1ROFA

Nmr study of 4fe-4s ferredoxin of thermatoga maritima
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
60
structure length
60
Chain Sequence
MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title An NMR-derived model for the solution structure of oxidized Thermotoga maritima 1[Fe4-S4] ferredoxin.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Electron transport
total genus 3
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rofA00
2XSJA 1BD6A 1H7WA 2FJDB 1FRKA 3OR2B 4RKUC 1GTEA 2WSFC 3EXYA 4XK8C 3MMBA 1JNRB 4KT0C 2XSJB 5BYQA 1GAOA 1AXQA 1DURA 3OR1A 1F5BA 2C42A 2O01C 2WSEC 3LW5C 2V4JB 3MM6B 6FD1A 3MMBB 1SJ1A 3IR7B 1Y5NB 3OR1B 2PA8D 1FTCA 2VPYB 3C8YA 2FJBB 1BQXA 5CHCB 3MM8A 2VPZB 1KEKA 3EUNA 2C3YA 1JB0C 1B0PA 2PMZD 1G3OA 1FEHA 2V4JA 1IQZA 3MM6A 7FD1A 1FRJA 3MM8B 1A6LA 1R27B 2VPWB 1BLUA 5CH7B 4CI0B 1F5CA 1XERA 1FRLA 1K0TA 1FCAA 1FDDA 1FRMA 1D3WA 2WAQD 1FRIA 1WTFA 3MM5B 1C4CA 1ROFA 1PC5A 5BYSA 1KQGB 3IR6B 1DFDA 4DHVA 3PNIA 4Y28C 3MMAA 3MM9A 2Y0SD 4ID8A 5L8RC 1GT8A 1F2GA 2C3PA 1FERA 1HFEL 1B0VA 1G6BA 2WSCC 3EGWB 1C4AA 2C3OA 3MMAB 2Z8QA 3MM9B 2WB1D 1DAXA 1RGVA 6FDRA 3MM5A 1SIZA 1BC6A 1BWEA 3HKZD 4OV1A 1Y5LB 4OMFG 2FD2A 2FGOA 2GMJA 4YDDB 2VKRA 5FD1A 2UZAA 2V2KA 3MM7A 1FRXA 1VJWA 1FDAA 3GYXB 1CLFA 1FRHA 1FXDA 1FD2A 2FJEB 1SIWB 1Q16B 1FXRA 1H7XA 1IR0A 1FDNA 3MM7B 5E7OB 2C3UA 4XDDA 1H0HB 3MMCA 5BYRA 3IR5B 2ZVSA 2C3MA 1PC4A 1B0TA 7FDRA 2VPXB 2FDNA 1Y5IB 2FJAB 4AYBD 3MMCB 1H98A 2IVFB 1JNZB 1Y4ZB 1FDBA 3OR2A 1FF2A 2PDAA 4XDCA 1KQFB 4L6V3 2GMHA 1GTHA
chains in the Genus database with same CATH superfamily
4Q8FA 4Q7AA 2RSQA 3QGIA 4KIAA 3MR7A 4LQ3A 4CNZA 2O01C 2R2UA 4K50A 1YRUA 2P8IA 1WG4A 4NMXA 3FK4A 1T95A 2DVIA 4DQQA 4ZVPB 3P49B 1FRIA 5A8KB 2RE1A 5HMZA 4PXBA 3Q8SB 4P2MA 3DLEA 5AXMA 3H2VE 4KGZB 3IP0A 1RT4B 3AD7C 1Y0HA 3O1LA 4USUA 3SEOA 2XBPA 4B9NA 1U8SA 4OX9F 3C15B 2CXEA 4FZVA 1U25A 2RH3A 4OLPA 4AYBD 3BGOP 3W9JA 1LNQA 2FVRA 4EUVA 5ETTA 3MUTP 2E5LF 4J9QA 1EJ7L 2V68A 3ULHA 4ZP6A 1TKTB 2APOA 2G4BA 3T5KA 1RLCL 3LALA 5GAEU 3KUGA 4DUYJ 2Y1LB 1NDCA 4JV5F 3OTEA 3VAMA 4X62F 1Y3KA 3M1VB 3BKFA 3ILLA 1BXNA 3BR9A 1Q0NA 4OYWA 2RDIA 3UCZP 3FBBA 4QOTA 1Y9OA 5CH7B 1F5CA 2E1PA 3NGDA 4JI3J 2HNDB 2OO4A 2E5JA 3N0VA 4NLDA 1X5OA 2UVRA 5E0OA 2C2EA 2DH8A 1YJVA 4ECZA 4C8ZA 2AX0A 3GZ7A 2F8EX 1NSKL 1GMWA 2CQPA 2F65A 2FVCA 2QO3A 1FXLA 2DGUA 3V4IB 4TU7A 4JI7J 1RTIB 3RBDA 1Q8KA 4O23A 5HLFA 2EFGA 4B3OB 3DFEA 2CNOB 4OZLA 2AGQA 3CGIA 3I96A 2IA6A 2DNPA 1S97A 4LF5F 4NA2A 3SDEB 3RG6A 4HT5A 3TRGA 5HJYA 4LRCA 1X9MA 1JLCB 1ZAWA 2W24A 1FKOB 3G4SS 5CCLA 2WOMB 3GSIA 1NH7A 2AWZA 4YB6A 3C6TB 5D3GB 1ZA2B 3SIPB 4ZMMA 1CQMA 1LV5A 1S6PA 4Y2AA 4OIXA 2V9WA 1WG5A 2DNHA 1AROP 1E6VB 2MZRA 4F4AA 1XR7A 4OQJA 2HEKA 3CE8A 4MK8A 3FBEA 3ZZOA 4RR5A 4ZN3A 2VU5A 4OV6A 4FP9A 4DV6J 1IM6A 2VQEF 3VF0B 4C98A 3S1TA 1E6YB 2HVEA 2I5JA 2CKWA 3W66A 2R4FA 3D28A 1WI8A 3FFIB 3CF5Q 3KG4A 1S7HA 3KKFA 1SKWA 3PZPA 5A8RB 3VAIA 3KDOA 1SI9A 3B4DA 5ETKA 3IN5A 4IH5A 2GMHA 5H9EJ 1UTAA 2HGNA 4OJ3A 4NZ6A 1TAUA 1OS5A 2BOAA 2VIHA 1NJXA 1LWEB 2MLZA 3KNGA 1BQNB 3TW0A 1NSAA 4YHHF 1AA1B 4UUWA 3E8OA 1QAIA 4ECVA 2HFNA 1CG2A 3MCOA 2W4DA 5I3UA 3ENWA 3CO9A 3VVTA 3KLIB 5T7LA 3D0IE 2GQ2A 1D3WA 3OSNA 3I5AA 5JMNA 2HFSA 1KD1T 1F2GA 2XYHB 3MR2A 2D9OA 2VZ9A 1PCAA 2XMWA 3IWNC 2UUTA 2KH9A 2DYAA 5IC6B 2J9CA 1Q1KA 4I56A 2ZUAA 2Z2ZA 1ZZNA 3NMAA 4YR2A 1KP6A 2JJ4D 2ILZA 1YZ7A 2RVJA 1RHUB 2RU3A 2AGPA 4FYDA 4DCJB 4OHWA 3M2VA 2G1HA 4USHA 1EP4A 3AOAA 2L41A 4DN9A 4I67A 1JLFB 5JXSA 2DHAA 3GFZA 2HHPA 3IR7B 2EXUA 5GADI 5F8HA 2JEFA 2ZWPA 1SJ4P 3IA0A 1P1TA 1HW8A 2VF3A 4CI0B 1WF1A 2AJFE 3J81j 2AJQA 3MXHP 1MU2A 3IAM9 3OXFA 4B3RJ 3TZYA 2CJQA 3OVBA 2QMXA 1G4CA 2COLA 1RT2A 4DG1B 1XNQJ 2R3VA 1KDNA 4KRWA 4ENOA 4MTPA 2W7AA 3NNAA 2BV3A 2DPIA 1DZ5A 1UVNA 1S0VA 4ZP9A 4XAKA 3MECB 2F7VA 2QFIA 1MROA 1JK9B 1WC6A 5AE1A 2UUCF 3R27A 3A8JA 3BF4A 1NJWA 2VC1A 4AT1B 3AJDA 4DPOA 1N5SA 4HT7A 1F1BB 1F3VA 3KXDA 2A2DA 1GTEA 3MR3A 3VQSA 3QIPB 2ZBPA 4K4YA 1GAOA 3H4BA 2QMUB 2HYIB 2LCWA 3KLHA 4Y0FA 3QO9B 4B9VA 3MTKA 1C0TA 2P6TA 3Q24A 4DV1F 1IKWA 5HSPA 3EWGA 1KWMA 5L1LA 4PG6A 1UEVA 1PYSB 2KRBA 1VBZA 2R7UA 1JJ2R 2NSCA 2J0QD 5C24A 2YWWA 2XCAA 3PR5B 4RW7A 2PIIA 2VBXA 1OY6A 1JLAA 4X62J 6FDRA 1T9XA 1A0OB 5AE2A 1EETA 2KI2A 2UZAA 2YKPA 2RRBA 4CDIA 2M4MA 1CLFA 4ILMA 4KHPF 2BM1A 3C3LA 1SC1B 1PG5B 5GADU 2J6TA 5KTQA 2DNRA 3Q8UA 4RBUA 4LR8A 5DM6Q 3QWUA 3J7A1 3PEJA 4J9UE 3HX9A 3DMJB 1FK9A 4J9LA 2YTCA 2FHMA 4H4KC 2HQIA 1NK7A 9RUBA 3GQCA 1ZAXA 1QSYA 4CT9A 5HMYA 1TZ0A 3P96A 2D9PA 3GIMA 3O2IA 4WZMA 1IQZA 3MCMA 3DLHA 4DEZA 2B3TB 2BX6A 4DQIA 5KFCA 4ECYA 2WK4A 3RW7A 2C2OB 1QE1A 3TR5A 1HNIB 3DNCA 4LF6J 4WFYA 5HROB 1TV6B 5DGBA 1X4FA 1N48A 2LYVA 2ILYA 4O3QA 3MFHA 3QMQA 3KK2A 2RT3A 3SFUA 4PQAA 3N01A 2QZ8A 1D1UA 4CO0A 4FVMA 2MKJA 1S1UB 1R0CB 2CJYB 1A9NB 5M2RA 4HVZA 3R5CA 2IC3B 4L72B 4ECQA 1HIYA 5L38A 1YJNS 3R2CJ 1RA7A 2IIHA 2CIMA 3MCSA 1TTHB 2QX0A 2RUGA 3EGNA 2HHTA 3UR0A 4CT8A 4ED1A 2V8DA 2DR8A 2L9NA 3NBPA 3KFWX 3GP9A 2QA1A 4OYIA 2WVBA 2LDYA 1UVIA 2GX8A 2N82B 3OVAA 4ZVQB 1RWKB 3DU5A 4B3TF 3ZTPA 