5H9FK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target at 2.45 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
159
Chain Sequence
b'MYLSKVIIARAWSRDLYQLHQGLWHDFLFHVEKCHVLLQSAQMPSTAVATVIKTQVEFQLQVGVPLYFRLRANPIKTICRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Immune system/rna
total genus 21
structure length 159
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9fK02
5CD4A 2Y9HA 3QRPA 5H9FK 3QRRA 4DZDA 4QYZK 2Y8WA 5H9EK 1WJ9A 4U7UD 3QRQA 2Y8YA
chains in the Genus database with same CATH superfamily
3H5SA 4KHRA 3QIPB 2BXJA 3NP5A 2YH1A 4OI0A 4DLEA 2AEMA 1DZ5A 2W7PA 3FUYA 3AT1B 2BKOA 4ECZA 1FO1A 4ZA1A 3HVTA 1VQKS 2QLJB 1NJXA 1YI2S 1AB8A 4OYBA 3UI3A 1YTYA 3G8TA 3H5XA 1F1BB 3KJVA 4BC9A 3AJ1A 4WFAQ 5A6WA 3MOZA 2ADBA 2QL5B 4BWJA 3KUHA 2EXUA 1X4FA 4DU7A 3W9IA 1RHUB 4IOBA 3KLIB 4FXDA 4OYXA 2M8HA 4MK8A 5B7WA 3R8YA 1RCXB 3BN7A 1PBUA 1AUDA 3CNQP 1GMWD 4LRBA 1F2HA 2EK6A 2IYGA 5C2GA 2DY1A 5JXSA 4TNOA 5GVQA 4IRDA 1EKSA 5DDQC 2OLWA 3R1HA 3DRRB 1FERA 1U47A 1YGYA 1C1CA 1H2TZ 3A3NB 3OXFA 3MECB 4A8FA 3FBBA 4NA1A 3M32A 1Q1KA 4OZ5A 3IRWP 2OPQB 2YKQA 2ERRA 5KFXA 4ICLB 2XMUA 1SUQA 3AQOA 1WKJA 1FRMA 5D15A 2V2KA 1NPPA 3GP9A 1TL7A 2VZ9A 4KGMA 1ROFA 1N34F 2MQOA 2Y1IA 4YFUA 3U1NA 3DLLQ 4BWMA 4ECYA 4NA2A 1S1TB 4P2FA 3Q8YA 2VONA 1N34J 4RW7B 2R7SA 1QDUB 2YNHB 5L1IA 2ROEA 1ICEB 1VC6A 1A7GE 4C8KA 4X4UA 4M5KA 1FJ7A 2NYIA 3B54A 3KLHB 2IDEA 4GO5X 4C3KA 4UY85 2WCXA 4G1PA 2DXFA 2UZAA 1NZ8A 1XIQA 3CSKA 4ZN1A 2HNDB 2K2PA 2RRAA 1KC8T 4CT9A 3DLGA 3QFWA 2HFOA 4ANEA 1V3ZA 2HHXA 3W8PA 1FXDA 5F3TA 3JB9k 2W4CA 1F5AA 2ZH8A 3T5KA 4WKRA 3AB4B 2DGWA 2OGUA 3AODA 2YXLA 4N56A 4NLPA 1TL3A 1HNWJ 4N8OA 2P6SA 2E7WA 3SEOA 2NR0A 3DLBA 1UJ6A 3UD3P 3X3UA 1ITPA 2K7JA 3UR0A 3DRYA 3J7A1 2JLFA 3AD9C 3ITHA 2AIRB 3LO3A 3FDSA 1AT1B 1CJTB 2BKNA 1FNOA 1SKUB 1REGX 2EFNA 1NSQA 2GO8A 4PYDA 4LMZA 4DFPA 4LBIA 1K0VA 4TQRA 2VFSA 3K5OA 3LQVA 1EHWA 2CADA 3MMBB 4DXLA 4NE9C 4CLKA 3W2VA 4ZPTR 5ETOA 1IBCB 4RNMA 2QRRA 2PA8D 4CLLA 4KKOB 3PM9A 1L3UA 2QV6A 3HVWA 1HMVB 1TKZA 1UVLA 2RUGA 1UEUA 2P9CA 1HWUA 4HLBA 2AW0A 4GKJF 1FEHA 2VC1A 3IBCB 3NMRA 2MKIA 4J7CA 1VS3A 1ZOTA 3BR8A 4N7TA 3PKMA 3B82A 1U45A 1P6TA 5LJ5Y 1B70B 4GKJJ 1JLAB 1VCTA 1R0CB 4FYXB 1UW4A 3V6DA 4CDIA 4OV1A 4ETZA 1W2IA 4ZIWA 2MQMA 3ZZUA 4W98A 3UVJB 4RUHA 1KHVA 4XTTA 4C6AA 5KFVA 4IUFA 4FYDA 1UVMA 1JLQB 3JSBA 1IKYA 4NXMF 4WJBA 4QQBA 2DNOA 3UCUP 3IBFB 1RE1B 1Y10A 4NXMJ 3O6QA 4I7FA 3CJQA 5KFYA 2NPFA 3BZQA 1OO0B 2KVQE 1D0EA 4JV2A 1KQFB 2HFZA 1EP4A 1NHUA 1IKVA 3DRPB 1KQGB 3GV7B 4Y2IA 2XM3A 2MY8A 3DU5A 4JI2F 2AGOA 4NXNF 5F8IA 2JSXA 3MF5A 4OI6A 5G0RA 4C8NA 2VG7B 1XR6A 2D41A 2E29A 2GQQA 1YJTA 1XR7A 5H1SV 1N48A 4JI2J 4F25A 2G9OA 1C0TA 4NXNJ 1CC8A 1DQAA 2BR0A 2HHWA 5MAOA 2PSZA 3TUJC 2G2YA 2YWKA 4QIVA 4DL5A 1AXQA 4J9LA 4MKYA 4FDFA 4B9NA 5IOLA 1WEYA 3G6ES 4ECRA 2J0XA 4D3GA 3LP2A 2YBVA 1WC5A 2V4RA 1KP6A 3K57A 3OV7A 2QTWA 3C6TB 3OQ2A 4BDPA 4YOEA 4ANDA 4R25A 4U9RA 2OFHX 3OR1B 1RTIB 1VMBA 1WELA 2CAJA 3M30A 1VLYA 1MWZA 2XI3A 4ECSA 5KAKA 4CLFA 1V9OA 1Q8BA 4UQGA 5I42B 2J0SD 2MSTA 4ZVOB 3OTEA 1FJGF 1ZTWA 3GJRB 1CBKA 1RTJA 1RACB 1VK3A 3A8JA 2BOAA 2J8SA 1VQ7S 3W9JA 4DEZA 2CG8A 1FJGJ 3M4XA 2ZZMA 2LXIA 3BH7B 1ZPWX 2CPIA 2DGVA 1FRHA 4ZJLA 2QL9B 3PHTA 5E41A 2OAUA 1BE4A 3OL6A 1VLOA 4C8MA 3FFIB 3MCSA 3HLUA 3BQ2A 1QLNA 1F9FA 4JBCA 4ITSA 5DG8A 4TY9A 3W63A 1OPZA 1R89A 4CIOA 4RBTA 2R2RA 2G0CA 2NUHA 4Q7AA 3RTVA 5D3GB 1LQ9A 2CWKA 2H51B 3TW0A 5LSOA 2LQ9A 2R42A 2A6OA 4UTGA 3HPOA 1SJRA 3M8RA 3OPKA 2I5JA 3UDVA 3VZIA 4ED7A 3EWGA 2FLOA 1KTQA 5KT6A 4DDFA 2R7WA 3OLAA 2HURA 2UXBF 1FVQA 4UF4A 5KFFA 5C24B 2UXDF 2K1RB 1MN7A 5ETRA 3T9NA 4TQSA 2QMXA 3TX8A 4A8MP 3GYGA 3TYTA 1HNZF 2R7TA 4X4VA 3KKFA 2UXBJ 2F9DA 4EO8A 1I51B 2B9YA 5DGAA 4OZ0A 4CLZA 4FN5A 2UXDJ 1D9FA 3EDRB 2KTQA 4JP8A 1I94J 3CJ3A 5I4MA 1R43A 4QYZK 2MZQA 1JJ4A 1K8AT 1HNZJ 1RT7B 3EYZA 1NDLA 4NRTA 1E6YB 2WVEA 2IHR1 1LWFB 2JFDA 3Q8RB 2OPPB 4RUCA 1JJ2R 3HHKA 1HR0F 5DDOC 2ZH3A 1CULB 2B51A 5IFMA 5J2PB 1XC9A 3Q2SC 2LXFA 1D09B 2H48B 3K58A 4DR3F 3US5A 1NSAA 1NO8A 1HR0J 1VQMS 2OD6A 3VAFA 2QA1A 1OMSA 4UOHA 1RK8A 1SI9A 4F4AA 2VOOA 3TA2A 4DR3J 4CLSA 3CCES 3KTQA 2CQ0A 1TUVA 3M2RB 1N8RT 2JOQA 1GXTA 5C7PA 4NCBA 4HL9A 2VFVA 4DSLA 5AXNA 5IT0A 2ZNYA 3SCJE 4WPAA 2A1BA 1NSKL 2X1GA 1V5IB 2VJUA 4I2QB 1U6FA 4K4SA 4RNHA 1IR2A 3HDSA 2DNYA 4A46A 2RDIA 4QOTA 3MM8A 2XYPB 3C46A 3CJ2A 4JI7F 1RT6B 1BWEA 4ALZA 5K8NA 2XZDB 3DMJB 2KJWA 3KLEB 1NAQA 2DXEA 2HWIA 3HJFA 4JI7J 2UVRA 1JB0C 4M5JA 3C6UB 1NDPA 4YS2A 4QPTA 2EC0A 2RQMA 3GLJA 3PIPQ 4USIA 3QJLA 2MZTA 1NHKL 3N79A 2LQBA 4HHJA 2YNIA 1FFSB 3QZ7A 1VRUB 4IRKA 1CJVA 1AYEA 2FZCB 3GIIA 2B4VA 2AYBA 3VVUA 2QJ3A 2G13A 3PW2A 3CJKB 3DXSX 4S0MA 3ZZOA 1NKEA 2RKIB 4NYZA 3SDEB 5D4LA 3FRZA 2HHSA 2NYHA 5C2CA 3PW7A 2V8HA 3CDBA 2GS8A 3H59A 3M2VA 6FDRA 4QR2A 2Q43A 4A4JA 4K4XA 5IT9Y 3DDKA 1FK9B 2OELA 3HO1A 2F1FA 3MI7X 1BQMA 3CDUA 4OYOA 2R7QA 2ZNZA 3OTCA 2E5JA 2DCUB 3HP6A 2ILZA 2VQFF 4LSNB 1KVKA 4G3IA 1R7IA 2DGOA 4J9QA 4IG0A 1KFDA 4RUBA 4J9RA 2PMWA 1GXLA 2GO9A 4OX7A 3FNNA 2VQFJ 1K47A 3EVOA 2VA2A 1RT3A 1R27B 1HHQA 1NK9A 2HNZA 3NGKA 2LDYA 4J9PA 2MPUA 3JQKA 4FYWB 3NWRA 3BKUA 4ZVHA 1U1PA 2MZRA 3RGIA 4C4WA 2MLZA 2APOA 2R7VA 3D5MA 2HEKA 1HQUB 5B0DA 2PFDA 2ZJQQ 3UD4P 3VWSA 4OHVA 2CPYA 4P2SA 3HM9A 1J5EF 5E3AA 2HSEB 2WSCC 3PO4A 5DQGA 3DLHA 1CVJA 1RHQB 2LKZA 1VJQA 4WP3A 1NJWA 5IQ6A 3DGPA 3P8BB 1TL7B 4O0IA 1RTDA 4FS2A 3UW1A 4C97A 1U1KA 3SQGB 3MR7A 1J5EJ 2DR7A 1H2VZ 1S79A 3M8SA 3PKYA 4Q5VA 4KBIA 3JS9A 3RAQA 4PWDA 4NMXA 1KONA 1WJ9A 2FUG9 4DJBA 3EVMA 3BPDA 5DLFA 5A76A 2C22A 4YDDB 3G87A 4ENOA 4WP9A 2HKEA 4ZLJA 3RW7A 2JDJA 2VQEF 3BDPA 4PG5A 4G65A 4L75A 1PSDA 3JTPA 2MKKA 2RSQA 4K8RA 5A0YA 4B9MA 4NLQA 2L9NA 1JWWA 2VQEJ 1KLNA 3AXMA 2VJVA 1R8CA 3WIVA 5CD4A 3F73A 4RO0A 2MHEA 1EJ7L 1GT8A 3KHHA 3SSRA 2FVRA 2OFGX 3EM1A 4LSZB 2DNNA 3KLFA 1FI4A 2CJ9A 2OMLA 1IBLJ 3VAGA 3NBPA 1RB0A 5EWGA 4DLGA 1VK8A 3RB0A 2RU9A 4CH7A 1I3OB 2RD5C 3M8PA 3AH6A 3WQPA 1FVSA 4EMDA 3QO9B 2LMIA 1ZS6A 3MMCB 4FVMA 3KXDA 3BR9A 1KOOA 3A12A 2KXHA 4P7VA 2QN6B 3KJQB 2DO4A 2V5HG 4TKTA 3OTBA 1J5OB 2CXEA 3ENWA 5GAHU 3NG8A 2F3JA 3OXGA 3OT9A 1QSSA 4K4ZA 2B4PA 3MR3A 2HBQB 3A3PB 3BBFA 3ZZRA 4N47A 3HHLA 3DRSB 2LECA 1YBUA 2IIHA 2Y0BB 1FDNA 4C98A 2ZH7A 3MXHP 1S1VA 3H98A 1SKWA 3KK2A 2VG6B 3HF5A 1SL0A 2FVSA 1IWGA 5HLFA 1XTZA 2DB1A 3JYTA 3O44A 4LQ9A 4OYIA 4Q8FA 4ZKAA 2HGNA 4MKBA 3T5JA 2ASLA 5E33A 2QYGA 5B0FA 3H20A 3RG6A 3V6DB 2VF3A 1T3OA 4M8LA 4EK2A 1FE0A 2W9CA 3R7NB 1SJ1A 3PYGA 4UQTA 5BYQA 4A8OA 1UL3A 2UUBF 3TZWA 3AD8C 1JXLA 3ISNC 2IBKA 2XNRA 2MSSA 2AEJA 1UTAA 4RR5A 2JZ5A 2W2NP 1EAYC 1RAHB 2KHDA 2RJZA 1WHYA 1JX4A 2UUBJ 3NY0A 2ZBPA 5HP1B 4FF1A 1S1XB 1U1MA 2NREA 5KG5A 2BQUA 3KLGB 2DVIA 1SVDA 1YZ7A 4I7FB 4KHPF 3I0SA 4OI2A 4Y00A 2HVEA 4FPRA 3J7YU 2B7CB 2KFNA 1YKWA 4UOGA 3TUZC 4XPEA 4RPFA 4G1IA 4PQUB 4KHPJ 5D77A 4OJ1A 4I6WA 2XGPA 2R2SA 1WC6A 4RNOA 3BSCA 3MM6A 5CYQB 3KUEA 1NH8A 4WKYA 4IH5A 4XDDA 3V81A 3RBZA 2NSBA 4PXCA 2IVFB 1EARA 4KV8B 2J5AA 1VBYA 3RYLA 4TLQA 1IWAA 1RWPB 5EN1A 4X4PA 1YJWS 5CQGA 1SC3B 3QSYB 5BR8F 1H38A 1R8AA 4M94A 2NZ4A 2D7SA 5LXYA 3J80U 1RKIA 3FEYB 3MR2A 3PZPA 2FJBB 5A8WA 5BR8J 2ZHOA 3NOGA 2AYMA 5A8RB 2XSJA 4TLRA 4HEA9 3R5AA 1S7HA 4ZPBA 4EI2A 4B3OA 2ZHAA 3W64A 4HH0A 1MSWD 1WTBA 3RBEA 2NZCA 2IDLA 4F0HA 1Y5IB 3M30B 1B3TA 2DY9A 3UNYA 3G6YA 2ZH1A 2P5VA 3BEGB 2XLJA 3GFYA 4ZVPB 3FBFA 4GO7X 1Q81T 2KN4A 3CD0A 4M95A 1I5OB 3S7RA 5K14B 3C66A 4I56A 3O5TB 4F4XA 1UETA 2J6TA 4J9UE 1J2VA 5I3UA 3C15B 5A8KA 5L39A 2FJVA 2KL8A 4KO0A 3OJUA 5F0WA 1IJFB 4KGXB 4Q2LA 2ZBQA 4X2BA 3DRXA 3DLEA 4NYPA 4ILMA 3PIOQ 1KNZA 2AF6A 2PEHA 3BGFA 2VFTA 2FJWA 2AJQA 1WEZA 1F3VA 1Z2LA 1MLAA 3W8GA 3DOMA 4RW9B 1WF0A 3ZZPA 4B9SA 4XIUA 1Q78A 4WIIA 2J6UA 4H4KA 3LGMA 3H2LA 4DPUA 2DHXA 1DFDA 1FWLA 4CH0S 1IXKA 4LREA 1X4GA 4FXWA 3KK1A 2NSCA 2SXLA 3RAMA 4DFMA 1RWOB 1TAUA 3V4MA 2H4WB 3CCZA 3A8EA 1U2CA 1VRTB 1YZ6A 4YUDA 2IMWP 4MT1A 2QIFA 2FHOB 2BANB 3DXBA 6AT1B 5HVGA 1SQEA 2IJRA 4JI8F 4MAKA 4AL5A 1K1QA 2DHHA 4C8LA 1WG5A 3G82B 4USHA 4DPWA 1HKAA 4ZLNA 1M5SA 5ADZA 2GX8A 3SXLA 4JI8J 1X60A 3EGWB 3MEEB 3BF4A 5AXLA 2CJKA 4EBDA 3I55S 1Y4ZB 4JV0A 2FVCA 4P73A 4J9NA 2MXYA 4NOHA 2YPZA 4OYZA 2ZOGA 3HXMA 4NLUA 4QU6A 4WBFA 1BD6A 4CI0B 2AEFA 1CSJA 2MHNA 1FE4A 4IOAQ 4RBUA 3WBZA 4DZDA 2ROGA 1OS5A 4OI4A 4DN9A 5I3PA 1JLFB 2BE7D 3CCUS 1S10A 4KH0B 2MZJA 2E5IA 5K9FA 2E9RX 3QPIA 4PKDB 3K2YA 2BJ7A 2MKHA 5A2QY 2M88A 1T11A 1RBOB 1YRTA 1JKHA 1W2BR 2G0JA 2YQ0A 3MZIA 5ETQA 2P9GA 4I68A 1C0UB 3C16B 1CJKB 2DJWA 3OXLA 4OI1A 3QMQA 1UVNA 3UNGC 3CD6S 3D7SB 4IH7A 3Q8QB 1TL1B 1KRPA 3DNCA 4YMEA 1LOUA 1YIJS 1S6QA 2FLPA 1ZM9A 5HVHA 2L48A 4YN3B 2C2KB 4USMA 1EKRA 4U67Q 1S49A 1R0AA 4KB7A 2W1BA 2J8AA 1AUSL 1VQNS 2CPZA 4MFBA 1S5ZA 1RT1B 3MM9B 4A8SA 1UAWA 3HKZD 3VAKA 1WC3A 3GR0A 4OYMA 1XNRF 3C3LA 3D3BJ 2HFVA 1TFWA 4YDXA 3PY8A 3LP0B 1MMNA 2AYEA 1NZAA 3P4UB 1RI7A 5HN0A 1T3NA 4FF2A 4ZVGA 3EE3A 2AGQA 1NJYA 4TU8A 3M2VB 3J7ZT 3Q22A 2XYGB 3CIMA 1XJWB 1XNRJ 1FRLA 2HRYA 2VPXB 1ZM3A 2Q3PA 1U48A 2VDIA 2U1AA 3QRPA 2GMHA 1BQMB 3MTJA 1LXNA 1S1WA 3HT0A 4GVLA 3QJJA 4NLXA 5KFUA 5AE3A 4ECQA 2UP1A 1S0VA 2B9EA 2AP6A 4OZJA 2WONA 2HHQA 1TKXB 3UFCX 4WTYA 1KQKA 3MCNA 2LCWA 2UUWA 2B56A 1CEZA 3J7Z5 1QTNB 3AFGA 3M9OB 2VBWA 2HNZB 5L38A 2HYIB 1D8ZA 1OY6A 3CJ4A 5AJ3F 1FX2A 9ATCB 3RB6A 1REVA 2DRAA 4Y34A 2CQIA 3W60A 2HAFA 2YQ1A 3DCAA 5GADU 5AJ3J 3PHEA 2FJEB 1UPPA 3IP0A 2WB4A 4GC6A 3W5XA 4KAIA 3GG0A 5ETPA 3TQEA 4K4TA 3DGPB 1NUEA 3PJ9A 5J1EA 1M5VC 3H90A 3R27A 2VIHA 2EFOA 3HX9A 3GFHA 4CLWA 5C25A 4C3LA 2GHPA 4ZVQB 2MJNA 3GMGA 2P9EA 2W2MP 4UZBA 4X4SA 2OHDA 2W8KA 1ACMB 4A8WA 1RWUA 3R6GB 3RRHA 5GAEU 1O0PA 2A6MA 4CO0A 1K73T 2JJ4D 3IA0A 2DGXA 3B6BA 2Y1LB 2GVZA 3OFGA 3CC4S 2EPIA 2C2RA 3BDEA 4YB6A 1PILA 4NZ0A 4LIWA 4C11A 2WHOA 4LRCA 5A0YB 1WG4A 3JSYA 1NNDA 1L3KA 1WUUA 5D4PA 3DI6B 3F56A 2W4DA 2ASDA 1HPZB 4CTAA 3PFEA 2CNNB 1TKTA 3CMQA 2CJXB 3DLKA 3ZZZA 2B6AB 4IFYA 2YKMA 4UOCA 2PDAA 4OZ2A 3PX4A 1CJUA 4O44A 3KLFB 1NBEB 2DNZA 4F8RA 2E7XA 2E1RA 