4XTTA

Structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
ASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIKRGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of Potassium Transport Protein KtrA Regulator of Conductance of K+ (RCK) C Domain in Complex with Cyclic Diadenosine Monophosphate (c-di-AMP)
pubmed doi rcsb
source organism Staphylococcus aureus 08ba02176
molecule tags Transport protein
molecule keywords Putative potassium transport protein
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 4xttA00
3KXDA 4J7CA 2BKOA 4GVLA 3RBXA 4EI2A 4YS2A 3RBZA 1VCTA 4L73A 2AEFA 1LNQA 2BKNA 2BKPA 3L4BC 4L75A 2AEJA 2FY8A 4J91A 4L74A 3JXOA 4G65A 4RO0A 4J9VA 4XTTA 4L76A 4J9UE 2AEMA 4J90A 2OGUA
chains in the Genus database with same CATH superfamily
4QU7A 2YKQA 4QZVB 3A3PB 2E5LJ 5B09A 4CLKA 4LF6F 4Y28C 4C3LA 2X7IA 1N4LA 4ZA1A 1GMVA 3CE8A 5BXIA 2POKA 2QLBB 4NEYA 1FRJA 1S7HA 3GFXA 3M30B 1BQMA 1FVQA 1JQGA 2ZBPA 1IJEB 1PYTA 3EGVA 4X4RA 2B7BB 3T6BA 5C2CA 4F4XA 2CQPA 1CG2A 4JV0A 2ADBA 1KWMA 4MK8A 4X4OA 3TA0A 2V2QA 3DDKA 3M9MB 3DN9A 1FRMA 4DR4F 2QG9B 2B9XA 1S10A 4RNMA 2HHHF 4NLOA 4FKYA 5IM0A 4XTTA 2OTJS 3OFEA 1SV5B 2Y1LB 2B8PA 3AODA 1H38A 2HHPA 2D3O1 1RA7A 1S1WA 2AGQA 3JB9k 1T0TV 2LXIA 3DKDA 4QYZJ 3FKBA 1NNDA 1QUVA 3NCRA 2E5GA 4RR5A 1OJ4A 2AZ1A 1HA1A 2DR9A 3MF5A 4JI7J 1FFSB 2C3PA 3OJSA 3CIZA 5DDPC 2RH3A 3KK1A 1YTYA 3BGLA 1H0HB 2V8HA 2B0GA 3M8SA 2Q1LA 1ACMB 3IS9B 2EC0A 1VOMA 4ECTA 3C15A 1RT2A 4ID8A 2HIYA 1DQ8A 1NHKL 3QYYA 3KG1A 3B78A 4IR1A 2BE7D 3KJQB 2MZTA 1J2VA 1G1XA 5L8RC 3SCIE 2RDIA 2XULA 2KG0A 4B3SF 4FYVB 4CYUA 1N34J 2X1GA 3HVRA 5D3GB 1YDLA 4JP8A 3LP1B 1M5PC 3K5NA 5EWGA 1YJ9S 1FJEB 1TTHB 3HX9A 3HVWA 3TR5A 1HYSB 2UUWA 1B0VA 4P2XA 4NRTA 1F0XA 1CC8A 2J7KA 3KUHA 3AJDA 3UN3A 4KGZB 3ZNJ1 2MDAA 5KFPA 4YQWA 3J81Y 4DBQA 1RT7B 3JYTA 2KRBA 5G0RA 4CWBA 2CZ9A 1JNRB 5J2QA 1U4BA 5C42A 1S77D 3L95X 3IN5A 2CKWA 4FF3A 2K7KA 3R8YA 1LV5A 4IG0A 4DSJA 4WKYA 5CD4H 1S57A 2JC0A 4DFPA 1NJZA 4KPYA 5LM7E 3TAMB 2CQCA 3Q8QB 4DR5J 1DRZA 2HS3A 4KQZA 3VGVA 1WELA 4J91A 4O3RA 3CD6S 1GXTA 1Y3KA 3C66A 1UJ5A 5DRKA 3T3FA 2XM3A 3OVSA 2O1PA 1X9MA 3K8WA 4XAKA 3IRWP 3DFEA 3HLUA 4X4QA 1XR7A 1Z2LA 2YBVA 3AXKA 4WU2A 3G8SA 4K4TA 4MKAA 2CDRB 2PMZD 3KLHA 1YBAA 3F41A 2Z8QA 3Q8RB 4ZPCA 2O67A 1WC1A 5F8NA 4OX8A 3PHEA 4OZ5A 4CM2A 4FXWA 2HRTA 3G82B 4UQTA 5KFOA 2R7WA 4LSZB 5E0OA 5ETOA 3PIOQ 2HHVA 4UZBA 4N41A 2GCFA 3W5YA 5J2MA 3AY0A 4RWWA 4DMZA 1R8PA 3CCQS 4DPWA 1DHMA 1RHKB 2F8HA 5E41A 2R4FA 2QL5B 2UV8A 2P9GA 2R42A 4IO1A 3US5A 5I4MA 3FUYA 1E6VB 4OZ2A 1M5KC 3Q2TC 4ATNA 1RT3B 2ILZA 4K0KF 4L76A 3GFHA 2HIQA 1I94F 1SQEA 4O44A 5IM0B 4UZCA 1SV5A 2XMAA 2EI5A 2OELA 1UVIA 2V34A 2GQCA 2C2RA 1HI8A 1NM2A 5DQHA 3OL8A 3HCXA 3EPGA 2QA4S 1T94A 2QA1A 4M5IA 2M7SA 5GVQA 2W7AA 2VQEJ 1Q81T 1RWWB 5ETMA 1RTDA 5E3CA 4PG5A 4DUYF 3L4BC 3F44A 4J9MA 1B7FA 1U8SA 2CPHA 3CDWA 1WWHA 2ZE2A 3M4XA 4P10A 4DPTA 3F73A 1U1QA 2ZHAA 5E2QA 1GFWB 4LVOP 3ZZ0A 2DEJA 1X4FA 5KFDA 1N32J 4TXSA 1RT6A 2MZQA 4Y65A 3TZYA 4N8NA 2I9SA 5IOLA 2YKOA 4JOUA 2E9RX 3H98A 2GVDB 3I0RA 1VLYA 2QRRA 4YHHJ 2W01A 4R8UA 3K5LA 4OYMA 2MJUA 4XPEA 1CSJA 3HM9A 2CQ4A 3MM7A 4ANCA 4RU9A 1GMWA 3FSIA 2HFVA 2RILA 2DGTA 3DLGB 4ETZA 4QWBA 1R6VA 2JLEA 2QT7A 1RAFB 3ENAA 2AX0A 5C24B 3GMGA 3UN2A 1RT4B 1AYEA 3VZIA 5CYJA 4B9VA 2DIVA 4DSIA 4UW2A 2BKNA 3M2UB 1IN0A 1NDCA 3AAWB 2O5DA 2CPEA 5J1PA 3ITHB 2HNYA 2JNJA 3H42A 2VHGA 4PUOB 1FXLA 1M5HA 3MDFA 2WBMA 2H1YA 3R1LA 4A48A 4K4XA 4LF1A 1DTQA 2B7CB 2YH1A 4I6AA 1IBCB 5HVGA 3TJ8A 1SL0A 3MURP 2FY1A 1NMEB 3OTCA 1H6KX 3GB0A 1YG0A 2GW8A 4HHHA 2OGUA 3AA9A 4OHYA 2GO9A 3HJFA 1JLGA 4A8YA 5HL7Q 3TANA 2VPWB 3PV8A 2F5GA 5KG0A 5IC6B 3BN7A 1ZM2A 2L48A 2XHWA 1HMVA 3B82A 5HQ8A 1APSA 4I2QA 3MWBA 4IRCA 2VJUA 2RUGA 2D7SA 2MHEA 4ANDA 1NDLA 4KR0B 3QAUA 4CO4A 2WK4A 3EMTA 4DV6F 3M8PB 4J9LA 1U2RA 3VGSA 4NLGA 1MW7A 3AQPA 4CH0S 1NSPA 4JI2J 1G6BA 2K2PA 3CJ4A 2EFVA 2EVZA 1VQYA 4DR1F 2GJIA 3EXYA 2R7RA 4LF2A 5D4OA 5IFMA 2KRRA 1W2BR 2ADCA 1R0AA 1VC6A 2YX7A 4DFJA 3NOGA 3UCUP 4OI3A 3G96A 4RKUC 2BV3A 4PR6A 2IC3B 3KXDA 2GHWA 2PD1A 4DR6J 2XY7A 4LUBA 1UZHA 2XY6A 3EICA 1C0TA 4P75A 3BPSP 5FD1A 4F4YA 2WOMB 1T05A 1F9HA 1HBOB 1EHWA 2DHXA 2X3DA 2V50A 3B54A 3MPDA 3OFFA 3R5JB 4M1KA 1ICEB 2V8PA 5IT4A 2ZH1A 4DV1J 1KLMB 1JXEA 1LWXA 2XMTA 1JB0C 3TA2A 4LSNA 1RP5A 3C6TB 2ZE2B 4CQ1A 3Q23A 2E5HA 3W3SA 1NPRA 1R31A 5G4DA 4IFVB 4PEOA 6FDRA 4KHPJ 2ZH5A 1NB2A 2XG8A 1BQNA 3TRGA 5KG2A 4JV5J 4KHPF 1L3KA 4ZVRB 3RTVA 3R5GA 4R8UB 1URRA 1RU1A 1MN7A 4OJHA 5GAEI 2GAHC 4P73A 4EO8A 2PA3A 1QE1A 2RS2A 4Q0BB 4MT1A 3NBPB 3TI0A 4AE5A 4ETXA 4F7VA 2IJFA 3DLGA 4X65J 3ENWA 4HI2A 3EZ5A 1VQ9S 1D9FA 3R3TA 4R5PA 2X1BA 3ET6B 5IZHA 4DX5A 2KM8C 4TNOA 5HAOA 4YN3B 4EBEA 4C8OA 4P2FA 4RNOA 2V4QA 2WB4A 3DGPA 2M8HA 3IGVA 1DTQB 3CJRA 3M8QB 3UCGA 3Q22A 4IUFA 1SBRA 1VK8A 2J0WA 2YWEA 3EXCX 1U7LA 3THVA 3OVBA 5JUMA 2RD5C 3HVTB 3RBEA 2UUBJ 3ENVA 5LL6d 5KFKA 1PSDA 2IVMA 3BSOA 4EUVA 3W8GA 1L5UA 4KJIA 2H5JB 2X3GA 1I1GA 1WI6A 2YTCA 5ETQA 1U1MA 3PR4A 4F4WA 4NZ0A 2FJBB 4W90B 3ILJA 1U0HB 3W5ZA 2AMCB 2I8EA 2IHR1 1HIYA 2RKIA 4YMEA 4DL3A 1V3RA 3H0PA 3T41A 4NCGA 2L9DA 3BDPA 2FHMA 3NS6A 3NGTA 3TX0A 2JJ4D 5ETKA 5A2QY 4C8YA 4L6V3 1SKWA 2ATCB 3OTBA 4JI0F 3P4UB 3ZC4A 3MM8A 4ZVTB 2FD2A 2EBGA 2L9WA 2P6TA 1BWEA 3BM7A 5D0HA 5KFZA 1XNQF 1S1UB 3PG9A 1AZSA 1N88A 5T41A 4L74A 4CO0A 4AL6A 4DX8H 1DLOB 4IQMA 1XMOF 2ZH4A 3SFGA 1TKZB 3FDSA 1NK8A 2OMOA 4EZ9A 1FJ7A 4QR2A 3PJXA 1HWUA 1FDBA 1RWVB 3LUYA 3M6VA 1X60A 2MMYA 4ZJQA 1S1WB 1X5SA 4KE5A 5H9FK 2B5JA 1Y5LB 3PR5B 3SQOP 1KOOA 3S1TA 2KXHA 2BANB 5C7PA 3FCWA 4DL2A 4ES3A 3CD5A 1S0VA 3UWTA 3OXLA 1FNXH 3WIVA 3G9CA 3W62A 4U7UD 1X5PA 3C6TA 1VRTA 2HSEB 1QTMA 3CDEA 4UF4A 4ZVFA 1RBOB 3I9V9 3O6QA 1NJWA 2GJFA 1ZYQA 1WDDA 3PIPQ 3PKYA 1S5ZA 2VC1A 2CQ1A 2ZBRA 4OHWA 1H72C 2HNDA 2W2QP 1Y00A 2VV5A 2JZ5A 3L7PA 1GK8A 3OSNA 3CULA 2RE1A 2DRAA 2ZUGA 3CTRA 2AQ4A 3M2VA 3BGRB 1R8HA 1UFWA 4N47A 3MUVP 1NK9A 1HYSA 3KNGA 3VAMA 1ZPWX 3G6VA 2VG7B 3M32A 1MMDA 2EKNA 4B02A 3L7UA 1MWQA 3DMJA 4ZHRB 2BE9B 1FKAF 1U6FA 3OR1A 1HD1A 4NLDA 4LFBF 3CEDA 4KFBA 4CCHA 1WC5A 2A18A 3GG0A 1LOUA 4ED0A 2E1CA 5HVFA 2J9DA 1VS3A 1TUWA 3R1HA 3D6TB 3QFHA 4IDKB 5KFAA 3SI8A 1T03A 5BYRA 1M0SA 5D4PA 2CXEA 5EWEA 4WCEQ 1WHYA 3TOQA 4BWMA 5DDOC 3BSNA 5L1JA 4B9UA 4IQXA 3IMQJ 3LGHA 4NLQA 2UXDF 3EDQB 4K4YA 1NK5A 1QUPA 3CCTA 2DEIA 4ANEA 2V9KA 4NRUA 5HROA 1YI2S 1RTZA 3RR8A 4FDFA 1V6HA 4FYYB 2CQDA 2ZD1B 3KLHB 3W5XA 2VQFJ 3RB4A 3KUGA 4M63A 3PYDA 3MR7A 2AKWB 2DR7A 4KGXB 4WFZA 3RB0A 1F9FA 4B3TJ 2A2CA 2C2NA 2HFZA 1RLDA 2AYMA 2CQ0A 2GVZA 3G82A 2ASYA 4L73A 1KQKA 5KG6A 3CCLS 2W9AA 3CO0P 1RDRA 3D3CJ 2XYPB 3K5OA 3MM8B 2B51A 4Q5VA 5A6PA 2B9EA 2O01C 4FF1A 2ZJPQ 3TO8A 3NY0A 1VQMS 1Q7YT 2H5EA 2ZZTA 4P2SA 3VAKA 2E7VA 3W2VB 1XR6A 1KD1T 4JI6J 3QMQA 3W64A 4C98A 3TQ1A 3BS9A 1PKUA 3FC9A 4Q7AA 5DG8A 2PFDA 1HI0P 4N8OA 1F9EB 2KXFA 1TKTB 3NP5A 3LOUA 2DK2A 1LWFA 3OTEA 2C22A 2KXNB 3BBBA 3CB4A 3Q8VA 1FRIA 4KGVB 1JXLA 1UPPA 2AWZA 1IR0A 5KTQA 2YQ1A 5HJYA 2IVYA 2KN4A 2B5JB 1UVKA 5KFEA 2AJ1A 4CLTA 5DDQC 1O5JA 7FDRA 4C7QA 1KNZA 1FNOA 3A8IA 4QIGA 4M8LA 2ZBQA 2C1EB 2NLWA 2HEKA 2K7JA 4IH6A 3CD0A 1RSCA 3MD3A 4I64A 2F65A 2DGWA 1EKRA 3KLFB 4ER8A 1SQGA 4ECUA 1JLAA 1RYRA 2CUYA 1QD1A 5CHCB 4J9QA 2ZH2A 2AEMA 2XCPA 2PT0A 3IBWA 5M2PA 2MKKA 3IO1A 5CCLA 3MGJA 3NWGA 4JI4J 1RJJA 2JX2A 2VG7A 3QNWB 4WYWA 4AQYJ 3IA0A 3R2DJ 4DCJB 4I2PA 4KGMA 3I55S 1TELA 4IH5A 3AFGA 3MMAA 3DOLA 4I68A 4NYOA 4WK1A 1W26A 1TVRA 4LF8F 4LFBJ 3GYXB 2HVIA 4Y0FA 2P2CB 1ZAXA 1QTNB 1TUVA 5A76A 4X4PA 4PUOA 5L1IA 4Q43A 1L3VA 5AJ3F 3K57A 1F5BA 4C11B 1WG5A 2VDIA 2ZM6J 2ERRA 3QZ7A 2CPIA 4IKAA 3BQ1A 2E1AA 1CJUB 1FT8A 2BW7A 2I5JA 4ELUA 4QU6A 2ZKUA 3S01A 2HHWA 2HQDA 3MHYA 4OYWA 3R7SB 1YHQS 1SL1A 4HDHA 4DX7A 2PI4A 3QJLA 2LXUA 5HROB 2VFRA 1N8RT 2ZWPA 3PCOB 2MY7A 1RWNB 2PE8A 2ZD1A 4ID5A 4U6PA 2VZ9A 3OLAA 1D9AA 4OYBA 3V5RA 2V6AA 2OPSA 4EI2A 4RU2A 1AFJA 4OI0A 3FMWA 1NZ8A 4NWBA 2FGOA 1S6QA 1HMVB 1HQUB 3OBIA 4F0MA 2W8KA 2GVZB 1S76D 2CPZA 3R6LB 5FLXY 5IT9Y 3IWLA 3UD5A 5KT2A 1KP6A 4I6YA 2LXFA 4PWWA 2CPXA 4TKTA 5I3UA 4EZ6A 5AJ3J 1TMMA 2RHSB 5KFLA 1MG7A 2W7PA 4O3OA 2ROGA 3UFCX 3VAFA 1TAUA 4QW9A 3WDOA 4LFAF 2E9TA 3H5UA 1SH3A 4DPXA 1HL6A 3ICLA 3KG0A 1U1KA 3HFVA 2XSJB 3WZ0A 4DL6A 2BJ7A 4DR6F 3DRRA 3MCOA 4AYBD 2LA4A 2FJWA 3DOMA 5D4LA 5KG4A 2JLGA 1VQOS 2AJQA 3WC0A 2F4VJ 2W4PA 4QQBA 2N82B 3HO1A 3MAAB 1LW2B 3IM8A 1FA0A 1N0UA 1R3NA 4KV8B 2PO4A 4H4OA 3RGIA 3FFIB 1KEKA 3TZXA 2DHAA 5I42A 2AP6A 2VU5A 5AE2A 2D9OA 1VBZA 2J9CA 2YNGA 2L08A 4ZCKA 4DV4F 3AJ1A 1N5YA 5E5NA 2E9ZA 1NUEA 3C15B 3GU0A 1JLAB 2VD3A 1KTQA 3BBFA 3RU0A 3KLGB 4K4WA 2DNKA 4U7CA 1IJFB 1IKWB 4C4WA 3GYGA 5D3GA 1VRQC 5LT5A 2G0CA 1ZM3A 2CPYA 2CAJA 4A8KA 2CFXA 5ETNA 2VA3A 1MROA 4IO9Q 1QSLA 2HHSA 3E01B 4QOTA 3ZZTA 2GMJA 2RRNA 2V4RA 4IR9A 4TU9A 2R7UA 2O66A 2NZ4A 2K3IA 3NLCA 2HNZB 2PMHA 5G0RB 4DV0J 2K3KA 2OSRA 1LNQA 5KFVA 5C42B 4LF8J 1FD2A 1YLXA 3ET6A 3FMBA 2DO0A 4ICLB 2OPRA 4ZVOB 4YR0A 4F02A 4X64F 3QATA 1TKXA 4OL8A 2W2NP 4MK9A 4MYTA 2R3VA 4X4UA 2QLJB 5HSPA 1IR1A 1MSWD 1S12A 3DGPB 4DOZA 1X5OA 1DTTB 2HMIB 2E1RA 1QY7A 3BGUA 5EGYA 3VAHA 1CJUA 1ZPVA 4DL4A 4LRDA 1VMBA 4NXMJ 2H9ZA 4N56A 2C2DA 3V4IA 2HBQB 2DGQA 1K44A 2FJVA 5DG7A 2KJVA 4U8VA 4CLYA 4ZIWA 4RX6A 2IM0A 4OV1A 2MGZB 4ID5B 3B4DA 4UQGA 3HD2A 2B9YA 5A0YB 2XLIA 3AHPA 5KT7A 2OEMA 3L9ZA 3NNAA 4M5MA 1MU2B 2F9DA 2HFSA 2RKIB 2F8MA 2GGPB 1NDKA 1GNKA 1P1TA 3GE9A 3QWUA 3BR9A 4OJ3A 4DPOA 4DV1F 4NCGB 2QGFB 3NGSA 5JVHQ 2F63A 5E3RA 1VBKA 3H4DA 1J5OA 5KFHA 1HNVA 4MTPA 3SCJE 2DRBA 3KHGA 1ZM9A 4ECVA 4RUCA 3PO4A 4OX6A 5HMYA 3D6HB 5F9NA 3CMES 4A4JA 2DXDA 3FQKA 4QYRA 1GEHA 4C8ZA 1WG4A 4ZPWR 5CA5A 1WF2A 2DGVA 3PHTA 1DQ9A 3VVTA 2HAFA 2DNGA 3IR5B 1RZMA 3TWZA 3HHDA 3EPIA 5KT6A 1V9OA 2DT9A 2A6MA 2NPIA 3PW7A 1TK0A 1V3SA 4KHRA 5IQQA 5DETA 1ULRA 4KH1B 4RZRA 1N5QA 2GS8A 5LXYA 5H9EJ 1K0TA 4IFYB 4USKA 1Q1KA 3G86A 4F26A 1RTIB 2QMWA 3H4BA 3BSAA 2IM1A 3EWGA 4OX7A 1K73T 5IS2A 1TL3B 3FFIA 1N36F 3FEYB 2R8GA 9ATCB 2MQOA 3MMBB 3VQTA 1VRTB 2CWXA 1FWKA 2MEWA 2WCXA 2ZJQQ 3GIIA 2HFOA 3K8VA 4YFUA 3QRRA 1TFYA 