1VBZA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in ba2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vbzA00
3FEYB 2M9KA 2FPHX 5LSLA 3VAJA 2MHNA 4PKDB 2CQ1A 2DGTA 3J7YU 3OW2R 3NMRA 1KOHA 4ED5A 4ZKAA 4C0OC 2CQBA 2KH9A 3MD3A 1WHXA 1QVGR 2AD9A 3MURP 3MUTP 3IWNC 2PE8A 2DNNA 2DHAA 2DIUA 1NU4A 1U1KA 2Q79A 1A9NB 2CJKA 3HI9A 1U1PA 1O0PA 2MKJA 3ZZZA 1VQNS 2SXLA 1U1MA 2DGQA 4CH0S 3P49B 5HL7Q 5LSOA 1G2EA 2J0QD 2QA4S 2WBRA 2DGVA 5DDPC 4TU9A 1OWXA 2RU3A 2DGXA 2RRAA 2E44A 2GO9A 3ZZYA 5D78A 2KM8B 2O3DA 1HD0A 2U1AA 1U1RA 1U2FA 1Q82T 2D9OA 2MY8A 2RS8A 1K8AT 4ERDA 5EN1A 2DISA 2KHCA 1SJQA 2KU7A 2MKIA 2E5GA 3B4DA 2YH0A 3G4SS 1X4FA 2MPUA 2M4MA 2CPJA 2N82B 4Z2XA 2NLWA 2B0GA 2CPYA 2I38A 2HZCA 2K8GA 4CQ1A 2OSRA 1WF2A 2OTLS 4W90B 3VAIA 2DNQA 2LA6A 1VQ5S 1YJNS 3P5TL 2CQ2A 2LA4A 5IM0A 3R27A 1ZZNA 2NZ4A 5D77A 1FXLA 3ULHA 1U1NA 1X5OA 2E5IA 1PGZA 1S72S 2AYBA 1VQKS 2VOPA 4QU7A 2PEHA 3S8SA 1WG5A 2G0CA 2M7SA 5GMKa 1KOOA 5LXRA 3P3DA 4CH1A 3R1LA 5ITHA 2MJUA 3P6YC 1H6KX 2M8HA 2CPFA 3G96A 1QVFR 2ZJQQ 2DNMA 1FJEB 5GAHU 1X4HA 2KM8C 2RVJA 5GVQA 2MZ1A 3TYTA 2KN4A 5DDRC 3CCVS 1FJCA 3BO3A 5DDOC 2XS7A 1S79A 4LJMA 1M1KT 1FHTA 1X4AA 5LJ3Y 1RK8A 2CQ3A 2HYIB 1PO6A 4PR6A 2RNEA 4C7QA 2LEAA 1WEYA 2MZQA 5IFMA 2KVIA 3CCUS 1VBXA 2LKZA 5LXYA 4IUFA 1VC5A 1YITS 2RT3A 1N88A 2XSFA 1WHWA 3L3CA 1M90T 2I2YA 1U6BA 2MKKA 4IOCQ 1WWHA 3TP2A 2CQIA 2DNOA 2RS2A 4W92B 1JJ4A 1UW4A 5GAEU 3NS6A 4M5DB 2F3JA 1UP1A 4F02A 4YOEA 5IM0B 4A8XA 2XNQA 1JMTA 1M5OC 1H2VZ 2YH1A 5CYJA 2DGOA 2KRBA 5CXTA 1VC0A 4RU2A 1U1OA 2N7CA 2OSQA 4TU7A 1VQ9S 4EGLA 2YWKA 1XN9A 2DHGA 3UD4P 2QEXS 1N54B 3G6ES 2JX2A 2KXFA 2N3LA 3DLLQ 1KD1T 2FC9A 1SJ3P 5DDQC 3IRWP 1JJ2R 2KI2A 1SJFA 2F9DA 1K73T 2FC8A 2LMIA 2MZJA 2DNKA 1DHMA 4Y0FA 3CMAS 3CCJS 1H2TZ 2MQMA 2F9JA 3EGZA 3CC4S 1R8PA 5JVGQ 2XS5A 2CQDA 2EK6A 1SJ4P 1D9AA 1WELA 4IOAQ 2DK2A 3U1LA 3HHNB 1VQ7S 1WF1A 2HGLA 2MKCA 1A7GE 1D8ZA 3H2VE 2MJNA 1SJRA 2XS2A 2LCWA 3NNAA 1WEXA 2XB2D 2ADCA 3Q2SC 3MOJB 2JRSA 2D9PA 2RRBA 1CVJA 2CPDA 1VQ8S 4QQBA 2FY1A 2CQHA 2MQOA 2CQ4A 2CQGA 2CQCA 5DM6Q 3I56S 2CPIA 3G71S 1X4DA 5LJ5Y 2KFYA 2CQ0A 1X4BA 4V19X 2D3OR 1NJIT 4BS2A 2LXIA 1VQOS 2AYGA 1HL6A 2LQ5A 2CPEA 2GHPA 3UCGA 3MXHP 2DNHA 2M2BA 3CCRS 1WF0A 3S6EA 1VQPS 3VAMA 1Q7YT 3J7ZT 2RUGA 5DETA 3LPYA 1NO8A 5CA5A 1M5KC 3BO4A 2DH7A 5IQQA 3CC7S 2DNZA 2MGZB 3Q2TC 1UFWA 2MZSA 4J5OA 3K0JA 2DO0A 2XNRA 4FXVA 2CPZA 1H2UX 1K9MT 2J0SD 2HVZA 1WI6A 2G4BA 4P6QA 2U2FA 2MQPA 2AYMA 3LQVA 3BEGB 3CC2S 2ZJRQ 4C4WA 4F26A 2DIVA 1X4CA 2OIHA 2ADBA 2M8DB 1WG1A 1FJ7A 1YTYA 2DGSA 4TU8A 1OO0B 2MSTA 2EVZA 2UP1A 3US5A 1P1TA 2DNRA 2VONA 3THPA 3CTRA 1YJ9S 1ZH5A 4WKRA 3VAGA 1BY9A 1X5SA 2FHOB 1DZ5A 2KXHA 2MMYA 2X1BA 1B7FA 1ZZFA 2J76E 4U67Q 3CD6S 1HD1A 2A3JA 2MXYA 2N3OA 3BO2A 2MB0B 3U1MA 3JB9k 2DITA 2MQLA 1FT8A 5MLCV 3N9UC 1JJHA 5GADU 2JVRA 4UY8T 4LMZA 4YB1P 2DGUA 1SXLA 2DO4A 2M88A 3CCES 3EGNA 3CCSS 1WHVA 2CQPA 3VAHA 2MKHA 1P27B 3THTA 2JVOA 2JWNA 2MY7A 4OZ0A 3B4MA 3CPWR 1RKJA 2RQ4A 1WTBA 1W2BR 1DRZA 4F25A 4WCEQ 4PRFA 2LYVA 1M5PC 1R8HA 2HGNA 3TO8A 1YIJS 3S7RA 2X1GA 3BS9A 3NS5A 1YJWS 1KC8T 3CCQS 3RW7A 3UE2A 1M5VC 3MUMP 2KT5A 4FXWA 2MQNA 4QPTA 2DNGA 5HO4A 3G8TA 2M70A 1WEZA 1U1QA 4UQTA 3UD3P 2DB1A 2MQQA 2YTCA 1Q86T 2MYFA 2ERRA 1YWXA 3H2UB 3FEXB 3SDEB 5DM7Q 2VOOA 3NNHA 2EK1A 2LEBA 1Q81T 2KG0A 2DH8A 4WIIA 3UWTA 5GAGU 3D2WA 3RW6A 3I55S 2DHSA 3UCZP 2DNPA 2DNYA 3R1HA 3CMES 2HGMA 3CF5Q 3G8SA 3MD1A 2J8AA 1URNA 4WFBQ 2DGWA 4OZ1A 3MDFA 2OTJS 1WHYA 2CPHA 1OPIA 2DHXA 1VQLS 2MSSA 3SXLA 3CXCR 2BOPA 2E5HA 5H1SV 2RQCA 1QM9A 2KXNB 5FJ4A 1U1LA 1VQMS 2E5JA 1WG4A 2MKSA 4YUDA 4WF9Q 3UCUP 1WI8A 2KYXA 2X1FA 2L9WA 1N52B 4IO9Q 2M0GB 1L3KA 1FO1A 1VQ4S 1VBYA 3PIOQ 2L41A 2LXUA 3VAKA 3NNCA 1FNXH 2G1DA 3CUNA 5JVHQ 2M52A 3G9CA 1YHQS 2X1AA 1UAWA 1X5TA 3DXBA 1X4EA 2L08A 2V94A 3MI7X 2MZTA 1AUDA 2MZRA 3CCLS 2KRRA 2OJ3A 4LIRA 2AYEA 3SDEA 4WFNQ 1KQSR 2KG1A 1N8RT 2YKAA 2LECA 4CIOA 3SMZA 2ZJPQ 4Y00A 2QFJA 3VF0B 2VODA 3CULA 1VC6A 1IQTA 1YI2S 1VBZA 1HA1A 2BZ2A 3EX7B 1U6FA 1X4GA 3MUVP 4WFAQ 1DBDA 4QU6A 2K3KA 1X5PA 3PIPQ 2MGZA 1VQ6S 3V4MA 1OIAA 3VAFA 1F9FA 2CPXA 3CCMS 5BJRA 2DNLA 4TLQA 1X0FA 3VALA 3S01A 2DH9A
chains in the Genus database with same CATH superfamily
2V2ZA 4DS4A 3IRXA 1HNVA 4DXLA 4LQ3A 4B9LA 1HBNB 3MPUB 3AA9A 4LF9J 4OYZA 2UXCF 4JYAJ 3FCWA 3SSRA 3ZFVA 2DGTA 1WSRA 5F8IA 4JI4F 2J0WA 4X65F 2I8EA 1CQNA 1VGYA 2HNYB 4KHPJ 2XHCA 2KH9A 1X60A 3MD3A 1WHXA 4H54A 3KJVA 2R2RA 1NSAA 3AD9C 1PYOB 1IM6A 3FUYA 5FLXY 3MURP 3C14A 4P2MA 4Y2KA 3CIZA 4RKUC 2IM0A 4RUAA 3DLBA 4ECYA 3NLCA 4RWXA 4USIA 4X84A 1NU4A 2W7PA 3PV8A 5D3GA 3HF5A 1PJ6A 2BW2A 4EO6A 3RRKA 2ACMA 2EXUA 3M8QB 4RLEA 3G6YA 4RBVA 4CH0S 3P49B 1OMSA 2BX6A 2HQGA 4J90A 4DFMA 3MFHA 1WC1A 3LO3A 5C2GA 1RHQB 3HSGA 2UXBJ 1G2EA 4ES1A 2J0QD 4HI2A 4PQAA 4DV5J 1ZS6A 1PAUB 2XYGB 2DGXA 2GVDA 4EBDA 1MMLA 1IJEB 2W25A 2GO9A 3P96A 4Y2AA 5LMNJ 1UVLA 1CEZA 2VPYB 3UN2A 1HD0A 2Y0SD 3CW2C 2XSJB 4YR0A 4EMDA 2W9CB 2BQUA 1TZ0A 4DR2F 4F4ZA 1Q82T 2DR8A 1DJ0A 3RGIA 2D9OA 2VG5B 4NLRA 3B82A 1Q78A 1VIOA 1ZM9A 2V0NA 4G1QB 