1ROFA

Nmr study of 4fe-4s ferredoxin of thermatoga maritima
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
60
structure length
60
Chain Sequence
MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title An NMR-derived model for the solution structure of oxidized Thermotoga maritima 1[Fe4-S4] ferredoxin.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 3
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rofA00
3EGWB 7FD1A 1G6BA 2FJBB 1PC4A 5E7OB 2GMHA 2O01C 1A6LA 2UZAA 3MM9A 1BQXA 1FEHA 1C4AA 3MM9B 1Y5IB 1Y5NB 1GAOA 2C42A 1FRIA 3EXYA 2V2KA 1FRKA 1FERA 3LW5C 1IR0A 1SJ1A 2VPXB 2VKRA 3MMAA 1XERA 5BYQA 6FD1A 4RKUC 1B0PA 3HKZD 1PC5A 5FD1A 3MMAB 1D3WA 2VPWB 2WSCC 3MMBB 1CLFA 2WSEC 2V4JB 1FD2A 1SIWB 1G3OA 1Y4ZB 1FXRA 4KT0C 4OMFG 3IR7B 1WTFA 7FDRA 2XSJA 1Q16B 3MMCA 2C3OA 2Z8QA 2XSJB 2IVFB 3MMCB 1BLUA 1FTCA 1K0TA 1GT8A 3OR2A 3MM6A 4YDDB 4XK8C 3OR2B 1C4CA 1KQGB 3MM6B 2VPYB 4XDDA 1KQFB 1BC6A 3MMBA 2V4JA 3MM5A 3MM5B 3C8YA 1KEKA 4OV1A 1F5CA 2FDNA 3OR1A 3MM7B 1H7XA 5CH7B 2Y0SD 1HFEL 1RGVA 3OR1B 1H0HB 5CHCB 1FCAA 1FDBA 1FRHA 1FDNA 1F5BA 1JNRB 2FGOA 1B0TA 2VPZB 2WB1D 3IR6B 2PMZD 1BD6A 1JB0C 5L8RC 1FRXA 1IQZA 1GTHA 4CI0B 2WAQD 1Y5LB 1R27B 2C3MA 3MM8A 2GMJA 1FRLA 2FD2A 6FDRA 3MM8B 1FDDA 1GTEA 1DAXA 1FDAA 5BYRA 2WSFC 1FRMA 2C3YA 3MM7A 4DHVA 2PA8D 1H98A 2C3PA 1DURA 3IR5B 1DFDA 1VJWA 2FJAB 4Y28C 1H7WA 3EUNA 1FF2A 1AXQA 2ZVSA 3PNIA 1F2GA 5BYSA 2C3UA 1ROFA 1SIZA 2FJEB 1B0VA 1JNZB 1BWEA 4ID8A 4AYBD 1FRJA 4XDCA 4L6V3 2FJDB 3GYXB 1FXDA 2PDAA
chains in the Genus database with same CATH superfamily
2V8GA 3CDEA 3FMBA 1Q4RA 2RQKA 2HSEB 2R7XA 2GC8A 3R2DJ 1VQSA 5LMNF 2QEXS 2VPXB 5EHHA 1UVLA 3CXCR 2HBQB 3ENVA 1NJIT 4RU2A 3MWBA 2KKHA 5CAAA 4ZVEA 1WOSA 1BQNA 4G3IA 3BF4A 1UVMA 4LFBF 4NLWA 1SKWA 3D6TB 2HIYA 5JXSA 2QLJB 4KYZA 3UFCX 2D69A 4FF2A 1S48A 3SBMA 2K3KA 2EFOA 4FBUA 3R6LB 3FFIB 1K0VA 4CH1A 1OY6A 1NJZA 4DX5A 1N5YB 1CC7A 2HLUA 2VQEJ 2OUGA 2HNYA 2OO4A 1T3NA 1N36J 3DHXA 2CPFA 5KG2A 3KHHA 2HQCA 1UJ5A 2HNDB 5DS7A 4WK3A 5KFCA 1EZZB 4CYUA 4NE9C 1WC6A 1RT3A 3U02A 3L7PA 3WBZA 5BR8F 4DV7F 4NLUA 4LQ3A 3B54A 2D3ZA 1GMVA 4F36A 3KDNA 5C25A 3GU0A 1XEZA 4JI0F 1F6TA 1IN0A 8AT1B 1RTJA 4RUAA 1IKWB 1HHSA 3R7NB 1L3SA 1EB0A 2BKPA 4XK8C 4JI7F 4XDDA 3THTA 1ZS6A 2ACMA 3TAMB 1HI8A 3AHPA 3DKDA 4HLBA 5GAHI 2QLBB 2M9KA 2ZBQA 4E2FB 2APOA 3EZOA 2N4CA 1A9NB 2ROGA 4GKJJ 3THVA 1D8YA 1N6QA 2YKOA 4DCJB 3TNVA 4Q5VA 4ER8A 1U6ZA 3U27A 2RNEA 3OTEA 2PE8A 2W9CB 2OPSB 1UVIA 2GAHC 5D3GA 2HLTA 3BBBA 2JC0A 1RQ0A 3G8TA 1HYSB 2NXCA 2FVSA 4O3RA 4MJKA 1YJWS 1N5TA 1FVSA 3KLHA 3Q8QB 2GJ2A 1VC0A 5KT4A 4X65J 2R7UA 1R43A 3M9NB 3GP9A 1RTIB 1QJHA 1WI8A 4R25A 4CTAB 1NNDA 1AYEA 3JSMA 3DGVA 1T9WA 3NCQA 2XCAA 4RBUA 3L7UA 4KKOB 4A4JA 3M7VA 4CLYA 1URRA 3ZNJ1 2R4FA 4G1QA 4JV5F 2O5DA 3PVXA 2V94A 3Q22A 3GPAA 4JUZA 1S97A 4KGXB 1X4BA 2QTWA 4UUXA 2YWWA 2ALYB 2WONA 6FDRA 4ITSA 4A8WA 4DSJA 5CZXA 1RT2A 5SZTA 1KKHA 5SUHA 1H7WA 4C11B 2BRKA 4NLTA 1REVB 3J7Z5 2H1YA 3N79A 3EGWB 7FD1A 3E2EA 1S79A 1RTZA 3UNGC 1A6LA 2XWXA 5FDLB 4M5DA 2UUAJ 3FEZA 1Y5NB 2EC0A 2HGMA 3B6BA 2UVVA 4C98A 4JI3J 2CUYA 3LP1A 4WTYA 1MWYA 3UI3A 2XMUA 3V4IB 1V3SA 1XR7A 4X62J 1EARA 1YWXA 5LSLA 4YN3B 1Z1ZA 1NRKA 1TUVA 5ETLA 1VQ6S 1CJKB 4PR6A 2L9DA 2QGFB 4C0HA 3BKUA 4S0MA 2BM1A 5BJRA 1UTAA 5F9NA 1NCLA 3DFEA 3OL7A 4WKYA 5IV3A 3PW0A 3OL6A 3PKYA 4FXVA 2MHEA 2HG4A 2E7VA 4N8OA 2ZJQQ 4HYKA 2CJBA 2CPEA 3G71S 3OL9A 2QRRA 4LBPA 5L8RC 3I96A 3US5A 4AL6A 1FX4A 2XTJP 1JXVA 4RW6B 1PYOB 4NYZA 1JJ4A 2IAJB 1OSDA 4YMEA 3V6KA 2M8DB 5IXUA 2EFPA 2V67A 3JSYA 3IR5B 1HNVB 2GV1A 5LOQA 3FKBA 1DQ9A 4PQUA 4FNHA 5KFZA 1GX5A 2JNJA 1RADB 3EICA 2MEWA 2W2OP 4A47A 4L75A 4NXNJ 4KJIA 1TV6B 3KJVA 1L5UA 2JH3A 4DPYA 3VTIA 5A8WB 4Y00A 3BM7A 4NMXA 2QA1A 3SSRA 1T9VA 2VQFF 3MMAA 2IRXA 1HBNB 3DRRA 3A8EA 2EWHA 3BEGB 2BDPA 5GAHU 1T9YA 3I9V9 3IR7B 3K89A 2P6TA 1P1LA 1RAOA 4YB5A 3HHEA 2VPYB 2D3O1 5IT9U 4ZPCA 4CO4A 2HHPA 2KVIA 2UUCF 3IBCB 1HWKA 2CAJA 2NCKL 2ZJPQ 2OAUA 1C0TA 1HFEL 2ZKUA 2OJ3A 3ISND 1URNA 2JFKA 1K73T 1ZM9A 2V68A 3QMQA 4DUYJ 4ZVGA 1TK5A 2N82B 4ECQA 4DV5F 2GMJA 4F4YA 4NLQA 2AGPA 2DPIA 1N88A 2HS0A 1FT8A 1WG4A 2HZAA 3ENQA 1U2FA 1C0UA 1LK7A 1IM4A 3PR4A 1TL7B 3I56S 2GGPA 2AJ2A 2DITA 4CO2A 5C5JA 1Q5YA 3BSCA 1D9FA 2DRAA 4U7CA 1VBZA 1R8PA 3TVYA 4K8RA 4QIEA 3V6JA 4HH1A 4AT1B 3T6JA 2KXNB 2FLNA 2CNNB 3HKZD 1MROA 3CCMS 3G6XA 4ZP6A 3P3DA 3UR3C 1VLOA 3VQTA 3RB4A 4I2QA 1TP7A 1R3NA 4OIXA 4OYOA 1LW0A 3RR7A 2QV6A 5HK4A 1DZ5A 2IMOA 2XYGB 5L1JA 2A3JA 1RP5A 4YB6A 1FJ7A 2F1FA 5KFPA 2B9YA 2H9ZA 4ECXA 3I9ZA 4Q45A 3TX0A 2IVYA 1S1TA 4OX9J 2Z2ZA 5KT5A 3D67A 2HRYA 2YNGB 3QIDA 5I3UB 3UDVA 4HACA 5LSOA 2DNZA 4RO0A 3UVJB 3HI9A 1S9GB 4KPYA 5DQIA 1BQMA 4P9SA 2BJ1A 2IIHA 2ZJRQ 4UF4A 2EG2A 4QIGA 1PBUA 2FJBB 5HO4A 1G1XA 5AJ3F 2BQUA 5I42B 3H5YA 2AHOB 3H0PA 2HFSA 1T9XA 2HS4A 1SVDA 3BR8A 2DNKA 1S10A 3PO5A 5DZ6A 1P6TA 1YHQS 4P2MA 4J9LA 2ILZA 4NEZA 2GNKA 3TX8A 4KGKA 3T6BA 4MTPA 2DXFA 1TL4A 2F4FA 3CJRA 5MAOA 4P75A 3F44A 4F0MA 2I5JA 4A8FA 2IRUA 4DL5A 4X4RA 3Q8VA 4TXSA 3CCRS 1F5BA 2CQ1A 1V5VA 1U1KA 2KXHA 3QFWA 2E5JA 1GTEA 3OV7A 