2A6OA

Crystal structure of the ishp608 transposase in complex with stem-loop dna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
AVLYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIENQQNSNRPKQKEKWKSYVDNLQTKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*CP*CP*CP*TP*AP*GP*CP*TP*TP*TP*AP*GP*CP*TP*AP*TP*GP*
publication title Active site sharing and subterminal hairpin recognition in a new class of DNA transposases.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 45
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2a6oA00
2VHGA 2XM3A 2A6OA 2VIHA 4ER8A 2F5GA 2EC2A 2XMAA 2FYXA 2VJVA 2XO6A 2F4FA 2VICA 2VJUA 2A6MA 2XQCA
chains in the Genus database with same CATH superfamily
4RW9A 3KK2A 2JOQA 4ITSA 3RAXA 2XMTA 3MM6A 2VA3A 2HHPA 4Y2MA 1LOUA 2ZBPA 2B4UA 2JEIA 2YKOA 5H9EK 3UR3C 1S72S 3R5JB 4DR7J 4NXMF 1YQHA 1VYAA 4MKYA 1HA1A 4NEZA 2ADCA 3KLHB 3GIJA 2RQKA 1KC8T 4HH1A 4FYXB 5CZVA 5GMDA 2KG0A 4ZPVR 4DN0A 1UW9A 4LVNP 4AQYF 3RJMB 3QZ8A 2B9YA 2AWZA 2W25A 2DIVA 1PJ5A 4QQBA 5D4LA 3OJUA 4NI2A 4NLUA 4RU9A 2HNZB 3JXOA 2PA8D 4YMEA 1VQ4S 3W5YA 1HWJA 4FVMA 2R7QA 1H6KX 5C25A 4UUXA 3EXYA 2CNNB 2I9SA 2CJQA 2CQPA 5DLGA 1S1WA 1UA0A 1FHTA 5DQIA 2V9WA 4EZ6A 4Q2LA 1HQEA 1DTQA 1Q7YT 1R0CB 1HBOA 5BYRA 2H4YB 4A8MP 3MMBB 1YHQS 2XLIA 3KLVA 2KFNA 1H3DA 2KHDA 4DCOB 3JB9k 1S1VA 4DV4F 2XLJA 2M8DB 2QYCA 4HHHA 1PJ7A 1D3WA 1NKBA 5F3ZA 2DT9A 2KT2A 2J6SA 4WP8A 1NK7A 3FFIB 3ZNUA 2K3KA 4J9OA 2CA9A 3DOLA 2VZ9A 4K5SA 1LV5A 2N4DA 1TU0B 3SFUA 4DFMA 2C2RA 3G82B 2E5GA 2JNJA 4M5KA 3MZIA 1YZ7A 3GJSB 3TANA 3QPIA 2ZM6F 2ZBIA 2QT7A 3UDLA 2YBVA 3TX0A 1AT1B 1F9EB 5C7PA 1LK7A 3EDQB 1F9HA 2IA6A 1UJ6A 2GW8A 1MWZA 2FJAB 3CJ0A 2MQNA 2XWXA 3M2VA 4F8RA 2G1DA 3RG6A 2DGOA 2DH8A 3DLBA 3J81U 4V19X 4KGZB 1M5OC 4NLTA 3QJPA 1RWOB 1RAEB 2F5GA 4IR9A 3D6TB 2V8VA 2W1BA 1TFYA 1WHVA 1C1BB 2J9DE 4RUBA 2BW7A 1Q53A 4DLGA 4LRAA 2WVFA 2EC2A 4FF1A 2V69A 2IY5B 2VD3A 1IBMJ 3POTA 1FXLA 2B8PA 5GAGI 1HI8A 5ETPA 3OXFA 2VQFJ 4RW6B 1YRXA 1RT7A 1XTZA 2L48A 4P2MA 4FS1A 3PXGa 4QIEA 3AOAA 3S7RA 1RISA 4PPDA 3V6DA 2IM0A 3D0HE 4BHQA 2YVSA 2BJ8A 3KJVB 5AJ3F 2Z2MA 4I1TA 1SBRA 2B4OA 3R5GA 3R6GB 5FD1A 2ADBA 2IRUA 1TUGB 4E98A 1T9TA 2XNRA 1JLBB 4LR9A 2RS8A 4TN2A 4WBFA 4DPWA 2GZOA 3FMBA 1JLQB 2EK6A 4LMZA 3TJAA 1K1SA 3GYGA 1FKOB 4C3KA 3MWBA 3CDBA 4JI1F 3TA1A 4LUBA 4QWEA 4UTGA 1VBZA 3IAS9 3MPYA 4S0MA 2CWKA 3Q23A 2YH0A 1S1UA 5CYMB 2CQDA 4IOBA 3V6KA 4I67A 1SB6A 5HVGA 2DCLA 3QIDA 3G4SS 3J7ZT 1VI7A 4G6VB 2D3OR 2DB1A 3HHLA 3K2YA 1YITS 5KFOA 1Q1KA 2AX1A 2HFZA 2Q79A 2VC1A 3BR8A 3JTNA 2ZUGA 4Q2MA 4I0WA 3HF5A 4F3QA 3TX8A 3V4MA 3BBCA 3HVWA 4RNHA 2QX0A 4HACB 4HKQA 2DYAA 3LGMA 3QZ7A 2JFDA 3NLCA 4E0DA 4CO0A 1R43A 1TVRA 1VRUB 4K4VA 1O6XA 3MR6A 2B6AB 1PKUA 3LPYA 3R2CJ 4NLSA 5KG1A 3KK3A 1F5BA 3VAIA 4RUHA 3HT0A 1RB0A 2HKEA 1NHVA 3UW1A 4OZ2A 4ZVEA 3W2WB 1HNIB 4ILMA 3JS9A 4FP9A 2CPHA 3ITHA 3HHKA 4W4MA 1HWLA 2I0XA 3BF4A 3IG1A 2IVFB 4NA2A 4PUOB 2ROGA 3H98A 3EZUA 1REVB 2RJZA 2HNYA 3WQPA 4CLTA 1TKDA 2QG9B 2D7SA 4Z37A 1N0UA 2BV3A 1AFJA 2YY3A 1N5TA 4DCJB 2GMLA 2J0SD 3UCZP 4DX8H 1RT4B 1MN7A 2E1CA 3UNGC 1JQGA 4MKAA 2W2NP 4I69A 4OJHA 2Y1LB 4WU3A 3PY8A 5CABA 1RTJB 4DV7J 3HSZA 1YJ7A 4NXNF 2V50A 1XMBA 3PEHA 4O4RA 4LRDA 4TU9A 2ZEJA 2CNKB 2NXJA 3M7VA 1HR0J 5GAHU 4BDPA 3W5ZA 2XG8A 1JXVA 3MPWA 1S0MA 3PCOB 1BMQB 3OV7A 2MJNA 4P52A 2W2QP 4TQSA 3Q0AA 4M5JA 2HK2A 3NS5A 4K0KJ 2HHUA 5I3UB 3CUNA 1OS5A 2QLXA 3QFWA 2GMHA 4PG5A 4F7VA 3QT5A 1EB0A 2B9WA 2PA3A 1UVMA 2L9WA 2W4CA 1MLAA 3UE2A 5JJBA 1UL3A 2YX4A 3EGZA 3DRPB 3OT9A 5J2PB 3L4BC 4C8YA 4DFPA 3SCIE 1FNOA 2Z2ZA 4DR2J 4FZVA 4X2BA 3OL9A 1WC5A 4CCHA 1IUJA 4MK7A 3M6UA 2B7BB 4B3MJ 1JLCA 3R7SB 4OYWA 5LMNJ 1G2EA 3FSXA 3FQKA 5A8KB 3Q8SB 4MFBB 4DPYA 4RW9B 1V5IB 3MM6B 3GSDA 3I56S 2XQCA 3GWCA 1JLEA 1M5HA 2DR6A 2KHCA 1FESA 3FDSA 3LQVA 2M4MA 2H5EA 5E2QA 1BQNA 2B5JA 4Y2AA 4N41A 3E3XA 3BH7B 4R5PB 5HQ8A 2C42A 1L3VA 5KFFA 4KBIA 5T14A 3WHIA 2H5JB 3V4IB 3I0RA 2AIRB 1T3OA 4IOCQ 2KH9A 2W8KA 3E01B 3MMAA 2XO7A 2X1GA 3W65A 1Y7PA 1SH2A 5HK4A 4PXCA 3PIPQ 4NI2B 5LOQA 4K7QA 3RBZA 1LWEA 2HHTA 3DLLQ 2P5VA 5FDLA 1FVQA 2BUNA 3LH2S 4MJKA 3QFHA 2VICA 5D4PA 3HHDA 1WTFA 4LQ3A 3AH6A 3WDOA 3UR0A 2JLEA 5LT5A 4LSZB 5C25B 1BQMA 4Q43A 3ETMA 1FTCA 2P9GA 2KM8B 1SKRA 2VPXB 4DL7A 4ZIWA 2V94A 4EUVA 2ZOMA 4A48A 1S1WB 2QC3A 2Q6CA 3TUZC 1F5CA 1HYSB 1K73T 2E5LJ 1APSA 1HQEB 2VB6A 2YQ3A 1GMWD 1DTQB 3QWPA 3IAM9 2EFVA 2ZWOA 1HMVB 1ZPWX 1HBOB 3HKWA 1ZPVA 1RKIA 4F67A 2OEJA 4IH6A 2VIHA 3PIOQ 5KFHA 1QSYA 2QO3A 4CLYA 1H0HB 1TKTA 5KT7A 3VAHA 2V4JA 4KTQA 1RCXB 5CHCB 4NE9C 2GAHC 3NOCA 3CJ2A 1NK0A 3TW0A 2YWEA 1A9NB 1QLNA 3QBCA 3AT1B 2CPXA 3DOLB 5JVHQ 4U8YA 5KOWA 4FYDA 1YBTA 1VHIA 1FWPA 4OZ0A 2DCUB 2OD4A 4IYQA 1G3OA 3ZZZA 3JYTA 2BABA 5D4OA 4YY3F 4ECVA 3ZZOA 4DQQA 3HSGA 1NB7A 2BE9B 1ZZFA 2AJQA 2GO9A 3TQEA 4RNNA 4DR4F 4BLGA 1HBNA 2XY7A 1UKUA 4B9SA 5KTQA 5HBMB 2GIQA 2DGWA 4PKDB 1QAYA 2W2OP 3U27A 2BKPA 2NXEA 1RI7A 1NDLA 2W9BB 4JI2F 1O8BA 2R7RA 4KB7A 2ZH7A 2C2NA 3VAMA 4OI6A 5KFIA 1ZAXA 2QLJB 2VJUA 2WVBA 4PQUA 3BGRA 1HNWJ 3HJFA 1TL1B 2ZHOA 2PMZD 1GK8A 1X8DA 3DHWC 4OLOA 3PR5B 2HLTA 2LQ8A 3FRZA 2PFFB 4DV5J 4USVA 1VIOA 1FD2A 1YK9A 3POTB 3ENWA 4M5IA 1NZ8A 4URSA 5LMUF 3H2LA 2WVEA 5FLXY 2ZH9A 4KRWA 1CULA 2RS2A 3LTOA 1H38A 3OTOF 2EBEA 3NRBA 3NAHA 3B78A 3V6DB 2QRRA 2FHKA 3Q2TC 3EGWB 3MR7A 1NJWA 2DHSA 2WSCC 3NNHA 3RW6A 1CVJA 3EZOA 3GYNA 5H9FK 2G4BA 2ZBCA 1PG5B 2FTRA 2HRYA 2JJ4D 2XLKA 4DMZA 1P9QC 4LSNB 2HHVA 4B3SJ 2Q66A 3NP5A 1CS4A 4CO1A 2QA1A 2FB0A 1L3TA 4DHVA 1RT5A 3M8WA 1RADB 1P27B 1KP6A 3N5FA 4M8LA 1M1HA 2DNLA 1UFLA 1K44A 3OW2R 1CJKA 2V0NA 1WG1A 2W8LA 3JAMU 4IG3B 4A8YA 4ECZA 1YJNS 3VZHA 2GGPA 1FJEB 1GAOA 4L6V3 2W7PA 1U7LA 2B56A 3LAMA 4OHWA 4ANCA 2HRUA 3KTQA 4EYIB 5HVFA 2QTWA 1RT2A 3MAAA 4DU7A 3CXCR 3CCMS 5DJBA 4P7VA 2VH7A 4IO1A 3K5PA 3P5BP 4UZBA 4LSLA 3ULHA 3I31A 2HVZA 5F0UA 1XN9A 4YEAA 4G1QA 5G4DA 5KFLA 3T1AA 5CYJA 3GJQB 1JWWA 2FIUA 2MHNA 1JK9B 2R8IA 2LVWA 1UTAA 4WE1A 4IRKA 5L46A 3KK3B 3SZ2A 2BJ7A 3J80Y 3JQJA 2KT3A 4I4BA 2CZVC 1RWPB 4ZPBA 2QSFA 2GV1A 3J7AN 4NL5A 4X4RA 2WBRA 3ITHB 2NUHA 4ZS6A 2VQEJ 1X0FA 2XSJA 4RX6A 3NGUA 2J8SA 3IG1B 4ILRA 1QAJA 1B7FA 3G96A 4ZP6A 1RHRB 4OYIA 2MLZA 3AD8C 2HNYB 3OL6A 3BBFA 2DXFA 5E7OB 2HZVA 1EKSA 1BXNA 2MSSA 1FA0A 1NM2A 1CQNA 3OL8A 2FHJA 1NPKA 4LIWA 2DIUA 2FVQA 4QWAA 2VFRA 1FRLA 3HK2A 3QJLA 4KV8A 3C15A 1N36J 1IR1A 3PJ9A 4JYAJ 5J2MA 1HNXJ 1PC4A 2DNZA 4DUYF 1GX6A 2OPPB 1JJHA 1S6QB 2H5IB 1NKCA 3F0NA 2XGPA 1VLOA 2EBGA 4CT9A 2WCXA 4PXEA 1DFDA 3VGSA 2RNEA 1HD0A 3D0IE 4RUCA 2ATLA 1AUSL 2HRTA 1JJCB 5DM6Q 1QSSA 2AYMA 4C0BA 5F8JA 4RPFA 2MKYA 2UU9J 4CM0A 4JP8A 5FJ4A 1IKVA 2CQBA 3W9HA 4L75A 3QO9B 4PABA 2CQIA 1W2IA 3MCMA 3OTCA 4USUA 1IBLJ 4ZPDA 4OI0A 1T9YA 5KG3A 3LWMA 1VQKS 3BDEA 2G13A 3VVUA 1XMQF 3KNGA 1WNEA 5G0RA 3D9BA 3PW4A 3PJXA 4Y34A 4AE5A 5DGBA 5HROA 1U1NA 3UI3A 4WXOA 1YJ9S 1JLCB 5GMKa 4DZDA 2R2UA 1U1QA 4EGLA 4IRDA 3UN3A 3DMJA 1XEZA 2LECA 2GHWA 2BMBA 3VVTA 1P6TA 2PI5A 1JLEB 4DPXA 3OSPA 3L3CA 1S77D 3GR0A 3QJJA 1XNRF 2I5JA 1BQNB 2C1EB 3SSQA 3U1LA 4HHJA 3W8PA 5L1LA 3I0RB 4Q7AA 3DI6A 2CQ2A 4K4XA 1V5VA 1Q78A 3MMAB 4ZK7M 4CLLA 1NHUA 3TR5A 5ETSA 2UUBF 1LWEB 1KOHA 1AZSA 2UP1A 2EEYA 4G1IA 2V4QA 1Y9OA 5LJ5Y 3H20A 2E29A 4HTIA 2YTCA 1N5SA 1FNXH 5BYSA 5D0EA 4TQRA 3MD1A 2L9DA 2QLFB 4C2MA 1JLFA 3VAJA 1K1QA 4DOZA 3BJYA 4OYBA 3E8OA 4DR3F 2YNIB 4JBCA 2V67A 3M9NB 2NYHA 2VASA 4MK9A 1NK5A 2YPZA 3SSSA 3ICLA 4DV0J 3OFHA 4OI4A 3ONQA 1WHWA 3L7OA 1TKTB 1M5SA 1QE1A 2V4JB 1L3SA 3KUHA 2HLUA 4HVZA 1Q8BA 4GKKJ 5B0FA 4EK2A 1NPRA 2FLNA 4KAIA 2EG1A 1R8HA 4Y2CA 3CCJS 4B9UA 3MEGA 1IWAA 4LBIA 5B0DA 4CH0S 1VQYA 5DETA 4X4QA 2ZD1B 2M5YA 4ED4A 3LPEA 1RWXB 1HQUA 3W66A 3I6PA 4CI0B 1K0TA 1U48A 1GMVA 5DQHA 4ANDA 2DITA 2QLWA 1ACMB 2O01C 2XS7A 4PEOA 2FJVA 2OLWA 1S4EA 4CO5A 1ZETA 1LFPA 2R7TA 1S57A 2FLPA 1K0VA 2H1YA 2LYVA 4ED3A 4OHXA 2DR5A 1Y00A 3PYEA 5A8RA 1CBKA 1VQNS 2JC0A 4C9DA 1U24A 2NSBA 3T9NA 2UV8G 3G6VA 2ZHBA 2HHHF 4PQUB 3BGRB 1KD1T 3OFFA 1N32F 1WF1A 2BEFA 2VFTA 2CJYB 4OZNA 4YB1P 1W25A 1U25A 5DRKA 3MGJA 1KNZA 1UWBB 4JI6F 4JI8J 2VF3A 5KFEA 2MJUA 2R4FA 1TL7A 1Y4ZB 5K20B 5IZHA 5LSOA 1CULB 1J5EJ 3HXMA 4FYWB 2J6TA 3I87A 4A8XA 1B3TA 2GMJA 3W9IA 1X9SA 1DJ0A 2XO6A 1JIHA 1HHSA 4JV0A 2FHOB 2K06A 3KUEA 2HBZB 4GO5X 4LF9F 3H2UB 2KFYA 4NCGB 3A8EA 2VBWA 4LF5F 3U1MA 1J2VA 4M1KA 2MDAA 4EBCA 2AQ4A 3KHHA 3OFEA 3L9ZA 2ZBQA 5KT5A 2YKAA 4DL6A 2Q6BA 1NSKL 1S9GB 1M90T 1NK6A 1PSDA 4C0HA 2WVCA 5D78A 5J1NA 4KHMA 3FQLA 2AMCB 3H4BA 3M8QA 3VQSA 3GG1A 3V81A 1NLKL 4OX6A 2P9EA 3OVAA 2ROPA 4QYZJ 5HVHA 1CJKB 1X9WA 3QATA 2GQCA 4WZMA 3M30A 1IWGA 3MUTP 2CVEA 1PAEX 2YQ1A 2HWTA 2KL8A 2BVZA 2RB7A 2NXNA 5KG6A 1X31C 4BBYA 3TAQA 1FX4A 4NOHA 4DL5A 1T3NA 4I56A 4J9UE 5C2CA 2HK3A 1WOPA 5HQLA 2DNYA 4FBTA 4WCEQ 4OZ1A 3GJRB 1I1GA 2W9CA 2CG4A 3NNCA 1TL5A 4OZ3A 4ZIVA 3IN5A 2QMWA 3T1YJ 1DARA 2MLXA 5IQ6A 4WE1B 1WHXA 3WZ0A 4K2JA 4J9NA 2AP6A 5BR8J 3N79A 3T9ZA 1U1PA 4URQU 5E3CA 3BSCA 2MLYA 1OJ4A 4JI5J 1FKPB 1S6PA 2PI4A 5J1PA 5E5NA 2C28A 5L8RC 5HAOA 2YQ0A 2AU0A 1AFIA 3B4DA 4C7QA 1RAIB 2XMVA 5LL6d 2OGUA 2HBYB 3BN7A 3VGVA 4YP3A 2PEHA 1RU1A 2B43A 1RHKB 2IM1A 1SC4B 2Y0BB 4KV8B 2HZAA 3C15B 5KFGA 2CQ3A 3H59A 3CMES 3RB6A 2LQBA 1NHKL 3SIPB 4KHPF 1GH8A 5K14B 2VG7B 4YHHF 1VBYA 1OYEA 2B8QA 3PDNA 3W7BA 4IG0A 2M2BA 3KFWX 1FFSB 2QN6B 1B0PA 1DTTB 3BEGB 4F26A 1WSRA 4P73A 4HLBA 2U1AA 3GFYA 3IS9A 3NEKA 2WSFC 5CCLA 3HD1A 5EX3A 3TJ8A 4DR6J 2FJXA 2LFVA 3DU5A 2MKKA 4I2QA 1DLOA 1SJ4P 4B3TF 2C2DA 1IKVB 1RABB 5I42A 4DF4A 1M1GA 4O0IA 2JRSA 2C2MB 4O4GB 4HDHA 4AUKA 3M8ZA 4F3MA 1AYEA 1D1UA 4UQTA 2XCAA 3IRXB 4E2FB 2KVQE 1NK9A 2FDNA 2HFUA 4I7FB 3W62A 1RK8A 4DG1A 1FE0A 1EX8A 2RHSB 4K8RA 4EO6A 5HROB 1FK9B 4M5GA 2AKWB 2IHR1 2F40A 4CH7A 3T5HA 3HZEA 1H2UX 3CCSS 4P9SA 3DMJB 4H4MA 4RNOA 2ATCB 2K1RB 1U1RA 3IWNC 1FDAA 3HDSA 5CQGA 1NZAA 1Q8KA 3BPDA 2HG4A 3EX7B 2P8IA 3IWLA 2FD2A 2J76E 3KK1B 2E1MC 2VU5A 3N9UC 2RRAA 1SUQB 3JSBA 2YKMA 4DWIA 3VQTA 3GTYX 3ZZPA 2HHWA 3ET6A 2F65A 3F44A 3GFXA 2ZC3A 1KTVA 3AFGA 4Y2IA 4HI2A 4IQXA 1ZM9A 4WP9A 4MK8A 