1HR0F 1FWPA 2EG2A 1RWUA 5H1SV 2HNDB 5HATA 3OSPA 2YKMB 3GJSB 5J1EB 5HP1B 3I0RB 3GIMA 5KT5A 4LRCA 3NG8A 2WVBA 1FTCA 5HMWA 4ED2A 3HD1A 4LF7J 1RE1B 4RPFA 3VZHA 1Q8LA 3IM9A 5MAOA 1F2HA 4P6QA 2OSQA 2VKRA 3IWNC 4V19X 1HBMA 1BD6A 1HD0A 3QT5A 1B0TA 2HQ3A 3N0VA 6AT1B 3V81A 1C4CA 2A6OA 2CZVC 1DFDA 2A0FB 2V94A 3R5BA 5C24A 2N4CA 1IKYA 3CJ5A 3G6YA 3KHRA 3RZAA 1I94J 1BMQB 3DC2A 3J81j 4EO6A 2VKZG 4DCPB 3MUTP 5L9NA 2BJ8A 3TW0A 3O2IA 3QIPA 3TP2A 4NCBA 1XNQJ 2C2ZB 3HZEA 5KG5A 4PWDA 3H2LA 4K2JA 2NZCA 4DQRA 4G3IA 4KIAA 1HNXF 1Q95G 1D9DA 3LF0A 5DLFA 4B9TA 3N6NA 4WXOA 1NLKL 1RKIA 3NAIA 3ZNUA 2JFKA 5HQLA 3OTOF 4DUZF 1S9GB 3OXGA 4ZN3A 4FXVA 4ENOA 5J2PB 4M5DA 1GAOA 1HNZF 1HWIA 3PACA 1M5OC 1UP1A 5CYQB 2FJXA 4ZITA 3NEKA 2UXCJ 2V5HG 1NXIA 4Q8FA 3NCPA 3SQGB 2UVUA 4K8RA 5L39A 1FERA 4NXNJ 1WSVA 5EX0A 1D8YA 2RVJA 3W61A 3EGWB 5E3QA 2IIHA 1J5OB 4Z7YA 2R2UA 1AA1B 1TQLA 1RAGB 5CYMA 3DDNA 5CH7B 1Q78A 2DNZA 2DKOB 3UD3P 3W2VA 1TL1A 4U96A 4LRAA 4ZP6A 1K47A 3I9ZA 3LTOA 3J80U 3HSJA 3Q8SB 4J9RA 3TAQA 2B4UA 3V6KA 2KTQA 3UVJB 1JJCB 3VAJA 1TKTA 3FRYA 4I56A 3CJ3A 1SQFA 3C8YA 2AHOB 1DY3A 3ZTPA 4X4SA 2HBYB 3IP0A 2GMLA 3KKFA 1NK0A 1U45A 5D4NA 4F04B 2Y8YA 1C0TB 3VTIA 1SJ4P 2HZVA 3MMJA 1TV6B 3ZZUA 1SUQB 5D6GA 5D0GA 5DJBA 3X3UA 3RAXA 4ECSA 2ZC3A 3MEDB 3BV8A 3D0HE 4MIWA 3KK1B 3HXMA 5E33A 2CPFA 2IYGA 2FHKA 3MM6A 1EB0A 2HZAA 2BXJA 2LFVA 3PRBA 2B3TB 4PXCA 3CJ2A 3X1LB 4ES1A 5C25A 5DQIA 1JMTA 2Z30B 3TEHB 1N5VA 1VLOA 2GNKA 4ED4A 4DS4A 2NPFA 3PM9A 3KMQA 4X4NA 3AD7C 1P8GA 2YKMA 3P5BP 4KSEB 8ATCB 5J1EA 4DV3J 2BR0A 2Q43A 2RF2A 1RCOB 1C1BB 1RCXB 2UUBF 4OZJA 2IM3A 5DLGA 1YJ7A 2KM8B 5HN0A 1XMQJ 4WE1B 1S6PB 1BHNA 1UEVA 3O3LA 3RW6A 1AXQA 4X4VA 4M5JA 2E5LF 3OQ2A 4Q0BA 1T7PA 2CPDA 1HBMB 2KFZA 1T9WA 2OI2A 2ZNYA 1HQEA 1H7WA 4OHVA 5BYQA 4C8NA 1VQ7S 2MY8A 3JSBA 3JYTB 3DOLB 1SL2A 2U1AA 1F2GA 1GTEA 2HS0A 3FJ2A 1TVRB 4YDXA 5J2QB 1TKDA 3WC2A 2H5IB 4ZPAA 2E7XA 4Y2KA 2Z56B 4ZN1A 1VQKS 4JI0J 1H74A 2N7CA 2G0IA 2XYGB 3T1HJ 4PABA 2LDIA 2PIIA 4C11A 2LECA 4RJVA 2LU2A 1NRKA 3M8QA 2N3OA 4QWEA 5KOWA 1FWLA 2UU9F 1CEZA 2VPXB 3AOCA 4E8UA 2RRAA 3D7SB 2GHVC 3SMZA 5KFUA 1T8EA 4BHQA 4CH7A 1DURA 4YR2A 4WP9A 3KJFB 1M1GA 2DNYA 1BWVA 4KH0B 3THPA 1ZETA 2DGUA 3B8HA 2OJ3A 3DXSX 3FCHA 3OD2A 5D0EA 3PW5A 2KZZA 4ZPDA 4CNYA 1TAQA 1RU2A 2K06A 5B0DA 3LANA 2MQLA 2CPJA 4A47A 5IV4A 2J0SD 4GO7X 3CT9A 4B08A 4XDCA 2W9CB 1XMBA 1LFWA 2Z2MA 4F2RA 1FESA 4Y2IA 1RABB 2R8IA 4EYIB 1TK5A 3TYTA 2FY8A 4Z37A 3MEKA 4ZVEA 1F60B 1GH8A 5CYMB 3K2YA 4QYZK 3ETOA 3GR0A 2YNFB 3NS5A 3PEJA 2BQRA 3OFGA 2G0JA 3MECA 3KLEB 1U25A 1D0EA 1TL1B 2ZDPA 1UPMB 5K9FA 3H25A 2XMJA 4JI1F 1B64A 2C3YA 3J7AN 3GJRB 2ZZMA 2DJWA 1RAIB 1WUUA 1HWKA 2W2PP 4NX9A 3QGGA 4PQAA 4O44B 1NSAA 1FTRA 1Y3JA 4KB7A 1BXNA 4ZIVA 3IAM9 5L38A 3SYZA 1KN6A 1K8AT 4HTJA 3EM1A 3QSIA 3QT6A 4Y2AA 4RUHA 1F3FA 1SUQA 4FVMA 1PAUB 4K0KJ 1IKXB 4DZDA 3B4MA 4H4MB 4H4OB 4ZVHA 5I42B 2SXLA 1F6TA 2YWGA 1GX5A 3PKMA 2W8LA 4EYHB 4ILMA 6FD1A 2AJ4A 3SZ2A 2HGNA 2F3JA 4FXDA 1T9YA 4F8RA 2OLWA 3TUIC 2AYBA 4X62J 2XZWA 3W60A 1SKSA 1X4DA 2M9KA 4O3NA 3DU5A 1JJ2R 3C6UB 2I38A 1WKLA 2LYVA 1C1BA 2E44A 5ETVA 1XR5A 4F36A 3LWMA 1QAJA 2KT2A 3T5HA 4DQPA 3BGRA 3MTJA 2V9WA 4WE1A 2VODA 3QBCA 3BKTA 5LMNJ 2XNRA 1Y9OA 1MLAA 1RWMB 4GVLA 4RBVA 1FXRA 3SDEA 3OJUA 4O3SA 2XS2A 1ZTWA 4L3NA 2ROPA 4Q45A 3IRXB 3KYLA 1RT4A 2XS7A 3OR1B 1R43A 1LK7A 3MPYA 3M2UA 4DV5J 4ICLA 5I3QA 2KYZA 3ITHA 2EBEA 2YWWA 2UUAJ 1BE4A 5E7OB 2KJWA 4DL7A 2WSFC 1H2TZ 1UVJA 1KVJA 4CNZA 4B3RF 4PAAA 1OWXA 2QSWA 3CD7A 4M5NA 4NYPA 4I69A 1Q82T 2QE5A 3JXOA 4X66F 1JLFA 1OYDA 1FDDA 3CCZA 4DR4J 1YZ6A 2J6UA 2ZDOA 1GQEA 3AB2B 4ED1A 3O44A 1ZZNA 1V3ZA 5KFFA 4DR7F 3D1OA 3M8WA 2MQNA 3I56S 5CXTA 5A8KB 1HNWF 2DPJA 2XHCA 4LBHA 3A8EA 2LLZA 1T9XA 5IT0A 3PRDA 3PJWA 1UMJA 4ZKAA 4CM0A 2I6WA 4M95A 3TVZA 1C4AA 4DSLA 2JHEA 2OP5A 2E5JA 2MLYA 2AEFA 5DO2A 3S6EA 1G2EA 1IBMF 3IGNA 2HS4A 2G2YA 2WAQD 2RRBA 2YNHA 2A2DA 4JUZA 1HNVB 4A8OA 4QWDA 3M2RB 2LQJA 2IYIA 1NJIT 1QJHA 3M8PA 3W63A 4NMXA 2YNFA 2CJ9A 2CQIA 2MQ8A 2AW0A 2Y1RI 3M7VA 5LSRA 3JQMA 1GX6A 4OLOA 1KRPA 4NXNF 4DHVA 4G6VB 3THTA 3KK3A 5H9EK 4OHXA 2MZSA 3FRZA 1FDAA 2IMOA 1HW8A 4EBDA 4UOGA 3RR7A 2EXUA 2YY3A 5GAHI 4UY8T 3LPYA 2R9LA 3PJ9A 3NNCA 2V63A 5HJXA 1REVB 2M5YA 4B9LA 4DR7J 1IBLF 3V6JA 4WFAQ 2DITA 2G2OA 1SC1B 1QLNA 1WC4A 2Q79A 2HKEA 2U2FA 1X8DA 2IFXA 1HBOA 3FBCA 1NSKL 1WHXA 2KB2A 2MLZA 1BGXT 4OYPA 2DY1A 3PYEA 3UDVA 2C3MA 2ZBIA 4L75A 4C0BA 3OL7A 1YSJA 3UR3C 1U48A 5K8MA 2UUAF 3PY8A 3CDBA 1X4EA 3AJ2A 3C19A 3FQLA 7FD1A 2CJAA 5ETSA 3KOAA 1O8BA 2OPQA 4NLSA 4Q44A 3BQ0A 1S1VB 2J76E 4OX9F 4YEAA 4KGKA 1NKCA 2WW4A 4ECWA 1S1TA 3N5BA 1Q8IA 2PSZA 1CPZA 1RT5A 4YY3J 1RAOA 3DRPA 2HVEA 3BR8A 2QO3A 5B08A 1RTJA 1IBKF 4AL5A 5EDWA 1NAQA 1YRUA 4HVZA 4Q2MA 1NSQA 3GJTB 4I2PB 2DXEA 1IKYB 3CMAS 3MMAB 3TEGA 5GAEU 4KT0C 3S8SA 1XMOJ 5CCMA 2R8HA 3CCRS 5GMEA 3EGNA 3MAHA 3WHIA 3GP9A 4M5GA 3TZWA 2P5VA 3LO3A 4ZCIA 3DI6B 3RAQA 1KOHA 1B70B 1W2IA 1N0VC 1WC6A 3CDUA 3QIPB 3QT8A 3BO4A 2CNKB 4OZ3A 4F4KA 1NU4A 2WSCC 4F2SA 1T95A 2EEYA 2FLPA 1WSRA 2JEGA 3ADAC 4RLEA 2MZRA 1N34F 4BS2A 2APOA 3HVTA 2V8VA 1VBYA 2ZZNA 2QFJA 3OR2B 2IBKA 2LP4A 1G7CB 4M5KA 3EZOA 3PW4A 1ZTTA 2CNNB 3KHLA 4JI5F 1FNMA 2KVQE 1FKPA 2XMMA 3G6ES 1RWOB 2JH3A 3K17A 1PGZA 4EK2A 1B3TA 2CNOB 1AROP 1VGYA 1JLBA 3D6FB 4TY9A 2DXFA 1E6YB 1JXVA 1EZZB 1HQUA 2CADA 2HWHA 2NXNA 3HKZD 2OEJA 2D9PA 2HQGA 3QIDA 4F4ZA 5D15A 1X0FA 2IA0A 1I3OB 3UPFA 1Y7PA 4NEZA 2L3MA 2BA9A 2KKHA 2EFGA 1D09B 2A3JA 2JEFA 4JI3F 2Y8WA 3KNAA 4ED5A 1RADB 3HZGA 4PG6A 4WJBA 4BC9A 2RNEA 3JSRA 2WVFA 4DSFA 1S48A 4IYQA 1YITS 2DNLA 1X9SA 2VG6B 2BRKA 3D2WA 4NZ6A 2QJ3A 4WXWA 2IAJA 3QO9B 3CCWA 1RACB 5F41A 3ISND 3GIKA 3G6XA 2CYYA 3UVJA 1VHFA 1IKVA 5HANA 3PW0A 3PFEA 5HMXA 4UUWA 4JI8J 1FI4A 1Q7LB 2OMLA 2DR8A 2VG5A 1SI9A 1WOPA 1UW4A 2D3ZA 4DJBA 1H3DA 2V0NA 2QYCA 1JLEA 1VJQA 1TV6A 2RS8A 3MOJB 1WKJA 1XIQA 4ED7A 2B56A 3FEZA 4DXLA 5GMDA 2XGPA 1XQIA 2H54B 1JLCA 4OHZA 1LQ9A 4C3KA 4U95A 1U1NA 1FRHA 3MM6B 2YNGB 4CTAB 4C0HA 2GQ2A 1PJ7A 1KFSA 1PJ5A 1UTAA 4O4RA 4K59A 1SIWB 4HTIA 4YR3A 4ZP8A 4FS1A 4F3OA 3DOKB 3G8QA 4G65A 5JMNA 2BM1A 4TQSA 3PRVA 3LP2A 1IKWA 5KFJA 3ZZYA 4ED3A 2DBBA 1T02A 3M2VB 3T5KA 5ETTA 1L3SA 1Q4RA 1ZA2B 1N54B 1ZZFA 1RT5B 1KFDA 2MSTA 2XBPA 3DRPB 3GPAA 4KC5A 4ZVSB 2HBZB 2XYHB 1PCAA 3E01A 3PFOA 5KFXA 2G2ZA 5F3ZA 2OEKA 1QSYA 1URNA 4WU3A 2RUSA 2ZHOA 3N79A 3DMJB 4ZHRA 3TUZC 2HNZA 2ILYA 1GMUA 1XERA 2G13A 1AW0A 4ITSA 1S49A 3EX7B 2XZTB 3P96A 1B0PA 2FQQB 4G1PA 2OPPA 1QAIA 4JYAJ 4WIIA 3SSQA 1BQXA 4HHUA 2VBWA 4XPCA 3T1HF 1S0OA 3JS9A 3EZUA 3K7RA 1HNWJ 4QBUA 1F1BB 2VFTA 3PX4A 2WVCA 4ZLPA 3V6HA 1RKJA 5B0AA 4C8LA 1JIHA 3CXCR 1YQHA 2UVVA 3OR2A 4FYWB 1X9WA 1FD8A 1VYAA 5AE1A 5HLFA 4X4TA 3MR6A 2VFUA 2VIHA 5AE3A 1TK8A 1WEXA 4HYKA 4PPDA 3CF5Q 2XLKA 2GFFA 3HSZA 2QX0A 2I0XA 1MMLA 2YWFA 4HH0A 4WYLA 1BY9A 2RHQB 4PXEA 1OSDA 2GA7A 4NZ7A 4MAKA 2YKNB 1UL3A 1KLNA 5HQMA 4Q8EA 2I1RA 2JEIA 3CCUS 3GG1A 2KU7A 4CT8A 1RXOB 3CCVS 2MKSA 2R7TA 1S4EA 1YRXA 4JI2F 3U7JA 5KFQA 2DYAA 2VQEF 4DV7J 4JI4F 3HF5A 1FDNA 2V2ZA 2GC8A 3BN4A 3OXFA 3FSYA 3KLEA 4AQYF 2HWTA 2L9NA 4I67A 2AT1B 4ZJLA 2DR6A 4UOHA 1NK7A 1IKVB 2YKPA 2LKZA 1H2UX 4USWA 5GADI 1WOSA 2RU9A 4DN0A 2X51A 3BYPA 5ADZA 3PX0A 5KFIA 1U6ZA 2HURA 3FCVA 2N7YA 2IY5B 3MZIA 3Q89A 1VCTA 4O3PA 1RTDB 3B6BA 4PCQA 1TL3A 2DHGA 3RB6A 2ZH8A 4NA3A 3MPVA 5EHHA 5KT3A 1UVMA 2QYGA 1DARA 4CTAA 5BYSA 1WJ9A 4FNIA 1EETA 4QR0A 4DUTA 2R8JA 4LF5J 4QCLA 4QPXA 1Q8BA 4BWJA 3NXZA 3OTDA 3DOKA 3MFIA 4Q2LA 1B7YB 1FFGB 1X4GA 2QL9B 4A8SA 4CP5A 5HP1A 4PYDA 2DH8A 1HPZA 3BSCA 3C6UA 2JWNA 3POTB 4LR9A 4V19J 3HK2A 4Y3CA 1VRUB 4MIBA 2MQMA 2XLJA 2CJYB 2ALYB 1W7WA 3V4MA 4KBIA 1PG5B 2FUG9 4CLFA 3Q2SC 2WVDA 1NEEA 4QPTA 4JV1A 2JEJA 3BH6B 3V81B 2KYXA 2MXYA 1J5EF 4IG3A 1FJGF 1PIEA 4USTA 1HARA 2OFHX 4P7VA 1C2PA 3C3LA 1VIXA 5SUHA 4YHHF 2FIUA 1RHRB 1XJWB 2AX1A 1M5VC 2LEPA 4OFZA 1SVDA 3ZXWA 4A8XA 1N6QA 1IM4A 1KTVA 2UV8G 5LXRA 3HJVA 3T6JA 1LEOA 3I0SB 5HMZA 2VPZB 1IWAA 4HKQA 3SIPB 4CLZA 1NHVA 1SB6A 2YH0A 2RAQA 1PBUA 1M1KT 2OD6A 1DAXA 1KBRA 3G87A 2PDAA 4P74A 4RNFA 2F40A 3OUYA 4YB6A 4DV5F 3T5LA 2R7VA 3RRGA 3O8WA 3DLKA 3O5TB 2HQFA 3KFWX 5HLFB 4X64J 4DPUA 2GZOA 2A10A 4IOAQ 2OKQA 3CJTA 2PI5A 1PO6A 3VAGA 1R0CB 2OPSB 3E51A 2RQ4A 1RYSA 2E29A 3CJQA 3U1MA 1U1OA 2N4DA 4E0DA 1IQTA 2CQHA 2G9OA 1S6QB 4DWIA 1Z4UA 4EU0A 1Y0HA 3H8YA 3LPEA 4CLPA 4USUA 2B8QA 2BABA 4E2FB 1NPKA 5L1KA 3AXMA 1U1PA 2FVSA 1CJVB 1N52B 3CIMA 3M2RA 4LQ3A 2YPYA 3IWXA 4LT6A 1S6OA 1TR0A 2PMWA 3HULA 1EIYB 3CDAA 4EGLA 1OYEA 4WFYA 2W24A 4QW8A 1BUXA 3UDLA 1NB7A 3NGDA 1UZDA 5KFCA 1NHUA 1KQSR 2FJAB 4ELTA 4QIFA 2KHCA 4IRKA 4IOCQ 5CZXA 2XSJA 2JVOA 1Q79A 1JKHB 3RB3A 2DO4A 1S1XA 1TUGB 3DRRB 4DS5A 1REVA 1IQZA 2J0QD 1FRXA 2NUHA 1HHSA 1SC3B 3CJ0A 4GC7A 1UAWA 3GV7B 3J7ZT 3PYGA 3HT3A 4CH1A 5I3PA 2BQ3A 2HAIA 4LF6J 1LW2A 3HT0A 4CLWA 2RU3A 5KFMA 2Y1IA 5B0FA 2VJVA 4TYAA 5KG3A 2NXUA 1SH2A 4P71A 2M3DA 4DCOB 4ZCMA 1FHTA 3N6MA 5K14B 2QLWA 1EETB 1Y4ZB 2YNIA 4N77A 4OJ1A 5C25B 3CSKA 4DV2F 3M05A 3T9ZA 4N7TA 2VONA 4YUDA 4QIEA 4E98A 5T14A 3KLGA 3BQ2A 2MHNA 4J9VA 1BLUA 1DJ0A 1KQGB 1REGX 2DIUA 2RF2B 2XGQA 3POTA 4TQRA 2QLFB 1D8ZA 1NKBA 1RT1B 2QL7B 2ZH3A 4OIXA 1ZM4A 4GVBA 2LQ9A 3K59A 1X4HA 2ZEJA 4AUKA 5GAGU 2EG1A 1HQEB 2DH7A 2MKIA 2M2BA 1QAXA 4IG3B 4LQ9A 4CRJA 3JSMB 1X4AA 4A46A 2ZWOA 3D68A 3K0JA 1Z2ZA 3LP0B 4RUBA 1FK9A 1UKUA 1P9QC 1V5IB 2BKPA 2ZBCA 3KJVA 1KC8T 2OPRB 2Y0SD 5K8PA 3HMJG 4RW6B 3VAIA 4BDPA 1TKXB 3ZTSA 3DI6A 4JI8F 2ZJRQ 1XBWA 2BJ1A 1JK9B 3D0IE 3DRYA 2DNMA 1ROFA 3N6LA 4J9KA 4B3OA 3D1QA 4EBCA 2H4YB 1P1LA 1XEZA 4QR1A 2HMIA 1SC6A 5F8JA 2Q3PA 2YX4A 4P9SA 1K0VA 2DD8S 3MMCB 4C48A 4I7FA 1YJTA 3I5BA 1WEZA 3M1VA 5DM7Q 3MCMA 3ZZZA 2V2KA 3SV3A 2NREA 1IUJA 5HO4A 1CULB 3W9IA 2KL8A 2MGZA 1QVFR 4ZP7A 2KZMA 3I32A 2Z58B 4V1Ak 5F9LA 5A0YA 2K8GA 5ETPA 3ETMA 4C9DA 2FVRA 4TYBA 4PWUA 2D3OR 1MU2A 3K89A 3W1YC 2R7SA 4FYDA 2MYFA 3DXBA 5DQGA 1R89A 3MAQA 4C8KA 4GKKF 3F0NA 3HHKA 1K1SA 3H2UB 1QM9A 4DZ6A 5BJRA 4B9MA 1GT8A 5A2QU 3MOZA 4JI3J 1CJVA 1Z1ZA 2PC6A 8RUCA 3D9BA 2IM2A 2W4DA 5THWA 1KSPA 3VALA 4UT4A 3W2WB 1D1UA 5KT4A 4TVAB 2OTLS 