2F9DA

2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Pre-mRNA branch site protein p14
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9dA01
2HZCA 4QU7A 4YB1P 2MKCA 1YIJS 1SJQA 3CCSS 2CQIA 3VAGA 5DM7Q 2M0GB 2DH7A 2MZQA 2MPUA 1HD0A 2L41A 4IOAQ 3CPWR 2DGQA 2AD9A 1U2FA 2KU7A 3RW6A 3P6YC 2DO0A 3B4MA 2RRBA 2J0SD 3CMAS 2J0QD 1N52B 3UCUP 2RS8A 1M5KC 2U1AA 5GAEU 4QU6A 2AYEA 2CPZA 2HYIB 2XNQA 2MQLA 5GVQA 2F3JA 3VAMA 3IRWP 3H2UB 1VQPS 2JVRA 2N3OA 5IFMA 2U2FA 4WFNQ 1X4EA 3CC4S 2DNNA 4A8XA 1JJ2R 2VOPA 2CQDA 1VBZA 2HGNA 2MZ1A 3NS5A 4W92B 2X1AA 3SDEA 1WTBA 2CQPA 5GMKa 3CCRS 2M8DB 2F9DA 1OO0B 1B7FA 1WHWA 1YITS 1KOHA 3PIOQ 5LSOA 3CCES 2V94A 3TYTA 3BO3A 4WIIA 2VOOA 1FXLA 1FO1A 1S72S 2DHAA 1WG4A 3P49B 3SMZA 2DNKA 2CQ4A 2LMIA 5EN1A 1FJCA 2MGZA 1M5OC 3CMES 3NNHA 1DBDA 4LJMA 3CCUS 2GO9A 2DB1A 2DITA 2DNRA 4Y0FA 1DZ5A 2XS2A 2VODA 1PGZA 1N8RT 3CC7S 3VALA 1U6BA 3TO8A 2HVZA 2M70A 2KVIA 3MXHP 1VQKS 5DDRC 2MQNA 1A9NB 2LA6A 1VQ4S 1U6FA 2DGXA 1WF0A 5GADU 3I55S 2KYXA 2HGLA 1VQOS 3EGZA 3IWNC 2N82B 2LA4A 1K73T 3G4SS 3H2VE 3G6ES 2ZJPQ 3R1LA 2EVZA 1YHQS 2D9PA 1F9FA 1R8HA 2M8HA 2DNGA 4ZKAA 2ADBA 3G8SA 1O0PA 3UWTA 2RQ4A 1X0FA 3J7ZT 2B0GA 3ULHA 1W2BR 1VC0A 1X5SA 3HI9A 2DGTA 3UCZP 2LXUA 1SJ4P 2OSRA 3V4MA 2DGUA 1JJHA 2E5JA 3DXBA 3BO4A 1U1KA 2M88A 3US5A 2UP1A 3S6EA 1Q86T 3G9CA 2DISA 3THPA 3CD6S 5DDQC 2MQMA 2DGVA 2DNLA 4WFBQ 1WEZA 4TLQA 2QFJA 5FJ4A 2EK1A 4TU8A 2YH1A 2KN4A 2X1BA 1A7GE 2RS2A 4F02A 1U1QA 3BEGB 1H2UX 4W90B 1DRZA 2XNRA 3SDEB 1P27B 5IM0A 3MUVP 5LJ5Y 2MMYA 3CUNA 3MD1A 1VQ5S 4WKRA 5CA5A 1VQ6S 4TU9A 1OIAA 2MKHA 2KFYA 3SXLA 2LYVA 2OTJS 2X1FA 2NLWA 1U1LA 2CQBA 3ZZYA 4Z2XA 1H6KX 2DIUA 1U1PA 1XN9A 2MY7A 5LSLA 1NJIT 4YOEA 1WELA 2ZJRQ 5GAGU 2BZ2A 1D8ZA 2E5IA 3EX7B 4J5OA 1HL6A 3BO2A 3Q2SC 2RNEA 1WHXA 4M5DB 2DH9A 3G96A 3MOJB 2AYGA 2E5HA 3G71S 2JX2A 3R1HA 2M9KA 2DNQA 5H1SV 2DNHA 1DHMA 2VONA 2E44A 2MKIA 2A3JA 2DHGA 3CCLS 2CQ2A 2XS5A 3L3CA 2KM8B 1VC6A 2MZRA 5GAHU 2L08A 2M7SA 2CPHA 3VAHA 1KD1T 3R27A 3CTRA 3NNCA 2LECA 4UQTA 3UE2A 2KM8C 2KXNB 1VBYA 1FJEB 1FHTA 3MDFA 5BJRA 2WBRA 1U1NA 2OIHA 2CQ3A 4CIOA 4U67Q 4TU7A 2FC9A 2I38A 2J76E 1Q82T 1ZZFA 1KQSR 3FEYB 3MD3A 1X5PA 1HA1A 1UFWA 2DO4A 1M5PC 3S8SA 4QPTA 1YJWS 2MZTA 3ZZZA 2MB0B 1PO6A 4CH1A 2G0CA 3CF5Q 2CPEA 4EGLA 2KG0A 2KHCA 1JJ4A 2QEXS 2DNZA 2LEBA 2G1DA 3P5TL 4ERDA 3CXCR 1AUDA 2KXHA 2ERRA 2ZJQQ 2GHPA 1VQ9S 2N7CA 3VAIA 1OPIA 2DNPA 3D2WA 3K0JA 2DGOA 4P6QA 2G4BA 2SXLA 2XB2D 1WI8A 1RKJA 2MXYA 1X4GA 5HO4A 4RU2A 2KI2A 1M5VC 1UAWA 1WF1A 4F26A 2OJ3A 3NS6A 2MQQA 2CPXA 5IM0B 5LJ3Y 1ZZNA 2DHXA 2MKSA 1R8PA 2MSTA 1H2VZ 2DGSA 1OWXA 2D9OA 5JVGQ 1U1RA 2M52A 1CVJA 3CCQS 1YJ9S 5ITHA 2YH0A 1KOOA 2D3OR 3TP2A 4IO9Q 2CPDA 2DNOA 1K9MT 3DLLQ 1UW4A 1WG1A 3J7YU 1X4HA 2MKJA 2OTLS 5LXRA 1L3KA 2MSSA 2I2YA 4BS2A 5MLCV 4V19X 1UP1A 2DNMA 3Q2TC 1WEXA 4Y00A 5JVHQ 2DK2A 3P3DA 4OZ0A 1ZH5A 1K8AT 2KT5A 1FJ7A 2CQGA 3RW7A 2O3DA 4WFAQ 1JMTA 5DM6Q 2KRRA 2M4MA 1Q81T 4LMZA 1N88A 1NO8A 1SJFA 1SJ3P 2L9WA 3BS9A 2JWNA 3NMRA 2LQ5A 2MY8A 1M1KT 1P1TA 2RUGA 1HD1A 3LPYA 3VAFA 3THTA 1YJNS 1VQ7S 1X5OA 1WHYA 2JRSA 2KG1A 1M90T 2KXFA 2MGZB 1X5TA 3S7RA 4CQ1A 4ED5A 3U1LA 4UY8T 1X4DA 2CQ0A 1YTYA 2CJKA 2Q79A 5D77A 2F9JA 3CULA 4IOCQ 4WF9Q 1H2TZ 2LEAA 5DETA 1QVGR 2CPYA 3CCVS 1G2EA 3NNAA 2M2BA 1NU4A 2CQ1A 5IQQA 1FNXH 1VQNS 4PR6A 3VAJA 1FT8A 2MQPA 2FHOB 4YUDA 1X4AA 2FPHX 2CQCA 5DDPC 2BOPA 2RT3A 3HHNB 1VQLS 3MUMP 4OZ1A 3B4DA 1S79A 4QQBA 1X4CA 2CQHA 2RRAA 3EGNA 4C4WA 2YTCA 3VF0B 3OW2R 5LXYA 1QVFR 2RU3A 1WI6A 3MUTP 2MHNA 2K3KA 4PRFA 3PIPQ 4FXWA 4FXVA 2LKZA 3VAKA 3S01A 1QM9A 3FEXB 1YWXA 2MZSA 2PEHA 4C0OC 2DGWA 1VQ8S 2X1GA 4IUFA 2FC8A 2RQCA 1WHVA 1SJRA 2XS7A 2KH9A 3UCGA 4WCEQ 2DNYA 1KC8T 1D9AA 5CXTA 1WG5A 2N3LA 2MQOA 1IQTA 4CH0S 1YI2S 2DH8A 5HL7Q 1RK8A 2OSQA 1BY9A 2KRBA 3U1MA 3CCJS 1URNA 2ADCA 1U1MA 1N54B 3JB9k 1VC5A 2XSFA 2MJNA 1VBXA 2DIVA 3G8TA 2MZJA 2CPFA 3LQVA 2RVJA 2YWKA 1SXLA 2E5GA 3MI7X 2LCWA 1Q7YT 2CPJA 2MYFA 4LIRA 5CYJA 2EK6A 3CC2S 1WWHA 2YKAA 5D78A 1U1OA 3UD3P 5DDOC 2MKKA 1VQMS 2CPIA 2FY1A 2HGMA 3UD4P 2LXIA 2NZ4A 2JVOA 2DHSA 2AYBA 1WEYA 1X4FA 1X4BA 4C7QA 2QA4S 2PE8A 1WF2A 3MURP 3N9UC 3I56S 3CCMS 2J8AA 2AYMA 2K8GA 4PKDB 4F25A 2MJUA
chains in the Genus database with same CATH superfamily
1T0TV 4YB1P 1EIYB 1FKPA 5F9LA 2BKNA 3HVWA 3HPOA 2XYGB 1C1BB 3BH7B 4OZLA 1CULA 4B9NA 4E8UA 2F3JA 4TYAA 5KT3A 2C22A 1FJGJ 3NWRA 3CDEA 2RKIB 3A12A 1EP4B 3MEEA 4P73A 4W92B 3TUZC 3HJVA 4QJVA 3CCRS 2GIQA 1HYSA 1B7FA 4NEYA 5E3QA 1SI9A 1NH7A 2RF2B 2OLWA 1PYOB 1WORA 3F56A 1FX4A 2CQ4A 3GYNA 2ZH3A 2JEFA 3FUYA 4EWTA 3OQ2A 4NCGA 2DB1A 3L7PA 1S1UA 2R7WA 4PPDA 4M5MA 1JWWA 2HHPA 3NL0A 3N79A 4DR7J 2BYCA 4C11B 1RAJA 4OYMA 3EGZA 4DI6A 3IWNC 1WOOA 2VIHA 2HAIA 2ZJPQ 2EVZA 4KFBA 3SEOA 3ZO7A 2DR5A 3G8SA 2V8VA 4HHHA 1KWMA 1GMVA 4TY9A 4OQJA 3ULHA 2E7WA 4ED7A 4ZPBA 1WSVA 3B6BA 4HTJA 5T41A 2V63A 2IY5B 3GJRB 4DQIA 4LQ9A 3MMBA 1BE4A 1S9GB 4HI2A 4DN9A 4QW8A 1GAOA 3W63A 2QFJA 2X3DA 4DBQA 3U02A 4NPOA 3D9BA 2X1BA 3NMAA 4KGMA 1HNWF 4ZVRB 2EW9A 3W65A 4DV2J 4YB7A 3ZZRA 4DQPA 3D5MA 1L3SA 