1G3OA

Crystal structure of v19e mutant of ferredoxin i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEECPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential
pubmed doi rcsb
molecule tags Electron transport
molecule keywords 7FE FERREDOXIN I
total genus 29
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g3oA00
2FD2A 1CLFA 1FTCA 1BLUA 1HFEL 4CI0B 3OR2A 1FDBA 1SIZA 3MM5A 1BQXA 1WTFA 3EXYA 3IR6B 2GMHA 1SIWB 4ID8A 1DAXA 1Y4ZB 1XERA 2VKRA 1C4AA 1FRKA 2WSCC 1Q16B 1D3WA 1PC5A 1FRHA 1AXQA 2FJDB 2GMJA 2PA8D 7FDRA 1GAOA 2VPYB 2XSJA 3PNIA 3MM5B 2C3YA 3LW5C 3OR2B 1Y5LB 1FD2A 3MM9B 3C8YA 1G6BA 1BD6A 2C3MA 2V4JB 2Z8QA 3MM8A 3MM7A 1FF2A 2FJEB 5BYQA 3MM6B 2C3OA 1GTHA 1FRJA 1PC4A 4RKUC 1KEKA 7FD1A 2FJAB 1A6LA 1FRIA 1G3OA 1VJWA 2WB1D 4KT0C 1BWEA 1DURA 3GYXB 1FDNA 3MMBA 4YDDB 3MMAB 2C3PA 1B0PA 4OMFG 6FD1A 2FGOA 2ZVSA 4Y28C 2V2KA 1H7XA 3MMCB 1KQGB 3IR7B 1F2GA 4XDDA 1KQFB 2WSFC 2C42A 4XK8C 1B0VA 1GTEA 1F5CA 4AYBD 3OR1A 2VPWB 2VPZB 1RGVA 1FEHA 1SJ1A 1FCAA 1FDAA 1Y5IB 1FDDA 5CHCB 1BC6A 3IR5B 2PDAA 2IVFB 1FERA 1JNZB 1B0TA 1Y5NB 4XDCA 5BYRA 3OR1B 4DHVA 1DFDA 1FXRA 1H7WA 3MM7B 3MMCA 3MM8B 1FRLA 3EGWB 1FRXA 3MMAA 1R27B 1H98A 3MM9A 3MMBB 3HKZD 6FDRA 1GT8A 2WAQD 4L6V3 1F5BA 5FD1A 1C4CA 5E7OB 2PMZD 2XSJB 1K0TA 4OV1A 5L8RC 2C3UA 1IQZA 1ROFA 2WSEC 1H0HB 1IR0A 5BYSA 3EUNA 3MM6A 1FRMA 1FXDA 2Y0SD 1JNRB 2FJBB 2UZAA 2O01C 2V4JA 1JB0C 2VPXB 5CH7B 2FDNA
chains in the Genus database with same CATH superfamily
2UUCJ 4OIXA 1OY6A 1KC8T 1A9NB 1H38A 5GMKa 3LP0A 1O8BA 2MSSA 4MFBA 1OMSA 4NCGB 4UOHA 3S7RA 5A8KA 1Q5VA 2VQEF 2XM3A 5HLFB 1RE1B 4K4SA 3MF5A 1TFYA 4HHUA 2B4VA 1U7LA 4PXDA 5B0CA 4DR5J 2M7SA 2QV6A 2HAFA 4DQRA 2W25A 1XC9A 1YIJS 3M8QA 2HQIA 1S9GB 2WONA 4GKJF 1KTVA 1RT4A 1AYEA 3I96A 3PY8A 5IS2A 3UNGC 1HNZJ 2R42A 2PE8A 2FGCA 3OLBA 5B09A 1HNIB 3DM2B 4PPZA 3JSMA 4N5SA 1Y7PA 4IR9A 3W2WB 5A8WA 2GQCA 4NRUA 2K7KA 5F8MA 1VRUA 1CC7A 1OO0B 2BRKA 4WP9A 1YQHA 2W8LA 3CCJS 2IBKA 2QJ3A 5E41A 2JVRA 3MEGA 3T5HA 2FYXA 2ZH1A 2UUAF 3SQOP 1VBXA 4PPDA 1C1CB 2MQNA 1YRXA 4RW4B 1GK8A 1EX8A 1YJVA 3DNCA 4FKXA 4PG4A 3SMZA 2DB1A 2HGLA 3M8RA 3MOJB 2YWKA 1MNEA 2DR8A 4LVOP 3G8TA 2F8EX 3FBBA 4I2PA 3H90A 4ICLB 5HROB 3I5CA 2UUTA 2CQ0A 5HP1A 1TV6B 1N34F 1FWKA 1U1PA 2OPPA 2P6TA 3ENWA 1RBOB 3GCXP 1S6QA 1Q8KA 1NDLA 1JLCA 1A6LA 1R8BA 2GX8A 2V63A 1D9DA 1U1KA 1F9HA 1OSDA 1PILA 3LTOA 4ECTA 2HQGA 1CJKB 3TUIC 4DN0A 5K14B 1MMDA 2P9GA 2VIHA 1DTQA 1B0PA 1WC6A 3BN7A 2W4DA 4M5IA 5J2QB 2ZVSA 1FFWB 3TVYA 5E2QA 3WX8A 3J80Y 2DVIA 1UFKA 1M0SA 4K5SA 3BYPA 2JEFA 2DEJA 4X62F 1IBLJ 1NSPA 2ACMA 1SH3A 2AEJA 3ISZA 2FVPA 1UJ5A 2HHHJ 4DPOA 4AFFA 4H4OA 2VPZB 2BJ7A 2CWXA 2XEXA 2ZUGA 4LT6A 2KM8C 2B51A 2Q66A 1RAHB 1DBDA 1BQMB 2CQ3A 2J7WA 5GMDA 5KFWA 5FJ4A 2B5JA 3KDOA 3WX4A 5A0YB 2ZH5A 3BQ2A 3TEGA 3HHLC 1X4FA 2XMTA 2HVEA 3CMES 3KUGA 2UUBJ 1UMJA 3AAWB 1JLEB 3EVMA 3SFUA 1S9EB 2QFIA 3CWJA 1P1LA 2XWXA 1XQIA 4ES3A 3SV3A 2J0QD 1PYTA 2AYEA 1K1SA 4N77A 1Y3KA 3NS5A 3CC2S 1SQFA 5KFTA 3B82A 1H3DA 2W8KA 1WF0A 5GADI 2N82B 4OHWA 1KFSA 3B4MA 1NLKL 3TJAA 1K73T 2MXYA 2EKYA 4QIEA 4TY8B 4NZ6A 3THPA 8RUCA 3EGZA 4GC6A 2X7IA 2QSWA 2EBGA 4OYPA 4FS1A 1WKLA 2EFNA 2AJQA 1QTNB 1WWHA 2HMIB 4USIA 4CZCA 4KHPF 2E66A 5LMUJ 5DG8A 3AJ2A 1XNRJ 2VA3A 3G86A 1IKWA 2RKIA 4DSFA 3M8PA 2UXBJ 2DHHA 3W1YC 2EG2A 2RD5C 3EWGA 1CEZA 1IBMJ 3DLGB 1VLYA 4K7QA 4AQYF 5KFFA 3RRHA 1HBNA 3VAGA 2KH9A 4M1KA 4QIWD 2EFPA 3Q8UA 2DCLA 2VPXB 2M52A 2XG8A 4TU8A 1R0AA 5KFIA 1K8AT 1W2BR 3CD7A 4C8OA 2P5VA 3D66A 4Y65A 3I87A 4OHZA 1IXKA 2QMXA 4H4KA 2CJKA 2RRNA 4NMLA 2EFVA 1WEZA 1TUVA 2R4FA 1AZSA 1UEKA 2M4MA 5KFEA 9ATCB 2OELA 2Y1RI 1CC8A 3W62A 2I38A 4PAAA 1HNZF 3EZUA 2K2PA 3H5UA 3VAKA 2V68A 3M6WA 3HJFA 3BR8A 3TAQA 4ZP7A 4ZCLA 2MKSA 4RJVA 2DD8S 1Y4ZB 1SC3B 3BBFA 3CDUA 4F36A 3L7UA 2V2QA 4DR3J 1UJ4A 2AV5A 2RRBA 2YQ1A 1YSJA 2VBZA 3EE3A 2COLA 4HACA 4KB7A 3D67A 5D6GA 2XGPA 2E1RA 2BM0A 2GIQA 3ENQA 4O4GA 1LW0B 1DHMA 2MY8A 4BBYA 4F50A 3OSPA 1YI2S 4MKYA 5KG3A 4OJ3A 4DPYA 4LF7F 4B08A 5C7PA 1H2UX 2IC3A 2NUHA 1JLBA 2ZUAA 1RHKB 2G1DA 3MM9B 2AGQA 1RK8A 3C19A 4USMA 4X65J 4HH0A 2F3JA 2HNZB 2ZKUA 1IKXB 2M88A 4I4BA 1RHRB 1LEOA 4Y34A 2CPFA 2CNNB 2JC1A 2RS8A 3D68A 1KTQA 3QT7A 5EDWA 1FF2A 4C8ZA 3KOAA 1UW9A 4K4TA 2VQFJ 4Q8FA 2CA9A 1YJRA 2BX6A 1Y0HA 3F41A 3V6DB 4CLYA 1X31C 4DV6F 4TYBA 3H98A 4K4WA 1HNVB 1Q8LA 1PIEA 2J76E 3LGHA 3X3UA 5CYMA 4WYLA 5E3PA 5A76A 3NY0A 3KYLA 4ED1A 1V3SA 3KHHA 4TLRA 3A8IA 4JI1J 2FPHX 2C3PA 3ZTSA 1R3NA 2YNFA 2VUGA 4M5DB 1S6OA 2OPSA 3LALA 2KVQE 4ZVQB 5HBMB 3UCUP 4B3SF 4UY85 1I3OB 2VBWA 4YDXA 2KG1A 4C48A 1HBOB 2EC2A 2XC9A 1VC6A 2KB2A 2XMVA 5AXKA 4O0IA 3LWMA 1YVFA 4ZLPA 5F3ZA 1N34J 1NSQA 4BHQA 1P8GA 1FDAA 4NA1A 3HMJG 2ROEA 3LF0A 1VK3A 2HLUA 3TAMA 2C1EB 2EBEA 2N4DA 2CNOB 2KYZA 3AH6A 2UP1A 5GAHU 5BYRA 2IRYA 1WACA 2YY3A 4C0BA 1RDRA 4O3OA 2GJ2A 3FZBA 4FDFA 3KJVB 4B3SJ 1X4BA 3BQ1A 2Y1JA 3LP2B 3C16A 1MWQA 2RQKA 4JI4J 4ZA1A 3IRWP 3D6FB 5J1PA 1VOMA 1F9FA 2G9OA 4I6AA 4TLQA 5DDRC 2ASLA 4CT9A 3CNQP 2M3DA 2YKQA 3IA0A 1N33J 1RHMB 3IO1A 3CCVS 3MZIA 2IAJB 4OZ5A 2N3LA 3MEGB 5AJ3F 2RRAA 3A3OB 