2FB0A 3RJMB 3KK2A 2K1RA 2EFPA 2FJDB 3AB4B 3MECB 4C2MA 3LA0A 3MFHA 5K5MA 2BX6A 4K2XA 1OY6A 4KHMA 2CJXB 4BLGA 4B3SJ 2IPOB 4W4MA 1SJ3P 2EWHA 4DV6J 1T9UA 1YWXA 4C0OC 3HHLD 1S1XB 2YKAA 1NCLA 3DGVA 3FBBA 3N28A 2KFYA 3RBXA 2HQIA 4PPZA 3Q8PB 3OLBA 4A8WA 3G2XA 4EEYA 2QEXS 2XB2D 1FO1A 1UWBB 3DLHA 4CO1A 4IFYA 3IG1A 3ZZOA 2PGCA 1PC4A 1RTIA 3GFZA 4DR3J 3E8OA 1IKXA 1VK3A 2MKHA 2NYIA 3CJSA 3KDOA 3H5XA 4H4MA 1P9YA 4WZQA 2HLTA 1HNIA 3MMBA 1S9FA 5D8HB 1VFJA 1WC3A 2RMLA 2V4JB 3MI7X 1YIJS 4O0IA 2YWHA 4G1QB 2KI2A 2BOPA 1ZA1B 4DV2J 2AD9A 3DLLQ 3QFWA 3MEGB 2YWKA 4RWXA 1CVJA 3M6XA 3DRSA 1F5CA 5L46A 4MFBA 3OFHA 3BH7B 1FX4A 4ELVA 4DF4A 2Q66A 1UFLA 2EFQA 3I4HX 1SKRA 3QWPA 3JTPA 2KHDA 4OYOA 2B6AA 4HT5A 5KOXA 3IBCB 2NYHA 1DQAA 4BC7A 1FE4A 2EC2A 5C2GA 2RB7A 4FZVA 3SDEB 3AH6A 1EX8A 4DI6A 2P9CA 4LR8A 4GC6A 4IRDA 2EFNA 2ZH9A 3IRXA 1N5TA 3JSMA 1HQ2A 3DLEA 1UFKA 1AB8A 1KHWA 2DNNA 4USHA 4C97A 1SJ1A 2CA9A 3PEHA 3R97A 4FF2A 2BM0A 3QGHA 5EUHA 3H20A 3R9LA 1GMWD 3U1NA 1OPZA 4HLBA 2E66A 2B43A 1ZH5A 2NXCA 2R7XA 4YOEA 2ZKTA 1CQMA 3EGZA 4PRFA 3I31A 4DR2F 1JLFB 2H48B 4URSA 2AJ2A 3QT7A 1GXLA 2XO6A 3VV2B 1XMQF 1S9GA 2QV6A 4DQQA 2J6SA 4M5DB 3H90A 4USJC 2B9WA 3C16B 2XWYA 5CYQA 3NL0A 2NSBA 4O23A 2RIJA 3SQGA 2HLUA 3CCSS 3D3BJ 3JAMY 2XNQA 4TLRA 1G3OA 1RB0A 1WG1A 2YNHB 1OO0B 3UDCA 3T9NA 3CVKA 3HSDA 5F0WA 4ZCLA 1N33J 3BO3A 1G4CA 1I5OB 1CS4B 1HR0J 4RL1A 1WDTA 2UVRA 1LXJA 1EP4A 3DM2B 3KDNA 1F3VA 2P6SA 3KK2B 4RW9B 1XN9A 3P6YC 3ILOA 3PTWA 4JB8B 4CIOA 3KK3B 4B3TF 3HVAA 4ZK7M 4OYIA 2C2MB 2LEAA 4H4KC 4RNHA 3CCMS 1FEEA 1S99A 4FN5A 5MLCV 3GCWP 3H7HB 4FPRA 3Q8YA 3GQCA 3L3CA 2Q6BA 1YX2A 3D28A 3NRBA 5T7LB 2BYCA 1KVIA 2D1CA 3CPWR 1HBUB 3RRHA 2UP1A 1VDHA 2UVWA 3ISNC 3IG1B 4HT7A 1TP7A 2HHQA 1WORA 1ZOTA 2AF6A 2AJFE 2C2OB 4W98A 2PEBA 4FYXB 1K1QA 3MEDA 3VGTA 1K9MT 4MH8A 4PZVA 1H73A 3NNHA 1WHVA 2CQ2A 2COLA 4H4KA 4WTOB 5B0GA 3NCQA 1U8WA 2LQ5A 4NI2B 4DR5F 2BMBA 3VWSA 1Y5IB 1HW9A 2CJBA 2G4BA 4FNHA 4K5SA 1S1VA 1VQPS 2DR5A 4JI7F 1YJWS 2C2KB 2EPIA 3PNIA 4DL5A 1S6PA 2B6AB 3AD8C 4ECQA 3CJKA 2YXLA 4OI2A 4Y6IA 2DNOA 3PO5A 4LF7F 3D54A 3SFUA 4OLPA 1RHUB 1RTJB 3DCAA 3AOAA 1Q86T 3ILLA 3TVKA 2HWIA 4X62F 1FJGJ 2RQMA 4X65F 8AT1B 2F4FA 4R0JA 3DLEB 3J7Z5 4B3RJ 1OY9A 2WHOA 4FKXA 3BB5A 2WBRA 1VQ4S 3NKYA 2C2EA 1ZAVA 2R2RA 4PYAA 1RHJB 5KFBA 1NH8A 1NZAA 3OHAA 4OJGA 1RHQB 1N48A 2NUUG 3KHHA 4I6WA 1LK5A 2DNHA 2DRDA 3SSRA 4CYUB 4DSEA 2P9EA 5HBMA 5F8HA 3R7NB 3ISZA 1KQFB 3DRXA 3HI9A 3UCZP 4RUAA 1FKPB 3MM5A 5IWAF 2YPZA 1S0NA 3HSGA 4NA1A 2NXJA 3D6MB 2JSXA 3HHLC 1KS2A 4AT1B 1UEUA 2YQ3A 4CI0B 5LJ5Y 1U02A 3BKFA 3C14A 5A6WA 3ZO7A 3J7YI 4D3GA 1E6YA 3V2UC 1U47A 2AZ3A 4LF5F 3D67A 1VHIA 1NDPA 2BEFA 1GXUA 5FLXU 2HHHJ 2W9CA 5IT9U 1WKKA 1SJRA 2LQBA 3DU6A 4IG0B 3UR0A 2BRLA 4A8FA 1Q8KA 2BE2B 4ZOSA 3G8TA 3RUBL 1FXDA 1YJNS 1FRKA 2Z2YB 4PQUA 3V6DB 1MWYA 1X31C 3L7OA 2UUCJ 2XY5A 1TL5A 5E3PA 2BUNA 3LAMA 4OZ1A 1FKOB 3TNVA 4NXMF 4JV5F 4CO3A 2EFOA 3MM9A 2IAJB 3QO9A 4CO2A 4ECZA 1MN9A 4PG7A 1FCAA 2HG4A 2IDLA 1XWLA 5DZ6A 2QIFA 4ZS6A 4DFKA 5B7WA 4B3MF 4N76A 1RWXB 4DDFA 4FS2A 2VG5B 5D77A 3WX4A 4Y2MA 2DPIA 3EYZA 3FBEA 3CC2S 4CT9A 2OD4A 1JLEB 4ECXA 3OL9A 1UEKA 1MWZA 2V8GA 4KRWA 3CNQP 3A1YG 4GKJJ 1WI8A 2UXBF 4AXIA 2FPHX 1XTZA 3FZBA 1C1CB 2EKYA 4DV0F 4DQSA 3QLHB 4MK7A 3RW7A 1JLCB 2B4OA 3CUNA 4KO0B 2F8EX 5K14A 5CQGA 2V8DA 2DCLA 2M52A 4J9SA 1KHVA 2BJ9A 4NI2A 2R2TA 2CZ4A 4DR3F 3TVYA 3KWMA 4BBYA 5B0EA 1JX4A 3BJYA 3QSYB 4ZP9A 5LJ3Y 4OQJA 1FE0A 2DB1A 2MQQA 4N5SA 1FX2A 5AT1B 2NS1B 1C0UA 2QC3A 4TU7A 3OT9A 2YX1A 4LIWA 5EX3A 2BOAA 5C5JA 4K4UA 4DSKA 4PXBA 4B3MJ 4ES2A 4ZVGA 3TA1A 1F5AA 1OQ6A 4J9PA 4OV6A 4K4ZA 4LREA 3UQSA 3J7YU 2CVIA 1FK9B 4M5LA 3A4TA 2BJ3A 4WTYA 5M2RA 3SCKE 3WQPA 4A8QA 4JI1J 1UA0A 4KYZA 3UO0A 2QA4G 1KVKA 4NLTA 5D78A 4NA2A 3TX8A 2DCUB 1EARA 1LW0A 1NK4A 3CCJS 3BO2A 1AT1B 1Q5YA 1IBLJ 4LFCF 3N5FA 4B3OB 3P3DA 2AIRB 3MMCA 3K5MA 2DGSA 2RJZA 2P8IA 4JBCA 3VCDA 4O4GB 2J0XA 3M1VB 2V67A 4AD6A 3RAMA 5HBMB 3CW2C 4S0MA 2XMVA 2FZKB 2E1PA 2HQCA 2FLNA 1CULA 1S4FA 5A8KA 3MM5B 2RDDA 1SIZA 1S9EB 2JRSA 3EUNA 2AJ0A 4J5OA 1TU0B 4K4VA 4I0WA 2ZOGA 1FJCA 3TUJC 2DISA 1LWCB 2GIRA 1T11A 2VL1A 4Y00A 2VF3A 4EFAC 2GHPA 2M0GB 2FHJA 2FLOA 2C3UA 3A8JA 3D5MA 4NPOA 4XK8C 4OX9J 2IJRA 4U7UK 2FVQA 2WONB 3JTNA 2DGXA 2JFDA 3ZTQA 4WFBQ 4CDIA 5DGAA 2PFFB 2O3DA 4ZLJA 3QJPA 3HDSA 2X1AA 4DU8A 3H5YA 2HVDA 4ECYA 4DFMA 1U0SA 3V6DA 4ZLNA 1U09A 5ETLA 4OI1A 4R0EA 4L3KA 2WRMA 1FKOA 2Z0GA 4RO0A 3MM9B 1RLCL 2IRYA 2HW3A 2Y9HA 2WSEC 1SJQA 1Y5NB 1H2VZ 2FC8A 3VF0B 4J9UE 4LSLB 4J90A 4I4BA 2XI3A 4NLRA 3BREA 3I5AA 1IR2A 2MJNA 3I87A 2ZITA 3W65A 3C46A 2ASLA 1XK8A 2W25A 5E3AA 5HVHA 4M94A 1U26A 2HZCA 1OY8A 1RA6A 1RK8A 3BF4A 3M6WA 3RG6A 1J5EJ 4URGA 2UXBJ 1R8AA 1B4SA 2E7WA 3RBZA 2ZM6F 5LMUJ 2VA2A 4G1IA 1YVFA 4I2QB 1C1CA 2C3OA 3GLJA 3MUMP 3L09A 3QLHA 1BQMB 1HNIB 4JV2A 2KT3A 2VB6A 1N5YB 4KO0A 4OYXA 2FLLA 2IRUA 1CJKA 4URQU 1XC9A 1VQLS 1RAAB 2ROEA 2CQGA 4K50A 2NQPA 1VI7A 3PZPA 3MEGA 1RWKB 2OPQB 3P8BB 4LF4F 3P45B 4KKOA 1ZBTA 4TY8B 5JJBA 1SH0A 1HPZB 1UVNA 4FPIA 1S0MA 1RTHA 1S1TB 1HHTP 3EVMA 1T3NA 3LALA 2VOOA 3U27A 1OS5A 4J7CA 1HNZJ 2B4PA 1CJTB 2HK2A 2KVIA 2ZH7A 1A6LA 2VQFF 3AT1B 3FEXB 2FVCA 1YJUA 5A8RA 5IQ6A 2KFNA 4KAIA 2WB1D 2HFUA 1RQ0A 5CD4A 3H59A 3FBFA 3O1LA 2GAGC 4NL5A 3T1YJ 4YY3F 5K8NA 1D3WA 3Q8UA 2XMUA 2ZNZA 1LW0B 5KFRA 1GTHA 1IBKJ 4YP3A 5H9FJ 4JYAF 1RT2B 2MB0B 3EVOA 4RW4B 2QSFA 4CZCA 4JI6F 4XO0A 4LVNP 4ZJOA 3G71S 1QSSA 2DVIA 3CJ8A 3GTYX 4LR7A 2DH9A 4WF9Q 1YJVA 1FRLA 5B0CA 1RAHB 3OUYB 1WHWA 1RHMB 2ACMA 2XWXA 5JXSA 5K8OA 3RRKA 4FBUA 4DN9A 4F50A 1TL7A 5KFYA 5LSOA 3HKWA 5AXLA 2VOPA 1DZ5A 1P6TA 2G1DA 3DNCA 2ASJA 1XNRF 3ENQA 4AFFA 1QAYA 1JLBB 4NLWA 2QA2A 4LBPA 4FF4A 4WZMA 4RW7B 2UUCF 3I96A 1M90T 1Q0NA 2CVEA 2M70A 2OUGA 2D69A 2G1HA 4LBIA 1IVZA 1RGVA 2JL9A 3DLJA 2XQCA 4J9NA 4LF9F 4GRSA 3W66A 3CC4S 1OSCA 3TJ9A 2J9DE 3TAMA 2CWKA 3ZZPA 2XC9A 5FIIA 3W8PA 2ASDA 1ZS6A 2XMWA 4RW9A 2UXDJ 5KAKA 3DYAB 3N9UC 4LF4J 3R5AA 9RUBA 2VG6A 4ECRA 2KT5A 2OHDA 4LRBA 1ELOA 2VFVA 4USVA 3J80Y 2UUTA 2YQ0A 1VC5A 3TJAA 2HPUA 2FTRA 2AU0A 4ED8A 3FNNA 4DV7F 1R0BG 1SKUB 4HHJA 1NPPA 4P72A 3T19A 2LDYA 3WX8A 4WFNQ 5KG7A 2AYGA 3CMQA 4RW8B 2UZAA 5FDLA 4OYZA 3PVXA 2HHUA 4NOHA 3J81U 3TUPA 2FYXA 2VBZA 2ZUAA 3UN5A 3BGFA 3K5PA 3PW2A 3MR3A 7AT1B 1WTBA 2AEJA 3WBZA 4HEA9 1CJKB 1X0PA 2MQPA 3MD1A 3WIUA 2J5AA 1NJYA 2YNIB 4X2BA 4NE9C 3H2VE 1NJXA 3UI3A 2W1BA 1AZSB 4QIVA 2Z2ZA 3UNYA 1U1RA 3GR1A 3LH2S 2R7OA 3GV5B 4KKOB 4TY8A 1L3UA 1E6VA 1U2CA 4YB1P 1T9TA 3LP2B 4WWSA 2XI2A 4UOCA 4XIUA 3MR5A 4NLUA 1RTHB 3OVAA 3V4IB 4ERDA 1KONA 3FGVA 2ZVSA 3I5CA 4NYZA 5DZ7A 3P5TL 3CJKB 1HWLA 4O0NA 2EK1A 1XNRJ 1VQ6S 3U1LA 2LQ8A 4DF8A 4MKBA 3AOBA 3M8ZA 5A8RB 3ZFVA 2C28A 2HBRB 1UETA 2JC1A 4ZPVR 3JTOA 3H40A 3SCLE 1RAEB 2LVWA 1Q16B 3LP0A 3QGIA 4TU8A 1U2FA 2KH9A 2LU1A 4DUYJ 1V5VA 4CLUA 2CIMA 3ILIA 4RW6A 3DHXA 2OPPB 2WZ1A 2E1MC 2JDJA 3MEEB 4OI6A 2ZOMA 3RYLA 5IWAJ 2W7OA 2MZJA 3TAPA 3VGUA 2Z2LA 2V2VA 2Y0BB 3MTKA 4NLPA 2WW8A 1RT6B 2PA8D 4F67A 4CO5A 2X1FA 3QRQA 4RW4A 3I82A 3Q24A 4J9OA 3R2CJ 2OAUA 1R8BA 1TL4A 1YRTA 2VC0A 4I7FB 2BJEA 1TFWA 5LMNF 2FC9A 3AQOA 2ZC4A 2FZGB 1YJRA 3LGNA 3TZZA 1TL7B 4YB7A 2CQBA 2ZVIA 2BDPA 2HYIB 2FVPA 3MM7B 3R27A 1RBLA 2CJKA 3M32B 3KTQA 3CWJA 3C14B 1PAEX 5SZTA 3MCSA 2MKYA 4RW7A 5AXKA 1LFPA 1PBAA 2RT3A 2B4VA 4X84A 4P2MA 2GV1A 5M2UA 2I2YA 4MJKA 2OO4A 2YKNA 2ATLA 3QRPA 4PKDB 2BE2A 2Y3YA 5DS7A 3HPOA 1VBXA 2HVHA 1JWWA 4DV4J 1R27B 4PQUB 2BZ2A 2MZ1A 4F0HA 4P52A 2FZCB 3OW2R 3IAS9 3DYAA 1CQNA 2IA6A 2HHXA 4DL0C 3KJNB 2C42A 2W9BB 4AXJA 2EK6A 2D3UA 2M88A 2HRUA 4B9NA 2PN6A 3GYNA 3ZTRA 4K7QA 4NMLA 3H5SA 5IC4B 5AXMA 3W9JA 2NCKL 3BZQA 5A8WA 5EWFA 2VICA 1U1LA 1QDUB 1VQ5S 3RBDA 2FHOB 3N4WA 4C8MA 1JNZB 4DEZA 3BPDA 3Q0AA 2CG8A 4F0KA 2QLXA 1UWBA 1UJ6A 3HFZB 4KY3A 2ZOFA 2BJDA 1HHQA 3OPKA 2XEXA 2HK3A 1T3OA 2J8AA 1A7GE 1OIAA 4W92B 4BCAA 3Q83A 2DHHA 3M30A 3Q86A 2F1FA 3QJJA 3FSXA 2QTWA 4ZPTR 3KMSA 1HLWA 3KUEA 4K4SA 1R8CA 3HFKA 2IJNA 3GV8B 3R5DA 2GX8A 2VPYB 2F9JA 5BR8F 1WNEA 1EJ7L 1FFWB 3DRSB 2IDEA 3SXLA 2DNRA 5BR8J 5JVGQ 3GONA 1W25A 1FF2A 4GO5X 5KFGA 3ULHA 3VVUA 3CCES 1NH7A 2BQUA 1HKAA 5FJ4A 1VRUA 2V69A 4WFXA 4JI5J 1RISA 1X5TA 1LWFB 3I4PA 4OMFG 1PJ6A 4MKVA 1H7XA 2GIFA 4Z7CA 2F4VF 2CQ3A 4NCAA 2NR0A 5IV3A 1WC0A 3UE2A 1T9VA 4OZNA 1PYOB 5GMKa 1VISA 2MTLA 4J37A 4RBUA 3JAMU 2DHSA 2WOMA 1T05B 2H3EB 4B9SA 4HACA 3BKUA 3MCNA 4D3HA 5F8GA 1EQ0A 2MKCA 4LJMA 3VHQA 4LSNB 2VASA 1OQ3A 4USIA 4WK3A 3M8RA 1N6QB 1VQNS 1SXLA 4NLVA 5DM6Q 1Y10A 1N56A 3IS9A 1TZ0A 2RQKA 1YBTA 3I0SA 3KLIB 3CC7S 1B99A 4L72B 5CABA 2OFGX 3NOCA 1BQNB 4HI1A 4WBFA 3SEOA 3TQEA 1EAYC 2ZHBA 4ZVPB 2HRYA 3T5JA 4O4GA 3FZ2A 4GKJF 3DLKB 1ITPA 5ETRA 5J2NA 1QE1B 1U6BA 4LMZA 2MSSA 3HHEA 4H54A 1S9EA 3NBPA 4TLQA 2L41A 1DBDA 1LXNA 1S79A 1SC4B 1VQ8S 3SSSA 4OYAA 5L9XA 2UU9J 4WPAA 1HWJA 2UXCF 1S7IA 2DNQA 4R5PB 5KG1A 2J9EA 4A8MP 2KG1A 2LCWA 1RAJA 1A0OB 1VQSA 1N32F 2WONA 3IC1A 3PDNA 2D41A 1CS4A 2NSCA 1RWPB 3DM2A 3IFEA 3LQVA 5B0BA 2AYEA 4M5HA 4C6AA 3E2EA 4GKKJ 4CLSA 1R6YA 1SPBP 1HI1A 2I5JB 2HVZA 4DX6A 3NMAA 1X4BA 5KFNA 2VDHA 3S7RA 3HHLA 4AL7A 3EE3A 4F4AA 2BW2A 1JKHA 5A8WB 1RI7A 3FK4A 1LKZA 4EWTA 3F56A 4U9RA 3OHBA 1CBKA 2RQCA 3I6PA 3NGUA 2J8SA 5AXNA 2ZH6A 3GFYA 5KFTA 1U0HA 5T7LA 2J7WA 2KO1A 1HBUA 2H4WB 3NGKA 4DG1A 1MMNA 1JJHA 4MIAA 4ED6A 3BGOP 4ILLA 1WEYA 2GQQA 4CLLA 3GIJA 2DY9A 3A12A 4R25A 1UVLA 3SBMA 4U67Q 2AV5A 3GSDA 5J2MB 3UD4P 1S6UA 5I3UB 3DLBA 2PEHA 1FEHA 1KDNA 2IMWP 1S1UA 2VBYA 2H65B 1HNXJ 4B17A 1DLOA 4HH1A 2IBOA 3KG4A 3ONQA 3PX6A 1RT3A 3VR1A 4ALZA 3OTOJ 4DUZJ 1TKZA 2OH2A 5LOQA 1I51B 3OV7A 5J1NA 5RUBA 1RT1A 2Y1JA 3GZ7A 4LF9J 1N33F 2CRLA 4GVBB 3GILA 1VR6A 1CJTA 2HHTA 4ZVQB 1KKHA 2QZ8A 5DG9A 3DHWC 3DOMB 1AUDA 3M8YA 5D0RA 2XCAA 5F0UA 3MXHP 3K58A 4QWAA 5CZVA 4PG8A 3MAAA 3GSIA 1Q5VA 2BANA 4KV8A 1YZ7A 2Q6CA 4HACB 3D0GE 3D4JA 3KJVB 1AFIA 3GJQB 3R7BB 3TARA 1LWEA 1S72S 3R6GB 3AD9C 3IR7B 2CJQA 5GAGI 5HI7A 2GJ2A 4MYUA 2XTJP 4DU7A 4Y2CA 2LMIA 3KLIA 3A3NB 1UJ4A 3BEGB 2WVEA 3D66A 2ACYA 1HBNB 3MR2A 5U47A 2GVDA 1WACA 3BDEA 4MKYA 3QPIA 4FP9A 3E3XA 2W4CA 4NLXA 5LMUF 3A13A 2WTFA 2YVSA 3OL6A 