3OFHA

Structured domain of mus musculus mesd
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
MTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords LDLR chaperone MESD
total genus 22
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ofhA00
2LVWA 3KWMA 3S1TA 2JOQA 3AB2B 1YBAA 2F1FA 5IT4A 4IO1A 3OFFA 2PC6A 2P9GA 3ENQA 3IXQA 5IT0A 3LUYA 3IBWA 4GO5X 3CEDA 2I9SA 1XTZA 1UJ4A 3OBIA 2J0XA 3TUJC 2LQJA 1M0SA 2NYIA 2RQMA 2MDAA 4PWUA 4M8LA 2DT9A 2P9CA 2PA3A 3P96A 4X84A 3DDNA 2QSWA 1UJ6A 2H9ZA 3TUZC 1LKZA 2FGCA 3AB4B 3L7OA 2QMXA 1RWUA 2RQKA 3TUIC 1LK7A 3U7JA 3OFGA 2DTJA 5T41A 1YGYA 1LK5A 3W7BA 1Y7PA 3MTJA 3ENWA 2ZHOA 2KO1A 3DHXA 3LOUA 5JJBA 3DC2A 3MAHA 3HHEA 3OFHA 4GO7X 2QMWA 4GMKA 3O1LA 5FIIA 3AAWB 3NRBA 4LUBA 2RE1A 2J0WA 3UW1A 1PSDA 1O8BA 3K5PA 4NMLA 2CDQA 1U8SA 1SC6A 2P9EA 3OFEA 2F8MA 3MWBA 3N0VA 1ZPVA 3ENVA 3DHWC 2JHEA 5IS2A 1KS2A 1UJ5A 2QRRA
chains in the Genus database with same CATH superfamily
2NS1B 3K8WA 2WONB 2ZH2A 2YPZA 3DFEA 2JLGA 1B0VA 1WC1A 3D6MB 4KC5A 2ZZNA 4CCHA 2FC8A 2GV1A 5IV3A 1EQ0A 3AB2B 5CH7B 4NOHA 5KFVA 1FNXH 3V6DA 1HYSB 1S5ZA 4KR0B 2YXLA 1ZM3A 2DY1A 3DLGB 4UTGA 4G1QB 3AA9A 1J27A 4TYAA 4ICLB 2HEKA 2CPEA 3TUPA 1GMUA 2B4PA 3US5A 4Z2XA 5GMKa 4PG4A 4DV5F 3CCUS 3IBWA 1TVRB 3BV8A 4R5PA 2YKNA 2GMLA 3MMJA 1T3NA 4JI1F 4YQWA 2NLWA 1S57A 1UJ4A 2BJ8A 3KMSA 1U0SA 3IR7B 2Q43A 2QA4S 3N01A 2K1RB 3THPA 2HAFA 2R8JA 3PX4A 2RMLA 2OPQA 1N54B 5AT1B 1VDHA 2HQIA 4OJ1A 2GHWA 3F56A 4IKAA 3SQOP 1N33J 3K17A 2YTCA 3HCXA 1T7PA 1PG5B 3CCVS 4ECXA 3WIVA 1CC7A 2FB0A 2V8GA 5F3TA 1WORA 2XMMA 3PG9A 3OVSA 3TQEA 1C1CA 5T7LA 5KFQA 1Q7LB 3DRXA 1NSQA 2BX6A 1QJHA 2GQCA 2QZ8A 3H98A 2Z2YB 5CA5A 4EUVA 4WFNQ 3DU5A 3KJQB 2RF2B 1ZZFA 2EFPA 2ILZA 4J7CA 3J7YI 2MZQA 4IRKA 3LAMA 2VOPA 4YOEA 2CPHA 1N34J 1N0VC 3H90A 4C8KA 5EX3A 3AD8C 4YY3F 1TL5A 1C2PA 3LWMA 1RTDA 2YNGB 1QM9A 2V4JA 4F02A 4OHVA 1UCNA 2HBZB 2WB1D 4O3QA 3H2UB 5AJ3F 4DSFA 4ICLA 2JX2A 4DQPA 4DFMA 3ZXWA 1DTQA 4A8MP 3NG8A 3C3LA 2WAQD 4IG0B 4KT0C 1Y5LB 2Y3YA 4IG3A 3SXLA 1Z2ZA 2PIIA 5K14B 1F9HA 3T19A 1AFJA 4Y3CA 5I3PA 4DCOB 4DG1A 2CDRB 1YZ7A 2GO9A 4DS4A 2MZRA 3RR8A 3IO1A 3G9CA 4CYUB 3TJAA 2I1RA 3E2EA 1Q79A 1SC1B 1TK5A 3J7YU 1PCAA 3AOAA 2IFXA 5FIIA 1CJVB 4DX8H 5D4OA 4QYZK 4CDIA 2C2ZB 4QWDA 4XK8C 1FWPA 4WKRA 3DOMA 2KL8A 2FZCB 1TL1B 4NRTA 4RUAA 4DV7F 4FNIA 1FRHA 1VLYA 4ZHRB 4HHJA 1FCAA 4ECSA 3B4MA 3H2LA 4NLVA 2FJXA 1OWXA 2H51B 4WYWA 5A6PA 2PMZD 2HQFA 2CDQA 4LFCJ 4ED0A 5J2QA 3L3CA 2G1DA 4ZVGA 1BQXA 1TR0A 4P73A 1LWEA 4NWBA 2VG7A 1VISA 2ZWOA 1HL6A 2Y0BB 5D3GB 4WE1A 4ED6A 1E6VA 3MR7A 3ZZUA 1WC6A 2M52A 4LF8J 3BQ1A 5LM7E 2AEJA 3SFUA 3M8QA 2DJWA 1T94A 2FQQB 4JI4J 3OUYB 3ZZOA 3D6TB 2V34A 2PA8D 3SQGB 2AU0A 1FRLA 4JV1A 3WC2A 3D4JA 5LSOA 1F9FA 1S48A 2CJQA 2C42A 1KLMA 1Q8KA 4IFVA 3K5NA 1TV6B 5JUMA 4M5MA 2W7OA 4B3MF 1VHFA 2E66A 1J5OB 2F1FA 2CQ2A 4DV0J 3THVA 4ZVQB 3CDUA 3RBZA 2VZ9A 1N32F 2HBQB 2X1BA 3JQJA 2LEAA 1AXQA 4DV7J 2ERRA 1VR6A 3BYRA 3DM2B 5B0CA 5GAGI 2JNJA 1WI8A 3OR2A 5IOLA 4CLZA 4DV2J 2DR5A 4F8RA 2XB2D 3GJRB 1I51B 2ZE2B 3HHKA 5BXIA 4WFAQ 3TX0A 3KK2A 1QSLA 4USVA 1QD1A 3KLIB 4RUCA 3MPWA 1Q1KA 2DIVA 2WVFA 4FP9A 3E51A 3R6GB 5HJYA 4A8FA 3EM1A 4OYZA 1HW8A 4ZP6A 3J81U 5BYQA 4UW2A 5E3CA 5A2QU 1VC6A 1HR0J 3TZWA 2D3O1 2NXUA 3LALA 3R7SB 5HQ8A 2MLZA 3UFCX 2AX1A 5L1LA 2RS8A 2RUGA 3OTDA 3P8BB 2V2KA 2W9AA 4ES2A 2XY7A 4LF6F 1FVQA 2ZITA 2HPUA 4RWXA 2CJAA 1XN9A 2NXJA 1YJNS 1U49A 4NZ7A 2FGCA 2A2CA 3AB4B 5IM0A 2DNYA 3UD3P 2XLKA 2HQDA 1WC4A 4P10A 3HKWA 4FYWB 3VGUA 1K9MT 3DLKA 3PYGA 4ZVSB 2E29A 2BM0A 1JKHA 2I38A 4CQ1A 4OIXA 2AJ0A 1WUUA 2HFVA 3FEYB 4LF4F 3MM6B 1TAUA 3NGTA 1M5HA 4OYBA 3FCVA 4Y0FA 5I42B 1LK7A 2MZJA 2NXEA 1WKLA 4OHYA 1FTRA 2V5HG 1RADB 1YRXA 4NLDA 3KJVB 1B64A 5LSRA 4LR9A 3TVKA 4WFZA 5HQMA 1S72S 1S7HA 2VA2A 4J5OA 2J7KA 4TN2A 3U1NA 1AZSB 3MM8A 2GQ2A 2XI3A 2O67A 4ED5A 2CQPA 3G4SS 4F4XA 5LJ3Y 2HQ3A 1REVA 5KFMA 1YHQS 1RT5B 2M4MA 3AXMA 4OX6A 2V67A 4E2FB 5HLFA 1S76D 1Q8IA 3AJ2A 4LFAJ 4IH7A 2KHCA 2W2NP 4LJMA 2BANA 1D9AA 4WU3A 5KG2A 1Q16B 1IBCB 3LGMA 1WDTA 2BJDA 5DO2A 2GMHA 4IFYB 4N5SA 3OL7A 3MAHA 5B0FA 3H5SA 4LSLB 2GHVC 4F67A 2YWWA 4DFJA 4GVBA 1SKRA 3M1VB 2HKEA 4R8UA 1AW0A 2OMOA 4HLBA 4F0MA 2ATLA 4BLGA 3IS9B 3HHLB 3HVTA 2VPZB 1GXLA 2GO8A 4O4GA 5DDRC 3NGKA 2FYXA 1GNKA 3BR8A 1Q5YA 1U8WA 2DRAA 4NASA 2WCXA 1NZAA 1N33F 2LEPA 4ECVA 2ROEA 3UD5A 3SSQA 1TL3B 3FFIA 3IWLA 4U8YA 3GTYX 2C3MA 3J7A1 2OPPB 4DX6A 2BDPA 3MMBA 4L3NA 1CSJA 4ECUA 4B9MA 2HQCA 1ZM2A 3EVOA 3LAKA 2AV5A 4P72A 4CLYA 5GADU 2DH8A 3Q8YA 4I2PB 5KFDA 3BF4A 2CNLB 1QE1A 2C2OB 3DXBA 3KLFA 2AJ2A 4MK9A 1TL1A 2J6TA 4BWMA 1H6KX 3NAHA 3M6WA 4ECZA 2ILYA 2AIRB 1SH2A 4K8RA 3RAMA 3PVXA 2XS5A 4C8YA 4P9SA 4GKKJ 4H4OA 3CJ0A 5ETTA 4F3OA 1RTHA 2JOQA 4OYIA 4QIEA 3TEGA 1PJ5A 2LA4A 5L46A 1HI0P 2HWIA 2KG1A 2UVUA 2F65A 2V2ZA 5CCLA 4Y2IA 2CQBA 1HA1A 1CJTA 1NHUA 1G4CA 1IKWA 1RHJB 2PT0A 2ZC4A 1S0OA 4FYDA 3CCLS 3G6XA 2UUWA 4ZOSA 4ATNA 1FKPB 4PXEA 5CYMA 4QR0A 4DPTA 2K8GA 1KFSA 1Q53A 2MKHA 4USMA 1HWUA 5F3ZA 3CPWR 3PYEA 4A8WA 4YB7A 2ADBA 2MMYA 1X4HA 3VVUA 3H7HB 1FXRA 1HWIA 5J1EA 1SB6A 1VIXA 