4XTTA

Structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
ASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIKRGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of Potassium Transport Protein KtrA Regulator of Conductance of K+ (RCK) C Domain in Complex with Cyclic Diadenosine Monophosphate (c-di-AMP)
pubmed doi rcsb
source organism Staphylococcus aureus 08ba02176
molecule tags Transport protein
molecule keywords Putative potassium transport protein
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 4xttA00
4J90A 2OGUA 2BKOA 4L75A 4RO0A 4EI2A 4L74A 1LNQA 4XTTA 2AEFA 4G65A 1VCTA 3JXOA 2AEMA 4L73A 3RBXA 3RBZA 4J9UE 4J91A 2FY8A 4YS2A 2BKPA 3L4BC 2BKNA 3KXDA 4J9VA 4GVLA 2AEJA 4J7CA 4L76A
chains in the Genus database with same CATH superfamily
4Q2MA 1Q7LB 1FJ7A 2Q66A 2F9DA 2Z56B 3NBPB 3WX4A 2F3JA 3OR1B 3LP0B 3UPFA 3KLFA 2RRBA 1I5OB 2GAHC 4NRTA 4P7VA 4XIUA 2U1AA 1VQ9S 4IOCQ 3TA0A 4YB1P 4V1Ak 2R2TA 3FZBA 1X5TA 5DO2A 4FXVA 4C98A 4LF7J 4DUYF 3TW0A 1T7PA 4KH0B 2CFXA 5CYJA 1FRJA 4O0NA 4EYHB 4ICLA 2NXUA 4ALZA 2ZH4A 2OH2A 5B0EA 2AQ4A 1RT5A 3UD3P 3IR5B 3FFIA 3MCMA 1EAYC 2DNZA 2B8PA 3NOCA 2JC0A 2H5EA 1LW2A 1QTNB 1S5ZA 2I8EA 4HT7A 3AODA 4KRWA 5C24A 4EGLA 3CMAS 1H2VZ 3HHLB 1VQ7S 2ZHOA 4P71A 1IBLF 2XS5A 3H90A 4PQAA 3DHXA 4KGZB 1ZM9A 2H5JB 1RAIB 4MK9A 3RU0A 1YJUA 3OVBA 3DHWC 2OD4A 4KIAA 4IO1A 5HMWA 2EFOA 4WXOA 3FCWA 3T1HJ 1RT1B 1U1MA 1LW0B 1YJVA 1HD0A 1Q79A 5KAKA 2ZZMA 2HS3A 2I5JA 3CDAA 3CCJS 3I32A 5DQGA 3M2VA 3CE8A 1N88A 3BGUA 2HQIA 4M5NA 5KG4A 3DLEA 2CPXA 4M5KA 4NL5A 5D4PA 3VALA 1TU0B 1UP1A 2EVZA 3PM9A 1FXDA 2K1RB 2AEMA 3S7RA 2C28A 3PY8A 2CDQA 4NEYA 3HKWA 3GCXP 1AT1B 5CZXA 2UUAJ 2YKNA 3CJKA 4WZMA 5HBMA 5F8JA 1Y0HA 2CQGA 1MWZA 4DV2J 1XNRJ 3VAFA 4P7TA 1K1QA 1I1GA 5HVFA 3EZ5A 4ZVHA 4DV4J 2DHHA 5KG5A 2VFUA 4RUBA 3L7PA 1FKPA 1RTIB 1K47A 2CJ9A 2QE5A 2CZ9A 1RWOB 1UEKA 2YPYA 3D28A 4P6QA 1HBUA 3IN5A 3GQCA 1T0TV 4FF1A 2F4VJ 1C0TB 3H20A 2ZM6J 4P52A 1RK8A 2CYYA 3VQSA 4BLGA 2KT5A 2RD5C 3A8KA 3MCNA 1RSCA 4MKAA 5KFAA 3PYGA 1X4FA 1FDNA 2CQIA 2EFNA 1TMJA 5HQ8A 2CUYA 4C8NA 4YR3A 4TKTA 2E5JA 1NNDA 2L9DA 3HMJG 1YRXA 4ELUA 2KZZA 1TMMA 4BWMA 4K0KJ 2ZUGA 4G1QB 1KVIA 1XR6A 2RF2A 2MQNA 5DLFA 3AHPA 4LF6F 3CCUS 2JWNA 5LJ5Y 1RWUA 3L4BC 3AB4B 1JLCA 4HI1A 5C25B 3EM1A 4LSZB 4RBVA 1SKWA 3TRGA 1KTQA 3D54A 3HVWA 4IFYA 4B08A 4ELVA 4J37A 2OEJA 2V0NA 1HW8A 3HSJA 4RU9A 4W4MA 4ZLPA 2CVIA 3S6EA 1TAQA 3QIPB 4OZ3A 2JLGA 1LW0A 2NR0A 4NMLA 4WFAQ 2RE1A 4OYXA 3T1YJ 2EKYA 3BKUA 3QFHA 3RR8A 3OR2B 3OTEA 2RDDA 4F0HA 5J1EA 4DV6J 3AJ2A 3ONQA 3R9LA 4CH1A 5K8MA 5A8WB 3DLGA 1H7XA 1CS4B 4DI6A 4O3QA 3DRPB 3H4DA 1RTDA 2XS2A 3RYLA 2QL9B 4A8OA 1B0PA 1CJUA 4ZITA 2NUHA 2MPUA 2ROGA 3FZ2A 4G6VB 1WF0A 2VQEJ 2YQ1A 2IA0A 4A8WA 2R7VA 3QJLA 3CCSS 1UWAA 1RYSA 1S76D 3I9V9 4OZ0A 2W7OA 1N56A 4RW7B 1M5HA 2VFVA 2KDOA 1GMVA 1TV6B 1URNA 1HBNB 2VHGA 3D6TB 5F8GA 4USMA 1VRTA 1CJKB 2DJWA 4DR1J 1N5YA 4B9SA 1FXLA 4QWEA 3HVAA 5ETKA 1R27B 1PO6A 4YMEA 3C3LA 3O8WA 2BA9A 2A18A 2HFUA 4C2MA 1FJCA 4I2QA 1X4GA 4KE5A 5C7PA 2P8IA 2E7XA 1V5VA 2HNDA 4JI3F 2G1HA 2ZITA 4KGVB 1OJ4A 2BQ3A 2KYXA 3EXCX 4GO5X 1VC0A 3C46A 4O4GA 2QC3A 3K8VA 5HJXA 3VWSA 2WVCA 2VQFJ 3NKYA 1S7HA 3GE9A 2UVWA 4JI8J 1QE1A 4R0JA 4DV5F 1FCAA 1B7YB 4C0HA 1LV5A 3D1HA 1VBKA 2BE2A 4FNIA 3EE3A 4TYBA 3WC0A 4ZVRB 2DXFA 3UVJB 1HNXJ 2GJIA 2E9ZA 2RNEA 1IN0A 3M2RB 1Q81T 2IFXA 1VQOS 2QA4G 3JQMA 3CD6S 1AFJA 1R3NA 3VGTA 3I55S 1NPKA 4F25A 2OTJS 4TU9A 2ZOFA 2J5AA 1UVIA 3LAMA 1K73T 3M2VB 4WP9A 1Y5LB 3R5BA 1X9MA 3DLEB 4DXLA 4B3TJ 2DR8A 1S9EB 1F60B 2D1CA 4NYZA 4PXCA 3W60A 2XNRA 1ZM2A 1IQTA 3D3BJ 5LOQA 3RBXA 3CJTA 4DV1F 1VQMS 1CC7A 5IC4B 4P2XA 2FHJD 3D67A 1ZBTA 3R5CA 3S01A 3BO4A 1XMQF 1XIQA 2M70A 2E1CA 4DR4F 1J27A 2ZD1A 4QIEA 4CO0A 1KEKA 3MM8A 3SV4A 4F4WA 2ZZNA 5M2RA 2AJQA 2YNHB 3W2VB 2XY7A 2HYIB 1OQ3A 1N0UA 1U8SA 5KFXA 2F7VA 2XZTB 4DL5A 2N4DA 3HFZB 3N6LA 4MIBA 2B9YA 3BQ1A 4BDPA 3N0VA 4DL4A 2R7SA 4YB6A 2JEIA 3CIMA 1UA1A 2DIUA 3AA9A 3J7YU 4QIFA 3HXMA 5CAAA 3OFEA 3QNWB 5HATA 4O44B 3TEHB 2MKKA 3MM5A 2AU0A 1YITS 1Q86T 3BDPA 1X8DA 5D78A 3GZ7A 3QBCA 3NS5A 3K58A 3HK2A 4DV7F 1XWLA 4I64A 2VFRA 3UQSA 1TL1B 5J2PA 4WZQA 4WE1A 4I6AA 2DCLA 3BSOA 3GB0A 4NLQA 3VF0B 1QE1B 2X1BA 2BV3A 4NI2A 4EU0A 3TX8A 3IO1A 2HIQA 4DSFA 2ASYA 4AT1B 1S6PA 1Y10A 3KLGB 4O4RA 2J0SD 4IFYB 1ZTTA 3KLHA 2DEJA 2V4JA 2XSJB 3PNIA 3ZZTA 1FEHA 4ECRA 1Q7YT 4WJBA 3GFXA 3VR1A 4X65F 1PJ6A 2RF2B 5AE1A 3Q8YA 1OSDA 1RISA 1RHUB 1SQEA 2LA4A 1VGYA 1YRUA 4LRDA 3DLJA 2XY5A 1JK9B 3MEDA 4NXNF 1RTJB 2A0FB 4WE1B 4CLPA 4B9TA 3LO3A 2Y1LB 1S1VB 4N76A 3MUTP 5I3QA 2YH1A 4HTJA 4R25A 1NPRA 3GSDA 5LSLA 4HHUA 1WNEA 1EKRA 1S1XA 1UEVA 3ETMA 2KFZA 4B3TF 4RNNA 4PUOA 1VS3A 2I6WA 2KM8C 3IM9A 2AYBA 5KT7A 3N79A 4UZCA 3BH7B 4B3MJ 3MXHP 2J0WA 2OKQA 2BVZA 3MTJA 3K17A 3ZZYA 1S0OA 4FBTA 3FSYA 1NK4A 2NYIA 3TX0A 4KB7A 3CNQP 4ILRA 2UV8G 2LDYA 4DPUA 1T03B 2DR7A 4Q8FA 1FX2A 3UW1A 1H6KX 4HHJA 1FNXH 3JTOA 2FY1A 1DRZA 3DFEA 2R7TA 1F0XA 1FTRA 3R5DA 3JSBA 3MM5B 4L6V3 4AXIA 3MF5A 1JNZB 2IM2A 3GJQB 4ZVPB 2DNYA 4LBIA 4OV1A 3HPOA 5D8HB 2FQQB 1VC6A 4A8FA 1TTHB 1VBZA 1AW0A 3IBFB 3BPSP 4QZVB 3KJVA 3T19A 4DX6A 4RPFA 4JI4F 4X64F 3VGUA 2ZC4A 3EVOA 2RKIA 2ILZA 3AB2B 4NA3A 3OFGA 3TJ8A 5KG3A 4TU8A 3O5TB 4K4XA 4DR6F 1FHTA 1YWXA 2IMOA 2PN6A 3CCTA 5EHHA 1N0VC 2LXFA 5JMNA 4LFBF 5L38A 4R0EA 2BANA 4Y0FA 4FYYB 3OSNA 1WF2A 2HAIA 3B4DA 3DLKA 3I5BA 3HP6A 4ED2A 3W63A 2FJDB 2WONB 1N6QB 2B4PA 1MU2A 2VONA 1GH8A 1H0HB 2FZKB 4F4AA 3AD7C 2XHWA 1N5TA 3QYYA 4Y28C 3NP5A 3LP2A 3CVKA 2AYGA 2DPJA 1F2GA 3TJ9A 1D1UA 2JRSA 3AOBA 2C2ZB 1RT6A 5LXRA 4CLKA 3DXSX 3MUMP 4BC9A 2XMVA 1UFWA 3G6ES 2KRBA 3BQ2A 2LQ9A 2GMJA 1RHMB 3F0NA 1U49A 5FD1A 1QSSA 1NSKL 3W9HA 1XJWB 1ZZNA 1N54B 5H9EJ 2UU9J 1BGXT 5HK4A 4CDIA 3H8YA 1R0BG 2WB1D 1URRA 3PX6A 2BOAA 2R9LA 5KFEA 4F4ZA 2LMIA 1IQZA 4JI6J 1RCOB 1VFJA 1WC3A 4PPZA 5EDWA 3CCMS 1E6YA 1V3RA 4WBFA 4RUCA 3ULHA 3G8SA 2ASLA 1IVZA 1C0TA 3HM9A 4JI5J 4USHA 3W65A 1WACA 5B0CA 1U2RA 2AGOA 4Q8EA 2FC8A 2D41A 3MMCA 4IFVB 2RRAA 1XEZA 2HQCA 2UUCF 1TKXA 2XMWA 5I3PA 8RUCA 3OTOJ 2J9EA 1FI4A 3N5FA 1S9GA 4KPYA 2H9ZA 2RQKA 5LMUF 1TQLA 1NJYA 2BDPA 3I0RA 4ED3A 4X66F 1HYSA 1TV6A 2R7OA 4X4TA 3KK3B 2MZRA 4S0MA 1QAJA 4O44A 2HQFA 2Q1LA 3RB3A 1HNWJ 5KFIA 2YKAA 5IFMA 3CDWA 4Q5VA 4F4YA 2OPRB 1RU1A 3DDNA 1RHJB 3LP2B 2M52A 1T9TA 4J9VA 2AW0A 4PWUA 4AYBD 4UZBA 2UUBF 4M95A 3H42A 1FRMA 2BJ1A 3NS7B 4EBDA 1UVNA 2JLFA 1PAUB 4ID5A 5GAGU 2G0CA 2IDEA 1GX6A 3DLKB 3IAM9 4M5DA 4EYIB 1RHRB 1T05B 2EKNA 1R7IA 3DLGB 4O3NA 1QY7A 3CJSA 4LRAA 5DGAA 3E01A 5I3UB 2V69A 2WVBA 4HH0A 3RZAA 1KKHA 2DRBA 3W5YA 2DH9A 2D74B 2VG5B 5L46A 3H2VE 2RSQA 4LREA 4MK7A 1LWFA 3QAUA 1BQXA 4OJ3A 5GAHU 4A8QA 2UVUA 2I2YA 2CPEA 2QLBB 4KQZA 4KHMA 3US5A 4P2FA 4JUZA 1XMQJ 3NMRA 2AV5A 3I4PA 1VRQC 3MPDA 3GG1A 2RT3A 4XAKA 5T7LB 4B9NA 1O51A 2ZDPA 4FXWA 5E3AA 1CBKA 2HBQB 3CJQA 3M2UB 4H54A 1HBMB 4MFBA 2W2QP 2GGPA 4KKOA 4ANDA 2N7CA 2OTLS 4M63A 4O3RA 2DT9A 2YNIB 3IGVA 2Y9HA 1HIYA 1WC4A 1YI2S 4F2SA 1HW9A 2E1PA 3BO3A 4C11B 1TK0A 1HHTP 4OLPA 2KTQA 3JXOA 2HBZB 3LWLA 3I5AA 1SI9A 4HHHA 2Y1IA 3DYAB 1U09A 1M90T 2FVQA 2XY6A 1FKPB 2HWTA 2ZKUA 1QAIA 2VODA 1IWAA 4YR0A 5J2MA 1V3SA 4LFAF 3TOQA 4LBPA 2R7QA 4PRFA 1OY8A 4J9OA 5D15A 5AT1B 4XDDA 2QA2A 4Y34A 3V4IB 1LQ9A 1U6BA 2L48A 3SZ2A 1NZ8A 3B4MA 2B9XA 3CWJA 3M05A 5A8KB 4U7UK 1EETA 3H4BA 2VOPA 1S6QA 4L76A 3CJKB 2WCXA 3FQKA 2BJDA 4DX5A 4K4VA 5LJ3Y 4X4PA 2YNFA 5DETA 4FNHA 4ZCLA 5KT3A 2RUSA 4KGKA 3ADAC 3N6NA 4WK3A 4DV3J 2H4WB 2IYIA 2C2RA 3OL9A 1SJFA 1N36J 3J7A1 2E5HA 2FHMA 3PJXA 3QFWA 2IVFB 5D6GA 2KVIA 1LOUA 4ZJLA 2NZCA 4DQRA 3VQTA 3GYXB 1Y5IB 1ROFA 1OWXA 4OI3A 2HG4A 4A8YA 2LU2A 4LRFA 4YDDB 1VQNS 1LWFB 3HF5A 2V8GA 2R2UA 4ZVQB 1QAYA 4DL7A 4Q44A 5THWA 4DZ6A 4Y65A 3MM8B 1J5OB 5HLFA 3IRWP 2DNKA 4URGA 5F8LA 5J1EB 1BQMA 1C4AA 5E3QA 1VQ8S 5B7WA 4ZVGA 4F36A 1WHVA 2DHGA 2C3UA 3MWBA 1ZAXA 2BRKA 4ZKAA 3CF5Q 3IG1A 2FJXA 1Q95G 1V9OA 2EW9A 3TUJC 5HANA 2KN4A 1S1UB 1YK9A 2JC1A 3SQGB 3ZC4A 1U1NA 1L3UA 4DV3F 3DRRA 4DS5A 1OQ6A 5FIIA 3UDVA 4A46A 2B6AB 3BN7A 2VFSA 5HQMA 3LWMA 3CPWR 2VA2A 4YDXA 4OIXA 1MMNA 1S10A 3K5NA 3VGVA 3RBDA 3P6YC 5KFCA 1NHUA 2IIHA 4CI0B 1P1TA 2UUWA 5I3UA 1XNQJ 1FFWB 1K44A 4DR4J 2DIVA 1LW2B 3MEGA 4OX9J 1T03A 1R6VA 2L9NA 2YKQA 3HFKA 4OLOA 4Y3CA 4Y2CA 5J2NB 2XQCA 1X7VA 3V4IA 4JV0A 1ZA1B 2OHDA 4A47A 1HFEL 4ZVFA 4Q0BB 3W62A 2WK4A 1YZ7A 5FLXY 2RS8A 2RH3A 5IM0A 4QR2A 1IKVB 3D1OA 5L1JA 5B0BA 2Z0GA 2XLKA 2P5VA 3KHRA 1UJ6A 5EN1A 3WIUA 2AKWB 1Y9OA 3AD8C 3DOLB 4UT4A 1EB0A 2R8JA 3V6HA 2JX2A 2YBVA 1VHFA 1LNQA 2MY7A 2KZMA 1JMTA 1RAAB 2YNIA 2HHSA 3FEYB 2IPOB 1SIWB 1DLOB 3QJJA 2RHSB 3PG9A 7FD1A 3MM6A 3BBFA 3TVKA 1WKKA 3BO2A 3CULA 2MZ1A 1RLDA 1P9YA 1O8BA 4Y2MA 3ZZRA 4JV5F 2KL8A 2F5GA 1HWLA 1X5SA 2A6MA 2DR9A 1IKWB 4JP8A 2C3OA 3IC1A 1KWMA 3KUEA 4WIQA 3G6XA 2V8PA 1C0UA 3EVWA 3W2WB 1UPMB 3PW2A 1DZ5A 2JJ4D 4C8MA 1VBXA 3T6BA 1N34J 1HQEA 2N7YA 2ZVSA 3ZTRA 3K59A 3BJYA 3DOMA 4DR1F 3V6JA 2DO4A 3K8WA 4RX6A 2E9RX 2CWKA 1RA7A 3CD7A 3MGJA 4CLTA 2ZZTA 4IQXA 4WCEQ 2HNZA 4QIVA 4RBUA 3E51A 1OIAA 3IXQA 1UL3A 3KYLA 3NMAA 1YX2A 4MTPA 4ZVOB 2QMXA 1Q78A 2PO4A 3HHKA 3WBZA 4DOZA 1N32J 2IM1A 7FDRA 2CPDA 3L95X 1SKSA 3PFEA 3CIZA 1S57A 1SKUB 5C25A 3DM2B 4GKKJ 4ENOA 3FJ2A 1HLWA 4EO6A 5DQIA 2VG5A 2AWZA 4AXJA 2SXLA 3U27A 3ELHA 2ZKTA 3DOMB 3F73A 4ECVA 2EG2A 3HHNB 1G4CA 4IUFA 2IBOA 1BQMB 1S77D 4X2BA 3OFHA 4OZLA 3KTQA 4QYZK 2YVSA 1HWIA 5IZHA 5DQHA 2GO8A 3A3OB 3UI3A 3FFIB 4X4UA 2MZTA 1QDUB 2WRMA 3ITHA 5L39A 1WC1A 3N4WA 5KOWA 3CCZA 3SQGA 3J80Y 3UD4P 2FVRA 5K8OA 2VDIA 2KVQE 4NLSA 2VD3A 1PGZA 1SKRA 4ZCIA 2PFDA 3QZ7A 2DGVA 1JJCB 2BJ8A 2QLXA 3R5AA 1Z2ZA 3DN9A 4ZDNA 2WB4A 3MM9B 3PRBA 2MJUA 5KFQA 3FEXB 3PDNA 4USTA 2PMHA 4A8XA 2VJUA 2JHEA 2A3JA 2DNNA 2W2OP 1RTJA 1H72C 2AGPA 1YDLA 2NZ4A 1DHMA 2BE2B 1TL3A 5CABA 3RRHA 3TA2A 4NEZA 3R7NB 5HP1A 4ZJOA 4BS2A 4M5GA 1F3FA 3KJNB 2OPSA 2ZC3A 2NPFA 1R8PA 4OYMA 2DGTA 2KXHA 2V8DA 4OFZA 3N6MA 3J7Z5 3H5UA 1UAWA 1FO1A 3CD0A 4CT8A 1KLMA 1G2EA 2GAGC 3U1NA 1GK8A 4GO7X 2M8DB 2NXCA 4IRDA 4OZ1A 1Q5VA 4AL6A 1Z2LA 2NSBA 2KT2A 2YH0A 3PW4A 1ZAWA 3THPA 1F1BB 3H5XA 