2A6OA

Crystal structure of the ishp608 transposase in complex with stem-loop dna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
b'AVLYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIENQQNSNRPKQKEKWKSYVDNLQTKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*CP*CP*TP*AP*GP*CP*TP*TP*TP*AP*GP*CP*TP*AP*TP*GP*
publication title Active site sharing and subterminal hairpin recognition in a new class of DNA transposases.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription/dna
total genus 45
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2a6oA00
2XM3A 2VJUA 2A6OA 2VHGA 2VICA 2F4FA 4ER8A 2XMAA 2F5GA 2VIHA 2FYXA 2EC2A 2A6MA 2VJVA 2XO6A 2XQCA
chains in the Genus database with same CATH superfamily
2WRMA 1LW0B 3RB0A 4JYAJ 1P1LA 1X9WA 2Y1LB 4LSNA 4ANCA 3ITHA 2DPJA 1JLGB 1VRUB 2HWTA 1F3FA 1TV6B 2DGOA 1GXUA 1HWIA 4ER8A 3BBFA 1QAYA 1VC0A 4QBUA 3DLJA 2ROPA 2FJBB 2MDAA 2CQ4A 3Q23A 3SQGA 2VL1A 3ISZA 5HROB 3DYAA 2ZH5A 1FX4A 2ZOGA 3HSGA 3CJSA 2WZ1A 4J9RA 2C3OA 1IBKJ 1T9VA 3CGIA 3QFWA 4QIFA 3G8SA 1UWAA 3SCLE 3THTA 4AXIA 2O66A 4U7CA 3SQOP 5GAHI 3D67A 1VQYA 5IZHA 3BZQA 4ZJQA 1JLAA 2QTWA 2V4JA 2C2ZB 3EGZA 4OYOA 3KJFB 2X51A 2WW8A 3FFIB 3FUYA 2JSXA 3GG1A 5D15A 5C24A 1G1XA 2JEIA 4DQPA 3IBFB 2COLA 5KAKA 4ATNA 2ASYA 2GVZA 1N5YA 2NSBA 3L09A 3PW4A 3AJDA 2Z2ZA 1JJ2R 4FKXA 3T9NA 4U7UK 3PJ9A 4TLRA 5EGYA 4A8SA 1NZ8A 3H5SA 3CCUS 1MU2A 2DNOA 3BV8A 3L3CA 3B78A 5DZ6A 2ZBQA 3D0GE 4C7QA 3LGMA 3CCQS 1FT8A 1QUPA 4TYBA 1HNZF 2P6TA 2UXCJ 5IC4B 3NL0A 3RTVA 4USVA 3SI8A 3R2CJ 1I3OB 1B3TA 3KUGA 3GMGA 3ULHA 2KFNA 3KUHA 4IG0A 4USUA 2DIVA 2XWXA 2WONB 3MUTP 1DQ8A 2V2KA 1IKXB 2MSTA 3LGHA 1SKRA 2CAJA 1PSDA 1UVLA 2OPPA 1BQNB 2QO3A 2E7XA 3S01A 3M2RB 2MLZA 2DY9A 1NJYA 2ZH3A 4YY3J 1H98A 4YB6A 5IOLA 2GAHC 1U6FA 2FLOA 3VGUA 3MM9B 2KG1A 3W2VA 3VAJA 2LXUA 3I6PA 5CZVA 1DRZA 3HZGA 3A3OB 1S1WB 2XO7A 3MEEB 3PYDA 4I7FA 2QLBB 3IO1A 2ZH6A 4WCEQ 2XBPA 1FFWB 4F3MA 3QT6A 5KG2A 1U48A 4FYXB 3JS9A 3I5CA 5F8HA 2QX0A 3Q8SB 3N6MA 1S6QB 5DG8A 2E7VA 2Z2LA 1D3WA 2H65B 3KFWX 2ABYA 5KFKA 1VFJA 3HFVA 3IN5A 1AZSA 2BA9A 3MZIA 2V8VA 3PYFA 3FZBA 4Q44A 1F60B 2V67A 3J81j 3UDEA 1NM2A 3T3FA 2Z57B 2WHOA 5KFVA 1PAUB 2MKSA 2PIIA 3CMQA 1S5ZA 1MROA 4WFZA 2BM0A 4WE1A 1KHVA 1MN9A 1NUEA 3HCXA 2E29A 5HJXA 2EFNA 4OL8A 2M9KA 1EIYB 2HZAA 1V3RA 4P74A 4DV1J 3BYPA 3R5BA 2U1AA 3AY0A 1U45A 3CJTA 3WX4A 1YRTA 3TI0A 4K5SA 1FK9A 3M30A 1U02A 3TYTA 3FZ2A 7FDRA 4X4TA 1PGZA 4EBCA 2C3UA 4LREA 1AROP 1ITPA 1V5IB 3ETOA 4ED3A 4OZ2A 5LL6d 2ZH4A 4IG3B 3RBEA 3OR2B 2C22A 5FD1A 2A18A 3SZ2A 1B4SA 1ZAVA 2PC6A 4ANEA 1UW9A 3DLKA 2HNDA 4KHPF 2LEAA 1CBKA 3HVWA 4JB8B 4J9VA 3G8TA 3CC7S 4IH7A 3PG9A 4NA2A 3H8YA 2ACYA 3AXMA 2NYIA 1KTQA 4PG7A 2V4RA 2ASJA 2VA3A 3FBBA 4M5KA 1RTHA 4NZ6A 4L72B 3KG1A 1B0VA 2DGUA 4ZVTB 2RQ4A 2QFIA 4PKDB 1B64A 4TXSA 3DNCA 3HHLB 2B4VA 2PT0A 5KFZA 3NOCA 3JTOA 1XMQJ 1RTIB 5A8RB 5KG7A 5L9XA 3IRWP 3MI7X 4NLXA 1CPZA 1V3SA 2D69A 3KJVB 4DR5J 1JLEA 3H4DA 4UOGA 1CQNA 1GTHA 3WIVA 2WTFA 3W5XA 2A6MA 4UOFA 1YX2A 1JQGA 1B7FA 3OTEA 1FVQA 4KE5A 2YNGA 4YS2A 4W4MA 1R8BA 3TZWA 2WW4A 5DZ7A 2MQ8A 3MAQA 1FKPB 4FF1A 2KYXA 4NE9C 5C25B 2K2PA 1BGXT 4DHVA 1X9SA 4F3OA 3I5AA 3KLFB 2YWGA 3NAIA 1ZTWA 1K47A 2NUHA 2HGNA 1FEEA 2V34A 1HWLA 4DSLA 4RW8B 3DLGA 3M9OB 3Q24A 1HI8A 2KB2A 2R7RA 4P9SA 4LFBJ 3H90A 3R27A 3D1QA 4P75A 1NPRA 5A6WA 3O3LA 1Q1KA 4HACA 4D3GA 3UD3P 1C1BB 3V81B 1SI9A 4DUZF 1GXTA 4ZVGA 1T02A 4OX9F 2X7IA 2HRUA 3IFEA 4RUAA 4OJ1A 4H4MA 5KFCA 3DI6B 4Y0FA 2DY1A 4QYZJ 2YPYA 1YHQS 4LSLB 2F5GA 4Y6IA 2UU9J 3O2IA 2OSRA 1NZAA 3E01A 4A46A 1KOOA 3I0SA 1D8ZA 3CCMS 5IT4A 2UUWA 3DC2A 1SJRA 2R9LA 1RB0A 3W64A 3AXKA 4X84A 4FN5A 3KUEA 1WC6A 5B09A 3VAIA 2BX6A 1RYSA 2BRKA 4ED2A 2OH2A 1RK8A 3L7UA 3ENQA 2XMMA 1GFWB 5ETLA 3MCNA 1RT2A 9ATCB 1LW0A 2GIQA 3UPFA 2DR7A 2HQFA 2IRUA 2ALYB 4P2MA 3JTNA 2FLPA 1JLGA 1VRUA 4QYRA 1GEHA 2D1CA 4PWWA 3NGRA 1S97A 1TV6A 1ZYQA 3L7PA 3KHHA 2W9BB 3CJRA 4UY8T 4O23A 3AOBA 2KFZA 1XNQJ 1QAXA 4DFPA 4JI8J 2Q6CA 4KGXB 5H9FJ 4DL3A 2VG7B 2IY5B 3NG8A 1IBMF 2J6UA 5HROA 4J5OA 4F2RA 2HS0A 5F9NA 1M5PC 1VRTB 4DR7F 1TR0A 2EC0A 4K8RA 3E2EA 4M63A 3BKFA 3K7RA 3UNGC 4QU7A 1U49A 3FRYA 3HFZB 3W1YC 4ECSA 4M94A 3ZZYA 4QCLA 2NLWA 3FFIA 1HBOB 1RU2A 1A7GE 1RBLA 3JXOA 4EYIB 5LMUF 4ILLA 3BGLA 4ZP8A 4O3OA 3HT3A 2NYHA 4OV1A 1CG2A 4LR9A 4YEAA 4WJBA 5LJ3Y 2K3IA 1FF2A 5HO4A 3D28A 4ED4A 3IWXA 4A8XA 3ZO7A 3MCOA 5KFLA 3SCJE 3GFHA 2EFGA 1F3VA 1CJVB 2BRLA 4ZS6A 4ZVQB 3JSBA 1IM6A 2KM8B 1XMQF 1D8YA 3HULA 2CQ2A 2J8AA 3H2UB 1PIEA 5FLXU 2BE7D 3TAPA 4PEOA 1RT4B 2XMVA 4DJBA 3KLGB 4B9NA 2EPIA 3AQOA 3KLIA 4CH0S 2HQ3A 2F9JA 1X7VA 1M5KC 1P9QC 1JWWA 1RSCA 2IMOA 2WONA 4XO0A 5HL7Q 2XULA 1IKXA 3V2UC 1H2UX 2DPIA 4DR3F 1J5EF 4NEZA 2R4FA 4LFCF 2MY7A 1BQNA 2U2FA 4LIRA 1XC9A 5K9FA 3M2RA 1C4CA 2GHVC 2DH8A 2EFQA 4N41A 3MM9A 1KVIA 4NEYA 3CDAA 3UCGA 3C2PA 4B9MA 2CPDA 1S1WA 3CIMA 4PCQA 4P71A 2VBYA 2UUCF 2CJYB 2AJ1A 3OTOJ 1CC8A 4RBVA 4CCHA 5E3PA 3HLUA 2MJNA 4I2QA 3LPEA 2NZ4A 2F63A 2W2MP 1S6QA 3FC9A 2HQGA 2XEXA 1IKVB 1VBZA 1P1TA 1WF1A 3EYZA 1IWGA 1X31C 1GAOA 1XEZA 3NNAA 4RNOA 1PYOB 3A1YG 3RR7A 3P6YC 1S59A 5D4NA 1J5OB 3OL7A 1N32J 4ED6A 2BMBA 1RI7A 2AYGA 3NS6A 3ET6B 5ETPA 4CLKA 5KFUA 1Q82T 4B3MJ 1PJ6A 4B3RJ 2CPZA 3MM7B 1N33J 2BUNA 4OYAA 1M5SA 1H6KX 3RG6A 3RB3A 2VU5A 1KQSR 2E5JA 2DD8S 2BANB 4N56A 3DLBA 3OR1B 3IM9A 1IQTA 2W2QP 4FZVA 4NZ7A 2B6AB 5JXSA 2DR8A 4OI3A 1UMJA 2NPFA 1XNQF 4ECYA 1VR6A 3KLVA 5GVQA 2W8KA 2CQGA 4W92B 1HBUB 2VA2A 5D4LA 2J0SD 3EZOA 4QIEA 4B3TJ 3OR2A 4NXMJ 1O51A 1YJWS 2VONA 2LXIA 4FVMA 5KFBA 2AF6A 2W7AA 4O3SA 4Y34A 5H9FK 1UZHA 1XNRF 2ZM6F 4RNMA 3TEGA 2B0GA 5KFAA 3AH6A 2KT2A 4PXCA 5F8NA 3BSNA 4DPXA 3C16B 4LF8F 1HWKA 3T5KA 2ASLA 3CWJA 2YWKA 4P73A 4WU3A 1NB7A 2F7VA 1IM4A 5LXYA 1JX4A 4NLSA 3DHWC 1C1CB 4F4WA 4X66J 4RWXA 3TUJC 4DEZA 3EZUA 4I0WA 3HHLA 2HFUA 4NA3A 3MURP 4C8NA 3QMQA 1RTIA 5A8RA 4TY8A 1U6BA 3HVRA 2CQ0A 5KFFA 2VASA 3VQTA 1YDLA 4B08A 2YX7A 2J7WA 5HANA 3KJVA 4EZ9A 4AQYF 2Y8YA 3C6UB 3HP6A 4BC9A 4ERDA 8RUCA 2Y0SD 3VZHA 5A8WB 3F0NA 4N76A 3CNQP 3H2LA 3BO4A 1OWXA 2DNNA 1Z2ZA 1N5VA 1FKPA 1WTFA 5C25A 5A0YB 2DHSA 5I3QA 5L38A 2HFZA 1RE1B 3W61A 3O6QA 4QW9A 2JH3A 2NXUA 3WQPA 2BQRA 3NMRA 2IRYA 4K0KF 2QMWA 5LMNJ 3UCUP 3CXCR 3JSRA 5HP1B 3BS9A 3IR6B 3HX9A 1WI8A 3D3BJ 4X4SA 1C0TA 2CJAA 5B0AA 3EX7B 1C1BA 4RX6A 5D0RA 3W5YA 3EDQB 2XG8A 3G2XA 2WVEA 2UXDJ 4DR1F 3IMQJ 1EKSA 3DI6A 4CT8A 4YDDB 4ICLB 4PG6A 5AXMA 1L3VA 1R27B 1EP4A 3TANA 2IMWP 4C9DA 1UFWA 2MZRA 4TN2A 1V5VA 4XK8C 3LWMA 4J9OA 1FRIA 4ID8A 2NXEA 3MMCB 3JSYA 3X3UA 5I42B 1RZMA 1LQ9A 3GSDA 3MR3A 5AJ3J 1U25A 3R8YA 2OO4A 4URGA 3V4IA 2AKWB 4FYDA 1NDLA 1YGYA 1NK5A 2VICA 2ZD1B 3HJFA 3CIZA 4AYBD 5J2QB 1UWBB 2C3MA 1WOSA 2BKNA 4M5GA 4ZPWR 2VDIA 3D2WA 2RDJA 2HK2A 2FJDB 4CLPA 1N33F 4PUOB 2DGQA 2W9BA 3FRZA 2VFRA 5HQMA 1T3OA 3D68A 3BQ0A 3V5RA 1M1GA 3EVOA 3U1MA 1HNWF 1HQUB 3TO8A 5D4PA 4AD6A 3NCPA 3JTPA 3GFZA 4FXWA 5E3CA 3H98A 4K2XA 2DGSA 1RAGB 1UEVA 2ZC3A 2FVRA 3B82A 2AT1B 4LVOP 2WBRA 4JI7F 2RUGA 2RS2A 3HHLD 1R6VA 4DV5J 1LWXA 5F0WA 1WEZA 2FJEB 3BBCA 3QJJA 3L95X 1HBOA 2DJWA 3L4BC 2WVBA 4DR4J 3BGUA 4TKTA 3HJVA 2M3DA 1VHIA 3GIRA 4OI4A 4DPWA 4ZK7M 4G6VB 1Q5YA 3BJYA 1KD1T 2MGZA 4N77A 1WELA 3DXSX 6AT1B 4Y3CA 3FCWA 3M8QB 2IYIA 3NGTA 4X66F 1FE0A 4ZOSA 2V2QA 4HVZA 2W4PA 2HBQB 1NXIA 1WSRA 1CJVA 4CLTA 2BDPA 1X4DA 3RB6A 4ELTA 4ETZA 2QT7A 4MAKA 2OEJA 4F36A 4WP8A 2KT5A 3GR0A 4OZ5A 1RT4A 4HI2A 2RQKA 3C3LA 1SQFA 2R2SA 3CC2S 1D0EA 4ELVA 3GB0A 3N5FA 2XHWA 2KL8A 4DU7A 1KQFB 1CVJA 4LF6J 1AUSL 2HHTA 3C14B 3BR9A 2DNRA 5D77A 4OYBA 4U96A 2BM1A 3HVAA 3JSMA 4QPXA 2W9CA 1PG5B 4DR6J 3CJ3A 2BJ9A 2HHHF 1FKOB 2IA0A 1EARA 3E51A 2YKOA 1X8DA 2HMIB 2BVZA 4ZP9A 1NJIT 5KG5A 4R0JA 2GC8A 5M2RA 4K59A 1H2TZ 5LSRA 4WXWA 1RXOB 5D3GB 5FLXY 3MEDB 2ZE2B 1RT5B 3LW5C 1D9FA 2UVUA 1OSCA 1M5OC 3CMAS 4CRJA 4A47A 2UXDF 1WOOA 1U2CA 3VALA 3PX0A 3C8YA 2DKOB 2HK3A 2RNEA 1MWQA 4JI5J 1BQMB 2X1AA 2L41A 3Q2TC 1I94F 4KJIA 1IKVA 1H2VZ 3K8VA 5F0UA 2RS8A 3PW7A 1DTTB 1V9OA 2B9XA 2LLZA 2LQ8A 1TUVA 4NLOA 3WX8A 2KI2A 2MTLA 1H73A 3I96A 4IR1A 3VAFA 2JEGA 2GJIA 1IJEB 5AJ3F 5KFSA 2AYBA 1RKJA 3ET6A 1FNOA 3J7ZT 1HNVB 4EO6A 3MM7A 3Q8PB 2I8EA 1S0OA 4OYPA 3MMAB 2BJ3A 1YJ7A 3JAMY 2EVZA 1NSKL 5ITHA 1CJTB 1LV5A 3UWTA 5HI7A 2BANA 3OR1A 1FWPA 4LF9J 3BH7B 3R3TA 3Q0AA 3MD3A 2B6AA 5AT1B 3GYNA 3BO2A 2RMLA 4DUYJ 4O4RA 4WFNQ 3KDNA 4JV2A 1AW0A 3BKUA 1HBUA 5F8MA 2CJXB 4F2SA 3NNHA 2Y1IA 3M2UB 4YHHJ 1UVKA 2HPUA 1FRJA 1GX6A 2LQ9A 1AA1B 3CEDA 3DCAA 2AJQA 5EHHA 1FDBA 3LALA 4UOHA 2RB7A 5DRKA 3QNWB 2AX1A 3HD2A 1RP5A 3Q8RB 4DFMA 1ZETA 1FJCA 5E7OB 4E8UA 2I5JB 4J9NA 1CSJA 1HIYA 2FTRA 4NL5A 1KWMA 3TVZA 1GTEA 1C1CA 2HEKA 3MUVP 3CC4S 1NDPA 2XLIA 4WF9Q 1T9XA 4WYLA 2N3LA 2B51A 3CCZA 4HHHA 2ZZNA 2CQPA 1FDDA 2E5LJ 3P5BP 1S4FA 1ZZFA 1WC0A 6FDRA 3TUZC 3QLHB 2LP4A 3SXLA 1UJ4A 3LP0B 3C6UA 1RHKB 4XAKA 5A8WA 1F5AA 4KC5A 2WB4A 2HSEB 3DGPB 5A0YA 1ZZNA 3UDVA 2HFNA 2DGVA 2MPUA 1JB0C 2XYHB 2ATCB 1S12A 2Q43A 4GO7X 4ZJOA 1HQ2A 3HSDA 3QJPA 2NXNA 4UTGA 4Q45A 3GILA 5HP1A 1Y9OA 2JWNA 2RQMA 2YXLA 4HEA9 2UVVA 1PILA 3PY8A 1BD6A 4FNHA 2NQPA 2HIYA 3T1HJ 3RW7A 3M2VB 2YWFA 5KFQA 5A2QY 3CCTA 5K8OA 1SIZA 2ZH1A 3TR5A 4ICLA 3AB2B 2DR6A 3W5ZA 1WHVA 4F67A 5CCLA 2B9WA 2NPIA 1F9HA 5I42A 2QYCA 2ALZA 2F4VF 5F8JA 4JI1F 1N4LA 4YR0A 1EX8A 2RF2B 3OVBA 1I1GA 3VV2B 3VGSA 3MFHA 4MH8A 4OYZA 1GH8A 5D8HB 1H72C 2OMLA 5D6GA 2MZJA 1XMOJ 2ZD1A 2AGPA 3A8EA 3KJNB 1N5TA 3DRSB 2HLUA 3M9NB 5J2QA 2OTLS 1KQKA 4GO5X 2VIHA 1QAJA 3KK1A 3ENAA 1XBWA 3AB4B 3QZ7A 3LUYA 3Q86A 4KQZA 1KTVA 3DDKA 1WKLA 3R7NB 4WK3A 4OX6A 2DGWA 3QIDA 2CYYA 2MQOA 4YFUA 1HQUA 3B8HA 1BE4A 4PG8A 2MZ1A 4N8NA 1S6PB 2AWZA 1X60A 2BABA 3MEKA 4DSIA 3HKWA 3BREA 5DG9A 2MQPA 3M4XA 3RRKA 3DFEA 4F4KA 4I6WA 4KV8B 2UUAF 1QSYA 4NRUA 2YH0A 4DL4A 2HHPA 3LP2B 4J7CA 2GJ2A 2OMOA 4KPCA 4YHHF 2LMIA 1RWUA 2BOAA 4WK1A 2IJNA 2H48B 4CO2A 2HZCA 3AA8A 4C3KA 3W9JA 4Q0BA 1SH2A 1JXEA 4N47A 2GAGC 4OHYA 3BGRB 5F8LA 2DTJA 4U8VA 4Y00A 4DBQA 3DRXA 1FNXH 1U4BA 2FJWA 1O5JA 4OJGA 2DO4A 3QPIA 1OSDA 2AYMA 3NAHA 4B9VA 3J80U 2W9AA 4PPZA 