5AXNA 4P2FA 5SUHA 2HNYA 3J80Y 1RWPB 3W66A 1RKIA 1RTHB 3TUJC 3UNGC 3OL6A 3DLJA 4HI2A 3FDSA 2IJNA 2NYIA 4QYZJ 1W2IA 2BA9A 3HT3A 3HULA 1RTZA 3JSBA 1RWMB 1R8AA 2DT9A 2ZEJA 5KT7A 3B8HA 4HEA9 4C98A 3GIMA 2RRAA 2LU1A 2VUGA 3D0GE 4ER8A 5KFPA 3P96A 1LWFB 1RT4B 4NI2A 3WX8A 3QYYA 3Q22A 3DOKA 3Q0AA 4TU7A 2MKIA 3HMJG 1IBMF 2DNOA 3QATA 3ZO7A 2BE2A 2EKNA 2ROPA 5L9XA 5K8MA 4KPCA 4H54A 1T9TA 2C22A 4KY3A 4OI4A 2K3IA 4AYBD 5KOWA 4DPYA 3W60A 1D8YA 3SDEA 2RDIA 3TYTA 1S49A 2EG2A 1T3OA 3BM7A 4Y28C 2LQ8A 1KVKA 5KG3A 2R7WA 1TKZB 4A48A 3GCXP 1N5VA 3M8ZA 3U7JA 3ZZYA 1FTCA 4CH1A 1VS3A 2KYXA 2RH3A 2WOMA 2HRTA 2AWZA 3BGRA 3I0SB 3KG0A 4KB7A 4PPDA 4JI8F 1ZTTA 1Y3JA 3BSOA 2UUCF 5GMEA 2Z4PA 3GB0A 3QFHA 2R4FA 3QT8A 1AT1B 1RT2A 4OZNA 3TJ9A 5D0RA 4ZCIA 4ALZA 1DHMA 1N6QA 4MIBA 4B3OB 2LP4A 2HIYA 5B0AA 2BKOA 4DR7J 2MKCA 5B0BA 1SKSA 3IMQJ 2J6UA 4PKDB 3W7BA 2KFNA 2BOAA 2H3EB 3M2VB 3MM6A 3RB3A 1RB0A 4F0KA 1ELOA 1FI4A 2HWTA 4HACA 4NA1A 4NZ0A 2MY7A 4Q5VA 4U95A 4QW9A 1JXLA 4IFVB 4WXWA 2XCAA 2VDHA 4F3MA 2WOMB 2CQ3A 2R7QA 3HSDA 4CO2A 5DM6Q 2ZBCA 4FYYB 3IP0A 3KLGA 2JWNA 4NZ6A 4AQYF 2QMWA 3H40A 2AW0A 1PAUB 2DNLA 1Y4ZB 2ZUGA 5KFXA 3IA0A 2MPUA 3LP1B 1VBYA 2DR9A 2H4WB 1X9MA 1B0TA 2W4PA 4HDGA 1HPZB 3DOLA 3NWRA 3W61A 1GXUA 1PSDA 4HH0A 5B0EA 3HHLC 2W9CB 1F5BA 2XZDB 5A8KB 3CCWA 2OLWA 2DH9A 2OHDA 3EWGA 1WSRA 3I96A 3PEHA 4U7UK 5L38A 1F0XA 3QRPA 1JLGB 1SC6A 2Z30B 1HWKA 2XYGB 3DOKB 1MNEA 4OL8A 3PW7A 2CPIA 1T9YA 5KFRA 2R9LA 2EC2A 2UVWA 1ACMB 2UV8G 2MQLA 3RRGA 2XSFA 3MWBA 3N4WA 2GQQA 4CLWA 3CDEA 3V6HA 4JI3F 1IM4A 2EFOA 2G0JA 4M94A 3ET6A 3PFOA 5J1PA 5IS2A 2GIFA 3PRDA 2WTFA 3FJ2A 3PW0A 2B8QA 3HM9A 3FSIA 1WHXA 1RTIB 2HGLA 5H1SV 3KWMA 2ZBQA 2LLZA 3S1TA 4N7TA 1TQLA 3IN5A 1FESA 4RNHA 1TKDA 2IMWP 3MM5A 3NCRA 4O44B 3W9HA 2R2TA 2DVIA 2UXBF 2Y8WA 1E6YA 1OJ4A 4C6AA 4WP9A 2WB4A 3SMZA 2ZVIA 1RAEB 4KFBA 4TKTA 1HNVB 4CO5A 3J81Y 1VBZA 2KT2A 3GQCA 4ED4A 2B5JB 2O01C 1OY8A 5KFUA 1UZHA 1HNWF 1U0HB 2MQMA 1SI9A 2BVZA 1Q8BA 1SC4B 1X7VA 5E5NA 2FLNA 3M2RB 3FNNA 4YHHF 1MMDA 2DNKA 1Y5NB 3OTCA 3ETOA 2B51A 5L8RC 2RU3A 5L1JA 1ZM4A 2G0IA 1R43A 2LQJA 1N5YA 2B7BB 4J9LA 4L3KA 4OI6A 3IBCB 2VD3A 4CI0B 1KBRA 4M5DA 1IBMJ 2HNDB 1LXNA 3M8PB 3C46A 4PWUA 1S9GB 4J9NA 1M5PC 1YK9A 2VODA 3O5TB 4WZMA 1HD1A 2AX0A 4ANCA 3FBFA 4LT6A 4OV6A 2XO7A 4FXVA 3I32A 4ES1A 2V69A 2EPIA 1UEUA 2M3DA 3QFWA 4QOTA 4U7CA 2ZWPA 3LP0A 1YDLA 2V4RA 1EZZB 4F4KA 1CS4B 2EFQA 2GVZB 3R5GA 1NO8A 3GR1A 3ISZA 1CBKA 3NAIA 3CD7A 2DXEA 2F9JA 4FZVA 3RZAA 1M1KT 1XWLA 1LW0B 5AXKA 5I3QA 1XERA 2DGTA 3MM7B 5RUBA 1IBKJ 1S6UA 2GW8A 3ICLA 3IS9A 3QIPA 4IRCA 2YPYA 3TJ8A 3KNAA 4Z7YA 4M5DB 5B08A 1X9SA 2Q1LA 2R7VA 3MM9A 3SZ2A 2IJFA 3BSCA 5HP1B 5KAKA 5M2PA 3HF5A 4NEZA 4RBTA 1P8GA 2CQDA 2V2QA 2J8SA 1EIYB 3EGVA 2B8PA 1KRPA 2EBGA 3KK1A 1WWHA 4OYWA 4P7TA 2QFIA 2BKPA 1LFPA 4OI3A 2VIHA 1DTTB 2KXHA 1RK8A 2YKAA 3C14B 2FJBB 2YVSA 3GJQB 3D9BA 4KGZB 2MQPA 4F50A 2E5LJ 3UN2A 2DPIA 1GEHA 5BYSA 3EXCX 3G86A 1R6VA 4MYUA 2WHOA 2HS3A 3K7RA 1FKOB 4QIFA 5KFYA 3PO5A 5FD1A 2GS8A 3DRPA 2JC1A 3ZTQA 4OZ1A 2KZZA 1Y00A 2A1BA 5DJBA 1LOUA 1RT3B 1Y11A 2AKWB 2O66A 3UE2A 4DJBA 2APOA 2XO6A 4LRDA 1UVMA 3MOJB 5JJBA 3MUVP 3KKFA 2YNHA 3LQVA 3CJ5A 4QBUA 5A8WA 2DITA 2MGZB 1I94F 3TI0A 3UN3A 3IRXA 2V63A 3AOBA 5E2QA 4JI5F 1S7IA 3L7PA 2B3TB 2VASA 2WBRA 4CLLA 4DV2F 4AD6A 3SV4A 3PV8A 1UZDA 3V4IB 5CHCB 3R5CA 2OSQA 4MTPA 1NJYA 2EFVA 2R8KA 5CAAA 2J76E 5DRKA 4B9LA 1HNIB 3DLKB 3GYXB 4CZCA 4DV4F 2KXFA 3QIPB 4H4KC 5GAEU 1NKBA 4NPOA 1BQNB 2UZAA 3I87A 2H48B 4JI3J 5DS7A 4KHPF 1JJHA 2CADA 1DZ5A 2BJ1A 3THTA 3AJDA 2FY1A 1UEKA 2D9OA 3K0JA 2GMJA 1QUVA 2Y1LB 4ZJLA 4OI1A 4Y00A 4ED1A 1FJCA 1JWWA 3AFGA 4KV8B 2ZJRQ 3LP1A 5HVFA 5KT2A 4F4WA 4JI4F 3QGPA 4JOUA 2VV5A 1RHQB 4OX9J 2NSCA 5IZHA 4DCJB 4QU6A 3NNAA 4UY8T 1XMOJ 3RYLA 4Q2MA 2UUTA 1UJ5A 2RQ4A 1P9QC 1MWYA 2AJ4A 4YHHJ 2AEFA 3BPSP 3HVAA 3MFIA 1TP7A 1X4EA 2CFXA 3GJTB 2AMCB 3W5XA 4M5NA 4DFPA 2A10A 4HT5A 2F40A 5GVQA 5J2NA 2VG6A 1SJ4P 3C15B 3IG1B 4GRSA 2LYVA 1WTFA 5F8GA 5KFHA 2XY6A 2XS7A 2FLOA 4HR2A 4TY8A 1DQ9A 3W5ZA 4NCBA 2QSFA 4JYAJ 2KH9A 5F8LA 1HD0A 1BWEA 5J1NA 4YB1P 3JSYA 2Z57B 5HROB 3TAPA 4ZIWA 5KFJA 2DHGA 1RT7B 5AE1A 1X60A 2YKQA 3BDPA 2IVYA 4KKOB 3W62A 4GO5X 1BQMA 3NBPA 4MFBB 3CB4A 3GFHA 4O0NA 3EVMA 5DQGA 1XR6A 2KM8C 5KG6A 3L4BC 4M95A 3UNYA 4ZVTB 4FS2A 3MR6A 3M6XA 3OJUA 4WK1A 3RW7A 3N6NA 4H4MA 5F8HA 3VF0B 4C0HA 1U1RA 2BR0A 2FUG9 3LPEA 5KFKA 1SJ3P 2HVHA 1NPRA 1TL3A 3FFIB 1YBTA 4OZLA 3GILA 3HSGA 3MMBB 3G2XA 4LIRA 2YKMB 1C1BA 3FEZA 1RQ0A 3MUTP 2PA3A 3T5KA 3P4UB 3MMCB 3DDNA 4QWAA 2IDEA 2RAQA 3MF5A 2VHGA 2JEJA 4IUFA 2BV3A 3QBCA 3KLEB 2R2SA 5MLCV 1A7GE 1OMSA 3M8RA 4DN0A 4BWJA 4Q0BA 3TUZC 7FD1A 1MMLA 2VQFJ 4TLQA 2ZH7A 2CZ4A 3DU6A 3IWNC 2LQ9A 1CLFA 5H9FK 4KHMA 1URRA 4FPRA 4FYXB 4F3QA 4B9TA 3TUIC 1O5JA 5ETVA 4YDDB 2EG1A 4QR1A 2B4OA 3BDEA 3FEXB 5EUHA 2V68A 1RGVA 3JYTA 3GE9A 4ANDA 4LRBA 2DGQA 3UPFA 1Q95G 4C0OC 4DU7A 3TR5A 2E9ZA 1TFYA 4OV1A 5AXLA 2MTLA 5KFBA 4NEYA 5J1EB 1URNA 1CC8A 4YDXA 2VBYA 2DGXA 5HLFB 2OD6A 3DM2A 4PQUB 2DGSA 1VRUB 3JS9A 3HSJA 5J2NB 5EX0A 1J5EF 4I68A 1K8AT 2CQ4A 4RJVA 3L9ZA 2MQNA 