1G3OA

Crystal structure of v19e mutant of ferredoxin i
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEECPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7FE FERREDOXIN I
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential
pubmed doi rcsb
molecule tags Electron transport
total genus 29
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g3oA00
1GTEA 3C8YA 2C42A 1KQGB 2PA8D 2VPYB 1FRKA 3OR1A 1FERA 1PC4A 2PDAA 4AYBD 3MMBB 4XDDA 1K0TA 1GTHA 2FJEB 5CHCB 1HFEL 1R27B 4OMFG 2C3UA 2WSFC 2C3YA 4DHVA 1FRHA 1JB0C 1F5CA 3MM5B 1SJ1A 1B0TA 3MM7B 2C3OA 3HKZD 1C4CA 4RKUC 1SIWB 1BQXA 2WSCC 2XSJA 3MMCA 1FXDA 1FTCA 2ZVSA 5BYQA 1GAOA 2C3PA 2FJAB 2C3MA 1FDDA 3MMAA 2VPXB 2PMZD 3MM6B 2O01C 1Y5IB 1FXRA 3OR2A 2GMHA 5BYSA 2V4JB 3MM8B 3IR6B 1F2GA 2V2KA 3MM9A 2WB1D 1Y5NB 1VJWA 5CH7B 1FD2A 3LW5C 1H7WA 1Q16B 3OR1B 4YDDB 2FDNA 1BLUA 1Y4ZB 1FRJA 1AXQA 4OV1A 2Z8QA 1G3OA 1RGVA 1XERA 1H0HB 2VPWB 2UZAA 3IR5B 1D3WA 1FRLA 4Y28C 6FDRA 2VPZB 1B0VA 1IQZA 1FDBA 1PC5A 4L6V3 1JNRB 1KQFB 5FD1A 3EUNA 7FD1A 1SIZA 5BYRA 4ID8A 1FF2A 2GMJA 1BD6A 1Y5LB 2FJBB 2FGOA 2WAQD 1BWEA 2XSJB 1IR0A 1FRMA 3MMCB 4XK8C 4KT0C 3IR7B 5L8RC 7FDRA 1FDAA 3MMBA 3MMAB 1FDNA 3OR2B 1C4AA 1H7XA 1WTFA 1B0PA 4CI0B 2FD2A 3MM9B 3EXYA 3GYXB 1F5BA 1BC6A 2IVFB 1KEKA 1DAXA 2Y0SD 3MM5A 3MM7A 3PNIA 5E7OB 1FRIA 1DURA 1A6LA 2VKRA 2WSEC 1G6BA 2FJDB 1JNZB 3EGWB 1CLFA 4XDCA 1DFDA 1FRXA 1H98A 6FD1A 3MM6A 1ROFA 1GT8A 1FEHA 2V4JA 1FCAA 3MM8A
chains in the Genus database with same CATH superfamily
5HVGA 3M2UA 1L3SA 4AUKA 3SXLA 4NLRA 3VGSA 4R5PA 2ZH6A 1M1HA 4WP3A 3RGIA 2HS4A 5KFHA 3K57A 2H5EA 1RI7A 4IR1A 1TL5A 2HVZA 3AD9C 4RUHA 2R2SA 2B8PA 2AW0A 4NWBA 1NH8A 2ALZA 3MM9A 3L95X 1FI4A 3R2DJ 2YKPA 1GMWA 2XYGB 2XC9A 1VBXA 1VRUB 5J2MB 4JI0F 2AGOA 1FO1A 2QLBB 4BHQA 3JTOA 1UVJA 1I3OB 3M30A 1XMQJ 1IR0A 2DGOA 1OPIA 1TVRB 1YJ9S 3ULHA 2WONA 3FQLA 2KKHA 3QRRA 3L4BC 1WSRA 2E1MC 1HQUA 3D28A 4DWIA 1HPZB 3DOLB 1HYSA 3CMQA 2VBWA 3CCQS 4BBYA 2WVEA 2AYGA 5IV4A 3MF5A 3Q24A 2MEWA 2JEGA 2A18A 1QTNB 4C11B 3TUPA 1F5CA 4MT1A 2Q43A 3HKZD 4U8VA 1JLEB 4IG0B 5CD4H 2PC6A 5HATA 4JV5J 4QU7A 1PGZA 3CJ3A 2J7WA 1UAWA 3TA1A 2OI2A 1YTYA 4H4MA 2NCKL 3SYZA 2BW7A 1TK0A 4DR5F 1RISA 2F4FA 4HTJA 4QWBA 2R4FA 4U8YA 2V8GA 4Y28C 1KBRA 1WORA 3HHLA 3IRXB 3HVTB 4B9TA 3MOJB 5JUMA 5EDWA 4X2BA 3UD3P 3KKFA 4KPCA 4KGZB 3MR6A 1Y9OA 2C22A 2AJ1A 1S4EA 2AHOB 4H4KC 2CQ1A 2DB1A 1URRA 3I5BA 1FJCA 2B56A 4KHPF 5JVHQ 5LJ3Y 1MMNA 5M2UA 4A4JA 5KFXA 1PC4A 3I4PA 1D0EA 1HI1A 4USUA 2UUAJ 4XIUA 4IH5A 2AD9A 4WF9Q 1C4CA 4LRCA 1WC3A 1WC6A 4P71A 3H42A 4M5HA 2HS0A 2EG1A 3H40A 1KQKA 4AXJA 5F0WA 1JKHA 5D15A 3U02A 4YDDB 4B3SJ 2GO9A 3CULA 4OV6A 3W60A 1XIQA 4DPOA 4WXWA 1PG5B 2GFFA 5BXIA 1D3WA 4DX7A 2LLZA 6FDRA 1HWUA 2CZ9A 2ROGA 4WU3A 2HWHA 3HFVA 3KHLA 5LOQA 3V6JA 5MAOA 3M8QB 3DRSA 2ZBQA 3FEYB 1UETA 3CJ4A 3ZC4A 2ATLA 1S79A 1I5OB 4ZVHA 3NS7B 3OFHA 4DV1J 1KFSA 1K47A 2FVRA 3WC2A 1N33J 2UXCJ 1KVIA 1UPMB 2ZJQQ 4OYPA 3ADAC 2UVVA 2NXUA 4JI3J 2P9EA 3HZEA 2GO8A 4ECTA 3G9CA 5CHCB 3D0HE 4QPXA 4OX8A 4QYZJ 3KOAA 3DI6A 4M5GA 2PO4A 4LSNA 4P6QA 3VV2B 2C3MA 4ELUA 5HQLA 5BYSA 2LXFA 5EN1A 1U1OA 3SQGA 1LQ9A 3JQKA 2JEFA 1V6HA 1R0CB 2CQPA 3RU0A 1YHQS 1B0VA 2XMJA 1JNRB 4DI6A 4KGXB 4HH1A 8ATCB 2HKEA 2XNRA 4OZ3A 3PZPA 2DK2A 2V9KA 5L8RC 1R6VA 5C42A 5KFSA 3A3NB 5KFUA 1EP4B 4DX8H 1KKHA 5IOLA 1ITPA 3QMQA 3MM8A 5AXKA 3OUYA 5J2NA 3E2EA 4KB7A 3CEDA 4PQUB 2IM2A 1IKXA 1MROB 1VRQC 1YG0A 3FEXB 1PO6A 3W8GA 4K4VA 5D0EA 1LEOA 4LF1A 1WG4A 5HMYA 3NCPA 3O5TB 1SJ4P 1EETA 1TV6B 1GAOA 2C3PA 2ZEJA 2VPXB 1F0XA 4N8OA 4QIGA 3UR0A 3TJ9A 1BQMA 5F3ZA 1FNXH 1UP1A 2UZAA 2WVFA 4ZLLA 2YH0A 2D3O1 3C6TA 1WHWA 5SUHA 2LECA 3RB3A 2MQOA 2RDDA 3V81B 1S9FA 3U1MA 4HLBA 1XNRJ 2MHNA 5HVFA 2CQIA 4IOBA 4K50A 1YSJA 2DXDA 4M5KA 4KV8B 4LBPA 1T0TV 4M5MA 4ZKAA 5EWGA 4HACA 3UNYA 4ZPBA 2FY1A 4I68A 2NSBA 3GILA 1CC8A 4F4YA 4LJMA 1H74A 2VASA 3RYLA 1C0UA 5D0HA 2MQNA 1L5UA 3ELHA 3KDNA 3DGPB 1U2CA 3DLGA 4HTIA 3RB4A 3HFZB 3LTOA 4CQ1A 1IM6A 4U7CA 1Q78A 2GVDA 4F0MA 2HIYA 4DUZF 4KAIA 3JAMY 3O2IA 1RCXB 2W7AA 2HRYA 4OV1A 3TOQA 2W7PA 1RHMB 4WBFA 2R2UA 5E0OA 4F02A 1WEZA 2E5IA 2YKOA 3MMCB 4QIVA 4F3OA 1ZA2B 3KLFB 3WZ0A 3ENQA 3OL8A 4LUBA 1EX8A 1QE1B 4LIWA 1D9FA 4MAKA 3V4IB 1N6QB 4HR2A 1KONA 4EZ9A 1LW0B 4TN2A 4L75A 3T9NA 3DM2B 2P5VA 4NCGA 2MKYA 1VC0A 1CC7A 3DDIA 3ZFVA 4RNNA 3D3BJ 4ZVGA 3ENVA 2X1AA 2V8DA 2ZE2B 3CO9A 3PEJA 1DARA 1REGX 3RG6A 2ZM6J 5IFMA 2XSJA 3M2VB 2Z2YB 3G82A 5HVHA 3J7AN 3BQ1A 4F0KA 3CCES 2QA4G 4UY85 3GYGA 2G0IA 2DITA 4IRKA 3LW5C 2CAJA 1Q16B 3E51A 1TFWA 3R2CJ 3W2VA 2BA9A 3DYAA 4C7QA 4KRWA 2WBMA 5E3PA 4KT0C 2UUTA 2HHPA 1FDAA 4ZVUB 1VYAA 2ZH9A 3CCVS 1VQKS 4WFXA 2DNQA 4M5DA 4X62J 4FDFA 2MLZA 1VQMS 1RWXB 4A8FA 2XZTB 1HNWF 2Q6BA 5KAKA 3PDNA 3ISNC 4QIWD 4USIA 5JMNA 2VOOA 2BJ8A 1EQ0A 4PWDA 2DHHA 1P1LA 4F67A 3CCJS 4Y0FA 4NASA 4DL4A 2DGTA 4V19X 4E8UA 3M6XA 2FVPA 1KD1T 1EJ7L 2UUBF 2XI2A 4OLOA 3DRPA 5T7LA 3P49B 2FUG9 1U26A 5T41A 4NRUA 2DGQA 3W62A 1SPBP 4YB6A 5KT4A 2V4JB 3K5NA 3K8WA 4AT1B 1UTAA 3CJ2A 3BYPA 2W4CA 5IQQA 1S10A 1VIXA 5AXMA 2VFVA 1WC4A 4O4RA 1M1KT 