4M5DB

Crystal structure of the utp22 and rrp7 complex from saccharomyces cerevisiae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
169
Chain Sequence
IEDISAMKNGFIVVPFKLPDHKALPASLHFMFAKRHQSSNSNESDCLFLVNLPLLSNIEHMKKFVGQLCGKYDTVSHVEELLYNDEFGLHEVDLSALTSPRNTALLKFVDAASINNCWNALKKYSNLHAKHPNELFEWTYTTPSFTTFVNFYKPLDIDYLKEDIHTHMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U3 small nucleolar RNA-associated protein 22
publication title An RNA-Binding Complex Involved in Ribosome Biogenesis Contains a Protein with Homology to tRNA CCA-Adding Enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 48
structure length 169
sequence length 187
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12923 RRP7 Ribosomal RNA-processing protein 7 (RRP7) C-terminal domain
B PF17799 RRM_Rrp7 Rrp7 RRM-like N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m5dB01
4C7QA 1FXLA 2KXHA 4WCEQ 1WHYA 2CPFA 1RK8A 2CQ0A 2FC8A 4TU8A 1ZZNA 5FJ4A 3VALA 1UFWA 2DHAA 3MD1A 2KYXA 2LECA 5CXTA 1UP1A 1VQLS 3CCVS 1YJ9S 1K9MT 2DIUA 1P27B 2AYEA 1D8ZA 2YTCA 1FNXH 2YH0A 1JJ2R 1X4FA 4QQBA 1VBYA 2GO9A 1WEXA 3CPWR 3UE2A 1A7GE 4PRFA 2RU3A 3UD4P 1VQ6S 2XS5A 1FHTA 2CQBA 2LMIA 3VAKA 4WKRA 2E5JA 2HGMA 2B0GA 2OSQA 2I2YA 2DGWA 3U1MA 4EGLA 3VAJA 2VOPA 1X4AA 2DNQA 2LEBA 1NO8A 1ZZFA 2M7SA 2F9JA 3VAIA 2G1DA 3ZZZA 4C4WA 2DHGA 2LYVA 3S6EA 4WIIA 2O3DA 2KXNB 4QPTA 3THPA 3S7RA 2X1FA 1VQNS 3UCUP 2L41A 2CQCA 1JMTA 2DNGA 2JRSA 1VQ9S 2LXUA 2DGOA 2MKCA 1SJ3P 2I38A 5DDOC 4CIOA 2MKSA 2DITA 2FPHX 2MQMA 3BO3A 3R1HA 1PGZA 2MXYA 3CMES 2KM8C 3G4SS 1WF0A 2M2BA 3L3CA 1Q86T 5DDPC 1L3KA 2YKAA 3RW6A 2CPXA 1Q82T 1YTYA 2KVIA 2L08A 3EGZA 3MDFA 3BEGB 2DH8A 1VC5A 3EGNA 2DNNA 3CC2S 3HI9A 1SJ4P 5MLCV 1S79A 2HZCA 1WF1A 2DH7A 2KM8B 2CPEA 1QM9A 2DNPA 1FJ7A 3G8SA 2DGTA 5EN1A 5IQQA 3H2UB 2N7CA 5CA5A 2DGUA 2ZJPQ 3CD6S 4IO9Q 2CPHA 1NU4A 2RNEA 2WBRA 1KOOA 1YWXA 3NNHA 2YWKA 1VQPS 2DO0A 3SXLA 1VBXA 4F25A 4QU6A 2OTJS 2MHNA 1FT8A 1DBDA 2RS8A 1WG4A 3S8SA 2JVOA 3BO4A 3PIOQ 3CCSS 3ZZYA 3D2WA 1WHXA 2CQPA 3I55S 2KI2A 5LSLA 3H2VE 1QVFR 2JX2A 2DNHA 1WTBA 1KD1T 1YI2S 2DIVA 1VQKS 4Y00A 3NNAA 2E5IA 3U1LA 2F9DA 2MPUA 1SJFA 4J5OA 3G96A 1K73T 1UAWA 1DZ5A 1U6FA 2MKJA 3DXBA 3HHNB 1FJCA 1YJNS 1W2BR 1SJRA 1WI8A 2EK1A 3MI7X 3R1LA 3ULHA 2CQ3A 2N3OA 2FY1A 2BOPA 5LJ3Y 4BS2A 1M5VC 3THTA 2VOOA 1X4GA 3DLLQ 2N82B 1U1RA 5DDRC 1M90T 4UQTA 2MQPA 3G71S 2CPDA 2OJ3A 2E5HA 2MQNA 5IM0A 4CH1A 1X5OA 1U6BA 2M4MA 2M52A 2VODA 2HYIB 1X5TA 2DNZA 1HD0A 2QEXS 1VBZA 1K8AT 1X0FA 4W92B 2G0CA 5LXRA 4WF9Q 4Z2XA 1P1TA 1BY9A 3TYTA 3MOJB 2K8GA 2KU7A 4A8XA 2AYGA 2CJKA 1WI6A 2QA4S 3MUVP 1U1LA 2CPIA 3CTRA 2RT3A 3UCZP 2DNYA 2M8HA 1A9NB 3FEXB 3P6YC 3LQVA 2U1AA 5LJ5Y 4CH0S 2MSSA 1WELA 1WHVA 5IM0B 1NJIT 2MKIA 3I56S 2SXLA 2MZSA 5JVGQ 1WF2A 2OTLS 2PE8A 1IQTA 2J8AA 2MZJA 2EK6A 5GMKa 2G4BA 3NNCA 4WFNQ 3G8TA 3LPYA 1U1NA 4F02A 3VAMA 2DNMA 4RU2A 2EVZA 1N52B 2XS7A 2CQGA 3Q2SC 3CUNA 2V94A 2MZRA 2AD9A 1X5PA 2D9PA 2OIHA 2ADBA 2M8DB 4WFBQ 1U1PA 2M70A 2MZ1A 4TU7A 3K0JA 4IOAQ 1DRZA 1M5KC 3B4MA 2MZQA 2HVZA 5D78A 3JB9k 3J7YU 5HL7Q 1B7FA 2J0SD 1WEZA 2DHSA 2MY8A 3CCUS 1Q7YT 1KQSR 3N9UC 2ZJQQ 4TU9A 1X4DA 3MUMP 2E5GA 1U1OA 2RQCA 4LMZA 2LKZA 2KRRA 3NS6A 2KRBA 1D9AA 5ITHA 1R8HA 1H2VZ 1HL6A 2KT5A 2DGQA 2M0GB 1R8PA 3CCQS 2DNLA 1HD1A 1VQOS 1XN9A 4ZKAA 3P3DA 2DNRA 3FEYB 5BJRA 1VQ4S 3CCES 1WG1A 2XS2A 2DH9A 3RW7A 2GHPA 4ED5A 4YUDA 4IUFA 3VF0B 5GAHU 2MSTA 5DDQC 2MQLA 2DHXA 5GAEU 3VAGA 5LXYA 2PEHA 2LEAA 1PO6A 2MGZA 1OIAA 2RVJA 3UD3P 1N54B 3R27A 3SMZA 3CCRS 2DGSA 2JVRA 5DM6Q 2MKKA 3VAFA 2LQ5A 1M1KT 2NLWA 2X1BA 2LA6A 1U1KA 1QVGR 2BZ2A 1URNA 3CC7S 1KOHA 3V4MA 2MJUA 5LSOA 3CF5Q 3P5TL 2M9KA 1YIJS 5H1SV 1KC8T 2F3JA 1WEYA 1VQMS 5DM7Q 4M5DB 4F26A 2RUGA 2DISA 2DNOA 4QU7A 1G2EA 1YHQS 3OW2R 1U2FA 1X4CA 2LA4A 1H6KX 2KG1A 2CPJA 1X4HA 1HA1A 2LCWA 2MGZB 2KH9A 2CQHA 3EX7B 1VC6A 2FHOB 2Q79A 2DGXA 2JWNA 1WG5A 2ADCA 5JVHQ 3Q2TC 3BS9A 2OSRA 1JJ4A 4ERDA 3SDEA 2KN4A 4CQ1A 5HO4A 3TP2A 2D9OA 1VQ7S 3MUTP 2AYBA 4W90B 3BO2A 4LIRA 2RRBA 4PKDB 1CVJA 2KFYA 2RQ4A 2MB0B 1N8RT 4YOEA 2CQ2A 3IRWP 2A3JA 2KG0A 2ZJRQ 4U67Q 5DETA 2K3KA 3CXCR 3G9CA 3CMAS 2D3OR 1YITS 3VAHA 4LJMA 2YH1A 4FXVA 3SDEB 3CCJS 1OWXA 1VC0A 3S01A 1S72S 3G6ES 2DB1A 2AYMA 2J76E 2FC9A 3P49B 4UY8T 5CYJA 2XSFA 4FXWA 1RKJA 2N3LA 1M5PC 4TLQA 3IWNC 3MD3A 1DHMA 1OPIA 4C0OC 3CULA 2CQ4A 2KHCA 2J0QD 2VONA 2NZ4A 1SJQA 2HGNA 1OO0B 2L9WA 3J7ZT 1X4BA 2MZTA 1VQ8S 1U1QA 2UP1A 1FJEB 2RRAA 2KXFA 5GVQA 3CCLS 1O0PA 1UW4A 3B4DA 2CQIA 2XB2D 1AUDA 2QFJA 1FO1A 2U2FA 1X5SA 1WWHA 2CQ1A 4OZ0A 2MQQA 2LXIA 5IFMA 2MY7A 2XNRA 1M5OC 2M88A 2RS2A 2MYFA 4Y0FA 4OZ1A 3TO8A 3UCGA 1JJHA 3CCMS 2HGLA 2E44A 4V19X 3NS5A 2CPZA 2DK2A 1VQ5S 2MMYA 1ZH5A 1U1MA 1F9FA 2XNQA 4IOCQ 1Q81T 2CQDA 1SXLA 2CPYA 1X4EA 2MKHA 2DO4A 5D77A 3MURP 1YJWS 2X1GA 4YB1P 1H2UX 3PIPQ 2DGVA 3US5A 2DNKA 2MQOA 2MJNA 4P6QA 3NMRA 2ERRA 4PR6A 1H2TZ 3UWTA 5GADU 3CC4S 5GAGU 1N88A 3MXHP 2X1AA 4WFAQ 1WHWA
chains in the Genus database with same CATH superfamily
