4XTTA

Structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
ASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIKRGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Putative potassium transport protein
publication title Structural Studies of Potassium Transport Protein KtrA Regulator of Conductance of K+ (RCK) C Domain in Complex with Cyclic Diadenosine Monophosphate (c-di-AMP)
pubmed doi rcsb
source organism Staphylococcus aureus 08ba02176
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 4xttA00
3L4BC 1LNQA 4YS2A 4RO0A 3KXDA 2AEMA 2FY8A 3RBXA 4J91A 4L76A 1VCTA 2AEJA 4G65A 3RBZA 4J90A 2BKPA 4J9VA 4EI2A 4XTTA 4J9UE 2OGUA 2BKNA 4GVLA 2AEFA 4L74A 3JXOA 4L75A 4L73A 4J7CA 2BKOA
chains in the Genus database with same CATH superfamily
3W2WB 4AFFA 3AD8C 2BYCA 4CM0A 2W9AA 4JYAF 4ZLJA 4WE1B 1TP7A 2RDJA 4Q2MA 1VQ9S 2Y1JA 4B3OA 3BH7B 4URQU 4QIEA 4Q43A 3TJ9A 5DDQC 2AJ1A 1WWHA 2J76E 2YKNA 1EQMA 3UQSA 1NK9A 5K8NA 3OD2A 4NLTA 3MFIA 1TL7B 3Q8VA 4ZMMA 5IT4A 4OZ3A 2HBYB 3IWLA 2KXHA 1S72S 2FJDB 4I7FB 4DX8H 1V3SA 3HKZD 2JLEA 1K1SA 2P8IA 5D0HA 2EXUA 4PR6A 3V6JA 4B3SJ 3CMES 3EZUA 5IS2A 3N5FA 2MQ8A 1UFLA 2ZH7A 3HD2A 5D0EA 2XI3A 5DLGA 1JXLA 1A6LA 4NWBA 1IBLF 3F0NA 3GV5B 3JSYA 2V6AA 2FVCA 1RZMA 3P4UB 1IM6A 1H2VZ 4ZVRB 4C8KA 2R7VA 3QWUA 4FN5A 2HZAA 1YK9A 3H5UA 4NLGA 3G6VA 3W2WA 1U45A 1R43A 4OZNA 1RA7A 1UZHA 1NK4A 2MKKA 1TTHB 2VG6B 3DOKB 1Q81T 4DR3F 1QD1A 1X5PA 5IT9U 4WE1A 3EDRB 3NXZA 3RRKA 4DR1J 3VAFA 3TUIC 3PR4A 4LBIA 1S48A 1KSPA 3D0IE 1FD8A 2KKHA 1YZ6A 4Y2AA 3E01B 1TFWA 1TL7A 2A18A 2YWKA 1WC5A 4P6QA 4A4JA 2A6OA 4X4SA 1FRMA 4FYVB 3UNGC 4ED0A 4TU7A 1I6JA 4ECSA 2DB1A 3HJFA 3QGHA 3GWCA 2D3O1 4LR9A 1EB0A 1JLCB 4A8KA 4F0HA 4ZIVA 3RAMA 5KFQA 5F8IA 2N3OA 1CVJA 4NLXA 2QYCA 3FEYB 1FCAA 4LF2A 1TAQA 3VAHA 5K8OA 2DGVA 4WK1A 2KU7A 2R8JA 1DTQB 3OSPA 5I4MA 3TO8A 3WIVA 1VQMS 5K5MA 1OS5A 1QY7A 4F0KA 2VG6A 3DOKA 2Z2ZA 4OX9F 5D4PA 2JC1A 3N6MA 2JSXA 1N5QA 1HD0A 4OYWA 2CAJA 1CJUB 5RUBA 5CH7B 2DVIA 2AZ1A 4LRCA 5LMUJ 3PHEA 3NGRA 3E01A 3H4BA 4YY3F 5HBMA 3AODA 5I3UB 2LXFA 4U96A 2XMKA 2XMAA 1N6QB 1WEYA 1ROFA 1Y3KA 3TR5A 2DHSA 4DN9A 2XZTB 4J9RA 3S8SA 1Y9OA 2ZOGA 1RAFB 3FK4A 3M8RA 1HQUB 3TZXA 2YNHB 1V9OA 4FVCA 1JLCA 4ERDA 3Q2TC 1TK5A 2EC0A 1KOOA 3DHXA 1BXNA 4P2FA 2RRNA 1LQ9A 4LFBF 4J9VA 4DPTA 3CDBA 3V6HA 4KE5A 2ZWPA 4I69A 4MK8A 3RZAA 3DU5A 4J7CA 1TUWA 1FDNA 3ENQA 2OEJA 3DFEA 2PMHA 3M2VB 2AU0A 4LR7A 2HSEB 5HVGA 3BS9A 2KM8B 3AY0A 2D7SA 4N56A 2CZ4A 2OIHA 4A8QA 4UY85 3P45B 1CJUA 2V4JB 1T0TV 3LF0A 3O1LA 2XLIA 4NMXA 2BANB 5J1PA 4GKJJ 4HDGA 3CCQS 4TY9A 1XNQF 2QV6A 3NOGA 2E1CA 2DHAA 3OJSA 2W2PP 5I3UA 1F2GA 4QPTA 3GIJA 4CO4A 1RT2B 4MK7A 1N6QA 2E9ZA 3I5AA 4NCGB 1NPRA 2UP1A 2ZKTA 3DN9A 4CLFA 4C8ZA 2BJ8A 1RTJB 2XO7A 1E6YA 1VBZA 5AT1B 1HQUA 4KHRA 2YNHA 1KS2A 4K2XA 2QLJB 2PFDA 4AYBD 5KFTA 2DO0A 1RHKB 4XDCA 3I96A 2R2RA 5L1JA 2KH9A 2NQPA 4EGLA 3UE2A 4DL4A 2XZDB 5D0RA 2JRSA 3C6TB 3M2VA 2GAGC 1H72C 2M7SA 1CSJA 3TW0A 4WU2A 3CO0P 1U1PA 5GMKa 3TNVA 4ZVUB 3VR1A 2RUSA 3VCDA 3LO3A 2VJVA 4NYPA 1R0CB 4ATNA 1H3DA 3NL0A 1BLUA 1SKRA 1ZA1B 2ROEA 3B8HA 4IKAA 4ZJLA 5DO2A 5A6PA 2VHGA 1D1UA 3DRRA 4I6WA 1QE1B 2GZOA 1RT2A 4CLLA 2Z57B 5B08A 3AT1B 2ACMA 4P9SA 1T95A 4NCGA 4IFYB 2GS8A 2VDHA 1UVNA 2FGOA 3M8ZA 3QT5A 3OVBA 1KVJA 1F3VA 1RTJA 2FVRA 4DV5F 4JI3J 1VISA 1WHVA 2E7VA 2KO1A 5I42B 5KFEA 1DLOB 3GJTB 4CTAB 1HNWF 5K9FA 4WZMA 4Y34A 1PO6A 2RQCA 4JV1A 3T5HA 4DX7A 1RI7A 2YWWA 1NB7A 1DJ0A 3KG1A 3ELHA 2KJVA 4LUBA 2RJZA 4JI7J 2V8GA 2F5GA 3ZNJ1 3C6TA 2HRYA 4C97A 2IRYA 2P6SA 1ZA2B 2J0QD 2PA8D 5KFOA 2PFFB 2WVEA 5D4NA 3DNCA 3IGVA 1KFDA 3M32B 3HT0A 1WC4A 3TI0A 1N54B 3LH2S 1RCOB 3IWNC 3B82A 1PAEX 2GHWA 1QE1A 2F4FA 3I4HX 4B02A 1QTNB 4E98A 4DFMA 1D0EA 5D8HB 1ZM9A 1S1UB 4IFYA 2M88A 3J80U 2DR7A 3THVA 1SXLA 4YR0A 2CWKA 2RDDA 5F9LA 1DLOA 4CTAA 5IM0B 1UVLA 3WQPA 3KLHA 1U49A 2BE2B 3O2IA 3LPEA 2VICA 3DGPB 2WTFA 3GONA 1FO1A 3V5RA 1TFYA 3PW2A 4J9LA 3WX4A 1LXNA 2VKZG 2EFGA 1X5OA 4YN3B 5KFSA 3BM7A 1X4DA 4BLGA 5IT0A 2N82B 1XEZA 3NGUA 3CMAS 3HJVA 1W25A 4QWAA 2H4WB 3HZEA 2GCFA 3LGMA 2ZH9A 3CE8A 2HQCA 1GX6A 4IUFA 3ADAC 4DF8A 2DR5A 4WFNQ 3MD3A 3LP2B 3T41A 3MTJA 2KT2A 1L3UA 4USHA 5K8MA 3M32A 1GEHA 3HHNB 1KFSA 4M5HA 3OL8A 1BMQB 3OTBA 1TAUA 3KJQB 4K4YA 3I56S 4MFBB 2DHHA 3MHYA 1FRJA 4CO3A 4W98A 1YSJA 1RU2A 2QTWA 4PWUA 4M5JA 1XNRJ 4RU9A 3OFHA 1S1UA 3K58A 5H9FJ 3GFHA 1WACA 4KPCA 4IR9A 5KOWA 1IR0A 3F73A 2EK6A 4B3TJ 1I3OB 1IR2A 2O66A 2BQ3A 4ANDA 3HHDA 5IM0A 2G0CA 2RS2A 2BE2A 2H1YA 7FD1A 3DOLB 3DGPA 3BBBA 4ID8A 3TUPA 2VODA 2JFDA 3SMZA 4DV1F 2CPFA 1UPPA 2ACYA 3MM7B 1FE0A 4ZS6A 4BDPA 1B99A 3HPOA 2DCLA 1QJHA 5KFPA 1NK8A 5L1KA 3UVJB 1APSA 3CWJA 2WAQD 4M5IA 3QNWB 3TRGA 4FBUA 2H4YB 3H4DA 3EGWB 5LOQA 2D69A 2DNMA 2I6WA 3LP2A 2V4RA 1L3SA 2B56A 1FJGF 1ZZNA 5LMNJ 5B09A 2E5LF 4ES3A 5AE3A 1RDRA 4F4ZA 3M2RB 4NCAA 1MWQA 1PCAA 3BV8A 1R6VA 4MFBA 1N48A 2VFRA 4FVMA 4FS2A 4OI2A 1RT3B 2HNDB 2C2OB 3THPA 2NXCA 5G4DA 1UETA 4X4NA 1BUXA 3LAMA 2DISA 4NLRA 3CCLS 1RISA 4K4VA 4UOGA 2V2ZA 2B5JA 1WEZA 2MEWA 3FRYA 2LEBA 4OV6A 4DPOA 3S01A 3IG1B 2SXLA 1KEKA 3GYGA 5HATA 2J5AA 3DOLA 3L7PA 4P73A 4WWSA 2DTJA 1F5CA 1QVGR 4NYOA 3RAXA 3MM7A 2E9RX 1HHSA 3PX6A 3B78A 2JNJA 3UVJA 1WKLA 1N34F 3CF5Q 1T9YA 1Q86T 1FF2A 4L73A 3D6FB 2OTLS 2IYGA 2K1RA 1IKVB 4RWXA 2CQ4A 4KHPF 2Y8YA 4PXEA 2BRKA 2KYZA 1RADB 1O6XA 4OI4A 3MEGB 4ETXA 4ITSA 3EXCX 1WC6A 2BW7A 3C15B 1NK7A 1WTFA 1X5TA 2DH8A 4DV6F 5J2QA 3M2RA 3NGTA 3PTWA 1TU0B 4ZK7M 2XCPA 1BHNA 3A4TA 1RT3A 2FHJA 2HNDA 3VQSA 3M9NB 3HM9A 4AL6A 3BR8A 2EFPA 5ETLA 4JI0J 4AE5A 2QFJA 1VOMA 2E7WA 4LREA 2K2PA 1YZ7A 5HAOA 1EP4B 1I94J 2HG4A 1Y10A 2ZDPA 4YDDB 4P52A 2EFOA 1GK8A 2HIQA 2QYGA 2EWHA 3AQPA 3QQCD 3KMSA 2MKHA 5F3ZA 2HGMA 4A8SA 3OHAA 2B6AB 2AD9A 4LQ9A 4B3SF 2GJ2A 1VYAA 1WHXA 5G0RB 1VMBA 3NRBA 2I1RA 4MKYA 2MQNA 2VPYB 2L9NA 1IKVA 3PIOQ 1T7PA 3SXLA 2AYBA 1TL3A 2IM0A 2R7UA 3QMQA 2XCAA 2VF3A 4YHHF 3R5BA 3MEGA 3NEKA 3C15A 3HHLD 2RAQA 4CLWA 4NLOA 5LL6d 1VBXA 3K2YA 2W4CA 3R5AA 1VS3A 1VQYA 5IV3A 4P10A 2VG5B 2GQ2A 4F7VA 3D0HE 3QAEA 1LK5A 1GTEA 2AHOB 2YKOA 1VC5A 3QIPA 3KG4A 4CP5A 4N7TA 1LOUA 4KO0B 2I38A 4AQYF 1EP4A 2ZBPA 3PV8A 4X2BA 3GTYX 2ZZTA 1EQ0A 4OZ2A 3CJ3A 4U8YA 3QSIA 2BQRA 4CM2A 2UVWA 3TZYA 2HW3A 2DNKA 4CI0B 1S97A 4QWBA 2BXJA 2FHOB 4NEYA 4UUXA 5L9XA 1HR0F 1FRLA 1FK9B 1K73T 1JJ2R 1X9SA 3N0VA 5G0RA 4ALZA 1ZZFA 4ZCLA 2MZ1A 2K3KA 4YB1P 1K47A 4A8YA 1DBDA 1XMOF 2I9SA 4CLZA 1CQNA 3LWLA 2XI2A 5HO4A 3O5TB 2WHOA 3BN4A 1KDNA 1HWUA 5EUHA 1RWMB 2HQIA 2WCXA 2CVIA 4U7UK 3FBEA 2WVFA 3EWGA 5KG6A 2VG5A 1NEEA 2RKIB 2HHWA 3R6GB 3GYXB 3KHHA 4PQAA 1URNA 2AX1A 2LU2A 3NCRA 3C3LA 2B9WA 2EFVA 4DG1B 4P75A 3SIPB 4KIAA 5AJ3F 1FHTA 2CA9A 2KN4A 3BSAA 3AH6A 4K8RA 1I1GA 4DL3A 1NB2A 3AOAA 3R2DJ 1VQNS 2K3IA 4QR1A 3A3NB 2CQBA 2Q3PA 4EO6A 2F63A 2MZSA 1LWXA 2RF2B 3RBDA 4A46A 4USMA 3LALA 1FK9A 2C3OA 3GG0A 4FS1A 2UUBF 1FRKA 3ISNC 1VBKA 3CCWA 4CRJA 1KR4A 4QIWD 2HVIA 4ELVA 2ZH8A 1GMWA 2B4OA 2EFNA 4HI1A 1K8AT 3GR1A 3SV3A 2Z2YB 1GT8A 1V5IB 2R7RA 3VAMA 2DO4A 3AJ1A 3PX0A 2UVVA 5DQIA 1SKUB 2KXNB 4URSA 2RKIA 2IAJB 1K44A 2FLOA 1U1NA 2W7OA 4QWCA 2VD3A 1LWCB 4DR6J 2GGPB 1RB0A 3PIPQ 3JQKA 4P7VA 1VDHA 3CJTA 4DG1A 1SC3B 2FLPA 4C9DA 3W9JA 1UEVA 2QIFA 4LVOP 2YWEA 4USVA 1M90T 1U09A 3V2UC 3V6DB 1U8WA 1OQ6A 2O67A 2V94A 1RTDB 3EX7B 1JWWA 2RRAA 2MKIA 1CC8A 3FSYA 2RF2A 1JJ4A 2F4VJ 4WXOA 4LRBA 2WRMA 3MAAB 1MWZA 4EYHB 1HI1A 2CQ1A 1RYRA 2Z2MA 1RQ0A 3RRGA 4TU8A 4QR2A 3RR7A 3H0PA 2KFNA 3O8WA 4C8OA 1HNXJ 4OYXA 4RL1A 4Q8EA 2HWIA 4KR0B 5E3PA 1CQMA 2BJ1A 1P1TA 4DV2F 2JEFA 2NSCA 3I9ZA 4JBCA 4LF6J 3H25A 4UQGA 3KTQA 4F4KA 1RHJB 1FX2A 4OYAA 2BQUA 3QFHA 3ULHA 3K89A 3LUYA 4DV0F 5A2QY 3KLFB 3AD9C 2DR8A 3W9IA 1LWCA 6FDRA 3VHQA 2GGPA 2MKJA 4ECTA 4JB8B 5KT3A 3UW1A 2BOPA 3F41A 3UD4P 2ZM6J 5EX3A 3HULA 4IQXA 2JOQA 4I6AA 1FNXH 3SCKE 4K5RA 3TX0A 4TQRA 5DM6Q 1RTDA 4DSLA 3CW2C 2P9CA 3PHTA 5J1NA 3AD7C 2MSSA 2RU3A 1JQGA 2G1HA 3WBZA 1A0OB 2KHCA 4ZJOA 3QRRA 3MAAA 2AQ4A 3S7RA 4TYBA 5HQMA 4DV7F 4Y65A 3FMWA 3Q89A 2CPXA 2DRAA 4USWA 3PACA 4RBVA 5GMDA 3PJXA 4NA2A 1RHQB 4X4VA 3DLJA 2A10A 1K9MT 1BQNB 3HMJG 3OLAA 3E51A 4IO9Q 3J81U 1N56A 3LTOA 5DM7Q 4JI7F 5I3PA 4NLDA 1TQLA 2BKPA 5H9FK 2HMIB 4B08A 3DXBA 3KLFA 3M8WA 2DGOA 4HHUA 1NM2A 2AGPA 3RBZA 1VQSA 3VVUA 2CPJA 2Y9HA 2DY1A 5CABA 3TAMB 2XHCA 1RXOB 1HPZB 2JHEA 3Q8UA 1MMNA 2IIHA 3M4XA 2Z4PA 3A8JA 4M8LA 1VIOA 2QFIA 2ZJRQ 1SJ3P 1NAQA 1FI4A 3MM9B 2OSRA 3NY0A 3HHLA 3E3XA 3MZIA 5C5JA 2ZHBA 4DMZA 4PAAA 4USTA 2MDAA 1KC8T 3CCMS 2MQOA 2VBWA 1QSYA 2QN6B 1N5YA 1IJEB 1U1RA 1X5SA 4XO0A 1WSVA 3VGVA 4MKVA 4KGMA 4PXBA 4U67Q 3K5OA 2AF6A 4EMDA 5E3QA 3NS7B 3MR2A 2IMOA 2J8SA 3VAJA 3R2CJ 4XTTA 5E7OB 3P6YC 4QIVA 1FVSA 5KFYA 1Q0NA 3P49B 4JI1J 2B8PA 2ALZA 2AYMA 4ID5B 2LLZA 2HMIA 4I68A 1CS4B 2ZZNA 5EHHA 4Q0BB 1JK9B 2BUNA 1YBAA 3ZZTA 1U2CA 2C1EB 2VFUA 3C6UB 2EPIA 3E8OA 2RQKA 5BJRA 4ZVHA 1JMTA 4DX6A 1FJ7A 3B4DA 4XDDA 5B7WA 4BWMA 4G1PA 4O44B 3ETOA 1QVFR 3H5XA 3TAMA 3D3BJ 1Y4ZB 2KVQE 4KRWA 4JYAJ 4X4QA 1SI9A 1S59A 1P9YA 4GKKJ 3A8EA 5F8LA 1NDPA 1HWIA 3UR3C 3MM9A 3EGNA 5B0DA 1XNRF 1FKAF 1TMMA 2RSQA 3NNCA 4IH6A 4F50A 4LQ3A 1BE4A 3WZ0A 4DZ6A 1MSWD 1J2VA 4LBHA 2ZE2B 2DNQA 1VC6A 4WIIA 1R0BG 2YPZA 2WW4A 1U47A 2F8MA 3IP0A 1RLDA 2GMLA 4FF4A 1LW0B 3N28A 3VTIA 4ER8A 2BBEA 2CPIA 2IJRA 4CH0S 2RS8A 2J7UA 4X4RA 4TVAB 4RPFA 3MAQA 3DLLQ 1MN9A 1KNZA 4QYZJ 1XMBA 2ZVSA 4ID5A 2XNQA 2KB2A 4PZVA 5B0FA 1CS4A 2XMWA 1MLAA 4F25A 4Q0BA 1IWGA 3C6UA 2JVRA 3OFEA 2R7TA 4WBFA 1MMDA 2GX8A 4O44A 2FYXA 4WKRA 3CJ5A 1S7IA 4AD6A 4DR3J 2IHR1 5F9NA 2NXNA 3PG9A 1S6PB 2HK3A 2RH3A 1S6UA 2ADBA 1X7VA 4YB5A 4QOTA 4NXNF 5LSOA 1IKXB 2CPYA 5B0GA 5L9NA 4IRCA 2ZE2A 3OXFA 3QJJA 4MT1A 1YJVA 3VALA 1NXIA 2AWZA 3FEXB 4DCJB 5L1LA 3M6WA 4P2XA 2VPZB 2HAIA 3S6EA 1L3KA 4ED2A 4DR4F 4IR1A 3A13A 4K4WA 3GP9A 4OJ3A 5MAOA 1J5OA 2LEPA 3L3CA 2VBXA 3FQLA 8AT1B 2VPWB 2VQFF 2V2VA 3N01A 1YVFA 2V4QA 4HEA9 1G1XA 3M30B 4AXJA 2RQMA 1S1XB 3D6MB 4AUKA 1R3NA 3J7Z5 2MLXA 3K17A 1U48A 1S6QB 4W92B 4OI6A 2AYEA 2DNHA 1HQ2A 3W61A 1S99A 1DARA 1YJNS 3W7BA 3OW2R 4OX9J 1NO8A 1S6PA 3BDEA 1XC9A 3GE9A 1IBCB 3M8YA 3EMTA 3C66A 