1J2VA

Crystal structure of cuta1 from pyrococcus horikoshii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
MIIVYTTFPDWESAEKVVKTLLKERMIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 102AA long hypothetical periplasmic divalent cation toleranc
publication title Structural implications for heavy metal-induced reversible assembly and aggregation of a protein: the case of Pyrococcus horikoshii CutA.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 27
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j2vA00
4NYOA 1H3DA 3N5BA 1PILA 1V3SA 1J2VA 4E98A 3TA1A 2ZFHA 4USHA 2CZ4A 3OPKA 3TA2A 2O67A 4CO2A 5D4NA 1UL3A 2O66A 1V6HA 1UKUA 2NUHA 4OZJA 5D4OA 2J9DA 3T9ZA 3NCRA 5DS7A 4RX6A 5D4LA 4D3HA 4WK1A 2V5HG 3AH6A 4YB6A 2DCLA 3MHYA 1P1LA 2EG2A 4CO3A 2JJ4D 3NCQA 4NYPA 3NCPA 1HWUA 3X3UA 2ZOMA 4Y65A 5L9NA 2NS1B 3CE8A 4CO5A 2GNKA 4CO4A 5D4PA 4D3GA 3AA8A 1NH7A 4OZNA 4RWWA 2Z0GA 2PIIA 1XK8A 3HLUA 3AHPA 1Q1KA 4Y6IA 4C3MA 5DRKA 4RLEA 1V3RA 2GW8A 1UMJA 4OZLA 2XULA 3O8WA 4R25A 3BZQA 4CO0A 4RWXA 2NUUG 4IYQA 4ZK7M 2VD3A 2XBPA 4YB5A 4YB7A 2GX8A 3DFEA 1V9OA 2J9EA 4CNYA 1UFLA 2XG8A 3GSDA 3M05A 4CO1A 2J9DE 4USIA 4C3KA 1NZAA 1NAQA 3LF0A 4USJC 2RD5C 1O5JA 1GNKA 4C3LA 3L7PA 1VFJA 2J9CA 1KR4A 1VHFA 1NH8A 3TA0A 4CNZA 4WK3A 1QY7A 2XZWA 3AA9A 4AFFA 2EG1A 3O5TB 2E66A 1O51A 1OSCA
chains in the Genus database with same CATH superfamily
2IHR1 1KQSR 3AXKA 1F2GA 4A8SA 4RBVA 1UWBA 4O4GB 3H90A 2DITA 1I6JA 1P1TA 2DRBA 1PAUB 1SQGA 4I0WA 4B3MJ 4CDIA 3IC1A 3QFHA 1X4DA 3K58A 4RL1A 2C3UA 1RHRB 4RW6A 1TKXA 2KU7A 2HAIA 2RE1A 3DLEB 3DC2A 3TZZA 1WC0A 3WZ0A 1K0TA 4RLEA 1XTZA 3K59A 2XGPA 3O8WA 1O8BA 3PKMA 1QDUB 2PO4A 5DLGA 4DL4A 3PW0A 2RHSB 4QU7A 1F1BB 2CVIA 3C16A 4WWSA 2I6WA 1QAYA 1SJQA 1VQNS 1VQ7S 3QMQA 2PA8D 1HD0A 1F6TA 4IG0A 1HNVB 2I1RA 2HZVA 4DV1J 1U0HA 1PYSB 1NK4A 5AXMA 1RB0A 1HL6A 3NG8A 2B0GA 1VISA 4ZP8A 5D78A 5I42B 1T7PA 2BX6A 5CABA 2NXEA 4H4OA 1FRMA 4KPYA 2XTJP 5LOQA 4IR1A 5DLFA 2DGVA 1VCTA 3EYZA 3TARA 4OV6A 1UA0A 3A8JA 4ES1A 3R8YA 5C24A 2PMZD 3W2WA 2PIIA 3RRGA 5KG4A 3QJJA 1FWLA 1IWAA 2HZAA 1S1XA 1Y3JA 2BACA 4AL5A 3A1YG 4BLGA 4HT5A 1WF0A 2KZZA 1TP7A 2FVCA 4LF1A 2M8HA 4B9MA 1WSVA 1MSWD 4RW7B 1N5VA 4DL7A 2F8HA 5AT1B 2V4JA 4PQAA 1S57A 1C1CA 2BKPA 1CQNA 3ADAC 1SL0A 3HXMA 2DPJA 1EIYB 4TNOA 3P3DA 3N28A 4H4MB 1VQ8S 3GR0A 3EM1A 4RUHA 1OJ4A 3F41A 2VF3A 2LEAA 1MN9A 2DXDA 1VRUA 4DR7F 1N33F 1B0PA 2R2UA 3T41A 1U45A 3CCVS 4Y2IA 1VBKA 4LF4J 2IA6A 2VG7A 2HNYB 5KFCA 3FEYB 2UUAF 4F4AA 2GIQA 4LF5F 3E8OA 1IKWB 1Q4RA 2YH0A 4RNNA 2ZHAA 1CC8A 2DISA 4L76A 5CA5A 5C7PA 5F8HA 1CJUB 5E3CA 4DXLA 2ROPA 3JSMB 1WF2A 3BF4A 1GNKA 1Q82T 4P10A 3VQSA 3G87A 2RU9A 4A8YA 3JS9A 5CQGA 3GFYA 1KLMB 1ZYQA 3SXLA 1A9NB 5B08A 4IH5A 2B8PA 5HP1A 1NKCA 1E6VB 5L1KA 5A0YB 1PYTA 4FKXA 2X1AA 5F0UA 1WJ9A 2IC3B 2MDAA 1JKHA 2V2KA 4M1KA 2YKQA 1I5OB 1EJ7L 1NJIT 4IFVA 2JX2A 3Q89A 1WORA 1WG1A 1YWXA 1C1BB 3VZIA 2C3OA 5DQHA 2A2CA 5HLFB 3ZTSA 3BKFA 1T9WA 4ZVGA 2PMHA 4PXBA 5THWA 3DYAB 1M5HA 1RT3B 5J2NA 4JI5F 3R5GA 1Q8BA 4J9MA 1RP5A 4YMEA 3T1HF 4X4PA 1PGZA 4ES3A 2C42A 4ZP6A 3KLFA 2RDIA 1YK9A 2RQKA 2B4UA 1OY6A 1F0XA 2WW8A 3BV8A 2WK4A 1TQLA 2DVIA 1P27B 2ROGA 4ZVQB 1V9OA 3TEHB 2XY6A 1U48A 1FXLA 2M7SA 3Q8QB 3GCWP 1RU2A 2GMJA 3KLEB 3A8KA 2P9GA 2XMUA 3MCMA 2UXBF 5KFJA 4WP9A 1FVSA 4HI1A 1ZM9A 3G4SS 1S97A 5F41A 3D6HB 3KLIB 4M94A 4DSKA 1TKZB 1HHQA 3K5PA 4RR5A 3GJSB 1U1QA 3P96A 2PSZA 3W61A 3UVJB 4DEZA 1Q78A 3OR1B 4DR4J 4JV5F 3T5KA 5B0GA 2MPUA 4Y3CA 4FPRA 4KY3A 3GONA 5H9EK 4OL8A 1QJHA 1X4AA 4RNHA 2FHOB 3CC7S 8AT1B 4P2MA 1YBAA 3BGRA 2Y8WA 2AYBA 3BKUA 4LIWA 4TXSA 2OFHX 2JOQA 3TAMA 4N8OA 1V3RA 1WHXA 2C2MB 2IM3A 2GO8A 4UOCA 4DR5F 1UEVA 3OTEA 3J7YI 4F67A 2UU9F 1NAQA 2BW2A 3I32A 1IKYB 1WEZA 2HHQA 4OZ2A 1O6XA 2IC3A 4N41A 5CYMB 1H72C 4OJGA 2RAQA 1JXLA 3QAUA 3G6YA 2G1DA 2I8EA 4DN0A 3ZTRA 2ADCA 4WPAA 1DTQB 1U47A 4PG5A 2M3DA 3V4IA 5ETVA 5B0FA 3DYAA 1RT5A 1RT3A 3S6EA 3T6JA 4C97A 1U8SA 3M8PB 2MGZB 3Q22A 5D4PA 1RZMA 1VC5A 3FSYA 4JI4F 1REVB 4ZLNA 4UY85 2AX1A 3OVBA 4MKVA 2NYHA 1RLCL 3FFIB 1Q0NA 1GX5A 3O3LA 2RRBA 1S1WB 4FF3A 3DOMA 1R43A 1GMVA 2VFSA 4YUDA 2J8SA 3TJ9A 2VV5A 4U7UD 4B08A 4C8OA 4J9SA 3JSRA 2HHSA 4HR2A 4P52A 2X7IA 5J2QB 3MR3A 4YFUA 4DQQA 3ZO7A 2ZNYA 4LSLA 3AJ2A 3L4BC 3Q86A 2O67A 3M9OB 4B3OA 4ECVA 2YNGB 1Y11A 5GMKa 3IBCB 3ITHA 2J7UA 2V8VA 3POTA 2HHPA 2QMWA 4KO0A 3QJLA 3W60A 3CE8A 4NA1A 1TL5A 4DCJB 5LSLA 4FP9A 3F56A 3MD3A 3FVYA 2HG4A 3U1LA 1RTDB 3B8HA 1SUQA 4C98A 2AEFA 2QL9B 4FVCA 2NPIA 4G1PA 4LF9J 1BQXA 4TYBA 1MLAA 3AJ1A 2OH2A 8RUCA 2MMYA 5C5JA 3SDEA 1H7WA 4ZVRB 3HJFA 1SJ1A 2Q66A 2LQ8A 3VVTA 4QWCA 2GS8A 4NWBA 1E6YA 2K3IA 1YTYA 4O4RA 3MZIA 3W7BA 3L95X 3GV5B 2DRDA 4CLSA 5FDLB 4PRFA 1VJWA 2VFRA 5B0BA 1U1NA 2ZFHA 4M5JA 3HD1A 4L72B 3ENVA 3VGTA 3FEZA 4P2SA 4USUA 2P2CB 2RT3A 4QW8A 3T1YF 2RQ4A 3GIIA 5E3RA 2DEJA 3IWNC 2V6AA 1U1PA 4A47A 1RHUB 4P7VA 2W2MP 2VICA 2XGQA 5B0CA 3OTOJ 2XMTA 3PZPA 2G13A 2J0WA 1Y00A 2B8QA 4LQ9A 2DO0A 2E1PA 2MY8A 5AE1A 1YGYA 2V50A 2CJXB 5E2QA 1ZOTA 1OYEA 5DETA 5B09A 4QPTA 2AEMA 4I6YA 4ZLPA 3TA0A 4WP8A 1CJKB 3NWGA 3PW5A 3MR6A 4AFFA 3NBPB 