2F9DA

2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA branch site protein p14
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9dA01
1A7GE 2YWKA 4J5OA 2KM8B 1ZZFA 2K8GA 3RW7A 2KM8C 3SDEA 2CPIA 1G2EA 2LXIA 2CPDA 2LEAA 2MJUA 3DLLQ 1KOHA 2DH7A 5DDOC 2LQ5A 2Q79A 1VQ4S 2J76E 5GMKa 2DNRA 3VAIA 1VC5A 1VQPS 2EVZA 4U67Q 3BEGB 2DO0A 1XN9A 1UAWA 2CQ1A 2NZ4A 1JMTA 4Y0FA 2DIUA 2B0GA 2L41A 2AYEA 1WHVA 1M5PC 2MKKA 5GVQA 2DHGA 2LXUA 2CQCA 5FJ4A 4CQ1A 2G4BA 4UY8T 3CMES 5LSOA 2JX2A 2L9WA 1D8ZA 3CC7S 1FXLA 1VQ5S 2J8AA 4ED5A 1WG4A 5D78A 5BJRA 1WF2A 1X4GA 1BY9A 2KHCA 2QA4S 2ADCA 3ZZZA 5MLCV 2MYFA 2RRBA 4A8XA 2DNQA 1X4DA 3EGZA 1S79A 3G4SS 3BO2A 2DNYA 3CCJS 2XNRA 4QPTA 3CF5Q 4C4WA 3U1MA 5DM6Q 2XS2A 5DDQC 4F25A 2JRSA 2M2BA 2XSFA 4C0OC 3RW6A 2DGXA 3D2WA 2QEXS 1DRZA 2CQGA 3NMRA 4V19X 1FJ7A 2RQCA 1B7FA 2OTJS 2MQLA 2MKSA 2M52A 2KRBA 5LXRA 2DITA 5JVHQ 3CCQS 1WG1A 2LYVA 2DNHA 4F26A 1AUDA 2KH9A 4YUDA 2MGZA 3VALA 2V94A 5HO4A 3G96A 4CH0S 2X1AA 1X0FA 4W92B 2J0QD 2RS8A 1VBZA 3S6EA 4WCEQ 1QM9A 4TLQA 1X5OA 2EK6A 1NO8A 3CCUS 2CPEA 4PKDB 2U1AA 3MXHP 2JWNA 2CJKA 3MURP 3EX7B 1R8HA 3NNAA 1YHQS 1DHMA 1N8RT 2MQPA 4QQBA 2E5IA 2MSSA 2D9PA 5JVGQ 2I38A 5DM7Q 3TP2A 1U1LA 1U1RA 2UP1A 3EGNA 2VONA 3PIPQ 4OZ1A 3TO8A 3CCMS 1O0PA 2AYBA 2CPJA 4ZKAA 2AD9A 2DNLA 4TU8A 2KN4A 2OTLS 1Q82T 1WEZA 2ZJRQ 3CD6S 2DGTA 2HZCA 1YITS 2KRRA 1HD0A 3G8SA 2MHNA 2BOPA 3CMAS 1HA1A 3MDFA 3CCES 1YI2S 2LKZA 2J0SD 2DGQA 3BS9A 3VAMA 2O3DA 1QVGR 1U1OA 2CQBA 1VQLS 1KQSR 1JJHA 2RUGA 2KG0A 3CC4S 2KXFA 4RU2A 1CVJA 2LECA 5IM0A 3K0JA 3MUTP 1WWHA 1KOOA 3S01A 2X1GA 1YIJS 1WF1A 2KFYA 2MMYA 2FPHX 3CXCR 1WI8A 2HVZA 4IOCQ 4QU7A 3G6ES 3LPYA 2RVJA 4OZ0A 1VQ7S 2XS5A 2ERRA 1HL6A 2LA4A 1K8AT 1X5SA 2WBRA 1A9NB 2FC8A 1OO0B 1WEXA 2KYXA 2LA6A 3CC2S 2MB0B 2KT5A 2RT3A 3OW2R 4WFAQ 3B4MA 1N88A 3UCGA 4FXVA 5LJ5Y 2N3LA 1U1QA 2VOOA 1M1KT 4WKRA 1FJEB 3VAFA 3V4MA 2KG1A 1VQ8S 2KU7A 2DGVA 2ZJPQ 1WEYA 1WHXA 3UD4P 2GHPA 2VOPA 1KD1T 5CA5A 3G71S 3UE2A 3MD3A 4YOEA 5IQQA 2E5GA 2G1DA 1VBYA 3H2UB 2OSQA 1VQNS 2MKJA 1WI6A 2MZQA 1R8PA 2DNPA 3L3CA 2XS7A 3VAJA 2FY1A 1ZZNA 4LMZA 3U1LA 3G9CA 2MKHA 5DETA 2ZJQQ 3CULA 2MJNA 3HI9A 2MGZB 1OWXA 2M7SA 4PRFA 1L3KA 4LIRA 1Q81T 3DXBA 1RKJA 2ADBA 2RS2A 1YWXA 2EK1A 3J7YU 2E5HA 3S7RA 2HGMA 2MSTA 3NS5A 1W2BR 3VAGA 2N7CA 2DHAA 2CPHA 3SXLA 3IRWP 2M9KA 1VC6A 4TU7A 2DNKA 3JB9k 3P49B 3Q2TC 1U2FA 2DNGA 2NLWA 5DDRC 1IQTA 2CQ3A 3UWTA 3S8SA 1X4EA 4CH1A 1VQ6S 3NNCA 2I2YA 2LEBA 2L08A 2M0GB 4M5DB 2MKIA 2HYIB 2PE8A 5LSLA 2E5JA 1U1KA 3N9UC 4IUFA 2OIHA 2DGUA 1WG5A 5CXTA 5IM0B 1WELA 2RU3A 2LMIA 2E44A 1Q86T 1X4FA 4Y00A 1VBXA 1FT8A 1M5VC 1H2TZ 2OSRA 1WHWA 5ITHA 1SJRA 1URNA 4TU9A 2DHSA 1DZ5A 3MD1A 1U6FA 2CQDA 2DGOA 1FHTA 4P6QA 1Q7YT 2XNQA 4Z2XA 2DH8A 4FXWA 3R1HA 2DISA 1F9FA 2MZ1A 1JJ2R 3NS6A 5GAEU 1YTYA 5GADU 3J7ZT 2K3KA 1NU4A 3CCLS 3FEYB 3B4DA 5EN1A 1NJIT 2RNEA 1P1TA 2G0CA 3NNHA 1VQMS 2F9DA 1X4HA 3SDEB 1SXLA 2KXHA 1WTBA 1FNXH 3IWNC 3ULHA 4QU6A 3THPA 2MZSA 3R1LA 5HL7Q 1PGZA 2F9JA 2CQ4A 4LJMA 1HD1A 4CIOA 1D9AA 3P6YC 2M8DB 2A3JA 2DK2A 1SJ4P 2MKCA 3VAKA 2AYMA 2CQHA 2D9OA 1YJNS 3CCVS 2YKAA 3BO3A 1P27B 2JVOA 2CPZA 2OJ3A 2DB1A 1SJQA 2DHXA 1M5KC 2KXNB 2HGLA 2CPFA 5DDPC 1SJ3P 1DBDA 2DO4A 5CYJA 1U1NA 3UCUP 1X5PA 2MQOA 1OIAA 2YTCA 1FJCA 1YJ9S 2U2FA 3Q2SC 1U1PA 2VODA 2FC9A 2YH1A 3LQVA 5GAHU 4IOAQ 1VQKS 4C7QA 4UQTA 2CQPA 5GAGU 1H6KX 1WHYA 3TYTA 3UCZP 2M4MA 4BS2A 2D3OR 1UFWA 2PEHA 3PIOQ 2XB2D 4F02A 3US5A 3CUNA 3MOJB 2SXLA 3P5TL 5LJ3Y 1WF0A 3FEXB 2X1BA 3CPWR 2HGNA 2MQQA 1U1MA 1PO6A 2MY8A 2DNNA 2CPYA 1JJ4A 3THTA 1YJWS 4W90B 2KI2A 3MI7X 2X1FA 1X4BA 2JVRA 2MZJA 2AYGA 3HHNB 2RRAA 3VF0B 2CQIA 3I56S 2MQNA 2DNZA 2MZTA 3G8TA 1UP1A 3CCSS 2N82B 1QVFR 2M88A 4ERDA 2MY7A 3SMZA 2MXYA 1S72S 4WIIA 3MUMP 1VQOS 1U6BA 1VQ9S 2LCWA 3VAHA 2N3OA 4PR6A 1KC8T 2CPXA 2DIVA 2GO9A 1OPIA 5LXYA 2MQMA 1X5TA 2CQ0A 1N54B 1H2VZ 3P3DA 2RQ4A 4WFNQ 3MUVP 2KVIA 1ZH5A 1X4AA 2MZRA 1UW4A 2DNOA 2FHOB 5IFMA 2DNMA 3I55S 2BZ2A 3UD3P 1RK8A 1X4CA 2DGSA 1N52B 5D77A 5H1SV 3CTRA 3R27A 4IO9Q 3ZZYA 2QFJA 2DH9A 4WFBQ 3CCRS 2F3JA 3BO4A 2M70A 1M5OC 2YH0A 2M8HA 2MPUA 1FO1A 4WF9Q 1VC0A 1SJFA 1M90T 4YB1P 1H2UX 1K9MT 4EGLA 3H2VE 2CQ2A 1K73T 2DGWA
chains in the Genus database with same CATH superfamily
3IGVA 3W1YC 4DPXA 4JI0J 4ELUA 1Q0NA 3V6DA 4ZPBA 5DLGA 3DGPA 3O6QA 1S1VB 3OTDA 2ZOFA 4Q5VA 1SCJB 2K8GA 2KM8C 4QWEA 3HVAA 1ICEB 4IFVA 3W2VA 4JI4F 4PG5A 5EWGA 4M94A 2RH3A 4LBPA 2LXIA 2WONA 4R0EA 4JI1F 2IM2A 4ZP7A 2BE2A 1K47A 3CDUA 4CLYA 4NXNJ 5KFDA 1YDLA 4LF8J 2E1PA 2LQ5A 3NAIA 1F0XA 1JLBA 5AXMA 5GMKa 4LBHA 2DNRA 1IKYA 4QYZK 3PW2A 3CJ3A 1M1HA 3LAKA 3LANA 3R5CA 2EVZA 4P7VA 1VQPS 3HKZD 3HT3A 4Q2MA 3DNCA 1S49A 2NZ4A 4NLRA 4OI4A 4Y0FA 3THVA 2AQ4A 4JI6F 3TEGA 3DLKB 4ZJQA 4C9DA 2L41A 3PO4A 2AYEA 2IJFA 3C8YA 3T1HJ 1UL3A 3PY8A 1HBMB 2XMJA 2RSQA 4O44A 2HHUA 2G2YA 1GXTA 4ID5A 3TVYA 4FS2A 1DQ8A 2IMOA 4QIGA 4E2FB 2UUWA 2DR7A 2XULA 1TK8A 4DXLA 3EVWA 2GAHC 3EYZA 2OPRB 1RUSA 4Z37A 5AE3A 2ALZA 4M5LA 5A8KA 2UUAF 5J2NB 1N5QA 3FBFA 3UDLA 1C4AA 2VKZG 5KFYA 4CQ1A 2L3MA 2R2RA 1N5YB 