5H9FK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target at 2.45 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
159
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHDFLFHVEKCHVLLQSAQMPSTAVATVIKTQVEFQLQVGVPLYFRLRANPIKTICRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Immune system/rna
total genus 21
structure length 159
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9fK02
4U7UD 5H9EK 2Y9HA 4DZDA 3QRPA 4QYZK 2Y8WA 2Y8YA 1WJ9A 3QRQA 5H9FK 5CD4A 3QRRA
chains in the Genus database with same CATH superfamily
3CCMS 2P9CA 5L8RC 4R5PA 2Y0SD 1S0MA 2BJ1A 1QAXA 2EBEA 3GONA 5I3QA 4JV5J 2B4PA 2VONA 3GYNA 2VQEF 4ECYA 2FQQB 4NYPA 4PPZA 1GAOA 5KFHA 3CC4S 2V67A 4EK2A 3GJQB 4IQXA 3SDEA 2JEJA 5BXIA 4ENOA 4OV6A 3LUYA 4DV6J 2VPXB 3UDVA 4PG6A 5I42A 4KPYA 1OQ3A 3Q24A 4GRSA 4KHRA 3BQ0A 1RT1B 1Q86T 3PTWA 1CLFA 4G3IA 2RH3A 2U1AA 3IG1A 2OI2A 4NI2B 5D4PA 1RWWB 3DU6A 5C25B 2VQFF 1U0HB 4IRDA 4O4GB 1LWEA 3C16B 2ASJA 2IAJB 2F9DA 3DHWC 1YBAA 1N0UA 5AE2A 2Z56B 2FGOA 2ROGA 4RW6B 3GIMA 2GW8A 4B02A 1XK8A 2X7IA 4MYTA 4I1TA 2DNNA 1N5YB 2HQCA 2IJFA 2IC3B 3OBIA 1WEYA 4IRKA 2NLWA 3N0VA 2E5HA 5KG5A 4UT4A 2DNHA 3EE3A 1RT5A 2AGPA 3I0SA 1F2HA 1GMUA 5KG1A 1FKPB 4HR2A 5ETVA 3WC0A 4PUOA 1LFPA 2NZCA 1HYSB 2A18A 4S0MA 4CO5A 1RKIA 2R7XA 4WXOA 3DXBA 2ERRA 4ELVA 2KFZA 2R42A 4Y0FA 4A8WA 1KOHA 1VFJA 1C1CB 4LF7F 5B0EA 3MR6A 3OT9A 2EK6A 2KDOA 2MQ8A 2ZZNA 2HHSA 5KFUA 3FNNA 3LQVA 1OS5A 3E8OA 4UUWA 4YDDB 1WD6A 2IVMA 4U7CA 3OUYA 4EZ6A 1I3OB 3M2UB 3OJSA 1TQLA 3O1LA 3AJ1A 4H4OB 3CB4A 1FERA 2G4BA 1TL4A 2LA6A 1NU4A 3HHLD 4NYZA 3R1LA 2M70A 2DR9A 1T3OA 3D9BA 3OR1A 3QJJA 1N48A 2EBGA 4M5IA 2QTWA 3V5RA 4KSEB 1ZM2A 4O23A 2KI2A 1VGYA 5IFMA 4EYHB 3RW7A 3ITHB 2H4WB 5GADI 3DI6A 1UJ4A 5GMDA 2Q1LA 3UD3P 4PG7A 4ZPWR 2LEBA 1RK8A 1G6BA 4MTPA 5KFQA 1XNQJ 3H4DA 5EUHA 2E5GA 4CI0B 1UVIA 3T1YF 3MM7B 2MHEA 3CDBA 3CVKA 3MOZA 2RS8A 3IP0A 2C2RA 1LK7A 2XGPA 4NA1A 1JLGB 4Q0BB 2RRBA 3QBCA 3PVXA 1H2VZ 3PW2A 2E5LF 4ZKAA 1GXLA 4DX5A 4HACB 3FMBA 5EN1A 3BO4A 4QU6A 3V6KA 5KT7A 3KLIA 1R3NA 2VDHA 4CM2A 4O44B 3D6TB 3MR3A 1NDLA 4DXLA 3Q89A 1WUUA 1S5ZA 2W2QP 1FDDA 1RUSA 1S9GA 2E5JA 3G96A 1FE0A 2B5JB 2FLLA 2XSJB 2HFZA 4WFYA 1D8YA 1MSWD 3R5DA 4OI4A 4J9OA 2C2DA 5HVFA 4UZCA 4J37A 4EYIB 4RZRA 1AUSL 2OEJA 2YWWA 2ADBA 2Z58B 3DKDA 4LUBA 4DHVA 1U4BA 1RTIB 2F63A 1WF1A 1RT4A 2R7QA 3MM5A 4LF6J 4DSKA 2M7SA 4DR2J 4WF9Q 4K2JA 3HVTA 3TO8A 1J2VA 3PHEA 1CJVB 2CQIA 3DNCA 2L48A 1RHJB 2CG8A 1TK5A 2CQGA 2QC3A 3OHBA 3M9NB 4F0MA 5F9NA 4OX6A 4F7VA 3L4BC 2CPIA 4ZPVR 4KGMA 3W2WA 1U26A 3TJ9A 4WYWA 3MMBB 1UJ5A 3M8QA 2Q3PA 3WDOA 3HI9A 2OPSA 3ET6B 4MYUA 1JXVA 3FQKA 4RX6A 3DRRA 2KN4A 4FBUA 4QWDA 2A2CA 2YH1A 2PT0A 1PYTA 1V3RA 1DQ8A 3BR9A 5J2NB 2IJNA 2ZE2B 3AD9C 1XERA 2KHDA 1HHSA 4TQRA 1TKTB 2IM0A 2JLFA 2AQ4A 4NA3A 2EXUA 3Q8RB 3WC2A 1TVRB 4YEAA 3L3CA 4KAIA 1NK7A 4XK8C 2R7UA 1RTDA 4P74A 4ZCIA 4TN2A 1Y5IB 1AW0A 1H6KX 1IM6A 2X51A 3UDEA 3K5OA 3AB2B 5IZHA 4K4XA 2GIQA 4F04B 1FRIA 1WKJA 4NCGB 4XDDA 1X9WA 2J0SD 4YY3J 1CJKA 2MQMA 4ZLJA 1UVLA 4QYZJ 1KQFB 2DXDA 2C2EA 1S99A 1JLQB 3TVZA 4NXNJ 2I38A 3S7RA 3CW2C 2DB1A 2AZ1A 2BA9A 4HLBA 1Q82T 5AXKA 2ASLA 5H9FK 5DLFA 4IO1A 1VK8A 2H51B 5IV4A 2APOA 3Q8QB 1AT1B 3HSGA 5K8OA 2HS0A 5AXMA 2KB2A 4CLWA 3S01A 2MSSA 1X60A 5E3PA 1RE1B 3FEYB 5E3CA 2LKZA 4QJVA 2EEYA 3PZPA 2DR5A 1ZZNA 2J7UA 1HR0J 2L9DA 3AD8C 4MFBB 1J5EF 4JI1J 3WX8A 2XS2A 4NMXA 2MGZA 1WORA 2JZ5A 1KLNA 3HJVA 3NGUA 1VQMS 5D4OA 2G0CA 4CLPA 4M5KA 2JL9A 2GHVC 3M6VA 3NKYA 4OYPA 1HNVB 3C14A 2HBQB 1Y0HA 4GMKA 1Z2LA 3FSYA 2JSXA 2Z2LA 4OYIA 4I69A 4JYAF 2R8KA 3UNYA 3OVSA 4ERDA 2I0XA 4OHWA 3PNIA 2HPUA 2XO6A 1RKJA 3CCTA 1TV6B 1WC0A 1UPMB 3ISNC 4EBDA 2EI5A 3P3DA 2E9RX 2PEBA 3HFKA 4F25A 1BE4A 4DI6A 1MROA 1ZETA 1JNRB 3CUNA 1K47A 3CF5Q 1NBEB 4KY3A 3KG1A 2OH2A 3TAMB 3BKUA 1SQFA 1IKXB 5F9LA 1RWPB 4F2RA 4NZ0A 2W9BA 4X66F 2BE2A 4UOCA 5HROA 5CA5A 1LK5A 3BB5A 1OPZA 3SSQA 2FYXA 2HAFA 1TKDA 1SUQB 1KVJA 1F6TA 4CLFA 2JEFA 3MDFA 1RBAA 4DPOA 2CJYB 1VOMA 3GCWP 4DQIA 4B9LA 2D41A 2YKOA 3Q86A 1HI0P 1K9MT 4IG0B 1SV5A 2C3PA 1HLWA 4KKOB 1JJ4A 1FRLA 5K5MA 1TMMA 4ER8A 1NZ8A 3WIVA 5ADZA 1U1NA 2R7VA 3W9JA 5D4LA 2HRTA 1VJQA 3US5A 3VAJA 1TFYA 4OLPA 3QIDA 2WB4A 2A10A 2YQ0A 2EG2A 1B0VA 3AA9A 2VIHA 4U67Q 4U8YA 5RUBA 3EUNA 4AQYF 2BZ2A 3AT1B 3H5XA 3MHYA 2CJ9A 1RHMB 3PYFA 2Y0BB 2AV5A 2Y8YA 2VG5B 1XR7A 4P52A 3C2PA 1YLXA 1C0UB 4JI3F 2R7WA 2XMWA 2AT1B 1RAGB 3MPDA 5H9EK 1JLEA 4Y3CA 1IBMJ 1RXOB 1QTNB 3O6QA 2AJ4A 2C1EB 4A8KA 3MF5A 2EWHA 4DFJA 4ZCMA 3UDLA 1XBWA 3VAHA 5C24B 2HK2A 2XMAA 3KG0A 3P4UB 1LW0A 3CDWA 1TL7B 1ICEB 4OI0A 5HJYA 4JI1F 1H2TZ 1BWVA 3EDRB 3QT7A 4RU2A 4Y2CA 2KXHA 4OX9J 4YB5A 2BDPA 3P96A 4LF2A 1LQ9A 4LR7A 1M1HA 3GR0A 5T7LB 1NAQA 2CWKA 1NUEA 4OZ2A 1TU0B 1MU2A 4DL4A 3DRPA 2DHXA 4B3SF 4A8OA 5I4MA 3DLKA 5T41A 5HLFB 4A8SA 1NDKA 5F8NA 2KFYA 5D6GA 4DUZF 7FDRA 3W66A 3CJ2A 3PHTA 2ZJQQ 5A8RA 2V63A 3PR4A 1GEHA 4IUFA 2NXNA 4M8LA 4LSNA 4LSZB 4OQJA 2NPFA 4DCPB 3F44A 1FRHA 3W7BA 2F8HA 2ACMA 3G8TA 1T94A 4OIXA 5A8WA 2IPOB 4P10A 5EDWA 1FDAA 2BUNA 2B56A 1X9MA 3G4SS 2P9EA 4AT1B 3DN9A 4ECVA 2ZDOA 3GV8B 1QSYA 1RTZA 3LGHA 2HWHA 1KQSR 4O3RA 2DPIA 4DV5J 2V2KA 3HHEA 3CJSA 3TX0A 1JXEA 5KFRA 1VRUA 5DGAA 3L95X 2YNIA 1KS2A 4FNIA 2HZCA 2DPJA 2OEMA 4WFAQ 2UUAF 2LQBA 2O3DA 1B99A 1I94F 2QZ8A 1NPRA 2LCWA 3R5AA 3OL9A 4NLSA 4OZ3A 2IRXA 1HA1A 1URNA 3QIPA 4ZOSA 2UP1A 1N8RT 3BQ1A 4YR3A 1GK8A 3OQ2A 2DGTA 1EKSA 3MMAA 2H4YB 4CLTA 2BM0A 2IDLA 2Z8QA 4RW9B 1F3FA 2HMIA 2OSQA 3HO1A 3CCRS 1UA1A 5F8LA 4JI5J 4X62F 1U1OA 4ZN1A 4Y6IA 3M8RA 3FEZA 3MPUB 1AZSB 4NLOA 4X2BA 2CQ1A 2ZBCA 4ZDNA 2CPYA 3TZXA 4PABA 3GYGA 3MM6A 5JXSA 1EIYB 4AXJA 3I32A 1V3SA 4K50A 4LVOP 4ED6A 3L09A 1N32F 4AYBD 4EUVA 2Z30B 3KK3A 1KD1T 3UD5A 1CVJA 2HNZB 4RUHA 2V0NA 5FDLB 2ASDA 2VOOA 3PDNA 3JS9A 3JTOA 1CJTA 3QGGA 4ZHRA 2M0GB 2LEAA 4Y2IA 4KH1B 4LF8F 4I2PA 3ENQA 1KR4A 1K1SA 2W9CA 3LAMA 4MK8A 5KFGA 2NSBA 3BO2A 1BC6A 4KRWA 3MZIA 5CYJA 2Q66A 2VICA 3UDCA 1Y7PA 3Q8UA 3Q2SC 3F0NA 1EETA 2M8HA 2MXYA 1NK4A 2VPZB 3J7YU 4YFUA 4M94A 1UWBA 3CDEA 3OVAA 4B08A 2GVZA 1Y4ZB 2QT7A 4P2FA 3R1HA 1S9EA 5KFEA 4OMFG 4M5DA 4XPCA 4DQPA 4NXMJ 1RT2A 4O3NA 2E44A 3JSBA 2OPPB 4AL6A 2V69A 2IRUA 4FYXB 3R7SB 2D1CA 3M30B 3ZZPA 3RZAA 3CJ5A 4O3QA 3KLGB 4TLQA 4OJ1A 3HKZD 1RHRB 3OSNA 2VPYB 2XYGB 1WG4A 2DR6A 3CIZA 3OTBA 2XBPA 4N76A 2RU3A 2LMIA 1QUVA 2FVCA 3RR7A 3OR2A 4UZBA 2HNYB 1RU1A 1FO1A 4HT7A 4FF3A 3RRKA 3VQSA 1WOPA 1EP4B 4ED2A 3HHLC 5KFBA 1HKAA 4X65F 5HVHA 3N9UC 4RUCA 1F3VA 3H59A 3MECB 2OIHA 5B0GA 4DSFA 2NREA 1XNRF 1B64A 1JX4A 5FLXY 4RUBA 4ILLA 4Q2LA 2ZHOA 4ELUA 2HBRB 5L9NA 5LMNF 4DV3J 1HBUB 4TY8B 3RRGA 5DJBA 2C42A 3J7Z5 1IR0A 3N28A 1EAYC 1HWIA 4JI0J 2VFSA 2RJZA 4ED1A 1RT1A 4OJGA 4CDIA 1VBZA 2V5HG 2MYFA 2W8LA 3V81B 5KFIA 1H72C 2ALYB 3AFGA 3W8GA 1Q8KA 1QUPA 5KT6A 3KYLA 4NI2A 3QSYB 4HL9A 3ZZTA 3H98A 1U0HA 3LPEA 4O4GA 2BACA 3IBFB 3MM8A 2ROEA 2W2MP 3R27A 1FI4A 1N5SA 2ASYA 2H9ZA 3RB4A 1CSJA 4ECWA 3PFOA 2HFUA 5L1JA 1HBOB 3VGTA 1EQ0A 2LXFA 2C2OB 3JSRA 2DRBA 1MWZA 1I6JA 1AA1B 1N5YA 2WAQD 4I0WA 1R6YA 1P1LA 2IC3A 3UQSA 4DR4F 5E41A 2J0QD 3ZTPA 1RTHA 3GP9A 1S79A 1EARA 4K4YA 4K4VA 5EX3A 1IN0A 4KGVB 4DR7J 1KSPA 1NJYA 2MTLA 4AE5A 2FUG9 2QLXA 3TRGA 1IBLJ 3BZQA 3BS9A 1C1CA 1VHIA 1CULB 1Z1ZA 2XMMA 4YUDA 1A9NB 1UWAA 3AJDA 5K9FA 3CJKB 2RKIB 5HN0A 4MKVA 3H40A 3QSIA 2YNHB 4C0HA 2KXNB 4W90B 3ISZA 2UUCJ 2ZD1A 4C0BA 3FKBA 2QYGA 4DCOB 5J1NA 2RAQA 1CQMA 4G1QB 4LMZA 1UFWA 2K1RB 4K8RA 3LP1B 3PR5B 2BKOA 5EX0A 2B9EA 3W2VB 4X4QA 2J8AA 4QIEA 3JTPA 1ZM9A 1T11A 2E1AA 2WOMB 2V4RA 3ITHA 2M8DB 2LXUA 2ZOFA 4CLYA 3H0PA 3HD2A 2FD2A 1HPZB 5L46A 3T6JA 4W4MA 1RHKB 3KFWX 3MM7A 4FVMA 1CS4B 2QJ3A 3BKFA 1NB2A 1RWVB 1ZM4A 4R5PB 2X1FA 1DJ0A 3SV4A 4ECRA 2YX7A 3B82A 3BPDA 1JLGA 3ZZ0A 4Q0BA 5G4DA 4RU9A 2DEJA 3FBFA 4X64J 4HACA 2B4OA 3ZO7A 5CXTA 4JI0F 3K89A 1UVMA 2DCLA 4OFZA 3W61A 3GU0A 2AHOB 5DETA 3VGVA 4CO2A 2GGPB 2B6AA 4FF2A 3EWGA 2JRSA 3CCES 4B3MF 5BYRA 1SI9A 3UD4P 2MKSA 2PMWA 2QLFB 3PV8A 3GCXP 2B5JA 2BJEA 1J5OB 2DRAA 2JDJA 1HMVB 1LWEB 2Y1IA 2Q6CA 3DGVA 2F4VF 2CIMA 2H5IB 1C4CA 1FTCA 2C2MB 2LU1A 3CJ3A 1S10A 3SQOP 2CADA 1WKLA 4HKQA 3R9LA 2XY5A 1RTIA 2IBKA 3LTOA 1Y9OA 2VZ9A 4CTAB 1ZM3A 1PJ6A 2BYCA 3UWTA 4FNHA 3D1QA 4ICLA 1XMOJ 5HAOA 1DURA 1DQAA 4Y2AA 2H65B 1HNWJ 1F60B 1CJVA 1RT5B 2AGQA 2OFGX 4ZPCA 3I0SB 3W9HA 2UUBJ 3PIOQ 1UKUA 2MKIA 2POKA 1JLCB 2MSTA 1X4HA 3JB9k 1U7LA 5AXLA 2WCXA 4DOZA 2HVZA 3ZZZA 2BE9B 3MMBA 4YP3A 2KT5A 4NASA 4WBFA 4MKAA 1HNXF 3ILIA 3Q83A 1FJ7A 3OFHA 3IAS9 3HD1A 3Q2TC 4KQZA 3EYZA 2YX1A 3A8KA 4QOTA 4DL0C 3SSSA 3CMES 4HI2A 4L73A 4Q44A 1YK9A 3A8IA 3BDPA 1ZTWA 3AQPA 3G71S 5BR8F 5LXYA 4Q8EA 2DNZA 4UOHA 2VBYA 2OO4A 4ED8A 3PW5A 1MG7A 2ZC3A 3OUYB 1TVRA 2GAHC 1RTJB 4KHMA 3MEDB 1EX8A 1WDTA 4RW7A 2XMKA 2I2YA 2MY7A 1L3TA 2VBZA 1N4LA 5KFJA 3TWZA 4BCAA 1HWUA 5F0UA 3G6YA 2V94A 1OY8A 4DV7J 3T1HJ 1Q0NA 3R5GA 4DFKA 5B0BA 2CUYA 4L3KA 4QIWD 4NCGA 3CCVS 4FP9A 3K59A 3DDNA 1Q53A 2YWHA 2OHDA 3MFIA 1YGYA 5A76A 2ZJPQ 1K73T 1JLQA 3KUHA 5SZTA 5ETMA 2GV1A 2GX8A 1YSJA 4XAKA 1C2PA 4USKA 4JI7F 4RUAA 3Q8SB 3T1AA 2ZDPA 2O5DA 3SV3A 3D0HE 3PG9A 2ABYA 4GVLA 1U1KA 2ZBPA 2R2UA 2WVFA 3VZIA 2Z2ZA 4P72A 3M8WA 1XMBA 3IAM9 2KH9A 1UMJA 2HHUA 1R8BA 3BBBA 2CJAA 1TKZB 2CQCA 2XTJP 4PYAA 5CHCB 2KG0A 1H7WA 1TUVA 1IWAA 3VGSA 4J9SA 2R8GA 4MFBA 4IYQA 1FTRA 1SH3A 3VAMA 1JLBA 4LF9J 4F4ZA 1VI7A 1RB0A 2B0GA 2UV8G 4C48A 1FDBA 2ZUGA 3PCOB 4ZN3A 2FGCA 3C6TA 1VQ9S 2DD8S 5CYMA 2W7OA 2CQ3A 2D7SA 4DLGA 4DL3A 2UXBF 2MMYA 1T02A 3MMCB 3K5NA 1TL3B 5G0RB 2CQ4A 2NUHA 1RT4B 4WKYA 5DM6Q 3QGHA 4M5LA 3MI7X 4O3OA 2JNJA 2N4DA 4WPAA 4BLGA 2HVIA 3HVTB 3W8PA 4DSIA 2LQ5A 3LAKA 3NS6A 4W92B 3Q8PB 3PKYA 4NCBA 1TV6A 2RUGA 5DQHA 3M1VB 4U95A 5J2QA 2MZJA 2J6SA 1FCAA 2D3UA 1MN9A 4LFBJ 5A8KB 3HLUA 3D66A 4YB6A 3W2WB 1U6FA 3NOCA 1TL5A 4DS4A 1HL6A 5L1KA 2OPSB 2EC2A 2DIUA 2WZ1A 1F1BB 3QO9A 2K3KA 3BSNA 3J81j 5GAEU 1SJ3P 3LANA 1EQMA 2D69A 4YHHF 5KFCA 1U48A 1IKXA 2UU9J 3KDOA 4G6VB 3HT0A 1VHFA 6AT1B 1WC3A 4A47A 5E0OA 3N5BA 2LQJA 3QZ7A 1RAFB 1SUQA 1I5OB 