2MXYA

Solution structure of hnrnp c rrm in complex with 5'-auuuuuc-3' rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Heterogeneous nuclear ribonucleoproteins C1/C2
publication title Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mxyA00
2N7CA 2DNPA 2DNKA 2KN4A 3CCRS 2CPEA 3RW7A 1U1QA 1X5TA 2SXLA 2MJNA 1WI8A 2RRAA 1ZH5A 4F25A 1VQ6S 2E5GA 2MB0B 3THTA 2ADBA 5LJ5Y 2M8DB 5JVGQ 3SDEA 4M5DB 1YJWS 2MHNA 2YWKA 4PKDB 3BO4A 5CYJA 5GVQA 4Y00A 2QFJA 1H2UX 2ZJPQ 2MQLA 2X1BA 3R1LA 2DGXA 3TP2A 1M5VC 4W90B 4CIOA 2X1AA 1BY9A 2HYIB 2J76E 2RVJA 1QVFR 5DETA 5D78A 1UFWA 4YB1P 3MUTP 3EGZA 1X5PA 3DXBA 1VQ8S 2CQ2A 2KM8B 2DO0A 2DISA 3VF0B 3D2WA 3JB9k 1Q82T 3P5TL 2AYGA 2M8HA 5GAGU 2XS2A 3MXHP 2CQPA 3CCUS 2MZQA 2L41A 1K9MT 3NNCA 3TO8A 2CQIA 1X4FA 2DGWA 1U1OA 2OTJS 1Q86T 1WEYA 2BZ2A 1VQOS 3DLLQ 3CULA 2LXUA 3I56S 3UCUP 1VBZA 5EN1A 1X4DA 1KOOA 1U6FA 2M70A 2VOOA 3PIOQ 4TU8A 3LQVA 2KXFA 1M5OC 1AUDA 2MZJA 3MUMP 4LMZA 2CQCA 1VQ7S 1XN9A 1M5KC 1HA1A 4W92B 4IOAQ 2LXIA 2CPDA 2CPXA 1Q7YT 4LIRA 2FPHX 5D77A 1VC6A 2DGTA 1HL6A 2YH1A 2FHOB 1U1KA 3CCVS 2DNLA 2MZTA 1G2EA 1VQ5S 4WFNQ 1YTYA 2DGVA 3P3DA 3G71S 1VC0A 4FXWA 2U1AA 2CPJA 2JVRA 1WF0A 3NNHA 1SXLA 4FXVA 1WHYA 4EGLA 3CMAS 3EX7B 2DNNA 5GMKa 4IUFA 2AYBA 2AD9A 1WG4A 2K8GA 2MKHA 3CCLS 3VALA 2PE8A 5IFMA 2LMIA 5DM7Q 3VAFA 5FJ4A 4Y0FA 4WKRA 5LJ3Y 2MZSA 1YWXA 4YUDA 2CQ1A 2HGLA 2FC9A 5HO4A 3ULHA 2J0QD 3NNAA 1N52B 2DNGA 4C7QA 1JMTA 1NU4A 1QVGR 5JVHQ 2J0SD 1H2TZ 2K3KA 2XSFA 1OWXA 3UE2A 4ERDA 2HZCA 2BOPA 2CQ0A 2RS2A 1X4CA 2LECA 2KI2A 2ADCA 2MKIA 2B0GA 2V94A 2DB1A 3V4MA 5IM0A 1B7FA 1VQMS 5DM6Q 3UD4P 3CD6S 2LA4A 2DGSA 2YKAA 5LXRA 1DBDA 3CUNA 2MXYA 4RU2A 5HL7Q 1ZZNA 4LJMA 3MOJB 1R8HA 2LEAA 3I55S 2CQGA 2DNQA 4OZ0A 3G4SS 4BS2A 2RQCA 2DHGA 2JX2A 2L9WA 1U1LA 2DNHA 4TU7A 2X1FA 3S7RA 3CCMS 1SJRA 1VC5A 4A8XA 2RRBA 2CQDA 1KQSR 2DHAA 1SJQA 1UP1A 1WELA 2EK6A 2M52A 2MZRA 1JJ2R 3EGNA 1UW4A 2HVZA 2KM8C 1YITS 1M90T 3LPYA 3VAHA 3HHNB 1YIJS 4WF9Q 2DNZA 2KVIA 2AYMA 1U1NA 1M1KT 3R27A 5GAHU 3UD3P 1DZ5A 2DH7A 3THPA 1VBYA 1PO6A 1KC8T 1WHVA 1X4GA 2E5HA 1YI2S 1S79A 2MSTA 1U1MA 1WI6A 3MUVP 2WBRA 3G8SA 3NS6A 3P49B 2MKCA 5MLCV 2VODA 1U1RA 1RK8A 2DNRA 2RS8A 1VQPS 2LEBA 5H1SV 2RQ4A 5BJRA 1P27B 4P6QA 1WTBA 4CH1A 2M2BA 2RT3A 2MY7A 1N8RT 4IO9Q 2XS5A 2MMYA 1FHTA 2MQNA 3VAJA 2XNRA 4WFBQ 2MQPA 3G8TA 4OZ1A 2I38A 5GAEU 1X5SA 2KXHA 1WHXA 3MURP 4CQ1A 2RNEA 1A7GE 2YH0A 4TU9A 2KG0A 1OO0B 2LCWA 3VAGA 1IQTA 3P6YC 3CC2S 2M4MA 1W2BR 2Q79A 5DDPC 1DRZA 3MI7X 2U2FA 2E44A 2DK2A 2KFYA 2XB2D 2PEHA 2DNYA 1HD0A 3BS9A 3IWNC 1Q81T 2DNMA 2MJUA 2CPHA 2JWNA 1VBXA 3VAMA 1VQKS 2F3JA 1WG5A 3G96A 4C4WA 1M5PC 2NZ4A 1ZZFA 2D3OR 2DGOA 4UY8T 3S6EA 3VAKA 1SJ3P 5GADU 2CPFA 2F9DA 4QU6A 3J7YU 1VQ4S 2KYXA 2N3LA 1WHWA 3BEGB 3H2UB 1DHMA 2NLWA 1H2VZ 1HD1A 1O0PA 2E5JA 4Z2XA 4WIIA 1FO1A 4TLQA 2DIUA 3CC4S 2CQ3A 4CH0S 2KG1A 1SJ4P 1WF2A 2KU7A 3J7ZT 1H6KX 2O3DA 2OSRA 2G4BA 1QM9A 2AYEA 2MQOA 1K8AT 2MKSA 2CQHA 2L08A 2EK1A 2F9JA 3TYTA 1UAWA 2MSSA 4IOCQ 3VAIA 2ZJQQ 3G6ES 2VOPA 1VQ9S 4YOEA 2KT5A 1WEXA 2LKZA 1WG1A 4QPTA 3RW6A 1X4BA 2MZ1A 3ZZYA 2CJKA 2X1GA 2MQMA 2A3JA 2MQQA 3Q2TC 2HGNA 2DNOA 1F9FA 2JVOA 2DO4A 1X0FA 1SJFA 1OPIA 3CCSS 4J5OA 3CTRA 2I2YA 2G0CA 3G9CA 5CXTA 2CQ4A 1FXLA 1X4HA 3MD3A 2N82B 1FJEB 2OTLS 1L3KA 4F02A 2OJ3A 1N88A 1NJIT 1JJ4A 2DGQA 3NMRA 5DDRC 2LQ5A 3Q2SC 2KRBA 3FEXB 5IQQA 2G1DA 2GO9A 2M9KA 3US5A 2N3OA 1YHQS 2JRSA 2CPZA 4ZKAA 2DH9A 3B4MA 3MD1A 2QA4S 2D9OA 2DIVA 4PR6A 1N54B 3CCJS 2DH8A 4F26A 2KH9A 1D9AA 3U1MA 4U67Q 2MGZB 2QEXS 1URNA 3OW2R 1WF1A 3K0JA 1U2FA 5LXYA 2XS7A 2J8AA 2OSQA 3CF5Q 1FJ7A 2LA6A 2ERRA 2MKKA 1U6BA 1D8ZA 3CPWR 1FT8A 2DGUA 3CC7S 2MPUA 2CPYA 4C0OC 2XNQA 1KOHA 2MYFA 1OIAA 1RKJA 4V19X 3R1HA 3NS5A 5LSOA 2RU3A 3SXLA 4WCEQ 1VQLS 3SMZA 3L3CA 2FY1A 3N9UC 3PIPQ 4QU7A 4UQTA 3CCQS 1NO8A 1R8PA 2RUGA 1A9NB 2E5IA 5IM0B 2MKJA 3B4DA 1PGZA 4PRFA 1U1PA 5LSLA 2M0GB 2HGMA 3S01A 2VONA 3H2VE 2FC8A 3MDFA 3BO2A 1X4AA 3S8SA 4ED5A 2DHSA 1S72S 3SDEB 2MGZA 2M88A 3IRWP 2KXNB 1FNXH 2UP1A 1YJNS 2YTCA 3HI9A 1X4EA 5DDQC 2KHCA 2DHXA 1CVJA 2DITA 1WWHA 3FEYB 2D9PA 5CA5A 2GHPA 4QQBA 5ITHA 1YJ9S 2CQBA 2CPIA 1X5OA 2MY8A 3U1LA 1KD1T 2ZJRQ 3UWTA 1FJCA 4WFAQ 2EVZA 3UCGA 3BO3A 1K73T 1WEZA 2OIHA 3UCZP 3CCES 2KRRA 2M7SA 3CXCR 3CMES 3ZZZA 1VQNS 1P1TA 1JJHA 5DDOC 2LYVA
chains in the Genus database with same CATH superfamily
