1G3OA

Crystal structure of v19e mutant of ferredoxin i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEECPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential
pubmed doi rcsb
molecule tags Electron transport
molecule keywords 7FE FERREDOXIN I
total genus 29
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g3oA00
5FD1A 1FF2A 1PC4A 3MMBA 1FDNA 4XDDA 2PDAA 3IR6B 1XERA 1FRHA 2VPXB 4RKUC 1K0TA 1PC5A 2FJEB 3MMCA 2WSFC 7FDRA 1BD6A 4YDDB 2VPYB 1H7WA 2C3UA 1FTCA 1Y5LB 2C3OA 1GTHA 1R27B 3MMBB 1F5CA 1IQZA 5BYQA 1BWEA 3MM7B 1FCAA 1CLFA 1ROFA 1H98A 3EXYA 2C3MA 3OR1B 2IVFB 1C4AA 1F5BA 1G6BA 2WSCC 1KQFB 4DHVA 2GMHA 1FRMA 1Y5IB 5BYRA 3LW5C 4CI0B 2FJBB 1FRKA 1DURA 2Z8QA 5CH7B 1IR0A 2FD2A 3MM6A 3OR2B 1H0HB 4Y28C 3MMAB 1G3OA 1BLUA 2VPWB 1Y4ZB 2C3YA 7FD1A 1HFEL 5CHCB 2C3PA 3HKZD 1B0VA 4KT0C 3MM6B 1WTFA 2V4JB 2FJAB 1FEHA 3MM9B 2VKRA 4L6V3 2FJDB 2WSEC 3MM8A 4OMFG 1GTEA 2UZAA 1DAXA 4XK8C 1FDBA 2V4JA 3IR7B 3OR2A 3EUNA 1DFDA 5BYSA 2WB1D 2PA8D 2ZVSA 3MM8B 3MM5B 2GMJA 3IR5B 1SJ1A 3MM9A 1F2GA 1JB0C 2WAQD 1BC6A 1JNRB 1FERA 5E7OB 1Q16B 1C4CA 1AXQA 3GYXB 2Y0SD 3MM7A 1FXDA 1FXRA 4XDCA 2XSJA 4ID8A 4OV1A 3C8YA 1FRIA 3MMAA 2VPZB 2FDNA 1FDAA 1B0PA 3MMCB 1KEKA 1JNZB 1D3WA 1KQGB 4AYBD 3MM5A 1A6LA 1FRXA 1FRLA 2FGOA 3PNIA 2PMZD 1SIWB 3OR1A 1SIZA 1RGVA 1FD2A 5L8RC 1BQXA 3EGWB 1H7XA 6FD1A 6FDRA 1FRJA 1FDDA 1Y5NB 1B0TA 1GT8A 1GAOA 1VJWA 2C42A 2O01C 2V2KA 2XSJB
chains in the Genus database with same CATH superfamily
4R8UB 3W9JA 1QAIA 3N4WA 3SCLE 3BBFA 5IV3A 4F50A 4RU9A 3V6DB 1RTHA 4LRFA 4FN5A 1NK5A 3DMJA 2D7SA 2K3KA 2RU9A 2ZBCA 3R7BB 2IIHA 3CMES 2XBPA 4QYZK 1V3RA 4PKDB 4U7UK 4ED3A 2B7BB 2VB6A 5KFWA 2P9EA 1ZBTA 2E7WA 4OX9J 4ZP9A 1CJUA 4TNOA 2F1FA 1U25A 4ZK7M 3I4PA 1RWUA 1Y5LB 1HHTP 1GTHA 3DRRA 1QSSA 1R27B 4ETZA 1S72S 1PG5B 1QD1A 3RB6A 2LEBA 2WHOA 2CPZA 4CQ1A 5H9FJ 5F0WA 1MMDA 2J6UA 8ATCB 4AQYJ 1FWKA 4KB7A 4BLGA 3M9NB 1RXOB 4WXOA 3G82A 4RLEA 4ZLLA 3ENAA 4ZLNA 5JVGQ 4B3TJ 1SC4B 1SQGA 3U1MA 4NCGA 1FVSA 5DGAA 1X4DA 1T05B 3MD3A 1Y5IB 3DNCA 1JWWA 4NYPA 2JVOA 4Q45A 2Z8QA 4UOGA 4LF9F 1LW2B 2IJNA 3LUYA 5EWEA 1Q5YA 3ENQA 1UJ4A 2KVIA 3BM7A 1WKJA 4O4RA 3GJSB 4DX7A 3UR3C 1PYTA 1TKTB 2YWKA 2ZBRA 2DGOA 4MK8A 1RCOB 2GO9A 1GNKA 3EGNA 3ILIA 1D9FA 2ZHAA 2FIUA 3M7VA 2PA3A 3QAUA 3TUZC 1XMOJ 3O3LA 1JLEB 3A1YG 5DDRC 3PYFA 2IA0A 1T94A 3HVTB 4JOUA 1HLWA 5GAGI 4ZOSA 1SL1A 2DTJA 3HLUA 4PCQA 3NNCA 1WTFA 3KTQA 3O2IA 2DGTA 3IS9A 3V4IB 2UUCJ 3Q86A 4L72B 5KT4A 4GO5X 3M8RA 4RW7B 4DQQA 2ABYA 2ZITA 5KFKA 3SYZA 2VKRA 4ICLB 4JYAF 2QL7B 5L46A 1N48A 4H54A 1X4EA 1RWMB 2L3MA 4WE1A 5B0FA 2EFVA 3GFZA 5FIIA 1Z2LA 1Q95G 1T11A 1RISA 1U0HA 3V6JA 4ED0A 3T5JA 1S9FA 4HLBA 1K8AT 1IBMF 2VODA 4PQUA 4V1Ak 4Y2KA 4YN3B 3MM9A 4LBIA 4CLYA 4J9PA 1EETB 1X4GA 1Y3JA 1MU2A 4O3OA 1SCJB 3H2UB 3P45B 1JK9B 3G6YA 3W5YA 2EFOA 2KL8A 3HFZB 3KLIB 1RT5A 4KV8A 4EUVA 4CDIA 2W2PP 5KFEA 2R2UA 3QT7A 4NZ6A 3ZNUA 2JOQA 3MM7A 3HT3A 3VAKA 3MUVP 1FJCA 4OZ2A 2MQPA 3MFIA 1HBNA 1VYAA 2R8GA 1UWAA 1G1XA 3DYAB 3BDEA 2OIHA 1BUXA 3R5BA 4QBUA 3PX0A 1JXVA 4Y2MA 3UNGC 4F8RA 2GAHC 2HWTA 1S59A 3RAMA 3PIPQ 3DDIA 4ATNA 1VQ6S 5LJ5Y 2VONA 2NCKL 3FMBA 3GONA 2VOOA 4LFBF 2VBWA 3AA9A 4EI2A 4J90A 2IJRA 5EUHA 3R3TA 1H7XA 1X4CA 3PW7A 1R0AB 5A8WB 1GT8A 2ZD1A 4J9VA 5GAHU 3WIUA 3E2EA 1WKLA 1UETA 4W4MA 4C8MA 2ZH5A 2E5GA 4ER8A 4KFBA 1QTMA 3PKMA 1QTNB 2J8SA 3W64A 2CJYB 4QWCA 3DGPB 3CSKA 4EYHB 1KP6A 1PBAA 1PKUA 1PAUB 3MHYA 5KOXA 3R5DA 4KTQA 4I68A 1HBMB 4IRCA 1AUSL 3JTPA 4DV0J 3W5XA 2FTRA 3CJKB 1TVRB 4AE5A 4JYAJ 3K5PA 2GHPA 3NGRA 1HNWJ 2VDIA 1QVFR 4DFMA 1L3KA 2WVDA 3GV8B 1OSDA 2E5LJ 3VF0B 1FJEB 2AZ3A 2ASDA 1DRZA 3FEYB 1RAOA 5J2QB 4OZ3A 5DZ7A 1WOPA 2UP1A 1S9GA 3M4XA 2Y0BB 1TR0A 2GQ2A 2LQ9A 5KG0A 4CO2A 2EWHA 2R7WA 1U6FA 1ZYQA 2DJWA 1D9DA 3HI9A 4C0HA 2DITA 1F5BA 4F0KA 1LWCB 3BB5A 3VHQA 3I5CA 4DHVA 5F3ZA 5IT4A 4BWMA 3RBEA 2CADA 4PABA 5AT1B 4AL7A 2HG4A 3HZEA 3QT5A 1IR0A 2CJBA 2FD2A 2OMOA 4I7FB 4OHWA 5HSPA 2ZHBA 5B0BA 1LXJA 5KG3A 3TR5A 5C42A 1MWYA 2ZNZA 3CCQS 1F0XA 1QAXA 4NA3A 2BEFA 1K9MT 2XYPB 1EP4A 2NLWA 4PXEA 2HBRB 4RWWA 1N4LA 1YJRA 3D2WA 1SBRA 2DNYA 4DUTA 7FD1A 2DR8A 4NLQA 3P96A 3IA0A 2HQCA 4OZNA 4E0DA 2ZJQQ 4F0HA 3MDFA 4U7UD 2DGVA 1JXEA 1O8BA 1FESA 1RJJA 1S1WB 3KXDA 4OYOA 4RNHA 1KHVA 4DN0A 5KG7A 2ADCA 2UUAJ 2QEXS 2CVIA 4AFFA 1I94F 4FF1A 4HDGA 3KLGB 3G6ES 5H9FK 1YZ7A 3PM9A 1B3TA 3W2WA 3GIIA 3QGGA 3A8JA 2FZKB 1KFDA 3D0IE 3ICLA 4GRSA 4UQGA 1MROA 2ZEJA 1QVGR 3Q8UA 1HNZF 3PEJA 1J27A 2ZUGA 1AB8A 2KI2A 1RQ0A 5L39A 3MM8B 2JLGA 5A76A 3T1YF 3CB4A 2Z2MA 3DXSX 3EDRB 2OKQA 1H73A 1SV5A 1VRTB 4CTAA 5KG4A 4CT8A 2CYYA 3N9UC 4JUZA 3FBCA 4DV2F 1Q16B 4KGVB 1KKHA 3VWSA 1XN9A 1ZPVA 3BKTA 3CJTA 3MR3A 3CF5Q 3CC4S 1S1VB 1RT1B 5I42B 1FX2A 4X4TA 1NK9A 1O0PA 4DL2A 3NS7B 2JWNA 1F60B 2HHVA 1XEZA 4NLYA 2D41A 2D3ZA 4FZVA 1YLXA 1OYEA 4JB8B 1WELA 1NNDA 3MMAA 4RW9A 1HYSA 4OI3A 1U6ZA 3BGLA 2OELA 4ECRA 3EGVA 1DY3A 1AYEA 3KDNA 4RBTA 1KEKA 2RT3A 4JI8J 1JNZB 1KQGB 3ETMA 4MIBA 3IG1B 2A6MA 4NLXA 1RTJA 2OJ3A 2JEIA 3M8WA 2XY6A 2R3VA 4MFBA 4Y65A 2MKIA 4KHPJ 2EK1A 2YNIA 3VZIA 4BS2A 2ZJPQ 5H9EJ 2HVDA 