3ZXWA 4DX6A 4H4KA 4LF5F 3GJSB 3DGPB 2YNGA 4IFYA 1N34J 1X8DA 4RW4B 2JL9A 1DQ9A 1D8ZA 3BQ2A 1JK9B 4NLQA 1KDNA 3CD7A 5K8NA 5B09A 1VQ5S 4O3SA 1LEOA 4ED5A 2QL9B 5DQGA 2GC8A 5L1KA 2YNFB 2IC3A 2FY8A 1I94J 3BSAA 4EBCA 3LALA 4X4SA 1RBLA 4TQSA 2GIFA 2J7UA 1N36J 5ETRA 5K5MA 1RZMA 1S79A 3KXDA 3R5GA 3BO2A 1S0OA 4AQYF 1XBWA 2EPIA 2BW2A 1RWUA 4RWXA 3CJSA 1ZAWA 3SZ2A 2AP6A 3CCJS 4QPTA 3Q8VA 4J9NA 1UVJA 4U6PA 4DUZF 5D3GB 2NREA 4NI2A 5E0OA 3QO9A 4F25A 1FK9B 1BC6A 4DUTA 3D6FB 2AU0A 2JHEA 2OP5A 4HDGA 1MU2B 1U2CA 3QGIA 4OZLA 4DJBA 1FNMA 1YZ7A 2DGXA 2O1PA 3FSYA 5IQ6A 4RNMA 1D1UA 4RWWA 4EUVA 2UU9J 2HWIA 3PKYA 1VRUB 4QWAA 1C1BB 2VKRA 2XYGB 9RUBA 3GE9A 2ZH9A 4UUWA 1S6QB 2K2PA 2XG8A 5F0WA 4BBYA 4TNOA 1FJ7A 2J0XA 4Y28C 1DARA 2VA2A 1RTZA 2OTJS 3BYPA 4C98A 2VQEF 4DL4A 2NUUG 2AX0A 3DI6B 3H0PA 5U47A 4B17A 1Y3KA 5GAGI 2KRBA 2YKMB 1Y00A 2GAGC 2YWGA 3OV7A 3C16A 5T7LA 1WG1A 3CCQS 2FJWA 2UXDJ 4O23A 4LFAJ 2KH9A 4TVAB 2MGZA 1YGYA 2V94A 3T41A 1F6TA 4ANDA 3BF4A 1MU2A 4GVBB 1GEHA 1WDTA 3O5TB 4JV0A 1YKWA 3VV2B 2X1AA 4W92B 1KS2A 2BM1A 3AH6A 2XGQA 2A18A 2FJAB 3CJQA 2R8JA 2V9WA 1JLFA 5KG0A 3W5XA 3ZZPA 4DDFA 3OSPA 1XWLA 1GQEA 4OI0A 3C16B 5CD4A 3T3FA 1Y3JA 2IHR1 4WIQA 2CJKA 4ED3A 2X3GA 2HS3A 5CH7B 1CC7A 1RA7A 5G4DA 3AOBA 1DHMA 2WSEC 1N8RT 5F8IA 4C97A 2L48A 1I1GA 1Q7LB 3MMCA 4O44B 4K59A 3FBBA 5FLXU 1CJKA 1FDAA 4TYBA 5KT3A 2H65B 5DM7Q 2HQ3A 5FDLA 4RW7A 3NGSA 5HVHA 3I0RA 4B3OB 2FHKA 3N5FA 4N41A 1SIWB 2B4VA 3ENWA 2WW4A 5HMYA 3PIPQ 2PSZA 2Q66A 2EBEA 3MFHA 2MLZA 2FD2A 4ZOSA 4NLTA 2FUG9 4LF9F 4DX7A 3DHWC 5E41A 4ZKAA 4MKYA 1TUWA 2DNLA 2K06A 3UVJA 3QGHA 3WIUA 4BC7A 2HFSA 3OR1A 3HX9A 4YDDB 1CPZA 5LMNF 1Z2ZA 2D7SA 4K5RA 4P71A 4ZVFA 4CYUA 1AROP 3RR7A 3C3LA 3FEZA 3MOZA 4WE1B 2QMWA 3ZNUA 1KFDA 4WZMA 3KJVB 2VH7A 3HSDA 4NEYA 1NK6A 3CD6S 4JI0F 4K7QA 3B8HA 3GFYA 2BVZA 3W65A 3NNAA 2HZCA 1TL3A 2CJBA 3CB4A 3TR5A 4FYYB 4KFBB 2PC6A 2K7JA 1HD0A 3DOLB 2UV8G 4XAKA 3TRGA 3E2EA 3M1VA 3MDFA 2AZ1A 1B0TA 3H7HB 4OYXA 1QY7A 3MMCB 2LKZA 5A6WA 5HQ8A 1HR0J 3NL0A 1IVZA 2NSCA 3MF5A 3W5ZA 5B08A 2V4QA 1L3UA 1LW2A 1WUUA 1E6YB 2GFFA 3RRGA 1OSCA 1QSSA 3M8SA 3BQ1A 3OFFA 2CQBA 4DQSA 1FNOA 1VQLS 2KG0A 2IDEA 2HK2A 1FF2A 3GCWP 1ZM3A 3G86A 4IH7A 3DYAA 2NYIA 4OJ1A 4P2XA 2ZKTA 5DQHA 5J2NA 3K0JA 4FYXB 5I4MA 2F4FA 3R7SB 1YIJS 3EM1A 1YRXA 2E5LF 3BR9A 3PX6A 2DXEA 1X9SA 1RE1B 2D74B 4DPYA 2KFYA 2C28A 2FPHX 2GS8A 4QR2A 5F8LA 3EVOA 2O67A 3AQOA 1CG2A 2Y0SD 3GIRA 3PYFA 2CFXA 3R2CJ 3KLGB 2W8KA 2F1FA 1AZSA 3BGRB 2BA9A 2RVJA 3AD8C 2MQ8A 4OZ0A 3FBCA 4YHHJ 1RT5A 4PAAA 5J2MB 1X5SA 3UPFA 4I2PA 2UVRA 4BS2A 4ZVSB 1LWXA 4DX5A 1WEXA 2LA6A 3MZIA 4O4RA 4NX9A 2VG5A 4TY8B 2C2EA 1SUQB 1T7PA 2GX8A 3OW2R 5E3CA 2VFUA 4KB7A 3Q8SB 4J9MA 2OEKA 1HPZA 1RU2A 4FXVA 2PDAA 4LR9A 2ZH2A 1HLWA 3VAFA 3C6UA 2HAFA 1ZAVA 3WC2A 4KGVB 1NZAA 1GT8A 1PC4A 2A10A 2BKPA 2HNDB 2OFGX 1F60B 3CDWA 3IM9A 3MAAB 3NXZA 2BQRA 4GO5X 2NR0A 3MMAB 3QGGA 3HHKA 2KU7A 5DRKA 1SI9A 1TZ0A 1N5TA 1RAOA 1S1WB 3SQGA 1JXEA 4ECVA 1HI1A 2BANA 4IDKA 3KJNB 1RHMB 4ZP9A 4DSIA 1FCAA 3CE8A 3TX0A 5ETQA 4CH7A 1KD1T 3UE2A 3M8PB 2PMZD 4YOEA 1WKJA 1D0EA 4CLKA 2G1DA 3A8EA 5E3RA 1RTDA 2EKNA 3KG0A 5B0EA 3PXGa 3GIIA 2IIHA 4FF2A 1NEEA 2IJNA 2MKJA 2C3PA 3ZC4A 3KLHB 4WXOA 4LF9J 4FKYA 3L3CA 2G2OA 3VAJA 1R89A 2HVIA 1SIZA 3KDNA 5KFJA 3AXKA 1GAOA 2GV1A 4PXCA 2RF2B 2EFPA 2Z56B 3D66A 2ZJQQ 2FLPA 2BBEA 8RUCA 3CULA 4AL6A 2F8MA 4ZVPB 2IVFB 3NMAA 4LIRA 2DCLA 5K9FA 1Q81T 1VOMA 4UOHA 5F8NA 2LQ8A 1RKJA 4YFUA 4ETXA 2ADBA 2RS2A 3D28A 5EWEA 2GHVC 3K5OA 4FF3A 2E7VA 3N6MA 3S7RA 2V68A 1N5SA 2ZE2A 2E66A 4CM2A 4RNFA 5KFOA 4YHHF 3OLAA 3NS5A 5KFQA 3BQ0A 3FJ2A 2HKEA 1W2BR 3VAGA 4YB7A 2H9ZA 4ECUA 1KBRA 2NXJA 3LP1B 4TY9A 4BWMA 4DPUA 3U1NA 1UJ5A 1PJ6A 1YBUA 4LRFA 3M8RA 1RTHA 3RRHA 2R7SA 5F8HA 2QMUB 1RI7A 4NL5A 2DNGA 3JB9k 2UUCF 3P49B 4X4VA 2AT1B 3SYZA 1RT7B 4OZNA 4C8KA 5DJBA 3DKDA 2W4DA 1X4EA 2FHJA 2HG4A 3PRDA 2ABYA 2W4CA 3EDQB 3NNCA 3QFHA 3TA2A 1FRKA 4DLEA 2L08A 2OMOA 2XMMA 2M0GB 3ADAC 4M5DB 1WKKA 3MM9A 2HYIB 5LSLA 2UUBF 4B9SA 4PXDA 1ZOTA 5F41A 3R6LB 4IUFA 4CT9A 1RT6A 2P6SA 1AXQA 2EC0A 1VIXA 3W63A 3ET6B 3F73A 2ASYA 1HNZF 1WELA 3LP1A 1Y7PA 3QFWA 4V1Ak 4Y2MA 3M30A 2D41A 1S10A 1L3TA 4X66F 1FRMA 1OY8A 4I2QB 4ZVEA 1GMVA 1Q95G 3UN3A 1H2TZ 4DQQA 1WHWA 4X4UA 3DC2A 4DL7A 3QSIA 5ITHA 3BBFA 1SJRA 1SC6A 4YQWA 1RGVA 5KFLA 3PRVA 1DZ5A 3MD1A 1TV6A 5KFEA 2CQDA 4CLTA 2P8IA 4TXSA 2BOAA 1NSQA 2DGOA 2UV8A 3MR7A 3LAMA 1L5UA 3H5YA 1HNXF 2DH8A 4GC6A 1HYSB 3BGUA 1XK8A 2DEJA 4FXWA 2ZBRA 1VLOA 2DISA 2VDIA 3GFZA 3HHLB 2HHPA 1U02A 2MZ1A 5I42A 1KP6A 1CQMA 5GAEU 5M2PA 3H40A 1B99A 2E1AA 4N7TA 4MIWA 3A3OB 3Q89A 4DV6F 4IQMA 3SCJE 4LQ9A 4M5DA 7FDRA 2ZWOA 2D3ZA 2UVVA 5E3QA 2B9YA 5EN1A 1NJIT 3MWBA 1J5OB 3D0GE 1P1TA 2XY7A 1RT3A 4PG6A 2D69A 1CULA 1NDLA 1V6HA 1FRXA 1X4HA 1HWIA 1YBAA 1S48A 2AEFA 2KXHA 3IWXA 2BANB 4IDKB 5CYQB 1RBOB 4PG8A 4N56A 2HHHJ 3LA0A 2XMKA 2HFOA 2XZWA 5GADI 2EW9A 3L09A 1UVNA 3R1LA 2AGPA 5EHHA 4AXJA 1BUXA 5KFFA 3QRPA 1R0AA 3M2UB 4H4KC 4Z7YA 5E3AA 4A8OA 5BR8J 1UVMA 3Q8QB 4DZDA 4M5HA 2VQFF 1LFPA 1OYDA 5KG5A 3G82B 3RTVA 1X0PA 