3H20A 1NKCA 4PYAA 3DU6A 3MCMA 2QN6B 4ZVFA 4DV4J 2DO0A 4OI6A 2AJ4A 2D3ZA 2PI5A 1FE4A 2QL7B 2MB0B 5ETNA 3J81U 4WP3A 2G4BA 4RU9A 1SJFA 4W98A 2M52A 3GCWP 3VR1A 1NK6A 5DG7A 3ISND 3UFCX 1KSPA 4MIWA 3Q2SC 3PV8A 1YITS 2PO4A 3K0JA 1VQKS 1NLKL 1FKOA 3IG1B 5CYMA 3QIPA 1YSJA 2YX1A 2M7SA 2Q79A 2HMIA 2QE5A 2ILYA 3EPIA 1NNDA 3HHKA 3OJUA 3AD7C 5AE1A 2HW3A 4J91A 5DLFA 4FPIA 3LH2S 1FWKA 1N5QA 5D3GA 1U1NA 2ZE2A 1RT5A 4Q43A 4ZVUB 3RW6A 1WTBA 1ZPVA 2ZNZA 2JJ4D 3D6MB 2IBOA 3VWSA 4MMOA 4J9SA 4R5PB 2ZHAA 1BMQB 1NDCA 1BWEA 1ZAWA 3HHLC 4JI4F 2HVEA 5BR8F 4K7QA 4P52A 4CM2A 4NZ0A 1BQMA 1RT1B 4W90B 5DJBA 1WC1A 1FO1A 1RHJB 2WSCC 1N88A 4XPEA 3BDPA 4KAIA 2MLYA 2F3JA 1QTNB 2ZBCA 1DTTA 3T5JA 2DNZA 2MKYA 4DCPB 1RJJA 4RWWA 1UVIA 1T05B 2Z30B 3H2VE 4X65J 3KWMA 3CPWR 2OLWA 2PE8A 2AMCB 5HN0A 1RAFB 1P9YA 4WKRA 4IR9A 2QG9B 4I68A 4U6PA 4DPOA 4J9LA 2W25A 4LFAF 5B0BA 5BJRA 3MMAA 2GCFA 2V2ZA 2RRAA 2N4DA 1G2EA 3R6LB 3R5AA 1CJTA 1QD1A 4YN3B 3W65A 3KKFA 1B7YB 1N0VC 1U8WA 3GR1A 1U26A 5CAAA 3S8SA 1LOUA 4A8QA 3R5JB 3H0PA 1OS5A 2PFFB 2HWIA 2K7JA 3CDWA 3KK2B 5KT2A 1GXLA 1LXNA 1TL1A 2CKWA 3TVKA 1S48A 2VH7A 2XY5A 4H4KA 5JVHQ 3ZZTA 4CWBA 5EWEA 3OHBA 2XO6A 3CCVS 1HW8A 5IT0A 2FY1A 2GX8A 1LFPA 4GKKJ 2HS4A 4JV5J 5CCMA 2HG4A 2I5JA 3AA9A 4MIBA 4ENOA 3PZPA 1KONA 3G86A 5K8PA 5M2PA 4H4OB 1GMVA 3D4JA 1RAHB 2JVOA 3TJAA 4RUBA 4BLGA 1NJWA 3KMSA 1KVJA 3GIMA 2I9SA 4WFAQ 3HXMA 3ILLA 4NLPA 4DQIA 5KG0A 3RGIA 3NMAA 3AODA 4OIXA 3R2DJ 2B4UA 9RUBA 3QLHA 1VLOA 4Q7AA 2DNYA 1RWOB 3DLEA 1HYSA 4JI0F 3AHPA 5KFIA 3IWNC 1XIQA 4DV4F 1DZ5A 3HZEA 3DKDA 1KC8T 1Y7PA 2WVCA 2RJZA 4CLLA 3GIKA 1NB2A 2A10A 4LF2A 3M6XA 3DGPA 1SC6A 3PW5A 4K4UA 3BSAA 4KB7A 4ZVRB 2ZJPQ 3P49B 3NGSA 1EQ0A 2AGQA 3PTWA 2VOPA 2B43A 2XCAA 4DX7A 1A9NB 3EXYA 4IRKA 2OD4A 1U8SA 2B9YA 1RWVB 4C8LA 2OFHX 2CZ4A 2FC9A 3BSCA 1TK8A 2KXFA 1TUWA 2VQEJ 4L74A 3M2VA 3OFHA 3BM7A 4L75A 1LWFB 4Q5VA 3K5LA 3BF4A 4ZHRB 2HQDA 2XC9A 2L9DA 2MZTA 5HLFB 2HZVA 4KY3A 4ECXA 1IQZA 2J9CA 1UW4A 5HMWA 3CT9A 1X4FA 4RBUA 2OKQA 3O5TB 3TRGA 4RW4A 4EYHB 4DG1B 2KM8C 1VOMA 3KJQB 5DO2A 5K8MA 2IC3B 2CWXA 5MAOA 4KIAA 1T9YA 1HR0J 1RAAB 2VG6B 2CNKB 2ZC4A 1AYEA 2G2ZA 2I2YA 5E3AA 4X62J 3MFIA 1F2GA 4DPTA 3UO0A 1PC5A 3M9MB 2DRBA 2ADBA 1UVNA 2QLXA 3Q83A 1OYEA 3MAAB 1M1KT 1SQGA 4ITSA 4DWIA 1V3ZA 3T5LA 1DURA 4NCBA 3EUNA 1I6JA 2P2CB 1SL2A 2XHCA 3VAHA 2HVIA 2OHDA 1NK7A 4RR5A 3KMQA 3GIJA 1RTJB 1R8PA 1W2BR 1JNZB 3PRDA 4JI2J 1HI1A 3K5MA 4CT9A 2AQ4A 1RDRA 2V9WA 4KV8A 4LR8A 1X0FA 1S49A 3LF0A 2CIMA 4WTOB 3LP2A 2DGXA 4P72A 1PBUA 1HLWA 3MWBA 1M0SA 1OMSA 2HKEA 5IV3A 4IDKA 3EJMA 2N82B 2G13A 1U6ZA 4PXBA 5CHCB 2MYFA 4B17A 3W8PA 2L9WA 3MTJA 3D54A 1YJ9S 1TL4A 3G8QA 2DIUA 1HA1A 3OQ2A 4B3SF 4A8WA 1CULB 3C66A 3CUNA 1S1UB 3DDNA 1Q5VA 5J2PB 3CCJS 2ERRA 3DHXA 1UA0A 2HIQA 2DH7A 2HAFA 2FDNA 2JZ5A 2FJAB 3W2WA 3OSPA 1TK5A 2OP5A 1ZA1B 3QYYA 1RWNB 1I5OB 4DSKA 2VFVA 4Z7CA 2DR5A 3N4WA 2ILZA 4NLGA 2SXLA 2CQIA 3K5NA 3QGIA 2OAUA 1YBAA 4OHXA 5KFXA 4UT4A 4DF8A 2MHEA 4I4BA 3MPYA 4NCAA 3TJ8A 3W7BA 2VB6A 4EWTA 4NLUA 1K9MT 2OPRB 3IG1A 2LA6A 1WUUA 2UP1A 4FS2A 3DOLB 3J80Y 3MXHP 1S9FA 1MWZA 3T19A 2HVZA 3A8JA 1DJ0A 3OFGA 2EI5A 2VC1A 2E1PA 3QAEA 1DLOA 4PZVA 4X4PA 3J81Y 3M8YA 3K59A 1DQ9A 4LSZB 3NRBA 4DV3F 1QSSA 3P5TL 2AEJA 5KG3A 4R5PA 4NCGB 1HQEB 1HNZJ 4ED5A 1LNQA 5DDQC 2XSJB 1RT1A 2V94A 2CQHA 5DQHA 3ZTOA 5CABA 4DR2F 1VCTA 4MKVA 4ZCIA 5KFJA 2OEKA 2H4WB 1VS3A 4CTAB 3VCDA 3UI3A 3ADAC 2D7SA 5KFTA 2EG1A 2XMUA 5HVGA 1N34F 1DBDA 2W4DA 3AQPA 1S72S 4DCOB 3GYXB 2CNOB 1X4AA 2LXFA 2GW8A 1KS2A 3R5CA 4YOEA 1KP6A 2CA9A 3FMWA 4PG4A 2EC2A 2WK4A 3LAMA 3D1OA 4ECWA 2M8HA 4V19X 2HHSA 2CG8A 2RHSB 3IGVA 1VYAA 1R0AB 3KK2A 3ISNC 1UEUA 3PO4A 1LEOA 1H74A 4JI2F 4U8YA 3HKZD 3WC0A 2QSFA 3THPA 3OSNA 1Q53A 5KFPA 2KN4A 3R7BB 3FBFA 1OQ3A 2CZ9A 1XMBA 3OJSA 2I38A 4ETXA 1CJUB 3KNAA 4ECRA 2E1RA 1RHUB 2AJFE 3GLJA 5B7WA 5BXIA 1F5BA 2VC0A 5L46A 1IKYB 2YKMB 3UR3C 2YVSA 2WVDA 3U02A 1ZAXA 2ZWPA 2IFXA 2VOOA 5J1EA 5HMXA 1HBMB 2LEPA 1WC3A 4U67Q 2A0FB 2GMLA 3M6WA 4DU8A 2ACMA 1VGYA 3P4UB 1D09B 3D0IE 2HNZB 3FVYA 2HBYB 2XMJA 2PMHA 4LF5F 3LO3A 5KFOA 3O8WA 1T95A 2KXNB 3RB4A 2PSZA 4DN0A 2VQFF 2QLFB 4C11B 4OJHA 1MG7A 2CUYA 5KT4A 4OYXA 2J76E 5L1LA 2CFXA 4KHPJ 5EX0A 2W2OP 3LOUA 2G9OA 4CDIA 2B8QA 5T7LB 1RCOB 2V8PA 8AT1B 5KFMA 2BYCA 1K8AT 1IBLF 2BE2B 1H3DA 4X4NA 1IR2A 2JEJA 4PRFA 3EE3A 3OL6A 3D5MA 2MY8A 2O3DA 3BB5A 3LAKA 5JJBA 2HNYB 2P9CA 3M8PB 1HBNB 1LWFA 2DH9A 2C2KB 3MM6B 4L3KA 4CLSA 4DLEA 2YKQA 5K14B 1WC4A 2N3OA 1HARA 2QRRA 1UTAA 1FD8A 1U1OA 3UCZP 5LSOA 2ZUAA 4ED1A 4N7TA 4E0DA 1YTYA 2J6SA 5I4MA 5KG6A 5KG4A 4A8YA 2POKA 5LSLA 3K5PA 5K8NA 2KH9A 5THWA 4X4QA 2E1MC 1SJ3P 2VG6A 6FD1A 3HHNB 1NJXA 3CB4A 1NHVA 3QRPA 1E6VB 4IFYB 4YB1P 2DNMA 4TNOA 2R7QA 4OJ3A 2CNNB 4UW2A 4TQSA 3MAAA 1YWXA 2GQCA 5L9NA 2R2UA 2XMWA 4DUZJ 2RE1A 2VHGA 4OX9J 1DTQB 1WI6A 3A12A 3OFEA 3ZNJ1 2ZH8A 4KPYA 4ZIVA 3KYLA 1YLXA 2VPYB 3RBXA 4FF2A 1JLBA 1HKAA 4BWJA 3MTKA 3DRPA 1HMVB 4ZP6A 1RHRB 3OLAA 2D9OA 3QRRA 4USJC 3V4MA 4CZCA 4K4TA 4ECTA 4K4YA 4KR0B 3D6FB 2XMAA 1Q8LA 2FVPA 1DFDA 3S1TA 4NWBA 3KK3B 3MM8B 3B54A 3OFFA 3GIIA 2XGQA 4OV6A 1TKZB 1B99A 2PN6A 2W1BA 1NK8A 1UJ6A 5HAOA 2JX2A 3UQSA 3G6VA 3D6TB 1T3NA 2E5IA 4B9UA 4MYTA 4R25A 3CJ2A 2EWHA 3JQJA 4ZLLA 2F4FA 2H5EA 3TAMB 3OD2A 3Q8UA 2DXFA 3R5DA 1CULA 3CJKB 4NMLA 2YNHB 1S0VA 1ELOA 4DQSA 1U47A 3U1NA 1R7IA 3VVTA 4DV0F 4C98A 1WC5A 3NCQA 4WFBQ 4L6V3 3D9BA 3OHAA 1T94A 3G4SS 2YWHA 3QWUA 4UZCA 3DN9A 2G0CA 4KYZA 2CG4A 1IBMJ 1YQHA 1ZBTA 1GMWA 4NYOA 5FIIA 4KGKA 2DEJA 4Y2IA 2UUBF 3FDSA 4DR7J 2LU2A 2G2YA 1W7WA 1WKJA 1TL7B 4USKA 1S10A 2JL9A 4Q8EA 4RLEA 1NKEA 2OPSA 1RTZA 3DM2B 5CXTA 4OX8A 2OTJS 3PX6A 3QGHA 1UL3A 1CS4B 2R7VA 2OPRA 5CYQA 4OZLA 3TA0A 4FYVB 4H4KC 1FWLA 3AAWB 4I2PA 5GMKa 5LMUJ 1VC5A 3DOLA 4DV6J 2MMYA 5DDPC 2K8GA 5CH7B 2KJWA 1NPPA 1N0UA 2B7BB 4ID5B 2H5IB 3TP2A 4TQRA 5IT9U 2CPFA 3CD5A 2AU0A 3Q89A 5IQ6A 2WSFC 2X3GA 4KH1B 3GJTB 2B5JB 4DCJB 5B0GA 1NKBA 1N5SA 1F1BB 4ZKAA 4P2FA 3CF5Q 4NCGA 1IJFB 1ICEB 4FPRA 3ZXWA 4P6QA 3SSRA 2XSJA 5I3UB 3T9ZA 1UJ5A 4JI3F 1VQMS 4LF7F 2FVQA 3RAQA 3G6ES 1X5PA 3I56S 1C0UA 2BJ7A 1VC6A 1RTDB 3I4HX 3L7OA 2FHJD 4DR3J 1SUQB 1U1PA 2E9ZA 1J5EJ 4FP9A 3MMBA 4CTAA 4LBPA 4U7UD 3IRXB 3C6TB 5KT5A 4LFCJ 3EWGA 4N5SA 3VZIA 1A0OB 1GT8A 3FEYB 3PW2A 3H25A 5SZTA 1LK5A 2J9EA 2E5GA 4RZRA 3RU0A 3LQVA 1SKWA 4C3LA 2G0IA 3MR6A 2F8EX 3BPDA 3I4PA 5D78A 1Q95G 2JEFA 2UUCJ 4LSNB 4P7TA 4C8ZA 3ITHB 1SL0A 4CH1A 3DOMB 3M6UA 2GIRA 1XR7A 2IAJA 1R0AA 2OPQB 1FXRA 1Y0HA 4C0BA 3HSZA 3I9V9 2DNKA 2CJBA 4QWCA 4V19J 2GNKA 2LKZA 3DYAB 2R8KA 4CYUB 2MQQA 2J5AA 3NWRA 1LK7A 3MHYA 1CJUA 5J1PA 3ETMA 4CO3A 1GMWD 4J37A 4X64F 2EK6A 4IYQA 2HWHA 1IKYA 2YKMA 2C2DA 1JLAB 3PM9A 5C24B 3VTIA 3GFYA 4MJKA 3BN7A 1HBMA 2R3VA 2AHOB 4RNNA 3I9ZA 5IQQA 1M90T 3HO1A 2AD9A 5G4DA 4Z2XA 2B8PA 2NS1B 2MKCA 4B3OB 3T5HA 4ZLNA 2QLWA 2I1RA 4X4UA 5DLGA 3D1HA 3G6YA 3MPUB 5GAEU 2IHR1 1HW9A 5KFYA 5GAGU 3NCRA 4IKAA 4J9KA 4ZPBA 4JI6F 2DISA 2I6WA 4IUFA 4YP3A 4D3HA 1XNRJ 2ZM6J 5D0EA 2LA4A 3CTRA 4WFYA 4F7VA 1K0TA 4OYMA 4DZDA 1J2VA 2QL9B 2L9NA 5T7LA 4PABA 3FKBA 2KVQE 5K5MA 4LF8J 4IG0B 1VIXA 2GA7A 4Q2LA 1N6QB 2BE2A 1RQ0A 1RT6B 4E98A 2R2TA 4NLQA 2XMKA 1EAYC 3UVJB 1XR6A 2BEFA 2P8IA 4DS4A 2XSFA 4DV6F 4PWUA 1N54B 3FBEA 2XM3A 2PA8D 1G6BA 3N79A 3FNNA 4NA1A 1BUXA 4BWMA 3MM6A 1IR0A 2HRTA 3GPAA 1WACA 5K14A 2H54B 4EI2A 1PKUA 1BHNA 4OYWA 1SCJB 2CPXA 5IWAF 3JQMA 1S57A 1Q86T 4AQYJ 3H5YA 1ACMB 1G3OA 1BC6A 2E7WA 4LRFA 2BOPA 4YB5A 2JLGA 1ULRA 3UD5A 2GIFA 1X5SA 2J9DA 4TY9A 3GFXA 4IH6A 4F4ZA 1KR4A 1FDNA 2GS8A 1ZTTA 5GAEI 4WTYA 5GAGI 4MTPA 5HQLA 2QZ8A 1F9EB 1O0PA 2J0XA 5CQGA 2V4QA 1KRPA 4G1QB 2OFGX 1QAIA 4DV2J 2IJFA 4K0KJ 2CWKA 2CPJA 2UXBF 4EEYA 4IFVB 3DLLQ 4HTIA 1E6VA 3G9CA 1YZ6A 4IFYA 4UQTA 4M5DB 3AD8C 1VK3A 2MJUA 2ZOFA 3C15B 3EGWB 5A76A 4DDFA 4EUVA 2UVWA 1N36F 4DV7F 1WHYA 1U1LA 1DTQA 4WE1B 4ZPVR 2XI2A 2V68A 4DR1J 3OXFA 5G0RB 4AE5A 2V9KA 1D9AA 3SBMA 2F65A 4E2FB 1Q7LB 1WJ9A 5CA5A 2XTJP 1HMVA 5GMEA 2VF3A 2R7WA 3MEEA 2QMXA 3K5OA 3JAMU 1YKWA 4RUCA 3HD1A 2DXDA 1SXLA 1FK9B 4ZCKA 3KLHB 3GE9A 2J7UA 4NASA 4L73A 3MM8A 3KK3A 1SJ1A 4P2SA 1TKZA 3DDIA 4YQWA 4DF4A 3IAS9 2DR9A 1KNZA 3SYZA 2PD1A 3OL8A 2XY6A 4EBDA 1FTCA 1NO8A 1VQSA 3K58A 1QDUB 1WNEA 1NAQA 4QYZK 3SDEB 5DQIA 2R7SA 1GNKA 2HNDB 2ZOMA 3TAMA 3VAGA 1YJRA 3ZZPA 5ETOA 2YNHA 4ES3A 3G6XA 3NGDA 3HFKA 3NS5A 4CIOA 1Q4RA 1OYDA 4IRCA 3WIUA 1BXNA 2CZVC 1RLCL 2HQIA 5A8KB 3FJ2A 4G3IA 2R8HA 2UV8G 3UNYA 2CXEA 1HNWJ 3QBCA 3OLBA 3HVTB 4LVNP 2QA4G 4RW6B 1PC4A 2RDDA 2HS3A 2YNFB 4KFBB 4C0OC 2ZFHA 3QT7A 3P96A 2C42A 1IR1A 4NLWA 1LFWA 3GU0A 4B02A 2JFDA 2LQBA 1TL7A 4JI7J 3QQCD 2P9EA 1JLEB 1UFLA 4IG3A 4S0MA 3IR5B 2C1EB 1SC1B 1SIWB 2FZGB 3MR7A 3DM2A 4OI1A 4K4WA 4IQMA 4ZLJA 4QIWD 5CD4A 1CS4A 5E3RA 4CO1A 3SSQA 3HK2A 2KRBA 3TUIC 3PO5A 1PYTA 4DL7A 1YJTA 1H0HB 4JBCA 5KFDA 3A3NB 3PNIA 1HNXF 3TNVA 2GMHA 4FBTA 1HHQA 3BN4A 1S0NA 1OQ6A 4ID5A 2A1BA 4XDCA 1JLQB 4LBIA 4ECUA 4QWBA 5KTQA 1VJQA 4QIVA 2BV3A 2H51B 4QIGA 2B5JA 4OZJA 3GSIA 3OW2R 4PWDB 4HACB 2DNPA 3QATA 3QO9B 3VGVA 3ZFVA 1IKWB 3TZZA 4DPUA 3R97A 3AOAA 4F26A 1Q8IA 1KDNA 3B4MA 1UKUA 3DXBA 3ZZZA 5A2QU 4K4SA 4DPYA 1J27A 1RTDA 5GAHU 4TYAA 3E01B 3Q8VA 3AD9C 2MKKA 4RW9B 1SUQA 3QT8A 4OZ0A 3M8SA 3IM8A 1VJWA 2FZKB 4CP5A 3KLFA 3GONA 5IT9Y 3IRXA 3C6TA 2HHHJ 4ILMA 3RAXA 4DV2F 4U9RA 1FRHA 1NJZA 1ZM2A 4RW8A 1NU4A 1JJHA 2RILA 3M7VA 4C8MA 3ZC4A 4IOCQ 1RLDA 1FRMA 2WB1D 3MR2A 1FEHA 4EU0A 3PYEA 1U09A 4ELUA 4DX6A 3SFUA 4HDHA 2DEIA 1RT2B 4NXNF 3MPWA 3V81A 1PJ5A 1P6TA 4NLYA 3LGNA 3NNCA 2IM0A 4IOAQ 2DHHA 4LF4F 4LQ9A 1RBOB 3DOMA 5LT5A 5C7PA 2AJ0A 1E6YB 1HWUA 2OPQA 4IQXA 4LMZA 4LSLA 4RNHA 2KJVA 1I94J 2ZDOA 4Y2KA 2ZZMA 5ETMA 2R8JA 3IA0A 5F3TA 4QPTA 1FA0A 3A13A 1FDAA 1JNRB 3K57A 2GVDB 4QQBA 4CYUA 3MMJA 4A48A 1ZA2B 2AEFA 5KFNA 2RRBA 2JNJA 1D1UA 1VQPS 1PYSB 1JLFB 4XIUA 3T6JA 3M05A 1YRXA 1QM9A 3V6HA 4F50A 4OHZA 1PJ7A 3PIPQ 5EN1A 2KZMA 2MZSA 1S4EA 3OBIA 3T1AA 5ADZA 1QVGR 2FGOA 3TWZA 2Z56B 3HMJG 1XWLA 2XS7A 1VK8A 5E3QA 2QLJB 3PDNA 1OO0B 4B3OA 1TMMA 3IS9B 2PA3A 1TFWA 4TU7A 3CCWA 3QT5A 1MN7A 3KLEB 