1DHMA 3HHLD 2DNNA 3NRBA 2I5JB 4KKOB 2H5JB 2V2KA 1P1TA 1VCTA 1VLOA 2YKOA 5E3QA 5M2UA 3HHLA 5FD1A 2B9XA 5ETLA 1RB0A 4RJVA 2XGPA 1HR0F 3WC2A 3CO0P 4JI6F 4XAKA 2FHOB 2G0IA 4HT5A 5GMKa 3DLLQ 3MD1A 4BDPA 3MZIA 4I2PB 1F5AA 6AT1B 3SCKE 4OYWA 3M8QA 2G9OA 2G2ZA 5FJ4A 1VLYA 2ZC3A 3FQLA 1REGX 2DO4A 4A8QA 2BRLA 1T03B 1LQ9A 2XZDB 3H98A 2DISA 2DNRA 7FDRA 4KBIA 4XTTA 2Y1IA 2RJZA 4WFYA 2FB0A 5B0AA 1Q86T 5B08A 3RW6A 2UXCJ 1BWVA 1YJUA 2HNDA 4FXWA 1ULRA 2A10A 3T9ZA 3HD1A 5DDOC 3EX7B 1ZTTA 2K7JA 1GX5A 5AE3A 2CJKA 5BYQA 1NEEA 4NRUA 1BWEA 1RT7A 2COLA 4MIWA 2RHSB 5H1SV 2ZH3A 3VAHA 4UOCA 1B64A 4AD6A 4AQYF 5HANA 3MEEA 4HDHA 4IRDA 5KFSA 2Z57B 4H4KA 2HIQA 1AZSA 2JFDA 5AXLA 1J5OB 1KOOA 3MEDB 2LXIA 5JMNA 1FJGJ 4DV6J 5LOQA 2R4FA 5GAGU 1F6TA 2YKPA 5DQGA 4OX9F 5EX3A 1TMMA 2BKOA 4CIOA 4LSZB 1D8YA 4OHYA 2DHXA 1VFJA 3JXOA 2CIMA 4LF5J 2CJ9A 2CQ4A 5D78A 3TAQA 2MMYA 2XEXA 1OY9A 3FEXB 4K2JA 3RW7A 3T6JA 3QSYB 1FD8A 1U1PA 4K4XA 1SJFA 3CC7S 1TKXB 4Q0BB 3O5TB 4ZPDA 4PWDA 2OI2A 3R9LA 3TANA 2R7RA 2QV6A 4B3SF 3KUEA 3QLHB 3TZXA 2ZH6A 2FLPA 2KDOA 1N54B 3FFIB 3IWXA 1UEKA 1NPRA 2ASYA 4DV3J 1FNOA 1G4CA 2W24A 4LF9J 3ZZRA 2NS1B 2NXCA 2OEKA 3D0HE 1PBUA 4MKYA 4OFZA 3BZQA 3JS9A 4JP8A 1RDRA 1YX2A 1K1QA 1NXIA 1FFSB 2I1RA 2LQ5A 3B4MA 4WIQA 1R3NA 2J7UA 3VQSA 1O6XA 2ZJRQ 2V2QA 2W9CA 2BE2B 3UPFA 3FVYA 4RU2A 1DFDA 2ZVSA 5A6PA 3IRWP 3NS5A 5K9FA 4E2FB 2I38A 3EVWA 3KOAA 3AD7C 4NCGB 5T14A 4DR6J 3JTNA 4LIRA 2V8PA 1RACB 4MK9A 3C14B 3W63A 3H90A 1VQYA 3G86A 2MPUA 4C6AA 4CO5A 2KM8C 3G71S 2BQ3A 1W25A 4PXDA 3ITHA 5DG9A 4WFNQ 3QRPA 3K5NA 3ET6B 3ELHA 1LWEB 2YH1A 4ZJOA 2AMCB 1U0SA 5KFOA 2A18A 3T5LA 2Y1LB 3TW0A 5KFTA 1B99A 3Q22A 2VPZB 4NCAA 1C1CA 4IFVA 2YQ3A 4Y34A 1N56A 2MTLA 2VL1A 2H4WB 1U8SA 4ID5B 3QWPA 4WYWA 5I3UB 3I96A 1KSPA 3G4SS 1ZS6A 4AYBD 3D1HA 1E6YA 3W65A 9RUBA 2DBBA 1NDPA 3CD5A 4O3SA 2YX4A 2WONB 4ZJQA 2F3JA 2VG6B 3VAGA 1EKSA 1MROB 3CCWA 5KFJA 5F8GA 3EJMA 3THPA 1U2CA 4OHVA 1RLCL 4YB1P 2H48B 1TU0B 3CO9A 2M4MA 3V5RA 4CWBA 2EKNA 1DTQB 2Q66A 3MEEB 4USUA 3SBMA 1HA1A 2LQ8A 2K7KA 3PVXA 1JLFA 3PEHA 4N47A 1APSA 1ZAXA 4LQ9A 3KJFB 3DGVA 1WDTA 2OPSA 2DHSA 2DY9A 3CC2S 1FKPB 1VBXA 4DWIA 3K8VA 1RSCA 1TL3B 1RKIA 2W1BA 2AJ4A 2R42A 2YVSA 4OYBA 1MU2B 4DV1J 4U6PA 3QMQA 3BH6B 2O5DA 3QSIA 1S1XB 2MQMA 3OBIA 2CQIA 2QTWA 4KFBB 2HVEA 1A9NB 2LDYA 2M7SA 1J5EF 2KT5A 3EWGA 2GZOA 4C11B 4W92B 1S77D 3O1LA 4WKYA 4NA1A 3G9CA 1HQ2A 2G0CA 3AFGA 3BGOP 3CDBA 3CCUS 4A48A 1JKHB 4OX8A 1C0TB 4A8OA 4N8OA 1JLAB 3LQVA 4DDFA 1GMUA 4X4PA 2XQCA 1URNA 1ACMB 2CVEA 3E8OA 2ZOMA 4G65A 1K1SA 3QGHA 3CXCR 1ZM2A 3H5SA 1LOUA 5HK4A 4ECQA 4NA2A 3HHLC 3NAHA 4LFCJ 2HVIA 2EXUA 1CJVA 1U1LA 1UTAA 4I6YA 4A8XA 2V94A 3DMJB 1TMJA 4EK2A 4RUCA 3Q8QB 2BE7D 2DNQA 1L3UA 4JV1A 2HMIB 3NGDA 2CXEA 2J6TA 2AKWB 3EZ5A 4KR0B 3ZZ0A 1TP7A 1WUUA 4QWAA 2HEKA 1NSAA 1UJ6A 4ZMMA 2VQFF 2WK4A 4O4GB 1S5ZA 4CO0A 4Y0FA 2B8QA 4NEYA 5E33A 2JJ4D 3UI3A 1S1TA 1RABB 5BR8J 2AF6A 3HKZD 1HWUA 2Y1RI 3HSGA 4ES3A 2MKYA 1ZZNA 3T3FA 4J9RA 2VU5A 1HPZB 4ITSA 3GFXA 1WJ9A 4PQUB 4TYAA 3VAMA 4F4KA 2VD3A 1FEHA 1K47A 1CC8A 1BMQB 1ZM4A 4P71A 1X0FA 2YX1A 5D0RA 4HEA9 3D67A 5EWFA 1CBKA 2W7AA 4BWJA 3GSDA 3C66A 3UCUP 3CCRS 1EQMA 3PRBA 1CQNA 1QLNA 2G1DA 1RAGB 4C8ZA 2EBEA 3GIRA 4YQWA 3MMJA 3JSMA 3W1YC 2M88A 1FE0A 3CNQP 5BR8F 3K8WA 3QRQA 5F8JA 3TJ9A 2MHNA 4ZVUB 2CPXA 2DGQA 3CD0A 1JLBA 5DO2A 1RHJB 3QFWA 3ZTOA 4KC5A 1N5SA 1Z1ZA 3DLKB 4HI1A 5J2NA 4LT6A 4DV3F 4ERDA 2YWEA 4P2XA 3J81j 4K4VA 1L3TA 2RB7A 3GWCA 3RU0A 1UMJA 3MEGB 5EX0A 2RSQA 2JEFA 3EGZA 1VHFA 2DYAA 2DIUA 2IFXA 2AHOB 2CQGA 2ZE2B 1PYSB 1JLCA 1YBTA 2M9KA 4M5LA 1WEXA 4RUBA 4F4WA 3RB0A 2BXJA 3AXKA 3I87A 4P9SA 4ZVRB 3C15A 1EIYB 3HJFA 3KHHA 1S1VA 1X5SA 5I42A 5HP1B 3Q2SC 5T7LA 2DH8A 1FNXH 4JI4J 2C2KB 1X4FA 5M2RA 1RKJA 2C2OB 4BCAA 4MKBA 1RGVA 3H7HB 3LP2A 1KDNA 2EG1A 3CD7A 4HHJA 5HVFA 4PEOA 4AUKA 5CYQA 9ATCB 5LSOA 3C6UA 3I5BA 1JLAA 1X9SA 1LV5A 2BUNA 1SH2A 2QYGA 4L3NA 3SXLA 3UD3P 1O5JA 1U8WA 2H5IB 4FF2A 4G1PA 1PCAA 2O01C 5F8HA 2JLEA 2XSJB 2CPDA 5JUMA 2OTLS 2K3IA 4IRKA 3QJJA 2LVWA 2BZ2A 3AAWB 4C0BA 5K8OA 5J2QA 3RRGA 2G0JA 2V5HG 2QLJB 4U7CA 1HYSB 2R7UA 2VG7A 5LT5A 4P75A 1KQKA 1AW0A 1XERA 3WZ0A 3PZPA 2XS5A 4ZVOB 1H2UX 3GILA 2BVZA 1NK7A 1TL7A 1YVFA 1KONA 2GCFA 5HVHA 2R2RA 1YJWS 1IN0A 2IYIA 4CLWA 3GQCA 1S0OA 5J1EB 3KJQB 2GO8A 2IYGA 3SZ2A 3SSSA 4F2SA 4X4VA 2GHVC 1NZ8A 2CPJA 5J2PA 4B3MF 4E8UA 5HBMA 4QR1A 1NLKL 4QZVB 2HQDA 4JI5J 3HHLB 2ZM6F 3JQMA 2A2CA 3ISNC 5HQLA 2D3OR 4YB5A 4ZLJA 1RTDA 2DGSA 4NLTA 4JI0J 3BBBA 3F44A 1UVLA 1SH0A 2FVCA 4ES1A 3T6BA 1RA7A 2ZD1B 4RNFA 1CEZA 3HDSA 2WSCC 2OEJA 5KFQA 5IS2A 2E1AA 3M30A 5BYRA 2MYFA 3LW5C 2A3JA 2YY3A 5HMWA 2DGUA 4QPXA 4ED6A 1I94J 2ZE2A 3I5AA 1RK8A 1YBUA 2CJXB 2KXFA 1TAQA 3JSRA 4X65J 4X2BA 5IV4A 2VV5A 3OVSA 2RRAA 1RP5A 3EZOA 4NI2B 2D3UA 1VR6A 3DKDA 3HHKA 2Q6BA 3PJWA 4HTJA 2AJ1A 4Y28C 1FK9B 3VVTA 3AY0A 4CNZA 1JMTA 3LANA 2CNKB 1BLUA 3KKFA 1Y4ZB 2I0XA 3PFEA 2B8PA 2K1RB 1E6VB 4C3MA 2UVRA 3MXHP 3ZTPA 3N79A 1FXLA 4M5DB 1F9FA 4JI2J 3D1OA 2AX0A 2X1FA 3M2UB 2J9DE 1T7PA 3QFHA 1IWGA 3PACA 1B7YB 4G1IA 1M5PC 4CO1A 1XMQJ 3F56A 1H72C 4YOEA 