1T9VA 4MK9A 3H5SA 3MR5A 2CJ9A 2E9ZA 1X0PA 4DSFA 3ISZA 2LEPA 5E33A 1XERA 4UQGA 4R5PA 3OL9A 5DDQC 3QLHB 2VBZA 3G9CA 2VKRA 1RT7A 1BHNA 1U25A 4KKOA 2XMAA 2IVMA 3M1VA 1LQ9A 1YBUA 1RQ0A 3I6PA 1NKEA 1IR1A 1RAAB 2FGOA 3O1LA 1U1OA 1N6QA 4LF5J 1RTDA 4M8LA 2RF2A 2I2YA 4Q8EA 4KT0C 2AGQA 1PIEA 2E5JA 3I87A 4KAIA 1RACB 3QWPA 3W64A 1REGX 3P6YC 1EZZB 1NRKA 2XO7A 5KT7A 1FKOA 4NE9C 2DHSA 2QLXA 4LSNB 2CQHA 4GRSA 1FO1A 2WSCC 4URSA 2JEGA 2GJIA 4DR3F 3G6ES 1X4BA 2L9WA 2IAJB 1PJ7A 3R3TA 1QTMA 1RWOB 1V6HA 5DS7A 5GAEU 2Y3YA 3E2EA 4IFYB 2AIRB 4HHHA 4CO4A 1HR0F 3LPYA 1NMEB 1RA6A 1SH0A 2Z0GA 3HHLA 2XLJA 2BVZA 2QYGA 1U6BA 4HL9A 4ICLA 2GQ2A 1FJ7A 3DRYA 4JUZA 3I0RB 1BXNA 3VF0B 3TUZC 2CPJA 2YWFA 1F5AA 2I0XA 3VR1A 4L73A 4FF2A 1AFJA 3TQ1A 2AGOA 3C6UB 3FRYA 2YX4A 3BO2A 2W8KA 3M8ZA 2DPIA 1Q5VA 2AF6A 4YR0A 3GJTB 5F3TA 3AODA 4JYAF 5I3PA 3MM6B 3DOLB 3Q8SB 1IM4A 2L9DA 3US5A 3QSIA 5KFSA 4DI6A 4PXDA 2ZWOA 2PEBA 4FPIA 1S0VA 5IQ6A 2B4PA 2AKWB 3E3XA 3AH6A 1UVMA 2ZBCA 2GVZB 3GU0A 1CQMA 4BS2A 1NHKL 3VAMA 5C25B 2O1PA 2XC9A 4DR5J 2HVHA 1T0TV 4Y34A 2BZ2A 2CWXA 3AQOA 1Q8KA 2HMIB 1CULB 2UU9J 2EFQA 3K5NA 4ZVEA 3BPSP 4X65F 1JLCA 4LVNP 4I69A 1H7XA 3PJWA 3B4MA 2VASA 1BD6A 2HVIA 2CQCA 3P5BP 2RB7A 5FLXU 3TAQA 3KWMA 4OYXA 4O3OA 4Q43A 2ZUAA 2ZD1A 4I2QA 3IWLA 2HQDA 4ZCLA 2XSJB 4DG1B 3KHGA 3FBEA 1FNOA 4N8NA 4N77A 1QE1A 3FKBA 3MEDA 4IOBA 4TKTA 4KGZB 3NY0A 4DS4A 3JSBA 3OFFA 3ILOA 8ATCB 4RPFA 1FEHA 1LFWA 3MTJA 1UZHA 2WOMB 2VQFJ 2C28A 1H98A 5ETRA 1PBAA 3C15A 3DLGA 1K47A 5GMEA 3AFGA 3SFUA 1YJVA 1YIJS 1M0SA 2OLWA 3NCPA 2ZOMA 2OEKA 5KFEA 4Y65A 4PXCA 1NJZA 1NPRA 3SEOA 1RXOB 1DURA 4MKYA 1SV5A 3WX4A 1JB0C 5C42A 3T5JA 2F5GA 2ABYA 3PJXA 3MEKA 3G82B 4B3RF 4OI3A 2AJ4A 2BA9A 4AD6A 4N5SA 2XBPA 4ILLA 2F1FA 3OTBA 4PG8A 1ZH5A 2QIFA 1L3UA 2DCUB 3C6UA 1MWQA 1Y10A 5LMUF 3DU5A 1W7WA 5ETLA 4CI0B 1XNRF 5B0EA 1S0MA 1N48A 3ZTOA 3GWCA 3W2VB 2B51A 3MM6A 2R7QA 2DGTA 2YKPA 1D8ZA 4RJVA 5BYQA 4NZ0A 2N3OA 4CWBA 1YBTA 1YHQS 3AY0A 5HO4A 4OHZA 3UN3A 4AXJA 3BGLA 4NEZA 2L3MA 5D4NA 4O23A 2E7XA 2ZVSA 1RABB 3EZOA 4CQ1A 2OAUA 4A8XA 3SCLE 4GVBA 1AZSB 1S6QA 3KK1B 4H4KA 4ID5A 3SIPB 3F73A 3OLAA 3W65A 3CGIA 3HHKA 3HSJA 5T7LB 2LLZA 1RTJB 1NH7A 3BN4A 3CJKA 3BQ0A 1LWFB 4DFMA 4EO6A 1KTQA 3GLJA 1R6YA 5SZTA 2ZDPA 1DJ0A 4K5SA 5HL7Q 1S5ZA 3NOCA 1CSJA 3CDWA 3CUNA 2A6MA 2KJVA 1Q79A 3PW7A 2FUG9 4AE5A 1JQGA 4XDCA 3LAKA 1Z4UA 2XCPA 2F7VA 1RAIB 2M5YA 1OYDA 4ECZA 4KRWA 1FWPA 4U7CA 3ZTPA 3HDSA 4J9LA 3UWTA 4YR3A 1S9GB 2BJ1A 3BSOA 5KT2A 4P71A 4KGKA 4UY8T 4G6VB 2BJ3A 3PHEA 2RNEA 2JEIA 3VVUA 1XN9A 2NCKL 1NZ8A 1KVKA 2AD9A 3ILIA 2VC1A 4Q0BB 4YDDB 4Q8FA 5H9FJ 1RAEB 2V34A 4OMFG 3H5YA 1T05B 4NI2A 5DQGA 4OI2A 2R2SA 2C3YA 1UMJA 1DTTB 4IYQA 3ETMA 5CD4A 5KFAA 1JK9B 2E9TA 2QN6B 2GQQA 2EC0A 3I5CA 1QAIA 4WYWA 2YNHB 4CLZA 3TQEA 1VHFA 3I96A 2GHVC 3CJ5A 3CJSA 1RCOB 4FNHA 1U6ZA 1ELOA 3BH6B 2F9JA 3CCJS 1ZM3A 2M2BA 3UCUP 2C2KB 1DQ9A 1JLEB 4NYZA 2J6TA 2ZC3A 2Q43A 3TA2A 4NLVA 1AZSA 2NUHA 3M7VA 4FBUA 2BRKA 2DGSA 4RX6A 4DQPA 1FJGJ 3IR7B 2HWIA 2HFSA 2PC6A 3SQGA 3U27A 2B43A 1LWFA 2FZCB 1SH3A 1NHVA 1P8GA 1T9UA 2HBZB 1JLBA 2ZH1A 2MZTA 5FJ4A 2C22A 3CDAA 4LF7J 2FHMA 3KJNB 2J5AA 4MYTA 1CG2A 1HBUB 4XDDA 1RHMB 3C14A 1F9EB 4PPDA 1AUDA 1M1GA 5ETNA 1RTHA 1BQNA 1VBZA 1RCXB 2HNZA 4B02A 3PX4A 1RYRA 1CVJA 1N5YB 4DR3J 1EHWA 1N56A 1TELA 3CJ8A 2APOA 1V5VA 3KUGA 5GMDA 1TZ0A 5D77A 5E5NA 1VQ9S 1RADB 2BOPA 5A8RB 1HNIA 1RISA 4DV2F 1Q81T 1PILA 1RAGB 4P75A 4WE1A 4G1QB 2P8IA 2YNFB 3PW4A 3RW6A 2JZ5A 3VV2B 4CM0A 2V9WA 1HNZF 3T9ZA 1HR0J 1C0UA 3JQKA 3OVSA 4O44A 4KGXB 5EGYA 1MMDA 3HHLD 3FRZA 3FQKA 3PEHA 3T5LA 1NK7A 3DNCA 2XEXA 3QWUA 3AD9C 2ZDOA 3HI9A 4ZIVA 4TVAB 1HNXF 3PYGA 4PG7A 3E01A 5BXIA 5EDWA 1FVQA 1TMMA 1UZDA 2HBRB 5RUBA 2UXCJ 1LWCB 4A8KA 2JC1A 1U26A 1BWVA 4TLRA 4RNFA 4MKAA 3AQPA 4LBPA 2N4CA 1T02A 1FRLA 1I94J 2E66A 2LXIA 2ZNZA 3M9MB 3OD2A 1S12A 4F3QA 3KNGA 1GT8A 2EI5A 4QPXA 4F0KA 3M8YA 1S4EA 3RR8A 3PYEA 4LR7A 1IJEB 3H25A 4WJBA 4ZP9A 5E3QA 2DBBA 3A8EA 4CO3A 4DX6A 3LP0B 4MK8A 1UEKA 1YQHA 2CJQA 3UQSA 3GG1A 4CLKA 2NS1B 4TY8B 3ULHA 3AOBA 3H2UB 2MQPA 5CYJA 2H65B 5HQLA 1X5TA 3EVOA 1KFDA 4OZ5A 3UD3P 3CD6S 2DHGA 3UPFA 1S9EB 2G0JA 2FLPA 2C3PA 4EK2A 3W62A 4RW4B 1JJCB 1OQ3A 1QAJA 2JEFA 2AYGA 2KT5A 4LBIA 1MU2B 2QZ8A 1TV6A 3A4TA 5K14B 2D9PA 4L3NA 1FFGB 4K59A 1HBOA 3CMQA 3M2UB 1X4GA 2GMHA 3PIOQ 4K0KF 2N3LA 4YY3F 5KT5A 5JVHQ 5KFPA 1T9TA 2KM8B 1FRIA 1QLNA 5KG3A 2ZKUA 5L38A 1S1UB 1S10A 1RT2A 4RNMA 4NLUA 2RQMA 2R42A 3GYNA 5F8IA 4I1TA 4NXNF 4X2BA 2ALYB 2I5JA 1BGXT 2X3DA 3R5DA 1HHSA 2QYCA 4DSIA 4QWEA 3SSQA 4NCAA 3FCWA 1J27A 3LP2B 4RW8B 2XNQA 2KH9A 1Q1KA 4QR1A 3TX8A 1CS4A 3GMGA 2JH3A 1XNRJ 1WOSA 5DG9A 2OKQA 2GVDB 2DHHA 3Q24A 2LECA 3QO9A 4ZHRB 1TFYA 2CVEA 5A6WA 2EFOA 1A7GE 3DMJA 3UFCX 1AT1B 1IXKA 2OI2A 4DFJA 3I0SA 5L39A 2J9CA 1FRXA 1KHWA 4IH6A 4B9TA 2BKOA 4XIUA 1XR5A 2VB6A 1SL2A 3D4JA 3W1YC 3CJQA 4A8MP 3H4BA 4A48A 4ENOA 2KG1A 5KFBA 4I2PB 1KQKA 3HKWA 1D9DA 2ZH3A 4MFBB 4HDHA 4KGVB 2PT0A 4L6V3 2EC2A 3FEXB 1XMBA 3M30B 1N5SA 3KJFB 3BB5A 4OZ0A 5FIIA 4K4UA 3HHLC 3W63A 4X62F 3FGVA 3VALA 1YRUA 1XWLA 3ELHA 2E5GA 4BC9A 5IT9Y 3NP5A 1DAXA 4OHXA 