4A8SA 1BQMA 3LP0A 3OR2B 2HQ3A 3HSDA 3SBMA 2JLGA 1SJQA 2F4FA 2KU7A 2RAQA 2E5GA 3HFZB 3PX4A 1T9VA 5KFXA 4C0HA 4F67A 3NXZA 3IAS9 5LOQA 4NMXA 4ZIVA 2GQQA 4O3RA 3O2IA 1RHUB 2V4JA 1SH2A 2CPJA 1TFWA 2V67A 4P73A 3BH6B 1QE1A 2NLWA 2EKYA 2NXUA 3KJQB 1QD1A 1WF2A 2Y1RI 4ENOA 5B0BA 2W9CA 2UXBF 1U8SA 2AQ4A 1WKKA 2RDIA 3OBIA 3PW7A 2KVQE 2RUSA 3L95X 2CQ2A 5C24A 2QJ3A 3EPGA 4NXNF 1NDLA 4ZP7A 3UVJB 5DQIA 2KO1A 4NE9C 3KLGB 4ZPDA 4CRJA 4YHHF 3ULHA 1U1NA 3TQEA 1Q5YA 3D7SB 3PCOB 4B3TF 3LP1B 1HW9A 5BYRA 2AYBA 3H25A 2ZDOA 4OYMA 2PEHA 2W9BB 4C8LA 2M7SA 3C19A 3M32A 5GMKa 4X65J 5KT7A 4CNZA 3P3DA 4CH1A 1PKUA 1S49A 4LF9F 5ITHA 4ZVPB 1BMQB 1NPPA 2Z2ZA 3P6YC 3N5FA 2B9XA 4J37A 2ZBPA 1GQEA 3I5BA 3D0HE 4DPUA 4DBQA 2ZJQQ 1IQZA 1IUJA 2ZD1B 4B3RJ 2Y8YA 1JQGA 1T95A 2RVJA 3G86A 4NI2B 4ZCLA 4DX8H 4CLLA 4O0NA 2PMWA 4ZLLA 5BR8J 2DXDA 4QW8A 1HWKA 1S1WB 3LWLA 1VRTA 2KN4A 2ATLA 2F4VF 4LF2A 4X4SA 3EE3A 3I82A 4OIXA 5KFGA 3CCVS 4M95A 1FJCA 2OMLA 2MQ8A 4CI0B 1FDBA 1JNRB 3FBEA 2IMOA 4ITSA 1S79A 4P2XA 3RB3A 4KV8A 4CM0A 4ZHRB 5DG8A 3M05A 3UN3A 4RW6B 5M2PA 5AE3A 2HYIB 2HG4A 1PO6A 1Q79A 4PR6A 3K7RA 4C7QA 1YBUA 2BJ1A 4DV4J 2OEJA 3CCUS 2DYAA 1H7XA 1LWFB 4PYDA 3OV7A 4EI2A 4IUFA 2IM1A 3PRBA 5E3AA 3T41A 2I2YA 1YJVA 1IXKA 2PDAA 2WW4A 1XEZA 2E1AA 4ZDNA 2MKKA 4IOCQ 4LRDA 3PTWA 4I7FB 3U02A 4ECQA 2XGPA 4DPXA 3R6LB 5F8LA 2YKMA 4RBTA 4NCAA 4UOFA 3ZZUA 2J7KA 4RW9A 4Z7YA 5KT5A 3PRDA 4ECVA 3TEGA 2HWIA 2C1EB 4F02A 2F3JA 2FJAB 4URGA 2ZC3A 4P2SA 4DR5F 2VQFF 4KBIA 1HMVB 2OI2A 2RF2B 1BE4A 1LWXA 3CEDA 3I6PA 3IM9A 1DTQA 3GSIA 3O5TB 4AQYJ 3OR1B 4CM2A 2IBKA 2UVUA 4IR1A 3PZPA 4K7QA 1N32J 2DGOA 2V2KA 4ZVQB 2N7CA 2OSQA 4TU7A 2HWHA 1T3NA 1S6QA 2QEXS 3UD4P 4I7FA 3TVZA 2XSJA 1V9OA 1LK7A 1TL7A 2C3OA 3MCMA 2JX2A 4ALZA 4DCJB 5K8MA 1U2RA 3ENWA 3I9V9 4E98A 5IT4A 1HBMA 1KD1T 2PI4A 1RJJA 2FC9A 1VMBA 3TAQA 3ICLA 4DSIA 3V4IA 2P9GA 4KT0C 3RB0A 1LOUA 1SJFA 1VQYA 4R25A 2WB4A 3NGDA 1U1LA 1HNXJ 2B6AB 3IBWA 2OPSB 4Y34A 1DHMA 4Y0FA 3CMAS 3Q86A 2VG6B 3OLAA 1UZHA 1HKAA 2J9DA 3TZYA 1HNIA 1KONA 3T3FA 2AJFE 1XNRF 4A8KA 2LQBA 2DY1A 2E7VA 1XK8A 1IKYA 3M2UA 2CQDA 4M5MA 3UN5A 3KHHA 5CCLA 1R6VA 2H5JB 3HHLD 3OTBA 1WELA 3TA0A 4IOAQ 2AGQA 4RX6A 4CLYA 2DK2A 2A18A 2W7AA 3I4PA 2ZFHA 2IVMA 2JHEA 3OQ2A 4P52A 2E1MC 4N8NA 2HGLA 4ZVFA 2MKCA 3DGPA 3T1YF 1QAJA 4DSJA 1SJRA 3V6KA 2Z56B 2LCWA 3B6BA 1WEXA 1B4SA 2HBZB 4X4RA 2VD3A 4RPFA 4HH0A 5LSRA 2XY5A 3Q2SC 2ADCA 3TR5A 5HQLA 3MOJB 3TNVA 4WP3A 2K1RA 4DV2F 2Z8QA 4U8VA 2QLJB 4PXCA 3T6BA 1NJYA 2Q6CA 1NM2A 4ZITA 3CJ8A 2G2YA 2HAFA 2CJQA 2YNIB 1RAOA 2CQ4A 3MPWA 5KFYA 3BQ1A 2NXEA 5ETRA 2M3DA 3QLHA 4DHVA 5J1EA 2AJ2A 2VL1A 2R3VA 3G71S 3QMQA 2CQ0A 3DLEA 3L4BC 4DL7A 1GEHA 1QY7A 3O44A 5HI7A 3K59A 2ZH8A 5T14A 1JLAB 2WVEA 1RTIB 4CT9A 4XO0A 2D3OR 1EIYB 4WYWA 4K50A 1NJIT 4OX6A 4K2XA 3OUYA 3BSOA 3PX6A 5IT9U 2HAIA 3QBCA 3KKFA 1NBEB 1UW9A 3FQKA 3I5AA 4JI3F 2W8KA 1F0XA 1KS2A 2LQ5A 2CPEA 3Q8UA 1RCXB 1Q16B 4NMLA 1FNOA 1UVJA 5D4PA 1T05A 3HDSA 2VFTA 2O67A 1SL2A 4TY9A 1VRUB 2YNIA 3DM2B 1WF0A 5HMXA 2P9EA 5ETVA 1FJGF 2L3MA 2HIQA 3U27A 4MKAA 1QAIA 4JI5F 1HNWF 1XTZA 1Y3JA 2G2ZA 3IG1B 1IKXB 4FPRA 3HJFA 1Y7PA 2QL5B 4X62F 2W9AA 2O5DA 4P71A 3SFUA 2BKNA 4LVNP 2WAQD 1PBUA 1HR0F 2RQMA 5IQQA 3Q2TC 4RU9A 1RUSA 2VH7A 2XLKA 4J5OA 5JJBA 2YKOA 3K0JA 1DTTA 1IR2A 4I64A 2XCAA 3KOAA 4USVA 4FXVA 3PRVA 2OEMA 5FLXU 1MROB 3K5NA 2Z2LA 4O3PA 1J5OA 4ILRA 4M94A 4USWA 2G4BA 2BJ8A 2VZ9A 1RAGB 1RKIA 2MQPA 2YWGA 3CD5A 4KE5A 2AIRB 2R8IA 4K4ZA 4F3MA 2F7VA 2W7OA 3AQPA 1X4CA 4ELUA 1VJWA 5KFHA 1QAYA 1FRLA 1QUVA 1RWWB 1SC3B 1T03B 1U0HA 4WXWA 4CLTA 2M8DB 1F5AA 2FD2A 4TVAB 2DGSA 4KH1B 4TU8A 2WW8A 3C6TA 5M2UA 5HVFA 2C2EA 1P6TA 2OD6A 1KFSA 1XR7A 4DR3F 1HNZF 3RBDA 2VONA 2IJFA 2WOMB 3WZ0A 1PSDA 1R0AB 3IBCB 2XI3A 3LTOA 2CUYA 4KFBB 4LSLA 3TAMA 3VGSA 2AWZA 4ETXA 3MM7A 6FDRA 3Q23A 1QLNA 5DQGA 3C15A 1X5SA 4A8OA 2LU1A 4RW4B 4ZVSB 2DEIA 4LFAJ 1RWMB 5H9FJ 5A8WB 1DZ5A 2UUAJ 2E9RX 1U2CA 4FYDA 2X1BA 4EO8A 4ZHRA 2Y9HA 4UOHA 5G0RB 1HQUA 1LNQA 1R8CA 2J7WA 3E01A 4U67Q 3R5JB 3WDOA 1FE0A 1NDPA 1RAFB 1FF2A 2A3JA 3QQCD 1FVQA 2HMIB 3QT6A 1B7YB 1RTHB 1RBLA 1W2IA 1M5SA 1A0OB 4OJGA 1NHKL 3VV2B 1FJGJ 5CZVA 2IHR1 2GMJA 2MQLA 1TKXA 1MU2A 2HBQB 1CJUA 4LQ9A 1JJHA 2HSEB 3HFKA 4LRBA 3VZHA 4PG8A 1VIXA 4YY3F 2I5JB 5GADU 3HM9A 2RDJA 1RT7B 1EP4B 3C3LA 4NRUA 4UY8T 2ILYA 4YB1P 2DGUA 2DO4A 4GKJF 1OJ4A 1P9YA 1IM4A 2M88A 4H4KC 5D4NA 2J5AA 1WHVA 4JV0A 1EZZB 4C3MA 5A8RA 3KG0A 2NS1B 4Q7AA 3THTA 4CT8A 4ED2A 2WVCA 2UVVA 3UDVA 2W1BA 4ELVA 3KJVB 1U7LA 3M8RA 1AT1B 5HP1B 1Y5IB 1O6XA 4DFPA 5EGYA 3NKYA 4DS5A 4OZ0A 5HVHA 5I3UA 1RWOB 3CPWR 4GO5X 2XMWA 1U45A 1WTBA 1SKWA 3BYRA 3KYLA 4WCEQ 1HWUA 1TMJA 4ZPTR 1VQSA 5AXNA 4DR1J 4NLQA 2Z57B 1F1BB 1M5PC 4CLZA 5KT3A 2FJBB 4QIFA 4DV2J 2HZVA 1GMUA 3BS9A 2O66A 3MAAB 5J2PB 1YJWS 1UEKA 3V6DA 1BC6A 4KYZA 5KOWA 1R0CB 4PWDA 5B08A 1M5VC 3G82B 3QZ8A 3MUMP 2D3UA 3O1LA 4Y3CA 4FXWA 8AT1B 2DNGA 3OTOJ 5DQHA 1U1QA 4E0DA 2XG8A 4UQTA 4PWUA 1LEOA 3HT0A 4CO3A 4M5NA 2V9WA 3HVRA 2QC3A 4CLFA 2YTCA 4YS2A 2EG2A 2MYFA 1RHRB 2VG5A 3T1HF 1YWXA 3CD0A 3CO9A 3TUJC 