1LEOA 2KO1A 3M2UA 4DU7A 3M8QA 2D3UA 3BR8A 3TNVA 4F3OA 3HHEA 4WP8A 3BYPA 3OD2A 1GAOA 1N52B 2R4FA 4J7CA 5KFJA 5GAHI 4I68A 4ZK7M 2UV8A 1RAGB 3VTIA 4LFBJ 2V8HA 4LJMA 1WHWA 4J90A 4C9DA 1H2UX 3M9OB 1UJ4A 5J2NA 3QPIA 3GFHA 1KQFB 5KG6A 1NO8A 3OJSA 3MMBB 4CLWA 2XZWA 4OYPA 2RB7A 3OTCA 5A8RB 3OTDA 1NDCA 3VZIA 4YP3A 1TP7A 4H4KC 4K4ZA 1WWHA 4TN2A 1FWLA 2MEWA 2MQLA 3UR0A 2DHXA 1NSPA 2GQQA 2E44A 3M8WA 3AXMA 3CXCR 1FKOB 3R6GB 3VAHA 3QSIA 1CJTB 2CDRB 1RTHA 4NMXA 4K5RA 4QPTA 4QR0A 4DV5J 4P9SA 6FDRA 1RT5B 2AX0A 3G9CA 3V5RA 2NS1B 4DEZA 4GKJJ 3A4TA 4O3OA 4ZVUB 2H51B 4QOTA 3IS9B 4TXSA 1HBUB 4CIOA 4HR2A 3KOAA 1SC4B 1U4BA 2V67A 2UZAA 3PW5A 2UVRA 4DR7J 1GXLA 1SXLA 1RABB 3R97A 5AXLA 4B3MF 2IJFA 1H38A 4PG5A 3H2LA 3MPUB 1NAQA 2IAJA 1KLMB 2O3DA 1IKWA 1P1LA 2CQDA 4OX7A 3WQPA 3GV7B 5KFTA 3T5LA 3UDCA 2M9KA 2XS7A 1MW7A 5IT9Y 1SV5B 4Z37A 4DWIA 1CJVA 5ETPA 3Q8PB 2HURA 1HI8A 2RMLA 3KK3A 1SQGA 2G0IA 1YBAA 4OI4A 2BABA 1RYRA 2IVMA 3DC2A 3WIVA 2CJQA 3MZIA 3OUYB 1AA1B 1U45A 2VF3A 4I67A 2Z57B 3EICA 2W9CA 1RQ0A 3LH2S 3LP1A 4M5IA 4QIGA 1VC5A 2LECA 3MEEB 3GIJA 1X4DA 3HX9A 3U1LA 3FC9A 3J81Y 2VPXB 2FZCB 4RW6B 4TY8A 4N56A 4I6YA 2WZ1A 1Y00A 2B43A 5AE2A 2VKRA 4P10A 4ZLJA 1RAEB 1YQHA 1WKJA 2AT1B 2Q6CA 4G65A 4WWSA 3M6XA 1QVFR 4CO2A 1P27B 4DPXA 2ACYA 4I4BA 2ATLA 4C11A 3BBCA 2OD6A 1K1SA 1RTHB 3CEDA 3GFYA 4P74A 2B56A 1JXLA 2EBGA 4URSA 4C0OC 1RT7A 2CG8A 4JI7F 1YKWA 2GW8A 4QQBA 4ZPVR 3OSPA 2D3ZA 1PKUA 2EEYA 1BLUA 3O3LA 3DRSA 4PG7A 3A8EA 3C6UB 1WI8A 3NNCA 5L1KA 2J76E 4RU2A 4NXNJ 1RT3B 4ATNA 5LT5A 1HMVB 1RT2A 3C15A 4NXMF 2HBYB 1VBYA 2FVCA 5D77A 1C1BA 5DGBA 5RUBA 3J7AN 4IO9Q 1NH8A 2DNGA 2XC9A 2V4QA 3GR0A 2YWHA 3DRPA 2KU7A 4Y2AA 2OIHA 4NCGB 1FK9A 5GMKa 1EQ0A 3B82A 1R8HA 2M3DA 2C22A 1KBRA 1FRKA 3KK2B 2MLYA 4QU6A 4OYBA 1VJQA 3KJVB 1VQ4S 1SQFA 4F2RA 2HNYA 2FC9A 4NLTA 5F8HA 4E98A 2DNRA 3PYEA 1UZDA 2F9JA 1VHIA 1EQMA 3TR5A 1KQKA 3C8YA 3PYDA 4L72B 2CVEA 4P2MA 5E5NA 1YJWS 2W8KA 2YX1A 1OY6A 4I2PA 5H9FJ 1JXVA 3W5XA 4DR3J 3CCWA 4NZ6A 2XO6A 2V4JB 4DUZJ 3KG1A 1M5SA 2Q3PA 3GJTB 3GV8B 3HVTA 5HO4A 2GQCA 2XEXA 4URQU 5B08A 4P75A 4B3RJ 2XWYA 2KXFA 2IRUA 2FJEB 3RB0A 4WYWA 2ATCB 2CJYB 5A8KA 2H4YB 1IUJA 1NB2A 1U24A 1VCTA 2OFGX 1BY9A 3M8ZA 3NCRA 4MFBB 5K14B 2CQ0A 5DDQC 3OHAA 3NY0A 4LT6A 1HI0P 4FF3A 2VC1A 1XMBA 4ECWA 2HZCA 4UY8T 4KV8A 5KFKA 2V4RA 2KT3A 2OELA 3LTOA 3GMGA 3VHQA 3EGVA 1CJVB 2YKPA 4DG1A 1X4CA 4QU7A 2AIRB 4FYWB 2JVOA 1GXTA 1MWYA 1HNIB 2AP6A 2MLXA 2P6TA 2QFIA 3DGPB 4MYUA 1AROP 2W4CA 4OX6A 1W2IA 5D4OA 4B9LA 1BQNA 2RIJA 2A6OA 3MR6A 2VIHA 3KK1B 1ACMB 9RUBA 4DL2A 3NRBA 2LEPA 3PKYA 1ELOA 4NLRA 4KGMA 1B4SA 3RB4A 2HW3A 5BXIA 3LF0A 3LGMA 2UXCF 2V94A 3QWPA 2XULA 2B6AA 4G1PA 3CT9A 3GYNA 2UXBJ 2YNGB 1FT8A 3MHYA 4KT0C 4RNHA 5D0GA 2CPJA 5B0DA 3CCVS 4QJVA 4KAIA 3KHLA 3D6MB 3D6HB 2HHHJ 1RTZA 1S1UA 2FLNA 4IRCA 3IP0A 4LF9J 1UW9A 3TWZA 1F9HA 5HMYA 3IWLA 2HVIA 2DRAA 2LA6A 1D8YA 2NYHA 5AXNA 5GADI 1T3NA 2H54B 3DOKB 4CZCA 3ILJA 3HDSA 2RU3A 3KFWX 4BWJA 2RJZA 1VMBA 3H2UB 3CC2S 4V19J 1JJ2R 2HHPA 2CQ2A 4CH0S 2FVPA 2DR6A 2MJNA 1V5IB 3IR7B 3P5TL 4LF8J 4NLPA 3M1VA 1KVJA 3HSGA 4TLQA 4ED8A 3MR3A 1HMVA 1GXUA 1RT2B 1S9EA 1TL4A 4J9NA 4ECQA 3VV2B 2XMMA 5A6PA 4YHHF 2E7WA 4X66J 2V6AA 1NBEB 2RVJA 1N33F 3X3UA 3SYZA 2XB2D 3TQ1A 3H40A 2MKJA 4KFBA 2UUTA 2JEJA 1VK3A 1KSPA 2IVYA 2C3PA 1WD6A 2CPYA 5C42A 4LRCA 1T95A 3UR3C 1REVB 2GIFA 2IAJB 4RLEA 5ITHA 2XCPA 5CXTA 3HHLD 1TKDA 1G1XA 5AJ3J 1KRPA 1M5PC 3A8JA 3KKFA 5ETNA 1BQNB 1XN9A 1M5VC 1VISA 2GIQA 2HSEB 4MH8A 2EWHA 3CO9A 3DMJA 4LIRA 5KFFA 1NDPA 2DXDA 1RWMB 2PEBA 5B09A 9ATCB 2ZH3A 2BE7D 4ECTA 1VQSA 2HGLA 1X4BA 2VBWA 1QUPA 3LUYA 4DV2F 2HHVA 1S12A 2GVDA 3PW0A 3JSYA 3QGPA 5MLCV 5KT5A 1LWEB 3EVMA 1WC0A 4XPCA 5SZTA 1X4HA 3DXBA 3LAKA 1TL1A 5EX0A 3RAMA 1ZM3A 2DGXA 3DI6B 4RKUC 3AQPA 2N3OA 4ERDA 1GTEA 1BC6A 1FFGB 4Z7YA 3N28A 3OTOF 3VVTA 3CJ3A 3I5CA 4ZVEA 3HHLA 4ES3A 4FYVB 4CTAB 3MM9A 1OS5A 2N4CA 2YXLA 5KFVA 4U7CA 5F3ZA 1XC9A 2BJ7A 1SC6A 2XSJA 3QIDA 2NQPA 2C2MB 1VLOA 3R2CJ 1XNQF 3OVSA 2PC6A 1DQ8A 3SCJE 5EGYA 2ZEJA 5JJBA 4ES1A 3MAAA 1TKZB 3POTA 1XTZA 3W2VA 4XO0A 5JVGQ 1L5UA 5IXUA 3ILIA 2IHR1 3MOZA 1QLNA 3PKMA 1TUWA 5IV4A 3Q0AA 4K4TA 2EG1A 3PYFA 2R3VA 3EZOA 3M8YA 2GGPB 3T1AA 2LEBA 2IA6A 2XZDB 2M88A 2UVVA 2DGUA 1TVRA 4DMZA 2RKIB 3GR1A 2LCWA 2ZE2A 4QWBA 2COLA 4LSLA 5J2QA 1ZPWX 3KG0A 4BBYA 1HWJA 4ZCKA 3UN5A 1HR0J 5JUMA 2G4BA 1TELA 4FS2A 2C2OB 3Q22A 4U7UD 2J9CA 2QJ3A 4OZ5A 1ITPA 3JSRA 3GJRB 1U1OA 2ZVIA 2GX8A 4DV1J 3IG1B 2ZJQQ 4YOEA 1QVGR 1RHKB 1T9VA 3M8QB 3MDFA 4MAKA 2F65A 5DRKA 5F8NA 1S97A 4ZS6A 3EGNA 4R8UA 3PR4A 2MDAA 2UXDJ 1TVRB 3T9ZA 4H4OB 1CSJA 4IYQA 2WBMA 3HHDA 3M9NB 3I87A 1CQMA 2XBPA 1MN7A 4B3OA 2GA7A 2DHSA 3BGRB 1H3DA 1I3OB 1S6UA 1WDTA 5J1PA 3BH6B 2VZ9A 5CD4H 4DQIA 2AJ0A 1ZYQA 1WELA 4X4SA 4IOAQ 4KHPF 1L3KA 1NLKL 2YKMA 4H4MB 2OPSB 2IC3A 3BSAA 5KFSA 3QSYB 5HVGA 1FNMA 4KGXB 3TUPA 4LFAJ 1PG5B 2HVDA 3Q86A 1S1XB 4YS2A 2OUGA 1T3OA 1XK8A 1JLFB 1E6VB 2CAJA 2MQMA 2PA8D 3NG8A 2X7IA 2ZNYA 4X4RA 3OLAA 2W9CB 2Z2YB 4B3SF 5FJ4A 4HDGA 4B3OB 4DR2F 1S9GB 2JEFA 2KI2A 2O5DA 4Y2KA 1NMEB 3DOLA 3T5JA 1EKSA 2AF6A 1FK9B 4F3MA 2APOA 4P73A 4X4OA 3MURP 3M6WA 1AB8A 2Y3YA 1YG0A 2ZUAA 3J81U 1AFIA 4RW8A 2C3YA 4USKA 3T5KA 3U02A 4JI1J 2CJXB 4MK8A 1PSDA 1UPPA 3ENQA 1WC5A 3D68A 3MM7A 3QAEA 2QA4S 3A8IA 1RT1A 2J9DE 3BGOP 4F26A 4OYOA 5E3CA 3PZPA 3M6UA 4F0MA 3N01A 1TUGB 4W92B 1K0VA 2ROPA 1WOPA 1YJ7A 2K7KA 1BWVA 1RLCL 2VA3A 3PO4A 1TUVA 2CIMA 4R5PB 1SH3A 1S9FA 3QO9B 4TLRA 2GCFA 2GJFA 3IR6B 2BRLA 4N41A 5LMNF 2B7BB 4ZHRA 2FLLA 3HJFA 4PKDB 5KFYA 4ZPWR 1X4AA 2V68A 2VG6A 1VQ6S 4WTOB 2EK1A 3TARA 3SDEB 3C19A 1FX4A 2AHOB 2IYGA 3LPEA 2CQBA 3MAHA 1IR2A 4ZPTR 4LF1A 4F67A 5BR8F 1JLCB 2DY9A 1SJ1A 5CYMA 1WDDA 4RW6A 4C97A 2G13A 4CNYA 2XMTA 3OBIA 5M2UA 5FDLB 4RW4B 4UOGA 1NKBA 2XMKA 2Y0BB 1SC1B 2GC8A 2QX0A 3C66A 3HLUA 3IBWA 3G4SS 3JTNA 2ZH2A 2CPFA 3MMBA 5EUHA 5HROA 1T02A 4WFXA 8AT1B 2WSEC 3J7ZT 3CCLS 1JKHA 2W01A 2B8QA 1YJTA 5G0RB 2IBKA 3NGUA 1NM2A 3SXLA 4CM0A 5KT4A 4C4WA 3WX8A 3I0SB 1WC6A 2QMWA 3KLIA 2ZH9A 2HRTA 3FEZA 1QSLA 4P72A 1AZSB 4JV1A 1NSQA 1F3VA 2G2OA 3B54A 3ENVA 2YX7A 3M6VA 2YWFA 2LQ8A 1DJ0A 1WHXA 2BW7A 1WI6A 5K14A 4WKRA 1R8BA 3Q8UA 1NHKL 1W7WA 3OUYA 1UA0A 1N32F 3TVZA 1KP6A 2HVHA 1VQKS 1HBOA 1TKXB 1HBNA 2OP5A 2VBYA 3NGKA 4PXDA 2DB1A 1T9UA 3FNNA 1SB6A 2ZHAA 4IRKA 1FKAF 2VQFF 1H2TZ 1Q0NA 5T7LA 3X1LB 2HKEA 1X60A 2IC3B 2BM0A 1RTIA 3EZUA 2X3GA 3IGNA 2E1AA 3Q23A 4DUTA 4ECZA 2WAQD 4K4WA 2DVIA 1SUQA 4JI0J 1B3TA 4I2QB 3T1HF 2KJVA 1KLNA 2QYGA 4ZPBA 3OHBA 4KPCA 3P45B 3I9ZA 3E8OA 1FRLA 3HZGA 5DJBA 4TQRA 4FP9A 1SJQA 2GVZA 1SVDA 3C14B 3OFFA 1ZZFA 3GONA 3KJFB 5HROB 2HZVA 2Y8YA 3KNAA 2PSZA 1UVLA 2DISA 2BM1A 4USVA 4RR5A 3QRRA 4DFPA 2V9WA 3D66A 2WOMB 3KJQB 3N9UC 5EWFA 1UETA 1LWXA 4LFCF 4LVOP 3PFOA 1RZMA 2ZBQA 1GMWA 4LIWA 1WUUA 2Z30B 4QYRA 2RS2A 2B4OA 2AZ3A 2BANB 5E33A 5C5JA 4LSLB 3M8PA 4WXWA 3QO9A 3W5ZA 3IWNC 4V19X 3KWMA 2ZBCA 4ECXA 5DG9A 2AJ1A 3DLHA 2OPQB 5BYSA 3DRRB 2XNQA 2QV6A 5SUHA 3ZO7A 4OZJA 1DBDA 1JLFA 1NH7A 2DGQA 1WJ9A 3GSIA 1VQPS 1UVMA 2B9WA 3CCES 1RXOB 4RW9B 5HQLA 4YEAA 1CULB 4K0KF 1RWNB 3TANA 1JJ4A 5IQ6A 4PUOB 3MCSA 1PJ7A 3O44A 1H73A 5ETTA 2LLZA 2IJRA 4M94A 1JLBA 5EWEA 3KLFB 3RGIA 4F7VA 1REGX 5GAEU 3D9BA 1U0HA 4C3KA 1P6TA 2O01C 1KOOA 5KG0A 5DG7A 2FGCA 4C48A 5KFWA 4K5SA 5B0AA 4FKXA 2D9PA 3FVYA 1KOHA 2JSXA 3ZTQA 5DDRC 1G7CB 3D2WA 2CJKA 2IY5B 2ADCA 4IOBA 4DG1B 1YBTA 3KDOA 3OXFA 1SL1A 4L75A 1MU2B 1RP5A 1WEXA 3DNCA 1R6YA 3GIRA 1KDNA 1SH2A 2FIUA 4HACB 4OHXA 4CO5A 4CYUA 2OEMA 4DV0F 5HP1B 2HFZA 2QIFA 1B7FA 1CG2A 1TR0A 1GT8A 2W2PP 2B3TB 2CJBA 1HNZF 5IV3A 1PJ5A 1LFPA 3THVA 1WKLA 3FSXA 1ZAVA 1G3OA 2N82B 1X4EA 2QGFB 2YKOA 4JYAF 4JI2J 1Y11A 2FPHX 2ZBIA 4M5DB 1UCNA 1IKVA 2M8HA 2VH7A 3DU6A 2FD2A 2V2KA 3FUYA 4RW7A 5T41A 2L3MA 3MAAB 2RDJA 1N8RT 1VQLS 3PTWA 1KTVA 2B0GA 2I0XA 3CW2C 3R5GA 3MUVP 1SL2A 1UZHA 4DR2J 5CA5A 3NAIA 2ASDA 2QLFB 2LVWA 5FLXU 3GU0A 3PACA 4JV2A 1JKHB 3GYGA 2G2YA 5L1IA 1N5YB 4YR2A 3ENWA 4RO0A 1ZPVA 2GHPA 2HFVA 4JI8F 4ZHRB 4PPDA 5A76A 5CD4A 1FE0A 4J9MA 1X5OA 3PJWA 2MZSA 4NLOA 3K5OA 4HDHA 3F44A 4MMOA 3SSQA 4UUWA 3KLEB 4NCGA 4DS4A 1JLGA 1IBKF 2BOPA 2YWGA 1RUSA 2OLWA 3QGHA 4LR7A 4N7TA 1RADB 3JQJA 4ZVSB 1NJXA 5AXMA 2CA9A 1TZ0A 4ZP9A 3NOGA 2KXNB 4ID5B 3KLVA 4XK8C 3G6YA 3SIPB 3K5MA 4C0BA 2FGOA 4N77A 2J0QD 2ZJRQ 2MKIA 5KFHA 4DX8H 1S79A 2FJAB 2HRYA 4KBIA 1NDKA 3NWRA 3Q8VA 5J1NA 3RTVA 2JDJA 4MKVA 3DMJB 2QT7A 2KHCA 3KLEA 3D4JA 2EC2A 1NSAA 1VIOA 3MMAA 3GPAA 4G1QA 5DDPC 2BXJA 3LALA 5KFLA 4O0IA 1T05A 1KC8T 3ET6A 2H1YA 3WDOA 3W7BA 2LQJA 2VDHA 3IA0A 4HACA 4FN5A 4DHVA 2C3MA 5ETVA 2XGPA 2UUBJ 1Z4UA 4B9MA 4O3SA 2HZAA 4ZIWA 2VPZB 1DQAA 5HVHA 2B51A 2VG7A 1T9XA 1IBMJ 1SV5A 4AD6A 1ZA2B 2LYVA 2VJVA 4FXDA 4M1KA 2N3LA 4PEOA 2W8LA 2Y1JA 5KG7A 3MM6B 2WONA 4M5MA 3ZNJ1 4USWA 2XI2A 2VQEF 4BCAA 1JLQA 1N6QA 2BJ3A 3QQCD 2Q79A 3KMSA 2HHHF 3L9ZA 2KB2A 1DTQA 3BREA 1RAOA 3ET6B 3G82B 4EBEA 3DLBA 4EZ6A 2GHVC 1RKJA 1NXIA 2JNJA 3I82A 2AD9A 3K0JA 3R1HA 2NPIA 2PT0A 3EGZA 3FK4A 3K5LA 4ZJQA 1H74A 2J0XA 1IKXA 4RW4A 1S99A 4DL0C 3BGLA 1IKYB 2QFJA 1N48A 1C2PA 4MIWA 3TUIC 2LQBA 3AQOA 3NCPA 4N8OA 4JI2F 2CZVC 3C16B 2MQPA 2RILA 4NCAA 1WORA 2JLEA 3SEOA 1BE4A 1CULA 3KLGA 3AJ1A 4LR9A 3BGRA 3RJMB 2HHWA 2E5GA 4YB7A 4Y6IA 2OPQA 3BDEA 1B0VA 5DZ6A 1CJKA 1HHSA 1Y5NB 1X9SA 4PWWA 1X5PA 4WFZA 3KK2A 3L09A 2QLWA 3SCLE 3QGIA 4JOUA 3H59A 4ED4A 3TZZA 2ZWPA 4F4XA 1I51B 5HL7Q 3KK1A 3HSZA 2K06A 1DY3A 4F04B 2E9TA 2DD8S 4W90B 3SV3A 2AZ1A 4NASA 5F3TA 2HPUA 3O1LA 5KT2A 5D4LA 3EPIA 2XSFA 3JSMB 2FUG9 2ALZA 1ZS6A 3C15B 1YIJS 3UN3A 3C6TA 2YNGA 1BHNA 2RRNA 4IR1A 4ILMA 2HAFA 1DTTB 3C6UA 4A4JA 5KFRA 3TAMB 5IQQA 3BR9A 3HSDA 4ZP6A 2Z2ZA 4OQJA 1NK0A 4Q43A 4ED7A 1SJRA 4GVBA 3JYTA 2HVZA 3Q83A 3I56S 1S7IA 2OJ3A 2R8IA 4J91A 5K9FA 1ZTWA 2DGWA 5D4NA 3V2UC 2BYCA 5CCMA 3P49B 3ISND 1JLQB 1K9MT 4CYUB 2CQHA 2RQ4A 2FHKA 3NLCA 2RHQB 1MNEA 1MLAA 2D7SA 2OMLA 4KTQA 2W9BB 3R2DJ 5KT6A 1CLFA 2CQ1A 4NX9A 4H4MA 3D7SB 4DV4F 2ADBA 2V2QA 4PG8A 2R2RA 1FNOA 2XLJA 1FVQA 1AUDA 2Z2LA 2PEHA 5AXKA 4EEYA 3LP0A 3NGDA 2KG1A 4M5JA 1WSRA 4XDCA 4NZ7A 2P9CA 2E1MC 2K2PA 3GIKA 