3OFHA

Structured domain of mus musculus mesd
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
b'MTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LDLR chaperone MESD
molecule tags Chaperone
source organism Mus musculus
publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
total genus 22
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ofhA00
1ZPVA 3ENQA 4GO5X 1UJ4A 1YGYA 1UJ6A 3AB2B 1O8BA 3ENWA 4LUBA 4M8LA 3TUIC 2F8MA 2FGCA 3DHWC 1RWUA 1SC6A 1Y7PA 5IT0A 5T41A 3OBIA 3TUZC 4PWUA 3U7JA 5IS2A 2QMWA 2MDAA 3MTJA 3K5PA 2P9GA 2QSWA 2LQJA 5JJBA 3DDNA 3DC2A 2J0XA 1LK7A 3N0VA 3MWBA 4GMKA 3LOUA 5FIIA 1M0SA 2H9ZA 2J0WA 2JOQA 1U8SA 3ENVA 2RQMA 3O1LA 1XTZA 4GO7X 2QMXA 3NRBA 4IO1A 3AAWB 3MAHA 2F1FA 2DT9A 3OFEA 3AB4B 3UW1A 1KS2A 2QRRA 2CDQA 2PA3A 3S1TA 1LKZA 3CEDA 3OFFA 2RE1A 3KWMA 1LK5A 5IT4A 2RQKA 3OFGA 3IXQA 3P96A 3L7OA 2P9EA 2P9CA 3TUJC 3IBWA 3W7BA 2KO1A 3LUYA 3DHXA 3HHEA 2I9SA 2JHEA 1UJ5A 2ZHOA 4X84A 1YBAA 1PSDA 2NYIA 3OFHA 4NMLA 2PC6A 2LVWA 2DTJA
chains in the Genus database with same CATH superfamily
2ASDA 2ASYA 3PEHA 4OYAA 1PAEX 4HHHA 1Y0HA 3ZTQA 4LF6J 1Y9OA 4WK3A 2EFQA 3J80Y 5MAOA 3AJ1A 1ACMB 3M6WA 1O8BA 3M1VA 4LUBA 5LMUJ 1IBMF 3MM5A 3DLKA 1GQEA 3MM7B 3NG8A 3NKYA 3CJRA 2K7JA 1LNQA 4DPYA 3GE9A 2IA6A 2Q6BA 4TXSA 3EXCX 3LAKA 4ZHRA 3TZYA 5KFBA 1HIYA 5CYMA 5LJ3Y 1NZ8A 4OZ0A 4DL4A 1RJJA 3OBIA 5KG5A 5IWAF 3DYAB 4QWCA 4GKKJ 4IFYA 1RLCL 3R6GB 1MWZA 2RS2A 5JUMA 3DI6B 1Q8LA 2ILZA 4DUYF 4CTAA 2RDIA 2CQPA 2ZH8A 1IKWB 3DDNA 2XYHB 3P4UB 3QGPA 1JJ2R 2IPOB 3OTEA 1S79A 3F56A 3NGRA 4P2MA 4EGLA 1JLAA 1BUXA 2W4DA 3FUYA 1YBTA 2YKPA 3M8PB 4KIAA 4QIWD 2K3IA 4ED4A 1U47A 1CBKA 2D3OR 2UP1A 4BDPA 2CNOB 3V4IB 5CAAA 4DQRA 5KFAA 1PAUB 1M0SA 1V3RA 3OW2R 4DR2F 3FBBA 2XLJA 2P8IA 3MPUB 3V81B 2W8KA 4P52A 3UDLA 4PPZA 1U2FA 3JS9A 3MR7A 3MDFA 3W5YA 5HAOA 2HG4A 2WSFC 3PR4A 4FKXA 4G1QA 3I56S 2BXJA 2FC9A 4E2FB 4YR3A 2AGPA 1S76D 2JJ4D 1EIYB 5HMYA 2DNYA 1FWLA 2RD5C 3T5HA 4DN0A 2HLTA 1RKIA 1MWQA 2DD8S 2EXUA 3R7SB 2R7OA 4NLOA 1VRUA 2NZCA 3M6VA 1FKOA 2C3PA 3N4WA 3QT5A 1A0OB 4A8WA 2CDQA 1AT1B 3E3XA 2OPPB 2O67A 2E5GA 4O44B 4WP3A 3TAQA 1Z4UA 1RT3B 2WSEC 1RTHB 4CH0S 4X4OA 1IKVB 3S1TA 3W65A 4DCPB 1S9FA 5DRKA 1H2VZ 3OHBA 1UEKA 3CULA 2F9DA 2MQ8A 1UETA 4ZPBA 1RABB 4OHWA 4DL0C 3IBCB 4C3MA 4J9MA 1MLAA 2EPIA 1WF0A 2JVOA 3OFFA 3PRBA 2W8LA 1QSSA 3GLJA 5K9FA 2I6WA 4CLSA 1FXLA 5C25A 1LK5A 5IZHA 1GNKA 5LOQA 1XMBA 2OH2A 1F9HA 4AL5A 3R3TA 2VBWA 4N41A 4K4SA 2PMHA 1X4AA 3TO8A 3A12A 3ILIA 5K14A 5F8MA 2R9LA 2YNHA 3GZ7A 1SQEA 3ZZTA 2BE9B 1LWCA 2IBKA 1RQ0A 4F4XA 2GVZA 2YNHB 5D0HA 1Q8KA 5A0YB 2XMWA 3CD7A 3HVAA 4ZMMA 1UKUA 3LGNA 3KUHA 2N3OA 1SV5A 5D3GB 2QL7B 2WVBA 3B6BA 1W2BR 1PIEA 3PJ9A 4DV0J 2DNLA 3OSNA 1HWIA 2FY8A 3P49B 1T94A 2RB7A 4KHRA 3QWPA 5ETKA 5IFMA 1VR6A 4NCGA 3AJDA 1BQMA 3OPKA 1RKJA 3DOMA 3G86A 4OZ1A 4PKDB 4F67A 1YRUA 3IBFB 4WP9A 4RNNA 1LW2B 1NJYA 1VFJA 4UUXA 1VQ8S 1FNMA 3Q22A 5CA5A 1FRXA 1KKHA 3H2VE 4LRCA 2DHSA 3QT6A 4Y34A 3VGVA 1S6QA 2DR8A 1LFWA 1KTVA 3AQOA 1B99A 2MZTA 4Z37A 1DQ9A 4CO5A 4LR9A 5I3QA 2CJYB 1ZAWA 2Y1RI 3JSYA 5KT7A 2J9DA 3V6KA 1ZPVA 4O23A 3CO0P 4CO2A 2D7SA 2GVDB 1V3SA 4W98A 2WBRA 4OI3A 1PBUA 4A46A 4DQPA 1HNVA 3AB2B 1HHTP 4WPAA 1S1XA 4RBUA 1NUEA 1E6VB 1PYSB 2XSJA 2EEYA 3KDOA 4OMFG 3K2YA 5H9EJ 1H2UX 3MI7X 4OI2A 1EJ7L 1P6TA 5CCMA 4A8OA 5CQGA 3HK2A 1WOSA 3BF4A 2J0SD 4JI8J 1YI2S 2C2NA 2OPRA 2G0IA 1QAJA 1QLNA 3QO9A 2MDAA 4IOAQ 1CG2A 3RB0A 1FE4A 2ZZNA 1BQNA 1IM4A 2RRBA 2BM1A 1RK8A 2CQ3A 2GHVC 3L09A 1JJCB 2HAFA 2NS1B 1TUGB 4DLGA 3HT0A 4PABA 2W7PA 3JQMA 4BHQA 5LT5A 3UN3A 2LYVA 2AW0A 4Y2IA 3BH7B 3PYDA 4GMKA 4B3TJ 4B3MF 2P6SA 2V5HG 5G4DA 3TJAA 1B4SA 5EWEA 2HIYA 4OZNA 4WIQA 3KLIA 3T1HJ 5C2GA 1X9SA 4ES1A 2W25A 2DGOA 2OIHA 3CDWA 1Y5NB 2HIQA 3I5AA 5KFVA 3NMRA 1S1VB 2FZKB 5HQLA 4DCJB 4GC7A 1A6LA 5CYMB 1T9YA 2B4OA 3IMQJ 3QLHB 2E5LF 4JI5F 1U8WA 1OY6A 2LKZA 2RF2A 1VCTA 3Q2SC 3SEOA 3PR5B 2ZH1A 1RHJB 1N5QA 2MMYA 3IRXB 3D6MB 1HQUA 4N8OA 4TU7A 2ZH7A 1U1OA 2R2SA 1JXLA 4FF4A 2BACA 4ZN3A 4DR6J 4OYIA 3MR2A 1HKAA 4AQYJ 1N36F 4ERDA 2VH7A 5K8OA 4Y6IA 2I5JB 1V5IB 2HGNA 3FZBA 1JLCA 4N7TA 1FT8A 2AYBA 4BCAA 1FRKA 1UL3A 2K2PA 1JLCB 9RUBA 2UUWA 3DU5A 1QM9A 3VWSA 2NPIA 4WXWA 2ATCB 4NXMF 3J80U 1FJGF 3OR1B 4PQUB 4O3SA 3ICLA 5FJ4A 2NXCA 3OJSA 5LXRA 1CEZA 1DURA 3K5OA 4TN2A 3VZIA 3G2XA 3M1VB 2ZJQQ 1GEHA 2VHGA 4O4RA 3EGZA 4PQUA 1EQMA 2R7WA 1NPPA 3VAKA 3PCOB 2FJXA 4K4UA 2QGFB 1EB0A 2YX7A 3PHEA 4Y2MA 2BBEA 3I0RB 3W64A 3GMGA 3SQGB 4ZKAA 4WJBA 5C5JA 2M70A 4X66F 1S1VA 4HI1A 5A8RB 3C6TB 3POTA 5D77A 1NHUA 3CJ0A 4PPDA 4MT1A 4AXIA 2J9EA 2FGOA 1S12A 4RUAA 3HM9A 1C4AA 1FI4A 4C2MA 5HQ8A 4OHZA 2VPXB 2OEMA 2WB4A 3O44A 1XC9A 2ZWOA 1D9AA 3J7AN 2XWYA 3CCES 4LFAJ 3N28A 2HNYB 1HNWJ 3C6UB 5B09A 3LUYA 3JYTA 4DSIA 3HHEA 2JSXA 1WHWA 4ZVFA 2ZM6F 3GYGA 3CD6S 3HKWA 2KI2A 1GXTA 3Q8QB 4FVCA 4WU3A 1TUVA 3VF0B 1J27A 3S7RA 3V81A 1R8HA 4ED3A 3I0RA 2IC3A 2BOAA 5A6PA 1SKUB 2DNOA 3LP2A 3R5DA 2VFSA 4NOHA 2HQIA 3RW7A 3GWCA 1T9XA 3PJXA 1YIJS 4FF3A 4B3TF 1T95A 4ZA1A 3THPA 2V4RA 2K06A 4CWBA 1UJ4A 2R2RA 1S0OA 1WHXA 3DOLA 4QQBA 5CCLA 3DKDA 3MEDB 