1G3OA

Crystal structure of v19e mutant of ferredoxin i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEECPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords 7FE FERREDOXIN I
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential
pubmed doi rcsb
total genus 29
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g3oA00
1FERA 1FRMA 1G6BA 1KQGB 2ZVSA 2PA8D 3OR1A 2FDNA 5BYRA 1GTHA 1Y4ZB 1BLUA 1FRIA 1A6LA 5CHCB 4XK8C 1WTFA 3MM9A 1BD6A 1PC4A 1JNZB 1FXRA 4OV1A 1R27B 1FDBA 1FRLA 1JNRB 3MMAA 1DFDA 4Y28C 1H0HB 2FJDB 1FD2A 2V2KA 2PMZD 1FRKA 2FJBB 4YDDB 2C3OA 3EUNA 3MMCA 4KT0C 4XDDA 1G3OA 6FDRA 1H98A 1GT8A 2VPWB 2WAQD 1BC6A 1AXQA 6FD1A 1F5BA 1BQXA 1C4CA 1F2GA 3MMBA 2WSCC 1B0TA 2Y0SD 1RGVA 1Y5LB 1FF2A 4RKUC 1XERA 2GMHA 3MMBB 2Z8QA 1IQZA 1K0TA 5L8RC 2VPZB 3HKZD 3IR6B 1H7WA 1IR0A 2V4JB 3IR7B 1GTEA 1ROFA 3MM6B 2FD2A 1FDDA 2WSEC 2C3UA 1FDAA 1KQFB 3IR5B 2UZAA 1FRXA 3MM8B 2VPXB 1DAXA 2XSJB 3GYXB 5BYQA 2V4JA 4CI0B 1SJ1A 2VKRA 5E7OB 3MM7A 4L6V3 3MM6A 1Y5NB 2WSFC 2O01C 1FDNA 5BYSA 1B0VA 5CH7B 4DHVA 1GAOA 2GMJA 3LW5C 3MM7B 1SIWB 7FD1A 1CLFA 4ID8A 1JB0C 1B0PA 1C4AA 1DURA 2VPYB 3MM5B 3C8YA 4XDCA 3MM8A 1FTCA 1F5CA 2IVFB 2C42A 1D3WA 3EXYA 2XSJA 1Y5IB 1PC5A 3OR2A 3PNIA 4OMFG 3OR1B 2WB1D 5FD1A 1BWEA 1KEKA 3OR2B 1HFEL 3MM9B 1FEHA 2C3PA 1FXDA 3EGWB 1FCAA 2PDAA 3MMAB 2FJEB 1Q16B 1H7XA 3MM5A 1VJWA 2FGOA 2C3MA 1FRJA 2FJAB 4AYBD 3MMCB 2C3YA 1FRHA 1SIZA 7FDRA
chains in the Genus database with same CATH superfamily
3TUZC 2HW3A 1BLUA 3MUVP 3BF4A 4X62F 1NB7A 1CJUB 5E0OA 1S7HA 4HACB 1MROA 2VC1A 1FEEA 3OTOF 1RT2A 1RWNB 2CQ4A 5K8MA 1BC6A 2DB1A 4YB1P 4QIWD 3CJQA 1F2GA 5KFBA 4DQPA 4DV4F 2VFTA 2W4PA 4LSNA 3TVZA 5KG4A 2IHR1 3ZTQA 3FRYA 1ZBTA 4YS2A 2CNNB 4RUAA 2KM8C 4ELUA 1CJTA 2BXJA 2E9ZA 4DV5F 3J80Y 2FVSA 2HSEB 2M7SA 3M8QA 3PX0A 3DLGB 1JKHA 3JSMA 5HAOA 3AA9A 3NMAA 1QUPA 1B0PA 2B9YA 2MKJA 3DU5A 3VGSA 4OX8A 4RX6A 5H9FK 2KG0A 2HS0A 4DR6J 1DTQB 3Q8QB 1TL7B 4Q2MA 2RS2A 3FK4A 3D0HE 9RUBA 5FJ4A 2Z58B 3MECA 1VJWA 1W7WA 1N32F 4R8UA 1HPZB 3ISND 3TJ9A 1JNZB 2QRRA 1B64A 2PEHA 3GFHA 2GIRA 3NY0A 5HJYA 3RAQA 5C2GA 3EUNA 1S6PB 1AB8A 5J2QB 3ZTRA 3MAQA 4DPTA 3MCSA 1XC9A 2QGFB 2Z30B 3KUEA 1YJVA 4RUCA 3TUJC 3AAWB 3N4WA 1VFJA 1S0VA 1HBUB 1RT6A 4F67A 4K5RA 2QE5A 2ZM6J 3PJXA 2LEBA 4DJBA 3M8WA 2MGZA 3MAAB 4PG8A 1K0VA 5L1KA 4MKYA 2DGXA 3D0GE 2KVQE 4I7FB 2AGQA 3R5CA 5CYQA 2BOAA 3FMWA 1NBEB 4Q5VA 5L1IA 3M6UA 2HFNA 2DKOB 3MMAB 1UAWA 3MM5A 4ZJLA 1T9VA 3A8KA 2XYHB 3W61A 4DWIA 2KN4A 2OFGX 3DGPB 3T1HJ 3N0VA 3OJUA 4CLYA 4P72A 1X60A 3DOMB 1FDBA 3D3BJ 1Z1ZA 3W8PA 3DMJA 3GG0A 3VHQA 1I94F 1OY6A 3LAKA 2CG8A 4X4NA 2MDAA 2CPXA 3SSQA 3OTBA 2DITA 1NHVA 2KRBA 1K8AT 1Q8LA 4DZ6A 2AW0A 1Q8BA 1XBWA 3SCJE 1YZ7A 4K4VA 3H42A 3T9NA 4QCLA 2BYCA 4QIGA 2F3JA 1WORA 4LR8A 1JMTA 1N0VC 5DDRC 3DHXA 2XB2D 2MQ8A 5IQQA 2IBOA 1IXKA 4DHVA 2HBQB 5KFVA 5I3UA 1UA1A 1JB0C 2DGUA 4PUOA 2QC3A 1F5CA 2KU7A 4E2FB 4ZPWR 2D74B 3EGNA 3D6HB 3FQKA 2BACA 5ETOA 4MMOA 5DGAA 2FJEB 2H1YA 4AYBD 4GMKA 1U2FA 1RAJA 1Q79A 3DOKB 2DNKA 3M2VA 2VJUA 2M52A 1C1CB 5HK4A 2MJUA 3QT8A 2G4BA 3R97A 4TU7A 4U8VA 3KLGA 2LQ9A 5KOXA 2ROPA 1S1WB 4LIWA 4PAAA 1VDHA 1RTJA 3V81B 1QSYA 5KG6A 3OXFA 3ITHB 4Y2CA 4A47A 2BUNA 4U7UK 5CA5A 3UPFA 4F04B 3KLEA 1PGZA 3EXCX 1N36J 3IA0A 2RHQB 2XHWA 3SCKE 3TAPA 3W2VB 1LWCA 1IBLF 1B7FA 4LF6F 5U47A 2K1RB 2AV5A 3BGRA 1NH8A 2YQ3A 2W01A 1I6JA 1S6QB 1RCOB 1QSSA 5LXYA 3SEOA 2Z2ZA 3HULA 4R0JA 2E29A 3ILLA 1D09B 4Y2AA 3OVBA 3WZ0A 3FEYB 1S9EA 5HQMA 2C3YA 4ALZA 2DT9A 4IOCQ 3OHBA 3KK3B 3KHHA 2DR6A 3DRRB 3V4MA 3B4DA 1UWAA 2W9BB 3R7NB 2C22A 5J1EA 3G86A 4EWTA 1ZETA 2KJVA 2CNKB 3FBBA 2DISA 4F26A 3J7YU 3ET6B 2MKYA 3N6MA 1VMBA 5HJXA 4IH7A 5CXTA 2NXEA 1Z2ZA 3R7BB 3EM1A 1TQLA 2FQQB 4PCQA 2HFVA 4DR1J 3IGVA 3QATA 5F0UA 5EHHA 4ED0A 1ZA2B 3K57A 2MXYA 3VQSA 5IT9U 1T3OA 4IRDA 4DR6F 1HQUA 3TQ1A 1OYEA 4DV6J 2MJNA 2KG1A 3A3OB 2C3PA 4M5GA 1KDNA 4O23A 3RAMA 3HXMA 3RYLA 2FJAB 4L73A 2CQCA 2CQGA 4X66J 1SJRA 1HIYA 2DBBA 3MM9A 1YQHA 5DDPC 1NH7A 3OPKA 9ATCB 3O5TB 4RLEA 2ASYA 4L75A 5E3CA 3UCZP 1KLMB 2XMVA 5KG0A 4F02A 3A3PB 3D3CJ 4TQRA 1X4HA 3EZOA 4NLWA 1JLQA 2Q79A 3OXGA 3L9ZA 4F2RA 5KFZA 4CRJA 4NLOA 1VCTA 4XIUA 3TO8A 4DI6A 3R6LB 2ZM6F 5ETVA 3L95X 1UPMB 4EMDA 3QPIA 4FF4A 1NK6A 1WG5A 4IRCA 3D4JA 1KWMA 4CI0B 3QT5A 3CJKB 2HNYA 3BR8A 3G82A 4DU8A 5IWAJ 2WVFA 3I5CA 2ZE2B 4FKXA 1WWHA 1OPZA 2E9TA 4V1Ak 2IVYA 3TVYA 4TQSA 3UD5A 1B7YB 4O3OA 4JI1J 2E7WA 1RT3B 1NK8A 3MEDB 2E5LJ 2E9RX 4DV2J 2MTLA 1K47A 2YPYA 3B54A 2CPYA 4Q43A 4LVOP 3FSYA 3T1HF 1TV6B 2PA8D 4IFYB 3ZNUA 2KL8A 3NBPB 1DTTA 1PAUB 1RWMB 2EXUA 1QAJA 3GV7B 4DSLA 1RBAA 4RWXA 4GO7X 1VQ6S 2FJBB 3GV5B 3R5AA 4FF3A 5KFKA 4A8YA 3ZTSA 3BM7A 3ZZRA 4RL1A 2HNDB 2M5YA 4V19X 2OSQA 5HBMB 1Y5LB 1LWEB 5KFUA 3W8GA 3WBZA 3IP0A 4ZLJA 3SSRA 1RWKB 4JI3J 5DM7Q 2XY7A 1HHSA 5A8RA 3SDEA 2B6AB 2DNHA 3E8OA 3PEHA 2A3JA 4ZP6A 1R8BA 2CWKA 1VI7A 4P2FA 1T9XA 3OR2A 3V2UC 4ELVA 2DGOA 3NXZA 3RBXA 3IC1A 4Q45A 4RO0A 1SH2A 1OMSA 4OHXA 4NYPA 4KGXB 3DYAB 4HKQA 3M8ZA 2Y3YA 1CQMA 3MPVA 5LSOA 5AE2A 3MFHA 2G0IA 3UI3A 3MR2A 2Y1LB 3GFYA 2VA2A 1QAXA 3IRXB 