1G3OA

Crystal structure of v19e mutant of ferredoxin i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEECPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential
pubmed doi rcsb
molecule tags Electron transport
molecule keywords 7FE FERREDOXIN I
total genus 29
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g3oA00
2C3MA 4L6V3 2IVFB 1BC6A 2C3YA 2XSJA 4Y28C 7FDRA 6FDRA 5CH7B 5E7OB 2C3PA 1JNRB 2C3UA 2XSJB 3MM6B 2VKRA 3MMBA 1B0PA 1A6LA 3GYXB 1WTFA 4DHVA 1FRMA 3MMBB 1Y4ZB 1JNZB 1PC5A 1C4CA 1GT8A 5L8RC 1Y5IB 1FD2A 1F5CA 2ZVSA 1D3WA 3HKZD 4XDCA 1FRKA 3EGWB 2WB1D 1PC4A 6FD1A 2WAQD 1H7XA 1IR0A 1FRIA 3OR1B 1KQFB 1FERA 1GTHA 1FEHA 1FRXA 3MM9B 1B0VA 2PMZD 2FD2A 2Y0SD 2VPWB 1FTCA 1FF2A 4OMFG 3PNIA 2VPYB 2V2KA 3MM7A 3OR1A 1FDDA 3MM5B 1GTEA 3IR5B 3OR2A 3C8YA 1DFDA 4XK8C 1FXRA 1GAOA 1CLFA 1H7WA 1AXQA 3OR2B 1FDBA 5FD1A 7FD1A 1FRHA 1Y5LB 1F5BA 2FJEB 2O01C 1SJ1A 3MMCB 1FRLA 2GMHA 1K0TA 5CHCB 1BLUA 2PDAA 2Z8QA 1Q16B 5BYSA 4KT0C 1F2GA 1SIZA 4XDDA 5BYQA 1SIWB 1C4AA 3IR6B 2WSFC 1B0TA 4OV1A 1RGVA 1FCAA 3MM8A 3IR7B 1BWEA 1ROFA 3MMCA 2C3OA 1KQGB 3EXYA 1VJWA 4RKUC 2FJDB 1JB0C 1H0HB 1HFEL 2V4JB 2C42A 5BYRA 2FJAB 3MM5A 1DURA 1H98A 1G6BA 3MM6A 1DAXA 1R27B 3MMAB 1BD6A 3MM8B 3LW5C 1G3OA 1Y5NB 2WSEC 1BQXA 1KEKA 2PA8D 2VPXB 3MM9A 3EUNA 2V4JA 2FGOA 1FDAA 2VPZB 1IQZA 4ID8A 1FXDA 3MMAA 1FRJA 1FDNA 4AYBD 2WSCC 2UZAA 2FJBB 4CI0B 3MM7B 4YDDB 1XERA 2GMJA 2FDNA
chains in the Genus database with same CATH superfamily
2P2CB 4LSNB 3M6WA 3KHLA 1N6QB 3NNHA 3M1VA 1GXLA 4JI0J 1OY8A 3A8KA 1HYSB 2I38A 3BYRA 3QT8A 3JXOA 3JYTA 4DL6A 1JXLA 4QR1A 2BR0A 2V8VA 1X4BA 2VL1A 3I96A 5T7LB 4HACA 1W26A 1EAYC 4AXJA 5DQGA 1PGZA 5L46A 4IRDA 3TEHB 2DEIA 2HPUA 2RDIA 3DU6A 3ITHA 4Y2CA 5A76A 3RAQA 3MMBA 3ZZTA 4LFBF 1C1CA 2N3OA 5JMNA 4O4GA 2HHSA 1C0UA 3OTOF 4XTTA 4K5RA 1WG1A 1ZBTA 5ETSA 3E2EA 1RT2B 3DOKB 5GMEA 1N56A 1Y4ZB 4B3OB 3MR5A 1EP4A 1NHVA 1PC5A 4HH1A 1M5HA 2EFVA 2ZJQQ 4B3MF 4DR6J 2XWXA 2DNRA 3MEEA 4RW4A 4Y0FA 1QE1A 1NK8A 1MROB 4PUOA 4YUDA 2Y1RI 1LWFB 3TZZA 3TI0A 2YNGA 4CT8A 5B08A 1U7LA 3GJQB 3DLKA 1RT2A 4FBTA 4Y6IA 2CQ0A 3HHNB 2KTQA 4USUA 4JI5F 1FERA 4ILRA 2DGSA 3WZ0A 4BHQA 1QLNA 4GKKJ 5IV3A 1FX4A 4CLYA 4A46A 4F2SA 1XR7A 2RKIB 3H2LA 1TL5A 1X4FA 4I7FA 4P52A 3NWRA 4Y2MA 5CQGA 3HFZB 5IQQA 4DBQA 4LQ9A 3G6VA 4HEA9 2RHQB 3H59A 2HFVA 1S9GA 2B9EA 2QIFA 4CH0S 4DSJA 3CULA 5KG2A 5CYMA 1WSVA 2DGWA 3DM2A 1J5EF 4O0NA 3K58A 3NWGA 1QUVA 4DN9A 3PW2A 2KT3A 4NI2B 1TTHB 2WBMA 2HAFA 3AOAA 1LFWA 2WONB 5KFGA 2IVYA 3T5JA 1WHVA 1SKWA 1S1UB 1YLXA 3EXCX 4YMEA 2NUHA 1FNXH 3DLHA 5EX0A 1J5OA 3DXBA 1FRLA 1CJTA 2MKCA 3DC2A 3B82A 2RF2A 3PFOA 3H5YA 1U48A 3H90A 4DX8H 1V5IB 5BYSA 2D3O1 5J1PA 4RNNA 4OI0A 2XB2D 2OTJS 1A7GE 1HR0J 5D4LA 3TUIC 4NCGB 3AAWB 4EEYA 3NGRA 4HTJA 3BDPA 3OL6A 3MCOA 2V2QA 3A12A 4YB7A 1RGVA 2BKPA 4WP9A 5J2PB 5KFVA 1ULRA 1EKRA 1BWEA 1SCJB 1Z2ZA 2JFDA 4I68A 3GG1A 2M70A 5D0EA 4NCAA 3IN5A 2DHXA 1VQPS 4ES3A 1TK5A 3CC2S 4Y2KA 3TVKA 4OI2A 2DGQA 1H0HB 3BB5A 3DLBA 3J81Y 4QU7A 2IVMA 2IDLA 2DCLA 4DQIA 1MROA 4IKAA 3RRKA 1QTNB 4CYUB 3SQGB 2YXLA 2UXCJ 3D68A 1DRZA 1WWHA 2ZDOA 2MZRA 1NDPA 2ZC4A 3LAMA 5C2CA 2HG4A 4NWBA 1YHQS 2HSEB 1OJ4A 1S9FA 4ILLA 4WP8A 3JQMA 4KHRA 2V8PA 3QJPA 2MQPA 4DV1F 4OYMA 2N7YA 4WXOA 4Z37A 1EARA 2XEXA 4FVCA 2CG4A 3U02A 1S1XB 1IJFB 1Q8IA 4NRTA 1ZAXA 3UW1A 3G82B 4U6PA 1FDNA 4X64J 3GYGA 4I64A 2JRSA 2B4VA 3GJSB 3FEYB 4ETZA 5KT6A 3UNYA 5GAEU 3TWZA 2QLBB 4X4RA 1HW9A 4B9MA 1U49A 1OYDA 3A1YG 3FMWA 1JLEA 4IDKA 2HZVA 4ENOA 3UWTA 1RAIB 2J6UA 4OYOA 2C28A 1TV6B 3OHBA 3LP2B 1BWVA 4ERDA 1ELOA 2RH3A 4P9SA 3DGVA 2Z56B 5E0OA 3GIJA 3ZNJ1 2CWXA 3BN7A 4PXDA 4YR3A 3IRXA 3NEKA 3NCRA 1D1UA 4MT1A 1P6TA 4O3RA 3CO0P 1Z2LA 4J9LA 2XS5A 4CLPA 1SL1A 1GFWB 5A8KB 2RMLA 4IFYA 2ZBCA 1NKBA 2IBKA 2DH8A 1AA1B 1T94A 1S77D 1TL7A 2ZE2A 2GGPB 2V34A 3ENQA 4OJGA 1WI8A 1TKXA 2FHJA 3OXLA 4ZOSA 5FDLA 2XMAA 3VV2B 2R9LA 4ZN1A 2XNQA 5J2QB 1G7CB 2NPIA 5J1NA 4I6AA 1JJ2R 3TOQA 3RAMA 3DXSX 2VQFF 1VRTB 2BA9A 2B9XA 2WB1D 3BDEA 4NYOA 2OMOA 1EB0A 4X65J 1YJTA 4KGZB 5C24B 2YWWA 2EI5A 2PMWA 2Q1LA 2RRBA 2AWZA 2GIFA 3BV8A 2UV8A 5LMNF 4ZVHA 3AXKA 2H1YA 2KB2A 1NM2A 4CH7A 5F9LA 3MEKA 2PD1A 3SQOP 1M5SA 2QGFB 3TZXA 2JLEA 4F4WA 3CCSS 2NSBA 3K89A 5LOQA 1S9EB 3MECA 4NLDA 2M2BA 1IKVA 1F9HA 2DHGA 2CPYA 4FXWA 1QAJA 3FJ2A 4LRBA 1XJWB 4ANDA 1QJHA 3H20A 5D0GA 1FD8A 3J7AN 3M8PA 2CADA 1T95A 2LQ9A 3L09A 3G8TA 3NBPA 4U95A 1I1GA 1P8GA 4B9TA 3BSNA 1F3FA 3ET6A 3FQLA 4BWMA 4LF9F 4UQTA 3W2VA 3T1YJ 3MPDA 2HNZB 3NXZA 5AE1A 3AJ2A 4Q8FA 2VFVA 1FDBA 4GVLA 1Y5LB 2DNQA 2FJEB 4DV2F 3OUYB 3PW7A 2MLZA 5LSLA 3NL0A 1H74A 5LXYA 2ZBRA 3KLEA 2E9ZA 1GXTA 3CJKA 1FI4A 2D7SA 3HD1A 2DR8A 1F2GA 1SIZA 1MMLA 2C2DA 5HQMA 1NMEB 4JI6J 2YBVA 2WBRA 4PWDA 1F60B 4A8XA 4AE5A 1R0CB 2R8KA 2VHGA 2B56A 2QA2A 2HNYB 2QG9B 4ZVTB 2RQCA 2UU9J 1RAFB 2MKYA 1RBOB 1YI2S 1FA0A 1H2TZ 4F3QA 4DUYF 3DOMB 4EBEA 5AXNA 1NK7A 4N76A 3V4MA 1HW8A 3GYNA 3CJKB 3EMTA 4IG0A 3MAQA 2FQQB 4NPOA 4C8ZA 2YNHA 2RT3A 2HLTA 4FKXA 1S0OA 3BSAA 1VC5A 4Y2IA 2DT9A 1GNKA 3AD7C 2HHPA 2WVBA 3PJ9A 2MLXA 2GQCA 2V8HA 4GVBA 4LIWA 5KOXA 