2F8EX 2XYPB 1PBUA 5D0RA 5D6GA 5KFUA 1KS2A 4RJVA 4UOGA 4PRFA 3KKFA 2F4VF 3TYTA 5CD4H 3HD2A 3IA0A 1WKKA 1X0PA 3RR8A 5F3TA 3Q86A 4IUFA 3GCWP 3IR7B 4GVBA 3SQOP 2XZTB 1FE4A 4M5DA 2EPIA 4ECTA 1U09A 2ROEA 3C19A 2XGQA 4P2XA 1FWLA 5DLFA 2GJFA 7AT1B 3SBMA 1KVKA 2FJWA 3RYLA 1AROP 1Q5VA 2VONA 2ALZA 4DF8A 3M6XA 2WONA 5J2NB 1CJVA 2Y1IA 3AJ1A 2GCFA 4PG7A 2R8GA 4L76A 2Y9HA 3IM8A 4CM2A 3M32A 1U8SA 4X66F 2YNGA 2RDDA 3DOKB 5A6PA 3EE3A 4DV2F 1QE1B 1GT8A 3FEYB 3PNIA 4KPCA 3G8TA 3M2RA 2IMOA 3DRSB 4ICLA 4K5RA 4K4ZA 3GFZA 3OR2B 5IV4A 4F0MA 5M2RA 4F04B 1LWXA 4CH1A 1TR0A 2CPFA 3KLFB 4K4UA 4P72A 1RGVA 1HQUB 4JI0F 4Q8FA 2QSWA 2QA4G 4NPOA 3FCVA 4ED8A 5ETMA 5CAAA 2ZKUA 2EFOA 2ACMA 3IBFB 3J81Y 4LIRA 3BSOA 4MIWA 2YWKA 2EWHA 3E51A 5A8RB 3E2EA 4NA3A 4B9NA 3CD7A 3M4XA 3DGPA 1U0HA 3UCGA 3IR5B 2E44A 1T9XA 3TNVA 3FK4A 1N6QB 2CQHA 3TARA 1M0SA 2ZJQQ 4PYAA 2AGPA 3CNQP 3LGHA 4U95A 1JMTA 4MIBA 4JI4J 1SIZA 5KOXA 1HQ2A 3IFEA 4K4SA 2QJ3A 2A6MA 1TL7B 4WZQA 2LEBA 4DZ6A 2WK4A 2GNKA 2IVMA 2OHDA 2N82B 3D0GE 3GR1A 4DR5F 2KJVA 5L1IA 3T1HF 2FVSA 4TNOA 2QMXA 2ZH2A 3CCVS 3JQKA 2P2CB 1Z1ZA 1WUUA 3GPAA 4QIGA 1T03A 3VGUA 2WZ1A 1NJXA 4NZ7A 2CADA 4H4OB 3ZXWA 2ZOGA 1ZA2B 2VG5A 3EZ5A 4ZVPB 4YDDB 2DRBA 3TRGA 5AXNA 3GIRA 2WTFA 2E5HA 2XI3A 3DFEA 2HS4A 4ZVSB 5C42A 4WJBA 3RZAA 3DDKA 4KKOB 4WU2A 4A4JA 3PO4A 2A0FB 3SV3A 3N6NA 2IJRA 3AJDA 1UETA 1J5OA 4HHUA 3V81B 4DSIA 4CTAA 2XMKA 4Q0BA 4WFZA 1YBAA 3RAQA 1BGXT 2D9PA 3LANA 2XY6A 2DBBA 1X4EA 5KFYA 1WG4A 4RKUC 2MQQA 1URRA 5D0HA 3K5NA 4WYWA 1Q4RA 2PE8A 1HW9A 5DDQC 2HS0A 5L1JA 2RILA 2Z56B 4ATNA 3IBCB 4L73A 2IFXA 1S99A 4IOAQ 4JUZA 2W9CB 2E5IA 2W7AA 4RW7A 1PGZA 1IKXA 1TUWA 4ENOA 2Z2LA 3C66A 3R5AA 4DL0C 1X4DA 2VOOA 1D8ZA 4KC5A 1X4CA 3GYXB 4C11A 1H98A 2J7WA 3ILIA 5K5MA 1HNZJ 1VQSA 3V6JA 6FDRA 3OR1B 4WF9Q 5EWGA 3HHNB 2AJFE 3KOAA 1LW0A 2YWFA 1ZOTA 7FD1A 2CQ1A 4J5OA 1Z4UA 3W63A 2J9EA 3W8GA 2PD1A 2W01A 2V8DA 1S6PB 1VC0A 2M88A 1F9FA 2EVZA 4X64J 3I9V9 1MW7A 3U1NA 3GB0A 3EWGA 4W98A 1JLGA 4U96A 4YB6A 5LM7E 2ZNYA 4OZLA 3M8SA 2QL9B 5C24A 3K57A 3AODA 4JV5J 1ZTWA 1R3NA 2OTLS 3S1TA 1OYDA 3VHQA 2PMHA 2CNOB 2YX7A 4RUAA 2P6TA 2DNQA 4Y0FA 3BBBA 1BC6A 5A0YA 1WC4A 5GAEU 1SJQA 4MYUA 1FRKA 4TY8A 4UOFA 1YWXA 2BE7D 3BS9A 5HJXA 4UQGA 4RW4A 1TMJA 4F4XA 4LF6F 4RR5A 4KO0A 1QUVA 1G4CA 4EYHB 3PYFA 2R42A 2D9OA 1S6UA 2CQ4A 4IG0B 4F25A 5L38A 1HBMA 4QU6A 4KGKA 1LXNA 4C8MA 1Q82T 4WFYA 2IAJA 4OLPA 3AOCA 2CPDA 2DGUA 3TVZA 4IH7A 1XK8A 1YVFA 3R2DJ 1YDLA 4LF7J 1P1TA 3IS9B 3DLHA 3L7PA 5LJ3Y 4I2QB 1DLOB 3HLUA 4LR8A 5IM0A 3K7RA 4P74A 4QWCA 5KFMA 5M2PA 2J0QD 5DQGA 2GAGC 1FVSA 1ZM2A 1VQOS 4ED2A 3CD5A 3IRWP 3GIMA 2FVRA 1EP4A 3QRRA 4X65J 3HCXA 2LQJA 3CDUA 4DG1B 3CD6S 2G2ZA 5ADZA 2XHCA 5D77A 1SC3B 2GQ2A 1QSLA 3MCOA 4UW2A 2QLBB 3S8SA 4LF2A 2PEBA 4N47A 4H4MB 1RLDA 4YFUA 3NMAA 1HI1A 2OSRA 1FF2A 5F9NA 2UUCF 1YGYA 2UUAJ 4Y65A 5AXLA 5KT3A 4DV3F 2UXBJ 4DUZJ 4ED1A 3CDEA 2DISA 2YKMB 1NNDA 3PEJA 1FT8A 5HQMA 3ET6B 2HGLA 4G65A 4KGMA 4O3NA 1TUVA 1IVZA 4YS2A 4O3QA 2YNFB 2D3O1 4ZPWR 3HKZD 4B9MA 3PW2A 1VISA 3MECB 5D3GA 2ZH8A 2HQGA 5KFKA 5KG0A 2IM2A 1S1TA 3OVSA 1H2VZ 4N7TA 2DR9A 2DO0A 2WSEC 4CRJA 2BRLA 1TKXA 2ZWPA 2OPSA 3V5RA 3D6MB 4M5DB 1U47A 4L72B 5IXUA 4R8UA 1M5PC 3ZTSA 2RDIA 1C0TA 5KFDA 3EYZA 2MY7A 4NLYA 3CGIA 4GKKF 1C4AA 3D1HA 4WKYA 2WB4A 4Y3CA 2BACA 1CJVB 3D68A 5GAHI 1LQ9A 2XI2A 2KYZA 4QU7A 3W3SA 1QAXA 4DCPB 3G2XA 2YNGB 4GC6A 2KZZA 1YJTA 4PG4A 2BQRA 2QGFB 3L95X 4P6QA 4ICLB 1N8RT 1WELA 3NBPB 3AB2B 4USMA 4NXMJ 2VBYA 4WXWA 3QIPB 2GX8A 3FGVA 1IR2A 4ELVA 2DJWA 1B99A 4NLPA 4PWUA 1OQ6A 4KSEB 3MM9A 3SYZA 4OZ5A 4AQYJ 2WOMA 1NU4A 2DNNA 3GE9A 2AW0A 2X1FA 2AV5A 3D2WA 4FF3A 1IN0A 4QIFA 4OQJA 4QR1A 3TUPA 4ZVTB 9RUBA 2ALYB 2F8MA 5AT1B 2CQCA 1D9DA 1OY9A 2DRDA 1SL0A 3U7JA 4LRBA 3DGPB 2DNRA 1XNQF 1WEXA 3H5SA 2D74B 1R6VA 1C1CA 3KLIA 2KRRA 5KFAA 2V68A 1WC3A 4BC9A 4L3NA 2NS1B 3M05A 4FN5A 2R8KA 3CCZA 2PDAA 4F0KA 4ED0A 2F9JA 2WW8A 4F2RA 3T41A 2MZSA 1WJ9A 2LA4A 4DV4J 1M5KC 4J9KA 1BE4A 2OEMA 3ZTQA 2HFOA 3UD5A 1D0EA 3BO4A 2ASDA 2AX0A 5HP1A 4ZJOA 5EGYA 2HS3A 1BLUA 4YUDA 4WIQA 3QQCD 2XWYA 3NY0A 4DI6A 4F4YA 2V63A 3DDIA 4BC7A 3K8VA 1CJUA 4RL1A 4MKVA 2MGZB 1XR6A 4CO4A 8RUCA 5F8HA 1HW8A 3RW7A 2RKIA 1Q0NA 1RT1A 4TYBA 4DX6A 1J5OB 2HHXA 2AHOB 4K2XA 3KHGA 3JAMY 1W2BR 2DPIA 4HTJA 4W92B 1PYOB 2HMIB 1S79A 5CYQA 3NCPA 4W90B 2V34A 4LF4F 3Q8UA 5DGAA 1QM9A 2HFVA 4KH0B 1OIAA 3KHRA 4IDKA 5K8MA 1U8WA 1F2GA 2BJ9A 5KFZA 4NYZA 1U6FA 3PZPA 1T02A 1I94F 4C8LA 5JXSA 4QYZK 4QPXA 3C6UA 3QGIA 1SKWA 1DHMA 1VRTA 5D4NA 1IKXB 3QAUA 2KM8C 5EX0A 4XO0A 2KJWA 3H5UA 4LFCF 4JI5F 1RU2A 1S7IA 1UFWA 3NGDA 1IKYB 1RTHA 4C11B 1M5VC 1NK8A 2FJBB 1MMLA 2CDQA 2ACYA 4M5NA 1X5OA 3SCKE 4OI1A 1CEZA 2LU1A 1LW0B 2G2YA 3NCRA 4ZLJA 5KFSA 4A47A 2ZH3A 2DGXA 3CIMA 4PG6A 1JLGB 1VOMA 3D5MA 4AL7A 4O3OA 5C24B 1V3ZA 3KG4A 2FUG9 2UXCJ 4BWJA 1RWNB 7FDRA 1UPPA 3IM9A 1YBUA 4XDDA 1VJQA 1QTNB 4J37A 5A0YB 4B9TA 3I96A 2AJ4A 2RF2A 2CQGA 3MAHA 5EDWA 4B3RF 4ZN1A 3RRHA 1GEHA 2XTJP 4MH8A 4KO0B 4CZCA 5AXKA 1HPZB 1RHMB 4L3KA 2OSQA 4RBVA 2OUGA 3GP9A 3RBDA 4HYKA 1BWEA 2GFFA 1X60A 3AD9C 5LSRA 2H51B 3DGVA 2BXJA 2IAJB 1RAGB 1LW2A 3D1QA 2BANB 2DGQA 3IGNA 1YX2A 1RJJA 4GMKA 1SV5A 4NCAA 3DYAA 5IM0B 1SKUB 5LXRA 3TZXA 4CNZA 4ZVUB 2CRLA 4EMDA 2IRYA 1JXEA 1HNVA 5AE3A 3K17A 4I6YA 4O3SA 1O0PA 5A76A 2OPQB 2GJIA 3I5BA 1ZBTA 1S10A 4TLQA 1EP4B 2ZH1A 1NSAA 3BKUA 2MQOA 3D66A 2L9NA 3PYDA 2DNKA 4U67Q 2NYIA 2FGOA 4LRFA 4MKBA 2AYEA 3HMJG 1WOOA 2W7OA 2GHVC 2W4PA 1N34J 4D3GA 2PMWA 3A4TA 2DRAA 4C97A 4M63A 2P9CA 4UOCA 4RNFA 2C3UA 2BJDA 2FYXA 3R1HA 1UVJA 3O8WA 2DR7A 1E6YA 4ZN3A 4G3IA 2IIHA 4GKJJ 3D3CJ 4HT7A 4ER8A 1S9EA 4CLKA 1JLAA 5MAOA 3M6VA 1N5YB 2IC3A 4UY8T 3FBBA 4NYPA 4C3MA 1UA1A 3GLJA 3B8HA 3VGTA 1N0VC 3ZTRA 1S6OA 2ZH6A 5H1SV 4FKYA 1WC1A 1U49A 2VKZG 3H40A 2H48B 2QZ8A 2Z4PA 1U1KA 3BV8A 1S5ZA 2XYHB 1FJGJ 2OFHX 4Y28C 3ENAA 2D41A 3R5BA 1TKXB 2E66A 1B0TA 2F3JA 2OPSB 4CWBA 2VG6B 4EZ9A 2YX1A 3FMWA 1ZZNA 2KU7A 2XHWA 4ZCLA 4YOEA 3P3DA 3M8PB 3O6QA 3BB5A 4C8KA 2F4FA 4KJIA 1NMEB 2F9DA 2HQ3A 4FYVB 5IV3A 2GA7A 3WX4A 1KQKA 3BO3A 3ZFVA 1KWMA 2RU3A 2KVIA 1IQZA 3UN2A 3CCRS 4DSFA 2DH9A 4Z7CA 1RWWB 3DDNA 4AL6A 2K8GA 1Q5YA 1YI2S 1R27B 2J8AA 4K4WA 3R7NB 2V2ZA 3ILLA 2XCPA 3F56A 2UXDF 1RAOA 4IFYA 3HFKA 4GVLA 3EPGA 2XY5A 1HLWA 2J6UA 5KFQA 4Z2XA 4OX9F 1Q81T 2A10A 4KH1B 4ZLLA 3IGVA 1TKZA 2C2EA 2ZZTA 3SFGA 5IT4A 1OSCA 2AEMA 1FXDA 2J0XA 2CXEA 3DRRB 2L3MA 4JI4F 2KZMA 1B4SA 1MU2B 1YRTA 1JJ4A 4ZP7A 2JC1A 3Q8QB 2ZZMA 3MMBA 4G1PA 3KLGA 1S0VA 5ETTA 2AYGA 8AT1B 2HVEA 3R3TA 4U6PA 2R2RA 2Z58B 1C1CB 4DSLA 2FQQB 4ELUA 1U1OA 2Z30B 2I2YA 2ILZA 2GVDA 3KLIB 3KK2B 3PX6A 1FRIA 2DEIA 3MD3A 3R7BB 3H5YA 4HR2A 3PX4A 1RWUA 3MTJA 2MZJA 3VCDA 5CH7B 2XEXA 1Q16B 1VGYA 3BGFA 2BJ1A 3CC4S 2RSQA 3J7A1 3CCLS 4HL9A 4N8OA 3BQ2A 5B08A 1W26A 1Y11A 4UZCA 3R5CA 3H2VE 5HP1B 3KXDA 2GS8A 3HPOA 5F8GA 1NUEA 2C3PA 4ZJQA 3CJQA 1CJUB 4YY3J 2PFDA 3R8YA 1WD6A 5DZ7A 4NZ0A 3FSIA 1FKAF 3NMRA 2G0JA 5SZTA 3G8QA 4DR4J 3OBIA 3P45B 2XYGB 1FDBA 2CJBA 5ETVA 4WP3A 3THTA 1RACB 3J7YI 5H9FJ 3K5OA 1EQMA 1H74A 4URGA 3CW2C 3ZZUA 4H4KC 4N5SA 5AE1A 4PXDA 1YLXA 2ZJPQ 4JI2J 1FCAA 5CYQB 1S12A 2V5HG 3QT6A 5IWAF 2XMJA 4I6AA 4IDKB 1S0OA 4HEA9 1V3RA 3A8IA 1YG0A 3IC1A 3TP2A 2ASYA 2AD9A 3O2IA 4NZ6A 4NRUA 5I3QA 3NGRA 5CZXA 4CLZA 1SC1B 5IQQA 2BRKA 2NPFA 2RMLA 3BDPA 3I5CA 1WDDA 1Q79A 3MM7A 1S1VB 2UV8A 2ZNZA 4Q8EA 3PFEA 1QTMA 4X4OA 2E7VA 2XMAA 3C6UB 1C4CA 1QUPA 1Q7LB 5LMUJ 3PW7A 1X4HA 3W2VA 1JLBA 2VBXA 4C3LA 4LBHA 2W4DA 3CMQA 1KLMA 4EU0A 3OTOJ 4D3HA 4LF8F 1JLQA 1CC7A 2F1FA 4X64F 3Q24A 3PR4A 4OJ1A 3ZZRA 1CG2A 2JX2A 4PAAA 1Y5IB 1N54B 1MNEA 1H2TZ 3OTDA 3CJRA 2QIFA 2KRBA 4ERDA 3CE8A 1WACA 3KNAA 1RKJA 1KTQA 3OPKA 2J0WA 1BY9A 1Y10A 3M2VB 1X5TA 1CC8A 1KHWA 3GV7B 4JV1A 2POKA 4ES2A 2DY9A 1YJUA 1S1XA 1PILA 4CP5A 5HMWA 1PCAA 3PHTA 1NJIT 2Z2YB 5ETKA 4YQWA 4F0HA 4ECUA 1NPPA 3WC2A 4LFAF 1JB0C 2RF2B 2UUTA 2E7WA 5L9NA 1N33F 4B17A 2R8HA 1EKRA 4HACA 3KWMA 3GMGA 2AGQA 4OIXA 4NX9A 2OTJS 2B0GA 4CO3A 1F60B 3ISNC 2B6AA 1UWAA 2MQMA 1SVDA 1RT7B 4OFZA 3D6HB 5I4MA 4CLWA 1WDTA 1LW2B 4DV1J 2MKCA 3CJ8A 1SV5B 2FVPA 4OI2A 3DYAB 1DAXA 2ZDPA 1XIQA 2DNMA 3BH6B 4QCLA 5SUHA 4CQ1A 2HEKA 3TI0A 2JLGA 1OY8A 3BYRA 2NSCA 3CTRA 3K58A 1ELOA 2WB1D 5DDOC 3BR9A 1VK3A 4IH5A 3N6LA 3PYGA 2YNHA 3CDWA 1WOSA 3H90A 1VQLS 2HGNA 3F73A 4PWDA 4KT0C 2RQMA 3A8KA 4FNHA 4JI7F 4J90A 1RT4A 4QW9A 2RRBA 2E1AA 4M5HA 3QT7A 3LALA 3RAMA 2DHXA 1P9YA 4ECYA 1RTJA 1LWFA 2QV6A 1ZS6A 2RHQB 3RTVA 1S1UB 4DV6F 3NWGA 5FIIA 3FCHA 3NGKA 3MUMP 3QMQA 1X7VA 1E6YB 2DNOA 3HHLB 2MQPA 3MPUB 1X5SA 1FJCA 5DDRC 5I3UA 1NH7A 1S9EB 3MAQA 1R8AA 3X1LB 2FLOA 4DUYJ 3NL0A 4R0JA 2IC3B 2MZRA 2ZBRA 2VODA 4DS5A 4IKAA 2APOA 2CAJA 3BSAA 1I51B 5AE2A 3UNYA 3TZYA 5EWFA 2BBEA 2COLA 1TVRB 2F63A 5KT6A 3QYYA 3Q8PB 4RNMA 4ED5A 5BJRA 2KT5A 2R9LA 3R6LB 4WFXA 1R8PA 1DBDA 3R9LA 3AA8A 1TK0A 3M8RA 3Q8RB 1HHTP 4USKA 5A8KA 2KB2A 2R7WA 3LUYA 2XC9A 5B0AA 4MFBA 5B09A 4IR1A 5A8WA 5IOLA 4DS4A 1VQMS 2FZCB 3H7HB 1XMQJ 1F5AA 3CCUS 3G86A 2RT3A 3LP1A 1NRKA 1UW4A 2MSTA 1VQ7S 3MR2A 3ZO7A 1VQPS 3AB4B 3OHBA 1RBAA 5BXIA 4BS2A 4R5PA 2K2PA 1F3VA 2N7YA 4X4TA 3H4DA 1RZMA 3V4IA 2Y3YA 5HO4A 2RAQA 4X4UA 4F2SA 1AXQA 3W1YC 3AXKA 3E01A 4KIAA 3W61A 4IFYB 5KFBA 1XNRJ 2VKRA 1S59A 2FPHX 4DDFA 5L1KA 2DO4A 1U2CA 2NQPA 4EFAC 1B70B 3Q8YA 3J81j 2GO8A 2E5JA 1JJ2R 2OMLA 3N4WA 4FXDA 4PR6A 1TKZB 3UD4P 2Y0SD 1WKLA 4NLGA 3DLKA 1QY7A 3QGGA 2ZFHA 3DU6A 5KG4A 4TYAA 2UUBJ 3B4MA 4R0EA 3ZZTA 2I1RA 1NBEB 5IFMA 1HYSA 5KAKA 1RQ0A 2FLLA 3I82A 1OPIA 5T41A 3D6FB 3C16A 1VQ8S 3CJ5A 1HMVA 2JVRA 3EMTA 3DLGA 1J27A 2IJFA 1I6JA 2AEJA 4XAKA 2ZHAA 3KLGB 1UJ4A 4DR7F 3M1VA 3LP0A 2ZITA 2EKNA 1S76D 1GMWA 2PSZA 4DR3J 4JB8B 1X4GA 2LEPA 2CDRB 1T11A 2YKNA 2GVDB 1SH3A 3MF5A 3WC0A 3THVA 4DSJA 4KFBA 2DGSA 3RRGA 4LFBJ 5HSPA 4ECSA 1LKZA 1V3SA 3HVAA 2B5JB 1RSCA 2C2ZB 5KT4A 3UCUP 4OYXA 3ETOA 1KHVA 4ZOSA 1ROFA 1L5UA 4FPRA 5D8HB 1N52B 5E33A 4Y2KA 2VFUA 1PYTA 1QJHA 2XB2D 3EXCX 5HBMA 2MYFA 3OJSA 5ETQA 3LGNA 3MI7X 4KGXB 1AW0A 1RT3A 4C0OC 4ZCKA 1HBUA 2G0CA 3PG9A 4RLEA 2W9BA 4CLFA 1JNZB 1GMUA 