4HI2A

Crystal structure of an acylphosphatase protein cage
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
QCSKFIVSGHVQGVGFCYHTSHQGLKLGLTGYAKNLNNGDVEVVACGTPERLEELYLWLQEGPKTASVRQVRRLSSELEHDYQGFEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Crystal structure of acylphosphatase C20R mutant from Vibrio cholerae0395
rcsb
source organism Vibrio cholerae o395
molecule tags Hydrolase
total genus 22
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4hi2A00
3LGMA 2LDIA 2HLTA 4NPOA 5F0UA 3HX9A 1CC8A 1Y3KA 3UDCA 3HHLD 2K7KA 4YEAA 2QLXA 3TRGA 1AFIA 2RSQA 3T9NA 5A6PA 1RJJA 2RMLA 3QGPA 2W4DA 1VQYA 2ZDPA 3KKFA 1N5TA 3CJKA 4A48A 1OPZA 1FE4A 2OAUA 1Q8LA 2AW0A 2RILA 3BF4A 2GCFA 3IWXA 5B0GA 3CJKB 3HHLC 2AJ1A 2OP5A 2KKHA 1TUVA 4ZA1A 3MZIA 1AW0A 4OJHA 1MWYA 2BYCA 3FMBA 2L3MA 1TZ0A 3BGUA 3DXSX 3LGNA 1JK9B 4HI2A 4Q2LA 1P6TA 1YJVA 4A4JA 2N4DA 2AJ0A 2OKQA 1URRA 1OQ3A 2FHMA 1VQSA 2G9OA 3KG1A 2N7YA 1GXUA 1YJUA 1X0PA 2OD4A 4Y2MA 5IXUA 1APSA 4HL9A 2BJEA 3HDSA 2JDJA 4HH1A 3TNVA 1FESA 4DPOA 2K1RA 3TOQA 2XMMA 5B0DA 3HFKA 1SQEA 3K7RA 3HHLB 1CC7A 2EW9A 1X8DA 3GZ7A 3KG0A 1FD8A 1P8GA 4FNIA 2K1RB 4Q2MA 1MWZA 3MCSA 2BBEA 2IYGA 1N5QA 2OMOA 3LO3A 2XMWA 5B0BA 2FTRA 4DL0C 1TL5A 2OD6A 2ROPA 1FEEA 4EFAC 2W4CA 1YJRA 2XMKA 2ROGA 2PGCA 4NL5A 4QOTA 2ACYA 1Q53A 1Q8BA 2QYCA 1K0VA 2ZDOA 5A6WA 2VV5A 1Q4RA 3WDOA 5F0WA 2HLUA 2LQ9A 1S6OA 2BJDA 1TL4A 2OFGX 2QLWA 2RU9A 3HHLA 3BM7A 2GGPB 1GXTA 1YG0A 2XMJA 1FE0A 1R6YA 4DN9A 5B09A 4OJ1A 2GV1A 2GO8A 1W2IA 4A46A 3FGVA 3BB5A 1KQKA 1SI9A 1U7LA 3VTIA 2XMVA 1OSDA 5T7LB 1YRXA 2Q3PA 3DCAA 1YJTA 2ROEA 5B0FA 2OFHX 4OJGA 3HF5A 4Y2IA 5K9FA 1V3ZA 2N4CA 2BUNA 2IFXA 3E8OA 1LQ9A 1FVQA 3KNGA 4HH0A 5B08A 4HI1A 5B0CA 3BDEA 4Y2KA 2HFNA 2PD1A 4ZOSA 2W4PA 2GGPA 5B0EA 2AP6A 1OQ6A 3I9ZA 2KT3A 4U9RA 4OJ3A 2GFFA 2K7JA 2XMTA 1ULRA 4YDXA 3QMQA 1CPZA 4F67A 2KT2A 3BR8A 2ASYA 2XMUA 3BN7A 2QIFA 2LXFA 1N5SA 1TR0A 1XBWA 2FIUA 5T7LA 2HFOA 3F44A 3IWLA 2LQBA 4A47A 2HIQA 1JWWA 1WD6A 1QUPA 1N5VA 2FB0A 2GA7A 5B0AA 1KVIA 2KYZA 1KVJA 5KAKA 2CRLA 1IUJA 2HQIA 1Y3JA 4FNHA 1S6UA 1Y0HA 3FRYA 1AFJA 2K2PA 2VH7A 2IYIA 1SB6A 1Y9OA 1FVSA 4OIXA 1X7VA
chains in the Genus database with same CATH superfamily
4K0KJ 5F3ZA 3GIMA 2KJVA 4U8YA 4KO0B 4ERDA 2JLEA 1CS4B 1RWPB 2YPZA 3I5BA 3KJQB 4DQRA 3GQCA 1G1XA 1TZ0A 4HI2A 3AD9C 3HFVA 2OEJA 1SKSA 4I2PB 2BM1A 1HYSB 1S49A 1N4LA 2L41A 1U4BA 1VQ8S 2Y3YA 4KT0C 4R8UA 2ZITA 3RGIA 5DZ7A 3TAPA 2BJDA 5KFEA 1GXTA 4HKQA 2F63A 1NSKL 2QL9B 5K5MA 1WEXA 2DKOB 2G1DA 2H5EA 3TYTA 4DR4J 3SZ2A 2E5GA 4PXDA 2XLIA 1VQ4S 3U1LA 2NQPA 5J2QA 4NI2A 2ALZA 5KFTA 5DDRC 4NI2B 3UN2A 1ACMB 2XB2D 1VK8A 2MPUA 4LVOP 2H4YB 1RT4A 2XGQA 3RR7A 2ZVIA 2RILA 1A0OB 4WYWA 1JJ4A 4IRCA 2MLZA 2VDHA 4UOFA 2QV6A 4UQGA 4C3LA 1RTJA 1P9QC 4Q5VA 2DBBA 2YX1A 1GMVA 1FRXA 1D8ZA 4XO0A 2N7CA 4KYZA 4X84A 1HBMB 3C16A 1R8CA 3SCKE 1NB7A 2XM3A 3G8TA 2EFPA 2PI4A 1ZAWA 1SJRA 1LWXA 2DR9A 4M5MA 4YFUA 4MJKA 3H5YA 5GADI 1S76D 2ZH5A 5D6GA 4NE9C 2QRRA 3WX8A 4M94A 3R97A 2HWIA 3IRWP 1QUVA 5B08A 3KHHA 4Y2KA 4DL7A 3LF0A 2LXUA 5ETKA 2V2KA 3BV8A 3GP9A 3OPKA 2FB0A 4XAKA 4JI2J 1S9FA 3KXDA 1S99A 5F0UA 2VF3A 1TVRB 2LP4A 3AD7C 2X51A 1YGYA 4ES3A 3GJSB 1S0VA 3ITHA 4UTGA 2MSTA 4W98A 3HT3A 3CJ8A 2G2ZA 3EPIA 5DLGA 2DCUB 4Y2MA 1YWXA 2IA0A 3HSDA 5IV3A 1U0SA 2P6SA 3HSZA 1C0TB 4QR0A 4ZPDA 2IJNA 3KOAA 3A12A 3R5CA 3P45B 2X3GA 4C2MA 1KN6A 3RBEA 3C46A 4DUZJ 5JJBA 4LR9A 1DLOA 2DNNA 1FX2A 1NPRA 2I38A 1KHWA 1YSJA 2V2ZA 5H9FJ 4J9SA 2H5JB 2DGQA 5DGBA 3G82B 2QTWA 3QO9B 2CJYB 1IR2A 2ASJA 3GJRB 2R2RA 2FZKB 3H40A 3DYAA 5MLCV 4DL3A 3R1HA 2MMYA 3DYAB 2H65B 3DLKA 5J1NA 2V6AA 4F02A 3K5NA 2NYIA 1T03A 2RS2A 3DLKB 4N8OA 2DT9A 5DRKA 4LSLB 4F3MA 2PEBA 3MZIA 1RZMA 2E9RX 3GG0A 2NLWA 1NK4A 1GXUA 4R25A 3ZZYA 3D1HA 5KFPA 3JTPA 4GO7X 3D3CJ 4EBEA 4IDKB 3TOQA 4C0BA 1T3NA 1SQFA 3HZGA 2N82B 3MPDA 4X4OA 3R3TA 2YWKA 1XR5A 2KVIA 3I5CA 4NL5A 1YI2S 3NGSA 2M0GB 2EKNA 3W9JA 3E3XA 2EFNA 1VQLS 5KFLA 2F8EX 4J7CA 5KT2A 2JSXA 3CUNA 3GWCA 2HK3A 3KK3B 3RZAA 4Z2XA 2CIMA 3F73A 1HR0J 3I0SB 4LRDA 1S9EB 3AAWB 2VKZG 4X62J 4A8YA 2HNYA 3M2VB 3ENWA 3MDFA 1EARA 5SZTA 3T9NA 3SV4A 2QLFB 1RGVA 1UZHA 3PY8A 4M5NA 3W2WA 2ATCB 2GC8A 1C1CA 1M1GA 3N28A 2OLWA 3VCDA 3MURP 1X0PA 1T05A 1JXEA 1T05B 2CQGA 3CCWA 1X4BA 2ZD1A 4Q2MA 3LA0A 2W7AA 2FJEB 4RNNA 2FTRA 4P52A 5HN0A 3H0PA 1LXNA 5KFSA 4NLGA 4YY3F 4WIQA 4C8LA 2MKKA 5A6WA 4CQ1A 2CNLB 2E5LJ 4DZDA 1KD1T 2VFRA 4UT4A 1VHFA 1UETA 3TA2A 3FGVA 3UD5A 4LF5F 4EYIB 4MK9A 1IBKJ 1KVKA 1H2UX 2FGOA 1I94F 4IG0A 1H7XA 5ETVA 3I6PA 3CJSA 2Z30B 4IG0B 3PTWA 2Z4PA 3PX6A 5F8HA 4JOUA 3DKDA 2LXFA 3FCVA 2KFNA 3HHEA 4DSKA 2W24A 2DNRA 3WHIA 3PEHA 2BKPA 2B4VA 5BR8F 1ZPVA 4WFNQ 3BGFA 5CYQB 5BYSA 4DV6J 3QJJA 4F4YA 2GHVC 5HVGA 2CG8A 4FXWA 1K44A 2ZM6J 5B0GA 3J7AN 4O4GA 3DU5A 1IR0A 4JV2A 5K14A 4DX5A 3ENQA 3BKUA 4O4GB 4ALZA 5K14B 3QIPB 4CO2A 1CC7A 2EW9A 2XBPA 3NEKA 4CO3A 4YN3B 3QT7A 4DF8A 2W9BB 5I42A 2E9TA 3T3FA 4BCAA 1G7CB 5BXIA 4I6AA 5I42B 3H2UB 3NNCA 4B3SJ 2ZHBA 2XNQA 1YITS 2KI2A 4DS4A 4ENOA 1YJWS 2UUBJ 3KLIA 4F4XA 2YX7A 3KLIB 3AHPA 2PEHA 2PC6A 4C11A 2KG0A 2AJ2A 4IKAA 4CO0A 