2IJNA 3I4HX 3ONQA 3DHWC 2B3TB 4B9SA 2GX8A 3A13A 5GVQA 2UXDJ 4DBQA 4PXDA 3C16A 3EGZA 4JOUA 4EBDA 2MQ8A 4C6AA 5DM7Q 1V9OA 3K5OA 5B0FA 4U95A 2VG6B 3AQPA 3KG1A 2P8IA 3EPGA 2JLEA 1O8BA 4R0EA 2VKRA 2YQ1A 4X64J 4A8SA 1R0AB 1JIHA 2LFVA 2IC3A 2DR8A 1RDRA 3BF4A 2C42A 4DPTA 1SV5B 3ET6B 3OR1A 3MR5A 4Q44A 1AUSL 1RT3B 2LQJA 1S9GB 4NX9A 3TJ8A 4FVCA 3ZTSA 1SIWB 2GZOA 2KJVA 4RJVA 1M1GA 4EBCA 3LAMA 1KDNA 2RU3A 5GMEA 2E29A 5ETVA 2VQFF 4B9UA 3HLUA 4Q8FA 3I96A 5B0AA 4ERDA 3MEGB 4EZ6A 4UZBA 4O3PA 2M0GB 1FX2A 3PO4A 1YK9A 3EVOA 4C8NA 1JWWA 1G3OA 1U1RA 4RLEA 5KG5A 2XWYA 1N48A 1VK8A 3ZZPA 9ATCB 2KHDA 3O8WA 3DLEA 3O3LA 4LRAA 1RAJA 3EMTA 4N77A 2DR7A 3PACA 3KK1B 4DSIA 3HF5A 5B0GA 1YRUA 3GR0A 1DURA 4MIAA 1CQNA 1VRUA 5J2MA 1HBUB 1OY8A 1Q7YT 1CVJA 3JYTB 2M52A 3UN2A 4B9MA 3C6UB 2VPYB 3NCQA 3P4UB 5CYMA 2ATCB 3GYNA 3NWGA 1KN6A 4W90B 4WFYA 4DR2F 1FFGB 3CD5A 5KT2A 3Q89A 4Y2IA 1OPZA 3IC1A 2YVSA 1U6ZA 1AB8A 1FXRA 1PILA 3C14A 4DV0J 1IBLJ 3M05A 1UFKA 5HK4A 4IH7A 2CWXA 2RSQA 1QSYA 3WX4A 3ICLA 3NGUA 5KG3A 3M2RB 4EO6A 4IG3A 2IYIA 3H0PA 1LW2A 2M70A 3W3SA 1HBMA 1NKCA 3MEEB 4JI2F 1B0PA 3BBCA 3IBFB 1KEKA 2B4PA 4IRDA 4KHMA 3OFGA 2KG1A 3BREA 5IZHA 2RRAA 4U6PA 3L7UA 5F8IA 3CDEA 2Y9HA 3QIPB 4F04B 4OHWA 5IC4B 1U25A 4UOFA 4AYBD 2JEIA 1ICEB 4HHUA 3PIOQ 1WG5A 3GG0A 1X4HA 2RRNA 3GWCA 2WVDA 3MWBA 2GGPB 1X5TA 2QL5B 3M6UA 1REVB 2OKQA 5CH7B 2HHXA 2XM3A 1RHQB 2BE2A 4JV2A 5E33A 4FF1A 4K7QA 2FZKB 4TU7A 4U9RA 3L3CA 1J5EF 3IR5B 3M9OB 2QEXS 2ABYA 4J9QA 3P96A 3HO1A 1ZBTA 3EUNA 3CC4S 5IV3A 2PEBA 1NKBA 5BR8F 1N36F 5D0GA 4F8RA 3DLKB 1WELA 4RU9A 2RD5C 3D7SB 3NMRA 2HHVA 2GHVC 5I42A 1SKRA 4LF5J 2HNDB 1HKAA 3E3XA 3DU6A 3KG0A 5B09A 5DQIA 3MAAB 2HFOA 5A2QU 3OTEA 1F5AA 1IBCB 1RU2A 2CJXB 1DTQB 1O5JA 1WI8A 2XNQA 2MY7A 4A48A 1FTCA 2ZJPQ 1NSPA 2FJAB 4DSLA 5DQGA 5DDRC 2R7VA 3D3CJ 3KNAA 2MKHA 2IAJA 2F9JA 2N7CA 1FJGF 1Q79A 2LQBA 3OFEA 2CQGA 2PEHA 2CFXA 1UCNA 1S48A 3W65A 2A1BA 3GJTB 3I87A 3KWMA 4ED6A 4LVNP 1UJ5A 4ID8A 2YKNA 3KLIB 2HFZA 4BDPA 4WKRA 1RWWB 2AZ1A 3DOKB 2E9TA 2MZJA 1N32J 4DR1F 4I6YA 2KZMA 3LP1B 4RW7A 3BPSP 3M8PA 3WBZA 2V0NA 4C9DA 2GJFA 1OQ6A 1K8AT 1P6TA 3R27A 1X4AA 3OFFA 4NXNJ 3QAEA 4QIFA 3DNCA 1Q5YA 1GT8A 1JXEA 4DUYJ 3QNWB 2FHOB 1KQGB 1R8HA 1UA0A 4NYOA 5B0DA 3BSOA 3P45B 2VDHA 3KHGA 3MEDB 1PJ6A 5C24A 3TEHB 1SJ1A 3H5YA 1WD6A 4EWTA 3GFZA 5GAEU 1L3UA 4NI2A 2VH7A 4WJBA 4JI7J 3W5XA 2XS7A 4QR1A 3QJPA 4X4PA 2RKIB 2KN4A 3SIPB 2BOPA 1S9EB 4YY3F 5I3UB 3BB5A 4OI0A 4BC9A 4P7TA 5CYQB 2DRAA 4DPUA 1TKXA 1MU2A 1WDTA 1NB2A 3DKDA 1U1LA 1BWEA 1VQYA 3H5UA 3MMAB 3PIPQ 3PX4A 4GKJJ 2R7XA 2KXHA 1XQIA 2FJVA 2FC8A 2E44A 2UVUA 4WPAA 4NLGA 3MZIA 2A2DA 4Q0BA 4OI3A 4YR2A 3GB0A 2PD1A 2DNRA 1YBUA 3EZUA 1Q53A 4NLQA 1T03B 4LR9A 4RNFA 1RAEB 5A8RA 2ZHBA 1J2VA 4FKXA 4N56A 5J2QB 5L9NA 1XMBA 3CMES 1LOUA 2C3YA 4HL9A 1B0TA 1E6VA 4LFAJ 3MUTP 1RT5B 4P72A 1NJIT 3J7Z5 1DHMA 3RB6A 5CD4A 5J1EB 2W8KA 5CXTA 3QQCD 3D67A 1RBLA 3KLHB 4ED0A 2MKCA 1X9MA 2ZBIA 3OVAA 1NDCA 4ZK7M 1KTQA 4OI1A 1QAYA 2V2ZA 1ZETA 1AFIA 3CO0P 1SB6A 1DAXA 3H90A 2HQDA 2MZRA 4Q43A 4LVOP 3T5KA 2YWHA 2DH9A 3AJ1A 2UVRA 1WEYA 5HLFB 5ETQA 2XWXA 4JI0J 2FJXA 2WK4A 3T1HJ 1CS4A 5HL7Q 1OQ3A 5F8HA 5U47A 1Q0NA 5CQGA 4X4QA 3OV7A 1NPKA 3D68A 3ZTPA 1Y7PA 2DNPA 2IHR1 3K2YA 4TYAA 3GFXA 3R6GB 3CCLS 4IOCQ 1XNQF 5JXSA 3HHLC 2KRRA 1HQ2A 5CA5A 3W61A 5HJXA 3TW0A 2QMUB 3FUYA 3TYTA 1QUPA 1Q1KA 1FK9B 1T11A 2H9ZA 2LDYA 1PYSB 4WFZA 3ITHB 2K8GA 1TL1B 2ZOFA 5HQ8A 3PYGA 1HMVA 2QV6A 3QZ8A 2ZKTA 3R1HA 2YX4A 3VVTA 3THTA 4ZP7A 3A8KA 1DTTA 4U96A 2X1FA 1VQSA 3UQSA 3BGOP 2KG0A 4NPOA 1NO8A 1T7PA 1XJWB 1U1KA 4KQZA 4DR5J 1S4FA 1VFJA 1GQEA 1LKZA 3PX0A 2OAUA 4ZJLA 1T9VA 3VAKA 1MLAA 3A8EA 3OHAA 3D6TB 4ZHRA 1TMJA 1IKVB 4U67Q 3DLLQ 4ZLJA 3KK2B 2GNKA 1NJXA 1Z2ZA 3WIVA 3MECA 2AJQA 1N5YB 4NLSA 3TAMA 5KOWA 4MFBB 2W1BA 3PRVA 4P2FA 5H1SV 2HMIB 1ZAXA 2BKPA 1B70B 2QA4S 1R6YA 1RAIB 2EFNA 4ILMA 2NS1B 4I2PB 2Z57B 4DX5A 2HHQA 2CJAA 2OO4A 2MXYA 5LL6d 4I6AA 3U1NA 1HWJA 2YNGB 2F65A 1FTRA 4ZMMA 4R8UA 3FRYA 4K4TA 3SCKE 1FVQA 2NQPA 2VHGA 1JLBB 3S8SA 2CQDA 4J9OA 1B3TA 1RHRB 2FLPA 2IVFB 4ELTA 1JJ2R 1U0SA 1SL2A 2JHEA 3GONA 2M88A 4DV6F 5C25A 2XYHB 2QA1A 2IY5B 1S7IA 4H4KA 2R2TA 1RYSA 2YNIB 1DQ8A 3RZAA 5F8GA 4EFAC 1RWNB 2Y3YA 3LGHA 4BC7A 2XSFA 1P8GA 2PA8D 3T6BA 1YITS 3E01B 1GTHA 1RYRA 2R7OA 1ZM4A 1HHTP 2HNZA 4PPDA 4RUCA 1U6FA 4LFCF 4JI3F 2MHEA 3C46A 1RBAA 1RUSA 3VWSA 1UWBB 1M5KC 2NUUG 4P75A 4H4OB 2SXLA 5K14A 3BGLA 3KJVA 5GMKa 2I5JA 1YWXA 3EM1A 3DOMB 4G6VB 1VRTB 1PC5A 2QC3A 4FBTA 2VFTA 4C0BA 4P74A 3M32B 3RRKA 4DQQA 3QAUA 5AT1B 4L3NA 3UCZP 4F36A 1FNOA 3PW5A 4DOZA 4KO0A 5K8OA 3G8SA 4OL8A 2K3IA 3R5GA 4KKOB 3JAMU 4CI0B 2GV1A 2QX0A 2DVIA 1Z4UA 4TY8A 3HULA 3CDWA 5C2CA 2DY9A 1X0FA 1BXNA 3ILIA 4UT4A 4ITSA 4YB7A 1N52B 2BKOA 4JI1J 1HQEB 1FERA 2B6AA 3IG1B 1D8YA 4F3QA 3LP2B 2CNLB 1IKWA 4K4WA 4GO7X 3PW0A 3QJLA 4OFZA 3CXCR 1RAHB 1N0VC 3HSZA 5HO4A 3NAIA 3MPUB 2VJUA 3VZHA 4MYUA 1YQHA 1FD2A 3HVRA 5AJ3J 1YJVA 1JXLA 2KVIA 5ETMA 3KXDA 2PI4A 3LWLA 2W8LA 1TAUA 2FTRA 2Z58B 4FPIA 4F7VA 2JJ4D 3FMBA 1VBZA 2ZC3A 1S1VA 2CQ0A 1H7XA 2BABA 1DQAA 4C48A 2RT3A 2P9GA 3MCNA 