1ROFA

Nmr study of 4fe-4s ferredoxin of thermatoga maritima
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
60
structure length
60
Chain Sequence
b'MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
molecule tags Electron transport
source organism Thermotoga maritima
publication title An NMR-derived model for the solution structure of oxidized Thermotoga maritima 1[Fe4-S4] ferredoxin.
pubmed doi rcsb
total genus 3
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rofA00
3C8YA 3GYXB 1FDNA 1BLUA 1H0HB 2GMJA 3OR2B 4OMFG 1WTFA 3OR1A 2Z8QA 2C42A 2FJDB 2WSEC 1Y5IB 2PDAA 1G6BA 1JNRB 2C3MA 1G3OA 5E7OB 5BYQA 1FRMA 4Y28C 3MMAB 3MM7B 2FJEB 1H98A 2FD2A 4ID8A 1FRJA 2C3YA 1Y4ZB 1FCAA 1BWEA 5BYSA 1GAOA 3MM8A 2VPXB 1A6LA 1FDDA 1FEHA 3MM7A 1R27B 1HFEL 7FD1A 1IR0A 4XDCA 1JNZB 1Y5NB 4AYBD 2WAQD 2XSJA 1FRKA 2WSCC 5CH7B 1GT8A 3MM6B 2XSJB 4YDDB 1FRIA 1BC6A 1FDBA 1RGVA 3HKZD 5L8RC 1PC4A 2V2KA 1BQXA 2VKRA 7FDRA 1PC5A 2ZVSA 1FRHA 5FD1A 4DHVA 1FXDA 6FDRA 2IVFB 1XERA 5BYRA 3MM5A 1GTEA 1KEKA 3EGWB 1KQFB 2PA8D 1FRXA 2C3OA 1C4CA 1ROFA 1DAXA 3MMBA 1GTHA 2C3PA 2WSFC 4XK8C 2VPYB 4L6V3 1CLFA 2UZAA 3EXYA 3EUNA 4RKUC 1C4AA 3MM9A 1K0TA 1SIWB 3LW5C 1F5BA 2V4JB 1FTCA 1FF2A 2FGOA 3MMAA 3MM6A 3IR7B 5CHCB 1KQGB 1AXQA 1FXRA 1BD6A 2VPWB 1JB0C 1DURA 2FDNA 1H7WA 3MMCA 3IR5B 3MMCB 1FDAA 2FJAB 1F5CA 3OR1B 1Q16B 1B0VA 3OR2A 4OV1A 1FERA 2WB1D 2PMZD 1DFDA 2Y0SD 3MM5B 1FD2A 1F2GA 1SIZA 2V4JA 1IQZA 2O01C 1SJ1A 3MM8B 4KT0C 4CI0B 1B0TA 1FRLA 2VPZB 4XDDA 3IR6B 3MMBB 2C3UA 1D3WA 3PNIA 2FJBB 1H7XA 1VJWA 2GMHA 1B0PA 6FD1A 3MM9B 1Y5LB
chains in the Genus database with same CATH superfamily
2CJQA 5KG5A 4KSEB 1RWMB 1Q8IA 1V9OA 2DITA 2VQFJ 2OP5A 4OX7A 3CCRS 2EKYA 4N47A 2R9LA 4FS1A 2CPIA 2OGUA 3CEDA 2N4DA 2OI2A 2YQ0A 5KFIA 1JKHA 1M5OC 1R8AA 2IRYA 1EKSA 4DV6J 4U7UD 5EN1A 1E6YA 1H2VZ 1NZ8A 1ZM2A 2DNGA 3BGFA 3QLHA 4HACA 2LEBA 2AD9A 2Y9HA 3MMAB 1XNRJ 1U09A 2M4MA 2RDIA 2W2PP 4RW8A 4DL6A 5ETVA 3U02A 5F8JA 4F3QA 1F9EB 2BJ3A 3QJJA 3DOMB 2GVZB 4WXWA 4Q0BA 1B4SA 2HHWA 4NMLA 2EBEA 3MAHA 2F8HA 2GIRA 4PABA 1S1VB 2PSZA 5AXMA 4JI7J 4I2PB 3CTRA 5L9XA 3BO3A 4QPTA 4J9VA 2JC1A 4RW9B 1RWKB 2ZDPA 1SPBP 4DPUA 4U95A 1WC1A 4RW8B 4IFVA 3ISZA 4LSNB 1RAHB 1TELA 3CUNA 4W90B 3CJRA 2MHNA 4CO4A 2Z0GA 2BE9B 3QT7A 1H74A 2JLFA 4RNHA 1FRKA 1KS2A 2HHPA 3KLHA 3VAFA 3PG9A 3VAJA 3G71S 2WOMA 1R43A 2ROPA 1Y7PA 4KRWA 2AW0A 5MLCV 4JYAJ 2QSWA 1NUEA 1OYDA 3OXGA 4CRJA 4PG4A 1FX4A 5KFFA 3HKZD 3KFWX 2YNHB 2HK2A 4NLSA 2LQ8A 4FBTA 4A8SA 2JEJA 4P72A 7FDRA 5M2UA 3VALA 4DV5J 2D74B 4DR3J 4EZ6A 1V6HA 3DRSA 3DCAA 2HIQA 2R3VA 3R7BB 5KG0A 4BBYA 3SZ2A 1K1SA 2BRKA 4Z37A 2CPEA 2HRYA 4L3KA 3EE3A 1C0UB 1EP4B 1S6OA 2WZ1A 3FQKA 3TWZA 3RB6A 2NXEA 4EMDA 1NB2A 4A8FA 1U0SA 4ZVGA 1N48A 1EB0A 4IUFA 1HQEA 1W26A 4OJ3A 5IZHA 3JXOA 5KFNA 2MTLA 4F4AA 4JV1A 1T03B 5KFLA 4DV4F 1RT4B 5DG9A 1HA1A 1EZZB 4FYYB 4A8QA 2Z2LA 3TRGA 2GNKA 4AT1B 3UCUP 2D9PA 4NCBA 2D9OA 1TAQA 4OHVA 1IWGA 1VFJA 2QA4S 2F4VF 1JK9B 1SIWB 3BKUA 4DV4J 1N5TA 2V50A 1FTCA 1AZSA 3CVKA 3VZHA 1SKSA 1Z2ZA 2Y1LB 2LECA 4KFBA 1Z2LA 3LAKA 1JLAA 3CD6S 2KDOA 3L95X 5HROA 2UXBF 3KMQA 3H59A 3G8TA 1VRUB 5E0OA 1L5UA 1FVSA 3GU0A 9ATCB 2ALZA 3QJLA 4LBPA 3NCPA 1VIOA 2XS5A 2C2NA 2K7KA 3KJFB 3C14B 4C8ZA 4PG8A 2ZC4A 4OI3A 4GC7A 1S6UA 4DQQA 3LWLA 2FJAB 3JAMY 2MMYA 2E5HA 3PW7A 1F5CA 1WACA 3DYAA 4QWCA 4EYIB 2ZDOA 2CPZA 3PR4A 3BSOA 2CQIA 4NCAA 2BJ8A 1HR0J 5I4MA 2XMWA 2Y0SD 4P10A 5BR8J 5AJ3J 3EWGA 4DV7F 4CP5A 4GMKA 4W92B 2AX1A 4DU7A 3GIJA 3ISND 1TVRB 4NRUA 1R0BG 4FNIA 4JI3J 1WDTA 3F44A 3PV8A 1IKWA 3CIMA 2EFOA 3R5BA 4ZCIA 3WIUA 4X4UA 3W5YA 1RWPB 5EUHA 4DSLA 4OZ1A 2KT2A 1WORA 4C8NA 3PKMA 3GCWP 2OPSA 3QJPA 3ETMA 4MKVA 3BKFA 2W9BB 2OD6A 1XEZA 4TY8B 3DI6A 5GAGI 4QZVB 3BEGB 4O4RA 3A8IA 3GYXB 3QBCA 4B3SF 4OZNA 1YRXA 3DRPB 2IAJB 1TMJA 5B0EA 4FF4A 2LQ5A 3KLIA 3DLEB 2Z8QA 4N56A 2MKIA 4ECQA 2RD5C 4B3TF 2OSQA 1G6BA 4ER8A 3MTKA 3GYNA 2L3MA 3T1YJ 2A6MA 3DMJB 3KHGA 1U6BA 5L1JA 2CQGA 4ZLLA 1HNZJ 3KUEA 2CJ9A 5B0FA 3FCVA 2FVQA 3ZNUA 4DV3J 2OPQB 1SKWA 2DXEA 4G1PA 5B0GA 3J80U 1I6JA 5DETA 4N77A 2NSBA 4DPTA 1X4DA 4G65A 5F8GA 3SV4A 4NLDA 2B9XA 1KOHA 1SUQB 5K8MA 4J9QA 1FEHA 3IAS9 1R27B 1U2CA 2G13A 2CAJA 1IR0A 1FI4A 3AOBA 5HMZA 4OZ3A 2WAQD 4U67Q 1U1PA 1PYSB 3MR3A 4JI1F 5KG7A 1Q8LA 2DGVA 2YNIA 4ID5A 1GT8A 3BH7B 5CH7B 5D4LA 3SFGA 3UW1A 3R1HA 1Q8KA 1VJQA 4M5MA 2QV6A 5DZ7A 1U4BA 1APSA 1Z4UA 4NZ7A 2OTLS 2VBYA 3GJTB 1U24A 4ED1A 3AJ1A 4JUZA 1GMWA 1KVKA 2DGTA 1VQ8S 3R6LB 2B43A 2VQEF 4LR8A 2FHJD 1QY7A 1VQOS 1SBRA 1BQNB 5FIIA 2MQMA 3R5GA 5FD1A 2N4CA 2VG5B 3WC2A 2G4BA 2IVMA 4ZA1A 1HPZB 3S01A 3I9V9 4BC9A 3HDSA 3D6TB 5I3PA 3PW0A 2JVRA 3SQOP 4ZLJA 3RR7A 2O66A 4Y65A 1CULB 2AJ4A 1U49A 2DT9A 4GVBB 2ZH5A 2DNZA 3TZYA 4WTOB 4R5PB 1HPZA 1U6FA 4OYOA 4ZHRA 3G2XA 4BC7A 3CWJA 1GX6A 1RXOB 2OEKA 2XTJP 2Y1RI 2RUGA 3L7PA 4A8WA 2OSRA 1QUVA 4NEZA 3J81U 2YX1A 5DG7A 5GAEI 4QBUA 2YWKA 3ET6A 4TY9A 3D1HA 3UQSA 4DUYJ 5HVFA 3MEKA 4MIWA 4ZPAA 1Q95G 2LA6A 1IM6A 3ZNJ1 4P6QA 3NGRA 1WC0A 4MH8A 4PRFA 4RJVA 2F9JA 4C0OC 2HPUA 1HKAA 2DIVA 4QU6A 4OHXA 4HYKA 3HSZA 1X4CA 1XJWB 5KOXA 3Q22A 