2NXJA 4IG0B 3DRPB 4X4OA 1KLMA 1VRUA 4R0JA 2ZC4A 1J2VA 3O6QA 4OJ3A 5HN0A 1WSRA 1SL0A 2QV6A 2Z0GA 3TJAA 4K5RA 4B3TF 2QMWA 2IJNA 3HDSA 4HYKA 1Q78A 3CW2C 2YQ1A 2MZRA 3QJPA 1KD1T 3GZ7A 4DV5J 1RHKB 5ETVA 4N76A 3M1VB 8ATCB 2OD4A 4DR1J 1NSQA 4IOBA 1RJJA 4JI3J 3W2WB 1X9SA 3VR1A 3BN7A 4X64J 2R8GA 2CIMA 2AJ2A 4DUYF 2XQCA 2BR0A 4LFAF 3I4PA 2C3UA 3BQ2A 3ILIA 5KT5A 3GFYA 3HFVA 3I96A 3BKUA 4YB6A 5J1EA 1N33F 3DNCA 2V69A 1HQEB 5HROB 1VLYA 1SJ3P 3T5JA 1QSLA 5KG0A 2K2PA 3MEGA 4JV2A 2XSJB 4WFZA 3GFZA 3BSOA 2WHOA 5ETOA 4IH5A 1T9YA 1N5YA 4LRCA 3GG0A 1G2EA 3NNAA 4A8KA 3DLBA 4B9MA 3IP0A 4FF3A 4CRJA 4ZLJA 2RT3A 3KNAA 3B4DA 1OQ6A 4MK7A 4RUBA 4O3PA 2ZM6J 4LF4J 1GXUA 3PIPQ 1LWFB 5IOLA 3J7YI 2QA2A 3LW5C 4USHA 4FVCA 2KH9A 1RABB 1KC8T 4DV3J 2B43A 4UTGA 2OPSB 5D6GA 1F60B 1T8EA 1EAYC 4JI1F 4N7TA 3QAUA 5L9NA 2QSWA 2MZJA 3BGFA 2ZUAA 2VKZG 1UVLA 2KT2A 1SXLA 5J2NB 3TNVA 8RUCA 2Y0BB 1NJXA 1UEKA 3C46A 4CM0A 3UI3A 3HVTA 3K58A 1SCJB 2AQ4A 4ECXA 2W9BB 1RAFB 1VK8A 4LVOP 2DPIA 4NEZA 5DM7Q 4ANCA 1T3NA 4RKUC 2RQMA 2Y8WA 4ZP6A 4B3OB 4QWBA 3J80Y 2NXEA 2Z57B 2YKMA 3C2PA 2Q1LA 5A8RA 3K5MA 4O3NA 1GX6A 5KFFA 1K47A 1T02A 4JV5F 2GIRA 3M8YA 2HBYB 5K5MA 3DLJA 5H9FJ 2E29A 1RWKB 1YG0A 3SFUA 4A46A 5GMKa 2M8DB 2X7IA 1FTCA 1TUVA 5KFQA 3DU6A 2J8SA 4IYQA 4WIIA 2HBQB 4B3SF 4G3IA 2IVFB 4JI6J 3C14B 4F36A 3KK1A 4UZBA 4JI7J 1KQGB 3H25A 2R8JA 3UNYA 2UUBF 1PGZA 1S99A 4ELVA 1K1QA 2XLKA 5AE2A 4J9LA 4ZA1A 3JYTB 1JX4A 2V2ZA 4NXNJ 4JV1A 3I55S 2CJYB 3OPKA 1V3ZA 4MKVA 1H72C 2VL1A 4EO6A 2E1CA 2XMWA 3FKBA 2IM3A 5A0YB 4YR2A 1Q95G 4O4RA 1H3DA 2HHUA 3M9MB 2BEFA 2ZH4A 1HNIA 2HZAA 5LL6d 2NSCA 3THPA 5C5JA 2YKPA 3CGIA 4WE1B 2YNIB 2BJDA 5GMDA 2OPRB 5B0AA 1HQUB 2AT1B 2RIJA 3E8OA 4JI2F 3M6XA 1HBUA 1VQ6S 1FRJA 4GKKJ 2MKHA 1JLGA 3SXLA 4NI2B 3OVSA 2OTJS 2HLTA 2ZJRQ 1WKJA 2WOMB 4C98A 4NLPA 1HL6A 2RNEA 2DR6A 4LBHA 2I5JB 3H5YA 3MOJB 1FEHA 2GQCA 1R31A 3CCLS 4UOFA 3L3CA 4X62F 4I68A 1E6YB 5C2CA 1YLXA 3GIIA 1C1BA 2M7SA 1RWNB 4DQQA 2FC9A 2R2SA 1X5PA 4DSJA 2Z56B 2C2DA 3V81B 3EXYA 3ZNUA 5IV3A 2RKIA 2CPEA 1EP4A 3U1NA 3TRGA 4NLXA 3SCKE 4EI2A 5KOWA 2D41A 4JI5F 3CEDA 4HDGA 2ROEA 4J7CA 2ZE2A 4PXCA 4N41A 3EE3A 1DQAA 3OVAA 3D2WA 3I4HX 3SSRA 1HBNA 2VPYB 1NK9A 2Z4PA 3UQSA 1Q8IA 4F4AA 4F26A 2P9CA 5LJ3Y 1A0OB 4IO1A 3T41A 2JC1A 1HBOB 2OD6A 3RYLA 4ZCKA 2WW8A 2R3VA 4DQRA 1U1RA 4PG6A 3KHHA 1S7HA 3O8WA 4JBCA 2IFXA 4GRSA 2MKJA 3OSNA 4C11A 4O3OA 1VQSA 1NPRA 3H59A 1UP1A 2DK2A 3P3DA 3KLHB 1ZH5A 3RBDA 3G87A 4WFAQ 1NO8A 3PFEA 7FDRA 4CT9A 4PXDA 3H42A 2BVZA 1XQIA 3GYXB 4TXSA 2EFPA 4Y2KA 1YTYA 2Q79A 2BANB 1WC3A 1JKHA 3AFGA 3R7BB 1O51A 1QAXA 1NU4A 5DZ6A 3LGMA 4PEOA 4K4VA 4IG0A 2CQCA 3GCXP 2OI2A 4I2QA 2PI5A 1T7PA 3UDEA 1QTMA 1ZTWA 3LGHA 3MUTP 2Y1JA 4M5HA 3CCZA 1YWXA 1K0VA 4B9VA 1D1UA 5HATA 4WCEQ 2F5GA 1TMMA 2O01C 1ZA1B 3SBMA 1WG5A 1TKXB 3MAHA 2DD8S 2FGCA 5CCLA 2W4DA 2LEPA 3FFIA 2GQ2A 3MOZA 4ZVHA 1NPPA 2XMJA 2B51A 3M1VA 3R9LA 2PMHA 1LK5A 1X4BA 1GMUA 2J8AA 4F25A 4J9MA 2MKCA 3GP9A 2M0GB 4K7QA 4LFCF 3R7SB 5E41A 1NSKL 1WTFA 2W9AA 3C15A 5K20B 1RWVB 3AJ2A 5DQIA 5GAEU 2XNQA 4YQWA 5L1JA 2JEIA 2OUGA 3BN4A 4F50A 1RTDB 4KGXB 1IJEB 2R9LA 1KBRA 4NXMF 1MMDA 2CQDA 1FRLA 3PHTA 1RA7A 2CQPA 4YN3B 3MGJA 3NBPB 3TYTA 3MHYA 4HR2A 2K7JA 3M6VA 6AT1B 2CRLA 3DHXA 4Y0FA 1U09A 1Y5IB 4ECYA 1U6BA 2WCXA 2LFVA 4DV1F 2ZKTA 2C2RA 1VISA 4DX8H 2W7AA 2R2RA 1AFIA 1RZMA 1IUJA 1W26A 1FERA 3H2VE 2JH3A 4IKAA 2BXJA 4KIAA 1X0FA 4S0MA 1F1BB 4ANDA 3KLEB 3A13A 4QWEA 2MKYA 3DLEB 1RGVA 3VV2B 3CMQA 3KJVB 1JXEA 2KTQA 4RPFA 1NAQA 4I64A 2FGOA 3HSGA 2OPSA 3QFHA 2FJXA 2KN4A 1AUSL 3NKYA 2RS2A 1NUEA 1VQYA 4ZLNA 1WD6A 4FYDA 1N6QB 1GMWD 3FQLA 5J2NA 1TL5A 1YJVA 2BQRA 2EBGA 4C0BA 1RTIB 4KKOB 4UOGA 3F41A 2YKNA 5B08A 9RUBA 2GVZB 4KHMA 1H6KX 1BWVA 3DOKB 1U1PA 1YRUA 1NSAA 1CQMA 4O23A 2WTFA 3RAMA 2FJDB 2W9BA 2DEJA 2VV5A 4DZDA 3W9JA 2DHGA 4B3OA 1TFWA 2KM8B 5B7WA 2CPHA 3Q8PB 3NGUA 1XWLA 2KM8C 1C4AA 3Q8SB 2H51B 1V6HA 1TMJA 3ZZOA 4U67Q 3FSIA 3T1YJ 1S1TB 1NNDA 4YHHJ 4ZJLA 2Q66A 3FRYA 4CT8A 2UXCJ 3FSXA 3VZIA 3VVUA 1SH0A 2QEXS 2GIFA 1S6QB 4Q5VA 3EPGA 3CIMA 4N47A 1P6TA 1QAYA 4C3MA 4LF5F 4KYZA 1RT5B 1OPIA 2OHDA 3OHBA 2JC0A 2G13A 4ES2A 2MXYA 4Y2IA 3C14A 4G65A 3E2EA 2MKSA 1CJTB 2HLUA 4EZ6A 2D9OA 2IRYA 2W24A 5KFHA 3EUNA 3GG1A 2R2TA 4ZHRB 4ZDNA 4DCPB 1UCNA 1DTQB 3OTOF 2NUHA 1OY9A 4JI8F 4XO0A 1RB0A 3BF4A 4C48A 1DLOB 1SL1A 1S0NA 2MY8A 2RUGA 1QE1A 5BXIA 2B5JA 2BX6A 2BQUA 2KG1A 4Q7AA 3OR2A 4ED5A 2VFTA 2JNJA 3K7RA 2C2ZB 4EUVA 2GVDB 3QRPA 1B7YB 3MMJA 5ADZA 5DGBA 4WE1A 1N0UA 3D6MB 1FJGF 3KHLA 3HHNB 1SC1B 4K2JA 4RNMA 4MYTA 4DR3J 2MHNA 2XWXA 1N36F 2LQ8A 4NL5A 1HW8A 4QR0A 2QE5A 4QBUA 1SJRA 1ITPA 3TAQA 4DL4A 2I5JA 3WIVA 2V8GA 1N5VA 2DRDA 1NDPA 4NA3A 2VH7A 1E6YA 1UZHA 3H40A 4KAIA 2CPFA 2RVJA 5DLGA 1NHKL 3J7AN 4OYIA 2GMJA 5DDOC 4OYAA 1GX5A 3DDKA 3V81A 5HP1B 2ZH1A 1WF2A 3I56S 4CYUA 2QL9B 4ZVOB 2HZCA 5E3CA 1YIJS 3OL9A 2B4UA 4U8VA 1Q53A 1S1XB 3DOMB 2DO0A 1HNVB 2LDIA 5KG5A 2WAQD 1N0VC 3UCUP 1KRPA 1LFPA 1S1VA 4ZPTR 5G0RA 4I6YA 3PG9A 2GHWA 3QBCA 4DV2F 2DXEA 3M6WA 3CC4S 3SZ2A 1AFJA 1JJ2R 5DG8A 4NLUA 2ZOGA 4U8YA 