4M5DB

Crystal structure of the utp22 and rrp7 complex from saccharomyces cerevisiae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
169
Chain Sequence
IEDISAMKNGFIVVPFKLPDHKALPASLHFMFAKRHQSSNSNESDCLFLVNLPLLSNIEHMKKFVGQLCGKYDTVSHVEELLYNDEFGLHEVDLSALTSPRNTALLKFVDAASINNCWNALKKYSNLHAKHPNELFEWTYTTPSFTTFVNFYKPLDIDYLKEDIHTHMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U3 small nucleolar RNA-associated protein 22
publication title An RNA-Binding Complex Involved in Ribosome Biogenesis Contains a Protein with Homology to tRNA CCA-Adding Enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 48
structure length 169
sequence length 187
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12923 RRP7 Ribosomal RNA-processing protein 7 (RRP7) C-terminal domain
B PF17799 RRM_Rrp7 Rrp7 RRM-like N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m5dB01
2MKHA 1BY9A 2CPHA 2LEAA 1YIJS 2X1AA 2MSTA 2RVJA 1ZZFA 2VOPA 2WBRA 1N88A 3CCMS 4WF9Q 2CPDA 1WF2A 5IM0A 3MUVP 2KXNB 2DGXA 3TO8A 3CCES 2VONA 3NMRA 2OTLS 1M1KT 3B4DA 1D9AA 1X5TA 5GAGU 2DHAA 3SDEA 1SXLA 3MDFA 3MD1A 1WG5A 3ULHA 2KM8B 5DM7Q 4TU9A 3VAHA 5GADU 2DNGA 5GAEU 1VQ6S 1U6FA 1WG1A 3G8SA 3ZZZA 2DGOA 2YH0A 1VQ5S 1K9MT 1G2EA 2LXUA 4W92B 2MZJA 2AYGA 4F25A 4TU7A 2EVZA 2M4MA 2RRAA 1UFWA 4PKDB 1X4GA 3MUTP 2JRSA 2KH9A 3Q2SC 3TP2A 2DGVA 1VQNS 2KG1A 2GO9A 2LQ5A 1HL6A 1U6BA 5IFMA 3CCQS 2MPUA 2RNEA 2AYMA 1PO6A 5LJ5Y 1X0FA 2KFYA 3VF0B 2K3KA 2OJ3A 1KD1T 5GAHU 5LXRA 1U1QA 4QQBA 1WF1A 1VC5A 4F26A 4ERDA 2CQ4A 2MGZB 3MD3A 3V4MA 3NNHA 3IWNC 1H2TZ 2MHNA 1JJ2R 1QVFR 1YITS 1Q81T 3US5A 4F02A 4BS2A 5DDQC 4CH0S 1FJ7A 2E5GA 2D3OR 1FJCA 4ZKAA 1VBZA 3CCJS 2DIUA 1M5PC 2J0SD 2AYBA 1KOHA 3BEGB 1X4HA 2DGUA 2AYEA 1AUDA 3P5TL 4V19X 1CVJA 2RT3A 1DZ5A 1WWHA 3BO2A 2N7CA 4IOAQ 4Y00A 3PIPQ 2KYXA 1VQ8S 2QFJA 3EGNA 2J76E 2RQ4A 1WG4A 2MQQA 3PIOQ 3J7YU 1VBYA 3B4MA 3I55S 1U1NA 1WEZA 3THTA 1HD1A 1RKJA 3S7RA 2XNQA 4WCEQ 3G8TA 1OWXA 2KI2A 2KVIA 5DETA 2DNZA 3DXBA 3CCSS 2MQMA 1YI2S 1U1LA 1U2FA 2MZ1A 1WELA 2F9JA 3VAKA 1R8PA 3CCUS 1S79A 2FC9A 2CQPA 5CYJA 3CC7S 1H2VZ 5IM0B 3G6ES 1H2UX 3S01A 4C7QA 5DDOC 4P6QA 3MUMP 2F9DA 4QU6A 2M88A 2JVRA 2MQNA 2G4BA 1UW4A 2CPEA 4C4WA 1H6KX 1OO0B 3MURP 5LSLA 4U67Q 2BZ2A 3CUNA 2DHGA 4FXWA 2MQOA 1A9NB 5EN1A 2DGWA 1OPIA 1Q86T 3UCGA 2K8GA 3CC2S 2RQCA 2KXHA 3CF5Q 3CMAS 3CPWR 3RW7A 1WEXA 2DH9A 3G4SS 1YJ9S 3CCLS 2SXLA 1YTYA 2MKSA 3UWTA 2J8AA 2MB0B 2U2FA 2MY8A 1A7GE 3NS6A 2DGQA 2ERRA 1DRZA 1HA1A 3BO3A 2G0CA 3R1LA 2MKJA 2QA4S 3P6YC 4QU7A 1M90T 2VODA 1Q7YT 2YWKA 2D9PA 1X4CA 2D9OA 5H1SV 1ZZNA 2DNLA 3L3CA 2RU3A 1JJHA 3EX7B 2MMYA 2RS2A 3TYTA 2YH1A 4A8XA 4RU2A 2MYFA 2MZRA 3UD3P 1SJ4P 5D78A 1YHQS 1X4DA 3FEYB 3CC4S 2B0GA 1P1TA 4PR6A 2LECA 1FJEB 1WHXA 2MZQA 5CXTA 2LA6A 1K8AT 2EK6A 3G96A 2KRBA 1VC6A 3VALA 1X4BA 4WIIA 4J5OA 2KRRA 1S72S 2DO4A 1B7FA 4LJMA 1X5OA 2E44A 4WFBQ 1KOOA 2JVOA 2M52A 2X1BA 1N52B 2DHSA 2CQBA 2O3DA 5FJ4A 2MJNA 1SJRA 2MSSA 2DNHA 5DDRC 2CQCA 2LEBA 2VOOA 5JVGQ 2MXYA 1VQOS 1FO1A 1VBXA 2E5HA 2CQ0A 1L3KA 2N82B 1VQ9S 1X4AA 2OTJS 5HO4A 2DGTA 1WEYA 2CPJA 4UY8T 2AD9A 1NO8A 2F3JA 3H2UB 1U1RA 1SJFA 2L08A 4PRFA 2YKAA 4CQ1A 1R8HA 2MKCA 4M5DB 2KG0A 1WHWA 1N54B 2EK1A 4WFAQ 2FHOB 3P3DA 2DO0A 4FXVA 1U1KA 2DH7A 2CQDA 2XSFA 2MZTA 1VQMS 3FEXB 4C0OC 5LJ3Y 3VAIA 2CQ1A 5CA5A 1PGZA 2DGSA 2CJKA 2ZJPQ 1FXLA 5IQQA 3LPYA 1QM9A 2DNPA 2M2BA 1YJNS 2U1AA 3CMES 2M8HA 2DITA 2LCWA 3MOJB 1WI8A 3ZZYA 5GVQA 2UP1A 2M7SA 4ED5A 2E5IA 2Q79A 1U1MA 1VQ7S 1HD0A 1U1PA 1N8RT 3SDEB 1WF0A 1FT8A 1OIAA 4OZ0A 2N3OA 4Z2XA 2FPHX 1WTBA 2KT5A 2DISA 3G71S 3SXLA 3BS9A 3EGZA 1F9FA 1M5OC 2QEXS 4IO9Q 3DLLQ 1WI6A 2LMIA 2KN4A 2LKZA 2M9KA 2OSRA 3CTRA 2XNRA 2V94A 5DDPC 3UCUP 1M5VC 3J7ZT 5BJRA 2CPXA 1M5KC 3VAGA 3JB9k 2MZSA 2DH8A 2RRBA 1VQPS 1SJQA 2CPFA 1KC8T 2PEHA 3Q2TC 2G1DA 2JX2A 2YTCA 5HL7Q 3G9CA 4WFNQ 4CIOA 2DNRA 1W2BR 1JJ4A 3P49B 1YWXA 2OIHA 3BO4A 2PE8A 1D8ZA 2KU7A 1VQLS 3R27A 2CPZA 1JMTA 3CD6S 1SJ3P 4QPTA 1ZH5A 5GMKa 4YB1P 2HGNA 2LYVA 4TU8A 4YOEA 2RS8A 2E5JA 4OZ1A 1WHYA 1IQTA 1O0PA 2X1GA 3U1MA 1DHMA 2DNNA 2M70A 1RK8A 3N9UC 4CH1A 4IOCQ 4Y0FA 4WKRA 2ZJQQ 2DNMA 2ADCA 2FC8A 3CULA 1VQKS 2BOPA 2L41A 1UAWA 1X5PA 3NNAA 4W90B 1NU4A 3HI9A 2DNKA 5MLCV 2MQPA 4LIRA 1X5SA 2KXFA 2ZJRQ 1YJWS 2I38A 3UCZP 1X4EA 3VAMA 2XS5A 1P27B 2M0GB 2DK2A 2HZCA 2OSQA 3VAFA 2CPIA 3OW2R 1QVGR 2CQ3A 4TLQA 2JWNA 2MY7A 3NS5A 3CCRS 2ADBA 2I2YA 2FY1A 2L9WA 3RW6A 5LSOA 3IRWP 2MQLA 1UP1A 2DNQA 4IUFA 2LA4A 2CPYA 2CQGA 2XS7A 2J0QD 3HHNB 3K0JA 1URNA 2CQIA 2X1FA 1XN9A 5ITHA 2NZ4A 4LMZA 2MKKA 2HVZA 1DBDA 2MGZA 5LXYA 3LQVA 2DNOA 1X4FA 2DIVA 2GHPA 3MI7X 4YUDA 3S6EA 3D2WA 1FHTA 3CXCR 2DHXA 3R1HA 5DM6Q 3MXHP 1Q82T 3NNCA 5JVHQ 3H2VE 3I56S 5D77A 2MKIA 4EGLA 3VAJA 1WHVA 2DNYA 2MJUA 2M8DB 4UQTA 1U1OA 1K73T 3S8SA 2LXIA 3THPA 2DB1A 2N3LA 2NLWA 2RUGA 3SMZA 3UE2A 1FNXH 2XS2A 2CQ2A 1VC0A 2HGMA 2CQHA 2KHCA 2KM8C 1NJIT 1KQSR 2A3JA 3UD4P 3U1LA 2XB2D 3CCVS 2HGLA 1VQ4S 2HYIB
chains in the Genus database with same CATH superfamily
