1VBZA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in ba2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vbzA00
3BO4A 2V94A 3UWTA 1NU4A 3EGZA 2X1FA 1WF1A 3CCQS 2BOPA 5LSLA 2DNZA 2EK6A 2YKAA 3MXHP 2XSFA 2XNQA 2PE8A 5DDOC 4C7QA 2MPUA 2U1AA 2M4MA 2MY8A 2DHGA 1U1QA 1DRZA 1F9FA 1G2EA 1YHQS 3V4MA 2OSRA 4V19X 2CQIA 2GHPA 3G71S 3ZZYA 2Q79A 1YWXA 1R8PA 4CH1A 4QU7A 2DIVA 2MZTA 5GVQA 3B4MA 3VAGA 1B7FA 5DM7Q 2M9KA 2J8AA 1FJEB 3MD1A 2NLWA 3US5A 2MKHA 4IOAQ 3CC4S 1OPIA 2CQPA 1JJHA 2X1GA 1KQSR 1VQ4S 3NS6A 2FPHX 1SJRA 3G8SA 3CCJS 3EGNA 3IRWP 4ZKAA 1BY9A 2HGNA 1X4GA 2MKJA 2DNRA 2M2BA 2DNPA 4FXWA 3RW6A 1S72S 1YJNS 3I55S 2KYXA 1UW4A 2MZRA 5CXTA 3CULA 2MQNA 5GADU 4IOCQ 2LEBA 3MD3A 3G4SS 1W2BR 2E5JA 2I38A 3VAKA 3I56S 2N7CA 3G9CA 2DHSA 3NNAA 3OW2R 1VQKS 2EVZA 1X4CA 4F02A 1X5TA 2CQ0A 2RUGA 3DXBA 1U6BA 1X5SA 3MUTP 2N82B 3S8SA 2HGMA 2MYFA 2PEHA 1U1LA 2CQ2A 2UP1A 1WHYA 2MQPA 3J7ZT 2ERRA 3U1MA 3CCUS 3CMES 1P27B 2DB1A 3G8TA 4W92B 3HHNB 2MQOA 2AYGA 3K0JA 2CQ1A 1H6KX 1X5OA 1AUDA 2OSQA 4WCEQ 2OTLS 3S01A 1M5VC 2YTCA 2LQ5A 2VOPA 1Q81T 5IFMA 1WG1A 4WFBQ 2HZCA 1YITS 1QM9A 3CC2S 1VQMS 3SXLA 1U1OA 2L9WA 2LYVA 1U1MA 2M8DB 3LQVA 2X1AA 2LCWA 2MZSA 1DHMA 1YTYA 3VAIA 2HGLA 3CXCR 1WI6A 2DH9A 2M52A 5IM0A 3CCES 3MI7X 2F3JA 5MLCV 2DGVA 1WF0A 1FNXH 3S6EA 3FEYB 1K8AT 3VAHA 2KXNB 3SDEA 2CPDA 3UE2A 1VBZA 1WEYA 1U1RA 2YH0A 2DNQA 3Q2SC 2CPXA 2I2YA 2KHCA 3R1HA 2CPEA 3BS9A 4WFNQ 3N9UC 1YJ9S 3VAJA 2CQ3A 2ZJRQ 2ADCA 2MXYA 1U6FA 1JMTA 5DM6Q 1OIAA 1M5PC 2KU7A 1WEXA 1YJWS 2K8GA 4ERDA 2JVRA 5DETA 2MKIA 2F9JA 3G96A 2DGOA 2KT5A 3U1LA 2J76E 2RNEA 4EGLA 4TLQA 2CPHA 2DNMA 4W90B 3ZZZA 2RRBA 1O0PA 2VONA 2MQQA 4TU7A 3J7YU 2RQ4A 2OTJS 2DH7A 2E5HA 4OZ0A 4LMZA 2KH9A 5GAEU 2DGTA 2MKCA 4U67Q 2XS5A 2M0GB 1OWXA 5HL7Q 1VQ6S 2LXIA 4TU9A 1R8HA 2KM8C 2BZ2A 2D9PA 2DNLA 3CPWR 2DO0A 5LXYA 1VQ8S 4J5OA 5DDQC 1JJ2R 3CTRA 2GO9A 2DGUA 2DK2A 2E5IA 1IQTA 2JRSA 1ZZNA 5GAGU 1Q86T 2KI2A 4UY8T 2KVIA 2MKSA 5LJ3Y 2CQDA 2VOOA 1FHTA 3VF0B 2RRAA 2MZQA 2HVZA 3R1LA 3Q2TC 1M90T 1WELA 3P6YC 1WF2A 3VALA 3CF5Q 4IO9Q 2KRBA 1VQLS 1QVFR 2KM8B 1VBXA 2DHXA 1ZZFA 2AYBA 2MJUA 2DNKA 1L3KA 3FEXB 1DZ5A 2AYMA 2DNNA 1KC8T 2FC9A 4A8XA 2KG1A 2MZ1A 1Q82T 4ED5A 2MHNA 2KXFA 3CCMS 4M5DB 3S7RA 2XB2D 2MSSA 2CQCA 2MQLA 2LXUA 2MGZA 1ZH5A 1SJ4P 1WHVA 2HYIB 3CMAS 2CPIA 1YI2S 1SJQA 4F26A 1X5PA 2DHAA 2DNYA 3MOJB 2DGQA 1DBDA 2K3KA 2MMYA 2DITA 2LA6A 2DH8A 2G4BA 1VBYA 2ADBA 4RU2A 3NNHA 1M1KT 2E44A 4QPTA 1CVJA 2MY7A 2DGSA 4C4WA 3BO3A 3PIPQ 3DLLQ 4WF9Q 4Y0FA 4QU6A 1PO6A 1QVGR 1P1TA 1VC0A 1JJ4A 4CH0S 1X0FA 2A3JA 2CPFA 1URNA 2LA4A 2DNHA 4PKDB 2DO4A 1U1PA 3THTA 4F25A 2FY1A 1FXLA 3TP2A 1NO8A 3P49B 2KXHA 2XS7A 5JVHQ 5IM0B 2L41A 1WG4A 1A7GE 1UAWA 1WHXA 4P6QA 3UCGA 3R27A 1RKJA 4LJMA 2RQCA 2DISA 3THPA 1D8ZA 1FT8A 2M88A 2J0QD 1N52B 1U2FA 2OIHA 3P3DA 3SDEB 4CQ1A 1KOOA 2X1BA 1SJFA 1VC6A 2U2FA 2KRRA 3NNCA 2F9DA 2KG0A 1U1NA 2CJKA 2RU3A 2WBRA 2SXLA 2KFYA 5LJ5Y 3P5TL 1HD0A 1RK8A 5IQQA 3CC7S 1X4FA 1VC5A 1WTBA 4Z2XA 1H2VZ 2JVOA 3UCUP 2FHOB 3CCLS 2DGXA 2G1DA 4WIIA 2JWNA 1X4AA 1SJ3P 3CCRS 4OZ1A 2AD9A 1X4BA 2LKZA 2M70A 2LECA 1H2TZ 2CQ4A 1N8RT 2RS8A 2QFJA 3H2VE 1N54B 2MZJA 1WWHA 3VAMA 1WI8A 1FJCA 1HD1A 2QA4S 2VODA 1HL6A 4WKRA 2RT3A 2ZJPQ 1X4DA 2D9OA 3MDFA 4PRFA 3TO8A 2XS2A 3D2WA 2L08A 5GAHU 1A9NB 2J0SD 2RVJA 1HA1A 1X4HA 3BEGB 5H1SV 1VQOS 2D3OR 2KN4A 4YB1P 5JVGQ 1NJIT 2CPZA 1H2UX 3HI9A 5ITHA 2FC8A 3SMZA 4YUDA 1S79A 2E5GA 5LXRA 5HO4A 2M7SA 1WHWA 3UCZP 4IUFA 3PIOQ 3CUNA 2DNOA 2JX2A 2ZJQQ 1VQ9S 4LIRA 1VQ7S 2DIUA 3MURP 2DNGA 2O3DA 3L3CA 5D78A 1OO0B 3B4DA 3BO2A 3H2UB 5BJRA 1VQ5S 2MKKA 3CCVS 1M5KC 4UQTA 5CYJA 1U1KA 1SXLA 1XN9A 3NS5A 2G0CA 2RS2A 2CQGA 2AYEA 3LPYA 1WG5A 1M5OC 3UD4P 1VQNS 3CD6S 5FJ4A 1N88A 5EN1A 2NZ4A 2MQMA 1VQPS 4BS2A 1Q7YT 2LEAA 3EX7B 2LMIA 4TU8A 2B0GA 5D77A 3ULHA 1WEZA 4FXVA 2N3LA 3G6ES 3UD3P 3JB9k 2MJNA 2CQBA 2CQHA 2QEXS 1FO1A 1KD1T 1K9MT 2XNRA 1FJ7A 1YIJS 5GMKa 2CPYA 1UFWA 3MUMP 4C0OC 2MGZB 4CIOA 3MUVP 2CPJA 3VAFA 4YOEA 4Y00A 3IWNC 3NMRA 2MSTA 4QQBA 5DDRC 5DDPC 3RW7A 1K73T 2YWKA 1D9AA 1PGZA 3TYTA 5LSOA 2OJ3A 4WFAQ 2EK1A 2N3OA 2MB0B 5CA5A 2M8HA 2YH1A 4PR6A 1KOHA 3CCSS 1X4EA 2DGWA 1UP1A
chains in the Genus database with same CATH superfamily
1UVMA 1BQXA 1RZMA 2BOPA 3EVOA 4DV4J 4NLUA 2NREA 5KFFA 4DV1F 2AIRB 2RKIB 3EGVA 2C2KB 3T1HF 1U09A 4KFBB 4G3IA 1S59A 2H5EA 4CLSA 2V8VA 3CIMA 2F63A 2V8GA 3W9HA 2CQIA 2Q66A 4C8OA 3Q89A 4OJHA 3H0PA 1C1BA 2MKHA 2QMUB 4ZA1A 3VGTA 1R0BG 4B9MA 4RW8A 1GX5A 1NUEA 3KLIB 1I94F 1R7IA 1D0EA 2WOMB 4P72A 4JI4F 1EAYC 5DGAA 1Z2ZA 5THWA 4DV7J 1IKXA 4OYIA 3QIDA 1EZZB 3SQGB 3GG1A 1R3NA 3OW2R 4KT0C 2VFRA 2EKNA 4OZJA 3D6HB 3ZTQA 2WCXA 3CVKA 2MQPA 2YKMB 1YQHA 4ECZA 4MMOA 1KHVA 4XK8C 3UNYA 1HKAA 3TEHB 3ILJA 3IC1A 3VTIA 1U1OA 2C28A 2MZSA 2OHDA 1YTYA 4ICLA 1Y5LB 1YRUA 3CCES 3MAQA 1GXUA 2ZBRA 1TQLA 3EXYA 5IC6B 4PEOA 2O5DA 4ID5A 1DTTA 3MMAB 3T41A 1S77D 3GIMA 5A8WB 3IR6B 1ZOTA 3M2RA 4NYOA 1WEYA 2YH0A 4ZCIA 2VG6A 4CO4A 3BS9A 3ICLA 2EG2A 1IKVB 3W5XA 2WW8A 1M5PC 3D67A 2H54B 3SI8A 2DGOA 2RNEA 2BM0A 3QBCA 1N5YB 2DNMA 