1P6TA 1JJ2R 2Y3YA 4M5GA 5ETPA 4CT9A 2WW4A 3QQCD 5KFVA 3JSBA 2OO4A 1ELOA 3R6GB 4TY8A 1VS3A 2EFGA 4WFZA 2NXJA 3MECB 2L9DA 3WDOA 4RUAA 3T5KA 2IMWP 5SUHA 1U1NA 3AOCA 2MQLA 4CLLA 4NMLA 3LP2B 3A8IA 1FDBA 2KRRA 3QYYA 4IH7A 3ULHA 1YJ9S 4TQRA 3OHBA 2W7OA 2FJXA 3GJTB 4HTIA 5ETMA 3BGRA 3TARA 4LSLB 1VC6A 5EN1A 1GXUA 2PEBA 3D6MB 4UUWA 2FY8A 2N82B 2HFOA 3OTDA 4PZVA 2Q1LA 1CULB 4CO3A 2FHMA 4MMOA 5LMUF 1C4CA 2Z0GA 2AEJA 4ZN1A 4ZITA 4N5SA 4A8YA 3TO8A 5D6GA 1FXDA 1CG2A 3KDOA 2HKEA 1HQEA 4LR9A 4FYDA 2MJUA 4UTGA 2C1EB 3D68A 2I5JA 3DYAA 1FJGF 1FI4A 4NE9C 1X5OA 4PG4A 2AQ4A 4ED5A 1FRIA 4OJ1A 3MCSA 2UU9J 2ZVIA 1S97A 2CFXA 3HSDA 3KHRA 1YHQS 3LP0B 1IWAA 3VGVA 2FQQB 1OJ4A 4DSFA 1J5OA 4M94A 2ZZNA 1FRXA 2PMZD 4URQU 4DFPA 1SIWB 4FYWB 3M8QB 4I56A 1TKZA 3SSRA 1X4BA 2E5HA 3ADAC 3DN9A 2QLXA 2QE5A 2R2SA 5CCLA 2LU2A 4OX6A 4DR7J 4IQXA 1VISA 3NMAA 4EU0A 1HNXJ 1S57A 4O44A 3EXCX 1R8PA 1Q8LA 2ZWPA 3GYNA 1VJWA 2A2DA 3RB4A 3LOUA 1NCLA 2RDIA 4H4KC 4N8NA 1LWEA 4DL6A 1C1BB 3CDUA 3DLGB 1ZETA 1IBKF 1X4AA 4YUDA 3MMBA 1FWLA 1FDNA 2QA1A 1RAFB 2W01A 4E98A 5E3RA 3AHPA 1N34J 4JI5F 2V6AA 5HQMA 4TU7A 2RRNA 4NLDA 3RRHA 1Q0NA 3TVKA 4ZHRA 1XC9A 3MPVA 4IOAQ 2HS0A 4I2QA 4LVOP 4J9UE 4F04B 3H8YA 4IDKB 3W8GA 4CO4A 1PJ6A 1UKUA 2LA4A 3OQ2A 5A0YA 1N6QB 4NX9A 1HNWF 3MMCA 4IH6A 5F8IA 1RZMA 3MGJA 4RPFA 1VQLS 1KWMA 2CQ1A 2FY1A 1AT1B 1BD6A 2VPYB 2BM0A 4ZPBA 2AU0A 4NLGA 2XLKA 3B82A 3UDLA 2GC8A 1DTQA 3V2UC 1WORA 3W2WB 3VAIA 1U1MA 4KPYA 1N0UA 3QGPA 2X3GA 2V4RA 3SQGA 4USHA 3HMJG 4K7QA 5DGBA 1U2RA 4F3MA 1S4EA 2QX0A 1IBCB 5E3CA 5KFLA 4DX5A 4I7FA 4JI8F 3KWMA 1X5TA 3OR1B 3M2RA 4C48A 5K20B 3BPSP 3S01A 2HQIA 3IFEA 3NLCA 2XY7A 1T8EA 4F2RA 1KQFB 2W4PA 4GKKJ 1JX4A 3TZZA 3K5OA 2FHJA 4DXLA 1Y9OA 1Y10A 3IBFB 4KRWA 4F67A 3NCQA 1QUVA 2CQHA 4C4WA 1T9XA 1HNVB 2MKHA 1NHUA 3DDNA 3H2LA 3MCNA 4P74A 4CH7A 3BQ0A 1Q82T 4FNHA 1FJ7A 4QJVA 4JBCA 1KLMB 2HQGA 4K4YA 1DTTB 1TQLA 2CPYA 2IA6A 3M8SA 4DV2J 3EZUA 4RW4B 3X1LB 1VK3A 1CJTA 3OD2A 2O3DA 4B17A 3DLEB 1M1HA 2JNJA 5ETKA 3NCRA 3HZGA 1WG1A 3NKYA 4UT4A 1XMOF 2CPEA 4UUXA 5DDPC 2KFZA 4LREA 1Q8BA 2DXFA 2JH3A 4M5JA 1RU1A 2ZZTA 4ZKAA 2IRUA 2XCAA 4YHHJ 4B3SJ 1LK7A 3T9NA 2W9CB 1NK8A 2N3LA 4C3KA 2OUGA 1YWXA 5DM6Q 3MR2A 5KFMA 2RMLA 1SC6A 4NYZA 5DS7A 2WRMA 3TX8A 3TX0A 5A8KA 2VFTA 3KK3A 4G3IA 5IT9Y 1KVJA 2FJDB 2HW3A 1IBLF 1D09B 4IG0A 3EVMA 2IC3A 2HZCA 1I51B 4KE5A 4QIEA 3FRYA 3IAS9 3CJ4A 4ZVSB 2BX6A 5LJ3Y 1IBMJ 4NLSA 1S6PB 3G8TA 2XZWA 1RT1A 3UQSA 3SSQA 3MM5B 5A0YB 4O44B 3WBZA 1NUEA 2ZHOA 2R7TA 3T41A 4WFBQ 3THVA 1TZ0A 5E3AA 2NUUG 2FHKA 4UF4A 5HLFB 1RUSA 5CA5A 1C2PA 1AXQA 2LYVA 3SDEA 3W7BA 4PXCA 3TJ8A 1TTHB 3OV7A 1M5OC 3MAAA 4M5DA 5GAEU 3BO4A 3NBPB 4X62J 2LEPA 2R9LA 4BHQA 3AJ2A 1SH3A 4WYLA 2KXNB 2WB4A 4ED2A 3TVZA 1IXKA 2NQPA 4KGKA 1Z4UA 1UZHA 2YNIB 3QPIA 1N5VA 3M8PB 3MMCB 4G6VB 4RWXA 4ZLPA 2RHQB 4DF4A 1SKSA 5ETNA 3W8PA 4R5PB 3RR7A 3CULA 2DH9A 3VVUA 2ERRA 5A8RB 2JC1A 1FE4A 5L8RC 3EGWB 4NL5A 1G7CB 2V8DA 3ZFVA 5IC6B 4CLPA 1CPZA 4LF4J 3LTOA 1NJWA 2E5LF 4ILLA 1RTHB 1WI6A 1YSJA 2L9WA 3J7AN 4RBVA 2XCPA 4A8MP 2J0SD 4DLEA 5E2QA 4K4UA 4F3QA 2RS8A 1WHYA 3GMGA 3TAMB 2DR6A 2WCXA 4Z7CA 2YQ0A 3AD9C 4NLWA 4W98A 5L1LA 3VAJA 1R8HA 4FF3A 4DPOA 2MXYA 3B4DA 3C46A 2AEMA 2XMVA 2Z4PA 3NXZA 5EHHA 5IQ6A 3KLVA 2FYXA 4WK1A 3HO1A 3Q2TC 1SVDA 1LFPA 3IWNC 4BC7A 3CCSS 2QT7A 3CJ2A 2VF3A 4C0OC 5F8LA 2WTFA 1PC5A 3M1VB 4M95A 1K44A 5KFZA 2P6SA 3PR5B 1VBZA 2KVQE 1WDDA 2IPOB 5AJ3F 2KFNA 3JB9k 4U9RA 2PE8A 2R7XA 1F1BB 4YP3A 1N36J 3BGUA 4L74A 1I3OB 2ZWOA 5LSLA 2E7VA 3MEDA 1RYRA 2MZTA 4RNOA 3KHGA 4M5MA 1NMEB 4B9VA 4JV2A 3AOAA 2ILZA 3ILOA 3GV7B 3CCZA 2WW8A 1VRQC 4IQMA 3HD2A 3DLKA 4LRBA 3FC9A 2AGPA 2DRAA 3RGIA 1KQSR 2FVQA 4B3MJ 2AD9A 2YKNA 1LWFB 1F3VA 2MKSA 2D74B 2HLUA 2Z2ZA 1NRKA 1CS4A 2J76E 1U24A 4WFXA 1Q1KA 4NXMF 5HP1A 1M5KC 4X4NA 3ISZA 4NLVA 1DARA 2H65B 1DLOA 2GW8A 3R5GA 1HBUA 4KSEB 3MR5A 4DPYA 5J2MA 2NXEA 5HLFA 2IM1A 3KFWX 4IH5A 3OL9A 3H2VE 1RBLA 2QIFA 3E01A 4LF7F 3PW2A 1X7VA 3C6TB 4NASA 4C8OA 1KVIA 2Q3PA 4IYQA 2E7XA 3N6NA 4DEZA 2AJFE 3Q0AA 3D6HB 1IKYB 2OPRB 4P72A 5J2NB 5F9LA 2DCUB 1GH8A 2MKCA 4X64F 1F3FA 1RU2A 4UY8T 4CLSA 4ANCA 4DCJB 2UUCF 4NMXA 4RZRA 3DOMA 3I31A 4NI2A 4OYIA 1KS2A 4XK8C 4OV6A 3TZWA 1MN9A 1IQTA 2NSBA 3OR2A 3SFUA 4Z37A 4R25A 2MSTA 2GMLA 5MLCV 2NYHA 4JI0F 3KLFB 1OS5A 2DKOB 4ZPCA 3LWMA 1P9YA 1T9UA 1NKEA 1S6QA 2WAQD 1HWKA 1JNRB 4C97A 2AP6A 5E3PA 2BJ7A 3CPWR 4M5NA 4WP8A 1X9MA 1WSRA 2VG7B 1HARA 2WVFA 2DY1A 2WVCA 3EVOA 2KM8B 1SL0A 4OIXA 2HS4A 2W9BB 1NJYA 2G1HA 3MAAB 1S1TB 3C16A 2JFKA 2H4YB 4QQBA 3UN3A 2OH2A 3E3XA 2FC9A 3DM2A 5L1JA 2EC0A 4OZ5A 5C2CA 4LRDA 1MSWD 2MEWA 3CDWA 4C8KA 1SI9A 3CCVS 3QJLA 1L3SA 2W4CA 2LFVA 2VASA 3FEZA 1LWXA 3S1TA 4IUFA 3G87A 2AJ0A 2RIJA 1JXLA 2ROEA 4AXIA 1BGXT 4FNIA 3LGMA 2CDQA 1A0OB 3PY8A 3UVJB 2MGZB 3VAFA 1WOOA 5HATA 1HI1A 1OQ3A 4YY3J 2C2DA 1U1QA 3OL8A 4LSNA 2K1RA 3MOZA 4ANEA 1G2EA 1FEEA 2CRLA 4B02A 2GX8A 2C42A 1JLFB 5IM0A 4A8SA 1N5YB 2MZSA 5B0DA 2PN6A 1NJXA 2BMBA 1IR2A 1AFIA 5D4OA 3LALA 1UWBA 2LXFA 1IKWA 1PC4A 4R0EA 4TY9A 3T1AA 5J1EA 1NDCA 4XDDA 1T9TA 1RAHB 2DNZA 3ILJA 1U45A 2VFUA 