1IBLJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1iblJ00
5IWAJ 4DV3J 2HHHJ 3R2CJ 4KHPJ 3R2DJ 5LMUJ 1IBKJ 2ZM6J 4DUZJ 3OTOJ 4B3SJ 4B3MJ 1I94J 4X65J 1XMQJ 1HNXJ 4YHHJ 4PWWA 3JAMU 2MEWA 2UUAJ 4JI7J 4B3RJ 2UXDJ 4DV5J 2VQEJ 4DR1J 3W1YC 5A2QU 2KL8A 5BR8J 1N33J 4DV6J 4B3TJ 3J81U 4LF9J 4DR4J 2F4VJ 2MQ8A 3J7AN 1IBLJ 4JI1J 3T1HJ 4YY3J 1N34J 4JI6J 4LF7J 1XMOJ 4LFAJ 4DV0J 1HNWJ 4X64J 4JI5J 1HR0J 1XNRJ 4LF5J 2E5LJ 4DV1J 5FLXU 4DUYJ 4JI4J 3J80U 4V1Ak 4X66J 4DR7J 2UU9J 1N32J 4DV7J 1N36J 5AJ3J 4DV4J 4JI0J 4HHUA 5IT9U 2UXBJ 4LF8J 4KYZA 4OX9J 3IMQJ 4AQYJ 4DR5J 4JI3J 1IBMJ 2KVQE 4DR3J 4RJVA 4NXMJ 4LF6J 4JI8J 4GKJJ 4GKKJ 4LF4J 4NXNJ 4DR6J 4LFBJ 4LFCJ 3T1YJ 1XNQJ 4NEYA 3D3BJ 4JV5J 2UXCJ 2UUCJ 1J5EJ 5LMNJ 4DV2J 1FJGJ 2UUBJ 4KY3A 5LM7E 4K0KJ 1HNZJ 4JI2J 4X62J 4JYAJ 4DR2J 2MTLA 2VQFJ 4NEZA 3D3CJ
chains in the Genus database with same CATH superfamily
1VQMS 4ED6A 3TO8A 2PMZD 5CAAA 3PXGa 3HHLB 3RBDA 4MFBA 2UU9F 1EIYB 1WNEA 3BSOA 1G1XA 2CJYB 3JAMY 3PKMA 2NPFA 5BR8J 2AYGA 4HL9A 1WEYA 5D0EA 1MWQA 1FESA 2VFUA 1IBLJ 2RH3A 1S0OA 1F2HA 4BHQA 2BRKA 5AXKA 3TWZA 3F44A 4XPCA 4UZBA 4R5PB 3N9UC 2ZH4A 3IFEA 5K14A 4Y28C 3TNVA 1D3WA 3IA0A 2NXNA 5KFGA 3ZZUA 3DRYA 5KG7A 3KLGA 2V0NA 3NWGA 3UN2A 4LF6J 2AGPA 4QBUA 4DR6J 1EKSA 4FF3A 3ZZ0A 3O5TB 2GW8A 3D3BJ 3OVBA 2RS8A 4AYBD 3H42A 3MPWA 4MYTA 4QPXA 1D0EA 2RQ4A 3EZ5A 2DNQA 1HYSB 3BGOP 3TQ1A 1FJ7A 3DLEA 3LUYA 2ROEA 2COLA 2OUGA 2QN6B 4LFAF 1CC7A 3OVSA 3J7Z5 4O23A 4DR1F 4USUA 2MEWA 2UUAJ 4MFBB 3OUYB 2VQEJ 4OI6A 2NUHA 1SQGA 3H2LA 1X4HA 2V67A 4DXLA 1TR0A 3KK1B 4IR1A 3W2WB 1UEKA 2RQCA 1RGVA 3U1LA 3CJTA 2EVZA 2E7XA 3SCJE 5BYRA 3PO4A 4DSEA 3I0SA 4C0OC 2WCXA 1FJGF 1Q81T 2E1RA 3LW5C 4A48A 4U9RA 1X0PA 3PDNA 2VKZG 3OL8A 