1WNEA 3KHGA 2V6AA 3C8YA 2VUGA 3ZZ0A 2VF3A 3KLHA 3NAIA 1C0TB 4GO7X 2BKOA 3NCPA 2QZ8A 2UV8G 2WB1D 3CCES 3CD0A 5A76A 4L76A 2HFOA 2W01A 2AJ0A 3SMZA 3CSKA 1DY3A 1XMBA 3CMES 3LAMA 4LJMA 4Q8FA 2DITA 2W9CA 3RZAA 3FNNA 2OH2A 1N8RT 5KFAA 2WW4A 3MXHP 2NSBA 4GKJF 4OZNA 3NWGA 4DV5F 3J81j 4O0NA 4WP9A 2LA4A 2B6AB 2QL7B 4JYAJ 4FYWB 4C8LA 3G6ES 1SB6A 3R1LA 2EFNA 1IVZA 2K7KA 4DR1F 4OI4A 1O0PA 3DRRB 4TQRA 2VQFJ 1VC0A 4WFXA 1RAHB 1MU2B 2F8HA 3ISNC 4DJBA 1X5SA 2C2KB 2DGTA 1Y5NB 1FFGB 3IBFB 4U7CA 4BCAA 5IT9U 3CCTA 1JLFB 2O1PA 3UVJB 2EBEA 1MN7A 3MM8B 2DGVA 3BGLA 5KFWA 4EZ9A 4CZCA 2IYGA 3MPVA 3IO1A 1JNZB 4OZJA 4ZP9A 4OI1A 3PX0A 3W5ZA 1BQNB 3MFHA 1Z2LA 2WVCA 4RJVA 4EBEA 5M2PA 5CHCB 3HVRA 4DR6J 4M63A 2OELA 4DDFA 1NJIT 4EYIB 2BE9B 1HI0P 2ZH8A 2A10A 2I9SA 2A6OA 4K4TA 1XK8A 4USVA 4H4OB 3JQKA 2AYGA 3A4TA 3R1HA 2IHR1 2MKIA 3M8ZA 3K8WA 1S48A 1FRXA 2W4CA 2HRTA 3MCNA 1H7WA 1R27B 3D0IE 5CZXA 5D3GB 3MM6A 4L6V3 3DN9A 1Q7LB 4ITSA 2DO4A 1RU1A 1FRHA 2WONB 4ZCIA 3GV5B 1J5OA 3CJ0A 5B0GA 5J2PA 1ULRA 2NR0A 2YPYA 3NBPA 4U6PA 2J9DA 2XZDB 1UJ5A 3OL6A 3GFHA 2XLIA 1X4GA 4AL5A 4NA1A 2J9DE 2DCUB 1IKXB 3D0GE 2WZ1A 1IBKF 1H74A 1S1WB 2YH0A 3A8IA 3FK4A 2IM0A 3N01A 2XGQA 4Q45A 4ID5B 3M7VA 2COLA 1LKZA 1BD6A 1VLOA 4ECTA 4H4KC 3I32A 4EEYA 5J2MA 1XNQF 3KLEA 2RH3A 4Q43A 2XCPA 3DLEA 3GLJA 1TL4A 4R8UA 4A8FA 4N5SA 3KJVA 3KXDA 3DXSX 4UY8T 2ATLA 4K2XA 3BM7A 4QYZJ 1LW0A 4LR8A 2PFDA 1IKWB 4OJGA 2IMOA 3PEHA 4QOTA 1RYSA 3VAJA 2H5EA 2PMZD 3WC2A 3PYGA 2OMOA 4KKOA 2CQHA 4CO0A 1V9OA 3VF0B 3OW2R 1YGYA 1ZM4A 2GVZA 3G6VA 2V0NA 4FXWA 4CO5A 4ED3A 4KSEB 5HSPA 1VQ8S 2X1GA 1CC7A 3JTPA 2FC8A 2RQCA 4FYYB 3AODA 2DNYA 3HO1A 2V8DA 5IQ6A 3LTOA 4PG8A 3MECB 2J6UA 5KFTA 3W5YA 1YI2S 4QW9A 4WK3A 3CCJS 5D4LA 2DKOB 1Y4ZB 2HRUA 4ETXA 1XTZA 1FVQA 2FZCB 1NK5A 2MYFA 3FBCA 2O5DA 4DUZF 3QMQA 2V9WA 3CJ8A 4NXNF 5E5NA 4J9KA 1VHFA 4DU7A 5IWAJ 4X4PA 2DBBA 3CO9A 2QA4S 3N9UC 4LRDA 4DL3A 3TUIC 4CWBA 1SL2A 3D28A 3NGDA 2VA3A 3FC9A 1I94F 2MZQA 3AXMA 1Q1KA 2DGQA 2AD9A 1UL3A 2DHHA 1CJTA 5C42B 5EGYA 2OGUA 3SCJE 1TKDA 3V6DA 1RT7A 2U2FA 3HMJG 2DNNA 1CQNA 2ZKUA 4UY85 2HGNA 2X1AA 4GKKF 1UMJA 3SDEA 4ZN1A 4L73A 4X65J 3A1YG 4LF1A 4P9SA 1WHWA 1YITS 3QO9B 3T6JA 1DLOA 4N77A 4U96A 4DCJB 5I4MA 4DV4J 2DHAA 3GIJA 2VFUA 4LIWA 1BLUA 5EWEA 2AGOA 5EN1A 1DBDA 2CNOB 2GO9A 3BPDA 5F8LA 1NKEA 4F7VA 2LQ9A 3KG0A 2M70A 4ZK7M 3KLFB 1T3OA 1SIWB 4Q8EA 5AJ3F 4NLOA 3M2VB 1BQXA 2G0JA 3A3PB 4ZKAA 2QC3A 4DL7A 1ZAXA 4NCBA 4R25A 4RWWA 4ZPAA 2XLJA 2DGUA 4ID8A 4ZIWA 4FXDA 3US5A 2XEXA 3X1LB 1ZM2A 1D0EA 1FCAA 5H9FK 5M2RA 1Y0HA 1W7WA 4NMLA 2CUYA 5L39A 2XI3A 2VBWA 3B82A 2PSZA 1S9EA 2VG6B 5JJBA 3PW0A 3LO3A 5DG9A 2V8PA 2QA1A 5CA5A 4A47A 5KG1A 6FD1A 1U8WA 1TVRA 3MZIA 3ZZTA 2B3TB 2HIQA 5HP1A 5KFCA 4LF7J 4DSLA 2E5IA 4P7TA 2R8IA 2LQBA 1KHVA 1U0HB 2YY3A 1IWAA 3G71S 1CBKA 1QTNB 5CABA 3HXMA 3BGRB 5G4DA 3RU0A 3VVTA 3QAEA 4WU3A 1KN6A 3NNCA 1VBKA 1S6OA 3PEJA 1WACA 1FJEB 3CDBA 4F0KA 1T05A 3FEYB 3IRXA 5KG4A 3OFHA 1PO6A 3ZC4A 5DG7A 5C24B 2KG0A 1ELOA 4F3MA 3P45B 3M9OB 2CZVC 2VBYA 4ZVGA 1SUQA 3T5KA 1C0TA 3MMAB 4CLTA 3VAIA 4QCLA 3EDQB 2RHQB 3DFEA 2BJEA 3HHLC 4PXEA 4RUHA 4LFAJ 4F8RA 3MWBA 2JFKA 3FQKA 1JB0C 2BM0A 4O4GB 2CFXA 2C42A 3EMTA 3AQOA 1YJUA 2N4CA 1N33J 2M52A 5A8WA 3D67A 1GXTA 2RB7A 1K9MT 4XIUA 1E6VB 1X4HA 2MSSA 2N7YA 2HW3A 2B6AA 2FQQB 3PR4A 1RTZA 3LP0B 2FVQA 5DM6Q 3DRRA 3E01B 3P8BB 4MFBB 5J2QB 1M1KT 1FWPA 4P2SA 3DRSB 4O44B 2BE7D 5E0OA 2GAGC 3UVJA 2CQ0A 5J1PA 2ZH7A 2LXFA 3CULA 3PKMA 3OSPA 2CDRB 3OUYB 4ZPVR 2B9EA 4I1TA 3H0PA 3IWLA 2XC9A 1BQNA 1SVDA 2J6TA 1S0OA 4QWCA 5E3AA 4OZ1A 2VFSA 4C4WA 4G1PA 2FJWA 2RU3A 4RW6B 4F67A 2K3KA 5T7LB 2HQ3A 3SCIE 3PR5B 2DGWA 1M0SA 4F2SA 3L7UA 4DG1B 3EPIA 1IBMJ 4WZQA 2R8KA 2F4VF 5HMXA 1FA0A 2V50A 4H4OA 4MIBA 3UW1A 1D9AA 5CXTA 3R6GB 4A8MP 3CE8A 3KDNA 4TN2A 1U1MA 2QFIA 3RB4A 4C9DA 2HMIB 3I82A 2C3PA 4KGZB 3KK2B 3W2VA 3LAKA 4B08A 2CPIA 3B54A 4RUAA 5DLFA 2AYBA 4KV8A 3POTA 4ED1A 4GVBB 4B9TA 2AYMA 2FZKB 5I3UB 3HKWA 3IG1A 2HNZB 1SJQA 4CLZA 3LH2S 3ZTOA 1U2FA 4NMXA 3HP6A 2FHJD 3RBEA 4JV5J 3TUPA 5FLXY 4WWSA 4IDKB 1IKXA 1MROB 4I67A 3M2UA 4RNHA 4DSIA 5BR8F 3KLIB 1U26A 1FKOB 3IRWP 2C2OB 1CG2A 1X4EA 5KTQA 3DU5A 2XMUA 3T19A 1GTEA 1RE1B 4WXOA 5CZVA 2XO6A 4B3SJ 4ID5A 2D3ZA 2YWEA 2ZC3A 3OXGA 2D3O1 2ZBIA 1WOPA 2XYPB 1F6TA 4CCHA 2UUBJ 3TEHB 3JSRA 4ZVQB 4NLRA 2CA9A 1UWAA 2APOA 2AHOB 4F4XA 2E1RA 4OYZA 3QZ7A 2DNRA 1JLCA 2VODA 4DX6A 3TO8A 1YJ7A 1RAOA 1VMBA 2DGXA 1BWEA 4MKYA 3T1YF 4YHHF 4NWBA 3R2CJ 3VCDA 1PCAA 1T9XA 1YHQS 2D9PA 1HR0F 2P6SA 2M8HA 3QWUA 5GAEI 2B4OA 3UD5A 4RBVA 3HHLD 4ELTA 2C3YA 2V4QA 1SC6A 3FBFA 1GH8A 4ED6A 1CULB 3QNWB 3K57A 4J9VA 1Y5LB 3CJ4A 3BQ0A 2ILZA 3F44A 2MQMA 3O5TB 3M8QB 3VZHA 4WZMA 5HANA 2GNKA 1P27B 4PG5A 1HYSB 4L3NA 4MIWA 2LDYA 1I3OB 5BYQA 1VOMA 2CDQA 3UN2A 3FCVA 3GQCA 4X4NA 2YKQA 2JL9A 1G6BA 1XN9A 2PI4A 1LWEA 4X62J 4NCGB 1X60A 1WHXA 4OZ5A 2WVFA 2VONA 4USTA 1CLFA 3M2RB 5EWGA 1S7IA 1UKUA 4FPIA 1TKTA 2LECA 4P72A 3FDSA 5C42A 5BJRA 4P52A 1FDNA 4KH1B 3W1YC 4KPYA 4KFBB 2J76E 4F4ZA 3I0SA 2R7VA 4O3RA 2MZTA 3CF5Q 1F3FA 4EGLA 3R5DA 3D4JA 