1J2VA

Crystal structure of cuta1 from pyrococcus horikoshii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
MIIVYTTFPDWESAEKVVKTLLKERMIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural implications for heavy metal-induced reversible assembly and aggregation of a protein: the case of Pyrococcus horikoshii CutA.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords 102AA long hypothetical periplasmic divalent cation toleranc
total genus 27
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j2vA00
3BZQA 3AA8A 2NUHA 1HWUA 4USJC 4C3LA 4E98A 4NYOA 4RWWA 4YB5A 1GNKA 4R25A 2E66A 2O66A 4Y6IA 4WK1A 3GSDA 3T9ZA 1V9OA 4OZLA 2EG1A 4USHA 2NS1B 4YB7A 4C3MA 3M05A 3LF0A 1PILA 5D4NA 1V3RA 4WK3A 2CZ4A 1UMJA 3TA0A 3DFEA 1H3DA 2DCLA 5D4LA 4ZK7M 1UFLA 4RWXA 2XZWA 1UL3A 3NCQA 1KR4A 4NYPA 1VFJA 1UKUA 1QY7A 2EG2A 3N5BA 1NH8A 2ZOMA 4CO1A 3OPKA 1NH7A 3TA2A 4D3GA 3MHYA 4YB6A 1V3SA 1Q1KA 2PIIA 4CNZA 2XULA 4CO3A 1NZAA 3O8WA 4OZJA 1O5JA 2NUUG 1OSCA 5DRKA 3NCRA 4D3HA 4RLEA 5DS7A 2GW8A 4IYQA 2RD5C 4C3KA 1NAQA 5L9NA 3AA9A 3CE8A 2XBPA 2V5HG 2VD3A 3O5TB 4OZNA 2J9DA 2Z0GA 1J2VA 3NCPA 5D4PA 4CO5A 3L7PA 2J9DE 2J9CA 4CNYA 4CO2A 4AFFA 2J9EA 1VHFA 4Y65A 4RX6A 1V6HA 2JJ4D 4CO4A 3AH6A 1P1LA 1XK8A 2GX8A 4USIA 3HLUA 4CO0A 2GNKA 2ZFHA 2XG8A 2O67A 3X3UA 3AHPA 3TA1A 1O51A 5D4OA
chains in the Genus database with same CATH superfamily
2HNYA 3NY0A 4KHRA 2R2SA 2VICA 1QAIA 2PI4A 2BA9A 2BACA 4ZVTB 4YHHF 4DV6F 5JVGQ 5CZXA 5HMYA 2FJEB 1GFWB 3TAMA 5C2GA 4N7TA 4DUZF 1TU0B 3KDOA 1QE1A 1GNKA 1YWXA 4OJHA 4LSNA 4DPXA 2RU3A 3U7JA 4AT1B 2PSZA 2ZKTA 3PYEA 4F67A 5HMZA 1HPZA 2BANB 3I87A 3I4HX 1V9OA 2BOAA 3TX0A 4F2SA 3RB3A 5F8JA 1Q8LA 4ITSA 1AZSB 2DGUA 4K5RA 2C22A 2DH7A 4DS5A 2ZH2A 1Y5NB 4JV1A 2ZHOA 4QIFA 3HSGA 5HN0A 3ITHB 4JI3J 2VJVA 2CJ9A 5LJ3Y 4DQQA 4NCBA 3IA0A 3J81Y 3QJLA 3PACA 3PJ9A 1VR6A 5E7OB 2E5LF 2KTQA 2OLWA 4DF8A 3GTYX 1QTMA 4NA2A 1SIWB 2MKCA 4DUZJ 1TL1A 3HULA 4X66J 6FD1A 2ERRA 1OWXA 2OO4A 1BUXA 2FZGB 4DCJB 4RWXA 5FD1A 1FJGJ 3Q8UA 3BGOP 4ZP7A 1S6PB 2YNGB 2LA4A 3ET6B 3V81B 4C8OA 2MDAA 1XR5A 2W24A 1GMWD 1RT2A 2Z2ZA 3BQ0A 2X3DA 2ZHBA 2QLFB 2KT3A 4O0NA 1TL5A 2QO3A 1ZBTA 3TUJC 1XN9A 2V34A 1Q5VA 1QY7A 3GFXA 1RAIB 5KG7A 3PR4A 3MUMP 1U2RA 4DL2A 3J7A1 1URNA 2H4YB 4YMEA 1S1TA 1CJUA 2FHMA 5J2PA 2Y1JA 1U26A 3R5BA 4IDKA 2MZJA 1ELOA 4CP5A 1F9EB 1WKKA 4X2BA 5GAHI 5E3QA 3UR3C 1HWJA 2ZD1B 4DPYA 3CMAS 3NL0A 2DHSA 2EFVA 3CD0A 3LP1B 3HHLA 3SQOP 1AZSA 3EZOA 1SCJB 2CA9A 4FKXA 2R8GA 2E7VA 4H4MB 2HVEA 4X65F 3GYGA 5F3TA 5D0HA 4DR6F 1S6QB 2HURA 3RAMA 4KGKA 4CLZA 1WG5A 2VA2A 5KG2A 1Y5IB 3QT8A 3W66A 3S01A 3JYTB 4GO5X 4EZ6A 2B7BB 3KLGB 1L5UA 1F60B 1NPRA 2QIFA 4C11B 4A46A 4N56A 3QBCA 2UV8G 1FEEA 4ZKAA 4W92B 3K0JA 3K8VA 3H59A 4A47A 3OSNA 1VQPS 3QJPA 2WB4A 4H4OB 3NOCA 2JWNA 1T11A 1T9VA 4U8VA 3W62A 1NK0A 1SKRA 2PI5A 3M8YA 3KMSA 3MPVA 3SDEB 2BQ3A 3JSBA 4OX7A 1KQFB 1RT1B 3GYXB 4MH8A 3PIOQ 4ZVFA 2VH7A 1IBKJ 4F02A 2FIUA 2HNZB 3ZZUA 5DM7Q 3I0RB 2CJYB 3IS9B 4ID5B 4L74A 5J1EB 3TUZC 2GMHA 3NCPA 3QZ7A 1TL3B 2ZEJA 1T05A 3ZXWA 2D41A 1FTRA 2ZDPA 4DSKA 1HBMA 1X31C 3NMAA 2HAIA 3DM2B 2R2RA 5KTQA 2FB0A 5J1NA 4DV5F 2E1CA 5HATA 3NMRA 4QIWD 1HYSB 3S1TA 3W61A 1XMQF 1RADB 4B9UA 2HYIB 2CZ9A 2YWEA 4N76A 3T5LA 3E51A 4DV1F 4IG3A 2F5GA 5C42B 4G1IA 5DQIA 3KJQB 3N6LA 1FA0A 2H3EB 1X5OA 2YWKA 2ZKUA 3FMWA 3HLUA 3MM5A 4NA3A 4QR2A 4C0OC 4F4AA 3CD5A 4ANDA 5AXKA 2C2KB 3OXGA 4IRCA 1AUSL 2MKYA 3S8SA 5H1SV 5DJBA 3WZ0A 1WHVA 5IM0A 3RBDA 1LWCB 5GMEA 1YIJS 2JLGA 2BM0A 1D9DA 2JH3A 2N3LA 1E6YA 1CJKA 1YTYA 1TMJA 2AW0A 4QWAA 5F8LA 4DPUA 2NZ4A 1OJ4A 2GJFA 3HVTB 5KFUA 3G96A 1RAHB 2QMWA 1XBWA 4C8MA 1H72C 1LQ9A 2CQDA 3GV7B 1DTTB 4OI1A 2C2EA 2GHWA 2GIRA 3UN3A 5CYMB 1TL3A 2LU1A 2CJQA 3NWGA 3L7OA 5DG9A 4JI4F 4K2XA 1FVSA 2BMBA 2R7WA 1NKBA 1JJ2R 1VLOA 1GX6A 1JLGA 3QWUA 1R43A 4MKBA 3VCDA 4YQWA 2W9CB 2HHQA 4KFBB 2DK2A 3OLAA 5U47A 4FXVA 3M9OB 3HCXA 5KFQA 2RVJA 4F4ZA 5CAAA 1RSCA 1S59A 2MMYA 2RKIB 2HHXA 3HK2A 3PRBA 3J7Z5 2YWWA 3N6NA 2MTLA 1HKAA 4ZK7M 1Q82T 4DR3F 3DMJB 1VQ8S 1WACA 2KVQE 2Q79A 4JI0F 1X0FA 2KXHA 4IH7A 1RT3B 2G1DA 1GTEA 2HS3A 3KUHA 2DGTA 3P96A 4DV3F 1VQOS 1RWPB 5ADZA 1U49A 1I6JA 3QRRA 4DR7F 4Z37A 2G0IA 1XMBA 3OR2A 3UVJA 3VGVA 1BQNA 1GMWA 2V9WA 2C42A 4HR2A 4DCOB 3QNWB 4DV5J 4WP8A 4K4WA 1K47A 1E6VB 1Y3KA 1AFJA 4P7VA 5GVQA 3CSKA 4HKQA 1TK5A 2PC6A 4OZ5A 4ECZA 4NLDA 4A8WA 1J5OB 2VL1A 3KNAA 4YN3B 1HI1A 2L9WA 3OR1A 5KG3A 3M2VA 4ZOSA 4ZPWR 2DNHA 1DARA 5HBMA 1RHRB 2YKMA 1VI7A 3GLJA 3MEGA 1SL2A 1YGYA 4ANEA 2BM1A 1X9WA 4W90B 2W9CA 1Q53A 1Q78A 1TV6B 2W8KA 2ZH7A 2KXNB 1D09B 4A8XA 1UW4A 1F5AA 5L1JA 2ACYA 4WFYA 4ZP8A 1RTJA 1WC4A 1RLCL 3HDSA 2ZVIA 4UZCA 1JX4A 4U8YA 2CADA 5CYQA 3PW5A 4RL1A 2GFFA 2N82B 1PC4A 1X0PA 2A6MA 4OI4A 4XDCA 3RBXA 2HSEB 5C5JA 3J81j 2ZH1A 2YKAA 1NK9A 3HHDA 2NR0A 3KK2A 2E5GA 2BQUA 3KK3B 3I9V9 1SXLA 2EFGA 2XNQA 2XLJA 3LGHA 3K17A 2ACMA 2LVWA 4USKA 3EX7B 2Y3YA 1HBOB 2MQMA 3B6BA 3BGLA 4M94A 4FYVB 3H7HB 1RDRA 2WSEC 2HNDB 4OZNA 1WHWA 2KT5A 2IYIA 2BZ2A 5I4MA 3BJYA 2CNKB 3R7NB 1MMDA 3C14A 1J2VA 3MOZA 1KQKA 2BKPA 1R8CA 2ZUGA 5KFSA 3TUIC 4CTAB 5D3GB 1RYRA 