4LUBA 1IBMF 3NL0A 1EKRA 3NKYA 1UKUA 1UFWA 1T7PA 3D66A 1IKWB 5DQHA 1X4AA 2BZ2A 4R0JA 1B0VA 3D6MB 3OR2A 4K0KF 5IV4A 3SDEB 1KSPA 3DHWC 1HNXF 2PMZD 4IQXA 2PO4A 5AXKA 2OLWA 3TZXA 1HNWF 1FD2A 1HMVB 3FZBA 3QGPA 4UF4A 2ASLA 1DY3A 1GQEA 4ES1A 4IDKA 4Q7AA 3OL8A 1S49A 1SL1A 4C9DA 3ZZPA 2V4JA 3U1MA 5A6PA 2IRUA 3E01A 2V9KA 4YR0A 2MZQA 2MQQA 2KM8C 1ZTWA 3KLFB 4DFJA 2CDRB 2VPZB 3MEEA 4XDDA 2MQOA 3BV8A 1LW2B 3DRPA 4PG5A 3VF0B 1YVFA 4O23A 2IJNA 3KJVA 4JV2A 2MZSA 2JWNA 4RUHA 5HP1A 5A76A 3TJAA 2FJBB 3FFIB 2RHQB 3G6XA 5SUHA 6FD1A 2EK6A 2W9BA 4N41A 1TL5A 3TVZA 1KTQA 2VB6A 1GEHA 1Y5LB 3P3DA 3AFGA 4I1TA 4LFCF 2J9CA 1CJUB 3QAUA 2NXCA 2XZDB 4OMFG 3A3OB 1XBWA 4QWDA 2ADBA 1TFYA 4B02A 5D8HB 3EX7B 4URQU 1FFSB 3UCGA 1C1CA 4IR1A 2ZUAA 5AXNA 2GCFA 4FS2A 3IGVA 2KH9A 4ZN3A 3V4IA 5LOQA 1MG7A 1X4FA 2HNDB 2MZRA 1JLAB 1HBUB 2Q3PA 3Q8SB 2YWWA 4K4YA 1Q8BA 2P9EA 4DR7J 2DNKA 1S9GB 2JJ4D 2QL5B 2MY7A 4UQTA 1SKUB 2P2CB 4CNYA 2NPFA 2WHOA 4DX7A 3CJ2A 3D1OA 2C2KB 2GO8A 2GMLA 2GO9A 3O2IA 3ZTRA 2MZTA 1Y11A 3D67A 1NPPA 2IYIA 2LDIA 2LU2A 3KG0A 4G1IA 4FYXB 4NLWA 1C1BA 3I0SA 1VQ4S 5D4PA 1DHMA 3AODA 3IMQJ 1RZMA 5L9NA 2WSCC 4LFCJ 3LGMA 3A13A 5AE2A 3GONA 1J5EJ 2M88A 2CZVC 2CQ0A 4WFAQ 3DLGB 5A8KB 1TKXB 3SSRA 1ZH5A 2CQ1A 2RQCA 3CPWR 4RLEA 4UTGA 4A47A 3JSMB 2HKEA 2E7VA 5DDRC 1REVA 3FMBA 3H4BA 2HAFA 1FE0A 3PEHA 4ZJOA 5RUBA 4DV2F 2FY1A 1FJGF 1UP1A 3PRBA 5IWAJ 4ED6A 4JV5J 4QIFA 3U1LA 5HI7A 3EDQB 1YJNS 3UO0A 4R5PA 4WWSA 1CJTB 2ZHAA 4DL5A 1NZAA 4YB5A 1S9FA 2FJWA 2R7VA 3BB5A 4C8MA 3C66A 3TEGA 3GILA 2HHHF 1VRTB 1GTEA 2W2NP 3AD9C 3B54A 5C2GA 5HVHA 4DV2J 1R0AA 4PCQA 1A7GE 2OMOA 4HEA9 4K4WA 3P5TL 4LSNA 2E1PA 2H4WB 3MMBA 2W4PA 4JOUA 1HNIA 2E1MC 1RLDA 2JZ5A 3AH6A 4RW7B 3HX9A 1WHWA 4UOCA 2B9WA 2K3KA 2HFVA 3BYRA 4KYZA 1NSKL 4ZP9A 1S99A 3OFFA 4HLBA 5K8OA 4IRKA 2G0JA 4I7FB 1C4AA 3QSIA 2NXUA 3EXCX 3H0PA 3ICLA 5DGAA 1L3VA 1XK8A 3D3CJ 1OQ6A 4J9PA 2FZGB 2W8KA 3QGGA 4LF1A 1XNRF 3DU6A 3MMAA 3NBPA 4L73A 1IXKA 1TTHB 2NREA 4WZMA 2J7WA 3IR7B 1N5YB 1T3NA 2HWTA 2L48A 3S7RA 4PZVA 2XB2D 1FXRA 4TU7A 1DTQB 4LVNP 4RW4B 4EGLA 2CPYA 4BLGA 4A8OA 3HXMA 2F63A 3ETOA 3IM9A 1NNDA 1NPRA 4QR0A 3T41A 2KFNA 2MSSA 4WIQA 2EEYA 1FDAA 4A4JA 4CCHA 4E98A 2HNDA 1WC3A 3OJUA 3KLVA 2KM8B 1U1QA 4DR4J 4F7VA 2QLJB 3DRRB 5GVQA 4PWUA 2LQBA 1QSLA 3NOCA 4F04B 2VG7B 1NDLA 4JP8A 3TUJC 1RHUB 3BR9A 4RWWA 5D0GA 5G0RB 4AL7A 2ASDA 4F3OA 2E9TA 1K0VA 5F8HA 1VQ5S 4LF5J 2GX8A 4LT6A 3OPKA 3FC9A 3OBIA 2AP6A 5KFZA 4LF4J 2HBRB 1FKPB 3NG8A 2LEAA 1XMOJ 3M8SA 2ZOFA 4A48A 2MGZB 4AFFA 1RWNB 3NCRA 3IG1B 3D68A 3NGKA 2HMIA 1N88A 1S5ZA 2VUGA 5HMYA 3RB3A 1RWUA 2H51B 4V19X 1F3FA 3CDWA 4YY3J 2HWIA 3KWMA 4FDFA 3W64A 5E3RA 3EDRB 2V2VA 4DR4F 1HMVA 4DF4A 5E33A 1N5QA 5A6WA 1UW4A 5HQ8A 4Y28C 4IR9A 2B6AA 4ZLPA 5ETQA 3HHLA 1CEZA 3OQ2A 4ID8A 1DQ8A 4RNMA 2KN4A 4USWA 1BGXT 1HQ2A 1LW2A 1TU0B 2FUG9 2ZD1B 3OTDA 1O6XA 2CZ4A 1F60B 3QO9A 1RCXB 3Q2SC 4OZLA 3JQKA 2RKIA 2V4QA 3GYGA 3QO9B 3HZEA 4QOTA 5L1LA 2FC8A 4A8KA 2EVZA 3GSIA 2DNMA 1NM2A 3VR1A 1A9NB 3I32A 4O0IA 3OVSA 3E3XA 1AA1B 3JTPA 3DU5A 2DO0A 5I3UB 3IRXA 3CJ4A 1OJ4A 3JS9A 4ZJQA 2QO3A 4MFBA 2IFXA 3W60A 3TEHB 7AT1B 3GIKA 2XNRA 4ED0A 5L1KA 3MFIA 2Q1LA 2WCXA 1N36F 4B17A 5DGBA 1QDUB 5CD4A 2ZJRQ 4ECTA 1IBKJ 2K1RA 1KTVA 2JH3A 2AYEA 4TXSA 4CLWA 5KFOA 4QW9A 1HQUB 2DNLA 2MQ8A 5KG3A 3UDLA 3Q24A 3RJMB 1ZYQA 1RT1B 3BS9A 2HGLA 4ED4A 2F3JA 2W4CA 2N7CA 2KJVA 3W9HA 2XS2A 5T7LB 5C5JA 2DISA 2G2OA 4PPZA 3TP2A 5CA5A 3T1HJ 1GFWB 1D1UA 1JXEA 2BJEA 4OZ5A 3M2UA 3K2YA 1HQEB 2YPZA 1DJ0A 3CCTA 2Q66A 1KQFB 3FSXA 3D0GE 2C3OA 3M32A 5DM7Q 2QYCA 3UPFA 3G6ES 2AX0A 5HATA 1UEKA 2DNPA 3BGRA 3UN5A 3I31A 2CQHA 4DSJA 4C4WA 2KFZA 2PEHA 1NEEA 3OTOF 5AXLA 2PMHA 4L3NA 3AD7C 5J1EB 2VONA 1REGX 2BJ9A 2QMXA 2B9YA 2UZAA 2KHDA 2DRDA 1WOPA 2EKNA 3GR0A 2HZAA 4FPRA 2QIFA 4RBUA 4RKUC 4LF8J 4Y2CA 5IOLA 4LQ9A 3UVJA 4X65F 4C8LA 3TUPA 3ISNC 4P74A 4M5JA 2WK4A 1F9FA 2WTFA 3IRWP 4M5KA 3MM6A 3PTWA 2CJAA 5KAKA 1QAYA 1HD1A 3R97A 1HI1A 1JMTA 1S79A 1RWWB 2RILA 1DARA 2W4DA 4YMEA 5F8LA 2KFYA 4ELUA 2CWXA 3HSDA 1EJ7L 5C2CA 4CLSA 2DYAA 2DH8A 1DTQA 2RQKA 5D0EA 5KG2A 1RCOB 5ETOA 4L76A 3W7BA 2BE2B 1LFWA 3NGUA 4DV7J 1V5IB 1T8EA 3LALA 3P4UB 3TA0A 2QGFB 2GVZA 1BHNA 3M8ZA 1SB6A 4J7CA 3D0HE 1DQAA 1JLFB 1RK8A 3F41A 2MDAA 5DJBA 3OTOJ 4LF6J 2YKMA 3FEZA 2IRXA 4DU8A 3CC4S 4HHHA 2XGQA 3I0RA 1YBTA 1I1GA 4D3GA 3Q83A 1MWZA 1Y3JA 1YLXA 3Q8QB 4PQUB 2IC3B 5CXTA 1IQZA 2AU0A 3PIOQ 2CPHA 1P1LA 1H2TZ 4RUAA 2A10A 3A3PB 4DQRA 2XWXA 1OY8A 2C2EA 4F4ZA 2RDDA 3QAEA 5KFKA 1SL2A 4DL3A 3UCZP 3HHNB 4PQAA 2V68A 2W24A 2XYGB 3ZZUA 5IQQA 4ES3A 4MIAA 4B3MJ 5ETLA 2BVZA 4LFBJ 2JDJA 3CE8A 2YQ1A 2GMHA 1VDHA 4KB7A 1NMEB 1S6PA 2M2BA 2XI2A 3MM9B 4ICLB 3TJ8A 2C1EB 3DRXA 4HACB 4RBTA 2YWGA 1H0HB 4M5LA 2GQCA 3KLIB 2AJ1A 3CSKA 2YKOA 3MAAB 5HLFB 4F4YA 4RU2A 2C42A 3CNQP 5D15A 3W2WB 2BKOA 4JI6F 2UU9J 2Y1IA 2R7SA 4KHPJ 3CDEA 2VQEJ 3NS6A 2F4FA 4UY85 5DRKA 5ETTA 2QLBB 2W7PA 3AD8C 4Z7CA 1OYEA 1FE4A 4JI8J 1S1TB 1HHQA 2IJFA 4MFBB 2BRLA 4OYWA 4AD6A 4ECRA 4NYPA 4KTQA 3C3LA 3W63A 3P49B 5IT9Y 4DDFA 3M8WA 3QT8A 1ZZNA 3KNGA 4CNZA 2XMKA 2VPXB 3R5AA 4C98A 1RWOB 3HHKA 1P6TA 5KT6A 