2F9DA

2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA branch site protein p14
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9dA01
3HHNB 2F9JA 1VQOS 2CQDA 2MSSA 3RW7A 2KU7A 2VONA 2MZQA 2FC8A 2N3OA 1YJ9S 4WFAQ 1RK8A 2DNGA 2KYXA 2RU3A 1BY9A 2KM8C 2M0GB 2CQ0A 2LMIA 1R8PA 2LXIA 1JJHA 2DGSA 2M2BA 2HZCA 2BOPA 1SJ3P 2MJNA 3VF0B 2KXFA 5GAHU 2MZTA 1R8HA 1FJCA 2MKIA 1VC6A 2LEAA 3CC7S 1X5SA 2MZ1A 2LQ5A 3MUMP 4Y0FA 1U1QA 2MY7A 2FY1A 4FXVA 2CPJA 1QVGR 2KHCA 3J7YU 1U1PA 2OTJS 4P6QA 1U1RA 2MKHA 1SJFA 1M5PC 4WFBQ 2L08A 2RRAA 3LPYA 3VAHA 3JB9k 4OZ1A 2E5GA 5DDOC 1JJ4A 2UP1A 1FJEB 2CPIA 2KFYA 5JVGQ 1FHTA 3CCSS 1O0PA 1K8AT 2O3DA 1X4AA 2CPFA 3P5TL 3MXHP 1UW4A 1WI8A 2YH1A 2DH7A 1U1OA 4WIIA 5IM0A 2YTCA 2CQGA 2M8HA 2U2FA 5IM0B 1VC5A 2CPEA 4PKDB 1Q82T 5DDRC 2M70A 3SDEA 3SDEB 2DGQA 2DO0A 3G8SA 1VQMS 1WHWA 3CD6S 1U2FA 3MUTP 1FXLA 2KI2A 1RKJA 3S7RA 4LJMA 2DGUA 2JVOA 1U1NA 2JVRA 1WTBA 3L3CA 3G6ES 1DBDA 1D9AA 2DK2A 2HVZA 1N88A 1X4BA 2D9PA 2DNOA 2MYFA 3P49B 2U1AA 5DETA 2QA4S 4ZKAA 4Y00A 2DNYA 1K9MT 4TU9A 2K8GA 4OZ0A 3BO2A 3BO4A 4CH1A 3EX7B 2FPHX 1HA1A 2KT5A 1HD1A 2MZJA 3BO3A 1X5PA 1KQSR 5LXRA 2M9KA 2MKKA 3UD3P 1YTYA 2LECA 4Z2XA 1X0FA 2I2YA 1WF1A 1AUDA 3CCQS 4CIOA 2AYBA 3K0JA 4BS2A 3CMAS 2VOOA 2DNPA 2DNLA 1NU4A 1DZ5A 4C0OC 4U67Q 2DHGA 2N3LA 3FEXB 2HGNA 2RUGA 2DHSA 1QVFR 2MB0B 2CQHA 1L3KA 2HYIB 3Q2TC 1X4FA 2M88A 1VQ4S 1B7FA 4W90B 2MHNA 5DDPC 2MQMA 5LSOA 1H2VZ 3CXCR 3UCUP 2RVJA 1WEYA 2KG0A 1SXLA 1KOHA 2MZRA 1UFWA 1YJNS 1N54B 2QEXS 5GVQA 2DNZA 1U6FA 3I56S 2MKSA 2JX2A 2MKCA 2MQQA 3S8SA 2XS2A 1HL6A 2K3KA 2KXHA 5MLCV 1M90T 4ED5A 2KN4A 1F9FA 4IUFA 3VAGA 2MSTA 3VALA 1KD1T 4TLQA 1A9NB 1U1MA 2L9WA 4WF9Q 1X4EA 1WHXA 2LYVA 1VQ5S 2JWNA 1QM9A 3US5A 4F26A 2KRRA 3PIOQ 1FO1A 3S01A 4YB1P 1X4CA 1X5OA 3CMES 1WF2A 5LXYA 2MZSA 1VBYA 1X5TA 1VQ7S 1IQTA 3NNAA 4J5OA 3SMZA 1UP1A 1M1KT 1XN9A 1WHVA 3S6EA 2CPYA 4TU8A 2RQCA 4IO9Q 2HGLA 3CTRA 3EGNA 1VQ6S 1URNA 2X1BA 5CA5A 3CCVS 3I55S 5D77A 4V19X 1P27B 2XNQA 1X4DA 2KVIA 1Q81T 3TYTA 2OJ3A 2JRSA 1PO6A 3G9CA 2CPHA 2XB2D 3CCJS 2N82B 2DGTA 2CQCA 3BEGB 4QQBA 3CPWR 3DLLQ 3LQVA 4M5DB 1M5VC 1N52B 2XNRA 1WHYA 1YIJS 5JVHQ 2YWKA 2EVZA 3MOJB 2G4BA 5GADU 2MXYA 2DHXA 1D8ZA 4TU7A 2KM8B 3RW6A 3MI7X 1WWHA 2LA6A 1HD0A 1NJIT 2F9DA 4YUDA 2DNRA 4LIRA 3U1LA 5ITHA 2CQ1A 2AYGA 3UCGA 1SJQA 5HO4A 1WG1A 4WCEQ 4PRFA 2KXNB 4C7QA 2RQ4A 1DRZA 1W2BR 3J7ZT 1JJ2R 2CQBA 2DO4A 3EGZA 3CF5Q 2CQ4A 2HGMA 3ZZZA 1N8RT 1NO8A 2VOPA 1DHMA 3G4SS 1U1LA 2SXLA 3P3DA 2DNNA 2J0QD 2L41A 1WI6A 2MPUA 2MGZA 4IOCQ 3CUNA 2MGZB 2FHOB 1YI2S 2CPDA 1S79A 3R1HA 2MMYA 3UD4P 2XS5A 2MJUA 3CULA 2CQPA 2WBRA 3H2VE 3G96A 3CC2S 1P1TA 1OIAA 1A7GE 2DNHA 2DGVA 2LA4A 1VC0A 3Q2SC 2CQ2A 2DNKA 2VODA 2MQPA 3VAIA 3V4MA 5GMKa 4QU7A 1JMTA 5IQQA 2XS7A 3N9UC 2RNEA 4F25A 3MD1A 2YH0A 3CCLS 1VQNS 1VQ9S 1YHQS 1SJ4P 2NZ4A 4W92B 2FC9A 2OTLS 2DH8A 2E5JA 2DH9A 3DXBA 3MDFA 3UWTA 4LMZA 2MY8A 1WEZA 1KOOA 3H2UB 3TP2A 3CCUS 2DGWA 2DISA 5CXTA 1VQKS 1OWXA 1ZZFA 2RS8A 5D78A 1Q7YT 2I38A 4F02A 2MQLA 2RT3A 2M8DB 4QU6A 2YKAA 3THPA 4QPTA 1VQLS 1FNXH 2OIHA 1H2TZ 3R27A 2B0GA 2ERRA 3MD3A 1OO0B 5IFMA 1YITS 1S72S 3NS5A 2E5HA 2G0CA 2MKJA 4ERDA 4UY8T 1CVJA 4YOEA 5FJ4A 3R1LA 1YWXA 5BJRA 4UQTA 3HI9A 2F3JA 4WFNQ 3G8TA 4RU2A 1YJWS 2Q79A 5CYJA 3OW2R 1VQPS 2ADBA 1FJ7A 3CCES 2DNQA 1WF0A 1FT8A 2KG1A 4CH0S 3BS9A 3NMRA 2XSFA 2J0SD 2PE8A 3U1MA 2PEHA 3CCRS 2G1DA 2DGXA 3FEYB 3IWNC 3VAMA 1M5OC 5LJ5Y 1H6KX 4CQ1A 2D9OA 2LKZA 5LSLA 2D3OR 4IOAQ 3THTA 1KC8T 2KRBA 1U6BA 1PGZA 4EGLA 3VAFA 4A8XA 3MURP 1WELA 3IRWP 2ADCA 1VQ8S 4WKRA 2CQIA 5HL7Q 1X4GA 2DNMA 5DDQC 2MQNA 2N7CA 2MQOA 3G71S 2M52A 1OPIA 2DITA 5DM6Q 2DGOA 2ZJRQ 3VAKA 2RS2A 2CPZA 4FXWA 2ZJPQ 2LCWA 3VAJA 5H1SV 1WG5A 3B4MA 2OSRA 2ZJQQ 1M5KC 2X1FA 2E44A 2X1AA 3D2WA 1VBZA 1WG4A 2DB1A 2KH9A 1UAWA 2GHPA 2CJKA 2DIUA 3SXLA 2DIVA 3MUVP 3CCMS 2AYEA 2CQ3A 2OSQA 2E5IA 2CPXA 1ZZNA 2BZ2A 2LEBA 2NLWA 2V94A 3CC4S 2AD9A 2M7SA 1Q86T 1VBXA 2RRBA 4C4WA 2J8AA 2A3JA 5LJ3Y 3NNCA 3B4DA 3PIPQ 1ZH5A 3NS6A 2EK6A 5GAEU 5GAGU 5EN1A 2AYMA 3UE2A 2M4MA 5DM7Q 2LXUA 2QFJA 3P6YC 1K73T 3UCZP 3NNHA 2EK1A 2GO9A 2X1GA 4PR6A 2DHAA 1SJRA 1H2UX 1U1KA 1G2EA 1X4HA 2J76E 3ZZYA 1WEXA 3TO8A 3ULHA
chains in the Genus database with same CATH superfamily
4AFFA 2MZQA 1I51B 1DARA 1RK8A 4J37A 2W24A 1UJ5A 3NCRA 1UFLA 3TAMB 5AXLA 5GMEA 1M0SA 1RT2A 2H4WB 1DAXA 3PR5B 3IAM9 2D41A 1G1XA 3T6JA 1HI0P 3FSIA 4DSLA 3W62A 2HFVA 2CPJA 4OX8A 4I7FA 3N28A 4LRFA 4WFBQ 3FCHA 2GIFA 4ZN3A 2ZBIA 5T7LA 1KQFB 2ZNYA 5H9FJ 1U4BA 2JEFA 2EI5A 2HHUA 4GKJJ 1YJ7A 1Z4UA 2CPFA 1VIXA 2YH1A 4KKOA 4LF8J 3W65A 3PXGa 1UW9A 3KLHA 1FTCA 1JLCB 1ZTWA 3JSBA 1IBCB 5AXMA 4C9DA 1AZSA 3W9IA 4MKBA 5A76A 1NKBA 3R7BB 1VIOA 2WAQD 5ETQA 2C2ZB 4Q44A 4WXWA 2NYHA 3H5YA 2W7AA 4ALZA 1DBDA 4DSFA 1CC8A 4ZKAA 2DRDA 2JLFA 3EX7B 2FPHX 4ID8A 1HD1A 1WC1A 4Y2AA 1YBAA 2ZZTA 5KTQA 4BS2A 3CMAS 1DJ0A 2GCFA 1RBOB 4ZIWA 3W7BA 3NCPA 3M8PB 4QYZJ 1XNQF 1TMJA 4JI7J 1SXLA 1YJNS 3DXSX 3RBXA 2KN4A 1FVSA 3A3OB 3THVA 2V9WA 2GQ2A 2UXDJ 2PEBA 3KJVB 2BKNA 2FJDB 2OMLA 2I9SA 4I2PA 1I3OB 2GO8A 