4EEYA 1TELA 1YJ7A 2ZD1B 1WORA 1IKXA 4HL9A 1UVJA 4YY3J 3VV2B 4LF5F 2KI2A 4HH1A 3IO1A 3S1TA 2VV5A 4LMZA 2CPDA 2QA2A 3K59A 4N77A 4HLBA 1YQHA 3BZQA 2BV3A 3H7HB 1M5PC 2W8LA 2B4PA 3A3OB 2Z8QA 1NH7A 2DNYA 4IG3B 4OLOA 4J9QA 3IS9B 2MYFA 4X64F 1IBKF 4OHYA 2APOA 3CJ0A 3G87A 1U25A 3PYDA 3M30A 1B64A 2NZ4A 4CO2A 1SC4B 1S1XA 4LFBJ 4OHZA 2HBQB 3BKTA 2E1MC 2ASLA 2VB6A 3GB0A 3GIKA 5D6GA 2NSBA 4OYZA 3TA2A 1S6QA 1D09B 1PBAA 2DIUA 3VZIA 3P3DA 4ED4A 3DLKB 2ZWOA 4NLQA 3WDOA 3K5PA 4KBIA 3TEHB 3US5A 1XWLA 5L38A 4UTGA 1H2UX 3EICA 2W7PA 1VFJA 3I31A 2ASJA 4JV5F 3CEDA 3WC0A 5J2MB 1HBMB 2WZ1A 2ZD1A 2G13A 1RYSA 2RQ4A 4CNYA 1AFIA 2DITA 4C7QA 1XNQJ 1UPMB 4DSJA 2KT3A 4ZVEA 2IFXA 5A76A 3OT9A 3D6HB 4B9MA 1U6FA 3PFEA 2D1CA 2B8QA 1WG1A 2FTRA 1HNZF 4IG3A 1WKJA 2G4BA 3MD1A 3N4WA 5E0OA 2J8AA 4TU9A 1Q5VA 1KQKA 1TUVA 4M5NA 2DT9A 1Q16B 1WF1A 4LR8A 1YBTA 4KKOB 3OV7A 1NJYA 1OIAA 5HQLA 4LRFA 3Q23A 3KJFB 5F8NA 2IJNA 1UWAA 3ISZA 1HLWA 5CYMB 3EPIA 1V5VA 3DLKA 4YDXA 5IOLA 3TZZA 1R0AB 2R2SA 3MR7A 4O3NA 3MR3A 4LFAF 5DDOC 2LXIA 3QO9B 1S5ZA 3TJAA 4HDHA 3CC2S 2KXFA 2NYHA 4J37A 5J2MA 1HBMA 1ZH5A 5KG7A 3H2VE 4X65F 3NMAA 5K14B 4N5SA 4P2MA 6AT1B 3UDEA 4A8WA 1IBMF 3E2EA 4QIFA 1SH0A 1OY8A 4CNZA 1FXDA 1TKZB 1KQFB 2J0SD 3J7A1 2V34A 2ZH6A 3WC2A 4DV5J 4X62F 2ZZMA 3R8YA 1HNIB 2IDLA 1HNWJ 4ILRA 1JLAB 3DMJB 1WOPA 2J9EA 5DG7A 1RAGB 4L3NA 2YKPA 4KKOA 2BA9A 1HKAA 4EK2A 2HFOA 3WHIA 3UR0A 2QMUB 2WBRA 4RO0A 3H98A 4QQBA 2CYYA 3ZZPA 3GLJA 4MKAA 4RBTA 4DPUA 5CYMA 4CLPA 2C3PA 2QL5B 4Y0FA 1R0AA 3G4SS 3PRBA 5GVQA 2V50A 2HRUA 2RHQB 4IRKA 5HJXA 1VJQA 3QO9A 2OD6A 3CCUS 5MLCV 2HHTA 1VQ4S 1SQEA 2EK1A 3CD5A 4GVLA 3FFIB 1PJ5A 2RMLA 1T05B 3JAMY 2HFNA 1UVIA 3RB6A 5K14A 3KHGA 5ETMA 2NYIA 3G71S 3RW7A 4LFCF 4PQUB 3QJLA 1RBLA 1TKZA 1N5VA 2DNPA 4C0OC 3LWMA 2BJ9A 5CD4H 4K2JA 4DX5A 3FSIA 2XTJP 4ED7A 3VVTA 2ZUGA 2VC0A 2U2FA 2VONA 4TYAA 2R8GA 3UCUP 3I5CA 3G8TA 2UV8A 1N0UA 2XYPB 2B3TB 3KK1B 7FDRA 2JEJA 2NPFA 1JLGB 4DOZA 1HNIA 1H2TZ 2DEJA 4JI5F 2GMHA 3SCJE 4Q7AA 3C14B 3CDAA 2H9ZA 2DNNA 1JLAA 1GH8A 3MPUB 4QJVA 4O3PA 5HMXA 3QGPA 4ZPBA 2VOPA 2HZVA 1Q7YT 3RJMB 4L74A 2L9WA 1SCJB 2W2OP 4HYKA 4O4RA 1NSKL 3GSDA 3EUNA 2LVWA 2X51A 3BQ1A 3DC2A 3DRXA 4U8VA 2Q1LA 3NWRA 3ZC4A 4WFAQ 4LF6F 2IRUA 5L1IA 2HBZB 4WFZA 5JMNA 2CJQA 1ZETA 3RAQA 2Z0GA 5A8WB 4RW8B 4PUOA 2YKQA 2X3GA 2W24A 3FFIA 1T05A 2EBEA 3K57A 3GQCA 3VZHA 1B0PA 3HHEA 2N4CA 1YRUA 3I6PA 4DFPA 3NS6A 1UW4A 2WB4A 2C2KB 4PQUA 3HK2A 2AEMA 2BM1A 2AJ0A 3DXSX 3L9ZA 2ZM6F 1NNDA 3D67A 2R4FA 3HF5A 4ES2A 1JXVA 1UA0A 4F36A 1UCNA 2N4DA 1Q4RA 2W2NP 2UXCJ 4OYMA 4DUYF 4DR7J 3FBBA 3KK1A 2QJ3A 1VHIA 3KG0A 1JLGA 2K06A 3V4IA 3CJKB 3C14A 4RNNA 2DNZA 4YB7A 1FWKA 2X3DA 3D54A 2R7QA 3DLEB 5IWAJ 1TKDA 3KNAA 4OZ0A 2CDRB 3OL7A 3ILJA 4UF4A 2CKWA 1SJRA 5IT9Y 4FF1A 3P96A 3M6XA 3RTVA 1NJWA 4BC9A 1WC3A 1SJ1A 2FZCB 4ZP6A 1K1QA 2E9TA 2JC0A 2W2QP 2CNKB 5A8WA 4RW8A 2B4UA 5ETTA 1FJGJ 2HHHF 3FCHA 1PBUA 4O3RA 2DPJA 3MMBB 2E5LJ 4NZ7A 2CZ9A 3R5GA 3MUTP 1VRTB 3HX9A 3VAIA 4DPYA 3OR1B 3BJYA 4J9PA 4P71A 5AXNA 2HRTA 1IN0A 1SH3A 4F26A 2HQFA 4NA3A 4PWDB 2HVHA 4QYZK 2PEHA 2DXFA 3BSOA 1YDLA 3W65A 2ZC3A 4E8UA 4ZCIA 4LIRA 4HR2A 4B9UA 3BB5A 1JLBB 1J5EF 2CPEA 4NCBA 3EM1A 3POTB 3CJKA 3ZTSA 1TL1A 1N5SA 2CG4A 1HWJA 4K7QA 3RB3A 1ZYQA 3DLEA 1IKYA 3IXQA 4HVZA 1HWKA 1T9TA 4EFAC 5D4LA 2BJ7A 1FTCA 2E5HA 1BWVA 4CLUA 4O4GB 4P72A 1N34J 3DM2B 3MM6B 2FDNA 5F8HA 5ETVA 1CEZA 4Z2XA 2OLWA 4PG4A 4XAKA 1L5UA 2KHDA 4KHPJ 1UZDA 4FYWB 4B3RF 1D3WA 2X1AA 1Q95G 1X8DA 3BGUA 3MMBA 4OHWA 3HHLC 4FYXB 4DV6J 1RAHB 4I2QB 3G86A 5J2PB 2Q66A 1RAEB 1VRTA 4M63A 5HL7Q 1NK6A 2BR0A 2ZUAA 3BGLA 3AB2B 3OR1A 3QLHB 4FP9A 3CCES 2FZKB 2J0XA 3QZ7A 1WHWA 3MEDB 4MYUA 4GKKF 4K59A 5DETA 3CCTA 4PWDA 1JNRB 4FPRA 2MLYA 1H74A 2Y3YA 1S4FA 3RBXA 4P7TA 1MNEA 3TX8A 1W2IA 2C42A 2P5VA 1U26A 1JLBA 1LKZA 4RW9B 4USKA 3POTA 3H5YA 2E5JA 3BSNA 3TAPA 1AZSB 2MZJA 2PEBA 1LNQA 3DLBA 1GXTA 2MXYA 1QUVA 3W5XA 5CHCB 1RJJA 3T5JA 4F4YA 1R31A 2IC3B 1HI8A 1QAYA 5CZXA 2W8KA 1Q8KA 1O5JA 3KMQA 2G0IA 2VFSA 4N41A 4GC6A 3FZ2A 4O4GA 2OTJS 3DM2A 3MM6A 3K8VA 4Y2CA 2ZC4A 4DPWA 3BQ2A 1VC0A 4L72B 3HDSA 4PEOA 3GIMA 2C3MA 4A8XA 2VC1A 2MQPA 4DCPB 2PC6A 5KTQA 1J27A 4YHHJ 3JSRA 2IYIA 5FLXU 5HJYA 1P1LA 4QU6A 2VA2A 3C46A 4I2QA 3NNHA 4WF9Q 5J2PA 2FLNA 4KT0C 2V8DA 3TA1A 3QLHA 4BS2A 3HZGA 1VJWA 3SBMA 2C2ZB 4U95A 4DQSA 3AJDA 1RKIA 3RB4A 2RIJA 2VBZA 3CB4A 2G0JA 4NLVA 3N6NA 1NMEB 3M6UA 4C6AA 4ZKAA 3SSSA 2GQCA 3KDNA 4AQYJ 4RW9A 2N3LA 2Z56B 2HBRB 1AZSA 1FESA 1VI7A 4CLTA 2IM2A 3UDLA 3OXGA 3I87A 1WI6A 4OX7A 4I7FA 2IC3A 2XMVA 1QDUB 1QAXA 3BKFA 1S10A 3M9MB 1YJWS 2VG7B 5C2GA 1KLNA 2E1AA 1HR0J 2EG1A 2M4MA 1NDKA 1FJEB 4XK8C 1GX5A 3PFOA 3CDEA 5SZTA 1EJ7L 1FX4A 1PYOB 3CCSS 1XMOJ 1WELA 3OTDA 1WSRA 5KFMA 2FY1A 4EO8A 2BABA 3GFZA 4J9NA 2VFVA 1VK8A 4KFBB 2YWGA 4IYQA 1NK0A 3U1MA 1RTIB 4WP9A 5L8RC 2ZJPQ 2DXEA 1N8RT 2KL8A 4ANEA 3PNIA 2D9OA 2BACA 4EBEA 1R8PA 3TQEA 2YKMB 1WOOA 4F3OA 1UFWA 2CFXA 1ITPA 2B9EA 3ZNUA 5JVHQ 4CQ1A 4ZPVR 5F8JA 1X4AA 1P6TA 4ED1A 5AJ3J 4R5PB 1F2HA 2DIVA 1GFWB 2OFGX 2FZGB 3IR5B 2HNYB 1TUGB 2XB2D 1RBAA 3BPDA 3H40A 4DHVA 1VQ5S 4DI6A 2JLFA 4RW7B 2JX2A 1KHVA 3MR6A 3J7YU 1LV5A 2VG7A 3ZZRA 2F3JA 3U7JA 3TARA 1FFWB 5KFDA 4P2SA 3JB9k 4Z37A 5KT4A 2UUBJ 2HFUA 4ZLLA 3W5YA 4ECZA 5JJBA 5KOXA 1B7FA 3PW7A 2ZNZA 1RTHB 1UVKA 3JSMB 4DL6A 4EZ6A 2XY5A 4KFBA 1DTQA 3GZ7A 2EKNA 1SKSA 2RD5C 4LBPA 4K4UA 2QL7B 2B9YA 2AGOA 2OJ3A 1QAJA 3HVTB 2FLLA 1SBRA 4RUCA 1UJ6A 3ZO7A 4CO1A 4OYBA 3D2WA 4PYDA 1VQ7S 1LEOA 2QSWA 2E44A 4KGKA 2PGCA 4CLSA 4ES1A 2YKMA 1G6BA 4ECRA 2HWHA 1SJ4P 2QA4S 1RAAB 4JV0A 1Q8IA 3MPYA 1U2RA 2PI4A 3ZZ0A 4F0MA 4LSNB 1B0TA 4WU3A 3T6JA 4R5PA 1QSLA 2HYIB 3H2LA 1HHQA 3IFEA 5F0WA 1EKRA 4J9KA 3OL6A 3QJPA 4DSEA 3T6BA 2HNYA 3IA0A 4OYOA 4RW7A 4G6VB 3TZWA 2IVMA 5F0UA 5ADZA 2WSEC 3W2VB 1XR6A 3NOCA 3IRWP 4YB6A 4MTPA 2BRLA 3LQVA 2BVZA 2XS5A 1RTHA 1YI2S 3JSMA 1C0TB 2KRRA 2FHJD 3BYRA 1X4BA 4OYPA 2CNNB 3EVMA 3GFYA 3T1AA 2DK2A 4HACB 5BR8J 1V6HA 2FIUA 4DV2J 3NS5A 1GNKA 4M5LA 2UUAF 1RUSA 2VUGA 4J5OA 3HVTA 2LP4A 1N36F 3HI9A 4U9RA 5DGAA 2UUCJ 4FXWA 3K5NA 4DV0J 4ZPAA 5E3AA 2BW2A 4X4PA 2V2QA 5FDLB 1JJCB 4A47A 1DQAA 1RAJA 2HK2A 2V4JA 3MPWA 3FC9A 4LSNA 3M8SA 4O3SA 5E2QA 1BQMB 2BANA 2DY9A 4CT9A 1IKWB 4TKTA 4KJIA 1IUJA 1T3OA 1PAUB 3ENAA 3D5MA 2ZJQQ 4AL5A 2DGTA 2EC2A 2ASYA 4TXSA 2J9DA 2XO6A 3BKUA 4DR5F 3EYZA 1PC4A 1XERA 4RU2A 2XMUA 4DXLA 3AOBA 3MURP 4OX8A 2DGUA 2J6UA 2Y0BB 4DV7J 2KG0A 3F56A 2FPHX 4F02A 2RE1A 1NSQA 2GHPA 4X4UA 3QT8A 1RHUB 5KT6A 1DRZA 4M94A 2DNLA 3L09A 4QWEA 2Y1IA 3UD5A 1NLKL 2MY8A 1FEEA 4BWJA 3HSGA 1C0UB 3K8WA 5F41A 4DQIA 1Y0HA 2XZWA 4F3QA 1JB0C 1F6TA 3PX4A 3P5TL 3B6BA 2CVEA 5FDLA 3T5LA 1ZM2A 2B4VA 4WK3A 3Q86A 4F67A 2IBOA 5I3QA 5J1EB 2XGPA 5IQ6A 4FXVA 1BQMA 3V4MA 1IKWA 3DRPB 2I0XA 2HPUA 2K8GA 2O1PA 1VQKS 2OGUA 3KLIB 4DUZF 3G8QA 1NKCA 1Q82T 2FC8A 3CXCR 4FNIA 2E29A 3B4MA 4Y2IA 1FT8A 2RT3A 1MN7A 1F0XA 2ZH4A 3BPSP 1NPPA 2FQQB 2HZCA 5I42A 4H4KC 2MHNA 3D1OA 2ROGA 2A1BA 3MM8B 2OPQB 4G1QB 1F1BB 4X84A 5HQ8A 2AW0A 4ZA1A 1X4GA 3FEZA 4EU0A 2DBBA 1OMSA 4FXDA 2HVEA 2KG1A 1ZAVA 5CCLA 4O3QA 4ZCMA 3X3UA 3W5ZA 2HFZA 4WYWA 4R25A 3EZOA 1YIJS 1C0UA 4NASA 3HO1A 3HFVA 2HHXA 3I55S 1NK5A 3OTEA 1VIXA 1TK8A 3EPGA 4QW8A 4ZVFA 3NWGA 2J6SA 1M1KT 4TNOA 4KAIA 2HGLA 5J1EA 4OJGA 4MJKA 4YFUA 3R97A 1Q8LA 2AEFA 3DRPA 1PYSB 4RNFA 4L75A 4JI2J 2CG8A 2Y1LB 1ZPWX 4OZLA 2NS1B 2NXEA 3KLIA 2W2MP 2FJEB 4KH1B 4E0DA 5HMZA 1GMWD 1SUQB 3MOZA 3GU0A 4RX6A 4BC7A 1FDAA 3UDCA 3D0GE 3HSZA 2UXCF 1U1LA 4DR7F 2VFTA 9RUBA 2E66A 2OD4A 1Q1KA 2HHPA 1XR5A 3J7YI 3HXMA 3MM8A 4G1QA 4JUZA 4FYDA 2CQGA 4PCQA 3W3SA 2RDIA 3KHLA 5ETRA 5DDRC 2VQEJ 5HMYA 3QPIA 5IWAF 1T94A 1OYEA 1MU2B 4NX9A 2XC9A 1S6OA 2HHSA 2LKZA 4DPXA 1S1VB 2OO4A 1RP5A 1U0SA 3VGUA 2QSFA 4QR0A 3ZXWA 1X0FA 2GVZB 2J7WA 2UUTA 2BX6A 4EZ9A 1KTVA 3OHBA 4CYUB 3RU0A 2OP5A 5KFGA 2GA7A 1FNMA 1T11A 2QL9B 2OFHX 1VQLS 4PXDA 3SDEB 3GCXP 5EWGA 3R9LA 4PRFA 1JX4A 1Q78A 3MTKA 1SC6A 2OPSB 4H4OB 3OPKA 4MIAA 4E2FB 4UT4A 3PY8A 4I56A 2V9WA 3PKMA 2G2YA 3DRYA 2YQ1A 4C48A 1SUQA 3QT6A 4NXNJ 3VF0B 2V0NA 1UVMA 3NAIA 2G1DA 1RWXB 2ZITA 4H4MB 4GO5X 2M0GB 3MR5A 4FDFA 3PJ9A 3BH6B 1FERA 4KGZB 4HHJA 3TWZA 2VOOA 4K0KF 2R7SA 3R5JB 3I0RB 2XG8A 3VWSA 4BCAA 2R9LA 2NUUG 2YVSA 1WC0A 2IDEA 4O0NA 2GJIA 2LMIA 4RKUC 1MU2A 4DR4J 3BO2A 5E33A 2M3DA 5EWFA 2WW8A 5HN0A 3VAGA 5AXKA 2VQFJ 4KPYA 3HP6A 4ZDNA 1EKSA 1F9HA 2DR6A 2GVZA 3VGTA 3UCGA 4DSIA 2H54B 1GXUA 1OY6A 4DU8A 1UP1A 3DRSB 4DSFA 3I32A 3OR2B 1SL1A 2I5JB 2OEKA 3SDEA 1JNZB 5CYQB 4DV4F 1DQ8A 4UW2A 5CQGA 2OPSA 1Q8BA 4H4OA 4RNHA 2CQHA 4DL2A 2V68A 2LQJA 3Q8SB 2CPHA 1Q5YA 1ZBTA 1XR7A 5KFRA 2X1GA 2CUYA 2KFYA 2DGXA 4F3MA 1XMQF 4NLSA 4H4MA 6FD1A 2Q79A 4N8NA 2PI5A 1WDTA 2ZFHA 4PKDB 2HURA 4LF5J 2D3ZA 2XBPA 3IG1A 3I0RA 4ECUA 1NZAA 3BGOP 3DDIA 5KFCA 2GV1A 3PRDA 4TLRA 9ATCB 4B3MJ 2ZKUA 1OYDA 1UAWA 4X64J 1IBKJ 1RWVB 2OPRB 2KVIA 4IG0B 1S57A 3IR6B 3KUGA 3CDWA 3IC1A 1R8BA 2HS4A 3DDNA 3HFKA 5HSPA 5JXSA 2DHGA 1QLNA 2GNKA 1PGZA 2UXBJ 2FHKA 1RWKB 1TL5A 3DRSA 5B0AA 3Q24A 1M5VC 2JZ5A 1LW2B 3OR2A 2I5JA 4Q5VA 5DDPC 1NHVA 2XEXA 4KV8B 5CYQA 3LPYA 4C0BA 4LF8J 3D1HA 5KFJA 2OI2A 1RT5B 1AXQA 1VLYA 5ETOA 2R42A 3W63A 1HQEB 1YKWA 4JV5J 1K0TA 2V67A 4YR3A 5C42B 1Y11A 2BKNA 4ZITA 4K50A 3WX8A 3PVXA 2CDQA 1SIZA 3IM8A 1V3ZA 1UEUA 4ELUA 3T1HF 2BOAA 4OZ5A 2CJYB 1VK3A 1WJ9A 1YJUA 1NDCA 1HL6A 2G9OA 1NJZA 1HNZJ 3RG6A 2HQGA 4LF4J 2B6AA 4U7UD 2MKSA 1VHFA 3CJRA 1TKTB 2OPRA 2XMMA 2RB7A 4IG0A 2KFZA 3M7VA 1VQ6S 2D9PA 2DJWA 1IWAA 4J91A 3SCLE 2YWFA 2EEYA 5BYSA 4N8OA 2VIHA 1MROB 2QLFB 3Q0AA 1FEHA 2V5HG 1R89A 1LW2A 1FRXA 5BYQA 3M2UB 1T03B 2IMWP 3EVOA 4KV8A 4DL7A 1OQ3A 5LSLA 3JQJA 4LFAJ 1Q7LB 1RT5A 1N5TA 2HKEA 4YEAA 5HBMB 4ECYA 3Q8QB 5IC6B 1HQEA 3HVAA 2NCKL 4ICLB 1MMLA 5C42A 4X65J 2ZOMA 1SJFA 1BC6A 4KO0A 3MFHA 1KOHA 1IBMJ 3GR0A 4I1TA 2BZ2A 4CCHA 3DI6B 2XWXA 4ZVTB 5EX0A 2F7VA 3CC7S 5ETPA 3J81Y 1LK7A 3CGIA 3QT7A 4X62J 4FZVA 1U2FA 3KJVB 1TKTA 4N76A 1IVZA 3CJSA 3KLVA 3D4JA 5B0CA 2LDIA 2ZHOA 3CCRS 1RK8A 3QSYB 3MCSA 2ZDOA 1D8ZA 2DNGA 3PJWA 1UA1A 2YBVA 1MROA 2HFSA 1F3FA 1P9QC 4LVNP 1Y3JA 2NR0A 3M2UA 1GMVA 3NKYA 2MKYA 1FVQA 