1K1QA 2VG7A 1Y4ZB 1KOHA 2HHQA 1TAUA 1UVJA 2IJRA 1VRTA 4K2JA 1U2FA 2XYGB 1MWYA 2JC0A 4QR0A 1S6OA 2OIHA 1SKUB 2FJVA 3MD1A 3KLIB 2W4CA 4NLTA 2DNHA 4PXDA 2HFSA 1FJGF 3GCXP 1N6QA 1RT6A 3PHEA 4M5MA 1WSVA 1NMEB 4LRDA 2UZAA 2J6TA 3UVJA 5KOWA 1T03B 4OHWA 3PEJA 1B0PA 2FHOB 3R6GB 3SMZA 4KO0B 4UY85 2DRDA 4OHVA 1VISA 1R89A 3MOJB 4G1IA 1Q8BA 3Q8YA 1S1XB 4PPDA 1UP1A 1LWEB 3VVUA 1SPBP 1NH8A 3DGVA 1YJUA 2ZH7A 4QWDA 1TVRB 2EBGA 1TAQA 1WG1A 2QFJA 1PBAA 3M1VB 4KGVB 4LBHA 2JHEA 1M5VC 2RKIB 3J7AN 3KLGA 4G1PA 5CD4H 4I2QB 1KBRA 3FEXB 2YY3A 1DQAA 1WDDA 1U0SA 1RKIA 5AXKA 4G1QA 4F04B 4MK8A 2CPIA 2ZITA 4EO8A 4IFVA 2KVIA 1RT7B 2GMJA 5IV4A 4M5DA 3W63A 4M8LA 3EPGA 1ZH5A 1T7PA 3C15A 2YQ1A 2NXJA 4PYDA 2J8SA 1YI2S 2R2RA 5IM0B 5G0RA 1WOPA 4K5RA 2HBRB 1NDKA 4ZITA 2G1DA 2LYVA 4JYAF 1TK0A 4WFXA 4UUXA 3EDRB 4ZN3A 2BW7A 2N7CA 4KGZB 1MLAA 3QAUA 3ZZUA 3KLHA 4DSEA 2F8MA 3I87A 2QL5B 4ZA1A 1S9EB 3NY0A 1X4HA 5C2GA 3ZNUA 2F4VJ 4ZN1A 4JI1J 2R7OA 3HHDA 3F41A 1Y3KA 2FD2A 5LJ5Y 1IVZA 5HQ8A 2NR0A 1YK9A 3SDEA 1IBKF 1J5OA 2BKOA 2B4OA 4ES1A 3VQSA 3TX8A 3ZZRA 4OQJA 4OZ3A 2BZ2A 2EEYA 4R0EA 3NGKA 3UW1A 1WDTA 2F9DA 5A8KA 4AL7A 4M5LA 1Y5NB 3HVTA 1A6LA 2V5HG 4RW6A 4AXJA 1CLFA 2YNFA 1Q8KA 1T9UA 4KFBA 2YTCA 2GV1A 4O44B 4TY8B 3VF0B 3G82B 4UOCA 1QY7A 3DRRB 2CVEA 4RPFA 2O5DA 2MEWA 5DQGA 4C8KA 1VRQC 2UUTA 1SQEA 2UUAJ 5C5JA 3QZ8A 2Q1LA 4NI2B 3SFGA 2KTQA 1AFIA 4I56A 2DNQA 2QEXS 3UR0A 2UXCF 2C2EA 3W66A 4C2MA 1Q81T 1RUSA 3CDBA 3RR8A 2VFTA 4Q2MA 1KLNA 3UN2A 5MLCV 3RBDA 3C16A 3SIPB 3IBWA 3K17A 4B9TA 5KFRA 2A6OA 4O3PA 5LOQA 1CJKB 1VBKA 1JLQA 4NYPA 4DOZA 2Z4PA 1WG5A 1Q78A 4QWAA 2KO1A 3C46A 4WIIA 4PWDA 1KLMB 1C0TB 2CQ3A 2YNIB 3T6BA 1M1HA 3A8IA 3A4TA 4NLVA 3PRBA 3VAMA 3QO9A 1IKWA 1KN6A 2AEMA 4QZVB 4CLZA 2MXYA 2L3MA 4YY3F 4RJVA 1O8BA 3SCKE 1RCXB 3PW0A 1LW2B 4HYKA 4GVBB 4PAAA 1S9GB 3R5GA 1EP4B 3B4DA 1UCNA 4QOTA 3M8RA 2EXUA 2RSQA 2RVJA 4RW9A 4NPOA 3FSIA 1YRUA 1B0TA 3UE2A 4Y28C 2JLFA 2Z8QA 3ENWA 1CEZA 2KT3A 1UVMA 7FD1A 2GO8A 4N8OA 4TU9A 1SC3B 4DN9A 1FXLA 4DL2A 3V4IB 2BQ3A 2XS2A 4LRAA 1NK9A 2VD3A 3CD6S 3RYLA 1ZM4A 1TKDA 3NLCA 2BACA 5C2CA 3THVA 5AE2A 2XNRA 3NP5A 4C4WA 2KU7A 2IYGA 1X5OA 1T0TV 2J0WA 1G7CB 5A6PA 4C48A 4ZVEA 2W24A 1E6YA 2VG5B 2ZVSA 4JI4J 4DV1F 5BR8J 2HHVA 2NCKL 1VDHA 5EDWA 2NREA 1S99A 3TQ1A 1UZDA 2Z0GA 3S6EA 4ZCMA 1NRKA 4F0KA 2FYXA 2B3TB 2GVDA 1FJ7A 3P8BB 1RHMB 2KDOA 4F25A 4FDFA 1F6TA 3MMCA 1QJHA 5JUMA 3MCSA 2V0NA 2YX4A 2Q3PA 3PX4A 1JLFA 3DMJB 3K89A 2B9EA 4ALZA 4F02A 2JVRA 5FDLB 1WKKA 3HSJA 2N4CA 4LFAJ 4CLFA 1RT3B 2ZBRA 2JDJA 3ILIA 2VBXA 4CH7A 1UWBA 1EB0A 3NOGA 2VBWA 1XN9A 4RW7B 3MR5A 1S0MA 5J2NB 3TZXA 2MSSA 2AJ2A 2MGZB 2O01C 1LXJA 4PUOA 2OUGA 3IS9A 2ZH2A 1WEXA 3KLEA 4HT5A 3RBZA 2PI4A 4DX5A 4F4XA 4C3MA 2J0QD 3FCVA 1WF0A 1U1RA 3WZ0A 2RQCA 1WHXA 4KSEB 2M70A 2HHWA 3CCSS 3EGVA 4RBTA 4DR5F 3SV3A 1FFGB 1HPZB 3BYRA 3KG4A 4CLUA 1UPPA 4GKJJ 3FQLA 2CQDA 3OXGA 5HMZA 2ZUGA 4ZMMA 3PJXA 4WZQA 1Y10A 4LQ3A 1SH0A 1TL5A 3MPVA 1T03A 3JSMB 2W9CB 2PMWA 2DB1A 3CJ8A 4KO0A 4MT1A 1DY3A 1DARA 1D9DA 5L39A 2E9RX 2DK2A 1S1XA 3Q8QB 1VQ9S 1NCLA 2RUSA 3M8QA 1SJQA 1FX2A 1LWEA 2ZH9A 4LFBF 1HFEL 2CDQA 2CJ9A 4I6AA 4BCAA 3GZ7A 2ZBIA 2IM3A 4QU6A 4F4AA 2V6AA 5EX3A 1TVRA 3MF5A 4R8UB 1C4AA 3R9LA 4JI0J 3M1VA 2J9DE 3FMBA 2RKIA 3KHRA 4I64A 2JLEA 1FD2A 5H9EJ 3N5BA 2QA1A 2C3PA 3M6VA 5DS7A 4OLPA 4MIAA 1NK4A 3BDEA 4HLBA 1DAXA 3KDOA 1LKZA 1K0VA 2IA6A 3C14A 2UU9F 5BYSA 1RT7A 2RAQA 5JMNA 2QJ3A 3HF5A 1EKRA 2DHAA 2HAIA 4DL6A 1FTRA 4GVLA 1TKXB 1OPZA 4AUKA 3PHTA 4M1KA 3WDOA 2XLKA 5IM0A 2PEHA 4JOUA 1GX5A 2AZ3A 5L8RC 3MEDA 2KYZA 2XMTA 2MLXA 3B6BA 1SB6A 1TU0B 3M8ZA 2DHGA 2VPWB 4F8RA 5J2MB 2OEMA 4JI8F 3N6LA 2HBZB 3CCRS 1S9EA 2LU1A 1WF2A 3J7YU 1JXLA 2RRNA 3KXDA 4LT6A 2H9ZA 1Y5IB 3IC1A 3TA2A 2VJVA 3OT9A 2BBEA 1OJ4A 3EVMA 4MFBB 1Y00A 2DHXA 3M32B 4AL5A 3QJLA 2Y9HA 2A2CA 2HLTA 1HNVA 1U1KA 1EETB 1UFKA 4DFJA 3VAKA 3NGUA 4NOHA 1S1VB 2RIJA 2EK1A 3KHLA 1FNMA 3IP0A 4ZIWA 3BPSP 3EMTA 3FGVA 2KRRA 4Y65A 4O44A 3EGNA 3G82A 1AT1B 2GGPB 3POTB 4O3QA 3DRRA 3GJRB 5RUBA 1R8HA 3OVSA 2OI2A 1H7XA 1XR5A 2L08A 4NI2A 5CYJA 3M2UA 2ZHBA 2VDHA 1Q79A 3MECB 2DITA 1R43A 2DCLA 5DM7Q 2E66A 2ZJRQ 3J7Z5 1RU1A 3LANA 4GKJF 3J7YI 4J9PA 4DL5A 3OTCA 3QGGA 2R8GA 1S76D 5F3ZA 1CJKA 3V6DB 4B3SJ 1OY8A 2QC3A 4PXEA 5AXNA 3ILJA 4K4ZA 4WZMA 1KLMA 2YNIA 1TP7A 3O1LA 4C0HA 3TUPA 3GJSB 4RKUC 2XY7A 3PYGA 5T41A 4LJMA 5AE3A 1LW2A 2QIFA 3LP0A 1F0XA 2LEBA 7AT1B 4GC6A 4GVBA 1NPKA 1VQ5S 1HWJA 1S9GA 3X1LB 5F9LA 2CPHA 2C28A 3OTOF 4HDGA 4CLYA 3H59A 4MYUA 3PKMA 4M5NA 1ZS6A 2DBBA 1FRXA 4A8FA 3PFOA 3GV7B 3CE8A 2HQCA 1EHWA 2EG2A 4O4GB 3OTDA 1SJ4P 4IO9Q 3TX0A 2BE9B 4UF4A 1ZPWX 5ETKA 3ZTSA 5H9EK 1KEKA 1X5TA 1BWVA 3H4BA 2FZCB 4QW8A 4WIQA 2XZDB 1N32F 4IOBA 1U1QA 4L3NA 1N56A 3F44A 4GRSA 3AFGA 2VFUA 2ZNYA 3J7A1 3KK1B 1F2HA 2V69A 4I69A 5IXUA 4B3MF 4B3RF 4DX8H 1ROFA 2IBKA 2HFOA 4DV3J 2RT3A 1P27B 2IDEA 2V2VA 4KH0B 2VG5A 4KKOB 5D0HA 2ZVIA 2DGTA 2C2OB 2BKPA 2DT9A 2DNGA 2GQQA 4J9UE 4USIA 1X4GA 1CC7A 2X3DA 4B9LA 5B0DA 1U24A 4DR2J 1S79A 2MQNA 4BS2A 2KHCA 1TUGB 2D74B 4XPCA 2QMUB 3EM1A 2Q66A 3GV8B 3FQKA 3DMJA 2RF2A 4B3TF 4NXMF 1L3SA 3BQ1A 5L1KA 5FDLA 1U0HB 1VLYA 5KFEA 1N34J 1RT3A 1NHKL 3AT1B 1VQNS 3CJ4A 2XS5A 3DRSA 5K20B 4GMKA 4Q0BB 2O1PA 4OZNA 4RW7A 2XLJA 1WORA 1JIHA 5CZXA 5J2NA 1PCAA 4L76A 2YKNB 4G65A 3PFEA 2PEBA 4KTQA 4A8KA 4M5IA 5ETSA 4KBIA 2DXEA 4F3QA 3LA0A 2XI3A 2W2PP 1S6PA 1NBEB 1RWKB 1V6HA 1JJCB 2L48A 2BJEA 1AB8A 2GZOA 3OVAA 4HH1A 3TQEA 3CCLS 4WP9A 4YMEA 3TJ9A 1F9FA 3TARA 2DRAA 2Y8WA 2CVIA 3EZ5A 2K1RB 2QA4S 1C2PA 1KKHA 5BYRA 1HPZA 3LP1B 1T11A 4I67A 2WCXA 1JKHB 3NWGA 5GADU 3PIOQ 2JC1A 2P9GA 5HSPA 4CLWA 2W2NP 1M5HA 5F8IA 4OMFG 5GMDA 2DNLA 3I32A 2KHDA 3W62A 3WHIA 2F40A 3BGRA 4URQU 5CYMB 2YKAA 3QIPB 2W7PA 5LMNF 4MKAA 2AGOA 1TFYA 1TTHB 4DLGA 2LCWA 2V8HA 3CD0A 3PVXA 3IGNA 3OL9A 2ZWOA 4DQRA 1EJ7L 5F8GA 2LECA 4LF5J 4R8UA 2R7UA 2P6SA 3D3CJ 3ELHA 3CMES 3D7SB 1B70B 2KKHA 2VQFJ 2YH1A 1BY9A 4ILRA 4F4YA 2E44A 3LWLA 4A4JA 4ED7A 2AP6A 3JB9k 1REGX 2B4PA 1HL6A 2ZHOA 2VUGA 3MEGB 1NSPA 4RNFA 3MAHA 3PR4A 2ATLA 4KHRA 2MHNA 1VQ4S 4WWSA 4X4OA 3FBCA 5F41A 1IBLJ 1IXKA 2V63A 1MW7A 1MMDA 1TL3B 2W7OA 2CADA 3NEKA 4HH0A 2VJUA 3ZTPA 1KFSA 4HR2A 1TKXA 5IC6B 2CPEA 1TKTB 4DL0C 4EBEA 2Y1JA 4LIWA 1TZ0A 5GADI 1PAEX 3AJ2A 1NK0A 3SSSA 1R3NA 1AFJA 1S1TB 5ETQA 4PQAA 2RHQB 3CO9A 3N28A 3H40A 2C2NA 3G87A 2D3OR 4ZDNA 4IRDA 5B0EA 3T1YJ 1ZM9A 4K4XA 5J2MA 1VQLS 2BW2A 3U27A 3ZTQA 4F0HA 2DCUB 4WU2A 4K4VA 4CI0B 3ZTRA 1VMBA 4HTJA 2HHXA 4FYWB 1TL1B 4OLOA 4ZVPB 1T05A 3U7JA 1NSQA 1F5CA 3BBBA 4A8OA 1NSAA 4DS5A 1FRLA 1HNIB 4ZP7A 3CJQA 8ATCB 4MFBA 3W9HA 3M32A 3R1HA 2MZQA 1FCAA 4MKBA 1QTMA 4DV5F 4YR3A 2JOQA 1VHFA 5LXRA 2XNQA 3NS7B 2XWYA 1UA1A 3C19A 1EETA 1XJWB 2LFVA 4OI0A 3JYTB 1R31A 1S1VA 3I0RB 3I55S 1N48A 2VKRA 4DR4F 3H7HB 4OYIA 2HVDA 2G2OA 4UZBA 2KXHA 1JK9B 4FVCA 3S7RA 1W26A 2IIHA 3N6NA 2GGPA 3POTA 1OY6A 2QGFB 3MUMP 5D4OA 2G0JA 1RWXB 1MMNA 3FSXA 3CDUA 4FF3A 2GHPA 3D0HE 3DLEB 1HYSB 3H5UA 3CULA 3MECA 2H4YB 4C97A 3TA1A 1RA7A 4NRTA 2W01A 4RL1A 4DQQA 1RADB 1JLCB 2AIRB 1MNEA 4LF6F 2M8DB 3A3PB 4TU8A 4FYYB 4WKYA 3HPOA 5DM6Q 2LQJA 5H1SV 2QYGA 3V6DA 4H4OA 2XZTB 2R7TA 4DR6F 5B0CA 4DV0J 2FB0A 2MQMA 1VIOA 1RWWB 4PQUB 4U95A 1UAWA 4Y2CA 4BHQA 5BYQA 1K44A 5IS2A 3QWPA 2AX0A 1HD1A 3G71S 3IXQA 2UUBJ 4OI2A 4O3RA 4XDDA 1K73T 2ZJQQ 2ZDPA 1YBTA 3BEGB 1KQGB 1NHUA 2CPYA 3BH6B 4RW4B 2E1CA 3BO3A 3KTQA 2EFPA 4JI5F 2VV5A 4O4GA 3SEOA 1T9TA 4P7VA 1N8RT 3H42A 1NEEA 4FF4A 5AXLA 1SV5B 3TOQA 2A3JA 2JRSA 1L3UA 4P2XA 3N01A 5B0FA 1RAJA 1Z4UA 5KFHA 2IVMA 4Y2MA 2FHMA 4EMDA 2FJXA 5KT7A 4NLDA 1SH3A 2GHWA 2AYEA 1YVFA 1GQEA 1R6YA 2EFVA 2YQ0A 4LRBA 1SC4B 4ZPTR 5SUHA 5I3PA 2RH3A 1RABB 3QGPA 4DSJA 4ZHRA 2GO9A 4KKOA 4Q8FA 5HLFA 4WBFA 2FVSA 3VGTA 2E9TA 1CQMA 4JI3J 4JV1A 4WYWA 4WXOA 4J90A 3CO0P 3T1YF 1YIJS 4LF7J 4LF9F 1AXQA 2K06A 4DUYF 3V6JA 4DG1A 1VBYA 1URNA 2IC3A 4NYZA 2CRLA 4NMXA 2WAQD 2HVHA 3WBZA 2R42A 1U0HA 5M2UA 1BLUA 1UPMB 4IDKB 3IBCB 2YQ3A 3I5BA 3MPDA 4ED8A 2K3KA 3GJQB 2WOMB 3F56A 1RWPB 2OSQA 2CDRB 4HHUA 2FGCA 1L3KA 3ONQA 5D0GA 1XK8A 1S7HA 3MM5B 4ZJLA 2YKNA 2Y1RI 4QJVA 4K50A 1YG0A 1ZOTA 3M8WA 4LRCA 4FXVA 2C2RA 3EVWA 2D9PA 4M5JA 1L3TA 2FHJA 2FUG9 2WBMA 3O44A 4PR6A 2BJ8A 3W2WB 1RTJA 4I6YA 4KT0C 2E1AA 1IWAA 2HGMA 2HFVA 3ZZ0A 2E5LF 2QSWA 4C8YA 2VPXB 3I31A 2K1RA 4MK9A 4ED0A 2GQ2A 3F73A 5ETVA 3OUYB 4J9QA 1SL1A 3K8WA 4DSFA 3CD7A 3RUBL 3SCIE 3LP1A 4EZ6A 2XQCA 1LWCB 4M95A 1JKHA 1S6UA 4KGMA 3ICLA 2QV6A 4M5HA 4MK7A 5EWFA 5KFGA 3DLHA 2F8HA 3PRVA 1QE1B 3TEHB 4V1Ak 5HK4A 1OY9A 3K2YA 2KFYA 2MKHA 1JMTA 4X64J 4IO1A 2M0GB 4Z37A 2Y0BB 3NBPB 4NLRA 2JFKA 2FC8A 1S1UA 3BR8A 4HT7A 5J2PA 4USWA 1R8CA 3W60A 1PO6A 1YJVA 2R7XA 3OXLA 2DVIA 2C2MB 1X9MA 2V8DA 1DLOB 3GTYX 1UEKA 3T1HF 1O6XA 1QSLA 1FXDA 2R8IA 3Q22A 1VQOS 4BBYA 2D3O1 1VBXA 4JI6J 1QVFR 3DU5A 5EWGA 5L1IA 3IR7B 1XQIA 2H3EB 5C42B 3QFHA 1W25A 2M2BA 3MEGA 4RO0A 2NZCA 4FKYA 3BQ2A 4X4VA 2Q6BA 4ZPCA 5DETA 1APSA 1Y5LB 2XGPA 2ASDA 1TL3A 3N9UC 1REVB 4AFFA 2ZEJA 4KRWA 4EFAC 1TKTA 2MKIA 3R1LA 1FFSB 1S77D 4MKYA 4YDXA 1XMOF 2UVRA 1S1TA 4FXDA 1RAIB 4USHA 3PJWA 1YZ7A 1IUJA 2EFOA 3OV7A 5IWAJ 4RU2A 1AUDA 3PXGa 3PR5B 1WD6A 2XZWA 2X1FA 2CQBA 3IWLA 1HQEA 3DOKB 1FJEB 1ZM3A 1X4EA 1T8EA 5KT3A 3UDLA 3UD4P 3RJMB 3WC2A 4CM0A 2M5YA 4CQ1A 2PMZD 3RZAA 4CO5A 2CJKA 3A8KA 3HI9A 4UQGA 3V6KA 3TVYA 2FIUA 3U1LA 3LTOA 1HNIA 4WPAA 5HBMB 2FLLA 2UXBJ 4HL9A 2YKPA 2A2DA 2YBVA 3AJ1A 1OPIA 2APOA 4NX9A 2KG0A 4DUTA 4O3NA 3CJ5A 3JQKA 1Z1ZA 3SV4A 4BDPA 3JYTA 1N36J 4DFKA 4DV7J 3I0RA 1Q7YT 4HHJA 2XYPB 2FVCA 4YR2A 2W8LA 3ILOA 5J1EB 1RHQB 1FHTA 4ZPAA 4DI6A 2YWWA 2HGLA 2MKJA 3HHEA 1GMUA 2H1YA 3KNGA 3RAMA 3HM9A 2V8GA 3EICA 1KVKA 5E5NA 4IH5A 5ETRA 4ECQA 5LM7E 2J7KA 3SQGB 4B9SA 2VFSA 3E8OA 3HDSA 1HI0P 1JLCA 1YJNS 3MOZA 1G4CA 3CJ0A 1R0CB 4A8MP 3BGFA 2BQUA 2G1HA 4Z7YA 2KZZA 3RRHA 1Z2LA 2V4JB 2LVWA 3AOCA 3ZZOA 2V50A 2C3YA 2N7YA 1I51B 4PQUA 4YB7A 4QR2A 3OPKA 2X1GA 2GVZB 1N5YB 2QA2A 2PGCA 1Q0NA 3I82A 4YUDA 1UETA 1KFDA 1SVDA 4ZPDA 1XERA 2EKYA 2HNZA 2NSCA 1SKSA 1QLNA 2RD5C 3GWCA 2IVFB 1MU2B 2D3UA 4GC7A 