1FRKA 1BHNA 3CCSS 3Q86A 3UDCA 5IC4B 1N36F 1S77D 3E01B 2V6AA 4LFAF 1CQNA 3W2WB 1W7WA 2BZ2A 4DN0A 5C42B 3EGNA 3K5PA 5L1KA 1JNZB 2MGZA 1DLOA 1N36J 4NEZA 4LFAJ 4Q0BB 2CVIA 3TAMA 1C4CA 1FD8A 4KYZA 2QEXS 2DNPA 1LW2B 3KDNA 1S6UA 3KK3A 4N5SA 3QRQA 1VQSA 1SV5A 1VQLS 4DI6A 1DTTA 3F41A 5DGBA 1T7PA 2HMIA 1R6VA 2FC9A 1SQGA 3GSIA 1KKHA 2A2DA 1FDDA 2YNGB 2Q79A 4J9KA 4I1TA 4ZCLA 4JUZA 3KK2B 2IC3A 1IR0A 3BKFA 1IQZA 5HLFB 2CKWA 4NLWA 1VHFA 2HBRB 4I67A 4NLSA 4HHUA 4LF2A 1RLCL 2MMYA 3WHIA 2BJEA 4DR6F 1QJHA 3IM9A 2W9CB 4C8OA 4ECUA 4M5GA 4UW2A 4WFBQ 1EETA 4CP5A 1FKOB 4E98A 2BW7A 1VC5A 1RU1A 4DR6J 4ECTA 4K7QA 5FDLA 4DSKA 2OH2A 1RWKB 1T0TV 5HI7A 3NWGA 2BQRA 3OUYB 2DITA 1IBKF 4AL6A 2PO4A 5KT2A 3VVTA 2HS0A 3EVWA 4B17A 4LF4F 5KFQA 2KG0A 3M2UA 1NJIT 4R8UB 2CG4A 5AE1A 3TVYA 1IBKJ 4JV1A 4RL1A 2V63A 1I6JA 1JIHA 2ZD1A 4R5PB 2GW8A 4LF4J 2JRSA 1FTCA 2XY7A 3OR2A 2PI4A 3AQPA 3BGOP 4QYZJ 1OY8A 4H4MA 3SYZA 4K50A 3SIPB 1Q86T 5JJBA 4OLOA 1IUJA 3NAIA 3KG0A 1QAYA 2M8DB 2FGOA 3DGVA 4CQ1A 3B4DA 3AD7C 3V81B 3ZC4A 1B0PA 2N3LA 3D6HB 2GQ2A 2O5DA 4QWDA 3VF0B 2DPIA 2F8HA 3W62A 2OMOA 4AFFA 5K8PA 2HLTA 3R5JB 3BV8A 3NRBA 4KT0C 2CPXA 3GJSB 2RT3A 1LW0B 4WXWA 1RADB 1JLCA 3H40A 4DUTA 3F44A 1U6ZA 1VR6A 1PJ6A 2N82B 1Q5VA 2D9PA 2E1PA 5A8WB 1SJ4P 1HW9A 1TL5A 1NRKA 4DL3A 4B3OB 1LEOA 3PCOB 2VPZB 2UV8G 1XN9A 3TA1A 1Y7PA 2MQLA 3V6JA 1M1HA 5DZ6A 2WBRA 2LQ5A 3MAHA 2IM0A 3IO1A 1HW8A 3LW5C 2HQGA 2W2QP 3DKDA 3N5BA 2WVBA 3MAAA 2O67A 1Q7LB 4U8YA 3LGNA 4LF9F 2ZBIA 3JTNA 2ZBCA 4FYVB 1RGVA 5KFJA 4KSEB 4CT8A 2NXCA 4PRFA 4DPTA 4AT1B 1DTQA 3AJ2A 2KO1A 4CH1A 4LF9J 3LTOA 3O1LA 4CLTA 2WB1D 1SJFA 3GCXP 1U1NA 3TVZA 4ES1A 1LFPA 4ES2A 4HT5A 1JJCB 1MMLA 2DNQA 1D1UA 2M3DA 2HS3A 5J2MB 3MEGB 1U1RA 1N5YA 2RHQB 5ETSA 2QFJA 3FZBA 4F67A 3DOMB 5D6GA 3I5CA 2M70A 4DG1A 1LKZA 3NOCA 4KFBA 4ZDNA 1HA1A 3W5ZA 4WZMA 5F8NA 1KR4A 3BYPA 2ZH9A 3A3OB 4K4UA 2VB6A 4ID5A 3KK1B 4DZ6A 3TAQA 3H5UA 4NLDA 4LF8F 5HANA 4C8YA 2B9WA 2DNHA 2OTJS 1MW7A 4PG8A 2R7OA 2RU3A 2YWFA 4LF8J 1RBLA 3JTOA 1HYSB 2K06A 3RR7A 3ET6A 2V50A 2DR9A 2C3YA 3ISZA 1T05A 3T3FA 5K8MA 3L7OA 4F4YA 1RAIB 3LGHA 1UWBA 2KZZA 4M5HA 3ISND 4G1QA 4F2RA 1Q8KA 1Q95G 4WWSA 3DOLA 3MEDA 1P8GA 1HBNB 2FJXA 3TZXA 4IDKB 1YBAA 4ZVSB 4AXJA 4RU2A 4U8VA 1G3OA 2JH3A 2FIUA 2C2DA 2ZDPA 2BABA 1UEKA 2OPSA 2F4FA 1URNA 3SMZA 4P72A 3UCGA 1P1TA 3ZZYA 3VGTA 3K5LA 4UUWA 4IFVA 1RWWB 5KFOA 1FKPA 3H4DA 4DCPB 2UVVA 3D28A 2MKCA 4MYUA 2V34A 4RWXA 3V6KA 4F02A 2Y9HA 4C8ZA 4B3SF 1UJ5A 1UVKA 4BHQA 1YRUA 2GIQA 1MN9A 1S6PB 4IR1A 1YJRA 4DV6F 3P3DA 1V3RA 2BM0A 2ZJRQ 4CLUA 5DM7Q 5ETLA 2JVRA 4IOCQ 2QA4G 4PUOB 4ECVA 1RXOB 2DH9A 4ZOSA 1IM6A 2CPJA 1GEHA 4DV6J 3C14A 1BQNA 2FHKA 5T7LB 3FMWA 4TU7A 1Y9OA 2AZ1A 3JAMY 3MTKA 1U4BA 4EGLA 3DYAA 2PE8A 3CCLS 2KI2A 1S6QB 4LF5F 1EIYB 1HNVA 3IM8A 1UZDA 2RDJA 1WOOA 3QGIA 4YP3A 2QYCA 5A6PA 3MURP 2IA6A 1S1UA 2ALZA 4DL4A 3EZOA 3TJAA 4LF5J 1RTHA 3CT9A 3NS7B 3VGSA 1EB0A 2GJIA 3GFXA 3Q8UA 1UMJA 1LFWA 1O6XA 1WF2A 4X66J 2CZVC 4Z2XA 2G2OA 2YWHA 1M90T 4OJGA 3IR5B 3DM2A 2G0IA 1TK5A 4I64A 3D68A 5KT3A 3FBEA 2IYIA 4NCGA 2E5HA 2IJFA 2ROPA 4KR0B 1M5KC 3JSRA 5CYMA 4W90B 2VUGA 4DU8A 2VFUA 4I69A 3ZTOA 5IM0A 2HQ3A 1OY9A 2VKRA 1WACA 2J9DE 3NNHA 2DXDA 1JXVA 1W25A 3N9UC 3VAJA 2KT5A 4IO9Q 3G8QA 3DOKA 2BACA 2Z58B 1EZZB 2BEFA 4LSLB 4FNIA 2W7OA 1SH2A 2NXNA 5HMWA 2WOMA 3IRXA 1U8SA 2DEIA 3W3SA 5IZHA 4TXSA 2OEMA 4E2FB 5H9EK 3AA8A 5DDPC 4ELTA 2OEKA 3FC9A 2KH9A 1U24A 3BQ0A 2ZWOA 5IC6B 3OHBA 4IG3A 4R0JA 5KT5A 2GFFA 4UT4A 2CQ3A 3KG4A 1FWPA 4A8KA 2V69A 5HROB 4ED3A 4DX6A 5E3PA 2RF2B 3ONQA 2AU0A 3QSIA 4OV6A 3SFUA 1GK8A 4QIFA 3Q8SB 1VQ6S 5F8MA 2FVPA 5KFTA 4OIXA 2LP4A 5B09A 3I5AA 4XAKA 2A2CA 5J1EB 2Y1JA 1B0VA 3GV8B 3TANA 1WI6A 2W9BA 2MLXA 3TARA 1PKUA 4J9VA 5E7OB 4DQRA 5C25B 4USWA 4WK3A 1DURA 3PYEA 3C2PA 1T9WA 3BN4A 4ZHRA 2ZKTA 3TJ8A 4GRSA 3GJTB 1SKRA 3PRVA 2MLYA 3S8SA 5J2QB 4P7TA 2D3ZA 1NHVA 1LXJA 3QLHA 3RB3A 3EZUA 5F3ZA 5B0CA 2OPRA 1HNIB 4Q2MA 2EVZA 4C11B 1HI1A 2JC0A 2XO6A 2IJNA 2R7RA 2HFSA 2JEIA 3HD1A 4LR9A 4CTAB 5KTQA 1HQEA 1TKTB 4DF8A 3TI0A 4Q8EA 2BJDA 4ZVRB 2KKHA 1HL6A 3K59A 2V4JA 4PG4A 1YJUA 4QYRA 2XZTB 3O2IA 3QBCA 1NCLA 2HBYB 4O44B 4ZP9A 2ZH6A 4OZLA 1S9EB 4U7UD 3CD7A 1H2UX 2MYFA 2Y8YA 4N8NA 3OL8A 1T9XA 2EK1A 4JI6F 1GMWA 4OJHA 2B4OA 1VQ9S 3R2DJ 5IT9U 2FZKB 1WF1A 3VALA 4L74A 3MPYA 4I2PB 1BQXA 2RDDA 5HJXA 4ZVUB 3UR3C 3POTB 2MGZB 4JI6J 1IR1A 1DLOB 1T9VA 3M1VB 4LT6A 3W7BA 4UY8T 5IT4A 1FRIA 3ZTQA 3BB5A 1HNXF 2HHUA 1B7YB 4KIAA 2QT7A 5SUHA 1E6VA 2L41A 3OL9A 1FHTA 3KK3B 2A10A 1HNXJ 2ZH4A 3EICA 1C4AA 1H0HB 4DPXA 1S4FA 1U02A 2J9DA 2EKNA 3W1YC 3CJRA 4LF1A 4PG7A 5DG9A 3HCXA 1DTTB 1ZPVA 2ZVSA 2DTJA 4EBCA 5LOQA 4YB7A 2HMIB 3IR7B 1JLEA 1YX2A 4ELVA 1K0TA 1HIYA 1S0OA 5E3QA 1N52B 1CQMA 2O01C 1WDTA 1P27B 3KMQA 1JLGB 4ZP7A 3QIPA 1Y5LB 2ZWPA 4K4YA 1X5OA 4CYUA 2F65A 1CG2A 4P2XA 3FKBA 2BOPA 4O3QA 5HMYA 4DMZA 2IAJB 5D78A 3OL7A 2C2ZB 4ED0A 1HNWF 2XG8A 2PD1A 3MM5B 1TQLA 1TU0B 2BMBA 4B9UA 2E9ZA 3TJ9A 3GR1A 1KVIA 1X4CA 2VPWB 3MGJA 2WSEC 2M4MA 1D8YA 1HWLA 2CZ4A 3CCJS 5FIIA 2CQ1A 3KLIA 4DV1F 1KWMA 3CGIA 2XS2A 3HHNB 1WSRA 1IBMF 3VV2B 3HK2A 2ZDOA 2QLWA 1NDKA 3R1LA 1QE1A 1VISA 4DV1J 2V9KA 5CCLA 3LP1A 4EUVA 5JVHQ 4NEYA 3J7AN 3M8YA 4EO6A 1IBMJ 2YWGA 3OR2B 5H9FJ 3GYXB 2BVZA 3DRRA 3IR6B 2IM2A 2DKOB 4YEAA 1NSPA 2HWHA 3VQSA 1X9MA 3QAEA 2LLZA 3HZGA 1SCJB 2H3EB 3UO0A 4X4QA 4WE1B 4BBYA 3NLCA 3LPYA 1R31A 1RT4A 1U49A 1F2GA 2HZAA 3OBIA 3MFHA 3D1QA 1DQ9A 3E8OA 5ETMA 2OPQA 4ICLA 4ER8A 2GAHC 1VOMA 4OX8A 1RP5A 3IS9A 4P71A 3JSMA 1PAUB 3RU0A 2EI5A 2DNGA 2NLWA 4N77A 3EUNA 4Y2MA 2Q1LA 2XGQA 3ENQA 1S1TA 2F9JA 4ZVEA 4RW7A 3IWXA 2YNHA 1P9YA 4K2XA 2C42A 4YY3F 3CE8A 2QFIA 4RLEA 4LF7F 2ZVIA 2Y3YA 1FTRA 1RWMB 3KLHA 3CCQS 3RZAA 2YY3A 2DH8A 4DPYA 4YY3J 5KFHA 4ZVTB 4LF7J 3V4IB 2NCKL 3HKWA 3HZEA 5D8HB 1DQ8A 4O4GB 2WVCA 5KFEA 5KFPA 3IXQA 1WG1A 2ACYA 1IVZA 5HJYA 1YBTA 1VQOS 1TAQA 1VBXA 3ENVA 1A0OB 5DJBA 2V2QA 2VH7A 1WDDA 2ZC3A 3VR1A 1S4EA 3BQ1A 4XK8C 2ILYA 4E8UA 1FXLA 2XY5A 4RW8B 2I1RA 4WFXA 3QQCD 1Z2ZA 2MQ8A 4Y65A 1X8DA 3M6XA 4DG1B 3EXCX 1CJTA 1BWVA 3V5RA 2VA3A 2XS5A 5I3QA 2CDRB 3HD2A 2XMMA 4ID5B 1PJ5A 3M9NB 4I0WA 3MMBA 5LL6d 3KUGA 4Q45A 3W61A 3PX0A 2IVYA 4RW4A 3DLJA 5DQIA 4KKOA 5GMDA 4PPDA 4ZN3A 1WEXA 2XMKA 1HMVA 5AT1B 2N7CA 3U1LA 3P5TL 2R2UA 3CJ0A 3UN3A 2VG5A 1KFSA 3B8HA 3D2WA 1ZAXA 2AJFE 3B78A 1S0NA 1T05B 4NLTA 3V2UC 3VZHA 3AB2B 4L3KA 2OTLS 1JLAA 4G1QB 3C19A 3FSIA 2X1BA 3DOLB 3MEDB 2HBZB 1R0BG 4QZVB 2ATLA 1X4BA 4DBQA 3UVJA 4Y2KA 1T9YA 1YDLA 3IAS9 1Q5YA 4PG6A 2MZSA 3N0VA 2CPFA 3SCIE 4EYHB 2DNRA 2QA4S 1GMVA 4JI5F 4ZP8A 2EFQA 2B9XA 5BYRA 4FYYB 5HQ8A 4AYBD 4USVA 4P52A 3CC2S 3HT3A 3ILOA 3MM7A 2EFGA 4IFVB 1ZA1B 4MK9A 4U6PA 2Q6CA 3CCTA 4JI5J 1UA1A 2RQKA 4ZPDA 1PAEX 3I4HX 3CXCR 2J0QD 4J9OA 2UUCF 4CNYA 2C3PA 5J1NA 2FY1A 5KOXA 1SPBP 1FF2A 4FXVA 4KGVB 1TELA 1V5VA 4V19X 2BKPA 4B9VA 3DRPA 3G2XA 4XDCA 2RE1A 3BS9A 2UUCJ 4AQYF 1NDCA 4LFBF 1DRZA 3KHRA 1I94F 5EDWA 4K4WA 2BV3A 4OHZA 2DK2A 3WIUA 2VG7A 4AQYJ 2MEWA 2GJ2A 5EWEA 4LFBJ 3HHDA 2QA2A 5F8HA 1C1BB 1UVJA 2Q66A 1GFWB 3TUPA 5B08A 4X84A 2YKNB 2VKZG 3RBXA 5KG2A 1LV5A 4GVBB 1KHWA 4O3RA 3R5GA 2POKA 2AJ0A 5D0EA 4F36A 3M8QB 2PN6A 4Q43A 1RHRB 1RTHB 2LQ8A 1HBOA 1WKKA 5F9NA 4WYLA 2J9EA 2DRDA 4IH6A 3SQOP 2V67A 3ZNUA 4X4TA 1F9HA 3RB4A 2R9LA 1RTIA 2HG4A 3CJSA 2FD2A 3Q0AA 2VHGA 1U0HA 5JMNA 1RBAA 1LK5A 2KU7A 1HBUB 3K17A 2NQPA 4WXOA 5I42A 4RNNA 2LVWA 2ZUAA 4NLRA 2CIMA 5CYMB 3OVSA 3FCWA 1KLMA 1KBRA 4PABA 4XPCA 2GGPB 4DSFA 2AX1A 8RUCA 1T8EA 4KJIA 1OIAA 2DT9A 2X7IA 5F8LA 4WFYA 3WZ0A 2MQQA 2IRYA 2FC8A 3A1YG 1NPKA 3GB0A 3FQKA 1SBRA 2HNYB 2Z30B 3HI9A 4NWBA 2CPEA 5F0UA 2WOMB 2VDHA 3MDFA 3FFIA 3LALA 4LQ3A 2L9DA 3AOBA 3TZZA 1TR0A 1JJHA 2DHGA 3DN9A 3FSYA 1KS2A 3A8IA 2W8LA 2ZUGA 2UUAF 2NS1B 2LU1A 2ZBRA 2ZEJA 1WOSA 5D3GA 3PACA 3KLVA 4FF3A 1TL4A 2OI2A 5RUBA 3ELHA 1TUGB 3QZ8A 5F9LA 2UUAJ 2RMLA 4YB5A 2GCFA 1FDAA 1H7XA 1S9FA 3R9LA 2BJ9A 4BCAA 3IBWA 5A2QU 4ZCMA 4DV5F 5C24A 3EJMA 3KHLA 2K1RA 1FXRA 3HVTB 2HK2A 3NGRA 2FZGB 2MTLA 5GMEA 3J81j 1RISA 3LUYA 4DV5J 1BMQB 1SIWB 5ETTA 5HO4A 3KJVB 2XO7A 2YWWA 4WU2A 3QFHA 1JK9B 1RT7A 2XB2D 2F40A 3ZTPA 3BPSP 4DOZA 5KFLA 2OPPA 1NK0A 3EGVA 5KFRA 3W66A 2XYHB 4FPIA 5J2PA 5EX0A 2B3TB 4L72B 1VFJA 2OJ3A 1NK7A 3MPDA 4B08A 1NKBA 2V94A 1HD1A 2C3UA 1ZH5A 3J81Y 2GC8A 3S01A 1XMQF 1UKUA 1SH0A 4KGZB 3P6YC 2XC9A 3QT7A 1HBMA 3BKTA 3PYFA 4DWIA 4HACA 1VBZA 1SJQA 1XMQJ 3OSNA 3NKYA 1KTVA 2BX6A 1C1CB 1QD1A 2KZMA 1Y5NB 4MMOA 4I2QA 4DV7F 1U25A 1RAEB 4WP8A 1K9MT 3M32B 3AAWB 1ZZFA 3I9ZA 1Y11A 1RT5A 1SJ3P 2ZJPQ 1SUQB 5L46A 3M7VA 2JC1A 2XLKA 1VQ8S 4DV7J 1MROA 3SV3A 3VAIA 4TYAA 2IRXA 1RT2A 3DMJA 3QAUA 1ZYQA 3KLEA 4JB8B 1K1SA 4M5IA 1OYDA 3QYYA 3I0RA 2QE5A 1WNEA 1VQPS 3MCMA 1QTMA 4WZQA 2I6WA 4V1Ak 1VYAA 2AD9A 2EW9A 3HHLC 4UUXA 1WHWA 3RW6A 1AA1B 1MWYA 2HIYA 3OFEA 3TWZA 3NS6A 2X3DA 5CH7B 3KNAA 3VQTA 3P5BP 4B3TF 1IKXA 2OSQA 2RUSA 3TEGA 2CFXA 3D0GE 1I1GA 1X5SA 3QT6A 5LJ3Y 1VRUA 1U1LA 1KSPA 5BJRA 1H7WA 5L1LA 5AXMA 3SCLE 3EZ5A 3TRGA 2RS2A 3CJKA 4B3TJ 2V68A 4AL7A 1DAXA 3PVXA 4OHWA 1O8BA 4HTJA 4CYUB 2H54B 3D0IE 5L9XA 2RKIA 3DLGB 4ATNA 4QU7A 3GIMA 3SDEA 5FLXY 2Z2LA 1MWQA 1IBLF 2G2ZA 4RKUC 1YSJA 4BLGA 1TVRA 3S1TA 2KFZA 2P8IA 1D9DA 3HVAA 2ZOMA 1FK9A 3QATA 2K7KA 1TL3B 2COLA 2AV5A 4LRDA 4GKKF 4NL5A 3D3CJ 2GZOA 4Z7CA 4LSNA 1PCAA 2H1YA 5F8GA 2E7VA 3ITHB 1FT8A 1QE1B 1S9GA 4GKKJ 3OTOF 1HHTP 1GXUA 3ZZTA 3LP1B 2GNKA 4NLGA 3PRBA 2XSFA 1YVFA 4ED4A 3KHGA 4NCAA 5AXKA 1T94A 3BO4A 3OTOJ 4Y6IA 5EUHA 2X1AA 2JVOA 4MYTA 2YNFA 3W2VB 3PEHA 4L6V3 4OX6A 1X0PA 5GAHI 1WC1A 1HQUA 4QWBA 1R6YA 2V2ZA 1TKZB 3A8KA 3CJ5A 4JI1F 1ZAVA 3T5HA 2AYGA 3KJNB 1RT4B 1N4LA 2W7AA 3T1AA 1N5VA 3PJWA 3EDQB 2ADCA 3BSAA 4Z7YA 1S99A 4JI1J 2W4PA 3IS9B 3WX8A 1AZSA 4URGA 2FDNA 2VD3A 1BGXT 4DR2F 1X9WA 3OLBA 1LWXA 3JSMB 1WSVA 2R3VA 4DR4F 1Y0HA 3SQGA 3MWBA 4JV5F 1NEEA 4IO1A 3FEZA 1KOHA 1NLKL 5T41A 5KFMA 2CJYB 1T95A 2KXNB 2JL9A 1FRJA 2AX0A 4DR2J 4DR4J 1DY3A 4JV5J 4QR1A 4HKQA 1B0TA 1TK0A 1GH8A 1IKYB 2GA7A 1GAOA 3CCMS 1WC0A 3N6MA 2MKYA 1YJ9S 1VHIA 5B0AA 