3K5PA 2F8EX 3QRQA 2RHQB 1R0AB 4C8MA 2XMJA 3G86A 4O4GA 1JIHA 3TA0A 1HWJA 3ONQA 2Y8YA 2COLA 2I1RA 2GAHC 1XMBA 1Y7PA 4MAKA 4UF4A 1VIXA 1IQTA 2E66A 1IKYA 4MFBA 3ET6A 5KT2A 3P6YC 3TVZA 3J81Y 1FVSA 3FCWA 1WTFA 2GGPA 4P74A 3IR7B 3MPVA 3CT9A 4O44B 5KTQA 2LP4A 2MSSA 2HNDB 4DFPA 2GIQA 2HHQA 2CPIA 1SJQA 4WKYA 2LA6A 5A6WA 3FBCA 5DQHA 2P2CB 4RPFA 2WVDA 1M1KT 1K1QA 4CLWA 4RWWA 2GJ2A 3SV4A 3BKTA 3IRXB 2FJDB 2W2QP 1NKBA 2RH3A 3BGRB 2YKPA 2J5AA 1TKTB 1X8DA 2FZCB 1HBOB 3HSGA 1J5EJ 3H90A 3KLEB 4RNMA 2H9ZA 2ROPA 2VG7A 1M1HA 1WNEA 3C14A 2BRKA 3CJTA 3NGUA 3SDEB 2GW8A 2CWKA 2KRRA 1P1LA 3KK1A 3PR4A 4JUZA 1GXTA 3L09A 2CRLA 4NOHA 3TARA 1S6QB 4HLBA 2G1DA 2C3MA 4JI3F 2KYZA 2FJVA 3IFEA 2Y1RI 2XMTA 2GFFA 3ZC4A 2F40A 3IWXA 2KFNA 2FTRA 3N79A 1F0XA 3M8SA 2QA4S 1IWGA 1FNMA 3HHEA 1OSCA 3LA0A 2UXCF 2OUGA 3RBZA 4XDDA 2AW0A 1L3UA 3T5HA 3PEJA 3FEZA 5E33A 3HSDA 3F73A 3BEGB 4KKOA 3CWJA 4MIAA 1TFWA 3W1YC 1OSDA 3KJNB 5SUHA 1VOMA 2UUAJ 1VJWA 3PIOQ 4CNZA 3OR2A 3H2UB 1HW8A 3NCPA 5RUBA 2E5LJ 1SXLA 3NS5A 2NZCA 3K57A 3T5JA 3ETMA 3OLBA 4JI1F 4I6YA 3HSZA 2IC3A 1FJGF 3HJFA 4IO1A 1I6JA 3IM8A 2E7WA 4A47A 5KFNA 2MJNA 2WB4A 2VBXA 2HFVA 3TI0A 4HHJA 4OQJA 2GVDB 3NMRA 3QRPA 4CM0A 3ITHB 5KFUA 1D9AA 4WBFA 1Y10A 5A76A 4L72B 3AXKA 4HHHA 4J9UE 3B54A 3KJVA 3D1QA 2C42A 1VQYA 1S1UB 3RZAA 3MXHP 4B3RJ 4ZCLA 3FRZA 4USUA 3H7HB 1IBKF 3GLJA 1RCOB 2B7CB 2HWIA 3VGVA 1RAEB 3MMCB 1KHWA 2GHPA 4CH1A 3GIIA 2QZ8A 4JV1A 3D6TB 4LVNP 2HS3A 4DN0A 4RBVA 1SJRA 2LFVA 4KGZB 2K06A 2XGQA 1UVIA 5CXTA 4FYYB 1SUQA 2BX6A 4U95A 3MD3A 2YWWA 3BM7A 1N0UA 4N5SA 2IJNA 3TAMB 5DGBA 2Z2MA 1O5JA 4CLKA 1EIYB 5ETOA 2YNIA 4UUXA 4DUTA 4NXMJ 4K4SA 1N5TA 3R6LB 2RUGA 1AROP 2FZGB 3HK2A 3LF0A 5E2QA 3H8YA 2CIMA 2IVMA 4DUYJ 3RTVA 2ERRA 1RTJA 1YZ7A 1U25A 1H6KX 3NBPB 3IAM9 1SQEA 4EK2A 1JNRB 2X1AA 4PQUB 2P9EA 3FK4A 5L9XA 3SSSA 3MI7X 3JSMB 1Y0HA 1Q0NA 4ED6A 5LT5A 4CLLA 2AGPA 3CNQP 1KLNA 2HHHJ 2GJIA 4Q2MA 5D4LA 5CYQA 3MCSA 4DR4F 4F4KA 1VJQA 2I6WA 2QO3A 3KTQA 2CPEA 2VC1A 4LR9A 1YJ9S 4P71A 4B9VA 1OIAA 1HI8A 3TX0A 3KHGA 1Q8BA 1PAEX 1SKRA 4JV2A 4EGLA 4UOCA 1VCTA 4DSKA 5D15A 2RQMA 2E7VA 4ZPAA 2DGTA 3M2VA 3POTA 5HL7Q 1SC1B 2Y9HA 1CC8A 1MN9A 1X7VA 4V1Ak 3DC2A 4NRUA 4Q43A 2GCFA 3U27A 1H7WA 1S48A 1ZYQA 4EFAC 4OZ5A 3ZZRA 1JK9B 2OGUA 2BACA 4OHZA 2DRAA 3Q8SB 2V4JB 2BE2A 4RNNA 4KE5A 2HYIB 1YI2S 2E9TA 2KL8A 3EMTA 1BMQB 5E41A 4I6WA 3PYDA 1Q4RA 1NSKL 3AD8C 4RU2A 1HNVB 4KC5A 4ZP6A 3D3BJ 4FYVB 2ZOMA 4YHHF 5AE2A 1KS2A 3CDBA 4PABA 4QYZJ 2YWHA 3MEGA 3V4IB 3T6JA 4HKQA 1JLBB 4K2JA 4X4SA 1T95A 2FY1A 2YNFA 1FXLA 1P9YA 1S1WA 2EG1A 1CQMA 1DARA 4WP9A 3NAIA 2I5JA 2FZKB 5D4NA 3CJRA 2JEIA 1HBMA 3BQ0A 4O3OA 2D74B 4LVOP 1UJ5A 1TK8A 2WBRA 1HD0A 1RK8A 3CW2C 1X4FA 1FKPA 4QIFA 2RRNA 3IN5A 3O8WA 3KYLA 5DQIA 3VHQA 2ZVSA 2VA2A 1B0PA 2ZH1A 4AE5A 4QIGA 2LECA 5JMNA 2ASLA 1WC0A 2QFJA 3NS7B 5DRKA 3OR1B 3TUZC 4WKRA 3MM5A 1WDDA 2ABYA 1NHUA 3J7YI 3QAUA 5GAEI 3UN3A 2F4VJ 4I2PA 2E1CA 2M7SA 1XK8A 3C8YA 3CD5A 3K8VA 3CJ5A 2PEBA 3CCVS 3RBXA 3QIPA 2UVUA 5E3QA 3I0SB 4ZN1A 3GCXP 2KVQE 1RLCL 4ZVQB 2FHJD 4DL4A 4XAKA 1UJ4A 3ULHA 5DJBA 1JXLA 3JB9k 4ED0A 1N32F 4G1QB 4AQYF 3PVXA 5GMKa 5IZHA 3DLEB 5F8JA 4Y65A 4LQ3A 4DMZA 5DDRC 2UZAA 5J1PA 3AJ2A 3N0VA 5LSOA 1N5VA 3U1NA 4UY85 4RW4B 2BJDA 1PBAA 4WE1B 1MWYA 3BO4A 4O3RA 1NU4A 2FJEB 1CJUB 3G82B 4NZ6A 5CCMA 2HFOA 4CLFA 3MTKA 4ZVHA 1DRZA 1KP6A 3P4UB 2ALZA 4RKUC 2CG8A 4C3MA 3CCJS 2HGNA 4J9OA 4LSLA 2M2BA 4BWJA 5I3QA 5K8OA 4I68A 3I55S 4ILRA 2MZRA 1F60B 1FX4A 2UUBJ 2CYYA 2V67A 4YN3B 3IBFB 3OL8A 4DV3J 3EXCX 2HBZB 3M6XA 3M30B 2OMOA 1ZBTA 5KFXA 3TJAA 3S8SA 4LR7A 3FVYA 2UP1A 3MR6A 3MEDB 4I67A 2QLWA 2J7KA 1JLAA 2QLFB 3JTOA 3ISZA 5HVFA 3KJFB 2YWFA 1P9QC 4PZVA 4WTYA 5KT7A 1NK8A 2QT7A 2QG9B 3AD9C 4RX6A 2BJ1A 3VAIA 5DG9A 5A0YA 3CXCR 3AJDA 3C15A 2HURA 3Q23A 3V6DB 5FLXY 2PI4A 1FWKA 3GJTB 4KPCA 1ZAWA 2ROGA 2IAJA 4DR1F 3TUIC 3N9UC 4DCPB 3M05A 1VRTB 1KVIA 3PRDA 2J9CA 2KT5A 3NWGA 2XYPB 1HNIB 2VDHA 2H5JB 2RRBA 1WKKA 2BV3A 2MQQA 1UW9A 5BR8F 5D0GA 1TAQA 2FVCA 2Q6BA 2XS5A 1N34F 2AX1A 3I87A 3KLHA 4Y2KA 2PGCA 3SCJE 4DPYA 1DLOB 1BQMB 2GO9A 1RT4A 5L46A 1LFWA 1RT1A 3V6HA 1SIWB 4YY3F 4ZVTB 2KVIA 5LJ3Y 4OI6A 2KDOA 1Y9OA 2HS4A 3JS9A 2BKNA 5SZTA 2DNKA 2FGCA 4R0JA 3R5BA 1TL1B 1JKHA 2ZH8A 2DYAA 2V9WA 2B8PA 3GV8B 4LF6F 1HQUB 2MGZA 1MU2A 2IDLA 2W9BA 1T94A 1LW2B 2DH8A 1T9TA 4X4TA 1LW0A 4F3OA 3BR9A 1QVGR 2HVEA 3IG1B 1FESA 4IH7A 1URNA 4X2BA 4EYHB 2XZWA 1S1VB 1UTAA 3QATA 4I7FA 1PYSB 3D6MB 1DJ0A 3P49B 2RAQA 2KXHA 1RT7B 4ZITA 3NOCA 3QT8A 4KV8B 3THPA 3NGDA 2GAGC 5CYMB 3R7BB 4ES1A 2OPQA 3K89A 2GJFA 4C11B 3DLKB 1K47A 3DRRA 2RU3A 3L95X 2B4OA 5M2RA 4LF5J 4DV6J 5E3AA 3RR7A 1H2VZ 1FK9B 2Z57B 5KT6A 5C42B 4NRTA 2K7JA 3V6KA 3OTOF 2P9CA 2CJ9A 4HACA 2Y0SD 4RWXA 1HL6A 4ELVA 2V8HA 3ETOA 3N5FA 2DEJA 3TEGA 2E1PA 4RBUA 5I42A 1X4HA 3M6VA 3HI9A 2FC8A 4FZVA 2LLZA 3BKFA 1N0VC 3CUNA 1VQ9S 2DIUA 3D1HA 3SCLE 2W2PP 4Y34A 4Y2CA 4DV2J 2WBMA 1M5OC 5L1LA 2BR0A 3TVYA 3X1LB 2NXEA 1H73A 1V5IB 3D6FB 1U45A 3MCMA 2F5GA 1SV5B 1UEUA 2KZMA 4OHVA 1K9MT 3GYXB 2OELA 1YRXA 2KT3A 3BB5A 1X60A 2A10A 4TYBA 