4YFUA 1ZS6A 2IJRA 5A8KA 2OSRA 4LF7F 3MOJB 2AJQA 3W5ZA 2HHHF 4ENOA 4DR3F 3LAMA 2HPUA 3TEHB 3WBZA 2QTWA 4ED0A 1HWJA 1QSLA 2LLZA 2IJFA 3DGPA 1U1LA 4KHPF 2ERRA 3D1OA 1N48A 5I3UA 1U4BA 2MLZA 2PD1A 5DLFA 1DY3A 2E1RA 1P27B 2HQ3A 1MROB 2MKSA 2VG6A 4ZJOA 2AGOA 2XZWA 4ICLA 4RW6B 4YMEA 3RBDA 3CCQS 1VQ9S 1HBMB 4K2JA 2OI2A 2KU7A 2YKNB 4A4JA 1LEOA 3HHLD 4CH1A 3JXOA 5D0RA 1L5UA 2MKCA 2HS0A 1NK8A 3RU0A 1WEXA 4N5SA 3CDBA 1HHQA 1HL6A 5B0EA 3TOQA 4CYUB 2B0GA 4WZMA 2MXYA 1NEEA 5DQIA 2H5EA 5IV4A 2GX8A 3AT1B 2YKOA 2NQPA 2AYMA 5B0FA 5FLXY 5J2QA 4WE1B 2KT5A 4ZOSA 1XNRJ 1WTFA 2JNJA 4K4WA 5E3PA 1RTJA 4R8UB 3KMSA 3V6HA 1T8EA 1IBLJ 4WIIA 4DPOA 2VC0A 2QLBB 2LXIA 4QOTA 2K1RA 2MQLA 3CJ4A 3SFGA 2DO0A 4DV2J 1E6YA 2ZVIA 2X1FA 3SYZA 4WWSA 3KLHA 2UUTA 2LFVA 4RUCA 3P8BB 4DQQA 5EWFA 3I5CA 2ASJA 3ADAC 3KLVA 3DLJA 2OPPA 2HK2A 4RR5A 3V6JA 1VOMA 1K9MT 1SBRA 1IKXB 2CQBA 1H72C 4R0EA 3TZXA 4Q44A 4LF8F 1L3KA 3H90A 2IM2A 3KLIB 2DKOB 5JXSA 2CJBA 4YOEA 4OJ3A 2RQCA 1TK8A 2OPRB 4RW4A 2OD6A 2F65A 2DHHA 3ZNUA 3OJUA 3EVMA 3QRQA 3MD1A 2RUGA 1ZA2B 4M94A 1I5OB 2MZRA 1WC6A 2GIRA 3HP6A 1RT5A 1REVB 2DXDA 4OZ5A 1Q5YA 4J9PA 4FYWB 2LU1A 2DR9A 4FXDA 1YJVA 5FDLB 4QYZJ 1RBLA 2DITA 2P9EA 2N4CA 3D66A 3DDIA 3HHKA 3HZEA 3LTOA 2YNFB 2MZQA 1GMVA 5LL6d 1S1UB 2D3ZA 2XO7A 4QIEA 1EZZB 4KGXB 4FS1A 4RX6A 1DTTA 3PACA 2L41A 4JI1J 1KOOA 4DR1F 4DX6A 2LP4A 1FVQA 2CRLA 1S0MA 2R7QA 1XR6A 4I68A 4NLDA 2APOA 2CJ9A 2GCFA 5A76A 1WG1A 5A0YA 3CUNA 4NA3A 7AT1B 1PC4A 3MHYA 4F02A 3RG6A 1RHRB 1M1GA 2YXLA 3NLCA 1MW7A 5HP1B 2W01A 5EUHA 1RE1B 2GVDA 1IR2A 3EZ5A 1FDDA 2N4DA 3ONQA 1RB0A 4B3SF 4I0WA 1WWHA 1GXUA 3QJJA 2FC8A 2DO4A 3DOMB 3QIDA 4UF4A 4MIBA 5DDPC 4BWMA 3D9BA 3EXYA 3FSIA 3Q0AA 3BQ2A 1TVRA 2BJ7A 2OFGX 2V50A 4K50A 3GTYX 2YH1A 2UXDJ 1CLFA 1TL1B 1LW0A 1NHKL 2WHOA 3ILLA 3C6TA 1FX2A 1FRJA 1YDLA 3POTB 2M52A 4LVOP 4ZCLA 1OY8A 1TMMA 2H48B 3VVUA 1N0UA 2O3DA 3UN5A 2Z2MA 3ELHA 4K4XA 1HD0A 3N6MA 3HKZD 3EX7B 1E6YB 4PQAA 2KFZA 1FK9A 1OIAA 2MJNA 2HLUA 2RU3A 3CMAS 3MECA 3N9UC 3GIJA 4B9UA 4ZVHA 4DV4F 3CJQA 3PFOA 1KVKA 1TL5A 1HNVB 4FN5A 4DU8A 3EPGA 3K5LA 2W2OP 4NYPA 2Y0SD 1QAIA 2HRTA 2FLPA 1K8AT 3CW2C 3LH2S 2B9XA 1JQGA 1NDCA 1N5TA 3TQ1A 1CQMA 2LQ8A 4DG1A 1VBKA 2VDIA 5CD4H 3K5PA 4KTQA 3CMES 3OR2B 2JFKA 5JJBA 3H25A 2QZ8A 2H4WB 2R8IA 3QJPA 4ETZA 1B64A 3WX8A 5K8MA 4LF1A 3KLGA 2HNZA 3LGMA 3OXLA 3G6ES 4XPEA 3PW0A 3GONA 3QIPB 2G2YA 1NJWA 1S4EA 2LECA 3IM9A 3E01A 3LOUA 1O6XA 2V4JB 4P10A 1TVRB 1S1UA 2AKWB 4I2PA 1EAYC 5JVGQ 1RU2A 3G8SA 1S7IA 1EX8A 3BEGB 1N34J 4IR1A 1KP6A 4ZK7M 2RIJA 4X4VA 4FKYA 1QE1A 2CUYA 4DF4A 1CULB 5IWAJ 1J5EJ 1FKOB 4PYDA 2FVRA 1FKPB 1X4FA 1SH2A 4WK1A 2E5LJ 4JI5J 2Q6CA 3IGNA 4Q7AA 5CYQB 2HURA 3BYRA 4IG0A 4DPWA 2HHTA 4A8KA 1TKXB 1C0TB 2B6AA 3I6PA 3H59A 2BKOA 5F9NA 3OTCA 2N3LA 4LSZB 4DL2A 4RU2A 1G1XA 1FHTA 5AJ3J 5J1PA 3MEDA 1MU2A 1YBUA 2AEJA 3I5BA 2EFVA 3VAMA 2AGQA 1X60A 2DRDA 1R89A 3D0GE 5KG6A 1TK0A 3BV8A 1KC8T 3H5XA 5IT9U 4YR0A 1R27B 2F4FA 4IFVA 3GSDA 4DV4J 4USKA 2UZAA 1JLGB 1WD6A 2WVFA 4PZVA 1LV5A 2MJUA 2E7XA 5GAGI 2LDIA 3KHHA 1HNZJ 1XR5A 2U2FA 4OI0A 1N34F 3HVTA 4W90B 4ZVGA 3US5A 4ZCKA 4XK8C 4QWEA 3R5CA 1UVMA 2H1YA 1SCJB 2M88A 2MLXA 4OFZA 4PXEA 4JI3J 4LRBA 5I3PA 4URGA 5IT4A 4KGKA 1CJVB 4L3KA 4RNMA 3CCJS 1R31A 2V2QA 2J7UA 2OELA 2W7OA 4KPCA 4DSFA 3TP2A 1CS4A 4IFYB 3ZXWA 2MKKA 2UVWA 1I51B 3HSJA 5HVGA 5GMKa 3NL0A 4NRUA 2IC3B 2H65B 4FDFA 4H4OB 5CABA 1FFSB 4M5DA 2EBEA 1BWEA 1GT8A 3QT8A 1RHMB 4KGZB 4QR2A 4PR6A 4ZLLA 2VFRA 3W61A 5JMNA 4F4WA 1VQLS 4I2PB 2B4VA 1DARA 1SIWB 1TL7A 3V4IA 1DHMA 3C6UA 5KFXA 2BW2A 3V2UC 1WELA 2F63A 2NREA 4O3RA 3WQPA 3EVWA 2CQ4A 1VIXA 2J9DE 3PW7A 2VL1A 4DEZA 3NGSA 4QZVB 2KVIA 1R8AA 5BXIA 2GA7A 3RAXA 4KJIA 4BLGA 3SDEB 4KHMA 2QN6B 1VYAA 3TZZA 4ZVRB 7FD1A 1CJKA 1F9FA 4NPOA 4A8FA 1BWVA 2ZBPA 2M5YA 4X4NA 3ZZPA 4K59A 1B3TA 2XG8A 2FHJA 1H2TZ 4W4MA 1KDNA 1AUDA 3GPAA 1YSJA 3VZHA 2FVSA 1Q7YT 3OTDA 2E1PA 3P5BP 1XWLA 1NKCA 4NXNF 3D3BJ 1YHQS 2O5DA 4Y3CA 2WW4A 2ACMA 2JLFA 1C0UA 1FTRA 2FJAB 3HF5A 3BDEA 4I2QA 4L76A 4V1Ak 5T41A 1U49A 3N5FA 4IRDA 4U7UD 1TFWA 4WFZA 3CDEA 2QMWA 3MTJA 4HH0A 4P7TA 4JI2J 5L38A 1RT7B 1KOHA 3G71S 1TTHB 4URSA 2HFSA 3WIVA 4QU7A 1RT2B 3FCHA 1DRZA 1F2HA 2WK4A 5C7PA 2ZOFA 3QNWB 4M5HA 1XMOF 1TK5A 2MKHA 3PDNA 1X8DA 1T0TV 2MTLA 3FFIA 4JBCA 5D4OA 5CXTA 4LF8J 3ILOA 1Z1ZA 2H9ZA 3BN7A 3RAQA 3G96A 5F3ZA 5GAHI 1HA1A 3HHLC 1S1XB 4GO7X 2BX6A 4AL6A 5ETRA 2G0CA 2Z2ZA 2G2ZA 3KXDA 1S6OA 5IXUA 3U02A 2HNDB 4RZRA 1J5OA 4DV1F 3IFEA 4CO1A 4CLZA 3OUYA 3NOGA 1WC1A 2CZVC 1IQZA 4NLRA 3KHGA 3OFEA 1CPZA 2VKZG 1RTJB 3ILJA 2B5JA 2DR7A 4I6AA 1RT5B 3SV4A 3OT9A 1Y5IB 2XY7A 1C1CA 2YH0A 4GRSA 1T9UA 4C7QA 4K4ZA 1VBXA 2E1CA 2EW9A 1VK8A 4CH7A 2ZZTA 3JTNA 3LF0A 1K1QA 1M1KT 5KFIA 2W4CA 3KLEA 3SCIE 2MB0B 1FRLA 2FZGB 2IIHA 3CJKA 8RUCA 4P74A 4ZP7A 2HQGA 3HSGA 4HTJA 4ANCA 3MR3A 3VAFA 3HPOA 1RTDA 3QAEA 1GK8A 1MG7A 3HX9A 1BC6A 2KM8C 3RW6A 2PSZA 3M6XA 4RW9A 3SQGA 4CNYA 4YB6A 3PIOQ 4UZBA 1XR7A 3AODA 4P71A 1BE4A 1WDDA 1HW8A 3VAIA 3JTOA 1W2IA 2RE1A 3OR2A 1TKZB 4OYMA 5DZ6A 1P9QC 5ETSA 4YR2A 4J9LA 4USTA 5D0GA 4DV5J 3UVJA 2CQ1A 2HQDA 4HT5A 4PG8A 3HFKA 5CD4A 