2BVZA 2VUGA 5J2NB 1MROB 3KLVA 1RBAA 2R2SA 2ABYA 4DR2J 3ELHA 2JOQA 4IH7A 2MPUA 2FDNA 1U24A 2F7VA 2GO8A 1AUSL 4RBTA 4ZDNA 4X66J 3J7A1 4YB5A 4F3QA 2W2MP 5F8IA 2ALZA 3P49B 1NKEA 1JLQB 1IXKA 4K5RA 4KFBB 4O3QA 1SJFA 1L3TA 1EQMA 4DPYA 2RSQA 3EVWA 4OZ0A 3C2PA 1YK9A 2HNYB 4HDGA 2QMUB 4MMOA 4IDKA 1N36J 3LAKA 3W2WA 4ZVUB 1T03B 3UDEA 3AA8A 4LIRA 4WIQA 2M4MA 4KPCA 2K1RB 3T1AA 1DTTA 3IXQA 2XMKA 3BBCA 3D1HA 3NWRA 5F8LA 1IBMJ 2VFSA 3HHLB 2D74B 4PXDA 4XDDA 1O51A 4I1TA 5GAHU 1PC5A 3M9OB 1JLGB 1MNEA 1OMSA 2FJEB 2JLFA 3U02A 2AGPA 5EN1A 2GMHA 2KDOA 4DLEA 4RW8A 1IM6A 5FDLB 3LWLA 2VBXA 1H98A 3JQJA 1O6XA 4UUXA 3NGRA 4YDDB 2RDJA 2A1BA 4ILRA 4DG1B 4YS2A 1U49A 2W2OP 2GGPA 2BACA 1I6JA 2JVRA 1X7VA 4LRFA 2AGOA 4FBTA 3QAEA 1WOOA 5DDRC 1EKSA 3M9NB 1UA1A 3QGPA 3CGIA 4C3MA 1NK6A 1WF1A 3NAHA 2LEBA 1CLFA 4QIWD 2V4JA 3UNGC 4WP8A 3GCXP 5F8MA 4G1QA 3N01A 1M5SA 1ZAWA 3PYFA 1VJWA 2XO7A 4WP3A 3JSYA 4F3MA 1P27B 2QFIA 5K20B 2CNLB 1FVSA 3GWCA 1TMJA 4MFBB 4Y34A 2BBEA 1A9NB 2XZDB 2MLXA 1C0UB 2J7UA 3EDRB 3VQSA 1R0AB 5DGBA 3W7BA 2J6TA 1O0PA 2IC3A 1UW9A 3BYRA 4F25A 5CAAA 4WKRA 2BKOA 2Z57B 1M1HA 4UY85 4IOBA 2IVFB 4QJVA 4ZLLA 2DNPA 4FVCA 1UCNA 2LA6A 3IBFB 4NLYA 1YBUA 2DTJA 3NMRA 4OI4A 4UTGA 2DGOA 2NXEA 4DLGA 1KLMA 4LFAJ 1YKWA 1LWEB 3LW5C 3G4SS 5L1LA 4HL9A 1Y11A 3MEEA 3QQCD 1IWGA 3T1YF 3KLFA 4DQIA 3GIRA 5LSLA 4U8YA 4LFCJ 3NS7B 4IFVA 5F3TA 1S97A 3ZTOA 4HR2A 1VC0A 4DV3F 3EJMA 4P7TA 3QZ8A 1HBNA 4NASA 2R7QA 2XS5A 3M6UA 1X4CA 4KTQA 4OZLA 3PXGa 1WF0A 1HFEL 2VH7A 1NBEB 1SCJB 2QN6B 2V68A 3LP1A 3ZZRA 2M8DB 2XSFA 3C16A 3MPUB 3FVYA 4Z2XA 1BC6A 4ZMMA 3A3OB 2FHJD 4DR1J 2CDQA 5IXUA 1PILA 1NO8A 1LWCA 1RT7A 2CG4A 3IR6B 2E5IA 3JQKA 3R5CA 3UW1A 2HFNA 3MPWA 1JLQA 3CO9A 4USMA 2R8KA 1OPIA 1WTFA 2IRXA 1R7IA 2EW9A 2HGMA 2FGCA 2MKJA 2Z4PA 4UOFA 5ITHA 1QVGR 3HHNB 1UWAA 3SV4A 5KFSA 2OIHA 1VIOA 1J27A 1CC7A 1EP4B 1N5SA 1PYSB 3LGMA 2H51B 3W9HA 4PWDB 4RNNA 5GADU 4PG4A 1KR4A 1S59A 3DDIA 5KFWA 2GIQA 2QMXA 4QWCA 1JJ4A 4TN2A 3HP6A 4GMKA 2W9BA 4ZPBA 3A8KA 1Q53A 1YGYA 1RUSA 1WD6A 5HK4A 2ZFHA 4LSLA 2HGLA 5J2PA 2N3LA 4EMDA
chains in the Genus database with same CATH topology
3KXDA 4J7CA 2BKOA 4GVLA 3RBXA 4EI2A 4YS2A 3RBZA 1VCTA 4L73A 2AEFA 1LNQA 2BKNA 2BKPA 3L4BC 4L75A 2AEJA 2FY8A 4J91A 4L74A 3JXOA 4G65A 4RO0A 4J9VA 4XTTA 4L76A 4J9UE 2AEMA 4J90A 2OGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXD A;  4J7C A;  2BKO A;  4GVL A;  3RBX A;  4EI2 A;  4YS2 A;  3RBZ A;  1VCT A;  4L73 A;  2AEF A;  1LNQ A;  2BKN A;  2BKP A;  3L4B C;  4L75 A;  2AEJ A;  2FY8 A;  4J91 A;  4L74 A;  3JXO A;  4G65 A;  4RO0 A;  4J9V A;  4XTT A;  4L76 A;  4J9U E;  2AEM A;  4J90 A;  2OGU A; 
#chains in the Genus database with same CATH topology
 4QU7 A;  2YKQ A;  4QZV B;  3A3P B;  2E5L J;  5B09 A;  4CLK A;  4LF6 F;  4Y28 C;  4C3L A;  2X7I A;  1N4L A;  4ZA1 A;  1GMV A;  3CE8 A;  5BXI A;  2POK A;  2QLB B;  4NEY A;  1FRJ A;  1S7H A;  3GFX A;  3M30 B;  1BQM A;  1FVQ A;  1JQG A;  2ZBP A;  1IJE B;  1PYT A;  3EGV A;  4X4R A;  2B7B B;  3T6B A;  5C2C A;  4F4X A;  2CQP A;  1CG2 A;  4JV0 A;  2ADB A;  1KWM A;  4MK8 A;  4X4O A;  3TA0 A;  2V2Q A;  3DDK A;  3M9M B;  3DN9 A;  1FRM A;  4DR4 F;  2QG9 B;  2B9X A;  1S10 A;  4RNM A;  2HHH F;  4NLO A;  4FKY A;  5IM0 A;  4XTT A;  2OTJ S;  3OFE A;  1SV5 B;  2Y1L B;  2B8P A;  3AOD A;  1H38 A;  2HHP A;  2D3O 1;  1RA7 A;  1S1W A;  2AGQ A;  3JB9 k;  1T0T V;  2LXI A;  3DKD A;  4QYZ J;  3FKB A;  1NND A;  1QUV A;  3NCR A;  2E5G A;  4RR5 A;  1OJ4 A;  2AZ1 A;  1HA1 A;  2DR9 A;  3MF5 A;  4JI7 J;  1FFS B;  2C3P A;  3OJS A;  3CIZ A;  5DDP C;  2RH3 A;  3KK1 A;  1YTY A;  3BGL A;  1H0H B;  2V8H A;  2B0G A;  3M8S A;  2Q1L A;  1ACM B;  3IS9 B;  2EC0 A;  1VOM A;  4ECT A;  3C15 A;  1RT2 A;  4ID8 A;  2HIY A;  1DQ8 A;  1NHK L;  3QYY A;  3KG1 A;  3B78 A;  4IR1 A;  2BE7 D;  3KJQ B;  2MZT A;  1J2V A;  1G1X A;  5L8R C;  3SCI E;  2RDI A;  2XUL A;  2KG0 A;  4B3S F;  4FYV B;  4CYU A;  1N34 J;  2X1G A;  3HVR A;  5D3G B;  1YDL A;  4JP8 A;  3LP1 B;  1M5P C;  3K5N A;  5EWG A;  1YJ9 S;  1FJE B;  1TTH B;  3HX9 A;  3HVW A;  3TR5 A;  1HYS B;  2UUW A;  1B0V A;  4P2X A;  4NRT A;  1F0X A;  1CC8 A;  2J7K A;  3KUH A;  3AJD A;  3UN3 A;  4KGZ B;  3ZNJ 1;  2MDA A;  5KFP A;  4YQW A;  3J81 Y;  4DBQ A;  1RT7 B;  3JYT A;  2KRB A;  5G0R A;  4CWB A;  2CZ9 A;  1JNR B;  5J2Q A;  1U4B A;  5C42 A;  1S77 D;  3L95 X;  3IN5 A;  2CKW A;  4FF3 A;  2K7K A;  3R8Y A;  1LV5 A;  4IG0 A;  4DSJ A;  4WKY A;  5CD4 H;  1S57 A;  2JC0 A;  4DFP A;  1NJZ A;  4KPY A;  5LM7 E;  3TAM B;  2CQC A;  3Q8Q B;  4DR5 J;  1DRZ A;  2HS3 A;  4KQZ A;  3VGV A;  1WEL A;  4J91 A;  4O3R A;  3CD6 S;  1GXT A;  1Y3K A;  3C66 A;  1UJ5 A;  5DRK A;  3T3F A;  2XM3 A;  3OVS A;  2O1P A;  1X9M A;  3K8W A;  4XAK A;  3IRW P;  3DFE A;  3HLU A;  4X4Q A;  1XR7 A;  1Z2L A;  2YBV A;  3AXK A;  4WU2 A;  3G8S A;  4K4T A;  4MKA A;  2CDR B;  2PMZ D;  3KLH A;  1YBA A;  3F41 A;  2Z8Q A;  3Q8R B;  4ZPC A;  2O67 A;  1WC1 A;  5F8N A;  4OX8 A;  3PHE A;  4OZ5 A;  4CM2 A;  4FXW A;  2HRT A;  3G82 B;  4UQT A;  5KFO A;  2R7W A;  4LSZ B;  5E0O A;  5ETO A;  3PIO Q;  2HHV A;  4UZB A;  4N41 A;  2GCF A;  3W5Y A;  5J2M A;  3AY0 A;  4RWW A;  4DMZ A;  1R8P A;  3CCQ S;  4DPW A;  1DHM A;  1RHK B;  2F8H A;  5E41 A;  2R4F A;  2QL5 B;  2UV8 A;  2P9G A;  2R42 A;  4IO1 A;  3US5 A;  5I4M A;  3FUY A;  1E6V B;  4OZ2 A;  1M5K C;  3Q2T C;  4ATN A;  1RT3 B;  2ILZ A;  4K0K F;  4L76 A;  3GFH A;  2HIQ A;  1I94 F;  1SQE A;  4O44 A;  5IM0 B;  4UZC A;  1SV5 A;  2XMA A;  2EI5 A;  2OEL A;  1UVI A;  2V34 A;  2GQC A;  2C2R A;  1HI8 A;  1NM2 A;  5DQH A;  3OL8 A;  3HCX A;  3EPG A;  2QA4 S;  1T94 A;  2QA1 A;  4M5I A;  2M7S A;  5GVQ A;  2W7A A;  2VQE J;  1Q81 T;  1RWW B;  5ETM A;  1RTD A;  5E3C A;  4PG5 A;  4DUY F;  3L4B C;  3F44 A;  4J9M A;  1B7F A;  1U8S A;  2CPH A;  3CDW A;  1WWH A;  2ZE2 A;  3M4X A;  4P10 A;  4DPT A;  3F73 A;  1U1Q A;  2ZHA A;  5E2Q A;  1GFW B;  4LVO P;  3ZZ0 A;  2DEJ A;  1X4F A;  5KFD A;  1N32 J;  4TXS A;  1RT6 A;  2MZQ A;  4Y65 A;  3TZY A;  4N8N A;  2I9S A;  5IOL A;  2YKO A;  4JOU A;  2E9R X;  3H98 A;  2GVD B;  3I0R A;  1VLY A;  2QRR A;  4YHH J;  2W01 A;  4R8U A;  3K5L A;  4OYM A;  2MJU A;  4XPE A;  1CSJ A;  3HM9 A;  2CQ4 A;  3MM7 A;  4ANC A;  4RU9 A;  1GMW A;  3FSI A;  2HFV A;  2RIL A;  2DGT A;  3DLG B;  4ETZ A;  4QWB A;  1R6V A;  2JLE A;  2QT7 A;  1RAF B;  3ENA A;  2AX0 A;  5C24 B;  3GMG A;  3UN2 A;  1RT4 B;  1AYE A;  3VZI A;  5CYJ A;  4B9V A;  2DIV A;  4DSI A;  4UW2 A;  2BKN A;  3M2U B;  1IN0 A;  1NDC A;  3AAW B;  2O5D A;  2CPE A;  5J1P A;  3ITH B;  2HNY A;  2JNJ A;  3H42 A;  2VHG A;  4PUO B;  1FXL A;  1M5H A;  3MDF A;  2WBM A;  2H1Y A;  3R1L A;  4A48 A;  4K4X A;  4LF1 A;  1DTQ A;  2B7C B;  2YH1 A;  4I6A A;  1IBC B;  5HVG A;  3TJ8 A;  1SL0 A;  3MUR P;  2FY1 A;  1NME B;  3OTC A;  1H6K X;  3GB0 A;  1YG0 A;  2GW8 A;  4HHH A;  2OGU A;  3AA9 A;  4OHY A;  2GO9 A;  3HJF A;  1JLG A;  4A8Y A;  5HL7 Q;  3TAN A;  2VPW B;  3PV8 A;  2F5G A;  5KG0 A;  5IC6 B;  3BN7 A;  1ZM2 A;  2L48 A;  2XHW A;  1HMV A;  3B82 A;  5HQ8 A;  1APS A;  4I2Q A;  3MWB A;  4IRC A;  2VJU A;  2RUG A;  2D7S A;  2MHE A;  4AND A;  1NDL A;  4KR0 B;  3QAU A;  4CO4 A;  2WK4 A;  3EMT A;  4DV6 F;  3M8P B;  4J9L A;  1U2R A;  3VGS A;  4NLG A;  1MW7 A;  3AQP A;  4CH0 S;  1NSP A;  4JI2 J;  1G6B A;  2K2P A;  3CJ4 A;  2EFV A;  2EVZ A;  1VQY A;  4DR1 F;  2GJI A;  3EXY A;  2R7R A;  4LF2 A;  5D4O A;  5IFM A;  2KRR A;  1W2B R;  2ADC A;  1R0A A;  1VC6 A;  2YX7 A;  4DFJ A;  3NOG A;  3UCU P;  4OI3 A;  3G96 A;  4RKU C;  2BV3 A;  4PR6 A;  2IC3 B;  3KXD A;  2GHW A;  2PD1 A;  4DR6 J;  2XY7 A;  4LUB A;  1UZH A;  2XY6 A;  3EIC A;  1C0T A;  4P75 A;  3BPS P;  5FD1 A;  4F4Y A;  2WOM B;  1T05 A;  1F9H A;  1HBO B;  1EHW A;  2DHX A;  2X3D A;  2V50 A;  3B54 A;  3MPD A;  3OFF A;  3R5J B;  4M1K A;  1ICE B;  2V8P A;  5IT4 A;  2ZH1 A;  4DV1 J;  1KLM B;  1JXE A;  1LWX A;  2XMT A;  1JB0 C;  3TA2 A;  4LSN A;  1RP5 A;  3C6T B;  2ZE2 B;  4CQ1 A;  3Q23 A;  2E5H A;  3W3S A;  1NPR A;  1R31 A;  5G4D A;  4IFV B;  4PEO A;  6FDR A;  4KHP J;  2ZH5 A;  1NB2 A;  2XG8 A;  1BQN A;  3TRG A;  5KG2 A;  4JV5 J;  4KHP F;  1L3K A;  4ZVR B;  3RTV A;  3R5G A;  4R8U B;  1URR A;  1RU1 A;  1MN7 A;  4OJH A;  5GAE I;  2GAH C;  4P73 A;  4EO8 A;  2PA3 A;  1QE1 A;  2RS2 A;  4Q0B B;  4MT1 A;  3NBP B;  3TI0 A;  4AE5 A;  4ETX A;  4F7V A;  2IJF A;  3DLG A;  4X65 J;  3ENW A;  4HI2 A;  3EZ5 A;  1VQ9 S;  1D9F A;  3R3T A;  4R5P A;  2X1B A;  3ET6 B;  5IZH A;  4DX5 A;  2KM8 C;  4TNO A;  5HAO A;  4YN3 B;  4EBE A;  4C8O A;  4P2F A;  4RNO A;  2V4Q A;  2WB4 A;  3DGP A;  2M8H A;  3IGV A;  1DTQ B;  3CJR A;  3M8Q B;  3UCG A;  3Q22 A;  4IUF A;  1SBR A;  1VK8 A;  2J0W A;  2YWE A;  3EXC X;  1U7L A;  3THV A;  3OVB A;  5JUM A;  2RD5 C;  3HVT B;  3RBE A;  2UUB J;  3ENV A;  5LL6 d;  5KFK A;  1PSD A;  2IVM A;  3BSO A;  4EUV A;  3W8G A;  1L5U A;  4KJI A;  2H5J B;  2X3G A;  1I1G A;  1WI6 A;  2YTC A;  5ETQ A;  1U1M A;  3PR4 A;  4F4W A;  4NZ0 A;  2FJB B;  4W90 B;  3ILJ A;  1U0H B;  3W5Z A;  2AMC B;  2I8E A;  2IHR 1;  1HIY A;  2RKI A;  4YME A;  4DL3 A;  1V3R A;  3H0P A;  3T41 A;  4NCG A;  2L9D A;  3BDP A;  2FHM A;  3NS6 A;  3NGT A;  3TX0 A;  2JJ4 D;  5ETK A;  5A2Q Y;  4C8Y A;  4L6V 3;  1SKW A;  2ATC B;  3OTB A;  4JI0 F;  3P4U B;  3ZC4 A;  3MM8 A;  4ZVT B;  2FD2 A;  2EBG A;  2L9W A;  2P6T A;  1BWE A;  3BM7 A;  5D0H A;  5KFZ A;  1XNQ F;  1S1U B;  3PG9 A;  1AZS A;  1N88 A;  5T41 A;  4L74 A;  4CO0 A;  4AL6 A;  4DX8 H;  1DLO B;  4IQM A;  1XMO F;  2ZH4 A;  3SFG A;  1TKZ B;  3FDS A;  1NK8 A;  2OMO A;  4EZ9 A;  1FJ7 A;  4QR2 A;  3PJX A;  1HWU A;  1FDB A;  1RWV B;  3LUY A;  3M6V A;  1X60 A;  2MMY A;  4ZJQ A;  1S1W B;  1X5S A;  4KE5 A;  5H9F K;  2B5J A;  1Y5L B;  3PR5 B;  3SQO P;  1KOO A;  3S1T A;  2KXH A;  2BAN B;  5C7P A;  3FCW A;  4DL2 A;  4ES3 A;  3CD5 A;  1S0V A;  3UWT A;  3OXL A;  1FNX H;  3WIV A;  3G9C A;  3W62 A;  4U7U D;  1X5P A;  3C6T A;  1VRT A;  2HSE B;  1QTM A;  3CDE A;  4UF4 