1GTHA 3DU6A 3X1LB 5IT4A 4WZQA 3O6QA 1LQ9A 2HHUA 1UVKA 1CLFA 1NHUA 4PKDB 3BO4A 3GIMA 4RNNA 2W4CA 4ZCKA 1WDDA 2D3O1 2XGPA 1PC4A 2DGXA 2J6UA 1SV5A 4RNMA 3Q24A 4PAAA 2NSCA 4QOTA 2G2YA 2FLNA 3KHHA 2BRLA 1X9SA 3JQMA 3QJLA 3B8HA 3MM8B 1F2GA 4WWSA 3SYZA 4NMXA 2C2DA 3R5BA 4M5DA 5DG7A 3MUMP 3VZIA 4P2MA 3DYAA 2DJWA 1RWPB 1AZSB 2E1MC 4TXSA 2C2EA 1ZM3A 5KT7A 2BQUA 2NXEA 3NWRA 5LSRA 2NR0A 5IC6B 2WOMB 3NNHA 3HK2A 4S0MA 3UDEA 2IC3A 3FFIB 3VTIA 4F2RA 5DM7Q 5FJ4A 1R0BG 2UXCJ 1YWXA 5F8LA 2YNIA 1T8EA 4DR6J 2HQDA 4QIVA 5JVHQ 1XNQJ 3HF5A 1R43A 4OLOA 3TJAA 1NZ8A 3KLEA 4ZP9A 2KDOA 1FX2A 1NPRA 3A3NB 1T94A 3UFCX 1HR0J 3OFFA 1K0TA 3PYDA 4LRFA 3MHYA 1RU2A 3I9V9 2HNZA 3ZZPA 2HPUA 4NLTA 4L3NA 5HI7A 4F7VA 1MN7A 4DR1J 1FVQA 4IRKA 3RZAA 4Y2KA 1REGX 1MG7A 4PQUA 2V0NA 3KMQA 3NCPA 3HO1A 5D4PA 1J5EF 3TAPA 1YLXA 4RL1A 4A4JA 1R8CA 2VJVA 4L76A 2H5IB 2PA8D 1R89A 4ZLLA 4LR8A 1U0HA 3GQCA 3I9ZA 2XNRA 4U9RA 5D0RA 3DOMB 2ZKTA 3T5HA 1F5CA 1JLEB 5L1JA 3PYFA 2VDHA 4K4YA 2LP4A 2GO8A 1B3TA 3BS9A 1HQEA 4QWEA 2F3JA 1UW9A 3IBCB 3NGRA 1HWIA 1JKHB 2AHOB 4GVBA 2OPQA 2QN6B 3H2UB 2ZVSA 4WFXA 2E5JA 3VGSA 4CI0B 3CC4S 4C3MA 2OGUA 3UNYA 1VRQC 4B3SJ 4K5RA 2CQHA 4F04B 4B9UA 1NM2A 2IMOA 3T9ZA 4ANEA 4M5NA 1ZTTA 4M1KA 4QPTA 4ES2A 4MFBB 4B9MA 1KVIA 3LAMA 3M30B 2V2QA 4N41A 1S49A 4ZP7A 2EXUA 3D54A 5HVFA 3HULA 1FFGB 2R7RA 4C2MA 5KFCA 3CCSS 5ETTA 3MECB 4NRUA 1FXLA 2FYXA 1RWXB 2HFVA 1YG0A 1JJ4A 2AGOA 3Q2SC 2HMIB 2HWIA 3KOAA 3QRRA 5D3GA 3KHLA 3BR9A 3EUNA 1QAXA 3OW2R 2P9GA 2P5VA 4FN5A 3ETOA 3FGVA 4DV4J 1S9GB 4MIBA 2IJRA 1I1GA 5C42A 5KFEA 2DGUA 2DPJA 1NSPA 2OI2A 5HP1B 1T3NA 1WC6A 2OPPA 4OYBA 2OPSB 4DSIA 4C97A 2AMCB 3C66A 2PI4A 5KFWA 4DHVA 3IO1A 4ED5A 2E7WA 2YNGA 1CJUA 1YJNS 1RWVB 5E5NA 2YXLA 5CA5A 1XTZA 2CPIA 1X5OA 5E41A 3B54A 1FJCA 3E01B 3VGUA 3CCWA 5HBMA 4ZPVR 4DCPB 1RT3B 2GS8A 4CTAA 1RJJA 1RT1A 1P1TA 3CE8A 2KB2A 1D9FA 1UZHA 2BJEA 2DNKA 2KN4A 2ZBIA 1F3VA 4WE1B 1WI8A 3IAM9 1Z1ZA 5F8MA 4QR2A 1PSDA 3R5CA 2ZOFA 1C1BA 1D9DA 4P73A 2X1BA 1FD2A 2UXCF 1TKXA 1TFYA 2LEPA 3NP5A 5E3AA 4DR6F 3D2WA 3M9NB 2CQPA 1XNQF 2AT1B 4MK7A 5JMNA 3C6UA 3A12A 4C9DA 4I7FA 3OL8A 2BM0A 3DLLQ 1KOOA 1HR0F 3TARA 2LQBA 4DN9A 2QSFA 3DDNA 4OYMA 2CG4A 1BXNA 1VS3A 1NH8A 1VQ7S 3GE9A 3KLVA 3WHIA 4OHVA 3OTOJ 2CPXA 4QIGA 1T02A 2QLBB 1S0NA 4H4KC 3CCVS 2MZTA 4X4TA 1WC3A 3OT9A 1YBTA 3EVWA 1GFWB 2PMZD 1XERA 2ZNYA 3TX0A 2VBWA 4FXVA 3VGTA 2D1CA 1AROP 4GKKJ 1WG4A 2DYAA 1AFIA 3HCXA 3CCLS 3W62A 5E2QA 3AFGA 3G6VA 4XAKA 2CWXA 1DLOB 1DTQA 3CD0A 1QSLA 3UE2A 3F44A 2BOPA 3MCMA 3OVAA 2RS2A 2R8KA 2VKZG 4EI2A 4DFPA 2NZCA 3V4MA 2CZVC 1F2HA 1YJUA 5AXMA 2UVRA 3WDOA 3LH2S 3T1YJ 3CW2C 1FXRA 4QWDA 4GO7X 1V5VA 3R5DA 1VHFA 2GC8A 2HBYB 3AOAA 1Q78A 2VBZA 3G4SS 3J81j 2QL7B 1RHRB 1TUGB 1TL7B 4C8ZA 3PEJA 2JLGA 4HHUA 2VG6B 4DQQA 2BKNA 4ZVRB 4Y3CA 2GW8A 4ATNA 3QGGA 4ES3A 3JSBA 1BHNA 4USMA 2HVDA 4NLXA 3KK2B 3MUVP 4EYHB 1Q4RA 3Q22A 1IJFB 2W7PA 4P6QA 2LLZA 3K5NA 5A6PA 2XC9A 2RQMA 3K8WA 4F8RA 2K7JA 1SKSA 1ZA2B 4CWBA 2YH0A 1T05A 3LWLA 4TNOA 3M05A 4Y2IA 3IG1B 1TL4A 1NK7A 1HQ2A 3OSNA 4R5PA 2EC0A 1WG5A 1RTDA 1RAAB 4C4WA 2P6SA 4DV5J 2QMUB 4QU6A 5D4NA 2N3LA 4EZ9A 1RAFB 3NL0A 5IC4B 3OR2B 1S12A 2HW3A 4JOUA 3H59A 5LMNJ 4DV4F 4CLLA 1WF2A 2KU7A 2O67A 5M2PA 2NREA 4YB7A 1MU2B 1WOPA 4IOCQ 3T5KA 2K3IA 2QLWA 4LQ3A 3GG1A 2LXFA 1M5SA 4EU0A 3GFXA 1WC4A 3CJRA 4MK9A 2W24A 4Q8EA 5ETPA 3O2IA 3EJMA 2WW8A 3QO9B 1KDNA 4N8NA 3HHEA 1H7WA 1XIQA 2R8HA 2FLOA 2CJQA 1UWAA 4DQRA 1YHQS 3EE3A 4K0KJ 4RNHA 1B0TA 4RUCA 4OI2A 3MMAB 4EFAC 4F26A 3U1MA 4U67Q 1WF1A 2HQGA 2VC1A 2J8AA 2ZFHA 3PW5A 3JTNA 3BSCA 4CO3A 1T9XA 1TL1B 2C28A 3QIPB 4LSNA 4FF4A 5KOXA 4OI1A 3AY0A 2B4UA 2VB6A 2PGCA 2RU3A 2FY1A 2ASLA 1U8WA 3JSYA 2VPWB 3TVZA 2IM3A 9ATCB 3CVKA 2NUHA 4ZCMA 4EBCA 1JWWA 3M2VA 3AXKA 3QNWB 5A0YB 4RW6A 2IIHA 2W25A 1S6PA 2Z2ZA 2UZAA 1X4EA 4URQU 2KHCA 1TKZA 5GMEA 4UOHA 2OKQA 4DZ6A 4O0IA 1YX2A 3TUIC 1R0AA 4B9NA 3NXZA 1HMVA 2V63A 2XHWA 5F8JA 3OTOF 3JSMB 3M8SA 2VQEJ 1X60A 4H4OB 3EPGA 2ZH3A 1JLBA 5E3RA 3GLJA 3AT1B 2IMWP 2ZVIA 2E5GA 4IKAA 4X84A 5LJ5Y 3SDEA 2YWKA 2JFKA 3ZZUA 1VR6A 2VFTA 4GKKF 2R7UA 4O4RA 1VJQA 1JB0C 2B5JA 5A8WA 4LF9J 3GV7B 2HHVA 3NNCA 2JL9A 1U1OA 2PA3A 3N5FA 3I56S 2DVIA 2HFUA 3Q86A 3V2UC 3T1YF 5F8IA 1FDBA 4NXNJ 3FRZA 3MPWA 1N32J 1ZAWA 2QE5A 3FBEA 4LF6J 4MMOA 3MTJA 2DGVA 4FXWA 2KFZA 2U1AA 4DI6A 4ALZA 2Q6BA 1WC0A 5KFVA 2AEMA 1E6VB 2AD9A 3FZBA 5F3TA 3DRRB 1YRUA 4IR9A 4YUDA 4C7QA 3QYYA 4TY8A 3MM5B 3V6JA 4CYUA 2P8IA 3FBFA 2J0SD 1H2TZ 2BOAA 1OWXA 5E3PA 3MR6A 1IN0A 1N5YA 1X4CA 3TNVA 3MM7B 3QLHB 2FVPA 4OI6A 2ZBRA 3IR6B 2N4DA 2CZ4A 2DGSA 3D68A 3CUNA 2DHHA 1KHWA 2GAHC 2FDNA 4BS2A 3GYGA 2JX2A 3ZO7A 3CCMS 3PO4A 2CQDA 4DV5F 3Q0AA 3DOLB 4ECZA 3I0SA 3I0RB 2HBZB 2ZH1A 1XMBA 2MKYA 1PYOB 2W4PA 3V6HA 2CJAA 1EETB 3M8ZA 5LMNF 3EPIA 4ZVEA 1JLCB 1U1MA 1WSVA 1Q8BA 4CLZA 1RK8A 1HBUB 4ZPTR 2XM3A 4QPXA 3SV4A 2B51A 1KFSA 2K06A 5H9FK 3EDQB 3LP2A 4IO9Q 4N7TA 4WU2A 3EGWB 4IFVA 1SC6A 1Q5YA 3W64A 1UA0A 4ZVSB 1RHJB 3U02A 3VHQA 1LOUA 2RNEA 3UNGC 2UVWA 4G1IA 2L9NA 2K1RB 1SUQB 5C7PA 2M4MA 4K4TA 3K2YA 3IA0A 1DRZA 4DDFA 3OVBA 2U2FA 4I6YA 3LWMA 3GYXB 2DNYA 1T3OA 1Q81T 4QW8A 3UR3C 3K7RA 2O01C 3VAKA 1FTCA 4K0KF 2F9DA 1T0TV 3J7YU 4X64J 1HNVB 4CO1A 2XMJA 1NJYA 4K4UA 4RNOA 4ZS6A 1YZ7A 1SV5B 3ZZOA 2CKWA 4DUYF 4O0NA 1H6KX 3R7BB 3UI3A 1KLMB 3MOZA 2FHKA 2ROGA 5KFHA 3IP0A 1VQ9S 3MM6A 4DR4J 2QL5B 1OMSA 1I3OB 5HQMA 5BR8J 5AE1A 3NLCA 3TZYA 3DYAB 4KO0A 3TUJC 2I2YA 1WOSA 4OX8A 5CXTA 1AB8A 4CZCA 3MD3A 4UUWA 4DV7J 5HJXA 1YKWA 1BQNA 2QGFB 2WVDA 3M6XA 2JRSA 4DR3J 5KFNA 2W7OA 3PYGA 2H51B 1H0HB 2HKEA 5THWA 2VQEF 4NYPA 2IC3B 4CP5A 4DV0J 2XS7A 1V3SA 3UQSA 4LSZB 2PMWA 2YNIB 1RTIB 4JI7J 1YBUA 2ZWOA 2ROEA 3NGTA 3DKDA 1IM4A 4B3RJ 3I32A 3MPDA 3PZPA 1SC3B 4DR7J 2RUGA 2B43A 1U7LA 2V4QA 3CB4A 4L3KA 4LF5J 1NDKA 3PJ9A 3OJSA 4YQWA 2JFDA 