5H9FK

Crystal structure of e. coli cascade bound to a pam-containing dsdna target at 2.45 angstrom resolution.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
199
structure length
159
Chain Sequence
b'MYLSKVIIARAWSRDLYQLHQGLWHDFLFHVEKCHVLLQSAQMPSTAVATVIKTQVEFQLQVGVPLYFRLRANPIKTICRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
molecule tags Immune system/rna
source organism Escherichia coli (strain k12)
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
total genus 21
structure length 159
sequence length 199
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5h9fK02
1WJ9A 5H9EK 4QYZK 4DZDA 4U7UD 5CD4A 2Y8WA 3QRQA 5H9FK 2Y9HA 3QRRA 2Y8YA 3QRPA
chains in the Genus database with same CATH superfamily
1KD1T 1UZHA 1OMSA 1JLQB 3OLBA 2H9ZA 2JH3A 3CDWA 1U1RA 2XMAA 2Q1LA 1ACMB 2DEJA 5G0RA 2HRYA 2HNZA 2XI2A 4LJMA 2W4PA 3MM5A 4CYUB 1KLMA 4U7UK 5KT4A 1P9YA 2Q3PA 2BQRA 4USUA 3KG0A 4PQAA 2C3MA 1HBOA 3GZ7A 4C98A 4MIWA 2DNMA 2MGZA 1KHWA 3MECB 4DSKA 3Q89A 2NCKL 1SXLA 4OHZA 1HLWA 1IWAA 1ZM2A 2DGVA 4OYZA 4JI3J 3UN3A 1RTIA 4HHHA 4Q45A 3CCES 3QGHA 1ZAXA 1TL5A 2CQ1A 2NPIA 2PMHA 2ROGA 3AJ2A 3I0SB 3D0IE 4I2PB 3I56S 1HD1A 4I6YA 3TVYA 3H59A 1DQAA 2EW9A 2IJRA 2QN6B 1WEZA 1AZSB 1FEEA 2LFVA 3M2RA 5KFAA 3RYLA 4F25A 1RYRA 2U2FA 1S4FA 1YITS 3AHPA 3KLHA 1HL6A 2DNPA 1KQGB 2R8GA 1VCTA 5D0RA 3NGUA 1OSDA 2V8PA 2UVRA 4N76A 1G4CA 4MKAA 4DV2J 3RRHA 2XS2A 4HTIA 1CJKA 3WIVA 1KN6A 1N5YA 2DY9A 3S1TA 1CPZA 2MGZB 4K5RA 1G3OA 1SC1B 3OXLA 3POTA 4HI1A 1BE4A 2VFVA 1RHRB 1UKUA 1VQPS 2CVEA 2DGOA 2M70A 3OTDA 3WIUA 4JI8J 4PEOA 3C14B 5DG9A 2WVFA 4NZ7A 3KK2A 2UVUA 3HHLC 4DR4F 1VI7A 3DRSB 4C3KA 3SZ2A 4KO0B 4LFCJ 5ETRA 2CPZA 2Y1LB 4DS5A 1FERA 4I69A 2KT5A 2DXEA 4OYIA 1V6HA 2PMWA 3LP2B 4KKOB 3MPUB 5LOQA 3LA0A 3WDOA 2ZZTA 3DRRB 5C25A 1F9HA 2CPXA 3D0GE 1N52B 3CJKA 1UW9A 3BSAA 3M9OB 4F4XA 2ZVSA 4OYWA 3H42A 1U7LA 1RWNB 2RH3A 2V94A 2WW4A 3CCZA 3KLIB 2FJDB 3QATA 2GV1A 4FXWA 2HNYA 2AEMA 3PXGa 2KJVA 4TYBA 3H4BA 3RB4A 4B9UA 2MMYA 4RW4A 4LFBF 4OHYA 3KHRA 1XMQF 1NB7A 2OD6A 5DO2A 2Q6BA 1ZTTA 4FYVB 1X9MA 5KFZA 1PG5B 4ANEA 2WONA 2ILYA 4M1KA 2YKNA 3GSIA 3DRPA 3EZUA 2KL8A 3EVMA 1GAOA 3EXYA 3THVA 3OD2A 4LF4F 5IT9U 2J7KA 1GXTA 4DMZA 1S1TB 5C2CA 3OLAA 2J9CA 2R2SA 3QT7A 4DPUA 3NCQA 2VBXA 4HI2A 3IR5B 4LQ3A 3CC2S 4P7VA 2RD5C 3FKBA 2P9CA 3QLHB 2DB1A 4M5LA 5L46A 3UDCA 2CKWA 2FLOA 3G8SA 1N33J 3G8TA 4O3QA 3MMAA 1VBXA 3AOAA 2QGFB 3VAHA 1U1OA 1GNKA 2ABYA 4EZ6A 5AE2A 3EXCX 1VQ6S 3BPDA 3H5UA 2BEFA 3IG1A 3G82A 1S48A 1RK8A 2PFDA 3H5SA 5E5NA 5H9EK 2CJBA 5KFMA 4TQSA 1ZPVA 2OEMA 2KVIA 1IUJA 4G1QB 4PG7A 4DN9A 4JI4F 3KMQA 2DGWA 4IH5A 3ZO7A 4UZCA 2HHHF 3A4TA 3FUYA 1T02A 3GB0A 2VUGA 3KG4A 4ZP8A 1F6TA 2XULA 4OX7A 4ZVQB 2X7IA 3OUYA 2M2BA 3OVAA 3HI9A 3DC2A 4JI2F 5BJRA 4DR7F 3CTRA 2HFVA 2FY1A 3PYFA 2PA8D 2JL9A 4YS2A 3VAFA 1VC0A 4J9UE 3VGVA 5JVGQ 3QNWB 1KP6A 1QJHA 1JK9B 2PIIA 1ZZFA 1OO0B 1TL7B 4C0BA 2BE2A 2JZ5A 4P73A 2DIUA 2HHPA 3GE9A 3GG1A 5B0AA 5GAHI 1NK5A 1JXLA 2JEGA 3MR6A 4NLYA 3NAIA 4WE1B 1KQKA 3VQTA 4QPXA 2AJFE 4OLOA 1ZTWA 1EQMA 4FXDA 3QIPA 5IV4A 1FXRA 1RLCL 2ADBA 4DL2A 1XMOF 4W92B 2LXIA 1RTJA 1B7YB 1ZBTA 2B4VA 2KYZA 3HD1A 1S6PB 2B4PA 3HFVA 3T41A 3SV4A 4ED8A 1N4LA 1KVIA 2JJ4D 4KGXB 1T94A 2CFXA 1X4GA 1U2RA 2XZDB 1XK8A 4OX9J 4F2RA 1S5ZA 4FBUA 2GGPA 1XBWA 1FNMA 1GTEA 3PACA 1W25A 4P2FA 4EK2A 1DQ9A 1UA0A 1L5UA 4IQXA 2YNHA 3CSKA 2KHCA 3JTPA 3LF0A 3Q83A 4NL5A 3UW1A 2UU9F 3C66A 1V3ZA 3NKYA 3UCZP 2HYIB 4F3MA 1FDAA 4NLOA 1KFSA 1AROP 1UJ4A 2HHUA 2V2VA 3LP1A 5HANA 1HR0J 2P9EA 3P8BB 2RQCA 4Q0BB 3TX0A 3G87A 2ALYB 2FVRA 2B6AA 4DXLA 2OPRA 4JV2A 2HS4A 3GFZA 2E1CA 2OSRA 2UZAA 3IG1B 1EJ7L 2RT3A 4QBUA 4ZN3A 1U09A 2BJ3A 4HL9A 1HBMA 3W7BA 1FHTA 1JJCB 5HAOA 2H51B 3SSQA 3PW0A 2BJ7A 3H5XA 3BQ0A 4JI8F 1D3WA 4A4JA 4B3TF 4LREA 1IXKA 5B08A 4OZ5A 1Y5NB 4IOCQ 4QCLA 1UEKA 3BV8A 2VBWA 3EDQB 1PAEX 2JHEA 2P8IA 4NA2A 2NXEA 4YR2A 2YNGB 1VQKS 1DHMA 1FRIA 2QIFA 4OZ3A 2HGMA 4DUZF 4NA1A 4ATNA 2J6UA 3IMQJ 4OLPA 3DDNA 2IM0A 2UXBJ 2CUYA 2HIYA 2HNYB 4KHRA 4F8RA 4DV1J 4Q0BA 5T14A 2HIQA 5C5JA 1KBRA 1JLAA 3AOBA 1VC5A 1RT5A 3Q8YA 1BXNA 1Y3JA 3S6EA 2N3OA 3ZXWA 3TA2A 5LMNJ 4NYZA 3EPGA 4LF9F 4DU7A 2RHSB 2VG6B 4BDPA 4K8RA 4JI3F 1Q1KA 3EMTA 2JC1A 3GYNA 2AKWB 2EC2A 3MTKA 2ZEJA 1GT8A 1WF2A 3GILA 3CMAS 1HNZF 1VK8A 2GMHA 2R8IA 1IBLJ 1Q8IA 3NAHA 4Y6IA 3TA0A 5ETLA 2ZHAA 2AEJA 4NWBA 5J1EB 5A0YA 1WKKA 3N28A 2YTCA 4P2MA 2MQMA 3W60A 2DXDA 2R7OA 3LH2S 4CLUA 2YBVA 2YH1A 5F3ZA 3HK2A 2VFTA 5J2PB 3SV3A 3T5JA 5J1PA 1TK8A 4AD6A 5F8IA 3RW7A 1UJ5A 4MH8A 2A18A 2HZAA 3UCGA 3VAJA 5HSPA 5HVFA 1UEUA 1Q0NA 1BQNA 2YWGA 4Y2CA 4ZVUB 4B3SF 1P1TA 3HCXA 1HARA 3HM9A 4CO3A 4XPEA 5DDOC 1RP5A 1YJTA 1FD2A 2KXNB 4FPIA 2E5LJ 4LT6A 2H1YA 1MU2A 4CT8A 3LUYA 1SJRA 5M2PA 1U0SA 3KLVA 2XMJA 4KPYA 4TLQA 4E0DA 1CVJA 3GFYA 1UJ6A 1LFWA 2BACA 2R42A 2XNQA 3CPWR 1FCAA 4KB7A 2VF3A 3B4MA 3M1VA 3RGIA 1GX6A 2AX1A 2J0QD 3I4PA 3IAM9 2H54B 5B0FA 7FDRA 1HPZA 2F7VA 4HDGA 4OZNA 2QV6A 3GCXP 2B9YA 3ITHB 5DQIA 4NLTA 2KM8C 2QE5A 3UWTA 2Z8QA 4TY8B 3WX8A 3CE8A 3HDSA 3PRVA 4DZDA 2EFVA 4LUBA 1K9MT 5KG6A 4Q8EA 2J9EA 4O3RA 1C4CA 2W2PP 1NK7A 1NPPA 4F0MA 4C3LA 3JQKA 1N34F 1I1GA 3M32B 1HWUA 1HW9A 3CD0A 3QWUA 3V6HA 3L7OA 4ZIWA 5LSLA 4MK9A 2DPJA 2P6TA 3ONQA 2BJ1A 3PEJA 1HBOB 2WAQD 2MQOA 2HFSA 4DL4A 2W8LA 2X51A 4IRCA 2CQ4A 3Q86A 4ZLPA 4I4BA 2IC3B 4ZVHA 3OTCA 5KG2A 1EP4B 5JMNA 5CYMB 5FD1A 3FK4A 4KGZB 3UR3C 1JLEB 3C16A 3PJWA 4OX6A 5B7WA 1SCJB 3G6YA 4F50A 3SBMA 4WFAQ 4RNFA 3M9NB 5D3GB 4NI2B 4MYTA 4K2JA 3W8GA 4RX6A 3L9ZA 4A47A 5EWGA 4EI2A 4DUYF 4IRDA 4O44B 2V69A 3P3DA 3I0RA 1GXUA 4TLRA 4WTYA 3GJRB 3GQCA 1IR2A 3IAS9 5B0CA 4N8NA 1J5EF 4DV4F 4JP8A 1WG5A 3T6JA 4WZMA 1RAEB 3TQ1A 3OR2A 4Z7YA 2Z57B 2EXUA 3TQEA 2WSFC 2EFGA 3GIIA 1FJGF 1X4EA 4I2QA 2UV8A 3T5HA 3F44A 5KG0A 2CWKA 4ZJQA 2OPPA 1WDTA 3IS9A 5KFTA 2VQFF 2VV5A 1DURA 1UFWA 5KG3A 1CJUA 3WQPA 4ZMMA 3NOGA 3WC2A 1KVKA 3D54A 1WG4A 3A8IA 3I82A 2K2PA 3M8QB 4DUYJ 3Q24A 2QSWA 1VOMA 2BX6A 1XNQJ 3EGVA 1TFYA 4TY9A 3V4IA 2DH8A 4PXCA 5F8MA 2UVWA 3WHIA 1NJZA 1U1LA 2ZJPQ 2AJ2A 3R7SB 1RB0A 1N5VA 5C25B 5LXRA 2XY6A 1TAUA 4GMKA 2LVWA 1PSDA 4A48A 1QSSA 3SCKE 2NZCA 1RT7B 2XMMA 4ITSA 2WTFA 1B99A 1RT3A 3EVWA 4U6PA 3GTYX 2IPOB 2M8HA 2Z2YB 5ETOA 5KT6A 2CIMA 3BKFA 4FVCA 1Z2ZA 1YJ9S 1B7FA 3CDBA 1SC4B 2B56A 1UL3A 2K1RB 1P8GA 2OGUA 4RW4B 4C8NA 3RG6A 3JYTB 4X64J 2RKIB 3SIPB 3D66A 4C48A 3BPSP 4L3NA 3CO0P 1SQEA 3E8OA 1RUSA 4ID8A 3MM9B 4DU8A 1S99A 2R8HA 1XJWB 2OFHX 3KUHA 3FZBA 4CT9A 4X65F 2BQ3A 2AWZA 2L08A 1YBTA 1CULA 1LW2B 4J5OA 3RAQA 1KQSR 4KY3A 4I67A 3K5NA 2O01C 2J8SA 3T5LA 1EB0A 2B9EA 2LQ9A 2OD4A 1HNIB 3C16B 4WIQA 4ZPBA 3MEGA 5HQMA 2HHQA 1X5OA 1XWLA 2BM1A 4ZPVR 1TAQA 2WVCA 3OSNA 4ZITA 4ECTA 3P45B 3NNCA 1FA0A 2HEKA 3UFCX 1KTQA 3OFEA 3OL6A 2OJ3A 1UVKA 2EFNA 4ES1A 2FHJD 2IVMA 3ILLA 3LGNA 2Q66A 2NYHA 3R8YA 5AJ3F 1RQ0A 3T1YF 5DGAA 3R5GA 3U1NA 1VISA 4QW9A 2I1RA 1N48A 4EEYA 4CWBA 3Q8PB 2VPWB 1JXEA 1WKLA 1Z2LA 3K5PA 3IS9B 5KFKA 1MN9A 4FS1A 1NHKL 3MAAA 4DR6J 1NK0A 1QAYA 5C42A 2MHEA 5KOWA 3BJYA 2AYBA 2DGQA 4WFZA 5E2QA 3RJMB 5DQGA 5LMUJ 4OV6A 4DF4A 3C15A 3H20A 4Y2MA 2HLUA 2BVZA 5LXYA 3I5CA 2EBGA 4RUBA 5HROB 1BQNB 2DCUB 2XO6A 2UUCF 4GC6A 4DL3A 2WOMA 1JB0C 1IKXB 4ZA1A 1BQMA 1H74A 5D0HA 5E3AA 4X62J 5A2QU 1FFWB 3MF5A 5HQ8A 3K5LA 1HWJA 2FHJA 4ED4A 2VJUA 2ACYA 2QA4S 3W8PA 2RUSA 4HHJA 4M5IA 1TKTB 3BGUA 3M2UA 4IOBA 3I55S 1RT6B 2UUBF 1GMWA 1YG0A 4N77A 3ENVA 4CH1A 4CRJA 3NBPB 4DSEA 3CJ2A 2ZOFA 3KLEB 1QSYA 2PI4A 2WRMA 2B9WA 3EGWB 2E7WA 1OQ6A 4LRFA 4DV2F 2KFZA 5KG4A 5F8LA 1ZETA 1KC8T 3OL8A 2V8GA 1F9EB 4LF1A 3SFGA 5DDQC 9ATCB 4PWUA 3RBEA 1C4AA 4L73A 1JLCB 5THWA 1K1SA 1BQMB 3CCJS 1ZZNA 2HWTA 5KFEA 2VQEJ 4IFVA 3B82A 3MGJA 2G0JA 1U45A 3B6BA 3LAKA 5DZ6A 4YHHJ 3PFEA 1HYSB 4AXJA 2X1AA 1OWXA 2KG0A 2BDPA 4JI6F 4JI1J 4QU7A 2L9NA 4RLEA 3Q8SB 3D4JA 3P6YC 1KVJA 1HHTP 4U95A 3D2WA 1HWIA 2YQ0A 5GMEA 3QFWA 3DGVA 4ZIVA 2ROEA 3H4DA 3F73A 1H2TZ 4LVOP 5E3PA 5KOXA 3H40A 1YVFA 4DX6A 2ROPA 2AT1B 2E5GA 1LWCB 4NLGA 2VG7A 2GIQA 1LKZA 2DNNA 1WF1A 1JLEA 3R5AA 3V4MA 5BR8F 2ZH8A 2HQ3A 1QSLA 1RHQB 4NI2A 2D69A 1OS5A 2XMVA 3AD8C 4KQZA 1FF2A 3TP2A 2MZ1A 4FYYB 1NJYA 4NCAA 4QR0A 1RWUA 2ZE2B 3IRWP 3PCOB 4NEYA 2R7SA 4UY85 1CEZA 3AA8A 2J7UA 2MQNA 3LW5C 2MB0B 1P6TA 2G2OA 2HWIA 3M05A 3FZ2A 3SQGA 1VMBA 1PBAA 1SV5B 4GVBA 4O0NA 4WYWA 5GADU 3KFWX 4DQQA 3TANA 1T05A 1K0VA 2L9WA 1NK8A 3VAGA 3Q2TC 2DRDA 4NX9A 2BYCA 2IMWP 4ZP7A 2Y8YA 4A8KA 4B9SA 3NGKA 2LEPA 2MQQA 1K44A 2LU1A 1CJVB 1U26A 2M7SA 5J2NB 2DNHA 5HVGA 3KNAA 4KHMA 4C7QA 4DQPA 4LF9J 4KGVB 2DRAA 5BYQA 1AZSA 1NM2A 1NKCA 2MSTA 3FEYB 2N3LA 4QU6A 4KC5A 5U47A 2HHSA 2DIVA 5AE1A 4L6V3 5KFQA 4Y0FA 2IA6A 1WUUA 1TELA 2JX2A 3W2VB 2ASDA 2V4JB 3G6VA 1HQEB 2UXDF 4PPDA 4ELVA 1N6QA 3VZHA 1DTTA 1REGX 5F41A 4QYZK 2OEKA 2RKIA 5A6PA 4Y2IA 1S1WA 5D4OA 1NH8A 3K8VA 5IM0A 3TARA 1VQ4S 3P96A 3NEKA 3R3TA 1GXLA 2EFOA 4F4ZA 4ELUA 3DLEA 4X4RA 4CLTA 2DGSA 3C3LA 3UO0A 1E6YB 2Y0BB 4OIXA 1TVRA 3NMAA 1SL2A 2OMLA 1ZA2B 3M1VB 1QD1A 3R5BA 1JIHA 3W2WA 5K20B 3QJLA 1CC8A 2HURA 3TUPA 4JYAJ 1I6JA 3ZTSA 3O5TB 3HSDA 3R1LA 4HYKA 1DTTB 4LFAJ 4CLZA 2J6TA 5I4MA 1GQEA 2VOOA 4U96A 1PYTA 4UF4A 5HMZA 5KFWA 3GIJA 3FNNA 4OI6A 5D8HB 1KEKA 3TZXA 1BWEA 5IT0A 5EUHA 3Q0AA 1X5PA 2YKMA 5E7OB 1RYSA 1KSPA 1EETA 5L1KA 2DISA 1PJ6A 2O66A 3FQKA 3L7PA 3LO3A 3OHBA 3DRPB 4ZP6A 3AJ1A 3M8SA 2CJKA 4A8OA 4U8VA 1BY9A 1JX4A 1S10A 3BGFA 4F4YA 1T3NA 1D9DA 3V6JA 2J9DA 2BR0A 4LFBJ 5IC4B 3ZNUA 4V1Ak 2PSZA 1LV5A 2HHVA 1N54B 3CJTA 3DFEA 3HHKA 2ZH4A 1C0UB 3PY8A 1U49A 2OTJS 1VRTB 2IC3A 4ZPDA 4ZKAA 1FE0A 2PDAA 3TO8A 3ULHA 5CYMA 2CNKB 2V2ZA 2FHMA 4LF5F 4X4UA 4DV5F 4X4VA 1VDHA 2YVSA 2Y9HA 4DPYA 2UUTA 4YP3A 1T03B 1RHJB 1BUXA 4WWSA 2CQHA 1QAIA 3TR5A 3QJJA 2DPIA 3C8YA 2ZBCA 3O44A 2VG6A 2LCWA 2N7CA 4FDFA 2XYPB 2C3YA 2JSXA 1M5PC 1TU0B 4USIA 1QM9A 3M8PB 2HRUA 2CNLB 2DY1A 2GIFA 2LA4A 2QL5B 3P49B 5KFIA 2P9GA 4D3GA 2CVIA 2EKNA 5J1EA 4USMA 3TUIC 3LWLA 2DNQA 3J81j 5F8NA 3A3PB 4ZLJA 4IFYA 3JB9k 1PIEA 1VBKA 2DR6A 4DX5A 2VPXB 2XGQA 3W2WB 3W65A 2AJ4A 1X4DA 2FHOB 1YGYA 3F41A 