A;  4ZVF A;  1RBO B;  3I9V 9;  3O6Q A;  1NJW A;  2GJF A;  1ZYQ A;  1WDD A;  3PIP Q;  3PKY A;  1S5Z A;  2VC1 A;  2CQ1 A;  2ZBR A;  4OHW A;  1H72 C;  2HND A;  2W2Q P;  1Y00 A;  2VV5 A;  2JZ5 A;  3L7P A;  1GK8 A;  3OSN A;  3CUL A;  2RE1 A;  2DRA A;  2ZUG A;  3CTR A;  2AQ4 A;  3M2V A;  3BGR B;  1R8H A;  1UFW A;  4N47 A;  3MUV P;  1NK9 A;  1HYS A;  3KNG A;  3VAM A;  1ZPW X;  3G6V A;  2VG7 B;  3M32 A;  1MMD A;  2EKN A;  4B02 A;  3L7U A;  1MWQ A;  3DMJ A;  4ZHR B;  2BE9 B;  1FKA F;  1U6F A;  3OR1 A;  1HD1 A;  4NLD A;  4LFB F;  3CED A;  4KFB A;  4CCH A;  1WC5 A;  2A18 A;  3GG0 A;  1LOU A;  4ED0 A;  2E1C A;  5HVF A;  2J9D A;  1VS3 A;  1TUW A;  3R1H A;  3D6T B;  3QFH A;  4IDK B;  5KFA A;  3SI8 A;  1T03 A;  5BYR A;  1M0S A;  5D4P A;  2CXE A;  5EWE A;  4WCE Q;  1WHY A;  3TOQ A;  4BWM A;  5DDO C;  3BSN A;  5L1J A;  4B9U A;  4IQX A;  3IMQ J;  3LGH A;  4NLQ A;  2UXD F;  3EDQ B;  4K4Y A;  1NK5 A;  1QUP A;  3CCT A;  2DEI A;  4ANE A;  2V9K A;  4NRU A;  5HRO A;  1YI2 S;  1RTZ A;  3RR8 A;  4FDF A;  1V6H A;  4FYY B;  2CQD A;  2ZD1 B;  3KLH B;  3W5X A;  2VQF J;  3RB4 A;  3KUG A;  4M63 A;  3PYD A;  3MR7 A;  2AKW B;  2DR7 A;  4KGX B;  4WFZ A;  3RB0 A;  1F9F A;  4B3T J;  2A2C A;  2C2N A;  2HFZ A;  1RLD A;  2AYM A;  2CQ0 A;  2GVZ A;  3G82 A;  2ASY A;  4L73 A;  1KQK A;  5KG6 A;  3CCL S;  2W9A A;  3CO0 P;  1RDR A;  3D3C J;  2XYP B;  3K5O A;  3MM8 B;  2B51 A;  4Q5V A;  5A6P A;  2B9E A;  2O01 C;  4FF1 A;  2ZJP Q;  3TO8 A;  3NY0 A;  1VQM S;  1Q7Y T;  2H5E A;  2ZZT A;  4P2S A;  3VAK A;  2E7V A;  3W2V B;  1XR6 A;  1KD1 T;  4JI6 J;  3QMQ A;  3W64 A;  4C98 A;  3TQ1 A;  3BS9 A;  1PKU A;  3FC9 A;  4Q7A A;  5DG8 A;  2PFD A;  1HI0 P;  4N8O A;  1F9E B;  2KXF A;  1TKT B;  3NP5 A;  3LOU A;  2DK2 A;  1LWF A;  3OTE A;  2C22 A;  2KXN B;  3BBB A;  3CB4 A;  3Q8V A;  1FRI A;  4KGV B;  1JXL A;  1UPP A;  2AWZ A;  1IR0 A;  5KTQ A;  2YQ1 A;  5HJY A;  2IVY A;  2KN4 A;  2B5J B;  1UVK A;  5KFE A;  2AJ1 A;  4CLT A;  5DDQ C;  1O5J A;  7FDR A;  4C7Q A;  1KNZ A;  1FNO A;  3A8I A;  4QIG A;  4M8L A;  2ZBQ A;  2C1E B;  2NLW A;  2HEK A;  2K7J A;  4IH6 A;  3CD0 A;  1RSC A;  3MD3 A;  4I64 A;  2F65 A;  2DGW A;  1EKR A;  3KLF B;  4ER8 A;  1SQG A;  4ECU A;  1JLA A;  1RYR A;  2CUY A;  1QD1 A;  5CHC B;  4J9Q A;  2ZH2 A;  2AEM A;  2XCP A;  2PT0 A;  3IBW A;  5M2P A;  2MKK A;  3IO1 A;  5CCL A;  3MGJ A;  3NWG A;  4JI4 J;  1RJJ A;  2JX2 A;  2VG7 A;  3QNW B;  4WYW A;  4AQY J;  3IA0 A;  3R2D J;  4DCJ B;  4I2P A;  4KGM A;  3I55 S;  1TEL A;  4IH5 A;  3AFG A;  3MMA A;  3DOL A;  4I68 A;  4NYO A;  4WK1 A;  1W26 A;  1TVR A;  4LF8 F;  4LFB J;  3GYX B;  2HVI A;  4Y0F A;  2P2C B;  1ZAX A;  1QTN B;  1TUV A;  5A76 A;  4X4P A;  4PUO A;  5L1I A;  4Q43 A;  1L3V A;  5AJ3 F;  3K57 A;  1F5B A;  4C11 B;  1WG5 A;  2VDI A;  2ZM6 J;  2ERR A;  3QZ7 A;  2CPI A;  4IKA A;  3BQ1 A;  2E1A A;  1CJU B;  1FT8 A;  2BW7 A;  2I5J A;  4ELU A;  4QU6 A;  2ZKU A;  3S01 A;  2HHW A;  2HQD A;  3MHY A;  4OYW A;  3R7S B;  1YHQ S;  1SL1 A;  4HDH A;  4DX7 A;  2PI4 A;  3QJL A;  2LXU A;  5HRO B;  2VFR A;  1N8R T;  2ZWP A;  3PCO B;  2MY7 A;  1RWN B;  2PE8 A;  2ZD1 A;  4ID5 A;  4U6P A;  2VZ9 A;  3OLA A;  1D9A A;  4OYB A;  3V5R A;  2V6A A;  2OPS A;  4EI2 A;  4RU2 A;  1AFJ A;  4OI0 A;  3FMW A;  1NZ8 A;  4NWB A;  2FGO A;  1S6Q A;  1HMV B;  1HQU B;  3OBI A;  4F0M A;  2W8K A;  2GVZ B;  1S76 D;  2CPZ A;  3R6L B;  5FLX Y;  5IT9 Y;  3IWL A;  3UD5 A;  5KT2 A;  1KP6 A;  4I6Y A;  2LXF A;  4PWW A;  2CPX A;  4TKT A;  5I3U A;  4EZ6 A;  5AJ3 J;  1TMM A;  2RHS B;  5KFL A;  1MG7 A;  2W7P A;  4O3O A;  2ROG A;  3UFC X;  3VAF A;  1TAU A;  4QW9 A;  3WDO A;  4LFA F;  2E9T A;  3H5U A;  1SH3 A;  4DPX A;  1HL6 A;  3ICL A;  3KG0 A;  1U1K A;  3HFV A;  2XSJ B;  3WZ0 A;  4DL6 A;  2BJ7 A;  4DR6 F;  3DRR A;  3MCO A;  4AYB D;  2LA4 A;  2FJW A;  3DOM A;  5D4L A;  5KG4 A;  2JLG A;  1VQO S;  2AJQ A;  3WC0 A;  2F4V J;  2W4P A;  4QQB A;  2N82 B;  3HO1 A;  3MAA B;  1LW2 B;  3IM8 A;  1FA0 A;  1N0U A;  1R3N A;  4KV8 B;  2PO4 A;  4H4O A;  3RGI A;  3FFI B;  1KEK A;  3TZX A;  2DHA A;  5I42 A;  2AP6 A;  2VU5 A;  5AE2 A;  2D9O A;  1VBZ A;  2J9C A;  2YNG A;  2L08 A;  4ZCK A;  4DV4 F;  3AJ1 A;  1N5Y A;  5E5N A;  2E9Z A;  1NUE A;  3C15 B;  3GU0 A;  1JLA B;  2VD3 A;  1KTQ A;  3BBF A;  3RU0 A;  3KLG B;  4K4W A;  2DNK A;  4U7C A;  1IJF B;  1IKW B;  4C4W A;  3GYG A;  5D3G A;  1VRQ C;  5LT5 A;  2G0C A;  1ZM3 A;  2CPY A;  2CAJ A;  4A8K A;  2CFX A;  5ETN A;  2VA3 A;  1MRO A;  4IO9 Q;  1QSL A;  2HHS A;  3E01 B;  4QOT A;  3ZZT A;  2GMJ A;  2RRN A;  2V4R A;  4IR9 A;  4TU9 A;  2R7U A;  2O66 A;  2NZ4 A;  2K3I A;  3NLC A;  2HNZ B;  2PMH A;  5G0R B;  4DV0 J;  2K3K A;  2OSR A;  1LNQ A;  5KFV A;  5C42 B;  4LF8 J;  1FD2 A;  1YLX A;  3ET6 A;  3FMB A;  2DO0 A;  4ICL B;  2OPR A;  4ZVO B;  4YR0 A;  4F02 A;  4X64 F;  3QAT A;  1TKX A;  4OL8 A;  2W2N P;  4MK9 A;  4MYT A;  2R3V A;  4X4U A;  2QLJ B;  5HSP A;  1IR1 A;  1MSW D;  1S12 A;  3DGP B;  4DOZ A;  1X5O A;  1DTT B;  2HMI B;  2E1R A;  1QY7 A;  3BGU A;  5EGY A;  3VAH A;  1CJU A;  1ZPV A;  4DL4 A;  4LRD A;  1VMB A;  4NXM J;  2H9Z A;  4N56 A;  2C2D A;  3V4I A;  2HBQ B;  2DGQ A;  1K44 A;  2FJV A;  5DG7 A;  2KJV A;  4U8V A;  4CLY A;  4ZIW A;  4RX6 A;  2IM0 A;  4OV1 A;  2MGZ B;  4ID5 B;  3B4D A;  4UQG A;  3HD2 A;  2B9Y A;  5A0Y B;  2XLI A;  3AHP A;  5KT7 A;  2OEM A;  3L9Z A;  3NNA A;  4M5M A;  1MU2 B;  2F9D A;  2HFS A;  2RKI B;  2F8M A;  2GGP B;  1NDK A;  1GNK A;  1P1T A;  3GE9 A;  3QWU A;  3BR9 A;  4OJ3 A;  4DPO A;  4DV1 F;  4NCG B;  2QGF B;  3NGS A;  5JVH Q;  2F63 A;  5E3R A;  1VBK A;  3H4D A;  1J5O A;  5KFH A;  1HNV A;  4MTP A;  3SCJ E;  2DRB A;  3KHG A;  1ZM9 A;  4ECV A;  4RUC A;  3PO4 A;  4OX6 A;  5HMY A;  3D6H B;  5F9N A;  3CME S;  4A4J A;  2DXD A;  3FQK A;  4QYR A;  1GEH A;  4C8Z A;  1WG4 A;  4ZPW R;  5CA5 A;  1WF2 A;  2DGV A;  3PHT A;  1DQ9 A;  3VVT A;  2HAF A;  2DNG A;  3IR5 B;  1RZM A;  3TWZ A;  3HHD A;  3EPI A;  5KT6 A;  1V9O A;  2DT9 A;  2A6M A;  2NPI A;  3PW7 A;  1TK0 A;  1V3S A;  4KHR A;  5IQQ A;  5DET A;  1ULR A;  4KH1 B;  4RZR A;  1N5Q A;  2GS8 A;  5LXY A;  5H9E J;  1K0T A;  4IFY B;  4USK A;  1Q1K A;  3G86 A;  4F26 A;  1RTI B;  2QMW A;  3H4B A;  3BSA A;  2IM1 A;  3EWG A;  4OX7 A;  1K73 T;  5IS2 A;  1TL3 B;  3FFI A;  1N36 F;  3FEY B;  2R8G A;  9ATC B;  2MQO A;  3MMB B;  3VQT A;  1VRT B;  2CWX A;  1FWK A;  2MEW A;  2WCX A;  2ZJQ Q;  3GII A;  2HFO A;  3K8V A;  4YFU A;  3QRR A;  1TFY A;  1HR0 F;  1FWP A;  2EG2 A;  1RWU A;  5H1S V;  2HND B;  5HAT A;  3OSP A;  2YKM B;  3GJS B;  5J1E B;  5HP1 B;  3I0R B;  3GIM A;  5KT5 A;  4LRC A;  3NG8 A;  2WVB A;  1FTC A;  5HMW A;  4ED2 A;  3HD1 A;  4LF7 J;  1RE1 B;  4RPF A;  3VZH A;  1Q8L A;  3IM9 A;  5MAO A;  1F2H A;  4P6Q A;  2OSQ A;  2VKR A;  3IWN C;  4V19 X;  1HBM A;  1BD6 A;  1HD0 A;  3QT5 A;  1B0T A;  2HQ3 A;  3N0V A;  6AT1 B;  3V81 A;  1C4C A;  2A6O A;  2CZV C;  1DFD A;  2A0F B;  2V94 A;  3R5B A;  5C24 A;  2N4C A;  1IKY A;  3CJ5 A;  3G6Y A;  3KHR A;  3RZA A;  1I94 J;  1BMQ B;  3DC2 A;  3J81 j;  4EO6 A;  2VKZ G;  4DCP B;  3MUT P;  5L9N A;  2BJ8 A;  3TW0 A;  3O2I A;  3QIP A;  3TP2 A;  4NCB A;  1XNQ J;  2C2Z B;  3HZE A;  5KG5 A;  4PWD A;  3H2L A;  4K2J A;  2NZC A;  4DQR A;  4G3I A;  4KIA A;  1HNX F;  1Q95 G;  1D9D A;  3LF0 A;  5DLF A;  4B9T A;  3N6N A;  4WXO A;  1NLK L;  1RKI A;  3NAI A;  3ZNU A;  2JFK A;  5HQL A;  3OTO F;  4DUZ F;  1S9G B;  3OXG A;  4ZN3 A;  4FXV A;  4ENO A;  5J2P B;  4M5D A;  1GAO A;  1HNZ F;  1HWI A;  3PAC A;  1M5O C;  1UP1 A;  5CYQ B;  2FJX A;  4ZIT A;  3NEK A;  2UXC J;  2V5H G;  1NXI A;  4Q8F A;  3NCP A;  3SQG B;  2UVU A;  4K8R A;  5L39 A;  1FER A;  4NXN J;  1WSV A;  5EX0 A;  1D8Y A;  2RVJ A;  3W61 A;  3EGW B;  5E3Q A;  2IIH A;  1J5O B;  4Z7Y A;  2R2U A;  1AA1 B;  1TQL A;  1RAG B;  5CYM A;  3DDN A;  5CH7 B;  1Q78 A;  2DNZ A;  2DKO B;  3UD3 P;  3W2V A;  1TL1 A;  4U96 A;  4LRA A;  4ZP6 A;  1K47 A;  3I9Z A;  3LTO A;  3J80 U;  3HSJ A;  3Q8S B;  4J9R A;  3TAQ A;  2B4U A;  3V6K A;  2KTQ A;  3UVJ B;  1JJC B;  3VAJ A;  1TKT A;  3FRY A;  4I56 A;  3CJ3 A;  1SQF A;  3C8Y A;  2AHO B;  1DY3 A;  3ZTP A;  4X4S A;  2HBY B;  3IP0 A;  2GML A;  3KKF A;  1NK0 A;  1U45 A;  5D4N A;  4F04 B;  2Y8Y A;  1C0T B;  3VTI A;  1SJ4 P;  2HZV A;  3MMJ A;  1TV6 B;  3ZZU A;  1SUQ B;  5D6G A;  5D0G A;  5DJB A;  3X3U A;  3RAX A;  4ECS A;  2ZC3 A;  3MED B;  3BV8 A;  3D0H E;  4MIW A;  3KK1 B;  3HXM A;  5E33 A;  2CPF A;  2IYG A;  2FHK A;  3MM6 A;  1EB0 A;  2HZA A;  2BXJ A;  2LFV A;  3PRB A;  2B3T B;  4PXC A;  3CJ2 A;  3X1L B;  4ES1 A;  5C25 A;  5DQI A;  1JMT A;  2Z30 B;  3TEH B;  1N5V A;  1VLO A;  2GNK A;  4ED4 A;  4DS4 A;  2NPF A;  3PM9 A;  3KMQ A;  4X4N A;  3AD7 C;  1P8G A;  2YKM A;  3P5B P;  4KSE B;  8ATC B;  5J1E A;  4DV3 J;  2BR0 A;  2Q43 A;  2RF2 A;  1RCO B;  1C1B B;  1RCX B;  2UUB F;  4OZJ A;  2IM3 A;  5DLG A;  1YJ7 A;  2KM8 B;  5HN0 A;  1XMQ J;  4WE1 B;  1S6P B;  1BHN A;  1UEV A;  3O3L A;  3RW6 A;  1AXQ A;  4X4V A;  4M5J A;  2E5L F;  3OQ2 A;  4Q0B A;  1T7P A;  2CPD A;  1HBM B;  2KFZ A;  1T9W A;  2OI2 A;  2ZNY A;  1HQE A;  1H7W A;  4OHV A;  5BYQ A;  4C8N A;  1VQ7 S;  2MY8 A;  3JSB A;  3JYT B;  3DOL B;  1SL2 A;  2U1A A;  1F2G A;  1GTE A;  2HS0 A;  3FJ2 A;  1TVR B;  4YDX A;  5J2Q B;  1TKD A;  3WC2 A;  2H5I B;  4ZPA A;  2E7X A;  4Y2K A;  2Z56 B;  4ZN1 A;  1VQK S;  4JI0 J;  1H74 A;  2N7C A;  2G0I A;  2XYG B;  3T1H J;  4PAB A;  2LDI A;  2PII A;  4C11 A;  2LEC A;  4RJV A;  2LU2 A;  1NRK A;  3M8Q A;  2N3O A;  4QWE A;  5KOW A;  1FWL A;  2UU9 F;  1CEZ A;  2VPX B;  3AOC A;  4E8U A;  2RRA A;  3D7S B;  2GHV C;  3SMZ A;  5KFU A;  1T8E A;  4BHQ A;  4CH7 A;  1DUR A;  4YR2 A;  4WP9 A;  3KJF B;  1M1G A;  2DNY A;  1BWV A;  4KH0 B;  3THP A;  1ZET A;  2DGU A;  3B8H A;  2OJ3 A;  3DXS X;  3FCH A;  3OD2 A;  5D0E A;  3PW5 A;  2KZZ A;  4ZPD A;  4CNY A;  1TAQ A;  1RU2 A;  2K06 A;  5B0D A;  3LAN A;  2MQL A;  2CPJ A;  4A47 A;  5IV4 A;  2J0S D;  4GO7 X;  