4IR1A 3VR1A 2MGZA 2M88A 1S1UA 2HNZB 4IG0A 4ID8A 1MWQA 5GADI 1OY6A 4KY3A 1BD6A 2D9PA 2MDAA 1CG2A 3U1LA 1RHKB 1FRKA 1K73T 4NXNF 3UCZP 3RRKA 4DOZA 3ILLA 4RUHA 3UR0A 4QR0A 5E7OB 3E3XA 3H8YA 1G4CA 4LF6F 1B70B 4Q5VA 1REVA 2M8DB 1YJWS 2IDEA 1V9OA 3EXYA 3MMJA 2BANB 5HJYA 1GNKA 1N5SA 5DETA 2B3TB 1NK6A 1AUSL 5FIIA 2XULA 4LBIA 4PPDA 2KM8B 5CHCB 5GAGU 5DZ6A 3D3CJ 2XS2A 3FCHA 3QRQA 2ZM6F 5B09A 2RU9A 2HS3A 3CULA 2LXUA 2ZZMA 4K8RA 1F0XA 1JXVA 3M9OB 4KH0B 4OZ2A 4TU8A 1AUDA 1U26A 1M5KC 4GVBB 2OPQB 3OD2A 2I0XA 3M6WA 5B0GA 1IKXA 4JUZA 4BDPA 2ILZA 1HNZJ 2YH1A 2DNLA 2R7VA 4DX8H 3GG0A 1FWPA 2GIFA 2VG5A 2CJXB 2V2VA 2MKHA 3MMCA 5J2MA 2UUAJ 1KTQA 2V8HA 4EO6A 4DL2A 3AQOA 4Y0FA 4L6V3 4R0EA 4UZBA 1NKCA 4DU7A 5HO4A 4UTGA 4LVNP 4OV1A 4YN3B 1HIYA 4KV8A 3AJDA 3QAEA 5ETVA 1LK7A 2C2NA 3OL6A 1JLAA 4RZRA 1TELA 3N6MA 3PY8A 3G2XA 4I0WA 3OFGA 3F41A 4J7CA 5D3GB 2ZBCA 1HYSA 2LEAA 1PKUA 2PFDA 1OPZA 5HVHA 4CLFA 1DQ8A 1SH2A 4B3TJ 2IA6A 1KQSR 2B7BB 5C42B 4J9VA 3SSRA 3VAHA 3A3PB 5IT0A 2RJZA 5KG6A 4F4YA 1HPZA 2OPPB 3QFWA 3LP1B 1RB0A 1WHVA 4Q8FA 2MEWA 3G8SA 1U1RA 4O3QA 4K4VA 1CJVA 1ICEB 2R7TA 1EQMA 5BJRA 4ZJLA 1VRTA 1EX8A 2RT3A 2YNGB 1CJUB 1LW0A 4DR4F 4URGA 2MQPA 2D69A 3DLEA 2KXHA 4K4WA 3T1HJ 5BR8F 1NK8A 1IQTA 2V5HG 4P71A 1RHMB 5HBMB 4ER8A 2Z2YB 1URRA 1RT1B 4DV7F 2CNLB 3CDAA 1TQLA 2BQ3A 1M5PC 2F4FA 1ZM2A 4OJGA 1DARA 3C46A 2NQPA 4A46A 1HW8A 4ZVUB 4G1QA 1H2VZ 1VLOA 1C1BB 3IWLA 3QFHA 4DV0F 4TLQA 5B0AA 1SJ4P 1TKXB 4OMFG 1I6JA 4HH1A 3OL7A 1EHWA 3BB5A 2J0XA 5I4MA 4B3RF 3I5BA 2Y0BB 4I7FB 4DR7F 3IGNA 2R8JA 3RW6A 3W3SA 4DUTA 3MPUB 4LF5F 3NS7B 3J81U 5HQ8A 1PBUA 4TYAA 4J5OA 2C1EB 3KNAA 2D74B 1CQNA 3CTRA 2E9TA 1S76D 2B9YA 4M5IA 2VFRA 3G86A 4L75A 5EGYA 3QPIA 3RAXA 4C8KA 4N76A 2W8LA 2YKNB 4ZN3A 3UDCA 3J7Z5 3M8QA 3AD8C 1TK0A 4RBVA 1N54B 2OFGX 2KH9A 3HJVA 3K0JA 4F67A 1GT8A 4XPEA 4YMEA 3H5XA 1MROB 4MTPA 2RF2B 2JJ4D 3FBBA 4NYZA 5G0RA 3FNNA 4JI8J 3EYZA 4QWCA 3HT0A 4QU7A 3BYPA 1GMWA 2E7VA 1R8PA 4RW9A 5IS2A 5HMYA 2IDLA 1U1PA 2FJBB 3GR0A 3NCRA 5L1KA 3J7AN 2YQ0A 1T9UA 1S72S 5D4LA 1RT4A 2HG4A 1Y0HA 1UETA 4A8KA 1GMUA 1UPMB 1D1UA 4PG5A 2PD1A 3FEYB 2GGPB 5J2PB 1FJGJ 4IQMA 4YY3F 4Q2LA 3CEDA 1IR2A 4ID5B 1JLQA 3SSQA 2ZUGA 2XY5A 1NDCA 2ASYA 3SCKE 1XMOJ 1RT6A 2AW0A 1S0MA 4LF4J 2AX1A 2HWTA 1U1QA 2OD6A 5H9EK 4RNFA 3R6GB 3CD5A 3QGHA 2PSZA 3W65A 1CSJA 1HBMA 2ZBPA 3N6LA 1H2UX 4FBUA 3HSGA 2ZC4A 3KLIA 4CIOA 3AD7C 1XR6A 1UFWA 4JI1J 5KT6A 3MUTP 2IVFB 1U6ZA 2DISA 3VF0B 2DR7A 1T05B 1B0PA 3VQTA 1RTHB 3AHPA 1WOOA 2RH3A 1RE1B 5C24A 4F0HA 4PG6A 1U6FA 4AQYJ 4DS5A 3KNGA 4ZHRA 3GJTB 4R5PB 1RTDB 3PIOQ 3D3BJ 4RWXA 2CQCA 4I2PA 3W5ZA 4KHPJ 3IFEA 4IOAQ 2C3UA 4J9RA 3MPYA 2AGQA 5K8NA 3Q8YA 4J9PA 1G2EA 4WFNQ 4B3TF 1RWUA 1FXDA 1RCXB 4DWIA 2KYZA 2W9BA 1TMJA 4XIUA 3BZQA 2J9DA 2AZ1A 2V8DA 2HFOA 1SC1B 4HKQA 4P10A 4U7CA 2PN6A 1QVGR 2YKOA 1AZSA 2KI2A 4LSLA 1SH0A 2Y1RI 4KIAA 1G7CB 2WOMA 3PG9A 2BRKA 3W9JA 2EC2A 1L3TA 1FKOA 5HL7Q 3B82A 4USUA 3FFIA 1SKUB 1XR5A 3NRBA 2FGOA 1Y10A 4A8XA 2VFSA 4I56A 4LSNB 2MZRA 1TK5A 3FCVA 4B9LA 3EZOA 2FVCA 5HVGA 2HHHJ 2MSTA 4O3SA 2ALYB 1RWNB 4RJVA 2QA2A 8AT1B 5H1SV 3J80Y 1SL2A 1Q5VA 4O3NA 4CH1A 4RW6B 2UUWA 5D0EA 1GK8A 3RBDA 1TKZB 2I9SA 1WHXA 5KG5A 4IYQA 4GC7A 3PM9A 4X4NA 1R0AB 2BYCA 4TU9A 2HNDA 2GNKA 1HMVB 2F40A 5ETKA 2BACA 4NEZA 4ZVTB 3QWUA 2XB2D 1FNOA 1HD0A 2CNOB 3SIPB 1Y11A 3D6FB 3P45B 1JLBB 4V1Ak 2DGOA 5T41A 4OZLA 4RUAA 1WDTA 1ACMB 3EMTA 1KTVA 2NLWA 2VBYA 4KFBB 5F8GA 3DOMA 2Y8YA 2JEIA 4CH0S 3HZEA 6FD1A 2FLPA 4H4MB 2OSRA 4JI8F 4DLEA 3DHXA 5IZHA 2XMUA 1NSAA 3IMQJ 4CO4A 3VV2B 4LREA 2V9WA 1JKHA 4BLGA 3CJ2A 4F4AA 1X0FA 2OMOA 1DTTA 1OPIA 2OP5A 2D7SA 4J9OA 3CIMA 1SIZA 3KKFA 2P6TA 4DQSA 2DKOB 2RAQA 2G1DA 1JIHA 4DV1J 2BE7D 2DH9A 2P9EA 2ZDPA 3BJYA 4OZNA 3FZ2A 5T7LB 4IFYA 4IH6A 3OBIA 1XMOF 5A8KB 4LF4F 3IM9A 1FJ7A 5ETRA 4HI2A 3WQPA 3TQ1A 1U6BA 3CPWR 5JUMA 4UZCA 2QSWA 4TY8B 2CPYA 3MECA 4USIA 5L1IA 1VQLS 5KFLA 4DL4A 1N5YB 3CCQS 2G9OA 1S10A 4DFKA 4X4RA 4I69A 4NZ0A 4FNIA 2ZH7A 1EQ0A 3H4BA 1KKHA 1RAHB 3S1TA 3MM9B 1RA7A 3H25A 4X4UA 2DHXA 4LVOP 4X4QA 1WUUA 1S9GA 4K2JA 4AQYF 1KD1T 5AXLA 1NPPA 4LFBJ 2PEBA 4KHPF 3W61A 4QW9A 1SIWB 2RE1A 1VQNS 2FJDB 4PXBA 1SKWA 5DDOC 1DFDA 2OPSA 2QLJB 3CCRS 3AXMA 1XC9A 2G0IA 1VQ6S 4WIQA 3KLGA 3I5AA 2A6MA 5GVQA 4Y00A 4C8OA 3HHLB 2DEIA 3LP2B 5CYQB 3TW0A 1UFLA 3DRXA 1HARA 3C6TA 2FUG9 5DLFA 3QIDA 1RAEB 3KYLA 1WKLA 4Q2MA 1S77D 4WE1A 4PUOA 1RWOB 1X4DA 4OLPA 4ZVPB 3TAMA 3L7PA 4NYOA 3CWJA 2DRDA 2LVWA 4J90A 5KFMA 2IY5B 4CLSA 4TKTA 2FPHX 4DQIA 2GJFA 1VC0A 5SZTA 3X3UA 4JB8B 3LANA 2JOQA 2CPJA 2JVRA 1VISA 3NOGA 4ED2A 4IUFA 3PTWA 2I8EA 3CDEA 1JNRB 4YHHJ 1CPZA 3RB6A 4KAIA 1JNZB 4PG4A 1NK9A 2CA9A 1DQ9A 3WC0A 3GB0A 4ERDA 2CQ0A 2KZZA 1NAQA 5A2QY 2LECA 2OUGA 3W60A 2LA4A 4ILRA 3KK1B 4KHRA 3P96A 2LDYA 4N47A 2IPOB 4MKVA 2RHSB 3JS9A 1BQNB 4YP3A 1QLNA 2EBEA 5BXIA 3EVOA 4KTQA 3MOJB 2YWHA 3PW2A 3I55S 3KJVA 1C4CA 3FQKA 3RB4A 1IM6A 4Q45A 2NXCA 1DLOA 1TL3A 4QIEA 2DNHA 5D15A 3NBPB 4DFJA 4OX9J 4U96A 2VA2A 1UW4A 3DU5A 4DR2J 2ZH9A 1YIJS 4WF9Q 2AYMA 1M1KT 1IKVA 5FLXU 3TEGA 1RBLA 2FTRA 2DNRA 2ZNZA 5EX0A 