5H9FK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target at 2.45 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
159
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHDFLFHVEKCHVLLQSAQMPSTAVATVIKTQVEFQLQVGVPLYFRLRANPIKTICRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/rna
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 21
structure length 159
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9fK02
3QRPA 3QRRA 4DZDA 5CD4A 1WJ9A 2Y8YA 4QYZK 2Y8WA 4U7UD 3QRQA 5H9FK 2Y9HA 5H9EK
chains in the Genus database with same CATH superfamily
3AXKA 1UA1A 2JFDA 1OSDA 2K3KA 2KL8A 4AE5A 1IN0A 3I5AA 4DN9A 3D1OA 2WCXA 1ACMB 3VVUA 1TL3A 2OPRA 2UXCF 4O23A 4HT5A 2IJNA 5JMNA 1IBLF 1YJWS 2DH8A 3HCXA 3J80Y 2D7SA 3BPSP 3WHIA 3C6UA 4OMFG 2H48B 2RD5C 4MH8A 3M7VA 1FXDA 4EO6A 3GP9A 3MWBA 2HLUA 1UVNA 1TL3B 3M1VA 2OPRB 4FYYB 4NXMJ 2GO8A 1TP7A 1RT2A 1M1KT 4J9RA 2QA4S 3H98A 2RE1A 2BE7D 4EYHB 3DOKA 3CGIA 2CQPA 1D8ZA 1SKUB 3C6UB 1ELOA 1FFSB 4NEYA 1IKVA 3M1VB 4KHPF 4RW4A 3AQOA 3JAMU 1RT2B 2HQCA 2DNKA 1GFWB 4LF6J 3GV8B 1ZAWA 4OV6A 4QWDA 3DOKB 3PX0A 2UXBF 2F65A 2LA6A 3MOJB 3MMBA 4JP8A 4QW8A 5GVQA 4DZDA 4WFBQ 1IKVB 5ETNA 2CXEA 4RW4B 1Q4RA 5EWGA 2ZHAA 4B9SA 4J91A 4ER8A 4B9UA 1HWIA 4P52A 1ZPVA 1BHNA 3G6YA 2DY1A 4TVAB 4X84A 4EFAC 4BC9A 4NCBA 3MMBB 2LXFA 3TA1A 4QWBA 2CZ9A 2VB6A 1MN7A 1SQFA 4P2SA 5HMZA 5CH7B 2OJ3A 1SL1A 2FLPA 3QPIA 1OSCA 3LP2A 4ED7A 3H20A 1T95A 3C19A 5D15A 1YJRA 1FRXA 1YHQS 3ENAA 2DHGA 4V19X 1J27A 5J2QA 5FIIA 1SUQA 2XI2A 3TVYA 1RAIB 1HL6A 2HBYB 4TU9A 2Z2ZA 5KG0A 2VC0A 3SI8A 2ATCB 4EBEA 4DCOB 3LP2B 2J9EA 1XNRJ 2IDEA 4Q5VA 1CC8A 2EI5A 3T1YF 1U49A 4CCHA 3QAEA 1S59A 3KJNB 3SSRA 4BS2A 4QPTA 5J2QB 5CD4A 1RWMB 1SUQB 3KXDA 4ED6A 1EETA 3G9CA 1H2VZ 3GG1A 4MAKA 4ZVTB 1NJXA 2DXDA 2NREA 2KDOA 5ETOA 3NS5A 2HHUA 5KFZA 5KG3A 2Z2YB 3JSRA 1Y3JA 4G1QA 1NSQA 1MROA 2Y0SD 3OVAA 2BJ9A 3AJ1A 1CQMA 4R8UA 3PKYA 1WF0A 1EETB 1U26A 4RUCA 2WONA 4CNYA 2HK3A 2FHKA 2HFNA 1PC5A 3TW0A 4G1QB 4X4VA 1MROB 4ZP9A 1Y4ZB 1U1NA 3FZ2A 1B3TA 4R8UB 1O0PA 3HPOA 1HBOA 3AOAA 4NMLA 5A76A 3J7YU 2WONB 4FF3A 1PAEX 2R8JA 4A8OA 1S12A 1RA6A 1HIYA 2E9TA 1KD1T 4CO2A 1HBOB 1WC4A 1SJFA 2BJ7A 1DAXA 2V4JA 4CO5A 1G3OA 4QIVA 4Z37A 4JV5J 2Z8QA 2HZVA 5ITHA 1DRZA 2Z2MA 4KRWA 2I5JA 2YWFA 2OPQA 3CCJS 3L7OA 3HO1A 2JNJA 4MYUA 2V4JB 3IWXA 4DQPA 4I64A 4ED1A 4ZCIA 1MSWD 1N48A 2XLIA 3B54A 1GXLA 1EP4A 3OVSA 4OX8A 2LYVA 2I5JB 1OPIA 1YTYA 2Z56B 2HIQA 2EFPA 2QSWA 4ZS6A 4P7TA 2OPQB 4C8LA 4NA1A 4OJGA 2HRYA 3TZWA 3BR9A 1RT6A 3R97A 2IMWP 2LKZA 5F8MA 1EP4B 5HK4A 1K9MT 2F4FA 1R0CB 1S79A 4ZVEA 3WIVA 2IDLA 3OL7A 1SKRA 1HBUA 3JQJA 4LRAA 1DFDA 4KGZB 3E3XA 4I67A 1RT5A 1O5JA 1U0SA 2L41A 1BQXA 1RT6B 3G6XA 4USWA 2F8EX 4A8WA 1S1TA 3NEKA 5RUBA 3OHAA 3JTPA 3NRBA 5KFAA 5IT4A 1R27B 4DV1F 1HBUB 1IBMF 1RT5B 5KFTA 2ZWPA 3BYPA 4NWBA 2FYXA 1HNVA 2ZH4A 3M4XA 4AD6A 2XO7A 4OJ3A 4PG5A 4IDKA 3W5XA 1S1TB 4GVBA 3PKMA 1S77D 4AXJA 1FXRA 4JI4F 3AB2B 3UDCA 3D5MA 4OX6A 2DRAA 2GAGC 2XHCA 3G96A 4DR2F 4DV5J 2CPJA 3D0HE 1T11A 3EE3A 3DRSA 1HNVB 4I68A 2LEBA 2GCFA 2FY8A 4ZVGA 1Q82T 2JJ4D 4IDKB 4OZNA 4GVBB 3QJPA 1FDNA 1OQ3A 1FD2A 3ISZA 1TL5A 1G4CA 3N4WA 3CCSS 1QAJA 3WBZA 3HHEA 2WK4A 1N5YA 1ZA1B 3QYYA 3DRSB 1VQ6S 1TL7A 5GAHU 5H9FK 1RBOB 3MR2A 2KU7A 1S6OA 2KT5A 2ASYA 1U8SA 1RBAA 1N5YB 1QAIA 4ZPTR 1XR6A 3VV2B 1TL7B 4UOFA 1EZZB 3CT9A 2W1BA 3ILIA 3LGNA 3MAQA 2BKNA 2VKZG 3RU0A 2H4YB 4H4KA 5DDOC 4OX9F 4DUZJ 2ASLA 3BH7B 3LANA 1R6YA 2MQOA 4ZIWA 2LMIA 2A0FB 3HHDA 3FRYA 3IWLA 5J2NA 2JEGA 4ECQA 4LFAF 4QIEA 3BM7A 4DPOA 4F4KA 1ULRA 3K59A 4B17A 2WVDA 2BEFA 1CVJA 4KO0A 2M3DA 2NSBA 2A2CA 3NLCA 3OHBA 2QA2A 2IM0A 4GO7X 1NH8A 3QGGA 5J2NB 1VJWA 4N8NA 1GH8A 4RUBA 3D68A 4QR0A 3EVMA 4KO0B 1X4GA 3FUYA 4ZPBA 1RU1A 4DUYJ 2Y9HA 4RW9A 2D9OA 3PACA 3MPYA 4WKYA 1KS2A 3MZIA 5B0BA 1RWWB 2YXLA 1SBRA 5T14A 2AWZA 1D8YA 4LVNP 2C3YA 2RU9A 4RJVA 2E7XA 2X1FA 2FUG9 1NHVA 4ECSA 1C4CA 4A8QA 4DF8A 4E98A 1UZHA 1NDCA 2NXJA 4RW9B 5AXLA 2QA4G 4K4WA 3J80U 3A1YG 2PEBA 4USJC 4CH0S 4Q0BA 3ZZYA 2G1DA 4C9DA 3TJ9A 2QL5B 2R3VA 2ERRA 2ZFHA 1FRIA 1HHQA 1VDHA 4ZN1A 3KJVA 3A13A 3OBIA 2XSJA 3FBBA 2GO9A 1F5CA 1VYAA 1WD6A 4Q0BB 1RU2A 4DV4J 4NLQA 5JUMA 2DR8A 3P3DA 4C8NA 2W9BA 5HP1A 5B0FA 3OW2R 2E1AA 3TO8A 3KJVB 4IUFA 3MM7A 4LBHA 2XC9A 1ITPA 2XSJB 3D1QA 4U6PA 1YZ6A 2MQMA 3VAKA 2N3OA 3EGNA 3FK4A 4DX7A 2PT0A 4QIGA 3BKTA 5HJXA 1RTIA 3TRGA 2W9BB 5HP1B 4ZCLA 3I9V9 5J1NA 4CZCA 2HWTA 5AJ3J 1NZ8A 3IC1A 3HMJG 2DNPA 3MM7B 3UD5A 1IWAA 3DLKA 3TAPA 5B7WA 3PIOQ 4L73A 1RDRA 3BDPA 2XCPA 1R6VA 1N88A 1U25A 2FC8A 2E1MC 3W63A 4FKYA 1DQAA 1GQEA 1RTIB 1HLWA 4ECZA 2RDIA 3KG1A 2XHWA 2I0XA 3O5TB 2E5IA 3MR3A 3BO3A 3DLKB 1L3UA 3G2XA 2R2TA 4AXIA 1FX2A 3K17A 3PVXA 1WKLA 2EK1A 5KG7A 3LQVA 2EWHA 3UO0A 4JV1A 3DGPA 2FJDB 2LU2A 5U47A 1J5EF 4FP9A 2WAQD 1WOPA 1RK8A 4ZCKA 1WTBA 3TZYA 2O67A 2XMAA 1S7IA 2L9DA 2J8AA 1QE1A 4U7CA 3EUNA 2VG7A 3DGPB 1F60B 3Q8SB 1SB6A 4LR9A 1T9YA 3JTOA 1HWKA 3OTCA 2RB7A 3EVOA 3Q22A 3JSBA 4AQYJ 3HFZB 1VGYA 3P5BP 1RAEB 1YJVA 1QE1B 5E3CA 2UUTA 3DI6A 1L3VA 2KVIA 2VG7B 4DEZA 3W5ZA 1FHTA 1TU0B 2AYMA 4C6AA 2J5AA 2LQ9A 3NXZA 2IY5B 4DWIA 1H38A 4UQTA 4F04B 5DZ6A 2BKOA 3DI6B 1IBLJ 3MMJA 2N3LA 3SSQA 1VQPS 4IR9A 2HLTA 2JL9A 4DS4A 4QYZK 4O3PA 2WSEC 3UDEA 4ZKAA 3KNAA 3D2WA 2AX1A 1XMBA 2PMWA 2B4OA 3GTYX 1WORA 4LIWA 2RU3A 1AUDA 2F8MA 5DG7A 2PFFB 4F4WA 3A3PB 4F4YA 2I1RA 5A8RA 3Q24A 2MQ8A 2ZJRQ 2GIFA 1IBKF 3IM8A 5ETMA 4KHPJ 4Q43A 1NU4A 2AJ0A 4C3LA 4JUZA 3CC7S 3QZ7A 2H9ZA 4P2MA 2QSFA 2QE5A 4K8RA 1LWFA 2UXBJ 3D7SB 3OLAA 3LOUA 3LAKA 4CLWA 2CVEA 4ELUA 2CJXB 5A8RB 4G1PA 2UXDJ 1NXIA 2ZWOA 3IXQA 3VF0B 1F6TA 2P8IA 2RRAA 2NPIA 1HNXJ 3FEZA 3RBZA 4FN5A 2MXYA 4CT8A 2M7SA 3W7BA 3ZTSA 3EDQB 2ZH7A 1LWFB 2XG8A 1AB8A 1H98A 5HI7A 2AV5A 1NK0A 1TKDA 2RF2A 5L8RC 2QL9B 1HQ2A 5CAAA 4DR6J 4ITSA 1PSDA 3RUBL 3CF5Q 4IOAQ 3DLHA 3QBCA 4OZJA 1CEZA 4CH1A 4FYDA 2VG5A 3Q8UA 2M70A 4Q8FA 3RAMA 1NO8A 4I0WA 3VHQA 3FBCA 4USKA 2BE9B 3VALA 2RF2B 3MCNA 2YQ3A 5HMYA 2NUHA 4J5OA 4QR2A 4J9SA 2VG5B 1FDBA 3NKYA 3BSCA 4B3TJ 1S7HA 5I4MA 4DN0A 5DETA 3HSDA 1WEZA 3EM1A 1WF1A 2VL1A 1MG7A 4YS2A 3IAS9 5JVHQ 2D69A 4F0KA 4ANEA 2Y1JA 1B0TA 3IN5A 2J0QD 2BW7A 3HVWA 1MLAA 4NRUA 4JI1F 2DBBA 5LJ5Y 3UN5A 2OELA 2V63A 1GK8A 3FCHA 2DISA 2ZC4A 2HRUA 5H9FJ 5KFUA 3JS9A 3P96A 5IT0A 1F2GA 1RWKB 2B7BB 2J7KA 4KGXB 4K4VA 2CG8A 4NXNJ 1X5TA 3ZZOA 3LGMA 5L1IA 4TLQA 2A2DA 2VFRA 3H2LA 3NCQA 3UVJA 2KT3A 2NCKL 2EXUA 2V67A 3RBDA 1JIHA 4C11A 3FEYB 4HTJA 2F7VA 4NZ7A 4C0HA 2LEPA 2KG1A 2AW0A 5KT5A 3G82A 2K06A 1TR0A 3UVJB 4DQIA 4ZLNA 4TYAA 2RAQA 3QFHA 4DV3F 3ETMA 5HVFA 4ZITA 3RW6A 4C11B 5AE3A 1UVIA 3I32A 4LF5J 1DARA 2UV8A 1VQ4S 2QFIA 2J6TA 3MM5A 1VI7A 3G82B 2RS2A 4DBQA 4URSA 3CSKA 4IH6A 1NJWA 1HI0P 4A8XA 3NAHA 7FDRA 4J9QA 3IG1A 2V2KA 4DV7F 1D1UA 2VBYA 2YNFA 2JDJA 5A0YA 5L9XA 2MZTA 2JEJA 4X65F 3HSJA 3IRXB 3MM5B 3EGVA 3GJTB 2FHMA 1UZDA 1APSA 1K44A 3IG1B 2AF6A 3M6WA 2KZMA 1HWLA 5J2PA 4K5RA 3R9LA 4NLDA 2YNFB 5A0YB 3CCES 4DR5F 4O3OA 2HVZA 2B0GA 4NL5A 1MMDA 2R42A 2I6WA 1PJ6A 2XMUA 4KBIA 5J2PB 3QJLA 4QWEA 4ELTA 4I6YA 5IT9Y 4JI0F 3GB0A 1KBRA 2E7WA 1FJGF 4A4JA 3CMES 2P9CA 3M8RA 1WWHA 2XTJP 3DLJA 2XMWA 2V8HA 5LXYA 4N76A 2J0WA 3FJ2A 3VCDA 2ZJQQ 3R6LB 4X62J 3DOMA 1Q7YT 5CYQA 2C3MA 3GFYA 1KTQA 5LM7E 4JI4J 1WJ9A 1FVQA 4LF1A 3QRQA 1WHXA 5I3UA 2B9WA 2LFVA 3NAIA 3CCMS 4NCGA 5IQ6A 1C0UA 1BE4A 1VQ7S 1S0VA 2C2OB 1IM6A 2XS2A 2BOPA 3RR8A 2R4FA 2MLYA 1VC5A 5IWAF 3DOMB 5CYQB 1YDLA 1UJ4A 4M5GA 4NE9C 4ZLJA 1SH2A 1KFDA 4A48A 2JLEA 5I3UB 4M5KA 1RAJA 4JI5F 3DDIA 4NCGB 1YG0A 2VA3A 1C0UB 2XMJA 3OXFA 4ELVA 3D3BJ 2WRMA 2Q66A 1HI1A 2V8DA 4Y2IA 1NRKA 2D3O1 3G8SA 3HSGA 4IYQA 3ILLA 1KLMA 3VAGA 3QAUA 3MUMP 4OYOA 3VVTA 3GJSB 4R0EA 4QU7A 3QGPA 2OMLA 4DU7A 2ZH9A 2CPHA 3W65A 1UAWA 2WZ1A 3C66A 3J81Y 2ASJA 2IJFA 4P73A 2JEIA 3DXSX 3P45B 2M9KA 5KFBA 1AFIA 4A47A 2IRYA 2HHXA 2MY7A 2DYAA 3VZIA 2UVVA 4P10A 4N77A 5F8NA 1KLMB 2WSFC 4PG4A 3CJRA 2R7XA 2JZ5A 4WP8A 2VPZB 4NZ6A 4ZJQA 4WZQA 3UD3P 4JV2A 2MZJA 5KFIA 5GMDA 3KG4A 2G2YA 1RLDA 2BW2A 3AY0A 2KZZA 3FFIA 1PILA 5D77A 1V5VA 2C3UA 2W7AA 3PJXA 1DJ0A 3SMZA 2OPSA 4ES2A 3MEKA 1TELA 4YB6A 4B3SF 2IVYA 3DDNA 4A8MP 1M5PC 2B7CB 1YJUA 4NEZA 5GAGU 4G65A 3P8BB 5D78A 3FFIB 3T41A 4DQQA 1U24A 8AT1B 2AYBA 2ZH2A 1X4BA 3MCSA 1GMUA 2OPSB 2UUCF 5C2GA 2J7WA 1WG4A 4DV6J 3L3CA 2OGUA 3VAFA 2FJVA 3MEDA 1IKXA 2YNIA 2FB0A 4KB7A 4QYZJ 1HHSA 3ILOA 5KG6A 3GE9A 1N32J 3U7JA 5IXUA 3GILA 2OIHA 3HLUA 1T3OA 1EAYC 5G0RA 3RAXA 4AL7A 1U8WA 4LF8J 3LALA 3MEDB 1IKXB 2YNIB 2QLJB 3A8JA 1W25A 3CJ0A 3FVYA 2C42A 3MPWA 1WC5A 1X4DA 1X60A 2LQ8A 3MEEA 4HR2A 5CZVA 3CWJA 4WFYA 4DOZA 1NLKL 1RAAB 1SIZA 3TAQA 3SQGA 5K8OA 4PZVA 4DR1J 2ALYB 5G0RB 5DGAA 4K50A 3K7RA 3KUEA 1CC7A 2W01A 4TNOA 4TN2A 4ZPWR 1T3NA 4ZOSA 2QN6B 2ASDA 1YX2A 3MEEB 2VJUA 3FMWA 1T94A 3PV8A 3Q89A 3PR4A 2UUBF 4NYOA 3HD2A 4QCLA 2G0JA 3SQGB 1EHWA 2GMLA 2JLGA 4RUAA 1YK9A 5LMUF 4RWXA 2XGQA 2VQFF 3PYFA 4WIQA 2DNHA 3T1AA 3C8YA 3NBPA 2BVZA 1I94F 3I55S 4DL4A 4TLRA 4N41A 4IO9Q 3ZZUA 4OX7A 4X66F 5ETVA 2QLFB 3OSPA 2G0CA 1R0BG 2QV6A 1SH3A 2AIRB 1IUJA 2K8GA 2ABYA 3NBPB 2YPZA 2MZSA 1F2HA 1Q8IA 4OI0A 2RQKA 3U02A 2MSSA 2PN6A 2GJ2A 1C1CA 3HK2A 2J9DE 1IQTA 1RHKB 1N34F 2XWYA 3SXLA 3ZO7A 1FDAA 1I51B 1QM9A 3TYTA 4PEOA 1MN9A 3KMSA 4RNMA 3GZ7A 3I87A 2P9GA 2DCLA 1YVFA 1U47A 5KT7A 1TKTA 4I2PA 1C1CB 4ZP6A 3E01A 3MCOA 1RYRA 5HO4A 5KT3A 2VUGA 1HBMA 3PFOA 3JTNA 1H2TZ 2DNYA 4M5DA 4DZ6A 2DRBA 1HD0A 1S48A 4FKXA 3M2VA 3TP2A 3ZTQA 3D6HB 1TKTB 5BR8F 4I2PB 3FCVA 4ZVQB 1KQSR 1QSLA 3E01B 2RT3A 4L74A 1M5HA 5J2MA 1NBEB 1HBMB 2DD8S 3Q23A 3LP1A 2CYYA 2QL7B 4M5DB 3PZPA 3RGIA 5GADU 3SZ2A 4OI3A 3BYRA 1FO1A 5HVHA 3M2VB 4LIRA 2XYHB 1JWWA 2QFJA 1VFJA 1WSVA 2UVWA 3CB4A 5J2MB 4DFMA 1AZSA 3LP1B 4H4KC 4G6VB 1HNWJ 1RKJA 3LWLA 4CRJA 2KHDA 2HHHF 3PHTA 2E9RX 3PRBA 4CTAA 2DRDA 2EPIA 3CC4S 1SCJB 4TU7A 3PX6A 3R7NB 5L38A 1AZSB 1K0VA 1NK8A 5LOQA 4B3RJ 1U1LA 1WHVA 4RKUC 3BSNA 2JEFA 2VF3A 5F0WA 3SQOP 3RJMB 4P74A 2H3EB 4CTAB 4RBUA 3L9ZA 1PAUB 1IBKJ 1VHIA 4DS5A 4F2RA 2IIHA 4ECXA 1G2EA 3TJ8A 4YR2A 