1ZBTA 4WZMA 3LW5C 2FLNA 4BWJA 2I5JB 4J5OA 2QMXA 3NAHA 1JLBA 1LW0B 1VQ6S 2H54B 4ECTA 2FJVA 2F8HA 5D0EA 2V4JB 3N4WA 3GV8B 4DL3A 3C6TB 4WKYA 4FF1A 2RKIB 4CO2A 4FKXA 3OPKA 3OSPA 4OZLA 2ZC4A 3MOJB 5KT5A 1CQNA 4F4KA 3TA0A 5KG6A 4O3OA 1Q7LB 3MI7X 3MMJA 4N8NA 4YUDA 2AYGA 4IH6A 1WOPA 4LF7J 4B9UA 2DO4A 2W9BB 1NO8A 3NEKA 1RU2A 1MMLA 4F2SA 2CKWA 4DUYJ 2CPDA 1X0PA 4J7CA 1SKUB 3FRZA 3R1HA 2MMYA 2FUG9 3MEEB 4FBTA 1RTHB 3DM2B 1Y5IB 4FBUA 3GTYX 1Q5VA 3CCLS 4OJ1A 3IA0A 4B3RJ 4RL1A 3PX0A 4W92B 2NXJA 5CXTA 5BXIA 3HVAA 2ASLA 2AGQA 1QE1A 2J7KA 4RW6A 4CNZA 2C2EA 4OI0A 4OX9J 5D4PA 4PG5A 4LT6A 5CYQA 3GMGA 5E2QA 3R27A 2ERRA 3BJYA 2UXBJ 3DLGA 3OQ2A 1BQMA 4M94A 4WFNQ 4RU2A 3G8TA 3DLHA 4LQ9A 1HNWF 4RUHA 3BS9A 2ZDOA 2XZWA 3FFIA 1SH3A 1GH8A 2G1DA 2HBZB 1Q0NA 4O3RA 3DLKA 1H6KX 1EAYC 1RWWB 4KHMA 1TKZA 5ADZA 1ZPVA 3MCOA 5BR8J 1TVRB 1YJUA 4OZNA 1FRLA 2VBWA 1F9HA 2I8EA 2AX0A 2VZ9A 4ETXA 2XSJA 3H98A 4PPDA 2DXEA 3EUNA 4NX9A 3VHQA 1RQ0A 3M05A 3KJFB 2JEIA 1LWCB 4A8QA 3M1VB 1IKXB 2GHVC 3DYAB 3OLBA 2E44A 2X1AA 4YEAA 1N5TA 2FZKB 1V5IB 4B9LA 5EX3A 2VJUA 5HQ8A 2M7SA 3QT7A 2C2OB 3GU0A 2JL9A 3LUYA 1RT5A 2P8IA 4NXNF 4NCAA 3PIPQ 1K73T 1LKZA 5KFGA 1H2UX 1CJUB 3IBCB 3DHWC 2F9JA 5AE2A 2WW8A 2DHHA 2KU7A 3OR1A 3QAUA 2KYXA 2BE7D 3OTOJ 4OL8A 1SI9A 1RT2B 4P2FA 2ACMA 5E33A 1V6HA 4JI6F 2QYCA 2BJ8A 2HQFA 4HTJA 2QMUB 1S9GA 2V2QA 4P2XA 3D4JA 4NA3A 4I7FB 4N77A 4RKUC 3O5TB 4FVCA 1UEUA 3DGPA 4M8LA 5T7LB 1LV5A 4EBDA 1FHTA 3UQSA 4HR2A 1UA1A 3AB4B 1UW4A 4DS5A 2X3DA 4KKOB 3EJMA 4XDDA 2RRNA 3GFYA 3R8YA 3KLHB 3HO1A 2DD8S 5I3UA 1KVJA 5KOXA 3S7RA 1AZSB 4KSEB 2JVOA 4UUWA 2HVZA 1RXOB 3AA9A 4GO5X 4OI3A 2ZVIA 1DLOA 1FNMA 3M8RA 3NCQA 2LQ8A 4DFMA 3DRSA 3GV7B 2L3MA 1KQSR 4NYPA 3TJ9A 1IWGA 3K0JA 2Z2LA 3R7SB 2NPFA 3EDRB 2XULA 6AT1B 5EHHA 1W26A 1HQ2A 3QZ7A 5HVGA 5JUMA 2CA9A 2MHNA 1H2VZ 2V8VA 4NXNJ 1UETA 3ZZTA 3HHKA 4ZPCA 5DGAA 1F2GA 2ZBQA 2IDEA 1M1HA 2JH3A 4CLLA 2ASDA 1LW2A 1S1UA 4CT8A 4LF2A 2B8PA 4QWCA 4DOZA 4WF9Q 1IR1A 5G0RA 4CT9A 1JNZB 3DDNA 4FDFA 3S01A 3K59A 1SH2A 4I2PB 2G13A 4KH1B 2MEWA 2B56A 3Q83A 4QIVA 1FRIA 3OL7A 3O2IA 1UP1A 5A0YA 1JLBB 1N5VA 1FDDA 3CCVS 2XY5A 2UU9F 3KHRA 1Q81T 1GQEA 4URGA 3UFCX 4ZCMA 3LO3A 1Y5LB 4FYWB 4NYZA 2OEMA 1JJCB 2YWEA 2XCAA 3ICLA 3M8WA 4M5GA 2HHQA 1WSVA 3TUIC 2XMKA 2W1BA 2IDLA 3MPYA 2B8QA 3PM9A 1HW8A 1Z2LA 1T3NA 4OLOA 3BGFA 4NLTA 5E5NA 3EGZA 3MFHA 2VQEF 3D0GE 2L41A 4OYBA 4JI4F 3BDEA 1T95A 5D3GA 4A8YA 1P1TA 1A7GE 1VK8A 3T5LA 1AXQA 1D9DA 2MQPA 2FHJA 2XGQA 4F25A 5KFCA 1YHQS 1EP4A 5DG8A 3GYGA 1N5SA 1NJWA 3WZ0A 2AGPA 2ZM6J 3TP2A 3UDCA 3N0VA 1QE1B 4RW6B 1WTFA 1PG5B 2I38A 2MQLA 2RT3A 4L72B 5CYQB 3H0PA 5F8NA 2Y1JA 2GQQA 3ENAA 4ED2A 4YOEA 3DLGB 1U02A 1BQMB 4BLGA 4DZDA 5HK4A 1R7IA 2QYGA 1GX5A 3CDUA 3CCES 2PD1A 3ILJA 3MAAA 3QRPA 1R0AA 4JP8A 3FFIB 3GYNA 1YJTA 3D9BA 3TEGA 1W7WA 4A48A 2WSCC 1T11A 2CDQA 3I4HX 4CLFA 1QUPA 3DLKB 3KK1B 1ZS6A 1CJTA 1TKZB 3JSMA 4B3MJ 3JTOA 3D66A 5DDQC 3UNGC 2WRMA 1JQGA 2XO6A 2B9WA 2XSJB 4MFBA 1LFPA 1FEHA 2NYIA 3GJQB 3MM9A 3CE8A 2AJ4A 2ZJQQ 2XY7A 1S76D 4DUZJ 3CT9A 3SXLA 2P9CA 3K89A 1FRJA 1YZ6A 3QPIA 5F8GA 1ZZNA 1O51A 3LAKA 2NLWA 2DPJA 1RUSA 2AD9A 1SQFA 3E8OA 4V19J 4B9TA 3WHIA 3NNCA 5JXSA 1SL1A 2E9TA 3IS9A 2GVDA 1AFJA 4K4WA 1RT5B 2VV5A 1SL0A 2J5AA 4J9VA 4P2MA 2L9NA 4EEYA 4PAAA 2CQDA 1BQNB 3OR1B 2YWFA 2J6TA 2CQ0A 1RYSA 2ZH8A 1NJYA 1S12A 3VF0B 2V50A 3TR5A 1UL3A 2VB6A 3GPAA 3L7OA 4QR0A 3QT6A 2F65A 2ZH7A 1Z2ZA 1S9GB 1N5QA 1R31A 5HATA 4OMFG 1RB0A 1OYEA 1U47A 2ZITA 4DV6J 3JB9k 2E1RA 4NEYA 3DGPB 3RTVA 5JVGQ 1Y9OA 2OFHX 3W3SA 1HWJA 4DQQA 2R2RA 4ZLNA 2G2OA 5L1LA 2EG2A 1PAEX 4M5KA 3GIRA 4U9RA 5I3UB 4DLGA 2VG7A 2FB0A 1RT1A 1MNEA 2DGUA 2OEJA 4WFXA 3CGIA 4DV7J 3MPWA 2QL5B 1H98A 4DR5F 1I5OB 5DETA 4LR7A 2R8HA 4OZ0A 1DLOB 4NZ7A 3PJXA 3DRSB 4O44A 2BANA 1IBKF 4DV0J 4DX5A 2DNPA 3DGVA 4C0OC 3ONQA 2H48B 1NSKL 2OPRA 3FEXB 2RUGA 2I1RA 4K59A 4ED7A 4MK9A 2XY6A 5IT4A 2AQ4A 3CD0A 2N7YA 3P5BP 4RW9A 2V2VA 1WUUA 5KT6A 1LW2B 3W9HA 2BM0A 1S1UB 3KJQB 1S0OA 4YB6A 1N33F 3ZZRA 5HJXA 4G1QA 5G0RB 2KRRA 3BQ1A 3QMQA 2UVRA 2XHWA 2MZSA 5KT3A 2N4CA 4NPOA 3QJPA 3ZTSA 1XN9A 1NKEA 1FJGF 2RQCA 5A0YB 1A0OB 2RQKA 1CJKA 3KDNA 2PI4A 3TYTA 8AT1B 4CLPA 4ZP9A 4QQBA 2V4RA 1AFIA 1NHKL 3UN3A 4HT7A 2AJ2A 1HR0J 2UXCJ 4A8KA 1K1SA 4W4MA 4LIRA 3IM8A 2KZMA 3A8KA 1SJQA 1MSWD 2KXNB 5L46A 2FJXA 2GAGC 2W2PP 1RDRA 3ZNUA 5B0FA 3AD8C 2DPIA 5D3GB 1QAYA 6FDRA 2LA4A 5AE1A 3FSXA 3V4MA 4QU7A 1OQ3A 1P8GA 2EW9A 1EP4B 2IVMA 2R8KA 3UN5A 1OY6A 2BJ1A 4KFBA 4X65F 2B9XA 2ZC3A 4F04B 3L09A 7AT1B 3KDOA 3THPA 5LSRA 4USIA 3KUHA 1JLFA 2CVEA 5BJRA 1Y4ZB 2AJ1A 4J9MA 1RTDA 1NAQA 1AA1B 2AEJA 2PMWA 3MAAB 1LWFA 1R0AB 3FEYB 2R7WA 2H5EA 3O1LA 2Y8YA 2VKRA 5CAAA 1CJTB 3SQGA 2VG6A 1ZA2B 5HMWA 3B54A 1U6BA 3JSMB 1SIZA 4IRKA 4DCPB 1VQ8S 2ZWPA 5B09A 2CQIA 3AXMA 2KT2A 3QWPA 2FTRA 3ZNJ1 2DITA 5DM6Q 2DGOA 3ISNC 3IG1A 4MFBB 3J7A1 2X51A 3MM9B 2Z2ZA 4C6AA 2W2OP 2Q6BA 1UAWA 3MUVP 2CQ3A 2WVCA 2HNZA 2C2DA 4EZ9A 4RJVA 3DRPA 5LMNJ 5A2QY 3CC4S 3MM6A 1KFSA 4C4WA 1SKSA 2A3JA 3H59A 1NSAA 3IS9B 2GVDB 4EFAC 2HHPA 5GAEU 5L1IA 1IR0A 4LF4J 2FJEB 