2B4UA 1SKRA 3TUPA 4PWDB 4DSIA 2J0SD 3OVBA 4R5PB 5FD1A 1C4CA 2HZCA 4JI1F 1EARA 4WBFA 1PSDA 5GAGI 3AOBA 3JTNA 1QVFR 1NZAA 4X64J 3UR3C 4G6VB 2CQPA 3BPSP 2R2TA 2KZZA 1HBUA 4WU2A 1H2VZ 3IFEA 4ID5A 4RW7B 2W9BB 4DL2A 3NAIA 1KONA 2DGVA 5I3QA 3HVAA 5H9EJ 3HSDA 1FTCA 2VG6B 4RBVA 3T1HJ 2R8JA 3NGKA 3R5BA 4I2QB 2ASJA 1QSSA 1FDBA 4TQSA 5ETQA 1CG2A 3MUVP 3KDNA 2NS1B 1HL6A 5G0RB 2RT3A 4AL5A 2OMOA 4BWJA 3S01A 4LR9A 1QJHA 2H5JB 2O67A 4ID8A 4OJ1A 3KK3A 3EVOA 2XSFA 5F8HA 1N5SA 3R6LB 4N41A 4U8VA 3NNCA 2CZ4A 4P73A 3UFCX 3IWLA 3VZIA 4KGZB 2ZOMA 4V1Ak 3KNGA 3MXHP 3VZHA 2UXCJ 1V3ZA 3QWUA 1ZETA 1RTIB 1RAIB 2GAGC 2PA8D 1U0SA 2HFZA 2BABA 4NZ7A 3GZ7A 5KFRA 4IRCA 1YK9A 3VAHA 2AEFA 2HNYB 1XN9A 1HQEA 1FD8A 1WORA 1SJFA 2XS7A 2BE2B 3BGRA 3CJ8A 5D78A 1RT6B 2IBOA 2V0NA 4JI2F 2W2MP 4J37A 3V6JA 1E6YA 1C1BA 3DN9A 2BDPA 1RAOA 2LP4A 4O44A 2R7VA 3T5LA 1KVIA 5IV3A 5DETA 4EZ9A 1EAYC 1REVB 3R1LA 2OHDA 1G4CA 2QLXA 1WEXA 3I32A 4DWIA 2MZQA 5J1EA 1S1XB 2PFDA 2A6OA 4B3RJ 3W5ZA 3FZ2A 2FJXA 2C2ZB 5BYQA 1HNWF 3C15B 2J9EA 1H2TZ 1D0EA 3G96A 3NBPB 1S57A 3VCDA 1RT2B 1YJTA 2KO1A 3BBBA 4ZVOB 2ZNZA 1S6UA 2JOQA 4RUHA 2ADCA 1YITS 1WOSA 3N9UC 1CBKA 1RACB 2WK4A 3HXMA 2FJAB 4KTQA 2B8PA 2NYIA 2E1AA 4KIAA 1GX6A 1TELA 2QYCA 3D3CJ 3IG1A 4FF4A 2UXBF 3TX0A 1WC0A 1WC1A 5D0EA 1S6PA 1KSPA 3MAHA 3B78A 3PO5A 1WF2A 1AT1B 3UN5A 4B3OB 1KDNA 1RISA 4UOCA 3QIDA 2OEKA 4GVBA 5KFZA 4OZJA 1J5OB 4C8NA 1W2IA 2WSFC 4YB5A 2N7CA 2AU0A 1XMQF 1ZYQA 3M32A 3BR9A 3MAAB 1MMNA 3DDNA 3ONQA 1ZAWA 2EW9A 3TVKA 4TU9A 2FLNA 1X5PA 4KHPJ 3BKFA 1J2VA 5KG5A 3DLKA 3LQVA 4W92B 2XMAA 5JVHQ 2HK3A 1UFLA 3VGTA 4NCBA 3UVJA 1FDDA 1N6QB 1TAUA 1NPKA 3GSIA 3I82A 2F9DA 1YZ6A 3FFIA 3MWBA 3AD8C 2AJ0A 3O3LA 4UZCA 2OTLS 2YXLA 3AQPA 2QA4G 5KFSA 2IMWP 1S1WA 4MYUA 1WSVA 3OR1B 4RU2A 1KLNA 4J9SA 2YX7A 1IQTA 3AJ1A 4LFCF 1HLWA 2HRYA 2YNGB 3KMQA 4Y2KA 1FXLA 1RCXB 2K3IA 3VR1A 1Q7YT 2KJVA 4QWCA 5EHHA 3MCMA 5HVGA 3MMAA 2HHTA 4RBUA 3US5A 5K14A 1H98A 1VIOA 2YQ3A 4B17A 3OHBA 3HKZD 2CPIA 5KFQA 3C6UA 3FVYA 3PM9A 4QR0A 1U1NA 4L6V3 2CG4A 1M5VC 4LF4J 1G1XA 1S1VA 1FJ7A 3P4UB 2AP6A 3CMAS 2QL9B 2V34A 3KK1B 2RDDA 5DDPC 1IR0A 1YBUA 4IOBA 4M5MA 3GCWP 1NDPA 4RWWA 4ZVSB 2RF2B 3W9JA 3IBWA 1RCOB 4QJVA 1HWIA 4PXEA 1X4GA 3UE2A 3FRYA 4DPXA 3OLAA 4DUYJ 4DS4A 4DQSA 3K57A 3WBZA 4K4YA 2B7BB 2JX2A 2YNIB 3AB2B 2ZM6F 3GPAA 4B3MJ 3HVTA 4FXWA 4FYWB 2ASDA 1SC6A 3CDEA 4JP8A 1CJVA 3R5DA 4WZMA 2I6WA 3CVKA 1P27B 4NOHA 1RT1A 2GHVC 1ACMB 4WP8A 3TAPA 1HW8A 2CQ4A 2HURA 3R7SB 3V81B 5I4MA 3EZ5A 5C24B 1Y11A 1YBAA 1UTAA 4N8NA 3RAQA 3PO4A 3C6TB 1KOOA 4ZPDA 2VKRA 2WSCC 2OAUA 3CJKB 2RDIA 2HPUA 5L38A 1FRHA 2QL7B 3Q86A 4AQYJ 1OY9A 2G0CA 3LGNA 3OD2A 3QJLA 3BZQA 3W65A 3QRRA 3D7SB 1FJEB 1R31A 1TQLA 1NDCA 2RE1A 1CQMA 2IVMA 2VPYB 1BHNA 1ZOTA 2WCXA 4KSEB 4RR5A 3ZXWA 4R5PA 5LMNF 3W64A 4ELTA 1XNRF 1Q1KA 4HLBA 1I6JA 4EZ6A 3BO2A 4PZVA 1AA1B 1B7YB 2IAJA 2MHEA 1QY7A 4L74A 2RJZA 4LF2A 3M8YA 4DSJA 4IH6A 1SJ3P 1U02A 1BXNA 1KLMA 1KVKA 2VD3A 2FY8A 4JI0F 4DPUA 1RWVB 3TJ8A 4YQWA 1T0TV 3UD3P 4HR2A 3R5JB 4DV4F 3LWLA 4M5HA 5EN1A 1ZA1B 3A13A 4PWWA 4LF8F 5D8HB 1JKHA 4O3SA 5JVGQ 3FSXA 3PRVA 3G71S 3D6HB 3LAKA 2J9CA 2NCKL 3Q8YA 5J2MA 1AFJA 2F8MA 4YB7A 4CM0A 4ES2A 3MR7A 1JJ4A 2ALZA 1RT3A 1X4CA 2EPIA 2FHKA 3L3CA 5ADZA 3G82A 2AEMA 3GQCA 1F1BB 1W7WA 4LF9F 2L08A 4U9RA 4K4UA 3NOGA 4WP3A 2ADBA 3K0JA 1TU0B 1UCNA 4V19J 3R2DJ 2E1PA 3X1LB 1XNQF 2HFOA 3BSCA 4KBIA 4N7TA 2ZBIA 1XIQA 3DXBA 2G2OA 5GAEU 2LEBA 1RA6A 2EK1A 2UVWA 4NRTA 4UW2A 4X84A 2VPWB 4M5DA 4B9MA 4X62J 2G0JA 4DFPA 4C8KA 3N6NA 1SQEA 2R7OA 3ITHB 3TO8A 1HD1A 2BM1A 3TAMB 4IG0A 4I64A 2J9DE 2G13A 4CYUB 3SFGA 2HWHA 1KQKA 3MURP 4ED5A 1GNKA 5J2MB 2E5LF 5HK4A 3N0VA 3TP2A 1B0TA 4C3LA 5KG7A 2VG5B 4O4RA 5KFAA 2H5IB 2X3DA 2C2DA 4Q45A 2QLJB 4DR3F 1UA0A 4DFJA 1T9TA 3KHLA 2B8QA 4LIWA 4F67A 2WVCA 1VQKS 1K0VA 4A47A 3L95X 3MM7B 2CPZA 2ATCB 2EEYA 3LO3A 4ZVGA 1ZZFA 2CJAA 2RU9A 4DR7F 5AJ3J 2MB0B 2F4FA 3CCTA 3KTQA 2HVHA 3MM9A 2QIFA 3QZ7A 2CPEA 2IM0A 2VDIA 1Y10A 3NP5A 1VJQA 3A8KA 2HEKA 3I0RA 2LXUA 2E9TA 4BWMA 5LXRA 2A1BA 1LW0A 1QM9A 4RW8A 4CDIA 3WHIA 4C11A 1X60A 1C0UA 1S1XA 1U45A 4USWA 3Q8PB 2HG4A 1HNXJ 4FF3A 2NXJA 3P3DA 4B9NA 1LQ9A 3PYFA 2G4BA 4DR6F 1XR5A 4DR7J 2ZH2A 5B0AA 1SBRA 1EJ7L 4O0NA 5DG7A 2JLGA 2FDNA 1PAUB 2P6SA 2VBYA 3ISNC 3MHYA 2W24A 1C1BB 2Z2LA 4ED2A 4IR1A 4ILMA 1VQPS 4RW6A 1OWXA 2QLWA 3DDIA 4LF1A 1U6BA 4USTA 3K5MA 3PIPQ 1FHTA 2KJWA 1BQXA 2PC6A 4IFYA 4YEAA 4RZRA 2VQEJ 1SKSA 1FEEA 4A46A 4UQTA 3MMJA 2QA1A 2BJ1A 4YP3A 3LH2S 3QFHA 1VC5A 1RTIA 3R5AA 5J1NA 1RJJA 1APSA 2E9RX 2BKOA 4L3NA 3QT8A 2UU9F 5BJRA 2RHQB 3CO0P 3NG8A 1ZM2A 3OXFA 4B9TA 2QE5A 4FBUA 1D3WA 1C0UB 4DSEA 4FPRA 3M8SA 2BKNA 2FVQA 4USVA 4ECWA 1SJRA 1HYSA 1SJ4P 4PXBA 4F3QA 1JQGA 2ZZNA 2GV1A 5DGAA 1IBKF 1F9EB 1SV5A 2BE9B 3OL7A 4DF8A 2HHPA 1U24A 2V4QA 4DV6J 3C6UB 1M5PC 4B9SA 1NB7A 2OD4A 4RW6B 1VS3A 2N7YA 2ZZTA 4ZIWA 3R1HA 2PD1A 1NKEA 1HI0P 5IT4A 4J7CA 1K44A 3MDFA 3DOLA 1OQ6A 1QD1A 4LIRA 4ZLNA 2CJQA 2Z8QA 5IFMA 1WG4A 3PDNA 4L76A 2W2OP 2OFGX 1S59A 1M5OC 1U1OA 2AYBA 1K47A 2FZKB 3AFGA 3MM6B 2O66A 1RYRA 3N4WA 4O3RA 2DRAA 4C3KA 2HRTA 