1KWMA 2R9LA 2OHDA 1C2PA 2I9SA 1OIAA 1FWPA 1RACB 5GMEA 1WI6A 3PJ9A 3V4IA 5B0DA 1TL1A 3I9ZA 2IRXA 4ZIVA 5KFLA 2RIJA 3HD1A 2MSTA 4ZP8A 3V4IB 5D0RA 2XM3A 2KYXA 3JYTA 4LT6A 1R8HA 1TL1B 4TYBA 2ALZA 2B6AA 2BJDA 5D4OA 4QR1A 2UVRA 2CJ9A 1S1WA 2M2BA 4PXCA 1A6LA 5HQ8A 3TJAA 2DGUA 2FIUA 1F9HA 4QZVB 4PYAA 5E41A 4FYXB 3HM9A 1Y0HA 4IOBA 5IT9U 3JYTB 1GMWA 3I82A 2IBOA 2B6AB 3CCQS 3ENWA 1XNRF 5EN1A 4PYDA 1XERA 2VPYB 2AYGA 1S1WB 4DFPA 4OZ2A 1FKAF 1PG5B 2CNOB 2BJ8A 3MGJA 4CQ1A 1KQFB 1YITS 5D6GA 1HNZF 4DV2J 4M5JA 2E5HA 3G86A 5I42A 3KDNA 5DM7Q 3W8GA 4JI1J 4KKOA 1NSPA 2LQJA 1RAFB 2A3JA 3O2IA 2H54B 4L72B 2HG4A 4ECWA 4TQSA 2V2ZA 3CCZA 2PI4A 1T7PA 3GJQB 5I42B 5CXTA 1RADB 3GR1A 4WKRA 4KKOB 4WXOA 2XMMA 2XZDB 4C8KA 3M6XA 2MQNA 1FRJA 3AXMA 1SH0A 3IGVA 2F9JA 2WW4A 4DPXA 2M88A 4RR5A 1AA1B 3PX4A 1SXLA 4C3KA 3W2VA 1VBKA 4G3IA 1CULA 4DV3J 3BBCA 5KOWA 3J81U 3ZZPA 4FS2A 1YJNS 3BH6B 2V94A 3Q86A 3TR5A 1VIOA 3M8SA 2ZUGA 3FC9A 3W2VB 3KHHA 4B3MJ 2AEMA 3RRHA 2M4MA 1CULB 1U48A 1WDTA 3E51A 4K4SA 2A18A 2P2CB 4X4SA 3P6YC 3OL8A 3FDSA 1MWZA 3HZEA 2YKPA 1RABB 1MWYA 2COLA 3ZTOA 3I5BA 4X65J 5LT5A 4XTTA 4ZVSB 3Q8VA 4LRFA 2P9EA 3RB6A 3CD7A 4ZK7M 2CJQA 4F36A 1W26A 4N7TA 1KHWA 4F0HA 3MCMA 3UNYA 2HIYA 2VH7A 4LRBA 5D0GA 4OZ1A 3MAAA 1VQ5S 2ATLA 4WIIA 1JXLA 3UW1A 5K8MA 1JLFA 4YDXA 2GIRA 2NR0A 3TA2A 1JB0C 2DXEA 5L1KA 1M5SA 1BWEA 4I6WA 4OL8A 4E0DA 1NPPA 2V68A 1GNKA 2C1EB 3MAAB 3MFHA 1FJGJ 1ZAXA 2RRNA 4OYZA 1JLFB 2JC1A 2DPIA 1ZYQA 3FQLA 3MPDA 2FVSA 4BHQA 3W64A 2IVMA 3V5RA 3O6QA 3AA8A 3MPUB 1SJ3P 3CJQA 1S1UA 4CLLA 3OLBA 1FVSA 5GAEI 4X4RA 5EDWA 2XY6A 3C6TA 2ZM6F 3WIUA 2FZKB 4DI6A 1WSRA 4HHUA 5BJRA 3D1HA 1JQGA 3R7SB 1BY9A 1S1UB 2XI3A 1RT3A 4FZVA 3C6TB 1FNMA 4CYUA 3GYNA 2MLZA 2D3ZA 1W2BR 1R89A 1WEYA 5BYQA 3K58A 4Y0FA 4WCEQ 3PY8A 4P75A 4RBVA 5IC4B 4M5LA 5HQMA 1JLGA 3Q2SC 2ZDPA 3NMRA 1RT3B 4CLZA 4I69A 2PEHA 2E29A 2AGQA 4CYUB 4ENOA 1S4FA 2C2NA 3IGNA 3QT7A 4DLGA 3QGHA 2W2PP 1UMJA 1JLGB 1S9EA 1RAGB 1M5OC 4XPEA 3GMGA 2EBGA 2F9DA 1X4HA 4YB7A 4X4UA 4LSNA 1RZMA 3ZC4A 3AH6A 2PC6A 1ZTWA 3A3NB 2BDPA 1ZM3A 3CUNA 1S9EB 2ZBPA 5HROA 4UOGA 2XLKA 5AXKA 3ET6A 4LSNB 1DTQA 2KRBA 2E9ZA 1R8PA 3A4TA 4KFBA 5M2RA 4CH7A 3AJ2A 1KOHA 3PCOB 3KDOA 4Y00A 1XMOJ 2GC8A 1Y10A 3TARA 5HROB 3AT1B 3S8SA 2BRLA 2BQRA 5LL6d 2UUCJ 3ET6B 4CO3A 3Q8YA 5HL7Q 2QYCA 4F2SA 1DTQB 5CYJA 3D0GE 4OYIA 5B08A 1YI2S 4KFBB 1M1GA 2VC1A 8ATCB 4M63A 4P71A 2VPWB 1Y3KA 3HULA 2BR0A 1IJEB 1WC1A 4UF4A 2IM3A 4KC5A 2H5EA 4LF4F 3POTA 2R2RA 3H2VE 2JOQA 1PO6A 2YX7A 2HKEA 7FD1A 2PO4A 2QLXA 3KLIA 4HH0A 3WDOA 5KG5A 4M5IA 4DPTA 2FLOA 4ZN3A 4FXDA 4QIWD 4MKYA 7AT1B 2FLLA 3MURP 2HWHA 3MUVP 3POTB 3FMBA 5K5MA 4ZPAA 2G1HA 3AAWB 4KIAA 5E0OA 5H1SV 5HVGA 3KLIB 3JB9k 2UUBJ 4MKAA 2BBEA 3JQKA 4DMZA 1NCLA 2SXLA 3OTOF 5HATA 4QW9A 2AP6A 5E33A 3MOZA 5KFRA 1PBUA 5I3PA 2DGQA 1WNEA 3CCTA 5G4DA 4NLOA 2XLJA 1VHFA 3G6VA 3W62A 1JKHA 5BYRA 2VQFJ 4ALZA 2Y0BB 4RLEA 5EWFA 4U7UD 1LW2A 4FF4A 1RHQB 2LA4A 1HD1A 4F25A 2KH9A 4AFFA 2VBWA 2F40A 1UVLA 4OYAA 5AJ3F 4O0IA 3RAQA 2YKMA 2POKA 1H0HB 1Z1ZA 4C8ZA 2CQ2A 1U0HA 2CZVC 5KFOA 1JKHB 3BGOP 4Q45A 2HHWA 2NQPA 4IH5A 3RBEA 2V8PA 2CNNB 2BACA 2BJEA 1LW2B 1RP5A 1M5VC 3N5FA 5DG9A 3BJYA 4ID5A 3AB4B 4DLEA 5KFHA 1JXVA 3G6ES 4Q2MA 2YKMB 4QIFA 4WU3A 1GT8A 4DSJA 1WELA 1FEEA 3C16A 1U0HB 3BDEA 3H59A 3OL6A 4ED0A 3J7A1 3HVTA 2EW9A 5FLXY 2GVZA 1HPZA 1PIEA 2VG6A 3GYGA 1D9FA 2MHEA 4CM2A 4ID5B 4WFZA 4BBYA 1YBAA 3I31A 1XMQF 4PG8A 3C16B 3N6NA 1VJQA 2GQ2A 3N5BA 2C3OA 3KLHA 1VQLS 4GKKF 3OQ2A 3HVTB 1CSJA 2ACMA 2GVZB 1HPZB 2VG6B 5ETKA 2MKIA 3PO4A 2BRKA 5L1JA 3PM9A 3LAMA 1KKHA 4KGVB 2XS5A 4AQYF 1LWXA 2EEYA 3KLHB 3FSXA 3BGFA 1G1XA 3HJFA 1NK4A 1FEHA 2MYFA 4ED4A 2YWEA 2FY1A 1FTRA 1S49A 4PQAA 4P9SA 5EHHA 4RO0A 4Y65A 3HSZA 1FJEB 2QIFA 4NI2A 3MMCA 2NXUA 3HVRA 4KE5A 1PYTA 2HHTA 1A7GE 2NXEA 2HHHJ 3BSOA 2AEJA 4ILLA 2AGPA 2KO1A 1FRHA 2BZ2A 2V8VA 1Y5IB 4NI2B 3M8PA 3DU5A 3MMCB 2HVDA 4EMDA 1N36F 1WOOA 2HK2A 3QNWB 3M05A 1PKUA 3OD2A 4J9MA 4TY9A 4A8SA 4JI2J 1Z2ZA 2QT7A 3CJ4A 4JYAJ 1BUXA 1QAYA 2HFUA 1NMEB 3M8PB 4YHHJ 3VAJA 3TI0A 2HAIA 3IR6B 3PIPQ 3NGSA 1QTNB 4HVZA 3C15A 2CQGA 1MU2A 2VPXB 2W2MP 1GTEA 1H73A 3T9NA 2LU1A 2UXDF 5IQQA 1D09B 2HURA 2XMKA 2ZNYA 2CJYB 1HNXF 1VMBA 5I3QA 3MF5A 3SV3A 2WBRA 1RT1A 3U27A 2GVDA 3TANA 3C15B 1MU2B 4JI7F 3T9ZA 1ZM9A 4QOTA 2B51A 1NUEA 3HHNB 3NS6A 3OFGA 3GIJA 2P6TA 4DR6F 3KMQA 2E7VA 1NJZA 1Q78A 1S99A 1RT1B 3PG9A 2GVDB 2QX0A 3TVKA 4E2FB 1I3OB 1NB7A 3QATA 2FDNA 1RTJA 4J7CA 1QAXA 4DSFA 2VU5A 2L3MA 2VONA 3UPFA 3MR5A 3IBCB 3I4HX 2EK6A 1R8CA 4WK3A 3G8TA 2AGOA 1RXOB 1V9OA 3BKUA 3NGUA 3H4DA 4B3TF 2DR9A 3B4DA 4YN3B 4BC7A 1RTJB 2XNRA 1AXQA 2LDIA 3R7BB 3BS9A 3M8QA 3EICA 2VKRA 1C1BA 5HMXA 2KI2A 2ROEA 3GFZA 2B9YA 4OI4A 2CIMA 4NYPA 1HNZJ 1SJQA 3ETOA 4LR8A 3MXHP 1TQLA 2HBQB 3QRPA 2WW8A 1EKRA 3M8QB 2DKOB 1C1BB 5D4LA 4ZVUB 4Q8EA 1MMLA 1NEEA 2Y1IA 4ED5A 1BQNA 5ETTA 1VRQC 1QVGR 3WC0A 2JLFA 3QWPA 4NXNF 3IMQJ 3KHGA 1WG1A 3DKDA 4WFXA 3BF4A 4B08A 1ZM4A 4U9RA 4L6V3 5K14A 2DT9A 2WVFA 2ROPA 3C14A 4C0OC 2CWKA 3CJ5A 4AL5A 3TUJC 4J9LA 1BQNB 2F5GA 1H6KX 1LFWA 1IJFB 4LSLA 2BM1A 1NM2A 4EEYA 2HAFA 1S1VA 1BLUA 4IO1A 4ETZA 3NGRA 2IM1A 1W7WA 5K8PA 3KK2A 5K14B 3C14B 4K2XA 3DOLA 2N82B 2VFVA 2R2SA 2R8HA 4LF5F 3CXCR 2ZEJA 4OI1A 3TNVA 4LSLB 2HHPA 4DU8A 3BB5A 2VICA 2J9CA 2LQ5A 1S1VB 2OI2A 4Z2XA 8RUCA 4RPFA 1FT8A 2EFOA 3KK2B 1TKZA 4X4PA 3DOLB 3AODA 1IR2A 1Q5YA 1PJ5A 3O3LA 4KHMA 2HNDA 3PW4A 2L9WA 4IKAA 1XN9A 4F3OA 2PSZA 2MGZA 3CO0P 1KC8T 1UEUA 4R25A 1TUVA 2BABA 3GR0A 3W60A 1TKZB 3HT0A 2FVPA 3OFEA 1XWLA 3N79A 2HNDB 1R0AA 5DZ7A 1EQ0A 4YB1P 2AHOB 1TTHB 4ZMMA 2MGZB 1R8AA 3NMAA 1ZH5A 2X51A 3K5OA 1LK5A 2CPFA 2W9CA 2IYIA 3PW7A 2Q6CA 3CJ8A 1YJTA 5KFCA 3NL0A 1R0AB 2BUNA 3BR8A 3KHRA 2Y1RI 3SBMA 1SC3B 3V6DA 2NUUG 3OTEA 4CIOA 3M9OB 1I1GA 2W9CB 2M8DB 3T6BA 4ECYA 3W5YA 2JFKA 2ZC3A 3I96A 3AA9A 4OZ0A 3D66A 1LFPA 2I38A 3V6DB 4X62F 4AYBD 3OVBA 2UUAF 3ITHA 1RWUA 2F63A 3T1HJ 2W8KA 2CJKA 4LF9J 4WF9Q 2ZM6J 1RHMB 2Z58B 3PEJA 2V69A 4IG3A 1VQSA 1RKIA 3CNQP 3ITHB 2DJWA 3FBEA 2FJWA 4RL1A 2ZBQA 4K4XA 2XYGB 3TEHB 3EDRB 4USIA 3E2EA 1NNDA 3QMQA 5C7PA 4N47A 2NS1B 4W90B 3QSIA 4IG3B 4J9OA 3J81j 3H42A 3SIPB 2HHVA 1CJKA 3DM2A 4MIBA 4CLUA 2OEMA 4LQ9A 4XDDA 1S0MA 5AE1A 3QGIA 2GQCA 5HSPA 1SV5A 4ECRA 2ACYA 4NLXA 2BXJA 4NA2A 1CJKB 4NOHA 3DM2B 4MK7A 4EYIB 5FLXU 1B0PA 1WF2A 1U2FA 4NLSA 2MKHA 1TUGB 2HYIB 3NNAA 2XMTA 2VODA 2HBRB 1SV5B 1TFWA 3LPEA 2RUGA 4A8KA 3P49B 2D3OR 4NMXA 2ZJPQ 1UJ5A 4CLPA 1ZZFA 3SV4A 1IVZA 1N5VA 3W8PA 1DQ9A 3ENQA 3AD9C 4J9PA 3L09A 4MIAA 1GMWD 4YB5A 3P5TL 2WOMA 2OTLS 3H90A 2DTJA 3I6PA 1X9WA 3W3SA 4U8YA 5KG4A 2W8LA 4DL3A 3HFVA 3KUGA 3PYGA 1GX5A 3GQCA 1VQ9S 3UE2A 2F3JA 3BGUA 3BGLA 2MKYA 4HEA9 2W2QP 3TQEA 2X1GA 4RW7A 2QYGA 3T5JA 4ECTA 4IRKA 2WOMB 4DV6F 4NPOA 5DLFA 1FA0A 1U45A 2CNLB 5FDLA 3GLJA 1SKSA 4QBUA 2AJ1A 4F0MA 1XQIA 1VQMS 1ZZNA 2EC2A 4MFBA 1NKCA 2C2KB 2WSCC 3F0NA 4J9NA 2NYIA 2DNZA 1N32F 1HW8A 2YWGA 2KN4A 4K0KF 4RW7B 1OJ4A 3HP6A 4LF4J 5DQHA 3LTOA 1LOUA 2N7YA 4DQSA 2Y8YA 4LF8F 5FDLB 1XNQJ 2HS4A 2O66A 1QSSA 1T9VA 3UCUP 2ZKUA 1TK8A 3FKBA 3MTJA 4MFBB 1VQYA 2MLXA 5CZXA 4YOEA 4OJHA 4UOHA 2OKQA 4DCJB 5IOLA 4WK1A 2HQGA 1KTVA 4KPYA 3I5CA 1S1XA 3JSYA 3K8WA 4DFKA 3T6JA 4KR0B 4DR1F 4KSEB 3L7PA 2V8GA 1ZETA 1V6HA 1Q81T 5DJBA 2VOOA 1U09A 1CS4A 3EYZA 2HHQA 3CDEA 4YUDA 2MKSA 4Y2AA 3OTOJ 2WBMA 1DTTA 3TOQA 1S1XB 3SCKE 3CMQA 3TUPA 2R8KA 2DNMA 5E7OB 4CLKA 1V5IB 1CS4B 5HMWA 3WQPA 2BKPA 4LJMA 3TQ1A 1OY9A 4FPRA 3H40A 2HFVA 4RX6A 3MD3A 1DTTB 1T03A 1T9WA 2KXFA 3FNNA 2YH1A 1QVFR 4LF7J 3UQSA 2XSFA 1O8BA 1N5SA 4OIXA 4TU8A 1VQ8S 2AJFE 2HGMA 3OR2A 4M95A 4RU2A 1T05A 1YLXA 3PNIA 5KAKA 1CPZA 2MZRA 1HMVA 2C2EA 3THPA 3KJQB 1T03B 1Q1KA 2HMIA 2H65B 3UFCX 2CQCA 2UZAA 1VQOS 2CPDA 4C2MA 4HI2A 3AD8C 1D9AA 3OR2B 5EX3A 2R7VA 1T05B 4OHZA 3A8KA 4Y2KA 4PR6A 5EWEA 1HMVB 2YKAA 2HMIB 3RRKA 1XMQJ 2HWIA 3RYLA 1WC6A 4EBDA 4USUA 1P1TA 3PYDA 2Q6BA 4FYWB 1S5ZA 2NPFA 3IO1A 5E2QA 4GKKJ 2IA6A 3T19A 4ATNA 3QJJA 3K8VA 2NZ4A 4W98A 3R5JB 1SC4B 2AU0A 4OZ5A 1LW0B 3S6EA 4RNFA 2HQDA 4LRDA 1UKUA 3MHYA 1LKZA 4WWSA 1SJRA 3UNGC 2CPYA 4DL2A 2HZAA 4BLGA 4DV0J 2HFSA 4PABA 3OFFA 2N7CA 1QUVA 1UA0A 4C3MA 1X4EA 4E8UA 3THVA 4HACA 4K7QA 4CO0A 1S9FA 2U2FA 4YP3A 3ILJA 5HAOA 4C7QA 1HNWF 1QDUB 1XEZA 1DQ8A 4PKDB 2AJ2A 2Q43A 3FZBA 3D6FB 4ZJLA 1RGVA 4HACB 2EBEA 5JXSA 1U1RA 1GAOA 1L3SA 2UU9F 1Q86T 1FI4A 4B3RF 1IXKA 1GEHA 4NX9A 1MWQA 2KYZA 1N36J 5ETQA 2QRRA 1N5QA 1PJ7A 3K5NA 3T5KA 3EZOA 2Z4PA 4ERDA 3NOGA 2HVEA 1PGZA 2OTJS 3PRDA 5FJ4A 1CQNA 1RI7A 3US5A 3IR7B 4DR4F 1U7LA 1B64A 5E3PA 1FE4A 2J8SA 4OQJA 3S1TA 4DF4A 3VGTA 2GA7A 5DGBA 4LFBF 2HFZA 2VQEJ 4D3GA 2PMHA 3CCUS 4P2FA 4JOUA 3W9IA 5F8IA 1YSJA 4PXEA 1FTCA 1CJUA 4DFJA 2R7OA 4ZCMA 5L46A 4GC6A 3OPKA 2RKIA 3HZGA 2N4CA 3VAMA 2FHOB 4XO0A 2H5JB 3AOBA 1F9FA 3Q0AA 4JI7J 1RBLA 1U1PA 1IR0A 4K59A 1YBUA 2LECA 4UQGA 1CJUB 4F7VA 4WZMA 3CEDA 1FWLA 5ETLA 1JJCB 2RKIB 3MEGA 5SUHA 3GWCA 1X0FA 2JSXA 4YEAA 1TAQA 3ZTPA 2FZCB 2JVOA 2AKWB 1WKKA 1WC0A 3UDLA 1RHRB 1P9QC 1NHUA 5CA5A 2OD4A 4PG6A 2GHVC 4LUBA 3CTRA 4F8RA 5A2QY 2A1BA 4UZBA 5IV4A 3MEGB 5KFKA 2APOA 3RG6A 5KFSA 4NASA 2EC0A 3QT6A 1Q0NA 1HHTP 2IAJA 3CJ2A 1NK7A 1SVDA 4NLTA 3FSIA 2QJ3A 1S6UA 2XZTB 3D0IE 3VR1A 2K7KA 5F8GA 1HQEA 4JI6J 2IAJB 3M8WA 3ZZRA 4DV2F 4C48A 4JI3J 2O1PA 2V9KA 2GMJA 3G8QA 1BWVA 4YMEA 5MLCV 4PWWA 3MTKA 3CIZA 2WB1D 3UDVA 1HQEB 4CLYA 5F41A 1HQUA 2DHHA 2DEIA 1FDDA 4OYXA 1X5PA 3B8HA 3QZ8A 3DFEA 3PO5A 4PWUA 2RH3A 3KNGA 2DH7A 1M1HA 5J1PA 1HQUB 1LWEA 1NZAA 2E44A 2ADBA 1Y11A 3F73A 3RB0A 1PBAA 2F4VF 2FZGB 5C42A 3AD7C 4G1IA 1K73T 1LEOA 3D9BA 3CDUA 2YWKA 2Z0GA 1LWEB 2KXHA 5LSLA 3CCVS 1IQZA 2GJIA 1S97A 4B3MF 3TUIC 3IRXA 2IPOB 5C42B 2YVSA 4MIWA 2HVHA 2W7OA 1VS3A 3GSIA 2DH9A 1K1QA 3IWNC 1HA1A 1SPBP 4URQU 5K20B 4FYVB 5KFWA 3GFXA 1EARA 4M94A 3PW0A 2RILA 1HW9A 4TQRA 4EUVA 3TVZA 4C97A 5KT4A 3NCRA 1HBNA 1ZBTA 4PCQA 5SZTA 2BANA 1KQGB 2ZHBA 4MT1A 3R8YA 2ZBIA 1ZTTA 3NWGA 1CG2A 1FD8A 2MJUA 2K7JA 2YH0A 1HBNB 4FBUA 4B9LA 1FFWB 2V2QA 2QMXA 3J7YI 5CHCB 2XEXA 2BANB 1T8EA 