4DX5A 1S1UB 2HAFA 4JI2J 2NXCA 4WK3A 5DO2A 2ZBRA 3K58A 2ILYA 2KHCA 1R89A 4RW9B 1ZPVA 5D4OA 4M5LA 3IWNC 3PIPQ 2L9DA 1P9QC 4OZLA 1M90T 2HMIA 1RHKB 5LOQA 3HZGA 1VBYA 2ZH7A 2ZJQQ 3QNWB 5LMNJ 4C0BA 3MEEB 1YJRA 2CUYA 4LMZA 3GFXA 3I82A 4HEA9 1SCJB 4OX9J 3OTDA 2EFOA 4MKAA 2V8HA 2LA6A 4M5NA 4C3LA 1SC4B 1Y9OA 1WC4A 3ZZOA 3LQVA 1CS4B 2AX1A 4K2XA 1D8ZA 1UVNA 3I56S 3FSIA 4F8RA 2JDJA 5HROA 2LEPA 5HVHA 2LP4A 1VQ7S 2HIQA 4ZVGA 2HRTA 3DLLQ 5IFMA 1RT7A 4ZIWA 4ETXA 2VBWA 4O3SA 3FCWA 4DV6F 2GIFA 4AT1B 4LQ3A 4M5DA 3OL9A 4RW4B 2ILZA 3EVMA 2XMAA 2I1RA 3RUBL 2CQ3A 1IKVB 4QR0A 1R8CA 4PKDB 1P27B 2WK4A 4OIXA 2YY3A 1RKIA 3RW7A 1VR6A 2VQFJ 2F8HA 3C66A 4EBDA 2QL7B 2DNQA 2XMKA 2JH3A 2MHNA 4H4MB 5M2PA 3OL7A 2NXUA 4ZP8A 1H74A 2YWWA 3ETOA 1IBMJ 2A0FB 2WOMA 4DSIA 1NXIA 1WF2A 2RSQA 3SMZA 4PQUB 4L74A 2RIJA 1UVKA 1RHJB 1X9WA 3Q86A 1WOSA 4BC9A 3DC2A 3CXCR 2IYIA 3EGVA 1MU2A 2QLXA 2LXUA 2VFVA 4J9QA 2X7IA 3VALA 2A6MA 1U4BA 1SJ1A 3DN9A 1X4FA 3OL8A 2J6SA 5IWAF 2Q1LA 1I3OB 1NK4A 5CZXA 1V5IB 2C42A 4JI1F 1HBMA 2DNRA 1JLGB 2E5LF 4DV2F 1TMMA 5CYQB 2R8HA 1HNXJ 2UVRA 1SH0A 3EGWB 3RRGA 4B9MA 3T5HA 1EJ7L 4KH0B 4L3KA 2KXNB 2J0QD 1S0MA 5GADU 2BKOA 4MH8A 3MDFA 3UW1A 3T5LA 2EW9A 2D1CA 3TNVA 3W5YA 4JBCA 2MZ1A 1M1KT 4G1IA 3Q2TC 2XLKA 3MPDA 2CZVC 4DUTA 2CPIA 3DDNA 1H7WA 3L09A 4EYIB 1WTBA 2MKHA 1YJUA 2KXFA 1V3RA 4JI3F 4ECYA 2DHSA 1AA1B 3UVJA 3IR5B 5AXKA 1SV5B 1U09A 4H54A 2XSJB 4NMLA 4J9OA 1JX4A 2UUWA 3P96A 4MTPA 1SKUB 1Q8IA 2AGOA 3WC2A 1Y3KA 1UMJA 2VZ9A 4I2QB 4DOZA 2YNGB 1UEVA 2QA2A 2P9CA 3TW0A 5C24B 2W24A 2AYEA 2HLUA 4IKAA 5C2CA 2RKIB 3CMAS 3CDEA 3HVWA 3HO1A 4O0IA 1HWIA 2BKPA 3L7PA 4OX6A 1HARA 1WC6A 2G0CA 1T05A 1HBOB 3OT9A 1UCNA 1FX4A 5FLXY 4ZPAA 1WKLA 2NZ4A 5K9FA 1NAQA 4JI2F 4MJKA 3QT6A 1MMLA 2JSXA 2N4CA 2QYCA 2ZWOA 2VPZB 1OQ6A 1U48A 1M5OC 2OI2A 3N28A 1N4LA 3CT9A 5I4MA 1SQFA 3H2LA 1T11A 1HI8A 1QVGR 4IOAQ 3CUNA 3NS7B 4IDKB 2CDQA 4RUHA 4OL8A 2Y1RI 3LF0A 1H2TZ 2RT3A 1ELOA 3CCMS 1SH3A 4Q0BB 2GVDB 1SL2A 4DLEA 4P7VA 3UE2A 3GZ7A 4WXWA 3PXGa 3TZYA 2HHQA 3HF5A 2X1AA 1X4DA 4OX9F 3A8EA 5SUHA 4WIQA 4ECQA 3TAQA 4RNHA 2B4PA 4G6VB 1J2VA 1IKYA 2IA6A 3K5OA 2PMHA 4J9PA 1U49A 3O44A 4PZVA 1MWZA 4C4WA 2CQIA 4N47A 3DDKA 1W2BR 1GXTA 2XO7A 1JLBA 4FP9A 1A7GE 2QSFA 4DV7J 5A8KB 3MOJB 4EBEA 1P1LA 2FZGB 3AH6A 4KPYA 2MKCA 2BE2B 5A8WA 4Y3CA 3NNAA 1LWFB 1RDRA 3B6BA 2YNHB 4DF4A 2GMHA 3BPSP 5F8NA 2VG6B 3MEGB 2WHOA 2ZOGA 1KFDA 4TLQA 2UUAJ 3RGIA 1FHTA 1HNZJ 2HBRB 1TK5A 3CW2C 1WG4A 1CBKA 3RW6A 1IM4A 1U8SA 1RTIB 1U0HA 4DSFA 1VQKS 2R7VA 1B0VA 3LW5C 3CMQA 3NRBA 2BJDA 2FJWA 4NLRA 4GVBB 2G1HA 2RDJA 1HFEL 4PPDA 4LSLA 4K4YA 3DI6B 2RQKA 2ZBPA 5DG8A 4UOGA 3UCGA 2VQFF 4KKOA 3BR9A 3R5DA 3TOQA 2WBMA 1JJ4A 4NCGA 5E3RA 3ILIA 1JLEA 2VUGA 1VIXA 2WW4A 1S49A 1G3OA 1IBMF 5A0YA 2YKPA 3I0RA 3KLFA 2IA0A 4LFCJ 2X1BA 5G4DA 3ENQA 2CG4A 2HKEA 3TUPA 2BDPA 3IM9A 3QO9B 3E3XA 1RXOB 1YSJA 1KTQA 4E98A 3ILJA 5A2QY 4JI5J 1DQ9A 4RNNA 3BDPA 4LF5J 5GMDA 2V8GA 3CC7S 4ANEA 1OS5A 4LIRA 2FVCA 4PWWA 2NUUG 8ATCB 3AODA 1RE1B 4ZVPB 4ZCLA 3H5YA 1R3NA 5KFLA 3UN2A 5C25B 3IS9B 4CZCA 4NXNJ 2ZKTA 1HNXF 3DHWC 2HVDA 4Y6IA 4LRDA 1YRUA 2AD9A 1D1UA 2V9WA 1WG1A 2OP5A 5F8IA 2Z57B 4ZLLA 1WDTA 3W2WB 3GIRA 5D0RA 1DLOB 2OFHX 1TP7A 5BR8J 1HHQA 1XK8A 1RADB 5L9XA 1DTTB 2E1PA 3A8IA 3HX9A 3Q8VA 3PIOQ 3I9V9 4N77A 5DZ6A 2FLNA 1UWBB 5G0RB 4O44B 3TRGA 2LLZA 4WTOB 3LAMA 4X4UA 1JLFA 1R7IA 1JXVA 2GJIA 3C6UA 2KRRA 4A8FA 5KFEA 4ZPCA 2DY1A 2Y0BB 1S10A 1GXUA 1JXEA 4KH1B 1ZOTA 3HHLC 3SDEB 1UP1A 3VAGA 4S0MA 2XLIA 2RAQA 2W7AA 2R4FA 1S4FA 1Q7LB 2XYGB 3CCES 3VQTA 1VHFA 2EKNA 1PCAA 4DV0J 3OR2B 1OY8A 4WXOA 1HWKA 3TVKA 2IVMA 4KFBB 1M0SA 2CDRB 5KFPA 4ID5A 3NCRA 5M2RA 3RB0A 1SC3B 5EDWA 1HNVB 1JQGA 3MMCA 2HVEA 1VQLS 1UVJA 4OLOA 3MCMA 4NYZA 3J7Z5 1FD8A 2JEJA 2OPRB 3HHKA 5HLFA 3H4DA 3E01A 3MI7X 1NHKL 1NM2A 2V4JB 3G8SA 4ECZA 2BKNA 2DH9A 2Z4PA 1L3SA 3D6FB 4GC6A 2U2FA 4G65A 4NLUA 4ES3A 1KQFB 2E7XA 2VU5A 1QAIA 5DS7A 1DHMA 2YKMB 4C8MA 3M4XA 2QZ8A 1WELA 2L3MA 3BKTA 1XEZA 4DR7J 3CJ4A 2FC9A 1Q78A 3AD9C 1D3WA 4KIAA 2ASLA 3BN4A 4PG5A 4J9MA 2GO8A 2OD4A 4UY85 4ECVA 3RB6A 2OPQA 1YJ9S 3KK1A 3OV7A 5KG1A 1DJ0A 2XZDB 3KK2A 4DV7F 1FD2A 3V4IA 3L4BC 2DPJA 2OPSA 1NEEA 1ZM4A 1IKWB 3D67A 4OYIA 1LWXA 3H40A 1BQXA 3NGSA 2WSCC 2R7OA 3OTCA 3ZO7A 3QAEA 2IJRA 2FLLA 1NDKA 2CJ9A 2UUAF 2MZRA 1BMQB 2CVIA 2XS2A 1HNZF 4CLTA 2CQBA 1ITPA 3THPA 3O1LA 1HD0A 2R8GA 4G1QA 2NLWA 4ZN3A 1YZ6A 4U7UD 2DGVA 3DRXA 3MEKA 3MM6A 2O01C 3EDRB 4C8LA 5GAEU 5KFXA 4W90B 3GLJA 2D9PA 5ETTA 1X4AA 2FHOB 5IM0A 2HQCA 5T41A 4KSEB 5CZVA 4C98A 3MURP 3CPWR 3JTNA 4ZVUB 3TX8A 1FWPA 2L08A 1T02A 3A12A 3TA1A 1NCLA 2WONB 4NA3A 1YDLA 2ZHAA 4NLVA 3S1TA 2H3EB 4YR0A 3RBDA 2C2EA 5K5MA 2F8MA 3CD6S 4LREA 3CJ8A 2J9CA 4Q7AA 3TAMA 4LFCF 1T3NA 2F7VA 2FIUA 2Z56B 3OUYA 3PVXA 4N8NA 2HVHA 1N56A 4C3MA 1TAUA 2BZ2A 1QJHA 1K44A 3IO1A 2GNKA 2YQ1A 4URGA 3MPUB 2P8IA 5H1SV 3ZZ0A 3HDSA 3Q8RB 5EWEA 4JI5F 2RQCA 1AW0A 4LF5F 1N5YB 1YGYA 1G1XA 3HLUA 1S1XA 3VZHA 2MLZA 3BYRA 4O3QA 2VKRA 3ETMA 2JEFA 5J2NA 3F41A 2ZC3A 3VAMA 1TL4A 1HWLA 5J2MA 3PKYA 4ZLPA 4RUBA 3IRWP 1LXJA 2MQOA 3ZZZA 4Y2KA 1S99A 4ECSA 