4P2FA 3FUYA 1Y3JA 2DD8S 2JX2A 2M2BA 3GP9A 3PFOA 2EEYA 3H5XA 5AE1A 4DR5F 2F8HA 5F0UA 3OL9A 3VQTA 5ITHA 2J9EA 4I2PB 1HWIA 2OEKA 4PXBA 5JJBA 4V19J 2DNYA 3HT3A 1BXNA 2AGPA 1GK8A 4OL8A 4PUOB 1NMEB 4YHHJ 2JVOA 2LEPA 1XQIA 3ELHA 3TEGA 3JAMY 4DV6J 3CJ8A 2RUSA 3NG8A 4YUDA 4U7UD 4V1Ak 3I0RA 5J1EA 2UXDJ 2MQNA 1PYOB 2CYYA 2XG8A 2B8PA 1FRLA 4ES2A 5IWAJ 1NJXA 3X3UA 3O3LA 1L3UA 5B0CA 3JB9k 2UVVA 5D0RA 3BKUA 1NDKA 2PMHA 3Q2SC 2QL7B 2V2ZA 4FYXB 3PDNA 4PR6A 2VOOA 4RW6A 1FWKA 3D3BJ 4RR5A 4P9SA 1S1WB 1KEKA 3P8BB 5T14A 3FGVA 1CS4B 3VAMA 5KFCA 3P6YC 4F2RA 2E29A 1S9GB 2OAUA 3PJXA 3JYTA 3KLIB 3TQEA 3W9HA 2E66A 2GMLA 1R6YA 3DRXA 2F40A 3L7UA 3OD2A 4C11A 4ZN3A 3CMES 1UCNA 1HQEB 1SIZA 2DITA 2O3DA 2P6TA 4S0MA 4CM0A 5AJ3J 4G1PA 3CCJS 3DKDA 4X84A 3JQJA 2CPDA 3WHIA 1DQ9A 2VB6A 4MT1A 2QFIA 4KH1B 1U48A 4K4UA 2V68A 3M05A 1F0XA 1S6QA 3FFIA 4I4BA 4E0DA 4HACB 5F3ZA 3TAPA 4EZ9A 5IT0A 4OJ1A 1S1XA 1V3RA 1EAYC 1XERA 2AX1A 4PCQA 2UXCJ 4DUYJ 2CZ4A 2YX1A 2B3TB 2WBRA 3I6PA 1H38A 4LBIA 1NKEA 3SFGA 1NJZA 2YQ0A 3A3OB 5D4LA 2KRBA 1IBMF 1X5SA 4IDKB 2XSJB 2RMLA 4C8KA 4WBFA 1G4CA 3CC2S 2HMIA 3M2UA 1B0PA 3TZXA 4I6WA 5DETA 2DXFA 4R5PB 2LDYA 1HNZF 2J6TA 1WC1A 2PA3A 3MPUB 2MQPA 1VOMA 1K44A 2F8MA 3HHNB 1LW0A 1X4EA 1DURA 1OY8A 2WONA 3QSIA 1S4EA 4YB1P 3V6DB 3TANA 1PGZA 1R8HA 5EN1A 3QRPA 2XI2A 3PG9A 2OTLS 5T7LA 4ZVGA 1OY6A 2HPUA 1T9YA 1FO1A 4Y2CA 5IM0B 2WTFA 4PXCA 2P9CA 3QMQA 2ZWPA 4FNIA 1H7WA 1EARA 2HQFA 1JKHA 3C8YA 4HLBA 4I7FA 3MDFA 4I56A 3RYLA 2DEJA 4RBVA 4RW9B 3CCSS 1U1MA 4RNNA 1CEZA 1IBLF 4X4VA 1S0MA 4ZVSB 4GVLA 4K4TA 1X9MA 1K8AT 2OPQB 2AT1B 3FVYA 2AEFA 4Q8FA 1N6QB 2IFXA 4O3NA 4C3KA 4LF5F 2BJ9A 4LVNP 3T19A 4X62F 4C8NA 1VK3A 3F73A 4ZCIA 2DBBA 4Z7YA 1NUEA 1UJ6A 3C15B 4J9VA 1Q8KA 3DOKB 1P9YA 5IOLA 4ZCKA 2LECA 1AT1B 4KPYA 4R8UB 2GA7A 1OIAA 3ENWA 3OTCA 3OT9A 1VQKS 4JI8J 4KHPF 1R0AA 1HNVB 2IIHA 1WOSA 2HHPA 3UDEA 1U6BA 4QR1A 1CJVA 1W7WA 3I9ZA 4LIWA 4LFAJ 4HHUA 3D28A 4OLOA 2NPFA 3DXSX 4TYAA 5B08A 1WEZA 3OTEA 4QCLA 1TKDA 2MPUA 3PXGa 1IKYB 5DDOC 2JJ4D 2IC3B 4O23A 4PXDA 5A0YB 4WTOB 1MWYA 2X3GA 4N41A 2F9DA 2XMAA 4IOCQ 2BJ1A 2WK4A 2CPIA 1VDHA 2QTWA 4WYWA 4EFAC 5EHHA 4JI3F 1TFYA 2B43A 2QSFA 1FJ7A 1IM4A 2CG4A 4P75A 3TO8A 5KG1A 1RU1A 2MJNA 3HKZD 2AU0A 2W4DA 2GJIA 3MAAB 3LW5C 4OI0A 2Y8WA 1B7YB 1RWKB 3BZQA 2FJAB 4ZJLA 2I5JB 5KFGA 2DNOA 1FRHA 3TX8A 4DFMA 3ENAA 4NRUA 9ATCB 2P9EA 4F36A 4ERDA 3IG1B 2COLA 1D8YA 4RW7A 1MN7A 5EX3A 4BWMA 1J5OA 4ZIVA 1M5KC 3OJSA 3NNHA 2AV5A 2BE2A 4DF4A 4U96A 3GWCA 1YRXA 3RJMB 4J9MA 1HBNB 1F2HA 1FERA 3SBMA 3JTNA 1LFPA 3V81A 1YKWA 1N32J 3EGVA 4DSIA 3G6ES 2JFKA 1D1UA 1PG5B 4C0HA 7FD1A 4IFYB 4PQUA 2C2ZB 1HBUA 2P5VA 5ETPA 1IN0A 1MWQA 3BH6B 3ENVA 5B0GA 1BC6A 4OYBA 5HP1B 1DLOA 4BDPA 3RGIA 3BM7A 4AE5A 4NLUA 3B82A 2V2VA 4X4SA 2CZVC 3ONQA 3TP2A 2B9WA 4ECWA 4JUZA 4NE9C 1SJFA 1Q7YT 2QLXA 2DCLA 4Q2LA 3K59A 2KJWA 1FF2A 5FJ4A 2KT2A 1OQ6A 3R5AA 1IR0A 1UL3A 4KFBA 4OYPA 3ZZPA 2KG1A 2YWGA 1U1OA 1QUPA 2VG5A 2ZH4A 4K5SA 2J5AA 2FGOA 1GMUA 1QM9A 2GS8A 3EVMA 4TY8B 5D6GA 3CCMS 4ILLA 4FP9A 4IRDA 2JVRA 2ADCA 3BBCA 5LL6d 1C1CA 3F44A 3P3DA 1OYDA 3PV8A 2ZE2B 4F25A 3I32A 3OPKA 1FEHA 4RNHA 5CCMA 4IUFA 2XS5A 5KFRA 2XCPA 1BQMA 1N5TA 1K0VA 2A1BA 3M30A 4H54A 4RW7B 2F4FA 1B0VA 1X4FA 4DPOA 2MKIA 2E9TA 4IQMA 1B7FA 1AW0A 1T8EA 2IVMA 5L46A 1E6YB 2UVWA 1YRUA 4CNZA 2JNJA 2MLXA 4FPRA 1VQLS 3CXCR 2R8HA 2NCKL 2ZOGA 2DNRA 2DXEA 4PG6A 3R5JB 5ETMA 1M5PC 2EVZA 2DXDA 1CQMA 1QAJA 4NRTA 1UEVA 1G3OA 2NYHA 4ZPVR 4ELVA 2XO7A 1EJ7L 3IBFB 1KWMA 2VBXA 4XO0A 1UPPA 1W26A 1EETA 2MSSA 3C3LA 2QT7A 1CQNA 2RU9A 3GONA 1RE1B 3BEGB 3ICLA 4IQXA 1NAQA 4DOZA 4JI0J 4NXMJ 4TN2A 1KOOA 1RHMB 2CG8A 3G8QA 4ED4A 3G87A 1KD1T 1CVJA 4O44B 3GJTB 3OHAA 2PDAA 2J7KA 3JS9A 4KGXB 1QD1A 3GIJA 3MR3A 2V8GA 4DR3J 2IM3A 1RTDB 1VQ4S 3MCOA 5IC6B 4C2MA 3BO2A 3H90A 3E8OA 3FEYB 1X8DA 3QFWA 4ZPCA 4ZVEA 2AJFE 3GG0A 4BC7A 5BXIA 3BN4A 5T41A 3G6VA 1SJ3P 3LWMA 1Y5LB 4WE1A 3FJ2A 4DR2F 3NP5A 2FVRA 3M8RA 2H4WB 1KKHA 2CFXA 1A7GE 2GAGC 3P5BP 2MQOA 5GAGI 3V6KA 1XNRJ 2RJZA 3G4SS 1S7IA 3QGHA 4OI3A 4QIGA 3MECB 2IRYA 3N4WA 4RW8B 4WFXA 2MQLA 1S72S 1G1XA 2OFGX 1FKPA 3K7RA 2VQEF 1D0EA 4USUA 2V2QA 2E1RA 4CO4A 1FD8A 4YR2A 1LWEA 2JL9A 1NB7A 1LK5A 4TVAB 3ADAC 3TVKA 2UUCJ 4RU9A 1MU2B 1SQFA 2OPQA 3W7BA 3W63A 4E8UA 4QWCA 1VJQA 4DL4A 2UUAJ 4I64A 1DHMA 5CD4H 3M2RA 3A8KA 5F9LA 2W9BB 4FF1A 1LKZA 4OHVA 4RNOA 4B3SF 5D4OA 1VRUB 3H2UB 1REVB 3WX8A 3EJMA 3J80U 5EDWA 4YP3A 3KNGA 1F9HA 1ZS6A 3KHGA 3W2WB 2XYGB 1KRPA 1ZETA 1U0HB 5F9NA 2FUG9 4NEYA 4RUAA 4NYOA 3MECA 4QR0A 2JSXA 4G3IA 1IM6A 1JLEA 1VRTB 2A2CA 2V67A 3FBBA 4AUKA 4LMZA 2CJKA 4DL0C 5KT6A 2M52A 3EUNA 3KLHB 4XAKA 2LU2A 4GKJJ 5CYMA 4ECTA 2DHXA 4WTYA 4OZLA 1DTQA 4J9KA 2OGUA 4JI2F 2R4FA 4DPTA 1UWAA 3LF0A 2OJ3A 2D7SA 1IKXB 1YJTA 1VQYA 5F8MA 2HVZA 3A3NB 4OHWA 3V4IA 1S1VB 4NLRA 2HHHF 4LF8J 4J37A 2EWHA 4IFVA 3T1YJ 1WF1A 2HRYA 5HO4A 3L3CA 2C3OA 4MIBA 1YQHA 4LR9A 4HH1A 4ZITA 1VQ7S 1S99A 2U2FA 3P45B 3BR8A 5F0WA 4MIWA 2Q3PA 3I4PA 1T7PA 1PKUA 4QU7A 3E01A 1K0TA 3QSYB 2OI2A 3D6FB 3NOGA 4YOEA 5I42A 5KG5A 1ZOTA 3H98A 3LP0B 1FXLA 5D15A 3IM9A 1JXEA 3G82A 2CPHA 2EG2A 2RUGA 5KT5A 