2ACMA 2RE1A 2V2VA 4FPRA 2Q79A 4H4MA 2YKMB 3JQKA 5K8NA 1N33F 2WONA 4CM2A 1FO1A 1KVKA 2VPXB 5HL7Q 1N8RT 2ADBA 4FXDA 4HACA 4PR6A 5HVGA 1IBKJ 2LECA 2UXCF 2HHUA 1SL2A 1YJNS 2BABA 1HNVA 2VIHA 2LLZA 4J9SA 4DFKA 3KLFA 4N76A 1SXLA 5U47A 4DR7F 5ETRA 5CYJA 2W25A 2M70A 3ZTSA 4DQRA 5CYQB 2GVZA 2YNFB 2ZOGA 3EMTA 3GFYA 4C8YA 3TEHB 4USKA 2BQUA 1YRTA 4DX6A 4ZCMA 2CJAA 4F36A 7AT1B 2DGXA 4C2MA 3OHAA 2PI5A 2J0QD 3C19A 4RW6A 5D77A 2UU9F 2GMHA 1DQ9A 2EK6A 3P5TL 4IOBA 3SQGB 2CG8A 2CWXA 3Q8VA 2QMUB 4DG1B 1ZA1B 3A3OB 2N4DA 3OR2B 3PX4A 3P8BB 1EJ7L 1HI8A 3GB0A 4OI4A 5HN0A 2LXUA 2YPYA 4J7CA 4AL5A 2QRRA 2CA9A 2KT3A 1CSJA 3BKFA 3NMRA 4B9UA 4YR2A 4X4UA 1TL7B 1Q53A 1C0UA 3TUPA 4C9DA 2N4CA 5J2MB 2QZ8A 1W7WA 3J7YI 3MTJA 3PW5A 5F9NA 1R8BA 1IM4A 2ZH7A 1HPZA 2XWYA 2X51A 1OYDA 3JSYA 1CQMA 3V6DA 5LM7E 3D3BJ 4URGA 4NXMJ 2M5YA 4OHZA 4WTOB 4GC6A 5AXNA 1AA1B 2OPPA 3AXMA 3MM8A 4GVLA 2PFFB 2Y9HA 5EWGA 3KMQA 2RKIB 1RWXB 3M32A 3UFCX 2M0GB 4YEAA 1XMBA 4LRCA 2U1AA 1FKOA 2J0XA 1NPKA 1WF1A 3HT0A 1I6JA 4K8RA 1HQUA 2IC3B 4JI2F 2IBOA 1YDLA 1WACA 4JI3J 1XNRJ 4X4SA 1HMVA 1WTBA 2PA8D 4F4ZA 1HNZJ 4IR1A 4XO0A 4ILMA 3HVTA 3GIMA 2XWXA 1ITPA 3OFHA 2MDAA 1S9EB 1JLCB 5K8PA 4X64J 1MMLA 2KKHA 3IP0A 3PX6A 2PMWA 4Z2XA 2JRSA 1WC4A 5BXIA 3BKUA 4DSIA 3DRSB 4M1KA 2KRBA 4ZVPB 2H5EA 5CZVA 5L9XA 3ZZZA 4OYXA 3JAMY 4P7TA 1RT3A 3R1LA 1RCXB 2ZZMA 2ALYB 4OV1A 1EHWA 4HH1A 4L3KA 4D3GA 1KLNA 3DM2B 2B5JB 3MPYA 3S7RA 2FLLA 2HNZA 4DR5F 4PXBA 5HO4A 1RHUB 1EQ0A 4DPWA 2RF2B 3Q24A 3UNYA 1DQ8A 2MY8A 1U1RA 2P8IA 2YNHA 3M2VB 4IKAA 5KFFA 2AIRB 4ZS6A 3TEGA 2HURA 4DI6A 1SIZA 1X31C 2HNYA 2OPQB 3P5BP 2B3TB 3W9HA 4KAIA 3J7Z5 2LP4A 4DPXA 3I32A 3AB4B 1AFJA 3EPIA 2QA4S 5A6WA 2VG5B 5ADZA 2HRYA 2GVDB 4P7VA 3DRRB 5KFUA 5B0EA 3R7NB 4YR3A 5CYMB 2KHCA 4EEYA 3ZZOA 1OWXA 4RX6A 1SC3B 5T41A 3LP1B 4O3PA 3BJYA 2UVVA 2I8EA 2V67A 2H54B 1R8AA 2IM3A 4J9KA 4IFYB 2DR7A 1ZH5A 3FSYA 1TUWA 3HKWA 3JTOA 3W2VA 2NUHA 2QO3A 1REVA 5LL6d 3JAMU 2AYEA 1HQEB 2KZZA 1KD1T 1RWVB 5THWA 2UXDJ 1RAIB 3HULA 2BRKA 1Q4RA 1VI7A 3CEDA 4X62F 1ZAWA 2XYHB 3KLHA 1K0TA 4QU6A 4Q2MA 2BOAA 4WBFA 1RT4B 4ZDNA 4KV8B 4OLOA 4DV0F 1WG5A 3U7JA 4ELVA 2DGWA 2DNPA 4ED4A 2Y8YA 3M6WA 2VFVA 2ZBIA 1S12A 2CWKA 3AH6A 3DOKA 5KFNA 5KG2A 4UZBA 4LF8J 3U1NA 3VR1A 3I9ZA 2JX2A 4NYOA 1S6PA 2VKZG 3TWZA 4RNNA 3A4TA 5HQ8A 2D1CA 3TQEA 3FSIA 1GFWB 1VQ9S 1UW9A 2DPJA 4HHUA 4C7QA 2GQQA 1YJTA 2W4DA 2NZCA 5IT0A 4IG0B 4CCHA 1U6BA 4DL5A 1RBOB 3I82A 4DUZF 1YBAA 1SB6A 2YX7A 2GQCA 4B9NA 1WC0A 1WHVA 3V4IA 3FJ2A 4MYUA 2EFNA 2Z2LA 4LF4F 1S6OA 1U7LA 1NB2A 3LAKA 2VFRA 3L9ZA 1L5UA 4PAAA 1S0NA 3OSPA 4QR2A 1RHMB 5D0HA 3DOMB 2V8GA 2V69A 4OZJA 1F9EB 2IY5B 1G3OA 2CPIA 1R6VA 4EMDA 2B4OA 3KK3B 3PFOA 3PRDA 3V81A 5C7PA 1PGZA 4EZ9A 4NRTA 1HFEL 3CW2C 5HI7A 2KHDA 1TK8A 2GGPA 2MKKA 1B0VA 3VGUA 4ILRA 1VQOS 5FDLA 2IM0A 2GVZB 4IO1A 4ZP8A 2L08A 3DGPA 2BR0A 5EDWA 1RWPB 3HFVA 4LSLA 4KHPF 4G1QB 4OMFG 1HNIA 3T1HF 3GYGA 1GTEA 4ELUA 1N5QA 5C42B 2E1RA 4DV4F 3MR7A 4MK7A 5IXUA 1C1BA 3DLGA 3KLEB 2Z56B 3N0VA 3O6QA 3IR7B 3X3UA 3OJSA 2GA7A 1D1UA 2MHEA 2CDRB 2EVZA 1RAAB 1W2BR 1M90T 4PUOB 4L73A 1HBOB 4K0KJ 2NZ4A 4FF4A 4DCPB 4MIAA 5D15A 4EWTA 3D9BA 4CLZA 2YWFA 1UPMB 2MZQA 3T1HJ 1Y00A 3VTIA 4RUHA 2ACYA 3G2XA 4OQJA 5KT3A 4X66J 1RHRB 1NO8A 1KC8T 2QGFB 2DRBA 4B3RF 2MZJA 2YXLA 3GPAA 5M2PA 2YWGA 2CQ2A 5DJBA 4OJHA 3DRSA 3POTA 3OXLA 3SIPB 2V9KA 4NZ0A 2W2MP 1WEZA 2XM3A 3BR9A 4GVBA 1T3NA 1B4SA 2E9RX 2G2YA 3ETOA 1UA1A 2MQNA 1WSVA 4PWDB 2PGCA 1TL4A 3DU6A 4DU8A 3OXGA 3IRXA 2GS8A 2D9PA 1T9VA 2EEYA 2K8GA 2JLFA 4JV5F 4ZIWA 2VJVA 3SI8A 1A6LA 3K17A 4DN9A 4PG5A 4DX8H 3RBZA 4DSLA 3CDAA 1FD2A 2UVWA 2HQFA 1VQ7S 1NZAA 4CLFA 2KTQA 1DQAA 1VBKA 1WF0A 3BEGB 5HMYA 1EAYC 3D7SB 2E5IA 4Y3CA 5G4DA 1YZ6A 2OP5A 4DPTA 5AJ3J 1Y5NB 4DPUA 2D3O1 2BJ9A 3C3LA 3P49B 2KO1A 1BE4A 3OVBA 2HRUA 3OJUA 2HPUA 3UCGA 4U8YA 2ASJA 4CYUA 2KB2A 3DDKA 2VDHA 3KHLA 1FF2A 2L9NA 3GFHA 5KFDA 4F25A 2KT2A 1S1XA 2DO0A 4R0JA 1ZZFA 2V50A 2EKYA 2JHEA 1WNEA 3PG9A 1NSKL 1QUPA 2BQRA 3Q8PB 1NJIT 2FHJD 4YFUA 1TKZB 3DRYA 1RTJB 2RH3A 2UV8G 3FUYA 1SV5B 1VRTA 3FCHA 3N01A 4H4MB 1SUQB 2UUBJ 3H5XA 2CQ3A 5CXTA 3R6LB 3G96A 1RYSA 4TKTA 4EZ6A 1KOHA 2B4PA 3UE2A 2IDEA 3I0RA 5D0EA 3J80U 2HBZB 3H4DA 1QAJA 1WC1A 1VK8A 2BM1A 3PR4A 4ECSA 5GVQA 3MMBB 1NH7A 3A13A 2XMMA 2BJ1A 3CJ0A 3MR6A 1M0SA 2C2EA 1T9YA 2VBXA 4MFBB 3E51A 2MQQA 1OPZA 4LRAA 1ROFA 3FFIA 3QWUA 4NPOA 3RJMB 5DDQC 2HFNA 2GVDA 1HHSA 3MOJB 2AYBA 2Q43A 2M2BA 1N5TA 1G6BA 2XMJA 4LF6J 4IDKA 3BYRA 2LQJA 1Q7YT 3FCVA 2OSQA 2B0GA 4LBHA 1VQKS 3PW0A 4PUOA 2EI5A 3VQTA 1U4BA 3BSNA 3NBPA 2DCLA 3NS6A 1X5PA 2C2MB 2F65A 3HF5A 2V68A 3GU0A 1WC5A 3P4UB 5GMDA 3I0SA 2MLYA 2QJ3A 5KFGA 5F8NA 1N32F 1T03A 2V9WA 4RW7A 1TUVA 3HPOA 2FLOA 3C14A 3HHDA 3JQJA 3RAQA 1WOSA 2ZFHA 1FKAF 1R6YA 2POKA 4ECWA 4FBTA 5CHCB 5F8MA 2AV5A 4JI3F 1WHXA 1M5SA 1Q8KA 4OYAA 2XGQA 1N6QA 2XS2A 4OX7A 5A8RA 5AE1A 1UFLA 4HH0A 2EFPA 1UWBB 1S9EA 3KLIA 3MM6B 4KPCA 2AZ1A 3J7ZT 3EPGA 2AGQA 2OLWA 3G8QA 1YRXA 3MM9B 5IM0B 5LMUJ 3OTEA 1AROP 2H51B 2BJ3A 4BC9A 4V19X 2X1GA 1RTIA 8RUCA 1M5HA 1XR6A 2DT9A 3LWLA 2HAFA 3KLEA 1UVIA 4OL8A 1VQ5S 