2AX1A 3CJTA 4ZJLA 2AEFA 1YZ7A 4NA2A 4C8MA 4LF5J 4PRFA 1QM9A 3NAHA 3H2UB 2NZ4A 1S1UB 3KMQA 1W26A 3RW6A 1C1BA 5CZVA 1X0PA 3D6FB 3FBEA 2CNLB 5CH7B 4KKOA 3RBEA 2G2YA 4P6QA 3DC2A 3BDEA 2XS5A 3CD5A 4KV8B 1NXIA 4JBCA 1LXNA 1UTAA 4ECSA 2NR0A 2R4FA 3R5BA 4EGLA 4A8MP 2VV5A 3OL7A 2RRAA 1BD6A 4HHJA 1RWXB 1CJKB 3BPSP 1SC1B 3CEDA 5BYQA 1IKVB 2LECA 3PACA 1ZPWX 1Z4UA 4LIWA 5LSRA 5DDQC 2ILZA 4RNMA 3HDSA 1P1TA 4OYBA 4DSLA 3CCLS 2IJRA 2CQHA 4ZITA 2N3OA 2NXUA 1NK9A 2J9EA 1VQSA 2MJUA 2QA4G 2N3LA 3LF0A 3BR8A 5HQLA 2DNKA 3F73A 1OMSA 2C2KB 2VODA 5D0EA 3M6WA 5C24A 2YXLA 3CCQS 1NB7A 1Y11A 1VC0A 2XMUA 2V8PA 2B9WA 1X5PA 1U1LA 1SIWB 4HI1A 1M1GA 5H9FJ 1XN9A 7FD1A 2MGZB 3ADAC 4N8NA 3BF4A 5T7LA 3TUIC 4YB7A 2XZWA 2CZ4A 2VBXA 5I3PA 4RPFA 1H3DA 4DS5A 3U27A 3GIJA 3RYLA 1W25A 4K0KJ 2LDIA 1IQTA 1IBKF 2WSFC 5HLFA 2GMHA 2XY6A 3NCPA 2FB0A 4WU2A 2XG8A 3QNWB 3UFCX 1UEVA 1K44A 5ETKA 1NJIT 5DG9A 3EPIA 3DLBA 4DV1F 3SQGB 5KFYA 3ZZOA 3QRRA 1N0VC 1HBMB 2HQIA 3GFYA 3MAQA 4O3PA 3PIPQ 2JEIA 4IKAA 3GWCA 5F8GA 1MROB 3MOJB 1RISA 4R0JA 2UU9F 1YQHA 1S1TA 2D3OR 4XPEA 4C8OA 1BQMA 1O6XA 1S1VB 4J9VA 1YJUA 3TVYA 3N5FA 2BVZA 1T9YA 2V8HA 2BJ7A 4DQRA 1SQGA 2AJ1A 1VIXA 1N6QB 3DOLB 2BE2B 5HROB 4CT8A 1FJGJ 4OZ1A 3IS9B 3LO3A 3AA8A 2D9PA 3NLCA 2QX0A 3IFEA 1OWXA 2JOQA 1MMLA 5DGBA 2WVEA 2AP6A 5K14A 4J9QA 1N56A 2IMOA 4LT6A 4NLUA 1YBTA 2WONB 1V6HA 2MQLA 2DXEA 5IWAF 3DM2A 3EGVA 3B78A 3T5LA 1FXDA 4L6V3 5E33A 4B3RJ 3EX7B 3L7OA 1WWHA 3DLLQ 3PJWA 2RQCA 3MEEA 2HFOA 4CLSA 2ZBRA 2BBEA 1F5AA 1QSSA 4RW9A 5D0RA 4NRTA 2IDEA 3UPFA 4AD6A 4R8UA 4WP8A 4X4PA 1U1QA 4FKYA 4ELTA 1ELOA 5I3UB 5MLCV 5ITHA 3FCWA 1YRXA 4KR0B 1HARA 1B7FA 2XM3A 4DR6F 4NYOA 1RYRA 1KEKA 4RBVA 4YS2A 5LXRA 5CCMA 2RU9A 1U45A 4LJMA 4PWWA 3DOKA 2B43A 1DQ9A 4DR3F 3DLEB 2DNYA 2HK3A 3MEGB 4MH8A 4YDXA 3BM7A 3H42A 2BABA 2CKWA 1HW9A 3FQLA 1B7YB 4Q2MA 1LW0B 1X0FA 2Y8WA 2EFPA 3TEGA 4DBQA 2HHHF 2CJXB 3VQTA 3PEHA 3P8BB 4P2SA 3FC9A 3U02A 2BJ3A 1Q5YA 1KONA 5U47A 4DF4A 2W9AA 3QRPA 4DF8A 5D78A 3AAWB 1D09B 1WSVA 2AYEA 2GJIA 5IT0A 2HVEA 5LMUF 1XQIA 2QA2A 5H9EJ 3JAMY 4ANEA 5K8NA 3WZ0A 2L9WA 3ILLA 2LEPA 1VQ7S 4GKJJ 1Y3JA 3DRPB 4J5OA 3DLKB 2JFKA 1W7WA 1SVDA 1RAIB 2CPHA 4RBTA 4PWUA 1KBRA 2K3IA 2DH9A 1Q78A 2VU5A 4QIVA 4EZ9A 4C7QA 3BGRA 3B4DA 1Y5LB 1LWCA 2OPRA 4NCAA 1NSAA 1NK8A 1XR6A 3M30A 4IOBA 4LF4J 4B9UA 3KLGA 4DV4J 2DH8A 4DN0A 3NGSA 2VKZG 3T5JA 1UW9A 5A8WB 4F4YA 1ZYQA 4NLRA 4F3QA 4CYUA 4A8YA 4C3KA 2AJFE 4ZP7A 3DXSX 2HNYA 4NLYA 2HQGA 1WF0A 2XLKA 4CQ1A 5HSPA 2LQ9A 2VFRA 4JI4F 4DL6A 1UPPA 4L72B 2CDRB 2E7WA 1X4FA 2MDAA 2F4FA 1VRQC 2OELA 1RZMA 2NYHA 3E01B 3RB3A 4N77A 1VRUB 4MIWA 2PD1A 2V68A 2RILA 4OZJA 3FVYA 4DV2J 2A2DA 5FIIA 4ECXA 3CCSS 3FJ2A 2G0IA 4ZPTR 3IRXA 4M5JA 5KG3A 1X9SA 3KHGA 2MJNA 3JTNA 3QIPB 2B8PA 4GVBB 2IA0A 1DTQA 1ZPVA 2HRYA 3AY0A 2M2BA 1KN6A 1LNQA 2DR7A 2YQ3A 5DS7A 5KOWA 4WIIA 2KU7A 1OYEA 2HMIB 1EJ7L 3ZTRA 3MR5A 3IR7B 4ZK7M 5HVGA 3I31A 2QYCA 3MPYA 4HHUA 4UTGA 3KLEB 2QV6A 3A1YG 4LIRA 3CJ8A 3I9ZA 1KDNA 4LFCF 4H4KC 3GJSB 4EWTA 2HSEB 3R3TA 3W60A 3MM6B 1M1KT 4X4NA 2Y1RI 3R7NB 1U47A 2V6AA 2RD5C 3HHLA 2CQDA 2PDAA 4OYAA 4N5SA 4B3TF 1S59A 3CTRA 2O66A 1HNZF 2W7PA 3GV5B 4DCJB 3IM8A 1CJTB 5HMYA 1P6TA 3PKMA 4Z7CA 1ZA2B 1NDCA 2HQFA 4AXIA 4UQTA 2W2PP 4TXSA 4I2PB 1HWKA 4QWAA 3SFUA 2WTFA 2HVHA 3PJ9A 2KVQE 4X4SA 4PYDA 2XLIA 4GKKF 2QEXS 1OO0B 1BQXA 1RWMB 1FRKA 4DV0J 3GMGA 2G9OA 3MUVP 1U8SA 3PO4A 1CJUA 4WZMA 5KFKA 4C98A 1UWBB 2GVZB 1HNIA 2YNHA 4F4XA 1QVGR 1SB6A 3NEKA 2L9NA 2RMLA 4JI6J 1S9EB 1HW8A 3CE8A 1HFEL 3G82B 4M5DB 1VQ8S 3HFZB 4W98A 2OTJS 2HAIA 4B9MA 1RT2B 2AZ3A 2UVRA 2IYGA 1KOOA 3D28A 2V2QA 4G1QA 5ETPA 1RWKB 2GCFA 3LP1A 5ETLA 3W2VA 1KFSA 8AT1B 3N6MA 1YKWA 3TANA 2OMLA 2BXJA 3I5AA 2WOMA 1FEHA 3PW0A 3HZGA 2OKQA 4IQMA 2MQPA 5J1EA 2R7SA 2P8IA 1HPZA 4OZLA 2MEWA 3ELHA 2K06A 3OR2B 3FZBA 2QLJB 3DFEA 2Z2MA 5M2RA 3N79A 3ZTSA 4DUYJ 4IDKB 3MM9B 4ZLNA 1CS4A 2DJWA 3MCOA 1NH8A 5KFPA 2FC8A 3OPKA 2PA3A 3RTVA 2KL8A 3EM1A 1S48A 5GAGU 1S76D 1N36J 1RGVA 4K4ZA 4CZCA 3HVAA 4RW4A 2QO3A 3I4PA 4ZA1A 2R8HA 3OTOJ 5E3RA 4F4AA 1NPKA 4J7CA 3D0GE 2XNRA 5AJ3J 2GGPA 2ILYA 1WSRA 5F8JA 2LLZA 4YB1P 3NXZA 1IR1A 1FESA 5HMZA 3POTA 2PI4A 4C3MA 2RVJA 2I9SA 2MLYA 2ZH3A 1J5OA 1HMVA 3MM8B 4WYLA 5KG0A 3IWNC 3CO0P 5IC6B 3FMWA 1S6OA 2RDJA 4OHXA 2UV8A 1RQ0A 1YJ9S 1V5IB 1WEXA 2DGWA 4UY8T 4CTAA 4DX8H 3GG1A 2OAUA 3KJNB 3E51A 5D0HA 1X31C 2YQ1A 4PXDA 4O0IA 1B70B 3O8WA 3MMJA 2D74B 2BQ3A 1M5OC 4JI2F 3R2CJ 1RTHB 3DRXA 4IO9Q 3RAXA 1FFWB 4CO4A 1BHNA 2NQPA 2K8GA 1JLCA 4Z7YA 1OQ6A 2DRDA 1BY9A 1C0TA 2ZNZA 4ZMMA 1HD0A 3TW0A 1NHKL 1H0HB 1AYEA 4NPOA 2HLUA 1SL0A 5GVQA 3TP2A 4P7VA 4URGA 3SZ2A 3UVJB 2HWTA 1E6YB 2ZH1A 1S6QB 4H4MB 3KJFB 3VAGA 3IN5A 2HW3A 4P71A 2V4JA 3RJMB 1UCNA 4RO0A 3SI8A 2X3GA 4I7FB 5KFOA 2H48B 3M32B 2ZD1B 1GNKA 1RTJA 4U8VA 2DKOB 5CQGA 3MEDA 2OFHX 2G1DA 4WK3A 1G7CB 2DO4A 3T5KA 4WFBQ 5JVGQ 3GR1A 3ZFVA 4RL1A 2Z2YB 4CLLA 1XC9A 3MAAB 1JLAA 3W1YC 5AE3A 1FWKA 1REVB 1UP1A 2B8QA 2KJWA 1HHQA 3LA0A 4OI1A 2R8IA 4EI2A 1FDNA 4X84A 3GE9A 4DPYA 3K7RA 1OJ4A 3V6HA 2FLPA 1WOOA 3AOCA 1NEEA 4PCQA 2DY9A 1SBRA 2AMCB 2R3VA 1BLUA 3SMZA 2JJ4D 4JV5F 1P9YA 4OZNA 1GXUA 4KHPJ 3PX4A 1S1XB 1KKHA 4OL8A 4G1IA 2YNFA 2CQ2A 4DV6F 1FNOA 4WWSA 1RACB 1JQGA 1X5OA 1XMQJ 2VA3A 4GO5X 1W2BR 1R31A 3HZEA 2XULA 3RUBL 1RAAB 1TKZA 2B6AB 1AB8A 4J90A 3DLJA 1N33J 4KE5A 4ZCLA 3TJAA 3V2UC 3D1OA 2IM1A 4N56A 1DAXA 3Q23A 2ZVIA 2EFOA 4F0HA 5F0WA 1GTEA 2HYIB 1X4GA 3U1MA 4AL5A 3AH6A 1SJFA 4E2FB 1C4AA 4NLGA 2H5JB 1LV5A 4FN5A 5DQGA 1VBYA 1FKAF 3SBMA 2B3TB 3MMCA 1S7HA 2ZM6J 1TL3A 2CA9A 5G0RA 2IVFB 4U7UK 1HQEA 2E7VA 5KT5A 3JSYA 2MPUA 2QFIA 4DFMA 2HZVA 1AFIA 3PO5A 4ICLB 3CO9A 4FXWA 3PW4A 2BKNA 1QLNA 2YX4A 3OLBA 3B6BA 3C15B 2YKMA 1HQ2A 4USVA 2W2OP 3D5MA 4WU3A 1R0AB 3M1VA 4F50A 1KLMB 3EZ5A 4YQWA 3HT3A 1FA0A 3I96A 5A8KA 2DNGA 1DY3A 3CIMA 2PIIA 4DU7A 4C8NA 1H2UX 4FKXA 2Y9HA 5M2PA 1HQUB 1FD2A 1WC6A 1BUXA 2H1YA 1SC3B 2YH0A 1W2IA 3DGPA 3BBCA 2XI3A 3Q8VA 3U1NA 2E66A 3DLHA 1R8PA 4HT5A 1D0EA 1U2FA 2DY1A 1F0XA 2V8VA 1RI7A 2QFJA 2VG6A 5AT1B 4DQQA 3UR3C 2BANA 3LP2B 1S1UA 4PR6A 3J7AN 2UXDJ 4RW7B 3QWPA 4HTIA 2YWGA 5D15A 3TA1A 1NPPA 3O5TB 4F0KA 1OYDA 4HDHA 1RAEB 4KV8A 3NWGA 4K4WA 4PEOA 2L41A 1XJWB 2FHJD 1VQ5S 4EFAC 2AYMA 1XNQF 5E7OB 1IBCB 3T9NA 2NUUG 2FZCB 4DG1A 3BSOA 4C97A 4QPTA 3LGNA 1RT6A 1IKVA 1YZ6A 1LWFA 3M4XA 5J2PB 4DPWA 2HWIA 2MKYA 2J0WA 1TELA 2I1RA 3CGIA 2HQDA 2QN6B 4HH1A 1SKSA 3UNGC 3HSJA 2EFQA 5HANA 1P27B 5DLGA 3J7A1 3B8HA 3AODA 4DR5J 5B0FA 4IR9A 4ITSA 3ZZUA 4LQ9A 1MWQA 2CJQA 2XCAA 1RBLA 5IV3A 3DRYA 4RLEA 2VOPA 4PG5A 5IQ6A 5T14A 3MD3A 1WC5A 5D3GA 3OFEA 2UXCJ 1R6VA 3VZHA 3GQCA 3D68A 3ILJA 4K4UA 3Q0AA 3SCJE 1CC7A 3HULA 2I6WA 2C22A 5GAEI 4KIAA 5AE1A 1JLBB 4I6AA 1NNDA 5E5NA 4C11A 8RUCA 1VJWA 4J9LA 2GNKA 3C6TB 3BQ2A 5CYMB 2YBVA 1HI1A 3M2VA 1MLAA 4Q8FA 4LF6F 4DR2F 5E3AA 3SCIE 4F3OA 2GHPA 5HJXA 4ED4A 5HQ8A 1QE1A 1FWLA 3HHNB 3KWMA 3EVMA 2ZKTA 1O5JA 2EW9A 3EGWB 1FX2A 2PN6A 3MR2A 5CD4A 2NS1B 2YWEA 3MAHA 1KP6A 3M8ZA 3SQGA 1L3VA 1L3KA 5J2QB 4DR1J 1HBMA 1FFSB 2V2ZA 2JLGA 1S6UA 2EFVA 3JSMB 3KHRA 4RNHA 1UVKA 3OTEA 2EK1A 3QO9B 3QATA 2HIQA 1S1VA 3K8VA 1JJCB 3NMAA 1VQOS 4NZ7A 3U7JA 2KJVA 3T9ZA 4Z37A 1BWEA 1DRZA 1N6QA 3DOLA 4Y2KA 2RE1A 3IS9A 4ES3A 2N82B 1ZAVA 4ECQA 4B9NA 3QPIA 4EMDA 5B0DA 3GFXA 1TL1B 2XZDB 3W9IA 4GO7X 3S6EA 3HF5A 2MLZA 1M5KC 3QMQA 3W64A 3KLVA 2WONA 1M0SA 3A13A 1C1BB 1FKOA 3R5CA 3GV7B 4MK7A 3D6HB 2XCPA 3PW7A 1SKWA 3RU0A 3K2YA 1QDUB 3TZWA 4NRUA 2XLJA 3KK1B 1F5CA 3UCZP 5JUMA 3LOUA 1RDRA 1VYAA 1Q7LB 4YY3F 4LRFA 4B3OB 1FXLA 1JK9B 1FNMA 1UFKA 2B9YA 1YVFA 4PKDB 2BR0A 1RADB 1SH2A 2W01A 4NXNF 3HVRA 3NAIA 1YHQS 2Z0GA 5I3UA 3OD2A 3CJRA 2DISA 1WG5A 3H7HB 1VQYA 4K4TA 4OYMA 3QWUA 4DZDA 2OD4A 3X1LB 1XWLA 4MT1A 4PQAA 5HMXA 5LOQA 3O44A 4AUKA 2WSEC 2WHOA 1F9FA 4MMOA 4JUZA 1U1MA 2R9LA 4O3SA 2AKWB 3DLEA 3MEGA 1UL3A 5KOXA 2YNGB 3HPOA 1PJ5A 2FZGB 2VFTA 3EVOA 3EZOA 3M6XA 1BMQB 2VQEJ 3VVUA 4LSLB 1HR0F 2AU0A 3FSIA 4G65A 5L1LA 1S77D 2GO9A 3HK2A 3H8YA 4UW2A 2BRKA 4X4TA 3RGIA 3M8SA 3D2WA 4U9RA 1T9XA 4CCHA 1E6VB 1TKXA 4RNOA 1D8ZA 3W3SA 3TEHB 2DT9A 3Q8YA 1VBXA 2E5IA 1UEKA 1U6ZA 1NZAA 3D3BJ 4IG3B 4DN9A 3GFHA 1ZS6A 1IKWA 2D3O1 2VQFJ 2CDQA 1FVSA 3QT5A 2HS4A 1P8GA 5HATA 3CPWR 2BJ8A 2Z4PA 3EXYA 4NX9A 2BX6A 3C66A 3THPA 2XEXA 1OY6A 1SQEA 2ATCB 2F1FA 1WI8A 5KG6A 1MW7A 1PBUA 3CD0A 1F9HA 2FZKB 3OW2R 3WHIA 3KHHA 5EWGA 4CLKA 3BGFA 2YWFA 2BM1A 4YR2A 2DHGA 4RNFA 3MTKA 1S1TB 5KFTA 2K2PA 2QGFB 1BQMB 2DNQA 2C3UA 1GMWD 4M5GA 2KM8C 2MZRA 3DMJA 2BOAA 3G6ES 4OX8A 4J9MA 4I67A 3E01A 3ENVA 4RWWA 3CD7A 3JXOA 2C3MA 3TVKA 5K14B 4LF7J 5IT4A 2HFVA 3NBPB 1VK3A 2OSRA 1ZZFA 5B0CA 4V1Ak 3DM2B 1AFJA 1GH8A 1IKYA 3SCKE 1DARA 2HGNA 4ZVRB 4WFZA 3FRZA 4GVBA 5KFSA 5IT9Y 2EPIA 3MEEB 2KT3A 2A6OA 4M5NA 2ALZA 2ZJRQ 3CC7S 1N54B 4KT0C 2B51A 2P5VA 2ZHBA 4IOCQ 2XY7A 5ETRA 1VBKA 4F36A 4R8UB 3AD7C 2GA7A 4B17A 1LXJA 1WHWA 4LRDA 3KLEA 2JWNA 2XO7A 2I5JB 2DIVA 1VQLS 5D8HB 2A0FB 1IBMF 4F4WA 1ACMB 2WSCC 1NHVA 2KM8B 3T1YJ 3HHKA 2KHCA 3AXMA 3DOKB 2NXJA 1N5QA 1SCJB 1YRUA 3P49B 4USIA 5KFFA 3NCRA 2ZH4A 1VMBA 2QL7B 3LGMA 3GFZA 2M88A 1Q8BA 3RAMA 3JQJA 5GAHU 3W62A 4DJBA 2VASA 2P2CB 1S0VA 2E5LJ 4OX9F 1T0TV 2R7TA 3O3LA 4F3MA 5DG8A 2QMWA 1WDDA 4CRJA 4OJHA 2KXFA 3BGUA 3IA0A 2FHMA 2OUGA 2GVDA 2RS2A 3DOMB 2CWXA 2KKHA 1FWPA 4PQUB 3J81Y 2RHQB 3ETMA 2ZH7A 2J6TA 3G82A 1OIAA 3LH2S 2B7BB 3GTYX 3MWBA 4ZVQB 2HGMA 2P6TA 2BRLA 4H4KA 3M8YA 1HWJA 1T03B 3BGRB 1VQKS 1LWCB 2OPRB 2QMUB 2ZC4A 5KAKA 3QFHA 1PBAA 3TQ1A 2RRNA 2HLTA 1LEOA 2XS7A 2X1GA 4OZ0A 1U02A 2DYAA 3ZTQA 2MHNA 1LWXA 4CYUB 4ID5B 3RBXA 2YTCA 2EFNA 3QRQA 2LVWA 3M9OB 3A3PB 2NYIA 1WKKA 4EEYA 2GFFA 4IDKA 4DV5F 3MM9A 4RBUA 2HHXA 2HIYA 4NEYA 3TX8A 4ILRA 1WI6A 4WE1B 2CPJA 3VHQA 4Z2XA 2VUGA 5CZXA 4ECUA 1NSPA 2J76E 1JXLA 2CRLA 1Q4RA 1KQKA 4ANCA 4Q43A 3BH6B 2Y3YA 1SC6A 3IRXB 1TTHB 1S1WA 3H25A 3DLGA 3M05A 4YOEA 3GJRB 3IXQA 1DTQB 1LKZA 5J2MB 2A1BA 2VC0A 3VWSA 4CLUA 4WKRA 4ZS6A 2EKYA 3KUEA 3TQEA 2QRRA 4DPUA 4JI5F 2AX0A 3FRYA 3OFGA 1K0VA 4OZ5A 2C3OA 4ZVSB 1WG1A 4CT9A 2R7RA 