4HI2A

Crystal structure of an acylphosphatase protein cage
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
QCSKFIVSGHVQGVGFCYHTSHQGLKLGLTGYAKNLNNGDVEVVACGTPERLEELYLWLQEGPKTASVRQVRRLSSELEHDYQGFEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acylphosphatase
publication title Crystal structure of acylphosphatase C20R mutant from Vibrio cholerae0395
rcsb
source organism Vibrio cholerae o395
total genus 22
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4hi2A00
2IYGA 1YRXA 2HQIA 3FRYA 2N4CA 3HHLC 4Y2KA 4YDXA 5K9FA 2XMKA 2QLWA 2KT3A 3DCAA 2IFXA 5IXUA 1SI9A 1TUVA 1VQYA 1XBWA 2HLUA 3HHLD 1GXUA 1FESA 2N4DA 3VTIA 2OD4A 2QYCA 2RU9A 4OJ1A 1OPZA 2OMOA 2GCFA 3CJKB 2N7YA 4FNIA 1WD6A 3LO3A 4HL9A 3TNVA 1N5QA 2ACYA 2XMTA 3CJKA 3LGMA 1FD8A 1N5VA 1VQSA 2XMUA 3BN7A 2RMLA 1Q8BA 2AJ0A 4A48A 1Y0HA 2AP6A 1RJJA 4OJGA 3QGPA 2AW0A 2XMMA 2RILA 2K1RB 3HDSA 1Y9OA 2KT2A 4DN9A 2OKQA 1ULRA 1AW0A 2OP5A 2JDJA 5B0EA 1TR0A 1MWZA 1P8GA 2K1RA 2GGPB 1TL5A 4DPOA 5B0DA 2K7KA 4ZA1A 2G9OA 4A46A 1W2IA 2K7JA 2BUNA 1FE4A 2FHMA 5B0CA 3HF5A 1JWWA 1Q4RA 2GGPA 2ROGA 4QOTA 2ROPA 1SQEA 1X8DA 2LQBA 1JK9B 3MZIA 2QLXA 1LQ9A 1SB6A 3BB5A 1R6YA 1P6TA 2CRLA 4F67A 3LGNA 5A6WA 1KQKA 3BF4A 2RSQA 4OJHA 3KKFA 2GFFA 4HI1A 3MCSA 4ZOSA 2Q3PA 2FB0A 2OAUA 5B09A 1Q53A 1YJUA 2BYCA 5B0AA 3BGUA 4Y2MA 3TOQA 5F0UA 2W4DA 1Y3KA 3I9ZA 4HI2A 4Q2MA 3TRGA 3BR8A 3KG1A 2W4CA 1QUPA 3T9NA 1YJTA 3FMBA 3WDOA 1N5TA 4Y2IA 1MWYA 3E8OA 2LXFA 3BDEA 2LQ9A 2GV1A 3QMQA 1FEEA 1TL4A 1X0PA 1V3ZA 1YJRA 2HFOA 1KVIA 1OQ3A 2BBEA 3DXSX 5B0GA 5B0FA 1CPZA 2BJEA 2FTRA 4A4JA 4EFAC 1OSDA 1IUJA 1X7VA 5B08A 2HIQA 1CC8A 5T7LB 2KKHA 4OJ3A 3BM7A 1N5SA 2XMWA 2XMJA 5KAKA 2EW9A 1S6UA 2K2PA 5T7LA 1APSA 1FE0A 2GA7A 2OFHX 5F0WA 2QIFA 2IYIA 4HH1A 4NPOA 2ROEA 4U9RA 3IWLA 2BJDA 1URRA 1TZ0A 3HHLB 1KVJA 1S6OA 2PD1A 4Q2LA 5A6PA 2VV5A 3GZ7A 1YG0A 2AJ1A 3HHLA 3FGVA 3HX9A 4FNHA 5B0BA 2LDIA 4HH0A 2ASYA 2XMVA 2ZDOA 2OD6A 1K0VA 2VH7A 4YEAA 2L3MA 4A47A 2HLTA 1AFJA 3UDCA 1CC7A 3K7RA 3KNGA 4OIXA 1GXTA 3KG0A 3IWXA 3HFKA 4NL5A 2FIUA 2OFGX 1FVSA 2HFNA 1YJVA 1AFIA 2KYZA 3F44A 1FVQA 1Q8LA 2ZDPA 2W4PA 4DL0C 2GO8A 1Y3JA 1OQ6A 2PGCA 1U7LA
chains in the Genus database with same CATH superfamily
2GVDA 2G0IA 1KN6A 3HVTA 1GTHA 1HI1A 3AHPA 4Y0FA 3NY0A 3CJKB 4RW9A 2ATCB 2N3OA 3C15A 3SQGB 2CQCA 4J9UE 5D0RA 4DHVA 1WF2A 4Q0BB 2DY9A 4KO0B 3NGSA 2XMAA 1BWEA 3MCSA 3IG1B 1T03A 3FDSA 1S9FA 3UN3A 4CNZA 1N8RT 2EG1A 1QUPA 4IOCQ 4RW7B 4NRTA 3THPA 2DYAA 4J9MA 2PMWA 1SKUB 3G86A 3GJQB 2EK1A 4CLZA 4ECTA 3HI9A 2GS8A 5K8OA 4MK9A 1KNZA 4P7VA 2OJ3A 2H4YB 3PRBA 4FNHA 3OD2A 2GIRA 1U0SA 3ZZUA 1W2BR 4ZITA 2XS2A 1FDNA 1HPZB 4KPYA 2XTJP 2Z4PA 4C11B 3CT9A 1OY8A 4LQ9A 5BR8J 1GX5A 1L3VA 1TFWA 1RAGB 4JI8F 2J7UA 5HAOA 5DG7A 4LVNP 2N7YA 1B3TA 3DHXA 3MXHP 3GU0A 1FKPA 2IM1A 2NPIA 1BMQB 2CJYB 4V1Ak 2VBYA 3KLVA 1H73A 1GMVA 2B9EA 3FQKA 2RRNA 4KC5A 3HHDA 3OFFA 3QIPA 2F8MA 4EWTA 3BEGB 4OV6A 2DNNA 1Y3KA 4F0MA 4WFZA 4WKYA 1RT7A 3OTDA 4LF9F 3KUEA 2JJ4D 2CPXA 4N8NA 1CPZA 1VQ4S 2XB2D 2ZH6A 2J5AA 3RBDA 4ZVRB 3A8KA 3ETOA 1S6OA 2ZHAA 5CHCB 3QRPA 2UVUA 4NA1A 2YXLA 1FRXA 3MM5B 1H2VZ 2KM8B 2FIUA 3CDUA 2WBRA 1RISA 1B99A 2B9XA 3AJ1A 4IH6A 1FWPA 1HMVA 3ISNC 1RABB 2DRDA 5D77A 2J8AA 2UVWA 4YDDB 1RAFB 4OYMA 4UZCA 2GGPB 1FNOA 4FN5A 3HZEA 3CCRS 1T94A 2Q66A 4KBIA 2ZH8A 2VBXA 3CDBA 5DQHA 3GFYA 4Y2IA 4WBFA 1S1XA 4XO0A 4KV8B 1KLMB 1RT2B 1JX4A 2RHQB 5DG8A 4F3OA 1XNRJ 4ED0A 2K2PA 4PG6A 4KFBB 4OZ2A 5IQ6A 2C2ZB 3H4BA 1WG5A 4Z7YA 2R7WA 3HO1A 2BANB 3W63A 1NO8A 3MEDA 1YJWS 3ILJA 1XC9A 4CQ1A 4LSNB 2M9KA 3KNGA 4MKYA 3U02A 2PSZA 3R9LA 2HZVA 3M7VA 1OQ6A 4DZ6A 1RTIB 3DOMB 1RTHA 3HVAA 4DUYJ 4F3MA 1JLQB 4NZ0A 3KHHA 4OHYA 3AT1B 1EP4B 2X3GA 3NWGA 3VGTA 2EKNA 1DAXA 4CO5A 2HFZA 2KG1A 3KJQB 4PUOA 4C4WA 3M8WA 1Y7PA 4P2SA 2ZWPA 2UXDF 3TYTA 4M5MA 2CQ0A 4X4NA 4Q2MA 1PSDA 1YIJS 2EKYA 1RGVA 5HMYA 5D6GA 3FUYA 1V3ZA 3QWUA 3H8YA 1IWGA 5J1NA 1S1VA 3OFEA 4Y2CA 2JFKA 5EX3A 2CQHA 1BQNB 2BR0A 4ZPVR 4BC9A 1XERA 1FFWB 4QW8A 3CCLS 1DTQA 3ISZA 1N0UA 1EQ0A 4DSEA 2LDIA 2G2OA 2VQFF 3VAFA 3GFZA 1S79A 1Q8LA 2PGCA 3MD3A 3FSXA 1IBKF 3F73A 5FDLB 1WEXA 3HHNB 4NX9A 3SSSA 5DETA 1BQMA 5KOWA 1BQXA 3BPDA 3M30B 2W24A 2DNQA 3NRBA 2K7KA 4M5GA 3NP5A 2LA4A 1C4AA 5LL6d 2LCWA 4LRDA 1WI6A 3D1QA 1S9EB 5LMNF 1FERA 3EWGA 5IWAJ 4YMEA 4X4VA 4P75A 1KVIA 1ZOTA 5HJYA 5GAEI 2CDQA 2LFVA 1GXLA 5HK4A 5H9FK 2XMWA 4RX6A 2ZZTA 3GJSB 3IWLA 4X66F 4RL1A 1SXLA 3ZZOA 2ZJPQ 4Y3CA 3C16A 1HNVA 2JRSA 3SXLA 2G1DA 2DKOB 4DU7A 2MQLA 1RACB 5LMUF 4YHHJ 3FRYA 1BLUA 3KUHA 2RU3A 3Q8VA 2RNEA 4LBIA 5HROA 2WZ1A 3ZTQA 3Q2SC 4CLTA 1UVJA 4I7FA 3VAHA 1U2CA 2RRAA 2KH9A 1FX2A 4M8LA 1J5OB 2Z8QA 3MMCA 1RU2A 2DGUA 3CCTA 2Z30B 4OX9F 2HHTA 1N48A 4ZVQB 3L09A 2E7VA 2J6TA 4H4MB 1KQGB 3CC2S 5A0YA 3W9JA 2RQCA 4K2XA 2NYIA 4RW6B 2VKZG 5HMXA 3PHEA 2W2PP 3N79A 5AE1A 4ICLB 4WK3A 3TW0A 4UF4A 1H38A 2FJAB 1IN0A 5HBMB 4AXJA 2RD5C 1JLGA 5E3AA 2V9KA 4FXVA 2VV5A 2BABA 1RT5A 4U8VA 4HH0A 4PXBA 2BE9B 1ZZNA 3T5LA 2D7SA 5IT9U 5EWGA 3H2UB 1RT1A 1S6QA 4DV7F 2G2ZA 1K1QA 3CULA 3EGVA 4PUOB 2L9WA 3PVXA 2KT3A 3OQ2A 2YPYA 3MECB 1BXNA 4DSLA 5C2GA 3EVWA 