5BYSA 5KOWA 3CJKA 3QNWB 4IG3B 3MUTP 5A8WA 3H25A 2JZ5A 2I9SA 1NHKL 2QYCA 4NLUA 2XY5A 2OPPB 1JQGA 2ZBPA 1SKRA 2QSWA 1NKCA 2R7VA 3D3CJ 4LF5F 4ZIVA 1FERA 2HNYB 3IGNA 2F4VJ 3BQ1A 2GIFA 4DSEA 2MLXA 2F4FA 2OGUA 4CM0A 4UOHA 2F9DA 1P27B 2JVRA 2B56A 2DNLA 3P3DA 3NGKA 1MLAA 4PWUA 3C15B 2WVBA 3N5FA 4WU2A 3ITHB 4HL9A 4MYTA 1VQPS 1YRUA 4X66F 4DSKA 4UZCA 2VFSA 2E9ZA 3C8YA 4ECZA 3DLBA 1XIQA 3MPWA 1FWPA 1ZPWX 4GVBB 3W62A 1R0AA 5HAOA 1NSPA 2DH7A 4USTA 5F0UA 1L3VA 3FBEA 3UD4P 4K4ZA 2IJFA 4WP3A 1U26A 2EW9A 2JC0A 2CQBA 2ZH4A 2BOPA 3BO2A 1PIEA 4DV4J 1BQXA 3KJNB 2Z30B 1JJHA 3M30B 2F7VA 3PDNA 5B0GA 5KFXA 2L41A 4F4XA 2LU1A 2HGLA 1UEVA 2PC6A 4B08A 2OTJS 2CQ0A 3IXQA 5KT6A 3OTCA 2F63A 1TL1B 1HWLA 3BGFA 4ZCLA 3RRKA 4N56A 3OSNA 4WK3A 2QFIA 1H2VZ 1TVRA 1HWJA 3FRZA 4Y2IA 5K5MA 3M1VA 3OW2R 4M8LA 3M8ZA 4Q5VA 2HZVA 2HNZB 3MI7X 1P9QC 3R7SB 2ZM6J 1UVNA 2QSFA 2RQKA 3E01B 2Z2YB 1MWQA 1YJ7A 4DL7A 1FRHA 2YWHA 1DBDA 4EGLA 3C16B 4RL1A 1YIJS 3NNAA 1Y0HA 2W8KA 1JJCB 1LXNA 2C2ZB 4C98A 3BR8A 1RHKB 2JEGA 4PG7A 2R8IA 5I4MA 3W61A 1YI2S 2KZMA 4B3RJ 4TN2A 3GV5B 3PCOB 3UDVA 3UN2A 5KTQA 1VQ8S 4USMA 2XNRA 3SCIE 3NGTA 3PO5A 2VZ9A 5RUBA 1X0PA 4DQSA 2XTJP 1FX4A 4FYXB 1VIOA 4ED1A 3MECA 1OY8A 5D4LA 2YKNB 3K7RA 3W66A 3D54A 4OI2A 4O23A 4QYZJ 1BQNA 1CLFA 2XYGB 4ZPWR 4DLGA 4FS1A 1JLGA 1FA0A 2BV3A 1CJKB 1PILA 2CQCA 2DEIA 2C3MA 3KUGA 1IKVB 2IVFB 2F5GA 5LSRA 4GKJJ 3TQ1A 3QZ8A 1FRMA 2ZBQA 3H42A 4C8LA 2VG6A 3AD8C 1DURA 4J9QA 2CPFA 1VRUA 2QL9B 1YG0A 4O0NA 3NEKA 1X9WA 4YDXA 3JSMB 4OZLA 3FBBA 4GMKA 2AYMA 1FT8A 2KJWA 4U67Q 5D4NA 4R8UA 2RKIA 1JLQB 2UXDF 4F0MA 5GMEA 1LK5A 3O44A 2UUWA 1PSDA 4O4GA 4F4YA 1ZOTA 4A8WA 5KG5A 1EARA 3T1YJ 4KQZA 1YQHA 1UFKA 4RBUA 1DLOB 2BBEA 4MTPA 2DHAA 3LAMA 3F0NA 3KLHB 2RU3A 1UP1A 2E44A 2BJEA 2PD1A 5L1KA 1XNQJ 1CJVB 3S6EA 2G4BA 3V81B 3DHWC 5A2QU 3ONQA 5DQIA 3FMWA 3ZZYA 4L6V3 4ZP7A 2E5JA 3VCDA 3OTOF 3DOKB 4ENOA 1CVJA 1RE1B 4WU3A 1OO0B 3QATA 1H3DA 1SKUB 3TA0A 3WQPA 1XMQF 3IS9B 5L9NA 4K4SA 1IKXB 2HVZA 1PJ5A 3IGVA 2CPHA 2VG5A 1R0CB 4KGXB 4AT1B 4K59A 3L95X 2GMJA 5C24A 3G6XA 3KNGA 3MTKA 1T05A 2XNQA 5DLGA 2O1PA 4B9SA 4LF8F 3PJ9A 1Z2ZA 1Y11A 2OPQA 2VC0A 1N32J 1VIXA 2ALZA 1TFYA 2J9CA 2CKWA 1RHQB 1BHNA 1M1KT 4K2XA 1XQIA 1GEHA 1IUJA 3BS9A 2R8HA 4KO0A 4I4BA 2XMAA 3KK2A 2J8AA 2HHHJ 4GO7X 3VGTA 3CJ3A 1RT5B 4DOZA 2OMLA 1V6HA 4OJGA 1VQMS 5A2QY 1B0PA 2W9BA 1T95A 4J9MA 4UY85 2YPZA 4MT1A 1B70B 1D3WA 4KKOA 4USVA 3V4MA 4WCEQ 5C25A 2B4VA 1ZTWA 2AYGA 4LFAF 3OR1A 2PIIA 3AA8A 4NLRA 4ALZA 1HHQA 4F3OA 2ATCB 1W26A 4LSNB 1OIAA 4WPAA 4LIWA 3MURP 2NPFA 5D3GB 4ZVHA 3IRXB 1WD6A 1FHTA 4M5HA 3M9MB 4I64A 5DETA 1JLGB 3GR1A 1NKBA 5E0OA 5BJRA 4LQ3A 4NXNJ 2RNEA 1U09A 3MCMA 2JL9A 2DEJA 5JJBA 1KN6A 4ZVGA 3BH7B 4KIAA 1A7GE 3NCPA 5KFHA 5AE2A 2NPIA 4YMEA 4F26A 4PPZA 3IN5A 1F2HA 3OFEA 4HVZA 4DL0C 2PEHA 2ZH2A 2J5AA 3I9V9 4DBQA 3DCAA 5E41A 5H9EK 4PG6A 2DPIA 4ANDA 2R8JA 1FK9A 3NGUA 3R5CA 4X4RA 5KT5A 2QMWA 3LGNA 5HROA 1TKXA 4YDDB 1D8ZA 3NWGA 5J1PA 3PHTA 3QO9A 3VZHA 2C3UA 3B54A 4EO8A 2CAJA 4ETXA 3PW4A 3RAXA 3QT6A 4KYZA 2DNKA 3N6MA 2MLZA 5HBMB 3K5MA 3R2CJ 3W5ZA 1OMSA 4ZPTR 3A3NB 2H3EB 2OHDA 3DXBA 3IWLA 4LUBA 1WHWA 1H98A 3EXYA 4TLRA 3RG6A 3K57A 2NR0A 3HK2A 3CCJS 2ZH1A 5ETVA 3HX9A 3EDQB 2VQFJ 4ZP6A 1RT6B 2GNKA 5IQQA 3FBFA 2BKPA 2DHHA 4LF1A 4C8NA 1SJ3P 3GCWP 3MM6A 4DR1F 2BE2A 4QU7A 1D9AA 1XK8A 1IKXA 4Q2LA 4JI7J 4IFYA 4ZCIA 2Y8WA 4ECUA 5KFAA 3RYLA 3GG0A 3V6KA 3TJAA 1IKWB 2FJVA 3J7YU 4OI1A 2XO7A 1BQMB 2YNGB 1UZDA 3CCES 2FJWA 5D4PA 3D0GE 3FNNA 1S79A 2XMTA 4DMZA 3QIDA 3MUMP 5D3GA 2QFJA 2GAGC 5KFCA 2KG0A 2QL5B 3OT9A 3Q8YA 1I1GA 2GIRA 5CD4H 3HP6A 3GZ7A 3TNVA 1HQUB 3B78A 2FZCB 1RTDB 1J2VA 1UJ5A 1T3OA 1Y3KA 3BSAA 4I6AA 4LVNP 2EPIA 2CZ9A 1AZSB 3KG1A 3NGSA 3SMZA 4DR6F 3HCXA 3WIVA 3BSOA 4B3OA 3GIJA 4TXSA 1YKWA 2X1BA 5KFPA 2HMIA 1R0BG 4N41A 2WVEA 2M8HA 3R2DJ 1YK9A 5KFYA 2U2FA 3VV2B 4WZQA 4QYRA 1HD1A 4IOCQ 4DL3A 1U02A 3QAEA 4PG8A 2L48A 3M2UA 2KN4A 3OTOJ 3QZ7A 4NWBA 1XTZA 2XI2A 2RD5C 4Q8EA 2I6WA 1NDLA 5K14A 2J7KA 3SEOA 2C2NA 3TUIC 2E1MC 3GYXB 3T5HA 2J7WA 4USIA 2OEMA 1MW7A 2HRTA 2FZGB 3M8PA 2BE9B 3R8YA 4YHHF 3KJVB 4Q8FA 2OSRA 4XDCA 4DR1J 2XSJA 1JKHA 1UPPA 1WF2A 5CQGA 3RZAA 4CH0S 3PIOQ 1FKOB 4EFAC 3MFHA 2DVIA 3D4JA 3DU5A 2OFHX 3SV3A 4MKAA 1CULA 3QIPA 4L75A 3Q23A 4JI6J 3ISND 3HVWA 1IJEB 2AWZA 4ZN3A 2I2YA 3M6XA 2BA9A 1FRLA 3PNIA 8AT1B 3G82B 4CZCA 1WKKA 3PXGa 5K8MA 3KK1A 3KMSA 1HD0A 2HGNA 3ZNJ1 3PHEA 3BN7A 4P73A 1WG4A 1FRJA 4NEZA 2VHGA 3WC0A 4LMZA 5J2PB 1GAOA 3QBCA 1TAUA 1TL5A 4EBDA 4V19J 3H20A 1NHVA 2ROPA 3CMQA 1NH8A 4QOTA 1YTYA 3RR8A 4RW8B 1OSCA 3F73A 3Q8SB 5ETSA 4A46A 2BJDA 3IBCB 2J9EA 3TI0A 3IR6B 2RUSA 1XWLA 2E29A 2A1BA 2IM2A 1U47A 1M1GA 1S4FA 3POTB 4NLPA 1TK0A 1QE1A 3O8WA 1FFWB 2IAJB 2HQ3A 3K2YA 2XHCA 3DRPA 1FFGB 4WTYA 2N7CA 2R2TA 1U1KA 1S76D 5KAKA 1VBYA 4NXNF 1WC6A 3GE9A 1VOMA 5FLXU 4ID5A 4J9OA 5I3UA 4K4WA 3AJDA 4HT7A 2Q6CA 4PYDA 2B4UA 3ENWA 1H7WA 3OXFA 1N88A 5CABA 3V6HA 1FTCA 2DB1A 3HHEA 3M9OB 4LR8A 1LW0B 1N52B 1C0TA 2APOA 3LH2S 4I6WA 3I0SB 2VOPA 1JLQA 3NNHA 2HHPA 3A8KA 5ETTA 3D5MA 5KG1A 4B9TA 3GLJA 4LFAJ 1VDHA 1HW8A 3US5A 