4K59A 2NCKL 4ZVPB 3KUGA 3GB0A 3IC1A 5JMNA 2CNNB 3MCMA 3PYDA 2IY5B 4P7TA 5ETTA 4JOUA 3M2RB 1NH7A 1S6PA 2KYXA 4NLQA 1TP7A 5F3TA 2YPYA 1RCOB 3HHLB 3W63A 2F9JA 3DRSB 2W2NP 3KMSA 3RRHA 2PFFB 2BW7A 3G8SA 1X7VA 5HBMB 2OPQA 1YJRA 3JQKA 1JMTA 3I0RA 5IT9U 2KTQA 4QW9A 4BHQA 4USHA 2Y1JA 1RYSA 5HK4A 1LW2B 5L1IA 4DL7A 1IWGA 4L75A 3TNVA 1NM2A 1X4BA 2N7YA 3JYTA 2AEMA 4EO8A 4NLTA 2RQ4A 2GO8A 2OMOA 4OHZA 3IRWP 3NRBA 3QYYA 1WHXA 3UVJA 5C2CA 5KFNA 2CJBA 3A8EA 1E6YA 4URQU 4H54A 1S6QA 3NGKA 4H4MA 1CJUB 1J5EJ 5ETQA 2DNMA 2V9KA 1HNIB 2CFXA 3K17A 4ES2A 1CEZA 5GAGI 4NXMF 2K7KA 2FJWA 4I7FA 2E7XA 3M32A 2GS8A 5H1SV 2HHTA 2QL9B 3QZ8A 2OP5A 3L7PA 4P9SA 1NK5A 2C28A 5LM7E 1S4FA 4I64A 4LVNP 2HZAA 4KTQA 3FZ2A 4JYAJ 2UVVA 3W5YA 4XTTA 3EDQB 3MAAA 1M5PC 1FD8A 1GQEA 3KLFA 1RU2A 2MZSA 1REVA 2MKJA 5J1EB 3OSPA 2HFSA 2RDDA 3W5ZA 5DRKA 2WK4A 2WVBA 4ED7A 3J81U 1GXTA 4TU9A 3QJPA 4TYBA 1NO8A 5EWFA 1RT7B 2DGVA 4AL7A 2FHOB 1FT8A 1S1XA 1TMJA 2W4DA 2MQNA 4OHYA 4DV3F 4DFPA 1VQ6S 2B4VA 4IR1A 1PILA 3NGRA 4RW4B 4X66J 1Y5NB 1QY7A 2QMXA 5HMWA 1CPZA 1YRTA 3EGNA 2CYYA 3WIUA 1G3OA 3VVTA 2EC0A 3THTA 3DYAB 2CPXA 1EZZB 1SJRA 2FDNA 9ATCB 3VAIA 4ED5A 4A8FA 4M63A 4C8YA 1VC5A 1R27B 1V5VA 4CNYA 2JEGA 2QLBB 3POTB 1NKCA 4IFYB 2RIJA 2EKNA 1AXQA 4MIBA 1UVNA 2X1AA 1XR5A 1TUWA 1WC4A 1T9VA 1WHVA 3H5UA 1YI2S 2O1PA 1HIYA 5CD4H 2PGCA 3C3LA 3NOGA 1AUDA 3NGDA 3R5JB 5FLXU 2J6UA 2ZZMA 2AJ2A 1WNEA 3OTDA 3QQCD 2M52A 2J5AA 2FLNA 2CPDA 1S72S 1OPIA 2FJXA 4A48A 3GG0A 4K5SA 1M5SA 2CQ0A 2ZBIA 4AQYJ 1JJ2R 3ZTOA 1HI8A 3G6XA 2QA4S 3OTCA 3I9V9 2VFVA 1IR2A 1NJXA 4KFBB 5BJRA 3G86A 1EKRA 3C15A 2DNPA 4Q45A 3DDKA 2F40A 4JI3J 4IFVA 1R0AA 4DR7F 1KLMA 4WTOB 4ZVOB 4USTA 1C0TB 2HG4A 4NMLA 1IBLF 3K8WA 4ZIVA 1UZDA 4BDPA 3OL8A 1HQUA 1SH0A 1V3ZA 1SJ4P 2AF6A 2EG1A 1DZ5A 3AQOA 5M2UA 4CH1A 5THWA 2LXIA 4N47A 2JVRA 4NOHA 5CYQA 4V19J 4QIGA 2FTRA 4USJC 4WP9A 4L76A 4F8RA 3WQPA 2V4JB 3G87A 2UUCF 2KRRA 1U2RA 2XMTA 4NLPA 1VLOA 2BE7D 5KG7A 2FVRA 3LP2A 4F26A 1CC8A 2YWKA 4JV2A 3ETOA 5A2QY 4DPXA 3EMTA 2GQQA 3N6NA 3J7ZT 2VF3A 5A6WA 4U6PA 1RLCL 1REGX 5DDPC 4CLZA 4B3SJ 3CCUS 3C46A 3K5LA 4C4WA 4OI6A 4C8KA 4DUZJ 1QAYA 1U8WA 1YITS 3A12A 4NLVA 5GMEA 3AHPA 4KGZB 4FXDA 3D4JA 4NZ6A 1JLAB 1GT8A 2GZOA 2LA4A 1F2GA 5K8PA 3TARA 3ENWA 4B9SA 1KC8T 1CQNA 2U2FA 2HFNA 4LRCA 4RW8B 4ANDA 1PYSB 1NJZA 1R8HA 2GC8A 1SL1A 4FYVB 4F2SA 3FGVA 2WVCA 2CNKB 2XWYA 3SCLE 4WFNQ 5J2PA 3TYTA 5F3ZA 2Y1LB 5HL7Q 3UCGA 3PJXA 4X64F 4OYXA 1TZ0A 1PKUA 1RAOA 4Y65A 1UVJA 5E2QA 3GPAA 3PRDA 4TU7A 4QCLA 2HVDA 2YNFB 5KG2A 2ZH5A 1D1UA 4E0DA 4FS1A 3HSDA 3PXGa 2BJDA 3H4BA 1F9EB 5LSLA 2UUAJ 3KNGA 3OHAA 1I94J 3MPWA 1HHTP 2N4CA 5B7WA 2CPEA 1VRTA 4X4VA 2PO4A 2IA6A 5HI7A 1M5HA 4WCEQ 2J9DA 4M5HA 4ZVHA 4CP5A 1FHTA 4Q5VA 4ZVEA 3HX9A 1PO6A 1KNZA 1HQEB 1T9TA 1XMOF 1UZHA 4X62J 1HNWF 3AXKA 3P45B 1A0OB 3AB4B 4ECTA 3OJUA 2UUBF 4J9RA 5KFAA 5L38A 3RBZA 2UVWA 2YKMB 3GIRA 3D6MB 4IH7A 1N5TA 1VC6A 5CAAA 4LRAA 1N32J 2DHAA 3VTIA 3KLHA 5KT2A 1FNXH 5HQMA 2R8JA 2FJAB 3JSMA 4TNOA 2XYPB 2D9OA 2D3ZA 4YMEA 4PWDB 1SL2A 4QQBA 3FCHA 1DLOA 3DGPB 2XQCA 2DTJA 3GYXB 1RA7A 2CJKA 5ETOA 3BKTA 3BYPA 1XIQA 4LF8J 1YJWS 3UN2A 3IWLA 2ATLA 3IWXA 1PYOB 1Q7YT 2VG6B 3TAQA 2HGLA 1TL1A 2BANB 1YDLA 4ZIWA 1YJTA 2LYVA 4NL5A 2HHQA 3M8PB 4X4OA 3W5XA 4DV7F 3T1HF 3OXFA 2Z57B 4LRBA 3NS7B 3KK1A 4DPTA 1UW4A 1FVQA 1X8DA 3LPYA 4A8QA 2DO0A 5HP1B 1A6LA 2KT2A 4B3OA 1SPBP 3RB0A 1YJNS 4DG1B 4ZJQA 3V6JA 2XSFA 2WW8A 1YG0A 2PC6A 1RT6B 1LWFB 1R8CA 4F02A 2MKHA 4TYAA 2DH7A 2JLEA 5B09A 3WBZA 1TK8A 4Q7AA 3OXLA 2E1MC 2V8GA 1RBOB 5A2QU 2CQBA 2AJ0A 3K57A 1I51B 2NSCA 2X3DA 1SC4B 1VCTA 3TA0A 4X65J 2YNGA 1UETA 2OD6A 2DR8A 2BMBA 2QIFA 4YN3B 1U24A 1Q5VA 1XNRJ 3R8YA 3QAEA 4LSLA 4TY9A 1WHYA 3I82A 1YIJS 4DSEA 5D3GB 4L3NA 1VQNS 1VR6A 4UF4A 3GIIA 5LMNJ 1T05B 4M5MA 4LF9F 1MN7A 2VL1A 2GIFA 4NLXA 1R0CB 3NNAA 2F8EX 4N8OA 1WTFA 4DU8A 4I6WA 4ZPAA 1E6VA 2J8SA 4C11B 4FYYB 3OFFA 3MXHP 5EWEA 2K7JA 1PC4A 4PZVA 2Q43A 1KHWA 2V9WA 1L3UA 3M2VB 2VBWA 2WBRA 4IG3A 2NPIA 4LBPA 4QR0A 1OSDA 3IGVA 3C6UB 4ZVGA 1FF2A 4CO1A 1I1GA 4Y28C 5IC4B 3CMAS 5IXUA 3H5SA 1QE1B 4TLRA 4KYZA 5C42B 2DHHA 2IBOA 2JHEA 3PX0A 2VA2A 2JX2A 5C5JA 2RF2B 1N34J 2DGQA 4ID8A 3BV8A 4LFBF 1KWMA 4ED3A 4KH0B 5L9XA 3LP0B 2FJVA 4DR4J 1MWYA 4KO0A 4EO6A 1VIOA 5ETNA 3CWJA 4ZVFA 2RHSB 1X4EA 3DDIA 3MCSA 4V19X 3VGUA 2GQCA 1RT3B 4A8XA 5FJ4A 4TVAB 1K0TA 3ILOA 1S7IA 3ZC4A 2XC9A 4AFFA 3NL0A 3L7UA 2RQKA 2FY8A 4I4BA 4C8LA 4LF5F 3V6DB 2E9ZA 1WF2A 4CNZA 3PRVA 3I55S 3KTQA 4WP3A 3NBPA 4EBCA 1G4CA 2O01C 3FBCA 4USWA 1FKOB 4QU7A 2H54B 4FZVA 1Q8LA 4B9VA 2BOPA 4ETXA 4HTJA 3TZYA 1N5VA 1TR0A 3V4IA 2GQ2A 5AXNA 3BGOP 2DHSA 3KJVB 2NXEA 1JLFA 2XWXA 2F8MA 4ZVTB 5A6PA 5EGYA 2OJ3A 2BEFA 3NCQA 4X4RA 2PA8D 1L5UA 1K1QA 2A3JA 4OI3A 3I5BA 3OXGA 1WOSA 3AJ2A 1FK9A 2MQOA 2I5JA 1GX5A 1PSDA 2XGQA 3KK2A 2AYGA 2FIUA 2W24A 4UUXA 3TUPA 2VPWB 2YPZA 1QAIA 1G2EA 2IRYA 1ZOTA 3QT6A 3T6BA 5B08A 1UAWA 3UO0A 1T7PA 2P9GA 4FDFA 2PMZD 3TJ8A 1TAUA 3D67A 5IM0B 3NWRA 1KHVA 4KPCA 3CDAA 3QFWA 4KGXB 4MKBA 2ZH6A 4WTYA 2FVPA 3CCJS 1DTTB 1NSKL 2CG4A 2IM3A 2AJQA 2VG7B 3QLHB 3OV7A 3NS5A 2DGXA 5KFLA 3A8JA 2J7KA 1LFWA 4MKYA 1B0TA 4FF4A 4ZP6A 1S0OA 4UQGA 1JKHB 2PFDA 4J9NA 1NHUA 6FDRA 2G2ZA 3ICLA 4HVZA 4HHHA 1HBNB 4F4KA 1TKXB 3OL6A 2CAJA 2CPZA 3DOMA 2HS3A 1R8AA 4B3MJ 2M4MA 4OYZA 4K0KF 3P5TL 4NWBA 1SKRA 3QJLA 5C25A 4RJVA 4PQUA 2DGOA 1U0SA 1RAJA 2MZ1A 3BGLA 3C16A 4HH0A 2IAJA 4LR8A 5D4NA 4I2QB 1IKWB 3D0IE 2L3MA 1B0PA 5LJ3Y 1FJEB 1ZA1B 4P75A 5KFDA 5CCLA 4QBUA 2F4VJ 4RW6A 1N34F 1Y00A 2KZZA 2G13A 1X5SA 1T03A 5B0AA 3KHLA 2M5YA 2DXFA 2F7VA 2HNDB 3CJ4A 2FHKA 1H38A 4QZVB 1FFGB 2C2NA 5DDOC 5A0YB 4XO0A 1FKPA 4KGKA 2DNOA 2JVOA 4I6YA 2E1CA 3TAPA 2HHPA 4KC5A 3HM9A 2GIRA 4ID5A 4GC7A 3H2VE 2ZH2A 1HYSA 5F8IA 2ZEJA 3A3OB 3GLJA 5KT3A 3H2LA 2LP4A 1FJGF 1RAHB 1OSCA 1Q8IA 1NDPA 3DMJB 4WK1A 2MZQA 1Q79A 3VAKA 4WE1A 2RDIA 3G8QA 4NLWA 2BKPA 2N7CA 1HNXJ 2FJBB 3R6LB 2OEKA 2R7OA 5KTQA 2HHVA 3ULHA 3HKWA 3MUTP 3NG8A 2MLXA 2IYIA 2C3YA 2YKNB 4J9UE 4B3RF 2W1BA 3TA2A 4UOGA 1H7XA 3BBFA 5GAHI 1IKYB 5IQQA 4ZJOA 3M2UA 4CWBA 4H4OA 5BR8J 2B7CB 2QE5A 3B4MA 1FRJA 5DQIA 5DZ6A 5J2MA 3U1LA 4P2MA 3F56A 3EJMA 3FFIB 3VV2B 3HFVA 2E1RA 1YBUA 3WX4A 3RR8A 3K58A 3CT9A 3D1HA 1BQNB 3BH7B 3J7YI 5D77A 1FEEA 4O4RA 4DEZA 3UI3A 4CH7A 2G1HA 3OVBA 1TAQA 1KFDA 3M2RA 3A3NB 2RT3A 3J80Y 1PCAA 3MFHA 3H20A 5LT5A 3DRSA 4TQSA 2V8DA 4DZ6A 1NRKA 4ALZA 3PM9A 3I4HX 2WW4A 5HBMA 4I68A 3CSKA 1HWLA 2YKPA 1V9OA 1PAEX 2HKEA 4J91A 4JI7J 4J9PA 1QJHA 1H73A 3SDEB 4IH5A 1RWNB 4WJBA 1LW2A 1U1RA 5IOLA 5I42B 1QD1A 1ZAXA 2CVIA 1LOUA 4O44A 3VCDA 2GVDB 1NJWA 4FF1A 3ONQA 4OYWA 4GKJF 1FE4A 3HP6A 4FBTA 2MKCA 3IG1B 1B4SA 5GADU 2XSJA 3RB6A 4C0OC 3RG6A 4HYKA 4MK9A 4C8ZA 1JNZB 5CABA 1L3SA 5HO4A 3ZZYA 2V34A 2UXBJ 5E3QA 4LF4F 4DX6A 1R7IA 4ZP8A 2CXEA 4DV4F 2AEJA 3KOAA 4QIFA 3HCXA 1ZBTA 3TI0A 2FY1A 1TFWA 3A4TA 1R89A 3KKFA 2YKAA 1WELA 2KYZA 3I6PA 3VAFA 2GMLA 2WB1D 4RWXA 1NK6A 4PUOB 3CCZA 4B9TA 3CD6S 1NKBA 2FVQA 1VQPS 3JAMU 2QLWA 3QGIA 1VS3A 3KJQB 5KFXA 3KXDA 2H5EA 1X4CA 3ET6A 1APSA 1S57A 3SEOA 2FJEB 2XMVA 4HDGA 4D3HA 2DITA 4ILMA 2AIRB 1Y10A 3LWMA 1RT7A 4WIQA 3BSAA 5J2NA 4YHHJ 4DV2F 2ZE2A 3ZNUA 4M1KA 1QAJA 3H5YA 1D9AA 5KFWA 1TKTA 1S1WB 4QYZK 3MURP 4ZLPA 3DLGB 2HURA 4UOFA 1YX2A 1YTYA 1GFWB 1UA0A 3DYAA 4DWIA 2AW0A 2E9TA 1MMNA 1PG5B 3FCVA 4DL2A 1M90T 3OR1B 3HXMA 3THVA 3QAUA 1BXNA 2IFXA 3R97A 4IFYA 1DFDA 3VR1A 1FRMA 3GZ7A 1KVKA 1T3NA 3DI6B 5KFZA 2BW2A 2XYHB 3BN7A 4K7QA 5F8MA 3EXCX 2B9XA 4EBEA 4K2XA 1WEZA 2VKRA 5MAOA 3FBBA 5C7PA 1S6PB 4PPDA 3MTJA 4K5RA 4TKTA 2F3JA 2UZAA 4ZLLA 4KFBA 2OPQB 1U6BA 3I0RB 1O0PA 1KTVA 2CQPA 3QGPA 4OV1A 3IBWA 2FHJA 3E3XA 1MMDA 3IGNA 4ZPDA 4BC9A 3CJQA 4ZP9A 2PMHA 3K0JA 2ZFHA 3KLIB 2VB6A 1PC5A 4ETZA 2HBZB 2ZH8A 4FXVA 3JYTB 2M9KA 4DV0F 1WJ9A 1HD1A 1IQZA 1SJQA 3I5CA 2BQRA 1U25A 1QTMA 2EVZA 1XTZA 4KBIA 2AWZA 1S9GB 3J80U 4JI6F 3CDUA 2RSQA 4OHVA 4WXWA 5KFVA 5DDRC 4KB7A 5K20B 2OLWA 4DQSA 4IRCA 2JH3A 1ULRA 1HNVA 4QPXA 2MKKA 2MZTA 1RWOB 3FSXA 4R25A 1XEZA 3MD1A 3MM5B 5KFMA 1R0BG 1IBKJ 3AOBA 2AD9A 2X1BA 3R6GB 4XDCA 2ACYA 2HBYB 2ZHAA 3LALA 4LBHA 2ZKUA 5D0GA 1SKUB 1PGZA 3KLFB 4JB8B 4RR5A 2XHCA 4RW8A 2IM2A 4DV1J 4DUYF 3IM9A 3M8QB 1ITPA 3ENAA 1BGXT 2GMJA 3IR5B 3TAMA 1JB0C 1JWWA 3DRRB 3UCUP 3Q22A 3PX6A 1YJVA 3IO1A 1N36F 2XZTB 4PAAA 4G1PA 4M95A 5LL6d 3OTOF 4OJ3A 3D3CJ 3UW1A 4A4JA 2DBBA 3PFEA 2QL5B 4WFXA 5AJ3F 2GHWA 4O0NA 1KTQA 3SFGA 3HHDA 3NP5A 3T19A 3S1TA 3M6UA 2DGUA 2HRUA 2P6SA 3KG4A 3MEKA 1RTDB 4IG0A 1B3TA 2J9DE 5IWAJ 2PI5A 3GSIA 3N6LA 2ZBQA 2ZH9A 2DVIA 4FPRA 3FK4A 3NGTA 2QSFA 1F5BA 2B4UA 3GSDA 4BWMA 3HJFA 3T5HA 1GMVA 2PSZA 1R43A 4JV1A 3G2XA 1NK0A 2CVEA 2MB0B 1N52B 1SIZA 1ZTTA 2VHGA 3OLAA 4XIUA 2G2OA 4MJKA 1EHWA 1RP5A 3W65A 2VG5A 4K4SA 3CJ0A 1D9FA 1C0UA 4LQ3A 1H98A 3PRBA 1T9UA 2R2SA 4DR6J 3LWLA 3DCAA 4IFVB 3C19A 5F8HA 4LR9A 3GILA 2VD3A 3EICA 2KFNA 3FUYA 2HHWA 2ZZTA 4DR3J 2UUTA 4NEZA 1IJFB 3EVWA 3UE2A 2J9CA 1TL7A 3KDNA 4J9KA 4PWDA 3I87A 4IH6A 3P6YC 1TUGB 4JI8J 3V4MA 2HHHJ 4FYWB 3MGJA 5CYQB 2IMWP 1S97A 2L08A 3F41A 4LF1A 2HQ3A 2COLA 3D7SB 4BC7A 1JJHA 4N7TA 4Y34A 2RUSA 2DEIA 2SXLA 2DK2A 5LMUJ 5K8MA 3CMQA 4CO3A 4IOAQ 1UEUA 4MIAA 3PYEA 1RHQB 3C14B 4CH0S 1SJ1A 1T95A 3T41A 3MCNA 2WRMA 2FPHX 3M8PA 1M5VC 4BWJA 4U7UD 4ES1A 5C2GA 4PXCA 4LBIA 2KVIA 3R7BB 3L9ZA 1WC1A 2ZNYA 2GAGC 5FD1A 2PE8A 4OI2A 5HP1A 1O8BA 3FDSA 5BYSA 3T3FA 3HSZA 4LFAJ 4DX7A 4ZVUB 3ZXWA 2CZ9A 2XB2D 1DBDA 4R0EA 1AROP 4PG4A 3GJTB 1RLDA 4KHPF 2AGOA 4TU8A 3KNAA 3VALA 1NLKL 1P9QC 1VQ4S 1T8EA 4RNNA 1RJJA 3E2EA 2KRBA 2W9BB 2UUWA 5F41A 4JI4J 3I56S 3JQMA 1IM4A 2LU2A 1XMQF 1WTBA 9RUBA 1Q81T 2QA1A 4CO0A 2VJVA 1UFLA 4OYOA 5ETSA 1KQGB 3NY0A 1N33F 3BSCA 4Y00A 4PXBA 3NMRA 3EPGA 2DNLA 1NCLA 1SV5B 3TZZA 1T05A 1RABB 2J0XA 4EU0A 4A46A 4N41A 3HMJG 3PYGA 1YJ7A 2ZOMA 1GMWA 2F65A 1VRTB 2VJUA 5SUHA 4P2XA 4ATNA 2PEHA 2ZM6F 2KZMA 2I8EA 2IVYA 2LQ8A 4GC6A 4I56A 4QW8A 3TUJC 3M7VA 2H3EB 3C6UA 1AZSA 1VISA 4PXEA 5C42A 2MQQA 4DLEA 3GIKA 2BV3A 2E29A 2RQMA 4LFCJ 2RF2A 2KG1A 4QWEA 2YKQA 1Q95G 5EHHA 2BQUA 