4M5DB

Crystal structure of the utp22 and rrp7 complex from saccharomyces cerevisiae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
169
Chain Sequence
IEDISAMKNGFIVVPFKLPDHKALPASLHFMFAKRHQSSNSNESDCLFLVNLPLLSNIEHMKKFVGQLCGKYDTVSHVEELLYNDEFGLHEVDLSALTSPRNTALLKFVDAASINNCWNALKKYSNLHAKHPNELFEWTYTTPSFTTFVNFYKPLDIDYLKEDIHTHMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U3 small nucleolar RNA-associated protein 22
publication title An RNA-Binding Complex Involved in Ribosome Biogenesis Contains a Protein with Homology to tRNA CCA-Adding Enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 169
sequence length 187
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12923 RRP7 Ribosomal RNA-processing protein 7 (RRP7) C-terminal domain
B PF17799 RRM_Rrp7 Rrp7 RRM-like N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m5dB01
2RRAA 2RU3A 1JJ4A 3P3DA 1SJ4P 1VQNS 2MSSA 4C7QA 2DNHA 1YI2S 1SJFA 3CCJS 2CPJA 2D9PA 5LJ5Y 5LSOA 1VQPS 3NNCA 1SXLA 2YH0A 2OSRA 2E5JA 2EK1A 4P6QA 3US5A 3S01A 3VAGA 4QQBA 2X1AA 3BO3A 5DDPC 4IO9Q 4FXVA 4Z2XA 4OZ1A 5D78A 1YJ9S 1JMTA 3CC7S 2MZ1A 2JVRA 2OIHA 3HI9A 1P1TA 2L41A 2A3JA 2LEBA 2VOPA 1Q86T 2AYEA 2F9DA 1JJ2R 2MKHA 1OPIA 2YTCA 2MQPA 1U1RA 1NJIT 4IUFA 1VQLS 5DDQC 1OO0B 1VQ5S 3RW6A 1UFWA 3P5TL 2KG0A 5HO4A 3G8TA 2LCWA 2RT3A 4QU7A 4QPTA 1BY9A 3MURP 2KH9A 3CD6S 1X4HA 2BOPA 2JVOA 2QFJA 5EN1A 2DH8A 2MKJA 1O0PA 2M88A 2DHSA 1WI6A 3H2VE 1N8RT 1U6BA 3S6EA 5GAHU 1UAWA 5GVQA 2HGLA 2V94A 2Q79A 2CPFA 2MQQA 2E5GA 2M8HA 1VQ9S 2MY8A 3G96A 2FPHX 1YHQS 1YJNS 3MI7X 4U67Q 2PE8A 1L3KA 2X1BA 4LIRA 4WFAQ 2K8GA 5LXYA 2KN4A 3UE2A 1X4DA 2RVJA 2DO0A 3VAKA 3NNAA 3ZZYA 1A9NB 3VAHA 2KG1A 1VBZA 1U1QA 2XS5A 2DH7A 5IM0A 2MJNA 3B4DA 2CQCA 1DZ5A 3CC2S 4V19X 1U1KA 2YKAA 4YB1P 4IOAQ 2LECA 2E5HA 2DIVA 3CCES 2VOOA 1YITS 1A7GE 2YWKA 2FHOB 2JRSA 4FXWA 2M70A 5FJ4A 2DITA 2MKIA 3PIPQ 2JWNA 2DNPA 3G4SS 3CCRS 2G0CA 1H2UX 1M5PC 1S79A 1WF2A 2HYIB 1NU4A 1XN9A 3DXBA 3J7YU 2CPZA 2HVZA 2DISA 2I2YA 2N3OA 3MDFA 2U2FA 4RU2A 2KVIA 2M7SA 2MKKA 1D9AA 3CCVS 2MZRA 3VAMA 2DNLA 2OJ3A 2KYXA 2FY1A 3SXLA 3S7RA 2DIUA 4TU8A 3CCMS 2YH1A 2DK2A 2DNZA 1YWXA 1M5OC 1WHWA 2J8AA 3VF0B 1KOOA 2VONA 4UQTA 4BS2A 3LPYA 1FJEB 4CIOA 1YJWS 2I38A 3CULA 2CQ2A 2AYMA 5IM0B 3NS5A 3NMRA 2KRRA 2QA4S 2CQDA 3UD4P 2U1AA 1W2BR 3IWNC 2MYFA 2MQLA 1P27B 2GHPA 3EGNA 4WKRA 1R8PA 2NLWA 3TYTA 3P49B 1VC0A 2MPUA 2F9JA 3EX7B 2X1GA 4EGLA 4WFNQ 2FC9A 4ED5A 3N9UC 1FT8A 3Q2SC 1X5SA 3UWTA 2MQNA 3G6ES 2VODA 1URNA 2MKSA 1U1NA 3D2WA 3UCGA 3UCUP 2JX2A 1X5TA 1HD1A 2L9WA 1SJ3P 4WCEQ 3G8SA 3NS6A 3P6YC 3MOJB 1WELA 3PIOQ 2M0GB 1UP1A 1WG4A 2DGOA 3OW2R 1S72S 2DHXA 2O3DA 1ZZNA 1CVJA 1FO1A 1M5KC 4CH1A 5GADU 1Q81T 2AYGA 2DB1A 2MMYA 2KI2A 1NO8A 2AD9A 1QVGR 3U1LA 2GO9A 2ERRA 2MZJA 3RW7A 1QVFR 1U1LA 1X4EA 3U1MA 5CA5A 1WHYA 1YTYA 3ULHA 3UD3P 1U2FA 2LA4A 1U1MA 2QEXS 2X1FA 2ZJPQ 2CPIA 5GAGU 3R27A 4YOEA 5HL7Q 2J0QD 3R1LA 2RQCA 1M5VC 5LSLA 1UW4A 1PGZA 2XSFA 4QU6A 1U6FA 5DDRC 1G2EA 1M1KT 1B7FA 1K9MT 3ZZZA 2DNNA 2DNQA 2J0SD 2XB2D 1Q82T 2N3LA 5CYJA 1KD1T 2MZSA 4ERDA 1H6KX 1JJHA 3J7ZT 1WI8A 3UCZP 1VQ4S 4TU7A 2KT5A 2EK6A 3CMAS 3SDEA 1HD0A 2CQBA 2OSQA 3LQVA 2LQ5A 3BEGB 2E44A 3CCSS 2BZ2A 2RS2A 1HA1A 1X4AA 1FNXH 2MJUA 1VQ7S 3G71S 1KQSR 1IQTA 3Q2TC 1RKJA 1X5OA 3NNHA 3B4MA 3MXHP 3BO2A 1ZZFA 2WBRA 1WHXA 2EVZA 4J5OA 1WG5A 2RQ4A 1X4CA 2KRBA 2XS7A 2HZCA 2LMIA 1WF0A 2MGZA 4WF9Q 1AUDA 2DNOA 1ZH5A 1KOHA 5DDOC 2LXUA 2DGQA 2KM8B 2M2BA 2MQMA 1F9FA 3JB9k 3VAJA 1FHTA 2XNRA 3S8SA 4PRFA 1FJ7A 1VC6A 4TLQA 1X0FA 3VAFA 1U1OA 1X5PA 2OTJS 2NZ4A 1X4BA 3VALA 2HGNA 2F3JA 5DM7Q 2DHAA 2N82B 1DRZA 2LXIA 4YUDA 1PO6A 5GMKa 2MXYA 3CTRA 1WWHA 2RNEA 1VQKS 2DNKA 2MKCA 3TO8A 2LEAA 3V4MA 3CUNA 2XNQA 1K73T 1H2VZ 3G9CA 4OZ0A 2D9OA 3SDEB 3CPWR 1K8AT 2MY7A 2KHCA 3MD1A 3MD3A 3CXCR 2KFYA 3VAIA 5IQQA 1Q7YT 4A8XA 2CQ1A 1X4FA 2FC8A 2KU7A 3FEYB 4WIIA 5JVHQ 4W90B 5JVGQ 4W92B 4PKDB 2CJKA 3MUMP 2M9KA 2CPHA 2DGWA 1DBDA 2CQ0A 3FEXB 1VBXA 2HGMA 1SJRA 2M8DB 2DO4A 2MGZB 2K3KA 3CCQS 2G4BA 1N88A 1KC8T 1WEXA 3IRWP 5LJ3Y 2LKZA 2MZTA 4IOCQ 2MB0B 2RUGA 2DHGA 3DLLQ 2CQ4A 2MQOA 2KXNB 4F26A 4F25A 2CPDA 3R1HA 2M4MA 2CQPA 4LJMA 2CQGA 4PR6A 5IFMA 1VQ8S 5MLCV 2MSTA 2MZQA 3EGZA 1WTBA 2AYBA 1WG1A 5GAEU 4WFBQ 2ZJQQ 2N7CA 4C0OC 2LYVA 5D77A 2MHNA 2DGVA 3L3CA 4M5DB 1RK8A 5LXRA 5ITHA 3CCLS 1VQ6S 1VQOS 1VBYA 5BJRA 2KM8C 2OTLS 2D3OR 1M90T 2DNRA 2DGXA 1FXLA 3CCUS 1VQMS 1VC5A 2CQIA 1WHVA 4TU9A 2G1DA 1WEYA 1FJCA 2DH9A 5DM6Q 2CPXA 2L08A 2RS8A 1X4GA 3BO4A 2ZJRQ 5CXTA 2CPYA 1OWXA 2DNMA 4LMZA 3BS9A 3TP2A 3I55S 3MUVP 2ADBA 3CMES 1SJQA 1QM9A 3HHNB 4F02A 2DGUA 3MUTP 2DNGA 2CQHA 2CPEA 1YIJS 2J76E 1WEZA 3SMZA 2E5IA 1D8ZA 4CQ1A 2B0GA 3THTA 2KXHA 1H2TZ 1N52B 2DGSA 3CC4S 3CF5Q 3I56S 3THPA 2ADCA 2DNYA 1OIAA 2UP1A 1DHMA 1WF1A 2LA6A 4ZKAA 1U1PA 2CQ3A 2XS2A 2DGTA 4C4WA 1R8HA 2PEHA 2SXLA 1HL6A 4CH0S 4UY8T 5H1SV 3H2UB 2KXFA 4Y00A 2M52A 1N54B 2RRBA 3K0JA 4Y0FA 5DETA
chains in the Genus database with same CATH superfamily