4DR7F 2C1EB 2VBZA 2IM1A 2UU9F 3DU6A 2GQCA 1N5QA 4ZPVR 1HHSA 4M5DA 3FEXB 4J91A 2KT2A 4DR7J 1SH3A 2UU9J 1Z4UA 3J7YI 2DR8A 4KHMA 1EP4B 3D6FB 1IKVB 3IN5A 2MDAA 4J9SA 4IRCA 3DDIA 1RHMB 1O5JA 1ZA2B 2C2NA 2KDOA 2YVSA 4TY8A 1WKLA 2Q6BA 5KT4A 1U0SA 2DIUA 1GNKA 5G0RB 1S48A 5CAAA 3LANA 2BE2A 1QAXA 1Q79A 5GAGU 4H4KC 5E2QA 2XEXA 3CB4A 3FVYA 1C0TB 3LAKA 2LXUA 5GAGI 1YK9A 2HRUA 3BM7A 4ED2A 3QO9A 3CJTA 1VQ5S 3MMCA 1NU4A 4USJC 1NK4A 1X7VA 4LJMA 2Z2MA 2VICA 2IMOA 2Z4PA 3MHYA 2YX7A 4HH1A 3MOJB 3Q83A 3GIJA 1J5OA 3LP2B 3GV5B 4FF4A 5DZ7A 1NM2A 2GHVC 1U7LA 3Q23A 1U1QA 4IYQA 4RW4B 4N41A 1PO6A 4OZ3A 5CZVA 3G8SA 4NZ6A 3MR6A 3IGVA 3MUMP 3DRSA 4KY3A 4WU3A 3NNAA 3R5BA 1YJVA 3M6WA 1V6HA 2VG5B 2VG6A 3AOAA 2V4QA 1QUPA 2E9TA 2R4FA 5HL7Q 4F50A 4HHHA 2MQPA 1RTJB 3ILIA 2XCPA 4YHHF 4DFKA 6FD1A 3SFGA 4P75A 4CO2A 1MMDA 4PWUA 3TA0A 5H9EJ 2RQCA 5LMNF 3CO9A 3PTWA 2JEJA 4ZJQA 3BO3A 4YHHJ 2QZ8A 2WSFC 5HAOA 3NCQA 5LMNJ 3K0JA 2Z57B 4NLYA 1UPMB 2ZZTA 2X1FA 2J7WA 4IQMA 3ZNJ1 3VAHA 2VL1A 2KM8C 3BGRA 4RBVA 2AMCB 3D54A 5HP1A 3GYNA 4D3HA 1S1XA 3MM7B 4I4BA 4USTA 3KLGA 4NLVA 3Q24A 2Z2YB 5THWA 4B3MF 4CWBA 4EZ6A 5B0EA 1UFLA 2WK4A 1U26A 4ZVFA 2EG2A 2O66A 2I5JB 4ZCIA 3ZO7A 3Q8VA 2B8QA 4KQZA 4B3MJ 4PQUA 2V0NA 1RSCA 1PC4A 2WW8A 4CO5A 3FGVA 5CYQA 5D0GA 3NGUA 1XMBA 1N54B 2HHVA 3NCPA 3KYLA 1XWLA 3MCOA 3I9V9 4DSEA 3O3LA 4DS4A 2CQPA 4KV8A 2FLLA 2RRNA 2KVIA 3KMSA 1RWVB 3BJYA 2DISA 1RZMA 5HBMA 4WFZA 2AKWB 2E44A 3GTYX 3L4BC 2BYCA 1X4AA 5MLCV 2XMJA 2CQGA 4ZK7M 4JYAF 2L9WA 1HBOB 4NYOA 3I56S 4CLPA 5A8RA 2D69A 4DV0F 1KN6A 4JYAJ 1N0UA 1FJCA 1SC6A 5FD1A 5L8RC 3NCRA 1XK8A 3QWUA 2XMVA 1U0HB 4HT7A 1QVFR 4F4KA 3FMBA 4DV0J 2HVZA 4LRFA 4NI2A 1KLMB 1X4HA 3DC2A 5LSLA 4PZVA 4KE5A 5K14A 2CPDA 2DGTA 2QMWA 3NNCA 4PXEA 4CLYA 4DPOA 5DM6Q 3MM8B 3C15A 4K59A 2XZWA 1RYSA 3PDNA 3ENAA 3BO2A 2RIJA 5LXRA 3PX6A 5ETNA 1S7IA 1A9NB 4U7CA 2C3MA 2DEJA 1OJ4A 3KDOA 2LYVA 3SSSA 3D66A 2RVJA 4QIWD 4RW9A 4C2MA 1X9SA 1JMTA 3M6VA 3UPFA 1KQSR 1J27A 2YNIB 2M5YA 3CJ8A 1WD6A 3HSDA 5M2RA 1CJVB 1LK7A 1SL1A 3GONA 4YB1P 1ZAWA 2GV1A 3QT5A 4IR9A 1VRTA 4F4ZA 4U95A 2BANA 2JEGA 2WZ1A 3OTDA 4F7VA 2DIVA 1TP7A 1BXNA 1C2PA 1FX4A 3G82A 3MUTP 4PEOA 5K20B 1Q8IA 4WK1A 2A3JA 2ZC4A 2JHEA 2B43A 2OO4A 3PXGa 4X4NA 4MIAA 3JAMU 4C0HA 1F5BA 4EYIB 1RQ0A 2AJ4A 2M52A 3MEEA 4A48A 4ANCA 4P6QA 2UXCF 3RAXA 3RJMB 3P45B 1FCAA 1XBWA 2GVDA 3TUIC 5IV3A 2W2PP 4IG0B 1IKWA 2UXCJ 1RT3B 2G1HA 5M2PA 2DGQA 2XQCA 1HBMB 3DHWC 4KTQA 2QO3A 1SB6A 4HACB 3HSGA 3MEKA 1JLFA 5D4OA 3NMAA 5BYSA 3GJQB 2W01A 4TN2A 2R8GA 1TZ0A 4CCHA 2FLNA 4OX9F 3U7JA 3LWMA 5GADI 4O3PA 1OSCA 3IWNC 1RT5B 4F3MA 1H72C 3PW0A 1MROB 4DQIA 1C0UA 2J9CA 4OX9J 1WHXA 4F26A 1RA7A 4A8YA 3C16A 1CJKA 1KDNA 1RTDB 2KG1A 1RT2B 2O1PA 3MPVA 1PGZA 3PJXA 2D74B 2G4BA 2CUYA 3I0RB 4URSA 4F3QA 2FJDB 3OSPA 1QAJA 5JVGQ 4K5SA 1U09A 1TL1A 1IJEB 4PWDB 3K8WA 4OYAA 2VASA 8ATCB 4EU0A 4NA3A 3NS5A 1M0SA 1UW9A 1U1OA 3T19A 1ZM4A 4MKAA 4USKA 1IKXB 2IPOB 4PYAA 2JLGA 5KFBA 2RAQA 3I82A 2CJBA 5GAEI 2QMUB 1B99A 1VQ4S 2I0XA 4DX8H 2C2EA 2WBMA 2FJAB 2N4DA 2GIFA 2P6TA 1RT1A 3MM9A 2CJQA 3L7UA 3EX7B 3M8ZA 1NXIA 2Y1RI 4ZITA 1OSDA 1X0FA 3LP0A 4USUA 5HQMA 1Q53A 2KYXA 2HQIA 3PO5A 2E1MC 4ED6A 2WW4A 1TVRB 4Y28C 4FP9A 3PW4A 2M2BA 5J2NA 2E1AA 2NXEA 1SQFA 4WIQA 4U7UK 3NBPB 4C3MA 2I9SA 3EPIA 3U02A 1OPIA 3L3CA 4KGKA 3M8PB 1FFGB 1TKXA 4JI4F 1X4EA 4KPYA 2CQ4A 1S9GB 3BSOA 3CO0P 1N6QA 3I4PA 2K8GA 4HTIA 3EPGA 1G1XA 2B5JA 5KG7A 4JI4J 3D0HE 3ILLA 5F41A 3R7BB 4J90A 3HFVA 1N5TA 3TAPA 2IM3A 2YNFB 1Q16B 2DGSA 3HMJG 3GIKA 3N6LA 1JNRB 3M8WA 3KWMA 5U47A 1X31C 3ULHA 4N76A 4J5OA 4ZPAA 5KG1A 5KG0A 2NXUA 3OW2R 1ZZNA 2YWEA 3HHLB 3B4MA 2E1CA 4LVOP 1F60B 2PEBA 3T1YF 1S59A 1S1VB 1LWEA 2GMLA 2Y8WA 1KD1T 5EHHA 3L09A 2DCLA 4LRAA 4L76A 4DR1F 3JYTB 4C7QA 1AZSB 3EXYA 4PR6A 3T1YJ 2C2MB 2D3OR 1XR5A 3KNGA 1BLUA 2HAIA 4DR1J 1F6TA 3HFZB 3S6EA 3CULA 1RHJB 4M63A 4EWTA 2EC2A 5KFSA 1BY9A 2AZ3A 1QY7A 1GQEA 2QSWA 2K3KA 1XQIA 3VGVA 2F5GA 1UEVA 2XBPA 2H5JB 4RX6A 3UE2A 1VC0A 1R8BA 5T14A 4FKYA 2HK3A 4LUBA 4CRJA 4RWWA 2OSRA 1M5PC 4WYWA 2ACMA 2R8HA 1ZM2A 4PPZA 3DI6A 3CVKA 4MIWA 2XY6A 1HPZA 4M5DB 3I0SB 4DF4A 1S0MA 3BYRA 1U8WA 3I87A 4CNZA 1OYEA 3I96A 3N4WA 1M1KT 2R7UA 1BC6A 5SZTA 2B6AA 2R8IA 2MKSA 1XNQF 1XMOF 3K7RA 5HK4A 2DD8S 1N5SA 3R3TA 1F5CA 3MM6B 4TY8B 3BBCA 3WC0A 1G2EA 2RHSB 3AY0A 1QAIA 1XNQJ 1T03A 1XMOJ 2ABYA 1RHKB 3E01A 1FD2A 1TUWA 2BE2B 4DL7A 3W2WA 2XTJP 4JI0F 3PR5B 4QIGA 4P2MA 5C42A 3HHLD 3H5YA 3PG9A 4C0OC 1NK5A 4ZLPA 1NKCA 4K0KF 4JI0J 5D0HA 4Q0BA 5DETA 4WFNQ 3NL0A 4Z37A 4X64F 1VBKA 4DV3F 2M0GB 4DL2A 1LW2A 2R7XA 1M5OC 1RKJA 2V8GA 4NX9A 2IBOA 4K0KJ 3ZTSA 1GX6A 2XSJB 3FBCA 1A6LA 2IFXA 2HHTA 4ILRA 4X64J 3L9ZA 4DV3J 1AW0A 1S12A 3G71S 3T5LA 2YNGA 1H6KX 4QWAA 3THPA 5HATA 5EX3A 4DQPA 2J7UA 4B9LA 3OD2A 3G6VA 4MKVA 4Y2AA 3Q89A 1AFIA 2VPYB 4KC5A 2JX2A 2L3MA 4GC7A 3RR8A 2O3DA 3LH2S 4F0KA 2CRLA 4QW9A 4DV4F 2AJ2A 5I3UB 2LA6A 5CYJA 1N33F 4FBUA 4KPCA 3UQSA 5A8KB 5DLGA 4OI3A 5K5MA 2KRRA 3IC1A 4KO0B 4RUAA 4DV4J 1FKOA 5FJ4A 2HVDA 3D1HA 3WDOA 2EFVA 3DLEB 1N33J 2D3UA 3K5NA 4ZMMA 2H65B 4P10A 3I32A 2WAQD 3BGRB 4RW6A 1M1GA 3GFZA 3OUYA 3H8YA 4DV2F 3P49B 2IVMA 4XO0A 2Y0SD 3R7SB 3PV8A 5KG6A 2B7BB 1RYRA 4R8UA 4OL8A 1RA6A 4DV2J 2LFVA 5KG4A 1IM4A 5CXTA 4R5PA 2XWXA 2H5IB 5E3CA 2N4CA 4ERDA 1GTEA 1PIEA 3P96A 7FDRA 1Z1ZA 3CC7S 2BA9A 2RNEA 2F7VA 2N3OA 2GAGC 3D4JA 2CNLB 1S72S 2CVEA 3IG1A 4HDGA 2BRLA 4F0MA 1WWHA 3JQJA 4DS5A 4PXDA 2PMZD 2EBGA 2FPHX 4ZPCA 3QWPA 4DQSA 5KFWA 2C2OB 3FRYA 4B9TA 2PIIA 5HBMB 3OFHA 3GWCA 3MMAA 2GHWA 2HVIA 5KFIA 1LW0A 1QUVA 4LR7A 1RABB 2E66A 5KFAA 1H73A 9RUBA 3I6PA 3N28A 1HFEL 4DQQA 5KT7A 2KJVA 2EEYA 3W5YA 1ELOA 1L5UA 1NK8A 1FKAF 2V8DA 2NPIA 1UVIA 4OLPA 1MU2A 1ZTTA 4QWCA 3ETOA 2RILA 2KM8B 5IWAF 2AHOB 3Q2TC 1CS4A 4F2SA 4NI2B 3SBMA 2WVFA 4KRWA 4H4OA 1X5TA 1B64A 1URRA 4F04B 1F0XA 1VIOA 2F8EX 4O23A 4W4MA 3QT8A 2CDQA 4QW8A 5L9NA 5DQHA 5DS7A 2JLEA 2Z2ZA 2V8VA 5IWAJ 1JKHB 2NUUG 1P9QC 4O3NA 4J37A 1MNEA 2ZH2A 4TVAB 1FEEA 3OJSA 5D0RA 2MKJA 3KJFB 2CJAA 1G6BA 4M1KA 3UWTA 5J2MA 3TR5A 3MEGA 2M9KA 4HVZA 4UZCA 4A8QA 3H7HB 4AD6A 3HFKA 2VU5A 3DHXA 2CQ2A 1JXEA 3N5FA 2FB0A 4MJKA 3SCKE 5CZXA 2R8KA 2QG9B 2M7SA 2QC3A 1HQ2A 2HRTA 4PWWA 2E5LF 1HWIA 2FHJD 4PCQA 1TV6A 1R0AB 4J9MA 4X66F 2NXJA 1RCOB 1HD0A 4MFBB 3RRGA 5KFCA 4HYKA 1U2FA 2ZOFA 2B8PA 1NK6A 2E5LJ 4PXBA 4Y3CA 3D6MB 2EG1A 2HHPA 1RDRA 1X5PA 1YQHA 3RRKA 2XI2A 2FYXA 2R2TA 3CUNA 2OD4A 3KFWX 1HYSA 5H9FK 2IRUA 3VAMA 2PT0A 3NXZA 2FHJA 1R3NA 4JI3F 3ZXWA 3ILJA 1GMUA 3L7PA 3T41A 4HDHA 3HSZA 1S1WB 2PFFB 4JOUA 3M9MB 1LWCA 3THVA 4LR8A 3IWLA 3G96A 2WONB 4JI3J 1HBNA 1CPZA 1IQTA 4IDKA 2X51A 2GVDB 1IN0A 1OWXA 3SZ2A 2HQFA 2L08A 2QLBB 1IKWB 2EKYA 2XNQA 2HGLA 2DPJA 3CW2C 2BJ1A 2YPYA 1UA0A 4DCJB 2YX1A 2ZE2A 2I2YA 1Y3JA 4WF9Q 4QJVA 1HI0P 4BC7A 1TK8A 4NZ7A 1S6OA 1WHVA 1REVB 1UFKA 1RUSA 3A13A 4I6YA 3IMQJ 2XHWA 1VJWA 1H98A 4E0DA 2DNMA 3GPAA 1S6PA 1UJ4A 2Z56B 1UCNA 4CM0A 5CA5A 2HGMA 4WCEQ 4MTPA 4ELUA 3NGDA 4ETXA 2AGPA 2DHAA 4PUOA 3FQLA 3HSJA 1D3WA 1JLBA 3X1LB 3UDLA 2RQ4A 4DHVA 3ICLA 5T7LA 4MH8A 4YR3A 2JFKA 1EQ0A 3W65A 4FVCA 2OEJA 4F4WA 2LQJA 2ZZNA 3E51A 5F8JA 2XWYA 1RAAB 4L73A 1PJ7A 2DR6A 3QGGA 3LAMA 1L3SA 2GVZB 4O3OA 5LT5A 1SC1B 1VDHA 5J1PA 2VBXA 5CABA 3PNIA 2HPUA 3F0NA 4LFCF 3CDWA 3V6HA 1TMMA 2ZM6F 2YKPA 3VGUA 2ALYB 1YHQS 2DR5A 2A0FB 2XLIA 4FZVA 2YKOA 4ZPWR 1WOPA 4C9DA 3DDNA 4QIEA 3NGTA 5K8OA 3PW5A 3DLKB 3PFOA 4LBPA 2CWXA 5CHCB 4LFCJ 5ETVA 2KT3A 1ZETA 1YITS 3D67A 4X65F 4IFYB 2YKMB 2ZM6J 3AA9A 3I5BA 1AFJA 3H4BA 1CJUB 4C48A 2P2CB 1WORA 2OIHA 5J2NB 3ETMA 1PYSB 4CO1A 4X65J 2AWZA 4CO4A 1TMJA 4URQU 1YRXA 1ZBTA 2J6SA 1V3SA 3GQCA 2HQDA 3SV4A 4BS2A 3CDAA 5DRKA 4FS1A 3GZ7A 1CC7A 1SL2A 4LSLA 2BW2A 5AE2A 3K5MA 2XS7A 1N6QB 1LNQA 1RAFB 3R5DA 1QSLA 3U1MA 2B5JB 3TO8A 3TAMB 1YJ7A 5HVFA 3J81U 2LU2A 4QPXA 1CLFA 1SV5B 2BQ3A 2F8MA 5LMUF 2KHCA 5KOWA 3T6BA 5HROA 2RF2A 1LWEB 5DO2A 5L1JA 2IC3B 4QBUA 3K8VA 5LMUJ 2YX4A 4UOFA 2F4VF 4CM2A 4G6VB 3CMAS 3H2UB 1FWKA 3SI8A 4ES3A 2N7YA 3R6LB 1U6BA 2CA9A 1PG5B 2F4VJ 1FFWB 2HFNA 3GE9A 1EETB 3IAM9 1T02A 1WC4A 2AT1B 3TP2A 5J2QA 1SKSA 3LWLA 2LEBA 2B0GA 4LBHA 2KXFA 5KFGA 5FDLB 3UN5A 2LEPA 1TTHB 3IGNA 1OQ3A 3OHAA 2KFYA 1PYTA 4ILLA 4OHYA 2RB7A 2GJFA 4V19J 1MG7A 3AXKA 3PYDA 5KFZA 1HNIA 2LDIA 4R0EA 3PR4A 1SIZA 4OMFG 3M2UB 2EBEA 2FHMA 2ZITA 1Y3KA 2HIQA 1W26A 2PGCA 3VCDA 2QX0A 1Q7YT 3FCHA 2ZD1B 3BGUA 2BJ8A 4QWEA 5KFNA 1DJ0A 5FLXU 2EFPA 3H25A 3L95X 2HQCA 4H4MB 3CTRA 2ZKUA 4Q44A 3CPWR 3CDEA 5CCMA 1S9EA 3TVKA 3RUBL 2GIRA 1UZHA 3QGPA 5HSPA 2CQHA 2BJ3A 3MECA 2ASJA 1KVJA 5C5JA 1TKDA 1T03B 3C8YA 4OYWA 2VODA 4FKXA 5IV4A 4I2PA 1F9EB 3CCRS 2CQCA 1EX8A 5EWFA 2QLXA 3POTA 1APSA 4Y2CA 3MUVP 4DL6A 3M1VA 4YQWA 4ZS6A 4RZRA 4KH1B 2J7KA 2QL7B 3OVAA 2QGFB 1JLCB 1L3VA 1GX5A 3PRDA 3CD5A 3FSXA 4RJVA 3RBDA 4M5NA 4P9SA 3R97A 1ULRA 2VBYA 1XERA 4DUYF 3LOUA 5IS2A 3ZZ0A 2OUGA 1FRXA 3WC2A 3M6UA 2WTFA 4DUYJ 4ZP6A 4NMLA 1VRQC 1UWAA 4TYBA 1JLGA 2V9WA 1Q8LA 2HNDA 3MAAB 3MAQA 1Q0NA 4AUKA 3QNWB 3Q8PB 4ECWA 1HARA 2BE9B 3GG1A 2XMAA 2DH7A 2W2OP 2IY5B 1H74A 3U27A 2IAJA 3NEKA 1O51A 2OP5A 2MY7A 1Q82T 3BH6B 1DTQB 3H2VE 3MM5A 2IA0A 3H0PA 3H42A 2FGCA 4OZNA 2W24A 3EGZA 2ZFHA 4ECXA 4ED1A 1S97A 1PBAA 1Y00A 2DGUA 3UCZP 4I6AA 4OYPA 2H9ZA 1NB7A 2HFUA 1N5YB 3FZ2A 4RW6B 3LA0A 1YG0A 1SXLA 2MJUA 1HI8A 5EGYA 4DCOB 3BREA 1T9TA 2QSFA 2ZH5A 4OHXA 3JXOA 4NRUA 2H5EA 3J80Y 2DO0A 4W92B 4KFBB 4ZIVA 4A8XA 2FTRA 4HI1A 2UVWA 4EEYA 2RRBA 3MMJA 2DNKA 1FJEB 3M05A 3W9HA 5KG3A 1VIXA 3R2CJ 2ASYA 4X4OA 2G1DA 5HMXA 1YLXA 3ADAC 3CCVS 2PA3A 2WRMA 1Q4RA 4FNHA 2Z8QA 5BXIA 3TOQA 1UFWA 4WE1A 5HMZA 3DFEA 2A18A 2QLFB 3A4TA 1HWKA 3IG1B 3FJ2A 3OFFA 3ET6B 4DX7A 1B4SA 2OKQA 4CZCA 1UWBB 1AROP 4NLOA 2CYYA 2UVUA 2HZVA 2CNKB 5B0GA 3MMAB 3SSQA 1S57A 2WVDA 4AXIA 4ZLLA 2HZCA 2RS8A 2CQDA 4B02A 4HR2A 2K3IA 3CEDA 1U2RA 3FCVA 2HVHA 1QM9A 2KRBA 2VFRA 4YR0A 2OPSB 3TZYA 1K44A 1EQMA 1JLQA 2XMTA 1FESA 4OFZA 3IFEA 1SC4B 4MK7A 4RU9A 3GCWP 1YWXA 2FY8A 1QSYA 3THTA 1HWJA 1MU2B 3V4IA 2VC0A 1FKPB 1CS4B 4LIRA 4H4OB 1YJNS 4GMKA 