2H54B 1E6YA 3AOBA 1SJFA 5F0WA 2XC9A 3CD7A 1RWNB 3I5CA 2FY1A 2HQDA 1FRJA 3C16B 1LWXA 5D77A 3PZPA 4C8YA 4Y2AA 1NK0A 4LFCJ 3KOAA 1HNXF 4FKYA 3CULA 3MD3A 4OI4A 1RABB 3POTB 3TUIC 2ROPA 3K8WA 2WW4A 1FD2A 5KFOA 4QWEA 4LSLB 3KK1B 2ZH6A 3K57A 4KBIA 1P8GA 1ITPA 2AJ0A 4PG5A 1FFWB 3J7AN 3OR2A 1CJUB 4B9SA 5E3PA 2ZD1B 3KFWX 3R5CA 4K4YA 4RW9A 1RJJA 3M8QA 2CADA 2ZH8A 3PG9A 3RZAA 3G96A 9RUBA 4F4ZA 4KV8B 3M2UA 4ZPAA 1Q7YT 2R7QA 3RBDA 2XYPB 2VG5A 3CDWA 3R8YA 1RWVB 1H38A 3NGRA 2MKCA 2HRTA 1B0VA 1U0SA 2Q66A 5CD4A 1D8ZA 1SJ3P 3R3TA 1F3VA 3QYYA 1Y00A 1RHKB 2BANB 1ZTTA 1SH0A 2R8KA 4DDFA 3G8SA 3QSYB 3PX0A 5IQQA 1LWEA 3CT9A 1C2PA 3G82A 4EU0A 2B8PA 3VAJA 5DG9A 1SI9A 1RHUB 3GFHA 5EWEA 3FBBA 4LFAF 3RBZA 1IR1A 2R8HA 4QWBA 1X60A 4PEOA 3KXDA 4JI8F 4M5NA 3ILJA 2YNFA 3PY8A 4ECUA 4ZA1A 3Q8SB 3NAIA 5D4LA 2CQ0A 1TVRA 3M2VB 4MKBA 3DYAB 3OFFA 2YY3A 1X0FA 2G2OA 3KDOA 2PO4A 3SXLA 1JKHA 3RB6A 2RDJA 4AFFA 3FC9A 4EZ6A 2WOMA 5ETNA 4DL4A 1WD6A 1N33J 1SIZA 4FP9A 2EEYA 3HVWA 4C0OC 3MOJB 3NS6A 2FHOB 4O44B 3DLKB 2ZNYA 1MWZA 1ZAXA 3AOCA 5D0EA 2DT9A 1KS2A 4J9PA 3TP2A 3FGVA 1AT1B 2DXEA 3T19A 2DNQA 2CNLB 4ZLPA 4DLEA 3BGLA 2MJNA 5E33A 3C19A 2DEJA 1Y9OA 2ZBIA 1SH2A 1WTFA 2V63A 1N56A 1HQ2A 1FTCA 4ED8A 1SJRA 3CC7S 2G4BA 4P72A 4CO3A 2ZNZA 1SC3B 2FHMA 3RU0A 2FVRA 4H4MB 2DNOA 2OPQA 4TQRA 5EUHA 2GJIA 2YH0A 4RW7A 4WFXA 2KG1A 3QFHA 5ITHA 2HHSA 2HQIA 3AH6A 3N5BA 2Q3PA 3WX8A 4DR3F 1XMOJ 1NDPA 2AZ1A 3MEDA 1FA0A 2O3DA 2PI5A 2YKMB 1YJ9S 1I6JA 3QO9A 5K14A 3PNIA 1SKSA 2E7XA 3BN7A 3SQGB 3ONQA 2RKIB 1QAXA 1N5SA 4F67A 2O01C 3SQOP 3UCZP 1Y11A 2CDRB 3HHDA 1D9DA 4JI2J 2G9OA 2QJ3A 1NK9A 1UWBB 3N6MA 3NNAA 3AQPA 2B5JA 3DHWC 4PG4A 3DLGA 4P7VA 3M32A 3KMSA 4J91A 3OW2R 4KR0B 2AJFE 1S6PB 2YX4A 2GHVC 5KG1A 4FS2A 3DDIA 3P8BB 4F4XA 2H5EA 3QNWB 3W62A 4QW9A 1I94J 1HIYA 3MFIA 5A6WA 5EWGA 1VHFA 1KFSA 3ICLA 4X4OA 2NREA 1N34J 2UXCF 4ILLA 3MUTP 2R8IA 1RK8A 3R5JB 1SL2A 2W01A 1XNRJ 3KLGB 1WWHA 2HVIA 2BE2A 2XG8A 4BC9A 3MAAB 2VB6A 3EE3A 3JYTB 2I8EA 5DM7Q 3H98A 4GMKA 4C2MA 3NOGA 1WJ9A 3KLEA 3T9NA 4DR6F 2ZWOA 4AYBD 1MMNA 1TKZA 1NAQA 3DLHA 4FVMA 1YJVA 1NM2A 4OYWA 1CC8A 4ZN1A 3SV4A 3MOZA 2COLA 4H4OB 3K59A 1HQUA 2CQPA 2B6AB 3M6VA 3CMES 2QIFA 3WIUA 5KG7A 1FD8A 2IM2A 1JLGB 1G4CA 3MFHA 3FNNA 5KFAA 4U96A 2MXYA 3MM6A 3PHEA 4IRCA 2KT5A 2HFOA 4ZVHA 2RU3A 3OVAA 2XGPA 4B9NA 3CCLS 1T0TV 1HWJA 1SKRA 1RA6A 4QR1A 1HHTP 3D6FB 1ZETA 1FJGJ 1IKVA 3T1HJ 2W9BB 2QL5B 4IKAA 2WHOA 5LM7E 3PX4A 3PACA 1NUEA 2HHHJ 3NLCA 2E29A 2RUSA 2RHSB 1CVJA 1CJVB 2HWHA 2M88A 4DR7J 2VFUA 5ETRA 4ED5A 2H3EB 2FQQB 4DR1F 1XR5A 2HNZA 1DJ0A 2IC3A 1Q5VA 2QLFB 4DCOB 4DR4F 4UW2A 3GTYX 2UXDJ 3G9CA 3NCPA 4WP9A 4DFKA 1F60B 4NLSA 1Q8IA 4NMLA 1XJWB 4UOGA 1HBOA 1KDNA 4LF4J 5KFKA 1GX6A 2FJVA 1JLFA 2WSCC 4YY3J 2EFGA 4XPEA 4CLPA 4KHMA 1HLWA 1SC4B 4DQPA 2RILA 5ETTA 1EP4A 2P9EA 4DPWA 3GCXP 4FF4A 4NA3A 2OTLS 4EBEA 2UUBJ 4DL6A 5KFEA 3BREA 3MM5B 1RU1A 4J9QA 2AYBA 1R0AB 2RAQA 1RLCL 2J9CA 1KWMA 4XPCA 4ZPWR 5HQ8A 3G4SS 4G1PA 4N5SA 2IBKA 4DXLA 1AW0A 4ES1A 2E66A 2WSFC 4NEYA 5KFRA 4WU3A 1QM9A 2ZVSA 3EWGA 3OTCA 4HDGA 2W24A 3LF0A 1SV5B 3QAEA 4B3MJ 2PDAA 2DR8A 4UOCA 1GXUA 1PC4A 4Y6IA 2ABYA 4Z2XA 3HFKA 4ES3A 1WC1A 2RMLA 6FD1A 2JVRA 3J7YI 5B0EA 2LLZA 2CJYB 4LT6A 4MKYA 4HT5A 3PRDA 1FWKA 3BYRA 3RW7A 2GS8A 1KLNA 1RCXB 1K1QA 4K0KF 3FEYB 1U6FA 3J7A1 4KH0B 4KE5A 3ET6B 4YUDA 2BJ8A 1JQGA 4NWBA 3TAPA 4LF1A 4OFZA 3OFEA 2ZHBA 5KFNA 2WCXA 3HHKA 3GJTB 3K8VA 4KKOA 3IC1A 5AE1A 1J2VA 3ETMA 4DR5J 2QYCA 5IZHA 4CIOA 3Q89A 2QFIA 3OPKA 3EUNA 1K47A 2U2FA 4CWBA 3B8HA 3MR5A 1S9FA 4ZCMA 2HHWA 2VFSA 2YXLA 3I5BA 1X7VA 1HBUA 4KSEB 2AZ3A 3F73A 1G6BA 2YQ1A 1WHXA 2ZVIA 2F3JA 3M8PA 4ID5A 2MKJA 4C11A 1PJ5A 3OLBA 5HP1B 1NDLA 3SDEA 5KFFA 4YR0A 3W63A 5C24A 1WEYA 1RWWB 2XMJA 2HAFA 1HMVA 2ZBCA 3SV3A 3BGRA 2ASDA 1VI7A 3V4IA 2HQFA 3OTBA 3DGPA 2LXUA 4BLGA 5HMWA 3E3XA 4PXEA 3PKMA 4UY8T 3H25A 5H9FK 2EK1A 4IDKB 3HSZA 3W5YA 1RTHA 1GMWD 4HHJA 3CW2C 2XB2D 2F63A 1CJKA 1UVKA 5GMKa 5A2QY 1UP1A 2XS7A 1XN9A 2JC1A 4DHVA 2CVIA 3CJSA 2Y1RI 4JOUA 2ACYA 4A8SA 2BVZA 2F8HA 1O5JA 5T7LB 2FJEB 1WTBA 2C2MB 3EGNA 1AROP 4CLKA 3TRGA 4K4XA 4NZ7A 4R0EA 3T9ZA 3C6UB 2IAJA 4ZVOB 5E5NA 1Q81T 4RU9A 5L39A 4X65F 3MCOA 3NAHA 2Q43A 3J80U 1M5VC 1H3DA 4EO8A 1JJ2R 3VQSA 2OKQA 3A8KA 3DRPA 4QOTA 4JI6J 2XY5A 2J0WA 5K8PA 2EFNA 3S1TA 3SIPB 1S0VA 4R0JA 1VS3A 3JXOA 1HBNA 3EXCX 1F1BB 3N6LA 2QYGA 4WIQA 1ZA2B 3TZXA 2DGQA 4EBCA 2GVDB 2VG6B 3KLFA 2J0SD 5KFWA 2KFNA 3KNAA 4ZKAA 3HDSA 3CCSS 5J1EB 4K7QA 4PWDB 4IQXA 3G6VA 2IY5B 5G0RA 3I0SB 1UJ6A 2UUAF 2R7OA 3IWLA 4NXMF 3IRWP 2ZH5A 5I4MA 3N0VA 4X62F 1C4AA 4DCPB 5EX3A 4OHXA 3RTVA 5HQMA 1A7GE 1RHQB 2K1RA 4FPIA 2Z2YB 5A8KB 3J81j 2BV3A 2E1RA 2NSBA 3GMGA 2HHQA 4NA2A 1CULA 5AXKA 2DH8A 1Q78A 2MDAA 1NSAA 1NKCA 5C2CA 2C22A 1RZMA 3QIPB 2DTJA 4Q44A 4U7UK 5HBMB 4RW4B 3M05A 1Q79A 2XMTA 1UCNA 4B3RJ 4N77A 2DR5A 4OX6A 4DLGA 3TUJC 1KVJA 4LF2A 3DI6B 1VRTA 2B56A 3O44A 2PIIA 1KOOA 3M2RA 2DNGA 2B3TB 2MQQA 4FDFA 1YZ6A 2Z57B 3O6QA 3W2VB 3V6DB 3VZHA 3LP2A 1HPZA 2ZZNA 5IV4A 4NXNF 2HQGA 3W65A 1REGX 1L3VA 1RT5A 3ZZRA 3MECB 3M4XA 2DNPA 3L09A 1WDDA 3MEGA 4I7FB 2ZBPA 3EVWA 