1Y11A 1SJRA 3A3PB 1FKOA 1G2EA 1RISA 1ICEB 1NBEB 4O3SA 1GMVA 3IBFB 2UUAJ 1VCTA 3JQJA 2DNGA 1BY9A 3LP1A 3N6NA 2B4PA 4KC5A 1PIEA 4TYBA 2MZTA 3QGGA 4I6YA 4HYKA 2AJ0A 2PC6A 2DR8A 3BB5A 4PZVA 2IBOA 4CI0B 2IJFA 2OTJS 2GC8A 3V6KA 3BKFA 5I4MA 1FRMA 4JB8B 1Y7PA 5IZHA 5E0OA 3NWRA 2KDOA 4U95A 3RBZA 1YJVA 4AXIA 2XQCA 5IS2A 3QLHA 2KL8A 1FXLA 3M4XA 2PSZA 4MYUA 4WP9A 3PR4A 2VG7B 4DX7A 1RT1B 1HARA 4USKA 2NSCA 3WC2A 3UR3C 4RNMA 3MPUB 1SQEA 4ZPAA 3P49B 5F0UA 5IOLA 4TVAB 2DNYA 4C2MA 2PGCA 2W2NP 5EDWA 2FQQB 2HHVA 3IWLA 4ZVHA 3MR3A 3L7UA 1J5EF 4O44B 3AODA 2BANB 2IYGA 1IWAA 2DNLA 4K4TA 3SSQA 3PYDA 1Y5NB 2Z2YB 2N3LA 2YBVA 3RR8A 2OPRB 1BUXA 4IG3A 3Q8YA 3G6VA 1GXUA 1HBUA 4USTA 2M88A 4KJIA 2XMUA 3BGRA 2LU2A 2ILYA 1S6OA 4DR7F 2CUYA 4R0EA 3VZIA 5KFPA 4LUBA 4RW9B 2EFNA 4DUTA 2ZBCA 1M90T 1HNXJ 3G8QA 3DLEA 2FJAB 1SC1B 1KDNA 3TOQA 1U1MA 2GMLA 2OGUA 1VQ5S 4PPZA 4G1QB 4U8YA 4X4TA 1U8SA 1WC5A 4H4OA 5F8JA 1X9SA 2MQ8A 3H42A 1S77D 4UZCA 4DPXA 1E6VA 2CPYA 2HGLA 3NWGA 1CJKB 2XNQA 3BSNA 3PY8A 2OJ3A 4CLTA 2LQBA 4C0HA 1PO6A 3NS7B 5KFLA 3OHAA 3CCJS 2RIJA 3D54A 1S6UA 1N52B 3HSGA 1VRUA 4M5MA 3M2RA 4F50A 2LA6A 2XLIA 5E3PA 4AL7A 1BE4A 3QFHA 5DG9A 4PRFA 4J9SA 1MWZA 4WWSA 2CQBA 3MECA 5KFKA 5IWAJ 2HHHF 2UVUA 1OY9A 5C2CA 3NGRA 2RU9A 3W2VA 3Q2SC 2DNKA 2VODA 2WZ1A 3NGUA 4CM2A 2MTLA 1LK7A 2BV3A 3P96A 1TAQA 1JLGA 3DC2A 3UWTA 3WC0A 4ELTA 2VIHA 1FWKA 4KFBB 2R2TA 3P45B 5DG7A 2YKAA 2OIHA 3PO5A 3ZXWA 5IFMA 5D8HB 3M6UA 1YITS 3AY0A 1JLFB 4ZVUB 2AMCB 1YWXA 5HMYA 4YHHJ 4KHPJ 1RTDB 2ZUAA 3X3UA 4L6V3 1EB0A 2XSFA 4FYVB 2XTJP 1LWFB 1I1GA 4U8VA 2AJQA 5LJ5Y 4B9SA 1HNZF 3F73A 3SQGB 2VG6B 1U09A 4ECSA 3FNNA 4X66J 4C8YA 4WE1A 1CC7A 4NLVA 2AIRB 4DL2A 1RT6A 3TRGA 2QG9B 4UOCA 4ECQA 3IG1B 4LFCF 2HQDA 1C2PA 1R89A 1FFGB 2VKZG 4QZVB 2DIUA 4O0NA 3OXGA 3CCMS 3VQSA 2NUHA 2GVZA 4RBUA 5EGYA 1R6VA 2HNZB 1T9WA 3M2UA 2V94A 3DRPB 3MM6B 1I94J 3I4PA 5SZTA 1S1VA 2HHTA 2NQPA 3F56A 4Z37A 2F63A 4DU7A 2J76E 1FKOB 4QWEA 5JJBA 3V5RA 1PC4A 1SC3B 1DQAA 2KJVA 1KLNA 3ETMA 1IM4A 3LP1B 1R8PA 3ZZUA 3J7AN 2QA1A 1PYTA 3T1HJ 2ALZA 1QY7A 1U25A 1QJHA 4NLUA 8RUCA 2OEKA 4B3SJ 1BGXT 3BGUA 3AQPA 3DNCA 2J7UA 1TMMA 5ETRA 1QVGR 4YR2A 3PNIA 4YY3J 2CDRB 2DVIA 3VAHA 3PEJA 4NLDA 4ZPWR 4PYAA 4K50A 4O3QA 3FUYA 4O0IA 4DZ6A 4WK1A 1KONA 4CCHA 3TX0A 2J9DE 2VH7A 4DWIA 4MK7A 3CD6S 1DFDA 1RKIA 3QLHB 1OSCA 1RKJA 4ELVA 4IRCA 1NK4A 4CP5A 1U26A 1N88A 1X4BA 1NPPA 3HHDA 1TK8A 1DTQA 5DGBA 3DLBA 3DLJA 5KFFA 2IRYA 5HBMA 2VPXB 2YNGA 3OV7A 1NU4A 4F7VA 1X8DA 3A8IA 2ATLA 2JDJA 3ZTQA 3M9NB 5B0BA 2GMJA 1GTHA 2MB0B 4IG3B 4CO1A 4IR1A 4X4UA 4FF3A 1HBUB 3H90A 3BGRB 1RT7B 3R9LA 2NXUA 1HIYA 4DX8H 2ALYB 2XS2A 1IJEB 3OD2A 1HWKA 3Q24A 3DLEB 5KFHA 1U7LA 3K58A 3Q8UA 1WOOA 2MSTA 3TW0A 3M6VA 3E3XA 2B4UA 2PI5A 5B0EA 3GP9A 2PA3A 1FO1A 2H9ZA 1HQUA 2F8MA 3FCWA 1VBYA 1OY8A 2YX4A 4H4OB 2IY5B 2K2PA 4J9OA 3CIMA 4YP3A 3R5CA 3DN9A 1LQ9A 1E6VB 4QR2A 2E9RX 3MGJA 2AZ1A 4BC9A 1XMQF 2BR0A 1SBRA 2V8DA 3FBBA 3CPWR 3JSYA 4M5DB 1B3TA 2F7VA 4QIEA 5JVHQ 4Y2IA 4OQJA 3HJFA 1VRUB 1RTJA 2KT3A 3F0NA 1HI1A 1SUQA 3M2RB 5C7PA 4JI2F 1S1TA 4K5SA 4K4VA 5BYSA 1TUVA 1HQEA 3T1YJ 1IKWA 2ZHBA 2EFPA 4RBVA 1TP7A 1WC3A 3MECB 2WONA 1FTRA 2SXLA 1KBRA 2YWWA 2WTFA 3G6YA 1S79A 4KTQA 3GIJA 4LBPA 4MMOA 1RABB 5KFQA 4H4MA 4I68A 3W2VB 2IA6A 4D3GA 3N9UC 1NPKA 3TANA 1WKLA 1JLGB 1RSCA 1L3VA 1K44A 2RQMA 4K2XA 1KNZA 1TKDA 3NKYA 2LDYA 1VQLS 3ZTOA 1R0CB 1OO0B 4P7TA 1F3VA 2P9EA 5CYJA 3RB3A 3KNAA 3Q8VA 1U0HA 4JV0A 3HXMA 2PEHA 4KRWA 4RUBA 3MMAA 4KE5A 1N34J 1M5OC 1UPMB 3PW2A 1NDKA 2QLJB 2EWHA 1KC8T 5A8WA 4QWAA 4OHVA 4FNIA 2IIHA 1WELA 3S1TA 4WE1B 3OTEA 1FKAF 4B3OA 1RT6B 1RTZA 2LCWA 2V5HG 1N6QA 3LF0A 2C22A 3SQOP 1H7XA 3NGDA 4P9SA 1H7WA 1X31C 2GVZB 1R8BA 3IR7B 3GB0A 5A8RA 3M2UB 3A3NB 4ANDA 1CS4A 2BXJA 2BX6A 2GNKA 1KVIA 1GXLA 2VFVA 1S1VB 2VFUA 3I5AA 4DV4F 5CD4H 2VFRA 1GT8A 3UCZP 1SC6A 2RUSA 4P7VA 2VDIA 1AB8A 2EC2A 4HH1A 2VL1A 2IM2A 1YJ9S 4LF5J 3TVKA 4OI6A 2QLWA 3EXYA 2HZCA 3OFEA 2YKQA 3QRQA 1NH8A 2WHOA 3PTWA 4BDPA 2Z2MA 3FZ2A 4NLQA 3FC9A 2MY7A 1LWXA 4R5PA 4DXLA 1SH0A 4JI0F 4H4KC 1DQ9A 2HWIA 1R43A 1IBLF 4NLYA 4X64F 2EFVA 1RADB 3CJTA 2WK4A 1GTEA 2JNJA 1JKHA 3C16A 2NREA 1XIQA 8ATCB 1N36J 2DR7A 3NP5A 2WVBA 3K7RA 3RZAA 3ZTPA 4IDKA 3HP6A 2FIUA 3L9ZA 1WTBA 3PX4A 4X4RA 3PW0A 4LFBJ 4RW8A 3FRYA 2CNKB 1DTQB 4R25A 1XNRF 3QYYA 4MIBA 4RO0A 4WFZA 4GO7X 2A6OA 2GV1A 5HBMB 3AJDA 1TUGB 2V69A 1NRKA 4P74A 2YNGB 1D9FA 2JEJA 2UV8A 1P1LA 1JLEA 4OYWA 1TUWA 2RVJA 1GEHA 3KK3A 3VTIA 1N54B 1RU1A 3WIUA 2JJ4D 4NL5A 3BKUA 1BC6A 1S0MA 4HT5A 2B7CB 4FF4A 4LFAJ 3VAGA 1KR4A 4TLQA 1F5CA 1XMOJ 2V34A 1DQ8A 2R3VA 2OELA 2WVDA 2Z56B 1HQUB 3UVJA 1NHVA 1TAUA 1VQSA 3HFZB 1NDCA 2V2KA 3EGNA 2L48A 1HMVA 2HW3A 5D4LA 4CTAA 3R2CJ 4V19X 3BSAA 3RBDA 3BZQA 1FI4A 4OYAA 4IR9A 2FLLA 1VDHA 3BEGB 1NHUA 4N7TA 4DV3J 4K4YA 4IRDA 3TA1A 2G4BA 3MEKA 2YPYA 2KZZA 1R0BG 3M8SA 3NMAA 4KB7A 1RTJB 1UVJA 1N4LA 2R4FA 1SUQB 3QJJA 4HLBA 1S1TB 2CQ1A 2Y0BB 4P75A 2E5LF 1IKWB 4M5NA 2XZDB 1EKRA 5HLFA 3ZZZA 5C2GA 2WONB 3P3DA 4E98A 2HWHA 1YJRA 2QE5A 3UD4P 2MJUA 3CULA 2QO3A 1RLDA 3WX8A 