4YEAA 5CD4H 1UWAA 4NRTA 1VQ7S 1IBMJ 1F9FA 4ZLLA 1X0PA 3CJ4A 1VQOS 1RTJB 1HNVA 1MG7A 2DH7A 2JLFA 2CWXA 3I4HX 1LQ9A 3LALA 3PG9A 3TAPA 4I56A 2VHGA 2HBZB 2JFKA 3HHLA 2N82B 1HHQA 3VAKA 2Y1JA 4K0KF 3POTB 2ZH9A 3TI0A 4B9TA 4DV3J 2DT9A 3BB5A 1RHMB 3UCUP 3DOMA 2NLWA 3AODA 2KFNA 3N6LA 4FPRA 1S7HA 1U2FA 4PUOB 1LW0A 1Q53A 4NYPA 5DDRC 2KI2A 3DU5A 2VH7A 3SFUA 4B9MA 3X3UA 1RTZA 2W25A 5KFDA 3FDSA 2B51A 4J90A 2CA9A 3K8WA 3LPEA 3QSIA 4HACB 4DZ6A 3IM9A 1HQ2A 4QJVA 2LEBA 2C2ZB 2FIUA 4QR2A 1N6QB 3D5MA 3EM1A 3ILJA 1M5VC 1VQNS 4AQYJ 1XNRJ 3DLGB 4GRSA 1YQHA 4WFXA 5IS2A 3HVTB 1SV5A 3DNCA 4YB6A 4BC7A 4CLLA 4DPOA 2VFUA 1T05B 1SL0A 4K0KJ 3DDIA 3OFGA 3QAUA 3ZFVA 2DTJA 2YKNB 4RNOA 4W4MA 1MMDA 5DLFA 4RO0A 4JI7J 2BKPA 1TKXB 3CVKA 2DGXA 3QPIA 3FJ2A 3GIRA 4IYQA 1S76D 2HBRB 1MMNA 2B4UA 3ZTOA 1IBCB 3I6PA 4QZVB 1IBKJ 1XERA 3PVXA 4MKVA 4NYOA 4P7TA 2XG8A 2DHSA 3H2LA 3G4SS 2B5JA 1YSJA 3HZGA 3BBFA 4OI4A 1HQUA 2CPJA 4Y2AA 2IBKA 1O0PA 3PO5A 4CM2A 2CQPA 2UU9J 5I3PA 1SJ4P 4B3SJ 1HQEA 2IVFB 3GV7B 2NZ4A 3N5BA 5HROA 2NXUA 2HZCA 3BBCA 3MDFA 3NXZA 4K59A 3AD7C 4WCEQ 3T5KA 2AJ1A 3MEDB 2YX7A 2ADCA 2G1HA 3BSCA 1YRXA 4RW9B 5CCLA 1EKSA 2V5HG 1RBAA 3MAHA 1O8BA 4O4GA 3DOMB 1VQYA 3M30A 3MMCB 2HW3A 5ETMA 4A8XA 3MM6A 1R0CB 2FDNA 3PJ9A 4ZK7M 1TL7A 1VRTA 3GONA 4KHPJ 3ETOA 2HFNA 2BANB 2CZVC 3BKTA 2EPIA 3PM9A 4ZVOB 4HHUA 1S6UA 1SQGA 2FJXA 3M8QA 5CABA 4ECYA 1V3RA 2IDEA 5GMDA 3QIPB 2RS2A 1JKHA 3J7A1 2WSCC 2M5YA 3C6UA 1RA6A 1ROFA 2OO4A 2QMUB 2YX4A 2NPFA 5FLXU 4KH0B 4IFVB 2DNKA 5IWAJ 3D28A 2HFUA 3DGPA 3KJVA 1SH2A 3W5XA 2DEIA 2NSCA 2GGPB 3CB4A 5A8KB 3C14A 2CJYB 2O3DA 3KHHA 3DHXA 4ED0A 3K89A 2Z2LA 2ZD1B 3ZZPA 2EFQA 1UVMA 4ALZA 3HT3A 1RABB 2F4FA 2OUGA 1HBNB 2ZBQA 2XZWA 2M4MA 4C0HA 4K4ZA 2M8DB 4EUVA 2RS8A 3I96A 1PJ5A 2W4DA 4WF9Q 1Y4ZB 2I38A 4IDKA 3C6TB 2CPDA 3TZYA 2V4RA 1F60B 4BLGA 3RTVA 4PG5A 2RQKA 4I68A 5I3UB 2CDQA 1SIZA 1IR0A 1JKHB 2VG5B 1FWLA 1XMBA 4CDIA 2IAJA 4ZVTB 1UAWA 4ZCIA 5HN0A 4DV6F 2DR7A 4LF7F 4FF1A 2KZZA 3DRXA 1Y9OA 4Y28C 4AUKA 2BUNA 2BE7D 1RAGB 2GO9A 5J2MB 3FSIA 2WVDA 2VQFJ 4ELTA 3IR7B 1UVJA 3DMJB 3ISNC 1DQ8A 1HHSA 3NY0A 5AT1B 3G9CA 2KVQE 3OQ2A 4RU2A 4CQ1A 4RR5A 3RBZA 3OHAA 2YH0A 2X3GA 1Z4UA 4OHXA 4IRKA 2QLBB 2VPYB 3N6MA 5KFHA 2F4VJ 1U0HB 4QIEA 1OY9A 1J5EJ 4WK1A 1FO1A 1VQ9S 2E7XA 3FFIB 1NPKA 2J5AA 4RNMA 1TL3A 1M1KT 1V3SA 2LXUA 2F3JA 4OZ1A 1FJCA 1MROA 4LSNA 4MIBA 5F8GA 4X4PA 2AYGA 3BSOA 1G6BA 3OTOF 4UUXA 3OTOJ 3KUGA 2FHKA 5CYQB 1FE4A 1SPBP 2HBYB 4LF7J 3FVYA 3NLCA 2JRSA 4OL8A 2FY8A 2GJFA 4QPTA 3CD7A 4YMEA 3KK1A 2R9LA 1HNXF 3QT6A 2WW8A 2J0XA 2RF2A 4LQ9A 4OYMA 4NXMJ 2AIRB 2BQUA 4ICLA 4N56A 2B7BB 4DG1A 2ZKUA 3JS9A 4CP5A 5EWFA 1C1BB 3MOZA 2F40A 1S1WB 2RE1A 2XQCA 2MHNA 3EZOA 3CD6S 2IM3A 4LF2A 3W9IA 2XY5A 2LU2A 3MD3A 5CAAA 2E9TA 2ZDOA 1TMMA 1X4FA 1WI8A 2YNIB 4CTAB 2RDDA 3SCLE 1BHNA 5DETA 2XCAA 4IO9Q 3H2UB 3CO9A 4KGMA 3S01A 2DJWA 5KT5A 1KHVA 4XTTA 3FEZA 5AXNA 1BQXA 4K2XA 1WD6A 3BM7A 3J7YU 1R31A 3T1HF 1RT7A 2NREA 2XYGB 4A8YA 1T9UA 2QYCA 4FKXA 4ICLB 1RCOB 2ZBPA 3BBBA 4C2MA 4J9OA 1M5SA 1VJQA 1N56A 1N88A 2HQFA 3QRRA 3MR2A 3KTQA 4UQTA 1RAAB 1H73A 2NYIA 5CHCB 2R7RA 1RAJA 3QBCA 2VQEF 1Q8BA 1H6KX 3AB4B 3F56A 3L09A 3N9UC 4URSA 4QYRA 1KNZA 2R8KA 4G1IA 2CPYA 1Q16B 1FVQA 1DJ0A 4PG6A 1TL3B 2G13A 2COLA 4OYAA 2WZ1A 4EFAC 2ZUAA 5LJ3Y 5DGBA 1REVA 1RWKB 5D4NA 4LRAA 4TY8A 2W2MP 4KFBA 2M88A 3SEOA 5GVQA 1YIJS 3DLKA 1HNIA 1BLUA 2FZCB 2WBMA 3HD2A 3JSRA 1RKIA 4ED7A 2B4OA 4M5MA 3BYRA 3UN2A 2AP6A 2FPHX 1XR6A 4NOHA 2W7PA 4ED6A 1ZAWA 2V8HA 2M52A 3DM2B 4ECUA 2JEIA 3MM8A 4FKYA 3K7RA 3JAMU 4UZBA 2VPZB 2KJWA 1A9NB 1WHWA 2QC3A 4G65A 4ENOA 3IM8A 5ADZA 1RBOB 3MWBA 4O4GB 2ZH7A 2IM2A 3SYZA 3JSYA 4ED5A 2BE9B 4YHHF 4M95A 3NS6A 1A6LA 4PYDA 1IVZA 5C42B 4KRWA 3MAAB 1WC1A 2U1AA 2QJ3A 3QT5A 2IVYA 3BN7A 3QGPA 4DCJB 3MPVA 3PRDA 2RSQA 2XHWA 2YNIA 3HULA 4USWA 4DV0F 3MFHA 1S0VA 3KOAA 1FX4A 4IFYB 1HMVB 2Y8WA 4NMXA 3HF5A 1IKYA 4N7TA 3D7SB 4O44A 1Y7PA 3R7BB 5D6GA 2VBZA 2YX1A 5DRKA 4DDFA 4CNYA 3OPKA 4K4XA 4FBTA 1WC3A 2L9DA 3DGPB 2DO4A 3AXMA 4KAIA 4F67A 3S7RA 4M5DB 3DI6B 1S0OA 5BXIA 3M9MB 1EAYC 2PFFB 4W90B 4EGLA 4ECQA 1AB8A 3TJ9A 4H4KA 1AW0A 3CCSS 4WXWA 3M2VA 3ZZOA 3RBXA 4P10A 3BDEA 1QY7A 3VHQA 8RUCA 2EKYA 2BBEA 1RTIB 1R27B 5D0GA 3D3CJ 2ZH6A 3ET6B 1LW0B 2DNOA 2J7WA 4WK3A 4AQYF 3SQOP 3BQ2A 2BXJA 2V2KA 3HKWA 3GR1A 3QO9B 4X65J 2HQIA 4TU8A 4N47A 5JVHQ 4ANDA 2A2CA 4DV5J 2OH2A 2FD2A 3A13A 2I2YA 5HJYA 2J8AA 1Y5IB 2MZJA 5EWEA 2RDIA 3KNGA 1IWGA 1XR7A 2F4VF 2HMIB 3GV8B 3OBIA 2IDLA 4B9NA 2W9BA 3CXCR 1PGZA 3R2DJ 1LWFB 3UVJB 4TU9A 3W64A 4OV1A 4IQMA 4YY3F 2NXCA 2MLYA 3UNYA 6FDRA 3PR5B 1R0BG 5F9LA 3VTIA 5KT2A 4OJHA 3N01A 2WK4A 1Q5VA 3DYAA 5GAEI 1U2CA 2ZWOA 5GADI 2YKAA 1KKHA 5JJBA 1J2VA 2Q43A 5DZ7A 1S9GA 3MEEB 5F0WA 4A46A 4WP3A 5IZHA 1NKEA 4CCHA 4IG0B 3HHNB 1JJ2R 4L74A 2FLLA 3J80Y 2I0XA 1R6YA 3NGRA 3MEGB 3EWGA 4C8KA 3CCTA 1R0AA 3MM7A 5DLGA 3FGVA 4XDCA 3V6DA 2E9ZA 1T3OA 3IBFB 1PJ7A 5KFRA 1BMQB 3OR1B 3M8RA 2KT2A 4C8LA 1KTVA 4J37A 2BJ8A 3CF5Q 3H98A 4I7FA 2QA4G 2H65B 3J81U 1PYSB 4XO0A 1AA1B 1F1BB 2MZTA 2EEYA 3GWCA 5H1SV 5KG5A 3TUJC 1NRKA 3KK3A 4JI2J 1ZM3A 3DXBA 4BCAA 4AE5A 4Y65A 4K4VA 2LDIA 2M0GB 3GLJA 4LBIA 4FYXB 2OKQA 1EP4A 4ECWA 3ZZRA 2E29A 1S1UB 2AZ1A 4WXOA 1O51A 4P9SA 1X7VA 3TAMA 3US5A 1WTFA 4EO6A 2D3OR 2IRUA 2LMIA 2H4YB 3PYEA 4DLEA 1APSA 1NPRA 2R2TA 3NGSA 3V6DB 1WC4A 4MTPA 2W9CA 2C42A 4P2XA 3OXFA 2IJFA 3ELHA 4NCGB 3SDEB 3D9BA 4I7FB 5I42A 2YKOA 4FN5A 1F3FA 1H7WA 1CJTB 5L39A 3JAMY 2VJVA 4QIGA 2ZNZA 1HI1A 2VL1A 4RBTA 4DV4J 2MDAA 1JMTA 2PA3A 2Z2ZA 5EX3A 5IT4A 5K8OA 1QAXA 1U02A 1U6BA 2BW2A 1RZMA 3TAMB 2HZVA 3EDRB 2X1GA 4ZJOA 3V4IB 1REVB 4DCOB 3BO3A 2VONA 3M2RB 3HSZA 3I5AA 3L95X 2KFYA 1JLCA 4WE1A 1L3VA 4NZ6A 5L9NA 2G0IA 3HZEA 2FGOA 5A8RB 5HMXA 3RW6A 4ED2A 2ZOMA 2DKOB 4BWJA 3K5OA 4EYHB 4ERDA 3MM8B 4DV7J 2DITA 2HG4A 2WB4A 2OFGX 2RRBA 3BH6B 2XYHB 2AJQA 2GJ2A 3MCNA 1X31C 1BGXT 2YKMB 1GK8A 4RPFA 4U8YA 2RMLA 4C8ZA 1TMJA 4EWTA 2IJNA 2I5JA 1DAXA 1RWPB 3LANA 2CADA 2OPQA 2GHWA 5A8WA 5F9NA 4LSLB 3QZ7A 3J7AN 3HX9A 4DL0C 1ZOTA 1FRJA 1Q79A 1NAQA 3ENWA 1C1CB 1FRMA 1RHUB 2MLZA 3QO9A 1RWMB 2HRTA 2MYFA 4LRBA 2POKA 1VJWA 1LXJA 4O23A 3U7JA 1TKDA 1YK9A 3CDUA 1I94F 5A8RA 4DR3F 2QX0A 5KFSA 3TZWA 1QUVA 4J9LA 3QRPA 3BS9A 5HLFB 4DR5F 5HMYA 5KFJA 4QWEA 1PC5A 1S77D 5EGYA 1HBUA 3BGOP 3UDVA 3QWPA 4DFJA 1AUSL 2XEXA 4ZLNA 1N5SA 1YBAA 1NUEA 4CLKA 3MOJB 2ILZA 2CJQA 4Q43A 2CDRB 3OL9A 1KOOA 4OX8A 4P2SA 1DARA 3FC9A 4NLVA 2VA2A 4MJKA 5KT3A 4K4SA 2B0GA 2JLEA 3DXSX 4ED1A 4DCPB 1C1CA 4B9LA 4U9RA 5HK4A 5B0DA 5CCMA 3HFKA 3TA1A 4B9VA 2A0FB 1I51B 3BZQA 3QLHA 2IYIA 1X9SA 3I9V9 1T9XA 1SH3A 4YDXA 4PXBA 1JNZB 4DX8H 4NLUA 1H98A 2OIHA 4X66F 4OYPA 1FJ7A 4OJGA 3KUEA 5DG7A 3DRRA 3ZZYA 1VQSA 4UOCA 3G82B 2V0NA 2BJ9A 4EU0A 1SVDA 1F2GA 1GMWD 2B43A 3LWMA 2JDJA 2BW7A 4GKJJ 5BR8J 4KH1B 5LMUF 4LMZA 1K47A 1OY6A 3FSXA 2UVVA 1P9QC 4DL5A 5KFLA 1QTMA 1S6QB 2YNFA 5E3QA 2R7TA 2RVJA 2JEFA 2GNKA 4AYBD 1NMEB 1RDRA 2AF6A 1M5HA 1J27A 1QTNB 3GP9A 2BKOA 1OPZA 3UI3A 1LK7A 2OPQB 3MFIA 1X60A 2V9KA 1B0VA 3MTJA 4NLXA 3UDEA 2Y1IA 4LF8F 4L3KA 2KM8B 4F36A 4I64A 3MEEA 3D6FB 4OHWA 3CMES 4ZS6A 2QLJB 4X84A 1A0OB 2QL7B 3R27A 4RKUC 6FD1A 4M8LA 2FC8A 3PZPA 1RTDB 5KG7A 1WF0A 2B9XA 4E98A 1CJKB 1ZA1B 1TV6B 3D6TB 4JUZA 3I5BA 3OR1A 1WOOA 2HQGA 3J7Z5 1Q78A 3KLFB 2JLGA 1G7CB 4ECRA 1B0PA 2PN6A 3FMWA 4IO1A 1KLMB 4L75A 4I0WA 1TQLA 3MUTP 4AXIA 2F8MA 4RNNA 1SKSA 5DJBA 4EBCA 5GAGI 3D3BJ 5KFXA 1FI4A 1TUGB 2MLXA 4KT0C 3AT1B 5MAOA 1WOPA 2V9WA 2N4CA 2X3DA 2GO8A 4RW8A 5D4PA 4CLSA 1R8BA 3NWRA 2BM0A 1KLNA 1WKJA 3IWNC 1MWZA 3GJSB 3AY0A 2CJXB 3T9ZA 3BF4A 3EYZA 1R89A 2Z2MA 1O6XA 5D0EA 3GIKA 3RUBL 3GYGA 3CULA 1M5KC 1B3TA 1Y00A 2W1BA 2C2KB 3OXGA 4G1PA 4M5KA 1EQ0A 4M63A 3T1HJ 2V68A 2XTJP 2G1DA 1MROB 3PHEA 4NLQA 1XTZA 4DR3J 1YWXA 2QG9B 3KKFA 2RAQA 1WNEA 2K8GA 2V50A 3PDNA 4RWWA 3SQGB 4F4WA 2PD1A 3OL7A 4HKQA 2LQBA 2RRNA 3J81Y 2KDOA 5EHHA 1CS4B 2GVDA 4OMFG 3I31A 2RJZA 3LPYA 1JLFB 1X4HA 4C0OC 2AYEA 2YWFA 1VFJA 3MCOA 3PNIA 1HWKA 4M5DA 4OI1A 2VFRA 3WZ0A 4YY3J 2D41A 1Q7YT 2MZRA 1EX8A 1RWVB 5FIIA 2UXDJ 3PW2A 4DEZA 4KR0B 3L4BC 3IRXB 2OLWA 3MMAB 2R7VA 3QGIA 4LFAF 4M5GA 4DV7F 2VDIA 5HL7Q 2WOMB 1VR6A 1RGVA 2J0WA 4ZVRB 3BH7B 3TWZA 2KTQA 2CQ3A 2XGPA 2VFSA 1VK3A 2QTWA 2OELA 3VV2B 3QSYB 2Q79A 3CJ5A 3N79A 1Y10A 3EZ5A 2NXNA 9RUBA 2WBRA 2YKQA 1SKUB 3MUMP 2OPSA 3HHEA 3THTA 4CI0B 4DR7J 3TUZC 4DR1F 4JI5F 3CC7S 3TJ8A 1WJ9A 4GKKJ 2DHXA 1WC0A 2LP4A 3JTOA 4PWWA 3OJUA 5F3TA 4C97A 5C24B 1F5AA 3KLEA 4NXNF 4K7QA 1YJ7A 2QRRA 4LSLA 1SQFA 4ER8A 2VBYA 2N4DA 4RW8B 2H48B 4Z2XA 2KYXA 4B02A 1RAHB 1TVRB 3HHLD 5AXMA 3QZ8A 2CPFA 1UEVA 2OMOA 2RU9A 3DOKA 4R8UA 1LFPA 1H3DA 1TP7A 2KH9A 4K50A 2CPIA 1AXQA 2RILA 4LRDA 4F02A 1R8PA 2JC0A 3GIMA 3MAQA 4FNHA 3AH6A 3IC1A 1HYSA 2FC9A 3QAEA 1FK9B 2DVIA 4EMDA 4O3NA 1FKPA 1OIAA 4USKA 3HVTA 4ZVGA 1WHVA 3MI7X 2XLJA 5J2MA 4JI1F 1VIOA 4PAAA 4B3MF 5L9XA 3KG1A 3GMGA 2MQ8A 3M6UA 3MPDA 2XC9A 4HEA9 2K1RA 1T9VA 5H9EJ 4F2SA 3PFOA 3GV5B 1U1NA 4JI6J 2LQ8A 3U02A 1B0TA 4X4TA 1ZH5A 3LTOA 5AXLA 1WC6A 4DFKA 4BC9A 1Q86T 1JXVA 2W2NP 3PJXA 2G4BA 2F8HA 1PCAA 3S8SA 1U24A 5KFFA 4DUZJ 3RB6A 4FF2A 1T0TV 2LKZA 4MFBB 4F04B 2AD9A 3MMBA 2DHAA 3MMJA 1NXIA 1GTHA 4J9RA 2ALZA 2HK2A 4LSNB 2XWXA 3PIPQ 1YJWS 1IR1A 3KYLA 4JV5J 3WX4A 1HMVA 2E1RA 1ITPA 2MQLA 3U1LA 3VGTA 3ZTPA 4RU9A 2AU0A 2HAIA 2O67A 5I3QA 1NKBA 2RF2B 3VGSA 4ZDNA 4ECVA 2B8PA 2IHR1 3MEDA 3PHTA 4NE9C 4PXDA 2R7QA 1RT3B 4RW9A 4Q5VA 1OPIA 4DR2F 2JOQA 4J9NA 2E1MC 3R6LB 3OTEA 1GFWB 4H4MA 1Q5YA 4H4OA 4AT1B 2C28A 4JI0J 5EN1A 2BANA 2BRKA 5LSOA 1M90T 2N7YA 3CNQP 2G2ZA 2F9DA 2HLTA 2MKJA 2RQ4A 3FBCA 1CSJA 3GCWP 3M4XA 2CXEA 3MMBB 3MM9A 3H90A 1H2UX 1IM4A 1DTQB 2GS8A 2SXLA 3BR8A 3GFXA 4WU3A 3TAQA 3C15B 3QIDA 1I94J 2XZTB 2KKHA 1OSCA 3CJ0A 1RSCA 4PG4A 5D15A 5K9FA 2BV3A 1FXDA 4HH0A 2GVDB 5J2QB 1M0SA 2ZBIA 3WC0A 1JLFA 5KFOA 1AFJA 3G8QA 3DLLQ 3VCDA 2MZQA 2C2NA 3CCWA 4EBEA 3ZZTA 4ETXA 4ZCKA 2CG4A 3SI8A 1LOUA 2MKYA 1WEYA 2XMWA 1U6FA 2EBEA 1H0HB 3IRXA 3CUNA 3MCSA 4DFPA 1VC6A 4PUOA 3R97A 4TQRA 3LAMA 4AL5A 3C2PA 1SUQA 1RXOB 