1RLDA 2QYGA 1KS2A 4RO0A 1SKWA 1XNRF 3GSIA 1J27A 1L3TA 2HHWA 5KFKA 2CJBA 4ED5A 3SBMA 4GVBA 1Q4RA 2XO7A 1BGXT 1U48A 2JVOA 5AE3A 3CJ0A 1IJEB 2E1AA 4PEOA 1U0HA 2WZ1A 3H59A 2GAGC 3G6YA 2RHSB 4MYTA 1FD8A 4K2XA 3M2UB 2RU9A 3AA9A 4EBEA 1VQ5S 1R8BA 3NGRA 4F50A 2OUGA 3QATA 4R5PB 2D7SA 2H3EB 3AJ2A 2J0XA 3Q8YA 3GPAA 4FBUA 1SJFA 1UJ4A 1HW9A 5KFRA 4JP8A 1O51A 2E7WA 2FGOA 3H2VE 4AD6A 2HAIA 3GIIA 1NSAA 3VQTA 3JSRA 2HHTA 2GMLA 2DHSA 2WB4A 3MM9B 3QT7A 2KHCA 2MZQA 1X9SA 4WTOB 3P8BB 2F4VJ 3WQPA 4DUZJ 3IGNA 2EPIA 4N41A 1OWXA 4DQSA 3K89A 2XI3A 3M9NB 4PXEA 3R5BA 5LMNJ 1ZAWA 2E5JA 4A8KA 2UUCJ 3AA8A 1TKDA 2WONB 2R7SA 3K59A 4Y00A 1RZMA 2UP1A 1HR0J 4G65A 1HQUB 3H4DA 1Q86T 2K1RA 1HYSB 2KYXA 1HWLA 4DFPA 1DLOA 1W7WA 2D3UA 1EARA 5G4DA 3ZZYA 1Q95G 2QTWA 2EFOA 4LBHA 3Q0AA 5CZXA 4DQPA 2UV8A 1FKAF 2CZVC 3CE8A 5CCLA 1SIZA 1GXUA 3UO0A 4YHHF 3HZGA 1AZSA 1LWEA 2Z30B 5HROA 4ZCMA 3HM9A 1Q82T 4H4MB 1F3VA 4PZVA 2GAHC 5E7OB 5KFGA 1NB7A 1OY6A 2EXUA 2MGZA 1PBAA 1W2IA 2DH7A 3D54A 4QWAA 1R8CA 3HHLB 1UW9A 3M1VA 1FVSA 2OPRB 2R2RA 4WYWA 2IYGA 1FRHA 3CWJA 3K17A 4TLQA 2GQ2A 3BH7B 4CLPA 4B9NA 4J90A 4XTTA 4QR2A 2NXJA 2AF6A 5B7WA 3SDEA 5E3RA 3D1QA 4C3LA 1S57A 4NEYA 3TVZA 2J8SA 2EWHA 1R43A 1S1UA 4OHYA 2E9RX 2L9NA 4XPCA 3TQEA 3MMBA 1WKLA 2L9WA 2RKIA 4A8OA 2ZD1A 3QT5A 1M0SA 4KPYA 1JKHB 2V68A 4LREA 2O67A 4DZ6A 3J7YI 2VKZG 1RWPB 2FB0A 2E7VA 4W98A 2U2FA 3TUIC 2BJDA 3FSIA 2FHKA 3DRSB 4X64F 1N56A 3T19A 1GX5A 5F9NA 3F44A 2DNHA 3X1LB 2R8KA 1U09A 2YNHA 4HI1A 1U7LA 4KFBA 3C15B 1CEZA 3QT8A 5FLXY 3VAHA 1FKOA 1F6TA 1B4SA 2RF2A 4YMEA 1ZM9A 5FIIA 4WP9A 2W9BA 4ZVOB 1XK8A 4FXWA 2WW4A 1S0NA 2Z8QA 3KJNB 1NM2A 2ZH1A 3Q8QB 2HQIA 2C2RA 5EUHA 3DI6B 5HQMA 4WU2A 4LSNB 3CMAS 2HBYB 2E1PA 2LEAA 3TZZA 1A9NB 3BYRA 5IM0A 3SQGB 1YIJS 4QIEA 2BOAA 3CCMS 3W9JA 4AXIA 2VQFJ 3Q8RB 5DDPC 1OY9A 2AP6A 2IVMA 2V63A 2C2DA 4XAKA 2OSRA 4LSLA 2JWNA 3PV8A 3GCWP 2NYHA 8AT1B 4QYZK 5C42B 1P9YA 1RLCL 3GG1A 3SV4A 3VAFA 3KDOA 1DY3A 3KJFB 1TKTA 1JLAA 2KH9A 5CYJA 4OX9J 1KVKA 2WSCC 3PHEA 1WNEA 3UDEA 2VC1A 1RTDA 3MM8B 3OUYB 2LQ9A 5GAHI 5J2NB 2UU9F 2KM8C 1RHKB 1K0VA 4QOTA 1IKXB 4G1PA 2VD3A 1R3NA 1F60B 1FRLA 3MI7X 1HD0A 5ETLA 4DV0F 1EETB 1IBLF 2QN6B 1NXIA 2P2CB 5F41A 3CJ5A 4K4XA 3NGKA 4IQMA 3HJFA 1BQMB 1HNZF 2MSTA 2BUNA 1RCOB 5GAEI 3C6TB 3Q22A 3OL7A 5KFDA 2AGPA 5C5JA 2J6UA 2BRKA 1T9WA 3SMZA 1OSCA 1NHKL 1R31A 3M6VA 3OL9A 1RAGB 4JI2J 4HACB 2OHDA 2AU0A 3NNCA 2GC8A 1WHVA 4YB5A 2WW8A 2CA9A 2DIVA 4DR7F 2C2NA 4WIQA 2RQ4A 1C0UB 1F2HA 5ITHA 2PIIA 3OXLA 4ZCLA 2HFNA 2DO4A 4PUOA 3RAQA 4CO5A 4F4XA 3TNVA 4RU2A 2QRRA 1WEXA 1OYDA 3M8ZA 4MKAA 2KXFA 4B9LA 3DLGB 1BD6A 3EWGA 3PR4A 4B17A 3TUJC 4JI6F 2V94A 4EYHB 2CXEA 2GVDB 1ZS6A 1X5PA 2AJ4A 1U8WA 2VF3A 2W4DA 3MM5A 4ZIWA 2KTQA 3IWXA 1J5OA 3HSDA 3MD3A 2K2PA 1FJ7A 3W2WA 4OHVA 3PTWA 1ZPVA 1ULRA 1RT2A 3MR7A 3V2UC 4J9LA 1J5EJ 2XLKA 5E2QA 4PABA 5EWFA 3I6PA 4IFYA 2PI5A 2IM3A 3LANA 2BM0A 3QGIA 4RR5A 4LF5F 2R3VA 1RAFB 1CULA 1N36J 2G13A 4OHZA 3TZYA 3S01A 1SXLA 2BW2A 3KK3A 4NCGB 3N79A 2A2CA 1XMOJ 4C3MA 2OD6A 2MYFA 1EIYB 3QSYB 4DL2A 3GTYX 4ZVRB 2LYVA 1LXJA 4URQU 2V8VA 3LGNA 1NH7A 2DJWA 1XR7A 5EWEA 1MWZA 4KJIA 1FWKA 3ZXWA 4NLYA 1T95A 2XSJB 4ECSA 2XY6A 3G82B 2JFDA 3QGHA 5EX0A 5A0YA 1KP6A 4I67A 4CO0A 5L38A 3R8YA 1RKIA 3Q23A 3CW2C 4DR3J 3HT3A 1K9MT 3W2VB 5B0EA 3DOMA 1FRXA 2CYYA 2AYEA 3DYAB 4RX6A 1Y3JA 3M32A 1N32F 2ZUAA 4FKYA 4ZCKA 2DYAA 4CO3A 2CPEA 3PG9A 2W24A 1NK0A 4OHXA 4NXNF 3CT9A 1CJVA 4M5DB 2IBKA 3LGMA 4RKUC 1KFDA 4RW8A 2CPHA 4DR1J 2W2NP 2X51A 4ANDA 3LPEA 3D66A 2MQMA 2RRBA 4M94A 3IFEA 4ECQA 3ENWA 3GIJA 3DXBA 1TR0A 4PWDB 5DJBA 4CLLA 3D5MA 2QSFA 1S97A 5KG1A 2IRYA 4QWEA 4ICLA 1UZDA 2IM0A 2CZ4A 3K0JA 1VHIA 1UW4A 3R5JB 4HYKA 1KQFB 1FT8A 3DRPB 5T7LB 1N34F 1T3OA 5K5MA 3V6DA 4CM2A 4WKYA 2VDIA 1WC0A 5D3GA 3DGVA 2PSZA 3FMWA 4O0NA 3L09A 5HI7A 4M63A 4YEAA 2IJFA 2N4DA 3FBEA 4GKJF 2DNNA 3LP0A 1UPPA 3C16B 1OJ4A 1RTJA 2D69A 2VJVA 1S0OA 1YX2A 4CRJA 1PKUA 2ALYB 3OTOJ 4DHVA 3T1YJ 1NJWA 3FCVA 2EI5A 1N5SA 4C98A 1QM9A 4OX7A 2OTJS 3NGTA 2ZBPA 3P5TL 2IC3B 4X4NA 3QGPA 4O4GA 3WHIA 4CO4A 3I31A 3T1AA 3OR2A 2M7SA 1SC6A 2OLWA 4CM0A 2M9KA 2WB1D 2KL8A 2N3OA 2FVQA 3OR1B 1Q8IA 4LFAF 1K73T 4LRDA 1RGVA 2Y1LB 4NEZA 1HBNA 3HHEA 3QGGA 3HXMA 2BQUA 4K4YA 1WKKA 2YH1A 1KC8T 4L73A 4G3IA 3PYFA 4L76A 1ZZFA 4I7FA 4JYAJ 3WDOA 4DSJA 4LF2A 4NXMF 1LWCA 1TKZB 1D9AA 4LSZB 5LM7E 2BANA 3EGWB 1U02A 4Q7AA 3TANA 2MLYA 3OXGA 3MUVP 3KUHA 4AL6A 3LUYA 2E66A 2C2EA 2X3GA 3DLEB 2CPFA 5KFPA 4NCBA 2AWZA 2F8EX 2HQCA 4DV7F 3TR5A 5LXRA 2XTJP 2J9CA 3W9IA 2QMWA 4K0KF 4RZRA 3T1HF 1GX6A 4WWSA 3IRWP 5D4NA 2JL9A 3SCLE 5ETKA 4OIXA 2D9OA 2CRLA 4R0JA 2CDQA 5B0BA 3N0VA 3EXCX 5CYMB 4ZPTR 1KLMA 3T3FA 4Z2XA 3PKYA 3EGNA 2DNKA 3FKBA 4OYOA 1Z1ZA 2BE7D 2IBOA 4KGVB 4Y34A 2WHOA 1VQ9S 2VPZB 2WBRA 2K06A 4ID5A 2ASLA 1BWVA 3TARA 1YLXA 1UZHA 3QLHA 4K5SA 5KFFA 3O6QA 3C14B 1WDDA 3JQMA 4HHHA 4WZQA 1XNQJ 1S1XA 1ZAVA 2LVWA 2EKYA 1RJJA 2OFGX 3JTPA 1IM4A 4OZ5A 1CLFA 1XWLA 5ETOA 1IR2A 4L74A 2V9WA 2WVBA 5CZVA 3UD5A 2CQHA 3MURP 4IG3B 1YRXA 1LW2B 1HBMB 1F3FA 1MG7A 2MQLA 3RBXA 3J7ZT 2AJ0A 3U27A 1AROP 4RBUA 3ENAA 5ETPA 