2R7TA 3BGUA 1EETA 4RBVA 1U45A 4OZ5A 2DNRA 1X4AA 1E6VA 4QIFA 4UW2A 3A8EA 1LWEA 4ZP6A 1S9FA 3UQSA 4JUZA 2MLXA 2NUUG 5EN1A 1RT6A 4JV5J 3OLBA 4BS2A 4WU3A 5DO2A 1G6BA 2XMJA 2CAJA 3HHDA 1U8WA 2NXUA 4TLQA 1WUUA 4RX6A 1JLCB 4USTA 2UVWA 1Q8BA 2BJ7A 4J9UE 2R7XA 1C0UB 3CDAA 3BYPA 3DRSB 5F8HA 1XERA 2OD4A 3AFGA 3FBBA 2ZVIA 3E8OA 2Z2LA 4DG1A 2EXUA 4HH0A 4ZITA 2ASLA 1ZA2B 3GZ7A 2CNNB 1QY7A 1BXNA 3R7SB 1UW4A 3WX8A 1YWXA 1SC1B 3HM9A 1VQPS 4YOEA 3GSIA 3BQ1A 4X4SA 4LF5J 1Q4RA 1X4GA 4OYWA 4K8RA 4KKOB 1CJVA 4I6AA 2ZC3A 2OP5A 1KQSR 2DGUA 1E6VB 4PR6A 4DSJA 4IG0A 3HMJG 4B02A 1QE1A 1NU4A 2VFSA 2B9EA 4LF1A 4I2QA 2DEJA 5ADZA 5CZXA 2ZOGA 3NCPA 4A8MP 4ED7A 3JQKA 2ZKTA 2GVDA 2IAJA 2Z2MA 3UR3C 4DV3J 2I5JA 4JOUA 3LTOA 2XSFA 2V2QA 1R8CA 1PO6A 4QIGA 3K7RA 5LSOA 2Q6CA 4NZ7A 5D4NA 1SVDA 1Q1KA 2MKCA 2XO7A 2XS7A 4ILRA 3NNHA 1F3FA 2XWYA 1S79A 1T7PA 2Y8WA 3PCOB 4Y2CA 2AWZA 2EG1A 3K5NA 4RNFA 3P5BP 1SKRA 3GTYX 2G2OA 1FI4A 2V8DA 3KTQA 4RUBA 3ENVA 1IBCB 2UUCF 3Q8QB 5HAOA 2IC3B 1C2PA 3GFYA 4RW4A 1SV5A 2OPPA 2LQ8A 3OHAA 5IT9Y 3RBXA 5HQMA 2BJEA 3CO0P 4HTIA 3ISND 4RW7B 4KT0C 2CPJA 1RT7A 4IG0B 4CI0B 2H54B 4ILLA 4KR0B 4KSEB 4FS1A 4JYAJ 1VC5A 4U96A 1AB8A 3QAUA 2H48B 2RT3A 2F3JA 4ZN1A 1VQ9S 2VF3A 2VBWA 4ETZA 4QOTA 2N4DA 4JI4F 3MR3A 3CD5A 1FHTA 3TOQA 2ATCB 1YJ7A 4X84A 5CYMB 1FCAA 2NZ4A 3MPUB 2BOPA 1LV5A 1RHMB 3I56S 5I42B 3H8YA 4D3GA 4KHRA 2VC0A 1AXQA 3EVOA 4HHHA 3GILA 4GMKA 1GMWA 2HNZA 2QMUB 2XSJA 1DTQB 3EZOA 1IBMF 4KH0B 1O5JA 1FWKA 3R5AA 3TP2A 3FRYA 5L38A 4LRCA 4AQYJ 1PG5B 2G0JA 2ZVSA 3WC0A 1U2FA 1HFEL 2C2RA 3CCSS 2WVEA 5AE3A 4I4BA 2NSBA 2DHXA 3AJ2A 3CMQA 3CJ5A 3B4MA 1WG1A 5HVHA 5D15A 4X64F 2KXFA 2BXJA 5D4PA 4F4ZA 4FF2A 1RSCA 1ROFA 3B6BA 5DDPC 3SDEA 2Y0SD 2CXEA 1AYEA 