4C7QA 4ID5A 1MN7A 3DU5A 3DOLA 3EZ5A 1REGX 2G2ZA 2UUAF 1TL7B 2B9YA 4F4AA 1D8ZA 3ELHA 2VHGA 1ZETA 3MGJA 5K14A 1S48A 1FVQA 4WKRA 3VAKA 3I31A 5A6PA 1RT5B 2G1DA 5DQGA 2O3DA 4FKXA 3THPA 2DY9A 4O3QA 1W25A 4JI2F 1GXTA 1BWVA 1LW0B 4I2PB 4WKYA 2ZM6F 3DMJA 2GZOA 2RKIA 2XMKA 3MMCA 3CDEA 3RR7A 4AXJA 1RCXB 2DH8A 1LQ9A 4LBPA 5L1LA 2DEJA 3HI9A 4AL6A 1IKVB 2VQEF 4RL1A 2ZJPQ 4AQYF 1NU4A 1TVRB 4DR1F 2MHNA 3ZZ0A 5ETKA 4BLGA 1QVFR 1VYAA 4OI2A 5BYSA 3CJRA 3U1LA 2MPUA 5FDLB 7AT1B 2PSZA 5F8GA 3R5DA 4HTIA 3V81B 2MLXA 4TYBA 4NCBA 4J9MA 1SQGA 4LSZB 4EU0A 2HKEA 1KR4A 4U7UD 3TJAA 2ZD1A 1SKSA 4O44A 3HX9A 4C8OA 3BGUA 1RDRA 1FXDA 1RAHB 3MEEB 4JBCA 2DNZA 5KFVA 4EYIB 1RBOB 3M30B 2G0CA 1OS5A 3GWCA 1LOUA 2M5YA 3MM6B 3OFEA 3KLHB 1FKOA 1R0CB 4NLOA 4F50A 2J0XA 2QG9B 4ILRA 5GMKa 3PX4A 4O3RA 1KQKA 2B43A 4OHXA 1EJ7L 4I6AA 2D3O1 2DVIA 4ECXA 3QT6A 4ANCA 2KDOA 3FC9A 3U02A 4J9RA 4M94A 4Y2MA 4CLFA 2ZH7A 3DRRA 5I3UB 4XDDA 3RB3A 2DXFA 4ZA1A 2ZC4A 1WJ9A 4WZMA 1WKJA 2DNLA 3FZBA 4DQIA 5HLFA 3AJ2A 3OR1B 2ZUAA 2DH9A 2ZOGA 4Z37A 4AFFA 3MM5B 3TARA 1P8GA 3T3FA 1UL3A 4OJHA 1UFKA 3HD2A 5DM6Q 2MKKA 4TN2A 1QVGR 4AD6A 1S1VA 3SQOP 3EGVA 3CF5Q 1JLQB 3ZTQA 3L95X 3HP6A 1TKTA 3OW2R 1FJGF 2GNKA 2DRBA 4OYOA 4PPDA 5KFPA 5IS2A 2VZ9A 4DV7J 1FA0A 4EK2A 1U09A 3KKFA 4DPUA 1EQ0A 1HPZB 2OPPA 3FK4A 4URSA 4X62F 3G6VA 1RADB 4B9LA 3I0RB 3E01B 4MK9A 1HI1A 1SVDA 3BGRB 4JI6J 4B3SF 4NLGA 1FWPA 8ATCB 3CDWA 3W2VB 2VU5A 2YH1A 3SDEB 4FYDA 1MLAA 2DYAA 3CCZA 4DR3F 2E29A 1DHMA 1FK9B 1U8WA 5BR8F 4JI4J 3W9JA 2VFRA 3OTOJ 4IRKA 1VQSA 3OBIA 5FLXU 1JLGA 2B4VA 1FWLA 1AUSL 4FYYB 2W2PP 5KFUA 2RE1A 1PKUA 3IM9A 4M5HA 4N76A 2E1MC 1XERA 2FHJA 4QR0A 3PRDA 1K0VA 2ZWPA 2RD5C 3PKMA 2G9OA 2Q66A 5L1IA 2RQMA 5CCLA 4JI7F 1Q16B 1Q95G 1H2UX 1RT1A 4DZDA 5KG6A 1R0AA 4DFJA 3HVAA 5CYMB 3PYEA 1IBMJ 1SKRA 1NHVA 3PEHA 2B8QA 4FBTA 2XSJA 3DGPA 1JB0C 4TQRA 3PYGA 2B6AB 5DZ6A 1K9MT 4J9KA 3PEJA 2B7CB 3JAMU 2GO9A 2OLWA 2ZBQA 3HHDA 1B7YB 4ID5B 1J5EJ 1HHQA 3U1MA 1RB0A 1XNQF 2JFDA 1NO8A 5KFDA 1MWQA 4B9SA 1WDTA 3KUGA 4F2RA 1LWCA 1ZPVA 4ZOSA 4XPEA 1RWMB 4DFKA 4KB7A 5HMZA 5K14B 2JEIA 2MKCA 3ZFVA 2FB0A 1UW9A 4HYKA 4A46A 3D1OA 2GX8A 3BSAA 3G4SS 1BWEA 3M8ZA 4HTJA 3GE9A 1D1UA 4HEA9 3W64A 3E51A 1X0PA 5J1PA 3AB2B 1CQNA 1HMVA 4P52A 3HMJG 2DPIA 2HFSA 4DLEA 3NGDA 3OUYA 2N7CA 4PCQA 3DMJB 2RKIB 3PW5A 4ZVFA 3MMCB 3CNQP 4RW6A 4Q7AA 1I5OB 1FT8A 4KH1B 2EG2A 3CCTA 3D4JA 3I0SA 4KPCA 2V2ZA 3JQJA 5LSLA 1MMDA 2V4QA 3KYLA 2C2MB 3DXSX 1VQKS 4WYLA 4DCPB 2MKJA 1QTNB 2VV5A 4QW9A 3MAHA 3L9ZA 2W4PA 4C8KA 2C28A 3MPVA 1OY8A 3R1LA 3NGUA 3NP5A 3CD7A 3MTKA 3QIDA 2R42A 3DCAA 3GPAA 3C8YA 1R6YA 2KJVA 3I87A 4B3RJ 1SJ1A 2HZAA 1DQAA 4UQTA 3G71S 2OJ3A 3J7AN 2R7SA 3K8VA 1U0HB 3ILIA 2WCXA 3J7Z5 3MEKA 4CLKA 2QA2A 2YKQA 4M1KA 3O3LA 5M2PA 4Z7YA 1RISA 5LXRA 4RR5A 1BY9A 1R43A 2HBYB 2R4FA 5KFAA 2BM0A 5B0DA 2Q1LA 2I9SA 2ZD1B 2MSSA 1TFYA 4O44B 4G1QA 4MK7A 4LBIA 2F1FA 4RBTA 3BKUA 2PMHA 2LLZA 2YX7A 3PV8A 1N48A 3QJLA 4F02A 2OD6A 4J9PA 3KHLA 3CUNA 1OQ3A 1FRHA 2M8DB 4DV0F 3TUPA 4DS4A 4FVCA 3PRBA 3HSDA 1FKOB 1LFWA 1UJ6A 4PUOA 1FESA 2MY8A 3IA0A 4MH8A 4TU9A 2F8HA 3FQLA 2B9EA 2IC3A 4NZ7A 4YHHF 1R8PA 1Q53A 4DBQA 3VGVA 4P73A 3QPIA 4YB5A 1RAJA 1HNZJ 2Y3YA 4DR5J 3DRRB 4NCAA 5KFOA 2VA2A 4ZCIA 2RVJA 1UPMB 2LQJA 4OZLA 3SMZA 2UUBJ 1IBLJ 2NLWA 5HLFB 3UDCA 4ZP7A 2YY3A 2IHR1 4ENOA 1C0UA 4ZJOA 3UN2A 2JDJA 4A8WA 3EX7B 1WG5A 1XMQF 1S1VB 3TRGA 4PYAA 3JYTB 4LIRA 4LR9A 4PKDB 2IY5B 1TKTB 4KIAA 3KLIA 2UVRA 1IWGA 2GJ2A 2CQ2A 4JP8A 1FNOA 1T9XA 3W8PA 2F40A 3M6XA 2XWYA 3CXCR 2H9ZA 3A3OB 2YXLA 2OPPB 2OELA 4I2QA 1PBUA 2O01C 2N3LA 4USVA 4DUTA 1JKHA 2EW9A 2JJ4D 4WE1A 2MZTA 4CCHA 2XULA 1S76D 3J81Y 2RRAA 3VZHA 4CLLA 2MEWA 1LNQA 2PI4A 3EUNA 2ZFHA 5C24A 2ZH6A 3UCGA 3NCQA 3J80Y 2W1BA 1TMMA 3HFZB 3ENWA 3NMAA 3CJ5A 1JLGB 3ZZUA 4USHA 1G1XA 3JSYA 4BWJA 4HT7A 5ETRA 2V50A 3D7SB 1WC5A 4ED1A 3F41A 2DO4A 1YJWS 1FDNA 3TZWA 4CO0A 5T14A 4B9UA 3KHHA 1FFGB 3OFGA 1HNWJ 2X1AA 2KT2A 4ED3A 3SBMA 4DQRA 4K2JA 4WBFA 1BGXT 1RABB 1RT1B 2DR9A 1R0AB 2YTCA 5KFQA 2ZH9A 2HMIA 1SL1A 4NXNJ 2GS8A 2B56A 2ZKUA 3UE2A 2W8LA 4C11A 2NXUA 3UD4P 3RBXA 3ENQA 1HNXJ 2XSJB 3DGPB 1RU2A 5L46A 1W7WA 3IMQJ 3RRHA 4QOTA 4C4WA 1NB2A 4DL7A 4QPTA 2HLTA 3LW5C 1I3OB 1WOOA 4PWWA 4UTGA 1EZZB 1DQ8A 1EETA 1REVA 2XY7A 1WC4A 5EWEA 1LWCB 3TQEA 4ZK7M 1EHWA 3EGNA 4WXWA 5HMWA 1S79A 5E3QA 4KHPJ 5L1JA 2CPEA 3ET6A 2LDYA 2BANA 4FXDA 1NSKL 2ZBPA 2CDQA 2PFFB 1S4FA 3EM1A 5K8OA 2DR7A 4DL3A 2CKWA 4QU6A 3AOBA 4DFPA 2IFXA 2EFVA 1HMVB 4K59A 1J5OA 4DV4J 2QO3A 3OUYB 1FVSA 3GFXA 1BQNA 5E7OB 3CIZA 3SCJE 3FJ2A 3NNAA 2HVHA 2WVEA 1SJFA 4JOUA 2OPRA 4RW6B 1K73T 2J9DA 2NR0A 3R5CA 3DXBA 1FJCA 1H73A 5SUHA 5KG1A 3IR7B 1GTHA 4DR2J 4MFBA 3I0SB 5A0YA 3GYGA 3RU0A 2ZZTA 2AX1A 2IM3A 2X51A 4L3KA 4G65A 2CPDA 5GAEI 1Z2LA 2GVZA 1TV6A 3IRXA 1P9YA 1RZMA 4F0MA 3BF4A 3ZNUA 3M8PA 4CNZA 5THWA 2VKZG 2R7VA 1WKLA 4RKUC 2FJEB 4XK8C 4DX7A 4ZLJA 2RT3A 3JXOA 1A9NB 3PKYA 5HVFA 2Q43A 4A47A 1WF2A 2C1EB 3IAS9 2PE8A 1OPZA 3MR2A 4NLVA 2JC1A 2OKQA 4NWBA 1SH2A 1VK8A 4Y2KA 4DQSA 2C42A 3EWGA 4DOZA 4F7VA 5F41A 1S59A 3Q2SC 3MAAA 1F5CA 4WFBQ 1U1PA 2M70A 4G1QB 1RAGB 3RAQA 2MZQA 5ADZA 3JB9k 1RT3A 5KT5A 5HL7Q 4AL7A 1J2VA 2NXEA 2AQ4A 3ZTSA 3ZXWA 4DN9A 2UUCF 1IXKA 2HVDA 4FN5A 4K5RA 4RX6A 4ZKAA 1S5ZA 2WVBA 2DNRA 9RUBA 2X7IA 1SBRA 2VB6A 4PUOB 3PHTA 4NEZA 1EP4A 