1HBMB 4DQIA 4BC7A 2FGOA 4KC5A 3ENWA 3QGIA 5BR8F 2YX7A 1VRUB 2OIHA 2JRSA 1L3KA 4WF9Q 1S4EA 2HNZA 4RW8B 1M5KC 2XMWA 1J27A 4KO0B 4ECXA 3PRDA 3OFEA 3A1YG 4H4OB 3C15A 1GT8A 3IFEA 4LT6A 4DV1J 4A8XA 4WZMA 4ER8A 1B3TA 1IN0A 1RHQB 4ENOA 1WF1A 4JOUA 1CULB 4DL4A 3T19A 1NKCA 2K7JA 4MFBA 4QYZJ 2LDYA 1TK0A 3CMES 1GTEA 5FDLB 2XI2A 5ETQA 3GIIA 2XY6A 1UKUA 4C8ZA 2VPXB 4RNMA 3AHPA 1HMVA 1PILA 4CYUA 1TVRB 1RSCA 4ED1A 2WSFC 2R2UA 4NLSA 4J9LA 3GG1A 1U1MA 3MTKA 4QYRA 4MKVA 3GFZA 1VC6A 2H48B 3GP9A 2W9CB 4C8NA 1URNA 2F5GA 3W9JA 2UUCJ 1VQMS 1FERA 4M1KA 4CO3A 2NSCA 1RTZA 3H7HB 3SV3A 2MZJA 4MIBA 2DRAA 3GILA 1OQ3A 1HI1A 1RT5B 3NMRA 3I87A 1R8HA 1CSJA 2OEMA 4DFMA 3IBCB 4ZK7M 3AD7C 3NCQA 2ZDPA 1BE4A 4DPOA 3LGNA 4DL7A 2HHWA 4CO0A 2VONA 2PFDA 3THVA 4WFZA 1S79A 4RR5A 3QFWA 2A6OA 1U25A 1OO0B 1AROP 3CTRA 3C3LA 2R7UA 3D5MA 3RB4A 4DR7F 4ZCKA 2POKA 1UTAA 4K59A 1DURA 2N7YA 1U1NA 2Q6CA 2YVSA 3HMJG 4OHWA 1N5QA 1PC5A 3S8SA 3LP0B 3HFVA 2R9LA 1REVB 1L3VA 4DXLA 1IKXA 3DM2B 2OPPB 3U7JA 3FKBA 4R25A 4TY8B 3WX4A 3ILOA 2DNPA 2K3IA 1GTHA 4FPIA 1NK5A 1YJNS 3PX6A 2WVBA 4K4SA 2QEXS 2IRYA 4EO6A 3L3CA 3TA0A 3IAS9 4RW6A 4DR4J 2WB4A 2GGPA 1VQ9S 4R5PA 4ED7A 3R7SB 3WC0A 1XERA 1AZSB 3RU0A 3W3SA 3NCPA 4OZ0A 3MOZA 4TYAA 2PC6A 4NEZA 3NEKA 3CCVS 1BUXA 1U0SA 3PY8A 1TL3A 4NWBA 2ZH4A 3ICLA 4WE1A 4DCPB 4WU3A 4Z37A 3P45B 2FLOA 1JLCA 2NZCA 1PYOB 4K4ZA 4UOHA 1J5OA 5DG9A 4NPOA 1WKKA 2PGCA 2QN6B 2BQRA 2IC3A 2BANA 3HI9A 2O67A 5DQGA 3FBCA 1HNIA 5AXLA 1IR2A 4RNOA 3MD1A 4O3NA 4B3OB 1X8DA 4IG3B 5A2QU 3EICA 3BH7B 3DOLA 3SCLE 4WCEQ 5D6GA 4ZP9A 3I0RB 2XCAA 2LXFA 4B3MJ 1O0PA 3G8QA 3QT7A 3CEDA 2RILA 5CYMB 4ZS6A 1PBUA 2HGNA 3L7OA 2UVWA 1C0TB 2KFNA 2IRXA 1ZTWA 1JLAB 2GAGC 2IM1A 2N4DA 4IYQA 5BYQA 3MM7A 2YWEA 3PG9A 3GWCA 2R2RA 5BYSA 3G6ES 1TL5A 4HDGA 4M5IA 4CLFA 4ED5A 4NEYA 2L48A 4IQXA 1UJ5A 4DPXA 1GMVA 5IV3A 2DJWA 2JJ4D 4OYOA 4IOBA 1R6YA 4WYWA 3H4BA 5JVGQ 4ED2A 4CT9A 1IBKF 2FHMA 4JI8J 2C2MB 2YWFA 4EU0A 4ZVTB 4F25A 4HYKA 1Q1KA 2FHKA 5K8OA 3CB4A 4DV1F 3C14A 1H98A 5CYJA 3PDNA 3CIZA 4WKYA 4RBTA 1B0TA 2B4OA 3M9MB 4CTAB 2MZSA 3AQOA 1BQNA 2G2OA 4DR2J 4TLRA 2M88A 2AIRB 1YBUA 3C6TA 5KFIA 2W9AA 2HFZA 5H9FJ 2C2ZB 3OW2R 5KG7A 3W9HA 2XSFA 4ZJQA 4I0WA 3HFKA 1VISA 5D3GA 3UR3C 3M2RA 4EZ6A 1KNZA 2OELA 1FKOA 1NUEA 4F3MA 3QIPA 3HHNB 3TANA 1CEZA 1FWKA 2KHDA 4CLPA 5KTQA 3QJPA 3V6KA 4DDFA 5B0GA 2VH7A 3OR1B 3VTIA 1HQ2A 1V9OA 1YG0A 4OFZA 3OFGA 1U45A 4WIIA 4X62J 3UFCX 4ELTA 4NZ7A 4DUYJ 2C3MA 4FZVA 4NLQA 1T03B 1D0EA 3C46A 2DCLA 3LGHA 3HM9A 4ZITA 5KFHA 5ETKA 2J9DE 3JYTA 4DS4A 2LYVA 4ZCMA 4C9DA 2PFFB 2XZTB 3HHLA 1M1HA 4WTYA 1SL0A 1R8AA 2XMUA 2AJ4A 1FKPA 3DCAA 2WW8A 5EWFA 4RNFA 3UCUP 3M8PA 4QYZK 1F1BB 3J81U 1RWVB 4DLGA 4CP5A 3QGGA 2HGMA 2LCWA 1NSPA 2EC0A 1T9WA 5E5NA 1EP4A 1NSAA 4CLZA 1Q5VA 3KDNA 1UFLA 4YHHJ 2GHWA 1S9GA 3W5XA 3H5UA 1Z4UA 2KKHA 2ZBIA 4I2PB 5KFOA 3UNGC 3FMBA 1NDCA 1QUVA 1WSRA 3KG1A 3IWLA 1RWPB 2IAJA 5KFYA 2NREA 3JTPA 3BQ0A 1KFSA 1XMBA 2B5JA 2HHVA 2O5DA 3G71S 1FCAA 1HYSA 3UN5A 5F8HA 2ZWPA 1Y11A 5HP1A 1NMEB 4DL6A 1WNEA 1REGX 4RU2A 1NO8A 4DR4F 2M8HA 3CD5A 4K50A 1S76D 3VWSA 4OZ5A 1LW0B 3EDQB 2RQ4A 4W98A 1HQEA 3M2UB 3RAXA 4PWUA 1TFWA 2FLPA 2IFXA 3AA8A 1X4BA 4ZVSB 2VBXA 5DRKA 5D15A 4A8MP 3O6QA 4L72B 4OI1A 3U02A 1WOOA 3AD8C 2G13A 3CDBA 4QWAA 4G1QB 4L6V3 1R6VA 2MY8A 2Z0GA 3G6VA 2E1CA 3KG4A 1C4AA 3BN7A 2NYHA 2IMOA 2OGUA 2DNNA 3QLHA 1HD1A 3S6EA 4D3HA 3KHGA 2VG5A 5DQIA 3N5FA 2VB6A 5IM0B 3EPGA 2KXHA 3PRVA 3BDEA 3RB3A 5D0HA 5KFGA 2GQ2A 2BEFA 2Y8YA 4J9KA 4O4RA 4ICLA 4CLKA 3F0NA 3C16A 5HO4A 3KJQB 2CJXB 3AY0A 2ZEJA 3B8HA 1MWYA 4B3MF 2YTCA 2JEIA 4OYXA 2VA3A 1EETB 1OY9A 4DL2A 3UDCA 1JJCB 4F50A 3JS9A 3POTB 2D3ZA 1YKWA 1X5TA 5AT1B 3BGUA 4DUZJ 3I31A 3E2EA 1S0NA 1S1XB 3BSAA 4YP3A 3HD2A 5EN1A 2YKQA 4NYOA 5IS2A 3D7SB 4HT5A 2CPJA 3JSRA 2MSTA 3MWBA 4C11A 2DNYA 3K89A 4P6QA 4ANDA 3KLIA 3TWZA 1C1BA 3K0JA 1SJQA 1GMWA 5J2MB 3M6VA 4JB8B 4F3OA 4JI8F 2CJQA 2MKSA 4ZHRB 2HVZA 1HBNA 5GMEA 2NXJA 4MIAA 4JP8A 3WDOA 5ETSA 4J37A 3A3NB 4PWDA 1U24A 4JI4F 4NA1A 3HZEA 4LRCA 1DRZA 1EAYC 3H2UB 5K8NA 3KOAA 2DNGA 3C19A 1RTDA 3EGZA 4EFAC 1E6YB 2DNZA 4DR2F 4DL5A 2RF2A 4NLPA 4W4MA 2PA3A 1GK8A 1WD6A 2I5JA 3DLJA 2JVOA 1IBLJ 4HVZA 2MZTA 2F65A 3W64A 1VBZA 1FK9B 3J7AN 4NCBA 1UEKA 1U26A 3MFIA 1N33J 4L76A 2APOA 2W8LA 5IQ6A 1JIHA 2N3OA 1CJKB 2B4VA 2OHDA 4TXSA 2OSRA 3R1HA 3PNIA 5LSLA 4J9RA 1BQMB 2B0GA 1FE4A 4DUYF 3AOCA 4DR5J 1S7IA 5KFRA 3IN5A 3ZZYA 1RT4B 2RD5C 1LW2B 3ENVA 5ADZA 4P2MA 3PW4A 4RW7B 1GEHA 3PTWA 3BREA 5DETA 5MLCV 4DSEA 2YX4A 3CO9A 3NOGA 2I0XA 4OI0A 4Z7YA 1VYAA 1FNOA 3IMQJ 1S1VA 4X4SA 5K14A 1K0TA 2H4WB 5L8RC 2YKAA 2LMIA 1DBDA 5F9NA 2EFGA 1UVLA 4MK9A 2WVDA 2HK2A 4U95A 3CCUS 2HHSA 2IM0A 3HFZB 3FFIB 1KHWA 4YHHF 3CD7A 2NUHA 3Q8PB 5HL7Q 3HSDA 2YNIB 1SIWB 4XAKA 4Y2IA 2ZH1A 2A1BA 1KONA 4I68A 4HTIA 3CJ0A 2PD1A 1BWEA 3D2WA 2V6AA 2DHHA 4RWWA 3D9BA 2A10A 4F3QA 4FXVA 1UETA 4DL3A 1FT8A 1C2PA 3JSYA 1B4SA 4PXCA 3MR6A 3PHTA 1BD6A 1UW9A 2LQBA 2ZFHA 3HP6A 1TKXA 4DN0A 1R0AB 3ADAC 4J9SA 3SXLA 2FVQA 1QM9A 4DG1A 4R5PB 1HL6A 3QSYB 2EC2A 3KJNB 4BS2A 4IO1A 1IR0A 1M5VC 3DLEA 1E6VA 3HVTA 