1S1XB 2JL9A 4G1QA 7AT1B 2BBEA 3SDEB 3NNHA 3GLJA 3KK3A 2P8IA 3W64A 5HLFB 2KG0A 1S57A 1HI8A 2GAHC 2YQ1A 3UWTA 4WZMA 5H9FK 3NCQA 4DUYJ 4ID5B 4B3TJ 4DR7F 3WC2A 1KEKA 1Y11A 4C3LA 4YHHJ 3RW6A 3M6XA 4B3OB 2FJXA 2DHSA 2DHHA 4DSFA 1FTCA 1N34J 2GVZB 3HCXA 2DNYA 4EFAC 5ETMA 1VK3A 2RHSB 4KIAA 2HGMA 2RSQA 3CF5Q 4F3OA 1LWEA 5ETKA 2WRMA 2UUCF 1U0HB 4CTAA 3ENQA 4OZNA 3WX8A 1URNA 2D69A 4GKJJ 3IGVA 5AE1A 1JXVA 5C5JA 3P8BB 3D0IE 1LWCB 2QL7B 3UD5A 1PIEA 1F5BA 2G9OA 2X3DA 4UF4A 1DURA 2CNKB 2MSSA 5BYSA 1TV6B 4C11A 1FKAF 3FDSA 3CXCR 2E5HA 2YWFA 3MR7A 3GIMA 3I0RA 2X51A 5LMUJ 1TK8A 1UCNA 2DRBA 1QM9A 4K5RA 2KXNB 4OX9J 1LWEB 1T94A 2KYZA 3CULA 5I3QA 5A8WA 4HACB 1VQMS 4KQZA 1TK5A 4IO1A 2KT3A 2MKSA 3BKFA 2VPWB 3K89A 3PYDA 5G0RA 1QTMA 2QMXA 3UCUP 1RT5A 5J2MB 2HNYA 1NKCA 2O01C 2ZD1A 2KYXA 2HHSA 1EJ7L 4FF4A 3KJNB 2OGUA 1N52B 3R97A 2DPIA 2M0GB 3QJJA 1AFIA 2E7XA 3H98A 5KFTA 3CNQP 3RYLA 4DL2A 2R7SA 1IBCB 1ZPVA 2D74B 3BBCA 3LAKA 3HMJG 3PO4A 1HYSB 1KLNA 3PYGA 3BPDA 3BR9A 3RG6A 3PYEA 3ZTPA 1EP4A 1NK6A 4I6YA 8RUCA 2HNZA 5A76A 2OLWA 2DJWA 2BM0A 4ICLB 4M63A 1JLQB 2OUGA 4IH6A 5IV4A 4USTA 2JLFA 3CCZA 1ITPA 3MI7X 4KGMA 3CIMA 2MZRA 4FYXB 2HQCA 5L8RC 2VQEJ 1C0UA 5E2QA 1AUDA 2OFHX 2BE2B 4CZCA 4U7CA 2GVDB 2KRRA 2VG7A 3SSQA 2XO6A 4L75A 5F41A 1QSSA 5KG1A 4FXDA 1KQSR 1PJ7A 3Q8PB 3MMJA 2C2MB 2YKAA 1TL5A 3A13A 2WVFA 4AFFA 2QRRA 2YPZA 2LECA 2FVSA 1FDDA 3N79A 4FS1A 2IA0A 3DRPA 4Y00A 2YPYA 5D15A 3MECA 1B70B 4RNMA 2FLLA 3L7UA 2CVEA 3GSDA 1YI2S 1IQTA 5CAAA 2A6MA 3HP6A 4ZP8A 4ETZA 1KKHA 3F56A 2OHDA 2QO3A 3EM1A 2IRUA 3HVTA 2VKZG 4NLXA 5AJ3J 4ZCMA 5A2QU 1IBKF 2NXJA 4WFAQ 4M5JA 5CZXA 4QU6A 4DLGA 1WDTA 1X5PA 1LW2A 2H5EA 3EDRB 2Y1JA 3GE9A 4LRFA 1VJQA 1S1UA 1S0VA 3F44A 2DNLA 3ILLA 5HBMB 3A3OB 4FKYA 1NH7A 4N5SA 2R8GA 4B3MJ 4DUZF 1X0FA 5LT5A 3MM6B 3QIPA 3RBEA 3S01A 1ACMB 1XERA 4IFYB 5LSLA 3ZC4A 4HYKA 3IR5B 5IC4B 2MHNA 2CQ1A 2K7KA 3MTKA 3OW2R 4B9UA 3NMRA 2LDYA 3M6WA 3TX0A 2C2RA 4ZKAA 1FVSA 1QJHA 5KOXA 1TELA 2ZZMA 2CQBA 3ITHA 4WK1A 3CJ3A 2QIFA 2DY9A 1BQNA 3DMJB 4BWMA 3W61A 4NCBA 2QLXA 1J27A 2PE8A 3VCDA 2YX4A 4JV5J 1QUPA 4K4SA 3D6HB 2KFZA 4O4GA 1IKYB 2W9BA 1S0NA 4EZ6A 2UUBF 1C1BB 3GFXA 1O0PA 2XY6A 1FKPA 2BANA 1VQNS 3W5YA 1U1MA 1FKOA 3M6VA 2DGQA 1WC0A 4CTAB 4FYVB 1CLFA 5K14A 4MJKA 4WP8A 4XK8C 4ZA1A 1LKZA 5LSOA 3UDLA 1KP6A 4FYWB 1SB6A 5KFMA 1ZTWA 3L7PA 1VLYA 2DGVA 3DGPB 1N0UA 2G13A 4TU9A 2Q6BA 5KT4A 2RU3A 4H4OA 3NS7B 1S76D 2E44A 1FFSB 1UL3A 4CYUA 3ZZYA 4O44A 5D78A 1S1WA 3M2RB 4O3NA 4OYIA 2BJ7A 2AP6A 2CZ9A 1N5QA 1QSYA 3KWMA 5KG0A 1U2FA 2GS8A 4USMA 1KVIA 3HSJA 2MY8A 2RS8A 1K8AT 4JP8A 3W63A 1CJTB 2DISA 3DLGA 5KTQA 1Z2ZA 2OPRB 4UZBA 5D0EA 2CYYA 4OJHA 3JAMY 4LF4J 4KKOA 3VQTA 3B4DA 3N28A 4F04B 2J6UA 3G4SS 1RU2A 2XY7A 1X4FA 3NP5A 2M4MA 3P5BP 3ILOA 4GO7X 4IQXA 3IP0A 2CVIA 4IG3B 1I1GA 2N82B 2ZZNA 4JYAF 5IWAJ 2OTLS 2UXCJ 2K8GA 1WC3A 4MYUA 1H0HB 1BUXA 4K4YA 3UR3C 2XCPA 3M8WA 3WIVA 1UFKA 1CJTA 3DLGB 4CNYA 2HFVA 1FEHA 2FHKA 3FSYA 2XMVA 4JI6F 1YSJA 2CWXA 1XIQA 2LFVA 3CO0P 1OYDA 5D77A 2AGOA 2VDIA 2ZEJA 1IKXA 2ACYA 2BE2A 1X5OA 2E5IA 1JWWA 4Y6IA 2VOPA 1ZAVA 3DRSB 3GJRB 2KDOA 5L1LA 2KZMA 3S8SA 1UJ4A 1QTNB 1WG5A 3JTPA 5H9EK 2VB6A 2W2OP 1DTTB 4ANDA 1OYEA 1FWKA 4TY8A 1FI4A 5B0EA 3OFHA 4HVZA 2B6AA 5D0HA 4AXJA 3IA0A 4F4AA 4P74A 2VG6A 3HLUA 2UU9F 1B99A 3A3NB 2PMHA 1FK9B 5L39A 5KFLA 2OKQA 1S1TA 1G3OA 2W01A 3M8PA 4MKBA 4DCOB 4BHQA 2DNMA 3EX7B 1FJEB 1VQLS 1N56A 5IXUA 1QVFR 4OJ1A 1SKRA 5GVQA 3I0SA 1H72C 1Y00A 3E8OA 3TYTA 3BB5A 4NLSA 5DDRC 1LK5A 2XTJP 3DRSA 3OTCA 3PHEA 1TUGB 2B3TB 2IFXA 2P6TA 5L9XA 2B4OA 2R7WA 1ZETA 1FX2A 1RI7A 2HVHA 1S4FA 1LFPA 1MN9A 3DGVA 1FTRA 1M1KT 2XS7A 3HSZA 2CA9A 2HK2A 1L3TA 2ASLA 3SIPB 5LJ3Y 2GHVC 4K59A 5IWAF 4LF5J 1JXEA 4NOHA 2ZH9A 4LSLB 3TAMB 4B3SF 3AD7C 4JI1F 1RAAB 3VGTA 1HWLA 3GFYA 5F0WA 2IAJA 1VBXA 1I51B 3AOBA 2MDAA 1HI1A 2RT3A 1N88A 3CDWA 3QGGA 1YITS 4R0JA 1M90T 1I3OB 4ECRA 4Q8FA 1WUUA 2QGFB 3HULA 2HFNA 4CO2A 5J1PA 5DLFA 1AZSA 1Y5NB 1NHVA 5HMZA 5GAEU 3H40A 4NZ6A 4W92B 1FKPB 2W2MP 1VYAA 1ZAXA 2GQCA 3DYAA 4Q8EA 2I6WA 3AJDA 3NCPA 4UUWA 5KFKA 5IM0B 4FS2A 3S1TA 3BBBA 2A10A 2B4PA 4WE1A 2IVFB 1VBKA 4NZ7A 1DY3A 5EX3A 3DOMA 1RT6B 4WTYA 5K8PA 3TUZC 4LF7F 1AXQA 1VISA 1HFEL 3QJLA 4ILMA 4UY85 1HBOB 3OVSA 4RU2A 1TQLA 4LF5F 5F8JA 1CJKA 4L76A 2EFPA 4R8UA 1V3SA 2YWKA 4ZS6A 3X1LB 1SV5B 1XN9A 5F3TA 1JIHA 3M2RA 4DEZA 3GIJA 4QWAA 4OYBA 4DMZA 1IBMF 3JS9A 1DQAA 2KJWA 4NEZA 2F8EX 3TZZA 1ELOA 4KTQA 3DLLQ 3NGUA 3MAHA 5L1JA 4O3SA 3DYAB 1T8EA 5DDQC 2V4RA 1RWPB 1W7WA 1HLWA 2GIRA 2KI2A 2HHHJ 3SZ2A 1K73T 5I42B 2FC8A 5EWGA 4JV5F 5LMUF 1XNQF 4FNIA 1UJ6A 2MZJA 3W9HA 1RA6A 3ZNJ1 4Q0BB 3IG1A 5D6GA 1H2TZ 5EDWA 3DI6B 3MMCA 2FYXA 3CC4S 2R7TA 1R8PA 3VHQA 4P10A 2G1HA 5JVGQ 1WNEA 3RB6A 2C3UA 2WCXA 5C42A 2EK6A 4I1TA 1IWGA 3NWGA 3KHRA 4X64J 1SJ4P 2J6SA 4OL8A 1RABB 2AEFA 3FFIB 1RE1B 3G2XA 4N77A 3W60A 5HMYA 1SL0A 4LFCF 4PQUA 1FRJA 3D5MA 1MROA 4AUKA 4ECUA 1J5OB 1GH8A 2IBOA 2EC2A 5ETPA 3HHNB 5B09A 3QAEA 1VQ7S 1RQ0A 1WF1A 2IC3A 1S9FA 3RU0A 5A2QY 1RT1B 2MJNA 2PD1A 3EXYA 3PVXA 3X3UA 2OAUA 3NOCA 3FK4A 4X4PA 