1WWHA 5FDLB 1WEZA 4QIVA 3MFIA 3OQ2A 5MLCV 3N0VA 1RP5A 3FBFA 5HATA 3FCWA 1TL1A 4F02A 2QFIA 3PTWA 1BQMB 3HVTA 4ELTA 1H72C 4LT6A 1MMDA 1FFWB 3LO3A 3DCAA 1NDCA 4OMFG 3CWJA 2HAFA 4U7CA 3V6HA 1C0UA 1KKHA 1T05A 4IFVA 2G0IA 2HHHJ 3JTPA 4NLWA 2EFGA 1N32J 1UEVA 1TELA 5B0BA 1UJ5A 2V8HA 1IQTA 3RB4A 1CQMA 3VF0B 1Y0HA 2HFSA 3MM7B 4JI6J 2MXYA 1A6LA 2XS5A 2A18A 3Q22A 3A13A 3W2VB 5KFXA 2P6SA 2KKHA 4J7CA 1UCNA 2NUUG 1KLMB 1YRUA 3FBEA 3KHLA 1GXLA 1TAQA 4PWWA 4LSNA 1U6BA 4OYZA 1GNKA 1VDHA 5E3AA 3SCJE 1HD1A 1IM4A 1S97A 3WX8A 3JYTB 1O51A 3P8BB 1T9UA 4R25A 4LF9J 2JEJA 3LW5C 2UXCF 2LQ9A 3ISND 3A3PB 4LF5J 2OJ3A 2K3IA 2MY8A 5K8PA 1SXLA 1HBNB 3P5TL 2VDIA 3AJ2A 2MHEA 2AZ3A 4UY85 4A46A 4XIUA 4IG3A 3S01A 1ZAVA 2VC0A 1IBMF 3MEKA 1JXLA 1IBKJ 3EVWA 4P75A 1S1XB 3WBZA 2FJDB 3PRDA 3QAEA 2VQFF 2MKJA 3SQGA 1DQ9A 2HQFA 4GRSA 1PO6A 4ES3A 1UPMB 2DHAA 4M5MA 3W9JA 4TLRA 2HQCA 2E9TA 4MAKA 2OP5A 2NPIA 4FXVA 1M1KT 2HNDA 3OTBA 3SEOA 1RBLA 3R5DA 3HZGA 2Y1RI 1KFDA 2BE2A 3ADAC 1CSJA 4QPTA 3W64A 3GIKA 2ABYA 3PO5A 5F9LA 5GADU 4NLOA 2F8HA 1N34F 1U4BA 2GHPA 4ZVOB 1WHYA 3IR6B 2ZE2A 4EBEA 4YN3B 1VR6A 2QL7B 2VOPA 1G6BA 4CDIA 4KHRA 2YNHB 4XPEA 2R7UA 1R0BG 4HDGA 3NAIA 1RTZA 4PWDB 2I38A 1CS4B 4O23A 2JL9A 2NZCA 1SL1A 5KFPA 4GKJF 1G1XA 2M7SA 3QLHA 1RT5B 3ISZA 2DR8A 4OJ3A 1AUDA 2E1RA 3D4JA 5A2QU 1LWFB 2OPPA 1S6QA 4ZP9A 2UVWA 1KN6A 3TAMA 1FFGB 3GJTB 2GGPB 1SJFA 5E3RA 2N4CA 1RT2B 3MAAB 1VCTA 1FJGF 2GJ2A 4KHPJ 2CFXA 4YDXA 4ZLPA 4ZA1A 4YHHJ 3QO9A 4LSLB 3VZIA 3THPA 3T19A 5BYQA 1EETA 1U2FA 3MMJA 2R2TA 4FVCA 1H7WA 2DGVA 4G1QB 5IC4B 4MIAA 1SH0A 3AY0A 1S7HA 1NK4A 1V6HA 2KTQA 4UUWA 3ZZYA 2UUWA 4Y6IA 3MM8A 2HQDA 4EEYA 1Z2ZA 3OXGA 4B3TJ 2FHMA 1DQAA 3AQOA 5GAEI 2CIMA 3KDOA 3DNCA 5A8WB 1KVIA 2XSJB 2YWGA 4X84A 2FHJD 3CJSA 3LP1B 4DV7F 2WBMA 3F41A 4F36A 1U1LA 4JI3J 2CJXB 3FZ2A 1HR0F 1VC6A 2RD5C 4J9SA 2DY1A 2IBOA 5IT9Y 1FDDA 2X1BA 3B54A 4H4KA 4K0KF 4DXLA 2EFQA 5J2MB 4KPYA 4ZKAA 2E9ZA 2KI2A 3SDEA 2BR0A 4DR1J 3DM2A 2AJ2A 2CZ9A 4WIIA 1NEEA 4NEYA 3VAGA 2CVIA 3Q83A 4DSEA 5HI7A 1IJFB 4DR2F 2ILYA 4P10A 5F8LA 3BQ0A 2JDJA 2J9CA 4B3MF 2OO4A 2W9AA 3PKMA 4K4TA 2B9XA 5LMNF 3DLKB 3I32A 4J9RA 1RLCL 1GXTA 1U1MA 3OVBA 3T5JA 2YNIA 5HJYA 4GC7A 3SV4A 2LXIA 2F4VJ 2J7KA 3MOZA 3DOMA 3NS6A 2G2OA 3C16B 2O3DA 3DLGB 3O3LA 2XZWA 3TUJC 3WIUA 3N5BA 1P1LA 2FJEB 2RDJA 1S49A 4C98A 5G0RB 2HVHA 1F0XA 3GSIA 5LSLA 5C2GA 2GVZA 3CO0P 2V2VA 3M1VB 3LP0B 3HFVA 1U2RA 3KDNA 4ILLA 4ECRA 4U7UD 1JX4A 2KXNB 3EJMA 2YKNB 4CYUA 5I3PA 2R7XA 2CZ4A 1UVKA 4O3PA 1WSVA 3DKDA 2KYXA 2H4WB 1RYRA 4FPIA 4KFBB 1HWKA 4X66J 2ZD1A 1R8BA 2MKIA 2CPZA 1KQFB 3SI8A 4FYYB 2I5JB 1ULRA 3PFOA 4DV2J 5KFWA 1DQ8A 4DSKA 4QWDA 3EUNA 1X9MA 2KDOA 2IA0A 1L3KA 3DI6B 2HAIA 4F4KA 2OIHA 3H42A 3PJWA 1RT3B 1SIWB 4ZVQB 3K0JA 1HBUB 3UD3P 1GXUA 3IXQA 4NCBA 3MEEA 5B7WA 3CCES 4JI0J 1AZSB 5DZ6A 3N6MA 3OFGA 1NDKA 3CMAS 2E5LF 3RR7A 3MXHP 1PJ6A 3QNWB 2BW2A 2B4PA 3T6BA 4JV2A 3B6BA 5LXYA 2HBRB 1UMJA 2LEAA 3HVTB 1UWBA 4A8SA 2BQ3A 1JLFB 1NB2A 1NKEA 1EAYC 2LU2A 2X1AA 2QYGA 2RQCA 1TV6A 1SI9A 4NA1A 5U47A 1C0UB 1R31A 2RQ4A 3CCQS 1T05B 2Z57B 4IFVB 2ZH5A 1NH8A 1P8GA 1UVLA 5E3QA 3AA9A 1WF2A 2V2QA 4P71A 1YTYA 1RHJB 2NXCA 1RAHB 2YH1A 2YPYA 4UT4A 1SJ1A 1VK8A 4NCGA 3OL7A 2W2PP 4N56A 1RA6A 3HI9A 5GAGU 4DR5J 2J5AA 2XNQA 4O3RA 3NNAA 2JFKA 4Q5VA 1NXIA 1UZHA 4X4NA 3T1HJ 3TVKA 1ZH5A 3MEGB 1S9GA 2MZTA 1TMMA 4LVOP 1R89A 2VPWB 2LP4A 3SCLE 1RDRA 2CJKA 2IMWP 2MQ8A 4WFAQ 4QZVB 2BOAA 4RW8A 1GTHA 2CJAA 2G9OA 1RTDA 2H54B 1ZTTA 5F8IA 5RUBA 4WTOB 1S48A 1KDNA 2VFVA 1HNWF 4FF4A 1FEEA 2Q3PA 4DV5F 5J1EA 3KG0A 2QL5B 4F50A 1QD1A 2O1PA 1R6YA 2F7VA 4TY9A 4C8NA 1A7GE 4PYDA 4XTTA 2U2FA 2IVYA 3FRYA 2JSXA 4CLPA 5HN0A 5IS2A 3SQGB 3I5AA 5DG7A 1LFWA 2HW3A 4AXIA 4OL8A 2OEKA 4DV1F 1XQIA 5F0WA 2YWWA 1GQEA 3MR3A 1UAWA 3TOQA 3K8WA 4AD6A 5KFVA 4J9VA 5DDPC 3AXMA 3GILA 4M94A 3MUVP 2DXDA 2HNDB 4E8UA 1CJTA 3DHXA 2YWHA 4FF2A 2HURA 1WG5A 3LAKA 4C8ZA 3FSYA 1WI6A 3RGIA 2BE2B 2W24A 3BPSP 2E1PA 1U0SA 5HMXA 1XBWA 1RBOB 1CPZA 3NOGA 3HP6A 4B3SF 1DZ5A 2WVDA 2HIQA 4QJVA 4F4ZA 5F8NA 1GTEA 2R2SA 1RWVB 2ZDOA 4ZMMA 5AXMA 2LQ5A 1R7IA 1VHFA 3RU0A 1FKPA 1L3UA 2ZE2B 2DD8S 2OAUA 3GONA 4MYTA 1VBXA 1Q8IA 4DPUA 5KG7A 2XS2A 4WPAA 3DXSX 2OD6A 4IQMA 1OY6A 2UZAA 2B51A 1E6VA 4FBUA 1NDPA 2Q43A 3UDVA 1HARA 4L74A 1I3OB 2EFNA 3QLHB 3KG1A 1FX2A 3M8QB 1EJ7L 3CCTA 5K14A 1SCJB 2VG7A 3QRPA 3M30B 1F1BB 1VC5A 3EICA 3ENQA 2E9RX 3TAMB 4WFBQ 4TU8A 2MZ1A 1OQ3A 1UVIA 4X4PA 3OSNA 3A3OB 3CVKA 1DTTA 1PAUB 2KFZA 3BKTA 4MTPA 3ZTPA 2EK1A 3FEXB 4ZJLA 2IYIA 2HGMA 4CIOA 1HFEL 2MZQA 4AT1B 4LF6J 3NCQA 2AEFA 3A8JA 4WFNQ 2IRXA 5EN1A 1EETB 1YKWA 3PVXA 2V6AA 5K8NA 4O4GA 2VQEF 2UVRA 3CULA 3ILOA 4B02A 3IRXA 3ZTOA 4CT8A 4I7FA 3NWRA 1ICEB 1RE1B 3DC2A 1XWLA 4X62J 2C3YA 3MM8B 4WTYA 1VLYA 1IBCB 1SC6A 1Q8LA 1FK9A 1FEHA 3C6TA 3M8YA 2Q1LA 1TZ0A 2B4VA 5KG5A 4OYMA 1Y3KA 2RE1A 4U9RA 2W2MP 2AZ1A 5A6WA 1N36F 2V2KA 2K1RA 3M9OB 5CA5A 1OSDA 4JYAF 1X4FA 1HNXF 4KR0B 3P6YC 2X7IA 3BZQA 4QBUA 3Q8VA 4ZVFA 3KK1A 1FNMA 3AAWB 2J7UA 3ZC4A 1LWCA 1FXRA 1SUQA 5B0GA 1ITPA 5E3PA 3MCSA 2XM3A 3S6EA 2VJVA 4TKTA 1XR7A 2B9EA 2DVIA 3MM5A 4K4YA 3FJ2A 3VR1A 4ALZA 2UUCJ 2FZGB 3GV5B 1YJRA 2UU9F 2HQIA 1WF0A 2K7JA 4DV3J 2LCWA 5J2QA 3SDEB 4ED6A 2BJEA 3DM2B 3HJVA 4OHYA 2I6WA 1IBLF 4RZRA 2C3OA 5ETOA 3R97A 3BGUA 2BX6A 2WAQD 3TA0A 1FRMA 4RWXA 2QEXS 2LDIA 1UZDA 2MTLA 1NCLA 3AOBA 1BD6A 1D9FA 5C5JA 3HM9A 3P96A 5I42B 3BREA 3GZ7A 3HHEA 3MEDA 3MFHA 4ZHRA 3DOMB 1EQ0A 4CLSA 2IJNA 5J2NA 4ZP8A 4LRCA 1HI0P 2KXHA 3FVYA 2VPZB 5ITHA 4ZVRB 2H9ZA 3DRXA 2N7CA 5CXTA 5ETLA 3SMZA 1IKWA 4CLUA 3DOKA 2GVZB 4LFBF 3HT3A 3TO8A 4O44A 3J7YU 4ANEA 1FJ7A 2GQQA 3FEZA 3W60A 4USTA 3O5TB 3DRSA 4BWMA 3AQPA 4CYUB 3OR2A 1BUXA 3T5KA 3J7Z5 3H8YA 2GIRA 3KLFA 1QVFR 3MURP 3D7SB 3UFCX 1SQEA 2AJ1A 1FRHA 3LOUA 3PKYA 1XMOJ 1ZM4A 1KOOA 4ECQA 1MN9A 3PRBA 4B9LA 2VBZA 4NLXA 2CJ9A 4ZCIA 3IP0A 4QWBA 4WK3A 1OPZA 3HX9A 2D69A 4ZLNA 2M52A 1G7CB 4DPOA 2OPRA 2AGOA 2IDEA 1QDUB 3MEEB 1U26A 5H9EJ 2CPIA 5GVQA 5THWA 2CNLB 3N28A 3ENVA 4LJMA 4GO7X 3UO0A 5ETNA 1Q86T 4MT1A 4DV0F 2BM0A 3CJ3A 1N6QA 1FD8A 3OLBA 4GVBB 3HSJA 5DG8A 5HMZA 3ZZ0A 3Q89A 4NLDA 1PYSB 1VS3A 2HWHA 1N4LA 3SXLA 1TV6B 4NASA 1TK5A 3R1LA 1D09B 2QFJA 1RCOB 1URNA 3KJFB 1SJ3P 1SL2A 2WONB 1XNQJ 4IO9Q 3X3UA 4J9LA 1X5PA 3M32B 4QW8A 1ZM3A 3FC9A 4AXJA 2M3DA 1RAJA 4H4OA 4LR7A 1OO0B 3CIZA 3H0PA 4DFJA 3H25A 4DL3A 3M2RB 5IT9U 4OYPA 4M95A 2HBQB 2WW4A 3KJQB 3TJ9A 1KVJA 2LA6A 4C48A 4OYAA 1FO1A 1HWUA 5DM7Q 3OUYA 3CC2S 4H54A 1VJWA 2RH3A 1N88A 4KKOA 3VTIA 4JOUA 1PBAA 1KQSR 1IBKF 5E0OA 4NRTA 4A8WA 4OHZA 2FGCA 4ZPTR 4RW8B 4YB7A 3W5XA 2K7KA 2XULA 3HULA 2AJ0A 4EBDA 1RTDB 4PCQA 1WKJA 1KRPA 4P2SA 3KMQA 3L09A 4ECXA 3NXZA 1NJYA 4NLVA 4X4SA 2XBPA 1N48A 3LP2A 2N3OA 2AF6A 5J1EB 2QA4S 3D54A 4ZCMA 5CCMA 4JI8F 1T9VA 4DQSA 3QSIA 4NWBA 3QWUA 1FRJA 2EG2A 1UEKA 1J5EF 2D1CA 4F4AA 4DX5A 1F2HA 2CKWA 1U0HB 1MROA 2BKOA 2CPEA 2FVCA 3P49B 1SJRA 4P7TA 4LF4J 2DK2A 5DO2A 4CNYA 4XDCA 1RA7A 2CWXA 2O5DA 1ZA1B 3TQ1A 2WRMA 1WTBA 1CJTB 3H5XA 1FRXA 2CPJA 2B7CB 2V4RA 1I94J 2JHEA 4QR0A 4FKXA 1BQXA 3OR1A 2UVVA 4TXSA 5ETRA 2Y8WA 1PIEA 1T03B 2EXUA 2ERRA 3M9MB 4DBQA 5DS7A 4LFCJ 2DH7A 3UWTA 2QA2A 2DTJA 2VG5B 3KLEA 4NLQA 2DNGA 3BGLA 4M5LA 3PX0A 2OELA 1T7PA 2L41A 2HFNA 3BQ1A 1LEOA 3MMCA 2DKOB 1E6VB 1Q95G 4WYLA 3IO1A 2ZC4A 1VQ6S 1TL3A 2HSEB 5C42B 2ZM6J 4AL5A 4LBPA 5JMNA 1REGX 2ASJA 2GC8A 2M0GB 3PV8A 4PQAA 2HWIA 2KXFA 4UF4A 2EFPA 3D1OA 4J9PA 1WI8A 5HLFA 2CYYA 2JWNA 4DLEA 3O1LA 1R8CA 4AFFA 4CTAB 4ES1A 2DXEA 3D28A 2X3DA 4Q0BB 1EHWA 3OTEA 3OD2A 1HWIA 4PXBA 2CUYA 3CSKA 2VHGA 4NMLA 4DQPA 3CJKA 5B0EA 5FLXU 3T1YF 3VV2B 2LDYA 1MWYA 2ZZNA 4B3RJ 3G6YA 4U7UK 1FDNA 1NSPA 3EGVA 2ZVSA 4Q44A 4RW7B 5BR8F 2RUSA 3MTKA 4FS2A 3BSNA 1V9OA 3UDEA 3T5LA 3D67A 4OJGA 5D0GA 3FBCA 9ATCB 2R7OA 2R7VA 3NG8A 1B0VA 2IBKA 1T9WA 1S9FA 5AJ3J 3UN5A 4JI3F 2FY8A 8ATCB 3C6TB 4USHA 2FY1A 2M8HA 1KQGB 3GG0A 2MKSA 2X51A 1OMSA 4ZVHA 3IMQJ 4O0NA 3UDCA 2M70A 5K8OA 2M9KA 1MMNA 3B82A 2H65B 3OLAA 4ETXA 2BM1A 2KG1A 4DL4A 2IDLA 3DLEA 4DR1F 2PN6A 3WIVA 1LWCB 2MEWA 4JI1J 3BN4A 4B3OA 3D3BJ 1WEYA 1KONA 3A1YG 4DFKA 4C8OA 1VBKA 2JEFA 1GX5A 2OFGX 4RO0A 3O44A 3MM5B 3CJTA 4TY8B 2I8EA 2YNFA 4DR6F 2X3GA 3MPDA 4P2FA 4RW4B 4OX7A 3NS7B 2RUGA 5J2QB 4UOHA 3MECA 3C14A 3G6ES 3PW5A 2VA2A 2G1HA 3PHEA 4I64A 1HBMB 2JLFA 4WWSA 1VFJA 3J80U 4I2PA 1N5VA 3ELHA 2A2CA 4OV1A 2MMYA 4ID8A 4EI2A 2DHHA 1N5QA 1WC0A 1UVNA 1RHUB 4NYOA 2ZJRQ 1NO8A 4ZPAA 3MEDB 3OXLA 2OI2A 4C6AA 4ZHRB 5EHHA 4USJC 1RWMB 2BDPA 2RIJA 1XERA 4NLRA 1MWQA 4DQRA 1ZYQA 1IKWB 5T7LA 5IT0A 1H7XA 1A0OB 4O44B 4RBUA 1I5OB 5EWEA 1Y3JA 2R7SA 1AB8A 1JKHA 3HO1A 3QSYB 5KFNA 1TK8A 2BZ2A 1RT6A 3NBPA 3JSRA 1YIJS 1RAFB 3QIPA 4A8FA 2JEGA 5HL7Q 3C2PA 3HVRA 1KEKA 1K8AT 3MPVA 1HIYA 2FZKB 4FXWA 4PPZA 4ID5A 3UVJA 1X4AA 4ZPCA 2KN4A 3AD7C 3JSMA 3MOJB 1Y5NB 4QYRA 2UXDJ 1QAIA 3QGPA 4PG8A 2A2DA 1KFSA 2EC0A 5L9XA 4NXNJ 1RTIA 3C46A 4ED7A 3LWLA 1C2PA 3I0SA 1R0AA 2OPRB 2VV5A 4XK8C 1RHQB 4WK1A 2RU9A 1CLFA 3M2UA 4QOTA 3A12A 5M2UA 5D3GB 4OX9J 1F6TA 1AA1B 4FDFA 2YKQA 4N76A 1T0TV 1S1TB 3HHLC 3V2UC 2DHGA 1U02A 1GFWB 3C8YA 2BOPA 3EGNA 2EI5A 3RB0A 3FNNA 5B0CA 1T94A 2MB0B 3I4PA 1LNQA 4HI1A 3IBWA 1RXOB 4AYBD 1KR4A 1S0NA 4R8UB 1C0TB 1O5JA 2R3VA 3CDAA 3PRVA 1D8YA 1EIYB 2IM3A 2J9DA 2BQUA 1F3FA 3RBEA 2V8PA 1LXJA 2HPUA 4EO8A 1TQLA 2ZVIA 2E7XA 5KT2A 4QIWD 3PW0A 6AT1B 1NAQA 4DPTA 4PZVA 2DEJA 5KFTA 2LXFA 3KLHA 1B7YB 2RRNA 3TEGA 1H73A 3VAKA 1S4FA 3G87A 1EZZB 3BYPA 2RVJA 1FTRA 1RWKB 1TAUA 3ZNJ1 1MG7A 4BCAA 5F41A 3G9CA 1EARA 3CEDA 3RB3A 3T6JA 3GCXP 4ZVGA 4MMOA 2VL1A 4Q45A 2MGZA 3OUYB 3CPWR 3TAPA 4A8KA 2HNZA 3BKFA 3VWSA 1IXKA 3MCNA 3QRQA 4V1Ak 1VQ5S 3U02A 4V19J 3IWXA 4DJBA 3MM9B 3HFZB 2LMIA 2Z0GA 5K9FA 2WOMB 3I55S 1IR0A 1K9MT 3DLJA 2HMIA 3LP2B 2VPYB 3Q2SC 1SKSA 1BHNA 3EDRB 2IPOB 2HYIB 2PGCA 4ZDNA 2OKQA 3M6WA 1FWKA 2A6OA 3L7UA 3R27A 5DG9A 2LXUA 3HSDA 3P4UB 2V8GA 1XR5A 1MROB 2DNHA 2NZ4A 4J9QA 4B9VA 5IWAJ 3FFIA 1NSQA 3RRKA 2D3UA 1HL6A 5GMEA 6FD1A 2C22A 4KE5A 4TU7A 1IKYA 3PM9A 3MR5A 1IM6A 3PACA 3CT9A 3VALA 4FNIA 3TUIC 3G82A 2MQLA 4OZJA 5JUMA 