4ZP6A 2RQ4A 1QJHA 4K4ZA 2MY7A 3H98A 1TL7A 2HRTA 2P9CA 4IG0B 2QZ8A 2J9DE 5IQ6A 4D3GA 2I38A 3J80U 4ED1A 2AGPA 1VMBA 4JI0J 1FD8A 2VG6A 3GONA 4J9KA 2Y1JA 1U24A 3K59A 1EKRA 2E44A 2ACYA 2DK2A 2KFYA 4AL5A 3TJ8A 1YGYA 3KK2A 2CPHA 4YR2A 3PRDA 3VAMA 4ZLPA 3ZTPA 4DV1F 1SJ3P 1REVB 2CPFA 1RBOB 3R2CJ 4UOGA 4YDXA 1SI9A 4PCQA 2XMVA 3BKUA 3NGSA 1VK3A 4WIIA 1QD1A 1NDLA 1I94F 3PKMA 2HBRB 2DY1A 2QYCA 2AYEA 4AL7A 5KFUA 3TOQA 2EK1A 4HTJA 2HEKA 2ZOMA 2XY7A 4YOEA 4RW7A 4PABA 1WG1A 3ZZYA 5RUBA 4B17A 2AZ3A 2A3JA 2CIMA 3JYTA 5EX3A 1QUVA 4ZPDA 4X65J 3OR2A 1YRTA 4JV1A 5K9FA 2H1YA 3C15B 1P9YA 1Q79A 1IKXB 2Q1LA 4DSFA 2FJEB 1N88A 3HXMA 3WBZA 2IFXA 1IR1A 1K44A 1S5ZA 4LFBF 2QA4G 4FXDA 2VD3A 2V8PA 4YR0A 2E66A 4PEOA 2VG5B 3DM2A 1NJXA 3R97A 5J2MB 3MMCB 3TX8A 2GQQA 4QIFA 5L38A 3O44A 3AD9C 4ECUA 3QO9A 3V4IB 5ETSA 4C0OC 1F3FA 1KOHA 4KV8B 3D4JA 2ZHOA 1M1GA 3R2DJ 3KJQB 2M0GB 2B8QA 5HMWA 3S8SA 5T14A 1SPBP 1SKRA 1RISA 1HYSB 3A4TA 2DITA 4CLTA 1TL1A 2WVEA 1IBLJ 3QIPA 3UCGA 2C2MB 4WXOA 3R8YA 1ZM9A 3KUEA 3M8YA 5CCLA 2XMWA 1G1XA 5AE3A 4OI4A 1HPZB 2V2KA 2XEXA 5CYMA 1UMJA 2G2ZA 5A0YA 1T03B 4NLPA 1XWLA 3H5YA 3OQ2A 4KGVB 5A8RB 1LW0B 1QVFR 3AA8A 3RBZA 4YHHF 1X5PA 3DXBA 2QV6A 2WBMA 4G6VB 3P5TL 4K2XA 1W26A 1QSYA 1KEKA 3MXHP 2BJDA 2WCXA 4YS2A 3TO8A 3UVJA 4CDIA 2VF3A 3Q8UA 1RA6A 4QWBA 2XMMA 2J7KA 3A8JA 4DR5F 4M8LA 4O4GB 2UUBJ 1JK9B 4DS4A 1HA1A 4F3OA 1SQGA 1A6LA 3SBMA 2DGTA 1XMQJ 5I42A 3A1YG 2NXJA 4X4OA 2RDJA 1HLWA 3LA0A 4FYDA 3IWXA 2OPRB 2POKA 1AA1B 1WF0A 2GIQA 2JZ5A 4URSA 4ED0A 4DR2F 2LMIA 5LJ3Y 4MIWA 1NHVA 2FC9A 5FD1A 4IRDA 2ZD1B 1TKDA 4WYLA 4IH5A 2CDQA 4DLGA 5CABA 2K3KA 3H40A 1ULRA 1NB7A 3Q83A 2ASJA 5HK4A 3OTCA 4JI0F 1E6VA 3M8QB 4BCAA 1S6UA 1Q0NA 2CQGA 1RT5A 2DNQA 1S1TA 3CDWA 4KPCA 5I3UA 2IBKA 4TU7A 2HS0A 5DS7A 1KVKA 3PR4A 3VQSA 5G0RB 1HNWJ 2K2PA 2ZH4A 4B3OA 4J9NA 3R5AA 3D6TB 3MM7A 2X3DA 3MEKA 1GQEA 1FWKA 3CIZA 3POTA 4RW9B 2EFPA 4O44A 3RRHA 2DEJA 1S57A 4CNZA 1OYEA 1Y5NB 5CAAA 3CO0P 1RT4B 1U02A 1U45A 4U8YA 2NPFA 3BDEA 2MQNA 1FHTA 2HAFA 3N4WA 2VBXA 3BSNA 1UZDA 1X5SA 2F8EX 1B0VA 3I0RA 3MR2A 3HVRA 2DY9A 4HDHA 1B7YB 4PXEA 2Q79A 2CJYB 1Q16B 2HK2A 2PEHA 2AJ1A 1LWFB 1EZZB 3WX4A 1RT6B 2MJUA 1JLCA 2G1HA 1OY9A 1RYSA 1HBUA 4WFZA 1MMLA 3JAMY 1FE0A 1VQ4S 4KR0B 3BBFA 1HBMB 2E29A 2XSJB 3KLIB 1Y3KA 1W7WA 3KDNA 3QGPA 2XLKA 1VQYA 1S48A 3GFYA 2A0FB 2QJ3A 3HVAA 3OXLA 3DDIA 1S97A 1D8YA 4MIAA 2MSSA 3A3OB 1Q8LA 1RAGB 3BM7A 1RWWB 2XWXA 1J27A 3HHDA 1ROFA 1MMDA 5C24B 1N33J 1H72C 1QSSA 1UEUA 4ZHRB 2R9LA 2YQ1A 1HNVA 4I2PB 5ETNA 2G0CA 3BV8A 2HVIA 2DXDA 2EI5A 1F60B 4OL8A 1NJIT 2FJAB 1M1HA 1W2IA 4USWA 4R8UB 2KRBA 1KLMA 2R7OA 1IBLF 1IBKF 4A8FA 4LF8J 2W9BB 2D9OA 2FVSA 1SL0A 1X7VA 4OJ1A 3BQ0A 1VQSA 4Y2AA 4HACB 1D8ZA 1G3OA 3W2VA 3NS5A 3JTOA 3CJKA 3H7HB 3ZTSA 4LSLB 2R2RA 1B64A 5J2NA 1A9NB 3W5XA 2MKJA 2XMAA 5IT9Y 2VPXB 2YWGA 2VQFJ 3BO2A 4C3KA 1FKOB 4K59A 3IRWP 2KXNB 3HI9A 2WSEC 1GH8A 3ET6B 1MWZA 2VDIA 4I2QA 4HYKA 1IBMJ 2CQBA 2YKPA 1RTIA 1TR0A 2W7AA 3GIRA 4NZ7A 1WEZA 3KDOA 5ADZA 1VDHA 2C3PA 2UUBF 5D8HB 3D0IE 5DQGA 1XK8A 1CJTB 2OO4A 1TTHB 3NAIA 3K8VA 3NGUA 2MJNA 4JI6J 1NJWA 3DRYA 4DX5A 4NCAA 2X51A 2MHNA 1TL5A 2ZJPQ 4L73A 2GVZA 3G8QA 1M5VC 1BY9A 3GIKA 1N6QB 5D78A 5KFQA 3EGZA 1TZ0A 3KUHA 4NLWA 1VQ8S 1FDDA 2DO0A 1ZTWA 1PBAA 3D0HE 4DQPA 2HNDB 2HVEA 3GJSB 5IWAJ 4QWAA 3FEZA 5K8OA 4X4VA 3EVMA 4P9SA 2HNYA 5BYQA 3WIUA 1VQOS 2IAJB 2QYGA 2VOOA 1UA1A 4OI0A 4ANCA 3BGUA 1T9TA 2MZJA 4WTOB 1KQFB 2C3MA 4NLGA 1IUJA 2RB7A 2R8GA 2BANA 3L9ZA 4DF4A 4PG7A 1GXTA 2K7KA 1FKAF 1SL1A 1OJ4A 3Q23A 1VQ5S 5B7WA 2FHJD 1YTYA 1GEHA 2FLLA 3OHBA 5KFIA 3SZ2A 4ZK7M 1HNWF 2FJVA 2V4JA 3KTQA 3DOKA 2WONA 1UCNA 1RDRA 3G82A 3L09A 1PCAA 1IKWB 4QR1A 4FP9A 1VI7A 3V81A 1Y5IB 3OV7A 4DJBA 1RYRA 1OQ3A 2R3VA 3DLGA 3K5MA 1DTTB 1OSCA 2YNHB 5JJBA 5E3CA 3KLHA 1B7FA 2L9DA 3MEEB 3C16A 2CJBA 2QC3A 7FD1A 5LXRA 3ETMA 3FK4A 1D09B 2OEKA 1HQUA 4LJMA 1RHUB 2VFUA 2W2MP 2V68A 3BKTA 3V6DB 2OLWA 3NY0A 2C3OA 5C2CA 1C0TA 1S99A 4IFYB 4UW2A 1O51A 4ELUA 2J6TA 4P2FA 4UY85 3OJUA 5B08A 3UDLA 4F50A 1SJQA 3HSJA 1UP1A 2UXDF 2JH3A 4ECXA 3FCWA 1IJEB 3PW0A 3LPYA 3BYRA 2KKHA 1NJZA 5L9XA 1ZYQA 5CZVA 2DH7A 2J7WA 1X4GA 4EWTA 3N28A 2RHQB 4JYAJ 1TVRB 1BQXA 2GIRA 3KUGA 2M2BA 4DUZJ 3UN2A 2PO4A 1YJRA 3QWPA 4WFBQ 5KFGA 4NEYA 1RAOA 5L1LA 2KG0A 1OO0B 4WFYA 3VAGA 1TV6A 3HMJG 4NA2A 1U25A 2YX4A 1Y7PA 3QT6A 3LP1A 4I4BA 1IKYB 5I3QA 2XI3A 3I6PA 1B4SA 4UY8T 3M2RA 4WTYA 3P4UB 2UXBJ 3KLGB 4LF8F 5IV3A 4CM2A 1T95A 2KYXA 2CWKA 3BEGB 1C1CA 3ITHB 1UJ6A 1HD1A 1WORA 4RR5A 2AF6A 3JAMU 4C11B 1XJWB 2F65A 2KG1A 2DRBA 5J2QB 3TA2A 3C6TB 4PWWA 2MKSA 1OY8A 2L08A 3CNQP 4ZVFA 2AKWB 3ADAC 4NZ6A 5DQHA 2VOPA 3M1VA 4PUOB 1U8SA 1EP4A 2MQMA 2HGNA 4ZVOB 4A8MP 4DX6A 1XQIA 3TAMB 2VQFF 1SQEA 1X9WA 1SJFA 2AEJA 2XO7A 1Z2ZA 2ZH8A 3HFKA 5EWGA 1RBAA 4F02A 5ETOA 3NMRA 3FEXB 4DZDA 5F0WA 2CPZA 3C2PA 1A0OB 4RLEA 4AFFA 1VFJA 3QATA 2MKKA 4JI6F 2YBVA 4KBIA 5LSOA 2HQIA 2HFZA 4TYBA 1JQGA 1QE1A 3CO9A 4DEZA 3CGIA 2YKNA 1QTNB 1S1WA 1PGZA 4DR1F 5F9LA 3HFVA 4P75A 4P7VA 1RACB 1MMNA 5IT9U 5IWAF 2B56A 3KJVB 5DGBA 3ZFVA 1MROA 2RF2A 4C98A 3IR7B 