5HROB 1S1WB 3T3FA 3TI0A 1YTYA 4WYLA 2BV3A 1M5PC 4OYZA 3UD5A 1FWKA 1JNZB 2DR8A 4FYDA 2UV8G 4F2RA 1T9WA 1U1LA 3PVXA 4YB1P 2P9CA 2DR6A 5KT3A 3I9ZA 3D9BA 2E5JA 1U26A 1VRUA 2CFXA 2YKNB 4WP3A 2GVDA 4ZVHA 3SSQA 4CO3A 4E8UA 3AQPA 2CJXB 2GJFA 4ECYA 5CD4H 1BQXA 4JI0F 4KGXB 3C14A 3NCQA 3QNWB 2OIHA 1JIHA 2HVEA 4YR3A 2HNZB 3D5MA 4MIBA 5C25A 4DR5J 2CDQA 4UOGA 1RT2B 5CYQB 1R89A 3SFUA 3ZTPA 5KFTA 4J90A 3K5LA 3PCOB 2CQDA 1VQ9S 2FY8A 4AL5A 4DMZA 2ZH3A 3OT9A 4CO5A 3EGWB 4DSKA 3UNYA 4C2MA 1H73A 3UDVA 5HMXA 2QFJA 2ERRA 1MSWD 2EFVA 4LF9J 2NS1B 4M5NA 2R8GA 5GADI 4WE1A 1N5VA 2FHMA 2ALYB 1OPZA 2Q79A 5FLXU 4DX5A 5LMUJ 5CCLA 1F3VA 3KJVB 2L9WA 2AIRB 2RRBA 2QL7B 1DLOA 3PJXA 4OLPA 1TV6B 4Y2IA 2IM3A 5IS2A 5DZ6A 1SH3A 2VFTA 5JVGQ 1UEVA 2H5JB 4WPAA 4CLKA 3MZIA 4WP8A 3V6JA 1IBKF 4DPYA 4O3SA 4NRTA 5F41A 3H5XA 3MDFA 3A8JA 3G82A 2M8DB 4P7TA 3ONQA 3DOKA 4H4KC 4CLTA 4O3RA 1KLNA 3LUYA 1BQMB 1IUJA 3LF0A 3AQOA 3M8PB 1HBNB 2C2DA 2V8GA 1NK0A 4Q8EA 3ZC4A 4B3RF 2KZMA 2XHCA 1R31A 2DXDA 2AYMA 2MZJA 2LVWA 4IFYA 2MQPA 2FLNA 4P2SA 3T1HF 3MAAA 3MWBA 2JLGA 1NK7A 4WJBA 3CJ5A 3KLHB 3M4XA 3GR1A 4NCGB 2HNYA 4ZP8A 3RRKA 2WVFA 3PYDA 4GRSA 4Y3CA 1Q78A 2RUSA 4XAKA 1SC1B 3B8HA 2VOPA 2IY5B 3N6LA 1XWLA 2VV5A 2FIUA 4FKYA 3OTBA 2UVRA 2EBGA 4GVBA 5HBMA 1SQEA 2KVQE 1B7YB 1FNXH 1HWLA 3UE2A 2O1PA 2QG9B 3Q23A 4M63A 1TL4A 2YXLA 2CYYA 2EFPA 2GHVC 4RO0A 3TAMB 4P52A 2CJKA 5DG8A 4B9MA 2DHHA 2LKZA 2BKNA 2M0GB 5GMEA 4NLPA 4BS2A 4TQSA 3TJ9A 4YQWA 2LP4A 1R0CB 5HO4A 4M5HA 2HW3A 2PA3A 2J7KA 5KTQA 3B6BA 1LW0A 2N3OA 1N34J 4V19J 1F9HA 1HWUA 2B4PA 4H4MA 5KT7A 3CMES 4URSA 3FBFA 2ZOMA 2V34A 3EZUA 4LF2A 2E44A 5A0YB 4YB6A 1RA7A 4X4OA 3SCIE 3TR5A 2IBKA 5A0YA 2PDAA 3DLKB 3RBDA 3IM8A 1RP5A 4KPCA 4LBHA 5I42A 2EK1A 4LR9A 3CDBA 4A8XA 4EU0A 1VR6A 4MTPA 5JJBA 3P45B 1BQNA 2E29A 3CJ3A 1XMBA 4LSZB 3V6DB 1IBLF 5FDLB 2IYGA 1UJ6A 4X66F 3HVTB 1YK9A 4V1Ak 4RU9A 1Y4ZB 2YWHA 1HBOA 2N82B 4HTIA 2JRSA 2QN6B 1FJ7A 3BN4A 2IHR1 3KG1A 2B9EA 1UZDA 3MF5A 3CULA 3DLBA 5F9NA 4HT5A 1IKVB 1V3RA 4W98A 2ZJQQ 2B5JB 2W9AA 3QQCD 4DCPB 3S6EA 4KHMA 3FRYA 2CQBA 5L38A 5BXIA 1FDBA 3T5KA 3BSCA 4PUOB 3T5JA 2UV8A 2BR0A 3TNVA 2KRBA 5KFHA 1HW8A 3PW4A 1LWCB 1PILA 2MYFA 1EARA 3MPVA 3JTNA 1RISA 3DN9A 1CJUA 3DOKB 1SC4B 2OPSB 4E0DA 4CM0A 1WEXA 3DGPB 1NHUA 3TOQA 1WKLA 2VD3A 1TL7A 2BABA 5LXYA 5GAGU 4QU7A 4RWXA 4MKYA 3AXKA 3EICA 1VK8A 2QA2A 2UXDJ 4U6PA 1UL3A 3QFHA 2YVSA 4FNHA 4WFYA 4ES2A 5LMNF 4OYPA 3JB9k 3FEYB 2B7BB 5KFDA 4NA2A 4IRCA 3AOAA 1CLFA 2DR9A 3J7A1 1NJXA 1J5EF 4HH1A 5F0WA 1PJ5A 1K0TA 2R7WA 3LW5C 1KFDA 2W2QP 1ZAVA 3Q8UA 3VGSA 2DHAA 4OI1A 3ZTSA 4C3MA 2AGPA 4DSIA 3MURP 4DFKA 2CQ2A 2HLUA 4Y0FA 5J2PA 2IA0A 4I2QA 4NI2A 4LF4F 4UY8T 4M8LA 1KQGB 4YEAA 3V2UC 4O3PA 3VAHA 3C46A 1U25A 1O51A 1NHVA 3WIVA 3WBZA 4EWTA 1VC5A 1KQSR 3QWPA 4YR2A 1Y3KA 1KNZA 1N33J 2DVIA 2DNOA 3G8QA 2A2CA 4TVAB 4J9SA 4AQYF 2IMWP 5IV3A 4X4PA 5EX3A 3OVBA 3J81Y 3RB4A 4TKTA 4F3MA 3R7SB 3NGSA 2DKOB 4DZDA 4LQ3A 1AT1B 3Q86A 4WE1B 1N36J 2UUAJ 1C0TB 2X1GA 3MCSA 2WB1D 3VHQA 4X4SA 5LMNJ 1I3OB 2XMTA 2XBPA 3HVAA 4O44A 3TUZC 1U1NA 1M1KT 4UZBA 2FTRA 4OZJA 2QLFB 4CQ1A 5HVGA 4KFBB 1J2VA 2MKHA 1S1WA 2ZM6F 3JTOA 1N8RT 1KP6A 1PBAA 4LF7J 1N52B 3BBFA 5E41A 4K4ZA 1PAEX 5LXRA 1JLGB 3UR3C 1UWBA 3PNIA 1UVIA 2MJNA 3M2VA 2HZCA 2KZZA 3IG1A 2CPDA 3C16B 4NLQA 3HKWA 4ATNA 1S48A 2CNLB 3GLJA 4UUWA 2JEGA 2J0QD 4B3SJ 1T03A 2IPOB 3EPIA 2JFDA 3DNCA 3GJSB 5IC6B 2GMJA 4DL2A 3H42A 2MSTA 3CJ8A 4RNFA 3G4SS 2CJBA 4LIRA 4KV8A 2MJUA 4I67A 1BC6A 2R7UA 3LP1B 4CDIA 2V63A 4NLTA 2XY7A 2HHXA 5G0RA 2PMWA 1TL1A 2AZ1A 1T11A 1TMMA 3TZZA 2ZWPA 1RHMB 3MM7B 4ANDA 1H98A 2B4VA 3NOGA 2QLXA 3DRRA 5KFWA 1U1OA 2PI5A 1IQTA 3PRVA 4WCEQ 2DRAA 1VBZA 2E5IA 1VS3A 4ZIWA 5KT5A 3QRPA 1RTHA 1Z1ZA 1Y9OA 2DGQA 1ZA2B 1R8HA 4ILRA 3S8SA 3Q8PB 4DQSA 2ATLA 1NDPA 1SKRA 4X62F 2YPYA 2K7JA 1S4FA 3CCWA 2V6AA 4WYWA 1KQKA 4WFBQ 3CCJS 4CYUB 2JL9A 7FD1A 4AYBD 3V4MA 1XNQF 1FESA 3DLGA 2M52A 3NXZA 4O3NA 2IM2A 4ECSA 4LF7F 1JLEA 2R8JA 1WF0A 4WZQA 4QIWD 1RGVA 3IAM9 1R0AB 4ZVRB 4KV8B 3A8KA 4PXCA 1U7LA 2QEXS 5B0BA 2J8AA 4PXBA 5J1PA 4X84A 3VZIA 4DEZA 4K4TA 1NK8A 2D3UA 1M5HA 3CO0P 4DN9A 2BKPA 1KEKA 3UN2A 1WTBA 2B4UA 1FKOB 4IO1A 4Y6IA 4WFNQ 2MKJA 3C16A 1FWPA 1E6YB 3GPAA 3T1AA 4CIOA 4ECVA 2KT5A 4USMA 4JI7F 1UWAA 1DAXA 1IKXA 2OKQA 5K5MA 2GJ2A 4EK2A 3KHLA 1WELA 4FXVA 4Y00A 2XMAA 4G1QB 4DX8H 2EFNA 1V5VA 1C1BB 3I0SB 1BY9A 1UFLA 2Z58B 2AYBA 2DNRA 4ZVPB 2Z56B 2UU9F 2HIYA 3N5BA 4JV0A 5DDQC 1YJTA 3D54A 3JAMU 1HLWA 2BE7D 2YNFB 3SCJE 4M95A 2RNEA 2NLWA 3I96A 4WFXA 5JXSA 3MFHA 2CG8A 4RPFA 3MUMP 3MPYA 3AB4B 4I4BA 1MWQA 2COLA 2J0XA 3PJ9A 2V67A 4NA1A 2FZCB 2R2RA 1G1XA 2WONB 1CJKA 3CCVS 2HBZB 2HFZA 1MMLA 3GB0A 3KJNB 3M2RA 3BQ1A 4AL6A 3R9LA 1D0EA 2R8KA 3I5BA 3R2DJ 2R8HA 2ZBCA 3TYTA 3N9UC 3CDAA 1YIJS 3MR5A 2EFQA 3FDSA 2FJXA 1FJCA 3T5HA 4DF8A 1X4GA 1PG5B 3VWSA 4OX9J 2RU9A 2NXNA 4NLYA 5LJ3Y 5HQLA 3EGVA 4FF2A 5J2QB 1RT6A 2CWKA 2Q6CA 5LSRA 1AFJA 3O8WA 4ZCKA 3M6WA 2V5HG 2VG6B 4D3HA 2OPPB 4LSLB 2E1RA 4OYBA 3FRZA 1ULRA 3IBFB 4ELVA 3KLFA 3EJMA 3FUYA 1NLKL 2I2YA 2RMLA 1MN7A 2P6TA 1B7FA 3Q8YA 1KONA 5A8RA 3FBCA 4RUCA 1QJHA 2MEWA 