1ROFA

Nmr study of 4fe-4s ferredoxin of thermatoga maritima
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
60
structure length
60
Chain Sequence
MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An NMR-derived model for the solution structure of oxidized Thermotoga maritima 1[Fe4-S4] ferredoxin.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 3
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rofA00
1F5BA 1FRIA 4L6V3 1F5CA 5L8RC 2VKRA 3MMAB 2C42A 1BWEA 1G3OA 3EUNA 1K0TA 3MMBA 2XSJA 1PC5A 2FJBB 1BLUA 1FRJA 2GMJA 1KEKA 1PC4A 2XSJB 2GMHA 2PA8D 2Y0SD 2WB1D 1FDBA 2V2KA 2PDAA 4XK8C 2V4JA 2FJDB 3IR7B 3MM9A 5BYSA 1R27B 2C3YA 3EGWB 1JB0C 1DAXA 3MM6B 1JNZB 1FRLA 3LW5C 2O01C 1G6BA 2ZVSA 3MMBB 1H0HB 2IVFB 1BC6A 1KQGB 1JNRB 1FRXA 1Y5NB 1B0PA 2C3MA 1FXDA 4DHVA 1Y4ZB 2VPYB 3MMAA 1GAOA 3MM7B 2Z8QA 7FD1A 3OR1A 3OR1B 1FRHA 1FXRA 1FD2A 1AXQA 1FCAA 1FERA 3GYXB 4AYBD 1B0VA 3PNIA 1Y5IB 4CI0B 3C8YA 2UZAA 1B0TA 1FTCA 1Y5LB 1D3WA 1BD6A 2C3PA 1XERA 1HFEL 3HKZD 3MM5B 1VJWA 2WSFC 2C3UA 3OR2B 2WSEC 1FRMA 2VPZB 4OMFG 5BYQA 1FDAA 1KQFB 1WTFA 1FDDA 3MMCB 1H98A 1A6LA 3MM8A 1GTHA 3IR5B 1C4AA 3MM6A 5BYRA 3MM9B 4XDDA 1SJ1A 1ROFA 4KT0C 1FRKA 1IQZA 1Q16B 2VPXB 1DFDA 5E7OB 2FJEB 2WSCC 4RKUC 2PMZD 1DURA 3MM8B 1F2GA 3MM7A 3MM5A 1GTEA 1IR0A 1SIWB 4Y28C 4ID8A 6FDRA 5CHCB 1GT8A 2FGOA 7FDRA 2C3OA 3EXYA 1FF2A 1FEHA 1FDNA 2VPWB 4YDDB 2FD2A 5FD1A 3MMCA 1H7WA 1BQXA 1RGVA 1CLFA 2V4JB 1H7XA 5CH7B 3OR2A 2WAQD 4OV1A 6FD1A 1C4CA 3IR6B 2FDNA 4XDCA 1SIZA 2FJAB
chains in the Genus database with same CATH superfamily
2NS1B 1E6YA 1UCNA 5A8WA 3P8BB 2KVIA 2AGPA 7AT1B 2M52A 2Y9HA 4XAKA 1URRA 3NAIA 1YG0A 3M6XA 3PW2A 4LF6F 5IC6B 1NK9A 3ZZYA 1BWEA 4IO1A 5E3QA 1JLAA 2D1CA 3K5LA 3SMZA 3DLEA 3KLFB 5HVFA 3NWRA 2WOMB 2XSFA 4RUBA 4DL4A 1H2UX 2AJ0A 1TKTB 2XSJA 2K7KA 2W24A 3I5BA 3OUYA 1BLUA 3ELHA 4PG5A 1S7HA 4KH0B 2DKOB 2IAJB 1IBMJ 3C46A 3CULA 1HD1A 3PR5B 3O1LA 1ZTTA 4JI7J 4HI2A 2LXFA 3N6MA 2YWKA 2AEMA 2EXUA 2RRBA 2CQBA 2D9PA 3W2WB 1U48A 3P49B 2X1GA 2V2QA 2D69A 5FLXY 3TUIC 1Y00A 2OP5A 2DR9A 2JLFA 1T9UA 1VS3A 2MDAA 4OHZA 4K5SA 2IVYA 4F4AA 1Y9OA 3CCWA 3HZGA 3CDEA 2DNMA 3X1LB 3M6WA 1K47A 3HT3A 1WHVA 1GNKA 3A8JA 4NI2A 2ZBQA 1UVKA 3O5TB 1S97A 1RAFB 4O0IA 1S5ZA 4O4RA 3WBZA 1Q81T 4G3IA 1FRXA 3O3LA 4B17A 1J2VA 3GIMA 4DV0J 3C2PA 3EZUA 4OYZA 5B0EA 4C0BA 1TK0A 3GYGA 3RRHA 1WF0A 1VLOA 1HBUA 3NS5A 4IFYB 3SDEB 3T41A 4CNZA 4LIRA 2Q1LA 2F5GA 1VHFA 4P7VA 3OR1B 8RUCA 1U1NA 1QTMA 1N5YB 4DSJA 1RWWB 2M8HA 3CJSA 3P4UB 1B64A 2FY8A 2DGUA 3WC2A 2PD1A 3A3PB 2Y8WA 2XMUA 4QPTA 4JBCA 3CDUA 1S6OA 2VJUA 4HTJA 2UZAA 1KTQA 2XMAA 1R6VA 4ECUA 2MSSA 1J5EF 2NXNA 3BKTA 1S9EA 5KFYA 1H3DA 2YNHA 2VBXA 4J9QA 3S7RA 4O0NA 3CD0A 4RW7B 4JV0A 4NEYA 5AXNA 3BDEA 1S7IA 2WBRA 4CO0A 5KFHA 2C3UA 4WFNQ 4NRUA 2GMLA 3SCJE 1JJ2R 1JK9B 3GR1A 2AJ4A 1YTYA 4RW6A 3VGTA 1VBYA 4DWIA 1YJRA 3MTKA 2RU9A 5E3PA 2FVCA 4ZHRA 1HNZF 1CJVA 2AT1B 2F4FA 4ECXA 2LP4A 3E01B 1PBUA 2RVJA 2E1AA 3MM8A 2EK6A 3OFHA 3IR5B 4TLQA 1TAQA 5D4NA 3H2VE 3KFWX 1CBKA 2L3MA 3GMGA 5GMEA 2CUYA 3T6JA 5LOQA 2EPIA 2DY9A 4PWWA 3GR0A 1RE1B 2H65B 1PJ7A 4MIAA 2CADA 1MMDA 3M2UA 3HVRA 2ZD1A 3F56A 3GSIA 2BM0A 4RKUC 4ETXA 1Q78A 1AT1B 3TANA 3CMES 2H1YA 2YWGA 1LKZA 2GJFA 4WPAA 4J9KA 4BS2A 1HNWJ 1HQUB 1HWLA 2VFTA 3DLJA 3PHEA 4I69A 2LQJA 5D4PA 1OWXA 1QE1B 2Y8YA 1BQMB 5I4MA 2N7CA 4CTAA 1XMOF 2PGCA 3HD1A 5EDWA 3PDNA 3TWZA 1MMLA 2QZ8A 5KG6A 3OHBA 1UW9A 1W2IA 3CCES 2CPZA 1UVJA 5FD1A 3E2EA 1WKJA 2G0IA 1C1CB 4N5SA 4K4SA 2R4FA 5F8HA 1YZ6A 2NCKL 2YNGB 3QIPB 1T7PA 4RZRA 3TJ9A 3G82B 5GADI 1QM9A 3Q2SC 2KT3A 1ZS6A 2SXLA 4URQU 4K4ZA 1H38A 2WAQD 3RW7A 5C25B 3OL9A 1TMJA 4ED0A 4Q2MA 1L3KA 5LMNF 5DLGA 2PN6A 3QWUA 1HWJA 2B7CB 3TA1A 1W26A 4QJVA 3THTA 4X4UA 2JL9A 5KOWA 1X9WA 2ZBPA 2KJWA 2VICA 2QL9B 1I5OB 1I3OB 3K5MA 1U7LA 3VCDA 1JWWA 2HHXA 2QA1A 3CCZA 4GVBA 3W64A 2FLPA 4EFAC 5L1JA 1SKRA 4UUWA 3ICLA 1RBAA 1X60A 3BSCA 3M30B 3QZ7A 3I31A 3DLBA 5KG2A 1RXOB 2GMJA 5I42B 2HBQB 1AUDA 2DNLA 4F7VA 2ZWPA 2IRYA 3F0NA 4YDXA 4C6AA 3TEGA 1K9MT 4JV2A 4KV8B 4W92B 1AFIA 1OY8A 5AE1A 3R1HA 3ILIA 3SV3A 2BRKA 5B08A 1UTAA 4Q8FA 5BYSA 3MFIA 4GC6A 1ITPA 1F2HA 1TFWA 1V6HA 1FTRA 5HP1B 2EI5A 2R8KA 1HMVB 1QLNA 4USJC 1JB0C 3M2RA 3V6DB 1C1CA 3MEEB 2B7BB 3M9NB 1N4LA 3MM6B 2N82B 1SUQA 2GZOA 2R7SA 2JC1A 3NP5A 3NOGA 3AJDA 5L1KA 4ZPCA 4HACB 4LF9F 4QOTA 2IPOB 2XZWA 2MKIA 2IFXA 1CVJA 1S12A 4FP9A 4KGKA 5IXUA 3QFHA 1FKOA 3QJPA 4M5HA 2UUTA 1XNQF 4USKA 4R0JA 3D9BA 2ZBRA 3Q89A 2AGOA 2VG7A 3FVYA 1EP4B 1T03B 1U26A 3D7SB 2NPFA 4U6PA 2EG1A 3CCQS 4GVBB 1EQ0A 1UWBB 1MW7A 2EFQA 1Y5IB 4V1Ak 4ZK7M 2C2EA 3KUGA 4ZVEA 3C8YA 4NZ0A 3JS9A 1RQ0A 3GIJA 2QSWA 1JKHA 3SFGA 1S9GA 4F0MA 1IUJA 3CTRA 3J7A1 1HBUB 2X1BA 3M9OB 2FHKA 4N8OA 4QYZJ 2DJWA 4KRWA 3KG4A 2CQCA 2AWZA 1Q8IA 2EFNA 3BBFA 3OR2B 2Y1JA 3T9ZA 4CM0A 2I5JB 1KWMA 3JSYA 2AMCB 4B3MJ 4V19J 5ETTA 1TTHB 4O23A 2LMIA 5GVQA 1GEHA 1UMJA 2OHDA 4MK8A 4WFYA 3UFCX 4K4WA 3M32A 1QAYA 1S9EB 1X4AA 3CCTA 3AB4B 4IH6A 4F2SA 5KT4A 1REVB 1RHKB 4WYWA 3NBPA 1B7YB 4USMA 4M95A 2CKWA 3T1YF 1YDLA 1RBOB 4J37A 4KY3A 2XO7A 2RQCA 2UUBF 1N33F 