4DV3F 2DR8A 1RTIA 1VLOA 2AT1B 3HX9A 2E9RX 3OR1B 2IY5B 4OQJA 2QLBB 5GAEI 3QLHB 5KFNA 1LXJA 3KK1B 3QGGA 4XTTA 3DC2A 1GFWB 2ACYA 1LWEB 1DTTA 1TUVA 2CPXA 3K89A 3M32B 3MD1A 3BKFA 5I42A 2H4YB 1BHNA 1FVSA 2YNGA 4K5SA 5A6WA 2NXNA 4ZLNA 5KFOA 3OTOJ 2FHKA 2A2DA 2MKSA 3LPYA 1Y0HA 2QC3A 1HQUA 2VKZG 3VAGA 4A8QA 1VQ8S 4NLWA 3VQTA 1WEZA 3H25A 4RBVA 3G6VA 1T02A 1UA1A 3RG6A 2W7PA 1QLNA 2VPWB 1O0PA 3MXHP 3GV7B 5HN0A 2HZAA 1JLAA 2K7JA 3CC7S 1HNWJ 3HHLD 4NLRA 1ZA1B 2NZ4A 4PAAA 4ZA1A 5G0RA 2BZ2A 3H0PA 5LXYA 2IC3A 2DR6A 4GVLA 3HVRA 4X62F 3TRGA 2W4CA 1R0BG 2A18A 5KFZA 3M8YA 3OJSA 1C1BB 4DL3A 1WOPA 3TANA 2UXBJ 2KVIA 3BH7B 2CWKA 1X0PA 1HI1A 3HO1A 1M5SA 2E1CA 2JC0A 3UR0A 4P52A 3I55S 3MR5A 2U2FA 1OY6A 3K5MA 1S0MA 2C2KB 4B9UA 3WQPA 2F4VJ 3T3FA 3I4HX 1T05A 3DKDA 2VQFF 1EQMA 4O3RA 4LSZB 3EZOA 2R7RA 4OZJA 1U2RA 3JQMA 1P6TA 4KE5A 2OKQA 2NYHA 3CD5A 3M6VA 2N3OA 1JJ2R 2GIRA 4I7FA 4NXMF 4B3RF 2ZM6F 1AFIA 2V4JB 4IO1A 3UR3C 1RBLA 5AXMA 2M70A 5HVHA 3T6BA 2RQCA 2HBRB 2LCWA 4LBIA 3SCKE 1NM2A 2AYMA 2MB0B 5ETNA 3HK2A 2DNPA 1B70B 2LDIA 4X4UA 1BE4A 4G1PA 3RBXA 1FERA 2V2VA 3M8QB 4LRCA 2BABA 2CPZA 4M5GA 1PJ6A 3M30B 3MDFA 5HJXA 4LF5J 1L3TA 2J0XA 2NZCA 2YNFA 2Z0GA 3SYZA 2DGOA 1HBOB 1R3NA 1WC0A 2ASYA 2RQMA 4QZVB 4X4QA 1MSWD 4USIA 4EO6A 1H2UX 2MDAA 3CO0P 3MEEB 1KQSR 1QVGR 4JV5J 4IH6A 1FE0A 2PN6A 3M2UA 5KFSA 4WU2A 5LOQA 1RXOB 2ZH5A 3SSSA 5KT4A 4GC7A 1RWKB 3Q8RB 4DSIA 4ILMA 3FMWA 1SIZA 2HFSA 5F8IA 3RTVA 1D0EA 2KN4A 2HFOA 4B3TJ 4I0WA 5DZ7A 2AD9A 4N41A 1YQHA 2F8HA 1JJ4A 4YB6A 5GAHU 2C2RA 4OZ2A 4I69A 1Q8LA 3ONQA 4J9SA 4DUTA 2O1PA 4CH0S 4LRAA 5LL6d 4AL7A 4YP3A 3KNGA 1RWUA 3AQOA 2YX4A 2RD5C 2D3ZA 3OTBA 1IKXB 4NLGA 4EBDA 1YG0A 4X2BA 2RIJA 3EZUA 4L73A 4DHVA 3AD9C 4KFBB 4MKAA 2DEIA 1YJRA 3OFGA 4DR6J 2MEWA 1NDPA 5E7OB 4C3LA 3M1VA 4UUXA 3GG1A 3FCWA 5GMDA 3CC2S 3MPYA 5DGAA 1RCOB 1VJWA 4J9VA 3MMAA 1XMQF 3QIDA 2QLFB 1LFWA 1UA0A 3QT5A 3H5XA 4PWDA 4KKOA 1UW9A 1HBMA 3EGZA 3HSZA 2EI5A 4ED7A 1QVFR 1NB7A 4UOHA 2E5IA 4C8OA 4ERDA 4A46A 4ZVUB 3AXKA 1YRUA 1KTVA 3EYZA 4I2QA 1RE1B 2YKPA 1FNOA 2KO1A 2XNRA 2DCUB 1X9WA 4TY9A 1NK5A 2XGQA 4MIAA 3C15A 4EZ9A 1R0AB 4FBUA 1HNZJ 3GFXA 3HJVA 1HBNB 1UKUA 4W98A 4X64J 2JEGA 1BXNA 1S79A 1F9EB 1WC3A 1FA0A 2MJUA 2XMKA 3I0SA 4NLUA 3O1LA 4F4AA 1OQ6A 5IQ6A 1L5UA 4OHWA 5I3UA 3T9NA 1H3DA 4C11A 1L3KA 3RJMB 2ZBRA 1RHKB 2J0WA 1LEOA 4I6WA 4WPAA 3CJKA 6FD1A 3JXOA 2L41A 2E7WA 3MM7A 4EBEA 2UXDF 1ITPA 1SJQA 3D0IE 3ILIA 3ISNC 1UEVA 3T5HA 2AGQA 2BE2B 4LFBJ 2ZOFA 3ZNUA 2RDDA 3B6BA 2W2OP 5L1IA 1VC0A 4I6AA 3WIUA 3U27A 1VC5A 4NMLA 4A8SA 3Q23A 2E5LF 2QE5A 1U8SA 2DEJA 3G8QA 5HATA 4J9MA 2A6OA 1UW4A 3EPIA 1HBNA 2UXCF 2LQBA 1Q86T 4QU7A 1U7LA 2DRBA 1BC6A 2ZDOA 3A4TA 4DV6J 5HI7A 3MEEA 2CXEA 3OFEA 3GCWP 2XMTA 3ILOA 3BYPA 1VQOS 2QGFB 1R8PA 1EETB 1N5YB 2N7CA 2XULA 3HKZD 3PACA 1KS2A 4PXBA 4J9RA 1RYSA 2C2DA 2QL9B 2JZ5A 1LWXA 5LXRA 4OYPA 1YJVA 3BKTA 4MK7A 3DRYA 2ZD1B 3EXYA 4IOBA 4IH5A 4JI2J 3QO9B 1FKPA 4ID8A 5CYMB 1HNVA 2I5JA 3FUYA 1HWJA 1IWAA 1TZ0A 3CW2C 4HACB 4URGA 5KT3A 3CCES 1F60B 1U4BA 3GU0A 2QMUB 3CCZA 4JI0F 3ZC4A 4CWBA 1EAYC 2X3DA 3EDQB 4F4YA 3DMJB 3JYTB 1SH0A 3FC9A 3IXQA 3GIKA 5KG1A 4U7UD 2UUBF 3LUYA 3MOZA 3ET6B 4U67Q 1U2CA 3V2UC 2XWYA 2MLXA 1IBKF 1S4FA 4H4OB 5A0YA 3I56S 1BWVA 2NR0A 1OIAA 2KZMA 3HFZB 5D0HA 1PKUA 3IWXA 2E9TA 5GADI 1R8BA 1RBAA 3DRRB 4B9VA 3TOQA 3NEKA 1F2HA 3IM9A 4WWSA 1X31C 4WIQA 5D77A 5F0UA 5KT6A 1N56A 4JI0J 4OYMA 4C9DA 3W65A 1KR4A 4KGKA 4PYDA 3T9ZA 5LMNF 3W3SA 4CH7A 4L72B 2E5GA 3Q2SC 4I6YA 4QIWD 3VGVA 3ZZTA 2UUAJ 2K06A 1FRIA 4WZQA 2OI2A 4X66F 3K58A 4R25A 2H65B 3TP2A 3MAQA 2YNFB 1TL4A 3ILJA 2MQ8A 2D69A 2DBBA 2IM2A 2ATCB 1SJFA 4G65A 1RISA 2WSFC 2KM8B 1WSVA 3S6EA 2AGOA 3FSYA 2XGPA 2ZC3A 2J7UA 4DPOA 5HQLA 1JXEA 1RWVB 1XR7A 3I82A 2UP1A 1ZA2B 5KOXA 2HS0A 1ZAXA 1RBOB 1ZAVA 4P2XA 2HNDA 3M8PA 3N28A 4GC6A 2LECA 1RKJA 4PXCA 4AL5A 4FVCA 2FJEB 4DI6A 1W7WA 5KFFA 1WI6A 4DV6F 3G96A 3RAQA 1N36F 5F8NA 5HROA 5FLXU 2HLTA 4PCQA 3PHEA 2ZKTA 3MEDA 2HFNA 3TZZA 2FVRA 4WP3A 2KG0A 2VA3A 3BH6B 3W8PA 1VRUA 2UXDJ 2WRMA 2E5HA 3AOCA 1S9FA 3EX7B 4DUZF 1REVB 1WKJA 4C0BA 1X5TA 1NKCA 1YVFA 4LVNP 1RLDA 3PFEA 4C7QA 3PW2A 2OFGX 1MROA 4DUYF 4ED2A 2IAJB 5HP1A 3E3XA 1Z1ZA 4USHA 3E01B 3KHRA 1DJ0A 3OFHA 3EZ5A 2FJVA 4ELUA 3R5BA 3OXFA 4DOZA 6AT1B 3Q86A 4I67A 4M5KA 4BC9A 4GKJF 4LF6J 3OVAA 5LJ5Y 4RWWA 5D4LA 2R8IA 1N0UA 3G82B 5C24B 1FKAF 4JI6J 2HVDA 3ZTOA 4DL7A 4K7QA 2BMBA 3LP0B 2IPOB 1FX2A 5KFCA 2RDJA 2FVSA 4NLOA 2JL9A 1JNZB 2VG5A 4QIVA 3BZQA 4Y2KA 1DFDA 1LW0A 2CNKB 3W2WA 3ZZZA 1SL0A 4PEOA 3AY0A 2UU9J 3N5FA 1RT4A 2C28A 5A0YB 3RW6A 2FC9A 4O3OA 2NPFA 1LWCB 4NXMJ 1JLCB 2XYHB 2K3KA 5ETPA 4E98A 1QUPA 1J5EJ 1JNRB 2CRLA 3PEJA 2XTJP 3H59A 1P1TA 4MFBA 5CQGA 4DL6A 2V8HA 2YH0A 1CQMA 1RAGB 3N0VA 2C3OA 2V8VA 2E5JA 4N8OA 2OELA 5EWEA 3CXCR 1KSPA 1K1SA 2HZVA 5KFTA 2LXUA 1RAJA 2CA9A 2DGVA 3P45B 4JV0A 2W8KA 2FD2A 2Y8YA 1R27B 4XDCA 2CNNB 2R8HA 2B43A 3CE8A 3FRYA 2ZNZA 3TAQA 2XM3A 1CPZA 3M9MB 5ADZA 4LREA 1VQMS 2AJQA 1CQNA 2LQ5A 3I5AA 4K2JA 4U8VA 4E0DA 1X4FA 1MU2A 3C6UB 2W9BA 2R8GA 4DQRA 3B78A 4AL6A 3GFZA 3M8WA 4DZDA 5C25B 5LMNJ 