2MQLA 3O1LA 3JXOA 4X4QA 1PYOB 4RNHA 5KFMA 2E1CA 2OAUA 1S9GA 5E3QA 3QFWA 4RUHA 5KFVA 1T0TV 3CPWR 2R7QA 3ZNUA 1BQMA 1JLQA 3BGRA 4PPZA 2XY7A 2X1BA 4J37A 2W4DA 1OYDA 5IFMA 2CQDA 1NDPA 4FPIA 2WB4A 4WP9A 4ANDA 3B4MA 2HRTA 3H5XA 1FESA 5B0AA 2MQQA 3LH2S 2B3TB 1KVJA 1S9GB 2UUAJ 2ZITA 3B78A 5IM0A 3CCWA 3K89A 3RB4A 1BQMB 1JLQB 2GQQA 3BGRB 3O8WA 4U8VA 2EFNA 2Z30B 5DDRC 3RZAA 5AE2A 1J5OA 2VFUA 1KONA 1ZAVA 3DXBA 4O4GA 4H4OA 1VR6A 4OHXA 4P6QA 5IM0B 4DPWA 5IV3A 4I2QA 4DXLA 2JX2A 3NS7B 3D3CJ 3R27A 2E66A 3TZZA 1Y5NB 3M6VA 1J5OB 3M9MB 1XTZA 2W2OP 4O4GB 4H4OB 3HJVA 1A0OB 4O3NA 1RB0A 1HWJA 4I2QB 1RAOA 2HBZB 5ADZA 3DDKA 5F8HA 1DZ5A 2YPYA 4EZ9A 1VISA 4NA3A 3RB3A 3PDNA 4C0BA 1AFJA 4GKJJ 1HWUA 4J9KA 3VAIA 2G13A 1OPZA 3CULA 2DK2A 4CLTA 1RQ0A 3Q8QB 1KFSA 1Q53A 2H1YA 2FJAB 3PJWA 4CM0A 2VJVA 2C3PA 3D6MB 2YKQA 4C8YA 5GMKa 1NKBA 1GMVA 1OS5A 3NOCA 4OYBA 1U2RA 4L75A 5LMNF 2HW3A 2IJRA 4U95A 3H25A 4K4YA 2FVCA 2BE2A 4KTQA 2F8HA 4AT1B 4IFYA 2UP1A 4NLUA 4LRCA 4LBPA 4DX6A 1H72C 4WFAQ 3KLEA 1XMOF 3FSYA 3DLBA 3LWMA 5KFNA 1URRA 3DRPA 4UW2A 2NYHA 1N54B 2FHJA 3F41A 2BE2B 2YQ1A 2ZH6A 5GAHI 4IFYB 4GMKA 1SC1B 3MM8A 3CJSA 4EK2A 1FNXH 1KVIA 3KLEB 4RNNA 2AZ1A 4K0KJ 2CJBA 2GGPA 2OMOA 3R5DA 2E1RA 1VBZA 3DRPB 5THWA 1KR4A 1B4SA 5KFFA 2PFDA 3PW2A 2QLWA 4O3RA 2HNYA 1FJ7A 4J9VA 4CLFA 4I6AA 1TUWA 1ICEB 3MM8B 2HQFA 3SCJE 4DQRA 4Y6IA 5CABA 3KK1A 2G0IA 1RHJB 2GGPB 9ATCB 3FBFA 4DX8H 2KFNA 1RSCA 2VD3A 5B0EA 1P9YA 5L1LA 2GS8A 2HNYB 2LEAA 3FEXB 1DLOA 5C24A 2EFVA 2C2RA 1G7CB 3FGVA 4X64F 4HDHA 3V6JA 1X8DA 3KK1B 2DNOA 4MK9A 3BREA 5D0EA 4KYZA 4URGA 3NP5A 1DLOB 5C24B 3NNHA 4O4RA 4ZP7A 4DCPB 3ZFVA 1VBYA 4ILRA 5CQGA 2FVRA 1JNRB 3TX8A 1N4LA 1TZ0A 4OHYA 2FC9A 3TAMA 4DR3J 2DB1A 3IS9A 2CRLA 4FVCA 5KFGA 2CPEA 1UJ6A 3MM9A 2YBVA 5A8KA 3R2CJ 3R1LA 2C2MB 2P6SA 4M8LA 3TAMB 5C5JA 1YJ7A 3IS9B 5HBMA 4QJVA 4B9VA 4L3KA 5AT1B 4BDPA 3EWGA 2HS3A 2J9DA 1S10A 1P27B 4LSZB 1LV5A 1UTAA 2CQ4A 2CQBA 3MM9B 2Y8WA 2DR5A 4CP5A 5DM6Q 4ZLLA 4ZHRA 5A8KB 1HFEL 4I4BA 3T5HA 4IR1A 2QG9B 4IH7A 5HBMB 1F5BA 1UL3A 5A2QU 4QWCA 3TA0A 2ZH8A 1YJ9S 4XPCA 4ZPVR 2CAJA 1KP6A 1TMMA 1WKJA 2RDJA 5DLGA 4ZHRB 2QC3A 4UUXA 1X5SA 3HHLA 4WYLA 4PG7A 1EIYB 3GV5B 1REGX 4JI8J 1NSKL 1U6FA 3K5PA 2GHWA 4NYZA 4ZVRB 3HKZD 2W2NP 1JLEA 2CQ3A 1XIQA 3M32A 2A6OA 1TAUA 5EGYA 4A8YA 5E5NA 1OO0B 3WC2A 1PYSB 2E5LJ 4L76A 3X3UA 3HHLB 2EFGA 1R3NA 3MECA 1UVKA 1OWXA 2E5JA 3F44A 2YQ0A 3GCWP 5DDQC 4ILMA 1P8GA 1ZS6A 4ED8A 4UY85 4KY3A 1JLEB 3NCPA 5CCLA 3M32B 4F3MA 3ZZZA 5LXRA 1GXTA 5KG1A 4N56A 1NB2A 1X9MA 5D8HB 3CD0A 3MECB 1N33J 1UFWA 1RCXB 5K8NA 3C46A 2LP4A 2IYGA 4XAKA 4Z7YA 1T9UA 4F02A 5C25A 2UU9J 1RWOB 4TKTA 1KNZA 1LNQA 5M2UA 3K2YA 2W24A 3OXGA 1C0TA 2DNLA 4N5SA 3CE8A 5EX0A 2DGSA 4B9TA 2EVZA 1R31A 4JI2F 5C25B 4DR4J 4JYAF 4RU9A 2DPJA 1UP1A 1H3DA 4J90A 3LA0A 1NPKA 4AUKA 3L7UA 4YHHF 3LW5C 1C0TB 4LFBJ 3NY0A 1TK0A 4YY3F 2VASA 5KOXA 3KLFA 3Q83A 2RHQB 3MR7A 2D3UA 2ZZMA 1FXLA 3KLGA 1CJVA 6FD1A 1JJ4A 4LFCJ 2HGLA 2X1AA 1CBKA 4HI1A 3D28A 1L5UA 2B9XA 2W4PA 3KK3A 4ES3A 5FD1A 2P5VA 2OSRA 2OPPA 1Y7PA 3KLFB 3KOAA 1RUSA 5ETSA 1T9TA 3EXYA 1RTHA 2V5HG 1YRUA 1UEKA 4OV1A 3KLGB 1CJVB 3SCIE 5D4NA 1UVJA 1NPRA 2ZNZA 2K1RA 4YR0A 3E8OA 3KK3B 1Y00A 2X7IA 2OPPB 2ZHOA 3H5UA 1RTHB 4F4AA 1H2UX 1P1LA 2JH3A 3R5AA 3KTQA 3OXLA 2K1RB 2UXCJ 4OYMA 3M2RA 2KG0A 1WEXA 1N0VC 2ZH3A 2YNHA 2FTRA 3ZZTA 4NLPA 4PUOA 3CJTA 5JVGQ 1UFKA 1F0XA 1FNOA 2M0GB 3H5SA 2KKHA 5D0HA 1SC6A 1Z4UA 4WTOB 4DPUA 3VQSA 3A12A 5DQGA 5D4PA 1T02A 2LXIA 4ZVFA 2I2YA 1U1KA 2FVQA 3EPIA 1SQEA 4DHVA 3MDFA 3M2RB 2YNHB 4HTIA 4NLRA 1ROFA 4PUOB 4X2BA 1IKWA 2CDRB 2CPIA 4DSEA 4MTPA 3R1HA 3MM6A 2B43A 1AUSL 5DO2A 4OYPA 2PMZD 1FRKA 1HR0F 3SDEA 5JJBA 4CI0B 2MZQA 3M30A 2H5IB 4LF2A 3ZNJ1 1FRLA 2HQ3A 5LJ3Y 1IKWB 4EGLA 1V3RA 2R2UA 3VGSA 3MM6B 3SEOA 1L3KA 3QQCD 2XMVA 4FF1A 4UTGA 2CUYA 1BC6A 3SDEB 4USVA 1JLBA 3GFHA 1FERA 3M30B 2RJZA 3TUZC 3MI7X 2CQ1A 3NNCA 2AT1B 2V34A 4KH0B 1HI8A 2IHR1 4KGMA 3H2UB 2DIUA 3J7AN 1YIJS 3FQKA 4NLVA 2F4VJ 1JLBB 4MKBA 2Y1LB 4I56A 1M0SA 2XBPA 4QQBA 2RMLA 1JJHA 3RRGA 1UWBA 2OFHX 4F67A 1N0UA 1A9NB 3EMTA 2GJFA 1RE1B 3PRVA 3RBXA 3N01A 1KLNA 4CO4A 4M5HA 1FWKA 2PIIA 1VOMA 4ECUA 5DS7A 2ILYA 3SCLE 1TKXA 2HFOA 4K4TA 2ZZTA 1S0NA 1FX4A 2QO3A 2MZ1A 1UWBB 4DUTA 3DMJA 3T1YJ 1ZPWX 2O3DA 4B02A 1X4AA 3ZZ0A 4DJBA 1BXNA 1VIXA 2G2OA 4O3QA 4P72A 1VC6A 3DRRA 4UZCA 1SJ1A 2JVRA 2MQPA 1TKXB 2MY8A 4V19J 2IA0A 1FRMA 2MPUA 3DMJB 3LUYA 2RS8A 4EZ6A 1QLNA 3BN7A 1X0PA 1LQ9A 3OSNA 4XIUA 5DG8A 3DRRB 2N4DA 3K5LA 3MFIA 1H7WA 3LPYA 1S4EA 2IMOA 3S01A 2RSQA 2VFTA 3HVAA 2QTWA 1S0OA 3NGTA 5KTQA 4LQ3A 5D3GA 4TY8A 2DIVA 5F3TA 2OP5A 1SIWB 3BQ2A 3PEHA 2KTQA 2VBXA 4ZPDA 4QYRA 1WUUA 1Y9OA 4EU0A 2XQCA 3T3FA 1YRTA 3WX4A 3N28A 4WP3A 5KFDA 1F5AA 2I8EA 5D3GB 1XC9A 2DGTA 4TY8B 1XK8A 2FLNA 2HVIA 3Q8RB 1U6BA 3NGDA 3J7Z5 2G9OA 3RTVA 5T7LA 4ZA1A 1REVA 2V2VA 2KHCA 3DYAA 3T1HF 3GIKA 3VGUA 3NWRA 4LF9F 3CDBA 1V3ZA 2DR7A 2MKJA 1QTMA 2OEKA 5KT6A 4GVLA 3F56A 5T7LB 1XR5A 1X5OA 1REVB 4ZJOA 2GNKA 3L95X 6AT1B 3CVKA 2JC0A 5GAEU 3DYAB 3EPGA 2XY5A 4BCAA 2QMWA 3EGZA 4USHA 2OFGX 5F0UA 3RR7A 1VK8A 4USTA 2FJXA 4K4ZA 2Y3YA 2GZOA 1IWGA 2XS7A 4WU2A 3H5YA 4HHHA 2WVCA 3KYLA 4IRDA 2LVWA 1B70B 2Q3PA 1FFGB 3NG8A 2DITA 1RWVB 2M5YA 5HJYA 2KM8B 6FDRA 2B4VA 4ANCA 2WTFA 1HNIA 4MJKA 2Q1LA 2RVJA 3ENVA 4YQWA 3GYXB 3S7RA 4P2XA 1DURA 1I6JA 2J76E 4OFZA 2X3DA 3BO2A 1RISA 4HLBA 3CO9A 3TZXA 1NK5A 2KRRA 1HNIB 1CJTA 2BX6A 1UPPA 3DLGA 3CW2C 3D6TB 2CNKB 1GX6A 4DV1J 1N5TA 2UUWA 3FCWA 1JNZB 2ZE2A 5LMNJ 1IBMJ 4D3HA 3TX0A 3IFEA 2R8GA 1OMSA 1OQ6A 3GG0A 2PA3A 2OEJA 4QPXA 2FJBB 3DRXA 4RNOA 5KG2A 4CDIA 1CJTB 2B56A 3R3TA 3DLGB 4NRTA 4WBFA 2ZE2B 1KVKA 4DR2J 1RTDA 4DL0C 2J6UA 3G71S 2W7PA 1SJ4P 2YKNA 4A46A 1UVMA 1VRUA 4KJIA 2YKOA 4UT4A 2NLWA 1B7FA 4KPCA 3LGHA 2BJ3A 4DR7F 4WE1A 2PE8A 4M5NA 1RTDB 2YKNB 3UCGA 1VRUB 1XNQF 4TXSA 2QA1A 2MDAA 2CPZA 3GCXP 3H0PA 3M8ZA 4MKVA 1YWXA 4EBCA 3AHPA 4B3OA 1DY3A 4OLOA 1KEKA 4WE1B 4Q7AA 2X3GA 1VLOA 2DXFA 3D4JA 2V6AA 4KHRA 3M8YA 3KFWX 3QIPA 3Q8PB 2ZH5A 1W2IA 1OY8A 4X64J 4DDFA 4OX9J 4IG0A 1GXUA 4B3OB 5EUHA 1F3VA 4HL9A 1QD1A 3H7HB 4Z7CA 4OZ3A 2ZDOA 2HPUA 3T5LA 4EWTA 2DNQA 3QIPB 3CIMA 4O44A 1U1OA 1URNA 3W66A 4LFAJ 5GAGI 1WI8A 4IG0B 4MMOA 5E3RA 5HLFA 4BWMA 1N8RT 1N52B 1X31C 2DGOA 2C2ZB 4DL5A 4JV0A 2DCUB 3OUYA 5F8LA 4LF7F 3PFEA 2BA9A 3KG0A 1LXNA 3W9HA 1QUPA 4O44B 3W2WA 3CC2S 5A8WA 2IC3A 4DL7A 3PR5B 5HLFB 3IRWP 3PXGa 3ZXWA 1KDNA 3D54A 1R43A 3JSMA 1D9DA 3M9NB 2L48A 4W92B 3OUYB 4HH1A 3VZHA 1UW4A 2KJVA 1KHVA 1I5OB 4WJBA 3W2WB 1KOOA 5A8WB 1S57A 1UETA 2DNGA 3AFGA 2NXNA 2GW8A 4K4UA 2IC3B 3V4MA 2MHNA 1J2VA 1FJCA 4FDFA 4NLYA 4IOCQ 2RQCA 1EJ7L 2FJEB 1M90T 1XBWA 5HQLA 3JSMB 3H8YA 2HSEB 1VBXA 4UUWA 3EJMA 2AD9A 2PD1A 2YY3A 3PYEA 2ILZA 4KGKA 2OSQA 2XB2D 4PWDA 1WHWA 5F8JA 1VC0A 1N56A 3H4BA 2ADCA 2AX0A 4F50A 1VQNS 1D0EA 3VQTA 2V0NA 3BO4A 1GTHA 2NSCA 1B0VA 4YR3A 4IRCA 3BZQA 4PWDB 1HYSA 2HQIA 2Z57B 1U02A 4FNIA 4DV0F 5AXNA 5B0CA 2V4RA 2UV8G 2CQ0A 4HDGA 2Z2LA 3IBFB 1NH7A 3DLEA 3MAHA 2CA9A 2ZKTA 2PGCA 2CPXA 2VV5A 1VCTA 5B09A 1HYSB 3ONQA 1ZA2B 1WACA 2E1PA 3PHEA 2VFSA 2HNZA 4X4TA 1MMNA 2U1AA 4HKQA 1RCOB 3DLEB 2XO6A 1AYEA 4U96A 2KXNB 5T41A 3BQ0A 3QLHA 1WG5A 3UD4P 1VK3A 1VRTA 5KFEA 1B99A 3W9JA 3KJFB 2R7RA 9RUBA 2W9AA 5IC6B 1LK7A 3TWZA 4RZRA 1MNEA 2ZBCA 2VIHA 5K9FA 3U1MA 2HNZB 1HARA 4KAIA 1HKAA 4WPAA 3X1LB 2AEFA 2VDIA 3QLHB 4ZDNA 4YDDB 3CD6S 4B9NA 1VRTB 4YY3J 2DNRA 1H7XA 1NK6A 1J5EJ 4EI2A 3B6BA 2VQEF 3N6MA 3UR0A 1RHUB 2R7UA 3IM9A 1RAHB 1UFLA 1FE0A 3BQ1A 4USMA 2JHEA 1SL0A 4GO5X 5CYMA 4O3SA 1O51A 5ETRA 3BV8A 5GADI 1AT1B 5H9EK 1IKYA 2K3IA 4EO8A 4C8MA 3GONA 4GC7A 2GV1A 2ZOGA 1FKOA 2ZD1A 5HANA 4ES1A 4ZVPB 2OUGA 1EB0A 2OLWA 4OLPA 4OYWA 4LVOP 5CYMB 4ZLPA 3ISNC 2DHAA 3CMAS 3D67A 4DX5A 1P6TA 1IKYB 4KV8A 4L3NA 4V1Ak 2AQ4A 2J6SA 4QU6A 4KH1B 1U1QA 3G87A 4NZ0A 3CJKA 1YGYA 2ZUAA 1FKOB 5KT2A 2ZD1B 3MMAA 2AJQA 3GIRA 1Q7LB 1Q5VA 5BYSA 2VA2A 2FHJD 2GHPA 4RBTA 1U2CA 4KQZA 1O6XA 3AQPA 1KQKA 5L39A 2CVIA 4H54A 4F4XA 1UEVA 1YZ7A 4KV8B 3N6LA 3HI9A 2MKKA 3M2UA 3HDSA 3CJKB 3HF5A 3MMAB 3Q2TC 4I7FA 3EX7B 1Q8KA 2WVEA 1TMJA 4ZVOB 4NXMF 2GAHC 4OI6A 1K47A 3SYZA 4S0MA 3ISND 2VOPA 4JI6F 4N8OA 2DGWA 3M2UB 4JI3F 4Y2CA 1HR0J 4NLGA 4WYWA 1ZM2A 2DO0A 2YX1A 4I7FB 5E3AA 2HHSA 3A3OB 2XGPA 2YWHA 2B9EA 4LF6F 5KFYA 4C98A 2MB0B 1IM4A 4OI2A 2ZOMA 2BYCA 2XZWA 4GRSA 4WXWA 4LR7A 1IR1A 4PPDA 1JLCA 2CDQA 5DRKA 3OL9A 3ICLA 5A6PA 4PQUA 4WTYA 4U7UK 1SKWA 2PDAA 4AL6A 1TVRA 2DNNA 1XJWB 5L9NA 1CLFA 1F3FA 1FKPA 2LXUA 4Q44A 3R6GB 2HS0A 1JLCB 2XULA 2OH2A 3QWUA 1NAQA 4PQUB 1OY6A 2E5GA 3HX9A 2B5JA 1TVRB 3HHLC 3BSAA 2DEJA 1BMQB 2LLZA 4R5PA 2VHGA 4MYTA 2ROGA 1SL2A 3TEGA 1FKPB 4CO1A 4LBIA 1JJ2R 4U67Q 4XDCA 1UWAA 4A8FA 2K2PA 2B5JB 1LXJA 2R7TA 1XR7A 1RJJA 4R5PB 5LSOA 1PC4A 2B4PA 2DHSA 3UN3A 2MMYA 2FQQB 4HYKA 1FK9A 4FF2A 3R2DJ 1NDKA 1UCNA 2CZ4A 1YKWA 4JB8B 1TV6A 3QSYB 5HN0A 1U6ZA 5ETPA 2V4QA 1TFYA 3HHLD 3AOCA 3U1LA 1U1MA 3EZ5A 4W4MA 3LF0A 4FNHA 3UWTA 1FK9B 4LMZA 1S76D 3OR1A 1WDDA 5MAOA 5DDPC 1NHKL 1TV6B 2XNQA 2QMUB 3A8IA 2QGFB 2J0XA 2IRUA 3R5CA 1M5KC 4IQMA 2ZBRA 2F1FA 2ZZNA 1EKSA 3CCRS 5KFJA 5F9NA 4PXDA 2AMCB 2HZCA 5LSRA 2FPHX 2KJWA 2BQ3A 4MK8A 1E6VA 4JBCA 4OHWA 3EXCX 3OR1B 3C2PA 2EKNA 2O5DA 1V3SA 2CQHA 2D1CA 4ETXA 3VWSA 3V2UC 4X4OA 5KFPA 3BKFA 2B8QA 4CNZA 1RYSA 3K5MA 4M1KA 4CWBA 2V50A 1EX8A 2GIQA 2RDDA 4DG1A 1S6PA 4PRFA 1E6VB 3QIDA 3GIIA 3SFGA 2WVBA 3DC2A 1WOSA 2D74B 1B7YB 1D3WA 2M52A 1U4BA 2AZ3A 3MR6A 4FVMA 2LDYA 1F9EB 3UR3C 3GV7B 4DG1B 3JAMY 1S6PB 4CT9A 3L4BC 1QJHA 2BV3A 1WTFA 4JV5F 3EGWB 2KT2A 1AW0A 2AYEA 1SI9A 1BD6A 5AXMA 1RLCL 4XK8C 4DV7J 3QRRA 1KN6A 2C2DA 5IS2A 4ZVHA 2FD2A 2CG4A 2RRBA 2L9NA 2C22A 2EKYA 1Y5LB 3W1YC 3BBBA 4IFVA 2R7WA 2IFXA 2ZH1A 4O0NA 4I1TA 1UPMB 2BM0A 3KUHA 1TK5A 4UY8T 1Z2LA 3K0JA 4Y28C 2CKWA 1RTZA 1VQKS 4ED3A 3BEGB 1QY7A 2RQMA 4DR5J 1S6QA 5M2PA 4GKJF 4DSKA 4IFVB 1NJIT 4FXVA 3DGVA 4ZPCA 2EG1A 2EG2A 3HT3A 3OTDA 3PW5A 4Y2MA 2CJAA 1S72S 4WFNQ 4FBTA 3CDWA 3RW7A 2H51B 1Q8BA 3DCAA 2H4WB 2DGVA 1BGXT 3W61A 1S6QB 5CCMA 2VDHA 