5HVGA 1TFWA 1GTEA 3LGNA 3ENAA 1DQAA 2VL1A 4QR2A 1HQUA 4YB1P 1W2BR 4B3TF 3T6BA 2VONA 4DZ6A 4TYAA 3DU6A 3PIPQ 3RR7A 1RWPB 3ZNJ1 4DHVA 2R7UA 3VTIA 4NYOA 4DX7A 1KONA 2UXDF 4ZVPB 2FJXA 3W5ZA 3O2IA 4PKDB 4C7QA 1UPPA 4OYWA 3SSSA 2FZKB 3BKTA 3MR7A 1HMVB 3T9NA 4K50A 1SIWB 3BSNA 3D9BA 4UUXA 1S72S 1W26A 3ZFVA 3D5MA 3ILLA 4X66F 3CC4S 4CTAB 4RW8A 2PDAA 1WC1A 1KKHA 2LP4A 2A10A 2EK1A 1CLFA 1T3OA 2LEBA 4U8VA 1U4BA 2J6SA 3BREA 1GK8A 2VD3A 1U09A 2J0XA 2E1MC 5CAAA 2CDQA 3JTNA 3DLJA 4DL2A 3TJAA 3D28A 4HLBA 3DI6B 1H0HB 2K7JA 2ZH6A 4NEYA 3I9V9 4NPOA 1IQZA 2FD2A 1RJJA 3TZXA 1RT1A 3MAQA 4ERDA 1J2VA 4O3RA 2WONB 2BM0A 2IY5B 4M5KA 1K1QA 5HSPA 2UV8A 3I4HX 1N0UA 4J5OA 4CLFA 2P6SA 1ROFA 3M30A 3IAM9 4ETXA 5DGBA 4MT1A 1HA1A 1LW2B 4C11A 2VFUA 3KNAA 2UVWA 1KTVA 2WVCA 3WQPA 1M5OC 1Y0HA 1R0AB 1HI1A 2IJFA 1PBUA 3NGTA 2FZGB 2V8HA 2XLKA 5J1NA 5LL6d 4HACA 2ZJPQ 1WC6A 3M6UA 3OHBA 2Y8YA 2VFTA 1RAJA 4DR1J 2GAGC 4EGLA 1UW4A 2M8DB 4C8YA 4OYIA 5A8WB 1U7LA 4WFAQ 2RUGA 3GFZA 3PY8A 3HVWA 1HARA 3C3LA 5KFXA 4YN3B 3M2VB 2ALZA 3NL0A 4FDFA 4HDGA 2B9XA 2XI3A 1WOOA 4DV2J 4OYOA 3UNGC 1CJVA 1LWXA 2JRSA 1JNRB 1W25A 1BQMA 1JLGA 4FXDA 3ZTQA 4V19J 3ET6A 2DR7A 4TN2A 3CEDA 2FVRA 3PEJA 5K8OA 1IBKJ 3HO1A 2QA1A 4X64F 1NK0A 1YRTA 2E1CA 4H4KC 1K44A 2EBEA 5U47A 1VK3A 2COLA 2IMOA 3DRPB 4FYDA 2KB2A 3QJPA 4P72A 2IYGA 3NMRA 2VU5A 3FUYA 3MI7X 2GNKA 1EETB 1NK5A 1YDLA 2QX0A 4EWTA 2IRYA 3GP9A 3TRGA 3H5XA 1KN6A 2YWWA 1TVRB 3LPEA 2HYIB 3K0JA 3HSDA 1LW0B 5D0RA 2G4BA 2HFOA 5F8JA 4FF1A 4UUWA 1L3SA 2ACYA 3IA0A 1TAUA 2MZQA 2CNLB 4KJIA 2MB0B 1ITPA 2KO1A 2BQ3A 4OX9F 2DNKA 4DV3J 3VAHA 2WONA 3IM9A 4XPCA 2LU2A 2B6AB 3VAIA 2GAHC 4IO1A 4RO0A 3HSZA 4NLSA 3M6VA 1L3VA 3L7OA 3UR3C 1KOHA 2GMLA 3QGPA 5K8NA 6AT1B 2DR9A 3J80U 1R0AA 2GJFA 2QRRA 1L3TA 1VI7A 5HK4A 4PPZA 4DR2F 2W1BA 2MKCA 1TK0A 2P6TA 4IOAQ 1SJRA 1VQPS 1S1VB 4OLOA 3QT6A 5A8WA 3W8GA 3PFEA 2NLWA 3MMBB 2F65A 4CLUA 3MMCA 1WHYA 2RRNA 3EPIA 3LW5C 4RW9B 5A2QY 4XK8C 1U1KA 1ZZFA 2PE8A 2HFUA 2R4FA 1ZAXA 2FIUA 3MAAA 3G86A 4K0KJ 1SBRA 2MLZA 4YY3J 3PO5A 4DFPA 5M2PA 4KHPJ 3FK4A 2JC0A 1EX8A 4OQJA 2B4OA 1N88A 4KV8A 2UVRA 1XEZA 4NLOA 3D6FB 3MD1A 3TNVA 5IC6B 1RWXB 4KE5A 5K9FA 2RUSA 1QM9A 2GGPA 1F5BA 2OPPB 2HQCA 4HH1A 2QA2A 3P8BB 4MIAA 2YWGA 2KTQA 1DLOA 3RB0A 4YB6A 1CJTA 3D6MB 3U7JA 1AXQA 4B17A 4M5DA 2HNDB 4OJ1A 6FD1A 4KFBB 2JHEA 4DV5F 2JNJA 3M8QA 2UUCJ 2BE2A 2HAFA 3ETOA 2GCFA 3D6TB 1TUWA 3AHPA 4DCPB 2BOAA 4TLQA 3PCOB 1UVIA 4FXVA 4YB7A 2QSFA 4JI1F 4NRTA 2HHHF 4UF4A 3NS7B 4BDPA 4ZIWA 2MZSA 1RTIB 2K2PA 2O01C 5EWFA 3DDKA 2VPYB 3IRXB 3SCKE 2DGXA 2QT7A 2HIYA 2HS4A 4ECRA 2KVQE 4DL3A 3PFOA 4AYBD 1G4CA 4DDFA 2R7TA 1RBOB 3MEGB 3AB4B 1FD2A 4IG3B 2DR5A 4X62J 2VUGA 4J90A 3OFEA 4PWWA 4YP3A 3R1LA 1RSCA 3CPWR 4JV1A 5D4LA 3MMAA 4DFKA 5L9NA 1NHUA 3LWLA 2RHQB 5DDPC 3SBMA 3DRSB 5I3UB 1XK8A 5HQ8A 4LBHA 4LF6F 1FESA 2OO4A 5KTQA 2GIFA 2V2QA 3KK2A 2MQQA 1S48A 2BANB 2YX7A 5JUMA 1GH8A 3HVRA 3PR4A 5JXSA 4F3MA 2HSEB 2J9DE 1S59A 3CC2S 3IO1A 3F0NA 4WXWA 3V6DA 3OLBA 2BYCA 3KG1A 1FE0A 4DZDA 3C6TA 2UXDJ 3QGHA 2VJVA 2AU0A 1RA7A 2BRLA 4ZN3A 2ASLA 5J2MB 1WI8A 4DV4F 2ZM6F 2YKNA 3QYYA 1M1KT 4DWIA 5ETSA 3IRWP 1OO0B 4WF9Q 1J5OB 2OPPA 1Y5IB 3UCGA 4RUAA 2L08A 2CPEA 4LR9A 1S1TB 4OI0A 5LMNJ 4OZJA 1FTRA 2IVFB 5D3GB 3M6XA 2SXLA 3SV3A 1MNEA 4LVOP 5EX3A 1SKUB 1WUUA 1FNXH 2YKMA 2D3OR 5LXYA 1XR7A 1YJTA 3RB4A 2W2NP 1HWJA 1G7CB 2HBYB 5CYQB 2JWNA 1JLQA 1LOUA 1JX4A 5J2PA 2HVDA 1H2UX 2R7VA 3KLGB 1JMTA 2BMBA 1TL1A 1X5SA 2Y1IA 1ZM4A 3G2XA 4O0NA 1FI4A 5L8RC 3EX7B 3D67A 1L5UA 2R8GA 5BR8F 1R31A 5HANA 4FS2A 4QW9A 4WIQA 4F04B 2HS3A 2W4PA 2G9OA 3MECB 3IRXA 4R8UA 2E29A 1VQLS 2JLGA 2Z4PA 2Z30B 2DGOA 1RTZA 1IKVA 3LANA 2MZ1A 4JI3J 1SC4B 3FSXA 4J7CA 3MEEB 2BM1A 1UKUA 2CZVC 1QSSA 4U9RA 1Y9OA 2RMLA 4NLGA 1VLOA 2OP5A 1RHQB 3QT5A 3TANA 5JVGQ 2FC8A 3J7YU 2AJQA 5ETQA 4F2SA 3M32A 3OFGA 1VLYA 5KFTA 3MURP 1X31C 5G0RA 1FKPB 3SZ2A 1AFIA 4K8RA 3TUIC 3RRKA 4UOHA 1BY9A 5D6GA 1UTAA 1HNWF 2HIQA 4J9RA 4WFBQ 4I6WA 4V19X 3NGRA 1UETA 4J9UE 2OPSA 2B5JA 5CD4H 4IO9Q 3AT1B 4DSEA 1LXJA 2VBWA 4X64J 4LUBA 2E7VA 2QLWA 3D2WA 4NXMJ 1XMQJ 2AT1B 3O5TB 3VZHA 4DU7A 3GYXB 1RGVA 3KHRA 2IBKA 3MFIA 1EKRA 3MM7A 1K0VA 4P6QA 1FTCA 3LA0A 3GTYX 1RT4B 1U0SA 3UW1A 1S6PB 1FK9B 3H4DA 2Y0BB 5AXNA 1R3NA 4ZN1A 1FERA 1TMJA 4OYBA 2ZZNA 1EB0A 5A76A 3M8RA 1WKLA 3BBBA 1TL7B 5KFIA 1FJCA 1TU0B 1FF2A 1NDKA 4F4WA 1TKTA 4JI0F 4OZNA 1Y5LB 4DV7F 3DGVA 4TQRA 1M5VC 4I7FB 2Z2MA 2J7KA 4FZVA 4TU8A 4YHHJ 2GZOA 2KZMA 3IG1B 2M9KA 4K4TA 2MHNA 3OL7A 1N34J 3BJYA 1HBNB 2YPZA 2PFFB 5LJ5Y 4JI8F 3N4WA 1EP4A 3BM7A 1QY7A 2FB0A 2YNIA 1IBLJ 1QTNB 2VA3A 2OPRA 4PUOB 3H5UA 4OJHA 3WX8A 4P7TA 2W2PP 3TWZA 3MOJB 2CG8A 3U1MA 4B3SJ 1T9XA 5AE3A 2FYXA 3NMAA 3WHIA 4CLTA 1FXRA 1F5CA 3SI8A 1SI9A 3OVAA 4DR2J 2A2DA 1BLUA 2VC0A 2KYXA 1VRTA 2DGQA 3DDNA 2JDJA 3QT7A 2HVZA 3PO4A 1NDLA 4IQMA 1OY9A 5HBMA 1PC5A 4OYMA 2W01A 2GHWA 1WELA 2KRRA 2DNZA 4X4QA 3RRHA 3BDPA 2EBGA 1Y7PA 4NLTA 4FYVB 5I3QA 3SSRA 1R0BG 3KK3A 5A8KA 2LKZA 3V6HA 3TVKA 1L3KA 1HYSB 4C6AA 4YB5A 2DNPA 4QWBA 5DZ7A 4CYUB 4WXOA 4O4GA 1NK8A 1NZAA 4ECSA 5B0DA 3HKZD 2Z58B 2YY3A 3NEKA 2AJ0A 1UJ5A 2H4WB 