2WONB 2XS2A 3V2UC 3TZWA 1TL1B 2ZOGA 1VOMA 2WZ1A 3CDBA 3SQGA 3PJWA 3WQPA 4ED7A 2PA8D 3QRQA 2HHQA 2RRBA 1IBKJ 2CPDA 1BQXA 1S1XA 1GXUA 2QL9B 2WOMA 4DV6F 4DV7J 2AJ1A 4ZVRB 2NXCA 2XYHB 1N0VC 4OMFG 3A4TA 3IGNA 2WK4A 1Y9OA 1ZOTA 3A8EA 5DZ7A 1S0OA 3R5GA 3DOKA 4Q43A 1N5SA 5DM6Q 2GNKA 3GQCA 4LRAA 3CCWA 1X4DA 2LVWA 1GMWA 2HS4A 3HX9A 1X4BA 1DLOB 3WC0A 4A46A 3IRXB 2HEKA 1N5TA 1FFGB 1RTZA 3H2LA 4LBIA 4DCPB 2GVZA 1RT1A 3KTQA 4BS2A 3OFEA 2C2DA 2VQEF 1RACB 3BQ0A 1T0TV 4F0MA 3EPIA 3R2DJ 5DO2A 3SQGB 4X4TA 3KJFB 4UOCA 3MWBA 3UCGA 3PW2A 1NKBA 2AEMA 2DNHA 4HHUA 2HZAA 1FERA 1J5EF 1LWCA 2ZH2A 2HVIA 1U24A 3DOKB 5D3GB 2DRAA 1VQPS 3HHKA 2XMMA 1FNMA 2I5JA 3J7ZT 2LQJA 3JQKA 3JSYA 3A3PB 5SUHA 5ETOA 2H5IB 3GYXB 4RO0A 3O8WA 3BH7B 2D7SA 2OEKA 3OVBA 4EZ9A 1FE4A 3NGRA 4HH1A 5A8RB 5C7PA 3SV3A 3BO4A 2ASDA 1FD8A 2DH7A 4FVCA 8ATCB 4M5IA 2OO4A 4DX5A 4ED4A 5HN0A 4YFUA 2MZSA 4YR2A 2MGZB 4FBUA 2ABYA 4ZN3A 5KFNA 1GTHA 4U7UD 1Q4RA 1BXNA 3G8QA 2CPZA 1H2UX 2HPUA 1KTVA 3IMQJ 3M2VA 4KHMA 1K9MT 2J0SD 2UV8G 5J2MA 1YBAA 1PC5A 4G6VB 3MEDB 4I6WA 5U47A 4IRCA 1G1XA 4MMOA 4P6QA 4YY3J 2WSFC 2ASYA 2E1RA 4AT1B 5B7WA 1LXNA 5HSPA 2FJDB 1RWXB 4OQJA 5KFRA 4F26A 2DIVA 3NGTA 4J9UE 4RW8A 1HYSA 2E29A 3ENVA 3OL8A 5B0CA 5EWEA 2J7UA 1RHMB 1SV5A 1WG1A 3FEZA 3D28A 4Y65A 3BQ2A 1XMOF 2R7UA 1PBAA 2Q1LA 3LUYA 1TTHB 1HWIA 2ZITA 3C6UB 2QZ8A 2YX1A 5KFBA 4IYQA 1N48A 3HO1A 3DKDA 2P9CA 3TUPA 2MSTA 2UP1A 4LUBA 2ZE2B 1KHWA 1X7VA 2YNHA 2RRNA 4OV1A 2DNRA 2LDIA 2WHOA 1WKLA 3LF0A 4DSEA 4C9DA 1APSA 2NR0A 1YJ9S 2W2NP 2BV3A 4OX8A 4RR5A 1GAOA 2R2SA 1N34F 1M1HA 5D8HB 2HW3A 3K5PA 4FYYB 1IKVB 1JB0C 3F0NA 4PXBA 4DX7A 3CD7A 4DR7J 3KHGA 4DG1A 5B0FA 2ZBQA 5CYQB 1CULB 1RXOB 2MMYA 1N5YA 2FLPA 2H1YA 5E7OB 1UMJA 5D4OA 4HT7A 2PMZD 5C42B 1IBMJ 4CLUA 3KK1B 1ZZFA 2E5LJ 1K47A 3OFFA 1H3DA 1RHKB 2MXYA 3BKUA 2DT9A 1NZAA 3IO1A 4MTPA 2WBMA 3VVUA 4DPTA 3H5YA 2MB0B 4HHJA 1E6YA 3KXDA 3IN5A 2C3PA 4R5PA 4MK8A 1ZYQA 4JI0J 3D1QA 1U02A 3N9UC 2QLWA 1RB0A 1IWAA 3OTOF 4HR2A 4NLDA 3BSAA 3MF5A 3ZO7A 1D09B 3R6GB 1TL1A 5KFOA 1FXDA 1SXLA 3MOZA 4I69A 1V5VA 2IIHA 2G0JA 3M8ZA 2ROGA 4C8YA 3MPYA 3PM9A 2BJDA 4OV6A 3C14B 3JSBA 1B3TA 1KQGB 1UEVA 3H20A 3TVYA 3CGIA 4YB6A 1ZAWA 3H0PA 5DGAA 4DR1F 1F2GA 1MWQA 2RHQB 4DU8A 1HR0J 3PY8A 4X62J 4C11B 3K5MA 4JI1J 3IR6B 3MM5A 3PFEA 2CRLA 2PT0A 3LOUA 1RKJA 1S99A 5F9LA 1DRZA 1W2BR 5KT2A 3GZ7A 3MMBA 4PRFA 4EK2A 5KFCA 2LYVA 1R8HA 4WZQA 4USHA 1S7IA 2OPPA 1NMEB 3OPKA 2X1GA 2KJVA 2D3O1 3PW4A 3G87A 1KC8T 4QJVA 1U26A 5RUBA 3KLEA 4Z37A 1YRTA 3K17A 3D6TB 4OZJA 3GJSB 2J0XA 1C4AA 3UE2A 1RT5B 1VI7A 4ED1A 2FTRA 1EARA 1I5OB 1IJFB 3CDEA 2ATCB 3DNCA 1UEUA 2YWEA 1B0PA 2AKWB 4LREA 4OHWA 1VR6A 1Y0HA 2VFSA 5F8HA 1EHWA 5HATA 5KG5A 4LF1A 3OR2A 4ICLA 2MQQA 2KFNA 2AJ0A 2YKNA 1Q86T 2DBBA 3W8GA 2IYGA 5JXSA 2PO4A 2GJIA 3K58A 4DF8A 3CT9A 4U96A 4WIQA 2VICA 3I4HX 2F1FA 3MR3A 3QGPA 3GV5B 2VOOA 2JEGA 2UUAF 5L1KA 4LFAF 1VFJA 1SH3A 1WOSA 2B51A 2BA9A 4ZOSA 3W2VB 2A6OA 4LF8F 2P5VA 4X4VA 3KDNA 3MEDA 5DG9A 2FZKB 5GAGU 3QYYA 5CH7B 4N7TA 3D2WA 2JH3A 2YKPA 3DRPB 4KJIA 2V5HG 1EX8A 4JI6J 4WFYA 2W2QP 4MAKA 2IJRA 1YX2A 3CMES 5IS2A 4AXIA 4IRKA 3MD1A 5AXMA 3SEOA 2J8AA 4YDXA 4FNHA 2WB1D 2AJQA 4RUCA 1REVA 2CNOB 2EWHA 4X4UA 2C2OB 2R9LA 1WHYA 1SUQB 4NLPA 2FVCA 2HVEA 5KFWA 1HW8A 1TL3A 2IDEA 2YNHB 4C0BA 1OPIA 2DHXA 2NYIA 1HHTP 4DL4A 2XI2A 3MEEB 2QN6B 1S1VB 2FHJD 3MM6A 2VU5A 3BF4A 3GG0A 3AODA 3QIPB 4KPCA 4OYPA 4ZPAA 2R7XA 4CDIA 4ZVGA 5D4LA 2FY8A 4DF4A 2HFSA 4NYOA 5AE2A 1IKVA 1FFWB 4ZP9A 3NBPA 3GIIA 3ZZOA 4Q2LA 1FRMA 2A2CA 3N6NA 4M8LA 5CHCB 5CYQA 2A0FB 2E5JA 3EWGA 1REVB 2XWYA 5IT0A 2DXEA 4OHZA 2ZUGA 3VGUA 4L72B 3IBFB 1LV5A 1TUVA 1V5IB 2YX7A 3OXGA 3DMJA 4TKTA 2P6SA 1C1BA 4XPEA 1S1VA 1NK4A 2L9WA 2C28A 3WIUA 4I56A 4F4KA 2B4VA 1AROP 1SJ1A 1VQ4S 4WXOA 1CSJA 1VBYA 4JI5J 2XYPB 1RT4B 3MPDA 4CLWA 4ANEA 5J1EB 3I9ZA 2VBWA 3PIOQ 2L41A 1NPKA 2NCKL 2VPXB 3VAKA 1Y3KA 2QLFB 3FMBA 1GTEA 2BACA 2VQFJ 3CUNA 4Q5VA 1JLGA 5JVHQ 1GMVA 1U0SA 4RNFA 2HHXA 2R7OA 3K8VA 4J9LA 4CLPA 3HZGA 1IVZA 1ULRA 3ZNUA 3EJMA 3JYTB 4JI3J 2V94A 4N76A 2R7QA 2AV5A 1S9GA 3M30A 2IAJB 1RWVB 2HFOA 4H4OB 4NLTA 1AYEA 4RW9B 1U47A 3BN7A 3OHAA 4O44B 4J9MA 2UU9J 2VFRA 3FCHA 1TL4A 4ED8A 4NA1A 4WYLA 2ZJPQ 3T9ZA 4OHYA 2WVBA 3OR1A 2BE7D 2X7IA 3QO9A 4WFZA 5DGBA 4MT1A 3HHLB 9ATCB 3DRXA 4MKYA 3W3SA 3GR1A 4B3MF 1CG2A 2FHJA 1S6QB 3UFCX 2CDRB 3M9OB 4IG3A 1DBDA 3BKTA 4HDHA 3JYTA 4J9QA 1UVMA 4OYAA 1VQ6S 3VWSA 2H4YB 1WSVA 2FUG9 1OIAA 4O3QA 2JC0A 1F9HA 2B5JA 1SI9A 2VBYA 5FDLA 2CZVC 3E3XA 2CPXA 3MM9B 1JLCB 2CWKA 3CDAA 3ZZPA 3CJTA 3ISND 4AD6A 3G6XA 3UDCA 4N41A 2CG4A 2FZCB 4GKKJ 2XMUA 3MEKA 2BW7A 5F8GA 1X9MA 4IRDA 2ZBIA 1R8BA 3LP2A 1NCLA 3MPVA 4EWTA 3HHLA 2YNGB 3EZOA 4PKDB 4DV1F 3J7YU 1C0TB 1RGVA 2JLEA 4JI8J 1KOHA 4ED5A 3GB0A 4PCQA 5CABA 1GX6A 2B43A 1HQ2A 1F9EB 3H8YA 5HP1A 4ED0A 4A8MP 1NK8A 3TA1A 2AD9A 3T19A 5C25A 2HVDA 4I4BA 4FBTA 3I31A 3ET6A 1VS3A 4C8ZA 1WC5A 4HLBA 3PKYA 2V9KA 4A8QA 1D9FA 3HI9A 1A9NB 2MKJA 3ZZZA 3RRHA 3PKMA 2BKPA 4I6AA 2HHTA 1CBKA 5CQGA 3C15B 4C3KA 4PG6A 1XR5A 4J91A 1N33F 4DL5A 1NKEA 1EKRA 