2GIRA 4IFVB 1KQFB 1EZZB 4K2JA 3MEGA 3NCRA 1HD1A 2C2DA 3PYDA 5BYQA 2H5JB 1LXJA 3K5NA 1RWPB 2DK2A 2GQCA 4KGKA 3QT8A 4FYVB 4B02A 4P73A 1KFSA 4NLUA 2QL5B 2WB1D 4W4MA 4M95A 3TW0A 2XWYA 3R5AA 4ECWA 1KTVA 1RHKB 1FFSB 1SC1B 2X51A 1YJNS 3EGVA 4IYQA 3MM5B 2J0WA 3EXYA 4ZPDA 7AT1B 3LW5C 3BO3A 4DV7F 5DO2A 1HHTP 1DFDA 3K89A 2K1RB 3HVTA 1S4FA 1JLFB 2R8GA 1NJZA 4ELVA 1BWEA 2CWKA 5F8JA 1TKZB 1JNZB 1X7VA 1IN0A 5BYSA 4I69A 2HGLA 3W8GA 3GV7B 4IQXA 2FJVA 2VPWB 2DO4A 4IG3A 2HNYB 1X5PA 3CGIA 1OIAA 2YTCA 2YXLA 1WKLA 1AT1B 3MEEA 5E33A 5A8RA 2NS1B 2EFGA 5F3TA 2HQDA 4M63A 3TUJC 5F3ZA 4XPEA 2XM3A 4K2XA 5H9FK 4PCQA 4ZJLA 1SV5B 1ZBTA 3DRSB 2DPJA 1FKOA 4NLXA 3OLBA 1JKHB 4UQTA 4ZPWR 3HP6A 1J5EF 1RHRB 4J7CA 3OVSA 3SIPB 4DR3J 3Q23A 3NCPA 4XTTA 1WHYA 4TY8A 2GNKA 2Z2LA 3J7Z5 1WSVA 4PWDA 6FD1A 2XSJA 3FKBA 1EETB 1F5CA 2PEHA 3QQCD 3CMAS 3US5A 4OHXA 2VDHA 1NHUA 3CUNA 2D3O1 1W2IA 3P5TL 3PYGA 4IG3B 2ZKUA 3ZZOA 5LJ3Y 1S0MA 2UUCJ 1URRA 5E2QA 4NOHA 1S4EA 4P10A 2QMXA 4R5PA 3TZZA 4LQ3A 4NI2B 2V50A 3K58A 1SV5A 4DR5F 1PO6A 4QWCA 2DNNA 1S1XA 4YR0A 2RILA 2Q6BA 5D15A 4J9QA 1PSDA 3M2VA 1M5SA 2DXFA 2FQQB 1SQGA 2HNYA 5DGAA 5HMXA 4Q8EA 4JV5J 2QLBB 4X4OA 2E7XA 2WVBA 4NZ0A 3T1HF 1T03B 3TEHB 2DCUB 3GR0A 3ENAA 4LFCF 1YJTA 2JDJA 4MFBB 3DLGA 2OELA 4JI2F 2W9CB 4AQYJ 4KTQA 3OT9A 1WOOA 4UOCA 3G8TA 1NK7A 4HT5A 1UP1A 2Z2ZA 1JLQA 4NWBA 1S6PB 2YWEA 1EP4B 4I4BA 4YY3F 1F2HA 1LFWA 2EKYA 4LF7F 4D3HA 3RRKA 2MXYA 1RWNB 3IAS9 2ZD1A 2YKPA 5A8WA 1VQOS 4ZVTB 5ETVA 4NCGB 2PO4A 4P75A 1DJ0A 4PR6A 1ZTWA 2DIVA 4LF5J 1YLXA 1XJWB 4NLDA 2R8HA 2IYGA 3IGNA 4RNHA 3OL8A 2A2CA 2NYHA 1H2VZ 3P3DA 3R5DA 4USIA 1U47A 3PACA 1ZH5A 1TL7B 4JI5F 3G87A 3BREA 2WVEA 3M8WA 2YKNB 1SVDA 4ZK7M 3QZ7A 3VQSA 2DNOA 4ZVUB 3EWGA 1CS4B 4OZ5A 5E3PA 1TKTA 1FRIA 2BZ2A 3PR4A 4ALZA 3I55S 5CZXA 5ETTA 3TZXA 3MCSA 1AFIA 3IBFB 4LFCJ 4CDIA 1HWKA 1N52B 4WK3A 5H1SV 1OJ4A 3OR1B 4DFJA 3BKTA 4JI7F 1XERA 4B3OA 4KJIA 2H3EB 1MWZA 2YH0A 3I6PA 4DV1J 3RAQA 3KNAA 4DBQA 3EXCX 4DS5A 5D8HB 1UWBA 1X31C 1TVRA 2WVDA 4F04B 1SJFA 1IKXB 4YB1P 4J9LA 2RQKA 1VHIA 3H2VE 2XS2A 3M32A 2EEYA 3PFEA 4M1KA 5EWFA 3HHLA 2HSEB 2B5JA 1T95A 2KM8B 4P2MA 2QLFB 1KTQA 4DR2F 1RU1A 1TP7A 3POTA 2JEJA 1PAEX 4JI5J 3GJTB 3SDEA 1DTTB 2CPIA 3MM6A 4HHJA 2QX0A 2MHEA 1GX6A 2GVDA 3OSNA 1RTJB 2HRTA 4NXMJ 4ZP6A 2LDYA 5KFRA 3VQTA 2AEMA 4LBIA 4Y2IA 4IRKA 2DH7A 2DYAA 2FZKB 2J5AA 2KJWA 2Q79A 3PNIA 2O5DA 4FYDA 2M5YA 4DL0C 1NNDA 1RT1B 4WTOB 2I5JB 4ED7A 4GVBA 2YQ1A 2BX6A 2CIMA 3AJ2A 3BEGB 5L1LA 1XN9A 1UAWA 2CQ1A 3E8OA 3BH6B 1JMTA 4EFAC 1U4BA 2B0GA 1NPKA 2VG7A 1O51A 2GJIA 3LPEA 4OX6A 3W9JA 5B0GA 1S1UA 3FNNA 5HQLA 1SL0A 5B0FA 4B08A 2RDDA 3C46A 5DG7A 1AYEA 1XMQF 1D09B 2YBVA 2R8IA 1KWMA 2DHGA 4FBTA 3P8BB 2CNNB 1RTHB 3L9ZA 3U27A 3SV3A 5JUMA 5FJ4A 4R8UA 2WOMB 1UW9A 2COLA 5CD4H 2ZC3A 3UNYA 5T41A 2G4BA 7FD1A 3LGHA 4PUOA 3MPWA 4V19J 5LSOA 2L9WA 4L73A 4TLRA 4OJHA 5BJRA 5D78A 2E9TA 4LFBJ 3TJAA 1X4GA 2VFRA 2A0FB 1B0VA 2JNJA 2RKIB 2X3DA 3HZGA 3O3LA 3QIPB 1HKAA 2LU1A 4G65A 2MYFA 1R3NA 4I7FB 3ZZZA 5C25A 5KFCA 3T5KA 1H3DA 3PKMA 2RRBA 3M7VA 2B4PA 4HACB 1X4DA 3I31A 4ELTA 4UZCA 2AJQA 4DSJA 3K7RA 2HBRB 4C3KA 1HBOA 5HLFB 4MK8A 4RZRA 3ISNC 2YQ0A 1SPBP 2FDNA 4CO5A 5DDQC 5C2CA 4K0KF 2F63A 2HQFA 4UF4A 3CO9A 1IBMJ 3I5CA 1T8EA 2NXEA 5HVFA 4CRJA 3KK3A 2YWHA 4LT6A 3PCOB 1EHWA 1VDHA 1HQUB 2CVIA 3M6XA 3BGOP 5T7LB 3NMRA 3KYLA 2HQGA 4V19X 4ANCA 2RQCA 3VGTA 1RWMB 2Z58B 4MMOA 5KFIA 1RT4A 4KKOB 4QYRA 2V8DA 1ZM4A 3KHRA 3KG4A 2R2TA 1V9OA 2DITA 1HI0P 3AD9C 5HBMB 1DURA 4OJ3A 4OJGA 2DNHA 3DRXA 1JLBB 1RT3B 3K5MA 3O1LA 4N5SA 2Y8YA 2GMLA 3FC9A 2NZCA 2W24A 3AFGA 5HO4A 3DMJA 3F0NA 3SI8A 2YVSA 4HH1A 4D3GA 1KKHA 3OFEA 3MHYA 4USKA 2YNIA 3QJLA 3MECA 2V63A 1IM4A 2NSBA 4TLQA 3Q8PB 2EK6A 1TK5A 5JJBA 3KLGA 2CPEA 4PKDB 3LP2B 4I0WA 1LWCB 1TTHB 1HQ2A 2I0XA 2Z0GA 1I3OB 4DQPA 4OX9F 4DFKA 4NLPA 3N6LA 1U09A 2JLFA 4GC7A 1QD1A 4YEAA 3EX7B 1R8HA 3H42A 3IO1A 1RJJA 4FF1A 4UY85 3BSOA 1CLFA 2RAQA 4ZPCA 2CZ4A 1QAJA 3RZAA 4QQBA 4C0BA 2MQPA 3HHLD 3DRRA 5JVGQ 1T0TV 2EFQA 4HKQA 4F2RA 3G6VA 1NK9A 2DHHA 3NGDA 1Y4ZB 2AF6A 5H9FJ 1TL1B 3NRBA 5BYRA 1B7YB 1PYSB 4USUA 3TP2A 1U1LA 5J2PB 3I96A 1U1RA 2FHJD 2UP1A 1KVJA 1QAYA 2VONA 1JLQB 1S57A 2LQJA 3RG6A 5BXIA 2FGOA 2WHOA 4I6AA 4OZ1A 2ZDOA 5SUHA 3TO8A 4X62J 1VQYA 3A12A 3TX8A 1O0PA 1DLOB 1MMLA 5IT4A 2CPJA 3D68A 2DR9A 1TL3B 4C8MA 2KN4A 2CNLB 1YBTA 4OYBA 1ZM9A 1HBNA 3KDOA 4EYHB 1WEZA 1EARA 3FSXA 1FJGF 4O3OA 3WC0A 4G6VB 1NSPA 3A8IA 4KAIA 1T9UA 5HK4A 3OTOF 1T02A 4O0IA 1RB0A 4A8YA 3AOAA 1R31A 3R97A 2DGTA 3UVJB 1YJ9S 1TL7A 1YITS 2ADCA 2IDLA 1S7IA 4P72A 1XNRF 1GTHA 4DV0F 3EPGA 4K0KJ 4PQUA 2FB0A 2F65A 3DU6A 1KR4A 2UUTA 1TUVA 4RU9A 1PIEA 2WBMA 3CCES 3TUPA 2L9NA 4DR4J 1YI2S 5KFXA 4QZVB 1HNZJ 4DSFA 1AW0A 4MIBA 4QWBA 2DY9A 1JKHA 2ZH1A 1VJQA 3VAMA 2O3DA 3LP0B 3RBDA 3QJJA 1RT2B 3C2PA 3MMBB 1U1OA 1HW9A 2KJVA 5A0YB 3TZYA 1JJHA 2RUGA 1KQSR 3DLEB 4U7UD 3O8WA 5C5JA 3SCKE 2RU9A 3KK1A 2VOPA 1RT5B 2XHWA 1S77D 1EQMA 5I3UA 3S01A 1FRLA 1JNRB 4K4WA 1S9GB 3IMQJ 1TKDA 4LFBF 1HNWJ 3FRZA 1TUGB 1FE4A 4RW9A 3M2VB 3KMQA 3CXCR 1EKRA 1HWUA 