1T03A 1E6VB 4QW9A 4NEZA 2PE8A 5C24B 4ILLA 5HI7A 4I0WA 2VPXB 1PC5A 4KY3A 3D28A 4DSKA 1JIHA 3RRHA 3AA8A 4ICLA 2DYAA 2JEGA 3RYLA 1R6YA 2YH0A 4RWWA 2R3VA 2DHXA 5C2CA 2K7KA 3MCNA 5HMWA 2QEXS 4AXIA 3LOUA 3C16B 4MMOA 3W66A 4OL8A 4Y28C 2H5JB 4LFCJ 1E6YB 2MSTA 3DI6A 1PKUA 1WDDA 2O5DA 1HARA 4ZN3A 3SQOP 2WVBA 4XPCA 2MKCA 2RNEA 2D3UA 4USIA 1S76D 3D7SB 2QX0A 1FA0A 4RZRA 1WHYA 2B9XA 1RWNB 1ZOTA 4JI4F 1S0OA 1YJRA 1CJKB 4UOCA 2ERRA 2KT5A 3KJVA 3KLEB 1B7YB 4JI5J 2VU5A 5KFWA 2OELA 1TKXB 2B43A 1KLMB 3SZ2A 1YG0A 3T1YF 4JI8F 3OTOJ 3I82A 2KTQA 5LXYA 4GRSA 5C7PA 2LA4A 4Y3CA 2XSFA 3DU6A 1RAIB 2YKAA 5LJ3Y 4A8OA 2OH2A 5B0BA 2GAHC 2XMTA 1AB8A 4LSLB 5BR8F 2PSZA 3QGIA 5IC4B 1E6VA 2WSFC 5C24A 4WKYA 4FKYA 2AP6A 3BF4A 3IR7B 2UUCF 2CJ9A 3OJUA 2LA6A 2IAJA 2HVZA 1CC7A 3I0SB 5AXMA 3RUBL 3MUMP 3DRRB 1ACMB 4A8FA 1PG5B 3C16A 4WFXA 1WTBA 1Z1ZA 2AJ4A 3GPAA 1VRUB 3CMQA 1AFJA 2GHVC 1RT4B 2MGZB 4M5DB 3W8GA 1YWXA 3UI3A 4GVBB 2L41A 1VQPS 1R8HA 4USUA 1N32F 3V6DA 2PDAA 1REVB 1MWYA 4RW6B 5F8MA 3K5MA 1RSCA 2RHSB 2BEFA 2HGNA 4H54A 4A8MP 3CIZA 2PN6A 4DUTA 4M5KA 3X1LB 1BY9A 1CJKA 4DUYJ 2YXLA 1S1TB 4WTOB 2P9EA 4F8RA 5GAHU 3KLEA 1G4CA 2YTCA 1TKXA 1KLMA 2VZ9A 4WJBA 1SQGA 2FD2A 3UN5A 2ZOFA 4HHHA 2A3JA 3LAKA 3KJNB 4DBQA 4MAKA 2KM8C 3CO9A 3CUNA 5DRKA 3OL9A 4LRDA 2DH7A 2XLKA 1D9FA 4F04B 1RHMB 2CQCA 2DCUB 4LSLA 2N7CA 1RWPB 4U6PA 1TL4A 2DNRA 2GC8A 5DQHA 3ZZZA 2N7YA 3H59A 1OPIA 2GO8A 3W9HA 5J2NB 1S1WB 3D68A 1U4BA 3I0SA 1FWPA 2PIIA 2MQMA 2FVQA 3PEJA 2CIMA 3OFFA 2QMXA 3MMCB 2HHHJ 4LF7F 2CXEA 3T5KA 2GJFA 2A2CA 2GMJA 1VRUA 4I67A 3U1LA 3EVWA 2R7XA 2HIYA 2WK4A 1ZAXA 1RT4A 4B9LA 1S12A 2MGZA 4M5DA 1TZ0A 4NMLA 1I5OB 4GVBA 5LM7E 4OJHA 3CJ8A 3KDOA 2C2EA 2KZZA 1REVA 4KB7A 3KLHB 3QAUA 5ETNA 4RW6A 4MYTA 1EHWA 5E41A 2H3EB 3MCMA 2LCWA 1C4AA 1S1TA 1U1QA 1U0HB 3IN5A 1J5EJ 4WFYA 1FE4A 3R3TA 4NXMF 2QT7A 2XMJA 2XS2A 2MLZA 1LFWA 3FBFA 3CCZA 4FYYB 3QBCA 4X4TA 2FB0A 1M1HA 4RUBA 1M5HA 1C2PA 1WF2A 4ECWA 4DLGA 4PXCA 1O51A 1OY9A 2C3UA 3ZTRA 2ZBRA 3IM9A 4I4BA 1BQNA 2GIFA 3CVKA 2C28A 2ZVIA 2LQ9A 3LA0A 2EG2A 2IVFB 1PJ6A 3ZTQA 2W9CB 3OVAA 4ECVA 1R8CA 2B7CB 1NUEA 2M5YA 4EWTA 5J2NA 1S1WA 3SCIE 1JKHB 2ZBQA 4B3RJ 5BYRA 3PR5B 3MGJA 1QTMA 1VBYA 3MMCA 2Y1RI 2VJUA 5H1SV 1OSDA 4ELTA 2DD8S 1SPBP 3GJSB 3OFGA 1T3NA 3N79A 4QCLA 3R1LA 2ZNYA 2CQIA 3GJQB 1D9AA 3U02A 3HSJA 1HPZA 2MHEA 5M2RA 2M8HA 3OSNA 4JI2F 3BO4A 2CQDA 2DH9A 1REGX 1X4CA 2M70A 4PPZA 3H90A 3FCWA 4EBDA 5FD1A 4RJVA 4IOBA 1N33F 3LP1B 1U0HA 1U6ZA 3OXLA 2Y0SD 2JL9A 1YBUA 1CPZA 1T8EA 3M9OB 1H7XA 4PYAA 4M95A 4IFVB 1FFGB 2VQEF 2UVRA 2MQLA 4M1KA 1IXKA 3LP0B 3OBIA 1S9EB 4F2SA 2EFQA 4F4XA 4FBTA 4J90A 4P74A 1NCLA 2QRRA 5AE1A 2Q6CA 2W9CA 3HSDA 3WIUA 2H48B 2XGQA 1JKHA 5M2PA 1NSAA 2CNLB 2AZ3A 3AHPA 2VDIA 2XYHB 3Q8RB 3L95X 1YTYA 2HAFA 3AQOA 4UY8T 3PO4A 2BE9B 1LWFB 5C25B 2ABYA 2FVSA 5KG2A 2B5JB 1YGYA 2CJBA 2Q43A 2W01A 4LF9F 2Z2LA 3MEKA 3NAHA 2VL1A 3W8PA 4OHVA 2W4PA 3LP1A 2UXDF 4KSEB 3TQ1A 3G6ES 1AROP 1UJ5A 3R27A 3A8KA 3SSRA 3FGVA 3EE3A 5ETQA 1U6BA 5BXIA 3QIDA 1LW0A 5KT5A 4IFVA 2K1RB 3FBCA 2UUWA 2XY7A 1NU4A 3LP0A 1FDDA 2KYXA 3R7NB 1S9EA 4DR2J 2E5GA 5HANA 4CLYA 2JJ4D 5KFKA 1Q79A 3A3PB 1RU1A 5J2QB 1CJTB 4DV3F 1UL3A 2XLJA 4JI6F 3SYZA 1UMJA 2QO3A 2E1RA 3OUYB 4ZP7A 4K4TA 4XIUA 1F5AA 1OSCA 1X4HA 4NRUA 4ED5A 4OI1A 4Z7YA 3CJ4A 2QLBB 4D3GA 1SL0A 1LWFA 2HVDA 5C25A 5ITHA 1YJ9S 3OVSA 2ZH5A 1NRKA 1UWBB 2WVCA 4LIWA 5KFNA 1D8YA 1BQXA 2UZAA 4WFBQ 3Q83A 2OKQA 3JSBA 1ZTWA 3TP2A 3KFWX 4ZIWA 2M2BA 2YH1A 3Q8YA 3GYNA 1KONA 3KWMA 4CO5A 1EZZB 3Q8PB 2J7KA 5FIIA 4DJBA 1OWXA 3NGKA 4EYIB 1FKPB 5D4OA 1X0PA 5DZ7A 3MMJA 2ATCB 1M5OC 5EGYA 2EKYA 3D3CJ 4DQQA 2L3MA 1HWLA 3QATA 4QIGA 5GAHI 3KHRA 2MJUA 3CT9A 1TL3B 3UN3A 2VASA 5KFIA 4B3MF 2EBGA 3PW4A 3IMQJ 1B70B 3FRZA 1R8AA 4ZHRB 5CXTA 2LQ8A 4ZP8A 2CJAA 2FJAB 1CJTA 5EWEA 4Y2MA 4LJMA 2NXUA 3IWXA 3OUYA 4D3HA 5KFVA 3NGDA 4ZPCA 2EI5A 3CSKA 3C19A 1HNVB 2MTLA 2UXBF 5KAKA 1AW0A 2AJQA 4MKBA 1S0MA 2JDJA 3PEHA 1FJCA 3QIPB 2GW8A 3IAS9 2D41A 1KP6A 1N4LA 4B17A 1NJXA 5A0YB 4LF8F 1UWBA 2CRLA 4QBUA 2QMWA 5CYJA 3GJRB 4HH0A 3M6VA 2DR9A 2AX0A 2LQBA 5KFFA 1FKPA 5GAGU 5E5NA 3QRPA 4HI2A 4TLQA 4DFKA 2W25A 3IBCB 4KGVB 3LGNA 5HK4A 5B0EA 1IJFB 4KHMA 2XYGB 5GMEA 3TUJC 3DLHA 2G2OA 1OJ4A 1R7IA 5DQGA 4MH8A 1HHTP 3PYGA 4LF4F 4EUVA 3IS9A 4ZHRA 4ILMA 1TR0A 2YX7A 3IBFB 4JP8A 3OLBA 4KYZA 3H2UB 4C8YA 4X66J 4EI2A 2F8HA 3ENVA 1JLQB 3GIIA 3Q22A 1B3TA 4CZCA 2W1BA 4NZ0A 2H65B 4QPXA 1RT7B 4L3KA 2ZEJA 1S7HA 3CNQP 4C98A 5IV4A 1HNVA 3RGIA 2KRBA 4DR1F 3QGGA 3KUHA 3FMBA 4CDIA 1CLFA 2UUAJ 1N36J 4CH7A 3NNAA 4L6V3 3CD0A 5A0YA 2H5EA 2AKWB 2XSJB 2F40A 3JS9A 3ZZUA 2NPIA 3CD7A 1IR1A 5KFHA 4WTYA 2V2KA 4C8NA 2CQ3A 3OTCA 4HT7A 4I2PB 1ICEB 3P5BP 3FJ2A 2M9KA 3GIRA 2DPIA 5CCMA 4IOCQ 3KLGB 3R5CA 5KFLA 4DR5J 3IGNA 4NLYA 4DZDA 3VAKA 1HIYA 3BEGB 1DFDA 1CG2A 2MMYA 1RT1B 1PIEA 1TVRB 2R8HA 4V19J 1RABB 1JLEB 5HP1B 5D15A 3M8PB 2HFVA 3R1HA 1HBUB 1FRHA 4MIBA 3UO0A 1JLQA 3DLGB 2R8KA 2IJFA 3KKFA 2BJ3A 1TK0A 3C2PA 1T02A 1RT7A 4KQZA 1L3VA 4Z7CA 1RHRB 4DWIA 2YQ3A 3PO5A 4ECQA 3W64A 4HT5A 2FVPA 2YX4A 2CJXB 2C2NA 3HD1A 3ILIA 3BBCA 2QA4G 4YQWA 4IH7A 1DAXA 3QRQA 2HLUA 5LMUF 2UV8G 2XSJA 1VLOA 1WKKA 2UU9J 4YS2A 3DHWC 3H8YA 1VRQC 1YJTA 3PZPA 1UJ4A 1H7WA 5GAEU 5KG0A 1HI0P 2V8VA 3DGVA 1FKOB 3SFGA 2R8IA 3MCOA 4I2PA 1NBEB 1EARA 4OQJA 3KUEA 3KLGA 2DEIA 2X7IA 3UDVA 3D1QA 4DUZJ 3IRXB 2AYGA 2QG9B 3MWBA 2HNZB 3TVZA 1RT1A 1VQOS 1TVRA 3T19A 3ICLA 1JLEA 1H0HB 5HP1A 2AT1B 3M8PA 1SJQA 1HBUA 3ET6B 5IXUA 4ZVOB 4DCOB 2ROPA 1A7GE 4O3OA 3DLGA 3DMJA 3OTOF 3UNYA 1HMVB 4DL0C 3EXYA 2V8HA 3QZ8A 1Y5IB 5DG9A 4I64A 3GFXA 5GADU 5CAAA 4HTJA 2AV5A 2FGCA 4NL5A 3DCAA 1C1CB 1GXLA 4GKJF 2R2UA 4YUDA 2C22A 3VGSA 5D0GA 4X4OA 1SC1B 2PMZD 4KH0B 2IRXA 1FKOA 3PM9A 4WP3A 1HBOB 2OUGA 3L4BC 5FJ4A 3RBEA 2OAUA 3IRXA 1MW7A 1A9NB 3GMGA 2D3OR 5D78A 2HNZA 3FVYA 3AB4B 1S0VA 4AT1B 5LSRA 1DHMA 1QSSA 3GILA 2Q6BA 2DGSA 2MQQA 3ZZYA 2FY8A 2XWYA 3T9NA 3ET6A 5ETKA 4CO0A 3ILOA 3HVRA 4F2RA 3CTRA 3DKDA 3QYYA 2E5IA 2MZRA 5FLXY 1U02A 2HEKA 1HMVA 3EZ5A 2RRBA 3G82B 2LQ5A 4C3LA 1RWUA 1NKBA 4JOUA 2YWHA 3GSIA 1ZM4A 3CIMA 4V1Ak 3IAM9 3C8YA 5KG5A 4LRAA 2M8DB 1N0VC 5U47A 3O44A 5K20B 5D77A 1C1CA 1KHWA 2PO4A 2Y8WA 1FTRA 3VQTA 3MM5B 4Y00A 4V19X 5E3CA 3W1YC 2L9DA 3BR9A 4C8MA 4Q2LA 3K5LA 1R27B 4WCEQ 4B9NA 5DJBA 3HHLB 2OPPB 2EVZA 1Y5LB 4C0HA 4AL7A 3RW6A 4WP8A 1U24A 1VQ8S 1KRPA 3FKBA 1HBOA 2GO9A 2V69A 4OMFG 3P8BB 3N5BA 2R7WA 4JI3F 1XQIA 1X31C 4LT6A 3MI7X 5LJ5Y 3MUVP 4FKXA 1N5YB 4ZLNA 5GAGI 2Z30B 2FHMA 1YITS 1V3RA 3DDKA 1KVIA 4Q45A 3U1NA 2RUGA 4NLWA 1XIQA 1ZTTA 4K0KJ 1KN6A 2YX1A 2AMCB 4N47A 3TAQA 4ED6A 1RTZA 3M8QB 2EW9A 3G82A 2CZVC 3GV7B 7AT1B 2BDPA 3QWPA 3ZTOA 5H9EJ 1XTZA 1N88A 1F5BA 3G9CA 4ZPDA 1RWOB 1NJIT 2ZBIA 3TJ8A 2OEMA 1D9DA 4ETZA 3FNNA 1FWLA 2CQ2A 5EN1A 4RBUA 1C4CA 1KQSR 1BD6A 3HVWA 1T9WA 4FF3A 1U7LA 3MM5A 1KTQA 2JVOA 1HW9A 3DYAB 2J9CA 4QWDA 4C8LA 3QFWA 3PCOB 1G3OA 2FUG9 1G2EA 5A8RB 1CJVB 2BE7D 2IM3A 1UW9A 2OPPA 2YY3A 4UOHA 1HYSB 3BDPA 4DV4J 3AA9A 2XULA 1HD1A 3L7OA 3PDNA 5DLFA 1NSPA 1PYTA 1WF0A 3KK2B 4GO7X 3MAHA 3Q2SC 2WBMA 1KQGB 3BN7A 2PMWA 5E3RA 1KD1T 5KG3A 4IO1A 3TA0A 4PWWA 1FD2A 2HQDA 3SSQA 1XMQJ 4OJ1A 1ZM3A 4Q44A 4Q8FA 1ZS6A 2IA0A 3ZZOA 1Z4UA 2B7BB 4ENOA 3A8IA 4B9SA 2FJBB 1PJ7A 3PXGa 2GIQA 3HCXA 4F4AA 1H38A 1WG5A 3NP5A 1S79A 3M8QA 4TY8B 4KC5A 3PRVA 1VCTA 4BBYA 3MF5A 1BWEA 3UFCX 1S9FA 1AYEA 4UUWA 1AT1B 4YOEA 2L08A 4MK9A 4K4SA 2IA6A 5HVHA 1WNEA 3GV8B 5KT7A 4NLPA 3FZBA 1RAOA 1ULRA 4DS5A 2C3YA 1SH2A 2HHUA 3D66A 3DYAA 4RNOA 2ATLA 5T41A 4O0IA 5A8RA 1CJVA 3NBPB 5K8PA 2LDYA 1HYSA 4Y6IA 5F3TA 3OQ2A 4F4WA 5A2QU 1TV6B 5GAEI 4B3TF 3KK2A 3NGSA 4RW4B 5IZHA 3W62A 3THTA 4ZVSB 2QA1A 4DQPA 4RLEA 3MEDA 4G1IA 3CJQA 5HLFB 3TVKA 4FPIA 5KFUA 4FF2A 5IFMA 2GQQA 2LXUA 1GTHA 3U27A 2CQPA 5JUMA 2C2RA 3FDSA 2FJXA 3BO3A 2X1FA 1FNOA 1NZ8A 3T1HJ 4JV2A 1J5OB 1HA1A 3MOJB 2COLA 1Z2LA 3B54A 1IBLJ 3AFGA 2BJDA 2MJNA 4TY8A 2VA3A 4UQTA 3PKYA 3M05A 2DRBA 2VKRA 2WONB 1YX2A 1W26A 2B51A 3TEGA 4U7CA 3K7RA 1KBRA 1VR6A 2BJEA 2UVUA 2MZTA 1ZPVA 4DR2F 2PT0A 4ZVQB 3RR8A 1YHQS 3SFUA 1SKWA 5LMNF 3NCPA 1UTAA 2MY7A 2JLGA 2A2DA 3T3FA 3HKWA 4LF1A 2HLTA 5KT2A 2DGWA 5GADI 2J9DE 1FRIA 1WOSA 3BGFA 3LGHA 5HVFA 2AJFE 1X4EA 1U1OA 4DS4A 1X9WA 1T9VA 3NBPA 1S77D 1WEXA 3AXMA 1NPKA 2CADA 4G65A 3EGVA 4IH5A 1X9MA 1TV6A 2WOMB 5A6WA 4NE9C 4RW4A 2OHDA 2GIRA 3MDFA 1UFKA 3R7BB 5L39A 5HLFA 4NOHA 5LT5A 1KKHA 4YR2A 1M5SA 3UCZP 3SV4A 2P9GA 1X4FA 3NCQA 3PW5A 2BKOA 3KK3B 3SQGB 3SEOA 4YP3A 5A8KB 4W4MA 3NG8A 2WONA 3T9ZA 2U1AA 3ONQA 3MEEB 2XQCA 4GC7A 3JQMA 2KZMA 2HWTA 1GQEA 2F8EX 1SIWB 4L76A 3A12A 5DZ6A 4PABA 2WSCC 2L48A 1YLXA 3M1VB 4WZQA 1H6KX 1IQZA 4DU7A 3DOMB 1YRTA 5KFAA 2YPYA 1NKEA 2VBYA 5JVGQ 4UZCA 3CCVS 4PG8A 4OZJA 2I2YA 1DTTB 1SQFA 3AXKA 2DXDA 2KDOA 3EJMA 4QZVB 2K7JA 5KG4A 4WXWA 5KFXA 1RTIA 4XPEA 5D3GB 3V6KA 1LFPA 4JI0F 3HHKA 4OFZA 1K0VA 3TVYA 1QUPA 3BSCA 2WOMA 3ITHB 2O3DA 3R5DA 2FJVA 5HROB 3J80Y 3GG1A 2HHQA 1I94F 5ETSA 2JFKA 2MPUA 3CULA 2ADCA 1H98A 1FDBA 3V81B 3CDUA 3LW5C 1S4EA 3KK3A 2DRDA 1W2BR 1C1BB 4URGA 3SQGA 4DFJA 1PILA 4NA1A 5A8KA 4W90B 2Z58B 3AAWB 4M5MA 1B0VA 2AJ2A 2LYVA 8ATCB 1GMUA 3ENWA 4JI4J 1UEKA 2ZHAA 2YNIB 4Y2KA 2QC3A 2RVJA 3MEEA 2QGFB 3UD3P 1WUUA 3T1YJ 3M1VA 2C2DA 1U8SA 3JTPA 1Q53A 3CJ2A 4NRTA 4JI8J 4RUHA 4X66F 3DOMA 3BREA 2P2CB 3O6QA 1DURA 4EBCA 4ZVPB 1PSDA 1M0SA 1IQTA 5LXRA 2F9DA 2YNGB 2O01C 3G2XA 1T9XA 5KFZA 2H51B 1DTTA 1U1MA 4NI2B 4ECXA 1QM9A 1JLFB 1S49A 5D3GA 2ALYB 2FJWA 4B9TA 2F1FA 1NHKL 3ITHA 3J7AN 2RILA 3FUYA 1S9GB 1EX8A 5HROA 3N9UC 4J9MA 4QU7A 1FXLA 4KTQA 4S0MA 4ZPTR 3BGRB 2JEIA 3F44A 2B0GA 4PG6A 2E7XA 1SV5B 3V81A 1LXJA 1HBNB 3LANA 4R8UB 4BHQA 3TUZC 4IOAQ 1NH8A 1KWMA 1C1BA 5CD4A 3N6LA 3CPWR 1WD6A 1N32J 1I51B 2H5IB 2D74B 2AGQA 2ZH3A 1JJHA 2IBKA 4I6YA 1RKJA 2YNIA 1ELOA 3H5SA 4WYLA 1SVDA 3W2VA 5T14A 2XNRA 1Y5NB 5EDWA 3AJ2A 2F65A 3CC4S 1RWWB 2YNGA 4K4ZA 1NHUA 2LU1A 1C0TA 2YNFB 4ZLPA 2MZQA 4NI2A 1JLFA 4DEZA 4HACA 2XY6A 1BGXT 3I4PA 5THWA 3HLUA 4TQSA 2J0WA 1AUDA 1WC1A 1EAYC 1S9GA 3JXOA 2ZH2A 4OHXA 2UU9F 3JTOA 2A6MA 3CD6S 3NMRA 3BGRA 2NUHA 2POKA 4LF7J 4ZCKA 5DGBA 2ZH1A 4YMEA 