3GQCA 1KLNA 3QGHA 5E41A 3SSRA 1KBRA 2Z8QA 3AHPA 4RWWA 2XMWA 3KMSA 2D3ZA 5HANA 2NR0A 3NKYA 4OYOA 3K5MA 4LF1A 1UFKA 2C3MA 4OHVA 3KLEB 2XMMA 4LF8J 2V9KA 4HT5A 2IYGA 3K5LA 4XPCA 3K89A 1T95A 1OWXA 2A1BA 2VDHA 3MMCB 3EVMA 3DXBA 1TL3B 1TL4A 1VQ9S 1Z2LA 1K47A 1C1BA 2RKIB 5A2QY 3LF0A 1RT1B 5HLFB 3GU0A 4OV6A 4Z7YA 3FUYA 2BJ3A 2B3TB 3JTOA 2Y8YA 2N3LA 3VAFA 1HPZA 4F4WA 3BM7A 2HHQA 4HH0A 1RYSA 2PO4A 4ECWA 2Y1JA 3CC7S 4RW6A 2LKZA 5IC6B 4I6WA 3CJKB 1DURA 1DRZA 3TVYA 4LFAJ 2HVDA 2BANA 4X62F 1YJVA 1UEUA 1N33J 3KJVA 5KFCA 1HNZF 2QMUB 2C2KB 4QR2A 1B64A 2CG8A 4KYZA 2QE5A 1X4BA 1YSJA 3CD0A 5D15A 1KSPA 2XSFA 1VRTB 3TA2A 4CO2A 4KQZA 2OPQA 1SPBP 2O67A 4A8OA 3GV8B 4I68A 4LREA 3US5A 2JVOA 2MPUA 3RUBL 1RTHB 5F8MA 2DPJA 1FKOA 3GFHA 3G71S 5EUHA 1TTHB 3KUGA 2OMOA 3TZZA 2YXLA 4X4VA 4JV5F 2AYBA 4B08A 2FC9A 3UPFA 2HZCA 3CF5Q 1NJZA 3MHYA 2CPYA 2ZKTA 4DN9A 4OX8A 4K50A 2PT0A 4C4WA 5CYMA 2BA9A 3CCWA 1WORA 4KGVB 1T8EA 1DY3A 1XJWB 4JI7J 3DLEB 1ZAWA 1U45A 4KY3A 1IJEB 2GIFA 3C3LA 3I4HX 3N01A 4B3OB 4F3OA 5KFRA 4DQIA 2HHSA 4K59A 3LA0A 1N56A 4NMXA 1UP1A 5GADI 1N5YA 4LF7F 2A3JA 2R8JA 4DV6J 1PC5A 2WHOA 2ZH4A 4N8NA 3FZBA 4RBTA 1W7WA 1VRQC 1YZ6A 1VRUA 3C14B 4WKRA 4U8VA 4Y00A 4TVAB 1JNRB 5L39A 3UQSA 3JSYA 4RU2A 2ASLA 3GIIA 2NXUA 2YKPA 4LQ9A 3TZWA 3TEHB 4X65F 1YJWS 3W2WA 2HVIA 1HNIA 4I2PB 2EW9A 2VG6A 4USWA 2SXLA 2O66A 3NGTA 1WC6A 2L08A 2NCKL 3EPIA 1TFWA 3M8PA 4PUOA 2NLWA 1HNVB 2KO1A 2JZ5A 2DNPA 3JQMA 1REVA 2BYCA 1SQGA 3TWZA 3DN9A 3KYLA 2JH3A 2UUAF 2XZDB 4OI3A 3FKBA 5T7LB 1SQFA 2UXBF 2AT1B 4DUZF 5KG2A 1Y5LB 3A3NB 1RAAB 2PC6A 1XMOF 1LK5A 3HHLD 3CO9A 1JKHB 3G6XA 4N77A 4YR0A 2EKYA 2VUGA 1VMBA 4DU8A 1RT6B 2VFSA 2UVUA 4J9MA 2OH2A 2PIIA 4YB5A 2DGTA 2ZOFA 3DRYA 2NREA 2HIYA 1TP7A 1BWVA 2H3EB 4DL2A 2ZUAA 4YR3A 4ID5B 3UVJB 1QVGR 3BGOP 4EWTA 1FI4A 3JSMB 5KFJA 3RBXA 5HMYA 3K59A 3T3FA 3QT8A 3EM1A 1JLAB 1FERA 3CJ4A 2FC8A 5CD4A 1VIXA 3I9ZA 1RTIB 4J91A 3MDFA 4USIA 4DEZA 2LLZA 2XMUA 1HKAA 3I0SB 3DRRA 1R0AB 2CQ0A 4ETZA 3DRPA 5J2PA 1U6ZA 3M2UB 1MU2A 4DUTA 3CB4A 1D9AA 3BO2A 4YR2A 1RUSA 3KJNB 2C2OB 3NGSA 5JVGQ 4A8QA 2MKHA 4DX7A 1HHQA 3G8SA 3OHAA 2BKNA 3ILJA 4ZITA 1XC9A 1MSWD 3EVOA 4IRCA
chains in the Genus database with same CATH topology
2VHGA 2XM3A 2A6OA 2VIHA 4ER8A 2F5GA 2EC2A 2XMAA 2FYXA 2VJVA 2XO6A 2F4FA 2VICA 2VJUA 2A6MA 2XQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VHG A;  2XM3 A;  2A6O A;  2VIH A;  4ER8 A;  2F5G A;  2EC2 A;  2XMA A;  2FYX A;  2VJV A;  2XO6 A;  2F4F A;  2VIC A;  2VJU A;  2A6M A;  2XQC A; 
#chains in the Genus database with same CATH topology
 4RW9 A;  3KK2 A;  2JOQ A;  4ITS A;  3RAX A;  2XMT A;  3MM6 A;  2VA3 A;  2HHP A;  4Y2M A;  1LOU A;  2ZBP A;  2B4U A;  2JEI A;  2YKO A;  5H9E K;  3UR3 C;  1S72 S;  3R5J B;  4DR7 J;  4NXM F;  1YQH A;  1VYA A;  4MKY A;  1HA1 A;  4NEZ A;  2ADC A;  3KLH B;  3GIJ A;  2RQK A;  1KC8 T;  4HH1 A;  4FYX B;  5CZV A;  5GMD A;  2KG0 A;  4ZPV R;  4DN0 A;  1UW9 A;  4LVN P;  4AQY F;  3RJM B;  3QZ8 A;  2B9Y A;  2AWZ A;  2W25 A;  2DIV A;  1PJ5 A;  4QQB A;  5D4L A;  3OJU A;  4NI2 A;  4NLU A;  4RU9 A;  2HNZ B;  3JXO A;  2PA8 D;  4YME A;  1VQ4 S;  3W5Y A;  1HWJ A;  4FVM A;  2R7Q A;  1H6K X;  5C25 A;  4UUX A;  3EXY A;  2CNN B;  2I9S A;  2CJQ A;  2CQP A;  5DLG A;  1S1W A;  1UA0 A;  1FHT A;  5DQI A;  2V9W A;  4EZ6 A;  4Q2L A;  1HQE A;  1DTQ A;  1Q7Y T;  1R0C B;  1HBO A;  5BYR A;  2H4Y B;  4A8M P;  3MMB B;  1YHQ S;  2XLI A;  3KLV A;  2KFN A;  1H3D A;  2KHD A;  4DCO B;  3JB9 k;  1S1V A;  4DV4 F;  2XLJ A;  2M8D B;  2QYC A;  4HHH A;  1PJ7 A;  1D3W A;  1NKB A;  5F3Z A;  2DT9 A;  2KT2 A;  2J6S A;  4WP8 A;  1NK7 A;  3FFI B;  3ZNU A;  2K3K A;  4J9O A;  2CA9 A;  3DOL A;  2VZ9 A;  4K5S A;  1LV5 A;  2N4D A;  1TU0 B;  3SFU A;  4DFM A;  2C2R A;  3G82 B;  2E5G A;  2JNJ A;  4M5K A;  3MZI A;  1YZ7 A;  3GJS B;  3TAN A;  3QPI A;  2ZM6 F;  2ZBI A;  2QT7 A;  3UDL A;  2YBV A;  3TX0 A;  1AT1 B;  1F9E B;  5C7P A;  1LK7 A;  3EDQ B;  1F9H A;  2IA6 A;  1UJ6 A;  2GW8 A;  1MWZ A;  2FJA B;  3CJ0 A;  2MQN A;  2XWX A;  3M2V A;  4F8R A;  2G1D A;  3RG6 A;  2DGO A;  2DH8 A;  3DLB A;  3J81 U;  4V19 X;  4KGZ B;  1M5O C;  4NLT A;  3QJP A;  1RWO B;  1RAE B;  2F5G A;  4IR9 A;  3D6T B;  2V8V A;  2W1B A;  1TFY A;  1WHV A;  1C1B B;  2J9D E;  4RUB A;  2BW7 A;  1Q53 A;  4DLG A;  4LRA A;  2WVF A;  2EC2 A;  4FF1 A;  2V69 A;  2IY5 B;  2VD3 A;  1IBM J;  3POT A;  1FXL A;  2B8P A;  5GAG I;  1HI8 A;  5ETP A;  3OXF A;  2VQF J;  4RW6 B;  1YRX A;  1RT7 A;  1XTZ A;  2L48 A;  4P2M A;  4FS1 A;  3PXG a;  4QIE A;  3AOA A;  3S7R A;  1RIS A;  4PPD A;  3V6D A;  2IM0 A;  3D0H E;  4BHQ A;  2YVS A;  2BJ8 A;  3KJV B;  5AJ3 F;  2Z2M A;  4I1T A;  1SBR A;  2B4O A;  3R5G A;  3R6G B;  5FD1 A;  2ADB A;  2IRU A;  1TUG B;  4E98 A;  1T9T A;  2XNR A;  1JLB B;  4LR9 A;  2RS8 A;  4TN2 A;  4WBF A;  4DPW A;  2GZO A;  3FMB A;  1JLQ B;  2EK6 A;  4LMZ A;  3TJA A;  1K1S A;  3GYG A;  1FKO B;  4C3K A;  3MWB A;  3CDB A;  4JI1 F;  3TA1 A;  4LUB A;  4QWE A;  4UTG A;  1VBZ A;  3IAS 9;  3MPY A;  4S0M A;  2CWK A;  3Q23 A;  2YH0 A;  1S1U A;  5CYM B;  2CQD A;  4IOB A;  3V6K A;  4I67 A;  1SB6 A;  5HVG A;  2DCL A;  3QID A;  3G4S S;  3J7Z T;  1VI7 A;  4G6V B;  2D3O R;  2DB1 A;  3HHL A;  3K2Y A;  1YIT S;  5KFO A;  1Q1K A;  2AX1 A;  2HFZ A;  2Q79 A;  2VC1 A;  3BR8 A;  3JTN A;  2ZUG A;  4Q2M A;  4I0W A;  3HF5 A;  4F3Q A;  3TX8 A;  3V4M A;  3BBC A;  3HVW A;  4RNH A;  2QX0 A;  4HAC B;  4HKQ A;  2DYA A;  3LGM A;  3QZ7 A;  2JFD A;  3NLC A;  4E0D A;  4CO0 A;  1R43 A;  1TVR A;  1VRU B;  4K4V A;  1O6X A;  3MR6 A;  2B6A B;  1PKU A;  3LPY A;  3R2C J;  4NLS A;  5KG1 A;  3KK3 A;  1F5B A;  3VAI A;  4RUH A;  3HT0 A;  1RB0 A;  2HKE A;  1NHV A;  3UW1 A;  4OZ2 A;  4ZVE A;  3W2W B;  1HNI B;  4ILM A;  3JS9 A;  4FP9 A;  2CPH A;  3ITH A;  3HHK A;  4W4M A;  1HWL A;  2I0X A;  3BF4 A;  3IG1 A;  2IVF B;  4NA2 A;  4PUO B;  2ROG A;  3H98 A;  3EZU A;  1REV B;  2RJZ A;  2HNY A;  3WQP A;  4CLT A;  1TKD A;  2QG9 B;  2D7S A;  4Z37 A;  1N0U A;  2BV3 A;  1AFJ A;  2YY3 A;  1N5T A;  4DCJ B;  2GML A;  2J0S D;  3UCZ P;  4DX8 H;  1RT4 B;  1MN7 A;  2E1C A;  3UNG C;  1JQG A;  4MKA A;  2W2N P;  4I69 A;  4OJH A;  2Y1L B;  4WU3 A;  3PY8 A;  5CAB A;  1RTJ B;  4DV7 J;  3HSZ A;  1YJ7 A;  4NXN F;  2V50 A;  1XMB A;  3PEH A;  4O4R A;  4LRD A;  4TU9 A;  2ZEJ A;  2CNK B;  2NXJ A;  3M7V A;  1HR0 J;  5GAH U;  4BDP A;  3W5Z A;  2XG8 A;  1JXV A;  3MPW A;  1S0M A;  3PCO B;  1BMQ B;  3OV7 A;  2MJN A;  4P52 A;  2W2Q P;  4TQS A;  3Q0A A;  4M5J A;  2HK2 A;  3NS5 A;  4K0K J;  2HHU A;  5I3U B;  3CUN A;  1OS5 A;  2QLX A;  3QFW A;  2GMH A;  4PG5 A;  4F7V A;  3QT5 A;  1EB0 A;  2B9W A;  2PA3 A;  1UVM A;  2L9W A;  2W4C A;  1MLA A;  3UE2 A;  5JJB A;  1UL3 A;  2YX4 A;  3EGZ A;  3DRP B;  3OT9 A;  5J2P B;  3L4B C;  4C8Y A;  4DFP A;  3SCI E;  1FNO A;  2Z2Z A;  4DR2 J;  4FZV A;  4X2B A;  3OL9 A;  1WC5 A;  4CCH A;  1IUJ A;  4MK7 A;  3M6U A;  2B7B B;  4B3M J;  1JLC A;  3R7S B;  4OYW A;  5LMN J;  1G2E A;  3FSX A;  3FQK A;  5A8K B;  3Q8S B;  4MFB B;  4DPY A;  4RW9 B;  1V5I B;  3MM6 B;  3GSD A;  3I56 S;  2XQC A;  3GWC A;  1JLE A;  1M5H A;  2DR6 A;  2KHC A;  1FES A;  3FDS A;  3LQV A;  2M4M A;  2H5E A;  5E2Q A;  1BQN A;  2B5J A;  4Y2A A;  4N41 A;  3E3X A;  3BH7 B;  4R5P B;  5HQ8 A;  2C42 A;  1L3V A;  5KFF A;  4KBI A;  5T14 A;  3WHI A;  2H5J B;  3V4I B;  3I0R A;  2AIR B;  1T3O A;  4IOC Q;  2KH9 A;  2W8K A;  3E01 B;  3MMA A;  2XO7 A;  2X1G A;  3W65 A;  1Y7P A;  1SH2 A;  5HK4 A;  4PXC A;  3PIP Q;  4NI2 B;  5LOQ A;  4K7Q A;  3RBZ A;  1LWE A;  2HHT A;  3DLL Q;  2P5V A;  5FDL A;  1FVQ A;  2BUN A;  3LH2 S;  4MJK A;  3QFH A;  2VIC A;  5D4P A;  3HHD A;  1WTF A;  4LQ3 A;  3AH6 A;  3WDO A;  3UR0 A;  2JLE A;  5LT5 A;  4LSZ B;  5C25 B;  1BQM A;  4Q43 A;  3ETM A;  1FTC A;  2P9G A;  2KM8 B;  1SKR A;  2VPX B;  4DL7 A;  4ZIW A;  2V94 A;  4EUV A;  2ZOM A;  4A48 A;  1S1W B;  2QC3 A;  2Q6C A;  3TUZ C;  1F5C A;  1HYS B;  1K73 T;  2E5L J;  1APS A;  1HQE B;  2VB6 A;  2YQ3 A;  1GMW D;  1DTQ B;  3QWP A;  3IAM 9;  2EFV A;  2ZWO A;  1HMV B;  1ZPW X;  1HBO B;  3HKW A;  1ZPV A;  1RKI A;  4F67 A;  2OEJ A;  4IH6 A;  2VIH A;  3PIO Q;  5KFH A;  1QSY A;  2QO3 A;  4CLY A;  1H0H B;  1TKT A;  5KT7 A;  3VAH A;  2V4J A;  4KTQ A;  1RCX B;  5CHC B;  4NE9 C;  2GAH C;  3NOC A;  3CJ2 A;  1NK0 A;  3TW0 A;  2YWE A;  1A9N B;  1QLN A;  3QBC A;  3AT1 B;  2CPX A;  3DOL B;  5JVH Q;  4U8Y A;  5KOW A;  4FYD A;  1YBT A;  1VHI A;  1FWP A;  4OZ0 A;  2DCU B;  2OD4 A;  4IYQ A;  1G3O A;  3ZZZ A;  3JYT A;  2BAB A;  5D4O A;  4YY3 F;  4ECV A;  3ZZO A;  4DQQ A;  3HSG A;  1NB7 A;  2BE9 B;  1ZZF A;  2AJQ A;  2GO9 A;  3TQE A;  4RNN A;  4DR4 F;  4BLG A;  1HBN A;  2XY7 A;  1UKU A;  4B9S A;  5KTQ A;  5HBM B;  2GIQ A;  2DGW A;  4PKD B;  1QAY A;  2W2O P;  3U27 A;  2BKP A;  2NXE A;  1RI7 A;  1NDL A;  2W9B B;  4JI2 F;  1O8B A;  2R7R A;  4KB7 A;  2ZH7 A;  2C2N A;  3VAM A;  4OI6 A;  5KFI A;  1ZAX A;  2QLJ B;  2VJU A;  2WVB A;  4PQU A;  3BGR A;  1HNW J;  3HJF A;  1TL1 B;  2ZHO A;  2PMZ D;  1GK8 A;  1X8D A;  3DHW C;  4OLO A;  3PR5 B;  2HLT A;  2LQ8 A;  3FRZ A;  2PFF B;  4DV5 J;  4USV A;  1VIO A;  1FD2 A;  1YK9 A;  3POT B;  3ENW A;  4M5I A;  1NZ8 A;  4URS A;  5LMU F;  3H2L A;  2WVE A;  5FLX Y;  2ZH9 A;  4KRW A;  1CUL A;  2RS2 A;  3LTO A;  1H38 A;  3OTO F;  2EBE A;  3NRB A;  3NAH A;  3B78 A;  3V6D B;  2QRR A;  2FHK A;  3Q2T C;  3EGW B;  3MR7 A;  1NJW A;  2DHS A;  2WSC C;  3NNH A;  3RW6 A;  1CVJ A;  3EZO A;  3GYN A;  5H9F K;  2G4B A;  2ZBC A;  1PG5 B;  2FTR A;  2HRY A;  2JJ4 D;  2XLK A;  4DMZ A;  1P9Q C;  4LSN B;  2HHV A;  4B3S J;  2Q66 A;  3NP5 A;  1CS4 A;  4CO1 A;  2QA1 A;  2FB0 A;  1L3T A;  4DHV A;  1RT5 A;  3M8W A;  1RAD B;  1P27 B;  1KP6 A;  3N5F A;  4M8L A;  1M1H A;  2DNL A;  1UFL A;  1K44 A;  3OW2 R;  1CJK A;  2V0N A;  1WG1 A;  2W8L A;  3JAM U;  4IG3 B;  4A8Y A;  4ECZ A;  1YJN S;  3VZH A;  2GGP A;  1FJE B;  1GAO A;  4L6V 3;  2W7P A;  1U7L