1UJ6A 4OLPA 1UWAA 1RTHA 2ACYA 3GP9A 3HVRA 2FB0A 5T14A 2HWHA 5ETRA 2CZ4A 2CDRB 1N6QB 3W9HA 4WFNQ 4QR1A 1VK3A 1SJQA 5FDLB 3CTRA 4DLEA 1Y4ZB 3GE9A 1PYTA 4CLWA 3CMES 4NA1A 4X4OA 2CQ3A 3HLUA 1JLFA 1HBNA 3H5YA 1CPZA 1S1XA 5HBMB 2ZH8A 4P2MA 4XK8C 1TL4A 3NGRA 1B70B 1YZ7A 1UWBB 2GAHC 5J2PB 1T05A 4CT9A 1BGXT 1IQZA 3IAM9 4OZLA 3ITHA 1S6PB 3MM9B 2GV1A 2VFVA 3TVYA 1SH0A 3W60A 1BC6A 2CG8A 4DEZA 4UF4A 3RRHA 2UXBF 1NK0A 1WG5A 2C2NA 3CJSA 2AGQA 1B7FA 1X4CA 3RR7A 1D9FA 2MZQA 5HP1A 4QIEA 2R9LA 2GZOA 3N79A 4DCJB 2UXCF 1RTIA 4WXWA 1S7IA 2P6TA 2IHR1 4IQMA 3VAIA 5FD1A 5HN0A 3LP0A 4USIA 3MOJB 2GHPA 3TJ8A 1AFJA 1ZZNA 4N8OA 3T1AA 2FPHX 4GC7A 1IBKF 2DYAA 3BH6B 5E2QA 1JLFB 2IBOA 3M2VA 2CJXB 1TK5A 3DKDA 1LW2A 4HDHA 5D78A 1W7WA 4Q45A 4YB1P 2AGOA 1I3OB 3M8QA 2IFXA 1FRHA 1WD6A 2D74B 2ZH1A 3IAS9 1DY3A 4DOZA 1MN7A 1TKDA 3DMJB 3RRGA 4MH8A 1D8ZA 3T5KA 1X9MA 2MY7A 2HNDA 3GJTB 1NDKA 2YQ0A 2QV6A 1DHMA 4ANEA 2BMBA 5KFIA 3HHNB 3G96A 2AEJA 2NLWA 4ZVRB 2ZUGA 1RAEB 3NS5A 1J5OB 3OJUA 4WU2A 4J7CA 1DQ8A 3D67A 1VRUA 2A10A 2QL5B 3VV2B 1TMJA 1J2VA 1GNKA 3R5GA 3W7BA 1N5YB 2YWKA 3UDEA 1HR0J 3TYTA 4F2SA 5F0UA 1RTIB 5DGBA 1N32J 1RT2B 5CYQA 1UVIA 1N36J 2CPHA 4NI2B 3O44A 1JJ4A 4ZCKA 2BJ9A 1KQGB 5F9LA 1NPKA 2B5JB 2NS1B 3CC7S 4LR7A 2WONA 3THPA 5EUHA 1S0NA 3VVTA 3QLHB 3GB0A 1YLXA 1QTNB 3M2VB 2JDJA 2HAIA 1S6QB 3R5JB 4LRBA 4TQRA 3TA1A 1RHRB 2DGOA 2R42A 2J0QD 3VTIA 1UCNA 2Q1LA 2G1DA 2MPUA 2YQ1A 2BE9B 3GR0A 2H1YA 1WTFA 3CCTA 2JRSA 3MPVA 5L39A 1T3NA 3L09A 5HO4A 3FRZA 4UT4A 3HKZD 2HBQB 2AEFA 3JSBA 2HQIA 5KT7A 4LREA 3MEGA 4WTOB 1EKRA 5AT1B 1RK8A 3G9CA 2HNDB 3IC1A 5I3UA 2CPYA 1RBOB 2O66A 1KOOA 1NHUA 4KBIA 2F63A 2J8SA 5HSPA 2VG7B 5J2QA 2JFDA 1PKUA 1QSLA 3M8PB 3DYAA 1T9WA 4A8WA 1U25A 4KGMA 