4C8OA 4PKDB 1SVDA 4ID8A 2HHVA 2HQCA 4Z7YA 1EZZB 4KC5A 4XDCA 4K50A 3Q83A 1UVIA 1X4GA 4IFYA 3A13A 2NCKL 1G3OA 4R0EA 3BDPA 3HFZB 3TI0A 3AB2B 4NMXA 4RW8B 1BC6A 2IRXA 3AJ1A 1FESA 3NCRA 1H2TZ 1X5OA 3KHRA 1B7FA 3VAGA 2LFVA 4X64F 1YIJS 4ICLA 4ECUA 2MGZA 4ICLB 3RYLA 4F3OA 5DLFA 2HHHJ 2MGZB 4E8UA 1WOSA 2QG9B 3PO5A 4UZBA 5ETLA 3IAM9 1UWBB 3KLFA 2J6SA 2XY5A 1Q8IA 2BJ7A 3BSOA 1SIZA 2KT5A 4AYBD 4TY9A 3FBCA 1U1KA 1FXRA 3KJVA 2J8SA 1RT7A 3SDEA 4N41A 1WI6A 3PM9A 2VQEF 3B78A 3OD2A 1F2HA 5IQ6A 1QAYA 2F7VA 3QGIA 1VHIA 1YVFA 2KFYA 3N9UC 3OT9A 2LVWA 3BBFA 2HS0A 3UE2A 3Q8SB 1G6BA 4OYAA 2BYCA 2I0XA 2N4DA 4R5PA 3P8BB 1S1XA 1XERA 2P2CB 5KOWA 4FKXA 2M8HA 4HL9A 4DCJB 3G96A 2PMHA 1JNZB 5B0BA 3QBCA 2HHXA 5DDQC 1TFYA 2LA6A 1IJEB 1SKRA 4K4UA 3JQJA 2QLWA 4ANCA 4RLEA 4FZVA 4CYUB 3CF5Q 3PR4A 2HIYA 1G4CA 2AYGA 1ZM3A 2OEKA 4YDXA 4F7VA 2M4MA 4GKJJ 1MWQA 1RQ0A 2DIVA 2VG6B 4U67Q 1WI8A 1FVSA 2O01C 5SUHA 1SJQA 1BUXA 3LGMA 1P1LA 1Y3KA 3SFUA 3D7SB 1EAYC 3CJKA 4RW4B 5HAOA 2YH0A 1F3VA 2ZBRA 3CJKB 1T0TV 3EJMA 5D3GB 2MKCA 3MMJA 4ZPBA 4D3GA 5KT7A 3HDSA 2B4PA 2RUGA 1L3KA 4QJVA 6FD1A 3MR3A 2UXBF 3M2RA 4Y28C 3OR1A 3AFGA 1WHYA 3PFEA 3OR1B 1XMQF 2JEFA 4TU7A 1Q53A 1RT2B 2HVEA 1H72C 1T7PA 2XS2A 2CZ4A 2W25A 2MHNA 2ZFHA 4F8RA 4WZQA 1NB2A 2YQ3A 2ZOFA 5L1LA 2HMIB 1AZSA 2FLPA 1REVA 4LR7A 4RWWA 2HWTA 4IQMA 1REVB 1N5YA 1N32F 1UVMA 3MM6A 2KM8C 2AJFE 3BR8A 3DNCA 3BN7A 1N5SA 2YX4A 3MM6B 3KUHA 1RBAA 2FC9A 5HJYA 1K47A 5E5NA 4RZRA 1WG4A 2H4WB 4MTPA 4RO0A 4UOCA 3KHGA 1RA7A 5J2PA 5ETNA 5J2PB 4O4RA 5CH7B 4KFBA 4I68A 4RNHA 4JI8J 4DV1F 3FMWA 2Q1LA 2K06A 3CMES 4M5GA 1W7WA 4DHVA 2YQ1A 1IBLF 1J2VA 2BA9A 1EKSA 3KK1B 2ILZA 4QPTA 2DNGA 2Z57B 3UN3A 2V9WA 2CNOB 4A8KA 2XMKA 3PYEA 2XWXA 4C98A 3P96A 4OFZA 3NS5A 2NR0A 3PJ9A 4QWBA 2XY6A 2BACA 5DQGA 4KAIA 4TYAA 1IWAA 4OX7A 5T7LB 2C2RA 3U02A 3CXCR 3HF5A 4DPXA 1NDPA 5HP1A 4CI0B 3NP5A 3BBCA 1PSDA 4YB5A 5IOLA 3GR0A 2KT2A 5G0RA 5JVGQ 3EE3A 1ZYQA 4CM2A 1RU2A 3DDIA 3RU0A 3I56S 3NGDA 3TAMA 1YX2A 4ZCLA 2QLXA 2GAHC 1RABB 1BE4A 2NZCA 3FBEA 3VWSA 1FHTA 2AD9A 1BWVA 1MLAA 2CJQA 4WK1A 2DXFA 4K2JA 3HFKA 3Q24A 3HHLB 4AUKA 1J5OB 4CLKA 4Y6IA 1QVFR 2B7CB 5KFGA 3QATA 2AIRB 5L46A 2KZZA 4PYAA 3A3OB 2KL8A 2OPQB 2WSEC 1MW7A 5A2QY 1OYEA 3IBCB 2Y1RI 4JBCA 4DFPA 4ILLA 4K8RA 4CTAB 1B99A 3RB0A 1RT3A 1YLXA 2DITA 1U49A 4ZLJA 4HYKA 2DGOA 2QJ3A 3M8RA 1U0HB 2HFZA 4FYXB 3SCIE 2UUCF 3IWLA 4UF4A 3CDUA 2B9EA 3HI9A 1UJ4A 2KU7A 1IQTA 2CWXA 5F41A 4AD6A 5A6PA 3KDOA 5AE3A 4TQRA 6AT1B 5HL7Q 3QJPA 2V2QA 4EI2A 1GMWA 4G1IA 1VQPS 2L3MA 5IT9Y 4EZ9A 1IKYA 4HDHA 3ZNUA 3MUMP 3R7SB 1J5EJ 3OFEA 1X4FA 1T9WA 4IG3B 2HRUA 3CGIA 1S6PA 2HZAA 2CQ3A 2WSFC 4JYAJ 3R6LB 1RAEB 4NYZA 4DQSA 2ROPA 2WK4A 1GNKA 1FJGJ 1REGX 1HBOA 1NU4A 3Q8RB 2B51A 3M8SA 1LK5A 2XLKA 1TTHB 2C3PA 3MM7A 4ZPVR 3MM9B 5KFRA 5KFMA 3K5PA 2KJWA 3J7Z5 3K5LA 4YHHF 4OJ3A 3UQSA 2HHWA 4EU0A 4XPEA 4BS2A 4C8ZA 1X4HA 3OR2A 2HS4A 5J2NA 2VA2A 2JVOA 4G1PA 1LFWA 3OR2B 1AFJA 5J2NB 5ETQA 4ETZA 1WF0A 2OTLS 3ICLA 3CCMS 3R5BA 4KGKA 4WBFA 1VOMA 4YEAA 4EEYA 1FJCA 1X4EA 4UUXA 3KKFA 4K4XA 3AQOA 5LSOA 5ETMA 2C2EA 3V5RA 4OHWA 2AYBA 4UOGA 1P6TA 2QMUB 3MR5A 5F8GA 1JLCA 1C0UA 3U1NA 3HJVA 2E44A 2UXCJ 1UPMB 4C0OC 2V8DA 1WG5A 4A8QA 4LFAF 1C1BA 2BW7A 4C8NA 1WHVA 4JI6F 3F0NA 1B0PA 4RX6A 5EUHA 4C8MA 2Q66A 4PAAA 1F5BA 5K8OA 1T02A 1FE0A 1RT1A 2UUAJ 1UW4A 1HQ2A 1RAJA 3G6ES 5EWGA 5H1SV 3V2UC 1Q0NA 3FC9A 2BUNA 2BQ3A 3PX4A 3FK4A 5L38A 2AYMA 1R8BA 2PMZD 1HNXF 1U02A 2RNEA 3VVTA 3P49B 3SQGB 2XSJB 1U09A 2L9WA 2XY7A 5LMUF 1RU1A 4EUVA 4Q0BA 1IKXB 4OLOA 4TN2A 2CXEA 2Z2LA 1KHVA 4PCQA 2R7WA 2UXDJ 2QEXS 4CO4A 2UV8G 3AXMA 2I9SA 5LM7E 3M6VA 3MGJA 3CT9A 3PRVA 4YB1P 2MQNA 3EZOA 2JX2A 2DY9A 1RT5A 1UA1A 1T11A 3MFHA 2GQQA 1S7HA 5F8MA 3HVWA 4QYRA 3BGLA 4KQZA 1HA1A 3M4XA 1KOOA 3HHKA 1DHMA 4C7QA 3EXYA 4ZCIA 2EFVA 2YWEA 4RUAA 3DI6A 4X4QA 4NLTA 2NXJA 1LKZA 3DI6B 1GMWD 3LAKA 1K73T 2F65A 2RJZA 4URQU 3ISNC 4UOHA 3M6WA 1CJKB 2CQ1A 2ZC3A 4IUFA 2K7JA 2YH1A 5ETTA 3HT0A 3DRXA 3P5BP 3PX0A 1QE1A 3MTJA 5I3QA 4KHPF 3Q23A 5KG3A 2MZJA 2DR8A 2RMLA 2DRBA 3MECA 4XK8C 1OY9A 3LWLA 1LWCA 1NSQA 4M5HA 3CC7S 2QE5A 5ADZA 2FVQA 1QDUB 3CPWR 1YJVA 4RU2A 1SXLA 1YK9A 5DG8A 1U6BA 4YS2A 2ZZTA 1Y4ZB 5C2CA 4FNIA 5I3UA 1WC4A 4KGVB 2R3VA 2DNHA 4RPFA 3G4SS 2VJUA 5I3UB 4MYUA 5IWAF 4CRJA 2J8AA 4DMZA 1A7GE 3DDNA 3UDLA 2ACYA 4DPTA 4LF7F 1S72S 1Q4RA 1NJXA 4AT1B 1S4EA 2XWYA 2FZGB 1UMJA 1NK0A 1D3WA 2Q43A 2RAQA 5D4LA 1SUQA 1M1KT 1SUQB 2RF2B 4H54A 3UDEA 1HWJA 1RCOB 3V6HA 4PWDA 4LF4J 2GAGC 4YR0A 1NSPA 1DY3A 5CABA 1Q16B 1WKKA 1KEKA 4DV0J 1X7VA 3A8EA 2VODA 5HK4A 1KS2A 4Z37A 1S97A 2BW2A 2JZ5A 2W4DA 5L9NA 5L9XA 1M0SA 4JV5J 3H8YA 1M5KC 2VFUA 3EYZA 2RS8A 3I96A 4BHQA 1BGXT 4M5LA 2MZTA 2ZE2B 1PBAA 3K7RA 4OZ3A 5M2RA 3TZXA 2GJFA 2E5HA 1E6YA 1OYDA 3DOKB 3HSGA 4QWAA 2PE8A 3VF0B 2BOAA 3V6JA 1SV5B 1EQ0A 2UP1A 3HD1A 1XNRF 5KFCA 3PXGa 3VR1A 5IQQA 1TAQA 1QTNB 3M2UA 4WE1B 2Q3PA 1DTTA 2APOA 4NZ6A 3CDAA 4FKYA 3M2UB 4OJGA 3W8GA 4NLDA 1DTTB 4Y2IA 2HGMA 1UJ5A 1GH8A 4FDFA 3EVMA 2RQMA 2GGPA 2J0SD 2XMUA 1VQ6S 2R7TA 4LUBA 3E51A 1RAIB 2DHAA 2JLGA 3TX8A 4RUBA 1U2FA 1B70B 4ELTA 4DX8H 1HHTP 2U1AA 