2GV1A 2K1RB 2XMUA 3W2VA 5L1IA 1RTIA 1KBRA 3CJ0A 3FCWA 1W2BR 2OH2A 4WF9Q 1T9TA 1NKBA 4FKXA 1TKTA 2BOPA 4Y2KA 4NXMF 1N56A 3OR2B 4K8RA 3G8SA 2OFHX 4OHYA 1BUXA 5KFVA 2HHSA 1WOSA 2HG4A 3CB4A 3ILLA 2FPHX 1SVDA 3A4TA 3NAIA 3TA1A 3GV5B 1M1GA 3K57A 1U1KA 3VGUA 5AJ3F 1VGYA 4NZ6A 1TKDA 3WX8A 4YHHJ 1CC7A 1RAEB 1ZPWX 2GAGC 2WVEA 2DPJA 2DH7A 2UUWA 2J6SA 3R5JB 5DLGA 2ZD1A 5IT9U 4HI1A 2DO4A 5M2RA 3E8OA 1CJVA 3POTA 4ZVUB 1JX4A 4HL9A 3ZZYA 5SZTA 3FBBA 2FLLA 4C7QA 3E2EA 2L08A 3W2WA 2V8DA 2GGPB 3C19A 1FKPA 2P9GA 3LGHA 2CNNB 4WTYA 3TVKA 2EFGA 4C97A 5EGYA 5EDWA 2G1HA 3M2RB 1IWAA 1NO8A 2BMBA 2IC3A 2IDEA 3NY0A 4LRBA 4OV6A 1UPMB 4RBVA 5HL7Q 2R8IA 1RI7A 5ITHA 2Y8WA 2BXJA 3DRYA 3SQGB 1YHQS 1DTTB 2RU3A 2E5LJ 2NQPA 1DRZA 2L41A 2VBZA 2BOAA 3SIPB 2KRRA 4ENOA 4NXMJ 3MUTP 3CCSS 5E2QA 1KD1T 4R8UB 3FMWA 4WFZA 2CUYA 5C7PA 3KTQA 4OL8A 2B8QA 1L3TA 2OD4A 5KFUA 2MLXA 2DJWA 5L8RC 4KBIA 3EVWA 1JKHB 2DNYA 1KC8T 4WXOA 1T9VA 1WG4A 2P6SA 4J91A 1N33F 4M5DB 2N3LA 5KFGA 5CCMA 1T9YA 2UUBF 3LA0A 5A2QY 1AB8A 3KG4A 2DB1A 1W25A 1XERA 4IH5A 5HN0A 5IFMA 3KHRA 4DS4A 1V3SA 1YG0A 3A3NB 5H9EJ 1HI0P 3V6DA 3OFGA 3IBCB 5D0HA 1FKOA 2MLZA 3ZXWA 3QZ7A 2XI3A 3NAHA 1UZHA 4FF1A 1ITPA 3RG6A 1X9MA 1Y10A 5D77A 4KKOA 2CADA 2WSFC 3BREA 2D3OR 4YP3A 1YKWA 3V5RA 5K8PA 1WF1A 3B78A 3D6FB 1WKJA 4IG3A 5D4OA 4FYVB 1RWVB 2GQ2A 1NPKA 3SXLA 4F0MA 1CS4B 2D3ZA 3CXCR 1QAIA 1WKKA 2VJUA 5KFXA 1RT7B 1X8DA 2W7AA 4K50A 1XMQF 4EUVA 3RRHA 3UD3P 1U48A 5K20B 4OZ2A 4PWDA 2LFVA 2AEMA 4ID5B 1ELOA 2F4VJ 3W9IA 1NH7A 3ZTOA 3RW6A 1FHTA 1JB0C 1DURA 2KYZA 4ZK7M 3NNAA 1U02A 1HBNA 1SJ4P 1S0OA 1RYSA 4ED5A 1S72S 3ITHA 3LAMA 4ZS6A 3MUVP 1FX2A 3EGNA 2IA6A 2UVUA 1NDCA 1YRTA 1RHKB 1FK9A 2HNYB 3ILIA 3KK3B 3LP0B 4C8OA 4OV1A 4LF9F 4PXDA 2VL1A 2HURA 1UPPA 5DM6Q 4G6VB 1NCLA 4I69A 1LKZA 2BQ3A 1JLQA 1LXNA 3L4BC 2PFFB 1WC5A 3P6YC 1RAOA 3NGDA 4QR2A 2XG8A 1Q0NA 4IH6A 2OPPA 4LSLA 3T5LA 2HHHJ 4ILLA 5KFQA 4CH7A 1N6QB 4DBQA 2R7TA 1SCJB 4QIEA 1TVRA 2ZNYA 2CG4A 2KYXA 1H7XA 1SJRA 2X3DA 4WKRA 2HSEB 3VAMA 3KK2A 1WEYA 4F67A 5B0AA 3MM8A 8RUCA 1CG2A 3W2VB 3C8YA 5CYQA 5D78A 1FDNA 4IFYB 1NJWA 1MN9A 4RZRA 2XLKA 2AEJA 4C3KA 3P5BP 4CO0A 4K0KJ 1SJFA 4Q5VA 1FEEA 2OAUA 3G82B 1VQMS 2UUCF 2C3MA 1T05B 1H6KX 2W9CA 1XC9A 2J6TA 3HHDA 3V6KA 2JSXA 3RRGA 2WVBA 1YJWS 1ZTTA 2LCWA 3UFCX 3J7YU 4DSFA 5D6GA 3P96A 4NLGA 2YH1A 1KWMA 5LM7E 3MOJB 4KGKA 2UXBJ 1K1QA 2NYHA 1TUGB 5HJYA 1GH8A 1BWEA 4FBUA 2W9CB 4PYAA 1AFIA 3PYGA 1O8BA 2ZITA 4RR5A 2H1YA 4EBDA 3QIPA 4C6AA 4EFAC 3LOUA 5CYMA 8ATCB 2ZJPQ 1RAIB 2M9KA 4HR2A 1TK8A 4DR6J 2C2OB 3K58A 3UDCA 5K8NA 2XNQA 1NU4A 1HW9A 3WDOA 1W7WA 2ZHBA 2R7RA 2IDLA 3WX4A 4QW8A 4EI2A 3S1TA 2ZH1A 2HHVA 2YX4A 1QD1A 1T9XA 3UNGC 2VKRA 1P9YA 2D1CA 4IFVB 2XS7A 1SH0A 3K0JA 2LDYA 5GMDA 2ZBRA 4Y2AA 1G4CA 1EIYB 3KK2B 2VKZG 2BJ7A 3C15A 3MEEB 1XMOF 2CPJA 4K5SA 5DLFA 1R6VA 2VG7A 4KH1B 5BYRA 4Q0BB 1TL7B 1RTJA 1MMDA 3Q0AA 3V81B 4OJGA 1PBUA 4M1KA 4NYZA 5GAEU 2V2QA 3EM1A 2QZ8A 4DR1J 1TR0A 2PC6A 2R7OA 4YY3F 4Q45A 2VZ9A 3M8QA 3HSGA 4ZVQB 1L3KA 4IO9Q 4L6V3 1AYEA 4DJBA 5B7WA 1W2IA 1JLEB 4CLPA 1ICEB 1CQNA 1FD8A 2GHWA 3MM9A 4ICLA 4ZMMA 4ANEA 3BSNA 1S1VA 2RB7A 3IP0A 4QYRA 3LQVA 3OV7A 3GG1A 2D69A 3M30B 3MEGA 1GXTA 4I6YA 4EZ9A 1UVMA 4AQYJ 2ZH9A 1CPZA 1FJGJ 3IS9B 3N6MA 1RBAA 5CHCB 5GAHU 1CJTA 2IJRA 2YQ3A 3B82A 2MKKA 1U1MA 4JI8F 4DZ6A 4KH0B 1C2PA 1OMSA 1P1TA 2HGMA 2ZE2A 3THTA 1REVB 3MMJA 2ATCB 3FEXB 4GC6A 1LV5A 5KOWA 1TL3A 2BM0A 1IKYA 1SQFA 4I64A 3W61A 1TL1B 4TLQA 2HS4A 4JYAF 3CJKB 1VRQC 1R8BA 1DFDA 1RYRA 2QC3A 1VRTA 3GZ7A 3KK1B 1F2GA 5EHHA 4Q2LA 3QLHB 4AUKA 4BCAA 2UVWA 1PJ7A 1CBKA 4GKKJ 4X4VA 2V8HA 1NAQA 1YJUA 2AJ2A 2V2ZA 3HP6A 3H2VE 3SYZA 1HNXJ 3CCUS 1HNWJ 2MQNA 1B0TA 4CI0B 5LMUF 3W1YC 2VG5A 3IWNC 3J7Z5 2FJVA 4EBCA 5HP1B 1MW7A 2C3UA 4MK9A 2VU5A 3TW0A 2BDPA 1S57A 2HAIA 3KLGB 4DV1J 3RB0A 1XMQJ 1HIYA 2B4OA 3ENQA 1VJWA 3NEKA 3W3SA 4ED8A 3HSJA 5CYMB 2X1AA 2HVHA 2KU7A 3T6JA 4DQPA 2VC1A 3HFVA 5J1EA 4DR3F 1S59A 3C15B 1PYOB 2FYXA 3M9MB 3AAWB 1UWBB 2H54B 3K5PA 2FJDB 3DLEA 2F5GA 1KN6A 2BEFA 2BA9A 3OHAA 2GW8A 2FGCA 2J76E 5F9LA 3H20A 5D4NA 4YUDA 1TK0A 2P5VA 2BUNA 1G3OA 2DGSA 3DDIA 5ETMA 4O3QA 3PYFA 1RU2A 2Z2MA 2AJQA 3SV3A 5T14A 1XQIA 2ZH4A 3BPDA 4NCGA 4B9TA 2FJEB 1S0NA 2FVRA 2QX0A 2I1RA 1UCNA 1YJ7A 1S6QB 2DGUA 3DDNA 1X4HA 3T19A 4MYTA 4UT4A 2XMVA 2J6UA 1I5OB 1RA6A 2NZCA 4J9LA 1GXLA 2OELA 4ZJLA 5BYSA 3CCQS 3J7AN 1BQMA 1GAOA 3E01B 1GMUA 2KG0A 2CQ3A 2X3GA 5ETRA 2R7QA 4CLFA 1IR2A 4F0HA 2XO6A 2XGPA 4ED7A 2DCLA 2HZVA 3PO5A 4CLUA 3HK2A 2JVOA 3BGRB 2ASJA 1U8WA 3EZOA 4ZPVR 1UJ5A 2AGOA 4GKKF 1EHWA 4TYBA 5ETNA 3SDEA 2LYVA 2DD8S 2XLIA 2HFUA 2DHXA 1RHQB 2DY9A 1N32F 4OI0A 4KR0B 3BR8A 2F8EX 3DI6B 4K2XA 4M94A 3BM7A 4XTTA 3I56S 2QRRA 2ZBIA 3HJFA 3OUYB 3DGVA 5KFAA 1JLQB 2HHTA 3O5TB 1N32J 4OHZA 3W8PA 1VLYA 1SXLA 1TP7A 3ILJA 4EYHB 3AY0A 5J2NB 1LWCA 1OS5A 3T1YF 4YOEA 3MAQA 4IDKB 3VCDA 1LK7A 2HQIA 4DFPA 4LFBF 1D09B 4KY3A 1JQGA 3PFEA 3BJYA 2JHEA 3AJ2A 4I68A 3W66A 2Y1JA 1YWXA 4B9LA 4ZVFA 4WK3A 5F8MA 5B0CA 2PD1A 4H4OB 3D4JA 2EWHA 2UXCJ 4JI3F 1GTHA 3EYZA 3MD3A 2E9RX 2BYCA 2HEKA 3RBZA 4B9NA 5MAOA 3GG0A 3CW2C 3K89A 4TN2A 1PIEA 