5EX3A 2FD2A 1CJVA 3IG1B 4QIFA 3CCJS 3P3DA 3LP1B 4CQ1A 4IRKA 2HQ3A 2KYXA 5E41A 3M8YA 1QE1B 4HH0A 2G0JA 2VV5A 3ZZPA 3DRPB 2ADCA 2GVZB 4LFAJ 1VIOA 2FJVA 2V67A 1GQEA 1BHNA 2GIQA 4NE9C 1N88A 4JI6J 3G6YA 3TI0A 5C5JA 2HURA 2QTWA 3W65A 2J8SA 2OKQA 4QWBA 4ES1A 1J5OB 5JXSA 4FYVB 4FXDA 3A13A 5HI7A 5L39A 1FVQA 2FB0A 1AFIA 1RYRA 4ED8A 1S57A 1Y3JA 3N79A 4I4BA 3FEZA 3MUMP 1N6QA 1RT1B 4DBQA 4USMA 3P6YC 2PI4A 4ZN1A 1C4CA 2CQ1A 3OVAA 2GC8A 1CJUA 2HHHJ 4HACA 1NHUA 3CF5Q 1F9FA 2VOOA 2GA7A 4DUZF 2BMBA 2FZCB 4WWSA 1X0FA 5IT4A 3V5RA 5MAOA 3GR0A 5LJ3Y 1FA0A 2JL9A 1TU0B 5CCMA 2XULA 2W4DA 2X51A 4J7CA 3VGUA 5IOLA 1XR5A 4C8OA 4TNOA 4CLSA 2UV8A 3S7RA 2LDIA 3R2DJ 2LXIA 3MM7B 3PZPA 3V6JA 2Y9HA 2OMOA 3HK2A 1SUQB 4NLYA 2RS8A 5EGYA 3I4PA 3DLGA 4F4WA 2UU9J 3MAHA 4B3SJ 3G6XA 2DGSA 1WF0A 4YOEA 1AYEA 2IPOB 8RUCA 4B9TA 4O3PA 1G6BA 4PG7A 5BYRA 1DTQA 3SFUA 3Q22A 1R31A 1TL7A 2AZ1A 1DFDA 1FRKA 5T7LB 2CIMA 5BJRA 3NL0A 3I32A 3HHLD 4X65J 3SQOP 1YHQS 1VQSA 1S6PA 2BRKA 3UN3A 5J2QA 2F63A 3BSOA 4FN5A 2VG7B 1NJIT 2AP6A 4OJ3A 1N33F 5E2QA 3F44A 3C6TB 1KN6A 4ZVOB 5AJ3J 2BJ1A 1LK5A 2IIHA 5C7PA 1HBUA 3DNCA 2J6TA 4UTGA 4M95A 2V8VA 3BGFA 2EG2A 4DR5F 4CO5A 5D78A 3MAAA 2RDDA 3BKFA 2YKNB 2XS5A 4I7FA 2BABA 4OYBA 2R7TA 4B17A 3Q8YA 1TKZB 2B7CB 2CQ0A 4XK8C 5LL6d 1TL1B 3MMAA 3KJVB 4JYAJ 1N54B 3JYTB 2PEBA 2CJYB 2DTJA 3D54A 3DGPA 3HVRA 4WU2A 3DOMA 2B3TB 1NU4A 2ATCB 1Y00A 4X4PA 3SQGB 3OHAA 3M8SA 2ZH3A 1FKPB 1YX2A 3RBZA 4ILMA 3M8PB 5GAGI 2O66A 1O51A 3BKUA 2ZD1A 1XNRJ 2OEKA 3VAIA 1O6XA 2C1EB 2OTJS 3LOUA 4ZIVA 1RKJA 3MXHP 4WFYA 2ZZTA 4LJMA 3G87A 2QG9B 1KTVA 1S9GB 1NDLA 4B9UA 1UFKA 2FPHX 4V19J 3JXOA 3EZ5A 3BS9A 1FFWB 4QOTA 3LP2B 1EIYB 1FXDA 4O4GA 3Q8SB 2GHPA 1HKAA 2K8GA 4QR1A 3ULHA 1WC3A 8AT1B 4OV1A 4MK7A 2IBKA 1ZZNA 4ZPBA 2PIIA 2V2KA 4AD6A 1QDUB 4AL6A 2HGLA 4NI2B 1CQNA 3G96A 3DOKA 2XO6A 1RLCL 3KLVA 5LMUJ 3M32B 1UJ4A 1C1CA 2CPEA 2VBZA 3IR6B 2DRDA 2DRBA 1G7CB 4CM0A 3NLCA 3FCVA 3G8TA 3I9ZA 4YQWA 3TR5A 1S1WA 4KJIA 5LJ5Y 3QRRA 2QFJA 2YKOA 3V81A 3B4MA 4I67A 3AFGA 2QV6A 3ITHA 2N7CA 4LFAF 5F41A 4FNHA 3DU6A 1YBTA 4JI7J 2G2ZA 2JZ5A 1CC7A 3FQLA 5I42B 1X4EA 4JI6F 2AT1B 1NRKA 1R8PA 2PMWA 5DJBA 2ZJPQ 2VDIA 1GMWD 1PJ7A 2QA4G 4HHHA 5KFQA 2OTLS 3W2VA 1RTHB 1WJ9A 2K1RA 3P49B 1H2UX 4C8YA 5F8GA 3M1VA 3PM9A 2V4RA 1S6QA 5JVHQ 3ZC4A 1FO1A 1PJ5A 2KT5A 3SCIE 1HNWJ 2PMZD 2HFSA 2BVZA 4FBTA 1NSQA 3KK3A 5B0DA 4DX7A 2HHHF 1T9YA 3DRRA 3MMBA 3HKWA 4H4KC 2Y0SD 4LQ9A 4PABA 5L38A 2W9BA 3CCZA 2QMUB 2I8EA 5GMKa 3T1YJ 4A8QA 7AT1B 4EGLA 4FF1A 4YMEA 4BHQA 1Q5YA 1UZHA 2JWNA 4USKA 3R9LA 5F8JA 2V0NA 1UVMA 2XLJA 1KQKA 3KYLA 2DHAA 4DV3J 2AEFA 2J0SD 4CO2A 2UU9F 4B3SF 4CNYA 1VRTB 2VFSA 4U96A 3MR5A 1XJWB 1S1TB 3DLHA 2CPZA 3V6DB 2JLEA 1QSLA 3AXMA 4OQJA 4LRBA 3HVAA 3I0SB 4TU9A 3KHRA 4TVAB 4F2SA 2BQUA 1HBNB 2CZ9A 4HLBA 3QSIA 4IH5A 2LVWA 3K5NA 2PT0A 3FRZA 3D1QA 3K17A 1HWUA 4CWBA 4PWDB 1ZTTA 4X65F 4PEOA 1F5BA 4KHPJ 2AF6A 3W63A 4R0EA 3KLHB 1BGXT 3GJSB 1NJYA 4RKUC 1RBLA 1KLMA 2J0WA 3O2IA 1VOMA 2Z2MA 4DF8A 5F9LA 5IC4B 4Q8FA 4K4TA 2VF3A 2H54B 4OHYA 2IJFA 4RZRA 2ABYA 1NLKL 1SPBP 3MM8B 5AJ3F 1EQ0A 3EZUA 2NR0A 4M5JA 2V5HG 1NB2A 2DEJA 4JV0A 3BQ2A 2QLFB 1TKTB 2CQ2A 1YRXA 2E5HA 2YH1A 1VS3A 2EK1A 3KFWX 2XZWA 4KHRA 1OPIA 1M5SA 3CJKA 3NG8A 1QAYA 4UUXA 1WHVA 4JV5J 2RE1A 3VF0B 1XWLA 3NP5A 1MROB 3H25A 2HQIA 2ZE2A 1RAEB 4CO1A 1RT2B 7FDRA 3IM8A 1Q7YT 4A8WA 1EX8A 1RT3A 1VQ4S 4JYAF 2DNLA 4A8OA 4LSNB 1I5OB 4C97A 3K5LA 2V8DA 1TV6A 3OTEA 4IFYA 3Q2SC 1XR6A 1MW7A 1P8GA 4NRUA 2HQGA 3NBPA 5HQLA 3WIVA 2E5IA 1CJTB 4A4JA 3M8QB 1FX2A 5HMZA 1JKHB 2BQ3A 1MMDA 1EARA 1XNRF 4P9SA 1T9UA 3JSMB 2HNDA 1RBOB 2H5JB 1WHXA 5HBMA 1OSCA 2FGCA 3H98A 4UT4A 1LWEA 5K20B 3P4UB 2VKZG 3T5KA 3GSIA 1S6UA 1YWXA 1KC8T 2MQLA 3KWMA 2XMMA 2B8QA 3BJYA 2QA1A 2N3LA 3PO5A 3MECB 1G4CA 1ACMB 4BWJA 1IBCB 2CPDA 2OLWA 2Z2YB 3IAM9 1Y5IB 1QD1A 2B6AA 4R8UB 2DXFA 2BJ3A 5IC6B 1H38A 2HAIA 2WBRA 2DVIA 2HWHA 2X3DA 2HHPA 4W92B 4KYZA 5AE1A 3PW5A 5LM7E 2XBPA 3SV4A 1KP6A 2FDNA 3Q83A 3LTOA 3R5JB 1FKAF 4QWEA 1GH8A 3W9IA 2LKZA 4F0MA 2CZ4A 1Q53A 2CRLA 3CGIA 5LMUF 2G2YA 3DYAA 3ENAA 2XI3A 1RT6B 1TK8A 3KNAA 2ZC4A 4YB5A 2FHJD 2BW7A 4YY3J 3BSNA 3GSDA 2MGZB 1IM6A 4AL5A 3DLEB 4OYAA 4K8RA 2MY7A 1CJVB 3IRXA 4DQRA 4FDFA 1RZMA 5ETRA 4JI7F 2GCFA 2ZJRQ 4I64A 1VLOA 3MM5B 4RW9A 1KHVA 3KUHA 2LU2A 5LXRA 1Q82T 3PW7A 2RHSB 3K59A 5B0CA 2Q66A 3FJ2A 4ZVEA 3DMJB 5EUHA 3MEEA 3I4HX 5KFDA 4F4ZA 1X0PA 2R2SA 5KAKA 1HNWF 2KH9A 3UNYA 3JB9k 2F9JA 2Q6BA 2Y1JA 1PAEX 2VFRA 4NZ0A 4WP8A 1NZ8A 2J0XA 1YBAA 4E0DA 2AZ3A 2H5EA 3GYNA 2Z8QA 3T1YF 4USUA 5D8HB 4LRAA 3J7A1 1FJCA 1LFWA 1CS4A 1WACA 5I3UB 2O1PA 3BBFA 3PJWA 4PUOB 4OZ2A 3D6TB 2P9GA 4F0HA 1PYTA 3MCOA 3VR1A 1VK8A 3JSBA 4DV3F 1W2IA 3OD2A 1SKWA 2MKIA 3Q23A 3BB5A 2IDEA 4U9RA 1ZM9A 2FJXA 1I1GA 2E1MC 1K1SA 4DCJB 3M2VB 1FNMA 2EFVA 3D0IE 4YFUA 3MMJA 1A0OB 1O5JA 3DGVA 3LGMA 1X5OA 1JJHA 3TZXA 1FFSB 3KLGB 4RJVA 4RW4A 2DNMA 2LQ8A 2B7BB 2GW8A 3T6BA 3M9OB 1RTJB 1BXNA 4C2MA 2C2OB 1IKVA 5GAHI 2GAHC 4KHPF 2D7SA 4QW9A 2V69A 1N5SA 1F60B 2B56A 3OFFA 3KLEB 1LQ9A 4OZNA 3KMQA 4H4MA 3N5BA 3CJTA 1RUSA 2QL5B 1LWCB 1Q4RA 4FF2A 