1NHVA 3MM9A 3V5RA 3SCJE 3R5GA 3VGUA 5KFMA 1B99A 4TNOA 3Q8UA 3SEOA 5DQGA 3O8WA 3U1NA 2BJ7A 1MLAA 2YX7A 3I6PA 4ANDA 4PG6A 4A8KA 2R2TA 5I42A 4R8UB 3D1HA 1C4CA 1LW2B 4MK9A 3F0NA 4DUYF 3H5XA 4M5GA 4P2FA 3ELHA 1KONA 3PW4A 5KG0A 5D4OA 4L74A 1RT4B 5KFGA 4PABA 2ZHOA 1ULRA 2DEIA 3OLAA 3I87A 3HPOA 1FRMA 2C3YA 4KRWA 2W7PA 5GAEI 3KK2A 4OYPA 2J0XA 1PYSB 1FK9A 1YJRA 3ZZYA 4YQWA 1RAEB 2HPUA 1KLMB 3DRXA 4ZCLA 2BACA 4ZJQA 4EMDA 5HROB 4GVBA 4JYAF 5LSRA 2DYAA 2CPJA 1IBKJ 3C16A 4P2XA 1LQ9A 4FF1A 3K58A 2CWKA 2YWEA 1W2BR 4QJVA 3H7HB 2VU5A 2B0GA 4B3OB 3C6TA 3W9JA 4LSLA 4YOEA 4OX9F 3IS9B 3W7BA 1VQLS 1CJUA 1RAJA 4X4UA 2DIVA 3FCHA 4PXBA 2KM8C 3ZZZA 1SCJB 2ZD1A 2WTFA 2YTCA 2FZCB 3NMRA 3WC0A 1D09B 1WC5A 2Q6BA 2VDIA 5IC6B 1YJUA 4RNOA 4RZRA 2ADBA 2FIUA 3FCWA 1WDTA 2VD3A 1VLYA 3LP0A 3FZ2A 2XI3A 1CG2A 3MCMA 3KUEA 1VGYA 3M8ZA 3AQOA 3K5NA 2P9GA 4YB7A 5DO2A 2AD9A 1GXTA 1T11A 2E1AA 1PC5A 1D3WA 3IWXA 4K4TA 3CIMA 3O5TB 2JL9A 1VQNS 5KFBA 2CJAA 1K0TA 1NHKL 3RYLA 2AKWB 3GE9A 2FC8A 5J2MB 4RWWA 4YR3A 2OEJA 2HBRB 1WC3A 3MI7X 3OL8A 4WE1A 3QJLA 4YFUA 4G65A 4I56A 2X1AA 3NBPB 3UD3P 3SSQA 2N3OA 3NG8A 5ETQA 3G86A 4L72B 2YKNB 4DF8A 3IRXA 3CO0P 2K06A 2EXUA 4ICLB 3ZZPA 3E51A 2V50A 4DR2J 1NJYA 4LFCF 3CJ5A 4O4RA 5KT7A 1LFWA 1B70B 2DNMA 1PYTA 2X1FA 3RUBL 1T9UA 4O0NA 4G1IA 4LRBA 5EWFA 3UWTA 1Y5IB 2LVWA 5J2QB 1IXKA 2ASJA 4LREA 3DMJB 4O44A 2V0NA 2MSTA 2GA7A 4MFBB 4I1TA 4O4GB 1U0HB 2XSJA 1LWCA 4AE5A 1WKKA 4OJHA 2P9CA 2HWTA 4USKA 1NSKL 3BPSP 2GZOA 2CQ2A 4DSKA 4ECRA 4NCGB 2IHR1 5GAEU 4FPRA 4CLLA 1IKXA 2YKPA 3QAUA 1FRHA 2XHCA 3M6UA 3E8OA 4KIAA 4ZPVR 2XHWA 3EZ5A 4L3NA 1R7IA 2CXEA 1SB6A 1RDRA 2D41A 4X2BA 4ELTA 1WC0A 2KXFA 4EBDA 3HULA 2YX1A 2EBEA 4RR5A 1HR0J 3TQEA 1TU0B 4RBVA 2YKMA 1UFLA 3ZTOA 2DHHA 3IBWA 2HHVA 4DPOA 3EXYA 1T05B 3SQGA 1P27B 3P49B 2E9ZA 2B4UA 1XQIA 4IOCQ 2D3UA 1TMJA 3GFXA 2BW2A 1VRUB 4WBFA 7FDRA 4LSZB 1DHMA 2XNQA 4ANCA 1MNEA 4FXDA 3BO3A 2X7IA 4JI5F 3M30B 3SCKE 1S6PA 3C46A 2VIHA 4CDIA 3K2YA 5E3CA 3UQSA 4TVAB 2ZE2B 3GYNA 2WB1D 4LF8J 2G0CA 5KFJA 1F5AA 1N33F 4QCLA 2L48A 3LGMA 3DOMB 2HGLA 1JJCB 3KLGA 4DBQA 2BJEA 3LALA 1DLOA 5JMNA 2A6OA 4K50A 2G2ZA 4KPCA 4EYIB 3QRRA 3UN2A 4IUFA 4ETZA 3DRSA 1V5IB 1H72C 3IG1A 1UKUA 3U7JA 3IXQA 5IWAJ 4OZ1A 3QJPA 2I2YA 3PTWA 5LJ3Y 2IA6A 2FUG9 1VISA 4LFAJ 2FC9A 2DRBA 1SQGA 1T03B 2ZEJA 4V19X 3BBCA 4J5OA 2CZ4A 4WZMA 1I51B 2JX2A 1HD0A 4ENOA 1XMOF 3H8YA 5DDOC 4D3GA 5ETOA 1UPPA 1MN7A 1JLBB 1QAYA 1ZPVA 3L4BC 4FYWB 4KFBA 3VVUA 1FESA 2K7JA 2VA3A 3W5XA 2IYGA 3T1YJ 5CXTA 5J2PA 4P7TA 4Y34A 5BYRA 1O0PA 1YQHA 2JOQA 3H59A 3LO3A 2OEMA 4WKRA 4CLTA 1NJXA 5F9LA 5KT2A 5CZVA 4UZBA 4JI2F 8RUCA 1U8WA 1A0OB 2GVZB 3W66A 4OHZA 3OUYB 3H40A 3U1MA 4OHVA 3RRKA 2N7YA 1U26A 1I1GA 4RL1A 1RYRA 4NLOA 2YQ3A 1FO1A 3TW0A 1I94F 2LDYA 4GC6A 2E9TA 4D3HA 2V4JB 2ZBRA 3AA8A 1QUVA 3CJKA 5KFHA 2C2OB 2U1AA 2UXBJ 1N34F 1P9YA 2NUUG 3Q23A 3E01B 2AEFA 2CWXA 1XNRF 3OSPA 1IKYA 3ZFVA 3RAMA 3IWNC 4B3SJ 2EKNA 2HKEA 4NZ0A 5D6GA 3CC2S 2MGZA 2YWHA 4QWDA 4C3MA 5FJ4A 1APSA 3LGNA 2JHEA 1TFWA 2YVSA 3EPIA 1FDDA 2CQCA 1SL1A 2QE5A 2C3PA 3MTKA 3I4PA 4PPDA 3RG6A 3VF0B 5HSPA 4F3OA 4IFYA 4XDCA 1MU2B 1WF0A 2LKZA 2V9WA 4N76A 3EVMA 1QSYA 2MZSA 4UOFA 2MMYA 1VK3A 1KR4A 3KUHA 1TUWA 2Y1JA 3HK2A 2MPUA 5K5MA 4PKDB 4C3LA 1EETA 3H90A 4C97A 4DPTA 2YQ0A 4QW8A 4HR2A 3W9HA 4DV1F 4HKQA 2BOAA 1X4DA 3MMCB 3DM2B 4C8OA 1C1BB 4ZHRA 3P5BP 1NSPA 4IFVB 3HJVA 2B9WA 1FJGF 3T1HF 2GX8A 2VG7A 5B0BA 2QL7B 1TL3B 1EIYB 4K4UA 2NXNA 5B0GA 3Q24A 1OWXA 3ZZTA 2QC3A 2IJRA 2HHHF 3N4WA 2KHDA 3R1LA 4LF5J 4DR7F 4V1Ak 2AYGA 2BJ3A 1IR2A 2FD2A 4OI6A 3ITHA 4LQ9A 4DR6J 2R7SA 1N0UA 3ET6A 4IG3B 5U47A 2DKOB 2UXDF 4KTQA 3ULHA 3OT9A 3KHRA 1GQEA 3DCAA 3B4MA 2KG0A 1Q8KA 1SPBP 1SKUB 2WVBA 5EN1A 1IVZA 2A2DA 4LF4F 4YY3F 1C1CB 2EKYA 2QG9B 3GZ7A 2KJVA 3IFEA 4EUVA 1IR0A 1NBEB 4PQAA 5B09A 3VAFA 4CP5A 2NYHA 2HIQA 2HFNA 4O3QA 1R8CA 3GR0A 2UUBF 1NDCA 1HD1A 5KFLA 1Y3KA 4QBUA 1XK8A 4K59A 4AD6A 1UEUA 1S1UB 2JZ5A 1NB7A 1AZSB 1HQEA 2HK2A 2FHJA 5L38A 4DFMA 3CD0A 1WKLA 3OR1A 2OMOA 1WUUA 4NOHA 2KDOA 4KB7A 2R7RA 4FVCA 4RBTA 1UETA 1SUQB 1YIJS 5LJ5Y 5DQHA 2NSCA 3TVKA 4WYWA 8ATCB 4LMZA 1FE4A 2LEBA 2GHPA 1U25A 1NKBA 2NQPA 3MPVA 2DHAA 4XTTA 3H4BA 1J5EF 3BO4A 4DG1B 2PSZA 2CJ9A 1AFJA 1B64A 2MLXA 2UUWA 4QYZK 2IYIA 2MQPA 2GMHA 1M1HA 2BRLA 1U09A 3PXGa 3JAMU 5GMDA 5T7LA 2VH7A 4C8NA 3Q86A 2DHSA 2KT3A 2ERRA 3WC2A 4OZ0A 1RT6B 3C6UA 2VUGA 1G2EA 1Q1KA 3R27A 5L1LA 2YH1A 2E5HA 2GHWA 3EVOA 4ZITA 4ZP7A 4A8OA 4CNZA 3D54A 1RT7A 1VQ5S 4K5RA 4WIIA 1BQNB 2NYIA 4FYVB 4O3PA 4B9TA 2LP4A 4IQMA 1BGXT 3C14A 2B7BB 3HFVA 2AGQA 2VICA 2FLOA 4X64J 3K5MA 2MKHA 4A8YA 3HVTA 3K7RA 1AUDA 4DR5F 1FKPA 1S1WA 2NXUA 1X5OA 4DOZA 3W8GA 2EFVA 1UW9A 3NL0A 4OX8A 1X0PA 1EX8A 3O1LA 3V2UC 2HNYB 3BKFA 4K4VA 3QT8A 1RT1A 1OMSA 3HM9A 2VOOA 1RBOB 2AP6A 2XBPA 4J9VA 2LQBA 5T41A 3BPDA 5J1EA 1O6XA 1RT3B 4PCQA 2DXDA 2ZC3A 2PEHA 3PM9A 3MUMP 4IO1A 3CJ8A 2MTLA 2DGOA 1FRKA 1OS5A 3CO9A 4NI2A 5C25B 4WFBQ 1QLNA 3LANA 2W2MP 2PMWA 1S6QB 1WELA 4LF6J 2FJWA 2YKAA 3CDUA 4K0KJ 1M1KT 2GW8A 5GAGI 1NZAA 2XULA 4ED3A 1O8BA 2DBBA 2L41A 2RHQB 4DV2J 1QDUB 2DHXA 3CJTA 4ECWA 