2KVIA 2AZ1A 2JC1A 4X66F 2GV1A 3MURP 4B3SJ 4H4OB 2JLEA 1VK8A 2EBGA 4PPZA 2CZVC 1NKBA 2B9EA 2I5JB 2E9ZA 1H6KX 2R2SA 1LXNA 4YS2A 2EG1A 2PI5A 3QFWA 4UOFA 1GX6A 2W4PA 4DSKA 4EU0A 4XDDA 2FZGB 4ES3A 4K4WA 5B0FA 2D41A 3S7RA 4C0HA 4NZ7A 1MWYA 2OP5A 4ETXA 2HWIA 2CPYA 3PYEA 1NHKL 1M5SA 1HBMB 3DRXA 2HNYA 3NWGA 3PIOQ 4WK1A 4TU9A 2IPOB 4YP3A 3OBIA 5DJBA 1RDRA 3JSBA 2K7JA 4MYTA 1UWBB 4B9MA 3H8YA 3SMZA 1HHTP 1FRLA 4NYOA 4GO5X 4QYZJ 5C2GA 1ICEB 3PNIA 1X4AA 1ZAVA 1N5TA 2J0SD 1WC1A 2DNOA 3TA0A 4PG5A 1RGVA 1YSJA 3KLEA 1L3TA 2ZZNA 4RNMA 2HFUA 4B08A 4GC7A 1J5OA 2MB0B 4ZLPA 2RMLA 3G8SA 4IG3A 1KS2A 4MMOA 3M2VB 2QA4S 1RISA 3Q2TC 4WP3A 2DNNA 2UXBF 1S4EA 5DQHA 3U7JA 3GCXP 2OH2A 1WKKA 3TZWA 4WXWA 3G87A 3MOZA 3R6GB 2WW8A 1R8CA 2R2TA 1DTTA 1U1QA 1TK8A 2B8PA 3B8HA 4NCGA 4RUCA 2ATLA 2OSRA 3N5FA 1GX5A 5F9LA 4QU7A 2XHWA 2GFFA 2H5EA 4CLSA 3V6DA 3UCGA 4X4NA 5D8HB 2UUCJ 1MU2B 2KXFA 2HLTA 4Q5VA 3MDFA 1RT2B 3NRBA 4BBYA 1XERA 1FCAA 3CUNA 4PWWA 2I2YA 2HGMA 1ZTTA 4HACA 2DR7A 2KFNA 3QJJA 1IKXB 4F4YA 4C4WA 1RKJA 1B64A 3EGWB 1K8AT 3VV2B 3BQ2A 1RT3A 1NK5A 1SC4B 3LUYA 2UVVA 2BQUA 1MROB 4DR3F 2YWGA 3Q8PB 1M90T 4BLGA 4ZPVR 1NPRA 2RF2B 3FRZA 4J9MA 1RADB 3T9ZA 2C3MA 3BR8A 2LA6A 7FDRA 2W7OA 3AA9A 2DNQA 4K4VA 5K9FA 5K14A 5A2QU 3M8PB 1H74A 2LP4A 2BKNA 4HDHA 1S57A 2DBBA 1QM9A 1C0TB 3FBCA 4C0BA 2A1BA 3DLGA 2EEYA 2IJRA 3W64A 4QQBA 1NDPA 3QT5A 1I6JA 4KHPJ 3M8QB 3FCVA 2HAFA 3M7VA 1T05B 3SQGA 4GKJF 2CRLA 4E8UA 2CA9A 3UQSA 4RLEA 5KG7A 5IM0A 2Q66A 1I94F 4IQXA 4RW7B 1KVJA 3W60A 1B0PA 5D4OA 3Q0AA 1JLAB 3HSZA 2YNIA 3WC2A 4M8LA 4Q2LA 3W5XA 5DQGA 1L3VA 1EETB 1KOOA 3SFGA 4ID8A 1HFEL 4EO6A 4P7VA 4TLQA 1SV5A 2VDIA 1TL4A 2G1DA 2OAUA 4ED5A 4LR7A 4O3RA 3N6NA 3BEGB 2R7RA 4F7VA 3Q8QB 4PXCA 4R5PB 2W8LA 1FK9B 4HTIA 1ULRA 2H54B 4ITSA 2OTJS 2CQIA 1NAQA 1RAHB 2X7IA 4EGLA 4F4ZA 4CYUB 2OPSA 2XI3A 3RJMB 1H3DA 1EAYC 2ZDPA 3P4UB 2B9XA 3KK1A 2RS2A 3MMBA 2E7VA 4CO5A 2NXCA 1V5VA 4M95A 2DIVA 1M1KT 3LA0A 4AL7A 1QE1B 2V50A 3FQLA 2E5HA 2QN6B 3MEGB 5AXNA 2XO6A 3OXGA 3W8PA 1S72S 4USVA 2VG7A 4FYVB 2Q6BA 2ZBQA 3I0SA 5LT5A 5J1PA 4MKAA 3KK2B 5GAGI 4J9PA 4B9LA 3DKDA 2A18A 5FLXU 3R6LB 4F04B 2IM0A 4V1Ak 2R7SA 4MH8A 4DL7A 2CWKA 2FGOA 2QE5A 2ROPA 5HQLA 4KV8A 3D9BA 1Q16B 1BQMA 4ANEA 1P8GA 4OYBA 3RRGA 4XO0A 2PMHA 4ANCA 4DV3F 4ILRA 2PD1A 3NAHA 2ZJRQ 2BKPA 4HH1A 4HHJA 1ZS6A 1R89A 1NZAA 4N8OA 1N6QA 1HR0F 3THTA 2UUAJ 3CCUS 1Z4UA 1FD8A 3ONQA 2JOQA 2QV6A 1JMTA 3TUJC 3K0JA 2XMUA 4P73A 1LWFA 3BKUA 1KQSR 4UQTA 2XLIA 4CLTA 1HBNB 2VOPA 2EK6A 2HK2A 2E66A 2LQ8A 2XEXA 2HS3A 3JTPA 2DJWA 3MM8B 2HHWA 4X84A 3ZNJ1 4NLXA 3FEZA 3VHQA 3R1LA 3Q22A 4L74A 4URQU 1OSDA 4ELVA 4DR6F 2B4OA 5IFMA 3OT9A 3TNVA 4G1QA 2R7WA 1C4AA 3NCPA 3BSNA 4ES1A 4YY3F 4K2XA 3LWMA 2EW9A 1TL7A 5HP1B 1XMOF 3SBMA 1FKAF 3HHLB 2GAHC 3E2EA 3BH7B 1VGYA 3EICA 4ICLA 1UCNA 5A8WB 4DUZF 1JKHA 1LXJA 3ET6B 1UJ4A 2ASDA 2FJXA 4HDGA 4ZCLA 4NWBA 2CYYA 2ZOMA 2PN6A 3GJQB 2V34A 3FCHA 4CQ1A 4K0KF 1HW9A 4QPTA 5H9FJ 2AU0A 3EXCX 3PJWA 5LXYA 3KLFA 3JS9A 2DGXA 3JQJA 2XGQA 4FF4A 1Y7PA 2J9EA 3TARA 3MEDA 2MQMA 3MGJA 2R7XA 1J5OB 4IG3B 3IWXA 2PGCA 2IM1A 4EI2A 2M3DA 4NEYA 3K89A 2HKEA 4ZPTR 1Q95G 3B4MA 2EKNA 4KGXB 2PMWA 3P6YC 5KFDA 4DR2F 1RAAB 2D3ZA 1FKPB 3M8RA 4KAIA 3UNGC 2YNHA 4GKKF 4I6YA 2JWNA 1H2UX 3RTVA 1OO0B 3NEKA 2YKAA 2QGFB 1V5IB 1GEHA 3GONA 1WUUA 4JI2F 4NCGB 2W7PA 4OX6A 4RW4B 1TKDA 1N5VA 1NHVA 2BVZA 5CA5A 4LF1A 1NHUA 2F4FA 1GMVA 1Q7LB 2QTWA 4DR3J 4C8OA 3NLCA 4DZ6A 4HHHA 3I82A 2NUHA 4L73A 4RUBA 2ZNZA 2UUBF 5DDPC 2DY9A 2IDEA 3CTRA 1NU4A 3OJSA 2AEJA 2KFYA 2CPZA 3PW4A 3ISZA 1O0PA 5K5MA 2XWYA 3HFZB 4WBFA 8RUCA 2K1RA 4AE5A 3I9V9 3E51A 3G82B 5ETRA 3N28A 1FJGJ 3JQMA 3PW2A 1UA0A 1CULA 3RU0A 2P2CB 2FD2A 4QIEA 1OYDA 1RAGB 3ZNUA 1KC8T 5F8NA 5KG3A 1Q82T 5AXLA 4MIAA 5D78A 4B17A 2VOOA 1VQLS 3GR0A 1X4GA 3H0PA 1BE4A 1PC4A 3AJ2A 2Z2YB 2VPXB 3M9OB 3HHLD 3DLGB 4DL5A 2OUGA 9ATCB 1RABB 2A0FB 4KFBA 5HN0A 5D15A 3O8WA 3SQGB 1RT1B 3CXCR 1FESA 2X3DA 5IT9U 1RYRA 1OSCA 2CJ9A 5IM0B 1DLOA 2VH7A 3ZTSA 1YLXA 2B7BB 2KTQA 2CG4A 2PA8D 2UV8G 4ZJOA 2M88A 1Q53A 2J7WA 2XLJA 1T94A 1XMQJ 2YKMA 1RHJB 4DR7F 1G3OA 4CP5A 1KRPA 5IQ6A 1VHFA 1S99A 1VRTB 1UFKA 1Q86T 2FHJD 4ZIVA 2J8AA 1UW9A 3D1HA 3HFVA 3QRPA 3G6VA 3CCTA 2FGCA 1RBAA 1GT8A 2KM8C 3P8BB 2WSCC 3SZ2A 4QIGA 1F9FA 2BJ7A 1W26A 2WB1D 4URSA 5K8PA 3TAMA 4OMFG 5KFPA 1X60A 2IDLA 5RUBA 4NCAA 3BSCA 3EVWA 2OPSB 2D74B 1S4FA 2IY5B 4ED8A 3C2PA 1U0HA 4CM0A 1FJEB 2GO9A 3N79A 3POTA 2HMIA 3KK1B 4Z7YA 2XZWA 4LREA 4UT4A 4PZVA 1WC3A 2XLKA 1N0VC 2MSTA 2FC8A 4YR0A 3VAKA 4LIWA 4ZKAA 2CWXA 1N5YA 1YRTA 2IFXA 2G9OA 3LP0B 3D66A 4KJIA 3PFOA 4DV3J 1WG1A 3I0SB 4WYWA 5HMWA 2MPUA 4Y2CA 4TQSA 3L09A 1U2CA 4X4SA 4K59A 3QAUA 1TAQA 2YVSA 3IGNA 1UP1A 1OY8A 3CCZA 3C16A 3OPKA 1NZ8A 2HQGA 3RAQA 2ACYA 2H5JB 2LLZA 1BWVA 4J37A 4UQGA 2MZSA 3OTOF 1S6UA 3TYTA 4OZ1A 4J90A 4WP8A 4LF9J 4UOHA 4X4TA 4YN3B 4OYMA 1TFYA 2QG9B 2J9DA 2F8MA 4G6VB 2G13A 1Q5YA 2R42A 2ZZTA 5J1EB 4CO2A 1TL3B 2F4VJ 2RS8A 2EFOA 2XULA 3H90A 1NKCA 2ZH1A 1H2TZ 3HSGA 2BJ8A 3M9MB 1EZZB 2MQLA 3QIDA 5DS7A 3ZZRA 1B99A 2XY5A 1RBLA 3TQ1A 1HMVA 3C6UA 2VJVA 3QGGA 4KE5A 1GXLA 4O3OA 