1R0AB 5J2QA 1SJ4P 3MM8A 4CT9A 1CS4A 1JLEA 4K8RA 4RU9A 3CCTA 4MFBA 3QZ8A 3OTDA 3UVJA 4KB7A 1NK9A 4QQBA 3BO3A 3RBXA 3UDEA 1D8YA 2ASYA 2GMLA 4O3NA 3CC7S 2JVRA 5C2CA 1XR5A 1SC3B 2RSQA 3OQ2A 1U1RA 2CG4A 5F41A 4FYWB 1RT1B 2Y1RI 3B82A 4GMKA 2AU0A 2KG0A 3LTOA 2LCWA 2IBOA 4QPTA 1AA1B 4Y65A 1NPRA 3H5UA 3F73A 5J2QB 2EWHA 2YNGA 1HKAA 1CS4B 1JLEB 3E01A 4MFBB 5HP1A 2GFFA 3CMQA 3OTOJ 3UVJB 1JLGA 1KLNA 4JV5J 3MFIA 2EI5A 1T9UA 3ENVA 3EJMA 1CJVA 1N34J 1W26A 4KO0A 3BKUA 3SSSA 4N56A 3CC2S 3GIJA 2B7CB 2XI3A 4DPUA 3PEJA 1Q8KA 3FDSA 2I8EA 2HMIA 2HPUA 5B0CA 1SVDA 1A7GE 2H54B 2YQ1A 1T3NA 2MKIA 4P2SA 2VUGA 2QTWA 3R5JB 3VWSA 2YNGB 3GG1A 1XBWA 3E01B 1Z2LA 3MEGA 2UXDJ 5HP1B 5MAOA 3VAMA 1JLGB 4RWXA 3ZTOA 3IBCB 4AXJA 3QMQA 1CJVB 2IDEA 1FJEB 4KO0B 2CQ2A 2AYMA 4AL5A 2BMBA 4NE9C 1KN6A 1JNZB 4DR1F 4DV5F 2HMIB 3K2YA 2QN6B 5KT5A 5K8OA 1R8PA 3FKBA 2ZEJA 2FC9A 2K06A 1NDLA 5C5JA 2G0JA 1IBMJ 4A8KA 1KHWA 4Q2MA 2BE2A 4J9UE 3MEGB 3UCGA 2GCFA 1NCLA 1RAAB 1ZA2B 3PYGA 2W9BA 4ZVEA 3IXQA 2LDYA 2B4PA 1WELA 1IXKA 4KGVB 3MMBB 4L74A 3MTJA 2GQ2A 3TUZC 1OSDA 3IS9A 4PQUA 2O3DA 5FD1A 2BM0A 2R7SA 3IR6B 2HIYA 1U1LA 4DU7A 4O4GB 2J0WA 3A3OB 4XIUA 3M8WA 4WXWA 2FJVA 2JLFA 2UUBJ 1B7FA 1K9MT 4DZDA 2BE2B 2VPXB 2W9BB 5DG7A 2OSQA 4J9MA 2V8HA 5HVGA 3IS9B 3G71S 2K1RA 4MIBA 4M95A 4TY9A 2UUCJ 3RR7A 4KV8A 4RNOA 1Q4RA 3B4MA 3MXHP 1U09A 2OP5A 2FZCB 3OL6A 3WBZA 3BDPA 3JB9k 1YX2A 1T9XA 4KIAA 3CGIA 1SCJB 1IM6A 5HMWA 4KAIA 2EKYA 3V4MA 3CPWR 2GGPA 4XPEA 3DLHA 4LREA 3T1YJ 2HSEB 3CJ0A 9ATCB 4UTGA 4C9DA 1MWZA 3ILIA 1S9EA 1M1GA 1N88A 2HAFA 4OFZA 4YB7A 5L38A 1WEXA 3JAMU 2E29A 4OYBA 4U7UD 4LRBA 2CQ4A 2ZKUA 2QSFA 5EWGA 4F25A 1FK9A 4W4MA 2HNZB 3ZXWA 5F8JA 2JLGA 2ASLA 3GU0A 4USTA 2GGPB 1NJZA 4CLKA 4TY8B 1EAYC 4YR0A 1U47A 4MKYA 2V67A 4OHVA 5KFEA 4F3QA 4FF4A 4PEOA 1WC5A 2ZH6A 1GXTA 3SSQA 3UNGC 3HHNB 3MPDA 4NYOA 2ZE2B 4HR2A 5J2MA 1S9EB 2YWWA 2Z30B 2IRYA 5L1LA 3W5XA 1JB0C 1SV5A 1FK9B 4Q0BA 3VZIA 5L9NA 2IVFB 5J2NB 1RT4B 1L5UA 4C3MA 5H1SV 4P7VA 2CDQA 2QGFB 3BGOP 2XMKA 3PFOA 4NLDA 5KT4A 2R4FA 4F4AA 4JUZA 3N4WA 5LSOA 5J2MB 2GVZA 1HNZJ 4P9SA 3FNNA 2IVYA 1AT1B 4Q0BB 2ZBCA 4FVMA 4OHXA 2HBQB 1RZMA 5ETTA 3MWBA 4NRUA 1XTZA 2RH3A 3GJRB 3HFVA 1OO0B 3UNYA 2XHCA 2LQJA 4X4PA 2OELA 5AJ3F 5LT5A 2WBMA 1FJGJ 2LU2A 2DY9A 4C2MA 1T7PA 2AF6A 1VRTA 2VB6A 1WI6A 1LWXA 5KFSA 5HMXA 1LWFA 1UEUA 3TUPA 2R7UA 2GVZB 4MH8A 3IMQJ 2NXUA 1RAFB 4RW8A 4ZPBA 1UCNA 4MKVA 2KG1A 4Q7AA 2Z0GA 4V19X 4FKXA 2UU9J 1Q78A 2VOOA 1IWAA 3GV7B 3UQSA 4BHQA 2JRSA 2CJAA 3HXMA 1T3OA 1VIXA 4O3PA 3HULA 1H38A 4C11A 1VRTB 3OFFA 4DF4A 3DXBA 4WK1A 1LWFB 4TKTA 3W5YA 2OJ3A 3CB4A 1Q95G 4LBIA 3CO0P 3J80U 2IMWP 2GMJA 2DIUA 4RW8B 4TYAA 2ATCB 2VONA 2IM0A 2JFDA 1FDAA 1FEHA 2EEYA 2J9EA 2NR0A 4ILLA 4EBCA 4CO2A 1U49A 2XULA 1YQHA 4TLRA 3ZZTA 3TYTA 2XMUA 1WC1A 1U2CA 1Q5VA 4C11B 5DS7A 3MFHA 1PBAA 2J8SA 1HQUA 4FF1A 2HLUA 2JFKA 2H4WB 5T7LA 2LU1A 4LSLA 4ZVTB 3B78A 3HHLA 3HHLC 4DSKA 2O01C 2VV5A 3GG0A 2R7VA 2MMYA 3I31A 5KG6A 2MZJA 4YDXA 4DUYJ 3ULHA 4KGZB 4FNHA 2BQRA 4Y34A 3QRRA 3BQ1A 4QU6A 3EZ5A 3JAMY 1HQUB 1EETA 3EVOA 1WI8A 1MWQA 2B5JA 3DRPA 4DR6F 2RF2A 5T7LB 4HKQA 2RILA 2DTJA 3LQVA 2OD6A 2LQ5A 4LSLB 4F2SA 1LEOA 4DL3A 3FZBA 1KDNA 2YQ0A 5D15A 3D66A 4USWA 4RW7A 2YWHA 4L72B 1FKAF 2XS7A 3H20A 2XCAA 2WSEC 4OHYA 5L1IA 2DGQA 2VQEJ 2XNRA 2HHHJ 3CO9A 2E5LF 5LOQA 1NK4A 2ATLA 5D4OA 5LMUJ 3RYLA 4WTOB 2HGNA 3IWXA 3A8IA 3DRPB 2RF2B 4X65J 2P9EA 5HLFA 4KFBA 3HVAA 3EZUA 3QRPA 4QYZK 3CJ8A 1RTIA 4YHHJ 1VRQC 4W92B 4URSA 1KWMA 4RW7B 3ENQA 4KHPJ 1B0TA 3TA1A 3W3SA 1C4CA 2QE5A 2VH7A 3PHTA 1KONA 1HPZA 2UXBF 3G2XA 4FBTA 2XQCA 2VPWB 1ZYQA 4ZMMA 4QYRA 1PJ6A 5HLFB 4QIFA 4KFBB 2ZH9A 5KOWA 1PAUB 3KJVA 1RTIB 3PKYA 1IKWA 4M63A 4UOFA 1H0HB 2XZTB 4EEYA 3WDOA 5KFHA 4GVBB 2HHXA 1SJQA 3EVWA 2A1BA 2H51B 4LRAA 2RHSB 4ZP6A 3HP6A 3Q8SB 1D0EA 2BKNA 4EFAC 5HMYA 1Q53A 4ZJLA 1OY8A 2OKQA 8ATCB 4KBIA 1RXOB 3KJVB 4DSIA 2JHEA 3D5MA 4G6VB 4DUZF 1IKWB 3DLKA 2HKEA 4NL5A 1SJFA 2GHVC 4HHHA 3ENWA 4ECVA 1JLBA 3PYFA 2DR8A 4ENOA 2YKOA 2IJRA 2IJFA 2Z2LA 2OIHA 3KOAA 2A3JA 1NZ8A 5GAGI 3OR1A 1UFWA 3OLAA 4WP9A 1L3SA 2GNKA 2UUTA 2QFJA 1O0PA 1NHVA 3CJ4A 3DLKB 2J9DA 4CWBA 2DBBA 2MQQA 2ZZTA 5D0HA 1JLBB 2C22A 5D0GA 5FLXU 1NLKL 4OI0A 2NPIA 1QTNB 1U1QA 2VJVA 3B4DA 4YB5A 1DZ5A 1P9QC 4V1Ak 4ED4A 1SL2A 1LXJA 1DLOA 1O51A 3KHHA 3OR1B 2QLFB 4DLGA 4FXWA 1XNRJ 4WZMA 4MKBA 2R3VA 2VBZA 2W7AA 2G0CA 2GAHC 1GK8A 3O8WA 2HVZA 2FD2A 3CW2C 1EP4A 4FZVA 2Y1LB 2GVDA 1FRLA 3PX6A 4LFAF 2BRKA 4FYVB 5HAOA 3KK3A 1R7IA 1OMSA 3HX9A 3W9IA 1R0BG 4DPXA 2FUG9 3D6TB 1XR6A 3EXYA 2V8DA 2GJIA 3PR4A 2CIMA 1KQGB 4N76A 1X60A 3M8RA 4NLPA 2MEWA 3PX4A 3RTVA 2NLWA 1JXVA 4KRWA 3U1NA 1T95A 3N6NA 3EX7B 2P6TA 4JI5J 3MPYA 5E41A 3T5HA 1DARA 3UCUP 4G1QA 2GVDB 1D1UA 4DX5A 1V3ZA 3KK3B 4M5LA 4ZCIA 1XQIA 3L9ZA 1WG4A 2WW8A 2PT0A 3OW2R 2V63A 1S72S 4DS4A 4Y2CA 4RPFA 4IO1A 3BSOA 3ET6A 2ZDOA 2AYGA 2W25A 2C2ZB 2ZITA 1QVFR 2APOA 5KAKA 1W7WA 4ZLNA 3GYGA 1I94J 4I2QA 4DV6J 4O44B 3MMJA 4F04B 3MPWA 4ERDA 4G1QB 5L9XA 3MHYA 4DR7J 4YN3B 1O6XA 3SDEA 1N4LA 2FHKA 1NSQA 1X4AA 3ZO7A 1SC1B 3OJUA 4DDFA 2BQ3A 1RKJA 2BRLA 4NCGA 3ET6B 1Q7LB 2RQ4A 4B17A 1ZH5A 2ZNYA 3W66A 4L3KA 5BR8J 4I2QB 4ED1A 1RTZA 1U1OA 2HHTA 4JB8B 5A8KA 3AFGA 3CTRA 1RJJA 3E2EA 2HS4A 1FA0A 2B8PA 3SDEB 4F0HA 1S1TA 3OR2A 4PPDA 4JI1J 5G4DA 4X64J 4TXSA 1HWLA 1U24A 4NCGB 3RUBL 