2BJ3A 3FBCA 3UDLA 1UVIA 3FBEA 2M0GB 2XI2A 2XG8A 4JV5F 1D09B 1T11A 1NRKA 1YJUA 2N4CA 3NNCA 4OI2A 2PFDA 1U1PA 3P6YC 1W25A 1S6PA 4AFFA 4JI2F 5F9LA 4DLEA 3J7Z5 1N52B 2ZJPQ 3KLHB 4OX8A 3R2DJ 3T1YF 3MMAB 3NMRA 1GMVA 2HHUA 3UDEA 1H2TZ 3KUGA 4LQ3A 2RUSA 3D2WA 2Q6CA 4W92B 2BXJA 1KKHA 2B9WA 1PBUA 1S6QA 3WDOA 3VTIA 4NX9A 4P74A 2KKHA 1TELA 2PEBA 3D1HA 4ZKAA 1OPZA 3R6LB 4CTAB 1SQEA 1JLQA 2LMIA 4HTIA 2ZHBA 1KQGB 2AZ1A 2YX7A 5CYQB 4XO0A 1WHYA 2IRXA 3VV2B 1V9OA 3MURP 4K4UA 2QA2A 3Q8UA 5HL7Q 4Q8EA 2VBWA 3FRZA 2Z2LA 2KJWA 1HPZA 3DOLB 4RBUA 1KONA 1XK8A 3IR5B 2GHPA 3QPIA 3CMAS 3NGDA 1IKYB 1T9WA 1WHWA 1EKRA 1KEKA 2CQ1A 1BMQB 3V6KA 5KFWA 3AA8A 3EUNA 5DDOC 3VAJA 3CCTA 2R7SA 1SV5B 2W24A 4RW9A 1HWLA 1M1HA 1WG1A 1N8RT 4YR0A 3D0HE 5HVGA 3P5BP 2RNEA 3PW4A 2RJZA 1M5OC 3P3DA 2KB2A 2DTJA 3KHHA 1I3OB 2BJ9A 4C3KA 2VFUA 2EXUA 4WTYA 3H5UA 1KDNA 4UZCA 3OLBA 3KK2B 3OSPA 3HLUA 3HZEA 2YWEA 4V19X 3W1YC 1IJEB 1H7XA 2R2RA 1T0TV 2ROGA 3NOGA 4YY3J 1PBAA 5ETLA 4CNYA 1KLMB 3CMES 3D7SB 2JRSA 2K7KA 1U47A 3EMTA 1X4DA 3MM9B 3B82A 1MW7A 4J90A 3C66A 5LT5A 2CPFA 2XMAA 2N82B 1RT1A 1LW2A 1TK8A 5F8MA 4HKQA 4ZPWR 4OJHA 1CJUB 4M5IA 2IRUA 1FXDA 3QRRA 3G6ES 1N88A 2YQ0A 2BUNA 2VG7B 5C5JA 2DPJA 1TKZA 2D3OR 2BJ7A 1SUQA 2QYCA 3TA1A 2YQ1A 2W1BA 5DG7A 4DU8A 4DSKA 2F8EX 4LFAF 4FXDA 2NQPA 2MKYA 4KPYA 5C42A 2YNIB 2MQOA 1BQNA 2VC0A 4EO8A 1TMMA 4LF5F 2BE7D 3T1HJ 4MKYA 4NYZA 4AUKA 2LXIA 2VC1A 1AROP 4O0IA 2CQCA 1IBLF 4DV1F 2MYFA 2P6TA 1XMQJ 3CNQP 1U1OA 3VR1A 3JAMY 3L95X 3M9OB 4CLSA 3M4XA 2JEFA 2H1YA 1R7IA 2MHNA 4N77A 1WDDA 4O23A 3VAHA 2YNHB 2PMWA 1T95A 1ICEB 4J9PA 4AE5A 4LF7J 5JVHQ 4CTAA 4V19J 4KQZA 1RACB 4OYAA 5GAGU 1N4LA 2J9DA 3NGSA 4K4YA 2FLPA 3ENVA 1IUJA 2AGPA 4X4OA 3DI6A 1VQ9S 3BB5A 3MCMA 2QT7A 5K14A 3S7RA 4DPUA 3MEGA 4C8MA 2WBMA 2YKNB 2LVWA 2XHWA 3D3CJ 2HURA 3K8VA 2JDJA 3O44A 5E3PA 4LF9J 1UVNA 4QWEA 1U6FA 4I7FB 3MGJA 5L39A 4CYUA 2AJFE 3CJQA 3MD3A 1UWAA 3O2IA 3B4DA 1EX8A 4BBYA 2CWXA 2W2PP 3OFFA 1NDKA 2GZOA 1FHTA 1O51A 1T9XA 4TY8B 1U2FA 4MMOA 1VI7A 3IR6B 1JXVA 4NLQA 1HQEB 2CYYA 4EWTA 1SKWA 1AZSA 3MM8B 3QT7A 5BR8J 2GAHC 4XPEA 4O3SA 2RSQA 1UL3A 1DAXA 1N5QA 2MZTA 1WACA 3DLEB 2IMOA 5CABA 1SCJB 2ALYB 4OFZA 1JJCB 4P71A 4X65F 3SEOA 2F7VA 1RI7A 2PMHA 1XNRF 4K4ZA 2QL5B 2ALZA 1X0FA 3CJ3A 1UETA 2HNZA 1M0SA 4ES3A 5I4MA 2OD4A 1WELA 2OPPA 1GH8A 3VZIA 2HHQA 1FRXA 2P9CA 2UV8A 1XEZA 2M9KA 4IO9Q 1L3SA 1B3TA 3NKYA 5BYRA 2IC3B 1QE1B 4BDPA 3FZBA 4Q2LA 4C2MA 3OV7A 2CZ9A 4D3HA 1U09A 4JI6F 3KLEA 1S77D 1SUQB 3U1LA 2IBOA 1QTMA 1UTAA 4D3GA 1U24A 2ZBPA 3ENAA 1WTBA 4TNOA 4CLFA 1YSJA 2L9WA 2E1MC 5K8NA 3KG4A 1BY9A 4I64A 4J9UE 3CMQA 1UWBA 3NGUA 1U0HA 3TO8A 2IHR1 4ZK7M 5T14A 4RNNA 1FFWB 2G9OA 4TU8A 2NSBA 4L76A 1N48A 2Y9HA 1RAOA 3V81B 1TKTA 3KLGB 4NXNF 5I3UB 3GV8B 2GCFA 3BSNA 3HXMA 4LF7F 1WNEA 2M7SA 4USUA 5A8RA 2HG4A 3MPUB 4QYRA 3SI8A 4CO0A 2B56A 3OTEA 2DYAA 1R8HA 2WSEC 3R8YA 5E3QA 2WONA 3RBEA 1SQFA 1UPPA 3PYDA 4I2QB 4NMXA 3T1HF 4EZ6A 1NZ8A 1KQFB 3MTJA 3ENWA 4DS5A 4DWIA 5IV4A 1NPKA 2ZHOA 3HD2A 5C2GA 3KHGA 1S59A 2FHJD 2L9DA 3O3LA 5IC6B 3HHNB 3MECA 1I94J 1VQPS 2QLWA 4A47A 1RTDB 2W25A 3A13A 4JI5J 5AJ3J 1EARA 2W4DA 3SFGA 3IM8A 2KTQA 2ZVSA 2IM1A 2JJ4D 1X5PA 4ID5A 5JXSA 3TWZA 5DLFA 4DR2F 1HLWA 1RUSA 2F9DA 4LUBA 2JFDA 3A3OB 3GG0A 2RE1A 4QPTA 3SIPB 9RUBA 1IM6A 3HT0A 5B0DA 3N6LA 2R7XA 2P5VA 1HBUA 2OEKA 4TQSA 3CJRA 4ZITA 2LEBA 3HI9A 1PO6A 4ZMMA 3BGUA 3CGIA 5LMUJ 2DNHA 1JLAB 4WJBA 3OSNA 1YLXA 3BGFA 5D15A 2BW7A 1G3OA 2VF3A 3A1YG 1JLBB 1YKWA 4YR2A 4RNMA 5CXTA 2EC0A 4ZVHA 2MJNA 1R0AA 4PZVA 2HHTA 1LWFA 4HHHA 3W2VA 2ZFHA 1RAIB 1CULA 2QIFA 3DOMB 3NBPB 2HLUA 3W8GA 4KO0B 2AJ1A 5A8WB 1UVLA 2LFVA 3TQ1A 3HZGA 1C0TB 1UFWA 1Y9OA 1F5CA 2YWGA 1ZBTA 4L75A 3X3UA 3SSRA 2KDOA 3TX8A 3A3PB 3ADAC 2OFHX 1MU2B 3QWPA 2W9BB 2OEJA 1XNQF 2I5JB 2J5AA 2IAJA 1YBAA 2BKNA 2QLXA 4DV5J 1G7CB 3W63A 4DG1B 1FNMA 4NCAA 4N8NA 4K5RA 4NLTA 4U6PA 3AT1B 5CD4H 4Y2MA 2IA6A 3DLLQ 1ZOTA 1KP6A 3BN7A 5H9EK 4DQSA 4HT7A 1KWMA 2FLLA 1NSAA 2OGUA 4ZLLA 4JYAF 3R3TA 3CJ2A 3IBFB 3NCPA 3OUYA 2DO4A 2HIQA 4RLEA 2GJIA 1Q78A 2PGCA 2IVFB 3V5RA 2AYGA 2I9SA 2YX1A 1TV6A 4Z37A 1RWWB 2KRRA 4ELTA 5KG4A 1VBXA 3LA0A 2VPYB 3KDOA 3NL0A 3F41A 4G1IA 1KC8T 3BGLA 2DISA 4KTQA 2C3UA 5KG0A 5J2QB 4PYAA 5H9FJ 4X4RA 4K4SA 2MSTA 2BRLA 4MAKA 3QSIA 3MI7X 4RNOA 1HMVB 3I0RA 3Q8PB 3D67A 4ILRA 4UY85 2YY3A 2D41A 3S8SA 5B09A 4KJIA 1CS4A 3TZYA 4I4BA 3LH2S 1OYDA 4MH8A 3HFKA 8ATCB 1CJVA 4DUZJ 3CIMA 2RILA 1QAYA 2FHJA 3ZTRA 1QAJA 1FK9B 2E44A 2QMXA 1HW9A 2YNIA 4WTOB 1FJEB 4PG6A 1FXLA 5KG7A 1DY3A 1IQZA 2BANB 1OO0B 3BO3A 1Q4RA 4URSA 2J6SA 2EFNA 3QJJA 4DV1J 4QCLA 3BBBA 2KI2A 3CWJA 1FWKA 5MAOA 4DR7F 1QSYA 4ZVPB 2D74B 3HFVA 1RU1A 3H4DA 4LSLA 1R6YA 4EI2A 1H72C 4ECQA 1GTHA 1FD2A 3M2RA 3VAIA 3C14A 3FBBA 3QRQA 4M1KA 4QJVA 3J7AN 3PTWA 3N5BA 4EYIB 2XYPB 4ZJQA 4ELVA 3M05A 4IYQA 1NK4A 1XNRJ 3Q8QB 2V0NA 2G4BA 4PG7A 4ECRA 4TYBA 1HBMB 4OLPA 1KLNA 2NUHA 2QL7B 2HGMA 2AP6A 2FIUA 3MEGB 3MM5B 2NREA 2DR7A 2HBYB 4HHUA 4ZCKA 5F9NA 3QNWB 4ZS6A 3G87A 3KJVA 1F3VA 2UVVA 1X5OA 2ZH6A 4Q43A 3BO2A 3FCHA 1NEEA 3ETMA 1YZ6A 2G0CA 2FJAB 4M5HA 3DLHA 3GIRA 1D3WA 