1YVFA 2Z2LA 1CQMA 1TL3B 2GHPA 3BSAA 1YJ9S 3PFEA 1WNEA 2BM1A 3BO3A 2KT2A 2OFHX 2D3UA 2AEFA 3CMES 2H54B 3RG6A 2DNPA 1T9VA 1IKVB 4YFUA 2CPEA 3EM1A 1Q7LB 3GCWP 5KT3A 2LQ9A 1KHVA 2I1RA 1FK9A 4M94A 1WTFA 1FA0A 4NLDA 3T6BA 5C5JA 2GGPA 5J2PA 5J1EA 3AJ1A 1HHSA 4BWJA 1UTAA 2R7QA 4LF7J 4ID5A 2M8HA 4PZVA 2WVFA 1S6QB 5AJ3J 1HHQA 1WEYA 4ENOA 4YB6A 1ZBTA 1DAXA 4B3SF 5IV4A 4LMZA 2B7CB 3TA1A 1NNDA 1RUSA 2UU9J 1RU1A 4A8YA 2XMKA 4WP8A 5M2RA 4LIRA 4CRJA 4F36A 3D28A 1IQZA 3A8EA 4N8OA 2XYGB 3BREA 1NPKA 1PC5A 4B02A 4E8UA 2CDRB 1SXLA 2VA3A 4AT1B 1RTHA 3PX6A 2AYBA 1HWKA 2V2ZA 4RUBA 1H7XA 2NYHA 2EFVA 3PDNA 1AXQA 2CQ1A 1RWKB 4RW7B 4A48A 4EBEA 4YB5A 1N52B 3DRPA 1UKUA 3JQJA 3JYTB 4JYAF 2OAUA 3BGOP 3CCTA 1UJ4A 3W9HA 4DUZF 3HD2A 4FKXA 5IM0A 2GQCA 3RR8A 3ICLA 1H3DA 5AT1B 1DBDA 2Q43A 3CJ8A 4X4SA 1BUXA 3BGFA 1T7PA 3DM2B 2DHGA 1U1LA 2AU0A 5C25B 2HHQA 2QG9B 3BF4A 1L5UA 2I5JA 1FRLA 2FVRA 1R8BA 2KT3A 1EIYB 3PX4A 2W9CA 4M5GA 2AJFE 2YWEA 2NXNA 4RKUC 2C2RA 1H98A 1F5AA 2KVIA 2V50A 1NK5A 4M5MA 1WJ9A 1VGYA 3THPA 3ENQA 3H2LA 3UDVA 1RTZA 1S79A 2CVIA 2OELA 2YPYA 5MLCV 2OEMA 1S7HA 4A8OA 4DL7A 2VKRA 3KG0A 3PRBA 1JLFA 4CLUA 2XS5A 2G13A 1CEZA 5GAEU 4WYWA 3DHWC 3MURP 4F3QA 2MQ8A 3BH7B 4AL6A 5DDPC 1GX6A 3PYEA 3MI7X 2O5DA 1VBXA 3GV5B 3BBBA 7AT1B 5CYMB 1FEEA 1VRUB 2YVSA 3OPKA 3RUBL 1S6OA 4R25A 4I64A 2P2CB 2VHGA 2BE2A 3MWBA 2IBOA 4K4SA 4C0HA 4DG1B 2MQOA 3TUZC 1Z4UA 4B08A 2W01A 3D6MB 4LRDA 2IM2A 2F7VA 3LOUA 1KR4A 5KFOA 3UVJB 5B0CA 2CYYA 2BMBA 2V34A 2CJKA 2B6AA 2MQQA 1NSKL 4ZPBA 1GX5A 2A1BA 2RKIA 3T1AA 3Q8SB 2WW4A 3HLUA 1R31A 3AOCA 4KFBA 2GJ2A 2ZITA 4O3PA 1VYAA 1X4HA 1UL3A 3RTVA 5GMDA 4USVA 5I42B 4XTTA 4H4MA 2QIFA 4J9UE 5IQQA 3B4MA 4HHHA 2QA4S 4GVLA 3LUYA 2MLYA 5IOLA 2HS4A 5HLFA 1C0UA 2ZH2A 4IG3A 2LU2A 2V6AA 2GHVC 1Q95G 2Q66A 3KG1A 4RBUA 4AUKA 3W9IA 3H0PA 5H9EJ 3HSDA 3I4HX 2B8PA 2DCLA 2AJ0A 4LF7F 3H2VE 1VHIA 2OHDA 4J9SA 3PX0A 2DHSA 3OFEA 5T7LA 1RAJA 5AJ3F 2RUSA 3BGLA 5A8KA 4OZ5A 2OMLA 1RT5B 1S1TB 1CVJA 3J7YI 1ZPVA 1YJVA 5I3UB 2ZJRQ 4HT5A 1IWAA 2IM1A 4UOFA 2JNJA 2UU9F 4B3OB 5KT5A 3BGRB 4M5KA 3L95X 3POTB 2RRAA 3MCNA 2Y1IA 2CFXA 4O44B 3THTA 1FFSB 3M32B 3MM9A 5KFFA 2YX7A 1U47A 1BLUA 4LBPA 3D66A 4L72B 2HYIB 1HI0P 3TRGA 2UUCJ 1KNZA 2CQ2A 4EYIB 4OHYA 1XNRJ 1BMQB 1PJ7A 3CJ3A 1K9MT 2HZVA 3K5OA 2B9XA 4FVCA 3GSDA 1YJTA 4LT6A 5K8MA 3AODA 4WK1A 3KJFB 2HHWA 3FBCA 1RLDA 4QZVB 4Q44A 4B3MJ 3HHLA 5CYQA 5D77A 4OYWA 2FJXA 4F4KA 6FDRA 2UV8A 2VV5A 1XBWA 3G6XA 4RBTA 4FPRA 1ELOA 4PXCA 5M2UA 5AXKA 3N6NA 5BYRA 3DGPB 1TFWA 1P6TA 2J7UA 4X66J 3VAFA 1BC6A 3HZGA 3NGKA 2XHCA 4QYZK 4DV2J 4OHXA 2HLTA 4NOHA 5DG8A 1SB6A 3GP9A 2BXJA 4Q43A 4Q0BA 1QAIA 2CXEA 2CZ9A 4B9TA 3UN3A 2ADCA 2RDDA 5C2GA 2CAJA 2V94A 3QT5A 2IRYA 2GCFA 3FC9A 2KJVA 1LXNA 1ZETA 2YKAA 4DFMA 1O8BA 2VG7A 2FHMA 4LBHA 4KKOB 5DG9A 2L9WA 1AW0A 5F9NA 3Q8RB 1PILA 1VLYA 3SCJE 4C3LA 2DHAA 3KJNB 1GMVA 3W2VB 4K50A 2M52A 4HEA9 1JJ2R 1F9HA 2KM8C 1YITS 3DXSX 2EKNA 1B99A 3CJKB 2EEYA 2G0JA 2YKMA 1FRJA 5GAGI 3KK1A 3MAQA 4IRCA 2RD5C 5J2NB 4ANDA 1KC8T 4LRAA 2QO3A 4RX6A 3MCOA 2LEBA 2V8VA 1MN9A 1HBOB 2UVUA 3NBPA 3EZUA 2V8GA 3NG8A 4I2QB 4HL9A 3GV8B 1R0CB 2BQRA 1NEEA 4YEAA 1UEKA 1UEVA 3FRYA 2QMXA 1IBCB 4N77A 2ZOGA 3DRSB 5KAKA 3O3LA 2IYGA 3DI6A 3N79A 4LF9F 2NZ4A 3CD7A 4ECVA 4FBTA 4U6PA 3QZ7A 2FJWA 2H5EA 2IRXA 1XEZA 4UUXA 2D3ZA 2GVZB 5KFRA 1ZS6A 4F4XA 1H74A 3DLKA 4Y34A 3SSSA 3GIIA 3O5TB 2A10A 1NCLA 2FZCB 3SI8A 1N32F 3KMSA 2XCAA 5KFTA 1CULA 1S9EA 2KT5A 1HW9A 2HNYB 4CM0A 5KFPA 2X1GA 4ETZA 4OJHA 2Z4PA 4B9SA 2YWFA 3D67A 4M95A 3HSZA 5CD4H 1UFKA 3ZC4A 4XO0A 4MYUA 3GILA 1K47A 2HRYA 4M63A 3EZ5A 3WIVA 1RP5A 4UT4A 2V4JB 3DOKB 2WONB 3VGVA 3G82B 2LA6A 3IGVA 3V81B 4IDKA 4V19J 3CC7S 4MKAA 1YK9A 3R1HA 3DLGB 2AJQA 3L3CA 3C15A 4UQTA 2WB4A 4UF4A 2JC1A 3KLHB 1TU0B 2UUCF 4PRFA 3C16B 1Y3JA 3BDPA 2VONA 3I4PA 1XNRF 3OSPA 2CG8A 4KSEB 1HQUB 3DMJA 2UP1A 3BH6B 3HKZD 4FYYB 2PIIA 3FDSA 2DPIA 1C0TB 1SH3A 1F6TA 1PYTA 2B4PA 3V4IA 5LMUJ 1U49A 4WFAQ 2W9AA 4C6AA 3PFOA 1HNIB 2CNNB 2KRRA 4B3MF 3ZZZA 4IQXA 2AV5A 1Y9OA 3IXQA 2XG8A 2NCKL 3RW7A 4J91A 4F25A 2H9ZA 2Z58B 2X7IA 1NDPA 4ZJOA 1N34J 5KFDA 1P9QC 3RAMA 1UPPA 4OX6A 4NXMJ 4Z7YA 2JEJA 4X66F 4W90B 3HFZB 2J76E 2RVJA 2NSBA 4DV2F 2EW9A 3G6YA 1Q82T 2LQ8A 4X64F 5K5MA 1TV6B 4QCLA 4ZPCA 1CS4A 4LR7A 3KLFA 2XLIA 1T03A 1RLCL 4CO2A 3MMBB 3M2RB 3RAQA 4ECWA 4I67A 1MSWD 1Q7YT 5A8RA 3TUPA 1C1CB 1HL6A 2IHR1 4EBDA 2OH2A 5KG7A 2WK4A 3P3DA 1LWCB 3GZ7A 3RU0A 1U4BA 3TVKA 5A6WA 4ZCLA 3Q8VA 4EGLA 3EX7B 3ZNJ1 2X3GA 3VALA 2E1RA 1RI7A 2JDJA 2A2DA 2MZSA 3TZZA 2KTQA 4X4PA 3M1VB 3OUYB 1EP4B 2GX8A 2BX6A 1ZAXA 3WC2A 2V69A 1JMTA 4O4GA 4DR3F 5F8NA 2RMLA 5J1PA 4KGXB 2DBBA 3OXFA 2WRMA 2B0GA 2DB1A 2WHOA 3AJ2A 3A8KA 2BR0A 3CD6S 2OPRA 4NL5A 3PVXA 4DL0C 2VPZB 2QMWA 1OYDA 4JI7F 2OEJA 4RU2A 4M5JA 2ROPA 5CD4A 4OV6A 3D6HB 2BKOA 1TUVA 2O66A 4PWDB 1PIEA 2ZD1A 3UO0A 4UQGA 4Z37A 4BBYA 1VC5A 4USKA 3PXGa 3ISNC 1M90T 5KFSA 2DNZA 1NBEB 3R27A 2VASA 1QE1B 1DZ5A 4NLQA 5K14A 4DCJB 1S1WB 3P49B 2WBRA 3NS6A 4F4WA 2VODA 1C4AA 3O1LA 4DXLA 3MEGA 3NKYA 1IVZA 2QTWA 4L74A 1WTBA 2PMHA 1LW2B 4OZ1A 4CQ1A 