1VLOA 2ZH3A 5J2PA 2CAJA 2E5IA 4IDKB 1HNXJ 4QIVA 5IT9Y 2EK6A 1HW8A 2VC1A 1WDDA 4KBIA 5IC6B 2M3DA 3VF0B 5C2GA 1NZ8A 2HS3A 1VYAA 1HD0A 1Z1ZA 2PC6A 3GJTB 3O8WA 4PR6A 1FRLA 4LF6F 3ISND 4WZQA 4LIRA 2VG5A 4WU2A 1O5JA 1Q7LB 1URRA 1QE1A 1QDUB 3MCMA 4OYOA 4YB1P 4A8MP 1B64A 4ED3A 3CT9A 1ULRA 4X4QA 4YN3B 4NLRA 1FKOA 3O6QA 5HATA 1NEEA 2QSFA 5HI7A 2RQMA 4B3RF 1YJUA 4KJIA 4ID5B 3G96A 1OYEA 3QYYA 4WP9A 4FS2A 4PRFA 1UWBB 1WC5A 3R6GB 4YUDA 4A8FA 5AJ3J 4LR7A 3KLGA 1R3NA 1NSAA 2DNLA 3DOKB 3T1YJ 4DWIA 4LVNP 2A1BA 1UZDA 1YJRA 1TKZB 2MKHA 4I2QB 5A0YB 1TKTA 4N5SA 1Y5LB 3AFGA 5DG8A 2ZVIA 1TUWA 1BC6A 4NMLA 2XSJA 1YBUA 3VVTA 3ZC4A 1CULB 1LW2A 1Q8KA 1VIXA 2CQDA 4Y2KA 4DFMA 1N36J 1W2IA 2HAFA 1D09B 5L8RC 1ZS6A 2W24A 3IA0A 1FFSB 1T03A 1YJVA 3NCRA 3W63A 1QUPA 4F4KA 3AD9C 3ENAA 1NSQA 1IKYB 2VA3A 5KFPA 2D3ZA 3M8WA 1GEHA 4P71A 1J5OB 2GMLA 2NXJA 4DUTA 3RAMA 4GC7A 4MIAA 2FYXA 1DBDA 5K8MA 3FCHA 1S0NA 2EVZA 3SDEA 5HP1A 2YWWA 2ZOGA 3DN9A 3GR0A 4ES3A 4Z7CA 2PEHA 4DG1B 4GVBB 1EZZB 4CLFA 4UY8T 4X64F 1FJGJ 1CLFA 4KV8A 3SSSA 4PKDB 3K58A 1W7WA 5E0OA 1KFDA 3M2VB 1FWPA 1NHUA 2KN4A 1SIWB 3MR5A 4AL6A 3KMSA 1NK6A 2FVQA 4V19X 2MKIA 3D1HA 3CJSA 1OJ4A 4OQJA 4DQSA 4GO5X 4Q2LA 1CJVA 1RU1A 4HT7A 4WYLA 3TRGA 1CG2A 4XPCA 4MMOA 2RIJA 4FVMA 8AT1B 3HHDA 4YFUA 4RJVA 4DOZA 2UV8G 2J6SA 4J91A 5ITHA 2C3OA 2AJ0A 5IOLA 3IFEA 1NJXA 4LF5J 4OZLA 3D1OA 2R2UA 3C6UB 1S49A 1WELA 1T9YA 2QO3A 1D9AA 4J9PA 4M5HA 3RR7A 2YXLA 2W7OA 2BJEA 5RUBA 5T41A 2GHVC 1IBMF 4HTJA 4O3PA 2C3UA 1NU4A 3PV8A 4TYAA 1TZ0A 1UVLA 2JEJA 3QRQA 3O2IA 3KHGA 1P27B 4H4KC 2VD3A 2W9BB 4FXVA 3HO1A 2GAGC 2D9OA 4KIAA 2CRLA 3PRBA 4JB8B 1ICEB 2GVZB 5IM0B 5GAHU 2HNDA 3K2YA 4LR8A 2KXHA 2DH9A 1HNWF 1SJFA 3CCRS 1E6VA 1NHVA 2DBBA 3Q8RB 5I3UA 4P72A 1E6YA 3NG8A 4O0IA 4V19J 2BZ2A 1CBKA 1TL1A 4MYUA 3OT9A 4ZVSB 2J76E 2FTRA 3P5BP 1NJIT 1D9FA 2R7XA 2ZHBA 2E1AA 1WOSA 1NZAA 2PEBA 3NGDA 3DLKB 1SJ3P 4M5NA 3DLHA 4UT4A 4LSZB 1X0FA 4R5PA 1WWHA 1S0MA 1NJWA 3I0RB 3A8JA 3NWGA 1HBUB 4UTGA 3NOCA 3IXQA 3M8YA 2DK2A 2VC0A 3D6MB 4DR2J 2K3KA 2O1PA 4PPZA 2V4JA 1N0UA 2AGPA 2MSSA 2LECA 1YHQS 3UR0A 3OW2R 1U25A 2V2QA 5CZVA 2A6OA 2RU3A 2QYGA 2ZC4A 4OZ2A 4OJ3A 5KTQA 2KXFA 4QWAA 1EKRA 1TTHB 4Y3CA 3SMZA 1S1UA 3Q8UA 1VRUA 1YDLA 4J9QA 3I9ZA 4K4YA 5G4DA 2C2DA 2AV5A 2V6AA 3R9LA 1H72C 2QFIA 4EO8A 1TL4A 4KPCA 2A10A 1NDKA 1NLKL 2ZBRA 1Y11A 3D67A 4NLSA 1X5TA 2AYMA 1H38A 2WVBA 3NNAA 2Z4PA 4USTA 3RB3A 1DY3A 3SCJE 3VQSA 2CQ2A 5M2RA 1NK9A 5K14A 5K8NA 4NCGA 4ID5A 4I1TA 4KHPF 2EK1A 3IWLA 1LXNA 3SCIE 1EARA 4AFFA 4JI0F 4F0HA 1ZYQA 3PKMA 4P75A 2K3IA 2GHPA 1N33F 2KG1A 3M30B 1PBUA 4URGA 2CQCA 2RHQB 1X9WA 2GX8A 1HNZJ 2OPSB 1FRXA 2KHDA 2R8JA 3BO4A 1R8AA 3PYGA 3OSPA 4HT5A 1RCXB 3QQCD 1VRUB 3R5JB 4PG8A 1Y0HA 1VQ5S 1BWVA 2MEWA 2NQPA 1RT2A 2AMCB 1K73T 3MR3A 5IWAF 1E6VB 1NDLA 4KO0A 1ZM4A 3CDAA 1LWCA 1MN7A 3ETMA 2WCXA 3SSRA 1HI8A 1NB2A 2L48A 4EBDA 3PYDA 4U7UD 2KT3A 1LK5A 3TNVA 1EHWA 4X4SA 2W9AA 4QYZJ 4IUFA 3EE3A 3R7NB 3E01B 3DLJA 3JSBA 5KFBA 1JLBB 2MKKA 3BYPA 4R5PB 4OI0A 1KOHA 2HHXA 3BREA 3KLIA 5B0EA 3HXMA 2FLPA 4CNZA 2OPRB 4U67Q 1PKUA 3RZAA 1MLAA 1F5CA 3CD5A 4YOEA 4O3OA 4LFCF 3W62A 1FX2A 2CQ0A 4ZJLA 2CPEA 3UVJA 4F26A 1NO8A 1WSVA 4DQIA 4NLPA 2HFZA 2E1PA 3KLGB 2G9OA 3N5FA 4N8OA 4TN2A 3UNGC 4QR1A 2K7JA 1MWQA 1S59A 2YWKA 2FQQB 1D8ZA 2LQJA 3NGTA 2ZH1A 5AXKA 1S6OA 4CIOA 3DYAB 3UD3P 4DLGA 2EG2A 3E3XA 3LOUA 1SKRA 1RACB 3CMQA 4CO5A 1NCLA 5LMNF 4C8OA 2BKNA 2A6MA 3ZTQA 1H2VZ 2YNGA 5GAGU 4C8MA 3NS7B 3EJMA 4BWMA 1UFKA 2MJNA 3B54A 3H0PA 1R0AB 5HLFA 4IOAQ 4KYZA 1UFLA 1Q8LA 1RWWB 2ZZMA 2LEAA 5K5MA 4ZVEA 5ETNA 3IGVA 5A76A 4CYUA 5AE3A 2XLIA 5HP1B 1L3UA 5G0RB 2XS5A 2FB0A 3OR2B 4QWCA 5FDLB 2HNDB 1RTHA 1UMJA 1RJJA 3KK3B 2CYYA 2KO1A 4NXNJ 1KRPA 4P52A 3RB0A 1L3KA 1P1LA 3MECA 2B8QA 2YWEA 3TJAA 5L38A 2F1FA 4F7VA 1M5OC 2W01A 4N41A 4B3OA 2QMXA 5CZXA 4DL6A 4JI7F 5KT7A 1UPPA 3D1QA 2RRAA 2AGOA 4ETZA 3IBCB 2HQDA 3CJQA 4ZN1A 4WTOB 2QEXS 2OSQA 4LBHA 3GJQB 2DHHA 3K5MA 5B09A 3KDOA 3M6VA 3WBZA 2DGUA 4CO4A 4X62F 2JVRA 3KLHB 3KK1B 2DXFA 1PO6A 1CQNA 3E01A 1QLNA 1DTQA 4USHA 2ZH5A 4CH7A 1FNXH 1SI9A 1QVGR 3OTBA 5I42B 1N5YB 3BDPA 3RRGA 4DSFA 1DFDA 2DNRA 2APOA 1CJTA 2D74B 1UVNA 3Q8QB 1S6QA 2ZC3A 3QGGA 3QJPA 2XB2D 2RUGA 4OYXA 4RUCA 4ILMA 3KJNB 4R0EA 4CLWA 1EETB 5L1LA 1DLOA 5SZTA 3KK2B 1WSRA 2AHOB 2HSEB 5BYRA 5KFUA 5JUMA 1X8DA 2XWYA 3W66A 1FVSA 3DRSA 1Q4RA 1XMOJ 1PILA 5H9FJ 2HHTA 1N32F 4UW2A 2V34A 4DHVA 5F8HA 1SUQB 3FMBA 1FJEB 1RT4A 2V63A 5K14B 1OYDA 4NLDA 2GJIA 2XM3A 5KG1A 2XO7A 3A1YG 2CPHA 1IKVA 5LSRA 3CJRA 1YZ7A 2GA7A 3N6NA 2RDJA 4A8SA 2IA0A 3NNHA 5A6WA 5DS7A 1B70B 2DR9A 1U1QA 1YRUA 3W3SA 3NRBA 1QE1B 2XBPA 4IG3A 1RT6A 2XY7A 1LEOA 1URNA 3OVBA 3HKZD 2ASLA 5FDLA 2XS7A 1RAFB 4AL7A 2WONB 1FEHA 2A3JA 4KE5A 1VGYA 5ETTA 3DLEB 4C11A 1U4BA 1KQFB 5LL6d 3T19A 4JI4J 3NL0A 1NDPA 1PAUB 4G3IA 2HHHJ 2WB1D 3GSDA 2YPZA 3KJFB 4OFZA 8ATCB 2MY7A 5IFMA 3TVZA 3H2VE 4IG0A 2VDHA 3Q23A 2UP1A 4PWDB 4X4OA 3ADAC 4QIWD 2CJAA 2FZKB 3UQSA 4Q2MA 3H5YA 4ECSA 4UUWA 1S9FA 2FVSA 3MPYA 4JV5F 4MFBA 4EZ9A 4K5SA 2OI2A 5FJ4A 1YZ6A 2ZH2A 1IQTA 1X4CA 3TEHB 3TZZA 3VAIA 5IQ6A 2HK3A 4RL1A 4MKYA 5EDWA 4ES2A 4ECZA 3TEGA 1Y3KA 3MM5B 4G1QA 4O4RA 5ETSA 1QAJA 1JJ4A 3G6XA 4HVZA 5CH7B 2R7WA 1U1MA 1UCNA 3JQJA 2E7VA 3DHWC 5T7LA 1U1PA 4LRCA 4R0JA 5B0BA 2VKZG 1RWOB 2YY3A 5B0GA 3A8KA 5HJXA 1FD8A 2AX0A 4OZJA 3I0SA 3J7ZT 3OV7A 4PWDA 1YRTA 4DR5J 1XMQJ 1CQMA 1RHKB 4H4OB 1T9WA 2WHOA 3FFIA 1I5OB 2OEJA 4C6AA 1CJUB 4C8YA 3KWMA 4PYAA 4LR9A 4Q44A 1T11A 3OFHA 2C2EA 4LF6J 2YWHA 3FCVA 3HVWA 2FJAB 4MKBA 5F8JA 3DI6A 2GMJA 5DM6Q 1IBKF 2GQCA 2NUHA 5CYQA 4CH0S 2ZHOA 2L3MA 2BOPA 2HPUA 2VZ9A 3UDLA 4CZCA 3HPOA 2D1CA 2DNYA 2OP5A 4RW6B 4A8WA 2W4CA 2YNFB 3BGLA 3ISZA 1S79A 4IG3B 4R25A 4CO1A 3VWSA 5T7LB 7AT1B 3M6XA 2VU5A 3FRYA 4DV3F 1R43A 2ZUGA 1V9OA 2PI5A 2KU7A 3X1LB 3A3NB 3MMCA 1IJFB 5C24A 4F0KA 4CM0A 1VS3A 4K4TA 1DRZA 2ZM6F 1C1BA 4DSJA 3T1AA 5IXUA 4WIIA 1OQ3A 1FT8A 4KGKA 4R8UB 2H4WB 2VASA 1U0HA 2HKEA 4OHVA 1UPMB 1SB6A 4FNIA 3MD1A 4I6WA 2VIHA 4C4WA 4CTAA 4NCBA 3AOCA 5M2UA 2NUUG 2QLXA 1SC3B 2BJDA 4J9SA 5ETKA 1TV6A 1FK9A 4P74A 2LA6A 3PX6A 1VHFA 3HSGA 4TXSA 3N0VA 3QFHA 3G6ES 3F0NA 1UP1A 1HBMB 1GMVA 1RTDA 1IBLF 1F5BA 3HLUA 4DBQA 2ASYA 1HWLA 4U7CA 1U8WA 3FQLA 5KAKA 1SKWA 3MURP 2R4FA 4F3QA 3R5CA 2ZJRQ 3DU6A 2Y3YA 2KRBA 1JQGA 1RT1A 1VQMS 2XI3A 2EWHA 2XMTA 2DYAA 1FDBA 3AB2B 5GMKa 5GAEU 1L3TA 2VODA 2KZMA 1U48A 4GKJF 1WHYA 4QQBA 4DPWA 3C6TA 2D9PA 1HI0P 4UOFA 5EX0A 4TNOA 2GW8A 3HT0A 4WPAA 1D8YA 4OI3A 2I6WA 3PEHA 1XQIA 4J9VA 2XHCA 2IAJB 3C19A 4RBVA 1R7IA 1U8SA 1RT5B 2FJVA 3V2UC 4IKAA 3PTWA 1ELOA 2IYGA 4XK8C 3MEKA 1LWEB 1VBZA 1AT1B 2F9JA 2E5JA 3D0HE 3ENQA 4E8UA 2Z30B 1HFEL 1Q82T 2DGTA 3OUYB 2MY8A 4C11B 2UUBJ 5LT5A 1RT1B 3O3LA 4BBYA 1TKXA 5JXSA 2BMBA 4K4WA 3EPIA 4ZHRB 2H3EB 1IQZA 4XDDA 3W9HA 1S4EA 5D4LA 4E2FB 3PW5A 2BE2B 4WKYA 4ZVFA 3VALA 4MT1A 4JYAF 1IJEB 2QMWA 5HO4A 2BA9A 4GVLA 3B8HA 2FJEB 2WVEA 4ZOSA 1YX2A 4WFYA 1RT2B 3J7YI 1S72S 3PO4A 1FDDA 2VKRA 2F63A 3AAWB 3PX0A 2ZNYA 4RZRA 1GH8A 2MZSA 1N0VC 2GQQA 2H5IB 2W2OP 1GX5A 1MWYA 2D7SA 3BKUA 1LNQA 3HSJA 2LLZA 2V67A 1RI7A 4BHQA 3T3FA 2ERRA 1C0TA 4KTQA 1AFIA 4NPOA 4EYIB 1VBYA 2HWHA 4ZCLA 4FYWB 4ZP9A 2HVIA 2Q6CA 3ZZ0A 1MU2B 3PW4A 2BOAA 1RU2A 1R8HA 2YNHB 3JYTA 5IQQA 4A8QA 1UETA 5CXTA 2GFFA 3AJDA 1R6VA 5HBMB 5MLCV 1S97A 1AUDA 3V6KA 2XMKA 3K59A 4B17A 1KWMA 2H5JB 2MJUA 1X5SA 1T8EA 5CQGA 2DR5A 4FF3A 3K17A 3TYTA 1XEZA 3UN5A 4CO2A 1N32J 4M5JA 2UUWA 3EUNA 1WG1A 2B6AB 1HPZB 5KFGA 3CDEA 1OY8A 5E41A 3H8YA 1Q81T 4DJBA 4X2BA 4OYBA 4RNHA 4DPTA 1FXLA 2HVDA 2BRLA 3KLFA 4X4NA 3HVAA 1FKPB 1TK5A 4RW7A 3THPA 3H25A 1XNQF 1M1GA 4LIWA 3M32A 5A8KA 4WP8A 1HKAA 2PO4A 3JXOA 2Z0GA 4ANCA 2VOPA 5A8WB 4DN0A 1VQ8S 2UXBF 3M8PA 1RLDA 1FKAF 2DNZA 3L3CA 3JQMA 1CC7A 2F8EX 4FYDA 4FF4A 1HA1A 2LDYA 2Y0SD 2HVZA 2QA1A 3MUVP 3LQVA 2IY5B 4DL7A 3AQOA 3BGRB 3DOLB 1TKZA 3DLBA 1S1VA 4OX9F 4G6VB 1B4SA 2MXYA 3V5RA 1JJHA 3LP0B 3VVUA 2V4QA 4DV0J 4RWXA 3JSMB 2V8DA 1S9GB 3IBWA 2ZJQQ 2C2OB 2QFJA 3DLGA 1JLAB 3L7UA 4GO7X 3KXDA 2AZ3A 3RRKA 3UE2A 2FJWA 2C2RA 2FLNA 3TX8A 2JFDA 3I32A 2DO0A 1GMUA 3ZZZA 2LQ5A 4DPXA 4LF8J 5D3GA 2XNRA 1TUVA 3EGZA 5A2QY 4RBUA 3HHLB 3ZNJ1 3PKYA 4CLYA 1KS2A 1JLGB 1S1XB 1MW7A 2G0CA 4FP9A 2XCPA 1IKWA 1S9EA 1F2HA 3KJVB 3BQ1A 5L1IA 3W2VA 1X4BA 3PX4A 3RAXA 4PQUB 2YQ1A 5J1NA 2LYVA 3QT8A 1RKJA 2K06A 2ZD1A 1S7IA 2C1EB 2IRYA 3CWJA 3M2UB 4KV8B 5HQLA 1WTBA 2Z58B 3FBEA 1VRQC 3A12A 1R8CA 2B5JB 1SC6A 3T6BA 3ILOA 4DS4A 4DI6A 2A2DA 1HQUB 2G2YA 4HR2A 1N34J 2MQPA 3TOQA 1PC4A 4TU7A 3CCMS 2C22A 1NDCA 2MKSA 3MHYA 4S0MA 4IH6A 4HACA 4DSIA 3K0JA 2PMZD 2LXFA 2GAHC 4F4AA 2F5GA 2JVOA 4QWBA 3EX7B 4DSLA 2ATCB 4ZPTR 3UPFA 2CZ9A 3OFFA 3FRZA 2GQ2A 2ZITA 3IGNA 3NS5A 5ETQA 5J2QA 4DF8A 1IKWB 1M1HA 1NSPA 1JLBA 1S9EB 4HLBA 5KFYA 5FLXY 5DM7Q 4PQUA 2HHWA 3CC4S 3HP6A 3FEXB 2ATLA 3A8EA 3MM6B 4ZVPB 1XR5A 2I9SA 2FVCA 3BEGB 4ZPCA 3UD4P 2QL9B 2XMUA 4D3HA 3QMQA 1T9TA 2E66A 4NEZA 4WFNQ 5CD4A 1VQLS 1RBLA 1X4AA 2DCLA 4NLWA 3CIMA 1KR4A 4Y34A 2GVZA 4YB7A 3UD5A 4H54A 1IN0A 1WEXA 2UUCJ 4URQU 2B3TB 2D3UA 3LP1B 3EVOA 4OI2A 5D78A 5E3RA 5E3CA 3TW0A 5KFCA 1UA1A 3GU0A 4DX7A 3AXKA 2IBOA 3LP0A 3LGHA 4PABA 1JNRB 2DNGA 5DDPC 4TVAB 3ITHA 2R3VA 2VICA 1TL1B 2QLFB 1XC9A 4DR6F 1KONA 2XSFA 5ETPA 2K7KA 2HBQB 2WSEC 2CNOB 2GIRA 1NSKL 4LBPA 1K0TA 4WBFA 1N5QA 1K1QA 3D68A 1YKWA 5E33A 4J9MA 4J9KA 2ZDPA 1JLGA 1S1XA 3Q2SC 1FKOB 5LM7E 5L1JA 2Z56B 2ZZNA 4RUHA 1VLYA 1F3VA 1LWFA 3ZZUA 4JV1A 1UWBA 2MPUA 3N4WA 1LWXA 1RTHB 1YI2S 4C9DA 3DKDA 4L72B 1SBRA 2I5JB 3CJ8A 1ZAVA 4UOHA 4WKRA 3HFZB 4OJ1A 3CJ3A 1V5IB 3KDNA 2XSJB 3SXLA 2I8EA 1S57A 5KFNA 4PXEA 4YQWA 3PR4A 1FTRA 3G71S 3FCWA 2FVPA 3C46A 3KJQB 5DQHA 2PGCA 5LJ5Y 1YTYA 2E44A 2GC8A 4KFBB 5J2NA 1EIYB 3RU0A 4IR9A 2CQBA 1AYEA 1WACA 4MK8A 4RW7B 2F65A 3Q8VA 4BS2A 4NA3A 1ZPWX 4DV1F 1UVIA 3R2CJ 2X1FA 1S12A 2AW0A 1J5OA 1MSWD 2CZ4A 1C0TB 1WORA 1RADB 4ZPAA 1H7XA 4O3SA 1TFWA 2H5EA 1HNVB 1KDNA 1WHXA 2FUG9 3HJFA 3BGRA 3DOLA 2HFOA 5ETVA 1NH7A 4MAKA 3IWXA 1S1VB 2C3PA 3FBBA 3R1HA 3RBDA 1NK4A 5H9FK 2M9KA 2YPYA 4DQRA 4DR4J 