4LF7J 4WKYA 3W8PA 3GU0A 5AXLA 1TR0A 2LXFA 4DOZA 3TEHB 4ZLLA 1RTDB 1NAQA 3GYXB 1OYDA 3CF5Q 4IG3B 3P5TL 1IR1A 3AOCA 2ZWOA 6FD1A 4OMFG 4FBTA 1UZHA 2FB0A 2HZAA 3H40A 3D4JA 2HHSA 3RR8A 1DQAA 5GAGU 3RBEA 2V2KA 4KKOA 4Q2MA 4NXNF 5D3GA 2RSQA 1RHUB 3MAAA 4O3NA 2BA9A 2F40A 5A8RA 2C42A 2VFTA 2QLBB 2BRLA 1N54B 2W4CA 3IXQA 2JFKA 4ZPWR 3KJVA 1U48A 1L3SA 1D9AA 2OJ3A 1ZM3A 4KPYA 2M2BA 5D0GA 4WF9Q 4A8WA 4C8YA 3V5RA 5F9LA 4X66F 2DO0A 3ZZUA 4PQAA 2FZGB 3ETMA 4RW9A 1Y5IB 4TYAA 4FS2A 4LR7A 2CUYA 2NPIA 1LWFB 3IR5B 3KJQB 4LQ9A 1KBRA 2C2KB 2IM1A 3RGIA 2ROPA 3PX4A 3J7AN 4IH5A 2WVBA 4JI6F 4EUVA 2YWWA 4OX9J 5E5NA 3KLGB 5IM0A 3I5AA 3QT5A 3G87A 2KT3A 3HHDA 1RU2A 2C2NA 2JFDA 3C15A 2VZ9A 4NYZA 4OYWA 4QIVA 3SCKE 4I6WA 4NLUA 4F4XA 1H7WA 4LF6J 2Z0GA 5HMWA 1RAFB 2AX0A 3W2VA 2FC8A 2ZM6J 2W9AA 3NCPA 3CPWR 2BUNA 4WTOB 3IS9A 4W98A 1R0CB 3BGFA 4XO0A 2FHJD 4OL8A 2BJ8A 4O44B 3ULHA 3KFWX 2DPJA 3EGVA 1JJCB 1NZ8A 1TZ0A 4OI1A 3DU5A 5FLXU 3CDWA 4CO5A 4I1TA 5CZVA 5HVFA 1VBZA 1HQUB 3UD5A 1HNIA 3V4IB 2BE7D 3NL0A 3OJSA 1H0HB 4FP9A 5HP1B 3H5XA 3ILIA 1HI8A 3ZTQA 4KH1B 2ALYB 3CO9A 2X3GA 3JYTB 2DNZA 2ZHAA 2A6MA 1FWLA 2LEPA 3M8QB 1N5YA 3I4PA 2V4JA 4UUWA 2LVWA 4RW4A 1HWJA 1HW9A 4CO4A 3G8SA 2ZJPQ 3T9ZA 3D0GE 2W2QP 3IRXA 1L3TA 4OI3A 2HQCA 1CLFA 3DLLQ 4LFCJ 2VOPA 1VLOA 4KGXB 1LWCA 5FDLB 1VRTA 4NCGA 4DR1J 4J5OA 2VG6A 4EFAC 3IR6B 1VYAA 1X5TA 2HGMA 3IRXB 2X1BA 2VDHA 3U02A 5KT4A 2QT7A 4DV2J 3D0IE 1I94F 2XS5A 1RHQB 2UVUA 4K0KJ 5RUBA 3NMAA 3DRPB 1UL3A 2XWYA 3FKBA 4YMEA 2AJ2A 1OJ4A 2OTJS 4PYAA 4K50A 2A18A 3MI7X 4K59A 1F0XA 4O3PA 7FDRA 2IPOB 3G9CA 1CPZA 4OLPA 2LDYA 4Q44A 4ZJOA 3M8ZA 3WZ0A 4NLYA 3MEEB 3UQSA 4BLGA 4LRAA 2XCAA 3TZXA 1GH8A 2MKYA 3LP0B 3LP1A 1VK8A 4WFBQ 3TYTA 3OFEA 1T7PA 2DNRA 5C2GA 2DGOA 2E7XA 3O44A 4IFVA 2CQIA 2NYHA 1B99A 2XY6A 2CKWA 4P6QA 3PW5A 1S10A 3QWPA 4MK7A 4QWEA 3MM8A 1M1GA 3TARA 1GXTA 2A2DA 3AOAA 2YWEA 4NLSA 2RF2A 3KLVA 3VALA 2MZJA 3DDKA 2XI3A 3ENVA 3NGSA 3UDLA 3VWSA 1S1VB 5KG0A 4HI1A 1NJWA 2JEIA 2XMJA 1BWEA 2DIUA 4WZQA 1QAYA 4UF4A 4F4YA 4KFBA 3SEOA 5LSLA 2OH2A 1FJCA 1S5ZA 4AXIA 1NB2A 5I42B 2J7UA 2FGOA 2FHJA 2Y8WA 2B3TB 5DM6Q 3KK2A 1VQ4S 4B3MF 4CO1A 3ZTRA 1E6VA 1D9FA 1KQGB 2K3KA 4XDDA 2V69A 4DMZA 5CXTA 3H25A 4MH8A 4LMZA 4CO3A 5CABA 2J8AA 2QSFA 3OR1A 2RUSA 4AYBD 2V8HA 5GVQA 2PT0A 3NLCA 3WQPA 1PCAA 2CPDA 3SSSA 3NNHA 4C0HA 2B5JB 4FPIA 2MMYA 4NLWA 2WBMA 1HHQA 4A4JA 4AL6A 1UVNA 4DXLA 3DGVA 4ETZA 1D8ZA 2PDAA 3DLKB 3KJNB 4ZVRB 4OI2A 1UPMB 4GKKJ 1NEEA 2LKZA 3D6TB 2OFHX 4F02A 3TZWA 2D9PA 4NA3A 2YKOA 4B3TJ 2RILA 3KLFB 1T02A 5F3TA 3T41A 1R8HA 2XB2D 1Z2LA 4LRDA 1N8RT 1FTRA 3DLBA 2MKJA 3H4DA 3Q0AA 4ALZA 2GVZB 2OUGA 1FESA 2DNGA 5DS7A 3W5XA 3OXGA 1CJKA 4FXVA 2VV5A 2L3MA 1FVSA 1YRTA 6FDRA 5E33A 5M2RA 4DV1J 4X4RA 3DOMB 4WWSA 5GAEI 3OVSA 1ITPA 1RYSA 2YWHA 1SV5B 2Z4PA 2EFQA 2CVEA 3AA9A 4X4OA 4HYKA 4IO9Q 2CQBA 2ZWPA 2HQDA 1KVJA 1FRMA 1XR7A 4U96A 1F3FA 4CH7A 5HQLA 2UZAA 1GXUA 4N47A 2NPFA 2CQ2A 1Q79A 4F7VA 1JB0C 2YQ0A 2XULA 3HHKA 4JI3F 2VFVA 1L3VA 3P8BB 3KK3B 3DOKB 4JI4F 3PR4A 1FX2A 4FYDA 1MLAA 2JH3A 4CI0B 2VC1A 1LW2A 3EDQB 5LM7E 4OZLA 1WHXA 1AZSB 3ZZOA 2RQCA 5A2QU 3K5PA 2MLXA 2E5IA 1HQEB 4EI2A 3AQOA 3T6JA 3HHNB 2BEFA 1QE1A 3M05A 5KFCA 3QYYA 3EMTA 3D3BJ 2QEXS 3HM9A 3HCXA 4QPTA 4UOFA 3AD9C 5DM7Q 1T05A 2XQCA 4NLTA 3G6ES 3BM7A 4C11B 1FT8A 1JLAA 3FSIA 2V94A 1IUJA 2RKIB 2MDAA 2QYGA 3BS9A 1S1TB 3AD7C 2NSCA 4KHRA 4OX8A 4P9SA 1NK7A 1EQMA 2C3YA 2YX1A 1X0PA 2GCFA 2QLFB 2HMIA 4MFBB 3LOUA 2ZDPA 3LW5C 1FNXH 4NLQA 3OW2R 4F2RA 4JI2J 1S0VA 1N0UA 4GC7A 4U7UD 4CM2A 1OY8A 2R8IA 4P75A 3HT0A 4DV2F 4HHHA 5CAAA 2MJUA 1V3RA 1MWYA 3QATA 2MKKA 4ED0A 4ES1A 1RAEB 1DY3A 4NI2B 3QMQA 1DQ8A 2HLTA 3H5YA 1N5YB 2QA4S 2BJ3A 3MM7A 2UXDF 4H4MB 4M5JA 4ZP8A 2BJEA 3PJWA 2PEHA 2ZE2A 3OHAA 1V9OA 2WTFA 4NYOA 4TU7A 3CCSS 3H8YA 3PHEA 4RU9A 5F8NA 1EETA 4HH1A 4HHJA 4NL5A 1YJ9S 1JXLA 4I6YA 2Y1IA 1FRIA 2OP5A 2ZITA 3MOZA 2D41A 4FNHA 3PKMA 4KO0A 3CJ0A 4QYZJ 4G3IA 3EDRB 1JLGA 3ET6A 1XNQJ 1TL7B 3B54A 2B7CB 3W9HA 2HWTA 3N28A 3TZYA 2DISA 3ICLA 1HA1A 5LSOA 3A1YG 3G2XA 4ZDNA 3TA0A 3RZAA 2DXEA 4J9LA 4DSKA 1F5CA 3C14A 2BJDA 3CMQA 1UW4A 2ZEJA 3IAS9 3UN3A 5L9XA 4Z7CA 2KU7A 4U7CA 2DRDA 2DEIA 2XMUA 1DZ5A 2ATLA 3HVWA 2ZHOA 1U0HB 2CJ9A 1LFWA 4GO5X 4P10A 3TA1A 2DITA 3CSKA 1LNQA 4I0WA 4UOGA 4OZ3A 4ECUA 1LOUA 2FC9A 1BC6A 1R6YA 5CZXA 2CWKA 3A12A 2LFVA 2KTQA 1U0HA 4EMDA 5IZHA 2M5YA 1WC5A 5EWEA 2L48A 4X4NA 2CAJA 2PN6A 1SI9A 3EGNA 4NYPA 3V6DA 3D5MA 3CJRA 1H72C 1WC3A 1WSRA 3R6GB 3T5KA 2CZVC 2ZE2B 4ECSA 3DMJB 3VAFA 1MU2A 3GLJA 4N8OA 5KFJA 3RB3A 2JEJA 3M2VB 4FZVA 1TKTB 2DCUB 1N5QA 4NE9C 4Y6IA 5THWA 4DX7A 3W9IA 3TR5A 2L41A 3EXCX 1N56A 3O8WA 4FYYB 2AD9A 2DHSA 4IG3A 3OPKA 1EKSA 1WHYA 2MEWA 3W7BA 4P74A 1WELA 1S4FA 4OV6A 3UO0A 2AJFE 5BXIA 2HZVA 4NX9A 2PMZD 3F0NA 2V9WA 2KT2A 1LK7A 4QR2A 2G1HA 3S8SA 2XZDB 3D1HA 2HBRB 1FXDA 2Y0SD 3MM6A 4DG1B 1T03A 1RT4B 3DHXA 1RHJB 3W66A 1VQYA 2D69A 1PYOB 5KFGA 4NEYA 2J0WA 4EBCA 2YKAA 4YS2A 2NREA 1IKVB 2O5DA 2FD2A 3GG1A 3V81A 3MD1A 1BLUA 2PMHA 4KQZA 4JV2A 4ZCMA 3P45B 4G1IA 1QDUB 4G65A 4ECVA 4HT7A 1TL3A 1WI6A 4XPEA 4N56A 3FJ2A 