4OX7A 4AL6A 2DNZA 4FVMA 4GC7A 4DPOA 4DR3F 4B3RF 1T9UA 1HNXF 3GR1A 1C0UA 2F1FA 1IR2A 1TUGB 2CJ9A 3BYRA 4KBIA 1ZZNA 2W4PA 3M32B 4DS5A 1B99A 4K50A 5AXKA 1KLMB 5EX0A 2ZHAA 2MDAA 3RB0A 3L95X 2D3OR 3K2YA 4IO9Q 3KLFA 2H5JB 3BH6B 2FLPA 3MR3A 3WBZA 2Z8QA 2DNMA 4V19J 3M2VA 4HI1A 2ZHBA 5KT7A 4OI3A 2MLYA 2L9WA 2GFFA 1H73A 1RHQB 4CM2A 3C3LA 2AEFA 1GMWA 4ZPCA 2MHEA 5EHHA 1AROP 1SKUB 3WX4A 1X7VA 4IOCQ 4WF9Q 3H90A 4HT5A 1UJ6A 3V4IB 1ZA2B 3MTKA 5C7PA 1SV5A 1FT8A 2GW8A 4MKAA 4PUOB 1JLQA 2IA6A 2X3GA 4YUDA 3OXLA 5A6WA 1U6ZA 3WZ0A 4OHVA 2PGCA 1RKIA 3FEXB 1KQKA 5EX3A 1FE0A 1JLEA 4DL6A 3UCGA 3TVYA 4J37A 3BGUA 2ZOFA 2AP6A 4DL5A 1IQTA 3BGRA 2B7BB 1N5SA 2L9NA 4ZP8A 5J1EB 2R7OA 1FESA 1HWLA 2HRYA 3W8PA 5E7OB 2LCWA 3NCQA 2CPJA 2EKNA 5E33A 1KSPA 3PACA 1YX2A 3UD4P 3LANA 5C24A 4ECZA 3MEGB 3KOAA 3IBCB 2VQFF 4OV6A 2VFRA 3MCOA 4CNYA 2Q6CA 3MM7A 1HWIA 2ACYA 4BBYA 5FIIA 2J0SD 2HWHA 3C6UB 3GFXA 3EGWB 4J9RA 2B9WA 4NXMJ 3IS9B 4B3MF 4ED4A 3D54A 1KFSA 2HS0A 3WIUA 2AX1A 1EZZB 2DY1A 3P5BP 5F9NA 4DR6F 3DDNA 4BLGA 4UF4A 3PRVA 1S4FA 2OP5A 5ETSA 3E01A 4M5KA 4ENOA 4Y2CA 2P2CB 3DRSA 4CLWA 3B8HA 4O44A 3R7NB 2XZTB 1FJCA 4K59A 1IBLF 5HVHA 1ICEB 4IH6A 5DQGA 3NAHA 2ZVIA 4YDXA 1HHSA 3OUYA 3MM9A 3GV8B 3HVTB 4PAAA 5DDRC 4XTTA 3O1LA 4P74A 2NCKL 2HNDA 4TY8B 1AZSA 2HQCA 2I6WA 2IAJA 5JMNA 2WSCC 3E3XA 4LF6F 2BDPA 2NPFA 4CLKA 4RW6A 5ETMA 4IRKA 4USKA 3K5LA 4L72B 1B70B 2G2YA 1U8SA 3S6EA 3G9CA 3JAMY 1NM2A 2KVQE 3EYZA 3RJMB 3S1TA 4LFBF 2PDAA 2HKEA 2XBPA 2J6SA 4W90B 1DAXA 1ZM3A 3N6NA 4Y2AA 5D0HA 1SH3A 3CNQP 5RUBA 3KK2A 4WKRA 2X1FA 3PTWA 1QJHA 2FZGB 1MNEA 1IXKA 2GX8A 2JJ4D 2P5VA 1S0VA 1C1CB 4DSEA 4RWXA 2UVUA 5I3UA 1KDNA 3T1HJ 2LLZA 5KFGA 1FKAF 4FF2A 4JI4J 1D9DA 4ZVPB 1MW7A 3NGRA 3R27A 4C8YA 2Z2MA 4A8YA 2WBRA 1MROA 2CQ3A 1Y9OA 3KLIA 1KQSR 2RMLA 5KG2A 1S4EA 3QYYA 1I51B 2FJBB 3BKFA 3Q22A 3RRHA 4ED0A 1JJ4A 2GO8A 4ETZA 3P96A 5H9EJ 3R6LB 3ZTRA 2GHPA 2G2ZA 3IM9A 2N7CA 2KYZA 1RSCA 3QJJA 4UOCA 2BV3A 2SXLA 1PC4A 2UV8A 3TX0A 1WF1A 4J9NA 5HJXA 2QIFA 3DLHA 4Y6IA 1R0BG 1R8PA 1IJFB 1HBUB 2GMLA 1N5TA 3OTOJ 4F4YA 4ZJOA 2BW2A 1IQZA 5CQGA 2F8EX 1N32F 4JI8J 1VYAA 4KGVB 4I69A 1ZPVA 3H8YA 1MMNA 2Y0SD 5IWAF 3M4XA 5L38A 3QT6A 5CD4A 4NYOA 2M4MA 1FD8A 4OYBA 1YZ7A 2LQ5A 1HD1A 1IKYA 4C8MA 4LF2A 3M8SA 2VG5A 4EK2A 1Q8KA 4HTIA 4DFPA 1F5CA 4QIVA 3M8QA 3KJQB 3PX6A 2OKQA 1UEUA 3BQ1A 2M2BA 3T1AA 2QRRA 4KQZA 5KFDA 1OS5A 1VK3A 3UR3C 4G1QA 3C19A 3PHEA 2ZE2B 1N36J 4ER8A 1VQLS 2ATCB 1XERA 2CWKA 4MMOA 1HBNB 4OHWA 3KK3A 3ILOA 3M8WA 1QVFR 2VU5A 3AHPA 4X65F 3OR1A 1PJ7A 4KR0B 3RAQA 3HHDA 2H4YB 4L75A 2QLXA 2ABYA 2VICA 4I6AA 4KJIA 3FVYA 5DRKA 4DV4F 3KDOA 3M2RA 5C2GA 2BKPA 2ADCA 3FCWA 4FBTA 3UR0A 2YWKA 1LW2A 1DARA 4IRCA 3D6TB 1OQ3A 2RRNA 2MTLA 1L3VA 3UDVA 3NOCA 1WEYA 2ALYB 1NK8A 1FK9B 4JOUA 1K1SA 1IM4A 3Q8RB 2ZH5A 1JKHB 2F7VA 3P6YC 2FYXA 4DSFA 5KG3A 3M32A 2PFFB 2CG8A 3C16A 2CPZA 2MQLA 5F3TA 5GVQA 4E2FB 4I2QB 1VQPS 3V2UC 2N3OA 1CJKB 2W1BA 1XC9A 1RACB 1NKCA 4QIEA 1N4LA 4LR9A 2R7SA 1S97A 2IDEA 2P8IA 2F9DA 4RW9B 1EHWA 2HK2A 5E2QA 5LSOA 4BC7A 4LF7F 2WK4A 3BSNA 1IKVA 4ATNA 3RGIA 2KL8A 4RZRA 4HDHA 3DLKA 4GKJJ 1APSA 4EFAC 3FFIB 4L74A 4RL1A 2LU2A 3EVWA 1L5UA 5K8NA 4WPAA 3ZZPA 1OMSA 1PYSB 2FJEB 4F3OA 2RUSA 3V4IA 2H3EB 3KG4A 2FVCA 3O44A 4H4MB 4PUOA 3OXFA 3SYZA 1UTAA 3GE9A 3NG8A 3HFZB 2B0GA 4MT1A 2NQPA 1F5AA 2BE2A 3C15B 1MG7A 1XIQA 4CLUA 2GCFA 3GYGA 3EZ5A 3H98A 4WFBQ 4NLWA 4TU8A 1UPPA 4LRBA 4USUA 4ED8A 1Q4RA 1TZ0A 5ETNA 2DT9A 5E3PA 2NS1B 1ZYQA 3CUNA 2CKWA 4HHJA 2QG9B 4F2RA 1BGXT 4JUZA 1C4CA 3ZZYA 2DIUA 4XPEA 4RO0A 2FLLA 5B0BA 3OBIA 5BYSA 1AW0A 3ZTSA 4LSLA 1KVJA 3CJRA 1QUVA 2VA2A 1XR7A 1S5ZA 2A3JA 3BZQA 2CQ2A 2RILA 4ILRA 5GAHU 1S6PB 9ATCB 2UU9J 1HI1A 2E5LJ 3C6UA 4NLDA 3RG6A 2HEKA 1N48A 3MDFA 3IS9A 1ZZFA 4PZVA 2D74B 4DLEA 2DVIA 3BPSP 2KHCA 1NZAA 5D8HB 4W98A 4OLOA 3K5NA 4PG4A 5E3RA 1IBKJ 4TQSA 1IBMF 3HZEA 4DN0A 1UETA 2DTJA 2AIRB 3GV7B 1UEVA 5ITHA 1TL7B 4RX6A 1FFWB 5KFUA 2YKNB 4AD6A 2V2VA 1QD1A 2BUNA 1XNQJ 4B17A 4TY8A 2J7UA 1LK7A 4Y00A 2OFHX 4YMEA 1CS4A 3TA0A 4CLPA 1XMQJ 1IBCB 1NHUA 2FHMA 2KZZA 2F65A 3HVAA 1S76D 4WYLA 2JRSA 3G86A 4G6VB 5HMYA 2J0WA 4M95A 4JP8A 1G4CA 2V34A 4K4ZA 3F73A 2E9ZA 4AYBD 2HK3A 3AD9C 1JIHA 3M6UA 5KFEA 4I4BA 3TZXA 4WKYA 3LALA 1I5OB 4EYHB 4HLBA 4ECSA 3WQPA 4J91A 2A2CA 1NJWA 2XTJP 1HBMB 5DDPC 2F40A 2RRAA 3RB6A 3EGNA 4OHXA 3HSDA 3OTCA 3PW2A 5ETRA 2WB4A 3EJMA 5IC6B 3H20A 1C1CA 3T9ZA 2HHVA 2HBRB 3NS7B 3PDNA 3A8KA 6FDRA 1FDAA 1I6JA 2N3LA 4J9UE 5F8GA 4ZN3A 1BQMB 5F0WA 1ZBTA 4DUZJ 4P2XA 2KRBA 4USIA 2IVMA 4P2MA 4CO1A 3TUJC 5FLXU 2AJFE 5K9FA 5CD4H 1FXRA 3BBFA 5L9XA 4F3QA 1QE1B 2B5JB 1M5HA 1I94J 3MURP 1KFDA 3OR2B 2POKA 2BRKA 2CQIA 2XMVA 3M05A 5U47A 3CMAS 3PCOB 2HWTA 3BB5A 4K4WA 1ROFA 4FP9A 1O8BA 1RWWB 2DYAA 4ALZA 3JSMB 2JVRA 3I9ZA 2XMAA 1RHJB 1EKSA 1VBZA 2PA3A 3IXQA 4ZLLA 4DV7J 1ZETA 4F4KA 4F0MA 3QGPA 2IM1A 3FEZA 4BHQA 4O0IA 1UVNA 2DNKA 2VD3A 5A2QY 3L4BC 2VPWB 2JSXA 5AJ3J 3W8GA 4Y3CA 2XS2A 3AOAA 2UUWA 1RWXB 3I9V9 2PC6A 1Y10A 2UXDJ 5KFSA 5SUHA 1TP7A 4CYUB 1NMEB 2XHCA 1EARA 4QWAA 5IXUA 1NJZA 4ECQA 1RU2A 