2E5IA 4RUHA 5KFEA 1JNRB 2BW7A 3I4PA 2V34A 5D8HB 1HWLA 3M8SA 2DGXA 1WC5A 1T9VA 3FEZA 2X7IA 3DLEA 2MKIA 5AJ3F 3LWMA 3TUJC 4DQSA 4DV3J 5LMUF 1XN9A 1W26A 4LF4J 4NEZA 3CVKA 4F4KA 1UMJA 2HHHJ 2OPSB 1FK9B 2DNMA 2V9KA 4WTYA 3MR6A 3VAHA 4Q8EA 4B3OB 1Q86T 2V94A 2WOMA 4OHXA 1YK9A 3X1LB 2GGPA 2Z2YB 1SKRA 3SCJE 4P7VA 2VPYB 1WI6A 5F0WA 3CPWR 1JNZB 1RP5A 2Z2LA 3Q2TC 1KLNA 3TI0A 2GO8A 4C8OA 3GCWP 2GV1A 3RB6A 2GVZB 2B9WA 3M8ZA 1RT6A 1VIOA 3MECB 5D6GA 1IKYA 2MSTA 3C66A 5F41A 1XK8A 3BQ1A 2RKIB 1S9GA 2XMJA 3MTKA 4LR7A 3RBXA 3OFHA 1IKVA 3CD5A 4QPTA 2VBXA 3TYTA 2QA2A 4X66J 2LVWA 1JLEA 3I96A 2E5HA 5FLXU 4LSLA 1VK3A 1VQYA 2FIUA 3DRSA 3K58A 4XIUA 1TUWA 2ZJRQ 2J8SA 2UXCJ 4USMA 2FPHX 5FD1A 2ROGA 1YX2A 2YBVA 1B0VA 1LWEB 3DGPB 2HBZB 1N8RT 1KN6A 3ZNJ1 1MMLA 5I42B 3PW5A 4O4GB 4B9TA 1J2VA 2E1MC 1KLMB 4LFAF 4JB8B 1FKAF 2FJBB 3JQJA 2E7WA 4Q2LA 5IT0A 3PVXA 1ZTWA 2YNFA 2FLLA 3DOLB 4G1QB 3K8VA 4F4AA 3J7ZT 1N32F 2IAJB 4U7CA 2ZH6A 1WG5A 4ECQA 3MM8B 2XO6A 2ZHAA 3QRPA 1N5VA 2KHDA 2VQFJ 3EUNA 3ZZYA 1UVLA 3KK2A 4LF9J 2Q3PA 3ET6B 5GADU 2GZOA 2D3O1 3C8YA 4JV2A 2XHCA 3G82A 1VRUB 3HHDA 3QATA 3SXLA 5KFPA 4DUZJ 4TU8A 4ECZA 2B6AB 1WF1A 3QZ7A 2IYIA 3MAAA 4Y28C 5E0OA 3T3FA 2BUNA 3PYGA 3SV3A 2GMHA 4LFCJ 4ZP8A 4IQXA 1LWEA 5EDWA 1FKPA 4ES3A 2I38A 3IR6B 1PGZA 3MCMA 1HQEA 2RU9A 1K47A 4IYQA 4NXMJ 1RWVB 3EM1A 3H4DA 1U0HB 3O1LA 4JI0J 3KKFA 2ACYA 4F4YA 1XTZA 1VQPS 3KJQB 4Q8FA 3QGIA 4FXVA 2H54B 2OPQB 2I5JA 4I1TA 5KAKA 3AA8A 4DWIA 1TV6B 3FRYA 4FNHA 1Y11A 1HMVB 3C16B 3GU0A 3HVWA 2DGTA 3GFXA 2VG5A 1S4FA 1LWFA 2KHCA 1S48A 4RW7A 3QSYB 4C3LA 2BYCA 3GJSB 4O3QA 1B7YB 2I8EA 4O3PA 3TR5A 1KQGB 5J2PB 2RKIA 1REGX 4YB5A 3IWXA 1S57A 5LSRA 4WFBQ 2KVQE 2L9DA 2ZKUA 2EG1A 2BKNA 3I9ZA 1ZM9A 3MM6B 2X1AA 3V6DA 3NNCA 2X3DA 2EKYA 1KR4A 1C1BB 3Q8YA 1DQAA 3GFZA 4DLEA 1RYRA 1TAUA 3MUTP 4ZPAA 1MMDA 2LMIA 5L1KA 3V6DB 2POKA 2ZNYA 3OXFA 1T05A 3G6VA 3KMQA 3CEDA 1D8ZA 4P73A 3MEEB 3GIRA 4G1PA 4KH1B 3CCMS 3NWRA 2DNPA 4NE9C 4ANDA 1P1TA 1Q16B 3HLUA 2F8HA 3TJ9A 3UDVA 3A4TA 5J2QB 3BM7A 3CDUA 2A10A 4ER8A 4DR4F 3LP1B 4MKAA 1GMUA 2XYGB 2MY7A 1BY9A 3S01A 2FHMA 2AP6A 2CPHA 4OIXA 4DR7J 2AV5A 2IFXA 2YKMB 3JSRA 3VR1A 3DM2A 4B17A 1NLKL 2XMKA 4K8RA 5T14A 1PC5A 5GVQA 3H2LA 4WKRA 2YKAA 1GFWB 3IAS9 4MFBA 2CPJA 4F3QA 1ZYQA 3W5XA 1GMWD 1M90T 3LPEA 4DSLA 2DVIA 4OLPA 5KG4A 5J2NB 1HR0J 1IKWA 5AE2A 1HNZF 3BH6B 3I4HX 4TYBA 4F3MA 2I9SA 5I4MA 4FF1A 1KD1T 3KJVB 3L3CA 2XMVA 3A8EA 1FD8A 3CCUS 2JEGA 1LQ9A 1U09A 2V6AA 4YHHF 2J6TA 4JV5J 2KDOA 2NSCA 3CC7S 1U1PA 2MZJA 4C0BA 1FTCA 4IH5A 1AA1B 1NDLA 4ZPVR 5F8HA 3R5BA 4JV5F 2IVMA 3OSPA 3JQKA 3M8QA 3HDSA 2XC9A 1T9WA 1WSRA 2PC6A 4FVMA 2HZAA 1N6QB 2HHXA 2XEXA 3ENQA 3DM2B 4ECUA 1SKSA 1D9DA 2A3JA 2YVSA 3M30B 4ECRA 4F0MA 5KOWA 3LGHA 1VQ4S 5J1NA 3QSIA 1NMEB 2MKYA 4P75A 4DR5J 3J81U 3H5YA 1Q53A 3Q86A 3CCLS 2AYGA 3GR1A 2MHNA 1CC8A 3NGKA 4IOBA 4QIVA 5D4NA 2K7KA 3MMCA 2HWTA 3VQSA 1YITS 1FDBA 2QA1A 2VFTA 4RW8B 2O66A 2O1PA 5HVHA 1QJHA 3EZOA 1JX4A 2CJKA 3ZTOA 5HJYA 2M7SA 3UD5A 5A8WA 3HJFA 5DLGA 2UVUA 1K73T 1C0UB 4LQ9A 3FDSA 3T9ZA 4UT4A 1NSPA 1OQ3A 3P6YC 4GKJF 1FRMA 2HFNA 4FNIA 3PV8A 1UA1A 3T1YJ 3DXSX 3NCQA 4KV8B 3X3UA 4PG4A 2J9CA 4ZS6A 3MOZA 3H40A 1R6YA 1CVJA 1VDHA 1UPPA 1ZAVA 5BR8J 3MF5A 1RHUB 1V9OA 3ZFVA 4F04B 2HS4A 1U1QA 3HMJG 3DRPA 4B02A 1D8YA 1UZHA 3DNCA 4DPXA 2PI5A 1AUSL 5L1LA 2VOOA 2Q1LA 2F9JA 4C0HA 3KLEB 4MK9A 3A1YG 1UW4A 6AT1B 1QVFR 1JJ4A 1N33F 2W9AA 4RWWA 4LFBJ 3TJ8A 1JWWA 3P3DA 4LSNA 1YJTA 1FXDA 1KQKA 4RW9B 5A8WB 2WW8A 1DTQB 2HBYB 5KT6A 5HMZA 3MAHA 4LSNB 4NZ6A 4DZDA 4ECYA 3UWTA 5DDOC 1NPKA 3KDNA 2X51A 4AXJA 1FDAA 1TKTB 3D67A 4MK8A 1KQSR 3IS9B 5A8RA 2RS8A 5DG7A 1XMQF 3MMCB 2ROEA 3CJSA 4L6V3 1NH7A 4CLKA 1RBAA 1YJUA 1NSKL 2YWKA 2MLYA 5KFKA 1RTIA 3UD3P 2VFUA 3VTIA 2VKRA 4XAKA 3IGVA 2XS5A 3UDCA 4XTTA 2HKEA 3MAAB 1C1CB 2R8HA 3NEKA 2WVDA 2OD4A 5I3UB 3T5JA 1Y3KA 1H0HB 3BSAA 2ZZMA 1M1HA 3E51A 3CC2S 3NOCA 4ICLB 3UPFA 3CJKB 2HSEB 3EDRB 2BJEA 1A7GE 1H74A 3D0IE 4WYLA 5K5MA 4CM2A 4ED6A 4X4RA 4RW8A 4R5PA 2XLIA 2C3UA 2YNGB 3CE8A 1PCAA 3KK3A 4GKJJ 3KWMA 4KC5A 2XCAA 3SFUA 3T6BA 2QSFA 2ZH9A 1T11A 2WAQD 2YPZA 3GIMA 3M8YA 3SCKE 1H3DA 2P2CB 3TZWA 1SJFA 5D0EA 1N36J 2DK2A 1JXVA 2LEBA 3DRSB 3Q89A 5CYJA 2IVYA 3BR9A 3HI9A 3PFEA 3QFWA 5LXYA 1AZSA 3B8HA 4JOUA 5ETOA 3QFHA 4OYWA 3MFIA 3GV5B 1N5YB 1S9GB 5DG9A 1X4BA 2V69A 4HR2A 3C14A 4QWBA 1B0TA 5LMNF 1R8CA 3MM9A 4OZ2A 1VQSA 3W9JA 1F5AA 4DV7J 3GB0A 4KBIA 4C8MA 4E8UA 4A8QA 3AD9C 1B70B 3TVYA 1FJGJ 4B08A 1X9WA 2KXFA 4UY85 3CGIA 1Q78A 1U25A 2A6MA 3FGVA 4DHVA 3AY0A 3R7NB 2AJ4A 1U6BA 2ZDOA 2R42A 3H98A 4ZVSB 2E9TA 3GYNA 4I7FB 1G7CB 1S6PA 2GQCA 2H4YB 2OHDA 2VDHA 4DV2F 4AQYF 5E7OB 1X9MA 5J2MB 4OI4A 4U9RA 2IBOA 1NCLA 3PO5A 3V5RA 3RTVA 3N6NA 2CAJA 4DR5F 2YWWA 4KGVB 3SI8A 3DXBA 4M5MA 1C1BA 3OVAA 1FRHA 2A1BA 3HCXA 4J91A 4NI2A 4CRJA 3LWLA 4ZVEA 4OZ3A 1YJ7A 1SJRA 3DMJB 3MMBB 2UU9F 3ITHA 4P2FA 3UR0A 2KM8B 3DHWC 3PEJA 4MFBB 3UCGA 2FQQB 1T3OA 2HHPA 4QU6A 2DNNA 4K2XA 4AFFA 2FJWA 4CI0B 5EX3A 1NJIT 1CJTA 1GTHA 2OUGA 1RA7A 3PZPA 4R8UA 3U27A 4YUDA 4ZCMA 1I6JA 3HVRA 1TV6A 4MKBA 2FHOB 4HHJA 2DGVA 4YHHJ 4ETXA 3M32B 3K8WA 