2IM0A 4KTQA 2PI5A 4G6VB 2BKNA 1NHKL 4ZCKA 2CPFA 5RUBA 3BN7A 1RAAB 1H2VZ 2YKNA 1IM6A 4CO4A 3MPVA 1FK9B 4CH7A 4M94A 4O3QA 5HATA 2BJ8A 1SH0A 2C2RA 4FF4A 2B9EA 7FDRA 4EBEA 1Z1ZA 2W2NP 4DV3J 1KRPA 2UUAJ 4QW8A 3CCMS 3QJLA 3D0IE 5DQGA 4X64J 1QAXA 1XK8A 3KHLA 5J2PA 3LGMA 4UT4A 5DQHA 5DETA 5LMUJ 5LJ3Y 3PRDA 5EX0A 1FJEB 1QE1A 4LRAA 2IBKA 2DEIA 3OLBA 3RRKA 1N34J 2IHR1 4QIGA 4JV5J 4D3GA 5D6GA 2WVCA 1RAEB 2OLWA 2E1CA 3MMJA 1XMQF 3VV2B 2YNFB 3VAIA 2C42A 4OZ0A 4PR6A 4WXOA 3H59A 3D0GE 3TJ8A 1U24A 4ZCIA 1VC6A 2WVDA 2UVWA 3QPIA 4KR0B 2LCWA 5C24A 2R7TA 4ZPWR 4M5NA 4MKBA 1SXLA 3MD1A 3OHAA 2VQFJ 1PGZA 4N76A 1O6XA 2ZOFA 1WTBA 2PT0A 3PIPQ 2LDYA 3H98A 2FY1A 2E44A 4A4JA 3HVTB 2AF6A 4K4XA 1S59A 1R89A 2H54B 4OYOA 3EGZA 3KJNB 4KV8A 3MPYA 3UE2A 3LAMA 3CCSS 2XY5A 3BM7A 5DM7Q 4PQUB 1PJ5A 2KKHA 1XJWB 3DU6A 1W25A 3CEDA 3KLIA 1CJKA 3HSGA 4H4MB 3ITHB 4I64A 4UQGA 1FJGJ 2CA9A 1Q8KA 2P2CB 1CULA 3IWNC 4TYAA 3FK4A 3PW0A 2RRAA 4NCGB 3U27A 4JB8B 1NK0A 2VDHA 4KSEB 2O01C 3G87A 1GK8A 3OFFA 4HTIA 3GB0A 3THPA 1N5YA 2FZGB 4LF5J 1X4HA 2CQHA 4NYPA 3WDOA 2DGVA 4QYRA 2XO6A 1EHWA 3RAMA 4O3OA 3Q8UA 1HIYA 1S1WA 4DSKA 3C16B 4DPYA 5GAGI 4OI3A 2G2OA 4ZVFA 4IG0A 3M8SA 4LF5F 2HVHA 2W8KA 5BR8J 3G6XA 2JC0A 2KYXA 4PG7A 4RWWA 2NPIA 2MKJA 3UCGA 1F5AA 1KVJA 1CC7A 1UVMA 2I8EA 3PY8A 2BA9A 1N0UA 5IM0B 4OX9J 2QGFB 1RWPB 2HNZB 2D3OR 2RRNA 4BHQA 5IWAJ 4QR2A 3QSYB 1C2PA 1DLOB 1FK9A 1U6ZA 3TA0A 2XMVA 4DX5A 3HHNB 5D8HB 3HMJG 1C0TA 3M8YA 4YFUA 3SSRA 3AJ1A 3JTNA 5KT7A 1I6JA 1RTDA 5K8NA 3JAMU 3DOKA 2LXUA 4YR0A 2Y0BB 3BR9A 5J1EB 2HS3A 1JJ4A 3FBCA 4OYBA 4LQ3A 2QMUB 1QSSA 2KO1A 2HBYB 3PJXA 4F4WA 4NLOA 3AD8C 4FPRA 5BYRA 4FYWB 1M5PC 2ATLA 4FS2A 1NH8A 2UXBJ 1ROFA 3ET6B 2XYPB 3DRRA 3JQJA 4RW6B 5E3RA 5F8LA 1PAUB 3BPDA 5KFZA 3PIOQ 3Q8SB 1AW0A 2CQDA 1N56A 2BJ9A 1Q79A 3A3NB 2X1FA 1UAWA 3DN9A 2YNHB 1FE0A 4DL2A 2W7OA 3RAQA 2ZH7A 4C3LA 4ZVHA 3OL7A 4EZ6A 2LLZA 4M5LA 1SJQA 4B9MA 2XB2D 1FJCA 4MK7A 1CJUB 2IJFA 3FQKA 5KG7A 3CSKA 1UZDA 6FDRA 5KFCA 2B5JB 4P6QA 5IQQA 4EO8A 3TARA 2VZ9A 5L46A 1WKKA 1JLBA 2VF3A 1RWXB 4ZVQB 3SDEA 3W8GA 2R7WA 1DZ5A 3GIRA 3OFEA 4GVLA 1NBEB 3ONQA 1RWVB 2YH0A 3X3UA 5MLCV 1OYEA 5DG9A 1QTNB 2I1RA 4IR9A 3HT0A 1YJ9S 1YZ7A 1ICEB 4J5OA 2E1PA 1Y10A 1S72S 2V2VA 3J80U 3H5XA 2VC1A 2YKQA 5A8RB 1TFYA 5I3UA 5HROB 1VK8A 2QLWA 2E1MC 5HJXA 5KFLA 1PILA 1N33J 4OYPA 2AYEA 2HFNA 4NOHA 4WP8A 5GAHI 5D78A 1IKWB 4ECYA 3A8IA 1EARA 4QZVB 3T19A 3CW2C 2R7VA 1SQGA 3C15A 3CNQP 2HURA 2H5JB 5T41A 5CYMB 3BYPA 2E9TA 1RAHB 4EBDA 2V9WA 1NNDA 3OXFA 4RO0A 1BMQB 3IC1A 3MOZA 4TNOA 3UVJB 4NXMF 3J7YI 2GMHA 2IAJA 2AX0A 3MEEA 2EEYA 2VKZG 4ZVRB 4IOAQ 5M2UA 1HNXJ 2BEFA 4CCHA 2C2MB 2CDQA 4HT5A 2HGLA 3MUVP 4OIXA 3CJKB 2KTQA 2LYVA 2HWHA 1O5JA 2MMYA 4IFVB 1RISA 3W60A 3TZXA 2KXNB 2VQEF 4HDGA 4I4BA 3DGPB 3TQ1A 2K7JA 4KBIA 5KFVA 4DBQA 2ZFHA 3LQVA 4DFJA 1FKPB 4KO0B 4L73A 1FFWB 1P6TA 1RSCA 2W25A 1SH2A 2KI2A 1UETA 2ZNZA 4IOCQ 4TY8A 1U6FA 3R7NB 4X2BA 4XTTA 2YPZA 2WRMA 3F41A 1CJTB 4QPXA 1NRKA 2HHHJ 1CQMA 1O0PA 2HQGA 2BR0A 1OQ6A 3MPUB 4OX7A 4Q43A 2FVSA 4ILLA 4TU7A 2FQQB 2EW9A 2GFFA 4QYZK 4WIQA 4QCLA 1LFPA 3BBCA 1RUSA 2IYGA 2Z8QA 2R2SA 1Y7PA 4B9SA 1RYRA 2E9RX 1NK7A 1FD2A 5EUHA 2JOQA 2RU3A 3MHYA 3IP0A 3U1MA 1HPZA 3FDSA 4Y65A 2HHHF 2NZ4A 1KNZA 1CC8A 2VQFF 1FTCA 4ZJOA 3PYGA 4OZ5A 4H4OB 3L3CA 3G71S 4ECSA 2C3PA 2HVEA 2IIHA 1UFLA 2ZDOA 3M32B 3MI7X 4C0HA 4F36A 1KVKA 5KT5A 2JWNA 3OXGA 4IO9Q 1UFWA 3UDEA 3HSZA 2M70A 2XGQA 3T6BA 5SUHA 3TUJC 4CH1A 1JLQB 4UUXA 3Q8YA 2L48A 2KU7A 5AXLA 1J27A 1H73A 2X3DA 3SXLA 3BQ0A 3OTEA 3KK3B 2UUCF 2F40A 5D4LA 1GMUA 5A76A 3W66A 2QMWA 4KQZA 1SJRA 2JLGA 4UY85 2POKA 2CWXA 1WELA 2W2MP 3KDNA 2YVSA 1N48A 3HCXA 2VDIA 1XR6A 2AX1A 2ZOGA 3A12A 3QATA 5HVGA 3OL6A 2HFUA 3SCIE 1NSAA 1HYSA 3MCOA 4MK9A 2G4BA 3K89A 4MH8A 3FKBA 2W9BB 5KFWA 4O44A 2XULA 1IR0A 4B3TJ 1CSJA 1NH7A 2HNDB 4QIFA 4CO3A 1ZOTA 1NU4A 3LP2B 2FJWA 5KG3A 4RW9B 1N5SA 2APOA 4ALZA 3A1YG 3BJYA 4IRDA 5FDLA 1D9AA 2J7UA 1GMWD 2WONB 2XYGB 4JI3F 1LXNA 2O1PA 5DDQC 2I2YA 4K0KJ 1SC1B 2KHDA 4YB6A 2QYGA 2MLXA 3NMRA 1WEYA 4WP3A 1IKXA 2B4UA 3EZOA 2E5HA 3I5AA 4PXEA 5CH7B 4JI6F 4X62F 3OJUA 1LWEB 4ED5A 6FD1A 2DGSA 3QGGA 4HI1A 1RTIA 5K8PA 1VIOA 1SJ4P 4TKTA 2DH9A 1RADB 2DNQA 1M0SA 3G2XA 3BPSP 4IQMA 4L6V3 2CNLB 4EYHB 3V4IA 3M6VA 4P2FA 3TAQA 1S77D 2DHHA 3OV7A 3AA8A 2CQGA 2GA7A 1OYDA 3F44A 3H40A 2VA2A 3SQGA 2ZH1A 2O5DA 3KLIB 4H4MA 4B9NA 4ZP6A 2MSTA 3G86A 2MQLA 3I6PA 5KG5A 5IC4B 3VAFA 1ZM2A 2UV8G 4F4KA 4A8MP 2Q6BA 3CMQA 2GHPA 3W3SA 1KKHA 1NJIT 1U4BA 5CCLA 2B4PA 1ZPWX 2V4JA 1QAIA 4C8OA 1DQ9A 1LWCB 1DTTB 1VBKA 3FJ2A 4J9UE 1YRTA 4IFVA 3T3FA 1QVFR 4LF9J 4ED6A 1B99A 4KGMA 3OSNA 1NZ8A 4CLSA 3HK2A 2BW2A 2BW7A 5GAGU 1EQMA 1VRQC 3FBFA 3CMAS 2HWTA 2W4DA 5KG1A 2R2TA 2HHWA 2YX4A 2CNKB 1G6BA 3FFIB 3GJRB 3DYAB 5LT5A 4LRFA 4AQYF 4LR8A 4P72A 4WFZA 2GS8A 1LWFA 1OQ3A 1UEKA 1HWIA 3KLEB 2U1AA 4LF4F 1REGX 4DSEA 3PV8A 1CG2A 1NDKA 2AJFE 3UN2A 3RBZA 3SV4A 4W90B 1ZAXA 4ZLJA 5F9NA 2VPYB 2LDIA 3DI6B 3DM2A 3MEDA 2CXEA 4JI8F 1HQUA 4G1PA 4DCPB 7FD1A 1I94F 2IM2A 3H7HB 2BV3A 2CRLA 3VR1A 2RQ4A 3I5CA 6AT1B 1K8AT 4WK1A 2MZRA 1C0TB 4CI0B 1SJ3P 