4OHWA 1ACMB 1JNRB 2FGOA 4WJBA 3QIPA 1JB0C 4OI3A 4B17A 4OZ2A 1Y0HA 5L9XA 4Y3CA 1RA7A 3M8SA 1HI0P 2W2QP 3OXGA 2YKQA 2JLFA 3DOLA 1KHVA 3OXFA 4TQSA 2LQ8A 3HMJG 3I0RA 2HWIA 2VFTA 2VJVA 1H2VZ 3QT5A 4IH6A 4PPZA 2B4OA 3W2VA 4ZLNA 3V6DA 2LXIA 5D3GB 2A6MA 3EPGA 2E7WA 3OTDA 1P9QC 4JI6F 4M5HA 4U95A 2C2RA 2CQDA 3SMZA 3MECA 4EGLA 1FERA 1CSJA 2AYMA 4TY9A 2GJFA 5CYQA 2VKRA 3KLHB 3ENAA 1VFJA 3BDEA 4ZMMA 4C8LA 1IBCB 3PJ9A 4DL7A 2VODA 2JDJA 1KN6A 4KT0C 2M2BA 3BS9A 4J9UE 1ZA1B 3D2WA 2DY9A 2P2CB 1S1VA 2E5IA 4YEAA 2OEKA 3W5ZA 5KFTA 3ADAC 1KOHA 5LXRA 2H5JB 4JV2A 2CKWA 2MZJA 4G1QB 4WP3A 4PG8A 1IQZA 4QZVB 4P52A 2VBXA 2PGCA 2L3MA 2VHGA 4G6VB 3QT6A 1RT2B 4MKAA 3NGKA 2XLJA 2UUTA 4OZ3A 2JRSA 1M1GA 1VHIA 3HD1A 1FKAF 2J8SA 4HVZA 2R7TA 2WVDA 1GEHA 1YRXA 1YRUA 2AMCB 3NGSA 4M94A 4ZCIA 3LP1B 5J2NA 1HNIA 1WEZA 5I3QA 1V9OA 2NZ4A 4I68A 4NASA 3DXSX 2FPHX 4J9RA 4B3RF 2KRRA 4OYBA 2Y1IA 3HFZB 1RU2A 2OD4A 3KK3A 4H4KC 3EGZA 4NA1A 2FDNA 3AJ2A 1RGVA 3IA0A 2PMZD 3X1LB 3CIZA 4X66F 2GO8A 3S6EA 2J5AA 3KKFA 4DSLA 4ZLLA 1WHWA 3IS9A 4DQIA 1QY7A 1DFDA 3GIMA 1BHNA 1BUXA 3HSDA 4NXMJ 2ZH4A 3RBEA 4PQUB 4ZIVA 4NYPA 2FY8A 4TLRA 4HI2A 3ZTQA 3KJVB 3S01A 2FGCA 4M8LA 5D4NA 3JAMY 3QLHA 3FZBA 1VQPS 5GAGU 3I55S 3BGFA 1IWGA 2DD8S 3MMAB 4YR2A 1IM6A 3MPUB 4ZPTR 1K8AT 3KWMA 4BWJA 2C2ZB 3TQ1A 3W1YC 5E3AA 4KGZB 1KQFB 3I31A 3WHIA 2ASLA 3RB0A 3DOKA 4ED6A 1VQMS 2YPYA 3FEXB 3D4JA 4DU7A 1C0TB 4DV3J 2E5LJ 1KRPA 2D74B 2W2PP 3UD5A 5J2MA 3LWLA 3GIJA 2A1BA 4RNNA 1U2CA 1KVKA 2H65B 2QL9B 5KG5A 2AJ1A 1C0UB 1ICEB 2CFXA 2KT2A 2GGPB 2RDIA 4RX6A 4QWCA 1IBKF 3ILLA 4USIA 4ECSA 2AGOA 1JLEB 2F40A 2V5HG 4K4ZA 4TKTA 3CD6S 4FYYB 2GCFA 4EO6A 1LXJA 3ISNC 2IDLA 4IO9Q 3ZZ0A 3UCGA 3J7ZT 4JV1A 2LU2A 2G0JA 1BY9A 2XWYA 4NLXA 2GIQA 1JLAA 3DXBA 3KHLA 2BQRA 3I32A 3W60A 1YJ7A 2Y8YA 5B0DA 4LRFA 2ALZA 4XAKA 3MEEA 4I67A 1U0HA 3CWJA 3H5UA 1Q95G 3I82A 3OD2A 3HX9A 5B08A 3PW5A 1S99A 3CJQA 4DSFA 2GIRA 3IR6B 1JLCA 3KHGA 5ETMA 3GJQB 1N32J 4NCGA 1FDAA 1LEOA 1Q86T 1XMQJ 2BUNA 3LH2S 4TYAA 2OPRA 5IOLA 5LL6d 1DURA 1R6YA 4Z7CA 3JQJA 4JYAJ 1RXOB 4P2SA 3UW1A 4M5LA 3KTQA 4DFPA 4DUZJ 5F0UA 3CGIA 3BKTA 5KAKA 1ZH5A 1YI2S 2BABA 5HVFA 2F9JA 1BMQB 2VV5A 3GFZA 1XWLA 1M5OC 1FXRA 1HNWJ 2XGQA 1RACB 4ZVFA 4EFAC 2E1MC 4CQ1A 1TL1A 3HSGA 3RW6A 5J1PA 3BO2A 2DB1A 3QGPA 5JVHQ 4U6PA 3S8SA 5IS2A 3SCIE 3D1OA 2J9DA 2I5JB 1VYAA 2RQMA 5AT1B 1SQFA 4KGMA 1Y5LB 2WBRA 3UDLA 3GSDA 4DR2F 3DLLQ 1BWVA 1UPMB 4O3OA 4Q0BB 4USUA 4N8NA 2JJ4D 1B3TA 1E6YB 2ZOFA 2UV8A 3CJ0A 2ZWPA 3GYXB 5G4DA 2VC1A 4V19J 1FXLA 1W26A 2M5YA 4ATNA 2MZ1A 5K8NA 1QUPA 2HQ3A 1XTZA 3GG0A 2EC2A 2QMXA 3BV8A 2OIHA 4PWUA 4IRDA 4W98A 3FBEA 4BC7A 1TKDA 1FTRA 1K1SA 1WI6A 2LQ9A 4GRSA 4OV6A 2R2SA 3OR2B 5DLGA 2C2EA 1OJ4A 4F8RA 1JWWA 4RNFA 5KOXA 4LR8A 4ZP8A 3GIRA 2I6WA 1U4BA 2R2RA 2AT1B 2MQ8A 2M70A 3A3OB 3KLIA 1H2UX 3M2UB 1SC6A 1Q8BA 1JK9B 5HLFA 4LRCA 3OFGA 3MM8A 5C42A 4QR2A 2VG5B 1V6HA 4URSA 2ILYA 4CLZA 5A8RA 1JLBA 3A4TA 4WFAQ 2ZM6J 1HR0F 2KZMA 5D0HA 1ROFA 3FRYA 4NRUA 3SFGA 2MB0B 1J5OA 2BYCA 1TFYA 2XQCA 5KFSA 3TZZA 2K8GA 3W8PA 1S9EA 1KFDA 4CLFA 2YNHA 1UEVA 2LA6A 1T9TA 3IN5A 1F9EB 2AV5A 1YZ7A 2RH3A 1N54B 2UVWA 1IJFB 2DVIA 5CD4H 4MYTA 3RBXA 3VAHA 2WW8A 1LWEB 1LWFB 3CCJS 1X5SA 2XMAA 3GWCA 3G82B 1BLUA 1NLKL 1HNZF 1S0NA 1DTQA 3MR2A 4CRJA 2H4WB 1U1MA 3TI0A 4P73A 2V4JA 3FSYA 4LF8F 1SJQA 3QATA 2DNRA 2J6TA 4JB8B 3ILIA 5CHCB 1TKXA 3V81A 2JSXA 3E01A 2BE9B 1CQMA 4RUHA 2YNFB 4W4MA 5K8OA 1TVRB 4IR1A 2XLIA 2JEIA 4UQTA 2UVUA 1JKHB 1RYSA 3TJAA 2QZ8A 2WOMB 2KVQE 4UZCA 3SZ2A 2YWKA 5ETVA 1QSLA 4TY8A 1LKZA 3LUYA 4ECTA 1HBMA 3HZGA 4AL5A 1ZPWX 3GIIA 1DARA 5HL7Q 1OQ3A 4DL2A 5IWAF 3LAKA 4HHUA 1ZM3A 1VR6A 3FQKA 3ZC4A 2F4VJ 2AX1A 1FRIA 5IT9Y 4C8MA 2FTRA 2BX6A 3FRZA 3HZEA 3MR3A 2E1CA 1Y4ZB 4JI5J 2Y3YA 1SBRA 4B08A 2K7KA 5DDQC 2MHNA 3PIPQ 2DR6A 4JP8A 2ZH9A 3AA9A 2MKKA 2FYXA 4RNMA 2OPQB 3A1YG 3T1YF 3Q8PB 3OHBA 1RI7A 3DM2A 1WF1A 1R8BA 2DCLA 2HURA 2LDIA 1N48A 4IFVA 2ZH1A 5DDRC 4QPXA 2IJNA 5KG3A 1MWQA 1F9HA 5HATA 2RRAA 1TL3A 3MEDB 3ZNUA 2P5VA 4KO0A 3DLEB 1TTHB 5K14B 2PA3A 5F3TA 1FWPA 4GO7X 4DV6J 5HAOA 5E3QA 1RTDB 3P45B 2CQ4A 3RAXA 4ZVPB 4JI1F 3TZYA 1BQXA 1H74A 2HBYB 1UVNA 1Q7LB 1R6VA 2UXBF 2BR0A 3WX4A 2B5JB 3DLGB 1PO6A 3M32B 2JEJA 2DRDA 4UT4A 1AA1B 4E98A 4NLYA 4IG0A 1S5ZA 1CJTB 2VKZG 2M7SA 2N4DA 4B3SF 4OLOA 1CEZA 4LSNA 2DK2A 1DRZA 1VQKS 4R5PA 1YJNS 1U6BA 3OFHA 2D9PA 2JEFA 2ZKTA 1YJTA 4F4KA 1UZHA 2BE2B 1KHWA 3JB9k 1AZSA 1W2IA 3TJ8A 2H51B 2VZ9A 3OBIA 4HH0A 4IRKA 2CZVC 3BGUA 2HFUA 3SCLE 2IFXA 1RKJA 3QGGA 2GAGC 3CTRA 5DGBA 2QA4G 1HKAA 4ED2A 4JV0A 3KMQA 5HMYA 2NXEA 2MKSA 1HQUB 2NUHA 2KYZA 4ECYA 4BDPA 1CLFA 2W8KA 1S6OA 3R5BA 3BSOA 1VDHA 1UZDA 3MURP 3NGTA 3M8RA 3PJWA 4ZLJA 4X4SA 1CS4A 1S59A 1WC4A 3MM6B 1RT6A 2XMMA 4B9UA 3WZ0A 4KHRA 4LF5F 4ECVA 1S57A 3IAS9 4M95A 3P96A 1VBXA 2VONA 3N01A 4RPFA 3IGNA 4CO5A 1IKVB 4PXDA 4RW8A 4PG7A 1U1OA 4I2PA 2GQQA 1H2TZ 4X4TA 2X3GA 3ZTRA 1TMMA 3OVSA 5DG7A 4YHHJ 2KHCA 3W2WA 1UWAA 2CG8A 3CDBA 3V4MA 1QVGR 2C2KB 3F56A 4LVOP 4DV0J 2HNZB 2DGXA 4DFJA 2IC3B 4DS5A 1VCTA 3CDAA 2BE7D 1TAQA 3CF5Q 5A0YB 2ZC4A 4OLPA 4CLSA 2ZOMA 4QWAA 1S12A 1D9AA 