4JI0J 1K0TA 3KKFA 2KVQE 3WZ0A 3EVWA 3U1NA 3IAM9 2R7SA 3DNCA 3V81A 4HHJA 3BPDA 2CWXA 1DHMA 1RT4A 1FCAA 2GFFA 5CD4H 1N6QA 1VLYA 3N0VA 2FGCA 2ZOFA 2YNGA 1E6YA 3BBFA 2VBZA 3IP0A 2XWXA 2HGNA 3V81B 2GX8A 2RQ4A 3ADAC 5J1EA 3THTA 4DV5F 2KFYA 3I0RA 2R8IA 5IWAJ 2A10A 1RT4B 1IBCB 4OZLA 1R7IA 3M6UA 5IZHA 3V6HA 1N6QB 4P7VA 1QSYA 2YNGB 1UW9A 2G4BA 4JI5J 1E6YB 4DR7J 3CCLS 2C28A 3DRYA 5J1EB 1OYEA 2Q79A 3I0SA 3I0RB 3G4SS 4B9MA 2HEKA 1H74A 3HKWA 3KHLA 2O01C 3B82A 2RUSA 3LO3A 1RWPB 3DHWC 3IR5B 2L08A 4HT7A 1NJYA 1EQMA 3P4UB 2IM2A 3OV7A 1YQHA 3I0SB 3MUTP 4ED2A 3SFUA 4ID8A 3WX8A 1Q16B 3DHXA 1AROP 3FRZA 4DSIA 4Y3CA 2DVIA 3UI3A 4DUZF 4RWWA 3LP0A 1JLAA 3QT8A 4H4MA 3CD5A 1RWNB 1NDLA 2OD6A 1SQGA 2J7UA 3AJDA 3QT5A 4F26A 5H9EJ 1Q95G 1G6BA 3MPVA 2M8HA 3N9UC 2B8PA 2W25A 3KWMA 2UVUA 4CLSA 4UOCA 2QEXS 3DU6A 3LP0B 1JLAB 3OJSA 3BN4A 4H4MB 2J0SD 4DR3F 4DL6A 1F1BB 2B4UA 1RA7A 3OTBA 1YBTA 4B3SJ 3I56S 4R0JA 4F4ZA 4KT0C 3OJUA 2FGOA 2MKCA 3K57A 1C4AA 1Q79A 2BMBA 1X4FA 3R5BA 2CADA 4DUYF 2MTLA 4M5MA 2MJNA 4K5SA 1K1SA 1R8BA 2DY9A 5F3ZA 1JX4A 1PCAA 2IBKA 1JMTA 1Q8LA 1LW0A 4IQXA 1LWCA 3I4PA 4PXBA 5B0GA 3UN2A 2V9WA 4DPYA 1DBDA 3ULHA 4PAAA 3CJ3A 2DHXA 2A6MA 2QLBB 3A8EA 2AJ4A 3UCZP 4JI8F 4Y34A 3CDAA 1LWCB 5A6WA 3ELHA 4Q2LA 1NKEA 5KFXA 3R5GA 2KM8C 1MW7A 2WHOA 2ZVIA 3DLLQ 2BOAA 2CQIA 3HFKA 1ZOTA 2KFZA 3GPAA 2E5LF 2G2ZA 2EFQA 2RNEA 1KSPA 4DV4F 3GIMA 4RW6A 3V6KA 4J9UE 3VAHA 4YFUA 4ICLA 3PTWA 5LMUJ 3JQMA 3C3LA 3EZUA 1NSAA 2PI5A 2YTCA 1T9XA 2NZCA 4FXWA 3ZTRA 3DN9A 1N33F 4RW6B 3OT9A 1I94J 2NXCA 4ICLB 4QWAA 2DO4A 4DSLA 4X66J 1L3TA 3MD1A 1X4CA 2YX4A 1TL4A 2QZ8A 2GMHA 4ECVA 4C8OA 4NCAA 4LREA 3VGVA 4K2JA 2RHSB 2LQBA 5C2CA 5F9LA 2D41A 4F3QA 4NLWA 3IA0A 2XCAA 2D9PA 1N34J 3IBWA 2XYPB 1KRPA 3HXMA 1WHYA 2BQUA 3SSSA 1YRXA 3J7ZT 2DR6A 2KB2A 5DQIA 2DGXA 4RW8A 2ZVSA 1RT7A 4OJ1A 1FF2A 2W4CA 3O44A 4BWJA 1X9SA 4X4NA 4LFCF 3HHKA 1JXEA 1RWXB 3QO9A 4OHVA 3GSDA 1K8AT 3GU0A 2IVFB 2LCWA 1JK9B 2VZ9A 1NK9A 2MEWA 4RW8B 4FS1A 1RT7B 5KFQA 3NGKA 2BJ1A 5BR8J 3OFHA 2CFXA 2JRSA 2JWNA 2PA8D 2YWWA 1WC3A 2OO4A 3QO9B 1X7VA 4C4WA 5BXIA 3KLVA 3GJRB 3VTIA
chains in the Genus database with same CATH topology
3QRPA 3QRRA 4DZDA 5CD4A 1WJ9A 2Y8YA 4QYZK 2Y8WA 4U7UD 3QRQA 5H9FK 2Y9HA 5H9EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRP A;  3QRR A;  4DZD A;  5CD4 A;  1WJ9 A;  2Y8Y A;  4QYZ K;  2Y8W A;  4U7U D;  3QRQ A;  5H9F K;  2Y9H A;  5H9E K; 
#chains in the Genus database with same CATH topology
 3AXK A;  1UA1 A;  2JFD A;  1OSD A;  2K3K A;  2KL8 A;  4AE5 A;  1IN0 A;  3I5A A;  4DN9 A;  3D1O A;  2WCX A;  1ACM B;  3VVU A;  1TL3 A;  2OPR A;  2UXC F;  4O23 A;  4HT5 A;  2IJN A;  5JMN A;  1IBL F;  1YJW S;  2DH8 A;  3HCX A;  3J80 Y;  2D7S A;  3BPS P;  3WHI A;  3C6U A;  4OMF G;  2H48 B;  2RD5 C;  4MH8 A;  3M7V A;  1FXD A;  4EO6 A;  3GP9 A;  3MWB A;  2HLU A;  1UVN A;  1TL3 B;  3M1V A;  2OPR B;  4FYY B;  4NXM J;  2GO8 A;  1TP7 A;  1RT2 A;  1M1K T;  4J9R A;  2QA4 S;  3H98 A;  2RE1 A;  2BE7 D;  4EYH B;  3DOK A;  3CGI A;  2CQP A;  1D8Z A;  1SKU B;  3C6U B;  1ELO A;  1FFS B;  4NEY A;  1IKV A;  3M1V B;  4KHP F;  4RW4 A;  3AQO A;  3JAM U;  1RT2 B;  2HQC A;  2DNK A;  1GFW B;  4LF6 J;  3GV8 B;  1ZAW A;  4OV6 A;  4QWD A;  3DOK B;  3PX0 A;  2UXB F;  2F65 A;  2LA6 A;  3MOJ B;  3MMB A;  4JP8 A;  4QW8 A;  5GVQ A;  4DZD A;  4WFB Q;  1IKV B;  5ETN A;  2CXE A;  4RW4 B;  1Q4R A;  5EWG A;  2ZHA A;  4B9S A;  4J91 A;  4ER8 A;  4B9U A;  1HWI A;  4P52 A;  1ZPV A;  1BHN A;  3G6Y A;  2DY1 A;  4TVA B;  4X84 A;  4EFA C;  4BC9 A;  4NCB A;  3MMB B;  2LXF A;  3TA1 A;  4QWB A;  2CZ9 A;  2VB6 A;  1MN7 A;  1SQF A;  4P2S A;  5HMZ A;  5CH7 B;  2OJ3 A;  1SL1 A;  2FLP A;  3QPI A;  1OSC A;  3LP2 A;  4ED7 A;  3H20 A;  1T95 A;  3C19 A;  5D15 A;  1YJR A;  1FRX A;  1YHQ S;  3ENA A;  2DHG A;  4V19 X;  1J27 A;  5J2Q A;  5FII A;  1SUQ A;  2XI2 A;  3TVY A;  1RAI B;  1HL6 A;  2HBY B;  4TU9 A;  2Z2Z A;  5KG0 A;  2VC0 A;  3SI8 A;  2ATC B;  4EBE A;  4DCO B;  3LP2 B;  2J9E A;  1XNR J;  2IDE A;  4Q5V A;  1CC8 A;  2EI5 A;  3T1Y F;  1U49 A;  4CCH A;  3QAE A;  1S59 A;  3KJN B;  3SSR A;  4BS2 A;  4QPT A;  5J2Q B;  5CD4 A;  1RWM B;  1SUQ B;  3KXD A;  4ED6 A;  1EET A;  3G9C A;  1H2V Z;  3GG1 A;  4MAK A;  4ZVT B;  1NJX A;  2DXD A;  2NRE A;  2KDO A;  5ETO A;  3NS5 A;  2HHU A;  5KFZ A;  5KG3 A;  2Z2Y B;  3JSR A;  1Y3J A;  4G1Q A;  1NSQ A;  1MRO A;  2Y0S D;  3OVA A;  2BJ9 A;  3AJ1 A;  1CQM A;  4R8U A;  3PKY A;  1WF0 A;  1EET B;  1U26 A;  4RUC A;  2WON A;  4CNY A;  2HK3 A;  2FHK A;  2HFN A;  1PC5 A;  3TW0 A;  4G1Q B;  4X4V A;  1MRO B;  4ZP9 A;  1Y4Z B;  1U1N A;  3FZ2 A;  1B3T A;  4R8U B;  1O0P A;  3HPO A;  1HBO A;  3AOA A;  4NML A;  5A76 A;  3J7Y U;  2WON B;  4FF3 A;  1PAE X;  2R8J A;  4A8O A;  1S12 A;  1RA6 A;  1HIY A;  2E9T A;  1KD1 T;  4CO2 A;  1HBO B;  1WC4 A;  1SJF A;  2BJ7 A;  1DAX A;  2V4J A;  4CO5 A;  1G3O A;  4QIV A;  4Z37 A;  4JV5 J;  2Z8Q A;  2HZV A;  5ITH A;  1DRZ A;  2Z2M A;  4KRW A;  2I5J A;  2YWF A;  2OPQ A;  3CCJ S;  3L7O A;  3HO1 A;  2JNJ A;  4MYU A;  2V4J B;  3IWX A;  4DQP A;  4I64 A;  4ED1 A;  4ZCI A;  1MSW D;  1N48 A;  2XLI A;  3B54 A;  1GXL A;  1EP4 A;  3OVS A;  4OX8 A;  2LYV A;  2I5J B;  1OPI A;  1YTY A;  2Z56 B;  2HIQ A;  2EFP A;  2QSW A;  4ZS6 A;  4P7T A;  2OPQ B;  4C8L A;  4NA1 A;  4OJG A;  2HRY A;  3TZW A;  3BR9 A;  1RT6 A;  3R97 A;  2IMW P;  2LKZ A;  5F8M A;  1EP4 B;  5HK4 A;  1K9M T;  2F4F A;  1R0C B;  1S79 A;  4ZVE A;  3WIV A;  2IDL A;  3OL7 A;  1SKR A;  1HBU A;  3JQJ A;  4LRA A;  1DFD A;  4KGZ B;  3E3X A;  4I67 A;  1RT5 A;  1O5J A;  1U0S A;  2L41 A;  1BQX A;  1RT6 B;  3G6X A;  4USW A;  2F8E X;  4A8W A;  1S1T A;  3NEK A;  5RUB A;  3OHA A;  3JTP A;  3NRB A;  5KFA A;  5IT4 A;  1R27 B;  4DV1 F;  1HBU B;  1IBM F;  1RT5 B;  5KFT A;  2ZWP A;  3BYP A;  4NWB A;  2FYX A;  1HNV A;  2ZH4 A;  3M4X A;  4AD6 A;  2XO7 A;  4OJ3 A;  4PG5 A;  4IDK A;  3W5X A;  1S1T B;  4GVB A;  3PKM A;  1S77 D;  4AXJ A;  1FXR A;  4JI4 F;  3AB2 B;  3UDC A;  3D5M A;  4OX6 A;  2DRA A;  2GAG C;  2XHC A;  3G96 A;  4DR2 F;  4DV5 J;  2CPJ A;  3D0H E;  1T11 A;  3EE3 A;  3DRS A;  1HNV B;  4I68 A;  2LEB A;  2GCF A;  2FY8 A;  4ZVG A;  1Q82 T;  2JJ4 D;  4IDK B;  4OZN A;  4GVB B;  3QJP A;  1FDN A;  1OQ3 A;  1FD2 A;  3ISZ A;  1TL5 A;  1G4C A;  3N4W A;  3CCS S;  1QAJ A;  3WBZ A;  3HHE A;  2WK4 A;  1N5Y A;  1ZA1 B;  3QYY A;  3DRS B;  1VQ6 S;  1TL7 A;  5GAH U;  5H9F K;  1RBO B;  3MR2 A;  2KU7 A;  1S6O A;  2KT5 A;  2ASY A;  1U8S A;  1RBA A;  1N5Y B;  1QAI A;  4ZPT R;  1XR6 A;  3VV2 B;  1TL7 B;  4UOF A;  1EZZ B;  3CT9 A;  2W1B A;  3ILI A;  3LGN A;  3MAQ A;  2BKN A;  2VKZ G;  3RU0 A;  2H4Y B;  4H4K A;  5DDO C;  4OX9 F;  4DUZ J;  2ASL A;  3BH7 B;  3LAN A;  1R6Y A;  2MQO A;  4ZIW A;  2LMI A;  2A0F B;  3HHD A;  3FRY A;  3IWL A;  5J2N A;  2JEG A;  4ECQ A;  4LFA F;  4QIE A;  3BM7 A;  4DPO A;  4F4K A;  1ULR A;  3K59 A;  4B17 A;  2WVD A;  2BEF A;  1CVJ A;  4KO0 A;  2M3D A;  2NSB A;  2A2C A;  3NLC A;  3OHB A;  2QA2 A;  2IM0 A;  4GO7 X;  1NH8 A;  3QGG A;  5J2N B;  1VJW A;  4N8N A;  1GH8 A;  4RUB A;  3D68 A;  4QR0 A;  3EVM A;  4KO0 B;  1X4G A;  3FUY A;  4ZPB A;  1RU1 A;  4DUY J;  2Y9H A;  4RW9 A;  2D9O A;  3PAC A;  3MPY A;  4WKY A;  1KS2 A;  3MZI A;  5B0B A;  1RWW B;  2YXL A;  1SBR A;  5T14 A;  2AWZ A;  1D8Y A;  4LVN P;  2C3Y A;  2RU9 A;  4RJV A;  2E7X A;  2X1F A;  2FUG 9;  1NHV A;  4ECS A;  1C4C A;  4A8Q A;  4DF8 A;  4E98 A;  1UZH A;  1NDC A;  2NXJ A;  4RW9 B;  5AXL A;  2QA4 G;  4K4W A;  3J80 U;  3A1Y G;  2PEB A;  4USJ C;  4CH0 S;  4Q0B A;  3ZZY A;  2G1D A;  4C9D A;  3TJ9 A;  2QL5 B;  2R3V A;  2ERR A;  2ZFH A;  1FRI A;  1HHQ A;  1VDH A;  4ZN1 A;  3KJV A;  3A13 A;  3OBI A;  2XSJ A;  3FBB A;  2GO9 A;  1F5C A;  1VYA A;  1WD6 A;  4Q0B B;  1RU2 A;  4DV4 J;  4NLQ A;  5JUM A;  2DR8 A;  3P3D A;  4C8N A;  2W9B A;  5HP1 A;  5B0F A;  3OW2 R;  2E1A A;  3TO8 A;  3KJV B;  4IUF A;  3MM7 A;  4LBH A;  2XC9 A;  1ITP A;  2XSJ B;  3D1Q A;  4U6P A;  1YZ6 A;  2MQM A;  3VAK A;  2N3O A;  3EGN A;  3FK4 A;  4DX7 A;  2PT0 A;  4QIG A;  3BKT A;  5HJX A;  1RTI A;  3TRG A;  2W9B B;  5HP1 B;  4ZCL A;  3I9V 9;  5J1N A;  4CZC A;  2HWT A;  5AJ3 J;  1NZ8 A;  3IC1 A;  3HMJ G;  2DNP A;  3MM7 B;  3UD5 A;  1IWA A;  3DLK A;  3TAP A;  5B7W A;  3PIO Q;  4L73 A;  1RDR A;  3BDP A;  2XCP A;  1R6V A;  1N88 A;  1U25 A;  2FC8 A;  2E1M C;  3W63 A;  4FKY A;  1DQA A;  1GQE A;  1RTI B;  1HLW A;  4ECZ A;  2RDI A;  3KG1 A;  2XHW A;  2I0X A;  3O5T B;  2E5I A;  3MR3 A;  3BO3 A;  3DLK B;  1L3U A;  3G2X A;  2R2T A;  4AXI A;  1FX2 A;  3K17 A;  3PVX A;  1WKL A;  2EK1 A;  5KG7 A;  3LQV A;  2EWH A;  3UO0 A;  4JV1 A;  3DGP A;  2FJD B;  2LU2 A;  5U47 A;  1J5E F;  4FP9 A;  2WAQ D;  1WOP A;  1RK8 A;  4ZCK A;  1WTB A;  3TZY A;  2O67 A;  2XMA A;  1S7I A;  2L9D A;  2J8A A;  1QE1 A;  4U7C A;  3EUN A;  2VG7 A;  3DGP B;  1F60 B;  3Q8S B;  1SB6 A;  4LR9 A;  1T9Y A;  3JTO A;  1HWK A;  3OTC A;  2RB7 A;  3EVO A;  3Q22 A;  3JSB A;  4AQY J;  3HFZ B;  1VGY A;  3P5B P;  1RAE B;  1YJV A;  1QE1 B;  5E3C A;  2UUT A;  3DI6 A;  1L3V A;  2KVI A;  2VG7 B;  4DEZ A;  3W5Z A;  1FHT A;  1TU0 B;  2AYM A;  4C6A A;  2J5A A;  2LQ9 A;  3NXZ A;  2IY5 B;  4DWI A;  1H38 A;  4UQT A;  4F04 B;  5DZ6 A;  2BKO A;  3DI6 B;  1IBL J;  3MMJ A;  2N3L A;  3SSQ A;  1VQP S;  4IR9 A;  2HLT A;  2JL9 A;  4DS4 A;  4QYZ K;  4O3P A;  2WSE C;  3UDE A;  4ZKA A;  3KNA A;  3D2W A;  2AX1 A;  1XMB A;  2PMW A;  2B4O A;  3GTY X;  1WOR A;  4LIW A;  2RU3 A;  1AUD A;  2F8M A;  5DG7 A;  2PFF B;  4F4W A;  3A3P B;  4F4Y A;  2I1R A;  5A8R A;  3Q24 A;  2MQ8 A;  2ZJR Q;  2GIF A;  1IBK F;  3IM8 A;  5ETM A;  4KHP J;  4Q43 A;  1NU4 A;  2AJ0 A;  4C3L A;  4JUZ A;  3CC7 S;  3QZ7 A;  2H9Z A;  4P2M A;  2QSF A;  2QE5 A;  4K8R A;  1LWF A;  2UXB J;  3D7S B;  3OLA A;  3LOU A;  3LAK A;  4CLW A;  2CVE A;  4ELU A;  2CJX B;  5A8R B;  4G1P A;  2UXD J;  1NXI A;  2ZWO A;  3IXQ A;  3VF0 B;  