3MPWA 4CT8A 1VIXA 3OSNA 4Q8EA 3EXYA 4O4GB 1SIWB 3DOKA 3TX8A 3DYAA 2ASYA 1R8AA 2OSRA 3R7BB 3CCRS 3KG1A 5F8LA 3FSYA 3ZZTA 1RZMA 4ENOA 2GZOA 1IWAA 2CVIA 1HHTP 3BSNA 1WHWA 3DLGA 4GO7X 4DCPB 4DEZA 1AXQA 3LGMA 4YR2A 5J2PA 2BW7A 5IC4B 5BR8F 3DYAB 1FKOA 1QAXA 3ZC4A 3MFIA 1Y3JA 1U47A 4OLOA 1TUGB 2CJBA 1RTJA 2XSJA 1TKDA 1YRUA 2A10A 2LDIA 3B6BA 3IMQJ 3FMWA 3PFEA 4OZ1A 1JJHA 3V4MA 1Q0NA 2UU9J 4M95A 2GHWA 4G1PA 3MAQA 1VBKA 2YH1A 3JQKA 3CJ3A 3HJVA 4PWUA 1I1GA 1WDTA 4JI8J 1IKVA 1RB0A 3T6BA 1Q82T 1RP5A 2X51A 4D3GA 3CCQS 3POTA 4JI7F 3EJMA 1IJFB 1NK0A 4PR6A 1JJ2R 1QSLA 1BMQB 2R7TA 4K2JA 3GR0A 2MPUA 1T94A 1UPPA 3H2LA 3ZZRA 3EPIA 3BYRA 4DS5A 4MKVA 3A8JA 1S1WB 4OX7A 4Q43A 3RB0A 1N48A 3FQKA 1M5KC 3I55S 2DPIA 1VI7A 2PIIA 3OXLA 3CCUS 1HR0J 1SCJB 1NH8A 1PJ6A 3GIRA 3SBMA 5KT5A 1JMTA 5HQ8A 2Q43A 2MKIA 4CH0S 5EUHA 1YHQS 3UI3A 2GVZA 3R5GA 1MN7A 2YKPA 5L1IA 3MR3A 1SXLA 1H7XA 4DF4A 3IR7B 3CIMA 5ETMA 5E3AA 1FX4A 2M9KA 3DMJA 3ISND 1KQFB 4J9VA 4XK8C 1QTMA 1M1HA 5DZ6A 3SV4A 1JLEA 3IBFB 4B3OA 4OZ0A 4E0DA 2HHXA 1N32F 5DO2A 5E3CA 2Q6CA 5C5JA 4NXNJ 2MZSA 1VMBA 1BGXT 2Q79A 3FK4A 4OYZA 3GV7B 2K06A 2GA7A 2HIYA 5HJYA 1T8EA 4OYIA 4DR5F 5A6WA 1UETA 4PYDA 1IN0A 1SKUB 4TY9A 4DL6A 2MGZB 1NSAA 1S1UB 2MQOA 3QFWA 2JRSA 4JI5J 3H0PA 1RT5A 4M5LA 2AQ4A 4OQJA 3CCMS 3VAMA 1KS2A 3GMGA 2V2VA 3DRSA 3BPDA 1B3TA 2ZZMA 2OMLA 2IIHA 3CD0A 3RAXA 1LKZA 9RUBA 5J1EB 3MR6A 2CQHA 5G4DA 2RVJA 3MM8B 5HJXA 1FE0A 1FRXA 2HIQA 4A8SA 5K8PA 4CO0A 4ECYA 4JYAF 3G82B 3BO4A 2HK2A 1D1UA 3G6YA 2CDQA 1F3VA 1EP4B 2ABYA 2XMMA 3JQJA 2D3ZA 4WK3A 5E7OB 5K20B 4UQGA 1RTHA 4P7TA 2MQPA 2OPPB 3JSMB 1JIHA 1PAEX 1FKOB 4LFBJ 5T7LA 1B7FA 1IBKJ 4NLDA 4F2SA 5J2PB 2FLLA 4KV8B 2GO9A 4H4MA 4C9DA 2FQQB 3EVWA 3ZTOA 1HWKA 2AWZA 3B8HA 3M2RA 2IRXA 1FE4A 1ZTTA 3QGPA 1FA0A 2L9WA 4P2SA 1SJQA 2Y8YA 2YVSA 3PCOB 3C3LA 2V8VA 3UCZP 2Z2YB 5B0DA 1NKCA 5HLFA 5IV4A 5D15A 2DR6A 3W61A 4JV0A 1GFWB 3DGPB 4RL1A 4YN3B 2KVIA 1T3NA 1T03B 3HDSA 1KRPA 1RBAA 3OJUA 3BB5A 4X64F 3RUBL 3VGUA 3DM2A 3GV8B 2OLWA 2G2YA 2R7SA 1S1TA 2GO8A 2DNYA 4JI5F 5KFNA 3K8WA 1T9XA 4XAKA 4L75A 2EFOA 1RWKB 1VFJA 4RO0A 2HYIB 1RWXB 1CS4B 1O51A 3ELHA 2IDEA 2IM2A 3CCWA 1Q16B 4DU8A 1VC0A 1PGZA 3BEGB 2ZVIA 3R2CJ 2RQMA 3T3FA 2ZNYA 5T7LB 4YR3A 4QWAA 4ED4A 2JDJA 2KFYA 2HBYB 3TUZC 4X4UA 4LFAJ 3VQSA 1FNOA 2UUAJ 2FVCA 1IR2A 3BJYA 1LWCB 1CJVB 1GMWD 5FDLA 5K8NA 3OTOF 3PZPA 1PO6A 2IJFA 4G1QB 1FD2A 3KHRA 4DL7A 3C8YA 2X1GA 3QIPA 3GYGA 2J6TA 3PTWA 2Y0BB 4YUDA 2YKMA 5D0HA 1WD6A 2RB7A 3LANA 3FBFA 4K4ZA 4P2MA 1G7CB 4NCAA 4RWXA 3W2VB 3NOCA 3BKTA 4Q2LA 4ZVPB 4KV8A 5JJBA 2WVDA 3GIMA 3ETOA 3AA8A 1FKPB 2E1MC 2QC3A 2UV8A 1RXOB 3EM1A 3DRSB 4DBQA 3KXDA 3IWNC 4KPCA 4CNZA 4A8OA 3S1TA 3N5BA 2MGZA 3TJ9A 2WB1D 5AT1B 3MCNA 1CJTB 3NWGA 2HQ3A 3NRBA 1FDNA 5U47A 3OBIA 2QMUB 2OI2A 4EBEA 2R7QA 2KKHA 3CGIA 1R43A 1RUSA 3EZOA 4CH1A 5KT3A 1NJYA 1UWAA 2IJNA 2D3O1 5KFBA 4OZNA 2E5HA 3HD1A 4ANEA 1CULB 4P72A 4Y3CA 4Q0BA 4IQMA 5DDQC 1S7HA 3HSGA 3IGNA 1V5VA 4TN2A 4QU7A 5AE1A 3R8YA 3PW0A 4CLLA 5KFXA 2KT5A 1FEHA 2B6AA 2LU1A 1LWEA 3HSJA 5KG6A 3OL6A 4U67Q 2XGQA 2VQFF 2ZJQQ 1N4LA 4XPCA 1JLQA 5ETTA 3R97A 3Q8QB 4ED6A 2BZ2A 2XY5A 2V50A 2L9DA 4F0KA 2RS2A 1UP1A 1V5IB 4BC9A 5HL7Q 4U6PA 1VISA 3DU6A 2FIUA 1EKRA 2HRUA 3TZZA 3M2UB 1TL1B 2HBQB 4R0JA 4XDCA 4ZP9A 2Y3YA 5KG4A 5ETKA 2W9CB 1RQ0A 3TANA 2AMCB 4RUBA 3H4BA 2KZMA 4HTIA 1NO8A 5A8RB 3JXOA 3K8VA 1W25A 1NSKL 5D3GB 1HWLA 1E6VB 1LV5A 2GVDB 1GQEA 3MUTP 2HS0A 2HNZA 2RH3A 4YB1P 2LXIA 1VQ6S 3GTYX 3IG1B 2IJRA 1ZPVA 3SXLA 2C28A 1JLFA 4I7FA 2CFXA 2PI4A 1IWGA 2QFJA 4IDKA 4ZPTR 1RTJB 3DLJA 4HL9A 2C3UA 5L8RC 2I5JA 3VGSA 1KFDA 1M5SA 1RAAB 4HTJA 1NU4A 4CTAA 5JMNA 1JLAB 1WOPA 4ZN3A 2AHOB 1O5JA 4FKYA 1JNRB 2G2ZA 2C2EA 1KQSR 4F3OA 3QAEA 4LF5J 4MKAA 5F8JA 5T41A 2ZC4A 3SSQA 2XNQA 4DUZF 3FCHA 3FEYB 4J9UE 4DU7A 4C4WA 5CQGA 5KFLA 5LT5A 4CRJA 2HFSA 2IRUA 2J6SA 2BJ9A 1GEHA 4DJBA 3OTBA 3WC0A 1Z2ZA 4ZIVA 3M1VA 1HFEL 3LPEA 4Q7AA 1RT6A 3DCAA 1WC4A 3J7A1 5CYQA 3NS7B 1X9MA 3J80U 5B0BA 1U8WA 4PCQA 2HNYA 3M1VB 2I2YA 4URGA 1S99A 1SQGA 2V9KA 1RAJA 3TVZA 2DGSA 1AB8A 1TUWA 1VR6A 2F9JA 2E5JA 2NLWA 1FWPA 1HBNB 1HQ2A 2RIJA 4WIQA 5MLCV 4FVMA 4J9OA 3V6HA 2YTCA 3ZZZA 2P2CB 4CLTA 1S12A 2CQDA 4DG1A 4QBUA 4ZJQA 2W7PA 3SCJE 1KKHA 2IHR1 1TKZB 1RTZA 3MPDA 3M9MB 4JB8B 1K9MT 2Y9HA 3TUJC 3OTDA 3MM5B 1TL3B 4R0EA 4JI8F 1VRTB 2HFUA 2YBVA 3OR2B 3FMBA 3HLUA 4LSNB 1JLFB 4I7FB 4KC5A 3LUYA 4C0OC 4LF4F 4GMKA 4RLEA 2R9LA 4O3QA 1G6BA 5C25B 5I3UA 4C7QA 2R3VA 2RMLA 5J2NB 3KNAA 1BD6A 3IWXA 4J9NA 4ILLA 3FC9A 4DR4F 4ID5B 2HVIA 4E2FB 1HYSB 2VONA 4S0MA 1MU2B 1OSCA 3NEKA 1MG7A 3GFHA 3E01B 4RNFA 2DGTA 2HKEA 4QIFA 3JYTA 2XYGB 4F0MA 3OFHA 4LFBF 4DPTA 5CCMA 4P7VA 3EICA 1WOOA 4EO6A 2VG5A 1TL1A 4RKUC 3CD6S 2UXDJ 3F56A 5CYJA 4WFYA 2ZD1A 1VJWA 4KT0C 2VFUA 3PXGa 3IN5A 2W01A 1SL0A 4HEA9 5E3QA 2VFRA 3MMBA 3BH7B 3FGVA 4KAIA 5LL6d 1AUDA 4LF8J 1AFIA 3QPIA 5C42B 3QLHB 4NLVA 4IRKA 1OS5A 1TKTA 1Z4UA 5I3PA 2R7WA 3MMCB 1RAGB 1Q5YA 4USKA 1TVRB 2GGPB 2LQ9A 3AB4B 3GJSB 1U26A 3D2WA 3O5TB 4DL5A 1X4DA 2H5EA 3KK2B 4JV5F 1KP6A 3JSYA 3U27A 1WUUA 5M2PA 3UWTA 1DTQB 2A3JA 4WK1A 