3J81U 2CQ2A 2CVIA 3RRGA 1FDNA 4H4MB 4N47A 2VPYB 3FEZA 4ECZA 4JYAJ 3K8VA 3D1HA 3SYZA 2YY3A 1KOOA 2RAQA 2R7QA 5K14A 4ZP7A 5D78A 4F02A 4J91A 1N48A 3W1YC 3J81j 2YX7A 4JI5J 2HHXA 4NCGA 3Q86A 1NXIA 4UY8T 4WP8A 4C8ZA 1WF0A 4F8RA 2HFOA 7FDRA 3DDKA 2ZH4A 1EZZB 1U0HB 2L9DA 1RAEB 1ELOA 4CO3A 4ZP8A 4F4WA 3MMAB 4E8UA 4CQ1A 2G0JA 3SFUA 3FBEA 3QT5A 5A8WB 6FD1A 3ZZPA 2ADCA 4O4RA 2EBGA 2WBMA 3KMQA 4F0MA 2B4OA 3UDLA 1OPIA 4B3OB 4PUOA 3IGNA 4QIWD 2WSFC 1WG5A 3TZXA 4M5IA 2J8SA 1N6QB 3CDWA 1MW7A 2N4DA 4P10A 4RW7A 5DRKA 2E5IA 5E3CA 4NXMJ 3QT8A 4P71A 4FS2A 5A8RB 4KBIA 2J8AA 1T9YA 1CS4B 3GR1A 2UUCJ 1FVQA 4DR4F 2HIQA 2MDAA 2OI2A 1FDBA 3I32A 5IT9U 3TQEA 4PG4A 2X1GA 4HACA 2PT0A 3CCZA 4OV1A 3ULHA 4WJBA 2OD6A 3T9NA 2MSSA 3HJVA 4WFAQ 4DR2F 1UJ4A 2C42A 4GC6A 3MCMA 3GZ7A 1FK9A 2V9KA 3H40A 1U1QA 2FY1A 3OFHA 3PDNA 4R5PB 3PFEA 4X4SA 3GG0A 4OZ1A 1PILA 2QA4G 2FJWA 2Z58B 3BGLA 1YRXA 4K5RA 2YKMA 2ZHAA 4B9VA 3MXHP 2FLPA 2YTCA 2FYXA 2CPEA 2JC0A 3HVTA 4RZRA 1JKHB 3G8SA 3C16B 1F1BB 2QRRA 2KI2A 1UVKA 2XLKA 3WDOA 4K4SA 3Q89A 2AJFE 4CNYA 4IDKB 2Y8WA 2JVRA 2J7WA 5AXNA 4GC7A 4DR1J 3OR2A 4RW8B 3LOUA 1B0TA 4UT4A 1YSJA 4ZVEA 1XK8A 3RAQA 4ES1A 3LWMA 4DBQA 3BO2A 1B7YB 1HA1A 1FCAA 4HI2A 3H25A 3IP0A 1X5PA 2W2MP 3QJLA 4X4PA 4ZVOB 1WF1A 1WKJA 3DI6A 1MG7A 3KJNB 5IC4B 1RJJA 1Q5YA 3GLJA 4JBCA 2VHGA 3BREA 3TZYA 2Y0SD 4TQSA 2NR0A 1TZ0A 1JLEB 2O5DA 1RA6A 2RDDA 1A6LA 3Q2TC 4F36A 1SKWA 4DL4A 3OXLA 2JSXA 5LSOA 3OHBA 5G4DA 2VFTA 3KK3B 4H54A 4W98A 4OI2A 4ANCA 2FVRA 1RWXB 2XO7A 4Y34A 1WC6A 2MKCA 1HL6A 3EPGA 2BMBA 3GCWP 1AW0A 1NNDA 4IUFA 4P2SA 1IVZA 4CLUA 2HFNA 1VJWA 4GKJF 4F3QA 5HANA 4LF8F 3E01A 3JS9A 3D6HB 2KYZA 3UVJB 1IQTA 5F3ZA 3BF4A 4GKKJ 4MYTA 3SMZA 4A46A 5HN0A 3BDPA 3AQOA 1HMVB 4CTAB 2P6TA 2Q43A 3ZO7A 3G9CA 7FD1A 2DGTA 4C8MA 1NB7A 2XNRA 3P8BB 4NYOA 1FD8A 4OI1A 2DHXA 4FYYB 2HVIA 1OJ4A 1GAOA 4DN0A 3FJ2A 4CLYA 2F9DA 4IFVA 3OUYA 2A0FB 5ITHA 1QSSA 1PYSB 4ZA1A 2K7KA 5I3PA 4LSLB 2X7IA 2VOPA 5HLFB 4U7UD 5ETKA 3BSCA 4DL5A 4ZN1A 3VV2B 3CJ4A 3HSZA 2BW2A 3NL0A 3H2VE 3G96A 4LRBA 1T05A 3GE9A 4DR3J 1UPPA 5L9NA 4JI7F 3J7YI 4PXEA 4CLKA 2HK3A 2LVWA 4TLRA 2RNEA 4PYDA 5IXUA 1SJ4P 1AT1B 3V2UC 2FC9A 4Y2KA 2DH9A 1DURA 4USWA 3D0IE 5J2QA 3SI8A 1VQKS 3DOKA 3GIIA 1N56A 4C11A 5K14B 2RS8A 2UXDF 1D1UA 1X7VA 2XC9A 3N5BA 1V3RA 4ZVPB 3KLIA 1N0VC 4DV1F 4NCGB 4LF9J 1OSDA 1NDLA 3EVWA 3OW2R 1FJ7A 1S4EA 4ZPBA 4FPRA 4L73A 1FT8A 2OPQA 1D0EA 1JXEA 4RPFA 4WZQA 3KUEA 2DY9A 4PXBA 2DEJA 1TL7A 2O66A 3D1OA 3RU0A 5J1PA 4CLZA 5LM7E 1S99A 2EKNA 2W25A 4KGXB 2MQOA 3CJ0A 4ECYA 3FQKA 3T6BA 4PUOB 3R6LB 2PFFB 3A4TA 4WXOA 1V3ZA 1VBZA 1T7PA 4LF7F 1XR6A 2R8JA 1J27A 2GHPA 3C3LA 3BYRA 4RW7B 2HBRB 4DUYF 3K5MA 3N79A 3QO9A 3CDBA 4M63A 4PCQA 2C2KB 2R7SA 2QGFB 3TARA 4HEA9 3OL8A 3W60A 3KOAA 3I0RA 4B3RF 4HACB 3CCTA 4AQYF 4X62J 4XO0A 2FC8A 2N3OA 2RU3A 2FVPA 3MAHA 1RHRB 2LXIA 3LH2S 3I9ZA 4OX9F 2Q1LA 2MJNA 1PYOB 4DF4A 4XIUA 5F8LA 2HNYB 2GFFA 2UXBF 4DEZA 3CC7S 1FK9B 3D1QA 3MHYA 3VGUA 1K47A 3E51A 4Y0FA 4NLWA 1IBMJ 4PABA 3FCVA 1KN6A 1M5PC 3CNQP 3HFVA 2AP6A 5KFMA 4DV1J 2YKMB 3OTDA 3R2DJ 3MR2A 2PFDA 2J9CA 5BR8F 1B64A 3RB0A 5C42A 2GX8A 2M70A 2XI3A 3HVTB 1VQMS 2R7TA 3NOCA 1WHWA 2F8EX 3HX9A 3BH6B 1BQXA 1YBTA 2ZE2A 3KKFA 4JV1A 5K8OA 2D3UA 5BYQA 2F4VJ 1HYSA 2OKQA 5E41A 2NUUG 2Y3YA 4EWTA 2ABYA 2R8IA 1M5HA 4OX6A 1ITPA 2PMHA 1CQMA 2DR6A 2E1AA 2EFGA 3CJKA 1X0FA 3CCQS 1G3OA 4KR0B 4O3NA 3DI6B 3EDQB 1Y3KA 2CNNB 3VR1A 4YDXA 1U48A 4QJVA 5THWA 3OTOF 2HRUA 4TKTA 3BH7B 4DV5J 3TUZC 1FF2A 1X60A 2CIMA 2HBYB 5HSPA 5KOWA 4J9KA 1HKAA 3MM7A 2DNZA 4PWWA 3KHLA 3LWLA 3M9OB 4KO0A 5IT0A 4AQYJ 2K3KA 4GVBA 1UZHA 2ATCB 3I6PA 1F9FA 2VG5A 4EUVA 3VALA 1A9NB 4HKQA 2L9WA 2VDHA 3D5MA 3HHLC 5H9FK 5F8IA 1SJ1A 3EVMA 2VASA 3CMES 4ETZA 2V68A 3E01B 2K3IA 2KFNA 3CIZA 3CTRA 2VA3A 4DLEA 4DSKA 2B7BB 1URNA 2HSEB 4AYBD 2OO4A 5LMUJ 3JAMU 4ZCIA 1LK5A 4DCJB 2CQCA 3AJ1A 1Q4RA 2DT9A 3V6DA 1M5VC 3OSNA 2EVZA 1SB6A 1HFEL 1NM2A 5K20B 1S4FA 4TU7A 4S0MA 3K5OA 2GIQA 1QSYA 4NLPA 4IFVB 2W4PA 3OUYB 3VVTA 2XWXA 2RQ4A 1W2BR 4BCAA 1JIHA 2KHDA 4LREA 5A8KA 2JLGA 3OBIA 1XQIA 2J0QD 2AHOB 3RBEA 5HMZA 4ELUA 3DCAA 5FD1A 4AUKA 2HWTA 1RAAB 2DGVA 3HHLA 4QYZK 1VC0A 1T05B 4DFJA 2DXDA 5LL6d 2P5VA 1VOMA 5AXKA 2NXNA 1P9YA 2M3DA 3D0HE 2R42A 2VJVA 2DH8A 3C15A 2IAJA 2CWXA 3M30A 3H8YA 3DOKB 1Q16B 4C11B 2ZBRA 1PBAA 4NLSA 1ZM2A 3RRHA 3KLIB 4LQ3A 2B43A 4ENOA 2MKJA 2P9GA 2MKYA 3PV8A 1CBKA 1YJWS 5KFTA 2ZHOA 5KFUA 2OPQB 5KG2A 4Q5VA 1UKUA 3I5BA 3NBPA 3VQTA 1G4CA 1EETA 1TL7B 1VLYA 1TL4A 3RB4A 2DR9A 3BBCA 3VAFA 1B4SA 4KAIA 2BYCA 3AT1B 3T5KA 2ZJPQ 1L3TA 3JQKA 4JOUA 3B4MA 4JI8J 2X1FA 3I96A 2KH9A 1S59A 4WFYA 2WB4A 4RW4A 3DFEA 1HWLA 1SVDA 4TQRA 4PG8A 1JB0C 3QO9B 5DQIA 2CJ9A 3C19A 4GMKA 3WQPA 3IBWA 1ZH5A 5EN1A 1UFKA 3M32A 3I0RB 2DHAA 3HDSA 3FKBA 2ZM6F 1TKTA 1ZYQA 1KFDA 4LSNA 3CJQA 2CZVC 3SEOA 3MR5A 1VC6A 4P52A 4K0KJ 1X5SA 5E7OB 3A13A 5KFEA 4UF4A 3RJMB 2V63A 3R6GB 3EPIA 4FXVA 2VQFJ 1ROFA 1R8CA 3CJRA 5HQMA 2XMAA 3JTPA 1RGVA 4PXCA 4P72A 3MCSA 4Z7YA 2GGPA 3KMSA 2H65B 1MROA 4RWWA 4B3MF 1IN0A 2VFSA 5C42B 4LF6J 1BWVA 3M9MB 1Q82T 