1B0VA 1Q7LB 1P9YA 1SXLA 1KHVA 2WVEA 2ZOFA 5B7WA 2QMUB 1G1XA 5E0OA 3MUTP 3BQ2A 4DUYJ 1QUPA 3N5FA 1X7VA 3DLEA 1U8WA 3WBZA 4PWDB 3KJVB 1HBMB 2DNRA 1PAEX 2C2RA 3TOQA 1ACMB 4LRAA 2J0QD 5KFYA 2H51B 3R5AA 4ZCIA 3THPA 1X9SA 1AA1B 1NK6A 3CVKA 4OX8A 1ZAVA 2VG5B 1DBDA 2JSXA 2KRBA 3R5JB 3I31A 3KHHA 4HTJA 2WAQD 5BJRA 1WSRA 3EMTA 3K5OA 2VQEF 4JV0A 3GFXA 4WFZA 4I7FA 3X1LB 3AXMA 1HNVA 1IBMF 3JTPA 2CPFA 1J5EF 1S4FA 1SH2A 4OHWA 1NU4A 1IR2A 2W25A 3LP1B 1HLWA 1I1GA 2VODA 1GMUA 3IBFB 4PG4A 4ECQA 5GAGI 2UUWA 4OX6A 4IRDA 4LIRA 5I42A 4M5GA 4W4MA 1M5KC 5HMWA 3M8WA 1JNZB 2QFIA 4OZ1A 1YJNS 5EWGA 2KDOA 2FJAB 1PG5B 2OTLS 1HQEB 1RWMB 3DLKB 3LGMA 3EGZA 4IRCA 4ECYA 4A8WA 2YKAA 4F4KA 3RAMA 1N32F 3EVWA 2MQOA 2LQ9A 3I4PA 3NGSA 2EXUA 5K8MA 3GG0A 2ZE2B 3L3CA 2Q79A 4NZ7A 2HHTA 4C8MA 1HKAA 3J7ZT 4NMXA 4C0OC 2G0CA 4LF6J 1GXUA 3ENWA 1QVFR 3RAXA 2L41A 1NM2A 2AGPA 2CXEA 3CWJA 1P6TA 5DJBA 1FEEA 4RW7A 3RG6A 1X0FA 3H8YA 2JFDA 6FDRA 4J9PA 2FDNA 3EUNA 2M4MA 2IM0A 3JAMY 1FDBA 3QRPA 2Q3PA 4LFBF 3PTWA 1GAOA 3MCNA 4H4MA 2O5DA 1YKWA 2OEJA 3KFWX 3HP6A 1JJ2R 2CFXA 3QFWA 4NLRA 4ZPVR 4QWDA 4NCGB 3BQ1A 4OI1A 5G4DA 4M5NA 3M2RB 4ZJOA 4B9NA 1H3DA 4IRKA 2HNYA 3M8SA 2IDLA 5KFHA 3DDIA 1SB6A 3DHWC 2HQGA 1OS5A 1RE1B 1IKWA 3AB2B 2KHDA 1F2HA 1CJUA 4WTYA 5IM0B 2MQNA 3JSMA 2W9BB 3HHEA 2K3KA 3QIPB 1HPZB 1KS2A 4J9NA 5GAHI 3IS9B 2KFZA 1KLMA 3LH2S 4ATNA 4K4ZA 5ADZA 2V2VA 2MY7A 4FNIA 1E6VA 4EBEA 4BWMA 3QQCD 3R7BB 5A0YA 1DRZA 4B3MF 4QJVA 3UDEA 3N0VA 2NSCA 3LF0A 1JLAB 2D69A 1UP1A 1VRQC 3NLCA 2C2EA 4WIIA 4QWAA 1C1BA 4N76A 5LT5A 5HLFA 3LOUA 2BUNA 2NXJA 3NNCA 1KWMA 1TTHB 1YG0A 1FRKA 3DOKB 3A13A 2XMMA 3CCZA 4ZVFA 4AQYJ 1WG5A 2KT3A 3B4DA 1SKRA 3PV8A 2NXNA 3GCXP 2E5HA 5L1JA 4W92B 1M5SA 1HNWJ 3NXZA 4DPYA 1HD1A 2Z57B 3LGHA 2HQ3A 4C2MA 4DV1F 2MQLA 2RSQA 3AAWB 3KLEA 4E8UA 3GYGA 1RAOA 3KDOA 4Y0FA 2K7KA 1P9QC 3DGPB 1SJ3P 3N6NA 2NZ4A 4PQUB 3KLIA 1TKZA 4CH1A 3GIMA 5IV4A 1T8EA 2BKNA 2KFNA 3PJ9A 5D0GA 3OR2B 1NNDA 3UVJA 2KXFA 1WDTA 3OR1A 4ZJLA 3KTQA 5HROB 4F3OA 2KFYA 2ZBQA 3C46A 4AT1B 3L7UA 4M5HA 1UA1A 1WHWA 4Q7AA 3KLHB 1N54B 4DPTA 2G2ZA 1WWHA 3CJ3A 5IT0A 4K5RA 2IM2A 2ZC4A 5KFDA 2YBVA 3MGJA 1X60A 2ZZMA 4UZCA 1OIAA 2IFXA 1FHTA 1FKAF 2CPXA 1LK5A 3CCLS 2R8KA 3MUMP 3EICA 5KG6A 4JI0J 4B9SA 4KB7A 2H5IB 4NRUA 4DV7J 2DGWA 1WACA 3OW2R 4F8RA 2HBQB 2KG0A 1NLKL 2XS7A 4HHJA 2JLFA 4KR0B 1FWKA 3D0GE 3CCUS 4JBCA 1IKYA 3EGNA 5AXKA 2WZ1A 1X9MA 5ETMA 1NBEB 3TO8A 3WC2A 2H54B 4CO0A 4PZVA 4JI8J 5CYMA 2LVWA 3TEGA 4W90B 1RUSA 2XMVA 3LALA 3CMES 2D41A 2FGCA 1DTQA 1PKUA 1ZTTA 2HRYA 3OT9A 4MAKA 3RGIA 1RHJB 4LF4F 3JYTB 4GKKF 2UVUA 2D9OA 1F3VA 1F3FA 3DRRB 2K1RB 2R9LA 3RJMB 2CUYA 3M8PA 2MGZA 3MCSA 4EU0A 1REVA 4EBCA 3V81B 2MKKA 2D3ZA 3NWRA 3MM9B 3EGVA 2U2FA 2IDEA 2D3UA 3FFIA 3TR5A 1LWEB 2WVFA 2W7PA 1S1WA 1XBWA 4P2XA 4B9VA 4PG6A 2W4CA 3HFKA 4DPOA 1D9FA 2F40A 4C8KA 3IFEA 1Q16B 1RK8A 1C0TB 3HULA 4ANCA 4PQUA 2GO9A 1NJXA 4CLYA 4TU7A 3CJ2A 3DM2B 3UDVA 4DUZF 3OR2A 3VAKA 5J2QA 4O0IA 5T14A 1GMWA 3UNYA 3VCDA 1V5IB 1Q53A 2HK3A 1W2IA 3IAS9 3LUYA 5H9FK 1IBCB 4ILRA 2A3JA 4DR7J 2YNGA 3QPIA 1N33J 4F26A 3MM8B 5L46A 1M90T 3FCVA 1X4HA 5LSRA 1LFPA 3NGUA 2N7CA 2UUAJ 5BYRA 1IWGA 1S7IA 3MPUB 3P4UB 1T9YA 1IKXB 2JL9A 3H0PA 4QIWD 1K73T 4ITSA 1YSJA 2YX1A 2BDPA 2I9SA 3FZ2A 2BE9B 4CIOA 4Z2XA 4DV0F 1N5QA 4KPCA 2EG2A 3RBDA 2AWZA 1IBMJ 2LFVA 1VBXA 4KHMA 4C48A 3N6MA 2AYMA 5KFUA 2F8MA 2DXFA 1KEKA 1MN7A 4GO5X 4RW6B 1TKXB 3C8YA 5FDLA 2KN4A 4O3SA 4DQSA 4CO1A 2BE7D 3VGUA 2GHPA 4USIA 3D3CJ 2V4QA 2XY5A 5GADU 1X4CA 4DBQA 1VFJA 2XI2A 2MKJA 2K1RA 2J0SD 3N9UC 4JI5J 2B7CB 5EX0A 3T1HJ 3QAEA 2R7OA 5CH7B 4DMZA 4PR6A 3C16B 3D0HE 1NCLA 4KIAA 1B70B 1RBLA 1ZPVA 2IM1A 2UV8G 2QV6A 4IG0B 1KVIA 5KFGA 3EZ5A 1U0HB 1EARA 1U1RA 3N6LA 4C8ZA 2NR0A 4M5LA 3J81Y 2UXBJ 3PACA 5HQMA 1YJWS 2F8EX 3CTRA 5DG7A 3DLHA 4U96A 1U1MA 2XWYA 2LCWA 4HKQA 4LFBJ 2WBMA 2UUBF 4H4OB 3DN9A 1CJKA 3IR5B 1U2FA 4HEA9 4JV5J 3NBPA 2CPYA 5JJBA 3K5LA 2Q6BA 3CO0P 3DXSX 3OTDA 2BW7A 1U1LA 2QLJB 3EZUA 1VQSA 5C24B 3QLHA 3W2WB 4QU6A 2WB1D 2RH3A 1SL1A 3CCSS 1ZA2B 4RUCA 1S1XB 3KMQA 1SJFA 2EG1A 2N4DA 2QG9B 3IBWA 4LJMA 2WHOA 3GPAA 1RYSA 2OELA 3AD7C 1YJRA 3PRDA 4AL6A 1UW9A 2CG4A 4USHA 4WU2A 1R89A 4QYZJ 3I55S 5KFFA 2XM3A 3FC9A 2DH8A 1C1CB 4R0JA 2HURA 2VH7A 4OHVA 3R97A 4M5IA 4PXEA 3Q83A 1VS3A 2JFKA 4GKJF 1LXNA 3EDQB 4I56A 4LSNA 4OHYA 2OFGX 1Q95G 5DRKA 4WKRA 4X4SA 2P5VA 2GIRA 1KBRA 3GE9A 1VRUB 1Z2LA 1NKBA 2KI2A 2OIHA 2AHOB 3MPYA 1BUXA 2IAJA 3DCAA 1UFLA 3OBIA 4ZMMA 2C2OB 1RLDA 4WFNQ 2VG7B 3BO4A 2DH9A 1ZAWA 4Q5VA 3UCZP 4LF8F 4DN9A 2MQ8A 1N36F 4FKYA 4DJBA 3C19A 3FJ2A 2KYZA 4JI4J 2RJZA 3ENQA 5ETOA 2RU3A 4IFYA 2AW0A 4LF9F 1FDDA 1VQKS 3D1QA 2QLBB 2Y0SD 2LA4A 4I68A 2RS2A 3C2PA 3OJSA 5HP1B 2OJ3A 2G0IA 3I0RA 2EFPA 1X5PA 4DF8A 4UW2A 1JKHB 1RWVB 1QSLA 1S77D 4E2FB 3C66A 4D3GA 4ZCMA 3MMJA 4IFVB 3SQOP 3TW0A 4NCBA 3CD7A 1GX6A 3V4MA 4YQWA 2FVQA 1UVKA 3FSIA 4ZITA 3G71S 3GSIA 4M5MA 2NUUG 4F02A 5HMXA 1ICEB 2ADBA 3K8WA 1HFEL 3O6QA 3DOLA 1ZA1B 2HGMA 5J2NB 4CRJA 4C3KA 2FJVA 2E5IA 5ETKA 3VHQA 4DR6F 2QMXA 2PGCA 3KLFB 1U49A 5IOLA 4CH7A 2PD1A 2VFVA 3ILJA 4ZPCA 1AW0A 3M6WA 3BH7B 2GVZA 2MTLA 