4DZDA 1EHWA 3GWCA 4MKBA 3SCLE 3I5BA 4USUA 5SUHA 1F2HA 2XLKA 2QGFB 2M70A 4YY3J 1N32J 2IVFB 3BGUA 2HBZB 4DUTA 1N36J 3GJTB 2HAIA 3DRRA 2ILZA 1TV6A 3I0SA 1OIAA 3N6MA 1VQSA 4F4ZA 1QAJA 1FXRA 3C14B 1YG0A 1R7IA 3CTRA 2BXJA 3FQLA 3CC4S 2N4CA 3E51A 2Q3PA 2IFXA 2BBEA 2DNMA 2MKHA 3GONA 3KHGA 3KLIA 3EGWB 1ZAXA 3QLHA 4FYXB 4A8QA 2LA4A 5CCLA 3VAJA 2VA2A 5IQQA 2ZC3A 1C1CA 3RTVA 4RBTA 2WW8A 3ZNUA 4C98A 1JLGB 3ET6B 2KRBA 4TXSA 4M94A 1DJ0A 2GW8A 2D74B 5K9FA 3SSRA 1VRUB 1S9FA 4WFXA 5CYMB 4OYAA 1XBWA 4OZ2A 3KLEB 1K0TA 1P9QC 2GJIA 3BGOP 2HHQA 3H5SA 1ROFA 4AD6A 4ZOSA 1TL4A 2MKCA 2D1CA 2WRMA 3E3XA 3CIZA 3ILOA 4F4KA 4Y0FA 4OI0A 3P49B 1GMUA 3CJKA 1VQOS 2WONB 3ILJA 1TKXA 3PW4A 1VQ9S 2E5LJ 3C6TA 1IKXA 1X5OA 1WG1A 3DOLB 3BV8A 5F8GA 3QZ8A 1QE1B 4F4AA 2PSZA 2JNJA 4D3HA 4ANDA 4DL4A 2HHVA 3IM8A 4RPFA 1IKYB 5H9EK 3OR2A 4LSNA 5A8KB 5HN0A 5HANA 1PYSB 3D1QA 4WE1A 2FLOA 2GMHA 2JZ5A 3A8EA 4LBPA 2DHGA 2OD6A 4X65F 3Q24A 3MECA 2VH7A 1M5HA 3HFVA 3W63A 3T1YJ 3OL8A 2DGWA 4FN5A 4LF9J 1C4AA 1FRKA 5IC6B 4ZN1A 2QL5B 4A8YA 1NK5A 3QJPA 1QUVA 3ADAC 5KT7A 3Q8SB 2VJUA 2I1RA 1L3KA 2KYXA 1BY9A 3SCIE 5EX0A 4OYXA 2ZKTA 1HMVA 2DH7A 3E8OA 4B02A 4JYAJ 3TA2A 4F4WA 1RT1B 2QTWA 2MYFA 2XTJP 2LMIA 4RNMA 3O2IA 1MROB 3NWRA 1ZTWA 1XJWB 4DV4J 2AT1B 1SH0A 3MUMP 4ERDA 2WZ1A 2W4PA 3HULA 4CLPA 2CPJA 4QCLA 4PABA 1R0AB 2AGOA 2OSQA 1YJUA 2ZBCA 3K5LA 4TVAB 4WKRA 1BQNB 5KAKA 4J9KA 3M8PB 4CWBA 1J5EF 1HBMA 2ZDOA 1SL1A 2FLPA 3OV7A 5F41A 5T14A 4ZVTB 1FJGF 4NWBA 1WI8A 3GP9A 3SDEA 4P71A 5D77A 2ZH7A 1PG5B 2V6AA 3K17A 2WOMA 3M30B 4U7UK 1BWVA 3CCLS 3JAMU 3VV2B 3C2PA 3UVJB 5HATA 4TY8A 3JTPA 4LBHA 3MPUB 4N76A 1FJGJ 3MMAB 5GAHI 2C2RA 1KN6A 1RADB 2DJWA 3R27A 3TOQA 2YWGA 4CLUA 4K4XA 1J5EJ 2KRRA 1RBLA 3ENAA 4WCEQ 3UR0A 2QA2A 1F2GA 4A48A 3KLFA 3GSDA 1NPRA 3RB6A 2Q1LA 4ZPBA 5HSPA 3KLHB 1YJNS 3RW6A 1RSCA 1S0OA 5IWAF 3WC2A 2HQFA 4KKOB 3NCRA 4PQUA 4KHMA 2JC0A 1EB0A 1WEYA 2PGCA 4LSLB 2FVRA 1OPZA 3QT6A 3CDAA 4DV0J 4BC7A 2R8GA 3QSYB 5F9NA 2DHXA 2NSBA 1OYEA 3FCWA 2BOPA 4CYUA 2MQLA 1BQMA 2CQ1A 2PEBA 3J7YU 2DBBA 2F4VF 2LA6A 2OIHA 2B6AB 3OFGA 3ZNJ1 3H20A 5KFDA 1Y5NB 1H6KX 2VF3A 1M90T 4K4VA 1NK6A 2YX4A 5LXYA 4L3KA 3M6VA 3CW2C 4Y00A 5SZTA 2RAQA 3UDEA 3DI6A 3FDSA 4FYVB 1N5VA 1ZS6A 2JSXA 1VQ7S 1IBCB 3T1YF 5IT9Y 1CVJA 2E1CA 1YBTA 4C2MA 3UD4P 1DLOB 1RU1A 3O6QA 3FEXB 1ZM4A 2VC0A 3K5NA 1KHWA 2IA6A 3GJQB 3IC1A 3L9ZA 1CJTA 1XMOF 4YOEA 1L5UA 1SPBP 4ETXA 4ED7A 4JV1A 1F5BA 4DLGA 1Q86T 1D09B 2EXUA 1TK5A 2FJVA 1MN9A 4DFKA 5D4PA 4NZ0A 3GILA 3NBPA 5IOLA 5HQMA 2AJ1A 1FKPA 3HKWA 3QO9B 5AXNA 2GJFA 3BF4A 1BQNA 2XHWA 2B43A 2V8PA 3OUYA 5ETSA 3NKYA 1SC4B 3Q8VA 4I56A 4MIWA 4EGLA 4E8UA 5DZ7A 3QJJA 2AF6A 4NLRA 3T1AA 1S49A 3NCQA 5D4OA 2D9OA 2OKQA 2YNHB 4DV0F 4ZS6A 2VICA 2MQMA 4F25A 4BS2A 5B0EA 4OX9F 1SIZA 3K58A 4I2QA 1MSWD 1WTFA 2HW3A 1S48A 1DQ9A 2ZH8A 4CO2A 2DTJA 1YZ7A 1WHVA 2O1PA 4ZPAA 3NGRA 2WB4A 3J7ZT 1VHFA 3W3SA 3HI9A 3JAMY 1HBUB 3J81U 5KG2A 1IM6A 2GQ2A 3D1OA 3N01A 4DPWA 4EYHB 1UWBB 1Y00A 5DG9A 3MCSA 4V19X 4QR1A 1VRQC 2WW4A 2Z2ZA 1SB6A 3I56S 1U2RA 3RW7A 1GAOA 1R6VA 5HMYA 3V6KA 4LF5F 4Z2XA 3PNIA 4WU3A 5G0RA 1WJ9A 2UVRA 4KH0B 2FJWA 2B0GA 1NM2A 5KFMA 5HI7A 4NASA 5DRKA 3N6LA 2M0GB 2MQQA 2JLFA 4AL7A 1NNDA 3FUYA 3MTKA 5K5MA 2YNIA 5ETRA 2V4JB 3M2VA 1D8YA 3EX7B 3IAM9 3M4XA 4DSLA 3PG9A 4MK8A 1ZH5A 3JB9k 2FJEB 4F0HA 2BKPA 2DR7A 1LXNA 1NXIA 2C3OA 2OPQB 3G6XA 2C2OB 4ZPVR 1EZZB 2E29A 3KLGA 3CJQA 1RTHB 1T9VA 4M5KA 1NPPA 2YKNB 4DV5J 3DHWC 1EP4A 3KLEA 3GIJA 5IT9U 2SXLA 5ETNA 1LWFA 5JXSA 2FTRA 2FUG9 4EYIB 2FHOB 1DURA 2MY7A 2CXEA 2XMKA 4RW9B 4KGMA 2AW0A 4OYOA 1DLOA 2GC8A 2HFNA 2QZ8A 1K1QA 3ZZPA 1X0FA 1VGYA 3SI8A 4BDPA 2QRRA 2IYGA 2GMLA 4Y28C 2DGXA 3KLIB 5EX3A 2HNDB 1X7VA 3AHPA 3DI6B 2YNGA 1T9WA 1UEVA 1ZPWX 2AJ4A 4M8LA 5IM0B 4LQ3A 4ZVFA 1B64A 1RT5B 4KY3A 5DLFA 3T1HF 2HFVA 2VKZG 1S1UA 3GFXA 2JL9A 2B9EA 2XLJA 5DLGA 2LQ5A 2B9XA 3PVXA 1OQ3A 4E98A 1RT3B 4X4QA 2O3DA 2AYMA 3CB4A 3HVRA 1QVGR 4ANCA 3IGVA 4MJKA 2F65A 1GXLA 2MZRA 3OT9A 1FERA 2HVDA 3FRZA 4QWBA 3PACA 2DGUA 8AT1B 4EBDA 4WTYA 4LRBA 4QOTA 4OYBA 3Q23A 2DRBA 3D28A 4RX6A 5L1KA 2CNLB 4PG6A 1J5OA 1RABB 3GG0A 2JWNA 1U6ZA 4OHXA 1MMLA 4CNYA 3MTJA 1C0TA 4DX8H 2R2UA 1KLMB 1KNZA 2NZ4A 1JWWA 2DNLA 4ELUA 2WVFA 5F0UA 2RUGA 4C8LA 2VHGA 2WBRA 4Y2IA 5CD4H 3Q22A 2QO3A 1JLBB 5LOQA 4NXMF 1MWZA 1NDKA 5ETOA 3QGHA 3S6EA 4X2BA 1IQZA 1TKZA 4IO1A 1SKWA 2Z30B 5MAOA 1HWUA 1TP7A 3EUNA 4ZVHA 2APOA 5H1SV 5KFOA 2JEGA 2BQ3A 2GAHC 1IBMF 1RKJA 1RWUA 2O01C 1P6TA 1T05B 1N36F 2QN6B 2DNNA 3WIVA 1N5TA 1R0BG 5HVHA 3DKDA 4YY3F 3M9OB 2W7OA 2OO4A 4A8FA 1YX2A 1PBUA 1NK4A 3HD2A 1ULRA 2H4WB 3BH6B 4IFYB 3HF5A 4OYMA 3HO1A 4OHVA 2GS8A 3BGRB 2Z2MA 2HSEB 3K2YA 3DC2A 3QGGA 1S97A 2EC0A 3MM5A 2ZBRA 3HHLA 3RBXA 1WNEA 4HVZA 2DXFA 4X4VA 4CLWA 4DFMA 1FFGB 1YLXA 1NK8A 1YDLA 1S4EA 2DNPA 4IKAA 2XZTB 1FK9B 2EVZA 1DAXA 4R8UB 3PYGA 3SZ2A 1TFWA 2VJVA 3T19A 2E44A 2QMWA 2W7AA 4PG5A 1RLDA 3GE9A 4HKQA 1FK9A 4QQBA 1SUQA 2GMJA 1HARA 2JHEA 3MECB 2XBPA 1WTBA 2UUBF 2HHUA 1IKWB 4F3MA 2NXUA 3F44A 3QNWB 1NHVA 1Q4RA 1S77D 5H9FK 4MT1A 1IKYA 2BMBA 2DIVA 4L72B 1VHIA 3VVUA 4WXWA 5H9FJ 