3JSMA 1ZM9A 2HPUA 1FEHA 3AB2B 1YG0A 2F5GA 3R5JB 2UU9F 4FNHA 1PSDA 1Q8BA 4LVOP 3H42A 2MQNA 1NLKL 1S6QA 1TL7B 3ZC4A 4W90B 4U7CA 3CD7A 4WFBQ 2B5JA 2IBOA 3VCDA 2XO7A 1K73T 4QW8A 2ZE2A 1TKZA 4EZ9A 4TLRA 2UUWA 2HZAA 1IR0A 4YDXA 4U8VA 3CJ3A 4IR9A 3VAGA 3IS9B 1M5HA 1S9FA 4CLPA 3V81A 4DQSA 2JEIA 4DV5J 2CADA 3OW2R 2CQGA 4MK7A 1Q8IA 4F26A 4DV7F 1YI2S 2LMIA 2ASLA 2HRUA 2FYXA 2N4DA 4RW9A 3VAJA 3KLFB 2M5YA 4QWAA 3K5LA 3PR4A 1SJ1A 4DR2J 1VLOA 2UXCF 1LEOA 5C5JA 4I2PA 4JI8J 1UA1A 4LFCJ 1MLAA 4OYAA 5IXUA 4DPWA 7FD1A 1IVZA 4ECUA 1HA1A 3M6XA 1SPBP 4C3MA 2DGTA 4ZHRA 2Y1JA 4FKXA 3MMAA 4DPTA 5LJ5Y 1JJHA 2HIQA 1L3KA 1JIHA 2JNJA 4ZCKA 4IH7A 2UUBJ 1PIEA 2YNHB 4X65F 4L76A 3MM7A 3HDSA 3R5GA 4X4OA 4CCHA 1JJCB 4CNYA 4KC5A 3CJSA 1X5PA 4CO3A 2ZC3A 4UZCA 2D3O1 1FVQA 3UR3C 1ZPVA 3KLGB 3NG8A 1EQ0A 4GRSA 3A4TA 4LSNA 3DI6A 2XZTB 2BJ1A 4I2QA 3AXKA 2RNEA 4LF8J 2V5HG 1HNVA 4ERDA 5CXTA 4OLOA 5HQ8A 5DDQC 2K1RB 3SQOP 3DYAA 1DHMA 1YJRA 3DN9A 1RKIA 5B08A 4A46A 1KSPA 3TZXA 4F3OA 3M9NB 3BGRB 1U0SA 1M1GA 3H20A 2Y1IA 4M63A 3W65A 1W25A 4DFJA 1DAXA 1RB0A 1S79A 3ZTRA 1SUQA 2K06A 2QLJB 3BQ1A 4DR7J 2X1FA 2ZD1B 1LK7A 1VIXA 3D4JA 2DRAA 4F2RA 2MDAA 1R8BA 3UD4P 2GIFA 1R0BG 3IBCB 1IKVB 4UW2A 1VQ5S 1DLOB 3MAHA 1OQ3A 2XC9A 4FS1A 4RPFA 4B3MJ 3EXYA 3CCMS 2KXHA 3MAQA 5E2QA 2NXEA 2YKMB 2Q3PA 4RBTA 4OYZA 2GA7A 4OZNA 3QAEA 1NO8A 4DZDA 1JB0C 4HR2A 3DOKA 3OFHA 2GCFA 4J5OA 1NDKA 4K8RA 4ZIWA 2JHEA 3MAAA 4EBCA 4WCEQ 3TAMB 3TWZA 3EZ5A 4ZPDA 4YUDA 3CJ5A 4PXEA 3PRDA 2BANB 2OFHX 2KM8B 2A10A 1KHVA 2DHXA 4LFBJ 3IMQJ 1Q5VA 3H5YA 4FPIA 1U0HB 1MNEA 3POTB 5IS2A 1FNXH 2VFUA 5AT1B 1YJWS 2JX2A 2QL7B 2W9BB 5L39A 4HH0A 2ZH2A 3I0RB 1O6XA 3A8KA 2EPIA 3QSIA 4MK9A 3MWBA 2VV5A 4RNFA 1H98A 2KT3A 3OTOJ 5C7PA 4ETZA 3PO5A 3DGVA 4OI1A 1SQFA 2WTFA 1W2IA 1LKZA 2OHDA 3M8WA 2AYGA 3VZHA 5GVQA 4QIWD 4RUHA 1JXVA 1LW0A 1IBKF 4CTAB 1S76D 1BQXA 1GFWB 3HP6A 2K3KA 4DPUA 4KBIA 2PSZA 4ECTA 4NE9C 4DOZA 1SH0A 4U95A 1DTQB 5IZHA 3CB4A 1YGYA 2HS4A 1U1RA 3G6YA 3FSIA 4I7FA 3RB3A 1R6YA 3EVOA 3ZZPA 3A3PB 5KFIA 5L1KA 1IN0A 2E7XA 1N36J 4DX5A 5LMUJ 3CCWA 3T5HA 4NXMF 1U1KA 1SIZA 1OY9A 4A48A 1JX4A 1NEEA 1X8DA 4OI3A 1FI4A 4C11B 3OXLA 1S0MA 1NUEA 2RILA 3JYTA 4ZPWR 2O1PA 5KFKA 4OYPA 1U49A 4LRBA 2LXUA 3LWLA 3KHRA 2L9DA 3C6UB 2ROEA 1H7WA 4N56A 2ZBRA 1SXLA 1UPPA 4FYXB 4FXDA 2AEMA 2KU7A 3JSMB 3WHIA 3BQ0A 1UEKA 2YKOA 2IYIA 2FHOB 3TVZA 5E5NA 5CHCB 3IM9A 3KJNB 2YX1A 4HLBA 1U45A 1SL1A 2MLYA 4NA1A 5A8KA 3R97A 2KDOA 2B5JB 1R8AA 2Z0GA 1ROFA 3CC7S 1WI6A 2ZJPQ 4YOEA 2F3JA 2MGZA 1RWUA 2BACA 5F3TA 1XTZA 4NLTA 3BV8A 1Y5LB 4R8UA 1ACMB 3UDLA 2KJWA 2VB6A 2DCLA 5EHHA 2WRMA 4HEA9 1HBUA 1KVKA 3W5ZA 1G1XA 2DRDA 1NXIA 3LQVA 4J9KA 1PYOB 3J7AN 2PDAA 4KGMA 3TP2A 1P9QC 5H9FK 4ECWA 3R7NB 4X65J 4I2PB 4XK8C 3M1VA 1KOHA 3SYZA 3QSYB 2PC6A 2W4CA 2GC8A 4OZ2A 5GMDA 2OELA 2IVMA 1VC0A 1LWXA 3SCLE 5M2PA 5KG6A 2XYPB 3BBCA 2ROGA 1YBAA 4ZHRB 1TL1A 4FXWA 2HNDA 3FQKA 3NAIA 2VONA 3T6JA 4USWA 4F4XA 4JV0A 3H98A 1PGZA 4DUYF 3FZ2A 1WD6A 4P71A 3M8SA 1J5EF 4N5SA 1SQEA 3IC1A 5HVGA 4FVCA 2E5IA 3F0NA 3J7ZT 3V4IA 2DNGA 1M5PC 4YDDB 3JXOA 3ITHB 3RBEA 4JI3F 4JI1J 2AW0A 4B3OA 4WE1B 3EZUA 2FC9A 4TKTA 3M8ZA 5ETPA 1XNRF 2PEBA 5F0WA 2C2ZB 1JLCA 3PHTA 1U6ZA 1FKOA 2HQ3A 1CEZA 4JI7F 3A8EA 2EKYA 2JFKA 2WOMA 3V6KA 3C6TA 5D3GA 1VRUA 2VPYB 5K20B 2BDPA 1FHTA 1CSJA 4IFVA 5SUHA 4M5LA 5LSOA 3B54A 2VPWB 3T6BA 2C2MB 4Y2KA 1TMMA 1C4CA 4CM2A 2W9AA 5BXIA 4UY8T 1SUQB 3ETOA 1M1HA 4F50A 2HBQB 1RT7B 1G6BA 5ETQA 3Q86A 3MZIA 2VG6B 5HMXA 1X5SA 2QJ3A 5IWAJ 1E6YA 3BH6B 1F6TA 4WXOA 3IRXA 2MQQA 3T1YF 3DOLA 3CCRS 7AT1B 1H0HB 5A0YB 3L3CA 4WYLA 5A8RA 1XN9A 3RW6A 4OZJA 2ZM6J 4DV6F 4JI0J 3OR2B 2FHKA 4DCOB 4ZJLA 3QT7A 5KFYA 4RJVA 4PRFA 1BQNA 2DGVA 2HAIA 2D3OR 2BE7D 5LJ3Y 3DLLQ 4A8MP 2DHHA 1QJHA 3OL6A 3G9CA 3T9NA 1FJCA 1DRZA 1MWZA 3CJ0A 3I9ZA 3LAKA 2C2NA 4DV0J 1RAEB 2K8GA 4KO0A 5KAKA 1FE4A 1WF2A 2E1AA 4X4RA 1HHSA 3L7PA 2XNQA 4YFUA 2F9JA 4NLWA 4J7CA 4ED7A 1OQ6A 4USKA 3GYNA 3EPGA 2WHOA 4P2SA 3DLJA 1RLDA 2BW2A 2FY1A 2PEHA 4YB1P 2DEJA 3E01B 2KHDA 1U26A 1ZM2A 2HHSA 2KL8A 2DK2A 1JLFA 4TQRA 1LW0B 3MCNA 3GIRA 2HHXA 1CJTB 2PT0A 1Q78A 3DRPA 3HI9A 1VOMA 4OHVA 5HAOA 1WEZA 3GYGA 2ZVIA 1Y10A 3G96A 3UNYA 5HO4A 4I7FB 2YNGB 1YVFA 2RKIA 3BM7A 2JFDA 2DHGA 1XK8A 3A13A 5L1IA 2XMTA 1N32J 4DG1A 2YPZA 2NUUG 1FX2A 3TO8A 4PXDA 4O3NA 5J2NB 3UE2A 2E1CA 4LT6A 2W2OP 3SSSA 4UZBA 3JYTB 4JBCA 2FUG9 1KR4A 1GMUA 3W3SA 1NRKA 3DLBA 3V6JA 1WC4A 3F44A 3D7SB 3WIUA 2HWHA 2CQBA 4B3RF 2VG5B 5L9NA 4LF7J 4EZ6A 1Y5IB 4P74A 1XNQF 3MMCB 2CNLB 2LXFA 2C28A 4LIRA 2DIUA 3QIPA 1TUWA 1VLYA 4DI6A 4LSZB 2GGPA 1CVJA 2D1CA 1VIOA 3TJAA 4NLGA 4IFYA 4ID5B 3QO9A 1OYEA 3I6PA 4F3MA 4IRKA 1RHKB 3OR1B 2AYBA 5KFRA 3RYLA 1D9AA 3CD5A 5EWGA 3MPDA 3MOJB 4C3LA 3NGSA 1CJVB 2MGZB 1A6LA 4O3PA 2DHSA 3GPAA 2NXNA 3IM8A 3OFFA 4M5KA 4R8UB 1U1PA 4IRCA 1XQIA 2O66A 1IBLF 4PYAA 2JLGA 4KGKA 1UAWA 1HBUB 3RB4A 4CLUA 4OZ3A 3ZZZA 3NP5A 1FFWB 3DMJA 4NLYA 1TK5A 1PILA 2AV5A 3JB9k 4F8RA 1J5EJ 3CDAA 4F4KA 3K7RA 3AJ1A 1PBUA 1SJRA 2N3LA 4HL9A 3BO2A 5CQGA 4E98A 3LP2A 4I69A 1KONA 4O0NA 1TL1B 4NLVA 2LQJA 4DU7A 2I8EA 1S1TB 4MKBA 2XMKA 1L3SA 2J6UA 