2ZHBA 3HVRA 2HS4A 3T9ZA 4O4GA 2JNJA 3QJPA 2V8PA 3MD3A 4PQAA 4Y0FA 3LPEA 2EWHA 3QIDA 3CMES 2C28A 4MIBA 2F63A 3PEJA 3EMTA 5M2UA 4DL0C 4HI2A 2BRKA 1RU2A 3C14B 4RNFA 1BQNB 3G4SS 4L3NA 4QR0A 5DDRC 3TX0A 4RW8A 3HHEA 1DARA 1FNXH 4K2JA 3OVBA 3UD5A 3D1OA 3DYAB 4K5RA 4EBEA 2AQ4A 2CQBA 5GMKa 2X3GA 1HNVB 3HULA 2D3O1 3LF0A 2FVQA 2BBEA 2C3OA 4M5LA 1TV6B 3FK4A 1S1UB 2JWNA 1NH7A 4ID8A 1NJZA 4QCLA 2MB0B 7FD1A 3WX4A 3TEHB 2YKAA 2MZ1A 3C6TA 1WI8A 1JQGA 1BUXA 3VTIA 5ITHA 3OR1A 3AOCA 4LF6F 3KG1A 4ZCKA 1RAGB 4F3OA 3ZTRA 4LVNP 3DM2B 5G4DA 1H3DA 3QGHA 2JEFA 2D1CA 2YTCA 2HLUA 4NCGB 2XCAA 4DX5A 2XHCA 4IQXA 3T6JA 4LF6J 4U96A 1NB2A 1OQ6A 3KOAA 4ZJOA 2DRBA 3E3XA 5IM0B 1X4DA 5E3RA 3GU0A 1NMEB 1DHMA 1LWCB 3TNVA 2LA4A 3DOKB 4B3RF 1N0VC 2HW3A 1KEKA 4YR2A 3CIZA 2H4YB 2PMHA 3K89A 1VGYA 2HHHF 4DUZF 3E2EA 1P1LA 1B7FA 1RTZA 4B3RJ 3IRXB 1G7CB 2KB2A 8AT1B 2HHHJ 4DUZJ 3NAHA 2ATCB 1T9UA 3CCWA 2YH0A 1RJJA 2ZE2B 4OJ3A 2FQQB 4O4RA 3MR5A 1L3TA 4IG3B 1FDBA 5LM7E 5LSRA 2E5GA 1PYOB 3N6NA 2CZ9A 3CF5Q 4FBTA 2CPHA 3T1HF 1F3FA 2B4UA 2DYAA 1RWXB 2W25A 3MD1A 3O8WA 4DR5F 3VHQA 1UP1A 3BSNA 4M5MA 3G9CA 5IXUA 3N01A 4H54A 4X62F 1HLWA 2DNLA 3T1HJ 4B3SJ 1NPRA 1R8HA 3BGLA 1GTHA 3AJDA 2PI5A 4DR5J 1RAOA 2W9BB 3G6XA 1JLBB 3NGSA 1WTFA 4X62J 3AHPA 5IQQA 1VQYA 4TU9A 4ZHRB 5DG7A 4AE5A 1RLDA 1C1BA 4O0NA 3G86A 4NASA 2DBBA 4NPOA 4ED5A 2PC6A 1E6YA 2YKNA 3QLHB 1LWFA 3UN2A 5E0OA 1VI7A 5B0BA 4GVBA 2HWTA 4ED8A 1CULA 2OPRB 2RH3A 3M8QA 4P74A 3D6TB 2YQ3A 4PAAA 1M5HA 4WTOB 4EZ9A 3I31A 2XULA 4DSJA 4A47A 4O3SA 3TQ1A 1HQEB 2KYZA 5CD4H 3D9BA 1RWNB 3QRRA 5E5NA 2V4JB 2CNOB 3M2RA 1FNMA 5KFKA 2J0WA 3HJVA 1HBUA 5ETKA 3MPUB 1N88A 5D4NA 2Z0GA 1XEZA 1DBDA 7AT1B 1FA0A 2GGPA 1R8PA 3MFIA 1N56A 2LEAA 1G4CA 3BBBA 4OQJA 2W9AA 2I38A 4DFJA 5HQLA 3GSDA 3JQMA 1RT6A 2XMWA 2J76E 2HNYA 2MQNA 2AJ1A 4C0BA 3GILA 2GMJA 1D9AA 3CWJA 1S76D 3ZFVA 2BM1A 3GIRA 2VOPA 2V2VA 2BUNA 1QVGR 2BDPA 1E6VB 3C6UA 3MPWA 1N32F 3R5CA 2UV8A 2UUTA 1PC5A 4DSIA 4X4RA 2D9OA 4EFAC 1RAJA 5KFDA 2VV5A 4K4VA 1JLEB 1N32J 2I8EA 2U2FA 2R8JA 4CO3A 2DHSA 5JUMA 4IKAA 4OZ1A 1TFYA 3UDEA
chains in the Genus database with same CATH topology
5CD4A 2Y9HA 3QRPA 5H9FK 3QRRA 4DZDA 4QYZK 2Y8WA 5H9EK 1WJ9A 4U7UD 3QRQA 2Y8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CD4 A;  2Y9H A;  3QRP A;  5H9F K;  3QRR A;  4DZD A;  4QYZ K;  2Y8W A;  5H9E K;  1WJ9 A;  4U7U D;  3QRQ A;  2Y8Y A; 
#chains in the Genus database with same CATH topology
 3H5S A;  4KHR A;  3QIP B;  2BXJ A;  3NP5 A;  2YH1 A;  4OI0 A;  4DLE A;  2AEM A;  1DZ5 A;  2W7P A;  3FUY A;  3AT1 B;  2BKO A;  4ECZ A;  1FO1 A;  4ZA1 A;  3HVT A;  1VQK S;  2QLJ B;  1NJX A;  1YI2 S;  1AB8 A;  4OYB A;  3UI3 A;  1YTY A;  3G8T A;  3H5X A;  1F1B B;  3KJV A;  4BC9 A;  3AJ1 A;  4WFA Q;  5A6W A;  3MOZ A;  2ADB A;  2QL5 B;  4BWJ A;  3KUH A;  2EXU A;  1X4F A;  4DU7 A;  3W9I A;  1RHU B;  4IOB A;  3KLI B;  4FXD A;  4OYX A;  2M8H A;  4MK8 A;  5B7W A;  3R8Y A;  1RCX B;  3BN7 A;  1PBU A;  1AUD A;  3CNQ P;  1GMW D;  4LRB A;  1F2H A;  2EK6 A;  2IYG A;  5C2G A;  2DY1 A;  5JXS A;  4TNO A;  5GVQ A;  4IRD A;  1EKS A;  5DDQ C;  2OLW A;  3R1H A;  3DRR B;  1FER A;  1U47 A;  1YGY A;  1C1C A;  1H2T Z;  3A3N B;  3OXF A;  3MEC B;  4A8F A;  3FBB A;  4NA1 A;  3M32 A;  1Q1K A;  4OZ5 A;  3IRW P;  2OPQ B;  2YKQ A;  2ERR A;  5KFX A;  4ICL B;  2XMU A;  1SUQ A;  3AQO A;  1WKJ A;  1FRM A;  5D15 A;  2V2K A;  1NPP A;  3GP9 A;  1TL7 A;  2VZ9 A;  4KGM A;  1ROF A;  1N34 F;  2MQO A;  2Y1I A;  4YFU A;  3U1N A;  3DLL Q;  4BWM A;  4ECY A;  4NA2 A;  1S1T B;  4P2F A;  3Q8Y A;  2VON A;  1N34 J;  4RW7 B;  2R7S A;  1QDU B;  2YNH B;  5L1I A;  2ROE A;  1ICE B;  1VC6 A;  1A7G E;  4C8K A;  4X4U A;  4M5K A;  1FJ7 A;  2NYI A;  3B54 A;  3KLH B;  2IDE A;  4GO5 X;  4C3K A;  4UY8 5;  2WCX A;  4G1P A;  2DXF A;  2UZA A;  1NZ8 A;  1XIQ A;  3CSK A;  4ZN1 A;  2HND B;  2K2P A;  2RRA A;  1KC8 T;  4CT9 A;  3DLG A;  3QFW A;  2HFO A;  4ANE A;  1V3Z A;  2HHX A;  3W8P A;  1FXD A;  5F3T A;  3JB9 k;  2W4C A;  1F5A A;  2ZH8 A;  3T5K A;  4WKR A;  3AB4 B;  2DGW A;  2OGU A;  3AOD A;  2YXL A;  4N56 A;  4NLP A;  1TL3 A;  1HNW J;  4N8O A;  2P6S A;  2E7W A;  3SEO A;  2NR0 A;  3DLB A;  1UJ6 A;  3UD3 P;  3X3U A;  1ITP A;  2K7J A;  3UR0 A;  3DRY A;  3J7A 1;  2JLF A;  3AD9 C;  3ITH A;  2AIR B;  3LO3 A;  3FDS A;  1AT1 B;  1CJT B;  2BKN A;  1FNO A;  1SKU B;  1REG X;  2EFN A;  1NSQ A;  2GO8 A;  4PYD A;  4LMZ A;  4DFP A;  4LBI A;  1K0V A;  4TQR A;  2VFS A;  3K5O A;  3LQV A;  1EHW A;  2CAD A;  3MMB B;  4DXL A;  4NE9 C;  4CLK A;  3W2V A;  4ZPT R;  5ETO A;  1IBC B;  4RNM A;  2QRR A;  2PA8 D;  4CLL A;  4KKO B;  3PM9 A;  1L3U A;  2QV6 A;  3HVW A;  1HMV B;  1TKZ A;  1UVL A;  2RUG A;  1UEU A;  2P9C A;  1HWU A;  4HLB A;  2AW0 A;  4GKJ F;  1FEH A;  2VC1 A;  3IBC B;  3NMR A;  2MKI A;  4J7C A;  1VS3 A;  1ZOT A;  3BR8 A;  4N7T A;  3PKM A;  3B82 A;  1U45 A;  1P6T A;  5LJ5 Y;  1B70 B;  4GKJ J;  1JLA B;  1VCT A;  1R0C B;  4FYX B;  1UW4 A;  3V6D A;  4CDI A;  4OV1 A;  4ETZ A;  1W2I A;  4ZIW A;  2MQM A;  3ZZU A;  4W98 A;  3UVJ B;  4RUH A;  1KHV A;  4XTT A;  4C6A A;  5KFV A;  4IUF A;  4FYD A;  1UVM A;  1JLQ B;  3JSB A;  1IKY A;  4NXM F;  4WJB A;  4QQB A;  2DNO A;  3UCU P;  3IBF B;  1RE1 B;  1Y10 A;  4NXM J;  3O6Q A;  4I7F A;  3CJQ A;  5KFY A;  2NPF A;  3BZQ A;  1OO0 B;  2KVQ E;  1D0E A;  4JV2 A;  1KQF B;  2HFZ A;  1EP4 A;  1NHU A;  1IKV A;  3DRP B;  1KQG B;  3GV7 B;  4Y2I A;  2XM3 A;  2MY8 A;  3DU5 A;  4JI2 F;  2AGO A;  4NXN F;  5F8I A;  2JSX A;  3MF5 A;  4OI6 A;  5G0R A;  4C8N A;  2VG7 B;  1XR6 A;  2D41 A;  2E29 A;  2GQQ A;  1YJT A;  1XR7 A;  5H1S V;  1N48 A;  4JI2 J;  4F25 A;  2G9O A;  1C0T A;  4NXN J;  1CC8 A;  1DQA A;  2BR0 A;  2HHW A;  5MAO A;  2PSZ A;  3TUJ C;  2G2Y A;  2YWK A;  4QIV A;  4DL5 A;  1AXQ A;  4J9L A;  4MKY A;  4FDF A;  4B9N A;  5IOL A;  1WEY A;  3G6E S;  4ECR A;  2J0X A;  4D3G A;  3LP2 A;  2YBV A;  1WC5 A;  2V4R A;  1KP6 A;  3K57 A;  3OV7 A;  2QTW A;  3C6T B;  3OQ2 A;  4BDP A;  4YOE A;  4AND A;  4R25 A;  4U9R A;  2OFH X;  3OR1 B;  1RTI B;  1VMB A;  1WEL A;  2CAJ A;  3M30 A;  1VLY A;  1MWZ A;  2XI3 A;  4ECS A;  5KAK A;  4CLF A;  1V9O A;  1Q8B A;  4UQG A;  5I42 B;  2J0S D;  2MST A;  4ZVO B;  3OTE A;  1FJG F;  1ZTW A;  3GJR B;  1CBK A;  1RTJ A;  1RAC B;  1VK3 A;  3A8J A;  2BOA A;  2J8S A;  1VQ7 S;  3W9J A;  4DEZ A;  2CG8 A;  1FJG J;  3M4X A;  2ZZM A;  2LXI A;  3BH7 B;  1ZPW X;  2CPI A;  2DGV A;  1FRH A;  4ZJL A;  2QL9 B;  3PHT A;  5E41 A;  2OAU A;  1BE4 A;  3OL6 A;  1VLO A;  4C8M A;  3FFI B;  3MCS A;  3HLU A;  3BQ2 A;  1QLN A;  1F9F A;  4JBC A;  4ITS A;  5DG8 A;  4TY9 A;  3W63 A;  1OPZ A;  1R89 A;  4CIO A;  4RBT A;  2R2R A;  2G0C A;  2NUH A;  4Q7A A;  3RTV A;  5D3G B;  1LQ9 A;  2CWK A;  2H51 B;  3TW0 A;  5LSO A;  2LQ9 A;  2R42 A;  2A6O A;  4UTG A;  3HPO A;  1SJR A;  3M8R A;  3OPK A;  2I5J A;  3UDV A;  3VZI A;  4ED7 A;  3EWG A;  2FLO A;  1KTQ A;  5KT6 A;  4DDF A;  2R7W A;  3OLA A;  2HUR A;  2UXB F;  1FVQ A;  4UF4 A;  5KFF A;  5C24 B;  2UXD F;  2K1R B;  1MN7 A;  5ETR A;  3T9N A;  4TQS A;  2QMX A;  3TX8 A;  4A8M P;  3GYG A;  3TYT A;  1HNZ F;  2R7T A;  4X4V A;  3KKF A;  2UXB J;  2F9D A;  4EO8 A;  1I51 B;  2B9Y A;  5DGA A;  4OZ0 A;  4CLZ A;  4FN5 A;  2UXD J;  1D9F A;  3EDR B;  2KTQ A;  4JP8 A;  1I94 J;  3CJ3 A;  5I4M A;  1R43 A;  4QYZ K;  2MZQ A;  1JJ4 A;  1K8A T;  1HNZ J;  1RT7 B;  3EYZ A;  1NDL A;  4NRT A;  1E6Y B;  2WVE A;  2IHR 1;  1LWF B;  2JFD A;  3Q8R B;  2OPP B;  4RUC A;  1JJ2 R;  3HHK A;  1HR0 F;  5DDO C;  2ZH3 A;  1CUL B;  2B51 A;  5IFM A;  5J2P B;  1XC9 A;  3Q2S C;  2LXF A;  1D09 B;  2H48 B;  3K58 A;  4DR3 F;  3US5 A;  1NSA A;  1NO8 A;  1HR0 J;  1VQM S;  2OD6 A;  3VAF A;  2QA1 A;  1OMS A;  4UOH A;  1RK8 A;  1SI9 A;  4F4A A;  2VOO A;  3TA2 A;  4DR3 J;  4CLS A;  3CCE S;  3KTQ A;  2CQ0 A;  1TUV A;  3M2R B;  1N8R T;  2JOQ A;  1GXT A;  5C7P A;  4NCB A;  4HL9 A;  2VFV A;  4DSL A;  5AXN A;  5IT0 A;  2ZNY A;  3SCJ E;  4WPA A;  2A1B A;  1NSK L;  2X1G A;  1V5I B;  2VJU A;  4I2Q B;  1U6F A;  4K4S A;  4RNH A;  1IR2 A;  3HDS A;  2DNY A;  4A46 A;  2RDI A;  4QOT A;  3MM8 A;  2XYP B;  3C46 A;  3CJ2 A;  4JI7 F;  1RT6 B;  1BWE A;  4ALZ A;  5K8N A;  2XZD B;  3DMJ B;  2KJW A;  3KLE B;  1NAQ A;  2DXE A;  2HWI A;  3HJF A;  4JI7 J;  2UVR A;  1JB0 C;  4M5J A;  3C6U B;  1NDP A;  4YS2 A;  4QPT A;  2EC0 A;  2RQM A;  3GLJ A;  3PIP Q;  4USI A;  3QJL A;  2MZT A;  1NHK L;  3N79 A;  2LQB A;  4HHJ A;  2YNI A;  1FFS B;  3QZ7 A;  1VRU B;  4IRK A;  1CJV A;  1AYE A;  2FZC B;  3GII A;  2B4V A;  2AYB A;  3VVU A;  2QJ3 A;  2G13 A;  3PW2 A;  3CJK B;  3DXS X;  4S0M A;  3ZZO A;  1NKE A;  2RKI B;  4NYZ A;  3SDE B;  5D4L A;  3FRZ A;  2HHS A;  2NYH A;  5C2C A;  3PW7 A;  2V8H A;  3CDB A;  2GS8 A;  3H59 A;  3M2V A;  6FDR A;  4QR2 A;  2Q43 A;  4A4J A;  4K4X A;  5IT9 Y;  3DDK A;  1FK9 B;  2OEL A;  3HO1 A;  2F1F A;  3MI7 X;  1BQM A;  3CDU A;  4OYO A;  2R7Q A;  2ZNZ A;  3OTC A;  2E5J A;  2DCU B;  3HP6 A;  2ILZ A;  2VQF F;  4LSN B;  1KVK A;  4G3I A;  1R7I A;  2DGO A;  4J9Q A;  4IG0 A;  1KFD A;  4RUB A;  4J9R A;  2PMW A;  1GXL A;  2GO9 A;  4OX7 A;  3FNN A;  2VQF J;  1K47 A;  3EVO A;  2VA2 A;  1RT3 A;  1R27 B;  1HHQ A;  1NK9 A;  2HNZ A;  3NGK A;  2LDY A;  4J9P A;  2MPU A;  3JQK A;  4FYW B;  3NWR A;  3BKU A;  4ZVH A;  1U1P A;  2MZR A;  3RGI A;  4C4W A;  2MLZ A;  2APO A;  2R7V A;  3D5M A;  2HEK A;  1HQU B;  5B0D A;  2PFD A;  2ZJQ Q;  3UD4 P;  3VWS A;  4OHV A;  2CPY A;  4P2S A;  3HM9 A;  1J5E F;  5E3A A;  2HSE B;  2WSC C;  3PO4 A;  5DQG A;  3DLH A;  1CVJ A;  1RHQ B;  2LKZ A;  1VJQ A;  4WP3 A;  1NJW A;  5IQ6 A;  3DGP A;  3P8B B;  1TL7 B;  4O0I A;  1RTD A;  4FS2 A;  3UW1 A;  4C97 A;  1U1K A;  3SQG B;  3MR7 A;  1J5E J;  2DR7 A;  1H2V Z;  1S79 A;  3M8S A;  3PKY A;  4Q5V A;  4KBI A;  3JS9 A;  3RAQ A;  4PWD A;  4NMX A;  1KON A;  1WJ9 A;  2FUG 9;  4DJB A;  3EVM A;  3BPD A;  5DLF A;  5A76 A;  2C22 