4QWAA 4DR5J 2ATCB 1N32J 1UA1A 3CCLS 2RJZA 3EDQB 1U1RA 5BR8J 4JI7F 1U24A 1X4AA 4C98A 3OHAA 4DLGA 4V19X 4R0JA 1BMQB 2XCAA 2R7XA 4LSNA 2F1FA 2W25A 2FJXA 2FLNA 4W92B 2UZAA 4A48A 2EFOA 4GO7X 2Y9HA 1YGYA 2BVZA 4LF9J 1RABB 5I42A 3ISZA 3R5BA 2OEKA 1CJVA 2FLPA 1R0AB 1HIYA 2ZOGA 3LP1A 3MD3A 3VVTA 1X5OA 3JTPA 1MN7A 5D3GA 5K9FA 4U7CA 3M8QB 3RB0A 1G2EA 5IXUA 2LXUA 1O5JA 2BQ3A 4D3GA 3HVTA 1UVMA 5DO2A 1SQEA 2EPIA 2LKZA 2EWHA 2C2NA 5M2UA 1K47A 2NR0A 1RTIA 1D9FA 2EKYA 4X4QA 2DR6A 3GMGA 3UD3P 3JB9k 1NJIT 1CS4B 2Q6BA 3BBCA 5B0AA 3V5RA 5HN0A 3LP1B 1A6LA 2KXNB 1S48A 4DV0J 5J1EA 1KTQA 3C19A 5LL6d 1X5PA 1HQUB 1SI9A 3CDEA 1N34F 3HSJA 2WVFA 1K44A 5KFPA 8ATCB 1ICEB 1C4CA 2AGOA 2V9WA 2O1PA 4MK7A 5KFFA 2UUBJ 3KLHA 1FD2A 4PQUA 3U1MA 2I6WA 1IJEB 4NE9C 5E3QA 4DV4J 1JKHB 1HARA 1NRKA 3MCNA 1H7XA 1IR0A 3M32A 4K2JA 4ECVA 1UJ6A 1T9TA 3D6MB 3LF0A 3MPUB 4LIRA 5J2MB 2QMWA 2CPJA 1EHWA 2MPUA 2HS4A 5EGYA 2CXEA 2KM8B 2KG0A 2ZNZA 5KG6A 3DDKA 3ILJA 1YG0A 2J9DA 4ZP6A 1UW9A 1MG7A 5GAGU 3DHWC 4PQUB 1TELA 4DF8A 1YZ6A 2VC1A 2FD2A 4LSLB 2F8HA 3PACA 1QAYA 2CNLB 2H5JB 1RAJA 2W24A 2NSCA 2RQ4A 5HVFA 4LF8J 4FF4A 2DNOA 2CDRB 2BM1A 2UXDF 1N5VA 2M52A 1RTDA 5F9NA 4F25A 4DR4J 3DLJA 4DFKA 3N6NA 5EUHA 3D67A 2IDEA 1WOSA 3FCHA 3TO8A 1TMMA 3PXGa 4B17A 2IAJA 2E1CA 1XWLA 4DSLA 4LSLA 4OYPA 3CD7A 3M8QA 5ETMA 1CJTB 3R1HA 2HYIB 2ZZMA 4RUBA 1HBOA 1O6XA 1S0MA 2DH9A 4DG1A 4U67Q 1NLKL 3GPAA 3PEHA 4I4BA 2KZMA 4WXWA 2DXDA 4LRDA 4UQGA 3TZWA 3SZ2A 4QYRA 2K7JA 2FC9A 3HVRA 2QTWA 2GQQA 2JSXA 2LYVA 3HF5A 4KT0C 4PG4A 1YJ9S 4MKYA 2R7UA 4LSZB 4YY3J 1XBWA 3BQ1A 5J1EB 4K7QA 1B0TA 3G8QA 1U1OA 2H48B 4ZMMA 1VCTA 2ASJA 1LW0A 5D78A 2NXJA 5ETPA 2LQ8A 4K0KJ 2UVVA 2UUAJ 4RNMA 1KFDA 4I7FB 1FKPA 2DNKA 4TQSA 2RUSA 2R2UA 2U2FA 3M9MB 2L08A 4ZHRB 4AL6A 5F8IA 4JV5J 3QT5A 2IPOB 2K2PA 3LPEA 4LF6F 2OO4A 3D66A 5DM6Q 2WW8A 3C15B 3D54A 1H38A 4OZJA 1XQIA 4N77A 2MZQA 4NEYA 4OX6A 4X4OA 1YTYA 4W4MA 4C9DA 1FJGF 1S1UA 4N8NA 1TKZB 4URQU 2JWNA 4M5GA 1U26A 5D15A 2M5YA 4ANEA 3OW2R 4ZJQA 1NSAA 2J8SA 2O67A 3IG1A 4L72B 4CLLA 1H2VZ 1S7IA 2FIUA 4USJC 1FRJA 2YWGA 4C11A 4LFCJ 3QRRA 2FJBB 1UFLA 2FTRA 2ABYA 4RUAA 3A13A 4C7QA 1RB0A 3PDNA 5C24A 5KFYA 5HL7Q 5EHHA 2XZDB 3P6YC 3Q0AA 2I2YA 3OTDA 3RGIA 3RBXA 1IKYA 4LUBA 5DDOC 2KJVA 1B64A 4WFXA 5GADU 4EWTA 3K8WA 5HQLA 3BBBA 1IWAA 4PEOA 4DG1B 7FDRA 3G6YA 2AQ4A 1IVZA 3V4IA 1NB2A 1S99A 4TNOA 4ZVGA 5H9FJ 3EX7B 3CCQS 1X5SA 2LFVA 4HR2A 2P6TA 2VBZA 3EE3A 1XR6A 5MAOA 1CC7A 3JQJA 4OZ1A 4TU7A 2XM3A 1QVFR 5DRKA 5CZXA 2KJWA 3HCXA 3QT6A 3KKFA 1UEVA 2PO4A 2PI5A 4ZVQB 2BBEA 1JXEA 3LWLA 3O44A 4JI1F 1S1XA 1YQHA 1PJ5A 2ADCA 3PKMA 2R3VA 3BGOP 3O8WA 4I56A 4M5DB 3IAM9 2RVJA 2DISA 4G1IA 1HNVA 1K0VA 2CJYB 2W9AA 2W2NP 3EZOA 2B43A 4KGMA 3CJRA 4ZK7M 2CJKA 1RBLA 4UF4A 4QCLA 2NZ4A 5DQIA 3PX6A 1S0VA 3KK1A 3MEGA 3TP2A 4TY9A 1TL3B 1T9YA 3W1YC 4DR3F 3RB6A 4EZ6A 1S57A 3AQOA 3R97A 1SV5B 5C2GA 5CYQA 3ZZPA 2CG8A 1HBMA 1RWMB 2QMXA 1VGYA 4A8WA 1FWLA 4ZPCA 2MKHA 1MWYA 1HWJA 3DLGA 3IRXB 3J7YU 2CQHA 1XMOJ 2RAQA 1PJ7A 5CXTA 2J8AA 4MIWA 3MM5B 2LEPA 4TQRA 3DNCA 3GWCA 4L73A 3QATA 3WQPA 1YJNS 3W2WB 3Q8QB 1IM4A 1M5PC 3E8OA 3HVWA 5LT5A 2OPSB 2CNKB 2QSWA 3BH6B 2OPQA 3E3XA 3LH2S 3LGNA 3MI7X 4KV8A 4JI3F 1RKIA 1JIHA 1IBLJ 4B3TF 1ZH5A 1N32F 4ZIVA 5FD1A 1HBUA 4A8YA 3DRYA 4UUXA 1Z4UA 3DGPA 2RQMA 3QRPA 1Q7LB 5E5NA 1WSRA 1F5AA 2YKPA 3CCUS 2ASYA 3THTA 1P9YA 4K4YA 3I56S 3P8BB 2J9CA 3HSDA 1M90T 4PZVA 3FMBA 4B9LA 3P4UB 1RT4A 2XSFA 5BYQA 4ELVA 2Z30B 2QN6B 3M2UB 5AXMA 5HJXA 4WTOB 1YIJS 3KLEB 1W7WA 2WCXA 4MKVA 2ZHAA 1YVFA 1LNQA 1F6TA 2BANB 2OEMA 2DHAA 3GJRB 2CPHA 3DRSA 2A2CA 4QJVA 4ECZA 4B3OA 3JAMU 2B8PA 3C14B 1RU2A 2KVIA 2NZCA 4DU7A 5BXIA 4DR6F 4QU6A 4MK9A 3GLJA 1S1TA 5BJRA 2CNOB 3A8JA 3IO1A 5KG0A 4PAAA 2YQ0A 3IP0A 4USHA 2UVWA 2C1EB 2YTCA 3BGUA 3DLEA 1WEZA 3QIPB 1DURA 1F9EB 3DYAA 5BR8F 2CPFA 5L1KA 3TA2A 2QZ8A 1TK8A 4M95A 1DLOA 2GZOA 3KDNA 4A4JA 1HNWJ 2PFFB 3LO3A 4KH1B 3S6EA 2AZ3A 3LANA 2WSEC 1BQXA 2XBPA 5DZ7A 5AXKA 2X1BA 5B0BA 1X9WA 4KGKA 2O5DA 3T19A 2HQGA 3N0VA 4G65A 3GCXP 1KWMA 2VFSA 7AT1B 3SBMA 4FNHA 4BC9A 4FXDA 1RT6B 1T9VA 1DLOB 3H7HB 1Q86T 3DMJA 1U1NA 5IWAJ 2HWTA 1XERA 5HO4A 3TNVA 2IFXA 2K06A 4F4XA 2KXHA 3NOGA 4X66J 2LLZA 2KXFA 4HTIA 3HHDA 4V1Ak 2ZH1A 3CC4S 4NI2A 3Q8YA 4O4GB 3TEGA 1D09B 1TL1B 2I1RA 4DCOB 5KFNA 4ZVSB 2F3JA 4UTGA 4MKBA 2N4DA 4KJIA 5L9XA 1RT6A 4DUZJ 2UXBJ 2G0CA 1WC1A 2V2VA 3H5SA 4CZCA 4FYDA 3VAGA 1N34J 2E44A 4M5JA 1FEEA 2HIQA 2KRBA 1OY6A 3KLFA 4C8NA 3NAHA 1WKJA 3BO3A 2ALZA 3HO1A 1ZZFA 3SFGA 4DL4A 1CEZA 1WTFA 2RILA 4KY3A 3BKUA 4RR5A 2NYHA 4TY8B 3TJAA 3JSBA 4EBCA 3AH6A 4OYZA 5KFHA 4ECSA 3NNAA 1ZA1B 1HWIA 1Q7YT 2VD3A 2UP1A 4LREA 2KM8C 4ZPDA 4NLPA 4R0EA 5KTQA 4U8YA 3OFHA 1HQUA 1OPIA 2EKNA 3HMJG 1SJFA 4B3RF 5IT9Y 1FRKA 1HPZB 2DO4A 2IM0A 3R5CA 2NYIA 3KUGA 1T3NA 2HFNA 5FJ4A 3NGDA 3THVA 2QA1A 1R0AA 3FNNA 4Q43A 3JTOA 3W9IA 5F8NA 3ONQA 3E01B 4H4KA 4O4RA 2QO3A 4A8FA 4YY3F 3VVUA 4Z2XA 2F4FA 3M8RA 4K50A 3ICLA 5IM0B 4M63A 4K0KF 1WELA 2P9GA 4RL1A 4ECTA 3NS6A 5SUHA 3DU5A 1N52B 4C97A 3PNIA 1S4EA 2VPYB 3HX9A 2GNKA 1NJXA 2HMIB 3DMJB 5EDWA 3OVAA 3B54A 3C2PA 