1KHVA 4ED0A 5C2GA 4CH7A 1RE1B 5GMEA 3UDLA 4ZMMA 4LF9F 1D3WA 5C42B 1G6BA 1L3TA 1X0FA 2W25A 4X62F 4D3HA 1KFSA 1NPPA 2XYGB 1R0AA 1B70B 4JI4J 1TK5A 2KM8B 1R8CA 1KHWA 1UMJA 2K1RA 2DNQA 2K3KA 3DCAA 3GFZA 2FY8A 3OPKA 3QLHA 2VPYB 4WIIA 2CKWA 4PWDA 2J8AA 2MYFA 3GG0A 7AT1B 3TZYA 3V81B 3FBEA 2JEGA 3IM8A 4B17A 3G8TA 4CO3A 2Z4PA 4ANEA 2MGZA 4HYKA 3R3TA 2NXNA 2GS8A 1W25A 2AJFE 3OT9A 1D09B 4IH7A 1M5KC 1GFWB 2UXDF 4PXBA 4YUDA 2V63A 5F0WA 1WF1A 3JYTB 2L08A 3BQ0A 3HHLC 3MPYA 1K8AT 3UCGA 3PHEA 4XTTA 4QW9A 1DTTA 4ZN3A 3DM2A 5DM6Q 1S49A 1TL7B 3KLHB 3G86A 2VV5A 1YLXA 3JQKA 4RNMA 2HQDA 4K2JA 4J9QA 1UVJA 2DNLA 2EFPA 3HCXA 3M30B 4LUBA 2EFVA 4RNFA 4DQPA 4KHPJ 3EXYA 3LOUA 1XBWA 4EK2A 1YJRA 3PJ9A 2ZOGA 4OYZA 2QG9B 2HK2A 2KH9A 3EPGA 2LP4A 2BQRA 3CJ2A 2HQ3A 3O6QA 1HWKA 3HJVA 1YHQS 3H98A 1N5VA 1FERA 1FRIA 3M32B 4NZ0A 4DPWA 2BJ9A 3W2WA 4U8YA 4FVMA 1FDAA 3AY0A 3FCVA 2DNOA 1C1BB 3LANA 3QT8A 3DDKA 4OJGA 2WW8A 3QIPA 4RWWA 2YPZA 3ZTPA 3CJRA 3JSMA 3R1LA 2CNKB 2BZ2A 4UQGA 3V4MA 4QYZJ 3C16A 4C3MA 2AJ4A 1AXQA 3BV8A 2OPRA 3OL7A 3CJ4A 2YX4A 1WG5A 4CP5A 3PR5B 2FJBB 2WSFC 2F4FA 2BMBA 3T5HA 4ZPAA 4EFAC 3PX4A 2R7XA 4CNZA 4J9PA 4U67Q 2D3OR 4DFKA 3MFHA 1IXKA 1S1VA 3VAIA 1A6LA 2AJ2A 3J81j 3MTKA 5DG8A 2ZM6F 2MY8A 1JWWA 3VAGA 3GJSB 5H9EK 3ISZA 4X65J 2EBEA 1IM4A 3RBEA 3K2YA 1QD1A 1YVFA 1PIEA 5LM7E 2ZH5A 4QBUA 3V6KA 3VAJA 5KTQA 1RI7A 3L3CA 3ZXWA 2FLPA 2HRUA 4K4YA 1IR0A 4ZLNA 3DYAA 2F8EX 1OO0B 2H5IB 3SFUA 5LMNJ 1ZETA 4B9UA 3NNAA 1RHQB 3RW6A 1R31A 2VU5A 4X84A 1QTMA 4QWCA 1FA0A 4J9RA 4DSIA 4IDKA 1KD1T 1VQYA 4B9VA 2HS4A 3WC2A 4LQ3A 1CVJA 3FMBA 5KFPA 1UTAA 5U47A 1UW4A 1NKCA 4C8YA 3UN2A 2GV1A 2M5YA 1E6VA 2OMOA 1Y3KA 2FLOA 2HWHA 2MKHA 3ZFVA 4X4QA 3OJUA 2MQ8A 4ILLA 1MMDA 2OFHX 2DKOB 5E7OB 2DH7A 3NGSA 5E41A 2MXYA 2YY3A 2CNLB 3JS9A 3Q24A 2AEJA 1LK5A 3BKTA 3CDUA 4P2SA 2W9BA 2HHTA 4F8RA 1PCAA 1PYOB 1SIZA 1RKIA 3I4HX 3ILOA 5ETOA 3WHIA 1CJUB 2HBRB 1NK9A 4I0WA 5I42B 4AQYJ 2ABYA 1U7LA 2OGUA 3BZQA 4CCHA 2FHJA 8ATCB 5L1LA 2C2EA 2WSCC 1CJTA 1VRTB 1Y3JA 1JB0C 5LXYA 2ZWOA 5F8MA 1S72S 2MSTA 2JL9A 1X31C 3IRXA 2GHWA 4OJHA 2JZ5A 5G4DA 3SFGA 3SQOP 1OMSA 1JLEA 3G87A 1J5OA 5FDLA 1NU4A 1RT4B 1KN6A 4JI6F 1HQ2A 3NXZA 1V6HA 3JAMY 5JVHQ 4H4KA 5DLGA 4DUYJ 4LF4J 1OYEA 1TKZA 4Q45A 4X64J 4B3SJ 4CLLA 3ZZ0A 1Y4ZB 3CJ5A 2X3DA 1NCLA 5CYQB 3GIIA 3W8GA 5KFOA 4DN9A 4RZRA 1U48A 1N36F 4DN0A 3MFIA 1HNVB 1UWBA 4KYZA 5ETRA 3KHHA 3V81A 3JB9k 2E5LF 2UP1A 4LF8F 4FF4A 3CJ0A 2HNZB 3K57A 1I6JA 2NUUG 2ZE2B 2BUNA 3FBBA 1YRTA 2FZGB 3PHTA 1R0AB 2YNFB 4JI1F 2BJEA 3I0RB 3KHGA 3MI7X 1FEEA 3FCHA 3OQ2A 4CLFA 2ZHBA 1YTYA 2R8KA 3LGNA 4FYDA 2RUGA 2MMYA 3W9JA 1IBLJ 2AGQA 3FGVA 3KG4A 4JI0F 5D0EA 5F0UA 4F0KA 4GKJF 3CJ8A 2B7CB 4ZN1A 4GC6A 4IDKB 1ZM4A 2M0GB 2X1AA 4EMDA 4HH1A 4LSNA 4QWAA 2ASJA 1N4LA 4NYPA 3QRQA 1HPZB 2ERRA 2O1PA 2RU9A 2E29A 3CMQA 3ILLA 1KONA 1HKAA 1O6XA 4PYAA 5GADU 1D9FA 1GMWD 4RW9A 5KFMA 4MKYA 2K3IA 3MEEA 4LF5F 3QJPA 3A3PB 4NRUA 1HQUB 4RBTA 1KQSR 2QRRA 2DRDA 4LFCJ 1WOSA 2IRXA 3TAQA 4C8LA 3CSKA 3TAPA 1FRHA 2DITA 2Z8QA 5IWAF 2W1BA 1F9FA 5CHCB 2CQPA 2QTWA 1MROA 3BEGB 4DV6F 3MD3A 2ZDOA 2GIRA 2XTJP 4EZ9A 3EGWB 4DBQA 1HA1A 5HN0A 4YFUA 3ZTOA 2F40A 4AQYF 1FJGJ 1TK8A 1FRXA 2VUGA 1UFKA 3BPDA 1WEYA 2M7SA 4TU7A 3PV8A 5BJRA 4WK1A 4X62J 2IRYA 2XYHB 4ECYA 1NEEA 1UJ5A 3EDQB 2WVDA 3MMJA 4OYAA 3SBMA 3TJAA 5J2PB 4Y2IA 2XI3A 5GMDA 3HFVA 1HARA 1HI1A 2EPIA 2YKNB 5I4MA 2YWWA 1HHQA 1HQEB 4LR8A 2BKNA 3D0HE 3RG6A 5C24B 1FF2A 4ZIVA 3CC4S 1MMLA 1CC8A 4J9SA 2Y1RI 5A6WA 3NNHA 4RUHA 2I9SA 3DRYA 2NXJA 4WU2A 3R27A 3C6TB 1A0OB 2CZ4A 3UE2A 1KQGB 4TYAA 2BR0A 2D3O1 2DO0A 4N47A 4PG6A 1SPBP 2WOMA 2P9GA 3Q8SB 4WU3A 1VJWA 2LXIA 4WTYA 1C4CA 3V6DA 1U1KA 4UOCA 2XM3A 2XLIA 3NBPA 1OY9A 4M5HA 3A12A 3ICLA 1JNRB 4ER8A 3TYTA 4FPIA 2GFFA 1JQGA 3U1MA 5KFUA 4IG0B 1VR6A 2CPHA 4PAAA 1RB0A 2UU9F 1F5CA 3MOJB 1HQUA 4BHQA 2W24A 3QT7A 4UOFA 2FYXA 3QZ8A 4OHYA 4WFYA 2KHDA 2MKCA 4KO0B 1YJNS 4ETXA 4HI2A 3AFGA 3HD2A 2YKMB 4I6WA 1NB7A 2F4VF 2V8VA 4PABA 3L7UA 5IWAJ 2GJ2A 3EWGA 2XCAA 4NLYA 3RR7A 1IKYA 3KUHA 4AUKA 4OV6A 5G0RA 2DGSA 4LF5J 2CG4A 2Q43A 3C14A 1U1RA 3FKBA 3P4UB 4O23A 1S6QB 4LMZA 2XG8A 2HVEA 2CPIA 4WFNQ 2KFNA 3MMAB 1J5EJ 1JLBB 5ETQA 1D8ZA 3TZXA 4F50A 1UKUA 5IS2A 5T14A 1TKTB 3T6JA 3TAMA 4OL8A 2VKZG 5H9FK 1U6FA 1RT6B 5F41A 4OYIA 4GKKF 1EP4B 4LVNP 4EI2A 1R89A 1XR5A 2G0JA 2WVFA 2DH8A 4KH1B 4LRBA 4OJ1A 3SDEA 4DR5J 2MTLA 1FXRA 1GEHA 2LKZA 5KFDA 4NOHA 2HMIA 1M1KT 2JOQA 2P6SA 2WBRA 1M1GA 4DR6J 5LL6d 5JXSA 4QPXA 3RB6A 4IKAA 4TVAB 3TVYA 1FD2A 3P96A 3HULA 4WPAA 3P8BB 1RAHB 4Q2LA 1T11A 3EX7B 2VICA 3FQLA 3TO8A 1FJEB 2RAQA 2H48B 4Y00A 3VAMA 5L8RC 1GX5A 3E2EA 4D3GA 4DCJB 5B0FA 2VBZA 3CCQS 5IM0B 1U1QA 4KO0A 4DLEA 4C3LA 2POKA 1RBLA 4QIWD 4DFJA 2J6SA 3E3XA 1U0SA 3GILA 1PYTA 4EO8A 4CLUA 5KFNA 3ZTSA 4DFMA 4KY3A 4MYTA 4PZVA 1IBCB 1BWEA 3RUBL 2YNHA 1O0PA 2WVEA 2A1BA 3QMQA 1CS4A 3T41A 1RTDB 1U8WA 3MAQA 5A8RA 2UXBF 2BBEA 2ZBRA 3MR7A 3M7VA 4ITSA 1M1HA 2GMHA 4K4SA 4Q7AA 1DAXA 3QT5A 1KVKA 2YQ0A 4X4VA 1I94J 4WYLA 4ETZA 3PIPQ 1B64A 1FESA 1T9WA 1VLYA 3LW5C 2WTFA 3TI0A 1W2BR 3UNYA 4DF4A 3IAS9 3VZHA 1MG7A 4IR9A 2FB0A 2HNDB 1RACB 1TKTA 2JFKA 3PEJA 3BN4A 1F5BA 4R5PA 5IT0A 4NLGA 1HYSB 1R8AA 4NPOA 4UOHA 3NL0A 1MWQA 4ID8A 3AOAA 3QWUA 1S1TA 4PQUB 4ZP8A 5AE3A 2U2FA 5A2QY 5K20B 1LWCB 3A3NB 3W61A 3ZZZA 2W7PA 3G82A 3KXDA 4ZOSA 4DV7J 4DF8A 4E2FB 2G1DA 4TNOA 2A10A 2XMAA 1J5EF 4PG4A 2DHAA 3W66A 3M4XA 3BS9A 4DX7A 4I56A 5M2PA 3C2PA 1IBKJ 1SL0A 2RQMA 4DJBA 3G96A 2OPPB 4MKBA 4YY3F 1XMOF 3MR5A 2NSCA 3B78A 3MEKA 1SJ4P 3EJMA 1ICEB 1S1WA 5AJ3F 2AYEA 4DPOA 4ELTA 4OI0A 4M8LA 5CYQA 6AT1B 1MROB 5L9NA 3PW7A 2X1GA 3NWGA 1RAFB 4K2XA 4NA2A 2EFGA 3QT6A 5A0YB 3GV5B 1LWCA 1FKOA 2GQ2A 2HEKA 4KC5A 3SMZA 3OV7A 4HLBA 4DSLA 1JLGB 3SI8A 2MHEA 4HT5A 2VOOA 1TAUA 2DEIA 2W7AA 3F41A 2VB6A 4NLUA 1NZAA 2VL1A 2DBBA 4QW8A 1Q82T 1HD1A 1NKEA 2QL5B 1AZSA 3DKDA 3JTPA 2KJWA 3H5YA 2R8GA 2R42A 4OZNA 2BACA 3NS6A 3TUZC 4NLXA 4W98A 4GMKA 2J6UA 3FMWA 3M30A 2V9KA 5ADZA 3M1VB 1VRUA 2IM3A 3B6BA 3M8SA 2VG6B 5J2QB 5BR8J 2JH3A 2MLZA 4DCPB 2GNKA 2VASA 2MZQA 2ZD1B 2F1FA 4U9RA 4DSKA 2YWEA 4ANCA 4CQ1A 5A8WA 1LXNA 3OL8A 2M4MA 2OEKA 4MJKA 2F8HA 2MHNA 1B99A 2V2ZA 3A13A 1TFYA 4RJVA 2ROEA 4PCQA 2GZOA 1MN9A 3G8QA 4HEA9 3JAMU 4DQSA 1NK5A 1P8GA 3PXGa 2CQ3A 1HNVA 1UWBB 3EYZA 4OI2A 1JXEA 3CDEA 1T9YA 1RT3A 3CGIA 1LFWA 1GNKA 1S1WB 2OSQA 2VBXA 3CB4A 4ZP7A 2PGCA 3DDIA 5E0OA 4FYXB 4L3NA 2YWKA 3D6FB 4OX8A 3SCKE 4UW2A 4KV8B 1WTFA 5CH7B 4YB5A 2JFDA 4UTGA 2LDIA 1FVSA 5ETLA 3SSRA 4NLWA 3GP9A 3KUGA 1RT7B 2D9OA 4ZPDA 1H98A 1HL6A 4TQSA 2E5LJ 1U0HB 2LU1A 1NJZA 2ZBPA 2QA1A 2W9AA 1YGYA 2F63A 4LF2A 2HHQA 1OPIA 2O66A 3IBCB 3L7OA 1DURA 1APSA 2LQ5A 3VCDA 3D0GE 4A8MP 4C6AA 1IBMF 2HHXA 1PC5A 2QMUB 3AH6A 2E5IA 4NCBA 4F02A 1KFDA 4I2PB 3GLJA 1RJJA 1HR0F 2LXUA 4KSEB 3MPVA 1EHWA 4E8UA 3BKFA 2Q6BA 1F6TA 2V50A 3ITHB 1F2HA 3RRGA 1AUSL 3UNGC 4C8ZA 2KKHA 3T9NA 4DU8A 2JVRA 3QRPA 4IH6A 4AL5A 2IJNA 3D3CJ 1BXNA 1RWVB 5L9XA 3OW2R 3W64A 2B4VA 2C2NA 3MECA 1RWPB 3PEHA 2ACMA 2Z2MA 3LA0A 4AL7A 1N34F 1WOOA 2DYAA 3D1QA 3IS9A 2CJAA 5MAOA 5F9NA 2EK6A 2QN6B 2CQCA 3ZZPA 4CLYA 5KG2A 2FJWA 2I38A 3UWTA 2E1RA 4DR3F 4YN3B 5BYRA 5GAEI 2W2NP 3U7JA 2VFTA 1QAXA 4GRSA 5CCLA 4LF4F 1AYEA 1TL3B 3NGTA 1NDLA 1QM9A 3G71S 2HQGA 4UUXA 1EJ7L 1IJFB 3MEGB 2UUCJ 4CT9A 1GTHA 3NCQA 4FKYA 4F3QA 2PFFB 3MD1A 2DTJA 4DZDA 4KFBB 4USIA 4USJC 2ZH6A 4YY3J 1XMOJ 2DNMA 3FBFA 3OLBA 5C2CA 5CYMB 3CTRA 1RBAA 4E0DA 1U25A 3KDNA 4FZVA 5D0RA 4FDFA 4ZPCA 1VDHA 3TP2A 3UCUP 2XGQA 1BD6A 4O3PA 4ICLB 4FPRA 2WW4A 1RAJA 4XPEA 1TL7A 5LSOA 3MR2A 1NK6A 3I31A 4L74A 5EWGA 4J5OA 2H65B 3D0IE 5GVQA 1JJHA 2DK2A 1QJHA 1FE4A 2EI5A 2QO3A 2OO4A 1RDRA 1S0MA 3K5PA 2Y0SD 5CQGA 1NK8A 4ECSA 3DOKA 6FD1A 2HWIA 1T8EA 3RBZA 4FBUA 1RBOB 4DLGA 1LKZA 2YTCA 1GQEA 2EC0A 5ETMA 4YHHJ 3HZEA 4J9KA 1C1CA 3PIOQ 5E3RA 2XYPB 1LWEA 3VVUA 1FDDA 4IG3B 1HNIA 1RWWB 2HFSA 2C2KB 5DZ7A 1NK7A 2B5JB 4DPTA 2G2ZA 3B8HA 4RL1A 2J7UA 3FRYA 4DV0J 2ZJPQ 2VG7B 2GO9A 3DLLQ 4PYDA 5DS7A 2FTRA 5EX3A 3HVRA 3MECB 1HBOB 2CNNB 3R8YA 1I94F 1SH0A 2KYZA 3G6VA 2X1FA 2X51A 4CLSA 4U96A 3BYRA 1EARA 2PIIA 2YQ3A 3MPWA 4IH5A 2R7UA 3VGSA 1QUVA 1QSYA 1TL5A 1DTQB 1SC3B 3AT1B 1ZH5A 1CEZA 4LBHA 1IJEB 4H4OA 2ZH8A 4G3IA 3DGVA 5F8IA 4ED5A 1VOMA 3V6DB 3NEKA 4KR0B 3IWXA 2DCUB 4AE5A 1KR4A 4LF7F 1S59A 4NE9C 3ZZUA 3HT0A 3OTBA 3R7BB 1S6PB 1BMQB 3I0SA 1OPZA 1HPZA 3CCRS 2FJVA 3CC7S 3KLIB 4CO4A 1VIXA 4I7FB 1RWXB 4QR1A 2KFYA 2ZOMA 2OAUA 4NYOA 1Q5YA 5IC6B 2E7VA 4ED6A 2XWXA 4YQWA 2DXEA 4OMFG 2PE8A 2W4PA 1REVA 4GVBB 1HBMA 2A2CA 2H3EB 2V2VA 2HHUA 2IDLA 3UCZP 1IR1A 1PAEX 4CM2A 4R8UB 2XHCA 3H0PA 2AEFA 2CADA 1VI7A 4BC7A 4DL6A 5K5MA 1HNXF 2OSRA 4WP3A 2QL7B 4DPYA 4JI3J 4A8KA 4FVCA 3G2XA 2XMJA 3R6LB 4DCOB 2WHOA 4ZCMA 2W2MP 4IG0A 3CD5A 4B3RF 3PRDA 5K8PA 1Q8BA 3RAQA 2B4UA 4OI6A 4RWXA 3S1TA 4WF9Q 3QATA 2IM0A 1S4EA 2BEFA 4A48A 1S48A 4MIAA 1B0TA 2XO7A 3DI6A 4DR7F 3PVXA 4ZLLA 1Z1ZA 2HMIB 2V34A 1LXJA 4ED1A 2D69A 3Q2SC 1T94A 2M2BA 2RQCA 2MQQA 2GVDB 3EDRB 2FDNA 4PXEA 2HFOA 3HKZD 1NHVA 4EWTA 5KFGA 5D3GA 1SCJB 3NGRA 1P9QC 1M5OC 3DRSB 3R7SB 1E6YB 4OHVA 3UD5A 2BE9B 3CDBA 1HWUA 2FHOB 2ZFHA 1KS2A 3M2RA 3CUNA 3Q2TC 5H1SV 2VC0A 1WHYA 1FWPA 3AXKA 1XERA 2MSSA 4U8VA 5B0GA 5HMZA 1R0CB 3M9MB 4F4KA 3UO0A 2CRLA 1NRKA 4I7FA 3J7YI 5IT9U 2L9WA 5ETSA 5KG1A 2HLUA 5KOXA 1M0SA 4ECUA 1X0PA 4NLDA 1D0EA 3AA8A 4X4NA 4NA1A 2ZH7A 3HI9A 2J6TA 2L41A 5DM7Q 4O4GB 2PDAA 1U2CA 3QLHB 4CLZA 2E66A 2C42A 4PWDB 4JBCA 3K89A 2RDIA 2ILYA 4LSNB 4C7QA 2PI5A 4K59A 1ZOTA 3O2IA 4C8OA 4LF6J 3S8SA 1DLOA 3AD9C 1MSWD 1Q16B 3F56A 1WTBA 1S0VA 3P5BP 3UVJA 1L3VA 5HI7A 3H25A 1OSCA 3OXLA 4N5SA 2ZH1A 1S0NA 2MKYA 1U1PA 3IFEA 3M32A 4M5LA 4CRJA 3M8RA 1KNZA 4WKYA 2NREA 1YSJA 2CNOB 3W3SA 3THTA 3J80U 2K7JA 1R43A 3HVTB 2CWXA 2MB0B 5CZVA 2Y8WA 2KG0A 1FWKA 3FBCA 3TA1A 2NXEA 2P9EA 4CO1A 2MQOA 3OVAA 3AOCA 4FF2A 4K4UA 1VRUB 1JLAA 2B5JA 4NLVA 4OI1A 1RA6A 2V5HG 2QSFA 2R8HA 4EBCA 4Q0BA 1N33J 2J8SA 1Y7PA 1PILA 3GCWP 2NCKL 3I96A 3N5BA 1H7WA 1V3ZA 3ETOA 4HL9A 1C1CB 1JX4A 2O67A 2HNYB 2F8MA 1Q8IA 5KFZA 2R7WA 4HVZA 4FS1A 3TZWA 1L3SA 3DRXA 4JI5F 1XQIA 3E01B 3GWCA 5K8NA 4K50A 