4A8SA 4HI2A 2BDPA 2Z56B 1KVIA 1RTIB 3U27A 4D3GA 2ATLA 4LSNB 5HANA 1HNIA 1MN9A 3CCRS 4DR6J 1ZTWA 1RT4B 4B3TF 3MHYA 1QDUB 1VHIA 5J2MA 2LA6A 2ASLA 1FJCA 1FDDA 2GMJA 4QIVA 4LSLB 2NLWA 4DZ6A 1APSA 1YVFA 3N5FA 3ITHA 2VONA 4WKRA 3LUYA 3O1LA 2X1FA 1CLFA 2XO6A 4ENOA 2FY1A 1KTQA 3CCTA 4TQSA 4DSEA 3M2UB 4F04B 3RRHA 4DJBA 1IKWA 5BR8J 2IJRA 1UVNA 2MEWA 3OHBA 3HVAA 3M8ZA 1PJ7A 2HQGA 3A8EA 2HGNA 2RQ4A 4USWA 4A48A 3VAIA 4IFVB 3LO3A 3J7YI 2D3ZA 1EB0A 2QN6B 1FDBA 4KQZA 2V4QA 4PUOA 5C25B 2Y0SD 1IUJA 5H9EJ 5CZVA 3FFIB 4UOHA 4AQYF 3CE8A 3GJQB 2L08A 1YDLA 2J8AA 2XZTB 2YNHA 4NLXA 1S9FA 1T3NA 2HHSA 2M8DB 2WB1D 1EP4B 2E1PA 2J9DA 2XWXA 2ZITA 3OR2B 3UCGA 2FZCB 2VFSA 1JLCA 2YY3A 3S6EA 3UVJB 4RNFA 4I7FB 5LSRA 5DGBA 3GIKA 1VBZA 3QRQA 2JOQA 2MZ1A 5A6PA 1RWNB 3BSCA 1UVLA 4X65J 1TL7B 1H2VZ 1U0SA 3CTRA 3GR1A 1CC8A 1ROFA 3N01A 1RTHA 2IM1A 3C66A 4RW6B 3VGSA 3N0VA 3CPWR 4Q0BB 1T0TV 2GIFA 4HI1A 5KFKA 5HROA 1FWPA 1OSDA 1TKZA 2F4VJ 3LA0A 1UAWA 4WU2A 3MD3A 1TVRA 2E7WA 3SFUA 1WDTA 2GX8A 3KJNB 1I1GA 1F3FA 3I0SA 3CCQS 2IVYA 1RWOB 2X51A 1O8BA 4CO0A 1UEKA 3Q8SB 5B0EA 4KE5A 3PHTA 3KOAA 3KJFB 3RZAA 4EK2A 3M7VA 4OJGA 4DPWA 2ADBA 3ZTRA 1V3ZA 2BABA 2O67A 1U1NA 2HWIA 4OHYA 1WF0A 3RB6A 1B3TA 4M5IA 1HR0F 3NGSA 1SJ1A 2DR9A 2OKQA 3M9NB 2XY5A 4B17A 1WWHA 2DPJA 3NGRA 3DRPA 3M4XA 1RT6A 3SIPB 4IKAA 2CPYA 2CJBA 5AXNA 4M1KA 4CCHA 2CNOB 2W2NP 4YB5A 3BDPA 2F4VF 1R31A 1GAOA 4KAIA 3GQCA 1AXQA 5K8NA 4QW8A 5J1PA 4JI4J 2WRMA 3CT9A 4Y6IA 2NSBA 2Y1IA 1U25A 2RQCA 4ECXA 5HVFA 2J7UA 2CPZA 3C6TB 1F3VA 3FDSA 3GYNA 3WX4A 3CC4S 2NS1B 3RBZA 1X4CA 3M9MB 3CCWA 2O5DA 2D1CA 1NM2A 4DR7J 2VC1A 2ABYA 1G6BA 4XPCA 1IWAA 2ALZA 3BGRA 4A8FA 3T1HF 2IY5B 4NLQA 3H0PA 1C1CB 3SCJE 3U1NA 4Y00A 4IRKA 5FIIA 2HGLA 1U8WA 2ZBIA 1JLAB 1RWMB 3MGJA 4P52A 3VAFA 1NBEB 3NGKA 3MM6A 5KFBA 1HNXF 1OPZA 4URSA 3FQKA 4NLSA 3G6YA 3NNAA 3CO9A 3W5YA 3PKMA 1FNOA 1HQUB 2HQIA 2PO4A 4J9UE 4MMOA 4CYUA 5KFWA 2KO1A 3QWPA 4WFAQ 6FDRA 2UU9F 3N79A 3CEDA 4ZCMA 1BD6A 4O3OA 4USMA 3N9UC 3JSMB 1VBYA 3LP2B 3TA2A 4MK7A 3QZ8A 1JLFA 2DNKA 3MEKA 4TLRA 3H4DA 3IWXA 4FS1A 1L3SA 5JMNA 1VS3A 4ECSA 2P6SA 1BQNB 5KT4A 3M6VA 1U47A 3G9CA 3IGNA 4TY8A 2RHSB 2V4RA 1ZZNA 4ZCLA 2FLPA 4Q0BA 1RCOB 4CRJA 2MZQA 2YBVA 3HHLD 3QYYA 1IBKF 3UD3P 4MKYA 1ZA1B 5LJ5Y 1KDNA 3UCZP 2IPOB 2PMZD 3EXYA 1VK8A 2V6AA 4NLYA 4B9VA 4DU8A 2JDJA 2J0SD 1YX2A 4NOHA 4B9LA 1RWXB 2FJXA 5GADU 1ZH5A 3D54A 3J7AN 2DHAA 3NCRA 1KOHA 4QJVA 1EQMA 3KKFA 2RB7A 5KFDA 2XNRA 4LF7F 3EE3A 1A6LA 5DS7A 5G0RB 4NWBA 4ECQA 2GO9A 4PWUA 5KFAA 1H73A 1TK0A 1MNEA 1BWVA 2KB2A 1HW8A 3IR6B 2GQCA 3MZIA 4MJKA 4OYZA 1OS5A 4Q2MA 1RQ0A 2Q43A 3HVWA 3CD6S 2DNQA 5ETQA 2OEMA 1RT6B 3L95X 3IXQA 2XS2A 4M5DB 1H0HB 2BE7D 2V5HG 2QG9B 4TU7A 1RZMA 2M70A 1Q95G 2Z2YB 3DDNA 3NS6A 2E1AA 1F5CA 2VFTA 3ETOA 1ZM4A 3O5TB 4MK8A 4WPAA 1HBMB 4ZP9A 5HAOA 3SSSA 2KYZA 3RR7A 3D67A 2PE8A 1TKTB 2KI2A 2MY8A 1TP7A 3ET6A 2YX7A 3K5PA 9RUBA 3F56A 2YNIB 5G4DA 2RS2A 1S77D 1RWVB 3MPWA 4DU7A 5KG4A 3DHWC 2WOMB 1T95A 3OVBA 2AHOB 1IQZA 3ILOA 1TVRB 4QBUA 3K5MA 2C3PA 4ZPTR 5G0RA 5CXTA 3LTOA 1WHYA 2A3JA 3W8PA 1YZ6A 1WKLA 4H4OA 1IBCB 1S79A 1Z4UA 2ZH9A 2XY6A 4F4WA 2ZBPA 3W2VB 4NL5A 1JLCB 2N4CA 2HVIA 4I67A 2OFHX 4K4XA 4OX9J 3TARA 4KGZB 2EC0A 1WC6A 3R5CA 5LXRA 1Q81T 5M2RA 3PKYA 1RAGB 1TZ0A 2B4VA 2ZZMA 2OPRA 4P74A 2O1PA 1XC9A 2RQKA 3HP6A 4DFJA 1OQ3A 3AQPA 5A8WA 2ZJRQ 1HWUA 3AD9C 2VIHA 1UFWA 4C3LA 2CXEA 2VG7B 2XI3A 4E98A 3DLBA 3SMZA 5KT2A 4LQ9A 2C3MA 1LWXA 5KFZA 4JI1F 1F9FA 4R25A 3S7RA 1N8RT 1UEUA 3CDAA 1RA7A 3BH7B 3PX4A 2ILYA 1WSRA 4KO0A 2DR7A 4PWDA 2L9DA 1RBAA 1KLMB 2KDOA 1UA1A 2UXDF 1JKHB 2AJ4A 3M8QB 4B3OB 4PG4A 1QAYA 3NBPB 5JXSA 1TFWA 4NZ6A 4X64J 3VR1A 1FKAF 5T7LB 3FEZA 2R3VA 4XIUA 3T1HJ 4ZLLA 4L73A 1FE0A 2HFNA 1Q7LB 4A8OA 1PAEX 5C24B 1U2CA 1VJWA 2IM0A 4NLVA 3B54A 4H4KC 4A8MP 4DWIA 4QWEA 4DLEA 3C19A 1RT4A 3DFEA 2NSCA 4WIIA 2QC3A 4OX8A 5HVHA 3D6TB 3DRRA 2C2NA 2KN4A 3ISZA 4OFZA 4OHZA 4RW9A 4J7CA 4O3PA 3C6TA 1NXIA 3Q24A 2J0QD 4H4MA 1NZ8A 1N56A 2HS0A 2RE1A 5IQ6A 1D9FA 1BGXT 2HNDA 2C1EB 4ZVRB 4JB8B 4TY9A 1Q79A 4DV7F 4U67Q 4TXSA 3GV8B 2CPEA 1OPIA 4NLPA 4ZHRA 3KLFA 1N34F 3FSIA 3V4IB 2XLKA 3DRSA 1SVDA 3IO1A 2QSWA 4ZN1A 2DISA 2OIHA 1S4FA 2ZVSA 3UNYA 1WEXA 3DNCA 4X4QA 2Q6BA 2JEFA 2QMUB 3KTQA 1Y10A 3ETMA 1XR7A 2CJAA 1H7XA 1ZM2A 3CVKA 4N77A 3O8WA 3KUGA 1MW7A 2O01C 3KLEA 1TAUA 3I0SB 3VVUA 4M95A 2Z58B 4X4RA 3QO9A 4KGMA 5CA5A 5L1LA 3EPGA 1FK9B 1O0PA 2H9ZA 4RZRA 1RHQB 4XDDA 4YEAA 4C97A 5HBMB 4DXLA 3HFZB 3QAUA 2ZWOA 4C7QA 1W2IA 3FEXB 2FVQA 2ROPA 2VPWB 2XTJP 3IGVA 3TJ9A 1JMTA 1N54B 1E6VA 1R27B 1RABB 1PJ6A 5KOWA 1VBKA 1XIQA 3EICA 3BSOA 1NCLA 2IA0A 3QIDA 4OYIA 2J6UA 1FXRA 1S76D 2EKYA 2X1GA 3M2RB 3GSIA 1H2UX 5D4PA 1NK4A 4V19X 1RT3A 3SCLE 4CNYA 2LFVA 1AB8A 2E1MC 2B0GA 3C16A 5F41A 1C0UB 3OW2R 3SSRA 5KT3A 2UVUA 4B3RF 3HZGA 3U02A 1DY3A 4NI2A 3DRSB 1ZPWX 5K5MA 4GC7A 4DFKA 5E2QA 2C2RA 4X64F 5IFMA 4F4KA 1REGX 2YTCA 4AXIA 2FLNA 1WSVA 2XMTA 5LMUJ 2GAHC 1N0UA 4OI2A 1Q8IA 2OP5A 3BREA 8AT1B 2WVBA 2FVCA 3KLEB 3CIZA 1OMSA 1ZPVA 2OSQA 1WKJA 2HQDA 3QGPA 5DG8A 1HNWF 1WC3A 2XGQA 4ETXA 1G2EA 3OTBA 1JLBB 4N47A 2AZ1A 5IV4A 1FWLA 1D8ZA 