4KHPJ 3MF5A 4WFBQ 3A8EA 4P2XA 1HQEB 3M05A 2R2RA 1N33F 1NDCA 2ILYA 4O3OA 1GH8A 3M1VB 5GVQA 1RDRA 2XMKA 1FXRA 1WC6A 2RKIA 2W4DA 4H4KC 3GG0A 5CABA 2B51A 5B0CA 1X8DA 3A3OB 4ZLJA 4CRJA 4I69A 1P1LA 1BE4A 3J81j 2FGCA 1YRUA 1VS3A 1RT1A 1ZM3A 2CJAA 3HDSA 4HI1A 1I94J 2MSSA 2ZWOA 4LF4J 5E41A 4Z7YA 1VQ8S 2O3DA 3R7BB 3O2IA 3CJQA 1C0UB 4L75A 5GAHU 3D1OA 1CJKB 1JLFB 1SKRA 3HT0A 2OD4A 5L9NA 5EN1A 3BGFA 3MM8A 4FF2A 1PJ6A 3JQKA 4KH0B 1JLCA 1UTAA 1XTZA 2E1PA 2QMUB 3T1AA 3UD5A 1C2PA 1YBUA 3N4WA 1RTZA 4RKUC 2R2SA 4ZP8A 1VRTA 2YKNA 3N6MA 2HHXA 3PW0A 1FNOA 5I3UA 3L4BC 2PI4A 2CNNB 1M0SA 4UZCA 2XS2A 2CWKA 1HMVA 1XMBA 1DTQA 4EBDA 2R8JA 4EGLA 3HP6A 4ETXA 3K5MA 3N01A 3VTIA 1RHRB 3KJVA 3KHGA 1URRA 1VQLS 2PN6A 1TR0A 1X4CA 5KFJA 2ZH5A 5KFWA 1NK9A 1AROP 1OIAA 2H3EB 1U8WA 2HS0A 2J76E 4PG8A 1ZYQA 3EVWA 2VPZB 1DBDA 3HFKA 4ED5A 1E6YA 3OD2A 3DRRA 5ETLA 3B8HA 2OHDA 3UDVA 1T9WA 3LGMA 4HT5A 4DOZA 3OV7A 4M5NA 4ZLPA 2C2RA 2BJ1A 4DV6J 2VH7A 3N9UC 2XMWA 3NBPB 3I0RA 1LXNA 2LP4A 4FYXB 4B9VA 3H0PA 4CO1A 2E9RX 4BCAA 4E98A 5FLXY 2FC8A 2AEJA 2HFOA 4R5PA 3Q83A 2AU0A 4L3NA 1NK5A 5HMWA 1DQAA 2KDOA 4LF1A 3ZTPA 2IC3A 4OI3A 2FZKB 1S5ZA 3DLLQ 2QX0A 1JNRB 2C3UA 1UFWA 2MHEA 2RIJA 3NRBA 4OHVA 3HKWA 3BO2A 1FVQA 4LRAA 4F04B 5F41A 5F8JA 2GA7A 2CYYA 5DDRC 4NLSA 5DM7Q 4JI1J 3BF4A 2P6SA 3CW2C 4LF7J 3W2WA 2ACMA 2OFHX 4K59A 4DUTA 1FTRA 2LVWA 2OKQA 2JZ5A 3CSKA 2MKIA 2DNPA 3SSRA 4KV8B 3Q89A 4X64F 3HHEA 2KU7A 4RWWA 4DDFA 3QO9A 1YRTA 2RB7A 4GMKA 4ZLLA 2FVQA 4OYWA 4JI2F 4DPXA 5DZ6A 3WX8A 2FJVA 4DFJA 1WHWA 2DJWA 2WAQD 2VB6A 2ZWPA 1TL3A 3R3TA 3W5ZA 4JYAF 1FRIA 4DS4A 2BOPA 1RA7A 1NEEA 1OSCA 1RHQB 4GVBB 1ZETA 4OV6A 1SH3A 1KQFB 5IC6B 4GKJJ 4FDFA 1LWCB 1OSDA 4M5IA 2W9CB 4J9SA 5IT9U 2BZ2A 1Y3JA 2BE2B 1NSPA 4ED1A 4DF4A 1NPPA 3EGVA 3EM1A 1S6OA 3C14A 5I3PA 4J91A 3BQ2A 1VRUB 3LQVA 1S1TB 2F9DA 1KOOA 3M30B 5G0RA 2HHQA 4H4MA 4O44B 1UZHA 3QFHA 2EK6A 2EFGA 3B4MA 3PW4A 1VQ7S 1Y00A 2X7IA 1A0OB 2IM3A 3WX4A 3H2UB 5K20B 1SH2A 3QLHB 2JDJA 5HLFA 1ZA2B 1URNA 4B08A 2VQFJ 4NX9A 4ECXA 2LQJA 3W5YA 1S49A 2LXIA 5K14B 2WHOA 4NLQA 1WKLA 4OYIA 4A8OA 2C2KB 4LJMA 4MYTA 4F4YA 3OXFA 3TQ1A 3AD9C 4K4TA 3C6TA 3MMCB 3ELHA 5A6PA 2M0GB 2POKA 2HURA 1BLUA 1Y3KA 5KAKA 4TLQA 4TXSA 2D1CA 5IOLA 1P27B 1HWKA 1KOHA 1LWEA 3CNQP 4RZRA 1S76D 2C2EA 1C4AA 2DR7A 4ITSA 3HHLD 4M5HA 1MW7A 2YH0A 3JSYA 4U7UK 2E29A 4G1QB 3GZ7A 3SSQA 2ZZTA 2M3DA 4X66F 2FVPA 1AW0A 2XMJA 1S4FA 4C8KA 2QL5B 3CO9A 3GJTB 4FXVA 5A2QU 2K7KA 2Z57B 1Q81T 3M2RB 4P74A 4QWCA 1AFIA 3T5KA 1BQNB 1PYOB 3N79A 3D2WA 4UY85 2CPZA 3POTA 5L39A 3MM5A 3PIOQ 1H98A 5KT2A 2JEJA 2H5EA 4NOHA 4MH8A 3OXGA 2DGUA 3OJSA 2V5HG 4CDIA 4NXNJ 3MD1A 5D4NA 3SV3A 3EZ5A 2AJ2A 2YQ1A 3GFYA 1RLCL 2ZBIA 4KB7A 3W64A 4FBUA 4LVNP 5CAAA 2HHHF 4QPTA 4DPOA 4IO1A 3R8YA 4DQRA 3OL9A 3R5AA 1RBAA 3V6JA 3NGSA 2H54B 1RTDB 3VWSA 4WFZA 2R7VA 4H4MB 4O44A 4QR0A 2AIRB 2D41A 3G2XA 3TAQA 4B3RJ 1R8AA 1TAQA 3PHEA 3CJTA 3LWMA 1TUWA 4UT4A 4OI6A 2N3LA 2YPZA 3SYZA 3ET6B 1BUXA 1T9XA 1NU4A 4DWIA 4NA1A 1FJEB 3HHKA 5DQHA 3F56A 2L9WA 2B4PA 4YS2A 1AFJA 5DG8A 2GCFA 4TY8A 3MMJA 3HSGA 2YWFA 5JJBA 1M5VC 2R8GA 2F8EX 2QRRA 2XI2A 2BJ8A 5C7PA 5JVGQ 1DZ5A 3ZO7A 5B7WA 4J9NA 3PYEA 2BX6A 3D7SB 1U1KA 3MMBB 4JI7J 2F4VJ 1NJWA 2DGOA 2WRMA 2ZDPA 2JEGA 5ETQA 2F5GA 3UN5A 1N33J 3HM9A 1QSYA 4B02A 2V4QA 1T03B 1YRXA 4PYDA 2ZVSA 3RG6A 2XY6A 2YNIB 1HBNB 2BKOA 2GHPA 2JLFA 3HULA 4FP9A 3PKYA 1V6HA 2QA4S 3A4TA 1UVLA 2B6AA 2CQ2A 3I32A 2KI2A 1N88A 2CQCA 2DHSA 2GMLA 3CIMA 4WU3A 5HSPA 2E5GA 1I94F 4F0MA 4PQAA 4KIAA 1JJCB 2IM1A 3IBWA 1S97A 3AQPA 5IM0A 2QJ3A 4G3IA 2GO8A 2K8GA 3MURP 1RISA 4Q8EA 1RAHB 2VBWA 3U27A 1HBNA 3GV7B 4L76A 1QUPA 1U2FA 3O3LA 1U0SA 2QLWA 2V67A 3F41A 4I1TA 3OSNA 4DV0F 4MTPA 1RACB 3P5BP 3T1HJ 3IMQJ 1TL4A 1RQ0A 2FLOA 3QIDA 3G6XA 5D0RA 1M1KT 5HI7A 2QT7A 3MR3A 2HGLA 2DCUB 2PA3A 4WK1A 3OR2A 2CPXA 2K1RA 2JH3A 1IKYB 4DMZA 5IT4A 2UUBF 4LF4F 1RUSA 1PBUA 1CQMA 3FEZA 1H7WA 2QL9B 3J7ZT 4YP3A 1AXQA 3RB3A 4CLUA 5DJBA 4JV2A 2BKNA 1WNEA 1VQYA 2R7OA 3M9NB 2HBZB 1X60A 2Z2LA 1XIQA 1VHFA 2XHCA 2Z8QA 4ALZA 2RDJA 1L3SA 2DNNA 3EDRB 1CS4A 3MAHA 3R27A 2OIHA 3GIKA 1ZM9A 2WSFC 1MU2B 3HJVA 2QA4G 1HQ2A 1R8CA 1K1QA 3BSCA 3C16B 1VI7A 1QD1A 1XMQJ 4O3SA 2HQIA 4RU2A 2QL7B 2VIHA 2DRDA 1RTHB 2B7CB 3OT9A 3UDLA 5KG7A 2H4WB 2J5AA 3SQGA 3N28A 4IUFA 3KMQA 4DZDA 2W9BA 3OVSA 1NAQA 1IBKF 1HI8A 5F3ZA 3ENWA 4IH7A 2D9OA 3ZTRA 1UPMB 2XI3A 2IA6A 1DAXA 2DO0A 2W2OP 4CO0A 2F63A 3HZGA 2E1MC 3CCWA 3LW5C 1JLAA 2JL9A 1A9NB 3MCMA 1UWBA 4ECWA 1TKXB 1VQ5S 1LW2A 4ATNA 1N5TA 3IFEA 2HIYA 2EFNA 5CYQB 4OX9J 4JUZA 2GVZB 1D9AA 9RUBA 3W3SA 1RAGB 1UKUA 2OGUA 3NOCA 3RYLA 3PVXA 4P72A 5CZVA 1IXKA 1RWXB 4TN2A 2HQFA 1D8ZA 4F0HA 1NK6A 3GTYX 2WSCC 1UWAA 2BEFA 2D3UA 2LDYA 3ZNUA 1L3UA 4W98A 2GMJA 2FDNA 3UDEA 5GAHI 1SJ4P 5F0WA 3D0GE 4JI2J 4OFZA 2V6AA 3WC0A 4I6YA 4LFAJ 3CJ4A 1PG5B 3H40A 2OPQB 1R8PA 4N5SA 4RU9A 2J0WA 1SKUB 1U09A 2KL8A 2R42A 2XSJA 6AT1B 1UEKA 1EX8A 5FLXU 2H4YB 1WDTA 5E7OB 1RT3B 2DY9A 1CULA 2XO7A 2LQ5A 3AHPA 4ZPAA 2XMUA 4KYZA 4C8LA 1RHKB 4C4WA 3MEDA 3OTBA 1FJGJ 1RWNB 1KTVA 2ZEJA 3QAEA 3V6KA 1X0PA 4QYZK 3IWXA 2UVUA 4LR8A 