2MLZA 1EQ0A 3RRGA 3K5OA 1NJZA 5HAOA 4ZLJA 5AXMA 1CSJA 5KOXA 5FLXY 2R8HA 4FF2A 4PRFA 3V2UC 4KJIA 1PKUA 4F04B 1IBLF 4RUCA 5DQIA 4ZK7M 3MFHA 1VBYA 2B9YA 2R2RA 1ZZNA 3RR7A 3A4TA 2NUUG 1GTHA 3Q89A 4I69A 1A0OB 1PC4A 1UVKA 1X5SA 2ILYA 2Q6BA 3U1LA 1MW7A 3N5FA 4DL0C 3W60A 4IDKB 2PI5A 3I0RB 4JI0J 3D6MB 2LU2A 1G3OA 4XTTA 2X1FA 4CLFA 4F8RA 3ILLA 1SVDA 4IFVB 4DZ6A 4PWDA 2EK6A 1T95A 4IG0B 4CLZA 2R2SA 1LWEB 2A2CA 1UVIA 3H42A 4W90B 4MIBA 1ZM9A 3I6PA 4ZPCA 1FNMA 1N52B 2E9ZA 3BGLA 5LMNJ 1GMVA 3CCZA 2AX1A 5L1JA 3C16B 3HPOA 3M32B 1UAWA 3VAIA 1GTEA 3MR5A 1NHKL 1WKKA 2PA3A 4B9LA 2DHAA 4DR4J 2HNDA 3MCOA 2RQ4A 1QUPA 1UA1A 5KG1A 2NXEA 4U8YA 2V8DA 5L46A 3KG4A 1S6PB 3KUEA 2AZ1A 2DH9A 2VB6A 1FCAA 4KFBB 5IQ6A 5CHCB 4KE5A 2P9EA 3TRGA 4X66J 4LFAF 4UY8T 4IH7A 3MEDA 2GIFA 1JXVA 3C66A 3SDEB 1TL5A 2YKNA 3NGTA 3VGVA 4H4OB 1JKHB 3M6UA 4YR0A 3GB0A 3HP6A 4J9RA 1RT2A 2UUWA 5DQHA 1HR0F 4ED8A 1R8CA 2W1BA 3BKUA 1FFSB 4ATNA 1DFDA 1VQLS 1BUXA 1JX4A 4GKJJ 3I4HX 2MQ8A 4TKTA 1FO1A 3VF0B 5LMUF 4P2FA 4PXCA 3MMCA 1ZAVA 2R7RA 4K2XA 4TNOA 5J2QA 3JTOA 2L9NA 4L73A 2YNFB 4XIUA 4DLEA 4DUYF 2V5HG 2PFFB 3TQEA 1S79A 4JI7J 2M8HA 1DRZA 1G2EA 5ETVA 4KO0B 3KWMA 3ZFVA 3T9NA 1U09A 3HHEA 4WYWA 2ZD1B 3PIOQ 3I31A 2HS4A 2MZ1A 1S6QB 2A0FB 2V8GA 4LRCA 4OV1A 2CJYB 2DNHA 1H73A 4M5GA 2Z56B 4H54A 4CCHA 1HPZB 4ZHRA 3QRQA 1IM4A 4I2PB 2B56A 3PYDA 2HHWA 5B08A 3CD5A 1U1RA 4ELVA 4KRWA 4J9PA 3VVTA 3VTIA 5B7WA 4I68A 2UV8G 3M9NB 2BVZA 1U6FA 3PX6A 2ERRA 1X9SA 6AT1B 1TK0A 3QIPB 5C25A 2KL8A 5I3UB 2VODA 2B4OA 5LSRA 2I9SA 4WE1B 4ITSA 1HD0A 1X4HA 5A2QY 7AT1B 1S0MA 4LJMA 4CLKA 3OTCA 2C22A 2YWFA 4IQXA 1NUEA 2YNHA 5D4LA 2ZH4A 4IOAQ 1UVMA 1P1TA 2BANB 3PHTA 4BCAA 1UWBA 4RW7A 2R7UA 4KGKA 1XR6A 2CRLA 3HHLD 5ETPA 4FXDA 1NJXA 4WPAA 3OTEA 2DNKA 4K8RA 4RNHA 2FJDB 4DV7J 3CJSA 3QO9A 2H54B 4ECQA 1Q53A 1HPZA 3MPYA 4J91A 2J8SA 1YWXA 3KK1A 2CPXA 2ZBQA 1HQUA 4MYTA 4OI6A 3V4IA 2EKNA 3TNVA 3UW1A 2XHCA 3BN4A 2QX0A 5E3RA 4ZMMA 2DYAA 1Y5LB 3CXCR 4LF6F 4LR8A 5CA5A 1WG5A 2XYPB 1S0NA 1VQ5S 1R89A 3GJRB 2XCPA 3C46A 2K1RB 3JSRA 4DR6J 3HZEA 3IS9B 1ZBTA 2C3MA 3CJTA 2KM8B 3TW0A 3M2RB 2ZH9A 2CZ9A 5B0FA 4ED3A 2BQUA 3OUYB 2VBXA 3RB4A 1RWOB 1NJIT 2F8HA 4Y2MA 2LYVA 5L39A 3U7JA 4QYZK 3UNYA 5KFPA 1UVLA 2YPZA 3BQ0A 5K8MA 1HNWJ 4JI3J 4DQIA 2MHNA 2HVZA 4WFZA 4JUZA 2LQJA 4Q5VA 3E2EA 2NQPA 3DOMA 1KOHA 4MAKA 4WJBA 3TI0A 1X9WA 2LCWA 2PMWA 3F73A 3D0HE 4DQQA 3PW7A 3R7NB 3O1LA 4YDDB 1M1KT 1KWMA 1S7IA 1OPIA 3HX9A 4HDGA 4IYQA 3ZO7A 2XY7A 4QU6A 4PQUB 1A7GE 2XO6A 5ETLA 4JBCA 4HT5A 2IVYA 3H7HB 1HI1A 3RU0A 4QIGA 5E0OA 1HHSA 1O0PA 2AZ3A 5IT0A 3UN2A 3GIIA 1YTYA 2KFNA 1NKBA 1S9EA 3BSAA 2W9CA 4URSA 3QGIA 2OPSB 5HBMA 3CE8A 2FZCB 2DY1A 1BE4A 2XMWA 4YHHJ 3Q2SC 2UVVA 3P6YC 3Q2TC 3ZTPA 2UUCF 4W4MA 2CPYA 4AE5A 3FFIB 2BQRA 2V2ZA 3AXMA 3TQ1A 1TMMA 2KFZA 1N6QA 4LUBA 1TK8A 4NLGA 1AW0A 2W2NP 2VG7A 3N79A 3NGDA 4CIOA 1AUSL 1XMOJ 1I5OB 4QZVB 3R3TA 4DL3A 3BDPA 4FF1A 4GKKF 1CJUB 3HFZB 2MSTA 3D54A 4ZKAA 4ZVEA 3UDCA 1U1QA 1KR4A 2AIRB 4RNNA 3KLHA 2H3EB 2V67A 3UCGA 1XEZA 3ZZYA 1H74A 2KHCA 2E7WA 3KG0A 3RYLA 3TWZA 1VDHA 4PUOA 2WVEA 1KD1T 1FRLA 2JLEA 5D4NA 3POTB 2H48B 1Q78A 2DT9A 3PYEA 1SC1B 2JJ4D 4MIAA 4PG7A 5AE2A 2LQ8A 4DV3F 1T3OA 5L1LA 2POKA 3HFKA 1Q8IA 2FVSA 1GT8A 1JLCB 4UUXA 3A3PB 1WDDA 4OJGA 3WIUA 3G6VA 5LJ5Y 1W26A 3G4SS 3CJ4A 3MD3A 5B0GA 3SYZA 1UZDA 2XYHB 2K8GA 1HBMB 2BACA 2V4RA 4QYRA 2DO4A 2IMOA 4OI4A 1SUQB 4ICLA 1O6XA 5HROA 1DARA 2FJBB 5M2UA 5IWAJ 3PKYA 1UFWA 4UZBA 2OPRA 2ZH3A 1N33F 2KXNB 1TAQA 5CH7B 2I8EA 1RA7A 4ILRA 4JOUA 4URQU 2NXCA 3IP0A 2E7VA 2H1YA 3HHLB 3SQGB 3QSIA 1U1MA 2BE2A 4PEOA 2XI2A 4C3MA 2OEMA 3W2WA 2J0XA 2D3UA 3MEEA 2J5AA 3HSZA 1HNXF 3J81j 4DI6A 1UEUA 1YKWA 3GFZA 3ZZ0A 3QQCD 5LJ3Y 1VQNS 1CQNA 1RKIA 3U1NA 2W9BA 5EWFA 1PJ5A 3KKFA 4USJC 5DJBA 2R8KA 4B3RF 2M8DB 1PC5A 2BANA 3KJFB 2F1FA 1T9YA 1WKJA 3K7RA 3GIKA 2CPHA 2MTLA 4ZJLA 4A8XA 1S76D 4CTAB 5KFVA 2VASA 2YH0A 3IM9A 1U25A 2KI2A 5K8OA 2BR0A 3P5BP 1ICEB 1RWMB 2XLIA 3DGPA 1QLNA 2LEAA 4K0KF 1JXEA 2KG0A 1R8PA 1I94J 4M5NA 3DRXA 4TQRA 4DV3J 2DK2A 1C0TB 1FI4A 2J6UA 4K5RA 1TKXB 4DR1F 1UVJA 2H9ZA 3DXSX 3H2UB 3PJXA 4HDHA 3AXKA 4DR2J 4ZHRB 2B9WA 4J9MA 3QAUA 3I0SB 5ITHA 3EYZA 4ECXA 1SL2A 2U2FA 2CYYA 2FHMA 3DRRB 5KOWA 1YJWS 2H65B 2XNRA 1U49A 4EU0A 4I67A 1GMWA 5HMXA 1B70B 1KHVA 5A0YA 5HO4A 2DNOA 2AKWB 5BR8J 4MTPA 3L4BC 1RT7B 1TMJA 4C8MA 4YFUA 4DCJB 2RNEA 3JQMA 1U2CA 1Z1ZA 3JS9A 3LAMA 4FNIA 2C2MB 4LREA 4DDFA 4Y2CA 4QWDA 4A8KA 3BSOA 4ER8A 2NZCA 3OQ2A 3M6XA 1DTTB 1X4EA 2OGUA 2J7KA 4NLOA 5KFYA 3LP2A 1WF1A 2IDLA 2GGPA 2J9DA 3A3NB 3L7PA 2CQGA 2Z57B 1CULA 4KR0B 4QW9A 1UJ6A 3GV5B 1VQ8S 4M63A 2JVOA 2AGPA 1Q7LB 3QRPA 2R7XA 4QW8A 1IJEB 1Q8BA 1P9YA 1RWPB 2B4PA 3DLEB 1X4AA 1LWXA 3R5CA 1SJ1A 1TL7A 2F63A 3MEDB 4GVLA 1F5AA 3Q8RB 4EEYA 3NNAA 4IOCQ 1NCLA 3M7VA 4J9QA 2ZOFA 2H51B 4X4SA 2X1AA 3DLEA 3DRYA 2ZH6A 5I42A 2EI5A 2VOOA 1NRKA 5IXUA 5KT6A 3BO3A 4JI6J 3RJMB 4OJHA 5DDOC 3HK2A 3KUHA 3CC7S 2ACYA 4DQPA 3DFEA 4LVNP 4DHVA 2XZWA 4LRFA 1XMQJ 2OPQA 2CJXB 1HBOA 4NA2A 1TVRA 4HI2A 3FNNA 2KXHA 4NLPA 1Q81T 1VCTA 1Y9OA 3E01A 4WIIA 1DTTA 5KFKA 4CQ1A 4DX6A 