3TW0A 3ELHA 4ZJQA 1KBRA 3ZZOA 3EPIA 3FK4A 4HHUA 5CHCB 3N6MA 3BYRA 2RUGA 4G1QB 1TUWA 4MJKA 1YQHA 3ZTSA 2QYCA 3QGGA 1XMQF 1GEHA 1VHFA 2MSTA 1N4LA 4Q0BA 1FJEB 3PM9A 2DXFA 2V4RA 3EM1A 2PA3A 3OL6A 1WC6A 2APOA 3Q2SC 3NG8A 1PGZA 2GC8A 4JI2J 2W2PP 2WW8A 3QSYB 3MAHA 4HTJA 1UMJA 4FP9A 3MFIA 1T8EA 3AB2B 1YZ6A 1SH3A 2LXFA 5K5MA 3O8WA 2AZ1A 1LK7A 3UDCA 1K44A 2DR6A 3S8SA 2XQCA 5DLGA 1B0TA 4L3NA 2CQDA 2RF2B 2EC2A 3HD2A 3FSXA 5JXSA 5L8RC 3MPYA 3BSAA 3T1HJ 2LYVA 3QGIA 3FBEA 2HZVA 2MKIA 4JI5J 4TU8A 2YNFB 1JNZB 2ZD1B 2OPSA 2KT3A 2YNGB 2VDHA 4JP8A 1VQLS 3A1YG 2FLNA 3LH2S 2WSFC 3AXKA 4DI6A 4S0MA 1RUSA 4C6AA 2DHGA 4FYWB 2ZM6F 3BBBA 2FVQA 5A8WA 4JB8B 3R5CA 3CMAS 4ICLB 1SC4B 1QUPA 2J6SA 2HRYA 3SCKE 4Q0BB 3M1VA 1HBOB 3P45B 1AFIA 2XY7A 3IR7B 2L9NA 2IJFA 4O3SA 3FCVA 3UE2A 1HNZJ 1WI8A 4X62J 1KRPA 4DR2J 2CZ9A 3KHGA 2YWFA 4NLSA 2ZEJA 2DNGA 2DR5A 4ZP8A 3X3UA 3LOUA 1WC0A 1YRXA 2DNHA 4DV5J 1YITS 1RAAB 5D4LA 1NSQA 3DOLB 3M6VA 2HSEB 3D68A 3VZIA 1Q79A 1IKYA 3J81Y 5D3GA 1O51A 4ED0A 3ZZYA 4JI8F 3EGWB 4GKJF 4PWUA 4KGZB 3M8SA 1FXRA 3VGVA 2OTLS 4QWBA 2OI2A 1L3KA 3VR1A 3HULA 1UPPA 3NOGA 2CNOB 2W2QP 4M63A 3QRRA 3Q86A 1B4SA 3BN4A 3M05A 3R7NB 2J0WA 2P8IA 3DC2A 4C3KA 3O3LA 1HKAA 1LEOA 1RT3B 5A8WB 4NLUA 5DQIA 1HLWA 3W62A 5GMEA 4ZJOA 1JLEA 3E01B 1VCTA 1M90T 1AZSA 1XBWA 5JMNA 1S0MA 5EWGA 1HPZA 2QA4S 2JEGA 4L74A 1GTHA 4TQSA 2GX8A 4OYPA 1KTQA 1AUDA 4IRDA 2JLEA 2DO4A 4I6WA 3DOKA 2ALZA 3ENQA 4F4XA 1T9UA 1R0BG 2GCFA 1WEXA 1IKVA 4F0MA 3EZUA 3THTA 3RZAA 1AW0A 3KHLA 1QLNA 2DO0A 4PXCA 3O6QA 1U48A 4K5SA 5C24B 4C8ZA 4KHMA 4JI3F 2GMHA 4NLVA 3Q83A 4AL5A 1XNQF 3DM2B 2N82B 1KQKA 2AJ1A 1QSSA 4DSFA 5KG2A 3EWGA 1ZTWA 1VR6A 3JSRA 3CPWR 3QIDA 2AU0A 3C46A 2R8KA 4OI4A 4ECWA 2OSQA 2AT1B 