3UPFA 5B0EA 1AZSA 3ENAA 2HZCA 1RT7A 2VKZG 3U7JA 3KK1B 1GT8A 3HLUA 3L7PA 1JJHA 4IYQA 2HBQB 1Y5IB 2HRUA 3FBEA 5FDLB 1SV5A 2GFFA 1JLBA 2HVIA 3W8PA 2HFUA 1MWQA 4MAKA 2A6MA 2JVRA 4JV0A 3N5FA 5KOWA 5LJ5Y 2EFQA 4QIEA 1Y11A 2QEXS 5ETTA 1GK8A 2AGPA 3OR1B 3K8VA 1SXLA 4QZVB 4DL7A 4ZJLA 1F1BB 3MZIA 4NLYA 2HNYA 1K73T 5HK4A 1B0VA 4GRSA 4M5DA 1R7IA 1TKZA 2V50A 2W8KA 2V69A 2XULA 1PKUA 4IOBA 3G71S 3M8ZA 4KR0B 2DB1A 5C25A 2KZZA 1QY7A 2VG6A 3TUZC 2V2KA 5SZTA 1N5SA 3OR1A 4XIUA 4QBUA 4DR7J 2M8DB 3X1LB 4HI2A 3ISND 1S12A 1GXUA 2IRYA 3FBFA 2MYFA 2ZE2B 4NLUA 2W2MP 1ZZNA 3NAIA 4MFBA 4Q44A 4ELUA 4RBVA 2KO1A 2OTLS 3OL8A 2WK4A 1HYSA 2OFGX 4X4NA 5CCMA 1MNEA 2G2YA 2LMIA 4AL7A 3V81B 1ZM2A 3OPKA 4L3KA 3RW7A 1TVRB 1U6FA 3GSIA 3NCPA 2O01C 1UA0A 2BJEA 3VGTA 2GMHA 2IHR1 3W2VB 2AT1B 4CO2A 1YDLA 5HP1B 4FZVA 3O6QA 4RLEA 4CTAB 3RBDA 2A6OA 1L3VA 2YWHA 1IBMF 2B4UA 1VBKA 2KVQE 1LOUA 2MJUA 2PEHA 4G1QA 2OPSA 2CZ9A 1ZM4A 3FGVA 4EMDA 2I9SA 4HL9A 2ZOMA 2J0SD 3VR1A 1LK5A 2LA4A 4PG5A 2DR5A 4DZ6A 2ZH6A 2XLJA 4B3SF 1XNQJ 3GR0A 1REVA 2HGNA 2X1GA 2AF6A 2QV6A 3VALA 1AUSL 3JSRA 2AX1A 4KHMA 5IC4B 3J81U 2L9NA 4ED7A 1V9OA 1YJ7A 3MEEB 3MTJA 2R8IA 3QJJA 3PR4A 4ZCMA 2V4JB 1FVSA 3KJFB 3P45B 4YEAA 5RUBA 3Q22A 1PCAA 3IXQA 4OIXA 1RTIB 4X84A 3DOMA 4XAKA 4URGA 2XYPB 5GAEI 2W01A 4RNHA 2VUGA 2FVRA 4DV5J 1RT5B 1G3OA 2V9KA 3Q2SC 4RJVA 2AD9A 1IBLF 1Q82T 2J9EA 1Q78A 1Q8LA 5B0GA 2AJFE 4H4OA 3WIUA 3GIIA 3W7BA 5A8WA 3UFCX 4NL5A 2V4JA 1X7VA 4Y34A 1NDLA 3D0IE 4OL8A 3UO0A 2XTJP 3TW0A 1T03A 2M4MA 3KLHB 4ED3A 3OVBA 5DGAA 3TX8A 3FC9A 4RNFA 1QSSA 3MMAA 3ISNC 2HBYB 3DM2B 4JI4J 3VF0B 2M7SA 2FB0A 3HSZA 3M32B 2Q6CA 4YB6A 3PV8A 1TKTB 2NXNA 1VQOS 1FJCA 1U25A 4KPYA 3PFEA 1R8HA 1RU1A 5A8RA 2L41A 1XC9A 1MSWD 2B5JB 1J27A 3KXDA 3ZZ0A 2HNDA 2BOAA 3VZHA 3X3UA 2ZHBA 1HNXF 4LFBJ 4Z7CA 1WG5A 4IRCA 2AP6A 3P96A 2VQEF 3U1NA 2Y0BB 4F36A 1EP4B 1TVRA 5L38A 1F2HA 1UFKA 2YX4A 5KFBA 5MLCV 2C3PA 1HA1A 3HD2A 1VBYA 2ZKTA 2FLLA 4F7VA 4F3MA 4G1PA 4USMA 3M8YA 2MSTA 3RUBL 1WTBA 3AJ1A 4PUOB 3J80U 3V6DB 3FCWA 4OJ3A 2G4BA 4FNIA 2XY5A 3TAMA 4NA2A 2F7VA 3GU0A 2PMHA 1YZ7A 4P2SA 4OYBA 4FKYA 3ZTOA 5K8PA 2BANA 2MZ1A 1JNZB 2IYIA 2Z4PA 4I2PB 3G96A 1ACMB 3ILOA 4CNZA 1NPRA 2B6AB 3LA0A 2ZH9A 1C1BB 3KYLA 3OTOJ 1SBRA 4EYHB 3HI9A 1HNIB 5KFTA 1KHVA 3CMAS 5E33A 3KDOA 1PC4A 4USWA 2ZZNA 2MJNA 1R43A 1RWPB 3KOAA 3GFXA 2Q3PA 3D1QA 5CYMB 4CLSA 3G8SA 4FS1A 4NCBA 3VAKA 3ZC4A 2PEBA 1DQ9A 2DIVA 1OYEA 2PMZD 2NLWA 1QE1B 3SMZA 1Q5VA 2MY8A 1RYRA 3HVAA 4O23A 1NJZA 2W9BB 3K2YA 3CDAA 2JHEA 3MM7A 4NRUA 2V2ZA 3NGTA 2VOPA 1IM6A 3FKBA 1B99A 2VFTA 4DPTA 4RUCA 1RI7A 3KNGA 2J7WA 2AYGA 3T3FA 2V8GA 4DL3A 4NCGA 1M5KC 1R8BA 4R5PB 2A18A 3R9LA 4LF5F 4RW6A 1GAOA 1P9QC 2AX0A 3T6BA 2NXUA 2FPHX 2GS8A 5AJ3J 4NA3A 2BDPA 3OR2B 2XGQA 1TFYA 2OPRA 4F0KA 2HMIA 3VAHA 3IBCB 2IC3B 1JLCB 3IWLA 3Q8PB 3Q8SB 4DSEA 4ID5A 1HBOB 3MCSA 1KLMA 3DRPB 4WTYA 4YHHJ 1MU2A 1WC0A 4EFAC 5ETOA 1K1SA 2YKNB 3BPSP 1YJRA 2DITA 2GAGC 1BY9A 2RNEA 3CIZA 4U9RA 3FBBA 3EGZA 2NQPA 3IR6B 1VDHA 3L7UA 1DHMA 4BWJA 1VJQA 1FKPB 2CQ3A 4YB5A 2RS2A 3CD5A 4P10A 4R25A 2RHSB 4TLRA 1X4DA 2MHNA 4DV7F 1Q1KA 2ILZA 1H6KX 1NHKL 2EEYA 3SI8A 2BJ3A 2IM2A 1KQGB 3K17A 2DXEA 1CVJA 2U1AA 4AUKA 4J9RA 1FO1A 2FJDB 5DDQC 2WOMA 2Y8WA 1JLQA 3KLIB 1HFEL 4DXLA 4RPFA 5J2NB 3V2UC 4OZ2A 1HNIA 4DV1J 1LWFA 1RP5A 1DQ8A 1S6PA 3GILA 4DPYA 4M94A 3DDNA 4JB8B 1T05B 3DLKB 3OFEA 4LRCA 2QYCA 3PRVA 4LR7A 3RR8A 4IOCQ 2CPDA 2OP5A 3DI6B 3CJ3A 1S1VA 1N0UA 2VASA 1PILA 3CJ2A 2R7RA 5KG5A 1UW4A 2B9YA 1JLQB 3KLIA 4USVA 2VA3A 4IG3A 2MGZB 3BBFA 4KKOA 4PPDA 3CXCR 3L9ZA 4OI1A 4Q5VA 3AA8A 3B4DA 3RB4A 5A0YB 1Q5YA 4ECQA 3Q8UA 4AYBD 2C2OB 1AYEA 5CA5A 1JX4A 1SB6A 3MM7B 2VZ9A 4YDDB 3M6UA 3PM9A 4ZKAA 3DDIA 3PEJA 1HNZJ 1I5OB 3D3BJ 3FFIA 2Q66A 4LR9A 4HKQA 4PG7A 4I2QA 2KT2A 2LEBA 3QLHA 4M5LA 4DQSA 2Z2YB 1XR5A 5F8HA 4ILMA 3RR7A 3AXMA 4L6V3 2P9CA 2C3YA 1M1GA 3DKDA 2FHKA 4CH1A 2YX1A 2AW0A 4Q45A 3OUYA 3J7A1 2CVEA 1NSKL 2EW9A 2VG7B 3FK4A 1FFSB 1SL2A 1WJ9A 4A8MP 4LF5J 4X4VA 4TKTA 2ZJPQ 4YOEA 2DK2A 2XYGB 2J7KA 2WVDA 3FRZA 3V4IB 3AOBA 2GO9A 4NLRA 1QAIA 2HVHA 4V19J 3TJ8A 1UWBB 3GSDA 3TRGA 1N4LA 4MFBB 3EVOA 3J80Y 5DETA 4E0DA 4ZJOA 5KG1A 4K4UA 1NKEA 4RWXA 3MUMP 3MPVA 1PAUB 4OX8A 4B9NA 4PWUA 2XZWA 1F5CA 3VQTA 2WOMB 1CJUB 2OH2A 4PKDB 2CQPA 1VFJA 4IG0B 4J9MA 1HHSA 3VGVA 1S0NA 2B0GA 1RWUA 2JC1A 3PZPA 5HROA 4ZN3A 3UR0A 4AQYJ 3WDOA 1KVKA 1G4CA 2WW4A 1RYSA 1IBMJ 4RBTA 3NMAA 2X1AA 2AYEA 4ER8A 2GJ2A 4KE5A 2C2MB 1SVDA 3KJQB 4QW9A 1JK9B 3JSMB 2VODA 3OLBA 1QDUB 4IG3B 1W25A 4C0HA 4USIA 4DJBA 4M8LA 3LALA 3LP0A 1MWZA 1KHWA 2RU9A 3ILIA 3EYZA 2BV3A 1TAUA 4X2BA 2B3TB 2BXJA 3PJWA 2HZAA 3ZFVA 3G82A 3CPWR 2HVEA 3KK3B 3I0SA 2XMTA 1VLOA 3DLGB 2BRKA 3V81A 2CQDA 3BPDA 1L3KA 3CB4A 2HAIA 1DFDA 4YB1P 4XK8C 3MFIA 1FHTA 4ED8A 1Y10A 1DARA 2IRUA 3EPIA 3B78A 4X4PA 5HP1A 4OHYA 3GV8B 2XY7A 2JOQA 2LA6A 3J7Z5 2YKQA 5F3TA 2M9KA 1SJ1A 2K3IA 3W63A 4Y3CA 2G0JA 5IFMA 1AT1B 4K4XA 2UU9F 1S79A 1Q16B 2I8EA 1RLDA 1I6JA 1U1PA 3TZYA 1XNRJ 4WK3A 1LEOA 4PG6A 3RW6A 3AOCA 4H54A 4CP5A 2H9ZA 3MEGB 2MQOA 1U1LA 5I3QA 4FYYB 4UY8T 2HHWA 1N5YA 5HMXA 1Q79A 