1RAIB 5KFVA 3V81B 1D1UA 1RISA 2PE8A 2V8VA 4USVA 2HQCA 2HVEA 3K57A 3Q22A 2EFPA 4HDHA 4I6AA 3GG0A 3P4UB 2J9DE 1WI6A 2FJBB 4J7CA 3M8ZA 2HVHA 1JWWA 2GCFA 5SUHA 1HNWJ 3W9JA 2X1BA 1RT4B 1S6PA 3NP5A 2W9CB 4IH7A 1F0XA 1UW4A 3HVRA 4P6QA 2XLKA 3G86A 3MM7B 3VR1A 3AQPA 2C2MB 1FNOA 3MZIA 4QW8A 1NNDA 3U1MA 3VGUA 2CQIA 4XIUA 5CYJA 2EG1A 3LGMA 2ZM6J 3KHLA 3FSYA 4PZVA 3CGIA 4OZ0A 3E2EA 4JV0A 2O5DA 2ACMA 2IMOA 2KB2A 3R5DA 2P2CB 3DCAA 2DRBA 4K4UA 1K8AT 2PT0A 4NXMF 1RWXB 2HGLA 3VZIA 4GKKF 1T95A 1BD6A 4NZ0A 3PIOQ 2DHGA 4DR1J 4JI5J 1Q95G 2OAUA 3ET6A 2VB6A 2VG7B 3BR9A 1D0EA 3JSMA 3MPWA 3EICA 2D3O1 2AGQA 2JWNA 2P6SA 1FDNA 3G2XA 3O1LA 3LP2A 4KKOA 1TK0A 2DR8A 2IRXA 3BO2A 3CCVS 1HR0F 5HMWA 2E5HA 3FBFA 2W2QP 2HMIA 2UXCJ 1PYOB 2UUAJ 3CCUS 3M7VA 2RNEA 2ZE2A 3NMRA 2FGCA 2P5VA 3B78A 2W8KA 4ILRA 2IFXA 2R2RA 1FRKA 4HH1A 1LWEA 3TVKA 5C7PA 3HJVA 1NBEB 1SH0A 4JOUA 4B3RJ 3IO1A 3OJSA 1V5VA 4Z37A 4YR3A 4YB5A 3CIZA 1YJNS 1DZ5A 3IN5A 2NSBA 5F0UA 4B3OB 3ICLA 6AT1B 4B3TJ 1S1TA 4ZHRA 1A7GE 3W1YC 2EI5A 4TKTA 1W2BR 4DV6J 2QA2A 3AA9A 1I3OB 4Q7AA 5IV3A 4RUAA 4QWDA 4B3MJ 4M94A 4XAKA 3GPAA 1FESA 3H7HB 4FZVA 3B4DA 4ILLA 1YLXA 3W5YA 1FFGB 2MTLA 3W61A 2OTLS 1L3SA 3D6HB 5BYSA 1JLQA 2IIHA 2QZ8A 1IKXA 4W98A 3J80U 4QOTA 5K8PA 5D77A 1SL1A 3E51A 1ZM9A 1N5TA 2W7AA 2QLWA 2AQ4A 2E9RX 4ECXA 1N8RT 2ZWPA 1HIYA 3NCPA 4NRUA 7FD1A 4RW6A 3VAMA 3U27A 1MNEA 4H4MB 3MXHP 2OHDA 1RAOA 3HMJG 4IR1A 2NR0A 4ZPWR 2CG8A 2OPPB 3M6WA 4Q8FA 1FTCA 2HGNA 3NBPA 4PCQA 1G2EA 4NASA 3DDKA 2CNNB 1DLOB 2Y1RI 2RB7A 2GZOA 3T9NA 4YDDB 2UXCF 2ZKTA 2HS0A 4I2PA 4USJC 4B08A 4F3OA 4UOGA 1XNRF 5HBMA 3DRYA 5CA5A 2KRRA 3IR6B 4WFBQ 3CCLS 2YKPA 1FRHA 1HBNA 3A3OB 2UUAF 1U1KA 1T7PA 1XIQA 3GYXB 1N36F 1RE1B 2YQ3A 4Y00A 2EC0A 4ZCMA 2J0SD 3CCQS 2FZGB 1QVFR 3GFHA 4WJBA 3RR8A 3JTNA 4JBCA 1RA7A 3DM2A 1IKVB 2B7CB 1SJ1A 1VHIA 2JNJA 4KSEB 2L41A 2NS1B 1FWKA 3I87A 1SJQA 2HNZB 2IM1A 4UQGA 4CO0A 1XN9A 4LF4J 1TR0A 5HVHA 1C2PA 2AEFA 3PW7A 3V81A 1U47A 3DMJA 1UTAA 3ILIA 4L76A 1CS4A 3W5ZA 3EGNA 3CEDA 4YR0A 2E5LF 2ASJA 1MMLA 2CQGA 4CLPA 2R7UA 4MK7A 2DD8S 2QT7A 3IP0A 2BABA 3BSNA 1G1XA 1IM6A 4C3MA 3CW2C 2MKCA 2ZFHA 3OVSA 1C0UA 2CJ9A 3ZTRA 3MR7A 4QIFA 3CJKB 1U6ZA 4X66J 1W26A 3P5TL 3BN4A
chains in the Genus database with same CATH topology
1WJ9A 5H9EK 4QYZK 4DZDA 4U7UD 5CD4A 2Y8WA 3QRQA 5H9FK 2Y9HA 3QRRA 2Y8YA 3QRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ9 A;  5H9E K;  4QYZ K;  4DZD A;  4U7U D;  5CD4 A;  2Y8W A;  3QRQ A;  5H9F K;  2Y9H A;  3QRR A;  2Y8Y A;  3QRP A; 
#chains in the Genus database with same CATH topology
 1KD1 T;  1UZH A;  1OMS A;  1JLQ B;  3OLB A;  2H9Z A;  2JH3 A;  3CDW A;  1U1R A;  2XMA A;  2Q1L A;  1ACM B;  2DEJ A;  5G0R A;  2HRY A;  2HNZ A;  2XI2 A;  4LJM A;  2W4P A;  3MM5 A;  4CYU B;  1KLM A;  4U7U K;  5KT4 A;  1P9Y A;  2Q3P A;  2BQR A;  4USU A;  3KG0 A;  4PQA A;  2C3M A;  1HBO A;  3GZ7 A;  4C98 A;  4MIW A;  2DNM A;  2MGZ A;  1KHW A;  3MEC B;  4DSK A;  3Q89 A;  2NCK L;  1SXL A;  4OHZ A;  1HLW A;  1IWA A;  1ZM2 A;  2DGV A;  4OYZ A;  4JI3 J;  3UN3 A;  1RTI A;  4HHH A;  4Q45 A;  3CCE S;  3QGH A;  1ZAX A;  1TL5 A;  2CQ1 A;  2NPI A;  2PMH A;  2ROG A;  3AJ2 A;  3I0S B;  3D0I E;  4I2P B;  3I56 S;  1HD1 A;  4I6Y A;  3TVY A;  3H59 A;  1DQA A;  2EW9 A;  2IJR A;  2QN6 B;  1WEZ A;  1AZS B;  1FEE A;  2LFV A;  3M2R A;  5KFA A;  3RYL A;  4F25 A;  1RYR A;  2U2F A;  1S4F A;  1YIT S;  3AHP A;  3KLH A;  1HL6 A;  2DNP A;  1KQG B;  2R8G A;  1VCT A;  5D0R A;  3NGU A;  1OSD A;  2V8P A;  2UVR A;  4N76 A;  1G4C A;  4MKA A;  4DV2 J;  3RRH A;  2XS2 A;  4HTI A;  1CJK A;  3WIV A;  1KN6 A;  1N5Y A;  2DY9 A;  3S1T A;  1CPZ A;  2MGZ B;  4K5R A;  1G3O A;  1SC1 B;  3OXL A;  3POT A;  4HI1 A;  1BE4 A;  2VFV A;  1RHR B;  1UKU A;  1VQP S;  2CVE A;  2DGO A;  2M70 A;  3OTD A;  3WIU A;  4JI8 J;  4PEO A;  3C14 B;  5DG9 A;  2WVF A;  4NZ7 A;  3KK2 A;  2UVU A;  3HHL C;  4DR4 F;  1VI7 A;  3DRS B;  4C3K A;  3SZ2 A;  4KO0 B;  4LFC J;  5ETR A;  2CPZ A;  2Y1L B;  4DS5 A;  1FER A;  4I69 A;  2KT5 A;  2DXE A;  4OYI A;  1V6H A;  2PMW A;  3LP2 B;  4KKO B;  3MPU B;  5LOQ A;  3LA0 A;  3WDO A;  2ZZT A;  3DRR B;  5C25 A;  1F9H A;  2CPX A;  3D0G E;  1N52 B;  3CJK A;  1UW9 A;  3BSA A;  3M9O B;  4F4X A;  2ZVS A;  4OYW A;  3H42 A;  1U7L A;  1RWN B;  2RH3 A;  2V94 A;  2WW4 A;  3CCZ A;  3KLI B;  2FJD B;  3QAT A;  2GV1 A;  4FXW A;  2HNY A;  2AEM A;  3PXG a;  2KJV A;  4TYB A;  3H4B A;  3RB4 A;  4B9U A;  2MMY A;  4RW4 A;  4LFB F;  4OHY A;  3KHR A;  1XMQ F;  1NB7 A;  2OD6 A;  5DO2 A;  2Q6B A;  1ZTT A;  4FYV B;  1X9M A;  5KFZ A;  1PG5 B;  4ANE A;  2WON A;  2ILY A;  4M1K A;  2YKN A;  3GSI A;  3DRP A;  3EZU A;  2KL8 A;  3EVM A;  1GAO A;  3EXY A;  3THV A;  3OD2 A;  4LF4 F;  5IT9 U;  2J7K A;  1GXT A;  4DMZ A;  1S1T B;  5C2C A;  3OLA A;  2J9C A;  2R2S A;  3QT7 A;  4DPU A;  3NCQ A;  2VBX A;  4HI2 A;  3IR5 B;  4LQ3 A;  3CC2 S;  4P7V A;  2RD5 C;  3FKB A;  2P9C A;  3QLH B;  2DB1 A;  4M5L A;  5L46 A;  3UDC A;  2CKW A;  2FLO A;  3G8S A;  1N33 J;  3G8T A;  4O3Q A;  3MMA A;  1VBX A;  3AOA A;  2QGF B;  3VAH A;  1U1O A;  1GNK A;  2ABY A;  4EZ6 A;  5AE2 A;  3EXC X;  1VQ6 S;  3BPD A;  3H5U A;  2BEF A;  3IG1 A;  3G82 A;  1S48 A;  1RK8 A;  2PFD A;  3H5S A;  5E5N A;  5H9E K;  2CJB A;  5KFM A;  4TQS A;  1ZPV A;  2OEM A;  2KVI A;  1IUJ A;  4G1Q B;  4PG7 A;  4DN9 A;  4JI4 F;  3KMQ A;  2DGW A;  4IH5 A;  3ZO7 A;  4UZC A;  2HHH F;  3A4T A;  3FUY A;  1T02 A;  3GB0 A;  2VUG A;  3KG4 A;  4ZP8 A;  1F6T A;  2XUL A;  4OX7 A;  4ZVQ B;  2X7I A;  3OUY A;  2M2B A;  3OVA A;  3HI9 A;  3DC2 A;  4JI2 F;  5BJR A;  4DR7 F;  3CTR A;  2HFV A;  2FY1 A;  3PYF A;  2PA8 D;  2JL9 A;  4YS2 A;  3VAF A;  1VC0 A;  4J9U E;  3VGV A;  5JVG Q;  3QNW B;  1KP6 A;  1QJH A;  1JK9 B;  2PII A;  1ZZF A;  1OO0 B;  1TL7 B;  4C0B A;  2BE2 A;  2JZ5 A;  4P73 A;  2DIU A;  2HHP A;  3GE9 A;  3GG1 A;  5B0A A;  5GAH I;  1NK5 A;  1JXL A;  2JEG A;  3MR6 A;  4NLY A;  3NAI A;  4WE1 B;  1KQK A;  3VQT A;  4QPX A;  2AJF E;  4OLO A;  1ZTW A;  1EQM A;  4FXD A;  3QIP A;  5IV4 A;  1FXR A;  1RLC L;  2ADB A;  4DL2 A;  1XMO F;  4W92 B;  2LXI A;  1RTJ A;  1B7Y B;  1ZBT A;  2B4V A;  2KYZ A;  3HD1 A;  1S6P B;  2B4P A;  3HFV A;  3T41 A;  3SV4 A;  4ED8 A;  1N4L A;  1KVI A;  2JJ4 D;  4KGX B;  1T94 A;  2CFX A;  1X4G A;  1U2R A;  2XZD B;  1XK8 A;  4OX9 J;  4F2R A;  1S5Z A;  4FBU A;  2GGP A;  1XBW A;  1FNM A;  1GTE A;  3PAC A;  1W25 A;  4P2F A;  4EK2 A;  1DQ9 A;  1UA0 A;  1L5U A;  4IQX A;  2YNH A;  3CSK A;  2KHC A;  3JTP A;  3LF0 A;  3Q83 A;  4NL5 A;  3UW1 A;  2UU9 F;  3C66 A;  1V3Z A;  3NKY A;  3UCZ P;  2HYI B;  4F3M A;  1FDA A;  4NLO A;  1KFS A;  1ARO P;  1UJ4 A;  2HHU A;  2V2V A;  3LP1 A;  5HAN A;  1HR0 J;  2P9E A;  3P8B B;  2RQC A;  4Q0B B;  3TX0 A;  3G87 A;  2ALY B;  2FVR A;  2B6A A;  4DXL A;  2OPR A;  4JV2 A;  2HS4 A;  3GFZ A;  2E1C A;  2OSR A;  2UZA A;  3IG1 B;  1EJ7 L;  2RT3 A;  4QBU A;  4ZN3 A;  1U09 A;  2BJ3 A;  4HL9 A;  1HBM A;  3W7B A;  1FHT A;  1JJC B;  5HAO A;  2H51 B;  3SSQ A;  3PW0 A;  2BJ7 A;  3H5X A;  3BQ0 A;  4JI8 F;  1D3W A;  4A4J A;  4B3T F;  4LRE A;  1IXK A;  5B08 A;  4OZ5 A;  1Y5N B;  4IOC Q;  4QCL A;  1UEK A;  3BV8 A;  2VBW A;  3EDQ B;  1PAE X;  2JHE A;  2P8I A;  4NA2 A;  2NXE A;  4YR2 A;  2YNG B;  1VQK S;  1DHM A;  1FRI A;  2QIF A;  4OZ3 A;  2HGM A;  4DUZ F;  4NA1 A;  4ATN A;  2J6U A;  3IMQ J;  4OLP A;  3DDN A;  2IM0 A;  2UXB J;  2CUY A;  2HIY A;  2HNY B;  4KHR A;  4F8R A;  4DV1 J;  4Q0B A;  5T14 A;  2HIQ A;  5C5J A;  1KBR A;  1JLA A;  3AOB A;  1VC5 A;  1RT5 A;  3Q8Y A;  1BXN A;  1Y3J A;  3S6E A;  2N3O A;  3ZXW A;  3TA2 A;  5LMN J;  4NYZ A;  3EPG A;  4LF9 F;  4DU7 A;  2RHS B;  2VG6 B;  4BDP A;  4K8R A;  4JI3 F;  1Q1K A;  3EMT A;  2JC1 A;  3GYN A;  2AKW B;  2EC2 A;  3MTK A;  2ZEJ A;  1GT8 A;  1WF2 A;  3GIL A;  3CMA S;  1HNZ F;  1VK8 A;  2GMH A;  2R8I A;  1IBL J;  1Q8I A;  3NAH A;  4Y6I A;  3TA0 A;  5ETL A;  2ZHA A;  2AEJ A;  4NWB A;  5J1E B;  5A0Y A;  1WKK A;  3N28 A;  2YTC A;  4P2M A;  2MQM A;  3W60 A;  2DXD A;  2R7O A;  3LH2 S;  4CLU A;  2YBV A;  2YH1 A;  5F3Z A;  3HK2 A;  2VFT A;  5J2P B;  3SV3 A;  3T5J A;  5J1P A;  1TK8 A;  4AD6 A;  5F8I A;  3RW7 A;  1UJ5 A;  4MH8 A;  2A18 A;  2HZA A;  3UCG A;  3VAJ A;  5HSP A;  5HVF A;  1UEU A;  1Q0N A;  1BQN A;  2YWG A;  4Y2C A;  4ZVU B;  4B3S F;  1P1T A;  3HCX A;  1HAR A;  3HM9 A;  4CO3 A;  4XPE A;  5DDO C;  1RP5 A;  1YJT A;  1FD2 A;  2KXN B;  4FPI A;  2E5L J;  4LT6 A;  2H1Y A;  1MU2 A;  4CT8 A;  3LUY A;  1SJR A;  5M2P A;  1U0S A;  3KLV A;  2XMJ A;  4KPY A;  4TLQ A;  4E0D A;  1CVJ A;  3GFY A;  1UJ6 A;  1LFW A;  2BAC A;  2R42 A;  2XNQ A;  3CPW R;  1FCA A;  4KB7 A;  2VF3 A;  3B4M A;  3M1V A;  3RGI A;  1GX6 A;  2AX1 A;  2J0Q D;  3I4P A;  3IAM 9;  2H54 B;  5B0F A;  7FDR A;  1HPZ A;  2F7V A;  4HDG A;  4OZN A;  2QV6 A;  3GCX P;  2B9Y A;  3ITH B;  5DQI A;  4NLT A;  2KM8 C;  2QE5 A;  3UWT A;  2Z8Q A;  4TY8 B;  3WX8 A;  3CE8 A;  3HDS A;  3PRV A;  4DZD A;  2EFV A;  4LUB A;  1K9M T;  5KG6 A;  4Q8E A;  2J9E A;  4O3R A;  1C4C A;  2W2P P;  1NK7 A;  1NPP A;  4F0M A;  4C3L A;  3JQK A;  1N34 F;  1I1G A;  3M32 B;  1HWU A;  1HW9 A;  3CD0 A;  3QWU A;  3V6H A;  3L7O A;  4ZIW A;  5LSL A;  4MK9 A;  2DPJ A;  2P6T A;  3ONQ A;  2BJ1 A;  3PEJ A;  1HBO B;  2WAQ D;  2MQO A;  2HFS A;  4DL4 A;  2W8L A;  2X51 A;  4IRC A;  2CQ4 A;  3Q86 A;  4ZLP A;  4I4B A;  2IC3 B;  4ZVH A;  3OTC A;  5KG2 A;  1EP4 B;  5JMN A;  5CYM B;  5FD1 A;  3FK4 A;  4KGZ B;  3UR3 C;  1JLE B;  3C16 A;  3PJW A;  4OX6 A;  5B7W A;  1SCJ B;  3G6Y A;  4F50 A;  3SBM A;  4WFA Q;  4RNF A;  3M9N B;  5D3G B;  4NI2 B;  4MYT A;  4K2J A;  3W8G A;  4RX6 A;  3L9Z A;  4A47 A;  5EWG A;  4EI2 A;  4DUY F;  4IRD A;  4O44 B;  2V69 A;  3P3D A;  3I0R A;  1GXU A;  4TLR A;  4WTY A;  3GJR B;  3GQC A;  1IR2 A;  3IAS 9;  5B0C A;  4N8N A;  1J5E F;  4DV4 F;  4JP8 A;  1WG5 A;  3T6J A;  4WZM A;  1RAE B;  3TQ1 A;  3OR2 A;  4Z7Y A;  2Z57 B;  2EXU A;  3TQE