A;  4YDD B;  3G87 A;  4ENO A;  4WP9 A;  2HKE A;  4ZLJ A;  3RW7 A;  2JDJ A;  2VQE F;  3BDP A;  4PG5 A;  4G65 A;  4L75 A;  1PSD A;  3JTP A;  2MKK A;  2RSQ A;  4K8R A;  5A0Y A;  4B9M A;  4NLQ A;  2L9N A;  1JWW A;  2VQE J;  1KLN A;  3AXM A;  2VJV A;  1R8C A;  3WIV A;  5CD4 A;  3F73 A;  4RO0 A;  2MHE A;  1EJ7 L;  1GT8 A;  3KHH A;  3SSR A;  2FVR A;  2OFG X;  3EM1 A;  4LSZ B;  2DNN A;  3KLF A;  1FI4 A;  2CJ9 A;  2OML A;  1IBL J;  3VAG A;  3NBP A;  1RB0 A;  5EWG A;  4DLG A;  1VK8 A;  3RB0 A;  2RU9 A;  4CH7 A;  1I3O B;  2RD5 C;  3M8P A;  3AH6 A;  3WQP A;  1FVS A;  4EMD A;  3QO9 B;  2LMI A;  1ZS6 A;  3MMC B;  4FVM A;  3KXD A;  3BR9 A;  1KOO A;  3A12 A;  2KXH A;  4P7V A;  2QN6 B;  3KJQ B;  2DO4 A;  2V5H G;  4TKT A;  3OTB A;  1J5O B;  2CXE A;  3ENW A;  5GAH U;  3NG8 A;  2F3J A;  3OXG A;  3OT9 A;  1QSS A;  4K4Z A;  2B4P A;  3MR3 A;  2HBQ B;  3A3P B;  3BBF A;  3ZZR A;  4N47 A;  3HHL A;  3DRS B;  2LEC A;  1YBU A;  2IIH A;  2Y0B B;  1FDN A;  4C98 A;  2ZH7 A;  3MXH P;  1S1V A;  3H98 A;  1SKW A;  3KK2 A;  2VG6 B;  3HF5 A;  1SL0 A;  2FVS A;  1IWG A;  5HLF A;  1XTZ A;  2DB1 A;  3JYT A;  3O44 A;  4LQ9 A;  4OYI A;  4Q8F A;  4ZKA A;  2HGN A;  4MKB A;  3T5J A;  2ASL A;  5E33 A;  2QYG A;  5B0F A;  3H20 A;  3RG6 A;  3V6D B;  2VF3 A;  1T3O A;  4M8L A;  4EK2 A;  1FE0 A;  2W9C A;  3R7N B;  1SJ1 A;  3PYG A;  4UQT A;  5BYQ A;  4A8O A;  1UL3 A;  2UUB F;  3TZW A;  3AD8 C;  1JXL A;  3ISN C;  2IBK A;  2XNR A;  2MSS A;  2AEJ A;  1UTA A;  4RR5 A;  2JZ5 A;  2W2N P;  1EAY C;  1RAH B;  2KHD A;  2RJZ A;  1WHY A;  1JX4 A;  2UUB J;  3NY0 A;  2ZBP A;  5HP1 B;  4FF1 A;  1S1X B;  1U1M A;  2NRE A;  5KG5 A;  2BQU A;  3KLG B;  2DVI A;  1SVD A;  1YZ7 A;  4I7F B;  4KHP F;  3I0S A;  4OI2 A;  4Y00 A;  2HVE A;  4FPR A;  3J7Y U;  2B7C B;  2KFN A;  1YKW A;  4UOG A;  3TUZ C;  4XPE A;  4RPF A;  4G1I A;  4PQU B;  4KHP J;  5D77 A;  4OJ1 A;  4I6W A;  2XGP A;  2R2S A;  1WC6 A;  4RNO A;  3BSC A;  3MM6 A;  5CYQ B;  3KUE A;  1NH8 A;  4WKY A;  4IH5 A;  4XDD A;  3V81 A;  3RBZ A;  2NSB A;  4PXC A;  2IVF B;  1EAR A;  4KV8 B;  2J5A A;  1VBY A;  3RYL A;  4TLQ A;  1IWA A;  1RWP B;  5EN1 A;  4X4P A;  1YJW S;  5CQG A;  1SC3 B;  3QSY B;  5BR8 F;  1H38 A;  1R8A A;  4M94 A;  2NZ4 A;  2D7S A;  5LXY A;  3J80 U;  1RKI A;  3FEY B;  3MR2 A;  3PZP A;  2FJB B;  5A8W A;  5BR8 J;  2ZHO A;  3NOG A;  2AYM A;  5A8R B;  2XSJ A;  4TLR A;  4HEA 9;  3R5A A;  1S7H A;  4ZPB A;  4EI2 A;  4B3O A;  2ZHA A;  3W64 A;  4HH0 A;  1MSW D;  1WTB A;  3RBE A;  2NZC A;  2IDL A;  4F0H A;  1Y5I B;  3M30 B;  1B3T A;  2DY9 A;  3UNY A;  3G6Y A;  2ZH1 A;  2P5V A;  3BEG B;  2XLJ A;  3GFY A;  4ZVP B;  3FBF A;  4GO7 X;  1Q81 T;  2KN4 A;  3CD0 A;  4M95 A;  1I5O B;  3S7R A;  5K14 B;  3C66 A;  4I56 A;  3O5T B;  4F4X A;  1UET A;  2J6T A;  4J9U E;  1J2V A;  5I3U A;  3C15 B;  5A8K A;  5L39 A;  2FJV A;  2KL8 A;  4KO0 A;  3OJU A;  5F0W A;  1IJF B;  4KGX B;  4Q2L A;  2ZBQ A;  4X2B A;  3DRX A;  3DLE A;  4NYP A;  4ILM A;  3PIO Q;  1KNZ A;  2AF6 A;  2PEH A;  3BGF A;  2VFT A;  2FJW A;  2AJQ A;  1WEZ A;  1F3V A;  1Z2L A;  1MLA A;  3W8G A;  3DOM A;  4RW9 B;  1WF0 A;  3ZZP A;  4B9S A;  4XIU A;  1Q78 A;  4WII A;  2J6U A;  4H4K A;  3LGM A;  3H2L A;  4DPU A;  2DHX A;  1DFD A;  1FWL A;  4CH0 S;  1IXK A;  4LRE A;  1X4G A;  4FXW A;  3KK1 A;  2NSC A;  2SXL A;  3RAM A;  4DFM A;  1RWO B;  1TAU A;  3V4M A;  2H4W B;  3CCZ A;  3A8E A;  1U2C A;  1VRT B;  1YZ6 A;  4YUD A;  2IMW P;  4MT1 A;  2QIF A;  2FHO B;  2BAN B;  3DXB A;  6AT1 B;  5HVG A;  1SQE A;  2IJR A;  4JI8 F;  4MAK A;  4AL5 A;  1K1Q A;  2DHH A;  4C8L A;  1WG5 A;  3G82 B;  4USH A;  4DPW A;  1HKA A;  4ZLN A;  1M5S A;  5ADZ A;  2GX8 A;  3SXL A;  4JI8 J;  1X60 A;  3EGW B;  3MEE B;  3BF4 A;  5AXL A;  2CJK A;  4EBD A;  3I55 S;  1Y4Z B;  4JV0 A;  2FVC A;  4P73 A;  4J9N A;  2MXY A;  4NOH A;  2YPZ A;  4OYZ A;  2ZOG A;  3HXM A;  4NLU A;  4QU6 A;  4WBF A;  1BD6 A;  4CI0 B;  2AEF A;  1CSJ A;  2MHN A;  1FE4 A;  4IOA Q;  4RBU A;  3WBZ A;  4DZD A;  2ROG A;  1OS5 A;  4OI4 A;  4DN9 A;  5I3P A;  1JLF B;  2BE7 D;  3CCU S;  1S10 A;  4KH0 B;  2MZJ A;  2E5I A;  5K9F A;  2E9R X;  3QPI A;  4PKD B;  3K2Y A;  2BJ7 A;  2MKH A;  5A2Q Y;  2M88 A;  1T11 A;  1RBO B;  1YRT A;  1JKH A;  1W2B R;  2G0J A;  2YQ0 A;  3MZI A;  5ETQ A;  2P9G A;  4I68 A;  1C0U B;  3C16 B;  1CJK B;  2DJW A;  3OXL A;  4OI1 A;  3QMQ A;  1UVN A;  3UNG C;  3CD6 S;  3D7S B;  4IH7 A;  3Q8Q B;  1TL1 B;  1KRP A;  3DNC A;  4YME A;  1LOU A;  1YIJ S;  1S6Q A;  2FLP A;  1ZM9 A;  5HVH A;  2L48 A;  4YN3 B;  2C2K B;  4USM A;  1EKR A;  4U67 Q;  1S49 A;  1R0A A;  4KB7 A;  2W1B A;  2J8A A;  1AUS L;  1VQN S;  2CPZ A;  4MFB A;  1S5Z A;  1RT1 B;  3MM9 B;  4A8S A;  1UAW A;  3HKZ D;  3VAK A;  1WC3 A;  3GR0 A;  4OYM A;  1XNR F;  3C3L A;  3D3B J;  2HFV A;  1TFW A;  4YDX A;  3PY8 A;  3LP0 B;  1MMN A;  2AYE A;  1NZA A;  3P4U B;  1RI7 A;  5HN0 A;  1T3N A;  4FF2 A;  4ZVG A;  3EE3 A;  2AGQ A;  1NJY A;  4TU8 A;  3M2V B;  3J7Z T;  3Q22 A;  2XYG B;  3CIM A;  1XJW B;  1XNR J;  1FRL A;  2HRY A;  2VPX B;  1ZM3 A;  2Q3P A;  1U48 A;  2VDI A;  2U1A A;  3QRP A;  2GMH A;  1BQM B;  3MTJ A;  1LXN A;  1S1W A;  3HT0 A;  4GVL A;  3QJJ A;  4NLX A;  5KFU A;  5AE3 A;  4ECQ A;  2UP1 A;  1S0V A;  2B9E A;  2AP6 A;  4OZJ A;  2WON A;  2HHQ A;  1TKX B;  3UFC X;  4WTY A;  1KQK A;  3MCN A;  2LCW A;  2UUW A;  2B56 A;  1CEZ A;  3J7Z 5;  1QTN B;  3AFG A;  3M9O B;  2VBW A;  2HNZ B;  5L38 A;  2HYI B;  1D8Z A;  1OY6 A;  3CJ4 A;  5AJ3 F;  1FX2 A;  9ATC B;  3RB6 A;  1REV A;  2DRA A;  4Y34 A;  2CQI A;  3W60 A;  2HAF A;  2YQ1 A;  3DCA A;  5GAD U;  5AJ3 J;  3PHE A;  2FJE B;  1UPP A;  3IP0 A;  2WB4 A;  4GC6 A;  3W5X A;  4KAI A;  3GG0 A;  5ETP A;  3TQE A;  4K4T A;  3DGP B;  1NUE A;  3PJ9 A;  5J1E A;  1M5V C;  3H90 A;  3R27 A;  2VIH A;  2EFO A;  3HX9 A;  3GFH A;  4CLW A;  5C25 A;  4C3L A;  2GHP A;  4ZVQ B;  2MJN A;  3GMG A;  2P9E A;  2W2M P;  4UZB A;  4X4S A;  2OHD A;  2W8K A;  1ACM B;  4A8W A;  1RWU A;  3R6G B;  3RRH A;  5GAE U;  1O0P A;  2A6M A;  4CO0 A;  1K73 T;  2JJ4 D;  3IA0 A;  2DGX A;  3B6B A;  2Y1L B;  2GVZ A;  3OFG A;  3CC4 S;  2EPI A;  2C2R A;  3BDE A;  4YB6 A;  1PIL A;  4NZ0 A;  4LIW A;  4C11 A;  2WHO A;  4LRC A;  5A0Y B;  1WG4 A;  3JSY A;  1NND A;  1L3K A;  1WUU A;  5D4P A;  3DI6 B;  3F56 A;  2W4D A;  2ASD A;  1HPZ B;  4CTA A;  3PFE A;  2CNN B;  1TKT A;  3CMQ A;  2CJX B;  3DLK A;  3ZZZ A;  2B6A B;  4IFY A;  2YKM A;  4UOC A;  2PDA A;  4OZ2 A;  3PX4 A;  1CJU A;  4O44 A;  3KLF B;  1NBE B;  2DNZ A;  4F8R A;  2E7X A;  2E1R A;  1FRK A;  1BHN A;  3CCS S;  3Q86 A;  3UDC A;  5IC4 B;  1N36 F;  1S77 D;  3E01 B;  2V6A A;  4LFA F;  1CQN A;  3W2W B;  1W7W A;  2BZ2 A;  4DN0 A;  5C42 B;  3EGN A;  3K5P A;  5L1K A;  1JNZ B;  2MGZ A;  1DLO A;  1N36 J;  4NEZ A;  4LFA J;  4Q0B B;  2CVI A;  3TAM A;  1C4C A;  1FD8 A;  4KYZ A;  2QEX S;  2DNP A;  1LW2 B;  3KDN A;  1S6U A;  3KK3 A;  4N5S A;  3QRQ A;  1VQS A;  1SV5 A;  1VQL S;  4DI6 A;  1DTT A;  3F41 A;  5DGB A;  1T7P A;  2HMI A;  1R6V A;  2FC9 A;  1SQG A;  3GSI A;  1KKH A;  2A2D A;  1FDD A;  2YNG B;  2Q79 A;  4J9K A;  4I1T A;  4ZCL A;  4JUZ A;  3KK2 B;  2IC3 A;  1IR0 A;  3BKF A;  1IQZ A;  5HLF B;  2CKW A;  4NLW A;  1VHF A;  2HBR B;  4I67 A;  4NLS A;  4HHU A;  4LF2 A;  1RLC L;  2MMY A;  3WHI A;  2BJE A;  4DR6 F;  1QJH A;  3IM9 A;  2W9C B;  4C8O A;  4ECU A;  4M5G A;  4UW2 A;  4WFB Q;  1EET A;  4CP5 A;  1FKO B;  4E98 A;  2BW7 A;  1VC5 A;  1RU1 A;  4DR6 J;  4ECT A;  4K7Q A;  5FDL A;  4DSK A;  2OH2 A;  1RWK B;  1T0T V;  5HI7 A;  3NWG A;  2BQR A;  3OUY B;  2DIT A;  1IBK F;  4AL6 A;  2PO4 A;  5KT2 A;  3VVT A;  2HS0 A;  3EVW A;  4B17 A;  4LF4 F;  5KFQ A;  2KG0 A;  3M2U A;  1NJI T;  4R8U B;  2CG4 A;  5AE1 A;  3TVY A;  1IBK J;  4JV1 A;  4RL1 A;  2V63 A;  1I6J A;  1JIH A;  2ZD1 A;  4R5P B;  2GW8 A;  4LF4 J;  2JRS A;  1FTC A;  2XY7 A;  3OR2 A;  2PI4 A;  3AQP A;  3BGO P;  4QYZ J;  1OY8 A;  4H4M A;  3SYZ A;  4K50 A;  3SIP B;  1Q86 T;  5JJB A;  4OLO A;  1IUJ A;  3NAI A;  3KG0 A;  1QAY A;  2M8D B;  2FGO A;  3DGV A;  4CQ1 A;  3B4D A;  3AD7 C;  3V81 B;  3ZC4 A;  1B0P A;  2N3L A;  3D6H B;  2GQ2 A;  2O5D A;  4QWD A;  3VF0 B;  2DPI A;  2F8H A;  3W62 A;  2OMO A;  4AFF A;  5K8P A;  2HLT A;  3R5J B;  3BV8 A;  3NRB A;  4KT0 C;  2CPX A;  3GJS B;  2RT3 A;  1LW0 B;  4WXW A;  1RAD B;  1JLC A;  3H40 A;  4DUT A;  3F44 A;  1U6Z A;  1VR6 A;  1PJ6 A;  2N82 B;  1Q5V A;  2D9P A;  2E1P A;  5A8W B;  1SJ4 P;  1HW9 A;  1TL5 A;  1NRK A;  4DL3 A;  4B3O B;  1LEO A;  3PCO B;  2VPZ B;  2UV8 G;  1XN9 A;  3TA1 A;  1Y7P A;  2MQL A;  3V6J A;  1M1H A;  5DZ6 A;  2WBR A;  2LQ5 A;  3MAH A;  2IM0 A;  3IO1 A;  1HW8 A;  3LW5 C;  2HQG A;  2W2Q P;  3DKD A;  3N5B A;  2WVB A;  3MAA A;  2O67 A;  1Q7L B;  4U8Y A;  3LGN A;  4LF9 F;  2ZBI A;  3JTN A;  2ZBC A;  4FYV B;  1RGV A;  5KFJ A;  4KSE B;  4CT8 A;  2NXC A;  4PRF A;  4DPT A;  4AT1 B;  1DTQ A;  3AJ2 A;  2KO1 A;  4CH1 A;  4LF9 J;  3LTO A;  3O1L A;  4CLT A;  2WB1 D;  1SJF A;  3GCX P;  1U1N A;  3TVZ A;  4ES1 A;  1LFP A;  4ES2 A;  4HT5 A;  1JJC B;  1MML A;  2DNQ A;  1D1U A;  2M3D A;  2HS3 A;  5J2M B;  3MEG B;  1U1R A;  1N5Y A;  2RHQ B;  5ETS A;  2QFJ A;  3FZB A;  4F67 A;  3DOM B;  5D6G A;  3I5C A;  2M70 A;  4DG1 A;  1LKZ A;  3NOC A;  4KFB A;  4ZDN A;  1HA1 A;  3W5Z A;  4WZM A;  5F8N A;  1KR4 A;  3BYP A;  2ZH9 A;  3A3O B;  4K4U A;  2VB6 A;  4ID5 A;  3KK1 B;  4DZ6 A;  3TAQ A;  3H5U A;  4NLD A;  4LF8 F;  5HAN A;  4C8Y A;  2B9W A;  2DNH A;  2OTJ S;  1MW7 A;  4PG8 A;  2R7O A;  2RU3 A;  2YWF A;  4LF8 J;  1RBL A;  3JTO A;  1HYS B;  2K06 A;  3RR7 A;  3ET6 A;  2V50 A;  2DR9 A;  2C3Y A;  3ISZ A;  1T05 A;  3T3F A;  5K8M A;  3L7O A;  4F4Y A;  1RAI B;  3LGH A;  1UWB A;  2KZZ A;  4M5H A;  3ISN D;  4G1Q A;  4F2R A;  1Q8K A;  1Q95 G;  4WWS A;  3DOL A;  3MED A;  1P8G A;  1HBN B;  2FJX A;  3TZX A;  4IDK B;  1YBA A;  4ZVS B;  4AXJ A;  4RU2 A;  