1XNRJ 4KPYA 5A2QY 1VR6A 4A47A 1HNIA 1T7PA 5EX3A 4WK3A 2V4RA 3BGLA 1K0TA 4DU8A 3BB5A 3THPA 2WAQD 5HROA 1NDLA 1TV6A 3KJVB 4MFBA 2HHUA 4W92B 1CS4B 3JAMU 2R2RA 1S1UA 3S01A 5F8LA 1ZBTA 1SQGA 1HQEA 3RAXA 2DNZA 2IC3A 1FXDA 3PVXA 4X2BA 5DO2A 3IG1A 4LF6F 1S59A 1KN6A 2CPJA 4IUFA 1QSSA 1P1LA 2QL9B 4G3IA 3PKYA 2RQKA 1VRUB 4E0DA 1RCOB 3T1YJ 2P9GA 4IFVB 1N52B 4IO1A 3T19A 3TQEA 2J8SA 4U96A 1UZHA 5L1JA 1RT5A 3HD1A 4MT1A 4JOUA 4EMDA 4H4OA 3O3LA 2K3IA 3HVTB 2RQCA 1QD1A 1S5ZA 3Q83A 2HG4A 5L9XA 2OLWA 3IRXB 3CIZA 4ED2A 3KG0A 3I4HX 1YKWA 4JV1A 3DOLB 2M8DB 3MUVP 3L9ZA 2POKA 4NLRA 4QPXA 3CEDA 1S49A 3HKZD 2XQCA 1HNXJ 3DRSA 3ZTOA 4LFAF 1H2VZ 1MN7A 2NYHA 2RQMA 4B3SF 1DBDA 3G6XA 1FVSA 1U4BA 1NNDA 3KMSA 3TJ9A 2ACMA 1HBMA 5FLXY 1JLBA 4P2XA 3BDEA 3PFEA 1D8ZA 2GJFA 2CVIA 3LW5C 1SJQA 3KUHA 5MAOA 2I38A 1UWBA 1BGXT 4ATNA 2FJVA 4KO0B 3HMJG 3EUNA 5ETNA 1VFJA 3PRBA 2ZHAA 4IOAQ 3CCVS 4P6QA 1U1OA 3U1MA 5L8RC 3N9UC 5E3AA 4AQYF 3HKWA 1SC3B 2HS0A 1Y11A 3GTYX 3DU6A 2ZEJA 4PQUB 4CLLA 2CZ9A 5GMKa 1CPZA 4I64A 2J0XA 2C3UA 3HZEA 2ZJQQ 4D3GA 3DRPB 3U27A 2BYCA 2DO4A 4LF4J 2B6AB 3DGPB 4I6AA 3MF5A 1ZETA 2XSFA 2XGPA 1HNWJ 2LEBA 1HBOB 2ZWOA 3PG9A 4BWJA 2FJDB 3BYRA 3K5NA 3FVYA 4RKUC 3KJQB 1KLMB 2GVZB 2X51A 1MMLA 2RKIB 1Z1ZA 5FJ4A 3THVA 4N7TA 1CQNA 5ITHA 3RRHA 1RHQB 1KTQA 1SJFA 4HHUA 4LUBA 5T41A 4QJVA 2RDJA 3FDSA 1JLQB 1S7IA 1IKXA 2JEJA 4USMA 3OUYA 2WBRA 5KFAA 3UN3A 1I51B 2N3OA 1U1MA 2AHOB 3O6QA 1AZSA 1NJZA 4DX7A 1B7YB 2CDRB 1Q79A 4ZDNA 1HI8A 2RF2A 4ILLA 4DV2F 4DXLA 3S8SA 3M8PA 2NQPA 3R9LA 4DR4J 4AFFA 2GGPB 4FKYA 3TANA 5KFZA 4IFYB 1IBLJ 1UEUA 4AL5A 3BN7A 4KHRA 5KFFA 3TUIC 4LBHA 1BD6A 3M8QA 4CLFA 1RJJA 1T05A 1DQAA 2BJEA 4I4BA 4XIUA 4K2JA 1GXUA 2NPFA 5D0EA 4M5DB 2IMWP 3W2VB 2P9CA 2QMWA 3C8YA 2FJBB 3DRRA 1AW0A 4C97A 3Q2SC 3QFHA 3UFCX 2Z2MA 3BSAA 4JI6J 2VFTA 1IBMJ 1AYEA 4KR0B 1YX2A 4LBPA 5F9NA 3MTJA 1YJ7A 4DF4A 1T11A 1Q8LA 5KFXA 3WX8A 2MQOA 1T3NA 2C2DA 3Q8RB 3RB6A 3W9IA 3MPWA 1RTHA 4R5PA 1FDAA 2ZUGA 1SIWB 1REVB 4NXNF 4ELUA 3NGUA 5KG2A 2UV8A 4CYUA 3EJMA 3LP2B 4CLKA 4K4UA 5I3QA 1J2VA 4QU6A 4Y3CA 2YPYA 4H4KA 1N88A 1U7LA 3GV5B 1AB8A 1WF0A 2XI2A 3PX0A 2MKSA 1WKJA 2XWXA 4KKOB 2M0GB 1RWWB 2CNKB 2N7CA 3AOBA 4N47A 5BR8F 4X4PA 3RR7A 2BR0A 3MEGA 1FTCA 2QL5B 5DG8A 3WZ0A 2KT5A 2W9CB 2VQFJ 3VQTA 3MI7X 3M32A 5SZTA 3P5BP 4MFBB 1WHYA 3MR5A 1URRA 4BS2A 3K8WA 8AT1B 2PO4A 1VS3A 4EO8A 3VZIA 1R7IA 2P6SA 2PFDA 5IT9Y 1AFIA 3UDCA 5HVHA 4JP8A 3AA8A 2CJXB 1HQEB 3DDNA 4IKAA 4XTTA 4CLZA 1U8WA 4ZLNA 3TVYA 3IG1B 1BC6A 4WIQA 4I6WA 3G71S 3KHGA 3IRWP 5F41A 2KVQE 4RNNA 4N41A 2AGOA 4K5RA 4ZVOB 2VDHA 1CBKA 1YIJS 3FSXA 3GILA 2DXFA 2CVEA 3D6HB 2OI2A 2B51A 3GJRB 4F36A 3CJ8A 1F60B 3FZBA 1RT5B 4DMZA 4KHMA 2WSFC 2XS2A 1JNRB 2ZOGA 5HATA 4ANDA 1HBNA 2ZKUA 4LFAJ 2ZH6A 4PG8A 2RHSB 2BKOA 2L3MA 1QDUB 2LVWA 3EDRB 5DDRC 3MM8A 2WBMA 1VHIA 1XEZA 2GZOA 2UUAF 1U6FA 2FPHX 2RUSA 4UY85 2OEMA 2W2PP 4NYZA 5F8IA 1N34J 3DRSB 2D69A 4CWBA 3HHLC 4H4MA 2R8IA 3MPUB 5HP1A 2HHVA 2OKQA 2B7CB 3K2YA 1FD2A 4RBVA 3NGTA 3HHLA 3I31A 1JLBB 1C1BA 4ZVHA 5A8WA 4RW6A 3TOQA 2FDNA 2GAGC 2V0NA 3ET6A 1KNZA 1VC6A 4AQYJ 5KOWA 1LQ9A 2UXDJ 2HBYB 4IRDA 1DY3A 4TXSA 4PUOB 2NZ4A 3PX6A 1QVFR 1F5BA 4QWCA 3UDEA 2ZH9A 3E3XA 2CPEA 2OEJA 2RAQA 4X64J 3J7YI 2OSQA 1WOPA 3HVRA 3UD3P 2FHJA 2DNYA 1WEYA 4DN0A 5D6GA 3SXLA 2BUNA 3JQKA 1PAEX 3NOCA 6AT1B 3R1HA 1RACB 3PYFA 3A1YG 4B9TA 1VQ4S 2WVDA 3UPFA 2YWHA 2BMBA 1W2BR 3PIPQ 5DZ6A 1VJQA 1D09B 1VBXA 2XMAA 2KYXA 1FKPA 2BE2A 2VBYA 3ILOA 4OI6A 1IBCB 3G8QA 2KHCA 3HHDA 1PJ6A 5C42A 2KT2A 5DRKA 3O5TB 1IUJA 4RW4A 1JNZB 3RBXA 5K8NA 3OTDA 2NLWA 4DLGA 1ZA1B 1VQNS 3M05A 4HI2A 3W1YC 4KTQA 4KYZA 4OYXA 1JXEA 1YWXA 3FMBA 1VYAA 4DV2J 4MJKA 1YQHA 5ETMA 5HJXA 4ALZA 2QSFA 1AUDA 3PRVA 3OUYB 4WFZA 2GIRA 2V4JA 2B9WA 4UUXA 1T9WA 3VGSA 3NNCA 1AZSB 3HM9A 3FMWA 2VFVA 2X1AA 3IR6B 1YDLA 3WIVA 2XCPA 3G82A 3QWPA 2FTRA 4WKRA 1GXTA 5CYQB 3MUMP 4OI4A 3T3FA 4OHXA 1B7FA 5KFLA 1T3OA 3MPVA 2XS5A 3GYXB 4DS4A 3V4MA 5IC4B 4FS2A 1VISA 2VBZA 2M9KA 4F0KA 4O4GA 4NCBA 1NB7A 2NXUA 4Y6IA 2XYGB 1K0VA 4KY3A 4QWBA 1UVJA 5KG4A 1RT1A 3DM2B 1FJGF 4V19J 4PG4A 1S0OA 3M2UB 4ZVGA 2QYGA 2FJWA 1S1WA 5KFSA 3DRRB 1HQ2A 2ZOFA 4JV2A 2XSJB 1MMDA 2MQPA 4NXNJ 1EIYB 1WDDA 2W25A 4K7QA 1ZOTA 3AY0A 4DV4J 1L5UA 3BREA 1RTJA 1VRTA 3QT6A 3H5XA 2SXLA 3NWRA 3X3UA 3FSYA 5CCMA 4ER8A 2BXJA 1RAJA 1RTHB 3UI3A 3ELHA 4LRDA 5THWA 2H5IB 5BR8J 2IM2A 4RU9A 1X4HA 4C8YA 1D8YA 5KT2A 5D0HA 1XMQF 1WACA 2HBRB 4O44A 4TVAB 3IGVA 4M5MA 1XC9A 4JYAJ 3R7SB 3DHWC 2OPQB 4EYIB 3U1LA 4GVBA 2LQBA 2I9SA 2GQQA 4ZVRB 4XPEA 2HFOA 1RWPB 2PA3A 1FX4A 4UTGA 4Q43A 5LOQA 4DBQA 2YKQA 4YB7A 3LP0A 3B6BA 2KKHA 2ASJA 3M32B 1X9WA 4DSEA 3OHBA 4DR5F 3LGMA 1SJ3P 4QR0A 3PACA 2E7WA 2ZKTA 2MZQA 5C2CA 3TX8A 1HNZJ 4IO9Q 3L95X 2R7VA 3M6VA 2LQ9A 1R27B 2BBEA 1MSWD 2G0IA 4M5IA 1VQPS 1QVGR 4P9SA 4ZCIA 2R9LA 1T9YA 1JLEA 4M5JA 2MLXA 1HPZB 4WFAQ 4JI5J 3Q89A 2QYCA 3GIJA 3Q23A 1UFWA 2FLLA 4OV1A 5K8OA 5KFTA 3NNHA 2H4YB 3R8YA 3J81U 3GJSB 1V9OA 1WDTA 1NH8A 5J1EA 1TL3A 3PM9A 3PDNA 1UVMA 5IT4A 5KT7A 3I32A 4FN5A 2C2RA 4OFZA 5EDWA 1RWNB 3NCQA 2GHPA 2KJVA 2W2NP 4LF9F 4L6V3 5EGYA 1S1VA 4I1TA 