3CT9 A;  4B08 A;  4XDC A;  2W9C B;  1XMB A;  1LFW A;  2Z2M A;  4F2R A;  1FES A;  4Y2I A;  1RAB B;  2R8I A;  4EYI B;  1TK5 A;  3TYT A;  2FY8 A;  4Z37 A;  3MEK A;  4ZVE A;  1F60 B;  1GH8 A;  5CYM B;  3K2Y A;  4QYZ K;  3ETO A;  3GR0 A;  2YNF B;  3NS5 A;  3PEJ A;  2BQR A;  3OFG A;  2G0J A;  3MEC A;  3KLE B;  1U25 A;  1D0E A;  1TL1 B;  2ZDP A;  1UPM B;  5K9F A;  3H25 A;  2XMJ A;  4JI1 F;  1B64 A;  2C3Y A;  3J7A N;  3GJR B;  2ZZM A;  2DJW A;  1RAI B;  1WUU A;  1HWK A;  2W2P P;  4NX9 A;  3QGG A;  4PQA A;  4O44 B;  1NSA A;  1FTR A;  1Y3J A;  4KB7 A;  1BXN A;  4ZIV A;  3IAM 9;  5L38 A;  3SYZ A;  1KN6 A;  1K8A T;  4HTJ A;  3EM1 A;  3QSI A;  3QT6 A;  4Y2A A;  4RUH A;  1F3F A;  1SUQ A;  4FVM A;  1PAU B;  4K0K J;  1IKX B;  4DZD A;  3B4M A;  4H4M B;  4H4O B;  4ZVH A;  5I42 B;  2SXL A;  1F6T A;  2YWG A;  1GX5 A;  3PKM A;  2W8L A;  4EYH B;  4ILM A;  6FD1 A;  2AJ4 A;  3SZ2 A;  2HGN A;  2F3J A;  4FXD A;  1T9Y A;  4F8R A;  2OLW A;  3TUI C;  2AYB A;  4X62 J;  2XZW A;  3W60 A;  1SKS A;  1X4D A;  2M9K A;  4O3N A;  3DU5 A;  1JJ2 R;  3C6U B;  2I38 A;  1WKL A;  2LYV A;  1C1B A;  2E44 A;  5ETV A;  1XR5 A;  4F36 A;  3LWM A;  1QAJ A;  2KT2 A;  3T5H A;  4DQP A;  3BGR A;  3MTJ A;  2V9W A;  4WE1 A;  2VOD A;  3QBC A;  3BKT A;  5LMN J;  2XNR A;  1Y9O A;  1MLA A;  1RWM B;  4GVL A;  4RBV A;  1FXR A;  3SDE A;  3OJU A;  4O3S A;  2XS2 A;  1ZTW A;  4L3N A;  2ROP A;  4Q45 A;  3IRX B;  3KYL A;  1RT4 A;  2XS7 A;  3OR1 B;  1R43 A;  1LK7 A;  3MPY A;  3M2U A;  4DV5 J;  4ICL A;  5I3Q A;  2KYZ A;  3ITH A;  2EBE A;  2YWW A;  2UUA J;  1BE4 A;  5E7O B;  2KJW A;  4DL7 A;  2WSF C;  1H2T Z;  1UVJ A;  1KVJ A;  4CNZ A;  4B3R F;  4PAA A;  1OWX A;  2QSW A;  3CD7 A;  4M5N A;  4NYP A;  4I69 A;  1Q82 T;  2QE5 A;  3JXO A;  4X66 F;  1JLF A;  1OYD A;  1FDD A;  3CCZ A;  4DR4 J;  1YZ6 A;  2J6U A;  2ZDO A;  1GQE A;  3AB2 B;  4ED1 A;  3O44 A;  1ZZN A;  1V3Z A;  5KFF A;  4DR7 F;  3D1O A;  3M8W A;  2MQN A;  3I56 S;  5CXT A;  5A8K B;  1HNW F;  2DPJ A;  2XHC A;  4LBH A;  3A8E A;  2LLZ A;  1T9X A;  5IT0 A;  3PRD A;  3PJW A;  1UMJ A;  4ZKA A;  4CM0 A;  2I6W A;  4M95 A;  3TVZ A;  1C4A A;  4DSL A;  2JHE A;  2OP5 A;  2E5J A;  2MLY A;  2AEF A;  5DO2 A;  3S6E A;  1G2E A;  1IBM F;  3IGN A;  2HS4 A;  2G2Y A;  2WAQ D;  2RRB A;  2YNH A;  2A2D A;  4JUZ A;  1HNV B;  4A8O A;  4QWD A;  3M2R B;  2LQJ A;  2IYI A;  1NJI T;  1QJH A;  3M8P A;  3W63 A;  4NMX A;  2YNF A;  2CJ9 A;  2CQI A;  2MQ8 A;  2AW0 A;  2Y1R I;  3M7V A;  5LSR A;  3JQM A;  1GX6 A;  4OLO A;  1KRP A;  4NXN F;  4DHV A;  4G6V B;  3THT A;  3KK3 A;  5H9E K;  4OHX A;  2MZS A;  3FRZ A;  1FDA A;  2IMO A;  1HW8 A;  4EBD A;  4UOG A;  3RR7 A;  2EXU A;  2YY3 A;  5GAH I;  4UY8 T;  3LPY A;  2R9L A;  3PJ9 A;  3NNC A;  2V63 A;  5HJX A;  1REV B;  2M5Y A;  4B9L A;  4DR7 J;  1IBL F;  3V6J A;  4WFA Q;  2DIT A;  2G2O A;  1SC1 B;  1QLN A;  1WC4 A;  2Q79 A;  2HKE A;  2U2F A;  1X8D A;  2IFX A;  1HBO A;  3FBC A;  1NSK L;  1WHX A;  2KB2 A;  2MLZ A;  1BGX T;  4OYP A;  2DY1 A;  3PYE A;  3UDV A;  2C3M A;  2ZBI A;  4L75 A;  4C0B A;  3OL7 A;  1YSJ A;  3UR3 C;  1U48 A;  5K8M A;  2UUA F;  3PY8 A;  3CDB A;  1X4E A;  3AJ2 A;  3C19 A;  3FQL A;  7FD1 A;  2CJA A;  5ETS A;  3KOA A;  1O8B A;  2OPQ A;  4NLS A;  4Q44 A;  3BQ0 A;  1S1V B;  2J76 E;  4OX9 F;  4YEA A;  4KGK A;  1NKC A;  2WW4 A;  4ECW A;  1S1T A;  3N5B A;  1Q8I A;  2PSZ A;  1CPZ A;  1RT5 A;  4YY3 J;  1RAO A;  3DRP A;  2HVE A;  3BR8 A;  2QO3 A;  5B08 A;  1RTJ A;  1IBK F;  4AL5 A;  5EDW A;  1NAQ A;  1YRU A;  4HVZ A;  4Q2M A;  1NSQ A;  3GJT B;  4I2P B;  2DXE A;  1IKY B;  3CMA S;  3MMA B;  3TEG A;  5GAE U;  4KT0 C;  3S8S A;  1XMO J;  5CCM A;  2R8H A;  3CCR S;  5GME A;  3EGN A;  3MAH A;  3WHI A;  3GP9 A;  4M5G A;  3TZW A;  2P5V A;  3LO3 A;  4ZCI A;  3DI6 B;  3RAQ A;  1KOH A;  1B70 B;  1W2I A;  1N0V C;  1WC6 A;  3CDU A;  3QIP B;  3QT8 A;  3BO4 A;  2CNK B;  4OZ3 A;  4F4K A;  1NU4 A;  2WSC C;  4F2S A;  1T95 A;  2EEY A;  2FLP A;  1WSR A;  2JEG A;  3ADA C;  4RLE A;  2MZR A;  1N34 F;  4BS2 A;  2APO A;  3HVT A;  2V8V A;  1VBY A;  2ZZN A;  2QFJ A;  3OR2 B;  2IBK A;  2LP4 A;  1G7C B;  4M5K A;  3EZO A;  3PW4 A;  1ZTT A;  2CNN B;  3KHL A;  4JI5 F;  1FNM A;  2KVQ E;  1FKP A;  2XMM A;  3G6E S;  1RWO B;  2JH3 A;  3K17 A;  1PGZ A;  4EK2 A;  1B3T A;  2CNO B;  1ARO P;  1VGY A;  1JLB A;  3D6F B;  4TY9 A;  2DXF A;  1E6Y B;  1JXV A;  1EZZ B;  1HQU A;  2CAD A;  2HWH A;  2NXN A;  3HKZ D;  2OEJ A;  2D9P A;  2HQG A;  3QID A;  4F4Z A;  5D15 A;  1X0F A;  2IA0 A;  1I3O B;  3UPF A;  1Y7P A;  4NEZ A;  2L3M A;  2BA9 A;  2KKH A;  2EFG A;  1D09 B;  2A3J A;  2JEF A;  4JI3 F;  2Y8W A;  3KNA A;  4ED5 A;  1RAD B;  3HZG A;  4PG6 A;  4WJB A;  4BC9 A;  2RNE A;  3JSR A;  2WVF A;  4DSF A;  1S48 A;  4IYQ A;  1YIT S;  2DNL A;  1X9S A;  2VG6 B;  2BRK A;  3D2W A;  4NZ6 A;  2QJ3 A;  4WXW A;  2IAJ A;  3QO9 B;  3CCW A;  1RAC B;  5F41 A;  3ISN D;  3GIK A;  3G6X A;  2CYY A;  3UVJ A;  1VHF A;  1IKV A;  5HAN A;  3PW0 A;  3PFE A;  5HMX A;  4UUW A;  4JI8 J;  1FI4 A;  1Q7L B;  2OML A;  2DR8 A;  2VG5 A;  1SI9 A;  1WOP A;  1UW4 A;  2D3Z A;  4DJB A;  1H3D A;  2V0N A;  2QYC A;  1JLE A;  1VJQ A;  1TV6 A;  2RS8 A;  3MOJ B;  1WKJ A;  1XIQ A;  4ED7 A;  2B56 A;  3FEZ A;  4DXL A;  5GMD A;  2XGP A;  1XQI A;  2H54 B;  1JLC A;  4OHZ A;  1LQ9 A;  4C3K A;  4U95 A;  1U1N A;  1FRH A;  3MM6 B;  2YNG B;  4CTA B;  4C0H A;  2GQ2 A;  1PJ7 A;  1KFS A;  1PJ5 A;  1UTA A;  4O4R A;  4K59 A;  1SIW B;  4HTI A;  4YR3 A;  4ZP8 A;  4FS1 A;  4F3O A;  3DOK B;  3G8Q A;  4G65 A;  5JMN A;  2BM1 A;  4TQS A;  3PRV A;  3LP2 A;  1IKW A;  5KFJ A;  3ZZY A;  4ED3 A;  2DBB A;  1T02 A;  3M2V B;  3T5K A;  5ETT A;  1L3S A;  1Q4R A;  1ZA2 B;  1N54 B;  1ZZF A;  1RT5 B;  1KFD A;  2MST A;  2XBP A;  3DRP B;  3GPA A;  4KC5 A;  4ZVS B;  2HBZ B;  2XYH B;  1PCA A;  3E01 A;  3PFO A;  5KFX A;  2G2Z A;  5F3Z A;  2OEK A;  1QSY A;  1URN A;  4WU3 A;  2RUS A;  2ZHO A;  3N79 A;  3DMJ B;  4ZHR A;  3TUZ C;  2HNZ A;  2ILY A;  1GMU A;  1XER A;  2G13 A;  1AW0 A;  4ITS A;  1S49 A;  3EX7 B;  2XZT B;  3P96 A;  1B0P A;  2FQQ B;  4G1P A;  2OPP A;  1QAI A;  4JYA J;  4WII A;  3SSQ A;  1BQX A;  4HHU A;  2VBW A;  4XPC A;  3T1H F;  1S0O A;  3JS9 A;  3EZU A;  3K7R A;  1HNW J;  4QBU A;  1F1B B;  2VFT A;  3PX4 A;  2WVC A;  4ZLP A;  3V6H A;  1RKJ A;  5B0A A;  4C8L A;  1JIH A;  3CXC R;  1YQH A;  2UVV A;  3OR2 A;  4FYW B;  1X9W A;  1FD8 A;  1VYA A;  5AE1 A;  5HLF A;  4X4T A;  3MR6 A;  2VFU A;  2VIH A;  5AE3 A;  1TK8 A;  1WEX A;  4HYK A;  4PPD A;  3CF5 Q;  2XLK A;  2GFF A;  3HSZ A;  2QX0 A;  2I0X A;  1MML A;  2YWF A;  4HH0 A;  4WYL A;  1BY9 A;  2RHQ B;  4PXE A;  1OSD A;  2GA7 A;  4NZ7 A;  4MAK A;  2YKN B;  1UL3 A;  1KLN A;  5HQM A;  4Q8E A;  2I1R A;  2JEI A;  3CCU S;  3GG1 A;  2KU7 A;  4CT8 A;  1RXO B;  3CCV S;  2MKS A;  2R7T A;  1S4E A;  1YRX A;  4JI2 F;  3U7J A;  5KFQ A;  2DYA A;  2VQE F;  4DV7 J;  4JI4 F;  3HF5 A;  1FDN A;  2V2Z A;  2GC8 A;  3BN4 A;  3OXF A;  3FSY A;  3KLE A;  4AQY F;  2HWT A;  2L9N A;  4I67 A;  2AT1 B;  4ZJL A;  2DR6 A;  4UOH A;  1NK7 A;  1IKV B;  2YKP A;  2LKZ A;  1H2U X;  4USW A;  5GAD I;  1WOS A;  2RU9 A;  4DN0 A;  2X51 A;  3BYP A;  5ADZ A;  3PX0 A;  5KFI A;  1U6Z A;  2HUR A;  3FCV A;  2N7Y A;  2IY5 B;  3MZI A;  3Q89 A;  1VCT A;  4O3P A;  1RTD B;  3B6B A;  4PCQ A;  1TL3 A;  2DHG A;  3RB6 A;  2ZH8 A;  4NA3 A;  3MPV A;  5EHH A;  5KT3 A;  1UVM A;  2QYG A;  1DAR A;  4CTA A;  5BYS A;  1WJ9 A;  4FNI A;  1EET A;  4QR0 A;  4DUT A;  2R8J A;  4LF5 J;  4QCL A;  4QPX A;  1Q8B A;  4BWJ A;  3NXZ A;  3OTD A;  3DOK A;  3MFI A;  4Q2L A;  1B7Y B;  1FFG B;  1X4G A;  2QL9 B;  4A8S A;  4CP5 A;  5HP1 A;  4PYD A;  2DH8 A;  1HPZ A;  3BSC A;  3C6U A;  2JWN A;  3POT B;  4LR9 A;  4V19 J;  3HK2 A;  4Y3C A;  1VRU B;  4MIB A;  2MQM A;  2XLJ A;  2CJY B;  2ALY B;  1W7W A;  3V4M A;  4KBI A;  1PG5 B;  2FUG 9;  4CLF A;  3Q2S C;  2WVD A;  1NEE A;  4QPT A;  4JV1 A;  2JEJ A;  3BH6 B;  3V81 B;  2KYX A;  2MXY A;  1J5E F;  4IG3 A;  1FJG F;  1PIE A;  4UST A;  1HAR A;  2OFH X;  4P7V A;  1C2P A;  3C3L A;  1VIX A;  5SUH A;  4YHH F;  2FIU A;  1RHR B;  1XJW B;  2AX1 A;  1M5V C;  2LEP A;  4OFZ A;  1SVD A;  3ZXW A;  4A8X A;  1N6Q A;  1IM4 A;  1KTV A;  2UV8 G;  5LXR A;  3HJV A;  3T6J A;  1LEO A;  3I0S B;  5HMZ A;  2VPZ B;  1IWA A;  4HKQ A;  3SIP B;  4CLZ A;  1NHV A;  1SB6 A;  2YH0 A;  2RAQ A;  1PBU A;  1M1K T;  2OD6 A;  1DAX A;  1KBR A;  3G87 A;  2PDA A;  4P74 A;  4RNF A;  2F40 A;  3OUY A;  4YB6 A;  4DV5 F;  3T5L A;  2R7V A;  3RRG A;  3O8W A;  3DLK A;  3O5T B;  2HQF A;  3KFW X;  5HLF B;  4X64 J;  4DPU A;  2GZO A;  2A10 A;  4IOA Q;  2OKQ A;  3CJT A;  2PI5 A;  1PO6 A;  3VAG A;  1R0C B;  2OPS B;  3E51 A;  2RQ4 A;  1RYS A;  2E29 A;  3CJQ A;  3U1M A;  1U1O A;  2N4D A;  4E0D A;  1IQT A;  2CQH A;  2G9O A;  1S6Q B;  4DWI A;  1Z4U A;  4EU0 A;  1Y0H A;  3H8Y A;  3LPE A;  4CLP A;  4USU A;  2B8Q A;  2BAB A;  4E2F B;  1NPK A;  5L1K A;  3AXM A;  1U1P A;  2FVS A;  1CJV B;  1N52 B;  3CIM A;  3M2R A;  4LQ3 A;  2YPY A;  3IWX A;  4LT6 A;  1S6O A;  1TR0 A;  2PMW A;  3HUL A;  1EIY B;  3CDA A;  4EGL A;  1OYE A;  4WFY A;  2W24 A;  4QW8 A;  1BUX A;  3UDL A;  1NB7 A;  3NGD A;  1UZD A;  5KFC A;  1NHU A;  1KQS R;  2FJA B;  4ELT A;  4QIF A;  2KHC A;  4IRK A;  4IOC Q;  5CZX A;  2XSJ A;  2JVO A;  1Q79 A;  1JKH B;  3RB3 A;  2DO4 A;  1S1X A;  1TUG B;  3DRR B;  4DS5 A;  1REV A;  1IQZ A;  2J0Q D;  1FRX A;  2NUH A;  1HHS A;  1SC3 B;  3CJ0 A;  4GC7 A;  1UAW A;  3GV7 B;  3J7Z T;  3PYG A;  3HT3 A;  4CH1 A;  5I3P A;  2BQ3 A;  2HAI A;  4LF6 J;  1LW2 A;  3HT0 A;  4CLW A;  2RU3 A;  5KFM A;  2Y1I A;  5B0F A;  2VJV A;  4TYA A;  5KG3 A;  2NXU A;  1SH2 A;  4P71 A;  2M3D A;  4DCO B;  4ZCM A;  1FHT A;  3N6M A;  5K14 B;  2QLW A;  1EET B;  1Y4Z B;  2YNI A;  4N77 A;  4OJ1 A;  5C25 B;  3CSK A;  4DV2 F;  3M05 A;  3T9Z A;  4N7T A;  2VON A;  4YUD A;  4QIE A;  4E98 A;  5T14 A;  3KLG A;  3BQ2 A;  2MHN A;  4J9V A;  1BLU A;  1DJ0 A;  1KQG B;  1REG