1YK9A 3SDEA 4ID5A 2Y1RI 2DO0A 4F4AA 4YB7A 4QCLA 2VPZB 4QWDA 2R7UA 3GILA 2XM3A 2ZE2B 4DUZF 2BVZA 3TVZA 1HYSB 5I42A 2DK2A 2IBKA 1IKYA 2D9PA 4YDDB 2MYFA 2ROEA 2ROPA 2U1AA 3TJ8A 3KG4A 3DU5A 3GYXB 2QA4S 3C66A 2BJ9A 5FLXY 1WD6A 5L39A 2UUBJ 4A4JA 4HL9A 2RJZA 2MKKA 1FEEA 4Z2XA 3CJKB 2YQ1A 4C8NA 3CDAA 1N32J 3EZOA 5E3RA 2H5IB 1KLMA 4CH7A 1FA0A 4CYUA 1U2RA 3OL6A 1NZAA 2YWHA 1C0UA 5D4NA 4DSIA 3AJ2A 4RBTA 4Y65A 1G7CB 3DOLA 4U6PA 4K4ZA 3HHLD 3MM7B 2JX2A 2UUTA 4DPWA 1PAUB 2KXHA 4KO0B 3ADAC 4GVBB 4ZMMA 1FFWB 4DV6F 2IMOA 1SV5A 4OV6A 2VG5B 1KD1T 3KLEA 1HNVA 4BC7A 1S10A 1X4EA 4J9LA 3H7HB 1FE0A 4F26A 1H74A 2JEGA 3VWSA 2AW0A 1F60B 4USMA 3PKYA 3S6EA 4TU8A 4FKYA 3A8JA 2DXFA 2DTJA 3H4DA 5HROA 1X4DA 2AT1B 5RUBA 4EYHB 2EG1A 4DV7F 1LXJA 3V6DB 4F3OA 3GG1A 4WU3A 5K9FA 2JC1A 5KG0A 2Q3PA 2YNHA 3SSRA 5HO4A 1IR2A 2J9DA 4LIWA 2E7VA 4DV0F 4ZCLA 5F9NA 3FK4A 2CQ4A 5A8KB 4I56A 4OHWA 1ZM4A 2IMWP 1HI8A 4IOCQ 2GMHA 4A47A 2O01C 2XS5A 5KT4A 4USUA 3ZC4A 1OIAA 4C0BA 3HHLB 4XAKA 4YQWA 2IM3A 4NMLA 3MD1A 3KUGA 3MPVA 2C28A 4LBIA 5C5JA 1HBOA 2V6AA 3C15B 1B0VA 3H2UB 1VHIA 1OWXA 3M30B 1ZZFA 2E29A 3DDIA 2HFSA 5EWGA 5CYMA 1S72S 4ERDA 1J2VA 3IGVA 2XHCA 3HF5A 3HI9A 2F3JA 3I9V9 1RAGB 2RHSB 4F3MA 4I0WA 3RUBL 3T5JA 4KY3A 2XGPA 1LOUA 5AJ3F 3JYTA 1RBLA 2DGXA 1TELA 3NBPB 1RWNB 2XMVA 2WW4A 2MHEA 2JZ5A 1EETB 2D9OA 2V4JA 2YX1A 3IXQA 4O4GA 2QFIA 1VJQA 1Q95G 2CNLB 4IFYA 3HKZD 2G0IA 2P6SA 1JK9B 1HR0F 2G1HA 2N7CA 3RRKA 2UXCF 1U24A 2ZJRQ 3VAKA 1Q8BA 4OYZA 4QIGA 2ZOFA 2EBEA 5H1SV 2OSRA 1KTQA 1ZM9A 1K0VA 1WG4A 3ET6A 4QWBA 2W9BA 2OSQA 3PZPA 4RW4B 2HMIA 4OHYA 1Q86T 1VBXA 2RRBA 4U7UK 4ZITA 4YB5A 3N01A 1RE1B 2EK6A 2RSQA 2AYMA 3NNHA 3M32B 4NA1A 1D8YA 3ZZYA 1XR7A 3TO8A 3JSRA 2E9ZA 1QUVA 2C2RA 1TKTB 1FERA 2ZOMA 2GJ2A 2K1RA 5E3QA 3MWBA 1R8HA 3GIKA 2MKIA 3MR7A 4DR6J 3C8YA 3Q8SB 3CVKA 2A2CA 3J7YU 1VFJA 2Y1IA 2A2DA 1SJFA 3FMWA 2BQ3A 1CEZA 1S1WA 1WACA 3W2WA 2O1PA 2GGPB 2RILA 5GADI 1MROB 2D1CA 3UW1A 3DRRA 5IM0A 4YR3A 3GJTB 5ETSA 2BJDA 5AJ3J 2F40A 2KKHA 3SDEB 4ID5B 4DV2J 1Q78A 4DMZA 3M8YA 4LJMA 5CZVA 2R7VA 5J1EA 1T9XA 5I42B 3UD5A 1IKYB 3O44A 3HD2A 4N8OA 3PCOB 4FS1A 5LMNF 4OYXA 2R2SA 4B17A 3LGNA 3ZZ0A 1K0TA 5JMNA 4LF4F 2DRAA 3R5JB 1B0PA 2NS1B 3ELHA 2I2YA 2AZ3A 4OZ2A 2HPUA 1RWPB 2W9AA 2UUAF 2OD4A 2BACA 2DHGA 1GXTA 2HGNA 5KT2A 1KLMB 4NWBA 2QSWA 1S7IA 4CYUB 3GV5B 1RHMB 5J2NA 4UQGA 2MQMA 4XK8C 1C0UB 3H5SA 1CPZA 3DOLB 3NXZA 2MQQA 1RA7A 1APSA 4UW2A 2E7XA 4CO4A 4Q43A 1YQHA 4ZLJA 1SV5B 5CCMA 3KLEB 1HNVB 3QBCA 3GQCA 5F8MA 4PWDA 2V8PA 3IRXA 2PA8D 1VHFA 2Y1LB 2HFZA 2HQIA 2OHDA 4IO9Q 3QATA 4OYIA 3TX8A 4JV5J 1F6TA 1S97A 5HROB 1FXDA 4G1PA 4FPIA 3FBCA 3K5LA 5A2QU 1PKUA 1YIJS 2YWKA 4NZ0A 3W9JA 3TWZA 2KM8B 1FRKA 1HD0A 2XYPB 1IXKA 3D3CJ 2YNHB 1R6YA 3PKMA 5F3TA 1F9EB 1EX8A 2BKOA 3FZBA 4I6WA 3POTA 4UTGA 2V2ZA 1PCAA 3BQ2A 1T9TA 1YI2S 4OJHA 2V4QA 3VCDA 4MK8A 3SBMA 1KEKA 4JI1J 3VAIA 2IVFB 5IQQA 2XS7A 1ZAXA 2YWGA 4DQIA 3RAXA 2QA2A 2CXEA 2OP5A 4Y28C 3MDFA 1HBOB 2E5JA 1HNXF 3QSYB 3UDEA 4EK2A 3J80U 3OVBA 4MKYA 3UNYA 3QGIA 1RP5A 4PEOA 1H38A 2WB1D 5CYMB 2E5HA 2IRUA 3CO0P 2DEIA 2OMOA 4F4ZA 1UVMA 4XDCA 2J0SD 2PE8A 3U1MA 3JYTB 3CCRS 1FWPA 4ECUA 3UPFA 2B3TB 5K8PA 1F5BA 2DR5A 1RAHB 4RNOA 4O4GB 1PGZA 1XWLA 3MOZA 1NK5A 1RAFB 4IFYB 1VK3A 4DSJA 2LP4A 5HL7Q 5GAEI 2DNMA 1RWOB 3T9ZA 1TL5A 4ED3A 3NGKA 3L95X 4I4BA 2ZKTA 3NGSA 2CG4A 1NK0A 4BWMA 3BBFA 1NMEB 3ET6B 5IWAF 4AT1B 2LEBA 2EXUA 2HMIB 4ED4A 4NA2A 3CB4A 1FNOA 1RTIA 1SL2A 3NS6A 2KVQE 2V8GA 5T41A 1H0HB 4B02A 4KIAA 1WEXA 2J6SA 3NAIA 5KFAA 3NRBA 3R3TA 2H1YA 4ANEA 1JJHA 4TY8A 4URSA 5HVFA 2K1RB 4ZIVA 2LDIA 4ZVQB 1XNQJ 3MMBA 4FVMA 1K1QA 4YHHF 3AD7C 4KHPF 2DJWA 4O3PA 2RH3A 2FD2A 2BRLA 2HQGA 3MAQA 4ZVRB 4WIQA 2RRAA 2H5JB 1QSLA 1S5ZA 2ZD1A 1S1WB 4CLSA 3W2WB 4L75A 3L4BC 4KV8A 2RD5C 3KK1A 4C97A 3PO4A 5A6WA 4HHHA 4X66F 3PHTA 2M8HA 3DRRB 2U2FA 5IM0B 1VC5A 3ILLA 4U96A 2BUNA 2DGQA 1QAJA 2EFOA 4P73A 2NSBA 2YNIA 5J1EB 5D0HA 3JAMY 1D9AA 3KYLA 2FDNA 3BPDA 2DNOA 4J90A 4OYPA 1I94F 1S48A 4TU9A 2XMTA 2B4VA 4IG0A 2YXLA 2XZTB 1URRA 4N5SA 5B0CA 1YVFA 5LXRA 3FSYA 4L74A 2X3GA 2VOOA 2HQCA 1DZ5A 4PQUA 2RF2A 4D3HA 2YKPA 1EQMA 1BQNA 3PX6A 3N6LA 2DHSA 2HLTA 1RT3A 3T1HF 4OZ5A 1F0XA 1BXNA 1TV6A 4OJ3A 5J2NB 1U0SA 4A8SA 4B3SF 1L5UA 4DHVA 2J6UA 1XERA 2HBQB 4YY3F 3I5CA 3HCXA 1NDPA 5MLCV 4ED5A 4PG6A 2LQ9A 2VBXA 3KLVA 3G87A 3CMQA 5CD4A 2BJ3A 3KG1A 5KFRA 1VBKA 2JWNA 3US5A 1JXVA 1WC4A 4PWDB 2E1MC 3FVYA 1X5TA 2KFZA 1HNWJ 1ACMB 3PYFA 3NNAA 4RNFA 5J1NA 5KG5A 3IRXB 2E7WA 1CULA 4CWBA 2CAJA 4K7QA 1CSJA 2CZ4A 3KLFA 3PACA 4DPUA 4N56A 1VR6A 3W5YA 1KQGB 1XTZA 2XB2D 4EMDA 3LQVA 1FXRA 1S9EA 3HK2A 1FFSB 4DS4A 3DKDA 3D3BJ 2YPZA 2HVHA 2QLFB 2BM1A 5CHCB 2DNRA 2H4YB 1E6YA 4DQPA 2Z30B 4NMXA 1JJ2R 1YKWA 3R5GA 3H5UA 3CF5Q 3G4SS 4C3LA 5GAHI 3BQ0A 3POTB 3ENVA 1YDLA 5H9EJ 1HW9A 3QFWA 2FHOB 2FJBB 1T3OA 3QIPA 1NKCA 2C2NA 2FVQA 5D15A 2QC3A 4DU8A 1L3SA 4UZBA 1RACB 2HS0A 2NZ4A 3GFHA 3DHXA 4PQAA 4UY85 3IM9A 5M2PA 4E2FB 2YKOA 3EXCX 3GJSB 4UOFA 3W61A 1TU0B 1FNXH 2B0GA 4UOGA 4LSZB 2VD3A 2G9OA 4A8MP 4JI6J 2IFXA 5F8HA 5DS7A 3W63A 4C8KA 