2AV5A 1WG4A 4LF1A 4Y2AA 2VODA 4C11A 1IN0A 1Q16B 4O0NA 5KFWA 4PG5A 2HYIB 3KHGA 1HHTP 5DDRC 1KHWA 1Y3JA 3W3SA 1SV5A 2FQQB 4ANDA 5E2QA 1HNXJ 1DHMA 3BKTA 4X65F 2HRYA 5FJ4A 1RAOA 4RUHA 1HD0A 4JUZA 3CCES 2HNYA 3FCHA 3PACA 2OPPB 3M8PA 1GK8A 3ENVA 1TQLA 1HBNA 5HVFA 3GG0A 3NKYA 4ZCLA 3CSKA 1MMLA 3TAQA 3QSIA 3UN5A 1EZZB 2ROEA 1N52B 4ZLPA 3DRYA 3W2VB 4CO0A 1NH7A 4OFZA 1JXVA 1JLBB 4TVAB 2EBEA 3DRPB 2EKNA 3IAM9 1EQMA 3P3DA 4P10A 3KG0A 1QUVA 4I7FB 5L1JA 1WHWA 2IRXA 4JP8A 2NUUG 1H7WA 5IFMA 4FBUA 5JVGQ 5DGAA 2RU9A 4DXLA 3L9ZA 2VZ9A 4LR7A 5E41A 2AW0A 2D41A 4HKQA 1FVSA 1AZSB 1RAEB 2WOMA 2Z2MA 1FI4A 5J1NA 2BJ1A 2VBZA 3G96A 3CVKA 4GKKF 2FY8A 4JV5F 2M88A 1FRKA 3MM5A 1WEYA 3FSYA 2X1BA 4ECVA 4NXNJ 4OZ1A 1MROB 3GYGA 2IM1A 2EW9A 2OGUA 3TZYA 4LF4J 2H5JB 1U2RA 5T14A 3BSOA 3NXZA 4I1TA 2Z58B 2LDIA 3KOAA 2E5HA 3MGJA 3PKYA 2ZBPA 3FEZA 4X4RA 3OUYA 4C8OA 3M30B 5U47A 1LWCA 4TLQA 2MQLA 2OELA 4EK2A 3CDEA 1L5UA 5E0OA 1X0PA 2OPSB 3FK4A 1W2IA 2CJQA 1YBUA 1QE1A 1SBRA 2YPZA 1FKAF 1S7IA 2ROGA 3MDFA 3GQCA 1MSWD 3W9IA 3NBPA 3UN3A 2ADCA 1H38A 3DLKB 4LUBA 2WSEC 4X2BA 5CYQB 2Y3YA 4FS1A 3N0VA 3PEHA 4I2PB 4ES2A 4C6AA 2P5VA 3CJKA 4ZVOB 1RYRA 3PCOB 3D66A 1VI7A 3RRGA 4BC7A 4CO4A 2CQ1A 2F1FA 1RBAA 2M4MA 5KT6A 3US5A 4EGLA 1RTHB 1OIAA 2VQEF 1RA6A 4UUWA 4J9MA 1T9WA 1R8AA 4O0IA 2WVFA 3P45B 4HI1A 1X4BA 1WWHA 5DGBA 2UV8A 4FNIA 4ECZA 5HJYA 5HATA 4JV0A 3R7SB 2RU3A 3E3XA 2ZKUA 5C42A 2I0XA 4URSA 2DYAA 3VHQA 1FERA 4KHMA 3GP9A 2GFFA 4DZ6A 1C0UB 1FESA 1FJGJ 2LQ5A 2NXCA 2YNGB 3QSYB 4AL6A 2CNLB 3EXCX 1BQXA 1REVA 3LPYA 2LDYA 1Y11A 3MMBB 4F0MA 2PFDA 2YWEA 3QRQA 4CNYA 2AZ1A 2IM2A 2FHKA 1K1SA 4AT1B 2RDIA 1HR0F 1VQ7S 3DLGB 4X62F 2VPZB 2IPOB 3UDCA 1P8GA 3HT0A 2XB2D 2BR0A 2OD6A 2B56A 5KG1A 1VQ8S 4ZVHA 2PDAA 2ZKTA 5HVHA 5B08A 1IBCB 1U7LA 4XTTA 4USMA 1RISA 4USTA 1JJ4A 3OTBA 1U1MA 3DOKA 5E33A 1RACB 1R0BG 2O67A 2IVYA 1HHSA 5I3UA 4H4MB 2HHUA 4QR1A 3TW0A 2IAJB 2GJFA 4H54A 5ETTA 5KOXA 5EUHA 1TMJA 1RGVA 2Z2YB 1VQ6S 3W8GA 4ZVSB 2K7KA 2ZZTA 1TELA 5HBMA 1X4CA 5DDOC 3I0SB 1URRA 3CW2C 4OX7A 2BJDA 2BXJA 1XTZA 4CNZA 2B7CB 2FPHX 2IDLA 2VKZG 3GV5B 3BGOP 4DMZA 1RWMB 2HURA 3D6HB 2XCPA 3H5XA 3T41A 4QWEA 2FLNA 2CQCA 5HMYA 2OJ3A
chains in the Genus database with same CATH topology
2XM3A 2VJUA 2A6OA 2VHGA 2VICA 2F4FA 4ER8A 2XMAA 2F5GA 2VIHA 2FYXA 2EC2A 2A6MA 2VJVA 2XO6A 2XQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM3 A;  2VJU A;  2A6O A;  2VHG A;  2VIC A;  2F4F A;  4ER8 A;  2XMA A;  2F5G A;  2VIH A;  2FYX A;  2EC2 A;  2A6M A;  2VJV A;  2XO6 A;  2XQC A; 
#chains in the Genus database with same CATH topology
 2WRM A;  1LW0 B;  3RB0 A;  4JYA J;  1P1L A;  1X9W A;  2Y1L B;  4LSN A;  4ANC A;  3ITH A;  2DPJ A;  1JLG B;  1VRU B;  2HWT A;  1F3F A;  1TV6 B;  2DGO A;  1GXU A;  1HWI A;  4ER8 A;  3BBF A;  1QAY A;  1VC0 A;  4QBU A;  3DLJ A;  2ROP A;  2FJB B;  2MDA A;  2CQ4 A;  3Q23 A;  3SQG A;  2VL1 A;  3ISZ A;  5HRO B;  3DYA A;  2ZH5 A;  1FX4 A;  2ZOG A;  3HSG A;  3CJS A;  2WZ1 A;  4J9R A;  2C3O A;  1IBK J;  1T9V A;  3CGI A;  3QFW A;  4QIF A;  3G8S A;  1UWA A;  3SCL E;  3THT A;  4AXI A;  2O66 A;  4U7C A;  3SQO P;  5GAH I;  3D67 A;  1VQY A;  5IZH A;  3BZQ A;  4ZJQ A;  1JLA A;  2QTW A;  2V4J A;  2C2Z B;  3EGZ A;  4OYO A;  3KJF B;  2X51 A;  2WW8 A;  3FFI B;  3FUY A;  2JSX A;  3GG1 A;  5D15 A;  5C24 A;  1G1X A;  2JEI A;  4DQP A;  3IBF B;  2COL A;  5KAK A;  4ATN A;  2ASY A;  2GVZ A;  1N5Y A;  2NSB A;  3L09 A;  3PW4 A;  3AJD A;  2Z2Z A;  1JJ2 R;  4FKX A;  3T9N A;  4U7U K;  3PJ9 A;  4TLR A;  5EGY A;  4A8S A;  1NZ8 A;  3H5S A;  3CCU S;  1MU2 A;  2DNO A;  3BV8 A;  3L3C A;  3B78 A;  5DZ6 A;  2ZBQ A;  3D0G E;  4C7Q A;  3LGM A;  3CCQ S;  1FT8 A;  1QUP A;  4TYB A;  1HNZ F;  2P6T A;  2UXC J;  5IC4 B;  3NL0 A;  3RTV A;  4USV A;  3SI8 A;  3R2C J;  1I3O B;  1B3T A;  3KUG A;  3GMG A;  3ULH A;  2KFN A;  3KUH A;  4IG0 A;  4USU A;  2DIV A;  2XWX A;  2WON B;  3MUT P;  1DQ8 A;  2V2K A;  1IKX B;  2MST A;  3LGH A;  1SKR A;  2CAJ A;  1PSD A;  1UVL A;  2OPP A;  1BQN B;  2QO3 A;  2E7X A;  3S01 A;  3M2R B;  2MLZ A;  2DY9 A;  1NJY A;  2ZH3 A;  4YY3 J;  1H98 A;  4YB6 A;  5IOL A;  2GAH C;  1U6F A;  2FLO A;  3VGU A;  3MM9 B;  2KG1 A;  3W2V A;  3VAJ A;  2LXU A;  3I6P A;  5CZV A;  1DRZ A;  3HZG A;  3A3O B;  1S1W B;  2XO7 A;  3MEE B;  3PYD A;  4I7F A;  2QLB B;  3IO1 A;  2ZH6 A;  4WCE Q;  2XBP A;  1FFW B;  4F3M A;  3QT6 A;  5KG2 A;  1U48 A;  4FYX B;  3JS9 A;  3I5C A;  5F8H A;  2QX0 A;  3Q8S B;  3N6M A;  1S6Q B;  5DG8 A;  2E7V A;  2Z2L A;  1D3W A;  2H65 B;  3KFW X;  2ABY A;  5KFK A;  1VFJ A;  3HFV A;  3IN5 A;  1AZS A;  2BA9 A;  3MZI A;  2V8V A;  3PYF A;  3FZB A;  4Q44 A;  1F60 B;  2V67 A;  3J81 j;  3UDE A;  1NM2 A;  3T3F A;  2Z57 B;  2WHO A;  5KFV A;  1PAU B;  2MKS A;  2PII A;  3CMQ A;  1S5Z A;  1MRO A;  4WFZ A;  2BM0 A;  4WE1 A;  1KHV A;  1MN9 A;  1NUE A;  3HCX A;  2E29 A;  5HJX A;  2EFN A;  4OL8 A;  2M9K A;  1EIY B;  2HZA A;  1V3R A;  4P74 A;  4DV1 J;  3BYP A;  3R5B A;  2U1A A;  3AY0 A;  1U45 A;  3CJT A;  3WX4 A;  1YRT A;  3TI0 A;  4K5S A;  1FK9 A;  3M30 A;  1U02 A;  3TYT A;  3FZ2 A;  7FDR A;  4X4T A;  1PGZ A;  4EBC A;  2C3U A;  4LRE A;  1ARO P;  1ITP A;  1V5I B;  3ETO A;  4ED3 A;  4OZ2 A;  5LL6 d;  2ZH4 A;  4IG3 B;  3RBE A;  3OR2 B;  2C22 A;  5FD1 A;  2A18 A;  3SZ2 A;  1B4S A;  1ZAV A;  2PC6 A;  4ANE A;  1UW9 A;  3DLK A;  2HND A;  4KHP F;  2LEA A;  1CBK A;  3HVW A;  4JB8 B;  4J9V A;  3G8T A;  3CC7 S;  4IH7 A;  3PG9 A;  4NA2 A;  3H8Y A;  2ACY A;  3AXM A;  2NYI A;  1KTQ A;  4PG7 A;  2V4R A;  2ASJ A;  2VA3 A;  3FBB A;  4M5K A;  1RTH A;  4NZ6 A;  4L72 B;  3KG1 A;  1B0V A;  2DGU A;  4ZVT B;  2RQ4 A;  2QFI A;  4PKD B;  1B64 A;  4TXS A;  3DNC A;  3HHL B;  2B4V A;  2PT0 A;  5KFZ A;  3NOC A;  3JTO A;  1XMQ J;  1RTI B;  5A8R B;  5KG7 A;  5L9X A;  3IRW P;  3MI7 X;  4NLX A;  1CPZ A;  1V3S A;  2D69 A;  3KJV B;  4DR5 J;  1JLE A;  3H4D A;  4UOG A;  1CQN A;  1GTH A;  3WIV A;  2WTF A;  3W5X A;  2A6M A;  4UOF A;  1YX2 A;  1JQG A;  1B7F A;  3OTE A;  1FVQ A;  4KE5 A;  2YNG A;  4YS2 A;  4W4M A;  1R8B A;  3TZW A;  2WW4 A;  5DZ7 A;  2MQ8 A;  3MAQ A;  1FKP B;  4FF1 A;  2KYX A;  4NE9 C;  5C25 B;  2K2P A;  1BGX T;  4DHV A;  1X9S A;  4F3O A;  3I5A A;  3KLF B;  2YWG A;  3NAI A;  1ZTW A;  1K47 A;  2NUH A;  2HGN A;  1FEE A;  2V34 A;  1HWL A;  4DSL A;  4RW8 B;  3DLG A;  3M9O B;  3Q24 A;  1HI8 A;  2KB2 A;  2R7R A;  4P9S A;  4LFB J;  3H90 A;  3R27 A;  3D1Q A;  4P75 A;  1NPR A;  5A6W A;  3O3L A;  1Q1K A;  4HAC A;  4D3G A;  3UD3 P;  1C1B B;  3V81 B;  1SI9 A;  4DUZ F;  1GXT A;  4ZVG A;  1T02 A;  4OX9 F;  2X7I A;  2HRU A;  3IFE A;  4RUA A;  4OJ1 A;  4H4M A;  5KFC A;  3DI6 B;  4Y0F A;  2DY1 A;  4QYZ J;  2YPY A;  1YHQ S;  4LSL B;  2F5G A;  4Y6I A;  2UU9 J;  3O2I A;  2OSR A;  1NZA A;  3E01 A;  4A46 A;  1KOO A;  3I0S A;  1D8Z A;  3CCM S;  5IT4 A;  2UUW A;  3DC2 A;  1SJR A;  2R9L A;  1RB0 A;  3W64 A;  3AXK A;  4X84 A;  4FN5 A;  3KUE A;  1WC6 A;  5B09 A;  3VAI A;  2BX6 A;  1RYS A;  2BRK A;  4ED2 A;  2OH2 A;  1RK8 A;  3L7U A;  3ENQ A;  2XMM A;  1GFW B;  5ETL A;  3MCN A;  1RT2 A;  9ATC B;  1LW0 A;  2GIQ A;  3UPF A;  2DR7 A;  2HQF A;  2IRU A;  2ALY B;  4P2M A;  3JTN A;  2FLP A;  1JLG A;  1VRU A;  4QYR A;  1GEH A;  2D1C A;  4PWW A;  3NGR A;  1S97 A;  1TV6 A;  1ZYQ A;  3L7P A;  3KHH A;  2W9B B;  3CJR A;  4UY8 T;  4O23 A;  3AOB A;  2KFZ A;  1XNQ J;  1QAX A;  4DFP A;  4JI8 J;  2Q6C A;  4KGX B;  5H9F J;  4DL3 A;  2VG7 B;  2IY5 B;  3NG8 A;  1IBM F;  2J6U A;  5HRO A;  4J5O A;  4F2R A;  2HS0 A;  5F9N A;  1M5P C;  1VRT B;  4DR7 F;  1TR0 A;  2EC0 A;  4K8R A;  3E2E A;  4M63 A;  3BKF A;  3K7R A;  3UNG C;  4QU7 A;  1U49 A;  3FRY A;  3HFZ B;  3W1Y C;  4ECS A;  4M94 A;  3ZZY A;  4QCL A;  2NLW A;  3FFI A;  1HBO B;  1RU2 A;  1A7G E;  1RBL A;  3JXO A;  4EYI B;  5LMU F;  4ILL A;  3BGL A;  4ZP8 A;  4O3O A;  3HT3 A;  2NYH A;  4OV1 A;  1CG2 A;  4LR9 A;  4YEA A;  4WJB A;  5LJ3 Y;  2K3I A;  1FF2 A;  5HO4 A;  3D28 A;  4ED4 A;  3IWX A;  4A8X A;  3ZO7 A;  3MCO A;  5KFL A;  3SCJ E;  3GFH A;  2EFG A;  1F3V A;  1CJV B;  2BRL A;  4ZS6 A;  4ZVQ B;  3JSB A;  1IM6 A;  2KM8 B;  1XMQ F;  1D8Y A;  3HUL A;  2CQ2 A;  2J8A A;  3H2U B;  1PIE A;  5FLX U;  2BE7 D;  3TAP A;  4PEO A;  1RT4 B;  2XMV A;  4DJB A;  3KLG B;  4B9N A;  2EPI A;  3AQO A;  3KLI A;  4CH0 S;  2HQ3 A;  2F9J A;  1X7V A;  1M5K C;  1P9Q C;  1JWW A;  1RSC A;  2IMO A;  2WON A;  4XO0 A;  5HL7 Q;  2XUL A;  1IKX A;  3V2U C;  1H2U X;  2DPI A;  4DR3 F;  1J5E F;  4NEZ A;  2R4F A;  4LFC F;  2MY7 A;  1BQN A;  2U2F A;  4LIR A;  1XC9 A;  5K9F A;  3M2R A;  1C4C A;  2GHV C;  2DH8 A;  2EFQ A;  4N41 A;  3MM9 A;  1KVI A;  4NEY A;  3CDA A;  3UCG A;  3C2P A;  4B9M A;  2CPD A;  1S1W A;  3CIM A;  4PCQ A;  4P71 A;  2VBY A;  2UUC F;  2CJY B;  2AJ1 A;  3OTO J;  1CC8 A;  4RBV A;  4CCH A;  5E3P A;  3HLU A;  2MJN A;  4I2Q A;  3LPE A;  2NZ4 A;  2F63 A;  2W2M P;  1S6Q A;  3FC9 A;  2HQG A;  2XEX A;  1IKV B;  1VBZ A;  1P1T A;  1WF1 A;  3EYZ A;  1IWG A;  1X31 C;  1GAO A;  1XEZ A;  3NNA A;  4RNO A;  1PYO B;  3A1Y G;  3RR7 A;  3P6Y C;  1S59 A;  5D4N A;  1J5O B;  3OL7 A;  1N32 J;  4ED6 A;  2BMB A;  1RI7 A;  2AYG A;  3NS6 A;  3ET6 B;  5ETP A;  4CLK A;  5KFU A;  1Q82 T;  4B3M J;  1PJ6 A;  4B3R J;  2CPZ A;  3MM7 B;  1N33 J;  2BUN A;  4OYA A;  1M5S A;  1H6K X;  3RG6 A;  3RB3 A;  2VU5 A;  1KQS R;  2E5J A;  2DD8 S;  2BAN B;  4N56 A;  3DLB A;  3OR1 B;  3IM9 A;  1IQT A;  2W2Q P;  4FZV A;  4NZ7 A;  2B6A B;  5JXS A;  2DR8 A;  4OI3 A;  1UMJ A;  2NPF A;  1XNQ F;  4ECY A;  1VR6 A;  3KLV A;  5GVQ A;  2W8K A;  2CQG A;  4W92 B;  1HBU B;  2VA2 A;  5D4L A;  2J0S D;  3EZO A;  4QIE A;  4B3T J;  3OR2 A;  4NXM J;  1O51 A;  1YJW S;  2VON A;  2LXI A;  4FVM A;  5KFB A;  2AF6 A;  2W7A A;  4O3S A;  4Y34 A;  5H9F K;  1UZH A;  1XNR F;  2ZM6 F;  4RNM A;  3TEG A;  2B0G A;  5KFA A;  3AH6 A;  2KT2 A;  4PXC A;  5F8N A;  3BSN A;  4DPX A;  3C16 B;  4LF8 F;  1HWK A;  3T5K A;  2ASL A;  3CWJ A;  2YWK