3J80Y 1FCAA 1HIYA 2HNDB 4DR2F 1UCNA 4WWSA 4GC7A 1C4AA 1GQEA 5GADI 3AB2B 4FDFA 2XMUA 4TQSA 5ETQA 1N36F 3CDEA 5HMZA 5GADU 3CT9A 1FRKA 2LCWA 2GJ2A 5KFIA 4W90B 4IG3A 1HNXF 4M63A 3RTVA 1TL3A 4DUYJ 4DQPA 4UOFA 3LF0A 3J81U 1NJZA 3OLBA 2KH9A 3FDSA 3CGIA 4K5RA 4Y6IA 3L3CA 4DR3F 1SJRA 2N3OA 2BW2A 3MCOA 4QIVA 5AXKA 1VMBA 3CCLS 4LF7J 3DLEA 5K14B 1N5YA 1KFSA 1S1UB 1VC0A 2DR9A 4RO0A 3EICA 4J9LA 2C3PA 1RAEB 1XNRF 1JLBB 4PYAA 2FGCA 1SQEA 3BN4A 3ZXWA 4B9MA 2R8KA 1SKWA 2K2PA 2ZH9A 4AL6A 2V4JB 3H59A 4KHRA 5GAEI 5CAAA 4PPDA 3TZYA 2FJAB 3MPDA 3P6YC 4U8VA 4X4QA 2ROGA 3DLJA 4DV7F 2HFZA 3U27A 3TYTA 1TK5A 4BBYA 1QSYA 2DD8S 2DNOA 3R5JB 3PTWA 2IBKA 3ZO7A 2HHTA 3K5LA 2YWWA 1IJFB 2UZAA 4CYUB 2NXUA 1RBAA 3KG0A 4ZPVR 3W9IA 2VICA 4KH0B 2QMXA 3WX4A 3CTRA 3HM9A 3U1LA 4CLKA 5T7LB 4ICLA 4WJBA 1RAJA 1S6UA 4FPIA 5KG6A 4DZDA 4OHXA 4U95A 1HWIA 5A8KB 2MZ1A 3DI6A 4QIFA 3CMAS 4M5KA 5FDLB 2MSSA 2RRBA 3THTA 1Q81T 1S0VA 3UWTA 1P1LA 4DV7J 4DS5A 4QCLA 2PFDA 1BQNB 3SV4A 2IRYA 1GMWD 1FXRA 2F8EX 2MJNA 2R7OA 2ZKUA 4ID8A 3CWJA 2K06A 3OTBA 4Q7AA 4S0MA 4D3HA 5IWAJ 3H5YA 2UUBF 4DQIA 4JI1J 1NDKA 2P5VA 4I1TA 2AX1A 3RBDA 5CCMA 3N28A 3N5BA 1MG7A 5DLFA 1TKDA 3CJ8A 4EO6A 1SJ4P 2B9YA 3D28A 2UVUA 2HSEB 2ZKTA 3QLHA 1QM9A 4R5PA 4X4OA 2HWIA 2J9DA 2UUTA 1NK4A 3TOQA 2CZ4A 3B6BA 1VHIA 5E5NA 5F41A 3IBWA 5IZHA 4K50A 1Q78A 4AXJA 1GX6A 2CUYA 3H5UA 4LBPA 3L4BC 4DS4A 1XNQF 2PO4A 4LF6F 3AT1B 2PMHA 4FVMA 4NLOA 2CNOB 3CJRA 1UFWA 1XR5A 3DRXA 3T19A 3KK2B 2OD6A 2VJUA 1RWOB 4Q0BA 2RAQA 2BANB 1NB7A 4JV5J 2PDAA 3D6TB 3SDEB 1WI8A 1O51A 1R8CA 1W2IA 1N33J 4HI2A 1X4HA 2RS2A 2IVMA 3FZBA 1PO6A 3NP5A 1KRPA 3LPEA 2RQ4A 2ILYA 5LXRA 5FLXY 1VJQA 4KY3A 4A8KA 1TELA 1HR0J 1Y7PA 3D6FB 2NREA 1JIHA 2OPSB 3CJQA 2WZ1A 3EE3A 4U96A 1NK0A 2DR5A 2WSFC 1TFWA 1CJKA 2QLFB 1JLEA 2AJ2A 2ZDPA 1S9GB 1S1UA 4HR2A 1MN7A 3IO1A 3AJ1A 1S48A 2HK2A 3NOGA 1U49A 1RTIB 1WC3A 2DNMA 4DR3J 2BYCA 4YB6A 1IQZA 5IOLA 1ZAVA 3I0RB 5C5JA 3HSJA 5C25B 2YBVA 1V5IB 4ZVEA 4WZMA 3OPKA 1H38A 1SUQA 4P2SA 1IBLJ 2HS3A 4CI0B 3HVAA 2LKZA 2AGOA 4B9LA 3CCMS 2R7QA 1ZA2B 1HI0P 2YKQA 2O67A 3NWRA 2BACA 4TVAB 4H4OA 4J5OA 4IR9A 4DL4A 2HGMA 3TAMA 2A0FB 1VQSA 1LKZA 3TA2A 4OI6A 2AW0A 3C2PA 1N0VC 3I4HX 4TY8B 2ZDOA 2YTCA 4ECTA 2J6SA 5KFRA 4XIUA 1CJUB 2M3DA 3H0PA 2VBYA 3MWBA 2W2OP 2ATLA 4M5IA 3CCTA 2BW7A 5B0CA 2LA6A 3BF4A 1I5OB 3FKBA 4N7TA 2UV8A 2E1CA 2XI3A 2QC3A 3ZTQA 4CH1A 1V5VA 3UDEA 4O3NA 3J7A1 3BREA 3OFGA 3NG8A 3MAQA 1HW9A 3MEKA 3UW1A 4N77A 3CUNA 3OUYB 2IDLA 4OZ1A 2HK3A 4TLQA 4YB7A 3NAIA 4DJBA 2CJQA 4USWA 2HWHA 1LW2A 2C2RA 1KTQA 3W3SA 2MQOA 4QWDA 1M5VC 3C6TA 2P2CB 4P10A 4I2QB 4ZJLA 3M05A 1X60A 1LWCA 2GJIA 2XLIA 1D0EA 4ECYA 3LO3A 2HLTA 1Q8IA 3MAHA 3QRRA 4Y2AA 1S7IA 2RDJA 4CTAB 2WOMA 2P6TA 4DF8A 3FZ2A 3PRVA 3PYGA 4F7VA 2Y0SD 5DG7A 3VALA 5DM7Q 2BANA 4KGZB 3OVAA 3DFEA 3JYTB 2RF2A 2ASLA 1T02A 2LDIA 2YKMA 2VBZA 2XSFA 5DRKA 4QPTA 4URSA 3D1QA 1UAWA 3F41A 4UQTA 1BQMA 2HBQB 2YNGA 2X3DA 1FDAA 1OY6A 1MNEA 2G2OA 4I0WA 1NSQA 5L1IA 2R7SA 1K0VA 3MEGA 3GJRB 2F9JA 4K5SA 4O3RA 2CZVC 1H2TZ 2DXEA 2KYZA 2KU7A 1IM6A 3MM5A 1IKVA 1NK6A 2HFVA 2ZOFA 1VQ4S 1TV6B 2HAIA 3QT8A 3IG1A 5G0RB 3KNAA 3FQKA 4KJIA 5I3PA 4JI7F 2B6AA 3DOLA 2X1AA 6FDRA 3R27A 3OFFA 2QA4G 2A6OA 2IMOA 2Z58B 1FDDA 2W2NP 2EFQA 3TRGA 1B0TA 4RR5A 1Q79A 3FK4A 3KLGA 4XPCA 2UUAF 2HFSA 2OAUA 4CNYA 1X8DA 4CRJA 4RW4A 3SCJE 3HFKA 2G13A 3CIZA 1IKYA 2OPRA 5F3TA 3QGIA 5EGYA 2F8HA 3PO4A 3GTYX 2F40A 1QSLA 2MQ8A 2W2QP 4G1QA 5IFMA 3PKYA 2C22A 1MWZA 2DHGA 1S7HA 3L7PA 4LJMA 4FP9A 3Q8RB 2HIYA 3R5AA 4ZHRB 2W7PA 2XLJA 2O66A 3A3PB 2B51A 4KO0B 5DZ6A 4A4JA 4JI1F 2BJ8A 4RKUC 1K73T 4ZPAA 1CJTB 4MAKA 5B09A 4HACB 1HBOA 2PSZA 1NPPA 2FJEB 3CE8A 3DRPB 2XHWA 3LP0A 1S10A 1J5EJ 4ZVQB 2HHQA 1VGYA 2V8VA 1GXLA 3GJQB 3IM9A 4QR0A 4WXWA 1ZM3A 1RT2B 3WX8A 1YJVA 2W8LA 1H74A 4Q43A 3AODA 2C3OA 3ZC4A 4QW9A 3HXMA 2YQ1A 2ZH8A 2CG4A 3BQ2A 3IM8A 3ZZPA 1HNIB 1RWNB 4UW2A 3RB3A 1GMWA 1LW0A 3I55S 2XULA 5LMNJ 2QLBB 3MM7B 4LFBJ 2IRXA 2P9GA 1XJWB 2B43A 2QN6B 3FGVA 3HSZA 3M2RB 4WP9A 4FBUA 3OL7A 2KG1A 4F02A 1B7FA 2ZUAA 3NOCA 2FVSA 1NU4A 1HBMA 3C6UB 1KHWA 4RW6B 2IAJA 5AXMA 3KK1B 2MB0B 1UEUA 3UVJA 2JSXA 2D9OA 1KNZA 3CJ5A 3ZZTA 2E66A 2OD4A 2YNFA 2GFFA 1EX8A 1HBNB 1DTTA 1U2FA 4QIWD 4DV5J 4H4OB 2V34A 3BSCA 5J1NA 4DCOB 3K0JA 3K89A 3RBXA 2E1PA 2VPWB 3PV8A 1C0UB 2WOMB 1S49A 2C3YA 4MH8A 3OL6A 3H4BA 2WBRA 3DC2A 4DR5J 1V9OA 5HROB 4I2PA 4EBCA 2CQPA 1EETA 2VA3A 3PYEA 2FPHX 5KFBA 3G6VA 2AJQA 3CJSA 4C3LA 1VRUB 1U0HB 4DG1A 1E6VA 4X65F 1LWFA 1RWWB 2F8MA 4DUYF 3EYZA 2GV1A 2PT0A 3GCXP 2DXDA 1GK8A 2KJVA 4WE1B 5C24B 2XO6A 2C28A 1TKTA 4HHHA 4RW8A 4YS2A 4J9NA 4ED7A 3TAPA 1RADB 4P6QA 1NBEB 2H9ZA 3AQPA 5IC4B 3S8SA 4FKYA 1RT7B 2V4JA 2X7IA 1XR7A 3J81Y 4P2MA 3UCZP 4DR4F 4PRFA 1SJQA 1KBRA 2DNGA 3VGSA 4DR2J 4Y00A 3N6LA 2P9CA 1NAQA 1KR4A 3IR5B 3A8EA 2YKAA 2N7YA 3DHXA 3TVYA 5C2GA 4TU9A 1LNQA 1RT2A 1JB0C 2BKNA 2WBMA 5E7OB 3UD5A 4CLUA 4Q44A 2HHXA 2DIVA 4MKVA 1UVJA 2RDDA 1EP4B 2RILA 3ZTRA 1T9WA 3BGRB 2LMIA 1JJ4A 3FCWA 2KYXA 4FKXA 4OYZA 2LQBA 1EZZB 1OPIA 1RWKB 3D66A 1GXTA 2DNHA 4KHMA 3EM1A 4HKQA 2HVHA 4LF2A 3IAM9 4OJ3A 