUA 5L9NA 1KVJA 2AV5A 2DNYA 2KVIA 4EEYA 5IT9Y 3HJFA 4B9MA 3SCIE 2C3UA 3C6UB 5DJBA 4A4JA 1RT1B 4C98A 2XLKA 1QVFR 5M2RA 2WW8A 3EYZA 4F3QA 1YJNS 2ACYA 4AL6A 1GX5A 3TRGA 2W7PA 4X4PA 1RT2B 4O4GB 1ZOTA 3N01A 3QMQA 3TQ1A 3OPKA 4USJC 1VQ4S 4MFBB 3M8RA 1JLEA 2YKPA 1RQ0A 2HNDB 4NA2A 5A8RA 3KLEB 4JI1F 2EBGA 4KQZA 5IZHA 4V19X 3TR5A 2DHXA 3C6TA 4C97A 2CQCA 4ZPBA 4NZ6A 2R9LA 1H3DA 1J5EF 3P96A 3RU0A 1C1CB 2IRXA 5IM0B 2IC3A 3SSSA 1VFJA 2ZH3A 1F9FA 4PXEA 5E3QA 3DLKA 4DV5F 1VRTA 4AE5A 1U48A 4BDPA 2GGPA 3MMJA 3M30A 4HTJA 2E1CA 1GTEA 2OPSA 2Q3PA 2NPIA 2RMLA 2YWKA 4OZ5A 5KT2A 3TAQA 4ED0A 4PWDA 2R2UA 5IS2A 4ZP8A 1QE1A 3R5CA 1YSJA 3VAMA 1U26A 4KO0B 5KT3A 4JV0A 5A0YB 2JLGA 2R8JA 5EN1A 4XIUA 2DITA 2MZRA 2HGLA 4QQBA 4B08A 5F3ZA 2ZKUA 3AB4B 4RW6B 1DARA 2FVQA 2IYGA 4GO7X 4FPRA 1WF0A 4C3KA 1MROA 3H2LA 2O3DA 1XMQF 2RIJA 1KN6A 3CGIA 5B0FA 1LWFB 2QFJA 4Y3CA 4YUDA 5C25B 3J7ZT 1ZZNA 4RWXA 4LFAF 3WC0A 4IUFA 3M8PA 5JJBA 2XG8A 4CO4A 3MUMP 1JLBA 2L08A 3W7BA 2VG7A 2EG2A 4IFYB 2H9ZA 3TYTA 1YRTA 2DGVA 1M5OC 4EWTA 5D4OA 2FC8A 1CQMA 3IR5B 3O8WA 3POTB 2IJFA 4B3OB 1JKHB 2ZOMA 4C11B 1XN9A 4PCQA 1N88A 5CD4H 5LXRA 4QBUA 2HHSA 2DPIA 2JSXA 3PACA 1R8HA 2GMLA 3BSCA 5MLCV 3BN4A 4QIVA 4WCEQ 4MKAA 1Q78A 1C2PA 4ICLB 3OL6A 1X7VA 2WSEC 5J2MB 4NA3A 3PHEA 3S1TA 3BDPA 3IWLA 3N5FA 5EDWA 3PR4A 3KLFA 3ZZPA 3HXMA 3EGNA 2BQUA 2WRMA 1X8DA 4NL5A 3SSRA 2C3PA 4Q44A 1DZ5A 4PG4A 1GX6A 3M9NB 4DSEA 5EX0A 3OXFA 4OZLA 4EBCA 2YKMB 5DS7A 4NCAA 5DQHA 1D0EA 1FRLA 2F7VA 3HP6A 4A8SA 1HWIA 1KTQA 2Z2LA 2X3GA 1JJ2R 5AXNA 2B3TB 2MQOA 3NMRA 1OQ3A 1SJQA 4QIWD 4IQMA 1TL1B 3MR6A 2OMLA 1V3SA 5JVHQ 2BQ3A 2XS2A 4NLTA 4ECZA 4B3TF 2MZSA 4UUXA 2DBBA 1R89A 4Y2IA 4DG1B 2K1RA 5FD1A 3MTKA 1IM4A 1U6FA 2YKAA 3CCZA 1YBAA 3M6VA 4JV1A 3HDSA 1X5OA 3SXLA 4KIAA 5B0AA 3ENVA 4YOEA 1NEEA 2O1PA 2RE1A 4J9KA 5KG6A 4MKYA 2LXUA 3JSMA 4EO8A 4ECRA 4G3IA 2DNZA 1HMVB 5KFOA 3KK1A 2MQMA 3U1MA 5DRKA 1XBWA 1FDAA 1HWLA 4QJVA 4M5DB 3I5CA 1L3VA 2Z0GA 3VZHA 2EFVA 5B08A 5BYRA 2XMMA 2UUTA 4DOZA 2FVSA 3EX7B 4E8UA 1NZAA 4ID5B 1WHXA 2XGQA 1OPIA 1WNEA 2L9DA 1Q16B 5DETA 4ZLPA 1TK0A 2EFGA 5CXTA 4ILMA 1RTJB 2FJDB 7FD1A 3CJ5A 1EP4A 1VLYA 1EETB 4KV8A 4ES2A 3MEKA 2HHXA 3V4IB 1ZETA 3OV7A 1T05B 4QOTA 2IRYA 5KFKA 1WI8A 2B7BB 2DGXA 2U2FA 4UOCA 2BACA 2XHWA 5CYMB 3T9NA 5B0CA 2AX1A 4I2PB 5CH7B 4RUCA 1S9EA 3OUYA 2JEJA 4ERDA 3CD0A 1PSDA 4WFZA 1HQEB 2MKKA