A;  2WSF C;  2EFG A;  3GII A;  1FJG F;  1X4E A;  4I2Q A;  2UV8 A;  3T5H A;  3F44 A;  5KG0 A;  2CWK A;  4ZJQ A;  2OPP A;  1WDT A;  3IS9 A;  5KFT A;  2VQF F;  2VV5 A;  1DUR A;  1UFW A;  5KG3 A;  1CJU A;  3WQP A;  4ZMM A;  3NOG A;  3WC2 A;  1KVK A;  3D54 A;  1WG4 A;  3A8I A;  3I82 A;  2K2P A;  3M8Q B;  4DUY J;  3Q24 A;  2QSW A;  1VOM A;  2BX6 A;  1XNQ J;  3EGV A;  1TFY A;  4TY9 A;  3V4I A;  2DH8 A;  4PXC A;  5F8M A;  2UVW A;  3WHI A;  1NJZ A;  1U1L A;  2ZJP Q;  2AJ2 A;  3R7S B;  1RB0 A;  1N5V A;  5C25 B;  5LXR A;  2XY6 A;  1TAU A;  4GMK A;  2LVW A;  1PSD A;  4A48 A;  1QSS A;  3SCK E;  2NZC A;  1RT7 B;  2XMM A;  4ITS A;  2WTF A;  1B99 A;  1RT3 A;  3EVW A;  4U6P A;  3GTY X;  2IPO B;  2M8H A;  2Z2Y B;  5ETO A;  5KT6 A;  2CIM A;  3BKF A;  4FVC A;  1Z2Z A;  1YJ9 S;  1B7F A;  3CDB A;  1SC4 B;  2B56 A;  1UL3 A;  2K1R B;  1P8G A;  2OGU A;  4RW4 B;  4C8N A;  3RG6 A;  3JYT B;  4X64 J;  2RKI B;  3SIP B;  3D66 A;  4C48 A;  3BPS P;  4L3N A;  3CO0 P;  1SQE A;  3E8O A;  1RUS A;  4ID8 A;  3MM9 B;  4DU8 A;  1S99 A;  2R8H A;  1XJW B;  2OFH X;  3KUH A;  3FZB A;  4CT9 A;  4X65 F;  2BQ3 A;  2AWZ A;  2L08 A;  1YBT A;  1CUL A;  1LW2 B;  4J5O A;  3RAQ A;  1KQS R;  4KY3 A;  4I67 A;  3K5N A;  2O01 C;  2J8S A;  3T5L A;  1EB0 A;  2B9E A;  2LQ9 A;  2OD4 A;  1HNI B;  3C16 B;  4WIQ A;  4ZPB A;  3MEG A;  5HQM A;  2HHQ A;  1X5O A;  1XWL A;  2BM1 A;  4ZPV R;  1TAQ A;  2WVC A;  3OSN A;  4ZIT A;  4ECT A;  3P45 B;  3NNC A;  1FA0 A;  2HEK A;  3UFC X;  1KTQ A;  3OFE A;  3OL6 A;  2OJ3 A;  1UVK A;  2EFN A;  4ES1 A;  2FHJ D;  2IVM A;  3ILL A;  3LGN A;  2Q66 A;  2NYH A;  3R8Y A;  5AJ3 F;  1RQ0 A;  3T1Y F;  5DGA A;  3R5G A;  3U1N A;  1VIS A;  4QW9 A;  2I1R A;  1N48 A;  4EEY A;  4CWB A;  3Q8P B;  2VPW B;  1JXE A;  1WKL A;  1Z2L A;  3K5P A;  3IS9 B;  5KFK A;  1MN9 A;  4FS1 A;  1NHK L;  3MAA A;  4DR6 J;  1NK0 A;  1QAY A;  5C42 A;  2MHE A;  5KOW A;  3BJY A;  2AYB A;  2DGQ A;  4WFZ A;  5E2Q A;  3RJM B;  5DQG A;  5LMU J;  4OV6 A;  4DF4 A;  3C15 A;  3H20 A;  4Y2M A;  2HLU A;  2BVZ A;  5LXY A;  3I5C A;  2EBG A;  4RUB A;  5HRO B;  1BQN B;  2DCU B;  2XO6 A;  2UUC F;  4GC6 A;  4DL3 A;  2WOM A;  1JB0 C;  1IKX B;  4ZA1 A;  1BQM A;  1H74 A;  5D0H A;  5E3A A;  4X62 J;  5A2Q U;  1FFW B;  3MF5 A;  5HQ8 A;  3K5L A;  1HWJ A;  2FHJ A;  4ED4 A;  2VJU A;  2ACY A;  2QA4 S;  3W8P A;  2RUS A;  4HHJ A;  4M5I A;  1TKT B;  3BGU A;  3M2U A;  4IOB A;  3I55 S;  1RT6 B;  2UUB F;  1GMW A;  1YG0 A;  4N77 A;  3ENV A;  4CH1 A;  4CRJ A;  3NBP B;  4DSE A;  3CJ2 A;  2ZOF A;  3KLE B;  1QSY A;  2PI4 A;  2WRM A;  2B9W A;  3EGW B;  2E7W A;  1OQ6 A;  4LRF A;  4DV2 F;  2KFZ A;  5KG4 A;  5F8L A;  1ZET A;  1KC8 T;  3OL8 A;  2V8G A;  1F9E B;  4LF1 A;  3SFG A;  5DDQ C;  9ATC B;  4PWU A;  3RBE A;  1C4A A;  4L73 A;  1JLC B;  5THW A;  1K1S A;  1BQM B;  3CCJ S;  1ZZN A;  2HWT A;  5KFE A;  2VQE J;  4IFV A;  3B82 A;  3MGJ A;  2G0J A;  1U45 A;  3B6B A;  3LAK A;  5DZ6 A;  4YHH J;  3PFE A;  1HYS B;  4AXJ A;  2X1A A;  1OWX A;  2KG0 A;  2BDP A;  4JI6 F;  4JI1 J;  4QU7 A;  2L9N A;  4RLE A;  3Q8S B;  3D4J A;  3P6Y C;  1KVJ A;  1HHT P;  4U95 A;  3D2W A;  1HWI A;  2YQ0 A;  5GME A;  3QFW A;  3DGV A;  4ZIV A;  2ROE A;  3H4D A;  3F73 A;  1H2T Z;  4LVO P;  5E3P A;  5KOX A;  3H40 A;  1YVF A;  4DX6 A;  2ROP A;  2AT1 B;  2E5G A;  1LWC B;  4NLG A;  2VG7 A;  2GIQ A;  1LKZ A;  2DNN A;  1WF1 A;  1JLE A;  3R5A A;  3V4M A;  5BR8 F;  2ZH8 A;  2HQ3 A;  1QSL A;  1RHQ B;  4NI2 A;  2D69 A;  1OS5 A;  2XMV A;  3AD8 C;  4KQZ A;  1FF2 A;  3TP2 A;  2MZ1 A;  4FYY B;  1NJY A;  4NCA A;  4QR0 A;  1RWU A;  2ZE2 B;  3IRW P;  3PCO B;  4NEY A;  2R7S A;  4UY8 5;  1CEZ A;  3AA8 A;  2J7U A;  2MQN A;  3LW5 C;  2MB0 B;  1P6T A;  2G2O A;  2HWI A;  3M05 A;  3FZ2 A;  3SQG A;  1VMB A;  1PBA A;  1SV5 B;  4GVB A;  4O0N A;  4WYW A;  5GAD U;  3KFW X;  4DQQ A;  3TAN A;  1T05 A;  1K0V A;  2L9W A;  1NK8 A;  3VAG A;  3Q2T C;  2DRD A;  4NX9 A;  2BYC A;  2IMW P;  4ZP7 A;  2Y8Y A;  4A8K A;  4B9S A;  3NGK A;  2LEP A;  2MQQ A;  1K44 A;  2LU1 A;  1CJV B;  1U26 A;  2M7S A;  5J2N B;  2DNH A;  5HVG A;  3KNA A;  4KHM A;  4C7Q A;  4DQP A;  4LF9 J;  4KGV B;  2DRA A;  5BYQ A;  1AZS A;  1NM2 A;  1NKC A;  2MST A;  3FEY B;  2N3L A;  4QU6 A;  4KC5 A;  5U47 A;  2HHS A;  2DIV A;  5AE1 A;  4L6V 3;  5KFQ A;  4Y0F A;  2IA6 A;  1WUU A;  1TEL A;  2JX2 A;  3W2V B;  2ASD A;  2V4J B;  3G6V A;  1HQE B;  2UXD F;  4PPD A;  4ELV A;  1N6Q A;  3VZH A;  1DTT A;  1REG X;  5F41 A;  4QYZ K;  2OEK A;  2RKI A;  5A6P A;  4Y2I A;  1S1W A;  5D4O A;  1NH8 A;  3K8V A;  5IM0 A;  3TAR A;  1VQ4 S;  3P96 A;  3NEK A;  3R3T A;  1GXL A;  2EFO A;  4F4Z A;  4ELU A;  3DLE A;  4X4R A;  4CLT A;  2DGS A;  3C3L A;  3UO0 A;  1E6Y B;  2Y0B B;  4OIX A;  1TVR A;  3NMA A;  1SL2 A;  2OML A;  1ZA2 B;  3M1V B;  1QD1 A;  3R5B A;  1JIH A;  3W2W A;  5K20 B;  3QJL A;  1CC8 A;  2HUR A;  3TUP A;  4JYA J;  1I6J A;  3ZTS A;  3O5T B;  3HSD A;  3R1L A;  4HYK A;  1DTT B;  4LFA J;  4CLZ A;  2J6T A;  5I4M A;  1GQE A;  2VOO A;  4U96 A;  1PYT A;  4UF4 A;  5HMZ A;  5KFW A;  3GIJ A;  3FNN A;  4OI6 A;  5D8H B;  1KEK A;  3TZX A;  1BWE A;  5IT0 A;  5EUH A;  3Q0A A;  1X5P A;  2YKM A;  5E7O B;  1RYS A;  1KSP A;  1EET A;  5L1K A;  2DIS A;  1PJ6 A;  2O66 A;  3FQK A;  3L7P A;  3LO3 A;  3OHB A;  3DRP B;  4ZP6 A;  3AJ1 A;  3M8S A;  2CJK A;  4A8O A;  4U8V A;  1BY9 A;  1JX4 A;  1S10 A;  3BGF A;  4F4Y A;  1T3N A;  1D9D A;  3V6J A;  2J9D A;  2BR0 A;  4LFB J;  5IC4 B;  3ZNU A;  4V1A k;  2PSZ A;  1LV5 A;  2HHV A;  1N54 B;  3CJT A;  3DFE A;  3HHK A;  2ZH4 A;  1C0U B;  3PY8 A;  1U49 A;  2OTJ S;  1VRT B;  2IC3 A;  4ZPD A;  4ZKA A;  1FE0 A;  2PDA A;  3TO8 A;  3ULH A;  5CYM A;  2CNK B;  2V2Z A;  2FHM A;  4LF5 F;  4X4U A;  4DV5 F;  4X4V A;  1VDH A;  2YVS A;  2Y9H A;  4DPY A;  2UUT A;  4YP3 A;  1T03 B;  1RHJ B;  1BUX A;  4WWS A;  2CQH A;  1QAI A;  3TR5 A;  3QJJ A;  2DPI A;  3C8Y A;  2ZBC A;  3O44 A;  2VG6 A;  2LCW A;  2N7C A;  4FDF A;  2XYP B;  2C3Y A;  2JSX A;  1M5P C;  1TU0 B;  4USI A;  1QM9 A;  3M8P B;  2HRU A;  2CNL B;  2DY1 A;  2GIF A;  2LA4 A;  2QL5 B;  3P49 B;  5KFI A;  2P9G A;  4D3G A;  2CVI A;  2EKN A;  5J1E A;  4USM A;  3TUI C;  3LWL A;  2DNQ A;  3J81 j;  5F8N A;  3A3P B;  4ZLJ A;  4IFY A;  3JB9 k;  1PIE A;  1VBK A;  2DR6 A;  4DX5 A;  2VPX B;  2XGQ A;  3W2W B;  3W65 A;  2AJ4 A;  1X4D A;  2FHO B;  1YGY A;  3F41 A;  4YEA A;  5CD4 H;  1UWA A;  4NRT A;  1VQ7 S;  1IBM J;  1F9F A;  4ZLL A;  1X0P A;  3CJ4 A;  1VQO S;  1RTJ B;  1HNV A;  1MG7 A;  2DH7 A;  2JLF A;  2CWX A;  3I4H X;  1LQ9 A;  3LAL A;  3PG9 A;  3TAP A;  4I56 A;  2VHG A;  2HBZ B;  2JFK A;  3HHL A;  2N82 B;  1HHQ A;  3VAK A;  2Y1J A;  4K0K F;  3POT B;  2ZH9 A;  3TI0 A;  4B9T A;  4DV3 J;  2DT9 A;  3BB5 A;  1RHM B;  3UCU P;  3DOM A;  2NLW A;  3AOD A;  2KFN A;  3N6L A;  4FPR A;  1S7H A;  1U2F A;  4PUO B;  1LW0 A;  1Q53 A;  4NYP A;  5DDR C;  2KI2 A;  3DU5 A;  2VH7 A;  3SFU A;  4B9M A;  3X3U A;  1RTZ A;  2W25 A;  5KFD A;  3FDS A;  2B51 A;  4J90 A;  2CA9 A;  3K8W A;  3LPE A;  3QSI A;  4HAC B;  4DZ6 A;  3IM9 A;  1HQ2 A;  4QJV A;  2LEB A;  2C2Z B;  2FIU A;  4QR2 A;  1N6Q B;  3D5M A;  3EM1 A;  3ILJ A;  1M5V C;  1VQN S;  4AQY J;  1XNR J;  3DLG B;  4GRS A;  1YQH A;  4WFX A;  5IS2 A;  3HVT B;  1SV5 A;  3DNC A;  4YB6 A;  4BC7 A;  4CLL A;  4DPO A;  2VFU A;  1T05 B;  1SL0 A;  4K0K J;  3DDI A;  3OFG A;  3QAU A;  3ZFV A;  2DTJ A;  2YKN B;  4RNO A;  4W4M A;  1MMD A;  5DLF A;  4RO0 A;  4JI7 J;  2BKP A;  1TKX B;  3CVK A;  2DGX A;  3QPI A;  3FJ2 A;  3GIR A;  4IYQ A;  1S76 D;  2HBR B;  1MMN A;  2B4U A;  3ZTO A;  1IBC B;  3I6P A;  4QZV B;  1IBK J;  1XER A;  3PVX A;  4MKV A;  4NYO A;  4P7T A;  2XG8 A;  2DHS A;  3H2L A;  3G4S S;  2B5J A;  1YSJ A;  3HZG A;  3BBF A;  4OI4 A;  1HQU A;  2CPJ A;  4Y2A A;  2IBK A;  1O0P A;  3PO5 A;  4CM2 A;  2CQP A;  2UU9 J;  5I3P A;  1SJ4 P;  4B3S J;  1HQE A;  2IVF B;  3GV7 B;  2NZ4 A;  3N5B A;  5HRO A;  2NXU A;  2HZC A;  3BBC A;  3MDF A;  3NXZ A;  4K59 A;  3AD7 C;  4WCE Q;  3T5K A;  2AJ1 A;  3MED B;  2YX7 A;  2ADC A;  2G1H A;  3BSC A;  1YRX A;  4RW9 B;  5CCL A;  1EKS A;  2V5H G;  1RBA A;  3MAH A;  1O8B A;  4O4G A;  3DOM B;  1VQY A;  3M30 A;  3MMC B;  2HW3 A;  5ETM A;  4A8X A;  3MM6 A;  1R0C B;  2FDN A;  3PJ9 A;  4ZK7 M;  1TL7 A;  1VRT A;  3GON A;  4KHP J;  3ETO A;  2HFN A;  2BAN B;  2CZV C;  3BKT A;  2EPI A;  3PM9 A;  4ZVO B;  4HHU A;  1S6U A;  1SQG A;  2FJX A;  3M8Q A;  5CAB A;  4ECY A;  1V3R A;  2IDE A;  5GMD A;  3QIP B;  2RS2 A;  1JKH A;  3J7A 1;  2WSC C;  2M5Y A;  3C6U A;  1RA6 A;  1ROF A;  2OO4 A;  2QMU B;  2YX4 A;  2NPF A;  5FLX U;  4KH0 B;  4IFV B;  2DNK A;  5IWA J;  3D28 A;  2HFU A;  3DGP A;  3KJV A;  1SH2 A;  3W5X A;  2DEI A;  2NSC A;  2GGP B;  3CB4 A;  5A8K B;  3C14 A;  2CJY B;  2O3D A;  3KHH A;  3DHX A;  4ED0 A;  3K89 A;  2Z2L A;  2ZD1 B;  3ZZP A;  2EFQ A;  1UVM A;  4ALZ A;  3HT3 A;  1RAB B;  2F4F A;  2OUG A;  1HBN B;  2ZBQ A;  2XZW A;  2M4M A;  4C0H A;  4K4Z A;  2M8D B;  4EUV A;  2RS8 A;  3I96 A;  1PJ5 A;  2W4D A;  4WF9 Q;  1Y4Z B;  2I38 A;  4IDK A;  3C6T B;  2CPD A;  3TZY A;  2V4R A;  1F60 B;  4BLG A;  3RTV A;  4PG5 A;  2RQK A;  4I68 A;  5I3U B;  2CDQ A;  1SIZ A;  1IR0 A;  1JKH B;  2VG5 B;  1FWL A;  1XMB A;  4CDI A;  2IAJ A;  4ZVT B;  1UAW A;  4ZCI A;  5HN0 A;  4DV6 F;  2DR7 A;  4LF7 F;  4FF1 A;  2KZZ A;  3DRX A;  1Y9O A;  4Y28 C;  4AUK A;  2BUN A;  2BE7 D;  1RAG B;  2GO9 A;  5J2M B;  3FSI A;  2WVD A;  2VQF J;  4ELT A;  3IR7 B;  1UVJ A;  3DMJ B;  3ISN C;  1DQ8 A;  1HHS A;  3NY0 A;  5AT1 B;  3G9C A;  2KVQ E;  3OQ2 A;  4RU2 A;  4CQ1 A;  4RR5 A;  3RBZ A;  3OHA A;  2YH0 A;  2X3G A;  1Z4U A;  4OHX A;  4IRK A;  2QLB B;  2VPY B;  3N6M A;  5KFH A;  2F4V J;  1U0H B;  4QIE A;  1OY9 A;  1J5E J;  4WK1 A;  1FO1 A;  1VQ9 S;  2E7X A;  3FFI B;  1NPK A;  2J5A A;  4RNM A;  1TL3 A;  1M1K T;  1V3S A;  2LXU A;  2F3J A;  4OZ1 A;  1FJC A;  1MRO A;  4LSN A;  4MIB A;  