1O51A 1S99A 2NPFA 2ZH9A 2CYYA 2EFNA 3OTOF 4G1IA 5C25A 1URRA 1XR6A 4V1Ak 2HMIA 4OI4A 1CULA 1S49A 1NO8A 3CSKA 5ETTA 3NAIA 3Q8VA 5EUHA 2H9ZA 2YWKA 1NDPA 2XYGB 3EWGA 2DR8A 2ASDA 3GFHA 3HT0A 4IH7A 2QE5A 1FE4A 3AJDA 2UUTA 1Q8IA 3KXDA 4FYWB 1WC5A 2CQBA 2XSJA 4DG1A 2VDIA 3GB0A 3KG0A 1VQYA 2D74B 1T3NA 1B99A 2GW8A 3UI3A 3V6JA 4USVA 4GKKJ 1FFWB 5M2UA 5LJ3Y 2W2QP 1U6FA 4RZRA 2WOMA 3BGRB 4I67A 4GC7A 1YVFA 5AXLA 1S6UA 4F25A 3Q2SC 3T1YJ 2VPWB 3OTCA 1ZTWA 2HK2A 4YOEA 3JSYA 3H7HB 3TAMB 2V68A 3H42A 1NB7A 3RB3A 2CQGA 4P74A 3CF5Q 1Q7YT 4DSJA 5CHCB 1V3ZA 4EI2A 1NJYA 1IQTA 5ITHA 2YTCA 1FD8A 1U24A 2QGFB 4EYHB 4DS5A 2UVVA 4WU3A 3G82A 2IPOB 2XNRA 5F8LA 1TK5A 3TUPA 1P1LA 2BV3A 1EKSA 3FBFA 2KT2A 4ED1A 3R27A 1JXVA 4DUZJ 2H5JB 1GQEA 1IUJA 3UO0A 1EQMA 3PX0A 2OD6A 1WNEA 4Y6IA 1GMWD 3V4IB 3W2VA 1OMSA 4R25A 1RT5B 1KOOA 4RU2A 4X4TA 4DUTA 5LSOA 5KAKA 4NA3A 4ED7A 1R8HA 2CAJA 4K4SA 1B7FA 4QYRA 2LU1A 3KJQB 2DO4A 2CJBA 2ILYA 1D9AA 2HHVA 3PRBA 3KK1A 5GADI 3BPDA 3DOMB 4DV0J 2IBOA 2Z2ZA 2WSEC 3CCWA 4DV6F 5T7LA 1RTJA 3B78A 3JQMA 5B0AA 4JI2F 1R8CA 2ILZA 4HH0A 5AJ3F 2AJ2A 3LO3A 2B3TB 7AT1B 4RU9A 4AXIA 1ZBTA 3ZZZA 3JXOA 1FRHA 3IR6B 4LSLB 5SUHA 4ZPAA 2IIHA 3KDNA 3PR5B 2HQIA 2MKYA 3R2CJ 4B3OB 5KFQA 4FYXB 2XB2D 2OD4A 5ETPA 3ITHB 3NS6A 2Z2YB 4EEYA 1S9GA 3POTB 4BCAA 3GJRB 2GA7A 2DTJA 2CNNB 4KO0B 4FVMA 2YQ0A 5IWAF 2R2TA 3CCRS 3GSDA 2R7XA 2VZ9A 2GV1A 3EPGA 4DL5A 2VJUA 1VK8A 1F9HA 2VOPA 1O5JA 1SQFA 4Q0BA 1TUVA 1SUQB 3FBBA 1CC7A 3TJ8A 3MOZA 3FZBA 5A6PA 3HHNB 4CLPA 5F9LA 5KG2A 1AROP 3Q23A 1T05A 5J1EB 2QFJA 2ZKTA 1H6KX 4Q2MA 3SDEB 1WHVA 2O66A 4ZVTB 2DR6A 2HRTA 4CLWA 1E6YB 1DTTA 3IGNA 2UUBJ 4K4WA 5E7OB 2ZEJA 4KQZA 4IQXA 4BC7A 4MJKA 2YNHA 3U1NA 5IT9U 4JYAJ 4LFCF 4H54A 2VQFF 4DOZA 1GEHA 2W9AA 3H40A 2MKHA 1TK8A 4F4ZA 2F4VF 3D0IE 3HM9A 4CNYA 1JLEA 1R8PA 3QATA 2JEJA 1HI8A 3S1TA 4NX9A 3QBCA 3TYTA 2XS5A 4WTOB 3PG9A 5KFNA 2OSRA 4CP5A 3N79A 2ZUGA 3ZZTA 5KG5A 2ZJRQ 3CCES 5F8MA 2FPHX 2AJ1A 3HK2A 1B7YB 4LRFA 5KOWA 1HWIA 4X65J 1RAFB 5D4OA 1U02A 4IOCQ 3CIMA 2EFVA 1HBUA 4GKJJ 4DX8H 4WK1A 2CQIA 2OMOA 3MAHA 3FDSA 3S8SA 2W9CB 2XCAA 2MLXA 1FFSB 3EJMA 3VGVA 1N5YA 4R5PB 2XMJA 5J1PA 1RT7B 2ASJA 4KKOB 4F4XA 3M1VB 2HHXA 4J91A 1AB8A 4LF8J 4OYPA 5A8RA 1DHMA 1N6QB 1N36J 3KLVA 2VIHA 4G1QA 2ZWPA 2ACMA 1RKIA 3B82A 1M5PC 2RF2B 4USJC 2YNFA 2PEHA 3NS5A 2AYEA 2XHWA 2H1YA 4ZS6A 2RKIB 4KYZA 5J1EA 4YS2A 1OSCA 1FKOB 2X1GA 1JXEA 1K1SA 4DCOB 4E98A 2M88A 3MPDA 4B3RJ 2B7BB 2FJWA 3EE3A 4Z7CA 1JJHA 1I3OB 1YJUA 4QBUA 4ED8A 3PYDA 4PYDA 5LMUJ 1LWCA 2L9NA 3MDFA 1ZS6A 4O3PA 1C2PA 4DLGA 4X4UA 1RBAA 2MJUA 4OZ3A 3PW2A 2WSFC 1VIXA 4TY9A 3BN7A 3OUYB 4OYZA 1JLFB 1S0OA 4DR6J 4C0BA 5E3AA 2RVJA 4YEAA 2ZJQQ 1LNQA 4OYAA 2AP6A 1UVNA 1SCJB 3CD5A 3CO9A 3HHLB 3BGUA 2FVSA 2ZVIA 3TI0A 4ICLB 5LM7E 2QA4G 2J8AA 2C3MA 3LP0A 2BJEA 4UT4A 2XMWA 4AL7A 2PFDA 2MKSA 3L09A 3HSGA 3Q8YA 4TY8A 1R0CB 4ZLLA 4L74A 4FXWA 2VPXB 4EYIB 4EUVA 2WBRA 4ELUA 2NXUA 2W9CA 2CQ3A 1RI7A 2CRLA 1SPBP 1T03B 3M9NB 1S9EA 2JLEA 1H73A 3P49B 4RW4A 1VOMA 3VAFA 2MZJA 2AQ4A 3D68A 1MU2A 4NOHA 4ID8A 1DZ5A 4X4NA 1N52B 3CJ4A 5IC4B 5K14A 4ETZA 1Y4ZB 4J9KA 1RWNB 2MKIA 2NSBA 4MIWA 3M2UA 1FJGF 2VG6B 2KXHA 3U02A 2R8IA 2MEWA 5IZHA 2OSQA 1H2VZ 3MF5A 3J7A1 4K2XA 4USKA 1VDHA 1S1UA 2KXNB 2RKIA 3BBCA 4X4RA 2CQDA 4CLLA 1WOPA 1JLCB 4LF7F 4U7UK 4RUBA 2ATCB 4DQIA 1Y3KA 2DNYA 2ZD1B 4I2QB 1H38A 3LP2A 3QZ7A 1S9FA 3GZ7A 3NAHA 3RU0A 5IQQA 2H3EB 1UJ4A 2DIUA 2V2ZA 1VQ6S 1QE1B 3MEDB 5HJXA 2RIJA 3NGDA 3KMSA 2GVDA 1UAWA 3KUEA 1O0PA 2BJ7A 4Q2LA 2XQCA 3CULA 4ZHRA 2XO6A 4Y2KA 1C4CA 2ASYA 2KL8A 1S7HA 2CQPA 2B9YA 3C15B 4MYUA 3OUYA 5HMYA 3DLGB 1JLFA 3W3SA 1XNQF 2VHGA 4IUFA 3Q8PB 4ECUA 5A2QU 5M2RA 2NYIA 5H9EJ 4ELTA 1SKWA 4I2PA 1TUGB 3CD0A 1SV5B 4MFBA 3TX0A 5C42B 4DV6J 4RNOA 3R7NB 2ZBIA 1GFWB 3EXCX 1NSKL 4XPEA 2V4RA 1RDRA 4JI2J 2W4DA 5CZVA 5AJ3J 1QD1A 1YZ7A 2EFGA 2XLIA 2GQCA 4ED4A 4CT9A 3MWBA 3KHLA 2WCXA 2E1AA 3DHXA 2BQUA 2UXCF 1T03A 2V8PA 4DSLA 2HFVA 1KQFB 4ZPDA 2CA9A 1X5OA 3D3BJ 1VIOA 3DKDA 2V8DA 3HHDA 1MROB 3MFHA 1KFSA 2C1EB 1I94F 4DPXA 5KG0A 5IWAJ 1HHTP 2Z8QA 3D66A 3BYPA 3TVYA 4Q44A 4G65A 2EKYA 4GVBB 4F50A 2D3O1 1S6QB 1R7IA 3RBZA 2KHCA 4ID5B 1D0EA 1DY3A 2VG6A 2IJRA 4F7VA 2UZAA 3OSNA 4GVLA 1VMBA 2IJNA 3UN5A 1NDCA 4URGA 7FD1A 1HNZJ 5K8PA 4F2RA 3CJKB 1YJ9S 4PAAA 1PO6A 1FX2A 4NLYA 2BQRA 4DL6A 3NRBA 4U6PA 1HMVA 4M63A 3P45B 3CT9A 1IN0A 3OXGA 2DH7A 3NGKA 1HWKA 3GIJA 4ZCKA 4F0HA 2R8JA 1T95A 4CTAA 3T1AA 2YPYA 3CW2C 1HNXJ 3RBEA 3OL8A 2DT9A 1ZZNA 4WZMA 2ZHOA 4Z7YA 2VBYA 2J9DA 4U67Q 5L9XA 2V9KA 3OSPA 1OPIA 1YI2S 3MHYA 3G6VA 4P73A 4LFCJ 5CCLA 1UFKA 2F4VJ 1TR0A 1WKJA 2JVOA 3K5MA 1G3OA 4JOUA 3PX6A 1QAXA 3DI6A 3K17A 3OXFA 2DJWA 1VHIA 3OHAA 1SIZA 2QL5B 2QTWA 2VBXA 4PCQA 4L75A 3HJVA 4ALZA 2WVDA 3TZYA 4LQ3A 1LKZA 1UCNA 4JI6F 1Q86T 3H2VE 2B9EA 3GILA 4NI2B 2NQPA 5KT6A 4UQTA 3SV4A 5AE2A 4I6AA 1LW2A 3G96A 3KOAA 3ISND 2Z2LA 2AZ3A 4J9VA 3R5CA 3BO3A 1IR0A 2OHDA 4USWA 2EEYA 3RUBL 4PABA 1KDNA 4BBYA 2LDIA 2A6OA 2VA2A 4D3HA 4ZKAA 4WP3A 5D15A 5KFRA 1MROA 3QSYB 2HHUA 2E1RA 3M2VA 2M52A 2LXUA 3CCMS 3LTOA 2W2OP 5HMZA 3G8TA 3A8IA 5MAOA 1JWWA 3OQ2A 2C2NA 1WC4A 1WF1A 