1RAAB 3JAMU 4YR3A 3G8TA 2U1AA 4DSEA 1H98A 3NS5A 3ITHA 4RW6A 4DMZA 9ATCB 4Y2CA 3UD4P 1C1CB 2D1CA 3GMGA 1S1UB 4LR7A 2CJXB 4RL1A 3CCRS 4K50A 4ZCMA 4LIWA 3CJKB 4YUDA 1FEEA 4CT9A 2G1HA 3CCMS 1HHQA 2BQRA 1U1LA 2RS2A 1MWQA 1VQKS 1S9GA 1D9FA 2C1EB 4K59A 3UDCA 2OPQB 4C97A 2QV6A 1VBKA 3UQSA 5LMUF 2QX0A 4V1Ak 2FVQA 1N5SA 2JSXA 3QLHA 2VQEJ 3GWCA 5E33A 1CG2A 2DNQA 2LDYA 2ZNYA 1HBUB 3IAM9 3MFHA 3QAEA 4K4XA 2XZTB 4YB5A 5CCMA 2JHEA 3M2VA 2FTRA 4FKXA 4RKUC 1I6JA 1XBWA 2B4UA 3M30A 5KFAA 5IWAJ 5BR8F 1B99A 2GVDB 3PYFA 4F7VA 2XHCA 3LGNA 2YQ3A 4H4MB 3IAS9 5ETKA 3OL8A 5L1KA 1U45A 3N79A 2R7UA 1Q0NA 4KGXB 4JI1J 1WC5A 1TUGB 3Q83A 4UQGA 4K4TA 4X4NA 2VG6B 2V50A 1SJRA 4PXDA 1P9YA 2GAGC 3MECB 3R9LA 4ZCLA 3BGRB 2X51A 3MPDA 4G1QA 2GFFA 1FJGJ 4DX7A 3I9ZA 3ZNJ1 2HZCA 3CF5Q 2J8AA 2R42A 5KFGA 1RT2B 2FY8A 5B0GA 3T1YJ 2L48A 3CJ8A 4HYKA 2OH2A 2ZJQQ 4B3OA 4XAKA 1MMNA 1WKKA 3G8SA 2VOOA 2AHOB 1GAOA 1IXKA 2WZ1A 4QWCA 3QJLA 3CCJS 2ZOGA 1DQ8A 3I9V9 4C4WA 3HPOA 2FGOA 3KYLA 3Q8SB 3GLJA 1TKXA 3E8OA 3NY0A 3W64A 3GIIA 2V9WA 4BCAA 1RAHB 3MR3A 4LF4J 1FFGB 3GONA 2OPRB 1JLBA 4M8LA 1VQ7S 5A76A 5DGBA 1Q81T 1TFWA 3MAAB 2HK3A 1X5SA 3NNHA 1K47A 3AJ1A 1C0UA 5BJRA 3ITHB 4RW6B 5IWAF 4NLPA 1Z2LA 1CVJA 4J91A 3DGPB 4DL4A 2B9YA 1T9UA 1VQLS 4ZN1A 4ZP7A 3LW5C 4ZPCA 2JEIA 1FRKA 4WIIA 5KFLA 1NSKL 5KTQA 4MKVA 2GGPB 2Z2MA 1KD1T 4B3SJ 5JVGQ 4DX5A 1HQ2A 4LBHA 2W7AA 4Z7CA 2MSSA 3JSMA 1V3SA 1U6BA 3K5LA 5IT9Y 3RRHA 2AQ4A 1KHVA 3D28A 2Z8QA 4ETZA 1NJZA 2O5DA 1KVIA 2K1RA 1L3VA 1RYRA 1S97A 2AF6A 4EEYA 2JLEA 3OL9A 4WP8A 1K1QA 2PEHA 5DQHA 1RT7A 4EK2A 3BO4A 2XQCA 1VOMA 2Q79A 1Z4UA 3H8YA 5C25A 3OLAA 4Q45A 2HHHF 3Q24A 1Y10A 3UWTA 4DCPB 3RU0A 1ZH5A 4PWDB 2QYGA 3DRSA 4KH1B 4ZPVR 4MYTA 1KOHA 4N76A 2RHSB 5L9NA 4JV2A 3N9UC 4UOFA 2I6WA 3PKYA 2GVDA 2QO3A 2M88A 1IKWB 1JB0C 3ZZPA 4X64F 1SIWB 2V9KA 2HHWA 2WVBA 5ETQA 1R0CB 4IRDA 1Q7YT 4DPWA 1DLOB 1JLCA 4CO3A 4DLGA 4K0KJ 2BM1A 1W26A 4FYVB 8AT1B 1RT6A 1ROFA 3IC1A 4CIOA 3NRBA 2C2EA 1T05B 3KUEA 2EW9A 2HFUA 2VG5B 4KIAA 2DKOB 3T1AA 1GMWD 1YJTA 3ZFVA 2G2ZA 3KDNA 3DYAB 3HHDA 2EFGA 3R5AA 1CJKA 2FZKB 2IYGA 2BACA 3DXSX 2QTWA 2RKIA 2R2UA 4F2SA 1SH3A 1SBRA 3TAMB 4OJGA 1IKVA 4ECTA 2B6AA 3TEHB 2L08A 4WCEQ 2OIHA 4B9NA 2R7OA 3MZIA 1B7YB 1RA7A 4LR8A 3U02A 3E01A 2V94A 3PIPQ 1RT1B 3BREA 3CCSS 1ZTWA 4B3MJ 4DR6F 1NLKL 2OPRA 1D9DA 2F8MA 3HDSA 2NPIA 3PRBA 4FDFA 3MAAA 2EK6A 2OPSB 2V6AA 2XEXA 1VQSA 1ZPVA 2J0SD 2XSJB 2ASDA 2F3JA 1WF2A 2BEFA 4S0MA 5DG9A 3MCSA 4X65J 4ECYA 4KGMA 1BQMB 1V3RA 4HH1A 2HSEB 2CZVC 5HBMB 1XQIA 4EYHB 3RB6A 4KAIA 4B3TF 3UCGA 5HMXA 3D6HB 1KN6A 2HK2A 5IT4A 3WX4A 3NLCA 2KU7A 1VQNS 1S1WB 4DV3J 2IBKA 1S99A 3MEDB 3VQSA 2VICA 3UVJB 1VGYA 5EN1A 4CO4A 1KOOA 1PYOB 1HR0F 2UUBJ 4MK8A 2JVOA 1OSCA 1VRTA 2H5JB 4YMEA 1HIYA 3CJSA 3MUMP 2VBXA 3W2VB 1GTEA 4RNFA 2KFYA 5J2MA 5HSPA 3JB9k 2AYBA 1XMBA 4JI7F 2Z58B 3UCUP 1PC5A 2NXCA 3POTA 4B3SF 3CULA 5EWGA 3OBIA 3A8KA 4C8ZA 2Y0SD 1V5VA 3QQCD 3R7NB 4Q0BB 4W90B 3R5DA 2XMUA 2FDNA 1NK0A 4B9SA 1IWGA 2HRYA 4NCGA 2KJVA 1NK6A 4KV8A 1S1VB 4KHPJ 2BBEA 3VAMA 4C48A 2XY5A 2H54B 1IN0A 4ZIVA 5M2RA 4QW8A 4CM2A 2MKKA 3ULHA 2XLIA 2D3UA 2QSWA 4M63A 2WW8A 5DDQC 3H42A 1RAFB 1XJWB 5K9FA 2H9ZA 1IBLJ 3OD2A 3PXGa 1RZMA 2OSRA 3PDNA 4DSLA 3KMQA 4FXWA 2J9DE 3W5YA 1HHSA 5E3RA 5D8HB 4DL5A 3EPGA 2FZGB 1PJ7A 1SC3B 1FX4A 1WHVA 4OZ0A 2KVQE 4Q7AA 5HMYA 2HHVA 4RO0A 2COLA 2HNZB 3MHYA 3UI3A 2BRKA 2BE9B 4DEZA 2OP5A 3OR1A 4L74A 1SXLA 1WEYA 3R97A 4CRJA 5DQIA 2V8DA 3V6DB 4OHXA 4NXNJ 3PNIA 4FF3A 1JK9B 1XIQA 2CKWA 2ZKUA 3HD1A 3OR2B 3B54A 1YRTA 4RR5A 1WF0A 2DHXA 4Y2AA 4PABA 5ETRA 3PR5B 4DL2A 4FF1A 4P2SA 3I6PA 3WZ0A 5J2MB 3JTPA 4IG0A 2ZHAA 3OW2R 1FJ7A 2DY9A 4DR5J 3ZTPA 2VH7A 3CDBA 4NLYA 2UUCJ 1EKSA 4P75A 3CVKA 1DBDA 4OX7A 3OTOF 2HHHJ 2ADCA 4BHQA 4HL9A 4ZPDA 1WG4A 1JKHB 1JLEA 2RVJA 2Q6BA 1H73A 1UVJA 1NK8A 3CJTA 1FRJA 4QPXA 2I2YA 1EJ7L 1G1XA 4C8NA 1OY9A 3FZ2A 2CVEA 2ZUAA 1YJWS 1HI8A 3EICA 1NJIT 1LQ9A 3BQ0A 1RTJB 2GNKA 4W4MA 2KYZA 4WXOA 2B9EA 2GVZA 2W2QP 2HVEA 4OX9F 4ZPAA 4ZHRA 5DG8A 3M7VA 2G2OA 4N47A 4ZDNA 5EWFA 5DETA 2E7VA 3C8YA 1QAXA 3QT6A 4RW8A 4DR3F 1O8BA 2VFTA 3K5PA 2XMWA 1V3ZA 2IA0A 3C16B 1RWXB 2DB1A 5KG5A 4DF8A 1KNZA 1WJ9A 1FDAA 3GFYA 1FWLA 1SKUB 4FBTA 3OXGA 1OPIA 2P9EA 1F3FA 3W2WB 3CO9A 4BS2A 2DCLA 4CT8A 2KXNB 1N32J 1YIJS 3V4MA 2DNMA 4P7VA 3H4BA 2J7WA 5AE2A 1X4AA 1ULRA 1GX6A 1NKEA 3UCZP 1CEZA 2KT3A 3BQ2A 2FHOB 1V6HA 1WD6A 3BSAA 2XBPA 1R8CA 3EVWA 4K4WA 1L3UA 1F6TA 3NMAA 5D4NA 2X1FA 3CJ4A 1UVKA 4JBCA 1Y5IB 3I31A 2OEMA 2UVRA 4I56A 1J2VA 2MZSA 1NHKL 3KJFB 1KVJA 5T41A 1RT3A 3DLGA 1LNQA 2LU2A 2CVIA 3EDRB 1HYSA 1VYAA 2G13A 5CD4A 3AHPA 3BR9A 1D8ZA 2M8HA 3QWUA 3KLFB 3I5BA 4FPIA 3OHBA 2Y1IA 1MLAA 3H5YA 1GK8A 1ZS6A 3KJNB 3CEDA 2R3VA 4KH0B 1A9NB 4DN9A 2GIQA 1HHTP 2PDAA 3D1OA 4A8YA 4NE9C 2W01A 1C4AA 1EP4A 4RW9B 1MG7A 3NS6A 1IKVB 3KK3B 4XIUA 1S9EA 2VFRA 1NMEB 1JLGA 1WF1A 2SXLA 3PCOB 4WBFA 2CG4A 4GKKF 4ZLJA 4DXLA 1YJ9S 2IYIA 2QG9B 3VALA 4LF9F 4OJ3A 4MJKA 4A8KA 2D9PA 3TA0A 4ZVFA 1HQUB 2LXFA 3K59A 5K5MA 3BPDA 3PR4A 4LQ9A 4USTA 4YEAA 2RB7A 3D1QA 2X1AA 1RT6B 2OAUA 2JLFA 2MZ1A 1PYTA 4DUYJ 4ZP8A 4RW8B 