5F8G A;  4X4P A;  2AYG A;  3BSO A;  1G6B A;  3OTO F;  4UUX A;  3OTO J;  3KUG A;  2FHK A;  5CYQ B;  1FE4 A;  1SPB P;  2HBY B;  4LF7 J;  3FVY A;  3NLC A;  2JRS A;  4OL8 A;  2FY8 A;  2GJF A;  4QPT A;  3CD7 A;  4YME A;  3KK1 A;  2R9L A;  1HNX F;  3QT6 A;  2WW8 A;  2J0X A;  2RF2 A;  4LQ9 A;  4OYM A;  4NXM J;  2AIR B;  2BQU A;  4ICL A;  4N56 A;  2B7B B;  4DG1 A;  2ZKU A;  3JS9 A;  4CP5 A;  5EWF A;  1C1B B;  3MOZ A;  2F40 A;  1S1W B;  2RE1 A;  2XQC A;  2MHN A;  3EZO A;  3CD6 S;  2IM3 A;  4LF2 A;  3W9I A;  2XY5 A;  2LU2 A;  3MD3 A;  5CAA A;  2E9T A;  2ZDO A;  1TMM A;  1X4F A;  1WI8 A;  2YNI B;  4CTA B;  2RDD A;  3SCL E;  1BHN A;  5DET A;  2XCA A;  4IO9 Q;  3H2U B;  3CO9 A;  4KGM A;  3S01 A;  2DJW A;  5KT5 A;  1KHV A;  4XTT A;  3FEZ A;  5AXN A;  1BQX A;  4K2X A;  1WD6 A;  3BM7 A;  3J7Y U;  1R31 A;  3T1H F;  1RT7 A;  2NRE A;  2XYG B;  4A8Y A;  1T9U A;  2QYC A;  4FKX A;  4ICL B;  1RCO B;  2ZBP A;  3BBB A;  4C2M A;  4J9O A;  1M5S A;  1VJQ A;  1N56 A;  1N88 A;  2HQF A;  3QRR A;  3MR2 A;  3KTQ A;  4UQT A;  1RAA B;  1H73 A;  2NYI A;  5CHC B;  2R7R A;  1RAJ A;  3QBC A;  2VQE F;  1Q8B A;  1H6K X;  3AB4 B;  3F56 A;  3L09 A;  3N9U C;  4URS A;  4QYR A;  1KNZ A;  2R8K A;  4G1I A;  2CPY A;  1Q16 B;  1FVQ A;  1DJ0 A;  4PG6 A;  1TL3 B;  2G13 A;  2COL A;  4OYA A;  2WZ1 A;  4EFA C;  2ZUA A;  5LJ3 Y;  5DGB A;  1REV A;  1RWK B;  5D4N A;  4LRA A;  4TY8 A;  2W2M P;  4KFB A;  2M88 A;  3SEO A;  5GVQ A;  1YIJ S;  3DLK A;  1HNI A;  1BLU A;  2FZC B;  2WBM A;  3HD2 A;  3JSR A;  1RKI A;  4ED7 A;  2B4O A;  4M5M A;  3BYR A;  3UN2 A;  2AP6 A;  2FPH X;  1XR6 A;  4NOH A;  2W7P A;  4ED6 A;  1ZAW A;  2V8H A;  2M52 A;  3DM2 B;  4ECU A;  2JEI A;  3MM8 A;  4FKY A;  3K7R A;  3JAM U;  4UZB A;  2VPZ B;  2KJW A;  1A9N B;  1WHW A;  2QC3 A;  4G65 A;  4ENO A;  3IM8 A;  5ADZ A;  1RBO B;  3MWB A;  4O4G B;  2ZH7 A;  2IM2 A;  3SYZ A;  3JSY A;  4ED5 A;  2BE9 B;  4YHH F;  4M95 A;  3NS6 A;  1A6L A;  4PYD A;  1IVZ A;  5C42 B;  4KRW A;  3MAA B;  1WC1 A;  2U1A A;  2QJ3 A;  3QT5 A;  2IVY A;  3BN7 A;  3QGP A;  4DCJ B;  3MPV A;  3PRD A;  2RSQ A;  2XHW A;  2YNI A;  3HUL A;  4USW A;  4DV0 F;  3MFH A;  1S0V A;  3KOA A;  1FX4 A;  4IFY B;  1HMV B;  2Y8W A;  4NMX A;  3HF5 A;  1IKY A;  4N7T A;  3D7S B;  4O44 A;  1Y7P A;  3R7B B;  5D6G A;  2VBZ A;  2YX1 A;  5DRK A;  4DDF A;  4CNY A;  3OPK A;  4K4X A;  4FBT A;  1WC3 A;  2L9D A;  3DGP B;  2DO4 A;  3AXM A;  4KAI A;  4F67 A;  3S7R A;  4M5D B;  3DI6 B;  1S0O A;  5BXI A;  3M9M B;  1EAY C;  2PFF B;  4W90 B;  4EGL A;  4ECQ A;  1AB8 A;  3TJ9 A;  4H4K A;  1AW0 A;  3CCS S;  4WXW A;  3M2V A;  3ZZO A;  3RBX A;  4P10 A;  3BDE A;  1QY7 A;  3VHQ A;  8RUC A;  2EKY A;  2BBE A;  1RTI B;  1R27 B;  5D0G A;  3D3C J;  2ZH6 A;  3ET6 B;  1LW0 B;  2DNO A;  2J7W A;  4WK3 A;  4AQY F;  3SQO P;  3BQ2 A;  2BXJ A;  2V2K A;  3HKW A;  3GR1 A;  3QO9 B;  4X65 J;  2HQI A;  4TU8 A;  4N47 A;  5JVH Q;  4AND A;  2A2C A;  4DV5 J;  2OH2 A;  2FD2 A;  3A13 A;  2I2Y A;  5HJY A;  2J8A A;  1Y5I B;  2MZJ A;  5EWE A;  2RDI A;  3KNG A;  1IWG A;  1XR7 A;  2F4V F;  2HMI B;  3GV8 B;  3OBI A;  2IDL A;  4B9N A;  2W9B A;  3CXC R;  1PGZ A;  3R2D J;  1LWF B;  3UVJ B;  4TU9 A;  3W64 A;  4OV1 A;  4IQM A;  4YY3 F;  2NXC A;  2MLY A;  3UNY A;  6FDR A;  3PR5 B;  1R0B G;  5F9L A;  3VTI A;  5KT2 A;  4OJH A;  3N01 A;  2WK4 A;  1Q5V A;  3DYA A;  5GAE I;  1U2C A;  2ZWO A;  5GAD I;  2YKA A;  1KKH A;  5JJB A;  1J2V A;  2Q43 A;  5DZ7 A;  1S9G A;  3MEE B;  5F0W A;  4A46 A;  4WP3 A;  5IZH A;  1NKE A;  4CCH A;  4IG0 B;  3HHN B;  1JJ2 R;  4L74 A;  2FLL A;  3J80 Y;  2I0X A;  1R6Y A;  3NGR A;  3MEG B;  3EWG A;  4C8K A;  3CCT A;  1R0A A;  3MM7 A;  5DLG A;  3FGV A;  4XDC A;  3V6D A;  2E9Z A;  1T3O A;  3IBF B;  1PJ7 A;  5KFR A;  1BMQ B;  3OR1 B;  3M8R A;  2KT2 A;  4C8L A;  1KTV A;  4J37 A;  2BJ8 A;  3CF5 Q;  3H98 A;  4I7F A;  2QA4 G;  2H65 B;  3J81 U;  1PYS B;  4XO0 A;  1AA1 B;  1F1B B;  2MZT A;  2EEY A;  3GWC A;  5H1S V;  5KG5 A;  3TUJ C;  1NRK A;  3KK3 A;  4JI2 J;  1ZM3 A;  3DXB A;  4BCA A;  4AE5 A;  4Y65 A;  4K4V A;  2LDI A;  2M0G B;  3GLJ A;  4LBI A;  4FYX B;  2OKQ A;  1EP4 A;  4ECW A;  3ZZR A;  2E29 A;  1S1U B;  2AZ1 A;  4WXO A;  1O51 A;  4P9S A;  1X7V A;  3TAM A;  3US5 A;  1WTF A;  4EO6 A;  2D3O R;  2IRU A;  2LMI A;  2H4Y B;  3PYE A;  4DLE A;  1APS A;  1NPR A;  2R2T A;  3NGS A;  3V6D B;  1WC4 A;  4MTP A;  2W9C A;  2C42 A;  4P2X A;  3OXF A;  2IJF A;  3ELH A;  4NCG B;  3SDE B;  3D9B A;  4I7F B;  5I42 A;  2YKO A;  4FN5 A;  1F3F A;  1H7W A;  1CJT B;  5L39 A;  3JAM Y;  2VJV A;  4QIG A;  2ZNZ A;  1HI1 A;  2VL1 A;  4RBT A;  4DV4 J;  2MDA A;  1JMT A;  2PA3 A;  2Z2Z A;  5EX3 A;  5IT4 A;  5K8O A;  1QAX A;  1U02 A;  1U6B A;  2BW2 A;  1RZM A;  3TAM B;  2HZV A;  3EDR B;  2X1G A;  4ZJO A;  3V4I B;  1REV B;  4DCO B;  3BO3 A;  2VON A;  3M2R B;  3HSZ A;  3I5A A;  3L95 X;  2KFY A;  1JLC A;  4WE1 A;  1L3V A;  4NZ6 A;  5L9N A;  2G0I A;  3HZE A;  2FGO A;  5A8R B;  5HMX A;  3RW6 A;  4ED2 A;  2ZOM A;  2DKO B;  4BWJ A;  3K5O A;  4EYH B;  4ERD A;  3MM8 B;  4DV7 J;  2DIT A;  2HG4 A;  2WB4 A;  2OFG X;  2RRB A;  3BH6 B;  2XYH B;  2AJQ A;  2GJ2 A;  3MCN A;  1X31 C;  1BGX T;  2YKM B;  1GK8 A;  4RPF A;  4U8Y A;  2RML A;  4C8Z A;  1TMJ A;  4EWT A;  2IJN A;  2I5J A;  1DAX A;  1RWP B;  3LAN A;  2CAD A;  2OPQ A;  2GHW A;  5A8W A;  5F9N A;  4LSL B;  3QZ7 A;  3J7A N;  3HX9 A;  4DL0 C;  1ZOT A;  1FRJ A;  1Q79 A;  1NAQ A;  3ENW A;  1C1C B;  1FRM A;  1RHU B;  2MLZ A;  3QO9 A;  1RWM B;  2HRT A;  2MYF A;  4LRB A;  2POK A;  1VJW A;  1LXJ A;  4O23 A;  3U7J A;  1TKD A;  1YK9 A;  3CDU A;  1I94 F;  5A8R A;  4DR3 F;  2QX0 A;  5KFS A;  3TZW A;  1QUV A;  4J9L A;  3QRP A;  3BS9 A;  5HLF B;  4DR5 F;  5HMY A;  5KFJ A;  4QWE A;  1PC5 A;  1S77 D;  5EGY A;  1HBU A;  3BGO P;  3UDV A;  3QWP A;  4DFJ A;  1AUS L;  2XEX A;  4ZLN A;  1N5S A;  1YBA A;  1NUE A;  4CLK A;  3MOJ B;  2ILZ A;  2CJQ A;  4Q43 A;  2CDR B;  3OL9 A;  1KOO A;  4OX8 A;  4P2S A;  1DAR A;  3FC9 A;  4NLV A;  2VA2 A;  4MJK A;  5KT3 A;  4K4S A;  2B0G A;  2JLE A;  3DXS X;  4ED1 A;  4DCP B;  1C1C A;  4B9L A;  4U9R A;  5HK4 A;  5B0D A;  5CCM A;  3HFK A;  3TA1 A;  4B9V A;  2A0F B;  1I51 B;  3BZQ A;  3QLH A;  2IYI A;  1X9S A;  3I9V 9;  1T9X A;  1SH3 A;  4YDX A;  4PXB A;  1JNZ B;  4DX8 H;  4NLU A;  1H98 A;  2OIH A;  4X66 F;  4OYP A;  1FJ7 A;  4OJG A;  3KUE A;  5DG7 A;  3DRR A;  3ZZY A;  1VQS A;  4UOC A;  3G82 B;  2V0N A;  2BJ9 A;  4EU0 A;  1SVD A;  1F2G A;  1GMW D;  2B43 A;  3LWM A;  2JDJ A;  2BW7 A;  4GKJ J;  5BR8 J;  4KH1 B;  5LMU F;  4LMZ A;  1K47 A;  1OY6 A;  3FSX A;  2UVV A;  1P9Q C;  4DL5 A;  5KFL A;  1QTM A;  1S6Q B;  2YNF A;  5E3Q A;  2R7T A;  2RVJ A;  2JEF A;  2GNK A;  4AYB D;  1NME B;  1RDR A;  2AF6 A;  1M5H A;  1J27 A;  1QTN B;  3GP9 A;  2BKO A;  1OPZ A;  3UI3 A;  1LK7 A;  2OPQ B;  3MFI A;  1X60 A;  2V9K A;  1B0V A;  3MTJ A;  4NLX A;  3UDE A;  2Y1I A;  4LF8 F;  4L3K A;  2KM8 B;  4F36 A;  4I64 A;  3MEE A;  3D6F B;  4OHW A;  3CME S;  4ZS6 A;  2QLJ B;  4X84 A;  1A0O B;  2QL7 B;  3R27 A;  4RKU C;  6FD1 A;  4M8L A;  2FC8 A;  3PZP A;  1RTD B;  5KG7 A;  1WF0 A;  2B9X A;  4E98 A;  1CJK B;  1ZA1 B;  1TV6 B;  3D6T B;  4JUZ A;  3I5B A;  3OR1 A;  1WOO A;  2HQG A;  3J7Z 5;  1Q78 A;  3KLF B;  2JLG A;  1G7C B;  4ECR A;  1B0P A;  2PN6 A;  3FMW A;  4IO1 A;  1KLM B;  4L75 A;  4I0W A;  1TQL A;  3MUT P;  4AXI A;  2F8M A;  4RNN A;  1SKS A;  5DJB A;  4EBC A;  5GAG I;  3D3B J;  5KFX A;  1FI4 A;  1TUG B;  2MLX A;  4KT0 C;  3AT1 B;  5MAO A;  1WOP A;  2V9W A;  2N4C A;  2X3D A;  2GO8 A;  4RW8 A;  5D4P A;  4CLS A;  1R8B A;  3NWR A;  2BM0 A;  1KLN A;  1WKJ A;  3IWN C;  1MWZ A;  3GJS B;  3AY0 A;  2CJX B;  3T9Z A;  3BF4 A;  3EYZ A;  1R89 A;  2Z2M A;  1O6X A;  5D0E A;  3GIK A;  3RUB L;  3GYG A;  3CUL A;  1M5K C;  1B3T A;  1Y00 A;  2W1B A;  2C2K B;  3OXG A;  4G1P A;  4M5K A;  1EQ0 A;  4M63 A;  3T1H J;  2V68 A;  2XTJ P;  2G1D A;  1MRO B;  3PHE A;  4NLQ A;  1XTZ A;  4DR3 J;  1YWX A;  2QG9 B;  3KKF A;  2RAQ A;  1WNE A;  2K8G A;  2V50 A;  3PDN A;  4RWW A;  3SQG B;  4F4W A;  2PD1 A;  3OL7 A;  4HKQ A;  2LQB A;  2RRN A;  3J81 Y;  2KDO A;  5EHH A;  1CS4 B;  2GVD A;  4OMF G;  3I31 A;  2RJZ A;  3LPY A;  1JLF B;  1X4H A;  4C0O C;  2AYE A;  2YWF A;  1VFJ A;  3MCO A;  3PNI A;  1HWK A;  4M5D A;  4OI1 A;  2VFR A;  3WZ0 A;  4YY3 J;  2D41 A;  1Q7Y T;  2MZR A;  1EX8 A;  1RWV B;  5FII A;  2UXD J;  3PW2 A;  4DEZ A;  4KR0 B;  3L4B C;  3IRX B;  2OLW A;  3MMA B;  2R7V A;  3QGI A;  4LFA F;  4M5G A;  4DV7 F;  2VDI A;  5HL7 Q;  2WOM B;  1VR6 A;  1RGV A;  2J0W A;  4ZVR B;  3BH7 B;  3TWZ A;  2KTQ A;  2CQ3 A;  2XGP A;  2VFS A;  1VK3 A;  2QTW A;  2OEL A;  3VV2 B;  3QSY B;  2Q79 A;  3CJ5 A;  3N79 A;  1Y10 A;  3EZ5 A;  2NXN A;  9RUB A;  2WBR A;  2YKQ A;  1SKU B;  3MUM P;  2OPS A;  3HHE A;  3THT A;  4CI0 B;  4DR7 J;  3TUZ C;  4DR1 F;  4JI5 F;  3CC7 S;  3TJ8 A;  1WJ9 A;  4GKK J;  2DHX A;  1WC0 A;  2LP4 A;  3JTO A;  4PWW A;  3OJU A;  5F3T A;  4C97 A;  5C24 B;  1F5A A;  3KLE A;  4NXN F;  4K7Q A;  1YJ7 A;  2QRR A;  4LSL A;  1SQF A;  4ER8 A;  2VBY A;  2N4D A;  4RW8 B;  2H48 B;  4Z2X A;  2KYX A;  4B02 A;  1RAH B;  1TVR B;  3HHL D;  5AXM A;  3QZ8 A;  2CPF A;  1UEV A;  2OMO A;  2RU9 A;  3DOK A;  4R8U A;  1LFP A;  1H3D A;  1TP7 A;  2KH9 A;  4K50 A;  2CPI A;  1AXQ A;  2RIL A;  4LRD A;  4F02 A;  1R8P A;  2JC0 A;  3GIM A;  3MAQ A;  4FNH A;  3AH6 A;  3IC1 A;  1HYS A;  2FC9 A;  3QAE A;  1FK9 B;  2DVI A;  4EMD A;  4O3N A;  1FKP A;  1OIA A;  4USK A;  3HVT A;  4ZVG A;  1WHV A;  3MI7 X;  2XLJ A;  5J2M A;  4JI1 F;  1VIO A;  4PAA A;  4B3M F;  5L9X A;  3KG1 A;  3GMG A;  2MQ8 A;  3M6U A;  3MPD A;  2XC9 A;  4HEA 9;  2K1R A;  1T9V A;  5H9E J;  4F2S A;  3PFO A;  3GV5 B;  1U1N A;  4JI6 J;  2LQ8 A;  3U02 A;  1B0T A;  4X4T A;  1ZH5 A;  3LTO A;  5AXL A;  1WC6 A;  4DFK A;  4BC9 A;  1Q86 T;  1JXV A;  2W2N P;  3PJX A;  2G4B A;  2F8H A;  1PCA A;  