3NNHA 2ZITA 2HNZA 1JLEB 4OLOA 4USMA 4CIOA 3LP0A 1G1XA 5FDLA 3CCWA 2XMJA 4C9DA 5JJBA 3KLHB 1X4AA 1YWXA 4B3TJ 1VDHA 4DDFA 4JI8F 2DNRA 1S0NA 3MPVA 2WVDA 8ATCB 3TOQA 3DU5A 1HNZJ 1RT3A 4QR2A 1NMEB 1IJEB 1DLOB 1Q16B 2BJ9A 4BS2A 3K5MA 2DCUB 1EB0A 5JVHQ 2C2ZB 3ISND 5DM7Q 4URSA 3V6DA 2YVSA 2VFUA 4C6AA 4GKKJ 3B54A 2UXDF 2QG9B 4QWCA 2FJDB 2EFGA 4DUTA 1MU2B 3RBDA 5LSOA 2J7WA 1S12A 3PEJA 2ZUAA 4FS2A 4UY85 5IS2A 2V4QA 6FD1A 1IXKA 4P73A 2FC9A 4NE9C 2OPPA 5A8RB 3P5BP 4USUA 4Y2MA 4C2MA 4JP8A 1JIHA 3KJVA 4LFAF 4LSNB 4DMZA 1A7GE 1CBKA 2E1PA 2GJFA 3BN4A 3D54A 3N01A 2F5GA 4QWBA 2ROPA 5DO2A 3S8SA 1D9DA 2G0JA 1RHUB 2V2VA 2HEKA 1KVIA 2CNOB 1FRXA 4JV0A 2NXCA 1CG2A 4PG8A 5DZ7A 3CC2S 1EP4A 4KJIA 3N4WA 4E8UA 2UVUA 3G6VA 5J1PA 2FLOA 1PJ7A 3BREA 4DR5F 3UR0A 3MECA 2MY8A 4ZPBA 5IM0A 1K8AT 2AYBA 2YNIB 2R2RA 2CZVC 4LREA 4U96A 3H90A 2JFDA 2UXCF 1DTTA 1RCXB 2OTLS 1ROFA 5GMKa 4FVCA 1D3WA 2RNEA 2VG7A 3NNCA 2JC0A 1HBUA 3IBCB 2XNQA 3BEGB 3TUZC 3QLHA 4TY8A 2VC1A 1VLYA 1JKHA 3QT8A 3HVWA 5DG7A 1HBNA 1S4EA 3V81A 3EZUA 3ZNJ1 3MMAB 3MUMP 2CPFA 1UJ6A 2Q79A 3MR7A 1U2CA 1RSCA 3UN3A 1WACA 3SIPB 2YY3A 1FXRA 4FYDA 2ZWOA 4ZCKA 3IR6B 4YR0A 4I2QA 5KG4A 5L39A 5KT4A 1HBOA 1RA6A 2V50A 1J27A 2Q6BA 2W7AA 4HEA9 4WZQA 1O51A 1X4DA 2W4CA 4F67A 3IMQJ 4NLDA 3SSRA 2HNDA 2XI2A 3KK3B 3DHXA 4DR1F 1QSLA 1Z2ZA 3O2IA 2ZWPA 3M9MB 3AOAA 4OX7A 2ZOGA 1FX4A 2W25A 1ZAWA 4DSJA 7AT1B 5LJ5Y 4FPIA 5A0YA 1U1PA 4JI2J 1PAUB 1DHMA 2O67A 1IUJA 1Y3KA 2IIHA 4KO0B 2LDYA 4ED0A 3CULA 3SXLA 2ADCA 1KRPA 1Q1KA 4QYRA 1S9FA 2GJ2A 2WBMA 1NSQA 4ZHRB 3BJYA 3PY8A 1MNEA 2R2TA 3R2DJ 3CXCR 2JC1A 4CM0A 1H74A 1GTHA 2W4PA 1GX6A 2W9CB 1SXLA 3UN5A 3BO3A 2A6MA 1PIEA 4L74A 3C8YA 1QVFR 1CULA 3X3UA 4RKUC 2RB7A 1U49A 3CNQP 1EETB 4ECZA 1OY9A 3CJKA 2RKIA 2YKNA 1S49A 4D3GA 4X4UA 3K5PA 2VH7A 2QSWA 2XHWA 2LFVA 2ZVSA 2W8KA 2FVSA 4QR1A 3ZZRA 3V4IB 3SYZA 3BYRA 2K1RA 1RWUA 2VDIA 2IHR1 3FFIA 1N88A 4BBYA 1JLFB 1IVZA 3G9CA 1T9WA 3TR5A 3VF0B 4C3LA 3EGZA 2OGUA 4MAKA 1BQNA 1TK0A 1ZH5A 3LW5C 2M3DA 1URRA 2KO1A 3RAQA 1FK9B 4E98A 1NKEA 1FJCA 2DGSA 3KK2B 1U09A 1X5TA 4DL5A 3FEXB
chains in the Genus database with same CATH topology
4U7UD 5H9EK 2Y9HA 4DZDA 3QRPA 4QYZK 2Y8WA 2Y8YA 1WJ9A 3QRQA 5H9FK 5CD4A 3QRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7U D;  5H9E K;  2Y9H A;  4DZD A;  3QRP A;  4QYZ K;  2Y8W A;  2Y8Y A;  1WJ9 A;  3QRQ A;  5H9F K;  5CD4 A;  3QRR A; 
#chains in the Genus database with same CATH topology
 3CCM S;  2P9C A;  5L8R C;  4R5P A;  2Y0S D;  1S0M A;  2BJ1 A;  1QAX A;  2EBE A;  3GON A;  5I3Q A;  4JV5 J;  2B4P A;  2VON A;  3GYN A;  2VQE F;  4ECY A;  2FQQ B;  4NYP A;  4PPZ A;  1GAO A;  5KFH A;  3CC4 S;  2V67 A;  4EK2 A;  3GJQ B;  4IQX A;  3SDE A;  2JEJ A;  5BXI A;  4ENO A;  4OV6 A;  3LUY A;  4DV6 J;  2VPX B;  3UDV A;  4PG6 A;  5I42 A;  4KPY A;  1OQ3 A;  3Q24 A;  4GRS A;  4KHR A;  3BQ0 A;  1RT1 B;  1Q86 T;  3PTW A;  1CLF A;  4G3I A;  2RH3 A;  2U1A A;  3IG1 A;  2OI2 A;  4NI2 B;  5D4P A;  1RWW B;  3DU6 A;  5C25 B;  2VQF F;  1U0H B;  4IRD A;  4O4G B;  1LWE A;  3C16 B;  2ASJ A;  2IAJ B;  2F9D A;  3DHW C;  1YBA A;  1N0U A;  5AE2 A;  2Z56 B;  2FGO A;  2ROG A;  4RW6 B;  3GIM A;  2GW8 A;  4B02 A;  1XK8 A;  2X7I A;  4MYT A;  4I1T A;  2DNN A;  1N5Y B;  2HQC A;  2IJF A;  2IC3 B;  3OBI A;  1WEY A;  4IRK A;  2NLW A;  3N0V A;  2E5H A;  5KG5 A;  4UT4 A;  2DNH A;  3EE3 A;  1RT5 A;  2AGP A;  3I0S A;  1F2H A;  1GMU A;  5KG1 A;  1FKP B;  4HR2 A;  5ETV A;  3WC0 A;  4PUO A;  1LFP A;  2NZC A;  1HYS B;  2A18 A;  4S0M A;  4CO5 A;  1RKI A;  2R7X A;  4WXO A;  3DXB A;  2ERR A;  4ELV A;  2KFZ A;  2R42 A;  4Y0F A;  4A8W A;  1KOH A;  1VFJ A;  1C1C B;  4LF7 F;  5B0E A;  3MR6 A;  3OT9 A;  2EK6 A;  2KDO A;  2MQ8 A;  2ZZN A;  2HHS A;  5KFU A;  3FNN A;  3LQV A;  1OS5 A;  3E8O A;  4UUW A;  4YDD B;  1WD6 A;  2IVM A;  4U7C A;  3OUY A;  4EZ6 A;  1I3O B;  3M2U B;  3OJS A;  1TQL A;  3O1L A;  3AJ1 A;  4H4O B;  3CB4 A;  1FER A;  2G4B A;  1TL4 A;  2LA6 A;  1NU4 A;  3HHL D;  4NYZ A;  3R1L A;  2M70 A;  2DR9 A;  1T3O A;  3D9B A;  3OR1 A;  3QJJ A;  1N48 A;  2EBG A;  4M5I A;  2QTW A;  3V5R A;  4KSE B;  1ZM2 A;  4O23 A;  2KI2 A;  1VGY A;  5IFM A;  4EYH B;  3RW7 A;  3ITH B;  2H4W B;  5GAD I;  3DI6 A;  1UJ4 A;  5GMD A;  2Q1L A;  3UD3 P;  4PG7 A;  4ZPW R;  2LEB A;  1RK8 A;  1G6B A;  4MTP A;  5KFQ A;  1XNQ J;  3H4D A;  5EUH A;  2E5G A;  4CI0 B;  1UVI A;  3T1Y F;  3MM7 B;  2MHE A;  3CDB A;  3CVK A;  3MOZ A;  2RS8 A;  3IP0 A;  2C2R A;  1LK7 A;  2XGP A;  4NA1 A;  1JLG B;  4Q0B B;  2RRB A;  3QBC A;  3PVX A;  1H2V Z;  3PW2 A;  2E5L F;  4ZKA A;  1GXL A;  4DX5 A;  4HAC B;  3FMB A;  5EN1 A;  3BO4 A;  4QU6 A;  3V6K A;  5KT7 A;  3KLI A;  1R3N A;  2VDH A;  4CM2 A;  4O44 B;  3D6T B;  3MR3 A;  1NDL A;  4DXL A;  3Q89 A;  1WUU A;  1S5Z A;  2W2Q P;  1FDD A;  1RUS A;  1S9G A;  2E5J A;  3G96 A;  1FE0 A;  2B5J B;  2FLL A;  2XSJ B;  2HFZ A;  4WFY A;  1D8Y A;  1MSW D;  3R5D A;  4OI4 A;  4J9O A;  2C2D A;  5HVF A;  4UZC A;  4J37 A;  4EYI B;  4RZR A;  1AUS L;  2OEJ A;  2YWW A;  2ADB A;  2Z58 B;  3DKD A;  4LUB A;  4DHV A;  1U4B A;  1RTI B;  2F63 A;  1WF1 A;  1RT4 A;  2R7Q A;  3MM5 A;  4LF6 J;  4DSK A;  2M7S A;  4DR2 J;  4WF9 Q;  4K2J A;  3HVT A;  3TO8 A;  1J2V A;  3PHE A;  1CJV B;  2CQI A;  3DNC A;  2L48 A;  1RHJ B;  2CG8 A;  1TK5 A;  2CQG A;  2QC3 A;  3OHB A;  3M9N B;  4F0M A;  5F9N A;  4OX6 A;  4F7V A;  3L4B C;  2CPI A;  4ZPV R;  4KGM A;  3W2W A;  1U26 A;  3TJ9 A;  4WYW A;  3MMB B;  1UJ5 A;  3M8Q A;  2Q3P A;  3WDO A;  3HI9 A;  2OPS A;  3ET6 B;  4MYU A;  1JXV A;  3FQK A;  4RX6 A;  3DRR A;  2KN4 A;  4FBU A;  4QWD A;  2A2C A;  2YH1 A;  2PT0 A;  1PYT A;  1V3R A;  1DQ8 A;  3BR9 A;  5J2N B;  2IJN A;  2ZE2 B;  3AD9 C;  1XER A;  2KHD A;  1HHS A;  4TQR A;  1TKT B;  2IM0 A;  2JLF A;  2AQ4 A;  4NA3 A;  2EXU A;  3Q8R B;  3WC2 A;  1TVR B;  4YEA A;  3L3C A;  4KAI A;  1NK7 A;  4XK8 C;  2R7U A;  1RTD A;  4P74 A;  4ZCI A;  4TN2 A;  1Y5I B;  1AW0 A;  1H6K X;  1IM6 A;  2X51 A;  3UDE A;  3K5O A;  3AB2 B;  5IZH A;  4K4X A;  2GIQ A;  4F04 B;  1FRI A;  1WKJ A;  4NCG B;  4XDD A;  1X9W A;  2J0S D;  4YY3 J;  1CJK A;  2MQM A;  4ZLJ A;  1UVL A;  4QYZ J;  1KQF B;  2DXD A;  2C2E A;  1S99 A;  1JLQ B;  3TVZ A;  4NXN J;  2I38 A;  3S7R A;  3CW2 C;  2DB1 A;  2AZ1 A;  2BA9 A;  4HLB A;  1Q82 T;  5AXK A;  2ASL A;  5H9F K;  5DLF A;  4IO1 A;  1VK8 A;  2H51 B;  5IV4 A;  2APO A;  3Q8Q B;  1AT1 B;  3HSG A;  5K8O A;  2HS0 A;  5AXM A;  2KB2 A;  4CLW A;  3S01 A;  2MSS A;  1X60 A;  5E3P A;  1RE1 B;  3FEY B;  5E3C A;  2LKZ A;  4QJV A;  2EEY A;  3PZP A;  2DR5 A;  1ZZN A;  2J7U A;  1HR0 J;  2L9D A;  3AD8 C;  4MFB B;  1J5E F;  4JI1 J;  3WX8 A;  2XS2 A;  4NMX A;  2MGZ A;  1WOR A;  2JZ5 A;  1KLN A;  3HJV A;  3NGU A;  1VQM S;  5D4O A;  2G0C A;  4CLP A;  4M5K A;  2JL9 A;  2GHV C;  3M6V A;  3NKY A;  4OYP A;  1HNV B;  3C14 A;  2HBQ B;  1Y0H A;  4GMK A;  1Z2L A;  3FSY A;  2JSX A;  2Z2L A;  4OYI A;  4I69 A;  4JYA F;  2R8K A;  3UNY A;  3OVS A;  4ERD A;  2I0X A;  4OHW A;  3PNI A;  2HPU A;  2XO6 A;  1RKJ A;  3CCT A;  1TV6 B;  1WC0 A;  1UPM B;  3ISN C;  4EBD A;  2EI5 A;  3P3D A;  2E9R X;  2PEB A;  3HFK A;  4F25 A;  1BE4 A;  4DI6 A;  1MRO A;  1ZET A;  1JNR B;  3CUN A;  1K47 A;  3CF5 Q;  1NBE B;  4KY3 A;  3KG1 A;  2OH2 A;  3TAM B;  3BKU A;  1SQF A;  1IKX B;  5F9L A;  1RWP B;  4F2R A;  4NZ0 A;  2W9B A;  4X66 F;  2BE2 A;  4UOC A;  5HRO A;  5CA5 A;  1LK5 A;  3BB5 A;  1OPZ A;  3SSQ A;  2FYX A;  2HAF A;  1TKD A;  1SUQ B;  1KVJ A;  1F6T A;  4CLF A;  2JEF A;  3MDF A;  1RBA A;  4DPO A;  2CJY B;  1VOM A;  3GCW P;  4DQI A;  4B9L A;  2D41 A;  2YKO A;  3Q86 A;  1HI0 P;  1K9M T;  4IG0 B;  1SV5 A;  2C3P A;  1HLW A;  4KKO B;  1JJ4 A;  1FRL A;  5K5M A;  1TMM A;  4ER8 A;  1NZ8 A;  3WIV A;  5ADZ A;  1U1N A;  2R7V A;  3W9J A;  5D4L A;  2HRT A;  1VJQ A;  3US5 A;  3VAJ A;  1TFY A;  4OLP A;  3QID A;  2WB4 A;  2A10 A;  2YQ0 A;  2EG2 A;  1B0V A;  3AA9 A;  2VIH A;  4U67 Q;  4U8Y A;  5RUB A;  3EUN A;  4AQY F;  2BZ2 A;  3AT1 B;  3H5X A;  3MHY A;  2CJ9 A;  1RHM B;  3PYF A;  2Y0B B;  2AV5 A;  2Y8Y A;  2VG5 B;  1XR7 A;  4P52 A;  3C2P A;  1YLX A;  1C0U B;  4JI3 F;  2R7W A;  2XMW A;  2AT1 B;  1RAG B;  3MPD A;  5H9E K;  1JLE A;  4Y3C A;  1IBM J;  1RXO B;  1QTN B;  3O6Q A;  2AJ4 A;  2C1E B;  4A8K A;  3MF5 A;  2EWH A;  4DFJ A;  4ZCM A;  3UDL A;  1XBW A;  3VAH A;  5C24 B;  2HK2 A;  2XMA A;  3KG0 A;  3P4U B;  1LW0 A;  3CDW A;  1TL7 B;  1ICE B;  4OI0 A;  5HJY A;  4JI1 F;  1H2T Z;  1BWV A;  3EDR B;  3QT7 A;  4RU2 A;  4Y2C A;  2KXH A;  4OX9 J;  4YB5 A;  2BDP A;  3P96 A;  4LF2 A;  1LQ9 A;  4LR7 A;  1M1H A;  3GR0 A;  5T7L B;  1NAQ A;  2CWK A;  1NUE A;  4OZ2 A;  1TU0 B;  1MU2 A;  4DL4 A;  3DRP A;  2DHX A;  4B3S F;  4A8O A;  5I4M A;  3DLK A;  5T41 A;  5HLF B;  4A8S A;  1NDK A;  5F8N A;  2KFY A;  5D6G A;  4DUZ F;  7FDR A;  3W66 A;  3CJ2 A;  3PHT A;  2ZJQ Q;  5A8R A;  2V63 A;  3PR4 A;  1GEH A;  4IUF A;  2NXN A;  4M8L A;  4LSN A;  4LSZ B;  4OQJ A;  2NPF A;  4DCP B;  3F44 A;  1FRH A;  3W7B A;  2F8H A;  2ACM A;  3G8T A;  1T94 A;  4OIX A;  5A8W A;  2IPO B;  4P10 A;  5EDW A;  1FDA A;  2BUN A;  2B56 A;  1X9M A;  3G4S S;  2P9E A;  4AT1 B;  3DN9 A;  4ECV A;  2ZDO A;  3GV8 B;  1QSY A;  1RTZ A;  3LGH A;  2HWH A;  1KQS R;  4O3R A;  2DPI A;  4DV5 J;  2V2K A;  3HHE A;  3CJS A;  3TX0 A;  1JXE A;  5KFR A;  1VRU A;  5DGA A;  3L95 X;  2YNI A;  1KS2 A;  4FNI A;  2HZC A;  2DPJ A;  2OEM A;  4WFA Q;  2UUA F;  2LQB A;  2O3D A;  1B99 A;  1I94 F;  2QZ8 A;  1NPR A;  2LCW A;  3R5A A;  3OL9 A;  4NLS A;  4OZ3 A;  2IRX A;  1HA1 A;  1URN A;  3QIP A;  4ZOS A;  2UP1 A;  1N8R T;  3BQ1 A;  4YR3 A;  1GK8 A;  3OQ2 A;  2DGT A;  1EKS A;  3MMA A;  2H4Y B;  4CLT A;  2BM0 A;  2IDL A;  2Z8Q A;  4RW9 B;  1F3F A;  2HMI A;  2OSQ A;  3HO1 A;  3CCR S;  1UA1 A;  5F8L A;  4JI5 J;  4X62 F;  1U1O A;  4ZN1 A;  4Y6I A;  3M8R A;  3FEZ A;  3MPU B;  1AZS B;  4NLO A;  4X2B A;  2CQ1 A;  2ZBC A;  