3I5CA 1H2TZ 4O0IA 2QL7B 3VAMA 1FNXH 3RUBL 4J9QA 3UCGA 4ZCIA 3PZPA 1IJFB 1R6YA 1X4HA 5A6WA 1U47A 2KFYA 2V0NA 1VHIA 4FYVB 2FJXA 4ALZA 4ETXA 1HYSA 2PMZD 1Q8IA 2GO9A 2G13A 1RDRA 4IYQA 3GIRA 3QNWB 1ZH5A 2GMLA 1FRHA 2VG7A 4JI8J 2I5JB 2EFVA 5CYQA 2P9EA 2QV6A 2V4JA 1N32F 3D3BJ 1DLOA 3HX9A 3BV8A 3FGVA 1N5YA 4CM2A 2PT0A 1RAIB 3N28A 2DXEA 4DFKA 2VPZB 7FDRA 1AROP 4KKOA 1JLEA 5FJ4A 3TUIC 4X4PA 2BRLA 2FLOA 3B4DA 4DCPB 2JLGA 1H0HB 3ADAC 3KMQA 2FVSA 1VHFA 4LF9J 2XMUA 2GJ2A 4DX6A 1C0TA 3SCIE 1TTHB 4IOBA 4CLPA 4B9MA 2ZKUA 2V2ZA 4DPOA 2MJUA 3AH6A 4NLGA 1RA7A 1MU2B 2GNKA 1S1UA 3BB5A 4HR2A 3ULHA 5J2MB 2YWEA 5KFWA 1UCNA 1QVGR 2KT5A 3GPAA 1PYSB 1K8AT 4O3NA 3JQJA 1B0PA 1Q79A 3IRXB 1HQ2A 3D7SB 3RBEA 4LBHA 2F8HA 4DV3J 4H4KC 2Q6BA 2J9DA 1U02A 5F0WA 2M3DA 1A0OB 3VR1A 3DLLQ 5M2UA 1SJRA 3CCJS 2AIRB 1FT8A 2IJNA 2DEJA 1GT8A 1Q5VA 1T3OA 3TVZA 2KVIA 2OFGX 1B0VA 1SJ4P 4PQUA 2RQMA 4QIWD 2HS4A 4DOZA 3ENAA 2YNIA 4U96A 1R3NA 4ECVA 2AEJA 5J2QA 2YKOA 5I3UA 1IKWB 3FJ2A 4HHJA 1FJGF 3CJSA 2XMTA 1X5TA 2D69A 3OXLA 2E5LJ 4IRKA 2UV8G 4JI1F 2WK4A 4XAKA 6FD1A 3EX7B 2HFSA 5IC4B 4FYXB 1CQNA 2A3JA 1T11A 1XTZA 3NS5A 1TV6A 2XWYA 3OVBA 2ZFHA 2OPPA 1C1CB 1TL7A 4Y6IA 2QSFA 2BYCA 2KB2A 2QO3A 3A3NB 5IFMA 1WF1A 3SZ2A 2BBEA 3D67A 2A6OA 4DV1F 1VQ5S 1VQ7S 4NA2A 1VC0A 2BJDA 2PEBA 2KVQE 3KLEB 2V2VA 4AL5A 5E0OA 3UR3C 4DL2A 1SKRA 4K4WA 5ETLA 2UXBJ 2VFRA 1RKIA 2H65B 2UXDJ 1HWJA 2R2TA 5JUMA 3HSZA 1DRZA 2GHPA 3IM8A 3D66A 2WSCC 4G6VB 4FYDA 3Q2TC 1IKVA 4MKAA 4DX7A 2JL9A 2NZ4A 1NNDA 2AU0A 1HBNB 4OYXA 4WXOA 1ZTWA 2CADA 3IR6B 3M6UA 3HP6A 2Q6CA 4ILMA 3JYTA 2MKYA 4J5OA 2ZZMA 3FVYA 3O3LA 4J7CA 2OEMA 1UMJA 4NXNF 5C24B 5DQGA 3G8QA 3E8OA 3VF0B 1JLBA 4ELTA 1S9GA 4YN3B 3W5YA 1RBAA 1IBKJ 5KFOA 2DRAA 3D1OA 4NMXA 5LJ5Y 3BBFA 1OYEA 2VC1A 1LFWA 1SH2A 1RU1A 4KGKA 1RTDA 2DNKA 2ZDOA 3W8GA 4A47A 4XK8C 2ZH1A 3NXZA 1QAXA 3SDEB 3GYGA 4IFVA 2AGQA 3AA9A 1F0XA 3FEXB 4IG3B 2KXHA 1DFDA 1FRLA 4C7QA 1S1UB 3OTOJ 3GSDA 1N5QA 1CJVB 2FHOB 3T3FA 5LMNJ 4DQQA 3BGRA 2MKHA 2EI5A 1GH8A 3U7JA 2B0GA 2GVZA 2UUCF 1U0HA 4GC6A 3H90A 3MEGB 2DD8S 3FCWA 3J7ZT 4HLBA 1REVA 2W9BB 2XS7A 2B51A 3DNCA 3P8BB 4FF2A 1P9QC 4P72A 3W2WA 4CM0A 1Q53A 4B9UA 4MFBA 2VZ9A 5A76A 4P6QA 1VQ9S 5LMUJ 1OSDA 1BUXA 2Y8WA 2QMWA 3R7SB 4U8YA 2F9DA 2VJUA 1SC1B 2DT9A 5KFSA 2GIFA 4OX9J 4NL5A 2XEXA 1NMEB 1X31C 1URNA 4LF5F 3CB4A 2DGTA 4QWCA 1S6PA 3C14A 1MLAA 4LF6F 2ZOGA 2OEKA 1HD0A 1ZA1B 3S8SA 5D3GB 4F0KA 3C3LA 4PAAA 1VISA 4XPEA 4CLKA 2HAFA 2DNPA 2QN6B 2A10A 3W60A 3QQCD 4H4OA 1P1TA 1X0FA 2E9TA 2H51B 5C7PA 3PW7A 2OAUA 1ZM3A 4P10A 5L38A 3EPIA 3RYLA 2NSCA 2HHVA 2ZH5A 1L3TA 2JFDA 4EMDA 1FNMA 4H54A 3DOLA 3WHIA 4JI4F 2HRYA 3QJPA 1OYDA 4UQGA 3VVUA 1F9FA 3FSIA 1WUUA 3D9BA 4NLYA 4I2PB 4DPUA 4LR8A 5KG5A 2C22A 2PD1A 1JNRB 1RWKB 1SV5B 2AYEA 3HT3A 5F8HA 1SIWB 4ERDA 2ZE2B 1Z1ZA 4IKAA 1UPPA 1DJ0A 2M52A 1Q1KA 4B3SF 3IO1A 2XWXA 3I55S 2DHHA 5HQ8A 1U8WA 5E3QA 1RHKB 3H4DA 2DRBA 2VG5B 5D0EA 4NLTA 2V94A 2MDAA 1S7HA 2FD2A 1JLBB 4I1TA 4OX8A 1IQZA 1NHUA 3M1VA 3TARA 2HNYB 1T05B 3POTB 5DLGA 5AT1B 4LFBF 1N32J 1RUSA 1IKXB 4L76A 4B3OA 1NDKA 3T1HF 1G6BA 2AZ1A 5MAOA 2VD3A 1JJHA 5ETPA 3Q8UA 1JXVA 1DTTB 2E9RX 4NEYA 3Q24A 2WSEC 2C3UA 2OSRA 4CIOA 2AJ2A 2CPZA 2QFIA 3C19A 4JV0A 3Q89A 2I6WA 1NK7A 3JAMY 5GAHU 4ES3A 2ACMA 1V5VA 1NXIA 1T9WA 1X5OA 1GTEA 5I42B 2XO6A 1NU4A 2P5VA 1A9NB 1K9MT 2B4VA 3HFKA 3SV3A 3G2XA 3CUNA 2DO4A 2KZMA 2RUGA 3E3XA 4ID8A 4J9RA 3MI7X 3OSNA 2IFXA 3MM7B 3PX6A 1J2VA 4URSA 1GX6A 1RADB 2JLEA 4WP8A 2FLLA 2CNNB 2XSJA 1UZHA 5JXSA 3AB4B 1R6VA 3GSIA 2FLNA 4DV5F 2K1RB 5LSOA 2F5GA 1MNEA 1WEZA 2BXJA 1IR0A 4CTAB 2UUBF 3UD4P 4FVMA 3MZIA 2ALZA 3N0VA 1VDHA 3CJRA 2RUSA 3CDWA 3IBWA 3KTQA 4CNYA 1VBZA 5DLFA 5CZVA 1RWNB 4X62F 4IR9A 1U1QA 1UVLA 3I32A 3X1LB 3AQOA 1D0EA 3AOCA 3HHKA 1JLFB 4ID5A 2IYIA 2YX7A 1QSLA 3ZTRA 2PE8A 4B9TA 1TK0A 4QYZK 1E6VB 3KLFA 1CVJA 4WIIA 3F44A 4LRCA 5CD4A 1WJ9A 1BGXT 2Z2LA 5GADI 1ZPVA 4R0JA 1IR1A 1XQIA 3DLKB 2OD4A 1FFSB 4R25A 1HLWA 2RKIA 2WOMB 2Q79A 2WW8A 3CW2C 4TU7A 4IUFA 4OMFG 1T02A 3BO3A 3LP2A 2C2MB 4DV1J 1Y5IB 1VJQA 1HQEB 1FWKA 3DRSA 2YPZA 3PX0A 3DRPA 4LRFA 1JK9B 4C9DA 2B8QA 1HNIB 3CCUS 5D4OA 2FB0A 1N6QB 5GMKa 1RAJA 2OPSB 3FCHA 2ZJRQ 4OLPA 3JSRA 4QBUA 3EICA 1HI0P 1IWAA 1R8CA 4RU9A 4ILLA 3BM7A 1KFSA 1R31A 2DNYA 1RWVB 3A8EA 2RQ4A 3HHLB 3KWMA 1F2HA 8ATCB 1L3SA 2DH7A 3PDNA 1KQSR 2YX4A 4F3QA 1RWOB 3KK1A 1U1LA 3M32A 4XIUA 3TAMA 4IRDA 1H3DA 1X4GA 5DDOC 3EE3A 3R5DA 3CIMA 1J27A 1HBOB 2YX1A 1RWUA 1CG2A 2YNFA 1G4CA 4UQTA 5D0GA 4NXNJ 2JZ5A 2RHSB 2WRMA 5HP1A 2QTWA 2NXNA 2P9CA 4MK7A 5ETNA 1XMQF 2DR9A 2BDPA 1HA1A 3IGNA 1VR6A 4IFYB 2R2SA 3R27A 3DLBA 1O51A 4LSLA 1RTZA 1OIAA 3C6UB 3O8WA 4DL4A 3M2UA 1WELA 1ZM4A 4USKA 5CYMA 1KOOA 1TUWA 3L7OA 1X4CA 2M70A 2IM0A 2A2CA 3IS9B 3RB0A 4ZLPA 2PA8D 3RW7A 4PWDA 1IBLJ 3H7HB 3BJYA 4B02A 2P8IA 4DI6A 2R7OA 2UUCJ 2DR7A 5HSPA 4JUZA 4PG4A 2HFVA 4LUBA 5F8LA 3TVKA 2XY7A 3L9ZA 3PTWA 3PW4A 2X51A 2BOPA 2DR5A 2HZCA 1HHSA 1UFKA 2FVPA 3TR5A 4MMOA 1A6LA 4ZPDA 2B5JA 3B78A 4DS4A 3DU6A 5DZ7A 2EVZA 4OLOA 3SBMA 3MUTP 1C0UB 5HLFA 4IG0B 3MD1A 5B0EA 1NKCA 2BUNA 4RKUC 3KXDA 1XR5A 5D4LA 3OR2A 