4CO2A 1ZZFA 4FBTA 2HQGA 3QBCA 4LF8F 1UA1A 1FE0A 4RU9A 4U8VA 4LUBA 2UUTA 4JUZA 1K47A 1Y7PA 1K9MT 4WZQA 2I5JA 3ET6A 3GTYX 3Q89A 3LP0A 1HNVB 5HQMA 3I0RA 4IRKA 2ZOMA 3CWJA 3GWCA 3QRRA 2HMIB 2BABA 1VQNS 1V9OA 2HFOA 3LANA 4PEOA 4UT4A 1X0FA 1U26A 4ZVSB 3BREA 4PG5A 1H2TZ 3HULA 1ZOTA 3OPKA 3PV8A 4DHVA 4OYOA 4GVLA 4FPIA 3BEGB 1Q4RA 4NE9C 1IWAA 3OUYA 3FRYA 3PIPQ 4JI3J 1WG4A 4RW9A 1U1NA 4NLGA 4WXWA 4C0HA 1HD1A 4DPOA 2B7CB 4DSLA 2CADA 2AP6A 4WCEQ 4DL2A 4DPYA 2KVIA 3CCSS 1UWBB 3OL6A 3CCUS 5AXNA 3QGIA 4AXIA 3GIRA 4IH7A 5EWEA 4H4KC 4DR5J 3UPFA 3T5LA 5LSLA 5HROA 3DOMB 3HHLC 2V8HA 4FXWA 2OEJA 2K8GA 2YNGB 3V6HA 4DSFA 3SQGB 4RW4A 4ECUA 3FFIB 4QPXA 5DLGA 1M5SA 1FJGJ 1OMSA 3BO3A 4I2QA 2MKJA 2AF6A 5E3PA 2QL7B 4DFJA 1N6QA 3QLHA 4Q8FA 1WACA 4TN2A 3I0SB 3GB0A 5K8MA 2ZH5A 4RNFA 2R7VA 3LP2A 4WK1A 1IKXB 2YH1A 4OHZA 1TKTA 2G1HA 3CW2C 2P6TA 2GJIA 3FEZA 1VK3A 3EZUA 1Q8KA 1D09B 2Y0BB 2LA6A 4F3MA 3G96A 3P96A 3IS9B 5J2NA 1B7FA 5KFXA 3CMQA 1S76D 5CQGA 4NMLA 2PDAA 2X1BA 4LF2A 2QJ3A 3D0HE 2XMKA 4IFYA 4FNIA 1JLEB 3NG8A 5DDRC 4MKBA 1NDPA 4NLDA 2H51B 5JMNA 1RT5B 4HACB 4I2PA 1VHIA 3M2VA 4LFCJ 1SKSA 3WDOA 3M6VA 2WONA 3GJQB 3M30B 1CJKA 3H4DA 2NXEA 2VG6A 1RTDB 1C4CA 3IR6B 3EZ5A 3EWGA 1RTIB 2ACYA 1JNRB 4Z7CA 2G0IA 1EHWA 2ZH6A 2IYGA 4P7TA 1SUQA 3LPYA 5D4PA 1TP7A 2HHWA 1FVSA 4PXCA 3Q83A 5GAGI 4ICLA 4CO0A 1U1PA 3ZZRA 4Q2LA 2QV6A 4IG0B 1QUPA 2VDIA 2PMHA 4P10A 2XNRA 2GHVC 4F2RA 3W8PA 3UCUP 1HYSB 3UVJB 2WK4A 2CG4A 2QFIA 2XSJB 2MZSA 1PBUA 3SIPB 3IR5B 3IN5A 3H20A 3BKTA 2PSZA 1NK7A 4CIOA 2YWHA 1NHKL 2L9NA 2CJYB 2QN6B 2FJAB 1FK9B 4ZVOB 4MH8A 3R27A 3TUJC 3JS9A 1VMBA 4L3KA 2IJNA 3RG6A 4KPYA 4ZIWA 1NRKA 2W9BB 3R2CJ 1RK8A 1ZA1B 1NU4A 2J6UA 1DY3A 4LIRA 3KLEB 5KFPA 1M1GA 4D3GA 1YJWS 1R3NA 3HKWA 1YRUA 2OSQA 1RADB 4R0JA 2ADBA 2L9WA 4E8UA 2IAJA 3OVAA 4ZPVR 4NEYA 4ED1A 1XNQF 5DZ6A 2HQDA 1S4FA 3EPIA 1UFKA 4I56A 1HKAA 4WBFA 2MGZA 3FQKA 3GZ7A 4F4AA 3D2WA 1VOMA 4HTIA 5F8LA 1HQEB 3BBCA 3CCZA 3RBDA 4JI7J 3M8WA 2KHDA 4I0WA 4B3SF 3J7Z5 5EDWA 4IOBA 4NLQA 4DV7F 3M2RB 4TYAA 1NJIT 4ED8A 4PG6A 3N28A 2VQFJ 2JZ5A 1RWPB 2LQ8A 4UTGA 1FRHA 4OJ1A 2X1AA 1F9HA 3OL8A 2JHEA 4EZ9A 4OI6A 1RT6A 3D54A 4MTPA 3DHWC 5KFVA 1D9AA 2EWHA 1RP5A 2PI4A 4LBHA 3D6HB 3ULHA 4J91A 3RTVA 3T3FA 3OTDA 3TZXA 4W92B 3FZ2A 4O0NA 1MW7A 4ZVPB 5DG7A 2RUSA 2HLTA 1RXOB 4G1QB 2IYIA 2CVIA 1H98A 2QGFB 2OKQA 3AXKA 3MWBA 1WSRA 3KJQB 2GAGC 5FIIA 3BQ1A 3VCDA 3TJ8A 3GU0A 1S9GA 2OD4A 1FJ7A 1ZTTA 4ZPCA 3UN5A 1JLQB 4Y3CA 4U7CA 4WWSA 5F3ZA 2DHHA 4XDCA 3IGVA 1HPZB 3ZTOA 2ROPA 4X4SA 3THTA 4G65A 1I94J 5CH7B 4LR9A 1UVJA 2UXBJ 1FTRA 1OWXA 3VAKA 1XR7A 5A8KA 5IM0B 3G6ES 3GJRB 2YX4A 1H6KX 2POKA 4X65F 5CYMA 2XLJA 2C3OA 2OGUA 2PC6A 3DM2A 3BBBA 4DG1A 5A8WA 3DYAB 4P74A 2KXHA 3CF5Q 5GADI 3OVBA 1TL3B 3DN9A 3OTEA 4RPFA 2KFNA 2J8AA 1W7WA 3D6TB 1F1BB 1NHUA 3ETMA 2D1CA 2PFFB 3HO1A 2C2OB 4PWWA 4ZLJA 4WIQA 1U8SA 2QIFA 3J80U 1HNZJ 4K5SA 1RT7B 5KG7A 1QE1B 3OBIA 2H3EB 1OQ3A 3RB3A 3DLKB 3JYTA 2WZ1A 3DRYA 1C4AA 3CJKA 4NZ7A 3BGUA 2L9DA 3EZOA 5E3CA 2FJVA 1VC6A 4BBYA 4LJMA 1U2CA 2N7YA 1DTTB 1N52B 2O3DA 3A8IA 3KLHA 4K4YA 1LK7A 3V5RA 1VBXA 2ZKUA 3DI6B 2EBEA 1EKRA 3I4HX 4UQGA 2C2KB 4LVNP 3G2XA 2IHR1 2O67A 2PEBA 4CNYA 4P72A 3A1YG 3M2UA 3KOAA 3CD0A 3ADAC 4ES3A 1IN0A 2QE5A 2EKNA 1FRIA 3IM8A 1YJNS 5B0GA 1SI9A 1Y3JA 5AT1B 4DL5A 3MOJB 3DFEA 2QL5B 4FYVB 1D0EA 1RA7A 1DQ9A 2V8DA 5F41A 2ZNZA 1WF0A 3M8PB 1SB6A 3PACA 3DOKB 2J9EA 3GIIA 3SXLA 4DCOB 4I64A 3QZ8A 4TXSA 1J27A 2NXNA 4QZVB 2ZE2A 5DDPC 3J7ZT 1TR0A 3AB2B 3GIMA 4IQMA 3QGGA 4OHVA 3VTIA 2YKNB 3Q2TC 2YTCA 3C16B 4WFNQ 1C1CA 1DFDA 1W2BR 2OIHA 2XY6A 3K59A 3VGTA 1FFSB 2DCLA 3CD6S 4B9NA 4O3QA 4TU8A 2RS8A 4QYRA 5K8OA 1G7CB 4O44B 3CULA 1FXRA 1IR2A 3OSPA 3NNAA 3W60A 1JKHB 2ZBQA 3F73A 4KE5A 3GE9A 2LXFA 3OQ2A 3KHLA 4KGXB 4J9VA 1S7HA 3TA0A 1BD6A 5IV3A 5K14B 3EUNA 3PRBA 3M6WA 3QIPA 1B99A 2RQMA 4DFPA 2LDYA 1FRXA 1IBLF 2FTRA 3KK3B 5G4DA 4PUOA 5KFDA 3MMAA 5EWGA 1QJHA 2FHKA 1KDNA 1VLOA 4K8RA 1Z2ZA 3M1VA 1REVB 1RT3A 4DV6F 2BQRA 2QLJB 1W25A 1AA1B 3HFZB 1Q16B 3NMAA 2XB2D 2CJBA 4IG3A 4HHJA 4ETXA 4EO8A 2WBRA 4A4JA 4HEA9 1NK4A 1QAIA 4YHHF 3Q8UA 4HI1A 3ZZ0A 1S6QB 4LF9F 1RI7A 1CJUB 3KFWX 4RZRA 2HWIA 2NUUG 2YY3A 1F3FA 3OD2A 3HXMA 4FKXA 1FRMA 1WG5A 3AD8C 2WB1D 4WTYA 4X66J 3TX0A 3G8SA 5HBMA 3BKFA 3NGSA 1VRQC 5J2MA 1Q53A 3PR4A 3EDQB 3ZZOA 4GKJJ 2XY7A 3TAPA 1GNKA 4HDGA 2GQ2A 2HNZA 2GA7A 2VBXA 4RO0A 4MYUA 3CCQS 3L95X 1WSVA 5EX3A 2FUG9 4QIVA 4QQBA 3B54A 1NEEA 5HSPA 3NNHA 5KFRA 1Q81T 4DQPA 3VVUA 2YNFB 3CCJS 2DR6A 1KQKA 5ADZA 4R5PB 2RT3A 3R5CA 3FBBA 4C6AA 2Z58B 2MQQA 2VG7B 3DLJA 5KAKA 4GC6A 1R8PA 1S79A 2W7AA 4FVCA 2J0WA 1SC3B 3JAMU 1ZM3A 2CPEA 4K4VA 3NOGA 1AYEA 3SV3A 3CUNA 2R2UA 3PX4A 2HIQA 2UXCJ 1GTHA 3OR1A 2JLFA 3PJXA 4DR7J 4IH5A 2YNHB 2KO1A 2DH9A 1M0SA 4URGA 4UOCA 4PXDA 2F8HA 4RW8A 4KYZA 5HK4A 1G1XA 4O3SA 2A0FB 3MPUB 1X9MA 3ZTSA 4HKQA 3OL9A 4ZPTR 3KK2A 1Q7YT 2OPSA 4LF8J 2OMLA 3J81Y 1KVKA 3NCQA 2ASJA 2KYZA 2MMYA 2LEPA 5GAHI 3QIDA 2YXLA 2YQ0A 1WHXA 4CO4A 3HVRA 4UY85 2ZHOA 3OUYB 4CZCA 2LEBA 4RW9B 3JTNA 3K89A 5IWAF 2CPJA 2AD9A 1V5IB 2OPRA 3IP0A 3FK4A 5BR8J 2LVWA 3T19A 3A13A 4NEZA 2JJ4D 5HROB 3K5LA 3MEEA 4ECWA 1LWCA 1Z1ZA 2QLWA 1Y5IB 1FA0A 3BPSP 7AT1B 4X62F 3WIVA 1Q8LA 1QDUB 4RW4B 1IKYA 2Q79A 1U1MA 2FD2A 3PW7A 2J7UA 1C0UA 2VFTA 3H0PA 2DISA 4EK2A 3D5MA 2FLLA 4C3MA 