3DDKA 4DCJB 1TKXA 2AW0A 3RUBL 4CLZA 4QU7A 3D6HB 5ADZA 1RTIA 5F8MA 1VQ7S 1RYSA 1RAAB 3WX4A 3EICA 3ETMA 2XS5A 3CCTA 2GVDB 3F44A 2BV3A 1RAEB 5ETMA 4WFXA 4N47A 2IAJB 1FD8A 2WBRA 4H4OB 1F1BB 1UFKA 3CDBA 1A9NB 2VFVA 1SQFA 2KYXA 4OZ2A 4S0MA 4URQU 3CC2S 4NYZA 2E1RA 2OD4A 2CJXB 4ATNA 4ED8A 2N4DA 5HJXA 2K3IA 4QIVA 2ZHBA 2F40A 4DOZA 3RAXA 2HLTA 2ATLA 5LJ5Y 1N5VA 3TQ1A 2FVSA 2VOOA 2J9DA 3S1TA 1NKEA 3LP0A 2CJAA 3SBMA 1OMSA 2VPYB 1VRUA 3PEJA 3V81B 3V4MA 4GMKA 4OLPA 4I6YA 2B9EA 2XQCA 1XR7A 4NASA 1IBLF 1GFWB 4IR1A 2UXCJ 4ED0A 2FIUA 2PFFB 3TJ9A 1K1SA 3QYYA 4Q0BB 2YX7A 1S6QA 2E7WA 3W8PA 2HVHA 1VRQC 3H2UB 2DTJA 3OXLA 4OYZA 2QFIA 3QO9B 4F3MA 1WI6A 2IA0A 3QZ8A 2BQUA 1JLCA 4PZVA 4JI3J 4ZCLA 2XS7A 2R7TA 1ZZNA 4LMZA 2BE2B 3G9CA 1WDDA 2MKHA 2IAJA 2F5GA 2QLWA 5DETA 5IV3A 2QTWA 4HI1A 3D54A 1OWXA 2M7SA 3FFIA 1L3KA 4NA3A 2XCAA 5HP1A 1RTIB 4DEZA 4BHQA 5IXUA 4G1QA 1HNVA 2Q43A 4J9UE 2N7CA 3AHPA 4F4ZA 3V6HA 2UVUA 1LW2B 1IBKF 5J2QA 4ZN3A 4FDFA 4ECXA 3GZ7A 1S5ZA 4WU3A 5HROA 1J27A 2E5HA 2CKWA 3GG0A 3NEKA 4RW6B 4USMA 1NB7A 4EI2A 1ZM2A 2F4VF 2FYXA 2WSFC 3PG9A 4KSEB 1NHVA 3OTCA 2GCFA 1ZS6A 3A3NB 3I4HX 4K8RA 4YS2A 4YMEA 4ZIVA 1C0TB 1ROFA 1S1TB 4L3NA 4WK1A 4DV3F 2E9ZA 2M9KA 4ITSA 4TU7A 2DNKA 4GO7X 1I5OB 2G9OA 1RT6B 3FCWA 4ILMA 3NWRA 2KDOA 3WDOA 5DDRC 4K4ZA 1J2VA 2AGOA 1RWKB 3M05A 3OHAA 1VQ6S 4XIUA 3BSNA 2IRUA 1XMOF 3IS9A 1CJVA 3SEOA 2OPQA 2YNIB 2E29A 2ZOGA 5KG6A 4YY3J 3JQKA 3N4WA 3OXGA 4HHHA 4NLSA 5JXSA 5B0CA 5KOXA 3PW4A 2DGUA 1IR1A 1WG5A 1KRPA 4CTAA 3TUZC 1NK5A 2NXUA 1NK8A 4OZ3A 1BE4A 2P6TA 1U2RA 2XMVA 1RT4B 4OMFG 3HLUA 1FESA 4M5NA 5HAOA 3JS9A 4LREA 3I4PA 1XQIA 4RW7B 5HBMA 2BABA 4DQIA 2VFTA 1HBUA 2HRUA 1C1BA 1JXVA 1IKVB 2PGCA 4OLOA 3V4IB 4NZ7A 3SSRA 2HFVA 1URNA 4TU9A 1Y10A 2DHSA 2FHMA 2HIQA 3CWJA 1PBAA 3J7A1 3MAHA 3R6GB 1VFJA 3JAMU 3TZWA 2KFZA 1RHQB 1UVLA 4Z2XA 3R5BA 2R8KA 3GU0A 1HFEL 2PT0A 1V5VA 4FP9A 4FZVA 3W61A 2ZFHA 3JTOA 3NS6A 3A4TA 4C8NA 3HZEA 2V0NA 5GADU 4FVMA 4ECQA 3AJDA 2QL7B 1EKSA 4B3SF 3BYRA 3FEYB 3L4BC 4DR4F 3NCQA 3MM7A 3KLFA 3DXSX 2ACMA 3M4XA 2XHCA 4KFBA 2BYCA 4WP3A 2FGCA 3K59A 1A0OB 3JSBA 2UXDF 1VQMS 3NOGA 3HULA 3SDEB 4IOBA 3HVRA 1REVB 1SXLA 2GZOA 3ZTRA 1J5EJ 4WFYA 1WTBA 3AB4B 4ED4A 1FNXH 3W9HA 2VQEJ 4HL9A 1FKAF 4OYAA 3EMTA 4RUBA 3L95X 1Z1ZA 1R6YA 2DXDA 2GMHA 1ZAXA 3JYTB 1FXDA 1TR0A 5SZTA 3JQJA 1JLCB 4U7CA 5LL6d 5KG3A 2IBKA 3CVKA 4LF4F 4LJMA 3UQSA 4ZVRB 1N32J 4BLGA 4DR1J 3GG1A 1D9AA 5A0YA 3E01A 4DL2A 3FCVA 4MK7A 4L6V3 4DR6F 4DR7J 1JLGB 3P96A 4B3SJ 2V2QA 3RB3A 2R2SA 4LIWA 1S59A 2UXBJ 5B7WA 5B0DA 1HHQA 3VAKA 8AT1B 2JEIA 1CJKB 2D9OA 1T9WA 2VPZB 4RKUC 4OI3A 2KZMA 4I2PB 1U0HB 1N33J 5KOWA 3D1OA 3CCVS 3DOMB 4RLEA 1S6PA 1FRHA 1U6ZA 2Y1RI 2CUYA 3O2IA 2HAIA 2M3DA 3JYTA 2R3VA 4TKTA 1P27B 2CPZA 2DB1A 3I5BA 2DHXA 2XLJA 1Q8BA 3RR8A 4X4PA 3ENQA 2C42A 4F4XA 3M6UA 2VQFJ 3TJ8A 2XY6A 3DU5A 2BR0A 3TAQA 1SJ3P 1RTDB 3C14B 4M5GA 4NYPA 2JJ4D 3FZBA 4BDPA 2MQOA 3A1YG 2UU9F 2U2FA 3Q2SC 1FERA 1FRJA 4ED2A 1T05B 1FVQA 2C2MB 2FC9A 3MMJA 2YH1A 3BN7A 1P1LA 4DN9A 1NDKA 1S1WA 3SQGB 1PC5A 4ZITA 5GAHU 4X84A 5EDWA 4IOAQ 1VQKS 2DR5A 1QAXA 1C2PA 4C7QA 3VVUA 4DSLA 1BGXT 4ES3A 4B3MF 4B9UA 2QV6A 3CNQP 1Y5LB 2GVZA 3AA9A 4NLWA 1U49A 4DWIA 2MDAA 2R7RA 1XNRJ 2M4MA 1SC3B 4DN0A 2VPXB 2Y3YA 4XO0A 1UFWA 3N79A 2JSXA 3PIOQ 2XB2D 2DBBA 3EZ5A 2EC2A 2R42A 4ZMMA 3CCZA 1WF0A 3HD1A 5KG2A 2HHXA 1RAFB 3B82A 4OHYA 2X1BA 3ONQA 3ZTOA 3RU0A 4DV5J 4Q45A 1FXLA 1CULB 1YVFA 4EO6A 2HGNA 1KEKA 2JLEA 1Y5NB 2MQQA 1U1MA 1D9DA 3OQ2A 4NXNF 2BW7A 4PWWA 2AV5A 2CPYA 4AYBD 3OL6A 3OPKA 2OO4A 2HVDA 3THTA 1RYRA 4W90B 1LW0B 2BJEA 4QIWD 3MI7X 3PO5A 1DTQA 1TU0B 3KNGA 1CBKA 1X4BA 4JV2A 1KHWA 2JVRA 2MZJA 2P5VA 3GMGA 3L7OA 3QWPA 4OI6A 3WHIA 3V6JA 3DMJB 3KJFB 1RAHB 1UA0A 2V67A 2Y1LB 3VF0B 2HHQA 1ZA2B 3RAMA 4CO0A 1RA6A 2CQIA 2LEPA 2DRAA 2KYZA 1R6VA 5A8WB 2LU2A 2V8VA 3MPDA 5F0UA 4DX8H 3UN2A 4UW2A 4DV2J 4USWA 1T94A 2OMLA 3CEDA 3CCSS 3P5BP 3IRXB 3MCNA 1R0BG 5C24A 4UOFA 3X3UA 4B9TA 4E0DA 1UEKA 3LGMA 3TOQA 5AE2A 4OV1A 3HSGA 3DRYA 2HHTA 2YX4A 3CW2C 2MY7A 4USTA 4DMZA 2R9LA 4HLBA 2RDJA 1HHSA 6AT1B 1S72S 4AL7A 4IG0A 1U6BA 4KHPF 1HYSA 2GIQA 3BM7A 5D4LA 4K4TA 2LCWA 2Z8QA 2N3OA 5C2GA 2HS0A 3CDEA 3VAHA 1KC8T 2CPXA 2GO9A 2V6AA 1OPIA 3Q8YA 5K14A 3ET6A 3VTIA 2ZH6A 4YR2A 2MQMA 1X5TA 4I67A 1YZ6A 2OKQA 3OVAA 3CD5A 4WFNQ 2GHWA 4ECRA 3QJPA 4K4SA 4RW9B 3ZNJ1 2QGFB 1ITPA 5AXLA 1V3SA 4RUAA 5FD1A 1FX2A 3KG1A 4YN3B 4OI2A 2DNMA 3ZZTA 3LP2A 3NGRA 3CJ8A 4RL1A 4JUZA 1RDRA 2AEJA 3HSZA 4ZCMA 5IT0A 1EAYC 1X4CA 3HKWA 4DFMA 4X65J 4IO9Q 2DH9A 4WFBQ 4MKVA 3BO4A 3DOMA 1HR0F 1M5OC 4XDDA 4DZ6A 4O3NA 5HSPA 5KTQA 4X4QA 4F0HA 4N76A 1TFYA 2W2NP 4PWDB 3ITHA 4I6WA 1N4LA 1Z4UA 5LT5A 2G0IA 4NRUA 5KG1A 1GXLA 2IA6A 4KGMA 1JIHA 1EX8A 1CJUB 4I64A 4USJC 4F7VA 2LXFA 4DU8A 2BQ3A 2J6UA 3QSYB 4NCBA 3M9OB 2J7KA 2DGWA 1A7GE 2YWKA 3CD0A 4J5OA 2ZBPA 4QBUA 5LM7E 1ZZFA 1RAJA 1FTCA 3PR5B 1FE0A 1R8AA 1W25A 2FJBB 5AT1B 1VJWA 2XMAA 5E5NA 3GWCA 3PVXA 1G2EA 2BJ1A 1I6JA 2B4OA 2CPDA 4XPCA 1GMUA 3AB2B 3UR3C 3SCIE 2XO7A 2JFDA 2IC3B 2RJZA 1KOHA 1T9VA 4JBCA 4LSLB 5CZVA 5DDOC 