5IXUA 1K44A 1VFJA 3SCLE 1MN7A 3GSIA 1EP4B 2HGNA 5G0RB 3WC0A 5G4DA 3L7OA 4IR9A 2C3YA 2I8EA 1AYEA 4NCGB 2FHMA 3D54A 2POKA 3DYAA 3QZ7A 5EHHA 3RR7A 1TKXB 4DBQA 1NHVA 3BN4A 4E8UA 2RHQB 3LGHA 4KYZA 3PIOQ 2X3GA 1M90T 3KFWX 1S6QB 1FO1A 3QGIA 1ZM9A 3IRWP 2VFVA 1HFEL 3M32A 4RZRA 1FT8A 1VRTB 2F4FA 1HNXJ 3QJPA 1YITS 1AB8A 3GP9A 2UU9F 2DNRA 2ABYA 1U1NA 1S0VA 7FDRA 1FDNA 2K2PA 3KXDA 4OYOA 1B4SA 3PZPA 2HVZA 2L3MA 2V4QA 1QSSA 3PW5A 1Y7PA 1ZPWX 2C3PA 2X7IA 1SQGA 3IG1A 4MKBA 4PR6A 3T5JA 3R1HA 3H2VE 3Q2TC 3I4PA 1NDLA 1RP5A 2EKYA 4I2PA 5C7PA 3WBZA 5HO4A 1U1MA 2M5YA 4O44A 3BBFA 4X66J 3ZZ0A 1VQYA 3HHEA 1TMJA 1NAQA 3GYNA 5HMWA 2QA4G 2MY8A 3TARA 3X1LB 1FJGF 5D3GA 4LSNA 4PWWA 4ZVRB 3UDVA 1NXIA 3BGOP 1G2EA 5KFEA 1H38A 3BBCA 1RDRA 3LO3A 1NJWA 3PO4A 3C2PA 4URQU 1GXTA 1QY7A 3D3BJ 5CZXA 3EJMA 3PY8A 4PUOB 1VQ4S 1RHRB 4NA3A 1U6ZA 2DNZA 4U96A 4KGVB 3BEGB 4L6V3 4USWA 4F25A 1TUWA 3RBDA 2B6AB 3P5TL 5FLXY 4PPZA 4DSJA 1JLFB 2HMIA 4FF4A 1EB0A 4UZBA 4B08A 2DNNA 6FDRA 1K73T 2PI4A 2XNQA 4XDDA 1P1LA 2WSCC 3EGNA 3PM9A 3OXLA 3MMCA 4WYLA 2HVIA 1IQTA 2PSZA 1YBUA 3TW0A 1N34F 4GVBB 2ACMA 2OUGA 2HHXA 2O3DA 4HVZA 3O8WA 1H7WA 1ZYQA 3DHWC 2BQUA 4RUHA 3FMBA 4DF4A 2EBEA 3DDIA 1OSDA 3FQKA 4O3NA 4NLXA 3C6TB 4PQUA 2E7XA 3SCJE 1MROB 4U9RA 5F41A 4F36A 2Z2ZA 4ZPBA 4N56A 2WVEA 4TU9A 1K0VA 1JQGA 1JLEB 5A8RB 4LF2A 2NCKL 2C2NA 1MWZA 4CO1A 3Q8VA 2ASLA 2V8PA 1BD6A 1DTQB 2BYCA 3ELHA 4IOAQ 2GJFA 4QQBA 4CNZA 2L9NA 2CJ9A 2CQGA 2AEMA 2P9GA 4WFXA 5E41A 3ENQA 1A0OB 2E1AA 5IT0A 1GMWA 1SJ1A 3OVBA 2RRBA 4KSEB 5J2PB 3W9JA 2C2MB 5F0WA 1HARA 2HAIA 4ZVEA 3GJSB 4CP5A 1XTZA 5IM0B 2R7TA 1VK3A 5IC4B 2DNGA 3DN9A 4ITSA 4UOGA 4LFBF 3CSKA 1QDUB 2FVPA 4RU2A 4DQIA 3NOCA 4X4SA 2MQQA 1QAIA 3KHLA 2QN6B 3R27A 4RW7B 3RUBL 1NBEB 1R89A 4EU0A 3V81A 3A3NB 4USKA 1U48A 1S10A 1IKXA 1RWNB 3PJ9A 3R7BB 1OYEA 4JUZA 4NLSA 3VGSA 3OT9A 2F63A 4YFUA 4WK3A 5ITHA 1T03A 2CIMA 4NYOA 4AQYJ 4H4KA 4PG8A 1RHUB 3FGVA 5D0EA 4OZ5A 3T5LA 1GQEA 1NK7A 2HQGA 3GR0A 1R31A 1WG5A 4LSNB 1NB2A 3DLBA 1RTJA 2HNYB 1X4GA 2CUYA 2F5GA 1S9EB 3C19A 3FK4A 4RW7A 4B17A 2GX8A 4J37A 2ZBIA 3P49B 4HDHA 3HP6A 3VHQA 3M2UB 3RGIA 4ECWA 4KRWA 1VQ5S 1M5KC 4DV4J 4EBCA 1VQ6S 4A8OA 4ILLA 1CJUA 3QSYB 3UVJA 2Y1RI 1F5AA 4K2XA 5K8PA 1CJTB 3VVTA 4AT1B 4J9KA 2AZ3A 2NUUG 3T6JA 2HS4A 2ZH3A 3D5MA 1RT5A 3LANA 3NWGA 3TNVA 4FNHA 8RUCA 1FRMA 1S1XB 5D6GA 3EGWB 2GJ2A 1D1UA 2OJ3A 2CAJA 1O6XA 2OMLA 1U1KA 2ZD1A 3GPAA 3MEKA 4TLRA 1HNXF 4TQRA 1KQKA 4B3RJ 5GAHI 3QO9A 4YN3B 2ZH1A 4NL5A 4RU9A 3W9IA 1AA1B 1S6OA 2J0QD 4CM0A 4IOCQ 1RJJA 2OO4A 4R0JA 3NCQA 1VRQC 3CUNA 4WE1B 1JIHA 3DNCA 2PI5A 2ASJA 2XLJA 2DD8S 4F4ZA 3DI6B 2F4VF 4KO0A 2DO0A 5FDLA 4NI2B 4DR4J 3MCOA 4RW4B 1CJKB 3R2CJ 5IT9U 2IIHA 5E3AA 4NYPA 2N3LA 2CJBA 3HHLA 3HVTB 5THWA 2ZH9A 4Y65A 1TK0A 5U47A 1PILA 1UFKA 3MTKA 5HAOA 3SBMA 1IR1A 1NDCA 3TA2A 3V6JA 3LP2A 3CD0A 1WOSA 2VKRA 4O3PA 1T03B 3DCAA 2B7CB 1HMVA 1PYSB 3I0RB 4Y6IA 5CYQA 4DPXA 3QMQA 3KK3A 3GV5B 4RPFA 1IR2A 5M2UA 3EE3A 4C11B 2MGZA 3CCQS 3KG1A 3GIJA 3IGNA 4ETXA 1S12A 3DLEA 3DMJA 3N6MA 3H20A 2JFKA 2ZM6J 2VONA 3WHIA 1RHMB 3KLIA 2IRYA 3DRPB 2QEXS 2ZZMA 4KBIA 3L7UA 2Q66A 3KLHA 2P8IA 3K5OA 3K57A 4DV0F 1DARA 2HW3A 4QWBA 3R1LA 2WW4A 3DRSB 2HYIB 1S1TA 1DURA 1S1WA 1FDBA 1GX5A 1NNDA 2B9XA 1S4EA 3AQPA 4A4JA 1KTQA 1FFSB 1VK8A 4X4VA 2B5JA 2KFZA 1TTHB 2YWHA 2W2MP 3K2YA 2PC6A 4RX6A 1QTNB 4EFAC 5B7WA 1EETA 5CYJA 3A8EA 2W8LA 1FD8A 4IDKA 3D68A 2VFSA 5ETMA 3FQLA 4DR1F 4LF8F 2RRNA 4GKJJ 1AUDA 5HK4A 4WKYA 1YTYA 2GGPA 4OI0A 4EGLA 1E6VB 2RF2A 3AH6A 2DXDA 1FK9A 5CZVA 2DHHA 4ENOA 3JSMB 3JSRA 1BUXA 4ANEA 2VDIA 3OQ2A 3SDEB 4WFBQ 1JLFA 1M5VC 2HMIB 2M2BA 1TKTB 3CDWA 3KLVA 4K0KF 1SPBP 3SV3A 1VJQA 4F0HA 1ZZNA 2YKMA 1YWXA 4ZP9A 1U1QA 3FVYA 3BKUA 2QA1A 1H0HB 4Y34A 2A0FB 1WEXA 1XC9A 3RRKA 4O4GB 1IJFB 1FDDA 1EHWA 2Q3PA 1KHWA 4RW4A 4HTJA 4USJC 3CIZA 2CNOB 2HWHA 5KT5A 4FS1A 1LKZA 3DGPA 4JB8B 2RT3A 2DGWA 1TAQA 5C42B 4X4PA 3KOAA 1UAWA 2DHSA 3GYGA 5FDLB 2VJUA 1NUEA 4G6VB 2CPDA 3PX0A 2IM0A 2MHEA 2RQKA 4DR2J 1XNQJ 3IRXB 4IFYA 3VAFA 5A2QY 1FE4A 3NS7B 2FVCA 2BJEA 1DLOA 3ZTSA 2EK1A 3TZXA 2MKJA 3GSDA 4ID5B 3MCNA 4OZ3A 3DDKA 2PE8A 3LWLA 1E6YB 2AYEA 1N6QB 3KUHA 3IFEA 3S01A 3U1MA 5E0OA 4CLKA 4FVMA 2IJRA 2YKOA 4LFCF 2FJDB 1ZAWA 2BW2A 2H5EA 3SQGA 2IVMA 2DRDA 1RCXB 2YH1A 1T8EA 4C3MA 1YJ7A 4X4TA 3MR2A 2E1RA 4UQTA 1S1TB 3A8IA 2EVZA 2DGUA 4FN5A 3J81j 4DR5F 1BGXT 4ZJOA 1B0PA 1Q5VA 4M5LA 4DFKA 1LV5A 2CPYA 1J5OA 3LOUA 3O6QA 2KHDA 5LSLA 3QZ8A 1C4CA 1F1BB 4ZLPA 4MIWA 4GO7X 3CC4S 3HVWA 2PFFB 2XMJA 3DGVA 3PJXA 1I5OB 2G2YA 2HRUA 1N5TA 4R0EA 4XPCA 2VPXB 2ZDPA 3GZ7A 3LF0A 2IM3A 1UPMB 1IKYA 2OPSA 3AAWB 4GMKA 2ZOMA 1KFDA 4DDFA 1XMOF 2XMVA 5ETOA 1APSA 2XSJA 2H5IB 4UOCA 1NH8A 5HMZA 3RB0A 4WF9Q 1HNIA 3FSXA 2QJ3A 3JQKA 4PUOA 4Q8FA 5A8KA 1S1UA 4TXSA 2E1PA 4JI8J 3VAKA 4BC7A 1PC4A 3D66A 2LKZA 4NA2A 2CPJA 4IQMA 4O4RA 2EEYA 2A3JA 4P6QA 3PRVA 2Y1JA 3VGTA 1MN9A 3F73A 1DQAA 2XS2A 2GA7A 1HBOA 5C2CA 2XWXA 3CT9A 1OQ3A 2MXYA 3ISND 3TVZA 2VL1A 4F04B 2YWFA 1NK9A 4JP8A 1NH7A 3Q89A 1PGZA 5DDPC 5HANA 1SL2A 2DH7A 2ZE2A 2XZWA 2HHPA 1HQEA 2BOPA 1FF2A 3A8JA 2VQEF 2ZH8A 2OTLS 