2A6MA 5CQGA 2MGZA 3EZOA 2IC3B 1UMJA 1HW8A 3UDEA 4KHMA 2QMUB 3GJRB 2FJBB 4Q44A 1UVKA 3QSYB 1K44A 4DSLA 4F26A 1G2EA 2DNOA 3LP2A 2AEJA 2B4OA 2WSCC 4RWXA 1T9WA 5JMNA 2EFQA 1UJ5A 4CQ1A 1Y3KA 4FF2A 5DQHA 3IP0A 1RQ0A 2YKNA 4K4TA 2WVCA 3UD5A 4RUBA 3CJKA 1VR6A 3D1QA 2KG0A 2PD1A 2QYCA 1ZS6A 1WC0A 4LBHA 4LF5F 2VQFF 3I32A 3CE8A 2CQ4A 3KLIB 4I68A 2C3UA 1X9WA 3I6PA 4M95A 1KTVA 4I6YA 4OZ2A 1L3TA 3GV5B 1FJEB 2HHTA 3EZUA 4JI1F 1SC3B 3TA0A 4HDGA 4IH6A 2WBMA 2CJQA 4I2QB 4NRTA 3T1YJ 1JKHB 1PILA 4LFBF 1L3VA 1DAXA 3KFWX 3EVWA 4KGXB 2MMYA 4H4MA 4J9VA 3DYAA 3M6UA 2IRYA 3BH6B 2K7JA 5C24B 1M5SA 1UFLA 2R8IA 3CC4S 1KFSA 4NA1A 4KT0C 5J2NA 4N47A 4QIEA 1XN9A 2Z8QA 5E0OA 4TU8A 5C25A 3ISZA 2N4CA 3VALA 5E2QA 1JQGA 1U8SA 2LECA 1VQLS 3CCVS 3KXDA 1DJ0A 3M2VA 4XO0A 3LOUA 2LMIA 4DV1J 3PFOA 2XBPA 1HBOA 2F4VF 1ZTTA 4NLDA 5DS7A 3TA1A 3A4TA 3NOCA 3QGGA 1JLCA 5E3CA 3M7VA 1BHNA 2DCLA 4RW8A 4A8SA 2HMIB 4WJBA 4C11B 2JRSA 3MEDA 4GVBA 1GT8A 2EBGA 2QLWA 2HFNA 3M8SA 2ZH3A 4USIA 5K5MA 3A13A 3H59A 4USKA 4JI8J 3C2PA 2AEFA 3V6DA 3L4BC 3R7SB 4FVMA 2ASLA 2FIUA 4OHZA 4JV1A 2DNNA 3WDOA 1IWAA 2Y1RI 2K2PA 5J1EA 4PG5A 2XLJA 2DGUA 4ELTA 2VD3A 2W9AA 3HULA 4C98A 5D0RA 1EETB 3ITHA 1REVB 1BXNA 3C3LA 1W26A 5HSPA 1VBXA 2CADA 2VG5A 3GONA 4M5JA 2JVOA 4FYXB 3PIOQ 1S0NA 3ET6B 1S0VA 3I55S 4Q8FA 5F8MA 4CT8A 2BANB 2BJ9A 1T9VA 2DKOB 1YI2S 4PXBA 1VISA 1LWFA 2F9DA 3UR3C 3JS9A 4C0BA 3FKBA 1Y5IB 1AT1B 3OTDA 3GCXP 1J5OB 4DX5A 1CJVA 2HNDA 3M8QB 5LOQA 1BQNB 1M5VC 5G4DA 3AB4B 2BUNA 4CLPA 2OPRB 1S9GA 4KC5A 1D3WA 4LR7A 1EKSA 1EIYB 4MFBB 5A0YB 4HI2A 2AF6A 5EWGA 3A3PB 3GR1A 1WSRA 2HS3A 1QSSA 1SC6A 4IKAA 3T5KA 4NLXA 3BM7A 1V3RA 4C8ZA 1C1CA 2SXLA 2GVZB 1TV6B 2EI5A 3IRXB 3CEDA 4JYAF 4CLZA 3M8PB 5F9LA 1TK5A 5F0WA 5KFHA 1DTTA 1URRA 3WC2A 1KFDA 2C2OB 2QRRA 2CJAA 1HQ2A 2HHPA 3O2IA 5H9FK 2FGCA 4O23A 2XMWA 4YQWA 1ROFA 3PW2A 1Q7YT 3U1NA 2P9EA 2DPJA 1RHMB 1UCNA 1YRXA 3MAAB 3FBEA 2IYIA 1VQ4S 4DF4A 3HFKA 4NLUA 2VPZB 1RT3B 5GAEU 2YQ0A 3NL0A 4Y2CA 1DARA 1IN0A 4ZVQB 4YFUA 3ZTPA 1XMBA 3CIMA 1VJWA 4Q5VA 3PM9A 1URNA 4NX9A 4RNOA 5KOWA 1FF2A 5KFRA 3BGOP 5DRKA 4C3LA 4WP3A 5J2MA 2CPJA 1EP4B 1HA1A 2MGZB 4RO0A 3VVUA 4FP9A 3BSNA 2RDDA 2V6AA 3R8YA 3LP2B 1S6OA 5E3AA 4JV5F 4CO4A 5B08A 3IRWP 2BQ3A 2R2RA 2JLEA 4PPZA 4KE5A 4U7CA 3VAHA 2XYGB 4P7VA 4LJMA 4Q2MA 2VL1A 2ZBIA 1H3DA 4CO1A 3CJKB 1TR0A 4OX6A 2LP4A 3VGSA 1RTIA 4J7CA 1U1QA 4KY3A 4XTTA 1NMEB 4B3MJ 2AGOA 4C0HA 4J37A 2K1RA 3KG4A 5HMXA 3KNGA 4X65F 3QYYA 3IR6B 1I94J 3NS5A 4DSIA 3T6JA 2DK2A 3CO9A 2HRTA 1RUSA 3HO1A 2ACYA 1S1UA 4ZLPA 1SXLA 5CCMA 3Q89A 4X4QA 4U7UK 2UXCJ 1U0SA 1HW9A 5HVHA 3NMRA 5D4OA 3DKDA 4LF6J 3UWTA 5LL6d 1WHWA 4LFCF 2KXHA 2E1RA 4WCEQ 1T9YA 1XTZA 4H4MB 2UXBF 3DYAB 5KFCA 2DHAA 2PA8D 3KLFA 1VIXA 3M9NB 1V5IB 2DIUA 3M4XA 2HFZA 2HHVA 4C3KA 4IFYA 3NS7B 5J2NB 3FDSA 2HIYA 4XAKA 3R2DJ 3LP1A 3RBEA 5GAGI 2VBWA 5C25B 4DLGA 1X4AA 3R3TA 1PJ7A 2FQQB 4WWSA 2AJ4A 2LYVA 3NAIA 3H8YA 3S6EA 3M2VB 3HZGA 5B7WA 4Y2AA 1ZOTA 1JMTA 4HHJA 8RUCA 1SKWA 2Q3PA 3NWRA 4USTA 4ECQA 4B3TJ 2XMMA 2FPHX 2J7KA 4NI2A 2KVIA 1JLCB 1N6QA 3MCSA 2J0WA 4RW8B 3EGWB 2AW0A 2HZCA 4R0JA 2DH7A 3MEDB 4GVBB 3T6BA 4PYDA 4ZITA 3H2UB 2OFHX 4LRCA 3M32A 1Y4ZB 1VQPS 3SXLA 2XMAA 3WC0A 5DO2A 2XO7A 2CQPA 4KJIA 1RGVA 4KKOA 4OX9F 5J1EB 1S6PA 4ZS6A 3FGVA 4EBEA 5K8PA 3ITHB 4RW7A 1EX8A 2O1PA 2VG5B 3N0VA 2CRLA 4H4KC 1HBUA 3LGHA 2IVYA 1RU1A 3CJSA 1YJNS 3RBZA 2VA3A 3D6TB 2AIRB 2Z2MA 3D0IE 3MI7X 3EXCX 2W8KA 3WIVA 5J1NA 4LF9J 7FD1A 2BX6A 2OPSA 1VOMA 1F3VA 5C2GA 3RRGA 1LWFB 1M90T 1RKIA 2ILYA 5IM0A 1TK8A 3BBCA 4QW8A 4RZRA 2CJBA 5D8HB 4N56A 2HYIB 2HHQA 2APOA 4QIFA 3BGLA 1CJVB 2HNDB 4WF9Q 4N8NA 3F0NA 3UNGC 1C2PA 4P72A 2E9TA 2D1CA 1S9GB 2C2NA 2PT0A 4ED2A 3NBPA 2HHHJ 5A8WA 3UFCX 3M1VA 2DEIA 2PEBA 3FMWA 1N52B 1RLDA 1R8AA 1UWAA 2CG4A 1TFWA 3IM8A 3K0JA 2ZE2A 2BJ1A 3ICLA 1C1CB 5JJBA 2HVZA 3CCUS 1KQSR 1N56A 1YZ6A 3DOMA 5ITHA 1DTTB 1D9AA 3Q8UA 2HPUA 3NXZA 3FEYB 5BJRA 4OI6A 2Y1JA 3WHIA 4ZVPB 3VF0B 1HBMA 4GKJJ 2ILZA 2XMTA 4C2MA 3N5BA 1NPPA 2QL7B 4LSLA 1S77D 2YNHA 5IZHA 3RJMB 3PW0A 1FDAA 3AHPA 3E2EA 3KJVA 3CB4A 3HHLA 2M9KA 2W4CA 4XDCA 4LQ3A 4QU7A 2EKNA 1S9EA 4M8LA 1KVIA 3QGPA 3FNNA 1N5VA 4C8LA 2V34A 4ZN3A 2HLUA 2QT7A 3OPKA 2H5JB 3TP2A 3MPUB 3GIKA 2D9OA 1P1LA 3ISND 3SV4A 4QBUA 5J2MB 1CVJA 2ZEJA 2W7OA 4RU9A 4YOEA 3F56A 4M5LA 3HM9A 1O8BA 3OSPA 2XGPA 4MAKA 4KV8A 4UY8T 5A2QY 1YBUA 4FXWA 1S4EA 3PRVA 4DV5F 3PYDA 3Q8RB 2CNNB 3A3NB 1O51A 2BV3A 5LMNJ 2EFOA 5HQ8A 2KXFA 3CCLS 1YJRA 5DJBA 2R8HA 4NLPA 3CSKA 2FDNA 1YK9A 1U2CA 2OGUA 4RUHA 1RTIB 5B0GA 1ZA2B 1AXQA 1EKRA 1SPBP 3H4BA 4ED4A 2CPZA 1ZH5A 1U1MA 2K1RB 1S6UA 1KS2A 1WACA 2QMWA 4GKKF 2QJ3A 4L75A 2VBXA 2OAUA 1RTHA 2BJEA 1ZM3A 2ZH1A 4ICLA 3PY8A 4P9SA 4PR6A 3T1HF 4B9TA 4G1PA 3KNAA 4KQZA 4PEOA 1S1UB 2D74B 3OD2A 4UZCA 5CXTA 2ZOFA 3IBWA 2MDAA 2YKMB 4ZLNA 4P2XA 1UEKA 2H5IB 3CPWR 3D0HE 1BC6A 1A7GE 1VQ6S 2AV5A 2QSFA 2AMCB 1RTJA 4P75A 2BVZA 3ENVA 2DGWA 3PX6A 4HHUA 2DNQA 3PJ9A 1FEEA 5KFMA 3KLFB 3TI0A 2FLLA 3X1LB 1C0TA 5EX3A 5CD4A 4C97A 2GJFA 4A4JA 4IFYB 1XR6A 1MN9A 1R7IA 3TAMA 3OL9A 1I51B 5I3PA 2BQRA 4MYTA 2MKSA 2DITA 3LP1B 1S7HA 3BR9A 4L72B 2KM8C 3LTOA 1G3OA 1QE1B 1K1QA 3OXFA 4FF1A 