2I0XA 3KMSA 2WHOA 3CJ2A 4NI2A 2CNKB 5C42A 2XS2A 2P9CA 1NBEB 2DKOB 2YKMB 4A8MP 3R9LA 2YPYA 1REGX 3W5YA 3MMBB 5L9NA 1RT7A 1T11A 3JSBA 2N3OA 4MMOA 3L09A 2DR9A 1RTDA 1HIYA 2GQQA 1J27A 2IC3B 2WAQD 3MEKA 4CP5A 5A8WB 4ECZA 1HNVA 2CDRB 2DH8A 1EETB 1URNA 3I9ZA 2EWHA 1XTZA 2G0IA 2DR5A 2H4YB 2PO4A 3SIPB 1V6HA 4MK9A 3CJ5A 3PRDA 4WFNQ 3OFFA 1N0VC 1PBAA 3D9BA 3EPGA 4NEZA 2ZFHA 3M8WA 3PFOA 4DCOB 5J2NA 2IY5B 5C24A 2KN4A 1QSYA 4DV1F 1S72S 1NK9A 2CQCA 2HGNA 3NAHA 4AT1B 2DNQA 2MZTA 5D0RA 4KYZA 2VU5A 5EGYA 2ZHBA 1NH7A 1LW2B 3P96A 1YJ7A 2CADA 2CG8A 3SQGA 4AXJA 5AE3A 5JUMA 2MJNA 3J81Y 3J7Z5 4ECRA 1RWNB 3HVTB 4Z37A 3FCVA 1U1LA 4ZP6A 4HACB 1L3UA 1FVQA 1F60B 4LSZB 2AYGA 2P8IA 1XERA 2OPRB 3NS6A 4ZVUB 3RBZA 2DY9A 1RLCL 4P2XA 3U1MA 4R8UA 4UTGA 4U95A 1GX5A 3IBCB 1I51B 4DN9A 2MLYA 2HWIA 4EWTA 5KFHA 1UKUA 3UDVA 2GHPA 4WXOA 3HT3A 5CYQB 3PW2A 3DLHA 2D7SA 2NR0A 2KDOA 2KHDA 3RRKA 3AY0A 1JK9B 3RAMA 4DR2F 4YHHF 2XO7A 4KGVB 4UT4A 4FVCA 1NMEB 5F8IA 4ZITA 3MR2A 2LLZA 2RDJA 2GVDA 2F4VJ 3CDBA 3T5JA 2BW2A 4OHYA 1URRA 1XMBA 5HMZA 1QAIA 4WFAQ 2EFGA 3MGJA 3RG6A 5F0WA 4ZCKA 4RW8B 1FRJA 1VQMS 2I5JB 4IRDA 3PEHA 1CJUA 3FBCA 3M2UA 1KEKA 3VQTA 3K89A 7FD1A 5C2CA 3UPFA 2GIRA 2BV3A 2VG7B 1RI7A 4LBIA 2QG9B 1N88A 2DGQA 3THVA 4B9VA 4IUFA 4DX5A 1LK5A 3H2VE 4QPXA 1SH2A 2KXFA 4LSLA 1HKAA 4O23A 4CLSA 4X4TA 3OTOJ 3NMRA 1RWWB 4F26A 4B9UA 1B4SA 4NXMJ 1AROP 3BBCA 4PUOB 5KTQA 3J7YI 4DUZJ 1B0VA 3HZGA 3PEJA 4YB6A 4NPOA 3PRBA 4C97A 4GVBB 2HS3A 3AJDA 1U8SA 4C6AA 2LQBA 4H4KC 1RGVA 3MPVA 1NHUA 4PG8A 3L7OA 1TTHB 2NXNA 3PJ9A 5EWGA 2RHSB 2BOAA 5FIIA 5KFUA 1U2FA 3WDOA 1ELOA 1JLQB 2K7JA 4RUAA 3OVAA 1PJ7A 2F7VA 2WOMB 3M30A 4JV5J 2LECA 3ITHA 2DXDA 2IM3A 5CD4A 1JNZB 1Q95G 2CIMA 2ZBPA 3LA0A 3THTA 3PX0A 4ZCIA 3LPYA 3PV8A 4DV7F 4OX6A 3B4DA 4Y2AA 4Q0BB 4GRSA 3VHQA 5KT2A 3H59A 3PR5B 3W8GA 2IYIA 1XK8A 3FEZA 1REVA 2GFFA 3I9V9 3CUNA 1F6TA 2F5GA 2VL1A 2BYCA 3Q83A 4EO8A 3RBDA 5GMEA 1R27B 3NGUA 8ATCB 3NXZA 3OL9A 1EIYB 1E6YB 2EG1A 2W2PP 3GFYA 4G1QA 2VFSA 2UXCF 1MROA 5A6PA 3LP1B 4RNOA 1X8DA 4NLXA 4EK2A 3CCES 2ROGA 2ZJRQ 3BDEA 3CULA 2XSJB 3K59A 2GNKA 2E5GA 4R25A 1C2PA 2Z58B 2WSEC 1HMVB 4B3TF 1LFPA 4USHA 5BYSA 5DGBA 1ZA2B 4P52A 3CT9A 1U4BA 1LXJA 2IA0A 2Y1LB 3GR1A 4Z7YA 1FKAF 2HHHF 1IVZA 3QBCA 4PKDB 3GYNA 4NMXA 5DQGA 3CEDA 2D3OR 1S9GA 3G8QA 5GADU 3DRPA 4X4PA 1CS4A 4DV5F 2ZOGA 1XWLA 4J90A 4OFZA 2RU3A 2U1AA 1YGYA 3AODA 2K1RA 3AT1B 3BREA 4AUKA 1T9UA 2FY1A 3FBEA 2OEJA
chains in the Genus database with same CATH topology
4OIXA 1KC8T 1A9NB 1H38A 5GMKa 3LP0A 1O8BA 2MSSA 4MFBA 4NCGB 3S7RA 5A8KA 2VQEF 5HLFB 4K4SA 3MF5A 1TFYA 2B4VA 1U7LA 4PXDA 5B0CA 2M7SA 2QV6A 4DQRA 2W25A 1XC9A 1YIJS 3M8QA 2HQIA 1S9GB 2WONA 4GKJF 1KTVA 1RT4A 3I96A 3PY8A 5IS2A 3UNGC 2PE8A 2FGCA 3OLBA 5B09A 1HNIB 3DM2B 4PPZA 3JSMA 4N5SA 1Y7PA 4IR9A 3W2WB 5A8WA 2GQCA 4NRUA 2K7KA 5F8MA 1VRUA 1CC7A 1OO0B 2BRKA 2W8LA 1YQHA 3CCJS 2IBKA 5E41A 2JVRA 3MEGA 2UUAF 2ZH1A 1VBXA 4PPDA 1C1CB 2MQNA 1YRXA 4RW4B 1YJVA 3DNCA 3SMZA 4PG4A 3MOJB 2DB1A 2HGLA 3M8RA 2YWKA 1MNEA 2DR8A 4LVOP 3G8TA 2F8EX 4I2PA 4ICLB 5HROB 3I5CA 2UUTA 2CQ0A 5HP1A 1TV6B 1N34F 1U1PA 2OPPA 2P6TA 3ENWA 1S6QA 1JLCA 1A6LA 1R8BA 2GX8A 1D9DA 1U1KA 1OSDA 1PILA 4ECTA 3TUIC 4DN0A 5K14B 1MMDA 2P9GA 1DTQA 1B0PA 3BN7A 2W4DA 5J2QB 2ZVSA 3TVYA 5E2QA 3J80Y 2DVIA 1M0SA 4K5SA 2JEFA 4X62F 1SH3A 3ISZA 2FVPA 1UJ5A 4DPOA 4AFFA 4H4OA 2VPZB 2ZUGA 2XEXA 4LT6A 2KM8C 2B51A 2Q66A 1DBDA 1BQMB 2CQ3A 2J7WA 5KFWA 5FJ4A 2B5JA 3WX4A 5A0YB 2ZH5A 3BQ2A 3HHLC 1X4FA 2XMTA 3CMES 1UMJA 3AAWB 1JLEB 3SFUA 1S9EB 3CWJA 1P1LA 2XWXA 4ES3A 3SV3A 2J0QD 2AYEA 1K1SA 4N77A 1Y3KA 3NS5A 3CC2S 5KFTA 3B82A 1H3DA 2W8KA 1WF0A 5GADI 2N82B 4OHWA 1KFSA 3B4MA 1K73T 2MXYA 2EKYA 4QIEA 4TY8B 4NZ6A 3THPA 3EGZA 4GC6A 2QSWA 2EBGA 4FS1A 2EFNA 2AJQA 1WWHA 2HMIB 4USIA 4CZCA 4KHPF 2E66A 5DG8A 3AJ2A 2VA3A 3G86A 1IKWA 2RKIA 4DSFA 3M8PA 2EG2A 2RD5C 1CEZA 3DLGB 1VLYA 4AQYF 5KFFA 3RRHA 1HBNA 3VAGA 2KH9A 4M1KA 4QIWD 2EFPA 2DCLA 2VPXB 2M52A 2XG8A 4TU8A 1R0AA 5KFIA 1K8AT 1W2BR 3CD7A 4C8OA 2P5VA 4Y65A 3I87A 4OHZA 1IXKA 2QMXA 4H4KA 2CJKA 2RRNA 4NMLA 2EFVA 1WEZA 1TUVA 2R4FA 2M4MA 5KFEA 2Y1RI 1CC8A 2I38A 1HNZF 3EZUA 2K2PA 3H5UA 3VAKA 3M6WA 3HJFA 3BR8A 3TAQA 4ZP7A 4ZCLA 2MKSA 2DD8S 1Y4ZB 3CDUA 1UJ4A 2AV5A 2RRBA 1YSJA 2VBZA 2XGPA 2COLA 5D6GA 4KB7A 2E1RA 2BM0A 2GIQA 3ENQA 4O4GA 1LW0B 1DHMA 2MY8A 4BBYA 4F50A 3OSPA 1YI2S 4MKYA 5KG3A 4OJ3A 4LF7F 4B08A 1H2UX 2IC3A 2NUHA 1JLBA 2G1DA 3MM9B 2AGQA 1RK8A 4HH0A 2F3JA 2HNZB 2ZKUA 1IKXB 2M88A 4I4BA 4Y34A 2CPFA 2RS8A 2JC1A 5EDWA 4C8ZA 1KTQA 1FF2A 3KOAA 4K4TA 4Q8FA 1YJRA 3F41A 1Y0HA 3V6DB 4DV6F 4TYBA 3H98A 4K4WA 1HNVB 1Q8LA 2J76E 3X3UA 5I4MA 4ED1A 5CYMA 4WYLA 5E3PA 3KYLA 1V3SA 3KHHA 4TLRA 2FPHX 2C3PA 1R3NA 2YNFA 2VUGA 4M5DB 1S6OA 2OPSA 3LALA 5HBMB 3UCUP 4UY85 4YDXA 2VBWA 2KG1A 1HBOB 2XC9A 1VC6A 2KB2A 2XMVA 5AXKA 4O0IA 3LWMA 1YVFA 4ZLPA 5F3ZA 4BHQA 1P8GA 1FDAA 4NA1A 3HMJG 2ROEA 3LF0A 1VK3A 2HLUA 3TAMA 2EBEA 2N4DA 2KYZA 3AH6A 2UP1A 5GAHU 5BYRA 2IRYA 1WACA 2YY3A 4C0BA 1RDRA 4O3OA 2GJ2A 3FZBA 3KJVB 1X4BA 3BQ1A 2Y1JA 3LP2B 2RQKA 4ZA1A 3IRWP 5J1PA 