4DUTA 3BGOP 2A2DA 1WEYA 1D09B 2A3JA 4WK3A 3CNQP 2XULA 5LOQA 3QZ8A 2QMWA 2B4OA 2D41A 3AB4B 1IKVA 2DEIA 1XIQA 1IKVB 2WB4A 1D9FA 3WBZA 1ZM9A 1X8DA 3FNNA 2J6UA 1Q5YA 3W9HA 3HLUA 2IA6A 3EGNA 2G4BA 5IS2A 1K0VA 2NUHA 1NLKL 5KFXA 3W5YA 2OPRA 2BZ2A 5AE1A 4Q7AA 1HI8A 4FBUA 3QAUA 2BJ1A 1QAJA 3GYNA 4W90B 4LIWA 1RHUB 1RBLA 1S12A 5DJBA 1Z2LA 2HNZA 2YKPA 3NOGA 1YBUA 1SJ1A 2KYXA 2JFKA 3QSYB 4C9DA 3FEXB 1Y5IB 3T41A 3J81U 1BD6A 2VJVA 3WZ0A 1KTQA 2I8EA 2GIRA 1B64A 1AA1B 2JL9A 3QT5A 5J2MA 3OLBA 5JMNA 4A48A 2CWKA 1Y10A 3SSQA 3CJ2A 1KC8T 1TL7A 2R8GA 3GG1A 4U7CA 2CQDA 1FWLA 2CKWA 3UR3C 2YWHA 2DNKA 2ZBQA 4ETXA 2OD6A 1NH8A 3VQTA 4L6V3 4MK7A 4O3SA 2CPDA 1I51B 3EGZA 1X4DA 2C2MB 3IRXA 4HACA 3I82A 4IOBA 3LP1A 3LW5C 3QMQA 3LP1B 4U95A 3EICA 3BQ0A 2I5JB 2BR0A 2ZKUA 3GSDA 3K17A 4JI5J 2DGUA 3JTOA 3E01A 3CO0P 3KLGB 4DV7F 4EYHB 3Q8UA 4TNOA 1JQGA 1OJ4A 3C15A 4MT1A 4IO1A 2R42A 2P9GA 3C15B 4Y0FA 1TAUA 1BWEA 1FKAF 4NXMJ 1S1UA 4QYZK 3MEDB 3HO1A 2VZ9A 4LMZA 2EVZA 3QRQA 4W4MA 1O5JA 1NHKL 2J9CA 4ECVA 4GKKJ 1UL3A 2EEYA 3AT1B 5KT5A 4PABA 2DISA 2HBZB 1BQMA 3B6BA 3MMAB 3PCOB 3NGUA 2Q6BA 4K4TA 3WQPA 4I2QB 4TY8B 4URGA 4K4YA 3TJAA 2BKOA 4FBTA 3CJRA 4OI4A 1GMUA 2JRSA 2M5YA 2HZVA 3GJTB 4DL5A 1NUEA 2CPHA 1IUJA 1EETB 1TL3B 2W01A 3VAMA 4NCGA 4A8MP 2LDIA 2HLTA 4ITSA 2XGPA 1OO0B 3R8YA 3EXCX 3QPIA 2DHXA 4NOHA 4KGZB 4L76A 1UJ6A 3QYYA 2RRBA 4B3MJ 3H20A 4RW7A 4MAKA 1DURA 1HWKA 4PR6A 4RW7B 3HCXA 2VFSA 1P9YA 1IJFB 2OHDA 4AL6A 3KTQA 1X4AA 3KG4A 1R3NA 2VG5B 1JLGA 2DR6A 2PFDA 1JLGB 3CVKA 3D67A 2KHDA 4WIIA 2RU9A 1FDNA 4OZNA 3DHXA 2F4VF 2P9CA 3O44A 2XMVA 5F8NA 1W25A 4HI1A 4LVNP 3IP0A 2BXJA 2D3UA 3CCTA 4O44A 3AY0A 2C3OA 5DDOC 1CVJA 4OLPA 2KHCA 2LQBA 2VIHA 2K3KA 2R8HA 4DSJA 4H4MB 1R8PA 2X1GA 4F2SA 4LBIA 4ZVOB 1G2EA 2VL1A 1RXOB 4ZPTR 4TQSA 3NMAA 1WC5A 4OHZA 1VQYA 3HM9A 3GV8B 1C4AA 2R2UA 1ZOTA 3DGPA 1QSYA 2P8IA 2HWHA 3DGPB 4K5RA 3BQ1A 3JXOA 4ZLLA 4KTQA 4DPOA 4LF8F 2XMMA 1SQEA 3ZZ0A 2VPXB 3M7VA 1DTQB 2D9PA 2OO4A 3NGKA 2CJKA 3PJWA 1VK3A 2FVRA 4KKOB 1IR1A 3L9ZA 1Y11A 5KFAA 4B3TJ 4QR1A 2VQFF 1VMBA 4CO1A 3KYLA 4B02A 3FVYA 2HFSA 2AF6A 4X4SA 4ED0A 3DCAA 1RBOB 4FF3A 5F3TA 4EBCA 3SV3A 3M9MB 1JX4A 4JI0J 2N4CA 1VC0A 3P3DA 2H48B 3K57A 2YKMB 4M5DB 5ETOA 2C3UA 3FEZA 1XBWA 2MJNA 5HROB 1KVIA 4LJMA 1BLUA 3W1YC 2ABYA 3M05A 5C2GA 3H90A 2DGWA 5A8KA 1MNEA 1RJJA 2KRBA 4BC9A 4PG6A 5A8KB 2OTJS 3ZZTA 3UW1A 3V4IA 4PQUA 1PJ6A 1RTIA 2XCPA 1H73A 1WJ9A 3JAMY 1YJUA 3CD0A 2W2QP 1V3SA 2ZNYA 2BVZA 1KSPA 2MKIA 3GIJA 3K58A 2AHOB 3ETOA 4JV1A 4LF9F 5C42A 2PT0A 4ECQA 4PEOA 3L7PA 3FSXA 2ZH4A 3NWRA 3US5A 3MEKA 3W5XA 1RWOB 3PHTA 1F9HA 3B4MA 2F9JA 2NXCA 3ENAA 3TZYA 1RTHB 2HRYA 4BLGA 4H4KC 1RWXB 3CB4A 3VGVA 4K5SA 4ER8A 4IFVB 2RB7A 3TZZA 3R9LA 4QWCA 1SB6A 1KKHA 4WFAQ 3KLVA 3O3LA 1RAGB 3KUGA 2FUG9 2CG4A 4M1KA 1CULB 2WONA 3PRDA 5HMWA 2G2OA 4DR2J 1RWKB 3KLEA 3PW0A 1S48A 2V67A 3KLEB 2ASDA 3LPEA 2NS1B 3L7UA 4B3RF 5HO4A 4JI7J 1RHMB 4OI2A 4M95A 3IGNA 2IAJB 2W9CB 2NREA 2ASLA 4O3PA 3D66A 3BJYA 4QW9A 4OYPA 3OJUA 3N01A 3A1YG 2YKNB 1QLNA 2WOMA 2DTJA 2ZH2A 1E6VA 2H54B 3MMCA 4EMDA 3PDNA 3MMCB 3S1TA 3QFHA 1NM2A 1U6ZA 2A6MA 2FZCB 4IQXA 3BO4A 2GFFA 3J80Y 3OVAA 4RW6A 1ROFA 2GVZA 4YDDB 3DC2A 5JVHQ 3DDKA 2MZSA 4ZVPB 4O3OA 1TKTA 1M1HA 5GAHU 5FD1A 1AFIA 4E0DA 3HP6A 1RHRB 1QM9A 4L3NA 2R9LA 3BF4A 3IWXA 3ZC4A 2F9DA 2FGCA 3UVJB 5D77A 4DV2F 1SH3A 1MN7A 4ZVHA 1HNZF 4F2RA 2XNRA 3BYRA 4QR2A 4Q44A 2P5VA 1N34F 1RKJA 4DR5F 1FKOA 5DZ6A 5T14A 2OMOA 2YNIB 4PQAA 4DL4A 2M2BA 3I4PA 1ELOA 5CYJA 2LEBA 2XEXA 4ID5B 1VQMS 1SH2A 3OXLA 2LECA 3I9ZA 3FDSA 4DV3F 2V4JA 2G13A 4HT7A 3K8VA 3CCJS 1FTCA 1F2GA 3MM8B 4DN0A 3OSPA 3UR0A 4LQ9A 4A8SA 1Q86T 2AV5A 3KK2A 1MMNA 1QTMA 2XYHB 2XQCA 2AZ1A 3KK2B 2AMCB 1NDKA 1JLBB 4ECSA 3SQOP 2HBYB 2OPSA 2XZTB 2YNHA 3LGNA 5K8MA 5EDWA 3X1LB 3ZTPA 2YNHB 3I0RA 5EN1A 4OX9F 3W8PA 3NCPA 4LRAA 3I0RB 3MM5B 2C22A 1N0UA 4B9SA 3E2EA 1WHWA 4CO5A 3MUVP 4PUOA 1LW0A 1V5IB 2KXNB 1WC1A 3HD2A 1D1UA 4V1Ak 3H2VE 3HVTA 2V0NA 3DMJA 4MIAA 3WDOA 1VQOS 4E2FB 3T5KA 1VQNS 4DR1F 1WC3A 3DXBA 4DFMA 1HWLA 2X1BA 5DS7A 9ATCB 2MKSA 1BQNB 4WU3A 5KFVA 2LLZA 2FVPA 3QGGA 3EPGA 3M8PA 1TK5A 4ZHRA 2A1BA 1MU2A 2IC3A 2ZNZA 3M8PB 4ZHRB 4B3OB 3V81A 2GA7A 4P9SA 3O2IA 5KAKA 2V8HA 2R7SA 1FFSB 4DUYF 4YOEA 5AE2A 3NRBA 1NK7A 3NGRA 3SFGA 1OPZA 5CA5A 3K5MA 5KFOA 3JS9A 4I4BA 2ZWOA 2W2OP 4IRDA 1LXJA 4IR9A 2UZAA 1LWEB 4Q8FA 4GO5X 1RAHB 2WW8A 1N5QA 2HHSA 3CJ0A 5C7PA 4MFBA 2IJRA 5IFMA 2DNYA 4USHA 2ADCA 1S1TA 3FSYA 3DFEA 2VICA 3AJDA 4ED1A 1RHKB 2LQ9A 4P71A 4DR7F 2QZ8A 2MZQA 3KLHB 3MEGB 1RWWB 1SIWB 5AXKA 2W8KA 4A8WA 1FI4A 2X1FA 4DU7A 1VISA 3WIVA 3VAFA 4OHYA 3OFHA 4LRCA 3T1YF 1CJTA 4F0MA 2V5HG 3KNAA 5EWFA 2X3DA 3IAS9 4QW8A 4F04B 1UZDA 1XMOF 4ZVTB 1MROA 4BBYA 4J91A 2XYPB 1Q1KA 4DPYA 3HHLC 1AYEA 2RQ4A 2DR5A 3KUEA 3MCOA 1TKXB 1JK9B 1VQ9S 3R7NB 2WZ1A 3C14A 5B7WA 3MMBA 4JI1F 4DBQA 2PSZA 3BPDA 1HW8A 3GB0A 1TFWA 1N33J 4JYAF 2IM0A 1S1VB 3MPYA 4WCEQ 4JI4F 1C2PA 4ZPWR 5KG7A 2Q79A 2VFTA 3GILA 4LBPA 4FS1A 1FF2A 1I1GA 3DOLB 4ILRA 5JUMA 1TV6B 1WOPA 4AQYF 1NKEA 1TKDA 4UY8T 1TL4A 4FXDA 3O5TB 2RQCA 2V69A 1JB0C 3DM2B 2EKYA 2VC1A 1J27A 