2UP1A 1O0PA 1TL1B 2DTJA 3PO5A 3V4IA 2ZBIA 5J1EB 1S57A 2ZH2A 5A8RA 3QSYB 1OJ4A 1V3RA 2ADCA 4LF5J 3G8TA 4NLDA 5L9XA 2WONA 2OFHX 3OR1A 4WP3A 2HBQB 1H98A 1VBXA 4A8FA 3OUYA 1UW4A 5A8KA 3NS7B 3CJ4A 3MEKA 2ZD1B 1Y11A 4DR3F 2XG8A 3HXMA 4J90A 4CRJA 2BQ3A 3Q8PB 4W90B 3SFUA 3A8JA 3VGVA 2QL9B 2ZWOA 4DUZF 2HGMA 2FVQA 1IKYB 2VB6A 2E7WA 4RWXA 2DR8A 5I3PA 1YZ7A 4RW8B 2FZKB 3N6LA 3KDNA 4IO1A 2ZOMA 1WC5A 1NHKL 1T9VA 3LUYA 4LFCJ 2OIHA 4LF4F 2MJNA 1K1SA 1NLKL 2PC6A 1JJ4A 4B3SJ 4G1QB 2HVDA 3NCQA 3DDIA 4F4YA 2AYBA 4DQIA 2ALYB 2M2BA 3GIKA 2CNOB 2D3ZA 2VFSA 4HH1A 1U25A 2VKRA 3J7AN 3D0GE 2A1BA 4N47A 2OPQB 2B6AA 5A2QU 3PEJA 2W2OP 4DXLA 4LFBJ 4X4OA 1NJZA 1H72C 2MQQA 2VODA 3GV7B 3T1HJ 3IM9A 3PYFA 3MEEB 3Q86A 4DR5F 2Y1JA 3QGPA 2MPUA 2FY1A 3M2UB 2R8JA 1QSYA 3GJRB 3HDSA 5J2NB 2BACA 3O6QA 4MYTA 3NGRA 4NYOA 3GR0A 2ROPA 3US5A 1WKLA 2MLZA 3JQMA 4U7CA 2DK2A 4AYBD 1NBEB 4B08A 3M2VB 3ZZYA 2YH1A 2DR6A 1YI2S 2I2YA 2IM2A 4GC7A 3KG1A 4ED5A 1WI8A 3PJ9A 4N7TA 4O3QA 4EI2A 2C2OB 1IBMF 4A4JA 3W5ZA 2XMJA 4RJVA 5KFLA 2APOA 3BKUA 4JV5F 4MKVA 1CULB 1LWFA 3PRVA 3DRXA 1CJUA 1SH0A 4ELVA 1KONA 4DV5J 2MGZA 4QYRA 4ANCA 1PJ7A 1VI7A 5HLFB 3G6ES 4P9SA 2UUBJ 4OYBA 2VFVA 4KT0C 2VG6A 1NDCA 2BZ2A 2CJKA 1N4LA 3I96A 3TNVA 4NLWA 1M5HA 4ZP9A 1TKTB 1Z2LA 4CLYA 1HR0F 2Y0BB 4AL7A 5A8WB 5EHHA 4PPZA 1Z2ZA 2CVIA 3ZTPA 4DV2J 4BS2A 4J37A 1XNQJ 4A8WA 1FX4A 2XYHB 4Y00A 1VQNS 4C3KA 2XYPB 3B82A 5AXMA 3OR1B 1RHRB 4MTPA 5K20B 6AT1B 2WAQD 4Y2MA 4DFMA 2VFUA 3W8PA 3UI3A 4N8OA 5A8KB 1YJRA 2KFZA 4YOEA 3AXMA 3PW2A 3D0HE 4NXMJ 4RU2A 2W9CB 2EFNA 1M5KC 3Q83A 3K8WA 1LWXA 1UL3A 3HKWA 4DUTA 3CO0P 3DRRB 1IVZA 1RT3B 2IJFA 4ZVPB 1HWUA 2G2YA 2XMVA 2N82B 2KXNB 1UFLA 3H2VE 2HLTA 2M7SA 1L5UA 3GYNA 1VQPS 4CT8A 2CPDA 2GZOA 4ZK7M 2EFQA 1UPMB 5E41A 4NLVA 1Q7LB 3LGHA 2Z57B 2RIJA 2V8VA 3P4UB 5BYQA 3C6TA 2RB7A 1RAHB 1Q81T 4AE5A 3DMJA 5F8GA 1J5EJ 2WHOA 4BHQA 1ULRA 3MAAA 1BHNA 3AY0A 4ZA1A 5E3CA 3ENVA 2KDOA 2EFOA 5LT5A 4KRWA 4XDCA 2OLWA 2VPYB 3J81Y 3MPVA 5MLCV 2HK2A 2DNLA 1S0VA 2HVHA 2XBPA 3QZ7A 3TRGA 2H5JB 5GADU 2C2DA 4LFAJ 1RWWB 1EETA 1X0PA 3NWRA 4WFYA 3V6DA 1IUJA 2HNDA 4OZNA 3ICLA 4KYZA 5T7LB 3MOZA 5CH7B 2IRYA 5AXLA 1BD6A 2W8LA 2FDNA 2AWZA 4NYPA 3MM6A 1CS4A 4P2FA 5KFUA 2V8DA 4WFBQ 1QM9A 3EM1A 4UUWA 1PAUB 1QAIA 4LREA 1XMQJ 2YQ0A 3GMGA 1N34F 3JAMU 1KLNA 2GQCA 4X65F 1FK9B 4WE1A 3MCMA 3TUPA 1T8EA 1LEOA 3D0IE 2BOAA 2MXYA 3MTJA 2VHGA 1NM2A 4OFZA 1SL1A 3PO4A 3SSRA 2ASJA 3LTOA 3VGUA 3VV2B 3MMAB 1F5AA 2EC0A 2Z2MA 3J7YI 2HHUA 3CF5Q 3W2VA 1JWWA 4FXDA 3G82A 3EZOA 3N5BA 3K8VA 3TAPA 2ZC4A 2W7OA 3VQTA 1SKSA 3M2RB 2QLFB 1HHQA 5CQGA 3PFOA 2DJWA 2HS0A 4K5RA 5H1SV 4QIGA 3BR8A 2DHGA 4WK1A 3QAEA 2ZH3A 2CJAA 1FXLA 3TA2A 2Y1RI 3HK2A 1NH7A 2R8HA 4EZ9A 2XI3A 1R0BG 1KRPA 2QIFA 1ZBTA 2GMHA 1S4FA 4WPAA 1DQAA 4BDPA 3VAJA 4TY8B 4DCOB 3AD8C 4RBVA 2R7UA 2RF2A 3IBCB 1X4FA 2UXCF 4IOAQ 3OLAA 2QYGA 4L73A 2GW8A 4ATNA 4LRBA 3UO0A 2PN6A 1R8HA 4EGLA 2NCKL 3I0SA 2DH8A 3QT6A 3GLJA 3QYYA 1Q8BA 2EG2A 1YDLA 2AP6A 2CJ9A 3M8QA 4J9VA 1W25A 4JV1A 2CNLB 2X1AA 4O44B 2J6SA 2Y0SD 1K47A 3SI8A 2J9CA 1FRMA 3UDVA 4UT4A 2AJ4A 2E9ZA 1U48A 1GAOA 5LXYA 3P6YC 4EO8A 4HACA 1N5TA 1XJWB 3RU0A 5L46A 3DLHA 5B0FA 1NSPA 3EJMA 4LF8F 2DITA 4DQPA 3M6VA 3DM2B 1RSCA 1RBOB 3RBZA 2E1RA 4F2SA 4PWUA 1FE0A 1O8BA 2C2RA 2Y1LB 4DPXA 3EYZA 3R2CJ 3GV8B 3QO9A 4DUZJ 3UDCA 3OPKA 1VRTB 3FQLA 1NCLA 4B3TF 1RT4B 2R3VA 2LXUA 2FHJA 2YKNB 4PPDA 1RA6A 3A13A 4OZJA 4DR2J 4ZHRA 1H2UX 1YBAA 3BN7A 4LF4J 2H9ZA 2O66A 1YQHA 2J9DE 2IVYA 2QG9B 3R3TA 3OHBA 3UDEA 4UY8T 1S5ZA 4CLWA 2CPHA 3E01A 4DR6J 3ETMA 1F9EB 5DRKA 1WC1A 1HQUB 3JSBA 4NOHA 5GMEA 4CLLA 4KTQA 2HYIB 5T14A 1GFWB 3T5JA 2JC1A 4CDIA 2YKAA 4B9LA 2G0CA 2DIVA 2QA2A 1VRUA 3KK3A 1B4SA 4X64F 4NCGB 5L1LA 5EWFA 2UVRA 1R8PA 1RAOA 1HBUB 1OS5A 4KGMA 3BQ0A 4AQYJ 3H5XA 3KDOA 1CJKB 1ZPWX 2EBGA 3R2DJ 4PG7A 2HFNA 3KLIB 3RR8A 2HWIA 1B7FA 2NXJA 3QSIA 1HHTP 3KJFB 2HLUA 1JLAB 4F7VA 1TFYA 5KFGA 2DHSA 2U2FA 3K57A 3PRDA 3CJKA 2COLA 5HJXA 3VALA 2O3DA 2RMLA 2IBOA 2AMCB 4DJBA 3SQGA 2M4MA 1NKEA 3HFZB 3FEYB 5IV3A 3W64A 3I31A 2MHNA 4Q0BA 4ZKAA 3H40A 5D8HB 1QD1A 4O4RA 2GC8A 1NK6A 1NB2A 3IG1A 3UQSA 2RT3A 4PYAA 3VZHA 3TEGA 3DDNA 4RW7A 4ZP7A 4TQSA 3QPIA 2KJVA 4FP9A 2E1CA 3NOCA 1EB0A 1D8YA 4C8ZA 1PYTA 1VBKA 2AX0A 4F50A 4CI0B 3K7RA 1JXLA 1HPZA 4C11A 1XWLA 1FRKA 2CQ1A 3M9OB 4P71A 1LW0B 2I1RA 2FC8A 4K5SA 4FS2A 2CKWA 4RUBA 2Y1IA 4DR4J 2DNZA 4M5KA 4I2QB 5KG2A 1DY3A 3KYLA 2YNGB 2ZBCA 4UUXA 3UN2A 4UOCA 2HFUA 3J80U 1WHYA 2FZCB 2X1BA 2LU2A 2DO0A 4JB8B 4CYUA 1R27B 2CAJA 1X8DA 1HIYA 2D3O1 4F67A 1S10A 3HJVA 1H7XA 5ETKA 1KC8T 4ECRA 4LBPA 2AHOB 2OMLA 2JEJA 1UVKA 1SQGA 2BKNA 2NXCA 2CPYA 1NHVA 5B08A 3FC9A 2E5IA 2PFDA 4K4TA 4GVBB 2F1FA 4JI5F 2XI2A 4UOGA 3OTEA 4LIRA 2M8HA 1C1BB 5ADZA 1KWMA 5IS2A 3DCAA 2Z0GA 3EDRB 3G4SS 3ZZPA 1KS2A 5J2PB 3VQSA 5RUBA 2K06A 2AYGA 4O3PA 4A8MP 2BJ3A 1QVFR 2OKQA 4MAKA 1TL5A 5L9NA 3MGJA 3NG8A 2GGPA 3R7NB 3QJLA 1LQ9A 1VQMS 3PV8A 1VRUB 4USVA 1FTCA 2MQNA 2YH0A 1VBYA 4NWBA 1BE4A 3OJUA 3TOQA 5DS7A 1TKXB 5DGAA 2YTCA 4KV8A 5KG6A 1KHVA 1KLMA 3PJWA 4OHXA 2F40A 5THWA 4ZN1A 1X4DA 1XMBA 3RRHA 4GKKF 4KFBA 2MSSA 1LFPA 