1X4CA 1N56A 3TX0A 1D9DA 4RWWA 1NK0A 2AMCB 4NX9A 4TYAA 2CJAA 4LQ9A 1JXLA 1RTDB 2JEGA 5D77A 2Q6CA 2F4VF 1QAJA 5HK4A 1JJ4A 2IBKA 2CDQA 1FRJA 4NYPA 4H4MB 2RD5C 2VKZG 1I5OB 3LANA 1T03B 5BJRA 2QIFA 1F9HA 1WHVA 4FF2A 1C1BB 4MKYA 1TFWA 5H9EK 1JLGA 5DG9A 2WONB 2RQ4A 2AP6A 4RW6B 4QIFA 3MD3A 3CCLS 2AT1B 5GAGU 2DR5A 3IS9A 2ZVSA 1B0TA 2XS7A 3DLKA 4C7QA 4Z37A 2V63A 4M94A 1HARA 1Y4ZB 1FDBA 3EX7B 4FYYB 4KH1B 4ECSA 2HHHJ 3W61A 2XMMA 2RIJA 1QUPA 4P52A 1T8EA 3CDUA 3CDEA 2XY6A 1V3ZA 2J0WA 2IRUA 1WNEA 1LFWA 2OD4A 3TI0A 3BZQA 3FEYB 1RAIB 1RWVB 3BPSP 4DV5F 2YWEA 3D67A 3GB0A 2OMOA 4DFPA 3WX4A 2G0CA 2HVIA 1SKSA 4ECXA 3NGRA 3CNQP 1RU2A 2N7YA 1X4EA 2B4UA 2ZH7A 4ZN1A 3OTBA 5LMNJ 4O4RA 3OSPA 2H3EB 3MM9B 3DOMB 4JI8F 4WJBA 2CPFA 3H59A 2BE2B 3LTOA 4LFCF 4NRTA 5FDLB 1V3RA 2EWHA 5CZVA 3I56S 2ZFHA 2NS1B 5C42B 2MZJA 3VR1A 4AUKA 2VFRA 3T5LA 3KK3A 4CH1A 1MW7A 1DARA 4KQZA 1Z2LA 5KFNA 3LPEA 3W63A 5KT4A 3T5JA 2LFVA 1LFPA 4LSLA 3OL9A 2AYEA 1WOSA 4NLQA 4MIWA 3NS6A 1YJTA 3KLGA 5AJ3F 5CD4H 4EYHB 1OJ4A 4BHQA 2VJUA 1WC0A 1HYSB 3V6HA 3N6LA 3QGHA 2V4JB 3JSYA 2CG8A 2AIRB 3QNWB 3CO0P 5KT6A 3VAHA 3UCUP 3MEEA 4ZVUB 3HT3A 3US5A 2VPZB 3G86A 3NS5A 3BGUA 4PWDA 2HQCA 1FWPA 1NSPA 3HK2A 3CCES 1RCXB 3IWLA 4WTOB 3BGRA 1PKUA 3D6TB 3M6UA 2XTJP 3BO3A 3H2LA 4LF8F 2GMLA 1B0VA 4PWUA 3TAQA 1QTNB 3KJFB 2FZCB 2EVZA 4O4GB 2NXJA 3BYPA 3PKMA 3LAMA 3FGVA 5HL7Q 2ZD1A 5G0RB 3Q8YA 5CZXA 4QWEA 1TVRA 2MKIA 2M70A 1NMEB 5HQMA 1IKVA 3AB4B 1S1WB 2FJAB 2XY7A 3GLJA 2ZITA 2ERRA 3FRYA 2CPIA 1R6VA 2H9ZA 3BBBA 2OGUA 2BM0A 3CJKB 5KFUA 1RTJB 1SC6A 1UFLA 2XG8A 3OLBA 3OFEA 2CQ4A 1VQ8S 2BABA 1Y5NB 4FF3A 4GC6A 4LF2A 1WTBA 2XMVA 2Y0BB 4P2FA 4J9NA 4C0OC 1QY7A 2CZ4A 4F0HA 4B3MF 5A6WA 2KZZA 1HWIA 2F8HA 1C0UA 4NRUA 4OX9J 2BANA 4O44B 1DJ0A 2GVDA 4DR5J 3LO3A 3QLHA 4GVBB 2E5LJ 1IJFB 4ZPBA 2W2MP 2W9BA 4TYBA 3DLEB 2AJ2A 4BC9A 2HLUA 4P7TA 3I0RA 1VJWA 1IWAA 4JV5J 1FDNA 2ZHOA 2V4QA 3R5BA 4K4XA 4U6PA 1F9EB 1WHWA 1C1CA 1FJ7A 3QJPA 4LFBF 2ZH3A 2YNFA 3FBFA 5KG0A 1HQUA 1FA0A 5B09A 2R8KA 3VGVA 4CTAA 2ALYB 4R0EA 1IWGA 2ZDOA 1IXKA 4RNOA 3T1AA 2EFPA 5JVGQ 2Q79A 3ENAA 3DDIA 1MWQA 2FVQA 2DITA 3DHXA 1DTQA 2J7KA 2VBWA 2KYZA 4K4SA 1JLEB 2V8HA 3PHEA 4WWSA 1S9EA 5IQQA 2DTJA 2HFVA 2VICA 4J91A 1RHMB 1RA6A 2FQQB 5LM7E 2H4WB 5EWEA 1R31A 5IOLA 3SCKE 1SCJB 2UVWA 2OJ3A 1HWUA 1VQSA 5B0BA 4LF5J 2A6OA 4EEYA 3N5BA 2DKOB 4C11A 2V2KA 1O5JA 2PE8A 2IM3A 4EBDA 3G2XA 3I5CA 2YBVA 3P45B 3NGKA 3NKYA 2YH1A 2CQCA 3KOAA 2V69A 1TELA 1S1VB 1X4DA 4QCLA 1N36F 4QYRA 5HVFA 4R25A 4GVLA 4DUTA 5LMUF 5HLFB 2R7OA 4A8OA 4AXJA 4NA3A 3FEXB 1ZYQA 1U09A 3SCIE 3HHNB 2KRRA 4G65A 3CDWA 2EK1A 5LL6d 3L7UA 2FLNA 4JB8B 4URGA 4EK2A 1UPMB 4J9SA 2HQDA 1Q7YT 2V8GA 3I5BA 2VQEJ 2GNKA 5I42A 3CW2C 3VGTA 2OMLA 3KNAA 5ETSA 3EMTA 2DPJA 1JLGB 2J6SA 2Y8WA 3W9HA 4I0WA 1S6PB 2Z2LA 2XM3A 1NCLA 1IR2A 2BJ9A 2ADBA 3CMQA 1WHXA 3ENQA 3D0GE 1JWWA 1SVDA 5D4PA 3TUPA 3DLKB 3GG0A 4WTYA 4DLEA 1H7XA 3MD1A 2DNMA 3FUYA 4NI2A 5DQIA 2GHVC 2D7SA 3N6MA 3O44A 2WVCA 3D6FB 4YHHJ 5B0AA 2RU9A 4U9RA 1WSVA 2E9RX 2C22A 2YQ1A 1LOUA 3CIMA 4QYZK 1RZMA 1WC5A 3TVKA 4IG0A 2E5GA 4K5SA 1VQ7S 4PABA 1YJUA 4U7UD 1R8HA 2CNNB 2DGQA 5KFMA 1UZDA 4C3KA 1N33F 2B56A 1KTVA 5AJ3J 1VQ9S 2CQ3A 3SV4A 2EFNA 1BLUA 5I3UB 2GIQA 4C8KA 1YBUA 3HT0A 5BYSA 3GV7B 3ISNC 4Y28C 5T7LB 4GMKA 4OZ5A 3KK3B 2HWTA 4NASA 4ZK7M 3QJLA 2MQ8A 5JUMA 3DXBA 3GSDA 2V94A 3ITHA 3ZZUA 2MMYA 4LSLB 2VKRA 4NL5A 4WE1A 2WW4A 5B0CA 4X4QA 4UF4A 1GMWD 2UVUA 3H5UA 1P27B 4IYQA 4M5GA 4OYOA 2I0XA 2KG1A 5BYRA 4BCAA 2MKKA 1PAUB 1NB2A 3CDBA 3MEKA 3PV8A 1LW2A 3HVWA 1TKXA 1KFDA 2ZHBA 1QAXA 3GG1A 5D0RA 3MEEB 1NK4A 4OJHA 4JI1F 3CJRA 2KFZA 1EP4B 4PWDB 2YX4A 5LSRA 4RWXA 1CJUA 1KVIA 1HD1A 2HBZB 2Z56B 1U48A 4ED3A 2EC0A 4A8XA 1M5KC 5C25A 2RJZA 3ILJA 2CPHA 5L46A 2JC0A 3MM6A 5A76A 1TP7A 4KB7A 3GCWP 2GW8A 3DCAA 2J76E 2AEFA 1RT7A 1X0FA 2EFVA 1SB6A 3IBFB 4O3SA 3ZTQA 2VG6A 2HIYA 1TVRB 4C2MA 2MTLA 2E9TA 3MM5A 1U1NA 3KTQA 3BDPA 1BWEA 1NSQA 3EZOA 2A2CA 1IQTA 3HHKA 2E29A 1FXRA 2QSWA 5A0YA 2HNZA 2IA0A 5EX0A 3AT1B 4AL6A 1HD0A 3PYGA 4DV1J 1YK9A 4KSEB 1FEEA 3RAMA 3JAMY 3K57A 3OR2A 5IWAF 3TA2A 8ATCB 2R8GA 1HWKA 5J2QA 4DX6A 2HVZA 5KOXA 1VQYA 4LJMA 1X5TA 2QLWA 1UJ6A 1FTRA 1AXQA 2DB1A 1AFJA 1BHNA 3HZGA 3HCXA 3LGHA 1C0UB 2WB4A 4YR3A 4G1PA 3KLHB 3KHLA 2KZMA 1U02A 2ZM6F 1HHQA 1IKWB 3VGUA 1KBRA 1N0UA 4JI0F 1K1SA 4RO0A 2LU1A 2GVDB 1CJKA 3QLHB 1FNMA 2V2VA 4TNOA 2H51B 1VQMS 2RHQB 4LMZA 2VODA 2L48A 1L3UA 3NCRA 1Y00A 1WSRA 1KFSA 5C24B 3AD9C 4DPYA 3H2UB 1F0XA 3MHYA 2HRTA 2VD3A 4C8MA 5KG5A 5DGAA 3N4WA 5AE3A 2DCUB 1M5OC 1C1CB 4DV0F 2P5VA 2MKCA 3KLVA 2BE9B 3AFGA 3AAWB 1UKUA 2YNFB 3G8TA 3GIIA 3E01A 2ALZA 5I3PA 2X1GA 1IR1A 1HQUB 4M1KA 1BMQB 1NK6A 4OL8A 2XMJA 3BSOA 2KG0A 2BQ3A 1V6HA 5KFQA 1VRQC 1CJTA 2GJIA 3UVJA 3M4XA 2B4VA 5B0DA 1U24A 3MFIA 2YKNA 3KG1A 3FJ2A 1YTYA 5CABA 4O0IA 1XWLA 1H38A 4ED0A 3UN2A 3B78A 3EGVA 2OPRA 1S9EB 2HSEB 2YNGA 4JUZA 5E33A 3QGPA 3EGZA 4RUAA 5E3CA 2RRNA 3P5TL 2ZH5A 3X1LB 4PPDA 4MAKA 3RRKA 4JI4F 1R43A 3ZXWA 2EFQA 4C48A 3DDKA 4F25A 3PEHA 3GU0A 4U7UK 4OHZA 1VC5A 3I4PA 5J2NA 2DXEA 4DHVA 1IKYA 1FERA 1NPPA 4B9UA 2L9WA 4U8YA 5CD4A 