1NH8A 4DR6J 3RR8A 4EO8A 1EQ0A 3Q24A 4QQBA 1K0TA 1YBTA 2W2MP 3MM8A 2EFPA 1WSRA 1UMJA 2K1RB 4YFUA 5DLGA 4GRSA 1T03A 1IN0A 3T19A 2V94A 2CZVC 1SC6A 1XC9A 1JLGA 1MMLA 3UQSA 2HZAA 2QE5A 4FNHA 3BBFA 3HD2A 2ZEJA 4OYMA 2YKNB 2DHGA 4CYUA 1F9FA 3AAWB 4BHQA 4ZIVA 1HMVA 2XGPA 2QLBB 4NPOA 3OBIA 2NYHA 4A48A 5J2QB 2J8AA 3J80Y 1ACMB 2FDNA 3PFEA 1RT3B 5C24A 2HIYA 4YR2A 1AZSA 1CJKB 4ZPCA 1B64A 2MKJA 2IRYA 2DNPA 1Q53A 4FF2A 1R6YA 3KFWX 1EX8A 1NBEB 2PA8D 4X64F 5IC4B 2ZD1B 2O01C 3HVRA 2I38A 2JNJA 1RISA 2DHSA 4KHPJ 2UUCJ 2V50A 2X3DA 2EVZA 1GMVA 4JI8F 3OD2A 1T05A 4C0HA 1TELA 4Q5VA 2XMAA 3J7ZT 3CCUS 3CMES 3UDCA 4TY8B 5GADI 4CTAB 2HWTA 3WC0A 1HYSA 3LAMA 4D3HA 1S1TB 5IFMA 2HZCA 3QJJA 2YNHA 2EEYA 1QAJA 4C97A 2AEMA 3PDNA 4USMA 4HDHA 5IM0A 3TJ9A 3BH7B 4DL3A 1VRQC 1LWCA 3P8BB 2ZC3A 4P2FA 3MCOA 2VBWA 3UE2A 1LKZA 4K0KJ 3G87A 5KFMA 4DR3J 1JLQA 4WFNQ 4CCHA 3T9NA 4LRDA 1XR7A 2YX4A 5F0UA 1T7PA 4ZLPA 4PWDB 3CB4A 3U1LA 4YP3A 2QJ3A 2BABA 4R5PB 4W90B 4H4KA 3TZXA 3IXQA 2XY5A 2GQCA 4OZ0A 3MMJA 3GWCA 5T7LA 2M0GB 1OWXA 4FS2A 4ZHRB 1YDLA 5LXYA 3MMBA 3PW5A 1T0TV 1ZAVA 1Q5YA 5IQ6A 1R0CB 4GVBA 1TV6A 5GAGU 4JI5F 4U7CA 2XCAA 2NUUG 3ZZUA 3KMQA 2OAUA 3ZTPA 2HG4A 2RRAA 1M90T 5HVHA 1UPPA 1UVJA 2GQ2A 3Q83A 3HPOA 3MECB 1ZM4A 1NB7A 1FTCA 5B0CA 3A12A 2AYMA 5E0OA 3VVTA 4A46A 1WJ9A 3VZIA 1J5EF 3DGPA 3GFHA 3MOJB 3KKFA 1VBYA 2NXCA 4N41A 1JXEA 1EHWA 3LTOA 2E44A 3HP6A 1YSJA 4JI7J 2K2PA 3J7AN 3AQPA 2A3JA 1FRXA 1C0TB 3UN5A 1KR4A 2BANA 2Y1IA 2L41A 2QYGA 5J1EA 4ES3A 1HIYA 1V3RA 1RWWB 4NWBA 1NSPA 4N76A 1OQ3A 4OYPA 4Q45A 4X4UA 2ATCB 2F9DA 4G65A 2R8KA 1V6HA 2R7XA 2SXLA 2CDQA 2VPWB 5HI7A 5F8MA 3RJMB 3AFGA 2FHOB 4TKTA 2BA9A 1F6TA 2DHHA 5G0RA 3Q86A 1TUWA 4NXNJ 2GMLA 4MYUA 4DSEA 1HD1A 3HKZD 5A2QU 4IYQA 2ZDPA 5K8MA 2QGFB 4DV1J 2CG4A 1LEOA 4CO0A 3SMZA 2E5GA 1EETA 1RADB 3UCZP 3T1HJ 4IUFA 2ZNZA 2HFNA 3MCNA 4B3SF 1I5OB 3BO2A 2MLXA 1N6QB 2J9DE 4FP9A 2QL5B 2CQGA 3FFIB 1L5UA 5EN1A 1BC6A 4BS2A 5F8IA 3WZ0A 4TU8A 4DG1A 3DOKB 4H4OA 5D77A 1WEZA 2LXFA 2H5IB 2JSXA 3HFKA 4FPRA 1KQFB 1I94J 4DSJA 2QEXS 3TZWA 4JI4J 5C5JA 4NLGA 1MN7A 4Y00A 1KKHA 4P52A 1K73T 4K7QA 2WVCA 4IRKA 1HBUB 1C4AA 5CA5A 3JXOA 2YH1A 3AQOA 3CCSS 2GC8A 1K1SA 5B08A 2ZOFA 2Z30B 2PMHA 3HHLC 2XI2A 2VKRA 5G4DA 3BKUA 3GTYX 1EQMA 2U1AA 1NH7A 3DRPA 1YHQS 3H5XA 2HNZB 3VGUA 2J0WA 4V19X 4BDPA 1FJEB 1SKUB 4IOAQ 3W62A 1FRKA 5M2UA 4B9NA 1QE1A 3KK2A 4WJBA 2DNRA 1MNEA 3O44A 2MTLA 3HHLD 4XO0A 4NZ0A 4I56A 2R7SA 1N33F 3G8QA 2O66A 3RRHA 3QGGA 4IRDA 4ZVSB 3DRYA 3UNGC 1TZ0A 1XNRF 3GMGA 3K5NA 3GFYA 4GKJF 5CABA 4YDDB 4F4YA 1Q1KA 5E3PA 5AT1B 4QIEA 4DV5F 4WFBQ 3DYAA 2LYVA 5KG0A 2V9KA 1GFWB 3I5CA 2R42A 1V9OA 1XIQA 2DGVA 2R7OA 1FNXH 4ZVUB 3O2IA 1K8AT 4JI6F 1E6YA 4OYOA 2CPXA 2I2YA 3R1HA 5HVGA 2C2ZB 2ZNYA 2QV6A 2GVZB 4NEZA 1GMUA 2KU7A 2K8GA 3DLBA 3KOAA 1RGVA 2C2NA 5FDLB 4DCOB 3H25A 3HHLA 1CC7A 8ATCB 4ECSA 2OTJS 2W4PA 3TUJC 3M8QA 2QTWA 3PO5A 3KHLA 4GC7A 1OJ4A 5KAKA 3N6LA 1AXQA 5J2MB 4MKVA 3BREA 1NJWA 2R2RA 2LDIA 1J5OB 2ACMA 3UR0A 4ZPVR 4B3OB 1VQLS 4H4MB 2XMWA 5C2CA 3QWPA 3FEXB 4WZQA 2A6OA 1MSWD 9ATCB 4M5DB 3O1LA 4UT4A 2GO8A 2XB2D 3AY0A 4Y2AA 1S57A 1WHVA 3DLGB 5KFEA 2DGQA 1DBDA 1MWZA 1IM6A 3BR8A 2G4BA 3OXGA 3HJVA 2UXCJ 2JFKA 4DU7A 3JYTA 2IA0A 2DXEA 1S4FA 2BRLA 4TY9A 3W64A 5EWEA 1RT2A 4JI2F 4EI2A 2F65A 4NCGB 5A8RA 4QCLA 1A0OB 3SIPB 3BGLA 1UWBB 1TFYA 1UL3A 1NK4A 3HT0A 2VA3A 4JI1J 2DISA 5ETVA 3VCDA 1DAXA 1FJGJ 3P3DA 2UVVA 3W2WB 3G6XA 3KHHA 2U2FA 3NNCA 2CJKA 1RAGB 2CA9A 3PV8A 3KUEA 1U8SA 3KUGA 4QWBA 1KVKA 3GQCA 1RDRA 2LKZA 1TKZA 3C16A 4OYBA 2MZJA 1WWHA 4M5JA 2ILYA 2C22A 4IH6A 3R9LA 4LF4F 2WZ1A 3EDQB 2OPSA 3OLAA 5DQGA 3T6BA 4R8UA 3CD0A 1YGYA 2L9NA 1LK7A 2E29A 4O23A 5LXRA 3ADAC 1BHNA 2JX2A 3D66A 4XDCA 1D09B 1IBKJ 3FRYA 1HQEB 3CDUA 5K5MA 2W8LA 4HEA9 3OVAA 3HVTB 1P8GA 1VQNS 2NZ4A 3ZFVA 4A4JA 2JLFA 1EP4B 3UD3P 4QYRA 1N48A 3BQ1A 1RTHA 3M8PB 1NHKL 5CCLA 2VUGA 1LOUA 1KVJA 5D3GB 3FQLA 2DTJA 2CPJA 3KHRA 4AD6A 2XO7A 2DR5A 2JH3A 2JOQA 3KG1A 5F8GA 2B56A 4IG3A 5I3UA 3SFGA 2EK6A 1PCAA 2ZVIA 1C1CB 3RB3A 4LBPA 2Z8QA 5HJXA 1U1QA 8AT1B 1HWKA 3OSPA 3D28A 1FDBA 1LWEA 1YWXA 3OFEA 2EPIA 1ZPWX 2W7OA 4FYWB 2V5HG 1I1GA 2HQIA 3CEDA 1TVRB 5ETMA 1Y00A 5IWAF 5HQ8A 1NKEA 2XULA 2R4FA 3WX4A 4NCAA 4ZKAA 5B0FA 4F4XA 2JEFA 4P2MA 4DR4J 1BWVA 4PXBA 1ZETA 3QT7A 2DY1A 3M30A 3R7NB 4X62F 1VLOA 4Q44A 5GADU 3VQSA 4O0IA 2HQCA 3FBEA 3A4TA 2W9CA 1VI7A 4NLXA 4WXWA 1LK5A 3QLHB 1PYOB 4P7VA 1S9GB 3I56S 2OPRA 2AMCB 4IFYA 3I96A 2Q6CA 5HN0A 3DXBA 1U1LA 1B7YB 2EFQA 4C0BA 2FLPA 3DOLB 1KQGB 1VIOA 3E51A 1T9XA 1KRPA 2WTFA 1IM4A 3KG0A 2LQ5A 1ITPA 1QY7A 3R8YA 4OI4A 4IFVB 2E9ZA 4DF4A 4BC7A 2IM3A 1F5BA 4I4BA 3MR3A 2PC6A 2IBKA 1WI6A 3W2VB 2F3JA 4JI0F 3A8KA 3R5AA 5H9FJ 4WWSA 4DOZA 5AXMA 2RILA 2KHCA 3M2UA 4PWWA 3F56A 1H3DA 4WK3A 5CH7B 5D0RA 3A8JA 3ENWA 3M32A 1ZA1B 2F9JA 4DQSA 4E0DA 1RLDA 3TW0A 3MM7B 2OO4A 4MJKA 3RUBL 2NS1B 3EVWA 4ZIWA 4YHHJ 3JAMU 2UUTA 1B99A 2B4UA 2RSQA 1VQ6S 1FA0A 1CS4A 1VQ8S 1PG5B 2DGUA 5HK4A 4U9RA 1VRUA 2HPUA 5B0DA 2H51B 2MZQA 5HMXA 4DUZF 3R1LA 4ANEA 5HROA 2ZM6F 4ED3A 3OL7A 2DCLA 4QIWD 4DPXA 