2AW0A 1D9FA 2FLNA 3ZXWA 5LSOA 4HDHA 5L1LA 4N41A 1L3SA 3NWGA 3D3CJ 4CLTA 1XERA 2FLLA 3B4MA 1B70B 3HHLA 3G6VA 1P27B 2DEJA 2L41A 2VJVA 1NK4A 3I0SA 2G0JA 3V6KA 2DIVA 2MB0B 2BYCA 3HO1A 1IKWA 1YIJS 5CA5A 4DX8H 1RU1A 3BGRB 3B78A 1SC4B 5F0WA 1GMWA 2JRSA 2OELA 5CYQA 3P5BP 1WHWA 3ILOA 4B02A 1R6YA 1H98A 3CJ5A 3HHLC 3PEHA 2VONA 1PAEX 4PUOB 5E41A 2DO0A 3IAS9 4RNFA 4B08A 3CPWR 1RA6A 4DSLA 4XDDA 4OI4A 4RW8B 4DPUA 2J9CA 2YPYA 1CQNA 2BKPA 3IWLA 3MPWA 3RZAA 4CT8A 3PKYA 2KH9A 4GC7A 2Y1IA 2OTLS 2HHQA 4RUHA 1F1BB 1JLBB 1VQYA 1MU2A 4NLPA 5CYJA 2EBEA 1F2GA 2UU9J 1FNMA 3IN5A 3N28A 4Y28C 1SIWB 2VODA 1WG1A 4ZS6A 2OSQA 3GPAA 4OJ1A 3HHDA 4QR0A 1RI7A 4USWA 3QMQA 5D0GA 3CD6S 5BXIA 1GT8A 2HHSA 1N34F 3DGVA 4KH1B 2IC3B 3EXYA 4IRKA 3VZIA 1OSCA 2CZ4A 2VBZA 2YNFA 4URGA 4NLYA 1RGVA 3W5ZA 5DM6Q 2ADCA 1OJ4A 1ULRA 1FD8A 2KXHA 2MZJA 3Q23A 3PW4A 1TMMA 4NLTA 4Q7AA 3VZHA 4V19X 3FNNA 4XDCA 1Q7YT 1IKVB 1GXUA 3VHQA 3VAHA 1N36F 3OTOF 2OIHA 5A8WB 1UWAA 1IWGA 2DITA 1OSDA 2GO8A 4FKXA 4QU7A 1FX4A 3RB0A 1WORA 2KL8A 1DRZA 3AA9A 3C14B 3GJQB 3HXMA 2BRLA 2MLZA 1HHSA 2GVZB 2HPUA 3Q8VA 4ZPVR 3UN3A 3UI3A 1R0BG 3TEHB 2RHQB 2I0XA 3DLKA 1TKTA 2G2YA 4ZN3A 2GIRA 2VU5A 3C6TA 3R5BA 2J9EA 2RNEA 4ZVSB 4XIUA 3KK2A 3T5JA 3DRSB 4P74A 2JFKA 3PXGa 3NGUA 1SB6A 4FZVA 3KJVA 2ZJRQ 4UY8T 3FZBA 3SI8A 1S1XB 3L7OA 2FJDB 1N52B 4IH5A 1TV6B 1RT6A 1T11A 2H9ZA 4MT1A 5EHHA 2CPHA 3QYYA 1T8EA 2ZH6A 1NPPA 4ILRA 1HNIB 4YB7A 9ATCB 1RK8A 3J7YU 4NA3A 2QT7A 2HMIA 3W5XA 3ENWA 3ENQA 1LW0B 2JFDA 3LW5C 1RP5A 5KFIA 3RGIA 2IY5B 4RNOA 4OHYA 4O3PA 5C25A 2BJ1A 3MTJA 3PYDA 2R2UA 3TI0A 2MZ1A 2HG4A 1VQ5S 1UVLA 1VQOS 4J9NA 4DV0F 5HLFB 4X4NA 2K3KA 4LF8J 4ZMMA 3CCJS 1FJ7A 4MAKA 1KC8T 2P9GA 2RE1A 3WHIA 4YMEA 1VQ4S 5EWEA 4NA1A 4DX7A 3M2VB 1X4EA 3GYXB 3R3TA 3QWPA 1M90T 2F7VA 1JLEB 3DOMB 3PNIA 4QIWD 4USTA 4CP5A 4USHA 4J9RA 1T02A 3DDKA 3MECB 3MOJB 1BD6A 1UP1A 3HF5A 1R43A 1U1QA 2DPJA 1YBAA 2V63A 4YHHF 3OVBA 2HHUA 2HFZA 3DXBA 3HJVA 4K50A 4IKAA 4J9PA 4DR1F 1VJWA 3J80Y 2EWHA 3W1YC 3UNGC 3W2VB 1VLYA 1YSJA 2C28A 4Y3CA 1VRUA 1HNWF 4WU3A 3ISZA 4I6YA 3KLHA 2VPZB 3MAAA 2CZVC 3UVJA 1RU2A 4DR5F 3AOCA 4DL0C 5IT4A 2W4PA 4KPCA 5IT0A 2E9ZA 1T05B 1FHTA 1UFKA 4JP8A 3L7PA 4Q2LA 2ZKUA 4ILMA 3M8QB 4OYXA 3QZ8A 3W62A 1ZM3A 4KGZB 4NLRA 5D3GB 3FEXB 4ANCA 3MPDA 3M05A 1Q16B 2XS5A 3N6LA 4Z7YA 3M8WA 4OYAA 2EFOA 2CJXB 1TKXB 2QSFA 4OX6A 1LWXA 3AHPA 3QAEA 1QVGR 1DURA 1FEEA 4U95A 1M1KT 2CVEA 1TUGB 1RTJB 1VYAA 1RWKB 2CDRB 2FHJD 3FCVA 3R6GB 4GO7X 4NWBA 3IRXA 3RR8A 3GJSB 2BOPA 5C2GA 2IYIA 4A8SA 3VAGA 1PG5B 1TKZB 4ZN1A 1RA7A 1BXNA 1VOMA 1XR7A 4KHMA 1FEHA 1RT4B 4BBYA 1NK6A 3N4WA 2ZH8A 5DS7A 1BQXA 1TP7A 1YQHA 3ADAC 2D7SA 4ZPDA 2ROPA 4BC7A 4ES2A 1QSLA 4F3QA 3G82A 2G1HA 2XWYA 2J7WA 2ZJPQ 2AP6A 2VD3A 3NCPA 2DGXA 2NUUG 2ZH9A 3RG6A 4FS1A 2ACYA 2RS2A 1NK8A 2Z0GA 5B0CA 3UCZP 5EN1A 1HNIA 2CWKA 2LEAA 1FRIA 4HLBA 1JLGB 4ZVGA 3ZC4A 3ZNJ1 2F65A 1J5OA 2JJ4D 1QD1A 1SL2A 2YKPA 1F5CA 3IAM9 5DJBA 2CVIA 4MKAA 3V5RA 3TUPA 4LRCA 1KS2A 1RT5B 2J8AA 2ZBCA 1GXTA 3OJSA 1JIHA 5AXKA 1X9SA 3O44A 3EWGA 2QLXA 2MY8A 5KFQA 2ALYB 1RTIB 3IO1A 4JI1J 3H42A 3R6LB 2MZTA 2XMMA 5EX3A 5KFXA 3KG0A 2RF2A 4OZJA 3WQPA 4CO1A 1IKYA 1RT1A 4FYYB 1AZSA 2D41A 2DNPA 4UF4A 2J6TA 4W98A 1N8RT 2C2KB 1NJXA 2IVMA 4ZJQA 2PDAA 1XNQJ 4DV1F 1WC4A 3JQMA 3M8PB 3EMTA 2DR6A 5CZVA 5EWGA 3VQTA 1DBDA 2DNRA 1HARA 3BQ1A 3KNGA 5M2PA 2UXBF 4BWJA 1QDUB 1SKUB 2HS0A 2YWFA 5KOXA 1UA1A 4C8KA 4CYUA 3MURP 2AYMA 1VMBA 3KK3A 3B8HA 4AL6A 1VC0A 4C0OC 4DL3A 2OEMA 1SCJB 4AT1B 4DV1J 2BE7D 1KVIA 1Z2ZA 1RHRB 3QO9B 5B7WA 4X4QA 3D6HB 1MROB 1ZM4A 2RKIB 4RBUA 5CABA 1IWAA 1VQ8S 3M7VA 3NS7B 4ECQA 3QRRA 1A7GE 2CQ3A 2XNRA 4ER8A 3MAAB 1M5VC 4OYWA 4QW9A 3V6JA 3IBCB 2U2FA 1RYSA 3DU5A 2EVZA 1Q53A 3MMAA 4J9OA 2CJ9A 3MM7B 1IBKF 1FFGB 4DR4F 3Q8QB 2B4OA 2ZHOA 3IFEA 2ZM6J 1FCAA 4RW8A 4NEZA 2B5JA 5HQMA 3GV5B 2RQKA 2O3DA 2B51A 1UL3A 3AB2B 1U1PA 2DVIA 2FLOA 3FBBA 3QT7A 2X51A 1YX2A 2OGUA 4HL9A 4N77A 3JSBA 3R8YA 3I0RB 3VVUA 2PIIA 3PO5A 1C1BA 1RTHA 5H9EJ 3R27A 4NLQA 1KR4A 3UNYA 4F26A 4FPIA 1N5QA 4LSLA 2GAGC 4O3SA 1TV6A 4PQUA 4J90A 1NAQA 1J5EJ 1N32J 1WOOA 4K5RA 2BOAA 5AXMA 4NCAA 2DHGA 5CAAA 4ECWA 3T1HF 3T5LA 3NGRA 1HR0J 4U96A 2HVIA 4HVZA 4PPZA 2W2PP 3LGNA 4B9VA 3ISND 2VFSA 2DH7A 1A6LA 3HHLB 3QQCD 4LR7A 4U8YA 2LKZA 2V68A 3AY0A 4IFYA 1C4AA 1LW0A 2EKNA 3K57A 4K59A 1BQNB 1TVRB 4FDFA 4DX6A 1SQEA 3E3XA 2DISA 4OJGA 3G4SS 1NKBA 2Y3YA 5JMNA 4YB5A 4DF8A 5HBMA 3I82A 2L08A 4FVCA 5I3PA 3OUYB 2WONA 4K4UA 1XWLA 3H20A 5F8GA 2ROGA 3MM8B 4OZ1A 5J2MB 4GKKJ 4LF8F 1R0AA 3MD3A 1JXEA 2D3ZA 4IG3A 5M2RA 2R8JA 4I2PA 4ID8A 5JUMA 2HNDA 1ZYQA 4HACA 1HI0P 3CCUS 4HT7A 3HX9A 3RBXA 5KFFA 4DL7A 1FT8A 4P71A 1IXKA 3ZZPA 3QAUA 2OPPA 5DDOC 1H7WA 2PSZA 5D77A 2FZKB 2RHSB 5HN0A 1E6VB 4OI0A 3KMQA 3KLVA 2NYIA 3WIVA 1WG4A 2BZ2A 2KG1A 1DLOA 3ILLA 4OV1A 2NREA 3Q2TC 5HI7A 2XSJB 4PYAA 4JV5F 2AHOB 2OTJS 3UPFA 4DUZF 3DLHA 1BHNA 1WSRA 3OD2A 3BKUA 4NLSA 2HZVA 2LQ8A 1NHUA 3BREA 1MN9A 2CPYA 2ZUGA 3RYLA 3ZZ0A 1X31C 4IOBA 5K20B 4LFCF 3G9CA 4R0EA 4Q45A 2VIHA 3CO0P 2W9CA 2G2ZA 3QIDA 4N47A 1NUEA 2N4DA 1YI2S 3O6QA 4ENOA 1VRTA 3B4DA 2HZAA 4TYBA 