3EPIA 1SL1A 4OV6A 1VQ4S 3GYXB 4DI6A 2W2PP 3ISND 3QAUA 3VAIA 1NUEA 1VC5A 2FLNA 1XNQJ 3C66A 5I3UB 3H4DA 4OHWA 4U67Q 2DO0A 5KT2A 3D3BJ 1CQNA 2DIUA 3OTBA 3PTWA 4ETZA 2N7YA 4G1IA 4Y2CA 5EX0A 3J80Y 1FKPA 5J1PA 5CABA 2LLZA 2ZC4A 5H9EJ 1YG0A 2BM0A 2DRDA 1DAXA 2JC0A 5AXNA 1TFWA 4FVCA 2MKKA 3LOUA 5GVQA 4A8QA 1L3SA 3IG1B 4LRCA 2CVEA 3MR6A 2YKMA 3QIPA 2QO3A 2OD6A 5KT7A 5I3PA 3B54A 1SH2A 2J9EA 1UETA 4EBEA 2VBYA 2AJFE 1S1UB 1REGX 2W4PA 1KLNA 2W8LA 1B0PA 3OHBA 3C6TB 2J8AA 4X62F 5ETPA 3HHDA 1WF2A 3JXOA 2XMUA 4O3PA 1BY9A 1VS3A 2ZEJA 4K4YA 2QA4S 1QTMA 1KLMA 3T9NA 1YJUA 5GAEI 3PW7A 3KHGA 3IR7B 4KHMA 4A8XA 1IWAA 2DNQA 2HNZA 4ZLNA 2N4CA 1NK4A 4NLVA 4M5JA 1D9FA 3EGZA 3ZFVA 1XMBA 4WKYA 3RGIA 1HWJA 4MTPA 4C3LA 1IKWA 1JB0C 1WC5A 4MJKA 1PAUB 1QUPA 3C19A 1HQEB 1AB8A 3N0VA 2XNRA 5L38A 3CF5Q 3LGNA 1P9QC 2OPPA 1IUJA 3N28A 3KLVA 4F4AA 3BDEA 5DM6Q 1HNXJ 4B3MJ 2Y9HA 2R2UA 2PI5A 2QN6B 1NHKL 2JRSA 1F3VA 4C48A 2YX1A 1MW7A 2KO1A 3VCDA 3ZTSA 1XMQJ 5HMWA 4F3OA 3SV4A 5KFZA 1DRZA 4K4UA 3RB6A 3DM2B 1WC1A 1YJVA 2CQGA 2CJ9A 4Y2AA 2LQ9A 1U8SA 3JAMY 5KFUA 4JV1A 2J6TA 3HFVA 2BE7D 1DQAA 3IFEA 4KV8A 2B51A 2YNGB 3MM6B 3FMWA 2MQLA 4IFYB 1U25A 4U9RA 1Q78A 2IJRA 4GKJF 3DLGB 3K5LA 2HBYB 5LXRA 1ZYQA 2WAQD 1AUDA 2B3TB 1AUSL 4CNYA 2QJ3A 1S0NA 1MG7A 2LYVA 1FI4A 3SFGA 2A1BA 4F26A 3HFZB 4QR0A 2VBXA 3PFOA 4UUXA 3VALA 4C11B 1U48A 2ATCB 4DPTA 3JTPA 1QDUB 2W9BA 3K57A 5KG4A 3NAHA 1APSA 2QSFA 1HPZB 2XMWA 2MEWA 1T3NA 3LUYA 1X0FA 2J0QD 5G0RB 5F9LA 2E1CA 1WOSA 5KFAA 3TVZA 2HS4A 2VG5B 3QAEA 2OPPB 4F3QA 1VBZA 1QM9A 3NGKA 3I87A 4URGA 4LF6J 3QRQA 4FXDA 3U02A 2A6MA 2W7OA 2ZITA 2R7OA 3BR8A 1RSCA 2BACA 3JSRA 5D0HA 2W7PA 2U1AA 3IS9B 4ZVOB 2KVQE 4ICLB 2ZD1B 3BJYA 3PZPA 1CSJA 3E01B 2ZH4A 5AXKA 2R4FA 5L1IA 3W9IA 1WACA 1LK5A 1DY3A 1LXNA 1YJ7A 1V5IB 3D5MA 3L7PA 3NBPB 4NCGA 4USHA 4WJBA 1IXKA 3DLHA 2D9PA 1XEZA 5A76A 2XO6A 4RNNA 3GFHA 2POKA 4ENOA 1UA1A 1C1CA 2HW3A 1JLAA 3MCMA 4DV6J 4MT1A 1FKPB 4EYIB 1G1XA 3QGPA 1ZPWX 2Q6CA 2ZH8A 1VR6A 3CCMS 1VMBA 1MWQA 3DRRB 4KPCA 2W2MP 2YY3A 1HARA 1HWLA 2FVCA 4LR7A 3ILJA 2AD9A 3BGLA 2JLGA 2RF2A 1VISA 2VIHA 4TU8A 3HT0A 2DR8A 3MR2A 2OTLS 3EGWB 4OFZA 1Q82T 5IZHA 2YNFA 4M5KA 4YB5A 3QPIA 2AIRB 4OYPA 4USVA 4YDXA 2B4UA 3FSIA 2ZJRQ 1S9FA 1RCXB 5C7PA 3MPUB 4AXIA 2VB6A 2GMJA 3GSIA 1G7CB 3I0SB 2HBZB 3PYEA 3M2RB 5I3QA 2XLIA 1F3FA 1IKWB 1IM6A 2W2QP 4CCHA 1Q53A 2G2ZA 2K7KA 3M32B 4J9KA 3MM5A 3B6BA 2KRRA 1IBLJ 1U24A 3DLEA 4ZVHA 1BQMA 2BOPA 3P45B 3MMAA 4IRCA 3D7SB 2UZAA 3EVMA 2EFVA 3G8QA 2OPSB 1GMWD 5HANA 5IWAJ 3OFHA 5GMEA 2B9XA 1RAGB 1XR6A 4ECSA 1QVGR 1EQ0A 3D3CJ 4IH5A 4XDCA 4F67A 2KXFA 1MMDA 4ZPAA 4RU2A 1CVJA 3DDNA 1AA1B 1LWEB 5IM0A 3DOKB 3MUTP 3EZOA 3TNVA 4K4VA 1PCAA 4A47A 2B43A 2X1GA 4G3IA 1PBUA 4H4OA 2B9WA 4NZ6A 4ZCIA 4F4YA 2MMYA 1NPPA 1H0HB 2Q3PA 3IA0A 4WU2A 1FDNA 2Y0BB 3M6VA 4R0JA 4LF4J 3UFCX 3G6ES 3LPYA 4A46A 4DU7A 4WYLA 2J7WA 1Y9OA 1O8BA 1RHUB 1HL6A 3QLHB 4MAKA 1M1GA 1WORA 3D9BA 1UJ6A 3HD2A 4DV1F 1CJVB 1HBOB 3KMSA 1ZA1B 1OO0B 1F5BA 3V6DB 1PYTA 2GO8A 2QLXA 2MB0B 2KTQA 4ECZA 1S97A 1VRTB 4WFAQ 2VUGA 2J9CA 1N88A 5ETLA 2DD8S 3FQLA 3MGJA 4B9VA 2N3LA 2PN6A 3PRBA 2ZZNA 1N36F 3CMQA 2FLOA 1UCNA 4PXEA 1FJEB 3BGFA 4WKRA 1E6YA 1GXUA 3PDNA 4FNHA 4EMDA 2MLXA 1ZTTA 4PEOA 2ASLA 2KG1A 4Y34A 2PMWA 1O5JA 1HNWF 1RWWB 1R8CA 2LP4A 4KR0B 1WEYA 1WHXA 5J1NA 2GHPA 1HNIA 2AZ3A 2QIFA 2KT3A 4M5IA 2IVMA 4E8UA 4P2SA 4Z7CA 4FS1A 2V4JA 2LFVA 5CA5A 3G71S 3ICLA 4ILRA 5IQQA 4CWBA 1FWKA 2HZAA 2E5GA 3JQMA 3KWMA 2F8EX 4MYUA 4PQUB 1VQNS 3IBCB 4LF7J 1U0SA 2YKQA 4ID5B 4C2MA 1T9XA 2CA9A 1P6TA 2MZQA 4ZPTR 1R8PA 3UDCA 4ZA1A 4UT4A 4J9OA 2UXCF 4NYOA 4EO8A 3R5JB 4A8FA 1QE1A 3DRPB 3AA8A 3U1LA 2EG2A 4KHRA 3IAM9 2MKYA 2W2OP 1KLMB 2MJNA 2V2KA 1TAQA 1WJ9A 2ZUGA 4DSEA 3D4JA 3DXBA 3I5AA 1REVA 3ISZA 3MPVA 4KE5A 4UQGA 5KAKA 1YWXA 4WWSA 3IM8A 2EK1A 1FXRA 1SKUB 3MM7B 4URSA 3KLFB 4WBFA 3T1YF 1XC9A 3M9MB 3NG8A 4M8LA 1H38A 4ZVQB 2GVZB 4WTYA 1UFLA 2DKOB 2H48B 4MKBA 5KFSA 3W2VB 4E98A 1Y5IB 2ZNZA 3KTQA 1HNIB 4N8NA 3IC1A 2E5LJ 1RAIB 3IRWP 3MM8B 4EU0A 3Q0AA 1VC6A 3VZHA 2IBOA 3Q2TC 3QT6A 3M8ZA 4DUYF 1S0VA 2HVEA 3DGVA 3H25A 1VIOA 3ELHA 3GLJA 4WXWA 2WRMA 3DFEA 4FYWB 1IQTA 2CQ3A 1H73A 2PIIA 3CIMA 3T6JA 3KUHA 2WVCA 3UWTA 1NK0A 2RDIA 2I2YA 1ACMB 2OLWA 3WQPA 3C15B 5K8PA 1SKSA 3TI0A 2XZTB 4ZLPA 4LFAF 5L1JA 2PE8A 2VL1A 5DLFA 2E5JA 2PFDA 1U1KA 2I1RA 1U0HA 2IM3A 4RJVA 2OIHA 4F4KA 4X4RA 1RKIA 5EGYA 2RMLA 3UW1A 4WFZA 5CXTA 1MN7A 4GKJJ 1LWEA 5IM0B 3CJRA 2RU3A 2LMIA 1NB2A 1RWOB 3DI6A 4QR1A 2AGQA 4DR7F 4DR6J 2EG1A 2BRKA 3VHQA 1MSWD 5IOLA 1Q5VA 4Y00A 4RUCA 3MFIA 2OSRA 3Q8RB 3I32A 5A6PA 4NCAA 3N5BA 3KKFA 4HI2A 1RLCL 4HR2A 4IO1A 2OAUA 3J81Y 2LQBA 5CCLA 1ZETA 1KQGB 1FHTA 4P6QA 1S99A 3MAQA 4KKOA 5MAOA 4Q44A 2XNQA 3I0RB 1HQUA 3HHLC 4ES2A 5KFKA 1FEHA 2ZWPA 5D4NA 4X4TA 2W1BA 3Q22A 5KFTA 1MN9A 2KB2A 3C6UB 2B6AB 4LSNB 3SCLE 3R1HA 2ASDA 1WOPA 4DV4J 1RBAA 5M2UA 1OQ3A 1C4CA 3ITHB 1JJ2R 4ECTA 1YTYA 4B9LA 3CSKA 3U7JA 2Z2YB 2K3KA 1U45A 5JMNA 4OX7A 1PJ7A 2WK4A 4M5MA 3CCLS 3B4DA 2QZ8A 2XBPA 2CG8A 2OI2A 2RNEA 3D1HA 3NNHA 3T5LA 1QUVA 3BBCA 