3EXYA 3THVA 1UW9A 3K8WA 2M5YA 3LANA 3HPOA 3PJWA 1FJEB 1UVJA 1LQ9A 1CULA 2YY3A 3LP2B 1QTNB 1UMJA 2HVDA 2PIIA 1N5YA 4DUTA 3R5CA 4MK8A 2J9EA 4M5IA 1JWWA 1WC6A 4YB7A 2NUHA 3CD7A 2WONA 4P75A 3D6HB 3G6VA 2K3IA 2B5JA 4RUBA 2FVSA 1EQMA 2WBMA 3R27A 1B3TA 3MMCB 1GNKA 2R2TA 3OSPA 1U0HA 4QIGA 2UUCJ 3AXMA 2VQFF 2C2ZB 1L3UA 5H1SV 3JYTA 1H2UX 1Q16B 3D28A 1KVIA 4QQBA 2YNIB 3PACA 4DPWA 1S6QA 2H9ZA 4ECZA 5I42B 2A6OA 2V8VA 3DLLQ 3L3CA 1K44A 4U96A 1S7HA 1SUQA 4DR1F 2H3EB 1S76D 3T9ZA 4LF8F 1TAUA 3ZZTA 1S1UB 4QR1A 4P9SA 4X65J 3ENAA 2NUUG 4ED3A 3QSYB 4M5DA 2YNFA 2VFRA 5FLXY 3HLUA 2EG1A 3CMAS 5IWAF 4B9VA 3H98A 2NYIA 2E9ZA 4JV5F 3MMBB 2BX6A 3TO8A 2F9DA 1GMVA 3QIDA 1U2FA 4JI4F 4F0KA 3DKDA 1WC4A 2VOOA 1RTJB 1LFPA 1URRA 4FP9A 4MKBA 2XYHB 1B70B 3DM2A 5K14A 4B3TJ 1HYSA 1SV5B 2ZVIA 3CT9A 4JI2F 1VMBA 3M6UA 5F3TA 4EEYA 2F8MA 3BYPA 2K8GA 2H65B 4WBFA 1Y5IB 4ZVSB 1G2EA 4ETXA 2W2MP 4PQUA 2FVPA 2QSFA 5IC4B 2VICA 5E7OB 1VYAA 4J37A 3PZPA 1F5AA 2HHQA 4ZLNA 2NCKL 2UUAF 2DGOA 4CLYA 2DBBA 1RADB 4KJIA 2HBYB 4X2BA 2HRTA 1B64A 4GKJF 2BANB 2I8EA 2E5LF 1M0SA 2EC0A 1IBMJ 2ADCA 2Y8YA 4FYWB 4EBEA 1JJ4A 1M5KC 1BMQB 2IM1A 4TU8A 4ZIVA 4OYIA 2LA4A 3B4MA 3KUHA 3HFZB 2U2FA 3HZGA 4Q44A 3MM7A 4PEOA 3RAMA 1HFEL 1Q5YA 2QMUB 4RNOA 2HLTA 1XTZA 3KMSA 4RW6B 1S9GA 2CA9A 2LU1A 2QFIA 3TQEA 1NK4A 3MR2A 1QSYA 3A8EA 3MM6B 4N7TA 4OIXA 2BBEA 3M9OB 4OX6A 3W9JA 1NK5A 3R3TA 4UOHA 2F1FA 2HS0A 1RAFB 3GFXA 4YFUA 4GO7X 3OL7A 3UVJB 1LOUA 1SJ3P 1C1CB 4PWWA 3JYTB 2MQLA 3M2VB 2E1AA 1O0PA 2K06A 1QE1B 3WQPA 2YKQA 2ZVSA 2AWZA 1RHJB 2QL9B 1MU2A 1NJIT 4DHVA 3C2PA 1DBDA 2DR5A 1Q86T 1QM9A 3I4HX 2HQCA 2IVFB 5J2QA 2F65A 2V0NA 3KKFA 1VC6A 5A8KA 2B7CB 3CCLS 1ZPVA 2MZ1A 3V6HA 1YSJA 1R8PA 2DGXA 1FRXA 4MYUA 3W8GA 1XIQA 5JUMA 1RT5B 2J8SA 4DL4A 4Q8FA 3JQMA 1ROFA 3N0VA 4MAKA 3M1VA 2EPIA 3CF5Q 1EX8A 1UAWA 3FK4A 4KGVB 1C0TA 2KO1A 5L46A 5FJ4A 4DPOA 2XM3A 2DH9A 3EUNA 4CO1A 1LWEB 1VBXA 1FFGB 3GWCA 3MPWA 2RIJA 1EAYC 5AT1B 1SH2A 3U7JA 3NRBA 5HMWA 2YWEA 4KO0A 3VQSA 3H90A 4RW6A 2VF3A 5IM0B 1YZ7A 2VBWA 2VFUA 3MXHP 1HBUA 5GAHI 3DLHA 2B8PA 4N8NA 1EQ0A 3P8BB 4ZVOB 1S1TA 2ASYA 3ENWA 5KG4A 4I2QB 4NI2B 3L7OA 3KHHA 5I3UA 5H9FJ 3VAGA 4ZPWR 2FDNA 2X7IA 3D3BJ 4F4WA 1SI9A 1U45A 1YGYA 1GXUA 4FVMA 2ILZA 2AQ4A 3MI7X 2NSCA 1HBMA 4U8YA 4BDPA 1RT4A 4LVOP 1PKUA 4QCLA 1YDLA 2ZBPA 1T95A 2ZNZA 2DEIA 5ETSA 4K4VA 3EPGA 4QJVA 2ZUGA 1IJFB 5KFSA 2R42A 3FCHA 4QIVA 3KDNA 2IMOA 3BPSP 2WVDA 3BSAA 3UI3A 2AMCB 1X5PA 2RE1A 2XEXA 2KXFA 4J5OA 3KNAA 1S1XA 4O4GA 3CJSA 4CLZA 2ROEA 4IG0A 5A8WB 2W2OP 3PX4A 3IA0A 1TUWA 4I2PA 4LRDA 4DLGA 2ROGA 3QT6A 2W25A 2C28A 3DRSB 3GP9A 1SV5A 3DDKA 4N8OA 1D9DA 4OI2A 3EGZA 3HFKA 4RL1A 3W65A 5LJ5Y 2HFOA 2XZWA 2QA4G 2O3DA 4Z2XA 4A46A 2EC2A 1J27A 2JEIA 2HQGA 2WOMB 1RLCL 2HRUA 9RUBA 3DXSX 2MGZA 4JI5F 3H40A 1OO0B 4U9RA 1HNVB 4PWDB 3RBEA 4WU2A 1QSSA 4JI1J 3DM2B 4ZPTR 5K14B 2H5EA 4F25A 3BGOP 1QTMA 2M8HA 2RQMA 2B3TB 3AJDA 4NLXA 3SMZA 3BKTA 4HH0A 5KG1A 1GK8A 5IT4A 1S10A 4B3MF 4OJHA 4JI5J 3X3UA 3CC2S 3J80Y 2RJZA 1Q5VA 3DHXA 3WZ0A 4CO2A 1RDRA 5C24B 4KC5A 1T3OA 2KKHA 3FGVA 4KKOB 4LRFA 3OJSA 2HYIB 4LJMA 5HJXA 1KOOA 3GTYX 3HM9A 1CVJA 4Z7YA 2A2DA 4LF6F 1KR4A 4C8KA 1ZS6A 2KXHA 4FXWA 3RAQA 4LRCA 2F40A 3M9NB 2RS8A 1M1HA 4DS5A 4IRDA 1CQMA 1FCAA 3BH6B 1JLFA 3NMRA 1UVLA 4IG3B 1TKZB 5E3AA 1T9UA 1K73T 1D9AA 3ITHB 3LGNA 1A6LA 3LO3A 2DNQA 1KHWA 1U0HB 3G9CA 4F26A 1SL0A 1JJ2R 2DPIA 2G2YA 1IM4A 4NMXA 3F56A 4H4MB 3EZ5A 3CMQA 2W8LA 3H25A 2I6WA 4DV0F 2N7YA 4DX6A 2HS3A 4HT7A 1R6YA 3US5A 4FF3A 4LREA 4YDDB 1H3DA 2OMLA 3OL6A 3NWGA 5B08A 1RKJA 1RB0A 4OI4A 1HWJA 1RUSA 2JEFA 1NSQA 4QPXA 2XQCA 3NS7B 4CM2A 1FVQA 4DV0J 4C8YA 1HNVA 1ZAWA 2IAJA 2KI2A 5HANA 1Q7YT 1HNIB 2E66A 4RW7A 2F7VA 4OI6A 6FDRA 1TKTB 1VISA 3ADAC 3R1LA 5DQIA 1NK6A 1SJQA 2BW2A 3TVYA 1RTZA 1RSCA 3OSNA 2CXEA 3IGNA 4QYZK 2C2RA 2DNNA 3J7ZT 3K7RA 1ACMB 5A8RB 1NKCA 2RSQA 3HHLC 3I6PA 1BWVA 3LPYA 2Y0BB 3T6BA 1Q53A 5KFMA 3M8YA 3OVAA 1YX2A 2QLWA 2RF2B 1D8YA 4B3OA 2XSFA 2YWFA 2OJ3A 4X4NA 4C0HA 1U47A 2LLZA 3QRRA 2I5JA 1JLCB 2DNHA 2QYGA 3AA9A 3ZZZA 1NJZA 3X1LB 4G3IA 2IM0A 3MGJA 4USHA 2SXLA 1TZ0A 3TAMA 2HVZA 2GC8A 3G96A 3JSMA 1IJEB 1FXLA 2DXFA 2U1AA 3PDNA 2RKIB 3JSBA 1WEZA 4ZPCA 1MNEA 2FGOA 1RTIB 4KPYA 3Q89A 3UN3A 3M6XA 1QUPA 2HQDA 3C6TB 3OD2A 4W4MA 5J2NA 3DXBA 3SEOA 1Q7LB 1M5VC 1DTTA 3R7NB 1BD6A 1YJ9S 2Q43A 3BF4A 3IXQA 3A12A 4OQJA 3MEDA 4J9RA 1H7WA 2RRNA 3OLBA 1RAAB 2HQFA 1CJKB 3EMTA 4JBCA 4L75A 4DUZF 1R7IA 2ZFHA 1DZ5A 2V94A 4P7VA 2B6AB 1XNQJ 5GADU 3FKBA 4Q43A 3E51A 1RACB 1K9MT 1ZAXA 2EW9A 2ZZTA 3QPIA 1CJVB 3POTB 4C3LA 3GQCA 1E6VB 2YNGA 1K8AT 3UD4P 1QLNA 1LWEA 4USVA 3BGLA 1WUUA 4R0EA 4ECWA 4ILMA 3OFEA 1D9FA 1HARA 3F73A 4KQZA 1S9EB 2A1BA 2M3DA 1ZM3A 3HHLB 1X60A 2O01C 2GJIA 4MMOA 2GHPA 4MK7A 4UOFA 4CTAA 3BO2A 4UW2A 2HMIB 3MCMA 1KKHA 2BM1A 2ILYA 3C6UA 3HT0A 5C25B 4IOAQ 2J0SD 1KFSA 5BJRA 3BO4A 2KHCA 5IXUA 1D3WA 2I5JB 3IO1A 1O5JA 2UUBJ 4ZPDA 2VFSA 3OXLA 2UVVA 3CGIA 1AZSB 1KLMA 1HL6A 2FQQB 2YKNA 3W5XA 2MHEA 3M1VB 3I87A 1SC3B 1C0UA 1EP4A 2VBXA 3PX6A 4ETZA 1WTFA 2MY8A 4BHQA 3OR1A 5KFBA 3RUBL 1S4EA 4U7CA 3GV8B 4YN3B 4PKDB 4NASA 4K4SA 1RJJA 1LNQA 