1SL0A 1BE4A 2WW8A 3EGZA 2B9WA 3TEGA 1VC5A 3CC2S 1RAOA 2YWFA 3UQSA 2KTQA 3OHBA 2QLXA 1NK5A 4GC7A 4QR1A 4DV3F 4H54A 1M1GA 3CVKA 4LF8J 1WTFA 2V2VA 1N6QB 2RRNA 2DXEA 2GAGC 1MWZA 2JL9A 4RJVA 3CCSS 4YR2A 3QSIA 4DPWA 2HIQA 1HARA 1VDHA 4I4BA 3M32B 4QIGA 1B4SA 1U6FA 3C46A 2NQPA 2KL8A 4JI1J 3D6FB 2I8EA 3DLGA 1M1HA 2BJ3A 1QY7A 4KKOB 2N3OA 4QWBA 4DR7J 3RB6A 2W24A 4ECUA 1S6PB 2FGOA 3HSZA 1SC1B 2FJXA 4RW7B 2C2DA 4U95A 1N34F 3ZZOA 5J2QA 1HBUB 3PO4A 1X5TA 2P6SA 3P8BB 3DN9A 2QEXS 3GTYX 2RQKA 4DV6J 2OPSB 3MUVP 2V4RA 3P6YC 5IM0B 1VMBA 2H65B 1NK6A 1GMVA 2BKPA 3G8TA 2GQCA 2HQ3A 2J5AA 3DHWC 3FQKA 2XY6A 3MCNA 1X5PA 2FJAB 4P2SA 4CO2A 1S10A 3LGMA 4I6WA 2F5GA 2AZ1A 3NBPB 4LIWA 5A8WB 5T41A 3LP0A 3ETMA 3M1VB 5KG5A 3CO0P 2GFFA 3DRXA 2E5LF 1H2VZ 1N5YA 3Q8YA 4CYUA 3T19A 4AE5A 2ZE2B 5EUHA 1HI0P 2LU2A 2BE7D 3PW4A 4U8VA 1APSA 4P71A 5EX0A 2WHOA 4ZVRB 5HQMA 3O6QA 3DOMB 3R27A 2YWEA 1RWPB 1U25A 2AJ0A 4K4WA 4YB6A 1F60B 4L6V3 5AT1B 1N33J 1HBMB 2LEPA 3K2YA 4NEYA 2DISA 3J81U 3Q83A 1H6KX 2C3YA 4JI5F 4LSLB 2YNHB 2FHOB 1R8CA 2CVIA 3BS9A 2UXDF 2FTRA 3KJVB 2HFVA 3HHLB 3IXQA 2AYBA 2JOQA 1U4BA 1S9EB 5F3ZA 2H54B 4OMFG 5F8JA 3K58A 5CH7B 1JIHA 4B08A 1RTDA 3JTNA 3G6ES 4HVZA 1RKJA 3I5CA 1UWBA 3IWNC 3MD3A 3CULA 1S97A 4B02A 4R25A 2BJ7A 5GVQA 4CLSA 3SIPB 4KV8B 2OO4A 4DQQA 2QFJA 2HVIA 1F1BB 4KTQA 4TY9A 4A8MP 2BQUA 4MKYA 2N4DA 3TO8A 4EBCA 3O5TB 3QATA 2JEJA 3A8JA 4OFZA 1U02A 4CM0A 1KN6A 4IOCQ 3DGVA 1JX4A 1KHWA 1Y0HA 3DU6A 3L09A 4OYPA 1NK7A 2I1RA 2HSEB 4X4OA 1N4LA 2CYYA 3EE3A 1ZYQA 3G2XA 2OI2A 2YWHA 1WHYA 4I64A 3NGSA 2DR6A 4ZVUB 4IDKA 3GIMA 1RTHB 3H5UA 4DR4F 4ICLB 4FF3A 3KJQB 4ZPVR 2UVUA 3HKZD 5DG8A 3BGFA 1NDKA 3PACA 4I7FA 5KT3A 4WU3A 4ZPAA 1RT2A 4X64F 3SZ2A 1IBKJ 3C6TA 1TUGB 2FZKB 1D9DA 4K0KJ 4ALZA 3TAPA 1R8BA 4U9RA 5KFNA 4MK8A 3UCUP 2UUTA 2DNGA 1H38A 1RTJB 5DG9A 1WF0A 5D3GA 5L39A 5I3UA 4CM2A 1C0TB 1YTYA 2GHVC 2L48A 5M2RA 2BOAA 4ZPCA 3TAMB 1Y3JA 3RB0A 2PO4A 1QM9A 1WSVA 4O0NA 4LF4J 3G8SA 2CIMA 1V6HA 3OV7A 1RTZA 2R7TA 5C7PA 4D3GA 4NLQA 2UU9F 1T7PA 2RS8A 1TQLA 4OI1A 5A8KA 5LMUF 2YNIA 4OYWA 3GB0A 1KKHA 3RR8A 4LF7J 1IKWA 3E8OA 1NKBA 3CJ2A 2E5IA 3CDBA 3J7YI 3VR1A 4OHWA 5FLXY 3KUEA 3IGVA 4ILMA 5IT9U 1U6ZA 4DV2F 2CQ3A 2FY1A 4NXMJ 5IT0A 1RHUB 2QFIA 5ETQA 3DDKA 3UR0A 3R5GA 2XMVA 2BBEA 3DLGB 4TKTA 3G82A 1ZBTA 1GEHA 1FERA 1SUQA 2FLOA 4OYMA 1Y00A 5AXMA 2ROEA 1KWMA 2BEFA 3GCWP 5KG3A 1GTEA 2M8HA 2OEMA 3FEXB 3K5NA 4WXOA 5J2QB 5JVGQ 2OHDA 4LUBA 3Q23A 1SB6A 2G4BA 1N36F 2Z0GA 5AXNA 4HH0A 1BLUA 2D9PA 3TJ9A 3I96A 2ZNZA 4M5KA 3JAMY 3WZ0A 2JSXA 2J9DE 1TKXA 1IKYB 1UJ4A 2CNLB 4PXDA 5KFIA 3N9UC 2E5GA 2V8DA 5KFSA 2LKZA 3NS6A 4KH0B 1ZA1B 4ANDA 2FZCB 2HQFA 2KT3A 5D4LA 3Q8VA 3R7NB 3Q86A 3LP0B 1N5SA 2RF2A 4M5GA 1VRUA 2WSEC 3V6KA 2AU0A 2BW7A 1N5YB 4AXIA 4CYUB 2VICA 1NUEA 5E5NA 2RUSA 2YX4A 1WEYA 3EVMA 1E6VA 2FHKA 1NK0A 4J9LA 4FNIA 3KLGA 4FPIA 4NMLA 1T94A 5BXIA 9ATCB 1GMWA 3SCKE 3K8WA 2VDIA 4JI0F 4FBUA 1VQ7S 1FDDA 1IKXA 2KFYA 2IIHA 3PCOB 4DN0A 4CNYA 2K06A 1VGYA 2ATCB 3OVAA 1YG0A 1OWXA 3MEGA 4EYHB 1JXEA 4DUZF 1OPIA 4O4GA 2KHCA 3OLBA 3BBFA 3M8RA 1N32J 1V9OA 2GJIA 1DURA 2A10A 2GQQA 1RTDB 3H90A 3B4DA 1U24A 2CQIA 2ZVIA 3BYRA 1UWBB 2MY7A 5ETOA 2MYFA 4R5PA 4EZ6A 1HIYA 3DI6A 3LANA 4WP9A 1R27B 2BMBA 2XNQA 4CH7A 1Q81T 3QRPA 4B3OA 3PTWA 5KFLA 4IR9A 2H51B 1R3NA 5D77A 3BDEA 3KWMA 3PIPQ 4DPTA 3MCMA 4NLTA 4M5NA 1TL1A 2ROPA 3MR3A 2ZBRA 2GVDA 2EEYA 3A1YG 1YRUA 3CMQA 1VRQC 3QWPA 2KZZA 2AJQA 2R9LA 2P8IA 2UV8G 4HLBA 1U0HA 1SIWB 3EMTA 1P27B 2QE5A 2HK3A 3OL7A 3JQMA 2DT9A 1D09B 1QAIA 2B0GA 4EGLA 1WC6A 2EFNA 2E9ZA 4C9DA 1B0TA 3NY0A 2F9JA 4IDKB 4DX6A 3VAIA 5ETTA 5LSRA 2KXNB 4DZ6A 1TKDA 2WK4A 1FE0A 3S7RA 1HHTP 1VQNS 3MR6A 4DSKA 4I7FB 3IBFB 3B8HA 3P5BP 1RT2B 2KFNA 3FRYA 3C6TB 1HI8A 4M63A 5DDPC 3M6VA 4FS1A 2J6UA 3EVOA 4BBYA 1VHIA 5MLCV 1WF1A 2KM8B 1FJ7A 3AAWB 3M2RA 5EN1A 1B64A 5HN0A 5D3GB 4DUYJ 1XNRJ 2CPHA 3R97A 4DR6J 2V8PA 2HQGA 3PFEA 4F25A 3ILJA 3BO4A 3TZYA 4UZBA 4X4SA 2J9EA 2J7UA 2XM3A 2XZDB 4A8QA 3HSGA 1MW7A 5G0RA 2HWHA 1H7XA 3SSSA 1S49A 5A8KB 1WOSA 2YNIB 1RA6A 2BOPA 4ANEA 3JYTA 1IKWB 2GIQA 1PBAA 4O3SA 4PWDA 1KP6A 2HHWA 1F9HA 1MG7A 4IH5A 2BYCA 4RUAA 4RNMA 2AWZA 1PYSB 1B0VA 2RB7A 2VBYA 5IWAJ 1DFDA 4Z2XA 1T9UA 2AYGA 1RYSA 3CTRA 3CJ0A 4PQAA 4LRAA 2MZSA 2DCUB 1DTQA 4WYWA 2OTLS 1ITPA 3KMQA 4IOBA 1NK8A 3G82B 5KFYA 1SUQB 1U1NA 4MTPA 2AP6A 1H98A 3C14A 1P6TA 3D3CJ 1L3UA 1WOPA 3J7YU 4DV7F 2B5JA 1MSWD 4A8KA 4LMZA 5KG7A 4E8UA 5HVGA 2GHWA 2LQ9A 2DHHA 1VQOS 2HQCA 3V5RA 1EAYC 3TA2A 3RAXA 3CCES 3GIJA 3RW7A 5CHCB 5DZ7A 4RNHA 1TKXB 3BH7B 3TWZA 2XLKA 1PJ5A 1JNZB 3PJXA 2O66A 4ZP6A 4JI6F 4V19J 1PAUB 1CJKA 2XI3A 2HFOA 2QL9B 3SCLE 2FJDB 4LSNA 4JI4F 4N77A 2F3JA 3OTOF 3PDNA 5J2PA 1YHQS 3G8QA 4EZ9A 4G6VB 2Y9HA 1U2FA 2KG1A 2RF2B 1VRUB 2R8JA 2DGXA 3N6LA 3W61A 1JK9B 1N5QA 4ERDA 1NEEA 4USUA 3AXMA 2D3ZA 1HWLA 3MUTP 2VG6A 1AROP 1Y5NB 1E6VB 2J7WA 4DSEA 4GMKA 2NXNA 3KLGB 2Y1LB 5DGBA 5A8RA 2ZJRQ 4FS2A 4A8OA 4U67Q 3KDOA 2K3KA 4LRFA 3F73A 4OI0A 4B9VA 4CRJA 1SH0A 5CYJA 2G0IA 1IBMF 3W60A 1IKXB 2UVWA 4PABA 2UP1A 1SC4B 1YJTA 1ELOA 1GX5A 4OYAA 3MEGB 5D0HA 3BN7A 2K7KA 3G86A 1DQ9A 1TAUA 4YY3J 1X5SA 1OSCA 4K5SA 2XNRA 3D5MA 1M5OC 3DLBA 