4ZPWR 2IVYA 1ZAWA 1SV5A 4J9UE 3K0JA 1SB6A 1HBNA 1XBWA 4LSZB 4R8UA 4C4WA 2IPOB 3EGZA 1DQ9A 3HFZB 2FC9A 1P8GA 3J81j 4OV1A 1U1KA 1Y7PA 2CNOB 4ED3A 5CA5A 1DZ5A 2ZBCA 3CCJS 1O0PA 4DL5A 1XK8A 4NXMJ 1L3TA 3TYTA 3R7SB 5F8GA 4HTIA 3UN2A 4H4KA 4O23A 4ZJQA 2PA3A 4RNMA 5CZVA 3MXHP 5IQQA 5M2UA 1F60B 3PW0A 3O3LA 3G6XA 1X60A 4C3MA 2CJKA 2YNFA 4ZP9A 2NLWA 3MPDA 1Y00A 1RGVA 4R0EA 4C11B 1W7WA 1RLCL 1G7CB 4NYZA 3J7ZT 4PUOB 3KOAA 4DQRA 2R7OA 3MPVA 4DR6F 3PYFA 2WB1D 3IBWA 4GMKA 1LWEB 1MG7A 1AUSL 1XJWB 4DF4A 3MMAB 4OIXA 2XS7A 4IRDA 2CWXA 4C3KA 3R6LB 2E1PA 4NPOA 2G2ZA 4CH1A 5T7LB 1WI8A 3D9BA 3G6YA 3NLCA 2F9JA 4OYIA 3I5BA 4C2MA 2F4VF 5H9EK 3V4IB 3TOQA 1WG4A 3ISND 4UOFA 4WIQA 1CBKA 3FQKA 5KG1A 4ANCA 2GVDB 1N33J 1RT6B 4OLPA 1M5KC 4CLKA 1KVKA 4RR5A 5AE2A 1HNXF 2W9BB 2ILYA 4UZBA 2XM3A 3JYTB 4QYRA 1B4SA 2AEJA 3FCVA 1F9FA 3MECB 2DKOB 2PD1A 2OPQA 1FXRA 2AIRB 1FFSB 2NXJA 4CWBA 1F9EB 4DLEA 2M52A 4C11A 2JWNA 4TN2A 4G3IA 2V9KA 1HFEL 3FSXA 1T9UA 1LWEA 2J6TA 4RUAA 3MMAA 2WVDA 3ILLA 3W60A 4ED8A 2NZCA 3UPFA 4J9OA 1OPZA 4B9VA 2GFFA 1SL2A 5T7LA 2X1BA 4IDKB 3BYPA 4KGXB 3GCWP 4OX6A 1M1GA 3BQ0A 2C2MB 1QAIA 4LF9J 2QLWA 1RACB 1TL1B 1TMJA 2LECA 1CULB 3H20A 2QZ8A 3KXDA 2GVDA 3L7UA 1DY3A 4OZ1A 1RT6A 1IKYB 3ETMA 5DS7A 2UXDJ 4OI3A 1RE1B 1O8BA 4DV1J 2W9BA 4MIWA 4HKQA 4CT8A 4CIOA 3JYTA 2ASDA 3KNGA 1RBOB 2HS0A 1EETB 2LFVA 3MECA 3D6TB 2P6TA 4IQMA 1JXEA 1EIYB 1HW8A 2VH7A 1UKUA 1XN9A 3JTNA 1N52B 3H42A 1S1VA 1NDLA 2KJWA 2W4DA 3I9V9 2JH3A 8RUCA 2W7AA 3AOCA 4DV3J 1P27B 2BM0A 4USJC 2CPZA 1YRXA 4JI6J 5DG8A 2ILZA 3SI8A 3PYEA 3TANA 4DN0A 4ZOSA 4CYUA 2OMLA 2A0FB 1VGYA 2MB0B 2QLXA 3A1YG 4B3OB 4R0JA 2V8PA 5L46A 2LEAA 4M5GA 2NREA 2QE5A 4K5SA 4NLUA 4J9SA 4IDKA 3BBFA 5KFBA 2HS3A 2XHWA 2YKNB 1URRA 3ZFVA 2HHVA 5SUHA 3KYLA 3EDQB 2I8EA 4NZ6A 1CULA 3JAMU 2IY5B 3G96A 4DDFA 1IM4A 2HQ3A 1H73A 4PG7A 4ZN1A 2IM1A 2CQ0A 4A48A 3G8SA 2YQ0A 1RA6A 3RB0A 5AXLA 4PPDA 4FNHA 2BMBA 4OI0A 2R2TA 4WPAA 2OSQA 1EETA 4JI1F 1OO0B 2DNOA 4PG5A 3HT3A 2V63A 3ZTPA 1S0NA 4ZVGA 1AA1B 1RCXB 2DGQA 1Z2ZA 2RU9A 4K4XA 2OMOA 1GAOA 3UWTA
chains in the Genus database with same CATH topology
3L4BC 1LNQA 4YS2A 4RO0A 3KXDA 2AEMA 2FY8A 3RBXA 4J91A 4L76A 1VCTA 2AEJA 4G65A 3RBZA 4J90A 2BKPA 4J9VA 4EI2A 4XTTA 4J9UE 2OGUA 2BKNA 4GVLA 2AEFA 4L74A 3JXOA 4L75A 4L73A 4J7CA 2BKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4B C;  1LNQ A;  4YS2 A;  4RO0 A;  3KXD A;  2AEM A;  2FY8 A;  3RBX A;  4J91 A;  4L76 A;  1VCT A;  2AEJ A;  4G65 A;  3RBZ A;  4J90 A;  2BKP A;  4J9V A;  4EI2 A;  4XTT A;  4J9U E;  2OGU A;  2BKN A;  4GVL A;  2AEF A;  4L74 A;  3JXO A;  4L75 A;  4L73 A;  4J7C A;  2BKO A; 
#chains in the Genus database with same CATH topology
 3W2W B;  4AFF A;  3AD8 C;  2BYC A;  4CM0 A;  2W9A A;  4JYA F;  4ZLJ A;  4WE1 B;  1TP7 A;  2RDJ A;  4Q2M A;  1VQ9 S;  2Y1J A;  4B3O A;  3BH7 B;  4URQ U;  4QIE A;  4Q43 A;  3TJ9 A;  5DDQ C;  2AJ1 A;  1WWH A;  2J76 E;  2YKN A;  1EQM A;  3UQS A;  1NK9 A;  5K8N A;  3OD2 A;  4NLT A;  3MFI A;  1TL7 B;  3Q8V A;  4ZMM A;  5IT4 A;  4OZ3 A;  2HBY B;  3IWL A;  2KXH A;  1S72 S;  2FJD B;  4I7F B;  4DX8 H;  1V3S A;  3HKZ D;  2JLE A;  1K1S A;  2P8I A;  5D0H A;  2EXU A;  4PR6 A;  3V6J A;  4B3S J;  3CME S;  3EZU A;  5IS2 A;  3N5F A;  2MQ8 A;  1UFL A;  2ZH7 A;  3HD2 A;  5D0E A;  2XI3 A;  5DLG A;  1JXL A;  1A6L A;  4NWB A;  1IBL F;  3F0N A;  3GV5 B;  3JSY A;  2V6A A;  2FVC A;  1RZM A;  3P4U B;  1IM6 A;  1H2V Z;  4ZVR B;  4C8K A;  2R7V A;  3QWU A;  4FN5 A;  2HZA A;  1YK9 A;  3H5U A;  4NLG A;  3G6V A;  3W2W A;  1U45 A;  1R43 A;  4OZN A;  1RA7 A;  1UZH A;  1NK4 A;  2MKK A;  1TTH B;  2VG6 B;  3DOK B;  1Q81 T;  4DR3 F;  1QD1 A;  1X5P A;  5IT9 U;  4WE1 A;  3EDR B;  3NXZ A;  3RRK A;  4DR1 J;  3VAF A;  3TUI C;  3PR4 A;  4LBI A;  1S48 A;  1KSP A;  3D0I E;  1FD8 A;  2KKH A;  1YZ6 A;  4Y2A A;  3E01 B;  1TFW A;  1TL7 A;  2A18 A;  2YWK A;  1WC5 A;  4P6Q A;  4A4J A;  2A6O A;  4X4S A;  1FRM A;  4FYV B;  3UNG C;  4ED0 A;  4TU7 A;  1I6J A;  4ECS A;  2DB1 A;  3HJF A;  3QGH A;  3GWC A;  2D3O 1;  4LR9 A;  1EB0 A;  1JLC B;  4A8K A;  4F0H A;  4ZIV A;  3RAM A;  5KFQ A;  5F8I A;  2N3O A;  1CVJ A;  4NLX A;  2QYC A;  3FEY B;  1FCA A;  4LF2 A;  1TAQ A;  3VAH A;  5K8O A;  2DGV A;  4WK1 A;  2KU7 A;  2R8J A;  1DTQ B;  3OSP A;  5I4M A;  3TO8 A;  3WIV A;  1VQM S;  5K5M A;  1OS5 A;  1QY7 A;  4F0K A;  2VG6 A;  3DOK A;  2Z2Z A;  4OX9 F;  5D4P A;  2JC1 A;  3N6M A;  2JSX A;  1N5Q A;  1HD0 A;  4OYW A;  2CAJ A;  1CJU B;  5RUB A;  5CH7 B;  2DVI A;  2AZ1 A;  4LRC A;  5LMU J;  3PHE A;  3NGR A;  3E01 A;  3H4B A;  4YY3 F;  5HBM A;  3AOD A;  5I3U B;  2LXF A;  4U96 A;  2XMK A;  2XMA A;  1N6Q B;  1WEY A;  1ROF A;  1Y3K A;  3TR5 A;  2DHS A;  4DN9 A;  2XZT B;  4J9R A;  3S8S A;  1Y9O A;  2ZOG A;  1RAF B;  3FK4 A;  3M8R A;  1HQU B;  3TZX A;  2YNH B;  1V9O A;  4FVC A;  1JLC A;  4ERD A;  3Q2T C;  1TK5 A;  2EC0 A;  1KOO A;  3DHX A;  1BXN A;  4P2F A;  2RRN A;  1LQ9 A;  4LFB F;  4J9V A;  4DPT A;  3CDB A;  3V6H A;  4KE5 A;  2ZWP A;  4I69 A;  4MK8 A;  3RZA A;  3DU5 A;  4J7C A;  1TUW A;  1FDN A;  3ENQ A;  2OEJ A;  3DFE A;  2PMH A;  3M2V B;  2AU0 A;  4LR7 A;  2HSE B;  5HVG A;  3BS9 A;  2KM8 B;  3AY0 A;  2D7S A;  4N56 A;  2CZ4 A;  2OIH A;  4A8Q A;  4UY8 5;  3P45 B;  1CJU A;  2V4J B;  1T0T V;  3LF0 A;  3O1L A;  2XLI A;  4NMX A;  2BAN B;  5J1P A;  4GKJ J;  4HDG A;  3CCQ S;  4TY9 A;  1XNQ F;  2QV6 A;  3NOG A;  2E1C A;  2DHA A;  3OJS A;  2W2P P;  5I3U A;  1F2G A;  4QPT A;  3GIJ A;  4CO4 A;  1RT2 B;  4MK7 A;  1N6Q A;  2E9Z A;  3I5A A;  4NCG B;  1NPR A;  2UP1 A;  2ZKT A;  3DN9 A;  4CLF A;  4C8Z A;  2BJ8 A;  1RTJ B;  2XO7 A;  1E6Y A;  1VBZ A;  5AT1 B;  1HQU A;  4KHR A;  2YNH A;  1KS2 A;  4K2X A;  2QLJ B;  2PFD A;  4AYB D;  5KFT A;  2DO0 A;  1RHK B;  4XDC A;  3I96 A;  2R2R A;  5L1J A;  2KH9 A;  2NQP A;  4EGL A;  3UE2 A;  4DL4 A;  2XZD B;  5D0R A;  2JRS A;  3C6T B;  3M2V A;  2GAG C;  1H72 C;  2M7S A;  1CSJ A;  3TW0 A;  4WU2 A;  3CO0 P;  1U1P A;  5GMK a;  3TNV A;  4ZVU B;  3VR1 A;  2RUS A;  3VCD A;  3LO3 A;  2VJV A;  4NYP A;  1R0C B;  4ATN A;  1H3D A;  3NL0 A;  1BLU A;  1SKR A;  1ZA1 B;  2ROE A;  3B8H A;  4IKA A;  4ZJL A;  5DO2 A;  5A6P A;  2VHG A;  1D1U A;  3DRR A;  4I6W A;  1QE1 B;  2GZO A;  1RT2 A;  4CLL A;  2Z57 B;  5B08 A;  3AT1 B;  2ACM A;  4P9S A;  1T95 A;  4NCG A;  4IFY B;  2GS8 A;  2VDH A;  1UVN A;  2FGO A;  3M8Z A;  3QT5 A;  3OVB A;  1KVJ A;  1F3V A;  1RTJ A;  2FVR A;  4DV5 F;  4JI3 J;  1VIS A;  1WHV A;  2E7V A;  2KO1 A;  5I42 B;  5KFE A;  1DLO B;  3GJT B;  4CTA B;  1HNW F;  5K9F A;  4WZM A;  4Y34 A;  1PO6 A;  2RQC A;  4JV1 A;  3T5H A;  4DX7 A;  1RI7 A;  2YWW A;  1NB7 A;  1DJ0 A;  3KG1 A;  3ELH A;  2KJV A;  4LUB A;  2RJZ A;  4JI7 J;  2V8G A;  2F5G A;  3ZNJ 1;  3C6T A;  2HRY A;  4C97 A;  2IRY A;  2P6S A;  1ZA2 B;  2J0Q D;  2PA8 D;  5KFO A;  2PFF B;  2WVE A;  5D4N A;  3DNC A;  3IGV A;  1KFD A;  3M32 B;  3HT0 A;  1WC4 A;  3TI0 A;  1N54 B;  3LH2 S;  1RCO B;  3IWN C;  3B82 A;  1PAE X;  2GHW A;  1QE1 A;  2F4F A;  3I4H X;  4B02 A;  1QTN B;  4E98 A;  4DFM A;  1D0E A;  5D8H B;  1ZM9 A;  1S1U B;  4IFY A;  2M88 A;  3J80 U;  2DR7 A;  3THV A;  1SXL A;  4YR0 A;  2CWK A;  2RDD A;  5F9L A;  1DLO A;  4CTA A;  5IM0 B;  1UVL A;  3WQP A;  3KLH A;  1U49 A;  2BE2 B;  3O2I A;  3LPE A;  2VIC A;  3DGP B;  2WTF A;  3GON A;  1FO1 A;  3V5R A;  1TFY A;  3PW2 A;  4J9L A;  3WX4 A;  1LXN A;  2VKZ G;  2EFG A;  1X5O A;  4YN3 B;  5KFS A;  3BM7 A;  1X4D A;  4BLG A;  5IT0 A;  2N82 B;  1XEZ A;  3NGU A;  3CMA S;  3HJV A;  1W25 A;  4QWA A;  2H4W B;  3HZE A;  2GCF A;  3LGM A;  2ZH9 A;  3CE8 A;  2HQC A;  1GX6 A;  4IUF A;  3ADA C;  4DF8 A;  2DR5 A;  4WFN Q;  3MD3 A;  3LP2 B;  3T41 A;  3MTJ A;  2KT2 A;  1L3U A;  4USH A;  5K8M A;  3M32 A;  1GEH A;  3HHN B;  1KFS A;  4M5H A;  3OL8 A;  1BMQ B;  3OTB A;  1TAU A;  3KJQ B;  4K4Y A;  3I56 S;  4MFB B;  2DHH A;  3MHY A;  1FRJ A;  4CO3 A;  4W98 A;  1YSJ A;  1RU2 A;  2QTW A;  4PWU A;  4M5J A;  1XNR J;  4RU9 A;  3OFH A;  1S1U A;  3K58 A;  5H9F J;  3GFH A;  1WAC A;  4KPC A;  4IR9 A;  5KOW A;  1IR0 A;  3F73 A;  2EK6 A;  4B3T J;  1I3O B;  1IR2 A;  2O66 A;  2BQ3 A;  4AND A;  3HHD A;  5IM0 A;  2G0C A;  2RS2 A;  2BE2 A;  2H1Y A;  7FD1 A;  3DOL B;  3DGP A;  3BBB A;  4ID8 A;  3TUP A;  2VOD A;  2JFD A;  3SMZ A;  4DV1 F;  2CPF A;  1UPP A;  2ACY A;  3MM7 B;  1FE0 A;  4ZS6 A;  4BDP A;  1B99 A;  3HPO A;  2DCL A;  1QJH A;  5KFP A;  1NK8 A;  5L1K A;  3UVJ B;  1APS A;  3CWJ A;  2WAQ D;  4M5I A;  3QNW B;  3TRG A;  4FBU A;  2H4Y B;  3H4D A;  3EGW B;  5LOQ A;  2D69 A;  2DNM A;  2I6W A;  3LP2 A;  2V4R A;  1L3S A;  2B56 A;  1FJG F;  1ZZN A;  5LMN J;  5B09 A;  2E5L F;  4ES3 A;  5AE3 A;  1RDR A;  4F4Z A;  3M2R B;  4NCA A;  1MWQ A;  1PCA A;  3BV8 A;  1R6V A;  4MFB A;  1N48 A;  2VFR A;  4FVM A;  4FS2 A;  4OI2 A;  1RT3 B;  2HND B;  2C2O B;  3THP A;  2NXC A;  5G4D A;  1UET A;  4X4N A;  1BUX A;  3LAM A;  2DIS A;  4NLR A;  3CCL S;  1RIS A;  4K4V A;  4UOG A;  2V2Z A;  2B5J A;  1WEZ A;  2MEW A;  3FRY A;  2LEB A;  4OV6 A;  4DPO A;  3S01 A;  3IG1 B;  2SXL A;  1KEK A;  3GYG A;  5HAT A;  2J5A A;  3DOL A;  3L7P A;  4P73 A;  4WWS A;  2DTJ A;  1F5C A;  1QVG R;  4NYO A;  3RAX A;  3MM7 A;  2E9R X;  1HHS A;  3PX6 A;  3B78 A;  2JNJ A;  3UVJ A;  1WKL A;  1N34 F;  3CF5 Q;  1T9Y A;  1Q86 T;  1FF2 A;  4L73 A;  3D6F B;  2OTL S;  2IYG A;  2K1R A;  1IKV B;  4RWX A;  2CQ4 A;  4KHP F;  2Y8Y A;  4PXE A;  2BRK A;  2KYZ A;  1RAD B;  1O6X A;  4OI4 A;  3MEG B;  4ETX A;  4ITS A;  3EXC X;  1WC6 A;  2BW7 A;  3C15 B;  1NK7 A;  1WTF A;  1X5T A;  2DH8 A;  4DV6 F;  5J2Q A;  3M2R A;  3NGT A;  3PTW A;  1TU0 B;  4ZK7 M;  2XCP A;  1BHN A;  3A4T A;  1RT3 A;  2FHJ A;  2HND A;  3VQS A;  3M9N B;  3HM9 A;  4AL6 A;  3BR8 A;  2EFP A;  5ETL A;  4JI0 J;  4AE5 A;  2QFJ A;  1VOM A;  2E7W A;  4LRE A;  2K2P A;  1YZ7 A;  5HAO A;  1EP4 B;  1I94 J;  2HG4 A;  1Y10 A;  2ZDP A;  4YDD B;  4P52 A;  2EFO A;  1GK8 A;  2HIQ A;  2QYG A;  2EWH A;  3AQP A;  3QQC D;  3KMS A;  