3UO0A 3CIMA 1N88A 5HBMB 3KUHA 1JLGA 1U25A 2CPJA 4NLVA 1VQSA 2MQ8A 5CYQB 2DGWA 1KEKA 3N5BA 2HRTA 4LFCJ 4PG6A 1N5TA 4U7CA 2NR0A 2A10A 3JXOA 3P3DA 3EM1A 2QA2A 2R7UA 1WEZA 4FYXB 2BE2A 2HHPA 5ETSA 1S10A 2YKAA 1RKJA 1OY6A 1R27B 4AQYJ 1X0PA 3C6TB 2DGQA 3I56S 3KK2B 5DLFA 2HEKA 1HHQA 2L9WA 5IFMA 1YK9A 4G1QA 3H8YA 4Y34A 2FYXA 4C3KA 1S9FA 2RSQA 5A6PA 4X66F 1OY9A 1YJNS 2ZBIA 3H0PA 4YUDA 1GMVA 1I51B 2M5YA 2RQMA 2CJQA 4OHVA 3QO9A 4G65A 3Q22A 4PAAA 4IDKA 4DR3J 3SQGB 4HHHA 3HLUA 2R7RA 4YOEA 1H0HB 3QRQA 2O67A 3D66A 4LRDA 2B6AA 1NO8A 1X5PA 1M1GA 1RT7A 1S6PB 3JTOA 1R3NA 2B9XA 3NNHA 3DRSA 2V5HG 3MCNA 1UKUA 1ELOA 1YWXA 4KYZA 2GJ2A 1T94A 3WX8A 1L3TA 2HRUA 5FJ4A 2HYIB 1ZAVA 4EO6A 2DHXA 4E8UA 2IBOA 4C8NA 5J2QB 1AXQA 2NXJA 4N7TA 1FERA 1HQ2A 5KFEA 4AYBD 3M8RA 2B56A 3HSJA 4LSNA 2R8GA 3MR2A 4I68A 4Y2IA 2IC3A 4H54A 2X1AA 1G2EA 3D6FB 3HD2A 2E5LF 2OD4A 2ZC4A 1PO6A 4JI5F 1YHQS 1RT2B 3DDNA 1Y3JA 2VG7B 3POTA 1OO0B 2CNOB 4F3MA 5FLXU 4ID5A 2YXLA 2ATCB 4DG1B 3Q24A 2E66A 2XS2A 1JJCB 1W2BR 4BCAA 3AOAA 1S1VB 2CFXA 2MYFA 3TYTA 1LWFB 3KLEA 2J5AA 1FRMA 2CAJA 4MKVA 3MWBA 4JI5J 2AEFA 1ZTWA 1R7IA 3HVWA 5ETVA 5HQLA 2DRAA 3QBCA 1ZBTA 3TZYA 3FCHA 3KHGA 4C8ZA 2MKSA 2FVPA 3NGKA 2AZ1A 2UU9F 3MM9B 2KJVA 1S0MA 3OXLA 2I5JA 2MKYA 2J0WA 4LBIA 4WXWA 1UPMB 3QGHA 4M8LA 4CLKA 1FRKA 1IQZA 1NSKL 4KAIA 5HP1A 2UUWA 1WI6A 2ZUAA 4RR5A 4ES1A 5DG8A 2HS4A 5F0UA 1HQEA 1PIEA 3BH7B 1WJ9A 4ED2A 1TK5A 1FVSA 4P2MA 2C1EB 3W9JA 4UW2A 2BKOA 2DK2A 4U7UD 4NCGA 3A4TA 3AXMA 3S1TA 2QLJB 4DU7A 4R5PA 3ZTRA 1EB0A 2F1FA 4Z37A 1MMNA 2C3OA 2EG2A 4DV5J 1KOHA 4DN0A 4B3RF 1YRUA 2J0XA 3J81U 2W9AA 2RDIA 1HBOA 3ILJA 4MMOA 3PZPA 1F9HA 2CQ2A 1QUPA 1HI8A 2M88A 3D1OA 3CXCR 4DV7J 2P9EA 5K14A 5KT2A 4MTPA 4RUCA 2DR7A 4JI8J 2AGQA 3R2DJ 2ZITA 3NS6A 3UD3P 1H7XA 4LF2A 2D3O1 2J0SD 2BX6A 5DO2A 3H4BA 3TVYA 3IM8A 2J76E 3G8QA 1HW9A 3GE9A 4ITSA 2V8HA 4FNIA 5LL6d 4DFKA 5HQ8A 4I6WA 3KMSA 4DR2J 1EIYB 4PPDA 2GGPB 3IMQJ 1WC5A 1F3VA 2KXFA 3ZO7A 4JYAF 3H5YA 4M5JA 5KG4A 3JTPA 4K4TA 1HD0A 1U8SA 3H4DA 3OSPA 3H2UB 3PRVA 5HJYA 4DPOA 1WOSA 2QTWA 3ETOA 4Y6IA 5D4OA 5B0FA 3FRYA 4TU9A 4DR6F 2DRDA 1SBRA 1D0EA 5HAOA 3OQ2A 4C8YA 4OLPA 2EC2A 5IT9U 1RLDA 4WK3A 2WB1D 1WHYA 2LA6A 5F9LA 2KRRA 4GKKF 3PX4A 2GQ2A 3C16A 3MF5A 4DF4A 2JVOA 3OVAA 3CJKA 2PMWA 1ZZFA 5CZXA 2JVRA 5THWA 5G4DA 4DR6J 5BJRA 1RWNB 1M5OC 3LGHA 3EGWB 1NLKL 4OX8A 4H4OA 1K73T 1VC5A 4ECTA 3TZWA 4AXJA 3D0HE 4WFXA 1LK5A 2GHVC 3VGSA 1JNZB 2BQRA 1FRLA 2OSRA 3DDIA 4OZLA 3W5YA 4UZBA 1XEZA 3KKFA 4RW4A 3P45B 2MHEA 1KQGB 4ZP8A 3TA2A 1BC6A 3L09A 3MECA 2F4VJ 1P9YA 3I55S 2FHMA 1UW4A 4YEAA 1K1SA 1Z2LA 2DNHA 2ZE2B 1IJEB 1MWQA 4DS5A 3GP9A 2MZSA 1RTJA 3CD7A 3MCMA 4P7TA 2V4RA 3TAMA 1FXRA 4LSLB 2VBWA 1XQIA 2HBZB 3GFHA 5KTQA 2XZTB 4FVMA 2VC0A 1KDNA 5A2QU 4O3RA 1GX6A 5IV4A 4UQTA 1B0VA 4UZCA 2PE8A 1LW2A 5DGBA 3DOLB 4O4GB 1T3NA 4LUBA 4ZCLA 2Z30B 1Y5LB 1D3WA 4ZDNA 2ZH5A 4IUFA 2J7KA 2JEIA 4Z7CA 2R3VA 5J1EA 2MJNA 2W4CA 2MXYA 1T05A 3MM5B 2JDJA 4RNMA 2FB0A 4N8NA 4CO2A 4A8QA 4NLGA 2OJ3A 1SPBP 3GFXA 3KUEA 1Q95G 5E33A 2NQPA 3HJFA 5KFDA 2GIFA 4Q8EA 5ETMA 3TP2A 1TKXA 2UUBJ 1FDDA 2DNGA 2XWXA 1KHVA 2F63A 3B82A 1EP4A 1RHJB 2MHNA 5J2NB 4QBUA 3CC7S 3PX0A 1RT3A 2IJRA 4TU8A 1VCTA 1HW8A 1LQ9A 3M8QA 2B9YA 4HEA9 4Y00A 5KT3A 4LRBA 4NZ6A 2B6AB 1YLXA 1WC1A 5CQGA 1P9QC 1WD6A 1S6PA 2GV1A 2IM3A 1U0SA 3BGFA 2VFRA 4LR9A 1VBZA 4L75A 3I9V9 1L3VA 3GV8B 3CT9A 4QIEA 4RL1A 5JVHQ 1S0OA 3R5JB 2BANA 3ZZZA 2RD5C 1JLFB 3FQLA 4F4YA 1FO1A 4WP9A 2MQMA 2FHOB 1S4EA 1F9EB 4DL6A 4CLUA 5GAEI 5IQ6A 3KLHB 4F4ZA 4IR1A 4ZPBA 4B3OB 2YKMA 4QIVA 4U8VA 3CCVS 4LJMA 1JX4A 4P73A 4MFBB 5KFUA 4X65F 3BH6B 3FEZA 1LNQA 2NXEA 3UDLA 4B9TA 2P6TA 4Y2CA 3VVTA 3J7AN 3CJRA 2R7OA 4KE5A 3WC0A 3RB6A 1T3OA 4DEZA 2V4JB 1CJUA 5KFJA 8ATCB 2OH2A 1YGYA 4FF3A 3PVXA 1C4CA 1IBCB 3DCAA 3IR6B 3FMBA 3TRGA 4CO5A 2HGMA 4CZCA 3NCRA 1CEZA 4WU2A 3W7BA 3ZTOA 4JI1F 2HQCA 4OJ3A 2DR5A 1HBOB 4FYVB 5LSLA 2VKRA 4NL5A 4R25A 1VQNS 1U02A 5HO4A 3M9MB 4A8FA 4OX9F 3GQCA 2BJ3A 2GQQA 1JLCB 3IG1B 2GX8A 1N6QB 2DGTA 2ILZA 4C97A 1S1VA 2F3JA 4RW4B 2BABA 2OAUA 1UPPA 2LQ5A 3ZZRA 3MR6A 4TXSA 3LP0A 2Y0SD 3R2CJ 1WHXA 1H2TZ 3S8SA 3PJ9A 3H25A 5J2PB 3MM9A 4NXMJ 2BBEA 2CQ4A 1NM2A 4NE9C 1LFWA 1LEOA 2KM8C 4YN3B 4YP3A 3D6MB 5ADZA 3Q8PB 1Q5YA 2DNKA 3EDRB 4EI2A 3W9IA 3IS9B 3BR8A 2ZHBA 4B3RJ 1BE4A 4CDIA 4UOCA 3DLGB 1BUXA 2UXDJ 1R0AB 4NLUA 3FSXA 3W9HA 3KK1A 2HLTA 3T5HA 2D9OA 3HM9A 2QE5A 2W2QP 3CB4A 4DV6F 3GFZA 3R9LA 2KB2A 1B0PA 4LF4J 4ECVA 3ULHA 4AE5A 2JNJA 2B0GA 1IKYB 2HAIA 2ZNYA 1DQAA 4A8KA 1T9XA 2HGNA 4Z2XA 3W61A 1FI4A 1FRHA 2F9JA 1YITS 3BSAA 3DLEB 2B9WA 1N6QA 2BE2B 1OMSA 1X4BA 2V9KA 2MGZA 4NCBA 3IXQA 3SCKE 1ACMB 1WC0A 4KJIA 5J1PA 5LMUF 2HHTA 3M30A 2YTCA 5HVHA 1T0TV 2MJUA 2UVRA 4RUAA 3D3BJ 5IV3A 1UEUA 5I42A 4LF6J 3LANA 1HNXF 1F0XA 4DV4J 1Y3KA 4IDKB 1PKUA 3PR4A 1XMQJ 2WSEC 2CJBA 2XMWA 4CLFA 3G8TA 1EKSA 4BWMA 4Q5VA 3J81j 4F2RA 1B7FA 3ZNUA 5L39A 1WTFA 3P96A 2QIFA 2QA4S 3R7SB 1GTHA 4LMZA 3B54A 4E98A 3V6HA 4X64F 1NB2A 1PYTA 4WTOB 4TY9A 3W2WA 3A8EA 2GO9A 3Q83A 3CUNA 3NGTA 4KGVB 1EZZB 2V8GA 4NXNJ 2VPXB 3IM9A 1WOPA 2MEWA 2QLBB 4DR2F 2OPRB 2KFYA 