3I6PA 4USWA 3I0RA 3OL8A 2ADBA 4DSKA 1NPKA 3I5CA 3UWTA 2IC3B 4AQYJ 5T14A 4JI0F 3V4MA 1REGX 1REVA 4B9SA 3CDWA 1B4SA 1S1VB 5G0RB 2AZ3A 4XDDA 2VDHA 1J5EF 3AD7C 2VC1A 4PYDA 2YH1A 5D4PA 1U1QA 2IJFA 1H2UX 3LWLA 2VKRA 2HHTA 2K1RA 1RT3B 5IM0A 3BKTA 3D66A 2E9RX 4CLLA 5L46A 3GSIA 5LOQA 1Z4UA 2HHWA 2CQBA 5D4OA 2FHJA 4M1KA 2W7PA 1FK9A 5GAGU 4HH1A 4QR2A 2EFVA 4DXLA 1L3UA 4FF4A 5KFLA 2W9CB 5LM7E 3G96A 3R2DJ 2RU9A 2JX2A 5H1SV 3Q23A 4DF8A 3WX8A 4HT7A 2NZCA 1F2GA 4N56A 1U1NA 3M9NB 4CIOA 4YFUA 1Q82T 3CDAA 4WU2A 2ACMA 1CJKA 3NCRA 1M5PC 3S8SA 2DR9A 1YJWS 3ET6B 3ILLA 2EC2A 2RAQA 4FYVB 2HSEB 2CADA 3DGVA 3FSYA 3TARA 5AXMA 2R7RA 4RW9A 3CJTA 1VQ9S 2Z30B 1N5QA 5JXSA 3TJ9A 3QT7A 3VGTA 1HLWA 2QGFB 2R7QA 3DRXA 1Q5VA 3MEKA 2KI2A 3NS6A 2CPXA 3AXKA 4E0DA 4UW2A 2CNNB 3CCQS 3HSJA 1YRXA 1RDRA 4OLPA 3DLGB 4DPYA 1VR6A 1S12A 1WG1A 1YBTA 1RBLA 3AB2B 4LF8F 2CZ4A 1U2CA 1TL3A 4M5LA 4LBPA 4H4MA 4OZ3A 3Q2TC 4LUBA 1K8AT 1NZ8A 2KT5A 2HQGA 2CQGA 1CJVB 3BREA 4YR0A 3BJYA 2L3MA 3NXZA 3VAFA 1X5OA 1SJ1A 1WHYA 1M90T 1CEZA 3PRBA 2YX7A 5KFMA 4K4XA 4C97A 2J9CA 3MM6B 3GIRA 5F3ZA 3AJDA 5DETA 2CPYA 2FY8A 1J5OB 4OYXA 5J2PB 1DURA 1EKRA 3EWGA 4BWJA 4ZIVA 1AYEA 3K8VA 4ZCMA 3ITHA 2V2KA 1X4CA 2F4VJ 3MAAA 3SQOP 3AOCA 4ZLPA 3CWJA 1R43A 1NEEA 2NXUA 3N6MA 3S01A 2EI5A 1U45A 2BBEA 3MF5A 1OY6A 3GU0A 3HULA 4IUFA 2XMTA 2Y9HA 1WHVA 4FKXA 3VGSA 1VIXA 2BJ7A 1HWUA 4DFJA 1RQ0A 4ES1A 2DH8A 2PIIA 3AD8C 2YNHA 1LV5A 1BY9A 1URNA 1R6YA 4ICLB 5LMUF 1S6PA 5GMEA 3I5BA 1TK8A 3FZ2A 1SIZA 2GGPA 3LQVA 3R3TA 2WSFC 2Y3YA 2VG7A 1U1OA 5J2MB 2MKKA 1VQMS 3TR5A 4ZPDA 4ECVA 1RT1A 2DPJA 3N5FA 3ELHA 2R2UA 3PJ9A 4R8UB 1ZM9A 2GZOA 4DR2J 2JLEA 4M5GA 1VRTB 1WJ9A 1LW0B 3D0HE 4IOAQ 5BR8J 2J7WA 3N4WA 3PVXA 2HVIA 2J0QD 2HFSA 3CJKA 4NLQA 2Q43A 4QU6A 2HYIB 2LP4A 2C3MA 1T9VA 1TL7A 3PM9A 4FN5A 3OV7A 5GADI 4USJC 2ZWPA 3M8PB 3MCMA 4PQUA 3N28A 3PIOQ 1V3SA 3LWMA 4A8QA 2GV1A 3PJXA 1NRKA 1S72S 4V1Ak 3T1HF 2FLOA 2LMIA 4QZVB 1G3OA 3TX8A 1LWCB 2BRLA 3JTOA 4JI4F 4M5DA 4TKTA 3VALA 3DI6B 1FRIA 5I3PA 5KFRA 3HD1A 1HR0J 2IPOB 4C0HA 3GMGA 1U25A 3GIMA 2KYXA 2N82B 1UVKA 3QSYB 1M5SA 1UWBA 1HBMA 4DS4A 3PRDA 4WBFA 5A6PA 2QO3A 1GNKA 2YX1A 2OSRA 3G8QA 4CNZA 2VC0A 4NZ6A 2QLFB 3V6DB 3T5HA 1RT7B 1BQMA 5K14B 1A7GE 1RT2A 3SDEB 4BWMA 3NP5A 2QN6B 1DFDA 4A48A 3AA8A 4IRDA 2M5YA 2XYHB 5HVGA 3C6TB 2NLWA 1TV6B 5C25A 4NE9C 3Q0AA 1NK0A 1YKWA 4FPRA 4J5OA 3RBXA 1KP6A 1RWMB 4DZ6A 1WC0A 2WVEA 3Q8VA 4PYAA 4RW4A 2RDDA 1RA6A 3NGKA 2HIYA 3CTRA 3R8YA 2H54B 2CJQA 2ROGA 1R0CB 4UT4A 2NYIA 2GQQA 3JSMA 2QX0A 2EEYA 4RNNA 1T03B 4B3RJ 4OJ1A 2W2NP 1XNRJ 1HNXJ 3OJSA 2D3UA 3SQGA 2UVRA 4LRAA 1FRMA 5EUHA 3NOGA 5EDWA 3V5RA 2HFNA 3GILA 2A2DA 2DGOA 2XCAA 1S10A 1RKJA 4KO0B 1FWKA 1NCLA 3CT9A 1NLKL 3KWMA 4I0WA 2FIUA 1UAWA 1S9EB 1PG5B 2GA7A 4NA2A 4OYOA 5DS7A 1UVIA 3LP2B 1TVRB 1KTQA 4CLSA 2YWGA 1JLAB 3OFEA 4CO4A 2Z2YB 4FZVA 3W60A 1BXNA 1KR4A 1H7XA 3MM5B 2B8PA 5B0FA 1KKHA 4WK1A 2OPQA 2IC3A 1AA1B 4YDDB 1PILA 2KKHA 1JK9B 5B0EA 1U49A 3QPIA 2CYYA 1YJNS 1VQ7S 4PPZA 2HBZB 1EQ0A 4IG3A 2MGZB 5IT9Y 1VHIA 2AMCB 1Y3JA 3ETOA 1RLCL 5K8PA 1T05B 3MR6A 1FD2A 2F9JA 4P75A 2LEAA 1EETB 3HT0A 4W4MA 3IRXB 5H9EK 3E51A 5J1NA 1FNXH 1RT3A 1SUQB 2ASJA 2HWIA 3A3NB 4D3HA 4QQBA 1R3NA 1VS3A 2ZUGA 1G1XA 3D1HA 2GHVC 2RDIA 4FXVA 2H1YA 4KT0C 2PEHA 2ZOMA 3AA9A 1FXDA 3TVKA 2Q6BA 3TQ1A 1SQGA 3DM2B 2GC8A 1KLNA 3UNGC 5A8WB 2B8QA 2QLBB 5DGAA 3K5OA 1X8DA 4DU8A 2UXBF 2YWFA 3M30A 3MAQA 1NHVA 1VC5A 2AX0A 3AT1B 4B02A 4LIRA 2EK6A 1X0PA 1WC5A 2ZBRA 5D78A 1LXJA 4MIAA 1MWYA 4I6WA 1VJWA 2OO4A 3ET6A 2LXIA 3QLHB 3JTNA 2K8GA 2KHDA 3MMCA 1DQ9A 2PD1A 3Q8UA 3T5LA 3CCSS 2ZEJA 1TU0B 3V6KA 2L41A 2GJFA 2OPPA 5KFJA 1CJUB 1PAUB 3OVBA 1TK5A 2IMWP 3I5AA 2RRBA 4B3MJ 3BDPA 4K0KF 2ZZNA 4C6AA 3OLBA 1MWZA 1R0AA 2W2OP 3KFWX 2CAJA 3DLGA 4NYPA 2YNFA 5K8MA 2HQFA 2PEBA 2MZ1A 2XY5A 1R89A 1TKZB 1FX2A 1NB7A 2ASYA 1WTBA 1OO0B 4R5PA 1CJVA 1U7LA 3JS9A 1IBLJ 3TZWA 4RW8B 1VIOA 1IWGA 4QWDA 1FO1A 1WG4A 2UUAF 5DJBA 2DEIA 1WDDA 2ZDOA 2HVDA 2WVBA 3K17A 4OX9F 3W2VB 4C8ZA 1FFSB 2UU9F 2XULA 2E5LF 1JNRB 1MWQA 4KV8B 5F8HA 1VQ4S 1HIYA 3A8EA 3POTB 4LF6J 3CB4A 1WF0A 4Z7YA 4QIWD 2HS4A 1NJYA 2C2MB 3IG1B 2UVWA 4DPXA 2IA0A 4BC9A 3ICLA 4DLGA 4CI0B 4M94A 3BBCA 3THVA 1MN9A 3J7ZT 4DV0F 1KVIA 1UFKA 2FUG9 1TTHB 1WUUA 2LXUA 1P9QC 3DXBA 4LFBJ 2UP1A 3M2UB 4L3KA 3G82B 2R4FA 2XZWA 4USMA 4DHVA 3FBBA 4TLQA 5FJ4A 2BW7A 4ICLA 3BEGB 3TZYA 1DRZA 3Q89A 2KO1A 2YXLA 1KHWA 1JLBA 4CLFA 1TK0A 4OMFG 1U24A 3L9ZA 5HMWA 2FDNA 1TAUA 2MY7A 5LSLA 3PX4A 1XMQF 1RAAB 1Q0NA 1JLCB 2IBKA 4P2FA 1VRTA 5CYMB 4WFYA 2I0XA 2DNHA 2FVRA 2NXCA 2AEJA 4EBCA 3HHKA 4MJKA 4RLEA 4OZ2A 3ZNJ1 2G9OA 2AWZA 2Q3PA 3UO0A 2DXFA 1YBAA 4GC6A 3RTVA 2DCLA 3DGPB 2OFGX 3A3OB 3D6FB 3UFCX 3UDCA 2LEBA 2ZDPA 3CXCR 1AUDA 2ZNYA 5LMNJ 3M8PA 2I1RA 2KZMA 5ETPA 4LR7A 2B7CB 1RT4B 2CZ9A 2XMKA 3QQCD 2E1AA 3KHRA 2G4BA 3J80U 5HO4A 4GO5X 3NGTA 5KT6A 5IZHA 1N32J 2MQQA 4YEAA 2HHHF 2QMXA 3J7Z5 1LWCA 3CD7A 1WC1A 1CVJA 2HS3A 4ECWA 1RCXB 1UVMA 3DI6A 5CH7B 2CPDA 2DNOA 4B9LA 2EFQA 5L1IA 2AGPA 3ISND 3D3CJ 3CIZA 4GMKA 5LXRA 1LWEB 1L3KA 3W62A 2I2YA 5GAHI 