X;  2DIU A;  2RF2 B;  2XGQ A;  3POT A;  4TQR A;  2QLF B;  1D8Z A;  1NKB A;  1RT1 B;  2QL7 B;  2ZH3 A;  4OIX A;  1ZM4 A;  4GVB A;  2LQ9 A;  3K59 A;  1X4H A;  2ZEJ A;  4AUK A;  5GAG U;  2EG1 A;  1HQE B;  2DH7 A;  2MKI A;  2M2B A;  1QAX A;  4IG3 B;  4LQ9 A;  4CRJ A;  3JSM B;  1X4A A;  4A46 A;  2ZWO A;  3D68 A;  3K0J A;  1Z2Z A;  3LP0 B;  4RUB A;  1FK9 A;  1UKU A;  1P9Q C;  1V5I B;  2BKP A;  2ZBC A;  3KJV A;  1KC8 T;  2OPR B;  2Y0S D;  5K8P A;  3HMJ G;  4RW6 B;  3VAI A;  4BDP A;  1TKX B;  3ZTS A;  3DI6 A;  4JI8 F;  2ZJR Q;  1XBW A;  2BJ1 A;  1JK9 B;  3D0I E;  3DRY A;  2DNM A;  1ROF A;  3N6L A;  4J9K A;  4B3O A;  3D1Q A;  4EBC A;  2H4Y B;  1P1L A;  1XEZ A;  4QR1 A;  2HMI A;  1SC6 A;  5F8J A;  2Q3P A;  2YX4 A;  4P9S A;  1K0V A;  2DD8 S;  3MMC B;  4C48 A;  4I7F A;  1YJT A;  3I5B A;  1WEZ A;  3M1V A;  5DM7 Q;  3MCM A;  3ZZZ A;  2V2K A;  3SV3 A;  2NRE A;  1IUJ A;  5HO4 A;  1CUL B;  3W9I A;  2KL8 A;  2MGZ A;  1QVF R;  4ZP7 A;  2KZM A;  3I32 A;  2Z58 B;  4V1A k;  5F9L A;  5A0Y A;  2K8G A;  5ETP A;  3ETM A;  4C9D A;  2FVR A;  4TYB A;  4PWU A;  2D3O R;  1MU2 A;  3K89 A;  3W1Y C;  2R7S A;  4FYD A;  2MYF A;  3DXB A;  5DQG A;  1R89 A;  3MAQ A;  4C8K A;  4GKK F;  3F0N A;  3HHK A;  1K1S A;  3H2U B;  1QM9 A;  4DZ6 A;  5BJR A;  4B9M A;  1GT8 A;  5A2Q U;  3MOZ A;  4JI3 J;  1CJV A;  1Z1Z A;  2PC6 A;  8RUC A;  3D9B A;  2IM2 A;  2W4D A;  5THW A;  1KSP A;  3VAL A;  4UT4 A;  3W2W B;  1D1U A;  5KT4 A;  4TVA B;  2OTL S;  2FB0 A;  3RJM B;  3KK2 A;  2K1R A;  2EFP A;  2FJD B;  3AB4 B;  3MEC B;  4C2M A;  3LA0 A;  3MFH A;  5K5M A;  2BX6 A;  4K2X A;  1OY6 A;  4KHM A;  2CJX B;  4BLG A;  4B3S J;  2IPO B;  4W4M A;  1SJ3 P;  2EWH A;  4DV6 J;  1T9U A;  1YWX A;  4C0O C;  3HHL D;  1S1X B;  2YKA A;  1NCL A;  3DGV A;  3FBB A;  3N28 A;  2KFY A;  3RBX A;  2HQI A;  4PPZ A;  3Q8P B;  3OLB A;  4A8W A;  3G2X A;  4EEY A;  2QEX S;  2XB2 D;  1FO1 A;  1UWB B;  3DLH A;  4CO1 A;  4IFY A;  3IG1 A;  3ZZO A;  2PGC A;  1PC4 A;  1RTI A;  3GFZ A;  4DR3 J;  3E8O A;  1IKX A;  1VK3 A;  2MKH A;  2NYI A;  3CJS A;  3KDO A;  3H5X A;  4H4M A;  1P9Y A;  4WZQ A;  2HLT A;  1HNI A;  3MMB A;  1S9F A;  5D8H B;  1VFJ A;  1WC3 A;  2RML A;  2V4J B;  3MI7 X;  1YIJ S;  4O0I A;  2YWH A;  4G1Q B;  2KI2 A;  2BOP A;  1ZA1 B;  4DV2 J;  2AD9 A;  3DLL Q;  3QFW A;  3MEG B;  2YWK A;  4RWX A;  1CVJ A;  3M6X A;  3DRS A;  1F5C A;  5L46 A;  4MFB A;  3OFH A;  3BH7 B;  1FX4 A;  4ELV A;  4DF4 A;  2Q66 A;  1UFL A;  2EFQ A;  3I4H X;  1SKR A;  3QWP A;  3JTP A;  2KHD A;  4OYO A;  2B6A A;  4HT5 A;  5KOX A;  3IBC B;  2NYH A;  1DQA A;  4BC7 A;  1FE4 A;  2EC2 A;  5C2G A;  2RB7 A;  4FZV A;  3SDE B;  3AH6 A;  1EX8 A;  4DI6 A;  2P9C A;  4LR8 A;  4GC6 A;  4IRD A;  2EFN A;  2ZH9 A;  3IRX A;  1N5T A;  3JSM A;  1HQ2 A;  3DLE A;  1UFK A;  1AB8 A;  1KHW A;  2DNN A;  4USH A;  4C97 A;  1SJ1 A;  2CA9 A;  3PEH A;  3R97 A;  4FF2 A;  2BM0 A;  3QGH A;  5EUH A;  3H20 A;  3R9L A;  1GMW D;  3U1N A;  1OPZ A;  4HLB A;  2E66 A;  2B43 A;  1ZH5 A;  2NXC A;  2R7X A;  4YOE A;  2ZKT A;  1CQM A;  3EGZ A;  4PRF A;  3I31 A;  4DR2 F;  1JLF B;  2H48 B;  4URS A;  2AJ2 A;  3QT7 A;  1GXL A;  2XO6 A;  3VV2 B;  1XMQ F;  1S9G A;  2QV6 A;  4DQQ A;  2J6S A;  4M5D B;  3H90 A;  4USJ C;  2B9W A;  3C16 B;  2XWY A;  5CYQ A;  3NL0 A;  2NSB A;  4O23 A;  2RIJ A;  3SQG A;  2HLU A;  3CCS S;  3D3B J;  3JAM Y;  2XNQ A;  4TLR A;  1G3O A;  1RB0 A;  1WG1 A;  2YNH B;  1OO0 B;  3UDC A;  3T9N A;  3CVK A;  3HSD A;  5F0W A;  4ZCL A;  1N33 J;  3BO3 A;  1G4C A;  1I5O B;  1CS4 B;  1HR0 J;  4RL1 A;  1WDT A;  2UVR A;  1LXJ A;  1EP4 A;  3DM2 B;  3KDN A;  1F3V A;  2P6S A;  3KK2 B;  4RW9 B;  1XN9 A;  3P6Y C;  3ILO A;  3PTW A;  4JB8 B;  4CIO A;  3KK3 B;  4B3T F;  3HVA A;  4ZK7 M;  4OYI A;  2C2M B;  2LEA A;  4H4K C;  4RNH A;  3CCM S;  1FEE A;  1S99 A;  4FN5 A;  5MLC V;  3GCW P;  3H7H B;  4FPR A;  3Q8Y A;  3GQC A;  3L3C A;  2Q6B A;  1YX2 A;  3D28 A;  3NRB A;  5T7L B;  2BYC A;  1KVI A;  2D1C A;  3CPW R;  1HBU B;  3RRH A;  2UP1 A;  1VDH A;  2UVW A;  3ISN C;  3IG1 B;  4HT7 A;  1TP7 A;  2HHQ A;  1WOR A;  1ZOT A;  2AF6 A;  2AJF E;  2C2O B;  4W98 A;  2PEB A;  4FYX B;  1K1Q A;  3MED A;  3VGT A;  1K9M T;  4MH8 A;  4PZV A;  1H73 A;  3NNH A;  1WHV A;  2CQ2 A;  2COL A;  4H4K A;  4WTO B;  5B0G A;  3NCQ A;  1U8W A;  2LQ5 A;  4NI2 B;  4DR5 F;  2BMB A;  3VWS A;  1Y5I B;  1HW9 A;  2CJB A;  2G4B A;  4FNH A;  4K5S A;  1S1V A;  1VQP S;  2DR5 A;  4JI7 F;  1YJW S;  2C2K B;  2EPI A;  3PNI A;  4DL5 A;  1S6P A;  2B6A B;  3AD8 C;  4ECQ A;  3CJK A;  2YXL A;  4OI2 A;  4Y6I A;  2DNO A;  3PO5 A;  4LF7 F;  3D54 A;  3SFU A;  4OLP A;  1RHU B;  1RTJ B;  3DCA A;  3AOA A;  1Q86 T;  3ILL A;  3TVK A;  2HWI A;  4X62 F;  1FJG J;  2RQM A;  4X65 F;  8AT1 B;  2F4F A;  4R0J A;  3DLE B;  3J7Z 5;  4B3R J;  1OY9 A;  2WHO A;  4FKX A;  3BB5 A;  2WBR A;  1VQ4 S;  3NKY A;  2C2E A;  1ZAV A;  2R2R A;  4PYA A;  1RHJ B;  5KFB A;  1NH8 A;  1NZA A;  3OHA A;  4OJG A;  1RHQ B;  1N48 A;  2NUU G;  3KHH A;  4I6W A;  1LK5 A;  2DNH A;  2DRD A;  3SSR A;  4CYU B;  4DSE A;  2P9E A;  5HBM A;  5F8H A;  3R7N B;  3ISZ A;  1KQF B;  3DRX A;  3HI9 A;  3UCZ P;  4RUA A;  1FKP B;  3MM5 A;  5IWA F;  2YPZ A;  1S0N A;  3HSG A;  4NA1 A;  2NXJ A;  3D6M B;  2JSX A;  3HHL C;  1KS2 A;  4AT1 B;  1UEU A;  2YQ3 A;  4CI0 B;  5LJ5 Y;  1U02 A;  3BKF A;  3C14 A;  5A6W A;  3ZO7 A;  3J7Y I;  4D3G A;  1E6Y A;  3V2U C;  1U47 A;  2AZ3 A;  4LF5 F;  3D67 A;  1VHI A;  1NDP A;  2BEF A;  1GXU A;  5FLX U;  2HHH J;  2W9C A;  5IT9 U;  1WKK A;  1SJR A;  2LQB A;  3DU6 A;  4IG0 B;  3UR0 A;  2BRL A;  4A8F A;  1Q8K A;  2BE2 B;  4ZOS A;  3G8T A;  3RUB L;  1FXD A;  1YJN S;  1FRK A;  2Z2Y B;  4PQU A;  3V6D B;  1MWY A;  1X31 C;  3L7O A;  2UUC J;  2XY5 A;  1TL5 A;  5E3P A;  2BUN A;  3LAM A;  4OZ1 A;  1FKO B;  3TNV A;  4NXM F;  4JV5 F;  4CO3 A;  2EFO A;  3MM9 A;  2IAJ B;  3QO9 A;  4CO2 A;  4ECZ A;  1MN9 A;  4PG7 A;  1FCA A;  2HG4 A;  2IDL A;  1XWL A;  5DZ6 A;  2QIF A;  4ZS6 A;  4DFK A;  5B7W A;  4B3M F;  4N76 A;  1RWX B;  4DDF A;  4FS2 A;  2VG5 B;  5D77 A;  3WX4 A;  4Y2M A;  2DPI A;  3EYZ A;  3FBE A;  3CC2 S;  4CT9 A;  2OD4 A;  1JLE B;  4ECX A;  3OL9 A;  1UEK A;  1MWZ A;  2V8G A;  4KRW A;  3CNQ P;  3A1Y G;  4GKJ J;  1WI8 A;  2UXB F;  4AXI A;  2FPH X;  1XTZ A;  3FZB A;  1C1C B;  2EKY A;  4DV0 F;  4DQS A;  3QLH B;  4MK7 A;  3RW7 A;  1JLC B;  2B4O A;  3CUN A;  4KO0 B;  2F8E X;  5K14 A;  5CQG A;  2V8D A;  2DCL A;  2M52 A;  4J9S A;  1KHV A;  2BJ9 A;  4NI2 A;  2R2T A;  2CZ4 A;  4DR3 F;  3TVY A;  3KWM A;  4BBY A;  5B0E A;  1JX4 A;  3BJY A;  3QSY B;  4ZP9 A;  5LJ3 Y;  4OQJ A;  1FE0 A;  2DB1 A;  2MQQ A;  4N5S A;  1FX2 A;  5AT1 B;  2NS1 B;  1C0U A;  2QC3 A;  4TU7 A;  3OT9 A;  2YX1 A;  4LIW A;  5EX3 A;  2BOA A;  5C5J A;  4K4U A;  4DSK A;  4PXB A;  4B3M J;  4ES2 A;  4ZVG A;  3TA1 A;  1F5A A;  1OQ6 A;  4J9P A;  4OV6 A;  4K4Z A;  4LRE A;  3UQS A;  3J7Y U;  2CVI A;  1FK9 B;  4M5L A;  3A4T A;  2BJ3 A;  4WTY A;  5M2R A;  3SCK E;  3WQP A;  4A8Q A;  4JI1 J;  1UA0 A;  4KYZ A;  3UO0 A;  2QA4 G;  1KVK A;  4NLT A;  5D78 A;  4NA2 A;  3TX8 A;  2DCU B;  1EAR A;  1LW0 A;  1NK4 A;  3CCJ S;  3BO2 A;  1AT1 B;  1Q5Y A;  1IBL J;  4LFC F;  3N5F A;  4B3O B;  3P3D A;  2AIR B;  3MMC A;  3K5M A;  2DGS A;  2RJZ A;  2P8I A;  4JBC A;  3VCD A;  4O4G B;  2J0X A;  3M1V B;  2V67 A;  4AD6 A;  3RAM A;  5HBM B;  3CW2 C;  4S0M A;  2XMV A;  2FZK B;  2E1P A;  2HQC A;  2FLN A;  1CUL A;  1S4F A;  5A8K A;  3MM5 B;  2RDD A;  1SIZ A;  1S9E B;  2JRS A;  3EUN A;  2AJ0 A;  4J5O A;  1TU0 B;  4K4V A;  4I0W A;  2ZOG A;  1FJC A;  3TUJ C;  2DIS A;  1LWC B;  2GIR A;  1T11 A;  2VL1 A;  4Y00 A;  2VF3 A;  4EFA C;  2GHP A;  2M0G B;  2FHJ A;  2FLO A;  2C3U A;  3A8J A;  3D5M A;  4NPO A;  4XK8 C;  4OX9 J;  2IJR A;  4U7U K;  2FVQ A;  2WON B;  3JTN A;  2DGX A;  2JFD A;  3ZTQ A;  4WFB Q;  4CDI A;  5DGA A;  2PFF B;  2O3D A;  4ZLJ A;  3QJP A;  3HDS A;  2X1A A;  4DU8 A;  3H5Y A;  2HVD A;  4ECY A;  4DFM A;  1U0S A;  3V6D A;  4ZLN A;  1U09 A;  5ETL A;  4OI1 A;  4R0E A;  4L3K A;  2WRM A;  1FKO A;  2Z0G A;  4RO0 A;  3MM9 B;  1RLC L;  2IRY A;  2HW3 A;  2Y9H A;  2WSE C;  1SJQ A;  1Y5N B;  1H2V Z;  2FC8 A;  3VF0 B;  4J9U E;  4LSL B;  4J90 A;  4I4B A;  2XI3 A;  4NLR A;  3BRE A;  3I5A A;  1IR2 A;  2MJN A;  3I87 A;  2ZIT A;  3W65 A;  3C46 A;  2ASL A;  1XK8 A;  2W25 A;  5E3A A;  5HVH A;  4M94 A;  1U26 A;  2HZC A;  1OY8 A;  1RA6 A;  1RK8 A;  3BF4 A;  3M6W A;  3RG6 A;  1J5E J;  4URG A;  2UXB J;  1R8A A;  1B4S A;  2E7W A;  3RBZ A;  2ZM6 F;  5LMU J;  2VA2 A;  4G1I A;  1YVF A;  4I2Q B;  1C1C A;  2C3O A;  3GLJ A;  3MUM P;  3L09 A;  3QLH A;  1BQM B;  1HNI B;  4JV2 A;  2KT3 A;  2VB6 A;  1N5Y B;  4KO0 A;  4OYX A;  2FLL A;  2IRU A;  1CJK A;  4URQ U;  1XC9 A;  1VQL S;  1RAA B;  2ROE A;  2CQG A;  4K50 A;  2NQP A;  1VI7 A;  3PZP A;  3MEG A;  1RWK B;  2OPQ B;  3P8B B;  4LF4 F;  3P45 B;  4KKO A;  1ZBT A;  4TY8 B;  5JJB A;  1SH0 A;  1HPZ B;  1UVN A;  4FPI A;  1S0M A;  1RTH A;  1S1T B;  1HHT P;  3EVM A;  1T3N A;  3LAL A;  2VOO A;  3U27 A;  1OS5 A;  4J7C A;  1HNZ J;  2B4P A;  1CJT B;  2HK2 A;  2KVI A;  2ZH7 A;  1A6L A;  2VQF F;  3AT1 B;  3FEX B;  2FVC A;  1YJU A;  5A8R A;  5IQ6 A;  2KFN A;  4KAI A;  2WB1 D;  2HFU A;  1RQ0 A;  5CD4 A;  3H59 A;  3FBF A;  3O1L A;  2GAG C;  4NL5 A;  3T1Y J;  4YY3 F;  5K8N A;  1D3W A;  3Q8U A;  2XMU A;  2ZNZ A;  1LW0 B;  5KFR A;  1GTH A;  1IBK J;  4YP3 A;  5H9F J;  4JYA F;  1RT2 B;  2MB0 B;  3EVO A;  4RW4 B;  2QSF A;  4CZC A;  4JI6 F;  4XO0 A;  4LVN P;  4ZJO A;  3G71 S;  1QSS A;  2DVI A;  3CJ8 A;  3GTY X;  4LR7 A;  2DH9 A;  4WF9 Q;  1YJV A;  1FRL A;  5B0C A;  1RAH B;  3OUY B;  1WHW A;  1RHM B;  2ACM A;  2XWX A;  5JXS A;  5K8O A;  3RRK A;  4FBU A;  4DN9 A;  4F50 A;  1TL7 A;  5KFY A;  5LSO A;  3HKW A;  5AXL A;  2VOP A;  1DZ5 A;  1P6T A;  2G1D A;  3DNC A;  2ASJ A;  1XNR F;  3ENQ A;  4AFF A;  1QAY A;  1JLB B;  4NLW A;  2QA2 A;  4LBP A;  4FF4 A;  4WZM A;  4RW7 B;  2UUC F;  3I96 A;  