2HZCA 4LF7J 3UN5A 3H2LA 1XERA 1HBOB 4DV1J 5BXIA 4QIFA 2Y9HA 1JLFB 4HTJA 3IAM9 1RWOB 5F3ZA 4FS1A 4Y2KA 1WOPA 1EP4B 4P10A 2V2QA 2HYIB 2VBYA 2A18A 5T14A 4OV1A 3M9MB 4YS2A 1HW9A 2ZHAA 1S6QA 4ZPBA 3FVYA 1W7WA 3MPWA 4LF9J 2KFZA 3BGOP 5DETA 3FFIA 4BBYA 2M52A 2XMVA 1N5YA 4C8ZA 4CI0B 4F0HA 1NPPA 5E2QA 4F25A 3IGVA 2IJFA 1IBMF 2XMKA 4DQRA 2LU1A 2V2ZA 2R2UA 2LEAA 1VJWA 2PT0A 1HWIA 1XR6A 4E8UA 2MLZA 1RWUA 2HNDA 2OMLA 1U47A 2BKOA 1WG1A 4QIVA 3HXMA 2F65A 5ETSA 3GONA 2VL1A 1RHJB 1PCAA 2QLWA 5D78A 2WVCA 3AB2B 3TVZA 2RF2B 1VOMA 1VIXA 5FD1A 2I9SA 2XS2A 2J6UA 1IKWA 2WVEA 4X64F 4ZN3A 1KD1T 2E5GA 3T5KA 3L7OA 3T5HA 2XY7A 3TAMA 2DNYA 4I6WA 3VR1A 4NCBA 4CT8A 2MJUA 4WK1A 3SFUA 3MD1A 2Q6CA 5FIIA 5LMUJ 2WK4A 2H48B 2RB7A 1J5EJ 2HMIB 1UA0A 2HVDA 4Y2CA 1H6KX 3JQMA 3VVTA 3KJFB 2Z4PA 2XYHB 2A2CA 3AFGA 3QGIA 2W9CA 2OPSA 1X4GA 4P74A 1HBUB 2XMWA 3NP5A 4Q43A 1HYSA 3M8PB 3MR7A 2NR0A 1UAWA 4ID5B 1Y3JA 4C4WA 3EM1A 1YBUA 4KQZA 4LF6F 2OFHX 3MMBB 1DY3A 3SDEB 2RQCA 4ZPDA 1RTIA 5FLXU 2OHDA 2LFVA 4CTAA 5IQ6A 3GR1A 5C24B 4Y0FA 2QX0A 1HW8A 1GXLA 4DV2F 4NLRA 5AE2A 2BQ3A 1HMVB 4Z7YA 3BGRB 3HHLB 2B51A 1P1TA 2ZUGA 2XO6A 3MMJA 1IJEB 2BZ2A 5IC4B 3DGPB 1X31C 1U45A 4C7QA 4CM2A 1KTQA 3NNCA 1RTHB 3H42A 2NPFA 1M5SA 2IM3A 4ED1A 2W4PA 3H20A 5KFIA 3U1LA 4MIWA 1T7PA 4WZQA 1RKIA 3G6ES 2PN6A 1D1UA 2V69A 3D3CJ 2QSFA 1REVA 3M8WA 2ZH2A 4ED7A 1U7LA 3HO1A 2N3LA 1FXDA 3VCDA 1NJWA 2DR7A 4HTIA 2W4CA 3EGVA 4UQGA 5FDLA 4QIWD 3PX6A 4HHHA 5HQLA 5LT5A 2CQHA 4DL3A 2AEMA 5CA5A 4RUBA 3DRPB 5HJXA 1NH7A 1QE1B 4ERDA 5ADZA 2BXJA 4TLQA 1Z4UA 2B7CB 2C3OA 4YB1P 4ILMA 3PW2A 4MMOA 3HHNB 2J9DE 3NMAA 3IO1A 4OHYA 1B7YB 1H7XA 3N9UC 1R0CB 5L1IA 3JTPA 2LXFA 2J0QD 3DLJA 2LA4A 1FDBA 4Q8EA 1AUSL 1N5VA 1RHRB 3D28A 3CNQP 3KLFB 4LR7A 4NLPA 4RW6A 3MF5A 1YDLA 2QSWA 1FHTA 3FQLA 2MQMA 4OL8A 4K2XA 1HNVA 4ED0A 3QZ7A 2CRLA 5G0RB 4WCEQ 1VRQC 5E0OA 1TV6A 4ED4A 1U1PA 1F3FA 1HL6A 1SXLA 5A8WA 3DDNA 3TYTA 1WSRA 2HW3A 1VBYA 2K1RB 3HVAA 1ZOTA 1VBKA 4CO0A 3PJXA 1X9SA 5B7WA 2VC0A 4OYIA 1CULB 1JLEA 3HKWA 4DUTA 1NPRA 3VAGA 2Z0GA 5CCMA 1NK7A 2UVRA 3UCUP 4PUOB 2B9EA 3R9LA 1SQEA 1TR0A 4KH1B 1S0OA 1GMUA 4CNYA 1KC8T 1DQAA 4WP8A 1R31A 1VMBA 4A48A 1HI1A 1MMDA 1WOOA 1RAAB 3MGJA 1Q82T 4DV4J 3LPYA 1VRTB 2UP1A 4PAAA 4OZJA 3M2RB 2GMLA 3T3FA 1HHQA 4OQJA 1NK6A 3LP2B 1HPZB 2YWFA 1TK8A 1TL5A 1RT5B 1TL7A 3DLBA 4ZVSB 2YBVA 4WXWA 4Q8FA 3MEGB 3FDSA 2DGWA 4HT7A 2Y8WA 2HHXA 4WWSA 1QVFR 2E1PA 1W25A 3MM9B 2H4YB 1U48A 1FI4A 4DMZA 4DX6A 2W4DA 3PYEA 1S72S 1SH3A 3UDEA 1UFWA 1GFWB 3Q0AA 2RS2A 3BJYA 3PFEA 4F7VA 3LTOA 3Q2SC 3D68A 2L9WA 4O3NA 1NDKA 1QTNB 4YDDB 2MY8A 4OZNA 4DZDA 1BC6A 1H73A 4X4QA 4DV3F 1OPIA 2HFZA 3M6WA 2E5LF 1HARA 1R89A 2F7VA 2OI2A 3D3BJ 4X66J 4X4VA 2QMUB 3UO0A 4Y2MA 5GADI 1S6UA 2HVEA 3OSNA 2J9EA 2WAQD 3EMTA 2YNGA 2XO7A 5DZ7A 3PHTA 5I3UA 1GNKA 4USVA 3T1AA 4C9DA 3DU6A 3UVJA 1S9GA 1OYEA 3MR6A 1UVJA 3LPEA 3KK2B 1NK4A 5D0RA 2MYFA 1JNZB 1FK9B 5KFVA 3HHLC 4C48A 3MXHP 1JXEA 1FJCA 4EWTA 4Q0BA 4ZIWA 2KTQA 5B0CA 4GVBB 3AXKA 3HHLD 1PJ7A 1M90T 1M5KC 3O2IA 2KZZA 1UMJA 2F8EX 1Q0NA 3MHYA 5HMXA 1XNQF 2SXLA 2QA2A 1OY8A 4Q7AA 5FLXY 4F3QA 5F8GA 4F4WA 2HBZB 3PFOA 1NK8A 1ZM4A 3NGDA 3EZUA 3RRHA 2W1BA 3R5AA 3HT0A 4QQBA 1TELA 3L95X 2VFRA 1MN9A 3C6TB 4CLWA 2LEPA 4WFNQ 2F5GA 1N32F 4NPOA 5KT3A 2AYEA 1XMQF 3TEHB 2V4RA 3QT7A 4RWXA 1KP6A 4X84A 2P6SA 4JI4J 2EBGA 1Q53A 1X4CA 5HJYA 1LK5A 3HP6A 2OSRA 4GKKJ 2RRNA 4O23A 2RD5C 4ECZA 1S77D 2AQ4A 4DUZF 4AQYJ 3BH7B 1RAIB 4L6V3 1KSPA 4AXIA 4WFYA 3LP0B 3POTA 1ELOA 3BH6B 4MIBA 2J6SA 3H4DA 1Z2ZA 1HNWF 2RVJA 3CCVS 3UE2A 1ZAVA 3KK1A 4GVLA 5F8HA 3QRPA 3TOQA 1Y10A 3VWSA 1WHYA 3MCNA 5EGYA 1U8SA 4OYZA 4Q2MA 1FNOA 3P4UB 3PRVA 3UN3A 3GSIA 2OPPB 3G6YA 1LWFA 1T94A 4WE1B 5B0AA 4X4PA 4KV8A 1T3OA 4MH8A 1VQ4S 1WACA 2MZRA 2NLWA 3A8JA 5CCLA 3TWZA 1BD6A 2DGUA 2KYXA 2W25A 3NOCA 2W2NP 2G1DA 2FLPA 2PD1A 3GQCA 2I1RA 1FRLA 1NH8A 3IRXB 2R8JA 3VZIA 4CZCA 3J80Y 1U1RA 3KUGA 1B4SA 1PBAA 4FYDA 1OYDA 4ID8A 3V6HA 3BR9A 4TN2A 1FKOB 3BB5A 3CCES 1X4EA 4BS2A 5AXLA 1KQKA 2D1CA 1U1LA 2BANA 2MY7A 2KO1A 2I0XA 3BYPA 1B0PA 4M5JA 5DLFA 3PV8A 4GO5X 3ILOA 2VBZA 2EVZA 5KFDA 4DEZA 2PMHA 2XSJB 1LWCB 1NO8A 5GADU 4PRFA 2GQ2A 3QWUA 3K0JA 4OI2A 4WTOB 3LGHA 5F41A 4UUWA 2YNIB 2BBEA 4RLEA 1KEKA 4B9LA 2UU9J 1FJEB 2Y0SD 2O67A 2FLLA 1IKXB 1BE4A 2HGNA 4DN0A 3IMQJ 5AXNA 3M2VA 3DYAA 4BHQA 2ZM6F 2ZUAA 1S1XB 4MAKA 4KAIA 1PJ6A 2KFYA 1NSQA 3CCUS 1S4EA 2DGSA 3MZIA 5DM6Q 4J90A 2POKA 2XSFA 2FJXA 3AOAA 1X8DA 4J9MA 2J76E 5JUMA 4J37A 3DLKA 5H9FJ 3PYFA 2KI2A 3RRGA 1ZBTA 2EG1A 3CB4A 2DNHA 3DLEA 4N47A 5ETKA 3LAMA 5K9FA 4IOAQ 4KHPJ 1T02A 5J1NA 3FCVA 3ZZUA 1RTDA 2MQOA 4Z37A 1WG5A 1O51A 3TA2A 1RHMB 2B43A 2EW9A 1Q16B 1XC9A 1U24A 5F8NA 2IM1A 3W3SA 4F2RA 4J7CA 4H4MA 5RUBA 4O3SA 3G8QA 1CJTA 3VGTA 1R0BG 3ZZOA 2PFFB 3OTOJ 3PCOB 3H2VE 4BWMA 3NGUA 1YGYA 3HF5A 4TU8A 3WDOA 1WNEA 1V3RA 3GJSB 2GO9A 3AB4B 3TA0A 1FE0A 5A2QU 1DLOB 2RU9A 3KJNB 2F4VF 2OELA 2RKIA 2R3VA 5I3PA 1EAYC 4A8QA 4CLUA 4OI0A 3DRSB 3B4DA 1HWUA 3MAHA 2VFVA 2Y1LB 4J9SA 3IG1B 1OPZA 1UWBA 4XIUA 3OJSA 2BJDA 4I69A 5GVQA 1YVFA 5DG8A 5ETPA 2FB0A 2VOPA 2V8VA 4IYQA 5D4PA 1HNZJ 