3P3DA 1JLEB 1S4FA 5A2QU 4G1IA 3FDSA 3OR2A 3R5JB 3A1YG 4U6PA 1RGVA 3T3FA 5I42A 2PA3A 2QZ8A 3W9IA 1UEUA 4J9UE 1XNRF 2DPIA 5KFBA 4L3KA 3BSCA 2HFNA 3OXGA 2PD1A 4RUAA 4KJIA 3I6PA 4WFBQ 1WG4A 2A2DA 2HGMA 4OHWA 2ALYB 2J7KA 2XMUA 4C8KA 4PR6A 1U2FA 4K7QA 1U26A 2CXEA 4I69A 1X9WA 1UFLA 1WG1A 2Z58B 2EXUA 2K8GA 3LP1B 2CPZA 1FJGF 2LEAA 3LPYA 3OR1A 4DR5F 5D0HA 4B02A 1C0UB 1S1TB 1WEZA 1YJ9S 4PQUA 3TEGA 2BX6A 3PCOB 4UY85 3D5MA 2FVSA 1PBAA 2AYMA 2CQ4A 2DY1A 3UDEA 3RAXA 2DGOA 1GMUA 4QWDA 4IFVA 3MM7B 4K8RA 1EZZB 3HD1A 4DL3A 1JLAB 1OYDA 3BM7A 2MZJA 1CQNA 2OPPA 1EP4A 1S6OA 2QEXS 4TY8B 3HO1A 1A9NB 1XR7A 2DR5A 1W26A 2AX1A 1TFWA 1IKXB 4NI2B 2I5JB 4MT1A 5BYQA 1SBRA 2BKPA 3T1YF 1F5AA 3EMTA 5HMXA 3GIMA 4USUA 1EETB 4DQQA 3WZ0A 4KKOB 3BB5A 3BGFA 4TY9A 5IT4A 2QSWA 2R2SA 4J9LA 4DSEA 5IOLA 2BKOA 2VPWB 3M8PB 1U47A 1NJWA 4JV5J 4UQTA 1N5QA 1PC4A 3UFCX 5F9LA 1F9EB 1NUEA 4GC7A 1O5JA 1EIYB 3TQEA 2HIYA 2QYCA 1HNZJ 1IWGA 1DFDA 1BUXA 1JIHA 1N5SA 3H7HB 2BQUA 4JYAJ 5HBMB 5DDOC 4Z7CA 5HAOA 3MCOA 4OHZA 2KRRA 4I1TA 1NJIT 2LFVA 2AMCB 2BW2A 1Q1KA 3IRXB 3Q8RB 1DQ9A 3ZNUA 5D3GB 3HT3A 2J9DA 1Q4RA 1ULRA 1PBUA 2ZNZA 5E2QA 4UF4A 2PMZD 5LSRA 4Z2XA 1HNWF 3BF4A 3LQVA 3W8PA 2QLJB 4RW8B 3RW7A 4ES2A 1VQ5S 2HGNA 2HS0A 4JB8B 4ZVTB 1CPZA 4OX9F 4CTAA 4DUZF 4HTIA 1RT4A 3SCIE 4NWBA 3PX0A 2EFQA 3Q89A 4DDFA 1YZ6A 5LMUJ 1SJ3P 4ZA1A 1FTCA 1YBUA 3DU5A 3KMQA 5HLFB 2R7RA 2GVZB 4A8SA 3QGGA 3POTB 5HJYA 2P2CB 4CWBA 1Q53A 1SUQB 2HK3A 3KNGA 4U95A 5GAGI 5J2MB 3VAKA 1PYSB 3EUNA 3MMCB 3DGPA 4GVLA 4NXMJ 5E3PA 1Q8KA 4QCLA 1FFSB 1U1LA 2C2DA 2J7WA 4DSJA 2IMWP 3PO5A 4EUVA 1EX8A 1WSVA 4IQMA 3LGHA 3K7RA 3SSSA 2G9OA 1RCXB 2B9EA 3ISNC 2C1EB 2PMWA 2MKSA 3NAHA 1IM6A 1FDBA 2I1RA 1D9AA 2DNHA 2DNPA 3AJDA 3BBBA 4LQ9A 3W1YC 3ZZOA 4RNOA 4JI7J 5A0YA 2UUAF 4HKQA 1A7GE 1RWKB 3GTYX 3MEDB 4KHRA 1DARA 4L73A 3IMQJ 3CMES 2MGZB 1Q8LA 3ENAA 3OL6A 2OI2A 3H5SA 1RU2A 2NLWA 4N8NA 2W4DA 4AFFA 3Q8QB 1LK7A 2HLTA 1UVKA 3PRVA 3RRKA 4OYWA 2UXCJ 5HSPA 1VK8A 1U02A 2GMLA 1J2VA 1VYAA 3AAWB 1FD8A 3CO0P 3FSIA 1U6ZA 3BSNA 1D9DA 4OZ2A 4IG3A 3FRZA 1K0TA 2PI4A
chains in the Genus database with same CATH topology
4J90A 2OGUA 2BKOA 4L75A 4RO0A 4EI2A 4L74A 1LNQA 4XTTA 2AEFA 4G65A 1VCTA 3JXOA 2AEMA 4L73A 3RBXA 3RBZA 4J9UE 4J91A 2FY8A 4YS2A 2BKPA 3L4BC 2BKNA 3KXDA 4J9VA 4GVLA 2AEJA 4J7CA 4L76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J90 A;  2OGU A;  2BKO A;  4L75 A;  4RO0 A;  4EI2 A;  4L74 A;  1LNQ A;  4XTT A;  2AEF A;  4G65 A;  1VCT A;  3JXO A;  2AEM A;  4L73 A;  3RBX A;  3RBZ A;  4J9U E;  4J91 A;  2FY8 A;  4YS2 A;  2BKP A;  3L4B C;  2BKN A;  3KXD A;  4J9V A;  4GVL A;  2AEJ A;  4J7C A;  4L76 A; 
#chains in the Genus database with same CATH topology
 4Q2M A;  1Q7L B;  1FJ7 A;  2Q66 A;  2F9D A;  2Z56 B;  3NBP B;  3WX4 A;  2F3J A;  3OR1 B;  3LP0 B;  3UPF A;  3KLF A;  2RRB A;  1I5O B;  2GAH C;  4NRT A;  4P7V A;  4XIU A;  2U1A A;  1VQ9 S;  4IOC Q;  3TA0 A;  4YB1 P;  4V1A k;  2R2T A;  3FZB A;  1X5T A;  5DO2 A;  4FXV A;  4C98 A;  4LF7 J;  4DUY F;  3TW0 A;  1T7P A;  4KH0 B;  2CFX A;  5CYJ A;  1FRJ A;  4O0N A;  4EYH B;  4ICL A;  2NXU A;  4ALZ A;  2ZH4 A;  2OH2 A;  5B0E A;  2AQ4 A;  1RT5 A;  3UD3 P;  3IR5 B;  3FFI A;  3MCM A;  1EAY C;  2DNZ A;  2B8P A;  3NOC A;  2JC0 A;  2H5E A;  1LW2 A;  1QTN B;  1S5Z A;  2I8E A;  4HT7 A;  3AOD A;  4KRW A;  5C24 A;  4EGL A;  3CMA S;  1H2V Z;  3HHL B;  1VQ7 S;  2ZHO A;  4P71 A;  1IBL F;  2XS5 A;  3H90 A;  4PQA A;  3DHX A;  4KGZ B;  1ZM9 A;  2H5J B;  1RAI B;  4MK9 A;  3RU0 A;  1YJU A;  3OVB A;  3DHW C;  2OD4 A;  4KIA A;  4IO1 A;  5HMW A;  2EFO A;  4WXO A;  3FCW A;  3T1H J;  1RT1 B;  1U1M A;  1LW0 B;  1YJV A;  1HD0 A;  1Q79 A;  5KAK A;  2ZZM A;  2HS3 A;  2I5J A;  3CDA A;  3CCJ S;  3I32 A;  5DQG A;  3M2V A;  3CE8 A;  1N88 A;  3BGU A;  2HQI A;  4M5N A;  5KG4 A;  3DLE A;  2CPX A;  4M5K A;  4NL5 A;  5D4P A;  3VAL A;  1TU0 B;  1UP1 A;  2EVZ A;  3PM9 A;  1FXD A;  2K1R B;  2AEM A;  3S7R A;  2C28 A;  3PY8 A;  2CDQ A;  4NEY A;  3HKW A;  3GCX P;  1AT1 B;  5CZX A;  2UUA J;  2YKN A;  3CJK A;  4WZM A;  5HBM A;  5F8J A;  1Y0H A;  2CQG A;  1MWZ A;  4DV2 J;  1XNR J;  3VAF A;  4P7T A;  1K1Q A;  1I1G A;  5HVF A;  3EZ5 A;  4ZVH A;  4DV4 J;  2DHH A;  5KG5 A;  2VFU A;  4RUB A;  3L7P A;  1FKP A;  1RTI B;  1K47 A;  2CJ9 A;  2QE5 A;  2CZ9 A;  1RWO B;  1UEK A;  2YPY A;  3D28 A;  4P6Q A;  1HBU A;  3IN5 A;  3GQC A;  1T0T V;  4FF1 A;  2F4V J;  1C0T B;  3H20 A;  2ZM6 J;  4P52 A;  1RK8 A;  2CYY A;  3VQS A;  4BLG A;  2KT5 A;  2RD5 C;  3A8K A;  3MCN A;  1RSC A;  4MKA A;  5KFA A;  3PYG A;  1X4F A;  1FDN A;  2CQI A;  2EFN A;  1TMJ A;  5HQ8 A;  2CUY A;  4C8N A;  4YR3 A;  4TKT A;  2E5J A;  1NND A;  2L9D A;  3HMJ G;  1YRX A;  4ELU A;  2KZZ A;  1TMM A;  4BWM A;  4K0K J;  2ZUG A;  4G1Q B;  1KVI A;  1XR6 A;  2RF2 A;  2MQN A;  5DLF A;  3AHP A;  4LF6 F;  3CCU S;  2JWN A;  5LJ5 Y;  1RWU A;  3L4B C;  3AB4 B;  1JLC A;  4HI1 A;  5C25 B;  3EM1 A;  4LSZ B;  4RBV A;  1SKW A;  3TRG A;  1KTQ A;  3D54 A;  3HVW A;  4IFY A;  4B08 A;  4ELV A;  4J37 A;  2OEJ A;  2V0N A;  1HW8 A;  3HSJ A;  4RU9 A;  4W4M A;  4ZLP A;  2CVI A;  3S6E A;  1TAQ A;  3QIP B;  4OZ3 A;  2JLG A;  1LW0 A;  2NR0 A;  4NML A;  4WFA Q;  2RE1 A;  4OYX A;  3T1Y J;  2EKY A;  3BKU A;  3QFH A;  3RR8 A;  3OR2 B;  3OTE A;  2RDD A;  4F0H A;  5J1E A;  4DV6 J;  3AJ2 A;  3ONQ A;  3R9L A;  4CH1 A;  5K8M A;  5A8W B;  3DLG A;  1H7X A;  1CS4 B;  4DI6 A;  4O3Q A;  3DRP B;  3H4D A;  1RTD A;  2XS2 A;  3RYL A;  2QL9 B;  4A8O A;  1B0P A;  1CJU A;  4ZIT A;  2NUH A;  2MPU A;  2ROG A;  3FZ2 A;  4G6V B;  1WF0 A;  2VQE J;  2YQ1 A;  2IA0 A;  4A8W A;  2R7V A;  3QJL A;  3CCS S;  1UWA A;  1RYS A;  1S76 D;  3I9V 9;  4OZ0 A;  2W7O A;  1N56 A;  4RW7 B;  1M5H A;  2VFV A;  2KDO A;  1GMV A;  1TV6 B;  1URN A;  1HBN B;  2VHG A;  3D6T B;  5F8G A;  4USM A;  1VRT A;  1CJK B;  2DJW A;  4DR1 J;  1N5Y A;  4B9S A;  1FXL A;  4QWE A;  3HVA A;  5ETK A;  1R27 B;  1PO6 A;  4YME A;  3C3L A;  3O8W A;  2BA9 A;  2A18 A;  2HFU A;  4C2M A;  1FJC A;  4I2Q A;  1X4G A;  4KE5 A;  5C7P A;  2P8I A;  2E7X A;  1V5V A;  2HND A;  4JI3 F;  2G1H A;  2ZIT A;  4KGV B;  1OJ4 A;  2BQ3 A;  2KYX A;  3EXC X;  4GO5 X;  1VC0 A;  3C46 A;  4O4G A;  2QC3 A;  3K8V A;  5HJX A;  3VWS A;  2WVC A;  2VQF J;  3NKY A;  1S7H A;  3GE9 A;  2UVW A;  4JI8 J;  1QE1 A;  4R0J A;  4DV5 F;  1FCA A;  1B7Y B;  4C0H A;  1LV5 A;  3D1H A;  1VBK A;  2BE2 A;  4FNI A;  3EE3 A;  4TYB A;  3WC0 A;  4ZVR B;  2DXF A;  3UVJ B;  1HNX J;  2GJI A;  2E9Z A;  2RNE A;  1IN0 A;  3M2R B;  1Q81 T;  2IFX A;  1VQO S;  2QA4 G;  3JQM A;  3CD6 S;  1AFJ A;  1R3N A;  3VGT A;  3I55 S;  1NPK A;  4F25 A;  2OTJ S;  4TU9 A;  2ZOF A;  2J5A A;  1UVI A;  3LAM A;  1K73 T;  3M2V B;  4WP9 A;  1Y5L B;  3R5B A;  1X9M A;  3DLE B;  4DXL A;  4B3T J;  2DR8 A;  1S9E B;  1F60 B;  2D1C A;  4NYZ A;  4PXC A;  3W60 A;  2XNR A;  1ZM2 A;  1IQT A;  3D3B J;  5LOQ A;  3RBX A;  3CJT A;  4DV1 F;  1VQM S;  1CC7 A;  5IC4 B;  4P2X A;  2FHJ D;  3D67 A;  1ZBT A;  3R5C A;  3S01 A;  3BO4 A;  1XMQ F;  1XIQ A;  2M70 A;  2E1C A;  4DR4 F;  1J27 A;  2ZD1 A;  4QIE A;  4CO0 A;  1KEK A;  3MM8 A;  3SV4 A;  4F4W A;  2ZZN A;  5M2R A;  2AJQ A;  2YNH B;  3W2V B;  2XY7 A;  2HYI B;  1OQ3 A;  1N0U A;  1U8S A;  5KFX A;  2F7V A;  2XZT B;  4DL5 A;  2N4D A;  3HFZ B;  3N6L A;  4MIB A;  2B9Y A;  3BQ1 A;  4BDP A;  3N0V A;  4DL4 A;  2R7S A;  4YB6 A;  2JEI A;  3CIM A;  1UA1 A;  2DIU A;  3AA9 A;  3J7Y U;  4QIF A;  3HXM A;  5CAA A;  3OFE A;  3QNW B;  5HAT A;  4O44 B;  3TEH B;  2MKK A;  3MM5 A;  2AU0 A;  1YIT S;  1Q86 T;  3BDP A;  1X8D A;  5D78 A;  3GZ7 A;  3QBC A;  3NS5 A;  3K58 A;  3HK2 A;  4DV7 F;  1XWL A;  4I64 A;  2VFR A;  3UQS A;  1TL1 B;  5J2P A;  4WZQ A;  4WE1 A;  4I6A A;  2DCL A;  3BSO A;  3GB0 A;  4NLQ A;  3VF0 B;  1QE1 B;  2X1B A;  2BV3 A;  4NI2 A;  4EU0 A;  3TX8 A;  3IO1 A;  2HIQ A;  4DSF A;  2ASY A;  4AT1 B;  1S6P A;  1Y10 A;  3KLG B;  4O4R A;  2J0S D;  4IFY B;  1ZTT A;  3KLH A;  2DEJ A;  2V4J A;  2XSJ B;  3PNI A;  3ZZT A;  1FEH A;  4ECR A;  1Q7Y T;  4WJB A;  3GFX A;  3VR1 A;  4X65 F;  1PJ6 A;  2RF2 B;  5AE1 A;  3Q8Y A;  1OSD A;  1RIS A;  1RHU B;  1SQE A;  2LA4 A;  1VGY A;  1YRU A;  4LRD A;  3DLJ A;  2XY5 A;  1JK9 B;  3MED A;  4NXN F;  1RTJ B;  2A0F B;  4WE1 B;  4CLP A;  4B9T A;  3LO3 A;  2Y1L B;  1S1V B;  4N76 A;  3MUT P;  5I3Q A;  2YH1 A;  4HTJ A;  4R25 A;  1NPR A;  3GSD A;  5LSL A;  4HHU A;  1WNE A;  1EKR A;  1S1X A;  1UEV A;  3ETM A;  2KFZ A;  4B3T F;  4RNN A;  4PUO A;  1VS3 A;  2I6W A;  2KM8 C;  3IM9 A;  2AYB A;  5KT7 A;  3N79 A;  4UZC A;  3BH7 B;  4B3M J;  3MXH P;  2J0W A;  2OKQ A;  2BVZ A;  3MTJ A;  3K17 A;  3ZZY A;  1S0O A;  4FBT A;  3FSY A;  1NK4 A;  2NYI A;  3TX0 A;  4KB7 A;  3CNQ P;  4ILR A;  2UV8 G;  2LDY A;  4DPU A;  1T03 B;  2DR7 A;  4Q8F A;  1FX2 A;  3UW1 A;  1H6K X;  4HHJ A;  1FNX H;  3JTO A;  2FY1 A;  1DRZ A;  3DFE A;  2R7T A;  1F0X A;  1FTR A;  3R5D A;  3JSB A;  3MM5 B;  4L6V 3;  4AXI A;  3MF5 A;  1JNZ B;  2IM2 A;  3GJQ B;  4ZVP B;  2DNY A;  4LBI A;  4OV1 A;  3HPO A;  5D8H B;  2FQQ B;  1VC6 A;  4A8F A;  1TTH B;  1VBZ A;  1AW0 A;  3IBF B;  3BPS P;  4QZV B;  3KJV A;  3T19 A;  4DX6 A;  4RPF A;  4JI4 F;  4X64 F;  3VGU A;  2ZC4 A;  3EVO A;  2RKI A;  2ILZ A;  3AB2 B;  4NA3 A;  3OFG A;  3TJ8 A;  5KG3 A;  4TU8 A;  3O5T B;  4K4X A;  4DR6 F;  1FHT A;  1YWX A;  2IMO A;  2PN6 A;  3CCT A;  5EHH A;  1N0V C;  2LXF A;  5JMN A;  4LFB F;  5L38 A;  4R0E A;  2BAN A;  4Y0F A;  4FYY B;  3OSN A;  1WF2 A;  2HAI A;  3B4D A;  3DLK A;  3I5B A;  3HP6 A;  4ED2 A;  3W63 A;  2FJD B;  2WON B;  1N6Q B;  2B4P A;  1MU2 A;  2VON A;  1GH8 A;  1H0H B;  2FZK B;  4F4A A;  3AD7 C;  2XHW A;  1N5T A;  3QYY A;  4Y28 C;  3NP5 A;  3LP2 A;  3CVK A;  2AYG A;  2DPJ A;  1F2G A;  3TJ9 A;  1D1U A;  2JRS A;  3AOB A;  2C2Z B;  1RT6 A;  5LXR A;  4CLK A;  3DXS X;  3MUM P;  4BC9 A;  2XMV A;  1UFW A;  3G6E S;  2KRB A;  3BQ2 A;  2LQ9 A;  2GMJ A;  1RHM B;  3F0N A;  1U49 A;  5FD1 A;  1QSS A;  1NSK L;  3W9H A;  1XJW B;  1ZZN