4ZIWA 3LPYA 2PDAA 3V5RA 4WP9A 5KFPA 4LJMA 2BANA 2P6TA 1AZSA 4PG5A 4QQBA 4LSNA 1MWQA 4X4UA 1UW9A 4AUKA 9RUBA 4GVLA 2HHHF 1RTIA 3T1YF 4M5HA 1UP1A 3DOMA 1HWKA 4XTTA 1JLQA 1RZMA 3H98A 5KFMA 1EP4A 4F8RA 1C4CA 2V67A 2RILA 4WTYA 2XSFA 1HNZF 2JSXA 2ROGA 2HNZB 1K73T 5ETVA 2XHWA 2BE2B 1YJUA 3Q0AA 2Z56B 4KHMA 2ASDA 3N6NA 2CPFA 4ETZA 1O6XA 4ES2A 3M9MB 3VAGA 1KTQA 1IM6A 4GO7X 4DWIA 3RGIA 2QJ3A 1BQNA 3RG6A 3OFGA 3WZ0A 2VICA 4QWBA 4RNFA 3QIDA 3J7YU 3NAIA 3ZZ0A 1SC6A 4JI0F 2RDIA 2L3MA 2IDEA 3GTYX 4NASA 4UOHA 1VQLS 3CCWA 4DV4F 2ZDPA 4X2BA 4PYDA 2QRRA 2CQ4A 1PC5A 4CYUB 3QFHA 2CG4A 1GXUA 4NLXA 1RTJB 5FDLA 1OPIA 3QGHA 1MMDA 3BBBA 2B9WA 3OFHA 5DDPC 1M1KT 2IVMA 4OJGA 5FLXU 4HYKA 3EMTA 1XMOF 4KQZA 3M30A 4CLUA 1EQMA 4A46A 2CYYA 2YBVA 4LR7A 4A8YA 1X60A 3BPSP 3LP1B 5CABA 5AE3A 2EK6A 3DGVA 5KG7A 3T6BA 2HGNA 1S9EA 2VFTA 2AYMA 4B3TJ 4A8OA 5ETOA 1YJ9S 2BEFA 1MMLA 3J81U 3B4MA 2BJEA 5IV4A 2YNHB 2HIQA 1U6FA 1UJ4A 3NNAA 4CH1A 1VLYA 4YR0A 1U6BA 4YP3A 2DPJA 3PKYA 1FDAA 2HQCA 5GVQA 3MPYA 1DQ9A 1GMWA 3I56S 3PW5A 2DVIA 4Y34A 1Q86T 4F4KA 3DRYA 1M0SA 2I8EA 4RW4B 4ELUA 1VQYA 1G7CB 1LWCB 1NK8A 1QAYA 3F0NA 1I5OB 1MW7A 3LGMA 3L3CA 3QGGA 2CQDA 1J5OA 5KG1A 3CVKA 4KPCA 2FHJD 2A6MA 1TKZB 4C0HA 3NBPB 3CJ8A 5H9EJ 1KHWA 3R6GB 2E5GA 2A18A 3IFEA 3BDPA 4H4MA 3T6JA 1YRUA 2UUAJ 4ED1A 5JMNA 4RW6A 3CCVS 4BCAA 1UEKA 1XN9A 2CZ9A 1XIQA 1AZSB 4C8LA 3GYXB 2X1GA 4PCQA 5L39A 4ICLA 1IR2A 4QPXA 4I56A 4M5NA 2HQDA 4MK8A 2XY5A 5HBMA 1F9HA 4DR7F 3K17A 2R8GA 1VC5A 2VQEF 4OZ1A 5H9EK 4C3LA 3V81B 2M0GB 2JEFA 1N36F 3WC2A 4TNOA 3CD7A 3IR7B 3UWTA 4IO9Q 1FJEB 2XGQA 1FKOB 1ROFA 3IR5B 1ZM2A 3FNNA 2FJVA 2MHEA 2LQ8A 2HMIB 4ZCKA 3MECA 2OEJA 3UFCX 2LECA 5AE2A 1X4AA 2FJBB 4OL8A 1RJJA 4NLSA 1PJ5A 1AW0A 3IAM9 2XHCA 2JEGA 3C66A 2X1FA 4KH1B 1WOSA 2R7XA 2GFFA 2LQ5A 1TL3B 3EDQB 3EZUA 1MMNA 1B70B 2DHAA 4J9LA 3MMJA 4QR2A 3B8HA 1Q0NA 2CXEA 2BKPA 2ZOFA 1ZAXA 4HHUA 5G0RB 1TL4A 3LOUA 1D9FA 4L74A 3S6EA 3CTRA 1B7YB 2FGCA 2GA7A 3BH6B 3V6KA 2I5JA 3KHGA 1VFJA 4ECYA 4ZPTR 4U6PA 2B4OA 2Y9HA 4NI2B 2NSBA 5H9FJ 4RBTA 2OSQA 4F04B 3W5XA 1N88A 2H5IB 1Q82T 2ZBPA 4EZ6A 2GHWA 3TUJC 3IP0A 4M5DB 3VTIA 1AXQA 3N01A 1V9OA 4DQSA 1BY9A 1ZYQA 1RYRA 4R8UA 1TR0A 1KVKA 4F4WA 4JI5J 1PG5B 1MU2A 1WC4A 5J2MA 1K0TA 2BW2A 4A8KA 5B0AA 4RNMA 3OXGA 2BJ7A 1N33J 3MPDA 2MQOA 3FMBA 1PBUA 4CT9A 4F0HA 3IRXA 3KJVB 4X4RA 5K14B 2HVIA 1F60B 4E8UA 4RUHA 3FFIB 3UNGC 1MROB 2CA9A 4AL6A 4ZVGA 1U1MA 5KG4A 3H5UA 3RRGA 2MMYA 2C42A 5KG0A 3LWLA 1X4BA 1RHMB 2CPEA 3G6VA 4OIXA 4MH8A 5F8JA 2HGLA 4ZVOB 3GR1A 3CSKA 2RVJA 3WX8A 1TUVA 1ZM9A 4B3RF 1IXKA 3D6MB 1IKWA 4Q8FA 2BMBA 2C3OA 1MG7A 3HPOA 2R8KA 1F1BB 3HM9A 1YVFA 4HTIA 1OY9A 2B4PA 2YKQA 4OI1A 2MZSA 3D68A 4GKKJ 3RBXA 3R5AA 4DS5A 3UVJB 2CZ4A 2X7IA 1RWXB 5HMZA 3CJTA 1C1CA 5D15A 1TQLA 3G9CA 5B7WA 1YJTA 2J0XA 4CZCA 4KGXB 1FEEA 3TO8A 3DXSX 1R43A 5CXTA 1TVRB 1YJ7A 2XULA 4WFXA 2B3TB 4PR6A 1Q7YT 4XPCA 4RPFA 1D09B 1RLDA 3A4TA 3FK4A 3IA0A 3KLEA 2JEIA 5K8PA 2VH7A 4OX6A 4KHRA 2XZDB 5ETMA 1RCXB 2C2EA 1FA0A 2KYZA 4TU8A 1HNZJ 1QSSA 1NH8A 4ZJOA 4NLQA 3OVSA 4WXWA 5GAHI 4F4XA 3UR0A 2JC0A 3IN5A 1EX8A 4PABA 3BGOP 1YTYA 3L4BC 2V4QA 4L75A 4AD6A 3NNCA 4Q8EA 5KFAA 1T7PA 5KFVA 4AT1B 5I4MA 4M95A 2FQQB 4ECQA 3KLHB 1LXNA 4JI6F 3DLJA 1VC6A 3E2EA 1HBNA 4CH7A 3CMQA 3MMBA 1I6JA 1D1UA 1S49A 4PXDA 2JHEA 1U6ZA 4G1PA 4ECXA 4DL3A 3FBFA 5C24A 3D6FB 4DV4J 1WG4A 4PZVA 1TAUA 4FBUA 1WSVA 2JVRA 3HVWA 3TZZA 3THVA 3Q8RB 2HBYB 2CG8A 5AJ3F 2LU1A 4ZIVA 3R8YA 2VDIA 3UCUP 3NMRA 2G1HA 2R42A 1GK8A 4ED8A 1CSJA 2OPRB 4MIWA 3EGZA 3SDEA 1DURA 2KRRA 1W26A 4R8UB 1U7LA 3C46A 3KLGB 4F4AA 2W2NP 4P2XA 4OZ3A 5C25B 3PEHA 4IG3A 4ZPWR 2NQPA 5KFQA 1CJVA 5AXNA 4C8NA 5C42B 2MQPA 3JSMB 2WTFA 2PI4A 1YJNS 3HKZD 3NLCA 1XNRF 2YWKA 1JLCA 3R5CA 3MEGA 1U45A 2MB0B 1T3NA 3CPWR 2W9BA 1HW8A 4J9SA 2VBWA 3I9ZA 2M88A 2CJQA 3SCLE 4X84A 4ED4A 1OQ3A 1RHUB 2V5HG 2H1YA 2YVSA 4R5PB 4WU3A 3LAKA 3LP0B 2ZH7A 5F8MA 1FCAA 1GMUA 2ROEA 3GB0A 4F26A 3DLGB 2E5HA 4OZ0A 1OMSA 4ZLNA 1WDDA 5F41A 5LJ3Y 5IT9Y 2QMUB 3HJFA 2E1PA 1S99A 4K50A 1FXRA 1AFIA 4E98A 5DGBA 1NSQA 4TVAB 4RBUA 1NK0A 2P9GA 3KHLA 5D3GA 1LV5A 2KM8C 2IA6A 2ZBRA 3MR3A 4U7UK 4Q45A 4W4MA 2QE5A 1DZ5A 4I6WA 4K4SA 2JDJA 2RJZA 4YB6A 1TK8A 2YKMB 4CO0A 2FLPA 4FF4A 4DR7J 2E1AA 4NLRA 1FDDA 4ZVFA 4WYLA 3MHYA 2VQEJ 4OJHA 3P96A 2Q3PA 3CCQS 3RTVA 1N36J 1TKDA 4DV6F 4CO3A 2DNGA 4I6YA 4ECUA 3W1YC 1JKHB 3NGKA 4ZMMA 4DFPA 1VCTA 3CC7S 5ETRA 3A3OB 4B9NA 3D2WA 1NK5A 3K0JA 2DHXA 2ABYA 3G87A 2ZVIA 4I2PA 4HTJA 2HIYA 4QIVA 1HKAA 1RQ0A 4HDGA 1SCJB 3GFHA 1SV5A 3QBCA 4JYAF 1OSCA 2CPJA 1JXEA 3M8YA 2ZE2A 3AOBA 1FVSA 1NDLA 2FHKA 3R5GA 1VQ6S 3O5TB 3M6XA 2NS1B 1UTAA 4M1KA 5HANA 4TLRA 2MZ1A 4RLEA 3MMBB 2FY8A 2VG5A 1E6YB 1TU0B 1ZZFA 4YB5A 1I51B 3V4MA 3T19A 2VQFJ 3P3DA 1JMTA 1P8GA 2IAJB 4LRAA 3DI6B 1LNQA 1O5JA 3K5NA 1SQEA 4HEA9 3MCNA 3NNHA 2HNYA 1T05A 3POTA 4LSZB 3HVRA 4KR0B 1S48A 2R4FA 1IKXA 2ZUGA 3QFWA 1YZ6A 3MWBA 2R8IA 3DYAB 3QMQA 3U1NA 1KEKA 1NKBA 5CCLA 1DTTA 4IDKB 1VQOS 3CCZA 2KKHA 3LPEA 1RHQB 1YLXA 3HSGA 5C2CA 1NB7A 2Z2YB 5HI7A 1TZ0A 3UN5A 1FHTA 1GQEA 4HT5A 1M1GA 5DM6Q 5EDWA 3AJDA 4ZLJA 3HT0A 5I42A 1R0AA 