2MKH A;  5F3Z A;  2HGM A;  4A8S A;  3OHA A;  2B6A B;  2AD9 A;  4LQ9 A;  4B3S F;  2GJ2 A;  1VYA A;  1WHX A;  5G0R B;  1VMB A;  3NRB A;  2I1R A;  4MKY A;  2MQN A;  2VPY B;  2L9N A;  1IKV A;  3PIO Q;  1T7P A;  3SXL A;  2AYB A;  1TL3 A;  2IM0 A;  2R7U A;  3QMQ A;  2XCA A;  2VF3 A;  4YHH F;  3R5B A;  3MEG A;  3NEK A;  3C15 A;  3HHL D;  2RAQ A;  4CLW A;  4NLO A;  5LL6 d;  1VBX A;  3K2Y A;  2W4C A;  3R5A A;  1VS3 A;  1VQY A;  5IV3 A;  4P10 A;  2VG5 B;  2GQ2 A;  4F7V A;  3D0H E;  3QAE A;  1LK5 A;  1GTE A;  2AHO B;  2YKO A;  1VC5 A;  3QIP A;  3KG4 A;  4CP5 A;  4N7T A;  1LOU A;  4KO0 B;  2I38 A;  4AQY F;  1EP4 A;  2ZBP A;  3PV8 A;  4X2B A;  3GTY X;  2ZZT A;  1EQ0 A;  4OZ2 A;  3CJ3 A;  4U8Y A;  3QSI A;  2BQR A;  4CM2 A;  2UVW A;  3TZY A;  2HW3 A;  2DNK A;  4CI0 B;  1S97 A;  4QWB A;  2BXJ A;  2FHO B;  4NEY A;  4UUX A;  5L9X A;  1HR0 F;  1FRL A;  1FK9 B;  1K73 T;  1JJ2 R;  1X9S A;  3N0V A;  5G0R A;  4ALZ A;  1ZZF A;  4ZCL A;  2MZ1 A;  2K3K A;  4YB1 P;  1K47 A;  4A8Y A;  1DBD A;  1XMO F;  2I9S A;  4CLZ A;  1CQN A;  3LWL A;  2XI2 A;  5HO4 A;  3O5T B;  2WHO A;  3BN4 A;  1KDN A;  1HWU A;  5EUH A;  1RWM B;  2HQI A;  2WCX A;  2CVI A;  4U7U K;  3FBE A;  2WVF A;  3EWG A;  5KG6 A;  2VG5 A;  1NEE A;  2RKI B;  2HHW A;  3R6G B;  3GYX B;  3KHH A;  4PQA A;  1URN A;  2AX1 A;  2LU2 A;  3NCR A;  3C3L A;  2B9W A;  2EFV A;  4DG1 B;  4P75 A;  3SIP B;  4KIA A;  5AJ3 F;  1FHT A;  2CA9 A;  2KN4 A;  3BSA A;  3AH6 A;  4K8R A;  1I1G A;  4DL3 A;  1NB2 A;  3AOA A;  3R2D J;  1VQN S;  2K3I A;  4QR1 A;  3A3N B;  2CQB A;  2Q3P A;  4EO6 A;  2F63 A;  2MZS A;  1LWX A;  2RF2 B;  3RBD A;  4A46 A;  4USM A;  3LAL A;  1FK9 A;  2C3O A;  3GG0 A;  4FS1 A;  2UUB F;  1FRK A;  3ISN C;  1VBK A;  3CCW A;  4CRJ A;  1KR4 A;  4QIW D;  2HVI A;  4ELV A;  2ZH8 A;  1GMW A;  2B4O A;  2EFN A;  4HI1 A;  1K8A T;  3GR1 A;  3SV3 A;  2Z2Y B;  1GT8 A;  1V5I B;  2R7R A;  3VAM A;  2DO4 A;  3AJ1 A;  3PX0 A;  2UVV A;  5DQI A;  1SKU B;  2KXN B;  4URS A;  2RKI A;  2IAJ B;  1K44 A;  2FLO A;  1U1N A;  2W7O A;  4QWC A;  2VD3 A;  1LWC B;  4DR6 J;  2GGP B;  1RB0 A;  3PIP Q;  3JQK A;  4P7V A;  1VDH A;  3CJT A;  4DG1 A;  1SC3 B;  2FLP A;  4C9D A;  3W9J A;  1UEV A;  2QIF A;  4LVO P;  2YWE A;  4USV A;  1M90 T;  1U09 A;  3V2U C;  3V6D B;  1U8W A;  1OQ6 A;  2O67 A;  2V94 A;  1RTD B;  3EX7 B;  1JWW A;  2RRA A;  2MKI A;  1CC8 A;  3FSY A;  2RF2 A;  1JJ4 A;  2F4V J;  4WXO A;  4LRB A;  2WRM A;  3MAA B;  1MWZ A;  4EYH B;  1HI1 A;  2CQ1 A;  1RYR A;  2Z2M A;  1RQ0 A;  3RRG A;  4TU8 A;  4QR2 A;  3RR7 A;  3H0P A;  2KFN A;  3O8W A;  4C8O A;  1HNX J;  4OYX A;  4RL1 A;  4Q8E A;  2HWI A;  4KR0 B;  5E3P A;  1CQM A;  2BJ1 A;  1P1T A;  4DV2 F;  2JEF A;  2NSC A;  3I9Z A;  4JBC A;  4LF6 J;  3H25 A;  4UQG A;  3KTQ A;  4F4K A;  1RHJ B;  1FX2 A;  4OYA A;  2BQU A;  3QFH A;  3ULH A;  3K89 A;  3LUY A;  4DV0 F;  5A2Q Y;  3KLF B;  3AD9 C;  2DR8 A;  3W9I A;  1LWC A;  6FDR A;  3VHQ A;  2GGP A;  2MKJ A;  4ECT A;  4JB8 B;  5KT3 A;  3UW1 A;  2BOP A;  3F41 A;  3UD4 P;  2ZM6 J;  5EX3 A;  3HUL A;  4IQX A;  2JOQ A;  4I6A A;  1FNX H;  3SCK E;  4K5R A;  3TX0 A;  4TQR A;  5DM6 Q;  1RTD A;  4DSL A;  3CW2 C;  2P9C A;  3PHT A;  5J1N A;  3AD7 C;  2MSS A;  2RU3 A;  1JQG A;  2G1H A;  3WBZ A;  1A0O B;  2KHC A;  4ZJO A;  3QRR A;  3MAA A;  2AQ4 A;  3S7R A;  4TYB A;  5HQM A;  4DV7 F;  4Y65 A;  3FMW A;  3Q89 A;  2CPX A;  2DRA A;  4USW A;  3PAC A;  4RBV A;  5GMD A;  3PJX A;  4NA2 A;  1RHQ B;  4X4V A;  3DLJ A;  2A10 A;  1K9M T;  1BQN B;  3HMJ G;  3OLA A;  3E51 A;  4IO9 Q;  3J81 U;  1N56 A;  3LTO A;  5DM7 Q;  4JI7 F;  5I3P A;  4NLD A;  1TQL A;  2BKP A;  5H9F K;  2HMI B;  4B08 A;  3DXB A;  3KLF A;  3M8W A;  2DGO A;  4HHU A;  1NM2 A;  2AGP A;  3RBZ A;  1VQS A;  3VVU A;  2CPJ A;  2Y9H A;  2DY1 A;  5CAB A;  3TAM B;  2XHC A;  1RXO B;  1HPZ B;  2JHE A;  3Q8U A;  1MMN A;  2IIH A;  3M4X A;  2Z4P A;  3A8J A;  4M8L A;  1VIO A;  2QFI A;  2ZJR Q;  1SJ3 P;  1NAQ A;  1FI4 A;  3MM9 B;  2OSR A;  3NY0 A;  3HHL A;  3E3X A;  3MZI A;  5C5J A;  2ZHB A;  4DMZ A;  4PAA A;  4UST A;  2MDA A;  1KC8 T;  3CCM S;  2MQO A;  2VBW A;  1QSY A;  2QN6 B;  1N5Y A;  1IJE B;  1U1R A;  1X5S A;  4XO0 A;  1WSV A;  3VGV A;  4MKV A;  4KGM A;  4PXB A;  4U67 Q;  3K5O A;  2AF6 A;  4EMD A;  5E3Q A;  3NS7 B;  3MR2 A;  2IMO A;  2J8S A;  3VAJ A;  3R2C J;  4XTT A;  5E7O B;  3P6Y C;  4QIV A;  1FVS A;  5KFY A;  1Q0N A;  3P49 B;  4JI1 J;  2B8P A;  2ALZ A;  2AYM A;  4ID5 B;  2LLZ A;  2HMI A;  4I68 A;  1CS4 B;  2ZZN A;  5EHH A;  4Q0B B;  1JK9 B;  2BUN A;  1YBA A;  3ZZT A;  1U2C A;  2C1E B;  2VFU A;  3C6U B;  2EPI A;  3E8O A;  2RQK A;  5BJR A;  4ZVH A;  1JMT A;  4DX6 A;  1FJ7 A;  3B4D A;  4XDD A;  5B7W A;  4BWM A;  4G1P A;  4O44 B;  3ETO A;  1QVF R;  3H5X A;  3TAM A;  3D3B J;  1Y4Z B;  2KVQ E;  4KRW A;  4JYA J;  4X4Q A;  1SI9 A;  1S59 A;  1P9Y A;  4GKK J;  3A8E A;  5F8L A;  1NDP A;  1HWI A;  3UR3 C;  3MM9 A;  3EGN A;  5B0D A;  1XNR F;  1FKA F;  1TMM A;  2RSQ A;  3NNC A;  4IH6 A;  4F50 A;  4LQ3 A;  1BE4 A;  3WZ0 A;  4DZ6 A;  1MSW D;  1J2V A;  4LBH A;  2ZE2 B;  2DNQ A;  1VC6 A;  4WII A;  1R0B G;  2YPZ A;  2WW4 A;  1U47 A;  2F8M A;  3IP0 A;  1RLD A;  2GML A;  4FF4 A;  1LW0 B;  3N28 A;  3VTI A;  4ER8 A;  2BBE A;  2CPI A;  2IJR A;  4CH0 S;  2RS8 A;  2J7U A;  4X4R A;  4TVA B;  4RPF A;  3MAQ A;  3DLL Q;  1MN9 A;  1KNZ A;  4QYZ J;  1XMB A;  2ZVS A;  4ID5 A;  2XNQ A;  2KB2 A;  4PZV A;  5B0F A;  1CS4 A;  2XMW A;  1MLA A;  4F25 A;  4Q0B A;  1IWG A;  3C6U A;  2JVR A;  3OFE A;  2R7T A;  4WBF A;  1MMD A;  2GX8 A;  4O44 A;  2FYX A;  4WKR A;  3CJ5 A;  1S7I A;  4AD6 A;  4DR3 J;  2IHR 1;  5F9N A;  2NXN A;  3PG9 A;  1S6P B;  2HK3 A;  2RH3 A;  1S6U A;  2ADB A;  1X7V A;  4YB5 A;  4QOT A;  4NXN F;  5LSO A;  1IKX B;  2CPY A;  5B0G A;  5L9N A;  4IRC A;  2ZE2 A;  3OXF A;  3QJJ A;  4MT1 A;  1YJV A;  3VAL A;  1NXI A;  2AWZ A;  3FEX B;  4DCJ B;  5L1L A;  3M6W A;  4P2X A;  2VPZ B;  2HAI A;  3S6E A;  1L3K A;  4ED2 A;  4DR4 F;  4IR1 A;  3A13 A;  4K4W A;  3GP9 A;  4OJ3 A;  5MAO A;  1J5O A;  2LEP A;  3L3C A;  2VBX A;  3FQL A;  8AT1 B;  2VPW B;  2VQF F;  2V2V A;  3N01 A;  1YVF A;  2V4Q A;  4HEA 9;  1G1X A;  3M30 B;  4AXJ A;  2RQM A;  1S1X B;  3D6M B;  4AUK A;  1R3N A;  3J7Z 5;  2MLX A;  3K17 A;  1U48 A;  1S6Q B;  4W92 B;  4OI6 A;  2AYE A;  2DNH A;  1HQ2 A;  3W61 A;  1S99 A;  1DAR A;  1YJN S;  3W7B A;  3OW2 R;  4OX9 J;  1NO8 A;  1S6P A;  3BDE A;  1XC9 A;  3GE9 A;  1IBC B;  3M8Y A;  3EMT A;  3C66 A;  4EEY A;  1TEL A;  1YJ7 A;  2ZD1 B;  1WOR A;  1IKX A;  4HL9 A;  1UVJ A;  4YY3 J;  3VV2 B;  4LF5 F;  2KI2 A;  4HH1 A;  3IO1 A;  3S1T A;  2VV5 A;  4LMZ A;  2CPD A;  2QA2 A;  3K59 A;  4N77 A;  4HLB A;  1YQH A;  3BZQ A;  2BV3 A;  3H7H B;  1M5P C;  2W8L A;  2B4P A;  3A3O B;  2Z8Q A;  1NH7 A;  2DNY A;  4IG3 B;  4OLO A;  4J9Q A;  3IS9 B;  2MYF A;  4X64 F;  1IBK F;  4OHY A;  2APO A;  3CJ0 A;  3G87 A;  1U25 A;  3PYD A;  3M30 A;  1B64 A;  2NZ4 A;  4CO2 A;  1SC4 B;  1S1X A;  4LFB J;  4OHZ A;  2HBQ B;  3BKT A;  2E1M C;  2ASL A;  2VB6 A;  3GB0 A;  3GIK A;  5D6G A;  2NSB A;  4OYZ A;  3TA2 A;  1S6Q A;  1D09 B;  1PBA A;  2DIU A;  3VZI A;  3P3D A;  4ED4 A;  3DLK B;  2ZWO A;  4NLQ A;  3WDO A;  3K5P A;  4KBI A;  3TEH B;  3US5 A;  1XWL A;  5L38 A;  4UTG A;  1H2U X;  3EIC A;  2W7P A;  1VFJ A;  3I31 A;  2ASJ A;  4JV5 F;  3CED A;  3WC0 A;  5J2M B;  1HBM B;  2WZ1 A;  2ZD1 A;  2G13 A;  1RYS A;  2RQ4 A;  4CNY A;  1AFI A;  2DIT A;  4C7Q A;  1XNQ J;  1UPM B;  4DSJ A;  2KT3 A;  4ZVE A;  2IFX A;  5A76 A;  3OT9 A;  3D6H B;  4B9M A;  1U6F A;  3PFE A;  2D1C A;  2B8Q A;  1WG1 A;  2FTR A;  1HNZ F;  4IG3 A;  1WKJ A;  2G4B A;  3MD1 A;  3N4W A;  5E0O A;  2J8A A;  4TU9 A;  1Q5V A;  1KQK A;  1TUV A;  4M5N A;  2DT9 A;  1Q16 B;  1WF1 A;  4LR8 A;  1YBT A;  4KKO B;  3OV7 A;  1NJY A;  1OIA A;  5HQL A;  4LRF A;  3Q23 A;  3KJF B;  5F8N A;  2IJN A;  1UWA A;  3ISZ A;  1HLW A;  5CYM B;  3EPI A;  1V5V A;  3DLK A;  4YDX A;  5IOL A;  3TZZ A;  1R0A B;  2R2S A;  3MR7 A;  4O3N A;  3MR3 A;  4LFA F;  5DDO C;  2LXI A;  3QO9 B;  1S5Z A;  3TJA A;  4HDH A;  3CC2 S;  2KXF A;  2NYH A;  4J37 A;  5J2M A;  1HBM A;  1ZH5 A;  5KG7 A;  3H2V E;  4X65 F;  3NMA A;  5K14 B;  4N5S A;  4P2M A;  6AT1 B;  3UDE A;  4A8W A;  1IBM F;  3E2E A;  4QIF A;  1SH0 A;  1OY8 A;  4CNZ A;  1FXD A;  1TKZ B;  1KQF B;  2J0S D;  3J7A 1;  2V34 A;  2ZH6 A;  3WC2 A;  4DV5 J;  4X62 F;  2ZZM A;  3R8Y A;  1HNI B;  2IDL A;  1HNW J;  4ILR A;  1JLA B;  3DMJ B;  1WOP A;  2J9E A;  5DG7 A;  1RAG B;  4L3N A;  2YKP A;  4KKO A;  2BA9 A;  1HKA A;  4EK2 A;  2HFO A;  3WHI A;  3UR0 A;  2QMU B;  2WBR A;  4RO0 A;  3H98 A;  4QQB A;  2CYY A;  3ZZP A;  3GLJ A;  4MKA A;  4RBT A;  4DPU A;  5CYM A;  4CLP A;  2C3P A;  2QL5 B;  4Y0F A;  1R0A A;  3G4S S;  3PRB A;  5GVQ A;  2V50 A;  2HRU A;  2RHQ B;  4IRK A;  5HJX A;  1VJQ A;  3QO9 A;  2OD6 A;  3CCU S;  5MLC V;  2HHT A;  1VQ4 S;  1SQE A;  2EK1 A;  3CD5 A;  4GVL A;  3FFI B;  1PJ5 A;  2RML A;  1T05 B;  3JAM Y;  2HFN A;  1UVI A;  3RB6 A;  5K14 A;  3KHG A;  5ETM A;  2NYI A;  3G71 S;  3RW7 A;  4LFC F;  4PQU B;  3QJL A;  1RBL A;  1TKZ A;  1N5V A;  2DNP A;  4C0O C;  3LWM A;  2BJ9 A;  5CD4 H;  4K2J A;  4DX5 A;  3FSI A;  2XTJ P;  4ED7 A;  3VVT A;  2ZUG A;  2VC0 A;  2U2F A;  2VON A;  4TYA A;  2R8G A;  3UCU P;  3I5C A;  3G8T A;  2UV8 A;  1N0U A;  2XYP B;  2B3T B;  3KK1 B;  7FDR A;  2JEJ A;  2NPF A;  1JLG B;  4DOZ A;  1HNI A;  1H2T Z;  2DEJ A;  4JI5 F;  2GMH A;  3SCJ E;  4Q7A A;  3C14 B;  3CDA A;  2H9Z A;  2DNN A;  1JLA A;  1GH8 A;  3MPU B;  4QJV A;  4O3P A;  5HMX A;  3QGP A;  4ZPB A;  2VOP A;  2HZV A;  1Q7Y T;  3RJM B;  4L74 A;  2L9W A;  1SCJ B;  2W2O P;  4HYK A;  4O4R A;  1NSK L;  3GSD A;  3EUN A;  2LVW A;  2X51 A;  3BQ1 A;  3DC2 A;  3DRX A;  4U8V A;  2Q1L A;  3NWR A;  3ZC4 A;  4WFA Q;  4LF6 F;  2IRU A;  5L1I A;  2HBZ B;  4WFZ A;  5JMN A;  2CJQ A;  1ZET A;  3RAQ A;  2Z0G A;  5A8W B;  4RW8 B;  4PUO A;  2YKQ A;  2X3G A;  2W24 A;  3FFI A;  1T05 