5F8MA 1YRXA 3CJTA 3F41A 1TUGB 1WELA 1PJ7A 1RYSA 3D0HE 2QFJA 3T1HF 1FWLA 3C19A 4WIIA 4ZPAA 4FYWB 5HI7A 2VG5A 4L3NA 1RK8A 1N32F 3MMCA 2IRXA 3W8GA 5KFGA 2V2ZA 1K1QA 2IVFB 4WPAA 2ZZMA 3W7BA 4B3TJ 1RT6A 1SL0A 4ID5A 4X66J 4Z7CA 3AHPA 2WZ1A 2BA9A 1MN9A 4KT0C 1TMJA 3OR1A 2M52A 4F02A 2K2PA 5I42B 1ZH5A 2EBEA 3CT9A 4LF7F 5CAAA 4DSFA 3NBPB 1CJVA 4FDFA 4YMEA 2HVHA 4ZPCA 3U02A 1X7VA 4PG7A 1D9FA 4S0MA 4ZVSB 2L08A 4LRAA 5E3QA 2AD9A 3BN4A 3OHAA 2LXIA 1YZ6A 2CQ2A 3D54A 4IH6A 2YWKA 4C6AA 3QRQA 3ZFVA 1VQOS 2IYGA 1QLNA 4NI2B 3MR6A 3OL8A 4CO1A 1N33J 4G1IA 1NPKA 3LOUA 3WC0A 2DGSA 4PEOA 1XIQA 2ZC4A 1N54B 3NOGA 2W01A 5KT3A 2DRBA 5E7OB 2W2QP 3D5MA 3HF5A 3EYZA 2HVDA 3UO0A 5B0EA 4MYUA 4IG0B 4RW8A 2V8VA 2FVSA 2J7UA 2LKZA 3ZZTA 2KXNB 2HW3A 4X4UA 2MJNA 2M2BA 3M30A 1S1TA 4ECRA 2BQRA 2HNYB 4FXVA 5F3ZA 3QYYA 2V2QA 4OJ1A 5FIIA 1UETA 3GWCA 1KEKA 4QBUA 2A3JA 4RX6A 4WFXA 2HHQA 3KJVA 1N8RT 1CS4A 3D68A 3J80Y 1RBOB 1M0SA 2UXBJ 1B70B 2WCXA 2DNLA 3A12A 1U47A 4DCPB 1RXOB 2JVRA 2B9YA 2CQDA 1KKHA 1RQ0A 3TAPA 3KLEB 4WF9Q 1HWJA 2E44A 1LW2B 4DL0C 1TKXB 1F2HA 3BKTA 5CYJA 2E1RA 2BZ2A 1OPZA 1TUVA 1UMJA 2C2KB 4DL2A 3K5MA 2Z57B 5KFWA 1PBAA 3GFHA 1YBTA 1CJUB 1I1GA 5DLFA 5C25B 3LGNA 1WEXA 2WSEC 3PJ9A 3MM6B 3EDQB 2YH0A 2Q1LA 5I4MA 1DTTB 3CD0A 2BEFA 1EHWA 1ELOA 4M5HA 5HBMA 4ES2A 2CFXA 1KLNA 1LWCA 3R5AA 5F0UA 3HVTA 4LRFA 5EUHA 3V6DB 2LQ5A 3M6WA 2KB2A 2H1YA 4WP9A 3OQ2A 2X3GA 3MM5B 4H54A 4DDFA 2J5AA 3PW5A 4HACB 3S6EA 2HNZB 3AH6A 3ETMA 1PO6A 3SCJE 1RWXB 5FD1A 1H73A 1RT3B 4DS5A 4NLOA 3CPWR 1GH8A 3CC2S 2MKYA 4OX8A 2KN4A 5DETA 2FB0A 3EM1A 4FPRA 3VWSA 2WVEA 5H1SV 5J2QB 3GFYA 4GKJJ 3CJ4A 1T9UA 3PJXA 4LVNP 1I94J 3DRYA 3IBWA 1HNXF 5K14B 3RB0A 4IDKA 3HJFA 1Q4RA 3UWTA 2QC3A 2VA2A 5IT0A 1WORA 1CJKB 3WQPA 1UW4A 4HI1A 2DH9A 3L7OA 1T9TA 4TN2A 5G4DA 1GNKA 1UVKA 2A6MA 1EB0A 3ICLA 3D2WA 3K5OA 2YNIB 2MYFA 4A4JA 3ISND 1ZM3A 4PQUA 1JQGA 3QBCA 2R7QA 2X1BA 1SV5B 3TA1A 2OTLS 3CULA 4JI4J 3IO1A 3IAS9 4V19X 1SKUB 4ZOSA 2MHNA 5A6PA 3UVJB 4CH0S 2DEIA 1OPIA 3CMAS 2B6AA 3DGPA 2YKNB 2G2YA 4ELTA 1MMNA 1HBOA 3BPDA 5J1NA 3D6MB 3JTOA 2OPRB 2C1EB 4QZVB 1KLMA 2YWFA 2GVZA 3GE9A 1EKRA 2FY8A 4Y00A 3PO4A 3T1HJ 4F4WA 4CLYA 2NZCA 4BDPA 3MMBB 2YX7A 4LF4F 1VI7A 1HNWF 3AD8C 2XNRA 1K9MT 4ZVTB 3KYLA 1IKYB 1VMBA 1JLQA 4MIBA 4ZJQA 4OX7A 4DPXA 4I68A 1VQKS 2VG7B 1OWXA 3AQOA 4FBUA 4PAAA 2ZH8A 3A8IA 3NMRA 2FZKB 1ZPWX 4DSLA 1O8BA 3EE3A 3VALA 3H40A 1S48A 2FIUA 3NY0A 3QT8A 1HR0J 3CVKA 3PW7A 4IOBA 2AX1A 2HGLA 3R7BB 1DQ8A 4W98A 2IAJA 3VTIA 4NLUA 4PR6A 1LK5A 1RT6B 4TY8A 4KV8B 2MZ1A 2BJDA 1BQMB 3QZ7A 2LECA 4F67A 4J9RA 2B0GA 2AF6A 3IFEA 2MXYA 1X0PA 2CJKA 4EBEA 4P72A 1N6QB 2DGOA 4M5DA 3KWMA 1U2FA 1R0AA 2W1BA 3W2VA 3PX4A 4ZLLA 5T14A 3D3CJ 4DR4F 4DR6J 1LWFB 5KFBA 4DFKA 5D4NA 4YY3J 1X9SA 3LPYA 2IJFA 3SSRA 2NR0A 1XMOJ 3BJYA 1VDHA 1PC5A 3AOCA 1K47A 4N77A 4P75A 2OIHA 5M2UA 4DUZJ 2LA4A 4G1QB 3EVMA 4FBTA 4JI6F 1REVA 3CD6S 2BW7A 2IHR1 3FCWA 5GMEA 1IBMF 1SL2A 3C66A 3TZZA 2LDIA 3GFXA 4RW8B 3SSQA 4DFMA 4K0KJ 2UP1A 2GO8A 4EWTA 3M30B 1RP5A 3ZZYA 2QRRA 1VK3A 3QZ8A 4ICLB 1QSLA 5DLGA 4B9SA 4TU8A 3GMGA 4KKOA 4A8QA 3CMES 1JKHB 1RTZA 1HKAA 4CIOA 2W9CA 5D0GA 2QLFB 3Q8VA 4M5NA 4N76A 5E3RA 2C3YA 5IV3A 4A8WA 3GIKA 1FRMA 2MHEA 1TU0B 1W7WA 3H5SA 2VL1A 3K58A 3TUZC 5ADZA 4UOCA 4ZVFA 2RDDA 1S12A 2Y0SD 3CWJA 4GKKJ 3K59A 3LP1A 1EKSA 4OI0A 1RI7A 5B0GA 3MEDB 1HWLA 4A8YA 2VQFF 2VUGA 4JI2J 4OZ0A 3CCSS 3ILIA 2B4PA 3RUBL 2NSBA 3W5YA 1FNOA 2EC2A 4F0MA 1AUSL 1Q81T 2QLBB 3NXZA 4DWIA 1YJ9S 2PFFB 5JJBA 3V2UC 1P6TA 1V3SA 2ZBIA 2MEWA 4CH7A 4NOHA 2IVYA 2Z58B 2KO1A 1FF2A 4YEAA 2JDJA 1U2RA 4CLWA 2VASA 1GTHA 5HBMB 1UJ5A 4NPOA 5BYQA 1LWCB 1G2EA 2O3DA 1PYTA 1MG7A 2O67A 4ZS6A 5AXKA 3PW0A 2BJ3A 3JSRA 2VHGA 1FO1A 2MSSA 4LR9A 5U47A 1HI1A 2Z30B 2CQ0A 4J9VA 1RWMB 2MZTA 3OTCA 3TEGA 2H65B 2PMZD 4ED6A 4EFAC 5JVHQ 4QR2A 2BRLA 1DFDA 2M8HA 1GQEA 3C14A 2GQCA 1QAYA 2QT7A 2K7KA 4R0JA 3CSKA 1TQLA 1X31C 2Y9HA 3CC4S 2R8JA 4A8FA 1OMSA 5J2PA 1U6BA 2AJ1A 4IR1A 1CULB 1WWHA 4DF8A 4WU2A 1NK8A 2RRAA 4RL1A 1DQ9A 4D3HA 4Y34A 3IR5B 1N34F 3R3TA 1HL6A 1OIAA 4IDKB 3P3DA 1XR6A 3VVUA 2ZNYA 2HRYA 2Y8YA 2Y3YA 2DNKA 5E3PA 4PUOA 2D3UA 2OD6A 4ZP8A 4KFBB 1S77D 3BS9A 1S9GA 4OJGA 3ZO7A 3VAFA 3J81Y 3HLUA 4Q0BA 1J27A 6FD1A 1FE0A 4J9OA 1D0EA 1TR0A 4DL3A 2YQ0A 4YQWA 2FLPA 4QWDA 5E41A 2UXDF 1EARA 4WFNQ 2PI4A 3W2WA 4U67Q 2AQ4A 4P10A 2AJ0A 3AODA 2AKWB 2OPPA 4W4MA 4UOGA 3PXGa 2G2OA 2C3OA 2MJUA 4X64F 2DR9A 1FWKA 2F1FA 2HZCA 3F56A 3C46A 1NJIT 3TJ8A 3R2DJ 3UDVA 1RAFB 4NLSA 3D3BJ 4ED4A 3RGIA 2YY3A 4MKVA 1RE1B 3OJUA 4DSJA 4DQRA 1HI0P 1EX8A 4DL6A 3GR1A 2GHWA 3HFKA 3AXMA 2HMIB 3WDOA 3PTWA 5HANA 4NEZA 2DH7A 4Y65A 3RR8A 1B4SA 1DURA 3PYDA 1WOOA 3K17A 4NMLA 4XPCA 1N5YB 2JLFA 1FT8A 2JH3A 2DT9A 4HTJA 2V6AA 2OEKA 2ZH4A 1RWOB 1ZTWA 1FDDA 5KT5A 3OLAA 4ZVEA 5CYQA 3C16B 4DSIA 4Q8EA 1ITPA 2B43A 2IAJB 2G0JA 4Z2XA 4TY8B 2V8PA 2Y1RI 4DX8H 3FNNA 1RUSA 4LBIA 3I87A 2LEPA 5J2MA 5ETOA 5CYMA 3J80U 3CCJS 3DM2A 1TK0A 1R3NA 1VQ6S 3M2UA 1QTMA 4USJC 3ENVA 1R0AB 1S1XA 2GJ2A 5KFJA 2XSJA 1RHRB 1CC8A 4TY9A 1FRKA 2UU9J 3M2RA 3RZAA 5KFVA 2CPDA 4BWMA 1O51A 2W8KA 4B02A 2IJNA 1VCTA 