4O4GB 4OJ1A 4OJ3A 4ZJQA 3CCMS 1OSDA 2Q6CA 3W5XA 1J5EF 3TW0A 1VQYA 3OL6A 1HLWA 3ENAA 3MOZA 3HPOA 2ZKTA 3MR7A 1NJZA 2RHSB 1X4EA 1Y10A 1HFEL 2Z56B 5DGAA 3OTCA 4R5PB 4O3OA 5L9XA 3DI6B 3G6YA 1UEVA 4TQSA 2GIRA 2XMJA 4NE9C 2AT1B 4PWUA 4B3OB 1NAQA 5LT5A 2AYEA 2NYIA 1D9FA 1ZM2A 4QJVA 1TL1B 2A2DA 2GVDB 1X9SA 1LWEA 5I3QA 2PA3A 1VLYA 4PRFA 2RU3A 4LQ9A 2CQBA 4ECZA 2G0JA 4CTAA 1KHVA 2DBBA 1Q8IA 4DCOB 2P2CB 1YJUA 2V67A 4ED7A 2J6TA 1H7WA 2QV6A 3KK2A 2R7RA 4QR2A 2QC3A 3BO3A 3CMES 1VCTA 2WSFC 3IGNA 3QZ8A 1XJWB 3SV3A 2AGQA 2ZHAA 1KBRA 2DNPA 4B3RF 3HVTA 4Y34A 2BDPA 3CD6S 4CLUA 4ZCMA 4AYBD 3A8KA 2OUGA 5KT6A 1YWXA 4JV2A 3VGUA 5F0UA 1WG4A 3S8SA 1YLXA 3D2WA 2NXCA 2KI2A 3M2RB 2NXJA 1CC8A 4Y65A 2W2OP 2KB2A 4UOCA 3KTQA 3AD7C 4L73A 3HHNB 1T9TA 3GIIA 1HQUA 1WI8A 4KGMA 3NLCA 1T0TV 2X3GA 3PG9A 1NCLA 3THTA 3OFHA 5K8MA 1NPRA 3FBCA 5G0RB 4CH1A 3QZ7A 2D3UA 4H4OA 3W9HA 1DY3A 4NPOA 4BCAA 5AJ3J 2XI2A 2PN6A 1NB7A 2QA4S 4IRCA 1HNZF 4DR5F 4PWDB 4YR0A 4NLWA 1PC4A 3QGIA 1PC5A 2WZ1A 2J8AA 2MZJA 3FRZA 2C2KB 3DNCA 3TOQA 2UUBF 1IBLF 4F0KA 3KJNB 3DLJA 2E7VA 2AD9A 4RNFA 1CEZA 4TU7A 1DRZA 4X66J 2FYXA 1NKCA 3H7HB 3B4MA 1DTQB 2V9KA 2A6OA 8AT1B 4TY8A 2ROGA 5KG0A 2I5JA 2KRBA 1RHKB 2HQIA 4F4YA 3C14B 4DCJB 4C8NA 2HG4A 1LW2A 2MSTA 4M5DA 2DHXA 4DL0C 3VAGA 4OZJA 1TK0A 2B5JB 4ZVTB 3JQKA 2FHMA 4KO0A 2QL5B 1SH3A 3R6GB 4DXLA 2X1BA 2WVDA 3T9NA 2E1AA 3RYLA 1QTMA 2KHDA 5H1SV 2E7WA 1KC8T 5GMEA 3PO5A 3IS9A 4Y3CA 1X4CA 1Q78A 1X7VA 2KH9A 2GMLA 1S1XA 4RBUA 1CJKB 2RJZA 4TVAB 2DRAA 2JNJA 4LSNB 2QX0A 5J2PB 4RNNA 3W9IA 3MM9B 3VGTA 3OJSA 2RHQB 1F0XA 4CWBA 2ZITA 4OLPA 4B17A 4DQPA 2YX1A 3DRPA 3H5SA 3IFEA 2ZH4A 4JI3J 2GGPA 3OFFA 2XSFA 4NMXA 3GFYA 2VG6B 1T3NA 3BJYA 4ECVA 2NZ4A 2J0QD 1HNWF 2HGNA 2L9WA 2BRKA 3NKYA 5A8RB 1X4BA 3MM7A 3EJMA 6AT1B 4MYUA 1HR0J 4WP8A 2IMOA 4C6AA 1RAIB 3T5HA 1FO1A 3K5MA 3NCPA 1NNDA 2LXIA 4ZVSB 4NXNF 5KFTA 3TAQA 2XG8A 1H74A 4C8MA 1HNXF 5IV3A 1TP7A 2CZ9A 3IO1A 2H3EB 1TTHB 4N7TA 3M8QA 5HJXA 3R9LA 2ERRA 2RILA 4KBIA 2OMOA 2WRMA 2VC0A 3DDNA 4MKBA 1FXLA 3ILOA 1HNVA 3R6LB 1ZZNA 3MD1A 2IDEA 1WORA 1B99A 3IC1A 5A76A 1FKPA 1YJ9S 4NOHA 4RLEA 4NA3A 4KHPF 2V0NA 4OI3A 1FNXH 1X4FA 1WEXA 2HNZA 1OMSA 1KVJA 2ZUGA 4LFAJ 2I2YA 3FFIA 5KFZA 2V2KA 2M7SA 5E3PA 5IOLA 2XHCA 3H5XA 1MWYA 4QWDA 1LWEB 1Y7PA 1XMOJ 4DV4F 5D0EA 1QJHA 1S7IA 5K9FA 3T41A 3CDAA 5DDOC 6FD1A 2LQ8A 3LALA 4CTAB 2ZDPA 1F2HA 2NCKL 1Q8KA 1ZAXA 2X3DA 3J81j 3L7OA 4DR2F 2UUAJ 2CFXA 4URQU 1F2GA 4PXEA 3KK2B 3FSXA 1UETA 3C19A 2DGTA 3IWXA 1CPZA 2NSCA 2DD8S 1SQFA 3NGRA 3NNHA 2EKYA 2KO1A 3PX0A 3AD9C 1RWXB 2YBVA 3FUYA 1VS3A 5L9NA 3HVTB 1U2RA 4JI2J 4Y28C 1FFSB 4NZ0A 2ZM6J 3T1AA 3G96A 2BE9B 1QUVA 3GIRA 2DY1A 3NOGA 4K2XA 2VIHA 1W2BR 2BA9A 3OHAA 2HBQB 3ULHA 2R7XA 2IRUA 2W7AA 4LRDA 5L38A 4ZHRA 1SIZA 1NDCA 4MKVA 2P5VA 1U1RA 3SQGA 2VQEJ 4AQYJ 3B54A 5KG2A 2M52A 2ZBCA 3BZQA 3AODA 1HQUB 4DR1J 4IYQA 2VJVA 3CJTA 1QLNA 2CJKA 3BPDA 2NUUG 2OH2A 1Q79A 5LJ5Y 3MMBA 1NJIT 2HRYA 3W7BA 2EFGA 4UT4A 3GYXB 1IQTA 4ATNA 2OFGX 4H4OB 4OYBA 1RSCA 4WFNQ 2NSBA 2MTLA 4RU2A 2QGFB 2OIHA 2ADBA 4X4NA 4MIAA 2WONA 1R89A 1OYEA 3C66A 3HLUA 5K8NA 3CJQA 2DR5A 2WB1D 1WEZA 3RUBL 1U49A 1U1OA 5L8RC 3FEZA 4NRUA 3P3DA 2G1HA 3UW1A 1HWUA 3PZPA 3GG0A 4X4UA 5DDQC 3MMJA 2IDLA 4OL8A 4TY8B 2IVMA 1U47A 5HANA 3W3SA 2I5JB 4HL9A 4KPYA 2QSWA 2GMHA 2ZOMA 2MJUA 3I9ZA 1ULRA 4I1TA 4DL2A 1LW2B 4UQGA 1XR7A 1O5JA 1N5TA 4M5DB 2WOMA 4QCLA 4USWA 2V63A 1X4HA 2VPWB 4W98A 2JWNA 4KO0B 2F7VA 1C4AA 2W2QP 3HVWA 5HO4A 3T1YF 1XBWA 3K7RA 3QJPA 3BO2A 3IS9B 2W9CA 5CD4H 1KLNA 2VUGA 1S1XB 4C8YA 4EMDA 2I0XA 3LWMA 3CMAS 5C42A 2GC8A 1I1GA 3CCJS 2CG8A 1VC0A 4KAIA 4MIBA 3J7A1 1LKZA 3MM8A 3CD0A 5DQIA 4C0OC 2WAQD 2QA1A 3QBCA 4BDPA 1VQ8S 1GMUA 1FJGJ 1FNMA 2R3VA 3DRPB 2C2RA 3TVZA 1RI7A 3UPFA 2B51A 3TJ8A 2GGPB 5HP1B 3MWBA 1WWHA 5AE3A 3GSIA 4X62J 4Y0FA 4NASA 4PXCA 2NUHA 2EG1A 3I9V9 4DV1F 3DLEA 3MM7B 4IG0A 1AA1B 2FHJD 1VQ5S 2V8HA 1F6TA 4NCGA 3DM2A 3CCWA 1H72C 4B3SJ 4FYVB 3POTA 2MKHA 3MPDA 2RIJA 5FIIA 2VPXB 4UOGA 3G6XA 3GZ7A 1T3OA 3US5A 4DR3J 4DEZA 4LF1A 5BR8J 2JEFA 1N88A 3CJ3A 2XCPA 3JTOA 1R0BG 5CABA 4JI8F 1VI7A 1IR1A 2BJDA 2FC8A 1DLOA 4EBDA 2KYXA 1UVNA 2CNOB 1IM4A 3X3UA 3QT8A 1T03A 3P96A 4ZPDA 2R2SA 2BM1A 3SI8A 1VBYA 3KUHA 2E5JA 1HNVB 2IBKA 1S9FA 2MQ8A 1JNRB 1D0EA 3HDSA 3OR2A 1ZZFA 3IR5B 1FKPB 3MF5A 2HW3A 1NZ8A 1NH7A 4JI7J 2HNZB 2V8VA 1QAJA 2HK2A 2LXUA 2DGOA 3R5AA 3L7UA 1FRXA 4K4ZA 2KZMA 4KRWA 1RACB 3FFIB 4ES2A 2ZH2A 2W2MP 1ZAWA 4I56A 2YKAA 4WFXA 2CPXA 2RSQA 5EHHA 1F3FA 1HYSA 2XC9A 3N6MA 2BKNA 2XO6A 2IBOA 5DG7A 4A8YA 4PAAA 3KG0A 5IQQA 3GSDA 3DDIA 2XTJP 3N28A 4X4TA 1HNIB 2HS4A 2RNEA 1XNQJ 1V3SA 4UOFA 4DL6A 1R6VA 1ACMB 3SFUA 1TU0B 1JXLA 1JWWA 1WHXA 3W5ZA 2MHEA 5B0CA 2XWXA 4RW4A 5DLFA 4RUCA 2F8MA 1NJXA 1UZDA 1WTBA 2CJYB 4U96A 2FVPA 5EWFA 4DPOA 4AL5A 1LV5A 3Q0AA 4O0IA 4Y6IA 2N7YA 3MZIA 3MECA 4NL5A 1NJWA 1LK5A 4PG8A 5HI7A 4ZVOB 3WBZA 3N6NA 1D8YA 4BS2A 2CJXB 2EBEA 2JC0A 5C5JA 2HWIA 2YNFA 5AE1A 3G87A 2ZH8A 1FI4A 2A1BA 2VOOA 1XK8A 1X4GA 2XZWA 4UY85 4GVLA 1SCJB 3D66A 2HHSA 3OQ2A 2IM0A 3DOLB 3JSRA 1N0UA 4F4KA 4MKAA 4FDFA 1EARA 1VBZA 1K8AT 1X0FA 4F04B 3UO0A 5CZVA 4ZHRB 3SQGB 1UVLA 5D4NA 1LXJA 1Q5YA 4OYZA 