4QU7A 1Q7LB 4QCLA 4NCAA 2IFXA 1RISA 1FVQA 1U1OA 3I31A 2L08A 1HBNA 2HFNA 4XDDA 4Q8EA 4YY3J 2QIFA 7FDRA 3ZTSA 2OELA 3FUYA 2MLYA 1P1TA 4AL7A 3QZ7A 3JQKA 1HHQA 4DF4A 5EX3A 5JXSA 4LF5J 2DO4A 3H59A 2Y8YA 3I4HX 1I94J 4OL8A 1FT8A 5CCLA 4FPIA 5D0EA 4WF9Q 3IR5B 1MN9A 4QIWD 4XTTA 2DJWA 3R5AA 4B9UA 4R8UB 5HQ8A 5DDPC 5H9EK 4ZPAA 1RTDA 2BKNA 2EK1A 5BR8J 1TK0A 2Y1LB 1FD8A 1JKHA 5K20B 5FJ4A 1N6QA 4BDPA 2RD5C 2WVBA 3ZZPA 2HPUA 1N6QB 1IBCB 5L8RC 3W9IA 1WSVA 5A0YA 3Q8PB 2OFGX 3BSNA 5A0YB 2X7IA 2HHUA 2GO8A 1YJ7A 2FVCA 1TMJA 2ZEJA 2RH3A 4OV1A 1U45A 5J2QB 5DETA 1PO6A 3A3NB 5EX0A 3ZZRA 1HIYA 4J9OA 1R7IA 1U8WA 2EFGA 2XO6A 4U9RA 3B4DA 3PFOA 2C2DA 1RT4B 3K2YA 4DV5F 4Q45A 4P72A 1XJWB 2CQ4A 4GVBA 3JSRA 4DQIA 3THTA 3MEEA 2OPPA 4GVBB 5CQGA 1RHJB 4DQQA 1RTJB 3M32A 4ILMA 2E1AA 4PG4A 1FE4A 2GCFA 3OXGA 4GRSA 3C16B 3R1LA 4NCBA 2ZZMA 2M52A 3OL8A 4A8OA 5IXUA 2E1MC 3DLEA 1UA0A 1FNOA 4WWSA 2DXEA 3KG0A 2A10A 1BHNA 4LF6F 4NLWA 5CAAA 4DLGA 4NLVA 2KH9A 1XWLA 3SSRA 3RR8A 4NLOA 3OTEA 3DOMA 1WDDA 1KONA 1IKWA 4C0HA 3J7YI 3LTOA 3D6FB 2EFOA 4A8XA 2IMOA 1M5PC 1AUDA 4X64J 1ULRA 2NXEA 1NKCA 1D9DA 1JLQA 3ITHB 1JLQB 2Z58B 3C6TA 3GYGA 4UQTA 4RUHA 3D3BJ 2QSWA 2MDAA 3TEHB 5KFFA 1OWXA 3QGPA 3KDNA 1NPKA 2YWWA 2RVJA 5LSLA 4NZ7A 2W8LA 1A9NB 3NLCA 4DEZA 4YMEA 2U2FA 2CJBA 4HDGA 3ZTRA 2KTQA 3UCGA 2GJ2A 1YKWA 1HPZA 2VQEJ 1HPZB 2LQ5A 3LP2A 1OSCA 2MYFA 2I6WA 3BR9A 3RUBL 2G0IA 4J9VA 1DLOB 2CVEA 3TW0A 2YBVA 3SMZA 1T3OA 1YZ6A 1WTFA 1S10A 3IM9A 4A46A 4PXCA 1LW2A 1S77D 2QGFB 5K9FA 1PKUA 1K0TA 3CD6S 2XMAA 5J1EA 4ZJLA 3MFIA 1Z2ZA 1T03B 4X66F 2ZOMA 2F5GA 4O3RA 2GQCA 3DLHA 5I4MA 4MYTA 3HK2A 2ZVSA 4NZ0A 2DGTA 1KLMA 3TUZC 2RQKA 2MQQA 5T41A 2NXNA 2VKRA 5GVQA 4KE5A 2DNPA 2G9OA 3I87A 4IH7A 2R8KA 1PYSB 4DL6A 4LFCF 2DH8A 4ZVQB 1UVNA 2RDIA 4NASA 2SXLA 3MXHP 3W7BA 1VCTA 4DR6F 3OJSA 5C5JA 4I6YA 3CMQA 2DR7A 1F5CA 1VR6A 2B6AA 1NKBA 1FFWB 2XMJA 1HNVA 5E3RA 3MOJB 2BEFA 2MSSA 3TWZA 2ADBA 1LK7A 5EHHA 2HNYB 2UXBJ 1R31A 2EBEA 1FTRA 5HMYA 1B0TA 3FBBA 4PPZA 3NMRA 1XMQJ 4ECXA 3PV8A 1HQEA 2YVSA 1VC6A 1HL6A 3W2WB 2GVDA 1Z1ZA 4HHUA 1Y0HA 2CNKB 3BQ2A 2M88A 1C1CB 4WU2A 3EGWB 3MPWA 3PACA 3UDCA 7AT1B 5HMXA 2CPJA 1FX4A 1N32J 2ZD1B 2HW3A 4ZVFA 2G0CA 1MWYA 1NAQA 3EZUA 1KP6A 3HSJA 2OI2A 3OBIA 5BYQA 3C66A 4F4KA 2RIJA 2AX0A 1VS3A 4URSA 4OYIA 1F1BB 2EK6A 4UZCA 1NDLA 4QOTA 1F60B 3BREA 1S59A 1VLOA 1GFWB 2VUGA 4DV1J 5DGAA 1NK8A 2IPOB 3EVWA 1YJTA 1JIHA 4PPDA 1IBLJ 1CBKA 2OFHX 3UD4P 3KMQA 3FFIA 1V3ZA 4I69A 1CLFA 1QJHA 5D0GA 5KFZA 2B4UA 4V19J 3BYPA 4B9VA 4YB6A 1Q79A 4ZVSB 2V94A 2QSFA 4IH6A 1QSSA 4OX6A 3UO0A 3TVYA 2D9OA 4UUWA 1SCJB 3MR6A 1UFLA 3GV5B 4DX6A 1V6HA 4C3MA 2XYGB 4CLZA 1YQHA 3SIPB 3DRRA 3TZWA 3DRRB 3GFYA 2CUYA 1TL5A 1SQGA 1FEEA 1ZAXA 4O3QA 4S0MA 1RI7A 1WUUA 2HNDA 3D4JA 4V19X 1DAXA 1T9TA 1LWFA 4C11B 1M90T 1SL1A 4P74A 3HKZD 3VTIA 1YRXA 3H5XA 2FY1A 1RSCA 4ZP9A 4X4RA 1S7IA 4IFYB 1NDCA 3SXLA 1TELA 1JWWA 1FDBA 1QUPA 4CH7A 3GR1A 4LRFA 4ZDNA 2KFZA 3FEYB 2H1YA 1SL0A 4OZJA 3IWNC 3NAIA 3A3PB 1B3TA 2CQPA 1HD1A 4H4OA 4NEZA 4NXMF 3CCQS 3LALA 5G4DA 3VV2B 3GONA 3GJQB 3NGTA 1R0AA 2RDDA 2AEJA 1R0AB 3G6XA 2UUCJ 1CEZA 2VPWB 1YBAA 1V5VA 1TL1A 5B0DA 3QWPA 1Q7YT 1FK9A 3KLFB 3TUIC 2B8PA 1LFPA 2JOQA 2CADA 3OVSA 2XS7A 4TYBA 3C8YA 1WKLA 3I55S 1NO8A 1FRIA 4WPAA 3H98A 3QWUA 2FDNA 1JJCB 5B0FA 3KJVB 1RT7B 3SDEB 3GLJA 2R7XA 4LFBF 4O0NA 1MSWD 4JUZA 4GC7A 1OQ6A 4ZVGA 4EBDA 4ZCKA 2JEIA 2YY3A 4ECTA 2M70A 4TXSA 1SJ4P 5CHCB 1U1PA 4LR8A 1XTZA 4R5PB 3N6MA 3CDBA 1S1XB 4FPRA 3PW4A 2BE9B 3J7A1 2M8DB 2BV3A 2BX6A 2BMBA 3J7YU 2CDRB 2ZKTA 4YHHJ 3IFEA 5KT6A 2AJ1A 2KKHA 2AWZA 2AJQA 1S9GA 1RWUA 4ZVUB 3QFWA 2Z2YB 2J9DA 1HBUA 3SBMA 3TNVA 2DPIA 1X9MA 1S57A 1KBRA 4OX8A 3OL7A 4NLYA 4CLUA 5C25A 2IBOA 2HG4A 4OHXA 5A76A 2QLBB 2LDYA 2VG7A 1ZAVA 3TARA 4DZ6A 4WP3A 3MCMA 1DBDA 2HFVA 2DY1A 4YR2A 3UCUP 1W2IA 1K8AT 4Y2CA 3LP0A 1IBMF 1LQ9A 4X65F 2HBQB 4LFAJ 4ZLNA 2I1RA 4JI6J 1CPZA 3H7HB 4RBTA 3D1QA 3JTNA 4HHHA 2E7XA 2DRAA 4AXJA 2BJ9A 1XR7A 1S79A 2BJ3A 2IYIA 4OIXA 1T94A 1GXLA 5THWA 2E29A 3SCJE 1VRUA 4QYZJ 1S6QA 1X5SA 3M2RB 1I3OB 1HNXJ 3D0GE 3IBWA 4M8LA 1OQ3A 5LMUJ 4YP3A 1WELA 2FHJA 4X4PA 3IS9A 1WF2A 3Q8YA 1VC5A 2MLXA 2F4FA 4JI3F 4DPUA 1YTYA 5E3CA 3CCZA 2L9DA 5KFQA 2Q6CA 4RU9A 1AZSB 3H4BA 3M6UA 4DLEA 1WDTA 2JHEA 4GC6A 4N77A 4WXOA 3IG1A 1N5YB 3IG1B 8RUCA 2P9EA 3CC2S 3RBZA 3L7OA 1OPIA 2E1CA 5LJ5Y 4C8YA 5IV4A 4ANDA 1HI0P 1XN9A 1ZTWA 4ZJQA 5IC6B 3D68A 4FVCA 1OY8A 2QFJA 5KG5A 1RAFB 4KFBB 3PW2A 2C2OB 5GMEA 1U48A 1N5TA 2WB1D 1HQUA 1JLAA 1KFSA 4J9LA 3DRSA 1HQUB 2OEMA 3DRSB 2KVQE 3B82A 3GIKA 1U47A 2BE2A 1UPPA 1TUWA 3KJNB 4MKAA 4KHPJ 2BE2B 1XMBA 1MWZA 3PKMA 5A8WA 4TVAB 3OV7A 2WVDA 3VAJA 3K5OA 4J9QA 2J7UA 2IDEA 5HP1B 2B5JA 4F4ZA 4ZIVA 4FF2A 4P2SA 4C8KA 2DIUA 5G0RB 1SJFA 1KQKA 2FPHX 1OSDA 4N8NA 2CQHA 3CWJA 2JEJA 5HBMA 4O0IA 3I5AA 3NS7B 3DLGA 1R8HA 4I67A 2XI2A 3CC4S 3PNIA 3DLGB 3PO4A 1NBEB 2DGVA 4USIA 3PW7A 1GQEA 1N0VC 3VQSA 3DN9A 2HBRB 3TAMB 2HHQA 1FRMA 4LF7J 2WCXA 1MMLA 4A47A 3QLHA 1QAIA 5FLXY 3GFXA 2HQIA 3L3CA 1S6UA 3W65A 3GV7B 1R0CB 4LRBA 5KT3A 3N5FA 4QIGA 3B8HA 4RW9A 1R43A 5LXRA 5KFNA 5L39A 3DRPA 3ET6A 4MIWA 