A;  1N54 B;  5H9E J;  2UU9 J;  1BGX T;  5HK4 A;  4CDI A;  3H8Y A;  1R0B G;  2WB1 D;  1URR A;  3PX6 A;  2BOA A;  2R9L A;  5KFE A;  4F4Z A;  2LMI A;  1IQZ A;  4JI6 J;  1RCO B;  1VFJ A;  1WC3 A;  4PPZ A;  5EDW A;  3CCM S;  1E6Y A;  1V3R A;  4WBF A;  4RUC A;  3ULH A;  3G8S A;  2ASL A;  1IVZ A;  1C0T A;  3HM9 A;  4JI5 J;  4USH A;  3W65 A;  1WAC A;  5B0C A;  1U2R A;  2AGO A;  4Q8E A;  2FC8 A;  2D41 A;  3MMC A;  4IFV B;  2RRA A;  1XEZ A;  2HQC A;  2UUC F;  1TKX A;  2XMW A;  5I3P A;  8RUC A;  3OTO J;  2J9E A;  1FI4 A;  3N5F A;  1S9G A;  4KPY A;  2H9Z A;  2RQK A;  5LMU F;  1TQL A;  1NJY A;  2BDP A;  3I0R A;  4ED3 A;  4X66 F;  1HYS A;  1TV6 A;  2R7O A;  4X4T A;  3KK3 B;  2MZR A;  4S0M A;  1QAJ A;  4O44 A;  2HQF A;  2Q1L A;  3RB3 A;  1HNW J;  5KFI A;  2YKA A;  5IFM A;  3CDW A;  4Q5V A;  4F4Y A;  2OPR B;  1RU1 A;  3DDN A;  1RHJ B;  3LP2 B;  2M52 A;  1T9T A;  4J9V A;  2AW0 A;  4PWU A;  4AYB D;  4UZB A;  2UUB F;  4M95 A;  3H42 A;  1FRM A;  2BJ1 A;  3NS7 B;  4EBD A;  1UVN A;  2JLF A;  1PAU B;  4ID5 A;  5GAG U;  2G0C A;  2IDE A;  1GX6 A;  3DLK B;  3IAM 9;  4M5D A;  4EYI B;  1RHR B;  1T05 B;  2EKN A;  1R7I A;  3DLG B;  4O3N A;  1QY7 A;  3CJS A;  4LRA A;  5DGA A;  3E01 A;  5I3U B;  2V69 A;  2WVB A;  4HH0 A;  3RZA A;  1KKH A;  2DRB A;  3W5Y A;  2DH9 A;  2D74 B;  2VG5 B;  5L46 A;  3H2V E;  2RSQ A;  4LRE A;  4MK7 A;  1LWF A;  3QAU A;  1BQX A;  4OJ3 A;  5GAH U;  4A8Q A;  2UVU A;  2I2Y A;  2CPE A;  2QLB B;  4KQZ A;  4KHM A;  3US5 A;  4P2F A;  4JUZ A;  1XMQ J;  3NMR A;  2AV5 A;  3I4P A;  1VRQ C;  3MPD A;  3GG1 A;  2RT3 A;  4XAK A;  5T7L B;  4B9N A;  1O51 A;  2ZDP A;  4FXW A;  5E3A A;  1CBK A;  2HBQ B;  3CJQ A;  3M2U B;  4H54 A;  1HBM B;  4MFB A;  2W2Q P;  2GGP A;  4KKO A;  4AND A;  2N7C A;  2OTL S;  4M63 A;  4O3R A;  2DT9 A;  2YNI B;  3IGV A;  2Y9H A;  1HIY A;  1WC4 A;  1YI2 S;  4F2S A;  1HW9 A;  2E1P A;  3BO3 A;  4C11 B;  1TK0 A;  1HHT P;  4OLP A;  2KTQ A;  3JXO A;  2HBZ B;  3LWL A;  3I5A A;  1SI9 A;  4HHH A;  2Y1I A;  3DYA B;  1U09 A;  1M90 T;  2FVQ A;  2XY6 A;  1FKP B;  2HWT A;  2ZKU A;  1QAI A;  2VOD A;  1IWA A;  4YR0 A;  5J2M A;  1V3S A;  4LFA F;  3TOQ A;  4LBP A;  2R7Q A;  4PRF A;  1OY8 A;  4J9O A;  5D15 A;  5AT1 B;  4XDD A;  2QA2 A;  4Y34 A;  3V4I B;  1LQ9 A;  1U6B A;  2L48 A;  3SZ2 A;  1NZ8 A;  3B4M A;  2B9X A;  3CWJ A;  3M05 A;  5A8K B;  4U7U K;  1EET A;  3H4B A;  2VOP A;  1S6Q A;  4L76 A;  3CJK B;  2WCX A;  3FQK A;  2BJD A;  4DX5 A;  4K4V A;  5LJ3 Y;  4X4P A;  2YNF A;  5DET A;  4FNH A;  4ZCL A;  5KT3 A;  2RUS A;  4KGK A;  3ADA C;  3N6N A;  4WK3 A;  4DV3 J;  2H4W B;  2IYI A;  2C2R A;  3OL9 A;  1SJF A;  1N36 J;  3J7A 1;  2E5H A;  2FHM A;  3PJX A;  3QFW A;  2IVF B;  5D6G A;  2KVI A;  1LOU A;  4ZJL A;  2NZC A;  4DQR A;  3VQT A;  3GYX B;  1Y5I B;  1ROF A;  1OWX A;  4OI3 A;  2HG4 A;  4A8Y A;  2LU2 A;  4LRF A;  4YDD B;  1VQN S;  1LWF B;  3HF5 A;  2V8G A;  2R2U A;  4ZVQ B;  1QAY A;  4DL7 A;  4Q44 A;  5THW A;  4DZ6 A;  4Y65 A;  3MM8 B;  1J5O B;  5HLF A;  3IRW P;  2DNK A;  4URG A;  5F8L A;  5J1E B;  1BQM A;  1C4A A;  5E3Q A;  1VQ8 S;  5B7W A;  4ZVG A;  4F36 A;  1WHV A;  2DHG A;  2C3U A;  3MWB A;  1ZAX A;  2BRK A;  4ZKA A;  3CF5 Q;  3IG1 A;  2FJX A;  1Q95 G;  1V9O A;  2EW9 A;  3TUJ C;  5HAN A;  2KN4 A;  1S1U B;  1YK9 A;  2JC1 A;  3SQG B;  3ZC4 A;  1U1N A;  1L3U A;  4DV3 F;  3DRR A;  4DS5 A;  1OQ6 A;  5FII A;  3UDV A;  4A46 A;  2B6A B;  3BN7 A;  2VFS A;  5HQM A;  3LWM A;  3CPW R;  2VA2 A;  4YDX A;  4OIX A;  1MMN A;  1S10 A;  3K5N A;  3VGV A;  3RBD A;  3P6Y C;  5KFC A;  1NHU A;  2IIH A;  4CI0 B;  1P1T A;  2UUW A;  5I3U A;  1XNQ J;  1FFW B;  1K44 A;  4DR4 J;  2DIV A;  1LW2 B;  3MEG A;  4OX9 J;  1T03 A;  1R6V A;  2L9N A;  2YKQ A;  3HFK A;  4OLO A;  4Y3C A;  4Y2C A;  5J2N B;  2XQC A;  1X7V A;  3V4I A;  4JV0 A;  1ZA1 B;  2OHD A;  4A47 A;  1HFE L;  4ZVF A;  4Q0B B;  3W62 A;  2WK4 A;  1YZ7 A;  5FLX Y;  2RS8 A;  2RH3 A;  5IM0 A;  4QR2 A;  1IKV B;  3D1O A;  5L1J A;  5B0B A;  2Z0G A;  2XLK A;  2P5V A;  3KHR A;  1UJ6 A;  5EN1 A;  3WIU A;  2AKW B;  1Y9O A;  3AD8 C;  3DOL B;  4UT4 A;  1EB0 A;  2R8J A;  3V6H A;  2JX2 A;  2YBV A;  1VHF A;  1LNQ A;  2MY7 A;  2KZM A;  1JMT A;  1RAA B;  2YNI A;  2HHS A;  3FEY B;  2IPO B;  1SIW B;  1DLO B;  3QJJ A;  2RHS B;  3PG9 A;  7FD1 A;  3MM6 A;  3BBF A;  3TVK A;  1WKK A;  3BO2 A;  3CUL A;  2MZ1 A;  1RLD A;  1P9Y A;  1O8B A;  4Y2M A;  3ZZR A;  4JV5 F;  2KL8 A;  2F5G A;  1HWL A;  1X5S A;  2A6M A;  2DR9 A;  1IKW B;  4JP8 A;  2C3O A;  3IC1 A;  1KWM A;  3KUE A;  4WIQ A;  3G6X A;  2V8P A;  1C0U A;  3EVW A;  3W2W B;  1UPM B;  3PW2 A;  1DZ5 A;  2JJ4 D;  4C8M A;  1VBX A;  3T6B A;  1N34 J;  1HQE A;  2N7Y A;  2ZVS A;  3ZTR A;  3K59 A;  3BJY A;  3DOM A;  4DR1 F;  3V6J A;  2DO4 A;  3K8W A;  4RX6 A;  2E9R X;  2CWK A;  1RA7 A;  3CD7 A;  3MGJ A;  4CLT A;  2ZZT A;  4IQX A;  4WCE Q;  2HNZ A;  4QIV A;  4RBU A;  3E51 A;  1OIA A;  3IXQ A;  1UL3 A;  3KYL A;  3NMA A;  1YX2 A;  4MTP A;  4ZVO B;  2QMX A;  1Q78 A;  2PO4 A;  3HHK A;  3WBZ A;  4DOZ A;  1N32 J;  2IM1 A;  7FDR A;  2CPD A;  3L95 X;  1SKS A;  3PFE A;  3CIZ A;  1S57 A;  1SKU B;  5C25 A;  3DM2 B;  4GKK J;  4ENO A;  3FJ2 A;  1HLW A;  4EO6 A;  5DQI A;  2VG5 A;  2AWZ A;  4AXJ A;  2SXL A;  3U27 A;  3ELH A;  2ZKT A;  3DOM B;  3F73 A;  4ECV A;  2EG2 A;  3HHN B;  1G4C A;  4IUF A;  2IBO A;  1BQM B;  1S77 D;  4X2B A;  3OFH A;  4OZL A;  3KTQ A;  4QYZ K;  2YVS A;  1HWI A;  5IZH A;  5DQH A;  2GO8 A;  3A3O B;  3UI3 A;  3FFI B;  4X4U A;  2MZT A;  1QDU B;  2WRM A;  3ITH A;  5L39 A;  1WC1 A;  3N4W A;  5KOW A;  3CCZ A;  3SQG A;  3J80 Y;  3UD4 P;  2FVR A;  5K8O A;  2VDI A;  2KVQ E;  4NLS A;  2VD3 A;  1PGZ A;  1SKR A;  4ZCI A;  2PFD A;  3QZ7 A;  2DGV A;  1JJC B;  2BJ8 A;  2QLX A;  3R5A A;  1Z2Z A;  3DN9 A;  4ZDN A;  2WB4 A;  3MM9 B;  3PRB A;  2MJU A;  5KFQ A;  3FEX B;  3PDN A;  4UST A;  2PMH A;  4A8X A;  2VJU A;  2JHE A;  2A3J A;  2DNN A;  2W2O P;  1RTJ A;  1H72 C;  2AGP A;  1YDL A;  2NZ4 A;  1DHM A;  2BE2 B;  1TL3 A;  5CAB A;  3RRH A;  3TA2 A;  4NEZ A;  3R7N B;  5HP1 A;  4ZJO A;  4BS2 A;  4M5G A;  1F3F A;  3KJN B;  2OPS A;  2ZC3 A;  2NPF A;  1R8P A;  4OYM A;  2DGT A;  2KXH A;  2V8D A;  4OFZ A;  3N6M A;  3J7Z 5;  3H5U A;  1UAW A;  1FO1 A;  3CD0 A;  4CT8 A;  1KLM A;  1G2E A;  2GAG C;  3U1N A;  1GK8 A;  4GO7 X;  2M8D B;  2NXC A;  4IRD A;  4OZ1 A;  1Q5V A;  4AL6 A;  1Z2L A;  2NSB A;  2KT2 A;  2YH0 A;  3PW4 A;  1ZAW A;  3THP A;  1F1B B;  3H5X A;  1LEO A;  2KO1 A;  3M2U A;  4DU7 A;  3M8Q A;  2D3U A;  3BR8 A;  3TNV A;  4F3O A;  3HHE A;  4WP8 A;  3BYP A;  3OD2 A;  1GAO A;  1N52 B;  2R4F A;  4J7C A;  5KFJ A;  5GAH I;  4I68 A;  4ZK7 M;  2UV8 A;  1RAG B;  3VTI A;  4LFB J;  2V8H A;  4LJM A;  1WHW A;  4J90 A;  4C9D A;  1H2U X;  3M9O B;  1UJ4 A;  5J2N A;  3QPI A;  3GFH A;  1KQF B;  5KG6 A;  1NO8 A;  3OJS A;  3MMB B;  4CLW A;  2XZW A;  4OYP A;  2RB7 A;  3OTC A;  5A8R B;  3OTD A;  1NDC A;  3VZI A;  4YP3 A;  1TP7 A;  4H4K C;  4K4Z A;  1WWH A;  4TN2 A;  1FWL A;  2MEW A;  2MQL A;  3UR0 A;  2DHX A;  1NSP A;  2GQQ A;  2E44 A;  3M8W A;  3AXM A;  3CXC R;  1FKO B;  3R6G B;  3VAH A;  3QSI A;  1CJT B;  2CDR B;  1RTH A;  4NMX A;  4K5R A;  4QPT A;  4QR0 A;  4DV5 J;  4P9S A;  6FDR A;  1RT5 B;  2AX0 A;  3G9C A;  3V5R A;  2NS1 B;  4DEZ A;  4GKJ J;  3A4T A;  4O3O A;  4ZVU B;  2H51 B;  4QOT A;  3IS9 B;  4TXS A;  1HBU B;  4CIO A;  4HR2 A;  3KOA A;  1SC4 B;  1U4B A;  2V67 A;  2UZA A;  3PW5 A;  2UVR A;  4DR7 J;  1GXL A;  1SXL A;  1RAB B;  3R97 A;  5AXL A;  4B3M F;  2IJF A;  1H38 A;  4PG5 A;  3H2L A;  3MPU B;  1NAQ A;  2IAJ A;  1KLM B;  2O3D A;  1IKW A;  1P1L A;  2CQD A;  4OX7 A;  3WQP A;  3GV7 B;  5KFT A;  3T5L A;  3UDC A;  2M9K A;  2XS7 A;  1MW7 A;  5IT9 Y;  1SV5 B;  4Z37 A;  4DWI A;  1CJV A;  5ETP A;  3Q8P B;  2HUR A;  1HI8 A;  2RML A;  3KK3 A;  1SQG A;  2G0I A;  1YBA A;  4OI4 A;  2BAB A;  1RYR A;  2IVM A;  3DC2 A;  3WIV A;  2CJQ A;  3MZI A;  3OUY B;  1AA1 B;  1U45 A;  2VF3 A;  4I67 A;  2Z57 B;  3EIC A;  2W9C A;  1RQ0 A;  3LH2 S;  3LP1 A;  4M5I A;  4QIG A;  1VC5 A;  2LEC A;  3MEE B;  3GIJ A;  1X4D A;  3HX9 A;  3U1L A;  3FC9 A;  3J81 Y;  2VPX B;  2FZC B;  4RW6 B;  4TY8 A;  4N56 A;  4I6Y A;  2WZ1 A;  1Y00 A;  2B43 A;  5AE2 A;  2VKR A;  4P10 A;  4ZLJ A;  1RAE B;  1YQH A;  1WKJ A;  2AT1 B;  2Q6C A;  4G65 A;  4WWS A;  3M6X A;  1QVF R;  4CO2 A;  1P27 B;  4DPX A;  2ACY A;  4I4B A;  2ATL A;  4C11 A;  3BBC A;  2OD6 A;  1K1S A;  1RTH B;  3CED A;  3GFY A;  4P74 A;  2B56 A;  1JXL A;  2EBG A;  4URS A;  4C0O C;  1RT7 A;  2CG8 A;  4JI7 F;  1YKW A;  2GW8 A;  4QQB A;  4ZPV R;  3OSP A;  2D3Z A;  1PKU A;  2EEY A;  1BLU A;  3O3L A;  3DRS A;  4PG7 A;  3A8E A;  3C6U B;  1WI8 A;  3NNC A;  5L1K A;  2J76 E;  4RU2 A;  4NXN J;  1RT3 B;  4ATN A;  5LT5 A;  1HMV B;  1RT2 A;  3C15 A;  4NXM F;  2HBY B;  1VBY A;  2FVC A;  5D77 A;  1C1B A;  5DGB A;  5RUB A;  3J7A N;  4IO9 Q;  1NH8 A;  2DNG A;  2XC9 A;  2V4Q A;  3GR0 A;  2YWH A;  3DRP A;  2KU7 A;  4Y2A A;  2OIH A;  4NCG B;  1FK9 A;  5GMK a;  1EQ0 A;  3B82 A;  1R8H A;  2M3D A;  2C22 A;  1KBR A;  1FRK A;  3KK2 B;  2MLY A;  4QU6 A;  4OYB A;  1VJQ A;  3KJV B;  1VQ4 S;  1SQF A;  4F2R A;  2HNY A;  2FC9 A;  4NLT A;  5F8H A;  4E98 A;  2DNR A;  3PYE A;  1UZD A;  2F9J A;  1VHI A;  1EQM A;  3TR5 A;  1KQK A;  3C8Y A;  3PYD A;  4L72 B;  2CVE A;  4P2M A;  5E5N A;  1YJW S;  2W8K A;  2YX1 A;  1OY6 A;  4I2P A;  5H9F J;  1JXV A;  3W5X A;  4DR3 J;  3CCW A;  4NZ6 A;  2XO6 A;  2V4J B;  4DUZ J;  3KG1 A;  1M5S A;  2Q3P A;  3GJT B;  3GV8 B;  3HVT A;  5HO4 A;  2GQC A;  2XEX A;  4URQ U;  5B08 A;  4P75 A;  4B3R J;  2XWY A;  2KXF A;  2IRU A;  2FJE B;  3RB0 A;  4WYW A;  2ATC B;  2CJY B;  5A8K A;  2H4Y B;  1IUJ A;  1NB2 A;  1U24 A;  1VCT A;  2OFG X;  1BY9 A;  3M8Z A;  3NCR A;  4MFB B;  5K14 B;  2CQ0 A;  5DDQ C;  3OHA A;  3NY0 A;  4LT6 A;  1HI0 P;  4FF3 A;  2VC1 A;  1XMB A;  4ECW A;  2HZC A;  4UY8 T;  4KV8 A;  5KFK A;  2V4R A;  2KT3 A;  2OEL A;  3LTO A;  