5F8IA 2EK6A 4ES2A 1G3OA 4A8MP 2VBWA 4ZCKA 5IFMA 4OYAA 2DO0A 2O1PA 2CQGA 1GT8A 5DDPC 1VQ8S 1NMEB 3K5LA 4B3TJ 1JJHA 3QGHA 4N56A 3MM7B 1YK9A 2AJQA 3TARA 1Y7PA 1OQ6A 3MAAA 1B0TA 4KFBB 1TKTB 3OQ2A 3JYTA 5J2PB 4DV6F 2HAIA 1GMWA 1AXQA 3IP0A 4IH5A 4P71A 4IH7A 5L1KA 1YTYA 4ZOSA 2G13A 4OX7A 1IUJA 4EYHB 5D8HB 4H4OA 3MCSA 2DNLA 3VGSA 2B6AA 3GJRB 3BSNA 3UDCA 2NS1B 4NCAA 2VPWB 1JLGA 2RQ4A 3NNHA 2LECA 4AUKA 4DX7A 2W9AA 3CJKB 5A0YA 3CSKA 1I3OB 2HEKA 3WIVA 1KQSR 2IVFB 2HHUA 1IBLJ 2BEFA 4CO1A 3IM8A 3PRBA 2XZWA 1IKYB 5F8MA 1JX4A 2BKNA 2MGZB 2A0FB 2R9LA 4K4WA 2W9BA 2ADCA 2CPYA 1FNXH 3A3NB 2V8PA 4OZ5A 4DQQA 2M3DA 4M5KA 1CJVA 1H98A 4ELUA 5JJBA 3CPWR 4Y28C 3EDRB 4JI1J 2Z2MA 3Q2TC 2BOPA 2F9DA 1K44A 4IFYB 2MQNA 3FJ2A 1YX2A 9ATCB 4DL0C 3TANA 4C6AA 5CABA 2IDEA 2CJXB 3SSSA 4WXOA 2LQJA 1RUSA 4UY85 3GV8B 2CNKB 4DJBA 1NKEA 2V2VA 2LCWA 1EETB 1SIWB 3PYGA 1HWLA 3C3LA 2NZCA 2ROEA 3AJDA 2QO3A 3AAWB 1JIHA 2RF2A 5M2UA 3JQKA 4ZHRB 2IM0A 2KH9A 3MM5A 5KG4A 4WYLA 3WQPA 4DQSA 1R0AA 2VG7B 1J27A 4U7UD 2PEBA 4ZJOA 4F50A 2LMIA 2CNOB 3A8IA 4YHHF 1NEEA 1NK5A 2GQCA 2ZH7A 2I38A 4DV0F 2PC6A 3J81U 3ITHB 4CCHA 2D9OA 3RB3A 1QD1A 4K5SA 2R7VA 1X4AA 2VQEF 2J7WA 5CYMB 2ZZTA 4L73A 1N36F 1SV5A 3BN4A 3C15B 3Q8RB 2R7WA 3PDNA 2L08A 1S4FA 3JTOA 1PAEX 3GG1A 2HMIA 3KG4A 4LF7F 3SYZA 3QQCD 4LVNP 2LYVA 4WFZA 4M1KA 3D5MA 3FSXA 2K3IA 1YSJA 3BSAA 4M5IA 2M4MA 3KG1A 2CPZA 4PYAA 2CVEA 5LMNJ 1QTMA 3ZXWA 2X51A 1T8EA 4EI2A 1KQGB 4LF9F 1QAJA 3MMBA 3GFYA 3UNYA 5IM0B 2AX0A 1HQEB 4XO0A 4N7TA 1VQ9S 2HS3A 2ZZMA 4LFBJ 3OR1B 1CQNA 3BQ2A 3VV2B 4MYUA 1F2HA 3R1HA 2G0IA 5D15A 3HHLA 4NLVA 2BA9A 1JLQB 2V34A 2JWNA 2DJWA 2G2YA 4A8XA 2ASYA 1IQTA 1U1QA 4C0BA 4OZLA 4GKJF 4LJMA 1U1NA 3DDKA 2FJAB 3AXMA 1WKJA 2CPXA 2B4VA 4U8VA 1VQOS 1WHVA 1PIEA 2FJDB 2M0GB 2JVOA 2NPIA 2QFJA 1WF2A 4FN5A 4F0KA 2GIFA 3D1QA 3JSRA 4I6YA 4QU6A 2CQ3A 2IRYA 3AD7C 3AD9C 5HP1A 3MPYA 4URGA 2CJKA 5BR8J 2WSEC 4DV7J 4ZS6A 1PAUB 4NLDA 3R6GB 1YLXA 3CCWA 3W64A 5HVGA 1PG5B 2YPZA 4TU9A 1RT7B 1Q8LA 3ZO7A 4JI0J 2KM8B 2FZGB 1QE1A 2Y0BB 2MZTA 2XNRA 3NY0A 2V8DA 1E6VB 4IDKA 1S49A 3C14B 2XY6A 4DPUA 3M1VB 4LR9A 5LMUF 3HCXA 4JI7J 1H0HB 3CEDA 1SL0A 3HVTB 1T95A 1LNQA 1DTTB 1K9MT 1EJ7L 4OI1A 1FKPB 1IBMJ 1S1WB 1GTHA 2XLKA 4K4SA 2QA4S 2PA8D 4DZ6A 3GCWP 1VJQA 2V9KA 1RT1B 3HD2A 5L9NA 5H9EK 2BW7A 1I5OB 3FK4A 3PR5B 2DH7A 3NWRA 2RIJA 5KFUA 3CCTA 2Z2LA 5THWA 1S76D 4I4BA 4B02A 4NI2B 2X3DA 3J7YU 5HVHA 2DNNA 4ZDNA 4U67Q 1UL3A 4JI3F 3I4HX 2N7CA 1GH8A 2ATCB 7AT1B 4IOBA 3EYZA 5E3RA 2CYYA 5A6PA 3D66A 3N6NA 2XM3A 2ATLA 2BM0A 5C2GA 3CCZA 4FZVA 2IPOB 3LA0A 3AJ1A 4QR0A 5C7PA 3F41A 4QYRA 4B9VA 2GVDA 2VG6A 4PUOA 2Z56B 1RLDA 3B78A 1ZZNA 3PYDA 2JEGA 4J9OA 3QJJA 2GFFA 1S7HA 4OYMA 2DCUB 4JV5J 4CYUB 4QU7A 2JLGA 3PO4A 1VC5A 4PWDA 2XCPA 3DOLB 2EFQA 2XS5A 3I0SA 2IVMA 3GLJA 3I0RB 4UOHA 3FUYA 4OJ1A 5AXMA 4F2SA 1AB8A 3ISZA 3NRBA 3FBCA 4I0WA 3DRYA 2IBOA 1RTJB 1EHWA 5A8KA 3PW7A 4LUBA 2DH9A 5CYQB 4RKUC 4YP3A 3JTNA 5B0FA 1U02A 3K5PA 1RAGB 4OMFG 3K17A 3HLUA 4E0DA 1RBAA 3PEHA 1N0VC 4AL7A 4WF9Q 2DGVA 5HBMA 1KTVA 4USMA 2OP5A 4ILRA 4RW4A 3T5JA 3K5OA 1LXNA 1N6QB 4ZVQB 1S1VB 1VK8A 4GC7A 2IA0A 5HANA 2PI4A 3DI6A 4RNHA 1FCAA 1NU4A 4PYDA 1FDNA 4F02A 5JVGQ 3R2CJ 4LRDA 1VQ7S 2R42A 4ETXA 3J81Y 1DAXA 2M8HA 1N52B 1WORA 3PEJA 2MKYA 2XI2A 2KB2A 5HN0A 3ZTSA 4I7FA 4B9MA 3OJUA 3FSIA 4UTGA 3A13A 1GK8A 4HDHA 1FEHA 5M2RA 2MZQA 1BXNA 2Z30B 3JSMB 2C42A 1YBTA 2WZ1A 2XZDB 2FHJD 1X9MA 5J2NB 1HNIB 2VQFJ 3AY0A 4OJGA 5KTQA 4R8UA 1UW4A 2O66A 3KYLA 3RR8A 3D0HE 4PXCA 3DC2A 4WU2A 4QPTA 1YG0A 2E9RX 1LW2A 1FEEA 4DV4F 3RGIA 2FVQA 3D6HB 2WONB 4N41A 4OJ3A 3KK3B 3QRQA 1TQLA 4JBCA 1EKSA 3BZQA 4DSIA 1RT4A 4A46A 2UUCJ 1PGZA 1FVQA 5MLCV 1X5PA 3TA1A 4NRTA 1RAHB 1NB2A 1M5HA 1TAUA 2JFDA 1N8RT 4M5DB 3ETOA 2MLYA 4DV5J 2C3UA 1U2RA 1KLMA 3G87A 3P5TL 3R5DA 5H1SV 3DNCA 5HROA 3BQ0A 3HSJA 2C1EB 5KT6A 1VIOA 3QLHB 2V2KA 2WVFA 5BYQA 2B4PA 5E41A 3RJMB 3TZWA 4DI6A 4BCAA 2DO4A 3LQVA 4IR9A 4RJVA 2AU0A 5M2PA 4FNIA 2VF3A 3HT3A 5A76A 3DU5A 2V6AA 4B3OA 3KLVA 3DOKB 4DPXA 4C3KA 3IBFB 2KU7A 4CT9A 3DN9A 2VJUA 1F0XA 3B82A 3EJMA 1FRXA 1LFPA 2W7OA 2CDQA 2OPPA 2DHGA 4CM0A 1ZAWA 4USJC 1F2GA 4YDXA 3CUNA 4C8KA 3VHQA 2UV8G 2NXJA 2CA9A 4LBIA 3DRRB 2XEXA 3CVKA 1EKRA 3HVRA 5CYJA 1XMBA 5CQGA 2MSSA 2P8IA 2CPDA 3GV5B 3VGVA 1GAOA 2RDDA 3OVBA 3LW5C 1UEKA 1SJ1A 5AJ3J 1FKOA 4EEYA 2CPHA 2FHKA 4KY3A 3LWMA 5HI7A 3LOUA 1RWPB 1R8HA 1MW7A 4OYXA 1JLAB 4FKXA 1ZYQA 1TUGB 3TO8A 3D0IE 4M63A 4FYXB 3MEEB 2L9NA 4JI4F 4DF4A 5KFQA 5CH7B 5D0GA 1RWMB 3NBPA 5HMZA 3FBFA 4GKKF 1SC1B 3R97A 3W9IA 2VPZB 1ZM2A 2YNIA 1JLCB 2YKNA 5F8JA 3D7SB 4ZK7M 4ICLA 1NPKA 4AQYF 4ANEA 3PIOQ 2VDHA 4URQU 2OPRB 3BDPA 4MKVA 2RE1A 2F8MA 3CMAS 2KRBA 1S1XA 4ZVTB 2HVZA 1MROB 1CBKA 4HL9A 4USTA 3D6MB 1XNQJ 4I2QB 5J2QA 3OHAA 1LW0B 1X4FA 4TU7A 3DMJA 2A10A 3BBFA 3R7SB 3OXLA 1HNXJ 2HFVA 2QT7A 2H5IB 4MFBA 3MEKA 1NXIA 1M5PC 4O4GA 1Z2LA 5DRKA 2ZDPA 3G2XA 2Z8QA 1G7CB 4QYZJ 3KJQB 1S7IA 4F4AA 2B8QA 5IT4A 1AFIA 1TL1B 1S1TB 4NL5A 1OIAA 1F5CA 5LXYA 4PZVA 3NXZA 1CPZA 3BQ1A 4HACB 4F26A 2J7UA 2X1BA 1OSCA 3EDQB 5K20B 5H9EJ 1BQMB 1X9WA 4I64A 4Q2LA 1X4HA 2AW0A 