1F6T A;  2P8I A;  2RRA A;  2NPI A;  1HNX J;  3FEZ A;  3RBZ A;  4FN5 A;  2MXY A;  4CT8 A;  2M7S A;  3W7B A;  3ZTS A;  3EDQ B;  2ZH7 A;  1LWF B;  2XG8 A;  1AB8 A;  1H98 A;  5HI7 A;  2AV5 A;  1NK0 A;  1TKD A;  2RF2 A;  5L8R C;  2QL9 B;  1HQ2 A;  5CAA A;  4DR6 J;  4ITS A;  1PSD A;  3RUB L;  3CF5 Q;  4IOA Q;  3DLH A;  3QBC A;  4OZJ A;  1CEZ A;  4CH1 A;  4FYD A;  2VG5 A;  3Q8U A;  2M70 A;  4Q8F A;  3RAM A;  1NO8 A;  4I0W A;  3VHQ A;  3FBC A;  4USK A;  2BE9 B;  3VAL A;  2RF2 B;  3MCN A;  2YQ3 A;  5HMY A;  2NUH A;  4J5O A;  4QR2 A;  4J9S A;  2VG5 B;  1FDB A;  3NKY A;  3BSC A;  4B3T J;  1S7H A;  5I4M A;  4DN0 A;  5DET A;  3HSD A;  1WEZ A;  3EM1 A;  1WF1 A;  2VL1 A;  1MG7 A;  4YS2 A;  3IAS 9;  5JVH Q;  2D69 A;  4F0K A;  4ANE A;  2Y1J A;  1B0T A;  3IN5 A;  2J0Q D;  2BW7 A;  3HVW A;  1MLA A;  4NRU A;  4JI1 F;  2DBB A;  5LJ5 Y;  3UN5 A;  2OEL A;  2V63 A;  1GK8 A;  3FCH A;  2DIS A;  2ZC4 A;  2HRU A;  5H9F J;  5KFU A;  3JS9 A;  3P96 A;  5IT0 A;  1F2G A;  1RWK B;  2B7B B;  2J7K A;  4KGX B;  4K4V A;  2CG8 A;  4NXN J;  1X5T A;  3ZZO A;  3LGM A;  5L1I A;  4TLQ A;  2A2D A;  2VFR A;  3H2L A;  3NCQ A;  3UVJ A;  2KT3 A;  2NCK L;  2EXU A;  2V67 A;  3RBD A;  1JIH A;  4C11 A;  3FEY B;  4HTJ A;  2F7V A;  4NZ7 A;  4C0H A;  2LEP A;  2KG1 A;  2AW0 A;  5KT5 A;  3G82 A;  2K06 A;  1TR0 A;  3UVJ B;  4DQI A;  4ZLN A;  4TYA A;  2RAQ A;  3QFH A;  4DV3 F;  3ETM A;  5HVF A;  4ZIT A;  3RW6 A;  4C11 B;  5AE3 A;  1UVI A;  3I32 A;  4LF5 J;  1DAR A;  2UV8 A;  1VQ4 S;  2QFI A;  2J6T A;  3MM5 A;  1VI7 A;  3G82 B;  2RS2 A;  4DBQ A;  4URS A;  3CSK A;  4IH6 A;  1NJW A;  1HI0 P;  4A8X A;  3NAH A;  7FDR A;  4J9Q A;  3IG1 A;  2V2K A;  4DV7 F;  1D1U A;  2VBY A;  2YNF A;  2JDJ A;  5A0Y A;  5L9X A;  2MZT A;  2JEJ A;  4X65 F;  3HSJ A;  3IRX B;  3MM5 B;  3EGV A;  3GJT B;  2FHM A;  1UZD A;  1APS A;  1K44 A;  3IG1 B;  2AF6 A;  3M6W A;  2KZM A;  1HWL A;  5J2P A;  4K5R A;  3R9L A;  4NLD A;  2YNF B;  5A0Y B;  3CCE S;  4DR5 F;  4O3O A;  2HVZ A;  2B0G A;  4NL5 A;  1MMD A;  2R42 A;  2I6W A;  1PJ6 A;  2XMU A;  4KBI A;  5J2P B;  3QJL A;  4QWE A;  4ELT A;  4I6Y A;  5IT9 Y;  4JI0 F;  3GB0 A;  1KBR A;  2E7W A;  1FJG F;  4A4J A;  3CME S;  2P9C A;  3M8R A;  1WWH A;  2XTJ P;  3DLJ A;  2XMW A;  2V8H A;  5LXY A;  4N76 A;  2J0W A;  3FJ2 A;  3VCD A;  2ZJQ Q;  3R6L B;  4X62 J;  3DOM A;  1Q7Y T;  5CYQ A;  2C3M A;  3GFY A;  1KTQ A;  5LM7 E;  4JI4 J;  1WJ9 A;  1FVQ A;  4LF1 A;  3QRQ A;  1WHX A;  5I3U A;  2B9W A;  2LFV A;  3NAI A;  3CCM S;  4NCG A;  5IQ6 A;  1C0U A;  1BE4 A;  1VQ7 S;  1S0V A;  2C2O B;  1IM6 A;  2XS2 A;  2BOP A;  3RR8 A;  2R4F A;  2MLY A;  1VC5 A;  5IWA F;  3DOM B;  5CYQ B;  1YDL A;  1UJ4 A;  4M5G A;  4NE9 C;  4ZLJ A;  1SH2 A;  1KFD A;  4A48 A;  2JLE A;  5I3U B;  4M5K A;  1RAJ A;  4JI5 F;  3DDI A;  4NCG B;  1YG0 A;  2VA3 A;  1C0U B;  2XMJ A;  3OXF A;  4ELV A;  3D3B J;  2WRM A;  2Q66 A;  1HI1 A;  2V8D A;  4Y2I A;  1NRK A;  2D3O 1;  3G8S A;  3HSG A;  4IYQ A;  3ILL A;  1KLM A;  3VAG A;  3QAU A;  3MUM P;  4OYO A;  3VVT A;  3GJS B;  4R0E A;  4QU7 A;  3QGP A;  2OML A;  4DU7 A;  2ZH9 A;  2CPH A;  3W65 A;  1UAW A;  2WZ1 A;  3C66 A;  3J81 Y;  2ASJ A;  2IJF A;  4P73 A;  2JEI A;  3DXS X;  3P45 B;  2M9K A;  5KFB A;  1AFI A;  4A47 A;  2IRY A;  2HHX A;  2MY7 A;  2DYA A;  3VZI A;  2UVV A;  4P10 A;  4N77 A;  5F8N A;  1KLM B;  2WSF C;  4PG4 A;  3CJR A;  2R7X A;  2JZ5 A;  4WP8 A;  2VPZ B;  4NZ6 A;  4ZJQ A;  4WZQ A;  3UD3 P;  4JV2 A;  2MZJ A;  5KFI A;  5GMD A;  3KG4 A;  2G2Y A;  1RLD A;  2BW2 A;  3AY0 A;  2KZZ A;  3FFI A;  1PIL A;  5D77 A;  1V5V A;  2C3U A;  2W7A A;  3PJX A;  1DJ0 A;  3SMZ A;  2OPS A;  4ES2 A;  3MEK A;  1TEL A;  4YB6 A;  4B3S F;  2IVY A;  3DDN A;  4A8M P;  1M5P C;  2B7C B;  1YJU A;  4NEZ A;  5GAG U;  4G65 A;  3P8B B;  5D78 A;  3FFI B;  3T41 A;  4DQQ A;  1U24 A;  8AT1 B;  2AYB A;  2ZH2 A;  1X4B A;  3MCS A;  1GMU A;  2OPS B;  2UUC F;  5C2G A;  2J7W A;  1WG4 A;  4DV6 J;  3L3C A;  2OGU A;  3VAF A;  2FJV A;  3MED A;  1IKX A;  2YNI A;  2FB0 A;  4KB7 A;  4QYZ J;  1HHS A;  3ILO A;  5KG6 A;  3GE9 A;  1N32 J;  3U7J A;  5IXU A;  3GIL A;  2OIH A;  3HLU A;  1T3O A;  1EAY C;  5G0R A;  3RAX A;  4AL7 A;  1U8W A;  4LF8 J;  3LAL A;  3MED B;  1IKX B;  2YNI B;  2QLJ B;  3A8J A;  1W25 A;  3CJ0 A;  3FVY A;  2C42 A;  3MPW A;  1WC5 A;  1X4D A;  1X60 A;  2LQ8 A;  3MEE A;  4HR2 A;  5CZV A;  3CWJ A;  4WFY A;  4DOZ A;  1NLK L;  1RAA B;  1SIZ A;  3TAQ A;  3SQG A;  5K8O A;  4PZV A;  4DR1 J;  2ALY B;  5G0R B;  5DGA A;  4K50 A;  3K7R A;  3KUE A;  1CC7 A;  2W01 A;  4TNO A;  4TN2 A;  4ZPW R;  1T3N A;  4ZOS A;  2QN6 B;  2ASD A;  1YX2 A;  3MEE B;  2VJU A;  3FMW A;  1T94 A;  3PV8 A;  3Q89 A;  3PR4 A;  2UUB F;  4NYO A;  3HD2 A;  4QCL A;  2G0J A;  3SQG B;  1EHW A;  2GML A;  2JLG A;  4RUA A;  1YK9 A;  5LMU F;  4RWX A;  2XGQ A;  2VQF F;  3PYF A;  4WIQ A;  2DNH A;  3T1A A;  3C8Y A;  3NBP A;  2BVZ A;  1I94 F;  3I55 S;  4DL4 A;  4TLR A;  4N41 A;  4IO9 Q;  3ZZU A;  4OX7 A;  4X66 F;  5ETV A;  2QLF B;  3OSP A;  2G0C A;  1R0B G;  2QV6 A;  1SH3 A;  2AIR B;  1IUJ A;  2K8G A;  2ABY A;  3NBP B;  2YPZ A;  2MZS A;  1F2H A;  1Q8I A;  4OI0 A;  2RQK A;  3U02 A;  2MSS A;  2PN6 A;  2GJ2 A;  1C1C A;  3HK2 A;  2J9D E;  1IQT A;  1RHK B;  1N34 F;  2XWY A;  3SXL A;  3ZO7 A;  1FDA A;  1I51 B;  1QM9 A;  3TYT A;  4PEO A;  1MN9 A;  3KMS A;  4RNM A;  3GZ7 A;  3I87 A;  2P9G A;  2DCL A;  1YVF A;  1U47 A;  5KT7 A;  1TKT A;  4I2P A;  1C1C B;  4ZP6 A;  3E01 A;  3MCO A;  1RYR A;  5HO4 A;  5KT3 A;  2VUG A;  1HBM A;  3PFO A;  3JTN A;  1H2T Z;  2DNY A;  4M5D A;  4DZ6 A;  2DRB A;  1HD0 A;  1S48 A;  4FKX A;  3M2V A;  3TP2 A;  3ZTQ A;  3D6H B;  1TKT B;  5BR8 F;  4I2P B;  3FCV A;  4ZVQ B;  1KQS R;  1QSL A;  3E01 B;  2RT3 A;  4L74 A;  1M5H A;  5J2M A;  1NBE B;  1HBM B;  2DD8 S;  3Q23 A;  3LP1 A;  2CYY A;  2QL7 B;  4M5D B;  3PZP A;  3RGI A;  5GAD U;  3SZ2 A;  4OI3 A;  3BYR A;  1FO1 A;  5HVH A;  3M2V B;  4LIR A;  2XYH B;  1JWW A;  2QFJ A;  1VFJ A;  1WSV A;  2UVW A;  3CB4 A;  5J2M B;  4DFM A;  1AZS A;  3LP1 B;  4H4K C;  4G6V B;  1HNW J;  1RKJ A;  3LWL A;  4CRJ A;  2KHD A;  2HHH F;  3PHT A;  2E9R X;  3PRB A;  4CTA A;  2DRD A;  2EPI A;  3CC4 S;  1SCJ B;  4TU7 A;  3PX6 A;  3R7N B;  5L38 A;  1AZS B;  1K0V A;  1NK8 A;  5LOQ A;  4B3R J;  1U1L A;  1WHV A;  4RKU C;  3BSN A;  2JEF A;  2VF3 A;  5F0W A;  3SQO P;  3RJM B;  4P74 A;  2H3E B;  4CTA B;  4RBU A;  3L9Z A;  1PAU B;  1IBK J;  1VHI A;  4DS5 A;  4F2R A;  2IIH A;  4ECX A;  1G2E A;  3TJ8 A;  4YR2 A;  1KWM A;  2R9L A;  2OHD A;  1C2P A;  2I9S A;  1OIA A;  1FWP A;  1RAC B;  5GME A;  1WI6 A;  3PJ9 A;  3V4I A;  5B0D A;  1TL1 A;  3I9Z A;  2IRX A;  4ZIV A;  5KFL A;  2RIJ A;  3HD1 A;  2MST A;  4ZP8 A;  3V4I B;  5D0R A;  2XM3 A;  2KYX A;  3JYT A;  4LT6 A;  1R8H A;  1TL1 B;  4TYB A;  2ALZ A;  2B6A A;  2BJD A;  5D4O A;  4QR1 A;  2UVR A;  2CJ9 A;  1S1W A;  2M2B A;  4PXC A;  1A6L A;  5HQ8 A;  3TJA A;  2DGU A;  2FIU A;  1F9H A;  4QZV B;  4PYA A;  5E41 A;  4FYX B;  3HM9 A;  1Y0H A;  4IOB A;  5IT9 U;  3JYT B;  1GMW A;  3I82 A;  2IBO A;  2B6A B;  3CCQ S;  3ENW A;  1XNR F;  5EN1 A;  4PYD A;  1XER A;  2VPY B;  2AYG A;  1S1W B;  4DFP A;  4OZ2 A;  1FKA F;  1PG5 B;  2CNO B;  2BJ8 A;  3MGJ A;  4CQ1 A;  1KQF B;  1YIT S;  5D6G A;  1HNZ F;  4DV2 J;  4M5J A;  2E5H A;  3G86 A;  5I42 A;  3KDN A;  5DM7 Q;  3W8G A;  4JI1 J;  4KKO A;  1NSP A;  2LQJ A;  1RAF B;  2A3J A;  3O2I A;  2H54 B;  4L72 B;  2HG4 A;  4ECW A;  4TQS A;  2V2Z A;  3CCZ A;  2PI4 A;  1T7P A;  3GJQ B;  5I42 B;  5CXT A;  1RAD B;  3GR1 A;  4WKR A;  4KKO B;  4WXO A;  2XMM A;  2XZD B;  4C8K A;  3M6X A;  2MQN A;  1FRJ A;  3AXM A;  1SH0 A;  3IGV A;  2F9J A;  2WW4 A;  4DPX A;  2M88 A;  4RR5 A;  1AA1 B;  3PX4 A;  1SXL A;  4C3K A;  3W2V A;  1VBK A;  4G3I A;  1CUL A;  4DV3 J;  3BBC A;  5KOW A;  3J81 U;  3ZZP A;  4FS2 A;  1YJN S;  3BH6 B;  2V94 A;  3Q86 A;  3TR5 A;  1VIO A;  3M8S A;  2ZUG A;  3FC9 A;  3W2V B;  3KHH A;  4B3M J;  2AEM A;  3RRH A;  2M4M A;  1CUL B;  1U48 A;  1WDT A;  3E51 A;  4K4S A;  2A18 A;  2P2C B;  4X4S A;  3P6Y C;  3OL8 A;  3FDS A;  1MWZ A;  3HZE A;  2YKP A;  1RAB B;  1MWY A;  2COL A;  3ZTO A;  3I5B A;  4X65 J;  5LT5 A;  4XTT A;  4ZVS B;  3Q8V A;  4LRF A;  2P9E A;  3RB6 A;  3CD7 A;  4ZK7 M;  2CJQ A;  4F36 A;  1W26 A;  4N7T A;  1KHW A;  4F0H A;  3MCM A;  3UNY A;  2HIY A;  2VH7 A;  4LRB A;  5D0G A;  4OZ1 A;  3MAA A;  1VQ5 S;  2ATL A;  4WII A;  1JXL A;  3UW1 A;  5K8M A;  1JLF A;  4YDX A;  2GIR A;  2NR0 A;  3TA2 A;  1JB0 C;  2DXE A;  5L1K A;  1M5S A;  1BWE A;  4I6W A;  4OL8 A;  4E0D A;  1NPP A;  2V68 A;  1GNK A;  2C1E B;  3MAA B;  3MFH A;  1FJG J;  1ZAX A;  2RRN A;  4OYZ A;  1JLF B;  2JC1 A;  2DPI A;  1ZYQ A;  3FQL A;  3MPD A;  2FVS A;  4BHQ A;  3W64 A;  2IVM A;  3V5R A;  3O6Q A;  3AA8 A;  3MPU B;  1SJ3 P;  3CJQ A;  1S1U A;  4CLL A;  3OLB A;  1FVS A;  5GAE I;  4X4R A;  5EDW A;  2XY6 A;  3C6T A;  2ZM6 F;  3WIU A;  2FZK B;  4DI6 A;  1WSR A;  4HHU A;  5BJR A;  3D1H A;  1JQG A;  3R7S B;  1BY9 A;  1S1U B;  2XI3 A;  1RT3 A;  4FZV A;  3C6T B;  1FNM A;  4CYU A;  3GYN A;  2MLZ A;  2D3Z A;  1W2B R;  1R89 A;  1WEY A;  5BYQ A;  3K58 A;  4Y0F A;  4WCE Q;  3PY8 A;  4P75 A;  4RBV A;  5IC4 B;  4M5L A;  5HQM A;  1JLG A;  3Q2S C;  2ZDP A;  3NMR A;  1RT3 B;  4CLZ A;  4I69 A;  2PEH A;  2E29 A;  2AGQ A;  4CYU B;  4ENO A;  1S4F A;  2C2N A;  3IGN A;  3QT7 A;  4DLG A;  3QGH A;  2W2P P;  1UMJ A;  1JLG B;  1S9E A;  1RAG B;  1M5O C;  4XPE A;  3GMG A;  2EBG A;  2F9D A;  1X4H A;  4YB7 A;  4X4U A;  4LSN A;  1RZM A;  3ZC4 A;  3AH6 A;  2PC6 A;  1ZTW A;  3A3N B;  2BDP A;  1ZM3 A;  3CUN A;  1S9E B;  2ZBP A;  5HRO A;  4UOG A;  2XLK A;  5AXK A;  3ET6 A;  4LSN B;  1DTQ A;  2KRB A;  2E9Z A;  1R8P A;  3A4T A;  4KFB A;  5M2R A;  4CH7 A;  3AJ2 A;  1KOH A;  3PCO B;  3KDO A;  4Y00 A;  1XMO J;  2GC8 A;  1Y10 A;  3TAR A;  5HRO B;  3AT1 B;  3S8S A;  2BRL A;  2BQR