2KRBA 3TX8A 1Y5NB 1LW2A 2AYBA 1RA6A 2XSJA 5C25B 5CD4H 3AOAA 5KFOA 2KG1A 5KFBA 3FC9A 3OTEA 2W9AA 2GV1A 2VH7A 4CO1A 3THVA 1NZAA 4LF9J 3L9ZA 1ZH5A 3DM2B 1SJ4P 4NA2A 3CMAS 1BQNA 1MG7A 1RWVB 3PW7A 2VG5A 4USIA 1AYEA 3JQMA 1RT7A 2B43A 3A1YG 4QR2A 1P1TA 4IQXA 4HH1A 1X31C 2W7PA 3DLKA 5KFLA 3GILA 3EPIA 2XS7A 4J9SA 2HQDA 1UKUA 2Z2LA 3MPYA 4P6QA 2F7VA 4HT5A 2UVWA 1KOOA 2NR0A 2X1BA 3DMJB 1SB6A 1HWUA 1N32J 4AQYJ 3P5TL 2Q43A 3MM9A 5KG3A 4JV5F 3SSQA 3FSYA 1RTIA 5HLFA 4OZ2A 4WIIA 2JWNA 3CO9A 2PIIA 2M70A 2YBVA 2ACYA 2FYXA 2CQ4A 1FFSB 3LAKA 1Q95G 2QSFA 5DO2A 1WORA 2OFHX 2WONA 1FI4A 5JVGQ 3K7RA 4LR8A 2GIRA 1JLEA 4RBTA 4IDKA 2E1MC 4C3KA 4OLOA 4QR1A 4LIRA 3JSYA 3MAAB 2DR6A 1RT6B 1JXVA 1U1KA 3ISNC 9RUBA 2WB1D 3T5LA 2RS2A 1RE1B 4CDIA 5KFGA 2YPYA 1N88A 1H0HB 3R6GB 4OI3A 3M4XA 2PI5A 3MM6A 2ZZMA 2RHSB 2XWYA 4ZJOA 2IMWP 1AFJA 3PW0A 3NGTA 4P2XA 3DOMA 3EGWB 4C48A 3IS9B 4KBIA 4LREA 4RL1A 2EBEA 3VAFA 3C3LA 3QO9B 4AT1B 2VFTA 2R7QA 2VFVA 3HHKA 1RUSA 4PG5A 4PR6A 1KOHA 4DR5F 3DDNA 3LP2A 3C19A 3QZ7A 3PKMA 4EUVA 1ULRA 2WSEC 3UVJB 3H5UA 4DL6A 1NM2A 5KFJA 1F1BB 3EE3A 3LUYA 3FZ2A 4WZMA 1G2EA 1R8CA 2VJVA 2UUCF 2HHSA 1R8PA 4QU7A 4PAAA 2E1AA 4DX6A 2GIFA 2P9GA 1CJVA 4M5MA 2WVBA 1E6VB 4ZJQA 4WYLA 2YX7A 3NGSA 4ETZA 4FXWA 1RB0A 4ILMA 3IR5B 1TL7B 1FRHA 2CNKB 1VK3A 4DR1J 4RW7B 3SZ2A 3OHBA 5KFTA 1LWFB 4LFBF 3JTPA 1VLYA 3VAKA 2ZKUA 2J9EA 3FCHA 2GZOA 2ZH9A 1S1XB 3QWUA 1R8BA 4F02A 4NLSA 2CQ0A 1XJWB 1U6BA 1FVQA 5J2PB 1CJTB 5BR8J 5GAHI 1Q79A 3OSNA 4FF4A 3UFCX 2DB1A 1N34J 3ELHA 3HHNB 2FJXA 2CQ1A 3DGVA 3T5KA 4J9RA 3UW1A 5J2NB 1WOSA 3W60A 1VQMS 2G2ZA 4IG0B 4RNHA 3EJMA 4YY3J 2PD1A 3BF4A 4B9TA 2VB6A 2FVQA 1BGXT 5IT9Y 1VGYA 4TNOA 4M94A 4KPYA 1UPMB 3FQKA 1VBZA 2MHEA 3BGOP 1FWLA 5DM6Q 5M2PA 1HNWF 4LF6J 1TL3B 2OPPB 2W1BA 3FBFA 3HHDA 2R7UA 4QWEA 4N77A 3I4PA 1RTDA 2VONA 4TU7A 4Q0BA 2NQPA 2FB0A 4F7VA 1XR6A 3KDNA 2R3VA 2YQ0A 2LXIA 2PN6A 3GR0A 2YQ1A 5HP1A 2VQFF 2DO0A 3JSRA 3TJ8A 2R7WA 2DK2A 3U7JA 4F36A 1WKLA 3OXLA 1C1BB 1RU1A 2BKPA 1ZZNA 2FLOA 1WSVA 2QN6B 4RW8B 3PX4A 5EDWA 1RABB 1U0HA 4M5NA 2ZFHA 1QVFR 1PILA 1TR0A 1RAOA 1PJ5A 1IKXB 3W7BA 8RUCA 3B78A 4M5KA 2OEMA 3I5AA 4C8NA 3TR5A 2LDYA 4JOUA 3OTOJ 2DNYA 3WC2A 1UEKA 4L76A 2BMBA 3FBBA 1JX4A 4DL2A 1JJ4A 4K4YA 3D54A 3AJ1A 1X0FA 5ETLA 2Y8WA 4F25A 1T02A 3W8PA 2GHWA 2JFDA 4ICLB 1WG4A 3IGNA 4ID5B 3UCGA 2KKHA 1DTTB 2DRBA 2ZHBA 3C6TA 2XEXA 2H65B 1Y3JA 4L75A 4GKKF 4K4WA 5DG7A 2VG6B 5D0EA 4I2QA 5F41A 3J7Z5 3EUNA 1LNQA 5EHHA 3UDVA 3RAXA 4C8ZA 1O6XA 1IBCB 5AJ3F 1GH8A 2XLIA 3EICA 1OPZA 5B0GA 3MDFA 4O4GB 4CLTA 2XMUA 3KDOA 4HDGA 2ZC4A 4ELUA 2KN4A 4YB1P 4ETXA 4DR7F 1FKOA 2FHKA 1F3VA 1IQZA 2MEWA 2AU0A 1SL1A 3L3CA 3M6UA 3RAQA 1ZTTA 1IKYB 2MKKA 1M5KC 2K7KA 2UXDF 4MFBB 3ET6B 2CZ9A 1NNDA 1H38A 1S99A 4HVZA 3W5ZA 1S9EA 4PYDA 4MH8A 3LPEA 3H42A 2GGPB 1HPZA 3M9NB 6FDRA 3H98A 3MUVP 4X64J 1YBUA 2UU9F 3RW7A 3KUHA 4UOFA 2UUWA 1VR6A 3Q8UA 4ZVOB 1KN6A 2ASYA 2IA6A 2GNKA 2ZKTA 4KO0A 1WOOA 2DGWA 1HNXF 4JI8J 2VU5A 3DDKA 4HI1A 3MPUB 2HLTA 1RT5A 4OZNA 3OFHA 1K44A 1BWEA 1W26A 2M4MA 4L73A 2QC3A 3G71S 2VG7B 2Q79A 3ENVA 3C14B 1SH3A 5GVQA 5DM7Q 3Q22A 4ILLA 3GJSB 1KQSR 1TU0B 3KK1B 3NS6A 3MR7A 3G8SA 2BW7A 3IM9A 1C0UA 2YNGA 3QT5A 1UW4A 3DXSX 2ZOGA 2AZ1A 1NSQA 3D3CJ 4F4ZA 4USWA 4WTOB 2CJXB 3V81A 3GCWP 1EKSA 3CDAA 2AWZA 1RHQB 4FS1A 2CUYA 4LSNA 5BYRA 3KK3A 2IJRA 4KKOB 3EWGA 2CXEA 2LVWA 3NGRA 2H4WB 5BYQA 3OR2B 1RWOB 2BE9B 5HATA 1W7WA 2YTCA 1X9SA 2VOPA 1NDLA 1Q8KA 4YMEA 1U1MA 2IC3B 5D8HB 4JI5J 2ALYB 4M63A 4B9UA 3AH6A 5FDLA 1R43A 2PA3A 2KXNB 4GVLA 2BYCA 2DRDA 3BQ2A 5L39A 1L3SA 1ZM3A 4YR3A 4X4PA 2B8QA 3K17A 3KLFA 3F0NA 4X66F 4F0MA 2VFUA 2QFIA 2CVEA 3OJSA 3KJVB 4Q7AA 4TLQA 2X51A 4LF8F 2PSZA 1VBKA 3QJPA 1SL2A 2RQ4A 3TVKA 3HF5A 1N36F 2ZE2A 4ZMMA 2DR8A 4NLWA 4M1KA 2XZTB 3OQ2A 2D3ZA 2EFNA 1NJXA 2G0IA 2AEFA 4X4QA 1W2IA 4LF1A 3OT9A 1NSAA 6AT1B 5B0EA 4C9DA 1NXIA 2DHXA 1ZTWA 4A8WA 3BN7A 2W4CA 2EXUA 1SUQB 1C4CA 2DNNA 2FC9A 2Z56B 3JSBA 5ADZA 2ZH6A 1JWWA 1HHTP 1S6PA 2HHTA 4QIVA 2LU2A 4RUCA 1NLKL 1QTNB 2YNIB 2DHAA 4Z7CA 4OZ3A 2ZZTA 3LGHA 3ZZTA 2LQBA 4KGMA 3HULA 4DLEA 3DRXA 3ZNJ1 4DU8A 2WRMA 1RTJB 4C4WA 4CLYA 4WPAA 1VC0A 4LFCF 2YKQA 4CH0S 4DR2F 2OP5A 4URQU 3RB4A 1NPPA 4B3SJ 3CSKA 4P2SA 4KH1B 1NO8A 2D1CA 1WHXA 3LGNA 1UZHA 5AXKA 1REGX 4QR0A 4ZPDA 1HBNA 3UDEA 3TANA 1U2FA 2IBOA 3CGIA 3CJKA 5CYQB 2LQ9A 5KT5A 3MOZA 4NCBA 3QYYA 3HVAA 3M6WA 3AB2B 5HMWA 1HNZF 1U49A 4OJ3A 2AJQA 4Z37A 1OY9A 1PSDA 2E7XA 2AD9A 1LQ9A 4CZCA 5E5NA 1FFWB 2G1HA 2XMMA 1QLNA 5BXIA 5K8NA 2GA7A 3QT6A 2HHXA 1M5HA 2P6TA 4F0KA 3HVTA 4K8RA 4DEZA 3M2VB 2EI5A 3POTB 4CLUA 1V3ZA 3PJWA 5ITHA 5L1KA 2DNOA 3MURP 5T14A 4ZP9A 4NL5A 3LP1A 2BQUA 3K59A 3E01A 1S0NA 2MQMA 2QL9B 1OQ6A 2KT2A 3DCAA 2EC0A 2CQBA 2V34A 1L3VA 3GFZA 1YIJS 2BE2B 3LW5C 1UFWA 4CIOA 3PHEA 1MROA 1TL5A 4DPUA 3DKDA 4CP5A 3SQOP 1N33J 3LP0A 2M8HA 5KOWA 3WBZA 1WKJA 2CNLB 5LSLA 5EX3A 3MEGB 5DLFA 1XNRJ 1GTHA 4GKJJ 1H98A 2YNFB 1S1WB 2HS0A 1EJ7L 1DTQA 4CT8A 4R0EA 3V4MA 1FEHA 2I5JB 3FUYA 4UQGA 4DV5J 2E1RA 1MLAA 3B4MA 1HHQA 1HBMB 3ZNUA 3UPFA 3CC4S 2CQPA 2V2ZA 4Q2LA 