2AEJA 4EBEA 1HBUB 1P9YA 3K17A 2EFNA 3H42A 4NCBA 3C3LA 4F0MA 1EARA 4M1KA 2DNRA 5J2NB 5A76A 4OYXA 1JLAA 1VISA 4QPTA 1HW9A 5GMKa 4MK8A 1IQTA 1YJTA 4CLWA 3TWZA 5C24A 4Y0FA 5F8GA 4EWTA 2WONB 4USIA 1BXNA 5KG1A 1UJ6A 1FD8A 3VAFA 4JI1J 1VYAA 1SBRA 4HL9A 1QAYA 4F8RA 5KFNA 3GFZA 3AODA 4ENOA 2AHOB 1PJ7A 4C97A 2CQGA 4DV5F 1REGX 1CULB 2G2OA 3AAWB 1FDDA 3RRKA 1Q82T 3MXHP 1HQUB 3CDAA 4Y28C 1F2GA 2DB1A 2N3LA 1YKWA 1FEHA 2VV5A 3QT8A 2Y9HA 2HK2A 5C2GA 2NPIA 2A3JA 3M8QA 4PXBA 5L8RC 3C15B 5HVGA 1R8BA 2V0NA 2C1EB 2HVDA 4OLOA 2LEAA 4KBIA 4ZITA 4I6AA 2Q6CA 2YQ1A 2KXNB 1FE4A 2VONA 3EE3A 1UVNA 5IC4B 3KLFB 4ZA1A 4BCAA 1T94A 1BMQB 2ZZMA 5KFSA 1T9WA 3HHKA 2MZJA 1RU2A 3P5BP 3ENVA 4TU7A 4P73A 5RUBA 3PDNA 3KJVA 2KH9A 1TVRA 4DDFA 2IAJB 2DEIA 2F7VA 3QT6A 5IFMA 1CC7A 2W2MP 2KFYA 2E7XA 1I3OB 5L1KA 1PAUB 2MGZB 3CCWA 2V67A 2KZZA 2XMVA 5DDQC 4CH0S 2B4VA 4DLGA 2CNOB 5F8IA 4HHHA 2RQKA 3R3TA 1M5PC 2AYBA 4K4UA 4CLUA 2DGUA 2IJFA 1YGYA 1UZDA 1XNQJ 5L39A 4LFBF 3I55S 4PZVA 1FKOA 2XNQA 5LMUJ 3NCPA 3KHGA 2GJ2A 2ABYA 2UV8G 3MMJA 2W25A 4WYWA 2FLNA 2RH3A 3KHHA 3GFYA 4C4WA 1OO0B 4J9QA 4ECSA 4HH0A 2RDDA 4PWUA 4H4OA 4DV7J 3MF5A 3MM7A 1AXQA 3MAHA 2RF2B 4GVBB 1YBTA 2P2CB 1K1SA 1FVQA 3KLVA 3RU0A 2V4JA 2GQCA 1P9QC 2DGQA 4Z37A 3IAS9 3DDKA 2CKWA 3CVKA 3SZ2A 3MM5B 4DN9A 1TUVA 2V2VA 2XLKA 1ZZNA 5G0RB 1S9EB 3MAAA 4NLSA 3BZQA 5LSRA 3UD3P 1X4DA 2J0XA 5C7PA 4ED4A 3G6XA 3G82A 4DR1F 5L1JA 2VQEF 1R7IA 3DNCA 1T9XA 2UXDF 2DY1A 1EZZB 3VALA 2OLWA 4NLOA 1KOOA 4OYWA 3CJ3A 4PPDA 1DARA 3CJ4A 2V8PA 3G6YA 2GGPA 2MXYA 4FF4A 2CQ0A 2HVHA 1DLOA 1VQ9S 1HWUA 1C0TA 1RLCL 1IJFB 2IMWP 2F8MA 1X9WA 4DN0A 4H4MB 1JLGB 5J1EB 1YX2A 4TY8B 1H74A 1RTHA 1N34F 1N54B 4KV8A 4K7QA 5ETSA 4P2SA 4MMOA 3EVOA 4DV2F 2C42A 1S1XA 2IBKA 3SFUA 3M9NB 2E9RX 2BJDA 5L38A 2ZH4A 2M7SA 3H25A 2AZ1A 5H9EJ 3AFGA 3DRPA 3MEGB 3V2UC 4Z2XA 2ASLA 5C42B 3ISZA 5E3QA 3BS9A 4X65J 1YVFA 2HZAA 3LF0A 4WU2A 3ISND 4QIEA 2M9KA 3TAMB 1LXJA 1U47A 3B6BA 4NLXA 2BJ8A 4KGKA 1GK8A 2RRBA 4DR2F 5HL7Q 1E6YA 3JTPA 3N6MA 1BHNA 1HI0P 4KH1B 3CJKB 1JJ4A 1N32F 3F56A 1ZM4A 2R7WA 3D67A 3E8OA 2X1GA 1DHMA 4CH1A 2IM2A 4CT8A 3HP6A 4W90B 4ZVQB 1U0SA 1RA6A 2RIJA 2GMJA 3CJRA 1X4EA 3VAMA 5GMEA 2XS5A 1XIQA 3DKDA 1S1VA 4TLQA 4K4ZA 4A8OA 4OX9F 1Q5YA 3H2LA 4IUFA 2WOMB 4EO6A 3BGRA 2XS7A 2Z2ZA 2XO7A 2CIMA 3PFOA 4Z7YA 5A0YA 3TJ9A 4U95A 3A12A 1U25A 4C11A 2EFVA 2XZWA 2FVPA 2PMZD 3O6QA 4HLBA 3NNCA 2MKIA 1KEKA 4YB5A 1IBMJ 4WXOA 1VC0A 4MT1A 2AGPA 5F9NA 5EUHA 1C1CB 3QZ7A 2VA2A 3PO4A 1UL3A 1S1WB 3NXZA 3E01A 2CPHA 4NXNF 3BH7B 2JEFA 1HWJA 4FVMA 1PJ5A 4ZLLA 1ZBTA 3DU5A 3B4DA 1RAJA 4M5LA 1JK9B 4J9NA 1CG2A 3ENQA 3OTBA 4X4VA 4Y65A 1WG1A 5J2QA 4AL7A 2AV5A 4CYUB 2UZAA 4DOZA 2J6TA 3CE8A 1FRJA 1S59A 4USWA 3MR5A 4WE1A 2W9CB 1LWEB 2C28A 3WZ0A 2OI2A 1UVKA 3R5DA 3DHXA 2UVUA 3FCHA 1PO6A 3M8RA 2OJ3A 1S7IA 2WTFA 4ERDA 3C19A 1R6VA 2ALYB 2HW3A 3MMAB 5SUHA 3US5A 5CYQA 1F5BA 5DLFA 3H5UA 3N6LA 4V19X 1CVJA 2OO4A 4J9MA 3IBWA 3T1HF 3N5BA 1IBLJ 4F4WA 1R27B 3R5JB 5KT4A 5B09A 4ZVHA 3MM6A 3B8HA 4DU8A 5FD1A 1TKXB 1XMOF 1PJ6A 4DV6J 2JVRA 2FZGB 1X9SA 2ZBPA 4F4ZA 4O4GB 2B43A 5D15A 2VJUA 1UPMB 4ES2A 2FJXA 1TUGB 3MCSA 5KG5A 4I68A 3DGPB 4EZ6A 4RKUC 3CCLS 1NBEB 5J2MB 2MY8A 3TI0A 1F9EB 3ZXWA 3A4TA 4WJBA 1DRZA 4YHHJ 3W5XA 3FQLA 2WAQD 5ETNA 3PYFA 2NPFA 4LF9J 1T02A 3HHLB 4MYTA 2EFQA 2RU3A 3EX7B 5F8MA 3Q8VA 1Q8IA 1YHQS 2OPPA 1HBMB 3H8YA 3W8GA 1TQLA 1X4BA 4WIIA 4J5OA 1S72S 1WTFA 4V19J 2UUBF 4GO5X 2MJNA 2MSSA 4NYPA 1MSWD 2E5HA 5ETLA 4NX9A 3EICA 2NZCA 1WEYA 2HMIA 3M4XA 1U24A 3ILLA 1WKKA 2C2RA 2AZ3A 3W66A 2R7XA 1R8HA 4M5DB 1PILA 4WFAQ 2I0XA 1J2VA 3BQ0A 4F4KA 1T95A 4PG4A 1J5OB 3VAIA 1Q78A 4B3RF 1VDHA 4I6WA 1X0PA 4L6V3 2DXDA 1YLXA 1IM6A 3C46A 3TEGA 2LCWA 2R42A 1YZ6A 4FF1A 4RW8B 1N8RT 1IKVB 1VJWA 2OEKA 4TQRA 2Y1RI 3RAXA 5KFGA 2GW8A 1RAEB 2OPSB 1HWKA 1SC1B 3NS7B 2AX1A 1UVIA 1DURA 3T6BA 1UWBA 4M5MA 1DAXA 2ZHBA 2Z30B 3BR9A 2CPFA 1MNEA 3C66A 1HNWJ 5AXKA 3ZZUA 3MMBB 4IR1A 3DOMA 1NXIA 3KHRA 3MPDA 1U48A 2KZMA 4I1TA 2GIFA 1NZAA 2AX0A 1AROP 3HSZA 3JSYA 3A3OB 3LWLA 4QWEA 2YNGA 5D0GA 3SQGA 3A8EA 2R7QA 2ZJQQ 3FFIA 4N56A 4HTJA 2ZD1B 2P9EA 4LVOP 2MQPA 3I9V9 3R9LA 1B0PA 2IM1A 3QWUA 1RWNB 3VGVA 2DK2A 4A47A 2JWNA 1J5EJ 1AW0A 2WVBA 3MR2A 5KFQA 3BSNA 5ETTA 3J7A1 1N36F 3QO9A 5IWAJ 3IS9A 4LF7J 4O3RA 4AFFA 3UQSA 2V4QA 2CFXA 4DX6A 3L4BC 3HHEA 1JLCB 1FHTA 2CG8A 3CJ2A 1RT5A 4HACA 3FJ2A 1KLNA 2LXIA 4M5KA 2FY8A 3M30A 1PYOB 1N33F 2NLWA 5H9FJ 4NLTA 2KM8C 3MCOA 3K7RA 4K50A 2LLZA 5IT9Y 1RTIA 3CCVS 1VQ4S 2VKZG 1UZHA 3A8JA 1RWVB 4YMEA 1RBLA 2MSTA 1KKHA 1RLDA 4RL1A 1S4EA 4L75A 2XZDB 4ANCA 2UVWA 1ZAXA 3HVAA 3HDSA 3W62A 5GAEU 5AXLA 3ZZZA 4ECTA 1VQSA 4I6YA 3OHAA 2AEFA 1HYSA 4LBPA 4BC9A 2JRSA 3BB5A 4QWCA 3KTQA 1XNRJ 5KT5A 2FHJD 4DPUA 1HWIA 3DOLB 1FK9A 1HQ2A 2VUGA 4F26A 2HHVA 2NXCA 4LBIA 2OPQB 2MHNA 4XIUA 2FZKB 1TUWA 2W9BA 1KONA 1KQGB 1VBZA 2W1BA 2P6SA 1T05B 3KLEA 2XMMA 2XYGB 2CWKA 2IBOA 2C2DA 3W9IA 3EGNA 4WP8A 3S1TA 6FDRA 1RKJA 4OJ3A 8ATCB 3FDSA 3DGVA 2WVEA 2FC9A 1GX5A 1Q8BA 2IDEA 4ZPAA 3NGKA 4MIBA 4DSEA 3WQPA 3PHTA 3GJTB 1Q0NA 1B7YB 4L73A 1WC4A 3CB4A 3C6TB 2ZDOA 2R2RA 2HHSA 4DL0C 1CS4B 2AU0A 3CC2S 2BM0A 1HQEA 3IAM9 2CXEA 2XMTA 