A;  2EBE A;  3K57 A;  3GQC A;  3VZH A;  1B0P A;  3HHE A;  2N4C A;  1YRU A;  3I6P A;  4DFP A;  3NS6 A;  1UW4 A;  2WB4 A;  2C2K B;  4PQU A;  3HK2 A;  2AEM A;  2BM1 A;  2AJ0 A;  3DXS X;  3L9Z A;  2ZM6 F;  1NND A;  3D67 A;  2R4F A;  3HF5 A;  4ES2 A;  1JXV A;  1UA0 A;  4F36 A;  1UCN A;  2N4D A;  1Q4R A;  2W2N P;  2UXC J;  4OYM A;  4DUY F;  4DR7 J;  3FBB A;  3KK1 A;  2QJ3 A;  1VHI A;  3KG0 A;  1JLG A;  2K06 A;  3V4I A;  3CJK B;  3C14 A;  4RNN A;  2DNZ A;  4YB7 A;  1FWK A;  2X3D A;  3D54 A;  2R7Q A;  3DLE B;  5IWA J;  1TKD A;  3KNA A;  4OZ0 A;  2CDR B;  3OL7 A;  3ILJ A;  4UF4 A;  2CKW A;  1SJR A;  5IT9 Y;  4FF1 A;  3P96 A;  3M6X A;  3RTV A;  1NJW A;  4BC9 A;  1WC3 A;  1SJ1 A;  2FZC B;  4ZP6 A;  1K1Q A;  2E9T A;  2JC0 A;  2W2Q P;  2CNK B;  5A8W A;  4RW8 A;  2B4U A;  5ETT A;  1FJG J;  2HHH F;  3FCH A;  1PBU A;  4O3R A;  2DPJ A;  3MMB B;  2E5L J;  4NZ7 A;  2CZ9 A;  3R5G A;  3MUT P;  1VRT B;  3HX9 A;  3VAI A;  4DPY A;  3OR1 B;  3BJY A;  4J9P A;  4P71 A;  5AXN A;  2HRT A;  1IN0 A;  1SH3 A;  4F26 A;  2HQF A;  4NA3 A;  4PWD B;  2HVH A;  4QYZ K;  2PEH A;  2DXF A;  3BSO A;  1YDL A;  3W65 A;  2ZC3 A;  4E8U A;  4ZCI A;  4LIR A;  4HR2 A;  4B9U A;  3BB5 A;  1JLB B;  1J5E F;  2CPE A;  4NCB A;  3EM1 A;  3POT B;  3CJK A;  3ZTS A;  1TL1 A;  1N5S A;  2CG4 A;  1HWJ A;  4K7Q A;  3RB3 A;  1ZYQ A;  3DLE A;  1IKY A;  3IXQ A;  4HVZ A;  1HWK A;  1T9T A;  4EFA C;  5D4L A;  2BJ7 A;  1FTC A;  2E5H A;  1BWV A;  4CLU A;  4O4G B;  4P72 A;  1N34 J;  3DM2 B;  3MM6 B;  2FDN A;  5F8H A;  5ETV A;  1CEZ A;  4Z2X A;  2OLW A;  4PG4 A;  4XAK A;  1L5U A;  2KHD A;  4KHP J;  1UZD A;  4FYW B;  4B3R F;  1D3W A;  2X1A A;  1Q95 G;  1X8D A;  3BGU A;  3MMB A;  4OHW A;  3HHL C;  4FYX B;  4DV6 J;  1RAH B;  4I2Q B;  3G86 A;  5J2P B;  2Q66 A;  1RAE B;  1VRT A;  4M63 A;  5HL7 Q;  1NK6 A;  2BR0 A;  2ZUA A;  3BGL A;  3AB2 B;  3OR1 A;  3QLH B;  4FP9 A;  3CCE S;  2FZK B;  2J0X A;  3QZ7 A;  1WHW A;  3MED B;  4MYU A;  4GKK F;  4K59 A;  5DET A;  3CCT A;  4PWD A;  1JNR B;  4FPR A;  2MLY A;  1H74 A;  2Y3Y A;  1S4F A;  3RBX A;  4P7T A;  1MNE A;  3TX8 A;  1W2I A;  2C42 A;  2P5V A;  1U26 A;  1JLB A;  1LKZ A;  4RW9 B;  4USK A;  3POT A;  3H5Y A;  2E5J A;  3BSN A;  3TAP A;  1AZS B;  2MZJ A;  2PEB A;  1LNQ A;  3DLB A;  1GXT A;  2MXY A;  1QUV A;  3W5X A;  5CHC B;  1RJJ A;  3T5J A;  4F4Y A;  1R31 A;  2IC3 B;  1HI8 A;  1QAY A;  5CZX A;  2W8K A;  1Q8K A;  1O5J A;  3KMQ A;  2G0I A;  2VFS A;  4N41 A;  4GC6 A;  3FZ2 A;  4O4G A;  2OTJ S;  3DM2 A;  3MM6 A;  3K8V A;  4Y2C A;  2ZC4 A;  4DPW A;  3BQ2 A;  1VC0 A;  4L72 B;  3HDS A;  4PEO A;  3GIM A;  2C3M A;  4A8X A;  2VC1 A;  2MQP A;  4DCP B;  2PC6 A;  5KTQ A;  1J27 A;  4YHH J;  3JSR A;  2IYI A;  5FLX U;  5HJY A;  1P1L A;  4QU6 A;  2VA2 A;  3C46 A;  4I2Q A;  3NNH A;  4WF9 Q;  5J2P A;  2FLN A;  4KT0 C;  2V8D A;  3TA1 A;  3QLH A;  4BS2 A;  3HZG A;  1VJW A;  3SBM A;  2C2Z B;  4U95 A;  4DQS A;  3AJD A;  1RKI A;  3RB4 A;  2RIJ A;  2VBZ A;  3CB4 A;  2G0J A;  4NLV A;  3N6N A;  1NME B;  3M6U A;  4C6A A;  4ZKA A;  3SSS A;  2GQC A;  3KDN A;  4AQY J;  4RW9 A;  2N3L A;  2Z56 B;  2HBR B;  1AZS A;  1FES A;  1VI7 A;  4CLT A;  2IM2 A;  3UDL A;  3OXG A;  3I87 A;  1WI6 A;  4OX7 A;  4I7F A;  2IC3 A;  2XMV A;  1QDU B;  1QAX A;  3BKF A;  1S10 A;  3M9M B;  1YJW S;  2VG7 B;  5C2G A;  1KLN A;  2E1A A;  1HR0 J;  2EG1 A;  2M4M A;  1NDK A;  1FJE B;  4XK8 C;  1GX5 A;  3PFO A;  3CDE A;  5SZT A;  1EJ7 L;  1FX4 A;  1PYO B;  3CCS S;  1XMO J;  1WEL A;  3OTD A;  1WSR A;  5KFM A;  2FY1 A;  4EO8 A;  2BAB A;  3GFZ A;  4J9N A;  2VFV A;  1VK8 A;  4KFB B;  2YWG A;  4IYQ A;  1NK0 A;  3U1M A;  1RTI B;  4WP9 A;  5L8R C;  2ZJP Q;  2DXE A;  1N8R T;  2KL8 A;  4ANE A;  3PNI A;  2D9O A;  2BAC A;  4EBE A;  1R8P A;  3TQE A;  2YKM B;  1WOO A;  4F3O A;  1UFW A;  2CFX A;  1ITP A;  2B9E A;  3ZNU A;  5JVH Q;  4CQ1 A;  4ZPV R;  5F8J A;  1X4A A;  1P6T A;  4ED1 A;  5AJ3 J;  4R5P B;  1F2H A;  2DIV A;  1GFW B;  2OFG X;  2FZG B;  3IR5 B;  2HNY B;  1TUG B;  2XB2 D;  1RBA A;  3BPD A;  3H40 A;  4DHV A;  1VQ5 S;  4DI6 A;  2JLF A;  4RW7 B;  2JX2 A;  1KHV A;  3MR6 A;  3J7Y U;  1LV5 A;  2VG7 A;  3ZZR A;  2F3J A;  3U7J A;  3TAR A;  1FFW B;  5KFD A;  4P2S A;  3JB9 k;  4Z37 A;  5KT4 A;  2UUB J;  2HFU A;  4ZLL A;  3W5Y A;  4ECZ A;  5JJB A;  5KOX A;  1B7F A;  3PW7 A;  2ZNZ A;  1RTH B;  1UVK A;  3JSM B;  4DL6 A;  4EZ6 A;  2XY5 A;  4KFB A;  1DTQ A;  3GZ7 A;  2EKN A;  1SKS A;  2RD5 C;  4LBP A;  4K4U A;  2QL7 B;  2B9Y A;  2AGO A;  2OJ3 A;  1QAJ A;  3HVT B;  2FLL A;  1SBR A;  4RUC A;  1UJ6 A;  3ZO7 A;  4CO1 A;  4OYB A;  3D2W A;  4PYD A;  1VQ7 S;  1LEO A;  2QSW A;  2E44 A;  4KGK A;  2PGC A;  4CLS A;  4ES1 A;  2YKM A;  1G6B A;  4ECR A;  2HWH A;  1SJ4 P;  2QA4 S;  1RAA B;  4JV0 A;  1Q8I A;  3MPY A;  1U2R A;  2PI4 A;  3ZZ0 A;  4F0M A;  4LSN B;  1B0T A;  4WU3 A;  3T6J A;  4R5P A;  1QSL A;  2HYI B;  3H2L A;  1HHQ A;  3IFE A;  5F0W A;  1EKR A;  4J9K A;  3OL6 A;  3QJP A;  4DSE A;  3T6B A;  2HNY A;  3IA0 A;  4OYO A;  4RW7 A;  4G6V B;  3TZW A;  2IVM A;  5F0U A;  5ADZ A;  2WSE C;  3W2V B;  1XR6 A;  3NOC A;  3IRW P;  4YB6 A;  4MTP A;  2BRL A;  3LQV A;  2BVZ A;  2XS5 A;  1RTH A;  1YI2 S;  3JSM A;  1C0T B;  2KRR A;  2FHJ D;  3BYR A;  1X4B A;  4OYP A;  2CNN B;  3EVM A;  3GFY A;  3T1A A;  2DK2 A;  4HAC B;  5BR8 J;  1V6H A;  2FIU A;  4DV2 J;  3NS5 A;  1GNK A;  4M5L A;  2UUA F;  1RUS A;  2VUG A;  4J5O A;  3HVT A;  2LP4 A;  1N36 F;  3HI9 A;  4U9R A;  5DGA A;  2UUC J;  4FXW A;  3K5N A;  4DV0 J;  4ZPA A;  5E3A A;  2BW2 A;  4X4P A;  2V2Q A;  5FDL B;  1JJC B;  4A47 A;  1DQA A;  1RAJ A;  2HK2 A;  2V4J A;  3MPW A;  3FC9 A;  4LSN A;  3M8S A;  4O3S A;  5E2Q A;  1BQM B;  2BAN A;  2DY9 A;  4CT9 A;  1IKW B;  4TKT A;  4KJI A;  1IUJ A;  1T3O A;  1PAU B;  3ENA A;  3D5M A;  2ZJQ Q;  4AL5 A;  2DGT A;  2EC2 A;  2ASY A;  4TXS A;  2J9D A;  2XO6 A;  3BKU A;  4DR5 F;  3EYZ A;  1PC4 A;  1XER A;  4RU2 A;  2XMU A;  4DXL A;  3AOB A;  3MUR P;  4OX8 A;  2DGU A;  2J6U A;  2Y0B B;  4DV7 J;  2KG0 A;  3F56 A;  2FPH X;  4F02 A;  2RE1 A;  1NSQ A;  2GHP A;  4X4U A;  3QT8 A;  1RHU B;  5KT6 A;  1DRZ A;  4M94 A;  2DNL A;  3L09 A;  4QWE A;  2Y1I A;  3UD5 A;  1NLK L;  2MY8 A;  1FEE A;  4BWJ A;  3HSG A;  1C0U B;  3K8W A;  5F41 A;  4DQI A;  1Y0H A;  2XZW A;  4F3Q A;  1JB0 C;  1F6T A;  3PX4 A;  3P5T L;  3B6B A;  2CVE A;  5FDL A;  3T5L A;  1ZM2 A;  2B4V A;  4WK3 A;  3Q86 A;  4F67 A;  2IBO A;  5I3Q A;  5J1E B;  2XGP A;  5IQ6 A;  4FXV A;  1BQM A;  3V4M A;  1IKW A;  3DRP B;  2I0X A;  2HPU A;  2K8G A;  2O1P A;  1VQK S;  2OGU A;  3KLI B;  4DUZ F;  3G8Q A;  1NKC A;  1Q82 T;  2FC8 A;  3CXC R;  4FNI A;  2E29 A;  3B4M A;  4Y2I A;  1FT8 A;  2RT3 A;  1MN7 A;  1F0X A;  2ZH4 A;  3BPS P;  1NPP A;  2FQQ B;  2HZC A;  5I42 A;  4H4K C;  2MHN A;  3D1O A;  2ROG A;  2A1B A;  3MM8 B;  2OPQ B;  4G1Q B;  1F1B B;  4X84 A;  5HQ8 A;  2AW0 A;  4ZA1 A;  1X4G A;  3FEZ A;  4EU0 A;  2DBB A;  1OMS A;  4FXD A;  2HVE A;  2KG1 A;  1ZAV A;  5CCL A;  4O3Q A;  4ZCM A;  3X3U A;  3W5Z A;  2HFZ A;  4WYW A;  4R25 A;  3EZO A;  1YIJ S;  1C0U A;  4NAS A;  3HO1 A;  3HFV A;  2HHX A;  3I55 S;  1NK5 A;  3OTE A;  1VIX A;  1TK8 A;  3EPG A;  4QW8 A;  4ZVF A;  3NWG A;  2J6S A;  1M1K T;  4TNO A;  4KAI A;  2HGL A;  5J1E A;  4OJG A;  4MJK A;  4YFU A;  3R97 A;  1Q8L A;  2AEF A;  3DRP A;  1PYS B;  4RNF A;  4L75 A;  4JI2 J;  2CG8 A;  2Y1L B;  1ZPW X;  4OZL A;  2NS1 B;  2NXE A;  3KLI A;  2W2M P;  2FJE B;  4KH1 B;  4E0D A;  5HMZ A;  1GMW D;  1SUQ B;  3MOZ A;  3GU0 A;  4RX6 A;  4BC7 A;  1FDA A;  3UDC A;  3D0G E;  3HSZ A;  2UXC F;  1U1L A;  4DR7 F;  2VFT A;  9RUB A;  2E66 A;  2OD4 A;  1Q1K A;  2HHP A;  1XR5 A;  3J7Y I;  3HXM A;  3MM8 A;  4G1Q A;  4JUZ A;  4FYD A;  2CQG A;  4PCQ A;  3W3S A;  2RDI A;  3KHL A;  5ETR A;  5DDR C;  2VQE J;  5HMY A;  3QPI A;  5IWA F;  1T94 A;  1OYE A;  1MU2 B;  4NX9 A;  2XC9 A;  1S6O A;  2HHS A;  2LKZ A;  4DPX A;  1S1V B;  2OO4 A;  1RP5 A;  1U0S A;  3VGU A;  2QSF A;  4QR0 A;  3ZXW A;  1X0F A;  2GVZ B;  2J7W A;  2UUT A;  2BX6 A;  4EZ9 A;  1KTV A;  3OHB A;  4CYU B;  3RU0 A;  2OP5 A;  5KFG A;  2GA7 A;  1FNM A;  1T11 A;  2QL9 B;  2OFH X;  1VQL S;  4PXD A;  3SDE B;  3GCX P;  5EWG A;  3R9L A;  4PRF A;  1JX4 A;  1Q78 A;  3MTK A;  1SC6 A;  2OPS B;  4H4O B;  3OPK A;  4MIA A;  4E2F B;  4UT4 A;  3PY8 A;  4I56 A;  2V9W A;  3PKM A;  2G2Y A;  3DRY A;  2YQ1 A;  4C48 A;  1SUQ A;  3QT6 A;  4NXN J;  3VF0 B;  2V0N A;  1UVM A;  3NAI A;  2G1D A;  1RWX B;  2ZIT A;  4H4M B;  4GO5 X;  2M0G B;  3MR5 A;  4FDF A;  3PJ9 A;  3BH6 B;  1FER A;  4KGZ B;  4HHJ A;  3TWZ A;  2VOO A;  4K0K F;  2R7S A;  3R5J B;  3I0R B;  2XG8 A;  3VWS A;  4BCA A;  2R9L A;  2NUU G;  2YVS A;  1WC0 A;  2IDE A;  4O0N A;  2GJI A;  2LMI A;  4RKU C;  1MU2 A;  4DR4 J;  3BO2 A;  5E33 A;  2M3D A;  5EWF A;  2WW8 A;  5HN0 A;  3VAG A;  5AXK A;  2VQF J;  4KPY A;  3HP6 A;  4ZDN A;  1EKS A;  1F9H A;  2DR6 A;  2GVZ A;  3VGT A;  3UCG A;  4DSI A;  2H54 B;  1GXU A;  1OY6 A;  4DU8 A;  1UP1 A;  3DRS B;  4DSF A;  3I32 A;  3OR2 B;  1SL1 A;  2I5J B;  2OEK A;  3SDE A;  1JNZ B;  5CYQ B;  4DV4 F;  1DQ8 A;  4UW2 A;  5CQG A;  2OPS A;  1Q8B A;  4H4O A;  4RNH A;  2CQH A;  4DL2 A;  2V68 A;  2LQJ A;  3Q8S B;  2CPH A;  1Q5Y A;  1ZBT A;  1XR7 A;  5KFR A;  2X1G A;  2CUY A;  2KFY A;  2DGX A;  4F3M A;  1XMQ F;  4NLS A;  4H4M A;  6FD1 A;  2Q79 A;  4N8N A;  2PI5 A;  1WDT A;  2ZFH A;  4PKD B;  2HUR A;  4LF5 J;  2D3Z A;  2XBP A;  3IG1 A;  3I0R A;  4ECU A;  1NZA A;  3BGO P;  3DDI A;  5KFC A;  2GV1 A;  3PRD A;  4TLR A;  9ATC B;  4B3M J;  2ZKU A;  1OYD A;  1UAW A;  4X64 J;  1IBK J;  1RWV B;  2OPR B;  2KVI A;  4IG0 B;  1S57 A;  3IR6 B;  3KUG A;  3CDW A;  3IC1 A;  1R8B A;  2HS4 A;  3DDN A;  3HFK A;  5HSP A;  5JXS A;  2DHG A;  1QLN A;  2GNK A;  1PGZ A;  2UXB J;  2FHK A;  1RWK B;  1TL5 A;  3DRS A;  5B0A A;  3Q24 A;  1M5V C;  2JZ5 A;  1LW2 B;  3OR2 A;  2I5J A;  4Q5V A;  5DDP C;  1NHV A;  2XEX A;  4KV8 B;  5CYQ A;  3LPY A;  4C0B A;  