4U8V A;  1G3O A;  2JH3 A;  2FIU A;  2C2D A;  2ZDP A;  2BAB A;  1UEK A;  2OPS A;  2F4F A;  1URN A;  3SMZ A;  4P72 A;  3UCG A;  1P1T A;  3ZZY A;  3VGT A;  3K5L A;  4UUW A;  4IFV A;  1RWW B;  5KFO A;  1FKP A;  3H4D A;  4DCP B;  2UVV A;  3D28 A;  2MKC A;  4MYU A;  2V34 A;  4RWX A;  3V6K A;  4F02 A;  2Y9H A;  4C8Z A;  4B3S F;  1UJ5 A;  1UVK A;  4BHQ A;  1YRU A;  2GIQ A;  1MN9 A;  1S6P B;  4IR1 A;  1YJR A;  4DV6 F;  3P3D A;  1V3R A;  2BM0 A;  2ZJR Q;  4CLU A;  5DM7 Q;  5ETL A;  2JVR A;  4IOC Q;  2QA4 G;  4PUO B;  4ECV A;  1RXO B;  2DH9 A;  4ZOS A;  1IM6 A;  2CPJ A;  1GEH A;  4DV6 J;  3C14 A;  1BQN A;  2FHK A;  5T7L B;  3FMW A;  4TU7 A;  1Y9O A;  2AZ1 A;  3JAM Y;  3MTK A;  1U4B A;  4EGL A;  3DYA A;  2PE8 A;  3CCL S;  2KI2 A;  1S6Q B;  4LF5 F;  1EIY B;  1HNV A;  3IM8 A;  1UZD A;  2RDJ A;  1WOO A;  3QGI A;  4YP3 A;  2QYC A;  5A6P A;  3MUR P;  2IA6 A;  1S1U A;  2ALZ A;  4DL4 A;  3EZO A;  3TJA A;  4LF5 J;  1RTH A;  3CT9 A;  3NS7 B;  3VGS A;  1EB0 A;  2GJI A;  3GFX A;  3Q8U A;  1UMJ A;  1LFW A;  1O6X A;  1WF2 A;  4X66 J;  2CZV C;  4Z2X A;  2G2O A;  2YWH A;  1M90 T;  4OJG A;  3IR5 B;  3DM2 A;  2G0I A;  1TK5 A;  4I64 A;  3D68 A;  5KT3 A;  3FBE A;  2IYI A;  4NCG A;  2E5H A;  2IJF A;  2ROP A;  4KR0 B;  1M5K C;  3JSR A;  5CYM A;  4W90 B;  2VUG A;  4DU8 A;  2VFU A;  4I69 A;  3ZTO A;  5IM0 A;  2HQ3 A;  1OY9 A;  2VKR A;  1WAC A;  2J9D E;  3NNH A;  2DXD A;  1JXV A;  1W25 A;  3N9U C;  3VAJ A;  2KT5 A;  4IO9 Q;  3G8Q A;  3DOK A;  2BAC A;  2Z58 B;  1EZZ B;  2BEF A;  4LSL B;  4FNI A;  2W7O A;  1SH2 A;  2NXN A;  5HMW A;  2WOM A;  3IRX A;  1U8S A;  2DEI A;  3W3S A;  5IZH A;  4TXS A;  2OEM A;  4E2F B;  5H9E K;  3AA8 A;  5DDP C;  4ELT A;  2OEK A;  3FC9 A;  2KH9 A;  1U24 A;  3BQ0 A;  2ZWO A;  5IC6 B;  3OHB A;  4IG3 A;  4R0J A;  5KT5 A;  2GFF A;  4UT4 A;  2CQ3 A;  3KG4 A;  1FWP A;  4A8K A;  2V69 A;  5HRO B;  4ED3 A;  4DX6 A;  5E3P A;  2RF2 B;  3ONQ A;  2AU0 A;  3QSI A;  4OV6 A;  3SFU A;  1GK8 A;  4QIF A;  3Q8S B;  1VQ6 S;  5F8M A;  2FVP A;  5KFT A;  4OIX A;  2LP4 A;  5B09 A;  3I5A A;  4XAK A;  2A2C A;  5J1E B;  2Y1J A;  1B0V A;  3GV8 B;  3TAN A;  1WI6 A;  2W9B A;  2MLX A;  3TAR A;  1PKU A;  4J9V A;  5E7O B;  4DQR A;  5C25 B;  4USW A;  4WK3 A;  1DUR A;  3PYE A;  3C2P A;  1T9W A;  3BN4 A;  4ZHR A;  2ZKT A;  3TJ8 A;  4GRS A;  3GJT B;  1SKR A;  3PRV A;  2MLY A;  3S8S A;  5J2Q B;  4P7T A;  2D3Z A;  1NHV A;  1LXJ A;  3QLH A;  3RB3 A;  3EZU A;  5F3Z A;  5B0C A;  2OPR A;  1HNI B;  4Q2M A;  2EVZ A;  4C11 B;  1HI1 A;  2JC0 A;  2XO6 A;  2IJN A;  2R7R A;  2HFS A;  2JEI A;  3HD1 A;  4LR9 A;  4CTA B;  5KTQ A;  1HQE A;  1TKT B;  4DF8 A;  3TI0 A;  4Q8E A;  2BJD A;  4ZVR B;  2KKH A;  1HL6 A;  3K59 A;  2V4J A;  4PG4 A;  1YJU A;  4QYR A;  2XZT B;  3O2I A;  3QBC A;  1NCL A;  2HBY B;  4O44 B;  4ZP9 A;  2ZH6 A;  4OZL A;  1S9E B;  4U7U D;  3CD7 A;  1H2U X;  2MYF A;  2Y8Y A;  4N8N A;  3OL8 A;  1T9X A;  2EK1 A;  4JI6 F;  1GMW A;  4OJH A;  2B4O A;  1VQ9 S;  3R2D J;  5IT9 U;  2FZK B;  1WF1 A;  3VAL A;  4L74 A;  3MPY A;  4I2P B;  1BQX A;  2RDD A;  5HJX A;  4ZVU B;  3UR3 C;  3POT B;  2MGZ B;  4JI6 J;  1IR1 A;  1DLO B;  1T9V A;  3M1V B;  4LT6 A;  3W7B A;  4UY8 T;  5IT4 A;  1FRI A;  3ZTQ A;  3BB5 A;  1HNX F;  2HHU A;  1B7Y B;  4KIA A;  2QT7 A;  5SUH A;  1E6V A;  2L41 A;  3OL9 A;  1FHT A;  3KK3 B;  2A10 A;  1HNX J;  2ZH4 A;  3EIC A;  1C4A A;  1H0H B;  4DPX A;  1S4F A;  1U02 A;  2J9D A;  2EKN A;  3W1Y C;  3CJR A;  4LF1 A;  4PG7 A;  5DG9 A;  3HCX A;  1DTT B;  1ZPV A;  2ZVS A;  2DTJ A;  4EBC A;  5LOQ A;  4YB7 A;  2HMI B;  3IR7 B;  1JLE A;  1YX2 A;  4ELV A;  1K0T A;  1HIY A;  1S0O A;  5E3Q A;  1N52 B;  1CQM A;  2O01 C;  1WDT A;  1P27 B;  3KMQ A;  1JLG B;  4ZP7 A;  3QIP A;  1Y5L B;  2ZWP A;  4K4Y A;  1X5O A;  4CYU A;  2F65 A;  1CG2 A;  4P2X A;  3FKB A;  2BOP A;  4O3Q A;  5HMY A;  4DMZ A;  2IAJ B;  5D78 A;  3OL7 A;  2C2Z B;  4ED0 A;  1HNW F;  2XG8 A;  2PD1 A;  3MM5 B;  1TQL A;  1TU0 B;  2BMB A;  4B9U A;  2E9Z A;  3TJ9 A;  3GR1 A;  1KVI A;  1X4C A;  2VPW B;  3MGJ A;  2WSE C;  2M4M A;  1D8Y A;  1HWL A;  2CZ4 A;  3CCJ S;  5FII A;  2CQ1 A;  3KLI A;  4DV1 F;  1KWM A;  3CGI A;  2XS2 A;  3HHN B;  1WSR A;  1IBM F;  3VV2 B;  3HK2 A;  2ZDO A;  2QLW A;  1NDK A;  3R1L A;  1QE1 A;  1VIS A;  4DV1 J;  2V9K A;  5CCL A;  3LP1 A;  4EUV A;  5JVH Q;  4NEY A;  3J7A N;  3M8Y A;  4EO6 A;  1IBM J;  2YWG A;  3OR2 B;  5H9F J;  3GYX B;  2BVZ A;  3DRR A;  3IR6 B;  2IM2 A;  2DKO B;  4YEA A;  1NSP A;  2HWH A;  3VQS A;  1X9M A;  3QAE A;  2LLZ A;  3HZG A;  1SCJ B;  2H3E B;  3UO0 A;  4X4Q A;  4WE1 B;  4BBY A;  3NLC A;  3LPY A;  1R31 A;  1RT4 A;  1U49 A;  1F2G A;  2HZA A;  3OBI A;  3MFH A;  3D1Q A;  1DQ9 A;  3E8O A;  5ETM A;  2OPQ A;  4ICL A;  4ER8 A;  2GAH C;  1VOM A;  4OX8 A;  1RP5 A;  3IS9 A;  4P71 A;  3JSM A;  1PAU B;  3RU0 A;  2EI5 A;  2DNG A;  2NLW A;  4N77 A;  3EUN A;  4Y2M A;  2Q1L A;  2XGQ A;  3ENQ A;  1S1T A;  2F9J A;  4ZVE A;  4RW7 A;  3IWX A;  2YNH A;  1P9Y A;  4K2X A;  2C42 A;  4YY3 F;  3CE8 A;  2QFI A;  4RLE A;  4LF7 F;  2ZVI A;  2Y3Y A;  1FTR A;  1RWM B;  3KLH A;  3CCQ S;  3RZA A;  2YY3 A;  2DH8 A;  4DPY A;  4YY3 J;  5KFH A;  4ZVT B;  4LF7 J;  3V4I B;  2NCK L;  3HKW A;  3HZE A;  5D8H B;  1DQ8 A;  4O4G B;  2WVC A;  5KFE A;  5KFP A;  3IXQ A;  1WG1 A;  2ACY A;  1IVZ A;  5HJY A;  1YBT A;  1VQO S;  1TAQ A;  1VBX A;  3ENV A;  1A0O B;  5DJB A;  2V2Q A;  2VH7 A;  1WDD A;  2ZC3 A;  3VR1 A;  1S4E A;  3BQ1 A;  4XK8 C;  2ILY A;  4E8U A;  1FXL A;  2XY5 A;  4RW8 B;  2I1R A;  4WFX A;  3QQC D;  1Z2Z A;  2MQ8 A;  4Y65 A;  1X8D A;  3M6X A;  4DG1 B;  3EXC X;  1CJT A;  1BWV A;  3V5R A;  2VA3 A;  2XS5 A;  5I3Q A;  2CDR B;  3HD2 A;  2XMM A;  4ID5 B;  1PJ5 A;  3M9N B;  4I0W A;  3MMB A;  5LL6 d;  3KUG A;  4Q45 A;  3W61 A;  3PX0 A;  2IVY A;  4RW4 A;  3DLJ A;  5DQI A;  4KKO A;  5GMD A;  4PPD A;  4ZN3 A;  1WEX A;  2XMK A;  1HMV A;  5AT1 B;  2N7C A;  3U1L A;  3P5T L;  2R2U A;  3CJ0 A;  3UN3 A;  2VG5 A;  1KFS A;  3B8H A;  3D2W A;  1ZAX A;  2AJF E;  3B78 A;  1S0N A;  1T05 B;  4NLT A;  3V2U C;  3VZH A;  3AB2 B;  4L3K A;  2OTL S;  1JLA A;  4G1Q B;  3C19 A;  3FSI A;  2X1B A;  3DOL B;  3MED B;  2HBZ B;  1R0B G;  4QZV B;  2ATL A;  1X4B A;  4DBQ A;  3UVJ A;  4Y2K A;  1T9Y A;  1YDL A;  3IAS 9;  1Q5Y A;  4PG6 A;  2MZS A;  3N0V A;  2CPF A;  3SCI E;  4EYH B;  2DNR A;  2QA4 S;  1GMV A;  4JI5 F;  4ZP8 A;  2EFQ A;  2B9X A;  5BYR A;  4FYY B;  5HQ8 A;  4AYB D;  4USV A;  4P52 A;  3CC2 S;  3HT3 A;  3ILO A;  3MM7 A;  2EFG A;  4IFV B;  1ZA1 B;  4MK9 A;  4U6P A;  2Q6C A;  3CCT A;  4JI5 J;  1UA1 A;  2RQK A;  4ZPD A;  1PAE X;  3I4H X;  3CXC R;  2J0Q D;  4J9O A;  2UUC F;  4CNY A;  2C3P A;  5J1N A;  2FY1 A;  5KOX A;  1SPB P;  1FF2 A;  4FXV A;  4KGV B;  1TEL A;  1V5V A;  4V19 X;  2BKP A;  4B9V A;  3DRP A;  3G2X A;  4XDC A;  2RE1 A;  3BS9 A;  2UUC J;  4AQY F;  1NDC A;  4LFB F;  1DRZ A;  3KHR A;  1I94 F;  5EDW A;  4K4W A;  2BV3 A;  4OHZ A;  2DK2 A;  3WIU A;  2VG7 A;  4AQY J;  2MEW A;  2GJ2 A;  5EWE A;  4LFB J;  3HHD A;  2QA2 A;  5F8H A;  1C1B B;  1UVJ A;  2Q66 A;  1GFW B;  3TUP A;  5B08 A;  4X84 A;  2YKN B;  2VKZ G;  3RBX A;  5KG2 A;  1LV5 A;  4GVB B;  1KHW A;  4O3R A;  3R5G A;  2POK A;  2AJ0 A;  5D0E A;  4F36 A;  3M8Q B;  2PN6 A;  4Q43 A;  1RHR B;  1RTH B;  2LQ8 A;  1HBO A;  1WKK A;  5F9N A;  4WYL A;  2J9E A;  2DRD A;  4IH6 A;  3SQO P;  2V67 A;  3ZNU A;  4X4T A;  1F9H A;  3RB4 A;  2R9L A;  1RTI A;  2HG4 A;  3CJS A;  2FD2 A;  3Q0A A;  2VHG A;  1U0H A;  5JMN A;  1RBA A;  1LK5 A;  2KU7 A;  1HBU B;  3K17 A;  2NQP A;  4WXO A;  5I42 A;  4RNN A;  2LVW A;  2ZUA A;  4NLR A;  2CIM A;  5CYM B;  3OVS A;  3FCW A;  1KLM A;  1KBR A;  4PAB A;  4XPC A;  2GGP B;  4DSF A;  2AX1 A;  8RUC A;  1T8E A;  4KJI A;  1OIA A;  2DT9 A;  2X7I A;  5F8L A;  4WFY A;  3WZ0 A;  2MQQ A;  2IRY A;  2FC8 A;  3A1Y G;  1NPK A;  3GB0 A;  3FQK A;  1SBR A;  2HNY B;  2Z30 B;  3HI9 A;  4NWB A;  2CPE A;  5F0U A;  2WOM B;  2VDH A;  3MDF A;  3FFI A;  3LAL A;  4LQ3 A;  2L9D A;  3AOB A;  3TZZ A;  1TR0 A;  1JJH A;  2DHG A;  3DN9 A;  3FSY A;  1KS2 A;  3A8I A;  2W8L A;  2ZUG A;  2UUA F;  2NS1 B;  2LU1 A;  2ZBR A;  2ZEJ A;  1WOS A;  5D3G A;  3PAC A;  3KLV A;  4FF3 A;  1TL4 A;  2OI2 A;  5RUB A;  3ELH A;  1TUG B;  3QZ8 A;  5F9L A;  2UUA J;  2RML A;  4YB5 A;  2GCF A;  1FDA A;  1H7X A;  1S9F A;  3R9L A;  2BJ9 A;  4BCA A;  3IBW A;  5A2Q U;  4ZCM A;  4DV5 F;  5C24 A;  3EJM A;  3KHL A;  2K1R A;  1FXR A;  3HVT B;  2HK2 A;  3NGR A;  2FZG B;  2MTL A;  5GME A;  3J81 j;  1RIS A;  3LUY A;  4DV5 J;  1BMQ B;  1SIW B;  5ETT A;  5HO4 A;  3KJV B;  2XO7 A;  2YWW A;  4WU2 A;  3QFH A;  1JK9 B;  1RT7 A;  2XB2 D;  2F40 A;  3ZTP A;  3BPS P;  4DOZ A;  5KFL A;  2OPP A;  1NK0 A;  3EGV A;  5KFR A;  3W66 A;  2XYH B;  4FPI A;  5J2P A;  5EX0 A;  2B3T B;  4L72 B;  1VFJ A;  2OJ3 A;  1NK7 A;  3MPD A;  4B08 A;  1NKB A;  2V94 A;  1HD1 A;  2C3U A;  1ZH5 A;  3J81 Y;  2GC8 A;  3S01 A;  1XMQ F;  1UKU A;  1SH0 A;  4KGZ B;  3P6Y C;  2XC9 A;  3QT7 A;  1HBM A;  3BKT A;  3PYF A;  4DWI A;  4HAC A;  1VBZ A;  1SJQ A;  1XMQ J;  3OSN A;  3NKY A;  1KTV A;  2BX6 A;  1C1C B;  1QD1 A;  2KZM A;  1Y5N B;  4MMO A;  4I2Q A;  4DV7 F;  1U25 A;  1RAE B;  4WP8 A;  1K9M T;  3M32 B;  3AAW B;  1ZZF A;  3I9Z A;  1Y11 A;  1RT5 A;  1SJ3 P;  2ZJP Q;  1SUQ B;  5L46 A;  3M7V A;  2JC1 A;  2XLK A;  1VQ8 S;  4DV7 J;  1MRO A;  3SV3 A;  3VAI A;  4TYA A;  2IRX A;  1RT2 A;  3DMJ A;  3QAU A;  1ZYQ A;  3KLE A;  4JB8 B;  1K1S A;  4M5I A;  1OYD A;  3QYY A;  3I0R A;  2QE5 A;  1WNE A;  1VQP S;  3MCM A;  1QTM A;  4WZQ A;  2I6W A;  4V1A k;  1VYA A;  2AD9 A;  2EW9 A;  3HHL C;  4UUX A;  1WHW A;  3RW6 A;  1AA1 B;  1MWY A;  2HIY A;  3OFE A;  3TWZ A;  3NS6 A;  2X3D A;  5CH7 B;  3KNA A;  3VQT A;  3P5B P;  4B3T F;  1IKX A;  2OSQ A;  2RUS A;  3TEG A;  2CFX A;  3D0G E;  1I1G A;  1X5S A;  3QT6 A;  5LJ3 Y;  1VRU A;  1U1L A;  1KSP