1ZTTA 4NLWA 3J81Y 3UI3A 3KG4A 2RMLA 3UNGC 1S1WA 2V67A 1R0BG 3BQ0A 2DNZA 2ADBA 2OPRA 2VU5A 2N82B 4A8QA 3T41A 2GA7A 4DSKA 3V4MA 5DRKA 4P2XA 4G1IA 2B7BB 4PG8A 3CVKA 3I32A 3OXFA 3WC0A 3PJXA 3Q2SC 4WE1A 1HWIA 3BQ2A 4JI8J 4Y2CA 3POTA 2D3ZA 2A0FB 4D3HA 2HVDA 5KOXA 3JSMA 1W25A 4KHRA 5IQ6A 3C66A 1C1BA 2BE2B 2IRXA 3CUNA 3VALA 3ZZ0A 4IFVA 3M4XA 4TQRA 5GMDA 4ELVA 1G2EA 9RUBA 1FCAA 2VUGA 4LIRA 1RTIA 2NREA 3CD6S 3N6NA 3QFHA 4PYDA 3GR1A 3MDFA 4X66F 2JFKA 2XMTA 4MH8A 3KTQA 1TZ0A 2HZAA 2V69A 2XMKA 2PGCA 3LH2S 3NNHA 1JLCB 4DV6J 2VQEJ 2BKNA 5I42B 1H38A 1VQPS 4K4SA 2E5GA 5HBMA 3ZZTA 1X31C 4NA1A 3ZTQA 1H0HB 4M1KA 2BM1A 2RILA 1IQZA 1UA1A 4ZLNA 4ZVTB 2IJRA 3C15A 3PEHA 2IRUA 4LF4F 1WUUA 2WAQD 4PG5A 4A46A 3CCRS 4FN5A 5K20B 3MR3A 3FQKA 4LFCJ 1TUGB 2IAJB 3PY8A 2FVCA 4URGA 2VV5A 1U47A 2XULA 1FHTA 1RT6A 2YKNB 5LMUF 1S12A 2VBYA 3OJUA 3V6KA 3QRQA 3B8HA 5HANA 3HVAA 4XDDA 4OYAA 2MLXA 4RW7B 3M8PB 1RT1A 1AA1B 2XLJA 1U1NA 4RW6B 3GJQB 2I9SA 5DETA 1KOOA 4ZN1A 4JI1F 1QVFR 1RWVB 3RTVA 2OPSA 4DS4A 2MZSA 2QSWA 4GO5X 3JSBA 3FZ2A 2WOMA 4CCHA 3R9LA 4ZVFA 4ILLA 1WF2A 3LPYA 1D9DA 2ZUGA 5H9FJ 2V8PA 4PRFA 1T05B 5C24B 2MJNA 1R89A 2AZ3A 4NI2B 4ER8A 2DTJA 1RQ0A 2AIRB 4C8LA 5AJ3F 4N47A 5KFZA 3ILOA 3NY0A 3EXYA 5LXYA 2LA6A 5HJYA 1WTBA 2JNJA 1TKXB 3MPYA 1VQ4S 2QMXA 1MU2B 4NZ7A 3BR8A 2AX0A 4RPFA 1LFWA 2XYPB 4U7UK 3W1YC 3FSYA 3WIUA 4JUZA 2IDEA 2HGNA 3PR5B 2EBEA 2JRSA 1TUWA 3K7RA 2CJQA 4Q0BB 1OIAA 3TAQA 2B8QA 4K2JA 4NMLA 3GLJA 3BM7A 3NGSA 1RT7A 5THWA 3QWPA 4DUTA 2XEXA 3TVKA 5A8RB 2KJWA 2V2KA 4PWWA 3QJJA 5D4PA 4LQ3A 1JLFA 2HSEB 2RHQB 3BKTA 4DG1A 1NMEB 2Q1LA 2Z4PA 4B3MJ 3MMJA 3VAMA 4RUAA 1NK4A 2DNMA 1E6VB 3NBPA 3CCZA 3Q8VA 4ZA1A 1U1MA 5KFLA 3F41A 4JI5J 1T9YA 2HVHA 2ZZNA 4NYPA 5KFOA 4OI6A 2EFVA 4ED3A 1FNMA 2E9ZA 3GFHA 1G6BA 4NMXA 5HN0A 5BJRA 2XO6A 2FGCA 2YX7A 5KFWA 3T9ZA 3L7PA 2RAQA 1NHVA 2HFVA 4ETXA 3N6MA 2F4VF 4C4WA 1YVFA 2DBBA 3VZIA 4GVLA 3B54A 3MPVA 2QG9B 3MGJA 4CLYA 5E41A 2XLIA 2B4OA 4DL3A 5LMNF 2PMHA 2UUCF 4C8KA 2Y8WA 2HZCA 4M5IA 1HHSA 1V5IB 1O6XA 3JS9A 2ASJA 1CS4B 1HR0F 5IWAJ 5A8KA 2AYMA 2CDRB 3PYEA 1UVNA 3HPOA 5AXLA 2R8GA 2RDIA 3RJMB 2DGUA 5FLXU 1NDLA 3RBDA 2XMVA 3TX0A 5HP1A 3DDKA 4LRFA 1SJ3P 3UVJA 4ED2A 3HFKA 2OPQA 1CJUA 2XZDB 2ZH4A 4Y65A 1HWKA 4QU6A 1VQ7S 2RDJA 1HMVB 4DN9A 3EZOA 2KYZA 4ILRA 1EB0A 3CDUA 1GTEA 3VVUA 2RIJA 2EFGA 1DTTB 2ZDPA 5A8WA 1TUVA 1VK3A 2NZ4A 5AXNA 4YHHJ 4URSA 2K7KA 1NU4A 1S6PA 4RNMA 1NK5A 1HNIA 3CJRA 2ZZTA 1VQ8S 1Z2LA 2Y1IA 5J2PA 5F8JA 1HLWA 1S1TA 4RW4A 3MXHP 1X4FA 3MR2A 4ZHRB 2VFRA 4USKA 3KUGA 1HI8A 3MECB 2EFPA 3Q83A 2HK3A 3TWZA 1S49A 1YDLA 3TAMB 3ZZOA 2HAFA 3OSPA 2NUHA 2W2OP 1C1CA 4KH0B 1RABB 2OMOA 3UCGA 1VBKA 1Q7LB 1FRIA 1UVKA 1ZYQA 2ZHOA 2PMWA 2NXEA 1EKSA 4CWBA 5H9EJ 4YFUA 2M3DA 1SC4B 4OZJA 1I94J 3PFEA 1XR6A 1BQNA 4R8UB 2W9CA 4J9NA 4DMZA 4DV3J 5KFMA 3PJWA 4Y2AA 2VG5A 2ILZA 1MSWD 2JLGA 1NZ8A 5F8NA 5C25B 3MEKA 1L3VA 4J9MA 2J9DE 1HI0P 4LF7F 1RT4B 2BV3A 3VGUA 2XY7A 1VJWA 3B6BA 3G71S 2DY1A 2EKNA 1JQGA 1TL4A 5F9LA 4IRCA 2HNZB 4DCPB 4JI4F 4FPRA 3GSDA 3R5AA 5E3QA 3IWLA 3BSNA 2OEMA 2HHHJ 4W4MA 2ZWOA 2QIFA 1X60A 4O3SA 5K14B 2AQ4A 3KJVB 3CJKA 2D1CA 4CT8A 3HVWA 2Z0GA 2I5JB 3FFIA 5KFAA 5AE1A 1S0VA 2L9DA 4X84A 4O3QA 4DLEA 3H8YA 1FFWB 2F9DA 2E1CA 4KBIA 1PAEX 3F73A 4HT5A 3J80Y 2MPUA 4EYIB 1S0MA 4KO0B 2ZBRA 3GIMA 2AJFE 4UQGA 2AJ2A 4IYQA 3PW4A 4J7CA 3BO3A 4TY8B 1B7YB 1TKZA 2XG8A 4FVMA 4CLSA 3MFIA 5DG8A 2MKSA 2YX1A 2CPIA 4I2QA 3R5DA 2GVZA 4BLGA 3FDSA 1JLQA 2YBVA 3OT9A 1EKRA 2C2KB 3FNNA 2FY8A 1BY9A 5T14A 2B6AB 2ZC4A 4DV2F 1NZAA 3QT6A 4OX9F 4PCQA 4CLKA 1IKWB 3ZZZA 4C2MA 3JTNA 1IBMF 4OYIA 4CIOA 4MK7A 4EK2A 2EEYA 1LK5A 1X5SA 4PG4A 3UDCA 1QVGR 1U1QA 3G86A 1BC6A 2C2OB 4P2SA 3I5AA 2Z56B 4ANEA 2GQCA 2UU9J 3UE2A 3I0RA 3T5HA 1SL0A 3SSSA 3MM6A 3G2XA 4YDXA 2D74B 2OELA 3E8OA 4ZPWR 3ZTRA 3UD4P 3NS6A 3W63A 4A8XA 2G2YA 1S1VB 2CQCA 3US5A 4KGKA 2LDIA 2OPPA 1RU1A 3OTBA 1CQMA 1QY7A 1WKJA 1HARA 3GV8B 1TELA 3G6ES 2ZOGA 3I0SA 1HNZJ 2HPUA 4GVBB 2B9YA 1OMSA 5G0RA 2CPZA 2HRUA 2NXNA 4FS2A 3D1HA 5D77A 4F25A 3DRRA 2X1GA 1CPZA 4MK8A 1U0HB 3N28A 4USWA 2VFSA 3DN9A 3EICA 3B4DA 4RUBA 1RB0A 4O3OA 2KFZA 1A0OB 4ZVSB 2J6TA 5E5NA 3CIMA 2DKOB 3VAGA 2LXUA 3RRGA 2IVYA 4EI2A 2OD4A 3J7YU 4DR7J 2B9EA 1SBRA 3NG8A 4PYAA 3BSAA 4X4UA 2YQ0A 4LR8A 4RW9A 3K5MA 4O44B 4MTPA 4DFMA 2LEBA 2J5AA 4WYLA 2H5JB 3T6JA 4JI6J 3TX8A 3NEKA 4ZP8A 1U45A 3VGVA 1GXTA 4CO2A 4IOAQ 3KLEA 1RA6A 1H72C 5KG0A 2X7IA 3EPIA 3OHBA 4EEYA 1BLUA 2Q6CA 2YWGA 2JLFA 2B9WA 2I8EA 1K44A 2HBQB 2K1RB 1XMOF 1JLCA 1DLOB 1WOSA 1D8ZA 1C4AA 1CJKA 3T5JA 1WTFA 4LMZA 3KMSA 1FWPA 4ANCA 2BJ1A 4Z37A 3NKYA 4HH0A 1C0TA 2FJDB 4CH0S 3W9HA 5DQHA 3EZ5A 1RK8A 3SFGA 3DMJA 2CKWA 1RTHA 1GH8A 2M4MA 1AZSB 1LWEB 5HROB 3ISZA 4DR3F 3FC9A 2MKIA 1R27B 2L41A 3CB4A 4PAAA 4DPXA 4FNHA 1IN0A 2RVJA 5KTQA 5LSLA 1JB0C 2OEKA 2BRLA 2MTLA 3D4JA 1ZA1B 4NLVA 2MGZB 4BCAA 1L3KA 3MFHA 4A8MP 1WF0A 1PAUB 2BZ2A 3GV7B 2ZHAA 1KTVA 1RWMB 4IO9Q 1QJHA 2LP4A 5GAHU 2DNOA 3M1VB 4OJ3A 3NLCA 2OIHA 5A6WA 2GS8A 1NNDA 3RBZA 3AODA 1FE4A 3JQJA 4CYUA 1XTZA 4RW6A 2I1RA 1Y5LB 3A4TA 2MDAA 2J7UA 2HZVA 2CPJA 1JJ4A 2YKMA 