4DS4A 1ACMB 2YWHA 1RKIA 1RTZA 1PYSB 1TKXA 2OPPA 3QAEA 4HDGA 4KPCA 5BYRA 4A8KA 1AUDA 3AA8A 5IQQA 4GKKJ 1U7LA 4DV3J 3DYAA 5L8RC 3ISND 3R6GB 4YR3A 3RBEA 5CYQB 2ZC4A 2BUNA 1HYSA 4XK8C 4F3OA 2R9LA 3OFFA 2DTJA 3ZZYA 5B0BA 3W3SA 3ZO7A 5ETSA 2HHVA 1NB2A 2AGQA 2XB2D 1IKVB 3MMAA 1WTBA 2G4BA 3BPDA 2OD6A 4RKUC 2N7CA 3O44A 4UOGA 3IBWA 3DI6B 1HBOA 1N0VC 2YQ3A 1QSSA 1ZAXA 3IWLA 3CCVS 3GIRA 3D0HE 3EGNA 4M5LA 4NXNJ 1P6TA 3MFHA 2ZH6A 3DLEA 2CQBA 3TAMB 1KHVA 2APOA 3I5AA 2QLBB 3HSJA 4KJIA 2FJDB 4BWJA 4Q5VA 2WZ1A 2OELA 1N33F 4LFCJ 4KKOB 1KFDA 1O6XA 1YZ7A 2HZAA 5EWEA 3E2EA 1LWFB 4ECVA 2A0FB 3IM8A 2A2DA 3SQGA 2VQEJ 1U6FA 2BKOA 4FPIA 2XLIA 2YKOA 5DLFA 3PW2A 3GB0A 4PQAA 2UVRA 5EGYA 3RRGA 2LQBA 2U1AA 3KLGA 4C4WA 2QA4G 1T05B 5KG0A 4EBEA 1HI8A 3PNIA 1HA1A 1TK8A 1GXUA 1NDCA 1VGYA 2GVZA 4CLYA 1ZAVA 2OPSA 5HK4A 4B9MA 3EGZA 2HRUA 3H4BA 3WBZA 5HSPA 2GO8A 1CULA 4O4GB 4KT0C 4RU2A 2R7SA 4O4RA 4P73A 1RBLA 2R8JA 3QT6A 3DXBA 5F8HA 3ILJA 5KFOA 3NGDA 1OYEA 3PO5A 4ER8A 2B9EA 1JJCB 2EBGA 2WOMA 3MCNA 1QVGR 1U6ZA 4DV1J 1L3TA 3CJ5A 4DZDA 2HK3A 3DRPB 4ECUA 5HP1A 1EIYB 1CJUB 2QL9B 4CO3A 4I0WA 5J2PB 2HHHJ 2CQ3A 3UDLA 3KG1A 5K20B 3QO9B 5GAHU 2ILZA 4J9SA 3VGUA 3HXMA 2CQIA 2E5HA 1IR1A 3EZUA 4G65A 2JZ5A 2IA6A 1N33J 2GHPA 3LGMA 2NQPA 1Q86T 4NLOA 1FKPB 4CDIA 4JI5F 3CJ3A 1WD6A 1M0SA 1RCXB 1WG1A 1B99A 3ZC4A 1S97A 3G71S 1BLUA 4YDDB 4QPTA 5HQ8A 1DRZA 2KRRA 1U2FA 3AA9A 3FCHA 5AE2A 2QMXA 1NHVA 3TI0A 3R2CJ 1FT8A 4JV2A 2SXLA 2KHDA 3KUEA 3DHXA 2DT9A 3LPYA 3DOMB 1IKVA 1TUVA 1Q16B 4LSZB 2ROEA 2VQFF 3PHEA 2BYCA 1M90T 1KS2A 2J0WA 4CLLA 4WCEQ 1M1HA 3AY0A 4LREA 4EYIB 3MM9B 1EZZB 2ZH8A 3DRRB 3DU5A 3CJ0A 3SCKE 1CJKB 3VZHA 4CO2A 2JEGA 4PYDA 2E7XA 3FQLA 1FHTA 1KHWA 2UUCF 5K8MA 4KGVB 3K5LA 3SV4A 4ED0A 2KFNA 4IG0B 4KB7A 3EYZA 3BO4A 3KJVA 4MFBA 2HZCA 4U9RA 2R8KA 4DV0F 3RB0A 3GCWP 3C6UB 3R5GA 4NEZA 3AH6A 1HNWJ 4ED6A 1JJ4A 2DGVA 3CCES 3BF4A 2K8GA 1HHQA 2R2TA 3EPIA 2GNKA 2ZFHA 4GMKA 2VG6B 2OTJS 1RT5B 4CH0S 4OYMA 1M5SA 1FFGB 1KLMA 1JNZB 1SI9A 3DOKA 4DR1F 1XMOJ 4K0KJ 4RPFA 2I9SA 2RH3A 4BC9A 2LYVA 1CJTA 5F8IA 4EI2A 1T9WA 2AMCB 1HNXJ 3IWNC 2D69A 3LAKA 3R3TA 1R8BA 4ZMMA 3BB5A 1HR0J 2B5JA 3SCIE 3DLLQ 2W01A 1VIXA 1F5BA 2CQ4A 2VUGA 2ZE2A 4I69A 1FJEB 1KQGB 3CDBA 1RISA 2R7RA 3Q8YA 1PCAA 4L3KA 1MWZA 4N8OA 4OX6A 1C0TA 5ETKA 1FNXH 4ID5A 3UDVA 5IT4A 2E5LJ 2HIYA 4X66F 3MAQA 1FRIA 4L75A 1YITS 1SPBP 1FE4A 1LXJA 2VG6A 4USHA 4JI1J 3MTKA 3UN2A 4USVA 1S5ZA 4YY3F 3LP1A 3SEOA 4F4XA 1R0BG 1VRQC 3OTOJ 1TELA 3C6UA 5D4NA 4YY3J 2HBRB 1CG2A 3DC2A 2B7CB 1NKCA 2DNMA 2EXUA 5KFEA 2RDDA 3Q8RB 2BR0A 2C28A 4HVZA 2W2PP 3UO0A 3THPA 1WUUA 2W7PA 4J9PA 1TKXB 5B0DA 1H3DA 3HD1A 4H4KA 5AXMA 1YHQS 3W60A 2I38A 2EC2A 2IJNA 2M5YA 2XZWA 3TZWA 5A8RA 3ZFVA 4DG1A 3PW0A 2D3O1 4J9NA 1RYSA 2XMUA 1PJ5A 2K3IA 4PAAA 4OIXA 1I51B 2BE2B 2MQ8A 2GQ2A 3DOMA 6AT1B 3NAHA 3WDOA 1QSLA 4QYRA 4WWSA 1JXVA 2KYXA 4OYWA 1RT7B 2AZ3A 5DZ7A 3WC0A 4CH7A 5BYSA 3IC1A 3M8PA 4BBYA 3A8JA 3NAIA 4NA1A 4E2FB 2J6SA 5KT7A 5FDLA 1FX4A 4EBCA 4LQ3A 1BQXA 2KFZA 5I3QA 1S1VA 2MYFA 2QEXS 1GTHA 1IKXA 4QZVB 2EPIA 1I5OB 4KY3A 4UOFA 1D3WA 2OPSB 3EZ5A 1S6OA 2MXYA 5ETTA 5IT9Y 5L39A 1OSCA 1QTNB 4CLKA 2ZOFA 4K4YA 1GT8A 3AOBA 1GQEA 4CLPA 1CS4A 4ECYA 3THVA 1NRKA 3AAWB 2WAQD 2YKQA 3PW4A 1S9GA 3BSNA 1MMLA 3DLJA 4AQYJ 4ILRA 1PIEA 2N3OA 3V6JA 2DIUA 2QL5B 4Y2AA 1AYEA 1VCTA 3B4MA 4KTQA 2AJQA 3PZPA 4ED3A 3P4UB 4X4OA 2IRXA 3VV2B 2IM2A 2YNFB 4DV2F 3L09A 2HBZB 3DLEB 5A2QY 3B78A 5E0OA 1NU4A 4WE1B 1UFKA 4DR4F 4LF6F 2BJDA 4OZ0A 1HQUA 3AJDA 4C0BA 4CYUB 5H9FK 5BR8F 4I6AA 1LW2B 2ZBQA 1S48A 5KFVA 4IR9A 2J9CA 2RRBA 4MIAA 4TU8A 3G8TA 2QZ8A 3T1YF 3MM8B 3UPFA 4JV0A 4A8QA 2EFQA 2PD1A 3KJVB 2BOPA 3M1VB 3PYFA 4OI6A 4W4MA 3K2YA 1N5YA 2AYEA 1SJ4P 4ZS6A 5K9FA 4RX6A 2WBMA 4J90A 4LF4F 4FVMA 5KG6A 3GU0A 4N5SA 3IN5A 1BWEA 1H2TZ 2CNNB 3EDQB 3LGNA 1RT5A 2HFZA 4TYBA 1YJ7A 2HEKA 4P6QA 1U8SA 4CTAA 5D3GA 3T1AA 5RUBA 5E3PA 5GMKa 3DLKA 1VYAA 3FBFA 1P27B 4FZVA 2LMIA 1H6KX 4ETZA 5IS2A 2AYBA 3UDCA 4ECRA 2K2PA 3MMAB 3D68A 4LFBJ 5C42A 2H5EA 1T03B 4M5NA 3OFEA 4ZIWA 3IP0A 2FQQB 1VQ9S 3MXHP 1VC6A 3GG1A 1WC0A 4GRSA 5KFFA 1U1QA 1IXKA 4KYZA 3T6BA 4X62J 1RBOB 2LQ8A 2QRRA 2QV6A 2VASA 3DGPA 1YBUA 1EETB 3PCOB 3HX9A 2O66A 1CC7A 4TNOA 4EWTA 2OHDA 2ROGA 2XEXA 2A18A 3BYPA 4B08A 2UZAA 4R5PA 1W25A 2JRSA 3CJSA 4KRWA 2YKPA 4MYUA 3UR0A 4ZPDA 4WFNQ 2GGPA 1R8AA 2GCFA 1WJ9A 3NRBA 4YB7A 3T5KA 2FJWA 3GFHA 1M1KT 5AT1B 3M2VB 1FD2A 2MLZA 3PIPQ 2VDHA 3CCLS 4QPXA 3MEGB 2V63A 3KFWX 4MAKA 5DLGA 4J9QA 2LDIA 1HD0A 3R1HA 2XMWA 3SSQA 4PEOA 2KZZA 1IWGA 2IAJB 3CCZA 3CJKA 2G0CA 1NJWA 2OSRA 3M30B 1N52B 4NX9A 2PA8D 2ATCB 2HBQB 3A8IA 2XHWA 4WJBA 3V4MA 4FS2A 2V69A 3OBIA 1TL4A 1RTDA 2DEIA 2KL8A 1GH8A 1JLQB 1YG0A 2C3UA 2IMOA 1N5VA 3GFZA 3O2IA 3TOQA 3KLHA 3SV3A 1NK7A 3DMJA 1YJRA 4DEZA 1Z2LA 2VC0A 4U7UK 4F0KA 1HD1A 2RSQA 1LWEB 3N5BA 1NSKL 3KK1B 5BYQA 2J7WA 2EKNA 1G7CB 5IV3A 2M9KA 3PJWA 5FDLB 4K4ZA 1MROA 2DIVA 1YJNS 2AJ1A 3BBFA 3W5ZA 2ZD1A 4X4UA 2IRUA 2XMKA 3GV5B 3R9LA 1RAJA 1C2PA 1Y00A 2G2ZA 2MZSA 1Y9OA 2PIIA 3UD4P 3ZZRA 4FNHA 4RW4A 4LF7J 1WG4A 4ALZA 4CLUA 2MQQA 3OFHA 4RUCA 3J7YU 2VF3A 4IH5A 3CCUS 4DQIA 