4QWBA 1HMVB 4UF4A 4C8MA 2DGWA 2NXEA 5H9FK 5K14B 1SIZA 4LF1A 5LJ3Y 2LKZA 4DPTA 4ZPVR 1NPPA 3IA0A 2ZM6F 2CQGA 4OYWA 2K7KA 2EFNA 1SH3A 1YRXA 1YRUA 2HAIA 4DR4F 3HD2A 2Z57B 2J0XA 3CCLS 1S1TB 2C2MB 5KG3A 3OR2B 2DGXA 2BA9A 1HI8A 1WD6A 4LUBA 1WKLA 2RDDA 4DFKA 2L9NA 2PC6A 2EC0A 3QGGA 2BQUA 1YIJS 4DL2A 3J81j 3OJSA 2C2DA 2JDJA 3IO1A 2VIHA 2LVWA 3IM9A 1V3SA 5FLXY 2W24A 2GZOA 1PG5B 4KHRA 3ICLA 1ZS6A 1OY9A 1B64A 5GMEA 2HK3A 5JMNA 1U8WA 2DGTA 2Q43A 4DLEA 4K2JA 3IBFB 3V81A 2ZHAA 4KSEB 1X0PA 3PTWA 3A1YG 3G6YA 2XMWA 2CFXA 3AJDA 4KGMA 3FEZA 3KHRA 4OZ1A 5L1KA 3FRYA 3HPOA 2Z4PA 3PZPA 2LFVA 2MQPA 2XMMA 1VQLS 4DL7A 3HDSA 4M94A 3WZ0A 3V81B 2KH9A 2BOPA 4H4MA 2B51A 5AXNA 1IBKJ 3BJYA 2AKWB 1UVLA 1RT5A 1N5TA 2DXDA 2V94A 3GYNA 3BPDA 3EXCX 3N5BA 3W7BA 5KG2A 4EWTA 5B0BA 5CZVA 4CLFA 2KN4A 3MAQA 4QR0A 4ID5B 4JI4F 4OV6A 1P6TA 2A2DA 2L48A 2DVIA 3QAUA 1GMVA 5L39A 1TR0A 3E51A 3KJNB 3VQSA 4OI2A 2DEIA 2YWKA 3I5BA 2XLKA 4HI1A 5DQIA 3CD7A 4H4MB 1XMQJ 3CCRS 4F50A 4F0KA 1BHNA 2R2SA 1RT5B 2N3OA 3KYLA 1SBRA 3DI6A 3PYDA 2M7SA 1XJWB 2UXCF 1P1LA 4EYIB 3AY0A 1KOOA 2H3EB 1PYOB 2I38A 2ZBQA 3N28A 1S4FA 2MQLA 3OSNA 4NXNF 3KHGA 1RT6A 1URRA 1YK9A 5F8GA 2F9JA 1RWNB 4OHZA 3JSRA 1HBNB 1RTDB 3DI6B 3D2WA 4DR3F 5KFWA 1X5TA 4BCAA 2D74B 2OPPA 3QSIA 2WVCA 3KDNA 2DHXA 1ZZNA 1CVJA 1M5KC 4YY3J 3Q8YA 2Z2MA 4P2XA 2GO9A 3ZZPA 1KHVA 1TKZA 3U1MA 4CLSA 4KY3A 4QW8A 1RWOB 3RB4A 3OTBA 1RT6B 4WFYA 2RQCA 2IA0A 3ENAA 4NLTA 4DR2F 3AOAA 2HW3A 2H1YA 1UVJA 4JI8F 1PJ7A 2HFZA 5THWA 5DJBA 2N3LA 5CYJA 4A8SA 2QO3A 2AX0A 3JQMA 1ZBTA 3W9HA 1K1QA 2OPPB 1OQ3A 3SCLE 3M05A 5KFXA 1I6JA 3MM5A 3U7JA 1R3NA 2F8HA 1B3TA 3D6MB 4GKKJ 1TKZB 3PY8A 1ZETA 4IRDA 2HFOA 2V9KA 4JI7F 4DV2F 5ETOA 3VHQA 3L7OA 1X9SA 4OJ1A 2XLJA 3RR8A 3R6GB 3QT8A 1X4BA 1S57A 5JJBA 2LEAA 1T8EA 5EUHA 3QSYB 3G9CA 3CD5A 3PV8A 2X51A 1YBTA 5EX0A 1RWPB 2AJ2A 3MM5B 4OJ3A 2R7OA 4LQ3A 4Q5VA 3KLHB 1Y10A 3PW2A 4OZ3A 2CG8A 3FEXB 3W5ZA 3H4BA 1VBXA 2HGMA 4BLGA 3NGSA 4GKJF 2WOMA 3VVUA 2ACMA 4MTPA 2ILZA 2R2TA 2C2RA 4OI4A 1MWYA 3J81U 1SQGA 1UVIA 4KE5A 3RRKA 1QDUB 4MK9A 3G6VA 1RWXB 1N0UA 1YVFA 1RK8A 2AX1A 2CZ4A 3DOLA 4ZVSB 2WRMA 2VC0A 4WP8A 3VVTA 4A8OA 4KT0C 1J5EF 5D8HB 1HNWF 4X4OA 3F0NA 2VA3A 1JKHA 4CLLA 3DN9A 4DL4A 1NSKL 2W1BA 1RISA 3NCPA 2OPSB 3I55S 3MUVP 3JSMA 4P2MA 3CMES 3DMJA 1TKDA 2D3ZA 5B0EA 3MUTP 1RWMB 2WOMB 4AQYJ 5DG8A 2DR6A 4OX8A 2C2NA 1D8ZA 3JSYA 4Q43A 2DPJA 3EDRB 1RU1A 2WCXA 2IRUA 3CT9A 3KJQB 3M2RA 1TL5A 3DOLB 3HMJG 3KJFB 3H40A 1C1BA 1FESA 3TUIC 4Y0FA 1VLYA 2KYZA 2RRAA 4KPCA 1JKHB 4ED2A 1FWPA 3JSMB 2NCKL 3DMJB 2D9PA 5J1EB 4CLUA 2V2VA 5GADI 1RA7A 1ITPA 2X3GA 4K5RA 1VLOA 1HLWA 3M2RB 3GMGA 2BKOA 4IUFA 3GSIA 1C1BB 4J9LA 1GMWA 2YPYA 1CJKA 1KEKA 2AEMA 3H2VE 3M1VB 2BKPA 1U4BA 1RAIB 1TAUA 3DLBA 3O5TB 3ILLA 3M30A 3UN3A 2KKHA 2IBKA 1YJNS 2PE8A 3DOKA 3LAKA 5SZTA 2IA6A 3OTEA 3VGUA 1SQFA 1MROA 1P8GA 3KG4A 4RBTA 3EPGA 1LWEA 2B9YA 4X4RA 1PBUA 5KFVA 3TJAA 4LBHA 4E98A 1VISA 1H2UX 1CJKB 4DG1A 2ZC4A 1MSWD 2I2YA 5C25A 2VDHA 3M8YA 2U2FA 4M5MA 3MM9A 4CT8A 4KYZA 3M30B 2ZOGA 3NGKA 4YB6A 4ZPTR 3DOKB 1N5SA 1FRJA 5JUMA 3OL9A 4PG5A 3CULA 1MROB 2HNDA 3MGJA 1TK8A 1LWEB 3BBFA 4DX7A 1NPKA 3UI3A 5GAEI 4QZVB 1VJQA 3BPSP 1BLUA 5KFAA 2MPUA 4ED5A 1DJ0A 1TAQA 2PGCA 4DG1B 3BSNA 5C25B 3MM9B 1I5OB 3G6XA 4J9RA 1UEKA 3PIOQ 3U27A 1HBOA 3CSKA 2C3UA 3VGTA 2G2ZA 4USHA 1H74A 3SV4A 2HNDB 3I0RA 3DLGA 4X2BA 4L6V3 1IKYA 1WHYA 1YTYA 2FJEB 1IBCB 1R89A 4YOEA 1XR7A 4V19J 4N47A 1U6FA 2K7JA 5KT6A 5F8NA 1YRTA 3QFHA 3UCZP 4PG6A 2FJBB 3J81Y 5L46A 4WP3A 1HWIA 1EHWA 1HBOB 4NLSA 2W2NP 3Q2TC 1KVKA 3DLGB 1IKYB 2IPOB 2KRBA 4RZRA 4DV1F 1UJ5A 3R7BB 3GSDA 4OIXA 3A8KA 3GFXA 1I51B 1JWWA 2W4PA 4FS1A 5DM7Q 2WONA 1RP5A 1DAXA 3NGTA 4IH5A 1H2VZ 1NJWA 2YVSA 4NLWA 4W90B 1DURA 2DD8S 5HSPA 2FLLA 4ZCKA 3ZTSA 3OFGA 1WJ9A 2C3PA 1ZTWA 2ZH7A 2C2OB 2JC0A 2PSZA 3LWMA 1N32F 1VRUA 4ZVOB 4DN0A 3D9BA 1FRIA 4U7CA 3BYRA 2KJWA 1TZ0A 4QIVA 2CZVC 2WONB 1HBMA 2CXEA 1V5IB 2DRDA 3L95X 2B9XA 2D3OR 1M90T 1S6QA 2WW4A 3FMBA 1UZDA 4C3LA 3TARA 3KK1A 1VQMS 1VC5A 4NLVA 4CDIA 3T9NA 3TRGA 2XO6A 3VGVA 5A0YA 2RQKA 4F02A 3RB3A 1RAEB 2CPEA 4OX9F 3R9LA 1JLCA 2BW7A 1VRUB 3PR5B 3SCKE 1WEZA 2AZ1A 1VOMA 3TQEA 3CC4S 1YJVA 1HBMB 2ADCA 1ZM2A 2UVVA 1RCOB 2CNKB 4RJVA 3QJJA 1S6QB 3D0HE 3UDCA 2WB4A 4WF9Q 3C66A 3BH7B 4ATNA 3SQGA 4LVOP 5A0YB 3NGDA 3DLEB 4J37A 3HHEA 3KDOA 1SXLA 4F4YA 1Q8IA 3US5A 1JLCB 4IO9Q 5KFNA 4FXVA 2MQ8A 3MEKA 4PXDA 2IYIA 3UN5A 3X3UA 5LM7E 4RR5A 5HANA 4IRCA 5DDQC 3DOMA 1SKRA 4YP3A 1QSLA 3MURP 1VBKA 2V34A 4N77A 3SQGB 3MPVA 2GIRA 2KL8A 3KG1A 2NUHA 3HCXA 3QPIA 1L3UA 2OFHX 5KG1A 2ZBIA 1OY6A 3PXGa 4ED8A 4K2XA 3LWLA 4ICLA 3L4BC 2VPYB 4HDGA 3F56A 3DFEA 3ISNC 2DH7A 4RBUA 5K8PA 2QL7B 3CCES 3DOMB 4NX9A 3GYXB 4XK8C 3DRRA 3HHKA 4U96A 4J91A 2FB0A 5LMNF 3SV3A 4UZBA 3GFZA 1PILA 4R5PB 3WX4A 2DISA 3QO9A 4K0KF 2KYXA 2FY1A 2VICA 2DK2A 2DNZA 4DR5F 4I68A 4ICLB 1M5OC 4UQTA 8AT1B 2H4YB 3DU5A 4NA1A 2CUYA 1N5YB 2EG2A 4DQSA 4O3QA 2JEFA 3K5MA 3EGNA 4UT4A 3QATA 2BJ8A 4PXBA 4WKRA 2CJ9A 3DRRB 4NXMF 2CKWA 3TQ1A 4EI2A 1RT3A 3Q86A 3GCWP 2H65B 3UWTA 4DF8A 2AJQA 4Y3CA 2D41A 1IR2A 3QO9B 3MMAA 2JX2A 4WIQA 1J2VA 1FXDA 2BANB 4TQSA 2A18A 3I5CA 4Y6IA 