4NCBA 2ZKTA 3BYPA 4JUZA 1NJZA 1WHYA 4ZPTR 4JI6F 3BGRA 3HD1A 2KTQA 2IDEA 2C2DA 1MMNA 4C8NA 1HNIA 2NPFA 3TEGA 4ID5B 1OYEA 2OO4A 5F8IA 4I4BA 3EE3A 1LFPA 1SH3A 3N0VA 4IKAA 3SIPB 1X5SA 2GQ2A 5B0BA 3KYLA 3L7PA 3VALA 4MAKA 5K14B 4DX7A 1H38A 2LDYA 4YB1P 2EFPA 3KHLA 2BRKA 3NAHA 4WZQA 1VQKS 1DLOA 4CLFA 5J2NA 1TR0A 2YKNA 2JOQA 3S6EA 2HQFA 1JLQB 2IJNA 5RUBA 3PX4A 2R7SA 2YY3A 1FEEA 2KN4A 4NZ7A 4Q5VA 1DAXA 2HWHA 3GIIA 1MU2B 4H4OA 4OYOA 2D9OA 2KFNA 1D09B 3KK1B 1JKHA 5KFNA 1WC4A 1PJ5A 1UVIA 3BR8A 2PEHA 5L46A 2HEKA 4N56A 3MPYA 2ZE2A 1RWWB 1F2GA 1UVJA 2J5AA 4ECTA 3KG1A 3BO4A 2B56A 1HYSB 2QIFA 4HLBA 1TMJA 1S72S 2RSQA 4OLOA 3J81j 4X4SA 1XIQA 2HFUA 1TU0B 1TKDA 2KYXA 2BZ2A 4WP8A 2E7VA 2AX0A 5SUHA 1MN7A 4ZPWR 4GVBB 1SJ1A 2ZH4A 3DN9A 5GADI 2ZM6J 2GO9A 3JTPA 3NWGA 3LP2B 5HP1A 2ZBQA 3KOAA 2JEIA 4QBUA 4XO0A 2QA4G 2HMIB 4KHPJ 1X7VA 3K59A 1RWXB 1LW2A 1U26A 1UFWA 2C3MA 3FC9A 3NGUA 4CT9A 2KG1A 3GIKA 4JI7F 2IY5B 2R7VA 4YQWA 4EU0A 1MSWD 4AD6A 3NNAA 2FD2A 3R8YA 2HFZA 3CT9A 5KTQA 2XY5A 3M2RB 5E33A 5A2QY 4ELUA 4ZVQB 3E01B 3OL6A 4DFMA 3RBEA 1I94F 1OO0B 2PA8D 1X4GA 2OPSA 2WRMA 2P9CA 1UVNA 2HRUA 2AF6A 1N4LA 4DUTA 2C22A 1HMVA 3C16A 2YWEA 2M9KA 4PUOB 5EGYA 3NXZA 3KFWX 4BBYA 2ADCA 2KT2A 4LQ3A 2V8HA 1D0EA 1HLWA 2OKQA 1BLUA 2IHR1 5DZ7A 3DI6A 4PUOA 4JI0F 3GV8B 1BXNA 2BEFA 2Z4PA 4MH8A 1NAQA 4F7VA 3UCUP 5K8PA 1IKYB 1PYTA 4K4YA 2C2MB 4AYBD 2B9YA 3IN5A 2ZC3A 3BGLA 3DRPB 4EYIB 3SBMA 3W9HA 1LW0B 1NK6A 2JHEA 2ZBRA 2DH7A 1UJ5A 4OV1A 3MM6A 1NK7A 1Q82T 4Q0BB 1B7FA 4B9SA 2W4PA 3HULA 2WOMB 2F8EX 5F8LA 1HBUA 4KKOA 3UCZP 2DY1A 2VUGA 1UEUA 4H4MB 4FXWA 4ID8A 1KHVA 2BQRA 6FDRA 4NMLA 2DNZA 1HBUB 4KKOB 4L72B 3G6YA 3W8GA 4QW9A 2VIHA 4DS5A 1X5PA 1U45A 3NMAA 4DCOB 3CD0A 1Q79A 3S8SA 3I87A 3ENWA 4M8LA 4ZHRB 1F1BB 2VD3A 5HO4A 2WCXA 1Z2LA 3GFHA 4DN9A 3TVZA 2MQQA 3HHNB 2RRAA 3UR3C 2GJFA 1FCAA 4CCHA 3IG1A 5LM7E 4LR8A 1M5SA 4URQU 1VJQA 5KG0A 1XJWB 1VLOA 2MY8A 1JMTA 4J9SA 3H2UB 4DV5F 4NMXA 5D15A 1A9NB 5KOXA 3CO9A 4N8NA 4QR0A 4JI3F 1NSQA 3UQSA 1WJ9A 1KQFB 2LQJA 3GFYA 3M4XA 4F50A 1PYOB 2HHWA 3C3LA 1OYDA 1UW9A 4ZJQA 1K0TA 1H73A 1ZPWX 3CWJA 1LK7A 4AUKA 2V68A 3FQLA 2NLWA 1GX6A 3KK2B 2CKWA 1SKWA 4CLLA 3FZ2A 3L9ZA 4LF4F 2HHQA 2C2OB 4KH0B 1JLAB 2HFVA 3Q83A 1RT4B 1WOPA 2Y9HA 1WDTA 2B5JB 2BQ3A 4PWDA 1WEYA 3W2WB 2Y8YA 3LO3A 2RQMA 4P6QA 1YLXA 2BJDA 2Y3YA 3QZ8A 4F0HA 4ZLJA 4QJVA 3CCZA 1QY7A 3GV7B 3R7BB 2H5IB 1UFLA 1WHVA 1FD2A 2VG7B 3A3OB 3KUGA 4ZJLA 1KNZA 2EFGA 2COLA 2FJVA 3LP0B 3CDAA 2QMUB 2N82B 2HZCA 3MFHA 2R2UA 4TY9A 1EARA 4C11A 2AZ3A 2GMJA 3AH6A 3MM7A 3M32A 3PKYA 2QLFB 1T3NA 4WFYA 3KNAA 3PJWA 2CPYA 2XY6A 2ATLA 1S0VA 1KS2A 4PG6A 4C11B 1PO6A 3CSKA 3ZTPA 4PEOA 1SL2A 4OX8A 2DRAA 3IP0A 2W2QP 4I6WA 4WE1A 2KFYA 2EG2A 1RWPB 4NZ0A 1H6KX 5E3RA 4EFAC 3BBCA 4K5SA 3BJYA 2RUSA 3F44A 3PX6A 2BMBA 4YY3F 1YG0A 1WORA 3B82A 4TLRA 1FO1A 2PMZD 4X64F 1OSDA 1SH0A 2OFHX 2VA2A 2PI4A 4W92B 2HGMA 5MLCV 4Y00A 5KFSA 4QYZK 2CQIA 1S7HA 3JAMU 2FJDB 1UTAA 3BO3A 3CJ2A 2XNRA 2DXFA 4NLXA 4ZVTB 5C25B 4TQSA 3TUPA 3LALA 1VRTB 4NA2A 3K5MA 3W60A 3KLHB 2G0JA 2KXHA 3B4DA 1YVFA 4MIWA 1Q81T 1HNXJ 4JI2F 2XGQA 4DV1J 4ID5A 2G1DA 4QIFA 2RQKA 4PRFA 1TAQA 4CLPA 1KBRA 3NCRA 4X4UA 5DDRC 1ZAXA 2QLXA 1HFEL 4J9UE 3UI3A 2Z0GA 4K0KJ 5DM7Q 5KFLA 4QYRA 4LF5J 4UQGA 3LP0A 4M95A 2IRXA 2P6TA 1RTHA 3FCVA 4ZPCA 2EK1A 1OS5A 2XQCA 2GMLA 2FUG9 5B0DA 2DGQA 2KYZA 4I7FA 4N76A 2L9WA 5IC6B 2KO1A 2YWGA 4DG1B 2G1HA 5HMWA 1KHWA 2KXNB 2X1BA 2QJ3A 3I32A 3U1NA 4CIOA 3PRVA 1VRTA 3TA2A 4EO8A 2NZ4A 1FNOA 4HDGA 3RRGA 1UFKA 2FLOA 1FJEB 1FE0A 1NSAA 1JLFA 2ZITA 5IV3A 5T7LB 5DQHA 1H98A 1TL7B 1ZOTA 4HH1A 2FVCA 3IA0A 1GAOA 5E3QA 4KGMA 4DI6A 5IC4B 4IDKB 2ZD1A 3P5TL 2CNNB 2KJWA 1RSCA 4ES2A 3FBFA 2CPEA 3MCNA 5E5NA 3JAMY 2ZJPQ 1EKRA 3TX8A 4LF2A 4NRTA 1JXEA 3SCLE 1YGYA 3R1HA 1FJCA 2EC0A 1RCXB 3AHPA 1RZMA 3UFCX 5B0CA 3RB4A 5F0UA 3CJ5A 1N6QA 3M2UA 4PAAA 4QPXA 1RWUA 3VGSA 4A48A 5LMNJ 3PX0A 2NUHA 2OTLS 4C8ZA 1ELOA 4PWWA 1RT7A 3P45B 3QAUA 2DNKA 2JZ5A 4L3NA 3SQOP 3FKBA 4JI7J 1IQTA 2QG9B 4J9VA 3THTA 4ALZA 1WC0A 4Q45A 2W9BB 1HQEB 2Y1JA 1UA0A 4TY8A 2IRUA 4FPIA 4NEYA 2ZUAA 3OD2A 2ILYA 4N77A 3F41A 4HHUA 4U95A 5EHHA 3R1LA 3CCVS 2D9PA 3A3NB 3AA9A 4RU9A 3BO2A 2QX0A 3M9MB 4DMZA 4LBPA 2W24A 3DC2A 4DXLA 4LF5F 3L4BC 4ZVPB 1S77D 4RWXA 1UWAA 2V4JA 1VBYA 1KFDA 1S9EB 1NKBA 4CLUA 5FDLA 3VAGA 5HK4A 4G1IA 3W2VB 2DJWA 3EYZA 2PGCA 1TL3A 2LA6A 4IG3A 5FIIA 4G65A 2UV8G 1SC4B 3QWUA 4I69A 1CJUB 1O51A 4I6YA 3TVKA 1SL1A 3AFGA 3BBFA 3DDKA 1F3VA 4DL5A 2UUAJ 3N01A 3PKMA 4GVBA 1G2EA 2R7UA 1SV5B 5KFFA 5KG3A 3L95X 2C3OA 3UD4P 1U6ZA 4ED1A 5HROA 3Q23A 3J7Z5 2R8JA 3C46A 4USWA 4G3IA 1EETA 2QO3A 2ZC4A 5AT1B 3Q8SB 3ULHA 1P1LA 2HGLA 1J5EF 2DH8A 3AB4B 1VS3A 4RNFA 5K20B 1ICEB 1RBOB 2M8HA 1Q0NA 2YPYA 2VODA 1VHFA 1XMQJ 2E5JA 3G6XA 2X1GA 4USVA 3LW5C 1MN9A 2VC1A 2VONA 2BRLA 1WSVA 2PA3A 2BJ9A 7FDRA 3DRRB 3K0JA 1HD1A 3GJQB 3LPYA 5HL7Q 2A2DA 2ZBCA 2C28A 4LF7J 2F4VJ 1R0BG 2BJ1A 3DRRA 5GMDA 3PTWA 1HPZA 4ZCIA 4I67A 3ZO7A 2H5JB 2ZNZA 4KY3A 5F3TA 4IUFA 1O0PA 4L73A 1QDUB 2YNIB 3AD7C 4CP5A 4KFBB 4NYOA 1EETB 2RQ4A 2F7VA 4ITSA 2FYXA 2C2KB 1Y10A 1OWXA 3OTBA 4NLYA 2JLEA 