4ZVQB 4LJMA 1H74A 1KBRA 4QW9A 2J8SA 2CRLA 3OL8A 2KH9A 4F50A 1Q8BA 1KLNA 4JBCA 2DH9A 2DH8A 1S6PA 3PRVA 5DRKA 3H5YA 3M8WA 5J2NB 2B6AB 4QYZK 3THTA 2VZ9A 3POTA 5L38A 2LXFA 4J9RA 2VFUA 5M2UA 1Y11A 3G6XA 2XMJA 2MZRA 3MPYA 2VBZA 2UP1A 3T3FA 3K5OA 2LQJA 2EBEA 2OPPB 5B0AA 1RTIA 2XBPA 1DFDA 1S7HA 2F63A 2QGFB 3D1HA 4YS2A 3CUNA 3C14B 5JVHQ 1U1KA 3PRDA 3AODA 3GIMA 2FTRA 3UCUP 4IOAQ 3E3XA 3DLGB 1YJ9S 2Q6CA 4NYZA 2JLFA 3BPSP 1R7IA 1Q4RA 4LRDA 1RXOB 1WORA 1ULRA 2PEBA 2DCUB 3I5BA 3KWMA 3MEDB 3MM5B 1LNQA 5IWAF 4ELUA 4F26A 3R8YA 5KFLA 4LRCA 2DO0A 2I6WA 1VHFA 2RILA 2N7YA 3D1OA 1T9UA 2FHJA 2FGCA 1V6HA 3SYZA 2LEAA 2DGSA 1ZYQA 2IDLA 5BJRA 2G9OA 1LW2A 4RBUA 2OD4A 3D7SB 2BBEA 2DHHA 3ZZOA 5GAEI 3CIMA 3NBPA 3PYDA 4ZVPB 3CC7S 5SUHA 4HYKA 2PT0A 3EMTA 3MM6B 3X1LB 3SDEA 2G2OA 3IS9A 4CZCA 4JI7J 2K1RB 1O51A 1RUSA 2MJUA 1TKZB 2M8HA 1MMNA 2NXCA 5CQGA 5KFYA 2RF2B 1UA0A 4B3MJ 4IOBA 5D78A 3JQMA 3TZZA 1GEHA 4JI6J 1NNDA 4Y2KA 1TL7A 4USJC 4DV0J 4FYDA 4DL3A 2YX4A 2V2KA 3D0IE 5LSOA 2CQPA 3HFKA 3P5TL 4OV1A 4KHMA 1VLYA 5SZTA 1XNQJ 3FCVA 2OMOA 5B0FA 3HHLC 1TUGB 4UT4A 2Z2LA 5A2QU 4WK1A 3GSDA 1NSPA 3U1MA 4ILMA 4WFZA 2VFRA 5KAKA 1WI8A 3CJ2A 4P2MA 4Y3CA 2R7VA 1S10A 1RHKB 1YJUA 3BSAA 2ZHAA 2E44A 2X1AA 3L4BC 1LOUA 2W4PA 2F7VA 2HFSA 2V0NA 3W2VA 4M5JA 4EO6A 2DNLA 3RR8A 4FBTA 3EGWB 4AL5A 4EBDA 4DSJA 1N36F 1DQAA 4Y28C 4LFAF 4RW8A 3N6MA 3RB4A 2UUBJ 1JIHA 3SZ2A 4B3SJ 3LQVA 2WCXA 5ETNA 2VBYA 2WONB 4A4JA 2Y0BB 3V6DA 2D9PA 4LF8F 4GC6A 3ZNUA 2DR6A 1T94A 3Q0AA 3BGFA 3PEJA 4DUTA 4OZ2A 1S0NA 5D77A 4NYPA 1SB6A 3D5MA 3DGPB 3PYGA 3Q8QB 1C1BB 1IJFB 1AA1B 2Z30B 1NH8A 2MGZB 2ZOMA 4AXJA 5LXYA 4XTTA 3TWZA 2HMIB 2DRDA 1RAFB 3TVZA 1U1LA 3MUTP 1JXLA 3Q86A 1WNEA 3K89A 1TL1B 1N88A 3BS9A 4CLTA 4C48A 1UZDA 5HQMA 3HZEA 2VJUA 5KFNA 5LMNF 2MKSA 3H25A 4M8LA 5L1IA 2WVDA 4P2XA 4MK9A 2UV8A 4QWDA 2R2UA 2RAQA 2DNNA 2JC1A 5LMNJ 1S9EB 4OYXA 1WHXA 1KVJA 2BANA 4F0MA 1VRUA 1SJRA 2NXUA 2BRLA 3QLHB 1ZZFA 1EP4A 3MF5A 5J2QB 1S1UA 4G1QB 3KHHA 2ZBRA 4BCAA 1JQGA 4UQTA 3VWSA 2Q66A 3H42A 1VIOA 3H20A 5A0YA 3EVOA 1SL0A 1KP6A 3RG6A 4NXMF 1GX5A 4M5KA 4GKKF 4OZ1A 1UP1A 2HK2A 3TRGA 2DR8A 1QE1B 1RK8A 4KV8B 5C2CA 2RD5C 1LWFA 4KV8A 2H5IB 1KFSA 3CW2C 2DJWA 1JLFB 2LQ5A 3T9NA 1PAUB 3TAQA 1SUQA 4KSEB 2KJVA 3HI9A 1FCAA 3M6XA 4X4PA 3U1LA 4UOCA 3CULA 1A9NB 3CJTA 4PPZA 2RRAA 1W2BR 4GVBA 2VFVA 1FRMA 4OJ3A 4USTA 3R5DA 4U7CA 2VG5B 3ILIA 1JK9B 4PXEA 2J9DE 3D9BA 1VMBA 3UFCX 4DFPA 4QWBA 5F8NA 2CQCA 3PX0A 1JLAA 3W2WA 4ED8A 5IC4B 2W2MP 3IFEA 1T9XA 5A8KB 5DDPC 4EUVA 3MUVP 2BJEA 3MEEA 4DV4J 2E9ZA 3MAHA 3UNGC 4K50A 3I5CA 4MFBB 3FKBA 1U1RA 2HHUA 1LXNA 1BHNA 3GPAA 4XPEA 1LV5A 4AL7A 1DZ5A 2F1FA 3HO1A 3CMQA 4JYAF 4FXWA 1S57A 1HBUB 1RKJA 4EGLA 3QLHA 5EUHA 2B4PA 3EXCX 3VAHA 2AD9A 1XNQF 3BYRA 1HHSA 4HTJA 2L9NA 3FBEA 2M3DA 3JTPA 4LF2A 3AHPA 3H5UA 4M5DA 3TA1A 4B3MF 3AXMA 3HHLB 2P2CB 1LEOA 3F0NA 5K14A 4BHQA 3D3CJ 1TTHB 3EWGA 2HKEA 2V4JB 4WF9Q 3ZTSA 2YKMB 4TU9A 4PZVA 2IVFB 4G6VB 3W8GA 3A13A 3OR1B 2YNIA 5ETRA 3VF0B 2W7OA 2BQRA 3GILA 1MROB 4LF9F 1UPMB 2AKWB 3VQSA 2CKWA 2DPIA 5J2NA 3TR5A 2DGQA 4AL6A 1RP5A 1JJHA 2EK6A 2B8QA 2DY1A 3SXLA 2IMWP 4MKVA 2ZH3A 2QLJB 3QGGA 5KFPA 2LXIA 3D2WA 2C3YA 4K59A 1PC5A 1CPZA 1KQSR 2HRTA 5KFIA 5HJYA 2VPZB 1EKRA 1PILA 4IO9Q 3BR9A 1SV5B 2LLZA 2XMMA 2GHVC 3AJ1A 3M6UA 1N5YB 3Q2TC 3LP2A 1Z1ZA 4EEYA 3TA0A 2GV1A 3MMBA 3MMBB 4ZLJA 4J5OA 3MR7A 2R7TA 2EW9A 1JNRB 2EK1A 2K1RA 3UQSA 2GVZB 2DNGA 3CDWA 1RU2A 2JHEA 3UE2A 1SH0A 2RQMA 4DR2J 4IO1A 4ED1A 1UVIA 4QYZJ 1HNVA 1UJ4A 1T9TA 3HSZA 3H5SA 1HARA 4FYWB 3SQGB 1FKOA 1X4HA 2XYPB 3NKYA 4WKYA 4MTPA 2AF6A 4EO8A 1YI2S 2M88A 2EFPA 3OJUA 1NH7A 1BY9A 1M5VC 4TLQA 4ED2A 3G86A 3AB4B 2YVSA 3HVTA 3PEHA 4B02A 1OO0B 1GXTA 2HFOA 2HIQA 5I3UB 2FY8A 1YRTA 4HT5A 3BQ1A 1T03A 3R2DJ 4Q8EA 1IR2A 2GJ2A 4L6V3 3Q8PB 2WSFC 2H5JB 3H2LA 5F8GA 1IKWB 2CUYA 2M0GB 1RAAB 2ZJPQ 1TUWA 2RS8A 4RJVA 1K1QA 3OUYA 1XR6A 3HVRA 2XM3A 4ZA1A 2E5IA 2B51A 4IG0A 4LF1A 5ETLA 2FC8A 3BGRB 2KZMA 4CLSA 5KFJA 1X4GA 2CJXB 1AFIA 2H48B 4DX5A 3HT0A 1FFWB 1FNMA 5CH7B 4K7QA 2AX0A 1EX8A 3SI8A 3DYAB 5C24A 1J5EF 1N32F 1S12A 1X4BA 2PMWA 3MWBA 3BGUA 5E3AA 3K57A 1VISA 3TJ8A 4KR0B 2DVIA 1WTFA 4ICLA 3AOAA 3HPOA 2ZH5A 4LF9J 4B3OA 4K8RA 2K06A 3RAXA 2GVDA 2RNEA 2HNZA 4I6YA 2CWXA 2ZBCA 3W65A 3UN5A 3KHLA 2RHQB 1FX2A 4JV5J 3I31A 3UW1A 7FDRA 4AFFA 5LOQA 4P2SA 3MMJA 2MSTA 2CNLB 4F4YA 4Y65A 1UVMA 1FDAA 3POTB 3KXDA 1P8GA 1Z2ZA 5CD4A 2IBKA 2QA2A 4K4VA 1RLDA 2CDQA 3FRYA 4LBHA 4LRAA 1KNZA 1C0UA 1P9QC 4NMXA 1TV6A 1RJJA 2FD2A 1URRA 3ULHA 5DQHA 4F0HA 2R8IA 1HWLA 2Y8YA 1UWBA 2ZJQQ 1UWBB 1SKUB 2DNZA 4C6AA 5I3PA 2KXFA 2FVSA 1P1TA 1CSJA 3QT7A 4JP8A 4R0JA 1IBLJ 2ZNZA 4DSFA 3DGVA 2CWKA 3TVYA 2PN6A 5C25A 1S9EA 2FHKA 1T02A 3MEEB 3JSYA 5E33A 5HMXA 1JLEB 1PYTA 1VRTA 1M5HA 2E5JA 2I0XA 1ZM3A 2NUHA 2QFJA 2LCWA 2QLWA 5K8OA 1SQGA 1NJIT 2V94A 5L9XA 2FC9A 2R7OA 3R97A 2E9RX 4RBTA 4LUBA 1U02A 2V8HA 2AWZA 5THWA 5LM7E 5K8PA 2YPZA 3C2PA 4IR1A 3RUBL 4HDHA 4AD6A 2QA4S 5KOXA 3IRXA 3A1YG 4CLFA 2W9AA 3T5HA 4NPOA 1SUQB 2QX0A 3OL7A 2Y9HA 3A3PB 5CHCB 2VHGA 3TJAA 2VPXB 3AQOA 1QJHA 2DB1A 2W4CA 2YQ1A 1YK9A 2GIQA 4ES3A 3NGUA 