4ZDN A;  2CPY A;  3TZX A;  4PAB A;  3GYG A;  3MM6 A;  5JXS A;  1EIY B;  4AXJ A;  3I32 A;  1V3S A;  4K50 A;  4LVO P;  4ED6 A;  3L09 A;  1N32 F;  4AYB D;  4EUV A;  2Z30 B;  3KK3 A;  1KD1 T;  3UD5 A;  1CVJ A;  2HNZ B;  4RUH A;  2V0N A;  5FDL B;  2ASD A;  2VOO A;  3PDN A;  3JS9 A;  3JTO A;  1CJT A;  3QGG A;  4ZHR A;  2M0G B;  2LEA A;  4Y2I A;  4KH1 B;  4LF8 F;  4I2P A;  3ENQ A;  1KR4 A;  1K1S A;  2W9C A;  3LAM A;  4MK8 A;  5KFG A;  2NSB A;  3BO2 A;  1BC6 A;  4KRW A;  3MZI A;  5CYJ A;  2Q66 A;  2VIC A;  3UDC A;  1Y7P A;  3Q8U A;  3Q2S C;  3F0N A;  1EET A;  2M8H A;  2MXY A;  1NK4 A;  2VPZ B;  3J7Y U;  4YFU A;  4M94 A;  1UWB A;  3CDE A;  3OVA A;  4B08 A;  2GVZ A;  1Y4Z B;  2QT7 A;  4P2F A;  3R1H A;  1S9E A;  5KFE A;  4OMF G;  4M5D A;  4XPC A;  4DQP A;  4NXM J;  1RT2 A;  4O3N A;  2E44 A;  3JSB A;  2OPP B;  4AL6 A;  2V69 A;  2IRU A;  4FYX B;  3R7S B;  2D1C A;  3M30 B;  3ZZP A;  3RZA A;  3CJ5 A;  4O3Q A;  3KLG B;  4TLQ A;  4OJ1 A;  3HKZ D;  1RHR B;  3OSN A;  2VPY B;  2XYG B;  1WG4 A;  2DR6 A;  3CIZ A;  3OTB A;  2XBP A;  4N76 A;  2RU3 A;  2LMI A;  1QUV A;  2FVC A;  3RR7 A;  3OR2 A;  4UZB A;  2HNY B;  1RU1 A;  1FO1 A;  4HT7 A;  4FF3 A;  3RRK A;  3VQS A;  1WOP A;  1EP4 B;  4ED2 A;  3HHL C;  5KFB A;  1HKA A;  4X65 F;  5HVH A;  3N9U C;  4RUC A;  1F3V A;  3H59 A;  3MEC B;  2OIH A;  5B0G A;  4DSF A;  2NRE A;  1XNR F;  1B64 A;  1JX4 A;  5FLX Y;  4RUB A;  4ILL A;  4Q2L A;  2ZHO A;  4ELU A;  2HBR B;  5L9N A;  5LMN F;  4DV3 J;  1HBU B;  4TY8 B;  3RRG A;  5DJB A;  2C42 A;  3J7Z 5;  1IR0 A;  3N28 A;  1EAY C;  1HWI A;  4JI0 J;  2VFS A;  2RJZ A;  4ED1 A;  1RT1 A;  4OJG A;  4CDI A;  1VBZ A;  2V5H G;  2MYF A;  2W8L A;  3V81 B;  5KFI A;  1H72 C;  2ALY B;  3AFG A;  3W8G A;  1Q8K A;  1QUP A;  5KT6 A;  3KYL A;  4NI2 A;  3QSY B;  4HL9 A;  3ZZT A;  3H98 A;  1U0H A;  3LPE A;  4O4G A;  2BAC A;  3IBF B;  3MM8 A;  2ROE A;  2W2M P;  3R27 A;  1FI4 A;  1N5S A;  2ASY A;  2H9Z A;  3RB4 A;  1CSJ A;  4ECW A;  3PFO A;  2HFU A;  5L1J A;  1HBO B;  3VGT A;  1EQ0 A;  2LXF A;  2C2O B;  3JSR A;  2DRB A;  1MWZ A;  1I6J A;  1AA1 B;  1N5Y A;  2WAQ D;  4I0W A;  1R6Y A;  1P1L A;  2IC3 A;  3UQS A;  4DR4 F;  5E41 A;  2J0Q D;  3ZTP A;  1RTH A;  3GP9 A;  1S79 A;  1EAR A;  4K4Y A;  4K4V A;  5EX3 A;  1IN0 A;  4KGV B;  4DR7 J;  1KSP A;  1NJY A;  2MTL A;  4AE5 A;  2FUG 9;  2QLX A;  3TRG A;  1IBL J;  3BZQ A;  3BS9 A;  1C1C A;  1VHI A;  1CUL B;  1Z1Z A;  2XMM A;  4YUD A;  1A9N B;  1UWA A;  3AJD A;  5K9F A;  3CJK B;  2RKI B;  5HN0 A;  4MKV A;  3H40 A;  3QSI A;  2YNH B;  4C0H A;  2KXN B;  4W90 B;  3ISZ A;  2UUC J;  2ZD1 A;  4C0B A;  3FKB A;  2QYG A;  4DCO B;  5J1N A;  2RAQ A;  1CQM A;  4G1Q B;  4LMZ A;  1UFW A;  2K1R B;  4K8R A;  3LP1 B;  3PR5 B;  2BKO A;  5EX0 A;  2B9E A;  3W2V B;  4X4Q A;  2J8A A;  4QIE A;  3JTP A;  1ZM9 A;  1T11 A;  2E1A A;  2WOM B;  2V4R A;  3ITH A;  2M8D B;  2LXU A;  2ZOF A;  4CLY A;  3H0P A;  3HD2 A;  2FD2 A;  1HPZ B;  5L46 A;  3T6J A;  4W4M A;  1RHK B;  3KFW X;  3MM7 A;  4FVM A;  1CS4 B;  2QJ3 A;  3BKF A;  1NB2 A;  1RWV B;  1ZM4 A;  4R5P B;  2X1F A;  1DJ0 A;  3SV4 A;  4ECR A;  2YX7 A;  3B82 A;  3BPD A;  1JLG A;  3ZZ0 A;  4Q0B A;  5G4D A;  4RU9 A;  2DEJ A;  3FBF A;  4X64 J;  4HAC A;  2B4O A;  3ZO7 A;  5CXT A;  4JI0 F;  3K89 A;  1UVM A;  2DCL A;  4OFZ A;  3W61 A;  3GU0 A;  2AHO B;  5DET A;  3VGV A;  4CO2 A;  2GGP B;  2B6A A;  4FF2 A;  3EWG A;  2JRS A;  3CCE S;  4B3M F;  5BYR A;  1SI9 A;  3UD4 P;  2MKS A;  2PMW A;  2QLF B;  3PV8 A;  3GCX P;  2B5J A;  2BJE A;  1J5O B;  2DRA A;  2JDJ A;  1HMV B;  1LWE B;  2Y1I A;  2Q6C A;  3DGV A;  2F4V F;  2CIM A;  2H5I B;  1C4C A;  1FTC A;  2C2M B;  2LU1 A;  3CJ3 A;  1S10 A;  3SQO P;  2CAD A;  1WKL A;  4HKQ A;  3R9L A;  2XY5 A;  1RTI A;  2IBK A;  3LTO A;  1Y9O A;  2VZ9 A;  4CTA B;  1ZM3 A;  1PJ6 A;  2BYC A;  3UWT A;  4FNH A;  3D1Q A;  4ICL A;  1XMO J;  5HAO A;  1DUR A;  1DQA A;  4Y2A A;  2H65 B;  1HNW J;  1F60 B;  1CJV A;  1RT5 B;  2AGQ A;  2OFG X;  4ZPC A;  3I0S B;  3W9H A;  2UUB J;  3PIO Q;  1UKU A;  2MKI A;  2POK A;  1JLC B;  2MST A;  1X4H A;  3JB9 k;  1U7L A;  5AXL A;  2WCX A;  4DOZ A;  2HVZ A;  3ZZZ A;  2BE9 B;  3MMB A;  4YP3 A;  2KT5 A;  4NAS A;  4WBF A;  4MKA A;  1HNX F;  3ILI A;  3Q83 A;  1FJ7 A;  3OFH A;  3IAS 9;  3HD1 A;  3Q2T C;  4KQZ A;  3EYZ A;  2YX1 A;  3A8K A;  4QOT A;  4DL0 C;  3SSS A;  3CME S;  4HI2 A;  4L73 A;  4Q44 A;  1YK9 A;  3A8I A;  3BDP A;  1ZTW A;  3AQP A;  3G71 S;  5BR8 F;  5LXY A;  4Q8E A;  2DNZ A;  4UOH A;  2VBY A;  2OO4 A;  4ED8 A;  3PW5 A;  1MG7 A;  2ZC3 A;  3OUY B;  1TVR A;  2GAH C;  1RTJ B;  4KHM A;  3MED B;  1EX8 A;  1WDT A;  4RW7 A;  2XMK A;  2I2Y A;  2MY7 A;  1L3T A;  2VBZ A;  1N4L A;  5KFJ A;  3TWZ A;  4BCA A;  1HWU A;  5F0U A;  3G6Y A;  2V94 A;  1OY8 A;  4DV7 J;  3T1H J;  1Q0N A;  3R5G A;  4DFK A;  5B0B A;  2CUY A;  4L3K A;  4QIW D;  4NCG A;  3CCV S;  4FP9 A;  3K59 A;  3DDN A;  1Q53 A;  2YWH A;  2OHD A;  3MFI A;  1YGY A;  5A76 A;  2ZJP Q;  1K73 T;  1JLQ A;  3KUH A;  5SZT A;  5ETM A;  2GV1 A;  2GX8 A;  1YSJ A;  4XAK A;  1C2P A;  4USK A;  4JI7 F;  4RUA A;  3Q8S B;  3T1A A;  2ZDP A;  2O5D A;  3SV3 A;  3D0H E;  3PG9 A;  2ABY A;  4GVL A;  1U1K A;  2ZBP A;  2R2U A;  2WVF A;  3VZI A;  2Z2Z A;  4P72 A;  3M8W A;  1XMB A;  3IAM 9;  2KH9 A;  1UMJ A;  2HHU A;  1R8B A;  3BBB A;  2CJA A;  1TKZ B;  2CQC A;  2XTJ P;  4PYA A;  5CHC B;  2KG0 A;  1H7W A;  1TUV A;  1IWA A;  3VGS A;  4J9S A;  2R8G A;  4MFB A;  4IYQ A;  1FTR A;  1SH3 A;  3VAM A;  1JLB A;  4LF9 J;  4F4Z A;  1VI7 A;  1RB0 A;  2B0G A;  2UV8 G;  4C48 A;  1FDB A;  2ZUG A;  3PCO B;  4ZN3 A;  2FGC A;  3C6T A;  1VQ9 S;  2DD8 S;  5CYM A;  2W7O A;  2CQ3 A;  2D7S A;  4DLG A;  4DL3 A;  2UXB F;  2MMY A;  1T02 A;  3MMC B;  3K5N A;  1TL3 B;  5G0R B;  2CQ4 A;  2NUH A;  1RT4 B;  4WKY A;  5DM6 Q;  3QGH A;  4M5L A;  3MI7 X;  4O3O A;  2JNJ A;  2N4D A;  4WPA A;  4BLG A;  2HVI A;  3HVT B;  3W8P A;  4DSI A;  2LQ5 A;  3LAK A;  3NS6 A;  4W92 B;  3Q8P B;  3PKY A;  4NCB A;  1TV6 A;  2RUG A;  5DQH A;  3M1V B;  4U95 A;  5J2Q A;  2MZJ A;  2J6S A;  1FCA A;  2D3U A;  1MN9 A;  4LFB J;  5A8K B;  3HLU A;  3D66 A;  4YB6 A;  3W2W B;  1U6F A;  3NOC A;  1TL5 A;  4DS4 A;  1HL6 A;  5L1K A;  2OPS B;  2EC2 A;  2DIU A;  2WZ1 A;  1F1B B;  3QO9 A;  2K3K A;  3BSN A;  3J81 j;  5GAE U;  1SJ3 P;  3LAN A;  1EQM A;  2D69 A;  4YHH F;  5KFC A;  1U48 A;  1IKX A;  2UU9 J;  3KDO A;  4G6V B;  3HT0 A;  1VHF A;  6AT1 B;  1WC3 A;  4A47 A;  5E0O A;  3N5B A;  2LQJ A;  3QZ7 A;  1RAF B;  1SUQ A;  1I5O B;  2AX1 A;  3CJT A;  4ZJL A;  2AEF A;  1YZ7 A;  4NA2 A;  4C8M A;  4LF5 J;  4PRF A;  1QM9 A;  3NAH A;  3H2U B;  2NZ4 A;  1S1U B;  3KMQ A;  1W26 A;  3RW6 A;  1C1B A;  5CZV A;  1X0P A;  3D6F B;  3FBE A;  2CNL B;  5CH7 B;  4KKO A;  3RBE A;  2G2Y A;  4P6Q A;  3DC2 A;  3BDE A;  2XS5 A;  3CD5 A;  4KV8 B;  1NXI A;  4JBC A;  1LXN A;  1UTA A;  4ECS A;  2NR0 A;  2R4F A;  3R5B A;  4EGL A;  4A8M P;  2VV5 A;  3OL7 A;  2RRA A;  1BD6 A;  4HHJ A;  1RWX B;  1CJK B;  3BPS P;  1SC1 B;  3CED A;  5BYQ A;  1IKV B;  2LEC A;  3PAC A;  1ZPW X;  1Z4U A;  4LIW A;  5LSR A;  5DDQ C;  2ILZ A;  4RNM A;  3HDS A;  1P1T A;  4OYB A;  4DSL A;  3CCL S;  2IJR A;  2CQH A;  4ZIT A;  2N3O A;  2NXU A;  1NK9 A;  2J9E A;  1VQS A;  2MJU A;  2QA4 G;  2N3L A;  3LF0 A;  3BR8 A;  5HQL A;  2DNK A;  3F73 A;  1OMS A;  2C2K B;  2VOD A;  5D0E A;  3M6W A;  5C24 A;  2YXL A;  3CCQ S;  1NB7 A;  1Y11 A;  1VC0 A;  2XMU A;  2V8P A;  2B9W A;  1X5P A;  1U1L A;  1SIW B;  4HI1 A;  1M1G A;  5H9F J;  1XN9 A;  7FD1 A;  2MGZ B;  3ADA C;  4N8N A;  3BF4 A;  5T7L A;  3TUI C;  4YB7 A;  2XZW A;  2CZ4 A;  2VBX A;  5I3P A;  4RPF A;  1H3D A;  4DS5 A;  3U27 A;  3GIJ A;  3RYL A;  1W25 A;  4K0K J;  2LDI A;  1IQT A;  1IBK F;  2WSF C;  5HLF A;  2GMH A;  2XY6 A;  3NCP A;  2FB0 A;  4WU2 A;  2XG8 A;  3QNW B;  3UFC X;  1UEV A;  1K44 A;  5ETK A;  1NJI T;  5DG9 A;  3EPI A;  3DLB A;  4DV1 F;  3SQG B;  5KFY A;  3ZZO A;  3QRR A;  1N0V C;  1HBM B;  2HQI A;  3GFY A;  3MAQ A;  4O3P A;  3PIP Q;  2JEI A;  4IKA A;  3GWC A;  5F8G A;  1MRO B;  3MOJ B;  1RIS A;  4R0J A;  2UU9 F;  1YQH A;  1S1T A;  2D3O R;  4XPE A;  4C8O A;  1BQM A;  1O6X A;  1S1V B;  4J9V A;  1YJU A;  3TVY A;  3N5F A;  2BVZ A;  1T9Y A;  2V8H A;  2BJ7 A;  4DQR A;  1SQG A;  2AJ1 A;  1VIX A;  1N6Q B;  3DOL B;  2BE2 B;  5HRO B;  4CT8 A;  1FJG J;  4OZ1 A;  3IS9 B;  3LO3 A;  3AA8 A;  2D9P A;  3NLC A;  2QX0 A;  3IFE A;  1OWX A;  2JOQ A;  1MML A;  5DGB A;  2WVE A;  2AP6 A;  5K14 A;  4J9Q A;  1N56 A;  2IMO A;  4LT6 A;  4NLU A;  1YBT A;  2WON B;  1V6H A;  2MQL A;  2DXE A;  5IWA F;  3DM2 A;  3EGV A;  3B78 A;  3T5L A;  1FXD A;  4L6V 3;  5E33 A;  4B3R J;  3EX7 B;  3L7O A;  1WWH A;  3DLL Q;  3PJW A;  2RQC A;  3MEE A;  2HFO A;  4CLS A;  2ZBR A;  2BBE A;  1F5A A;  1QSS A;  4RW9 A;  5D0R A;  4NRT A;  2IDE A;  3UPF A;  4AD6 A;  4R8U A;  4WP8 A;  4X4P A;  1U1Q A;  4FKY A;  4ELT A;  1ELO A;  5I3U B;  5MLC V;  5ITH A;  3FCW A;  1YRX A;  4KR0 B;  1HAR A;  1B7F A;  2XM3 A;  4DR6 F;  4NYO A;  1RYR A;  1KEK A;  4RBV A;  4YS2 A;  5LXR A;  5CCM A;  2RU9 A;  1U45 A;  4LJM A;  4PWW A;  3DOK A;  2B43 A;  1DQ9 A;  4DR3 F;  3DLE B;  2DNY A;  2HK3 A;  3MEG B;  4MH8 A;  4YDX A;  3BM7 A;  3H42 A;  2BAB A;  2CKW A;  1HW9 A;  3FQL A;  1B7Y B;  4Q2M A;  1LW0 B;  1X0F A;  2Y8W A;  2EFP A;  3TEG A;  4DBQ A;  2HHH F;  2CJX B;  3VQT A;  3PEH A;  3P8B B;  4P2S A;  3FC9 A;  3U02 A;  2BJ3 A;  1Q5Y A;  1KON A;  5U47 A;  4DF4 A;  2W9A A;  3QRP A;  4DF8 A;  5D78 A;  3AAW B;  1D09 B;  1WSV A;  2AYE A;  2GJI A;  5IT0 A;  2HVE A;  5LMU F;  1XQI A;  2QA2 A;  5H9E J;  3JAM Y;  4ANE A;  5K8N A;  3WZ0 A;  2L9W A;  3ILL A;  2LEP A;  1VQ7 S;  4GKJ J;  1Y3J A;  3DRP B;  4J5O A;  3DLK B;  2JFK A;  1W7W A;  1SVD A;  1RAI B;  2CPH A;  4RBT A;  4PWU A;  1KBR A;  2K3I A;  2DH9 A;  1Q78 A;  2VU5 A;  4QIV A;  4EZ9 A;  4C7Q A;  3BGR