1ROFA 3C6TB 3FSXA 3MMCA 3OSPA 3C3LA 2C3OA 3QIPA 4DQPA 1SC3B 3RJMB 4KQZA 2EFPA 4PR6A 3W62A 3CJ0A 3OLAA 4NYPA 4K4VA 1WEXA 2DBBA 4OZLA 1YJVA 1HNXJ 3LOUA 1CJUA 2OLWA 2IJNA 2P9EA 3AODA 3IWNC 2FJAB 3MTKA 3WIVA 3LAKA 3KLVA 2BM0A 2FYXA 2E7XA 4NXMJ 1YK9A 5I4MA 1Y5NB 3MR7A 4IQMA 2C2ZB 2YWKA 2MEWA 5GADI 1RKJA 4MIAA 2BE2A 2G2OA 4WIQA 2ZITA 5LMUJ 4IO9Q 2BACA 4CLFA 2N4CA 3CC7S 1EKSA 2W7AA 1FDAA 3QGGA 5D0HA 1IQZA 4ZCKA 4OQJA 1TKDA 4F4KA 3IGNA 2GJFA 3M8WA 3S01A 4DR5F 1VBXA 4OI4A 3T9ZA 2KFYA 1NH8A 2L3MA 2YNFA 5KFRA 2XCPA 3T5LA 3QRQA 5KFIA 1KBRA 2B5JA 3A3PB 3D6FB 3HHLA 5ADZA 1PBAA 2MZSA 3RTVA 2HK3A 2P8IA 4OLPA 3QSYB 1VC6A 1H2UX 3S1TA 2DNGA 4FF3A 3EPGA 4WFYA 3NS7B 4OYAA 2IVFB 5GMKa 3CCRS 1W2BR 2KFZA 1YBAA 2LXFA 3A8IA 3I9V9 3W66A 4B9UA 1NH7A 3OJUA 4ZCLA 5D6GA 5T41A 5I42B 2DRAA 1FXLA 1VK3A 3P5TL 2EC2A 3JYTB 3MM6B 1TK0A 1KC8T 4OHWA 2UUCJ 2YNIA 1S1WB 3NKYA 2AKWB 2YKOA 2A0FB 2DH7A 3CJSA 2DIUA 4WZQA 1UEUA 3H4DA 2VICA 1GX5A 3KHRA 2OPPA 4DHVA 5D3GB 5K8MA 2G2ZA 3HVTB 2EK1A 2VFUA 4RX6A 3BQ0A 1NB7A 3RRGA 2WONA 4QIVA 4Y65A 2Y1JA 3BR8A 2BQUA 4HDGA 1SQGA 2ASLA 2SXLA 3FSYA 1D3WA 3BJYA 4GO5X 1MMNA 1FWKA 4EO8A 1IBCB 3PYFA 4OYXA 4CO5A 3MUVP 2ZKUA 1LWXA 3FQKA 3KK2A 4DCPB 2ZBPA 2BE9B 1TKTA 2R4FA 4RW4B 2RS8A 4LF8F 2L9DA 2QSFA 3MOZA 4J90A 4UOGA 4QIFA 4ECUA 3QSIA 4C48A 3OL7A 3SXLA 3UCGA 2IJRA 2APOA 4HHHA 4U8VA 4DV4F 1UVNA 3GQCA 4HHJA 2HK2A 1EJ7L 1WC5A 2VPWB 4RW7B 2VJVA 1C0TA 1F9FA 2A10A 3Q8VA 3CDUA 3ITHB 5AXLA 2GVDB 2VFRA 3IS9B 5IZHA 3DN9A 1FDDA 2E5JA 5AJ3F 3AFGA 1JMTA 5CD4H 2YWEA 4ZPBA 2XLIA 3KLGB 2F4VF 4RW6B 1DTQB 1UVKA 3QFWA 1UVIA 3W65A 4OJHA 1T05A 4P6QA 1U4BA 4ELTA 4YR2A 1APSA 3KG1A 4YHHF 2XHWA 4Q7AA 1OMSA 1R6YA 4TU8A 1BQMB 5ETNA 4WYLA 3UCUP 1RA6A 1QSLA 3C66A 1OO0B 1HLWA 3G6ES 2MB0B 4IFVB 1DJ0A 2NS1B 5KFUA 1TMJA 4WYWA 2BJ9A 3DRRB 1M5OC 3MOJB 2ZNYA 2VA2A 4C6AA 3PR5B 2W7OA 4J9OA 2K1RB 2OI2A 4NZ6A 4DR1J 1ZAWA 3GFZA 4KTQA 3ZZRA 1L3TA 4TVAB 5ITHA 4I2QB 3TR5A 3GB0A 4CIOA 1KRPA 2DGXA 2VG5B 4KGVB 2PFDA 1WOOA 4ZP7A 1RT7B 3I5CA 4DPUA 1QTMA 4I6WA 1WF0A 1NZ8A 4TYAA 5J2PA 3LGHA 5KT3A 4F4ZA 1UAWA 1SUQA 4ECYA 2OUGA 1NBEB 2ZUAA 3OTCA 2GV1A 1HNVB 2ZVIA 2E66A 3KFWX 3THPA 4E2FB 1WC4A 2Z2MA 2UUAF 2DNZA 1FE4A 2OD6A 1IN0A 1S1VB 1LW0B 5E3RA 2VDIA 4C11B 2CQ1A 4CM2A 3C16A 3MR6A 3BGRA 1UPPA 4P7TA 3BR9A 4OZ3A 1HMVB 5E2QA 4WIIA 2YKAA 3CDBA 2LEAA 1U0HB 2AJ0A 1XN9A 1WI6A 3VGUA 3MUTP 1HNZF 2MQ8A 3PYDA 2FGOA 2J0XA 1JLGB 3M9OB 2BUNA 5LJ3Y 3ZTSA 3PO5A 4CLZA 3QGIA 1HD0A 4NASA 4CO3A 2F9JA 1XEZA 2MLYA 4HH0A 2GVDA 1UJ4A 3IS9A 3BSOA 2KYZA 5G4DA 2AJQA 4LF2A 3I5AA 1R89A 1CJKA 2NCKL 2QFJA 3M6VA 2VF3A 4OX7A 4ZVRB 3TVZA 3MGJA 2LECA 1VQ6S 1FK9B 2CFXA 3R2CJ 4AQYF 2GVZA 1LWCA 2F40A 3PJXA 4U96A 5EX3A 5C42A 2JC0A 5KFEA 2W9CA 1J2VA 1O8BA 1U1MA 3G9CA 3HPOA 3NG8A 2CJQA 1NDKA 2BE7D 4ZLNA 2H51B 2GW8A 4NLXA 1AZSB 3PCOB 4WP3A 5M2PA 2A1BA 3CUNA 3MPWA 2IY5B 4M1KA 2ZC3A 4CYUA 1BXNA 1IKVB 3SV4A 2LU1A 2ZD1B 5KFZA 1UL3A 2DEJA 1FNMA 1GEHA 3D28A 1FKOB 1VR6A 2RD5C 2VG7A 2XMMA 1IKXA 2AZ1A 1NHUA 1Y7PA 2K3KA 2ZFHA 3DRSB 5E3AA 4R8UA 3ULHA 4ZCIA 2XQCA 3H25A 2R7TA 4F50A 1KLNA 3CJ5A 1P1TA 3D0HE 2HRYA 1YJWS 2ERRA 1FKAF 2KN4A 5D4OA 4F4AA 1QM9A 3CE8A 2J6SA 1FFGB 5HVHA 1FKOA 2W4CA 4N8OA 1RXOB 4NLGA 4USTA 4R8UB 2LU2A 1EETB 2D3OR 2OSQA 3R5DA 1LFPA 2QYGA 1JLAB 3RRHA 1FWPA 4KAIA 2YQ3A 1XMOF 1FEHA 4ES2A 3I31A 4AT1B 1FRXA 1VRUA 1WHXA 2GQ2A 2QE5A 4JI8F 3K5LA 4B9SA 1ZPVA 1SPBP 4FPIA 1X0FA 2HWIA 3A3NB 1IKWB 1X4HA 2CVIA 1JLGA 1WEYA 3D5MA 3L3CA 1HI0P 3CMES 3UI3A 2OAUA 5H9EK 3NCQA 4DSKA 2QLXA 4DV3J 2HLUA 2ZOFA 2RDDA 1CPZA 4KBIA 5KT5A 1GTEA 4J9PA 1TL7B 1QVGR 2F8MA 1OWXA 2EG1A 2IRXA 5K14A 3R1LA 3M2UA 2Y1IA 3W60A 3I82A 4JI4F 3KMSA 4X4TA 1VQKS 4WBFA 1XNRF 2KT5A 1R0BG 4OHXA 3I6PA 4WFNQ 1WF1A 3EZUA 1S59A 1MMDA 2V94A 4C3MA 4UZBA 1H73A 1EZZB 1RJJA 3ILLA 3GR1A 2Y3YA 3CJ8A 4WCEQ 1EQMA 1C1CB 2HEKA 1NK4A 4DL2A 3RU0A 3V6DA 4B3TJ 4M5MA 4ZVOB 1SIWB 1F0XA 1Q8BA 2Y1LB 5H9EJ 2DNHA 1UZDA 1VBZA 2E5HA 3K5OA 1FCAA 4YR0A 3MAAA 2VU5A 4I2PA 1X31C 3PHTA 3B6BA 1Q4RA 4N56A 4PWDB 4QQBA 4NXMF 3K0JA 4JI0F 3IBFB 4QWBA 1V3SA 3AJDA 5ETRA 1HL6A 2E1AA 1HPZA 3ADAC 3HT3A 1XK8A 1JLBB 4WE1A 3GCWP 4JBCA 3WBZA 2YNGB 3BKTA 5AE2A 4ECRA 4QYZJ 2KHCA 1NXIA 1T0TV 4ZPVR 3M8PB 4CM0A 4CLKA 2KH9A 2E5LJ 3JTNA 3QZ8A 1V3ZA 3FDSA 3QPIA 2D9PA 4ZVFA 3MAAB 4IRKA 1KONA 1EETA 4DEZA 5AE3A 5B09A 2ZH3A 3T9NA 2N7CA 2M8HA 3GONA 4Q2MA 3H2VE 5IV4A 3GIRA 3P3DA 1RE1B 2WZ1A 1MN9A 1YKWA 1RHUB 3VAIA 1IUJA 4NMXA 1HNWF 3AT1B 4QIGA 1PYSB 4ZVPB 2EVZA 1AUDA 2IMOA 2FZGB 2Z0GA 5EWEA 4DUZF 3M2VB 1RCXB 2UXBF 2NXEA 4BLGA 3BO4A 1S72S 2CJBA 4LMZA 4O3PA 1WHYA 4J5OA 1R3NA 3TJ9A 2CQIA 1R6VA 4RUHA 4IR1A 4U7UD 1FJ7A 2N82B 1LV5A 5HANA 5HMZA 4JI5J 3BN4A 3DOKA 3JS9A 3M2RA 3W5XA 5LXRA 1HBUB 2CZVC 1OQ3A 3BH7B 4L74A 1K9MT 1SH0A 1Q8KA 4OZ0A 1C0TB 1OQ6A 2VKRA 4LT6A 4K4WA 2HS3A 1N6QA 1HD1A 4YQWA 3KG4A 2B8QA 4DS5A 3CTRA 3EGNA 3CGIA 1RAOA 1FRMA 4LBIA 1JXVA 3VQSA 1S1WA 1LQ9A 2QC3A 4ZITA 3WHIA 1NKCA 2EC0A 3QGPA 3MHYA 3RAXA 4K2XA 5F8LA 3R6LB 2E5IA 3AA9A 1UETA 3CCVS 4GC6A 4WE1B 4F3OA 1SJQA 2HHVA 2XGPA 1SL0A 2CAJA 2W1BA 4HT7A 4O3QA 3PG9A 