3UN5A 3M6VA 3OLAA 4DUZJ 1UA0A 2FDNA 1QAYA 3SFGA 3H40A 1ICEB 2CNNB 1FNMA 1UW4A 2NXNA 5JXSA 1T0TV 1RT4A 3UDCA 4K0KF 1TUGB 1RLDA 1SPBP 1FVQA 1WEYA 2XMKA 5I3QA 1VQNS 3G8SA 5GAHI 2IVYA 4FS2A 1QE1B 1QY7A 2LEAA 3I6PA 4F4AA 2UXBJ 1S6QB 2RUGA 3M8YA 3L7OA 2B7CB 2B6AB 2XZTB 3DOLB 1V3ZA 3HVRA 4J37A 4QW8A 5CD4A 1R43A 4DV6F 1HMVB 4NOHA 2FVRA 3BDPA 1IVZA 1PYOB 4GKJF 1E6YB 2UXBF 1Q7LB 1MMNA 5HJXA 3SQOP 3ZZUA 2VUGA 5MAOA 1KTVA 1RA6A 2HFUA 2HBYB 2D69A 2MZRA 4LR7A 2GJFA 5HJYA 1RTZA 2EC2A 1S0MA 1EB0A 2MY7A 1R7IA 3L7UA 1LFWA 3NY0A 3PYDA 3R1HA 1UVKA 3UR0A 1U48A 3K59A 3QO9B 4A47A 1HL6A 1N34F 1REVB 2YH0A 3DI6B 4O3QA 5B7WA 2XC9A 2J0WA 2QA2A 3Q89A 1DJ0A 4NZ7A 5SZTA 2KFYA 1ZM9A 4MJKA 2CNLB 4QWEA 1S99A 1P8GA 4WIIA 2H1YA 2DRDA 3B8HA 3LP1A 2VQEJ 3QIPB 2M8DB 4ELTA 3BBCA 5DG8A 4TU8A 4DSJA 3I56S 4DFJA 4JV0A 4YR0A 5CZXA 3TUJC 2VA2A 2V8HA 1H6KX 4I69A 1RT3B 1HBUB 4EBEA 1F5CA 4L76A 3R97A 4Y2CA 4B3TF 3BPDA 2QG9B 2NSCA 2KXHA 1LEOA 2RQCA 2FUG9 4GKKF 2JEJA 2XMWA 4C11A 5D0GA 4I67A 3W2VB 2GHWA 4NCBA 1WWHA 2YNHB 4FYVB 5D8HB 2JDJA 3ILLA 1FTRA 1R89A 2ZC4A 4FXVA 4KGMA 3GP9A 5IWAF 2FLNA 2FJBB 3GIKA 5CH7B 4IO9Q 4YY3F 4ECXA 1F9HA 2FVPA 2ZNYA 3NL0A 4PWWA 4OI0A 4FVCA 3MF5A 3GG1A 3L09A 4RNMA 1H0HB 1EKRA 4FYYB 4QIGA 2M52A 4X84A 5CYMA 3TP2A 3U02A 3MMAB 4RW9B 2V4QA 2IHR1 2FC8A 4J91A 4OYMA 2Y1JA 3CVKA 2AT1B 2E9TA 3A12A 1PAEX 3ET6A 3IMQJ 4ECVA 1KLMA 2AEFA 3W60A 5KT7A 4A8FA 3K58A 4KT0C 1RT6A 3HJVA 2MGZA 2V2ZA 5LXYA 3FSXA 4DV5F 2V0NA 3HHNB 2EBGA 2HZAA 1YGYA 4PQAA 4Z7YA 5DQHA 2CQDA 2XG8A 4CP5A 4CLTA 1AUDA 4WKRA 5L38A 1SC1B 2F4VF 4B3OB 4ZA1A 1UL3A 2WSEC 2W9AA 4LFCF 4O0IA 3CD6S 2B5JA 1QDUB 3LGHA 4TYBA 1DAXA 1NM2A 1TL1A 4P2FA 4EYIB 2B9EA 3OUYA 1CS4B 3EUNA 1URRA 3GSIA 2WB1D 3GR0A 4DR4J 3KJVA 2BDPA 2XB2D 3M2VA 5LMNF 3PJXA 2RVJA 3LA0A 2OFGX 1SJ1A 2GGPB 2MKJA 3KUHA 3TA1A 3UO0A 3QJPA 5ETOA 1F2GA 1BC6A 4WFAQ 4K4TA 1TV6A 1S1WA 5G0RA 1Q5VA 2HHHF 3ENVA 3BO3A 3DLHA 3M6UA 3KG4A 1FKPA 2EG2A 4USJC 1HKAA 1SQFA 2GIQA 4OLPA 4DZ6A 2QLWA 2VC1A 3BV8A 5HMXA 4ZCKA 1OQ6A 3AQOA 1V3SA 4DV1F 4ES2A 4HYKA 1R31A 2SXLA 3M32B 4OZ0A 1YITS 1U1OA 4WF9Q 4XPEA 2HHSA 1PJ7A 3Q83A 2HYIB 4ZVFA 5IT9U 4P52A 1CC7A 4ZVTB 3AOBA 1IR1A 3MPUB 3JYTA 3LPYA 4ED8A 5JVHQ 4JI4F 2V63A 2XS7A 2VH7A 2FGOA 3WHIA 4KH1B 2B9WA 3IC1A 2NYIA 5KT2A 4DU7A 4OYPA 2PI4A 6FD1A 1VC5A 1BXNA 1XBWA 2DK2A 3BYPA 1C1CB 1GMVA 4IFVB 5ITHA 3CIMA 1BY9A 1UVMA 4QWBA 3KYLA 1RI7A 2RQMA 2VQEF 1DZ5A 3RUBL 1QJHA 2HHWA
chains in the Genus database with same CATH topology
4R8UB 1QAIA 4FF1A 3N4WA 3SCLE 4F50A 3V6DB 4RU9A 1RTHA 4FN5A 1NK5A 3DMJA 2D7SA 2K3KA 2RU9A 2ZBCA 3CMES 2XBPA 1V3RA 4PKDB 4U7UK 4ED3A 2B7BB 2VB6A 5KFWA 2P9EA 1ZBTA 2E7WA 4ZP9A 4TNOA 2F1FA 1U25A 4ZK7M 3I4PA 1RWUA 1Y5LB 1HHTP 1GTHA 3DRRA 1QSSA 1R27B 4ETZA 1S72S 3RB6A 2LEBA 2WHOA 2CPZA 4CQ1A 5H9FJ 5F0WA 1MMDA 2J6UA 4KB7A 3M9NB 4WXOA 4RLEA 5JVGQ 3U1MA 4NCGA 1FVSA 5DGAA 1X4DA 1T05B 3MD3A 1Y5IB 3DNCA 1JWWA 4NYPA 2JVOA 4Q45A 2Z8QA 4LF9F 1LW2B 2IJNA 3LUYA 5EWEA 3ENQA 1UJ4A 2KVIA 3BM7A 4O4RA 3UR3C 2YWKA 1TKTB 2DGOA 4MK8A 2GO9A 1GNKA 3EGNA 1D9FA 2ZHAA 2FIUA 2PA3A 3QAUA 3TUZC 3O3LA 1JLEB 3A1YG 5DDRC 2IA0A 1T94A 3HVTB 4JOUA 5GAGI 4ZOSA 1SL1A 2DTJA 3HLUA 4PCQA 3NNCA 1WTFA 3KTQA 3O2IA 2DGTA 3IS9A 3V4IB 4L72B 5KT4A 3M8RA 4GO5X 4DQQA 4RW7B 2ABYA 2ZITA 5KFKA 3SYZA 2VKRA 4ICLB 4JYAF 1N48A 4H54A 1X4EA 2L3MA 4WE1A 5B0FA 2EFVA 3GFZA 5FIIA 1Z2LA 3V6JA 1RISA 4ED0A 3T5JA 1S9FA 4HLBA 1K8AT 1IBMF 2VODA 4PQUA 4Y2KA 3MM9A 4J9PA 4DR3F 1EETB 1X4GA 1Y3JA 1MU2A 4O3OA 3H2UB 3PY8A 1JK9B 3G6YA 2EFOA 3KLIB 4KV8A 1RT5A 4EUVA 5KFEA 3CD6S 2R2UA 2JOQA 3MM7A 3HT3A 3VAKA 3MUVP 1FJCA 2MQPA 3MFIA 1HBNA 2R8GA 1G1XA 3DYAB 3BDEA 2OIHA 3R5BA 4QBUA 3PX0A 4Y2MA 3UNGC 2HWTA 3RAMA 3PIPQ 4ATNA 1VQ6S 5LJ5Y 2VONA 3FMBA 2VOOA 4LFBF 2VBWA 3AA9A 5EUHA 3R3TA 1H7XA 1X4CA 3PW7A 1R0AB 5A8WB 1GT8A 2ZD1A 5GAHU 3E2EA 1UETA 4C8MA 2ZH5A 2E5GA 1QTMA 4KFBA 3PKMA 4QWCA 3CSKA 4EYHB 3MHYA 5KOXA 3R5DA 4KTQA 4I68A 1HBMB 4IRCA 3JTPA 2FTRA 3CJKB 1TVRB 4AE5A 3K5PA 2GHPA 1QVFR 4DFMA 1L3KA 3GV8B 1OSDA 3VF0B 1FJEB 2ASDA 1DRZA 3FEYB 5J2QB 2UP1A 1S9GA 3M4XA 5KG0A 1TR0A 2GQ2A 2LQ9A 2R7WA 4CO2A 2EWHA 1U6FA 1ZYQA 2DJWA 1D9DA 3HI9A 4C0HA 2DITA 1F5BA 5IT4A 1LWCB 3BB5A 4DHVA 3I5CA 5F3ZA 1NJXA 4BWMA 3RBEA 4AL7A 2HG4A 3HZEA 1IR0A 2CJBA 2FD2A 2OMOA 4I7FB 4OHWA 2ZHBA 5B0BA 1LXJA 5KG3A 3TR5A 5C42A 1MWYA 2ZNZA 3CCQS 1F0XA 1QAXA 4NA3A 1K9MT 1EP4A 2NLWA 4PXEA 4RWWA 1N4LA 1YJRA 3D2WA 1SBRA 2DNYA 7FD1A 2DR8A 4NLQA 3P96A 3IA0A 4OZNA 4E0DA 2ZJQQ 3MDFA 2DGVA 1JXEA 1O8BA 1FESA 1RJJA 1S1WB 4DN0A 4RNHA 5KG7A 1KHVA 2ADCA 2QEXS 2CVIA 4AFFA 1I94F 4HDGA 3KLGB 3G6ES 3PM9A 3W2WA 3GIIA 3QGGA 3D0IE 3HHNB 1KFDA 3ICLA 4UQGA 1MROA 1QVGR 1HNZF 3PEJA 2ZUGA 2KI2A 1RQ0A 5L39A 3MM8B 2JLGA 3T1YF 3CB4A 2Z2MA 3DXSX 2OKQA 1SV5A 1VRTB 4CT8A 4CTAA 5KG4A 2CYYA 3N9UC 4JUZA 4DV2F 1Q16B 3VWSA 1XN9A 1ZPVA 3MR3A 3CF5Q 3CC4S 1S1VB 1RT1B 5I42B 4X4TA 1NK9A 1O0PA 4DL2A 2JWNA 1F60B 2HHVA 1XEZA 4NLYA 2D41A 2D3ZA 4FZVA 1WELA 1NNDA 3MMAA 4RW9A 1HYSA 4OI3A 1U6ZA 3BGLA 4ECRA 4RBTA 1KEKA 2RT3A 1JNZB 1KQGB 4MIBA 3IG1B 4NLXA 1RTJA 2OJ3A 