2AV5A 4CNYA 2ZH7A 3EGNA 4JI6J 1X4GA 3D1OA 1FKPB 3BDEA 1JLFA 4EYIB 1WC6A 4CLPA 3LO3A 5HBMA 2MQNA 4ECWA 1GK8A 5CQGA 5EGYA 3MM5B 3G9CA 4ZN3A 1X4CA 2RF2A 4QYZK 3KLGB 2HGMA 4I2PB 2EBGA 4HTJA 2CQ2A 3QFWA 2Q3PA 4S0MA 1RAJA 4FN5A 4IKAA 1AUDA 1MMNA 2P6SA 3QIPB 1UETA 4FYDA 3I0RA 3QFHA 4NX9A 2LCWA 1GQEA 3GJQB 2AZ3A 4URGA 1FX2A 2DH9A 2G2OA 3G6VA 4JYAF 3GSIA 2DVIA 2B5JA 1GAOA 3FSXA 1IR0A 2KTQA 3PR5B 5KT4A 4CLZA 2OEKA 2X7IA 2DPJA 4ZLLA 3J7A1 4ATNA 2JVRA 5DETA 2MKIA 2QA2A 1GMWA 5BYSA 2J76E 3NP5A 1JLCA 4P10A 7FD1A 4ZOSA 2NXNA 3DDIA 3PX6A 2HFUA 5CAAA 1D3WA 4YDXA 4ECVA 2HNYA 5IT0A 5AE3A 4U67Q 1NDKA 4P75A 5I3PA 3VZHA 1KFDA 2XTJP 4JI2J 2HK3A 4LF9F 1KTQA 3ENAA 1GNKA 3BBCA 4FPIA 2CZ4A 1KLMA 1SVDA 3SBMA 2V2VA 3QQCD 2DR7A 5ETNA 2Z2ZA 4PQAA 1RSCA 3Q2TC 1D9FA 4LSLB 3JAMY 1FRJA 2F8MA 2FY8A 1FD2A 4W98A 2OD6A 4DPTA 2CDRB 3S7RA 5FLXU 1B4SA 1BUXA 4AL6A 3C66A 2IM2A 2DKOB 1X5PA 2VBYA 2AEJA 3NLCA 2V69A 4LF4J 2K3IA 1N56A 1RQ0A 4QPTA 5LM7E 3IAS9 1JLAB 2MLZA 2IDEA 5DZ7A 3GU0A 3RB6A 4RW9A 1F9EB 1F3FA 3TP2A 4B3MJ 3PJXA 4MIBA 5A0YB 2L3MA 2W4DA 3C15B 4OI1A 3GV7B 2R8JA 3NGKA 1D8ZA 4FKXA 3SV3A 1N52B 2OIHA 3T1YF 1WUUA 4ES2A 1M0SA 3PJ9A 4AYBD 2IAJB 4NYZA 3QGPA 2AJ2A 3B8HA 3HZGA 4ZCMA 2O67A 2IVFB 5EX0A 4OZ1A 1OY8A 4WIQA 3DN9A 4W4MA 1H7XA 3SSRA 2B7BB 3UN2A 1VS3A 2POKA 1X4DA 2ROEA 4PRFA 2XS2A 2QYCA 4URSA 3KLHB 2RVJA 2Y3YA 2FD2A 4YUDA 2NYIA 1KONA 1RT4B 2CNOB 2DXDA 1RT1B 3OVBA 1XERA 1URRA 2VF3A 5BJRA 4MTPA 4ZDNA 1T3NA 4YEAA 4LF7F 5CYJA 4ZVPB 4K5SA 2H4YB 2GQQA 3K5LA 2NXUA 3N6NA 2AYEA 2VFSA 3UD4P 3IO1A 3ZZ0A 1V5VA 4WU3A 5IWAJ 3M1VA 3G6ES 4HH0A 4L6V3 1FO1A 1JKHB 3O5TB 5KFCA 3DU5A 4PWUA 5LL6d 1RXOB 4X62J 2MGZB 1MU2B 2Y1JA 4YOEA 2W9BB 3H4BA 5KG7A 2G2YA 2JZ5A 2HFSA 4WFAQ 2HRTA 1LW0B 2B51A 1Z4UA 2EWHA 1YK9A 5A8KA 3GB0A 3CIZA 1NB2A 4E98A 3P96A 3EGZA 4TXSA 3Q0AA 3A3NB 1U6ZA 2YKAA 1CULA 2NUHA 5ETQA 2ZH3A 4I7FB 1Q8LA 3C6UA 2JEJA 1U2RA 4DQRA 2JHEA 2B6AA 1LXNA 3QMQA 2MZTA 1ZA2B 4A8SA 1IBLF 3TOQA 2OPQB 3MD1A 3US5A 2HKEA 1TK0A 3DRRB 1VQ4S 4JI0J 5KFDA 3LH2S 3ZO7A 2R8IA 4G6VB 2C2MB 3GFXA 4NI2A 3TZZA 2LEBA 1SH0A 4HACB 2V4RA 2XC9A 2HHWA 3PW2A 1X5TA 5I42B 2HVDA 2BDPA 3RB0A 4PG4A 2J6UA 2IRXA 1R6VA 5AE1A 4CWBA 3K58A 3IMQJ 4RW6A 3I9ZA 4F67A 2G0JA 2ZH2A 1FDAA 3SXLA 4KY3A 5K20B 3H5SA 3PYFA 1U47A 3V6JA 4KHRA 4L3NA 5MLCV 4DUZJ 2ZM6J 4ZVEA 1M5SA 3DRSA 2ZHOA 2UXBF 3J80U 4PUOA 2L9DA 1U1RA 1D9DA 1M1GA 1QDUB 1RACB 1IKWA 4PXEA 2L48A 4KR0B 2MXYA 1JMTA 2J0XA 1NMEB 4CO2A 3MM8B 4M5GA 2BBEA 1SH2A 1S7HA 4FXDA 1T03B 3JQJA 4KJIA 1JLGB 1FKAF 4LBIA 4NLPA 1SI9A 1QTMA 4CYUB 4GC6A 3T9ZA 1HMVB 3MEEA 1R8HA 2WSFC 3CPWR 3NY0A 1FXRA 1Q16B 3DI6A 1UFKA 1ZM2A 2JRSA 1Q86T 3OFGA 4WP8A 2RU9A 1XWLA 2XHWA 5C24B 1FHTA 2HBYB 1AZSB 4DL5A 3OHAA 1N5SA 3VALA 3EZOA 1REVA 4F04B 1ZZFA 2MJUA 4HTIA 4RLEA 5K14A 2D7SA 2GHVC 3FMWA 1DZ5A 3GZ7A 4DHVA 3MF5A 2MZ1A 1TTHB 2MHNA 3RG6A 4JV5J 4LRFA 4O4RA 1GX6A 2AJ0A 5F9NA 4KIAA 1QUVA 1TKXA 4EWTA 3KXDA 2AT1B 2BJ3A 1T05B 4N56A 1FF2A 2HRUA 3AOBA 1DQ8A 2DGSA 1X0PA 4Y0FA 2J8SA 1PIEA 1HYSB 3BPDA 2AJ1A 2WK4A 1KEKA 4FDFA 2LA4A 2DNHA 2RKIA 4DL0C 2YNHB 1U1PA 3THTA 4R25A 4ENOA 3LANA 4KFBA 1G4CA 2LQJA 2VDIA 3MR5A 5IM0B 1A7GE 4HHUA 3OXFA 3CJ0A 4OX6A 2FLLA 4L74A 1XQIA 2W24A 4B9SA 4RO0A 2J0QD 1TUVA 1LWCB 5F8NA 4YB6A 2B9XA 4H4KC 2AQ4A 1JLQB 3FZBA 3KLIA 3RAMA 3EYZA 4O0NA 5L9NA 2WOMA 3OPKA 5CZVA 2DGXA 1RWNB 3BSNA 4CM2A 1SJ3P 1X4BA 1W25A 1NK6A 1NAQA 1OMSA 5DG8A 3SQGA 4DR5J 3PG9A 1NPRA 5T7LB 3RGIA 2A1BA 2L08A 1R8AA 4YB5A 3KLVA 4RR5A 3MMBB 3PEHA 1WHWA 2YKMA 1KTVA 3IBWA 1OO0B 4GVBB 1TV6B 5KG5A 2CJBA 1RWUA 3LPYA 2APOA 1F5AA 4DN9A 4NLQA 1CSJA 2CJYB 1SQGA 3BGUA 4FXVA 2IY5B 1BD6A 4F2SA 1UVLA 3MMAA 2G13A 5A8WA 2XNRA 5IV3A 3F41A 2H48B 3TA2A 2CPYA 3DGPB 2G9OA 2ZITA 3BBBA 5EUHA 5CD4A 3IWNC 3ILOA 1FFGB 3L7OA 1IKVA 4LFBJ 1RAHB 4PXCA 4O3QA 1TAUA 4U8YA 5ETKA 4TVAB 2X1FA 1N5YA 4QOTA 2DNZA 1RU2A 2XNQA 2PE8A 1R0AA 2VC0A 3W65A 3CDEA 4N7TA 3C46A 2BANB 1XMQF 3DHXA 5HMYA 2NPFA 4M5HA 3PY8A 5J1EB 3G2XA 3PHTA 2R2UA 1R27B 1VFJA 1B7FA 3R5DA 2OEJA 3RU0A 1OPIA 4Z7YA 2RUSA 3C2PA 4NA1A 4F0HA 3HZEA 2XO6A 2CNNB 1HI1A 5K8PA 5G0RB 3GG0A 4O44A 1HNWJ 4F4AA 2HNDA 2LEPA 2CJAA 1NK5A 1S97A 1HWLA 2VASA 3VV2B 3PYEA 4ZP8A 2HK2A 2OI2A 4UZCA 1EETB 1WHYA 1QUPA 2Q1LA 4GO7X 2B9EA 3HFVA 3IBCB 2VQFJ 3IRXA 1VHFA 1Q81T 3BGRA 7AT1B 1QM9A 1YITS 2XI3A 1TKTA 4EO6A 1HBOA 4DG1B 3KLEA 2JLEA 4H4OB 4F4WA 4ANDA 4DS5A 3N4WA 1WF0A 4X84A 3VAHA 3SDEA 2JC0A 4P9SA 1VISA 4B3TF 2BQ3A 4DQPA 4DX5A 5B0AA 3Q2SC 4GMKA 3NRBA 3G6YA 4P73A 1SC3B 2CQ3A 3GONA 5E7OB 3ZTSA 1S6QA 2ZWOA 3R7SB 3HKWA 3BSCA 2BJ9A 4KH0B 4OZLA 4USJC 2CWXA 3J7YU 1QAIA 1ZPVA 2DH7A 1FDNA 2KO1A 5GAEU 1OYDA 3DRPB 5I4MA 2XQCA 4TQRA 2BZ2A 3CTRA 1KNZA 2OD4A 5HSPA 2FGOA 3NCQA 3FCVA 4ZLJA 4M5IA 4OX9J 2A2DA 2YVSA 5C7PA 2VOOA 2C2RA 3NL0A 2R9LA 1QE1B 1RHRB 1O51A 2RIJA 4P7TA 3KK2B 1RHUB 4GKKJ 3AA9A 4UOHA 4J9LA 1L3KA 2F8HA 2IRUA 1Q5VA 4ED5A 3QZ8A 1FERA 1PJ6A 1U7LA 1GT8A 3ZXWA 4J9QA 1IR1A 2LXUA 2GVDA 1XR5A 3AOCA 5AJ3J 4IOBA 2MMYA 3ITHA 1DY3A 2VQEF 1RP5A 1MWQA 1XBWA 2BW2A 2ADBA 4RJVA 3VR1A 1CBKA 3DLLQ 4WF9Q 