4O23A 2FZKB 4FVCA 4OJHA 3BREA 3QGHA 1F5AA 3CDAA 3OTOF 2OMOA 4WFXA 4LF6F 1ZOTA 2ZJPQ 3D68A 4PZVA 4JV5F 4FP9A 4CH7A 1RT3B 1Z4UA 1N34F 3K57A 4RNMA 1NM2A 3NGUA 4DR6J 1W2IA 1JJHA 3MMAB 3CJQA 4TU7A 3W9JA 3N79A 3CCSS 1FRKA 2DXEA 2XSJA 4MIAA 2KFZA 2UXDF 4TYBA 3N0VA 1B4SA 3BSCA 3H5YA 3OL7A 3GIKA 3MPUB 1CPZA 3RAMA 3WC2A 2E5LJ 4UY85 2NYIA 1N56A 2DPIA 4PRFA 4LF7F 4QWEA 3D54A 3PW4A 4OI6A 4NEZA 1S48A 4G1PA 4ILRA 1DY3A 2KU7A 4U9RA 3BH6B 4ES3A 1Z2ZA 4LF9F 1WOOA 1N0VC 3JS9A 1HHQA 1S9GB 2XY5A 3TA2A 4FBUA 3IG1A 2N4DA 4DSJA 4J9NA 2MZTA 5CHCB 3DLLQ 1AUSL 4F4WA 3E8OA 1K47A 3SYZA 1C2PA 5E3RA 4ZIVA 2OEKA 3JQKA 2DGVA 3DYAA 1TL4A 1TKTA 4PUOA 3TAQA 3AODA 2UVRA 3FJ2A 2YX4A 2HBYB 3EYZA 1REVA 1HW9A 1U45A 2OEJA 2BJ3A 3QZ7A 2HVIA 1J27A 2E66A 1NSAA 2F40A 3C6TB 2PFDA 1T11A 3JQJA 3DM2A 3IG1B 2UVWA 3NCQA 4Y2KA 3UO0A 3ONQA 2UUCF 3ZTQA 4RL1A 2W8LA 4KQZA 3DYAB 2FY8A 1TKTB 3D6HB 2F5GA 1GX5A 3H2UB 4DUZJ 1GTEA 4A8MP 1REVB 1IKXA 4CNZA 1O8BA 3HSJA 3FZ2A 1YI2S 1Q8BA 1D3WA 4M1KA 1PCAA 3N6MA 4A47A 2EK1A 3ILOA 3AAWB 4NCAA 3T1YF 3W64A 3MR3A 2GAGC 3AD9C 3ZTPA 3D67A 4FF2A 2HWTA 1M0SA 1OPZA 2YTCA 3I6PA 4NA3A 5D0RA 1H3DA 1X4HA 3G86A 4ALZA 2JVOA 1KRPA 5CCLA 1IKXB 3BKTA 3R5GA 1N8RT 1UAWA 3TAPA 4DQQA 1RTHA 3M8PB 4P10A 4DSEA 3RB0A 2JEIA 1T02A 4WFAQ 3FGVA 3VAKA 2DO0A 1UETA 4XTTA 3VR1A 4Y28C 3ELHA 2OH2A 4YB1P 2Y8YA 3N01A 3PFEA 3TEGA 4ZJQA 4I7FA 4DCOB 3H0PA 3T41A 3NKYA 3KG0A 2XY6A 1NU4A 1WKKA 5KFIA 4LFAJ 2HRYA 5F3TA 1RTHB 1ACMB 3CCVS 3DDNA 3DHXA 4B3RF 1Q8LA 1WHWA 4PWDB 5IT9U 1FWLA 3NS5A 3GV5B 4I1TA 4K59A 2CQDA 4M8LA 1R0CB 4CM0A 1BQXA 1TL1A 1HNZF 4C8NA 1IQZA 5KFJA 1XNQF 3FMWA 3G6ES 1X31C 2G0IA 5F8LA 5IT4A 4WPAA 4B9NA 2HQDA 1SL0A 1GXLA 1L3VA 1KQKA 3EM1A 3OVSA 1KNZA 4OYMA 2D1CA 2CNOB 1UP1A 3HLUA 1TV6B 3GIRA 1RCXB 1U7LA 2RB7A 3K5OA 1FD8A 5E5NA 1QVGR 1X4EA 4C0HA 1U2FA 1IVZA 2ZBPA 5GAGU 3LP2B 3BR8A 3R7NB 1NEEA 1EIYB 4CCHA 2HQIA 1IBLF 1KD1T 2UU9F 1RHMB 1N36F 2CQBA 3BQ2A 1IR0A 3JYTA 1WUUA 4HEA9 2X7IA 1MLAA 2BEFA 4LVNP 1O5JA 1I3OB 3GZ7A 3IAM9 2EVZA 2K3IA 2BE9B 4OHWA 1IR1A 1T9TA 3MMCA 2VZ9A 1RLCL 4A4JA 2FHMA 2KM8B 3LUYA 1HWKA 2VG7A 2H5IB 2GIFA 1FJ7A 3U02A 4PPZA 1NBEB 2ZUAA 2F3JA 5M2RA 2C3MA 4J9OA 5CCMA 4P74A 1VQKS 2XGQA 2Y8WA 3I0SA 1XK8A 3JYTB 5CYMA 3IR5B 5KFOA 4F4ZA 3NBPA 1Q7YT 1EQMA 4WIIA 3LANA 4LRDA 3V6HA 1BUXA 1UVKA 4HLBA 5JXSA 1GT8A 4AXIA 3MMCB 3UDLA 3PG9A 5J1NA 3CJ3A 2ZM6J 3KNAA 1N6QA 1QY7A 3HHDA 1HBUA 1F5CA 1ZAVA 3MM8B 3W60A 1VQ6S 1YJTA 2QMXA 4CNYA 2FLPA 3I0SB 3TWZA 2DNRA 3PX0A 5CYMB 3T19A 3NBPB 2CPXA 3EGWB 3I82A 5I3UA 1TMMA 1TUGB 1S99A 4D3HA 4F3OA 2P9CA 4CTAA 3KLVA 3QT6A 4PXEA 3D6FB 2HS0A 1N6QB 1FXRA 3OTCA 2KVQE 5J2PA 3W8GA 1HBUB 1LW2A 2FYXA 1TL3A 3CE8A 2EFGA 3MCSA 4DFPA 2BM1A 2KXFA 5E3AA 4DV0F 1F2GA 3DCAA 2EPIA 2JOQA 5LMUF 4O0IA 2V4JA 5I3UB 2XWXA 2V8PA 3W2WA 1WOSA 2PI5A 5HQMA 4I67A 3C15A 4LT6A 3UR3C 4X65F 5HROA 4CTAB 3VAGA 4ZVGA 1SIWB 3T1AA 2PEBA 4YHHF 1JMTA 4LRCA 1UJ6A 5J2PB 2MZ1A 4AYBD 1UMJA 1LW2B 5I3PA 1TL3B 1X7VA 4URQU 1OPIA 1R8AA 1NJIT 4UOGA 2R7XA 4KHPF 1CC7A 2J9CA 4QR1A 1LW0A 3CJ5A 4MK7A 4CO3A 2JEGA 4N8NA 3S6EA 1MU2A 3W2WB 3HF5A 3O44A 1FFGB 3C15B 5HROB 2IC3A 4C97A 2OLWA 2MTLA 2RQMA 3K8VA 3C46A 3CIZA 2FVQA 3QLHA 4WU2A 2XYHB 2F8MA 2W01A 2I6WA 1T94A 1NJYA 4XO0A 2ZH8A 1BWEA 4ECRA 4URGA 4EMDA 3P45B 1LW0B 3BQ0A 8RUCA 5EDWA 4H4KA 1F0XA 1UKUA 1M5PC 4H4KC 2WZ1A 1C4AA 3RB6A 1XN9A 1X9WA 4NYZA 1MU2B 4PQUB 2ZC3A 2EBEA 2UXCJ 2MKKA 2IC3B 2AGQA 2A6OA 2W2MP 2XZDB 1F9EB 1IUJA 2BDPA 4CI0B 3QLHB 5C2GA 3FCVA 3MR5A 1YJWS 4N41A 3HSZA 1BXNA 2OFGX 1X8DA 4P2FA 1UVNA 1FNMA 4Q8EA 2VFRA 4R0EA 2OAUA 2MQNA 3IC1A 2V69A 2K1RB 1U1NA 4GC7A 4QJVA 4KV8B 3OV7A 3P6YC 5KFQA 4QIEA 3JTOA 3VGSA 4NMXA 2QT7A 2YWEA 5B0FA 1T05A 4ZLLA 4FXDA 2DB1A 2JLEA 3SZ2A 1E6VA 2YKMA 2CPIA 5KFMA 3H5SA 4DR2J 2VD3A 3TZWA 2XSFA 5RUBA 4JI8J 4PG7A 5AE3A 4HDHA 3FCWA 1FD2A 4X84A 2EFPA 2IFXA 3V6KA 3M4XA 2Z56B 2EK6A 4FYDA 5E3QA 3UFCX 3CMAS 1UFLA 3M8ZA 5IV4A 1XNRF 3EVMA 2RS2A 5A8RA 5KG4A 2MJUA 4EBEA 3W61A 1T05B 2LXFA 2XLIA 1X4CA 1RSCA 4J7CA 3QIPA 2Z2YB 1QAIA 5IC4B 1C1CA 1GFWB 2J7WA 2CNLB 1E6VB 4J9KA 5DDOC 4B9SA 2YKMB 1V3RA 4JI3F 1Y9OA 2V0NA 2IRXA 2W8KA 2J9DE 3NXZA 2HWIA 1TMJA 3BSAA 4Q2LA 2N82B 1GH8A 4WWSA 4LIWA 2J6TA 4ZPWR 4X4TA 2PMZD 3TO8A 1NB7A 3ADAC 1HHTP 4CLYA 4OZ0A 3F41A 1XMBA 5A8RB 3GCXP 1S1UA 1K0VA 4R8UA 5JVGQ 2COLA 1U25A 2BABA 1HI1A 4OX7A 2M9KA 1SV5B 2HLTA 3TX8A 3KK2A 4Y2IA 3LAMA 3QIPB 1UA0A 2K3KA 2HVHA 3QJLA 3Q83A 5B08A 3OBIA 2LDIA 4MIWA 4IKAA 1HNVA 3DHWC 4EK2A 3KUHA 5MLCV 2DCLA 2ZH2A 2BOAA 3SBMA 3M9OB 3EPIA 3PW7A 2DR5A 2XY7A 2C42A 3HSGA 4YQWA 3I9ZA 3R5AA 1FXLA 2CQIA 2HRTA 3M2VA 4DV7J 5DM6Q 4R8UB 5IOLA 3DNCA 3AQOA 3BF4A 5KT7A 2CPYA 2QV6A 3FRZA 4BDPA 2AHOB 2PO4A 4LQ9A 2UUWA 1J5OA 4RX6A 3SMZA 1NHUA 3H25A 4B3TJ 3CDWA 1HNVB 2R2UA 3I96A 3THPA 2ASJA 5HMZA 2DNYA 3SEOA 2WHOA 3AD8C 4LFBF 1MN7A 4YR2A 2SXLA 4PYDA 4XPCA 2V4RA 4HVZA 3M2VB 3UPFA 1H7WA 1RQ0A 2M52A 2OMLA 1CC8A 2CAJA 4ELUA 1J5OB 2YH0A 5HVHA 5K9FA 4P6QA 3M9NB 4Z2XA 4X64F 1JLFA 3CDUA 3CDBA 4ZP7A 2B9WA 5D78A 1TP7A 4USVA 4DV4F 2MKHA 3AJ1A 2I0XA 2AJ0A 2W4CA 2AMCB 1TVRA 3PJWA 3LGNA 2R7TA 2B4VA 3R3TA 2MKJA 2YPZA 5CH7B 3R6LB 2HGLA 2VKRA 2MHEA 3KKFA 