3KWMA 3PX0A 4Q0BB 3AB4B 4NZ7A 4UW2A 1RHJB 1CG2A 2VQEJ 3KNAA 3OBIA 4LVOP 4PXCA 5JVHQ 1DY3A 1VQ9S 4LQ3A 2XS7A 1ZAVA 1NPKA 4X4SA 3NMRA 2G0IA 5A8WB 2X3GA 5DDPC 5B0FA 2Y0SD 1FTCA 2MDAA 2FY8A 1VK8A 4HDHA 2OPRB 2OEJA 2G1HA 1HWUA 2VDHA 4DSIA 2ZJRQ 3HHLC 4OJ1A 5GMDA 3PTWA 2HQ3A 2XLKA 1H72C 3FUYA 3H4BA 4LBPA 2ADBA 3IR5B 3D6TB 1GMWD 1S10A 3C8YA 2UXCF 1U8SA 5A8RB 3LP2A 3D4JA 3QYYA 3SSSA 4KPCA 4IH6A 5JUMA 2MQQA 3M8SA 2MQNA 4KHPF 3T41A 1X5TA 2J9DE 7FD1A 3F0NA 3J7YI 2FHMA 3FRYA 5KFCA 2PE8A 4JP8A 4N7TA 4XO0A 1JKHA 2CQGA 1BQMA 1Q95G 3LPYA 1KQSR 3BKFA 2VOOA 3M6XA 2DPIA 3QZ7A 1RCOB 2KFNA 5J2NA 2R7QA 5I3UB 4IFYB 2BYCA 1GMVA 3IGVA 3VCDA 2XO6A 4BDPA 2VBYA 2VV5A 2FVCA 2V8DA 1R31A 1RTHA 3K7RA 1VISA 1G1XA 1V5VA 3UVJB 3US5A 4WFAQ 2ACYA 4GC7A 4UOFA 3NS5A 2DY1A 3TYTA 2C22A 3TX0A 1VJWA 1EQ0A 1SC4B 4RW7A 1RAAB 3QO9B 2XMVA 2ROEA 5C25B 2MY7A 1WORA 2MGZA 4DR2F 2OMLA 2DD8S 1VMBA 2KKHA 1ZS6A 2ZHOA 3ETMA 3LTOA 5BYRA 4C3KA 5HROB 4EZ9A 1G6BA 2Z58B 2HWHA 3KLGA 1WD6A 1R27B 3NP5A 3UNGC 4CO4A 1LW2B 3R7SB 2RE1A 1O0PA 3CF5Q 4KO0B 1HI1A 3KUEA 3MM8B 2MMYA 2R2TA 1X4EA 3NY0A 4CQ1A 3S7RA 3IRWP 3UD4P 5KG3A 2WTFA 1U47A 3JSMA 1KP6A 2VPXB 3PX4A 2CJXB 1ZPWX 2GJIA 3EUNA 3NGKA 5F0UA 4E8UA 2CIMA 5L1JA 3BEGB 4XPCA 3KK2B 4ED4A 3HFVA 1ZTTA 1UP1A 4G6VB 3QWPA 3ZZZA 1DTTA 2YKMA 4NEZA 4QR2A 4AD6A 4EI2A 4HYKA 5DLFA 1S9GB 2DYAA 4CLWA 1GMWA 2CKWA 1RSCA 3UDCA 1WC3A 1REGX 8AT1B 3IG1B 3D9BA 4DV7J 4I0WA 3K59A 2VONA 1NUEA 3GFHA 4DX7A 1PO6A 5A8KA 4O0IA 2X3DA 1UVJA 1IR2A 2V68A 2V0NA 2IBOA 2L48A 5LMNJ 1B3TA 1SUQB 4DV6F 2YH1A 3OFGA 5KFSA 1J5OB 4JI8J 5CH7B 4ZVEA 1LKZA 4ES1A 2XSJB 4CNYA 1N5QA 3NLCA 4N47A 5D8HB 1IKXB 4WWSA 3D3CJ 3FBCA 1D9DA 1RAEB 2E7WA 3H42A 4ZS6A 3GYXB 5E3PA 3L95X 3MR2A 2M88A 1PAEX 2ZBQA 3PRBA 1CULB 3CVKA 4QW8A 1FESA 4DV3F 5KFQA 4ZPWR 4CT9A 4IQXA 1NZAA 2ALYB 2Q79A 3EICA 3H5UA 5D4PA 1Z1ZA 1LK7A 5KT4A 2BW2A 3KHHA 3NNCA 3MXHP 4P71A 4JYAJ 3ENVA 5L8RC 3TUJC 3DOLB 3HKZD 4GKJF 4LF7F 3QNWB 4AXIA 5KFAA 1HHTP 4X4UA 3EGWB 2CA9A 2HBRB 3QJLA 1CC8A 1S7HA 2AEFA 4WF9Q 2GC8A 5HAOA 4F26A 1FX2A 2HRTA 4EO6A 4RNOA 3DHXA 4F2RA 3U1LA 3KK3A 4KO0A 5F8GA 1B7YB 3KJVB 2QFIA 2ROPA 4P7VA 3R7NB 3VZIA 5ETVA 1T7PA 1YWXA 4YDXA 5C42B 1T3OA 1PIEA 2G1DA 2XYHB 2KG1A 2RRAA 2XZTB 2EG2A 1CBKA 2VG6B 3DFEA 2V63A 4K8RA 4TYBA 5HLFB 1VQNS 5HMYA 1E6VB 1WACA 5JXSA 3UN2A 5LSOA 3PO4A 3AB2B 2AHOB 1RT3A 1YSJA 4NLOA 4Y00A 2GX8A 3UN3A 1FF2A 5KFDA 4OMFG 2VBXA 2EXUA 3BS9A 3H8YA 4QWEA 3UR3C 2W2PP 5IS2A 2KHDA 4NZ0A 3GP9A 4ZA1A 1S6QB 4C0OC 4BBYA 4DU8A 3TARA 3CCTA 4USKA 5IT0A 1E6VA 1U02A 4Y2AA 3SFUA 2RQKA 4H4OB 5B0DA 3HXMA 2ZM6F 1U6ZA 2YPYA 1TQLA 1IBKJ 2HW3A 1KR4A 1NCLA 1FRHA 1F5BA 1K0TA 3EVMA 2GIRA 4J9KA 4K5SA 3GE9A 3SDEB 3G4SS 1NO8A 4NLWA 1BQNA 3TAPA 5AT1B 2HHUA 3QAUA 1H3DA 3POTB 4XDDA 2OPPB 4ZVUB 4OZNA 4CLTA 2DRBA 4OV1A 4W90B 4CTAA 4WU2A 4JOUA 5EWFA 1PSDA 3HK2A 2E5LF 1N36F 4MIBA 4C8YA 1RWWB 3EXYA 2AYMA 4NMLA 1X4GA 3GV5B 1JB0C 4A8KA 4WZMA 3BM7A 1KKHA 5H1SV 1N54B 2IA0A 5DGBA 4NXNF 2C42A 1VC0A 4K4ZA 1GX6A 1UCNA 2PT0A 3ETOA 1RWOB 1LWEB 3W9HA 4DLEA 2XG8A 3CCMS 4P2MA 1T8EA 4J37A 1RHMB 1Q53A 9ATCB 4F02A 1VQ4S 1BD6A 2HVDA 3I4PA 4ZDNA 4ICLB 4X62F 1W2IA 2XC9A 3P49B 3KJNB 2YX7A 4I67A 3DYAB 2AV5A 5CYJA 3TAMB 4MJKA 4S0MA 1ITPA 8RUCA 2NPFA 1KDNA 2GAHC 2DR9A 4WKYA 4DX6A 1NJYA 4QWDA 4WKRA 3VGSA 4LBHA 4KC5A 5IQ6A 3MWBA 5EWGA 3Q8RB 1WDDA 3PYGA 1O51A 1KSPA 1VLYA 2FVSA 5K5MA 3TANA 2DGVA 4DX5A 2EBGA 2HHHJ 3RBZA 4AFFA 2HNDB 2DNMA 2C3MA 4DFMA 2BW7A 1B70B 1M1HA 2FY1A 4FYVB 4DCJB 2AGQA 2DVIA 2CQ4A 2FHOB 4F67A 2OJ3A 1BGXT 1SJ3P 1RZMA 1X9SA 1BC6A 4RW8B 1TFWA 3R5JB 2E1RA 3WC2A 4IFVA 2MKSA 2D3ZA 4UUWA 2YNFB 1WUUA 2NUUG 1VQMS 2FJWA 1N0VC 1U45A 1KS2A 1Y0HA 5L1LA 1VOMA 2DNYA 3IA0A 4DPWA 3G86A 5LMUF 3I4HX 1HQEA 2UXDJ 1YX2A 1CQNA 3QGHA 3KLFB 4IR9A 2W8LA 2X1FA 4DR4F 3VAMA 3PW5A 2R7SA 3EWGA 3QT7A 3SCIE 1KVIA 1TP7A 2YY3A 2MQMA 3O5TB 2FZCB 1IR1A 1NK0A 1L5UA 2DGTA 3HJFA 5H9FK 4XDCA 2J0QD 2CJ9A 1VRQC 1KVJA 3V6HA 2G9OA 1HKAA 2UV8G 3VAFA 4FS2A 2A3JA 3PRDA 4C8MA 3VHQA 4A8SA 3CWJA 5F8MA 4J9UE 1SC6A 3M2VA 1C1BA 2GHVC 2LDIA 2HFZA 4ZPTR 4B3MJ 3EJMA 1FFWB 2PGCA 3OFFA 4WPAA 5T14A 3C15A 1JQGA 3AD8C 3OTEA 5CCLA 2DTJA 3I87A 1JLFA 3T1HF 4F8RA 1FE0A 3I9ZA 2B4OA 1U0HA 3CCJS 1U6BA 4EYIB 3K5NA 2HQDA 3UQSA 3C46A 4CCHA 2UUCF 4PWWA 2JJ4D 2QLJB 2MKJA 3F73A 1D8YA 2IYGA 1TUVA 1ZOTA 2WVCA 3CMQA 4HHUA 4BS2A 5J2MA 2PC6A 2J7UA 4NLTA 5M2RA 4Q2LA 4QIWD 1OY9A 4URSA 4PRFA 2AJ4A 2BJ7A 1KNZA 1VIOA 2ROGA 2DXFA 3LUYA 2DHHA 4DR2J 1BHNA 1TUGB 4JV5F 2ZUGA 1Y9OA 4DV2J 3N5BA 2B9WA 2UUTA 1U2RA 3L7OA 3SCJE 4EUVA 4ED2A 4LF6J 1B4SA 2ASDA 2O66A 1RT1B 1U2CA 3KUHA 3Q86A 5K8OA 1NNDA 3I55S 5DG9A 1J5EJ 2BJDA 1CLFA 3W8GA 4EK2A 1F3VA 3R6GB 1KN6A 2NXCA 2V4RA 4OHZA 2HFSA 1XMQF 1OPZA 4QOTA 3ZTQA 1Q0NA 4PABA 3UCZP 1N5YB 2JEFA 4PXEA 4ZHRA 4GKKF 2IAJB 3MFHA 2IIHA 3JAMY 3TUPA 3SCLE 4LFCF 2AJ1A 1KLMB 3DRPA 3E01A 3Q23A 4ED0A 3I0RB 4MK8A 1RTJB 1PYTA 3M4XA 4C8OA 3RZAA 3IR7B 1SKSA 3BGRB 5D77A 1TZ0A 4NLVA 3DRXA 5ETKA 2ZH2A 5L1IA 2ATLA 4D3HA 2AYBA 2XNRA 2PSZA 3UVJA 1SJRA 2CQBA 2FHJD 1HR0F 3S8SA 3KG0A 4P73A 5HVGA 5A2QY 2KRRA 4UOCA 