3ZTPA 5FLXU 1N6QA 1VQ5S 1HWKA 4GO7X 2EFNA 4JI2J 3MCMA 1UMJA 4HT7A 3W64A 5EWFA 2ZZNA 4WZQA 1GMVA 1JLGB 3G82B 1TR0A 3IBCB 4X4TA 5LMUF 4DUYF 4DV4F 1UFLA 3ZNJ1 2P9GA 2VPYB 4LVOP 3LP0A 1S1TB 4ZPAA 4L72B 1RACB 3DOLB 5CABA 4YFUA 1LFWA 1N36J 2V8PA 2PGCA 2BX6A 4HACA 3NS5A 1YBTA 1U09A 2W25A 3MR2A 4LF6J 2UXCF 4ICLB 3QIPB 5MAOA 4TKTA 2R7UA 1V5IB 1HPZB 4N8NA 2NYIA 4U6PA 3J80Y 3OLBA 4J9LA 2UUAF 2CDRB 2AQ4A 1ZA2B 3AT1B 2YKNA 3D6HB 4PYAA 4PG8A 3KK3A 1YSJA 4ES1A 2V8DA 1NDPA 1KVKA 3BV8A 2NXJA 2AP6A 1XWLA 1R3NA 2BJ7A 5E3CA 2ZC3A 1VQSA 3G2XA 4YDXA 3IRXB 3VZIA 5KFMA 3GE9A 2R7XA 3DOLA 3OTDA 5A76A 2CPFA 1RHJB 3M8QA 1VBXA 1BMQB 2ASYA 3LH2S 4R8UA 3M6WA 1KN6A 3HMJG 3K58A 2WHOA 2HGMA 1XNRF 3MFIA 4EU0A 2CQGA 4Y0FA 4CIOA 2MY7A 1S1XB 3BQ2A 5FLXY 2FDNA 1NO8A 3KG0A 4NI2B 2M7SA 4HTIA 4ZVOB 4UQGA 4OMFG 4PKDB 1N48A 2KKHA 4FBUA 3OXFA 2X7IA 2Z4PA 3D1QA 3M32B 1WDDA 4K4SA 3MPDA 2IBOA 1X5TA 5AJ3F 1SL1A 2HWHA 2R7QA 1FJGF 2OPRB 2M4MA 1FVQA 1XJWB 3AFGA 3AB2B 3H2VE 3DRYA 2BEFA 3MD1A 1RB0A 1TQLA 4DMZA 5AE3A 5MLCV 1SKSA 3AXKA 3RU0A 1SC4B 2BJ8A 2XQCA 4I2QA 1EQ0A 2DRBA 4OZ3A 2L41A 1S1WA 2FHJD 2POKA 1SC6A 2XZDB 4FDFA 2WVFA 5DZ6A 5A6WA 4JI6F 3GJSB 5KFTA 2VKRA 3DDIA 1NSQA 3WQPA 3IG1A 4L3NA 1HI0P 4RUHA 3KYLA 4HHJA 3CJ4A 1IJEB 1SKWA 4M5MA 1SV5A 4NMLA 2F9JA 2I5JA 2LQ9A 1LW0B 4DI6A 1VQ6S 4C8ZA 1K1SA 3HHKA 1TKTA 4P72A 4WU3A 4DN9A 4UY85 5GMDA 3MM9A 4IH6A 4OHXA 1XTZA 3TZYA 2KG0A 1RT2B 2GGPB 1RTJB 1FTCA 2YNGA 4LBPA 5E41A 3NWRA 2L3MA 4CH1A 3DLHA 3KMQA 1MSWD 1HBNA 2JLEA 2KM8B 4UUWA 5HI7A 3P49B 2P8IA 2VBWA 2WW8A 2BRKA 1X4AA 4WXOA 2L48A 4UUXA 4DCPB 2GZOA 2IC3A 5DDQC 4QU6A 4DR1J 1XMOF 2HLTA 1SQEA 3FZBA 2NXNA 2RDJA 3PR5B 3N28A 3DDKA 2FJVA 4F3MA 2HZVA 3OL6A 2JEIA 3CGIA 1HIYA 1ZM9A 4WYLA 5KFXA 1CJVB 3TYTA 3PX6A 4B9TA 4PWWA 3OSPA 3KDNA 2V8VA 4O44A 1B4SA 2V50A 3NLCA 4ZJQA 4LT6A 4C3MA 4O3SA 2LXUA 2F8EX 4KH0B 4GVBB 3KLIA 1UJ5A 3W1YC 3CJQA 3MM7A 1MG7A 3QQCD 2Z57B 3ISNC 3D66A 4C98A 1GXLA 1WEYA 1WF2A 1X5PA 1ZAWA 5DDRC 2HHWA 3HJVA 3FNNA 3T6JA 2XSFA 3WC2A 4WZMA 5A8KA 1CJTB 2H54B 2HWTA 4O3QA 2K7KA 5E5NA 3VALA 1B0TA 3GIIA 4JI8F 4DV7J 5DO2A 2CQ0A 1DBDA 1B64A 3M8SA 4UF4A 3LALA 1VFJA 4CQ1A 5I3UA 2AYGA 1C0TB 2BE9B 3NGTA 2OEJA 3CDUA 3DI6A 2VV5A 4P7TA 3MR5A 2LKZA 2J0XA 2VG7A 3C15A 1HLWA 2Y1RI 3FZ2A 3GMGA 3MMCB 5C7PA 2BXJA 5A8WB 3MTJA 1DAXA 2Z2MA 2BW2A 4L76A 4HH0A 1V3SA 2HAFA 4NZ7A 3I56S 3R7BB 2H1YA 3EDRB 1C4CA 3JAMU 3LPEA 4B3TJ 4FF3A 3KG4A 2DY9A 5IXUA 1X60A 2D74B 4OYOA 3DLGA 1FRJA 3NS7B 4PG7A 3RW6A 4U95A 4C8YA 4LFBF 3QIPA 4OZJA 5J2QA 1O5JA 2VQFJ 1KONA 4R0EA 2ALYB 1M1GA 2HQ3A 2RDIA 2GC8A 3AD8C 2BW7A 3FSXA 4FN5A 4NLTA 4Q7AA 2BJ3A 5I42B 3CJKB 3E01B 4DL6A 1J5EJ 8ATCB 2B9XA 4TQRA 2NREA 2GW8A 1FFSB 3JTOA 1XEZA 3UWTA 5K14B 1NDLA 2VDIA 4IFYA 4PQUB 4M63A 4DQRA 1RT7A 1S0VA 3AD7C 2JC0A 5DG7A 3BO3A 2A10A 1DTTA 3CF5Q 1UVKA 3A4TA 1DTQB 3HSDA 3L7PA 4DG1B 3FRZA 4ZDNA 5A8RB 2HW3A 3QATA 3PM9A 4HHHA 4OX9F 1HQEA 4ELTA 3DCAA 2FLLA 2AGOA 1HW9A 1R8PA 2YNFA 3EM1A 1NPPA 4AYBD 2V4JA 4PPDA 4EMDA 7AT1B 1VQNS 2VA3A 2NXEA 3I82A 4LR8A 3MAAA 3K5NA 5ETOA 1WELA 1IQTA 4MYTA 2AYMA 2RIJA 5D0EA 2FLOA 4CWBA 4I2QB 5HJXA 3VVTA 3CO0P 1FK9A 1QAXA 2CQHA 2NPIA 2Z8QA 3FK4A 4FKYA 4DN0A 1JLQA 4URQU 1FXDA 2YNHB 2JEJA 2DO4A 3OVAA 3FCWA 3OFGA 1F1BB 2F65A 3H8YA 1TMMA 1HMVA 1NHUA 3BBBA 4M5GA 3I55S 5H9FJ 1N4LA 3WIVA 2CIMA 4KKOA 3NEKA 2RT3A 4CM2A 1Q0NA 2FZKB 2XYHB 3QGIA 1R0CB 3OXLA 1M5OC 3CDEA 1MLAA 2CVEA 3MM8A 4W98A 3UD5A 1RGVA 2UUTA 3JSMA 1HNZJ 5HLFA 1IBMJ 4NLGA 3IRWP 1EHWA 2UU9J 3M8PB 3T5JA 3QPIA 4GKJF 2UUBF 3H40A 2RF2A 2OH2A 1R0AB 1F2GA 3OVSA 3R7SB 1SJQA 5HL7Q 2FPHX 2ZDOA 3RRKA 3T9ZA 4WIQA 3AOCA 1Y0HA 2J76E 2KU7A 4J9OA 4OV6A 1VC0A 2V9KA 4B9NA 4PRFA 2EG1A 4OLPA 3LAMA 2IHR1 1UTAA 1N5QA 3L9ZA 2Q1LA 3GCXP 3B8HA 2DNPA 1Q5YA 3US5A 3PW7A 2EI5A 1RI7A 3DN9A 3HFVA 2VU5A 5HQLA 1BE4A 2NZCA 2QJ3A 3AJ2A 3CD7A 3D4JA 4RO0A 4DR5J 1V5VA 4URGA 3HJFA 3KK2B 5LSLA 3TUPA 2FJBB 2XGPA 2W1BA 3JSRA 1YJWS 3ZZTA 1HNIB 5H9EK 1ITPA 1S1UB 2YKNB 4G1QA 4DX8H 1FDNA 4Z7CA 3D0GE 2DYAA 3IR7B 4PG5A 3OV7A 3GJRB 2IDEA 2RRNA 4UTGA 2MZTA 2QE5A 4ATNA 2Y1LB 1PSDA 1R6VA 4LR7A 4JYAJ 3D6MB 4UZBA 1X7VA 1CBKA 4NLWA 3IAS9 2QYCA 2ZM6F 2OUGA 4CO1A 3HM9A 4DSLA 1SH2A 5IZHA 4QIEA 5EX0A 4CLWA 4LIRA 3VAJA 4P71A 3Q23A 2HVDA 4JI7F 1JB0C 3IAM9 4O3RA 4YB6A 2XY7A 3M1VA 3TNVA 1Q1KA 2FYXA 1B70B 2MKKA 2W8LA 1C1BA 3EVWA 3Q22A 5DGAA 1BQMB 2R42A 2EFOA 4Q43A 2HFUA 2W2OP 2WVEA 2XULA 3FBCA 4KIAA 2HNYB 2B4UA 2W7AA 2UXBF 3J7ZT 3KK1A 1NZAA 1FKOB 1C4AA 1I3OB 5KFHA 1N34J 4FXDA 1WI6A 4WXWA 1LK7A 2CPJA 5HMWA 4Y2IA 3K8WA 2NUUG 4EYHB 4JOUA 2ZM6J 4HL9A 4D3HA 2AEJA 4RLEA 5HROB 3OTOF 4I1TA 2WW4A 1NEEA 1I94F 1ICEB 3DU6A 4I68A 2DGXA 3HHEA 1WOOA 2DR5A 4LFCF 3BKFA 3ZTOA 3PO4A 1PO6A 4QQBA 1UZHA 3C46A 3FSYA 2I2YA 2VOPA 2HLUA 3C16B 2ASDA 2W9BA 3HKWA 1R89A 3RAQA 2HFVA 1RWUA 3JXOA 2K3KA 1REVA 4DBQA 4F3QA 4BLGA 3KLVA 3MI7X 3TEHB 3Q83A 4Q44A 1VQMS 3R6LB 2MLYA 3B4DA 1TAQA 3HF5A 1NPKA 1RAOA 3ILLA 2AJ0A 1RA6A 2FHOB 3PTWA 3QFHA 5B09A 1X9SA 3LWLA 1MU2A 1KSPA 3BDEA 2XCAA 2HHTA 2UXBJ 4X4NA 1D9AA 2XS7A 2B5JB 3Q8VA 1UVJA 1IVZA 3V2UC 2PFFB 1YLXA 1QVFR 2XWYA 1EKSA 2W2QP 