3GMG A;  3VHQ A;  3EGV A;  1CJV B;  2YKP A;  4DG1 A;  1X4C A;  4QU7 A;  2AIR B;  4FYW B;  2JVO A;  1GXT A;  1MWY A;  1HNI B;  2AP6 A;  2MLX A;  2P6T A;  2QFI A;  3DGP B;  4MYU A;  1ARO P;  2W4C A;  4OX6 A;  1W2I A;  5D4O A;  4B9L A;  1BQN A;  2RIJ A;  2A6O A;  3MR6 A;  2VIH A;  3KK1 B;  1ACM B;  9RUB A;  4DL2 A;  3NRB A;  2LEP A;  3PKY A;  1ELO A;  4NLR A;  4KGM A;  1B4S A;  3RB4 A;  2HW3 A;  5BXI A;  3LF0 A;  3LGM A;  2UXC F;  2V94 A;  3QWP A;  2XUL A;  2B6A A;  4G1P A;  3CT9 A;  3GYN A;  2UXB J;  2YNG B;  1FT8 A;  3MHY A;  4KT0 C;  4RNH A;  5D0G A;  2CPJ A;  5B0D A;  3CCV S;  4QJV A;  4KAI A;  3KHL A;  3D6M B;  3D6H B;  2HHH J;  1RTZ A;  1S1U A;  2FLN A;  4IRC A;  3IP0 A;  4LF9 J;  1UW9 A;  3TWZ A;  1F9H A;  5HMY A;  3IWL A;  2HVI A;  2DRA A;  2LA6 A;  1D8Y A;  2NYH A;  5AXN A;  5GAD I;  1T3N A;  2H54 B;  3DOK B;  4CZC A;  3ILJ A;  3HDS A;  2RU3 A;  3KFW X;  4BWJ A;  2RJZ A;  1VMB A;  3H2U B;  3CC2 S;  4V19 J;  1JJ2 R;  2HHP A;  2CQ2 A;  4CH0 S;  2FVP A;  2DR6 A;  2MJN A;  1V5I B;  3IR7 B;  3P5T L;  4LF8 J;  4NLP A;  3M1V A;  1KVJ A;  3HSG A;  4TLQ A;  4ED8 A;  3MR3 A;  1HMV A;  1GXU A;  1RT2 B;  1S9E A;  1TL4 A;  4J9N A;  4ECQ A;  3VV2 B;  2XMM A;  5A6P A;  4YHH F;  2E7W A;  4X66 J;  2V6A A;  1NBE B;  2RVJ A;  1N33 F;  3X3U A;  3SYZ A;  2XB2 D;  3TQ1 A;  3H40 A;  2MKJ A;  4KFB A;  2UUT A;  2JEJ A;  1VK3 A;  1KSP A;  2IVY A;  2C3P A;  1WD6 A;  2CPY A;  5C42 A;  4LRC A;  1T95 A;  3UR3 C;  1REV B;  2GIF A;  2IAJ B;  4RLE A;  5ITH A;  2XCP A;  5CXT A;  3HHL D;  1TKD A;  1G1X A;  5AJ3 J;  1KRP A;  1M5P C;  3A8J A;  3KKF A;  5ETN A;  1BQN B;  1XN9 A;  1M5V C;  1VIS A;  2GIQ A;  2HSE B;  4MH8 A;  2EWH A;  3CO9 A;  3DMJ A;  4LIR A;  5KFF A;  1NDP A;  2DXD A;  1RWM B;  2PEB A;  5B09 A;  9ATC B;  2ZH3 A;  2BE7 D;  4ECT A;  1VQS A;  2HGL A;  1X4B A;  2VBW A;  1QUP A;  3LUY A;  4DV2 F;  2HHV A;  1S12 A;  2GVD A;  3PW0 A;  3JSY A;  3QGP A;  5MLC V;  5KT5 A;  1LWE B;  3EVM A;  1WC0 A;  4XPC A;  5SZT A;  1X4H A;  3DXB A;  3LAK A;  1TL1 A;  5EX0 A;  3RAM A;  1ZM3 A;  2DGX A;  3DI6 B;  4RKU C;  3AQP A;  2N3O A;  4ERD A;  1GTE A;  1BC6 A;  1FFG B;  4Z7Y A;  3N28 A;  3OTO F;  3VVT A;  3CJ3 A;  3I5C A;  4ZVE A;  3HHL A;  4ES3 A;  4FYV B;  4CTA B;  3MM9 A;  1OS5 A;  2N4C A;  2YXL A;  5KFV A;  4U7C A;  5F3Z A;  1XC9 A;  2BJ7 A;  1SC6 A;  2XSJ A;  3QID A;  2NQP A;  2C2M B;  1VLO A;  3R2C J;  1XNQ F;  3OVS A;  2PC6 A;  1DQ8 A;  3SCJ E;  5EGY A;  2ZEJ A;  5JJB A;  4ES1 A;  3MAA A;  1TKZ B;  3POT A;  1XTZ A;  3W2V A;  4XO0 A;  5JVG Q;  1L5U A;  5IXU A;  3ILI A;  2IHR 1;  3MOZ A;  1QLN A;  3PKM A;  1TUW A;  5IV4 A;  3Q0A A;  4K4T A;  2EG1 A;  3PYF A;  2R3V A;  3EZO A;  3M8Y A;  2GGP B;  3T1A A;  2LEB A;  2IA6 A;  2XZD B;  2M88 A;  2UVV A;  2DGU A;  1TVR A;  4DMZ A;  2RKI B;  3GR1 A;  2LCW A;  2ZE2 A;  4QWB A;  2COL A;  4LSL A;  5J2Q A;  1ZPW X;  3KG0 A;  4BBY A;  1HWJ A;  4ZCK A;  3UN5 A;  1HR0 J;  5JUM A;  2G4B A;  1TEL A;  4FS2 A;  2C2O B;  3Q22 A;  4U7U D;  2J9C A;  2QJ3 A;  4OZ5 A;  1ITP A;  3JSR A;  3GJR B;  1U1O A;  2ZVI A;  2GX8 A;  4DV1 J;  3IG1 B;  2ZJQ Q;  4YOE A;  1QVG R;  1RHK B;  1T9V A;  3M8Q B;  3MDF A;  4MAK A;  2F65 A;  5DRK A;  5F8N A;  1S97 A;  4ZS6 A;  3EGN A;  4R8U A;  3PR4 A;  2MDA A;  2UXD J;  1TVR B;  3T9Z A;  4H4O B;  1CSJ A;  4IYQ A;  2WBM A;  3HHD A;  3M9N B;  3I87 A;  1CQM A;  2XBP A;  1MN7 A;  4B3O A;  2GA7 A;  2DHS A;  3BGR B;  1H3D A;  1I3O B;  1S6U A;  1WDT A;  5J1P A;  3BH6 B;  2VZ9 A;  5CD4 H;  4DQI A;  2AJ0 A;  1ZYQ A;  1WEL A;  4X4S A;  4IOA Q;  4KHP F;  1L3K A;  1NLK L;  2YKM A;  4H4M B;  2OPS B;  2IC3 A;  3BSA A;  5KFS A;  3QSY B;  5HVG A;  1FNM A;  4KGX B;  3TUP A;  4LFA J;  1PG5 B;  2HVD A;  3Q86 A;  1S1X B;  4YS2 A;  2OUG A;  1T3O A;  1XK8 A;  1JLF B;  1E6V B;  2CAJ A;  2MQM A;  2PA8 D;  3NG8 A;  2X7I A;  2ZNY A;  4X4R A;  3OLA A;  2W9C B;  2Z2Y B;  4B3S F;  5FJ4 A;  4HDG A;  4B3O B;  4DR2 F;  1S9G B;  2JEF A;  2KI2 A;  2O5D A;  4Y2K A;  1NME B;  3DOL A;  3T5J A;  1EKS A;  2AF6 A;  1FK9 B;  4F3M A;  2APO A;  4P73 A;  4X4O A;  3MUR P;  3M6W A;  1AB8 A;  2Y3Y A;  1YG0 A;  2ZUA A;  3J81 U;  1AFI A;  4RW8 A;  2C3Y A;  4USK A;  3T5K A;  3U02 A;  4JI1 J;  2CJX B;  4MK8 A;  1PSD A;  1UPP A;  3ENQ A;  1WC5 A;  3D68 A;  3MM7 A;  3QAE A;  2QA4 S;  3A8I A;  1RT1 A;  2J9D E;  3BGO P;  4F26 A;  4OYO A;  5E3C A;  3PZP A;  3M6U A;  4F0M A;  3N01 A;  1TUG B;  4W92 B;  1K0V A;  2ROP A;  1WOP A;  1YJ7 A;  2K7K A;  1BWV A;  1RLC L;  2VA3 A;  3PO4 A;  1TUV A;  2CIM A;  4R5P B;  1SH3 A;  1S9F A;  3QO9 B;  4TLR A;  2GCF A;  2GJF A;  3IR6 B;  2BRL A;  4N41 A;  5LMN F;  2B7B B;  4ZHR A;  2FLL A;  3HJF A;  4PKD B;  5KFY A;  4ZPW R;  1X4A A;  2V68 A;  2VG6 A;  1VQ6 S;  4WTO B;  2EK1 A;  3TAR A;  3SDE B;  3C19 A;  1FX4 A;  2AHO B;  2IYG A;  3LPE A;  2CQB A;  3MAH A;  1IR2 A;  4ZPT R;  4LF1 A;  4F67 A;  5BR8 F;  1JLC B;  2DY9 A;  1SJ1 A;  5CYM A;  1WDD A;  4RW6 A;  4C97 A;  2G13 A;  4CNY A;  2XMT A;  3OBI A;  5M2U A;  5FDL B;  4RW4 B;  4UOG A;  1NKB A;  2XMK A;  2Y0B B;  1SC1 B;  2GC8 A;  2QX0 A;  3C66 A;  3HLU A;  3IBW A;  3G4S S;  3JTN A;  2ZH2 A;  2CPF A;  3MMB A;  5EUH A;  5HRO A;  1T02 A;  4WFX A;  8AT1 B;  2WSE C;  3J7Z T;  3CCL S;  1JKH A;  2W01 A;  2B8Q A;  1YJT A;  5G0R B;  2IBK A;  3NGU A;  1NM2 A;  3SXL A;  4CM0 A;  5KT4 A;  4C4W A;  3WX8 A;  3I0S B;  1WC6 A;  2QMW A;  3KLI A;  2ZH9 A;  2HRT A;  3FEZ A;  1QSL A;  4P72 A;  1AZS B;  4JV1 A;  1NSQ A;  1F3V A;  2G2O A;  3B54 A;  3ENV A;  2YX7 A;  3M6V A;  2YWF A;  2LQ8 A;  1DJ0 A;  1WHX A;  2BW7 A;  1WI6 A;  5K14 A;  4WKR A;  1R8B A;  3Q8U A;  1NHK L;  1W7W A;  3OUY A;  1UA0 A;  1N32 F;  3TVZ A;  1KP6 A;  2HVH A;  1VQK S;  1HBO A;  1TKX B;  1HBN A;  2OP5 A;  2VBY A;  3NGK A;  4PXD A;  2DB1 A;  1T9U A;  3FNN A;  1SB6 A;  2ZHA A;  4IRK A;  1FKA F;  2VQF F;  1H2T Z;  1Q0N A;  5T7L A;  3X1L B;  2HKE A;  1X60 A;  2IC3 B;  2BM0 A;  1RTI A;  3EZU A;  2X3G A;  3IGN A;  2E1A A;  3Q23 A;  4DUT A;  4ECZ A;  2WAQ D;  4K4W A;  2DVI A;  1SUQ A;  4JI0 J;  1B3T A;  4I2Q B;  3T1H F;  2KJV A;  1KLN A;  2QYG A;  4ZPB A;  3OHB A;  4KPC A;  3P45 B;  3I9Z A;  3E8O A;  1FRL A;  3HZG A;  5DJB A;  4TQR A;  4FP9 A;  1SJQ A;  2GVZ A;  1SVD A;  3C14 B;  3OFF A;  1ZZF A;  3GON A;  3KJF B;  5HRO B;  2HZV A;  2Y8Y A;  3KNA A;  2PSZ A;  1UVL A;  2DIS A;  2BM1 A;  4USV A;  4RR5 A;  3QRR A;  4DFP A;  2V9W A;  3D66 A;  2WOM B;  3KJQ B;  3N9U C;  5EWF A;  1UET A;  1LWX A;  4LFC F;  4LVO P;  3PFO A;  1RZM A;  2ZBQ A;  1GMW A;  4LIW A;  1WUU A;  2Z30 B;  4QYR A;  2RS2 A;  2B4O A;  2AZ3 A;  2BAN B;  5E33 A;  5C5J A;  4LSL B;  3M8P A;  4WXW A;  3QO9 A;  3W5Z A;  3IWN C;  4V19 X;  3KWM A;  2ZBC A;  4ECX A;  5DG9 A;  2AJ1 A;  3DLH A;  2OPQ B;  5BYS A;  3DRR B;  2XNQ A;  2QV6 A;  5SUH A;  3ZO7 A;  4OZJ A;  1DBD A;  1JLF A;  1NH7 A;  2DGQ A;  1WJ9 A;  3GSI A;  1VQP S;  1UVM A;  2B9W A;  3CCE S;  1RXO B;  4RW9 B;  5HQL A;  4YEA A;  1CUL B;  4K0K F;  1RWN B;  3TAN A;  1JJ4 A;  5IQ6 A;  4PUO B;  3MCS A;  1PJ7 A;  3O44 A;  1H73 A;  5ETT A;  2LLZ A;  2IJR A;  4M94 A;  1JLB A;  5EWE A;  3KLF B;  3RGI A;  4F7V A;  1REG X;  5GAE U;  3D9B A;  1U0H A;  4C3K A;  1P6T A;  2O01 C;  1KOO A;  5KG0 A;  5DG7 A;  2FGC A;  4C48 A;  5KFW A;  4K5S A;  5B0A A;  4FKX A;  2D9P A;  3FVY A;  1KOH A;  2JSX A;  3ZTQ A;  5DDR C;  1G7C B;  3D2W A;  2CJK A;  2IY5 B;  2ADC A;  4IOB A;  4DG1 B;  1YBT A;  3KDO A;  3OXF A;  1SL1 A;  4L75 A;  1MU2 B;  1RP5 A;  1WEX A;  3DNC A;  1R6Y A;  3GIR A;  1KDN A;  1SH2 A;  2FIU A;  4HAC B;  4OHX A;  4CO5 A;  4CYU A;  2OEM A;  4DV0 F;  5HP1 B;  2HFZ A;  2QIF A;  1B7F A;  1CG2 A;  1TR0 A;  1GT8 A;  2W2P P;  2B3T B;  2CJB A;  1HNZ F;  5IV3 A;  1PJ5 A;  1LFP A;  3THV A;  1WKL A;  3FSX A;  1ZAV A;  1G3O A;  2N82 B;  1X4E A;  2QGF B;  2YKO A;  4JYA F;  4JI2 J;  1Y11 A;  2FPH X;  2ZBI A;  4M5D B;  1UCN A;  1IKV A;  2M8H A;  2VH7 A;  3DU6 A;  2FD2 A;  2V2K A;  3FUY A;  4RW7 A;  5T41 A;  2L3M A;  3MAA B;  2RDJ A;  1N8R T;  1VQL S;  3PTW A;  1KTV A;  2B0G A;  2I0X A;  3CW2 C;  3R5G A;  3MUV P;  1SL2 A;  1UZH A;  4DR2 J;  5CA5 A;  3NAI A;  2ASD A;  2QLF B;  2LVW A;  5FLX U;  3GU0 A;  3PAC A;  4JV2 A;  1JKH B;  3GYG A;  2G2Y A;  5L1I A;  1N5Y B;  4YR2 A;  3ENW A;  4RO0 A;  1ZPV A;  2GHP A;  2HFV A;  4JI8 F;  4ZHR B;  4PPD A;  5A76 A;  5CD4 A;  1FE0 A;  4J9M A;  1X5O A;  3PJW A;  2MZS A;  4NLO A;  3K5O A;  4HDH A;  3F44 A;  4MMO A;  3SSQ A;  4UUW A;  3KLE B;  4NCG A;  4DS4 A;  1JLG A;  1IBK F;  2BOP A;  2YWG A;  1RUS A;  2OLW A;  3QGH A;  4LR7 A;  4N7T A;  1RAD B;  3JQJ A;  4ZVS B;  1NJX A;  5AXM A;  2CA9 A;  1TZ0 A;  4ZP9 A;  3NOG A;  2KXN B;  4ID5 B;  3KLV A;  4XK8 C;  3G6Y A;  3SIP B;  3K5M A;  4C0B A;  2FGO A;  4N77 A;  2J0Q D;  2ZJR Q;  2MKI A;  5KFH A;  4DX8 H;  1S79 A;  2FJA B;  2HRY A;  4KBI A;  1NDK A;  3NWR A;  3Q8V A;  5J1N A;  3RTV A;  2JDJ A;  4MKV A;  3DMJ B;  2QT7 A;  2KHC A;  3KLE A;  3D4J A;  2EC2 A;  1NSA A;  1VIO A;  3MMA A;  3GPA A;  4G1Q A;  5DDP C;  2BXJ A;  3LAL A;  5KFL A;  4O0I A;  1T05 A;  1KC8 T;  3ET6 A;  2H1Y A;  3WDO A;  3W7B A;  2LQJ A;  2VDH A;  3IA0 A;  4HAC A;  4FN5 A;  4DHV A;  2C3M A;  5ETV A;  2XGP A;  2UUB J;  1Z4U A;  4B9M A;  4O3S A;  2HZA A;  4ZIW A;  2VPZ B;  1DQA A;  5HVH A;  2B51 A;  2VG7 A;  1T9X A;  1IBM J;  1SV5 A;  4AD6 A;  1ZA2 B;  2LYV A;  2VJV A;  4FXD A;  4M1K A;  2N3L A;  4PEO A;  2W8L A;  2Y1J A;  5KG7 A;  3MM6 B;  2WON A;  4M5M A;  3ZNJ 1;  4USW A;  2XI2 A;  2VQE F;  4BCA A;  1JLQ A;  1N6Q A;  2BJ3 A;  3QQC D;  2Q79 A;  3KMS A;  2HHH F;  3L9Z A;  2KB2 A;  1DTQ A;  3BRE A;  1RAO A;  3ET6 B;  3G82 B;  4EBE A;  3DLB A;  4EZ6 A;  2GHV C;  1RKJ A;  1NXI A;  2JNJ A;  3I82 A;  2AD9 A;  3K0J A;  3R1H A;  2NPI A;  2PT0 A;  3EGZ A;  3FK4 A;  3K5L A;  4ZJQ A;  1H74 A;  2J0X A;  1IKX A;  4RW4 A;  1S99 A;  4DL0 C;  3BGL A;  1IKY B;  2QFJ A;  1N48 A;  1C2P A;  4MIW A;  3TUI C;  2LQB