2D69A 1ZETA 2Y8WA 1C0TA 2C42A 2V67A 3OFGA 3DLBA 3D0HE 2FTRA 2ZWPA 4UUWA 5U47A 5HLFB 4WFAQ 1D3WA 1JLGA 2KG0A 4UOHA 3RAMA 1F5BA 1WKKA 1ZBTA 2CVEA 4P2XA 1Z2ZA 5CZVA 2RDJA 3J7YI 3D6TB 2NSBA 4LREA 3UVJB 2VA3A 1M5KC 3ISZA 4J5OA 2CQCA 3M2VA 4TU9A 2XS7A 4P2SA 1M5VC 1RADB 4RW6A 5DGBA 3CCRS 4DF8A 1NKEA 3DHXA 2PDAA 3F0NA 3MPVA 3TRGA 4D3HA 3QYYA 3MURP 2IAJA 4IG0B 3RYLA 4KYZA 5A6WA 1HQ2A 5KFOA 4X2BA 4UY8T 4ECWA 2DR6A 4LBIA 1VQ7S 1DFDA 5CZXA 4DZ6A 3W9IA 1ZZNA 2YKQA 1UCNA 5L39A 1PBAA 4OJ1A 3U1MA 2AJ2A 1RDRA 4QWAA 4EZ6A 2Q66A 1APSA 1WUUA 2JRSA 3DOKB 5HANA 4CTAB 4CT8A 5H9EK 2U1AA 4OYPA 1R8BA 3T41A 4Y0FA 2DEIA 3DYAA 5KG2A 4MYUA 2V8PA 2F4VF 2CADA 3VVTA 2DNHA 5G0RB 2XLKA 2CPZA 2V2KA 2XWXA 3RGIA 1FRIA 3FSXA 4EWTA 2CWKA 2MPUA 4DR1J 4LSLB 2XZTB 4ECSA 3WC2A 3R5AA 4GC6A 3DLHA 1SC6A 2V2VA 1YWXA 1NK5A 3Q8RB 4MMOA 4EYHB 1AFIA 2RDDA 3TA0A 5DETA 4JI4F 1RYSA 2K8GA 2XBPA 2E1AA 2EBGA 1TZ0A 3QJLA 4J7CA 4ZPDA 3OVSA 1KLMA 3QT7A 4B9NA 4B3SJ 4PXCA 2IRYA 3MGJA 3FK4A 2KJVA 2IDLA 3EWGA 3C2PA 4X4PA 2AJFE 1NH8A 1FX4A 1LWCB 3QPIA 4USIA 3HJVA 2M4MA 1NK4A 5E2QA 2CJQA 3Q8VA 3CIZA 2UV8A 2RVJA 4RL1A 1IUJA 5DJBA 5GMEA 3OL8A 2M0GB 2DGWA 3GG0A 2BANA 5C24B 2WVEA 1RAEB 1HNIB 4H4MA 2LXUA 1P9YA 3KNGA 1NBEB 2J0WA 2B9EA 1Q8BA 1U8SA 3G8QA 3I9V9 4EK2A 3VCDA 3G87A 4TYAA 1GH8A 3DMJA 4X4QA 5HATA 5F8NA 4JYAF 4C48A 1BMQB 1U24A 1YQHA 2QMXA 1V3ZA 2JH3A 3D1QA 2GC8A 3CIMA 4CO0A 2VB6A 2G4BA 2KZZA 4ED7A 1RLDA 3HFVA 4DJBA 5J2PA 2RHQB 3M8WA 4JI4J 1W25A 3T19A 2DH9A 1S59A 3DFEA 3OVBA 5IT9Y 1IBLF 1T03B 1F60B 4C3KA 5KT2A 1S6UA 1REVA 4O3NA 2YTCA 2VICA 4LVNP 3DLGA 1VQNS 5E3CA 1FJ7A 2HBQB 2VQEJ 2C2RA 3PIPQ 1S9EA 5HSPA 2ASLA 1FFWB 1VQ5S 3EGWB 3RJMB 2MZ1A 1SC3B 4IG3B 3BKFA 5D78A 4LF9F 3C19A 2IMOA 3CC4S 4KO0A 2BM0A 4RNOA 1NZAA 2LXFA 5BJRA 2HVIA 2P5VA 4RJVA 3N5BA 3THVA 2HNDA 4A47A 4LIRA 1HNXF 2J6UA 1WNEA 1JLEB 4U7UK 2OEKA 2QYGA 4RKUC 3TAMB 1NK9A 3FRZA 2ZH3A 1NK0A 3RUBL 4B3RJ 4C9DA 1S99A 3BKUA 1WEZA 1FXRA 3HSZA 5B08A 1DZ5A 2XZDB 3W8PA 2K1RB 4NLTA 2RHSB 2W9CB 1N56A 4OX9F 4DUZF 5I42A 1BD6A 1OQ6A 1SB6A 2DHGA 5GAHU 4ELTA 3CMQA 2E9RX 2MYFA 3TQEA 2JL9A 1F9EB 5M2RA 2HVEA 3IM8A 2HWIA 4TY8B 2HVZA 2CPDA 1VMBA 1RT1A 3OL9A 2CZ4A 1TELA 2V0NA 4C0OC 2O01C 4B3OA 4RUBA 5EWGA 1YKWA 3W62A 3WZ0A 3ZTRA 1WG4A 3EDQB 5KFRA 5BYQA 2D41A 2V9WA 2ZD1B 5ETQA 1L3SA 2DPJA 1NO8A 4KSEB 1FDNA 4A8YA 1N5SA 2BE2B 1DJ0A 3KLFB 4OV6A 3FCWA 4EBDA 4I2QB 3C15A 5HJXA 4WYWA 2JDJA 3W2VA 4GVLA 2VV5A 1H7XA 4AT1B 1FVSA 2L9NA 3IWNC 2E44A 3FEXB 2XM3A 2CWXA 4X84A 5KFWA 3AXMA 2NXEA 4KV8A 1RGVA 1JLFB 2DISA 3ZZOA 2HK3A 5AXMA 3OV7A 2DPIA 3A3PB 3HHLB 1VC6A 1LOUA 5F8GA 2V63A 5L8RC 2MQPA 4FYDA 2DTJA 1U1MA 2LQBA 1NDPA 2R3VA 3NGTA 2W9BA 2DBBA 1ULRA 1RISA 4LT6A 4DR7F 2MZSA 1RCOB 4ILLA 1KVIA 3BGRB 4UOGA 4DR3J 3GSIA 4HTIA 2DIVA 2KRBA 3OXGA 4P9SA 2QA4S 2YNIA 2HNYA 1Y7PA 2IM0A 4F25A 2KL8A 5HVFA 3VHQA 1DTQA 4DQIA 4K7QA 3QGGA 4DV7F 4HEA9 2DGUA 4TKTA 2XMTA 2DHAA 3U7JA 1SVDA 4M5LA 1TP7A 4OHVA 1IWGA 1RAFB 4NLQA 5IS2A 4F3OA 1KVJA 5B0AA 1FEHA 4NYZA 5KFDA 1Q1KA 4X62F 4USJC 1FNXH 2J7KA 1U1RA 1S97A 2DNRA 3DU6A 2E66A 1TFYA 3MXHP 2CG8A 2YX4A 4LFCF 3WX4A 3ISNC 3QQCD 2J0XA 4FYVB 1ROFA 5E3AA 3UN2A 2LEPA 3OTOF 2JEJA 3IO1A 4DOZA 1NDKA 2AWZA 4ILMA 1SUQB 1LXNA 1HI1A 2CPFA 4Y2CA 5L1JA 3N79A 3CXCR 4DFPA 4EZ9A 1ITPA 2QT7A 3E8OA 4X65F 4CLWA 2UUBJ 4KRWA 1HARA 1HHSA 1IBCB 1RI7A 2AEFA 3LQVA 5KT4A 4MIAA 1RAOA 3ENAA 3CTRA 3I82A 5IQQA 4D3GA 1YZ7A 2XSFA 3UE2A 1RU1A 2CNKB 2GS8A 2YKMA 2YNGA 2J76E 1CSJA 4QWDA 3EJMA 1D1UA 1JIHA 2GNKA 3ET6A 4M5GA 2RILA 3ZZUA 4C98A 2CPIA 2EFOA 2J7WA 1YZ6A 1SI9A 3DCAA 2F3JA 4WFNQ 3T5LA 3RR7A 1HBNB 1JLBB 1X0PA 2UXDF 3IRXA 2XMAA 4Z7YA 2J0QD 4TNOA 5G0RA 2YX1A 3MEGA 4NLSA 5BR8F 1IM6A 2ALYB 3FVYA 2M8DB 4CZCA 2OMOA 2QFIA 1U2CA 3M05A 1ZM3A 4OI1A 2JFDA 3M2RA 2C2EA 1SL0A 3KTQA 4A8XA 4ECXA 1I1GA 1Q8IA 1AXQA 1XERA 2DNGA 2XHWA 2H3EB 1OMSA 3W2WA 4FS2A 4LRFA 3L7UA 1IBKJ 4X65J 1UVKA 1IN0A 2HVDA 5HI7A 4MJKA 3JSMA 2BE7D 4YEAA 4LFBF 2H51B 4OX6A 2QFJA 3MUMP 4PYAA 4C6AA 4DUYJ 1X4HA 3FEYB 4X62J 1CQNA 3PYFA 1HBNA 3O2IA 5D4PA 4C8LA 5EX0A 3TAPA 4ZLPA 2WZ1A 2OJ3A 4B9MA 1YJNS 2XCPA 3A8KA 3BB5A 3DOKA 1JLQA 4ZVUB 2ZHBA 3QLHA 1R8PA 5F8JA 1RAAB 3BBBA 3IBWA 4N47A 3SSQA 5KFCA 4B3MJ 5CYQA 2WBMA 3QIPA 4J9OA 1QAXA 2PN6A 4DPUA 3EMTA 5THWA 3ZZ0A 3GILA 1X0FA 1V6HA 4ZN1A 3T5KA 3R2CJ 2Z8QA 1WKLA 3FSYA 3OQ2A 2CNLB 4J9NA 3TANA 2WSCC 3MEEA 4DFJA 2BV3A 1F6TA 2C2ZB 3R97A 1YJRA 2QLWA 2ZBIA 3N6LA 3K5NA 1R0AA 2XTJP 3TNVA 4K5RA 2BQUA 4NCGB 3H7HB 3G82B 1IJEB 4G6VB 3VGTA 4UOCA 1HBOB 1S5ZA 4UW2A 2RAQA 2RT3A 1QTNB 2AX1A 1RUSA 1LWFB 1SQFA 3GCXP 4I64A 3UNGC 2JEFA 1C4CA 2NCKL 3FNNA 1OPIA 1PKUA 1RAGB 3QMQA 4RNHA 4QW8A 1PJ7A 3GJRB 4IH6A 2AU0A 1S10A 1Y3JA 3J7A1 1OSCA 1QUVA 3H5SA 1RTDB 3HO1A 3D54A 4PXBA 2OMLA 2FB0A 2Z57B 2I0XA 3AXKA 4YDXA 2DR5A 2UUAF 4TQRA 3NGDA 4EO6A 2DRBA 3CJ3A 4OZJA 1N52B 3UO0A 1XNQF 4X4TA 4TLQA 2BOPA 1VGYA 1Y4ZB 3B78A 4ZIVA 3TARA 1BQNB 4CO3A 2BJ3A 2KH9A 1DBDA 2B4UA 4ECVA 1HR0F 2AJ0A 2Z58B 2IVFB 3K89A 2CA9A 3TUZC 5KFHA 1VLYA 3GR0A 4ANEA 4CYUA 5ETPA 2W9CA 1M5OC 3HVTB 4LRAA 1Y00A 1VI7A 2BA9A 4K4TA 1HBOA 2VPZB 3O5TB 4JI8F 