2VZ9A 3T3FA 3L09A 1ZOTA 4WTYA 3NRBA 2HVHA 3UPFA 5FD1A 4I7FA 4FNHA 3CJ5A 2GS8A 3LPYA 2HQIA 1OYEA 3LF0A 1UZDA 3THTA 1TKTB 1EB0A 4HEA9 3S7RA 4KHPF 1NDLA 2CJKA 4K8RA 3I0SB 3LGNA 1H2TZ 3D3BJ 5K14A 3H5XA 2DRAA 7FD1A 1VQNS 3MPWA 2A6MA 4ZCLA 4M5IA 1OPZA 2ZD1B 1EX8A 1X4AA 4F4WA 4RU9A 1C0UB 1VJQA 1Q5YA 3C6TA 4XDCA 5L8RC 1TV6A 4DV7F 1WI6A 4NOHA 3VAKA 1RWUA 2EG2A 1HW9A 1RWPB 3QZ8A 1WC4A 4CO3A 4OJHA 5FDLB 1SPBP 2RF2A 1G7CB 4ZVSB 3U27A 2HG4A 4U9RA 3MI7X 4NZ0A 2UXDF 5AXLA 2VBXA 3CC2S 3Q8YA 3VGVA 1TUWA 3UD3P 2EFGA 2O67A 2VQEF 4PG7A 1T03A 5IS2A 1AT1B 1X4FA 5HBMB 1NDCA 4HACB 4YR3A 1NDKA 3UDLA 4XAKA 1I1GA 1ZPWX 3ENAA 5F8IA 3QRRA 4FYXB 1V5VA 3CJQA 4AQYF 3HKZD 4QU7A 1SBRA 3BYPA 2MLZA 1K44A 4KO0A 2KU7A 4KHRA 1SV5B 2YNGB 1N52B 1SC3B 2UUCJ 1JLQB 4CP5A 2U1AA 5A2QU 1S9GA 3H4BA 2AZ1A 3LP2A 4WP3A 4OYPA 2ZNZA 3JQJA 4ZP7A 2D7SA 1IN0A 1JLAA 4G1IA 2DR7A 3FMWA 2VOPA 1EJ7L 3HFKA 1JLEB 2P9GA 2H48B 3PJWA 4OI6A 4AE5A 3MM5A 3BR8A 3DRPA 2R42A 5KG7A 3BO3A 1U47A 3T6BA 2YPZA 2V4JB 2MGZA 4BDPA 3MR2A 3FGVA 1DZ5A 2ZHOA 3VQTA 2V4RA 4ELUA 2V8HA 3CC7S 4U95A 1EETA 1LQ9A 1Q8BA 2YBVA 1NXIA 1A9NB 1U6FA 2PT0A 3OTDA 3W7BA 3MPYA 3GJTB 3MM7B 3HZGA 3TW0A 2HFZA 1HNZF 3OLAA 4OHYA 1FVSA 4KC5A 3D1OA 5D0RA 3IM8A 4LRFA 1T9TA 2HHXA 1JJHA 3IN5A 3HF5A 4FBUA 4C8OA 2PN6A 3PV8A 2Y1RI 3RR8A 1Q86T 2F4FA 3DM2A 3W2WA 3CD6S 4C3KA 1DQ8A 5ETLA 4OI0A 2B4VA 2MQ8A 4NRUA 5CYQB 4YB5A 1AB8A 2MMYA 2XG8A 2J7KA 2CVEA 5KT4A 4F0HA 3MEDB 2K3IA 4AXIA 3QLHA 2H9ZA 1R8CA 4YOEA 2BZ2A 4DR5F 1LWXA 1D8ZA 2OMLA 4GVLA 4OFZA 4Q0BB 1HQEA 3BO2A 2XO7A 1OJ4A 5HROA 3B78A 2E5HA 2V9KA 2QYCA 3BBBA 3MM9B 2E44A 1CJUA 2XS5A 1HKAA 4NCAA 2CXEA 2HNDB 4EU0A 4WIQA 2KXNB 1FHTA 3FJ2A 1AZSB 2XSJA 2I38A 2IAJB 2DR8A 3SFGA 5THWA 2MEWA 5KT2A 1HHTP 1QSSA 4NZ7A 2G0CA 4J9QA 4ED2A 3P5TL 4KB7A 4URGA 1TKZA 1LFWA 4Q2LA 3RR7A 4DFMA 3K0JA 3K89A 3TANA 4RW8A 4UUXA 3IGVA 4Q44A 4RU2A 1LWFA 2VPZB 2OJ3A 4MKBA 5GAGI 1H2VZ 2ZBCA 3TOQA 3CJ3A 3Q8QB 3TP2A 1BHNA 1UW4A 1RAIB 2W2QP 3TVZA 1XEZA 3R5GA 2GMHA 2JEJA 3IGNA 4HH0A 2JLFA 3MTJA 1RAGB 1BC6A 2EWHA 1Q81T 2J5AA 3NMRA 4ECUA 3JSBA 4DR2F 2DJWA 4DL2A 3GJQB 2ZFHA 5A8KB 1KVKA 2HAFA 3G82A 2KFNA 2BJ9A 2CNLB 3OHAA 4DX7A 1QVGR 4R0EA 1O5JA 3CCVS 4HHUA 1N34J 5IQQA 1BMQB 3AH6A 2W2MP 2FHOB 4KGKA 3F0NA 2BOPA 1U4BA 4P10A 3TQEA 1WC6A 3OJUA 2H5IB 5LXYA 1TAQA 3IR5B 4PRFA 1B64A 1NK7A 3PFOA 2HQDA 2E7XA 3HK2A 3K59A 2CJAA 1PIEA 3Q86A 4MK9A 4PWUA 5CYMA 4ILLA 3CJSA 4KTQA 3BGOP 3PY8A 3KUHA 2CJBA 2M3DA 1XMOJ 1RK8A 4DF4A 4XK8C 2DIVA 1V3RA 2AJ1A 3D68A 1HI8A 2E5GA 1RI7A 5F8NA 1VDHA 1M1HA 1Q8LA 5CYJA 4DR4J 3QIPB 4MK8A 4TNOA 4ZMMA 4LT6A 3R5AA 3DGPA 2FJVA 3IAM9 1IKYB 4OX6A 4C7QA 2PE8A 3JYTA 5M2UA 2VG5B 3W61A 3CCMS 2IM2A 1SKWA 2ZWOA 3DC2A 2MJUA 5K8OA 1RT4A 2DH7A 3BV8A 5A0YA 4ZOSA 5HK4A 1RHMB 2RD5C 4DPUA 3RW6A 1ACMB 4TYBA 3BSAA 4G1QB 2GJIA 4U7UK 3PKYA 2RS8A 4ZITA 4AT1B 3GIKA 4ZJQA 3VAMA 1QLNA 1P9YA 3R5BA 3KJNB 3KK3B 2HURA 1O6XA 2ZVSA 3WC0A 5D4NA 3Q83A 3OR1B 2YNIA 2UZAA 4URSA 2OPRA 3NS5A 1HQUA 2BMBA 2H65B 1N56A 1VRQC 1EQMA 5LT5A 1TFYA 1KOHA 1IR1A 3CO0P 4NI2A 1RAEB 2QMUB 2VOOA 1S77D 4RNOA 1CPZA 2KT3A 4ZVUB 3EM1A 1LW2B 1RTHB 2WOMA 3CCUS 5KAKA 1S6UA 1UVJA 2R8HA 4O3SA 1GTHA 3C66A 2KVIA 3EGVA 4X66J 3VGUA 1VQOS 2KJVA 3G4SS 2G2OA 1ZTTA 2ZD1A 4JI0J 1F9FA 1XNRF 4DR7F 5HVFA 2DNGA 2RJZA 3DRYA 1A6LA 2RQ4A 4NYZA 2Y1LB 2GAHC 1QAIA 3EZUA 3KMSA 1J5EJ 4LSNB 5HLFB 1T9WA 2FD2A 3N6LA 4AUKA 4DOZA 3C16B 3MFIA 3WDOA 5FDLA 4RBUA 1WEZA 1NBEB 1TQLA 2EK1A 2DXDA 4OI2A 4DQSA 4F02A 2XNRA 4J90A 3M8RA 3OT9A 3QGHA 4OYWA 3MD1A 3HJFA 1HBOA 2VDIA 1B0PA 2EG1A 3G2XA 2ZBQA 1IKVB 3N0VA 4M5JA 5SZTA 3DLKB 5HBMA 1HFEL 4HACA 3EX7B 3ZTPA 3ENWA 4DMZA 2EKYA 2YQ3A 5MAOA 2DNQA 1DHMA 2FVSA 1D09B 3ENVA 2YVSA 2VHGA 3FRZA 4FS2A 1RBAA 1MLAA 2YNGA 3ISZA 4UQTA 2VB6A 2OIHA 4N8NA 3KJFB 1YRTA 5D0GA 4KE5A 3W3SA 2BANA 2F8MA 1S49A 3AY0A 4QPTA 4FKYA 3GR0A 2MB0B 2BE2B 1DJ0A 2ILYA 5HAOA 3CVKA 3D1QA 2ERRA 2ZJQQ 3KUEA 3D7SB 2VFVA 4D3GA 2CNKB 4P7VA 2V4JA 4JI3F 4IFVB 1RT6B 5DQHA 1D9FA 4LF8J 4X64F 2DGSA 4MH8A 3ADAC 5JVGQ 3NEKA 1TELA 2NPIA 3DLLQ 3O3LA 1TKXA 1ZAVA 2V68A 3RRKA 3OFGA 5CAAA 5I42B 4DX5A 1WEXA 4OZ0A 2XHWA 4LSLB 1FJ7A 2XWYA 3BSCA 3RW7A 2O3DA 1GFWB 2QLWA 2KRRA 1WKLA 3AQPA 1RHUB 1YDLA 1N88A 3ZTQA 2JZ5A 4X4UA 1TR0A 3TZZA 2WBMA 3SSSA 1RLDA 4Z7CA 3OD2A 2AGQA 3MR7A 2KXFA 1F2HA 3I31A 4HVZA 1GK8A 1R6VA 1Z2ZA 3IAS9 3CJ2A 1VCTA 2XY7A 4YY3J 1VGYA 4K4SA 2IYIA 2HPUA 5DO2A 1RWOB 1NSPA 2B4PA 2CQ1A 2E7VA 4LBIA 3GWCA 1SQFA 2MQPA 1QAJA 5CYQA 3H2LA 2BOAA 4UOHA 1YSJA 2XI2A 3MEDA 5KOXA 4RBTA 3W66A 1RTDA 2LKZA 3RB3A 2JDJA 4HL9A 4C0OC 4Q0BA 3NGSA 3FBEA 5HMZA 5LMUJ 2ZM6F 3VTIA 4LF4F 3EVMA 3TJ8A 2MQOA 4JV0A 1IR0A 4CDIA 3JB9k 4AFFA 2XMMA 4C8NA 4DV3F 1Q7YT 1CS4B 1WWHA 2L9DA 4K5SA 1F3VA 3KNGA 2I8EA 2HGMA 2NZ4A 2JVOA 5EWFA 2BQ3A 1FNMA 4DPTA 4DPWA 4RR5A 4OHZA 2L48A 4MYUA 3BR9A 3LPEA 4PQAA 1FI4A 4DFKA 4IFYB 3CPWR 4FDFA 1T94A 2DRBA 2EFOA 3ZFVA 2VBZA 3PW5A 2C2EA 3ZZUA 3HLUA 3J81Y 2AJQA 1M5KC 3DHWC 2X51A 2QA4G 1W25A 2QYGA 1KONA 2Z2LA 4A8XA 3PYFA 3QIDA 4NX9A 4LF9J 4DV6J 4KH0B 1PYTA 3AB4B 1CSJA 1N6QA 2RE1A 