4KSEB 3A3PB 1WD6A 4UOFA 2B9WA 5L1IA 3SQGB 2AEJA 3ONQA 5HJYA 4GO7X 2PMWA 2FJBB 5KFOA 3NNHA 1JLBB 3L7PA 1FNMA 2RDDA 4LREA 3PKYA 3ZZYA 4I4BA 4NXNJ 3DRPA 2A0FB 4K2JA 5C2CA 2MQMA 3C14B 5EHHA 4N56A 1RTHB 5HN0A 1BQNB 2CQ2A 1IJFB 1V3SA 1AUSL 1EETA 2HNZB 2DNNA 4CO2A 4KHRA 2CPIA 4ZVHA 2R8HA 3T5HA 2WTFA 1T94A 4QQBA 4ED5A 1TVRA 3KKFA 3OV7A 1B64A 4EFAC 1LK7A 1DQ8A 1HNIB 3ZZRA 1LW0A 3MR2A 3W9IA 1FX4A 3OXLA 1GXTA 1FT8A 1VYAA 4WE1B 1RU1A 3G8QA 1ZPWX 2MYFA 1C0UB 2VPZB 2X1FA 4N47A 4OZLA 4O44B 4G3IA 4FYYB 1PCAA 5KFKA 3CDUA 1X4EA 2V94A 3CDBA 4CM2A 5IT4A 4LRDA 2B6AA 5FLXY 1K8AT 5F3ZA 2DGUA 3THVA 2RDJA 1URNA 4NL5A 3E01B 3I9ZA 4DPUA 1XIQA 4HVZA 5IXUA 1QSYA 4Z37A 1B0TA 1KD1T 1JIHA 1XMOF 4NZ6A 1B3TA 3HF5A 3G6XA 1S1VA 3HT3A 3HFZB 4ZLJA 1PC4A 3MMBA 2I38A 2EVZA 2W8LA 1ZM2A 2Y1RI 1MWYA 5GAGU 2YQ3A 4RW9A 4UZBA 4YR2A 1ZETA 3BGOP 3J81j 4B3TJ 2ZITA 2R3VA 3BSAA 3BGFA 4XAKA 3TZWA 2VOOA 2AX0A 5KG1A 3PNIA 3QGGA 1M1HA 3JB9k 4WZQA 1CBKA 3PM9A 5GAEI 3SCJE 4ZK7M 5H1SV 4X84A 4OFZA 2CQ4A 4BHQA 4J9OA 1XJWB 1EAYC 4XTTA 3R1HA 1BMQB 2X1BA 1HIYA 2ZZTA 2CJAA 3CB4A 3MUVP 1YITS 4X66J 2NREA 2QO3A 2XZWA 2DHAA 3TUJC 4PEOA 3UN2A 4DR1F 1DARA 4LF2A 2HNDA 5IV3A 3ISNC 4KFBA 3LAMA 2K8GA 2FHKA 3F44A 1SJ4P 2XS2A 5T41A 2DRAA 3Q8UA 4QIFA 2X51A 1UVJA 1NSPA 3ZZOA 1BC6A 3GJQB 4K4YA 1TV6B 5D8HB 1XNQJ 3HVTB 4GC6A 3MTKA 1HBOB 4A46A 4JI7F 2C2ZB 2FVPA 2QLFB 3BR8A 1IBKF 4RBUA 1TL3B 3ZZPA 3W9JA 1RT2B 1RTIA 5KT4A 3HFVA 1BWEA 2WB4A 4ECWA 2I5JB 1KRPA 3QRRA 2J76E 3H98A 2FQQB 3VGSA 4LSZB 5BYSA 3GV7B 1APSA 2CADA 2MSSA 3MEGA 4LFAF 4IG3A 2XY7A 3GR1A 1VBYA 1G2EA 3O44A 1B4SA 5EWEA 1X8DA 1CS4B 5DDOC 1R8BA 2CNKB 3ZXWA 2WW4A 3W9HA 3VAGA 3N5BA 3QO9B 2E7WA 5GAHU 2OMLA 4ZJQA 2XYHB 1VGYA 3DMJB 3DRSA 3BEGB 7FDRA 1X4FA 5I3UA 3PVXA 2V63A 3I0SB 4XO0A 1SC3B 4QIEA 2FY8A 4ZPBA 2DNHA 1S76D 3QNWB 3M4XA 2XHCA 2QC3A 3IP0A 1VQ5S 2BANA 3PRVA 3BYRA 3NCQA 3JQJA 5DM7Q 2BEFA 2BXJA 1VC6A 4DV3F 3B6BA 3QGIA 1H74A 2E5LF 2D1CA 2V0NA 5J2MA 2DXEA 4IDKB 4W98A 4Y28C 5FD1A 3HX9A 2NXCA 2CDRB 1J5OA 3GIRA 2AV5A 3K2YA 4L3KA 3MXHP 1OY8A 1S1TA 2KJWA 2V8GA 2CQ0A 4JP8A 5D3GA 1DFDA 1N4LA 4URQU 1U2RA 3W5XA 1VJQA 3VQTA 3IN5A 4EMDA 5KFVA 2ZBRA 4ANDA 2CJYB 3SMZA 1G6BA 3CCTA 2CIMA 3BR9A 1YZ6A 3UDCA 3CNQP 1HQUB 3DXBA 5CYQA 1T11A 2YWEA 2R7SA 2BJ8A 5DZ6A 2EWHA 2CNOB 3DLLQ 2DNQA 4O3NA 3HVTA 4FF4A 3KLGA 1HI0P 1HWUA 1PYOB 4F36A 2FY1A 4KHPF 1TL3A 2HWHA 2RILA 4EZ9A 4EZ6A 3IGVA 4F4YA 4OX9J 3B54A 3MECA 3JAMU 4C0HA 4JI6J 5F8NA 2HVEA 4EBDA 4ZVSB 3GQCA 2KM8C 4KC5A 3N01A 1RAHB 2V69A 3NNAA 2DK2A 4JV2A 3CMAS 2HS0A 3MEEA 2HRUA 2CKWA 3RB6A 3Q8RB 1KR4A 1NH8A 2UUCF 2EPIA 3RW7A 1UJ6A 2JVRA 2GFFA 4DF4A 2MSTA 4NLXA 5LXRA 4HI2A 3NOGA 4U8YA 2LMIA 5DM6Q 3D54A 1FKPA 2FLNA 4Y00A 2ZHBA 2K06A 2G1HA 3CCQS 4WCEQ 1QVGR 1SVDA 2P9EA 1WI6A 1KP6A 1FDNA 3D1OA 3LQVA 1VC0A 4PWUA 3PXGa 1WDDA 4MH8A 3A12A 2POKA 1IVZA 1RT1B 1VQMS 4UTGA 4NASA 1NPPA 5HVHA 1N5TA 1Z1ZA 3HLUA 2ATLA 4IDKA 4NLWA 2R7WA 3EVMA 2L48A 2XZTB 2ZH4A 2ZH2A 4C11B 2Z56B 1UPMB 1OWXA 1FA0A 2F3JA 4MMOA 1UWAA 3MPWA 1HW8A 4HHUA 4F0MA 4HACB 1RT4A 3QRQA 1S6PA 1FK9A 2DYAA 3CJ0A 4DV5J 1WTFA 2MZRA 1RKJA 1YRXA 1MMNA 2YXLA 4HTIA 4K4XA 2HKEA 4E0DA 2HPUA 3PDNA 3H20A 1TL7A 1Q8LA 1KQGB 2G2OA 3PYFA 4QIVA 3G8SA 9RUBA 5D0HA 1UL3A 3KYLA 1CJVB 4KBIA 3SFGA 1BQMB 1JLGB 4JI1J 3ET6B 2HHHJ 4USTA 2V67A 1NB2A 2DIVA 2JJ4D 3X3UA 4DLEA 4ZVUB 2YKOA 1R27B 3W8PA 3IG1A 3KG4A 2R2RA 4OX7A 2E9RX 4RWWA 4LRCA 1HBNA 3E51A 1WKKA 1WG4A 4OIXA 2LDYA 4QR0A 4PUOA 2W7OA 5LMNF 1OSDA 3CJTA 2J7WA 1UVLA 3L9ZA 1H2TZ 4FS1A 2FC9A 4X4OA 1Q5YA 2DNLA 5HATA 1KLNA 2DY9A 2R7RA 1XMOJ 2F9DA 2HZCA 1NSQA 1NPKA 2BR0A 5D0EA 3FNNA 1UFWA 3W5YA 3BDEA 3KUHA 2KVIA 4WBFA 1HQ2A 2HFNA 4MIBA 3FMBA 2QL7B 5KT3A 2LXFA 3RYLA 4RKUC 4CZCA 3ZC4A 1HYSA 2DCLA 3UD4P 4I64A 4CYUA 1JJ4A 2ZH5A 1A0OB 2RQCA 4DV4J 2ZM6J 4N7TA 3GV8B 3A3OB 4NMLA 2WVBA 4JI3F 4OV1A 4WFYA 4ILMA 1F60B 1HWLA 3RTVA 2GJ2A 3BZQA 4Y2MA 2HGLA 2FTRA 2FLOA 2H48B 4PWDA 3KJVA 2FHJA 1HBMA 2M70A 4YDXA 1RWWB 4QCLA 2PA3A 3CJRA 2E44A 2VG5A 1RHKB 3LWMA 3MMCB 3HCXA 4IR9A 1FJEB 5DQIA 5IFMA 4DL0C 5K5MA 2MLYA 3R5BA 2B56A 2CZ4A 3QIDA 1WTBA 3MAAB 4M95A 4NLQA 4JI7J 2AJFE 1SC1B 4ZVOB 3MCOA 1FRJA 5BR8J 2H4YB 3S01A 1VQ4S 3LP1A 2YH1A 4NYPA 2XYPB 1NXIA 2DEIA 4KV8B 1AYEA 1NUEA 2DNOA 4NXMF 1XMQF 4QZVB 4WKYA 5K20B 4QOTA 3NKYA 2GGPB 2IRUA 4ED3A 5I4MA 4MTPA 5KFWA 4RBTA 2W7AA 4LFAJ 3WIUA 1DLOB 4BWJA 2Y9HA 1CJTB 4P9SA 4DPWA 1MG7A 4NA2A 1HQEA 2B4VA 3DLKA 4M5DB 2DHXA 3T3FA 1R6VA 4J37A 3M05A 1RWUA 4LR8A 3M8QB 4AUKA 2IRXA 2BE2B 4QYZK 4CH0S 4J9QA 2CPZA 4ZPTR 2RD5C 2F63A 3IWXA 3V5RA 2A1BA 1UEUA 2ZE2A 2PN6A 1GXLA 2YWHA 4CNZA 1MMLA 4P2FA 4KTQA 1VQOS 3V6KA 5E41A 5MLCV 2OTJS 3CDEA 1NJWA 3JTOA 3QZ8A 4KH1B 5KG7A 4ECXA 4ECTA 2LQJA 4A4JA 2Y1LB 1PSDA 4YHHF 1I51B 4U95A 1Y5NB 2IVYA 1A6LA 2PI5A 2V5HG 3DRXA 4OJ3A 4Y2AA 1N34F 3TAPA 2GC8A 3K7RA 3MPVA 2E5LJ 2CJKA 3RZAA 4KGMA 2Y1JA 5KFMA 1IBLF 3AA8A 4OI6A 5EN1A 5DDRC 4TU9A 3WDOA 4CT8A 3OJUA 1N0VC 2KKHA 2DD8S 3I5BA 4B3SF 1K9MT 3MMAB 2IYIA 2EK6A 3ZZUA 4NCGA 1TAQA 3M2RA 4ZP7A 4R0EA 4Q45A 4FBTA 3K57A 2VDHA 5CXTA 2CZ9A 4B9UA 2BJ9A 4ELVA 2XG8A 4ZPWR 2QEXS 2HQFA 2MHEA 