3SEOA 1IJEB 4DN0A 1YJVA 2L9DA 4OYWA 2AV5A 1HNWF 1NJWA 1S1WB 1TELA 4YDXA 1JLCB 2H54B 2PA3A 1XBWA 3HULA 1C2PA 3KMSA 3MM7A 1DBDA 4C6AA 4K4XA 4X66J 4K7QA 2WVDA 2EFPA 3NOGA 2MQMA 1FDBA 5DM7Q 3PYGA 3OLBA 4KHPF 2P6SA 2CQIA 2AGOA 2VA3A 2K1RA 2IC3B 4CTAA 4B9SA 4B3MF 4FPRA 3O2IA 1AT1B 5E3PA 3IGVA 1RLCL 5BYSA 4I6AA 2BE7D 2B4UA 3B54A 3U27A 4WCEQ 2HAIA 3K5LA 1YRTA 4B3RJ 1JLFA 1NRKA 3CDAA 4USUA 1T9TA 4UZBA 1QE1B 2HVZA 2OD6A 1AUDA 2WB1D 4MYUA 3P5BP 4V19X 2KTQA 1GXTA 1E6VA 3DGPB 2BM1A 4QWAA 1HBMB 3MM8B 1RT6B 1SBRA 2CZVC 2Y8YA 1SKWA 2LYVA 1WEYA 2IMWP 1NPRA 3DLKA 1SUQB 2AJ0A 3W9IA 3BR9A 2WOMA 5KFYA 2C3PA 1SL2A 1R0CB 2ZJQQ 3UW1A 2VU5A 2K7JA 2VDHA 4DV7J 1WOPA 1HQEA 5JJBA 1HNXF 1PBAA 1R89A 3ONQA 1SVDA 3BZQA 1HNIA 4K4YA 3RB3A 1S1TB 2CNKB 1HFEL 3TUZC 1N6QA 3QLHB 2QL5B 2OPSA 1MWYA 4GKJF 3I0RA 3AFGA 2QC3A 3VAIA 3BSNA 2F8EX 4OYOA 4U9RA 2PO4A 4O0NA 1U2RA 3EXYA 3HHLA 2JX2A 4LMZA 3PW0A 2ZUAA 8AT1B 3LWMA 2KFNA 4TKTA 1SJ1A 4USMA 5KFBA 3A8IA 4O4GB 3ITHB 4JI6J 3M6WA 2J0QD 4YR2A 4Q5VA 2HQFA 2WVCA 4RZRA 4ZVEA 3QWPA 1HBOA 3MTKA 2HVEA 4TXSA 3GIJA 4KSEB 4FF3A 2XM3A 3BBCA 4CO1A 3DOKB 4G3IA 4DV3F 3WQPA 4ECSA 3D6TB 5IM0B 3CMES 2V9WA 4M63A 3W62A 4IFYA 3Q8QB 5AJ3J 3KKFA 4LF2A 5EX0A 5HN0A 2OELA 3C6UA 3UDLA 2WB4A 4Z7CA 1L3UA 4F2RA 1NPKA 1R0AB 3NGDA 2V4RA 4ZPBA 4USWA 4EFAC 1LWEB 5CAAA 3AOAA 2M8DB 2HPUA 1SJFA 2OTJS 4ZVUB 3IS9A 2IPOB 2ZNYA 2GX8A 4DMZA 1U26A 2AQ4A 2C3YA 2E5LF 4DZDA 2HURA 3Q8YA 2E29A 4WYWA 3FBEA 4LR9A 3GV5B 1FVQA 2GVDB 1Y3JA 3SMZA 5F9LA 3HVTB 2GJIA 2I38A 2F65A 1UKUA 4RW9B 2FUG9 2GCFA 3A12A 4J9NA 4QYZJ 2EEYA 3C15B 1QTMA 4OHVA 1VJWA 3WBZA 3I87A 4ED2A 2B9YA 2BW7A 3TA0A 3FZBA 2ILYA 1C0UA 4IG0A 1S7IA 1UVIA 2RRBA 2XY6A 3WIUA 2LQBA 3QRRA 3PHTA 2RSQA 1T03B 4DSIA 3BGUA 3C2PA 1TL1A 1FJGJ 5J1EA 4M5IA 2PEHA 3QATA 4JI1J 2UXBF 2NUHA 3HD2A 3R5BA 2W7AA 4ZPCA 1WOOA 2D1CA 2C2NA 2DNOA 4C98A 4DPTA 3MAHA 5KOXA 4OZLA 1DQ8A 5L1KA 5GAGU 2FVCA 5FD1A 5K5MA 3R7BB 1SIZA 1V5IB 2GO8A 2ZD1A 4D3HA 2HZAA 1TK5A 2J6UA 3H42A 2LDYA 4DX5A 2W8KA 4OJ1A 3HCXA 3O1LA 2L9NA 3TJAA 4DV6J 3L95X 1FKPB 3EVOA 1T95A 2XLIA 2F63A 4OYPA 2MZJA 2QSWA 3BGLA 3I0RB 3TQEA 4C8MA 3TZYA 2R7SA 4V19J 1IKYA 3KHRA 2I0XA 4DPWA 3OL8A 3QIPB 4RW8A 4DDFA 1FKAF 2BQUA 2GJFA 4JYAJ 1RT7B 4DEZA 2RQKA 4EUVA 4L72B 3M4XA 5HQLA 1RAAB 2CFXA 1BWVA 3BDEA 3CMAS 4YFUA 7AT1B 1XR6A 4G1QA 4OYZA 3FRZA 4ER8A 3HMJG 4OJ3A 4P2MA 1RWMB 3T9ZA 3OTOF 3PYEA 1NPPA 2OHDA 2Y3YA 2VASA 4PXEA 2OPQA 2UUTA 1JJ2R 3V2UC 4E2FB 2C2KB 2LQJA 2WVFA 2QMXA 4NRUA 4ZN3A 4KY3A 5K8MA 2JLFA 1HMVB 2Q43A 2MYFA 2RS8A 1H6KX 1Q95G 4U7UD 2DXDA 3MEEA 4KE5A 1SH3A 4A8XA 2DGXA 3M9NB 1WTBA 2W9AA 4TY9A 4OV1A 4DSFA 5J2NA 5EGYA 3I6PA 2ASLA 1LK7A 2OTLS 2BA9A 2KG0A 2CRLA 4WZQA 1VOMA 3W7BA 5K8NA 4FPIA 1B64A 3BO2A 3FZ2A 3M2VA 1S1XB 5HVHA 4FYWB 2MKSA 4AXIA 1HNWJ 1UZDA 4FKXA 3D28A 5D4PA 4J9KA 2ERRA 4QR1A 1RCOB 1JJCB 2DNHA 4USHA 2C3MA 4KIAA 1WTFA 3GZ7A 3MEDB 1CULA 1KKHA 3AJ2A 2JH3A 4KHPJ 2GIQA 2AJFE 4NYZA 5KT4A 3OL6A 3PIOQ 1FFGB 1RTHB 3TX0A 2NREA 4B3MJ 3GG0A 4IRCA 3PKMA 4QJVA 1RAEB 1YBUA 1MSWD 1TKTA 2GAHC 2KJWA 1KD1T 2HWHA 1MN7A 5A8WA 1WACA 2C28A 2IHR1 2B56A 4LF1A 2WW4A 2LMIA 1GNKA 1ZETA 3KFWX 5DZ6A 3TJ9A 4LF6J 4IH5A 1WSRA 4WJBA 4NLUA 4FBTA 5I3QA 1U24A 4DFJA 4HKQA 3GQCA 2LEAA 1S1VB 1JIHA 2QFJA 4DQRA 1ZS6A 4FS1A 2W9CA 3BSCA 4RUCA 1DTQB 2CJXB 1QAJA 1NJXA 3DRRA 1WHXA 2HKEA 1RT3A 3CDEA 3ENQA 1KTVA 1PCAA 2DY1A 3JS9A 3E51A 2ZH9A 2BQRA 4DL0C 1T9UA 1HNXJ 4JI4J 2CDRB 5HVFA 1D9DA 1CJTA 4U67Q 5LXRA 1L3KA 3H5SA 1BQMB 3ILOA 1OO0B 4GKJJ 1S97A 4N77A 2HRUA 2J76E 1M5OC 3W3SA 1FE4A 2V34A 2RS2A 3T1AA 3SFGA 4ZVHA 3GE9A 4NEZA 3DXBA 3RR7A 2YWWA 4FKYA 4J9OA 2GAGC 2ZNZA 2MY8A 2OUGA 3EVMA 2ZH4A 1F2GA 5KFRA 1PGZA 2HQGA 2W2MP 1U8SA 3UE2A 2J7WA 2BRKA 3GJTB 1F5CA 4L3KA 5T7LA 4DX8H 2FVRA 3C16B 2CQGA 1NZAA 1HNVB 1NEEA 2ASYA 4YY3F 3T5HA 5IZHA 2J7KA 3RB6A 4C3MA 3NEKA 5HL7Q 3AQPA 2NUUG 2YY3A 1TAQA 1Q16B 5HROB 1BC6A 4Y2KA 2XMKA 2R2RA 4I7FB 1FK9A 5BYRA 3HHLD 1D3WA 4C0BA 3BS9A 3ZZTA 2YWGA 3ZNJ1 3MMCB 2XS5A 2AKWB 4OQJA 2O5DA 1WG1A 4IH7A 3MMAA 2DNRA 2G9OA 3ZFVA 3J7Z5 5B0CA 3IWNC 3V6HA 3W61A 3GILA 2UU9F 2QLXA 1G2EA 1SB6A 1YX2A 2CVEA 4TU9A 3I4HX 5A0YB 1G3OA 3M2RA 3DC2A 2HHXA 4AFFA 2PI5A 1NDPA 1U49A 2GQ2A 3WDOA 4Q43A 3TWZA 4UTGA 4ZPAA 4TLQA 5DDRC 1VS3A 1T9XA 2H5EA 2YKPA 3MURP 1JNZB 1JLGB 1RXOB 1APSA 4RO0A 3S7RA 4NCBA 1RT5B 3OBIA 3VZIA 2ZM6F 2QT7A 2ZBQA 5ETQA 3WIVA 4EU0A 1RT1B 5BXIA 1S6QB 4TY8A 2U1AA 4I4BA 2H4WB 1FJ7A 3I82A 1HWIA 4JOUA 4X62J 1NUEA 4A8SA 4O23A 2KZZA 1CQMA 2K8GA 2BV3A 4PKDB 2O67A 4M5LA 4FYYB 3S01A 4GMKA 4DF4A 4ZDNA 5SUHA 3RZAA 5G4DA 3GCXP 3J7A1 3VHQA 5B0DA 3CXCR 4K4UA 3OSPA 4OI2A 4O44A 2AZ3A 1YHQS 3TX8A 2XLJA 1IBCB 4CLFA 3MFHA 2VONA 4HI1A 1HYSB 3H59A 4CH0S 2X3DA 5KFCA 4HI2A 1N52B 1VLOA 1U2FA 2AEMA 1WDTA 1S0MA 2VG7B 1ACMB 1I94F 3SYZA 5KT3A 4EYHB 5ETTA 1SQFA 5CYQB 3DM2A 2V4JB 4QU6A 1DLOB 1CJTB 1KVJA 4EO6A 1N5YB 1YG0A 1I3OB 2J0WA 3JB9k 2EFGA 2UVVA 4KKOB 1JLEB 3KG0A 3PM9A 1VRTA 1ZA2B 5A2QY 1RT4A 4DPYA 2HQIA 5K9FA 2HQ3A 2YKNA 1RP5A 5DO2A 3NGUA 2O1PA 3H5YA 1R8BA 2RU9A 3KG4A 1WD6A 4DLEA 3HZGA 5HVGA 1U1KA 1C0TB 3IRWP 4DF8A 2MSTA 