1FK9A 1R27B 2HURA 2YNFA 4RW7B 4WU3A 1M0SA 1SUQA 2QA4S 2WBRA 1NZ8A 2B8QA 3AJ1A 1OWXA 2GX8A 2P2CB 3W2WA 4DZ6A 2F5GA 2EFQA 3CWJA 2X3GA 3PX0A 3PO5A 2YXLA 1FDAA 3NG8A 1HQUB 4L3NA 2WONA 1MLAA 3W5ZA 1SC6A 2KM8B 1PAEX 4AQYF 5L46A 2BJ9A 1U1RA 2V69A 2GCFA 1XMQF 3WX4A 1T9YA 2GJFA 2W2PP 1ROFA 1F2HA 2EW9A 4QIVA 3RBXA 5A8KA 2ZH4A 4ERDA 5EN1A 1Q5VA 5L38A 4TQSA 1L5UA 1VK8A 3PJ9A 4MFBB 4K2JA 4OZLA 5IOLA 1L3SA 4ZJLA 1RAEB 3TWZA 5K8NA 4DR2J 1E6VA 2IMWP 1KVKA 1RZMA 2YH0A 4KH0B 4NLYA 4EUVA 1X9SA 3HT3A 3W9JA 1UVIA 3C16A 1MWYA 1YJUA 3P45B 1AZSB 2QSWA 1RT3B 2CDQA 3MHYA 3MMAA 3PHTA 4ED6A 1Q53A 4CP5A 4DV4F 1REGX 3GV7B 3CVKA 2OSRA 3ELHA 2B0GA 2CPYA 4DV5F 2AF6A 3EDQB 3QT8A 3RUBL 1SBRA 3VAIA 4DPYA 1BD6A 2LA6A 1WD6A 2HBRB 3DLKA 1RT6A 2UUWA 1N33J 5HAOA 2XMJA 1Z1ZA 4C97A 2LXFA 2QA4G 4ZIWA 5IM0A 1VCTA 2RE1A 1CJKB 2GGPA 2ALYB 3QGIA 4FVMA 4XAKA 1ZZNA 2DPJA 2AJ4A 2YQ0A 4B9NA 3LGNA 3DOMB 3OXLA 2C22A 3MAAA 1HIYA 2F40A 4QIEA 4DUYF 1PGZA 3R7NB 3U1NA 4FF1A 4C8NA 4PWDB 2RMLA 3DRRA 3EICA 2BQ3A 4OI6A 3ZTRA 2AZ3A 2IRYA 4A47A 1NB2A 2QX0A 2PI5A 4JI8F 1NK0A 1CS4A 3MTJA 5AXKA 4WPAA 5IQ6A 2N4DA 4DN0A 4ZPVR 2FGCA 1JLFA 2HKEA 5LXRA 3OJUA 3R1LA 2IA6A 2MJUA 2PN6A 3OL6A 5HMWA 4NLWA 5JMNA 4HI1A 4HDGA 1H6KX 3GJQB 2M8HA 4J7CA 3Q8SB 3G96A 2G0IA 1RP5A 1HQEA 2KKHA 1FXRA 2MKYA 5KG6A 2AX1A 4OFZA 3UI3A 2VHGA 2DR5A 4NX9A 1X4HA 3UNYA 1Q8BA 3FBCA 2KM8C 3ISZA 3R8YA 1C4CA 5BYQA 3VVTA 2MZ1A 3OL9A 1WC6A 1WACA 3D6FB 4RNOA 4ZVUB 4AL6A 4IR9A 3H7HB 3A12A 3D54A 3K2YA 1S59A 4ZJQA 3T5KA 4NXNJ 3FZ2A 2XO7A 2IC3B 3SCLE 2V2QA 2KHDA 1JLFB 4U9RA 3BSCA 2F65A 2BRLA 4BC7A 1LFWA 2QYCA 3NOGA 4OLPA 1RK8A 2CQ3A 3FJ2A 1XQIA 2W8LA 4QYRA 1Q0NA 1QAXA 2EFVA 1HNVB 2LEAA 5IFMA 2GMLA 1HBNA 1WKJA 2LKZA 4W98A 5LXYA 4ZCIA 3L3CA 3T5HA 1WHWA 1U6BA 4O4RA 3FC9A 2B9EA 2VF3A 1YJRA 1R8AA 2IYIA 5C25B 4H4MA 2F63A 1XBWA 2BEFA 4QYZK 2Q3PA 1S5ZA 2CQIA 1Q1KA 1RISA 1RTHA 4OI4A 2DNOA 2DXFA 1DLOA 2HRUA 1UW4A 4OX9F 3MEGA 3HKZD 4CLSA 3NS6A 3V81A 4ILLA 1NEEA 3B8HA 1MNEA 3CDUA 4A8XA 2O1PA 5K5MA 3M9NB 4DR4J 1JMTA 3FZBA 1R0BG 3KLHB 3RZAA 3ZTQA 1JLBA 2KL8A 5CYJA 1SQFA 4Q45A 5LMNF 4O3OA 4I67A 4C2MA 5CXTA 3IXQA 1VC0A 4UZCA 1MMDA 4EGLA 1UPPA 2XMTA 4NEYA 3Q8VA 3L09A 4C8MA 1XC9A 7FD1A 1IBLJ 4LFBF 1DQ9A 3SCKE 3AFGA 1N54B 2UUCJ 2N3LA 5A0YB 3SCJE 2Y1LB 4KFBA 1PYSB 2GZOA 2VC0A 4RL1A 1SJ3P 3PR4A 1JXLA 1N4LA 1NXIA 4Y2MA 3J7A1 3IRWP 2OP5A 4USKA 2RD5C 3AT1B 2F9DA 3KLHA 2HNZB 3N0VA 5FD1A 1P1LA 4DN9A 3D3CJ 2Q43A 2MQMA 2GJ2A 2UV8A 1H7WA 1UZDA 1OY9A 2F9JA 5E3CA 1UA0A 3MMAB 4DR3J 3EGZA 1DAXA 2GW8A 4QWDA 1SC4B 3BYPA 2XS5A 2WSCC 1KQKA 4DWIA 1BHNA 4DV1J 4JI7J 4F50A 3RJMB 4W4MA 4NLUA 1CJVA 4UQGA 3LA0A 4LR9A 1RCOB 5I3PA 3R9LA 3U1LA 3R3TA 3CSKA 5KG2A 4S0MA 3BDPA 3MM8A 2HLTA 2NSBA 3M8QA 4YB5A 3IR7B 3H2VE 4BWJA 2RIJA 4ZK7M 1ICEB 3NNAA 5HLFA 1ZTTA 1MMNA 2Y0BB 3MFIA 4DQPA 2ZE2A 5C2CA 3O3LA 1L3VA 4QWEA 2ROEA 2JRSA 2D9PA 1CVJA 2GA7A 1SVDA 2W4DA 4QR0A 4DSKA 3F73A 1VQ8S 5EHHA 2DR9A 3ETMA 4B3OA 2CQHA 9RUBA 1DFDA 2MQOA 1KVJA 3GYGA 4TN2A 5F3ZA 3QAUA 2EPIA 2CQGA 4HL9A 2HQFA 2CPIA 2MLXA 1TUWA 5LJ5Y 5MAOA 3QSYB 2BXJA 3D1OA 1EAYC 5KFVA 3ZZRA 4JUZA 4ZVHA 5EWFA 2CZ4A 3QJPA 1BQMB 3LP0B 1SC1B 1VHIA 4K0KF 4RUHA 3SI8A 1I94J 3CJSA 4K8RA 3KLVA 4UW2A 2AYGA 2UZAA 1EQMA 3CJ2A 1X9WA 1K0TA 1HL6A 3H4DA 4ZPCA 4CO4A 2Z30B 2VBZA 5HANA 3MXHP 3DFEA 4DUTA 2V50A 2RDDA 2EC0A 1AW0A 3MCNA 4ATNA 1OSDA 3CCRS 4O4GB 1AA1B 3DC2A 1SPBP 4IQMA 1I94F 4F0KA 3VAMA 4M5LA 1WC4A 3LPYA 5KFDA 5HQMA 5HROB 4F4XA 1YGYA 4OI2A 2EI5A 1TMMA 2HS3A 3DDNA 3AB2B 3QGHA 3GCXP 2UUTA 3KDOA 4QIGA 3VTIA 3UVJA 2ZM6J 3EXCX 4DQSA 1YJ7A 1M5KC 3EVOA 1NJXA 2V8VA 3KLGA 2DCUB 4KC5A 3EZ5A 2F8MA 3W8PA 1UFWA 3CJKA 2DO0A 2AZ1A 1S9EA 4DSLA 2BYCA 1AFJA 2ZKUA 1W26A 2YVSA 4X66F 1ZPWX 3AH6A 2IJNA 1NAQA 1WI6A 3FKBA 3H90A 3E51A 2YKMB 4H4KA 3R7SB 2U2FA 1Z4UA 3LQVA 3BEGB 3MM5B 4OJ3A 4C4WA 1YDLA 2IVYA 3LW5C 2VV5A 3CJQA 3IFEA 1HMVA 2RF2A 4ID8A 4QPXA 4U6PA 2ZH6A 2OIHA 4F2SA 4DV3J 2ADBA 1KRPA 3A8KA 3PACA 1FJ7A 1C0UB 1U6ZA 2EEYA 3AJ2A 4IKAA 4TYBA 3D3BJ 1YTYA 2BDPA 4NI2A 1HARA 3OVAA 3KK2B 1T9XA 3QNWB 3SCIE 4KGVB 2H3EB 5JUMA 4ZVOB 4G65A 3TVKA 1P1TA 1VRTB 2BJEA 4ANCA 2MTLA 3OSNA 3KK2A 2EFGA 2YKNB 3CTRA 3DLJA 4LVOP 1ZH5A 1YKWA 5DLGA 1HNXF 3MECB 2OELA 1FRKA 4WKRA 2XQCA 3FNNA 3IWXA 2XZDB 4OHVA 4X66J 3FRZA 1KLMB 4AE5A 2FHOB 4AL7A 3RRGA 2KZZA 4A8YA 1WOOA 3KNAA 5T41A 3SQOP 4A48A 3I32A 1B7FA 2EKNA 2NSCA 1LWFA 2ZH5A 2QFIA 2DEJA 4KO0A 4OLOA 2J76E 3EVMA 3TANA 1CJVB 1HD1A 3KNGA 4M5DA 4PYAA 4MH8A 3W2VA 2PFDA 2N3OA 3BO2A 1HNWJ 3ILIA 1EETA 1RSCA 3U1MA 4BC9A 2K7JA 5HQ8A 3C2PA 2DITA 4DR4F 2ZUAA 1RU1A 3V5RA 2ZHAA 2HK3A 1PC4A 4ECXA 1CPZA 1Y4ZB 2BABA 2MEWA 2FGOA 1S6PA 1KLMA 4QBUA 4LMZA 4DJBA 1TL3B 5D0GA 4I68A 4B02A 4LF6F 3EGNA 3CCSS 1G7CB 3NCRA 2CQPA 2VG7B 2MKHA 5KFJA 1LXJA 2BM1A 2R42A 2YQ3A 3PDNA 3ZXWA 4Q44A 3PW5A 2BQRA 1QE1B 4DQIA 1Q8KA 1LQ9A 1RYRA 1JLEB 2JVOA 2JWNA 2MY7A 2VUGA 2JNJA 5SZTA 4YR3A 1XJWB 4M5HA 4DZDA 1O51A 1HBMB 1K0VA 3POTB 1FWPA 1O5JA 5D0RA 7FDRA 2RQ4A 2LEPA 1OQ3A 4EEYA 4F25A 2AHOB 3HVTB 3Q83A 4IOBA 1IKWA 4MK7A 4JOUA 4BDPA 5I4MA 2HGNA 