2VC0A 2OFGX 3WBZA 3HD2A 3KMQA 4C8NA 2EI5A 2Z4PA 4QR1A 1HMVB 2DY1A 1B3TA 4ZITA 3SV3A 1NM2A 3M8YA 2MKHA 4DL4A 2QA2A 3PCOB 1YHQS 2MY8A 3JTNA 1F5AA 2RB7A 1IJEB 4YB5A 5KFOA 3HSDA 4DR1F 1A7GE 1M5VC 1BY9A 3D1OA 4HKQA 4F2SA 2YXLA 2AJ4A 1CC7A 2I1RA 3UD5A 1EQMA 1K44A 4ZP7A 1NBEB 1PJ5A 4DV4F 3TEHB 1S6QB 4FNIA 2GMJA 3AQPA 1UL3A 2OPQA 4DV7J 1U1LA 2IMOA 1FRXA 5F8JA 2FJEB 1FFSB 4OI2A 2N4CA 2ZE2B 3QPIA 1TKZB 3HHEA 4NLPA 3UW1A 4N8NA 1RT4A 2MY7A 3HJVA 3W62A 2XZDB 1XMBA 2UXCJ 2XB2D 5DG7A 4IOCQ 2DR6A 3C15A 1SBRA 4KGVB 3V81B 5ETVA 3B82A 5KG1A 4Q45A 4JYAF 3OD2A 2E1MC 4AD6A 1FFGB 2R8HA 4RW9B 2C42A 1UWAA 1TKTA 2ATCB 4ZA1A 3J7Z5 2LU2A 3HO1A 4RNHA 5GAHI 1T9VA 2P9EA 3A3OB 5F8GA 3LP1B 2DGWA 3MPYA 4L3KA 3CJQA 2B8QA 2O5DA 4C9DA 1HPZA 2CQHA 4K4TA 2YQ3A 1T0TV 2FLOA 3HULA 5EWFA 2HK3A 2Z8QA 3MMAB 1HNZF 1P9YA 5ETLA 1S10A 4IQMA 1SH3A 1XJWB 1N5QA 2JSXA 2CAJA 2F63A 3HXMA 3MM7B 3H7HB 2JL9A 2I6WA 2GS8A 1NK9A 4JI5F 5DZ7A 4L75A 2CJBA 1X4BA 3V5RA 4ZCMA 3NL0A 1APSA 1RTIA 4ZLJA 4Y2MA 3OFGA 1H72C 1R8PA 4RZRA 2HQFA 4USTA 4Y2IA 1Z2ZA 1RTDA 2VA3A 4LSNB 3SDEA 3DI6B 3R5DA 3BGFA 2ABYA 3QATA 4I2QB 3FKBA 4C8LA 1HNVB 2AYMA 2F9DA 3C14B 4A8KA 2M7SA 3KUEA 4FF1A 2VFSA 3H4DA 3T41A 4CZCA 1KQKA 1T03A 1Y3JA 3DYAB 4WKYA 1KQGB 5J2PB 2DXDA 2JRSA 4CRJA 3OVSA 1AT1B 2WONA 2CQ1A 3U1NA 3MMJA 4QIVA 3HVAA 3IXQA 1NKEA 1E6VA 4Q2MA 1BUXA 3UN5A 3D1QA 1G7CB 2NCKL 3DXSX 1ZZFA 1TL5A 3BO4A 3LH2S 2ASYA 4WZQA 3G6ES 3BBFA 1YITS 1URNA 3DC2A 1UVLA 4DQPA 2U1AA 1ZM4A 5GAHU 1S9GB 3A3NB 3OL7A 1S0NA 2JZ5A 4Q0BB 3CJ2A 3NS7B 3ZZ0A 2EG2A 2QEXS 1T02A 4DJBA 3FFIA 2ZBCA 3LF0A 4BC7A 5IV4A 1RU1A 4PKDB 3CCQS 4USIA 3L4BC 5KFHA 1N4LA 3GV8B 3W2WB 5LSLA 4PYDA 2BOPA 1RAOA 2OPPB 3EPIA 2HHHF 1LWEA 5MLCV 4WU3A 3K5PA 5DDOC 2DO0A 1WTFA 3DOKB 4RU2A 3QQCD 4NZ0A 3MM9A 3DOMA 4PCQA 3MAAB 1SH2A 2G2ZA 4A8SA 2DD8S 4HYKA 5FDLA 3KLIA 3HPOA 4X4VA 4AXIA 5B7WA 5DM7Q 2DISA 2FVPA 1RSCA 2ADCA 1XR5A 1QUVA 1S6OA 4CO4A 1FRHA 3PY8A 3KDNA 5LMNF 1IBKJ 3ADAC 4OHYA 1WKLA 2LEAA 1XBWA 1VBKA 4K4ZA 3GJTB 1HYSA 2H48B 2QLXA 1HLWA 5LXRA 2V67A 4F3QA 1WJ9A 3OV7A 3KHHA 1VBYA 2V9KA 2J9DE 3K8VA 4KPCA 5K8MA 3SI8A 1IM4A 4NXMJ 2HZVA 4QW9A 2CUYA 2HFZA 1C2PA 2U2FA 2BRKA 4E2FB 2XHCA 3I55S 2WVFA 3QRRA 4KH0B 3H25A 5GAEI 2C3PA 3J7YU 2IRYA 4Q44A 5J2MB 1GK8A 2HURA 5G0RA 5CYMB 1SKRA 3FC9A 2AZ3A 2NYIA 2F40A 2NPIA 1REGX 1F3FA 2JVOA 3HSJA 1KHWA 2R7TA 2NREA 3RBZA 5EN1A 5KFEA 1S1XB 4GO7X 4DR1J 2CPXA 5D4LA 1I3OB 3M2RB 2QA4G 1NJYA 3CJKA 3F73A 4XDCA 1KQFB 2Q43A 3MECA
chains in the Genus database with same CATH topology
2MSTA 1BD6A 3KG1A 3M8QA 4Q8FA 1RJJA 3FJ2A 2FC8A 4Q7AA 2RSQA 4YR0A 1DQAA 3VAKA 1T05A 2BJEA 4LIWA 3QGIA 1YTYA 4KIAA 4ZKAA 4LQ3A 4I4BA 4O0IA 1N5YA 1YRTA 1XWLA 2IFXA 1H38A 4CNZA 4ED0A 2G9OA 2O01C 3LP0B 4XIUA 2R2UA 3B78A 4KJIA 2OPRA 1GXUA 2NPFA 1S9EB 3PFOA 4K50A 4M5DB 2YNGA 4JUZA 5E33A 2IMWP 1YRUA 1WG1A 3QGPA 3I0SB 3W2VB 2P9CA 4WYWA 2QMWA 3C8YA 2FJBB 3DRRA 1AW0A 5HMWA 4C97A 3EGZA 4RUAA 1WG4A 3Q2SC 2RRNA 3P5TL 5E3CA 2MPUA 2ZH5A 3X1LB 4PPDA 4Y2CA 4MAKA 3RRKA 3UFCX 4TQSA 4JI4F 3L09A 2Z2MA 3BSAA 1R43A 4X4SA 2EFQA 2VFTA 4K59A 1T95A 3QAUA 1TAQA 2DVIA 3DDKA 2YVSA 4F25A 4KR0B 3IGNA 1UP1A 4DQQA 3CCZA 3PEHA 4U7UK 3P49B 4OHZA 1FRIA 1VC5A 3OPKA 5A8KB 3I4PA 5F9NA 5J2NA 3RAQA 3MTJA 4DHVA 2RE1A 5HMZA 4PXBA 1IKYA 2ACYA 3Q8SB 4DF4A 1FERA 2LLZA 1Q8LA 4J37A 4UQGA 2MZSA 4B9UA 5KFXA 2L9WA 3DLEA 5AXMA 3H2VE 3OTOF 2MQOA 1T3NA 1S6UA 5F8MA 3TYTA 2C2DA 4OZ1A 1YRXA 3Q8RB 3F41A 1RT4B 1WELA 3RB6A 4X4TA 3MPWA 1Y0HA 3D0HE 3O1LA 2QFJA 1RYSA 3SEOA 1RTHA 4R5PA 3T1HF 1FDAA 2XBPA 4B9NA 2ZUGA 4WIIA 1SIWB 1REVB 1U8SA 4NXNF 4ZPAA 4ELUA 4OX9F 1TFYA 5HI7A 2VG5A 5KG2A 4L3NA 1RK8A 2J9DA 2F8MA 1N32F 2UV8A 3MMCA 4FZVA 4G6VB 2G13A 1U25A 2IRXA 2RH3A 3LP2B 5KFGA 4OLPA 4AYBD 1K1QA 5J1EB 4CO2A 2FVRA 1TL3B 4EUVA 3MUTP 2IVFB 2RS8A 2E5LF 4K4UA 4J9QA 2EFOA 5I3QA 2ZZMA 3W7BA 1J2VA 3ULHA 2XULA 4ZP6A 1RT6A 1TKTB 2APOA 2G4BA 1SL0A 1NKCA 3T5KA 4QU6A 4Y3CA 4ID5A 2ZH1A 4H4KA 1H2TZ 3AHPA 3M9MB 1N88A 1U7LA 3LALA 3GV5B 1WF0A 2MQLA 2XI2A 3QIDA 5GAEU 3PX0A 2BA9A 2MKSA 2XWXA 5DS7A 4KKOB 2M0GB 4KT0C 3OTEA 4JV5F 3ZZRA 3VAMA 2N7CA 2XY5A 3OR1A 2M52A 4F02A 4N47A 4X62F 2K2PA 5I42B 1Y3KA 5BR8F 3TQ1A 3M1VB 1ZH5A 1HMVA 2EBEA 3CT9A 3C6UA 4LF7F 4X4PA 3RR7A 4DSFA 3NBPB 2BR0A 3MEGA 1FTCA 3QGGA 4KE5A 4YMEA 5DG8A 3WZ0A 1GXLA 4O3OA 2KT5A 2W9CB 3VQTA 3MI7X 3BR9A 3M32A 4ZPCA 3U02A 1X7VA 4PG7A 1ZM9A 2RDIA 5SZTA 2HPUA 3JSMA 4MFBB 1WHYA 1FEHA 3UCZP 3AB2B 1D9FA 3MR5A 1URRA 1YG0A 4BS2A 3K8WA 4QOTA 1Y9OA 2UU9F 5CH7B 2L08A 4FNHA 1F5CA 3NGDA 2PO4A 1VS3A 2HNDB 2E5JA 2OO4A 3N0VA 5E3QA 3VZIA 4EO8A 4NLDA 2AD9A 1R7IA 2P6SA 5IT9Y 1AFIA 3UDCA 1X5OA 1PSDA 3BN4A 3OHAA 3AA8A 2LXIA 2UVRA 1Q8BA 4LVOP 5E0OA 2C2EA 1HQEB 2DH8A 2MQNA 1YJVA 3DDNA 4IKAA 4ECZA 1S6QA 2CQ2A 3ZC4A 4W90B 4U7CA 4C8ZA 3D54A 4IH6A 2YWKA 2AX0A 3GZ7A 2F8EX 3ZFVA 3CD7A 1VQOS 2IYGA 3TVYA 4WFBQ 2B5JA 2CQPA 1QLNA 3MR6A 2IBOA 3IG1B 2FVCA 3OL8A 2QO3A 4CO1A 1FXLA 1BC6A 3VCDA 2XO7A 1K73T 2DGUA 4I6WA 3G71S 4QW8A 4G1IA 2ZE2A 3KHGA 3LOUA 3WC0A 3V4IB 2DGSA 1TKZA 3IRWP 2ZC4A 4EZ9A 5F41A 4TLRA 4TU7A 1N54B 5KT3A 2UUWA 2DRBA 1IR0A 