3SDEB 3KNGA 2QGFB 5AE2A 3MM7A 2NXCA 1XN9A 3FJ2A 3R7NB 1TL7A 1S1UB 2MSSA 1T05A 3QRPA 3IP0A 4G1QA 3B82A 1V5VA 2KDOA 1O0PA 3NAHA 3C8YA 4WK3A 3MMBB 3LALA 4BS2A 1H2TZ 1N34J 5IT9U 2ZD1B 2DGSA 2PN6A 3MUMP 2G2OA 3RAMA 1S7HA 1NK6A 2BACA 4DV5F 4C0HA 2B43A 4NRTA 2CIMA 1OSDA 4USJC 1R8PA 5DLFA 4OYZA 3OTOF 3AY0A 1BE4A 1VI7A 1QD1A 3CC2S 3T1YF 3ZZRA 1WG1A 4B3TF 3QO9A 1ACMB 1SH0A 3I5CA 2CG4A 1SC3B 2HIQA 4WZMA 4J9SA 1T02A 3J81U 1MWYA 1RWOB 3R3TA 2EK6A 2YNHB 1NAQA 1YBAA 3CD7A 3DRXA 1HW8A 4KFBB 4QBUA 1GEHA 4TU8A 2GJIA 2XCPA 2KFYA 2WTFA 2HQGA 2JVRA 1FKOB 2RF2B 3PO5A 4HT7A 4ECXA 3GYXB 2W9BB 4TNOA 3TJAA 1S6QA 2OP5A 3BGRA 1UEVA 4GKKF 2XS5A 3TZWA 5D4OA 1H73A 4LF9F 4DF4A 5DZ6A 1T9XA 3A12A 3BV8A 4I0WA 4JYAF 2E5LJ 2XBPA 3H2UB 4OZ0A 3SI8A 3PYDA 1X5OA 4LF6J 2ZFHA 2VG7A 3LA0A 2V50A 4YUDA 5IM0B 2LEPA 2XB2D 2ZDOA 2ZH7A 4TLRA 2BMBA 2ACMA 3HDSA 2FJWA 4OI2A 1VS3A 1MW7A 1BQXA 3U1LA 3FBCA 5K9FA 3O44A 4NXMJ 3DCAA 2R8HA 2FQQB 1GNKA 4A8YA 4LSLB 3H7HB 2H65B 2BR0A 2HNYA 2HHUA 4J9UE 3D2WA 2ERRA 4IDKA 3VCDA 1E6YA 2YNFA 3L7OA 2RNEA 2HWTA 5FJ4A 4YP3A 1FWLA 2J0QD 1TKTB 1JLAB 5K8NA 2CNNB 5FD1A 7FD1A 1KR4A 4DV7J 1YJNS 2JOQA 2FJBB 1WACA 1VIOA 3GJSB 4Q8EA 1RTDB 3CTRA 4K0KJ 2W01A 3CPWR 4CLZA 2YY3A 4QJVA 2IMOA 2G9OA 3HP6A 3JSYA 2K7JA 3BDPA 4DU8A 2RQCA 3OJSA 3W7BA 4ZPVR 2EW9A 2B4UA 3IAM9 3TUZC 3Q2TC 2DD8S 4ZCIA 2GJ2A 2A10A 5F8LA 4R25A 4WK1A 1HFEL 5A6PA 2W9AA 2CJKA 4B08A 4WFAQ 2HQFA 1VQ6S 1Y10A 1Q5VA 5MLCV 2POKA 3SQOP 2O1PA 2CG8A 1SUQA 4ES2A 4KH1B 2G4BA 1QSLA 1KQSR 3IM9A 1X7VA 3RW6A 1OO0B 1NK9A 4V19J 3Q86A 4PWUA 5IS2A 3IN5A 3FBFA 2GIQA 4X4OA 2XY5A 3IXQA 2YKAA 1V3SA 1RADB 2DNLA 2NPFA 1V3ZA 3M7VA 1IWGA 1PIEA 2ADCA 3C19A 2JDJA 1U49A 3S1TA 4NLDA 4TKTA 4CLUA 3CJTA 4ENOA 2HG4A 1UVLA 1M5VC 4OI4A 1RTZA 3KLGA 1FE0A 1BUXA 2DXFA 2QJ3A 3HCXA 3QSIA 3AB4B 4JI8F 3NMAA 1UVMA 2JX2A 4PUOB 3LO3A 2AKWB 4DCJB 1HNVA 5ETTA 1QUVA 1LXNA 3K5PA 2PDAA 1NUEA 2APOA 2AYBA 2QL7B 3G96A 1W26A 3MM5B 1J5OB 4X4VA 5JJBA 1PJ5A 3M6WA 3W2WB 3MHYA 2BYCA 3VF0B 1RT2B 3IMQJ 2G0CA 4B3RJ 3H2LA 4NLTA 2PE8A 3IR6B 5KG4A 1JLGA 3OD2A 4QWCA 4IFYB 3DHXA 4WFNQ 1M5HA 3M8WA 4OJGA 2VQEF 1IJFB 2HWIA 3IS9A 4DN0A 1FRMA 1CULB 4X66J 1S72S 3MTJA 1RT4A 2DO0A 2FZCB 3KK3B 5ETRA 3HT0A 3NCRA 1DRZA 4S0MA 3M8SA 2R7QA 2HFUA 5KFQA 2B5JA 2J9EA 1LWFA 5E3CA 2ZH8A 2G2ZA 2LQ8A 5FDLA 2KT5A 5A0YB 1Q8KA 3IBCB 2PT0A 4LF4J 5M2PA 1TFYA 2G1DA 4C8ZA 2C2MB 4RL1A 2F5GA 4KIAA 5GADI 4ZITA 2GMHA 2HLTA 2ZOMA 2F1FA 3G8TA 3HX9A 2BVZA 2DGXA 3WX8A 3OBIA 5DGBA 1RP5A 1M90T 5LMUJ 1HA1A 1CJVB 1F9EB 2ZBCA 4AE5A 3CCWA 3SZ2A 3H20A 4RW8B 4Z7YA 1JJHA 1NJYA 4DQIA 2QA2A 3ZZUA 2EC2A 3P3DA 2QE5A 4PG7A 4DR6J 2Y0SD 3ZNJ1 3UCUP 2DCUB 2J0SD 4ICLB 4ZDNA 3ETMA 5DS7A 2QLWA 4JV0A 4HDHA 3QIDA 4DZDA 2IIHA 3V6DB 5SZTA 1WJ9A 1IXKA 3H5SA 1WWHA 3PCOB 3Q8SB 1FXLA 2C3UA 5D3GB 4X65F 3SSRA 4PR6A 3G6XA 2YTCA 3I82A 4OYXA 3O1LA 4CTAA 3KUEA 2V34A 3HD2A 1RAAB 2B0GA 3LP0B 3JXOA 1Q8BA 4TVAB 1H2UX 3TA2A 2DEJA 1VLYA 3LQVA 2NR0A 4F4ZA 1RTJB 2AV5A 1PSDA 1R7IA 1OYEA 2OMLA 2H4YB 2DEIA 3OTCA 3OLBA 1H2VZ 4P9SA 4CNYA 4FP9A 3AAWB 4J9PA 2RUGA 4EU0A 5GAGI 4O4GB 2DGWA 1LV5A 1HNXJ 3D6MB 3GIRA 3OR2B 2VODA 1PYOB 3AD8C 5HMWA 4B3MF 2BE9B 3AT1B 5D6GA 5KFVA 1T94A 1RSCA 1IKYB 2R42A 4F2RA 4B02A 2ZNYA 4L3KA 2KRBA 3J81j 4JI5F 4FYDA 1HBNB 4Y6IA 2GHPA 2IFXA 2RS2A 4XPEA 3SCIE 1VBYA 1SC1B 3CDAA 2OJ3A 4QQBA 4I7FB 2X3DA 2MB0B 4F2SA 1SJRA 1KSPA 1LWCB 2NSCA 1NDKA 2BANB 3GE9A 5J1PA 1N54B 4ECZA 4F3MA 3AD7C 3DC2A 1FKPA 2VB6A 2O01C 3QPIA 2PMZD 2MQQA 2CNOB 1TL3A 2ZWPA 2WRMA 2CQ4A 4J5OA 5B08A 2YWKA 2BJ3A 4O44A 3FK4A 2AGQA 2VPWB 2JZ5A 3W8PA 5KT6A 2DH8A 2V2VA 4UUXA 2ZVIA 3HD1A 1M5PC 5IWAF 4I1TA 1T9UA 4IQXA 4MKYA 4TQSA 2V2QA 2UV8G 5KT7A 3HHNB 1SJQA 2CVEA 3PNIA 2YQ3A 1KLMB 1QAIA 3BGFA 2ILYA 2J9DA 3AXKA 5KFYA 2F8MA 1AYEA 1VQNS 4ID5B 4EO8A 2J6SA 2MZTA 1UJ6A 4CO1A 3LOUA 1APSA 2FYXA 3QLHB 2FJEB 2DIUA 4N8NA 5F8MA 1UMJA 1S1XB 4F0HA 2FC9A 2IDLA 5KFBA 4ATNA 1TVRA 4C97A 3NRBA 1ZZNA 3S7RA 2D9PA 4TYBA 3BH6B 3J80U 1JXVA 2HQ3A 1VQLS 4ED1A 1KNZA 1PBUA 5L1JA 1HPZA 3DOLA 3N01A 4FNIA 4XO0A 4L72B 2VONA 2LA4A 2CWKA 4YOEA 1NRKA 5KFTA 5C7PA 2XZWA 4OJ1A 2F7VA 2W2MP 1F9HA 1S1WB 2UVWA 1N88A 1UL3A 4OYBA 5IC6B 4C11A 2W2QP 1JLEA 1U2RA 5L1LA 5CAAA 4IG0A 1AT1B 4J91A 4OZLA 3IM8A 1U8SA 2XCAA 4QR0A 4WE1B 2HYIB 3POTB 4E0DA 2W4PA 3JSMB 2H4WB 1C1BB 2J7KA 3IRXA 2WCXA 3HVTA 1I94F 3KYLA 4IFVB 5D0RA 3EDRB 4DV3F 7AT1B 3R97A 3HI9A 1RTIB 2KFNA 2DT9A 2FZGB 4CNZA 3QBCA 2XMUA 3EDQB 1QAJA 1WOOA 1K1SA 1IBKJ 1JX4A 4UOCA 4IH6A 4J9KA 1FX4A 2B4VA 3GFYA 3W66A 4ZVPB 2DCLA 2AX1A 5IT0A 1YRTA 4ED7A 3PW2A 3BZQA 1RACB 2OTLS 4LF7J 4ECRA 1S77D 4DR4J 5HBMB 2H1YA 2BJ9A 4DL0C 4YB1P 1JNZB 1IQTA 4LFBF 1MN7A 4USHA 1M5SA 4V1Ak 4I64A 2Q66A 2E5HA 2HHHF 5DGAA 1EAYC 2PFDA 3OVBA 3OVSA 4JI4J 4DPYA 5K8MA 4JBCA 3B78A 3G8QA 3MPDA 4FF2A 5KFJA 2DISA 2JEJA 4LQ9A 2EC0A 4LF8J 2QYCA 4A8WA 2UXBF 4LT6A 2W7OA 5BYQA 3IAS9 3M8QA 3BO4A 2DRDA 3EYZA 2ZNZA 2HGLA 3P6YC 1RT6B 2MZ1A 1KHWA 1P1TA 2I0XA 4Q2LA 1WC5A 1UFWA 1MMLA 3QWUA 1XERA 1RT1B 1TAQA 1FDBA 3TZXA 4DL5A 5JVGQ 2FVSA 2Y1RI 2H51B 3HSJA 3PVXA 4ECYA 2OPSB 3VQSA 1AW0A 1FEEA 