3S8S A;  1U24 A;  5KFF A;  4DUZ J;  3RB6 A;  4FF2 A;  1T0T V;  2LKZ A;  4MFB B;  4F04 B;  2AD9 A;  3MMB A;  2DHA A;  3MMJ A;  1NXI A;  1GTH A;  4J9R A;  2ALZ A;  2HK2 A;  4LSN B;  2XWX A;  3PIP Q;  1YJW S;  1IR1 A;  3KYL A;  4JV5 J;  3WX4 A;  1HMV A;  2E1R A;  1ITP A;  2MQL A;  3U1L A;  3VGT A;  3ZTP A;  4RU9 A;  2AU0 A;  2HAI A;  2O67 A;  5I3Q A;  1NKB A;  2RF2 B;  3VGS A;  4ZDN A;  4ECV A;  2B8P A;  2IHR 1;  3MED A;  3PHT A;  4NE9 C;  4PXD A;  2R7Q A;  1RT3 B;  4RW9 A;  4Q5V A;  1OPI A;  4DR2 F;  2JOQ A;  4J9N A;  2E1M C;  3R6L B;  3OTE A;  1GFW B;  4H4M A;  1Q5Y A;  4H4O A;  4AT1 B;  2C28 A;  4JI0 J;  5EN1 A;  2BAN A;  2BRK A;  5LSO A;  1M90 T;  2N7Y A;  3CNQ P;  2G2Z A;  2F9D A;  2HLT A;  2MKJ A;  2RQ4 A;  3FBC A;  1CSJ A;  3GCW P;  3M4X A;  2CXE A;  3MMB B;  3MM9 A;  3H90 A;  1H2U X;  1IM4 A;  1DTQ B;  2GS8 A;  2SXL A;  3BR8 A;  3GFX A;  4WU3 A;  3TAQ A;  3C15 B;  3QID A;  1I94 J;  2XZT B;  2KKH A;  1OSC A;  3CJ0 A;  1RSC A;  4PG4 A;  5D15 A;  5K9F A;  2BV3 A;  1FXD A;  4HH0 A;  2GVD B;  5J2Q B;  1M0S A;  2ZBI A;  3WC0 A;  1JLF A;  5KFO A;  1AFJ A;  3G8Q A;  3DLL Q;  3VCD A;  2MZQ A;  2C2N A;  3CCW A;  4EBE A;  3ZZT A;  4ETX A;  4ZCK A;  2CG4 A;  3SI8 A;  1LOU A;  2MKY A;  1WEY A;  2XMW A;  1U6F A;  2EBE A;  1H0H B;  3IRX A;  3CUN A;  3MCS A;  4DFP A;  1VC6 A;  4PUO A;  3R97 A;  4TQR A;  3LAM A;  4AL5 A;  3C2P A;  1SUQ A;  1RXO B;  1VLO A;  2ZH3 A;  5J2P A;  2CAJ A;  2E5I A;  4IDK B;  1HNX J;  4QIV A;  5IT9 Y;  2EK6 A;  1HW8 A;  2VC1 A;  1WDD A;  4KBI A;  5IC6 B;  2M3D A;  3VF0 B;  5C2G A;  1NZ8 A;  2HS3 A;  1VYA A;  1HD0 A;  1Z1Z A;  2PC6 A;  3GJT B;  3O8W A;  4PR6 A;  1FRL A;  4LF6 F;  3ISN D;  4WZQ A;  4LIR A;  2VG5 A;  4WU2 A;  1O5J A;  1Q7L B;  1URR A;  1QE1 A;  1QDU B;  3MCM A;  4OYO A;  4YB1 P;  4A8M P;  1B64 A;  4ED3 A;  3CT9 A;  1ULR A;  4X4Q A;  4YN3 B;  4NLR A;  1FKO A;  3O6Q A;  5HAT A;  1NEE A;  2QSF A;  5HI7 A;  2RQM A;  4B3R F;  1YJU A;  4KJI A;  4ID5 B;  3G96 A;  1OYE A;  3QYY A;  4WP9 A;  4FS2 A;  4PRF A;  1UWB B;  1WC5 A;  3R6G B;  4YUD A;  4A8F A;  5AJ3 J;  4LR7 A;  3KLG A;  1R3N A;  1NSA A;  2DNL A;  3DOK B;  3T1Y J;  4DWI A;  4LVN P;  2A1B A;  1UZD A;  1YJR A;  1TKZ B;  2MKH A;  4I2Q B;  5A0Y B;  1TKT A;  4N5S A;  1Y5L B;  3AFG A;  5DG8 A;  2ZVI A;  1TUW A;  1BC6 A;  4NML A;  2XSJ A;  1YBU A;  3VVT A;  3ZC4 A;  1CUL B;  1LW2 A;  1Q8K A;  1VIX A;  2CQD A;  4Y2K A;  4DFM A;  1N36 J;  1W2I A;  2HAF A;  1D09 B;  5L8R C;  1ZS6 A;  2W24 A;  3IA0 A;  1FFS B;  1T03 A;  1YJV A;  3NCR A;  3W63 A;  1QUP A;  4F4K A;  3AD9 C;  3ENA A;  1NSQ A;  1IKY B;  2VA3 A;  5KFP A;  2D3Z A;  3M8W A;  1GEH A;  4P71 A;  1J5O B;  2GML A;  2NXJ A;  4DUT A;  3RAM A;  4GC7 A;  4MIA A;  2FYX A;  1DBD A;  5K8M A;  3FCH A;  1S0N A;  2EVZ A;  3SDE A;  5HP1 A;  2YWW A;  2ZOG A;  3DN9 A;  3GR0 A;  4ES3 A;  4Z7C A;  2PEH A;  4DG1 B;  4GVB B;  1EZZ B;  4CLF A;  4UY8 T;  4X64 F;  1FJG J;  1CLF A;  4KV8 A;  3SSS A;  4PKD B;  3K58 A;  1W7W A;  5E0O A;  1KFD A;  3M2V B;  1FWP A;  1NHU A;  2KN4 A;  1SIW B;  3MR5 A;  4AL6 A;  3KMS A;  1NK6 A;  2FVQ A;  4V19 X;  2MKI A;  3D1H A;  3CJS A;  1OJ4 A;  4OQJ A;  4DQS A;  4GO5 X;  4Q2L A;  1CJV A;  1RU1 A;  4HT7 A;  4WYL A;  3TRG A;  1CG2 A;  4XPC A;  4MMO A;  2RIJ A;  4FVM A;  8AT1 B;  3HHD A;  4YFU A;  4RJV A;  4DOZ A;  2UV8 G;  2J6S A;  4J91 A;  5ITH A;  2C3O A;  2AJ0 A;  5IOL A;  3IFE A;  1NJX A;  4LF5 J;  4OZL A;  3D1O A;  2R2U A;  3C6U B;  1S49 A;  1WEL A;  1T9Y A;  2QO3 A;  1D9A A;  4J9P A;  4M5H A;  3RR7 A;  2YXL A;  2W7O A;  2BJE A;  5RUB A;  5T41 A;  2GHV C;  1IBM F;  4HTJ A;  4O3P A;  2C3U A;  1NU4 A;  3PV8 A;  4TYA A;  1TZ0 A;  1UVL A;  2JEJ A;  3QRQ A;  3O2I A;  3KHG A;  1P27 B;  4H4K C;  2VD3 A;  2W9B B;  4FXV A;  3HO1 A;  2GAG C;  2D9O A;  4KIA A;  2CRL A;  3PRB A;  4JB8 B;  1ICE B;  2GVZ B;  5IM0 B;  5GAH U;  2HND A;  3K2Y A;  4LR8 A;  2KXH A;  2DH9 A;  1HNW F;  1SJF A;  3CCR S;  1E6V A;  1NHV A;  2DBB A;  3Q8R B;  5I3U A;  4P72 A;  1E6Y A;  3NG8 A;  4O0I A;  4V19 J;  2BZ2 A;  1CBK A;  1TL1 A;  4MYU A;  3OT9 A;  4ZVS B;  2J76 E;  2FTR A;  3P5B P;  1NJI T;  1D9F A;  2R7X A;  2ZHB A;  2E1A A;  1WOS A;  1NZA A;  2PEB A;  3NGD A;  3DLK B;  1SJ3 P;  4M5N A;  3DLH A;  4UT4 A;  4LSZ B;  1X0F A;  4R5P A;  1WWH A;  1S0M A;  1NJW A;  3I0R B;  3A8J A;  3NWG A;  1HBU B;  4UTG A;  3NOC A;  3IXQ A;  3M8Y A;  2DK2 A;  2VC0 A;  3D6M B;  4DR2 J;  2K3K A;  2O1P A;  4PPZ A;  2V4J A;  1N0U A;  2AGP A;  2MSS A;  2LEC A;  1YHQ S;  3UR0 A;  3OW2 R;  1U25 A;  2V2Q A;  5CZV A;  2A6O A;  2RU3 A;  2QYG A;  2ZC4 A;  4OZ2 A;  4OJ3 A;  5KTQ A;  2KXF A;  4QWA A;  1EKR A;  1TTH B;  4Y3C A;  3SMZ A;  1S1U A;  3Q8U A;  1VRU A;  1YDL A;  4J9Q A;  3I9Z A;  4K4Y A;  5G4D A;  2C2D A;  2AV5 A;  2V6A A;  3R9L A;  1H72 C;  2QFI A;  4EO8 A;  1TL4 A;  4KPC A;  2A10 A;  1NDK A;  1NLK L;  2ZBR A;  1Y11 A;  3D67 A;  4NLS A;  1X5T A;  2AYM A;  1H38 A;  2WVB A;  3NNA A;  2Z4P A;  4UST A;  3RB3 A;  1DY3 A;  3SCJ E;  3VQS A;  2CQ2 A;  5M2R A;  1NK9 A;  5K14 A;  5K8N A;  4NCG A;  4ID5 A;  4I1T A;  4KHP F;  2EK1 A;  3IWL A;  1LXN A;  3SCI E;  1EAR A;  4AFF A;  4JI0 F;  4F0H A;  1ZYQ A;  3PKM A;  4P75 A;  2K3I A;  2GHP A;  1N33 F;  2KG1 A;  3M30 B;  1PBU A;  4URG A;  2CQC A;  2RHQ B;  1X9W A;  2GX8 A;  1HNZ J;  2OPS B;  1FRX A;  2KHD A;  2R8J A;  3BO4 A;  1R8A A;  3PYG A;  3OSP A;  4HT5 A;  1RCX B;  3QQC D;  1VRU B;  3R5J B;  4PG8 A;  1Y0H A;  1VQ5 S;  1BWV A;  2MEW A;  2NQP A;  1RT2 A;  2AMC B;  1K73 T;  3MR3 A;  5IWA F;  1E6V B;  1NDL A;  4KO0 A;  1ZM4 A;  3CDA A;  1LWC A;  1MN7 A;  3ETM A;  2WCX A;  3SSR A;  1HI8 A;  1NB2 A;  2L48 A;  4EBD A;  3PYD A;  4U7U D;  2KT3 A;  1LK5 A;  3TNV A;  1EHW A;  4X4S A;  2W9A A;  4QYZ J;  4IUF A;  3EE3 A;  3R7N B;  3E01 B;  3DLJ A;  3JSB A;  5KFB A;  1JLB B;  2MKK A;  3BYP A;  4R5P B;  4OI0 A;  1KOH A;  2HHX A;  3BRE A;  3KLI A;  5B0E A;  3HXM A;  2FLP A;  4CNZ A;  2OPR B;  4U67 Q;  1PKU A;  3RZA A;  1MLA A;  1F5C A;  3CD5 A;  4YOE A;  4O3O A;  4LFC F;  3W62 A;  1FX2 A;  2CQ0 A;  4ZJL A;  2CPE A;  3UVJ A;  4F26 A;  1NO8 A;  1WSV A;  4DQI A;  4NLP A;  2HFZ A;  2E1P A;  3KLG B;  2G9O A;  3N5F A;  4N8O A;  4TN2 A;  3UNG C;  4QR1 A;  2K7J A;  1MWQ A;  1S59 A;  2YWK A;  2FQQ B;  1D8Z A;  2LQJ A;  3NGT A;  2ZH1 A;  5AXK A;  1S6O A;  4CIO A;  3DYA B;  3UD3 P;  4DLG A;  2EG2 A;  3E3X A;  3LOU A;  1SKR A;  1RAC B;  3CMQ A;  4CO5 A;  1NCL A;  5LMN F;  4C8O A;  2BKN A;  2A6M A;  3ZTQ A;  1H2V Z;  2YNG A;  5GAG U;  4C8M A;  3NS7 B;  3EJM A;  4BWM A;  1UFK A;  2MJN A;  3B54 A;  3H0P A;  1R0A B;  5HLF A;  4IOA Q;  4KYZ A;  1UFL A;  1Q8L A;  1RWW B;  2ZZM A;  2LEA A;  5K5M A;  4ZVE A;  5ETN A;  3IGV A;  5A76 A;  4CYU A;  5AE3 A;  2XLI A;  5HP1 B;  1L3U A;  5G0R B;  2XS5 A;  2FB0 A;  3OR2 B;  4QWC A;  5FDL B;  2HND B;  1RTH A;  1UMJ A;  1RJJ A;  3KK3 B;  2CYY A;  2KO1 A;  4NXN J;  1KRP A;  4P52 A;  3RB0 A;  1L3K A;  1P1L A;  3MEC A;  2B8Q A;  2YWE A;  3TJA A;  5L38 A;  2F1F A;  4F7V A;  1M5O C;  2W01 A;  4N41 A;  4B3O A;  2QMX A;  5CZX A;  4DL6 A;  4JI7 F;  5KT7 A;  1UPP A;  3D1Q A;  2RRA A;  2AGO A;  4ETZ A;  3IBC B;  2HQD A;  3CJQ A;  4ZN1 A;  4WTO B;  2QEX S;  2OSQ A;  4LBH A;  3GJQ B;  2DHH A;  3K5M A;  5B09 A;  3KDO A;  3M6V A;  3WBZ A;  2DGU A;  4CO4 A;  4X62 F;  2JVR A;  3KLH B;  3KK1 B;  2DXF A;  1PO6 A;  1CQN A;  3E01 A;  1QLN A;  1DTQ A;  4USH A;  2ZH5 A;  4CH7 A;  1FNX H;  1SI9 A;  1QVG R;  3OTB A;  5I42 B;  1N5Y B;  3BDP A;  3RRG A;  4DSF A;  1DFD A;  2DNR A;  2APO A;  1CJT A;  2D74 B;  1UVN A;  3Q8Q B;  1S6Q A;  2ZC3 A;  3QGG A;  3QJP A;  2XB2 D;  2RUG A;  4OYX A;  4RUC A;  4ILM A;  3KJN B;  4R0E A;  4CLW A;  1EET B;  5L1L A;  1DLO A;  5SZT A;  3KK2 B;  1WSR A;  2AHO B;  2HSE B;  5BYR A;  5KFU A;  5JUM A;  1X8D A;  2XWY A;  3W66 A;  1FVS A;  3DRS A;  1Q4R A;  1XMO J;  1PIL A;  5H9F J;  2HHT A;  1N32 F;  4UW2 A;  2V34 A;  4DHV A;  5F8H A;  1SUQ B;  3FMB A;  1FJE B;  1RT4 A;  2V63 A;  5K14 B;  1OYD A;  4NLD A;  2GJI A;  2XM3 A;  5KG1 A;  2XO7 A;  3A1Y G;  2CPH A;  1IKV A;  5LSR A;  3CJR A;  1YZ7 A;  2GA7 A;  3N6N A;  2RDJ A;  4A8S A;  2IA0 A;  3NNH A;  5A6W A;  5DS7 A;  1B70 B;  2DR9 A;  1U1Q A;  1YRU A;  3W3S A;  3NRB A;  1QE1 B;  2XBP A;  4IG3 A;  1RT6 A;  2XY7 A;  1LEO A;  1URN A;  3OVB A;  3HKZ D;  2ASL A;  5FDL A;  2XS7 A;  1RAF B;  4AL7 A;  2WON B;  1FEH A;  2A3J A;  4KE5 A;  1VGY A;  5ETT A;  3DLE B;  4C11 A;  1U4B A;  1KQF B;  5LL6 d;  3T19 A;  4JI4 J;  3NL0 A;  1NDP A;  1PAU B;  4G3I A;  2HHH J;  2WB1 D;  3GSD A;  2YPZ A;  3KJF B;  4OFZ A;  8ATC B;  2MY7 A;  5IFM A;  3TVZ A;  3H2V E;  4IG0 A;  2VDH A;  3Q23 A;  2UP1 A;  4PWD B;  4X4O A;  3ADA C;  4QIW D;  2CJA A;  2FZK B;  3UQS A;  4Q2M A;  3H5Y A;  4ECS A;  4UUW A;  1S9F A;  2FVS A;  3MPY A;  4JV5 F;  4MFB A;  4EZ9 A;  4K5S A;  2OI2 A;  5FJ4 A;  1YZ6 A;  2ZH2 A;  1IQT A;  1X4C A;  3TEH B;  3TZZ A;  3VAI A;  5IQ6 A;  2HK3 A;  4RL1 A;  4MKY A;  5EDW A;  4ES2 A;  4ECZ A;  3TEG A;  1Y3K A;  3MM5 B;  4G1Q A;  4O4R A;  5ETS A;  1QAJ A;  1JJ4 A;  3G6X A;  4HVZ A;  5CH7 B;  2R7W A;  1U1M A;  1UCN A;  3JQJ A;  2E7V A;  3DHW C;  5T7L A;  1U1P A;  4LRC A;  4R0J A;  5B0B A;  2VKZ G;  1RWO B;  2YY3 A;  5B0G A;  3A8K A;  5HJX A;  1FD8 A;  2AX0 A;  4OZJ A;  3I0S A;  3J7Z T;  3OV7 A;  4PWD A;  1YRT A;  4DR5 J;  1XMQ J;  1CQM A;  1RHK B;  4H4O B;  1T9W A;  2WHO A;  3FFI A;  1I5O B;  2OEJ A;  4C6A A;  1CJU B;  4C8Y A;  3KWM A;  4PYA A;  4LR9 A;  4Q44 A;  1T11 A;  3OFH A;  2C2E A;  4LF6 J;  2YWH A;  3FCV A;  3HVW A;  2FJA B;  4MKB A;  5F8J A;  3DI6 A;  2GMJ A;  5DM6 Q;  1IBK F;  2GQC A;  2NUH A;  5CYQ A;  4CH0 S;  2ZHO A;  2L3M A;  2BOP A;  2HPU A;  2VZ9 A;  3UDL A;  4CZC A;  3HPO A;  2D1C A;  2DNY A;  2OP5 A;  4RW6 B;  4A8W A;  2W4C A;  2YNF B;  3BGL A;  3ISZ A;  1S79 A;  4IG3 B;  4R25 A;  4CO1 A;  3VWS