A;  2B56 A;  3LAM A;  4OHW A;  4ANC A;  2HRU A;  3KTQ A;  4EYI B;  5HVF A;  2QTW A;  1RT2 A;  3MAA A;  4DU7 A;  3CXC R;  3CCM S;  5DJB A;  4P7V A;  2VH7 A;  4IO1 A;  3K5P A;  3P5B P;  4UZB A;  4LSL A;  3ULH A;  3I31 A;  2HVZ A;  5F0U A;  1XN9 A;  4YEA A;  4G1Q A;  5G4D A;  5KFL A;  3T1A A;  5CYJ A;  3GJQ B;  1JWW A;  2FIU A;  2MHN A;  1JK9 B;  2R8I A;  2LVW A;  1UTA A;  4WE1 A;  4IRK A;  5L46 A;  3KK3 B;  3SZ2 A;  2BJ7 A;  3J80 Y;  3JQJ A;  2KT3 A;  4I4B A;  2CZV C;  1RWP B;  4ZPB A;  2QSF A;  2GV1 A;  3J7A N;  4NL5 A;  4X4R A;  2WBR A;  3ITH B;  2NUH A;  4ZS6 A;  2VQE J;  1X0F A;  2XSJ A;  4RX6 A;  3NGU A;  2J8S A;  3IG1 B;  4ILR A;  1QAJ A;  1B7F A;  3G96 A;  4ZP6 A;  1RHR B;  4OYI A;  2MLZ A;  3AD8 C;  2HNY B;  3OL6 A;  3BBF A;  2DXF A;  5E7O B;  2HZV A;  1EKS A;  1BXN A;  2MSS A;  1FA0 A;  1NM2 A;  1CQN A;  3OL8 A;  2FHJ A;  1NPK A;  4LIW A;  2DIU A;  2FVQ A;  4QWA A;  2VFR A;  1FRL A;  3HK2 A;  3QJL A;  4KV8 A;  3C15 A;  1N36 J;  1IR1 A;  3PJ9 A;  4JYA J;  5J2M A;  1HNX J;  1PC4 A;  2DNZ A;  4DUY F;  1GX6 A;  2OPP B;  1JJH A;  1S6Q B;  2H5I B;  1NKC A;  3F0N A;  2XGP A;  1VLO A;  2EBG A;  4CT9 A;  2WCX A;  4PXE A;  1DFD A;  3VGS A;  2RNE A;  1HD0 A;  3D0I E;  4RUC A;  2ATL A;  1AUS L;  2HRT A;  1JJC B;  5DM6 Q;  1QSS A;  2AYM A;  4C0B A;  5F8J A;  4RPF A;  2MKY A;  2UU9 J;  4CM0 A;  4JP8 A;  5FJ4 A;  1IKV A;  2CQB A;  3W9H A;  4L75 A;  3QO9 B;  4PAB A;  2CQI A;  1W2I A;  3MCM A;  3OTC A;  4USU A;  1IBL J;  4ZPD A;  4OI0 A;  1T9Y A;  5KG3 A;  3LWM A;  1VQK S;  3BDE A;  2G13 A;  3VVU A;  1XMQ F;  3KNG A;  1WNE A;  5G0R A;  3D9B A;  3PW4 A;  3PJX A;  4Y34 A;  4AE5 A;  5DGB A;  5HRO A;  1U1N A;  3UI3 A;  4WXO A;  1YJ9 S;  1JLC B;  5GMK a;  4DZD A;  2R2U A;  1U1Q A;  4EGL A;  4IRD A;  3UN3 A;  3DMJ A;  1XEZ A;  2LEC A;  2GHW A;  2BMB A;  3VVT A;  1P6T A;  2PI5 A;  1JLE B;  4DPX A;  3OSP A;  3L3C A;  1S77 D;  3GR0 A;  3QJJ A;  1XNR F;  2I5J A;  1BQN B;  2C1E B;  3SSQ A;  3U1L A;  4HHJ A;  3W8P A;  5L1L A;  3I0R B;  4Q7A A;  3DI6 A;  2CQ2 A;  4K4X A;  1V5V A;  1Q78 A;  3MMA B;  4ZK7 M;  4CLL A;  1NHU A;  3TR5 A;  5ETS A;  2UUB F;  1LWE B;  1KOH A;  1AZS A;  2UP1 A;  2EEY A;  4G1I A;  2V4Q A;  1Y9O A;  5LJ5 Y;  3H20 A;  2E29 A;  4HTI A;  2YTC A;  1N5S A;  1FNX H;  5BYS A;  5D0E A;  4TQR A;  3MD1 A;  2L9D A;  2QLF B;  4C2M A;  1JLF A;  3VAJ A;  1K1Q A;  4DOZ A;  3BJY A;  4OYB A;  3E8O A;  4DR3 F;  2YNI B;  4JBC A;  2V67 A;  3M9N B;  2NYH A;  2VAS A;  4MK9 A;  1NK5 A;  2YPZ A;  3SSS A;  3ICL A;  4DV0 J;  3OFH A;  4OI4 A;  3ONQ A;  1WHW A;  3L7O A;  1TKT B;  1M5S A;  1QE1 A;  2V4J B;  1L3S A;  3KUH A;  2HLU A;  4HVZ A;  1Q8B A;  4GKK J;  5B0F A;  4EK2 A;  1NPR A;  2FLN A;  4KAI A;  2EG1 A;  1R8H A;  4Y2C A;  3CCJ S;  4B9U A;  3MEG A;  1IWA A;  4LBI A;  5B0D A;  4CH0 S;  1VQY A;  5DET A;  4X4Q A;  2ZD1 B;  2M5Y A;  4ED4 A;  3LPE A;  1RWX B;  1HQU A;  3W66 A;  3I6P A;  4CI0 B;  1K0T A;  1U48 A;  1GMV A;  5DQH A;  4AND A;  2DIT A;  2QLW A;  1ACM B;  2O01 C;  2XS7 A;  4PEO A;  2FJV A;  2OLW A;  1S4E A;  4CO5 A;  1ZET A;  1LFP A;  2R7T A;  1S57 A;  2FLP A;  1K0V A;  2H1Y A;  2LYV A;  4ED3 A;  4OHX A;  2DR5 A;  1Y00 A;  3PYE A;  5A8R A;  1CBK A;  1VQN S;  2JC0 A;  4C9D A;  1U24 A;  2NSB A;  3T9N A;  2UV8 G;  3G6V A;  2ZHB A;  2HHH F;  4PQU B;  3BGR B;  1KD1 T;  3OFF A;  1N32 F;  1WF1 A;  2BEF A;  2VFT A;  2CJY B;  4OZN A;  4YB1 P;  1W25 A;  1U25 A;  5DRK A;  3MGJ A;  1KNZ A;  1UWB B;  4JI6 F;  4JI8 J;  2VF3 A;  5KFE A;  2MJU A;  2R4F A;  1TL7 A;  1Y4Z B;  5K20 B;  5IZH A;  5LSO A;  1CUL B;  1J5E J;  3HXM A;  4FYW B;  2J6T A;  3I87 A;  4A8X A;  1B3T A;  2GMJ A;  3W9I A;  1X9S A;  1DJ0 A;  2XO6 A;  1JIH A;  1HHS A;  4JV0 A;  2FHO B;  2K06 A;  3KUE A;  2HBZ B;  4GO5 X;  4LF9 F;  3H2U B;  2KFY A;  4NCG B;  3A8E A;  2VBW A;  4LF5 F;  3U1M A;  1J2V A;  4M1K A;  2MDA A;  4EBC A;  2AQ4 A;  3KHH A;  3OFE A;  3L9Z A;  2ZBQ A;  5KT5 A;  2YKA A;  4DL6 A;  2Q6B A;  1NSK L;  1S9G B;  1M90 T;  1NK6 A;  1PSD A;  4C0H A;  2WVC A;  5D78 A;  5J1N A;  4KHM A;  3FQL A;  2AMC B;  3H4B A;  3M8Q A;  3VQS A;  3GG1 A;  3V81 A;  1NLK L;  4OX6 A;  2P9E A;  3OVA A;  2ROP A;  4QYZ J;  5HVH A;  1CJK B;  1X9W A;  3QAT A;  2GQC A;  4WZM A;  3M30 A;  1IWG A;  3MUT P;  2CVE A;  1PAE X;  2YQ1 A;  2HWT A;  2KL8 A;  2BVZ A;  2RB7 A;  2NXN A;  5KG6 A;  1X31 C;  4BBY A;  3TAQ A;  1FX4 A;  4NOH A;  4DL5 A;  1T3N A;  4I56 A;  4J9U E;  5C2C A;  2HK3 A;  1WOP A;  5HQL A;  2DNY A;  4FBT A;  4WCE Q;  4OZ1 A;  3GJR B;  1I1G A;  2W9C A;  2CG4 A;  3NNC A;  1TL5 A;  4OZ3 A;  4ZIV A;  3IN5 A;  2QMW A;  3T1Y J;  1DAR A;  2MLX A;  5IQ6 A;  4WE1 B;  1WHX A;  3WZ0 A;  4K2J A;  4J9N A;  2AP6 A;  5BR8 J;  3N79 A;  3T9Z A;  1U1P A;  4URQ U;  5E3C A;  3BSC A;  2MLY A;  1OJ4 A;  4JI5 J;  1FKP B;  1S6P A;  2PI4 A;  5J1P A;  5E5N A;  2C28 A;  5L8R C;  5HAO A;  2YQ0 A;  2AU0 A;  1AFI A;  3B4D A;  4C7Q A;  1RAI B;  2XMV A;  5LL6 d;  2OGU A;  2HBY B;  3BN7 A;  3VGV A;  4YP3 A;  2PEH A;  1RU1 A;  2B43 A;  1RHK B;  2IM1 A;  1SC4 B;  2Y0B B;  4KV8 B;  2HZA A;  3C15 B;  5KFG A;  2CQ3 A;  3H59 A;  3CME S;  3RB6 A;  2LQB A;  1NHK L;  3SIP B;  4KHP F;  1GH8 A;  5K14 B;  2VG7 B;  4YHH F;  1VBY A;  1OYE A;  2B8Q A;  3PDN A;  3W7B A;  4IG0 A;  2M2B A;  3KFW X;  1FFS B;  2QN6 B;  1B0P A;  1DTT B;  3BEG B;  4F26 A;  1WSR A;  4P73 A;  4HLB A;  2U1A A;  3GFY A;  3IS9 A;  3NEK A;  2WSF C;  5CCL A;  3HD1 A;  5EX3 A;  3TJ8 A;  4DR6 J;  2FJX A;  2LFV A;  3DU5 A;  2MKK A;  4I2Q A;  1DLO A;  1SJ4 P;  4B3T F;  2C2D A;  1IKV B;  1RAB B;  5I42 A;  4DF4 A;  1M1G A;  4O0I A;  2JRS A;  2C2M B;  4O4G B;  4HDH A;  4AUK A;  3M8Z A;  4F3M A;  1AYE A;  1D1U A;  4UQT A;  2XCA A;  3IRX B;  4E2F B;  2KVQ E;  1NK9 A;  2FDN A;  2HFU A;  4I7F B;  3W62 A;  1RK8 A;  4DG1 A;  1FE0 A;  1EX8 A;  2RHS B;  4K8R A;  4EO6 A;  5HRO B;  1FK9 B;  4M5G A;  2AKW B;  2IHR 1;  2F40 A;  4CH7 A;  3T5H A;  3HZE A;  1H2U X;  3CCS S;  4P9S A;  3DMJ B;  4H4M A;  4RNO A;  2ATC B;  2K1R B;  1U1R A;  3IWN C;  1FDA A;  3HDS A;  5CQG A;  1NZA A;  1Q8K A;  3BPD A;  2HG4 A;  3EX7 B;  2P8I A;  3IWL A;  2FD2 A;  2J76 E;  3KK1 B;  2E1M C;  2VU5 A;  3N9U C;  2RRA A;  1SUQ B;  3JSB A;  2YKM A;  4DWI A;  3VQT A;  3GTY X;  3ZZP A;  2HHW A;  3ET6 A;  2F65 A;  3F44 A;  3GFX A;  2ZC3 A;  1KTV A;  3AFG A;  4Y2I A;  4HI2 A;  4IQX A;  1ZM9 A;  4WP9 A;  4MK8 A;  2F8E X;  2XYP B;  1PBU A;  5D0R A;  5D6G A;  5KFU A;  1KS2 A;  4RJV A;  4UOG A;  4PRF A;  3KKF A;  2F4V F;  3TYT A;  5CD4 H;  3HD2 A;  3IA0 A;  1WKK A;  1X0P A;  3RR8 A;  5F3T A;  3Q86 A;  4IUF A;  3GCW P;  3IR7 B;  4GVB A;  3SQO P;  2XZT B;  1FE4 A;  4M5D A;  2EPI A;  4ECT A;  1U09 A;  2ROE A;  3C19 A;  2XGQ A;  4P2X A;  1FWL A;  5DLF A;  2GJF A;  7AT1 B;  3SBM A;  1KVK A;  2FJW A;  3RYL A;  1ARO P;  1Q5V A;  2VON A;  2ALZ A;  4DF8 A;  3M6X A;  2WON A;  5J2N B;  1CJV A;  2Y1I A;  3AJ1 A;  2GCF A;  4PG7 A;  2R8G A;  4L76 A;  2Y9H A;  3IM8 A;  4CM2 A;  3M32 A;  1U8S A;  4X66 F;  2YNG A;  2RDD A;  3DOK B;  5A6P A;  3EE3 A;  4DV2 F;  1QE1 B;  1GT8 A;  3FEY B;  3PNI A;  4KPC A;  3G8T A;  3M2R A;  2IMO A;  3DRS B;  4ICL A;  4K5R A;  4K4Z A;  3GFZ A;  3OR2 B;  5IV4 A;  4F0M A;  5M2R A;  4F04 B;  1LWX A;  4CH1 A;  1TR0 A;  2CPF A;  3KLF B;  4K4U A;  4P72 A;  1RGV A;  1HQU B;  4JI0 F;  4Q8F A;  2QSW A;  2QA4 G;  4NPO A;  3FCV A;  4ED8 A;  5ETM A;  5CAA A;  2ZKU A;  2EFO A;  2ACM A;  3IBF B;  3J81 Y;  4LIR A;  3BSO A;  4MIW A;  2YWK A;  2EWH A;  3E51 A;  5A8R B;  3E2E A;  4NA3 A;  4B9N A;  3CD7 A;  3M4X A;  3DGP A;  1U0H A;  3UCG A;  3IR5 B;  2E44 A;  1T9X A;  3TNV A;  3FK4 A;  1N6Q B;  2CQH A;  3TAR A;  1M0S A;  2ZJQ Q;  4PYA A;  2AGP A;  3CNQ P;  3LGH A;  4U95 A;  1JMT A;  4MIB A;  4JI4 J;  1SIZ A;  5KOX A;  1HQ2 A;  3IFE A;  4K4S A;  2QJ3 A;  2A6M A;  1TL7 B;  4WZQ A;  2LEB A;  4DZ6 A;  2WK4 A;  2GNK A;  2IVM A;  2OHD A;  2N82 B;  3D0G E;  3GR1 A;  4DR5 F;  2KJV A;  5L1I A;  3T1H F;  2FVS A;  4TNO A;  2QMX A;  2ZH2 A;  3CCV S;  3JQK A;  2P2C B;  1Z1Z A;  1WUU A;  3GPA A;  4QIG A;  1T03 A;  3VGU A;  2WZ1 A;  1NJX A;  4NZ7 A;  2CAD A;  4H4O B;  3ZXW A;  2ZOG A;  1ZA2 B;  2VG5 A;  3EZ5 A;  4ZVP B;  4YDD B;  2DRB A;  3TRG A;  5AXN A;  3GIR A;  2WTF A;  2E5H A;  2XI3 A;  3DFE A;  2HS4 A;  4ZVS B;  5C42 A;  4WJB A;  3RZA A;  3DDK A;  4KKO B;  4WU2 A;  4A4J A;  3PO4 A;  2A0F B;  3SV3 A;  3N6N A;  2IJR A;  3AJD A;  1UET A;  1J5O A;  4HHU A;  3V81 B;  4DSI A;  4CTA A;  2XMK A;  4Q0B A;  4WFZ A;  1YBA A;  3RAQ A;  1BGX T;  2D9P A;  3LAN A;  2XY6 A;  2DBB A;  1X4E A;  5KFY A;  1WG4 A;  4RKU C;  2MQQ A;  1URR A;  5D0H A;  3K5N A;  4WYW A;  1Q4R A;  2PE8 A;  1HW9 A;  5DDQ C;  2HS0 A;  5L1J A;  2RIL A;  2Z56 B;  4ATN A;  3IBC B;  4L73 A;  2IFX A;  1S99 A;  4IOA Q;  4JUZ A;  2W9C B;  2E5I A;  2W7A A;  4RW7 A;  1PGZ A;  1IKX A;  1TUW A;  4ENO A;  2Z2L A;  3C66 A;  3R5A A;  4DL0 C;  1X4D A;  2VOO A;  1D8Z A;  4KC5 A;  1X4C A;  3GYX B;  4C11 A;  1H98 A;  2J7W A;  3ILI A;  5K5M A;  1HNZ J;  1VQS A;  3V6J A;  6FDR A;  3OR1 B;  4WF9 Q;  5EWG A;  3HHN B;  2AJF E;  3KOA A;  1LW0 A;  2YWF A;  1ZOT A;  7FD1 A;  2CQ1 A;  4J5O A;  1Z4U A;  3W63 A;  2J9E A;  3W8G A;  2PD1 A;  2W01 A;  2V8D A;  1S6P B;  1VC0 A;  2M88 A;  1F9F A;  2EVZ A;  4X64 J;  3I9V 9;  1MW7 A;  3U1N A;  3GB0 A;  3EWG A;  4W98 A;  1JLG A;  4U96 A;  4YB6 A;  5LM7 E;  2ZNY A;  4OZL A;  3M8S A;  2QL9 B;  5C24 A;  3K57 A;  3AOD A;  4JV5 J;  1ZTW A;  1R3N A;  2OTL S;  3S1T A;  1OYD A;  3VHQ A;  2PMH A;  2CNO B;  2YX7 A;  4RUA A;  2P6T A;  2DNQ A;  4Y0F A;  3BBB A;  1BC6 A;  5A0Y A;  1WC4 A;  5GAE U;  1SJQ A;  4MYU A;  1FRK A;  4TY8 A;  4UOF A;  1YWX A;  2BE7 D;  3BS9 A;  5HJX A;  4UQG A;  4RW4 A;  1TMJ A;  4F4X A;  4LF6 F;  4RR5 A;  4KO0 A;  1QUV A;  1G4C A;  4EYH B;  3PYF A;  2R42 A;  2D9O A;  1S6U A;  2CQ4 A;  4IG0 B;  4F25 A;  5L38 