1GMUA 1T02A 1VYAA 5KFLA 1HHQA 2HKEA 2MZJA 4OX9F 3C6UB 2MTLA 1RTJA 2LCWA 2JVOA 1U1QA 3MDFA 2UUWA 4KFBB 4QPXA 3H98A 4AL5A 1S6PB 4KKOB 4DL0C 2GGPA 2UVRA 3CEDA 4J7CA 1KEKA 2PA8D 2VJUA 5DG7A 3ZZUA 3TQEA 1FK9A 1HBMB 1JWWA 4DSFA 2R8HA 4FVMA 2E9TA 4P75A 3GIMA 1FXDA 1JJ4A 1KQKA 4ID5B 1GQEA 4LFAF 2CRLA 2RF2B 3QBCA 4DR1F 5KFOA 3HZEA 3C6UA 4CI0B 4ZP9A 1WF2A 4HLBA 4KFBA 3H5XA 1RWVB 1E6YB 4PPZA 5A0YA 4KGXB 2RUGA 4DFPA 5HQ8A 3QMQA 4O3NA 2GIQA 3FCVA 2COLA 4A47A 4JV1A 2IMWP 4DV5F 1S6UA 3O1LA 2XWYA 3ZXWA 3VAJA 4OZ5A 4Y28C 2JFKA 3DCAA 3FSIA 2I0XA 2H5IB 2Q43A 6FDRA 4DR3J 2ZH7A 2CPEA 1YBTA 4ZIWA 2MXYA 5FIIA 5U47A 1T9UA 5G0RB 2ZH8A 2J6TA 1B0PA 4RW9B 3CDWA 2X51A 1NSQA 4IOAQ 1S6QA 1X9MA 3CT9A 4PYAA 3ZZYA 4C0BA 3DI6A 3CCZA 3PY8A 2CUYA 3BGLA 3BREA 3DOLA 2JX2A 3T6JA 4BC7A 4EU0A 4N41A 1IQTA 2VG5A 3CD6S 1SQFA 3PIPQ 3D1HA 1WG4A 4FPRA 2CPIA 3QQCD 4NYZA 4ED6A 2Z2ZA 3I5BA 2BQRA 1DTTB 2YKMB 4JI3J 1FT8A 3CCES 4RW9A 1IKWA 3K57A 5J2QA 3MEDB 3MPYA 6FD1A 4RBUA 5C5JA 3SDEA 2NREA 5GAGI 4FF1A 5DS7A 2JEIA 3FFIB 1UJ5A 1WKKA 1JLEB 1WOPA 4IDKB 1RT5A 2DPJA 3IC1A 1GTHA 2GHWA 2LQBA 1TV6A 3IAS9 3LP0B 4YN3B 3MM9B 2G13A 3FZ2A 1UMJA 2WVEA 3QWUA 5K8NA 4X65F 1KFSA 1AB8A 1QAXA 3D6HB 4KRWA 3T5HA 1N48A 2HQCA 1OS5A 2E7VA 4TU9A 2Y8YA 4ANCA 2P5VA 4C2MA 3SIPB 2AMCB 4HVZA 4LRFA 1EIYB 1LXJA 2W7PA 4OLOA 2RRNA 5KFMA 2ZM6J 3Q24A 3CD0A 3AY0A 3N6LA 2KYXA 2QLFB 2DKOB 2HNZA 3M30A 4ICLA 2BMBA 3SEOA 3ZZOA 4XPEA 4DL5A 2AEMA 3IM8A 4KSEB 1VIXA 4MKAA 4DR7F 1D0EA 1REVB 2RSQA 4HACB 4WJBA 5KG4A 1SC1B 5DLGA 3SCKE 2R7WA 3OQ2A 5CHCB 2PDAA 3BYPA 2HVZA 4M5KA 4B3SJ 1N36J 1XNQF 5HJYA 4A8QA 2JNJA 1YITS 1I51B 2ZD1A 3K5PA 1RADB 4FYWB 1K8AT 1I3OB 2WB4A 4FN5A 2DNLA 3DLEB 3W9JA 4C3LA 3RBEA 3NGUA 4PXBA 4UOHA 3E51A 2D69A 5IWAF 2D74B 1RK8A 3Q2TC 1ZTWA 1TU0B 5HBMB 2H65B 3DGPB 4X62J 3F44A 2YNHB 2CDQA 1YJUA 1S9EA 3M7VA 3MECB 4RW8A 3R2DJ 1RWKB 2A2DA 2I5JB 5KFXA 5E3CA 4CWBA 3FZBA 2JLGA 2BRLA 1RT4B 2OSRA 3I0SB 3G87A 4MYUA 3W61A 4J9VA 3MM6A 4DI6A 4K4SA 2W4PA 2MQLA 3MMAB 4Q0BA 5CD4A 2HGMA 3TVYA 4IH5A 1CSJA 3TA1A 4DUYJ 2MKKA 3T1YF 5HBMA 5THWA 2ZH4A 1V3RA 5HATA 1IWGA 1HWLA 1MLAA 4RO0A 2EBEA 3FEXB 1VHIA 2B7BB 2VC0A 2CZ4A 3MM9A 2FUG9 4MMOA 1TL1A 4PCQA 3TA0A 5LSRA 2I5JA 5A6WA 3BZQA 1VQSA 4P2FA 3FVYA 3R5GA 4J9QA 4ID8A 4YFUA 2RU3A 1KD1T 2F65A 3KTQA 3HHLB 2YVSA 2OELA 4JI6F 1CJVB 2MZTA 4DQQA 5T7LA 4DN0A 3IM9A 1B7FA 1N8RT 3UE2A 2HHTA 5KFKA 2PIIA 1T11A 2IJFA 2W2QP 5LM7E 5KT7A 2BABA
chains in the Genus database with same CATH topology
4LSNB 3M6WA 3KHLA 1N6QB 3NNHA 3M1VA 1GXLA 1HYSB 2I38A 3JYTA 4DL6A 1JXLA 4QR1A 2BR0A 2V8VA 1X4BA 2VL1A 3I96A 5T7LB 4AXJA 5DQGA 1ZYQA 1PGZA 4IRDA 2HPUA 2RDIA 4Y2CA 3DU6A 3ITHA 3RAQA 3MMBA 3ZZTA 4LFBF 1C1CA 2N3OA 2HHSA 4O4GA 1C0UA 3OTOF 4K5RA 1WG1A 1ZBTA 3E2EA 1RT2B 3DOKB 1N56A 1Y4ZB 4B3OB 3MR5A 1EP4A 1NHVA 1PC5A 4HH1A 1M5HA 2EFVA 2ZJQQ 4B3MF 2XWXA 2DNRA 3MEEA 4RW4A 4Y0FA 1QE1A 1NK8A 1MROB 4PUOA 4YUDA 2Y1RI 1LWFB 3TI0A 2YNGA 4CT8A 5B08A 1U7LA 3DLKA 1RT2A 4FBTA 4Y6IA 2CQ0A 3HHNB 2KTQA 4JI5F 1FERA 4ILRA 2DGSA 3WZ0A 4BHQA 1QLNA 4A46A 4F2SA 1XR7A 2RKIB 3H2LA 1TL5A 1X4FA 4I7FA 4Y2MA 5IQQA 4U67Q 5CQGA 3G6VA 4DV2F 4LQ9A 4HEA9 3H59A 4CH0S 1S9GA 2QIFA 4DSJA 3CULA 5KG2A 5CYMA 2DGWA 3DM2A 1J5EF 3K58A 3NWGA 1QUVA 4DN9A 3PW2A 2KT3A 2WBMA 1LFWA 2WONB 5KFGA 2IVYA 3T5JA 1WHVA 1SKWA 1S1UB 3EXCX 4YMEA 1FNXH 2NUHA 3DLHA 5EX0A 1J5OA 3DXBA 1FRLA 2MKCA 3DC2A 3B82A 2RF2A 3PFOA 3H5YA 1U48A 4DX8H 4OI0A 5BYSA 2XB2D 5J1PA 4RNNA 2OTJS 1A7GE 5D4LA 3TUIC 4NCGB 3AAWB 4EEYA 4HTJA 3BDPA 3OL6A 5J2PB 4YB7A 1RGVA 5KFVA 1ULRA 1BWEA 2JFDA 1Z2ZA 4I68A 3GG1A 2M70A 4NCAA 3IN5A 2DHXA 1VQPS 4ES3A 1TK5A 3CC2S 4Y2KA 3TVKA 4OI2A 2DGQA 1H0HB 3BB5A 3DLBA 3J81Y 4QU7A 2IVMA 4DQIA 2DCLA 1MROA 4IKAA 3RRKA 3SQGB 1DRZA 1WWHA 2ZDOA 2MZRA 2ZC4A 3LAMA 2HG4A 4NWBA 1YHQS 1S9FA 4KHRA 3QJPA 2MQPA 4DV1F 2N7YA 4WXOA 4Z37A 2XEXA 4FVCA 2CG4A 3U02A 1S1XB 1IJFB 1Q8IA 4NRTA 1ZAXA 3UW1A 4U6PA 1FDNA 4I64A 2JRSA 2B4VA 4ETZA 3FEYB 5KT6A 5GAEU 4X4RA 1HW9A 4B9MA 1U49A 3A1YG 3FMWA 1JLEA 4IDKA 3UWTA 2J6UA 2C28A 1TV6B 3OHBA 3LP2B 4ERDA 1ELOA 2RH3A 5E0OA 3GIJA 3BN7A 4PXDA 4YR3A 3IRXA 3NCRA 1D1UA 1P6TA 4O3RA 1Z2LA 4J9LA 2XS5A 1SL1A 5A8KB 2RMLA 4IFYA 2ZBCA 1NKBA 2IBKA 2DH8A 1T94A 1S77D 3ENQA 2ZE2A 2GGPB 4ZOSA 5FDLA 4OJGA 1WI8A 1TKXA 2FHJA 3OXLA 2R9LA 2XNQA 5J2QB 1G7CB 2NPIA 5J1NA 4I6AA 1JJ2R 3TOQA 3RAMA 3DXSX 2VQFF 1VRTB 2BA9A 3BDEA 2B9XA 2WB1D 4NYOA 2OMOA 1YJTA 5C24B 2EI5A 2Q1LA 2RRBA 2AWZA 2UV8A 5LMNF 4ZVHA 2KB2A 4CH7A 5F9LA 3MEKA 2PD1A 1M5SA 2JLEA 4F4WA 3CCSS 2NSBA 1S9EB 3MECA 4NLDA 2M2BA 1IKVA 2DHGA 4FXWA 2CPYA 1QAJA 3FJ2A 1QJHA 3H20A 1FD8A 3M8PA 2LQ9A 1T95A 3L09A 3G8TA 3NBPA 1I1GA 1P8GA 4B9TA 3BSNA 3FQLA 4BWMA 4UQTA 3W2VA 2HNZB 5AE1A 3AJ2A 4Q8FA 2VFVA 1FDBA 1Y5LB 2DNQA 2FJEB 3OUYB 3PW7A 5LSLA 3NL0A 5LXYA 3KLEA 2E9ZA 1GXTA 3CJKA 2D7SA 2DR8A 1F2GA 1SIZA 1MMLA 2C2DA 2WBRA 4PWDA 1F60B 4A8XA 4AE5A 2R8KA 2B56A 2QA2A 2HNYB 2RQCA 1YI2S 1FA0A 1H2TZ 4F3QA 4DUYF 4EBEA 5AXNA 1NK7A 4N76A 3V4MA 1HW8A 3GYNA 3CJKB 3MAQA 4IG0A 4C8ZA 4NPOA 2YNHA 2RT3A 2HLTA 1S0OA 3BSAA 1VC5A 4Y2IA 2DT9A 