4UZCA 3MPWA 2C28A 3BGRB 1T0TV 2EI5A 4OYMA 3LPEA 1PKUA 2HZVA 2HS3A 4PQUA 5KFMA 3CE8A 2CKWA 4J9VA 1XN9A 2I2YA 3IWXA 3QBCA 2XY5A 2VPYB 1FI4A 1APSA 2FC8A 1S9EB 2R8KA 5DM6Q 5KT7A 3TA2A 4JV5F 2XS7A 2WVCA 2A2CA 4F4YA 3DXBA 3R6GB 1DQAA 2RRBA 1S5ZA 1V5VA 1LKZA 1I51B 2AJ0A 4FBUA 1TUGB 1FRMA 5J1EB 5F8MA 1JLGA 1UVIA 4HH1A 3WIUA 1RP5A 6AT1B 4A8KA 5KG3A 3G9CA 3R5GA 3ZZTA 3BO3A 1CVJA 2CXEA 4CLLA 2PE8A 2GFFA 2M3DA 4LBPA 2O3DA 2V2QA 5THWA 4QWCA 2EBEA 2DXDA 4HT7A 1SC6A 1F6TA 4PQAA 2V63A 4XPCA 4OZJA 4O0NA 1F3VA 1YLXA 1Z2LA 3LO3A 4KHMA 3ZZUA 4AE5A 4LF8J 3HT0A 3QJLA 1V3SA 1Y0HA 2ZD1B 2VQEJ 1HQUB 4ZJOA 2JVRA 1CG2A 1MMNA 7FD1A 2B9XA 2ZH6A 3NGTA 1J5EJ 1D8YA 1SV5A 3OBIA 2XSJA 2JFDA 1MWQA 1W26A 3MM9B 1MNEA 1RACB 2CADA 3T1AA 2OH2A 2ZUAA 3SIPB 2MQNA 4O4GB 4KBIA 2LA4A 2CWXA 4I2QA 4XO0A 2YNGA 2DCUB 3LWMA 3FUYA 2ZVSA 3R5BA 5B0AA 1RAAB 3B82A 3J7ZT 2FZKB 2ZOFA 1YJ7A 5C24A 2LFVA 3Q89A 4ZPVR 1JLQB 4XDDA 4MT1A 1U1RA 3HSJA 2XQCA 2RNEA 2V68A 3GTYX 3OSNA 3H90A 2RKIA 4D3GA 4YY3F 3FDSA 4PXEA 1IQZA 4WBFA 4K5SA 1HBOA 2VDHA 3TP2A 1VGYA 2HNYB 3G82B 3VZIA 2DR5A 3LALA 1URRA 5DGBA 1GX6A 1Q8KA 1SQEA 2V34A 4ZVHA 1FDNA 2PO4A 3UDEA 4FYWB 4ANCA 4ED3A 4EO8A 4UY8T 4GKJJ 4IDKA 1PO6A 4NLXA 1TAQA 5A6WA 4Q0BA 1KEKA 2GVDA 1FJEB 5I3PA 5HQ8A 3BBBA 2XYPB 4U7CA 1DQ8A 3ISZA 1GXLA 3AB4B 5JJBA 3PKMA 2PI5A 4BLGA 4A8SA 3M1VB 3ONQA 2GS8A 2NS1B 1LXNA 3LUYA 4TN2A 2DD8S 3TJAA 1X5PA 1H0HB 4ILLA 1UEUA 2GJ2A 3H20A 3NOCA 5LT5A 3MPYA 3RR8A 2XNRA 3H5SA 3GONA 4BDPA 2AGPA 3MMBB 5A8KA 5DLGA 3RZAA 5A8RB 4OJGA 3K7RA 3CCWA 1RU2A 3H0PA 2H4YB 2BE2A 2CFXA 1LWFA 3G2XA 2YNHA 2BJ8A 2FTRA 2QX0A 2VG6A 4LBIA 3MEGA 3CCQS 1U6ZA 4P74A 4IR9A 2AYMA 3F73A 4DQQA 4UUWA 1VC0A 1LNQA 2YPZA 3R27A 2QLBB 1RTIA 4DX6A 5BXIA 2AHOB 2JOQA 5SZTA 1WOPA 4ZVQB 3EVOA 4LSZB 4H4KA 4HTJA 2X3GA 1RCXB 4C7QA 2BM0A 2D69A 1AT1B 4GVBA 2DR7A 4P2XA 1WTFA 1KOOA 3DI6A 4X4VA 5L1JA 2C3OA 2P6SA 2RUGA 2HVIA 1NPRA 3SSSA 2EFNA 3X3UA 1S59A 2AX0A 3D28A 2OMLA 2VOPA 4Y34A 2DH7A 4KY3A 3AJ2A 5D4LA 2DGQA 3J81Y 2XGQA 3NWRA 3EX7B 4YR3A 2HMIB 3AOAA 5ITHA 2ALYB 1VBXA 5HMWA 3P8BB 3CSKA 3QO9A 3VVUA 4CCHA 2ZZNA 3W5ZA 1KBRA 2B8PA 3NAIA 4B3TJ 4B3RJ 1PIEA 1ZM3A 4QU6A 1S6OA 1FRJA 5C25A 4G3IA 3IS9A 4QBUA 2IY5B 2QFIA 1Y4ZB 3ZFVA 2MQPA 4FKYA 1GFWB 5B7WA 2CJKA 2ROGA 3MD3A 2ZNZA 1RA7A 3W2WA 3B78A 2LU1A 2RRAA 1YJWS 5B0EA 1DLOA 3GJQB 5HROB 3PX4A 2KZMA 4DEZA 3BGOP 2G1DA 2NSBA 2BX6A 1NZAA 4CO4A 2HG4A 2ZDOA 1UWBA 3IBWA 5G0RA 1RT7B 2BV3A 3RBEA 4LF8F 2C3UA 4O44A 3VAJA 3UD4P 1X4CA 2VQEF 1WC0A 3D68A 1EHWA 4DFPA 2CQDA 3BYPA 5AXMA 4M5DB 4OHVA 2W7OA 3GMGA 4FNIA 1RAFB 5JMNA 4OJ1A 2XWYA 1J5EF 2X1FA 3PV8A 3DLBA 3X1LB 4GVLA 3BGLA 4KB7A 1EKSA 4C0OC 4F4AA 4BCAA 5I3QA 2JC1A 4AQYJ 1NJZA 3N6NA 3NGKA 2KM8B 3CDWA 3GIMA 2IMWP 3K8VA 5E33A 4AXIA 1Q0NA 1O8BA 3TZZA 5JUMA 3I5BA 3U1LA 2WOMB 4CH7A 4OI6A 2VODA 4KFBA 5GVQA 1NDPA 4EBCA 1NNDA 2EKYA 2MLXA 1XMOJ 2YWKA 2GQCA 2AQ4A 4KAIA 1MU2B 1HNVA 3HKZD 2VBYA 2F9DA 3DRSA 3WQPA 3FCHA 2YXLA 2E66A 5KG5A 3OFHA 2J8AA 1UW4A 1NK0A 2OPRA 2IM3A 1P9YA 2V4JA 3BSCA 4ZOSA 2R8JA 2EBGA 4GKJF 4UF4A 1GAOA 4YUDA 2U1AA 4EK2A 4LF4J 1IBKJ 1N36F 2IVFB 3I96A 3MR7A 4C3KA 2YKMA 1FFGB 5FIIA 3CVKA 2E7VA 5DQHA 4I6AA 3UDVA 4Q44A 2KT3A 1PG5B 3D66A 1K73T 4OLPA 1FRLA 4DQSA 2ZNYA 3UWTA 4DX8H 2W2PP 6FDRA 1QY7A 4J91A 4IQMA 2CPHA 2I6WA 3UVJB 2I9SA 3HJVA 4UOFA 3ZNJ1 3JQMA 1ZA1B 4YR2A 5RUBA 1VQOS 4N56A 1IKWA 3OQ2A 1LK7A 4LF7J 5HVFA 2HPUA 5IXUA 1FESA 4Y65A 1TFYA 2JLFA 3UR0A 3J80U 1ZM2A 5KT2A 1HR0J 1GMUA 4ES2A 2RU9A 2DO0A 5T14A 2GQQA 1D9DA 3BZQA 4DR1F 2AJQA 3BBCA 2WVEA 1OIAA 2ZKUA 3RRKA 1RA6A 3S01A 2B51A 4BBYA 4QZVB 3K5MA 3G4SS 4LFBJ 4XPEA 1U7LA 1N8RT 1R0BG 2V2ZA 3KXDA 3W66A 2C2KB 1T05B 2KI2A 4K4XA 4ED6A 1X9MA 3M30A 1A6LA 5CD4A 4B9LA 3M6WA 3VVTA 3PYGA 3U27A 3WHIA 4FS2A 4WP3A 4AL7A 2UXBJ 4X66F 2WONA 3T9ZA 2JFKA 3CJRA 1XQIA 2Y8WA 1NK9A 2FY8A 1K1QA 5DG7A 2M9KA 4K0KJ 3V6HA 1P6TA 4DSJA 5CQGA 3BPDA 1FJGJ 4A46A 1JXLA 1VK3A 5HMYA 4JV2A 4DFKA 3A8JA 1N5YA 5D4NA 2W25A 4YEAA 1IKYB 3PRBA 2EFQA 4NLTA 4KV8A 2BJEA 3J7YI 2N82B 3TJ8A 4B3TF 2QT7A 4B3RF 3LPYA 2ZBQA 4ZDNA 4ECTA 2FY1A 2NPIA 4P10A 5LSRA 1JLBB 4RU9A 3VCDA 1VLYA 1PBAA 1DY3A 4PPZA 1QTMA 3MF5A 4J9NA 2R7RA 4MYUA 1YVFA 3VGTA 5A8WB 2WRMA 4O3RA 3TX0A 1V3ZA 1KSPA 4YDDB 3T6JA 1VRUA 4CH0S 3QWPA 1EKRA 2VPWB 4RW8A 4K4UA 4WFXA 3ELHA 4UOCA 4I6WA 4KO0A 3CULA 1FE0A 4QPXA 2ZH8A 2YX1A 3HHDA 1UL3A 4H4OA 4RBUA 2CAJA 1UFWA 2HWIA 2M4MA 4UW2A 3I55S 1U0HB 2R7WA 5KFSA 2AJFE 5DDQC 2M2BA 1FDAA 4GO5X 4KPCA 2Q43A 1CULA 4JI0J 4X4QA 2GMLA 2KFYA 1ICEB 4FS1A 3MR3A 5FDLA 4YN3B 3RTVA 2XMJA 3UQSA 2HK3A 5CD4H 4LSLB 2C2DA 3JQKA 4ZMMA 2LEAA 3EXYA 3AJDA 1SI9A 4LUBA 4AQYF 2ZHOA 1TVRA 4KKOB 2HWTA 3FSXA 2WCXA 5KT6A 3VAHA 3PHEA 4NCGB 3C2PA 1JLEB 4DS5A 1VQYA 4KGKA 3CIMA 1XMQJ 5A0YB 3JAMY 3KLFB 3M9NB 1PSDA 2UUTA 3RJMB 2W9CA 2YBVA 2XEXA 2B43A 4AUKA 3PEJA 3GIKA 4KQZA 2HEKA 3HJFA 1XMOF 2CNOB 3F56A 4FPRA 3QQCD 5IV4A 2XM3A 2XWXA 1R43A 2J6UA 1X5SA 3QMQA 2KVIA 3KHLA 3GCWP 1QLNA 2ACMA 1RT5A 3N6LA 5H9EJ 1UA0A 4IUFA 3CNQP 4M5MA 3BV8A 4OV6A 2RRNA 4J9UE 3LH2S 4PYDA 2E1RA 1U1KA 3OLBA 4QU7A 4Y00A 3WX8A 2NQPA 