4PZVA 3TNVA 1FFSB 2QFIA 2RB7A 3FRZA 2HK3A 2XMTA 4DUYF 1FKAF 4FNHA 4DLEA 2BQUA 4BLGA 2WB4A 4KKOA 1MSWD 4NXNF 5CHCB 2FGOA 2YX1A 2I6WA 3MUMP 3DXSX 3EZ5A 4ELTA 3DNCA 1D9DA 4HYKA 1A0OB 4H4KA 4CYUB 5AE3A 3DGPA 2DIUA 1KFDA 3VF0B 1VGYA 4DV5F 1HYSB 3K5OA 1JKHB 1IR1A 5A2QY 3RB3A 2VASA 1TR0A 4WYLA 1SI9A 1VQ7S 2H4WB 2YWWA 3D2WA 2Y1LB 1TL3A 2DT9A 2DB1A 3M8ZA 4J9LA 2R7XA 1UA0A 4F67A 5KAKA 4YY3J 2QL5B 3LF0A 2FDNA 3NGSA 3AT1B 4LSNB 1IQTA 4K0KF 1KLNA 3GCXP 5E3CA 5FDLB 2PA3A 1N36J 2YNIA 3V81A 2V67A 2I9SA 4H4KC 4ATNA 2RDDA 3RB4A 3VTIA 2A3JA 1WUUA 2FZCB 5A0YB 3DLGA 2XLIA 4O44B 2XM3A 2Z56B 1U45A 1RT3B 1G3OA 4I2PB 3EVWA 3FFIA 2VFVA 1WEXA 3NBPB 1JLQA 4IG0B 4L72B 3CCLS 3LP1B 2V4QA 4U67Q 4QWBA 2L9DA 1RLCL 3RAXA 1S6QA 4PXDA 4LBPA 4DXLA 2Q43A 2O66A 1XNRF 1X5TA 3OFGA 3SQOP 2JX2A 2JEJA 2RJZA 1HNVA 4XK8C 4C11B 2YKNB 3FC9A 1D09B 3IR7B 3Q8RB 3J7ZT 5GMKa 5L1IA 2XYHB 4NX9A 4ZA1A 3R1LA 2ZHAA 1U2FA 2YWEA 4DPXA 2OPQB 2ASLA 1U2CA 3FBEA 4JI6J 2B43A 2OUGA 2MKKA 5GAEU 1RT4A 2ZDPA 5SZTA 4ZPTR 4X4RA 3G8SA 3RBEA 1IBLF 1LV5A 2AIRB 3I96A 3MEGA 3ZZOA 2XZDB 4EGLA 3AD7C 1T9VA 3QIPA 3UD5A 1UEVA 4WFAQ 3GILA 1XMOJ 5A6WA 2DR8A 1WF1A 1DY3A 4LQ9A 4RPFA 4CLWA 5AJ3J 2ZH2A 1CJTA 3DHXA 4HH1A 1VRTB 3PACA 1Y5NB 2MTLA 1HBMB 2KFZA 5B0BA 3CDBA 3FSYA 4TVAB 1HBNA 4Q0BB 1EETB 4F0HA 4JI4F 3W63A 3M1VA 4CQ1A 3NL0A 5KFRA 4LFAJ 2BVZA 3CIZA 3GJTB 2EFGA 4NMXA 5IOLA 3J81Y 4MIBA 1LWEA 1O8BA 2R42A 3D6TB 3U7JA 3CD5A 4CLZA 5C24B 4ERDA 3MAQA 3BKFA 4ZVUB 1RAGB 3HKWA 4KHPJ 2XMJA 3D4JA 3PYEA 2VHGA 3G6ES 4X4OA 1S6UA 2W1BA 1CJVB 1E6VA 4LVOP 4E2FB 1XN9A 2GIQA 3MCSA 3QT8A 4K8RA 1JLFA 2EKYA 4TY8B 4DR7F 5K8MA 2E7VA 4CRJA 4YR3A 2WSFC 2A1BA 4ZVOB 3BO2A 4I6AA 3RW6A 4MIWA 4IQXA 3OW2R 1R0CB 2LEBA 4KHPF 2LQBA 4E0DA 5HROA 4CH0S 4UTGA 3RR7A 1NPKA 1SL1A 3VAJA 4JV1A 2W9BA 2DHAA 3K8WA 2IM1A 2CQ1A 1SUQB 1YJVA 3TAMB 2OFGX 2V8DA 2HW3A 4R5PB 2OKQA 2V94A 3CJ0A 5IS2A 1I94J 2QEXS 2WVBA 1FWPA 2CPDA 4LFBJ 1UJ5A 4HR2A 3SFUA 2BXJA 4ZHRB 2DO4A 3RUBL 3BGOP 4ZP9A 3OVSA 3M1VB 2V8PA 2BQ3A 1FXLA 5A8KB 2IRXA 2DYAA 3L95X 3MM5A 3OTDA 2CQ0A 3H90A 1HL6A 5DDPC 2NLWA 4GRSA 3E8OA 3C19A 2Z2YB 3OTCA 3MFHA 3F73A 1JLEA 1K1QA 1U1RA 1HLWA 4HKQA 3QLHA 3UR0A 4I7FA 4X62J 1RAOA 1S6QB 2KT2A 1Y0HA 2OPRA 2FD2A 3LOUA 3GCWP 5EGYA 2WZ1A 1NK5A 2UXDF 3QGIA 5HMXA 2ZE2A 4EZ9A 1JXLA 5LXRA 2COLA 1ZETA 3HHEA 5F8MA 2R7QA 3OT9A 1D1UA 4IRCA 1V5IB 4RLEA 5B0DA 3EPIA 1BQMA 1RAIB 2H5IB 2HIQA 4DV4F 1C0UB 2HNYA 3DMJB 3OR2A 1D8YA 3G6YA 2BACA 1SIZA 1MG7A 1UJ6A 4KC5A 3PO4A 3V4MA 4LFAF 2YNIB 3V81B 1S57A 2OEJA 2YQ3A 3KDOA 1ZZNA 2ASJA 1IBKJ 1HKAA 3HP6A 1S9GB 2B8PA 1WDDA 2FPHX 1TUVA 3D68A 2IA0A 3H2LA 4UOHA 2JZ5A 4ZIVA 3K8VA 4AXIA 4DL5A 2FJXA 1RAJA 2MQPA 1WKLA 1R8HA 2HFSA 3EUNA 5D0HA 1G4CA 4USUA 4CIOA 4RW9A 2XLKA 4DQQA 1PJ6A 3QJJA 3BN4A 4FYDA 2WK4A 2DTJA 2HVDA 2V2ZA 3RJMB 3UDVA 3UCUP 1Q82T 2OD6A 3N5FA 5ETQA 5KG0A 5A0YA 2PA8D 3TQEA 1VR6A 2MQOA 3BO3A 3C3LA 4WKYA 3LWLA 2V2KA 3CGIA 4A46A 3A3OB 4EEYA 4WWSA 3UN5A 2AD9A 2IRUA 4KPYA 2DXFA 2FUG9 3DYAA 3KOAA 4Y0FA 1JJHA 1X4DA 2BM1A 4M5IA 2FVRA 2E29A 3CC4S 3MUTP 2VV5A 4M5MA 2J6UA 3NNCA 4G1IA 2Z2LA 4OHXA 4DMZA 4L74A 4ED8A 1S0NA 3KLGB 2V69A 2F9DA 2XGPA 2W7PA 2PC6A 3D1HA 3BZQA 3E01A 1TL3B 1ZAWA 2DD8S 3AD9C 3HSDA 2DCLA 5E3AA 2HNZA 2N4CA 5C2CA 4XPEA 2QA4G 1VRUB 1WACA 3QGPA 1YRXA 1Q5VA 4WJBA 3TW0A 2ZVSA 5IT9Y 1Z4UA 3C6UA 3MMBB 5ETRA 4U7UK 1JNRB 4CM2A 2KYZA 5IZHA 2Q79A 1HBNB 2N3OA 1RWOB 2DNZA 2C3MA 3BGLA 4ZKAA 3OLAA 1VFJA 4JI7F 1Y4ZB 4A47A 4IYQA 4JI0F 3TO8A 1KOOA 4DV2J 3T1YJ 3K5NA 2KFNA 1IM4A 1Q0NA 2C2OB 2DPIA 1IBMF 3CJ4A 5E5NA 5F8JA 4NYOA 2FHJA 2WTFA 2JEGA 3JAMY 4RBVA 2P6SA 4QWCA 4P52A 2GC8A 2VFUA 4DZ6A 2YQ1A 3DRRB 1XR5A 5JVGQ 3HVTA 2P9CA 5HLFA 3CJTA 4B3MF 2EBGA 4MFBA 3EE3A 1T9YA 3T1AA 1VJQA 1NJZA 1X5SA 1T9TA 2ADBA 3L4BC 4DV3F 1T9WA 2UUAF 1VQLS 1KSPA 4P10A 1EJ7L 3NAHA 5KFSA 1TKZA 3FGVA 3H5SA 2CJKA 1ZA1B 3BB5A 4BC9A 1N32F 2HMIB 1AYEA 2F8EX 3ZFVA 3CJ3A 3TX8A 2C2ZB 2NUHA 4B3TF 4F04B 2PEHA 2HQDA 2DY1A 2DCUB 4C98A 4HH0A 1I1GA 1F3FA 1SV5B 2MLYA 2XG8A 3HPOA 3CF5Q 1C1BB 1OPZA 5HMZA 2KZMA 1X8DA 1VQ6S 1T03A 2OI2A 2QN6B 1RZMA 1KONA 1JLAB 1U2RA 3LUYA 2HWIA 3D5MA 3NGDA 1RABB 4R8UB 1AA1B 3GSDA 2BDPA 2GVDB 1TUWA 3MXHP 1FE4A 2MGZB 5LM7E 3TVZA 2AQ4A 1NDCA 1QUVA 5E7OB 1DFDA 2WSCC 3D67A 3IWXA 2E5GA 3LPYA 4DU8A 3DOKB 2K06A 1TQLA 1TK8A 2RT3A 3MGJA 1R8AA 3ISNC 3CCRS 4JI4J 4FN5A 1U0HB 1P1LA 1NXIA 4OYIA 1IVZA 2RS8A 2CPXA 3DRXA 2B3TB 1WG5A 2RIJA 2L9NA 1TVRA 4EU0A 3M6UA 1HHTP 3IBFB 4NLWA 1HNZJ 3N79A 5CYMA 2KM8B 2V34A 2ACMA 1MWZA 2DXDA 1HMVA 2W7AA 3Q86A 2RUGA 1S48A 5IM0A 5D0EA 1TELA 4EUVA 1U1MA 4PWDA 3HHKA 1CPZA 4DQSA 2KN4A 3LWMA 3LPEA 3UDCA 1PYSB 4QWDA 3KK1B 4F50A 1RT5A 1FJGF 3KWMA 5HK4A 1C0UA 2HNYB 3DMJA 3M2VA 3BF4A 4IG3B 4RU9A 2VA3A 2RH3A 3EDQB 2YH1A 1Q86T 3NRBA 1F9FA 1UZHA 1NPRA 1VQMS 2KG0A 1F5BA 2DRBA 4P75A 2OFHX 1R8CA 4N56A 4EYIB 2RUSA 2VG6A 2XI2A 3GYNA 3KJQB 1RT1B 3LP0B 3MEGB 4QQBA 3I4HX 4YHHJ 2R8HA 2AU0A 1SJFA 1MN7A 1KQKA 1K44A 4GKJJ 1QSYA 1O51A 5CD4H 5JJBA 3UW1A 3DRPB 1TKDA 1KQSR 4ANEA 1VI7A 2H5EA 3C6UB 3MMBA 3N9UC 3LH2S 1VQKS 1PC5A 1WSVA 2G13A 2QYCA 1HQEB 5H9FK 1CULB 