A;  5LL6 d;  2UUC J;  3ET6 B;  4CO3 A;  3Q8Y A;  5HL7 Q;  2QYC A;  4F2S A;  1DTQ B;  5CYJ A;  3D0G E;  4OYI A;  5B08 A;  1YI2 S;  4KFB B;  1M1G A;  2VC1 A;  8ATC B;  4M63 A;  4P71 A;  2VPW B;  1Y3K A;  3HUL A;  2BR0 A;  1IJE B;  1WC1 A;  4UF4 A;  2IM3 A;  4KC5 A;  2H5E A;  4LF4 F;  3POT A;  2R2R A;  3H2V E;  2JOQ A;  1PO6 A;  2YX7 A;  2HKE A;  7FD1 A;  2PO4 A;  2QLX A;  3KLI A;  4HH0 A;  3WDO A;  5KG5 A;  4M5I A;  4DPT A;  2FLO A;  4ZN3 A;  4FXD A;  4QIW D;  4MKY A;  7AT1 B;  2FLL A;  3MUR P;  2HWH A;  3MUV P;  3POT B;  3FMB A;  5K5M A;  4ZPA A;  2G1H A;  3AAW B;  4KIA A;  5E0O A;  5H1S V;  5HVG A;  3KLI B;  3JB9 k;  2UUB J;  4MKA A;  2BBE A;  3JQK A;  4DMZ A;  1NCL A;  2SXL A;  3OTO F;  5HAT A;  4QW9 A;  2AP6 A;  5E33 A;  3MOZ A;  5KFR A;  1PBU A;  5I3P A;  2DGQ A;  1WNE A;  3CCT A;  5G4D A;  4NLO A;  2XLJ A;  1VHF A;  3G6V A;  3W62 A;  1JKH A;  5BYR A;  2VQF J;  4ALZ A;  2Y0B B;  4RLE A;  5EWF A;  4U7U D;  1LW2 A;  4FF4 A;  1RHQ B;  2LA4 A;  1HD1 A;  4F25 A;  2KH9 A;  4AFF A;  2VBW A;  2F40 A;  1UVL A;  4OYA A;  5AJ3 F;  4O0I A;  3RAQ A;  2YKM A;  2POK A;  1H0H B;  1Z1Z A;  4C8Z A;  2CQ2 A;  1U0H A;  2CZV C;  5KFO A;  1JKH B;  3BGO P;  4Q45 A;  2HHW A;  2NQP A;  4IH5 A;  3RBE A;  2V8P A;  2CNN B;  2BAC A;  2BJE A;  1LW2 B;  1RP5 A;  1M5V C;  3N5F A;  5DG9 A;  3BJY A;  4ID5 A;  3AB4 B;  4DLE A;  5KFH A;  1JXV A;  3G6E S;  4Q2M A;  2YKM B;  4QIF A;  4WU3 A;  1GT8 A;  4DSJ A;  1WEL A;  1FEE A;  3C16 A;  1U0H B;  3BDE A;  3H59 A;  3OL6 A;  4ED0 A;  3J7A 1;  3HVT A;  2EW9 A;  5FLX Y;  2GVZ A;  1HPZ A;  1PIE A;  2VG6 A;  3GYG A;  1D9F A;  2MHE A;  4CM2 A;  4ID5 B;  4WFZ A;  4BBY A;  1YBA A;  3I31 A;  1XMQ F;  4PG8 A;  3C16 B;  3N6N A;  1VJQ A;  2GQ2 A;  3N5B A;  2C3O A;  3KLH A;  1VQL S;  4GKK F;  3OQ2 A;  3HVT B;  1CSJ A;  2ACM A;  2GVZ B;  1HPZ B;  2VG6 B;  5ETK A;  2MKI A;  3PO4 A;  2BRK A;  5L1J A;  3PM9 A;  3LAM A;  1KKH A;  4KGV B;  2XS5 A;  4AQY F;  1LWX A;  2EEY A;  3KLH B;  3FSX A;  3BGF A;  1G1X A;  3HJF A;  1NK4 A;  1FEH A;  2MYF A;  4ED4 A;  2YWE A;  2FY1 A;  1FTR A;  1S49 A;  4PQA A;  4P9S A;  5EHH A;  4RO0 A;  4Y65 A;  3HSZ A;  1FJE B;  2QIF A;  4NI2 A;  3MMC A;  2NXU A;  3HVR A;  4KE5 A;  1PYT A;  2HHT A;  1A7G E;  2NXE A;  2HHH J;  3BSO A;  2AEJ A;  4ILL A;  2AGP A;  2KO1 A;  1FRH A;  2BZ2 A;  2V8V A;  1Y5I B;  4NI2 B;  3M8P A;  3DU5 A;  3MMC B;  2HVD A;  4EMD A;  1N36 F;  1WOO A;  2HK2 A;  3QNW B;  3M05 A;  1PKU A;  3OD2 A;  4J9M A;  4TY9 A;  4A8S A;  4JI2 J;  1Z2Z A;  2QT7 A;  3CJ4 A;  4JYA J;  1BUX A;  1QAY A;  2HFU A;  1NME B;  3M8P B;  4YHH J;  3VAJ A;  3TI0 A;  2HAI A;  3IR6 B;  3PIP Q;  3NGS A;  1QTN B;  4HVZ A;  3C15 A;  2CQG A;  1MU2 A;  2VPX B;  2W2M P;  1GTE A;  1H73 A;  3T9N A;  2LU1 A;  2UXD F;  5IQQ A;  1D09 B;  2HUR A;  2XMK A;  2ZNY A;  2CJY B;  1HNX F;  1VMB A;  5I3Q A;  3MF5 A;  3SV3 A;  2WBR A;  1RT1 A;  3U27 A;  2GVD A;  3TAN A;  3C15 B;  1MU2 B;  4JI7 F;  3T9Z A;  1ZM9 A;  4QOT A;  2B51 A;  1NUE A;  3HHN B;  3NS6 A;  3OFG A;  3GIJ A;  2P6T A;  4DR6 F;  3KMQ A;  2E7V A;  1NJZ A;  1Q78 A;  1S99 A;  1RT1 B;  3PG9 A;  2GVD B;  2QX0 A;  3TVK A;  4E2F B;  1I3O B;  1NB7 A;  3QAT A;  2FDN A;  1RTJ A;  4J7C A;  1QAX A;  4DSF A;  2VU5 A;  2L3M A;  2VON A;  3UPF A;  3MR5 A;  3IBC B;  3I4H X;  2EK6 A;  1R8C A;  4WK3 A;  3G8T A;  2AGO A;  1RXO B;  1V9O A;  3BKU A;  3NGU A;  3H4D A;  4B3T F;  2DR9 A;  3B4D A;  4YN3 B;  4BC7 A;  1RTJ B;  2XNR A;  1AXQ A;  2LDI A;  3R7B B;  3BS9 A;  3M8Q A;  3EIC A;  2VKR A;  1C1B A;  5HMX A;  2KI2 A;  2ROE A;  3GFZ A;  2B9Y A;  4OI4 A;  2CIM A;  4NYP A;  1HNZ J;  1SJQ A;  3ETO A;  4LR8 A;  3MXH P;  1TQL A;  2HBQ B;  3QRP A;  2WW8 A;  1EKR A;  3M8Q B;  2DKO B;  1C1B B;  5D4L A;  4ZVU B;  4Q8E A;  1MML A;  1NEE A;  2Y1I A;  4ED5 A;  1BQN A;  5ETT A;  1VRQ C;  1QVG R;  3WC0 A;  2JLF A;  3QWP A;  4NXN F;  3IMQ J;  3KHG A;  1WG1 A;  3DKD A;  4WFX A;  3BF4 A;  4B08 A;  1ZM4 A;  4U9R A;  4L6V 3;  5K14 A;  2DT9 A;  2WVF A;  2ROP A;  3C14 A;  4C0O C;  2CWK A;  3CJ5 A;  4AL5 A;  3TUJ C;  4J9L A;  1BQN B;  2F5G A;  1H6K X;  1LFW A;  1IJF B;  4LSL A;  2BM1 A;  1NM2 A;  4EEY A;  2HAF A;  1S1V A;  1BLU A;  4IO1 A;  4ETZ A;  3NGR A;  2IM1 A;  1W7W A;  5K8P A;  3KK2 A;  5K14 B;  3C14 B;  4K2X A;  3DOL A;  2N82 B;  2VFV A;  2R2S A;  2R8H A;  4LF5 F;  3CXC R;  2ZEJ A;  4OI1 A;  3TNV A;  4LSL B;  2HHP A;  4DU8 A;  3BB5 A;  2VIC A;  2J9C A;  2LQ5 A;  1S1V B;  2OI2 A;  4Z2X A;  8RUC A;  4RPF A;  1FT8 A;  2EFO A;  3KK2 B;  1TKZ A;  4X4P A;  3DOL B;  3AOD A;  1IR2 A;  1Q5Y A;  1PJ5 A;  3O3L A;  4KHM A;  2HND A;  3PW4 A;  2L9W A;  4IKA A;  1XN9 A;  4F3O A;  2PSZ A;  2MGZ A;  3CO0 P;  1KC8 T;  1UEU A;  4R25 A;  1TUV A;  2BAB A;  3GR0 A;  3W60 A;  1TKZ B;  3HT0 A;  2FVP A;  3OFE A;  1XWL A;  3N79 A;  2HND B;  1R0A A;  5DZ7 A;  1EQ0 A;  4YB1 P;  2AHO B;  1TTH B;  4ZMM A;  2MGZ B;  1R8A A;  3NMA A;  1ZH5 A;  2X51 A;  3K5O A;  1LK5 A;  2CPF A;  2W9C A;  2IYI A;  3PW7 A;  2Q6C A;  3CJ8 A;  1YJT A;  5KFC A;  3NL0 A;  1R0A B;  2BUN A;  3BR8 A;  3KHR A;  2Y1R I;  3SBM A;  1SC3 B;  3V6D A;  2NUU G;  3OTE A;  4CIO A;  3M9O B;  1I1G A;  2W9C B;  2M8D B;  3T6B A;  4ECY A;  3W5Y A;  2JFK A;  2ZC3 A;  3I96 A;  3AA9 A;  4OZ0 A;  3D66 A;  1LFP A;  2I38 A;  3V6D B;  4X62 F;  4AYB D;  3OVB A;  2UUA F;  3ITH A;  1RWU A;  2F63 A;  3T1H J;  2W8K A;  2CJK A;  4LF9 J;  4WF9 Q;  2ZM6 J;  1RHM B;  2Z58 B;  3PEJ A;  2V69 A;  4IG3 A;  1VQS A;  1RKI A;  3CNQ P;  3ITH B;  2DJW A;  3FBE A;  2FJW A;  4RL1 A;  2ZBQ A;  4K4X A;  2XYG B;  3TEH B;  3EDR B;  4USI A;  3E2E A;  1NND A;  3QMQ A;  5C7P A;  4N47 A;  2NS1 B;  4W90 B;  3QSI A;  4IG3 B;  4J9O A;  3J81 j;  3H42 A;  3SIP B;  2HHV A;  1CJK A;  3DM2 A;  4MIB A;  4CLU A;  2OEM A;  4LQ9 A;  4XDD A;  1S0M A;  5AE1 A;  3QGI A;  2GQC A;  5HSP A;  1SV5 A;  4ECR A;  2ACY A;  4NLX A;  2BXJ A;  4NA2 A;  1CJK B;  4NOH A;  3DM2 B;  4MK7 A;  4EYI B;  5FLX U;  1B0P A;  1WF2 A;  1U2F A;  4NLS A;  2MKH A;  1TUG B;  2HYI B;  3NNA A;  2XMT A;  2VOD A;  2HBR B;  1SV5 B;  1TFW A;  3LPE A;  2RUG A;  4A8K A;  3P49 B;  2D3O R;  4NMX A;  2ZJP Q;  1UJ5 A;  4CLP A;  1ZZF A;  3SV4 A;  1IVZ A;  1N5V A;  3W8P A;  1DQ9 A;  3ENQ A;  3AD9 C;  4J9P A;  3L09 A;  4MIA A;  1GMW D;  4YB5 A;  3P5T L;  2WOM A;  2OTL S;  3H90 A;  2DTJ A;  3I6P A;  1X9W A;  3W3S A;  4U8Y A;  5KG4 A;  2W8L A;  4DL3 A;  3HFV A;  3KUG A;  3PYG A;  1GX5 A;  3GQC A;  1VQ9 S;  3UE2 A;  2F3J A;  3BGU A;  3BGL A;  2MKY A;  4HEA 9;  2W2Q P;  3TQE A;  2X1G A;  4RW7 A;  2QYG A;  3T5J A;  4ECT A;  4IRK A;  2WOM B;  4DV6 F;  4NPO A;  5DLF A;  1FA0 A;  1U45 A;  2CNL B;  5FDL A;  3GLJ A;  1SKS A;  4QBU A;  2AJ1 A;  4F0M A;  1XQI A;  1VQM S;  1ZZN A;  2EC2 A;  4MFB A;  1NKC A;  2C2K B;  2WSC C;  3F0N A;  4J9N A;  2NYI A;  2DNZ A;  1N32 F;  1HW8 A;  2YWG A;  2KN4 A;  4K0K F;  4RW7 B;  1OJ4 A;  3HP6 A;  4LF4 J;  5DQH A;  3LTO A;  1LOU A;  2N7Y A;  4DQS A;  2Y8Y A;  4LF8 F;  5FDL B;  1XNQ J;  2HS4 A;  2O66 A;  1QSS A;  1T9V A;  3UCU P;  2ZKU A;  1TK8 A;  3FKB A;  3MTJ A;  4MFB B;  1VQY A;  2MLX A;  5CZX A;  4YOE A;  4OJH A;  4UOH A;  2OKQ A;  4DCJ B;  5IOL A;  4WK1 A;  2HQG A;  1KTV A;  4KPY A;  3I5C A;  1S1X A;  3JSY A;  3K8W A;  4DFK A;  3T6J A;  4KR0 B;  4DR1 F;  4KSE B;  3L7P A;  2V8G A;  1ZET A;  1V6H A;  1Q81 T;  5DJB A;  2VOO A;  1U09 A;  1CS4 A;  3EYZ A;  2HHQ A;  3CDE A;  4YUD A;  2MKS A;  4Y2A A;  3OTO J;  2WBM A;  1DTT A;  3TOQ A;  1S1X B;  3SCK E;  3CMQ A;  3TUP A;  2R8K A;  2DNM A;  5E7O B;  4CLK A;  1V5I B;  1CS4 B;  5HMW A;  3WQP A;  2BKP A;  4LJM A;  3TQ1 A;  1OY9 A;  4FPR A;  3H40 A;  2HFV A;  4RX6 A;  3MD3 A;  1DTT B;  1T03 A;  1T9W A;  2KXF A;  3FNN A;  2YH1 A;  1QVF R;  4LF7 J;  3UQS A;  2XSF A;  1O8B A;  1N5S A;  4OIX A;  4TU8 A;  1VQ8 S;  2AJF E;  2HGM A;  3OR2 A;  4M95 A;  4RU2 A;  1T05 A;  1YLX A;  3PNI A;  5KAK A;  1CPZ A;  2MZR A;  1HMV A;  2C2E A;  3THP A;  3KJQ B;  1T03 B;  1Q1K A;  2HMI A;  2H65 B;  3UFC X;  2CQC A;  2UZA A;  1VQO S;  2CPD A;  4C2M A;  4HI2 A;  3AD8 C;  1D9A A;  3OR2 B;  5EX3 A;  2R7V A;  1T05 B;  4OHZ A;  3A8K A;  4Y2K A;  4PR6 A;  5EWE A;  1HMV B;  2YKA A;  2HMI B;  3RRK A;  1XMQ J;  2HWI A;  3RYL A;  1WC6 A;  4EBD A;  4USU A;  1P1T A;  3PYD A;  2Q6B A;  4FYW B;  1S5Z A;  2NPF A;  3IO1 A;  5E2Q A;  4GKK J;  2IA6 A;  3T19 A;  4ATN A;  3QJJ A;  3K8V A;  2NZ4 A;  4W98 A;  3R5J B;  1SC4 B;  2AU0 A;  4OZ5 A;  1LW0 B;  3S6E A;  4RNF A;  2HQD A;  4LRD A;  1UKU A;  3MHY A;  1LKZ A;  4WWS A;  1SJR A;  3UNG C;  2CPY A;  4DL2 A;  2HZA A;  4BLG A;  4DV0 J;  2HFS A;  4PAB A;  3OFF A;  2N7C A;  1QUV A;  1UA0 A;  4C3M A;  1X4E A;  4E8U A;  3THV A;  4HAC A;  4K7Q A;  4CO0 A;  1S9F A;  2U2F A;  4YP3 A;  3ILJ A;  5HAO A;  4C7Q A;  1HNW F;  1QDU B;  1XEZ A;  1DQ8 A;  4PKD B;  2AJ2 A;  2Q43 A;  3FZB A;  3D6F B;  4ZJL A;  1RGV A;  4HAC B;  2EBE A;  5JXS A;  1U1R A;  1GAO A;  1L3S A;  2UU9 F;  1Q86 T;  1FI4 A;  4B3R F;  1IXK A;  1GEH A;  4NX9 A;  1MWQ A;  2KYZ A;  1N36 J;  5ETQ A;  2QRR A;  1N5Q A;  1PJ7 A;  3K5N A;  3T5K A;  3EZO A;  2Z4P A;  4ERD A;  3NOG A;  2HVE A;  1PGZ A;  2OTJ S;  3PRD A;  5FJ4 A;  1CQN A;  1RI7 A;  3US5 A;  3IR7 B;  4DR4 F;  1U7L A;  1B64 A;  5E3P A;  1FE4 A;  2J8S A;  4OQJ A;  3S1T A;  4DF4 A;  3VGT A;  2GA7 A;  5DGB A;  4LFB F;  2HFZ A;  2VQE J;  4D3G A;  2PMH A;  3CCU S;  4P2F A;  4JOU A;  3W9I A;  5F8I A;  1YSJ A;  4PXE A;  1FTC A;  1CJU A;  4DFJ A;  2R7O A;  4ZCM A;  5L46 A;  4GC6 A;  3OPK A;  2RKI A;  3HZG A;  2N4C A;  3VAM A;  2FHO B;  4XO0 A;  2H5J B;  3AOB A;  1F9F A;  3Q0A A;  4JI7 J;  1RBL A;  1U1P A;  1IR0 A;  4K59 A;  1YBU A;  2LEC A;  4UQG A;  1CJU B;  4F7V A;  4WZM A;  3CED A;  1FWL A;  5ETL A;  1JJC B;  2RKI B;  3MEG A;  5SUH A;  3GWC A;  1X0F A;  2JSX A;  4YEA A;  1TAQ A;  3ZTP A;  2FZC B;  2JVO A;  2AKW