1NK7A 1VRQC 2DO4A 4N8OA 4LF4F 2HQFA 1XNQJ 2AEJA 1IUJA 4OZ1A 2K2PA 1WHWA 3IBFB 4QJVA 3VAFA 2B9WA 1TUWA 3VGVA 1H2VZ 4CLUA 3PFEA 2YQ0A 1VJQA 2MYFA 2NPFA 1S0OA 4JI4J 5LMNF 1FRHA 4KR0B 3LP0A 1REVA 3DM2A 2OPPA 4WFBQ 4IFVA 1JLFB 4TY8A 3C6UB 2FVRA 2QLWA 3CJ5A 2HFUA 4UQTA 4YB7A 1RJJA 1RGVA 5IT0A 4EUVA 1L5UA 4LF7F 3LWLA 4LF9J 2A2DA 3ISNC 4J5OA 3SBMA 1ZZFA 1NPPA 4DMZA 4ITSA 4X2BA 3W62A 1HR0F 2BJ7A 5F8LA 2ERRA 1AZSA 3HPOA 4HI1A 3H2VE 3FGVA 2BR0A 5KFWA 1LOUA 3QZ7A 2F4VJ 4OX7A 3DDIA 4ZVFA 2H65B 1FTCA 4B08A 5ETPA 4LFBF 4MYTA 2VASA 2KZZA 1ZH5A 1RHUB 4ID5B 3TEHB 3T41A 1ZAVA 2MKKA 3MMCB 3OJSA 3K5PA 3M8RA 2ATLA 1WEYA 1F2HA 2ZUGA 4RPFA 3PJ9A 2VFUA 1ZPWX 1S12A 5HLFB 1YTYA 1X7VA 3E01B 2UXBF 1KD1T 5HSPA 3J81j 2JLGA 3T5JA 4CLWA 4IG0A 1TELA 1KRPA 1Y10A 4K0KF 4USVA 4B02A 4DPUA 3PW2A 4B3OA 4IG3A 4OI3A 1VQPS 1FJGF 3K8WA 2M70A 3QGHA 2JX2A 3ZXWA 3GV8B 5CYMA 1T7PA 4ZVRB 2FUG9 2CQHA 1YJTA 2DPIA 1XR7A 3ZTOA 1FNXH 1C0TA 2AU0A 2OPQB 1GNKA 2KO1A 3KK1B 1JLAA 4ZA1A 4DN9A 4CDIA 3H8YA 4NASA 5ETMA 4U6PA 2DR8A 3KK2B 3CCSS 4DPWA 3V4IB 3OXLA 2OPSB 3QJJA 4NZ6A 5HVGA 4TYBA 2BBEA 2MB0B 3EYZA 4L3NA 1IQTA 1Y7PA 2H51B 2QYGA 2V9KA 4Y28C 3PFOA 2IRUA 1TKDA 3N9UC 2CYYA 3W60A 2ROEA 6FD1A 2D3O1 4NLDA 1SJ4P 1EQMA 1IWAA 1WSVA 3MM6B 4JI0F 4M5HA 2Q3PA 1RYSA 3P5TL 4LVNP 2QMXA 5KG2A 4CTAA 1XTZA 2UXDJ 2ZH9A 1HWJA 2W2OP 4DZDA 3FBFA 3U1MA 2QJ3A 4PR6A 2DIUA 4C48A 4ZPTR 3FZ2A 1Q95G 4KTQA 1R0CB 2B4UA 1N5VA 1YRTA 2R3VA 4ZLNA 3QRPA 2P6TA 4NRTA 1XMQF 4GKKJ 1SIZA 1T9TA 3OR1A 3TAMB 2MQQA 3OUYB 5CHCB 2HHXA 1WI8A 2QL9B 1R27B 4QR2A 4N41A 3RG6A 5DZ7A 4I6YA 1LFPA 4DU7A 2DHXA 1T03A 3NAHA 3GE9A 2B9EA 3CO0P 5D0GA 3HCXA 1U1PA 3CDAA 1M1GA 2L9WA 4URSA 2ZITA 3OL6A 3AT1B 3FBEA 2M0GB 4OYZA 1M5PC 3DRSB 5J2NB 3CJ2A 4FVMA 4WFAQ 1F3FA 5GADI 2XMTA 1C0UA 1T8EA 2BE7D 2G9OA 2XGPA 4LBHA 3KTQA 1DAXA 3Q24A 4OI4A 1XNQF 4Z7CA 3VAKA 2GMJA 4TU8A 1IWGA 2BE9B 4I1TA 5C42A 3PYDA 4XDCA 2RJZA 2KJWA 1PJ6A 2QMWA 2HNZB 2EVZA 1HA1A 2JHEA 4HDHA 3QIDA 2CPFA 3BH6B 2XHCA 5D77A 1RU1A 2J76E 3UO0A 4I2PA 1ULRA 2YWHA 3Q8UA 4UZBA 3NGUA 3C15B 5GAGU 2L9NA 3N01A 5HANA 3DLKA 2YH0A 1WI6A 3Q0AA 2W4CA 2F40A 4OJHA 4MFBB 4XTTA 5J2PA 4QWDA 3HSZA 3M7VA 3FNNA 2XCPA 3DFEA 5DLFA 2HYIB 1SKSA 1UZDA 4USJC 4LF9F 5M2UA 4I56A 1HMVB 1LW0A 3FEXB 2HRYA 4CYUB 1VC5A 1FXLA 3M2UA 2DYAA 4HL9A 5H9EK 3AQPA 1U47A 2W7PA 2UVVA 2UZAA 1GX5A 5L1LA 2F4VF 2SXLA 1CPZA 3GYXB 1RK8A 3D6MB 4NXMJ 4NLGA 2AJ2A 1WKJA 4NX9A 2HFOA 3FZBA 5AE3A 1L3UA 3MTJA 2QIFA 2I38A 1F9EB 4KRWA 4B9NA 3NNCA 3MZIA 2QA4S 1DZ5A 1IJFB 2V4QA 2MPUA 1SJ3P 2PDAA 2IJNA 3QWUA 2F4FA 4DFJA 4ETZA 3PYEA 2CQPA 2NCKL 4DR3J 2D3OR 3PACA 4PXBA 3M30B 5KT4A 3W1YC 1WDDA 3A4TA 4EEYA 5F3ZA 3BO2A 4DCOB 1KQSR 4ECUA 2GHVC 5B0FA 3TARA 3NGDA 5D4PA 1FTRA 4M94A 4P73A 5KFNA 1X31C 2HLTA 1PYSB 3R8YA 3UD3P 1WHYA 1EETA 2LQ5A 2ZHBA 2VD3A 4PG4A 5E3QA 3POTA 1S48A 2HIYA 3QFHA 5E3AA 3PR4A 1IKXB 5B08A 2DIVA 4NMXA 2J5AA 3QZ8A 3O3LA 4KV8B 2MZQA 1NJXA 4X4TA 4YDXA 2KTQA 3BO4A 1KKHA 5KFCA 3PYFA 1MLAA 2UXCJ 1LEOA 2J9DA 3AB2B 4RW6B 4NXNF 2HBYB 3GQCA 4PG6A 2GGPB 3OSPA 1MN7A 3PO4A 4LF2A 4X4OA 1QTNB 2OAUA 2QSWA 1RISA 4C6AA 3SYZA 2FJDB 3VV2B 2COLA 3AJ1A 1AUSL 1N48A 4ZHRA 1YIJS 1VQNS 3MGJA 1SXLA 2K06A 2YNFA 5ETNA 1TTHB 1H6KX 3NKYA 1YK9A 3MUTP 4LF1A 3QAUA 3NS5A 1U8WA 2V2VA 1TL3B 2A18A 2W2NP 4FXWA 3R1LA 4WE1B 4EI2A 2KT2A 3HSGA 1FRXA 2UXDF 3DRYA 1TZ0A 4JV1A 4FYXB 2DGTA 1E6YA 4BWMA 1G2EA 3CCRS 2ALZA 2OD6A 4U8YA 1JLCB 3U1NA 4HI2A 4USTA 2RDIA 1RB0A 1RQ0A 1FK9A 1HW9A 3TQEA 3JAMU 4ZP7A 2M8DB 3D1HA 2UUBJ 5KFJA 2C2NA 2IC3B 1CC8A 2BANB 1KLNA 3NWGA 4HHUA 2HBZB 3GU0A 4OHZA 5EX0A 4ED4A 4GKKF 1HNIB 4F36A 1H7XA 3H5XA 3QYYA 1CJKA 4NA2A 4ILRA 4OZ3A 4WP9A 3TUIC 4DL0C 1KQGB 3DOLB 4DV0F 2AYBA 5F3TA 1JJ2R 5B0BA 1SKRA 1BQMA 1W25A 2FHJA 1FXRA 3ZTPA 3GYGA 5FLXU 5CCLA 1RT4A 1RAGB 2XC9A 1LW2A 2R42A 4FYDA 2GO9A 4RW7A 4Y0FA 4F7VA 2CNLB 1WC1A 1RHMB 2JC0A 4P2SA 3TYTA 1U1LA 3GR1A 2ASDA 5J1PA 3P5BP 4DPYA 1NJWA 1Q81T 1S9FA 2XTJP 2AMCB 3TZWA 2ZBCA 5IZHA 5AXNA 2H9ZA 2LQJA 4LR9A 4UQGA 1YITS 4C8KA 2QO3A 3FFIA 2RB7A 1HLWA 4OMFG 1SVDA 4GC7A 4FYYB 3CC2S 3R3TA 2HZCA 2ASJA 4NOHA 2ZOMA 1X9SA 2YNIA 2Y1IA 2DGWA 2HQDA 3THTA 4LR7A 5CABA 1HPZA 5A76A 2ZH5A 3C14B 2UVUA 4A48A 4MK8A 3FVYA 4LRFA 1NKBA 1VQ8S 3KMSA 4YB6A 1ZYQA 2EG1A 4IFVB 1BQNB 2E5GA 2EK6A 2ADBA 4M8LA 2KDOA 2E1AA 2AKWB 1ZS6A 1R0AA 2BOPA 4Q2LA 2VIHA 2J7KA 4IO9Q 4KGVB 2KFZA 2JNJA 5KFAA 5D3GB 1FDDA 3M2RB 3US5A 1FKOB 3SZ2A 3QIPB 4WJBA 1RWWB 2E44A 4IH6A 4NXMF 2VICA 1U2RA 3L7UA 4FVCA 4U67Q 1AFJA 2BRLA 1MG7A 1XIQA 3IG1A 1H73A 2ZH2A 4OYWA 1RAIB 3LP1A 2WTFA 3CJSA 3KKFA 1QE1A 3DRPA 1EB0A 2GVZA 2W1BA 2PN6A 4DR3F 4MIWA 3EE3A 2P5VA 3HHLB 1HHTP 3KDOA 1JNRB 1F9HA 2Z2LA 3NGRA 2K7KA 4E8UA 4Z2XA 4NL5A 2RVJA 4QIVA 1M5HA 1B99A 3R2CJ 4JUZA 1UPPA 4WKRA 3I6PA 1EP4B 1T94A 4QW8A 1BY9A 4IG0B 1RT1A 4USIA 2EPIA 1ROFA 1FWLA 3LA0A 2V94A 2OO4A 1RLDA 2YWGA 4G1PA 3TEGA 3KJFB 4AFFA 2VJVA 3RR7A 3CCTA 2NXNA 5E7OB 2IAJB 2DY9A 2B5JB 1HYSB 2P9EA 1CLFA 1WC5A 2K3KA 2VL1A 1KVIA 4WPAA 5HP1B 3FC9A 2UXCF 3EVWA 1F0XA 1Q16B 3AXKA 4MKBA 1SUQA 1HQEB 3E51A 3UDLA 1EZZB 1KVKA 3HD1A 1ZAXA 1Q86T 