1YJ7A 1EHWA 2FD2A 3NWRA 5ETSA 3AFGA 1HIYA 2WOMB 4U7UD 1YJTA 4WFBQ 2OH2A 2R7WA 4F4AA 3BJYA 4QW8A 1H98A 4DV2J 2CJYB 5E3AA 5ADZA 1SVDA 3N5FA 1UWAA 4UTGA 2CQBA 1H3DA 4USVA 4USTA 2CQ2A 5DZ7A 1F9FA 2Y1JA 2KVQE 1IBMJ 4FYYB 4DL7A 1T9TA 2COLA 2QFJA 3QYYA 2P6SA 2ZH2A 3B4MA 4K59A 4P2MA 3DLJA 1UKUA 4P52A 4Y2MA 5H9FK 1FESA 3R6LB 2VOPA 3J7A1 3NL0A 4DCOB 4KE5A 2F8HA 1EP4A 4E98A 3HSGA 4B3OB 3D0IE 5KG6A 4AQYF 2HFSA 2JC1A 4DV4F 1ZM3A 1RT7B 2XQCA 4DS5A 4PQUA 1TU0B 2B7CB 1SH2A 1MROA 4H54A 2D41A 5LSOA 3BGUA 4ED8A 1JLFB 2HS3A 3IGVA 4DG1B 5I3QA 3MCOA 1TV6A 3BDEA 1QTMA 3NBPB 2VL1A 1RA7A 4K4ZA 1DJ0A 2KZZA 2AEMA 4I6WA 2Z2ZA 2ROPA 2B9XA 2U1AA 2DGVA 2A6OA 1S76D 4D3GA 5C2GA 2NZCA 4QPTA 1A7GE 3V81A 1X4DA 2HEKA 5DDQC 3G6VA 5K8PA 5KG2A 2F3JA 5DLGA 2XHCA 4NLPA 2A3JA 2H5IB 2VFUA 1R8AA 3H4BA 2XMWA 2FHJD 4OYWA 4KV8A 2FPHX 3FZBA 2NPIA 1SQGA 2XGQA 2L08A 3AHPA 2KXNB 4HKQA 3SFUA 3FCHA 4ETZA 2IA0A 5DO2A 1N5TA 4W92B 1Y00A 3UDLA 3DLBA 5A8KB 2J8AA 4FZVA 1BMQB 3DGPA 3LAKA 4MKVA 4MKBA 1WSVA 2UUWA 4FYWB 4DSEA 4KGMA 3ILLA 3HJVA 1H6KX 5HP1B 4Z7CA 3UVJB 3N6LA 3KJQB 1HD1A 4NCAA 1QSSA 1XMQF 2OPQB 1CJUB 1RBOB 1VMBA 3UWTA 2DHGA 1SQFA 3NP5A 8RUCA 3MMCA 4FXDA 2KU7A 2ZVSA 3GIKA 3MTKA 1G7CB 2ACYA 3KLFA 1GK8A 4UF4A 2Q79A 3MCMA 2HBZB 1U4BA 1ZPWX 5HMZA 3F0NA 2Q3PA 1X9WA 2RB7A 2VICA 1IUJA 1FA0A 3PKMA 2GIFA 1I6JA 5A8WB 2FLLA 2V4QA 2H48B 1ZOTA 2V8HA 1QE1A 3DDNA 4GMKA 1QDUB 1F1BB 3V4IA 1TK5A 1N6QA 4K4UA 1AUDA 1LW0A 3TAPA 1NEEA 3MAQA 3NXZA 3DM2A 1S6PB 3BN7A 1YJUA 3AB2B 1HNIB 1JK9B 4A47A 2ZE2A 3EVMA 4JV5F 4N7TA 5J2PB 2OGUA 1S1TB 3PW7A 4RW4B 4OYMA 2CPYA 1IWAA 2WSEC 3MCSA 3M2VA 4HHJA 3CIZA 5D8HB 4WCEQ 3VAIA 3Q8UA 1C1CB 4M95A 1RAOA 3RW7A 5IT4A 4ZP9A 4IR9A 2DPJA 3CJ8A 2VBXA 1HBOB 2LMIA 3W64A 4GC6A 1SH3A 4F26A 4OZ2A 3PHTA 4YR3A 1FDDA 1S6UA 2J76E 2KB2A 5L1KA 1RWUA 1BQNB 2W9CB 4QCLA 2F40A 2O5DA 2CPDA 3ISND 4I69A 1YKWA 1FRJA 1AXQA 1VLOA 2VG5B 1IR1A 2OFHX 3X3UA 1MNEA 6AT1B 4P7VA 2BDPA 2UUAF 2BQ3A 2EFQA 3IR7B 2YPYA 4QYRA 2YWEA 4DV5J 4KHPJ 3MAHA 3CC7S 3OPKA 3RR8A 5H9EK 4F4WA 4B3TJ 4B3SF 1UVIA 1U2FA 2BBEA 2V4JA 4ZPDA 1VDHA 5L9XA 4X4SA 2YWFA 4NZ6A 3CF5Q 4J9VA 1S59A 4OZ1A 3GCXP 5KG7A 3BBFA 1N8RT 4MIWA 3UW1A 1X8DA 4DL6A 4HDGA 1SI9A 2C3OA 3CCTA 1IKYA 3I9V9 2JH3A 3CJKB 2E5LF 3SSQA 1WI6A 4DFKA 4RBVA 3FFIB 4O0IA 3FVYA 5KT3A 4LF6F 3R5CA 4KTQA 4GKKJ 1UEUA 1LFPA 4DV1F 4LF9J 2VG6A 2FDNA 2DXEA 1N33F 2UXCF 1Y4ZB 3OSNA 1R0AA 3NS5A 4LBIA 4RWXA 2ZH5A 5L1IA 4L6V3 2C2ZB 1IVZA 1SV5A 3ET6A 4I2QB 7FDRA 5HMXA 2GVZB 1RT3A 1JLQB 3KMQA 4C8MA 1S9GA 5I3PA 1HL6A 1T3NA 4NLUA 4XDCA 2H54B 3QZ7A 1DBDA 3TP2A 4MJKA 1FEHA 1YJWS 3FBBA 4EMDA 2XHWA 3ZO7A 3MEGA 1P27B 1K0TA 4IKAA 2PA3A 1T8EA 4PPZA 5LSRA 3ETOA 3Q8PB 2XS2A 2N3LA 4DF8A 1S99A 1SKUB 2V4RA 2M8HA 3VAJA 3HHKA 1NPPA 1PCAA 3H5XA 1SQEA 3BS9A 2CUYA 3MPWA 2AEJA 3I0RB 3IWNC 2D3OR 3MM6B 1OS5A 3PX6A 1F2GA 4UZCA 4X4RA 4I4BA 5DG9A 3KK1A 2LCWA 2HBRB 2M2BA 4CDIA 1CJTB 1HBUA 2J0WA 3OQ2A 3OLAA 3TI0A 5IT9Y 3NNAA 3JYTA 1LWXA 2AMCB 3QFWA 5EGYA 3I9ZA 4F4KA 3AOAA 2CADA 3C6UA 2OPPB 4XK8C 1NJZA 5KT5A 2QL9B 3I0SB 5RUBA 2R7UA 2DR9A 5F0UA 2OSQA 5KFEA 4YS2A 2G0JA 1VC6A 2KM8B 5G0RB 3P5BP 3BBBA 4FS1A 3FGVA 3DRRB 4OZNA 2OEJA 1ROFA 3A8JA 1CG2A 1X4CA 2HGMA 1U6BA 2MY8A 3NOCA 3VHQA 4OMFG 1KHVA 2Y0BB 3GU0A 4HI2A 3TQ1A 2EBGA 2AT1B 2ASDA 1GMUA 1V3RA 2C1EB 3M8YA 1RHUB 3EVWA 4N76A 3M2RA 1Y3KA 4M5NA 4UQTA 2RS8A 2ZJRQ 2V5HG 4PXBA 3MEEA 1LK7A 3DRYA 2LU1A 4NE9C 3D6HB 4CZCA 3BN4A 2A6MA 2F63A 4AL5A 1CBKA 1YZ7A 4ZVEA 4RW9B 4ECUA 3MD1A 4NYZA 4YN3B 3QIPA 3KFWX 4KYZA 4B3RF 3OW2R 4Q5VA 5BYRA 3K58A 2IMWP 4ZIVA 4UUWA 4EGLA 3KLEB 3CJSA 1N4LA 4M5LA 1RXOB 3UPFA 4M8LA 1NLKL 5LT5A 3I55S 4O3NA 3VGTA 2MQPA 2G1HA 1YJRA 2IPOB 2C28A 2GGPA 2FIUA 3TA0A 3KLVA 4DSFA 3SCJE 5A76A 1REVA 4K8RA 5L46A 3AJDA 2N4CA 2R8IA 1CJKB 4C8YA 1GXLA 2FHJA 1TQLA 1GMVA 4CLFA 2W2PP 4MIBA 4N5SA 1CSJA 3D0GE 3R7BB 5DM6Q 3DU5A 1Y11A 1C0TB 2QLFB 3M30B 3A3PB 2BJEA 4CLTA 1Y5IB 3DMJB 1NBEB 4UOGA 1RTHB 2Z2LA 4X4TA 1RE1B 3R1LA 4BWJA 3PRBA 3HMJG 4TU9A 2X1BA 1X4EA 2R8JA 1XR5A 3K5LA 4UOHA 3DLKA 2YWWA 4ES1A 3V5RA 3BPDA 1U1PA 1TP7A 2EK1A 1B7FA 4ZJOA 1Y0HA 2HNDA 4M5JA 5EHHA 2MKKA 3H25A 2Z2MA 3S6EA 3HHDA 1VR6A 4YQWA 3MAAA 4Q45A 2YKQA 2HHSA 1SL1A 2ZM6F 4J37A 4PKDB 1DTQA 5L39A 3SEOA 3N4WA 3TO8A 3CCSS 2HURA 4CYUB 3K8VA 2NLWA 3VR1A 3BR9A 4DDFA 2HW3A 4DR6F 4KC5A 1WHYA 3VTIA 2YKMB 2QT7A 4CLWA 1WF1A 2ASYA 1NPRA 3CD0A 4JB8B 3MM7B 4KY3A 1NCLA 4NA3A 1TL7B 2CJ9A 4FF4A 3KLIA 1UEKA 1FXDA 2DR5A 4X62F 1X4BA 3DOKA 3UN3A 2R9LA 4G1QB 3LP1A 3DLHA 4MK9A 2EVZA 4KR0B 1ZTWA 1YBTA 2DHAA 3M9MB 4USMA 4E2FB 1PJ7A 4MMOA 2RH3A 1HNWJ 3UR3C 4X65J 2CPXA 2I6WA 3MEDA 2VA3A 4K5RA 2RE1A 1MWQA 3QO9B 3CSKA 3OL6A 3ILJA 4DPWA 2BJ7A 3BKFA 3AXMA 1VOMA 3FCWA 6FD1A 1HNXF 4B3OA 3NGDA 2UUBJ 1S9EA 2RJZA 4HEA9 5I3UA 3KHHA 2KT2A 5CYQA 2UXDF 1X0PA 1S6QB 2V6AA 5F3TA 3BGRB 2IM1A 3GZ7A 3AOBA 2DPIA 1B99A 4ES3A 2VZ9A 1VISA 2FHMA 5B0CA 3MMAA 3RBEA 4WTYA 4CH7A 4WXOA 3A1YG 3FEZA 2PFFB 4IUFA 4UY8T 3U7JA 1M5OC 2VG7B 3G87A 2M8DB 1T03A 2JSXA 4TY9A 1FF2A 3JB9k 2GQQA 2QZ8A 4O23A 2KI2A 2KO1A 3DXSX 2GIRA 5J2QA 1D1UA 2HNYB 2CNKB 4QW9A 3C3LA 