A;  5BJR A;  1H7W A;  5L1L A;  5AXM A;  3SCL E;  3EZ5 A;  3TRG A;  2RS2 A;  3CJK A;  4B3T J;  2V68 A;  4AL7 A;  1DAX A;  3PVX A;  4OHW A;  1O8B A;  4HTJ A;  4CYU B;  2H54 B;  3D0I E;  5L9X A;  2RKI A;  3DLG B;  4ATN A;  4QU7 A;  3GIM A;  3SDE A;  5FLX Y;  2Z2L A;  1MWQ A;  1IBL F;  2G2Z A;  4RKU C;  1YSJ A;  4BLG A;  1TVR A;  3S1T A;  2KFZ A;  2P8I A;  1D9D A;  3HVA A;  2ZOM A;  1FK9 A;  3QAT A;  2K7K A;  1TL3 B;  2COL A;  2AV5 A;  4LRD A;  4GKK F;  4NL5 A;  3D3C J;  2GZO A;  4Z7C A;  4LSN A;  1PCA A;  2H1Y A;  5F8G A;  2E7V A;  3ITH B;  1FT8 A;  1QE1 B;  1S9G A;  4GKK J;  3OTO F;  1HHT P;  1GXU A;  3ZZT A;  3LP1 B;  2GNK A;  4NLG A;  3PRB A;  2XSF A;  1YVF A;  4ED4 A;  3KHG A;  4NCA A;  5AXK A;  1T94 A;  3BO4 A;  3OTO J;  4Y6I A;  5EUH A;  2X1A A;  2JVO A;  4MYT A;  2YNF A;  3W2V B;  3PEH A;  4L6V 3;  4OX6 A;  1X0P A;  5GAH I;  1WC1 A;  1HQU A;  4QWB A;  1R6Y A;  2V2Z A;  1TKZ B;  3A8K A;  3CJ5 A;  4JI1 F;  1ZAV A;  3T5H A;  2AYG A;  3KJN B;  1RT4 B;  1N4L A;  2W7A A;  3T1A A;  1N5V A;  3PJW A;  3EDQ B;  2ADC A;  3BSA A;  4Z7Y A;  1S99 A;  4JI1 J;  2W4P A;  3IS9 B;  3WX8 A;  1AZS A;  4URG A;  2FDN A;  2VD3 A;  1BGX T;  4DR2 F;  1X9W A;  3OLB A;  1LWX A;  3JSM B;  1WSV A;  2R3V A;  4DR4 F;  1Y0H A;  3SQG A;  3MWB A;  4JV5 F;  1NEE A;  4IO1 A;  3FEZ A;  1KOH A;  1NLK L;  5T41 A;  5KFM A;  2CJY B;  1T95 A;  2KXN B;  2JL9 A;  1FRJ A;  2AX0 A;  4DR2 J;  4DR4 J;  1DY3 A;  4JV5 J;  4QR1 A;  4HKQ A;  1B0T A;  1TK0 A;  1GH8 A;  1IKY B;  2GA7 A;  1GAO A;  3CCM S;  1WC0 A;  3N6M A;  2MKY A;  1YJ9 S;  1VHI A;  5B0A A;  4DR7 F;  2C1E B;  2VBZ A;  2IM1 A;  2UU9 F;  3DU6 A;  2GQC A;  1N5Q A;  4ZPV R;  1HHS A;  4M5D A;  3FEX B;  4J91 A;  2KT2 A;  4DR7 J;  1SH3 A;  2UU9 J;  1Z4U A;  3J7Y I;  2DR8 A;  4KHM A;  1EP4 B;  3D6F B;  1IKV B;  3IN5 A;  2MDA A;  4J9S A;  4IRC A;  3DDI A;  1RHM B;  1O5J A;  1ZA2 B;  2C2N A;  2KDO A;  2YVS A;  4TY8 A;  1WKL A;  2Q6B A;  5KT4 A;  1U0S A;  2DIU A;  1GNK A;  5G0R B;  1S48 A;  5CAA A;  3LAN A;  2BE2 A;  1QAX A;  1Q79 A;  5GAG U;  4H4K C;  5E2Q A;  2XEX A;  3CB4 A;  3FVY A;  1C0T B;  3LAK A;  2LXU A;  5GAG I;  1YK9 A;  2HRU A;  3BM7 A;  4ED2 A;  3QO9 A;  3CJT A;  1VQ5 S;  3MMC A;  1NU4 A;  4USJ C;  1NK4 A;  1X7V A;  4LJM A;  2Z2M A;  2VIC A;  2IMO A;  2Z4P A;  3MHY A;  2YX7 A;  4HH1 A;  3MOJ B;  3Q83 A;  3GIJ A;  1J5O A;  3LP2 B;  3GV5 B;  4FF4 A;  5DZ7 A;  1NM2 A;  2GHV C;  1U7L A;  3Q23 A;  1U1Q A;  4IYQ A;  4RW4 B;  4N41 A;  1PO6 A;  4OZ3 A;  5CZV A;  3G8S A;  4NZ6 A;  3MR6 A;  3IGV A;  3MUM P;  3DRS A;  4KY3 A;  4WU3 A;  3NNA A;  3R5B A;  1YJV A;  3M6W A;  1V6H A;  2VG5 B;  2VG6 A;  3AOA A;  2V4Q A;  1QUP A;  2E9T A;  2R4F A;  5HL7 Q;  4F50 A;  4HHH A;  2MQP A;  1RTJ B;  3ILI A;  2XCP A;  4YHH F;  4DFK A;  6FD1 A;  3SFG A;  4P75 A;  4CO2 A;  1MMD A;  4PWU A;  3TA0 A;  5H9E J;  2RQC A;  5LMN F;  3CO9 A;  3PTW A;  2JEJ A;  4ZJQ A;  3BO3 A;  4YHH J;  2QZ8 A;  2WSF C;  5HAO A;  3NCQ A;  5LMN J;  3K0J A;  2Z57 B;  4NLY A;  1UPM B;  2ZZT A;  2X1F A;  2J7W A;  4IQM A;  3ZNJ 1;  3VAH A;  2VL1 A;  2KM8 C;  3BGR A;  4RBV A;  2AMC B;  3D54 A;  5HP1 A;  3GYN A;  4D3H A;  1S1X A;  3MM7 B;  4I4B A;  4UST A;  3KLG A;  4NLV A;  3Q24 A;  2Z2Y B;  5THW A;  4B3M F;  4CWB A;  4EZ6 A;  5B0E A;  1UFL A;  2WK4 A;  1U26 A;  4ZVF A;  2EG2 A;  2O66 A;  2I5J B;  4ZCI A;  3ZO7 A;  3Q8V A;  2B8Q A;  4KQZ A;  4B3M J;  4PQU A;  2V0N A;  1RSC A;  1PC4 A;  2WW8 A;  4CO5 A;  3FGV A;  5CYQ A;  5D0G A;  3NGU A;  1XMB A;  1N54 B;  2HHV A;  3NCP A;  3KYL A;  1XWL A;  3MCO A;  3I9V 9;  4DSE A;  3O3L A;  4DS4 A;  2CQP A;  4KV8 A;  2FLL A;  2RRN A;  2KVI A;  3KMS A;  1RWV B;  3BJY A;  2DIS A;  1RZM A;  5HBM A;  4WFZ A;  2AKW B;  2E44 A;  3GTY X;  3L4B C;  2BYC A;  1X4A A;  5MLC V;  2XMJ A;  2CQG A;  4ZK7 M;  4JYA F;  2L9W A;  1HBO B;  4NYO A;  3I56 S;  4CLP A;  5A8R A;  2D69 A;  4DV0 F;  1KN6 A;  4JYA J;  1N0U A;  1FJC A;  1SC6 A;  5FD1 A;  5L8R C;  3NCR A;  1XK8 A;  3QWU A;  2XMV A;  1U0H B;  4HT7 A;  1QVF R;  4F4K A;  3FMB A;  4DV0 J;  2HVZ A;  4LRF A;  4NI2 A;  1KLM B;  1X4H A;  3DC2 A;  5LSL A;  4PZV A;  4KE5 A;  5K14 A;  2CPD A;  2DGT A;  2QMW A;  3NNC A;  4PXE A;  4CLY A;  4DPO A;  5DM6 Q;  3MM8 B;  3C15 A;  4K59 A;  2XZW A;  1RYS A;  3PDN A;  3ENA A;  3BO2 A;  2RIJ A;  5LXR A;  3PX6 A;  5ETN A;  1S7I A;  1A9N B;  4U7C A;  2C3M A;  2DEJ A;  1OJ4 A;  3KDO A;  2LYV A;  3SSS A;  3D66 A;  2RVJ A;  4QIW D;  4RW9 A;  4C2M A;  1X9S A;  1JMT A;  3M6V A;  3UPF A;  1KQS R;  1J27 A;  2YNI B;  2M5Y A;  3CJ8 A;  1WD6 A;  3HSD A;  5M2R A;  1CJV B;  1LK7 A;  1SL1 A;  3GON A;  4YB1 P;  1ZAW A;  2GV1 A;  3QT5 A;  4IR9 A;  1VRT A;  4F4Z A;  4U95 A;  2BAN A;  2JEG A;  2WZ1 A;  3OTD A;  4F7V A;  2DIV A;  1TP7 A;  1BXN A;  1C2P A;  1FX4 A;  3G82 A;  3MUT P;  4PEO A;  5K20 B;  1Q8I A;  4WK1 A;  2A3J A;  2ZC4 A;  2JHE A;  2B43 A;  2OO4 A;  3PXG a;  4X4N A;  4MIA A;  3JAM U;  4C0H A;  1F5B A;  4EYI B;  1RQ0 A;  2AJ4 A;  2M52 A;  3MEE A;  4A48 A;  4ANC A;  4P6Q A;  2UXC F;  3RAX A;  3RJM B;  3P45 B;  1FCA A;  1XBW A;  2GVD A;  3TUI C;  5IV3 A;  2W2P P;  4IG0 B;  1IKW A;  2UXC J;  1RT3 B;  2G1H A;  5M2P A;  2DGQ A;  2XQC A;  1HBM B;  3DHW C;  4KTQ A;  2QO3 A;  1SB6 A;  4HAC B;  3HSG A;  3MEK A;  1JLF A;  5D4O A;  3NMA A;  5BYS A;  3GJQ B;  2W01 A;  4TN2 A;  2R8G A;  1TZ0 A;  4CCH A;  2FLN A;  4OX9 F;  3U7J A;  3LWM A;  5GAD I;  4O3P A;  1OSC A;  3IWN C;  1RT5 B;  4F3M A;  1H72 C;  3PW0 A;  1MRO B;  4DQI A;  1C0U A;  2J9C A;  4OX9 J;  1WHX A;  4F26 A;  1RA7 A;  4A8Y A;  3C16 A;  1CJK A;  1KDN A;  1RTD B;  2KG1 A;  1RT2 B;  2O1P A;  3MPV A;  1PGZ A;  3PJX A;  2D74 B;  2G4B A;  2CUY A;  3I0R B;  4URS A;  4F3Q A;  2FJD B;  3OSP A;  1QAJ A;  5JVG Q;  4K5S A;  1U09 A;  1TL1 A;  1IJE B;  4PWD B;  3K8W A;  4OYA A;  2VAS A;  8ATC B;  4EU0 A;  4NA3 A;  3NS5 A;  1M0S A;  1UW9 A;  1U1O A;  3T19 A;  1ZM4 A;  4MKA A;  4USK A;  1IKX B;  2IPO B;  4PYA A;  2JLG A;  5KFB A;  2RAQ A;  3I82 A;  2CJB A;  5GAE I;  2QMU B;  1B99 A;  1VQ4 S;  2I0X A;  4DX8 H;  2C2E A;  2WBM A;  2FJA B;  2N4D A;  2GIF A;  2P6T A;  1RT1 A;  3MM9 A;  2CJQ A;  3L7U A;  3EX7 B;  3M8Z A;  1NXI A;  2Y1R I;  4ZIT A;  1OSD A;  1X0F A;  3LP0 A;  4USU A;  5HQM A;  1Q53 A;  2KYX A;  2HQI A;  3PO5 A;  2E1M C;  4ED6 A;  2WW4 A;  1TVR B;  4Y28 C;  4FP9 A;  3PW4 A;  2M2B A;  5J2N A;  2E1A A;  2NXE A;  1SQF A;  4WIQ A;  4U7U K;  3NBP B;  4C3M A;  2I9S A;  3EPI A;  3U02 A;  1OPI A;  3L3C A;  4KGK A;  3M8P B;  1FFG B;  1TKX A;  4JI4 F;  1X4E A;  4KPY A;  2CQ4 A;  1S9G B;  3BSO A;  3CO0 P;  1N6Q A;  3I4P A;  2K8G A;  4HTI A;  3EPG A;  1G1X A;  2B5J A;  5KG7 A;  4JI4 J;  3D0H E;  3ILL A;  5F41 A;  3R7B B;  4J90 A;  3HFV A;  1N5T A;  3TAP A;  2IM3 A;  2YNF B;  1Q16 B;  2DGS A;  3HMJ G;  3GIK A;  3N6L A;  1JNR B;  3M8W A;  3KWM A;  5U47 A;  1X31 C;  3ULH A;  4N76 A;  4J5O A;  4ZPA A;  5KG1 A;  5KG0 A;  2NXU A;  3OW2 R;  1ZZN A;  2YWE A;  3HHL B;  3B4M A;  2E1C A;  4LVO P;  1F60 B;  2PEB A;  3T1Y F;  1S59 A;  1S1V B;  1LWE A;  2GML A;  2Y8W A;  1KD1 T;  5EHH A;  3L09 A;  2DCL A;  4LRA A;  4L76 A;  4DR1 F;  3JYT B;  4C7Q A;  1AZS B;  3EXY A;  4PR6 A;  3T1Y J;  2C2M B;  2D3O R;  1XR5 A;  3KNG A;  1BLU A;  2HAI A;  4DR1 J;  1F6T A;  3HFZ B;  3S6E A;  3CUL A;  1RHJ B;  4M63 A;  4EWT A;  2EC2 A;  5KFS A;  1BY9 A;  2AZ3 A;  1QY7 A;  1GQE A;  2QSW A;  2K3K A;  1XQI A;  3VGV A;  2F5G A;  1UEV A;  2XBP A;  2H5J B;  4RX6 A;  3UE2 A;  1VC0 A;  1R8B A;  5T14 A;  4FKY A;  2HK3 A;  4LUB A;  4CRJ A;  4RWW A;  2OSR A;  1M5P C;  4WYW A;  2ACM A;  2R8H A;  1ZM2 A;  4PPZ A;  3DI6 A;  3CVK A;  4MIW A;  2XY6 A;  1HPZ A;  4M5D B;  3I0S B;  4DF4 A;  1S0M A;  3BYR A;  1U8W A;  3I87 A;  4CNZ A;  1OYE A;  3I96 A;  3N4W A;  1M1K T;  2R7U A;  1BC6 A;  5SZT A;  2B6A A;  2R8I A;  2MKS A;  1XNQ F;  1XMO F;  3K7R A;  5HK4 A;  2DD8 S;  1N5S A;  3R3T A;  1F5C A;  3MM6 B;  4TY8 B;  3BBC A;  3WC0 A;  1G2E A;  2RHS B;  3AY0 A;  1QAI A;  1XNQ J;  1T03 A;  1XMO J;  2ABY A;  1RHK B;  3E01 A;  1FD2 A;  1TUW A;  2BE2 B;  4DL7 A;  3W2W A;  2XTJ P;  4JI0 F;  3PR5 B;  4QIG A;  4P2M A;  5C42 A;  3HHL D;  3H5Y A;  3PG9 A;  4C0O C;  1NK5 A;  4ZLP A;  1NKC A;  4K0K F;  4JI0 J;  5D0H A;  4Q0B A;  5DET A;  4WFN Q;  3NL0 A;  4Z37 A;  4X64 F;  1VBK A;  4DV3 F;  2M0G B;  4DL2 A;  1LW2 A;  2R7X A;  1M5O C;  1RKJ A;  2V8G A;  4NX9 A;  2IBO A;  4K0K J;  3ZTS A;  1GX6 A;  2XSJ B;  3FBC A;  1A6L A;  2IFX A;  2HHT A;  4ILR A;  4X64 J;  3L9Z A;  4DV3 J;  1AW0 A;  1S12 A;  3G71 S;  3T5L A;  2YNG A;  1H6K X;  4QWA A;  3THP A;  5HAT A;  5EX3 A;  4DQP A;  2J7U A;  4B9L A;  3OD2 A;  3G6V A;  4MKV A;  4Y2A A;  3Q89 A;  1AFI A;  2VPY B;  4KC5 A;  2JX2 A;  2L3M A;  4GC7 A;  3RR8 A;  2O3D A;  3LH2 S;  4F0K A;  2CRL A;  4QW9 A;  4DV4 F;  2AJ2 A;  5I3U B;  2LA6 A;  5CYJ A;  1N33 F;  4FBU A;  4KPC A;  3UQS A;  5A8K B;  5DLG A;  4OI3 A;  5K5M A;  2KRR A;  3IC1 A;  4KO0 B;  4RUA A;  4DV4 J;  1FKO A;  5FJ4 A;  2HVD A;  3D1H A;  3WDO A;  2EFV A;  3DLE B;  1N33 J;  2D3U A;  3K5N A;  4ZMM A;  2H65 B;  4P10 A;  3I32 A;  2WAQ D;  3BGR B;  4RW6 A;  1M1G A;  3GFZ A;  3OUY A;  3H8Y A;  4DV2 F;  3P49 B;  2IVM A;  4XO0 A;  2Y0S D;  3R7S B;  3PV8 A;  5KG6 A;  2B7B B;  1RYR A;  4R8U A;  4OL8 A;  1RA6 A;  4DV2 J;  2LFV A;  5KG4 A;  1IM4 A;  5CXT A;  4R5P A;  2XWX A;  2H5I B;  5E3C A;  2N4C A;  4ERD A;  1GTE A;  1PIE A;  3P96 A;  7FDR A;  1Z1Z A;  3CC7 S;  2BA9 A;  2RNE A;  2F7V A;  2N3O A;  2GAG C;  3D4J A;  2CNL B;  1S72 S;  2CVE A;  3IG1 A;  4HDG A;  2BRL A;  4F0M A;  1WWH A;  3JQJ A;  4DS5 A;  4PXD A;  2PMZ D;  2EBG A;  2FPH X;  4ZPC A;  3QWP A;  4DQS A;  5KFW A;  2C2O B;  3FRY A;  4B9T A;  2PII A;  5HBM B;  3OFH A;  3GWC A;  3MMA A;  2GHW A;  2HVI A;  5KFI A;  1LW0 A;  1QUV A;  4LR7 A;  1RAB B;  2E66 A;  5KFA A;  1H73 A;  