1A7GE 3B78A 1N36J 1OSDA 1FERA 2JC0A 1UWBA 3GFHA 3RB0A 2HIQA 4PQAA 3G96A 1SC4B 2C2KB 4ZVHA 2D3OR 3FMWA 4P72A 4N5SA 3J7A1 1FK9B 4Y2MA 3IC1A 3DN9A 3QJPA 1RHQB 2E5LJ 3AA9A 1NKBA 5J1EB 4ZPAA 3J7ZT 4RU9A 1X0PA 1LFPA 2AX0A 3H42A 1K8AT 1RAIB 1E6YB 2F9JA 1M0SA 1LWXA 3IR5B 1LWFA 3D5MA 3WZ0A 1HNZF 3U1NA 1S0VA 1VCTA 1JX4A 4NLUA 1WKKA 1HI8A 2BW7A 2DO4A 4E98A 3BR8A 1GXUA 2ZHBA 2CQ4A 2XSJA 2UUAF 3ZTQA 2HURA 3K5LA 4ED4A 4EK2A 2AP6A 2LQ5A 5LMUF 5CZXA 2QL9B 5A76A 2GO9A 4YR3A 3US5A 4LQ9A 4OYIA 4NCGB 2QEXS 3TZWA 5DLGA 3MR3A 1JLGA 3KHGA 3HPOA 2APOA 1X8DA 3DRPB 1N34F 4NLSA 2W2NP 4B9VA 2XZTB 3SMZA 4NXMF 3PIPQ 4J9QA 1BWVA 2VU5A 3NGDA 3LGHA 4R8UA 5IM0B 4Y2CA 3B4DA 3LW5C 2E9RX 1P8GA 1NXIA 1OQ6A 3S01A 4LFCJ 2FC8A 1X4AA 3FKBA 1CJKB 4HACA 5LM7E 2HBQB 2F63A 4MYTA 4P7TA 2MY8A 2R42A 2I5JB 3TAQA 2YX1A 2HFNA 3LP0B 5MAOA 4AXIA 2W9CB 3L7OA 3HVTA 5L39A 1ITPA 5KG4A 1S0OA 4TVAB 3GJRB 1KVJA 5JXSA 2YNFB 4O3RA 3K5PA 3PW4A 1LXJA 3T1HF 3OL9A 1TP7A 3UD5A 3U7JA 5CYJA 4Z7CA 3H5UA 3ET6A 2EKYA 1L3SA 3MEDB 2MLXA 1JLFB 2CJ9A 3GIJA 4YB1P 3PNIA 1F9EB 4ED6A 2BVZA 4A8QA 1H38A 3R7NB 1CJTA 2W1BA 3HDSA 1SBRA 4G3IA 2ASDA 2BZ2A 2EBGA 1VBZA 5EN1A 3ISND 2XQCA 4LIWA 4DUYJ 1S1XB 2B9WA 3LQVA 1YZ6A 2KXFA 2GMJA 2ZBQA 2DRAA 1TKTB 1XN9A 2QLFB 1DQAA 1AFJA 2OD4A 3JSRA 1N6QA 4P2SA 2VL1A 1VOMA 4KGKA 3EDRB 2BE2B 1RSCA 4WZMA 4LUBA 4JP8A 1V3RA 7FDRA 2HFSA 4ETXA 4MKBA 1R27B 2IAJA 2WAQD 4DSJA 4HR2A 3A13A 4U95A 2J0QD 1F1BB 1KONA 2R8IA 1T11A 2B6AB 4W4MA 1QDUB 4ICLB 2RKIB 4FYVB 3F56A 5DO2A 3JQKA 1RT7A 2GMHA 2H48B 2HHXA 3RBEA 4K7QA 4F4ZA 2L3MA 4NWBA 1YDLA 2MXYA 2EFQA 1KWMA 5D6GA 1N36F 1RZMA 4FPIA 2ZE2A 5HROA 1EJ7L 1IKWA 5CCMA 5F41A 3FJ2A 3TA0A 2RQCA 5HLFB 4HLBA 1C0UB 1LWEA 4IG3B 3DLJA 3HHLC 3GR1A 3ZNUA 4MAKA 2QA1A 4KGMA 2EK6A 2YNHA 4A8SA 1SQFA 3EGNA 3OVSA 1HBNB 3ILOA 2E5LF 3PEHA 3MEEA 1SCJB 3BQ1A 3RB3A 1FJGF 2BJ9A 4I6WA 2N7YA 2XTJP 3KFWX 2HHPA 3C8YA 4JI2J 3V6DA 2IVYA 4DV3J 2MMYA 4OYAA 1JXEA 4OYOA 1J2VA 3ZZTA 2V67A 1HWLA 3DLHA 3NCQA 1T9YA 3IWNC 1S9FA 4ECQA 1MNEA 3GSIA 1MWYA 2UV8G 2YKQA 2JWNA 4JI1F 2DXFA 4NPOA 1S4FA 2UUTA 1TVRA 4NLYA 1FX4A 4WP3A 1T9WA 1KQKA 2GVDA 5ETLA 2ZM6J 1WHWA 4BHQA 1LKZA 3OTEA 1Y00A 1NUEA 3IS9B 3ZTRA 3PACA 4PYDA 1QM9A 2KHDA 3BKFA 3QMQA 2HSEB 3D1QA 2H5JB 3CDUA 1UVMA 3I96A 1IKYA 2R7SA 2MLZA 3QGIA 1S7IA 4LFCF 3ITHA 3IBFB 1LEOA 4DPOA 3G9CA 4KT0C 1NRKA 1FRMA 4C11A 4HHJA 3SV3A 2OJ3A 4GRSA 2GFFA 1D3WA 5J2QA 1RTJB 4OYXA 1GAOA 1RT2A 3SFUA 1JJCB 1RABB 4ZKAA 2PI5A 5KT2A 3R6LB 3K89A 1U2FA 1X31C 5ETMA 3CF5Q 2W2PP 1U2RA 4CO0A 2WSFC 4ZITA 1FT8A 4JI3J 4JI5J 4Q0BB 4DPUA 3MAAB 2LQJA 1QAJA 1DJ0A 2XCPA 2HQCA 1WKJA 4NA1A 2XMTA 4P52A 4ECYA 4W98A 2Y1LB 1N0VC 3SCIE 2C42A 2E7XA 2HRUA 4OJ3A 2F4VJ 2ZEJA 2VG7B 3MZIA 3FSYA 5DDQC 1U0SA 1TAQA 1WWHA 3IAS9 3ENWA 2E9ZA 3AH6A 1V6HA 2HHHF 1FFWB 1N48A 2J5AA 1Q1KA 1EARA 3OTDA 3AQPA 2VICA 2Q6CA 3CJ5A 1JJHA 2DR6A 3PV8A 2N7CA 3J81Y 2YKMB 1WACA 4KHMA 1N5VA 4ED3A 4J9LA 2A18A 3T3FA 3BQ2A 3CJQA 4M5DB 2KZMA 4MH8A 2ZHAA 2HAIA 4F0MA 1GXLA 3M6VA 2X1AA 1S59A 2RIJA 1FRIA 5CQGA 2MTLA 1I5OB 4J37A 5IXUA 4FYXB 3HHLD 4PWUA 4NI2A 3K58A 5DQIA 2OTJS 2LU1A 3UCUP 4JV2A 1NB2A 4ELTA 3DI6B 1Q8KA 4OI3A 2Y9HA 1VBKA 4W92B 2H65B 2CPDA 4RW4A 2KL8A 2IA0A 4FF1A 3KLEB 1VC6A 1YSJA 2FHOB 3DLKB 1S6QA 3UN5A 2C22A 2XGQA 1L3VA 2R2SA 4ZLNA 2YQ3A 4ZP8A 2K8GA 1MW7A 2PE8A 5HMZA 1CULB 1QTMA 2GV1A 1S9EB 1TK8A 2HGLA 3TQEA 3CSKA 4A8WA 5DZ7A 3NNAA 1BQMA 1S1VA 5F0UA 4KC5A 1UVJA 4JI2F 2J8SA 2Z57B 4PQUB 4DV3F 1MLAA 1KN6A 2FZGB 2MKIA 4WU3A 1NLKL 2ZUAA 4F0KA 3DDKA 2W8KA 3F73A 1FKPA 2F8MA 1FVSA 3CMQA 1ZZNA 3N0VA 3NEKA 1U0HB 4XPCA 3Q89A 2X1FA 1SJRA 4KQZA 4DL3A 3V5RA 4IDKB 1KRPA 2F8HA 3VWSA 3PCOB 3QRPA 4C8YA 1DY3A 2EG2A 1U1NA 3MR5A 3UD3P 4DN0A 4DBQA 5E33A 5KFKA 1PO6A 2PT0A 1HQEB 2E5HA 1YI2S 2MKCA 4YY3J 1WC5A 3G87A 1I51B 2HQFA 2RS8A 1VQPS 2HHTA 3DGVA 2F1FA 3DMJB 1N8RT 5C25A 3ZZ0A 3W2WA 2R7WA 3M4XA 4ELVA 1IWGA 3LGNA 2Q3PA 1HFEL 3R5JB 4G65A 3ZZRA 2EPIA 3ILIA 3ENAA 3IM8A 4WK3A 4ZA1A 5BYSA 4PPZA 1BWEA 1VJWA 3S6EA 4NLVA 4C8NA 1PAEX 5GADU 1KSPA 4RO0A 3BPDA 5HMXA 2ZZNA 1J5OA 3KK3A 2G4BA 4JI3F 3RBXA 4JI5F 1UAWA 2IVMA 2Z0GA 3VAIA 3OFHA 4XDDA 5FDLA 1BGXT 2LKZA 2MZ1A 1CS4B 5DGAA 1IR0A 2EWHA 3KLFB 2NPIA 2GA7A 3E51A 2XYHB 1VRUA 2KO1A 3ZXWA 2N4CA 4AE5A 3HKWA 3OR1A 2F4VF 2EG1A 2N82B 1H73A 1L3KA 4EZ6A 2QRRA 4DG1A 3CJ0A 6AT1B 4DL5A 2CVEA 5KFAA 2NS1B 3VZHA 1YJ7A 1LV5A 3CJSA 3RGIA 3JXOA 2ERRA 1YBAA 2AJ2A 2AWZA 2Z56B 1Q8IA 2MYFA 4AXJA 4AYBD 1HWJA 3HVWA 3N9UC 3GFZA 4GMKA 1NK0A 4FZVA 3O8WA 4CTAB 2BA9A 3D1HA 1RXOB 2ZH6A 2CUYA 4C8MA 1RWMB 3LAKA 3PO5A 5LSLA 4OX9F 3C14A 3CJTA 4XDCA 4M5LA 4OZ3A 4NLOA 2Y8WA 1PJ5A 5KFJA 2BBEA 4QQBA 5ITHA 1QUPA 3ELHA 4NASA 3SQGA 4Y65A 4ECRA 4K5SA 2OIHA 3W66A 3CCES 4USTA 3CXCR 2FB0A 5L46A 2C3YA 1V5IB 2V9KA 2LYVA 3C6UB 1XR7A 1N4LA 3RR7A 4WKYA 5A2QU 4P2XA 2AQ4A 3HP6A 4M5HA 2AIRB 5K14B 2DR5A 4BWMA 4ES1A 1FRXA 4RW8A 3QSIA 3MEGB 4GC6A 5D0GA 2MQLA 2ILYA 3R1LA 3OLBA 5KG3A 4TLRA 1VIXA 2RSQA 2I6WA 3I31A 4D3HA 4KE5A 3H90A 5HN0A 4CT8A 3LPEA 4E0DA 2L41A 4ED8A 4LFAJ 2R2UA 3M2UA 2NXUA 2HQ3A 3W63A 3BGRA 4OQJA 1UWBB 