3PM9A 4IDKB 1E6YB 1GMWD 2YNFB 2QO3A 1A6LA 2HK2A 3F56A 1RT5A 3UN5A 2E7XA 1DFDA 2LKZA 3BSCA 4AFFA 3PXGa 1RWKB 3CGIA 5J1EA 2XGPA 1VC5A 1MMDA 4PG6A 5HAOA 4Y3CA 2DNGA 2HVIA 2WVCA 3KLHA 4WIIA 3MOZA 2BQRA 2WSFC 2R7TA 3THPA 2BXJA 4OLPA 2EG2A 1ELOA 1S6OA 1YI2S 4GRSA 4PQAA 5GADU 4DLGA 3TEGA 3N9UC 2ZH3A 1EQMA 5DDOC 2CQ3A 1C2PA 1KWMA 3AQOA 1NDPA 2KT3A 1TTHB 2MKJA 2LQ5A 5HLFA 2GMJA 1Q8LA 1SUQB 3I56S 4HVZA 2BEFA 4UW2A 5D78A 2MJUA 2CVIA 1JMTA 1VQOS 2JC0A 4DEZA 3GQCA 5DG7A 3RRHA 4ZPCA 3RB0A 2QLXA 3UFCX 1WHXA 4I56A 1BHNA 3HHLD 3GMGA 3A8IA 3C2PA 4DR2J 4B9VA 1RHJB 1FJEB 4NOHA 3TVYA 1LNQA 5I4MA 3D9BA 3EX7B 1TK8A 1FK9A 1U24A 3W5YA 3GJRB 1I1GA 3ITHA 1TL1A 1B64A 4DXLA 3N5BA 3KLGB 2I2YA 3LWMA 4ZN3A 2FLNA 2ZITA 1KVJA 5KFCA 4ECWA 3RUBL 4ECVA 3UDVA 1SKSA 2RQMA 1HNVB 3HKWA 4QWDA 4RBTA 3PJ9A 3FRZA 4ZVQB 5LJ5Y 4C3KA 1WC1A 2DHXA 1XC9A 2N7YA 4CH1A 2O3DA 1KLNA 3T5LA 3CDBA 2MMYA 5ETNA 1KRPA 3PRDA 4NA2A 1HBOA 4FYXB 2LU2A 1NK8A 1MN9A 3AOCA 1NSKL 4ALZA 5GAGU 2IA6A 1XBWA 3IO1A 4EUVA 2QFIA 1JJCB 3SV3A 1IKVA 1N5QA 3KK2A 1JLGB 1IBKF 4WP8A 1N5YA 1K1QA 4MFBA 3THVA 3H98A 2NYIA 2RQKA 3IS9B 2GHWA 2HMIA 1S5ZA 4JV1A 4I2PA 3LF0A 4ED4A 4DR4F 4AL7A 4DFJA 1D09B 5KFIA 4PXCA 4YR0A 2YNGA 3D1OA 2B5JB 3KHRA 1W2BR 3R7SB 1LWFB 4OX6A 1JLBA 4O3RA 2Y8YA 1N0UA 3HK2A 2K3KA 1SCJB 1VJQA 2DR6A 1PYTA 5D4LA 1Y5NB 4LFBJ 5FDLB 2HVEA 4LF8F 3PFOA 1KOHA 2YNIA 4LR7A 5CCMA 2FLOA 2R7RA 5BR8J 3V6HA 3IA0A 5IXUA 2B51A 2LXIA 1HHQA 1G4CA 2ZKUA 4OJHA 3E01A 2UXBJ 2VC0A 1NSQA 1QLNA 3BKUA 2VIHA 3L9ZA 3BEGB 4LRBA 4RWWA 2HRTA 3A3OB 1XEZA 4P10A 2ROEA 5EX3A 5HSPA 1I51B 4Q2MA 4BWMA 4TXSA 1UWBA 4ZOSA 4NL5A 4H4OA 3NOGA 4CP5A 3M8RA 4FF3A 3RR7A 1DQ9A 4RNOA 3RAXA 1VRTA 1FJGJ 4C8OA 1DZ5A 1Q81T 1ZM2A 1N5VA 2YPZA 3CNQP 4KKOA 4RNHA 4C0OC 2XMAA 1H7WA 4DJBA 4DUYF 1EZZB 3GP9A 4CTAB 2HLUA 4ZS6A 1WOPA 3EJMA 3CCUS 4GC7A 4QZVB 1HQEA 2E1RA 3IG1A 3OTDA 2P6TA 3LP2A 1FDNA 1VGYA 1VHFA 3GV5B 4JI7F 5M2RA 4ZJQA 3EGVA 3ZNUA 2XMMA 1CJTA 2M5YA 2AEFA 1P9QC 2VBZA 5CABA 4IO1A 1FRKA 3W5ZA 1VCTA 5KFNA 4FXVA 4AQYJ 1NK7A 4YY3J 4DV4J 3ZTOA 4J9RA 4FYVB 3AH6A 4DU7A 4OQJA 2O66A 2GCFA 3DFEA 2DNYA 2GW8A 1AFJA 2QLJB 4Y2KA 3TRGA 4P73A 4NZ0A 1UFLA 2W25A 3FSXA 3CJQA 1YZ6A 1QAXA 1ZH5A 1YGYA 3EE3A 3D6FB 2BX6A 3BO2A 2DRBA 2L48A 1NKEA 2RUSA 1RKJA 1FKPB 2P9CA 4CT9A 4NLXA 5J1NA 1GFWB 1TL3B 2ZZMA 1F5BA 4ZPAA 4ZP6A 2YXLA 3IBWA 1G1XA 2L3MA 4DQRA 5A2QY 1NHUA 2I38A 4DX6A 1URNA 3G4SS 4KSEB 1X4GA 1FFSB 2VA2A 1TMMA 4NLOA 4ZLPA
chains in the Genus database with same CATH topology
5KFWA 1P8GA 3M2UA 2PA8D 3T9ZA 3T6BA 1YITS 1L3SA 3L7PA 4AUKA 1NHVA 3SXLA 4ETXA 4NLRA 3E01B 3N6MA 1GTHA 1RYRA 4R5PA 3OVSA 3OVBA 2F4VF 4C4WA 2ZH6A 5K8MA 2R7OA 1ZM4A 4JBCA 1YVFA 1HHTP 3B78A 3G8QA 4FF2A 2HS4A 5KFJA 2DBBA 2DISA 5KFHA 3VZIA 2HNZA 2JEJA 4PPDA 4LQ9A 3K57A 2EC0A 4RUCA 2H5EA 1U6FA 1RI7A 2QYCA 3MPVA 4LFCF 3MGJA 5E41A 2XLIA 4IR1A 1TL5A 2HVZA 4A8WA 2UXBF 2B4OA 4DL3A 5LMNF 4JI3F 4RUHA 4LT6A 2R2SA 2W7OA 5BYQA 3IAS9 2AW0A 2MHEA 2PMHA 2UUCF 4NWBA 3M8QA 3C46A 3BO4A 3VWSA 4C8KA 1NH8A 2ZNZA 1UWBB 3EYZA 2HZCA 1M5KC 2HGLA 2NUUG 2ALZA 3P6YC 4H4OB 3MM9A 1RT6B 2MZ1A 1HHSA 1KHWA 2SXLA 1P1TA 3L95X 2ASJA 1HR0F 2I0XA 5K14A 5A8KA 3BGLA 4Q2LA 3KJVA 1UFWA 2AYMA 2YKPA 5GMKa 1MMLA 1VBXA 2XC9A 1VRUB 1UVNA 3QWUA 1XERA 2I5JA 5J2MB 3HPOA 4JI0F 1YWXA 1RT1B 1TAQA 4G6VB 4O3RA 2AGOA 1FO1A 1VRTB 5AXLA 1FDBA 1PC5A 2R8GA 2RDIA 2VFTA 4C0BA 4FBTA 4BHQA 3JTOA 3M32B 3RRKA 4DQQA 1UVJA 2DGUA 3M30A 3QAUA 5JVGQ 4DL5A 2FVSA 2Y1RI 4L3NA 1IR0A 3RBDA 2DGOA 1OPIA 2XMVA 3UCZP 1TVRB 3PVXA 4ECYA 1FNOA 3PW5A 5HP1A 3DDKA 1YJ9S 4DOZA 2OPSB 4KO0A 3ULHA 5K8OA 1SJ3P 3G8SA 2WONA 3FQLA 2KKHA 4OL8A 3VQSA 2K3IA 4KKOB 1FEEA 1AW0A 4ED2A 4CI0B 2FD2A 2GV1A 3HFKA 2DVIA 1Z4UA 2OPQA 2WOMB 4TY8A 1YJTA 2E1MC 4WFBQ 3CDWA 2OH2A 1HQUA 3D28A 2R7WA 2ZH4A 4DWIA 1HPZB 3DOLB 4Y65A 1HYSA 1HWKA 4QU6A 3BJYA 2RDJA 1VQ7S 1X0FA 4QW8A 1HMVB 1H98A 2VBWA 4DN9A 5E3AA 3CCQS 2KYZA 4BBYA 4ILRA 5ADZA 2AYGA 3N5FA 4ITSA 3CDUA 1GTEA 4YB7A 1N52B 3MF5A 3Q24A 2CQBA 2RIJA 2JEGA 1H3DA 2A18A 1HQEB 2EFGA 1DTTB 1FERA 2B6AA 2ZDPA 3IG1B 5A8WA 4F3QA 2CQ2A 1D8YA 1F9FA 1TUVA 3LP2B 2Y1JA 1VK3A 2NZ4A 5AXNA 4C11B 1IKWA 4URSA 1F5CA 4DL7A 2Q43A 2K7KA 3HKZD 4GO7X 1JLEB 4K4WA 3PW0A 4IG0B 5CD4H 2COLA 2PC6A 3QJLA 1NU4A 2QFJA 4OFZA 1S6PA 4RNMA 3CXCR 3QYYA 4QU7A 1NK5A 1PGZA 1N0VC 1HNIA 3CJ3A 2P6SA 2J7WA 2ZH2A 3B4MA 4K59A 5HO4A 1UAWA 3NAIA 3DLJA 1UKUA 3TA1A 4Y2MA 3VZHA 1VQ8S 1Z2LA 2Y1IA 4MYUA 5J2PA 1YTYA 5F8JA 4H4MA 1S1TA 1YQHA 3SYZA 1FD2A 4RW4A 1TK0A 4DR5F 3MXHP 1FESA 1RISA 2VOPA 3J7A1 4HTJA 3HVRA 4QWBA 1X4FA 1YJVA 3MR2A 1JXLA 3NL0A 2KVIA 4ZHRB 2PI4A 2VFRA 2R4FA 3LWLA 1SL2A 4KE5A 2W8LA 2F8HA 1EP4A 2V8GA 4Y28C 4E98A 1TAUA 1HI8A 2FTRA 4B3OB 3MECB 2EFPA 3D0IE 5KG6A 3HHLA 3IRXB 3HVTB 4B9TA 1S49A 4AQYF 3TAMB 3ZZOA 3MOJB 2JC1A 5JUMA 4DV4F 1ZM3A 5EDWA 3OSPA 4X2BA 1RT7B 2JJ4D 2NUHA 3FMBA 1C1CA 4DS5A 3UD3P 1VBZA 4PQUA 2B7CB 2ZC3A 1S1VA 2CQ0A 1H7XA 2BABA 1DQAA 1SH2A 2OMOA 2RT3A 3KKFA 1MROA 4H54A 2D41A 3UCGA 2P9GA 3MR6A 1Y9OA 2C22A 1Q7LB 1FRIA 5LSOA 3BGUA 4ED8A 2AJ1A 1JLFB 2HS3A 3IGVA 1UVKA 1KS2A 4DG1B 4H4KC 