4LF8 J;  3D1H A;  5KFJ A;  2OI2 A;  1RT5 B;  1AXQ A;  1VLY A;  5ETO A;  2R42 A;  3W63 A;  1HQE B;  1YKW A;  4JV5 J;  1K0T A;  2V67 A;  4YR3 A;  5C42 B;  1Y11 A;  2BKN A;  4ZIT A;  4K50 A;  3WX8 A;  3PVX A;  2CDQ A;  1SIZ A;  3IM8 A;  1V3Z A;  1UEU A;  4ELU A;  3T1H F;  2BOA A;  4OZ5 A;  2CJY B;  1VK3 A;  1WJ9 A;  1YJU A;  1NDC A;  1HL6 A;  2G9O A;  1NJZ A;  1HNZ J;  3RG6 A;  2HQG A;  4LF4 J;  2B6A A;  4U7U D;  2MKS A;  1VHF A;  3CJR A;  1TKT B;  2OPR A;  2XMM A;  2RB7 A;  4IG0 A;  2KFZ A;  3M7V A;  1VQ6 S;  2D9P A;  2DJW A;  1IWA A;  4J91 A;  3SCL E;  2YWF A;  2EEY A;  5BYS A;  4N8O A;  2VIH A;  1MRO B;  2QLF B;  3Q0A A;  1FEH A;  2V5H G;  1R89 A;  1LW2 A;  1FRX A;  5BYQ A;  3M2U B;  1T03 B;  2IMW P;  3EVO A;  4KV8 A;  4DL7 A;  1OQ3 A;  5LSL A;  3JQJ A;  4LFA J;  1Q7L B;  1RT5 A;  1N5T A;  2HKE A;  4YEA A;  5HBM B;  4ECY A;  3Q8Q B;  5IC6 B;  1HQE A;  3HVA A;  2NCK L;  4ICL B;  1MML A;  5C42 A;  4X65 J;  2ZOM A;  1SJF A;  1BC6 A;  4KO0 A;  3MFH A;  1KOH A;  1IBM J;  3GR0 A;  4I1T A;  2BZ2 A;  4CCH A;  3DI6 B;  2XWX A;  4ZVT B;  5EX0 A;  2F7V A;  3CC7 S;  5ETP A;  3J81 Y;  1LK7 A;  3CGI A;  3QT7 A;  4X62 J;  4FZV A;  1U2F A;  3KJV B;  1TKT A;  4N76 A;  1IVZ A;  3CJS A;  3KLV A;  3D4J A;  5B0C A;  2LDI A;  2ZHO A;  3CCR S;  1RK8 A;  3QSY B;  3MCS A;  2ZDO A;  1D8Z A;  2DNG A;  3PJW A;  1UA1 A;  2YBV A;  1MRO A;  2HFS A;  1F3F A;  1P9Q C;  4LVN P;  1Y3J A;  2NR0 A;  3M2U A;  1GMV A;  3NKY A;  2MKY A;  1FVQ A;  1T03 A;  1E6V B;  4QW9 A;  4NEZ A;  2PE8 A;  5C24 B;  4ILL A;  5HI7 A;  4I0W A;  2VPX B;  1PC5 A;  4KY3 A;  3D28 A;  4DSK A;  1JIH A;  3RRH A;  3AA8 A;  4ICL A;  2DYA A;  2JEG A;  3RYL A;  1R6Y A;  2YH0 A;  4RWW A;  2R3V A;  2DHX A;  5C2C A;  2K7K A;  3MCN A;  5HMW A;  2QEX S;  4AXI A;  3LOU A;  3C16 B;  4MMO A;  3W66 A;  4OL8 A;  4Y28 C;  2H5J B;  4LFC J;  1E6Y B;  2MST A;  3DI6 A;  1PKU A;  1WDD A;  2O5D A;  1HAR A;  4ZN3 A;  3SQO P;  2WVB A;  4XPC A;  2MKC A;  2RNE A;  2D3U A;  4USI A;  1S76 D;  3D7S B;  2QX0 A;  1FA0 A;  4RZR A;  1WHY A;  2B9X A;  1RWN B;  1ZOT A;  4JI4 F;  1S0O A;  1YJR A;  1CJK B;  4UOC A;  2ERR A;  2KT5 A;  3KJV A;  3KLE B;  1B7Y B;  4JI5 J;  2VU5 A;  5KFW A;  2OEL A;  1TKX B;  2B43 A;  1KLM B;  3SZ2 A;  1YG0 A;  3T1Y F;  4JI8 F;  3OTO J;  3I82 A;  2KTQ A;  5LXY A;  4GRS A;  5C7P A;  2LA4 A;  4Y3C A;  2XSF A;  3DU6 A;  1RAI B;  2YKA A;  5LJ3 Y;  4A8O A;  2OH2 A;  5B0B A;  2GAH C;  2XMT A;  1AB8 A;  4LSL B;  5BR8 F;  2PSZ A;  3QGI A;  5IC4 B;  1E6V A;  2WSF C;  5C24 A;  4WKY A;  4FKY A;  2AP6 A;  3BF4 A;  3IR7 B;  2UUC F;  2CJ9 A;  3OJU A;  2LA6 A;  2IAJ A;  2HVZ A;  1CC7 A;  3I0S B;  5AXM A;  3RUB L;  3MUM P;  3DRR B;  1ACM B;  4A8F A;  1PG5 B;  3C16 A;  4WFX A;  1WTB A;  1Z1Z A;  2AJ4 A;  3GPA A;  1VRU B;  3CMQ A;  1AFJ A;  2GHV C;  1RT4 B;  2MGZ B;  4M5D B;  3W8G A;  1YWX A;  3UI3 A;  4GVB B;  2L41 A;  1VQP S;  1R8H A;  4USU A;  1N32 F;  3V6D A;  2PDA A;  1REV B;  1MWY A;  4RW6 B;  5F8M A;  3K5M A;  1RSC A;  2RHS B;  2BEF A;  2HGN A;  4H54 A;  4A8M P;  3CIZ A;  2PN6 A;  4DUT A;  4M5K A;  3X1L B;  1BY9 A;  1CJK A;  4DUY J;  2YXL A;  1S1T B;  4WTO B;  2P9E A;  4F8R A;  5GAH U;  3KLE A;  1G4C A;  2YTC A;  1TKX A;  1KLM A;  2VZ9 A;  4WJB A;  1SQG A;  2FD2 A;  3UN5 A;  2ZOF A;  4HHH A;  2A3J A;  3LAK A;  3KJN B;  4DBQ A;  4MAK A;  2KM8 C;  3CO9 A;  3CUN A;  5DRK A;  3OL9 A;  4LRD A;  2DH7 A;  2XLK A;  1D9F A;  4F04 B;  1RHM B;  2CQC A;  2DCU B;  4LSL A;  2N7C A;  1RWP B;  4U6P A;  1TL4 A;  2DNR A;  2GC8 A;  5DQH A;  3ZZZ A;  2N7Y A;  3H59 A;  1OPI A;  2GO8 A;  3W9H A;  5J2N B;  1S1W B;  3D68 A;  1U4B A;  3I0S A;  1FWP A;  2PII A;  2MQM A;  2FVQ A;  3PEJ A;  2CIM A;  3OFF A;  2QMX A;  3MMC B;  2HHH J;  4LF7 F;  2CXE A;  3T5K A;  2GJF A;  2A2C A;  2GMJ A;  1VRU A;  4I67 A;  3U1L A;  3EVW A;  2R7X A;  2HIY A;  2WK4 A;  1ZAX A;  1RT4 A;  4B9L A;  1S12 A;  2MGZ A;  4M5D A;  1TZ0 A;  4NML A;  1I5O B;  4GVB A;  5LM7 E;  4OJH A;  3CJ8 A;  3KDO A;  2C2E A;  2KZZ A;  1REV A;  4KB7 A;  3KLH B;  3QAU A;  5ETN A;  4RW6 A;  4MYT A;  1EHW A;  5E41 A;  2H3E B;  3MCM A;  2LCW A;  1C4A A;  1S1T A;  1U1Q A;  1U0H B;  3IN5 A;  1J5E J;  4WFY A;  1FE4 A;  3R3T A;  4NXM F;  2QT7 A;  2XMJ A;  2XS2 A;  2MLZ A;  1LFW A;  3FBF A;  3CCZ A;  4FYY B;  3QBC A;  4X4T A;  2FB0 A;  1M1H A;  4RUB A;  1M5H A;  1C2P A;  1WF2 A;  4ECW A;  4DLG A;  4PXC A;  1O51 A;  1OY9 A;  2C3U A;  3ZTR A;  2ZBR A;  3IM9 A;  4I4B A;  1BQN A;  2GIF A;  3CVK A;  2C28 A;  2ZVI A;  2LQ9 A;  3LA0 A;  2EG2 A;  2IVF B;  1PJ6 A;  3ZTQ A;  2W9C B;  3OVA A;  4ECV A;  1R8C A;  2B7C B;  1NUE A;  2M5Y A;  4EWT A;  5J2N A;  1S1W A;  3SCI E;  1JKH B;  2ZBQ A;  4B3R J;  5BYR A;  3PR5 B;  3MGJ A;  1QTM A;  1VBY A;  3MMC A;  2Y1R I;  2VJU A;  5H1S V;  1OSD A;  4ELT A;  2DD8 S;  1SPB P;  3GJS B;  3OFG A;  1T3N A;  3N79 A;  4QCL A;  3R1L A;  2ZNY A;  2CQI A;  3GJQ B;  1D9A A;  3U02 A;  3HSJ A;  1HPZ A;  2MHE A;  5M2R A;  2M8H A;  3OSN A;  4JI2 F;  3BO4 A;  2CQD A;  2DH9 A;  1REG X;  1X4C A;  2M70 A;  4PPZ A;  3H90 A;  3FCW A;  4EBD A;  5FD1 A;  4RJV A;  4IOB A;  1N33 F;  3LP1 B;  1U0H A;  1U6Z A;  3OXL A;  2Y0S D;  2JL9 A;  1YBU A;  1CPZ A;  1T8E A;  3M9O B;  1H7X A;  4PYA A;  4M95 A;  4IFV B;  1FFG B;  2VQE F;  2UVR A;  2MQL A;  4M1K A;  1IXK A;  3LP0 B;  3OBI A;  1S9E B;  4F2S A;  2EFQ A;  4F4X A;  4FBT A;  4J90 A;  4P74 A;  1NCL A;  2QRR A;  5AE1 A;  2Q6C A;  2W9C A;  3HSD A;  3WIU A;  2H48 B;  2XGQ A;  1JKH A;  5M2P A;  1NSA A;  2CNL B;  2AZ3 A;  3AHP A;  2VDI A;  2XYH B;  3Q8R B;  3L95 X;  1YTY A;  2HAF A;  3AQO A;  4UY8 T;  3PO4 A;  2BE9 B;  1LWF B;  5C25 B;  2ABY A;  2FVS A;  5KG2 A;  2B5J B;  1YGY A;  2CJB A;  2Q43 A;  2W01 A;  4LF9 F;  2Z2L A;  3MEK A;  3NAH A;  2VL1 A;  3W8P A;  4OHV A;  2W4P A;  3LP1 A;  2UXD F;  4KSE B;  3TQ1 A;  3G6E S;  1ARO P;  1UJ5 A;  3R27 A;  3A8K A;  3SSR A;  3FGV A;  3EE3 A;  5ETQ A;  1U6B A;  5BXI A;  3QID A;  1LW0 A;  5KT5 A;  4IFV A;  2K1R B;  3FBC A;  2UUW A;  2XY7 A;  1NU4 A;  3LP0 A;  1FDD A;  2KYX A;  3R7N B;  1S9E A;  4DR2 J;  2E5G A;  5HAN A;  4CLY A;  2JJ4 D;  5KFK A;  1Q79 A;  3A3P B;  1RU1 A;  5J2Q B;  1CJT B;  4DV3 F;  1UL3 A;  2XLJ A;  4JI6 F;  3SYZ A;  1UMJ A;  2QO3 A;  2E1R A;  3OUY B;  4ZP7 A;  4K4T A;  4XIU A;  1F5A A;  1OSC A;  1X4H A;  4NRU A;  4ED5 A;  4OI1 A;  4Z7Y A;  3CJ4 A;  2QLB B;  4D3G A;  1SL0 A;  1LWF A;  2HVD A;  5C25 A;  5ITH A;  1YJ9 S;  3OVS A;  2ZH5 A;  1NRK A;  1UWB B;  2WVC A;  4LIW A;  5KFN A;  1D8Y A;  1BQX A;  2UZA A;  4WFB Q;  3Q83 A;  2OKQ A;  3JSB A;  1ZTW A;  3TP2 A;  3KFW X;  4ZIW A;  2M2B A;  2YH1 A;  3Q8Y A;  3GYN A;  1KON A;  3KWM A;  4CO5 A;  1EZZ B;  3Q8P B;  2J7K A;  5FII A;  4DJB A;  1OWX A;  3NGK A;  4EYI B;  1FKP B;  5D4O A;  1X0P A;  5DZ7 A;  3MMJ A;  2ATC B;  1M5O C;  5EGY A;  2EKY A;  3D3C J;  4DQQ A;  2L3M A;  1HWL A;  3QAT A;  4QIG A;  5GAH I;  3KHR A;  2MJU A;  3CT9 A;  1TL3 B;  3UN3 A;  2VAS A;  5KFI A;  4B3M F;  2EBG A;  3PW4 A;  3IMQ J;  1B70 B;  3FRZ A;  1R8A A;  4ZHR B;  5CXT A;  2LQ8 A;  4ZP8 A;  2CJA A;  2FJA B;  1CJT A;  5EWE A;  4Y2M A;  4LJM A;  2NXU A;  3IWX A;  3OUY A;  4D3H A;  5KFV A;  3NGD A;  4ZPC A;  2EI5 A;  3CSK A;  3C19 A;  1HNV B;  2MTL A;  2UXB F;  5KAK A;  1AW0 A;  2AJQ A;  4MKB A;  1S0M A;  2JDJ A;  3PEH A;  1FJC A;  3QIP B;  2GW8 A;  3IAS 9;  2D41 A;  1KP6 A;  1N4L A;  4B17 A;  1NJX A;  5A0Y B;  4LF8 F;  1UWB A;  2CRL A;  4QBU A;  2QMW A;  5CYJ A;  3GJR B;  4HH0 A;  3M6V A;  2DR9 A;  2AX0 A;  2LQB A;  5KFF A;  1FKP A;  5GAG U;  5E5N A;  3QRP A;  4HI2 A;  4TLQ A;  4DFK A;  2W25 A;  3IBC B;  4KGV B;  3LGN A;  5HK4 A;  5B0E A;  1IJF B;  4KHM A;  2XYG B;  5GME A;  3TUJ C;  3DLH A;  2G2O A;  1OJ4 A;  1R7I A;  5DQG A;  4MH8 A;  1HHT P;  3PYG A;  4LF4 F;  4EUV A;  3IS9 A;  4ZHR A;  4ILM A;  1TR0 A;  2YX7 A;  3IBF B;  4JP8 A;  3OLB A;  4KYZ A;  3H2U B;  4C8Y A;  4X66 J;  4EI2 A;  2F8H A;  3ENV A;  1JLQ B;  3GII A;  3Q22 A;  1B3T A;  4CZC A;  2W1B A;  4NZ0 A;  2H65 B;  4QPX A;  1RT7 B;  4L3K A;  2ZEJ A;  1S7H A;  3CNQ P;  4C98 A;  5IV4 A;  1HNV A;  3RGI A;  2KRB A;  4DR1 F;  3QGG A;  3KUH A;  3FMB A;  4CDI A;  1CLF A;  2UUA J;  1N36 J;  4CH7 A;  3NNA A;  4L6V 3;  3CD0 A;  5A0Y A;  2H5E A;  2AKW B;  2XSJ B;  2F40 A;  3JS9 A;  3ZZU A;  2NPI A;  3CD7 A;  1IR1 A;  5KFH A;  4WTY A;  2V2K A;  4C8N A;  2CQ3 A;  3OTC A;  4HT7 A;  4I2P B;  1ICE B;  3P5B P;  3FJ2 A;  2M9K A;  3GIR A;  2DPI A;  5CCM A;  4IOC Q;  3KLG B;  3R5C A;  5KFL A;  4DR5 J;  3IGN A;  4NLY A;  4DZD A;  3VAK A;  1HIY A;  3BEG B;  1DFD A;  1CG2 A;  2MMY A;  1RT1 B;  1PIE A;  1TVR B;  2R8H A;  4V19 J;  1RAB B;  1JLE B;  5HP1 B;  5D15 A;  3M8P B;  2HFV A;  3R1H A;  1HBU B;  1FRH A;  4MIB A;  3UO0 A;  1JLQ A;  3DLG B;  2R8K A;  2IJF A;  3KKF A;  2BJ3 A;  1TK0 A;  3C2P A;  1T02 A;  1RT7 A;  4KQZ A;  1L3V A;  4Z7C A;  1RHR B;  4DWI A;  2YQ3 A;  3PO5 A;  4ECQ A;  3W64 A;  4HT5 A;  2FVP A;  2YX4 A;  2CJX B;  2C2N A;  3HD1 A;  3ILI A;  3BBC A;  2QA4 G;  4YQW A;  4IH7 A;  1DAX A;  3QRQ A;  2HLU A;  5LMU F;  2UV8 G;  2XSJ A;  1VLO A;  1WKK A;  2UU9 J;  4YS2 A;  3DHW C;  3H8Y A;  1VRQ C;  1YJT A;  3PZP A;  1UJ4 A;  1H7W A;  5GAE U;  5KG0 A;  1HI0 P;  2V8V A;  3DGV A;  1FKO B;  3SFG A;  2R8I A;  3MCO A;  4I2P A;  1NBE B;  1EAR A;  4OQJ A;  3KUE A;  3KLG A;  2DEI A;  2X7I A;  3UDV A;  3D1Q A;  4DUZ J;  3IRX B;  2AYG A;  2QG9 B;  3MWB A;  2HNZ B;  3TVZ A;  1RT1 A;  1VQO S;  1TVR A;  3T19 A;  3ICL A;  1JLE A;  1H0H B;  5HP1 A;  2AT1 B;  3M8P A;  1SJQ A;  1HBU A;  3ET6 B;  5IXU A;  4ZVO B;  4DCO B;  2ROP A;  1A7G E;  4O3O A;  3DLG A;  3DMJ A;  3OTO F;  3UNY A;  1HMV B;  4DL0 C;  3EXY A;  2V8H A;  3QZ8 A;  1Y5I B;  5DG9 A;  4I64 A;  3GFX A;  5GAD U;  5CAA A;  4HTJ A;  2AV5 A;  2FGC A;  4NL5 A;  3DCA A;  1C1C B;  1GXL A;  4GKJ F;  2R2U A;  4YUD A;  2C22 A;  3VGS A;  5D0G A;  4X4O A;  1SC1 B;  2PMZ D;  4KH0 B;  