A;  3AQO A;  3NCP A;  4N8O A;  4JI2 F;  2CZV C;  3C16 B;  2MQP A;  2RIL A;  4NCA A;  1WOR A;  2JLE A;  3SEO A;  1BE4 A;  1CUL A;  3KLG A;  3AJ1 A;  4LR9 A;  3BGR A;  3RJM B;  2HHW A;  2E5G A;  4YB7 A;  4Y6I A;  2OPQ A;  3BDE A;  1B0V A;  5DZ6 A;  1CJK A;  1HHS A;  1Y5N B;  1X9S A;  4PWW A;  1X5P A;  4WFZ A;  3KK2 A;  3L09 A;  2QLW A;  3SCL E;  3QGI A;  4JOU A;  3H59 A;  4ED4 A;  3TZZ A;  2ZWP A;  4F4X A;  1I51 B;  5HL7 Q;  3KK1 A;  3HSZ A;  2K06 A;  1DY3 A;  4F04 B;  2E9T A;  2DD8 S;  4W90 B;  3SV3 A;  2AZ1 A;  4NAS A;  5F3T A;  2HPU A;  3O1L A;  5KT2 A;  5D4L A;  3EPI A;  2XSF A;  3JSM B;  2FUG 9;  2ALZ A;  1ZS6 A;  3C15 B;  1YIJ S;  3UN3 A;  3C6T A;  2YNG A;  1BHN A;  2RRN A;  4IR1 A;  4ILM A;  2HAF A;  1DTT B;  3C6U A;  4A4J A;  5KFR A;  3TAM B;  5IQQ A;  3BR9 A;  3HSD A;  4ZP6 A;  2Z2Z A;  4OQJ A;  1NK0 A;  4Q43 A;  4ED7 A;  1SJR A;  4GVB A;  3JYT A;  2HVZ A;  3Q83 A;  3I56 S;  1S7I A;  2OJ3 A;  2R8I A;  4J91 A;  5K9F A;  1ZTW A;  2DGW A;  5D4N A;  3V2U C;  2BYC A;  5CCM A;  3P49 B;  3ISN D;  1JLQ B;  1K9M T;  4CYU B;  2CQH A;  2RQ4 A;  2FHK A;  3NLC A;  2RHQ B;  1MNE A;  1MLA A;  2D7S A;  2OML A;  4KTQ A;  2W9B B;  3R2D J;  5KT6 A;  1CLF A;  2CQ1 A;  4NX9 A;  4H4M A;  3D7S B;  4DV4 F;  2ADB A;  2V2Q A;  4PG8 A;  2R2R A;  1FNO A;  2XLJ A;  1FVQ A;  1AUD A;  2Z2L A;  2PEH A;  5AXK A;  4EEY A;  3LP0 A;  3NGD A;  2KG1 A;  4M5J A;  1WSR A;  4XDC A;  4NZ7 A;  2P9C A;  2E1M C;  2K2P A;  3GIK A;  1KHV A;  4ED0 A;  5C2G A;  4CH7 A;  1RE1 B;  5GME A;  3UDL A;  4ZMM A;  4LF9 F;  1D3W A;  5C42 B;  1G6B A;  1L3T A;  1X0F A;  2W25 A;  4X62 F;  4D3H A;  1KFS A;  1NPP A;  2XYG B;  1R0A A;  1B70 B;  4JI4 J;  1TK5 A;  2KM8 B;  1R8C A;  1KHW A;  1UMJ A;  2K1R A;  2DNQ A;  2K3K A;  3DCA A;  3GFZ A;  2FY8 A;  3OPK A;  3QLH A;  2VPY B;  4WII A;  2CKW A;  4PWD A;  2J8A A;  2MYF A;  3GG0 A;  7AT1 B;  3TZY A;  3V81 B;  3FBE A;  2JEG A;  3IM8 A;  4B17 A;  3G8T A;  4CO3 A;  2Z4P A;  4ANE A;  2MGZ A;  4HYK A;  3R3T A;  2NXN A;  2GS8 A;  1W25 A;  2AJF E;  3OT9 A;  1D09 B;  4IH7 A;  1M5K C;  1GFW B;  2UXD F;  4PXB A;  4YUD A;  2V63 A;  5F0W A;  1WF1 A;  3JYT B;  2L08 A;  3BQ0 A;  3HHL C;  3MPY A;  1K8A T;  3UCG A;  3PHE A;  4XTT A;  4QW9 A;  1DTT A;  4ZN3 A;  3DM2 A;  5DM6 Q;  1S49 A;  1TL7 B;  3KLH B;  3G86 A;  2VV5 A;  1YLX A;  3JQK A;  4RNM A;  2HQD A;  4K2J A;  4J9Q A;  1UVJ A;  2DNL A;  2EFP A;  3HCX A;  3M30 B;  4LUB A;  2EFV A;  4RNF A;  4DQP A;  4KHP J;  3EXY A;  3LOU A;  1XBW A;  4EK2 A;  1YJR A;  3PJ9 A;  2ZOG A;  4OYZ A;  2QG9 B;  2HK2 A;  2KH9 A;  3EPG A;  2LP4 A;  2BQR A;  3CJ2 A;  2HQ3 A;  3O6Q A;  1HWK A;  3HJV A;  1YHQ S;  3H98 A;  1N5V A;  1FER A;  1FRI A;  3M32 B;  4NZ0 A;  4DPW A;  2BJ9 A;  3W2W A;  4U8Y A;  4FVM A;  1FDA A;  3AY0 A;  3FCV A;  2DNO A;  1C1B B;  3LAN A;  3QT8 A;  3DDK A;  4OJG A;  2WW8 A;  3QIP A;  4RWW A;  2YPZ A;  3ZTP A;  3CJR A;  3JSM A;  3R1L A;  2CNK B;  2BZ2 A;  4UQG A;  3V4M A;  4QYZ J;  3C16 A;  4C3M A;  2AJ4 A;  1AXQ A;  3BV8 A;  2OPR A;  3OL7 A;  3CJ4 A;  2YX4 A;  1WG5 A;  4CP5 A;  3PR5 B;  2FJB B;  2WSF C;  2F4F A;  2BMB A;  3T5H A;  4ZPA A;  4EFA C;  3PX4 A;  2R7X A;  4CNZ A;  4J9P A;  4U67 Q;  2D3O R;  4DFK A;  3MFH A;  1IXK A;  1S1V A;  3VAI A;  1A6L A;  2AJ2 A;  3J81 j;  3MTK A;  5DG8 A;  2ZM6 F;  2MY8 A;  1JWW A;  3VAG A;  3GJS B;  5H9E K;  3ISZ A;  4X65 J;  2EBE A;  1IM4 A;  3RBE A;  3K2Y A;  1QD1 A;  1YVF A;  1PIE A;  5LM7 E;  2ZH5 A;  4QBU A;  3V6K A;  3VAJ A;  5KTQ A;  1RI7 A;  3L3C A;  3ZXW A;  2FLP A;  2HRU A;  4K4Y A;  1IR0 A;  4ZLN A;  3DYA A;  2F8E X;  1OO0 B;  2H5I B;  3SFU A;  5LMN J;  1ZET A;  4B9U A;  3NNA A;  1RHQ B;  3RW6 A;  1R31 A;  2VU5 A;  4X84 A;  1QTM A;  4QWC A;  1FA0 A;  4J9R A;  4DSI A;  4IDK A;  1KD1 T;  1VQY A;  4B9V A;  2HS4 A;  3WC2 A;  4LQ3 A;  1CVJ A;  3FMB A;  5KFP A;  1UTA A;  5U47 A;  1UW4 A;  1NKC A;  4C8Y A;  3UN2 A;  2GV1 A;  2M5Y A;  1E6V A;  2OMO A;  1Y3K A;  2FLO A;  2HWH A;  2MKH A;  3ZFV A;  4X4Q A;  3OJU A;  2MQ8 A;  4ILL A;  1MMD A;  2OFH X;  2DKO B;  5E7O B;  2DH7 A;  3NGS A;  5E41 A;  2MXY A;  2YY3 A;  2CNL B;  3JS9 A;  3Q24 A;  2AEJ A;  1LK5 A;  3BKT A;  3CDU A;  4P2S A;  2W9B A;  2HHT A;  4F8R A;  1PCA A;  1PYO B;  1SIZ A;  1RKI A;  3I4H X;  3ILO A;  5ETO A;  3WHI A;  1CJU B;  2HBR B;  1NK9 A;  4I0W A;  5I42 B;  4AQY J;  2ABY A;  1U7L A;  2OGU A;  3BZQ A;  4CCH A;  2FHJ A;  8ATC B;  5L1L A;  2C2E A;  2WSC C;  1CJT A;  1VRT B;  1Y3J A;  1JB0 C;  5LXY A;  2ZWO A;  5F8M A;  1S72 S;  2MST A;  2JL9 A;  1X31 C;  3IRX A;  2GHW A;  4OJH A;  2JZ5 A;  5G4D A;  3SFG A;  3SQO P;  1OMS A;  1JLE A;  3G87 A;  1J5O A;  5FDL A;  1NU4 A;  1RT4 B;  1KN6 A;  4JI6 F;  1HQ2 A;  3NXZ A;  1V6H A;  3JAM Y;  5JVH Q;  4H4K A;  5DLG A;  4DUY J;  4LF4 J;  1OYE A;  1TKZ A;  4Q45 A;  4X64 J;  4B3S J;  4CLL A;  3ZZ0 A;  1Y4Z B;  3CJ5 A;  2X3D A;  1NCL A;  5CYQ B;  3GII A;  3W8G A;  5KFO A;  4DN9 A;  4RZR A;  1U48 A;  1N36 F;  4DN0 A;  3MFI A;  1HNV B;  1UWB A;  4KYZ A;  5ETR A;  3KHH A;  3V81 A;  3JB9 k;  2E5L F;  2UP1 A;  4LF8 F;  4FF4 A;  3CJ0 A;  2HNZ B;  3K57 A;  1I6J A;  2NUU G;  2ZE2 B;  2BUN A;  3FBB A;  1YRT A;  2FZG B;  3PHT A;  1R0A B;  2YNF B;  4JI1 F;  2BJE A;  3I0R B;  3KHG A;  3MI7 X;  1FEE A;  3FCH A;  3OQ2 A;  4CLF A;  2ZHB A;  1YTY A;  2R8K A;  3LGN A;  4FYD A;  2RUG A;  2MMY A;  3W9J A;  1IBL J;  2AGQ A;  3FGV A;  3KG4 A;  4JI0 F;  5D0E A;  5F0U A;  4F0K A;  4GKJ F;  3CJ8 A;  2B7C B;  4ZN1 A;  4GC6 A;  4IDK B;  1ZM4 A;  2M0G B;  2X1A A;  4EMD A;  4HH1 A;  4LSN A;  4QWA A;  2ASJ A;  1N4L A;  4NYP A;  3QRQ A;  1HPZ B;  2ERR A;  2O1P A;  2RU9 A;  2E29 A;  3CMQ A;  3ILL A;  1KON A;  1HKA A;  1O6X A;  4PYA A;  5GAD U;  1D9F A;  1GMW D;  4RW9 A;  5KFM A;  4MKY A;  2K3I A;  3MEE A;  4LF5 F;  3QJP A;  3A3P B;  4NRU A;  1HQU B;  4RBT A;  1KQS R;  2QRR A;  2DRD A;  4LFC J;  1WOS A;  2IRX A;  3TAQ A;  4C8L A;  3CSK A;  3TAP A;  1FRH A;  2DIT A;  2Z8Q A;  5IWA F;  2W1B A;  1F9F A;  5CHC B;  2CQP A;  2QTW A;  1MRO A;  3BEG B;  4DV6 F;  3MD3 A;  2ZDO A;  2GIR A;  2XTJ P;  4EZ9 A;  3EGW B;  4DBQ A;  1HA1 A;  5HN0 A;  4YFU A;  3ZTO A;  2F40 A;  4AQY F;  1FJG J;  1TK8 A;  1FRX A;  2VUG A;  1UFK A;  3BPD A;  1WEY A;  2M7S A;  4TU7 A;  3PV8 A;  5BJR A;  4WK1 A;  4X62 J;  2IRY A;  2XYH B;  4ECY A;  1NEE A;  1UJ5 A;  3EDQ B;  2WVD A;  3MMJ A;  4OYA A;  3SBM A;  3TJA A;  5J2P B;  4Y2I A;  2XI3 A;  5GMD A;  3HFV A;  1HAR A;  1HI1 A;  2EPI A;  2YKN B;  5I4M A;  2YWW A;  1HHQ A;  1HQE B;  4LR8 A;  2BKN A;  3D0H E;  3RG6 A;  5C24 B;  1FF2 A;  4ZIV A;  3CC4 S;  1MML A;  1CC8 A;  4J9S A;  2Y1R I;  5A6W A;  3NNH A;  4RUH A;  2I9S A;  3DRY A;  2NXJ A;  4WU2 A;  3R27 A;  3C6T B;  1A0O B;  2CZ4 A;  3UE2 A;  1KQG B;  4TYA A;  2BR0 A;  2D3O 1;  2DO0 A;  4N47 A;  4PG6 A;  1SPB P;  2WOM A;  2P9G A;  3Q8S B;  4WU3 A;  1VJW A;  2LXI A;  4WTY A;  1C4C A;  3V6D A;  1U1K A;  4UOC A;  2XM3 A;  2XLI A;  3NBP A;  1OY9 A;  4M5H A;  3A12 A;  3ICL A;  1JNR B;  4ER8 A;  3TYT A;  4FPI A;  2GFF A;  1JQG A;  3U1M A;  5KFU A;  4IG0 B;  1VR6 A;  2CPH A;  4PAA A;  1RB0 A;  2UU9 F;  1F5C A;  3MOJ B;  1HQU A;  4BHQ A;  2W24 A;  3QT7 A;  4UOF A;  2FYX A;  3QZ8 A;  4OHY A;  4WFY A;  2KHD A;  2MKC A;  4KO0 B;  1YJN S;  4ETX A;  4HI2 A;  3AFG A;  3HD2 A;  2YKM B;  4I6W A;  1NB7 A;  2F4V F;  2V8V A;  4PAB A;  3L7U A;  5IWA J;  2GJ2 A;  3EWG A;  2XCA A;  4NLY A;  3RR7 A;  1IKY A;  3KUH A;  4AUK A;  4OV6 A;  5G0R A;  2DGS A;  4LF5 J;  2CG4 A;  2Q43 A;  3C14 A;  1U1R A;  3FKB A;  3P4U B;  4O23 A;  1S6Q B;  4LMZ A;  2XG8 A;  2HVE A;  2CPI A;  4WFN Q;  2KFN A;  3MMA B;  1J5E J;  1JLB B;  5ETQ A;  1D8Z A;  3TZX A;  4F50 A;  1UKU A;  5IS2 A;  5T14 A;  1TKT B;  3T6J A;  3TAM A;  4OL8 A;  2VKZ G;  5H9F K;  1U6F A;  1RT6 B;  5F41 A;  4OYI A;  4GKK F;  1EP4 B;  4LVN P;  4EI2 A;  1R89 A;  1XR5 A;  2G0J A;  2WVF A;  2DH8 A;  4KH1 B;  4LRB A;  4OJ1 A;  3SDE A;  4DR5 J;  2MTL A;  1FXR A;  1GEH A;  2LKZ A;  5KFD A;  4NOH A;  2HMI A;  1M1K T;  2JOQ A;  2P6S A;  2WBR A;  1M1G A;  4DR6 J;  5LL6 d;  5JXS A;  4QPX A;  3RB6 A;  4IKA A;  4TVA B;  3TVY A;  1FD2 A;  3P96 A;  3HUL A;  4WPA A;  3P8B B;  1RAH B;  4Q2L A;  1T11 A;  3EX7 B;  2VIC A;  3FQL A;  3TO8 A;  1FJE B;  2RAQ A;  2H48 B;  4Y00 A;  3VAM A;  5L8R C;  1GX5 A;  3E2E A;  4D3G A;  4DCJ B;  5B0F A;  2VBZ A;  3CCQ S;  5IM0 B;  1U1Q A;  4KO0 A;  4DLE A;  4C3L A;  2POK A;  1RBL A;  4QIW D;  4DFJ A;  2J6S A;  3E3X A;  1U0S A;  3GIL A;  1PYT A;  4EO8 A;  4CLU A;  5KFN A;  3ZTS A;  4DFM A;  4KY3 A;  4MYT A;  4PZV A;  1IBC B;  1BWE A;  3RUB L;  2YNH A;  1O0P A;  2WVE A;  2A1B A;  3QMQ A;  1CS4 A;  3T41 A;  1RTD B;  1U8W A;  3MAQ A;  5A8R A;  2UXB F;  2BBE A;  2ZBR A;  3MR7 A;  3M7V A;  4ITS A;  1M1H A;  2GMH A;  4K4S A;  4Q7A A;  1DAX A;  3QT5 A;  1KVK A;  2YQ0 A;  4X4V A;  1I94 J;  4WYL A;  4ETZ A;  3PIP Q;  1B64 A;  1FES A;  1T9W A;  1VLY A;  3LW5 C;  2WTF A;  3TI0 A;  1W2B R;  3UNY A;  4DF4 A;  3IAS 9;  3VZH A;  1MG7 A;  4IR9 A;  2FB0 A;  2HND B;  1RAC B;  1TKT A;  2JFK A;  3PEJ A;  3BN4 A;  1F5B A;  4R5P A;  5IT0 A;  4NLG A;  1HYS B;  1R8A A;  4NPO A;  4UOH A;  3NL0 A;  1MWQ A;  4ID8 A;  3AOA A;  3QWU A;  1S1T A;  4PQU B;  4ZP8 A;  5AE3 A;  2U2F A;  5A2Q Y;  5K20 B;  1LWC B;  3A3N B;  3W61 A;  3ZZZ A;  2W7P A;  3G82 A;  3KXD A;  4ZOS A;  4DV7 J;  4DF8 A;  4E2F B;  2G1D A;  4TNO A;  2A10 A;  2XMA A;  1J5E F;  4PG4 A;  2DHA A;  3W66 A;  3M4X A;  3BS9 A;  4DX7 A;  4I56 A;  5M2P A;  3C2P A;  1IBK J;  1SL0 A;  2RQM A;  4DJB A;  3G96 A;  2OPP B;  4MKB A;  4YY3 F;  1XMO F;  3MR5 A;  2NSC A;  3B78 A;  3MEK A;  1SJ4 P;  3EJM A;  1ICE B;  1S1W A;  5AJ3 F;  2AYE A;  4DPO A;  4ELT A;  4OI0 A;  4M8L A;  5CYQ A;  6AT1 B;  1MRO B;  5L9N A;  3PW7 A;  2X1G A;  3NWG A;  1RAF B;  4K2X A;  4NA2 A;  2EFG A;  3QT6 A;  5A0Y B;  3GV5 B;  1LWC A;  1FKO A;  2GQ2 A;  2HEK A;  4KC5 A;  3SMZ A;  3OV7 A;  4HLB A;  