1X31C 3M8SA 3LAMA 2HBRB 1HA1A 3CCTA 1S77D 3TZWA 4Y2MA 1N56A 5H1SV 2DPJA 2P5VA 3QSYB 5KFOA 2MZRA 1FD2A 3MTKA 1RCOB 2B6AB 2BE2A 2YNIA 3I5AA 4MIWA 2V6AA 1BQXA 2D7SA 5CXTA 3H4BA 1K8AT 1R0CB 3W3SA 4ZVEA 1NKBA 5KG2A 4HDHA 2VOOA 3AQPA 5D3GB 4ZN1A 1LK5A 4FZVA 2JC0A 2CAJA 5D0EA 2BANB 4G1QA 1KSPA 2NS1B 3MECB 3QFWA 1UWAA 1N0UA 2YKAA 3MGJA 4CQ1A 2W8KA 3EVMA 2UXBF 3PKMA 2CQ1A 4CM2A 2CJKA 1XBWA 2M2BA 2XCAA 4DQRA 3UN2A 4NLRA 2M8HA 2DITA 1F5CA 5GVQA 1LW2B 4MKVA 5HN0A 1AB8A 1FX2A 1JLQA 4A8QA 1VQ7S 2HWHA 2R8IA 1HPZA 3OJUA 1WTBA 5FDLA 5T14A 4Y2IA 2G2ZA 1Y5LB 2LKZA 2Q43A 3KUGA 4M5NA 3MM8B 2V2KA 1MMNA 2ZH7A 4QIFA 2DH8A 4M5IA 1DJ0A 1KC8T 1VIOA 2PEHA 3AOBA 4DV0J 3FZBA 1RAFB 1UVMA 1YWXA 5M2PA 1ICEB 1FDNA 1JMTA 3DYAA 4LRBA 1HNZF 4UUXA 2DNNA 2GGPB 2K7JA 2DY9A 1UAWA 1C0TB 3J81U 4DV1F 4DR1J 2VQEJ 3SSQA 3GYNA 2UXDJ 4M94A 2LQ9A 2M0GB 1QVGR 3H5XA 2MY7A 4KTQA 3T41A 3WHIA 3QGHA 1RT7A 3OV7A 2FHJA 3BV8A 1QE1A 3RAMA 1R8CA 4C2MA 4N5SA 1QSYA 1YBAA 2LA4A 3DLKA 1RWUA 1NSKL 1IBKJ 2HK3A 3KG0A 3LAKA 3DRPB 1PYSB 3OFEA 3EGVA 1N34J 3R1HA 1LXNA 5CD4A 3DI6A 5JVHQ 3I56S 4DV2J 3EPGA 4ELUA 1HMVB 2RUGA 4Y2AA 2BVZA 2HGMA 2KHCA 2LQBA 2HHQA 2M3DA 3U1LA 1E6YB 3KG1A 1UFLA 2BX6A 5EHHA 4RBUA 2ZH3A 4WYLA 4KC5A 2ASYA 1N88A 3R97A 2FZCB 3CCMS 3R8YA 4ID8A 2FVCA 4QOTA 2DVIA 1T7PA 4B3TF 2DHAA 4MIAA 3M8PA 1NDKA 4XPCA 4DV3J 2D3UA 4TU9A 1SC4B 2DNGA 1RE1B 3V4IB 2F63A 4IH6A 2GHWA 1N32J 1S1VB 1A0OB 3D6MB 2KKHA 4C8NA 3RBXA 3HZEA 3Q2SC 2HPUA 3MZIA 1MMLA 3C16A 1XJWB 1MROA 2AYMA 1RAIB 3ETOA 3VF0B 1VC5A 2G9OA 2W8LA 1XTZA 1QVFR 4OHYA 3I87A 4IO1A 5BYQA 1SQEA 4C11B 2E5GA 2D3OR 4FS2A 4O44A 2IVFB 4OX9J 1JWWA 1T9VA 5HI7A 3T5KA 4QWBA 2EFGA 3ZFVA 1VQ8S 2BRLA 2X51A 2ZITA 2MZ1A 5K14A 3CC7S 2IC3B 3IM9A 1DTQB 5DDOC 2F9DA 1LFWA 1WOOA 5KG6A 4F50A 4OX6A 3KK3A 1UEVA 2GJFA 1Q7LB 3R5BA 1RYRA 4K4WA 5KFTA 1X8DA 3TA1A 3IXQA 1SKUB 4MK7A 3D7SB 1REVA 3UWTA 2ZFHA 2IPOB 4NXNJ 1HHTP 2RE1A 3K2YA 1HFEL 2ZWPA 2XHCA 4AYBD 4X66F 2C3MA 4CT9A 1QAXA 4YR0A 5T41A 2XWYA 4KGZB 1EETA 1VHFA 1QSSA 5DQHA 4DSIA 4USMA 1PCAA 1IVZA 5AXMA 2DXEA 2BE7D 4M8LA 2I6WA 1EP4B 4MKYA 3FUYA 1S6OA 2C3UA 3AJ2A 4OJHA 1S6QA 1CJUA 4KHPF 3MOZA 2HURA 3CJ8A 2QC3A 3R7SB 3N79A 3L9ZA 1X5OA 2ZUGA 2GVZA 2DYAA 4DR4F 3RR7A 1SJRA 4Y34A 5JVGQ 3ENWA 3NOCA 3HT3A 2CNLB 4ZCLA 4RNOA 3I31A 1SV5A 2A18A 4TVAB 1B4SA 4X2BA 5IC6B 4O3OA 3MM6B 2F3JA 2RDJA 1SJFA 4NOHA 1MWZA 2BUNA 4J9SA 1L5UA 1ROFA 3RR8A 3ZZTA 2Z57B 2OUGA 1VQMS 1KWMA 4JBCA 4C0OC 4EU0A 4USTA 2QSWA 4LFAF 3OHBA 1RHUB 2AGQA 1KVJA 2IA6A 1QM9A 2YNFA 3ITHA 3KKFA 4ECZA 2HHXA 2W24A 2VIHA 3UFCX 2E5IA 5KG4A 4MFBB 1F5AA 1NPKA 4WZMA 4RUAA 2UXCF 1XMOJ 2HAFA 1KN6A 5EGYA 4NLWA 4KO0B 2VG7A 3EGZA 3MR3A 1M5OC 2GFFA 2AKWB 2YWFA 3CTRA 7FD1A 3RAQA 5JUMA 4OFZA 1RT1B 2OPPB 4L72B 1GFWB 3ELHA 3ENAA 2G1DA 1TTHB 2KU7A 2B4PA 4ILMA 4ZVFA 4BLGA 2YNHA 1ZH5A 1U7LA 2VH7A 1O0PA 3U1MA 3EXYA 3NGRA 4C8LA 4UOFA 4LF5F 3FMBA 3NGDA 3AB4B 3HI9A 2DNKA 2YKPA 4GKKJ 3RBEA 4BDPA 2DRBA 4OX7A 4YB6A 2UUBJ 1HI8A 4QYZK 1VBKA 2VG5B 1R89A 1HLWA 2QX0A 1N5YA 3FBCA 3IRWP 3ICLA 4C3KA 1QTNB 5BR8F 4KHRA 4DI6A 5D4OA 2GIQA 2CQIA 4KH0B 2J6SA 2RKIA 1JLBB 2DIVA 4ECXA 4TYBA 3ILIA 1N5QA 5ETKA 1WJ9A 3FSYA 2WW8A 2K2PA 3T1YF 4YDXA 4KQZA 4B3RJ 4UOGA 2CQHA 3PX6A 1KBRA 3IC1A 2J5AA 1HARA 3TR5A 1F2HA 3V6DB 3U1NA 1CJTB 2RSQA 1B64A 2CPDA 5I42B 4ZP8A 2Y1IA 4G3IA 1M5HA 4RWXA 3FSXA 3TUIC 4CLLA 2LU1A 4Q43A 3KJNB 4JOUA 4EYHB 4OYZA 4U8YA 3GG1A 3EYZA 3CEDA 3LP1B 2BE9B 1U6FA 2F4VF 1FKPB 3GG0A 2R3VA 2W7OA 2GCFA 3RB4A 4F25A 3GLJA 3AJDA 1HBUA 3UNYA 2QMUB 1X4GA 3HZGA 4CLZA 3P45B 4N77A 2MPUA 3QO9B 1BWEA 1NH7A 4J9UE 4LR7A 5B0BA 1ZPWX 1SQGA 2LDIA 1U4BA 3CD5A 5DJBA 4JI1F 2CRLA 2AJ4A 4MK9A 4OZ2A 4F02A 2RMLA 4KR0B 5LM7E 4NLVA 2BW7A 4Q0BB 2YQ3A 1LWFB 2I1RA 3BO2A 2HBQB 1N36J 4IOAQ 2JNJA 2C3YA 4OJGA 1WEZA 3O2IA 4OZLA 3HD1A 5DETA 4FDFA 3DRXA 4N7TA 4QR2A 2GZOA 2AJ2A 5I3UB 2ZOFA 5E41A 3W2WB 2E9TA 3S01A 1ZM9A 4EBCA 3KMSA 2AMCB 4RW7B 1SKWA 2UU9F 2D69A 4V1Ak 1SIZA 1N33J 3IGNA 1CULA 3CDEA 5E7OB 1Q86T 3Q23A 1YZ7A 1FDBA 3CPWR 3V6JA 5KFLA 3OLBA 4W4MA 4CH7A 2N4CA 2XWXA 2MKSA 3NS6A 1HQUA 5D6GA 3KNAA 3UDVA 1UETA 3EGWB 4TNOA 3PYEA 1VCTA 5D0RA 3C15A 5HQLA 3FMWA 2MYFA 4IR9A 3FEYB 1IWGA 3UDEA 4WP3A 5CD4H 2MLXA 4M63A 1T0TV 3M32A 2O01C 5IT4A 5DGAA 2HFSA 3KLFA 4KGMA 4WFBQ 3TZYA 2JVOA 1RT2B 3W5ZA 4NLPA 2UV8A 2VD3A 2V69A 1EB0A 2CQCA 1TFWA 2OEMA 2E7WA 1S1UB 1PBAA 1X4AA 2LU2A 2ZNYA 1XR5A 2XMAA 1KR4A 4CDIA 4OI2A 4PRFA 1RHQB 2KG0A 3T9NA 2XQCA 2DO0A 2MZTA 1N5SA 4C8YA 2ZC3A 5LMUF 1S5ZA 3GJSB 2U1AA 1YSJA 4HHUA 2F40A 2W01A 2FQQB 2HBZB 4UF4A 4IKAA 2VBZA 2V8VA 5C2CA 3SDEB 5C25B 5KFFA 1Y5NB 2A2CA 3FNNA 1E6VB 3ZC4A 1L3SA 2Z56B 1PKUA 1YJ7A 4MJKA 3EXCX 1M5VC 3UR0A 2CPXA 2I8EA 4LF1A 2BE2B 4DL4A 2YNIB 1UEUA 1SJQA 3UN3A 1P1LA 3G9CA 2NYIA 2FJWA 1I1GA 4Q5VA 4R25A 4A8FA 2RF2A 1AT1B 4GVBA 2HSEB 2JLEA 4FXDA 4DU7A 1NK8A 2HFNA 1NK9A 3V81B 4KFBB 4PCQA 1X5PA 3RBZA 4I4BA 1Q95G 2YWWA 3MM5A 2V2ZA 4G6VB 2ZOGA 4X4PA 3GILA 5G0RA 2HBYB 1S9EA 2H54B 3NS5A 4KKOB 3PCOB 2YKQA 1GXTA 1V6HA 1APSA 2MQLA 1F60B 4ECRA 3TRGA 1U2RA 1HBOB 2HNYB 1URNA 2X1FA 1KFDA 1ULRA 4LF4F 4LMZA 1S99A 2WB4A 1X4FA 2ASDA 1XMBA 4JYAF 3RB6A 1C1BB 4IFVB 3TARA 