9RUB A;  3I6P A;  3N28 A;  1HFE L;  4DQQ A;  5KT7 A;  2KJV A;  2EEY A;  3W5Y A;  1ELO A;  1L5U A;  1NK8 A;  1FKA F;  2V8D A;  2NPI A;  1UVI A;  4OLP A;  1MU2 A;  1ZTT A;  4QWC A;  3ETO A;  2RIL A;  2KM8 B;  5IWA F;  2AHO B;  3Q2T C;  1CS4 A;  4F2S A;  4NI2 B;  3SBM A;  2WVF A;  4KRW A;  4H4O A;  1X5T A;  1B64 A;  1URR A;  4F04 B;  1F0X A;  1VIO A;  2F8E X;  4O23 A;  4W4M A;  3QT8 A;  2CDQ A;  4QW8 A;  5L9N A;  5DQH A;  5DS7 A;  2JLE A;  2Z2Z A;  2V8V A;  5IWA J;  1JKH B;  2NUU G;  1P9Q C;  4O3N A;  4J37 A;  1MNE A;  2ZH2 A;  4TVA B;  1FEE A;  3OJS A;  5D0R A;  2MKJ A;  3KJF B;  2CJA A;  1G6B A;  4M1K A;  3UWT A;  5J2M A;  3TR5 A;  3MEG A;  2M9K A;  4HVZ A;  4UZC A;  4A8Q A;  3H7H B;  4AD6 A;  3HFK A;  2VU5 A;  3DHX A;  2CQ2 A;  1JXE A;  3N5F A;  2FB0 A;  4MJK A;  3SCK E;  5CZX A;  2R8K A;  2QG9 B;  2M7S A;  2QC3 A;  1HQ2 A;  2HRT A;  4PWW A;  2E5L F;  1HWI A;  2FHJ D;  4PCQ A;  1TV6 A;  1R0A B;  4J9M A;  4X66 F;  2NXJ A;  1RCO B;  1HD0 A;  4MFB B;  3RRG A;  5KFC A;  4HYK A;  1U2F A;  2ZOF A;  2B8P A;  1NK6 A;  2E5L J;  4PXB A;  4Y3C A;  3D6M B;  2EG1 A;  2HHP A;  1RDR A;  1X5P A;  1YQH A;  3RRK A;  2XI2 A;  2FYX A;  2R2T A;  3CUN A;  2OD4 A;  3KFW X;  1HYS A;  5H9F K;  2IRU A;  3VAM A;  2PT0 A;  3NXZ A;  2FHJ A;  1R3N A;  4JI3 F;  3ZXW A;  3ILJ A;  1GMU A;  3L7P A;  3T41 A;  4HDH A;  3HSZ A;  1S1W B;  2PFF B;  4JOU A;  3M9M B;  1LWC A;  3THV A;  4LR8 A;  3IWL A;  3G96 A;  2WON B;  4JI3 J;  1HBN A;  1CPZ A;  1IQT A;  4IDK A;  2X51 A;  2GVD B;  1IN0 A;  1OWX A;  3SZ2 A;  2HQF A;  2L08 A;  2QLB B;  1IKW B;  2EKY A;  2XNQ A;  2HGL A;  2DPJ A;  3CW2 C;  2BJ1 A;  2YPY A;  1UA0 A;  4DCJ B;  2YX1 A;  2ZE2 A;  2I2Y A;  1Y3J A;  4WF9 Q;  4QJV A;  1HI0 P;  4BC7 A;  1TK8 A;  4NZ7 A;  1S6O A;  1WHV A;  1REV B;  1UFK A;  1RUS A;  3A13 A;  4I6Y A;  3IMQ J;  2XHW A;  1VJW A;  1H98 A;  4E0D A;  2DNM A;  3GPA A;  1S6P A;  1UJ4 A;  2Z56 B;  1UCN A;  4CM0 A;  5CA5 A;  2HGM A;  4WCE Q;  4MTP A;  4ELU A;  3NGD A;  4ETX A;  2AGP A;  2DHA A;  4PUO A;  3FQL A;  3HSJ A;  1D3W A;  1JLB A;  3X1L B;  3UDL A;  2RQ4 A;  4DHV A;  3ICL A;  5T7L A;  4MH8 A;  4YR3 A;  2JFK A;  1EQ0 A;  3W65 A;  4FVC A;  2OEJ A;  4F4W A;  2LQJ A;  2ZZN A;  3E51 A;  5F8J A;  2XWY A;  1RAA B;  4L73 A;  1PJ7 A;  2DR6 A;  3QGG A;  3LAM A;  1L3S A;  2GVZ B;  4O3O A;  5LT5 A;  1SC1 B;  1VDH A;  5J1P A;  2VBX A;  5CAB A;  3PNI A;  2HPU A;  3F0N A;  4LFC F;  3CDW A;  3V6H A;  1TMM A;  2ZM6 F;  2YKP A;  3VGU A;  2ALY B;  1YHQ S;  2DR5 A;  2A0F B;  2XLI A;  4FZV A;  2YKO A;  4ZPW R;  1WOP A;  4C9D A;  3DDN A;  4QIE A;  3NGT A;  5K8O A;  3PW5 A;  3DLK B;  3PFO A;  4LBP A;  2CWX A;  5CHC B;  4LFC J;  5ETV A;  2KT3 A;  1ZET A;  1YIT S;  3D67 A;  4X65 F;  4IFY B;  2YKM B;  2ZM6 J;  3AA9 A;  3I5B A;  1AFJ A;  3H4B A;  1CJU B;  4C48 A;  2P2C B;  1WOR A;  2OIH A;  5J2N B;  3ETM A;  1PYS B;  4CO1 A;  4X65 J;  2AWZ A;  4CO4 A;  1TMJ A;  4URQ U;  1YRX A;  1ZBT A;  2J6S A;  1V3S A;  3GQC A;  2HQD A;  3SV4 A;  4BS2 A;  3CDA A;  5DRK A;  4FS1 A;  3GZ7 A;  1CC7 A;  1SL2 A;  4LSL A;  2BW2 A;  5AE2 A;  3K5M A;  2XS7 A;  1N6Q B;  1LNQ A;  1RAF B;  3R5D A;  1QSL A;  3U1M A;  2B5J B;  3TO8 A;  3TAM B;  1YJ7 A;  5HVF A;  3J81 U;  2LU2 A;  4QPX A;  1CLF A;  1SV5 B;  2BQ3 A;  2F8M A;  5LMU F;  2KHC A;  5KOW A;  3T6B A;  5HRO A;  2RF2 A;  1LWE B;  5DO2 A;  5L1J A;  2IC3 B;  4QBU A;  3K8V A;  5LMU J;  2YX4 A;  4UOF A;  2F4V F;  4CM2 A;  4G6V B;  3CMA S;  3H2U B;  1FWK A;  3SI8 A;  4ES3 A;  2N7Y A;  3R6L B;  1U6B A;  2CA9 A;  1PG5 B;  2F4V J;  1FFW B;  2HFN A;  3GE9 A;  1EET B;  3IAM 9;  1T02 A;  1WC4 A;  2AT1 B;  3TP2 A;  5J2Q A;  1SKS A;  3LWL A;  2LEB A;  2B0G A;  4LBH A;  2KXF A;  5KFG A;  5FDL B;  3UN5 A;  2LEP A;  1TTH B;  3IGN A;  1OQ3 A;  3OHA A;  2KFY A;  1PYT A;  4ILL A;  4OHY A;  2RB7 A;  2GJF A;  4V19 J;  1MG7 A;  3AXK A;  3PYD A;  5KFZ A;  1HNI A;  2LDI A;  4R0E A;  3PR4 A;  1SIZ A;  4OMF G;  3M2U B;  2EBE A;  2FHM A;  2ZIT A;  1Y3K A;  2HIQ A;  1W26 A;  2PGC A;  3VCD A;  2QX0 A;  1Q7Y T;  3FCH A;  2ZD1 B;  3BGU A;  2BJ8 A;  4QWE A;  5KFN A;  1DJ0 A;  5FLX U;  2EFP A;  3H25 A;  3L95 X;  2HQC A;  4H4M B;  3CTR A;  2ZKU A;  4Q44 A;  3CPW R;  3CDE A;  5CCM A;  1S9E A;  3TVK A;  3RUB L;  2GIR A;  1UZH A;  3QGP A;  5HSP A;  2CQH A;  2BJ3 A;  3MEC A;  2ASJ A;  1KVJ A;  5C5J A;  1TKD A;  1T03 B;  3C8Y A;  4OYW A;  2VOD A;  4FKX A;  5IV4 A;  4I2P A;  1F9E B;  3CCR S;  2CQC A;  1EX8 A;  5EWF A;  2QLX A;  3POT A;  1APS A;  4Y2C A;  3MUV P;  4DL6 A;  3M1V A;  4YQW A;  4ZS6 A;  4RZR A;  4KH1 B;  2J7K A;  2QL7 B;  3OVA A;  2QGF B;  1JLC B;  1L3V A;  1GX5 A;  3PRD A;  3CD5 A;  3FSX A;  4RJV A;  3RBD A;  4M5N A;  4P9S A;  3R97 A;  1ULR A;  2VBY A;  1XER A;  4DUY F;  3LOU A;  5IS2 A;  3ZZ0 A;  2OUG A;  1FRX A;  3WC2 A;  3M6U A;  2WTF A;  4DUY J;  4ZP6 A;  4NML A;  1VRQ C;  1UWA A;  4TYB A;  1JLG A;  2V9W A;  1Q8L A;  2HND A;  3MAA B;  3MAQ A;  1Q0N A;  4AUK A;  3QNW B;  3Q8P B;  4ECW A;  1HAR A;  2BE9 B;  3GG1 A;  2XMA A;  2DH7 A;  2W2O P;  2IY5 B;  1H74 A;  3U27 A;  2IAJ A;  3NEK A;  1O51 A;  2OP5 A;  2MY7 A;  1Q82 T;  3BH6 B;  1DTQ B;  3H2V E;  3MM5 A;  2IA0 A;  3H0P A;  3H42 A;  2FGC A;  4OZN A;  2W24 A;  3EGZ A;  2ZFH A;  4ECX A;  4ED1 A;  1S97 A;  1PBA A;  1Y00 A;  2DGU A;  3UCZ P;  4I6A A;  4OYP A;  2H9Z A;  1NB7 A;  2HFU A;  1N5Y B;  3FZ2 A;  4RW6 B;  3LA0 A;  1YG0 A;  1SXL A;  2MJU A;  1HI8 A;  5EGY A;  4DCO B;  3BRE A;  1T9T A;  2QSF A;  2ZH5 A;  4OHX A;  3JXO A;  4NRU A;  2H5E A;  3J80 Y;  2DO0 A;  4W92 B;  4KFB B;  4ZIV A;  4A8X A;  2FTR A;  4HI1 A;  2UVW A;  4EEY A;  2RRB A;  3MMJ A;  2DNK A;  1FJE B;  3M05 A;  3W9H A;  5KG3 A;  1VIX A;  3R2C J;  2ASY A;  4X4O A;  2G1D A;  5HMX A;  1YLX A;  3ADA C;  3CCV S;  2PA3 A;  2WRM A;  1Q4R A;  4FNH A;  2Z8Q A;  5BXI A;  3TOQ A;  1UFW A;  4WE1 A;  5HMZ A;  3DFE A;  2A18 A;  2QLF B;  3A4T A;  1HWK A;  3IG1 B;  3FJ2 A;  3OFF A;  3ET6 B;  4DX7 A;  1B4S A;  2OKQ A;  4CZC A;  1UWB B;  1ARO P;  4NLO A;  2CYY A;  2UVU A;  2HZV A;  2CNK B;  5B0G A;  3MMA B;  3SSQ A;  1S57 A;  2WVD A;  4AXI A;  4ZLL A;  2HZC A;  2RS8 A;  2CQD A;  4B02 A;  4HR2 A;  2K3I A;  3CED A;  1U2R A;  3FCV A;  2HVH A;  1QM9 A;  2KRB A;  2VFR A;  4YR0 A;  2OPS B;  3TZY A;  1K44 A;  1EQM A;  1JLQ A;  2XMT A;  1FES A;  4OFZ A;  3IFE A;  1SC4 B;  4MK7 A;  4RU9 A;  3GCW P;  1YWX A;  2FY8 A;  1QSY A;  3THT A;  1HWJ A;  1MU2 B;  3V4I A;  2VC0 A;  1FKP B;  1CS4 B;  4LIR A;  4H4O B;  1YJN S;  4GMK A;  2ZHB A;  3HVR A;  2HS4 A;  3T9Z A;  4O4G A;  2JNJ A;  3QJP A;  2V8P A;  3MD3 A;  4PQA A;  4Y0F A;  3LPE A;  2EWH A;  3QID A;  3CME S;  2C28 A;  4MIB A;  2F63 A;  3PEJ A;  3EMT A;  5M2U A;  4DL0 C;  4HI2 A;  2BRK A;  1RU2 A;  3C14 B;  4RNF A;  1BQN B;  3G4S S;  4L3N A;  4QR0 A;  5DDR C;  3TX0 A;  4RW8 A;  3HHE A;  1DAR A;  1FNX H;  4K2J A;  3OVB A;  3UD5 A;  3D1O A;  3DYA B;  4K5R A;  4EBE A;  2AQ4 A;  2CQB A;  5GMK a;  2X3G A;  1HNV B;  3HUL A;  2D3O 1;  3LF0 A;  2FVQ A;  2BBE A;  2C3O A;  4M5L A;  1TV6 B;  3FK4 A;  1S1U B;  2JWN A;  1NH7 A;  4ID8 A;  1NJZ A;  4QCL A;  2MB0 B;  7FD1 A;  3WX4 A;  3TEH B;  2YKA A;  2MZ1 A;  3C6T A;  1WI8 A;  1JQG A;  1BUX A;  3VTI A;  5ITH A;  3OR1 A;  3AOC A;  4LF6 F;  3KG1 A;  4ZCK A;  1RAG B;  4F3O A;  3ZTR A;  4LVN P;  3DM2 B;  5G4D A;  1H3D A;  3QGH A;  2JEF A;  2D1C A;  2YTC A;  2HLU A;  4NCG B;  2XCA A;  4DX5 A;  2XHC A;  4IQX A;  3T6J A;  4LF6 J;  4U96 A;  1NB2 A;  1OQ6 A;  3KOA A;  4ZJO A;  2DRB A;  3E3X A;  5IM0 B;  1X4D A;  5E3R A;  3GU0 A;  1NME B;  1DHM A;  1LWC B;  3TNV A;  2LA4 A;  3DOK B;  4B3R F;  1N0V C;  2HW3 A;  1KEK A;  4YR2 A;  3CIZ A;  2H4Y B;  2PMH A;  3K89 A;  1VGY A;  2HHH F;  4DUZ F;  3E2E A;  1P1L A;  1B7F A;  1RTZ A;  4B3R J;  3IRX B;  1G7C B;  2KB2 A;  8AT1 B;  2HHH J;  4DUZ J;  3NAH A;  2ATC B;  1T9U A;  3CCW A;  2YH0 A;  1RJJ A;  2ZE2 B;  4OJ3 A;  2FQQ B;  4O4R A;  3MR5 A;  1L3T A;  4IG3 B;  1FDB A;  5LM7 E;  5LSR A;  2E5G A;  1PYO B;  3N6N A;  2CZ9 A;  3CF5 Q;  4FBT A;  2CPH A;  3T1H F;  1F3F A;  2B4U A;  2DYA A;  1RWX B;  2W25 A;  3MD1 A;  3O8W A;  4DR5 F;  3VHQ A;  1UP1 A;  3BSN A;  4M5M A;  3G9C A;  5IXU A;  3N01 A;  4H54 A;  4X62 F;  1HLW A;  2DNL A;  3T1H J;  4B3S J;  1NPR A;  1R8H A;  3BGL A;  1GTH A;  3AJD A;  2PI5 A;  4DR5 J;  1RAO A;  2W9B B;  3G6X A;  1JLB B;  3NGS A;  1WTF A;  4X62 J;  3AHP A;  5IQQ A;  1VQY A;  4TU9 A;  4ZHR B;  5DG7 A;  4AE5 A;  1RLD A;  1C1B A;  4O0N A;  3G86 A;  4NAS A;  2DBB A;  4NPO A;  4ED5 A;  2PC6 A;  1E6Y A;  2YKN A;  3QLH B;  1LWF A;  3UN2 A;  5E0O A;  1VI7 A;  5B0B A;  4GVB A;  2HWT A;  4ED8 A;  1CUL A;  2OPR B;  2RH3 A;  3M8Q A;  4P74 A;  3D6T B;  2YQ3 A;  4PAA A;  1M5H A;  4WTO B;  4EZ9 A;  3I31 A;  2XUL A;  4DSJ A;  4A47 A;  4O3S A;  3TQ1 A;  1HQE B;  2KYZ A;  5CD4 H;  3D9B A;  1RWN B;  3QRR A;  5E5N A;  2V4J B;  2CNO B;  3M2R A;  1FNM A;  5KFK A;  2J0W A;  3HJV A;  1HBU A;  5ETK A;  3MPU B;  1N88 A;  5D4N A;  2Z0G A;  1XEZ A;  1DBD A;  7AT1 B;  1FA0 A;  2GGP A;  1R8P A;  3MFI A;  1N56 A;  2LEA A;  1G4C A;  3BBB A;  4OQJ A;  2W9A A;  2I38 A;  4DFJ A;  5HQL A;  3GSD A;  3JQM A;  1RT6 A;  2XMW A;  2J76 E;  2HNY A;  2MQN A;  2AJ1 A;  4C0B A;  3GIL A;  2GMJ A;  1D9A A;  3CWJ A;  1S76 D;  3ZFV A;  2BM1 A;  3GIR A;  2VOP A;  2V2V A;  2BUN A;  1QVG R;  2BDP A;  1E6V B;  3C6U A;  3MPW A;  1N32 F;  3R5C A;  2UV8 A;  2UUT A;  1PC5 A;  4DSI A;  4X4R A;  2D9O A;  4EFA C;  1RAJ A;  5KFD A;  2VV5 A;  4K4V A;  1JLE B;  1N32 J;  2I8E A;  2U2F A;  2R8J A;  4CO3 A;  2DHS A;  5JUM A;  4IKA A;  4OZ1 A;  1TFY A;  3UDE A; 
#chains in the Genus database with same CATH homology
 5CD4 A;  2Y9H A;  3QRP A;  5H9F K;  3QRR A;  4DZD A;  4QYZ K;  2Y8W A;  5H9E K;  1WJ9 A;  4U7U D;  3QRQ A;  2Y8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...