2HBRB 2JEFA 1PC4A 5DRKA 1AFJA 3R5DA 1P8GA 4J9MA 1NKCA 3NY0A 1FVQA 2VBYA 2OO4A 2VG5B 2VB6A 1RT6B 1CS4B 1MROA 2RKIA 1SH3A 4K2XA 2BUNA 3GONA 4NMLA 2YBVA 4DV6J 4EBCA 4OZ3A 3GTYX 3PW7A 2QLFB 3IBWA 3O2IA 1FKOB 4NZ7A 3I0RA 2UVUA 3R5CA 1X5OA 4WE1B 3FUYA 5KT6A 3D1QA 2Z57B 1NKEA 4KFBB 5A8KA 2N7YA 4JI3J 1G7CB 2G0CA 1QJHA 3PFOA 1RHQB 4P2SA 5F8IA 5ETNA 3UWTA 2OMOA 4X4VA 3U1LA 4DI6A 1NHVA 4FXVA 1RTDB 1ZA2B 2M0GB 5C7PA 1V3RA 2VL1A 3D28A 3KLGA 4LREA 1XBWA 2B8QA 2GGPA 1GAOA 4YS2A 3HZEA 1KTVA 5LMNJ 1M5KC 1WWHA 2B4VA 3EGNA 3D54A 4OFZA 3K5PA 3W2VA 4ZLNA 1IJFB 1TAUA 4RX6A 1TL7B 3C15B 2CNNB 4ZP7A 1FWKA 5G0RB 4X4TA 5F3TA 3PKMA 3K59A 3DOMA 3BEGB 1B0TA 3SCLE 2HKEA 3FCWA 4LF7J 2AZ3A 3A8KA 2JSXA 1M1HA 4YB1P 3CJ8A 1EAYC 3PEJA 4HHJA 4DQRA 2CQIA 3LA0A 5J2MA 2DXEA 1DJ0A 1S1WB 2WHOA 4DR5J 2OPSA 3DHWC 5AE2A 3SEOA 3JB9k 4DR7J 2LQ9A 5C42B 4ZLLA 3IA0A 4P9SA 4ECZA 1HWUA 4LF7F 4KHRA 5BYQA 4ZJLA 1FDAA 3VGUA 4M5DA 1TZ0A 4ZPAA 1KQFB 3ZZUA 4AFFA 1IR2A 3MMCB 5KFNA 2A2CA 3HVAA 4A8YA 4F02A 1P1TA 1U1KA 4C11A 2QO3A 3THVA 3TUZC 3AH6A 3IG1A 2QMXA 4PKDB 3BQ2A 2UUCJ 3AQOA 1S76D 1SJ1A 3ITHA 4M5KA 4RU2A 4I67A 5EWFA 3DLLQ 5K5MA 1JQGA 2MQNA 4C8LA 5U47A 2Q66A 2D74B 1S0VA 4K4VA 1RTHB 4OZNA 2C2NA 1V3SA 2VUGA 3R5AA 5DZ7A 4O3NA 3FZ2A 2Z58B 3CC2S 3DRYA 1PCAA 1S79A 1WNEA 2UXCF 4P2XA 5ETKA 1S1TB 2ZVIA 1U1LA 4OHWA 4ZITA 4PG8A 2EC0A 1WC6A 4B3SF 3US5A 2OPQA 3MAHA 2W8LA 4A8XA 3K0JA 2VPWB 1RACB 3N0VA 2WW8A 3H5UA 2DHSA 2IMOA 4OL8A 3POTB 3M4XA 3PW5A 2UXCJ 2AYGA 3W8PA 3O8WA 3OL8A 4LT6A 5ETLA 2FVQA 3WX4A 4QR1A 3QT5A 2D3UA 1ZH5A 4DSFA 3KTQA 2AV5A 3PRBA 2ZM6F 1M5HA 2WVEA 1S49A 3HI9A 4GO5X 3IRWP 4GMKA 2N3LA 2LXIA 1YJWS 1NSPA 2YX7A 5CD4A 4FXWA 1FKPA 2G9OA 4KO0A 5B0AA 4D3HA 4ES3A 2JHEA 5MAOA 5F41A 1U1OA 4WTYA 1W7WA 1H72C 2Q6CA 3DKDA 3EJMA 5K9FA 5DDRC 4JYAJ 1LK7A 3HHLD 5CXTA 1PSDA 1YJTA 2WBMA 3AAWB 4KGXB 3NMAA 4RBTA 4FKYA 1N0VC 3GZ7A 1XIQA 2QL7B 4C8MA 5I3UB 4F3OA 3RTVA 5HMWA 3T1HJ 1FRJA 2ROEA 5ITHA 1ZM9A 3NEKA 1AZSB 1U0HA 4AL5A 1NJWA 5E2QA 1GFWB 3QRPA 3OTOJ 2XC9A 4WIIA 1LWCA 2ASDA 2QRRA 1VQPS 3MR5A 2QX0A 1V5VA 1HWKA 3ETMA 4DCOB 2LU2A 2BJDA 4F0KA 1FA0A 1KHWA 3TZZA 2MPUA 2HQ3A 3EXCX 2R8IA 4MKYA 1ZPVA 2C3YA 1RT7B 4URSA 1Q8BA 3K2YA 2E5IA 4PWUA 3SYZA 2M8DB 4DQPA 2A18A 3NNAA 4RNNA 2HZCA 2LA4A 2BE9B 3EX7B 2YNGA 4Q44A 1DTQA 1Q8LA 1REVA 1TU0B 1KLMB 2AEJA 4NI2B 4NA2A 3KHRA 5KFOA 3HDSA 3PX6A 2I38A 5DQIA 1R31A 3JSRA 1BGXT 4Y2MA 4USVA 2IVFB 5HSPA 1V3ZA 3ET6A 2ILYA 3QLHB 1NZAA 2EFVA 4USIA 3W65A 4G1QB 4TQSA 3MDFA 2VOOA 1QAJA 1FXDA 5F8NA 3CDWA 1RCXB 4L3NA 4ED4A 2MZQA 1LXJA 4X4SA 4TN2A 2A6OA 2C22A 3OR1A 2BJEA 2GW8A 3LAKA 3VQSA 2CIMA 1HI1A 3DC2A 4DG1A 4YQWA 1TL7A 1IN0A 2RDJA 1SVDA 4ZLPA 2GQCA 3QT6A 4X65J 5GAHU 3PM9A 4HHUA 4JOUA 3G96A 4PEOA 1N5VA 2XNQA 3ZTQA 4AL7A 2ZWOA 2OPPB 3KJFB 3PJWA 4PXBA 1SL0A 3B6BA 1R8BA 3I9ZA 2RAQA 1OPIA 1R8PA 5KFKA 2BANB 2RILA 3CE8A 3CO9A 1X4FA 2DNYA 3R7BB 4YR2A 1SKSA 2FJVA 3BGRA 3KLFA 4DDFA 4ICLB 2K3IA 1YJ7A 3ZTSA 4LBHA 4WE1A 3AXKA 1RT2A 3K58A 3UR3C 1RHUB 4ID5B 2LECA 5J2NA 3BDPA 1D8ZA 4K4YA 3MM6A 2DGOA 4K2JA 1BQNA 2MKHA 1RJJA 3AQPA 5KFBA 4KT0C 4S0MA 2HFVA 2MY7A 2ZZMA 2XEXA 2ZKTA 4J9SA 1DQ8A 2RF2B 4UOFA 3RBDA 1MU2B 5IWAF 4ED7A 1X4GA 3DI6A 3DM2B 3MEDB 2DNOA 4KIAA 5ETOA 1F6TA 4M5GA 1UVNA 5K8OA 1KFSA 2V6AA 3GFYA 4J7CA 4LF1A 3JQKA 4LVNP 3P6YC 4R8UA 2R9LA 2K8GA 4B9LA 5JXSA 3HFKA 5AJ3F 1H74A 3SIPB 5T14A 4OI1A 1LOUA 1SC3B 2LU1A 1FF2A 3MR7A 5A8RA 4RJVA 5H1SV 1FDNA 1X4CA 3OPKA 3TVKA 3IGVA 4C2MA 3GV7B 1SV5A 1NEEA 1AB8A 1UJ4A 1GQEA 3BSNA 3L7UA 1GX5A 3T5KA 2HQIA 1N54B 2NSCA 2XMKA 4NLDA 4X4PA 4NYZA 4TQRA 1U47A 1CLFA 1RWUA 4I0WA 3UQSA 4DCJB 1QY7A 2CJYB 2PO4A 4XO0A 2CPEA 2FJAB 2FIUA 1Q7LB 2KVQE 4XPCA 2VH7A 2YKMB 2AJ1A 2ZOMA 4I2QA 4DJBA 3JYTB 2ZH4A 1DHMA 4PWDB 2XQCA 1RTZA 3PTWA 3ENVA 3I32A 1M5SA 2KHCA 3KG1A 3MMAB 1X9MA 1XC9A 3R5GA 1IKXB 5E0OA 1X0FA 1U49A 4L3KA 4M63A 4CNYA 1VBXA 5F3ZA 4B9UA 2UV8A 5C42A 1K0TA 1RWMB 2XCAA 4JI2F 4DSIA 2FJBB 2HVZA 4U9RA 4ELUA 3MZIA 5KFAA 5B09A 2HK2A 2Z4PA 2XS7A 5KFGA 3KJVB 3I87A 1FDBA 1BY9A 5CCMA 4CLPA 1HR0F 3QNWB 1XMBA 2V8VA 2IDEA 4OQJA 1JMTA 1WC3A 4Y2AA 4C48A 4JI2J 2YY3A 4DR3F 3CDAA 2AYBA 5FIIA 3M2UB 5J1NA 4LFBF 4I56A 1B4SA 1WF2A 3M2RB 3V6DA 2P8IA 2E1RA 3PHTA 4LIWA 3KYLA 2FC9A 2UVVA 5D0RA 4DV2F 3ZZTA 3TR5A 3VAMA 5J2QA 5T7LB 2KRBA 4OV6A 4OLOA 1DTTA 3EVOA 1FNXH 3LP2A 4DFPA 5C5JA 2G1DA 2H4YB 3LALA 4ECRA 2WOMA 4ETZA 2E7XA 4ED3A 2GVDA 5LXYA 5KFMA 3KHHA 2J0QD 2PI4A 4O4GA 4EK2A 4QU6A 4DUYJ 1Q1KA 3IS9A 4DHVA 2FC8A 3BBBA 5KFTA 1U09A 4TLRA 3K17A 2H51B 4EWTA 5KFPA 4ZVTB 5L9XA 2MQQA 5HL7Q 3NXZA 4DV7F 1Y11A 2EK1A 3JSMA 1B3TA 2F4VF 3SSSA 1KBRA 3Q0AA 1CS4A 4PXCA 5LSRA 2R2RA 2XLJA 1K0VA 2M9KA 2PMHA 3HULA 1YBUA 4I7FB 2WVFA 4MYUA 5B0GA 2J8SA 3PCOB 1GXLA 3EGVA 3IGNA 2P5VA 3LO3A 1H6KX 4C3MA 1AUSL 4OJHA 1KN6A 3L9ZA 2GNKA 5GADU 2LVWA 1HFEL 3TJAA 4YY3F 2VOPA 3S01A 2IMWP 3AODA 1SQFA 1JLCA 3HFVA 5H9EK 3GG1A 1RKIA 4CWBA 1LW2B 1RCOB 1FWLA 2CQPA 1WDTA 2J9DE 1YJUA 4OMFG 1T95A 1NMEB 4OI6A 4W4MA 4DR1J 3V4IB 4PRFA 2VG6B 3NKYA 4PYDA 2GAHC 2VQEJ 1EX8A 4KB7A 4DQIA 1VK3A 1KLMA 2E5JA 1NDLA 5HMYA 3VAKA 1TL4A 3AJ2A 