2YH0A 4DHVA 4F7VA 4C8LA 3FC9A 5GAEU 1FRKA 2WVCA 4NCGA 1NHKL 2MHEA 2IYGA 5B7WA 4ID8A 1FI4A 4O0IA 4K0KF 3PFEA 4ZVUB 4DDFA 5GAGU 4KHPJ 4ZJOA 3W5XA 2MKJA 2BKNA 1HHTP 2DRAA 2GVDB 3ZZZA 1DQ8A 2K7JA 2VKZG 5AXLA 3UI3A 2CQ1A 3V5RA 3R27A 1AROP 3IR5B 2OMLA 4FYYB 2UUWA 5D0GA 3NNCA 4LSLA 2MB0B 4LF5J 4B3RJ 1SC3B 1PBUA 5J2MB 4I2PA 4CT8A 2ASJA 3NXZA 4ZHRB 2CPXA 1FESA 2B6AA 5DM6Q 4WFBQ 4Q45A 3MEDA 3WIUA 3RTVA 1NSAA 1K73T 4RWWA 4HEA9 2GQQA 2G2YA 1HQ2A 5GADI 2HQCA 2A6OA 1VC5A 3W9JA 1KC8T 1CULB 3JQKA 2KHCA 1Y7PA 4O4GA 3G8SA 5ETVA 3VTIA 1WC5A 4Y2MA 4J91A 4DX6A 1J27A 1U1PA 5IT9U 4BS2A 4ZLPA 1H98A 3VGTA 2I8EA 2BV3A 5HLFB 1RT1A 3CWJA 3A12A 5HVGA 3GFYA 1X4DA 2C2OB 2XHCA 3MCSA 4KC5A 4OYAA 4P10A 2YWFA 1L3VA 4OQJA 4WK3A 3F41A 2I1RA 1NK8A 1WOPA 3R1LA 1HMVB 3V6HA 1HL6A 2C2DA 2HG4A 4CT9A 2KM8C 3TQ1A 3ZTQA 1RHUB 4DX7A 1ZTTA 5DQGA 3MOJB 1DJ0A 4DR4J 2XMVA 2DKOB 2ZNYA 3MM7B 2H51B 1YJVA 3NCQA 1KR4A 1S6UA 1SBRA 4KO0B 4PABA 4RW4B 1NK6A 4NXNF 3GZ7A 1UKUA 3LANA 2B56A 2C2MB 2CAJA 2IAJA 8RUCA 1U0HA 3PVXA 2AJ2A 4DQSA 2RKIA 2H65B 3Q89A 4LRBA 3QT5A 4ZLNA 2AIRB 3KHRA 2BVZA 1S49A 3ZZ0A 1N5SA 2JFDA 4M5HA 4QOTA 3TW0A 1HFEL 3FMBA 1DLOB 3RW7A 1U45A 5M2PA 4UW2A 4FF4A 1SH3A 4C9DA 2QA1A 2MGZA 4RUBA 4JI5J 4ED5A 1YBAA 2MHNA 4LF4J 2HBYB 2XC9A 4KBIA 1SC1B 1JLBA 3BN7A 2G0JA 3CJRA 3VHQA 1XMQJ 5LT5A 3CB4A 4DL7A 4LRFA 4A8YA 4ANCA 3T41A 4B9SA 2ZZTA 2N4DA 2IJFA 3IMQJ 4DLGA 4ED7A 1L3KA 2XSJA 4DL5A 1QLNA 2X1BA 4IYQA 2DHGA 4JV5F 2B4OA 5D8HB 3HD2A 2F3JA 4UY8T 4DV2J 5L9NA 3KLFB 1LWCA 4DQPA 4MKAA 4FF2A 4Z2XA 2DGOA 1KTVA 2YPYA 3MR6A 2CQ2A 4YR0A 1UETA 1T3OA 1QSYA 2VD3A 3DLKB 4ZVHA 4CI0B 3MURP 3O6QA 1JWWA 1RAEB 1U4BA 3QJJA 2Z0GA 3PY8A 4F8RA 2AEMA 2B9YA 3ENQA 2DGWA 3W9IA 1PBAA 4CO5A 1OY9A 5L1KA 3VAGA 3OQ2A 1S0OA 2MKHA 2G13A 2QYGA 3LOUA 1NLKL 1QUVA 4K2JA 4WP9A 1A0OB 2HVHA 5EWGA 2HS4A 3GR0A 1NJYA 5JUMA 3J81U 1UW9A 2YXLA 3I96A 3M32A 4NZ0A 4NASA 3DM2A 1IKYA 2LP4A 3MMCA 5CYJA 2PFDA 5E3RA 1U24A 3VAKA 2FVPA 3CNQP 1RTHB 2D3OR 2KVIA 4USIA 1P1LA 1XK8A 3OUYB 1Y4ZB 4Y34A 2KFYA 2LEBA 4FVCA 1I94J 3BKTA 2D9OA 1K9MT 2PEHA 2WSCC 1RWWB 1F6TA 2D3UA 4IG3B 4ZPBA 2VODA 2CVIA 4WP3A 1NK5A 5CCLA 2ZUAA 4PWDB 4NCAA 4ZP6A 1FRXA 4NCGB 2G1HA 4RNMA 2YH1A
chains in the Genus database with same CATH topology
2HNYA 4KHRA 2R2SA 1QAIA 2PI4A 2BA9A 2BACA 4YHHF 4DV6F 5JVGQ 5CZXA 5HMYA 2FJEB 3TAMA 4DUZF 1QE1A 1GNKA 1YWXA 4OJHA 4LSNA 2RU3A 3U7JA 2PSZA 2ZKTA 4F67A 5HMZA 1HPZA 2BANB 3I87A 3I4HX 1V9OA 5F8JA 4F2SA 3RB3A 1Q8LA 4ITSA 2DGUA 4K5RA 2C22A 2DH7A 4DS5A 2ZH2A 1Y5NB 4JV1A 2ZHOA 4QIFA 5HN0A 3ITHB 4NCBA 2CJ9A 5LJ3Y 4DQQA 3IA0A 3J81Y 3PACA 5E7OB 2E5LF 2KTQA 2OLWA 4DF8A 1QTMA 4NA2A 1SIWB 2MKCA 1TL1A 6FD1A 2ERRA 1OWXA 2OO4A 4RWXA 5FD1A 4ZP7A 1S6PB 2YNGB 2LA4A 3V81B 4C8OA 2MDAA 1XR5A 2W24A 1RT2A 3BQ0A 2ZHBA 2KT3A 3TUJC 1TL5A 2QO3A 1ZBTA 3MUMP 1XN9A 3GFXA 5KG7A 1QY7A 4DL2A 3PR4A 3J7A1 1U2RA 1URNA 4YMEA 1S1TA 5J2PA 2FHMA 2Y1JA 1U26A 3R5BA 4IDKA 2MZJA 1ELOA 4X2BA 5GAHI 5E3QA 3UR3C 1HWJA 2ZD1B 3CMAS 3NL0A 2DHSA 2EFVA 3CD0A 3LP1B 3HHLA 2R8GA 4H4MB 4X65F 5F3TA 4DR6F 1S6QB 3RAMA 4KGKA 1WG5A 2VA2A 5KG2A 1Y5IB 3S01A 3JYTB 4GO5X 4EZ6A 2B7BB 3KLGB 1L5UA 1F60B 2QIFA 4C11B 4A46A 4N56A 4W92B 2UV8G 1FEEA 4ZKAA 3K0JA 3K8VA 3H59A 4A47A 3OSNA 1VQPS 3QJPA 2WB4A 4H4OB 1SKRA 2JWNA 2PI5A 1NK0A 3KMSA 3MPVA 3SDEB 2BQ3A 3JSBA 1KQFB 1RT1B 3GYXB 4MH8A 3PIOQ 4ZVFA 2VH7A 4F02A 2FIUA 2HNZB 3ZZUA 5DM7Q 3I0RB 3IS9B 4ID5B 5J1EB 3TUZC 3QZ7A 2GMHA 3NCPA 1TL3B 1T05A 2D41A 1FTRA 2ZDPA 4DSKA 1HBMA 3NMAA 2HAIA 3DM2B 2R2RA 5KTQA 2FB0A 5J1NA 4DV5F 2E1CA 3NMRA 4QIWD 1HYSB 3S1TA 1XMQF 4B9UA 2HYIB 2YWEA 4N76A 3T5LA 3E51A 4DV1F 4IG3A 5C42B 4G1IA 5DQIA 4UQTA 3N6LA 1FA0A 3HLUA 1X5OA 2YWKA 2ZKUA 3FMWA 3MM5A 4NA3A 4QR2A 4C0OC 5K8PA 3CD5A 5AXKA 3OXGA 4IRCA 3S8SA 5H1SV 5DJBA 3WZ0A 1WHVA 5IM0A 3RBDA 1LWCB 1YIJS 2JLGA 2BM0A 1D9DA 2JH3A 2N3LA 1E6YA 1YTYA 2AW0A 4QWAA 5F8LA 2NZ4A 3HVTB 5KFUA 3G96A 2QMWA 1XBWA 4C8MA 1LQ9A 3GV7B 2CQDA 1DTTB 4OI1A 2C2EA 2GHWA 2GIRA 5CYMB 1TL3A 2LU1A 2CJQA 3NWGA 3L7OA 5DG9A 4JI4F 4K2XA 1FVSA 2R7WA 1NKBA 1JJ2R 1GX6A 1JLGA 3QWUA 1R43A 4MKBA 3VCDA 4YQWA 2W9CB 2HHQA 4KFBB 2DK2A 3OLAA 5U47A 4FXVA 3M9OB 5KFQA 2RVJA 4F4ZA 2MMYA 2RKIB 2HHXA 3HK2A 3PRBA 3J7Z5 3N6NA 4ZK7M 1Q82T 4DR3F 3DMJB 1VQ8S 1WACA 2Q79A 4JI0F 1X0FA 2KXHA 4IH7A 1RT3B 2G1DA 1GTEA 2HS3A 3P96A 2DGTA 4DV3F 1VQOS 1U49A 5ADZA 1I6JA 4DR7F 4Z37A 1XMBA 3OR2A 1BQNA 2V9WA 2C42A 4K4WA 1AFJA 1E6VB 1Y3KA 4P7VA 5GVQA 3CSKA 4HKQA 1TK5A 2PC6A 4OZ5A 4ECZA 4NLDA 4A8WA 1J5OB 2VL1A 3KNAA 1HI1A 2L9WA 3OR1A 5KG3A 3M2VA 4ZOSA 4ZPWR 2DNHA 1DARA 5HBMA 2YKMA 1VI7A 3MEGA 1SL2A 1YGYA 2BM1A 1X9WA 4W90B 2W9CA 1Q53A 1Q78A 1TV6B 2W8KA 2ZH7A 2KXNB 4A8XA 1UW4A 1F5AA 5L1JA 2ACYA 4WFYA 4ZP8A 1RTJA 3HDSA 1JX4A 5CYQA 3PW5A 2GFFA 2N82B 1PC4A 1X0PA 4OI4A 4XDCA 2ZH1A 5C5JA 1NK9A 2NR0A 2YKAA 3HHDA 3KK2A 2E5GA 2BQUA 3KK3B 3I9V9 1SXLA 2EFGA 2XNQA 2XLJA 3EX7B 4ECSA 2LVWA 4M94A 1HBOB 2MQMA 3BGLA 1RDRA 2WSEC 2HNDB 4OZNA 1WHWA 2KT5A 2IYIA 2BZ2A 5I4MA 3BJYA 1MMDA 1J2VA 3MOZA 1KQKA 1R8CA 2ZUGA 5KFSA 3TUIC 4CTAB 5D3GB 1RYRA 1Y3JA 2DD8S 2JX2A 2M2BA 3PFOA 5AE1A 4DR5F 