2W1BA 4U96A 5DG8A 3PW4A 4S0MA 2FDNA 3KUEA 4XPCA 1GX5A 1OY9A 2KRRA 2SXLA 4RLEA 4DDFA 3M30A 4KT0C 3CCSS 2E29A 1VC5A 4EMDA 2ZOGA 2RMLA 2XNQA 4JV0A 2G9OA 3IG1B 3NY0A 5AXNA 4FZVA 1HWUA 2LA4A 4ZLNA 4LIWA 2GGPB 5HROB 4HDHA 3ENVA 5E41A 2CDRB 2YWHA 2VBZA 3IR7B 2BVZA 4V19X 1TQLA 1K0VA 2UUCF 4JI1F 3BQ0A 3NRBA 2A0FB 3OUYB 2BJ8A 1HYSA 1Q4RA 4YS2A 2JC1A 5A8KB 2RRNA 2DEJA 2PT0A 3K7RA 3UNYA 3FBCA 2ZEJA 4AL7A 2LQ5A 4FBTA 2CVIA 4WU2A 2Y0BB 2GJ2A 3DLLQ 1N5YA 2CIMA 3A8IA 2JWNA 3CB4A 2CXEA 4DL7A 4FPRA 3KK1A 5BYSA 1HI0P 4O0NA 1UEVA 8AT1B 4HYKA 2WONB 1EHWA 2MGZA 4E0DA 1S6QB 1N0VC 2HNZB 3MMAA 3G4SS 2ZH2A 5F9LA 4YB7A 1HNWF 2J8AA 5ETMA 2HQCA 4PG5A 1FWKA 4IDKA 2I1RA 5GAEI 4WCEQ 3B54A 3VAJA 4EI2A 1U0SA 3VV2B 1GXLA 3PG9A 3AJ2A 1FWPA 4NLVA 1OJ4A 4OJHA 4USHA 5ETLA 1VRQC 1X4EA 2HHUA 2LQ9A 4MKYA 1N32J 4F36A 2HS3A 4O44A 3D2WA 2UXBJ 2B8PA 2CJAA 2B51A 2ALZA 1R6VA 2D74B 2L08A 2DHXA 3EVOA 2MQNA 3R6LB 3DLEB 5SZTA 3D28A 2V4QA 3IXQA 3CCTA 3RBZA 4ED2A 3MMBA 4M1KA 3H20A 4IO9Q 4FBUA 4JV1A 3EPIA 5AE3A 4Q43A 1WF2A 4LRDA 2OSQA 2CQ2A 5J1EB 3QRRA 3D3CJ 3RZAA 3W7BA 2WTFA 1R0CB 4CDIA 2Z56B 3AOCA 4Q0BA 3AQPA 5M2UA 3TA1A 1TL1A 2N7CA 4X64J 4YY3J 1SQGA 1X4DA 5HBMA 3OL7A 4OI6A 2J6SA 1WKJA 2CPXA 3HFZB 4OYBA 1SJQA 4CQ1A 1D9FA 3H0PA 3BGFA 2GHPA 4A8MP 3MD3A 4DS4A 2BR0A 2B3TB 1S1WA 4L75A 2GQQA 2ZHOA 2QL9B 1IJFB 1NRKA 4O3OA 4R25A 4Y2AA 2IM1A 1YBAA 3CCWA 2FLNA 2LEAA 4QCLA 4DR6F 2NYIA 4MK7A 3C14B 8ATCB 4PG7A 4RW4B 5IOLA 4TVAB 2N7YA 2XULA 4IQMA 3MZIA 1JJHA 3T1HF 3NS5A 1RWKB 5KFTA 2UXCF 4NLPA 1JLBA 2VBYA 2ZOMA 2YWFA 1RAIB 2F8MA 4DFKA 2GIFA 3AD8C 2ZE2B 1U1KA 2UUCJ 2HVHA 3O6QA 3R5JB 1RTZA 3PO4A 2CQGA 1URNA 4ED5A 2EWHA 2VU5A 2EI5A 4QR1A 4HL9A 1F5CA 2VPWB 1X5TA 3IS9A 5KFGA 1WC3A 5LSOA 1S6PB 2YQ0A 4U67Q 2NUUG 3BPDA 1VQOS 1RT4A 4KFBA 1DQ8A 1LWXA 1QE1B 2W2PP 1S1WB 4WFXA 2JLGA 4DL3A 4K4VA 3MEGB 3H42A 1HI8A 3MWBA 4R0JA 3SMZA 4DSEA 1Q7LB 2KZMA 1I3OB 1BQMB 1RHKB 1ZM2A 2CYYA 4OL8A 4EBEA 3DRYA 1QUPA 1WI8A 4UTGA 2FY1A 2D3UA 5C42B 2ABYA 1K1SA 1S49A 3IC1A 3GP9A 1HWKA 2AD9A 3J7YU 2ZH5A 1LXJA 1BQXA 5KFZA 3AAWB 1EP4B 4RBTA 2PMWA 2QL5B 3MR5A 3IRWP 2V8GA 5ITHA 2IYGA 4FYXB 2M3DA 4Z2XA 3T9NA 5KFUA 4HKQA 3PNIA 4MYTA 1KTQA 1B0PA 4ATNA 3G8TA 1QTMA 3Q24A 1CJVA 2Y1LB 2AT1B 3BN4A 1URRA 3PXGa 3M9OB 4MTPA 4CO4A 1M5PC 4EUVA 2QRRA 4DBQA 1UWBA 2CFXA 3ZC4A 3ETOA 3SDEA 4WF9Q 1U7LA 1LKZA 3I0SB 3IWLA 3MM9B 3MUVP 2QE5A 2B7BB 4I56A 2E9ZA 1QAYA 3E2EA 4F26A 2XS2A 2FJEB 2EVZA 1KEKA 2EK6A 3ITHB 1F3FA 1RWOB 1K44A 3BGOP 3MCOA 5IM0A 5KT5A 2M2BA 5K8NA 3J81Y 3MPDA 1AROP 4M5DB 4F4ZA 3BSNA 2JVRA 3VGUA 1KFSA 1OPZA 1I94J 2B7CB 5B7WA 3JSMB 3F73A 4C8YA 4PCQA 4IH7A 1BHNA 2FZCB 4M63A 5KG1A 2CG4A 4MKVA 4HI2A 1UPMB 3WC0A 4DX8H 2ADBA 1L3VA 1YRXA 4OHYA 3P96A 2XI3A 4Z7CA 1T9TA 2RH3A 2VG6B 2QLJB 2YQ1A 1EP4A 1CULA 5C2CA 3FQKA 2A2CA 1JK9B 2DB1A 4CLTA 1IWAA 1FF2A 2K3KA 3MMAB 1VJWA 4BC9A 2VJUA 2HYIB 1TL4A 3NAIA 1N54B 4BC7A 3W1YC 5L1IA 4NWBA 3T6JA 3NNHA 5B0GA 4DU7A 3FMWA 2VJVA 2CQ0A 4B3RF 2BANB 2ZDPA 3IAM9 5C24A 3OLBA 4ELVA 2AJ1A 3U1LA 3T1AA 1EKSA 2LCWA 2OPQA 3M6UA 3TAMA 2XB2D 3W63A 2BDPA 3RRKA 3Q8UA 3KLFA 2B4PA 2CZ9A 2UVRA 2R2TA 2DGSA 2C1EB 1SC1B 2BABA 2DCUB 3HSDA 4BWJA 2JC0A 2AQ4A 1SXLA 3HXMA 2KKHA 5GAGU 4HVZA 2WB1D 2Q43A 1RT2A 4GO5X 3OR1A 2GJIA 5HMXA 4DR2J 2LU2A 3R9LA 2GHWA 4UQTA 1NB7A 2R8KA 2OTJS 3DLGB 2FHKA 4NLUA 1SJ3P 4NCAA 4Q2MA 3HD2A 1T7PA 1O5JA 3OHAA 1KONA 1QVGR 2HHSA 2QV6A 1FESA 1Q95G 2HRYA 1JKHB 1S1TB 3K57A 1IBKF 4UOFA 1C2PA 1L3TA 4U6PA 4PXDA 4NXNJ 3KLGB 2W2NP 2VOPA 3ETMA 4KO0B 2I2YA 4CM0A 3D6FB 3BKTA 1BGXT 3D68A 4M5NA 4DPTA 5DM6Q 4GKKF 2P9GA 4F2SA 3MCSA 1PJ6A 3OTOJ 3LANA 4OYXA 1V5VA 3MAQA 4ZIWA 2MKJA 2XMUA 4J9KA 2R7TA 2GAHC 4K0KF 1R43A 1PG5B 1IXKA 2NXUA 1L3UA 3KHRA 3MMJA 2HBRB 4HACA 1ZM4A 4H4KC 1U1NA 1NNDA 4ZVOB 2W7AA 2XMMA 1HPZB 6FD1A 5IQ6A 5HBMB 5AXKA 3GQCA 4F8RA 2HAIA 4F2RA 4NLGA 1FFGB 2B43A 1GTEA 1R7IA 4OJGA 2QYCA 3QBCA 4IR9A 2IA0A 2ZVSA 1VISA 1AYEA 1HQUB 1NHVA 2WONA 4M5IA 2MGZB 4IOCQ 1IVZA 5H9FK 1GMWA 1MNEA 5KFJA 3QGHA 2UUBF 3PW2A 1VHIA 3NCPA 1YTYA 2AZ1A 4YN3B 4DV3F 1G4CA 1AW0A 3M9NB 5D3GA 3C15B 3V4MA 3SSRA 5DQGA 3FMBA 4U8YA 2GFFA 2WVCA 5LSLA 3UW1A 3FBEA 1U48A 3PHTA 4RPFA 1IR0A 1AB8A 2VASA 2W2MP 2RF2B 1G3OA 4IFVB 4KAIA 4NI2B 2NXNA 2L3MA 5M2PA 1UZDA 3H5UA 4BS2A 1RWNB 3O8WA 4ZDNA 3BSOA 4KQZA 5A2QU 5BYRA 2A6OA 4P72A 2FVQA 3IR5B 3W3SA 4PWDB 4DV6J 3VQTA 3A13A 5KG7A 2EC2A 1R3NA 1CJTB 3MPWA 4ILRA 1IBMJ 2PFDA 4XDDA 1NM2A 4NA1A 5AE1A 2HHVA 1U02A 3NS7B 2GW8A 3K17A 3Q8PB 5EN1A 1W7WA 3PRDA 4FYYB 1NB2A 2DIUA 1DTTB 3KJNB 4HACB 1IR1A 1QD1A 5D4LA 3RR8A 2NXJA 2CJXB 1S1TA 1CC7A 1NU4A 2HZVA 2AYEA 2OP5A 2KB2A 2BE2A 2CQHA 4RW7B 2A18A 3M2VB 1E6VA 2XSJB 4EBCA 1VQ6S 4XDCA 4IRKA 3RB3A 1G6BA 2XGPA 4OX9J 1UAWA 1SJ4P 1AZSB 1RA6A 4OQJA 1KRPA 2RNEA 4DSJA 3FJ2A 3JYTB 1XMOJ 2KT3A 5ADZA 5DS7A 1RACB 2VG7A 1SPBP 2MHEA 4KR0B 3G9CA 5HLFA 2PIIA 3M8PA 1YJWS 4H4KA 4DSKA 2G2OA 4DV6F 3JSBA 4L74A 3TWZA 1KSPA 1Y5LB 4O4GA 4WTOB 4DL6A 3OLAA 4NLWA 2Y1IA 1F0XA 2V2ZA 1T03A 2YQ3A 3TW0A 4OZLA 4CLYA 5KFQA 3ISND 4R5PB 3D4JA 2OAUA 1T05B 4USUA 3WDOA 5IM0B 1EQ0A 2UXBF 3BGUA 5HQMA 2B8QA 2XI2A 3WIUA 