A;  4P73 A;  4WU3 A;  1NB7 A;  2F7V A;  1IM4 A;  5LXY A;  1JX4 A;  4NLS A;  3DHW C;  1C1C B;  4F4W A;  4X66 J;  4RWX A;  3TUJ C;  4DEZ A;  3EZU A;  4I0W A;  3HHL A;  2HFU A;  4NA3 A;  3MUR P;  4C8N A;  3QMQ A;  1RTI A;  5A8R A;  4TY8 A;  1U6B A;  3HVR A;  2CQ0 A;  5KFF A;  2VAS A;  3VQT A;  1YDL A;  4B08 A;  2YX7 A;  2J7W A;  5HAN A;  3KJV A;  4EZ9 A;  4AQY F;  2Y8Y A;  3C6U B;  3HP6 A;  4BC9 A;  4ERD A;  8RUC A;  2Y0S D;  3VZH A;  5A8W B;  3F0N A;  4N76 A;  3CNQ P;  3H2L A;  3BO4 A;  1OWX A;  2DNN A;  1Z2Z A;  1N5V A;  1FKP A;  1WTF A;  5C25 A;  5A0Y B;  2DHS A;  5I3Q A;  5L38 A;  2HFZ A;  1RE1 B;  3W61 A;  3O6Q A;  4QW9 A;  2JH3 A;  2NXU A;  3WQP A;  2BQR A;  3NMR A;  2IRY A;  4K0K F;  2QMW A;  5LMN J;  3UCU P;  3CXC R;  3JSR A;  5HP1 B;  3BS9 A;  3IR6 B;  3HX9 A;  1WI8 A;  3D3B J;  4X4S A;  1C0T A;  2CJA A;  5B0A A;  3EX7 B;  1C1B A;  4RX6 A;  5D0R A;  3W5Y A;  3EDQ B;  2XG8 A;  3G2X A;  2WVE A;  2UXD J;  4DR1 F;  3IMQ J;  1EKS A;  3DI6 A;  4CT8 A;  4YDD B;  4ICL B;  4PG6 A;  5AXM A;  1L3V A;  1R27 B;  1EP4 A;  3TAN A;  2IMW P;  4C9D A;  1UFW A;  2MZR A;  4TN2 A;  1V5V A;  4XK8 C;  3LWM A;  4J9O A;  1FRI A;  4ID8 A;  2NXE A;  3MMC B;  3JSY A;  3X3U A;  5I42 B;  1RZM A;  1LQ9 A;  3GSD A;  3MR3 A;  5AJ3 J;  1U25 A;  3R8Y A;  2OO4 A;  4URG A;  3V4I A;  2AKW B;  4FYD A;  1NDL A;  1YGY A;  1NK5 A;  2VIC A;  2ZD1 B;  3HJF A;  3CIZ A;  4AYB D;  5J2Q B;  1UWB B;  2C3M A;  1WOS A;  2BKN A;  4M5G A;  4ZPW R;  2VDI A;  3D2W A;  2RDJ A;  2HK2 A;  2FJD B;  4CLP A;  1N33 F;  4PUO B;  2DGQ A;  2W9B A;  3FRZ A;  2VFR A;  5HQM A;  1T3O A;  3D68 A;  3BQ0 A;  3V5R A;  1M1G A;  3EVO A;  3U1M A;  1HNW F;  1HQU B;  3TO8 A;  5D4P A;  4AD6 A;  3NCP A;  3JTP A;  3GFZ A;  4FXW A;  5E3C A;  3H98 A;  4K2X A;  2DGS A;  1RAG B;  1UEV A;  2ZC3 A;  2FVR A;  3B82 A;  2AT1 B;  4LVO P;  2WBR A;  4JI7 F;  2RUG A;  2RS2 A;  3HHL D;  1R6V A;  4DV5 J;  1LWX A;  5F0W A;  1WEZ A;  2FJE B;  3BBC A;  3QJJ A;  3L95 X;  1HBO A;  2DJW A;  3L4B C;  2WVB A;  4DR4 J;  3BGU A;  4TKT A;  3HJV A;  2M3D A;  1VHI A;  3GIR A;  4OI4 A;  4DPW A;  4ZK7 M;  4G6V B;  1Q5Y A;  3BJY A;  1KD1 T;  2MGZ A;  4N77 A;  1WEL A;  3DXS X;  6AT1 B;  4Y3C A;  3FCW A;  3M8Q B;  2IYI A;  3NGT A;  4X66 F;  1FE0 A;  4ZOS A;  2V2Q A;  4HVZ A;  2W4P A;  2HBQ B;  1NXI A;  1WSR A;  1CJV A;  4CLT A;  2BDP A;  1X4D A;  3RB6 A;  4ELT A;  4ETZ A;  2QT7 A;  4MAK A;  2OEJ A;  4F36 A;  4WP8 A;  2KT5 A;  3GR0 A;  4OZ5 A;  1RT4 A;  4HI2 A;  2RQK A;  3C3L A;  1SQF A;  2R2S A;  3CC2 S;  1D0E A;  4ELV A;  3GB0 A;  3N5F A;  2XHW A;  2KL8 A;  4DU7 A;  1KQF B;  1CVJ A;  4LF6 J;  1AUS L;  2HHT A;  3C14 B;  3BR9 A;  2DNR A;  5D77 A;  4OYB A;  4U96 A;  2BM1 A;  3HVA A;  3JSM A;  4QPX A;  2W9C A;  1PG5 B;  4DR6 J;  3CJ3 A;  2BJ9 A;  2HHH F;  1FKO B;  2IA0 A;  1EAR A;  3E51 A;  2YKO A;  1X8D A;  2HMI B;  2BVZ A;  4ZP9 A;  1NJI T;  5KG5 A;  4R0J A;  2GC8 A;  5M2R A;  4K59 A;  1H2T Z;  5LSR A;  4WXW A;  1RXO B;  5D3G B;  5FLX Y;  3MED B;  2ZE2 B;  1RT5 B;  3LW5 C;  1D9F A;  2UVU A;  1OSC A;  1M5O C;  3CMA S;  4CRJ A;  4A47 A;  2UXD F;  1WOO A;  1U2C A;  3VAL A;  3PX0 A;  3C8Y A;  2DKO B;  2HK3 A;  2RNE A;  1MWQ A;  4JI5 J;  1BQM B;  2X1A A;  2L41 A;  3Q2T C;  1I94 F;  4KJI A;  1IKV A;  1H2V Z;  3K8V A;  5F0U A;  2RS8 A;  3PW7 A;  1DTT B;  1V9O A;  2B9X A;  2LLZ A;  2LQ8 A;  1TUV A;  4NLO A;  3WX8 A;  2KI2 A;  2MTL A;  1H73 A;  3I96 A;  4IR1 A;  3VAF A;  2JEG A;  2GJI A;  1IJE B;  5AJ3 F;  5KFS A;  2AYB A;  1RKJ A;  3ET6 A;  1FNO A;  3J7Z T;  1HNV B;  4EO6 A;  3MM7 A;  3Q8P B;  2I8E A;  1S0O A;  4OYP A;  3MMA B;  2BJ3 A;  1YJ7 A;  3JAM Y;  2EVZ A;  1NSK L;  5ITH A;  1CJT B;  1LV5 A;  3UWT A;  5HI7 A;  2BAN A;  3OR1 A;  1FWP A;  4LF9 J;  3BH7 B;  3R3T A;  3Q0A A;  3MD3 A;  2B6A A;  5AT1 B;  3GYN A;  3BO2 A;  2RML A;  4DUY J;  4O4R A;  4WFN Q;  3KDN A;  4JV2 A;  1AW0 A;  3BKU A;  1HBU A;  5F8M A;  2CJX B;  4F2S A;  3NNH A;  2Y1I A;  3M2U B;  4YHH J;  1UVK A;  2HPU A;  1FRJ A;  1GX6 A;  2LQ9 A;  1AA1 B;  3CED A;  3DCA A;  2AJQ A;  5EHH A;  1FDB A;  3LAL A;  4UOH A;  2RB7 A;  5DRK A;  3QNW B;  2AX1 A;  3HD2 A;  1RP5 A;  3Q8R B;  4DFM A;  1ZET A;  1FJC A;  5E7O B;  4E8U A;  2I5J B;  4J9N A;  1CSJ A;  1HIY A;  2FTR A;  4NL5 A;  1KWM A;  3TVZ A;  1GTE A;  1C1C A;  2HEK A;  3MUV P;  3CC4 S;  1NDP A;  2XLI A;  4WF9 Q;  1T9X A;  4WYL A;  2N3L A;  2B51 A;  3CCZ A;  4HHH A;  2ZZN A;  2CQP A;  1FDD A;  2E5L J;  3P5B P;  1S4F A;  1ZZF A;  1WC0 A;  6FDR A;  3TUZ C;  3QLH B;  2LP4 A;  3SXL A;  1UJ4 A;  3LP0 B;  3C6U A;  1RHK B;  4XAK A;  5A8W A;  1F5A A;  4KC5 A;  2WB4 A;  2HSE B;  3DGP B;  5A0Y A;  1ZZN A;  3UDV A;  2HFN A;  2DGV A;  2MPU A;  1JB0 C;  2XYH B;  2ATC B;  1S12 A;  2Q43 A;  4GO7 X;  4ZJO A;  1HQ2 A;  3HSD A;  3QJP A;  2NXN A;  4UTG A;  4Q45 A;  3GIL A;  5HP1 A;  1Y9O A;  2JWN A;  2RQM A;  2YXL A;  4HEA 9;  2UVV A;  1PIL A;  3PY8 A;  1BD6 A;  4FNH A;  2NQP A;  2HIY A;  3T1H J;  3RW7 A;  3M2V B;  2YWF A;  5KFQ A;  5A2Q Y;  3CCT A;  5K8O A;  1SIZ A;  2ZH1 A;  3TR5 A;  4ICL A;  3AB2 B;  2DR6 A;  3W5Z A;  1WHV A;  4F67 A;  5CCL A;  2B9W A;  2NPI A;  1F9H A;  5I42 A;  2QYC A;  2ALZ A;  2F4V F;  5F8J A;  4JI1 F;  1N4L A;  4YR0 A;  1EX8 A;  2RF2 B;  3OVB A;  1I1G A;  3VV2 B;  3VGS A;  3MFH A;  4MH8 A;  4OYZ A;  1GH8 A;  5D8H B;  1H72 C;  2OML A;  5D6G A;  2MZJ A;  1XMO J;  2ZD1 A;  2AGP A;  3A8E A;  3KJN B;  1N5T A;  3DRS B;  2HLU A;  3M9N B;  5J2Q A;  2OTL S;  1KQK A;  4GO5 X;  2VIH A;  1QAJ A;  3KK1 A;  3ENA A;  1XBW A;  3AB4 B;  3QZ7 A;  3LUY A;  3Q86 A;  4KQZ A;  1KTV A;  3DDK A;  1WKL A;  3R7N B;  4WK3 A;  4OX6 A;  2DGW A;  3QID A;  2CYY A;  2MQO A;  4YFU A;  1HQU A;  3B8H A;  1BE4 A;  4PG8 A;  2MZ1 A;  4N8N A;  1S6P B;  2AWZ A;  1X60 A;  2BAB A;  3MEK A;  4DSI A;  3HKW A;  3BRE A;  5DG9 A;  2MQP A;  3M4X A;  3RRK A;  3DFE A;  4F4K A;  4I6W A;  4KV8 B;  2UUA F;  1QSY A;  4NRU A;  2YH0 A;  4DL4 A;  2HHP A;  3LP2 B;  4J7C A;  2GJ2 A;  2OMO A;  4KPC A;  4YHH F;  2LMI A;  1RWU A;  2BOA A;  4WK1 A;  2IJN A;  2H48 B;  4CO2 A;  2HZC A;  3AA8 A;  4C3K A;  3W9J A;  4Q0B A;  1SH2 A;  1JXE A;  4N47 A;  2GAG C;  4OHY A;  3BGR B;  5F8L A;  2DTJ A;  4U8V A;  4Y00 A;  4DBQ A;  3DRX A;  1FNX H;  1U4B A;  2FJW A;  1O5J A;  4OJG A;  2DO4 A;  3QPI A;  1OSD A;  2AYM A;  3NAH A;  4B9V A;  3J80 U;  2W9A A;  4PPZ A;  3H20 A;  1NKC A;  4PYA A;  3DU6 A;  3MCM A;  2QN6 B;  4ZVF A;  4DV4 J;  2DO0 A;  4OI6 A;  2AJ4 A;  2D3Z A;  2PI5 A;  1FE4 A;  2QL7 B;  2MB0 B;  5ETN A;  3J81 U;  4WP3 A;  2G4B A;  4RU9 A;  1SJF A;  4W98 A;  2M52 A;  3GCW P;  3VR1 A;  1NK6 A;  5DG7 A;  3ISN D;  3UFC X;  1KSP A;  4MIW A;  3Q2S C;  3PV8 A;  1YIT S;  2PO4 A;  3K0J A;  1VQK S;  1NLK L;  1FKO A;  3IG1 B;  5CYM A;  3QIP A;  1YSJ A;  2YX1 A;  2M7S A;  2Q79 A;  2HMI A;  2QE5 A;  2ILY A;  3EPI A;  1NND A;  3HHK A;  3OJU A;  3AD7 C;  5AE1 A;  2HW3 A;  4J91 A;  5DLF A;  4FPI A;  3LH2 S;  1FWK A;  1N5Q A;  5D3G A;  1U1N A;  2ZE2 A;  1RT5 A;  4Q43 A;  4ZVU B;  3RW6 A;  1WTB A;  1ZPV A;  2ZNZ A;  2JJ4 D;  3D6M B;  2IBO A;  3VWS A;  4MMO A;  4J9S A;  4R5P B;  2ZHA A;  1BMQ B;  1NDC A;  1BWE A;  1ZAW A;  3HHL C;  4JI4 F;  2HVE A;  5BR8 F;  4K7Q A;  4P52 A;  4CM2 A;  4NZ0 A;  1BQM A;  1RT1 B;  4W90 B;  5DJB A;  1WC1 A;  1FO1 A;  1RHJ B;  2WSC C;  1N88 A;  4XPE A;  3BDP A;  4KAI A;  2MLY A;  2F3J A;  1QTN B;  2ZBC A;  1DTT A;  3T5J A;  2DNZ A;  2MKY A;  4DCP B;  1RJJ A;  4RWW A;  1UVI A;  1T05 B;  2Z30 B;  3H2V E;  4X65 J;  3KWM A;  3CPW R;  2OLW A;  2PE8 A;  2AMC B;  5HN0 A;  1RAF B;  1P9Y A;  4WKR A;  4IR9 A;  2QG9 B;  4I68 A;  4U6P A;  4DPO A;  4J9L A;  2W25 A;  4LFA F;  5B0B A;  5BJR A;  3MMA A;  2GCF A;  2V2Z A;  2RRA A;  2N4D A;  1G2E A;  3R6L B;  3R5A A;  1CJT A;  1QD1 A;  4YN3 B;  3W65 A;  3KKF A;  1B7Y B;  1N0V C;  1U8W A;  3GR1 A;  1U26 A;  5CAA A;  3S8S A;  1LOU A;  4A8Q A;  3R5J B;  3H0P A;  1OS5 A;  2PFF B;  2HWI A;  2K7J A;  3CDW A;  3KK2 B;  5KT2 A;  1GXL A;  1LXN A;  1TL1 A;  2CKW A;  3TVK A;  1S48 A;  2VH7 A;  2XY5 A;  4H4K A;  5JVH Q;  3ZZT A;  4CWB A;  5EWE A;  3OHB A;  2XO6 A;  3CCV S;  1HW8 A;  5IT0 A;  2FY1 A;  2GX8 A;  1LFP A;  4GKK J;  2HS4 A;  4JV5 J;  5CCM A;  2HG4 A;  2I5J A;  3AA9 A;  4MIB A;  4ENO A;  3PZP A;  1KON A;  3G86 A;  5K8P A;  5M2P A;  4H4O B;  1GMV A;  3D4J A;  1RAH B;  2JVO A;  3TJA A;  4RUB A;  4BLG A;  1NJW A;  3KMS A;  1KVJ A;  3GIM A;  2I9S A;  4WFA Q;  3HXM A;  3ILL A;  4NLP A;  4DQI A;  5KG0 A;  3RGI A;  3NMA A;  3AOD A;  4OIX A;  3R2D J;  2B4U A;  9RUB A;  3QLH A;  1VLO A;  4Q7A A;  2DNY A;  1RWO B;  3DLE A;  1HYS A;  4JI0 F;  3AHP A;  5KFI A;  3IWN C;  1XIQ A;  4DV4 F;  1DZ5 A;  3HZE A;  3DKD A;  1KC8 T;  1Y7P A;  2WVC A;  2RJZ A;  4CLL A;  3GIK A;  1NB2 A;  2A10 A;  4LF2 A;  3M6X A;  3DGP A;  1SC6 A;  3PW5 A;  4K4U A;  3BSA A;  4KB7 A;  4ZVR B;  2ZJP Q;  3P49 B;  3NGS A;  1EQ0 A;  2AGQ A;  3PTW A;  2VOP A;  2B43 A;  2XCA A;  4DX7 A;  1A9N B;  3EXY A;  4IRK A;  2OD4 A;  1U8S A;  2B9Y A;  1RWV B;  4C8L A;  2OFH X;  2CZ4 A;  2FC9 A;  3BSC A;  1TK8 A;  2KXF A;  1TUW A;  2VQE J;  4L74 A;  3M2V A;  3OFH A;  3BM7 A;  4L75 A;  1LWF B;  4Q5V A;  3K5L A;  3BF4 A;  4ZHR B;  2HQD A;  2XC9 A;  2L9D A;  2MZT A;  5HLF B;  2HZV A;  4KY3 A;  4ECX A;  1IQZ A;  2J9C A;  1UW4 A;  5HMW A;  3CT9 A;  1X4F A;  4RBU A;  2OKQ A;  3O5T B;  3TRG A;  4RW4 A;  4EYH B;  4DG1 B;  2KM8 C;  1VOM A;  3KJQ B;  5DO2 A;  5K8M A;  2IC3 B;  2CWX A;  5MAO A;  4KIA A;  1T9Y A;  1HR0 J;  1RAA B;  2VG6 B;  2CNK B;  2ZC4 A;  1AYE A;  2G2Z A;  2I2Y A;  5E3A A;  4X62 J;  3MFI A;  1F2G A;  4DPT A;  3UO0 A;  1PC5 A;  3M9M B;  2DRB A;  2ADB A;  1UVN A;  2QLX A;  3Q83 A;  1OYE A;  3MAA B;  1M1K T;  1SQG A;  4ITS A;  4DWI A;  1V3Z A;  3T5L A;  1DUR A;  4NCB A;  3EUN A;  1I6J A;  2P2C B;  1SL2 A;  2XHC A;  3VAH A;  2HVI A;  2OHD A;  1NK7 A;  