2JFDA 4OI3A 3TO8A 3Q8RB 1YIJS 3S7RA 2OPSA 2GFFA 5K9FA 3NS5A 5J2QA 1J5EJ 1OSCA 3AQOA 2FVPA 3LH2S 1H98A 3NAIA 3RW7A 2ZH1A 4F4WA 3FSIA 4ECWA 3GIKA 2R7RA 2I0XA 4RW7A 3CJ5A 4PG5A 4ZLJA 1KHVA 1OQ6A 5HBMA 3LWMA 1RAIB 2KT5A 1S7HA 5T7LB 1VHFA 2MQNA 4QPTA 1SH0A 5HO4A 3G8TA 2M70A 1WEZA 3T1YJ 4B3RF 4KSEB 5HROA 2DB1A 3UPFA 2OPRA 3ADAC 1U8WA 1SKUB 2RILA 3BR8A 2Y3YA 3TZXA 3MR6A 1M1GA 2V4QA 3RTVA 3BGLA 4KKOB 4JI7F 2ERRA 1TR0A 2QG9B 2C42A 3R5AA 4OHXA 2YWWA 5A8KB 3GPAA 1XNRJ 4UOGA 1OY6A 2HRYA 2D3ZA 2EK1A 3BN4A 3W1YC 4DX6A 2LEBA 1S9EB 3TX8A 4DV6J 4ZVTB 4QOTA 4Y2IA 1S9GB 4Q2MA 3D4JA 2ZHBA 4J9VA 3WHIA 3FBFA 1DARA 1RBAA 5HJXA 1YBTA 2ZVIA 4DL0C 1X0PA 1N6QA 3R2CJ 2LQ9A 3UQSA 4KR0B 2XLJA 3UCZP 1FKOB 2R8HA 1SCJB 3R1HA 3CMQA 3QLHB 2WTFA 1MN7A 1S12A 2CJAA 3DU6A 4ECSA 3HK2A 3G8SA 1F60B 3D6MB 3NEKA 3W66A 2XLIA 4WFBQ 2XC9A 1FX4A 5J2NB 1FWLA 1S97A 3OJSA 3R5DA 2XNRA 3ZZTA 4I2QB 2ZZTA 4X64F 1XMOJ 1NK5A 3J80Y 3J81U 5F9NA 1D1UA 4F8RA 2RQKA 1R89A 2CPHA 4NCGB 3U7JA 1RWKB 3ETOA 1UWAA 1WTFA 2XEXA 1S6OA 1SIZA 3CJ4A 2B5JB 2HNDB 3N6MA 4P7TA 4HTIA 2CXEA 3PFOA 3GONA 5H1SV 1TKDA 1JLCA 3JXOA 2YNGA 3MAQA 1ZA2B 2RQCA 1R0AA 4E8UA 2I9SA 4JI2J 4RBUA 4DOZA 1MW7A 2OPQA 4FZVA 2XMAA 5KFZA 1YZ6A 3MM7B 1R31A 4KGKA 4OYWA 3OL7A 4ZVEA 1XMQJ 3LP2B 1WG4A 3I0SB 2RJZA 1R7IA 4RW4A 4YUDA 3AOCA 4UTGA 3EMTA 2APOA 2HLUA 2COLA 4KO0B 4WF9Q 4RJVA 4XTTA 3H5XA 4HHHA 1WI8A 1UFLA 4DPOA 3K8WA 4OZ5A 2X1FA 2WSEC 3QRRA 3N4WA 3PW0A 4A8WA 5ETSA 3A1YG 1XWLA 1EETB 3E01B 3ONQA 4RUBA 5THWA 3GIRA 4IO9Q 4K4TA 3KLFB 3V6HA 4C8OA 2QMWA 2E9TA 2B8PA 4PEOA 4PG7A 3QIDA 4BLGA 3O6QA 4HTJA 1PILA 2W24A 5GADI 2G1DA 4CCHA 2M52A 2V8PA 4ZJOA 4P72A 4ECTA 1JK9B 3TW0A 2F4VJ 2GO8A 5CYMA 3G9CA 2JEJA 2X1AA 5GAHI 1UAWA 1X5TA 3DXBA 2HS0A 1X4EA 2L08A 3IC1A 3L7OA 4GRSA 1PJ5A 2MZTA 4FPIA 1LW0A 1T03A 5GAGI 1D3WA 1YLXA 2VDHA 1S6UA 1TVRB 3M2UB 3NAHA 4U95A 2FVQA 2OJ3A 1RT2A 4LIRA 3ILJA 1NSKL 2G2OA 2KG1A 4J9PA 1AB8A 4PABA 2FJWA 4QIWD 1KQFB 2H9ZA 3JTOA 5LL6d 1H38A 5F0UA 4YP3A 1NSQA 4CIOA 3PR5B 1P9QC 2QTWA 4YEAA 4NLVA 4K4WA 2VODA 2FQQB 2JSXA 1T3OA 3M6UA 4OX7A 3UNGC 4IDKB 2VIHA 1NJZA 3C16B 3QT7A 1VBZA 1NSPA 3KMQA 1HA1A 3G6VA 2XZTB 3FGVA 4KHRA 4R8UB 4WBFA 3JQMA 1KNZA 3DDIA 4DL3A 5KFIA 2ZOFA 2MGZA 1QSLA 3V4MA 1VLOA 2AMCB 2I1RA 1JJCB 1B0TA 1RDRA 1NH8A 3NGSA 3M2VB 5B0AA 4D3GA 3VAFA 3T5LA 3V6DB 1PCAA 2NPIA 5ETLA 5BJRA 4QZVB 4DFKA 2A1BA 3D0GE 3DOLB 3JTNA 3VZIA 4DU7A 1S77D 1R6YA 2HMIA 2XBPA 3EYZA 2N7YA 2GGPB 3VALA 1NLKL 4M5GA 3DN9A 3QFWA 3DLEB 3RR8A 1UETA 3FEYB 4LFCJ 4L73A 5DRKA 2M9KA 2FPHX 4CO1A 3GILA 1KWMA 3VAJA 2JJ4D 3DDKA 3RAMA 3OUYB 1Q95G 1V3RA 4PUOB 1CC7A 1RT7A 2AT1B 4LR7A 5ETNA 5HVGA 2H51B 5IZHA 4C0OC 2FDNA 1JKHA 1QVGR 4V19X 2PIIA 2UVRA 4PQUB 2OFGX 2VC1A 4NLOA 3MUTP 1XNQJ 3IWNC 4XPCA 3OFGA 2DNNA 2R7VA 2DHAA 1Q8IA 2HHHF 1UKUA 3OSPA 2DIUA 3MZIA 1U1KA 2A2DA 2Q79A 2CJKA 2BOAA 4IFVA 4EBEA 1U1PA 4AL5A 2E66A 2RB7A 4WU2A 3AY0A 2SXLA 3IWLA 1SQGA 5HL7Q 3B54A 4ER8A 3LPEA 1N36F 3TRGA 1RAJA 3EGWB 4ZLPA 2IM2A 1PYTA 5DJBA 5DDPC 2FHMA 1YG0A 4HT5A 3J7Z5 2RRAA 1J2VA 1JKHB 3BV8A 1NK7A 1O8BA 4YB7A 2XZWA 1X31C 4V19J 2O3DA 4N56A 1KSPA 1HPZB 4ZPWR 4FKXA 2U1AA 4AYBD 2ZKTA 1CC8A 1TFYA 2HBYB 5B0GA 1FEEA 4URQU 5EX0A 4EU0A 5KT6A 3GCWP 4F0HA 4DL6A 4LF4F 3GU0A 2BVZA 2HWTA 5LM7E 3NL0A 3AXKA 5KFEA 4QCLA 2HHWA 3GG1A 4PAAA 2KHCA 2MKIA 3DI6A 3MMCB 3UR0A 2BR0A 5KFFA 1RAHB 1HHQA 4G1PA 3JSMA 2BE9B 4LBHA 4KHPF 3PJXA 4KV8B 3A8JA 2MPUA 3M1VB 4MIWA 4OI1A 4EYHB 1UJ5A 3AOAA 3FFIA 3MGJA 1NRKA 4GVLA 1S0MA 3GYNA 3IS9B 3H5UA 1DQ8A 4IDKA 4F2RA 4JI4J 4CQ1A 1RWNB 4Z2XA 2I38A 2HZCA 3DCAA 3HFVA 4O23A 4W90B 2DNQA 1VQ5S 4DLEA 4GVBA 1JLBB 1NUEA 1YJNS 2MHEA 4ZMMA 3EZUA 3P5TL 5GAEI 3THVA 4WTOB 2CFXA 2LA4A 1GK8A 2GMHA 1BWVA 4OZ3A 2ASJA 3R27A 4M5KA 4KPYA 2NZ4A 1TKTB 2VA3A 3F41A 3LAMA 1RTJB 2LP4A 1FXLA 1NNDA 2B9YA 3QSIA 4PG4A 3JSMB 2FJEB 4JBCA 4QW9A 4X4NA 1TVRA 4WP9A 4LF8J 3V6JA 3JSRA 4K5SA 2L9NA 4F4YA 1S72S 1VQKS 2ZWOA 3HJVA 4E2FB 4QU7A 1R43A 2R4FA 2GIQA 5A6WA 2G0CA 4C6AA 2JEIA 2V68A 1KOOA 3NRBA 1OY8A 4CO5A 3AAWB 4GVBB 1U49A 4MYTA 3N5BA 2C2ZB 1TKZB 4IG0A 2PSZA 1MU2B 3D66A 3DXSX 1YJTA 1PG5B 2C2NA 2CPFA 2OH2A 3CE8A 1ZM4A 2EFNA 1RTJA 1V3ZA 5GAHU 3M8YA 4M1KA 3C6UA 4P2FA 2XWXA 3NGKA 3W65A 3H5SA 3C8YA 4FN5A 3QT5A 4J9SA 4EBCA 1FESA 3FBBA 4MKVA 2PGCA 3UW1A 6AT1B 3BGRB 2NUHA 3P4UB 4NPOA 2DTJA 2OD4A 2DKOB 3MR5A 5DDOC 2ZH3A 3BO3A 3NWRA 1GNKA 2CNLB 3J80U 1MSWD 2CJYB 4LJMA 4J9OA 1FHTA 4PPDA 3N01A 5KFAA 3FQLA 1X4AA 2VFUA 4IG0B 4KY3A 2GV1A 5KFQA 2AGPA 5GMDA 5HK4A 4MIAA 4I0WA 2EBEA 2QA1A 3TARA 2RKIB 2RNEA 2XHWA 3AB4B 3MM8B 5H9EJ 4R0EA 3DHWC 1WEYA 2MZQA 1FRXA 2KVIA 4IFYA 1FD2A 4KRWA 4OYOA 1B0VA 1VC5A 3KK1A 2XSFA 4DQRA 4RWWA 2AEJA 2POKA 4CO0A 1WWHA 3D67A 4NWBA 3C66A 1VRQC 2BJ3A 3ITHB 5KG4A 3BGRA 1BQNB 2JDJA 3Q8QB 3BSNA 1T7PA 3TEHB 1T11A 4XDCA 2RS2A 4JV1A 1JJ4A 2V4JB 2ZOMA 4B9TA 2XULA 3GJTB 3HVWA 4M5DB 1S4EA 1UP1A 4TYAA 1RLCL 5DZ6A 5GMEA 1YRXA 2QT7A 4F7VA 4DQQA 1RA7A 4YOEA 3HD2A 3NBPB 3TUIC 4X4QA 2XNQA 5FIIA 4RNNA 2VKRA 1M5OC 2RKIA 1H2VZ 1K44A 2YH1A 4OYXA 3T6JA 4DR6F 1CQMA 2KRBA 