A;  1HBM A;  4QU6 A;  4KGK A;  1LXN A;  4C8M A;  1Q82 T;  4WFY A;  2IAJ A;  4OLP A;  3AOC A;  2CPD A;  2DGU A;  3TVZ A;  4IH7 A;  1XK8 A;  1YVF A;  3R2D J;  1YDL A;  4LF7 J;  1P1T A;  3IS9 B;  3DLH A;  3L7P A;  5LJ3 Y;  4I2Q B;  1DLO B;  3HLU A;  4LR8 A;  5IM0 A;  3K7R A;  4P74 A;  4QWC A;  5KFM A;  5M2P A;  2J0Q D;  5DQG A;  2GAG C;  1FVS A;  1ZM2 A;  1VQO S;  4ED2 A;  3CD5 A;  3IRW P;  3GIM A;  2FVR A;  1EP4 A;  3QRR A;  4X65 J;  3HCX A;  2LQJ A;  3CDU A;  4DG1 B;  3CD6 S;  2G2Z A;  5ADZ A;  2XHC A;  5D77 A;  1SC3 B;  2GQ2 A;  1QSL A;  3MCO A;  4UW2 A;  2QLB B;  3S8S A;  4LF2 A;  2PEB A;  4N47 A;  4H4M B;  1RLD A;  4YFU A;  3NMA A;  1HI1 A;  2OSR A;  1FF2 A;  5F9N A;  2UUC F;  1YGY A;  2UUA J;  4Y65 A;  5AXL A;  5KT3 A;  4DV3 F;  2UXB J;  4DUZ J;  4ED1 A;  3CDE A;  2DIS A;  2YKM B;  1NND A;  3PEJ A;  1FT8 A;  5HQM A;  3ET6 B;  2HGL A;  4G65 A;  4KGM A;  4O3N A;  1TUV A;  1IVZ A;  4YS2 A;  4O3Q A;  2YNF B;  2D3O 1;  4ZPW R;  3HKZ D;  4B9M A;  3PW2 A;  1VIS A;  3MEC B;  5D3G A;  2ZH8 A;  2HQG A;  5KFK A;  5KG0 A;  2IM2 A;  1S1T A;  3OVS A;  1H2V Z;  4N7T A;  2DR9 A;  2DO0 A;  2WSE C;  4CRJ A;  2BRL A;  1TKX A;  2ZWP A;  2OPS A;  3V5R A;  3D6M B;  4M5D B;  1U47 A;  4L72 B;  5IXU A;  4R8U A;  1M5P C;  3ZTS A;  2RDI A;  1C0T A;  5KFD A;  3EYZ A;  2MY7 A;  4NLY A;  3CGI A;  4GKK F;  1C4A A;  3D1H A;  4WKY A;  2WB4 A;  4Y3C A;  2BAC A;  1CJV B;  3D68 A;  5GAH I;  1LQ9 A;  2XI2 A;  2KYZ A;  4QU7 A;  3W3S A;  1QAX A;  4DCP B;  3G2X A;  2YNG B;  4GC6 A;  2KZZ A;  1YJT A;  4PG4 A;  2BQR A;  2QGF B;  3L95 X;  4P6Q A;  4ICL B;  1N8R T;  1WEL A;  3NBP B;  3AB2 B;  4USM A;  4NXM J;  2VBY A;  4WXW A;  3QIP B;  2GX8 A;  3FGV A;  1IR2 A;  4ELV A;  2DJW A;  1B99 A;  4NLP A;  4PWU A;  1OQ6 A;  4KSE B;  3MM9 A;  3SYZ A;  4OZ5 A;  4AQY J;  2WOM A;  1NU4 A;  2DNN A;  3GE9 A;  2AW0 A;  2X1F A;  2AV5 A;  3D2W A;  4FF3 A;  1IN0 A;  4QIF A;  4OQJ A;  4QR1 A;  3TUP A;  4ZVT B;  9RUB A;  2ALY B;  2F8M A;  5AT1 B;  2CQC A;  1D9D A;  1OY9 A;  2DRD A;  1SL0 A;  3U7J A;  4LRB A;  3DGP B;  2DNR A;  1XNQ F;  1WEX A;  3H5S A;  2D74 B;  1R6V A;  1C1C A;  3KLI A;  2KRR A;  5KFA A;  2V68 A;  1WC3 A;  4BC9 A;  4L3N A;  2NS1 B;  3M05 A;  4FN5 A;  2R8K A;  3CCZ A;  2PDA A;  4F0K A;  4ED0 A;  2F9J A;  2WW8 A;  4F2R A;  3T41 A;  2MZS A;  1WJ9 A;  2LA4 A;  4DV4 J;  1M5K C;  4J9K A;  1BE4 A;  2OEM A;  3ZTQ A;  2HFO A;  3UD5 A;  1D0E A;  3BO4 A;  2ASD A;  2AX0 A;  5HP1 A;  4ZJO A;  5EGY A;  2HS3 A;  1BLU A;  4YUD A;  4WIQ A;  3QQC D;  2XWY A;  3NY0 A;  4DI6 A;  4F4Y A;  2V63 A;  3DDI A;  4BC7 A;  3K8V A;  1CJU A;  4RL1 A;  4MKV A;  2MGZ B;  1XR6 A;  4CO4 A;  8RUC A;  5F8H A;  1HW8 A;  3RW7 A;  2RKI A;  1Q0N A;  1RT1 A;  4TYB A;  4DX6 A;  1J5O B;  2HHX A;  2AHO B;  4K2X A;  3KHG A;  3JAM Y;  1W2B R;  2DPI A;  4HTJ A;  4W92 B;  1PYO B;  2HMI B;  1S79 A;  5CYQ A;  3NCP A;  4W90 B;  2V34 A;  4LF4 F;  3Q8U A;  5DGA A;  1QM9 A;  2HFV A;  4KH0 B;  1OIA A;  3KHR A;  4IDK A;  5K8M A;  1U8W A;  1F2G A;  2BJ9 A;  5KFZ A;  4NYZ A;  1U6F A;  3PZP A;  1T02 A;  1I94 F;  4C8L A;  5JXS A;  4QYZ K;  4QPX A;  3C6U A;  3QGI A;  1SKW A;  1DHM A;  1VRT A;  5D4N A;  1IKX B;  3QAU A;  2KM8 C;  5EX0 A;  4XO0 A;  2KJW A;  3H5U A;  4LFC F;  4JI5 F;  1RU2 A;  1S7I A;  1UFW A;  3NGD A;  1IKY B;  1RTH A;  4C11 B;  1M5V C;  1NK8 A;  2FJB B;  1MML A;  2CDQ A;  2ACY A;  4M5N A;  1X5O A;  3SCK E;  4OI1 A;  1CEZ A;  2LU1 A;  1LW0 B;  2G2Y A;  3NCR A;  4ZLJ A;  5KFS A;  4A47 A;  2ZH3 A;  2DGX A;  3CIM A;  4PG6 A;  1JLG B;  1VOM A;  3D5M A;  4AL7 A;  4O3O A;  5C24 B;  1V3Z A;  3KG4 A;  2FUG 9;  2UXC J;  4BWJ A;  1RWN B;  7FDR A;  1UPP A;  3IM9 A;  1YBU A;  4XDD A;  1VJQ A;  1QTN B;  4J37 A;  5A0Y B;  4B9T A;  3I96 A;  2AJ4 A;  2RF2 A;  2CQG A;  3MAH A;  5EDW A;  4B3R F;  4ZN1 A;  3RRH A;  1GEH A;  2XTJ P;  4MH8 A;  4KO0 B;  4CZC A;  5AXK A;  1HPZ B;  1RHM B;  4L3K A;  2OSQ A;  4RBV A;  2OUG A;  3GP9 A;  3RBD A;  4HYK A;  1BWE A;  2GFF A;  1X60 A;  3AD9 C;  5LSR A;  2H51 B;  3DGV A;  2BXJ A;  2IAJ B;  1RAG B;  1LW2 A;  3D1Q A;  2BAN B;  2DGQ A;  3IGN A;  1YX2 A;  1RJJ A;  4GMK A;  1SV5 A;  4NCA A;  3DYA A;  5IM0 B;  1SKU B;  5LXR A;  3TZX A;  4CNZ A;  4ZVU B;  2CRL A;  4EMD A;  2IRY A;  1JXE A;  1HNV A;  5AE3 A;  3K17 A;  4I6Y A;  4O3S A;  1O0P A;  5A76 A;  2OPQ B;  2GJI A;  3I5B A;  1ZBT A;  1S10 A;  4TLQ A;  1EP4 B;  2ZH1 A;  1NSA A;  3BKU A;  2MQO A;  3D66 A;  2L9N A;  3PYD A;  2DNK A;  4U67 Q;  2NYI A;  2FGO A;  4LRF A;  4MKB A;  2AYE A;  3HMJ G;  1WOO A;  2W7O A;  2GHV C;  2W4P A;  1N34 J;  4D3G A;  2PMW A;  3A4T A;  2DRA A;  4C97 A;  4M63 A;  2P9C A;  4UOC A;  4RNF A;  2C3U A;  2BJD A;  2FYX A;  3R1H A;  1UVJ A;  3O8W A;  2DR7 A;  1E6Y A;  4ZN3 A;  4G3I A;  2IIH A;  4GKJ J;  3D3C J;  4HT7 A;  4ER8 A;  1S9E A;  4CLK A;  1JLA A;  5MAO A;  3M6V A;  1N5Y B;  2IC3 A;  4UY8 T;  3FBB A;  4NYP A;  4C3M A;  1UA1 A;  3GLJ A;  3B8H A;  3VGT A;  1N0V C;  3ZTR A;  1S6O A;  2ZH6 A;  5H1S V;  4FKY A;  1WC1 A;  1U49 A;  2VKZ G;  3H40 A;  2H48 B;  2QZ8 A;  2Z4P A;  1U1K A;  3BV8 A;  1S5Z A;  2XYH B;  1FJG J;  2OFH X;  4Y28 C;  3ENA A;  2D41 A;  3R5B A;  1TKX B;  2E66 A;  1B0T A;  2F3J A;  2OPS B;  4CWB A;  2VG6 B;  4EZ9 A;  2YX1 A;  3FMW A;  1ZZN A;  2KU7 A;  2XHW A;  4ZCL A;  4YOE A;  3P3D A;  3M8P B;  3O6Q A;  3BB5 A;  4C8K A;  2F4F A;  4KJI A;  1NME B;  2F9D A;  2HQ3 A;  4FYV B;  5IV3 A;  2GA7 A;  3WX4 A;  1KQK A;  3BO3 A;  3ZFV A;  1KWM A;  2RU3 A;  2KVI A;  1IQZ A;  3UN2 A;  3CCR S;  4DSF A;  2DH9 A;  4Z7C A;  1RWW B;  3DDN A;  4AL6 A;  2K8G A;  1Q5Y A;  1YI2 S;  1R27 B;  2J8A A;  4K4W A;  3R7N B;  2V2Z A;  3ILL A;  2XCP A;  3F56 A;  2UXD F;  1RAO A;  4IFY A;  3HFK A;  4GVL A;  3EPG A;  2XY5 A;  1HLW A;  2J6U A;  5KFQ A;  4Z2X A;  4OX9 F;  1Q81 T;  2A10 A;  4KH1 B;  4ZLL A;  3IGV A;  1TKZ A;  2C2E A;  2ZZT A;  3SFG A;  5IT4 A;  1OSC A;  2AEM A;  1FXD A;  2J0X A;  2CXE A;  3DRR B;  2L3M A;  4JI4 F;  2KZM A;  1B4S A;  1MU2 B;  1YRT A;  1JJ4 A;  4ZP7 A;  2JC1 A;  3Q8Q B;  2ZZM A;  3MMB A;  4G1P A;  3KLG A;  1S0V A;  5ETT A;  2AYG A;  8AT1 B;  2HVE A;  3R3T A;  4U6P A;  2R2R A;  2Z58 B;  1C1C B;  4DSL A;  2FQQ B;  4ELU A;  1U1O A;  2Z30 B;  2I2Y A;  2ILZ A;  2GVD A;  3KLI B;  3KK2 B;  3PX6 A;  1FRI A;  2DEI A;  3MD3 A;  3R7B B;  3H5Y A;  4HR2 A;  3PX4 A;  1RWU A;  3MTJ A;  2MZJ A;  3VCD A;  5CH7 B;  2XEX A;  1Q16 B;  1VGY A;  3BGF A;  2BJ1 A;  3CC4 S;  2RSQ A;  3J7A 1;  3CCL S;  4HL9 A;  4N8O A;  3BQ2 A;  5B08 A;  1W26 A;  1Y11 A;  4UZC A;  3R5C A;  3H2V E;  5HP1 B;  3KXD A;  2GS8 A;  3HPO A;  5F8G A;  1NUE A;  2C3P A;  4ZJQ A;  3CJQ A;  1CJU B;  4YY3 J;  2PFD A;  3R8Y A;  1WD6 A;  5DZ7 A;  4NZ0 A;  3FSI A;  1FKA F;  3NMR A;  2G0J A;  5SZT A;  3G8Q A;  4DR4 J;  3OBI A;  3P45 B;  2XYG B;  1FDB A;  2CJB A;  5ETV A;  4WP3 A;  3THT A;  1RAC B;  3J7Y I;  5H9F J;  3K5O A;  1EQM A;  1H74 A;  4URG A;  3CW2 C;  3ZZU A;  4H4K C;  4N5S A;  5AE1 A;  4PXD A;  1YLX A;  2ZJP Q;  4JI2 J;  1FCA A;  5CYQ B;  1S12 A;  2V5H G;  3QT6 A;  5IWA F;  2XMJ A;  4I6A A;  4IDK B;  1S0O A;  4HEA 9;  1V3R A;  3A8I A;  1YG0 A;  3IC1 A;  3TP2 A;  2ASY A;  2AD9 A;  3O2I A;  4NZ6 A;  4NRU A;  5I3Q A;  3NGR A;  5CZX A;  4CLZ A;  1SC1 B;  5IQQ A;  2BRK A;  2NPF A;  2RML A;  3BDP A;  3I5C A;  1WDD A;  1Q79 A;  3MM7 A;  1S1V B;  2UV8 A;  2ZNZ A;  4Q8E A;  3PFE A;  1QTM A;  4X4O A;  2E7V A;  2XMA A;  3C6U B;  1C4C A;  1QUP A;  1Q7L B;  5LMU J;  3PW7 A;  1X4H A;  3W2V A;  1JLB A;  2VBX A;  4C3L A;  4LBH A;  2W4D A;  3CMQ A;  1KLM A;  4EU0 A;  3OTO J;  4D3H A;  4LF8 F;  1JLQ A;  1CC7 A;  2F1F A;  4X64 F;  3Q24 A;  3PR4 A;  4OJ1 A;  3ZZR A;  1CG2 A;  2JX2 A;  4PAA A;  1Y5I B;  1N54 B;  1MNE A;  1H2T Z;  3OTD A;  3CJR A;  2QIF A;  2KRB A;  4ERD A;  3CE8 A;  1WAC A;  3KNA A;  1RKJ A;  1KTQ A;  3OPK A;  2J0W A;  1BY9 A;  1Y10 A;  3M2V B;  1X5T A;  1CC8 A;  1KHW A;  3GV7 B;  4JV1 A;  2POK A;  4ES2 A;  2DY9 A;  1YJU A;  1S1X A;  1PIL A;  4CP5 A;  5HMW A;  1PCA A;  3PHT A;  1NJI T;  2Z2Y B;  5ETK A;  4YQW A;  4F0H A;  4ECU A;  1NPP A;  3WC2 A;  4LFA F;  1JB0 C;  2RF2 B;  2UUT A;  2E7W A;  5L9N A;  1N33 F;  4B17 A;  2R8H A;  1EKR A;  4HAC A;  3KWM A;  3GMG A;  2AGQ A;  4OIX A;  4NX9 A;  2OTJ S;  2B0G A;  4CO3 A;  1F60 B;  3ISN C;  2B6A A;  1UWA A;  2MQM A;  1SVD A;  1RT7 B;  4OFZ A;  3D6H B;  5I4M A;  4CLW A;  1WDT A;  1LW2 B;  4DV1 J;  2MKC A;  3CJ8 A;  1SV5 B;  2FVP A;  4OI2 A;  3DYA B;  1DAX A;  2ZDP A;  1XIQ A;  2DNM A;  3BH6 B;  4QCL A;  5SUH A;  4CQ1 A;  2HEK A;  3TI0 A;  2JLG A;  1OY8 A;  3BYR A;  2NSC A;  3CTR A;  3K58 A;  1ELO A;  2WB1 D;  5DDO C;  3BR9 A;  1VK3 A;  4IH5 A;  3N6L A;  3PYG A;  2YNH A;  3CDW A;  1WOS A;  3H90 A;  1VQL S;  2HGN A;  3F73 A;  4PWD A;  4KT0 C;  2RQM A;  3A8K A;  4FNH A;  4JI7 F;  4J90 A;  1RT4 A;  4QW9 A;  2RRB A;  2E1A A;  4M5H A;  3QT7 A;  3LAL A;  3RAM A;  2DHX A;  1P9Y A;  4ECY A;  1RTJ A;  1LWF A;  2QV6 A;  1ZS6 A;  2RHQ B;  3RTV A;  1S1U B;  4DV6 F;  3NWG A;  5FII A;  3FCH A;  3NGK A;  3MUM P;  3QMQ A;  1X7V A;  1E6Y B;  2DNO A;  3HHL B;  2MQP A;  3MPU B;  1X5S A;  1FJC A;  5DDR C;  5I3U A;  1NH7 A;  1S9E B;  3MAQ A;  1R8A A;  3X1L B;  2FLO A;  4DUY J;  3NL0 A;  4R0J A;  2IC3 B;  2MZR A;  2ZBR A;  2VOD A;  4DS5 A;  4IKA A;  2APO A;  2CAJ A;  3BSA A;  1I51 B;  5AE2 A;  3UNY A;  3TZY A;  5EWF A;  2BBE A;  2COL A;  1TVR B;  2F63 A;  5KT6 A;  3QYY A;  3Q8P B;  4RNM A;  4ED5 A;  5BJR A;  2KT5 A;  2R9L A;  3R6L B;  4WFX A;  1R8P A;  1DBD A;  3R9L A;  3AA8 A;  1TK0 A;  3M8R A;  3Q8R B;  1HHT P;  4USK A;  5A8K A;  2KB2 A;  2R7W A;  3LUY A;  2XC9 A;  5B0A A;  4MFB A;  5B09 A;  4IR1 A;  5A8W A;  5IOL A;  4DS4 A;  1VQM S;  2FZC B;  3H7H B;  1XMQ J;  1F5A A;  3CCU S;  3G86 A;  2RT3 A;  3LP1 A;  1NRK A;  1UW4 A;  2MST A;  1VQ7 S;  3MR2 A;  3ZO7 A;  1VQP S;  3AB4 B;  3OHB A;  1RBA