2R4FA 2BKPA 5ETNA 5GAEU 1M5HA 1PSDA 3GJTB 3PYEA 5H9FJ 5H1SV 4IRCA 1YRTA 1RT6B 1TKTA 3GYXB 4Y65A 1X31C 3LP1A 2GAGC 2AHOB 2VG5B 3D1HA 4ED8A 3MM8A 5DO2A 4RBVA 1QSYA 3SSSA 3KK3B 1PILA 1HW9A 4LJMA 2MEWA 2XYPB 2Q79A 1UJ6A 1N33J 5ETVA 1U2RA 3TUIC 4F0KA 4A8SA 2FGCA 3AOBA 5T7LA 4DX5A 4LMZA 1VQMS 2OEJA 3EGNA 2IMWP 1U0HA 4HT7A 4J37A 4DV0F 4NX9A 3UDEA 2DCLA 2QC3A 3ZZZA 2AIRB 2C3YA 2QEXS 2DXEA 2F40A 1T02A 3BDPA 4PWUA 4RO0A 3CNQP 5HN0A 3T1YF 2R8GA 1XEZA 2NYHA 4LF6F 3H8YA 3CF5Q 1RXOB 4M5JA 5L9NA 4U8VA 5C42A 2QSWA 4KB7A 4CNZA 2VQEF 4NASA 1FERA 2L48A 3D6HB 1MROA 3D7SB 3KG4A 1TL3B 3LA0A 2HMIA 4KPYA 1CJKB 4WKYA 1RT3A 3EICA 4C97A 1NPRA 3DRXA 4J90A 3PY8A 3M7VA 3MEKA 1X4CA 3B4MA 2PFFB 2OGUA 2RJZA 2ZFHA 4LBHA 1CS4B 5J2MA 3I0SA 2VFVA 1VC0A 3BSCA 3ZTSA 4V19J 4H54A 2JX2A 1WACA 3KG0A 1UWBB 2D1CA 3I31A 4IO1A 1ZTTA 1ZA1B 2EKNA 4WXOA 2X3GA 3ZZRA 5KT3A 1VBZA 4JYAJ 4OX7A 3R5GA 2F1FA 2DT9A 1N88A 1U6FA 2G13A 2PO4A 3A8JA 3CJTA 5DDQC 2AMCB 2HFOA 3SZ2A 3JB9k 3NBPB 2MQMA 1CJUA 1AFJA 2OLWA 4Y2KA 1J5OB 4JI6J 1FA0A 2NR0A 3EZUA 1R0AB 1IKXA 4C4WA 2IM3A 3BS9A 2HW3A 3DGVA 4QIGA 4YDDB 2R7XA 1XQIA 3DLKB 1RWMB 1S0NA 2Z30B 1H7WA 1MWYA 4EEYA 2V8DA 1JB0C 1X5OA 2V8VA 3GG1A 3BREA 2UU9J 2DNQA 1Q5VA 4JP8A 5ETTA 3HT3A 1TKXA 2VF3A 2PEBA 3M2UB 4WBFA 4O0IA 3PM9A 4ZITA 3EGVA 2ZUGA 3O3LA 1NXIA 3R2DJ 3I55S 4E98A 1SIZA 9ATCB 3KJVA 1XNRF 2VQFF 2AEMA 4OYZA 4DR4J 1RT1B 1YJ9S 2FHJD 3BZQA 5CH7B 3WHIA 5DGAA 4M5KA 2F5GA 1SUQA 3CJ8A 5L9XA 3W66A 4J9QA 3MM5B 2R7RA 2CQDA 2EFNA 3QO9B 4ZP9A 3L7OA 2GIQA 3M8QB 5LJ5Y 4B9VA 1TKZA 5CHCB 4YP3A 1ZH5A 1RTIB 2ROPA 5KFMA 4AE5A 1WTBA 1XNQJ 2MSSA 2DYAA 3NBPA 3R27A 4ZP6A 3KJFB 1RAHB 3BPSP 2UVVA 4FF2A 1NJXA 3HZGA 1RAJA 1P8GA 5JVHQ 1ZZFA 2VZ9A 3RRHA 5J1EA 1DLOB 4C8KA 1HBMA 3TX0A 4KE5A 4J9RA 3FFIB 3NP5A 2MQOA 3AOAA 1UP1A 3H4BA 4UZCA 2FVPA 4NL5A 3HHLA 3M8RA 1KWMA 4FP9A 4B9LA 5AXLA 1WOOA 1XBWA 3D5MA 2PE8A 1RHQB 5KFYA 2DY9A 3NS6A
chains in the Genus database with same CATH topology
2ASDA 2ASYA 3PEHA 1Y0HA 1Y9OA 4WK3A 2EFQA 3J80Y 5MAOA 3AJ1A 3M6WA 1O8BA 3M1VA 4LUBA 1IBMF 3MM5A 3DLKA 1GQEA 3MM7B 3NG8A 3NKYA 2K7JA 2IA6A 3GE9A 2Q6BA 4TXSA 3EXCX 3LAKA 4ZHRA 5KFBA 5CYMA 5LJ3Y 4OZ0A 4DL4A 1RJJA 3OBIA 5KG5A 5IWAF 3DYAB 4QWCA 4IFYA 2RS2A 1MWZA 5JUMA 3DI6B 1Q8LA 2ILZA 4DUYF 4CTAA 2RDIA 2CQPA 2ZH8A 1IKWB 3DDNA 3QGPA 1JJ2R 3OTEA 1S79A 3F56A 4EGLA 1JLAA 2W4DA 3M8PB 2YKPA 4KIAA 4JI1F 4QIWD 2K3IA 1U47A 2D3OR 2UP1A 4BDPA 3V4IB 4DQRA 5KFAA 1M0SA 1V3RA 3OW2R 4DR2F 2XLJA 3V81B 2W8KA 3UDLA 4PPZA 1U2FA 3MDFA 3PR4A 2HG4A 2WSFC 4G1QA 3I56S 2BXJA 2FC9A 4YR3A 2AGPA 1S76D 2JJ4D 5HMYA 2DNYA 2RD5C 3T5HA 4DN0A 2HLTA 1RKIA 2DD8S 2R7OA 4NLOA 1VRUA 3M6VA 1FKOA 2C3PA 3N4WA 4A8WA 2CDQA 4O44B 3E3XA 2OPPB 2O67A 2E5GA 3TAQA 1Z4UA 1RT3B 2WSEC 1RTHB 4CH0S 4X4OA 1IKVB 3S1TA 1S9FA 5DRKA 1H2VZ 3OHBA 3CULA 2F9DA 1UETA 4ZPBA 4OHWA 4DL0C 4C3MA 4J9MA 2EPIA 2JVOA 1WF0A 3OFFA 3PRBA 2W8LA 1QSSA 5K9FA 1FXLA 5C25A 1LK5A 5IZHA 1GNKA 1XMBA 2OH2A 4AL5A 3R3TA 2VBWA 4N41A 4K4SA 2PMHA 1X4AA 3TO8A 5K14A 5F8MA 2R9LA 2YNHA 3GZ7A 1SQEA 3ZZTA 1LWCA 2IBKA 1RQ0A 4F4XA 2YNHB 5A0YB 2XMWA 3CD7A 3HVAA 4ZMMA 1UKUA 3LGNA 5D3GB 2N3OA 1SV5A 1W2BR 2DNLA 3OSNA 1HWIA 3P49B 1T94A 2RB7A 4KHRA 3QWPA 5IFMA 4NCGA 1BQMA 3OPKA 1RKJA 3DOMA 3G86A 4OZ1A 4PKDB 4F67A 1YRUA 4RNNA 1NJYA 1VQ8S 1LW2B 1VFJA 4UUXA 1FNMA 3Q22A 5CA5A 1FRXA 3H2VE 2DHSA 4Y34A 2DR8A 1S6QA 1LFWA 1KTVA 3AQOA 4Z37A 2MZTA 1DQ9A 4CO5A 5KT7A 5I3QA 1ZAWA 2Y1RI 3JSYA 2J9DA 3V6KA 1ZPVA 4O23A 4CO2A 2D7SA 1V3SA 2WBRA 4OI3A 4A46A 4DQPA 1HNVA 3AB2B 1HHTP 1S1XA 4RBUA 1E6VB 2XSJA 4OMFG 3K2YA 5H9EJ 1H2UX 3MI7X 4OI2A 1P6TA 5CCMA 4A8OA 5CQGA 3HK2A 3BF4A 2J0SD 1YI2S 2OPRA 1QAJA 1QLNA 3QO9A 2MDAA 4IOAQ 1CG2A 1FE4A 2ZZNA 1BQNA 1IM4A 2RRBA 2BM1A 1RK8A 2CQ3A 2GHVC 3L09A 2NS1B 4DLGA 2W7PA 4BHQA 5LT5A 2LYVA 2AW0A 4Y2IA 4GMKA 4B3MF 2P6SA 2V5HG 5G4DA 5EWEA 4OZNA 3KLIA 1X9SA 4ES1A 2W25A 2DGOA 2OIHA 3CDWA 1Y5NB 2HIQA 3I5AA 5KFVA 3NMRA 1S1VB 4GC7A 1A6LA 5CYMB 2B4OA 2E5LF 3QLHB 4JI5F 2RF2A 3PR5B 2LKZA 3Q2SC 3SEOA 2ZH1A 2ADBA 1N5QA 2MMYA 3IRXB 4N8OA 1HQUA 4TU7A 2ZH7A 1U1OA 2R2SA 1JXLA 4FF4A 2BACA 3MR2A 1N36F 4ERDA 2VH7A 5K8OA 4Y6IA 2I5JB 2HGNA 3FZBA 1JLCA 1FT8A 2AYBA 4BCAA 1FRKA 1UL3A 2K2PA 1JLCB 2UUWA 3DU5A 1QM9A 3VWSA 2NPIA 4WXWA 4NXMF 1FJGF 3OR1B 4PQUB 4O3SA 3ICLA 5FJ4A 3OJSA 5LXRA 1CEZA 1DURA 3K5OA 4TN2A 3VZIA 3M1VB 2ZJQQ 4PQUA 4O4RA 3EGZA 2R7WA 3VAKA 2FJXA 4K4UA 2YX7A 3PHEA 4Y2MA 4ZKAA 2BBEA 3I0RB 5C5JA 3GMGA 3SQGB 4X66F 4WJBA 4LF9F 2M70A 2X1AA 1S1VA 4HI1A 5A8RB 3C6TB 3POTA 5D77A 1NHUA 3CJ0A 4PPDA 4AXIA 4RUAA 2J9EA 2FGOA 3RB0A 3HM9A 1C4AA 4C2MA 5HQ8A 4OHZA 2VPXB 2WB4A 3O44A 1XC9A 1D9AA 2XWYA 3CCES 3N28A 2HNYB 3C6UB 5B09A 3LUYA 3JYTA 4DSIA 3HHEA 2JSXA 1WHWA 4ZVFA 2ZM6F 3CD6S 3HKWA 2KI2A 1GXTA 3Q8QB 4FVCA 4WU3A 1TUVA 3VF0B 3S7RA 3V81A 1R8HA 4ED3A 3I0RA 2IC3A 5A6PA 2DNOA 3LP2A 3R5DA 2VFSA 4NOHA 2HQIA 3RW7A 3GWCA 3PJXA 1YIJS 4FF3A 4B3TF 1T95A 4ZA1A 3THPA 2V4RA 1UJ4A 2R2RA 1S0OA 1WHXA 3DOLA 4QQBA 5CCLA 4YFUA 3MEDB 4LF7F 5A8KA 3MOJB 2OSRA 2HHHF 4DR3F 3LAMA 2HPUA 2AJQA 3WBZA 4ED0A 1HWJA 1QSLA 2LLZA 2IJFA 3DGPA 1U1LA 