5FDLB 3BYPA 4NA1A 2W4CA 3DLEB 3GMGA 2F5GA 2DNYA 5EX0A 5IXUA 1D8YA 4H4MA 1JLGA 1FNXH 5J1EA 1T3NA 4TY8A 2FB0A 3HPOA 2HRYA 1NJYA 2I9SA 1F3VA 2MKHA 4J9LA 4DS4A 4IRDA 3OFFA 5IT0A 2VOPA 2PI5A 4CLYA 2VPWB 3NLCA 1KLMB 4KY3A 3MEDB 2H4YB 3PVXA 4NZ6A 4ZCMA 3PKYA 3MEGA 4RUBA 5GADU 5C42A 1Q1KA 4X4TA 3FRZA 5E3AA 1G2EA 1JX4A 2DXFA 2PN6A 2E66A 3TAMA 4DL3A 3LOUA 2C3PA 2ATCB 3HHLD 2V9WA 4Q8EA 3THVA 4F2SA 4NXMJ 3GIKA 2EPIA 4LREA 3CO0P 3DLHA 2RNEA 2VASA 4DV1J 1KTVA 1KD1T 2XLIA 2APOA 2CQ4A 3MD3A 1JJ2R 3QGPA 4EUVA 3GYGA 3PEHA 3HJVA 3H59A 3W63A 1FWPA 3Q86A 5B08A 2KT2A 4N76A 3NP5A 4CRJA 1O6XA 2VDHA 5B7WA 2KYXA 3F41A 1NB7A 2QFJA 5E5NA 1DQ8A 2AT1B 3B4MA 3G8TA 2DNZA 3DXBA 2KJVA 1F0XA 1IBMF 4KRWA 4P2MA 2W9AA 3IR7B 4C7QA 2WOMA 2CJQA 5IS2A 4QWAA 1G6BA 4DS5A 3BDEA 3MURP 3TW0A 2BZ2A 4WKYA 4RW6B 1RZMA 4L74A 2V4RA 2F8EX 3UNGC 3UCGA 1RQ0A 4CLSA 5A6WA 3AOAA 2CJXB 4M95A 3A8KA 2DEJA 2V50A 4FF3A 4J7CA 5IT9U 2CZ9A 3AQOA 5CHCB 4QU7A 4D3HA 1S10A 1EKSA 4OZNA 3T5JA 1MROB 2VBYA 4B3TJ 3L3CA 3M6UA 4DF4A 1JJHA 2AJ1A 1S1WA 2CJ9A 4DPTA 1R0AA 3AA9A 1SH0A 4PR6A 3MM9A 3OFHA 4B3OB 1NDCA 3DDNA 3MMCB 4EEYA 1NJXA 4GO7X 1T8EA 4ILLA 2DHSA 2CQBA 3W65A 5L1LA 1FF2A 5KT2A 2L3MA 4PG8A 1RSCA 4CYUA 2NXJA 1L3KA 4L3NA 2HHPA 2ROEA 5K8PA 4JI6J 1ZAWA 4ZN3A 2W9CA 1LWEA 4ZVTB 1OY9A 3E2EA 2IM0A 3GV7B 3CT9A 3LUYA 4X4RA 2W2OP 1N48A 2CVEA 3AJ1A 5CA5A 3KG4A 1UA0A 3IRXB 6AT1B 5DS7A 1S0OA 2M5YA 1UEKA 2H5IB 1BC6A 2GAHC 1NB2A 3RRHA 2VHGA 2HHHJ 3Q8YA 4ZPWR 1S0VA 1T9UA 5KFUA 3QJJA 3G71S 3PG9A 4I7FA 2D74B 4B9VA 1S6UA 4GMKA 4CLPA 1EETB 1F6TA 3C6UB 5BJRA 4BC7A 1D1UA 1T11A 2QA4G 1HI1A 1TKXA 3D1QA 1PIEA 2DRDA 3EMTA 4O4GA 4ES1A 2B5JB 1QSLA 4FYDA 2GVZB 3DGPA 3C2PA 2HGNA 1XK8A 2Z8QA 2FC8A 2BV3A 1SV5B 4XDDA 3J81j 3CO9A 1T03B 4U7UD 1RYSA 2DRAA 4H4KA 3P8BB 3HHLA 3ZNUA 4KHPJ 3N01A 2LQJA 4DR4J 1BGXT 2I2YA 3TZZA 2BW2A 3HSDA 1HBMA 2QO3A 3ITHB 3K0JA 2DTJA 2MKKA 3OL7A 2XC9A 1D9DA 4F0HA 1W2IA 1DBDA 1WC3A 2OD6A 2MQ8A 2JEJA 2WSFC 2DHXA 5A2QU 2GS8A 3H2VE 3NAHA 4LFAJ 2W2PP 3IFEA 1BQMA 3NKYA 3THPA 3IA0A 2QA2A 1I6JA 4M5DA 5KFWA 2HKEA 4HT7A 2NREA 2VFRA 1RTJB 1J5OA 4FPRA 2CDRB 2RRNA 3MUVP 4JI0J 2B9XA 4DZDA 2DCUB 2W4PA 2XMUA 4KSEB 4X4QA 5E3RA 2GX8A 3DRSA 2L48A 1HNWF 4X4UA 1VQYA 2VPZB 1Y10A 1IKVA 2NYHA 2HNDA 4P7VA 2KM8B 1L3UA 2JEGA 5HATA 4FBUA 2LXUA 1OYEA 2BRKA 2EC2A 2FDNA 1GT8A 5DO2A 5F9LA 3X3UA 2J9CA 2NSCA 1N5YB 2R8GA 1WC1A 1HNXF 2LQ5A 3AA8A 3MCNA 3MMBA 3JSMA 3CSKA 1TMMA 4LF5J 2VC0A 2K3KA 5GAHU 3H5YA 1J5EF 1OQ6A 2RKIB 1YITS 2CYYA 4BS2A 4DXLA 3SCKE 3BSCA 5L1IA 2ZD1A 1AUDA 3P5TL 4LF7F 1U6ZA 4IQXA 3D6FB 4Y00A 2H9ZA 4JI2F 1YJVA 3O44A 5KFAA 2HQIA 4LRFA 1VLYA 2F1FA 1U1LA 4PQAA 2E1PA 1HR0J 3PNIA 2DBBA 1S6PB 1PG5B 3T1YJ 5THWA 1B0VA 4WFYA 5HVFA 3CJSA 2BKPA 5EN1A 1WORA 4AQYJ 1JLCA 2IRYA 1H7WA 1FFGB 4KAIA 4Q45A 3SFGA 1NJWA 1TK8A 1GXUA 4J9KA 3G8QA 3Q8SB 1MWYA 4EI2A 3IBCB 4WPAA 2FGOA 4WTOB 3BYRA 1U09A 3CD7A 3VQTA 1NK5A 4J37A 1GMWD 3AH6A 4AL5A 1RKIA 2R2SA 4RNNA 3DMJB 2F4VJ 3C8YA 4ITSA 2DPIA 5M2UA 1XNRF 1NK0A 3QYYA 1EIYB 3CNQP 2EFPA 2VFSA 2M52A 3BM7A 1QLNA 3BN7A 3GONA 1RCXB 1FO1A 2ZUAA 3HF5A 5J2PA 3AXMA 3VGSA 2OTJS 5HO4A 2DGTA 3CJQA 2IRXA 1MN9A 5AJ3F 1LKZA 4PABA 1NMEB 2HAIA 5F8HA 1H73A 5K9FA 1WHWA 2C2MB 3VVTA 1HW8A 2DH7A 2MLYA 3DOLA 3FEXB 2EW9A 3M9OB 3D1OA 1FXLA 2P8IA 2OPQA 5B0AA 2PMWA 3LTOA 2ALZA 5HMXA 3AT1B 4ZS6A 1BQNB 4X84A 4NA3A 1HHSA 1T05A 4YS2A 1XC9A 1HD0A 4DQIA 3BSAA 4TY9A 2UU9J 5IZHA 1S1TB 3DLLQ 1WI6A 2BBEA 4PPZA 3VAGA 4DCJB 2IVYA 4OHXA 1VQPS 3PW2A 1P8GA 1LOUA 3M32B 3KWMA 3C6TA 4NYOA 2IMOA 3TAQA 3CGIA 1CS4A 3PRVA 4YOEA 4RUHA 3D0IE 3N9UC 2P9CA 2XYHB 3SCJE 2B8QA 4G1PA 3PO5A 1RB0A 3D3BJ 1ZS6A 3UCZP 1RUSA 3H7HB 3IWXA 2EG2A 2R9LA 1U0HB 2B6AA 2QA1A 4R8UB 1SJ1A 4GRSA 2ILYA 5DQIA 2NZ4A 2OP5A 4CLFA 1H3DA 1RT4B 1WD6A 4ZPBA 2O66A 3LQVA 2GHPA 4KJIA 2ZBCA 9RUBA 4CCHA 5D3GA 3AOCA 4ELVA 4A8WA 4A46A 2BANA 1RWMB 4NZ0A 3MECA 3BF4A 2BMBA 3QATA 2Y1LB 3KLGB 4YN3B 2JLGA 4DMZA 1ACMB 1A6LA 1FRLA 3OTOF 3NBPB 5D4LA 4O4RA 4OHWA 2ZH2A 2DGXA 2OTLS 3PM9A 3POTB 2CZ4A 1TAQA 4DV0F 1LW2A 2BJ7A 1I5OB 1QAJA 2WRMA 2D3O1 4JI5J 1EAYC 4P2XA 2YH0A 1XERA 1TAUA 4Q7AA 4Q2MA 2COLA 5F8JA 2AYGA 2EVZA 4AT1B 3MM8A 4ID5A 3D66A 3PX0A 3K8WA 5KFEA 4TKTA 2QYCA 1GMWA 2ZH8A 4B3MF 2YX1A 1TK5A 2ZH1A 3BPDA 4NCGA 1JB0C 1TELA 3VHQA 1IUJA 1MMDA 4MAKA 3MFIA 1NLKL 3VV2B 1SH2A 4I69A 2UUCJ 5HVHA 1U8WA 3JQKA 4ZKAA 1LW0B 1KOHA 2MHEA 1IBKF 2RAQA 3LWMA 3EJMA 3K58A 4WFXA 2OFHX 2J76E 3BJYA 2EC0A 3PIOQ 4ZJOA 2E5LF 2N4DA 1GH8A 4LF4J 2GNKA 2FJDB 5HAOA 2MQMA 1U45A 3CIMA 4O3NA 3OSNA 1V3ZA 4X64F 4JYAJ 3I5BA 1GMUA 1UW4A 3N5FA 1OY6A 5EWFA 1MN7A 4PQUB 1RAGB 4NL5A 2IVMA 4OI4A 1XMQF 1RHRB 2Z2MA 1R0BG 3BBFA 3CMAS 2OFGX 5KFZA 4JI4J 2SXLA 1YTYA 2MB0B 4DPWA 1NK6A 1HMVA 1N4LA 3PY8A 4NMXA 4DV3F 3LALA 4A8YA 2JH3A 2D9PA 2D9OA 1VJQA 3KLIA 4YR2A 2RDIA 4LSLA 4B9TA 1NM2A 4DR3J 4PG7A 1VS3A 3D9BA 5ETOA 2PFDA 2Q66A 4ANDA 1Q5VA 4USJC 3FGVA 1TL7B 2PA3A 3QWPA 1NUEA 2KRRA 1YK9A 3TVZA 1TL4A 2E44A 4NI2B 2K1RA 3VZIA 3V4IA 5FJ4A 1DQAA 3M8ZA 4XK8C 3NL0A 2Y3YA 2W2QP 4X4NA 3SSSA 4LQ9A 3ILJA 4FYXB 1WOSA 1NZ8A 2EFOA 3QT7A 1HNIA 4WU3A 2PD1A 3JTOA 2FHOB 3MR6A 3MPWA 4IDKB 5K20B 1GX6A 1FX4A 3E51A 4OV6A 