A;  5BXI A;  4BS2 A;  4R5P A;  2K2P A;  1F3V A;  2N7Y A;  4X4T A;  3H4D A;  1RZM A;  3V4I A;  2Y3Y A;  5HO4 A;  2RAQ A;  4X4U A;  4F2S A;  1AXQ A;  3W1Y C;  3AXK A;  3E01 A;  4KIA A;  3W61 A;  4IFY B;  5KFB A;  1XNR J;  2VKR A;  1S59 A;  2FPH X;  4DDF A;  5L1K A;  2DO4 A;  1U2C A;  2NQP A;  4EFA C;  1B70 B;  3Q8Y A;  3J81 j;  2GO8 A;  2E5J A;  1JJ2 R;  2OML A;  3N4W A;  4FXD A;  4PR6 A;  1TKZ B;  3UD4 P;  2Y0S D;  1WKL A;  4NLG A;  3DLK A;  1QY7 A;  3QGG A;  2ZFH A;  3DU6 A;  5KG4 A;  4TYA A;  2UUB J;  3B4M A;  4R0E A;  3ZZT A;  2I1R A;  1NBE B;  5IFM A;  1HYS A;  5KAK A;  1RQ0 A;  2FLL A;  3I82 A;  1OPI A;  5T41 A;  3D6F B;  3C16 A;  1VQ8 S;  3CJ5 A;  1HMV A;  2JVR A;  3EMT A;  3DLG A;  1J27 A;  2IJF A;  1I6J A;  2AEJ A;  4XAK A;  2ZHA A;  3KLG B;  1UJ4 A;  4DR7 F;  3M1V A;  3LP0 A;  2ZIT A;  2EKN A;  1S76 D;  1GMW A;  2PSZ A;  4DR3 J;  4JB8 B;  1X4G A;  2LEP A;  2CDR B;  1T11 A;  2YKN A;  2GVD B;  1SH3 A;  3MF5 A;  3WC0 A;  3THV A;  4DSJ A;  4KFB A;  2DGS A;  3RRG A;  4LFB J;  5HSP A;  4ECS A;  1LKZ A;  1V3S A;  3HVA A;  2B5J B;  1RSC A;  2C2Z B;  5KT4 A;  3UCU P;  4OYX A;  3ETO A;  1KHV A;  4ZOS A;  1ROF A;  1L5U A;  4FPR A;  5D8H B;  1N52 B;  5E33 A;  4Y2K A;  2VFU A;  1PYT A;  1QJH A;  2XB2 D;  3EXC X;  5HBM A;  2MYF A;  3OJS A;  5ETQ A;  3LGN A;  3MI7 X;  4KGX B;  1AW0 A;  1RT3 A;  4C0O C;  4ZCK A;  1HBU A;  2G0C A;  3PG9 A;  4RLE A;  2W9B A;  4CLF A;  1JNZ B;  1GMU A;  1WWH A;  5FDL B;  1WEZ A;  4QIV A;  3MFI A;  3OQ2 A;  5MLC V;  3N0V A;  1RP5 A;  3FBF A;  5HAT A;  3FCW A;  1TL1 A;  4F02 A;  2QFI A;  3PTW A;  1BQM B;  3HVT A;  4ELT A;  1H72 C;  4LT6 A;  1MMD A;  1FFW B;  3LO3 A;  3DCA A;  1NDC A;  4OMF G;  3CWJ A;  2HAF A;  4U7C A;  3V6H A;  1C0U A;  1KKH A;  1T05 A;  4IFV A;  2G0I A;  2HHH J;  3JTP A;  4NLW A;  2EFG A;  1N32 J;  1UEV A;  1TEL A;  5B0B A;  1UJ5 A;  2V8H A;  1IQT A;  3RB4 A;  1CQM A;  3VF0 B;  1Y0H A;  2HFS A;  3MM7 B;  4JI6 J;  2MXY A;  1A6L A;  2XS5 A;  2A18 A;  3Q22 A;  3A13 A;  3W2V B;  5KFX A;  2P6S A;  2KKH A;  4J7C A;  1UCN A;  2NUU G;  1KLM B;  1YRU A;  3FBE A;  3KHL A;  1GXL A;  1TAQ A;  4PWW A;  4LSN A;  1U6B A;  4OYZ A;  1GNK A;  1VDH A;  5E3A A;  3SCJ E;  1HD1 A;  1IM4 A;  1S97 A;  3WX8 A;  3JYT B;  1O51 A;  3P8B B;  1T9U A;  4R25 A;  4LF9 J;  2JEJ A;  3LW5 C;  2UXC F;  2LQ9 A;  3ISN D;  3A3P B;  4LF5 J;  2OJ3 A;  2K3I A;  2MY8 A;  5K8P A;  1SXL A;  1HBN B;  3P5T L;  2VDI A;  3AJ2 A;  2MHE A;  2AZ3 A;  4UY8 5;  4A46 A;  4XIU A;  4IG3 A;  3S01 A;  1ZAV A;  2VC0 A;  1IBM F;  3MEK A;  1JXL A;  1IBK J;  3EVW A;  4P75 A;  1S1X B;  3WBZ A;  2FJD B;  3PRD A;  3QAE A;  2VQF F;  2MKJ A;  3SQG A;  1DQ9 A;  2HQF A;  4GRS A;  1PO6 A;  4ES3 A;  1UPM B;  2DHA A;  4M5M A;  3W9J A;  4TLR A;  2HQC A;  2E9T A;  4MAK A;  2OP5 A;  2NPI A;  4FXV A;  1M1K T;  2HND A;  3OTB A;  3SEO A;  1RBL A;  3R5D A;  3HZG A;  2Y1R I;  1KFD A;  2BE2 A;  3ADA C;  1CSJ A;  4QPT A;  3W64 A;  3GIK A;  2ABY A;  3PO5 A;  5F9L A;  5GAD U;  4NLO A;  2F8H A;  1N34 F;  1U4B A;  2GHP A;  4ZVO B;  1WHY A;  3IR6 B;  2ZE2 A;  4EBE A;  4YN3 B;  1VR6 A;  2QL7 B;  2VOP A;  1G6B A;  4CDI A;  4KHR A;  2YNH B;  4XPE A;  2R7U A;  1R0B G;  4HDG A;  3NAI A;  1RTZ A;  4PWD B;  2I38 A;  1CS4 B;  4O23 A;  2JL9 A;  2NZC A;  1SL1 A;  5KFP A;  4GKJ F;  1G1X A;  2M7S A;  3QLH A;  1RT5 B;  3ISZ A;  2DR8 A;  4OJ3 A;  1AUD A;  2E1R A;  3D4J A;  5A2Q U;  1LWF B;  2OPP A;  1S6Q A;  4ZP9 A;  2UVW A;  1KN6 A;  3TAM A;  1FFG B;  3GJT B;  2GGP B;  1SJF A;  5E3R A;  2N4C A;  1RT2 B;  3MAA B;  1VCT A;  1FJG F;  2GJ2 A;  4KHP J;  2CFX A;  4YDX A;  4ZLP A;  4ZA1 A;  4YHH J;  3QO9 A;  4LSL B;  3VZI A;  3THP A;  3T19 A;  5BYQ A;  1EET A;  1U2F A;  3MMJ A;  2R2T A;  4FVC A;  1H7W A;  2DGV A;  4G1Q B;  5IC4 B;  4MIA A;  1SH0 A;  3AY0 A;  1S7H A;  1NK4 A;  1V6H A;  2KTQ A;  4UUW A;  3ZZY A;  2UUW A;  4Y6I A;  3MM8 A;  2HQD A;  4EEY A;  1Z2Z A;  3OXG A;  4B3T J;  2FHM A;  1DQA A;  3AQO A;  5GAE I;  2CIM A;  3KDO A;  3DNC A;  5A8W B;  1KVI A;  2XSJ B;  2YWG A;  4X84 A;  2FHJ D;  3CJS A;  3LP1 B;  4DV7 F;  2WBM A;  3F41 A;  4F36 A;  1U1L A;  4JI3 J;  2CJX B;  3FZ2 A;  1HR0 F;  1VC6 A;  2RD5 C;  4J9S A;  2DY1 A;  2IBO A;  5IT9 Y;  1FDD A;  2X1B A;  3B54 A;  4H4K A;  4K0K F;  4DXL A;  2EFQ A;  5J2M B;  4KPY A;  4ZKA A;  2E9Z A;  2KI2 A;  3SDE A;  2BR0 A;  4DR1 J;  3DM2 A;  2AJ2 A;  2CZ9 A;  4WII A;  1NEE A;  4NEY A;  3VAG A;  2CVI A;  3Q83 A;  4DSE A;  5HI7 A;  1IJF B;  4DR2 F;  2ILY A;  4P10 A;  5F8L A;  3BQ0 A;  2JDJ A;  2J9C A;  4B3M F;  2OO4 A;  2W9A A;  3PKM A;  4K4T A;  2B9X A;  5LMN F;  3DLK B;  3I32 A;  4J9R A;  1RLC L;  1GXT A;  1U1M A;  3OVB A;  3T5J A;  2YNI A;  5HJY A;  4GC7 A;  3SV4 A;  2LXI A;  2F4V J;  2J7K A;  3MOZ A;  3DOM A;  3NS6 A;  2G2O A;  3C16 B;  2O3D A;  3DLG B;  3O3L A;  2XZW A;  3TUJ C;  3WIU A;  3N5B A;  1P1L A;  2FJE B;  2RDJ A;  1S49 A;  4C98 A;  5G0R B;  2HVH A;  1F0X A;  3GSI A;  5LSL A;  5C2G A;  2GVZ A;  3CO0 P;  2V2V A;  3M1V B;  3LP0 B;  3HFV A;  1U2R A;  3KDN A;  4ILL A;  4ECR A;  4U7U D;  1JX4 A;  2KXN B;  3EJM A;  2YKN B;  4CYU A;  5I3P A;  2R7X A;  2CZ4 A;  1UVK A;  4O3P A;  1WSV A;  3DKD A;  2KYX A;  2H4W B;  1RYR A;  4FPI A;  4KFB B;  1HWK A;  4X66 J;  2ZD1 A;  1R8B A;  2MKI A;  2CPZ A;  1KQF B;  3SI8 A;  4FYY B;  2I5J B;  1ULR A;  3PFO A;  4DV2 J;  5KFW A;  1DQ8 A;  4DSK A;  4QWD A;  3EUN A;  1X9M A;  2KDO A;  2IA0 A;  1L3K A;  3DI6 B;  2HAI A;  4F4K A;  2OIH A;  3H42 A;  3PJW A;  1RT3 B;  1SIW B;  4ZVQ B;  3K0J A;  1HBU B;  3UD3 P;  1GXU A;  3IXQ A;  4NCB A;  3MEE A;  5B7W A;  3CCE S;  4JI0 J;  1AZS B;  5DZ6 A;  3N6M A;  3OFG A;  1NDK A;  3CMA S;  2E5L F;  3RR7 A;  3MXH P;  1PJ6 A;  3QNW B;  2BW2 A;  2B4P A;  3T6B A;  4JV2 A;  3B6B A;  5LXY A;  2HBR B;  1UMJ A;  2LEA A;  3HVT B;  1UWB A;  4A8S A;  2BQ3 A;  1JLF B;  1NB2 A;  1NKE A;  1EAY C;  2LU2 A;  2X1A A;  2QYG A;  2RQC A;  1TV6 A;  1SI9 A;  4NA1 A;  5U47 A;  1C0U B;  1R31 A;  2RQ4 A;  3CCQ S;  1T05 B;  2Z57 B;  4IFV B;  2ZH5 A;  1NH8 A;  1P8G A;  1UVL A;  5E3Q A;  3AA9 A;  1WF2 A;  2V2Q A;  4P71 A;  1YTY A;  1RHJ B;  2NXC A;  1RAH B;  2YH1 A;  2YPY A;  4UT4 A;  1SJ1 A;  1VK8 A;  4NCG A;  3OL7 A;  2W2P P;  4N56 A;  1RA6 A;  3HI9 A;  5GAG U;  4DR5 J;  2J5A A;  2XNQ A;  4O3R A;  3NNA A;  2JFK A;  4Q5V A;  1NXI A;  1UZH A;  4X4N A;  3T1H J;  3TVK A;  1ZH5 A;  3MEG B;  1S9G A;  2MZT A;  1TMM A;  4LVO P;  1R89 A;  2VPW B;  2LP4 A;  3SCL E;  1RDR A;  2CJK A;  2IMW P;  2MQ8 A;  4WFA Q;  4QZV B;  2BOA A;  4RW8 A;  1GTH A;  2CJA A;  2G9O A;  1RTD A;  2H54 B;  1ZTT A;  5F8I A;  5RUB A;  4WTO B;  1S48 A;  1KDN A;  2VFV A;  1HNW F;  4FF4 A;  1FEE A;  2Q3P A;  4DV5 F;  5J1E A;  3KG0 A;  2QL5 B;  4F50 A;  1QD1 A;  2O1P A;  1R6Y A;  2F7V A;  4TY9 A;  4C8N A;  1A7G E;  4PYD A;  4XTT A;  2U2F A;  2IVY A;  3FRY A;  2JSX A;  4CLP A;  5HN0 A;  5IS2 A;  3SQG B;  3I5A A;  5DG7 A;  1LFW A;  2HW3 A;  4AXI A;  4OL8 A;  2OEK A;  4DV1 F;  1XQI A;  5F0W A;  2YWW A;  1GQE A;  3MR3 A;  1UAW A;  3TOQ A;  3K8W A;  4AD6 A;  5KFV A;  4J9V A;  5DDP C;  3AXM A;  3GIL A;  4M94 A;  3MUV P;  2DXD A;  2HND B;  4E8U A;  1CJT A;  3DHX A;  2YWH A;  4FF2 A;  2HUR A;  1WG5 A;  3LAK A;  4C8Z A;  3FSY A;  1WI6 A;  3RGI A;  2BE2 B;  2W24 A;  3BPS P;  2E1P A;  1U0S A;  5HMX A;  1XBW A;  1RBO B;  1CPZ A;  3NOG A;  3HP6 A;  4B3S F;  1DZ5 A;  2WVD A;  2HIQ A;  4QJV A;  4F4Z A;  5F8N A;  1GTE A;  2R2S A;  1RWV B;  2ZDO A;  4ZMM A;  5AXM A;  2LQ5 A;  1R7I A;  1VHF A;  3RU0 A;  1FKP A;  1L3U A;  2ZE2 B;  2DD8 S;  2OAU A;  3GON A;  4MYT A;  1VBX A;  1Q8I A;  4DPU A;  5KG7 A;  2XS2 A;  4WPA A;  3DXS X;  2OD6 A;  4IQM A;  1OY6 A;  2UZA A;  2B51 A;  1E6V A;  4FBU A;  1NDP A;  2Q43 A;  3UDV A;  1HAR A;  4L74 A;  1I3O B;  2EFN A;  3QLH B;  3KG1 A;  1FX2 A;  3M8Q B;  1EJ7 L;  3CCT A;  5K14 A;  1SCJ B;  2VG7 A;  3QRP A;  3M30 B;  1F1B B;  1VC5 A;  3EIC A;  3ENQ A;  2E9R X;  3TAM B;  4WFB Q;  4TU8 A;  2MZ1 A;  1OQ3 A;  1UVI A;  4X4P A;  3OSN A;  3A3O B;  3CVK A;  1DTT A;  1PAU B;  2KFZ A;  3BKT A;  4MTP A;  3ZTP A;  2EK1 A;  3FEX B;  4ZJL A;  2IYI A;  2HGM A;  4CIO A;  1HFE L;  2MZQ A;  4AT1 B;  4LF6 J;  3NCQ A;  2AEF A;  3A8J A;  4WFN Q;  2IRX A;  5EN1 A;  1EET B;  1YKW A;  3PVX A;  2V6A A;  5K8N A;  4O4G A;  2VQE F;  2UVR A;  3CUL A;  3ILO A;  4B02 A;  3IRX A;  3ZTO A;  4CT8 A;  4I7F A;  3NWR A;  1ICE B;  1RE1 B;  3DC2 A;  1XWL A;  4X62 J;  2C3Y A;  3MM8 B;  4WTY A;  1VLY A;  1IBC B;  1SC6 A;  1Q8L A;  1FK9 A;  1FEH A;  3C6T A;  3M8Y A;  2Q1L A;  1TZ0 A;  2B4V A;  5KG5 A;  4OYM A;  1Y3K A;  2RE1 A;  4U9R A;  2W2M P;  2AZ1 A;  5A6W A;  1N36 F;  2V2K A;  2K1R A;  3M9O B;  5CA5 A;  1OSD A;  4JYA F;  1X4F A;  1HNX F;  4KR0 B;  3P6Y C;  2X7I A;  3BZQ A;  4QBU A;  3Q8V A;  4ZVF A;  3KK1 A;  1FNM A;  3AAW B;  2J7U A;  3ZC4 A;  1LWC A;  1FXR A;  1SUQ A;  5B0G A;  1ITP A;  5E3P A;  3MCS A;  2XM3 A;  3S6E A;  2VJV A;  4TKT A;  1XR7 A;  2B9E A;  2DVI A;  3MM5 A;  4K4Y A;  3FJ2 A;  3VR1 A;  4ALZ A;  2UUC J;  2FZG B;  3GV5 B;  1YJR A;  2UU9 F;  2HQI A;  1WF0 A;  2K7J A;  4DV3 J;  2LCW A;  5J2Q A;  3SDE B;  4ED6 A;  2BJE A;  3DM2 B;  3HJV A;  4OHY A;  2I6W A;  1IBL F;  4RZR A;  2C3O A;  5ETO A;  3R97 A;  3BGU A;  2BX6 A;  2WAQ D;  3TA0 A;  1FRM A;  4RWX A;  2QEX S;  2LDI A;  1UZD A;  2MTL A;  1NCL A;  3AOB A;  1BD6 A;  1D9F A;  5C5J A;  3HM9 A;  3P96 A;  5I42 B;  3BRE A;  3GZ7 A;  3HHE A;  3MED A;  3MFH A;  4ZHR A;  3DOM B;  1EQ0 A;  4CLS A;  2IJN A;  5J2N A;  4ZP8 A;  4LRC A;  1HI0 P;  2KXH A;  3FVY A;  2VPZ B;  5ITH A;  4ZVR B;  2H9Z A;  3DRX A;  2N7C A;  5CXT A;  5ETL A;  3SMZ A;  1IKW A;  4CLU A;  3DOK A;  2GVZ B;  4LFB F;  3HT3 A;  3TO8 A;  4O44 A;  3J7Y U;  4ANE A;  1FJ7 A;  2GQQ A;  3FEZ A;  3W60 A;  4UST A;  3O5T B;  3DRS A;  4BWM A;  3AQP A;  4CYU B;  3OR2 A;  1BUX A;  3T5K A;  3J7Z 5;  3H8Y