3UD5A 2V8VA 4C8KA 4C48A 3EICA 1KQFB 2NQPA 4X4SA 1Y5LB 1YKWA 4NASA 4L76A 3NNAA 2G2OA 2IM2A 1RAHB 2QFIA 2V6AA 2UV8A 1FKOA 2ABYA 3W2VA 2EC2A 1KTQA 2LECA 5C7PA 2DIVA 1TVRB 1NHKL 4OQJA 2W7PA 3I32A 4I6AA 2AEFA 3HHLB 3RGIA 1BQMA 4F4KA 2X3DA 2DCUB 1BWVA 2ZH4A 4B02A 4NWBA 2IMOA 4DXLA 1V6HA 4LR8A 1S76D 2FZGB 2LLZA 2J8AA 2BACA 2B43A 2H48B 3FSYA 3POTA 3QYYA 4CO4A 1FKOB 2HFSA 1OS5A 2ASDA 3IWNC 3HHLD 1EETB 4RNFA 2JH3A 2MDAA 2B5JB 2QG9B 4L75A 1S0MA 4BWJA 4NMLA 3N9UC 2QX0A 1X5SA 2QRRA 3T9ZA 1BQMB 4WFZA 2VG5A 1UW9A 2AZ3A 5KG0A 3ZNJ1 4PWUA 5J1PA 1NB2A 1RT2A 3QIDA 2V5HG 2KHDA 2GW8A 3POTB 4ZITA 5GADU 3EZOA 2KJVA 2XI2A 1GAOA 2KI2A 1IN0A 2AD9A 3R97A 3BR9A 1D9FA 5CA5A 4J9VA 2LA4A 5G0RA 2QEXS 2X1FA 3RJMB 1G4CA 1FNOA 5HL7Q 2FHJA 5DGBA 1MN9A 4B3MF 5DDRC 2F4VF 4Q8FA 3G8QA 2QA1A 4QW9A 4KR0B 1WC0A 1MMLA 2EKNA 4FNIA 2VG5B 4J9QA 4CLZA 2BJ7A 1XMOF 1Z1ZA 3LOUA 2HFNA 1QLNA 2E44A 3B54A 2C2EA 1RT2B 1YDLA 1XMQF 4PG4A 5HATA 3AT1B 2ROGA 1HPZB 4DV1J 3P4UB 3GIIA 3BBBA 1SH0A 3IWLA 4WBFA 2GIQA 1R31A 4ZPAA 5G0RB 3WQPA 1C0TA 3AH6A 3T5JA 3VCDA 2OTJS 3EMTA 3TZYA 1WDDA 2MXYA 4DQRA 4GO5X 2RNEA 2DNKA 4WYLA 3NRBA 4ES1A 1CJUA 3GQCA 2WSFC 5GAHI 1ZM4A 1SQEA 1JQGA 4ILMA 2AIRB 2CQ1A 2FC8A 2QL9B 2Z58B 3ILJA 2FHJD 4RO0A 5KFCA 2WSCC 1DBDA 4UW2A 3J80Y 3CJSA 1TFYA 2DO4A 4ZS6A 2B8QA 2V4QA 1CJTA 1HFEL 3HK2A 2ZVSA 4YEAA 1C0TB 4DQIA 2B4UA 2CQPA 2RKIA 2YWFA 2QLWA 5GAEU 2N7CA 3FUYA 3TR5A 2LYVA 3SSRA 1CJUB 3H98A 2OHDA 2OTLS 4ZVUB 1S0OA 2Q66A 4Y2AA 1SH2A 2DH9A 2GQQA 2Y1JA 2ZJRQ 2JZ5A 1TQLA 4OX9J 1OSCA 4PXCA 2RJZA 3PM9A 1CJTB 4AE5A 2QYGA 1RB0A 5DQHA 1NK5A 2R8JA 3X1LB 4Y2MA 2FQQB 4HTJA 1FX4A 4CQ1A 2KXHA 2AJFE 2RKIB 3CF5Q 3I56S 4QPXA 1H98A 3C19A 4CYUA 2XZWA 1U1PA 4OZ2A 4CRJA 4LF8J 1EKSA 3BGLA 4ZHRA 4DWIA 1WTFA 1I1GA 2DNHA 3CCJS 2VDIA 4EUVA 3IBWA 5LJ5Y 4ETXA 3A8EA 4MAKA 1HWUA 1DLOB 2AEJA 2A0FB 3GWCA 1RTJA 4XDDA 4C8ZA 4USIA 4HT5A 1QUVA 2V2ZA 2XG8A 5CQGA 2ROEA 3H5XA 2L9DA 3KLGA 4ZP8A 5DQGA 4I69A 4GVLA 1EP4B 3T5KA 2RHQB 4CYUB 3QNWB 3TW0A 2AJ4A 2XTJP 3NL0A 4ZHRB 1VI7A 4IR9A 4X4VA 1JLQA 4HT7A 4JYAJ 7AT1B 3IFEA 4A8QA 2VJUA 4ECYA 4EU0A 1VQ9S 2MY8A 3T6JA 1YHQS 1RTJB 1V9OA 4U67Q 1CG2A 3PJ9A 4M5NA 3QGPA 2E1PA 2O67A 5AXLA 1CEZA 3VV2B 3FSIA 2ZHOA 4NLGA 4AQYF 2YBVA 5LMNJ 2DITA 2D3UA 1CBKA 1S79A 1JLQB 2CPZA 1ZAXA 4K0KJ 2FJDB 4NZ6A 2PD1A 1XIQA 1LOUA 1S5ZA 3IAS9 1S6OA 3GFHA 1UJ4A 3K5LA 4BS2A 2NXNA 4CIOA 4N5SA 1B7YB 5IWAJ 2WTFA 2FLNA 4B3SJ 3WC0A 4WKYA 5KTQA 3GJQB 1PC5A 4NXMJ 3EE3A 2E7XA 5K8NA 5KFUA 2VA2A 2HBZB 3RZAA 1VC0A 4ELVA 1UPPA 3D3CJ 2W7OA 3PVXA 3A8JA 2HQFA 5HBMA 2MKSA 1N5VA 3OXLA 5HVFA 3ETOA 1HD1A 1RAOA 3M9MB 3NMAA 1RAGB 2GJ2A 3ZC4A 3KMSA 2JEJA 2C2KB 1UFKA 2KTQA 2DGOA 2Y0BB 3JTNA 2CJBA 2NSCA 2ZKTA 3A4TA 3H4DA 3QAEA 1REGX 3ZZRA 1RBOB 3W62A 4LF6J 5A8KB 3GILA 3K59A 4AUKA 2XHWA 3UD3P 1RU2A 2HQCA 1AYEA 1SB6A 1UW4A 1FVQA 4NI2A 5HQ8A 1F60B 2G9OA 4I6YA 3DRSA 5HBMB 3GV8B 1Q82T 3I5AA 1FFWB 1S59A 3T3FA 2UVUA 4OMFG 3FBCA 2CVEA 1VQSA 2ZOMA 2R9LA 3NWRA 2ALYB 1F9HA 3T5LA 1RA6A 4HI2A 3NS7B 2CYYA 2LMIA 1WF0A 5D4NA 3MMBA 3AA8A 2HHVA 2DNOA 4LF7J 3AHPA 3VAJA 5I42A 2FJWA 3CWJA 4NI2B 3H7HB 4N7TA 3ETMA 1X5PA 1OYDA 2KT3A 3DRSB 4R25A 1DRZA 5EHHA 2XM3A 2E9ZA 1WWHA 1RWUA 4O4GA 5C24A 2AGOA 2WVBA 2IJNA 3ZZ0A 2FDNA 4OZNA 1RLDA 3MD1A 1RHQB 2A6MA 5M2PA 4A8XA 2UUAJ 4LF9J 3DRXA 3FEYB 4I4BA 4Z37A 4WJBA 3W65A 3F44A 3DDKA 1ELOA 3RBDA 3ITHA 4B3OA 3EUNA 2VG6A 2G4BA 2XMJA 2MB0B 5I42B 2KXNB 2CPDA 4LJMA 1R27B 3TA0A 1IWGA 2AP6A 2Q6BA 1SC4B 1GNKA 1JJCB 5C24B 3Q8RB 5D77A 3L3CA 2MHNA 5ITHA 4OYAA 1BC6A 1WHVA 3Q24A 1X4GA 1OWXA 1H7XA 2AQ4A 1BQNA 4DV3J 4B3OB 3ITHB 5IQ6A 2E1AA 1U0SA 3SFGA 2V50A 2VG6B 2VC1A 1FRXA 4DCJB 1F6TA 4NLYA 3MM7A 2R8HA 3NEKA 5ETLA 1NH7A 1RDRA 4UUWA 5E0OA 1UWAA 4EO6A 4JI0J 1GTHA 5AXKA 3IN5A 2ZDPA 2DHHA 2OO4A 5HK4A 3NAHA 2V2QA 5E2QA 2HNZA 2VF3A 3AXMA 4IDKA 2DRBA 2CVIA 3R2CJ 5IC6B 1BQNB 2VHGA 4BBYA 1ZAWA 2GA7A 2VBWA 3S01A 4TY8A 4LSNA 2VQFF 3MM7B 4UOHA 1YJ9S 4KC5A 4J9SA 2ZE2A 4HHUA 2HHWA 4B9VA 3PEHA 3NG8A 3MCNA 3RW6A 2OPRA 5HO4A 2RT3A 4QU7A 5AT1B 4MYTA 3J7A1 2VFTA 3A3PB 2DR7A 1Q5YA 3DLJA 2FJAB 5J2NA 2DHSA 1RT4A 4PYAA 4OYPA 4QWAA 4IDKB 2FIUA 2HVEA 5DO2A 1UVMA 1KS2A 2DR9A 4NZ7A 4LSNB 1T9VA 1UL3A 4PABA 1X4DA 1ICEB 2P6SA 3M6WA 3ZZYA 1BD6A 1LQ9A 4F36A 1SPBP 4ZJOA 2CQCA 2FLOA 5D4PA 1M5HA 2E5HA 2OPRB 2FHOB 2FVCA 4NLOA 2W9AA 4USKA 4JBCA 2VFUA 5B0GA 4DL0C 3K5NA 3G4SS 5KFZA 1B0PA 4OYIA 4CM2A 1P9YA 2QYCA 1D9AA 4ZIWA 4B3RJ 1W25A 1HNXJ 2RDIA 2BXJA 3IGNA 2YH1A 1UPMB 1LWCA 1IKVA 2XBPA 2IDLA 4ANDA 4JI2J 2KRRA 1DQ9A 3N5FA 4LF4F 4ES2A 4OI3A 5KFLA 6FDRA 3LGMA 1XNQJ 2AT1B 1VDHA 2HZAA 2IIHA 4EGLA 2NS1B 3LO3A 4XAKA 3FBBA 1PYTA 1HR0F 4OZ5A 4LR9A 2L9WA 1KLMA 4PCQA 3NS6A 4LBPA 2M0GB 3SCJE 1LWCB 1IKVB 3CJKA 4K4UA 2M3DA 3LP0A 1U2RA 1FO1A 2D7SA 3Q8UA 4A46A 4IG0A 4CLTA 1SKUB 2ZOFA 3TOQA 4ZDNA 2R8IA 1FF2A 1G6BA 2ZHBA 2J0QD 5L1JA 2DT9A 1M1KT 1IBLJ 2ZD1A 3ZZZA 5KT3A 3L7PA 4X62F 2XB2D 5T14A 2Q3PA 2YKPA 1N36J 1VQ4S 3FK4A 1KLMB 3CJKB 2QC3A 2BZ2A 1ULRA 3LP0B 1KQSR 2GMHA 4USJC 1X5OA 2W4DA 3JTPA 3BO2A 4ER8A 2HG4A 4IG0B 1WG5A 4M5KA 1AUDA 5M2UA 4OJGA 3WHIA 4F3MA 3GIMA 4TLQA 3VAFA 2KZZA 2ZD1B 5AE2A 2HNYA 1R8BA 5BYRA 5GMKa 