5GMEA 1ZZFA 2OGUA 2R8GA 4X4NA 1R8AA 1X5TA 1FFSB 2CG4A 1QSSA 3M8YA 5EDWA 2YWGA 4NYOA 1TK0A 2UZAA 3UR0A 1T05A 3CE8A 1UJ4A 4H54A 4WPAA 2FVCA 2VA2A 2OD6A 3VAKA 3GYGA 1SJ4P 1VRUA 1HA1A 2ZDOA 3ZTPA 1RCOB 3GILA 1MSWD 3AD8C 2RT3A 4ZVUB 2UU9F 3NEKA 3L9ZA 1KBRA 2G1HA 3M6XA 2DY1A 2AEJA 3TEGA 3C2PA 3RAQA 1PSDA 3M30A 3AODA 3NS5A 6AT1B 2W7AA 4ELVA 2RUGA 2DGTA 2ZITA 2ZE2A 1LOUA 3A3PB 3I5AA 2CPIA 3KLIB 3TUZC 1RB0A 5DJBA 2VASA 2C28A 2C3MA 5HLFB 2DR9A 3DOMA 1YRTA 4JI8J 3MM8B 5C42B 1V3ZA 3MM7A 1LV5A 2CQBA 1FF2A 1NZ8A 5A8RB 2IMWP 2EPIA 4CH7A 1EQMA 1S0MA 4TYBA 1TKTA 1J5OB 4LIRA 2HRUA 4KHPF 2BMBA 5E7OB 1MG7A 3TUPA 3NKYA 1DQ8A 1S9EB 2YNHB 4HEA9 4DN9A 1KVIA 3L3CA 1OY9A 4ZP9A 3QZ8A 1ZTWA 2FVPA 1N4LA 4USHA 4FF3A 2WBMA 4DSEA 3T5LA 2PFDA 3X3UA 4RW9B 3CJ4A 3M8QB 1IWAA 1T03A 3UD4P 3IM9A 1DTQB 3W61A 4EZ9A 2QLXA 1FNMA 1JXLA 1RBLA 3H2UB 3OTOF 4DS4A 1M0SA 3C8YA 4MK7A 4MK8A 1RAFB 2J8AA 4O0IA 4NZ6A 4RUCA 2WRMA 4P6QA 2AWZA 1TKXB 3V81B 3QWPA 2HVHA 5L46A 3T41A 1KNZA 2KL8A 3H5SA 4J9KA 3CCQS 2W8LA 3AT1B 4M5MA 3QPIA 3O3LA 5KOWA 2E44A 1WSVA 3TJ9A 4CH0S 4DR3J 2CQIA 3ENWA 4Y2IA 3SI8A 4TY8B 1RE1B 3C66A 3KG0A 1HBMB 1QAIA 2GVZA 2AJ4A 3OUYA 2OLWA 1N5QA 4I6AA 2WB4A 3HJFA 4J9NA 2HHTA 4EK2A 2LQ5A 2RS8A 4MIAA 3P6YC 2OTJS 2MQLA 3UPFA 4B3TF 4KGVB 2ZFHA 4KC5A 1XBWA 3S7RA 3JSBA 3FMWA 2AIRB 3CJ3A 4FXWA 1EQ0A 2UXCJ 2Z58B 3VALA 5KG6A 1RSCA 1WEXA 1L3KA 2KJWA 2DIUA 4AXJA 3KNGA 3CC4S 3GB0A 2J7KA 1FX2A 4KO0B 3GIKA 3M9OB 3A12A 4U8YA 5BYSA 1MU2A 2CZ9A 2OSQA 4K2JA 1XIQA 4NX9A 2FZKB 4ZVRB 2HK3A 3GV7B 5KFXA 3MTJA 2BJ9A 5EX0A 4DX8H 5CYMA 1F9FA 4DU8A 1VC6A 3C15A 3TAQA 1D0EA 2V4QA 1YITS 1IBLF 3TR5A 3MDFA 2MKIA 3MAQA 1UFKA 4IG0B 4RW7B 3MMCA 4LRAA 1C1BA 2RSQA 1U49A 3D9BA 4LSNB 2V8HA 4L3KA 4NLGA 2EI5A 4R5PB 4W90B 2JLEA 4MT1A 2OFGX 1L3TA 3NWGA 1FFGB 3QO9B 3R7BB 4W92B 4LIWA 1YKWA 5IM0A 1PKUA 2XZTB 2RJZA 1UA1A 4IG3A 3N28A 1YBAA 2KN4A 4F3MA 3MUVP 2Q1LA 1RISA 1BWEA 4HI1A 5KFYA 1JLQA 2Q79A 3QBCA 3Q8YA 3CD5A 3CJ2A 4USWA 3EX7B 4DR1J 1L3UA 1C1CA 4B3MF 4Y65A 3D0GE 4DR4J 2AF6A 1TZ0A 2B9XA 1RWKB 2D3OR 2QMWA 3QSIA 5DGAA 1FWLA 2D7SA 2DISA 2X1GA 2ZOGA 2CIMA 1CS4B 1S1UA 3MPDA 1JMTA 4FBTA 2DPJA 1DBDA 1VQYA 2OH2A 1RWXB 2K2PA 4DWIA 2C2DA 1B7FA 2CJQA 2HZVA 2C2NA 1SUQA 4L76A 3KLEB 2RRBA 5IT0A 3NS7B 1TKZB 3VAIA 4RW8B 3NCRA 1R27B 4ZJLA 1NHUA 1E6VA 4I2PB 5F8LA 2ZH3A 1PILA 3VAMA 4U9RA 3M1VA 5K8MA 3W2WB 3JS9A 5AE3A 4DG1A 4ALZA 1DTTA 2QN6B 3N5FA 4F04B 1OO0B 4PWWA 3Q83A 3THPA 3CMQA 1MMLA 4LBHA 4H4KA
chains in the Genus database with same CATH topology
2V8GA 5I3PA 4A8QA 4P2SA 3UW1A 3IRWP 3CDEA 3FMBA 3KTQA 4OI0A 3DRSB 2ZH5A 4DFPA 1Q4RA 2RQKA 5I4MA 3WC2A 3N0VA 3B4DA 1HWUA 3MAHA 5F0UA 2VFVA 4J9SA 3IG1B 1OPZA 3CGIA 4X62F 1C4AA 1UWBA 2R7XA 5EX3A 4XIUA 3OJSA 2BJDA 2GC8A 4OHXA 4I69A 3RTVA 1A7GE 5KAKA 2K1RA 1ZH5A 1VQSA 1YI2S 5GVQA 2BABA 5LMNF 1YVFA 2QEXS 5A8KB 5DG8A 2FB0A 2BV3A 2E1RA 2NSBA 2VPXB 3GMGA 5EHHA 1UVLA 2VOPA 3CXCR 2F9JA 2V8VA 2HHQA 2VV5A 4IYQA 4NA2A 5D4PA 3GFZA 3ENVA 1XWLA 5F8IA 1NJIT 2EK6A 4ES2A 5AXKA 1G3OA 4A8MP 4RU2A 1M5OC 3MWBA 1FXRA 2XGQA 2DH8A 1Q78A 2MDAA 2VBWA 1NKCA 4ZCKA 5IFMA 2KKHA 4ZVFA 2DO0A 4ZVEA 2C22A 1BQNA 2O1PA 4EFAC 4G3IA 2E1MC 3BF4A 4CQ1A 2CQGA 1UVMA 1GT8A 5DDPC 4LFBF 1TL1A 4NLWA 1VQ8S 3QIPB 1SKWA 3RW6A 2DTJA 4Q44A 4U7UK 5HBMB 5J1PA 5JXSA 4RW4B 3BO2A 3M05A 3K5LA 3UFCX 4FF2A 1Q79A 2XMTA 2DB1A 3QGPA 5JVHQ 1JJHA 3S8SA 3QGHA 4U6PA 4N77A 1S48A 4N56A 2DR5A 3MM7B 4OX6A 5IS2A 3SCIE 4DLGA 3TUJC 1KVJA 2AJQA 3D1OA 3TARA 2J9DA 3DI6B 2I5JB 1Y7PA 2K3KA 1OQ6A 2RQMA 1VRTA 2EFOA 4FBUA 2B56A 3FFIB 1K0VA 1B0TA 3O44A 4CH1A 2PIIA 4KFBB 1KOOA 3M2RA 2DNGA 4KGMA 1NJZA 1N5YB 1TKTB 1Y5LB 2B3TB 1CC7A 2WBRA 3UDLA 3OQ2A 2MQQA 3GSDA 4DR2F 3JYTA 3DLLQ 3O6QA 2HLUA 3W2VB 3V6DB 3VZHA 3LP2A 2HNYA 1HPZA 4O3OA 4Q0BB 5J2PB 4DV6F 2OO4A 1T3NA 4N8NA 2HAIA 2ZZNA 4NXNF 3DHXA 2CPFA 2JJ4D 1E6YB 2ZOFA 5KG2A 1L3VA 1AXQA 1RT5A 2UV8A 4IH5A 4IH7A 3CJ0A 3M4XA 3MECB 3ZZRA 3KHHA 1UJ5A 2DNPA 3L09A 5L1KA 1YTYA 2HNDB 3GYXB 3MEGA 4WK3A 5DS7A 4ZOSA 2VC1A 5G4DA 5KFCA 4I7FB 2G13A 4V19J 1FXLA 1RT3A 3U02A 4OX7A 1IUJA 3L7PA 1NHVA 2M5YA 4ATNA 3MM9A 3WBZA 4EYHB 5BR8F 3V5RA 2MZ1A 5D8HB 4H4OA 4DV7F 4NLUA 3SCJE 4LQ3A 5K8NA 3MCSA 2DNLA 1QUPA 5KFMA 2D3ZA 2B6AA 4TNOA 2HQ3A 3SEOA 5DQGA 3BSNA 1XTZA 3GG0A 3O8WA 5C25A 3U1NA 3UDCA 2NS1B 2YX7A 2VPWB 3I6PA 2QMXA 4NCAA 2OIHA 1JLGA 2RQ4A 4PWUA 4IRDA 1XEZA 3NNHA 2LECA 4AUKA 4JI0F 4PG6A 4A8KA 2W9AA 3CJKB 4BC7A 1IN0A 1TKDA 5A0YA 3CSKA 2R2TA 5I42A 1FTRA 1K1SA 1WI6A 2LQ9A 1KQSR 1RTJA 2IVFB 2HHUA 4R8UB 4RUAA 3D1HA 1IKWB 1HHSA 1L3SA 2R2SA 4XK8C 3OR2B 1C4CA 5DLGA 2C2EA 4JI7F 4F8RA 4XDDA 4CO1A 1JWWA 1LW2B 4RNFA 3THTA 3PRBA 5KOXA 4MK9A 2XZWA 3TAMB 1IKYB 1HI8A 3AHPA 4ZP8A 4DUYF 5F8MA 3H5XA 1U4BA 2R2RA 4HLBA 1KONA 3PW4A 5KG0A 5GAHI 5D4OA 2M9KA 1JX4A 2M70A 2MGZB 3KLIA 1H2UX 2APOA 3M2UB 2R9LA 4K4WA 1RT4B 2N4CA 2W9BA 5KFGA 2ADCA 1SC6A 1A9NB 1Q8BA 1JK9B 2CPYA 2ROGA 1FNXH 3THVA 2ZHOA 1ULRA 5HLFA 3OFGA 1D8YA 3MM8A 4OZ5A 4DQQA 2M3DA 1N6QA 5C42A 4QR2A 2YKOA 3OLAA 2VG5B 3I87A 3TNVA 3HPOA 1V6HA 4URSA 1FRMA 2C3YA 4Q5VA 4KRWA 2W7PA 1H98A 5GAEI 4ELUA 2ILYA 3KK2A 