3I5BA 5KFYA 5U47A 4A8MP 1S1UA 4DR7J 5K9FA 4FKYA 4PXDA 4O3SA 3DYAB 2JC1A 2UXDJ 4DXLA 3MMCA 4ITSA 3MFIA 1J2VA 4RU9A 4NLVA 1E6YB 4XIUA 1U1NA 1SKWA 1C2PA 5IQQA 4TN2A 4PG7A 2B9WA 1FD8A 3WDOA 4B08A 4A8QA 2UU9J 3HHLB 3N01A 3D68A 4KGKA 5HQMA 2RS8A 2RDDA 3R5GA 1IR2A 1T3OA 3TAMA 2C3UA 3M8QB 1HNXJ 2NPIA 3HDSA 1A9NB 2D3OR 4HYKA 1NJIT 2ZBIA 2FQQB 4HT7A 1TMJA 5HO4A 2W25A 1GXLA 2XMVA 3BDPA 3NBPA 4UQTA 5KOXA 1AB8A 2EKYA 2DCUB 1WG5A 4ZVFA 5GAGI 2AJ4A 5FJ4A 3N5BA 2AKWB 2OMLA 3MTJA 4PQUA 2QMXA 3PW4A 2B0GA 4TLRA 4N47A 2W8KA 3JSMA 4JBCA 4NEYA 4K4ZA 5KFQA 2AP6A 2CJQA 1F9HA 3IGVA 4K50A 2BJ7A 4WU2A 1RHKB 4LRAA 4CO5A 1SKSA 4ED2A 3QJLA 3MZIA 4J7CA 4UUWA 4Y2IA 2EK1A 2RMLA 1UVKA 4U96A 3JYTB 5IT4A 1KDNA 2C1EB 1RT2B 4G1PA 1S49A 3CCTA 4OI2A 4KSEB 3SCIE 3WIUA 5A8RB 4C7QA 4DFMA 2DR9A 4LF2A 4WP3A 5KFWA 4EBCA 2FVPA 2QSWA 4OYAA 3VWSA 4KGVB 1SCJB 2X3GA 2NLWA 5KT3A 3H5YA 3BV8A 1B0VA 3CCZA 2ZH4A 5CZXA 4ZPBA 2EFVA 1FNOA 1T9YA 4K2XA 1Q78A 1D8YA 3TUPA 3KLGA 4BC9A 1J27A 1TKZB 4ZP7A 3C16B 4X4RA 3MR2A 1ELOA 2V4JA 3OUYB 1KQKA 4ZK7M 4X66J 2OPSB 4R8UB 4LF8J 3M7VA 1QSSA 4DFKA 1NK7A 2QIFA 3QGHA 3TNVA 3KNAA 1HNVA 1SPBP 3FSIA 1N36J 3G8TA 1FXDA 3OTCA 2OTLS 4AXIA 5HQLA 3V4IA 4J90A 1JLBA 3LALA 3MEKA 3DFEA 3UR3C 4OX8A 2WAQD 1UWAA 5F8LA 4DV0F 3S6EA 1RTHB 3T3FA 1U26A 1RWKB 4EBEA 1S0MA 3K5MA 3A3OB 2BE7D 1U24A 1WEXA 3EPGA 3H40A 1DFDA 4J9MA 2UVRA 3ILLA 4DX8H 3G96A 1QSYA 4AXJA 4IG3B 3QPIA 5I3UB 3WX8A 3ZZZA 4ED4A 5LMNF 3OR1A 1NCLA 3FGVA 4B02A 5LMUF 1DQ9A 4LMZA 4LFCJ 3BN4A 4DR2J 3OL6A 2E9RX 2GX8A 2KM8C 5KFAA 2D9PA 2FHJA 1LWEB 4J5OA 1TUGB 4U7UD 4OI0A 3BSAA 1D1UA 3KMSA 3I0SA 4MKAA 5C2GA 1JJCB 2KM8B 1HR0F 5KG1A 4LBHA 1Y3KA 1H74A 3BSOA 1PBUA 1HNZJ 3GIRA 2KXFA 4G1QA 1WOPA 2W9CB 4B3MF 2CQCA 1B0TA 3TZYA 3DLEA 3KJQB 2OPRB 4IFYB 2W01A 2D3UA 4MYTA 5KG6A 1NK0A 1FTRA 4MKBA 4RW4A 4WE1A 1P6TA 1CPZA 2V63A 1PO6A 3V2UC 1R31A 4B17A 2V0NA 2HVIA 1CJUA 3B82A 2CPFA 1XMOF 3G82A 5ETTA 1Q8IA 4NMLA 3CJSA 2DO4A 3QNWB 5B0BA 2QLXA 3SCKE 5ETRA 3UO0A 2VV5A 2AJFE 2RQCA 1PC4A 2ZBCA 3OTDA 3MGJA 1YJUA 4LFAF 5F3ZA 1WDTA 2EFOA 4ZPWR 2FHMA 3M2UB 3WHIA 5GMEA 3N6MA 2BJ8A 3M32B 3WQPA 1APSA 1N54B 1FCAA 1NKCA 2D9OA 4PPZA 2R7VA 1FE0A 4CI0B 1YKWA 2CPZA 4X65J 1CS4B 4L3KA 3MEDA 2DNGA 5D78A 1VRUB 5H9FK 4FNIA 1WC5A 5HROB 2FUG9 3MPWA 4ZJLA 3EX7B 2XSJB 1HW9A 4F2RA 1YJRA 3V6DA 2AF6A 2YQ3A 3QRRA 3MUMP 3ZTRA 1BQNB 3KG4A 4IRCA 5IXUA 4X4OA 4LT6A 3R2CJ 3TRGA 2YWKA 4QW8A 2VG5B 1ZM9A 2HIQA 1N5QA 1XNQF 2OJ3A 1VRTA 3FKBA 3Q8YA 2BXJA 1UP1A 1I51B 4NLTA 4H54A 1HNIA 1H72C 1QJHA 2HEKA 5KG2A 2KZZA 3CE8A 2XSFA 4XPEA 1G7CB 3CJ4A 2MPUA 4NASA 3TA1A 4WXOA 1S0VA 3QSIA 1DLOA 3P45B 1BQMA 1RWMB 2M9KA 4JV0A 4RZRA 2UV8A 5D4OA 1JJHA 3PRBA 4JYAJ 1JQGA 2FPHX 2J6SA 4PYAA 3MM9B 1QD1A 3M8ZA 1U0SA 2YWEA 1RTIB 1S72S 1YJNS 5HLFB 3WIVA 1RCXB 3CULA 4J9NA 1TL1A 1IBMF 2Y0BB 3VGSA 4U7UK 3OL9A 1YLXA 1HQUA 4E8UA 2PFDA 3NNAA 2ASJA 1VQKS 3W63A 2MLYA 2MQ8A 2WONB 3MUTP 2XWXA 2N82B 2H1YA 1JLEB 2MYFA 4DV4F 3H4DA 4IDKB 2FVRA 2Z4PA 3FDSA 4W92B 3L4BC 1S4EA 2AYGA 4KYZA 1EKRA 3K0JA 4USKA 3IG1A 1FDDA 1X5OA 5KFHA 3NWRA 2OSQA 3S1TA 3S01A 3EZ5A 3I31A 1S1VA 1PAUB 2IYIA 1UZDA 2L9WA 2HSEB 5D0HA 3GIKA 4K4TA 3MM6B 1T9UA 3LWMA 4KV8A 1S76D 5L1JA 2JL9A 2VPZB 3W9IA 3DOMB 5CYMA 1SQFA 2CPDA 1VK8A 5IV4A 4C11A 4RUBA 2WW4A 4RUHA 4DV7F 2ADCA 4ERDA 1B3TA 1FK9A 2HZVA 5B7WA 4NLRA 3LP2B 5C42A 4KRWA 1K0VA 2ATLA 3D0IE 2R8GA 4OHYA 2KH9A 4F50A 1OS5A 2HMIB 3A3PB 3NOGA 4DWIA 4UW2A 2ZWPA 2O1PA 3K2YA 1CQNA 1NJYA 4ECRA 1CJVB 2KI2A 2XLKA 2Z2YB 5FIIA 3T1YJ 3UI3A 2RD5C 1UEVA 3HSJA 5AXLA 2BJEA 1SV5A 4BCAA 1KC8T 4K4UA 2V2KA 5IT9U 3U02A 2XLJA 1UVNA 4OV6A 2FJWA 2HAIA 4U6PA 2HQGA 3NG8A 3OTBA 3EZUA 3DNCA 3JTNA 2DY9A 1HFEL 1YJTA 2HBRB 3NNHA 3IWLA 2MY7A 2K1RA 1DURA 3I82A 2R2TA 2HHUA 1RTZA 2V4QA 2QA4G 4OYWA 3M9MB 2YKNA 4LF7J 3I32A 4RUAA 1S6UA 2BVZA 2B4PA 2KJWA 1JNZB 3ISND 2M88A 5J2QA 5KFKA 4DI6A 4NA3A 3PXGa 3TWZA 1VC6A 3AT1B 1DQAA 1RT3A 2VHGA 2DT9A 1CJKA 4DJBA 2OLWA 4X4NA 1Q7LB 2EFGA 5JJBA 4Z2XA 2RJZA 2EW9A 1SIZA 3E2EA 1G3OA 2ZD1A 4C6AA 3H2LA 1RTDB 3BPSP 4Q0BB 4KTQA 2RT3A 3B6BA 4NLOA 2IIHA 3NMAA 5HP1B 1H2UX 2RQKA 1S79A 2AX0A 2Z0GA 3O6QA 4KB7A 3BYPA 4TY8A 4CTAA 5FD1A 2D3O1 5JUMA 3SEOA 3RRKA 4NE9C 4USTA 2G0CA 3BZQA 1UA1A 1S1TA 1IBLJ 1U0HB 3M8YA 1VQPS 2RDIA 1T9WA 2A2CA 5KFPA 4ALZA 1V3SA 4DF8A 1RJJA 4J9KA 4AUKA 1KWMA 2JEGA 4ZLNA 1GEHA 5DDPC 4WFYA 5E3CA 3TYTA 2N3OA 4EMDA 1RAAB 4PWDA 3DU6A 3MWBA 4I1TA 1U8WA 3NKYA 3UWTA 4R5PA 1RWPB 2DBBA 4OIXA 1IVZA 3W66A 3CDWA 4EEYA 2UUAF 5L38A 1KBRA 4ECUA 4ZHRA 3CCWA 2OSRA 2HBQB 2E5LF 5B09A 3OVSA 3DHWC 3D5MA 2VKZG 3C6TB 1U2CA 2N7YA 1NK9A 4I2QB 4K4XA 3IRWP 2N4CA 1BY9A 2VIHA 2UXBJ 4DPOA 3MECA 3RW6A 4OHXA 1MMDA 3SFUA 2B4VA 4IOCQ 4EU0A 1RAFB 2Z58B 1UA0A 3VQTA 3EVMA 5A6PA 5KG4A 4DZDA 3EDRB 4IR9A 3F44A 4QWAA 4C2MA 3LGMA 3D0GE 1X5SA 3HFZB 3PKYA 1CG2A 1IJFB 1FKOB 3H20A 1P27B 3M9OB 4B3RF 2NXJA 2OFGX 3K8WA 2VZ9A 1FRMA 2I0XA 3PCOB 4YS2A 4ZS6A 1C0TA 3CC2S 4TYAA 1S9EB 4OYZA 4FF3A 2M52A 2F4FA 1YG0A 1HPZB 1FRIA 4DDFA 4USHA 4DFJA 3FEYB 5IS2A 2GS8A 2ILZA 1SJ1A 3L7PA 2DNQA 4F8RA 