4RR5 A;  3KMQ A;  3GIJ A;  1RTJ B;  1R8P A;  1W2B R;  1JNZ B;  3PRD A;  4JI2 J;  1HI1 A;  3K5M A;  4CT9 A;  2AQ4 A;  1RDR A;  2V9W A;  4KV8 A;  4LR8 A;  1X0F A;  1S49 A;  3LF0 A;  2CIM A;  4WTO B;  3LP2 A;  2DGX A;  4P72 A;  1PBU A;  1HLW A;  3MWB A;  1M0S A;  1OMS A;  2HKE A;  5IV3 A;  4IDK A;  3EJM A;  2N82 B;  2G13 A;  1U6Z A;  4PXB A;  5CHC B;  2MYF A;  4B17 A;  3W8P A;  2L9W A;  3MTJ A;  3D54 A;  1YJ9 S;  1TL4 A;  3G8Q A;  2DIU A;  1HA1 A;  3OQ2 A;  4B3S F;  4A8W A;  1CUL B;  3C66 A;  3CUN A;  1S1U B;  3DDN A;  1Q5V A;  5J2P B;  3CCJ S;  2ERR A;  3DHX A;  1UA0 A;  2HIQ A;  2DH7 A;  2HAF A;  2FDN A;  2JZ5 A;  2FJA B;  3W2W A;  3OSP A;  1TK5 A;  2OP5 A;  1ZA1 B;  3QYY A;  1RWN B;  1I5O B;  4DSK A;  2VFV A;  4Z7C A;  2DR5 A;  3N4W A;  2ILZ A;  4NLG A;  2SXL A;  2CQI A;  3K5N A;  3QGI A;  2OAU A;  1YBA A;  4OHX A;  5KFX A;  4UT4 A;  4DF8 A;  2MHE A;  4I4B A;  3MPY A;  4NCA A;  3TJ8 A;  3W7B A;  2VB6 A;  4EWT A;  4NLU A;  1K9M T;  2OPR B;  3IG1 A;  2LA6 A;  1WUU A;  2UP1 A;  4FS2 A;  3DOL B;  3J80 Y;  3MXH P;  1S9F A;  1MWZ A;  3T19 A;  2HVZ A;  3A8J A;  1DJ0 A;  3OFG A;  2EI5 A;  2VC1 A;  2E1P A;  3QAE A;  1DLO A;  4PZV A;  4X4P A;  3J81 Y;  3M8Y A;  3K59 A;  1DQ9 A;  4LSZ B;  3NRB A;  4DV3 F;  1QSS A;  3P5T L;  2AEJ A;  5KG3 A;  4R5P A;  4NCG B;  1HQE B;  1HNZ J;  4ED5 A;  1LNQ A;  5DDQ C;  2XSJ B;  1RT1 A;  2V94 A;  2CQH A;  5DQH A;  3ZTO A;  5CAB A;  4DR2 F;  1VCT A;  4MKV A;  4ZCI A;  5KFJ A;  2OEK A;  2H4W B;  1VS3 A;  4CTA B;  3VCD A;  3UI3 A;  3ADA C;  2D7S A;  5KFT A;  2EG1 A;  2XMU A;  5HVG A;  1N34 F;  1DBD A;  2W4D A;  3AQP A;  1S72 S;  4DCO B;  3GYX B;  2CNO B;  1X4A A;  2LXF A;  2GW8 A;  1KS2 A;  3R5C A;  4YOE A;  1KP6 A;  2CA9 A;  3FMW A;  4PG4 A;  2EC2 A;  2WK4 A;  3LAM A;  3D1O A;  4ECW A;  2M8H A;  4V19 X;  2HHS A;  2CG8 A;  2RHS B;  3IGV A;  1VYA A;  1R0A B;  3KK2 A;  3ISN C;  1UEU A;  3PO4 A;  1LEO A;  1H74 A;  4JI2 F;  4U8Y A;  3HKZ D;  3WC0 A;  2QSF A;  3THP A;  3OSN A;  1Q53 A;  5KFP A;  2KN4 A;  3R7B B;  3FBF A;  1OQ3 A;  2CZ9 A;  1XMB A;  3OJS A;  2I38 A;  4ETX A;  1CJU B;  3KNA A;  4ECR A;  2E1R A;  1RHU B;  2AJF E;  3GLJ A;  5B7W A;  5BXI A;  1F5B A;  2VC0 A;  5L46 A;  1IKY B;  2YKM B;  3UR3 C;  2YVS A;  2WVD A;  3U02 A;  1ZAX A;  2ZWP A;  2IFX A;  2VOO A;  5J1E A;  5HMX A;  1HBM B;  2LEP A;  1WC3 A;  4U67 Q;  2A0F B;  2GML A;  3M6W A;  4DU8 A;  2ACM A;  1VGY A;  3P4U B;  1D09 B;  3D0I E;  2HNZ B;  3FVY A;  2HBY B;  2XMJ A;  2PMH A;  4LF5 F;  3LO3 A;  5KFO A;  3O8W A;  1T95 A;  2KXN B;  3RB4 A;  2PSZ A;  4DN0 A;  2VQF F;  2QLF B;  4C11 B;  4OJH A;  1MG7 A;  2CUY A;  5KT4 A;  4OYX A;  2J76 E;  5L1L A;  2CFX A;  4KHP J;  5EX0 A;  2W2O P;  3LOU A;  2G9O A;  4CDI A;  2B8Q A;  5T7L B;  1RCO B;  2V8P A;  8AT1 B;  5KFM A;  2BYC A;  1K8A T;  1IBL F;  2BE2 B;  1H3D A;  4X4N A;  1IR2 A;  2JEJ A;  4PRF A;  3EE3 A;  3OL6 A;  3D5M A;  2MY8 A;  2O3D A;  3BB5 A;  3LAK A;  5JJB A;  2HNY B;  2P9C A;  3M8P B;  1HBN B;  1LWF A;  2DH9 A;  2C2K B;  3MM6 B;  4L3K A;  4CLS A;  4DLE A;  2YKQ A;  5K14 B;  1WC4 A;  2N3O A;  1HAR A;  2QRR A;  1UTA A;  1FD8 A;  1U1O A;  3UCZ P;  5LSO A;  2ZUA A;  4ED1 A;  4N7T A;  4E0D A;  1YTY A;  2J6S A;  5I4M A;  5KG6 A;  5KG4 A;  4A8Y A;  2POK A;  5LSL A;  3K5P A;  5K8N A;  2KH9 A;  5THW A;  4X4Q A;  2E1M C;  1SJ3 P;  2VG6 A;  6FD1 A;  3HHN B;  1NJX A;  3CB4 A;  1NHV A;  3QRP A;  1E6V B;  4IFY B;  4YB1 P;  2DNM A;  4TNO A;  2R7Q A;  4OJ3 A;  2CNN B;  4UW2 A;  4TQS A;  3MAA A;  1YWX A;  2GQC A;  5L9N A;  2R2U A;  2XMW A;  4DUZ J;  2RE1 A;  2VHG A;  4OX9 J;  1DTQ B;  1WI6 A;  3A12 A;  3OFE A;  3ZNJ 1;  2ZH8 A;  4KPY A;  4ZIV A;  3KYL A;  1YLX A;  2VPY B;  3RBX A;  4FF2 A;  1JLB A;  1HKA A;  4BWJ A;  3MTK A;  3DRP A;  1HMV B;  4ZP6 A;  1RHR B;  3OLA A;  2D9O A;  3QRR A;  4USJ C;  3V4M A;  4CZC A;  4K4T A;  4ECT A;  4K4Y A;  4KR0 B;  3D6F B;  2XMA A;  1Q8L A;  2FVP A;  1DFD A;  3S1T A;  4NWB A;  3KK3 B;  3MM8 B;  3B54 A;  3OFF A;  3GII A;  2XGQ A;  4OV6 A;  1TKZ B;  1B99 A;  2PN6 A;  2W1B A;  1NK8 A;  1UJ6 A;  5HAO A;  2JX2 A;  3UQS A;  3G6V A;  3D6T B;  1T3N A;  2E5I A;  4B9U A;  4MYT A;  4R25 A;  3CJ2 A;  2EWH A;  3JQJ A;  4ZLL A;  2F4F A;  2H5E A;  3TAM B;  3OD2 A;  3Q8U A;  2DXF A;  3R5D A;  1CUL A;  3CJK B;  4NML A;  2YNH B;  1S0V A;  1ELO A;  4DQS A;  1U47 A;  3U1N A;  1R7I A;  3VVT A;  4DV0 F;  4C98 A;  1WC5 A;  3NCQ A;  4WFB Q;  4L6V 3;  3D9B A;  3OHA A;  1T94 A;  3G4S S;  2YWH A;  3QWU A;  4UZC A;  3DN9 A;  2G0C A;  4KYZ A;  2CG4 A;  1IBM J;  1YQH A;  1ZBT A;  1GMW A;  4NYO A;  5FII A;  4KGK A;  2DEJ A;  4Y2I A;  2UUB F;  3FDS A;  4DR7 J;  2LU2 A;  2G2Y A;  1W7W A;  1WKJ A;  1TL7 B;  4USK A;  1S10 A;  2JL9 A;  4Q8E A;  4RLE A;  1NKE A;  2OPS A;  1RTZ A;  3DM2 B;  5CXT A;  4OX8 A;  2OTJ S;  3PX6 A;  3QGH A;  1UL3 A;  1CS4 B;  2R7V A;  2OPR A;  5CYQ A;  4OZL A;  3TA0 A;  4FYV B;  4H4K C;  1FWL A;  3AAW B;  4I2P A;  5GMK a;  5LMU J;  1VC5 A;  3DOL A;  4DV6 J;  2MMY A;  5DDP C;  2K8G A;  5CH7 B;  2KJW A;  1NPP A;  1N0U A;  2B7B B;  4ID5 B;  2H5I B;  3TP2 A;  4TQR A;  5IT9 U;  2CPF A;  3CD5 A;  2AU0 A;  3Q89 A;  5IQ6 A;  2WSF C;  2X3G A;  4KH1 B;  3GJT B;  2B5J B;  4DCJ B;  5B0G A;  1NKB A;  1N5S A;  1F1B B;  4ZKA A;  4P2F A;  3CF5 Q;  4NCG A;  1IJF B;  1ICE B;  4FPR A;  3ZXW A;  4P6Q A;  3SSR A;  2XSJ A;  5I3U B;  3T9Z A;  1UJ5 A;  4JI3 F;  1VQM S;  4LF7 F;  2FVQ A;  3RAQ A;  3G6E S;  1X5P A;  3I56 S;  1C0U A;  2BJ7 A;  1VC6 A;  1RTD B;  3I4H X;  3L7O A;  2FHJ D;  4DR3 J;  1SUQ B;  1U1P A;  2E9Z A;  1J5E J;  4FP9 A;  3MMB A;  4CTA A;  4LBP A;  4U7U D;  3IRX B;  3C6T B;  5KT5 A;  4LFC J;  3EWG A;  4N5S A;  3VZI A;  1A0O B;  1GT8 A;  3FEY B;  3PW2 A;  3H25 A;  5SZT A;  1LK5 A;  2J9E A;  2E5G A;  4RZR A;  3RU0 A;  3LQV A;  1SKW A;  4C3L A;  2G0I A;  3MR6 A;  2F8E X;  3BPD A;  3I4P A;  5D78 A;  1Q95 G;  2JEF A;  2UUC J;  4LSN B;  4P7T A;  4C8Z A;  3ITH B;  1SL0 A;  4CH1 A;  3DOM B;  3M6U A;  2GIR A;  1XR7 A;  2IAJ A;  1R0A A;  2OPQ B;  1FXR A;  1Y0H A;  4C0B A;  3HSZ A;  3I9V 9;  2DNK A;  2CJB A;  4QWC A;  4V19 J;  2GNK A;  2LKZ A;  3DYA B;  2R8K A;  4CYU B;  2MQQ A;  2J5A A;  3NWR A;  1LK7 A;  3MHY A;  1CJU A;  5J1P A;  3ETM A;  4CO3 A;  1GMW D;  4J37 A;  4X64 F;  2EK6 A;  4IYQ A;  2HWH A;  1IKY A;  2YKM A;  2C2D A;  1JLA B;  3PM9 A;  5C24 B;  3VTI A;  3GFY A;  4MJK A;  3BN7 A;  1HBM A;  2R3V A;  2AHO B;  4RNN A;  3I9Z A;  5IQQ A;  1M90 T;  3HO1 A;  2AD9 A;  5G4D A;  4Z2X A;  2B8P A;  2NS1 B;  2MKC A;  4B3O B;  3T5H A;  4ZLN A;  2QLW A;  2I1R A;  4X4U A;  5DLG A;  3D1H A;  3G6Y A;  3MPU B;  5GAE U;  2IHR 1;  1HW9 A;  5KFY A;  5GAG U;  3NCR A;  4IKA A;  4J9K A;  4ZPB A;  4JI6 F;  2DIS A;  2I6W A;  4IUF A;  4YP3 A;  4D3H A;  1XNR J;  2ZM6 J;  5D0E A;  2LA4 A;  3CTR A;  4WFY A;  4F7V A;  1K0T A;  4OYM A;  4DZD A;  1J2V A;  2QL9 B;  2L9N A;  5T7L A;  4PAB A;  3FKB A;  2KVQ E;  5K5M A;  4LF8 J;  4IG0 B;  1VIX A;  2GA7 A;  4Q2L A;  1N6Q B;  2BE2 A;  1RQ0 A;  1RT6 B;  4E98 A;  2R2T A;  4NLQ A;  2XMK A;  1EAY C;  3UVJ B;  1XR6 A;  2BEF A;  2P8I A;  4DS4 A;  2XSF A;  4DV6 F;  4PWU A;  1N54 B;  3FBE A;  2XM3 A;  2PA8 D;  1G6B A;  3N79 A;  3FNN A;  4NA1 A;  1BUX A;  4BWM A;  3MM6 A;  1IR0 A;  2HRT A;  3GPA A;  1WAC A;  5K14 A;  2H54 B;  4EI2 A;  1PKU A;  1BHN A;  4OYW A;  1SCJ B;  2CPX A;  5IWA F;  3JQM A;  1S57 A;  1Q86 T;  4AQY J;  3H5Y A;  1ACM B;  1G3O A;  1BC6 A;  2E7W A;  4LRF A;  2BOP A;  4YB5 A;  2JLG A;  1ULR A;  3UD5 A;  2GIF A;  1X5S A;  2J9D A;  4TY9 A;  3GFX A;  4IH6 A;  4F4Z A;  1KR4 A;  1FDN A;  2GS8 A;  1ZTT A;  5GAE I;  4WTY A;  5GAG I;  4MTP A;  5HQL A;  2QZ8 A;  1F9E B;  1O0P A;  2J0X A;  5CQG A;  2V4Q A;  1KRP A;  4G1Q B;  2OFG X;  1QAI A;  4DV2 J;  2IJF A;  4K0K J;  2CWK A;  2CPJ A;  2UXB F;  4EEY A;  4IFV B;  3DLL Q;  4HTI A;  1E6V A;  3G9C A;  1YZ6 A;  4IFY A;  4UQT A;  4M5D B;  3AD8 C;  1VK3 A;  2MJU A;  2ZOF A;  3C15 B;  3EGW B;  5A76 A;  4DDF A;  4EUV A;  2UVW A;  1N36 F;  4DV7 F;  1WHY A;  1U1L A;  1DTQ A;  4WE1 B;  4ZPV R;  2XI2 A;  2V68 A;  4DR1 J;  3OXF A;  5G0R B;  4AE5 A;  2V9K A;  1D9A A;  3SBM A;  2F65 A;  4E2F B;  1Q7L B;  1WJ9 A;  5CA5 A;  2XTJ P;  1HMV A;  5GME A;  2VF3 A;  2R7W A;  3MEE A;  2QMX A;  3K5O A;  3JAM U;  1YKW A;  4RUC A;  3HD1 A;  2DXD A;  1SXL A;  1FK9 B;  4ZCK A;  3KLH B;  3GE9 A;  2J7U A;  4NAS A;  4L73 A;  3MM8 A;  3KK3 A;  1SJ1 A;  4P2S A;  1TKZ A;  3DDI A;  4YQW A;  4DF4 A;  3IAS 9;  2DR9 A;  1KNZ A;  3SYZ A;  2PD1 A;  3OL8 A;  2XY6 A;  4EBD A;  1FTC A;  1NO8 A;  1VQS A;  3K58 A;  1QDU B;  1WNE A;  1NAQ A;  4QYZ K;  3SDE B;  5DQI A;  2R7S A;  1GNK A;  2HND B;  2ZOM A;  3TAM A;  3VAG A;  1YJR A;  3ZZP A;  5ETO A;  2YNH A;  4ES3 A;  3G6X A;  3NGD A;  3HFK A;  3NS5 A;  4CIO A;  1Q4R A;  1OYD A;  4IRC A;  3WIU A;  1BXN A;  2CZV C;  1RLC L;  2HQI A;  5A8K B;  3FJ2 A;  4G3I A;  2R8H A;  2UV8 G;  3UNY A;  2CXE A;  1HNW J;  3QBC A;  3OLB A;  3HVT B;  4LVN P;  2QA4 G;  4RW6 B;  1PC4 A;  2RDD A;  2HS3 A;  2YNF B;  4KFB B;  4C0O C;  2ZFH A;  3QT7 A;  3P96 A;  2C42 A;  1IR1 A;  4NLW A;  1LFW A;  3GU0 A;  4B02 A;  2JFD A;  2LQB A;  1TL7 A;  4JI7 J;  3QQC D;  2P9E A;  1JLE B;  1UFL A;  4IG3 A;  4S0M A;  3IR5 B;  2C1E B;  1SC1 B;  1SIW B;  2FZG B;  3MR7 A;  3DM2 A;  4OI1 A;  4K4W A;  4IQM A;  4ZLJ A;  4QIW D;  5CD4 A;  1CS4 A;  5E3R A;  4CO1 A;  3SSQ A;  3HK2 A;  2KRB A;  3TUI C;  3PO5 A;  1PYT A;  4DL7 A;  1YJT A;  1H0H B;  4JBC A;  5KFD A;  3A3N B;  3PNI A;  1HNX F;  3TNV A;  2GMH A;  4FBT A;  1HHQ A;  3BN4 A;  1S0N A;  1OQ6 A;  4ID5 A;  2A1B A;  4XDC A;  1JLQ B;  4LBI A;  4ECU A;  4QWB A;  5KTQ A;  1VJQ A;  4QIV A;  2BV3 A;  2H51 B;  4QIG A;  2B5J A;  4OZJ A;  3GSI A;  3OW2 R;  4PWD B;  4HAC B;  2DNP A;  3QAT A;  3QO9 B;  3VGV A;  3ZFV A;  1IKW B;  3TZZ A;  4DPU A;  3R97 A;  3AOA A;  4F26 A;  1Q8I A;  