5B0DA 1URRA 1S9FA 1RTIA 4C3LA 3KKFA 4Q2MA 4J9PA 3RAXA 1QSYA 1TL1B 3I87A 3P49B 1QY7A 3DOKA 4EO8A 1LNQA 3HM9A 5A8KA 3H5UA 3HX9A 2C2NA 1Y00A 2W8LA 4CLYA 4JI6F 2XY6A 2HVZA 2OEJA 3FCHA 4JI7F 3EICA 1LXNA 3R5JB 1K73T 2V5HG 1IM6A 3RUBL 1S1TA 2LU1A 2IVYA 3QGGA 1WKKA 4JB8B 5LMNF 2AW0A 4UUWA 1SJ4P 4PCQA 1S6QA 4CTAB 1VI7A 2FLNA 3JSYA 1FWLA 1B3TA 3G6XA 3BDEA 1SH2A 3R5CA 3DCAA 1LEOA 3TI0A 1RT5A 3UN5A 2CVIA 2DNLA 4NLSA 3LP1B 3GTYX 2EXUA 4NLYA 1WDTA 3MUVP 3DYAB 1VQ5S 3QIPA 4TU9A 1HPZB 1OIAA 4IQXA 1PBUA 2KJWA 1D3WA 4ZHRA 1WOSA 1OSDA 1NH8A 2HNYB 1U48A 4K4UA 1DTQA 1RUSA 1RTJB 2HFUA 5HJYA 3QFWA 3SIPB 4X2BA 4Z37A 3EZOA 3CD5A 1GT8A 2ZH9A 1Y7PA 2HHQA 3EVOA 1XBWA 4DUTA 2A18A 1FDBA 2GVDA 3I0RB 3MD3A 2N4DA 1HA1A 2W25A 2R7XA 4X4SA 1HHQA 1REVB 3FMBA 3SSQA 2B56A 4I2PB 4I56A 1F5BA 4PXBA 3X3UA 3PO5A 3IR6B 3QATA 1HMVB 3SI8A 2XB2D 3KUGA 1RCOB 1U2RA 1M5VC 2K1RB 5IM0B 1B0VA 1RTHA 2F63A 5F0UA 1HNWJ 3AJ1A 5L1KA 5I3QA 2BM1A 1R8BA 3LA0A 3J7YU 3TAMB 2OTLS 1V5IB 3T9NA 5MLCV 3VQSA 4V19X 4QYZK 2E66A 2J9EA 2YWHA 3HHEA 1YQHA 4OIXA 2V67A 3TA1A 1H0HB 5HI7A 3BS9A 4B3TJ 2HVEA 4IR1A 4LSNA 5HLFA 1X5TA 1X4DA 3W64A 1NB2A 3PNIA 4K4YA 3ETMA 3V6JA 2ZH6A 1S1XA 3DOMA 2UUCF 1CC8A 2C3OA 2ASLA 5AE1A 2ROPA 1HNVA 1PJ5A 3KLGB 2PA8D 1LOUA 3AAWB 1R8AA 1S79A 2HHSA 1XR6A 5KFVA 2IBOA 4H54A 4MTPA 3DOLB 5F8JA 3GPAA 2MZSA 2BJ1A 5B0CA 2UXBJ 3OL7A 4A4JA 3HHLB 4DUYJ 4CH0S 3QT8A 3Q24A 3DMJB 4IH7A 3EDRB 2ASDA 2IRXA 5HL7Q 1FEEA 4WJBA 1TL3B 5KFXA 3HSZA 5LSRA 2R7UA 3PYDA 2PO4A 2AV5A 4X4QA 1RISA 1RXOB 4NASA 2ZITA 4ES3A 2WVDA 3MPUB 2VASA 5F8MA 1Q16B 5IT4A 4K0KJ 1X9MA 3VAGA 4PWWA 3PYEA 2MPUA 3AOBA 1MU2A 4HKQA 1NKBA 2QTWA 1BUXA 4IFVA 1U02A 1RT6A 1JLFA 2AYEA 1UA0A 2BACA 3ITHB 3MM8A 3MAAB 5IFMA 4WFNQ 1DTTB 4X4VA 5KFPA 2E1MC 2RQKA 3H5SA 3OFFA 5I42A 1KS2A 3IBWA 4EBDA 2P6TA 2UUAJ 1SQEA 3NY0A 3PO4A 2IIHA 2G0IA 1C2PA 4OX9J 2CG4A 2YNHB 1FXLA 4EMDA 1YJRA 2GGPB 3NNHA 2WRMA 4KPCA 4JI1J 4ECRA 3IWXA 3CDUA 3SCLE 2VG7B 2JOQA 4WTOB 4PWDB 5KFIA 2E1PA 2IJRA 2LA6A 1RT1B 1YVFA 4DV0J 2HGLA 2B9YA 2AKWB 3JQMA 4TLRA 5F41A 3U7JA 5KFZA 3V6HA 5D3GA 2WSEC 2QSFA 1S57A 4M5NA 3KTQA 2J0XA 2WONA 1ZS6A 2LVWA 3CJKB 2E5JA 2M88A 3GONA 2DISA 5DDQC 4C8KA 2RSQA 2FTRA 2Y1IA 1KEKA 4FNIA 2NYHA 3VHQA 3LUYA 1MSWD 2W8KA 4PQUB 3K5PA 1MMLA 4E98A 2KFYA 1S1WA 3GJSB 2LYVA 5KG6A 3LOUA 1U1LA 4Z2XA 1WELA 4QIGA 2A1BA 4H4KA 1KQFB 5KFNA 1P1LA 4M5DB 2DH9A 3JXOA 1K0TA 1YBUA 4IFYA 1SKSA 1PAEX 4ZS6A 4RUCA 2NUUG 7AT1B 3QJLA 2L08A 4RW7B 3IR7B 1VBYA 3GCWP 1UWBB 3IA0A 2VJUA 1S59A 4TU7A 1KTVA 2O66A 1N34F 5AT1B 2YWWA 2ZH2A 3ZZZA 5HQ8A 4CH1A 1IKWA 5KFOA 3QGIA 5ETTA 3WHIA 2IRUA 2G1DA 4ZPWR 3CCWA 4YS2A 2UXCF 2QL5B 2AJ4A 5D0EA 2OEMA 2W2PP 1FKPB 2HHHJ 2ALZA 1JQGA 2XGPA 4P6QA 1B0TA 1WI8A 4UQGA 1TL1A 2IDLA 1RT2B 1T95A 3QWPA 1SKRA 4N8OA 1Z1ZA 4Y2MA 1XMOF 4B9UA 3MECA 2NREA 4JI2J 1UFLA 5C25B 1VFJA 4LQ3A 4CH7A 3P4UB 5JUMA 3MEEB 2JEGA 4M8LA 4DR4F 4MAKA 4BS2A 4LVNP 1YJTA 1XJWB 2BABA 5JVHQ 3TWZA 4Y65A 3ILJA 4KHPJ 1FE4A 8AT1B 1JMTA 3L7OA 4DWIA 1SJFA 4RW4B 2KB2A 1FNOA 1RYRA 1P1TA 3OTEA 2C28A 1F0XA 3A8JA 4CTAA 4NLTA 1R7IA 3U1LA 4J9SA 1S1UB 2VJVA 2FVPA 4ILMA 2KDOA 4QPXA 1GEHA 1X31C 3LP1A 1YK9A 2QJ3A 4PR6A 3SQGB 4A8OA 3DYAA 2FPHX 1HPZA 1OSCA 3MUMP 4JI5J 2YTCA 5AXNA 2BJ8A 2HNYA 1F9HA 1QM9A 1RTJA 2Z58B 3KMQA 2EC0A 3MMBB 2RHSB 4A8SA 2XS7A 5ETQA 5DZ7A 3W9IA 3D6HB 4NRTA 4P71A 3QO9A 3EXCX 3W5XA 2OSQA 2W7OA 3U1MA 4C2MA 2VQEJ 2XSFA 1VBXA 3G8TA 1H38A 3RBZA 3TA2A 5KFYA 2YKAA 2VPXB 2BJ3A 1VRUB 4X66F 2OPQB 2ZZTA 1UA1A 2DHSA 2BA9A 5AE3A 2KFZA 4IG3B 2RDJA 2D69A 4I2PA 4FS1A 1NK6A 1HWJA 2OAUA 4ZVTB 1PJ6A 1FRKA 1HD0A 1HMVA 2CJXB 4ANEA 4LREA 3G6YA 3B4MA 2LQJA 4QYRA 5KFBA 3IFEA 3HT3A 2UVVA 3H2UB 2AF6A 1L3TA 1UJ4A 3TAMA 2FB0A 1S0MA 4J9OA 3NLCA 4QIFA 4URQU 2VG6A 2GJ2A 1HQ2A 3KYLA 2V94A 3KG1A 1SC4B 3M30B 1UW9A 2AEMA 3IC1A 1M5OC 1JXVA 4U7UD 2EPIA 3ZXWA 2Z2ZA 2MLXA 4NLGA 5ETKA 1U0HA 3DDIA 5B09A 4OX8A 3PW7A 1VQKS 3TEGA 1HWKA 2MQNA 2XM3A 1AXQA 1HNZJ 5GADU 1HARA 2YKOA 3QSIA 2V2QA 4OL8A 1FTRA 3MMCB 3KLGA 2R7TA 1H98A 2A0FB 1R8HA 1U0SA 1PKUA 4O3QA 4DEZA 1W2BR 2OPPB 3HI9A 4JYAF 3UCZP 1W2IA 3KLVA 3DOLA 4LFCJ 3BO4A 1U1KA 3HCXA 1R0AB 4IQMA 1J27A 4ZVFA 3MMAA 3HHLA 1N5YB 3DMJA 2YNFB 3O2IA 1M1GA 5L1LA 4Y28C 4O4GA 3OTBA 5LJ5Y 4QR1A 4R5PB 4DR5J 4WP8A 1JXLA 4OV1A 2HFVA 1KNZA 1X9WA 3HD2A 1E6VA 2YX4A 4PABA 2H4WB 4UZCA 4F04B 2AU0A 2E9TA 3Q2SC 3TAPA 3LP0A 2QT7A 4X84A 5HQLA 2M9KA 4FF1A 4WYWA 1GQEA 4MFBA 5J2QA 3MCSA 2JLGA 3H7HB 3MR5A 1VC6A 3VAHA 4YP3A 4YY3F 3UE2A 2YQ0A 4DV1J 3SV3A 1YZ6A 2NXNA 1OY8A 4NLVA 2FJAB 4TVAB 3N5BA 1RADB 4DL0C 4IR9A 1UFWA 2G1HA 1DTTA 3W9HA 4AXJA 1Y3KA 4ERDA 2KXHA 4XPCA 5BYRA 3ONQA 2DNPA 2JFDA 1QDUB 3PZPA 1UPMB 3ENQA 2ZBPA 5T7LA 3QRQA 2YKMB 2DHXA 5A8RB 3R97A 2MSTA 4DG1A 1JLBB 1OWXA 3SV4A 1ZAWA 3J7A1 1YJ9S 3H4DA 1KOOA 3GB0A 4PWDA 4KRWA 5KFKA 1PSDA 3PXGa 2D1CA 1PC5A 3RRGA 2ZZMA 5D15A 4A8WA 2HMIA 1XR5A 2Y8YA 1GXLA 2PMWA 1RBOB 4Y34A 4LMZA 4ZVEA 4X4TA 2JWNA 1D8YA 4KY3A 2JHEA 2B9XA 3MPDA 2FHKA 3KK1B 4GVBA 1FF2A 4CQ1A 3DKDA 1T11A 3PW4A 2HNZA 1RP5A 2DY9A 5IV4A 1RHRB 5D77A 3QT5A 2OEKA 4WXWA 3IMQJ 2CWXA 4IDKA 1F9EB 4RNFA 1FDDA 5IT0A 1FKOA 3FZBA 4LF9F 4DV6F 1NK4A 4LF5J 2QLJB 1QUPA 4LSZB 1P8GA 1Q79A 1HNIB 3JAMU 1JJCB 3UN3A 1Y11A 3GSDA 3VWSA 4CO2A 4AL7A 4DCOB 1N54B 4RW7A 2P9EA 2MJNA 2HZVA 1OYDA 3J81U 2K06A 5HQMA 1JLGB 4I7FB 5CCMA 1PBAA 2C1EB 2FY1A 5IC4B 4X4RA 2UUTA 4PKDB