2BRLA 3KLHA 2NPFA 4A8KA 4H54A 4WZQA 3M2RA 2HFZA 3GIKA 4CO2A 3PJ9A 3QMQA 2I6WA 2HIYA 2ZUAA 4KH1B 4I1TA 3UDVA 3CJ2A 3ULHA 4QPXA 1C0TA 4KT0C 5EUHA 2KZZA 1H74A 2B7BB 3JSMA 2MZSA 3TUIC 5HL7Q 1CJTA 2XMTA 1PGZA 4CO4A 1SC4B 4KGXB 4KY3A 4MK9A 4CO3A 1KN6A 1TAUA 2CQ4A 3PJXA 2HRYA 1HW8A 1JXLA 3K8WA 2HWTA 2HMIB 1UZHA 2C2NA 4ANEA 5HJYA 3P6YC 3H90A 3M8QA 3DOLA 4CZCA 2VASA 1SJ4P 5K20B 4IRDA 2RIJA 2MKCA 3LWLA 5C24B 3A8KA 2XSJB 3GV8B 1RHJB 2AYMA 4NPOA 1EIYB 1I94F 4I56A 3KLEB 2QA1A 1NSAA 1KQKA 4C8OA 4WYWA 1PJ5A 2JC1A 3FGVA 2CJYB 4LR8A 1WC0A 3PEHA 2KT2A 3PX0A 1FKOB 1I51B 2YKAA 4Q8FA 1Z2LA 1WC3A 1J5OA 2HFNA 4PG7A 1Q16B 2ZHOA 3NLCA 4AD6A 2JVOA 5DGBA 1P9YA 4X64F 2OJ3A 4U95A 4A48A 3TA0A 1WNEA 1SJQA 4LRAA 2CG4A 4DPOA 3DOKA 1U7LA 3CT9A 3M6WA 2KXNB 4DV0J 5G0RA 2UUAJ 2CPFA 4FKXA 5FIIA 4C8LA 5D6GA 2EXUA 4AFFA 1DBDA 2PMHA 4EBDA 2GA7A 2FVQA 2BKOA 4X66J 3HFKA 2VZ9A 3MEDB 3OTOJ 2ROPA 4DL5A 2VODA 1AZSB 3LQVA 5BR8F 4DF4A 4ILLA 1GNKA 1UEUA 3NY0A 2BMBA 5C42B 2AWZA 4ECYA 1FVSA 1Q8IA 3IG1A 3Q83A 1AFJA 2HMIA 1RXOB 4F36A 5GAGU 1Q1KA 3CCWA 1K1QA 1H6KX 2AJ2A 3GYGA 1EP4A 2R7WA 4NRTA 4G1QB 4RW4A 2C2RA 1FEEA 3UCZP 2Z57B 5J2QB 1TL4A 3CO0P 4CLSA 2ZM6J 2R7VA 1CEZA 1LWFA 3GQCA 2QT7A 2D3UA 3UD5A 4PWUA 4LVOP 3W5YA 5K8OA 4RW8A 4KGZB 2C1EB 3FFIB 3MEDA 3T5HA 2CAJA 1VRTA 2FJEB 2PEBA 4ZP8A 4BWJA 1B3TA 1K0TA 1XR5A 4ZLLA 5C42A 4O3RA 1R43A 4QCLA 1S9GA 3MCOA 3KUEA 2NXNA 1YJWS 3WX8A 1QJHA 1FX4A 2C2OB 2NUHA 1SL2A 2HFUA 2KI2A 2X1FA 1Q7YT 1N56A 2OFHX 1MNEA 1D3WA 4ZLJA 4DQRA 1IKYB 3UNGC 2ALYB 3PW5A 3HHNB 3FBEA 2C3UA 4L74A 5KFNA 2OPQB 2V4JB 3OR2A 1EB0A 1VYAA 4LSZB 2PI4A 4K50A 3K2YA 1BLUA 2EWHA 4K4XA 4CNZA 2CADA 2MZTA 3X1LB 1FDDA 3TAPA 1HMVA 4J9VA 2VG6A 4L76A 4P9SA 2N82B 1S9EB 2QA4G 1QSYA 3BDPA 1QVFR 3CJ5A 4ERDA 4LF1A 5D0GA 3CJKB 3D6MB 2RRNA 4DUYJ 1Q5YA 3R7BB 4KQZA 4OYWA 3MUMP 1S6OA 5EX3A 3V81A 1B4SA 1N6QA 3R3TA 5CCMA 4P2FA 1Q8KA 3LO3A 2BJDA 3BGRA 2VBZA 1N54B 1RT1A 3GR1A 3IXQA 5D4PA 4UOGA 2ZH5A 2RQ4A 1NH8A 3OVBA 1RQ0A 1NMEB 4CT8A 3MUVP 1X4AA 3T1YJ 4DR2J 3G2XA 1Q79A 1UW4A 3C14A 1YRUA 4RW8B 4QW8A 5KFGA 5K8MA 2FVRA 2JEGA 3OL9A 1LK7A 5K14B 4QIFA 2BE9B 2WW8A 5KFPA 2XTJP 2A6OA 2JOQA 4LF2A 3GCXP 2RHSB 3BBBA 3UD3P 1BXNA 2GJ2A 1RK8A 1SH0A 2B7CB 2DGSA 4L75A 2WB4A 3MM8A 3CTRA 3PM9A 3DHXA 3R27A 3MMBA 5D77A 3TVKA 3VGUA 3ZZYA 3ZZRA 3DCAA 2QFJA 4JV5F 3BN4A 1JLAB 2DY1A 2M8HA 2Q1LA 2HNZB 2MPUA 1FO1A 2WOMA 4WF9Q 2VG6B 4NE9C 1UJ4A 5HMZA 1VC0A 2ZBIA 3CC7S 4JI2J 3QATA 2HZVA 4HTJA 1F9HA 5D4OA 1K9MT 1C1CB 3E3XA 2CQ2A 3DRSA 2B56A 3UD4P 1K73T 2XGPA 3NP5A 3HCXA 1VK8A 3VZIA 4CLPA 3PJWA 2VG7B 4PUOB 4EEYA 3NGTA 3RW7A 4ZIWA 2BJ7A 2V8GA 1NJYA 2CJQA 2ZM6F 3GPAA 2YNHB 1S7HA 3D1QA 2E1MC 5DS7A 3JTNA 2LEAA 3NGUA 3IN5A 4ED1A 2MJUA 1GH8A 4EZ9A 1JLEB 1N33F 2YKNA 3DLLQ 5IWAF 3HM9A 2J76E 1Y0HA 4MKAA 2DPIA 2NQPA 3CJ0A 2H5EA 1QE1B 3DRPA 2UXBF 1FTRA 1VCTA 4KIAA 2CNOB 2H1YA 3QIDA 5J2PA 3TQEA 3POTB 4DR1F 4DR3F 1NAQA 1WHVA 1K44A 3HJVA 2W9BB 2ASJA 1M5PC 1X9WA 1S6UA 1FWLA 1TL1A 2OGUA 3HJFA 1MMNA 2LXUA 3ILOA 2CQCA 2H4WB 3GYNA 2XYHB 4FBUA 2RUSA 1IKVA 3V4IA 1N48A 1FJGJ 3K5PA 4UY8T 4JI8F 1HBMA 3CMES 4P7TA 2RHQB 4H4MA 1TVRB 2H54B 1FD2A 2JX2A 1KONA 3LH2S 5L46A 2KL8A 3G6YA 3IBWA 3Q24A 1WG4A 3SSQA 5A2QU 2FLLA 2E9RX 4RX6A 2W9CA 4DPWA 2KHCA 3EUNA 5A8KB 3NBPA 5MLCV 1C0UA 2BXJA 4ID8A 3AOCA 1S12A 2XWXA 3NWGA 3G4SS 2DEIA 1LWCA 3H59A 3QLHA 2XLKA 2VHGA 2HPUA 2D1CA 5ETOA 2DNYA 3O44A 2JFKA 4PYAA 4A8SA 4C4WA 1BQNB 3HHEA 2VBWA 1GX5A 3QT5A 3GONA 3U1MA 2IVYA 1UEVA 4WP8A 3VVTA 1JJCB 4ZS6A 1JX4A 1OY9A 2G1HA 2M2BA 3HF5A 2XSFA 3EJMA 4PXBA 3FRYA 4C0OC 2AJ0A 1TL5A 1WD6A 3TANA 1S1TA 3RW6A 4OL8A 1OSDA 1YRTA 1YX2A 3NS7B 4RBVA 1RABB 4UTGA 3VR1A 3D2WA 2J6SA 2QEXS 4HH0A 2DRBA 3FDSA 2YKOA 2YWWA 4CO1A 3TWZA 3V5RA 3TARA 1Y11A 2MTLA 2W25A 4HDHA 3OJUA 3T9ZA 3PX4A 2R7XA 1N0VC 1BQMB 4LUBA 4IR9A 2VJUA 1B7FA 2Y1JA 1QTNB 2VF3A 2YWFA 1F5AA 4CLLA 2MKSA 4J37A 1NLKL 5A2QY 2CWXA 4U96A 3D6TB 1UKUA 1U26A 5M2RA 2M52A 2HHHF 5JVHQ 1XNQF 2ZH3A 3HPOA 2WVFA 3M8YA 5B0BA 4EZ6A 4LVNP 2ZE2B 4LF8F 4PABA 4TQRA 3T19A 3RB0A 1XMOJ 1YSJA 4C0HA 4YUDA 4XK8C 2BJ8A 1SQEA 1UWBB 4HACA 4KRWA 2V2ZA 4F0KA 3KK3B 2RQMA 3G96A 4JI1J 1S1XB 5KFWA 4CH0S 1V3ZA 4JOUA 2CRLA 4YP3A 3RBEA 4FNIA 2IMWP 1RTJA 1ZPVA 2CNKB 1FFWB 4I7FA 4GRSA 5HATA 2RS8A 3FMBA 1T9TA 3S6EA 5KG7A 2BKNA 4WCEQ 5ETSA 1X5OA 2XCPA 1JQGA 4KO0A 1NO8A 3R8YA 1BQXA 1F9EB 3CCUS 5T14A 2BUNA 4DG1B 4W98A 3RBZA 4GKKF 3W7BA 3KHHA 3MXHP 2JWNA 2ZJPQ 1IJFB 3GILA 1G6BA 2CZ9A 3MURP 2W9AA 3OXFA 1IBMF 1RT2A 2C2ZB 1YHQS 3IWNC 1SB6A 2R7UA 2H4YB 1X9MA 1RT7A 2MLYA 2P9CA 2E5IA 2MSSA 3VWSA 2I38A 4AT1B 4F0MA 5J1EB 2UUBJ 1RISA 1U8WA 2W7AA 3JSYA 5L9NA 2I8EA 2V34A 2ZVIA 4G1PA 2Z30B 3UI3A 1M0SA 3CDAA 3W2WB 1YQHA 4UZBA 1SUQA 3EGNA 3Q8UA 4QW9A 1T11A 1LV5A 3R2DJ 1SBRA 5F9NA 2VJVA 2AYBA 3OR2B 5KT6A 3KK2A 2V9KA 5IT9U 3BPDA 2LVWA 3HO1A 3BSCA 2EBGA 1C0UB 1IQZA 4KHPJ 4ER8A 3HMJG 2F4VJ 2XYPB 4R25A 4F4WA 1BD6A 4WPAA 4GKKJ 1TQLA 4DUZJ 4DS4A 1RWXB 1NJXA 1T3OA 2VICA 3BB5A 3M8PA 3SQOP 4OHVA 4J91A 2VA3A 1OPZA 4C3MA 3G8SA 3KHLA 2MHNA 2HHVA 4F2SA 4KV8B 4RO0A 2ILZA 