A;  3B4D A;  1Y5L B;  1LWC A;  2OPR A;  4NCA A;  1NSA A;  1NK8 A;  1XR6 A;  3M30 A;  4IOB A;  4LF4 J;  4B9U A;  3KLG A;  4DV4 J;  2DH8 A;  4DN0 A;  3NGS A;  2VKZ G;  3T5J A;  1UW9 A;  5A8W B;  4F4Y A;  1ZYQ A;  4NLR A;  4F3Q A;  4CYU A;  4A8Y A;  4C3K A;  2AJF E;  4ZP7 A;  3DXS X;  2HNY A;  4NLY A;  2HQG A;  1WF0 A;  2XLK A;  4CQ1 A;  5HSP A;  2LQ9 A;  2VFR A;  4JI4 F;  4DL6 A;  1UPP A;  4L72 B;  2CDR B;  2E7W A;  1X4F A;  2MDA A;  2F4F A;  1VRQ C;  2OEL A;  1RZM A;  2NYH A;  3E01 B;  3RB3 A;  4N77 A;  1VRU B;  4MIW A;  2PD1 A;  2V68 A;  2RIL A;  4OZJ A;  3FVY A;  4DV2 J;  2A2D A;  5FII A;  4ECX A;  3CCS S;  3FJ2 A;  2G0I A;  4ZPT R;  3IRX A;  4M5J A;  5KG3 A;  1X9S A;  3KHG A;  2MJN A;  3JTN A;  3QIP B;  2B8P A;  4GVB B;  2IA0 A;  1DTQ A;  1ZPV A;  2HRY A;  3AY0 A;  2M2B A;  1KN6 A;  1LNQ A;  2DR7 A;  2YQ3 A;  5DS7 A;  5KOW A;  4WII A;  2KU7 A;  1OYE A;  2HMI B;  1EJ7 L;  3ZTR A;  3MR5 A;  3IR7 B;  4ZK7 M;  5HVG A;  3I31 A;  2QYC A;  3MPY A;  4HHU A;  4UTG A;  3KLE B;  2QV6 A;  3A1Y G;  4LIR A;  3CJ8 A;  3I9Z A;  1KDN A;  4LFC F;  4H4K C;  3GJS B;  4EWT A;  2HSE B;  3R3T A;  3W60 A;  3MM6 B;  1M1K T;  4X4N A;  2Y1R I;  3R7N B;  1U47 A;  2V6A A;  2RD5 C;  3HHL A;  2CQD A;  2PDA A;  4OYA A;  4N5S A;  4B3T F;  1S59 A;  3CTR A;  2O66 A;  1HNZ F;  2W7P A;  3GV5 B;  4DCJ B;  3IM8 A;  1CJT B;  5HMY A;  1P6T A;  3PKM A;  4Z7C A;  1ZA2 B;  1NDC A;  2HQF A;  4AXI A;  4UQT A;  2W2P P;  4TXS A;  4I2P B;  1HWK A;  4QWA A;  3SFU A;  2WTF A;  2HVH A;  3PJ9 A;  2KVQ E;  4X4S A;  4PYD A;  2XLI A;  4GKK F;  2QEX S;  1OO0 B;  1BQX A;  1RWM B;  1FRK A;  4DV0 J;  3GMG A;  2G9O A;  3MUV P;  1U8S A;  3PO4 A;  1CJU A;  4WZM A;  5KFK A;  4C98 A;  1UWB B;  2GVZ B;  1HNI A;  2YNH A;  4F4X A;  1QVG R;  1SB6 A;  3NEK A;  2L9N A;  2RML A;  4JI6 J;  1S9E B;  1HW8 A;  3CE8 A;  1HFE L;  3G82 B;  4M5D B;  1VQ8 S;  3HFZ B;  4W98 A;  2OTJ S;  2HAI A;  4B9M A;  1RT2 B;  2AZ3 A;  2UVR A;  2IYG A;  1KOO A;  3D28 A;  2V2Q A;  4G1Q A;  5ETP A;  1RWK B;  2GCF A;  3LP1 A;  5ETL A;  3W2V A;  1KFS A;  8AT1 B;  3N6M A;  1YKW A;  3TAN A;  2OML A;  2BXJ A;  3I5A A;  2WOM A;  1FEH A;  3PW0 A;  3HZG A;  2OKQ A;  4IQM A;  2MQP A;  5J1E A;  2R7S A;  2P8I A;  1HPZ A;  4OZL A;  2MEW A;  3ELH A;  2K06 A;  3OR2 B;  3FZB A;  2QLJ B;  3DFE A;  2Z2M A;  5M2R A;  3N79 A;  3ZTS A;  4DUY J;  4IDK B;  3MM9 B;  4ZLN A;  1CS4 A;  2DJW A;  3MCO A;  1NH8 A;  5KFP A;  2FC8 A;  3OPK A;  2PA3 A;  3RTV A;  2KL8 A;  3EM1 A;  1S48 A;  5GAG U;  1S76 D;  1N36 J;  1RGV A;  4K4Z A;  4CZC A;  3HVA A;  4RW4 A;  2QO3 A;  3I4P A;  4ZA1 A;  2R8H A;  3OTO J;  5E3R A;  4F4A A;  1NPK A;  4J7C A;  3D0G E;  2XNR A;  5AJ3 J;  2GGP A;  2ILY A;  1WSR A;  5F8J A;  2LLZ A;  4YB1 P;  3NXZ A;  1IR1 A;  1FES A;  5HMZ A;  3POT A;  2PI4 A;  4C3M A;  2RVJ A;  2I9S A;  2MLY A;  2ZH3 A;  1J5O A;  1HMV A;  3MM8 B;  4WYL A;  5KG0 A;  3IWN C;  3CO0 P;  5IC6 B;  3FMW A;  1S6O A;  2RDJ A;  4OHX A;  2UV8 A;  1RQ0 A;  1YJ9 S;  1V5I B;  1WEX A;  2DGW A;  4UY8 T;  4CTA A;  4DX8 H;  3GG1 A;  2OAU A;  3KJN B;  3E51 A;  5D0H A;  1X31 C;  2YQ1 A;  4PXD A;  4O0I A;  1B70 B;  3O8W A;  3MMJ A;  2D74 B;  2BQ3 A;  1M5O C;  4JI2 F;  3R2C J;  1RTH B;  3DRX A;  4IO9 Q;  3RAX A;  1FFW B;  4CO4 A;  1BHN A;  2NQP A;  2K8G A;  1JLC A;  4Z7Y A;  1OQ6 A;  2DRD A;  1BY9 A;  1C0T A;  2ZNZ A;  4ZMM A;  1HD0 A;  3TW0 A;  1NHK L;  1H0H B;  1AYE A;  4NPO A;  2HLU A;  1SL0 A;  5GVQ A;  3TP2 A;  4P7V A;  4URG A;  3SZ2 A;  3UVJ B;  2HWT A;  1E6Y B;  2ZH1 A;  1S6Q B;  4H4M B;  3KJF B;  3VAG A;  3IN5 A;  2HW3 A;  4P71 A;  2V4J A;  3RJM B;  1UCN A;  4RO0 A;  3SI8 A;  2X3G A;  4I7F B;  5KFO A;  2H48 B;  3M32 B;  2ZD1 B;  1GNK A;  1RTJ A;  4U8V A;  2DKO B;  5CQG A;  3MED A;  2OFH X;  2G1D A;  4WK3 A;  1G7C B;  2DO4 A;  3T5K A;  4WFB Q;  5JVG Q;  3GR1 A;  3ZFV A;  4RL1 A;  2Z2Y B;  4CLL A;  1XC9 A;  3MAA B;  1JLA A;  3W1Y C;  5AE3 A;  1FWK A;  1REV B;  1UP1 A;  2B8Q A;  2KJW A;  1HHQ A;  3LA0 A;  4OI1 A;  2R8I A;  4EI2 A;  1FDN A;  4X84 A;  3GE9 A;  4DPY A;  3K7R A;  1OJ4 A;  3V6H A;  2FLP A;  1WOO A;  3AOC A;  1NEE A;  4PCQ A;  2DY9 A;  1SBR A;  2AMC B;  2R3V A;  1BLU A;  3SMZ A;  2JJ4 D;  4JV5 F;  1P9Y A;  4OZN A;  1GXU A;  4KHP J;  3PX4 A;  1S1X B;  1KKH A;  4OL8 A;  4G1I A;  2YNF A;  2CQ2 A;  4DV6 F;  1FNO A;  4WWS A;  1RAC B;  1JQG A;  1X5O A;  1XMQ J;  2VA3 A;  4GO5 X;  1W2B R;  1R31 A;  3HZE A;  2XUL A;  3RUB L;  1RAA B;  1TKZ A;  2B6A B;  1AB8 A;  4J90 A;  3DLJ A;  1N33 J;  4KE5 A;  4ZCL A;  3TJA A;  3V2U C;  3D1O A;  2IM1 A;  4N56 A;  1DAX A;  3Q23 A;  2ZVI A;  2EFO A;  4F0H A;  5F0W A;  1GTE A;  2HYI B;  1X4G A;  3U1M A;  4AL5 A;  3AH6 A;  1SJF A;  4E2F B;  1C4A A;  4NLG A;  2H5J B;  1LV5 A;  4FN5 A;  5DQG A;  1VBY A;  1FKA F;  3SBM A;  2B3T B;  3MMC A;  1S7H A;  2ZM6 J;  1TL3 A;  2CA9 A;  5G0R A;  2IVF B;  4U7U K;  1HQE A;  2E7V A;  5KT5 A;  3JSY A;  2MPU A;  2QFI A;  4DFM A;  2HZV A;  1AFI A;  3PO5 A;  4ICL B;  3CO9 A;  4FXW A;  3PW4 A;  2BKN A;  1QLN A;  2YX4 A;  3OLB A;  3B6B A;  3C15 B;  2YKM A;  1HQ2 A;  4USV A;  2W2O P;  3D5M A;  4WU3 A;  1R0A B;  3M1V A;  4F50 A;  1KLM B;  3EZ5 A;  4YQW A;  3HT3 A;  1FA0 A;  3I96 A;  5A8K A;  2DNG A;  1DY3 A;  3CIM A;  2PII A;  4DU7 A;  4C8N A;  1H2U X;  4FKX A;  2Y9H A;  5M2P A;  1HQU B;  1FD2 A;  1WC6 A;  1BUX A;  2H1Y A;  1SC3 B;  2YH0 A;  1W2I A;  3DGP A;  3BBC A;  2XI3 A;  3Q8V A;  3U1N A;  2E66 A;  3DLH A;  1R8P A;  4HT5 A;  1D0E A;  1U2F A;  2DY1 A;  1F0X A;  2V8V A;  1RI7 A;  2QFJ A;  2VG6 A;  5AT1 B;  4DQQ A;  3UR3 C;  2BAN A;  3LP2 B;  1S1U A;  4PR6 A;  3J7A N;  2UXD J;  4RW7 B;  3QWP A;  4HTI A;  2YWG A;  5D15 A;  3TA1 A;  1NPP A;  3O5T B;  4F0K A;  1OYD A;  4HDH A;  1RAE B;  4KV8 A;  3NWG A;  4K4W A;  4PEO A;  2L41 A;  1XJW B;  2FHJ D;  1VQ5 S;  4EFA C;  2AYM A;  1XNQ F;  5E7O B;  1IBC B;  3T9N A;  2NUU G;  2FZC B;  4DG1 A;  3BSO A;  4C97 A;  4QPT A;  3LGN A;  1RT6 A;  1IKV A;  1YZ6 A;  1LWF A;  3M4X A;  5J2P B;  4DPW A;  2HWI A;  2MKY A;  2J0W A;  1TEL A;  2I1R A;  3CGI A;  2HQD A;  2QN6 B;  4HH1 A;  1SKS A;  3UNG C;  3HSJ A;  2EFQ A;  5HAN A;  1P27 B;  5DLG A;  3J7A 1;  3B8H A;  3AOD A;  4DR5 J;  5B0F A;  4IR9 A;  4ITS A;  3ZZU A;  4LQ9 A;  1MWQ A;  2CJQ A;  2XCA A;  1RBL A;  5IV3 A;  3DRY A;  4RLE A;  2VOP A;  4PG5 A;  5IQ6 A;  5T14 A;  3MD3 A;  1WC5 A;  5D3G A;  3OFE A;  2UXC J;  1R6V A;  3VZH A;  3GQC A;  3D68 A;  3ILJ A;  4K4U A;  3Q0A A;  3SCJ E;  1CC7 A;  3HUL A;  2I6W A;  2C22 A;  5GAE I;  4KIA A;  5AE1 A;  1JLB B;  4I6A A;  1NND A;  5E5N A;  4C11 A;  8RUC A;  1VJW A;  4J9L A;  2GNK A;  3C6T B;  3BQ2 A;  5CYM B;  2YBV A;  1HI1 A;  3M2V A;  1MLA A;  4Q8F A;  4LF6 F;  4DR2 F;  5E3A A;  3SCI E;  4F3O A;  2GHP A;  5HJX A;  4ED4 A;  5HQ8 A;  1QE1 A;  1FWL A;  3HHN B;  3KWM A;  3EVM A;  2ZKT A;  1O5J A;  2EW9 A;  3EGW B;  1FX2 A;  2PN6 A;  3MR2 A;  5CD4 A;  2NS1 B;  2YWE A;  3MAH A;  1KP6 A;  3M8Z A;  3SQG A;  1L3V A;  1L3K A;  5J2Q B;  4DR1 J;  1HBM A;  1FFS B;  2V2Z A;  2JLG A;  1S6U A;  2EFV A;  3JSM B;  3KHR A;  4RNH A;  1UVK A;  3OTE A;  2EK1 A;  3QO9 B;  3QAT A;  2HIQ A;  1S1V A;  3K8V A;  1JJC B;  3NMA A;  1VQO S;  4NZ7 A;  3U7J A;  2KJV A;  3T9Z A;  4Z37 A;  1BWE A;  1DRZ A;  1N6Q A;  3DOL A;  4Y2K A;  2RE1 A;  3IS9 A;  4ES3 A;  2N82 B;  1ZAV A;  4ECQ A;  4B9N A;  3QPI A;  4EMD A;  5B0D A;  3GFX A;  1TL1 B;  2XZD B;  3W9I A;  4GO7 X;  3S6E A;  3HF5 A;  2MLZ A;  1M5K C;  3QMQ A;  3W64 A;  3KLV A;  2WON A;  1M0S A;  3A13 A;  1C1B B;  1FKO A;  3R5C A;  3GV7 B;  4MK7 A;  3D6H B;  2XCP A;  3PW7 A;  1SKW A;  3RU0 A;  3K2Y A;  1QDU B;  3TZW A;  4NRU A;  2XLJ A;  3KK1 B;  1F5C A;  3UCZ P;  5JUM A;  3LOU A;  1RDR A;  1VYA A;  1Q7L B;  4YY3 F;  4LRF A;  4B3O B;  1FXL A;  1JK9 B;  1FNM A;  1UFK A;  2B9Y A;  1YVF A;  4PKD B;  2BR0 A;  1RAD B;  1SH2 A;  2W01 A;  4NXN F;  3HVR A;  3NAI A;  1YHQ S;  2Z0G A;  5I3U A;  3OD2 A;  3CJR A;  2DIS A;  1WG5 A;  3H7H B;  1VQY A;  4K4T A;  4OYM A;  3QWU A;  4DZD A;  2OD4 A;  3X1L B;  1XWL A;  4MT1 A;  4PQA A;  5HMX A;  5LOQ A;  3O44 A;  4AUK A;  2WSE C;  2WHO A;  1F9F A;  4MMO A;  4JUZ A;  1U1M A;  2R9L A;  4O3S A;  2AKW B;  3DLE A;  3MEG A;  1UL3 A;  5KOX A;  2YNG B;  3HPO A;  1PJ5 A;  2FZG B;  2VFT A;  3EVO A;  3EZO A;  3M6X A;  1BMQ B;  2VQE J;  3VVU A;  4LSL B;  1HR0 F;  2AU0 A;  3FSI A;  4G65 A;  5L1L A;  1S77 D;  2GO9 A;  3HK2 A;  3H8Y A;  4UW2 A;  2BRK A;  4X4T A;  3RGI A;  3M8S A;  3D2W A;  4U9R A;  1T9X A;  4CCH A;  1E6V B;  1TKX A;  4RNO A;  1D8Z A;  3W3S A;  3TEH B;  2DT9 A;  3Q8Y A;  1VBX A;  2E5I A;  1UEK A;  1U6Z A;  1NZA A;  3D3B J;  4IG3 B;  4DN9 A;  3GFH A;  1ZS6 A;  1IKW A;  2D3O 1;  2VQF J;  2CDQ A;  1FVS A;  3QT5 A;  2HS4 A;  1P8G A;  5HAT A;  3CPW R;  2BJ8 A;  2Z4P A;  3EXY A;  4NX9 A;  2BX6 A;  3C66 A;  3THP A;  2XEX A;  1OY6 A;  1SQE A;  2ATC B;  2F1F A;  1WI8 A;  5KG6 A;  1MW7 A;  1PBU A;  3CD0 A;  1F9H A;  2FZK B;  3OW2 R;  3WHI A;  3KHH A;  5EWG A;  4CLK A;  3BGF A;  2YWF A;  2BM1 A;  4YR2 A;  2DHG A;  4RNF A;  3MTK A;  1S1T B;  5KFT A;  2K2P A;  2QGF B;  1BQM B;  2DNQ A;  2C3U A;  1GMW D;  4M5G A;  2KM8 C;  2MZR A;  3DMJ A;  2BOA A;  3G6E S;  4OX8 A;  4J9M A;  4I67 A;  3E01 A;  3ENV A;  4RWW A;  3CD7 A;  3JXO A;  2C3M A;  3TVK A;  5K14 B;  4LF7 J;  5IT4 A;  2HFV A;  3NBP B;  1VK3 A;  2OSR A;  1ZZF A;  5B0C A;  4V1A k;  3DM2 B;  1AFJ A;  1GH8 A;  1IKY A;  3SCK E;  1DAR A;  2HGN A;  4ZVR B;  4WFZ A;  3FRZ A;  4GVB A;  5KFS A;  5IT9 Y;  2EPI A;  3MEE B;  2KT3 A;  2A6O A;  4M5N A;  2ALZ A;  2ZJR Q;  3CC7 S;  1N54 B;  4KT0 C;  2B51 A;  2P5V A;  2ZHB A;  4IOC Q;  2XY7 A;  5ETR A;  1VBK A;  4F36 A;  4R8U B;  3AD7 C;  2GA7 A;  4B17 A;  1LXJ A;  1WHW A;  4LRD A;  3KLE A;  2JWN A;  2XO7 A;  2I5J B;  2DIV A;  1VQL S;  5D8H B;  2A0F B;  1IBM F;  4F4W A;  1ACM B;  