2E1MC 4N8NA 4HH1A 1B0TA 2WHOA 3HD2A 4NYZA 2DNPA 1Q79A 3CMES 3N4WA 1WI8A 3MTJA 3ZZYA 1NAQA 4QIWD 2IJRA 4OLPA 2B9YA 3TQEA 1OIAA 2R7TA 4B9UA 4ZVUB 3R6GB 3R7BB 2CZVC 2KN4A 4DUTA 4LRAA 4LIWA 2ZVSA 3W7BA 3PW0A 4ED7A 3GFHA 3M05A 5DG9A 3JB9k 2IC3A 1R0AB 5DQGA 1DTQA 2B9EA 4WK3A 2RB7A 3MM9B 1S49A 2ZWOA 5KG3A 1VIXA 4PWDA 2CPZA 1JLFB 3NGTA 2LYVA 2HEKA 3K5NA 3M9MB 1TV6B 2RJZA 5ETVA 4RBTA 2V5HG 1VQKS 4C8ZA 1NJZA 5D0HA 4OYMA 2B51A 3M6XA 2GMLA 4TQSA 2ZJRQ 5LL6d 1P27B 3FVYA 1S9FA 1U49A 1VRTB 3OW2R 1ZYQA 1EP4A 2FY1A 4DEZA 3HMJG 4F3OA 4OI0A 1UP1A 5F8NA 1U02A 2VU5A 4DQSA 2AJFE 3PXGa 3C14B 5ITHA 2GC8A 1KRPA 4HT5A 4F36A 2XI2A 1OS5A 3ZNJ1 2DNOA 3MI7X 1VFJA 3CXCR 4I7FB 5HLFA 3Q8QB 4HR2A 2V68A 3KYLA 4NASA 5B0CA 2Q6BA 4Y6IA 3LGMA 4ZHRB 2RHSB 3K5MA 3AD7C 2DKOB 1RTZA 4BWJA 3PFEA 4QJVA 3I5CA 4JV2A 1HIYA 3A3PB 3M7VA 4ZPDA 1JJCB 3CJ0A 1BLUA 3NMRA 1M1KT 3OXGA 4LRCA 1T9TA 2GVDA 1LEOA 4MFBA 2J7KA 2WCXA 3K57A 2Z0GA 3MCMA 1WC5A 2E29A 1YBUA 1NSQA 4KO0A 4FN5A 4PYAA 2DGOA 3PEJA 3QAEA 1L3VA 5HJXA 4ZP9A 2RRAA 3EM1A 1RT1A 2J8SA 4DX8H 2E1AA 1OYDA 2NR0A 4XO0A 5HMWA 4GKKF 2GO9A 2MEWA 1HL6A 2HVEA 3W2VB 4OI3A 1U6BA 3QSIA 3JSRA 1NPRA 1PAEX 1CQMA 3LGNA 1SIWB 2AIRB 5A6PA 2BEFA 4DBQA 5KFCA 3UI3A 1IKWB 1RISA 2B56A 1BQMB 2G13A 1WWHA 2N7CA 1NDLA 1G3OA 4FS1A 4DFMA 2VA3A 2Q3PA 1VRUA 5CAAA 3S7RA 2MDAA 4B9MA 5ETPA 1YI2S 2VG5A 1S0NA 3W9HA 1H2VZ 4YY3F 5B0FA 4USKA 3MFHA 3DRSB 5C5JA 2XG8A 1KP6A 3GV5B 2MQOA 2HNDB 1JLBA 3ZTQA 2RQCA 2V63A 3PYGA 4LF6F 1YJ9S 3P4UB 2J9DA 3NAIA 2B9WA 1MU2B 4NWBA 4EMDA 1NH8A 1M90T 2AW0A 2BXJA 2YWKA 4NRTA 2H4WB 1TL1B 3JSMB 3U27A 2DNLA 3V6DA 2YKMA 1GXLA 4A8XA 1KVIA 2C22A 1CJTA 4GC7A 4IRCA 1FTCA 5I42A 2XM3A 1FJEB 3VQSA 5KFJA 2DO4A 2BOAA 4RJVA 5B0EA 3LP1A 4J9PA 3WIUA 2YWEA 5LOQA 1HNXJ 1UCNA 1YQHA 5L46A 1FKPA 2VJVA 1VQOS 2HHUA 2E1CA 1RWKB 5HANA 1KQFB 3KDNA 3I4PA 2HS0A 1U1RA 2MKCA 4OI1A 3SCLE 4CNZA 5A8RA 2Z2YB 1VK8A 4FXVA 5AE2A 3TOQA 1QD1A 3SI8A 4QW9A 2DGSA 4JI2J 1NKEA 1TU0B 2D41A 1OJ4A 2CDQA 1CBKA 3DU6A 3G86A 2KVQE 3JQMA 4Q0BA 2ZBIA 2XMWA 1KNZA 4LSNA 1LWFA 2HQFA 2YPZA 1R8AA 4OZ0A 1XR6A 4P71A 4NA2A 2I5JB 3ET6B 3MHYA 2WW4A 3LP0B 4NRUA 1N5VA 2IDLA 3I0RB 5FLXY 5I3UA 5SZTA 3W2WA 3GPAA 2HQ3A 3WBZA 4RW7A 1SH3A 1Y11A 1AZSA 3FBFA 4RUCA 2R8JA 3OVSA 4OQJA 4Q44A 2ACMA 4K0KF 1WHYA 2M70A 3D0GE 2FLPA 4ZK7M 4O23A 4DV4F 2W4DA 3ZO7A 5J2PB 1NSPA 2CJAA 4QR1A 4CLTA 4DUZF 5HP1A 1Y0HA 4RNMA 4C8MA 5MLCV 1SCJB 1X5SA 2KXFA 4C0BA 2GQQA 2HHTA 4C3LA 3Q8PB 2BYCA 3GV8B 1X60A 1CPZA 3Q22A 3ISNC 3T6JA 2FJBB 1EQMA 4DX7A 3HHNB 2J0QD 1CLFA 3H98A 1SQFA 5AJ3J 1RT2A 2GO8A 4LT6A 4L76A 4OX8A 1KS2A 2R8HA 2WSEC 4FP9A 1S1UA 8RUCA 2HLUA 4ZCKA 4A8SA 5E0OA 3S8SA 4NLUA 2YX7A 4I2QB 3LA0A 2Y8YA 1N6QB 1Y3KA 3QLHB 2HZVA 3QT5A 2HS3A 4JI8F 1WKLA 4ZLNA 2H48B 4NPOA 3LP2B 1MLAA 2QMXA 1TKTB 3HVTA 2IA0A 2EG1A 1ITPA 5J1PA 1WF2A 1P6TA 1LNQA 3TO8A 3CCES 2ROGA 3QRPA 2ZHAA 2UUWA 4ZP7A 3LPEA 3SDEA 1SXLA 3MDFA 5C25A 5BYSA 4ECQA 1E6VA 3KUHA 3T5HA 4IFYB 1VI7A 4N41A 1LV5A 3KK1A 3QMQA 5JXSA 4ER8A 4I2PB 2F4FA 3D3CJ 2ZKTA 3M2VB 3R6LB 5I3QA 3MUTP 4C8OA 1HHQA 3TP2A 1CJKB 3NRBA 1I51B 2VG6B 4JP8A 2XZTB 2OH2A 5IQ6A 1U1QA 1FDAA 1SUQB 3V4MA 3IWNC 1S48A 1RWXB 2FIUA 2XGPA 3PJWA 3MPVA 3FC9A 2YPYA 4ECVA 1JXVA 4ED3A 2BDPA 4QCLA 3RJMB 3V81A 4KFBA 2PT0A 4ICLB 4MKAA 3MR7A 2FLOA 4CO3A 3TX8A 2RU9A 2HFZA 4OYPA 1JIHA 2JFKA 4KKOA 2F9JA 1O51A 4DX5A 4ZVRB 4LRDA 3RB0A 2E9ZA 3OR2A 1H2UX 4EFAC 2M88A 2P9GA 1HBOA 2HNYA 4ED6A 3R7NB 5KFYA 2VL1A 3U7JA 3AY0A 5D4NA 1FESA 2R7SA 3ONQA 1B3TA 3JXOA 1A9NB 3IG1A 1KHWA 3RUBL 1C1BA 4IFVA 4EYIB 3G4SS 4DL7A 4N8OA 2XO6A 2VFVA 3OTOJ 3L7PA 3DLEA 5CZXA 1SVDA 3W61A 2B3TB 3HFVA 3V6KA 4ID5B 4ED0A 2V34A 1C2PA 5HJYA 4K59A 3BDPA 3P6YC 1RAAB 5CCLA 2CA9A 1FNOA 3WX4A 2AQ4A 4NCGB 1O5JA 2QG9B 1WKJA 2QTWA 2C2NA 5IV4A 3R2DJ 1ELOA 4J9RA 1SKRA 2BJ9A 4UZCA 1KLMA 3QRQA 3MEKA 3CC4S 2QT7A 4ZOSA 3EVWA 2KJWA 2LECA 4NXMF 2MZQA 4M5JA 4KIAA 3MEDA 4W98A 1UJ4A 4B3MJ 4CO1A 2VPYB 1SC6A 4J90A 4A8MP 4U96A 3I96A 2N82B 1CJVA 4X4OA 4UY8T 3H5SA 5B0DA 3KDOA 1XWLA 1R31A 3BSOA 4YP3A 1GTEA 4RNHA 2XSFA 3SSRA 3K5PA 2ZJPQ 5IQQA 2E5LJ 2DR8A 4M5GA 1RT6B 2QSFA 3UR3C 3LGHA 4YB7A 4B3SJ 9ATCB 4B9SA 4X64J 2Z2LA 2JOQA 4U6PA 5KFMA 2G2YA 2FPHX 3R5GA 3UDLA 4RLEA 2QEXS 4F3QA 2LMIA 4DWIA 3KLIB 2V94A 4LSLB 5LMNF 1XMQJ 2IIHA 4LSZB 2G0JA 3QFHA 1X7VA 1RJJA 3MAQA 3RGIA 2X3DA 2J7WA 1SPBP 4RW6A 1QUVA 1D8ZA 5KFBA 3GYXB 1XEZA 1K1QA 2K1RB 1S9GB 4YB1P 1RBAA 3T9ZA 4AUKA 5CZVA 1FWKA 4B02A 4RWWA 3OLAA 2ADCA 2PGCA 2L41A 1LFPA 3SYZA 2JSXA 5BYRA 4CLKA 1IR0A 2OELA 2I38A 4OYAA 1HNIB 3WC0A 2CPIA 4XPEA 2A6OA 1SL1A 4O3PA 3DRRA 3R5AA 1TK0A 5A8KB 2DNQA 5ETMA 2CPYA 4JI6F 4OZ5A 4B3OA 5E33A 5CYMB 3MMCA 3CIZA 2IFXA 3DM2B 4DG1B 5A8WB 3PW4A 4P2FA 5DM6Q 3TQ1A 1LQ9A 2M8DB 5KTQA 4UQTA 4I67A 4NLYA 1K44A 4ATNA 3TUZC 2CQ2A 4HYKA 2HHHF 1KQSR 3UD4P 3HT0A 4RX6A 2HYIB 4DPXA 2RD5C 2VKRA 2BKNA 4PWDB 1WOPA 4M5HA 3IRXA 2OHDA 3W64A 2QRRA 1RU1A 3SV4A 3JYTB 1PSDA 5H9EK 2AWZA 4UUWA 4HVZA 5KG0A 2FJEB 2JL9A 3O1LA 3MD1A 5HMYA 2V9KA 3KLHB 3BH6B 3DLGA 4DR6F 1LWXA 3C6UA 1VR6A 1UFWA 4CM0A 2LP4A 2DGVA 1FFWB 2KG1A 1TL5A 4ANEA 4DUYF 3M2UB 2KDOA 3DC2A 2B5JA 1WF1A 2V8GA 4JV0A 1GEHA 3HHDA 