1VOMA 1F9FA 2G9OA 4I6AA 4TLQA 5DDRC 2ASLA 4CT9A 2M3DA 2YKQA 3IA0A 3IO1A 3CCVS 3MZIA 2IAJB 4OZ5A 2N3LA 3MEGB 5AJ3F 2RRAA 4PWDB 2B4UA 1SKRA 4DSIA 2J0SD 3OVBA 4R5PB 5FD1A 1C4CA 2HZCA 4JI1F 1PSDA 5GAGI 3JTNA 1QVFR 1NZAA 3UR3C 4G6VB 2CQPA 2R2TA 2KZZA 1HBUA 4WU2A 1H2VZ 3IFEA 4ID5A 4RW7B 2W9BB 4DL2A 3NAIA 1KONA 2DGVA 5I3QA 3HVAA 5H9EJ 1FTCA 2VG6B 4RBVA 2R8JA 3NGKA 3R5BA 4I2QB 2ASJA 1QSSA 1FDBA 4TQSA 1CG2A 3MUVP 2NS1B 1HL6A 5G0RB 2RT3A 4AL5A 2OMOA 4BWJA 3S01A 1QJHA 4OJ1A 2O67A 4ID8A 3KK3A 2XSFA 5F8HA 1N5SA 4N41A 3NNCA 2CZ4A 3UFCX 3IWLA 3VZIA 2ZOMA 3KNGA 3MXHP 3VZHA 1V3ZA 3QWUA 1ZETA 1RTIB 2PA8D 2HFZA 2BABA 4NZ7A 3GZ7A 5KFRA 4IRCA 3VAHA 2HNYB 1XN9A 1HQEA 1FD8A 1SJFA 2XS7A 2BE2B 3BGRA 5D78A 1RT6B 2IBOA 2V0NA 4JI2F 4J37A 3V6JA 1E6YA 1C1BA 3DN9A 2BDPA 4O44A 2R7VA 3T5LA 1KVIA 5DETA 4EZ9A 1REVB 3R1LA 2QLXA 1WEXA 3I32A 4DWIA 2MZQA 5J1EA 1S1XB 2FJXA 3FZ2A 1HNWF 5BYQA 2J9EA 1H2TZ 1D0EA 3G96A 3NBPB 3VCDA 1RT2B 1YJTA 2KO1A 2ZNZA 1S6UA 2JOQA 4RUHA 2ADCA 1YITS 3N9UC 2WK4A 3HXMA 2FJAB 4KTQA 2NYIA 2E1AA 4KIAA 1GX6A 2QYCA 3IG1A 2UXBF 4FF4A 1S6PA 1KSPA 3MAHA 3B78A 3PO5A 1WF2A 4B3OB 1RISA 4UOCA 3QIDA 5KFZA 4OZJA 1J5OB 4C8NA 1W2IA 2WSFC 4YB5A 2N7CA 2AU0A 1XMQF 1ZYQA 3M32A 3BR9A 1MMNA 3DDNA 3ONQA 1ZAWA 2EW9A 3TVKA 4TU9A 2FLNA 1X5PA 5KG5A 1J2VA 3DLKA 3LQVA 4W92B 5JVHQ 1UFLA 4NCBA 1TAUA 1FDDA 1N6QB 3I82A 2F9DA 3FFIA 3MWBA 3O3LA 2AJ0A 2OTLS 3AQPA 2QA4G 5KFSA 2IMWP 1S1WA 4MYUA 3OR1B 4RU2A 1KLNA 4J9SA 2YX7A 1IQTA 3AJ1A 4LFCF 2HRYA 2YNGB 1FXLA 4Y2KA 2K3IA 3VR1A 1Q7YT 2KJVA 4QWCA 5EHHA 2HHTA 3MMAA 4RBUA 3US5A 5K14A 1H98A 1VIOA 2YQ3A 4B17A 3OHBA 3HKZD 2CPIA 5KFQA 3C6UA 3FVYA 3PM9A 4QR0A 1U1NA 4L6V3 2CG4A 1M5VC 1S1VA 2AP6A 3CMAS 3KK1B 5DDPC 1IR0A 4IOBA 4RWWA 2RF2B 3IBWA 3UE2A 4QJVA 1HWIA 4PXEA 1X4GA 3OLAA 3FRYA 4DS4A 4DQSA 3K57A 3WBZA 4K4YA 2B7BB 2JX2A 2YNIB 3AB2B 2ZM6F 3HVTA 4FXWA 2ASDA 1SC6A 3CDEA 3R5DA 4WZMA 3CVKA 1P27B 4NOHA 1RT1A 2GHVC 3TAPA 1HW8A 2CQ4A 3V81B 3EZ5A 5C24B 1YBAA 4N8NA 3RAQA 3PO4A 3C6TB 1KOOA 4ZPDA 2VKRA 2WSCC 2OAUA 3CJKB 2RDIA 2HPUA 5L38A 1FRHA 3LGNA 2G0CA 3QJLA 3BZQA 1FJEB 1R31A 1TQLA 2WCXA 1CQMA 2IVMA 2RE1A 2VPYB 1ZOTA 4KSEB 4ELTA 4R5PA 5LMNF 1XNRF 1Q1KA 4HLBA 1I6JA 4EZ6A 3BO2A 2IAJA 2MHEA 1QY7A 2RJZA 4DSJA 4IH6A 1SJ3P 1KLMA 2VD3A 4JI0F 4YQWA 3UD3P 4DV4F 3LWLA 5EN1A 4LF8F 5D8HB 1JKHA 4O3SA 5JVGQ 3FSXA 3G71S 3LAKA 2J9CA 1AFJA 5J2MA 2F8MA 4YB7A 4ES2A 1JJ4A 2ALZA 1RT3A 1X4CA 2EPIA 2FHKA 3L3CA 5ADZA 3GQCA 4LF9F 4K4UA 2L08A 4U9RA 3K0JA 2ADBA 4V19J 3X1LB 1XNQF 2HFOA 3BSCA 4KBIA 5GAEU 2ZBIA 3DXBA 2LEBA 1RA6A 2EK1A 2UVWA 4NRTA 4UW2A 4X84A 2VPWB 4M5DA 4B9MA 4DFPA 4C8KA 3N6NA 1SQEA 2R7OA 3ITHB 3TO8A 1HD1A 2BM1A 3TAMB 4IG0A 4I64A 2J9DE 2G13A 3SFGA 2HWHA 1KQKA 3MURP 4ED5A 1GNKA 5J2MB 2E5LF 4C3LA 3N0VA 3TP2A 1B0TA 5KG7A 2VG5B 4O4RA 5KFAA 2C2DA 4Q45A 4DR3F 1UA0A 4DFJA 1VQKS 3KHLA 4F67A 4LIWA 1K0VA 4A47A 3L95X 3MM7B 2CPZA 3LO3A 4ZVGA 1ZZFA 2CJAA 2RU9A 4DR7F 2MB0B 3CCTA 3KTQA 2HVHA 3MM9A 2QIFA 3QZ7A 2CPEA 2IM0A 3NP5A 3I0RA 2LXUA 2E9TA 4BWMA 5LXRA 2A1BA 1LW0A 1QM9A 4RW8A 4C11A 1C0UA 1S1XA 1U45A 3Q8PB 4FF3A 2HG4A 4DR6F 3P3DA 4B9NA 1LQ9A 2G4BA 1XR5A 2ZH2A 5B0AA 1SBRA 5DG7A 2JLGA 2FDNA 2VBYA 2P6SA 3ISNC 3MHYA 4ED2A 2W24A 1C1BB 2Z2LA 4IR1A 4ILMA 1VQPS 4RW6A 1OWXA 2QLWA 1U6BA 3K5MA 3PIPQ 1FHTA 2KJWA 1BQXA 2PC6A 4IFYA 4YEAA 4RZRA 1SKSA 1FEEA 4A46A 4UQTA 3MMJA 2QA1A 4YP3A 3LH2S 1VC5A 1RTIA 3R5AA 5J1NA 1RJJA 1APSA 2E9RX 4L3NA 2UU9F 5BJRA 3NG8A 3OXFA 1ZM2A 4B9TA 4FBUA 2QE5A 1D3WA 1C0UB 4DSEA 4FPRA 3M8SA 2FVQA 1HYSA 4ECWA 1SJRA 1SJ4P 4PXBA 4F3QA 2ZZNA 2GV1A 5DGAA 1IBKF 1SV5A 3OL7A 4DF8A 2HHPA 1U24A 2V4QA 3C6UB 1M5PC 4B9SA 1NB7A 2OD4A 4RW6B 1VS3A 2N7YA 3R1HA 2PD1A 1HI0P 5IT4A 3MDFA 3DOLA 1OQ6A 4LIRA 2CJQA 2Z8QA 5IFMA 1WG4A 3PDNA 2OFGX 1M5OC 2AYBA 1U1OA 4O3RA 3MM6B 2O66A 1RYRA 3N4WA 4C3KA 4WKYA 5AXLA 1TR0A 2LXFA 4DOZA 1RTDB 1NAQA 3GYXB 3CF5Q 4IG3B 3P5TL 4FBTA 6FD1A 4OMFG 2FB0A 3H40A 2HHSA 3RR8A 1DQAA 5GAGU 3RBEA 2V2KA 4KKOA 4Q2MA 4NXNF 5D3GA 2RSQA 4O3NA 2BA9A 2F40A 5A8RA 2C42A 2VFTA 2BRLA 1N54B 2W4CA 3IXQA 2JFKA 4ZPWR 3KJVA 1U48A 1L3SA 1D9AA 2OJ3A 1ZM3A 4KPYA 2M2BA 4A8WA 4C8YA 3V5RA 5F9LA 4X66F 2DO0A 3ZZUA 4PQAA 4RW9A 1Y5IB 4TYAA 4FS2A 2NPIA 1LWFB 3IR5B 4LQ9A 2IM1A 3PX4A 2ROPA 4IH5A 4JI6F 4EUVA 5E5NA 3KLGB 5IM0A 3I5AA 3HHDA 2KT3A 2VZ9A 2JFDA 3SCKE 3TUJC 4QIVA 3CC4S 4NYZA 4F4XA 4I6WA 4NLUA 1H7WA 2Z0GA 5HMWA 2AX0A 3W2VA 2FC8A 2W9AA 3CPWR 3NCPA 2BUNA 3IS9A 4XO0A 3BGFA 2FHJD 4OL8A 4O44B 3ULHA 3KFWX 2DPJA 1TZ0A 4OI1A 3DU5A 3CDWA 4CO5A 4I1TA 5CZVA 1VBZA 3NL0A 1HQUB 3V4IB 1HNIA 3OJSA 1H0HB 4FP9A 5HP1B 3H5XA 1HI8A 3CO9A 2X3GA 3JYTB 2DNZA 2ZHAA 2LEPA 3M8QB 1N5YA 3I4PA 2V4JA 4UUWA 2LVWA 4RW4A 1HWJA 1HW9A 4CO4A 3G8SA 2ZJPQ 3T9ZA 3D0GE 3IRXA 1L3TA 4OI3A 1CLFA 3DLLQ 2VOPA 1LWCA 5FDLB 1VRTA 4NCGA 4J5OA 2VG6A 4EFAC 3IR6B 1X5TA 2HGMA 3IRXB 2X1BA 3U02A 5KT4A 1B64A 2QT7A 2XS5A 3D0IE 1I94F 2UVUA 3NMAA 3DRPB 1UL3A 2XWYA 4YMEA 2OTJS 4K50A 2A18A 3MI7X 4K59A 1F0XA 4O3PA 7FDRA 3G9CA 1CPZA 4OLPA 2LDYA 4Q44A 3WZ0A 4NLYA 3MEEB 3UQSA 2XCAA 1GH8A 3LP0B 3LP1A 1VK8A 4WFBQ 3TYTA 3OFEA