A;  2GIR A;  3KLF A;  1QVF R;  3MUR P;  3D7S B;  3UFC X;  1SQE A;  2AJ1 A;  1FRH A;  3LOU A;  3PKY A;  1XMO J;  1ZM4 A;  1KOO A;  4ECQ A;  1MN9 A;  3PRB A;  4B9L A;  2VBZ A;  4NLX A;  2CJ9 A;  4ZCI A;  3IP0 A;  4QWB A;  4WK3 A;  1OPZ A;  3HX9 A;  2D69 A;  4ZLN A;  2M52 A;  1G7C B;  4DPO A;  2OPR A;  2AGO A;  2IDE A;  1QDU B;  3MEE B;  1U26 A;  5H9E J;  2CPI A;  5GVQ A;  5THW A;  2CNL B;  3N28 A;  3ENV A;  4LJM A;  4GO7 X;  3UO0 A;  5ETN A;  1Q86 T;  4MT1 A;  4DV0 F;  2BM0 A;  3CJ3 A;  1N6Q A;  1FD8 A;  3OLB A;  4GVB B;  3HSJ A;  5DG8 A;  5HMZ A;  3ZZ0 A;  3Q89 A;  4NLD A;  1PYS B;  1VS3 A;  2HWH A;  1N4L A;  3SXL A;  1TV6 B;  4NAS A;  1TK5 A;  3R1L A;  1D09 B;  2QFJ A;  1RCO B;  1URN A;  3KJF B;  1SJ3 P;  1SL2 A;  2WON B;  1XNQ J;  4IO9 Q;  3X3U A;  4J9L A;  1X5P A;  3M32 B;  4QW8 A;  1ZM3 A;  3FC9 A;  4AXJ A;  2M3D A;  1RAJ A;  4H4O A;  4LR7 A;  1OO0 B;  3CIZ A;  3H0P A;  4DFJ A;  3H25 A;  4DL3 A;  3M2R B;  5IT9 U;  4OYP A;  4M95 A;  2HBQ B;  2WW4 A;  3KJQ B;  3TJ9 A;  1KVJ A;  2LA6 A;  4C48 A;  4OYA A;  1FO1 A;  1HWU A;  5DM7 Q;  3OUY A;  3CC2 S;  4H54 A;  1VJW A;  2RH3 A;  1N88 A;  4KKO A;  3VTI A;  4JOU A;  1PBA A;  1KQS R;  1IBK F;  5E0O A;  4NRT A;  4A8W A;  4OHZ A;  2FGC A;  4ZPT R;  4RW8 B;  4YB7 A;  3W5X A;  2K7K A;  2XUL A;  3HUL A;  2AJ0 A;  4EBD A;  1RTD B;  4PCQ A;  1WKJ A;  1KRP A;  4P2S A;  3KMQ A;  3L09 A;  4ECX A;  3NXZ A;  1NJY A;  4NLV A;  4X4S A;  2XBP A;  1N48 A;  3LP2 A;  2N3O A;  2AF6 A;  5J1E B;  2QA4 S;  3D54 A;  4ZCM A;  5CCM A;  4JI8 F;  1T9V A;  4DQS A;  3QSI A;  4NWB A;  3QWU A;  1FRJ A;  2EG2 A;  1UEK A;  1J5E F;  2D1C A;  4F4A A;  4DX5 A;  1F2H A;  2CKW A;  1U0H B;  1MRO A;  2BKO A;  2CPE A;  2FVC A;  3P49 B;  1SJR A;  4P7T A;  4LF4 J;  2DK2 A;  5DO2 A;  4CNY A;  4XDC A;  1RA7 A;  2CWX A;  2O5D A;  1ZA1 B;  3TQ1 A;  2WRM A;  1WTB A;  1CJT B;  3H5X A;  1FRX A;  2CPJ A;  2B7C B;  2V4R A;  1I94 J;  2JHE A;  4QR0 A;  4FKX A;  1BQX A;  3OR1 A;  2UVV A;  4TXS A;  5ETR A;  2Y8W A;  1PIE A;  1T03 B;  2EXU A;  2ERR A;  3M9M B;  4DBQ A;  5DS7 A;  4LFC J;  2DH7 A;  3UWT A;  2QA2 A;  2DTJ A;  2VG5 B;  3KLE A;  4NLQ A;  2DNG A;  3BGL A;  4M5L A;  3PX0 A;  2OEL A;  1T7P A;  2L41 A;  2HFN A;  3BQ1 A;  1LEO A;  3MMC A;  2DKO B;  1E6V B;  1Q95 G;  4WYL A;  3IO1 A;  2ZC4 A;  1VQ6 S;  1TL3 A;  2HSE B;  5C42 B;  2ZM6 J;  4AL5 A;  4LBP A;  5JMN A;  1REG X;  2ASJ A;  2GC8 A;  2M0G B;  3PV8 A;  4PQA A;  2HWI A;  2KXF A;  4UF4 A;  2EFP A;  3D1O A;  4J9P A;  1WI8 A;  5HLF A;  2CYY A;  2JWN A;  4DLE A;  3O1L A;  1R8C A;  4AFF A;  4CTA B;  4ES1 A;  2DXE A;  3D28 A;  2X3D A;  4Q0B B;  1EHW A;  3OTE A;  3OD2 A;  1HWI A;  4PXB A;  2CUY A;  3CSK A;  2VHG A;  4NML A;  4DQP A;  3CJK A;  5B0E A;  5FLX U;  3T1Y F;  3VV2 B;  2LDY A;  1MWY A;  2ZZN A;  4B3R J;  3G6Y A;  4U7U K;  1FDN A;  1NSP A;  3EGV A;  2ZVS A;  4Q44 A;  4RW7 B;  5BR8 F;  2RUS A;  3MTK A;  4FS2 A;  3BSN A;  1V9O A;  3UDE A;  3T5L A;  3D67 A;  4OJG A;  5D0G A;  3FBC A;  9ATC B;  2R7O A;  2R7V A;  3NG8 A;  1B0V A;  2IBK A;  1T9W A;  1S9F A;  5AJ3 J;  3UN5 A;  4JI3 F;  2FY8 A;  8ATC B;  3C6T B;  4USH A;  2FY1 A;  2M8H A;  1KQG B;  3GG0 A;  2MKS A;  2X51 A;  1OMS A;  4ZVH A;  3IMQ J;  4O0N A;  3UDC A;  2M70 A;  5K8O A;  2M9K A;  1MMN A;  3B82 A;  2H65 B;  3OLA A;  4ETX A;  2BM1 A;  2KG1 A;  4DL4 A;  2IDL A;  3DLE A;  4DR1 F;  2PN6 A;  3WIV A;  1LWC B;  2MEW A;  4JI1 J;  3BN4 A;  4B3O A;  3D3B J;  1WEY A;  1KON A;  3A1Y G;  4DFK A;  4C8O A;  1VBK A;  2JEF A;  1GX5 A;  2OFG X;  4RO0 A;  3O44 A;  3MM5 B;  3CJT A;  4TY8 B;  2I8E A;  2YNF A;  4DR6 F;  2X3G A;  3MPD A;  4P2F A;  4RW4 B;  4OX7 A;  3NS7 B;  2RUG A;  5J2Q B;  4UOH A;  3MEC A;  3C14 A;  3G6E S;  3PW5 A;  2VA2 A;  2G1H A;  3PHE A;  4I64 A;  1HBM B;  2JLF A;  4WWS A;  1VFJ A;  3J80 U;  4I2P A;  1N5V A;  3ELH A;  2A2C A;  4OV1 A;  2MMY A;  4ID8 A;  4EI2 A;  2DHH A;  1N5Q A;  1WC0 A;  1UVN A;  1RHU B;  4NYO A;  2ZJR Q;  1NO8 A;  4ZPA A;  3MED B;  3OXL A;  2OI2 A;  4C6A A;  4ZHR B;  5EHH A;  4USJ C;  1RWM B;  2BDP A;  2RIJ A;  1XER A;  4NLR A;  1MWQ A;  4DQR A;  1ZYQ A;  1IKW B;  5T7L A;  5IT0 A;  1H7X A;  1A0O B;  4O44 B;  4RBU A;  1I5O B;  5EWE A;  1Y3J A;  2R7S A;  1AB8 A;  1JKH A;  3HO1 A;  3QSY B;  5KFN A;  1TK8 A;  2BZ2 A;  1RT6 A;  3NBP A;  3JSR A;  1YIJ S;  1RAF B;  3QIP A;  4A8F A;  2JEG A;  5HL7 Q;  3C2P A;  3HVR A;  1KEK A;  1K8A T;  3MPV A;  1HIY A;  2FZK B;  4FXW A;  4PPZ A;  4ID5 A;  3UVJ A;  1X4A A;  4ZPC A;  2KN4 A;  3AD7 C;  3JSM A;  3MOJ B;  1Y5N B;  4QYR A;  2UXD J;  1QAI A;  3QGP A;  4PG8 A;  2A2D A;  1KFS A;  2EC0 A;  5L9X A;  4NXN J;  1RTI A;  3C46 A;  4ED7 A;  3LWL A;  1C2P A;  3I0S A;  1R0A A;  2OPR B;  2VV5 A;  4XK8 C;  1RHQ B;  4WK1 A;  2RU9 A;  1CLF A;  3M2U A;  4QOT A;  3A12 A;  5M2U A;  5D3G B;  4OX9 J;  1F6T A;  1AA1 B;  4FDF A;  2YKQ A;  4N76 A;  1T0T V;  1S1T B;  3HHL C;  3V2U C;  2DHG A;  1U02 A;  1GFW B;  3C8Y A;  2BOP A;  3EGN A;  2EI5 A;  3RB0 A;  3FNN A;  5B0C A;  1T94 A;  2MB0 B;  3I4P A;  1LNQ A;  4HI1 A;  3IBW A;  1RXO B;  4AYB D;  1KR4 A;  1S0N A;  4R8U B;  1C0T B;  1O5J A;  2R3V A;  3CDA A;  3PRV A;  1D8Y A;  1EIY B;  2IM3 A;  2J9D A;  2BQU A;  1F3F A;  3RBE A;  2V8P A;  1LXJ A;  2HPU A;  4EO8 A;  1TQL A;  2ZVI A;  2E7X A;  5KT2 A;  4QIW D;  3PW0 A;  6AT1 B;  1NAQ A;  4DPT A;  4PZV A;  2DEJ A;  5KFT A;  2LXF A;  3KLH A;  1B7Y B;  2RRN A;  3TEG A;  1H73 A;  3VAK A;  1S4F A;  3G87 A;  1EZZ B;  3BYP A;  2RVJ A;  1FTR A;  1RWK B;  1TAU A;  3ZNJ 1;  1MG7 A;  4BCA A;  5F41 A;  3G9C A;  1EAR A;  3CED A;  3RB3 A;  3T6J A;  3GCX P;  4ZVG A;  4MMO A;  2VL1 A;  4Q45 A;  2MGZ A;  3OUY B;  3CPW R;  3TAP A;  4A8K A;  2HNZ A;  3BKF A;  3VWS A;  1IXK A;  3MCN A;  3QRQ A;  4V1A k;  1VQ5 S;  3U02 A;  4V19 J;  3IWX A;  4DJB A;  3MM9 B;  3HFZ B;  2LMI A;  2Z0G A;  5K9F A;  2WOM B;  3I55 S;  1IR0 A;  1K9M T;  3DLJ A;  2HMI A;  3LP2 B;  2VPY B;  3Q2S C;  1SKS A;  1BHN A;  3EDR B;  2IPO B;  2HYI B;  2PGC A;  4ZDN A;  2OKQ A;  3M6W A;  1FWK A;  2A6O A;  3L7U A;  3R27 A;  5DG9 A;  2LXU A;  3HSD A;  3P4U B;  2V8G A;  1XR5 A;  1MRO B;  2DNH A;  2NZ4 A;  4J9Q A;  4B9V A;  5IWA J;  3FFI A;  1NSQ A;  3RRK A;  2D3U A;  1HL6 A;  5GME A;  6FD1 A;  2C22 A;  4KE5 A;  4TU7 A;  1IKY A;  3PM9 A;  3MR5 A;  1IM6 A;  3PAC A;  3CT9 A;  3VAL A;  4FNI A;  3TUI C;  3G82 A;  2MQL A;  4OZJ A;  5JUM A;  3GQC A;  1KLN A;  3QGH A;  5E41 A;  3SSR A;  1KBR A;  2Z8Q A;  3AHP A;  4RWW A;  2XMW A;  3KMS A;  2D3Z A;  5HAN A;  2NR0 A;  3NKY A;  4OYO A;  3K5M A;  4LF1 A;  1UFK A;  2C3M A;  4OHV A;  3KLE B;  2XMM A;  4LF8 J;  2V9K A;  4HT5 A;  2IYG A;  3K5L A;  4XPC A;  3K89 A;  1T95 A;  1OWX A;  2A1B A;  2VDH A;  3MMC B;  3EVM A;  3DXB A;  1TL3 B;  1TL4 A;  1VQ9 S;  1Z2L A;  1K47 A;  1C1B A;  2RKI B;  5A2Q Y;  3LF0 A;  1RT1 B;  5HLF B;  3GU0 A;  4OV6 A;  4Z7Y A;  3FUY A;  2BJ3 A;  2B3T B;  3JTO A;  2Y8Y A;  2N3L A;  3VAF A;  1HPZ A;  4F4W A;  3BM7 A;  2HHQ A;  4HH0 A;  1RYS A;  2PO4 A;  4ECW A;  2Y1J A;  3CC7 S;  4RW6 A;  2LKZ A;  5IC6 B;  4I6W A;  3CJK B;  1DUR A;  1DRZ A;  3TVY A;  4LFA J;  2HVD A;  2BAN A;  4X62 F;  1YJV A;  1UEU A;  1N33 J;  3KJV A;  5KFC A;  1HNZ F;  2QMU B;  2C2K B;  4QR2 A;  1B64 A;  2CG8 A;  4KYZ A;  2QE5 A;  1X4B A;  1YSJ A;  3CD0 A;  5D15 A;  1KSP A;  2XSF A;  1VRT B;  3TA2 A;  4CO2 A;  4KQZ A;  2OPQ A;  1SPB P;  2O67 A;  4A8O A;  3GV8 B;  4I68 A;  4LRE A;  3US5 A;  2JVO A;  2MPU A;  3RUB L;  1RTH B;  5F8M A;  2DPJ A;  1FKO A;  3GFH A;  3G71 S;  5EUH A;  1TTH B;  3KUG A;  2OMO A;  3TZZ A;  2YXL A;  4X4V A;  4JV5 F;  2AYB A;  4B08 A;  2FC9 A;  3UPF A;  2HZC A;  3CF5 Q;  1NJZ A;  3MHY A;  2CPY A;  2ZKT A;  4DN9 A;  4OX8 A;  4K50 A;  2PT0 A;  4C4W A;  5CYM A;  2BA9 A;  3CCW A;  1WOR A;  4KGV B;  1T8E A;  1DY3 A;  1XJW B;  4JI7 J;  3DLE B;  1ZAW A;  1U45 A;  4KY3 A;  1IJE B;  2GIF A;  3C3L A;  3I4H X;  3N01 A;  4B3O B;  4F3O A;  5KFR A;  4DQI A;  2HHS A;  4K59 A;  3LA0 A;  1N56 A;  4NMX A;  1UP1 A;  5GAD I;  1N5Y A;  4LF7 F;  2A3J A;  2R8J A;  4DV6 J;  1PC5 A;  2WHO A;  2ZH4 A;  4N8N A;  3FZB A;  4RBT A;  1W7W A;  1VRQ C;  1YZ6 A;  1VRU A;  3C14 B;  4WKR A;  4U8V A;  4Y00 A;  4TVA B;  1JNR B;  5L39 A;  3UQS A;  3JSY A;  4RU2 A;  2ASL A;  3GII A;  2NXU A;  2YKP A;  4LQ9 A;  3TZW A;  3TEH B;  4X65 F;  1YJW S;  3W2W A;  2HVI A;  1HNI A;  4I2P B;  2EW9 A;  2VG6 A;  4USW A;  2SXL A;  2O66 A;  3NGT A;  1WC6 A;  2L08 A;  2NCK L;  3EPI A;  1TFW A;  3M8P A;  4PUO A;  2NLW A;  1HNV B;  2KO1 A;  2JZ5 A;  2DNP A;  3JQM A;  1REV A;  2BYC A;  1SQG A;  3TWZ A;  3DN9 A;  3KYL A;  2JH3 A;  2UUA F;  2XZD B;  4OI3 A;  3FKB A;  5T7L B;  1SQF A;  2UXB F;  2AT1 B;  4DUZ F;  5KG2 A;  1Y5L B;  3A3N B;  1RAA B;  2PC6 A;  1XMO F;  1LK5 A;  3HHL D;  3CO9 A;  1JKH B;  3G6X A;  4N77 A;  4YR0 A;  2EKY A;  2VUG A;  1VMB A;  4DU8 A;  1RT6 B;  2VFS A;  2UVU A;  4J9M A;  2OH2 A;  2PII A;  4YB5 A;  2DGT A;  2ZOF A;  3DRY A;  2NRE A;  2HIY A;  1TP7 A;  1BWV A;  2H3E B;  4DL2 A;  2ZUA A;  4YR3 A;  4ID5 B;  3UVJ B;  1QVG R;  3BGO P;  4EWT A;  1FI4 A;  3JSM B;  5KFJ A;  3RBX A;  5HMY A;  3K59 A;  3T3F A;  3QT8 A;  3EM1 A;  1JLA B;  1FER A;  3CJ4 A;  2FC8 A;  5CD4 A;  1VIX A;  3I9Z A;  1RTI B;  4J91 A;  3MDF A;  4USI A;  4DEZ A;  2LLZ A;  2XMU A;  1HKA A;  3I0S B;  3DRR A;  1R0A B;  2CQ0 A;  4ETZ A;  3DRP A;  5J2P A;  1U6Z A;  3M2U B;  1MU2 A;  4DUT A;  3CB4 A;  1D9A A;  3BO2 A;  4YR2 A;  1RUS A;  3KJN B;  2C2O B;  3NGS A;  5JVG Q;  4A8Q A;  2MKH A;  4DX7 A;  1HHQ A;  3G8S A;  3OHA A;  2BKN A;  3ILJ A;  4ZIT A;  1XC9 A;  1MSW D;  3EVO A;  4IRC A; 
#chains in the Genus database with same CATH homology
 2VHG A;  2XM3 A;  2A6O A;  2VIH A;  4ER8 A;  2F5G A;  2EC2 A;  2XMA A;  2FYX A;  2VJV A;  2XO6 A;  2F4F A;  2VIC A;  2VJU A;  2A6M A;  2XQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...