2JEIA 2XY6A 4MFBA 4Y65A 2MKIA 2EK1A 2YNIA 3VZIA 4BS2A 2ZJPQ 5H9EJ 1DHMA 3HHLD 2DNNA 3NRBA 2I5JB 4KKOB 2V2KA 5E3QA 1P1TA 5M2UA 4B3SF 2YKOA 3CC2S 3HHLA 5FD1A 2B9XA 1HR0F 2XGPA 3WC2A 5GMKa 4JI6F 4XAKA 2FHOB 4HT5A 3DLLQ 4BDPA 3MD1A 3MZIA 4I2PB 1F5AA 3SCKE 3M8QA 2G9OA 5FJ4A 1VLYA 2ZC3A 3FQLA 2DO4A 4A8QA 2BRLA 1T03B 1LQ9A 3H98A 2DISA 2DNRA 7FDRA 4KBIA 2Y1IA 2RJZA 4WFYA 2FB0A 5B0AA 1Q86T 5B08A 3RW6A 2HNDA 1YJUA 4FXWA 1ULRA 2A10A 3T9ZA 5DDOC 3EX7B 1ZTTA 2K7JA 1GX5A 5AE3A 2CJKA 5BYQA 1NEEA 4NRUA 1BWEA 1RT7A 2COLA 4MIWA 5H1SV 2ZH3A 3VAHA 1B64A 4UOCA 4AQYF 3MEEA 4HDHA 4IRDA 5KFSA 4H4KA 2HIQA 5AXLA 2JFDA 1J5OB 1KOOA 3MEDB 2LXIA 2R4FA 5GAGU 2YKPA 5DQGA 4OX9F 5EX3A 4CIOA 1D8YA 4OHYA 2DHXA 1VFJA 2CIMA 2CJ9A 2CQ4A 5D78A 3TAQA 2XEXA 2MMYA 3FEXB 3RW7A 3T6JA 1U1PA 1FD8A 1SJFA 4K4XA 3CC7S 4Q0BB 1TKXB 3O5TB 4ZPDA 3TANA 2R7RA 2QV6A 3QLHB 2ZH6A 2FLPA 2KDOA 1N54B 3FFIB 3IWXA 2ASYA 1FNOA 2W24A 3ZZRA 2NS1B 4MKYA 3D0HE 4OFZA 3BZQA 4C3LA 1RDRA 2LQ5A 1K1QA 2I1RA 3B4MA 1R3NA 2J7UA 3VQSA 2ZJRQ 4RU2A 2W9CA 1DFDA 2BE2B 3UPFA 3FVYA 2ZVSA 5A6PA 3IRWP 3NS5A 5K9FA 3KOAA 2I38A 4NCGB 5T14A 3JTNA 4LIRA 4MK9A 3G71S 1VQYA 3G86A 2MPUA 2KM8C 4CO5A 2BQ3A 1W25A 4PXDA 3ITHA 5DG9A 4WFNQ 3K5NA 1LWEB 2YH1A 5KFOA 3T5LA 2A18A 3TW0A 5KFTA 3Q22A 2VPZB 4NCAA 1C1CA 4IFVA 2YQ3A 4Y34A 1N56A 2VL1A 4ID5B 1U8SA 5I3UB 3QWPA 4WYWA 3I96A 1KSPA 3G4SS 4AYBD 3D1HA 1E6YA 2DBBA 3CD5A 4O3SA 2YX4A 2WONB 2F3JA 2VG6B 3VAGA 1MROB 3CCWA 5KFJA 5F8GA 3THPA 4OHVA 4YB1P 3CO9A 3V5RA 2M4MA 1DTQB 2Q66A 3MEEB 1HA1A 2K7KA 3PVXA 1JLFA 3PEHA 4N47A 1APSA 1ZAXA 4LQ9A 1TFYA 2OPSA 1VBXA 2DHSA 1FKPB 4DWIA 3K8VA 1TL3B 1RKIA 2AJ4A 2YVSA 1MU2B 4U6PA 3QMQA 2O5DA 1S1XB 2MQMA 3OBIA 2CQIA 4KFBB 1A9NB 2LDYA 2M7SA 1J5EF 2KT5A 4C11B 4W92B 1S77D 3O1LA 4WKYA 4NA1A 3G9CA 2G0CA 3CCUS 3CDBA 4A48A 1JKHB 4OX8A 1C0TB 4A8OA 4N8OA 1JLAB 3LQVA 4DDFA 4X4PA 1URNA 2CVEA 3E8OA 2ZOMA 1K1SA 3QGHA 3CXCR 1ZM2A 3H5SA 1LOUA 4ECQA 4NA2A 3HHLC 3NAHA 2HVIA 1U1LA 4I6YA 4A8XA 2V94A 3DMJB 4RUCA 3Q8QB 2DNQA 1L3UA 4JV1A 2HMIB 3NGDA 2J6TA 3EZ5A 4KR0B 3ZZ0A 1TP7A 4QWAA 2VQFF 4ZMMA 1UJ6A 4EYIB 2WK4A 4O4GB 4CO0A 4Y0FA 5E33A 2JJ4D 3UI3A 1S1TA 2AF6A 3HKZD 1HWUA 2Y1RI 4ES3A 1ZZNA 3T3FA 4J9RA 1HPZB 4ITSA 3GFXA 4PQUB 4TYAA 3VAMA 4F4KA 2VD3A 1FEHA 1X0FA 1CC8A 1ZM4A 2YX1A 4HEA9 5EWFA 2W7AA 4BWJA 3GSDA 3C66A 3UCUP 3CCRS 3PRBA 1CQNA 1QLNA 2G1DA 4C8ZA 2EBEA 4YQWA 3MMJA 3JSMA 2M88A 1FE0A 5F8JA 5BR8F 3K8WA 2MHNA 2CPXA 3CD0A 2DGQA 1JLBA 5DO2A 4KC5A 1N5SA 1Z1ZA 3DLKB 4HI1A 5J2NA 4LT6A 4DV3F 4ERDA 2YWEA 4K4VA 1L3TA 2RB7A 3GWCA 3RU0A 1UMJA 3MEGB 5EX0A 2RSQA 2JEFA 3EGZA 1VHFA 2DIUA 2IFXA 2CQGA 2ZE2B 2M9KA 1JLCA 3RB0A 1WEXA 4F4WA 2BXJA 3I87A 3HJFA 3KHHA 1S1VA 1X5SA 5I42A 5HP1B 3Q2SC 5T7LA 2DH8A 1FNXH 4X2BA 1X4FA 5M2RA 1RKJA 4BCAA 4MKBA 1RGVA 3LP2A 3CD7A 2EG1A 4HHJA 4AUKA 5LSOA 5CYQA 3C6UA 3I5BA 1JLAA 1X9SA 1LV5A 2BUNA 1SH2A 4L3NA 3SXLA 3UD3P 1O5JA 4FF2A 4G1PA 2O01C 5F8HA 2JLEA 2XSJB 2CPDA 5JUMA 2OTLS 2K3IA 4IRKA 3QJJA 2LVWA 2BZ2A 3AAWB 4C0BA 5K8OA 5J2QA 3RRGA 2V5HG 4U7CA 1HYSB 2R7UA 2VG7A 5LT5A 1KQKA 1AW0A 1XERA 3WZ0A 3PZPA 2XS5A 1H2UX 3GILA 2BVZA 1NK7A 1YJWS 1YVFA 1KONA 2GCFA 2R2RA 1IN0A 2IYIA 3GQCA 1S0OA 5J1EB 2GO8A 2IYGA 3SZ2A 3SSSA 4F2SA 4X4VA 2GHVC 5J2PA 2CPJA 4B3MF 4E8UA 5HBMA 4QR1A 4QZVB 3HHLB 2ZM6F 2A2CA 3ISNC 2D3OR 4YB5A 1RTDA 2DGSA 4NLTA 3F44A 1UVLA 1SH0A 2FVCA 4ES1A 3T6BA 1RA7A 2ZD1B 4RNFA 1CEZA 3HDSA 2WSCC 5KFQA 5IS2A 2E1AA 3M30A 5BYRA 2MYFA 3LW5C 2A3JA 2YY3A 5HMWA 2DGUA 4QPXA 4ED6A 2ZE2A 3I5AA 1RK8A 2KXFA 1TAQA 3JSRA 2VV5A 3OVSA 2RRAA 1RP5A 2D3UA 3HHKA 2Q6BA 3PJWA 4HTJA 2AJ1A 4Y28C 1FK9B 3AY0A 4CNZA 1JMTA 3LANA 1BLUA 3KKFA 1Y4ZB 2I0XA 3PFEA 2K1RB 1E6VB 4C3MA 2UVRA 3MXHP 1FXLA 3N79A 4M5DB 1F9FA 2X1FA 3D1OA 2AX0A 3M2UB 2J9DE 1T7PA 1M5PC 3PACA 4G1IA 4YOEA 4CO1A 3F56A 1P6TA 1JJ2R 4CT9A 5KFVA 3JSBA 2OO4A 1ELOA 4TY8A 1VS3A 2EFGA 4WFZA 3WDOA 3MECB 2L9DA 4RUAA 3T5KA 2IMWP 5SUHA 1U1NA 2MQLA 4NMLA 3LP2B 1FDBA 2KRRA 3QYYA 4IH7A 3ULHA 1YJ9S 4TQRA 3OHBA 2W7OA 2FJXA 4HTIA 3BGRA 3TARA 4LSLB 1VC6A 5EN1A 1GXUA 2N82B 4UUWA 2HFOA 3OTDA 2Q1LA 4CO3A 2FHMA 4MMOA 5LMUF 1C4CA 2Z0GA 4N5SA 4A8YA 3TO8A 5D6GA 1FXDA 1CG2A 1HQEA 4FYDA 2MJUA 1FJGF 3DYAA 2I5JA 4ED5A 1X5OA 4PG4A 2AQ4A 1FRIA 4OJ1A 3MCSA 1S97A 2CFXA 3KHRA 1YHQS 3LP0B 2ZZNA 4DSFA 4M94A 1J5OA 1FRXA 2PMZD 4URQU 4DFPA 1SIWB 4I56A 3M8QB 3W2VA 1TKZA 3SSRA 1X4BA 2E5HA 3DN9A 2QLXA 2QE5A 2R2SA 5CCLA 2LU2A 4OX6A 4IQXA 3NMAA 4EU0A 4O44A 3EXCX 1R8PA 1Q8LA 3GYNA 1VJWA 2A2DA 3RB4A 3LOUA 2RDIA 4H4KC 4N8NA 1LWEA 4DL6A 1C1BB 3CDUA 3DLGB 1ZETA 1IBKF 1X4AA 4YUDA 3MMBA 1FDNA 2QA1A 4E98A 5E3RA 3AHPA 4JI5F 4TU7A 2RRNA 4NLDA 3RRHA 3TVKA 4ZHRA 1XC9A 4IOAQ 3MPVA 2HS0A 4I2QA 4LVOP 3H8YA 4IDKB 4CO4A 1N6QB 2LA4A 1UKUA 1HNWF 3OQ2A 5A0YA 4NX9A 3MMCA 4IH6A 5F8IA 1VQLS 3MGJA 2FY1A 2CQ1A 1BD6A 2VPYB 2BM0A 4ZPBA 2AU0A 4NLGA 2XLKA 3B82A 3UDLA 2GC8A 1DTQA 3V2UC 3VAIA 3W2WB 4KPYA 1U1MA 1N0UA 3QGPA 2X3GA 2V4RA 3SQGA 4USHA 3HMJG 5DGBA 1U2RA 4F3MA 5E3CA 5KFLA 4I7FA 4JI8F 3KWMA 1X5TA 3OR1B 3M2RA 3S01A 2HQIA 3IFEA 3NLCA 2XY7A 1T8EA 4F2RA 1KQFB 2W4PA 1JX4A