1S99A 3K17A 2ZVSA 2QLFB 3OVSA 3K59A 4S0MA 3HK2A 1K47A 3W2WA 2NREA 2DRDA 3H20A 3D0GE 2UV8A 1H0HB 3MMBB 2MZ1A 2NS1B 2IMWP 2EC2A 4K50A 4AUKA 1JJCB 2IYGA 2FD2A 3BSCA 3M05A 4NA2A 1NSAA 3MUMP 4ETXA 4PZVA 1HL6A 4CP5A 3DLKA 2C2EA 2HEKA 2OEKA 2WONB 2XS2A 1RJJA 4ED5A 4IQMA 4ELVA 4YUDA 4IUFA 2AJFE 3QT7A 2RDIA 3PW7A 1ICEB 1MU2A 3UD3P 2KKHA 4NZ6A 1QSYA 5F8HA 2XYPB 1KOHA 2YKMA 3V4MA 5LSOA 1VRTA 1YIJS 1RWVB 4USMA 2D41A 5DM7Q 2NPFA 4DV0J 5KT4A 2LCWA 1F5BA 2V69A 4B3MF 1YKWA 2ADCA 2BJ8A 2XCAA 4LVNP 1L5UA 1LWXA 2KN4A 3LGNA 4YHHJ 2L3MA 2HZVA 3ISNC 4QZVB 4ECYA 4NLSA 1CC7A 2WOMB 5IC6B 5BYQA 3HJVA 5GADI 1I94F 2MB0B 2CUYA 4WU2A 4HI1A 2EC0A 3MFHA 1WNEA 1FWKA 2B3TB 1QE1A 2F65A 3GLJA 4FXVA 4K7QA 2AYMA 4OZNA 3NEKA 2UXCF 3JTPA 2W9CB 4LF6F 2YPYA 5D15A 1YDLA 3F44A 2IPOB 2AX0A 3D54A 4ZCKA 3U27A 3TX8A 4MIWA 3H25A 1NXIA 5C42B 3W1YC 1XMQJ 2QTWA 2MQQA 3MM8B 3Q8SB 1FD2A 3H40A 4G1IA 1CG2A 1TAQA 3MTJA 2GW8A 3IBCB 2HGLA 2XGQA 2FJVA 2PC6A 3VTIA 4L76A 2ZHBA 3HXMA 1YZ7A 1JLBA 1IVZA 3V6HA 2MQOA 1KTQA 3PNIA 3DLEB 4B3TF 4IG0B 3ILLA 5KFJA 2LU1A 4NCGB 3DM2B 1UVJA 3POTB 4WIQA 2JFKA 4IR1A 3QT5A 1PAEX 3O8WA 3VQSA 2DTJA 4XPCA 5F9NA 1TUWA 1UEUA 1DLOB 4ZPTR 4K4UA 5ETLA 1YSJA 4HACA 2RH3A 3ZZZA 1Q8LA 3C6UA 1T03B 1U7LA 5HBMA 1TL4A 4F2SA 3D9BA 2AEMA 1SJ3P 1RLCL 3UVJA 4TXSA 2MXYA 1QDUB 2G13A 4EI2A 3OR2B 1XR5A 1PYOB 2CVEA 1HWIA 4L74A 1SJ4P 4TYAA 4LF9F 1HWKA 3TUJC 4USJC 5CA5A 5ETMA 4XIUA 3D1HA 2ZHOA 2W2NP 1HYSB 5KOXA 1QSLA 2YWKA 1LK7A 3JSBA 3OT9A 2XHWA 1TL3A 1L3SA 1FX4A 4ZVEA 3H2VE 4WPAA 4WFZA 2DNHA 1KD1T 3QJJA 3HFVA 4R8UA 1KVKA 5H9FJ 5JXSA 1VLOA 1RT6A 1CJUA 4URGA 1DZ5A 4ECWA 4MMOA 2HHHF 1K0TA 1HBNA 3DFEA 2GCFA 2EK1A 4RW4B 3SCIE 1PG5B 5LJ3Y 4YS2A 3I82A 5A6WA 1A0OB 2AJ2A 2IJNA 1G6BA 3OJUA 3SFGA 2XQCA 2L9DA 3TZXA 5DDRC 2XLIA 3QLHA 1BMQB 3MECB 4O4RA 2M3DA 4R0EA 1U6BA 2M4MA 3QMQA 4ZIVA 4EO8A 3HT3A 5U47A 4DMZA 3RGIA 4CDIA 3CT9A 2YNFB 3JSMA 3TYTA 2KU7A 4FYWB 3HHEA 1U1LA 2CPIA 2DNYA 4DPXA 4GKJF 2U1AA 3LH2S 1SV5A 4IG3A 4I67A 2EK6A 4ZDNA 2VFTA 1CS4A 1VIOA 3M9OB 5B0BA 2CQGA 2MZRA 2Z30B 4MJKA 1FXRA 4J91A 4UUWA 1QAXA 1TZ0A 1FRIA 3RRKA 4RWWA 1S6QA 3W2WB 4OYXA 2DHSA 1CJTA 1X4DA 4ZVHA 3BDPA 3QO9A 2HNYA 1K1SA 4AT1B 2W9BA 2MLYA 2Z2LA 2OD4A 3V2UC 3KLVA 5HROA 5F8NA 4Q8EA 3ZZTA 2ASYA 2LEAA 1PO6A 1T05A 3D68A 1U45A 4EO6A 1GQEA 3TVYA 2J8SA 2VBZA 5GMDA 2UZAA 3DLKB 2FVQA 2ZDOA 1RP5A 3P5TL 3DC2A 3EYZA 2FUG9 1NDPA 2RUGA 5LMNF 3DRYA 1O6XA 1BQMA 1G4CA 1MU2B 1NK4A 2COLA 5JVHQ 3Q2TC 3GFHA 2UUCJ 1RWOB 4LF2A 1VRTB 1RWNB 4OV6A 3PYFA 3W66A 2VFVA 3D6MB 4P10A 4HHHA 3AJDA 2PMZD 5K20B 1IM6A 1PYTA 2FC9A 3HHKA 4TLQA 4QYZJ 5IT9Y 4DSJA 1Q5VA 1Z2ZA 1WUUA 2WW4A 3J7ZT 2C2ZB 1RA7A 4WTYA 1CQMA 4UOHA 3MPYA 1XEZA 3HZEA 5IT4A 2U2FA 4OZ0A 5IFMA 1G7CB 1Q0NA 2RS2A 5IXUA 2IAJA 3TUZC 2E9RX 2FLNA 2E44A 5EGYA 3K89A 3TQ1A 3FVYA 4FNHA 3HSJA 3B78A 2CQDA 3LO3A 2LQBA 1C1BA 4M5IA 2R2UA 4OX7A 2X1GA 4YB1P 4FF4A 4LF5J 2VQFJ 5GADU 5GAGU 4H4KA 1FEHA 1FDBA 3QWUA 2CPFA 3AQOA 1T11A 2PI5A 1RK8A 3H42A 3BB5A 4ZIWA 1UPPA 2FVCA 2HAIA 1RT7A 1JLBB 2POKA 2CAJA 1JLEA 3D6HB 2ACMA 3NGKA 3A8IA 4LFBJ 4WZQA 1C0UB 1XIQA 2HS0A 3EICA 5KFBA 3K5OA 4LF8F 3CGIA 2C3MA 4BC9A 4BC7A 1A6LA 4Q0BA 3H0PA 1YBTA 4HR2A 4PQUA 4MT1A 4K4XA 1C4CA 2ALYB 2XYHB 3VVTA 5L1KA 1IKYA 4HACB 4P74A 3OTEA 3FCHA 2R7OA 1IJEB 3C6UB 3HJFA 4YMEA 5HBMB 3TZZA 4DR7F 2EPIA 2OEJA 3ZC4A 3UVJB 5IQ6A 2V9WA 1V5VA 2IVFB 3ZO7A 2CWKA 4WE1B 1VBKA 2GA7A 1X31C 2F4VJ 2WBRA 4X4RA 1KOOA 2W7PA 2LVWA 1HWJA 4DV6F 3RTVA 1PJ6A 3RBDA 1RBAA 2IA0A 4QWCA 4JB8B 1UTAA 4G3IA 3K5PA 4YEAA 4F8RA 1UAWA 3QFHA 3AD8C 4W4MA 1BD6A 1T02A 2ZNYA 1TL3B 2W4DA 3KHRA 3AOCA 2JLGA 4OHVA 5KT7A 3QIPA 4CZCA 2Q6BA 4I0WA 4R8UB 2R8KA 4I69A 2HWTA 1RT6B 2H1YA 4CO5A 2MQPA 4OYIA 1V3ZA 2E5HA 1CJUB 4LR8A 2QMXA 3MHYA 1F5AA 1HBNB 4ER8A 1RHRB 5KG4A 2Z57B 3J80U 1P1TA 3MOJB 2BR0A 1I6JA 3MAQA 3UCZP 2GO8A 3LQVA 3QLHB 4PG6A 1WHVA 2MKIA 5SZTA 3N79A 4QWAA 3EXYA 4O3PA 1B0PA 1JLAA 5KFFA 1XQIA 4JUZA 3IWLA 2WVFA 3JSMB 2IRXA 2DNMA 3GQCA 2EVZA 2XS7A 4E0DA 1FTCA 1N33F 5KAKA 2V8GA 4OZ5A 2E1CA 3FMBA 2HAFA 4IOAQ 1M5KC 3R5JB 1RE1B 4EFAC 1SV5B 4IG3B 2LFVA 3IG1A 4GO5X 1NPKA 3KK3A 3NGTA 1GXLA 4PG4A 1CS4B 2VPYB 2CNKB 2M0GB 1VHFA 1MMLA 4DU7A 5HAOA 1RXOB 4UF4A 3AH6A 2MQLA 2QIFA 3VHQA 1S6QB 1MNEA 4L3NA 6FDRA 2KYZA 4ID8A 1CJTB 3Q22A 4JYAJ 3QO9B 2HNYB 1Y5LB 2W9BB 2DGSA 1MMNA 2CZ4A 5HROB 4YDDB 3EDRB 4ILLA 4DG1A 4KGKA 2HFUA 1T05B 3EDQB 3KG1A 5CAAA 5C2CA 1KQGB 1SKUB 2R8GA 3T9ZA 3W5YA 1AZSA 1VK3A 4W90B 1OJ4A 2GMJA 2V68A 2RRBA 1U26A 1TMJA 1BQMB 4NLRA 1VFJA 4WK3A 4D3HA 3R5BA 1YBAA 3H98A 1XC9A 4K8RA 2W25A 4YP3A 2YVSA 3IAM9 2DB1A 1AW0A 3P49B 5KTQA 4Z7CA 1M5PC 4LVOP 4F4XA 3WX4A 5RUBA 3QAEA 3AA9A 1IJFB 1FRLA 4JV0A 1OO0B 2B8PA 2YQ1A 3HVRA 1B3TA 3R2CJ 3LA0A 1KRPA 4ITSA 1KNZA 2XZTB 2XB2D 2JZ5A 2WTFA 5H9EJ 1RYRA 4J90A 2FLPA 1HKAA 2F8EX 1UVIA 4OZ1A 3FCVA 3KJFB 4JV5J 4QIVA 1IBKF 1YJ7A 3OSNA 2P9CA 1UA1A 3E3XA 4K0KF 4EEYA 4F3QA 4YN3B 2YKPA 3ZTRA 1S1WA 1WD6A 2IAJB 4NYZA 1H2TZ 3MXHP 1GX6A 4WFAQ 1E6YA 3QFWA 3HHLC 2KJWA 1ZM4A 1EB0A 4K4VA 3FZ2A 4BWMA 1C1BB 2GV1A 4IFVA 4LF4F 4X65J 1AYEA 1GAOA 2B4PA 1FHTA 2A18A 1FE4A 3MPWA 2LEBA 1KQFB 4DF8A 2AJ1A 1RT7B 2F4FA 4WIIA 