3GFXA 4WP3A 3SCLE 1HBNA 1OS5A 4LR9A 4J9RA 3VVUA 3M6WA 5U47A 2LXFA 3THTA 2KRBA 4NRTA 1VMBA 1T94A 2OPSA 1KSPA 2RHQB 1SPBP 3BV8A 1SKRA 2H51B 3T1YF 5BYRA 1B99A 1CLFA 1T02A 2UVWA 3TZZA 1M5KC 5CCLA 1EIYB 2DB1A 5KFZA 4ZCKA 1R3NA 5DJBA 1U49A 3KK2A 5L9XA 3PW4A 1PJ6A 1SIWB 2NXEA 1RTIB 4QR1A 5DM7Q 2EK1A 1ZPWX 2LQJA 3KHHA 3K17A 2FHMA 3CCWA 1TL3A 3TQ1A 2IM0A 5CABA 3B6BA 1NB2A 4HVZA 1YLXA 4I6AA 2GZOA 2M0GB 2LU1A 3OJSA 2VC0A 4C98A 2BOPA 4TY8B 3MEGA 1UMJA 5HQLA 3R5AA 1REGX 3MMBB 1VYAA 4IQXA 2ZEJA 2KHCA 2IPOB 2J0WA 1U1PA 2IVYA 4ZLPA 3H2LA 4BHQA 1N34F 3WIVA 2ZD1B 5EX0A 3B82A 2E5GA 5DDOC 3W8PA 4KV8B 1KP6A 2RDJA 3C2PA 4NLXA 2OUGA 4M5LA 2K7JA 2XMMA 3QGHA 2Z57B 1M1GA 3OFGA 1DTTA 4A8FA 2UU9J 3HHEA 4EO6A 2YNIB 3U02A 4USJC 1C4AA 5HMXA 3MM8A 1Q1KA 4WYLA 5H9EK 4Y00A 1K9MT 2WSEC 3Q8PB 2C3OA 4CH1A 4LRCA 4IG0B 2KT5A 1LFWA 3PJWA 2MZJA 3RAMA 2M9KA 1PJ5A 3AAWB 2W4CA 3CSKA 1RHKB 1UVIA 2P2CB 4NOHA 2VQEJ 1YGYA 3Q8QB 2RF2B 4PQUB 4LF5F 4KGVB 4JI4J 2HYIB 2ILZA 1X4FA 1KVKA 1RT3B 1VISA 4PXDA 3FGVA 1TV6B 1V9OA 2CFXA 3G2XA 2G2ZA 2CNOB 2FZCB 4Y3CA 2MZRA 3OL9A 1WDDA 2D69A 1NK7A 1NZ8A 4ZJLA 3S8SA 5KFWA 4Q8FA 4MAKA 3O6QA 2E1PA 3T5HA 5EUHA 2R7RA 3GCXP 2G2YA 1WHXA 3MEDA 1FDAA 2LYVA 4JUZA 1RZMA 1C1BA 3IR6B 4NZ6A 5ETLA 9RUBA 4ER8A 1CULB 4ECWA 4X4QA 1N36F 5ETOA 4ITSA 5D77A 4Z7CA 3TAQA 5CH7B 3KLFB 4FYDA 1GFWB 2W4DA 2CPHA 2N82B 4LFBF 4LVNP 4ED8A 5HI7A 1S9EB 1RLCL 5GADU 2BKPA 3EYZA 3JXOA 5AT1B 2Z8QA 1ULRA 2IRXA 1YBUA 1BWEA 5KG4A 4MKAA 1RWMB 1WG1A 4J9NA 1E6YB 4J9PA 2R2UA 1IM6A 1TK5A 1Y10A 4ED0A 2HGMA 1N8RT 2HS3A 2C1EB 2DNNA 2MGZA 4OZ3A 3D6TB 1C1CA 3QIPB 2MLYA 3ISZA 3HT3A 1HHSA 4C8LA 2XI2A 1RI7A 2B5JA 3MF5A 2COLA 1VQ9S 2W7OA 2HKEA 3M2VA 4CO0A 3DXBA 2FHJD 3IWXA 4LFAF 5L8RC 1XMOF 2AU0A 1AROP 1XR5A 4F4XA 1EQ0A 4ED1A 1GX6A 2WOMA 3C14A 4KGZB 1CVJA 5FJ4A 3LPEA 1WKKA 1F3FA 4G65A 2DNQA 1PC5A 4K4XA 4CH0S 4CDIA 2BQRA 3ILIA 2CZ9A 3KLGA 1HBNB 2FY8A 3Q8RB 4DCOB 2LLZA 4TN2A 3VAMA 4ZVFA 3GSDA 3R5BA 2R9LA 4DV3F 3M6XA 1NCLA 4A8XA 2QTWA 4OIXA 3MURP 3I82A 3JQMA 2YNFA 1TFWA 2A6MA 2OPSB 3F44A 3AD9C 3O3LA 2APOA 4OI4A 3D2WA 5HAOA 3D67A 2QT7A 2DYAA 2HK2A 2DIVA 4G3IA 1Q8KA 2JFKA 3K5PA 3RGIA 3AOCA 4DR5J 3KK2B 2ZH1A 4EBEA 3B4DA 4DX6A 1AUSL 3R97A 1UTAA 3SV4A 3UE2A 4C48A 2QFJA 1KHVA 4PR6A 2XCPA 1IBKJ 4JYAF 3P4UB 1TL3B 4M95A 3MTJA 3RW7A 3EZUA 2QL7B 2UZAA 4K2JA 1KHWA 3EGVA 1SJ3P 3AFGA 2KXFA 2JFDA 2ZOGA 3MEGB 4JI5F 4QOTA 2VC1A 3IC1A 1TKXA 1QDUB 2BE2A 1KKHA 3OVAA 3FBFA 2HLUA 4C8OA 3MR6A 1U1RA 1C0TA 3LPYA 1R8AA 1N33J 5KFYA 1W25A 2KFYA 3HVRA 5D4OA 1O0PA 1K8AT 5HP1A 1UEVA 4X4VA 1WI8A 1U1OA 4WIIA 3V81A 3QRRA 2CWKA 3N6MA 5DDRC 4OX7A 3TEHB 2V67A 3QGPA 4MH8A 3AA8A 1FJGJ 1NJZA 3IAS9 1U2FA 2HURA 1DTTB 1VLOA 1YZ7A 4KT0C 1S0NA 3TZWA 2J9EA 3GR0A 3H20A 1QTNB 4EBCA 9ATCB 3KHGA 4B08A 4NXMF 3MM8B 2XYGB 1NSPA 4MT1A 4ZVGA 5SUHA 3GWCA 5ETVA 3L7PA 1EKSA 2UUCF 2BJ7A 1HQEB 2UUWA 2IJNA 3D6MB 4NLRA 2VA2A 3BGOP 3BO3A 3UD3P 2LECA 1X9WA 1EARA 2AYBA 3Q23A 2B6AA 3IMQJ 1NJXA 1L3KA 2GAHC 1UWAA 1B7FA 2XEXA 1VQ4S 4RX6A 1CJVA 5DDPC 3UCUP 1TK0A 1KRPA 3HMJG 1UFWA 1UVLA 4WPAA 5FIIA 5L1JA 4WBFA 1MLAA 5IV3A 3EZ5A 4X65J 4DPOA 1HHTP 2AEMA 1L3UA 3J80Y 3MEDB 2O67A 4L3NA 2D7SA 4YB1P 1C1BB 3O8WA 4HTIA 4Q2MA 2KTQA 4IO1A 2CJXB 2UVVA 4WTYA 2OPPA 1G6BA 1KQKA 1M1KT 3EM1A 1WHVA 4OHZA 3LTOA 2IM1A 2XG8A 1C4CA 3HSJA 4NE9C 4DR1F 3IN5A 1NPRA 3HVWA 5C25A 4OZJA 2QLXA 4A8WA 3HSDA 1UJ6A 1ZAWA 5AE3A 2MXYA 1D8ZA 3M7VA 2HVEA 3SCKE 4MIWA 1NJIT 4I64A 1V3SA 5KFBA 4IYQA 2WVEA 1RAIB 1KS2A 3IO1A 4UUXA 1U1LA 4L3KA 2DBBA 3CUNA 2MGZB 5KFVA 3HZGA 1UCNA 1JWWA 4ECVA 1C1CB 1RT7A 1MN7A 2B5JB 5IV4A 1CG2A 1D3WA 2QZ8A 2OTLS 3M2VB 2AV5A 1HWIA 2MLZA 2DGWA 4PG7A 1V5VA 3E2EA 1Q7YT 5M2UA 2CJQA 1VS3A 4RNNA 4DG1A 3MD3A 3DMJA 3NS5A 2WOMB 3DRYA 3C14B 4UQTA 2QSFA 1NUEA 4J9QA 2W8LA 2QV6A 2ADBA 4GKKF 5DLFA 2E1CA 3U7JA 4UOHA 4QYRA 5L1KA 3OT9A 2CJYB 3QWUA 4XPCA 3KLGB 3V6HA 1S6PA 1X9MA 2LKZA 4DL6A 1LNQA 3LGMA 1TQLA 3H4BA 4M5DA 1OPZA 2Q6CA 2QLBB 3J7Z5 3UR0A 1X4GA 3F41A 2YNFB 2MQNA 2ZNZA 3PYGA 1QD1A 3G71S 1R27B 5B0AA 3TA2A 1WORA 4ZPVR 1IKVA 4TXSA 4C3MA 2ZWOA 4NLGA 3I0SA 3WBZA 1S0VA 4RUCA 4TYAA 3TJAA 1Q8LA 4Q45A 5B7WA 4HH0A 5LJ3Y 1N0UA 4DR3F 5K5MA 4KYZA 1JX4A 4DN9A 1KWMA 4CO5A 3VGTA 4NI2A 2LXUA 1EJ7L 2Q66A 1J5EJ 1U1KA 1X4HA 4E0DA 1MMNA 1REVA 1WOSA 3HHNB 4ZPTR 4URQU 2R8GA 2F5GA 4DL7A 1KTVA 2VONA 1SC4B 2WVFA 3C6UA 4QBUA 1S6QA 3OXFA 4ICLA 1M5SA 2EPIA 4M5HA 2DGSA 3JTNA 5GAHU 2Z0GA 1FJCA 4DR7J 1IJFB 4LF9F 1XBWA 5KG7A 1TKXB 2AKWB 4Q2LA 2MZ1A 2BE2B 3MUMP 4BBYA 3A8EA 4B9MA 4EZ6A 2KB2A 2OLWA 4IQMA 4P6QA 2ZFHA 3UN2A 2ZZMA 4JI3F 1HWUA 1C0TB 3A1YG 4ZK7M 1JJ4A 2UP1A 2CPIA 3ISND 2J0XA 5HP1B 3P5TL 3AXKA 4ZOSA 4ZJQA 5C24A 4YS2A 3DRXA 1OYDA 3V81B 1GNKA 2FZGB 2GA7A 2VICA 4R0JA 4QPXA 3SCJE 2RE1A 1N5YA 4YFUA 2A18A 4I67A 3R7NB 2AWZA 3SV3A 1SCJB 4LRAA 1O5JA 2JHEA 4L76A 1BD6A 2GQCA 2DRBA 1JLQA 3DU6A 2K8GA 5M2RA 2OAUA 5GMDA 2BW7A 2EC0A 5KG1A 3GIMA 2ZUGA 3MM5A 1YTYA 1AUDA 2HS4A 4FP9A 2VF3A 4X62F 2Y9HA 1OMSA 2HHHJ 2BEFA 2PIIA 3UDVA 2B6AB 5EWFA 3HZEA 4V1Ak 1LEOA 2CQHA 4W90B 2OFGX 1NH7A 3AOAA 