3OSPA 4ZP9A 1K1SA 2MKCA 3C14A 3KNGA 5CABA 2RIJA 4M5DA 1T9WA 1Y4ZB 4RKUC 1GMUA 2VKZG 2CA9A 2POKA 3MD3A 2KFYA 3VAIA 5KOXA 2CJKA 5A6PA 1LXNA 4I6WA 4U6PA 1SJRA 1S4EA 1K44A 1VHFA 2BJEA 4JV0A 2GC8A 4M5GA 1FE4A 1EJ7L 1NDKA 2PMWA 2O5DA 3TVYA 2MQOA 3QJPA 2HNYB 1RI7A 1S1WA 5I4MA 3C14B 1R43A 1V5VA 4M5DB 2H9ZA 1TU0B 3ZTRA 4O3OA 3J7YI 3W1YC 4OV1A 1FJCA 2DXFA 3WX8A 3V5RA 2L08A 2CWKA 2ZBRA 1HARA 1HWJA 2DNMA 4HH1A 4KGXB 4DHVA 1LV5A 3BZQA 4RW4A 3GTYX 3BGRA 3I9V9 1MMNA 2CQHA 3WIUA 4ANEA 5ETVA 4FS2A 3H2LA 3AXKA 3MOZA 3THTA 1H2TZ 2OGUA 4JP8A 2C28A 4EO8A 1S1WB 2KFNA 2UP1A 4C4WA 4DV0J 3LF0A 5ETSA 2MLYA 2RRBA 3K0JA 2B6AA 3L7UA 4PG8A 4A8FA 2MSSA 4ECSA 4X4UA 1GMWD 4RW4B 3BGRB 4DR1J 4DV5J 2OUGA 3ZNUA 1VYAA 2FVPA 2E9TA 1NMEB 4GVBA 2L41A 3DGVA 4BC7A 1D09B 2VPZB 4U95A 4CZCA 1WC4A 3WIVA 3RU0A 1KVJA 4E2FB 4QYZJ 1FE0A 3NY0A 6FD1A 2B6AB 2DH8A 4NCBA 2EXUA 2HRUA 3GR1A 3HJVA 3NAIA 1KSPA 3EGVA 2YNFA 3T1HF 3G96A 5KFRA 5KFKA 1R8CA 5B0DA 1N5QA 4LIRA 2QA2A 1PKUA 4ED7A 1K0TA 1A9NB 1QAJA 1FRHA 1XEZA 1YG0A 2ZWOA 1RE1B 3HVRA 3CNQP 4H4OA 1FRMA 4E8UA 4QOTA 1S10A 1VHIA 2YNFB 3I0RB 3TJ9A 1CQNA 4NEYA 1QSSA 4CO5A 4KHMA 4U7UK 1NRKA 1VK3A 1S9FA 1RUSA 3I87A 4YFUA 1F2HA 2P8IA 4G3IA 2VASA 2WVDA 1WSRA 3A3NB 2R2RA 3FBFA 1P27B 2DYAA 4JOUA 2CZ9A 1NUEA 4DMZA 2V8GA 3PW5A 1TK5A 4U8YA 4BC9A 3M6XA 3R5CA 4C8YA 1OQ6A 4H4OB 3ISZA 3IGVA 1N33F 4EYHB 3H59A 4O0NA 1FI4A 1RACB 3LPEA 4JI6F 3G8SA 3BN7A 3MOJB 2BBEA 5KFGA 4F7VA 1AFIA 3H90A 2XMAA 1BGXT 3HT3A 4MYUA 4ZVPB 1Q81T 3M7VA 3R8YA 4X66F 2R8GA 3PRBA 3CCWA 3R27A 3R1LA 1M5VC 3P8BB 1PGZA 1QD1A 3RBZA 5K20B 4NPOA 1NSPA 2DNNA 2J0SD 1YJRA 3DGPA 3KLEA 4B9UA 2MKYA 1EX8A 4YS2A 1RAJA 4C6AA 4RUHA 2DRAA 2J7UA 3QT5A 4KPYA 1IQTA 3C8YA 4PWWA 4K5SA 3LP1A 4J5OA 3HZEA 4ZOSA 4DSLA 4M5JA 4DS5A 5CD4H 4JI3J 2LXUA 3S8SA 4FN5A 3KK1B 3B6BA 3MECA 1VCTA 3VALA 2NSBA 4AD6A 3LH2S 3DGPB 3KLEB 3NP5A 2HS3A 3K5PA 3AB2B 3RG6A 1K8AT 3OVBA 3KUGA 4O44A 2KHCA 1RWWB 1RWVB 3Q8VA 3A13A 4KGKA 1HQEA 3MUMP 3LP1B 1S7IA 2CPHA 1PYSB 4UZCA 2B7BB 3A12A 1FERA 1XWLA 3CCQS 3I4HX 4OZJA 5AJ3J 1WKJA 2BVZA 1DQ8A 1EARA 2RUGA 4LFCF 3OPKA 4O3RA 2M4MA 1DTQA 3MECB 1VQ8S 1Y5NB 4LF5F 2JL9A 4WFBQ 4ANCA 2I5JA 1HNIA 4CLPA 4P7TA 2CNNB 5BJRA 3GJTB 3OFEA 2RAQA 4LF2A 1NJXA 1UA1A 2N7YA 1YJUA 3B8HA 3CJTA 1HQEB 2PDAA 5FIIA 1NXIA 1LK5A 1MMDA 2FGCA 1CSJA 1QUPA 1TL7A 2J76E 3RAQA 3OXFA 4DI6A 5HJXA 2E1MC 1YJ7A 1QAYA 1HMVA 1DTQB 2CJQA 3O6QA 4HL9A 3DXSX 2BE7D 5K14A 2I5JB 2ZZNA 1HNIB 4LFBJ 4FPRA 5DZ6A 1DHMA 2LA6A 2GHWA 3D28A 4CH0S 1HL6A 2EFQA 2P9GA 4Y00A 5CYQA 1U6ZA 5DETA 1VQNS 4P52A 3AJ2A 2ZUGA 4QWDA 2KT2A 2BV3A 4TNOA 2IAJA 4DBQA 3BKFA 3NNCA 3D1HA 3AQPA 5E33A 2CADA 1TL7B 3UN2A 2W9CA 4C3KA 3NLCA 2CJYB 3HI9A 4DV4J 1P1TA 1NZAA 2C3YA 5LL6d 1Q86T 3D3BJ 2D3O1 2LEPA 3ISND 2XYPB 3P5TL 3EWGA 2BYCA 1RHUB 1DTTA 2XMVA 3D0IE 2HFVA 2ROPA 5CYQB 4IFYA 3QWPA 3GONA 1U6BA 5H9FJ 2IAJB 2QMWA 2MLXA 2M8HA 1SJ1A 2W9CB 1JXEA 2ZFHA 5LXYA 4OLPA 3VQTA 1B0VA 5B7WA 1IM4A 4U8VA 4IOAQ 4WZQA 4ED3A 4F2RA 5LSRA 1YITS 5D6GA 1DTTB 3PYEA 3DKDA 3PIPQ 4NRTA 3BB5A 4YMEA 2AWZA 4IFYB 2HYIB 2F4FA 3O3LA 4Z7CA 3Q89A 3MEEA 3SI8A 5KFDA 3OXGA 3SIPB 2MZRA 2PMHA 3M2UA 3CCMS 2AJ1A 5KFYA 5IV3A 2LQ8A 1EB0A 3D4JA 3AD7C 4NZ0A 1WORA 3OD2A 2HBRB 1MNEA 3UDVA 3TNVA 2CJXB 2JC1A 4WK3A 1Q79A 2YQ3A 3NCRA 3R2DJ 5ETQA 1JLAA 4ID5A 1HI0P 1RABB 4DL6A 2X1GA 2YKNA 3AOCA 5HI7A 3DDIA 2VODA 2XSJB 2E7VA 3V2UC 1IBMF 3MEEB 4WCEQ 5ADZA 2F8EX 4MKAA 3FVYA 3M2UB 1TTHB 1RADB 2PIIA 4DSFA 4IOBA 2H5EA 3N6LA 4YDDB 2UXBJ 2DEJA 3BM7A 4CH1A 2E1RA 1NNDA 3OL8A 3RW7A 1MG7A 3KLIA 2AW0A 2B56A 2RE1A 4NLUA 4OL8A 4B3MJ 1U8SA 1JLAB 1VIOA 2J5AA 2F4VJ 5F8IA 3OLBA 4ZLPA 2YKNB 3D7SB 3PHEA 2ZH5A 2DNQA 1DFDA 4FYYB 2UUBF 4M5HA 3GE9A 2MZSA 1XMOJ 2W2OP 2KT5A 1QE1A 2D69A 2KO1A 4PQAA 2EW9A 3FQLA 2LQ9A 3BEGB 4ZPDA 2Z8QA 1F5BA 3MAAA 1S6UA 1HBNA 1RTDA 2P2CB 4F67A 3NNHA 5B09A 3THVA 3BGFA 1WHXA 5E7OB 3KLIB 1HYSA 2WAQD 1Y11A 4NYPA 3M6UA 4PUOB 2NZCA 1RHKB 4ZPCA 3MM6A 3RRGA 1NDCA 2HURA 4FDFA 2DHAA 1S0VA 5F8MA 4IQMA 4K7QA 4TN2A 1QE1B 3CD0A 3CUNA 4P71A 1L3TA 1YZ7A 2YNHA 2YX1A 4FF3A 2R8KA 3DM2B 3MAAB 2EBGA 2O66A 4DOZA 3Q8QB 5EWEA 1OYEA 4DJBA 4Z7YA 3H42A 3BYPA 4K4VA 2K2PA 1FEEA 4IH7A 5AE1A 1HYSB 5F9LA 2VL1A 1JX4A 1JIHA 2Z2ZA 2ZVIA 4GC6A 3V6DA 2XEXA 3MM6B 1VJWA 2PN6A 5IFMA 3PJXA 2MZQA 4AL7A 2F63A 2AYBA 3CVKA 4TQRA 3HFZB 2IHR1 4DQPA 4N8OA 2YNHB 4DCPB 3E3XA 3CCUS 4RNHA 3R7SB 2BJ9A 2Q6CA 4DUTA 4ETZA 1WEYA 3BO4A 4KH0B 3HT0A 5DLFA 4MMOA 2DNGA 1IJEB 4D3GA 3Q0AA 2FGOA 3V6DB 3KLHA 3IM8A 3HSDA 4R0JA 3KXDA 5HQLA 4WE1A 5A6WA 1OIAA 3DU6A 3QRQA 1SKSA 3V4IA 1WF1A 2XS2A 2PA3A 3DC2A 1TKXA 1D9DA 5IS2A 1HW8A 2RU3A 4XDCA 4S0MA 2QLXA 2JJ4D 1VQYA 2QZ8A 4CLWA 1VQPS 1KBRA 1PSDA 5DDPC 3HFKA 1AW0A 1ROFA 4DX6A 2RU9A 2OPSA 4I7FB 2PA8D 4JV2A 2LEBA 4WE1B 3IR7B 2F9DA 2XMTA 2XCPA 2HHSA 1M1HA 3FC9A 2QA4G 3V4IB 4HYKA 3SFUA 1PC4A 1U02A 5A2QU 1KFSA 1FJGF 1TKXB 2N4CA 5EN1A 2M88A 4ED6A 2IYGA 5GAHU 4FKYA 2Q79A 1QJHA 1CLFA 5KFPA 1NDPA 2QLBB 1HHSA 4ECXA 4I56A 2NYHA 1TL1B 4DV7F 2K8GA 3CCZA 1TFWA 3VAHA 2XS5A 3PDNA 5J1EA 5IM0A 2MJNA 2YKAA 2J7KA 4HHJA 1GQEA 2M70A 4AL6A 5FJ4A 4B3TF 5H9EK 1FDBA 3PNIA 3MCMA 3GFYA 1PJ5A 4ECWA 2Y3YA 2KVIA 