1NEEA 3CIZA 5DG8A 1FCAA 1BE4A 2NZCA 3Q2TC 1WEXA 2OEMA 3R6LB 4ER8A 3EDRB 1ULRA 3KK2B 2Q1LA 3PHTA 2CQ1A 3HVAA 3UDLA 5IM0A 2XSFA 3J7Z5 2W9BA 2UP1A 3QIPA 1HPZA 2OPQB 3V6DB 3P5TL 3IS9A 1GTHA 4S0MA 3HMJG 3C6TB 3MM5B 1Z2ZA 1S0NA 4TQSA 3R6GB 1WEYA 5F8GA 2HLTA 3EGWB 2YKNB 3J81U 2HEKA 2QA4S 1PJ5A 1YJ7A 1JLAA 4ZA1A 2MXYA 3SCIE 4ES2A 4DUYF 3GIKA 5KOXA 1RT6B 1LEOA 4CCHA 2FJDB 2M0GB 1CPZA 2ROEA 2D7SA 3WIVA 4K4VA 3DFEA 2IA0A 2J9EA 2YKMB 3EXYA 2P9CA 3H59A 1F9FA 5HI7A 2XWXA 3DOKA 2WRMA 1YX2A 1NSAA 1JLQB 3UE2A 4NLDA 2F4FA 5J2PB 3AA9A 4LT6A 5KFZA 1SQEA 1TL1B 3K89A 1KC8T 2AMCB 4A8OA 3TVZA 2N7YA 4IKAA 2HWTA 1KSPA 4KH0B 3BSCA 4HT7A 1IM6A 3R9LA 4GMKA 2BJDA 3DGPA 3AOCA 4OLPA 1S79A 1OQ6A 2HFZA 3IM8A 4R8UB 3HPOA 2ZH7A 2H5EA 1EQ0A 1D1UA 2LQBA 2XZDB 5DO2A 1N8RT 1IKVB 3ZNUA 2BBEA 4ZDNA 5HROA 4WFXA 2RS8A 3RBXA 3KLHA 2HGNA 2O3DA 2ERRA 3HZEA 3A3NB 4LMZA 4JB8B 4MK7A 2QSWA 2QJ3A 2EW9A 3M32B 2FLLA 2OGUA 4EO8A 5HVFA 5DGAA 4FN5A 1HW9A 5G0RB 1OPZA 3SYZA 1D3WA 4C4WA 3AD8C 4C3LA 2C2DA 3BS9A 3IMQJ 5HAOA 1FDAA 2J6UA 1MWZA 3T19A 4DX5A 5C2GA 1RWKB 4K7QA 2A18A 5GVQA 2VQEJ 3DLBA 2DKOB 2OPQA 2XMKA 2ZOGA 4HYKA 3TA1A 2OPSB 4PYAA 1WC3A 2N82B 3MM5A 2B5JB 3OPKA 1TKDA 1J5EJ 1UWBB 1U2CA 9ATCB 1S6OA 1D09B 1XC9A 2DB1A 2RRAA 3NCRA 1FXDA 4QIGA 2EKNA 3D7SB 3V2UC 4ED6A 2LA6A 1TL4A 2DNGA 4DR4F 3FBCA 1SC6A 1R8AA 4ZOSA 3THTA 3J80Y 2CWKA 2AZ1A 3TP2A 4CO5A 3MM7B 2CPHA 3OL6A 1KNZA 5JMNA 2DNMA 1RT6A 1LV5A 4B9LA 2HHWA 1X9WA 3R2DJ 2ZBPA 3JYTA 3QT8A 2W24A 1SKSA 1N32J 3DRRA 2CPDA 2DY1A 5CZXA 1VR6A 2OUGA 2Q6CA 3FMWA 4UOGA 4DU8A 3VAJA 4NLPA 1TKTB 1KVJA 3V81A 4DQRA 3ZZ0A 1MW7A 3MM9A 3VWSA 4O3QA 1CEZA 4WK3A 1LWEA 3I56S 3D1HA 4USMA 3W66A 3H2LA 4ED2A 2HW3A 3HD2A 2YQ1A 2HLUA 5L1LA 2MJNA 1NK9A 1XQIA 3UD5A 3K8VA 3OFHA 3IXQA 4X4VA 4A8QA 2U1AA 1C0TA 5E3PA 2IMWP 4C8LA 5IS2A 1EP4B 3DM2A 2BABA 2YNIB 2OPRB 2VKZG 2ZH8A 1YLXA 3HZGA 5CCMA 1D8YA 2G2YA 4A8FA 3RAQA 3J7AN 3ICLA 2LYVA 3S7RA 1PJ6A 2X3GA 3Q0AA 4Y2CA 1C4AA 3I5AA 2FJEB 4LRBA 3I82A 4C3MA 3FQLA 1VRTB 3MM8A 4C8NA 2XULA 5KFLA 4AQYF 3UR0A 4RWXA 2FHJD 2GX8A 1QUVA 4WYLA 5F9NA 5HBMB 4C9DA 1IKXA 2YVSA 2PI4A 4ED0A 3R7SB 3BBFA 2LQ5A 3WC0A 3KK3B 5A8KB 3CXCR 3FCHA 4ANEA 5F0WA 4MKBA 2V4JB 3AOAA
chains in the Genus database with same CATH topology
2IHR1 1KQSR 3NNCA 1F2GA 2R8JA 1YG0A 1T95A 1FRKA 4A8SA 4CTAA 4RBVA 3T1AA 1UWBA 2LXIA 2ZNZA 3DOKB 4O4GB 3RBEA 2DITA 3M9MB 1I6JA 2XMMA 3CCZA 4ZVFA 3OL8A 2DT9A 1ZZNA 1P1TA 1WG5A 3KNGA 4F3QA 4WZMA 2KT3A 1GT8A 2ZHOA 3B4DA 2EI5A 2DRBA 2VBYA 4QPXA 2J9DA 3RR8A 4I0WA 4U67Q 1SKRA 3PV8A 3IC1A 1IJEB 1X4DA 5L9XA 3H25A 3K58A 2V9KA 3OSPA 2C3UA 1OPIA 1YI2S 2E5HA 4WJBA 4ZP9A 5L1JA 5E3QA 1M5SA 2DBBA 4W92B 3A8EA 3MHYA 3G6VA 4RW6A 1TKXA 4CO3A 3LP0B 4MK8A 2KU7A 1HD1A 1YQHA 2CJQA 2HAIA 2RE1A 3UQSA 5CCLA 3GG1A 2HQ3A 2NS1B 3DLEB 4TY8B 3DC2A 3ULHA 4C2MA 4DV1F 2MQLA 2RSQA 3AAWB 1TR0A 3H2UB 2MQPA 5CYJA 4E8UA 3KLEA 2JVOA 3K5MA 1G3OA 4JOUA 3WZ0A 4Y0FA 3PX6A 1QAXA 2K7KA 3DI6A 1X5TA 1P9QC 1KFDA 1SJ3P 1K0TA 3N6NA 4OZ5A 3UD3P 4RLEA 2DHGA 3OXFA 3UPFA 1XTZA 3K59A 3CD6S 2DJWA 2NZ4A 2XGPA 4PQUB 3KLIA 1O8BA 3O8WA 1S9EB 3PKMA 3OHAA 1TKZA 4CH1A 3GIMA 2PO4A 2FLPA 1T8EA 2C3PA 1SIZA 2KFNA 3OR2B 5DLGA 1NNDA 4DL4A 2VBXA 2KXFA 3OR1A 4PCQA 3PW0A 4QU7A 3KTQA 4RW4B 5HROB 4ALZA 4F3OA 2KFYA 4LQ3A 2CVIA 1LKZA 3C46A 4JI6F 1Q86T 1OQ3A 1QAJA 3H2VE 1UA1A 2JEFA 3GILA 1QAYA 2AYGA 1SJQA 1WHWA 4Q7AA 1VQNS 1VQ7S 2NQPA 3QMQA 3KLHB 2PA8D 5KT6A 1N54B 1HD0A 2KT5A 4UQTA 3SV4A 4IG0A 1MU2B 5AE2A 1HNVB 2I1RA 2QZ8A 1WWHA 4I6AA 1LW2A 1TV6A 3G96A 3KOAA 3CJ3A 5IT0A 4K5RA 2IM2A 2ZC4A 5K14B 3ISND 2Z2LA 5KFDA 2D9PA 4L3NA 1NK4A 3MGJA 5AXMA 4K59A 1HBOA 3M2UB 1X4GA 3R5CA 2GMHA 3BO3A 3PIOQ 2ZZMA 4K0KF 1HL6A 2N3LA 3NG8A 4YY3F 5KT5A 5JVHQ 1OIAA 2IFXA 1IR0A 1FHTA 1FKAF 2CPXA 5KFPA 2KM8B 1FRIA 2B0GA 1LK5A 1QLNA 5KG3A 3CCLS 4ZP8A 5D78A 5I42B 1T7PA 2ZKUA 2R8KA 4BBYA 3MUMP 5L38A 1S1UB 1S10A 2LDIA 1RT2A 4H4OA 2VA2A 1FRMA 5KG6A 4D3HA 4ZKAA 4KPYA 4B9SA 4IR1A 5DLFA 4KB7A 4RNMA 2DGVA 4NLUA 4NRUA 2DGWA 2RQMA 1WACA 3GYNA 5KFRA 5F8IA 1MROA 4I1TA 3EYZA 3OW2R 4F8RA 4NXNF 4X2BA 2I5JA 3TARA 1BGXT 1UA0A 3R5DA 2KG0A 4ES1A 2HHUA 2E1RA 3M2VA 2XS7A 1HHSA 2M52A 2QYCA 4HHJA 2LXUA 4DSIA 2JLFA 4KR0B 4QWEA 3CCMS 3SSQA 5C24A 2PMZD 3D0GE 3CCUS 4NCAA 4JBCA 1IKYA 3W2WA 3EGNA 5AXKA 4RW8B 3LP2B 5HMZA 1X9MA 3G8TA 2PIIA 2XNQA 3RRGA 2KH9A 5KG4A 3QJJA 1Q1KA 5MAOA 1JWWA 4QR1A 3OQ2A 3TO8A 3WC2A 1S1XA 1WF1A 3TX8A 3GMGA 1Y3JA 4CO0A 2BACA 2JH3A 4AL5A 4KSEB 3A1YG 5DG9A 2OKQA 4HT5A 1WD6A 5CYMA 2B9WA 5L1IA 2LVWA 3Q24A 3SQGB 1WF0A 2LECA 2KZZA 3QO9A 4W90B 4ZHRB 1TFYA 1TP7A 3ONQA 2CVEA 4GO7X 5A6WA 2EFOA 1A7GE 2XMVA 3LALA 2FJBB 3DMJA 2FVCA 3UFCX 3CMES 5KFOA 2M8HA 1IXKA 3NNHA 4B9MA 1JLBB 1MSWD 3L7PA 2D41A 4RW7B 1FNMA 4DFJA 3I0SA 1N5VA 2FGCA 4DL7A 1DTQA 1ZTTA 5L39A 3PKYA 2J9CA 2F8HA 1FRXA 3ZZYA 2HRYA 4I4BA 1KHWA 3DRPA 4MAKA 2V4JA 4IH6A 4PQAA 4LF4F 3JYTB 4B9TA 2UVUA 4GKKF 2D9OA 2MQMA 5EHHA 4N56A 4XIUA 1C1CA 1XR5A 2VB6A 3DRRB 1CQNA 1SL2A 1RTHB 1SL0A 2K1RB 5HN0A 4A8MP 2R9LA 3HXMA 3H4BA 1BQNB 2DPJA 4A48A 3M8PA 2CQ2A 2MGZA 1IJFB 1V3SA 3MCSA 1EETA 4TNOA 3P3DA 2KG1A 2HNZB 