3TUPA 2WTFA 4LF1A 3DRPB 3ET6B 1RAAB 5IM0A 1F5AA 4A4JA 5IM0B 3PG9A 4DDFA 3V6KA 4KO0A 3T1HF 1U26A 3PZPA 2JFDA 1CS4A 2K1RA 2K1RB 5A2QU 1RT3B 3W62A 1X4CA 2HAIA 4O3NA 4C4WA 3CCUS 1TP7A 4I2PA 3EZ5A 1HYSA 2DHHA 4EWTA 1X9WA 4M63A 2GV1A 3AOCA 3ISND 1NPPA 1AT1B 3CJ3A 3BN4A 4J9UE 1H7WA 1ZETA 3S6EA 2C2KB 2FHJD 3OTOF 1HNWF 4BWMA 4K4ZA 1SPBP 2KXFA 3LQVA 4WFZA 4D3HA 1GTEA 1KVJA 2OUGA 3OXFA 1KLNA 3KWMA 1FWKA 1XNRJ 2GQ2A 4Y65A 3AA8A 2ZJRQ 1IKYB 1QVGR 1N88A 2OSRA 1PILA 5IT9U 1S6PB 3D2WA 4HT5A 3HPOA 3TVZA 3K0JA 1IN0A 2DVIA 1HBOB 3QQCD 3S8SA 3MM7B 2GNKA 2VPYB 2D3O1 1KQSR 4RJVA 3TANA 2FJAB 4DSFA 1FXLA 1M5HA 4DJBA 3HVRA 4FXVA 5HJXA 1HBMA 2YWGA 3BS9A 4OJ1A 1BQXA 2VONA 2W7OA 1X9SA 4F25A 1IQZA 1SC1B 3MD1A 1VBZA 1S4FA 3IM8A 2W4PA 3AQPA 5HVFA 3VAHA 2BJ8A 3QIDA 5FIIA 2X1AA 2HS3A 4QPXA 4FYVB 3VAIA 1PGZA 3M1VA 3TP2A 1XNQJ 3M1VB 2J0WA 2VFVA 1NK5A 1KQGB 4WYLA 4NA3A 3M9NB 1JLCB 1C0UB 2B9YA 4CLSA 1PC5A 1Y00A 2C42A 3FQLA 4U7UD 2J76E 2W9AA 1C1BB 1TVRA 2HAFA 1XC9A 4WTYA 1O0PA 4USKA 3R5DA 1NMEB 2XZWA 3PYFA 1RT1B 2CAJA 3M8ZA 1CJUA 1CJUB 2V2VA 4U7UK 5AJ3F 3K89A 1B7YB 3CCRS 2CPXA 3PVXA 5HLFA 1C0TA 3UNGC 5HLFB 3VGTA 1TMMA 3OHAA 2EPIA 1RCXB 1N36F 4Q0BB 4J9PA 2QC3A 2ZH3A 3W2VA 2BQRA 1JLEA 3W2VB 1YRUA 5GAEU 2C3MA 1FRKA 1JLEB 4IO9Q 4ZN3A 2QMXA 3BPSP 2WRMA 3GSIA 4ZN1A 2VH7A 2H5IB 2HVDA 1ZM4A 4DX7A 2RHSB 4OI6A 2MZRA 2ZBIA 2R8JA 2DNOA 4NMLA 1R6VA 3G82A 3QO9A 3ONQA 1YHQS 1Q8LA 2JWNA 1RT5B 3GIRA 4QIFA 1RLCL 4LF2A 3ELHA 4CNYA 2MB0B 2ZJQQ 4FF1A 2WW4A 4DV7J 5CYMA 1GTHA 2F1FA 3OTBA 2HGLA 2Y0BB 2CFXA 5CYMB 4LSLA 2WVCA 3NNAA 4G1QA 4CP5A 4G1QB 5C24A 4EFAC 2W4CA 3CO9A 1GAOA 4KH0B 5C24B 1B0VA 4OZLA 2QYCA 5KTQA 4MK8A 4IDKA 5F0WA 1HMVA 5BYRA 1HMVB 2NUUG 2XG8A 5LSRA 3WC2A 2CNNB 1NJIT 1OS5A 2ROEA 1QE1B 3TR5A 1TK8A 5HATA 5KG4A 2L9NA 3GIIA 2ZBPA 3MECB 3MUTP 2KO1A 4FS2A 1LWCB 5HSPA 2FQQB 1F9EB 3KK3A 2E5IA 4ANEA 4NLPA 4OI1A 4NXNF 3I0SA 1Z4UA 1S9EA 3W63A 5KFKA 2E7WA 1EB0A 3IN5A 3QT6A 2Z56B 3M2VA 3CD7A 4EO6A 2ZWPA 2UU9F 4DOZA 5K8NA 4CLWA 4P7VA 1N33F 1T9YA 1GX6A 3T9ZA 4KPCA 2BJEA 2RDJA 4J5OA 2V8VA 2R2SA 2DYAA 1FD2A 4WFYA 2QA2A 1WC0A 5AXNA 1AUSL 1U1QA 4DXLA 1K9MT 4PWDB 1PAUB 3EDRB 3UDVA 4B9LA 4K0KF 1HW9A 3VHQA 2MQ8A 4ED7A 5L1JA 4ED3A 2ZH9A 2IVYA 2Z2ZA 4CT9A 3QJLA 2M7SA 5D0RA 2LU2A 2FIUA 1N56A 4TKTA 2YKAA 2F4VJ 1Y9OA 1DFDA 1VI7A 3RRHA 2FHMA 3D6HB 5FDLA 3ENVA 3NOCA 5FDLB 1IVZA 5DQIA 1C4CA 5E2QA 2AKWB 2LKZA 3H2LA 8AT1B 1QY7A 4ZCMA 1E6YB 5CYQA 2N7YA 3ZO7A 1L3TA 2E66A 1ZS6A 2V68A 4KY3A 5EWEA 2XSFA 1YRTA 2A18A 4OYXA 2AQ4A 1CJVA 2PA8D 4LSZB 2ILYA 4CWBA 4DR4F 1CJVB 3L09A 1R27B 4FVMA 1LNQA 3TA0A 3QIPA 2FHKA 4KRWA 4OYZA 3TO8A 2GGPB 3CE8A 1R6YA 1TU0B 2N3OA 3THVA 4M5JA 2W9BA 4W92B 3TJ9A 4LF8J 2R8IA 1FKPA 4Q43A 1FKPB 4P73A 1T9XA 5E3PA 4USMA 2OSQA 4ZOSA 5GMKa 1FXDA 2MKHA 1JJ2R 2DXDA 1FDAA 4X2BA 1U2CA 4OYWA 2YNGA 1WD6A 3ILOA 2YNGB 2VQFJ 3CJQA 3S7RA 4ZITA 1KR4A 1U1LA 3OSNA 3DHWC 2XC9A 3H42A 2MQMA 1UW9A 3IMQJ 3UFCX 4PWWA 2FY8A 3BGUA 2AJ0A 4H4KA 3P6YC 4L75A 4C48A 4ZIWA 3RJMB 2OPRB 1I5OB 3GZ7A 2MXYA 4DV4J 1Q82T 4RW8A 4MKBA 2HNZB 1Q81T 1RWNB 2ZH1A 3D28A 4RL1A 2VASA 4JP8A 4N5SA 2V8PA 2OJ3A 4I56A 4PWUA 1MMDA 4JI2F 1BXNA 3J81j 1XQIA 1SI9A 2C2ZB 5IT4A 4YR3A 2FLOA 5E7OB 3VZHA 1L3VA 3SI8A 1RB0A 2B3TB 2FHOB 2EC2A 4FYDA 5B0CA 4PXBA 1OIAA 3UPFA 4F67A 4LF9J 2E7VA 4G3IA 5J2MB 2HFOA 1UWBA 2AGPA 2O66A 3Q2SC 4OZ2A 4HVZA 2D7SA 1TL7B 1O8BA 1S0OA 2VPZB 3M8WA 4J9KA 2JC1A 3MAAA 3SSSA 2C28A 3MAAB 1NH7A 2O5DA 4RNFA 5H9EJ 2DEJA 3FZ2A 2AGQA 4B9MA 2ALYB 2VOOA 1JXVA 3NG8A 4C6AA 2JJ4D 3D6TB 4OZ0A 4DUZF 5GAHI 1JNRB 5GADU 2A0FB 3G86A 4OYOA 2AX1A 2BABA 1KRPA 2NZ4A 2MY7A 4BWJA 5KFIA 1VQKS 4CZCA 2UVWA 3IRXB 4HACB 4X4VA 3NL0A 1UEUA 4B3RJ 3BB5A 2FJWA 4OHVA 3BKTA 5HMZA 1F0XA 3E01B 4KPYA 2Z0GA 2MEWA 1SC6A 1EIYB 1RLDA 2PMWA 3F56A 4CYUA 5RUBA 4WFXA 5LMNJ 1R0BG 3LAMA 2WSCC 4U6PA 5DG9A 2IVFB 4NLXA 2FJBB 1PG5B 1S1UB 2KRRA 5D4PA 1OY6A 3LOUA 2VG6A 3HVAA 3SEOA 1BQMB 3N0VA 1H98A 4RW4A 4G6VB 2ZC4A 5AXLA 1NXIA 3QT8A 1F6TA 3T6BA 5D3GA 1M5OC 3T1AA 1HR0F 2B56A 5LL6d 4CIOA 4CCHA 3PR5B 2W7PA 4ZS6A 1RWVB 3THPA 4DV2J 4K2XA 4X62F 4LT6A 1HNZJ 3NS6A 1NJWA 4NYOA 4CLLA 1PAEX 3MPUB 1KFDA 1XEZA 2IRUA 1VQ7S 1N34J 1RT2A 4DR5J 4RUCA 4NCGB 2AT1B 4PG5A 4FN5A 5L1KA 3RAMA 2WBMA 3AA9A 2CVIA 4YUDA 2BOPA 3NKYA 2HMIA 1N5VA 2CRLA 4NA2A 3ZTOA 3CCSS 2FVSA 3CSKA 3G2XA 1NZAA 4KV8A 2LQ8A 4KV8B 2AZ3A 3OL9A 1O6XA 4DV3J 1UP1A 2E5LF 4TLRA 1URRA 1T9UA 4K4SA 3OFGA 3MR7A 2JDJA 4HH1A 2CQ2A 2CQBA 2VOPA 1IBKF 1S0MA 2CJAA 4EGLA 1CG2A 3MOZA 3RRKA 3VGUA 1RP5A 3PW5A 1SKWA 4P2FA 4DSLA 1YJRA 1FEHA 1V3RA 4IOAQ 4O44B 3TJ8A 3KK1A 3R5JB 2LQJA 2CJXB 2V9KA 4QIVA 4OX9J 2ERRA 4DV6F 3OW2R 3RAQA 1SH0A 2ZM6F 4A8FA 2ZBCA 1PJ7A 4LSNA 4RWXA 4OYBA 3A8IA 4LSNB 5KFYA 1TR0A 3IC1A 5T7LA 3PYDA 4B08A 4QU6A 4DR1J 5KG6A 2F3JA 1U1RA 2VBYA 3NNHA 2RSQA 1ZZFA 3CCES 2UUWA 5GMDA 5HANA 4KHMA 2CZVC 3DLJA 3LWMA 3AOBA 4HEA9 4OJHA 1QAXA 4B3SF 2B43A 3UWTA 2H3EB 3EWGA 2D74B 2RRAA 2UUBF 1T8EA 2DGXA 2FC8A 3GCXP 3ILJA 3KHLA 3RB3A 3GTYX 2G2YA 1ITPA 4L72B 3QAEA 5E41A 2R7QA 3IR6B 4DUYJ 3CDWA 1SC3B 3CIZA 1FERA 1Q8BA 3M30A 4KH1B 4P2XA 2HVZA 3M30B 4TLQA 