A;  5T7L B;  7AT1 B;  3M6X A;  2VU5 A;  3FRY A;  4DV3 F;  1R43 A;  2ZUG A;  1V9O A;  2PI5 A;  2KU7 A;  3X1L B;  3A3N B;  3MMC A;  1IJF B;  5C24 A;  4F0K A;  4CM0 A;  1VS3 A;  4K4T A;  1DRZ A;  2ZM6 F;  1C1B A;  4DSJ A;  3T1A A;  5IXU A;  4WII A;  1OQ3 A;  1FT8 A;  4KGK A;  4R8U B;  2H4W B;  2VAS A;  1U0H A;  2HKE A;  4OHV A;  1UPM B;  1SB6 A;  4FNI A;  3MD1 A;  4I6W A;  2VIH A;  4C4W A;  4CTA A;  4NCB A;  3AOC A;  5M2U A;  2NUU G;  2QLX A;  1SC3 B;  2BJD A;  4J9S A;  5ETK A;  1TV6 A;  1FK9 A;  4P74 A;  2LA6 A;  3PX6 A;  1VHF A;  3HSG A;  4TXS A;  3N0V A;  3QFH A;  3G6E S;  3F0N A;  1UP1 A;  1HBM B;  1GMV A;  1RTD A;  1IBL F;  1F5B A;  3HLU A;  4DBQ A;  2ASY A;  1HWL A;  4U7C A;  1U8W A;  3FQL A;  5KAK A;  1SKW A;  3MUR P;  2R4F A;  4F3Q A;  3R5C A;  2ZJR Q;  3DU6 A;  2Y3Y A;  2KRB A;  1JQG A;  1RT1 A;  1VQM S;  2XI3 A;  2EWH A;  2XMT A;  2DYA A;  1FDB A;  3AB2 B;  5GMK a;  5GAE U;  1L3T A;  2VOD A;  2KZM A;  1U48 A;  4GKJ F;  1WHY A;  4QQB A;  4DPW A;  3C6T A;  2D9P A;  1HI0 P;  4UOF A;  5EX0 A;  4TNO A;  2GW8 A;  3HT0 A;  4WPA A;  1D8Y A;  4OI3 A;  2I6W A;  3PEH A;  1XQI A;  4J9V A;  2XHC A;  2IAJ B;  3C19 A;  4RBV A;  1R7I A;  1U8S A;  1RT5 B;  2FJV A;  3V2U C;  4IKA A;  3PTW A;  1ELO A;  2IYG A;  4XK8 C;  3MEK A;  1LWE B;  1VBZ A;  1AT1 B;  2F9J A;  2E5J A;  3D0H E;  3ENQ A;  4E8U A;  2Z30 B;  1HFE L;  1Q82 T;  2DGT A;  3OUY B;  2MY8 A;  4C11 B;  2UUB J;  5LT5 A;  1RT1 B;  3O3L A;  4BBY A;  1TKX A;  5JXS A;  2BMB A;  4K4W A;  3EPI A;  4ZHR B;  2H3E B;  1IQZ A;  4XDD A;  3W9H A;  1S4E A;  5D4L A;  4E2F B;  3PW5 A;  2BE2 B;  4WKY A;  4ZVF A;  3VAL A;  4MT1 A;  4JYA F;  1IJE B;  2QMW A;  5HO4 A;  2BA9 A;  4GVL A;  3B8H A;  2FJE B;  2WVE A;  4ZOS A;  1YX2 A;  4WFY A;  1RT2 B;  3J7Y I;  1S72 S;  3PO4 A;  1FDD A;  2VKR A;  2F63 A;  3AAW B;  3PX0 A;  2ZNY A;  4RZR A;  1GH8 A;  2MZS A;  1N0V C;  2GQQ A;  2H5I B;  2W2O P;  1GX5 A;  1MWY A;  2D7S A;  3BKU A;  1LNQ A;  3HSJ A;  2LLZ A;  2V67 A;  1RI7 A;  4BHQ A;  3T3F A;  2ERR A;  1C0T A;  4KTQ A;  1AFI A;  4NPO A;  4EYI B;  1VBY A;  2HWH A;  4ZCL A;  4FYW B;  4ZP9 A;  2HVI A;  2Q6C A;  3ZZ0 A;  1MU2 B;  3PW4 A;  2BOA A;  1RU2 A;  1R8H A;  2YNH B;  3JYT A;  5IQQ A;  4A8Q A;  1UET A;  5CXT A;  2GFF A;  3AJD A;  1R6V A;  5HBM B;  5MLC V;  1S97 A;  1AUD A;  3V6K A;  2XMK A;  3K59 A;  4B17 A;  1KWM A;  2H5J B;  2MJU A;  1X5S A;  1T8E A;  5CQG A;  2DR5 A;  4FF3 A;  3K17 A;  3TYT A;  1XEZ A;  3UN5 A;  4CO2 A;  1N32 J;  4M5J A;  2UUW A;  3EUN A;  1WG1 A;  2B6A B;  1HPZ B;  5KFG A;  3CDE A;  1OY8 A;  5E41 A;  3H8Y A;  1Q81 T;  4DJB A;  4X2B A;  4OYB A;  4RNH A;  4DPT A;  1FXL A;  2HVD A;  2BRL A;  3KLF A;  4X4N A;  3HVA A;  1FKP B;  1TK5 A;  4RW7 A;  3THP A;  3H25 A;  1XNQ F;  1M1G A;  4LIW A;  3M32 A;  5A8K A;  4WP8 A;  1HKA A;  2PO4 A;  3JXO A;  2Z0G A;  4ANC A;  2VOP A;  5A8W B;  4DN0 A;  1VQ8 S;  2UXB F;  3M8P A;  1RLD A;  1FKA F;  2DNZ A;  3L3C A;  3JQM A;  1CC7 A;  2F8E X;  4FYD A;  4FF4 A;  1HA1 A;  2LDY A;  2Y0S D;  2HVZ A;  2QA1 A;  3MUV P;  3LQV A;  2IY5 B;  4DL7 A;  3AQO A;  3BGR B;  3DOL B;  1TKZ A;  3DLB A;  1S1V A;  4OX9 F;  4G6V B;  1B4S A;  2MXY A;  3V5R A;  1JJH A;  3LP0 B;  3VVU A;  2V4Q A;  4DV0 J;  4RWX A;  3JSM B;  2V8D A;  1S9G B;  3IBW A;  2ZJQ Q;  2C2O B;  2QFJ A;  3DLG A;  1JLA B;  3L7U A;  4GO7 X;  3KXD A;  2AZ3 A;  3RRK A;  3UE2 A;  2FJW A;  2C2R A;  2FLN A;  3TX8 A;  2JFD A;  3I32 A;  2DO0 A;  1GMU A;  3ZZZ A;  2LQ5 A;  4DPX A;  4LF8 J;  5D3G A;  2XNR A;  1TUV A;  3EGZ A;  5A2Q Y;  4RBU A;  3HHL B;  3ZNJ 1;  3PKY A;  4CLY A;  1KS2 A;  1JLG B;  1S1X B;  1MW7 A;  2G0C A;  4FP9 A;  2XCP A;  1IKW A;  1S9E A;  1F2H A;  3KJV B;  3BQ1 A;  5L1I A;  3W2V A;  1X4B A;  3PX4 A;  3RAX A;  4PQU B;  2YQ1 A;  5J1N A;  2LYV A;  3QT8 A;  1RKJ A;  2K06 A;  2ZD1 A;  1S7I A;  2C1E B;  2IRY A;  3CWJ A;  3M2U B;  4KV8 B;  5HQL A;  1WTB A;  2Z58 B;  3FBE A;  1VRQ C;  3A12 A;  1R8C A;  2B5J B;  1SC6 A;  3T6B A;  3ILO A;  4DS4 A;  4DI6 A;  2A2D A;  1HQU B;  2G2Y A;  4HR2 A;  1N34 J;  2MQP A;  3TOQ A;  1PC4 A;  4TU7 A;  3CCM S;  2C22 A;  1NDC A;  2MKS A;  3MHY A;  4S0M A;  4IH6 A;  4HAC A;  4DSI A;  3K0J A;  2PMZ D;  2LXF A;  2GAH C;  4F4A A;  2F5G A;  2JVO A;  4QWB A;  3EX7 B;  4DSL A;  2ATC B;  4ZPT R;  3UPF A;  2CZ9 A;  3OFF A;  3FRZ A;  2GQ2 A;  2ZIT A;  3IGN A;  3NS5 A;  5ETQ A;  5J2Q A;  4DF8 A;  1IKW B;  1M1H A;  1NSP A;  1JLB A;  1S9E B;  4HLB A;  5KFY A;  5FLX Y;  5DM7 Q;  4PQU A;  2HHW A;  3CC4 S;  3HP6 A;  3FEX B;  2ATL A;  3A8E A;  3MM6 B;  4ZVP B;  1XR5 A;  2I9S A;  2FVC A;  3BEG B;  4ZPC A;  3UD4 P;  2QL9 B;  2XMU A;  4D3H A;  3QMQ A;  1T9T A;  2E66 A;  4NEZ A;  4WFN Q;  5CD4 A;  1VQL S;  1RBL A;  1X4A A;  2DCL A;  4NLW A;  3CIM A;  1KR4 A;  4Y34 A;  2GVZ A;  4YB7 A;  3UD5 A;  4H54 A;  1IN0 A;  1WEX A;  2UUC J;  4URQ U;  2B3T B;  2D3U A;  3LP1 B;  3EVO A;  4OI2 A;  5D78 A;  5E3R A;  5E3C A;  3TW0 A;  5KFC A;  1UA1 A;  3GU0 A;  4DX7 A;  3AXK A;  2IBO A;  3LP0 A;  3LGH A;  4PAB A;  1JNR B;  2DNG A;  5DDP C;  4TVA B;  3ITH A;  2R3V A;  2VIC A;  1TL1 B;  2QLF B;  1XC9 A;  4DR6 F;  1KON A;  2XSF A;  5ETP A;  2K7K A;  2HBQ B;  2WSE C;  2CNO B;  2GIR A;  1NSK L;  4LBP A;  1K0T A;  4WBF A;  1N5Q A;  1K1Q A;  3D68 A;  1YKW A;  5E33 A;  4J9M A;  4J9K A;  2ZDP A;  1JLG A;  1S1X A;  3Q2S C;  1FKO B;  5LM7 E;  5L1J A;  2Z56 B;  2ZZN A;  4RUH A;  1VLY A;  1F3V A;  1LWF A;  3ZZU A;  4JV1 A;  1UWB A;  2MPU A;  3N4W A;  1LWX A;  1RTH B;  1YI2 S;  4C9D A;  3DKD A;  4L72 B;  1SBR A;  2I5J B;  3CJ8 A;  1ZAV A;  4UOH A;  4WKR A;  3HFZ B;  4OJ1 A;  3CJ3 A;  1V5I B;  3KDN A;  2XSJ B;  3SXL A;  2I8E A;  1S57 A;  5KFN A;  4PXE A;  4YQW A;  3PR4 A;  1FTR A;  3G71 S;  3FCW A;  2FVP A;  3C46 A;  3KJQ B;  5DQH A;  2PGC A;  5LJ5 Y;  1YTY A;  2E44 A;  2GC8 A;  4KFB B;  5J2N A;  1EIY B;  3RU0 A;  4IR9 A;  2CQB A;  1AYE A;  1WAC A;  4MK8 A;  4RW7 B;  2F65 A;  3Q8V A;  4BS2 A;  4NA3 A;  1ZPW X;  4DV1 F;  1UVI A;  3R2C J;  2X1F A;  1S12 A;  2AW0 A;  1J5O A;  1MSW D;  2CZ4 A;  1C0T B;  1WOR A;  1RAD B;  4ZPA A;  1H7X A;  4O3S A;  1TFW A;  2H5E A;  1HNV B;  1KDN A;  1WHX A;  2FUG 9;  3HJF A;  3BGR A;  3DOL A;  2HFO A;  5ETV A;  1NH7 A;  4MAK A;  3IWX A;  1S1V B;  2C3P A;  3FBB A;  3R1H A;  3RBD A;  1NK4 A;  5H9F K;  2M9K A;  2YPY A;  4DQR A;  4DR4 J;  1RAI B;  5KFV A;  3V81 B;  1D1U A;  1RIS A;  2PE8 A;  2V8V A;  4USV A;  2HQC A;  2HVE A;  3K57 A;  3Q22 A;  2EFP A;  4HDH A;  4I6A A;  3GG0 A;  3P4U B;  2J9D E;  1WI6 A;  2FJB B;  4J7C A;  3M8Z A;  2HVH A;  1JWW A;  2GCF A;  5SUH A;  1HNW J;  3W9J A;  2X1B A;  1RT4 B;  1S6P A;  3NP5 A;  2W9C B;  4IH7 A;  1F0X A;  1UW4 A;  3HVR A;  4P6Q A;  2XLK A;  3G86 A;  3MM7 B;  3VR1 A;  3AQP A;  2C2M B;  1FNO A;  3MZI A;  4QW8 A;  1NND A;  3U1M A;  3VGU A;  2CQI A;  4XIU A;  5CYJ A;  2EG1 A;  3LGM A;  2ZM6 J;  3KHL A;  3FSY A;  4PZV A;  3CGI A;  4OZ0 A;  3E2E A;  4JV0 A;  2O5D A;  2ACM A;  2IMO A;  2KB2 A;  3R5D A;  2P2C B;  3DCA A;  2DRB A;  4K4U A;  1K8A T;  2PT0 A;  4NXM F;  1RWX B;  2HGL A;  3VZI A;  4GKK F;  1T95 A;  1BD6 A;  4NZ0 A;  3PIO Q;  2DHG A;  4DR1 J;  4JI5 J;  1Q95 G;  2OAU A;  3ET6 A;  2VB6 A;  2VG7 B;  3BR9 A;  1D0E A;  3JSM A;  3MPW A;  3EIC A;  2D3O 1;  2AGQ A;  2JWN A;  2P6S A;  1FDN A;  3G2X A;  3O1L A;  3LP2 A;  4KKO A;  1TK0 A;  2DR8 A;  2IRX A;  3BO2 A;  3CCV S;  1HR0 F;  5HMW A;  2E5H A;  3FBF A;  2W2Q P;  2HMI A;  2UXC J;  1PYO B;  2UUA J;  3CCU S;  3M7V A;  2RNE A;  2ZE2 A;  3NMR A;  2FGC A;  2P5V A;  3B78 A;  2W8K A;  4ILR A;  2IFX A;  2R2R A;  1FRK A;  4HH1 A;  1LWE A;  3TVK A;  5C7P A;  3HJV A;  1NBE B;  1SH0 A;  4JOU A;  4B3R J;  3IO1 A;  3OJS A;  1V5V A;  4Z37 A;  4YR3 A;  4YB5 A;  3CIZ A;  1YJN S;  1DZ5 A;  3IN5 A;  2NSB A;  5F0U A;  4B3O B;  3ICL A;  6AT1 B;  4B3T J;  1S1T A;  4ZHR A;  1A7G E;  3W1Y C;  2EI5 A;  4TKT A;  1W2B R;  4DV6 J;  2QA2 A;  3AA9 A;  1I3O B;  4Q7A A;  5IV3 A;  4RUA A;  4QWD A;  4B3M J;  4M94 A;  4XAK A;  3GPA A;  1FES A;  3H7H B;  4FZV A;  3B4D A;  4ILL A;  1YLX A;  3W5Y A;  1FFG B;  2MTL A;  3W61 A;  2OTL S;  1L3S A;  3D6H B;  5BYS A;  1JLQ A;  2IIH A;  2QZ8 A;  1IKX A;  4W98 A;  3J80 U;  4QOT A;  5K8P A;  5D77 A;  1SL1 A;  3E51 A;  1ZM9 A;  1N5T A;  2W7A A;  2QLW A;  2AQ4 A;  2E9R X;  4ECX A;  1N8R T;  2ZWP A;  1HIY A;  3NCP A;  4NRU A;  7FD1 A;  4RW6 A;  3VAM A;  3U27 A;  1MNE A;  4H4M B;  3MXH P;  2OHD A;  1RAO A;  3HMJ G;  4IR1 A;  2NR0 A;  4ZPW R;  2CG8 A;  2OPP B;  3M6W A;  4Q8F A;  1FTC A;  2HGN A;  3NBP A;  4PCQ A;  1G2E A;  4NAS A;  3DDK A;  2CNN B;  1DLO B;  2Y1R I;  2RB7 A;  2GZO A;  3T9N A;  4YDD B;  2UXC F;  2ZKT A;  2HS0 A;  4I2P A;  4USJ C;  4B08 A;  4F3O A;  4UOG A;  1XNR F;  5HBM A;  3DRY A;  5CA5 A;  2KRR A;  3IR6 B;  4WFB Q;  3CCL S;  2YKP A;  1FRH A;  1HBN A;  3A3O B;  2UUA F;  1U1K A;  1T7P A;  1XIQ A;  3GYX B;  1N36 F;  1RE1 B;  2YQ3 A;  4Y00 A;  2EC0 A;  4ZCM A;  2J0S D;  3CCQ S;  2FZG B;  1QVF R;  3GFH A;  4WJB A;  3RR8 A;  3JTN A;  4JBC A;  1RA7 A;  3DM2 A;  1IKV B;  2B7C B;  1SJ1 A;  1VHI A;  2JNJ A;  4KSE B;  2L41 A;  2NS1 B;  1FWK A;  3I87 A;  1SJQ A;  2HNZ B;  2IM1 A;  4UQG A;  4CO0 A;  1XN9 A;  4LF4 J;  1TR0 A;  5HVH A;  1C2P A;  2AEF A;  3PW7 A;  3V81 A;  1U47 A;  3DMJ A;  1UTA A;  3ILI A;  4L76 A;  1CS4 A;  3W5Z A;  3EGN A;  3CED A;  4YR0 A;  2E5L F;  2ASJ A;  1MML A;  2CQG A;  4CLP A;  2R7U A;  4MK7 A;  2DD8 S;  2QT7 A;  3IP0 A;  2BAB A;  3BSN A;  1G1X A;  1IM6 A;  4C3M A;  3CW2 C;  2MKC A;  2ZFH A;  3OVS A;  1C0U A;  2CJ9 A;  3ZTR A;  3MR7 A;  4QIF A;  3CJK B;  1U6Z A;  4X66 J;  1W26 A;  3P5T L;  3BN4 A; 
#chains in the Genus database with same CATH homology
 1WJ9 A;  5H9E K;  4QYZ K;  4DZD A;  4U7U D;  5CD4 A;  2Y8W A;  3QRQ A;  5H9F K;  2Y9H A;  3QRR A;  2Y8Y A;  3QRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...