2VFVA 3T5JA 5KT4A 4KB7A 5I3PA 3M32A 4K4XA 1DTQB 2IJNA 1HI1A 4MK8A 2DXEA 4CT9A 3IRXA 2E1AA 3G71S 5D0HA 3P8BB 4FKYA 5AXNA 5L8RC 1UVLA 1EB0A 3SEOA 4LF2A 2VPYB 4DPYA 3CMAS 2DNNA 5GMKa 4X65F 3V6KA 3M8PA 4DF8A 1CBKA 5AE2A 5EWEA 3T9NA 2RILA 1QY7A 1BE4A 5E3QA 3ULHA 1NU4A 2H4YB 4ZIVA 4N56A 2XSFA 1W25A 4WBFA 2HZCA 4LRCA 2ZKUA 3QSYB 4BC7A 4I6AA 4NRTA 4ZN1A 3PJWA 5CH7B 2FVQA 2YWWA 3GJQB 2WVBA 2JLEA 3DGPA 3HT3A 2Y0SD 3JTPA 4QIWD 3VVTA 4ILLA 3T19A 3HHKA 3GU0A 3LO3A 4USJC 1JLGB 5EHHA 3CCZA 3FMBA 3ENVA 1FESA 3OTBA 2DR8A 4QYRA 1R8AA 1RQ0A 5F3ZA 3W8PA 4ZCIA 5B0EA 1PAUB 1NKEA 1WI6A 4RWWA 4HT7A 3LF0A 1R6VA 1RGVA 4KKOA 5KFYA 2R7XA 4KRWA 4WJBA 3TZXA 1GMWD 1O6XA 1PYSB 4OFZA 4ECTA 4KGZB 1SVDA 4DPXA 2HHSA 2LCWA 4FS1A 2HK3A 3MM8A 1Y4ZB 4UOCA 4YDDB 1KBRA 3HVTB 3M8RA 4ITSA 4OYZA 4LF1A 3E8OA 2FHJA 1VQKS 2GJIA 1RKIA 2YPZA 1M5HA 2FY8A 3GCXP 1HBOA 5HSPA 2FIUA 1FNMA 4QBUA 5KOWA 1FO1A 2CQ3A 3PHEA 4G1PA 2O3DA 4GO5X 4X62J 2PDAA 2WZ1A 2EFNA 2XY6A 3TYTA 3MFHA 2IRUA 4NA3A 2IM0A 1Z2LA 8RUCA 3DRSA 3VCDA 2ZJQQ 2R4FA 5KG0A 1XMQF 1WEXA 1QAYA 3M9MB 1X4BA 2XI2A 2WTFA 1F9FA 2JVOA 5FLXY 5G4DA 2DR9A 2MHEA 4IO1A 1FJEB 2H3EB 1D0EA 5DDRC 1FI4A 2M9KA 2M3DA 4ZPWR 3MD1A 2DIVA 3MF5A 4PR6A 4CLYA 3M2VB 3CCJS 5B0BA 2ZC3A 1K0VA 1KQGB 1URNA 4LR9A 2ALZA 2NUUG 4MJKA 2HVHA 1S6PB 3SCLE 2OSQA 1SJ1A 4FDFA 3H4DA 3NOCA 3TI0A 2XZDB 4DX7A 4C8LA 3SXLA 3GWCA 1WD6A 5U47A 1RT7B 1NO8A 2XYPB 1R7IA 5HATA 3Q8QB 2HGMA 4JV5J 1S4EA 3BN4A 2XLJA 3SDEB 4HTIA 4LFAF 1WSRA 4KYZA 2ZE2B 5HROB 4CLPA 4FNHA 3ZTOA 2JLFA 1LWEB 3W5YA 2B5JB 1JLEA 2BW2A 5A8WB 4EEYA 2H4WB 4C48A 2BE9B 3TR5A 3A8IA 4KJIA 5B0DA 3MFIA 3TJ9A 1X5TA 2SXLA 1ZH5A 1TAUA 1FF2A 1ZPWX 5JVGQ 3HD1A 5H9FJ 1HNXJ 2QFJA 2L48A 5KTQA 5LOQA 4HH0A 2G2OA 3QT8A 3JB9k 2AYGA 1HNIA 2KVQE 4DMZA 2RQKA 3CCUS 1AT1B 2CQIA 2E1CA 1N5QA 3THVA 1Q86T 4QYZJ 4NLRA 4HI1A 4MFBA 1I94J 3M30A 2WVCA 2JSXA 3OLAA 3K57A 1M5OC 2J0WA 2HLUA 3PKYA 1G6BA 3DCAA 4CYUB 2GVDB 2LXIA 1NK4A 2Y3YA 3N5BA 2E1PA 2VJUA 2HMIA 5KFZA 4ZDNA 1N33F 1KS2A 4ZIWA 3OXGA 4WP9A 4BC9A 3R9LA 2ABYA 4WKRA 2FGCA 3E2EA 3TVYA 2DNGA 3MMBA 4ZVGA 1FEHA 3I5CA 5EDWA 1P1LA 4ED7A 4FF3A 5HP1A 3QAUA 1EAYC 4PG8A 3I0SB 2XO6A 2CRLA 4WPAA 2PFFB 3FSIA 5DM6Q 1LNQA 1LWCA 3UD4P 2ZH5A 1YQHA 1Q53A 2ZZTA 3IBWA 1FDAA 4PXDA 1RT2B 4NCBA 3PJXA 4KPYA 1R8HA 1LFWA 3T41A 2GAGC 4Y28C 4OZ0A 4OIXA 3CDBA 3M7VA 3OUYA 3UW1A 4IFVB 3TANA 4CLWA 3E01A 4JI4J 2M5YA 1RT3A 3LALA 4Y6IA 2ATCB 4OHWA 1TUWA 3L4BC 2WSCC 3HHNB 2AJ4A 5KG2A 1U2CA 1IBMF 4TQRA 4CNYA 2FZKB 5F8HA 4X62F 4O23A 4CO5A 2GZOA 3LGMA 1P27B 4FVMA 5DRKA 2J9CA 4PWDA 4X2BA 2V4RA 3DNCA 4ZOSA 1FTRA 3G8TA 2IYIA 3MCSA 4DL6A 1C2PA 2W2QP 4CH7A 2R2TA 1IXKA 4J9MA 3BPSP 3SQOP 1F5BA 4DV6J 1W2BR 1LK5A 3C3LA 4I68A 4QJVA 4FS2A 3EGVA 2GMLA 2XWYA 3MM6B 4RPFA 3CJ4A 3AAWB 1N5TA 1N0UA 3T6JA 1UJ5A 4ECSA 4IH7A 3FSXA 3GYNA 3RJMB 1LW2A 1NSQA 1K1QA 4KO0B 1O0PA 2DIUA 1OS5A 3HJFA 4DPTA 2C2OB 3PR5B 2RDIA 5L9NA 4NX9A 2BJ7A 4U7UK 2DCUB 2Z30B 4DR5J 1RADB 5EUHA 2HWHA 1KFDA 3IN5A 5KFXA 4NI2B 3D9BA 4OYPA 3Q2TC 2EFOA 4JV5F 1R3NA 2BUNA 4DPWA 2JHEA 3D0GE 4RW4B 2OTLS 1PG5B 3R3TA 3Q8PB 1E6YA 1L3UA 4TQSA 3QT7A 1TMMA 1D9AA 2MGZB 2ATLA 1S1UB 5LXYA 5KG1A 4HVZA 2J6SA 2Z8QA 2MPUA 2D41A 1BQMB 2XNQA 1S1VB 1OIAA 1RKJA 4V19X 3ISZA 1APSA 5GAEI 2COLA 1HNXF 4JV0A 2PC6A 3FVYA 4DSEA 5B0FA 1FKPB 3DC2A 4NCGA 3MDFA 2BEFA 4P74A 3NWGA 4C0BA 1X9MA 4I1TA 2YTCA 4H54A 4EUVA 3M8WA 4DSLA 3AB2B 1VK8A 2B4VA 2QX0A 4XK8C 4FF2A 3UWTA 1K1SA 2EVZA 4GKJJ 3U27A 4H4KA 4NE9C 5LT5A 3IG1A 2QT7A 3I87A 5E0OA 1UVNA 1EKSA 3QJJA 3D7SB 4E2FB 2ZWPA 3EICA 3BSOA 2MB0B 2ADBA 2VH7A 2HZAA 3N01A 2B4OA 3KG4A 1CJKA 1FE4A 5D4OA 2C2ZB 4U7UD 3AB4B 3GTYX 3RRGA 3TP2A 3SFGA 3K17A 3DLBA 3W2WB 3LP0A 1ZOTA 3KHRA 5HAOA 2BJ3A 1V3ZA 4TN2A 3RYLA 2UXBF 1MU2A 5GAHI 2MZQA 1R6YA 2QLXA 1X4FA 1YRXA 1CC7A 2DGWA 3QBCA 2J9EA 3NAHA 2YNFA 4R0JA 2M70A 3OHAA 1HWUA 2FQQB 3PRVA 4O3OA 2VZ9A 3H5SA 3MEDA 1Y5LB 1U1KA 1JXLA 1JLAB 3FUYA 2A6OA 3F0NA 1J5OB 3KK3B 1WHYA 4JI4F 3MMAA 4OZJA 5DJBA 3TWZA 2NYIA 5LL6d 3W7BA 1HKAA 5IFMA 5HQLA 2VC0A 5FDLB 1S1XA 3I82A 2F5GA 1TKTA 1WC1A 1IBKJ 1U09A 1ZAVA 2XBPA 4TY9A 4FYWB 1AYEA 5HANA 2FD2A 3KWMA 3OR1B 2HIYA 3VVUA 2B9EA 3KXDA 1VQMS 3T5LA 3LTOA 3DFEA 1UVIA 2ZDOA 4MT1A 1CC8A 3HM9A 4DV6F 4ZJQA 3BBCA 1CJVB 3UPFA 1VRTB 3FQLA 3S7RA 4DSKA 2Z2MA 3W8GA 2RRBA 3ILJA 4PYAA 3DLEB 3EXCX 3GMGA 4ICLA 1WELA 2VUGA 2HVZA 3JSMA 4NMLA 4H4OA 2DD8S 8ATCB 3P5BP 3R5GA 5GAHU 2BDPA 3R7SB 1VBYA 3AOBA 3MR7A 4CCHA 4EMDA 1KP6A 2CNKB 2BABA 2VIHA 2JEGA 1U48A 3C19A 3C14B 9RUBA 1PJ6A 3QZ8A 4G1QB 4ZMMA 3VAJA 1N56A 3W1YC 4CLKA 2GQ2A 4ZVQB 5EWFA 3SQGB 4F2SA 3HX9A 2YY3A 3P6YC 1HBNA 3CC2S 1O5JA 1GTEA 5KFBA 4DCOB 3L7UA 2DNMA 3PHTA 3MTKA 4OHZA 4ZLJA 1ZM4A 1ZZFA 4U8VA 2BJ1A 1KLNA 4RW8B 4ILMA 2KJWA 3M6UA 1J5EJ 1DHMA 2QFIA 4AD6A 2W4DA 3PW7A 3EWGA 1RCOB 2XZWA 4Z2XA 4IOBA 3MPVA 4EO8A 1DURA 2LDIA 2DTJA 3B6BA 2JEFA 2BKPA 4USHA 2ACMA 3MAHA 5K8PA 1FWLA 4Q7AA 4F3MA 3DRRA 3M2UB 3MGJA 3G6ES 3D1OA 2KFNA 4JBCA 2EFGA 3MM5A 2DNOA 2GHWA 4MKYA 3QLHA 3GPAA 3ONQA 5ETQA 4OX7A 2DGQA 3IS9A 1FCAA 2DT9A 3IRXB 2UVVA 2N3OA 2LFVA 4GKJF 2BJ8A 2DH8A 2O1PA 3M8PB 5K20B 1NMEB 2W2OP 3DOLA 2A2CA 3TEHB 1VIOA 1HHTP 4WCEQ 4WXWA 1NH7A 1FDNA 1JLQB 3QQCD 2WB1D 1EETA 3CT9A 2IJFA 1RTJA 2E5IA 4KH1B 3NMAA 4LRBA 1FRHA 1ZA1B 5J1NA 2UXDJ 4DU8A 1NHKL 1FNXH 4HDGA 1NZAA 2CADA 4A47A 5SUHA 2BV3A 2RRNA 3BN7A 3H20A 2K1RA 1SUQA 3MAAA 2M7SA 3WX8A