3HHLA 1IXKA 1UKUA 2HSEB 1J5OA 1RUSA 3C2PA 3FBFA 2UVVA 2MHEA 5LXYA 2NSCA 4HTIA 3G9CA 2O3DA 3W3SA 4HR2A 1L3UA 1DJ0A 2V34A 4HTJA 2OPQA 1ZM2A 4HH0A 3CMAS 5KFHA 4CTAA 2J9EA 1RE1B 2PIIA 3H5SA 1L3SA 2FYXA 5M2PA 5CD4H 4DR7J 5B0AA 3G8SA 4KGMA 3V4IB 4PQUB 1RTIB 3M8YA 1U0HA 4LQ3A 3TAQA 4AXIA 2JH3A 4ZLPA 1EHWA 3I9V9 1T95A 3JAMU 2D69A 3IR7B 2EXUA 5AT1B 2CYYA 1YJNS 2HHHF 3TX0A 4EO8A 4WZMA 2CJ9A 2KN4A 4WKYA 3KG1A 3T1YJ 1CQMA 5C42B 5EGYA 1W2BR 4USJC 2AYEA 1VJQA 4Z7CA 4P6QA 5J1PA 1AB8A 1XMOJ 3D9BA 1JJHA 3HULA 1LEOA 5ITHA 4DR3J 1Q95G 2WHOA 1FNMA 4IG3A 4N7TA 2VHGA 1RAOA 3VZIA 2CPYA 2Z2MA 4P2MA 1WSRA 4JI1J 2EC0A 3UN5A 3CCLS 4M5IA 3EDQB 1F3FA 2MQLA 2HKEA 4JI4J 4NX9A 1TKZA 5F9LA 4UY85 2J5AA 3POTA 4U8VA 1TKZB 1O51A 3MM9A 3MWBA 3POTB 4AQYJ 2CZ9A 1GX5A 2NSBA 2WONB 2RHQB 4ES1A 1D8YA 3R6GB 1Y3JA 4QZVB 1H2VZ 1VQ5S 3Q8VA 4NLQA 2LEAA 4WP8A 4O23A 3NAHA 1Y5LB 3F41A 2XHCA 2IM1A 2GX8A 5KFDA 1HWUA 1F9FA 4J37A 3LH2S 4ECZA 4BC7A 2Y1IA 4RBUA 2WOMB 4KR0B 2BBEA 3NBPA 2F8HA 1E6VB 2KB2A 3IXQA 3NBPB 3NWGA 2QLJB 2R7UA 1S0NA 4GKJF 1S5ZA 3V4MA 5B09A 3QGHA 4RW6B 2GVZB 1TUGB 1X31C 2ZOGA 3J80U 2V4QA 2PN6A 1TKTB 3ILLA 2Y9HA 3LANA 2MKYA 2HIQA 2FLNA 1R89A 5H9FK 3O8WA 3BZQA 3HHNB 1AROP 5CZXA 1CC8A 3GCWP 3HHLD 3SQGA 2XSJA 3C3LA 1IKXA 4B9NA 3L95X 1FKOB 2CQCA 1UVKA 4DV5J 3JYTA 1RADB 1RWMB 3JYTB 4JV0A 3JQMA 2LYVA 1FWPA 1V9OA 2XLJA 1XR6A 2O67A 2FD2A 3FKBA 2J6TA 3W64A 3Q2TC 2YWFA 1S6OA 1WHXA 4N56A 2V4JB 2C3YA 1DQ8A 4AL5A 2LU1A 2DNLA 4AFFA 1VFJA 2HYIB 1P27B 4LF6J 4WP9A 2ZUAA 3CEDA 3TQEA 2AEFA 4DCPB 1IM6A 2VBZA 3RB4A 4JI8F 5ETPA 2HVHA 2YTCA 1FA0A 2KYZA 3RW7A 1CJKA 2OPSB 2POKA 3WIUA 4IRKA 1KDNA 3HMJG 3NXZA 1SC4B 2R4FA 3VAKA 4NLUA 4PUOB 3CJ5A 3VALA 1ZH5A 2OP5A 1LW0B 4ZA1A 4CT8A 4MKYA 2R7OA 1MG7A 3PIPQ 1X5TA 5DO2A 3HVTB 1APSA 4KJIA 3DMJB 1U6FA 4DU8A 4MMOA 1Q78A 1ZA1B 5KFUA 2IYGA 5KFWA 3P5TL 3DRYA 3TEGA 3BH6B 3BM7A 2ZHAA 2IC3B 1MU2B 4ZVEA 1NZ8A 2QN6B 4XPCA 1YDLA 2D1CA 3OFFA 3V81B 2GIQA 1W26A 4DFJA 2COLA 1FDDA 2QA1A 2XTJP 3Q86A 2IVMA 2E9ZA 3CULA 3FRYA 5E33A 2NXUA 2RF2A 3B54A 1NHUA 1HLWA 1VDHA 2B0GA 2ZHOA 4DQPA 1QD1A 2JLFA 5KG2A 3T6JA 4X66J 4MFBB 3AXKA 3BH7B 2OMLA 1S1TB 1WOOA 3MCNA 4ELUA 3O1LA 2CPZA 3BSAA 5LJ3Y 4PXEA 3W61A 4ZP8A 2G0JA 3V6DA 3QRRA 2PO4A 2ZH8A 3V6DB 2QT7A 2JEGA 1U1MA 2ZE2A 3RBDA 4OZ5A 3DGVA 1X0FA 4N47A 4PG7A 3EX7B 2ACMA 3AH6A 4LFCJ 1WC6A 3DOKA 5LT5A 1CJTB 2IRYA 2UV8A 3RBXA 5HQMA 1SV5A 2L48A 5MAOA 3ETMA 1MROB 4Y34A 4DR6J 1A6LA 4WE1A 1SKUB 3W60A 4RNOA 3T5HA 1AXQA 1J5EF 2LMIA 3TVKA 2GW8A 1VGYA 9RUBA 4NLSA 3ZNJ1 3C14B 3ADAC 4CLFA 3MMBB 2J9DE 2OIHA 1KNZA 2BQUA 1RACB 1FJGF 2CPIA 3K59A 3VVUA 2J7KA 3ZZOA 4TU9A 1SL2A 3DXSX 4IR1A 1H38A 2DNQA 3GFHA 3FRZA 3SCLE 1PYTA 2V8GA 2B9XA 3G8QA 4RR5A 1RHQB 2F8MA 5KFJA 5AXMA 3HZEA 2R7VA 1BY9A 2EWHA 2HQFA 5GAGI 2QYGA 4C3KA 3J7ZT 3EMTA 2ROGA 4K4WA 4PRFA 4QBUA 3R2DJ 6FDRA 1PIEA 2RT3A 1HBNB 4ZJOA 1LOUA 4KIAA 5CCMA 2MZ1A 3EVOA 5DQHA 3E8OA 3X3UA 4P10A 4FYYB 4U96A 4USTA 2YKQA 4ED6A 1XNQF 2PFFB 2W1BA 1VYAA 2DNZA 4I0WA 2UXCF 4I7FA 2MKJA 3RB6A 3TRGA 3J81Y 4I7FB 3PJXA 1RTDB 1HNIA 1VBYA 5ETSA 1HNIB 2DH7A 1JKHB 3VGSA 1DZ5A 2VB6A 3CIMA 2WVFA 5E0OA 4CM0A 2UUAF 1NCLA 1ZA2B 4L73A 4ZMMA 1M5SA 4QWEA 2IM2A 1VBKA 4IH5A 4B9TA 4X4NA 3IA0A 4WFBQ 2ZDOA 1UAWA 5D4OA 2CQ0A 4F3QA 3TUJC 1L5UA 2YKOA 4LBHA 4DN9A 4ATNA 3WX4A 3ZTQA 2UXDF 3GU0A 3U7JA 2QA4G 4Y3CA 3MEEB 2OPPB 1PYOB 1UEVA 3MTKA 4FF4A 2BRKA 3M32B 4ZPCA 2V63A 2E1PA 3N4WA 3KMSA 2J7WA 3RTVA 4DS5A 2ZH7A 4YQWA 3OTCA 4KHRA 1RYSA 2I5JA 3DLEB 2RU3A 3MPVA 2GJIA 2EG1A 2AW0A 3KLGA 1ZPWX 3R7BB 2MQOA 2KXHA 3MF5A 4Q2LA 4ECRA 3FJ2A 3D6MB 4KGXB 3DOMB 2B9WA 2DH9A 1N54B 3ZXWA 2CA9A 4EK2A 3CDEA 1EX8A 1IKWB 1Q5VA 2G1HA 2FJVA 2ZZNA 3A8KA 2XHWA 5F8IA 3MEDA 5HQLA 2VV5A 2VDIA 3D0IE 2KG1A 3DLLQ 2HQGA 3OUYA 2P6TA 3OUYB 2W2PP 2HVIA 3ISZA 1NHVA 1URNA 2HFUA 2IDLA 4NRTA 3C6TB 1WTBA 4EZ6A 3MMAA 4I6WA 1SBRA 4F0HA 2QL7B 4KBIA 4J9NA 3N6LA 4I2QA 4TY8A 4DCOB 2W2NP 4K7QA 2ASYA 3PIOQ 3H4DA 2GMLA 3CJ4A 3D5MA 4P75A 8ATCB 4J9RA 4MKVA 2ATLA 4I1TA 3EUNA 4RNMA 2Z8QA 2GHPA 2QO3A 4LFBJ 4L3KA 4IOCQ 3LGHA 3LP2B 1VBXA 1EETA 1TUVA 1TL3A 2VD3A 3BEGB 5E3QA 2WAQD 2H51B 1GK8A 1DQAA 4ED4A 2OD4A 1NJYA 2DO0A 2XCAA 2YPYA 1FNXH 4PZVA 5D0HA 2WVEA 4DG1A 4OV6A 2GO9A 3MCSA 4DG1B 1UVLA 2CDQA 2OH2A 3H5UA 4WXWA 2K8GA 1LW2B 4I64A 4NYPA 2HHTA 4LF4F 2WBRA 5F9NA 1ICEB 5J1EB 5KFBA 2I2YA 1KWMA 3M6XA 2VG5A 4DV0F 1U25A 3GYXB 3OQ2A 4ECWA 4JV5F 5DG7A 2AP6A 3FCHA 1JXLA 4F0KA 4M5KA 1KLMB 1NSAA 2ZH6A 1EP4A 3QSIA 3UI3A 3MAQA 4USVA 1VIXA 2K2PA 3JSYA 4K59A 2NPIA 1EP4B 5KOXA 2AJ4A 2M3DA 3EM1A 3RAXA 3AJ2A 4OYMA 2CPEA 3HX9A 4ELVA 2KM8B 2J0QD 4OI0A 2MTLA 3MD3A 2IMWP 1IBMJ 4X65J 2OAUA 3RW6A 2JC0A 4ES2A 3Q0AA 4H4MA 5I3PA 3D54A 3ILIA 5D4NA 2JNJA 2LA4A 5KG0A 2B8QA 4HLBA 4NWBA 2B6AB 1HNVB 2HRTA 2RE1A 3CJTA 4WKRA 3ULHA 3PRBA 4QQBA 5CXTA 2AEMA 2HLUA 1FO1A 2E1RA 1H0HB 1HQEB 2IM3A 1DTQA 2IBKA 4K4VA 1U7LA 2YXLA 2R7RA 4JI3J 3Q89A 1GT8A 4KKOA 2GVDB 1VRTA 3PYGA 4CNZA 3KNGA 5D78A 1VRTB 2DNMA 1UEKA 1RT6A 3SYZA 2MY8A 4F4AA 2FJDB 1I6JA 1RT6B 4F36A 1FJ7A 1UFKA 3R2CJ 4FNHA 1X5PA 3H25A 4NA1A 2F40A 2EFQA 3LUYA 3GE9A 2YKMA 