1M90 T;  1Q0N A;  2CVE A;  2M70 A;  2OUG A;  2D69 A;  2G1H A;  4LBI A;  1IVZ A;  1RGV A;  2JL9 A;  3DLJ A;  2XQC A;  4J9N A;  4LF9 F;  4GRS A;  3W66 A;  3CC4 S;  1OSC A;  3TJ9 A;  2J9D E;  3TAM A;  2CWK A;  3ZZP A;  2XC9 A;  5FII A;  3W8P A;  2ASD A;  1ZS6 A;  2XMW A;  4RW9 A;  2UXD J;  5KAK A;  3DYA B;  3N9U C;  4LF4 J;  3R5A A;  9RUB A;  2VG6 A;  4ECR A;  2KT5 A;  2OHD A;  4LRB A;  1ELO A;  2VFV A;  4USV A;  3J80 Y;  2UUT A;  2YQ0 A;  1VC5 A;  3TJA A;  2HPU A;  2FTR A;  2AU0 A;  4ED8 A;  3FNN A;  4DV7 F;  1R0B G;  1SKU B;  4HHJ A;  1NPP A;  4P72 A;  3T19 A;  2LDY A;  3WX8 A;  4WFN Q;  5KG7 A;  2AYG A;  3CMQ A;  4RW8 B;  2UZA A;  5FDL A;  4OYZ A;  3PVX A;  2HHU A;  4NOH A;  3J81 U;  3TUP A;  2FYX A;  2VBZ A;  2ZUA A;  3UN5 A;  3BGF A;  3K5P A;  3PW2 A;  3MR3 A;  7AT1 B;  1WTB A;  2AEJ A;  3WBZ A;  4HEA 9;  1CJK B;  1X0P A;  2MQP A;  3MD1 A;  3WIU A;  2J5A A;  1NJY A;  2YNI B;  4X2B A;  4NE9 C;  3H2V E;  1NJX A;  3UI3 A;  2W1B A;  1AZS B;  4QIV A;  2Z2Z A;  3UNY A;  1U1R A;  3GR1 A;  3LH2 S;  2R7O A;  3GV5 B;  4KKO B;  4TY8 A;  1L3U A;  1E6V A;  1U2C A;  4YB1 P;  1T9T A;  3LP2 B;  4WWS A;  2XI2 A;  4UOC A;  4XIU A;  3MR5 A;  4NLU A;  1RTH B;  3OVA A;  3V4I B;  4ERD A;  1KON A;  3FGV A;  2ZVS A;  3I5C A;  4NYZ A;  5DZ7 A;  3P5T L;  3CJK B;  1HWL A;  4O0N A;  2EK1 A;  1XNR J;  1VQ6 S;  3U1L A;  2LQ8 A;  4DF8 A;  4MKB A;  3AOB A;  3M8Z A;  5A8R B;  3ZFV A;  2C28 A;  2HBR B;  1UET A;  2JC1 A;  4ZPV R;  3JTO A;  3H40 A;  3SCL E;  1RAE B;  2LVW A;  1Q16 B;  3LP0 A;  3QGI A;  4TU8 A;  1U2F A;  2KH9 A;  2LU1 A;  4DUY J;  1V5V A;  4CLU A;  2CIM A;  3ILI A;  4RW6 A;  3DHX A;  2OPP B;  2WZ1 A;  2E1M C;  2JDJ A;  3MEE B;  4OI6 A;  2ZOM A;  3RYL A;  5IWA J;  2W7O A;  2MZJ A;  3TAP A;  3VGU A;  2Z2L A;  2V2V A;  2Y0B B;  3MTK A;  4NLP A;  2WW8 A;  1RT6 B;  2PA8 D;  4F67 A;  4CO5 A;  2X1F A;  3QRQ A;  4RW4 A;  3I82 A;  3Q24 A;  4J9O A;  3R2C J;  2OAU A;  1R8B A;  1TL4 A;  1YRT A;  2VC0 A;  4I7F B;  2BJE A;  1TFW A;  5LMN F;  2FC9 A;  3AQO A;  2ZC4 A;  2FZG B;  1YJR A;  3LGN A;  3TZZ A;  1TL7 B;  4YB7 A;  2CQB A;  2ZVI A;  2BDP A;  2HYI B;  2FVP A;  3MM7 B;  3R27 A;  1RBL A;  2CJK A;  3M32 B;  3KTQ A;  3CWJ A;  3C14 B;  1PAE X;  5SZT A;  3MCS A;  2MKY A;  4RW7 A;  5AXK A;  1LFP A;  1PBA A;  2RT3 A;  2B4V A;  4X84 A;  4P2M A;  2GV1 A;  5M2U A;  2I2Y A;  4MJK A;  2OO4 A;  2YKN A;  2ATL A;  3QRP A;  4PKD B;  2BE2 A;  2Y3Y A;  5DS7 A;  3HPO A;  1VBX A;  2HVH A;  1JWW A;  4DV4 J;  1R27 B;  4PQU B;  2BZ2 A;  2MZ1 A;  4F0H A;  4P52 A;  2FZC B;  3OW2 R;  3IAS 9;  3DYA A;  1CQN A;  2IA6 A;  2HHX A;  4DL0 C;  3KJN B;  2C42 A;  2W9B B;  4AXJ A;  2EK6 A;  2D3U A;  2M88 A;  2HRU A;  4B9N A;  2PN6 A;  3GYN A;  3ZTR A;  4K7Q A;  4NML A;  3H5S A;  5IC4 B;  5AXM A;  3W9J A;  2NCK L;  3BZQ A;  5A8W A;  5EWF A;  2VIC A;  1U1L A;  1QDU B;  1VQ5 S;  3RBD A;  2FHO B;  3N4W A;  4C8M A;  1JNZ B;  4DEZ A;  3BPD A;  3Q0A A;  2CG8 A;  4F0K A;  2QLX A;  1UWB A;  1UJ6 A;  3HFZ B;  4KY3 A;  2ZOF A;  2BJD A;  1HHQ A;  3OPK A;  2XEX A;  2HK3 A;  1T3O A;  2J8A A;  1A7G E;  1OIA A;  4W92 B;  4BCA A;  3Q83 A;  2DHH A;  3M30 A;  3Q86 A;  2F1F A;  3QJJ A;  3FSX A;  2QTW A;  4ZPT R;  3KMS A;  1HLW A;  3KUE A;  4K4S A;  1R8C A;  3HFK A;  2IJN A;  3GV8 B;  3R5D A;  2GX8 A;  2VPY B;  2F9J A;  5BR8 F;  1WNE A;  1EJ7 L;  1FFW B;  3DRS B;  2IDE A;  3SXL A;  2DNR A;  5BR8 J;  5JVG Q;  3GON A;  1W25 A;  1FF2 A;  4GO5 X;  5KFG A;  3ULH A;  3VVU A;  3CCE S;  1NH7 A;  2BQU A;  1HKA A;  5FJ4 A;  1VRU A;  2V69 A;  4WFX A;  4JI5 J;  1RIS A;  1X5T A;  1LWF B;  3I4P A;  4OMF G;  1PJ6 A;  4MKV A;  1H7X A;  2GIF A;  4Z7C A;  2F4V F;  2CQ3 A;  4NCA A;  2NR0 A;  5IV3 A;  1WC0 A;  3UE2 A;  1T9V A;  4OZN A;  1PYO B;  5GMK a;  1VIS A;  2MTL A;  4J37 A;  4RBU A;  3JAM U;  2DHS A;  2WOM A;  1T05 B;  2H3E B;  4B9S A;  4HAC A;  3BKU A;  3MCN A;  4D3H A;  5F8G A;  1EQ0 A;  2MKC A;  4LJM A;  3VHQ A;  4LSN B;  2VAS A;  1OQ3 A;  4USI A;  4WK3 A;  3M8R A;  1N6Q B;  1VQN S;  1SXL A;  4NLV A;  5DM6 Q;  1Y10 A;  1N56 A;  3IS9 A;  1TZ0 A;  2RQK A;  1YBT A;  3I0S A;  3KLI B;  3CC7 S;  1B99 A;  4L72 B;  5CAB A;  2OFG X;  3NOC A;  1BQN B;  4HI1 A;  4WBF A;  3SEO A;  3TQE A;  1EAY C;  2ZHB A;  4ZVP B;  2HRY A;  3T5J A;  4O4G A;  3FZ2 A;  4GKJ F;  3DLK B;  1ITP A;  5ETR A;  5J2N A;  1QE1 B;  1U6B A;  4LMZ A;  2MSS A;  3HHE A;  4H54 A;  1S9E A;  3NBP A;  4TLQ A;  2L41 A;  1DBD A;  1LXN A;  1S79 A;  1SC4 B;  1VQ8 S;  3SSS A;  4OYA A;  5L9X A;  2UU9 J;  4WPA A;  1HWJ A;  2UXC F;  1S7I A;  2DNQ A;  4R5P B;  5KG1 A;  2J9E A;  4A8M P;  2KG1 A;  2LCW A;  1RAJ A;  1A0O B;  1VQS A;  1N32 F;  2WON A;  3IC1 A;  3PDN A;  2D41 A;  1CS4 A;  2NSC A;  1RWP B;  3DM2 A;  3IFE A;  3LQV A;  5B0B A;  2AYE A;  4M5H A;  4C6A A;  3E2E A;  4GKK J;  4CLS A;  1R6Y A;  1SPB P;  1HI1 A;  2I5J B;  2HVZ A;  4DX6 A;  3NMA A;  1X4B A;  5KFN A;  2VDH A;  3S7R A;  3HHL A;  4AL7 A;  3EE3 A;  4F4A A;  2BW2 A;  1JKH A;  5A8W B;  1RI7 A;  3FK4 A;  1LKZ A;  4EWT A;  3F56 A;  4U9R A;  3OHB A;  1CBK A;  2RQC A;  3I6P A;  3NGU A;  2J8S A;  5AXN A;  2ZH6 A;  3GFY A;  5KFT A;  1U0H A;  5T7L A;  2J7W A;  2KO1 A;  1HBU A;  2H4W B;  3NGK A;  4DG1 A;  1MMN A;  1JJH A;  4MIA A;  4ED6 A;  3BGO P;  4ILL A;  1WEY A;  2GQQ A;  4CLL A;  3GIJ A;  2DY9 A;  3A12 A;  4R25 A;  1UVL A;  3SBM A;  4U67 Q;  2AV5 A;  3GSD A;  5J2M B;  3UD4 P;  1S6U A;  5I3U B;  3DLB A;  2PEH A;  1FEH A;  1KDN A;  2IMW P;  1S1U A;  2VBY A;  2H65 B;  1HNX J;  4B17 A;  1DLO A;  4HH1 A;  2IBO A;  3KG4 A;  3ONQ A;  3PX6 A;  1RT3 A;  3VR1 A;  4ALZ A;  3OTO J;  4DUZ J;  1TKZ A;  2OH2 A;  5LOQ A;  1I51 B;  3OV7 A;  5J1N A;  5RUB A;  1RT1 A;  2Y1J A;  3GZ7 A;  4LF9 J;  1N33 F;  2CRL A;  4GVB B;  3GIL A;  1VR6 A;  1CJT A;  2HHT A;  4ZVQ B;  1KKH A;  2QZ8 A;  5DG9 A;  3DHW C;  3DOM B;  1AUD A;  3M8Y A;  5D0R A;  2XCA A;  5F0U A;  3MXH P;  3K58 A;  4QWA A;  5CZV A;  4PG8 A;  3MAA A;  3GSI A;  1Q5V A;  2BAN A;  4KV8 A;  1YZ7 A;  2Q6C A;  4HAC B;  3D0G E;  3D4J A;  3KJV B;  1AFI A;  3GJQ B;  3R7B B;  3TAR A;  1LWE A;  1S72 S;  3R6G B;  3AD9 C;  3IR7 B;  2CJQ A;  5GAG I;  5HI7 A;  2GJ2 A;  4MYU A;  2XTJ P;  4DU7 A;  4Y2C A;  2LMI A;  3KLI A;  3A3N B;  1UJ4 A;  3BEG B;  2WVE A;  3D66 A;  2ACY A;  1HBN B;  3MR2 A;  5U47 A;  2GVD A;  1WAC A;  3BDE A;  4MKY A;  3QPI A;  4FP9 A;  3E3X A;  2W4C A;  4NLX A;  5LMU F;  3A13 A;  2WTF A;  2YVS A;  3OL6 A;  2BVZ A;  2VUG A;  5J2N B;  1MRO B;  3KLV A;  1RBA A;  2R2S A;  2ABY A;  4DR2 J;  3ELH A;  2JOQ A;  4IH7 A;  2MPU A;  2FDN A;  1U24 A;  2F7V A;  2GO8 A;  1AUS L;  4RBT A;  4ZDN A;  4X66 J;  3J7A 1;  4YB5 A;  4F3Q A;  2W2M P;  5F8I A;  2ALZ A;  3P49 B;  1NKE A;  1JLQ B;  1IXK A;  4K5R A;  4KFB B;  4O3Q A;  1SJF A;  1L3T A;  1EQM A;  4DPY A;  2RSQ A;  3EVW A;  4OZ0 A;  3C2P A;  1YK9 A;  2HNY B;  4HDG A;  2QMU B;  4MMO A;  4IDK A;  1N36 J;  3LAK A;  3W2W A;  4ZVU B;  1T03 B;  3UDE A;  3AA8 A;  4LIR A;  4WIQ A;  2M4M A;  4KPC A;  2K1R B;  3T1A A;  1DTT A;  3IXQ A;  2XMK A;  3BBC A;  3D1H A;  3NWR A;  5F8L A;  1IBM J;  2VFS A;  3HHL B;  2D74 B;  4PXD A;  4XDD A;  1O51 A;  4I1T A;  5GAH U;  1PC5 A;  3M9O B;  1JLG B;  1MNE A;  1OMS A;  2FJE B;  2JLF A;  3U02 A;  2AGP A;  5EN1 A;  2GMH A;  2KDO A;  4DLE A;  4RW8 A;  1IM6 A;  5FDL B;  3LWL A;  2VBX A;  1H98 A;  3JQJ A;  1O6X A;  4UUX A;  3NGR A;  4YDD B;  2RDJ A;  2A1B A;  4ILR A;  4DG1 B;  4YS2 A;  1U49 A;  2W2O P;  2GGP A;  2BAC A;  1I6J A;  2JVR A;  1X7V A;  4LRF A;  2AGO A;  4FBT A;  3QAE A;  1WOO A;  5DDR C;  1EKS A;  3M9N B;  1UA1 A;  3QGP A;  3CGI A;  4C3M A;  1NK6 A;  1WF1 A;  3NAH A;  2LEB A;  1CLF A;  4QIW D;  2V4J A;  3UNG C;  4WP8 A;  3GCX P;  5F8M A;  4G1Q A;  3N01 A;  1M5S A;  1ZAW A;  3PYF A;  1VJW A;  2XO7 A;  4WP3 A;  3JSY A;  4F3M A;  1P27 B;  2QFI A;  5K20 B;  2CNL B;  1FVS A;  3GWC A;  1TMJ A;  4MFB B;  4Y34 A;  2BBE A;  1A9N B;  2XZD B;  2MLX A;  1C0U B;  2J7U A;  3EDR B;  3VQS A;  1R0A B;  5DGB A;  3W7B A;  2J6T A;  1O0P A;  2IC3 A;  1UW9 A;  3BYR A;  4F25 A;  5CAA A;  4WKR A;  2BKO A;  2Z57 B;  1M1H A;  4UY8 5;  4IOB A;  2IVF B;  4QJV A;  4ZLL A;  2DNP A;  4FVC A;  1UCN A;  2LA6 A;  3IBF B;  4NLY A;  1YBU A;  2DTJ A;  3NMR A;  4OI4 A;  4UTG A;  2DGO A;  2NXE A;  4DLG A;  1KLM A;  4LFA J;  1YKW A;  1LWE B;  3LW5 C;  3G4S S;  5L1L A;  4HL9 A;  1Y11 A;  3MEE A;  3QQC D;  1IWG A;  3T1Y F;  3KLF A;  4DQI A;  3GIR A;  5LSL A;  4U8Y A;  4LFC J;  3NS7 B;  4IFV A;  5F3T A;  1S97 A;  3ZTO A;  4HR2 A;  1VC0 A;  4DV3 F;  3EJM A;  4P7T A;  3QZ8 A;  1HBN A;  4NAS A;  2R7Q A;  2XS5 A;  3M6U A;  1X4C A;  4KTQ A;  4OZL A;  3PXG a;  1WF0 A;  1HFE L;  2VH7 A;  1NBE B;  1SCJ B;  2QN6 B;  2V68 A;  3LP1 A;  3ZZR A;  2M8D B;  2XSF A;  3C16 A;  3MPU B;  3FVY A;  4Z2X A;  1BC6 A;  4ZMM A;  3A3O B;  2FHJ D;  4DR1 J;  2CDQ A;  5IXU A;  1PIL A;  1NO8 A;  1LWC A;  1RT7 A;  2CG4 A;  3IR6 B;  2E5I A;  3JQK A;  3R5C A;  3UW1 A;  2HFN A;  3MPW A;  1JLQ A;  3CO9 A;  4USM A;  2R8K A;  1OPI A;  1WTF A;  2IRX A;  1R7I A;  2EW9 A;  2HGM A;  2FGC A;  2MKJ A;  2Z4P A;  4UOF A;  5ITH A;  1QVG R;  3HHN B;  1UWA A;  3SV4 A;  5KFS A;  2OIH A;  1VIO A;  1J27 A;  1CC7 A;  1EP4 B;  1N5S A;  1PYS B;  3LGM A;  2H51 B;  3W9H A;  4PWD B;  4RNN A;  5GAD U;  4PG4 A;  1KR4 A;  1S59 A;  3DDI A;  5KFW A;  2GIQ A;  2QMX A;  4QWC A;  1JJ4 A;  4TN2 A;  3HP6 A;  4GMK A;  2W9B A;  4ZPB A;  3A8K A;  1Q53 A;  1YGY A;  1RUS A;  1WD6 A;  5HK4 A;  2ZFH A;  4LSL A;  2HGL A;  5J2P A;  2N3L A;  4EMD A; 
#chains in the Genus database with same CATH homology
 3KXD A;  4J7C A;  2BKO A;  4GVL A;  3RBX A;  4EI2 A;  4YS2 A;  3RBZ A;  1VCT A;  4L73 A;  2AEF A;  1LNQ A;  2BKN A;  2BKP A;  3L4B C;  4L75 A;  2AEJ A;  2FY8 A;  4J91 A;  4L74 A;  3JXO A;  4G65 A;  4RO0 A;  4J9V A;  4XTT A;  4L76 A;  4J9U E;  2AEM A;  4J90 A;  2OGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...