3N28A 4H4MB 5KFBA 1VQ8S 4I2PB 3GR0A 4EU0A 1KQKA 3HKWA 1REVA 2DNNA 4EBCA 1D9DA 3V81B 4CO2A 4KHRA 2ZH3A 2CPIA 4RUHA 2MKKA 2D3ZA 4ZVHA 3F41A 4MFBB 3MM9B 4HDHA 2U2FA 2LEAA 2R8HA 3T5HA 2WTFA 2PT0A 1T94A 2D3UA 3FFIA 3TR5A 4L6V3 4QQBA 1LWEB 4ED5A 1TVRA 3KKFA 1VRUA 1S1WA 1XMBA 3FEXB 3M30B 1N5SA 3OV7A 2W7PA 4DR7F 1B64A 4EFAC 1LK7A 1XBWA 3BB5A 1DQ8A 4OZ0A 4B9VA 1N33F 1HNIB 3ZZRA 1B0PA 1LW0A 5FIIA 3MR2A 2R2UA 4K4UA 4PG6A 3HHLC 3OXLA 2W4CA 4X62F 1GXTA 3HFKA 3FGVA 1U45A 3VALA 4DPOA 1YRUA 3CCVS 1FT8A 4Y2IA 4WE1B 1D9FA 2IA6A 2F40A 1XWLA 2VG7A 2HNYB 5KFCA 4C8KA 3FEYB 2UUAF 3IFEA 2E5GA 3G8QA 1Q16B 4BC9A 1RK8A 1ZPWX 1C0TB 4PQUA 2MYFA 2GO9A 1NJXA 4TU7A 2GIQA 1C0UB 2VPZB 2X1FA 3CJ2A 3DM2B 5IT9Y 4LF5F 4N47A 4OZLA 4DUZF 4O44B 4G3IA 3OR2A 3E8OA 3VAKA 3NP5A 1IKWB 5J2QA 1Q4RA 4O0IA 1DAXA 2YH0A 4OHXA 5KFKA 5T14A 1TFWA 3CDUA 1GTEA 1X4EA 2V94A 3VCDA 3LGNA 4RNNA 2ZHAA 1CC8A 2DISA 3CDBA 5CA5A 5F8HA 5IT4A 1Q53A 5E3CA 2ROPA 3JSMB 2B6AA 1DQAA 1W2IA 3IAS9 3LUYA 5FLXY 1K8AT 5F3ZA 2VL1A 4QR2A 1WF2A 4ILRA 1HQUA 2A3JA 2DGUA 3BF4A 2RDJA 1GNKA 3THVA 4YB1P 1Q82T 1W2BR 1URNA 2YNGA 3VQSA 2RU9A 4A8YA 4B3TF 3QPIA 4NL5A 5CQGA 3T6BA 2VONA 3GFYA 1KLMB 1ZYQA 3SXLA 1A9NB 5B08A 4F26A 3MM8B 3E01B 4IH5A 3I9ZA 5HP1A 1NKCA 1M90T 4HVZA 5IXUA 4TYAA 1E6VB 5L1KA 1X4HA 3DU6A 5A0YB 5LSRA 3PIPQ 1QSYA 1LFPA 2N7CA 2X1AA 3RR7A 5F0UA 4Z37A 2MDAA 2IC3B 4DHVA 1JKHA 2V2KA 4M1KA 2R7UA 2YKQA 3VTIA 4NYOA 5BYRA 1B0TA 1KD1T 1NJIT 1KONA 2UXDF 1IKXB 4IFVA 2JX2A 1JIHA 1XMOF 2FJXA 3O2IA 4NZ6A 4PKDB 2JL9A 4C7QA 3HF5A 1WG1A 4QIWD 3G6XA 1S1VA 4ITSA 3SSSA 1K73T 1YSJA 2YX1A 3HT3A 2BDPA 1YWXA 2I9SA 1C1BB 1HMVB 3VZIA 2C3OA 3FZ2A 3T9NA 4CIOA 4K50A 1PC4A 4Z2XA 3MMBA 5DQHA 2I38A 4DV0F 2A2CA 2EVZA 1ZM2A 2W8LA 5HLFB 2Y1RI 1N5QA 1MWYA 1SIWB 3BSNA 4UUXA 1S72S 4ZVGA 2EG2A 2PMHA 4PXBA 3ZFVA 5THWA 3D5MA 5GAGU 3RBDA 4X66F 2YQ3A 4RW9A 3DYAB 1M5HA 2AWZA 4YR2A 1ZETA 1RT3B 3CC4S 4CTAB 2ZITA 1VBXA 4KHMA 5J2NA 4JI5F 3BSAA 3BGFA 4XAKA 1Q8BA 4RW8A 4J9MA 1RP5A 2PDAA 4YMEA 2VOOA 3T1HF 3N6MA 4X4PA 2AYMA 5KFUA 2AX0A 2A10A 5KG1A 4ES3A 2C42A 4ZP6A 2EK1A 2F8MA 3PNIA 3KLFA 2RDIA 1PGZA 3QGGA 1CLFA 1KEKA 3JB9k 2RQKA 2B4UA 1F0XA 1T3OA 2WW8A 4WZQA 2LEBA 1U4BA 2J6SA 3BREA 3PM9A 5GAEI 3SCJE 4ZK7M 5H1SV 2VD3A 4GO5X 2WK4A 1TQLA 1TKXB 4RW6B 4X84A 1U09A 4OFZA 3C8YA 2DVIA 1P27B 2ROGA 2CQ4A 2J0XA 1V9OA 5FDLA 2KN4A 4BHQA 2E1MC 4DQSA 4O3SA 4J9OA 4CO1A 2CDQA 2GHPA 2XY6A 3JTNA 4USIA 1U48A 1FXLA 2M7SA 2V4QA 3DLJA 3Q8QB 3R1HA 4DL2A 2X1BA 2XY5A 2CJAA 2GMJA 5GADU 3CB4A 3KLEB 1X4CA 2P9GA 2XMUA 1VFJA 4DBQA 3MUVP 3D28A 2UXBF 1YITS 4HLBA 3DI6B 1H0HB 5KFJA 2XI2A 1FVSA 2K7JA 2MKJA 1ZM9A 4HI1A 3G4SS 2ZH6A 2QO3A 1S97A 2XZWA 2K1RA 2NREA 2J0SD 2DHAA 3N9UC 3TUJC 5F41A 2B7CB 5EX0A 3I9V9 3KLIB 4M94A 4DSKA 1TKZB 3QAEA 4DR1F 4NPOA 1DARA 3K5PA 2HNDA 2R7OA 1IQZA 2FD2A 3ISNC 5CH7B 4KFBA 4DMZA 1U1QA 1RJJA 3P96A 2PSZA 1RT1A 4DEZA 3MAQA 3LAMA 1Q78A 2K8GA 3OR1B 4ERDA 1J2VA 4PR6A 4JV5F 4O3RA 2WONB 2BM0A 3D0HE 4KIAA 3T5KA 5B0GA 2FHKA 1K1QA 2MPUA 3F44A 1ZPVA 2UV8A 4Y3CA 3I4HX 4FPRA 1SJ4P 2XS2A 2IM1A 5T41A 1N0UA 4J5OA 2DRAA 2P6SA 2UV8G 4QIFA 1ROFA 2QV6A 4OL8A 2X51A 1UVJA 3M30A 3IAM9 4IG0B 3ZZOA 1BC6A 4ETXA 5DGBA 1QJHA 5KFGA 1KVIA 3EZ5A 4K4YA 1HA1A 1LW2B 1TV6B 1X4AA 4RNHA 4C11A 2VFUA 1U1RA 3KNAA 3N6LA 5D8HB 2FHOB 2UVWA 1KTVA 4C8ZA 3CC7S 3HVTB 4GC6A 2NR0A 1M5OC 3MTKA 1HBOB 3J81Y 1Y0HA 4A46A 3PACA 1YJWS 4JI7F 1YBAA 1HI1A 2F8EX 2IJFA 3CTRA 5DG7A 3BGRA 1R0AB 3DLHA 1U1MA 2V8HA 2XLKA 2AYBA 2XWYA 2FVPA 3BR8A 5J1NA 5LL6d 2ZJPQ 3M6UA 2LCWA 3OHBA 4HKQA 2VFTA 1RAJA 4LIWA 1IBKF 4RBUA 4TXSA 1TL3B 2WBMA 3ZZPA 2UUBF 2OFHX 1RT2B 4H4OB 3DN9A 1RTIA 2JOQA 3IR5B 3TAMA 1U2FA 5KT4A 4EGLA 4HEA9 1UW4A 2M8DB 4C8YA 4N8OA 1V3RA 5A8WB 1U7LA 1WHXA 2IM3A 3NBPA 4WFAQ 2CPYA 2RUGA 5JJBA 3K5LA 2GO8A 4UOCA 4DR5F 1BWEA 3GFZA 3PY8A 3HVWA 1UEVA 3OTEA 2WB4A 1HARA 4ECWA 3C3LA 5KFXA 2Q6BA 3DXSX 2I5JB 4F67A 3J7YI 3OTDA 1KRPA 2J76E 1U1LA 3M2VB 2UU9F 3H98A 2ALZA 3NL0A 1NAQA 3EZUA 1VQSA 5C24B 4HDGA 5BYSA 3GV7B 2B9XA 1APSA 2BW2A 3QLHA 2XI3A 3I32A 2MSSA 1IKYB 3MEGA 3W2WB 1WEZA 4LFAF 4QU6A 4IG3A 2XY7A 3UNGC 3GR1A 2JRSA 2WB1D 2RH3A 1JNRB 1VBYA 1G2EA 1W25A 1BQMA 1JLGA 3O44A 1SL1A 4FXDA 3CCSS 2HHQA 5EWEA 4V19J 1X8DA 4RUCA 2IC3A 1S1XB 5DDOC 1R8BA 1SJFA 3KMQA 2EG1A 2DR7A 4TN2A 2N4DA 3CEDA 3IBWA 2FVRA 4N41A 4LJMA 3PEJA 5CYMB 5K8OA 4OJGA 2WHOA 1RYSA 3HO1A 1YJRA 3VAGA 3N5BA 3QO9B 2E7WA 2QA1A 3PRDA 4X64F 1JXLA 4AL6A 5GAHU 3QAUA 2OMLA 3G6YA 1VGYA 2CG4A 3DMJB 1NK0A 2G1DA 4USHA 1YRTA 2E1CA 3DRSA 3BEGB 7FDRA 2I8EA 1X4FA 4DN0A 5I3UA 4H4KC 3PVXA 2ADCA 2EBEA 3I0SB 5U47A 1VK3A 1DTQB 2COLA 4XO0A 1U47A 4QIEA 4PG5A 4WU2A 2IMOA 2M3DA 1R89A 4ZPBA 3DRPB 3V4IA 4FYDA 4QYZJ 2DNHA 2KB2A 1S76D 3M4XA 3I55S 3QJPA 5B0FA 5KFFA 1VQ5S 3DYAA 1RT5A 1RT3A 2DH8A 1C1CB 2BANA 3S6EA 4R0JA 3T6JA 2IYGA 2VH7A 3NCQA 4OHVA 3NMRA 4C97A 1U8SA 4PXEA 5DM7Q 3M8PB 3MI7X 2MGZB 3Q22A 2GNKA 1EETB 1VS3A 5D4PA 2JFKA 1VC5A 1NK5A 4GKJF 3FSYA 4JI4F 1LXNA 1REVB 2BXJA 4EWTA 1VC6A 2IRYA 4DV3F 4I56A 4LSNA 4OHYA 3QGIA 3TRGA 2OFGX 4UY85 2AX1A 3OVBA 3H5XA 5DRKA 2E5LF 2D1CA 1KN6A 4WKRA 2V0NA 5J2MA 3FFIB