2HHPA 3ISNC 5A6PA 1VQ9S 1AUSL 3Q8YA 1U1OA 5K20B 5J2NA 3VGVA 1NHUA 2DHGA 3ZTOA 4MK9A 2DR7A 4B9MA 2J8SA 4LSZB 4ID5A 3G6ES 1KDNA 2KXFA 2CNNB 2UVWA 3LP1A 2D41A 1S1UB 4DV0J 4MIBA 2K06A 4USJC 2KB2A 5F8MA 4B9SA 3KG1A 2L9DA 1JJ2R 1JLEA 4KAIA 3TOQA 4DG1B 2LMIA 2YBVA 5DS7A 4Z7CA 2DNKA 1TAUA 3CJKB 3CCJS 3M1VA 1B64A 1OS5A 1IBLF 1IKWB 2Q66A 2UXDJ 3HHLC 3PNIA 5EUHA 4XIUA 2VA2A 3M30B 1Q8LA 3HPOA 4CLKA 5J2QB 1Q7LB 1D9AA 4WJBA 4DFJA 2FB0A 2HQDA 5IC6B 2Z2MA 4TXSA 1V6HA 4QR1A 1K1QA 1RWUA 1T9UA 2M5YA 3PEJA 6FD1A 1UWBB 2V6AA 4LSNB 1KBRA 2IRXA 2NYHA 1U4BA 1TKTA 4GMKA 2B4UA 2BANB 2HRTA 1A7GE 1D8ZA 2JEFA 4HACA 4TQRA 3VQSA 3H59A 4K4XA 1HWJA 1QDUB 5IT9Y 3GR0A 1UA1A 2PFFB 5K14B 2R8JA 3LANA 2XB2D 2B7BB 2ZDPA 1BLUA 1SKSA 4NXMF 2B56A 2FLOA 3OXFA 1N32F 1NPRA 3SFGA 5AJ3F 3N6LA 2K3IA 4UUXA 4F3QA 4QWCA 1BWEA 4NA3A 5FDLB 2QYGA 5AT1B 3GP9A 4QQBA 5CCMA 2FY1A 4K4VA 1NJWA 3IM8A 2HHVA 2AU0A 3RBZA 2CQCA 3HD1A 1TKZA 5BXIA 3MR2A 3M8SA 3TAPA 3I56S 4UT4A 3RR7A 1H73A 2NZCA 2KFYA 1UWBA 4LSNA 3PG9A 4DPWA 2BMBA 2ZBRA 1N6QB 2Y8WA 2DVIA 4ES3A 4ELTA 1G4CA 4LT6A 4U7UK 1NB7A 4V1Ak 5E3QA 1JLQA 5B0DA 2YKQA 2LXIA 1VQOS 3BM7A 3HKWA 3K57A 2E1PA 1U48A 1DTQB 2ZWPA 5E3RA 3Q89A 3KG4A 2ZC4A 2GHPA 2MLYA 3MEEA 3PEHA 4LIWA 3PYFA 4RZRA 5CD4H 3EVWA 5C24B 2M2BA 4JI0F 1S10A 2F8HA 2LLZA 1GT8A 3DRYA 3M4XA 3S6EA 4LFBJ 1Q7YT 1S6PB 4ZCKA 2L48A 2RUGA 3EUNA 5DETA 1WDDA 2FIUA 1FRHA 1IR0A 3BGFA 2LU2A 4XDDA 1Z2LA 1TU0B 1NO8A 4P7VA 5IV3A 5CA5A 1F3VA 5L9NA 3OHBA 1GX5A 2E5LF 3CC7S 2ZBCA 4C8KA 3TI0A 3I96A 3B78A 3TJ8A 2DNZA 1LW2B 3BGOP 1U25A 4TNOA 1ZBTA 4NA2A 2J9EA 2ZNZA 3M32B 4DDFA 4WKYA 1JX4A 5J1NA 4NXMJ 2DCLA 3CCTA 1HNIB 2D1CA 2C3YA 3DU5A 3HVAA 3OT9A 4Y28C 4A4JA 2HVZA 4NLGA 4NZ0A 2E9ZA 1RADB 3OLBA 4JI2F 1D9DA 3GTYX 5E41A 4GC7A 4TY8B 2AYMA 4USUA 2BKOA 2V63A 3CC2S 2JFKA 3J81Y 2ZJRQ 3K5OA 4JV2A 1RLDA 3POTA 3RAXA 1HI0P 2EFOA 4WE1B 3M7VA 3C46A 3R5CA 2Z58B 4PXDA 4Y2CA 2WVDA 4P75A 1HBOA 1KTQA 2FLNA 1RT3A 1EKSA 5KFSA 2XMKA 4BBYA 1OO0B 2RU9A 1OPZA 2EVZA 2VFVA 4NYPA 2UXDF 3US5A 4RW6A 4I2PA 3J81j 1RTDA 1R3NA 1D8YA 3AHPA 1W25A 4ES2A 5T7LA 4PWWA 3THPA 2W4CA 3CJ0A 5E5NA 2ILZA 3QO9B 4L3KA 4QYZJ 1JLAA 4IH5A 1H74A 3VAGA 2KT2A 1C1CB 2ZVSA 1BY9A 5KFPA 3SYZA 2YWHA 1MG7A 4WWSA 1NK9A 3TP2A 2DRDA 4NYZA 2ZH7A 5DG7A 5I42A 2FVRA 1HNZJ 4LRCA 2KXHA 5L1IA 4WK3A 3FVYA 2CADA 3CB4A 4ZPBA 4HKQA 1XR6A 4CYUB 3CD6S 1HBUB 1VRUA 2LQ8A 3DM2A 3T1HJ 3AD8C 3TQ1A 3GFHA 4PPZA 1RT4A 3QZ7A 4DV3F 1CS4B 1NDCA 3HZEA 3JB9k 4LF7J 2CJBA 2J6TA 4KB7A 1JLGB 1N5VA 3BDEA 1I6JA 1KFDA 1FT8A 3DOLA 5MLCV 4BCAA 1C0TA 4I2QA 2JVRA 1T9TA 4NRTA 2IM3A 1HQEB 1EB0A 1M5HA 4N8OA 5AXLA 3FMWA 2HIYA 2N4CA 2B9WA 1JNZB 2Z0GA 1YQHA 3KUHA 1TL7B 3QFHA 5K8OA 3JAMU 2XGQA 3CCES 3VAHA 2FJVA 1X8DA 2GAGC 3HXMA 1F3FA 1P27B 2DR6A 1HBUA 4G1IA 2JOQA 4EYIB 3GFZA 2NPFA 4NCGA 4TLRA 3V4IB 2H65B 3BGUA 4HEA9 2W4PA 1TP7A 5M2RA 3MCOA 3W62A 4DI6A 2ZM6F 2HNDA 3TJAA 3B4MA 1RBOB 3A8IA 2ZHOA 2PA3A 2ZNYA 4NL5A 3RB4A 4K4UA 1TK0A 1SL1A 3W7BA 5HJYA 3HHEA 2OPQB 2DD8S 1GFWB 2J9DE 4C98A 2E1CA 1YK9A 4DV7F 4ECZA 3J7AN 1SQEA 5ETQA 4Q0BA 2H48B 3KLIB 4B9VA 2C2KB 1GMWD 3CCQS 4LF6J 3NMAA 1MWZA 1NDKA 2BRKA 4H4MB 3HHDA 1K1SA 1GXTA 3BREA 4QR2A 3W9IA 3MM9A 3OD2A 2CAJA 2OMOA 3ENAA 1WJ9A 3KMSA 3H4BA 2NQPA 4U8YA 3QPIA 4K0KJ 1WORA 3UD3P 4YMEA 4YQWA 4PZVA 1HPZA 3KLFA 4NASA 4MFBA 5CYMB 1SIWB 4O0IA 2CG8A 5ETTA 4FF3A 2XM3A 3D1HA 3Q22A 4N47A 1E6VB 1FCAA 1S1TB 3M8PB 5KFUA 1LW0B 2CKWA 2QSFA 3H2UB 1GXLA 1HHSA 2K1RB 2B7CB 3DHXA 4L6V3 2ROPA 4WFXA 3LALA 1RT2B 3FEXB 5DM7Q 2HQIA 3AXMA 1Q81T 2EG1A 2H4WB 3R5BA 2DH8A 1ZA1B 4WIIA 2QV6A 1T9WA 3ET6B 2V8HA 4KGZB 2GIFA 3M9MB 1BGXT 4B17A 5A0YA 3FRYA 2PC6A 1Y10A 3DLKB 5KG7A 3T1AA 3I55S 2VBXA 3Q0AA 4ZLNA 1RTIA 2DNPA 3E2EA 1XMBA 2VPZB 4KGXB 4DV0F 4GC6A 4FP9A 4IH7A 5G4DA 1KR4A 2RH3A 2YNFB 2VASA 3KHLA 3LGHA 2C3MA 5F8NA 2NXNA 2DGWA 2E7WA 1IN0A 1Y5LB 4OZ1A 3W2WB 3I5CA 3EGVA 3MDFA 4F36A 3GV8B 3RAQA 2OTJS 1T05B 2JC1A 3NY0A 4DR6J 2Z4PA 3L9ZA 4I2PB 3ZZ0A 1RTDB 2HFZA 2CJXB 4C48A 5ADZA 2EBGA 2IPOB 4JB8B 3SV4A 4ED3A 1F5CA 3TJ9A 1L3UA 2K2PA 3PXGa 3DLHA 1RHJB 3SXLA 1EQ0A 2BOPA 3VR1A 4J9RA 1F6TA 1C1CA 2QLBB 3IAM9 3TA2A 2V8GA 2AX0A 2QE5A 4A8FA 3QATA 5FJ4A 1C2PA 1U09A 1T02A 4URSA 4B08A 2R2TA 4J9NA 4PUOA 3BJYA 5I3UB 2KTQA 2HHUA 2IDLA 2J9CA 3KUEA 4YN3B 2Y1IA 4LR8A 5KG3A 2GHWA 3H42A 3LGMA 3T5JA 3UDEA 3BPSP 4GKKF 3J7YI 2H54B 1CULA 2VJVA 1N5YB 3D9BA 4CH7A 1URRA 4PXEA 1IR1A 1RYSA 3MCSA 3QWUA 4CWBA 5J2PA 2MLZA 1YRUA 4IFVB 2NREA 4B3SJ 2ALZA 2QMUB 1L3KA 1FO1A 3OTEA 4L74A 3T9NA 1N36J 2Z2YB 3G82A 4OZ2A 4YDDB 3OTDA 5E33A 2LXUA 3GWCA 1VDHA 3W5XA 2V8DA 1FNXH 2PEBA 2V2VA 3FCVA 3KUGA 3NNCA 4R5PB 4DR5J 2YY3A 3QRPA 2BUNA 4LBPA 4X4OA 2UUBJ 5KAKA 1YHQS 1KN6A 3C6TB 3GMGA 4RW8B 2AW0A 1YZ7A 2GC8A 2IY5B 4FDFA 3K5LA 3DRRB 4D3HA 3CCLS 3WBZA 4RNHA 2FZGB 1S48A 3SSSA 3ZTSA 1P8GA 2HFUA 4ZN1A 3SDEA 2AYEA 5E3PA 2CJ9A 1UPMB 3MEGB 4QWBA 3KK3B 4J9KA 3V81B 1FDNA 4WFNQ 1N8RT 1G6BA 4FF2A 1UVNA 5CD4A 3BZQA 2R8KA 3SMZA 2QA2A 3R7BB 2QFJA 2VJUA 3VF0B 1YVFA 1VC6A 2GQ2A 2R2UA 1FRIA 1WOPA 5E0OA 4DUZJ 4P9SA 2BZ2A 3MMBB 3KLIA 3QWPA 3Q24A 3CJRA 1U6FA 1X4GA 3KFWX 3MUVP 1UTAA 2CIMA 1ZM2A 2OPPB 2V34A 2K3KA 1TAQA 1ZM3A 3IS9A 2NUUG 3PIPQ 1FA0A 3I87A 3FSXA 1A6LA 3BBFA 1UVKA 1D0EA 3KLEB 1TV6A 5BR8F 3D68A 1F9FA 4OI0A 4ZP6A 3CCMS 3I0RB 1TKXB 3AA8A 4G3IA 1CJUB 2JZ5A 3JQJA 4TLQA 4X2BA 1E6YB 2DH9A 3UO0A