4HHJA 2RUSA 4WZQA 4N76A 1MSWD 5GAEI 1NPKA 1RWUA 3GCXP 2CVEA 1H3DA 2V8PA 3M6XA 2FVPA 4PRFA 5B09A 4AXJA 1X4GA 3BQ1A 2WAQD 5J1NA 1RHRB 1OJ4A 1U1OA 2RH3A 4X64J 3HHEA 1S77D 4M5KA 5T7LA 1A9NB 3GJTB 4M63A 3NS6A 4WFNQ 4NCAA 2F8EX 3PW0A 2BA9A 3RRHA 2P2CB 2DEIA 4WYLA 4USWA 4ZKAA 3QLHB 4KGZB 4Q8EA 1N34J 2DH8A 1TUVA 4F4KA 3CCLS 2VG7A 2KB2A 2VG5B 2UUBF 2BM1A 5KT3A 5GAHU 2J7WA 4Y2MA 5K8PA 1IJEB 2W8KA 4ATNA 4ICLB 3T3FA 3O8WA 2PSZA 3C16B 2L41A 3IGNA 3OLAA 3KNGA 1UJ6A 4KE5A 4K2JA 3EMTA 3GIJA 5HMXA 2FYXA 3DKDA 4URQU 2YKNA 2MEWA 3GB0A 1RAOA 2F1FA 3OVSA 2UUCF 2GJFA 1OYDA 4TY9A 3QRQA 1KS2A 1TR0A 4QPTA 3OTOJ 3ET6A 1TKZA 4TKTA 1AXQA 2DXEA 4RBVA 4WK1A 1KOHA 1TL1A 5D0EA 3QGPA 2JEGA 1P1TA 1TMJA 1U6FA 2RU3A 3KJVA 2MQMA 4DV4J 1ZAWA 2AWZA 5A6PA 1N5TA 1VQ5S 2MSSA 2WSEC 1SJFA 3NNHA 4C11B 4IR1A 2EFPA 2R8IA 2UP1A 3KLIB 1C0UB 3SQGA 1C1BB 4J90A 1U2CA 3PR5B 4DV5J 4CH1A 1Y5NB 2QLJB 2J7UA 2ZVIA 5DDOC 1T95A 3SFGA 2EEYA 1OWXA 3KG0A 2BJ9A 3I5AA 2KYZA 5C42B 5FD1A 4ZPDA 5E3PA 1FEHA 1HI0P 4PYAA 1D9FA 3CWJA 1QVFR 4C0HA 2R7SA 1N32J 1FRIA 4B9VA 5IT9Y 1N0UA 2X1GA 3LP2A 1PC4A 4B9SA 1N52B 2MHEA 3DLKB 4ECWA 1RTDB 2OUGA 1JWWA 5CAAA 2RF2B 1WEZA 2CJBA 2I5JB 4N7TA 2ZZMA 5J2PB 1WUUA 1VBKA 1IR1A 1FF2A 2RQMA 5F0WA 2VHGA 3MCNA 4NI2A 1F5AA 1AUDA 3MHYA 4K4WA 3M32A 3JTOA 4P52A 2GX8A 1D9AA 2DNOA 4F0KA 1V6HA 3D1OA 2DK2A 4ERDA 4QIEA 5KOWA 2E5JA 4CIOA 2HHUA 2W2QP 2HS4A 4CM2A 3MEDA 5HATA 1NSKL 4K7QA 2MMYA 1B70B 5I42A 1RI7A 3SI8A 2D9OA 1FVSA 4N5SA 2ACYA 1HW8A 4P7TA 3JQJA 2HZAA 2HRUA 4EZ9A 1RTHA 2D3UA 1SL1A 1S1VB 4X4RA 1LV5A 5K14B 5L9NA 2UV8G 4I69A 2GV1A 2NYIA 1JK9B 1U6BA 1RABB 4GRSA 2H5IB 1H72C 3LANA 5KFFA 1I94J 3DXSX 2CA9A 4ZCIA 1U1QA 1RAHB 3CJ3A 1VHIA 2OJ3A 3HT3A 3M05A 3H59A 2R7XA 5EWGA 2AJ1A 2GZOA 3EWGA 2DR9A 1YI2S 3K2YA 1S97A 4MAKA 2D41A 2R7QA 5ETLA 3C8YA 4DSKA 1RWOB 3EPIA 3IXQA 4KGMA 2IDLA 3PCOB 1K9MT 2WB1D 2BW2A 1SQGA 1SBRA 4P71A 1L3TA 3W7BA 1TKXB 1MN9A 2LECA 1DARA 2MLYA 1VRTA 2AYGA 3GJRB 4DG1B 5KFTA 2IYGA 2J9EA 4P75A 1S1TA 1RWXB 2C2RA 3V6DA 4KT0C 3I0SA 1E6VB 4F4XA 3EJMA 5KT5A 4QQBA 3HVTB 3CD0A 1U02A 4X64F 3CDUA 1S1UA 2EWHA 4X84A 1BWVA 2AEMA 5HN0A 2YNFB 4ECRA 1FJ7A 4CT8A 2XNQA 2WZ1A 3IR7B 3CC4S 2DHGA 4OYPA 3KLHA 2V50A 2OEJA 1SB6A 2XG8A 1WEXA 2R2TA 1IVZA 2IM2A 3AOBA 1N34F 1S72S 2W2MP 4CNZA 4OI2A 5CH7B 2RMLA 4USHA 4EYHB 3KUGA 4ID8A 3BEGB 1KR4A 3MM8A 4LF6J 2HHTA 2CJAA 1SC1B 5L46A 1TKTA 3GPAA 4HR2A 1OSDA 1NKEA 1KVJA 2VC0A 4PXDA 1N6QB
chains in the Genus database with same CATH topology
4QR1A 5A0YB 3TUZC 3ULHA 2HW3A 5KG1A 1BLUA 3JAMY 3MUVP 3BF4A 1DJ0A 4X62F 3KK2A 1NB7A 4DV7F 3KLFB 3M9NB 1PSDA 2UUTA 4OV1A 4MK7A 2W9CA 5E0OA 1S7HA 2IBKA 2XEXA 1ZZNA 4ZPBA 1FD2A 1MROA 2VC1A 3V4IA 2PIIA 2B43A 2V2KA 1FEEA 3PEJA 4AUKA 3OTOF 2OPSA 1NEEA 3GIKA 2DPJA 4KQZA 1ZM4A 4AL6A 1RT2A 2HGLA 3HJFA 1XMOF 1CQNA 1IKWB 3G96A 3DOKA 2CQ4A 5K8MA 3F56A 1BC6A 2DB1A 4FPRA 3KLVA 3H40A 1BQXA 4YB1P 4QIWD 2XWXA 1F2GA 3M32B 1R43A 2J6UA 1X5SA 2WSCC 1UJ4A 5KFBA 2R7OA 3OTCA 3QMQA 1C1CA 4DQPA 2CPEA 3QAEA 4DV4F 2KVIA 2VFTA 2W4PA 2FLLA 2VBZA 3IR6B 4LSNA 3TVZA 2DRBA 3KHLA 2CJ9A 1G7CB 2MZRA 2IHR1 5KG4A 2UUAF 3NLCA 1QLNA 2CVIA 1RT5A 3N6LA 5H9EJ 1UA0A 3FRYA 4IUFA 1ZBTA 2XS2A 1HNZF 3G8TA 2RRNA 3I9ZA 2CQBA 4YQWA 3TR5A 4RUAA 1S1WA 2KM8C 4ELUA 4KJIA 3THPA 3LH2S 3O1LA 2BXJA 2E9ZA 5LJ5Y 2E1RA 1HD0A 1U1KA 4DV5F 2QFJA 2R8GA 2YKOA 4G1QA 3J80Y 3V81A 3OLBA 2NLWA 2FVSA 3B4MA 4I67A 4QU7A 2M7SA 3M8QA 4Y00A 3PX0A 2QV6A 3DLGB 1JKHA 3ITHA 2DGVA 2N7CA 2NQPA 3DRXA 1NK7A 3MEKA 3MM6A 4LFAF 2O01C 2DO4A 4N8OA 3JSMA 5F41A 4LF4F 4FNHA 4C8LA 3DU6A 5GAEU 5KFXA 4W90B 3AA9A 2JZ5A 1IUJA 1CC7A 3FQLA 1QUPA 1B0PA 1X4EA 4OZ1A 5I42B 3NMAA 2K2PA 4JI6F 1WHWA 2D9PA 1NRKA 1R8PA 5DJBA 2ZJPQ 4QJVA 3VAFA 2B9YA 2MKJA 2B9WA 3DU5A 1X4AA 1H2VZ 3PFEA 4OX8A 4RX6A 2QA4G 2KG0A 2HS0A 5KFQA 1DTQB 2FHOB 2OTLS 5IM0A 3W2VA 1RTHB 5T41A 3Q8QB 4KSEB 2MYFA 4Q2MA 5CZVA 4C98A 2RS2A 2K1RA 3D0HE 5FJ4A 3P49B 1FJ7A 3MECA 1VJWA 3MURP 3CPWR 2NPFA 3JTNA 1S0OA 3TX8A 1H2UX 1N32F 5LMNF 4C8YA 1FRHA 5F8GA 3M1VA 3PM9A 4R8UA 1HPZB 2V4RA 2L08A 1S6QA 1T02A 4KR0B 3TA1A 3LP0A 5JVHQ 3ZC4A 1REVA 3ISND 2WONB 4NA3A 2ZHAA 1FO1A 4NLVA 3S1TA 1JNZB 3DM2A 4YR0A 2QRRA 1B64A 2PEHA 2KT5A 2GIRA 3GFHA 2OPPA 3SCIE 4WFBQ 3RBDA 4IFVA 3RAQA 2C2EA 5K5MA 2PMZD 2F8MA 3EUNA 1S6PB 1JLFB 3CD6S 5J2QB 4TY8A 2BVZA 4FBTA 3C6UB 2J9CA 2FVRA 4Q7AA 3TAMA 3MAQA 4LFCF 3KK3A 5B0DA 2F7VA 2FIUA 2QLWA 3CJ5A 3OUYA 1T3NA 2HHHF 3PVXA 4N8NA 3DRRA 2HVHA 1N56A 4UQTA 3MCSA 3MMBA 3HKWA 4YB7A 1RJJA 4C3MA 1XC9A 4H4KC 2BZ2A 1TAUA 2Y0SD 4LQ9A 1QJHA 1RGVA 3IO1A 5IT0A 2GNKA 4URGA 5L38A 2W9BA 4EUVA 1L5UA 4LF7F 3CCZA 5H1SV 3LWLA 2I8EA 1YJVA 3ZZ0A 2A2DA 5GMKa 3ISNC 3HDSA 3Q8RB 4A8QA 5EWEA 4RUCA 4J5OA 2RQCA 3TUJC 4JI5F 1AW0A 3AAWB 4LF5F 1N5YB 1YGYA 4EGLA 1ZZFA 3N4WA 4FF1A 1VFJA 4DMZA 4ITSA 1S0VA 4X2BA 1HBUB 1HR0F 1G1XA 4YMEA 3HLUA 1RT6A 1S1XA 4F67A 3VZHA 4BHQA 5F8LA 4K5RA 2QE5A 2ERRA 3HPOA 4HI1A 4O3QA 2JWNA 3H2VE 3FGVA 3PJXA 2LEBA 4DJBA 5F8JA 2BR0A 2VKRA 5KFWA 1LOUA 3QZ7A 2V0NA 4OX7A 2MGZA 2JEFA 1UVMA 2XLJA 4PG8A 1K0VA 5J2NA 1KQKA 3F41A 3KYLA 2DHAA 5L1KA 