3HVWA 3L9ZA 4PG6A 1RT2A 2CQPA 2B56A 2AF6A 1HI8A 2QTWA 3FBEA 4USKA 2H4YB 4NZ0A 3VVUA 2CJYB 2ZKTA 6AT1B 1FRMA 1J5OB 3DLJA 5FDLA 3R8YA 1QE1A 4ZKAA 4R25A 1LXJA 3DOLA 1I51B 2E7XA 1LEOA 1UVKA 2FD2A 2MLYA 2BJDA 2XMMA 2GIFA 3N5FA 3NGTA 3NS5A 4BWMA 2VJVA 1F6TA 2MB0B 3QGHA 1XR6A 3OW2R 2Q6BA 3DLKA 1X9WA 3I5CA 2A18A 3BZQA 2QE5A 3D1QA 4NWBA 1PAUB 3CJKA 2DHSA 4ZDNA 5B0DA 1FTRA 2JC0A 2V69A 1OQ3A 4NA3A 2D7SA 1RHRB 3FSYA 2XCAA 4N76A 3IS9A 1TL3B 3H2LA 1WI6A 3RYLA 2Z4PA 4RNNA 3J81j 2DEJA 4LIWA 1LWFB 5ETPA 1PCAA 2AKWB 4QWBA 4OYAA 3THPA 3HI9A 3OLAA 1OWXA 1UETA 1G7CB 1NSAA 2PE8A 1U2RA 1VQLS 4I7FA 1T02A 2OHDA 1RT7A 2VH7A 1F1BB 2J7UA 3Q2TC 4RW9A 2X1FA 3RW7A 1X5OA 4H4KA 2ZE2B 4NLRA 3JSRA 4UQGA 4NL5A 2H48B 3K5OA 3G6YA 5IT0A 4AXIA 2V9WA 2LXUA 1VQKS 3MPDA 3OTEA 4DXLA 5JMNA 3W5ZA 3RTVA 2V4RA 4JI4J 4DFMA 3GMGA 3PY8A 2RVJA 4B9UA 3MM5A 4HKQA 5HLFA 1M5SA 3SCKE 2OEJA 2L9DA 2PN6A 3PRDA 2W7OA 2RRAA 2LMIA 4LFAF 3GJQB 3LTOA 4NXNJ 3PR5B 2PFDA 3TANA 3NLCA 4CYUA 2AT1B 1UFKA 4GVLA 1VBYA 1QAXA 3UR0A 1S1UA 1J5OA 4ZPBA 1F2HA 2HBQB 2UP1A 2LEPA 2OUGA 2KG1A 3M8QB 2WW8A 1VIXA 3I0RB 1VBKA 1RTHB 1U6ZA 2A3JA 3GJRB 2R4FA 4J9KA 4K2JA 3ILOA 5GMKa 3CD0A 2G2ZA 3UWTA 1F5BA 4DR2J 4DCJB 2VFVA 3PKYA 1D8ZA 2XMJA 1URNA 1YBAA 4F02A 1H72C 2NPIA 3QIPB 4M5GA 5KFEA 3TAQA 5CABA 1RKIA 1IBLJ 4OYXA 4K4XA 1LWFA 5DS7A 2D41A 1HWIA 1JLGA 5LL6d 4HDHA 4FZVA 3TX0A 4X66J 2MXYA 4XIUA 3IN5A 3KYLA 2FHJA 2DCUB 1VQ6S 3MPUB 5B09A 2CIMA 2E5GA 3IR5B 2IBOA 2R7XA 5HK4A 3GIRA 3HJVA 4NLUA 4NOHA 4JI6J 1VQNS 1X31C 2OPQA 4I0WA 3OR1B 5U47A 3V4IB 4DLEA 3DFEA 1BE4A 5KFRA 2ZZNA 3IBWA 4FN5A 3FNNA 3TZWA 1OIAA 1WWHA 3SSSA 1E6VA 2YNGB 4IYQA 4CH0S 3NNCA 4JI0J 4KO0B 2UXDF 4AE5A 5KFCA 4LBIA 1K47A 1YJVA 1WNEA 3LPEA 3MM8B 4HDGA 3VGVA 5EWEA 1ZBTA 4H4OA 4P73A 2BQRA 1RBOB 4NYOA 2W01A 4NPOA 5T7LA 3IFEA 1MLAA 2QT7A 3MCOA 1WD6A 2GVDB 4HVZA 3VVTA 4O44B 2M7SA 3M2UB 3PXGa 1NJYA 1YRUA 4TY8A 2MKYA 5C42B 3GFYA 3H5UA 4HHJA 1TK5A 2PI4A 2NZ4A 4YS2A 1T05A 2OTJS 3HULA 2RAQA 5I3QA 2Z57B 1B99A 1KVJA 3BN7A 3QATA 4L74A 4F50A 1AUDA 3VTIA 2YKAA 2ABYA 1WSRA 4H54A 4MJKA 4USTA 1NRKA 3NNHA 3KDOA 3CJTA 2YKPA 4ECUA 2K2PA 1V3ZA 2JNJA 4J9MA 1RBLA 1RT6B 1MROA 2KT3A 4NLOA 4DV5F 4K5RA 2YTCA 2DR7A 5BYQA 4DUYF 1S0VA 1FK9B 1XR5A 2RF2A 4B3OB 3N79A 3N01A 1Y0HA 4Q2MA 2V8PA 3C6TA 3FJ2A 1IKVA 3BGUA 1FRJA 3PHTA 3WHIA 4X4RA 1U1RA 3AT1B 4DG1A 4F8RA 2VDIA 1PSDA 2RQ4A 3M05A 1NB7A 4LRAA 2P8IA 4FVCA 3ZZOA 3U27A 3G86A 1X0PA 2KTQA 2OFGX 4NEYA 2VG6A 2XY5A 4KE5A 4DWIA 1X5SA 2B51A 2GAHC 1Y5NB 4ZHRB 3ET6B 1JLCA 2BANA 3PM9A 3H2UB 4IH7A 2DK2A 3H8YA 3ZTQA 4J9OA 2HK3A 5LSLA 4X62J 4CT9A 1VQSA 1VCTA 3IWLA 1TUVA 3PHEA 2H5IB 3FZ2A 2CPFA 2EI5A 4UZCA 4X4QA 2ZH8A 2X1BA 1VK3A 4WKYA 3QRQA 4KHRA 5ADZA 1X4EA 2WBRA 1FXDA 3B4DA 3R2CJ 2GQQA 4GKJJ 1UEUA 3KLGA 2YKMB 3VAIA 1N4LA 1I94J 2ZWOA 4WP9A 2IIHA 4DV1F 2BACA 4ALZA 1EETA 3BDPA 5THWA 4USUA 2G9OA 4QYZJ 2PEBA 2C3PA 1NSPA 4N5SA 4XK8C 4EO8A 4MT1A 3PYEA 1VLOA 1SC6A 3WC0A 5CZXA 1I94F 4PYDA 4R8UA 1AROP 5KT2A 3RU0A 3CCZA 4ZP7A 5CYJA 2AYGA 2YNHA 3FVYA 3GCXP 4PG7A 2PT0A 5EX0A 2X51A 5IQ6A 3K5MA 4DQIA 1IKXB 2AJ0A 4PUOA 2FHKA 1Q79A 3SQGA 2BQUA 2VODA 1IKYB 2CNKB 3IC1A 4B3RJ 1QVFR 2D3O1 2DRBA 3PW5A 1AXQA 4TQRA 1RAJA 4IOCQ 1Q4RA 3O3LA 5E3QA 2GGPA 2MKSA 3DMJA 5CAAA 3QT5A 3MMCA 4CZCA 2MKCA 3RBXA 1LW0B 1YJRA 2APOA 2BJ1A 3NBPB 5CZVA 3N6NA 5KG6A 3TQ1A 1EETB 3Q8VA 3L09A 1X7VA 2NXJA 3O6QA 3KJQB 5E5NA 5KFPA 1XR7A 3I4PA 3BQ0A 3IWXA 1P27B 1P9QC 1PYTA 2LQJA 5A2QU 2VC0A 1VC0A 3QMQA 1DLOB 2MPUA 2EG2A 3CD5A 1PJ6A 3CIZA 3K8VA 2YH0A 2M70A 3CJQA 3MEGB 3LWMA 1XN9A 2B0GA 4KT0C 4DV3F 4DG1B 3RR8A 3HCXA 1X9SA 3MR6A 3IR6B 4K4UA 1IN0A 3AB2B 2ZOGA 5KFYA 3ZZRA 5LSOA 2WW4A 1S1XB 1S7IA 4O4GB 1KDNA 2DY1A 3R5DA 4MKAA 3T9NA 4ANCA 3OL9A 2GIQA 1TKXA 1ZA1B 2VASA 4CT8A 1VQ7S 1WHYA 2ZC3A 1WI8A 3GIIA 2G1DA 3GV7B 3VAKA 2HNZA 2UXCF 1X4BA 2RS2A 1ZM4A 5HQMA 2WSEC 3D0IE 2JOQA 4FPIA 2JLEA 4QWAA 2VA2A 1ZETA 5D3GA 4P2FA 2E7WA 2RHSB 3OUYA 4ECXA 2LQ9A 1HQUA 2RH3A 3KOAA 4Y2MA 4DL7A 3DC2A 4WK1A 2VDHA 1VI7A 4NXNF 1WF2A 3GE9A 4TLRA 5L39A 2HVIA 2XULA 3Q8RB 3K59A 2YBVA 3OFHA 4ZITA 3TA2A 2C2MB 2KL8A 3KK3A 4ZP6A 2I38A 4LF5F 4ZVTB 3M8PA 3HF5A 2ZEJA 4B08A 2CZ9A 2E1CA 3GFZA 2LXFA 2AGQA 3W62A 2QMWA 1ZOTA 2XSJA 4O0NA 1N54B 4L72B 1WHVA 2XSJB 2Z30B 3VGTA 4OX9F 4ZCMA 1UVNA 3I5AA 1FRIA 3EVMA 1N5SA 4P2XA 3J7YI 2UUTA 2FB0A 3QGIA 5CQGA 2ACMA 2HGNA 3U1NA 1TV6A 5D3GB 1CSJA 3NWRA 1Q1KA 1WSVA 3JSYA 1NKEA 2DIUA 4ERDA 1Q81T 3D7SB 2FZKB 1S0MA 4DI6A 1MU2B 4P2MA 4Y34A 4A8MP 4KGMA 4ZN1A 1NK9A 2FLPA 4KAIA 2J0WA 4YDXA 3HHLD 3EVOA 2PA8D 3DGPA 3M7VA 3N28A 2CKWA 4IQMA 2JFKA 3MCNA 2AZ3A 2XO7A 1PO6A 4DSEA 3MHYA 4S0MA 2VPYB 4U7UK 1SQGA 1NHKL 4G1QA 5DDOC 3CCES 1WOOA 1FO1A 1RAGB 1U8SA 5AE1A 5F0UA 4X64J 2RDJA 2DHGA 1WG5A 3O44A 1X5TA 3PW2A 2J5AA 2VA3A 4KHPF 3H5YA 3AHPA 1HYSB 1WHXA 2XWYA 1NH8A 4OFZA 1UA0A 5G4DA 2FVCA 4CLLA 2XHWA 1VQYA 2AJFE 5KFJA 3VV2B 5EWGA 2XC9A 3PX0A 3R6GB 3HD1A 4GO5X 4KIAA 2HQ3A 1WDDA 3MR7A 1OPIA 1T0TV 2HWHA 4F36A 1YITS 1PGZA 4OX8A 4PXEA 1OSCA 1ZM9A 5LT5A 1FKAF 1JJHA 5F3ZA 3K17A 1YI2S 1OY9A 2R2SA 4TYAA 2KXNB 3L7UA 3GSDA 2J9DA 4LMZA 2L9NA 