1KDN A;  3B4M A;  1UKU A;  3DXB A;  3ZZZ A;  5A2Q U;  4K4S A;  4DPY A;  1J27 A;  1RTD A;  5GAH U;  4TYA A;  3E01 B;  3Q8V A;  3AD9 C;  2MKK A;  4RW9 B;  1SUQ A;  3QT8 A;  4OZ0 A;  3M8S A;  3IM8 A;  1VJW A;  2FZK B;  4CP5 A;  3KLF A;  3GON A;  5IT9 Y;  3IRX A;  3C6T A;  2HHH J;  4ILM A;  3RAX A;  4DV2 F;  4U9R A;  1FRH A;  1NJZ A;  1ZM2 A;  4RW8 A;  1NU4 A;  1JJH A;  2RIL A;  3M7V A;  4C8M A;  3ZC4 A;  4IOC Q;  1RLD A;  1FRM A;  2WB1 D;  3MR2 A;  1FEH A;  4EU0 A;  3PYE A;  1U09 A;  4ELU A;  4DX6 A;  3SFU A;  4HDH A;  2DEI A;  1RT2 B;  4NXN F;  3MPW A;  3V81 A;  1PJ5 A;  1P6T A;  4NLY A;  3LGN A;  3NNC A;  2IM0 A;  4IOA Q;  2DHH A;  4LF4 F;  4LQ9 A;  1RBO B;  3DOM A;  5LT5 A;  5C7P A;  2AJ0 A;  1E6Y B;  1HWU A;  2OPQ A;  4IQX A;  4LMZ A;  4LSL A;  4RNH A;  2KJV A;  1I94 J;  2ZDO A;  4Y2K A;  2ZZM A;  5ETM A;  2R8J A;  3IA0 A;  5F3T A;  4QPT A;  1FA0 A;  3A13 A;  1FDA A;  1JNR B;  3K57 A;  2GVD B;  4QQB A;  4CYU A;  3MMJ A;  4A48 A;  1ZA2 B;  2AEF A;  5KFN A;  2RRB A;  2JNJ A;  1D1U A;  1VQP S;  1PYS B;  1JLF B;  4XIU A;  3T6J A;  3M05 A;  1YRX A;  1QM9 A;  3V6H A;  4F50 A;  4OHZ A;  1PJ7 A;  3PIP Q;  5EN1 A;  2KZM A;  2MZS A;  1S4E A;  3OBI A;  3T1A A;  5ADZ A;  1QVG R;  2FGO A;  3TWZ A;  2Z56 B;  3HMJ G;  1XWL A;  2XS7 A;  1VK8 A;  5E3Q A;  2QLJ B;  3PDN A;  1OO0 B;  4B3O A;  1TMM A;  3IS9 B;  2PA3 A;  1TFW A;  4TU7 A;  3CCW A;  3QT5 A;  1MN7 A;  3KLE B;  1K1Q A;  2VG7 A;  1Y4Z B;  1KOH A;  2HHQ A;  1TAU A;  1UVJ A;  2IJR A;  1VRT A;  4K2J A;  1U2F A;  2XYG B;  1MWY A;  2JC0 A;  4QR0 A;  1S6O A;  2OIH A;  1SKU B;  2FJV A;  3MD1 A;  3KLI B;  2W4C A;  4NLT A;  2DNH A;  4PXD A;  2HFS A;  1FJG F;  3GCX P;  1N6Q A;  1RT6 A;  3PHE A;  4M5M A;  1WSV A;  1NME B;  4LRD A;  2UZA A;  2J6T A;  3UVJ A;  5KOW A;  1T03 B;  4OHW A;  3PEJ A;  1B0P A;  2FHO B;  3R6G B;  3SMZ A;  4KO0 B;  4UY8 5;  2DRD A;  4OHV A;  1VIS A;  1R89 A;  3MOJ B;  4G1I A;  1Q8B A;  3Q8Y A;  1S1X B;  4PPD A;  1UP1 A;  1LWE B;  3VVU A;  1SPB P;  1NH8 A;  3DGV A;  1YJU A;  2ZH7 A;  4QWD A;  1TVR B;  2EBG A;  1TAQ A;  1WG1 A;  2QFJ A;  1PBA A;  3M1V B;  4KGV B;  4LBH A;  2JHE A;  1M5V C;  2RKI B;  3J7A N;  3KLG A;  4G1P A;  5CD4 H;  4I2Q B;  1KBR A;  3FEX B;  2YY3 A;  1DQA A;  1WDD A;  1U0S A;  1RKI A;  5AXK A;  4G1Q A;  4F04 B;  4MK8 A;  2CPI A;  2ZIT A;  4EO8 A;  4IFV A;  2KVI A;  1RT7 B;  2GMJ A;  5IV4 A;  4M5D A;  3W63 A;  4M8L A;  3EPG A;  1ZH5 A;  1T7P A;  3C15 A;  2YQ1 A;  2NXJ A;  4PYD A;  2J8S A;  1YI2 S;  2R2R A;  5IM0 B;  5G0R A;  1WOP A;  4K5R A;  2HBR B;  1NDK A;  4ZIT A;  2G1D A;  2LYV A;  4JYA F;  1TK0 A;  4WFX A;  4UUX A;  3EDR B;  4ZN3 A;  2BW7 A;  2N7C A;  4KGZ B;  1MLA A;  3QAU A;  3ZZU A;  3KLH A;  4DSE A;  2F8M A;  3I87 A;  2QL5 B;  4ZA1 A;  1S9E B;  3NY0 A;  1X4H A;  5C2G A;  3ZNU A;  2F4V J;  4ZN1 A;  4JI1 J;  2R7O A;  3HHD A;  3F41 A;  1Y3K A;  2FD2 A;  5LJ5 Y;  1IVZ A;  5HQ8 A;  2NR0 A;  1YK9 A;  3SDE A;  1IBK F;  1J5O A;  2BKO A;  2B4O A;  4ES1 A;  3VQS A;  3TX8 A;  3ZZR A;  4OQJ A;  4OZ3 A;  2BZ2 A;  2EEY A;  4R0E A;  3NGK A;  3UW1 A;  1WDT A;  2F9D A;  5A8K A;  4AL7 A;  4M5L A;  1Y5N B;  3HVT A;  1A6L A;  2V5H G;  4RW6 A;  4AXJ A;  1CLF A;  2YNF A;  1Q8K A;  1T9U A;  4KFB A;  2YTC A;  2GV1 A;  4O44 B;  4TY8 B;  3VF0 B;  3G82 B;  4UOC A;  1QY7 A;  3DRR B;  2CVE A;  4RPF A;  2O5D A;  2MEW A;  5DQG A;  4C8K A;  1VRQ C;  2UUT A;  1SQE A;  2UUA J;  5C5J A;  3QZ8 A;  2Q1L A;  4NI2 B;  3SFG A;  2KTQ A;  1AFI A;  4I56 A;  2DNQ A;  2QEX S;  3UR0 A;  2UXC F;  2C2E A;  3W66 A;  4C2M A;  1Q81 T;  1RUS A;  3CDB A;  3RR8 A;  2VFT A;  4Q2M A;  1KLN A;  3UN2 A;  5MLC V;  3RBD A;  3C16 A;  3SIP B;  3IBW A;  3K17 A;  4B9T A;  5KFR A;  2A6O A;  4O3P A;  5LOQ A;  1CJK B;  1VBK A;  1JLQ A;  4NYP A;  4DOZ A;  2Z4P A;  1WG5 A;  1Q78 A;  4QWA A;  2KO1 A;  3C46 A;  4WII A;  4PWD A;  1KLM B;  1C0T B;  2CQ3 A;  2YNI B;  3T6B A;  1M1H A;  3A8I A;  3A4T A;  4NLV A;  3PRB A;  3VAM A;  3QO9 A;  1IKW A;  1KN6 A;  2AEM A;  4QZV B;  4CLZ A;  2MXY A;  2L3M A;  4YY3 F;  4RJV A;  1O8B A;  3SCK E;  1RCX B;  3PW0 A;  1LW2 B;  4HYK A;  4GVB B;  4PAA A;  1S9G B;  3R5G A;  1EP4 B;  3B4D A;  1UCN A;  4QOT A;  3M8R A;  2EXU A;  2RSQ A;  2RVJ A;  4RW9 A;  4NPO A;  3FSI A;  1YRU A;  1B0T A;  3UE2 A;  4Y28 C;  2JLF A;  2Z8Q A;  3ENW A;  1CEZ A;  2KT3 A;  1UVM A;  7FD1 A;  2GO8 A;  4N8O A;  4TU9 A;  1SC3 B;  4DN9 A;  1FXL A;  4DL2 A;  3V4I B;  2BQ3 A;  2XS2 A;  4LRA A;  1NK9 A;  2VD3 A;  3CD6 S;  3RYL A;  1ZM4 A;  1TKD A;  3NLC A;  2BAC A;  5C2C A;  3THV A;  5AE2 A;  2XNR A;  3NP5 A;  4C4W A;  2KU7 A;  2IYG A;  1X5O A;  1T0T V;  2J0W A;  1G7C B;  5A6P A;  4C48 A;  4ZVE A;  2W24 A;  1E6Y A;  2VG5 B;  2ZVS A;  4JI4 J;  4DV1 F;  5BR8 J;  2HHV A;  2NCK L;  1VDH A;  5EDW A;  2NRE A;  1S99 A;  3TQ1 A;  1UZD A;  2Z0G A;  3S6E A;  4ZCM A;  1NRK A;  4F0K A;  2FYX A;  2B3T B;  2GVD A;  1FJ7 A;  3P8B B;  1RHM B;  2KDO A;  4F25 A;  4FDF A;  1F6T A;  3MMC A;  1QJH A;  5JUM A;  3MCS A;  2V0N A;  2YX4 A;  2Q3P A;  3PX4 A;  1JLF A;  3DMJ B;  3K89 A;  2B9E A;  4ALZ A;  4F02 A;  2JVR A;  5FDL B;  1WKK A;  3HSJ A;  2N4C A;  4LFA J;  4CLF A;  1RT3 B;  2ZBR A;  2JDJ A;  3ILI A;  2VBX A;  4CH7 A;  1UWB A;  1EB0 A;  3NOG A;  2VBW A;  1XN9 A;  4RW7 B;  3MR5 A;  1S0M A;  5J2N B;  3TZX A;  2MSS A;  2AJ2 A;  2MGZ B;  2O01 C;  1LXJ A;  4PUO A;  2OUG A;  3IS9 A;  2ZH2 A;  1WEX A;  3KLE A;  4HT5 A;  3RBZ A;  2PI4 A;  4DX5 A;  4F4X A;  4C3M A;  2J0Q D;  3FCV A;  1WF0 A;  1U1R A;  3WZ0 A;  2RQC A;  1WHX A;  4KSE B;  2M70 A;  2HHW A;  3CCS S;  3EGV A;  4RBT A;  4DR5 F;  3SV3 A;  1FFG B;  1HPZ B;  3BYR A;  3KG4 A;  4CLU A;  1UPP A;  4GKJ J;  3FQL A;  2CQD A;  3OXG A;  5HMZ A;  2ZUG A;  4ZMM A;  3PJX A;  4WZQ A;  1Y10 A;  4LQ3 A;  1SH0 A;  1TL5 A;  3MPV A;  1T03 A;  3JSM B;  2W9C B;  2PMW A;  2DB1 A;  3CJ8 A;  4KO0 A;  4MT1 A;  1DY3 A;  1DAR A;  1D9D A;  5L39 A;  2E9R X;  2DK2 A;  1S1X A;  3Q8Q B;  1VQ9 S;  1NCL A;  2RUS A;  3M8Q A;  1SJQ A;  1FX2 A;  1LWE A;  2ZH9 A;  4LFB F;  1HFE L;  2CDQ A;  2CJ9 A;  4I6A A;  4BCA A;  3GZ7 A;  2ZBI A;  2IM3 A;  4QU6 A;  4F4A A;  2V6A A;  5EX3 A;  1TVR A;  3MF5 A;  4R8U B;  1C4A A;  3R9L A;  4JI0 J;  3M1V A;  2J9D E;  3FMB A;  2RKI A;  3KHR A;  4I64 A;  2JLE A;  1FD2 A;  5H9E J;  3N5B A;  2QA1 A;  2C3P A;  3M6V A;  5DS7 A;  4OLP A;  4MIA A;  1NK4 A;  3BDE A;  4HLB A;  1DAX A;  3KDO A;  1LKZ A;  1K0V A;  2IA6 A;  3C14 A;  2UU9 F;  5BYS A;  1RT7 A;  2RAQ A;  5JMN A;  2QJ3 A;  3HF5 A;  1EKR A;  2DHA A;  2HAI A;  4DL6 A;  1FTR A;  4GVL A;  1TKX B;  1OPZ A;  4AUK A;  3PHT A;  4M1K A;  3WDO A;  2XLK A;  5IM0 A;  2PEH A;  4JOU A;  1GX5 A;  2AZ3 A;  5L8R C;  3MED A;  2KYZ A;  2XMT A;  2MLX A;  3B6B A;  1SB6 A;  1TU0 B;  3M8Z A;  2DHG A;  2VPW B;  4F8R A;  5J2M B;  2OEM A;  4JI8 F;  3N6L A;  2HBZ B;  3CCR S;  1S9E A;  2LU1 A;  1WF2 A;  3J7Y U;  1JXL A;  2RRN A;  3KXD A;  4LT6 A;  2H9Z A;  1Y5I B;  3IC1 A;  3TA2 A;  2VJV A;  3OT9 A;  2BBE A;  1OJ4 A;  3EVM A;  4MFB B;  1Y00 A;  2DHX A;  3M32 B;  4AL5 A;  3QJL A;  2Y9H A;  2A2C A;  2HLT A;  1HNV A;  1U1K A;  1EET B;  1UFK A;  4DFJ A;  3VAK A;  3NGU A;  4NOH A;  1S1V B;  2RIJ A;  2EK1 A;  3KHL A;  1FNM A;  3IP0 A;  4ZIW A;  3BPS P;  3EMT A;  3FGV A;  2KRR A;  4Y65 A;  4O44 A;  3EGN A;  3G82 A;  1AT1 B;  2GGP B;  3POT B;  4O3Q A;  3DRR A;  3GJR B;  5RUB A;  1R8H A;  3OVS A;  2OI2 A;  1H7X A;  1XR5 A;  2L08 A;  4NI2 A;  5CYJ A;  3M2U A;  2ZHB A;  2VDH A;  1Q79 A;  3MEC B;  2DIT A;  1R43 A;  2DCL A;  5DM7 Q;  2E66 A;  2ZJR Q;  3J7Z 5;  1RU1 A;  3LAN A;  4GKJ F;  3J7Y I;  4J9P A;  4DL5 A;  3OTC A;  3QGG A;  2R8G A;  1S76 D;  5F3Z A;  1CJK A;  3V6D B;  4B3S J;  1OY8 A;  2QC3 A;  4PXE A;  5AXN A;  3ILJ A;  4K4Z A;  4WZM A;  1KLM A;  2YNI A;  1TP7 A;  3O1L A;  4C0H A;  3TUP A;  3GJS B;  4RKU C;  2XY7 A;  3PYG A;  5T41 A;  4LJM A;  5AE3 A;  1LW2 A;  2QIF A;  3LP0 A;  1F0X A;  2LEB A;  7AT1 B;  4GC6 A;  4GVB A;  1NPK A;  1VQ5 S;  1HWJ A;  1S9G A;  3X1L B;  5F9L A;  2CPH A;  2C28 A;  3OTO F;  4HDG A;  4CLY A;  3H59 A;  4MYU A;  3PKM A;  4M5N A;  1ZS6 A;  2DBB A;  1FRX A;  4A8F A;  3PFO A;  3GV7 B;  3CE8 A;  2HQC A;  1EHW A;  2EG2 A;  4O4G B;  3OTD A;  1SJ4 P;  4IO9 Q;  3TX0 A;  2BE9 B;  4UF4 A;  1ZPW X;  5ETK A;  3ZTS A;  5H9E K;  1KEK A;  1X5T A;  1BWV A;  3H4B A;  2FZC B;  4QW8 A;  4WIQ A;  2XZD B;  1N32 F;  4IOB A;  1U1Q A;  4L3N A;  1N56 A;  3F44 A;  4GRS A;  3AFG A;  2VFU A;  2ZNY A;  3J7A 1;  3KK1 B;  1F2H A;  2V69 A;  4I69 A;  5IXU A;  4B3M F;  4B3R F;  4DX8 H;  1ROF A;  2IBK A;  2HFO A;  4DV3 J;  2RT3 A;  1P27 B;  2IDE A;  2V2V A;  4KH0 B;  2VG5 A;  4KKO B;  5D0H A;  2ZVI A;  2DGT A;  2C2O B;  2BKP A;  2DT9 A;  2DNG A;  2GQQ A;  4J9U E;  4USI A;  1X4G A;  1CC7 A;  2X3D A;  4B9L A;  5B0D A;  1U24 A;  4DR2 J;  1S79 A;  2MQN A;  4BS2 A;  2KHC A;  1TUG B;  2D74 B;  4XPC A;  2QMU B;  3EM1 A;  2Q66 A;  3GV8 B;  3FQK A;  3DMJ A;  2RF2 A;  4B3T F;  4NXM F;  1L3S A;  3BQ1 A;  5L1K A;  5FDL A;  1U0H B;  1VLY A;  5KFE A;  1N34 J;  1RT3 A;  1NHK L;  3AT1 B;  1VQN S;  3CJ4 A;  2XS5 A;  3DRS A;  5K20 B;  4GMK A;  4Q0B B;  2O1P A;  4OZN A;  4RW7 A;  2XLJ A;  1WOR A;  1JIH A;  5CZX A;  5J2N A;  1PCA A;  4L76 A;  2YKN B;  4G65 A;  3PFE A;  2PEB A;  4KTQ A;  4A8K A;  4M5I A;  5ETS A;  4KBI A;  2DXE A;  4F3Q A;  3LA0 A;  2XI3 A;  2W2P P;  1S6P A;  1NBE B;  1RWK B;  1V6H A;  1JJC B;  2L48 A;  2BJE A;  1AB8 A;  2GZO A;  3OVA A;  4HH1 A;  3TQE A;  3CCL S;  4WP9 A;  4YME A;  3TJ9 A;  1F9F A;  3TAR A;  2DRA A;  2Y8W A;  2CVI A;  3EZ5 A;  2K1R B;  2QA4 S;  1C2P A;  1KKH A;  5BYR A;  1HPZ A;  3LP1 B;  1T11 A;  4I67 A;  2WCX A;  1JKH B;  3NWG A;  5GAD U;  3PIO Q;  2JC1 A;  2P9G A;  5HSP A;  4CLW A;  2W2N P;  1M5H A;  5F8I A;  4OMF G;  5GMD A;  2DNL A;  3I32 A;  2KHD A;  3W62 A;  3WHI A;  2F40 A;  3BGR A;  4URQ U;  5CYM B;  2YKA