4ED8A 2UV8G 2XG8A 2YPZA 3KWMA 4OX9F 1YX2A 2H3EB 1XEZA 3AD7C 3A8IA 4KO0B 5AXNA 3MFHA 3NAHA 4NXMF 3M2RB 2B3TB 1O0PA 2IM0A 3Q8PB 1AT1B 1RT5B 3A8EA 2VICA 3QAEA 2KJVA 3QGIA 4DUYF 4IH5A 2IMOA 2MKCA 3J81U 2HHPA 4WFZA 4O3NA 3SYZA 2I8EA 2V8PA 1NDCA 2DNLA 3I6PA 5DDQC 1JJ2R 4NZ7A 1UJ6A 4BBYA 3AHPA 2E5IA 2WVEA 2CVIA 1I3OB 1N6QA 4DPWA 1WC4A 1TL4A 4I0WA 3FFIA 3RBDA 2HVZA 3CJ2A 1WF2A 3CF5Q 5F9LA 4IO9Q 2HHHF 1C0UB 2YNGB 4LIWA 3DOKA 3LWLA 3AXMA 4C8KA 3RYLA 2FJAB 3BGFA 3V81B 2IM1A 2XYHB 5LSRA 2ASDA 4EZ9A 5A2QY 2MQLA 2IVYA 4MT1A 3GIJA 4Y3CA 4F26A 4X4VA 2FVSA 2K3KA 4Y6IA 2DITA 4LSNB 3KK3B 1HWIA 1PKUA 1HBUA 2R2SA 1HARA 1GTEA 1JB0C 2DJWA 3BO3A 3PRVA 1TP7A 4OLPA 4QU6A 5IOLA 1T11A 2HW3A 4NLYA 2XMKA 4PG6A 4BLGA 4CT9A 3GJRB 5D6GA 3DLJA 3E8OA 4ID8A 1OY6A 2ZUAA 3RRGA 4V19J 3AB4B 2A18A 4ECTA 3MPDA 2KB2A 2C3PA 5HJYA 2HNZA 4LUBA 4I6AA 4LQ9A 2XYGB 3R27A 1RKJA 4LJMA 1YJVA 2W2OP 3X3UA 4HL9A 5L8RC 2XCPA 3O3LA 3D0HE 2KFYA 3TAPA 3CC7S 4J9VA 2NSBA 2JVOA 3UCUP 3KLFB 4IQMA 1NZ8A 2PT0A 3OJUA 2HFZA 3NEKA 3H2VE 3MHYA 1FJCA 3HLUA 1S0OA 3N28A 2ZJPQ 3BJYA 2ZE2B 3TO8A 5J1NA 3D2WA 4C8YA 3ZZPA 2YX1A 3EM1A 1S12A 1TMMA 1VQ7S 4RNOA 1XMQJ 3B4DA 1RWXB 3FJ2A 2XM3A 2DEIA 4ZVGA 4JI3J 3CD6S 3W61A 3GE9A 1LV5A 2XY6A 5F8HA 3IA0A 1U4BA 4LRCA 2CQHA 4ELTA 1S6PB 4UOGA 1PJ7A 3AODA 5HANA 3VVUA 2HQ3A 3HT3A 3P5BP 4MK9A 1N4LA 2HWHA 2C3OA 2GVZA 4G1IA 2MB0B 4HI2A 5KFSA 2VJUA 1X4EA 1F5CA 3HXMA 1RYSA 1WF1A 3T1AA 1NDPA 2F4VF 2WVFA 2PFFB 5DDOC 3FNNA 5KFRA 3CJQA 3CMQA 2MY8A 4QBUA 1HI0P 1U02A 2QX0A 4DSFA 3M8WA 2DIVA 1HBNB 5J2MA 3VAGA 3CJKB 5ETSA 3OUYA 1HLWA 2F1FA 1S5ZA 1J5OA 2V2QA 4B3OA 4J9PA 3CD7A 4JB8B 4B3TJ 2ZBQA 4H4MA 2VPXB 2XHCA 1AUSL 1LWXA 3ZZOA 3HD1A 2I9SA 4M5DA 1WD6A 1W2BR 2PMWA 3DLGA 4M5LA 1F2GA 2M3DA 4K5RA 1HQ2A 3CO0P 3UDLA 4YB7A 2PEHA 1O8BA 2RDJA 2DPIA 3U1MA 2RE1A 1L3TA 2P5VA 1SC4B 1M5VC 1RHJB 2VL1A 2D41A 1NEEA 3LP1B 4NCGA 1ZS6A 4CO3A 3E01B 2M8DB 3OV7A 2C3YA 1DHMA 1UWBA 1AW0A 1Z1ZA 1OYEA 5KFIA 3H59A 4K4VA 1NPKA 4ED1A 1RI7A 3GP9A 3R2DJ 3W2WA 4ER8A 1AFIA 4J37A 2HAFA 5HAOA 5EWFA 2UUBF 1MROB 3BH6B 3R97A 2ZJRQ 4UZBA 3J81j 3LP0B 4JP8A 4KHMA 4OJ1A 2IFXA 4DV3F 1FEEA 1QAYA 2A6MA 1KFSA 2VQEJ 4A8FA 4OYXA 1YRTA 3TQ1A 1TKDA 2QRRA 1YVFA 4WYWA 2GMJA 4KQZA 3HMJG 1DTQB 2W2NP 1VHIA 4TU9A 2VD3A 1RBLA 3K5OA 2HLUA 4DCJB 1VMBA 3CJ3A 2IJFA 4C3LA 1HQEA 1S6OA 4MIWA 4UY8T 2MKSA 4UTGA 2CQDA 2AGOA 2C2OB 2YXLA 1BXNA 3DLHA 1JLFB 4QW9A 1SBRA 4O3PA 5HBMB 4DQIA 1KSPA 2KFZA 1RAIB 1EARA 1EP4A 4A8XA 1Q82T 2J7WA 1AA1B 2JDJA 2V8DA 4J91A 2BQRA 4CRJA 3KNGA 3M8PA 3QSYB 2ZDOA 4YQWA 2DD8S 1UFLA 5D3GA 4DZ6A 4EZ6A 3GYNA 1YJ7A 1U48A 2R8HA 2RF2B 4QZVB 3GV5B 2ZHAA 2CFXA 2WSCC 3TAQA 1CVJA 3GR1A 2IPOB 4BWMA 4C98A 1B70B 3I0RB 1T8EA 1C1CA 4N8NA 2J7UA 5JVHQ 2Y1LB 4Y28C 3ILIA 1FT8A 2B5JB 2LU1A 2AGQA 4CQ1A 4I64A 2R7RA 1WC3A 4X65F 2CAJA 2KG0A 1S7IA 1TVRA 4U8VA 5JXSA 4OL8A 2BM1A 4D3GA 2HVHA 1X4AA 5KFZA 1PYTA 2QMWA 5GMDA 1JLCB 2A0FB 5KFVA 1H2TZ 1VQSA 1N8RT 1WI8A 3QLHA 2VODA 1S9GA 4F3MA 2HNYB 3MAHA 4Y2MA 5CHCB 2IHR1 1LFPA 5GAHU 4I69A 1VQOS 1GMWD 1IWAA 4NYPA 2CKWA 3DOLA 4ECYA 1KLMB 2O3DA 2YWGA 1VQ5S 4QWDA 2J9DA 2AHOB 1XN9A 4FVCA 4LRBA 2RB7A 2FIUA 4FBTA 4IFVA 4FBUA 1FE4A 2GMHA 1XTZA 3PM9A 2ZBPA 3PNIA 3W2VA 4OMFG 4DSLA 5T41A 2HHVA 2EC2A 4LF5F 4XTTA 3PX0A 3R5JB 1YBAA 3GPAA 4Q8EA 4C8LA 1WC1A 4DV6F 4FYXB 1BLUA 1G1XA 2XZDB 4HR2A 1QAXA 1PGZA 3RBEA 4M8LA 4ECQA 2W7AA 1X9WA 5F0WA 2IYGA 3MM7A 3HO1A 4K59A 3CCQS 4ED7A 1Y11A 4IR1A 4RW9B 4ECXA 3Q8QB 1SL0A 2MKYA 3FMBA 5EWGA 4FVMA 2BEFA 4E2FB 2R7TA 4PCQA 4DV2F 3ZZYA 2ZUGA 5E3RA 1Z2LA 5ETPA 3Q8VA 3GSDA 4DS4A 2JLGA 4USVA 2KHDA 4MK8A 2X1GA 1IXKA 5L1IA 2PDAA 4DV0J 3L7UA 1T9VA 1LXJA 3W8GA 4A8YA 2QA1A 1FWPA 4EBDA 3PFOA 2YY3A 3PO4A 3D4JA 2HRYA 1G6BA 2KYXA 5C25A 2NCKL 4OV1A 4DR6F 4YR0A 3IP0A 3G4SS 2V68A 2E5JA 2HQFA 2PO4A 2N7CA 3DM2A 2OH2A 1NRKA 1ICEB 5LMNJ 1RBAA 2CADA 3D9BA 3R5CA 1UCNA 5LMUJ 4TQSA 1S10A 2D69A 3Q8RB 2MQOA 4PG8A 4WCEQ 4DBQA 1RBOB 1WG1A 4NLDA 1X9MA 3LQVA 4QPXA 4QWCA 2YKOA 2HGLA 4ZPTR 2VPYB 3HM9A 3M1VB 4DL7A 7FDRA 1F2HA 4OJGA 1HR0J 3HCXA 3E3XA 1ROFA 2ZZNA 3DMJA 4QJVA 1VDHA 1IUJA 1Y5IB 1CLFA 3VAJA 1CEZA 4LSZB 1U6FA 2HMIA 1YJWS 1WACA 4RNFA 3W3SA 3TQEA 1TK5A 5A8KB 3ENQA 5F3TA 4Q8FA 4KHPF 1FRLA 4WFXA 2CPHA 3PYGA 4WK1A 1CULB 2OKQA 4MKYA 4NMXA 5DZ6A 1PC5A 2E5HA 3A13A 2PMZD 2N4DA 3I9V9 3C6UB 4DQQA 1XMOJ 4OFZA 2J6TA 2B6AB 5MAOA 5DS7A 2LQ8A 4PPDA 3MAAA 1RT6A 3LOUA 1NHVA 3VF0B 2FJBB 3HX9A 2BKOA 1WELA 4MK7A 2JJ4D 4LFAJ 1VBXA 4K0KF 1QSLA 4DSIA 1IJEB 4N8OA 4NI2B 3CCMS 4DR3F 4OX7A 2V6AA 3IS9A 1RA7A 3I4HX 3PACA 3R3TA 2VBZA 3QO9A 3GYGA 2MDAA 2P8IA 3CJ8A 2C2EA 2NSCA 4KAIA 4A8KA 5H9EK 3PTWA 2BOAA 3PIPQ 4RW6B 4FF1A 3UVJA 4PKDB 1A6LA 1HHSA 3ZTOA 3HVWA 3PZPA 2QL7B 2XY7A 1VYAA 1UAWA 1RKIA 4M95A 2WHOA 2FLNA 1S9FA 3BYRA 3UD5A 3DRSB 4OHWA 2ZH5A 4PUOB 1SJFA 4ANCA 1Y4ZB 1MW7A 1IKWB 4ZVRB 5LJ5Y 1E6VA 5H9EJ 4XPCA 4DLGA 1VC5A 1WTBA 4AL5A 2M5YA 1TL7A 3CCLS 2B9YA 4RW7A 3CCRS 3NXZA 1XNQJ 1LWFA 3VAMA 1ZAXA 3W5YA 6FD1A 1S1XA 1NJZA 4DX7A 3NCRA 2J0SD 1HA1A 5H1SV 4JI7F 3M8RA 3MEEB 5J2PA 3W9JA 1CJTA 1RHMB 3OFFA 2ZJQQ 3DI6B 2C2DA 4ZCKA 1YZ6A 2DXFA 5J2NA 5HMZA 1R89A 1BE4A 4IG0A 5LOQA 1Q7YT 1REVB 2LEAA 1EB0A 2LMIA 5K14B 2QLJB 2N3LA 4AL7A 4A8OA 1KD1T 1FJ7A 3JQKA 4CH7A 4AFFA 3V5RA 5D4PA 1RYRA 4C0OC 1IBMJ 1TKXB 2MSTA 3AA8A 4NXNF 4GO5X 4KGXB 4F3QA 2BUNA 1TL3A 2OPPA 4B9LA 3D7SB 2XBPA