3NG8A 1JLEB 5KT2A 3AXKA 3WX8A 3KHGA 1S0MA 2CQCA 3DOKA 2YKNB 3AY0A 4OV1A 3B82A 3TNVA 2CZVC 2I38A 4LF7F 4CIOA 3UI3A 3QGHA 3FBBA 2VDHA 4LFCJ 1S12A 2M2BA 2HURA 1YGYA 1JXVA 4J9OA 5E3RA 2UXBJ 2OPQA 4J9QA 4Q0BB 2R7UA 2L08A 4ZP9A 1TELA 2JEGA 1EQMA 3FBFA 4PQUB 2EFPA 3GMGA 4OJGA 4NXMF 5DLGA 4ES3A 4QWEA 2JHEA 4PG7A 4F3OA 3PXGa 4DX8H 2DR8A 5I42A 1IQZA 1OQ6A 5D6GA 2DO0A 4Q45A 2OTJS 4HDHA 3ZZYA 3BQ0A 3TANA 3UN3A 2G2YA 4QIWD 2B4UA 3MMAA 5LM7E 4ZMMA 1GK8A 4E98A 1JLFA 3T5LA 5IC4B 1RAEB 3ZZPA 3V6JA 2V2QA 3NCRA 3M2UA 4F3MA 5F8LA 2IA6A 4QYZK 3UDVA 2V4JA 2PDAA 3LWLA 2E1PA 1TUVA 2N82B 1RWUA 4CT9A 4V1Ak 4IRDA 2Z58B 3VV2B 4W92B 3O1LA 3QIPB 2K8GA 1WI6A 3D67A 3VZIA 4OX9J 1GFWB 2VC1A 3TX0A 1Q7LB 2YNGA 4O3NA 4IH7A 1HBOB 4OIXA 1QAYA 2BRLA 2RAQA 3CJ4A 3NNCA 3MR5A 1UA0A 3KOAA 4TLRA 2LDIA 2HBRB 4UUXA 2V94A 2HQDA 2HVEA 5F8IA 2YWGA 4NLYA 2H4YB 1PSDA 2B7BB 5EDWA 1IBCB 5HATA 3KK1A 2KFZA 2GAHC 4KGZB 1JLAB 2Z2YB 5D4PA 2J0SD 2RMLA 3GJSB 2E7XA 3V6DB 2RQCA 2KRRA 5ETVA 3KLEA 1R8HA 3W62A 2DGQA 3LAKA 3M6WA 5KFEA 1M5HA 2ASDA 2H4WB 1TKZA 2NYHA 3IG1B 3VWSA 4DL4A 3KK3B 2O5DA 4KYZA 2JVRA 2LQ5A 1Q8BA 2LA6A 1FD8A 2BW2A 2CA9A 4IQXA 4RW9A 1NDLA 4X84A 1NK9A 1N32F 1VQMS 1CULA 3HHLD 2VG7A 3GJQB 1NH8A 2H5EA 2CQHA 2Q79A 4E2FB 4TNOA 4F36A 2R7WA 2AZ3A 1NLKL 1NSQA 1AFIA 1KSPA 2A0FB 4J9UE 4DG1B 2RQ4A 3SYZA 3GJTB 1NKEA 2ALZA 3C16A 1F9EB 4ZJLA 2HHUA 3LUYA 4CI0B 1SI9A 2A2CA 3S01A 1S72S 2IM2A 4P2MA 1FFWB 1AZSB 3M9MB 3V4IA 2NPIA 3PHEA 4OX8A 1SJQA 1OY9A 2VH7A 2FY8A 1X8DA 3CD5A 3QQCD 1HQEA 2XY5A 4GRSA 4J9NA 1RT4A 3D3BJ 1MROA 4CLWA 2IJFA 4X4VA 2CQ1A 2PFDA 2BE2A 4OLOA 4CO3A 3C15A 2MKYA 2Y0SD 2Z2ZA 1R31A 1JJHA 1ZTWA 4V19X 3BKTA 1PCAA 4DI6A 3BN4A 1ZM9A 4Y2IA 3R7BB 5FD1A 5HMYA 4ECTA 4LREA 4ZLLA 1NZAA 1BQXA 2VASA 3ZZRA 1Q1KA 4ED0A 2MJNA 4DV5J 2CXEA 3BKFA 4WTOB 4F4ZA 5BYRA 2QLBB 2CQ0A 4F4WA 1ZPWX 5ETPA 1UFWA 3W8GA 1UP1A 3NAHA 2Y8YA 1S1WB 2YH0A 2ABYA 3BYPA 3B6BA 2CJ9A 1QD1A 2HBZB 2R2TA 2XS5A 1FRJA 4N5SA 1E6YB 3O44A 4YB7A 4DUYF 1XNRF 1GH8A 2VOPA 1KDNA 4DR6F 4NYOA 2XEXA 4B9NA 3Q8QB 4IFVB 3ADAC 4ZPWR 4GKKJ 1RCOB 2CWXA 3BV8A 2ZZMA 4QPXA 1S0OA 3T1HJ 3R1HA 1PGZA 1RAAB 3L3CA 1Q86T 1IUJA 3KDNA 2RDJA 3RW6A 3LAMA 1Q82T 5AXKA 3SSRA 1NBEB 3MDFA 4GO7X 3BEGB 4OQJA 3DOKB 4DWIA 1IR2A 3AA8A 4GC6A 3QNWB 3QAUA 4DPYA 2OPQB 3HCXA 4M5MA 3BREA 3GV7B 5IWAF 1CBKA 3UN5A 2J6SA 3CWJA 4Y00A 5I42B 2YWWA 2YPZA 2G2OA 1NM2A 3QRQA 5T7LA 1RBLA 1KLMA 2VJUA 3SSQA 4A8FA 3ZNJ1 4DSFA 3AQPA 3TUIC 3MMAB 5HQLA 3UDLA 4J9SA 1JLFB 3VCDA 3DLLQ 3MM9A 3CJ8A 5GAHI 4WFYA 2FZGB 1RHJB 3ETOA 2ZC3A 4DV3J 3MFIA 2VODA 5H9EK 3M2UB 3LF0A 4HKQA 1KONA 2V4JB 4A8XA 1FKAF 1Y11A 1GNKA 2CDRB 1S1TA 4KSEB 3LPEA 1YX2A 2P9GA 2KVQE 3H4DA 2PIIA 1UVMA 4YR3A 1RHQB 3VAMA 2J9CA 5KFKA 1NHKL 4ETZA 3UNYA 3DHXA 2B9XA 3BSOA 2YNGB 1GXUA 4YDXA 4NI2B 5D78A 1N34J 1B7FA 5B0FA 3T5JA 2VKRA 3RG6A 4Q43A 2KT5A 3I4PA 1HD1A 4DL5A 2C22A 1B70B 4EUVA 1OYDA 2VFUA 2PMWA 1NJYA 3KK1B 4RBVA 3QRRA 1QUPA 2I6WA 2JLFA 4DHVA 2H48B 1OIAA 2ZZNA 1X9MA 4C3MA 3KLEB 3DRSA 1RWWB 4C48A 3GFZA 3VAFA 2D69A 2QLJB 3I5BA 4KGVB 5IV4A 3K57A 2HHXA 2HRUA 3BR8A 1TKZB 4KFBA 4DJBA 2LA4A 1VC6A 1TL5A 2OSRA 1JJ4A 2QA4G 4YY3F 2ZH5A 2E5LJ 4RW9B 1FRMA 1CULB 2XMUA 2VG7B 1N8RT 2WB4A 2QYGA 1T95A 3PVXA 5HK4A 5E41A 2D3OR 1YITS 4LRBA 3H2LA 5CYQA 3GG1A 2J76E 3FSYA 3TR5A 3BQ2A 4NYPA 4ZCLA 4K4YA 2UVVA 4DU8A 3C16B 4Q2LA 4JI5J 1UW4A 1AUDA 2UXDJ 3L7PA 4ECSA 1M0SA 1RAFB 1Z1ZA 3V4IB 1FCAA 2RU9A 3MCOA 1HQEB 3N5FA 5JUMA 2F63A 2BKOA 1RT4B 1PIEA 1F9FA 1MROB 2EWHA 2CPYA 2BE2B 3C15B 1TL7A 2DGVA 1RWKB 4EWTA 4P6QA 4WK1A 4OHYA 1FTRA 5F3TA 5AE2A 3I56S 3OXLA 2IM1A 3AJ1A 1LXNA 2R7QA 5FJ4A 3ZTOA 2BABA 4ED6A 1RT5A 4ES1A 3EPGA 1WC1A 3S1TA 4CLYA 4DS5A 1JJ2R 4QQBA 2E66A 3RZAA 1Y9OA 2HGMA 2BXJA 1LW0A 2OSQA 3VAJA 4I2PA 4QYRA 3D28A 4IO1A 3HF5A 2DHGA 4ZVGA 2Y0BB 3PJWA 2X1FA 1NSPA 1AB8A 2L41A 2OMLA 1VQ9S 4ZP8A 1IKVA 4CLTA 2MQMA 1CLFA 2VFSA 3OL8A 1L3KA 1TVRA 1UKUA 4DR4J 2VF3A 4B9MA 1YVFA 4X4PA 3RB4A 3FSIA 4IO9Q 4X64J 2Z4PA 5FDLA 1VJQA 1FRKA 1DBDA 2DXDA 4KHRA 2NZCA 5AJ3F 5M2UA 3V81A 5KFWA 2JX2A 4F0HA 2C3PA 2DIVA 4OI4A 4J5OA 1SQEA 5B0AA 5MAOA 7FDRA 3BQ1A 5A2QU 3MEEA 5HJYA 3W65A 2MLZA 2YKOA 1SJRA 4P7TA 3M8YA 3M30A 1UZHA 3HT0A 4F67A 4X66F 3MM6A 1OY6A 4A48A 2ATLA 3OXGA 3TVKA 3KLHA 2MQNA 3TEHB 5ETNA 3ONQA 5T7LB 3NRBA 1N0VC 1X5OA 1KLMB 4FKYA 3GYNA 3IN5A 2UU9J 1HD0A 1FX2A 1NRKA 3N01A 2IJRA 3P4UB 5LMUJ 5AXLA 4ZPBA 4ED8A 3I5AA 5B0EA 4CH0S 3CW2C 1WELA 3RAMA 2LXFA 3PR5B 1S57A 1NHUA 3P45B 1CSJA 1U48A 3AOAA 2Y8WA 3A12A 4HT5A 2DJWA 2AGPA 4DFMA 3LPYA 5HP1A 3GP9A 4DV2J 1S1TB 3OR1A 2GIFA 1IR0A 4ECRA 3OLAA 2P6TA 4ZN1A 2QN6B 1P9QC 2QZ8A 5I4MA 3PR4A 3MM5A 3EPIA 2ZJQQ 2BACA 4FPRA 5KFXA 5E33A 3CCQS 1SL2A 5KFGA 2C3OA 1WG1A 2GHPA 3BBBA 5GAHU 1JLQA 5LXYA 4OZ3A 4X2BA 2PEHA 4N41A 4ELUA 1N54B 5B09A 4JI3F 4U6PA 3OVBA 4LT6A 1Q4RA 3CCRS 2OP5A 1N36J 1LEOA 1M1KT 3WIUA 1U1KA 2BZ2A 1HPZA 2O67A 3CC7S 1KEKA 3Q8PB 3M8WA 4KR0B 1XWLA 4UW2A 3GR0A 2W01A 3THVA 1HR0F 3GILA 3AT1B 3I0RA 3E01A 3FCWA 3DRSB 1YQHA 3BGRA 2AHOB 3WQPA 2ASJA 3W2VA 3I4HX 3SDEA 3SEOA 4HH1A 1WDDA 3CDUA 4KFBB 1GMWD 3K5LA 1FK9A 3W63A 3GV8B 1AFJA 2A3JA 1T8EA 5DETA 3G9CA 1YJVA 2AKWB 5CZXA 1J27A 2ZWOA 1BUXA 4N8OA 3U7JA 1W2IA 2VONA 1LFPA 1HNIA 1Z4UA 3H5YA 5ETSA 1WKKA 3NWGA 3VQTA 1O0PA 3AFGA 2K3IA 1YRTA 3BPSP 5CYQB 5D0GA 4RPFA 2JH3A 2PGCA 4DDFA 2EXUA 3A8EA 2M88A 4JI0J 2D7SA 2FVSA 5CYMA 2Y1IA 2FVRA 3OTBA 2GQ2A 4LFAF 3HD1A 3GU0A 3DLHA 2V5HG 3KMSA 2UUWA 3HKWA 2L9NA 1X60A 1HHSA 3MURP 2B6AA 4P2FA 1XMOF 2YQ3A 2FJWA 4U8YA 4BHQA 2DNKA 1WC3A 4DUZJ 4K4SA 1ZAVA 4FZVA 3Q24A 3N4WA