2ZC3A 4MKYA 3VAMA 1TL4A 2DGXA 1HWLA 4ZVFA 3D0GE 2J0SD 4I7FB 4CO2A 2AGQA 1FTCA 4B08A 5J2MA 3PKYA 4ZLPA 3IRWP 1LXJA 3R5CA 4MYTA 2VASA 5CYQA 2MQOA 4LFBF 3ZZZA 2KZZA 2UU9F 4B3SF 4CNYA 4Y2KA 1VRTB 1S99A 3FMWA 4Q5VA 4ECSA 1ZH5A 1HBMB 5L1IA 3M6UA 2VFSA 4ID5B 4DQIA 3MR5A 2HFNA 1S1TB 4BC7A 1ZAVA 3MMAB 1UAWA 3DLHA 2CPZA 3MM5A 2FGOA 3V6DB 2JLEA 4KC5A 2MKKA 3ENWA 3MMCB 1QSLA 3OJSA 3QGIA 5BR8F 2YX7A 1VRUB 4OQJA 3K5PA 2OIHA 3HVAA 3I0SB 3M8RA 2JRSA 1L3KA 2KN4A 1WEYA 2ATLA 4DWIA 4TU9A 4WF9Q 2HNZA 4RW8B 2ZUGA 3KHRA 1M5KC 4F2SA 2OFGX 2BQUA 1HBNB 2XMWA 3N0VA 4HLBA 3OJUA 4KO0B 2VFUA 4IH5A 1ZPWX 2LVWA 4ECXA 1FDBA 3K5NA 3PRDA 5HLFB 3OFEA 2PT0A 1YTYA 1X7VA 3A1YG 3FRZA 3D1QA 3E01B 1Z1ZA 1HWUA 4H4OB 2UXBF 3DMJA 1KD1T 3GG0A 4PWDB 1I94F 1GT8A 3LAKA 3IFEA 1ZTTA 4X65F 4LT6A 4X4NA 4A8XA 2MDAA 4WZMA 2CPXA 2JLGA 1F5BA 3SSQA 3OTBA 2DITA 2AF6A 1NHVA 3T5JA 4R0EA 3KLHB 1IN0A 2KRBA 1K8AT 1WF1A 4IG0A 1BGXT 4JOUA 1NJYA 4RKUC 4DL4A 3T19A 1NKCA 1Q8LA 1KRPA 4K0KF 4B02A 2K7JA 4MFBA 4QYZJ 2AW0A 3PW2A 1Q8BA 1KLMA 2J0WA 1XBWA 2LDYA 3SCJE 1TK0A 3O2IA 1VOMA 2Z2MA 4IG3A 4OI3A 4B3OA 3CMES 1VQPS 4K4VA 3T9NA 1GTEA 4DF8A 4QCLA 5F9LA 2BYCA 5FDLB 2XI2A 1FJGF 3GIIA 3K8WA 4Q8FA 4QIGA 2F3JA 2XY6A 1UKUA 4K4TA 2M70A 3QGHA 4OHYA 1JMTA 2IJFA 2JX2A 4RZRA 2ABYA 1N0VC 4C8ZA 3MM8B 2VPXB 5DDRC 3GV8B 3DHXA 5AJ3F 3EZUA 5CYMA 2NR0A 4RNMA 1T7PA 3AHPA 1HMVA 1PILA 2V5HG 2XB2D 2FUG9 5IQQA 4JV0A 3BQ2A 1TVRB 2CQHA 1YJTA 2DPIA 4ED1A 2WSFC 1XR7A 2IBOA 1IXKA 4DHVA 1TKTB 2R2UA 4NLSA 2CQ2A 4JI3F 1FNXH 1YRXA 5KFVA 5I3UA 1C0TA 2E5HA 2AU0A 2YH1A 1VS3A 1UA1A 1JB0C 4J9LA 2DGUA 2OPQB 1GNKA 3GG1A 2KO1A 3KK1B 4PUOA 1JLAA 2EK1A 1F5CA 3KFWX 1U1MA 2XZWA 4KHRA 2KU7A 4ZA1A 4DN9A 1OPIA 4ZPWR 2D74B 1M5SA 3H8YA 3MTKA 3CJKA 4QYRA 3NG8A 4U6PA 3EGNA 1QAYA 2DR8A 3GFZA 3FQKA 4UUXA 1WHVA 2BACA 3KK2B 3CCSS 1VC6A 4MMOA 2RE1A 2W9CB 5DGAA 4C8NA 3VF0B 1XWLA 2FJEB 3NP5A 1URNA 1MROB 3V4IB 3H25A 3OXLA 2OPSB 2HQIA 4AYBD 2ZE2A 4GMKA 3QJJA 1U2FA 4NZ6A 4CO1A 1RT2B 7FDRA 1RAJA 1VQMS 1FERA 4M1KA 1Q79A 1Q7YT 4CO3A 3DOKB 2DNKA 2NSCA 3M2VA 4TYBA 4A8WA 2BBEA 2MB0B 1RT3A 1VQ4S 3EYZA 4L3NA 2M52A 4JYAF 1IQTA 1Y7PA 1C1CB 2DNLA 4A8OA 2MJUA 2V9KA 4Y28C 3SV3A 2MZJA 3PFOA 4MIBA 2IRUA 4LSNB 4C97A 1TKDA 3K5LA 2DRAA 2V8DA 2G4BA 3GILA 1OQ3A 1HI1A 4TU7A 1RT5B 3KLGA 2LQ9A 3N9UC 1TV6A 3NMRA 3OTEA 2CYYA 4IFYA 3Q2SC 1XR6A 3I87A 1MW7A 1R8HA 1P8GA 1CSJA 2ROEA 4NRUA 6FD1A 3NBPA 5KOXA 4DFMA 2ROPA 1S1WB 2E5IA 4LIWA 4ZK7M 4NLDA 1SJ4P 1RTJA 3NCQA 3V81B 4A4JA 1QSYA 3M8QB 2ZDPA 5KG6A 3OXFA 5HMZA 1JKHB 3ITHB 4DPOA 2BQ3A 1MMDA 4Y2CA 4A47A 3MM6B 1XNRF 3JSMB 2HNDA 3LGNA 4JI0F 2BUNA 4U7UK 5CA5A 3UPFA 4DL7A 2Q3PA 2HHWA 1WHXA 5HBMA 1RYSA 3P5TL 4LVNP 1OSCA 2FGCA 3H98A 3KLEA 2QMXA 3EXCX 4CO0A 1LWEA 5KG2A 1PGZA 2VONA 4CTAA 2VKZG 3T5KA 3IA0A 3THVA 4WFZA 1S79A 1XTZA 1S6UA 2ZH9A 1U25A 2XHWA 3SCKE 1YWXA 1KC8T 3TAPA 1HWJA 1OO0B 1AROP 2MQLA 3CTRA 3C3LA 2R7UA 3KWMA 3W2VB 1LWCA 3D5MA 3RB4A 1IBLF 4DR7F 2XMMA 1B7FA 4LF6F 4ZCKA 3BJYA 2QA1A 5U47A 2POKA 2K1RB 2AV5A 2N3LA 3BGRA 3MECB 4K59A 3PO5A 1DURA 1NH8A 2N7YA 3U1MA 1U1NA 4BWJA 2YQ3A 2Q6CA 2CPDA 2OLWA 2YVSA 3HMJG 1I6JA 3IAM9 4OHWA 1Y5IB 1N5QA 1PC5A 2B6AA 4PR6A 2DIUA 4R8UB 3S8SA 1S6QB 3LP0B 1QSSA 2R9LA 1REVB 5LXYA 4ZPTR 1L3VA 1H38A 2HAIA 2WBRA 2DVIA 3FZ2A 1IKXA 2HWHA 3SEOA 4KTQA 2HHPA 3DM2B 4R0JA 2B4UA 2E29A 1N5VA 1YRTA 2OPPB 4Y2AA 3OVBA 2P6TA 4NRTA 3WZ0A 3FEYB 3U7JA 1XMQF 4W92B 5AE1A 1S9EA 4R25A 2C3YA 4ALZA 3PW5A 1SIZA 2DT9A 4TY8B 2XBPA 3WX4A 4IOCQ 3OHBA 3SV4A 3OR1A 2DNPA 3TAMB 2FDNA 2K3IA 1GTHA 2MQQA 3KK3B 3OUYB 1NK5A 1YJNS 3KHHA 3PX6A 1FKAF 3DRRB 5CHCB 4QWEA 4K4SA 3V4MA 2QEXS 2HHXA 1WI8A 1R27B 3B4DA 4QR2A 1GH8A 2IRYA 4N41A 2LKZA 4EO6A 2W9BB 3L3CA 3TA0A 2CZ4A 1Q53A 3IAS9 4RW6A 4I6YA 1LFPA 2CRLA 3CGIA 2C22A 2DHXA 1T03A 5LMUF 5J1EA 3G86A 2WB4A 3DYAA 4EWTA 1ZETA 2GGPA 3NAHA 1VQ9S 4R5PA 2KJVA 3GE9A 4ED7A 2DISA 4F26A 2XI3A 3J7YU 1RT6B 1TK8A 3KNAA 2ZC4A 3WC0A 1XERA 4YB5A 2FHJD 3N6MA 1VMBA 3BSNA 1U1PA 3CDAA 2L9WA 3RU0A 3GSDA 4URSA 2ZITA 3OL6A 4IH7A 5CXTA 3W3SA 2M0GB 3NCPA 4OZ0A 1M5PC 2MGZB 1Z2ZA 3DRSB 5J2NB 4AL5A 3DLEB 3CJ2A 4FVMA 4WFAQ 3MOZA 1TQLA 2MY7A 5GADI 4PCQA 2XMTA 1C0UA 1T8EA 3IRXA 4DQRA 3IGVA 4TYAA 2G9OA 2PC6A 2XGPA 3KTQA 5F0UA 1DAXA 3Q24A 4OI4A 5EHHA 3CCVS 1XNQF 4JI7F 2GCFA 3VAKA 2ZJRQ 4ED0A 4I64A 2GMJA 3PY8A 1TL3A 4TU8A 4NWBA 2ZH4A 3ICLA 2MXYA 4I1TA 4WE1A 3VQSA 5C42A 3K57A 3MM5B 4RW9A 4XDCA 1KHVA 2RJZA 2KJWA 1T3OA 4IRDA 4WU3A 4DR6F 1HQUA 3TQ1A 4Z37A 2QMWA 2LU2A 2MJNA 2FLOA 5LXRA 2KG1A 1JLCA 1Q82T 2HNZB 2EVZA 1HA1A 3PW7A 2JHEA 3K59A 5B0CA 4HDHA 3QIDA 4K4ZA 2C3PA 2Q66A 2CPFA 1J5OA 3FJ2A 5D77A 4O23A 5DG9A 3RAMA 4ZVEA 2J76E 4NPOA 3HXMA 4I2PA 3RYLA 2FJAB 1ULRA 2YWHA 3DMJB 5EUHA 2CQCA 2CQGA 3MEEA 2PGCA 5GAGU 2L9NA 3I4HX 5KFDA 2BQRA 2IC3A 3N01A 2BANA 3DLKA 4F4ZA 1X0PA 2R2SA 5KAKA 1SJRA 1HNWF 3HI9A 2YH0A 2DBBA 1WI6A 3MM9A 3Q0AA 1YQHA 2KH9A 5DDPC 1NH7A 2O67A 3JB9k 5DQGA 2W4CA 3OPKA 2F40A 1HNIA 3O5TB 5AXLA 4OJHA 4RNOA 4RLEA 2ASYA 5E3CA 2F9JA 4MFBB 3MD1A 2Q6BA 1KLMB 4O3NA 3UCZP 4B3OB 1X8DA 2Y1JA 2XMVA 4IG3B 5J2PA 2VFRA 3DOLA 4QWDA <