A;  3QIP B;  2W7P A;  5LMN F;  4MKA A;  2AGO A;  1TFY A;  1TTH B;  4DLG A;  2LCW A;  2V8H A;  3CD0 A;  3PVX A;  3IGN A;  3OL9 A;  2ZWO A;  4DQR A;  1EJ7 L;  5F8G A;  2LEC A;  4LF5 J;  4R8U A;  2R7U A;  2P6S A;  3D3C J;  3ELH A;  3CME S;  3D7S B;  1B70 B;  2KKH A;  2VQF J;  2YH1 A;  1BY9 A;  4ILR A;  4F4Y A;  2E44 A;  3LWL A;  4A4J A;  4ED7 A;  2AP6 A;  3JB9 k;  1REG X;  2B4P A;  1HL6 A;  2ZHO A;  2VUG A;  3MEG B;  1NSP A;  4RNF A;  3MAH A;  3PR4 A;  2ATL A;  4KHR A;  2MHN A;  1VQ4 S;  4WWS A;  4X4O A;  3FBC A;  5F41 A;  1IBL J;  1IXK A;  2V63 A;  1MW7 A;  1MMD A;  1TL3 B;  2W7O A;  2CAD A;  3NEK A;  4HH0 A;  2VJU A;  3ZTP A;  1KFS A;  4HR2 A;  1TKX A;  5IC6 B;  2CPE A;  1TKT B;  4DL0 C;  4EBE A;  2Y1J A;  4LIW A;  1TZ0 A;  5GAD I;  1PAE X;  3AJ2 A;  1NK0 A;  3SSS A;  1R3N A;  1AFJ A;  1S1T B;  5ETQ A;  4PQA A;  2RHQ B;  3CO9 A;  3N28 A;  3H40 A;  2C2N A;  3G87 A;  2D3O R;  4ZDN A;  4IRD A;  5B0E A;  3T1Y J;  1ZM9 A;  4K4X A;  5J2M A;  1VQL S;  2BW2 A;  3U27 A;  3ZTQ A;  4F0H A;  2DCU B;  4WU2 A;  4K4V A;  4CI0 B;  3ZTR A;  1VMB A;  4HTJ A;  2HHX A;  4FYW B;  1TL1 B;  4OLO A;  4ZVP B;  1T05 A;  3U7J A;  1NSQ A;  1F5C A;  3BBB A;  4A8O A;  1NSA A;  4DS5 A;  1FRL A;  1HNI B;  4ZP7 A;  3CJQ A;  8ATC B;  4MFB A;  3W9H A;  3M32 A;  3R1H A;  2MZQ A;  1FCA A;  4MKB A;  1QTM A;  4DV5 F;  4YR3 A;  2JOQ A;  1VHF A;  5LXR A;  2XNQ A;  3NS7 B;  2XWY A;  1UA1 A;  3C19 A;  1EET A;  1XJW B;  2LFV A;  4OI0 A;  3JYT B;  1R31 A;  1S1V A;  3I0R B;  3I55 S;  1N48 A;  2VKR A;  4DR4 F;  3H7H B;  4OYI A;  2HVD A;  2G2O A;  4UZB A;  2KXH A;  1JK9 B;  4FVC A;  3S7R A;  1W26 A;  2IIH A;  3N6N A;  2GGP A;  3POT A;  1OY6 A;  2QGF B;  3MUM P;  5D4O A;  2G0J A;  1RWX B;  1MMN A;  3FSX A;  3CDU A;  4FF3 A;  2GHP A;  3D0H E;  3DLE B;  1HYS B;  3H5U A;  3CUL A;  3MEC A;  2H4Y B;  4C97 A;  3TA1 A;  1RA7 A;  4NRT A;  2W01 A;  4RL1 A;  4DQQ A;  1RAD B;  1JLC B;  2AIR B;  1MNE A;  4LF6 F;  2M8D B;  3A3P B;  4TU8 A;  4FYY B;  4WKY A;  3HPO A;  5DM6 Q;  2LQJ A;  5H1S V;  2QYG A;  3V6D A;  4H4O A;  2XZT B;  2R7T A;  4DR6 F;  5B0C A;  4DV0 J;  2FB0 A;  2MQM A;  1VIO A;  1RWW B;  4PQU B;  4U95 A;  1UAW A;  4Y2C A;  4BHQ A;  5BYQ A;  1K44 A;  5IS2 A;  3QWP A;  2AX0 A;  1HD1 A;  3G71 S;  3IXQ A;  2UUB J;  4OI2 A;  4O3R A;  4XDD A;  1K73 T;  2ZJQ Q;  2ZDP A;  1YBT A;  3BEG B;  1KQG B;  1NHU A;  2CPY A;  3BH6 B;  4RW4 B;  2E1C A;  3BO3 A;  3KTQ A;  2EFP A;  4JI5 F;  2VV5 A;  4O4G A;  3SEO A;  1T9T A;  4P7V A;  1N8R T;  3H42 A;  1NEE A;  4FF4 A;  5AXL A;  1SV5 B;  3TOQ A;  2A3J A;  2JRS A;  1L3U A;  4P2X A;  3N01 A;  5B0F A;  1RAJ A;  1Z4U A;  5KFH A;  2IVM A;  4Y2M A;  2FHM A;  4EMD A;  2FJX A;  5KT7 A;  4NLD A;  1SH3 A;  2GHW A;  2AYE A;  1YVF A;  1GQE A;  1R6Y A;  2EFV A;  2YQ0 A;  4LRB A;  1SC4 B;  4ZPT R;  5SUH A;  5I3P A;  2RH3 A;  1RAB B;  3QGP A;  4DSJ A;  4ZHR A;  2GO9 A;  4KKO A;  4Q8F A;  5HLF A;  4WBF A;  2FVS A;  3VGT A;  2E9T A;  1CQM A;  4JI3 J;  4JV1 A;  4WYW A;  4WXO A;  4J90 A;  3CO0 P;  3T1Y F;  1YIJ S;  4LF7 J;  4LF9 F;  1AXQ A;  2K06 A;  4DUY F;  3V6J A;  4DG1 A;  1VBY A;  1URN A;  2IC3 A;  4NYZ A;  2CRL A;  4NMX A;  2WAQ D;  2HVH A;  3WBZ A;  2R42 A;  1U0H A;  5M2U A;  1BLU A;  1UPM B;  4IDK B;  3IBC B;  2YQ3 A;  3I5B A;  3MPD A;  4ED8 A;  2K3K A;  3GJQ B;  2WOM B;  3F56 A;  1RWP B;  2OSQ A;  2CDR B;  4HHU A;  2FGC A;  1L3K A;  3ONQ A;  5D0G A;  1XK8 A;  1S7H A;  3MM5 B;  4ZJL A;  2YKN A;  2Y1R I;  4QJV A;  4K50 A;  1YG0 A;  1ZOT A;  3M8W A;  4LRC A;  4FXV A;  2C2R A;  3EVW A;  2D9P A;  4M5J A;  1L3T A;  2FHJ A;  2FUG 9;  2WBM A;  3O44 A;  4PR6 A;  2BJ8 A;  3W2W B;  1RTJ A;  4I6Y A;  4KT0 C;  2E1A A;  1IWA A;  2HGM A;  2HFV A;  3ZZ0 A;  2E5L F;  2QSW A;  4C8Y A;  2VPX B;  3I31 A;  2K1R A;  4MK9 A;  4ED0 A;  2GQ2 A;  3F73 A;  5ETV A;  3OUY B;  4J9Q A;  1SL1 A;  3K8W A;  4DSF A;  3CD7 A;  3RUB L;  3SCI E;  3LP1 A;  4EZ6 A;  2XQC A;  1LWC B;  4M95 A;  1JKH A;  1S6U A;  4KGM A;  3ICL A;  2QV6 A;  4M5H A;  4MK7 A;  5EWF A;  5KFG A;  3DLH A;  2F8H A;  3PRV A;  1QE1 B;  3TEH B;  4V1A k;  5HK4 A;  1OY9 A;  3K2Y A;  2KFY A;  2MKH A;  1JMT A;  4X64 J;  4IO1 A;  2M0G B;  4Z37 A;  2Y0B B;  3NBP B;  4NLR A;  2JFK A;  2FC8 A;  1S1U A;  3BR8 A;  4HT7 A;  5J2P A;  4USW A;  1R8C A;  3W60 A;  1PO6 A;  1YJV A;  2R7X A;  3OXL A;  2DVI A;  2C2M B;  1X9M A;  2V8D A;  1DLO B;  3GTY X;  1UEK A;  3T1H F;  1O6X A;  1QSL A;  1FXD A;  2R8I A;  3Q22 A;  1VQO S;  4BBY A;  2D3O 1;  1VBX A;  4JI6 J;  1QVF R;  3DU5 A;  5EWG A;  5L1I A;  3IR7 B;  1XQI A;  2H3E B;  5C42 B;  3QFH A;  1W25 A;  2M2B A;  3MEG A;  4RO0 A;  2NZC A;  4FKY A;  3BQ2 A;  4X4V A;  2Q6B A;  4ZPC A;  5DET A;  1APS A;  1Y5L B;  2XGP A;  2ASD A;  1TL3 A;  3N9U C;  1REV B;  4AFF A;  2ZEJ A;  4KRW A;  4EFA C;  1TKT A;  2MKI A;  3R1L A;  1FFS B;  1S77 D;  4MKY A;  4YDX A;  1XMO F;  2UVR A;  1S1T A;  4FXD A;  1RAI B;  4USH A;  3PJW A;  1YZ7 A;  1IUJ A;  2EFO A;  3OV7 A;  5IWA J;  4RU2 A;  1AUD A;  3PXG a;  3PR5 B;  1WD6 A;  2XZW A;  2X1F A;  2CQB A;  3IWL A;  1HQE A;  3DOK B;  1FJE B;  1ZM3 A;  1X4E A;  1T8E A;  5KT3 A;  3UDL A;  3UD4 P;  3RJM B;  3WC2 A;  4CM0 A;  2M5Y A;  4CQ1 A;  2PMZ D;  3RZA A;  4CO5 A;  2CJK A;  3A8K A;  3HI9 A;  4UQG A;  3V6K A;  3TVY A;  2FIU A;  3U1L A;  3LTO A;  1HNI A;  4WPA A;  5HBM B;  2FLL A;  2UXB J;  4HL9 A;  2YKP A;  2A2D A;  2YBV A;  3AJ1 A;  1OPI A;  2APO A;  4NX9 A;  2KG0 A;  4DUT A;  4O3N A;  3CJ5 A;  3JQK A;  1Z1Z A;  3SV4 A;  4BDP A;  3JYT A;  1N36 J;  4DFK A;  4DV7 J;  3I0R A;  1Q7Y T;  4HHJ A;  2XYP B;  2FVC A;  4YR2 A;  2W8L A;  3ILO A;  5J1E B;  1RHQ B;  1FHT A;  4ZPA A;  4DI6 A;  2YWW A;  2HGL A;  2MKJ A;  3HHE A;  1GMU A;  2H1Y A;  3KNG A;  3RAM A;  3HM9 A;  2V8G A;  3EIC A;  1KVK A;  5E5N A;  4IH5 A;  5ETR A;  4ECQ A;  5LM7 E;  2J7K A;  3SQG B;  4B9S A;  2VFS A;  3E8O A;  3HDS A;  1HI0 P;  1JLC A;  1YJN S;  3MOZ A;  1G4C A;  3CJ0 A;  1R0C B;  4A8M P;  3BGF A;  2BQU A;  2G1H A;  4Z7Y A;  2KZZ A;  3RRH A;  1Z2L A;  2V4J B;  2LVW A;  3AOC A;  3ZZO A;  2V50 A;  2C3Y A;  2N7Y A;  1I51 B;  4PQU A;  4YB7 A;  4QR2 A;  3OPK A;  2X1G A;  2GVZ B;  1N5Y B;  2QA2 A;  2PGC A;  1Q0N A;  3I82 A;  4YUD A;  1UET A;  1KFD A;  1SVD A;  4ZPD A;  1XER A;  2EKY A;  2HNZ A;  2NSC A;  1SKS A;  1QLN A;  2RD5 C;  3GWC A;  2IVF B;  1MU2 B;  2D3U A;  4GC7 A;  2AV5 A;  1WG4 A;  4LF1 A;  4Y2A A;  2VOD A;  4C11 A;  1IN0 A;  1Q16 B;  4O0N A;  5KFW A;  4PG5 A;  2HYI B;  3KHG A;  1HHT P;  5DDR C;  1KHW A;  1Y3J A;  3W3S A;  1SV5 A;  2FQQ B;  4AND A;  5E2Q A;  1HNX J;  1DHM A;  3BKT A;  4X65 F;  2HRY A;  5FJ4 A;  1RAO A;  4RUH A;  1HD0 A;  4JUZ A;  3CCE S;  2HNY A;  3FCH A;  3PAC A;  2OPP B;  3M8P A;  1GK8 A;  3ENV A;  1TQL A;  1HBN A;  5HVF A;  3GG0 A;  3NKY A;  4ZCL A;  3CSK A;  1MML A;  3TAQ A;  3QSI A;  3UN5 A;  1EZZ B;  2ROE A;  1N52 B;  4ZLP A;  3DRY A;  3W2V B;  4CO0 A;  1NH7 A;  4OFZ A;  1JXV A;  1JLB B;  4TVA B;  2EBE A;  3DRP B;  2EKN A;  3IAM 9;  1EQM A;  3P3D A;  4P10 A;  3KG0 A;  1QUV A;  4I7F B;  5L1J A;  1WHW A;  2IRX A;  4JP8 A;  2NUU G;  1H7W A;  5IFM A;  4FBU A;  5JVG Q;  5DGA A;  2RU9 A;  4DXL A;  3L9Z A;  2VZ9 A;  4LR7 A;  5E41 A;  2AW0 A;  2D41 A;  4HKQ A;  1FVS A;  1AZS B;  1RAE B;  2WOM A;  2Z2M A;  1FI4 A;  5J1N A;  2BJ1 A;  2VBZ A;  3G96 A;  3CVK A;  4GKK F;  2FY8 A;  4JV5 F;  2M88 A;  1FRK A;  3MM5 A;  1WEY A;  3FSY A;  2X1B A;  4ECV A;  4NXN J;  4OZ1 A;  1MRO B;  3GYG A;  2IM1 A;  2EW9 A;  2OGU A;  3TZY A;  4LF4 J;  2H5J B;  1U2R A;  5T14 A;  3BSO A;  3NXZ A;  4I1T A;  2Z58 B;  2LDI A;  3KOA A;  2E5H A;  3MGJ A;  3PKY A;  2ZBP A;  3FEZ A;  4X4R A;  3OUY A;  4C8O A;  3M30 B;  5U47 A;  1LWC A;  4TLQ A;  2MQL A;  2OEL A;  4EK2 A;  3CDE A;  1L5U A;  5E0O A;  1X0P A;  2OPS B;  3FK4 A;  1W2I A;  2CJQ A;  1YBU A;  1QE1 A;  1SBR A;  2YPZ A;  1FKA F;  1S7I A;  2ROG A;  3MDF A;  3GQC A;  1MSW D;  3W9I A;  3NBP A;  3UN3 A;  2ADC A;  1H38 A;  3DLK B;  4LUB A;  2WSE C;  4X2B A;  5CYQ B;  2Y3Y A;  4FS1 A;  3N0V A;  3PEH A;  4I2P B;  4ES2 A;  4C6A A;  2P5V A;  3CJK A;  4ZVO B;  1RYR A;  3PCO B;  3D66 A;  1VI7 A;  3RRG A;  4BC7 A;  4CO4 A;  2CQ1 A;  2F1F A;  1RBA A;  2M4M A;  5KT6 A;  3US5 A;  4EGL A;  1RTH B;  1OIA A;  2VQE F;  1RA6 A;  4UUW A;  4J9M A;  1T9W A;  1R8A A;  4O0I A;  2WVF A;  3P45 B;  4HI1 A;  1X4B A;  1WWH A;  5DGB A;  2UV8 A;  4FNI A;  4ECZ A;  5HJY A;  5HAT A;  4JV0 A;  3R7S B;  2RU3 A;  3E3X A;  2ZKU A;  5C42 A;  2I0X A;  4URS A;  2DYA A;  3VHQ A;  1FER A;  4KHM A;  3GP9 A;  2GFF A;  4DZ6 A;  1C0U B;  1FES A;  1FJG J;  2LQ5 A;  2NXC A;  2YNG B;  3QSY B;  4AL6 A;  2CNL B;  3EXC X;  1BQX A;  1REV A;  3LPY A;  2LDY A;  1Y11 A;  3MMB B;  4F0M A;  2PFD A;  2YWE A;  3QRQ A;  4CNY A;  2AZ1 A;  2IM2 A;  2FHK A;  1K1S A;  4AT1 B;  2RDI A;  1HR0 F;  1VQ7 S;  3DLG B;  4X62 F;  2VPZ B;  2IPO B;  3UDC A;  1P8G A;  3HT0 A;  2XB2 D;  2BR0 A;  2OD6 A;  2B56 A;  5KG1 A;  1VQ8 S;  4ZVH A;  2PDA A;  2ZKT A;  5HVH A;  5B08 A;  1IBC B;  1U7L A;  4XTT A;  4USM A;  1RIS A;  4UST A;  1JJ4 A;  3OTB A;  1U1M A;  3DOK A;  5E33 A;  1RAC B;  1R0B G;  2O67 A;  2IVY A;  1HHS A;  5I3U A;  4H4M B;  2HHU A;  4QR1 A;  3TW0 A;  2IAJ B;  2GJF A;  4H54 A;  5ETT A;  5KOX A;  5EUH A;  1TMJ A;  1RGV A;  2Z2Y B;  1VQ6 S;  3W8G A;  4ZVS B;  2K7K A;  2ZZT A;  1TEL A;  5HBM A;  1X4C A;  5DDO C;  3I0S B;  1URR A;  3CW2 C;  4OX7 A;  2BJD A;  2BXJ A;  1XTZ A;  4CNZ A;  2B7C B;  2FPH X;  2IDL A;  2VKZ G;  3GV5 B;  3BGO P;  4DMZ A;  1RWM B;  2HUR A;  3D6H B;  2XCP A;  3H5X A;  3T41 A;  4QWE A;  2FLN A;  2CQC A;  5HMY A;  2OJ3 A; 
#chains in the Genus database with same CATH homology
 2XM3 A;  2VJU A;  2A6O A;  2VHG A;  2VIC A;  2F4F A;  4ER8 A;  2XMA A;  2F5G A;  2VIH A;  2FYX A;  2EC2 A;  2A6M A;  2VJV A;  2XO6 A;  2XQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...