3FQLA 2FGCA 4AL5A 1CJVB 1FKPA 3MFIA 3QAEA 1XMBA 1HLWA 3TUJC 2QEXS 3BR8A 5GVQA 1IBMF 3I56S 1ZTTA 4WK3A 4ECRA 4Y2MA 3N5FA 4LVOP 2B9YA 2HAFA 2IYIA 3G6XA 4HI1A 3VGVA 4F4YA 2JLEA 5ETMA 3TUPA 1WF2A 5LXYA 2XMJA 1VQ7S 2OPPB 3CWJA 2FGOA 1P9QC 1S1XA 4JI3J 1HNIA 3I55S 2QX0A 3BR9A 1W2IA 2B51A 2F4VF 3V4IA 4ILMA 2QL9B 1HNZJ 3SSSA 3EE3A 3FMBA 3CD5A 3KTQA 3I31A 3TI0A 4Q0BA 4LBHA 3BBBA 5C25B 2HEKA 5GAGI 1FX4A 1NK9A 1WWHA 2ZZNA 2POKA 3D68A 5EWEA 4LFCJ 1QLNA 5DLGA 2ZH5A 4Y6IA 1DHMA 2FHKA 3MTKA 4HDHA 5I3QA 4DV5F 1XJWB 1S49A 4ZHRA 5DQGA 3X1LB 3T41A 1TL1A 4QIFA 4HHUA 5GMKa 3T19A 3OVSA 3CO9A 4DQSA 2C3YA 1VQNS 3NLCA 4LMZA 2MY8A 3B78A 4DPYA 1GMWA 3CCUS 2DISA 2HNDA 4KQZA 4ZLLA 3CDEA 4KH0B 1U6ZA 4DFKA 4DG1B 3DMJB 3EWGA 3ETOA 4Y2CA 5J2MA 4AE5A 3G82A 3M8QA 2YKNA 3RYLA 1FRXA 1VQPS 4N41A 1RWKB 4USVA 2KG1A 5CQGA 1Y00A 4ILLA 1MN9A 5KG3A 4ZJOA 5LMUF 3IWNC 2HZVA 1Q53A 1S6PB 3M8ZA 4A8OA 2HG4A 1T8EA 5ETPA 4ECXA 1HPZA 5F0WA 3IRWP 4MIAA 1JXLA 2KO1A 3GFZA 4WTOB 2W9CA 4CM0A 4USHA 1BMQB 4MKVA 3CJSA 3VZHA 4AL6A 1IKVB 1NK6A 2ZVSA 3I0SB 2BDPA 4GVLA 1IUJA 2CJKA 3PFOA 2AYEA 3OR2B 2ASYA 3DOMA 2CPXA 3LP0A 2GIRA 4CRJA 5A6PA 2PDAA 3CW2C 2AX1A 3P6YC 4NI2B 1VGYA 3VGSA 2ZH9A 2FLOA 3ENWA 1REVB 1VQOS 3H5XA 2BE9B 3HKWA 4FXDA 5KFNA 4FN5A 3C6UB 3NG8A 1T9VA 1S6QB 4ICLB 2M2BA 3ILOA 3Q0AA 2EKYA 2LEAA 3RR7A 3SZ2A 3OTCA 1H3DA 2GJIA 2HIYA 3BN4A 3QQCD 2MKHA 1Z1ZA 3ENQA 2L08A 1RWVB 2PO4A 4YR0A 2XLJA 1Q79A 2ZDPA 4KGKA 4DPTA 2XWYA 4FYXB 1FJEB 1WC0A 3BKTA 3D28A 3EVOA 3PRVA 4RLEA 4QW9A 2O3DA 1X4AA 1JNRB 1YG0A 2I0XA 5C24B 4PKDB 3NGTA 4I2QA 3G86A 4NLOA 5B08A 1FD2A 2AF6A 3QIDA 3U1NA 2VBZA 2D3O1 1N5YB 4JI8F 4RWXA 4IOBA 1U1NA 1O8BA 3L3CA 1XMQJ 1RBAA 1TTHB 3D7SB 4XPEA 2BRKA 2QN6B 4ED6A 4B9NA 1MWYA 4ILRA 2NZCA 1JLQB 2ACYA 3NY0A 3TNVA 5KT7A 4JI2J 4IH7A 4QW8A 4N76A 5DQHA 3MM5B 1U45A 4CIOA 2KJWA 3HM9A 2HVDA 3W64A 2FVCA 1UA0A 5D0GA 2ZH6A 1QVFR 5ETTA 3BSOA 3QNWB 2BA9A 1WEYA 4OJGA 4K0KF 2KG0A 2BOAA 1FKPB 1KOHA 1VRTA 3PHEA 3PJ9A 2RDIA 2W8KA 2MKSA 4FZVA 4TY9A 2VQFF 2VPWB 1HBMA 3K8WA 1RAOA 5J2QB 3W66A 4DFPA 1GK8A 4ZVSB 2CG8A 1ZA1B 3LAMA 3KG0A 4LF1A 2E66A 1FESA 1GMWD 1X4CA 3OLAA 1F5AA 1X5OA 4Q7AA 2LEPA 4IKAA 1UVNA 1PJ7A 2IC3A 4LF6F 4OYOA 1ZETA 5F9LA 1LXNA 3CJ2A 4HDGA 1S1XB 5CA5A 3TAPA 1HNIB 1T03A 1P27B 4NCBA 2KVIA 1P6TA 4MTPA 3ZTRA 4M5JA 3V4IB 2XBPA 4OHXA 5J2PA 5KFDA 3KFWX 1FX2A 1BHNA 5L38A 3K5NA 4Q0BB 2ZH3A 3RW6A 5DZ6A 1XEZA 1RHUB 2Z4PA 4J9UE 2UUBF 2GHWA 5D0RA 3UCGA 2LFVA 2W7PA 4WCEQ 2BABA 4Q8EA 4C7QA 3J7ZT 4R8UA 1NLKL 1N32F 3EICA 2AGOA 1FWLA 4DQRA 1RHQB 1S57A 1WI6A 2MPUA 3MMCA 5D6GA 4ES3A 2A10A 2WBRA 2D74B 2C2MB 4H4KA 3KXDA 3LP2A 1U2CA 1MU2A 2DNHA 3HLUA 4ZHRB 3MPDA 2R7XA 1WDTA 4C3KA 1U8WA 1TL1B 4LRDA 4DV4J 4IH5A 4AXJA 4OFZA 4EO8A 2YH0A 1J5OA 3LA0A 1RT4A 3GJRB 3BPSP 4WU2A 5DZ7A 1WEZA 3NOGA 2RMLA 1PBUA 4I1TA 4FF2A 3HT0A 2M8DB 2HNDB 2V0NA 3PYEA 5KFXA 4QPTA 1ZM3A 1H2TZ 3UO0A 2HRYA 4JV2A 3ZZOA 3HULA 4RUAA 1UWBA 2G0CA 1JLAA 3PG9A 2IHR1 5J2MB 3G82B 3M8QB 2YKNB 2H3EB 3LANA 4JI0J 3HFKA 4K8RA 4LR8A 1IBLJ 5FDLA 2HZAA 4X64J 4NASA 4KPCA 1PSDA 2DKOB 2K06A 3WX4A 4EGLA 4XTTA 1WJ9A 1VQYA 1HPZB 2YQ0A 1SQGA 3BYPA 2ROGA 5ETNA 2RB7A 5FLXU 2W9CB 2M52A 2CPZA 4M1KA 5IQ6A 2CYYA 4RNHA 2OH2A 3PRBA 3VAJA 5KFJA 3AHPA 4LSLA 5B0DA 1Y3JA 4X84A 2YVSA 3DOMB 4EU0A 3LP0B 4RR5A 5LT5A 3CJ8A 2BJEA 3LALA 1RCXB 1MWQA 3KWMA 1RHJB 1LWEA 1XNRJ 3MCNA 3I87A 1I6JA 3ITHA 2M4MA 2HAIA 2GO9A 5IC6B 2QMWA 3UI3A 4DF8A 5KAKA 2ZH2A 1RYRA 1YX2A 2KM8C 1DY3A 2LMIA 4YMEA 3TAMA 1RCOB 3ZFVA 2W01A 3J81Y 4RU9A 2LQ5A 5HJYA 4EYIB 2CADA 1S9FA 3BN7A 4X4OA 1ZAVA 4O23A 5DO2A 2AEFA 4KPYA 1Y0HA 4U7CA 2EFQA 3K2YA 2I6WA 1TFYA 3CCSS 3W5ZA 4TNOA 3PW5A 5KFSA 2QIFA 1BLUA 2CRLA 4F0HA 2DH7A 2CQGA 5F41A 3EGWB 4I2QB 1JLCA 2DCUB 3B8HA 1QAIA 3MUTP 1NEEA 2C3PA 4ZPDA 4F67A 3PEHA 2QJ3A 1QTMA 2C3MA 1EHWA 3G6ES 3TVYA 2ASJA 1RAJA 1B70B 2W2QP 3SCIE 5MAOA 4G6VB 5HVHA 3AOBA 3PW7A 1UEKA 2V8HA 3BO4A 1D09B 2CJBA 3CJ5A 3A12A 1NK8A 1XC9A 3GSIA 2E5LJ 3SFGA 4EI2A 3R5DA 3AB2B 2DY1A 4U67Q 3LGHA 2F1FA 2YQ3A 3W5XA 3AH6A 3IFEA 3M8PA 1UZDA 3CXCR 2VU5A 2XYHB 2HNYA 1FE4A 1NSQA 4DR6F 1VRTB 4CZCA 2BBEA 1WNEA 5IT9Y 1U6FA 4KHRA 4PWUA 4GRSA 2NXCA 4I69A 2PMZD 1HBMB 5KFIA 2IAJB 1H72C 4DL0C 2A1BA 3KJVA 5E3AA 3HPOA 4DDFA 4ZDNA 1QM9A 1YRTA 4HHJA 3PIOQ 2GW8A 4ATNA 4DJBA 2GJFA 2I5JA 1O6XA 2IC3B 4MJKA 1LW0A 3EMTA 4DV2F 2EEYA 4WYWA 2HRTA 4KGMA 2X1BA 4B3TF 4F2RA 1T03B 2CJAA 2XMWA 2WCXA 2HHWA 1OQ6A 3C6TA 3SIPB 2JRSA 2UV8G 2MLXA 2RKIA 5J2PB 3FDSA 3DLLQ 5K8NA 1WHYA 5K8MA 3CJ3A 3U1LA 2IJRA 1TR0A 5KFOA 1DRZA 1VRQC 3PVXA 1RWUA 2PN6A 1S7HA 4G1IA 3CEDA 4R8UB 1HHQA 3V6JA 1T9UA 3IR5B 4NRUA 1GMUA 1MMDA 3MMCB 3MEEA 2CQPA 1RTHA 3CC2S 4OYMA 5CZXA 2R7OA 3DM2A 4YN3B 3LP2B 1MU2B 1VI7A 4DR4J 1Q8IA 1JMTA 2ZKUA 4ZP6A 3Q22A 1QAXA 2IA0A 4ES2A 1J5OB 1RT4B 2F4FA 1YRUA 3OFFA 4NEZA 4LSNB 4DR2J 1IQZA 3RB6A 4FNHA 3GONA 3U27A 2GS8A 4QU6A 2M5YA 3HD1A 3MZIA 3K57A 4X4NA 3CD7A 3QZ8A 1UWBB 2HFUA 1JLAB 3R1LA 2Q79A 2ZBPA 4CLWA 3T1AA 3NMRA 4DI6A 4ZS6A 4JV5F 2NCKL 3QSIA 3W8GA 2NPIA 1AYEA 4DSEA 5LOQA 5LSLA 5FDLB 2D3OR 4IOAQ 5T14A 2JOQA 2C3UA 1TVRA 3RG6A 3PRDA 4WKRA 2HQ3A 2DCLA 2BQUA 4K4UA 4B3TJ 2RS2A 1LWCA 2D3ZA 3M1VA 1IKXA 4FXWA 3DYAA 2VBYA 3C46A 2VUGA 4ZVTB 2HHSA 3D6FB 4F0KA 3T3FA 2BZ2A 4OLPA 2B9EA 3BM7A 1T0TV 1H73A 3OJUA 3OTBA 1LWEB 4AD6A 5B0GA 4JI1F 1F2HA 2FVSA 5GAGU 1FRHA 3ITHB 1WSRA 3KNGA 1CJUA 1ZOTA 4X2BA