1S6PB 1Y3KA 2QRRA 1S1XA 4CLPA 1B7FA 3J7ZT 4LMZA 1TVRA 4R5PB 4HI1A 2DXFA 3OHAA 3L09A 1VMBA 1LW2B 1YX2A 2CG8A 5D4PA 1M1GA 3AD7C 3VWSA 5HBMA 5IFMA 4J9QA 2IDLA 2B4VA 1TL7B 2YBVA 4QIGA 1N36J 5AE3A 1YI2S 5D0GA 1NSPA 3RB4A 1XR5A 5IQQA 2N4DA 4X62J 1VIOA 4CLUA 5EDWA 1X4BA 2CQHA 4ZN3A 2PD1A 1BLUA 2D7SA 3AODA 1U26A 4LRFA 2WK4A 4LVOP 4NRUA 4ZPTR 4B02A 2XC9A 4A8XA 4PRFA 3QAUA 1RABB 2FPHX 1PIEA 1X8DA 4ED8A 4F2RA 4IR1A 5H9EJ 1F2GA 2J9EA 2DHAA 4UT4A 4DQQA 3PX6A 1V5IB 2N7YA 1U25A 1HNZF 1SV5A 1IVZA 1UWBB 2DK2A 3LP2B 3NGRA 4F26A 3IGVA 3VZHA 3BJYA 3RAXA 2CQ0A 1LWCA 1H2VZ 5DLGA 3M9NB 1I1GA 2GC8A 4X84A 2BQ3A 4ZVOB 5D78A 4DR3J 1U02A 1UJ6A 4LF1A 3T41A 1C0UB 1H74A 2W9CA 2QFJA 4LBPA 1PAEX 1RA6A 2J9CA 4G3IA 3TAMA 3UN5A 3J80U 3LTOA 3JTNA 4OLOA 2M8DB 2XCPA 1G6BA 2VBZA 3G82A 2CQIA 2KRBA 5C24A 3VCDA 2UXCJ 4DZ6A 1JLQB 5JMNA 4IG3B 1FEHA 1AUSL 1RWOB 1GT8A 3G6YA 1IR0A 4AXIA 4UUWA 2ZH4A 3CDAA 5KFIA 1TU0B 1TL7A 3FKBA 4DL0C 4R8UB 1RLCL 3HJFA 1SVDA 3R5JB 1UMJA 4Q44A 4PG5A 3PHTA 1T9VA 2RU9A 4IDKB 1FKOA 4P2MA 3G71S 1YGYA 4PQAA 4QR2A 5J2PA 3I5CA 2DIUA 1OS5A 3PJWA 4ED3A 2CJYB 1P27B 1HKAA 1LK5A 1UFLA 1WOOA 5EGYA 1C0TA 2MLYA 2VB6A 4TVAB 2CJKA 1K0TA 4DR4F 2FJWA 2X1GA 2I0XA 2P6SA 3C6UA 4JI7J 1NJXA 3ILLA 4M5JA 1JX4A 1NPPA 2LA6A 3DHXA 2P2CB 3NP5A 2WVCA 3UO0A 3CD6S 4RUBA 3OPKA 4CLTA 5SZTA 4K4VA 2YWKA 1SL1A 1W2BR 5DM7Q 5T7LB 5ETSA 3ZZRA 1A6LA 1JMTA 3C6TA 4OYXA 3F0NA 1NCLA 2VU5A 3BS9A 2KT5A 2QLJB 2EWHA 5K20B 3KTQA 4IQXA 2A6MA 2JH3A 3SCIE 1CULB 3UW1A 3PKMA 5FJ4A 3C16A 4MT1A 1REGX 4AXJA 2ZZTA 4EMDA 7AT1B 4J9OA 1Q82T 4C8LA 1S1VA 1ZETA 2OTJS 3A12A 4OMFG 5K8OA 1DRZA 2RKIB 3JTOA 2PO4A 3D6FB 3F44A 3TVYA 2UUAF 2WVDA 1VCTA 4UF4A 3M8SA 3DRRA 1UP1A 4KHRA 2VJVA 1NU4A 2HHSA 4OHZA 1S0NA 4FF2A 1RSCA 1VHIA 2B0GA 3MPVA 5F8JA 3CTRA 1RU2A 2HFZA 2JVRA 4WFYA 3M6UA 3QGHA 4I1TA 4YS2A 4FKYA 3V4IA 2Z56B 5DZ6A 3POTB 4DR1J 3NXZA 1X4CA
chains in the Genus database with same CATH topology
2NS1B 3K8WA 2WONB 2ZH2A 3DFEA 2JLGA 1B0VA 4KC5A 2ZZNA 4CCHA 2FC8A 2GV1A 3AB2B 5CH7B 4NOHA 5KFVA 1FNXH 3V6DA 1HYSB 4KR0B 1ZM3A 3DLGB 4G1QB 3AA9A 4TYAA 4ICLB 2CPEA 2B4PA 3US5A 4Z2XA 5GMKa 4DV5F 4PG4A 3CCUS 3IBWA 1TVRB 4R5PA 2YKNA 2GMLA 3MMJA 1T3NA 4JI1F 4YQWA 2NLWA 1UJ4A 3KMSA 3IR7B 2Q43A 2QA4S 3N01A 2K1RB 3THPA 2R8JA 3PX4A 2RMLA 2OPQA 1N54B 2HQIA 4OJ1A 2GHWA 3F56A 4IKAA 2YTCA 1T7PA 3CCVS 4ECXA 1CC7A 2FB0A 2V8GA 5F3TA 2XMMA 3OVSA 1C1CA 5T7LA 5KFQA 1Q7LB 3DRXA 2GQCA 1QJHA 3H98A 2QZ8A 5CA5A 4EUVA 4WFNQ 3DU5A 2RF2B 1ZZFA 2EFPA 2ILZA 3J7YI 4IRKA 2MZQA 2VOPA 3LAMA 4YOEA 2CPHA 1N0VC 4C8KA 5EX3A 4YY3F 1TL5A 1C2PA 3LWMA 1RTDA 2YNGB 1QM9A 2V4JA 4F02A 4OHVA 2WB1D 4O3QA 5AJ3F 4DSFA 3H2UB 4DQPA 4ICLA 2JX2A 4DFMA 1DTQA 4A8MP 3NG8A 3C3LA 2WAQD 4IG0B 4KT0C 1Y5LB 4IG3A 3SXLA 1Z2ZA 2PIIA 5K14B 3T19A 1AFJA 5I3PA 4DG1A 2GO9A 4DS4A 2MZRA 3RR8A 3IO1A 3G9CA 2I1RA 3E2EA 1Q79A 1TK5A 3J7YU 2IFXA 5FIIA 4DX8H 5D4OA 4XK8C 4WKRA 3DOMA 4RUAA 4NRTA 1TL1B 4DV7F 4FNIA 1FRHA 1VLYA 4ZHRB 4HHJA 1FCAA 4ECSA 3B4MA 3H2LA 4NLVA 2FJXA 1OWXA 4WYWA 5A6PA 2PMZD 2CDQA 4ED0A 5J2QA 3L3CA 2G1DA 4ZVGA 1BQXA 1TR0A 1LWEA 4NWBA 2VG7A 1HL6A 5D3GB 4WE1A 4ED6A 1E6VA 3ZZUA 2M52A 3BQ1A 3SFUA 3M8QA 2DJWA 1T94A 3OUYB 3ZZOA 2AU0A 2PA8D 3SQGB 1FRLA 4JV1A 3WC2A 5LSOA 1F9FA 1S48A 2CJQA 2C42A 1KLMA 4IFVA 3K5NA 1TV6B 5JUMA 2W7OA 4B3MF 1VHFA 2E66A 1J5OB 2F1FA 2CQ2A 3THVA 3CDUA 2VZ9A 1N32F 2X1BA 2LEAA 1AXQA 2ERRA 3DM2B 5B0CA 5GAGI 2DR5A 3OR2A 1WI8A 4F8RA 2XB2D 2ZE2B 3HHKA 3KK2A 4WFAQ 1QSLA 3KLIB 4RUCA 3MPWA 1Q1KA 2DIVA 4FP9A 3E51A 4A8FA 1HW8A 4ZP6A 5BYQA 4UW2A 5E3CA 1VC6A 2NXUA 3LALA 5HQ8A 3UFCX 2AX1A 5L1LA 2RS8A 2RUGA 3OTDA 2V2KA 2W9AA 4ES2A 2XY7A 4LF6F 1FVQA 2ZITA 2HPUA 4RWXA 2CJAA 1XN9A 1YJNS 1U49A 4NZ7A 2FGCA 2A2CA 3AB4B 5IM0A 2DNYA 3UD3P 2XLKA 3HKWA 1K9MT 3DLKA 2E29A 2BM0A 1JKHA 2I38A 4CQ1A 4OIXA 2AJ0A 3FEYB 4LF4F 3MM6B 1M5HA 4Y0FA 5I42B 1LK7A 2MZJA 4OHYA 1FTRA 2V5HG 4NLDA 1YRXA 3KJVB 1B64A 5LSRA 3TVKA 4WFZA 1S72S 2VA2A 1S7HA 4J5OA 2J7KA 4TN2A 3U1NA 3MM8A 2GQ2A 2XI3A 2O67A 4ED5A 2CQPA 3G4SS 4F4XA 5LJ3Y 2HQ3A 1REVA 5KFMA 1YHQS 1RT5B 2M4MA 4OX6A 5HLFA 1S76D 1Q8IA 3AJ2A 4IH7A 2KHCA 4LJMA 2BANA 1D9AA 4WU3A 5KG2A 1Q16B 3LGMA 2BJDA 5DO2A 2GMHA 4IFYB 4N5SA 3OL7A 3MAHA 5B0FA 3H5SA 4LSLB 2GHVC 4F67A 4DFJA 1SKRA 3M1VB 4R8UA 1AW0A 2OMOA 4HLBA 2ATLA 3IS9B 3HHLB 3HVTA 2VPZB 1GXLA 2GO8A 4O4GA 5DDRC 3NGKA 1GNKA 3BR8A 2DRAA 2WCXA 1NZAA 1N33F 2LEPA 4ECVA 2ROEA 3SSQA 1TL3B 3FFIA 3IWLA 3J7A1 2C3MA 2OPPB 2BDPA 3MMBA 4L3NA 1CSJA 4ECUA 4B9MA 1ZM2A 3LAKA 5GADU 2AV5A 2DH8A 5KFDA 4I2PB 1XNRF 3BF4A 3DXBA 1QE1A 3KLFA 4MK9A 2J6TA 1TL1A 4BWMA 1H6KX 3NAHA 3M6WA 4ECZA 2ILYA 2XS5A 1SH2A 3RAMA 3PVXA 4C8YA 4H4OA 3CJ0A 4F3OA 1RTHA 2JOQA 4QIEA 2LA4A 1HI0P 2HWIA 2KG1A 2UVUA 5CCLA 4Y2IA 1HA1A 1NHUA 2CQBA 2ZC4A 1S0OA 1IKWA 2PT0A 4FYDA 3CCLS 3G6XA 2UUWA 4ZOSA 4ATNA 1FKPB 4PXEA 5CYMA 4QR0A 1KFSA 2K8GA 1Q53A 2MKHA 5F3ZA 1HWUA 3CPWR 4A8WA 4YB7A 2ADBA 2MMYA 1X4HA 1FXRA 1HWIA 5J1EA 1SB6A 1VIXA 5AXNA 5SUHA 2HNYA 3J80Y 1RKIA 1RTHB 3TUJC 3UNGC 3OL6A 3DLJA 4HI2A 3FDSA 2IJNA 2NYIA 4QYZJ 1W2IA 2BA9A 3HT3A 3JSBA 1R8AA 