2WSC C;  1NHV A;  2KM8 B;  3T1Y J;  3HHK A;  2KHC A;  3AXM A;  3DOK B;  2NXJ A;  1N5Q A;  1SCJ B;  1YRU A;  3P49 B;  4USI A;  5KFF A;  3NCR A;  2ZH4 A;  1VMB A;  2QL7 B;  3LGM A;  3GFZ A;  2M88 A;  1Q8B A;  3RAM A;  3JQJ A;  5GAH U;  3W62 A;  4DJB A;  2VAS A;  2P2C B;  1S0V A;  2E5L J;  4OX9 F;  1T0T V;  2R7T A;  3O3L A;  4F3M A;  5DG8 A;  2QMW A;  1WDD A;  4CRJ A;  4OJH A;  2KXF A;  3BGU A;  3IA0 A;  2FHM A;  2OUG A;  2GVD A;  2RS2 A;  3DOM B;  2CWX A;  2KKH A;  1FWP A;  4PQU B;  3J81 Y;  2RHQ B;  3ETM A;  2ZH7 A;  2J6T A;  3G82 A;  1OIA A;  3LH2 S;  2B7B B;  3GTY X;  3MWB A;  4ZVQ B;  2HGM A;  2P6T A;  2BRL A;  4H4K A;  3M8Y A;  1HWJ A;  1T03 B;  3BGR B;  1VQK S;  1LWC B;  2OPR B;  2QMU B;  2ZC4 A;  5KAK A;  3QFH A;  1PBA A;  3TQ1 A;  2RRN A;  2HLT A;  1LEO A;  2XS7 A;  2X1G A;  4OZ0 A;  1U02 A;  2DYA A;  3ZTQ A;  2MHN A;  1LWX A;  4CYU B;  4ID5 B;  3RBX A;  2YTC A;  2EFN A;  3QRQ A;  2LVW A;  3M9O B;  3A3P B;  2NYI A;  1WKK A;  4EEY A;  2GFF A;  4IDK A;  4DV5 F;  3MM9 A;  4RBU A;  2HHX A;  2HIY A;  4NEY A;  3TX8 A;  4ILR A;  1WI6 A;  4WE1 B;  2CPJ A;  3VHQ A;  4Z2X A;  2VUG A;  5CZX A;  4ECU A;  1NSP A;  2J76 E;  1JXL A;  2CRL A;  1Q4R A;  1KQK A;  4ANC A;  4Q43 A;  3BH6 B;  2Y3Y A;  1SC6 A;  3IRX B;  1TTH B;  1S1W A;  3H25 A;  3DLG A;  3M05 A;  4YOE A;  3GJR B;  3IXQ A;  1DTQ B;  1LKZ A;  5J2M B;  2A1B A;  2VC0 A;  3VWS A;  4CLU A;  4WKR A;  4ZS6 A;  2EKY A;  3KUE A;  3TQE A;  2QRR A;  4DPU A;  4JI5 F;  2AX0 A;  3FRY A;  3OFG A;  1K0V A;  4OZ5 A;  2C3O A;  4ZVS B;  1WG1 A;  4CT9 A;  2R7R A;  4K59 A;  2NCK L;  4ZVP B;  3KUG A;  3GB0 A;  3IC1 A;  5JMN A;  2CNN B;  3MCM A;  3PYD A;  2IY5 B;  4P7T A;  5ETT A;  4JOU A;  3M2R B;  1NH7 A;  1S6P A;  2KYX A;  4NLQ A;  1TP7 A;  5F3T A;  2YPY A;  1RCO B;  3HHL B;  3W63 A;  2F9J A;  3DRS B;  2W2N P;  3KMS A;  3RRH A;  2PFF B;  2BW7 A;  3G8S A;  1X7V A;  5HBM B;  2OPQ A;  1YJR A;  3JQK A;  1JMT A;  3I0R A;  5IT9 U;  2KTQ A;  4QW9 A;  4BHQ A;  4USH A;  2Y1J A;  1RYS A;  5HK4 A;  1LW2 B;  5L1I A;  4DL7 A;  1IWG A;  4L75 A;  3TNV A;  1NM2 A;  1X4B A;  2N7Y A;  3JYT A;  2AEM A;  4EO8 A;  4NLT A;  2RQ4 A;  2GO8 A;  2OMO A;  4OHZ A;  3IRW P;  3NRB A;  3QYY A;  1WHX A;  3UVJ A;  5C2C A;  5KFN A;  2CJB A;  3A8E A;  1E6Y A;  4URQ U;  4H54 A;  1S6Q A;  3NGK A;  4H4M A;  1CJU B;  1J5E J;  5ETQ A;  2DNM A;  2V9K A;  1HNI B;  2CFX A;  3K17 A;  4ES2 A;  1CEZ A;  5GAG I;  4NXM F;  2K7K A;  2FJW A;  4I7F A;  2E7X A;  3M32 A;  2GS8 A;  5H1S V;  2HHT A;  2QL9 B;  3QZ8 A;  2OP5 A;  3L7P A;  4P9S A;  1NK5 A;  2C28 A;  5LM7 E;  1S4F A;  4I64 A;  4LVN P;  2HZA A;  4KTQ A;  3FZ2 A;  4JYA J;  2UVV A;  3W5Y A;  4XTT A;  3EDQ B;  3MAA A;  1M5P C;  1FD8 A;  1GQE A;  3KLF A;  1RU2 A;  2MZS A;  1REV A;  2MKJ A;  5J1E B;  3OSP A;  2HFS A;  2RDD A;  3W5Z A;  5DRK A;  2WK4 A;  2WVB A;  4ED7 A;  3J81 U;  1GXT A;  4TU9 A;  3QJP A;  4TYB A;  1NO8 A;  5EWF A;  1RT7 B;  2DGV A;  4AL7 A;  2FHO B;  1FT8 A;  1S1X A;  1TMJ A;  2W4D A;  2MQN A;  4OHY A;  4DV3 F;  4DFP A;  1VQ6 S;  2B4V A;  4IR1 A;  1PIL A;  3NGR A;  4RW4 B;  4X66 J;  1Y5N B;  1QY7 A;  2QMX A;  5HMW A;  1CPZ A;  1YRT A;  3EGN A;  2CYY A;  3WIU A;  1G3O A;  3VVT A;  2EC0 A;  3THT A;  3DYA B;  2CPX A;  1EZZ B;  1SJR A;  2FDN A;  9ATC B;  3VAI A;  4ED5 A;  4A8F A;  4M63 A;  4C8Y A;  1VC5 A;  1R27 B;  1V5V A;  4CNY A;  2JEG A;  2QLB B;  3POT B;  1NKC A;  4IFY B;  2RIJ A;  2EKN A;  1AXQ A;  4MIB A;  1UVN A;  2X1A A;  1XR5 A;  1TUW A;  1WC4 A;  1T9V A;  1WHV A;  3H5U A;  1YI2 S;  2O1P A;  1HIY A;  5CD4 H;  2PGC A;  3C3L A;  3NOG A;  1AUD A;  3NGD A;  3R5J B;  5FLX U;  2J6U A;  2ZZM A;  2AJ2 A;  1WNE A;  3OTD A;  3QQC D;  2M52 A;  2J5A A;  2FLN A;  2CPD A;  1S72 S;  1OPI A;  2FJX A;  4A48 A;  3GG0 A;  4K5S A;  1M5S A;  2CQ0 A;  2ZBI A;  4AQY J;  1JJ2 R;  3ZTO A;  1HI8 A;  3G6X A;  2QA4 S;  3OTC A;  3I9V 9;  2VFV A;  1IR2 A;  1NJX A;  4KFB B;  5BJR A;  3G86 A;  1EKR A;  3C15 A;  2DNP A;  4Q45 A;  3DDK A;  2F40 A;  4JI3 J;  4IFV A;  1R0A A;  4DR7 F;  1KLM A;  4WTO B;  4ZVO B;  4UST A;  1C0T B;  2HG4 A;  4NML A;  1IBL F;  3K8W A;  4ZIV A;  1UZD A;  4BDP A;  3OL8 A;  1HQU A;  1SH0 A;  1V3Z A;  1SJ4 P;  2AF6 A;  2EG1 A;  1DZ5 A;  3AQO A;  5M2U A;  4CH1 A;  5THW A;  2LXI A;  4N47 A;  2JVR A;  4NOH A;  5CYQ A;  4V19 J;  4QIG A;  2FTR A;  4USJ C;  4WP9 A;  4L76 A;  4F8R A;  3WQP A;  2V4J B;  3G87 A;  2UUC F;  2KRR A;  1U2R A;  2XMT A;  4NLP A;  1VLO A;  2BE7 D;  5KG7 A;  2FVR A;  3LP2 A;  4F26 A;  1CC8 A;  2YWK A;  4JV2 A;  3ETO A;  5A2Q Y;  4DPX A;  3EMT A;  2GQQ A;  3N6N A;  3J7Z T;  2VF3 A;  5A6W A;  4U6P A;  1RLC L;  1REG X;  5DDP C;  4CLZ A;  4B3S J;  3CCU S;  3C46 A;  3K5L A;  4C4W A;  4OI6 A;  4C8K A;  4DUZ J;  1QAY A;  1U8W A;  1YIT S;  3A12 A;  4NLV A;  5GME A;  3AHP A;  4KGZ B;  4FXD A;  3D4J A;  4NZ6 A;  1JLA B;  1GT8 A;  2GZO A;  2LA4 A;  1F2G A;  5K8P A;  3TAR A;  3ENW A;  4B9S A;  1KC8 T;  1CQN A;  2U2F A;  2HFN A;  4LRC A;  4RW8 B;  4AND A;  1PYS B;  1NJZ A;  1R8H A;  2GC8 A;  1SL1 A;  4FYV B;  4F2S A;  3FGV A;  2WVC A;  2CNK B;  2XWY A;  3SCL E;  4WFN Q;  5J2P A;  3TYT A;  5F3Z A;  2Y1L B;  5HL7 Q;  3UCG A;  3PJX A;  4X64 F;  4OYX A;  1TZ0 A;  1PKU A;  1RAO A;  4Y65 A;  1UVJ A;  5E2Q A;  3GPA A;  3PRD A;  4TU7 A;  4QCL A;  2HVD A;  2YNF B;  5KG2 A;  2ZH5 A;  1D1U A;  4E0D A;  4FS1 A;  3HSD A;  3PXG a;  2BJD A;  3H4B A;  1F9E B;  5LSL A;  2UUA J;  3KNG A;  3OHA A;  1I94 J;  3MPW A;  1HHT P;  2N4C A;  5B7W A;  2CPE A;  1VRT A;  4X4V A;  2PO4 A;  2IA6 A;  5HI7 A;  1M5H A;  4WCE Q;  2J9D A;  4M5H A;  4ZVH A;  4CP5 A;  1FHT A;  4Q5V A;  4ZVE A;  3HX9 A;  1PO6 A;  1KNZ A;  1HQE B;  1T9T A;  1XMO F;  1UZH A;  4X62 J;  1HNW F;  3AXK A;  3P45 B;  1A0O B;  3AB4 B;  4ECT A;  3OJU A;  2UUB F;  4J9R A;  5KFA A;  5L38 A;  3RBZ A;  2UVW A;  2YKM B;  3GIR A;  3D6M B;  4IH7 A;  1N5T A;  1VC6 A;  5CAA A;  4LRA A;  1N32 J;  2DHA A;  3VTI A;  3KLH A;  5KT2 A;  1FNX H;  5HQM A;  2R8J A;  2FJA B;  3JSM A;  4TNO A;  2XYP B;  2D9O A;  2D3Z A;  4YME A;  4PWD B;  1SL2 A;  4QQB A;  3FCH A;  1DLO A;  3DGP B;  2XQC A;  2DTJ A;  3GYX B;  1RA7 A;  2CJK A;  5ETO A;  3BKT A;  3BYP A;  1XIQ A;  4LF8 J;  1YJW S;  3UN2 A;  3IWL A;  2ATL A;  3IWX A;  1PYO B;  1Q7Y T;  2VG6 B;  3TAQ A;  2HGL A;  1TL1 A;  2BAN B;  1YDL A;  4ZIW A;  1YJT A;  2LYV A;  4NL5 A;  2HHQ A;  3M8P B;  4X4O A;  3W5X A;  4DV7 F;  3T1H F;  3OXF A;  2Z57 B;  4LRB A;  3NS7 B;  3KK1 A;  4DPT A;  1UW4 A;  1FVQ A;  1X8D A;  3LPY A;  4A8Q A;  2DO0 A;  5HP1 B;  1A6L A;  2KT2 A;  4B3O A;  1SPB P;  3RB0 A;  1YJN S;  4DG1 B;  4ZJQ A;  3V6J A;  2XSF A;  2WW8 A;  1YG0 A;  2PC6 A;  1RT6 B;  1LWF B;  1R8C A;  4F02 A;  2MKH A;  4TYA A;  2DH7 A;  2JLE A;  5B09 A;  3WBZ A;  1TK8 A;  4Q7A A;  3OXL A;  2E1M C;  2V8G A;  1RBO B;  5A2Q U;  2CQB A;  2AJ0 A;  3K57 A;  1I51 B;  2NSC A;  2X3D A;  1SC4 B;  1VCT A;  3TA0 A;  4X65 J;  2YNG A;  1UET A;  2OD6 A;  2DR8 A;  2BMB A;  2QIF A;  4YN3 B;  1U24 A;  1Q5V A;  1XNR J;  3R8Y A;  3QAE A;  4LSL A;  4TY9 A;  1WHY A;  3I82 A;  1YIJ S;  4DSE A;  5D3G B;  4L3N A;  1VQN S;  1VR6 A;  4UF4 A;  3GII A;  5LMN J;  1T05 B;  4M5M A;  4LF9 F;  1MN7 A;  2VL1 A;  2GIF A;  4NLX A;  1R0C B;  3NNA A;  2F8E X;  4N8O A;  1WTF A;  4DU8 A;  4I6W A;  4ZPA A;  1E6V A;  2J8S A;  4C11 B;  4FYY B;  3OFF A;  3MXH P;  5EWE A;  2K7J A;  1PC4 A;  4PZV A;  2Q43 A;  1KHW A;  2V9W A;  1L3U A;  3M2V B;  2VBW A;  2WBR A;  4IG3 A;  2NPI A;  4LBP A;  4QR0 A;  1OSD A;  3IGV A;  3C6U B;  4ZVG A;  1FF2 A;  4CO1 A;  1I1G A;  4Y28 C;  5IC4 B;  3CMA S;  5IXU A;  3H5S A;  1QE1 B;  4TLR A;  4KYZ A;  5C42 B;  2DHH A;  2IBO A;  2JHE A;  3PX0 A;  2VA2 A;  2JX2 A;  5C5J A;  2RF2 B;  1N34 J;  2DGQ A;  4ID8 A;  3BV8 A;  4LFB F;  1KWM A;  4ED3 A;  4KH0 B;  5L9X A;  3LP0 B;  2FJV A;  4DR4 J;  1MWY A;  4KO0 A;  4EO6 A;  1VIO A;  5ETN A;  3CWJ A;  4ZVF A;  2RHS B;  1X4E A;  3DDI A;  3MCS A;  4V19 X;  3VGU A;  2GQC A;  1RT3 B;  4A8X A;  5FJ4 A;  4TVA B;  1K0T A;  3ILO A;  1S7I A;  3ZC4 A;  2XC9 A;  4AFF A;  3NL0 A;  3L7U A;  2RQK A;  2FY8 A;  4I4B A;  4C8L A;  4LF5 F;  3V6D B;  2E9Z A;  1WF2 A;  4CNZ A;  3PRV A;  3I55 S;  3KTQ A;  4WP3 A;  3NBP A;  4EBC A;  1G4C A;  2O01 C;  3FBC A;  4USW A;  1FKO B;  4QU7 A;  2H54 B;  4FZV A;  1Q8L A;  4B9V A;  2BOP A;  4ETX A;  4HTJ A;  3TZY A;  1N5V A;  1TR0 A;  3V4I A;  2GQ2 A;  5AXN A;  3BGO P;  2DHS A;  3KJV B;  2NXE A;  1JLF A;  2XWX A;  2F8M A;  4ZVT B;  5A6P A;  5EGY A;  2OJ3 A;  2BEF A;  3NCQ A;  4X4R A;  2PA8 D;  1L5U A;  1K1Q A;  2A3J A;  4OI3 A;  3I5B A;  3OXG A;  1WOS A;  3AJ2 A;  1FK9 A;  2MQO A;  2I5J A;  1GX5 A;  1PSD A;  2XGQ A;  3KK2 A;  2AYG A;  2FIU A;  2W24 A;  4UUX A;  3TUP A;  2VPW B;  2YPZ A;  1QAI A;  1G2E A;  2IRY A;  1ZOT A;  3QT6 A;  3T6B A;  5B08 A;  1UAW A;  3UO0 A;  1T7P A;  2P9G A;  4FDF A;  2PMZ D;  3TJ8 A;  1TAU A;  3D67 A;  5IM0 B;  3NWR A;  1KHV A;  4KPC A;  3CDA A;  3QFW A;  4KGX B;  4MKB A;  2ZH6 A;  4WTY A;  2FVP A;  3CCJ S;  1DTT B;  1NSK L;  2CG4 A;  2IM3 A;  2AJQ A;  2VG7 B;  3QLH B;  3OV7 A;  3NS5 A;  2DGX A;  5KFL A;  3A8J A;  2J7K A;  1LFW A;  4MKY A;  1B0T A;  4FF4 A;  4ZP6 A;  1S0O A;  4UQG A;  1JKH B;  2PFD A;  4J9N A;  1NHU A;  6FDR A;  2G2Z A;  3ICL A;  4HVZ A;  4HHH A;  1HBN B;  4F4K A;  1TKX B;  3OL6 A;  2CAJ A;  2CPZ A;  3DOM A;  2HS3 A;  1R8A A;  4B3M J;  2M4M A;  4OYZ A;  4K0K F;  3P5T L;  4NWB A;  1SKR A;  3QJL A;  5C25 A;  4RJV A;  4PQU A;  2DGO A;  1U0S A;  1RAJ A;  2MZ1 A;  3BGL A;  3C16 A;  4HH0 A;  2IAJ A;  4LR8 A;  5D4N A;  4I2Q B;  1IKW B;  3D0I E;  2L3M A;  1B0P A;  5LJ3 Y;  1FJE B;  1ZA1 B;  4P75 A;  5KFD A;  5CCL A;  4QBU A;  2F4V J;  4RW6 A;  1N34 F;  1Y00 A;  2KZZ A;  2G13 A;  1X5S A;  1T03 A;  5B0A A;  3KHL A;  2M5Y A;  2DXF A;  2F7V A;  2HND B;  3CJ4 A;  2FHK A;  1H38 A;  