chains in the Genus database with same CATH topology
4M95A 3MTJA 4AFFA 3RW7A 5JJBA 3EZUA 3V5RA 2ZM6F 1PC4A 1TKTA 2MZQA 2UZAA 1ZYQA 1DQAA 1DARA 1KHWA 1RK8A 2KJVA 1KFDA 1KLNA 4J37A 4LSNA 1IM4A 2W24A 1R8PA 1UJ5A 3LP1B 3ZZUA 2QA1A 3NCRA 1UFLA 2CZVC 1SJ3P 2ALZA 2KXFA 1QY7A 2JFDA 1U25A 5AXLA 3SEOA 2ZOGA 1M0SA 3MEGB 3TAMB 4QOTA 4JI5F 1RT2A 2VC1A 3MR5A 1VC6A 1QJHA 4NLUA 1X5SA 1DAXA 3IC1A 3PR5B 1BGXT 3BGUA 2D41A 1TKXA 3IAM9 5E7OB 1G1XA 2BE2A 3T6JA 1HI0P 5KFEA 3AQPA 3DNCA 2J7UA 3FSIA 3OVAA 4DSLA 2HLUA 3EPIA 4FXVA 2CPJA 4YR2A 1QVGR 1ROFA 3PNIA 4C8OA 3MR6A 1R8CA 1U1RA 4OX8A 4I7FA 3N28A 4WFBQ 2DVIA 3FCHA 1C0TA 3LPYA 3JTPA 1RGVA 1R8AA 3VAHA 2ZBIA 4PXCA 3PEJA 4NLDA 3MCSA 5T7LA 2GGPA 3KMSA 4ZPWR 5KFYA 1KQFB 4K50A 1W25A 4O3QA 2KFYA 2ZNYA 3HVRA 1MROA 5D4OA 5H9FJ 1U4BA 2JEFA 1O0PA 2EI5A 2HHUA 1K8AT 5HP1A 1UEVA 1Z4UA 4O0IA 2CPFA 4RWWA 4X4VA 4B3MF 1VIXA 1IN0A 1WI8A 2YH1A 2VFSA 1U1OA 4KKOA 4WIIA 3V81A 4WK1A 1KONA 4CCHA 3PXGa 3N6MA 5C42B 3M9MB 2J9DE 1Q82T 5DDRC 3SDEA 4ID5A 2VH7A 2Y1RI 3KLHA 4DWIA 1FTCA 2DO0A 4OX7A 3QGPA 4YB7A 4MK7A 4MH8A 3AA8A 4QCLA 3CD6S 1NJZA 1JLCB 3IAS9 2VPZB 1U2FA 1DFDA 1ZTWA 3JSBA 1RKIA 3QLHB 1OSCA 5AXMA 1RKJA 4QWDA 1DTTB 2R7UA 4ELVA 4C9DA 4KT0C 4MKBA 1S0NA 3GILA 1NKBA 1VIOA 2ZE2B 2WAQD 2J9EA 4DUZF 4IRCA 4Q44A 4WXWA 2BVZA 3TVZA 3H5YA 1HYSB 3GR0A 3H20A 4EBCA 2W7AA 5I42A 4ALZA 1DBDA 1NK4A 2DK2A 4DSFA 2IBKA 1IKYA 1N88A 1U26A 3KHGA 1X4BA 2D9PA 4YDDB 4B08A 4NXMF 2MYFA 2ROEA 2ROPA 2U1AA 3KG4A 3HHDA 1TK8A 3MM8B 3DU5A 3GYXB 1CC8A 2QA4S 4ZKAA 1DTQA 4ZVGA 3C66A 5SUHA 5DGBA 3DLBA 3GWCA 2JLFA 5FLXY 3DLJA 3L7PA 1WD6A 5KFFA 3EX7B 5L39A 2FPHX 2IRYA 4ID8A 2UUCF 1HQEB 2UUWA 2IJNA 4NLRA 1HD1A 2VA2A 4Y2AA 3BO3A 4A4JA 4HL9A 2RJZA 5HBMA 2MKKA 1YBAA 3UD3P 1FEEA 2LECA 4Z2XA 1X9WA 3CJKB 4C8NA 3CDAA 2VPXB 5KTQA 2AYBA 4BS2A 3CMAS 1DJ0A 2YNGA 3OV7A 1NU4A 2GCFA 3Q23A 1X8DA 3W7BA 2B6AA 5E3RA 2ATLA 2JDJA 3M9NB 5B0BA 2GMJA 1KLMA 4CH7A 1FA0A 3NCPA 1NJXA 1GTHA 2MB0B 4IG3B 1L3KA 4CO1A 4IR1A 4X4UA 2XEXA 1U2RA 3OL6A 1VQ4S 4RX6A 1NZAA 1HBUB 4FF3A 1B7FA 3M8PB 5DDPC 2YWHA 3BGRB 1C0UA 3UCUP 4QYZJ 1TK0A 5D4NA 1XNQF 1RT7B 4DSIA 3AJ2A 2NXUA 1KRPA 3HMJG 1SXLA 4RBTA 1UFWA 1YJNS 4Y65A 1G7CB 1UVLA 3DXSX 3DOLA 5FIIA 4DX8H 4U6PA 4K4ZA 3HHLD 3MM7B 5L1JA 2JX2A 2UUTA 2XS2A 1IJEB 2KXHA 4KO0B 1HWKA 4ZMMA 2KN4A 1FVSA 3Q24A 3DLEB 5KFHA 3EZ5A 4DV6F 1U7LA 2IMOA 3THVA 3K58A 1SV5A 2V9WA 4DPOA 1HHTP 2VG5B 2MSTA 2GQ2A 1KD1T 3KLEA 1HNVA 4BC7A 1S10A 3TW0A 3KJVB 3M6VA 1L3UA 3J80Y 1X4EA 3E3XA 2B4UA 4J9LA 2PI5A 3MEDB 2O67A 5B0EA 2FJDB 2OMLA 1FE0A 2I9SA 4F26A 4L3NA 2JEGA 2PA3A 1FO1A 2D7SA 4YB1P 1C1BB 3O8WA 4HTIA 2H9ZA 4I2PA 4Q2MA 3VWSA 2KTQA 1HQUA 4IO1A 2GO8A 2F8MA 2AW0A 1ZBTA 2UVVA 1VBYA 2YX4A 4WTYA 4H4OB 4WZMA 2K2PA 3LW5C 4J9OA 2FLNA 4BWJA 2OPPA 1F60B 3CIMA 4YP3A 2I5JB 4J5OA 2QMXA 3R5CA 1G6BA 1KQKA 1M1KT 3NAHA 3PKYA 1WHVA 3S6EA 1JLBA 1LW0B 3DN9A 1LQ9A 4TU8A 1E6VB 1VQ6S 4QR2A 4ECTA 4OHZA 2E9RX 2DTJA 3MGJA 3H4DA 2IM1A 2FJVA 2F8HA 2XG8A 1C4CA 5HROA 1X4DA 4BC9A 2V4JB 3N4WA 3GV8B 4DL3A 1XMQF 3C6TB 4WKYA 4EYHB 2BR0A 4FF1A 1SBRA 2V8DA 2RKIB 4CO2A 2EG1A 4DV7F 4DR1F 3IN5A 3CPWR 1LXJA 3JSYA 4M5DB 2F7VA 3HVWA 3OPKA 4QIEA 3V6DB 5C25A 4OZLA 5JVHQ 3OSPA 4F3OA 2ZC4A 3MOJB 3GG1A 2QLXA 4OZJA 4WU3A 4Y2IA 4A8WA 5KT5A 1CQNA 4OQJA 1UJ6A 1ZAWA 5AE3A 2MXYA 4F4KA 1VRUB 1D8ZA 3TA0A 5KG6A 4O3OA 3HJFA 1RTJA 2KT3A 1Q7LB 1HI1A 5K9FA 3MI7X 3SCKE 1SUQA 3M2RB 2JC1A 3MMJA 4MIWA 4JI2F 1S1TA 4K5SA 4N8NA 5KG0A 4YUDA 4I64A 1V3SA 2Q3PA 1NJIT 5BYSA 4K4VA 5KFBA 2YNHA 1TUVA 1HQEA 2AYGA 4IYQA 3SSRA 5HO4A 1IKWA 4IH6A 2J9DA 2ZHBA 4LIWA 2EFPA 4DV0F 1KS2A 4RBVA 4ZCLA 4B9UA 3IO1A 5F9NA 1TP7A 2DO4A 2W9BB 2CQ4A 1NO8A 2WONA 3MECB 5A8KB 4I56A 1FTRA 4OHWA 4UUXA 2SXLA 1U1LA 1ZM4A 1MMLA 4F2SA 2CKWA 2IMWP 1HI8A 2DBBA 2WTFA 3CUNA 2MGZB 4IOCQ 5KFVA 2CPDA 1X0PA 3HZGA 1S79A 2GMHA 3FRZA 4A47A 3G6YA 2O01C 2MMYA 3R1HA 4KTQA 2XS5A 1JWWA 3GIJA 2FUG9 3MEEB 5KT4A 1C1CB 4ECVA 4FBTA 3ZC4A 1RTHB 1OIAA 4MMOA 4C0BA 3DM2B 3HHLB 5KFQA 1Y5IB 4H4MA 4I68A 3W2VB 4FBUA 1RT7A 4XAKA 4YQWA 2IA6A 2IM3A 4D3GA 3N9UC 4NMLA 3MD1A 2B5JB 3CCLS 4OJ1A 1CG2A 3MPVA 3IA0A 3TANA 5C5JA 2C28A 3PX0A 4W92B 1D3WA 1HBOA 2QZ8A 2OTLS 3M2VB 2AV5A 1HWIA 1JLGB 1L3VA 1B0VA 3H2UB 5CXTA 2DGWA 3HVAA 2ASLA 2AGQA 1QE1A 2RQMA 4PG7A 1OWXA 2J7KA 1ZZFA 3M30B 4K2XA 4RW6A 4CNZA 2C2EA 4OI0A 3E2EA 1Q7YT 2E29A 5D4PA 1TKDA 5M2UA 1KNZA 4PG5A 4LT6A 2CJQA 5CYQA 3NKYA 2LDYA 1VQLS 5EWGA 3GMGA 1VS3A 5E2QA 3R27A 4RNNA 4DG1A 2ERRA 3MD3A 1OO0B 3DMJA 5CYMA 3BJYA 4P7TA 3DLGA 1S72S 3NS5A 3OQ2A 4ERDA 1J2VA 1BQMA 2WOMB 4M94A 3DRYA 3IGVA 4UQTA 3HF5A 3HI9A 2F3JA 2P9EA 3I9V9 4WFNQ 3G8TA 2QSFA 4RU2A 3DLHA 4F3MA 4I0WA 4LQ9A 2W8LA 2QV6A 5CYJA 4J9QA 3RB3A 2ADBA 1HNWF 4GKKF 3KNAA 3T5JA 5DLFA 2XGPA 2E1CA 3U7JA