B;  1WKK A;  1WC0 A;  3UDL A;  1RHR B;  1P9Q C;  1NHU A;  5CA5 A;  2OD4 A;  4PG6 A;  2GHV C;  4LUB A;  3CTR A;  4F8R A;  5A2Q Y;  2A1B A;  4UZB A;  5IV4 A;  3MEG B;  5KFK A;  2APO A;  3RG6 A;  5KFS A;  4NAS A;  2EC0 A;  3QT6 A;  1Q0N A;  1HHT P;  2IAJ A;  3CJ2 A;  1NK7 A;  1SVD A;  4NLT A;  3FSI A;  2QJ3 A;  1S6U A;  2XZT B;  3D0I E;  3VR1 A;  2K7K A;  5F8G A;  1HQE A;  4JI6 J;  2IAJ B;  3M8W A;  3ZZR A;  4DV2 F;  4C48 A;  4JI3 J;  2O1P A;  2V9K A;  2GMJ A;  3G8Q A;  1BWV A;  4YME A;  5MLC V;  4PWW A;  3MTK A;  3CIZ A;  2WB1 D;  3UDV A;  1HQE B;  4CLY A;  5F41 A;  1HQU A;  2DHH A;  2DEI A;  1FDD A;  4OYX A;  1X5P A;  3B8H A;  3QZ8 A;  3DFE A;  3PO5 A;  4PWU A;  2RH3 A;  3KNG A;  2DH7 A;  1M1H A;  5J1P A;  1HQU B;  1LWE A;  1NZA A;  2E44 A;  2ADB A;  1Y11 A;  3F73 A;  3RB0 A;  1PBA A;  2F4V F;  2FZG B;  5C42 A;  3AD7 C;  4G1I A;  1K73 T;  1LEO A;  3D9B A;  3CDU A;  2YWK A;  2Z0G A;  1LWE B;  2KXH A;  5LSL A;  3CCV S;  1IQZ A;  2GJI A;  1S97 A;  4B3M F;  3TUI C;  3IRX A;  2IPO B;  5C42 B;  2YVS A;  4MIW A;  2HVH A;  2W7O A;  1VS3 A;  3GSI A;  2DH9 A;  1K1Q A;  3IWN C;  1HA1 A;  1SPB P;  4URQ U;  5K20 B;  4FYV B;  5KFW A;  3GFX A;  1EAR A;  4M94 A;  3PW0 A;  2RIL A;  1HW9 A;  4TQR A;  4EUV A;  3TVZ A;  4C97 A;  5KT4 A;  3NCR A;  1HBN A;  1ZBT A;  4PCQ A;  5SZT A;  2BAN A;  1KQG B;  2ZHB A;  4MT1 A;  3R8Y A;  2ZBI A;  1ZTT A;  3NWG A;  1CG2 A;  1FD8 A;  2MJU A;  2K7J A;  2YH0 A;  1HBN B;  4FBU A;  4B9L A;  1FFW B;  2V2Q A;  2QMX A;  3J7Y I;  5CHC B;  2XEX A;  2BAN B;  1T8E A;  2MQL A;  3O1L A;  3JXO A;  4X4Q A;  1PYO B;  4RNH A;  5KFM A;  2E1C A;  2OAU A;  1S9G A;  5E3Q A;  3QFW A;  4RUH A;  5KFV A;  1T0T V;  3CPW R;  2R7Q A;  3ZNU A;  1BQM A;  1JLQ A;  3BGR A;  4PPZ A;  2XY7 A;  2X1B A;  4J37 A;  2W4D A;  1OYD A;  5IFM A;  2CQD A;  1NDP A;  4FPI A;  2WB4 A;  4WP9 A;  4AND A;  3B4M A;  2HRT A;  3H5X A;  1FES A;  5B0A A;  2MQQ A;  3LH2 S;  2B3T B;  1KVJ A;  1S9G B;  2UUA J;  2ZIT A;  3B78 A;  5IM0 A;  3CCW A;  3K89 A;  3RB4 A;  1BQM B;  1JLQ B;  2GQQ A;  3BGR B;  3O8W A;  4U8V A;  2EFN A;  2Z30 B;  5DDR C;  3RZA A;  5AE2 A;  1J5O A;  2VFU A;  1KON A;  1ZAV A;  3DXB A;  4O4G A;  4H4O A;  1VR6 A;  4OHX A;  4P6Q A;  5IM0 B;  4DPW A;  5IV3 A;  4I2Q A;  4DXL A;  2JX2 A;  3NS7 B;  3D3C J;  3R27 A;  2E66 A;  3TZZ A;  1Y5N B;  3M6V A;  1J5O B;  3M9M B;  1XTZ A;  2W2O P;  4O4G B;  4H4O B;  3HJV A;  1A0O B;  4O3N A;  1RB0 A;  1HWJ A;  4I2Q B;  1RAO A;  2HBZ B;  5ADZ A;  3DDK A;  5F8H A;  1DZ5 A;  2YPY A;  4EZ9 A;  1VIS A;  4NA3 A;  3RB3 A;  3PDN A;  4C0B A;  1AFJ A;  4GKJ J;  1HWU A;  4J9K A;  3VAI A;  2G13 A;  1OPZ A;  3CUL A;  2DK2 A;  4CLT A;  1RQ0 A;  3Q8Q B;  1KFS A;  1Q53 A;  2H1Y A;  2FJA B;  3PJW A;  4CM0 A;  2VJV A;  2C3P A;  3D6M B;  2YKQ A;  4C8Y A;  5GMK a;  1NKB A;  1GMV A;  1OS5 A;  3NOC A;  4OYB A;  1U2R A;  4L75 A;  5LMN F;  2HW3 A;  2IJR A;  4U95 A;  3H25 A;  4K4Y A;  2FVC A;  2BE2 A;  4KTQ A;  2F8H A;  4AT1 B;  4IFY A;  2UP1 A;  4NLU A;  4LRC A;  4LBP A;  4DX6 A;  1H72 C;  4WFA Q;  3KLE A;  1XMO F;  3FSY A;  3DLB A;  3LWM A;  5KFN A;  1URR A;  3DRP A;  4UW2 A;  2NYH A;  1N54 B;  2FHJ A;  3F41 A;  2BE2 B;  2YQ1 A;  2ZH6 A;  5GAH I;  4IFY B;  4GMK A;  1SC1 B;  3MM8 A;  3CJS A;  4EK2 A;  1FNX H;  1KVI A;  3KLE B;  4RNN A;  2AZ1 A;  4K0K J;  2CJB A;  2GGP A;  2OMO A;  3R5D A;  2E1R A;  1VBZ A;  3DRP B;  5THW A;  1KR4 A;  1B4S A;  5KFF A;  2PFD A;  3PW2 A;  2QLW A;  4O3R A;  2HNY A;  1FJ7 A;  4J9V A;  4CLF A;  4I6A A;  1TUW A;  1ICE B;  3MM8 B;  2HQF A;  3SCJ E;  4DQR A;  4Y6I A;  5CAB A;  3KK1 A;  2G0I A;  1RHJ B;  2GGP B;  9ATC B;  3FBF A;  4DX8 H;  2KFN A;  1RSC A;  2VD3 A;  5B0E A;  1P9Y A;  5L1L A;  2GS8 A;  2HNY B;  2LEA A;  3FEX B;  1DLO A;  5C24 A;  2EFV A;  2C2R A;  1G7C B;  3FGV A;  4X64 F;  4HDH A;  3V6J A;  1X8D A;  3KK1 B;  2DNO A;  4MK9 A;  3BRE A;  5D0E A;  4KYZ A;  4URG A;  3NP5 A;  1DLO B;  5C24 B;  3NNH A;  4O4R A;  4ZP7 A;  4DCP B;  3ZFV A;  1VBY A;  4ILR A;  5CQG A;  2FVR A;  1JNR B;  3TX8 A;  1N4L A;  1TZ0 A;  4OHY A;  2FC9 A;  3TAM A;  4DR3 J;  2DB1 A;  3IS9 A;  2CRL A;  4FVC A;  5KFG A;  2CPE A;  1UJ6 A;  3MM9 A;  2YBV A;  5A8K A;  3R2C J;  3R1L A;  2C2M B;  2P6S A;  4M8L A;  3TAM B;  5C5J A;  1YJ7 A;  3IS9 B;  5HBM A;  4QJV A;  4B9V A;  4L3K A;  5AT1 B;  4BDP A;  3EWG A;  2HS3 A;  2J9D A;  1S10 A;  1P27 B;  4LSZ B;  1LV5 A;  1UTA A;  2CQ4 A;  2CQB A;  3MM9 B;  2Y8W A;  2DR5 A;  4CP5 A;  5DM6 Q;  4ZLL A;  4ZHR A;  5A8K B;  1HFE L;  4I4B A;  3T5H A;  4IR1 A;  2QG9 B;  4IH7 A;  5HBM B;  1F5B A;  1UL3 A;  5A2Q U;  4QWC A;  3TA0 A;  2ZH8 A;  1YJ9 S;  4XPC A;  4ZPV R;  2CAJ A;  1KP6 A;  1TMM A;  1WKJ A;  2RDJ A;  5DLG A;  4ZHR B;  2QC3 A;  4UUX A;  1X5S A;  3HHL A;  4WYL A;  4PG7 A;  1EIY B;  3GV5 B;  1REG X;  4JI8 J;  1NSK L;  1U6F A;  3K5P A;  2GHW A;  4NYZ A;  4ZVR B;  3HKZ D;  2W2N P;  1JLE A;  2CQ3 A;  1XIQ A;  3M32 A;  2A6O A;  1TAU A;  5EGY A;  4A8Y A;  5E5N A;  1OO0 B;  3WC2 A;  1PYS B;  2E5L J;  4L76 A;  3X3U A;  3HHL B;  2EFG A;  1R3N A;  3MEC A;  1UVK A;  1OWX A;  2E5J A;  3F44 A;  2YQ0 A;  3GCW P;  5DDQ C;  4ILM A;  1P8G A;  1ZS6 A;  4ED8 A;  4UY8 5;  4KY3 A;  1JLE B;  3NCP A;  5CCL A;  3M32 B;  4F3M A;  3ZZZ A;  5LXR A;  1GXT A;  5KG1 A;  4N56 A;  1NB2 A;  1X9M A;  5D8H B;  3CD0 A;  3MEC B;  1N33 J;  1UFW A;  1RCX B;  5K8N A;  3C46 A;  2LP4 A;  2IYG A;  4XAK A;  4Z7Y A;  1T9U A;  4F02 A;  5C25 A;  2UU9 J;  1RWO B;  4TKT A;  1KNZ A;  1LNQ A;  5M2U A;  3K2Y A;  2W24 A;  3OXG A;  1C0T A;  2DNL A;  4N5S A;  3CE8 A;  5EX0 A;  2DGS A;  4B9T A;  2EVZ A;  1R31 A;  4JI2 F;  5C25 B;  4DR4 J;  4JYA F;  4RU9 A;  2DPJ A;  1UP1 A;  1H3D A;  4J90 A;  3LA0 A;  1NPK A;  4AUK A;  3L7U A;  4YHH F;  3LW5 C;  1C0T B;  4LFB J;  3NY0 A;  1TK0 A;  4YY3 F;  2VAS A;  5KOX A;  3KLF A;  3Q83 A;  2RHQ B;  3MR7 A;  2D3U A;  2ZZM A;  1FXL A;  3KLG A;  1CJV A;  6FD1 A;  1JJ4 A;  4LFC J;  2HGL A;  2X1A A;  1CBK A;  4HI1 A;  3D28 A;  1L5U A;  2B9X A;  2W4P A;  3KK3 A;  4ES3 A;  5FD1 A;  2P5V A;  2OSR A;  2OPP A;  1Y7P A;  3KLF B;  3KOA A;  1RUS A;  5ETS A;  1T9T A;  3EXY A;  1RTH A;  2V5H G;  1YRU A;  1UEK A;  4OV1 A;  3KLG B;  1CJV B;  3SCI E;  5D4N A;  1UVJ A;  1NPR A;  2ZNZ A;  2K1R A;  4YR0 A;  3E8O A;  3KK3 B;  1Y00 A;  2X7I A;  2OPP B;  2ZHO A;  3H5U A;  1RTH B;  4F4A A;  1H2U X;  1P1L A;  2JH3 A;  3R5A A;  3KTQ A;  3OXL A;  2K1R B;  2UXC J;  4OYM A;  3M2R A;  2KG0 A;  1WEX A;  1N0V C;  2ZH3 A;  2YNH A;  2FTR A;  3ZZT A;  4NLP A;  4PUO A;  3CJT A;  5JVG Q;  1UFK A;  1F0X A;  1FNO A;  2M0G B;  3H5S A;  2KKH A;  5D0H A;  1SC6 A;  1Z4U A;  4WTO B;  4DPU A;  3VQS A;  3A12 A;  5DQG A;  5D4P A;  1T02 A;  2LXI A;  4ZVF A;  2I2Y A;  1U1K A;  2FVQ A;  3EPI A;  1SQE A;  4DHV A;  3MDF A;  3M2R B;  2YNH B;  4HTI A;  4NLR A;  1ROF A;  4PUO B;  4X2B A;  1IKW A;  2CDR B;  2CPI A;  4DSE A;  4MTP A;  3R1H A;  3MM6 A;  2B43 A;  1AUS L;  5DO2 A;  4OYP A;  2PMZ D;  1FRK A;  1HR0 F;  3SDE A;  5JJB A;  4CI0 B;  2MZQ A;  3M30 A;  2H5I B;  4LF2 A;  3ZNJ 1;  1FRL A;  2HQ3 A;  5LJ3 Y;  1IKW B;  4EGL A;  1V3R A;  2R2U A;  3VGS A;  3MM6 B;  3SEO A;  1L3K A;  3QQC D;  2XMV A;  4FF1 A;  4UTG A;  2CUY A;  1BC6 A;  3SDE B;  4USV A;  1JLB A;  3GFH A;  1FER A;  3M30 B;  2RJZ A;  3TUZ C;  3MI7 X;  2CQ1 A;  3NNC A;  2AT1 B;  2V34 A;  4KH0 B;  1HI8 A;  2IHR 1;  4KGM A;  3H2U B;  2DIU A;  3J7A N;  1YIJ S;  3FQK A;  4NLV A;  2F4V J;  1JLB B;  4MKB A;  2Y1L B;  4I56 A;  1M0S A;  2XBP A;  4QQB A;  2RML A;  1JJH A;  3RRG A;  1UWB A;  2OFH X;  4F67 A;  1N0U A;  1A9N B;  3EMT A;  2GJF A;  1RE1 B;  3PRV A;  3RBX A;  3N01 A;  1KLN A;  4CO4 A;  4M5H A;  1FWK A;  2PII A;  1VOM A;  4ECU A;  5DS7 A;  2ILY A;  3SCL E;  1TKX A;  2HFO A;  4K4T A;  2ZZT A;  1S0N A;  1FX4 A;  2QO3 A;  2MZ1 A;  1UWB B;  4DUT A;  3DMJ A;  3T1Y J;  1ZPW X;  2O3D A;  4B02 A;  1X4A A;  3ZZ0 A;  4DJB A;  1BXN A;  1VIX A;  2G2O A;  4O3Q A;  4P72 A;  1VC6 A;  3DRR A;  4UZC A;  1SJ1 A;  2JVR A;  2MQP A;  1TKX B;  2MY8 A;  4V19 J;  2IA0 A;  1FRM A;  2MPU A;  3DMJ B;  3LUY A;  2RS8 A;  4EZ6 A;  1QLN A;  3BN7 A;  1X0P A;  1LQ9 A;  3OSN A;  4XIU A;  5DG8 A;  3DRR B;  2N4D A;  3K5L A;  3MFI A;  1H7W A;  3LPY A;  1S4E A;  2IMO A;  3S01 A;  2RSQ A;  2VFT A;  3HVA A;  2QTW A;  1S0O A;  3NGT A;  5KTQ A;  4LQ3 A;  5D3G A;  4TY8 A;  2DIV A;  5F3T A;  2OP5 A;  1SIW B;  3BQ2 A;  3PEH A;  2KTQ A;  2VBX A;  4ZPD A;  4QYR A;  1WUU A;  1Y9O A;  4EU0 A;  2XQC A;  3T3F A;  1YRT A;  3WX4 A;  3N28 A;  4WP3 A;  5KFD A;  1F5A A;  2I8E A;  5D3G B;  1XC9 A;  2DGT A;  4TY8 B;  1XK8 A;  2FLN A;  2HVI A;  3Q8R B;  1U6B A;  3NGD A;  3J7Z 5;  2G9O A;  3RTV A;  5T7L A;  4ZA1 A;  1REV A;  2V2V A;  2KHC A;  3DYA A;  3T1H F;  3GIK A;  3VGU A;  3NWR A;  4LF9 F;  3CDB A;  1V3Z A;  2DR7 A;  2MKJ A;  1QTM A;  2OEK A;  5KT6 A;  4GVL A;  3F56 A;  5T7L B;  1XR5 A;  1X5O A;  1REV B;  4ZJO A;  2GNK A;  3L95 X;  6AT1 B;  3CVK A;  2JC0 A;  5GAE U;  3DYA B;  3EPG A;  2XY5 A;  4BCA A;  2QMW A;  3EGZ A;  4USH A;  2OFG X;  5F0U A;  3RR7 A;  1VK8 A;  4UST A;  2FJX A;  4K4Z A;  2Y3Y A;  2GZO A;  1IWG A;  2XS7 A;  4WU2 A;  3H5Y A;  4HHH A;  2WVC A;  3KYL A;  4IRD A;  2LVW A;  1B70 B;  2Q3P A;  1FFG B;  3NG8 A;  2DIT A;  1RWV B;  2M5Y A;  5HJY A;  2KM8 B;  6FDR A;  2B4V A;  4ANC A;  2WTF A;  1HNI A;  4MJK A;  2Q1L A;  2RVJ A;  3ENV A;  4YQW A;  3GYX B;  3S7R A;  4P2X A;  1DUR A;  1I6J A;  2J76 E;  4OFZ A;  2X3D A;  3BO2 A;  1RIS A;  4HLB A;  3CO9 A;  3TZX A;  1NK5 A;  2KRR A;  1HNI B;  1CJT A;  2BX6 A;  1UPP A;  3DLG A;  3CW2 C;  3D6T B;  2CNK B;  1GX6 A;  4DV1 J;  1N5T A;  2UUW A;  3FCW A;  1JNZ B;  2ZE2 A;  5LMN J;  1IBM J;  4D3H A;  3TX0 A;  3IFE A;  2R8G A;  1OMS A;  1OQ6 A;  3GG0 A;  2PA3 A;  2OEJ A;  4QPX A;  2FJB B;  3DRX A;  4RNO A;  5KG2 A;  4CDI A;  1CJT B;  2B56 