2DT9A 5KT7A 3B8HA 4HEA9 4C98A 3GIMA 2RRAA 2LU1A 2VUGA 3D0GE 5KFPA 3P96A 1LWFB 1RT4B 3Q22A 3QYYA 3DOKA 3Q0AA 4TU7A 2MKIA 3HMJG 1IBMF 2DNOA 2BE2A 5L9XA 2ROPA 5K8MA 4H54A 2C22A 4OI4A 2K3IA 4AYBD 5KOWA 1D8YA 3SDEA 2RDIA 3TYTA 1S49A 2EG2A 1T3OA 3BM7A 4Y28C 5KG3A 2R7WA 1TKZB 4A48A 1N5VA 3U7JA 3ZZYA 1FTCA 4CH1A 1VS3A 2KYXA 2RH3A 3BGRA 2WOMA 2AWZA 3I0SB 3KG0A 4KB7A 4PPDA 4JI8F 1ZTTA 2UUCF 1Y3JA 3BSOA 2Z4PA 3GB0A 4OZNA 2R4FA 1RT2A 4ZCIA 4ALZA 1DHMA 1N6QA 4MIBA 4B3OB 5B0AA 2MKCA 5B0BA 2KFNA 2J6UA 4PKDB 3W7BA 3M2VB 3MM6A 3RB3A 1ELOA 2HWTA 4NA1A 4NZ0A 4Q5VA 4QW9A 2MY7A 1JXLA 4IFVB 4WXWA 2XCAA 4F3MA 2WOMB 2CQ3A 2R7QA 4CO2A 5DM6Q 2ZBCA 3KLGA 2JWNA 4NZ6A 4AQYF 2QMWA 3H40A 2AW0A 2DNLA 1Y4ZB 2ZUGA 5KFXA 3IA0A 2MPUA 3LP1B 2DR9A 1X9MA 1B0TA 2W4PA 4HDGA 1HPZB 3DOLA 1PSDA 1GXUA 4HH0A 5B0EA 3HHLC 2W9CB 1F5BA 5A8KB 3CCWA 2OLWA 2DH9A 3PEHA 3I96A 4U7UK 5L38A 1F0XA 1JLGB 1SC6A 1HWKA 3DOKB 1MNEA 4OL8A 3PW7A 2CPIA 5KFRA 2R9LA 2UVWA 2UV8G 3RRGA 2MQLA 2XSFA 3MWBA 3N4WA 2GQQA 3V6HA 3CDEA 4JI3F 1IM4A 2EFOA 4M94A 3PFOA 5J1PA 5IS2A 3PRDA 2WTFA 3FJ2A 3PW0A 3HM9A 3FSIA 1WHXA 1RTIB 2HGLA 5H1SV 3KWMA 3S1TA 2LLZA 1TQLA 3IN5A 1FESA 4RNHA 1TKDA 2IMWP 3MM5A 3NCRA 4O44B 2R2TA 2DVIA 2UXBF 1E6YA 2WB4A 3SMZA 4CO5A 4KFBA 4TKTA 1HNVB 3J81Y 1VBZA 2KT2A 3GQCA 2B5JB 2O01C 5KFUA 1HNWF 2MQMA 1SI9A 2BVZA 1Q8BA 1X7VA 5E5NA 2FLNA 3M2RB 3FNNA 4YHHF 1MMDA 2DNKA 1Y5NB 3OTCA 3ETOA 2B51A 5L8RC 2RU3A 5L1JA 1ZM4A 1R43A 2LQJA 1N5YA 2B7BB 4J9LA 4OI6A 2VD3A 4CI0B 4M5DA 2HNDB 1LXNA 3M8PB 3C46A 4PWUA 1S9GB 4J9NA 1M5PC 2VODA 3O5TB 4WZMA 1HD1A 2AX0A 4LT6A 2XO7A 4FXVA 3I32A 4ES1A 2EPIA 1UEUA 2M3DA 4QOTA 4U7CA 2V4RA 4F4KA 3LP0A 2EFQA 4RNNA 3SZ2A 1NO8A 3GR1A 3ISZA 3NAIA 3RZAA 3CD7A 1M1KT 2F9JA 4FZVA 1AFIA 1XWLA 1LW0B 5AXKA 5I3QA 1XERA 2DGTA 3MM7B 4IRCA 1S6UA 2GW8A 3ICLA 3IS9A 3QIPA 3KNAA 4M5DB 5B08A 1X9SA 2Q1LA 2R7VA 3MM9A 2IJFA 3BSCA 5HP1B 5KAKA 5M2PA 3HF5A 4RBTA 1P8GA 2CQDA 1KRPA 2EBGA 3KK1A 1WWHA 4P7TA 4OI3A 1LFPA 1DTTB 2KXHA 1RK8A 2YKAA 4F50A 2FJBB 2YVSA 2MQPA 2DPIA 5BYSA 3EXCX 3G86A 4MYUA 2WHOA 2HS3A 3K7RA 1FKOB 4QIFA 5KFYA 3PO5A 5FD1A 3DRPA 2JC1A 4OZ1A 2KZZA 1Y00A 2A1BA 5DJBA 1LOUA 1RT3B 2O66A 4DJBA 3UE2A 1UVMA 1TAUA 2APOA 3MOJB 5JJBA 3MUVP 3KKFA 2YNHA 3LQVA 3CJ5A 4QBUA 5A8WA 2DITA 2MGZB 1I94F 3TI0A 3IRXA 5E2QA 4JI5F 3L7PA 2B3TB 2VASA 2WBRA 4DV2F 3SV4A 3PV8A 3V4IB 5CHCB 3R5CA 2OSQA 4MTPA 1NJYA 2EFVA 2R8KA 2J76E 5DRKA 4B9LA 1HNIB 3DLKB 3GYXB 4CZCA 4DV4F 2KXFA 3QIPB 4H4KC 5GAEU 1NKBA 4NPOA 1BQNB 2UZAA 3I87A 4KHPF 5DS7A 1JJHA 1DZ5A 3THTA 2FY1A 2D9OA 3K0JA 2GMJA 1QUVA 1FJCA 4Y00A 4OI1A 4ED1A 4KV8B 2ZJRQ 4F4WA 3LP1A 5KT2A 4JI4F 3QGPA 4JOUA 2VV5A 2NSCA 5IZHA 4QU6A 3NNAA 4UY8T 3RYLA 4Q2MA 2UUTA 2RQ4A 1UJ5A 1P9QC 1MWYA 2AJ4A 3HVAA 3MFIA 1TP7A 1X4EA 2CFXA 4DFPA 2A10A 4HT5A 2F40A 5GVQA 5J2NA 2VG6A 1SJ4P 3IG1B 2LYVA 1WTFA 5F8GA 5KFHA 2XY6A 2XS7A 2FLOA 4TY8A 1DQ9A 4NCBA 2QSFA 2KH9A 5F8LA 1HD0A 1BWEA 5J1NA 4YB1P 3JSYA 3TAPA 5HROB 5KFJA 2DHGA 1RT7B 5AE1A 2YKQA 3BDPA 2IVYA 4KKOB 4GO5X 1BQMA 3NBPA 4MFBB 3CB4A 3GFHA 5DQGA 1XR6A 2KM8C 5KG6A 4M95A 4FS2A 3MR6A 3M6XA 3OJUA 4WK1A 3RW7A 3N6NA 4H4MA 5F8HA 3VF0B 4C0HA 1U1RA 2BR0A 2FUG9 5KFKA 1SJ3P 2HVHA 1TL3A 3FFIB 4OZLA 3GILA 3MMBB 4LIRA 2YKMB 1C1BA 3FEZA 1RQ0A 3MUTP 2PA3A 3T5KA 3MMCB 3DDNA 4QWAA 3MF5A 2JEJA 2BV3A 3KLEB 2R2SA 5MLCV 1A7GE 3M8RA 4DN0A 4BWJA 4Q0BA 3TUZC 7FD1A 1MMLA 4TLQA 2ZH7A 2CZ4A 3DU6A 3IWNC 2LQ9A 1CLFA 4KHMA 1URRA 4FPRA 4F3QA 4B9TA 3TUIC 1O5JA 4YDDB 2EG1A 4QR1A 2B4OA 3BDEA 3FEXB 5EUHA 1RGVA 3JYTA 3GE9A 2DGQA 3UPFA 4C0OC 3TR5A 2E9ZA 1TFYA 4OV1A 5AXLA 5KFBA 5J1EB 1URNA 1CC8A 4YDXA 2VBYA 2DGXA 5HLFB 2OD6A 3DM2A 4PQUB 2DGSA 1VRUB 5J2NB 5EX0A 1J5EF 4I68A 1K8AT 2CQ4A 2MQNA 4DV3F 2DR8A 1RTIA 3HX9A 2E9RX 3OR1B 4OQJA 5GAEI 3QLHB 5KFNA 1LXJA 3KK1B 3QGGA 3DC2A 2ACYA 5CYJA 1LWEB 1DTTA 1TUVA 2CPXA 3M32B 3MD1A 5I42A 1FVSA 2YNGA 4K5SA 5A6WA 5KFOA 2FHKA 2A2DA 2MKSA 3LPYA 1Y0HA 2VKZG 1HQUA 3VAGA 4A8QA 1VQ8S 4NLWA 3VQTA 1WEZA 3H25A 4RBVA 3G6VA 1T02A 1UA1A 2W7PA 1QLNA 2VPWB 1O0PA 3MXHP 3GV7B 5HN0A 1JLAA 2K7JA 3CC7S 3HHLD 4NLRA 2NZ4A 4ZA1A 5G0RA 2BZ2A 5LXYA 2IC3A 3HVRA 4X62F 3TRGA 2W4CA 5KFZA 2A18A 3OJSA 1C1BB 4DL3A 3TANA 2KVIA 1X0PA 1HI1A 3HO1A 1M5SA 2E1CA 2JC0A 3UR0A 3I55S 3MR5A 2U2FA 3K5MA 1S0MA 4B9UA 3T3FA 3I4HX 1T05A 2VQFF 4O3RA 2R7RA 4OZJA 1U2RA 1P6TA 4KE5A 2OKQA 3CD5A 3M6VA 2N3OA 1JJ2R 2GIRA 4I7FA 4NXMF 4B3RF 2ZM6F 2V4JB 4IO1A 3UR3C 5AXMA 2M70A 3T6BA 2RQCA 2LCWA 3SCKE 2AYMA 2MB0B 3HK2A 2DNPA 2LDIA 4X4UA 4G1PA 1FERA 3M8QB 2BABA 2CPZA 3M30B 3MDFA 1L3TA 2J0XA 2Z0GA 2YNFA 3SYZA 2DGOA 1HBOB 1R3NA 2ASYA 2RQMA 4QZVB 4X4QA 1MSWD 4USIA 4EO6A 1H2UX 2MDAA 3MEEB 1KQSR 1QVGR 4IH6A 1FE0A 2PN6A 3M2UA 5KFSA 4WU2A 2ZH5A 4GC7A 4ILMA 3SSSA 5KT4A 3Q8RB 4DSIA 3FMWA 1SIZA 5F8IA 3RTVA 1D0EA 2KN4A 2HFOA 4I0WA 4N41A 2AD9A 1YQHA 2F8HA 1JJ4A 4YB6A 5GAHU 2C2RA 4I69A 1Q8LA 3ONQA 4J9SA 2O1PA 4CH0S 5LL6d 4AL7A 4YP3A 3KNGA 1RWUA 3AQOA 2YX4A 2RD5C 2D3ZA 3OTBA 1IKXB 4NLGA 4EBDA 1YG0A 4X2BA 2RIJA 3EZUA 4DHVA 4KFBB 4MKAA 1YJRA 3OFGA 4C3LA 5E7OB 3M1VA 4UUXA 3GG1A 3CC2S 3MPYA 5DGAA 1VJWA <