3SBMA 4XPCA 3ELHA 3FQLA 4K59A 2HHUA 1S97A 2A0FB 3MM5B 2IVYA 3SCLE 3RZAA 5F8NA 1MMNA 2KVIA 3DOMA 1N6QA 2ZH2A 3HO1A 2XYPB 3QWUA 1FFWB 1S12A 5T41A 3PFOA 1UTAA 4WU3A 3PO4A 1FT8A 4X64F 1SJ1A 2CNOB 3PEJA 2OEMA 3GFHA 1RU1A 4OHWA 1WG1A 4PPDA 2G0CA 2FHOB 4U8VA 4ZVEA 1R8CA 3N4WA 2NR0A 2OO4A 2W1BA 2AV5A 2AEFA 1Q82T 5AE3A 1X0FA 3KLEB 1S6PB 1HHSA 2CPXA 4O3OA 3V81A 3LP1A 3CDUA 3JQJA 4ITSA 4EO6A 1N0VC 1FNMA 3ZO7A 4URGA 3D2WA 1VHIA 2WVCA 2VIHA 5J1NA 4DUZJ 1YQHA 1BLUA 4F2SA 4LR7A 4F4KA 2KB2A 2VHGA 1LK5A 8AT1B 3TAPA 4NE9C 4NX9A 1RTDA 2FC9A 3KUGA 4IKAA 3I55S 1AUSL 1TQLA 3F0NA 4RX6A 4XO0A 1JNRB 1KLMB 1TKZA 1T94A 3KXDA 4I6WA 2ACYA 4K7QA 1HD0A 2Z2ZA 5DQGA 2ZH7A 2ZZMA 3PIPQ 3DOLB 3ULHA 5DDPC 1OY6A 4F4XA 3I82A 5M2PA 3H4DA 3MOZA 1YZ6A 2FLOA 3QFWA 5E3PA 3HD2A 2C3YA 3ZFVA 3C6UB 1ZZFA 3AA8A 3ENVA 3MECB 5JVHQ 4QWEA 1JLBA 4DN0A 4B9SA 2GFFA 3OTCA 1FNOA 1S9EA 3M6VA 2BE2A 4JB8B 1NBEB 2LXIA 3AOCA 1GMWD 5J2MB 1JJCB 5HBMB 1FDDA 4USJC 1RT1A 1UJ4A 2R2UA 5J2PB 4XDCA 4IG0B 5A8WA 2POKA 4ZCLA 4KGZB 3K5NA 3CC7S 3BBCA 2CRLA 4CH1A 1QVGR 5EWFA 3FFIA 1FA0A 1H38A 2CQ4A 2JX2A 2ZBQA 4DR2F 3CCMS 3M8RA 1IR1A 1RT3A 2O67A 4C11B 2DTJA 1RQ0A 3H5SA 4NLVA 1MROB 3BBBA 4OLOA 4USIA 1NDKA 3LP2A 1PC4A 3GIMA 2V2KA 1MWYA 1L3SA 2XCPA 2AHOB 3MEDB 1S77D 4FXDA 1PC5A 1HBMB 1FWLA 4I56A 4CTAB 4ED2A 2EXUA 2RT3A 1FRHA 1HR0F 5H9FK 1UA1A 3HMJG 1IVZA 1VOMA 1JXLA 5ETKA 1BXNA 2OPRA 3A1YG 4OZ0A 4PAAA 1R3NA 2ZH6A 1IBCB 3MTJA 2OPRB 1CC8A 2QA1A 2HFSA 3CO9A 3HHEA 2XZTB 3M32B 4DL0C 1KRPA 4A8YA 5BR8F 1QAJA 2J9DE 2Z2YB 2ZKUA 4C0BA 1C4CA 2CQCA 2I9SA 4UUXA 4AXJA 4JI2J 5IM0A 3NP5A 2GZOA 5HAOA 3RAXA 2CVEA 5KT4A 1HNZF 2CVIA 1N34F 1RE1B 1WJ9A 2PGCA 5K9FA 2BW7A 3MD1A 3TUIC 4YHHF 4J9UE 2ZM6J 2V4JB 1YBUA 4CWBA 4P71A 1FF2A 1Y00A 5C42A 1TFWA 4DR6F 3H7HB 5J2MA 1M90T 1GX5A 2HFNA 5H9EK 3G87A 2YX7A 3LP0A 1KHVA 1RT3B 1N0UA 2G0IA 3UDEA 3IRXB 4C11A 4DPXA 1LWXA 2VPWB 4DR7F 1HBOB 2GS8A 1F0XA 3O1LA 4C48A 4XPEA 4J9NA 5F8IA 2WB4A 2O5DA 3DYAB 2GA7A 1JXVA 2ZHOA 4I6AA 4LFAJ 4PR6A 1RABB 3TARA 3NMAA 1VQPS 1A0OB 4TNOA 1JLBB 1FERA 3KK1A 3VQTA 2QJ3A 2C22A 3MECA 3QZ8A 4HHUA 1OSDA 4DV6F 1RT5A 1SIZA 4ELTA 4HI2A 5HSPA 2XLJA 3KLEA 4OYMA 3FSIA 1CS4A 1HHTP 1AW0A 3BQ2A 3SI8A 4BWJA 1P8GA 4WIIA 4DR5F 2XY6A 3RGIA 2KJWA 3HVRA 1FRLA 5D0RA 3LH2S 4HTJA 3HVTA 4OJ1A 3ZZ0A 4TU9A 2DGWA 4DOZA 4RW4A 1DQ9A 1NXIA 3OHBA 4X4TA 5DO2A 5E3CA 1RTDB 3TX8A 2WRMA 3HT3A 4DCOB 3BDEA 1RWXB 1VHFA 4E2FB 1B0PA 1HWKA 3OXFA 3QYYA 4IOBA 4ZOSA 5C24A 3M30A 2Y3YA 2I0XA
chains in the Genus database with same CATH topology
2CJQA 5KG5A 4KSEB 1Q8IA 1V9OA 2DITA 2OP5A 4OX7A 3CCRS 2EKYA 4N47A 2R9LA 4FS1A 2CPIA 3CEDA 2N4DA 5KFIA 1JKHA 1M5OC 1R8AA 2IRYA 5EN1A 1E6YA 1H2VZ 1ZM2A 2DNGA 3QLHA 3BGFA 2LEBA 2AD9A 2HW3A 3MMAB 1U09A 2M4MA 2RDIA 4RW8A 4DL6A 3U02A 5F8JA 4F3QA 3QJJA 2HHWA 4WXWA 4Q0BA 4NMLA 2EBEA 3MAHA 2F8HA 2GIRA 1S1VB 2PSZA 5AXMA 4I2PB 3CTRA 5L9XA 3BO3A 4QPTA 2JC1A 4RW9B 2ZDPA 3CUNA 4W90B 4RW8B 4IFVA 3ISZA 4LSNB 2MHNA 4CO4A 2Z0GA 4RNHA 2JLFA 1FRKA 1KS2A 2HHPA 3KLHA 3VAFA 3VAJA 3G71S 2WOMA 1R43A 2ROPA 1Y7PA 4KRWA 2AW0A 5MLCV 2QSWA 3OXGA 4PG4A 5KFFA 3HKZD 3KFWX 2YNHB 4NLSA 4FBTA 4A8SA 2JEJA 4EZ6A 7FDRA 5M2UA 4GKKF 2D74B 1V6HA 3DRSA 3DCAA 2HIQA 5KG0A 4BBYA 3SZ2A 1K1SA 2BRKA 4Z37A 2CPEA 2HRYA 1C0UB 1EP4B 1S6OA 3FQKA 3RB6A 4A8FA 4ZVGA 1N48A 4IUFA 1HQEA 4OJ3A 5IZHA 5KFNA 4JV1A 1T03B 5KFLA 4DV4F 1RT4B 5DG9A 1HA1A 4A8QA 3UCUP 2Z2LA 3TRGA 2GNKA 4NCBA 2D9PA 2D9OA 1TAQA 4OHVA 1VFJA 2QA4S 2F4VF 1JK9B 1SIWB 1N5TA 3VZHA 1FTCA 3CVKA 1SKSA 1Z2ZA 2LECA 4KFBA 1Z2LA 3LAKA 1JLAA 3CD6S 2KDOA 3L95X 5HROA 2UXBF 3KMQA 3H59A 3G8TA 1VRUB 5E0OA 1L5UA 1FVSA 3QJLA 2ALZA 3NCPA 1VIOA 2XS5A 2K7KA 4C8ZA 4PG8A 2ZC4A 4OI3A 1S6UA 4DQQA 3LWLA 2FJAB 3JAMY 2MMYA 2E5HA 3PW7A 1F5CA 1WACA 3DYAA 4QWCA 4EYIB 2ZDOA 2CPZA 3PR4A 3BSOA 2CQIA 4NCAA 5I4MA 2XMWA 2Y0SD 4DV7F 4GMKA 4W92B 2AX1A 3GIJA 3ISND 1TVRB 4NRUA 4FNIA 3F44A 3PV8A 1IKWA 3CIMA 2EFOA 3R5BA 4ZCIA 4X4UA 5EUHA 4DSLA 4OZ1A 2KT2A 4C8NA 3PKMA 2OPSA 3QJPA 2W9BB 2OD6A 1XEZA 4TY8B 3DI6A 5GAGI 4QZVB 3BEGB 4O4RA 3GYXB 4B3SF 4OZNA 1YRXA 3DRPB 2IAJB 5B0EA 4FF4A 2LQ5A 3KLIA 3DLEB 2Z8QA 4N56A 2MKIA 4ECQA 2RD5C 4B3TF 2OSQA 1G6BA 3MTKA 3GYNA 2L3MA 3DMJB 3KHGA 1U6BA 5L1JA 2CQGA 2CJ9A 5B0FA 2FVQA 2OPQB 1SKWA 4G1PA 5B0GA 1I6JA 5DETA 4N77A 2NSBA 1X4DA 5F8GA 3SV4A 4NLDA 2B9XA 1KOHA 1SUQB 5K8MA 4J9QA 1FEHA 3IAS9 1R27B 5HMZA 2G13A 1U1PA 1IR0A 4U67Q 2WAQD 4JI1F 5KG7A 1Q8LA 2DGVA 2YNIA 4ID5A 1GT8A 5CH7B 5D4LA 3SFGA 5DLFA 3UW1A 3R1HA 3TANA 1U4BA 2QV6A 1APSA 1Z4UA 4NZ7A 2OTLS 2VBYA 4ED1A 1U24A 3AJ1A 4JUZA 2DGTA 1VQ8S 2B43A 2VQEF 2FHJD 1QY7A 1VQOS 1SBRA 1BQNB 5FIIA 2MQMA 5FD1A 3WC2A 2N4CA 2VG5B 2G4BA 2IVMA 4ZA1A 1HPZB 3S01A 3I9V9 4BC9A 3HDSA 5I3PA 3PW0A 2JVRA 3RR7A 2O66A 4Y65A 2AJ4A 1U49A 2DT9A 2ZH5A 2DNZA 4R5PB 1HPZA 1U6FA 4ZHRA 4BC7A 3CWJA 1GX6A 2Y1RI 2RUGA 3L7PA 2OSRA 1QUVA 2YX1A 5DG7A 5GAEI 4QBUA 2YWKA 4TY9A 3D1HA 3UQSA 3MEKA 4MIWA 4ZPAA 2LA6A 4P6QA 4MH8A 4PRFA 2F9JA 4C0OC 2HPUA 2DIVA 4QU6A 4OHXA 4HYKA 1X4CA 5KOXA 3Q22A 4LUBA 1IBMF 3NL0A 3NKYA 1UKUA 1UFWA 1T7PA 1IKWB 5DQHA 1X4AA 2BZ2A 4R0JA 1B0VA 3OR2A 