4NPOA 4M5DA 2EBGA 1D9AA 1EJ7L 4KB7A 1RYRA 1K1SA 5HROA 4ZP6A 4OZ1A 5IC4B 1PCAA 3RG6A 3FMBA 3QRPA 4MIBA 1YJ9S 1VQSA 2K3IA 1VIOA 2NYHA 4DSEA 4DV4F 3O6QA 1BMQB 1RKIA 3G6YA 4WJBA 1B4SA 4ZVRB 2D3OR 1Y5NB 5DM7Q 3FFIB 2DRDA 1RTZA 4OI3A 3HHDA 4ZP7A 4E98A 1QSLA 5E3AA 4USUA 1NK9A 3U27A 4QWDA 5BJRA 2BRLA 1U24A 2IY5B 1VJWA 2HGNA 2KT3A 5GAGU 1H6KX 3N79A 2DK2A 4R0JA 1U1NA 4IYQA 1EQMA 2IHR1 3AD8C 4PYDA 1RTHA 4TU8A 4C97A 5F8LA 2K7KA 4GMKA 3MHYA 4IFVA 1UVJA 3CD5A 3I32A 3G87A 1WEZA 1KOHA 3BO2A 2MQPA 1UTAA 5U47A 3OTDA 4F4WA 1YBTA 2HNDB 1H74A 1CULA 4JB8B 4XIUA 2A2CA 1ZTTA 1LWFB 2BE7D 2D3ZA 5IZHA 3DU6A 4X4TA 1PBUA 4L74A 4ZK7M 2M9KA 2PGCA 1HHSA 2IAJA 5CD4A 4JI5F 2W9CA 2HHPA 1IM4A 4GVLA 3GFZA 4UW2A 3BO3A 2DGSA 3JSBA 3M9OB 3R5GA 4G65A 1PC4A 4X4UA 3T1HJ 1VLYA 3HKWA 1IWGA 3NY0A 3AODA 2B7BB 3FQKA 5M2UA 4QIEA 2YKNA 5LMNF 1D0EA 2J0XA 3AOAA 3ZZZA 4ED5A 2GMJA 1WG1A 4H4OB 1U8SA 2PDAA 2Y1JA 3T19A 2LEPA 1NK6A 1ZBTA 2DD8S 2DCLA 2BDPA 3HXMA 2RRNA 4GKKF 2DB1A 4CH0S 1FFGB 1FCAA 1N48A 1HFEL 1TL1B 3P4UB 3OTOJ 1HNWJ 1HD0A 4LIRA 3JB9k 2CQIA 2VA3A 5KG1A 2GZOA 1Y7PA 4NRUA 2UUTA 3CCVS 3KJFB 1FK9B 2IJFA 4CLPA 1R8AA 1NNDA 1HKAA 3UVJA 2QL5B 3JSMA 2XMWA 4DFKA 3A8JA 4PG8A 3JSMB 4YB7A 2QFIA 5HVHA 3OLAA 1JLFA 3L4BC 1JLFB 4DWIA 1RA6A 3S01A 1N8RT 2YNIA 3FZBA 2OGUA 2KDOA 4KSEB 1WACA 1K1QA 4F50A 1NEEA 3U1MA 4Y00A 3G71S 2CPFA 3PHEA 3TA1A 4J9MA 4B3MF 4ID5A 2HK2A 2Y0SD 3LPYA 2C1EB 2O1PA 4OMFG 1NRKA 2GIFA 3T5JA 2FLLA 1S9GB 5HI7A 1WKJA 2QX0A 2UVRA 2ZJPQ 1ZZNA 3T5LA 1HBUB 1CSJA 4CLTA 1M5VC 3MM8A 3OVBA 5GAEI 5C25B 4HHJA 2DHGA 2W2MP 3RRGA 2OKQA 2VG7B 1JLBA 4ED8A 4USWA 3BBBA 1FJEB 3LO3A 2PI5A 3LP0B 3HJFA 5D15A 2VC0A 2YQ0A 2DHSA 2LCWA 3MM5A 4RKUC 2RKIA 1Q8KA 2RKIB 5L1IA 1VRQC 4Y2AA 1U2RA 3PKYA 1H3DA 4J90A 1DQ9A 4AE5A 2XO7A 2BM0A 1X60A 3EGVA 3IGVA 4P7TA 3PEJA 2PD1A 3Q8QB 4DL2A 2KZMA 4WTOB 3OHBA 3ZZUA 1WWHA 5AJ3J 2EG2A 5A8RA 1VRUB 3C19A 1S6QB 5A8RB 1BQNA 2V50A 2C2NA 3K8WA 2VU5A 3CW2C 3WC0A 3N5BA 2AU0A 1N36J 2EI5A 3NCQA 2MJUA 3IS9B 1UFWA 1SJ3P 1TQLA 4B3OA 1S1WA 2HURA 3CTRA 2IIHA 3W5ZA 1JMTA 1S1WB 1AW0A 4B3TF 3UNYA 1HWIA 2FJXA 2QA4S 3GMGA 4DPWA 1P8GA 4CH1A 1UWAA 2LXIA 4JI0F 1WORA 3DLBA 5F8JA 4DSIA 2XZDB 1KQFB 4CDIA 2RUSA 1LWEA 1RK8A 1N52B 1LV5A 3IO1A 3D0HE 7FD1A 3ZFVA 2H9ZA 4NLRA 4FYWB 3BGRA 3N6NA 3MR2A 3A4TA 3BGRB 3KLHA 3MEGA 3TQ1A 1FRJA 2XMTA 2BANA 2N3LA 2BANB 1FRLA 2ZUGA 2JVRA 3R27A 1JLAB 2GMHA 3MI7X 1DARA 1YZ7A 2AGOA 3G6VA 5CZVA 2A6OA 5DM6Q 4DI6A 2HZCA 2UVUA 2ZDPA 4NEYA 2R2TA 1HI1A 1EKRA 1OMSA 5A8WB 4FP9A 1DRZA 4LREA 1PJ5A 3W66A 2E5JA 4ECYA 2GHWA 3KFWX 2NPFA 2YNFA 3GPAA 4ZKAA 2B5JB 1NJZA 2XI3A 4RBVA 3IBFB 2YNFB 3OL6A 4NXNJ 4CLYA 1CQNA 3BSCA 3C6UA 4DR3F 2Y8WA 1TKXA 2HEKA 1KTVA 4OQJA 4DL0C 3MAHA 3C6UB 4B17A 5HBMB 4MH8A 2V4RA 5IWAJ 5IT0A 1FRHA 2UU9J 3UD3P 1S1VA 1HARA 2HQDA 1YG0A 3FCWA 2GS8A 4F26A 1XK8A 2VBWA 1T9VA 1RDRA 3DOLA 3QLHB 1TV6A 3UCZP 5ETRA 2XS5A 4DR2F 2DPJA 4N76A 3QNWB 3BDEA 1WF1A 4RW9B 5B0EA 5FLXU 3M8QA 3DM2A 4ED2A 3M8QB 3F44A 1WNEA 4JI7F 3D1OA 5K8PA 1UCNA 1GEHA 5KT4A 2VBXA 2PA3A 5D8HB 3BKFA 2HQ3A 3Q22A 3FSIA
chains in the Genus database with same CATH topology
4DX8H 1HHTP 2U1AA 3TAQA 4YB6A 4LQ3A 4AXIA 2JH3A 4ZLPA 5F3ZA 3GIMA 1Q79A 2KJVA 4KO0B 3I9V9 2JLEA 4ERDA 2A2DA 1WEYA 2V94A 2QSFA 4IH6A 1QSSA 3I5BA 1T95A 2A3JA 4WK3A 3IR7B 4OX6A 2XULA 2CYYA 3TVYA 4DQRA 3GQCA 1YJNS 3QZ8A 2D9OA 1G1XA 1TZ0A 2QMWA 2B4OA 2D41A 3AB4B 4HI2A 1IKVA 4UUWA 2HHHF 3MR6A 1UFLA 4EO8A 3GV5B 4WZMA 2CJ9A 1V6HA 2KN4A 4WKYA 3KG1A 1IKVB 4C3MA 1CQMA 2WB4A 5C42B 5EGYA 1W2BR 1D9FA 4USJC 1SKSA 2AYEA 4I2PB 2BM1A 3WBZA 1HYSB 1YQHA 1S49A 4P6QA 1ZM9A 1X8DA 1N4LA 2L41A 3DRRA 3FNNA 2J6UA 5J1PA 1U4BA 3DRRB 1VQ8S 1JJHA 3GFYA 3HLUA 4KT0C 1TL5A 1FEEA 2IA6A 1ZAXA 4R8UA 3EGNA 4O3QA 5ITHA 1RI7A 2HNDA 2G4BA 5IS2A 2WHOA 2ZITA 4V19X 1K0VA 1FNMA 1DAXA 2NUHA 5KFXA 4IG3A 1LWFA 4C11B 3TAPA 2OPRA 2BJDA 2BZ2A 5AE1A 4Q7AA 1HI8A 5KFEA 1M90T 3VZIA 1GXTA 2CPYA 4FBUA 4HKQA 3QAUA 2Z2MA 1QAJA 3GYNA 1SL1A 3HKZD 4W90B 4LIWA 3VTIA 2EC0A 5DJBA 1YRXA 1Z2LA 2HNZA 2YKPA 5K5MA 1WEXA 3CCLS 2G1DA 3H5XA 2MQLA 2FY1A 4NX9A 2H5EA 1TKZA 5F9LA 4UY85 2J5AA 3TYTA 1SJ1A 2KYXA 3SZ2A 2JFKA 4ZP9A 2E5GA 3POTA 4X4RA 1TKZB 4PXDA 1O51A 3MM9A 2XLIA 3MWBA 3POTB 4C9DA 1GX5A 2NSBA 1VQ4S 3U1LA 2WONB 4IFYB 2NQPA 3SXLA 5J2QA 1FDBA 3FEXB 4ES1A 1JWWA 1QUPA 4CH7A 1D8YA 3GR1A 2ALZA 1Y5IB 1Y3JA 4ZDNA 4QZVB 5KFTA 1H2VZ 5DDRC 2KFZA 1BD6A 3FEYB 3WZ0A 1SL0A 2XB2D 1KTQA 1VK8A 1VQ5S 4OZJA 4NLQA 2MPUA 2LEAA 3IWNC 4O23A 2I8EA 2GIRA 3NAHA 1Y5LB 1B64A 3F41A 4LVOP 3NAIA 2JL9A 1RT4A 2XGQA 2CQPA 5J2MA 3OLBA 1HD1A 3RR7A 2IM1A 4H4OA 4A48A 2GX8A 4NXMF 3CCQS 2RILA 3LALA 5G4DA 4WYWA 1JJ4A 3SSQA 1R0AA 3CJ2A 5KFDA 1HWUA 1F9FA 4J37A 4IRCA 1KC8T 2R8GA 1R0AB 3GG1A 3G6XA 4U7CA 1CEZA 2CQDA 2QV6A 4UQGA 2VPWB 4C3LA 1RTJA 3LH2S 1P9QC 4ECZA 1YBAA 4BC7A 4Q5VA 2Y1IA 2DBBA 2YX1A 1TL1A 1FRXA 2CKWA 1D8ZA 4RBUA 5B0DA 4XO0A 2N7CA 4X84A 3QWPA 1HBMB 2WOMB 3UR3C 2YWHA 4KR0B 2DNKA 2BBEA 3NBPA 2F8HA 1R8CA 3SCKE 1E6VB 4ETXA 2OD6A 2KB2A 3IXQA 3NBPB 1Q7YT 1FK9A 3NWGA 1NH8A 3KLFB 1NB7A 3TUIC 3G8TA 2EFPA 2PI4A 1LFPA 2JOQA 1ZAWA 1SJRA 