4Y28C 8RUCA 1Y0HA 4P74A 3CCES 2AW0A 2XMMA 1U1OA 5KT6A 2HRTA 3PG9A 1KSPA 1LW2A 4C2MA 3CD6S 4KB7A 1IBLF 3LGNA 4G1IA 3BF4A 5FIIA 1HQUA 2M5YA 1FI4A 3JTOA 3T5KA 1TMMA 3T41A 1YITS 3OL7A 5LSLA 2LP4A 3QAUA 1JQGA 2D9OA 1WKJA 3GIMA 2D74B 2HBRB 4F36A 4NCGA 1Y4ZB 1HBUA 1A7GE 3GFXA 1CC7A 3M05A 1S12A 1CJKA 4YUDA 3K5OA 3KJNB 3R1HA 4PQUB 5GMDA 4NMLA 3PXGa 3SSQA 1VK8A 3FBBA 1NJIT 3W65A 4BBYA 4ZVSB 3KLIA 4RNOA 2FPHX 2IIHA 2YNIB 3HHLC 5J2QB 5I3UB 4K0KF 4M94A 1DHMA 1PO6A 1YSJA 1JLAA 2G0JA 4WFAQ 3R6LB 2JNJA 3CC4S 5L1JA 3R1LA 3SIPB 3R5JB 3F56A 2V2KA 3CGIA 1TV6B 1X5PA 3ZTOA 4Q44A 5GAEU 2QA1A 2OPPB 1TL7B 3JTNA 4ENOA 2LLZA 1EJ7L 1WC6A 4FVCA 5E7OB 5F8IA 3LH2S 3LF0A 1X4EA 3CCSS 3D4JA 2R7QA 3K89A 2HEKA 2EWHA 4IQXA 1KP6A 2RH3A 1HW9A 4ED7A 1FRJA 3BO4A 1UFWA 4B17A 3K5PA 1REGX 3PY8A 3NGTA 2QLWA 4UW2A 3ZZZA 1LW0A 4BWJA 1I1GA 1SI9A 5DJBA 3P45B 4P7TA 2LEBA 5CD4H 4CCHA 3LALA 3OTBA 4BWMA 3MR6A 2V2QA 1UJ6A 5T41A 1KR4A 4NLPA 4LFCF 4J91A 4JBCA 4XDDA 3H25A 1IKVB 4I2QA 2AEFA 2DCUB 2VPXB 2YNGA 2KT2A 3TZXA 3ZZRA 2OGUA 2DIUA 4YB7A 5E2QA 4RUAA 1LOUA 2C1EB 5KG3A 3QT5A 3JYTB 2UV8A 4DR3J 2HW3A 2NYHA 4PXCA 3UD3P 2QLJB 3KNAA 1U09A 3FBCA 4J9PA 3T9NA 2MZQA 1S9GB 2IBKA 2N7CA 4OX7A 5KFHA 3ZC4A 2CUYA 4N56A 1N56A 4ANDA 2LKZA 1RTDB 4GVBA 3TZWA 3FMWA 2L41A 3BKTA 2H48B 3HHEA 4X4QA 1KOHA 2EBEA 4DR1F 1S0OA 3U1MA 5F8NA 1UETA 2MKJA 4IFVB 1RBLA 4RNNA 1C1BA 2FGOA 3HLUA 3BH7B 1LW2B 3BYRA 5IXUA 2I9SA 1ZAVA 4CP5A 5J2PA 3FKBA 3BGRB 1R8AA 4QR0A 1NAQA 3MPUB 2DBBA 2GVZB 4IQMA 4QCLA 1U0HB 1RK8A 1MN9A 2MKKA 3LW5C 4UOFA 5IT0A 3OVAA 2HHPA 4ZCLA 1SPBP 1Y10A 1REVB 5HATA 1KQKA 3W2WB 4MFBB 4YY3J 2VA2A 1AUSL 3RRKA 4WFNQ 4DR5J 1HD1A 1TKXA 1CBKA 5B0GA 1B0TA 2AT1B 4S0MA 3OXFA 2HHSA 2GHVC 4I68A 3N5FA 2FJWA 4NPOA 1UWAA 3CO9A 2QLBB 4ZLLA 1PIEA 1M5PC 1WC0A 2J0SD 4JP8A 3ZO7A 2F7VA 1OY6A 2YQ1A 2IA0A 2N3LA 3GONA 3AODA 1X5SA 3NS6A 4O3OA 5F3ZA 4DV2F 4I0WA 2CQ2A 1XNQF 1IBMJ 1S6PB 3C14B 2UU9J 3UNYA 2MQ8A 2XLKA 4JV5J 1EKRA 5ETSA 4K8RA 2VOOA 3M8ZA 2O01C 1EZZB 1Y9OA 4DN9A 4H4OB 1MWZA 1FD2A 3RAMA 4NXMF 4YR3A 2KHCA 3HF5A 4OHWA 2HNZA 3M8RA 2ZM6J 3MPWA 4ZOSA 2W7PA 2ZKTA 2BE2A 4LF7F 2MZTA 3G8SA 3DOLB 2BJ8A 2LXFA 1HR0J 5CYJA 2B7CB 4I64A 1GEHA 3MUMP 2FZGB 3PR5B 4JI2F 2DNMA 2EPIA 2CQBA 3M8SA 1J5EF 1K0VA 1XK8A 1Y5NB 2PMHA 4C8KA 4NA3A 9ATCB 3OTCA 2DISA 3KK2A 5LSRA 3MCOA 4PQAA 2W4PA 4QWEA 1F5BA 2P2CB 4KGVB 3WX4A 3NCPA 1F3VA 3MDFA 3PYDA 3QGIA 4DV0F 2YWFA 1RTJA 5F9NA 2DXFA 1VQSA 3A1YG 4LFAF 4DL6A 3HFVA 1EARA 1I94J 1WHVA 4CWBA 3M1VB 1PKUA 3IXQA 2ZVSA 4EBDA 4B3OB 3N6MA 1UA0A 1Q78A 4O3RA 1G1XA 3LP1A 1QTNB 3MF5A 4JI3F 2QZ8A 3AB2B 2LQ9A 4HHHA 3SV4A 1S76D 3GCWP 1CEZA 1RE1B 1YGYA 2YNHA 5KFDA 1X9MA 2E66A 3PIPQ 4JI7F 4L6V3 4Q2LA 5U47A 4FDFA 1ZAWA 3CD0A 4PRFA 1FRIA 2IJRA 2HG4A 5HO4A 5DDQC 3R97A 1TP7A 3H2LA 2CQPA 2POKA 4CO4A 1X9SA 2NPFA 4C8OA 1RHJB 3MOJB 4RW4A 1RKJA 5KFTA 1KQFB 3PJXA 2RE1A 2N4DA 5D0HA 1LWCA 3RB4A 4ZP8A 3D54A 2XSJB 5KFXA 1AA1B 2KU7A 2RAQA 3CJ0A 2VOPA 1UWBA 2WBMA 2W1BA 4RNHA 3Q8SB 1VRQC 1TKZA 3NBPA 4NZ7A 4QPTA 5JVGQ 1M5SA 1N34J 4OZ5A 4X65J 3ENWA 2FYXA 3VGSA 3SQOP 3BQ2A 3I9V9 2D41A 1QJHA 3RAQA 3GWCA 2D3OR 2YQ3A 4YS2A 4HDHA 3OW2R 1SL0A 3BGFA 2VC0A 1WF0A 4ID5B 1N5SA 2DPIA 2EW9A 4K0KJ 5C5JA 2IMOA 2ZITA 3V81A 4YEAA 3KLFB 4USJC 2VBZA 2Q1LA 1Y00A 2BJ9A 1WHWA 5L8RC 4ES1A 1FKOA 4EBEA 1FESA 3AD7C 2OMOA 4FNIA 2CIMA 2RKIB 2HMIA 1H7WA 4K4VA 4K59A 4Z2XA 3LP2B 4ILRA 4KAIA 1QLNA 4USIA 4ECZA 3DRSB 1U4BA 4K4ZA 3DRPB 2NR0A 3J80Y 4PWWA 4OHZA 3MM9A 3AAWB 2UXCJ 4C97A 5IC6B 2R7VA 5KFFA 1TL3A 3B6BA 3CJQA 3ET6A 3OL9A 2GV1A 2DGVA 5G0RA 1D8ZA 3OV7A 3KK2B 4F4ZA 1CC8A 4WZMA 1FJCA 4DR2F 1DARA 2WVBA 4OYIA 1PC4A 5A6PA 1VIOA 3ZNUA 3ZTSA 3KK1B 3BYPA 2DCLA 3V6JA 3JSYA 3CNQP 3M32B 3TAMB 2AX1A 4WIQA 4NI2A 3Q23A 4N41A 3PACA 3DU5A 4DR6F 4LF8J 1U1NA 2NXEA 4JV2A 2YNFB 4M5DA 1YBTA 2R7TA 1OWXA 4DG1A 5HP1B 1T9YA 1FD8A 3MR2A 2BM0A 5CCMA 1YKWA 3U1LA 2L08A 1M5VC 1YWXA 5EUHA 4YB1P 1FO1A 2LA6A 1EKSA 1Q4RA 3AA8A 4OYAA 3HSDA 3K59A 3WC0A 4ZCMA 4LSLB 3VVTA 1U1PA 4KGZB 3K5MA 2XCAA 4AQYF 2FJDB 3MUVP 3JTPA 3M8PA 3QT8A 3OJSA 5KT7A 5CYMB 4DR1J 2MLXA 4EYIB 3KJVA 4Q7AA 5K14A 2AF6A 3EXCX 2DGOA 4QIEA 4G65A 4PWDB 4K2JA 1EHWA 3FFIA 3TAQA 4DBQA 4F25A 4PG8A 3PR4A 1F3FA 3N9UC 4MJKA 1MROA 4N5SA 2Z58B 2IDLA 2OO4A 3G6XA 4CO2A 1FEHA 2UUWA 2LVWA 4O3SA 3MFIA 1UWBB 2A2DA 2HK3A 1VGYA 1RI7A 4URGA 1F6TA 4D3GA 3ZXWA 4C48A 1RB0A 3LA0A 1ITPA 2VL1A 3P5TL 4OI4A 2B5JB 4X64J 2H3EB 2VIHA 5DQIA 1VYAA 1FTRA 2KO1A 3CIZA 3OR2B 5D78A 3TEHB 2B43A 4GRSA 3JXOA 3UVJA 3V4IB 5B09A 3D1HA 3G71S 1S4EA 5A8RB 1WKKA 2D3UA 1V6HA 2EC2A 2HFOA 2IRXA 2ZHBA 3EZ5A 4R0EA 2WONB 2ILZA 2DB1A 5KT2A 2E5JA 1TVRA 2E1MC 3LANA 4DR4F 3UCZP 2J8SA 2AJ1A 3OUYB 2BVZA 3CEDA 3FCVA 1X9WA 4ZP6A 1PAEX 1NSAA 5M2PA 1TMJA 2N4CA 2MZRA 2QX0A 3UPFA 3N4WA 2DGSA 3QT7A 3BQ1A 1EIYB 3MM9B 3OHAA 4HT7A 4LF7J 2JVOA 2WCXA 2KHDA 4FF1A 1TUGB 3ET6B 4QZVB 3K58A 1S59A 2PIIA 5FLXY 3EGNA 2GQQA 7FD1A 2GMJA 4OI0A 2BKOA 3KLHA 4JI2J 4RWWA 5LOQA 4Y2AA 5ITHA 3BN4A 1NJYA 4TYAA 1ICEB 4EK2A 1Q5YA 1PJ6A 1QUVA 2W4CA 4DSJA 3RAXA 1S77D 1UVMA 2ZHOA 3PCOB 1VK3A 3DKDA 1S6UA 4ZS6A 2VUGA 1ELOA 2J9EA 