1FJCA 4CI0B 5HLFB 2R8KA 1PC4A 3RRGA 1T03A 3UW1A 3J7YU 2Q1LA 3ZTPA 2QMWA 4S0MA 2QL9B 4RR5A 4ETZA 2ZE2B 4Y2KA 1WELA 1YRTA 1FRKA 2XULA 4P6QA 3PZPA 4QU6A 2KB2A 4U67Q 2GMHA 2ZM6F 1TKZA 2GVDB 1WC6A 1SL0A 2ZEJA 3PRDA 5ETRA 3NGUA 5LT5A 2DGWA 4OZ3A 1V5VA 2MLZA 3DLBA 3RW7A 4JI0F 4KB7A 1JXEA 2UUAF 1V3RA 2U2FA 1A7GE 3I6PA 2ERRA 3R1LA 2QA4S 2YKOA 4TLRA 5KT3A 1WDDA 1S97A 2J9DE 2ATLA 1Z2LA 1X4CA 3HLUA 1RTJA 2HWTA 3KJFB 3TUPA 2QLBB 3RZAA 4CTAA 3TA2A 4QYZJ 2E1RA 4QIGA 3QIPB 1GMVA 1HBNA 3D4JA 2K7KA 1T9YA 1FKAF 3SQOP 5DRKA 4BWMA 4F04B 4JV1A 4PUOB 3EDRB 2VB6A 4ALZA 3PHEA 2DNHA 4JV5F 1ZAVA 1VRUB 3M1VB 1RT3B 3KXDA 4LR8A 3O5TB 2IY5B 1B70B 1RWOB 1AFIA 2FVQA 3IWLA 1NO8A 3TNVA 1MWQA 5T7LA 1TMJA 3QPIA 3P3DA 4AD6A 2CQDA 3G6VA 4OV1A 4F4XA 4IG3B 4ED2A 2BJ1A 1Z4UA 2Z4PA 5CCMA 2ZH9A 2QYGA 1HR0F 4FKYA 2UP1A 5DZ7A 2ZVIA 4K4XA 2HVIA 3NWRA 1JXLA 4YY3J 2Y8WA 3FCWA 4AQYF 2KT5A 3IMQJ 5HBMB 4IO9Q 2ILZA 2DT9A 3I9ZA 2YKMB 5KOWA 1M5KC 1JNZB 3ZTRA 2C2ZB 4LF6J 1S6PA 2HNZB 3DXSX 2KL8A 1SJ3P 2ZZTA 4K2JA 3F0NA 2E5JA 2JEIA 4IOCQ 2A1BA 3FKBA 1YJUA 4EBDA 1S0MA 2XBPA 2BKOA 5A8RB 1HNVA 1BWVA 5IOLA 1K0VA 3DMJA 3RW6A 1RGVA 3OJSA 1RDRA 2H5JB 3GSIA 2EXUA 3HJFA 5AE3A 1ZPVA 3TANA 4JI3F 4ZLPA 4CP5A 2HVZA 4LSNB 3OR1B 2BA9A 2JFDA 4URSA 4UZBA 3KUEA 2BJEA 5M2RA 5D77A 4DR5F 4DSJA 3A3NB 2A10A 3GCWP 1K73T 2R7OA 4KGVB 3HKZD 3UE2A 4IYQA 4BHQA 2XS2A 1ZETA 3KK2B 4ECYA 1RWWB 2FVRA 1IXKA 1ZA2B 2HGLA 3H40A 1AZSB 4QWDA 2FVSA 2QLXA 3GP9A 1FJGF 4K5RA 1BQNA 2UVRA 1CSJA 5L9NA 3J80Y 4LQ3A 2BJ3A 4PAAA 1X5TA 2YVSA 5GAGU 2OMOA 5HP1B 5AE1A 5K8NA 2KTQA 1O8BA 1S1TA 1IM4A 2AJQA 5HMZA 5F0UA 4E0DA 4YEAA 1FERA 2M4MA 4F7VA 4K4TA 2OPRB 5I4MA 4K0KJ 5L9XA 3CDUA 3I0SA 4DV4J 3HFKA 4ELTA 4DUZJ 1YJRA 5LJ5Y 1IKXA 3MEEB 2R7UA 5LXRA 1LWCB 2Y1JA 3BQ2A 4LFCF 1NSAA 1NNDA 4OZJA 1WUUA 3I32A 1Y00A 3TVYA 2J0SD 2B8PA 1IKYB 1X4HA 4QR0A 2AYEA 4A48A 1DZ5A 1C0UB 3OTCA 4FYYB 1JLEA 2RQ4A 3G87A 4DCPB 1Y4ZB 2CNKB 2X7IA 2XY5A 3OXLA 1NCLA 2KI2A 1U2FA 1U0HA 3HVTB 1UTAA 4R8UA 2HIYA 4X62J 3LH2S 1RTDA 1Y9OA 2VFUA 4JB8B 3Q24A 4DSKA 3MPYA 1UKUA 2DHGA 1MG7A 1RT4A 2W2NP 1RABB 5I3PA 1JLAB 1OPIA 3LO3A 3NWGA 5GAEI 4JI8J 1WDTA 5C24B 1FCAA 3KK1B 2K06A 2ZBRA 5H9FK 1KTQA 1BUXA 1OPZA 2G0CA 2B7BB 3KLGA 1S12A 4IG0A 1AUSL 4JI5F 2AJ0A 3OFGA 3FBEA 4USVA 3TJAA 1H38A 3GSDA 1UPPA 2RS2A 3UVJA 2WSCC 3NBPA 2XCPA 3GCXP 3UD5A 2XSJA 1XQIA 1R43A 3QNWB 1P1TA 3GR1A 1RHMB 2O1PA 1D3WA 3AHPA 2DR5A 3POTA 4F4YA 4OL8A 4ZJLA 2WBMA 4ZP6A 2R4FA 2XGQA 5KFHA 4HI2A 2NQPA 1URRA 2VPXB 1YRXA 3B82A 2UUCF 2HG4A 4C8KA 3HSGA 3OXFA 3N6NA 1IR1A 4G1IA 3NEKA 3HCXA 2DJWA 2HRTA 3L7UA 4WFZA 2WVFA 2AGOA 3CJ5A 2DD8S 4FNHA 3OR2B 2L08A 2PA8D 5U47A 3M8QB 2EK1A 5JJBA 4DV5J 3X1LB 1U1KA 2W7PA 1UVLA 4USHA 1IBCB 5LJ3Y 3GFXA 4AE5A 1PGZA 3LW5C 4JI7F 3IG1B 3GIJA 4ZJQA 2D3ZA 2VICA 2VF3A 1LW0A 1RHJB 2FYXA 1NHVA 3HVWA 2VQFF 1EX8A 5KOXA 1FNMA 1FT8A 5F3TA 3TEHB 2N3OA 1H0HB 3VGUA 1QY7A 2H65B 3Q8RB 1N0VC 1FEEA 1F9FA 4B17A 4DLEA 3IO1A 2OSRA 2VC1A 4JI4F 1TFYA 1RACB 3SBMA 4K4SA 3KJVB 1TVRB 3W9JA 3M2RA 4H54A 2JX2A 4ZVGA 4PQUA 3QJPA 4YR3A 1WNEA 2HS4A 5DG8A 1CEZA 3BN4A 1YDLA 2NCKL 4DR3F 1L3TA 1FWLA 1UMJA 4OZ1A 4N47A 1R6YA 4WKRA 2XI3A 1CJVB 1KFSA 2X3GA 2YWGA 2MTLA 1KHVA 3SEOA 4RBVA 2HZCA 2ZC4A 2IRUA 2CQ3A 2ZZNA 1FKOB 3CCRS 5A2QY 2A6MA 1H72C 3K5OA 1IJEB 2VBWA 3JQJA 3ZZPA 1ZTWA 2EKYA 4FYWB 1TL7A 3FSIA 4AL6A 1I94F 3CDWA 3JAMY 2E7VA 1GAOA 4H4OB 4NI2A 4YUDA 3MM7B 4LFBJ 3S6EA 2YBVA 2F65A 3D68A 1QTMA 2V4JB 1D9FA 1AFJA 2MJUA 4R0EA 3T1AA 3SMZA 1UJ5A 1HWLA 1RHKB 3WX8A 4DL6A 4IDKA 4E98A 4DQQA 3HSJA 2DR7A 3MAAB 4A8KA 1BY9A 2CNNB 3PYDA 1YIJS 3IBFB 2RVJA 3GQCA 4WF9Q 5IM0A 3G82B 5MAOA 2OAUA 3ILOA 5LMNJ 5F0WA 3NY0A 5DM7Q 3VAHA 1VQ6S 3D1HA 4P9SA 1TL3A 1VQ5S 5FLXU 1G4CA 1DLOB 3D28A 3KMQA 3BKUA 5BXIA 4PKDB 1NKCA 3DRRB 4U7UK 1T3OA 5HQ8A 3QQCD 2NSBA 1OSDA 1ZM2A 3PTWA 4C98A 1RTHB 4KV8B 5J1NA 1K0TA 2ZDPA 2GIRA 2A2DA 1JLFA 1RAHB 1V3SA 1S1XB 3H90A 1NPPA 3L7OA 3L09A 5D8HB 2FGCA 4ZIVA 2XMJA 2Y0SD 4PYDA 1IQZA 1TV6A 2PIIA 2DIUA 2BR0A 2HRUA 3UO0A 2R7RA 3B78A 2QLFB 1DTTA 3QJLA 5KT6A 2CWXA 4P52A 1VBYA 3RYLA 2GV1A 1VRTA 3OT9A 3Q0AA 2XTJP 1EQ0A 2JC1A 1N5TA 4KHMA 4DJBA 4UW2A 2CQPA 5CYJA 2HQCA 2B4OA 8AT1B 3MUMP 1H7XA 3TVKA 2MQNA 3BR8A 2G4BA 3C14A 4DZ6A 5KT7A 4F67A 3U02A 1VGYA 4FF2A 1S57A 2H5EA 7FDRA 1OY8A 1WEXA 3FCVA 1FXDA 3DLGB 2B4UA 2EEYA 1SL2A 4DR2J 3GR0A 3DOKA 4ZHRA 3PR5B 2BACA 2VODA 3J7AN 5CABA 2CUYA 4CWBA 2K3IA 4PXEA 3TYTA 4RU2A 1SJ4P 1FI4A 5D78A 4NCAA 2VZ9A 2QZ8A 4DR6J 2B0GA 3W5YA 2YKNA 4WP9A 3HK2A 3DCAA 3BGOP 1TZ0A 2RHQB 4AXJA 2XHWA 2MKYA 3BGRB 3PJ9A 2EK6A 2HFUA 2KRBA 3JSBA 3E3XA 2IM3A 1W26A 5DGBA 3VR1A 5A0YB 4C48A 4E2FB 4DUYJ 3BGLA 4OYIA 3UDCA 4YDDB 2NXUA 4DFKA 2H1YA 2XYPB 2DR9A 1PC5A 1JKHA 3PW5A 1M1HA 2HFVA 5E2QA 3H2UB 3KNGA 3W2VA 4QBUA 2LFVA 4OIXA 3SCIE 1TKZB 3QAUA 1EJ7L 3E01B 3NCRA 2WVCA 1RBOB 6FD1A 2BQUA 4Y2CA 3DDIA 4B08A 4O0IA 5ETQA 1IKWA 4ED5A 4UOHA 2O5DA 3WC2A 2UVVA 4URQU 1CC8A 1TKDA 3F44A 3N0VA 3VWSA 2ZM6J 5J2QB 1PYTA 4P75A 2C2EA 3O3LA 4OMFG 3HX9A 4CO5A 2EBGA 4CTAB 4DF8A 4B9LA 4ZMMA 1UW9A 3W1YC 4WE1B 2UUAJ 4ZDNA 1HBNB 4XTTA 2XEXA 4ZCIA 2NUHA 3P49B 2R2TA 3BO4A 2PE8A 2EI5A 1BE4A 3HM9A 4KT0C 1VQLS 4U9RA 4GKJF 3CDBA 4XAKA 2BM1A 2WVDA 5GMDA 2DNMA 5CYQB 2JDJA 1MU2A 2BOPA 3M8YA 4J9OA 2KFZA 1RAOA 4ILRA 4OYBA 1YG0A 5T7LB 3J7YI 1TL1A 3O8WA 2FHMA 3CJTA 1OSCA 4C9DA 4K2XA 4YFUA 5LSOA 3K8VA 4JV5J 5KFIA 2RILA 1XN9A 2KT3A 5KFKA 1CQNA 5K5MA 3T1HJ 3AD9C 5LXYA 1GQEA 4USUA 3VZHA 4EGLA 3I82A 1WHVA 3VAJA 4R5PA 4QW8A 1U1OA 4KPCA 4YQWA 2PO4A 1JQGA 4DR7F 2V2QA 4F0KA 2AEMA 2BQ3A 3BGFA 1WC0A