chains in the Genus database with same CATH topology
4C7QA 1UEVA 1FEHA 4LFCF 2KXHA 1FDBA 2E1RA 3QWUA 2CPFA 3AQOA 4WCEQ 4TQSA 1XTZA 4ID5A 4H4MB 2GIRA 2PI5A 1RK8A 2XMJA 3DU5A 3BB5A 2UXBF 3DYAB 4PWUA 3DOLA 4B3OB 3EZ5A 5KFCA 2DHAA 1NAQA 2FVCA 2PA8D 2HAIA 5LT5A 3KLFA 1VIXA 3M9NB 1RT7A 2DIUA 2UUAF 3M4XA 2AYEA 2B9YA 2HFZA 1D8ZA 2NYIA 1D9FA 1JLBB 1ZM2A 4QJVA 1TL1B 2A2DA 2POKA 4C3KA 1JLEA 1X9SA 4IFYA 1ZETA 1LWEA 5I3QA 3NGKA 2PA3A 1VLYA 3MGJA 5K14A 2RU3A 5J2NB 4PRFA 3FDSA 1S48A 4LQ9A 4WZQA 4XAKA 1C0UB 1FVQA 2CQBA 3VAKA 4ECZA 4WKRA 2HS0A 3LP1A 4CTAA 3RBEA 5GAGI 5KFBA 2VBWA 3I31A 5C25B 3K5OA 1KHVA 2DBBA 4DLGA 1Q8IA 1X4AA 3R3TA 5A6PA 4LF8F 3CGIA 2C3MA 1RT5B 4BC9A 1YJUA 2G1DA 1A6LA 4BC7A 2AJ4A 5DQGA 4ED7A 2LYVA 3NAIA 3H8YA 3S6EA 4Q0BA 2O3DA 2J6TA 3M2VB 3HZGA 3THPA 5B7WA 4PQUA 1H7WA 4Y2AA 1ZOTA 4O3QA 2QV6A 1W25A 1JMTA 4HHJA 1SKWA 3KK2A 2Q3PA 4JI2F 2R7RA 1GXTA 4K4XA 4ECQA 1LW0B 1C4CA 4QR2A 2XMMA 2FPHX 4I2PB 4WKYA 3BO3A 5L1KA 3CMES 2J7KA 2ZM6F 3DMJA 1IKYA 2RKIA 2WSFC 2XMKA 3IGNA 3MMCA 3FCHA 3OTEA 3CDEA 3QZ8A 2R7OA 3SV3A 2KVIA 1IJEB 3C6UB 3RR7A 1JLCB 4AXJA 1N6QA 2AGQA 3HJFA 3MCSA 4YMEA 2ZHAA 2J0WA 5HBMB 2DH8A 1LQ9A 4RW8B 5L1LA 3EGWB 3HI9A 4DR7F 2AW0A 4AL6A 2EPIA 2HZCA 4R0JA 2DH7A 3MEDB 2DNPA 3ZC4A 1IKVB 2V9WA 5IQ6A 4B3RF 3HVTA 3T6BA 2IVFB 4WE1B 2VQEF 3H2UB 2OFHX 4Y34A 2BDPA 2ZJPQ 4AQYF 3CD6S 3M32A 1NU4A 1Y4ZB 4ZCMA 2GA7A 4AYBD 2WBRA 4X4RA 1KOOA 2W7PA 5KT6A 1YWXA 4JV2A 1TVRB 1VQPS 3SXLA 2LVWA 1HWJA 4DR1F 2MHNA 5F0UA 1WG4A 3ZZ0A 3S8SA 3WC0A 5DO2A 4DV6F 3D2WA 3RTVA 2XO7A 2CQPA 4KJIA 1RGVA 4KKOA 3RBDA 2KI2A 2IA0A 4OX9F 1QVFR 4QWCA 3M2RB 5J1EB 1CC8A 1S6PA 4Y65A 4OI2A 4ZS6A 3FGVA 5BYSA 4EBEA 2KB2A 4UOCA 5K8PA 3ITHB 4G3IA 4RW7A 3K5PA 3U1LA 4YEAA 2MPUA 5FDLB 4F8RA 3KTQA 1UAWA 2PSZA 5F8GA 3R5DA 2O1PA 2VG5B 3N0VA 2CRLA 4H4KC 1HBUA 2IVYA 1BD6A 3HHNB 1T02A 1YJNS 2ZNYA 3GIIA 2VA3A 1TL3B 2W4DA 4HTIA 3KHRA 1HQUA 1WI8A 2Z2MA 3D0IE 3MI7X 3EXCX 3V81B 4TYBA 4KGMA 3NLCA 2W8KA 4NCBA 2JLGA 4J9MA 4OHVA 2X3GA 5KT7A 5J1NA 3QIPA 4CZCA 7FD1A 2Q6BA 4I0WA 2OPSA 3THTA 4R8UB 1VOMA 3OFHA 5K8MA 2R8KA 4EU0A 1KR4A 4I69A 3RRGA 2HWTA 1RT6B 1LWFB 2ZD1A 1RKIA 5G0RB 4CO5A 2MQPA 1M90T 1V3ZA 2ILYA 2E5HA 5IM0A 1TK8A 1SKSA 4O44A 4CH1A 2QMXA 3HX9A 4QW8A 4RZRA 3QZ7A 2CJBA 3MHYA 4C8OA 3BGUA 5D8HB 1F5AA 1RDRA 2D3UA 1FXDA 4N56A 1HBNB 3MEEB 2HYIB 2HHQA 4JBCA 2DNZA 5KFVA 4EYIB 4H4OA 4NPOA 4BCAA 2APOA 5KG4A 4QIFA 2XI2A 3BGLA 3M30B 2G0CA 2HNDB 4WF9Q 2PN6A 1NB7A 1P1TA 3MOJB 4N8NA 1OS5A 3GWCA 3UNGC 2BR0A 1LOUA 1C2PA 2QA4S 2M5YA 4IRCA 1I6JA 3MM6B 3MAQA 3OFEA 3UCZP 2GO8A 3LQVA 3QLHB 4PG6A 1WHVA 3KLHB 4DR5F 1HNZF 2E9TA 2MKIA 2D1CA 4PWDB 4YR0A 1S9GB 4NLWA 5SZTA 1PC4A 3N79A 3QGIA 1PC5A 2PT0A 4ED2A 4QWAA 1FKOA 3EXYA 4NLOA 4F50A 3NBPA 2J8AA 4O3PA 1B0PA 2MZJA 2J0XA 1JLAA 5KFFA 4ILRA 5GMKa 3FRZA 5A8WA 3UFCX 3PX4A 4O3RA 1KQKA 2B43A 3DNCA 3TOQA 2UUBF 3M1VA 4JUZA 1IBLF 3IWLA 3JSMB 2IRXA 2DNMA 3FMWA 2EVZA 4OHXA 3GQCA 1N52B 2XS7A 4E0DA 4I6AA 3DLJA 1FTCA 1N33F 5KAKA 2AD9A 1R8AA 2DVIA 2CG4A 2V8GA 4OZ5A 4ECXA 2E1CA 3FMBA 1TFWA 4RNFA 1CEZA 4TU7A 3K0JA 4IOAQ 1DRZA 1M5KC 2ZE2A 3ICLA 1C1CB 5JJBA 1NKCA 3B4MA 1DTQB 2KDOA 2V9KA 4EFAC 2HVZA 3U02A 4J9RA 1SV5B 4M94A 4Y2MA 4IG3B 4TY8A 2ZH7A 3DRRA 3IG1A 4GO5X 5I3UB 4XDDA 3RB3A 2ROGA 4ZA1A 5KG0A 3KK3A 3CCUS 1KQSR 1N56A 1GXLA 2I5JA 2ZC4A 3DOMA 4PG4A 5ITHA 1DTTB 2KRBA 1D9AA 2VPYB 4WZMA 2M0GB 1VHFA 2HPUA 2DNLA 3FZBA 4DQIA 2HQIA 1MMLA 4F4YA 5HLFA 3AJ2A 3OR1B 3FEYB 5BJRA 3AH6A 4C8NA 4OI6A 2DH9A 2HG4A 2Y1JA 1LW2A 3VF0B 1HBMA 2MSTA 4M5DA 2ILZA 2MQLA 2DHXA 2ZOGA 4DL0C 4Z37A 2XMTA 4OZJA 2QIFA 4AFFA 3VAGA 4C2MA 1TK0A 3MM5B 1S6QB 1MNEA 4L3NA 6FDRA 2B5JB 2KYZA 3N5BA 4ID8A 3TARA 1P8GA 3T3FA 1UL3A 3Q22A 4OJHA 4LSLA 1S77D 2YNHA 5IZHA 2FHMA 3QO9B 2HNYB 1Y5LB 4KO0A 2W9BB 1SH3A 2DGSA 5DM6Q 2MKKA 3PW0A 1MMNA 2X1BA 4TN2A 1QVGR 1FDAA 1S1VA 3AHPA 3E2EA 3T9NA 2E1AA 3RYLA 3CB4A 3KJVA 3CF5Q 3HHLA 2CZ4A 2M9KA 1QTMA 2KHDA 5H1SV 5HROB 2E7WA 4YDDB 1KC8T 2W4CA 4ILLA 4XDCA 4DG1A 4LQ3A 1JLQB 3PO5A 3L95X 3IS9A 4QU7A 4KGKA 3HP6A 1TKTA 1S9EA 4Y3CA 3OW2R 1FJGF 2GNKA 4M8LA 2DRBA 1X4CA 1Q78A 1KVIA 1X7VA 3QGPA 4PPDA 3FNNA 5KFPA 5IS2A 2VZ9A 2KH9A 1T05B 2GMLA 1S1XA 3KG1A 1N5VA 4C8LA 1FA0A 4RBUA 1U09A 3KKFA 2HLUA 2RJZA 2QT7A 3OPKA 1KQGB 1HPZB 2DRAA 2R8GA 2OPPA 3TP2A 4URSA 4X62F 3GIKA 2D9OA 4LSNB 3T9ZA 1P1LA 3ISND 3SV4A 1VK3A 4W90B 4QBUA 2GMJA 3G6VA 5J2MB 2RRBA 5J2PB 4RNNA 1CVJA 1U26A 2W7OA 4RU9A 3MM9B 1BQMB 4YOEA 4NLRA 1VFJA 4B9LA 3OJSA 3F56A 1F0XA 3I0RB 4WK3A 4D3HA 3R5BA 3HM9A 2ZITA 1O8BA 3E01B 3OSPA 1YBAA 4MK9A 4OLPA 4B17A 2XGPA 4DQPA 4MAKA 1HI1A 3H98A 1XC9A 3BGRB 4B3SF 2YX1A 3DRPA 3H5SA 3IFEA 4KV8A 2ZH4A 4NLGA 3CDWA 3W2VB 2W25A 2YH1A 4YP3A 3SDEB 2YVSA 4FYDA 3IAM9 2DB1A 1AW0A 2GGPA 3P49B 5KTQA