2KL8A 4YQWA 1QY7A 4DV0J 1RWPB 1UEVA 3GP9A 3D3CJ 4DG1B 2B6AB 3IAS9 3FEZA 2A0FB 2V6AA 1NZ8A 2VF3A 2G4BA 2OPRA 2PFFB 2XZWA 4DL7A 3CWJA 3KLGA 4ECWA 3CE8A 4X4TA 5KFEA 2WVEA 3DLEA 2QYCA 5C25A 1Q8KA 4HL9A 4FZVA 1Y5LB 4JI3J 1T0TV 1N5VA 3EGWB 1M90T 4NCAA 5HMWA 2F4VF 2DGWA 2E7XA 5IT4A 2QEXS 3M8PB 1S0NA 4WF9Q 3DHWC 3VAKA 3I5AA 5EN1A 5C42A 3JSMA 3MR5A 5KFNA 4UY85 3MAQA 2ZZNA 3OT9A 4JI7J 2MKIA 4BLGA 1SJQA 1S72S 3TI0A 3MR7A 3BSOA 4QW9A 5JVHQ 1VIXA 2OH2A 4USTA 2B7BB 5D4NA 2R7RA 2CJBA 2XYGB 4N76A 1M1HA 4R5PA 1NK9A 1U1RA 3LP0A 1LWFB 4P52A 1LK5A 5J1PA 1NK4A 1UEUA 1CJUB 4U95A 3DLGA 5KFKA 2AJQA 1ZTTA 2MGZB 3ELHA 5KFZA 4HVZA 4TYBA 3UD5A 3D6HB 2KXFA 2W01A 3SCJE 1HI8A 1CLFA 1YRXA 2NZCA 2VG6B 3F41A 2XNRA 5E33A 2MY7A 2HBZB 3H0PA 4QU7A 3QJJA 3P49B 1QDUB 2UZAA 2XO7A 2ADBA 5KFIA 1WC3A 2YWHA 4NZ6A 2XQCA 1FXDA 2OP5A 5BR8F 2BJ1A 5KFJA 5F3TA 3W66A 4NLOA 2IVFB 1WNEA 2YKMA 1R7IA 1SC3B 2IM3A 2HHHJ 3T1YJ 2ATLA 2QA4G 1YK9A 4MIAA 3I4PA 1SJ3P 5F0UA 2W4DA 1JB0C 4PEOA 2FC9A 2KN4A 5M2RA 2FTRA 1JKHA 2XNQA 2HWTA 3VWSA 3GG1A 4ZVTB 3Q22A 1N0VC 3IMQJ 5KAKA 5EWEA 4IR1A 3LAMA 4ZJLA 1FWLA 1KFDA 1URRA 1RYSA 3CD5A 1VQ8S 5B0BA 2AD9A 1PYOB 3HSJA 3TA1A 2V68A 4L3NA 1HWLA 2F9JA 3S1TA 4ED6A 2V69A 1SC4B 6FDRA 2B8PA 2NXUA 1WORA 5E3RA 3VCDA 4ED3A 2JWNA 3C6TB 1OPZA 1VQKS 1LXJA 3LO3A 5IQQA 3O44A 1IM4A 4Z37A 3DMJB 4E0DA 1E6YA 2HHQA 2CQ3A 4A48A 4ANEA 4P73A 4JI0J 2VJVA 3MAAB 3ILLA 2V8GA 4EEYA 2MKCA 2IAJA 4QOTA 2K3KA 3DI6A 3TANA 1NSKL 3LQVA 1P6TA 3KOAA 2MEWA 3CCMS 3THTA 4ITSA 1N54B 3J81j 3I5BA 4LIWA 1EETB 3V6DB 3L7PA 3IBFB 4X4SA 2HNDB 3DYAA 1UAWA 4NE9C 4URQU 1XMOJ 4IDKA 5KT5A 3SCKE 3G96A 2HHWA 3MM6B 1CS4B 2BX6A 1FF2A 4OI6A 4EBCA 2W2QP 2E44A 3EPGA 3DLEB 5AXKA 1D9AA 5CZXA 3HD1A 3NCRA 4W92B 1P9YA 2WSFC 3H20A 4CLSA 4MKBA 4KH0B 4Y65A 2QA4S 4WE1B 2LXIA 1XEZA 4BC7A 5CA5A 2IYGA 3A3PB 3EUNA 1HARA 1S1WA 2IRUA 4MIBA 2UUAF 5DG9A 5GAGI 4B9VA 3K2YA 1AYEA 5KTQA 2V50A 3PNIA 3TQ1A 3W2VB 3G82B 2DEIA 2FHMA 2IC3A 2OI2A 4LVOP 4QIFA 2F3JA 2F4FA 4DUYF 4WTOB 4I69A 3ILIA 3CJ3A 2HSEB 3NL0A 2CPIA 4I67A 4A8QA 4ZJQA 4TQRA 3TP2A 4KO0A 5SZTA 4TN2A 1H74A 1PILA 4DU8A 1QE1A 2V63A 1K44A 1AFJA 2SXLA 2RF2B 1GMWD 2V8HA 2CWXA 5E5NA 3CJ2A 3DGPA 3W9HA 1HBMA 3MM8A 2CWKA 1RT6A 1UVNA 3D5MA 4WKRA 2RDDA 2NLWA 3I0SB 2ACYA 3RJMB 1SUQA 4LT6A 4C0OC 5HQMA 2RDJA 3BREA 1EAYC 2V8PA 4DLGA 3M8QB 3DFEA 3NAHA 3GIIA 3AD9C 3L7UA 1W2IA 1XR7A 1UJ5A 3X3UA 2L48A 4WU2A 4H4KA 4HACB 1UA1A 2DGQA 3PX4A 1S1TA 3QLHA 1V3SA 4FXWA 4DSKA 4KJIA 3DN9A 2HS3A 2KRBA 3CJ5A 1WWHA 3QRQA 1KDNA 2KI2A 1AB8A 3TJ8A 2R9LA 2K3IA 3QO9B 4M5JA 4C8YA 2Z2ZA 4LQ3A 1IQTA 5IOLA 5IWAF 2DH9A 2VPWB 3IWXA 1W7WA 3RW6A 1P1LA 4O4GA 3ITHA 2FJEB 2XCPA 5LM7E 2EXUA 1Z4UA 2LEPA 4W98A 4ZHRB 1KBRA 2KYXA 3TVYA 1N33F 4QWDA 3JQKA 3MM5A 2XGPA 3NMAA 4DL5A 3ISND 3DOKA 4GO5X 5L1IA 3FSYA 3E01B 2MTLA 2D9PA 4MT1A 1VMBA 1P27B 1LKZA 4YHHF 5IM0A 3C8YA 4DCJB 1HL6A 2W25A 2ZC3A 2JOQA 2IY5B 4RR5A 2XC9A 3AXKA 3G6YA 2XZTB 3IC1A 2MLYA 1X7VA 3KK3B 1LWEA 4WWSA 4OI3A 2R2UA 3DDKA 2AGPA 2ZEJA 3QZ8A 2F4VJ 3NKYA 5BJRA 3PFEA 3KUGA 3BSAA 1RT2A 4F02A 3BKFA 2QGFB
chains in the Genus database with same CATH topology
2YNIB 3HHLC 2BOPA 1KN6A 5J2QB 2DR5A 5I3UB 3HVTA 4K0KF 1GTHA 1TUVA 1HI1A 1ZM9A 3AHPA 4M94A 4Y0FA 1DHMA 2HZCA 4B3RF 1IXKA 1HHSA 1YSJA 3CJKB 1JLAA 1PO6A 4RW9A 2FVPA 3TR5A 4MMOA 1IKWA 1A6LA 2N3OA 4Q8FA 4ZPDA 2C3OA 4WFAQ 2B5JA 3SQGB 3B78A 3HPOA 2R8KA 4DS4A 2CQCA 3DU6A 3HM9A 1YVFA 2EVZA 4HTIA 3CC4S 4OLOA 5L1JA 3R1LA 3MUTP 1C0UB 5HLFA 4IG0B 2B4PA 3MD1A 2YKQA 3F56A 5B0EA 4OI1A 4DHVA 1WF2A 2MZSA 2V2KA 1NKCA 2BUNA 4RKUC 1XR5A 3CGIA 4Q0BB 1TV6B 1X5PA 4KO0B 5D4LA 4Q44A 5GAEU 2QA1A 2OPPB 3OR2A 3R5AA 4DS5A 1BWEA 2UP1A 1O0PA 2CZ4A 3MCSA 3JTNA 3IG1B 1TL1B 1T03A 3FDSA 2DTJA 2LLZA 1S9FA 5HMZA 1C1CA 4CNZA 3PO5A 3V4IA 1TQLA 1N8RT 2ZBIA 4FVCA 3G9CA 2EG1A 5J1EB 1QUPA 5B7WA 1YJTA 5E7OB 2ZH2A 4IOCQ 5A8RA 4RW7B 4NRTA 2J0XA 4CZCA 5F8IA 1FEEA 3LH2S 3THPA 3TO8A 3DXSX 4J9MA 1V3RA 2ADCA 3G8TA 4ECTA 3G86A 3LF0A 2EK1A 1X4EA 1R43A 3CCSS 4NLDA 5CXTA 3HI9A 5L9XA 1TVRB 2WONA 2R7QA 2XULA 4WFXA 2OFHX 5K8OA 2B3TB 4MK9A 4PR6A 1Q7YT 1KNZA 3OR1A 4P7VA 4XPCA 2EWHA 4IQXA 1H98A 2RH3A 2OJ3A 3PRBA 4FNHA 1HW9A 3IA0A 3KLEA 2JEIA 5K8PA 2GIRA 3ZZUA 1W2BR 2VH7A 4ED7A 1FRJA 1VBXA 4A8FA 3OUYA 3BO4A 2XS2A 4OX6A 1FDNA 1HPZB 1UW4A 4KHRA 4KPYA 1UFWA 5A8KA 2Z4PA 4B17A 4C11B 3CT9A 3K5PA 2C2EA 4LQ9A 3CJ4A 1GX5A 3MEKA 1FA0A 2ZD1B 1L3VA 2KYZA 1TFWA 4TU8A 1QSSA 1NH8A 4NLQA 4DR3F 3PY8A 3OVSA 4WXWA 2QLWA 4UW2A 3ZZZA 1LW0A 4BWJA 5GAHI 4F4XA 2XG8A 1I1GA 4JI8F 3HXMA 1SI9A 2J7UA 5DJBA 2JC0A 3UR0A 4P7TA 3IN5A 2LEBA 5DG7A 4LVNP 5CD4H 2BQ3A 4CCHA 2N7YA 3LALA 3OTBA 4BWMA 3MR6A 3DHXA 3Q8PB 1YTYA 1UJ6A 5T41A 1KR4A 4W90B 4NLPA 4LFCF 4JBCA 3MXHP 4XDDA 3SFUA 2V4QA 3H25A 1IKVB 4I2QA 1FKPA 2DCUB 3NNCA 4Q8EA 4DUZF 5KFAA 1T7PA 2HGMA 2VPXB 2IM1A 2YNGA 2FVQA 2KT2A 2NPIA 5KFVA 3ZZRA 5I4MA 4M95A 2DIUA 4YB7A 5E2QA 4ECQA 1IKYB 2VB6A 4RUAA 1LOUA 2E7WA 2VBYA 3KLHB 3KLVA 4RWXA 2DR8A 5KG3A 1LXNA 4JI6F 3DLJA 3FQKA 3JYTB 1VC6A 3E2EA 1HBNA 2RRNA 2UV8A 5I3PA 4KC5A 3HHDA 3OFFA 4RW8B 4CH7A 2HW3A 3QIPA 3N6LA 2F8MA 4PXCA 