chains in the Genus database with same CATH topology
2MKHA 4J9LA 1S1WB 4DS4A 4IRDA 3E01A 2CPHA 2QMXA 1TKTB 3HVTA 3OFFA 5IT0A 2IA0A 2EG1A 4CO2A 1ZZFA 2VOPA 5J1PA 4NXNF 2PI5A 1WF2A 2JEFA 1HWJA 1P6TA 2VPWB 3NLCA 1KLMB 4FVMA 3TO8A 3CCES 4FBTA 2ROGA 1ZBTA 3DU5A 3B4DA 1RAJA 4LF8F 1UA1A 3MEDB 2UUWA 1FE0A 2ZHAA 1JK9B 4J9NA 4ZP7A 4RU9A 3PVXA 4LUBA 4NZ6A 3SDEA 1SXLA 1CG2A 3MDFA 5C25A 3ENQA 4ZCMA 3PKYA 5BYSA 3MEGA 3OTBA 4ECQA 4X4VA 5GADU 5C42A 1E6VA 1Q1KA 2UUTA 4Y65A 1WG1A 4X4TA 4JUZA 3FRZA 3T5HA 4IFYB 1Y7PA 5E3AA 1K9MT 1VI7A 1G2EA 4WZQA 5J2QA 2I5JA 4AL7A 1JX4A 4N41A 2AV5A 3LP0A 2PN6A 2E66A 2UZAA 3QMQA 3TAMA 3KK1A 4DL3A 1LV5A 5JXSA 4DOZA 1HNVB 4I2PB 3LOUA 2ZKTA 3M2VB 3CE8A 2C3PA 2J6TA 3I0RA 4IRKA 1FRJA 2ZOMA 3CWJA 3GWCA 5I3QA 3MUTP 2HMIB 4C8OA 3HHLD 3TP2A 2V9WA 4Q8EA 3THVA 4F2SA 2BABA 3NRBA 1VQNS 1V9OA 3MR5A 2VG6B 3GIKA 4WE1A 2HFOA 2EPIA 2W9CB 1LWEB 2C28A 3WZ0A 1UVKA 3R5DA 3DHXA 3LANA 2UVUA 3FCHA 3DLHA 2RNEA 2OH2A 1PO6A 2VASA 5IQ6A 1X0FA 1U26A 3M8RA 1KD1T 1KTVA 2OJ3A 1U1QA 1FDAA 2XLIA 2APOA 2WTFA 4ERDA 2CQ4A 3BREA 1SUQB 3MD3A 4PG5A 3V4MA 3IWNC 2HW3A 1H2TZ 3MMAB 1JJ2R 1S48A 5SUHA 2FIUA 3US5A 1ZOTA 3OPKA 2XGPA 3PV8A 3PJWA 3MPVA 3QGPA 4EUVA 4ECVA 4DHVA 3PEHA 4ED3A 2BDPA 3H59A 4QCLA 5CYQA 1F5BA 5DLFA 5B08A 2KT2A 3H5UA 2PT0A 3BEGB 4KFBA 3NP5A 3V81A 4N76A 3N6LA 4ICLB 4V19X 1CVJA 1Q4RA 2OO4A 4J9MA 4MKAA 3IBWA 3OUYA 3FRYA 3PIPQ 5B7WA 2KYXA 3T1HF 2FLOA 3F41A 3N5BA 2QFJA 5E5NA 1NB7A 1DQ8A 1WG4A 4RW9A 3B4MA 4CO3A 1U1NA 4NLGA 4WXWA 2RU9A 3TX8A 4C0HA 4DPOA 1HD1A 2B7CB 2HFZA 4F4WA 4DSLA 2AP6A 4WCEQ 4DL2A 3G8TA 1JIHA 2KVIA 2JFKA 1R27B 2DNZA 3DXBA 3CCSS 4KKOA 5B09A 5KT4A 2KJVA 1UWBB 2F9JA 1O51A 4ZVHA 3OL6A 3CCUS 1F0XA 3MM6A 5AXNA 3RB0A 4KRWA 1IBMF 3B8HA 3QGIA 2E9ZA 4AXIA 5FD1A 3OR2A 2W9AA 1TKXB 3IR7B 1XMOF 1H2UX 4C7QA 2WOMA 2CJQA 4EFAC 4IH7A 5IS2A 5EWEA 2M88A 2JVRA 4H4KC 2P9GA 4QWAA 1G6BA 1HBOA 2HNYA 3UPFA 4ED6A 5KFYA 2VL1A 3U7JA 3BDEA 4DS5A 3MURP 3T5LA 1X9SA 3AY0A 5LSLA 4F4ZA 5HROA 3HHLC 4O4GB 1FESA 5D4NA 3TW0A 2B43A 2BZ2A 4WKYA 4RW6B 2R7SA 3ONQA 2V8HA 4ES2A 2V4RA 4FXWA 1A9NB 2FJXA 2F8EX 3UNGC 3MCSA 3UCGA 2K8GA 3IG1A 1KHWA 5KG5A 4I68A 1C1BA 4IFVA 1RQ0A 2YNGB 4EYIB 3V6HA 4DSFA 4EZ6A 3G4SS 4RKUC 5A6WA 3CCLS 3SQGB 4DL7A 4N8OA 2VFVA 3L7PA 3DLEA 4RW4A 5CZXA 5J2MB 2MY8A 4ECUA 2B3TB 3FFIB 3V6KA 4QPXA 3TI0A 4M95A 4ID5B 1M5SA 5DLGA 4WJBA 4ED0A 1DRZA 1C2PA 4FF3A 3BO3A 4I2QA 3FQLA 4K59A 2WAQD 2MKJA 3BDPA 3P6YC 3AQOA 5CHCB 2AF6A 5E3PA 1N6QA 4DFJA 2NPFA 3QLHA 4D3HA 5CCLA 4Q8FA 4QU7A 1FNOA 1WACA 3WX4A 4TN2A 1S10A 1T02A 3I0SB 4OZNA 2AQ4A 4NCGB 3GB0A 5K8MA 1O5JA 3HHLB 3T5JA 2ZH5A 4RNFA 2R7VA 4MYTA 1MROB 2EFQA 3LP2A 2VBYA 3L3CA 3M6UA 4WK1A 2RU3A 4DF4A 1JJHA 5F8MA 2AJ1A 3EX7B 1S1WA 2CJ9A 1IKXB 2YH1A 4OHZA 1TKTA 1ELOA 1Q8IA 4J9RA 1SKRA 1YHQS 2OPPA 2P6TA 1R0AA 2GJIA 3FEZA 1VK3A 3AA9A 1KLMA 3EZUA 3MEKA 3CC4S 2QT7A 4ZOSA 1SH0A 1HBMB 4PR6A 3MM9A 2KJWA 2LECA 4NXMF 3OFHA 2MZQA 4KIAA 3H8YA 2LA6A 1TQLA 4B3OB 3MEDA 4F3MA 3G96A 3DDNA 3P96A 3IS9B 3MMCB 4EEYA 5J2NA 1X4BA 4WIIA 4J5OA 5KFXA 1S72S 1B7FA 1UJ4A 1WTFA 1S76D 5CQGA 4NMLA 4CO1A 2UUBF 1NJXA 4GO7X 4GO5X 4V19J 2VPYB 2PDAA 2X1BA 1SC6A 1T8EA 4ILLA 2DHSA 2CQBA 3D0HE 2XMKA 1FF2A 4IFYA 5L1LA 4FNIA 5KT2A 2MJNA 2MSSA 4NYPA 2L3MA 1JLEB 3NG8A 5DDRC 4MKBA 4PG8A 4A8MP 1MSWD 4NLDA 2E5HA 3I96A 1L3KA 1RT5B 2N82B 4L3NA 2HHPA 4I2PA 3M2VA 4X4OA 1SKSA 4NX9A 3WDOA 3M6VA 2WONA 1WEYA 4UY8T 3H5SA 2ROEA 2HMIA 3M4XA 1U24A 5B0DA 3M30B 2C2RA 3H4DA 1XWLA 5K8PA 1ZAWA 2VG6A 2R7XA 1R31A 1RTDB 1C4CA 2W9CA 3BSOA 1LWEA 1R8HA 3IR6B 4M5DB 4YP3A 1PILA 3E2EA 1GTEA 4WFAQ 2IM0A 3GV7B 3CT9A 2I0XA 3EZ5A 4RNHA 3LUYA 1RTIB 2ACYA 4X4RA 1J2VA 2XSFA 3BQ0A 4F4KA 1T95A 4PG4A 1N48A 1J5OB 1JNRB 3SSRA 3VAIA 3K5PA 2CVEA 3AJ1A 5CA5A 2ZH6A 1Q78A 2IYGA 4P7TA 4B3RF 2ZJPQ 1SUQA 4I6WA 1X0PA 3KG4A 5IQQA 3LPYA 5D4PA 1UA0A 3IRXB 1TP7A 4L6V3 2DR8A 3C46A 1RT6B 2QSFA 2HHWA 5DS7A 1FVSA 2LCWA 1S0OA 3UR3C 4PXCA 2M5YA 4YB7A 4FF1A 4RW8B 1BC6A 5GAGI 4B9SA 4ICLA 4CO0A 1U1PA 1N8RT 3RRHA 3ZZRA 2Z2LA 1IKVB 2JOQA 4U6PA 1VJWA 4Q2LA 4ZPWR 5KFMA 4TQRA 1S0VA 2Y1RI 2FPHX 5KFUA 5KFGA 3RAXA 2GW8A 2QV6A 3QJJA 3G71S 3UDLA 4I7FA 2D74B 4RLEA 2OPSB 4IG0B 2QEXS 4F3QA 1HWKA 1QUPA 4B9VA 2PMHA 1S6UA 2LMIA 2AX1A 4GMKA 4DWIA 1UVIA 2XNRA 1EETB 1DURA 2GHVC 3KLIB 2V94A 4F2RA 3T6BA 3UCUP 4LSLB 3C6UB 1UWBA 5LMNF 1HYSB 2WK4A 5BJRA 1DAXA 2CG4A 4BC7A 2ZHBA 2XSJB 2MZSA 1D1UA 1X7VA 3BR9A 2QA4G 1HI1A 3IR5B 3IN5A 1TKXA 3H20A 1RJJA 2CPFA 3MAQA 1MNEA 2PSZA 3D1QA 3C66A 5AXKA 3ZZUA 3MMBB 1NK7A 4CIOA 2YWHA 4IR1A 2J7WA 3DOMA 4O4GA 4ES1A 2L9NA 3KHRA 1U48A 4RW6A 2KZMA 2FJAB 1QUVA 4I1TA 1D8ZA 1FK9B 2B5JB 5KFBA 1QSLA 4MH8A 1NZAA 2AX0A 3R27A 4FYDA 1AROP 3GYXB 1XEZA 3TUJC 3JSYA 1K1QA 1VMBA 3LWLA 3DGPA 2K1RB 3C2PA 4QWEA