1U6ZA 3U27A 2RNEA 5JJBA 5A8RA 1JLBA 3CPWR 4WFAQ 4Y28C 1HR0F 2J0XA 2KZMA 3OTEA 1FK9A 1ROFA 1YJRA 3FRYA 3ZZYA 4YQWA 4NRUA 3SFGA 2MB0B 2PE8A 2W9CB 1J5OA 2Z2MA 3Q2TC 2BOPA 2F9DA 2HPUA 2OPSB 2BYCA 1KLMB 4IFYB 1UVIA 1TFYA 5KFSA 2MQNA 3DRXA 4ZCLA 2BACA 3FJ2A 5D3GA 2HLTA 2K8GA 2JC0A 1RQ0A 5HROB 4DL0C 3TANA 1S9EA 1KFDA 3G8TA 2YNHA 4JYAF 1UEVA 1HYSB 5LSRA 2LA6A 3SSSA 3IN5A 2AV5A 2FVSA 2RH3A 4WXOA 2LQJA 4MJKA 4O3RA 1N54B 2UVWA 1IJFB 2CPJA 2DVIA 1YJWS 1N5TA 4UY85 1FVSA 3KLHA 3Q8QB 3GV8B 5CD4H 2GJ2A 4MYTA 1VC0A 5KT4A 4DJBA 1NKEA 2R7UA 3VAHA 2LCWA 1EETB 1R43A 3M9NB 2WW8A 1SIWB 1LWEB 1RTIB 1LWFB 1QJHA 3CCJS 1WI8A 4R25A 1X5SA 1LQ9A 4CTAB 4FF1A 1HWLA 1NNDA 3GWCA 3C3LA 3K58A 3JSMA 2ROEA 1BLUA 1HNZF 1S0NA 2QO3A 3AAWB 2YWEA 1DTQA 3MR2A 1W2BR 4QJVA 1JIHA 2RF2A 5M2UA 1U1MA 3NCQA 4ZHRB 2IM0A 2KH9A 3TI0A 2XCAA 4RBUA 2V4JA 3MM5A 3FSYA 4KKOB 4WYLA 2B0GA 5KG4A 4A4JA 3C6TA 4B3OB 4DQSA 4LSLA 4LF8F 1SJQA 1R0AA 4YOEA 1URRA 2DNRA 4OX9F 2VG7B 2J6TA 2R4FA 3IS9B 4G1QA 4JV5F 3W7BA 2O5DA 5CHCB 1TKXA 3V81A 1VQLS 2JSXA 3E01A 3PVXA 2V94A 4JUZA 3Q22A 1RAJA 4F50A 2DIVA 2LMIA 1S97A 1CQMA 3FCHA 4RUHA 4X4UA 4YHHF 4PXBA 2YNFB 1NEEA 1X4BA 1NK5A 2KM8C 2GQCA 3ZZZA 5K8OA 2ZD1A 2ZH7A 4UUXA 1TVRB 2WTFA 2I38A 4IR1A 4DV0F 2XLIA 2WONA 2PC6A 6FDRA 4UQTA 2YTCA 4ITSA 4A8WA 2JEIA 2UVUA 1JKHB 1RYSA 4DSJA 5CZXA 3NMRA 1RT2A 3ITHB 2QZ8A 3WC0A 5SZTA 2WOMB 2Q6BA 4CCHA 2D9OA 3RB3A 4K5SA 3SZ2A 2YWKA 5SUHA 1H7WA 4C11B 2BRKA 4NLTA 1QSLA 1X4AA 1YJUA 4TY8A 2VQEF 2J7WA 2R7VA 1REVB 1LKZA 3LUYA 5CYMB 4ECTA 1HBMA 4RNOA 3HZGA 4AL5A 4RZRA 1ZPWX 1N36F 1SV5A 3GIIA 2ADBA 1DARA 2FIUA 5HL7Q 3J7Z5 3BN4A 1OQ3A 3Q8RB 2R7WA 3PDNA 2L08A 4DL2A 1S4FA 3JTOA 2VD3A 3N79A 1VLYA 3EGWB 3LP0A 7FD1A 3GG1A 5IWAF 2HMIA 3FZ2A 3E2EA 3KG4A 4LF7F 1S79A 3SYZA 2XI3A 3UNGC 1CG2A 3LAKA 4LVNP 1A6LA 1VGYA 1ZM3A 2LYVA 4M1KA 4WFZA 2XWXA 3D5MA 5FDLB 3FQKA 4M5DA 3AQOA 3FEZA 3ZC4A 2P9GA 3K5NA 3FSXA 4YB7A 5DO2A 1Y5NB 2EC0A 2AX1A 2HGMA 1FRIA 2AD9A 2UVVA 4C98A 3LP1A 4WTYA 5IT9Y 1MWYA 4C8MA 3UI3A 1GXTA 2XMUA 2FTRA 2E1AA 1V3SA 3V4IB 3FRZA 1PC5A 2K3IA 3HZEA 1D3WA 1YSJA 3IWXA 1XR7A 3BSAA 1YWXA 3MR3A 4K4TA 2E1CA 3CIMA 5LSLA 2M4MA 3O5TB 3KG1A 1Z1ZA 2CPZA 1Y4ZB 2CVEA 1NRKA 1TUVA 2JL9A 1QTMA 1VQNS 1SBRA 4B08A 1VQ6S 5KFBA 2K7KA 5DDQC 2X51A 2MHNA 4PR6A 2L9DA 2CJAA 1K0TA 3PIPQ 4C0HA 3RYLA 1T8EA 2BM1A 5BJRA 2ZH9A 3AA9A 5F9NA 1KQGB 2MKKA 3GE9A 2FC8A 4LF9F 1QAJA 3MMBA 3DFEA 5J2MB 3OL7A 3GFYA 4WKYA 4RWWA 4YR3A 3PW0A 5IM0B 3MI7X 2AX0A 3OL6A 1HQEB 4XO0A 4RNMA 3OL8A 3PKYA 1VQ9S 4FXVA 2MHEA 4WE1A 2OPQB 3QJLA 2HG4A 2HS3A 3A1YG 4N8OA 2ZZMA 2ZJQQ 4YFUA 4HYKA 3T1YF 2CJBA 3OR1B 1CQNA 3Q8PB 3BQ2A 2CPEA 4I56A 3G71S 4MYUA 2X1AA 3OL9A 3OHBA 3NBPB 3R1HA 1RI7A 3DM2A 1WF1A 1R8BA 2DCLA 2QRRA 3HHLA 5L8RC 3UD3P 3SSQA 2LDIA 4NLVA 2N3OA 4IFVA 1N48A 3I96A 2BA9A 3NG8A 3US5A 5DDRC 2ZH1A 4AL6A 1JLQB 3G86A 4L72B 4QPXA 2IJNA 5KG3A 2YKNB 2JWNA 4DF8A 2DJWA 4RW6B 3IRXA 4NYZA 1JJ4A 2RRAA 1TL3A 2ASYA 4ICLB 4A8XA 2IAJB 1OSDA 4YMEA 1IQTA 3MEDB 1U1QA 4C0BA 4OZLA 3V6KA 4GKJF 2P5VA 2M8DB 4KO0A 4LJMA 3ZZPA 3DLEB 5IXUA 2EFPA 1U1NA 3JSYA 3E51A 3DDKA 3IR5B 1HNVB 2FJAB 2GV1A 1DQ9A 4PQUA 4FNHA 5K14B 2PA3A 5KFZA 1GX5A 1NJYA 2CPXA 2B4VA 4LFCF 5F3TA 3CJ5A 1VQOS 4O4RA 1WHVA 4GO7X 2FJDB 2M0GB 5E3QA 5KT7A 1RTDB 1LFWA 4A47A 2JVOA 2NPIA 4KJIA 1TV6B 2QFJA 2CQ4A 3KJVA 3RAXA 1WF2A 2DNMA 4JI1F 1L5UA 2JH3A 3VTIA 2X1FA 4FN5A 5A8WB 4Y00A 1BQXA 4G1IA 3D1QA 5EWFA 3JSRA 4I6YA 3UWTA 1UVNA 1Y5IB 3BM7A 4QU6A 2LVWA 5J2QB 1IXKA 1Q7LB 2CQ3A 2IRYA 2QA1A 3SSRA 2ASJA 5HP1A 2UXBF 2BR0A 3WX4A 3MPYA 2VQFF 2B5JB 3MMAA 3DMJB 4O44A 4URGA 3DLGB 2IRXA 2CJKA 1PO6A 3M32B 1HBNB 2V0NA 3DRRA 2JEJA 2MSTA 2WSEC 3A8EA 2EWHA 4ZS6A 2GA7A 4E98A 3BEGB 4NLYA 4IG0A 4MFBB 2BDPA 4NLDA 4I1TA 4O4GB 5GAHU 2VKZG 3I9V9 3IR7B 3CCWA 2XSJA 1LWCA 2M7SA 4AE5A 2P6TA 1P1LA 2N4DA 4TU9A 4B3SF 1RT7B 1Q8LA 2P9CA 2HWTA 4OJHA 4YB5A 3HHEA 4OLOA 1CEZA 2KM8B 4LSNA 2VPYB 2DK2A 2CQ2A 4ZPCA 1DRZA 4DSKA 1VQKS 4CO4A 4ECRA 2HHPA 2KVIA 1QE1A 2UUCF 2MZTA 2XNRA 1HWKA 4R5PA 2V8DA 1E6VB 4IDKA 1YJNS 4NCGB 1S49A 1U6BA 3OFHA 2IHR1 2ZJPQ 2OAUA 2XY6A 3M1VB 2D9PA 5GAEU 4FPRA 5LMUF 1C0TA 1IKXA 2JEFA 1HFEL 2ZKTA 1YJTA 1H0HB 4F4KA 2ZKUA 3CEDA 1SL0A 3HVTB 2OJ3A 2YKPA 3QAUA 1T95A 1FRHA 3ISND 1URNA 1DTTB 2JFKA 1K9MT 2BE2B 3M6UA 4OI1A 1FKPB 1S1WB 1KHWA 1K73T 1ZM9A 3QMQA 4ZVGA 1TK5A 3E8OA 1GTHA 2N82B 3JB9k 4KIAA 2XLKA 4ZPVR 1W2IA 4ECQA 4DV5F 2XHWA 2GMJA 4K4SA 3EZ5A 2QA4S 4F4YA 2VZ9A 4L3NA 3OBIA 4NLQA 1R7IA 2AGPA 2DPIA 1N88A 2HS0A 4HH0A 1FT8A 2PA8D 1WG4A 3ENQA 4IRKA 1SB6A 2V9KA 1U2FA 2CZVC 1RDRA 3BGUA 1C0UA 2D41A 4X2BA 1LK7A 4ELTA 3SCLE 1RT1B 5L9NA 1IM4A 3PR4A 2IFXA 2KXFA 2GGPA 3I56S 1RKJA 4EBDA 2YX1A 2DITA 3QGGA 4CO2A 2EBEA 3CTRA 3PR5B 5C5JA 2DH7A 3BSCA 4RBVA 5DGBA 2QA4G 1D9FA 2DRAA 2YKMA 4U7CA 1UFLA 3TVYA 1R8PA 2RIJA 1VBZA 5KFUA 3IBWA 2HHVA 4ED2A 4JV0A 4DPOA 4QIEA 3KMQA 5HMYA 3CCTA 3EXYA 1T05B 3V6JA 4HH1A 3SQGA 2MKSA 1P27B 2Z2LA 1HQUB 3P49B 5THWA 3T6JA 2KXNB 2NUHA 2KYZA 2E9ZA 4ECYA 4I4BA 4B02A 2B4UA 2FLNA 4BDPA 1S76D 3HKZD 4IOCQ 2D3UA 3J7YU 1MROA 1CLFA 2DNNA 4ZDNA 4U67Q 2W8KA 3CCMS 1UL3A