chains in the Genus database with same CATH topology
4DS4A 3IRXA 1HNVA 4LQ3A 4B9LA 1HBNB 3AA9A 2UXCF 3SSRA 4JI4F 3ZFVA 2DGTA 5F8IA 2J0WA 4X65F 2I8EA 1CQNA 1VGYA 2HNYB 2KH9A 3KJVA 4H54A 3MD3A 1WHXA 2R2RA 5FLXY 3MURP 4Y2KA 3CIZA 4RKUC 2IM0A 4RUAA 3DLBA 4ECYA 3NLCA 4RWXA 4USIA 4X84A 1NU4A 2W7PA 3PV8A 5D3GA 3HF5A 2BW2A 4EO6A 3RRKA 3M8QB 4RLEA 3G6YA 4RBVA 4CH0S 3P49B 4DFMA 3MFHA 3LO3A 1G2EA 4ES1A 2J0QD 4HI2A 4PQAA 2DGXA 4EBDA 1MMLA 1IJEB 2W25A 2GO9A 3P96A 4Y2AA 1UVLA 1CEZA 2VPYB 1HD0A 2Y0SD 2XSJB 4YR0A 2W9CB 2BQUA 1Q82T 1TZ0A 4DR2F 4F4ZA 2DR8A 1DJ0A 2D9OA 2VG5B 4NLRA 3B82A 1Q78A 1VIOA 1ZM9A 2V0NA 4G1QB 4A8SA 1BQMA 3LP0A 3OR2B 2HQ3A 2JLGA 1SJQA 2KU7A 2E5GA 3PX4A 5KFXA 4C0HA 4F67A 3IAS9 4O3RA 2GQQA 3O2IA 2V4JA 1SH2A 2CPJA 1TFWA 1QE1A 2NLWA 2EKYA 2NXUA 1WF2A 2W9CA 2Y1RI 5B0BA 2UXBF 1U8SA 2AQ4A 2RDIA 3OBIA 3PW7A 3L95X 2CQ2A 5C24A 3EPGA 4NXNF 4ZP7A 5DQIA 2KO1A 3KLGB 4ZPDA 4YHHF 3ULHA 1U1NA 4B3TF 3LP1B 1HW9A 5BYRA 2AYBA 3H25A 2ZDOA 2PEHA 2W9BB 4C8LA 2M7SA 5GMKa 3M32A 5KT7A 4CNZA 3P3DA 4CH1A 1S49A 4LF9F 5ITHA 3P6YC 3N5FA 2B9XA 4J37A 1GQEA 3I5BA 3D0HE 4DBQA 2ZJQQ 1IQZA 1IUJA 2ZD1B 4DX8H 1T95A 2RVJA 3G86A 3KK2A 4ZCLA 3LWLA 4QW8A 1HWKA 1S1WB 1VRTA 2KN4A 2ATLA 2F4VF 4X4SA 3I82A 5KFGA 4OIXA 3CCVS 1FJCA 2OMLA 4CI0B 2FLNA 1FDBA 1JNRB 2IMOA 4ITSA 1S79A 3RB3A 4KV8A 4ZHRB 5DG8A 3M05A 5M2PA 4RW6B 5AE3A 2HYIB 2HG4A 1PO6A 1Q79A 4PR6A 3K7RA 4C7QA 3CCUS 1H7XA 1LWFB 3OV7A 4IUFA 2IM1A 3PRBA 5E3AA 2I2YA 1YJVA 1IXKA 2PDAA 1XEZA 2E1AA 4ZDNA 2MKKA 4IOCQ 4I7FB 3U02A 4ECQA 2XGPA 5F8LA 2YKMA 4RBTA 4NCAA 3ZZUA 2J7KA 4RW9A 5KT5A 4ECVA 3PRDA 2HWIA 4F02A 2F3JA 2FJAB 4URGA 2ZC3A 4P2SA 4DR5F 2VQFF 4KBIA 1HMVB 2RF2B 3CEDA 3I6PA 4DSJA 2IBKA 2UVUA 1DTQA 3O5TB 4Q8EA 3OR1B 4IR1A 3PZPA 2DGOA 2V2KA 2N7CA 2OSQA 4TU7A 2HWHA 1T3NA 1S6QA 2QEXS 3UD4P 4I7FA 3TVZA 2XSJA 1V9OA 1LK7A 4ALZA 2C3OA 2JX2A 5K8MA 1U2RA 3ENWA 3I9V9 4E98A 5IT4A 1HBMA 1KD1T 2PI4A 1RJJA 2FC9A 1VMBA 3TAQA 3ICLA 4DSIA 3V4IA 2P9GA 4KT0C 3RB0A 1LOUA 1SJFA 1VQYA 4R25A 2WB4A 3NGDA 2B6AB 3IBWA 2OPSB 4Y34A 1DHMA 4Y0FA 3CMAS 2VG6B 3OLAA 2J9DA 1HNIA 1KONA 3T3FA 2AJFE 1XNRF 4A8KA 2LQBA 1XK8A 1IKYA 3M2UA 2CQDA 3KHHA 5CCLA 3HHLD 3OTBA 1WELA 3TA0A 4IOAQ 2AGQA 4RX6A 2DK2A 2A18A 2W7AA 3I4PA 2ZFHA 2IVMA 2JHEA 3OQ2A 4ZVFA 2E1MC 4N8NA 2HGLA 3T1YF 2MKCA 3DGPA 1QAJA 1SJRA 2LCWA 1WEXA 4X4RA 2VD3A 2XY5A 4HH0A 5LSRA 2ADCA 3Q2SC 3MOJB 3TR5A 3TNVA 2K1RA 4DV2F 2Z8QA 4PXCA 3T6BA 1NJYA 2Q6CA 3MPWA 2CJQA 2YNIB 3BQ1A 2CQ4A 5KFYA 2M3DA 3QLHA 4DHVA 5J1EA 2VL1A 3G71S 3QMQA 2CQ0A 3DLEA 4DL7A 1QY7A 2ZH8A 3O44A 5HI7A 3K59A 2UVRA 5T14A 1JLAB 4XO0A 1RTIB 4CT9A 2D3OR 4K50A 4WYWA 1NJIT 4OX6A 4K2XA 3OUYA 3BSOA 3PX6A 2HAIA 3KKFA 3FQKA 3I5AA 4JI3F 2W8KA 1F0XA 1KS2A 2LQ5A 2CPEA 1Q16B 4NMLA 1FNOA 1UVJA 5D4PA 1T05A 3HDSA 2VFTA 2O67A 1SL2A 4TY9A 1VRUB 2YNIA 3DM2B 1WF0A 5HMXA 2P9EA 1FJGF 2L3MA 2HIQA 3U27A 4MKAA 1QAIA 4JI5F 1HNWF 1XTZA 1Y3JA 3IG1B 1IKXB 4FPRA 3HJFA 1Y7PA 4X62F 2W9AA 2O5DA 3SFUA 4LVNP 1HR0F 2WAQD 2RQMA 5IQQA 3Q2TC 4RU9A 2XLKA 2VH7A 4J5OA 5JJBA 2YKOA 3K0JA 1DTTA 4I64A 2XCAA 3KOAA 4FXVA 1MROB 3K5NA 2Z2LA 4O3PA 1J5OA 4ILRA 4M94A 2G4BA 2VZ9A 1RKIA 2MQPA 2YWGA 3CD5A 4KE5A 2R8IA 4K4ZA 4F3MA 2F7VA 2W7OA 3AQPA 1X4CA 4ELUA 1VJWA 5KFHA 1QAYA 1FRLA 1QUVA 1T03B 2M8DB 4WXWA 1F5AA 2FD2A 2DGSA 4TU8A 3C6TA 2WW8A 5M2UA 2C2EA 1P6TA 2OD6A 1KFSA 1XR7A 4DR3F 1HNZF 3RBDA 2VONA 2IJFA 2WOMB 3WZ0A 1PSDA 1R0AB 4KFBB 2XI3A 4LSLA 3TAMA 6FDRA 2FVRA 4ETXA 2AWZA 1QLNA 3MM7A 3Q23A 5DQGA 1X5SA 4A8OA 2LU1A 4RW4B 1DZ5A 5A8WB 5H9FJ 2E9RX 4FYDA 2X1BA 4EO8A 4ZHRA 5G0RB 1HQUA 1R8CA 2J7WA 3E01A 4U67Q 3WDOA 1FE0A 1FF2A 2A3JA 1FVQA 2HMIB 1RTHB 1W2IA 4OJGA 1M5SA 5CZVA 2IHR1 2GMJA 2MQLA 1TKXA 1MU2A 4LQ9A 1JJHA 3HFKA 3VZHA 4PG8A 5GADU 1VIXA 4YY3F 2I5JB 3HM9A 2RDJA 4UY8T 1RT7B 1EP4B 4NRUA 2ILYA 4YB1P 2DGUA 2DO4A 1IM4A 2M88A 4H4KC 5D4NA 2J5AA 1WHVA 4JV0A 4C3MA 5A8RA 3KG0A 2NS1B 4Q7AA 3THTA 4CT8A 4ED2A 2UVVA 4ELVA 3KJVB 1U7LA 3M8RA 1Y5IB 4DFPA 5EGYA 3NKYA 4DS5A 4OZ0A 5I3UA 3CPWR 4GO5X 2XMWA 1U45A 1WTBA 1SKWA 3KYLA 4WCEQ 1HWUA 4ZPTR 1VQSA 5AXNA 4NLQA 1M5PC 5KT3A 2FJBB 4QIFA 3BS9A 2O66A 5J2PB 1YJWS 3V6DA 4PWDA 5KOWA 5B08A 1M5VC 3QZ8A 3MUMP 2D3UA 3O1LA 4Y3CA 4FXWA 2DNGA 1U1QA 4E0DA 2XG8A 4UQTA 4PWUA 4CO3A 2V9WA 3HVRA 2YTCA 2EG2A 2MYFA 2VG5A 3T1HF 1YWXA 3CD0A 3CO9A 3TUJC 1S1XB 2JL9A 4G1QA 2BBEA 3SDEB 3NNHA 3KK3A 5HLFB 2KG0A 1HI8A 3UWTA 4WZMA 3NCQA 4ID5B 4DR7F 3WC2A 1KEKA 4C3LA 3RW6A 3M6XA 4B3OB 2FJXA 2DHSA 4DSFA 1FTCA 2DNYA 4EFAC 1VK3A 4KIAA 4F3OA 2HGMA 2RSQA 3CF5Q 1LWEA 2WRMA 2UUCF 1URNA 4CTAA 3ENQA 4OZNA 3IGVA 5AE1A 5C5JA 3D0IE 1LWCB 1F5BA 2G9OA 1DURA 5BYSA 2MSSA 1FKAF 1TV6B 4C11A 3FDSA 3CXCR 2E5HA 2YWFA 3GIMA 3I0RA 2X51A 1TK8A 2DRBA 1QM9A 4K5RA 2KXNB 1LWEB 1T94A 2KYZA 5I3QA 5A8WA 1VQMS