2R7UA 2DR9A 1S0NA 3VQTA 3OVSA 4YFUA 4GKJF 4L6V3 4MJKA 3V4MA 2XS7A 4MK7A 3H5YA 4TYBA 5GADI 3C8YA 4O3SA 5B09A 1S76D 3I55S 2ZH5A 1NO8A 5D6GA 3QGHA 1FRIA 4RW6B 2QRRA 4M94A 3H98A 3QWUA 2CPDA 2ZOGA 2FDNA 5B0FA 3KJVB 1RT7B 3SDEB 3EGZA 1X4DA 3IRXA 2HWIA 3IRWP 1QUVA 2V4QA 2R7XA 4LFBF 5B08A 2PN6A 3I82A 4IOBA 4Y2KA 3KHHA 3LP1A 1TKTB 4DL7A 1MSWD 4JUZA 3LF0A 3LW5C 4GC7A 1OQ6A 3QMQA 3LP1B 4ZVGA 3BQ0A 4EBDA 2I5JB 2BR0A 2ZKUA 3GSDA 3LANA 2LXUA 2DGUA 2V2KA 3OPKA 3JTOA 4ZCKA 1APSA 2HIQA 3E01A 2FLNA 2JEIA 2FB0A 1R89A 2YY3A 3KLGB 4ECTA 4DV7F 2M70A 4XAKA 4EYHB 4TXSA 1SJ4P 4TNOA 3O8WA 3BZQA 5CHCB 1U1PA 1S9FA 3HHNB 1AROP 1XTZA 5CZXA 1S99A 4R5PB 3N6MA 5F0UA 1CC8A 1TVRB 3CDBA 1S1XB 3HHLD 2X51A 1YGYA 4FPRA 4IO1A 4ES3A 3PW4A 3SQGA 2XSJA 3C3LA 3J7A1 2P9GA 2M8DB 2BV3A 4Y0FA 3J7YU 1S0VA 2ZKTA 3ITHA 1IKXA 3IFEA 1TAUA 4B9NA 1BWEA 2MSTA 5KT6A 3L95X 2AJ1A 2KKHA 1FKOB 2AWZA 2AJQA 1S9GA 1FKAF 2CQCA 3HT3A 1RWUA 1UVKA 1S1UA 3EPIA 5DLGA 2DCUB 3JYTA 2J9DA 1HBUA 4Y2MA 3MEDB 3HO1A 2VZ9A 1YWXA 2IA0A 4LMZA 3TNVA 2DPIA 3JYTB 2EVZA 1X9MA 2P6SA 4JV0A 1O5JA 2LYVA 1C0TB 4OX8A 4QR0A 3OL7A 1V9OA 4NLYA 4ZPDA 5C25A 2XLJA 2J9CA 2IJNA 4ECVA 1XR6A 3KOAA 1UL3A 2O67A 2IBOA 2HG4A 5KT5A 2FD2A 4OHXA 2DISA 3R5CA 2J6TA 2LDYA 2VG7A 1ZAVA 2X3GA 3TARA 1BQMA 3MMAB 4C2MA 3Q2TC 2YWFA 1S6OA 1WHXA 1DBDA 2Q6BA 1KN6A 4K4TA 4N56A 3RBEA 4I2QB 4YR2A 4TY8B 3UCUP 2V4JB 1W2IA 3C46A 2C3YA 4URGA 5JJBA 1DQ8A 1K8AT 4Y2CA 3LP0A 4AL5A 2LU1A 4K4YA 1DLOA 2DNLA 4AFFA 1VFJA 2DNNA 2HYIB 1P27B 2I38A 4FBTA 1IBMF 1KHWA 4OI4A 1LQ9A 4X65F 1YSJA 3CEDA 2I1RA 5H9FJ 4J9SA 2JRSA 1CPZA 4RBTA 2DGQA 2M5YA 2VBZA 3D1QA 3JTNA 3RB4A 4JI8F 5DGBA 2HVHA 2E7XA 3QO9B 4DL5A 2YTCA 4AXJA 2DRAA 2ASJA 1FA0A 2CPHA 2KYZA 2R2RA 1XR7A 1IUJA 3RW7A 1S79A 1EETB 3H40A 1TL3B 3DYAA 2OPSB 2IYIA 3VAMA 2POKA 4NCGA 5MLCV 4OIXA 4IRKA 4A8MP 3HMJG 4DL3A 3R1HA 1T94A 2MMYA 1GXLA 2LDIA 2HLTA 3DYAB 2R4FA 4ITSA 3DLKA 5THWA 2XGPA 5J1NA 1OO0B 2E29A 4F02A 3K5NA 3SCJE 3VAKA 2NYIA 1T03A 2RS2A 4NLUA 3DLKB 3EXCX 4N8OA 1VRUA 3QPIA 2DHXA 2DT9A 5DRKA 4NOHA 4PUOB 1S6QA 4QYZJ 3CJ5A 4LSLB 1UJ6A 3VALA 1X5SA 4F3MA 1ZH5A 2OP5A 3M2RB 1LW0B 4ZA1A 3MZIA 4CT8A 3QYYA 3D0GE 3HK2A 3IBWA 4M8LA 2RRBA 4MKYA 2R7OA 3H20A 2E9RX 3GG0A 2NLWA 4RW7A 1NK4A 1OQ3A 3PIPQ 4MAKA 1DURA 4YP3A 1HWKA 1GXUA 1WELA 1X5TA 4R25A 3HVTB 5DO2A 3D1HA 4PR6A 3ZZYA 2FHJA 4RW7B 3JTPA 3IS9A 5KFPA 3DMJB 4X4PA 1WF2A 1U6FA 2VFSA 4KJIA 1VC5A 4GO7X 4EBEA 1IJFB 4IDKB 3TOQA 4JI3F 4C0BA 4MMOA 1YTYA 1T3NA 4AL6A 3KTQA 1X4AA 5E3CA 1Q78A 3CCZA 2L9DA 3KG4A 3HZGA 1R3NA 2N82B 5KFQA 4X4OA 2Q6CA 2VG5B 2IYGA 5KFUA 1JLGA 3R3TA 2YWKA 4RU9A 5KFWA 1XR5A 3P5TL 2KVIA 3I5CA 3H4BA 1JLGB 3CVKA 3DRYA 3M6UA 4DLEA 2JHEA 4NL5A 4GC6A 4N77A 1YI2S 2KHDA 4WIIA 4WXOA 2M0GB 3IG1A 3E3XA 2RU9A 2EFNA 1VQLS 1FDNA 3BM7A 1N5YB 5KFLA 2ZHAA 2F8EX 3IG1B 2IC3B 1MU2B 2P9EA 4OZNA 5KT2A 3DHXA 4ZVEA 3CC2S 2F4VF 3L7OA 2JSXA 4XPCA 1OPIA 2P9CA 3O44A 2E1CA 2XMVA 3CUNA 2D1CA 3GWCA 3OFFA 5LJ5Y 3V81B 4C8YA 5F8NA 2GIQA 3KK3B 1HI0P 1XN9A 1ZTWA 1W25A 4HI1A 4LVNP 4DFJA 2BXJA 2COLA 2D3UA 3RZAA 3CCTA 4Z2XA 2CIMA 4O44A 3AY0A 3F73A 1FDDA 2QA1A 3I0SB 2C3OA 4FVCA 1S9EB 5DDOC 3AAWB 2VKZG 4OLPA 1CVJA 2KHCA 2LQBA 2IVMA 2QFJA 2K3KA 2E9ZA 3CULA 2R8HA 5KG5A 4DSJA 4A8YA 4H4MB 2HNYA 3FRYA 3ENWA 3M2VB 5E33A 1R8PA 4KFBB 2X1GA 2NXUA 2RF2A 4F2SA 3MDFA 5SZTA 1NHUA 1G2EA 2VL1A 3PW2A 4ZPTR 4TQSA 3NMAA 3T9NA 3SV4A 2B0GA 1RGVA 4OHZA 3PY8A 1VQYA 2ZHOA 1U48A 4DQPA 1N5TA 2WB1D 3HM9A 2JLFA 3GV8B 1HQUA 1JLAA 3W2WA 1KFSA 4J9LA 2GC8A 5KG2A 3DRSA 1C4AA 1HQUB 1C1CA 3T6JA 2R2UA 1ZOTA 3DRSB 3DGPA 3N28A 1QSYA 3B82A 4MFBB 2OLWA 3VCDA 3GIKA 3MURP 2HWHA 1X0PA 1U47A 2OMLA 1T05A 4K5RA 1S1TB 2BE2A 3BQ1A 4ELUA 4KTQA 1JXEA 3O1LA 4DPOA 2CPZA 1T05B 2CQGA 4MKAA 3BSAA 4LF8F 2XMMA 2BE2B 1SQEA 3CCWA 1XMBA 1X4BA 3ZZ0A 2VPXB 2ZD1A 4Q2MA 1MWZA 5LJ3Y 2W7AA 4PXEA 3PKMA 5A8WA 2FJEB 1DTQB 2D9PA 4RNNA 2FTRA 2OO4A 5HN0A 3OV7A 4ZP8A 3VAJA 1LXNA 3NGKA 3V6DA 3PJWA 2CJKA 1VK3A 5KFSA 4NLGA 2PO4A 2FVRA 4YY3F 4KKOB 2ZH8A 3K5OA 4J9QA 3V6DB 2QT7A 4C8LA 2MKKA 5A6WA 2J7UA 2JEGA 5HP1B 2B5JA 4CQ1A 1U1MA 5KFAA 4F4ZA 2ZE2A 4FF2A 3RBDA 4QR1A 4OZ5A 2VQFF 1X0FA 1KD1T 4P2SA 2VFRA 4C8KA 1VMBA 4N47A 4CO1A 3KYLA 2DIUA 3FVYA 4B02A 4PG7A 1VHFA 3AH6A 1UETA 3EX7B 3TA2A 5G0RB 2AF6A 3FGVA 1SJFA 1KQKA 4LF5F 1OSDA 2FPHX 3DOKA 4X4SA 3DCAA 2CQHA 4MK9A 4N8NA 4EYIB 4ED0A 3CWJA 5F3TA 2JEJA 4FF3A 5HBMA 4EBCA 5LT5A 4O0IA 3SV3A 3I5AA 3M9MB 1H2UX 2IRYA 2FGOA 2UV8A 3DLGA 4IG0A 1JX4A 1I94F 1R8HA 4I67A 1H7XA 2N4CA 2XI2A 1VC0A 3CC4S 3I6PA 3P3DA 3PNIA 3DLGB 3K57A 3PO4A 4IG0B 2DGVA 1SV5A 2YKMB 2L48A 4USIA 1GQEA 1N0VC 5MAOA 3PW7A 3VQSA 3DN9A 3TAMB 4M5DB 2Z4PA 3PX6A 1FRMA 2HW3A 2HHQA 5F8HA 4JOUA 1MROB 4Y34A 2LXFA 1A6LA 2C3UA 2WCXA 3FEZA 1XBWA 2MJNA 4WE1A 5HROB 1MMLA 2KFNA 4A47A 3HHEA 4DSKA 4RNOA 3QLHA 1KVIA 1QAIA 5FLXY 3GFXA 2W24A 2HQIA 3T5HA 3L3CA 4LJMA 1BLUA 1S6UA 1AXQA 2DNRA 3GV7B 1J5EF 3PEHA 2ABYA 2LMIA 2B4VA 5BR8F 5KT3A 3TVKA 1ZPVA 2GW8A 3N5FA 1VGYA 4QIGA 3M05A 3B8HA 4WFNQ 4RW9A 4NLSA 3BGFA 5CYQB 5BYSA 4F4YA 1R43A 5LXRA 2GHVC 2DGWA 5KFNA 3QJJA 4FXWA 5A8KA 3MMBB 1MNEA 1RJJA 2KRB<