2W9CB 2BJ7A 4CTAB 1HPZB 4F4XA 2M3DA 2ZC3A 5G0RA 4WKRA 1NB7A 3K7RA 1NDPA 4MYTA 3NCQA 4ICLA 3N6NA 2CG8A 2FJEB 2M4MA 2NSBA 3AFGA 4I1TA 4PABA 2PMZD 1SC6A 3E51A 3ENAA 3ZTPA 4F25A 1S99A 3BO4A 2QC3A 3FMWA 2ZH3A 4NASA 3GG0A 2W2OP 1HA1A 1GTEA 3C14A 3I0SB 3MM7A 4LSZB 2FTRA 2J6SA 2GVZA 4C9DA 2IA6A 3VGVA 1WI8A 2NZCA 1BWVA 4C7QA 1UWBA 1VHIA 2HQFA 3OTBA 5DGAA 5D15A 2UP1A 4WF9Q 2KT5A 4B3SJ 3T9NA 4YDDB 1SKWA 1KP6A 1PBAA 8AT1B 3S6EA 2DH8A 3BGUA 3KNAA 3EPGA 4A48A 4KFBA 4DZDA 3CVKA 2FGCA 2CG4A 5HANA 4JI0J 1U6BA 4GKJF 2NYHA 1A9NB 4WZQA 1XNRJ 4J91A 1U8WA 5BR8F 1NJYA 4A8OA 2AKWB 1FESA 3QSIA 3GU0A 2ZJQQ 2XY6A 2A0FB 2Q3PA 1E6YB 4OI2A 3TAPA 2HHVA 2Z2ZA 3PYFA 3WZ0A 1S1UB 2GJIA 2XI3A 3OBIA 2WCXA 5L8RC 4PUOA 5ETPA 1DTQB 3MR3A 1YKWA 4PCQA 4FXDA 3BSOA 1L3UA 4X66J 3VWSA 2LFVA 2F8HA 3DFEA 2HIYA 4L76A 1Q4RA 3SBMA 2Z2MA 1MWYA 2K1RA 3A13A 2H48B 2HFOA 4I2QB 4M5DB 3JYTA 2EFPA 1APSA 3GIIA 2HRYA 2C2DA 1EETA 2V0NA 3I4PA 2RMLA 2M2BA 4RNHA 3CJQA 4OYMA 2LEPA 5K14B 3EYZA 3NG8A 2PFFB 2KDOA 3IRXB 2QFJA 1RBLA 2ASYA 4ZCMA 3JSMB 2BMBA 4DUZJ 2E7WA 2VG5A 4MJKA 3U1NA 1VQ9S 1URNA 3VALA 3LP1A 5L9NA 4AD6A 4DLGA 2QG9B 2ALZA 1MLAA 1AROP 3V2UC 4CLYA 9RUBA 4ELVA 1YBTA 3WIUA 2ZEJA 3NLCA 4DN9A 3AOBA 1IBLJ 4F8RA 4CT9A 1DAXA 1NSQA 4FBUA 1TL1A 3BS9A 5T7LA 5DG7A 3C66A 4BDPA 3DRPA 5LJ5Y 1TL5A 4NRTA 4DOZA 4RWXA 3DLKB 2ERRA 4B3OA 1X7VA 1L5UA 1JXVA 2W01A 1S4FA 2ZD1B 2J9DA 4NPOA 4ZIWA 2KZZA 2YQ0A 1S1UA 1GH8A 2A2DA 2CYYA 2HSEB 3PFEA 4JUZA 4WFBQ 5AT1B 4M1KA 4DS4A 2OPSB 2JH3A 3PG9A 4IH7A 3P5TL 3TOQA 1VISA 4X84A 3UD4P 1PYOB 5D3GA 2K2PA 1IKVA 2H3EB 4ZOSA 1VIXA 4ANDA 2M7SA 3EVMA 3KXDA 5H9FJ 1MNEA 3BV8A 2XCPA 2JLEA 4Y2KA 4Q0BA 3CWJA 3EICA 3GIKA 2MKCA 1F60B 4PQAA 3HKZD 1XTZA 1YVFA 4RW7A 2OEKA 3RRGA 1RB0A 3NOCA 3M8PA 2XHWA 3HFZB 3QFWA 1FX2A 4PG4A 4WBFA 3RU0A 4WCEQ 3SSQA 2GCFA 2GHWA 4NLXA 2XHCA 2CPIA 3R97A 2F8MA 3FSIA 4A8WA 2DNNA 4C4WA 1DARA 4FF1A 2PEBA 4DPTA 1VDHA 4DUTA 5DZ6A 4FBTA 2AJ2A 2WW4A 2IJNA 1V9OA 2X3GA 1NCLA 1TL1B 1EKRA 2Y1RI 3CJ2A 5I3QA 3J7Z5 3TX0A 3GLJA 1S1TA 4KKOB 5L38A 3BYRA 4ZVPB 1HBMA 1CJKB 3DOLA 4K7QA 2HLUA 1OS5A 1J5OB 4FF2A 2ZZNA 2DBBA 4J9VA 3N01A 4DFMA 1S1XA 2X7IA 2YKOA 1KD1T 2XBPA 1OIAA 1FNOA 2IDLA 2CJAA 4AUKA 4UOGA 2ZZTA 2QV6A 3LTOA 1G1XA 3FEYB 2YWHA 4ED1A 2K1RB 2NXUA 2XY7A 3SZ2A 3MMCA 2XTJP 2ABYA 4DR4J 2PFDA 2HAFA 1HNVB 1RHMB 2NXCA 5GMDA 4CLLA 4QWAA 2E5LJ 2V50A 4WZMA 3MEKA 1UVIA 4OZ2A 3GWCA 2QJ3A 2A6MA 1RDRA 4DPWA 4QWEA 2AJQA 2CZ9A 2OMLA 4EMDA 3U02A
chains in the Genus database with same CATH topology
2NS1B 1E6YA 5A8WA 2KVIA 2AGPA 2M52A 4XAKA 1URRA 3NAIA 1YG0A 3M6XA 3PW2A 4LF6F 1NK9A 3ZZYA 1BWEA 4IO1A 5E3QA 1JLAA 2D1CA 3K5LA 3SMZA 3DLEA 3KLFB 2WOMB 2XSFA 4DL4A 1H2UX 2AJ0A 1TKTB 2XSJA 2K7KA 2W24A 3I5BA 3OUYA 1BLUA 4PG5A 1S7HA 2IAJB 3C46A 3CULA 1HD1A 3PR5B 3O1LA 1ZTTA 4HI2A 2LXFA 3N6MA 2YWKA 2RRBA 1U48A 3W2WB 2CQBA 2D9PA 3P49B 2X1GA 5FLXY 3TUIC 1Y00A 2OP5A 2DR9A 2JLFA 1VS3A 2MDAA 4OHZA 4K5SA 2IVYA 1Y9OA 3CCWA 3HZGA 3CDEA 2DNMA 3X1LB 3M6WA 3HT3A 1WHVA 1GNKA 1S97A 1UVKA 4O0IA 3WBZA 4O4RA 4G3IA 1Q81T 1FRXA 3O3LA 4B17A 1J2VA 3GIMA 3C2PA 3EZUA 4C0BA 5B0EA 1TK0A 3RRHA 1WF0A 3SDEB 1HBUA 3NS5A 4IFYB 4CNZA 3V4IB 4LIRA 2Q1LA 1QTMA 1VHFA 4P7VA 3OR1B 1U1NA 1N5YB 4DSJA 2M8HA 1B64A 2DGUA 3WC2A 2PD1A 2XMUA 4QPTA 4JBCA 3CDUA 1S6OA 4HTJA 2UZAA 1KTQA 4ECUA 2MSSA 1J5EF 5KFYA 1S9EA 1N48A 1H3DA 2YNHA 2VBXA 4J9QA 3S7RA 4PUOB 3CD0A 4RW7B 4JV0A 5AXNA 3BDEA 2WBRA 4CO0A 5KFHA 2C3UA 4WFNQ 4NRUA 2GMLA 3SCJE 1JJ2R 1JK9B 3GR1A 2AJ4A 1YTYA 4RW6A 1VBYA 4DWIA 1YJRA 3MTKA 2RU9A 5E3PA 2FVCA 4ZHRA 1HNZF 4ECXA 3E01B 2RVJA 3MM8A 2E1AA 3OFHA 2EK6A 2R7WA 3IR5B 4TLQA 1TAQA 5D4NA 3H2VE 3KFWX 3T6JA 2L3MA 3GMGA 1K8AT 2EPIA 3GR0A 4MIAA 3HVRA 1MMDA 3M2UA 3TANA 2ZD1A 3F56A 4ETXA 2BM0A 4RKUC 2HMIA 1Q78A 2YWGA 1LKZA 4BS2A 1HQUB 1HWLA 2VFTA 3DLJA 3PHEA 4I69A 2LQJA 5D4PA 1OWXA 1QE1B 1BQMB 5I4MA 2N7CA 4CTAA 1XMOF 2PGCA 5EDWA 3PDNA 1MMLA 2QZ8A 5KG6A 3OHBA 1W2IA 3CCES 1UVJA 2CPZA 5FD1A 3E2EA 1C1CB 4N5SA 4K4SA 2R4FA 5F8HA 2YNGB 1T7PA 3QIPB 4RZRA 5GADI 1QM9A 3Q2SC 2KT3A 2SXLA 4URQU 4K4ZA 1H38A 2WAQD 3RW7A 5C25B 4ED0A 4Q2MA 1L3KA 5LMNF 5DLGA 2PN6A 3QWUA 1HWJA 2B7CB 3TA1A 4QJVA 3THTA 4X4UA 2JL9A 5KOWA 1X9WA 2KJWA 3K5MA 1U7LA 3VCDA 1JWWA 2HHXA 2QA1A 3CCZA 2FLPA 4EFAC 5L1JA 1SKRA 4UUWA 3ICLA 3BSCA 3M30B 3QZ7A 3I31A 3DLBA 5KG2A 2GMJA 5I42B 1AUDA 2DNLA 4YDXA 2IRYA 4JV2A 1K9MT 4KV8B 4W92B 1AFIA 3R1HA 3SV3A 2BRKA 5B08A 4Q8FA 5BYSA 3MFIA 4GC6A 1TFWA 1V6HA 1FTRA 5HP1B 2EI5A 2R8KA 1HMVB 1QLNA 4USJC 1JB0C 3M2RA 3V6DB 1C1CA 3MEEB 2B7BB 3M9NB 1N4LA 3MM6B 2N82B 1SUQA 2R7SA 2JC1A 3NP5A 4ZPCA 4LF9F 4QOTA 2XZWA 2MKIA 2IFXA 1CVJA 4FP9A 4KGKA 5IXUA 1FKOA 3QJPA 2UUTA 1XNQF 4R0JA 2AGOA 2VG7A 3FVYA 1EP4B 1T03B 1U26A 2NPFA 4U6PA 2EG1A 3CCQS 1UWBB 1MW7A 2EFQA 1Y5IB 4ZK7M 2C2EA 3OL9A 4ZVEA 3C8YA 4NZ0A 1RQ0A 3GIJA 2QSWA 1JKHA 3SFGA 1S9GA 1IUJA 3CTRA 3J7A1 1HBUB 2X1BA 3M9OB 2FHKA 4N8OA 4QYZJ 2DJWA 4KRWA 3KG4A 2CQCA 2AWZA 1Q8IA 2EFNA 3OR2B 2Y1JA 2VOPA 3T9ZA 4V19J 2I5JB 3JSYA 4O23A 2LMIA 5GVQA 1UMJA 4WFYA 4MK8A 4K4WA 3UFCX 3M32A 1QAYA 1S9EB 1X4AA 3CCTA 3AB4B 4IH6A 