1GNKA 5H1SV 2HHPA 4QWAA 2GQCA 2V8HA 4LIWA 5KOXA 1UA1A 3CCLS 2RJZA 1U1RA 4JI7F 1U24A 1X4AA 4C98A 3OHAA 4DLGA 4V19X 4R0JA 2XCAA 2R7XA 4LSNA 2F1FA 2W25A 2FJXA 2FLNA 2UZAA 4A48A 2EFOA 4GO7X 1YGYA 2BVZA 5I42A 3ISZA 3R5BA 2FLPA 1R0AB 2ZOGA 3LP1A 3MD3A 1X5OA 3JTPA 5D3GA 5K9FA 4U7CA 3M8QB 3RB0A 1G2EA 5IXUA 2LXUA 1O5JA 2BQ3A 4D3GA 3HVTA 1UVMA 5DO2A 1SQEA 2EPIA 2LKZA 2EWHA 5M2UA 2NR0A 1RTIA 1D9FA 2EKYA 4X4QA 3GMGA 3UD3P 3JB9k 1NJIT 1N5YA 2Q6BA 3V5RA 1T8EA 5B0AA 5HN0A 2KXNB 3LP1B 1A6LA 1S48A 5J1EA 1KTQA 5LL6d 1X5PA 1HQUB 1SI9A 3CDEA 1N34F 5KFPA 1C4CA 2AGOA 2O1PA 4MK7A 5KFFA 3KLHA 1FD2A 4PQUA 3U1MA 1IJEB 5E3QA 1JKHB 1HARA 1NRKA 1H7XA 1IR0A 3M32A 4ECVA 1UJ6A 5J2MB 4LIRA 3LF0A 2QMWA 2CPJA 2MPUA 2HS4A 5EGYA 2KM8B 2KG0A 2ZNZA 5KG6A 3DDKA 4ZP6A 1YG0A 2J9DA 5GAGU 3DHWC 4PQUB 4DF8A 2VC1A 2FD2A 4LSLB 2F8HA 3PACA 2W24A 1QAYA 1RAJA 2NSCA 2RQ4A 4FF4A 2DNOA 2BM1A 2UXDF 1N5VA 2M52A 1RTDA 5F9NA 4F25A 3DLJA 4DFKA 3N6NA 5EUHA 3FCHA 3TO8A 3PXGa 4B17A 2IAJA 2E1CA 1XWLA 4DSLA 4LSLA 3CD7A 3M8QA 3R1HA 2ZZMA 2HYIB 1HBOA 1S0MA 2DH9A 4DG1A 3PEHA 4I4BA 4WXWA 4UQGA 3SZ2A 4QYRA 2K7JA 2FC9A 3HVRA 3HF5A 2GQQA 2JSXA 2LYVA 4PG4A 4KT0C 1YJ9S 4MKYA 2R7UA 1XBWA 3BQ1A 5J1EB 1B0TA 3G8QA 1U1OA 4ZMMA 2ASJA 1LW0A 5D78A 2UVVA 4RNMA 1KFDA 4I7FB 1FKPA 2DNKA 4TQSA 2R2UA 2U2FA 3M9MB 2L08A 4ZHRB 4AL6A 5F8IA 2K2PA 4LF6F 2OO4A 5DM6Q 2WW8A 3D54A 1H38A 4OZJA 4N77A 2MZQA 4OX6A 4X4OA 1YTYA 4C9DA 1FJGF 1S1UA 4N8NA 1TKZB 4URQU 2JWNA 1U26A 2M5YA 3OW2R 2O67A 3IG1A 4L72B 1H2VZ 2FIUA 4USJC 4C11A 1FRJA 2YWGA 2FJBB 1UFLA 2FTRA 2ABYA 4RUAA 4C7QA 3PDNA 5C24A 5KFYA 5HL7Q 3P6YC 5EHHA 3Q0AA 2I2YA 3OTDA 1IKYA 4LUBA 5DDOC 2KJVA 1B64A 4WFXA 5GADU 4EWTA 3K8WA 4DG1B 7FDRA 3G6YA 2AQ4A 3V4IA 1S99A 4TNOA 4ZVGA 5H9FJ 3EX7B 3CCQS 1X5SA 2P6TA 2VBZA 1XR6A 5MAOA 1CC7A 4OZ1A 4TU7A 1QVFR 5DRKA 5CZXA 2KJWA 3KKFA 1UEVA 2PO4A 2PI5A 2BBEA 1JXEA 3LWLA 3O44A 4JI1F 1S1XA 1YQHA 3PKMA 3O8WA 4I56A 4M5DB 3IAM9 2RVJA 2DISA 4G1IA 1HNVA 1K0VA 2W9AA 2B43A 4KGMA 4ZK7M 2CJKA 4QCLA 2NZ4A 5DQIA 3PX6A 1S0VA 3KK1A 3MEGA 3TP2A 4TY9A 1TL3B 4DR3F 3RB6A 3AQOA 1SV5B 5CYQA 3ZZPA 1HBMA 2QMXA 1VGYA 4A8WA 4ZPCA 2MKHA 1MWYA 1HWJA 3DLGA 3IRXB 3J7YU 2CQHA 5CXTA 2J8AA 4MIWA 3MM5B 2LEPA 4TQRA 3DNCA 3GWCA 1YJNS 3W2WB 3Q8QB 1IM4A 1M5PC 3E8OA 3HVWA 5LT5A 2OPSB 2QSWA 2OPQA 3E3XA 3LH2S 3LGNA 3MI7X 4KV8A 4JI3F 1RKIA 1JIHA 4B3TF 1ZH5A 1N32F 5FD1A 1HBUA 4A8YA 3DRYA 4UUXA 1Z4UA 3DGPA 2RQMA 1Q7LB 5E5NA 1F5AA 2YKPA 3CCUS 2ASYA 3THTA 4K4YA 3I56S 2J9CA 1M90T 4ELVA 3FMBA 4B9LA 1RT4A 2XSFA 5BYQA 3M2UB 5AXMA 1YIJS 1PO6A 3KLEB 2ZHAA 2WCXA 4JI4F 4LF9F 1YVFA 3UCUP 2BANB 4QJVA 2DHAA 2CPHA 3DRSA 2A2CA 4ECZA 4B3OA 2KVIA 4DR6F 4QU6A 4MK9A 1S1TA 5BJRA 3IO1A 5KG0A 4USHA 2UVWA 1APSA 3QIPB 2YTCA 3BGUA 3DLEA 1WEZA 5L1KA 1DURA 3DYAA 1TK8A 5BR8F 2CPFA 3TA2A 2QZ8A 4M95A 2PFFB 1DLOA 4A4JA 3LO3A 3S6EA 3LANA 2WSEC 1BQXA 2XBPA 5AXKA 2X1BA 5B0BA 1X9WA 4KGKA 2O5DA 3T19A 3N0VA 2VFSA 4FNHA 4BC9A 4FXDA 1RT6B 1DLOB 1Q86T 3DMJA 1U1NA 2HWTA 1XERA 5HO4A 3TNVA 2IFXA 4F4XA 2KXHA 2LLZA 2KXFA 4HTIA 3HHDA 2ZH1A 3CC4S 4O4GB 1TL1B 2I1RA 5KFNA 2F3JA 4MKBA 2N4DA 4KJIA 5L9XA 1RT6A 2G0CA 3H5SA 4CZCA 4FYDA 3VAGA 2E44A 1FEEA 2HIQA 2KRBA 3KLFA 4C8NA 3NAHA 2ALZA 3BO3A 3HO1A 1ZZFA 3SFGA 4DL4A 1CEZA 1WTFA 2RILA 4TY8B 4EBCA 3JSBA 3AH6A 4ECSA 5KFHA 3NNAA 1HWIA 1Q7YT 2VD3A 2UP1A 2KM8C 4ZPDA 4NLPA 4R0EA 5KTQA 3OFHA 1HQUA 1OPIA 3HMJG 1SJFA 4B3RF 5IT9Y 1FRKA 1HPZB 2DO4A 2IM0A 3R5CA 2NYIA 1T3NA 2HFNA 5FJ4A 3NGDA 3THVA 2QA1A 1R0AA 3FNNA 4Q43A 3JTOA 5F8NA 3ONQA 3E01B 4H4KA 4O4RA 2QO3A 4A8FA 4YY3F 4Z2XA 3M8RA 4K50A 3ICLA 5IM0B 4M63A 4K0KF 1WELA 2P9GA 4ECTA 3NS6A 5SUHA 3DU5A 1N52B 4C97A 3PNIA 2VPYB 2HMIB 3HX9A 2GNKA 1NJXA 3DMJB 5EDWA 3OVAA 3C2PA 3MF5A 4WFBQ 3A8EA 1HQEB 3M05A 2R2RA 1N33F 4O3OA 2ILYA 1GH8A 3M1VB 5GVQA 1RDRA 2XMKA 1FXRA 2RKIA 2W4DA 4H4KC 3GG0A 2B51A 5B0CA 1X8DA 4I69A 1P1LA 2FGCA 1YRUA 1VS3A 1RT1A 1ZM3A 2CJAA 3HDSA 4HI1A 2MSSA 5E41A 1VQ8S 2O3DA 3O2IA 1C0UB 1SKRA 5GAHU 3D1OA 1JLFB 5L9NA 2OD4A 5EN1A 3BGFA 3MM8A 4FF2A 1JLCA 1XTZA 3T1AA 2R2SA 1C2PA 3N4WA 4RKUC 4ZP8A 1VRTA 2YKNA 3N6MA 2HHXA 3PW0A 1FNOA 5I3UA 2PI4A 1M0SA 2XS2A 1HMVA 1XMBA 1DTQA 4EBDA 2R8JA 4EGLA 3HP6A 4ETXA 3K5MA 3N01A 3VTIA 3KJVA 3KHGA 1URRA 1VQLS 2PN6A 1TR0A 1X4CA 5KFJA 2ZH5A 5KFWA 1NK9A 1AROP 1OIAA 2HS0A 4PG8A 2J76E 2VPZB 1DBDA 3HFKA 4ED5A 1E6YA 3DRRA 3B8HA 3LGMA 4HT5A 4DOZA 3OV7A 4ZLPA 2C2RA 2VH7A 3N9UC 2XMWA 3NBPB 3I0RA 1LXNA 4B9VA 4CO1A 2E9RX 4BCAA 4E98A 5FLXY 2FC8A 2HFOA 4R5PA 2AU0A 4L3NA 1NK5A 5HMWA 1DQAA 2KDOA 2IC3A 4OI3A 3DLLQ 3BO2A 1JNRB 2C3UA 1UFWA 2MHEA 2RIJA 3NRBA 4OHVA 3HKWA 1FVQA 5F8JA 5F41A 2GA7A 2CYYA 5DDRC 4NLSA 5DM7Q 3BF4A 2P6SA 3W2WA 2OFHX 4K59A 1FTRA 2LVWA 2OKQA 2JZ5A 3CSKA 2MKIA 2DNPA 3SSRA 4KV8B 4X64F 3HHEA 2KU7A 4RWWA 4DDFA 3QO9A 1YRTA 2RB7A 4GMKA 2FVQA 4JI2F 2FJVA 4DFJA 1WHWA 2DJWA 2WAQD 2VB6A 1TL3A 3R3TA 4JYAF 1FRIA 4DS4A 2BOPA 1RA7A 1NEEA 1OSCA 1ZETA 1KQFB 1SH3A 1LWCB 1OSDA 2W9CB 4J9SA 2BZ2A 1Y3JA 2BE2B 4ED1A 4DF4A 1S6OA 5I3PA 3BQ2A 1VRUB 3LQVA 1S1TB 2F9DA 1KOOA 3M30B 5G0RA 2HHQA 4H4MA 4O44B 2EK6A 2EFGA