chains in the Genus database with same CATH topology
3D28A 4YB1P 2BRKA 3NGDA 2VA3A 1RT4A 2CQIA 1FKPA 5F9LA 2DH7A 1I94F 2MZQA 5A0YA 1Q1KA 4ZOSA 2DGQA 2RD5C 2AD9A 1UL3A 2XMVA 3RW6A 3HVWA 4TYBA 3HPOA 3M05A 5U47A 1C1BB 3CMAS 3BSAA 4OZLA 4G1QB 2GJIA 4U7UK 2HWTA 5C42B 3BB5A 5EGYA 2RS8A 3PKYA 4B9NA 4K4WA 1ROFA 4FP9A 3SCJE 4E8UA 1O8BA 2F3JA 4TYAA 3GIKA 3VAMA 1QLNA 1TKDA 4ALZA 5KT3A 3V6DA 2C22A 3R5BA 3JSMB 3KK3B 2JVRA 1RT7A 2U2FA 3I9ZA 2ZVSA 3HMJG 2DNNA 3WC0A 5D4NA 3CDEA 1CQNA 3OR1B 2RKIB 2YNIA 1EP4B 2UZAA 2ZKUA 3MEEA 4URSA 4UY85 1VBZA 2HGNA 2OPRA 2PA3A 3IXQA 3NS5A 4W92B 1HQUA 3TUZC 2X1AA 1UMJA 3SDEA 4GKKF 4QJVA 3CCRS 2GIQA 1HYSA 3A1YG 1N56A 1ZETA 4F4KA 1B7FA 5E3QA 3QGPA 1SI9A 1WHWA 5LT5A 1KOHA 1YITS 1TFYA 2IM1A 1NH7A 3QO9B 3T6JA 1DLOA 3FEZA 2RF2B 4BHQA 4N77A 2VOOA 2OLWA 5I4MA 1S77D 4O0IA 2DHAA 1UVNA 3GIJA 3F56A 4RNOA 1CPZA 2VFUA 2KT3A 4LIWA 1BLUA 2CQ4A 2DNKA 3GYNA 5EWEA 2VD3A 2ZH3A 2AGOA 5EN1A 2JEFA 1LW2B 1RTHB 1DBDA 2WOMA 3OQ2A 4EWTA 5A2QY 3CCUS 2GO9A 4NCGA 2DB1A 2VPWB 2JSXA 3L7PA 5KAKA 1S1UA 1S6UA 4PPDA 5F8LA 4Y3CA 2R7WA 2XS2A 1NKEA 2UUWA 1UVJA 2R8HA 4O3SA 1GTHA 2LQ9A 3I9V9 3C66A 3KG0A 2HHPA 2M70A 1JWWA 2KVIA 2PC6A 3NL0A 3N79A 4ZK7M 3KLFB 1T3OA 5KFSA 5SUHA 1SIWB 2BYCA 4Q8EA 4C11B 1RAJA 1TP7A 5AJ3F 1VQOS 3EGZA 4NLOA 3IWNC 2KJVA 4QWAA 5IXUA 1NJZA 3G4SS 2HAIA 3M2VB 2ZJPQ 4ECQA 1ZTTA 2ZD1A 1BQXA 3I6PA 2EVZA 4KFBA 3SEOA 1F9FA 1XNRF 4DR7F 3I0RA 3OL8A 2DR5A 2DNGA 2RJZA 3DRYA 4ZKAA 3G8SA 3I5CA 2V8VA 2ADBA 4DSKA 3UWTA 1A6LA 2RQ4A 4NYZA 4TY9A 4OQJA 2IC3B 3ULHA 4DL7A 2E7WA 4ED7A 1ZAXA 4ZPBA 1QAIA 4NCBA 4R25A 4RWWA 5T14A 4ZPAA 4HTJA 5T41A 3EZUA 2XLJA 3KMSA 4LSNB 5HLFB 4JI0F 3V4MA 2DGUA 1REVA 2FD2A 4ID8A 3N6LA 4AUKA 4DOZA 4B9SA 4DQIA 3CDWA 4LQ9A 3US5A 4FXDA 2XEXA 3MMBA 3MFIA 1S9GB 3X1LB 1S1VB 3WDOA 5FDLA 5G0RB 4HI2A 4DN9A 4XDDA 4QW8A 1GAOA 4RBUA 1ZM2A 1D0EA 1FCAA 1J5EF 1WEZA 2QFJA 1TQLA 2EK1A 5M2RA 1Y0HA 2YH1A 2VC1A 4DBQA 3U02A 4OI2A 4NPOA 5D4PA 2X1BA 4DQSA 4KGMA 1HNWF 3NMAA 4F02A 1U1QA 2IJFA 1H2UX 2EW9A 4NMLA 3LWLA 2VKRA 5L39A 2XNRA 2HHTA 2K1RA 1RT3B 2XI3A 2VBWA 5IM0A 3B82A 4YB7A 3ZZRA 3M8RA 4DQPA 3D5MA 2PSZA 2E9RX 1L3SA 1S9EA 3QGHA 2VG6B 5JJBA 3PW0A 3LO3A 4IG0B 5DG9A 3MD1A 3HJFA 3DRPB 4X4OA 1HBOA 2QA1A 1B0PA 5CA5A 4A47A 1KLMA 1VRUA 5KG1A 4R0JA 6FD1A 2ZC4A 1J2VA 3O6QA 4OJ3A 2EG1A 1IKVB 5HN0A 3N0VA 1TVRA 3MZIA 3ZZTA 1Z4UA 5SZTA 2HHWA 2B3TB 2CQBA 5D4OA 2FHJA 4M1KA 2W7PA 2HIQA 1FK9A 3DLKB 5HBMA 5HP1A 1HFEL 5KFCA 4DSLA 5GAGU 4HH1A 4QR2A 2EFVA 2E5IA 1SL0A 2QV6A 1L3UA 3EX7B 4FF4A 5KFLA 2Z0GA 4P7TA 3ENWA 2R8IA 4K5RA 2W9CB 2LQBA 4DMZA 1KHVA 2EKYA 4B3TF 2YQ3A 3G96A 2QMWA 2YY3A 3G71S 2RU9A 2JX2A 5MAOA 2IJNA 5H1SV 2DNQA 1DHMA 2FVSA 3HDSA 3HXMA 3BGRB 5G4DA 3RU0A 3Q23A 4DF8A 3ENVA 2YVSA 4HYKA 1Q78A 3QAEA 3FRZA 4WU3A 1KN6A 4FS2A 2MZRA 4HT7A 1F2GA 3QJPA 1KD1T 3NNCA 2YNGA 1S6OA 3ISZA 3PEJA 4UQTA 3GZ7A 1WACA 1FJEB 2VB6A 4N56A 2OIHA 3CDBA 1U1NA 3M9NB 4CIOA 4N8NA 4YFUA 1YRTA 1T05A 4N76A 4KE5A 1Q82T 3CDAA 3W3SA 2BANA 3FEYB 4WU2A 2F8MA 1S49A 3M1VB 3NCRA 1M5PC 3S8SA 2DR9A 3AY0A 3IRXA 4QPTA 1YJWS 2OD4A 3GR0A 5KG4A 2MB0B 3OFHA 2BE2B 1PO6A 3ZC4A 5DG7A 1DJ0A 5C24B 2KG0A 1ELOA 4IOBA 4F3MA 2ILYA 3M9OB 3CVKA 2CZVC 3FSYA 1RJJA 3D1QA 3TARA 2ERRA 5AXMA 2R7RA 2VBYA 2ZJQQ 4ZVGA 4RW9A 3W2WB 1SUQA 3T5KA 1VQ9S 1C0TA 3MMAB 3VAIA 1N5QA 5JXSA 1X9SA 3VR1A 4QCLA 2VFVA 2BJEA 3BN7A 3DFEA 3HHLC 4PXEA 2R8GA 4D3GA 4RUHA 2R7QA 3DRXA 3MWBA 4F8RA 4P7VA 2JFKA 2V4JA 3MEKA 2CIMA 3FQKA 2KI2A 4JI3F 1JB0C 3NS6A 4IFVB 2BM0A 2CPXA 1RT6B 4O4GB 2CFXA 4DUYF 5DQHA 2C42A 1D9FA 4E0DA 4UW2A 4X64F 2DGSA 4MH8A 3AQOA 1YJUA 2N4CA 2BR0A 4LFAF 5JVGQ 2M52A 3CCQS 5A8WA 1YRXA 3I4PA 2NPIA 1RDRA 1GXTA 4OLPA 2RB7A 3DLGB 1K9MT 3DLLQ 4XIUA 3O3LA 2C3UA 3BQ2A 1TKXA 1WG1A 1E6VB 5KT5A 1X4HA 3GFYA 1ZAVA 3I96A 3AB2B 4LF8F 2CZ4A 4YB6A 3RRKA 2MSSA 3OFGA 5J1EA 2N7YA 5I42B 1TL3A 2HW3A 1N33F 4H4MA 2B6AA 3DNCA 3Q2TC 1WEXA 1HQEB 4LUBA 4OZ0A 2XHWA 3PR4A 3LP0B 1K8AT 4LSLB 2KT5A 1FJ7A 2CQGA 2XWYA 3BREA 5HROB 4YR0A 3BSCA 3RW7A 2O3DA 2FVQA 5DM6Q 3DRRA 2QLWA 2KRRA 1VLYA 3BJYA 3AQPA 3E01B 4MFBB 5J2QB 1N88A 2L3MA 1SJ3P 2JZ5A 1M1KT 3T5JA 4P2SA 1QSLA 1TR0A 4X4UA 2WBMA 3DRSB 3SSSA 5KG0A 2K2PA 4O44B 3VAFA 2AGQA 3MEGA 1X5OA 1SJ1A 1WHYA 4JV2A 1M90T 1CEZA 2KXFA 5E0OA 3PRBA 2YX7A 2XSJB 3I31A 5KFMA 4K4XA 4WFZA 3GFZA 4HVZA 4C97A 2J9CA 1Z2ZA 2CQ0A 5J1PA 3BSOA 3IAS9 3CJ2A 2ZH7A 2XY7A 2LXFA 2WHOA 3MM6B 1VGYA 3CULA 3OSPA 3PKMA 3OUYB 4ZPVR 4IH5A 4K4SA 2IYIA 2HPUA 1N5YA 5DO2A 5F3ZA 5DETA 4I1TA 2B4PA 2CPYA 3GG0A 1G2EA 3NNAA 2CQ1A 4A8KA 1J5OB 3IWLA 3DLBA 4B9MA 3GWCA 5J2PB 1DURA 2XC9A 4FF3A 2MQPA 1QAJA 5CYQA 4BWJA 1BQNA 2J6TA 3H2LA 3K8VA 2RT3A 1S0OA 3KNAA 4ZCMA 4QWCA 5E3AA 4OZ1A 3B4DA 3ITHA 2V2KA 1X4CA 1OQ6A 1YSJA 2VFSA 4C4WA 2XI2A 4MK7A