4F2SA 5KT4A 1REVB 4WYWA 4M95A 3NBPA 2CKWA 3T1YF 2UUBF 2XO7A 4J37A 2RQCA 2IM0A 4KTQA 2PI5A 4G6VB 4ZCKA 2CPFA 3BN7A 1H2VZ 2YKNA 4CO4A 3MPVA 1FK9B 4CH7A 4M94A 4O3QA 2C2RA 1SH0A 4FF4A 7FDRA 4EBEA 1Z1ZA 1KRPA 4QW8A 3CCMS 3QJLA 3D0IE 5DQGA 1QAXA 1XK8A 3KHLA 5J2PA 3LGMA 5DQHA 5DETA 5LJ3Y 3PRDA 5EX0A 1FJEB 1QE1A 2IBKA 3OLBA 3RRKA 2IHR1 4QIGA 4D3GA 5D6GA 2OLWA 2E1CA 3MMJA 1XMQF 2YNFB 3VAIA 2C42A 4OZ0A 4PR6A 4WXOA 3H59A 3D0GE 1U24A 4ZCIA 1VC6A 2UVWA 3QPIA 4KR0B 2LCWA 5C24A 2R7TA 4ZPWR 4N76A 4MKBA 1SXLA 3MD1A 1PGZA 2ZOFA 1WTBA 2PT0A 3PIPQ 2LDYA 3H98A 2FY1A 2E44A 4A4JA 3HVTB 2AF6A 4K4XA 3EGZA 1R89A 4KV8A 3MPYA 3UE2A 3LAMA 3CCSS 2XY5A 3BM7A 5DM7Q 4PQUB 2KKHA 3DU6A 3KLIA 1W25A 3CEDA 4H4MB 4I64A 4UQGA 3ITHB 3IWNC 4TYAA 3PW0A 2RRAA 4NCGB 3U27A 1NK0A 4KSEB 3THPA 2O01C 3OFFA 4HTIA 1N5YA 3GB0A 1X4HA 2CQHA 4NYPA 3WDOA 2DGVA 4QYRA 3RAMA 4O3OA 1S1WA 4DSKA 5GAGI 4OI3A 4ZVFA 4IG0A 3M8SA 4LF5F 2HVHA 2W8KA 3G6XA 2JC0A 2KYXA 4PG7A 4RWWA 2NPIA 2MKJA 3UCGA 1F5AA 1KVJA 1CC7A 1UVMA 2I8EA 3PY8A 2BA9A 1N0UA 5IM0B 2HNZB 2D3OR 2RRNA 4BHQA 4QR2A 1C2PA 1DLOB 1FK9A 1U6ZA 3TA0A 2XMVA 3HHNB 5D8HB 3HMJG 1C0TA 4YFUA 3SSRA 3AJ1A 3JTNA 1I6JA 1RTDA 5K8NA 4YR0A 3DOKA 2LXUA 3BR9A 5J1EB 2HS3A 1JJ4A 4LQ3A 1QSSA 2KO1A 3PJXA 4F4WA 4NLOA 4FPRA 5BYRA 1M5PC 2ATLA 4FS2A 1NH8A 1ROFA 3CMES 5E3RA 3DRRA 5F8LA 4RW6B 3Q8SB 3PIOQ 5KFZA 1AW0A 2CQDA 1N56A 1Q79A 2X1FA 1UAWA 3DN9A 2YNHB 1FE0A 4DL2A 2W7OA 3RAQA 2ZH7A 4C3LA 4ZVHA 3OL7A 4EZ6A 2LLZA 4B9MA 1SJQA 2XB2D 1FJCA 4MK7A 5KG7A 2IJFA 3FQKA 3CSKA 6FDRA 5KFCA 2B5JB 4P6QA 5IQQA 4EO8A 3TARA 2VZ9A 1JLBA 3SDEA 1DZ5A 3OFEA 3ONQA 3X3UA 2YH0A 5MLCV 4IR9A 5DG9A 2I1RA 1YJ9S 4J5OA 3H5XA 2VC1A 2YKQA 5A8RB 1TFYA 5I3UA 5HROB 1VK8A 2QLWA 2E1MC 5KFLA 1PILA 2AYEA 2HFNA 4NOHA 5GAHI 5D78A 1IKWB 4ECYA 4QZVB 3T19A 2R7VA 2E9TA 5T41A 5CYMB 4EBDA 2V9WA 1NNDA 3OXFA 4NXMF 3IC1A 3MOZA 4TNOA 3J7YI 2GMHA 2IAJA 2AX0A 3MEEA 2VKZG 4IOAQ 5M2UA 4CCHA 2KTQA 2CDQA 4HT5A 2HGLA 3MUVP 4OIXA 3CJKB 2LYVA 2HWHA 1O5JA 2MMYA 4IFVB 1RISA 2KXNB 2VQEF 4HDGA 4I4BA 3TQ1A 2K7JA 4KBIA 5KFVA 4DBQA 2ZFHA 3LQVA 4DFJA 1FKPB 4KO0B 4IOCQ 3HO1A 2W25A 1P6TA 1SH2A 2KI2A 1UETA 2ZNZA 4X2BA 4TY8A 1U6FA 2WRMA 3F41A 4QPXA 1NRKA 1CQMA 1O0PA 2FVSA 2BR0A 1OQ6A 4OX7A 4Q43A 4ILLA 4TU7A 2EW9A 2GFFA 4QCLA 1LFPA 2R2SA 2IYGA 2Z8QA 1Y7PA 4B9SA 1RYRA 2E9RX 1NK7A 1FD2A 5EUHA 2JOQA 2RU3A 3MHYA 2HHHF 3U1MA 1HPZA 3FDSA 4Y65A 2NZ4A 1KNZA 1CC8A 2VQFF 1FTCA 3L3CA 4ECSA 4OZ5A 4H4OB 2C3PA 1UFLA 2ZDOA 3M32B 3MI7X 4C0HA 5KT5A 2JWNA 3OXGA 4IO9Q 1UFWA 2M70A 2XGQA 3T6BA 5SUHA 3TUJC 4CH1A 1JLQB 4UUXA 2L48A 2KU7A 5AXLA 3SXLA 3OTEA 3KK3B 2UUCF 2F40A 5D4LA 2QMWA 4KQZA 1SJRA 2JLGA 4UY85 2POKA 1WELA 2YVSA 3OL6A 1XR6A 2AX1A 2ZOGA 3SCIE 1HYSA 4MK9A 2G4BA 4MH8A 2W9BB 5KFWA 4O44A 2XULA 1IR0A 1CSJA 1NH7A 2HNDB 4QIFA 4CO3A 1ZOTA 1NU4A 3LP2B 2FJWA 5KG3A 4RW9B 1N5SA 2APOA 4ALZA 3A1YG 3BJYA 4IRDA 5FDLA 1D9AA 2J7UA 2WONB 4JI3F 1LXNA 2O1PA 5DDQC 2I2YA 4YB6A 2KHDA 3NMRA 1WEYA 1IKXA 2B4UA 3I5AA 2E5HA 4PXEA 5CH7B 4JI6F 4X62F 3OJUA 4ED5A 1LWEB 6FD1A 2DGSA 3QGGA 4HI1A 1RTIA 5K8PA 1VIOA 1SJ4P 4TKTA 2DH9A 2DNQA 1M0SA 4IQMA 4L6V3 4EYHB 3V4IA 3M6VA 1S77D 3TAQA 3OV7A 3AA8A 2CQGA 2GA7A 3F44A 3H40A 2VA2A 3SQGA 2ZH1A 2O5DA 3KLIB 4H4MA 4B9NA 4ZP6A 2MSTA 3G86A 2MQLA 3I6PA 5KG5A 3VAFA 1ZM2A 2UV8G 4F4KA 4A8MP 2Q6BA 2GHPA 3W3SA 1NJIT 1U4BA 5CCLA 2B4PA 1ZPWX 2V4JA 4C8OA 1DQ9A 1LWCB 1DTTB 3FJ2A 3T3FA 1YRTA 4IFVA 1QVFR 4ED6A 4KGMA 3OSNA 3HK2A 2BW2A 5GAGU 3CMAS 2HWTA 2W4DA 5KG1A 2R2TA 2YX4A 1G6BA 3FFIB 5LT5A 3DYAB 4AQYF 4WFZA 4LF4F 1LWFA 1OQ3A 3KLEB 1HWIA 2U1AA 4DSEA 3PV8A 1CG2A 2AJFE 3SV4A 1ZAXA 5F9NA 5J2PB 3DI6B 2LDIA 2VPYB 3DM2A 3MEDA 4JI8F 1I94F 1HQUA 4G1PA 7FD1A 1N33F 2IM2A 2BV3A 2CRLA 3VR1A 2RQ4A 3I5CA 4WK1A 2MZRA 1C0TB 4CI0B 1SJ3P 2AW0A 1D9FA 2FLNA 5LSOA 4HDHA 5L1LA 4N41A 1L3SA 3NWGA 1XERA 2FLLA 3B4MA 3HHLA 3G6VA 1P27B 2L41A 1NK4A 3I0SA 3V6KA 2DIVA 2MB0B 2BYCA 1IKWA 1YIJS 5CA5A 4DX8H 3BGRB 3B78A 5F0WA 2JRSA 5CYQA 1WHWA 4B02A 1R6YA 1H98A 3CJ5A 3HHLC 3PEHA 5E41A 2DO0A 3IAS9 4RNFA 4B08A 3CPWR 1RA6A 4DSLA 4XDDA 4OI4A 4RW8B 2J9CA 3IWLA 1CQNA 3MPWA 3PKYA 4CT8A 3RZAA 2KH9A 4GC7A 2Y1IA 2HHQA 2HHSA 2OTLS 4RUHA 1JLBB 1VQYA 1MU2A 4NLPA 5CYJA 2EBEA 1F2GA 1FNMA 3IN5A 3N28A 4Y28C 1SIWB 2VODA 1WG1A 4ZS6A 2OSQA 4OJ1A 4QR0A 3HHDA 4J9KA 1RI7A 3CD6S 3QMQA 2HHWA 1GT8A 1N34F 2IC3B 3EXYA 4IRKA 3VZIA 1OSCA 2CZ4A 2VBZA 2YNFA 4URGA 4NLYA 1RGVA 2ADCA 5DM6Q 1ULRA 2KXHA 1FD8A 2MZJA 3Q23A 3PW4A 4NLTA 4Q7AA 3VZHA 4V19X 3FNNA 4XDCA 1Q7YT 1IKVB 1GXUA 3VAHA 1N36F 2OIHA 3OTOF 5A8WB 2DITA 1OSDA 2GO8A 4QU7A 3RB0A 1DRZA 3AA9A 3HXMA 2BRLA 1HHSA 4ZPVR 2HPUA 3UI3A 3DLKA 2I0XA 1TKTA 4DR2F 1M5OC 2GIRA 3R5BA 3C6TA 3KK2A 2J9EA 2RNEA 4XIUA 3T5JA 3DRSB 2JFKA 3PXGa 3KJVA 1SB6A 4FZVA 2ZJRQ 4UY8T 3FZBA 3SI8A 1S1XB 3L7OA 2FJDB 1N52B 4IH5A 1TV6B 1RT6A 2H9ZA 5EHHA 2CPHA 3QYYA 1T8EA 2ZH6A 4ILRA 1HNIB 4YB7A 1RK8A 3J7YU 4NA3A 2QT7A 3ENWA 3ENQA 1LW0B 2JFDA 3LW5C 1RP5A 5KFIA 4RNOA 4OHYA 4O3PA 5C25A 1VQ5S 3MTJA 2R2UA 3TI0A 2MZ1A 2HG4A 1UVLA 1VQOS 4J9NA 4DV0F 5HLFB 4X4NA 2K3KA 4ZMMA 3CCJS 1FJ7A 4MAKA 1KC8T 2P9GA