chains in the Genus database with same CATH topology
2N7CA 3J81Y 1RT6A 1GTHA 2AW0A 2DNPA 1S0MA 3DU6A 3X1LB 2AX1A 2YKMB 5IT4A 4WZQA 1IKVB 1WACA 3O6QA 4YFUA 2CPEA 4KHMA 1LQ9A 1N5VA 1Q7LB 2HWTA 1U1QA 2OD6A 2HHUA 1UVKA 2LQ9A 5KT3A 4ED3A 4RNFA 1KHVA 2A18A 4J9LA 3CD5A 3QGHA 3T3FA 1CLFA 2I1RA 1FK9A 2PSZA 4M94A 3BQ2A 1NHUA 4M5DB 2KZMA 4MH8A 1WTFA 1FA0A 1CSJA 4NLDA 1HBMA 2ZHAA 4PKDB 3BO4A 2HAIA 3T6BA 3GIMA 4RNNA 2W4CA 4ZCKA 3N6LA 1H2UX 4FBUA 2XGPA 1PC4A 5C5JA 2ZC4A 2DGXA 1GXLA 3M6VA 3KLIA 2J6UA 2GGPA 4CIOA 2X1AA 1SV5A 5J2PA 1XR6A 1UFWA 5J1EA 4RNMA 3AJ1A 5KT6A 3MUTP 1HHSA 4BWJA 3Q24A 2IVFB 1U6ZA 2RIJA 1FRIA 2NSCA 2R7QA 2DISA 5CQGA 3VF0B 4ID5A 2M8HA 4QOTA 2DR7A 1T05B 1B0PA 2FLNA 1S6QB 4J37A 3VQTA 5IXUA 3KHHA 2BRLA 1RTHB 3AHPA 3HHLD 4PWUA 1X9SA 2RH3A 3QJLA 3B8HA 3MM8B 3K58A 5DQIA 2OTJS 1F2GA 1WEYA 3SYZA 2LU1A 3UCUP 5C24A 4PG6A 4JV2A 1U6FA 4ELTA 4DS5A 3KNGA 4ZHRA 2C2DA 4R5PB 3DI6B 3R5BA 4YB6A 1RTDB 4M5DA 3PIOQ 1ZBTA 5DG7A 1DAXA 3MUMP 4B3SF 4LMZA 4OI3A 4RWXA 2B7CB 3VZIA 2CQCA 4I2PA 3TA1A 1NNDA 3DYAA 3IFEA 4W92B 2DJWA 4IOAQ 2CPDA 4A8YA 2C3UA 2XMKA 4RW4A 4J9RA 5M2RA 2E1MC 4LIRA 2IA0A 4TXSA 2C2EA 4FF1A 3KLEB 3MPYA 2AGQA 1VC6A 1ZM3A 1YSJA 3D28A 1IQZA 5K8NA 3A8EA 2FHOB 5KT7A 4J9PA 4N8OA 1G2EA 2BQUA 4WFNQ 4B3TF 3BREA 1RWUA 1FXDA 1PC5A 5LSRA 4DWIA 3DLKB 4B02A 2KYZA 2NR0A 1S6QA 2W9BA 4E8UA 2C22A 2WOMB 2XGQA 2R2SA 1SXLA 1L3VA 2VA3A 3NNHA 3HK2A 2YQ3A 1RTHA 4ZP8A 3PX6A 2AYBA 1HWKA 4XIUA 2K8GA 3BZQA 2J9DA 2IC3A 3FFIB 1MW7A 1H7XA 2PE8A 3VTIA 5DM7Q 4F2RA 2V8DA 5FJ4A 5HMZA 2HFOA 2EFVA 4HKQA 1QTMA 2GV1A 1YWXA 3PDNA 1S9EB 1AXQA 2CQ1A 2HGLA 4RW7B 5F8LA 1TK8A 4A48A 2YNIA 3CSKA 4A8WA 1T8EA 4EBEA 4YB5A 4U7CA 2PN6A 3NNAA 1N52B 3DRPA 1UKUA 1BQMA 1S1VA 1QVGR 2YKOA 3UWTA 3JYTB 5F0UA 4KC5A 4QIVA 5JVHQ 4JYAF 1UVJA 4JI2F 3HF5A 2OAUA 1R43A 4OLOA 3CCTA 1UJ4A 3KLEA 4PQUB 4DV3F 4ZP9A 2KDOA 2KI2A 4LSLA 1KN6A 2MKIA 4DUZF 1T94A 4WU3A 3UFCX 5IM0A 2GQCA 3OFFA 3DDKA 2W8KA 1SH0A 2Y1RI 4KIAA 3F73A 1G7CB 2WOMA 1FKPA 2BRKA 2F8MA 1H3DA 3ICLA 3RR8A 1FVSA 1K0TA 3MHYA 1DBDA 2Q43A 1L3TA 1FKOA 5HL7Q 1ZZNA 3B82A 4X4SA 3FFIA 3I9V9 2HNZA 3ZZPA 1XR5A 2HPUA 3BGFA 3N0VA 1T7PA 3DM2B 4NLTA 4L3NA 2DHGA 5HI7A 1U1LA 4XPCA 2AU0A 5C25B 3NRBA 2X1FA 2HHQA 3BF4A 1SJRA 2FGOA 1L5UA 4KQZA 2I5JA 1FRLA 1FVQA 4A8XA 1R8BA 3RZAA 2FVRA 4IRKA 2VFSA 2KT3A 4Y2KA 4I56A 4DL3A 3V5RA 4IDKB 3PX4A 1KRPA 2W9CA 2AJFE 2YWEA 4LSNB 2F8HA 2MZRA 4PQUA 2V0NA 4RKUC 3VWSA 2C2RA 1TK5A 3KMQA 1H98A 4B9LA 4C8YA 3NCPA 3HO1A 1F5AA 2EG2A 2KVIA 5D4PA 1J5EF 3TAPA 1U1NA 3MR5A 1NK5A 4A4JA 1R8CA 3UD3P 2FVCA 1VGYA 4DN0A 4DBQA 5E33A 5KFKA 3THPA 1PO6A 2PT0A 3ENQA 3H2LA 1HQEB 2E5HA 1YI2S 1S79A 2CVIA 2MSTA 2MKCA 5MLCV 4O3SA 1S7HA 4A8OA 2PA8D 4DL7A 2RS8A 1VQPS 2HHTA 2QA2A 5H1SV 3J80Y 1SL2A 1R89A 2VKRA 2F1FA 4O3NA 4CH1A 3KG0A 3PRBA 4RW6B 1JLFA 3DMJB 2UUWA 3GQCA 1N8RT 2XS5A 5C25A 3I9ZA 3RBDA 3ZZ0A 2XNRA 4U9RA 2G13A 3W2WA 1TKZB 1CEZA 2R7WA 5GAEU 4WYWA 3M4XA 2I9SA 1WHXA 3DHWC 5KG5A 4IYQA 4GC7A 3PM9A 3MURP 4ELVA 4X4NA 2ZKTA 3T5HA 3LGNA 1F5CA 1R0AB 1JLEB 2BYCA 2Q3PA 5L1JA 1HFEL 2HNDA 2GNKA 4TU9A 1HMVB 2F40A 3ZZRA 4F3QA 2EPIA 4K4YA 2GO8A 2BACA 4AL6A 5DDPC 1GX6A 3MI7X 3QWUA 2XB2D 1FNOA 1HD0A 3BS9A 1HQEA 2O5DA 4WK3A 4QWEA 1VBXA 2F3JA 4ZA1A 3GV5B 1JLBB 5BYSA 4PPZA 2DGOA 1BWEA 5T41A 1VJWA 3S6EA 1HWIA 4OZLA 1JKHB 4NLVA 1FEEA 5CYMB 4C8NA 4RUAA 5GADU 2OPQA 1KSPA 3H2UB 1VRUB 1KTVA 2ZVSA 2NLWA 5HMXA 4WFXA 2VBYA 2YVSA 3OPKA 4KFBB 1S6OA 5F8GA 2E5JA 4R25A 3DOMA 4CI0B 3CC4S 2ZZNA 4C3MA 4I64A 2JEIA 4CH0S 2BE2A 3HZEA 6FD1A 3MWBA 2IBOA 2FLPA 1J5OA 3KK3A 4H4MB 4K4SA 4C0HA 2OSRA 2G4BA 4DG1B 4JI3F 2MQOA 3TUZC 4JI8F 1Z4UA 4K5RA 2CQHA 4B08A 4B9UA 4JI5F 1UAWA 4DLEA 2IVMA 2IM2A 2IMOA 2Z0GA 2F7VA 2XMUA 3DHXA 3LOUA 3OFHA 5IZHA 1KR4A 3VAIA 4XDDA 5KFOA 3T9ZA 5FDLA 4CO4A 1ZTTA 4M1KA 1BGXT 5B0CA 2CYYA 2LKZA 4QPTA 2MZ1A 4ES2A 4MFBB 2CJKA 2V9WA 4B9MA 1KVIA 3LAMA 5DGAA 1IR0A 2EWHA 1JKHA 3KLFB 2B6AA 3M30B 2MQQA 4N41A 1S49A 2NPIA 4ZP7A 3D54A 2GA7A 3E51A 3CJ2A 4ZPBA 1GX5A 2A1BA 2RKIA 3T1AA 1X0FA 2OMOA 1VRUA 2KO1A 1DTTA 3Q8SB 2N4CA 4C2MA 2R7RA 1OPIA 5KFCA 2OP5A 3HLUA 3CCSS 4AE5A 3HKWA 1R31A 4KFBA 3OR1A 3MECB 2F4VF 2GJ2A 2ZITA 4NRUA 4O3PA 1FXLA 2EG1A 2D7SA 1X4HA 2N82B 4J9OA 1YG0A 1L3KA 1UL3A 4EZ6A 3RTVA 3CIMA 1JJ4A 5I42B 1SIZA 3KKFA 2P6TA 2QRRA 4DQSA 2AGOA 4H4MA 2QIFA 3Q2SC 4DG1A 2HMIB 3CJ0A 2HWIA 5IQQA 2G1DA 1JIHA 3KOAA 4DL5A 5D3GA 2CVEA 2DH9A 3B4MA 3KHLA 2QA4S 5KFAA 2NS1B 3BR9A 2P9EA 2ZDPA 3BJYA 3VZHA 4OZNA 3EUNA 3LUYA 1QAXA 3FZ2A 1LV5A 5T7LB 2HS4A 2P9GA 4IFYA 3OW2R 4IH6A 5HLFA 2P5VA 4FN5A 1C0UA 3ETOA 3OBIA 2ZH2A 1XMOF 5A8KB 4LF4F 4IG3A 3FGVA 2LU2A 1FJ7A 1S9GB 2ERRA 4HI2A 4MIBA 3TQ1A 1U6BA 1I1GA 1YBAA 2GHVC 2AWZA 5C42A 5KFEA 1Q8IA 3CPWR 2DGUA 5JUMA 2DPJA 2QSWA 4TY8B 2CPYA 2MYFA 2Q66A