A;  3R3T A;  3DLG B;  4NRT A;  4WBF A;  2ZE2 B;  1KVK A;  4DR2 J;  1RTD A;  4DL0 C;  2J6U A;  3G71 S;  2W7P A;  1SJ4 P;  2YKN A;  4A46 A;  1UVM A;  1VRU A;  4KJI A;  2YKO A;  4UT4 A;  2NLW A;  1B7F A;  4KPC A;  3LGH A;  2BJ3 A;  4DR7 F;  4WE1 A;  2PE8 A;  4M5N A;  1RTD B;  2YKN B;  3UCG A;  1VRU B;  1XNQ F;  4TXS A;  2QA1 A;  2MDA A;  2CPZ A;  3GCX P;  3H0P A;  3M8Z A;  4MKV A;  1YWX A;  4EBC A;  3AHP A;  4B3O A;  1DY3 A;  4OLO A;  1KEK A;  4WE1 B;  4Q7A A;  2X3G A;  1VLO A;  2DXF A;  3D4J A;  2V6A A;  4KHR A;  3M8Y A;  3KFW X;  3QIP A;  3Q8P B;  2ZH5 A;  1W2I A;  1OY8 A;  4X64 J;  4DDF A;  4OX9 J;  4IG0 A;  1GXU A;  4B3O B;  5EUH A;  1F3V A;  4HL9 A;  1QD1 A;  3H7H B;  4Z7C A;  4OZ3 A;  2ZDO A;  2HPU A;  3T5L A;  4EWT A;  2DNQ A;  3QIP B;  3CIM A;  4O44 A;  1U1O A;  1URN A;  3W66 A;  4LFA J;  5GAG I;  1WI8 A;  4IG0 B;  4MMO A;  5E3R A;  5HLF A;  4BWM A;  1N8R T;  1N52 B;  1X31 C;  2DGO A;  2C2Z B;  4DL5 A;  4JV0 A;  2DCU B;  3OUY A;  5F8L A;  4LF7 F;  3PFE A;  2BA9 A;  3KG0 A;  1LXN A;  3W9H A;  1QUP A;  4O44 B;  3W2W A;  3CC2 S;  5A8W A;  2IC3 A;  4DL7 A;  3PR5 B;  5HLF B;  3IRW P;  3PXG a;  3ZXW A;  1KDN A;  3D54 A;  1R43 A;  3JSM A;  1D9D A;  3M9N B;  2L48 A;  4W92 B;  3OUY B;  4HH1 A;  3VZH A;  1UW4 A;  2KJV A;  1KHV A;  1I5O B;  4WJB A;  3W2W B;  1KOO A;  5A8W B;  1S57 A;  1UET A;  2DNG A;  3AFG A;  2NXN A;  2GW8 A;  4K4U A;  2IC3 B;  3V4M A;  2MHN A;  1J2V A;  1FJC A;  4FDF A;  4NLY A;  4IOC Q;  2RQC A;  1EJ7 L;  2FJE B;  1M90 T;  1XBW A;  5HQL A;  3JSM B;  3H8Y A;  2HSE B;  1VBX A;  4UUW A;  3EJM A;  2AD9 A;  2PD1 A;  2YY3 A;  3PYE A;  2ILZ A;  4KGK A;  2OSQ A;  2XB2 D;  4PWD A;  1WHW A;  5F8J A;  1VC0 A;  1N56 A;  3H4B A;  2ADC A;  2AX0 A;  4F50 A;  1VQN S;  1D0E A;  3VQT A;  2V0N A;  3BO4 A;  1GTH A;  2NSC A;  1B0V A;  4YR3 A;  4IRC A;  3BZQ A;  4PWD B;  1HYS A;  2HQI A;  2Z57 B;  1U02 A;  4FNI A;  4DV0 F;  5AXN A;  5B0C A;  2V4R A;  2UV8 G;  2CQ0 A;  4HDG A;  2Z2L A;  3IBF B;  1NH7 A;  3DLE A;  3MAH A;  2CA9 A;  2ZKT A;  2PGC A;  2CPX A;  2VV5 A;  1VCT A;  5B09 A;  1HYS B;  3ONQ A;  1ZA2 B;  1WAC A;  2E1P A;  3PHE A;  2VFS A;  2HNZ A;  4X4T A;  1MMN A;  2U1A A;  4HKQ A;  1RCO B;  3DLE B;  2XO6 A;  1AYE A;  4U96 A;  2KXN B;  5T41 A;  3BQ0 A;  3QLH A;  1WG5 A;  3UD4 P;  1VK3 A;  1VRT A;  5KFE A;  1B99 A;  3W9J A;  3KJF B;  2R7R A;  9RUB A;  2W9A A;  5IC6 B;  1LK7 A;  3TWZ A;  4RZR A;  1MNE A;  2ZBC A;  2VIH A;  5K9F A;  3U1M A;  2HNZ B;  1HAR A;  4KAI A;  1HKA A;  4WPA A;  3X1L B;  2AEF A;  2VDI A;  3QLH B;  4ZDN A;  4YDD B;  3CD6 S;  4B9N A;  1VRT B;  4YY3 J;  2DNR A;  1H7X A;  1NK6 A;  1J5E J;  4EI2 A;  3B6B A;  2VQE F;  3N6M A;  3UR0 A;  1RHU B;  2R7U A;  3IM9 A;  1RAH B;  1UFL A;  1FE0 A;  3BQ1 A;  4USM A;  2JHE A;  1SL0 A;  4GO5 X;  5CYM A;  4O3S A;  1O51 A;  5ETR A;  3BV8 A;  5GAD I;  1AT1 B;  5H9E K;  1IKY A;  2K3I A;  4EO8 A;  4C8M A;  3GON A;  4GC7 A;  2GV1 A;  2ZOG A;  1FKO A;  2ZD1 A;  5HAN A;  4ES1 A;  4ZVP B;  2OUG A;  1EB0 A;  2OLW A;  4OLP A;  4OYW A;  4LVO P;  5CYM B;  4ZLP A;  3ISN C;  2DHA A;  3CMA S;  3D67 A;  4DX5 A;  1P6T A;  1IKY B;  4KV8 A;  4L3N A;  4V1A k;  2AQ4 A;  2J6S A;  4QU6 A;  4KH1 B;  1U1Q A;  3G87 A;  4NZ0 A;  3CJK A;  1YGY A;  2ZUA A;  1FKO B;  5KT2 A;  2ZD1 B;  3MMA A;  2AJQ A;  3GIR A;  1Q7L B;  1Q5V A;  5BYS A;  2VA2 A;  2FHJ D;  2GHP A;  4RBT A;  1U2C A;  4KQZ A;  1O6X A;  3AQP A;  1KQK A;  5L39 A;  2CVI A;  4H54 A;  4F4X A;  1UEV A;  1YZ7 A;  4KV8 B;  3N6L A;  3HI9 A;  2MKK A;  3M2U A;  3HDS A;  3CJK B;  3HF5 A;  3MMA B;  3Q2T C;  4I7F A;  3EX7 B;  1Q8K A;  2WVE A;  1TMJ A;  4ZVO B;  4NXM F;  2GAH C;  4OI6 A;  1K47 A;  3SYZ A;  4S0M A;  3ISN D;  2VOP A;  4JI6 F;  4N8O A;  2DGW A;  3M2U B;  4JI3 F;  4Y2C A;  1HR0 J;  4NLG A;  4WYW A;  1ZM2 A;  2DO0 A;  2YX1 A;  4I7F B;  5E3A A;  2HHS A;  3A3O B;  2XGP A;  2YWH A;  2B9E A;  4LF6 F;  5KFY A;  4C98 A;  2MB0 B;  1IM4 A;  4OI2 A;  2ZOM A;  2BYC A;  2XZW A;  4GRS A;  4WXW A;  4LR7 A;  1IR1 A;  4PPD A;  1JLC A;  2CDQ A;  5DRK A;  3OL9 A;  3ICL A;  5A6P A;  4PQU A;  4WTY A;  4U7U K;  1SKW A;  2PDA A;  4AL6 A;  1TVR A;  2DNN A;  1XJW B;  5L9N A;  1CLF A;  1F3F A;  1FKP A;  2LXU A;  4Q44 A;  3R6G B;  2HS0 A;  1JLC B;  2XUL A;  2OH2 A;  3QWU A;  1NAQ A;  4PQU B;  1OY6 A;  2E5G A;  3HX9 A;  2B5J A;  1TVR B;  3HHL C;  3BSA A;  2DEJ A;  1BMQ B;  2LLZ A;  4R5P A;  2VHG A;  4MYT A;  2ROG A;  1SL2 A;  3TEG A;  1FKP B;  4CO1 A;  4LBI A;  1JJ2 R;  4U67 Q;  4XDC A;  1UWA A;  4A8F A;  2K2P A;  2B5J B;  1LXJ A;  2R7T A;  1XR7 A;  1RJJ A;  4R5P B;  5LSO A;  1PC4 A;  2B4P A;  2DHS A;  3UN3 A;  2MMY A;  2FQQ B;  4HYK A;  1FK9 A;  4FF2 A;  3R2D J;  1NDK A;  1UCN A;  2CZ4 A;  1YKW A;  4JB8 B;  1TV6 A;  3QSY B;  5HN0 A;  1U6Z A;  5ETP A;  2V4Q A;  1TFY A;  3HHL D;  3AOC A;  3U1L A;  1U1M A;  3EZ5 A;  4W4M A;  3LF0 A;  4FNH A;  3UWT A;  1FK9 B;  4LMZ A;  1S76 D;  3OR1 A;  1WDD A;  5MAO A;  5DDP C;  1NHK L;  1TV6 B;  2XNQ A;  2QMU B;  3A8I A;  2QGF B;  2J0X A;  2IRU A;  3R5C A;  1M5K C;  4IQM A;  2ZBR A;  2F1F A;  2ZZN A;  1EKS A;  3CCR S;  5KFJ A;  5F9N A;  4PXD A;  2AMC B;  2HZC A;  5LSR A;  2FPH X;  2KJW A;  2BQ3 A;  4MK8 A;  1E6V A;  4JBC A;  4OHW A;  3EXC X;  3OR1 B;  3C2P A;  2EKN A;  2O5D A;  1V3S A;  2CQH A;  2D1C A;  4ETX A;  3VWS A;  3V2U C;  4X4O A;  5KFP A;  3BKF A;  2B8Q A;  4CNZ A;  1RYS A;  3K5M A;  4M1K A;  4CWB A;  2V50 A;  1EX8 A;  2GIQ A;  2RDD A;  4DG1 A;  1S6P A;  4PRF A;  1E6V B;  3QID A;  3GII A;  3SFG A;  2WVB A;  3DC2 A;  1WOS A;  2D74 B;  1B7Y B;  1D3W A;  2M52 A;  1U4B A;  2AZ3 A;  3MR6 A;  4FVM A;  2LDY A;  1F9E B;  3UR3 C;  3GV7 B;  4DG1 B;  3JAM Y;  1S6P B;  4CT9 A;  3L4B C;  1QJH A;  2BV3 A;  1WTF A;  4JV5 F;  3EGW B;  2KT2 A;  1AW0 A;  2AYE A;  1SI9 A;  1BD6 A;  5AXM A;  1RLC L;  4XK8 C;  4DV7 J;  3QRR A;  1KN6 A;  2C2D A;  5IS2 A;  4ZVH A;  2FD2 A;  2CG4 A;  2RRB A;  2L9N A;  2C22 A;  2EKY A;  1Y5L B;  3W1Y C;  3BBB A;  4IFV A;  2R7W A;  2IFX A;  2ZH1 A;  4O0N A;  4I1T A;  1UPM B;  2BM0 A;  3KUH A;  1TK5 A;  4UY8 T;  1Z2L A;  3K0J A;  4Y28 C;  2CKW A;  1RTZ A;  1VQK S;  4ED3 A;  3BEG B;  1QY7 A;  2RQM A;  4DR5 J;  1S6Q A;  5M2P A;  4GKJ F;  4DSK A;  4IFV B;  1NJI T;  4FXV A;  3DGV A;  4ZPC A;  2EG1 A;  2EG2 A;  3HT3 A;  3OTD A;  3PW5 A;  4Y2M A;  2CJA A;  1S72 S;  4WFN Q;  4FBT A;  3CDW A;  3RW7 A;  2H51 B;  1Q8B A;  3DCA A;  2H4W B;  2DGV A;  1BGX T;  3W61 A;  1S6Q B;  5CCM A;  2VDH A;  4JI0 J;  1K0T A;  3KKF A;  2KVQ E;  3WZ0 A;  3EVW A;  3U1N A;  3IAM 9;  2R7S A;  3DNC A;  3V81 A;  4HHJ A;  3BPD A;  2CWX A;  1DHM A;  1RT4 A;  1FCA A;  2GFF A;  5CD4 H;  1N6Q A;  1VLY A;  3N0V A;  2FGC A;  2ZOF A;  2YNG A;  1E6Y A;  3BBF A;  2VBZ A;  3IP0 A;  2XWX A;  2HGN A;  3V81 B;  2GX8 A;  2RQ4 A;  3ADA C;  5J1E A;  3THT A;  4DV5 F;  2KFY A;  3I0R A;  2R8I A;  5IWA J;  2A10 A;  1RT4 B;  1IBC B;  4OZL A;  1R7I A;  3M6U A;  5IZH A;  3V6H A;  1N6Q B;  4P7V A;  1QSY A;  2YNG B;  1UW9 A;  2G4B A;  4JI5 J;  1E6Y B;  4DR7 J;  3CCL S;  2C28 A;  3DRY A;  5J1E B;  1OYE A;  2Q79 A;  3I0S A;  3I0R B;  3G4S S;  4B9M A;  2HEK A;  1H74 A;  3HKW A;  3KHL A;  2O01 C;  3B82 A;  2RUS A;  3LO3 A;  1RWP B;  3DHW C;  3IR5 B;  2L08 A;  4HT7 A;  1NJY A;  1EQM A;  3P4U B;  2IM2 A;  3OV7 A;  1YQH A;  3I0S B;  3MUT P;  4ED2 A;  3SFU A;  4ID8 A;  3WX8 A;  1Q16 B;  3DHX A;  1ARO P;  3FRZ A;  4DSI A;  4Y3C A;  2DVI A;  3UI3 A;  4DUZ F;  4RWW A;  3LP0 A;  1JLA A;  3QT8 A;  4H4M A;  3CD5 A;  1RWN B;  1NDL A;  2OD6 A;  1SQG A;  2J7U A;  3AJD A;  3QT5 A;  4F26 A;  5H9E J;  1Q95 G;  1G6B A;  3MPV A;  2M8H A;  3N9U C;  2B8P A;  2W25 A;  3KWM A;  2UVU A;  4CLS A;  4UOC A;  2QEX S;  3DU6 A;  3LP0 B;  1JLA B;  3OJS A;  3BN4 A;  4H4M B;  2J0S D;  4DR3 F;  4DL6 A;  1F1B B;  2B4U A;  1RA7 A;  3OTB A;  1YBT A;  4B3S J;  3I56 S;  4R0J A;  4F4Z A;  4KT0 C;  3OJU A;  2FGO A;  2MKC A;  3K57 A;  1C4A A;  1Q79 A;  2BMB A;  1X4F A;  3R5B A;  2CAD A;  4DUY F;  2MTL A;  4M5M A;  2MJN A;  4K5S A;  1K1S A;  1R8B A;  2DY9 A;  5F3Z A;  1JX4 A;  1PCA A;  2IBK A;  1JMT A;  1Q8L A;  1LW0 A;  4IQX A;  1LWC A;  3I4P A;  4PXB A;  5B0G A;  3UN2 A;  2V9W A;  4DPY A;  1DBD A;  3ULH A;  4PAA A;  3CJ3 A;  2DHX A;  2A6M A;  2QLB B;  3A8E A;  2AJ4 A;  3UCZ P;  4JI8 F;  4Y34 A;  3CDA A;  1LWC B;  5A6W A;  3ELH A;  4Q2L A;  1NKE A;  5KFX A;  3R5G A;  2KM8 C;  1MW7 A;  2WHO A;  2ZVI A;  3DLL Q;  2BOA A;  2CQI A;  3HFK A;  1ZOT A;  2KFZ A;  3GPA A;  2E5L F;  2G2Z A;  2EFQ A;  2RNE A;  1KSP A;  4DV4 F;  3GIM A;  4RW6 A;  3V6K A;  4J9U E;  3VAH A;  4YFU A;  4ICL A;  3PTW A;  5LMU J;  3JQM A;  3C3L A;  3EZU A;  1NSA A;  2PI5 A;  2YTC A;  1T9X A;  2NZC A;  4FXW A;  3ZTR A;  3DN9 A;  1N33 F;  4RW6 B;  3OT9 A;  1I94 J;  2NXC A;  4ICL B;  4QWA A;  2DO4 A;  4DSL A;  4X66 J;  1L3T A;  3MD1 A;  1X4C A;  2YX4 A;  1TL4 A;  2QZ8 A;  2GMH A;  4ECV A;  4C8O A;  4NCA A;  4LRE A;  3VGV A;  4K2J A;  2RHS B;  2LQB A;  5C2C A;  5F9L A;  2D41 A;  4F3Q A;  4NLW A;  3IA0 A;  2XCA A;  2D9P A;  1N34 J;  3IBW A;  2XYP B;  1KRP A;  3HXM A;  1WHY A;  2BQU A;  3SSS A;  1YRX A;  3J7Z T;  2DR6 A;  2KB2 A;  5DQI A;  2DGX A;  4RW8 A;  2ZVS A;  1RT7 A;  4OJ1 A;  1FF2 A;  2W4C A;  3O44 A;  4BWJ A;  1X9S A;  4X4N A;  4LFC F;  3HHK A;  1JXE A;  1RWX B;  3QO9 A;  4OHV A;  3GSD A;  1K8A T;  3GU0 A;  2IVF B;  2LCW A;  1JK9 B;  2VZ9 A;  1NK9 A;  2MEW A;  4RW8 B;  4FS1 A;  1RT7 B;  5KFQ A;  3NGK A;  2BJ1 A;  5BR8 J;  3OFH A;  2CFX A;  2JRS A;  2JWN A;  2PA8 D;  2YWW A;  1WC3 A;  2OO4 A;  3QO9 B;  1X7V A;  4C4W A;  5BXI A;  3KLV A;  3GJR B;  3VTI A; 
#chains in the Genus database with same CATH homology
 3QRP A;  3QRR A;  4DZD A;  5CD4 A;  1WJ9 A;  2Y8Y A;  4QYZ K;  2Y8W A;  4U7U D;  3QRQ A;  5H9F K;  2Y9H A;  5H9E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...