4K0KF 3SDEB 1KSPA 3DHWC 1HNXF 2PMZD 4IQXA 2PO4A 5AXKA 2OLWA 1HNWF 1FD2A 1HMVB 3FZBA 3QGPA 2ASLA 1GQEA 3OL8A 4ES1A 4IDKA 4Q7AA 1SL1A 1S49A 4C9DA 3ZZPA 2V4JA 3U1MA 5A6PA 2IRUA 3E01A 2V9KA 4YR0A 2MZQA 2MQQA 2KM8C 1ZTWA 3KLFB 4DFJA 2VPZB 3MEEA 4XDDA 2MQOA 1LW2B 3DRPA 4PG5A 3VF0B 1YVFA 4O23A 2IJNA 3KJVA 4JV2A 2MZSA 2JWNA 4RUHA 5HP1A 2FJBB 3FFIB 3G6XA 5SUHA 6FD1A 2EK6A 2W9BA 4N41A 1TL5A 3TVZA 1KTQA 2VB6A 1Y5LB 3P3DA 4I1TA 4LFCF 2J9CA 3QAUA 4OMFG 1XBWA 4QWDA 2ADBA 1TFYA 4B02A 5D8HB 3EX7B 4URQU 3UCGA 1C1CA 4IR1A 5AXNA 2GCFA 4FS2A 3IGVA 2KH9A 3V4IA 1X4FA 2HNDB 2MZRA 1JLAB 1HBUB 2Q3PA 3Q8SB 4K4YA 1Q8BA 2P9EA 2DNKA 1S9GB 2JJ4D 4UQTA 2MY7A 4CNYA 2NPFA 2WHOA 3CJ2A 3D1OA 2GO8A 2GMLA 2GO9A 3O2IA 4WFBQ 2MZTA 4G1IA 3MR3A 2IYIA 2LDIA 2LU2A 3KG0A 4NLWA 3BQ0A 1VQ4S 3PO4A 1C1BA 3I0SA 5D4PA 1DHMA 5L9NA 2WSCC 3LGMA 5AE2A 2M88A 2CZVC 2CQ0A 4WFAQ 3DLGB 5A8KB 1TKXB 3SSRA 1ZH5A 2CQ1A 2RQCA 3CPWR 4RLEA 4A47A 3JSMB 3H4BA 5DDRC 1REVA 3FMBA 3PEHA 1FE0A 4DV2F 2FY1A 1FJGF 1UP1A 3PRBA 4ED6A 4QIFA 3U1LA 5HI7A 1YJNS 4R5PA 2ZHAA 4DL5A 2R7VA 1NZAA 4YB5A 1S9FA 2FJWA 3BB5A 4C8MA 3C66A 3GILA 2HHHF 1VRTB 1GTEA 1R0AA 4PCQA 1A7GE 2OMOA 4HEA9 4K4WA 3P5TL 4LSNA 3MMBA 2W4PA 4JOUA 1HNIA 2E1MC 2JZ5A 3AH6A 4RW7B 4UOCA 3HX9A 1WHWA 3KK3A 2B9WA 2K3KA 4ZP9A 3TA0A 4GC7A 3SI8A 1S99A 3OFFA 4HLBA 5K8OA 4IRKA 4I7FB 1C4AA 5DGAA 2NXUA 3EXCX 3ICLA 1L3VA 1XK8A 1OQ6A 4J9PA 1XNRF 2W8KA 3QGGA 3DU6A 3MMAA 3NBPA 2NREA 1IXKA 4WZMA 2J7WA 3IR7B 1N5YB 1T3NA 2HWTA 2L48A 3S7RA 2XB2D 1FXRA 4TU7A 1DTQB 4LVNP 4RW4B 4EGLA 2CPYA 3HXMA 4A8OA 3OL9A 3ETOA 1NNDA 4QR0A 2MSSA 1FDAA 4A4JA 4CCHA 4E98A 2HNDA 3OJUA 3KLVA 2KM8B 1U1QA 3DRRB 5GVQA 4PWUA 2LQBA 1QSLA 2VG7B 3TUJC 4F3OA 3BR9A 4RWWA 5G0RB 4AL7A 1K0VA 2E9TA 5F8HA 1VQ5S 2GX8A 4LT6A 3OPKA 3OBIA 2AP6A 5KFZA 1FKPB 3NG8A 2LEAA 3M8SA 2ZOFA 4A48A 2MGZB 4AFFA 3NCRA 3IG1B 3NGKA 2HMIA 1N88A 5HMYA 2VUGA 3RB3A 1RWUA 4V19X 3CDWA 2HWIA 3KWMA 5E3RA 4DR4F 1HMVA 4DF4A 5E33A 1N5QA 5A6WA 1UW4A 5HQ8A 4Y28C 4IR9A 2B6AA 4ZLPA 3HHLA 1CEZA 3OQ2A 4ID8A 1DQ8A 4RNMA 2KN4A 3L3CA 1BGXT 1LW2A 2FUG9 2ZD1B 3OTDA 2BR0A 2CZ4A 1F60B 3QO9A 3Q2SC 4OZLA 2RKIA 5L1LA 3QO9B 4QOTA 3HZEA 4A8KA 2FC8A 2EVZA 2DNMA 3VR1A 1A9NB 3I32A 4O0IA 3OVSA 3E3XA 3JTPA 3DU5A 2DO0A 5I3UB 3IRXA 3CJ4A 5BJRA 3GIKA 2QO3A 4MFBA 2IFXA 2XNRA 4ED0A 5L1KA 3MFIA 2Q1LA 2WCXA 1N36F 4B17A 5DGBA 2ZJRQ 4ECTA 1KTVA 2K1RA 2JH3A 2AYEA 4TXSA 4QW9A 5KFOA 1HQUB 2DNLA 5KG3A 3UDLA 3Q24A 1ZYQA 1RT1B 3BS9A 2HGLA 2F3JA 2W4CA 2N7CA 2KJVA 2XS2A 5T7LB 5C5JA 2DISA 3TP2A 4PPZA 5CA5A 1D1UA 1JXEA 2BJEA 4OZ5A 3M2UA 3K2YA 1HQEB 2Q66A 1DJ0A 3CCTA 1KQFB 3FSXA 3D0GE 2C3OA 3M32A 5DM7Q 2QYCA 3UPFA 3G6ES 2AX0A 2DNPA 3BGRA 4C4WA 3I31A 2CQHA 4DSJA 2KFZA 2PEHA 1NEEA 3OTOF 5AXLA 2PMHA 4L3NA 5J1EB 2VONA 2QMXA 3SCIE 3GR0A 2B9YA 2UZAA 2KHDA 3VALA 2ASDA 4RKUC 4FPRA 4RBUA 2QIFA 4Y2CA 4LQ9A 4X65F 4C8LA 3ISNC 2WK4A 1F9FA 2WTFA 3IRWP 3MM6A 2CJAA 5KAKA 1QAYA 1HD1A 1HI1A 1JMTA 1S79A 2RILA 2W4DA 1DARA 2KFYA 4YMEA 5F8LA 4ELUA 2DH8A 1DTQA 2RQKA 5KG2A 3W7BA 2BE2B 1LFWA 1T8EA 3LALA 1SB6A 3D0HE 1DQAA 1JLFB 1RK8A 3F41A 2MDAA 5DJBA 2YKMA 3FEZA 2IRXA 3CC4S 2XGQA 3I0RA 1I1GA 4D3GA 3Q8QB 1MWZA 1Y3JA 4PQUB 2IC3B 5CXTA 1IQZA 2AU0A 3PIOQ 2CPHA 1P1LA 1H2TZ 4RUAA 2A10A 4DQRA 2XWXA 2C2EA 4F4ZA 3QAEA 5KFKA 1SL2A 4DL3A 3UCZP 3HHNB 4PQAA 2W24A 3ZZUA 5IQQA 4ES3A 4MIAA 2BVZA 2JDJA 3CE8A 4KB7A 2GMHA 1S6PA 2M2BA 2XI2A 3MM9B 4ICLB 3DRXA 4RBTA 2YWGA 1H0HB 2GQCA 3KLIB 2AJ1A 3CSKA 2YKOA 5HLFB 4F4YA 4RU2A 2C42A 3W2WB 4JI6F 2R7SA 2Y1IA 3CDEA 3NS6A 4UY85 5DRKA 2W7PA 1FE4A 1S1TB 2IJFA 4MFBB 4ECRA 2BRLA 4KTQA 3C3LA 5IT9Y 4NYPA 3P49B 4DDFA 1ZZNA 3KNGA 4CNZA 2XMKA 2VPXB 3R5AA 4C98A 3T3FA 3HHKA 1P6TA 5KT6A 5HROB 1S1WB 3TI0A 1YTYA 4WYLA 2BV3A 1M5PC 4FYDA 1JNZB 2UV8G 4F2RA 1U1LA 3PVXA 4YB1P 2P9CA 5KT3A 3I9ZA 2E5JA 1U26A 1VRUA 2CFXA 2YKNB 4ZVHA 3SSQA 4CO3A 5F3ZA 4E8UA 3AQPA 4ECYA 5CD4H 1BQXA 4JI0F 3NCQA 2OIHA 1JIHA 4YR3A 2HNZB 3D5MA 4MIBA 5C25A 2CDQA 1RT2B 5CYQB 1R89A 3SFUA 5KFTA 4AL5A 3K5LA 1VQ9S 2CQDA 4DMZA 2ZH3A 4CO5A 3EGWB 4DSKA 4C2MA 5HMXA 2QFJA 2ERRA 1MSWD 2EFVA 2NS1B 2R8GA 5GADI 4WE1A 1N5VA 2FHMA 2Q79A 1OPZA 5CCLA 3KJVB 2L9WA 2RRBA 1DLOA 3PJXA 4OLPA 1TV6B 4Y2IA 2IM3A 5IS2A 1KNZA 1SH3A 2VFTA 5JVGQ 1UEVA 3V6JA 3MZIA 1IBKF 4O3SA 3H5XA 4NRTA 5F41A 3MDFA 4P7TA 3ONQA 3DOKA 4H4KC 4O3RA 1KLNA 3LUYA 1BQMB 1IUJA 3LF0A 3AQOA 3M8PB 1HBNB 2C2DA 2V8GA 4Q8EA 4B3RF 3ZC4A 1R31A 2MZJA 2AYMA 4IFYA 2LVWA 2FLNA 2MQPA 4P2SA 3T1HF 3MWBA 2JLGA 1NK7A 4WJBA 3CJ5A 3KLHB 3M4XA 3GR1A 4NCGB 2HNYA 4ZP8A 3RRKA 2VOPA 4Y3CA 1Q78A 4XAKA 3B8HA 3N6LA 1XWLA 2VV5A 2FIUA 3OTBA 2UVRA 2EBGA 5HBMA 1SQEA 1FNXH 1HWLA 3UE2A 2O1PA 3Q23A 4M63A 1TL4A 2CJKA 2CYYA 2EFPA 2GHVC 3TAMB 4B9MA 5DG8A 2LKZA 2M0GB 4NLPA 4BS2A 4TQSA 4YQWA 5HO4A 2PA3A 2J7KA 5KTQA 1LW0A 2N3OA 4V19J 1HWUA 2B4PA 5KT7A 4H4MA 3CMES 4URSA 2ZOMA 3EZUA 4X4OA 2E44A 5A0YB 4YB6A 1RA7A 3TR5A 2IBKA 5A0YA 2PDAA 3DLKB 3RBDA 5I42A 1RP5A 2EK1A 3CDBA 4A8XA 4EU0A 4MTPA 5JJBA 3V6DB 2FVRA 1BQNA 2E29A 3CJ3A 1XMBA 1IBLF 5FDLB 2IYGA 1UJ6A 4X66F 3HVTB 4RU9A 1Y4ZB 2YWHA 1HBOA 2N82B 4HTIA 2JRSA 1FJ7A 3BN4A