chains in the Genus database with same CATH topology
5B08A 2ZOFA 4NLTA 4H54A 1UVMA 1HNIA 1BQXA 1QJHA 2PMHA 3HHLC 2BOPA 5LSLA 4NLUA 5KG2A 2NREA 2KZZA 2XI2A 2VKRA 2XSFA 3CE8A 5KFFA 2RKIB 5EX3A 4XPEA 4DV1F 3MEGB 5G4DA 5DLFA 1G7CB 1GTHA 3CJ4A 3T1HF 1U09A 1H98A 2MPUA 4KFBB 2YNFB 4G3IA 2U1AA 1S1WB 1NH7A 2H5EA 2HS0A 3DRPA 1DTQA 2V8VA 4CT8A 3TA1A 3CIMA 4R0EA 4WXOA 1YHQS 3H5XA 3V4MA 1S0VA 1FEHA 2HNZB 2V8GA 2I5JB 2CQIA 2J0WA 1DLOA 4UQGA 4V19X 2Q66A 4C8OA 1BQMA 2E1RA 4BDPA 4OJHA 3B4MA 2M9KA 1HBMB 4JV0A 1FJEB 4RZRA 2UV8A 3UPFA 1C1BA 2MKHA 4IOAQ 3CC4S 5D4OA 4ZA1A 2CQPA 1JJHA 3PRBA 4B9MA 4Q2LA 2AV5A 4CNYA 2ZH7A 4RW8A 1FRKA 5M2UA 2FPHX 1GX5A 4B9NA 3EGNA 3KLIB 1QE1A 1I94F 2J6SA 1R7IA 1X4GA 3D1OA 1FKPB 3BDEA 2WOMB 3MM9B 4WJBA 3KK2A 2DNRA 1D0EA 1JLFA 2YWEA 1RTIB 4EYIB 1S72S 4JI4F 1YJNS 5HLFB 1MNEA 3CULA 3LO3A 5HBMA 3O44A 2MQNA 4J9NA 4ECWA 5DGAA 1Z2ZA 3HHLD 1TL1A 5CQGA 5THWA 1IBMF 1IKXA 4XO0A 4NZ0A 5EGYA 4I56A 4U7UK 3OL9A 3QIDA 3SQGB 3MM5B 2R7SA 1N33F 3G9CA 1HQUA 3GG1A 4E8UA 1R3NA 3G8QA 3NNAA 3OW2R 2ASJA 2O66A 1VQKS 3RRHA 4KT0C 1X4CA 3QGGA 2VFRA 4IRDA 2RF2A 4OZJA 2WONB 3MUTP 2XWXA 2N82B 3KLGB 2WCXA 2HGMA 1JLEB 2MYFA 2EBGA 4I2PB 4HTJA 4DV4F 2CQ2A 3CVKA 3DRYA 3UNGC 3H4DA 1TZ0A 4IDKB 2FVRA 2MQPA 2Q3PA 2YKMB 1XNRF 2Z4PA 3GMGA 1YQHA 3FDSA 4ECZA 4W92B 3K5NA 4MMOA 2AYGA 3GFYA 4GKJF 1KHVA 4XK8C 3K0JA 1RAJA 4FN5A 3IG1A 4YDDB 4IKAA 1FDDA 1X5OA 5KFHA 4F4YA 1AUDA 1MMNA 1Q1KA 2OSQA 5E3PA 3S1TA 5FJ4A 3S01A 3EZ5A 2P6SA 4QIEA 3I31A 3QIPB 3IC1A 1S1VA 1UETA 4DV5F 3VTIA 4WFBQ 1U1OA 2C28A 3DYAA 4FYDA 2IYIA 2L9WA 2LYVA 3I0RA 4NX9A 2LCWA 2MZSA 5KG0A 3GIKA 1GQEA 2V9KA 4K4TA 1YTYA 4ICLA 4URGA 3MM6B 3I5CA 1Y5LB 1YRUA 2DH9A 3G6VA 3MAQA 1GXUA 3CCES 1TQLA 1V9OA 3EXYA 2O5DA 3LWMA 4ID5A 4KV8A 1S76D 5L1JA 2JL9A 2DGVA 4JYAF 2R7OA 1DTTA 3MMAB 1FNXH 1S77D 2VPZB 3GIMA 5A8WB 2DVIA 3O2IA 2B5JA 1K8AT 1GAOA 3FSXA 5CYMA 4JI6F 2CPDA 3IR6B 1IR0A 1VK8A 2KTQA 1ZOTA 3M2RA 4NYOA 1WEYA 4C11A 2YH0A 1E6YA 3PR5B 2CPXA 2I2YA 4ZCIA 2VG6A 3R1HA 4CO4A 3BS9A 3ICLA 5KT4A 2EG2A 1IKVB 2ZNYA 4RUHA 2QV6A 4DV7F 2ADCA 2DPJA 2WW8A 2KU7A 1M5PC 3J7A1 4ATNA 2K8GA 4ERDA 2JVRA 5DETA 1FK9A 3DLBA 3KOAA 5B7WA 2QA2A 2MKIA 1RGVA 4NLRA 5FDLB 3SI8A 3LP2B 2DGOA 3H25A 5BYSA 5C42A 3HHLA 2J76E 3NP5A 1JLCA 2RNEA 2BM0A 1CC7A 4KRWA 7FD1A 4ZOSA 3PX6A 2DNMA 1N5YB 3K5PA 1K0VA 2ATLA 4ECSA 3D0IE 2F8EX 2R8GA 2OTJS 1D3WA 2W4PA 4YDXA 4OHYA 1R0AB 4C8MA 4ECVA 2XMJA 2HNYA 3TUJC 5IT0A 3M8QA 2KH9A 4F50A 3G86A 5AE3A 3PO5A 4O4GA 1JIHA 1OS5A 4U67Q 3KHLA 4GC7A 3TA0A 2HMIB 5I3PA 1HWJA 3ONQA 3VZHA 1KFDA 2COLA 5KAKA 3N6LA 4LF9F 2I1RA 1AXQA 1KTQA 1GNKA 1XMBA 4DWIA 4UW2A 5J2MB 2CZ4A 2O1PA 1KLMA 3K2YA 1Y7PA 4MAKA 3BREA 1VIXA 1NJWA 2E66A 1IQTA 1IKYA 1CQNA 1NJYA 4ECRA 2KI2A 2R2RA 2DR7A 4MFBA 2LDIA 5KT2A 1J5OB 2XLKA 4PQAA 3UR0A 4ZPVR 4B3OB 3Q2TC 5FIIA 3P6YC 1D9FA 4LSLB 3TVZA 3JAMY 3J81Y 3UI3A 1VQLS 2RD5C 1FRJA 4H4MB 1FVSA 2F8MA 2XMWA 1FD2A 1UEVA 1WTFA 5AXLA 2BJEA 3FEXB 3QWPA 1SV5A 2OD6A 2GGPA 4BCAA 3IR7B 4WZQA 1KC8T 1MSWD 3MPVA 3CT9A 4O44B 4K4UA 4M5DB 3O1LA 5KTQA 2V2KA 3S7RA 2GO8A 2XB2D 2MSSA 2HNDB 3U02A 4AL6A 2XLJA 4DFPA 1UVNA 3C66A 2GIQA 3AY0A 4Y2AA 2IM2A 2FJWA 1WHVA 2HAIA 3DLGB 4U6PA 2HHQA 2CPIA 5KFEA 1SJQA 1X5PA 3NG8A 2VBYA 2DGQA 1DBDA 1MWZA 3OTBA 3EZUA 4WKYA 3NLCA 3DNCA 3JTNA 2LA6A 3BR8A 2G4BA 3OXGA 5A6WA 2K3IA 5DQHA 1HFEL 1N56A 1YJTA 2JFKA 3NNHA 1M1KT 1RQ0A 4QPTA 3IWLA 2MY7A 2K1RA 1K1QA 1DURA 2IA0A 3JYTA 3IAS9 4RWWA 1JLAB 1S4FA 2BRLA 4TY9A 3I82A 2GJ2A 2R2TA 2HHUA 3SV4A 5EWEA 3RB6A 1RT2A 3IRXB 2FJDB 1NKBA 4JI2F 2RH3A 2V4QA 2QA4G 3BGRB 4NCGB 5A8RA 2YKPA 4RW9A 4QCLA 2J5AA 1TKTB 1X8DA 3TP2A 3M9MB 3BGLA 1UWBB 2YKNA 3PJXA 4MIBA 1TFYA 5A0YB 1HBOB 3I32A 1UL3A 4RUAA 1NK4A 3KLEB 1S6UA 4RNMA 2H9ZA 2BVZA 2B4PA 2L3MA 2ROPA 2W4DA 4OI1A 2KJWA 2VG7A 2VA3A 1JNZB 3GV7B 2R8JA 3NGKA 1WNEA 2DISA 1D8ZA 2M88A 3ISND 3VCDA 3SV3A 5J2QA 1N52B 5KFKA 2BRKA 2OIHA 1DAXA 3T1YF 3P3DA 3SDEB 4NA3A 2UVVA 4ES2A 1M0SA 2GW8A 3PXGa 3W2WB 3G6XA 4AYBD 3KHHA 1VC6A 2U2FA 2KRRA 3NNCA 1P1LA 2IAJB 1DQAA 2CJKA 1RT3A 4NYZA 3KK1A 3PR4A 4JUZA 2DT9A 3PV8A 3QGPA 1GXTA 4DJBA 2OLWA 3L09A 2CRLA 4X4NA 1U8SA 1Q7LB 2EFGA 5JJBA 4NOHA 4Z2XA 2RJZA 3TARA 2EW9A 3B8HA 3HZGA 1S6QB 4HLBA 2G1DA 4QWBA 4ZCMA 3GQCA 1RDRA 2C3MA 2O67A 1SIZA 2IVFB 2KYZA 4JI3F 5EX0A 4OZ1A 2FJVA 2LKZA 1TKZA 3IFEA 2Y1RI 3E2EA 1G3OA 2XMTA 2GFFA 2ZD1A 3ZC4A 3H2LA 3DN9A 2F40A 1H7XA 3SSRA 1RTDB 2MZJA 3IWXA 1WWHA 2KFNA 2FTRA 2ILYA 1F0XA 3N79A 3M8SA 4IH6A 2C22A 2B7BB 2QA4S 1FNMA 4LF4F 3HHEA 1OSCA 4Q0BB 2OPSA 3OLAA 1VS3A 2POKA 2RT3A 4KTQA 2UXCF 1X4DA 2ROEA 4PRFA 4XDDA 2AW0A 5DQGA 3T6BA 3T5HA 1L3UA 4NLOA 3PEJA 3CD0A 3FEZA 2QYCA 4R8UA 4URSA 5E33A 2XS2A 1YGYA 2L9NA 3KLHB 3F73A 3NMAA 2RVJA 3BEGB 4KKOA 1LK7A 3CWJA 4MIAA 5HP1B 2E29A 1TFWA 1OSDA