4QZV B;  1FFG B;  2C2N A;  5DDO C;  5A0Y B;  4XO0 A;  1FKP A;  4KGK A;  2DNO A;  2JVO A;  4I6Y A;  2E1C A;  3TAP A;  2HHP A;  4KC5 A;  3HM9 A;  2GIR A;  4ID5 A;  4GC7 A;  3H2V E;  2ZH2 A;  1HYS A;  5F8I A;  2ZEJ A;  3A3O B;  3GLJ A;  5KT3 A;  3H2L A;  2LP4 A;  1FJG F;  1RAH B;  1OSC A;  1Q8I A;  1NDP A;  3DMJ B;  4WK1 A;  2MZQ A;  1Q79 A;  3VAK A;  4WE1 A;  2RDI A;  3G8Q A;  4NLW A;  2BKP A;  2N7C A;  1HNX J;  2FJB B;  3R6L B;  2OEK A;  2R7O A;  5KTQ A;  2HHV A;  3ULH A;  3HKW A;  3MUT P;  3NG8 A;  2MLX A;  2IYI A;  2C3Y A;  2YKN B;  4J9U E;  4B3R F;  2W1B A;  3TA2 A;  4UOG A;  1H7X A;  3BBF A;  5GAH I;  1IKY B;  5IQQ A;  4ZJO A;  3M2U A;  4CWB A;  4H4O A;  5BR8 J;  2B7C B;  2QE5 A;  3B4M A;  1FRJ A;  5DQI A;  5DZ6 A;  5J2M A;  3U1L A;  4P2M A;  3F56 A;  3EJM A;  3FFI B;  3VV2 B;  3HFV A;  2E1R A;  1YBU A;  3WX4 A;  3RR8 A;  3K58 A;  3CT9 A;  3D1H A;  1BQN B;  3BH7 B;  3J7Y I;  5D77 A;  1FEE A;  4O4R A;  4DEZ A;  3UI3 A;  4CH7 A;  2G1H A;  3OVB A;  1TAQ A;  1KFD A;  3M2R A;  3A3N B;  2RT3 A;  3J80 Y;  1PCA A;  3MFH A;  3H20 A;  5LT5 A;  3DRS A;  4TQS A;  2V8D A;  4DZ6 A;  1NRK A;  4ALZ A;  3PM9 A;  3I4H X;  2WW4 A;  5HBM A;  4I68 A;  3CSK A;  1HWL A;  2YKP A;  1V9O A;  1PAE X;  2HKE A;  4J91 A;  4JI7 J;  4J9P A;  1QJH A;  1H73 A;  3SDE B;  4IH5 A;  1RWN B;  4WJB A;  1LW2 A;  1U1R A;  5IOL A;  5I42 B;  1QD1 A;  1ZAX A;  2CVI A;  1LOU A;  4O44 A;  3VCD A;  2GVD B;  1NJW A;  4FF1 A;  3ONQ A;  4OYW A;  4GKJ F;  1FE4 A;  3HP6 A;  4FBT A;  2MKC A;  3IG1 B;  1B4S A;  5GAD U;  2XSJ A;  3RB6 A;  4C0O C;  3RG6 A;  4HYK A;  4MK9 A;  4C8Z A;  1JNZ B;  5CAB A;  1L3S A;  5HO4 A;  3ZZY A;  2V34 A;  2UXB J;  5E3Q A;  4LF4 F;  4DX6 A;  1R7I A;  4ZP8 A;  2CXE A;  4DV4 F;  2AEJ A;  3KOA A;  4QIF A;  3HCX A;  1ZBT A;  3TI0 A;  2FY1 A;  1TFW A;  3A4T A;  1R89 A;  3KKF A;  2YKA A;  1WEL A;  2KYZ A;  3I6P A;  3VAF A;  2GML A;  2WB1 D;  4RWX A;  1NK6 A;  4PUO B;  3CCZ A;  4B9T A;  3CD6 S;  1NKB A;  2FVQ A;  1VQP S;  3JAM U;  2QLW A;  3QGI A;  1VS3 A;  3KJQ B;  5KFX A;  3KXD A;  2H5E A;  1X4C A;  3ET6 A;  1APS A;  1S57 A;  3SEO A;  2FJE B;  2XMV A;  4HDG A;  4D3H A;  2DIT A;  4ILM A;  2AIR B;  1Y10 A;  3LWM A;  1RT7 A;  4WIQ A;  3BSA A;  5J2N A;  4YHH J;  4DV2 F;  2ZE2 A;  3ZNU A;  4M1K A;  1QAJ A;  3H5Y A;  1D9A A;  5KFW A;  1TKT A;  1S1W B;  4QYZ K;  3MUR P;  4ZLP A;  3DLG B;  2HUR A;  4UOF A;  1YX2 A;  1YTY A;  1GFW B;  1UA0 A;  3DYA A;  4DWI A;  2AW0 A;  2E9T A;  1MMN A;  1PG5 B;  3FCV A;  4DL2 A;  1M90 T;  3OR1 B;  3HXM A;  3THV A;  3QAU A;  1BXN A;  2IFX A;  3R97 A;  4IFY A;  1DFD A;  3VR1 A;  1FRM A;  3GZ7 A;  1KVK A;  1T3N A;  3DI6 B;  5KFZ A;  2BW2 A;  2XYH B;  3BN7 A;  4K7Q A;  5F8M A;  3EXC X;  2B9X A;  4EBE A;  4K2X A;  1WEZ A;  2VKR A;  5MAO A;  3FBB A;  5C7P A;  1S6P B;  4PPD A;  3MTJ A;  4K5R A;  4TKT A;  2F3J A;  2UZA A;  4ZLL A;  4KFB A;  2OPQ B;  1U6B A;  3I0R B;  1O0P A;  1KTV A;  2CQP A;  3QGP A;  4OV1 A;  3IBW A;  2FHJ A;  3E3X A;  1MMD A;  3IGN A;  4ZPD A;  4BC9 A;  3CJQ A;  4ZP9 A;  2PMH A;  3K0J A;  2ZFH A;  3KLI B;  2VB6 A;  1PC5 A;  4ETZ A;  2HBZ B;  2ZH8 A;  4FXV A;  3JYT B;  2M9K A;  4DV0 F;  1WJ9 A;  1HD1 A;  1IQZ A;  1SJQ A;  3I5C A;  2BQR A;  1U25 A;  1QTM A;  2EVZ A;  1XTZ A;  4KBI A;  2AWZ A;  1S9G B;  3J80 U;  4JI6 F;  3CDU A;  2RSQ A;  4OHV A;  4WXW A;  5KFV A;  5DDR C;  4KB7 A;  5K20 B;  2OLW A;  4DQS A;  4IRC A;  2JH3 A;  1ULR A;  1HNV A;  4QPX A;  2MKK A;  2MZT A;  1RWO B;  3FSX A;  4R25 A;  1XEZ A;  3MD1 A;  3MM5 B;  5KFM A;  1R0B G;  1IBK J;  3AOB A;  2AD9 A;  2X1B A;  3R6G B;  4XDC A;  2ACY A;  2HBY B;  2ZHA A;  3LAL A;  4LBH A;  2ZKU A;  5D0G A;  1SKU B;  1PGZ A;  3KLF B;  4JB8 B;  4RR5 A;  2XHC A;  4RW8 A;  2IM2 A;  4DV1 J;  4DUY F;  3IM9 A;  3M8Q B;  1ITP A;  3ENA A;  1BGX T;  2GMJ A;  3IR5 B;  3TAM A;  1JB0 C;  1JWW A;  3DRR B;  3UCU P;  3Q22 A;  3PX6 A;  1YJV A;  3IO1 A;  1N36 F;  2XZT B;  4PAA A;  4G1P A;  4M95 A;  5LL6 d;  3OTO F;  4OJ3 A;  3D3C J;  3UW1 A;  4A4J A;  2DBB A;  3PFE A;  2QL5 B;  4WFX A;  5AJ3 F;  2GHW A;  4O0N A;  1KTQ A;  3SFG A;  3HHD A;  3NP5 A;  3T19 A;  3S1T A;  3M6U A;  2DGU A;  2HRU A;  2P6S A;  3KG4 A;  3MEK A;  1RTD B;  4IG0 A;  1B3T A;  2J9D E;  5IWA J;  2PI5 A;  3GSI A;  3N6L A;  2ZBQ A;  2ZH9 A;  2DVI A;  4FPR A;  3FK4 A;  3NGT A;  2QSF A;  1F5B A;  2B4U A;  3GSD A;  4BWM A;  3HJF A;  3T5H A;  1GMV A;  2PSZ A;  1R43 A;  4JV1 A;  3G2X A;  1NK0 A;  2CVE A;  2MB0 B;  1N52 B;  1SIZ A;  1ZTT A;  2VHG A;  3OLA A;  4XIU A;  2G2O A;  4MJK A;  1EHW A;  1RP5 A;  3W65 A;  2VG5 A;  4K4S A;  3CJ0 A;  1D9F A;  1C0U A;  4LQ3 A;  1H98 A;  3PRB A;  1T9U A;  2R2S A;  4DR6 J;  3LWL A;  3DCA A;  4IFV B;  3C19 A;  5F8H A;  4LR9 A;  3GIL A;  2VD3 A;  3EIC A;  2KFN A;  3FUY A;  2HHW A;  2ZZT A;  4DR3 J;  2UUT A;  4NEZ A;  1IJF B;  3EVW A;  3UE2 A;  2J9C A;  1TL7 A;  3KDN A;  4J9K A;  4PWD A;  3I87 A;  4IH6 A;  3P6Y C;  1TUG B;  4JI8 J;  3V4M A;  2HHH J;  4FYW B;  3MGJ A;  5CYQ B;  2IMW P;  1S97 A;  2L08 A;  3F41 A;  4LF1 A;  2HQ3 A;  2COL A;  3D7S B;  4BC7 A;  1JJH A;  4N7T A;  4Y34 A;  2RUS A;  2DEI A;  2SXL A;  2DK2 A;  5LMU J;  5K8M A;  3CMQ A;  4CO3 A;  4IOA Q;  1UEU A;  4MIA A;  3PYE A;  1RHQ B;  3C14 B;  4CH0 S;  1SJ1 A;  1T95 A;  3T41 A;  3MCN A;  2WRM A;  2FPH X;  3M8P A;  1M5V C;  4BWJ A;  4U7U D;  4ES1 A;  5C2G A;  4PXC A;  4LBI A;  2KVI A;  3R7B B;  3L9Z A;  1WC1 A;  2ZNY A;  2GAG C;  5FD1 A;  2PE8 A;  4OI2 A;  5HP1 A;  1O8B A;  3FDS A;  5BYS A;  3T3F A;  3HSZ A;  4LFA J;  4DX7 A;  4ZVU B;  3ZXW A;  2CZ9 A;  2XB2 D;  1DBD A;  4R0E A;  1ARO P;  4PG4 A;  3GJT B;  1RLD A;  4KHP F;  2AGO A;  4TU8 A;  3KNA A;  3VAL A;  1NLK L;  1P9Q C;  1VQ4 S;  1T8E A;  4RNN A;  1RJJ A;  3E2E A;  2KRB A;  2W9B B;  2UUW A;  5F41 A;  4JI4 J;  3I56 S;  3JQM A;  1IM4 A;  2LU2 A;  1XMQ F;  1WTB A;  9RUB A;  1Q81 T;  2QA1 A;  4CO0 A;  2VJV A;  1UFL A;  4OYO A;  5ETS A;  1KQG B;  3NY0 A;  1N33 F;  3BSC A;  4Y00 A;  4PXB A;  3NMR A;  3EPG A;  2DNL A;  1NCL A;  1SV5 B;  3TZZ A;  1T05 A;  1RAB B;  2J0X A;  4EU0 A;  4A46 A;  4N41 A;  3HMJ G;  3PYG A;  1YJ7 A;  2ZOM A;  1GMW A;  2F65 A;  1VRT B;  2VJU A;  5SUH A;  4P2X A;  4ATN A;  2PEH A;  2ZM6 F;  2KZM A;  2I8E A;  2IVY A;  2LQ8 A;  4GC6 A;  4I56 A;  4QW8 A;  3TUJ C;  3M7V A;  2H3E B;  3C6U A;  1AZS A;  1VIS A;  4PXE A;  5C42 A;  2MQQ A;  4DLE A;  3GIK A;  2BV3 A;  2E29 A;  2RQM A;  4LFC J;  2RF2 A;  2KG1 A;  4QWE A;  2YKQ A;  1Q95 G;  5EHH A;  2BQU A;  3NNH A;  2ZIT A;  2HNZ A;  1JLE B;  4OLO A;  4USM A;  4CIO A;  3LP0 A;  1G1X A;  5FDL A;  3CCW A;  2XMJ A;  4C9D A;  5JJB A;  3KLH B;  1X4A A;  1YWX A;  4B3T J;  1VDH A;  4DDF A;  4JI8 F;  2DNR A;  1S0N A;  3MPV A;  2WVD A;  8ATC B;  3TOQ A;  3DU5 A;  1HNZ J;  1RT3 A;  4QR2 A;  1NME B;  1IJE B;  1DLO B;  1Q16 B;  2BJ9 A;  4BS2 A;  3K5M A;  2DCU B;  1EB0 A;  5JVH Q;  2C2Z B;  3ISN D;  5DM7 Q;  4URS A;  3V6D A;  2YVS A;  2VFU A;  4C6A A;  4GKK J;  3B54 A;  2UXD F;  2QG9 B;  4QWC A;  2FJD B;  2EFG A;  4DUT A;  1MU2 B;  3RBD A;  5LSO A;  2J7W A;  1S12 A;  3PEJ A;  2ZUA A;  4FS2 A;  4UY8 5;  5IS2 A;  2V4Q A;  6FD1 A;  1IXK A;  4P73 A;  2FC9 A;  4NE9 C;  2OPP A;  5A8R B;  3P5B P;  4USU A;  4Y2M A;  4C2M A;  4JP8 A;  1JIH A;  3KJV A;  4LFA F;  4LSN B;  4DMZ A;  1A7G E;  1CBK A;  2E1P A;  2GJF A;  3BN4 A;  3D54 A;  3N01 A;  2F5G A;  4QWB A;  2ROP A;  5DO2 A;  3S8S A;  1D9D A;  2G0J A;  1RHU B;  2V2V A;  2HEK A;  1KVI A;  2CNO B;  1FRX A;  4JV0 A;  2NXC A;  1CG2 A;  4PG8 A;  5DZ7 A;  3CC2 S;  1EP4 A;  4KJI A;  3N4W A;  4E8U A;  2UVU A;  3G6V A;  5J1P A;  2FLO A;  1PJ7 A;  3BRE A;  4DR5 F;  3UR0 A;  3MEC A;  2MY8 A;  4ZPB A;  5IM0 A;  1K8A T;  2AYB A;  2YNI B;  2R2R A;  2CZV C;  4LRE A;  4U96 A;  3H90 A;  2JFD A;  2UXC F;  1DTT A;  1RCX B;  2OTL S;  1ROF A;  5GMK a;  4FVC A;  1D3W A;  2RNE A;  2VG7 A;  3NNC A;  2JC0 A;  1HBU A;  3IBC B;  2XNQ A;  3BEG B;  3TUZ C;  3QLH A;  4TY8 A;  2VC1 A;  1VLY A;  1JKH A;  3QT8 A;  3HVW A;  5DG7 A;  1HBN A;  1S4E A;  3V81 A;  3EZU A;  3ZNJ 1;  3MMA B;  3MUM P;  2CPF A;  1UJ6 A;  2Q79 A;  3MR7 A;  1U2C A;  1RSC A;  3UN3 A;  1WAC A;  3SIP B;  2YY3 A;  1FXR A;  4FYD A;  2ZWO A;  4ZCK A;  3IR6 B;  4YR0 A;  4I2Q A;  5KG4 A;  5L39 A;  5KT4 A;  1HBO A;  1RA6 A;  2V50 A;  1J27 A;  2Q6B A;  2W7A A;  4HEA 9;  4WZQ A;  1O51 A;  1X4D A;  2W4C A;  4F67 A;  3IMQ J;  4NLD A;  3SSR A;  2HND A;  2XI2 A;  3KK3 B;  3DHX A;  4DR1 F;  1QSL A;  1Z2Z A;  3O2I A;  2ZWP A;  3M9M B;  3AOA A;  4OX7 A;  2ZOG A;  1FX4 A;  2W25 A;  1ZAW A;  4DSJ A;  7AT1 B;  5LJ5 Y;  4FPI A;  5A0Y A;  1U1P A;  4JI2 J;  1PAU B;  1DHM A;  2O67 A;  1IUJ A;  1Y3K A;  2IIH A;  4KO0 B;  2LDY A;  4ED0 A;  3CUL A;  3SXL A;  2ADC A;  1KRP A;  1Q1K A;  4QYR A;  1S9F A;  2GJ2 A;  2WBM A;  1NSQ A;  4ZHR B;  3BJY A;  3PY8 A;  1MNE A;  2R2T A;  3R2D J;  3CXC R;  2JC1 A;  4CM0 A;  1H74 A;  1GTH A;  2W4P A;  1GX6 A;  2W9C B;  1SXL A;  3UN5 A;  3BO3 A;  2A6M A;  1PIE A;  4L74 A;  3C8Y A;  1QVF R;  1CUL A;  3X3U A;  4RKU C;  2RB7 A;  1U49 A;  3CNQ P;  1EET B;  4ECZ A;  1OY9 A;  3CJK A;  2RKI A;  2YKN A;  1S49 A;  4D3G A;  4X4U A;  3K5P A;  2VH7 A;  2QSW A;  2XHW A;  2LFV A;  2ZVS A;  2W8K A;  2FVS A;  4QR1 A;  3ZZR A;  3V4I B;  3SYZ A;  3BYR A;  2K1R A;  1RWU A;  2VDI A;  2IHR 1;  3FFI A;  1N88 A;  4BBY A;  1JLF B;  1IVZ A;  3G9C A;  1T9W A;  3TR5 A;  3VF0 B;  4C3L A;  3EGZ A;  2OGU A;  4MAK A;  1BQN A;  1TK0 A;  1ZH5 A;  3LW5 C;  2M3D A;  1URR A;  2KO1 A;  3RAQ A;  1FK9 B;  4E98 A;  1NKE A;  1FJC A;  2DGS A;  3KK2 B;  1U09 A;  1X5T A;  4DL5 A;  3FEX B; 
#chains in the Genus database with same CATH homology
 4U7U D;  5H9E K;  2Y9H A;  4DZD A;  3QRP A;  4QYZ K;  2Y8W A;  2Y8Y A;  1WJ9 A;  3QRQ A;  5H9F K;  5CD4 A;  3QRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...