2F8HA 5F0UA 3OL9A 3VQTA 5ITHA 2J9EA 4I2PB 1HWIA 4PXBA 5JJBA 4V19J 2DNYA 3HT3A 2AGPA 4PUOB 2JVOA 2LEPA 3JAMY 3NG8A 4YUDA 3I0RA 5J1EA 2MQNA 2CYYA 2XG8A 1FRLA 4ES2A 1NJXA 3X3UA 3O3LA 1L3UA 5B0CA 3JB9k 2UVVA 3Q2SC 2PMHA 2VOOA 4PR6A 3PDNA 4RW6A 1S1WB 1KEKA 5T14A 3FGVA 3VAMA 5KFCA 3P6YC 4F2RA 2E29A 1S9GB 2OAUA 3PJXA 3JYTA 3KLIB 5I3QA 5F8IA 2E66A 2GMLA 1R6YA 3DRXA 2F40A 3CMES 4C11A 1HQEB 1SIZA 2DITA 2O3DA 2P6TA 4G1PA 3CCJS 4X84A 2CPDA 1DQ9A 2VB6A 1U48A 4K4UA 3M05A 1F0XA 1S6QA 3FFIA 4I4BA 4E0DA 3TAPA 5F3ZA 4EZ9A 5IT0A 4OJ1A 1S1XA 1V3RA 1XERA 2AX1A 4PCQA 2CZ4A 2YX1A 2B3TB 2WBRA 3I6PA 1H38A 1NKEA 1NJZA 1IBMF 5D4LA 2KRBA 1X5SA 4IDKB 2XSJB 2RMLA 4C8KA 3CC2S 2HMIA 3M2UA 1B0PA 4I6WA 5DETA 4R5PB 2LDYA 1HNZF 2J6TA 2PA3A 2MQPA 1VOMA 2F8MA 3HHNB 1LW0A 1X4EA 1DURA 4YB1P 2WONA 3V6DB 1PGZA 3TANA 5EN1A 1R8HA 2XI2A 2OTLS 5T7LA 4ZVGA 2HPUA 1FO1A 4Y2CA 5IM0B 2WTFA 4PXCA 2P9CA 3QMQA 4FNIA 1H7WA 1JKHA 3C8YA 4HLBA 4I7FA 3RYLA 3MDFA 4I56A 4RBVA 4RW9B 3CCSS 1U1MA 4RNNA 1CEZA 1IBLF 4X4VA 1S0MA 4K4TA 1K8AT 1X9MA 2OPQB 3FVYA 4Q8FA 1N6QB 2IFXA 4O3NA 4C3KA 4LF5F 4LVNP 3T19A 4X62F 4C8NA 1VK3A 3F73A 4ZCIA 2DBBA 1UJ6A 2LECA 4KPYA 1CLFA 3DOKB 4ZCKA 4R8UB 2GA7A 1OIAA 3ENWA 3OTCA 4KHPF 1VQKS 1R0AA 1HNVB 2HHPA 1U6BA 4QR1A 4LIWA 3I9ZA 2NPFA 3D28A 4OLOA 5B08A 3DXSX 4TYAA 1WEZA 3OTEA 4QCLA 1TKDA 2MPUA 3PXGa 1IKYB 5DDOC 2JJ4D 2IC3B 4O23A 4PXDA 5A0YB 1MWYA 2X3GA 4N41A 2F9DA 4IOCQ 2WK4A 2CPIA 4WYWA 5EHHA 1TFYA 4EFAC 4JI3F 2B43A 2QSFA 1FJ7A 1IM4A 2CG4A 3TO8A 5KG1A 3HKZD 2MJNA 2AU0A 2W4DA 2GJIA 3LW5C 4OI0A 3BZQA 2FJAB 2I5JB 5KFGA 2DNOA 1FRHA 3TX8A 4DFMA 4NRUA 2P9EA 4ERDA 3IG1B 2COLA 1D8YA 4RW7A 4BWMA 5EX3A 1M5KC 1J5OA 3NNHA 3OJSA 2AV5A 2BE2A 4DF4A 3GWCA 1YRXA 4J9MA 1HBNB 1FERA 3JTNA 1LFPA 3V81A 4DSIA 3G6ES 2JFKA 1D1UA 7FD1A 4C0HA 4IFYB 4PQUA 1HBUA 2P5VA 5B0GA 1IN0A 3ENVA 1BC6A 5HP1B 1DLOA 3BM7A 4AE5A 4NLUA 3B82A 4X4SA 2CZVC 3ONQA 3TP2A 2B9WA 4ECWA 4JUZA 1SJFA 1Q7YT 2QLXA 2DCLA 4Q2LA 3K59A 2KJWA 1FF2A 5FJ4A 2KT2A 1OQ6A 3R5AA 1IR0A 1UL3A 4KFBA 3ZZPA 2KG1A 1U1OA 2YWGA 1QUPA 2VG5A 2ZH4A 4K5SA 2FGOA 2J5AA 4TY8B 1QM9A 5D6GA 3CCMS 4OL8A 4ILLA 4FP9A 4IRDA 2JVRA 2ADCA 5LL6d 1C1CA 3F44A 3P3DA 4B9SA 3PV8A 2ZE2B 4F25A 3I32A 3OPKA 1FEHA 4RNHA 5CCMA 4IUFA 2XS5A 5KFRA 2XCPA 1BQMA 1N5TA 1K0VA 2A1BA 3M30A 4H54A 4RW7B 2MKIA 1B0VA 1X4FA 4DPOA 2E9TA 1AW0A 4IQMA 1GH8A 1T8EA 2IVMA 1E6YB 2UVWA 1YRUA 4CNZA 1VQLS 4FPRA 3CXCR 2R8HA 2ZOGA 2DNRA 4PG6A 1M5PC 2EVZA 1CQMA 1QAJA 4NRTA 1UEVA 1G3OA 4ZPVR 4ELVA 2XO7A 2VBXA 4XO0A 1EETA 2MSSA 3C3LA 2QT7A 1CQNA 2RU9A 3ICLA 3BEGB 4IQXA 1NAQA 4DOZA 4TN2A 1KOOA 3G8QA 1KD1T 1CVJA 4O44B 3OHAA 2PDAA 2J7KA 3GIJA 3MR3A 2V8GA 2IM3A 1VQ4S 4C2MA 3BO2A 3E8OA 3FEYB 1X8DA 4ZVEA 4ZPCA 2AJFE 3GG0A 4BC7A 3BN4A 5T41A 3G6VA 1SJ3P 3LWMA 1Y5LB 4WE1A 3FJ2A 4DR2F 3NP5A 2FVRA 3M8RA 2MQOA 2CFXA 3V6KA 1A7GE 5GAGI 2RJZA 3G4SS 3QGHA 4OI3A 4QIGA 3MECB 2IRYA 3N4WA 4RW8B 4WFXA 2MQLA 1S72S 1G1XA 2OFGX 1FKPA 3K7RA 2VQEF 1D0EA 2E1RA 4CO4A 1FD8A 4YR2A 1LWEA 2JL9A 1NB7A 1LK5A 3TVKA 4RU9A 1MU2B 2OPQA 3W7BA 4E8UA 4QWCA 4DL4A 4I64A 1DHMA 5CD4H 3M2RA 5F9LA 2W9BB 4FF1A 1LKZA 4OHVA 4RNOA 4B3SF 5D4OA 1VRUB 3H2UB 1REVB 5EDWA 4YP3A 3KNGA 3KHGA 3W2WB 1KRPA 1ZETA 5F9NA 2FUG9 4RUAA 4NYOA 3MECA 4QR0A 2JSXA 4G3IA 1JLEA 1VRTB 2A2CA 4LMZA 4AUKA 1B7FA 2CJKA 4DL0C 5KT6A 2M52A 3EUNA 3KLHB 4XAKA 2LU2A 5CYMA 4ECTA 2DHXA 4WTYA 4OZLA 1DTQA 4J9KA 4JI2F 2R4FA 3LF0A 2OJ3A 2D7SA 1IKXB 1YJTA 1VQYA 5F8MA 2HVZA 4OHWA 3V4IA 1S1VB 4NLRA 2HHHF 4J37A 2EWHA 4IFVA 1WF1A 2HRYA 3L3CA 2C3OA 4MIBA 1YQHA 1VQ7S 4HH1A 1S99A 2U2FA 3BR8A 5F0WA 4MIWA 2Q3PA 3I4PA 1T7PA 4QU7A 1K0TA 3E01A 4YOEA 5I42A 5KG5A 1ZOTA 3H98A 3LP0B 1FXLA 1JXEA 2CPHA 2EG2A 2RUGA 5KT5A 4A8SA 4HI2A 2BDPA 1KVIA 1RTIB 3U27A 4D3GA 2ATLA 4LSNB 1HNIA 3CCRS 1ZTWA 1RT4B 4B3TF 3MHYA 5J2MA 2ASLA 2LA6A 1FJCA 1FDDA 2GMJA 4QIVA 4LSLB 2NLWA 1APSA 1YVFA 3N5FA 3ITHA 2VONA 4WKRA 3LUYA 3O1LA 2X1FA 2FY1A 1KTQA 3CCTA 4TQSA 4DSEA 3M2UB 3RRHA 4DJBA 1IKWA 1UVNA 3OHBA 3HVAA 3A8EA 2HGNA 2RQ4A 4A48A 3VAIA 4IFVB 3LO3A 3J7YI 2D3ZA 1FDBA 4KQZA 2V4QA 4PUOA 5C25B 2Y0SD 1IUJA 5H9EJ 5CZVA 3FFIB 4AQYF 3CE8A 2L08A 2J8AA 2YNHA 4NLXA 1S9FA 1T3NA 2HHSA 2M8DB 2WB1D 1EP4B 2J9DA 2XWXA 2ZITA 3OR2B 3UCGA 4RNFA 2VFSA 1JLCA 2YY3A 3S6EA 5LSRA 5DGBA 4I7FB 3GIKA 1VBZA 2JOQA 5A6PA 3BSCA 1UVLA 1H2VZ 3CTRA 3GR1A 1CC8A 1ROFA 3N01A 1RTHA 2IM1A 3C66A 4RW6B 3CPWR 3N0VA 4HI1A 5KFKA 5HROA 1OSDA 1TKZA 1UAWA 4WU2A 3MD3A 1TVRA 2E7WA 3SFUA 2GX8A 1I1GA 3I0SA 3CCQS 2IVYA 2X51A 1IQTA 1O8BA 4CO0A 3KOAA 3Q8SB 5B0EA 4KE5A 3RZAA 2ADBA 4OJGA 1V3ZA 2BABA 2O67A 1U1NA 2HWIA 4OHYA 1WF0A 3RB6A 1HR0F 1SJ1A 2DR9A 2OKQA 3M9NB 2XY5A 4B17A 1WWHA 2DPJA 3DRPA 3M4XA 1RT6A 4IKAA 2CPYA 2CJBA 5AXNA 4M1KA 4CCHA 2F4VF 3BDPA 4YB5A 1R31A 1GAOA 4KAIA 3GQCA 1AXQA 5K8NA 4QW8A 5J1PA 2WRMA 3CT9A 4Y6IA 2NSBA 2Y1IA 1U25A 2RQCA 2J7UA 2CPZA 3C6TB 3FDSA 3GYNA 3WX4A 3CC4S 2NS1B 1X4CA 3M9MB 3CCWA 2O5DA 2D1CA 2VC1A 2ABYA 1G6BA 4XPCA 2ALZA 3BGRA 4A8FA 3T1HF 4NLQA 1C1CB 3SCJE 3U1NA 4Y00A 4IRKA 5FIIA 2HGLA 4ECXA 2ZBIA 1JLAB 3MGJA 3VAFA 1HNXF 3NGKA 3MM6A 5KFBA 1OPZA 4URSA 3FQKA 4NLSA <