5I42B 1MROB 2CYYA 1HA1A 1TV6B 1PYOB 1WSRA 4JB8B 4A4JA 3KK2B 4X64J 4JI7J 2HHSA 3EZUA 4A8WA 2J0SD 3MPYA 2DGQA 3BS9A 3GP9A 4JP8A 3GFXA 3WIVA 2VU5A 2CZVC 2B5JB 1VI7A 4WP9A 4C8ZA 3OBIA 1R0AB 3W2WA 4KC5A 2AHOB 3CC4S 4X2BA 4AUKA 3PHTA 4QIEA 5DQIA 5LOQA 3EE3A 2OEMA 2RB7A 4IKAA 3G82A 2LECA 4NMLA 1WWHA 1PG5B 1KOOA 2HLUA 2OEJA 1ULRA 2OPRA 2FTRA 2WSCC 3H8YA 4FPIA 3UO0A 5GMDA 2Y8WA 4DV3J 4ICLA 1WF1A 4DCPB 2XI3A 4C8YA 3QRRA 4L72B 3ZO7A 4J9RA 1A6LA 2CDRB 1WI8A 4ES1A 5ETKA 2PA3A 4PPDA 2JZ5A 2HVZA 2ZNYA 4CTAB 4OHZA 4R5PB 3M2UA 4ZDNA 2NPIA 3GB0A 4MIAA 4IOCQ 1SKWA 2ZDPA 5CYQA 3K8VA 2IPOB 2C3YA 2ERRA 4B3TJ 2LA4A 2YNHA 1K8AT 1O6XA 4TN2A 1NZ8A 3MM9B 5L39A 4QJVA 4ZJOA 2ZZMA 2IY5B 3V6KA 3UDEA 1HBNB 2FC8A 4QOTA 1V3RA 3B78A 4NA2A 5IS2A 1FDBA 1WC6A 2R7QA 4PQAA 2CXEA 3SSSA 3TAMB 2KT5A 2RT3A 4HTIA 3B4MA 3UCGA 4F50A 3ILLA 1U1QA 5FDLB 3KLIA 1M1KT 3KLEA 1IR2A 1GK8A 2EFOA 3FCHA 1K0VA 2HBQB 3KUGA 5HROB 2VD3A 3DM2A 3GTYX 3M8QB 3AAWB 2HEKA 3MEEB 3AXMA 5A8RB 1VQ8S 1T03A 3GSDA 2DGVA 3N6NA 4DG1A 2FZCB 3QBCA 4NXMF 1Q8LA 1VLYA 4DV4F 4QYZJ 3AODA 2QA2A 3BKUA 3GIJA 2GGPB 3R9LA 9ATCB 3MD3A 3Q86A 3J7YI 3OFGA 3J80U 4DR5J 1LNQA 1VBYA 2IRXA 2NCKL 4OIXA 4RW6A 1B64A 2OSQA 3HVTB 4OX8A 1TKXB 3KJVA 2FZGB 3VGSA 4DL6A 3LTOA 3GIMA 2DNPA 3OJSA 1KNZA 2FY1A 3GJQB 4JYAJ 4Q43A 3OTEA 1IBKJ 2ROEA 1T9YA 5AE1A 5HLFA 2ROGA 3DLJA 4QWDA 2AMCB 1QLNA 2HQIA 2B6AA 4OYIA 5C25B 1LW0A 3HI9A 2MGZB 1XTZA 4PRFA 4AL5A 2ZBQA 1RACB 3IP0A 3HDSA 4DL3A 4HVZA 1NKBA 2I9SA 2KFNA 2PD1A 1BHNA 2DVIA 1RCOB 4RPFA 3AT1B 3MTKA 4Y65A 1NBEB 2RKIA 2V8HA 3N01A 6FDRA 4PPZA 2QLJB 2IFXA 3AQPA 3J7YU 3OUYB 4X65F 1HBUB 2FJDB 1KVIA 4B3TF 4OYMA 2HGMA 1FFGB 2WCXA 2MSTA 2A2DA 2C2KB 1UZDA 2HWHA 5FLXY 5THWA 1LOUA 3I9V9 3LF0A 1UPPA 4HEA9 5HVGA 5KFMA 3I56S 2DHAA 3KOAA 2QE5A 4BC9A 2CPHA 3C6TA 1H98A 1IWGA 1VGYA 4N77A 4OI1A 3SXLA 5LMUF 1BQNA 1CJTB 1U2FA 2PA8D 2NLWA 2JH3A 5D0EA 4DSKA 2C22A 2NXCA 1TMMA 5ETNA 3HSJA 3IR6B 3S8SA 2Z4PA 1MROA 5CYMB 4CH1A 3H4BA 1R8BA 2I5JA 3FQKA 4ZHRB 2LEBA 5DG9A 1OQ6A 2MKIA 2V4RA 4MFBA 5DZ7A 1R0CB 3H5SA 3N9UC 1IBCB 2BJ3A 1TMJA 2GQ2A 4KYZA 5IV4A 3MR3A 3H20A 1UVIA 4BCAA 3W3SA 2ZOMA 2K1RA 4KH0B 2P9EA 2J8SA 2F8HA 1OYEA 3VGVA 3UR0A 2E44A 2VFSA 1TKZA 1G4CA 1SH3A 4ED6A 1Q86T 4DFPA 1P8GA 1YJRA 1X4FA 2DJWA 3AD7C 3W60A 1FT8A 2XY5A 5E7OB 3QNWB 1VBXA 1M5VC 2FVPA 4EK2A 1NJWA 5DZ6A 4LSLA 4CI0B 2GW8A 1N6QB 2WTFA 2IM1A 2W01A 1S9EA 2XEXA 4U8YA 1IR0A 4B3RF 4ZHRA 2P2CB 1F2GA 1U6FA 1HNVB 4OQJA 2HURA 1NSKL 4OYOA 2VC1A 4CLWA 4B9MA 2OUGA 4I2QA 3OUYA 2J9DE 1KSPA 2H5IB 4R8UB 1NCLA 3BZQA 5LMNJ 4LF6F 3TAMA 3ZZ0A 1F9FA 4NEZA 4DV7J 2EFNA 2C3MA 1TKTB 4DCOB 3RJMB 2AJ4A 3J7ZT 3W64A 3ILIA 3W62A 2XC9A 4DV5F 1NU4A 3A13A 2HK3A 3ZTQA 5KFVA 3J81U 1WC4A 4YB6A 3DLKA 2V5HG 1VK3A 2EI5A 4OZJA 4Q0BA 3EDRB 2AJ1A 2G0CA 3HK2A 2ZBCA 1W7WA 3T6BA 4C11A 1B70B 4B9NA 5LMUJ 2F9DA 3BH7B 4RR5A 3I82A 1VHFA 2WZ1A 4CLFA 4JI8J 5D0RA 1BMQB 5KFHA 4CP5A 1LWFB 5J2MA 2GGPA 3PW0A 4QU6A 1LKZA 4Y3CA 3THPA 4NA1A 3W66A 2OHDA 3TA1A 2F9JA 1D8YA 1HI8A 5CAAA 4DLGA 3LWMA 4X4NA 4CLUA 5HQMA 2LDIA 2QC3A 2KKHA 1W26A 1NDCA 4Y2KA 1DLOA 1FA0A 1DTTA 4O3QA 5B0AA 1TK0A 1IKXA 2BJ9A 4IG0B 5RUBA 3AY0A 4CIOA 3J7AN 1GMWA 3ENVA 4DHVA 4NLYA 2KHDA 1NM2A 5KFBA 2JEFA 2IRYA 1S76D 3V2UC 4J9PA 3H98A 1PILA 2M8DB 2A3JA 3T5JA 5HP1B 3NOCA 4NLGA 2QSWA 2YPZA 2P9GA 5L8RC 2GQQA 3DLBA 4JYAF 1JWWA 2CQHA 3M9NB 5KT5A 1H7XA 1HQEA 1OS5A 3MEGB 3NKYA 4U8VA 2HNDA 3A8JA 3F56A 3MR5A 1E6VB 1QAIA 5IT9Y 1HMVB 2RD5C 1L3VA 1IJEB 4HYKA 2ILYA 5CHCB 4CYUB 5L9XA 3BV8A 4LRBA 3MTJA 1G3OA 3M30B 5CYMA 1M5KC 3D0HE 3KK1B 2ZH7A 2VC0A 2X7IA 5CQGA 3ZTPA 2HHWA 4OX9J 2UVWA 1R7IA 2QYGA 5DDPC 1N34F 3IWLA 1ELOA 1N32F 5CYJA 1DTQB 3UCUP 1U1NA 3CIZA 4LSNA 4P74A 4TYAA 1FJCA 2IM0A 4WE1A 2V69A 2C3OA 3RBXA 1U1PA 1EETA 1CJUA 1TELA 1NKCA 2WONB 3FK4A 1E6VA 1XIQA 2APOA 2CQPA 1M5HA 2G13A 4B3RJ 2QYCA 4O4GA 3KFWX 1S1VA 3KJQB 1JLGA 2ZVSA 2XI2A 3D67A 4CM0A 8ATCB 1SKRA 2BDPA 4JI6J 3DN9A 4H4MB 4ZVGA 3TYTA 5J1EA 4HHUA 1X60A 1UVKA 1MLAA 3DYAB 4RBTA 2IYIA 1MWYA 3HXMA 2D3OR 2OPSA 4F02A 3RB4A 3CJ4A 1HIYA 1H72C 3MOJB 2SXLA 4I68A 4DF8A 3D0IE 3PV8A 3FEXB 5KT4A 2H51B 1NDPA 2L9DA 3CPWR 1RADB 1T05A 1Q4RA 1UPMB 4YR3A 3GV5B 1R27B 4PG4A 2VV5A 3ETOA 4KPYA 2G0JA 2MY8A 3C15A 3F41A 3J81j 2CDQA 4FN5A 3JSMB 4ZPVR 3BKFA 4J9SA 4MYTA 1JJ4A 2HQCA 3H2LA 2Y1IA 5H9EK 4NMXA 4EWTA 2O01C 1GTEA 1UTAA 4Q2LA 5IC6B 1KVKA 3BPSP 4RUHA 1KHVA 2AYGA 4LRDA 1RP5A 3CJKA 5AJ3F 2RRAA 3G6XA 1NH7A 4N8OA 1VBKA 2Z2MA 1JLEA 2MQNA 2DNZA 3K17A 3ZZUA 5HN0A 2YQ3A 4HT7A 1N5YA 2RE1A 4Q7AA 4FF4A 3I9ZA 1NXIA 3WBZA 2DR6A 4J90A 1VQSA 3FZ2A 3MAAA 1NPRA 3UN5A 2B8QA 2M88A 2BEFA 2B8PA 3E51A 4A8MP 1RWVB 1PKUA 3SMZA 1CC8A 2QRRA 4WIIA 1H7WA 4O4GB 1VQ9S 2AX1A 1UMJA 3MECB 3SFUA 5D3GA 3A3PB 1CS4A 1BWVA 2O66A 4U7UK 5GAHI 5LXYA 4KO0B 1RLDA 2CQ0A 3DDIA 3I0SA 4FPRA 4MH8A 4O0NA 4JI4J 1OY6A 3R7NB 2YPYA 4PYDA 2KVIA 1YK9A 2QG9B 2FJXA 4IH6A 2MZRA 1LQ9A 4GVLA 1SJ1A 5HI7A 2OH2A 3QWUA 5IC4B 3CJTA 4P52A 1FK9A 2FHOB 5LSRA 5IFMA 2ZHAA 4L3KA 3GJRB 1NRKA 2V2VA 5AJ3J 5F8GA 3PHEA 3OD2A 2V8PA 2XZDB 3FUYA 4RNOA 3HVWA 3CCRS 2F3JA 3OL7A 2M70A 4AE5A 2AKWB 2ACYA 4NLOA 2DT9A 3RYLA 3IR5B 3FVYA 3QT7A 4C6AA 4DV2F 3IRXA 1UWAA 1QSLA 4JI3F 3P4UB 1FWPA 3H5XA 4ZCKA 3WZ0A 2GJFA 3L7UA 3M1VB 4RBUA 3AJ1A 3KLIB 4KBIA 4Y6IA 3T1AA 2ZZTA 5DG8A 4K5SA 1M90T 4F8RA 1H2UX 1N0UA 1WTFA 4EGLA 2F7VA 1EJ7L 3H5UA 4ZN1A 3MEKA