1EKRA 2DNLA 2HHPA 4AFFA 4W98A 5SUHA 3OFHA 1FDDA 1KP6A 3M1VA 2F7VA 4K4TA 3LPYA 2WB1D 3W63A 1CQMA 5IM0B 5BYQA 2BUNA 2QLJB 1Y3KA 3SCIE 3MF5A 2GHPA 2NXCA 2JSXA 4AT1B 4G65A 3P5BP 4X4QA 3KWMA 4OX6A 3R5DA 4NOHA 4X4NA 1FT8A 3QBCA 3ZZOA 2ZH1A 5DGAA 1XC9A 3CIMA 1AROP 3BN4A 1C0UA 1BE4A 5IZHA 4NLXA 4UUXA 1FX2A 2GS8A 2HFUA 2C3OA 2VG7B 4CP5A 3U1LA 4ZN1A 2DKOB 4DR4J 7FD1A 4DUYF 1U1MA 3M6VA 3M8SA 5LSLA 4P73A 1T0TV 4ZK7M 4NA2A 3KLFA 1C0UB 1H6KX 1NK8A 2GX8A 3IP0A 2Y0SD 3DRYA 4KH1B 2Q1LA 1F3FA 4Q44A 1RYRA 1RT7A 1HA1A 4ZA1A 5GMDA 3MR2A 1KKHA 3TVZA 3PACA 2HQGA 3AB4B 4GO7X 3TUJC 2P5VA 4F8RA 3HVWA 1UTAA 2XO7A 4PAAA 2M2BA 1F9FA 1UEVA 1LKZA 5CAAA 4QCLA 1VC6A 2NXJA 1HIYA 2VQEF 3GLJA 2HHHF 2YKQA 3KLFB 2C1EB 5EWFA 2BJDA 4C8LA 2E7WA 2D9OA 1KR4A 2BW2A 3PW0A 4QWCA 1RT7B 2B3TB 5IQQA 3O2IA 5D0EA 4ED0A 2G1HA 2HIQA 2RD5C 4OLOA 2RUSA 1RYSA 1SL1A 4IG3A 2R7RA 1S1VA 2M8DB 1X9MA 5CD4A 1KC8T 5L8RC 5IT9Y 1RGVA 1CULA 3TEHB 3SQOP 5HJYA 3R1HA 1R6YA 3KMQA 1WTBA 3NOCA 1WG1A 3JXOA 2V4JB 2ZJQQ 3HKWA 2Y1IA 3FSXA 2QIFA 1VBYA 2M5YA 4ELTA 4I0WA 4TU9A 5BYSA 2RS8A 2V2KA 4JI4J 4C98A 3TP2A 3I4PA 4IG3B 1S77D 1S1VB 1QM9A 5A2QY 2DGUA 4RBVA 2ALZA 3FBEA 2YXLA 2BR0A 1T9YA 1CULB 5D4LA 2B0GA 2O1PA 3QWUA 1Y0HA 4LSZB 1FDNA 4ZCLA 5KFTA 1Y00A 2NPFA 3Q8PB 3MEDA 4P75A 4IH6A 1N54B 2W2QP 2BJ1A 4QIGA 1JJ4A 2VFSA 3HZGA 3T6BA 2CPJA 4HH0A 3PO4A 2ILYA 2E5JA 4NXNJ 2VQFJ 2EG1A 2QMUB 2X1AA 1DQAA 9RUBA 3TANA 2W2PP 4OYXA 4ZVQB 5ETRA 5IXUA 1U26A 4F0MA 4A48A 2VOPA 1JJ2R 4DR3J 2GJFA 3G8TA 2LQBA 5DLGA 1BY9A 3CD6S 3MEDB 2YNIA 1R6VA 3C2PA 2QSWA 5GVQA 1YLXA 4B08A 2CPFA 2E5GA 2A10A 3Q22A 3Q23A 1WC6A 2FPHX 2HZVA 2WVEA 2QL5B 4HACA 1YZ6A 1VBZA 1TUWA 4WTYA 3DLEA 2R7WA 1U1KA 3NGRA 4G1IA 3MZIA 4K50A 4K4SA 4ZVRB 2YNIB 3GP9A 2DNPA 2KDOA 1ZPVA 1WF2A 3QQCD 1TK0A 4DZ6A 3MDFA 1NKBA 4LF8F 1LFWA 3S7RA 3CJ2A 3VTIA 4JI7J 3D0GE 4DV2J 1SI9A 3VF0B 4HACB 2CDRB 3P96A 3UR0A 3NMRA 2QA4S 4LF4J 4KJIA 3UD4P 4B9TA 1W2BR 2IVMA 2MYFA 1N48A 3GR0A 5E3PA 1WOPA 3JSBA 3FFIA 1HR0J 1HQ2A 2IY5B 2OPQA 1WDTA 1URNA 3VZHA 1U48A 4JI5F 3LALA 2QJ3A 1WACA 4RNNA 5KG7A 1F3VA 1SJ3P 2HHUA 2L3MA 4GKJJ 3D1OA 1ZM9A 3GJSB 4ECZA 3TAMA 4FYXB 1C1CB 2YWGA 4R5PA 1G7CB 3H8YA 3D1QA 4OYZA 2MLZA 3L09A 2CRLA 4JYAF 1U0HA 3NOGA 1KTVA 3O1LA 2ERRA 2OI2A 1TUVA 3W8PA 3HVTA 4ZLJA 4DFJA 1J5EJ 1HNWJ 3FFIB 4K4XA 4X62J 3M32A 2UV8G 1G2EA 3J7Z5 1I94F 2GQCA 1N5YA 1S49A 4DV6F 1S1UB 2OPQB 3J7ZT 5IT0A 1WC3A 2KB2A 3KK2B 4ECTA 1BMQB 4DR7F 3OVAA 3TAMB 2R42A 3KTQA 3C16A 4OYOA 4RWWA 5BXIA 5KG5A 1FNXH 2DJWA 3MTKA 4A8WA 1VQ7S 1NK7A 1S6PA 1U0HB 3KFWX 1GXUA 1VFJA 4KKOA 1B99A 2GV1A 4JV1A 1ZZFA 2WBRA 2BANA 1VS3A 5ETPA 1NH8A 4H54A 3LW5C 1ZA1B 1FTRA 3HVTB 3TJ8A 1EZZB 1S97A 1QAXA 2MQMA 2E9RX 3PCOB 1AZSA 3M32B 3C6UA 5BR8F 3OUYA 1FVSA 2FJXA 2NZ4A 5IWAF 1OJ4A 4MT1A 4YUDA 4Q45A 4B3SF 2LP4A 4K4WA 2G13A 4B9MA 2XNQA 1K73T 1AB8A 2MY7A 1LK7A 2VBXA 4ZCMA 3C16B 5JVHQ 1VGYA 4JI1F 1S6PB 1JNRB 4KKOB 5B0AA 2WK4A 5DG9A 1NK0A 5DZ7A 4IYQA 1YGYA 3IRWP 4IOCQ 2DHGA 5AXMA 1AZSB 3C6UB 3OUYB 1Y3JA 5A76A 5I3QA 2MSTA 2F1FA 4EZ9A 3EGZA 2E1CA 1ZM3A 5ETMA 1H72C 4L73A 4DX8H 4NLRA 1VQOS 2B4OA 5HN0A 2YY3A 4DFMA 4RUCA 2R7QA 2RRNA 1RWKB 1ZPWX 1JLFB 4C8OA 3OT9A 4LMZA 3BS9A 2PFFB 4M5IA 4OZLA 2ADBA 3HM9A 1QTMA 3PRVA 2FVRA 2AGPA 1JXLA 2E5IA 4NLQA 4CO1A 3MR7A 1B70B 4WYWA 4RUAA 1PIEA 1FFSB 1N52B 4ECUA 1VR6A 1RHJB 1S9GA 2WVFA 2I1RA 4ZN3A 1UWBA 6AT1B 2AV5A 4QIWD 3V6JA 3RBEA 2YX7A 2ACYA 1ZTTA 1R8HA 2HQ3A 2DY1A 4UY8T 4LRFA 4B9LA 3BV8A 3P3DA 4C7QA 1A6LA 1G3OA 1QSYA 3W2VB 2OSRA 1FCAA 1G1XA 3CJRA 4IQXA 2UUAF 1Q0NA 4DEZA 3C6TA 2AYEA 3M8QA 1KVIA 1UWBB 4IFVA 1AFJA 3BGUA 1RBLA 1VQ5S 4J90A 3QT7A 3IRXA 3TZZA 3FQKA 3LGHA 2EFOA 2FVSA 3G82A 1Q16B 1IBKF 1FTCA 4K4YA 4DPOA 3T1HJ 2NREA 2HVDA 3NWGA 2J6SA 2RDJA 4I64A 3KUEA 4RW6A 4EZ6A 4I2PA 3MI7X 4DPYA 4EBDA 4HTIA 1L3KA 2VFVA 2X1BA 3AA9A 4QR2A 4KTQA 3UE2A 2RVJA 2ZH3A 3AOBA 5ETKA 3M8QB 2HWHA 4DV3F 4IFVB 1GEHA 5DRKA 1TELA 1IJFB 1RKIA 3IRXB 2IM3A 7FDRA 4F4XA 5K8MA 1NK6A 2JWNA 3CEDA 3G82B 1WNEA 2RMLA 2NUUG 3J7YU 3TI0A 1Y5IB 4P72A 4JI0F 4RU2A 3MCOA 5F3ZA 1VK8A 3QGIA 3SXLA 4RW6B 1WSVA 1S1XA 2V9WA 4TU8A 2KZMA 4I2PB 3HKZD 1YWXA 2I9SA 2VBYA 1KFDA 5KFFA 3EDQB 5F9NA 4WXOA 3M8PA 3PRDA 4YR3A 5U47A 2U1AA 2VU5A 4DL5A 4C0BA 2OEMA 1UZHA 4MK8A 5CZXA 2ZNZA 2UZAA 3G87A 3P49B 1N33J 4WFNQ 1H73A 3Q2SC 2BX6A 4UQGA 3K17A 4DN9A 3K8WA 1GX6A 2ZWPA 5F0WA 1LNQA 2F65A 4JI6J 2J6UA 4GRSA 1APSA 2XWYA 4E0DA 3GB0A 1S1XB 3J7AN 1N32J 1PAEX 1VMBA 3RAXA 3TVKA 1JK9B 1NO8A 4X66J 4YY3F 5EGYA 3MAHA 3HO1A 4L3NA 4O4RA 4A8YA 3RRHA 4PWDA 1E6YA 5KFBA 3CDEA 4K4ZA 4RLEA 2GO8A 1EQ0A 4ZVFA 3PO5A 3HD1A 5C42A 1Q1KA 3K58A 2ZZMA 1NKCA 4USUA 1HD0A 2CWXA 2IM1A 1AXQA 3FCHA 4FPIA 4ZVHA 4IR1A 4WU3A 2HZCA 4GKKF 1HNXF 1TV6A 2MGZA 1E6YB 1F1BB 4UOCA 1KOHA 3PKMA 1FHTA 3ZFVA 1X0FA 4JI2F 5F8HA 5A8WA 1T03A 4USMA 3OHAA 2LXIA 2A2CA 1PO6A 5C42B 2PI4A 1RBAA 5F0UA 4QBUA 5T41A 3ZZUA 3LP2A 1SUQA 4RW9A 3CXCR 4LR7A 5D3GA 3R5BA 1X4FA 3K7RA 5EX3A 4PKDB 4ITSA 1FKPA 3TZXA 3GPAA 3C3LA 2CQ0A 4BWMA 2B9EA 3MR6A 2MGZB 3HJFA 1LFPA 4LFCJ 3K89A 3QFWA 2XC9A 4LF5J 2FTRA 1NKEA 4F26A 4MJKA 1M5SA 5A8WB 4PR6A 1T03B 1YBUA 3KHLA 2H5JB 4DPWA 5K5MA 1FWKA 3UW1A 4CO0A 2G2YA 2Y9HA 4C0OC 5LXRA 2XYGB 4DU8A 2KM8C 5FDLA 1SUQB 4RW9B 4ECQA 1MW7A 2G1DA 5D3GB 5KT2A 5CXTA 1R0AA 5ETNA 1NAQA 1FKPB 2HEKA 1XERA 3LA0A 5E3CA 1A0OB 2OD4A 1S7HA 4TVAB 4IRKA 1RHRB 3KLGB 3S1TA 4ID8A 3BDEA 1YSJA 3TX0A 2HHQA 2JNJA 2DGSA 2EFVA 2HK2A 3OHBA 2XGPA 1Y7PA 5H9EJ 1YBAA 1S0NA 1RT1A 4RUBA 2V68A 4ZKAA 3BBCA 2CQ3A 5FDLB 1S12A 2PEHA 1SKWA 4OI1A 4O3SA 4J9PA 4DR5J 1SC6A