3MMBA 4IO1A 4EWTA 3UD3P 1I6JA 1D1UA 3BEGB 2ZOMA 1S49A 3KNAA 2DNNA 1Y3KA 4PXDA 4WFZA 1U09A 1RT7A 2JHEA 4WKYA 3LUYA 3OTDA 1U6ZA 4LF9F 4J9PA 4G1PA 2OIHA 3T9NA 4ECXA 4LF4F 2MJNA 4DL3A 1K1SA 2MZQA 5C24A 2JJ4D 1S9GB 2PC6A 1JJ4A 2N7CA 2IBKA 2CPXA 4OX7A 4G1QB 4N8NA 1CPZA 1WG4A 3NCQA 1VQ4S 4F4YA 2AYBA 4DQIA 2XB2D 1TAUA 2ZH6A 5KFHA 2M2BA 3ZC4A 3GIKA 4FBUA 2JVRA 2D3ZA 3HVWA 4N56A 2J5AA 2VFSA 3THVA 4HH1A 3Q8RB 3RBDA 1N56A 3ETOA 1S6OA 5AJ3F 2ZHAA 5CHCB 2LKZA 1U25A 1RTDB 2VKRA 2LU1A 3D0GE 3UCUP 3NMRA 2UVUA 3FMWA 4NA1A 2L41A 1FRXA 2A1BA 4N47A 2OPQB 2B6AA 3MM5B 4ED8A 3HHEA 3PEJA 1H2VZ 4X4QA 1CSJA 1KOHA 2OPRB 4MIWA 2KM8B 2EBEA 2FIUA 4DR1F 3U1MA 1S0OA 1UETA 5F8NA 2MKJA 3EGZA 4IFVB 3SDEA 4RNNA 1DURA 1C1BA 2KRRA 3CDUA 4R8UB 1U7LA 2FGOA 2WBRA 3HLUA 3KLGB 3C46A 1RISA 1LW2B 5IXUA 4X4OA 1NJZA 2MQQA 2B9XA 5C25B 2I9SA 3PEHA 4IG3A 4ZPWR 1ZAVA 2VODA 3GV7B 3AJ1A 4IH6A 3MEEB 2NQPA 1HMVA 5J2PA 3BGRB 1R8AA 4QR0A 5KFQA 1NAQA 2DBBA 3ISNC 4IQMA 5AXNA 4DR5F 4QCLA 1RK8A 2Y1JA 2MKKA 3LW5C 4C8NA 3QGPA 5C42B 2MQPA 2MPUA 2FY1A 3M2UB 3JSMB 5D77A 2WTFA 2R8JA 1QSYA 3HDSA 2J8AA 5J2NB 2PI4A 1YJNS 5IT0A 3OVAA 2BACA 2HHPA 3O6QA 4MYTA 4YDDB 2UVWA 3HKZD 4NYOA 4ZCLA 3GR0A 2GGPB 3NLCA 1XNRF 1FNOA 2YWKA 1JLCA 4FN5A 3R5CA 1REVB 3MEGA 3HZEA 1U45A 2ROPA 2MB0B 3US5A 4U7CA 1T94A 3CCRS 2Q66A 2DK2A 1T3NA 3CPWR 1KQKA 4AYBD 3W2WB 4KBIA 2W9BA 2ZH8A 1HW8A 4B08A 3M2VB 4MFBB 3ZZYA 2YH1A 4J9SA 2VBWA 2VA2A 1YI2S 3I9ZA 2I2YA 2VBXA 2M88A 3CDBA 2IM2A 5DQHA 3KG1A 4GC7A 4ED5A 2CJQA 3GFYA 1WI8A 3RRKA 3SCLE 4X84A 4Y2IA 4WFNQ 1S1XA 4XO0A 4O3QA 1HD1A 4KV8B 1TKXA 1KLMB 1OQ3A 5B0GA 1IBMF 4A4JA 1RT2B 1JX4A 1B0TA 2V5HG 5DG8A 3OXFA 2YVSA 4F3OA 4R5PB 2HHSA 4WU3A 2XMJA 5KFLA 2K2PA 2GHVC 3LAKA 3LP0B 4PG6A 2ZH7A 4I68A 4KFBB 5F8MA 1FCAA 2APOA 5IQ6A 3N5FA 2FJWA 4JV5F 4NPOA 2ROEA 3H4BA 3CO9A 1WG5A 3GB0A 4F26A 2R7WA 3HO1A 1M5PC 3DLGB 1LWFA 2E5HA 4OZ0A 2BANB 2J0SD 1NO8A 3MEDA 1YJWS 3DRXA 1XC9A 4CQ1A 1SH0A 4ELVA 1KONA 5F41A 4LSNB 2M9KA 2F7VA 3KNGA 5LJ3Y 2IA0A 2MGZA 4QYRA 4MKYA 2N3LA 3U02A 2PSZA 5IT9Y 3HJFA 1VI7A 1X5SA 4K50A 1S99A 3NS6A 1FXRA 4O3OA 5F3ZA 4DV2F 4I0WA 1AFIA 2CQ2A 4E98A 5HLFB 1XNQF 3G6ES 1OQ6A 1S6PB 5DGBA 1RTIB 2VFVA 4KT0C 1RTHA 2VG6A 3HVAA 2BZ2A 4F3MA 2CJKA 1N4LA 1JLQB 3I96A 4NZ0A 2XLKA 3KHHA 4OHYA 3TNVA 4NLWA 4RBUA 1NK0A 1EP4B 2P9GA 3KHLA 1M5HA 5D3GA 2X3GA 4ZP9A 1TKTB 1LV5A 1Z2LA 2KM8C 2IA6A 3NWGA 2VOOA 1HR0F 1DAXA 3MR3A 4AL7A 4U7UK 4Q45A 2O01C 2QE5A 4CO5A 1Y9OA 2HFZA 5A8WB 4DN9A 5EHHA 1DZ5A 4I6WA 4H4OB 4K4SA 2JDJA 2RJZA 4YB6A 1MWZA 4PPZA 1FD2A 3RAMA 4NXMF 2KG1A 1Z2ZA 4YR3A 1TK8A 4PUOA 2YKMB 2CVIA 2KHCA 3HF5A 4CO0A 2FLPA 4J37A 4BS2A 4C4WA 4A8WA 4FF4A 1Y7PA 2E1AA 4Y00A 4NLRA 1FDDA 4P2SA 4ZVFA 4C3KA 1VQNS 4OHWA 3B82A 2HNZA 5AXMA 2UXDF 4WYLA 3MHYA 4OJHA 3TYTA 3P96A 3M8RA 3OR1B 4MTPA 3MPWA 4ZOSA 2Q3PA 3CCQS 2WAQD 2W7PA 2ZKTA 4J9LA 4Y2MA 3RTVA 4DFMA 2CQ0A 4X4NA 2VFUA 2BE2A 1TKDA 4Q2MA 4DV6F 4LF7F 4CO3A 2DNGA 2MZTA 1PSDA 4I6YA 3UI3A 2EKYA 3G8SA 4ECUA 1YIJS 4N8OA 1RGVA 5HMYA 3DOLB 2LXFA 5A8KB 5D6GA 1YJRA 1V3ZA 3QWUA 3H8YA 5J1NA 1JKHB 1S1VA 3NGKA 4ZMMA 3OFEA 2KFZA 5CYJA 2B7CB 4Y2CA 4DFPA 4YOEA 3CC7S 2JFKA 5EX3A 2CQHA 3PW2A 4I64A 1BQNB 3D0HE 3MUMP 4RU2A 2W9CB 2EFNA 4B9NA 1M5KC 3D2WA 2BR0A 1NK5A 4ZPVR 2DHXA 3PR5B 3K0JA 4BC9A 2ABYA 4JI2F 1XERA 4QW8A 2DNMA 3CCLS 3K8WA 1UL3A 3HKWA 4I2PA 4HTJA 1DTQA 3DRRB 3ISZA 2EPIA 2CQBA 1N0UA 1RT3B 4QIVA 4DSEA 2IJFA 1HWUA 1RQ0A 2LDIA 4HDGA 3M8SA 3GFHA 1SV5A 4JYAF 2XMVA 2N82B 1J5EF 1K0VA 1OSCA 2KXNB 1XK8A 2CPJA 1UFLA 3H2VE 1Y5NB 2HLTA 2M7SA 2PMHA 4C8KA 2VQFF 3VAFA 1JXEA 1L5UA 3GYNA 3GFZA 4NA3A 1S79A 1VQPS 2ZE2A 4CT8A 3OTCA 1FVSA 2CPDA 2DISA 3KK2A 5LSRA 2FHKA 4ZK7M 1Q8LA 4PQAA 2W4PA 4QWEA 1VQ6S 3O5TB 3M6XA 1F5BA 2PGCA 3MD3A 2NS1B 2EFQA 3FSXA 5E41A 1IBKF 4NLVA 1Q7LB 4M1KA 4TLRA 3F73A 3WX4A 5FDLB 2MZ1A 2RIJA 2V8VA 3NCPA 4RLEA 3MDFA 5BYQA 3QGIA 4DV0F 2YWFA 1RTJA 3C6TA 3MMBB 5F9NA 1WEXA 2RB7A 3HHNB 4NX9A 2VG5A 1E6YB 1Q81T 1VQSA 3A1YG 1ZZFA 4LFAF 4YB5A 4DL6A 3SSSA 4AE5A 3DMJA 5F8GA 5DETA 3V4MA 2WHOA 1BQMA 5KOWA 1BQXA 3T19A 3P3DA 3M30B 1WHVA 4BHQA 1ULRA 1JMTA 2DNQA 2W24A 3NRBA 1P8GA 2IAJB 3M1VB 3AY0A 2K7KA 4ZA1A 5E3CA 3DI6B 3ENVA 2KDOA 3NP5A 1O5JA 2EFOA 2LA4A 1SQEA 3IXQA 4HEA9 1C4AA 5LT5A 4KRWA 3K5NA 4XDCA 2ZVSA 5LL6d 4EBDA 2OLWA 4B3OB 3N6MA 2VPYB 2LCWA 2HNYA 3NNHA 1WI6A 1UA0A 3J81Y 3POTA 1T05A 3MPVA 3HVRA 5MLCV 1Q78A 1S48A 4KR0B 4O3RA 1G1XA 2R4FA 1IKXA 2ZUGA 3D1QA 3LP1A 1S9EB 2DNLA 1S0VA 2HVHA 2XBPA 3QZ7A 5LMNF 1FERA 3MF5A 3TRGA 4JI3F 2C2DA 5GADU 3MWBA 2QZ8A 3AB2B 4YMEA 2LQ9A 4X4VA 2R8IA 3DYAB 3QMQA 1EETA 1X0PA 4WFYA 3V6DA 1KVIA 3SV4A 1S76D 3U1NA 1KEKA 1NKBA 5CCLA 1ZOTA 1IUJA 1DTTA 4IDKB 2CDQA 5GAEI 1CEZA 2HNDA 4OZNA 3ICLA 1VQOS 3CCZA 5T7LB 2KKHA 1GXLA 3MOZA 5CH7B 2IRYA 1YGYA 5AXLA 1BD6A 2XMWA 2YNHA 4RX6A 2W8LA 2FDNA 2AWZA 1NB7A 3IWLA 5HI7A 5KFDA 4X66F 2E66A 3PIPQ 1TZ0A 1X9MA 4JI7F 4NYPA 4L6V3 3MM6A 1FHTA 1GQEA 4Q2LA 4HT5A 5KFUA 1SXLA 5U47A 2V8DA 3ZZOA 4WFBQ 2ZJPQ 1QM9A 1ZAWA 4Y3CA 5DM6Q 5EDWA 3CD0A 1HNVA 4PRFA 4UUWA 1FRIA 2HG4A 2JRSA 3SXLA 5HO4A 5DDQC 5I42A 1R0AA 3SEOA 1IJEB 1QAIA 2G1DA