1RTIB 4YDXA 5E7OB 3CJ3A 4IR9A 3RBDA 4RNNA 4N41A 4O23A 3D5MA 3HF5A 5HLFA 3EYZA 2AGOA 2EFGA 3VAGA 4K5RA 4B3OB 3DFEA 1YIJS 3IS9B 1M5HA 1S9FA 5B0EA 4OZLA 4MYUA 3FSXA 3CGIA 3GILA 3V81A 4DQSA 2AGQA 4IG0B 3I96A 2IA6A 2JEIA 2CVEA 2DNPA 4RW8A 1S97A 3OW2R 2B51A 4LF5F 4NA2A 2CQGA 3SDEB 4HT5A 4MK7A 1Q8IA 3TRGA 2V8VA 4F26A 2FVSA 2J7UA 4DV7F 1YI2S 1F60B 2LMIA 2LKZA 2ASLA 2HRUA 3ZZTA 2KXNB 3FZBA 2HW3A 4X4UA 2MJNA 2N4DA 1X9MA 1RT5B 4RW9A 4DMZA 3VAJA 4KHMA 2WSFC 2XS2A 2M2BA 3M30A 1JLCB 1S1TA 3KLFB 2M5YA 1ZAWA 4ECRA 1JNRB 2ZOGA 4QWAA 2BQRA 2W24A 1FKOB 1HBNA 2ZKUA 3K5LA 2HNYB 4FXVA 3G4SS 2ZH6A 4PG8A 3PR4A 5F3ZA 3QYYA 1SJ1A 2L3MA 5CCLA 4OJ1A 2WOMB 5FIIA 2UXCF 1NH7A 2LVWA 2AWZA 4YB6A 3C6TB 1UETA 5C5JA 4I2PA 5DDRC 5D3GB 3MM8A 1UA1A 2WBMA 1XEZA 3GWCA 4ZMMA 1KEKA 4QBUA 2A3JA 1CQMA 5IXUA 7FD1A 4RX6A 2UUAF 1U6FA 4WFXA 2FPHX 4ECUA 1LV5A 1S6PA 1HA1A 3M6XA 4UY85 4Y2AA 4OIXA 2HHQA 2V9WA 1WG5A 3KJVA 4C3MA 2DGTA 2DNHA 4ZHRA 1N8RT 4NYZA 5F8IA 1AROP 3J80Y 1E6VB 2Y1JA 3MMAA 3DRSB 2MZRA 1M0SA 1XR7A 5LJ5Y 3HHLC 4H4MA 4OQJA 1JJHA 3CE8A 4MK8A 2HIQA 3ZZOA 2WCXA 2DNLA 1L3KA 1JIHA 4ZCKA 2R8IA 4IH7A 1U47A 5HP1A 2HHVA 4FP9A 2OKQA 2B7CB 3K2YA 2VQEF 2JVRA 2YNHB 3VF0B 2B9YA 2CQDA 4C98A 4X65F 3MM7A 1RQ0A 3TAPA 3HDSA 4X4OA 3S1TA 3KLEB 1FD2A 4RBVA 1E6YB 3HHLA 3I31A 2I5JA 4WF9Q 4CCHA 1JLBB 1HWJA 2E44A 1LW2B 4DL0C 1C1BA 2CKWA 1TKXB 4CNYA 4ZVHA 2R4FA 4KC5A 5A8WA 5CYJA 2E1RA 3D28A 2BZ2A 1X5PA 1OPZA 1WI8A 3FFIB 4RW6A 4CO3A 3TOQA 2FDNA 2V0NA 2ZC3A 1TUVA 3CF5Q 1KNZA 1UMJA 3KG4A 1S7HA 1FVQA 3KKFA 1VC6A 5KOWA 1SKWA 1LQ9A 3UR3C 3PZPA 1ZPVA 5A8RB 3VAIA 4DL2A 3K5MA 3KLGB 1SI9A 4IRDA 3B4DA 3NG8A 3IN5A 4IH5A 5KFWA 2GMHA 5H9EJ 3GFHA 4TXSA 2HGNA 4PUOB 4LSNA 1I1GA 3DI6A 5DLFA 2NZ4A 4OJ3A 4NZ6A 5C25B 3LGNA 3PX6A 1TAUA 1QVFR 1OS5A 4I2QA 1F5BA 1WEXA 2RNEA 2WSEC 3MM6B 1NJXA 2YH0A 1LWEB 2V5HG 4QWCA 3KNGA 2ZH9A 2Q1LA 5I4MA 1DTTB 1HNVA 2CPEA 3E3XA 1BQNB 3CD0A 4ERDA 5CXTA 1ELOA 3TW0A 5HBMA 4OLOA 3J7YI 4ES2A 4YHHF 5HQ8A 2OSQA 4UUWA 3HVRA 3UD3P 2CFXA 3E8OA 1QAIA 2FHJA 2DNYA 5DDQC 2HFNA 1WEYA 4ECVA 2K1RB 1CG2A 1LWCA 4DN0A 2W4DA 3R5AA 5F0UA 5I3UA 1KLNA 3HVTA 5D6GA 3ENWA 3SXLA 5EUHA 2BUNA 3V6DB 2LQ5A 3DYAA 3M6WA 2KB2A 3CO9A 1DHMA 3KLIB 1YJRA 5T7LA 3D0IE 3R1HA 3DN9A 2GQ2A 1D3WA 3OSNA 3OQ2A 1RKIA 2X3GA 3A1YG 3MM5B 3I5AA 4H54A 5B08A 4B9TA 4A46A 1KSPA 4F3OA 4DDFA 1VQ4S 3M9NB 3BGRB 1KD1T 1F2GA 2J5AA 3H20A 3UPFA 2YWHA 3PW5A 2Y1IA 1W2BR 4M63A 1W25A 3S6EA 2D9OA 3PIPQ 3MR2A 4DFJA 2VZ9A 1DAXA 2HNZB 3AH6A 1S79A 3IWNC 2XMWA 1VBXA 1PO6A 2CJKA 1SUQA 2UUTA 3SCJE 5FD1A 2KYXA 1RT3B 4DS5A 3BQ1A 4NLOA 3CPWR 1GH8A 3CC2S 2KH9A 1FKPA 4OX8A 2J9CA 2KN4A 5DETA 2FB0A 2X1FA 1Q1KA 4I56A 2ZD1B 1LK7A 2BE2A 2VBYA 1VIXA 4FPRA 4OI6A 1ZZNA 3VWSA 3G8QA 2KHCA 5H1SV 2DRAA 3NMAA 5J2QB 4F2RA 3HHDA 5C42A 3GFYA 4YR2A 2JJ4D 2ILZA 2KT2A 2MDAA 1R8BA 5DRKA 3UD4P 3O5TB 1IUJA 3CJ4A 1IKVB 4RW4A 4UW2A 1VQ5S 2HVHA 1DLOB 2RVJA 3PJXA 3MAHA 1JNZB 4LVNP 1OQ3A 2RU3A 2XC9A 4FS1A 3DRYA 2AGPA 3IBWA 4FYDA 5K8NA 4OHWA 3M2VA 1HNXF 3OTDA 2NLWA 5K14B 3RB0A 4USHA 1EP4A 2L41A 4IDKA 4DN9A 4DLGA 3HJFA 1VQNS 4I67A 1Q4RA 3EXYA 1JLFB 3M05A 4HI2A 3CCMS 4KTQA 3UWTA 5JXSA 2KXHA 3MAQA 5E2QA 2DHAA 3GFZA 1JXEA 1YWXA 2VA2A 2YKMB 5IT0A 3FMBA 4MJKA 2Q3PA 4RBTA 2HHPA 1YQHA 3IR7B 2GA7A 1UW4A 4ALZA 5GADI 2QSFA 4OZNA 4HI1A 3QAEA 1AUDA 5F8HA 3OUYB 2DH9A 1NO8A 4WFZA 2GIRA 3L7OA 1JB0C 2JEFA 4TN2A 5G4DA 1SJ4P 3IA0A 2V4JA 1P1TA 2B9WA 3DOKA 4UUXA 1HW8A 3OFHA 4CI0B 2GCFA 4J5OA 3NNCA 1GNKA 1UVKA 1WF1A 2AJFE 2JHEA 3HM9A 3FMWA 2AJQA 4EBCA 3MXHP 4WCEQ 3TAMB 2VFVA 2X1AA 3IR6B 3EZ5A 4ZPDA 3ICLA 4YUDA 2XCPA 3CJ5A 1MU2A 3K5OA 4PXEA 3D2WA 3IAM9 2YNIB 3OXFA 2CJQA 3OVBA 2MYFA 2QMXA 3PRDA 3QWPA 2COLA 2BANB 2OFHX 1RT2A 4DG1B 4A4JA 2A10A 3ISND 2KM8B 1ZM3A 1KHVA 2DHXA 2FTRA 4WKRA 1GXTA 5CYQB 3MUMP 4PQUA 4KRWA 4OI4A 3H5YA 3T3FA 2R7QA 2X1BA 4OHXA 1B7FA 1MNEA 1SV5B 5KFLA 1T3OA 3TA1A 2OTLS 3POTB 3MPVA 5IS2A 3CULA 3IO1A 4MTPA 1FNXH 2W7AA 2VFUA 2XS5A 3GYXB 3IAS9 1YJWS 4V19X 3NNAA 2JX2A 4DS4A 3V4MA 2W9BB 4FS2A 2VBZA 5L39A 4ZOSA 2BV3A 2M9KA 2MHNA 5A6PA 4HH0A 2DPIA 2ZH2A 4CH0S 4O4GA 1OPIA 3I0RB 4NCBA 1DZ5A 1UVNA 3CMAS 1S0VA 4ZP9A 1NB7A 2EPIA 2B6AA 2NXUA 3DGPA 4XAKA 2YKNB 3MECB 2F7VA 4Y6IA 1K0VA 1MROA 1JK9B 4MK9A 4QWBA 3MWBA 5AE1A 1UVJA 2VV5A 4ELTA 5KG4A 1RT1A 1MMNA 2UUCF 3R27A 1HBOA 3DM2B 4RNFA 1H98A 1FJGF 4V19J 4PG4A 5J1NA 3BF4A 1NJWA 1S0OA 3M2UB 3JTOA 2VC1A 2KT3A 4DPOA 2OPRB 4ZVGA 1N5SA 4QZVB 4ETZA 1KLMA 2YWFA 4HT7A 3PO5A 4OI1A 2WTFA 2FJWA 1S1WA 1W2IA 3GE9A 1LKZA 2A2DA 5KFSA 1GTEA 3MR3A 3DRRB 2ZOFA 2AYGA 4Y00A 3VZHA 3VQSA 4JV2A 3QIPB 2XSJB 3PO4A 1MMDA 4K4YA 1GAOA 5GVQA 3H4BA 4F4WA 2MQPA 4QIWD 2HYIB 2LCWA 4RUHA 4BDPA 1LW0A 3MMBB 3KLHA 4CTAB 1IBKF 4Y0FA 2YX7A 3QO9B 2W25A 4B9VA 3MTKA 1S76D 1C0TA 2P6TA 1ZOTA 3AY0A 1IKWA 3Q24A 4DV1F 4LF4F 1BQXA 1L5UA 1VI7A 5L1LA 1HNWF 3BREA 4PG6A 2K3KA 3HP6A 1RTJA 4KBIA 2XNRA 1UEVA 2PSZA 4ECTA 1VRTA 1K9MT 3KYLA 1IKYB 4DOZA 1VMBA 1JLQA 1SH0A 2KRBA 4MIBA 3H5XA 1VBZA 1DTQB 2R7UA 1JJ2R 5IZHA 2SXLA 3CB4A 1YGYA 2NSCA 2HS4A 4OX7A 3X3UA 1U1RA 2J0QD 3G6YA 3FSIA 5C24A 4I7FA 4I68A 2XCAA 3PR5B 1R6YA