5I3QA 1ZYQA 2ZHOA 2CQ1A 2DB1A 1URRA 3I5BA 1TV6A 3BDEA 1SKWA 1FJCA 1QTMA 2B56A 1XNRF 3NBPB 2VL1A 1RA7A 5JVHQ 1DJ0A 4KHPF 4K4ZA 2KZZA 5H9EJ 4YFUA 2M3DA 1L3TA 5LJ3Y 4OZJA 2HHWA 3PFEA 5KFKA 4I6WA 2CJBA 1XR6A 1BQNA 4R8UB 2W9CA 4ED5A 1MMNA 5M2UA 4A4JA 4J9NA 2ROPA 1PC4A 3I4PA 5KFXA 4DMZA 1D0EA 2B9XA 1HI1A 5KFMA 1Q4RA 3PJWA 2U1AA 4Y2AA 2VG5A 2XO7A 2DGVA 1BGXT 2ILZA 2JVOA 1U48A 1MSWD 5AE3A 3CJ0A 4IH5A 4XIUA 1IJEB 2AD9A 1S76D 4WF9Q 1C4CA 2JLGA 5F8NA 5C25B 3MEKA 1L3VA 4D3GA 2E1AA 4QPTA 1A7GE 4J9MA 2J9DE 3V81A 1X4DA 5DDQC 3G6VA 5K8PA 5KG2A 2F3JA 1HI0P 5DLGA 4LF7F 1RT4B 2HS0A 4NLPA 2EG1A 3H40A 3H59A 2A3JA 1KQKA 4AXJA 2VFUA 1R8AA 2BV3A 3G6YA 4MYTA 1FD8A 4K2XA 2XY7A 3H4BA 3M2UB 1VJWA 2RU9A 2XMWA 3AA9A 4EBEA 1R8BA 1VQ5S 2FHJD 1JKHA 5F0WA 4F50A 3G71S 3U02A 4YDDB 4KV8A 2GO9A 3CULA 4R5PB 2FPHX 4DPOA 3FZBA 2D7SA 1TL4A 4WXWA 3AJ2A 5F9LA 2GFFA 2J0XA 1D3WA 2NPIA 4IRCA 4FBUA 2HNZB 2LLZA 6FDRA 1SJFA 1HWUA 1UJ4A 2ROGA 1HW9A 4JI4F 4WU3A 4FPRA 5KFRA 2XGQA 1O51A 3GSDA 2HWHA 2L08A 3R5AA 3AHPA 2E7WA 3KHLA 2KXNB 2FGOA 5E3QA 3IWLA 3BSNA 4HKQA 3H2VE 3V6JA 2HAIA 3GIIA 5MAOA 3M8QB 3FCHA 3SFUA 3DRSA 3VQTA 3JSRA 2HHTA 3FEYB 4ETZA 2IA0A 2GMLA 2DHSA 2WB4A 5DO2A 1N5TA 3MM9B 1UETA 4W92B 1Y00A 3CJ4A 2KHCA 3UDLA 2QIFA 3DLBA 4O3SA 5K14B 3ZC4A 5A8KB 3KJVB 2MZQA 2AQ4A 2J8AA 4FZVA 3CJKA 1S79A 2ATLA 3DGPA 1X9SA 2D1CA 3LAKA 4MKBA 4ZVHA 4CT8A 3HVWA 2Z0GA 2UUWA 3OFHA 3IGNA 2I5JB 3FFIA 1KFSA 5KFAA 2EPIA 4N41A 5AE1A 1S0VA 2L9DA 2FVRA 4X84A 4O3QA 4DLEA 1OWXA 3WC2A 3H8YA 1KVIA 2F9DA 4DSEA 4DQSA 2ZJQQ 2XI3A 2UVVA 2NXUA 4KGMA 2E1CA 4KBIA 3M9NB 4PXEA 3R5BA 3F73A 2P9EA 3HZEA 1ZAWA 4HT5A 2E5JA 4A8KA 3J80Y 2GO8A 2MPUA 4EYIB 4ECTA 1H6KX 5HP1B 1S0MA 3G9CA 3AA8A 4KO0B 1TKDA 2WONB 3N6LA 1HD1A 3GIMA 5CHCB 2R7SA 3D0HE 4NCAA 2AJFE 3K59A 1QSSA 4Y00A 4UQGA 4QPXA 4OX8A 1XMQF 4QYZJ 4IYQA 2OPQB 3PW4A 3BO3A 2UP1A 3KOAA 4TY8B 1TKZA 2XG8A 1VMBA 4FVMA 1HQUB 3DI6A 3H4DA 1Q86T 3UWTA 2DHGA 3MFIA 2K1RA 2PO4A 1HYSB 5DG8A 2KYXA 3NP5A 1HWLA 2MKSA 2YX1A 4DFPA 2CPIA 3MMCA 4FXDA 2KU7A 1DLOA 2ZVSA 4I2QA 4LSNA 4P6QA 3GIKA 2D3UA 3MTKA 3R5DA 2C3MA 1G7CB 2ACYA 4ELUA 3KLFA 3FDSA 5BYSA 2Q79A 1JLQA 5G4DA 3ZZYA 1U4BA 1ZPWX 5HMZA 2LXFA 3FNNA 2Q3PA 5EN1A 2EFOA 3Q0AA 1U1OA 2RB7A 1X9WA 1IUJA 1BY9A 1FA0A 3SQGA 3PKMA 5T14A 2B6AB 2ZC4A 5CZXA 1LQ9A 1NZAA 5A8WB 4DV2F 2UV8A 1I6JA 2FLLA 2V4QA 2JEFA 4DQPA 1FKAF 1V6HA 2CQPA 4OX9F 1ZOTA 2V8HA 1QE1A 4PCQA 3DDNA 4GMKA 1IKWB 3RU0A 1YHQS 3ZZZA 2CZVC 3V4IA 1TK5A 4C2MA 3CE8A 1N6QA 4K4UA 1B0VA 3JTNA 2XMJA 1AUDA 1LW0A 1JNRB 5CCLA 1NEEA 4HH1A 3MAQA 3TAPA 1IBMF 1SIZA 3DM2A 2XNRA 1S6PB 3PZPA 2DK2A 4CIOA 1GXUA 4YHHF 3BN7A 3HZGA 1YJUA 4MK7A 1LWEA 1HNIB 3AB2B 2V9KA 5L8RC 1LK5A 5HROA 1X5SA 4PG4A 1JK9B 3UDCA 4ZCMA 4A47A 5C42A 3HM9A 1QVGR 1U1QA 5KFSA 2ZE2A 4JV5F 1Q82T 5J2PB 3G86A 1BC6A 4H4MB 1S1TB 3PW7A 4RW4B 4P2SA 5E7OB 5KFGA 2CPYA 1NB7A 3I5AA 2WSEC 2MGZA 5KFUA 3MCSA 3M2VA 2GQCA 1EP4B 4HHJA 4DX8H 1W2IA 3UE2A 2DH7A 3D54A 3I0RA 4QWAA 3T5HA 1SL0A 3SSSA 1R8CA 3MM6A 3HHLB 3QMQA 4YDXA 2D74B 3CIZA 3E8OA 3MM8A 5AXKA 4ZPWR 3OUYA 5D8HB 4WCEQ 3UD4P 5J2NA 3E2EA 3NS6A 4KB7A 3M1VA 3VAIA 1FVSA 4A8XA 3CEDA 1C1CB 2OPRB 4PQUB 4M95A 2IM2A 2R2RA 1S1VB 4WYWA 3RW7A 5IT4A 1IKXA 1MROB 1YG0A 2IYGA 4ZP9A 2DPJA 4IR9A 3FEXB 1PO6A 1FRHA 4K4VA 3CWJA 2CQCA 5HMYA 1WG4A 3US5A 2VBXA 4TLQA 3NCPA 1HBOB 2LMIA 3O5TB 1SJ4P 4KGKA 4GC6A 2GQ2A 1SH3A 2LDIA 2OPPA 3OTBA 4B9NA 4F26A 1EETA 1CQMA 1TV6B 1QY7A 1GAOA 2C3PA 4YR3A 4QR2A 1HARA 1FDDA 3GV8B 2VPXB 1F0XA 2AF6A 5B7WA 3G6ES 1S6UA 3SDEA 2ZOGA 3I0SA 2XS2A 2J76E 5E3RA 2KB2A 3D1QA 4C3LA 3TVZA 5L1KA 1RWUA 1BQNB 2W9CB 4QCLA 2F40A 2HPUA 2EWHA 2O5DA 4N8OA 2CPDA 3ISND 4I69A 4QIGA 2B9YA 3UR0A 5G0RA 2CPZA 1R43A 2HRUA 1BQMA 1FRJA 1AXQA 4FS2A 3D1HA 5D77A 2VG5B 4F25A 5F3ZA 1S1UA 1FNXH 3DRRA 2OFHX 2X1GA 1UP1A 2UZAA 1CPZA 4MK8A 2YH0A 3X3UA 3C6TA 1WHWA 5SUHA 2LECA 1MNEA 3RB3A 4OHYA 2E9RX 2L9NA 2MQOA 3V81B 4XPCA 4P7VA 1S9FA 2BDPA 2UUAF 2BQ3A 3N28A 2EFQA 3IR7B 3U1MA 2VFSA 3MMBA 4HLBA 3DN9A 4QYRA 2YWEA 2MHNA 3B4DA 2L9WA 2RKIA 4A8OA 3MAHA 3CC7S 2ZD1A 3OPKA 1M0SA 2CQIA 4IOBA 4K50A 4O3OA 4KPYA 2KFZA 2J6TA 1YSJA 1JKHB 5E5NA 3CIMA 4KV8B 2O67A 3VAGA 2LXUA 4ZKAA 3RRGA 2IVYA 5EWGA 3RR8A 2OD4A 3J7YI 3J7YU 2VKZG 4F4WA 2FB0A 4ZPBA 1SBRA 2U2FA 4B3SF 1UVIA 1U2FA 3NG8A 2BBEA 3TUIC 2FY1A 2V4JA 4ZPDA 2BJDA 5L9XA 4X4SA 3FSIA 2YWFA 4I68A 2NSBA 3BSAA 1CC8A 4NZ6A 4LJMA 3GILA 4F4YA 2FHKA 4X4UA 2VASA 3CF5Q 4OZ1A 3RYLA 5KG7A 3DRSB 4RW9A 4X64F 1N56A 3K5MA 1N8RT 4O44B 1C0UA 4MTPA 3T19A 4MIWA 3UW1A 1X8DA 4DFMA 4HDGA 4DL6A 1GX5A 1SI9A 2MQNA 2LEBA 2J5AA 4WYLA 5F9NA 1L5UA 3T6JA 2C3OA 3CCTA 3F44A 2DNHA 1IKYA 3TX8A 3I9V9 2JH3A 3CJKB 2E5LF 4ZP8A 3SSQA 3X1LB 1U45A 2R8KA 1U09A 2YNHA 1WI6A 1U7LA 4HI1A 4KFBA 1CEZA 3DLGA 4HTIA 4DFKA 1GXTA 4RBVA 3RB4A 3FFIB 4CO2A 4IOAQ 4O0IA 3KLEA 1RA6A 3FVYA 5KT3A 5FLXY 4CQ1A 3VAHA 1FKOA 5KG0A 2RF2A 4U7CA 3R5CA 1Q78A 4LF6F 4YMEA 4KTQA 1ZM9A 3EPIA 3OHBA 1UEUA 5FIIA 1LFPA 2W9BA 4DUZF 4KAIA 4DV1F 1XK8A 4EEYA 2VG6A 3O2IA 4FXWA 3JAMY 2FDNA 1N33F 2UXCF 1BLUA 2Q6CA 1S0NA 2YWGA 1Y4ZB 2W7AA 2HRYA 4OV1A 3TOQA 3OSNA