4DSL A;  1JLG B;  3SI8 A;  2MHE A;  4HT5 A;  2VOO A;  1TAU A;  2DEI A;  2W7A A;  3F41 A;  2VB6 A;  4NLU A;  1NZA A;  2VL1 A;  2DBB A;  4QW8 A;  1Q82 T;  1HD1 A;  1NKE A;  2QL5 B;  1AZS A;  3DKD A;  3JTP A;  2KJW A;  3H5Y A;  2R8G A;  2R42 A;  4OZN A;  2BAC A;  3NS6 A;  3TUZ C;  4NLX A;  4W98 A;  4GMK A;  2J6U A;  3FMW A;  3M30 A;  2V9K A;  5ADZ A;  3M1V B;  1VRU A;  2IM3 A;  3B6B A;  3M8S A;  2VG6 B;  5J2Q B;  5BR8 J;  2JH3 A;  2MLZ A;  4DCP B;  2GNK A;  2VAS A;  2MZQ A;  2ZD1 B;  2F1F A;  4U9R A;  4DSK A;  2YWE A;  4ANC A;  4CQ1 A;  5A8W A;  1LXN A;  3OL8 A;  2M4M A;  2OEK A;  4MJK A;  2F8H A;  2MHN A;  1B99 A;  2V2Z A;  3A13 A;  1TFY A;  4RJV A;  2ROE A;  4PCQ A;  2GZO A;  1MN9 A;  3G8Q A;  4HEA 9;  3JAM U;  4DQS A;  1NK5 A;  1P8G A;  3PXG a;  2CQ3 A;  1HNV A;  1UWB B;  3EYZ A;  4OI2 A;  1JXE A;  3CDE A;  1T9Y A;  1RT3 A;  3CGI A;  1LFW A;  1GNK A;  1S1W B;  2OSQ A;  2VBX A;  3CB4 A;  4ZP7 A;  2PGC A;  3DDI A;  5E0O A;  4FYX B;  4L3N A;  2YWK A;  3D6F B;  4OX8 A;  3SCK E;  4UW2 A;  4KV8 B;  1WTF A;  5CH7 B;  4YB5 A;  2JFD A;  4UTG A;  2LDI A;  1FVS A;  5ETL A;  3SSR A;  4NLW A;  3GP9 A;  3KUG A;  1RT7 B;  2D9O A;  4ZPD A;  1H98 A;  1HL6 A;  4TQS A;  2E5L J;  1U0H B;  2LU1 A;  1NJZ A;  2ZBP A;  2QA1 A;  2W9A A;  1YGY A;  2F63 A;  4LF2 A;  2HHQ A;  1OPI A;  2O66 A;  3IBC B;  3L7O A;  1DUR A;  1APS A;  2LQ5 A;  3VCD A;  3D0G E;  4A8M P;  4C6A A;  1IBM F;  2HHX A;  1PC5 A;  2QMU B;  3AH6 A;  2E5I A;  4NCB A;  4F02 A;  1KFD A;  4I2P B;  3GLJ A;  1RJJ A;  1HR0 F;  2LXU A;  4KSE B;  3MPV A;  1EHW A;  4E8U A;  3BKF A;  2Q6B A;  1F6T A;  2V50 A;  3ITH B;  1F2H A;  3RRG A;  1AUS L;  3UNG C;  4C8Z A;  2KKH A;  3T9N A;  4DU8 A;  2JVR A;  3QRP A;  4IH6 A;  4AL5 A;  2IJN A;  3D3C J;  1BXN A;  1RWV B;  5L9X A;  3OW2 R;  3W64 A;  2B4V A;  2C2N A;  3MEC A;  1RWP B;  3PEH A;  2ACM A;  2Z2M A;  3LA0 A;  4AL7 A;  1N34 F;  1WOO A;  2DYA A;  3D1Q A;  3IS9 A;  2CJA A;  5MAO A;  5F9N A;  2EK6 A;  2QN6 B;  2CQC A;  3ZZP A;  4CLY A;  5KG2 A;  2FJW A;  2I38 A;  3UWT A;  2E1R A;  4DR3 F;  4YN3 B;  5BYR A;  5GAE I;  2W2N P;  3U7J A;  2VFT A;  1QAX A;  4GRS A;  5CCL A;  4LF4 F;  1AYE A;  1TL3 B;  3NGT A;  1NDL A;  1QM9 A;  3G71 S;  2HQG A;  4UUX A;  1EJ7 L;  1IJF B;  3MEG B;  2UUC J;  4CT9 A;  1GTH A;  3NCQ A;  4FKY A;  4F3Q A;  2PFF B;  3MD1 A;  2DTJ A;  4DZD A;  4KFB B;  4USI A;  4USJ C;  2ZH6 A;  4YY3 J;  1XMO J;  2DNM A;  3FBF A;  3OLB A;  5C2C A;  5CYM B;  3CTR A;  1RBA A;  4E0D A;  1U25 A;  3KDN A;  4FZV A;  5D0R A;  4FDF A;  4ZPC A;  1VDH A;  3TP2 A;  3UCU P;  2XGQ A;  1BD6 A;  4O3P A;  4ICL B;  4FPR A;  2WW4 A;  1RAJ A;  4XPE A;  1TL7 A;  5LSO A;  3MR2 A;  1NK6 A;  3I31 A;  4L74 A;  5EWG A;  4J5O A;  2H65 B;  3D0I E;  5GVQ A;  1JJH A;  2DK2 A;  1QJH A;  1FE4 A;  2EI5 A;  2QO3 A;  2OO4 A;  1RDR A;  1S0M A;  3K5P A;  2Y0S D;  5CQG A;  1NK8 A;  4ECS A;  3DOK A;  6FD1 A;  2HWI A;  1T8E A;  3RBZ A;  4FBU A;  1RBO B;  4DLG A;  1LKZ A;  2YTC A;  1GQE A;  2EC0 A;  5ETM A;  4YHH J;  3HZE A;  4J9K A;  1C1C A;  3PIO Q;  5E3R A;  2XYP B;  1LWE A;  3VVU A;  1FDD A;  4IG3 B;  1HNI A;  1RWW B;  2HFS A;  2C2K B;  5DZ7 A;  1NK7 A;  2B5J B;  4DPT A;  2G2Z A;  3B8H A;  4RL1 A;  2J7U A;  3FRY A;  4DV0 J;  2ZJP Q;  2VG7 B;  2GO9 A;  3DLL Q;  4PYD A;  5DS7 A;  2FTR A;  5EX3 A;  3HVR A;  3MEC B;  1HBO B;  2CNN B;  3R8Y A;  1I94 F;  1SH0 A;  2KYZ A;  3G6V A;  2X1F A;  2X51 A;  4CLS A;  4U96 A;  3BYR A;  1EAR A;  2PII A;  2YQ3 A;  3MPW A;  4IH5 A;  2R7U A;  3VGS A;  1QUV A;  1QSY A;  1TL5 A;  1DTQ B;  1SC3 B;  3AT1 B;  1ZH5 A;  1CEZ A;  4LBH A;  1IJE B;  4H4O A;  2ZH8 A;  4G3I A;  3DGV A;  5F8I A;  4ED5 A;  1VOM A;  3V6D B;  3NEK A;  4KR0 B;  3IWX A;  2DCU B;  4AE5 A;  1KR4 A;  4LF7 F;  1S59 A;  4NE9 C;  3ZZU A;  3HT0 A;  3OTB A;  3R7B B;  1S6P B;  1BMQ B;  3I0S A;  1OPZ A;  1HPZ A;  3CCR S;  2FJV A;  3CC7 S;  3KLI B;  4CO4 A;  1VIX A;  4I7F B;  1RWX B;  4QR1 A;  2KFY A;  2ZOM A;  2OAU A;  4NYO A;  1Q5Y A;  5IC6 B;  2E7V A;  4ED6 A;  2XWX A;  4YQW A;  2DXE A;  4OMF G;  2PE8 A;  2W4P A;  1REV A;  4GVB B;  1HBM A;  2A2C A;  2H3E B;  2V2V A;  2HHU A;  2IDL A;  3UCZ P;  1IR1 A;  1PAE X;  4CM2 A;  4R8U B;  2XHC A;  3H0P A;  2AEF A;  2CAD A;  1VI7 A;  4BC7 A;  4DL6 A;  5K5M A;  1HNX F;  2OSR A;  4WP3 A;  2QL7 B;  4DPY A;  4JI3 J;  4A8K A;  4FVC A;  3G2X A;  2XMJ A;  3R6L B;  4DCO B;  2WHO A;  4ZCM A;  2W2M P;  4IG0 A;  3CD5 A;  4B3R F;  3PRD A;  5K8P A;  1Q8B A;  3RAQ A;  2B4U A;  4OI6 A;  4RWX A;  3S1T A;  4WF9 Q;  3QAT A;  2IM0 A;  1S4E A;  2BEF A;  4A48 A;  1S48 A;  4MIA A;  1B0T A;  2XO7 A;  3DI6 A;  4DR7 F;  3PVX A;  4ZLL A;  1Z1Z A;  2HMI B;  2V34 A;  1LXJ A;  4ED1 A;  2D69 A;  3Q2S C;  1T94 A;  2M2B A;  2RQC A;  2MQQ A;  2GVD B;  3EDR B;  2FDN A;  4PXE A;  2HFO A;  3HKZ D;  1NHV A;  4EWT A;  5KFG A;  5D3G A;  1SCJ B;  3NGR A;  1P9Q C;  1M5O C;  3DRS B;  3R7S B;  1E6Y B;  4OHV A;  3UD5 A;  2BE9 B;  3CDB A;  1HWU A;  2FHO B;  2ZFH A;  1KS2 A;  3M2R A;  3CUN A;  3Q2T C;  5H1S V;  2VC0 A;  1WHY A;  1FWP A;  3AXK A;  1XER A;  2MSS A;  4U8V A;  5B0G A;  5HMZ A;  1R0C B;  3M9M B;  4F4K A;  3UO0 A;  2CRL A;  1NRK A;  4I7F A;  3J7Y I;  5IT9 U;  2L9W A;  5ETS A;  5KG1 A;  2HLU A;  5KOX A;  1M0S A;  4ECU A;  1X0P A;  4NLD A;  1D0E A;  3AA8 A;  4X4N A;  4NA1 A;  2ZH7 A;  3HI9 A;  2J6T A;  2L41 A;  5DM7 Q;  4O4G B;  2PDA A;  1U2C A;  3QLH B;  4CLZ A;  2E66 A;  2C42 A;  4PWD B;  4JBC A;  3K89 A;  2RDI A;  2ILY A;  4LSN B;  4C7Q A;  2PI5 A;  4K59 A;  1ZOT A;  3O2I A;  4C8O A;  4LF6 J;  3S8S A;  1DLO A;  3AD9 C;  1MSW D;  1Q16 B;  3F56 A;  1WTB A;  1S0V A;  3P5B P;  3UVJ A;  1L3V A;  5HI7 A;  3H25 A;  1OSC A;  3OXL A;  4N5S A;  2ZH1 A;  1S0N A;  2MKY A;  1U1P A;  3IFE A;  3M32 A;  4M5L A;  4CRJ A;  3M8R A;  1KNZ A;  4WKY A;  2NRE A;  1YSJ A;  2CNO B;  3W3S A;  3THT A;  3J80 U;  2K7J A;  1R43 A;  3HVT B;  2CWX A;  2MB0 B;  5CZV A;  2Y8W A;  2KG0 A;  1FWK A;  3FBC A;  3TA1 A;  2NXE A;  2P9E A;  4CO1 A;  2MQO A;  3OVA A;  3AOC A;  4FF2 A;  4K4U A;  1VRU B;  1JLA A;  2B5J A;  4NLV A;  4OI1 A;  1RA6 A;  2V5H G;  2QSF A;  2R8H A;  4EBC A;  4Q0B A;  1N33 J;  2J8S A;  1Y7P A;  1PIL A;  3GCW P;  2NCK L;  3I96 A;  3N5B A;  1H7W A;  1V3Z A;  3ETO A;  4HL9 A;  1C1C B;  1JX4 A;  2O67 A;  2HNY B;  2F8M A;  1Q8I A;  5KFZ A;  2R7W A;  4HVZ A;  4FS1 A;  3TZW A;  1L3S A;  3DRX A;  4JI5 F;  1XQI A;  3E01 B;  3GWC A;  5K8N A;  4K50 A;  3P3D A;  1JLE B;  1S4F A;  5A2Q U;  4G1I A;  3FDS A;  3OR2 A;  3R5J B;  3A1Y G;  4U6P A;  1RGV A;  3T3F A;  5I42 A;  2PA3 A;  2QZ8 A;  3W9I A;  1UEU A;  4J9U E;  1XNR F;  2DPI A;  5KFB A;  4L3K A;  3BSC A;  2HFN A;  3OXG A;  2PD1 A;  4RUA A;  4KJI A;  3I6P A;  4WFB Q;  1WG4 A;  2A2D A;  2HGM A;  4OHW A;  2ALY B;  2J7K A;  2XMU A;  4C8K A;  4PR6 A;  1U2F A;  4K7Q A;  1U26 A;  2CXE A;  4I69 A;  1X9W A;  1UFL A;  1WG1 A;  2Z58 B;  2EXU A;  2K8G A;  3LP1 B;  2CPZ A;  1FJG F;  2LEA A;  3LPY A;  3OR1 A;  4DR5 F;  5D0H A;  4B02 A;  1C0U B;  1S1T B;  1WEZ A;  1YJ9 S;  4PQU A;  3TEG A;  2BX6 A;  3PCO B;  4UY8 5;  3D5M A;  2FVS A;  1PBA A;  2AYM A;  2CQ4 A;  2DY1 A;  3UDE A;  3RAX A;  2DGO A;  1GMU A;  4QWD A;  4IFV A;  3MM7 B;  4K8R A;  1EZZ B;  3HD1 A;  4DL3 A;  1JLA B;  1OYD A;  3BM7 A;  2MZJ A;  1CQN A;  2OPP A;  1EP4 A;  1S6O A;  2QEX S;  4TY8 B;  3HO1 A;  1A9N B;  1XR7 A;  2DR5 A;  1W26 A;  2AX1 A;  1TFW A;  1IKX B;  4NI2 B;  2I5J B;  4MT1 A;  5BYQ A;  1SBR A;  2BKP A;  3T1Y F;  1F5A A;  3EMT A;  5HMX A;  3GIM A;  4USU A;  1EET B;  4DQQ A;  3WZ0 A;  4KKO B;  3BB5 A;  3BGF A;  4TY9 A;  5IT4 A;  2QSW A;  2R2S A;  4J9L A;  4DSE A;  5IOL A;  2BKO A;  2VPW B;  3M8P B;  1U47 A;  1NJW A;  4JV5 J;  4UQT A;  1N5Q A;  1PC4 A;  3UFC X;  5F9L A;  1F9E B;  1NUE A;  4GC7 A;  1O5J A;  1EIY B;  3TQE A;  2HIY A;  2QYC A;  1HNZ J;  1IWG A;  1DFD A;  1BUX A;  1JIH A;  1N5S A;  3H7H B;  2BQU A;  4JYA J;  5HBM B;  5DDO C;  4Z7C A;  5HAO A;  3MCO A;  4OHZ A;  2KRR A;  4I1T A;  1NJI T;  2LFV A;  2AMC B;  2BW2 A;  1Q1K A;  3IRX B;  3Q8R B;  1DQ9 A;  3ZNU A;  5D3G B;  3HT3 A;  2J9D A;  1Q4R A;  1ULR A;  1PBU A;  2ZNZ A;  5E2Q A;  4UF4 A;  2PMZ D;  5LSR A;  4Z2X A;  1HNW F;  3BF4 A;  3LQV A;  3W8P A;  2QLJ B;  4RW8 B;  3RW7 A;  4ES2 A;  1VQ5 S;  2HGN A;  2HS0 A;  4JB8 B;  4ZVT B;  1CPZ A;  4OX9 F;  4CTA A;  4DUZ F;  4HTI A;  1RT4 A;  3SCI E;  4NWB A;  3PX0 A;  2EFQ A;  3Q89 A;  4DDF A;  1YZ6 A;  5LMU J;  1SJ3 P;  4ZA1 A;  1FTC A;  1YBU A;  3DU5 A;  3KMQ A;  5HLF B;  2R7R A;  2GVZ B;  4A8S A;  3QGG A;  3POT B;  5HJY A;  2P2C B;  4CWB A;  1Q53 A;  1SUQ B;  2HK3 A;  3KNG A;  4U95 A;  5GAG I;  5J2M B;  3VAK A;  1PYS B;  3EUN A;  3MMC B;  3DGP A;  4GVL A;  4NXM J;  5E3P A;  1Q8K A;  4QCL A;  1FFS B;  1U1L A;  2C2D A;  2J7W A;  4DSJ A;  2IMW P;  3PO5 A;  4EUV A;  1EX8 A;  1WSV A;  4IQM A;  3LGH A;  3K7R A;  3SSS A;  2G9O A;  1RCX B;  2B9E A;  3ISN C;  2C1E B;  2PMW A;  2MKS A;  3NAH A;  1IM6 A;  1FDB A;  2I1R A;  1D9A A;  2DNH A;  2DNP A;  3AJD A;  3BBB A;  4LQ9 A;  3W1Y C;  3ZZO A;  4RNO A;  4JI7 J;  5A0Y A;  2UUA F;  4HKQ A;  1A7G E;  1RWK B;  3GTY X;  3MED B;  4KHR A;  1DAR A;  4L73 A;  3IMQ J;  3CME S;  2MGZ B;  1Q8L A;  3ENA A;  3OL6 A;  2OI2 A;  3H5S A;  1RU2 A;  2NLW A;  4N8N A;  2W4D A;  4AFF A;  3Q8Q B;  1LK7 A;  2HLT A;  1UVK A;  3PRV A;  3RRK A;  4OYW A;  2UXC J;  5HSP A;  1VK8 A;  1U02 A;  2GML A;  1J2V A;  1VYA A;  3AAW B;  1FD8 A;  3CO0 P;  3FSI A;  1U6Z A;  3BSN A;  1D9D A;  4OZ2 A;  4IG3 A;  3FRZ A;  1K0T A;  2PI4 A; 
#chains in the Genus database with same CATH homology
 4J90 A;  2OGU A;  2BKO A;  4L75 A;  4RO0 A;  4EI2 A;  4L74 A;  1LNQ A;  4XTT A;  2AEF A;  4G65 A;  1VCT A;  3JXO A;  2AEM A;  4L73 A;  3RBX A;  3RBZ A;  4J9U E;  4J91 A;  2FY8 A;  4YS2 A;  2BKP A;  3L4B C;  2BKN A;  3KXD A;  4J9V A;  4GVL A;  2AEJ A;  4J7C A;  4L76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...