chains in the Genus database with same CATH topology
3IGVA 4ELUA 3V6DA 4ZPBA 5DLGA 3DGPA 3O6QA 1S1VB 3OTDA 2ZOFA 4Q5VA 3OJUA 2K8GA 2KM8C 4QWEA 3HVAA 3W2VA 4IFVA 4JI4F 4PG5A 5EWGA 4M94A 2RH3A 2LXIA 2WONA 4R0EA 4JI1F 2IM2A 4ZP7A 2BE2A 3CDUA 5KFDA 2LQ5A 5AXMA 3NAIA 1F0XA 1JLBA 5GMKa 2DNRA 1IKYA 3PW2A 3CJ3A 3LAKA 3LANA 3R5CA 2EVZA 4P7VA 1VQPS 3HKZD 3HT3A 4Q2MA 3DNCA 1S49A 2NZ4A 4NLRA 4OI4A 4Y0FA 2AQ4A 4C9DA 4JI6F 3DLKB 2L41A 3PO4A 2AYEA 2IJFA 3C8YA 1UL3A 3PY8A 1HBMB 2XMJA 2RSQA 4O44A 2HHUA 3TVYA 1GXTA 4ID5A 4FS2A 1DQ8A 2IMOA 4QIGA 2DR7A 2UUWA 2XULA 3EYZA 2OPRB 4Z37A 5AE3A 2ALZA 5A8KA 2UUAF 5J2NB 1N5QA 3UDLA 4CQ1A 1C4AA 2VKZG 5KFYA 1N5YB 2L3MA 4B9NA 4LF5F 4H4KA 2YNGA 4IFYA 1X8DA 4RW4B 2JL9A 1DQ9A 1D8ZA 3BQ2A 1JK9B 4NLQA 3CD7A 5K8NA 1VQ5S 5B09A 4ED5A 4O3SA 5DQGA 2GC8A 5L1KA 2YNFB 2IC3A 3BSAA 3LALA 4X4SA 4TQSA 2J7UA 5K5MA 1S0OA 1S79A 3BO2A 4AQYF 1XBWA 2EPIA 2BW2A 1RWUA 4RWXA 1ZAWA 3SZ2A 2AP6A 3CCJS 4QPTA 4J9NA 1UVJA 4U6PA 4DUZF 5D3GB 5E0OA 3QO9A 4F25A 1FK9B 1BC6A 2AU0A 2JHEA 2OP5A 4HDGA 1MU2B 3QGIA 4DJBA 4OZLA 1FNMA 2DGXA 2O1PA 3FSYA 5IQ6A 4RNMA 1D1UA 4RWWA 4EUVA 2HWIA 3PKYA 1VRUB 4QWAA 1C1BB 2VKRA 3GE9A 2ZH9A 4UUWA 1S6QB 2K2PA 2XG8A 5F0WA 4BBYA 4TNOA 1FJ7A 2J0XA 4Y28C 1DARA 2VA2A 2OTJS 4C98A 2VQEF 2NUUG 2AX0A 3DI6B 5U47A 4B17A 1Y3KA 5GAGI 2KRBA 2YKMB 1Y00A 2YWGA 3OV7A 5T7LA 1WG1A 3CCQS 2FJWA 4O23A 2KH9A 2MGZA 1YGYA 2V94A 3BF4A 1MU2A 3O5TB 4JV0A 2X1AA 4W92B 1KS2A 2BM1A 3AH6A 2XGQA 2A18A 2FJAB 2R8JA 2V9WA 1JLFA 5KG0A 3ZZPA 4DDFA 3OSPA 1XWLA 1GQEA 4OI0A 3T3FA 1Y3JA 2IHR1 2CJKA 4ED3A 2X3GA 2HS3A 5CH7B 1CC7A 1RA7A 5G4DA 1DHMA 2WSEC 1N8RT 5F8IA 4C97A 2L48A 1I1GA 1Q7LB 3MMCA 4O44B 4K59A 4TYBA 1FDAA 5DM7Q 5KT3A 2HQ3A 5FDLA 4RW7A 3I0RA 4B3OB 2FHKA 3N5FA 4N41A 1SIWB 2B4VA 3ENWA 5HMYA 3PIPQ 2PSZA 2Q66A 2EBEA 3MFHA 2FD2A 4ZOSA 4NLTA 2FUG9 4LF9F 3DHWC 5E41A 4ZKAA 4MKYA 2DNLA 4YDDB 3QGHA 4BC7A 3OR1A 3HX9A 1CPZA 5LMNF 1Z2ZA 2D7SA 4K5RA 4ZVFA 1AROP 3RR7A 3C3LA 3FEZA 3MOZA 4WE1B 2QMWA 1KFDA 4WZMA 3KJVB 2VH7A 3CD6S 1NK6A 4JI0F 3B8HA 3GFYA 2BVZA 3NNAA 2HZCA 1TL3A 2CJBA 3CB4A 3TR5A 4KFBB 2PC6A 2K7JA 1HD0A 3DOLB 2UV8G 4XAKA 3TRGA 3E2EA 3M1VA 3MDFA 5HQ8A 1B0TA 1QY7A 3MMCB 2LKZA 5A6WA 3NL0A 2NSCA 3MF5A 1L3UA 5B08A 2V4QA 1LW2A 1E6YB 2GFFA 3RRGA 1OSCA 1QSSA 3M8SA 3BQ1A 3OFFA 2CQBA 4DQSA 1FNOA 1VQLS 2KG0A 1FF2A 3G86A 1ZM3A 4IH7A 3DYAA 2NYIA 4OJ1A 5J2NA 2ZKTA 5DQHA 3K0JA 5I4MA 1YIJS 1YRXA 2E5LF 3BR9A 3PX6A 1X9SA 2D74B 2KFYA 2C28A 2FPHX 4QR2A 5F8LA 2O67A 3AQOA 1CG2A 2Y0SD 2CFXA 3KLGB 2W8KA 2F1FA 3BGRB 2BA9A 2RVJA 4OZ0A 1RT5A 5J2MB 1X5SA 3UPFA 4I2PA 2UVRA 1WEXA 2LA6A 3MZIA 4O4RA 4NX9A 2VG5A 4TY8B 2C2EA 1SUQB 1T7PA 2GX8A 3OW2R 5E3CA 2VFUA 4KB7A 3Q8SB 4J9MA 4FXVA 1HPZA 2PDAA 2ZH2A 3VAFA 3C6UA 1ZAVA 3WC2A 1NZAA 1GT8A 1PC4A 2A10A 2HNDB 2OFGX 3CDWA 1F60B 2BQRA 4GO5X 3MMAB 3QGGA 3HHKA 2KU7A 5DRKA 1SI9A 1TZ0A 1N5TA 4ECVA 1S1WB 3SQGA 1JXEA 1HI1A 2BANA 4IDKA 4ZP9A 4DSIA 1FCAA 3CE8A 1KD1T 4CH7A 3UE2A 3M8PB 2PMZD 4YOEA 1D0EA 2G1DA 3A8EA 5E3RA 1RTDA 3KG0A 3PXGa 5B0EA 3GIIA 4FF2A 1NEEA 2IJNA 2MKJA 2C3PA 3ZC4A 3KLHB 4WXOA 3L3CA 3VAJA 2HVIA 1R89A 1SIZA 5KFJA 1GAOA 2GV1A 4PXCA 2RF2B 2EFPA 2ZJQQ 3CULA 2FLPA 2BBEA 4AL6A 2F8MA 2IVFB 3NMAA 4LIRA 2DCLA 5K9FA 1Q81T 1VOMA 5F8NA 1RKJA 4YFUA 4ETXA 2ADBA 2RS2A 3D28A 5EWEA 2GHVC 3K5OA 4FF3A 3N6MA 3S7RA 2ZE2A 1N5SA 5KFOA 2E66A 4RNFA 4YHHF 3OLAA 3NS5A 5KFQA 3BQ0A 3FJ2A 1W2BR 3VAGA 4YB7A 2H9ZA 4ECUA 3LP1B 4TY9A 4BWMA 2KZMA 3U1NA 1UJ5A 3RRHA 3M8RA 2R7SA 1RTHA 5F8HA 3JB9k 1RI7A 4NL5A 2DNGA 2UUCF 3P49B 4X4VA 3SYZA 1RT7B 4OZNA 5DJBA 3PRDA 2W4DA 1X4EA 2FHJA 2HG4A 2ABYA 2W4CA 3NNCA 3TA2A 1FRKA 4DLEA 2L08A 2OMOA 2XMMA 2M0GB 4M5DB 2UUBF 3MM9A 2HYIB 4B9SA 5LSLA 4PXDA 1ZOTA 5F41A 4IUFA 4CT9A 1RT6A 2P6SA 1AXQA 2EC0A 1VIXA 3F73A 2ASYA 1HNZF 1WELA 3LP1A 1Y7PA 4Y2MA 1S10A 3M30A 2D41A 1L3TA 4X66F 1FRMA 4I2QB 4ZVEA 1H2TZ 4DQQA 1WHWA 4X4UA 3DC2A 4DL7A 5ITHA 1SJRA 1SC6A 4YQWA 1RGVA 5KFLA 1DZ5A 3MD1A 1TV6A 5KFEA 2CQDA 4TXSA 2DGOA 2UV8A 1L5UA 3LAMA 3H5YA 1HNXF 2DH8A 4GC6A 1HYSB 3BGUA 1XK8A 4FXWA 3GFZA 2DISA 3HHLB 5I42A 2HHPA 2MZ1A 1CQMA 5GAEU 5M2PA 3H40A 2E1AA 4MIWA 4DV6F 3SCJE 4LQ9A 4M5DA 7FDRA 2UVVA 2D3ZA 5E3QA 2B9YA 5EN1A 1NJIT 3MWBA 1J5OB 3D0GE 1P1TA 2XY7A 1RT3A 4PG6A 1V6HA 2WCXA 4IQMA 1FRXA 1X4HA 1HWIA 1YBAA 3IWXA 1S48A 5CYQB 2KXHA 5E33A 2BANB 4IDKB 4PG8A 4N56A 2XMKA 2HFOA 2XZWA 5GADI 2EW9A 3L09A 1UVNA 3R1LA 2AGPA 5EHHA 4AXJA 5KFFA 1R0AA 3M2UB 4H4KC 5E3AA 4A8OA 1UVMA 3Q8QB 2VQFF 1LFPA 5KG5A 3RTVA 1X0PA 2GIRA 4IFVB 1KQFB 3MEGA 3NCRA 1HD1A 2C2DA 5BYQA 1LXJA 3K5NA 2DK2A 2GQCA 4KGKA 4B02A 1KFSA 4M95A 4NLUA 2WB1D 3TW0A 2XWYA 3R5AA 4ECWA 1KTVA 2X51A 1YJNS 4ZPDA 4IYQA 3MM5B 2J0WA 3EXYA 3BO3A 4DV7F 3LW5C 2NREA 1DFDA 5DO2A 2K1RB 3HVTA 1S4FA 1JLFB</