2IRX A;  1FKO A;  3PM9 A;  4WP3 A;  1HBO B;  2OUG A;  3L4B C;  5FJ4 A;  3RBE A;  2OAU A;  3IRX A;  1MW7 A;  1A9N B;  3GMG A;  2D3O R;  5D78 A;  2HNZ A;  3FVY A;  3AB4 B;  1S0V A;  4AT1 B;  5LSR A;  1DHM A;  1QSS A;  3GIL A;  2Q6B A;  2DGS A;  2MQQ A;  3ZZY A;  2FY8 A;  2XWY A;  3T9N A;  3ET6 A;  5ETK A;  4CO0 A;  3ILO A;  3HVR A;  4F2R A;  3CTR A;  3DKD A;  3QYY A;  2E5I A;  2MZR A;  5FLX Y;  1U02 A;  2HEK A;  1HMV A;  3EZ5 A;  2RRB A;  3G82 B;  2LQ5 A;  4C3L A;  1RWU A;  1NKB A;  4JOU A;  2YWH A;  3GSI A;  1ZM4 A;  3CIM A;  4V1A k;  3IAM 9;  3C8Y A;  5KG5 A;  4LRA A;  2M8D B;  1N0V C;  5U47 A;  3O44 A;  5K20 B;  5D77 A;  1C1C A;  1KHW A;  2PO4 A;  2Y8W A;  1FTR A;  3VQT A;  3MM5 B;  4Y00 A;  4V19 X;  5E3C A;  3W1Y C;  2L9D A;  3BR9 A;  4C8M A;  4Q2L A;  3K5L A;  1R27 B;  4WCE Q;  4B9N A;  5DJB A;  3HHL B;  2OPP B;  2EVZ A;  1Y5L B;  4C0H A;  4AL7 A;  3RW6 A;  4WP8 A;  1U24 A;  1VQ8 S;  1KRP A;  3FKB A;  1HBO A;  2GO9 A;  2V69 A;  4OMF G;  3P8B B;  3N5B A;  2R7W A;  4JI3 F;  1XQI A;  1X31 C;  4LT6 A;  3MI7 X;  5LJ5 Y;  3MUV P;  4FKX A;  1N5Y B;  4ZLN A;  5GAG I;  2Z30 B;  2FHM A;  1YIT S;  1V3R A;  3DDK A;  1KVI A;  4Q45 A;  3U1N A;  2RUG A;  4NLW A;  1XIQ A;  1ZTT A;  4K0K J;  1KN6 A;  2YX1 A;  2AMC B;  4N47 A;  3TAQ A;  4ED6 A;  1RTZ A;  3M8Q B;  2EW9 A;  3G82 A;  2CZV C;  3GV7 B;  7AT1 B;  2BDP A;  3QWP A;  3ZTO A;  5H9E J;  1XTZ A;  1N88 A;  1F5B A;  3G9C A;  4ZPD A;  1RWO B;  1NJI T;  2ZBI A;  3TJ8 A;  2OEM A;  1D9D A;  4ETZ A;  3FNN A;  1FWL A;  2CQ2 A;  5EN1 A;  4RBU A;  1C4C A;  1KQS R;  1BD6 A;  3HVW A;  1T9W A;  4FF3 A;  1U7L A;  3MM5 A;  1KTQ A;  2JVO A;  1HW9 A;  3DYA B;  2J9C A;  4QWD A;  4C8L A;  3QFW A;  3PCO B;  1G3O A;  2FUG 9;  1G2E A;  5A8R B;  1CJV B;  2BE7 D;  2IM3 A;  1UW9 A;  2OPP A;  2YY3 A;  4UOH A;  1HYS B;  3BDP A;  4DV4 J;  3AA9 A;  2XUL A;  1HD1 A;  3L7O A;  3PDN A;  5DLF A;  1NSP A;  1PYT A;  1WF0 A;  3KK2 B;  4GO7 X;  3MAH A;  3Q2S C;  2WBM A;  1KQG B;  3BN7 A;  2PMW A;  5E3R A;  1KD1 T;  5KG3 A;  4IO1 A;  3TA0 A;  4PWW A;  1FD2 A;  2HQD A;  3SSQ A;  1XMQ J;  4OJ1 A;  1ZM3 A;  4Q44 A;  4Q8F A;  1ZS6 A;  2IA0 A;  3ZZO A;  1Z4U A;  2B7B B;  4ENO A;  3A8I A;  4B9S A;  2FJB B;  1PJ7 A;  3PXG a;  2GIQ A;  3HCX A;  4F4A A;  1H38 A;  1WG5 A;  3NP5 A;  1S79 A;  3M8Q A;  4TY8 B;  4KC5 A;  3PRV A;  1VCT A;  4BBY A;  3MF5 A;  1BWE A;  3UFC X;  1S9F A;  1AYE A;  4UUW A;  1AT1 B;  4YOE A;  2L08 A;  4MK9 A;  4K4S A;  2IA6 A;  5HVH A;  1WNE A;  3GV8 B;  5KT7 A;  4NLP A;  3FZB A;  1RAO A;  1ULR A;  4DS5 A;  2C3Y A;  1SH2 A;  2HHU A;  3D66 A;  3DYA A;  4RNO A;  2ATL A;  5T41 A;  4O0I A;  5A8R A;  1CJV A;  3NBP B;  5K8P A;  2LDY A;  1HYS A;  4Y6I A;  5F3T A;  3OQ2 A;  4F4W A;  5A2Q U;  1TV6 B;  5GAE I;  4B3T F;  3KK2 A;  3NGS A;  4RW4 B;  5IZH A;  3W62 A;  3THT A;  4ZVS B;  2QA1 A;  4DQP A;  4RLE A;  3MED A;  4G1I A;  3CJQ A;  5HLF B;  3TVK A;  4FPI A;  5KFU A;  4FF2 A;  5IFM A;  2GQQ A;  2LXU A;  1GTH A;  3U27 A;  2CQP A;  5JUM A;  2C2R A;  3FDS A;  2FJX A;  3BO3 A;  2X1F A;  1FNO A;  1NZ8 A;  3T1H J;  4JV2 A;  1J5O B;  1HA1 A;  3MOJ B;  2COL A;  1Z2L A;  3B54 A;  1IBL J;  3AFG A;  2BJD A;  2MJN A;  4TY8 A;  2VA3 A;  4UQT A;  3PKY A;  3M05 A;  2DRB A;  2VKR A;  2WON B;  1YX2 A;  1W26 A;  2B51 A;  3TEG A;  4U7C A;  3K7R A;  1KBR A;  1VR6 A;  2BJE A;  2UVU A;  2MZT A;  1ZPV A;  4DR2 F;  2PT0 A;  4ZVQ B;  3RR8 A;  1YHQ S;  3SFU A;  1SKW A;  5LMN F;  3NCP A;  1UTA A;  2MY7 A;  2JLG A;  2A2D A;  3T3F A;  3HKW A;  4LF1 A;  2HLT A;  5KT2 A;  2DGW A;  5GAD I;  2J9D E;  1FRI A;  1WOS A;  3BGF A;  3LGH A;  5HVF A;  2AJF E;  1X4E A;  1U1O A;  4DS4 A;  1X9W A;  1T9V A;  3NBP A;  1S77 D;  1WEX A;  3AXM A;  1NPK A;  2CAD A;  4G65 A;  3EGV A;  4IH5 A;  1X9M A;  1TV6 A;  2WOM B;  5A6W A;  4NE9 C;  4RW4 A;  2OHD A;  2GIR A;  3MDF A;  1UFK A;  3R7B B;  5L39 A;  5HLF A;  4NOH A;  5LT5 A;  1KKH A;  4YR2 A;  1M5S A;  3UCZ P;  3SV4 A;  2P9G A;  1X4F A;  3NCQ A;  3PW5 A;  2BKO A;  3KK3 B;  3SQG B;  3SEO A;  4YP3 A;  5A8K B;  4W4M A;  3NG8 A;  2WON A;  3T9Z A;  2U1A A;  3ONQ A;  3MEE B;  2XQC A;  4GC7 A;  3JQM A;  2KZM A;  2HWT A;  1GQE A;  2F8E X;  1SIW B;  4L76 A;  3A12 A;  5DZ6 A;  4PAB A;  2WSC C;  2L48 A;  1YLX A;  3M1V B;  4WZQ A;  1H6K X;  1IQZ A;  4DU7 A;  3DOM B;  1YRT A;  5KFA A;  2YPY A;  1NKE A;  2VBY A;  5JVG Q;  4UZC A;  3CCV S;  4PG8 A;  4OZJ A;  2I2Y A;  1DTT B;  1SQF A;  3AXK A;  2DXD A;  2KDO A;  3EJM A;  4QZV B;  2K7J A;  5KG4 A;  4WXW A;  5KFX A;  1RTI A;  4XPE A;  5D3G B;  3V6K A;  1LFP A;  4JI0 F;  3HHK A;  4OFZ A;  1K0V A;  3TVY A;  1QUP A;  3BSC A;  2WOM A;  3ITH B;  2O3D A;  3R5D A;  2FJV A;  5HRO B;  3J80 Y;  3GG1 A;  2HHQ A;  1I94 F;  5ETS A;  2JFK A;  2MPU A;  3CUL A;  2ADC A;  1H98 A;  1FDB A;  3V81 B;  3CDU A;  3LW5 C;  1S4E A;  3KK3 A;  2DRD A;  1W2B R;  1C1B B;  4URG A;  3SQG A;  4DFJ A;  1PIL A;  4NA1 A;  5A8K A;  4W90 B;  2Z58 B;  3AAW B;  4M5M A;  1B0V A;  2AJ2 A;  2LYV A;  8ATC B;  1GMU A;  3ENW A;  4JI4 J;  1UEK A;  2ZHA A;  2YNI B;  4Y2K A;  2QC3 A;  2RVJ A;  3MEE A;  2QGF B;  3UD3 P;  1WUU A;  3T1Y J;  3M1V A;  2C2D A;  1U8S A;  3JTP A;  1Q53 A;  3CJ2 A;  4NRT A;  4JI8 J;  4RUH A;  4X66 F;  3DOM A;  3BRE A;  2P2C B;  3O6Q A;  1DUR A;  4EBC A;  4ZVP B;  1PSD A;  1M0S A;  1IQT A;  5LXR A;  2F9D A;  2YNG B;  2O01 C;  3G2X A;  1T9X A;  5KFZ A;  2H51 B;  1DTT A;  1U1M A;  4NI2 B;  4ECX A;  1QM9 A;  1JLF B;  1S49 A;  5D3G A;  2ALY B;  2FJW A;  4B9T A;  2F1F A;  1NHK L;  3ITH A;  3J7A N;  2RIL A;  3FUY A;  1S9G B;  1EX8 A;  5HRO A;  3N9U C;  4J9M A;  4QU7 A;  1FXL A;  4KTQ A;  4S0M A;  4ZPT R;  3BGR B;  2JEI A;  3F44 A;  2B0G A;  4PG6 A;  2E7X A;  1SV5 B;  3V81 A;  1LXJ A;  1HBN B;  3LAN A;  4R8U B;  4BHQ A;  3TUZ C;  4IOA Q;  1NH8 A;  1KWM A;  1C1B A;  5CD4 A;  3N6L A;  3CPW R;  1WD6 A;  1N32 J;  1I51 B;  2H5I B;  2D74 B;  2AGQ A;  2ZH3 A;  1JJH A;  2IBK A;  4I6Y A;  1RKJ A;  2YNI A;  1ELO A;  3H5S A;  4WYL A;  1SVD A;  3W2V A;  5T14 A;  2XNR A;  1Y5N B;  5EDW A;  3AJ2 A;  2F65 A;  3CC4 S;  1RWW B;  2YNG A;  4K4Z A;  1NHU A;  2LU1 A;  1C0T A;  2YNF B;  4ZLP A;  2MZQ A;  4NI2 A;  1JLF A;  4DEZ A;  4HAC A;  2XY6 A;  1BGX T;  3I4P A;  5THW A;  3HLU A;  4TQS A;  2J0W A;  1AUD A;  1WC1 A;  1EAY C;  1S9G A;  3JXO A;  2ZH2 A;  4OHX A;  2UU9 F;  3JTO A;  2A6M A;  3CD6 S;  3NMR A;  3BGR A;  2NUH A;  2POK A;  4LF7 J;  4ZCK A;  5DGB A;  2ZH1 A;  4YME A;  4ZPW R;  2IVY A;  1ZAW A;  1SV5 A;  4J9U E;  3K0J A;  1SB6 A;  1HBN A;  1XBW A;  4LSZ B;  4R8U A;  4C4W A;  2IPO B;  3EGZ A;  1DQ9 A;  3HFZ B;  2FC9 A;  1P8G A;  3J81 j;  4OV1 A;  1U1K A;  1Y7P A;  2CNO B;  4ED3 A;  5CA5 A;  1DZ5 A;  2ZBC A;  3CCJ S;  1O0P A;  4DL5 A;  1XK8 A;  4NXM J;  1L3T A;  3TYT A;  3R7S B;  5F8G A;  4HTI A;  3UN2 A;  4H4K A;  4O23 A;  4ZJQ A;  2PA3 A;  4RNM A;  5CZV A;  3MXH P;  5IQQ A;  5M2U A;  1F60 B;  3PW0 A;  3O3L A;  3G6X A;  1X60 A;  4C3M A;  2CJK A;  2YNF A;  4ZP9 A;  2NLW A;  3MPD A;  1Y00 A;  1RGV A;  4R0E A;  4C11 B;  1W7W A;  1RLC L;  1G7C B;  4NYZ A;  3J7Z T;  4PUO B;  3KOA A;  4DQR A;  2R7O A;  3MPV A;  4DR6 F;  3PYF A;  2WB1 D;  3IBW A;  4GMK A;  1LWE B;  1MG7 A;  1AUS L;  1XJW B;  4DF4 A;  3MMA B;  4OIX A;  2XS7 A;  4IRD A;  2CWX A;  4C3K A;  3R6L B;  2E1P A;  4NPO A;  2G2Z A;  4CH1 A;  5T7L B;  1WI8 A;  3D9B A;  3G6Y A;  3NLC A;  2F9J A;  4OYI A;  3I5B A;  4C2M A;  2F4V F;  5H9E K;  3V4I B;  3TOQ A;  1WG4 A;  3ISN D;  4UOF A;  4WIQ A;  1CBK A;  3FQK A;  5KG1 A;  4ANC A;  2GVD B;  1N33 J;  1RT6 B;  4OLP A;  1M5K C;  4CLK A;  1KVK A;  4RR5 A;  5AE2 A;  1HNX F;  2W9B B;  2ILY A;  4UZB A;  2XM3 A;  3JYT B;  4QYR A;  1B4S A;  2AEJ A;  3FCV A;  1F9F A;  3MEC B;  2DKO B;  2PD1 A;  2OPQ A;  1FXR A;  2AIR B;  1FFS B;  2NXJ A;  4CWB A;  1F9E B;  4DLE A;  2M52 A;  4C11 A;  2JWN A;  4TN2 A;  4G3I A;  2V9K A;  1HFE L;  3FSX A;  1T9U A;  1LWE A;  2J6T A;  4RUA A;  3MMA A;  2WVD A;  3ILL A;  3W60 A;  4ED8 A;  2NZC A;  3UPF A;  4J9O A;  1OPZ A;  4B9V A;  2GFF A;  1SL2 A;  5T7L A;  2X1B A;  4IDK B;  3BYP A;  4KGX B;  3GCW P;  4OX6 A;  1M1G A;  3BQ0 A;  2C2M B;  1QAI A;  4LF9 J;  2QLW A;  1RAC B;  1TL1 B;  1TMJ A;  2LEC A;  1CUL B;  3H20 A;  2QZ8 A;  3KXD A;  2GVD A;  3L7U A;  1DY3 A;  4OZ1 A;  1RT6 A;  1IKY B;  3ETM A;  5DS7 A;  2UXD J;  4OI3 A;  1RE1 B;  1O8B A;  4DV1 J;  2W9B A;  4MIW A;  4HKQ A;  4CT8 A;  4CIO A;  3JYT A;  2ASD A;  3KNG A;  1RBO B;  2HS0 A;  1EET B;  2LFV A;  3MEC A;  3D6T B;  2P6T A;  4IQM A;  1JXE A;  1EIY B;  1HW8 A;  2VH7 A;  1UKU A;  1XN9 A;  3JTN A;  1N52 B;  3H42 A;  1S1V A;  1NDL A;  2KJW A;  2W4D A;  3I9V 9;  2JH3 A;  8RUC A;  2W7A A;  3AOC A;  4DV3 J;  1P27 B;  2BM0 A;  4USJ C;  2CPZ A;  1YRX A;  4JI6 J;  5DG8 A;  2ILZ A;  3SI8 A;  3PYE A;  3TAN A;  4DN0 A;  4ZOS A;  4CYU A;  2OML A;  2A0F B;  1VGY A;  2MB0 B;  2QLX A;  3A1Y G;  4B3O B;  4R0J A;  2V8P A;  5L46 A;  2LEA A;  4M5G A;  2NRE A;  2QE5 A;  4K5S A;  4NLU A;  4J9S A;  4IDK A;  3BBF A;  5KFB A;  2HS3 A;  2XHW A;  2YKN B;  1URR A;  3ZFV A;  2HHV A;  5SUH A;  3KYL A;  3EDQ B;  2I8E A;  4NZ6 A;  1CUL A;  3JAM U;  2IY5 B;  3G96 A;  4DDF A;  1IM4 A;  2HQ3 A;  1H73 A;  4PG7 A;  4ZN1 A;  2IM1 A;  2CQ0 A;  4A48 A;  3G8S A;  2YQ0 A;  1RA6 A;  3RB0 A;  5AXL A;  4PPD A;  4FNH A;  2BMB A;  4OI0 A;  2R2T A;  4WPA A;  2OSQ A;  1EET A;  4JI1 F;  1OO0 B;  2DNO A;  4PG5 A;  3HT3 A;  2V63 A;  3ZTP A;  1S0N A;  4ZVG A;  1AA1 B;  1RCX B;  2DGQ A;  1Z2Z A;  2RU9 A;  4K4X A;  2OMO A;  1GAO A;  3UWT A; 
#chains in the Genus database with same CATH homology
 3L4B C;  1LNQ A;  4YS2 A;  4RO0 A;  3KXD A;  2AEM A;  2FY8 A;  3RBX A;  4J91 A;  4L76 A;  1VCT A;  2AEJ A;  4G65 A;  3RBZ A;  4J90 A;  2BKP A;  4J9V A;  4EI2 A;  4XTT A;  4J9U E;  2OGU A;  2BKN A;  4GVL A;  2AEF A;  4L74 A;  3JXO A;  4L75 A;  4L73 A;  4J7C A;  2BKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...