chains in the Genus database with same CATH topology
1VLYA 2KYZA 2RRAA 1R0AB 4ED2A 1JKHB 5J2QA 1SJ4P 1VQNS 3MM8A 4CT9A 1JLEA 3AJ2A 2ZUGA 3JSMB 4QWDA 3DMJB 2KT2A 2BV3A 4TNOA 4ELUA 2D9PA 2IAJA 4DBQA 3CCTA 4MFBA 5J1EB 4RU9A 3QZ8A 3OTDA 3NNCA 3D1HA 1J5OB 2YH0A 3AQPA 5E33A 4KB7A 5K9FA 4P6QA 1NK9A 2W9CA 4QQBA 5GADI 3BO3A 3M9NB 4C3KA 1RA7A 3NLCA 4Z2XA 2X3GA 4X64F 1JLFA 3CDUA 4K5RA 1D8YA 3CDBA 4ZP7A 2ASYA 2B9WA 2GMLA 5D78A 4O3NA 4F8RA 3CC7S 1TP7A 2JVRA 3HI9A 1P1TA 1XR5A 1NZAA 2C3YA 5LL6d 1Q86T 3M2RB 3GMGA 4DV4F 2MKHA 3AJ1A 2RSQA 2I0XA 3OQ2A 2CG4A 1U1RA 5F41A 4IUFA 2LEPA 1RT1B 2Y1RI 3B82A 4GMKA 2AU0A 2AJ0A 2W4CA 3ISND 3P5TL 2KG0A 1TVRA 2LCWA 3PJWA 2BYCA 2IBOA 4QPTA 1DTTA 3LGNA 2R7TA 2XMVA 2B4VA 3D0IE 1C1BB 3R3TA 2ROPA 4J9LA 4Y65A 5CYQB 2MKJA 3H5UA 4IFYA 1KEKA 3QWPA 3F73A 5J2QB 3H2VE 3M1VB 2EWHA 5CH7B 2YNGA 1U6BA 1U4BA 1JLEB 3E01A 2HGLA 5H9FJ 2VKRA 2MHEA 3KKFA 2IAJB 2V8VA 4MFBB 4C8KA 5HP1A 2GFFA 2QMWA 1TAUA 3DLBA 2M8HA 3O5TB 1JLGA 1KQFB 1SJ1A 3M30A 2W9CB 2KKHA 2NQPA 2IBKA 1YJNS 1JXEA 4X4SA 2PE8A 3DOKA 1KLNA 1Y5LB 3MFIA 2EI5A 3LAKA 2ZFHA 3ENVA 5LXYA 5SZTA 2IA6A 3OTEA 3NNAA 2IM2A 4KO0A 2UV8A 1MROA 1FKOA 2ABYA 3SSSA 4N56A 3W2VA 4OLPA 3CC2S 3GIJA 2B7CB 1B0VA 2XI3A 3VQTA 1P8GA 5B7WA 1IM4A 1KTQA 3PEJA 3KG4A 4IOAQ 4WZQA 2LECA 3FDSA 4RBTA 4ED3A 2I8EA 1LWEA 2B9YA 3EPGA 2DIVA 4F2RA 2HMIA 5LSRA 4X4RA 1TVRB 2HPUA 5B0CA 1YITS 1A7GE 5D6GA 1DTTB 1T3NA 4OQJA 2W7PA 2MKIA 3I32A 4I6AA 4P2SA 5KFVA 3PIPQ 4E98A 4NRTA 3BB5A 1H2UX 4YMEA 2AWZA 4IFYB 2HYIB 2VUGA 4DG1A 3HHLB 3VWSA 2YNGB 3GG1A 2ZC4A 1MSWD 1XBWA 3O3LA 2I2YA 5C25A 1BQMA 3E01B 1Z2LA 3MEGA 4F4KA 2U2FA 3MEEA 3SI8A 5HP1B 5KFDA 2DCUB 3MM9A 2ZH4A 3OXGA 4CT8A 2MZRA 5MAOA 3VAMA 1JLGB 4B02A 4NWBA 2IMOA 4RWXA 3M30B 2PMHA 3M2UA 2ZOGA 3CCMS 2AJ1A 1V6HA 3NGKA 4YB6A 4ZPTR 5KFYA 1S76D 3DOKB 1N5SA 4AXJA 2LLZA 2J8AA 2BACA 2B43A 3QMQA 4NZ0A 1FRJA 5JUMA 1FJEB 3FSYA 1MNEA 3POTA 3QYYA 4KO0B 4PG5A 4CO4A 3CULA 2CQ2A 3OL9A 1MROB 2AYMA 1FKOB 4AL5A 3TNVA 2HNDA 3MGJA 1OS5A 2ASDA 2JC1A 4WK3A 3IWNC 1KN6A 1JNZB 1TK8A 3HHLD 1LWEB 1Q79A 4DR1F 1EETB 4RNFA 2YQ3A 4DV5F 2HMIB 3NCRA 3K2YA 2JH3A 5KT5A 5K8OA 2MDAA 3UI3A 2B5JB 5GAEI 1JLAA 1R8PA 4ID5A 4QZVB 1S0MA 4BWJA 5KFAA 1HI0P 1BLUA 4DL6A 2MPUA 4NMLA 2X1GA 4ED5A 1DJ0A 1TAQA 2FC9A 3N9UC 2YKNA 2PGCA 1X5SA 4DG1B 3BSNA 5C5JA 5HI7A 4A8KA 2VODA 1KHWA 2QRRA 2XSJB 1BQMB 2BE2A 4Q2MA 3T9ZA 5C25B 3MEGB 4WFZA 3V2UC 2VG5A 3UCGA 1IBMF 2GCFA 3MEEB 2W9BA 3MM9B 4ZVEA 5KG0A 3IXQA 4WCEQ 5ADZA 3G6XA 2F8EX 2LDYA 4MKAA 3FVYA 4PWUA 5J1PA 4J9RA 2B4PA 1WELA 3M2UB 1IXKA 3PIOQ 3U27A 1HBOA 3CSKA 3MMBB 2C3UA 3MTJA 1RT2A 2GQ2A 3QIDA 3TUZC 1OSDA 3IS9A 4USHA 2V5HG 4PQUA 2PIIA 2KHDA 4DSFA 2GW8A 2H5EA 4IOBA 3N6LA 3POTB 4YDDB 2O3DA 5FD1A 3SV4A 2BM0A 3BM7A 2HNDB 5GADU 3I0RA 4CH1A 2KJVA 2XI2A 2R7SA 1GAOA 2KI2A 2E1RA 1IN0A 1NNDA 3DLGA 4L6V3 3OL8A 1IKYA 2AD9A 4X2BA 3IR6B 3RW7A 1U1LA 3KLIA 3BR9A 2AW0A 1D9FA 5CA5A 1WHYA 1YTYA 2B56A 2FJEB 2RE1A 4O4GB 4NLUA 4OL8A 2LA4A 5G0RA 2QEXS 2X1FA 2J0WA 4XIUA 1R89A 1U8SA 1JLAB 4WXWA 4YOEA 1FNOA 1VIOA 5HL7Q 2J5AA 2FJVA 5F8IA 3OLBA 2FHJA 5DGBA 1XR7A 4B3MF 4V19J 4N47A 4ZLPA 2JLFA 1U6FA 2K7JA 5DDRC 2YKNB 4Q8FA 2F4VF 3G8QA 3PHEA 2QA1A 4QW9A 2ZH5A 1K9MT 2DNQA 4KR0B 5KT6A 1B7FA 1DFDA 5F8NA 1MMLA 2UUBF 2BE2B 4FNIA 3GE9A 1YRTA 2MZSA 2VG5B 3UCZP 2VPXB 2W9BB 4J9QA 2KT5A 1QE1A 4PG6A 2FJBB 5DG7A 3J81Y 2KO1A 4PQAA 1XMOF 2EW9A 3FQLA 1HWIA 2LQ9A 1Z1ZA 3LOUA 2OSQA 2HFNA 1HBOB 4NLSA 1QLNA 3BEGB 4J9MA 4ZPDA 2E44A 2Z8QA 2C2EA 1RT2B 1F5BA 2V8HA 1XMQF 4PG4A 3IS9B 1S6UA 3G71S 1HBNA 2K1RA 4MIBA 1RTDA 4M95A 4TY9A 3Q2TC 3RR7A 2ROGA 4KV8A 4F67A 4RNOA 3NNHA 1Q4RA 3B4MA 1HPZB 3MXHP 5B09A 3THVA 1U09A 3BGFA 1WHXA 3DLGB 3GIIA 1IKYB 2KRBA 5E7OB 1SH0A 3KLIB 4RZRA 2OP5A 1HYSA 4DV1F 1UJ5A 2WAQD 3IWLA 3OL6A 4NYPA 3GSDA 4OIXA 3GFXA 2GIQA 1R31A 4ZPAA 5G0RB 3WBZA 1C0TA 3BDPA 3JB9k 3AH6A 3M6UA 4PUOB 3T5JA 1JWWA 4ZPCA 3VCDA 4KIAA 2W4PA 3MM6A 3RRGA 2OTJS 3CGIA 4FS1A 2DHAA 5HMWA 5DM7Q 1S0VA 2MXYA 4DQRA 2WONA 5F8MA 4GO5X 1RP5A 4IQMA 2RNEA 1DAXA 2DNKA 4TN2A 4WYLA 4KAIA 1QE1B 3CD0A 3NRBA 2EKYA 4IH5A 3V4MA 4ES1A 3CUNA 1H2VZ 3GQCA 3CPWR 2WSFC 1L3TA 1NJWA 2YNHA 1ZM4A 2GGPA 2YVSA 2YX1A 5GAHI 2R8KA 3DM2B 1SQEA 4FF3A 4XPEA 2EBGA 3DLHA 2O66A 4ILMA 2CQ1A 2FC8A 3CJ0A 1DURA 4NLWA 2DD8S 4DOZA 4W90B 3Q8QB 2FLLA 4ZCKA 4C9DA 5EWEA 4DJBA 1MWZA 2FHJD 3OFGA 5KFCA 4K4VA 2C3PA 2WSCC 1DBDA 1ZTWA 4UW2A 3J80Y 2K2PA 1FEEA 4IH7A 5AE1A 2ZH7A 2JC0A 1HYSB 1TFYA 2DO4A 4ZS6A 5F9LA 2V4QA 1HFEL 1S9EA 2PSZA 2VL1A 3LWMA 1JX4A 1N88A 4OFZA 4YB7A 5L38A 1WEXA 1N32F 1VRUA 1JIHA 2E29A 2ZVSA 4YEAA 3HK2A 1C0TB 4GC6A 3V6DA 2CQ4A 2ZKUA 4DQIA 2XEXA 4DN0A 2QSFA 5EWGA 3MM6B 4F25A 1VJWA 2PN6A 2B4UA 2CQPA 4U7CA 1FK9A 1FRIA 3PJXA 5IFMA 2KJWA 2RKIA 1TZ0A 2MZQA