4KHPF 2ERRA 3D1OA 1N48A 5I3UA 1U4BA 2PD1A 5DLFA 2E1RA 1P27B 2HQ3A 1MROB 2MKSA 2VG6A 2AGOA 2XZWA 4ICLA 4RW6B 4YMEA 3RBDA 3CCQS 1VQ9S 1HBMB 2KU7A 2YKNB 4A4JA 3HHLD 4CH1A 1L5UA 2MKCA 2HS0A 1NK8A 3RU0A 1WEXA 4N5SA 3CDBA 1HL6A 5B0EA 3TOQA 2B0GA 4WZMA 2MXYA 1NEEA 5DQIA 2H5EA 2GX8A 2YKOA 2NQPA 2AYMA 5B0FA 5FLXY 4WE1B 2KT5A 4ZOSA 1WTFA 4K4WA 5E3PA 1RTJA 4R8UB 3KMSA 3V6HA 1T8EA 4WIIA 4DPOA 2VC0A 2LXIA 4QOTA 2K1RA 2MQLA 3CJ4A 3SFGA 2DO0A 1E6YA 2X1FA 3SYZA 3KLHA 2UUTA 4RUCA 4DQQA 5EWFA 3I5CA 2ASJA 3KLVA 3DLJA 2OPPA 3V6JA 1VOMA 1K9MT 1SBRA 1IKXB 2CQBA 4R0EA 4Q44A 4LF8F 1L3KA 3KLIB 2IM2A 5JXSA 2CJBA 4YOEA 4OJ3A 2RQCA 1TK8A 2OPRB 4RW4A 2OD6A 3OJUA 3MD1A 2RUGA 4M94A 2MZRA 2GIRA 3HP6A 1RT5A 1REVB 4OZ5A 4J9PA 2DR9A 2LU1A 4FXDA 1YJVA 5FDLB 4QYZJ 2DITA 2P9EA 2N4CA 3HHKA 3HZEA 5J2QA 4X4VA 2YNFB 2MZQA 5LL6d 1S1UB 2D3ZA 2XO7A 4QIEA 4FS1A 1R0AA 4RX6A 1DTTA 3PACA 2L41A 1KOOA 4DR1F 1FVQA 2CRLA 1S0MA 2R7QA 1XR6A 4I68A 4NLDA 2APOA 2CJ9A 2GCFA 3CUNA 1WG1A 5A0YA 4NA3A 1PC4A 3MHYA 4F02A 3NLCA 1MW7A 5HP1B 5EUHA 3EZ5A 1FDDA 2N4DA 3ONQA 4B3SF 4I0WA 1WWHA 1GXUA 3QJJA 2FC8A 2DO4A 3QIDA 3Q0AA 4MIBA 5DDPC 4BWMA 3FSIA 3EXYA 3BQ2A 1TVRA 2OFGX 4K50A 2YH1A 1CLFA 1TL1B 1LW0A 2WHOA 3C6TA 1FRJA 3POTB 4LVOP 4ZCLA 2M52A 5SUHA 4K4XA 1N0UA 2O3DA 2Z2MA 1HD0A 3N6MA 3HKZD 3EX7B 1E6YB 4PQAA 2KFZA 1FK9A 1OIAA 2MJNA 2HLUA 2RU3A 3CMAS 3MECA 3N9UC 3GIJA 4B9UA 4ZVHA 4DV4F 3K5LA 3PFOA 1TL5A 1HNVB 4FN5A 3EPGA 4NYPA 2Y0SD 1QAIA 2FLPA 1K8AT 3LH2S 2B9XA 1N5TA 3TQ1A 1CQMA 4DG1A 5CD4H 3K5PA 4KTQA 3CMES 3OR2B 2JFKA 5JJBA 3H25A 2QZ8A 2R8IA 3QJPA 4ETZA 5K8MA 3KLGA 3G6ES 2HNZA 3LGMA 3OXLA 4XPEA 3PW0A 3QIPB 1NJWA 2LECA 3E01A 3LOUA 2V4JB 1TVRB 1S1UA 4I2PA 5JVGQ 3G8SA 3BEGB 4IR1A 4ZK7M 2RIJA 1QE1A 4DF4A 1FKOB 2FVRA 1FKPB 1X4FA 1SH2A 4WK1A 2Q6CA 3IGNA 4Q7AA 5CYQB 4IG0A 2HHTA 4A8KA 1TKXB 1C0TB 2B6AA 3I6PA 3H59A 4DL2A 5F9NA 3OTCA 2N3LA 4RU2A 1S0VA 1FHTA 1G1XA 5J1PA 3MEDA 1MU2A 3I5BA 3VAMA 2EFVA 2AGQA 1R89A 3D0GE 5KG6A 1TK0A 1KC8T 3H5XA 4YR0A 1R27B 4IFVA 3GSDA 1LV5A 2UZAA 1JLGB 1WD6A 1B64A 2MJUA 2E7XA 5GAGI 2LDIA 3KHHA 1XR5A 2U2FA 4OI0A 1N34F 3HVTA 4W90B 4ZVGA 3US5A 4ZCKA 4XK8C 4QWEA 3R5CA 1UVMA 2M88A 4OFZA 4PXEA 4URGA 5I3PA 5IT4A 4RNMA 4KGKA 3CCJS 1R31A 2J7UA 2W7OA 4DSFA 3TP2A 4IFYB 2MKKA 2UVWA 5GMKa 3NL0A 4NRUA 2IC3B 4H4OB 4M5DA 2EBEA 1BWEA 1GT8A 4QR2A 4PR6A 1VQLS 2VFRA 4F4WA 4I2PB 2B4VA 1DARA 1SIWB 3V4IA 1DHMA 3C6UA 5KFXA 2BW2A 3V2UC 1WELA 2NREA 4O3RA 2CQ4A 1VIXA 2J9DE 3PW7A 2VL1A 4DEZA 4QZVB 2KVIA 1R8AA 3RAXA 2GA7A 4KJIA 3SDEB 4KHMA 7FD1A 1F9FA 4NPOA 4A8FA 2M5YA 4X4NA 3ZZPA 4K59A 2XG8A 2FHJA 1H2TZ 1AUDA 1YSJA 3VZHA 2FVSA 1Q7YT 3OTDA 1XWLA 1NKCA 4NXNF 1YHQS 2O5DA 4Y3CA 2V9WA 2JLFA 1C0UA 1FTRA 2FJAB 3HF5A 3BDEA 4I2QA 5T41A 1U49A 4IRDA 3N5FA 1TFWA 4WFZA 3CDEA 2QMWA 3MTJA 4HH0A 4P7TA 5L38A 1RT7B 1KOHA 3G71S 4URSA 4QU7A 1RT2B 3FCHA 1DRZA 2WK4A 2ZOFA 1TK5A 1XMOF 1NB7A 2MKHA 3PDNA 1X8DA 3FFIA 4JBCA 5D4OA 5CXTA 1Z1ZA 2H9ZA 3BN7A 3RAQA 3G96A 5F3ZA 5GAHI 1HA1A 3HHLC 1S1XB 4GO7X 4AL6A 2G0CA 1S6OA 5IXUA 3U02A 2HNDB 4RZRA 1J5OA 4DV1F 3IFEA 4CO1A 3OUYA 2CZVC 1IQZA 4NLRA 3KHGA 3OFEA 1CPZA 2VKZG 1RTJB 2DR7A 2B5JA 4I6AA 1RT5B 3SV4A 1Y5IB 2XY7A 1C1CA 2YH0A 4C7QA 4K4ZA 1VBXA 2E1CA 2EW9A 1VK8A 4CH7A 3JTNA 3LF0A 1K1QA 1M1KT 5KFIA 2W4CA 3KLEA 3SCIE 2MB0B 1FRLA 3CJKA 4ZP7A 3MR3A 4HTJA 3VAFA 1RTDA 3HPOA 3QAEA 3HX9A 1BC6A 2KM8C 3RW6A 2PSZA 3M6XA 4RW9A 3SQGA 4CNYA 4YB6A 3PIOQ 1XR7A 1HW8A 3VAIA 3JTOA 1W2IA 2RE1A 3OR2A 1TKZB 4YR2A 4J9LA 1P9QC 2CQ1A 4HT5A 4PG8A 3HFKA 2E5IA 4RUHA 5KFEA 1JNRB 5D8HB 3I4PA 1HWLA 3M8SA 2DGXA 2MKIA 3FEZA 3DLEA 5AJ3F 3LWMA 3TUJC 4DQSA 5LMUF 1XN9A 3CVKA 4F4KA 1UMJA 2OPSB 1FK9B 2DNMA 2V9KA 4WTYA 3VAHA 4B3OB 4Q8EA 1Q86T 2V94A 2WOMA 4OHXA 3X1LB 2GGPA 1SKRA 3SCJE 4P7VA 2VPYB 1WI6A 5F0WA 3CPWR 1JNZB 1RP5A 2Z2LA 3Q2TC 1KLNA 3TI0A 2GO8A 4C8OA 2GV1A 3RB6A 2B9WA 3MECB 1RT6A 1VIOA 5D6GA 1IKYA 2MSTA 3C66A 5F41A 1XK8A 3BQ1A 2RKIB 1S9GA 2XMJA 3MTKA 3TYTA 2DRAA 3OFHA 1IKVA 3CD5A 4QPTA 2VBXA 2QA2A 2LVWA 1JLEA 3I96A 2E5HA 4LSLA 1VK3A 1VQYA 2FIUA 3DRSA 3K58A 4XIUA 2ZJRQ 2FPHX 5FD1A 2ROGA 1B0VA 1LWEB 1N8RT 1KN6A 1MMLA 5I42B 3PW5A 4O4GB 4B9TA 1J2VA 2E1MC 1KLMB 4LFAF 1FKAF 2FJBB 2E7WA 4Q2LA 5IT0A 3PVXA 1ZTWA 2YNFA 2FLLA 3DOLB 4G1QB 3K8VA 3J7ZT 1N32F 2IAJB 4U7CA 2ZH6A 1WG5A 4ECQA 3MM8B 2ZHAA 1N5VA 2KHDA 3EUNA 3ZZYA 1UVLA 3KK2A 2Q3PA 5GADU 3C8YA 4JV2A 3SXLA 1VRUB 3HHDA 5KFPA 4ECZA 4TU8A 2B6AB 1WF1A 3QZ7A 2IYIA 4Y28C 5E0OA 3T3FA 2BUNA 3SV3A 2GMHA 4ZP8A 4IQXA 1LWEA 5EDWA 1FKPA 4ES3A 2I38A 3IR6B 1PGZA 4IYQA 1HQEA 2RU9A 3H4DA 3O1LA 3KKFA 2ACYA 4F4YA 1XTZA 1VQPS 4Q8FA 3QGIA 4FXVA 2OPQB 2I5JA 4I1TA 5KAKA 3AA8A 4DWIA 1TV6B 3FRYA 4FNHA 1HMVB 3HVWA 2DGTA 3GFXA 2VG5A 1S4FA 1LWFA 2KHCA 1S48A 4RW7A 4C3LA 2BYCA 4O3QA 2I8EA 4O3PA 3TR5A 1KQGB 5J2PB 2RKIA 4YB5A 3IWXA 5LSRA 4WFBQ 2L9DA 2ZKUA 2EG1A 3MM6B 3I9ZA 1ZM9A 3V6DA 3NNCA 2EKYA 1KR4A 1C1BB 4DLEA 1DQAA 3GFZA 1RYRA 1TAUA 3MUTP 4ZPAA 1MMDA 2LMIA 5L1KA 3V6DB 2POKA 2ZNYA 3OXFA 1T05A 3G6VA 3KMQA 3CEDA 1D8ZA 3MEEB 4G1PA 3CCMS 2DNPA 5J2QB 1P1TA 1Q16B 3HLUA 2F8HA 3BM7A 3CDUA 2A10A 4DR4F 3LP1B