4NXMF 4DFJA 5A8RB 1J27A 3SQGA 1X4BA 4I64A 4DL6A 5H1SV 1HNXF 4YHHF 5EWFA 1JNRB 3DRRB 4N77A 2A18A 4BWMA 2WVBA 1DLOB 4TKTA 4HI2A 2QLXA 4OJGA 3BEGB 2PMWA 3GFXA 1NO8A 4PYDA 1NUEA 2Z2ZA 3MM5A 3CD6S 4KPCA 1FKPB 3BJYA 5LMUJ 1R8PA 2YXLA 2GO9A 5E3QA 3JAMU 1T0TV 2UXDJ 5AJ3F 5IQ6A 2VG6A 1H98A 2CZVC 3HHLC 1UVLA 2XMTA 4O0IA 1WC4A 4DSLA 3ZZRA 2J0XA 1Q78A 3W9JA 1TKZB 1UAWA 3HJFA 2LQ9A 1HNWJ 3G6YA 4DR7J 3HSJA 4B9VA 2R2RA 2AJFE 3AD7C 4F04B 1K9MT 1HHSA 2VQFF 2ACMA 2CPZA 2NXJA 2YBVA 3MEEB 3GSDA 2KFNA 2GIQA 4ED8A 3KMQA 2LU2A 3U7JA 3EPGA 2HAFA 1TUVA 4L76A 5H9FJ 4A8XA 5BR8F 4URGA 5DG8A 2JEFA 2WSEC 4CO5A 1FNXH 2Z2YB 1IBLF 4Q5VA 3T6BA 3ISZA 4B9UA 5DGAA 5ETKA 3MM5B 5HQLA 2BW2A 2LLZA 2ZH9A 1NKEA 1YJVA 2YNIA 3QWPA 3Q24A 1K1QA 2IVYA 4ZKAA 3D54A 2BA9A 2XBPA 4C3MA 1DTTA 1VI7A 3H4DA 2E66A 4B3TJ 3W66A 3OJSA 5HROB 1RAFB 4ID8A 4CT8A 1T03A 3OTBA 3QO9A 4LF6F 2CQPA 2PEBA 4F50A 3JTNA 4DR6F 4O0NA 1K8AT 3TUZC 2CWKA 3PVXA 2HG4A 4MK8A 3EJMA 3MEDA 2FHKA 1M5KC 2ZH2A 5F41A 3TUPA 1RACB 4X4RA 4USKA 3TX0A 1UJ5A 3DXSX 2EPIA 4CCHA 3MMJA 2W8LA 2NXEA 3CCRS 1Q95G 2C2KB 1RTDA 4LF4J 4OJ3A 3V6KA 2C2MB 2UUAF 3TJAA 4K4VA 1NMEB 3EDRB 2VQEF 3CW2C 4GRSA 3W5XA 5IM0B 2FLLA 3DLGA 5H9FK 2VBZA 3IP0A 4ES1A 4PG4A 3P8BB 2C3PA 1C1CA 1FFGB 3ZZTA 1FDDA 3B54A 2KJVA 2MJNA 3T19A 1TAUA 3LANA 4M5HA 1XQIA 3HSZA 1C1BA 1APSA 4LSLA 2R7VA 1VGYA 3T5HA 4NLYA 2RKIA 3L95X 4XDDA 3HVAA 4DR4J 4YQWA 4QWAA 5M2RA 3VZHA 3DNCA 2R7OA 3TA0A 2DH9A 1PJ6A 2BQUA 5BXIA 2O5DA 5IZHA 4F26A 2YKOA 4DF8A 1RLCL 4DPWA 4JV5F 1L3TA 3HKWA 4DS4A 3MEDB 1UVJA 3M8ZA 1RWUA 3N6LA 2VG5A 1RADB 2R8JA 2EKNA 3I55S 3CDWA 3BPSP 2QA4G 3CUNA 2PSZA 3MOZA 1N0UA 2V5HG 3MCSA 1HWLA 2VA2A 3B8HA 2JL9A 2DGTA 4P6QA 2QMXA 2FZCB 4HACB 1KP6A 2VU5A 4QWEA 2DIVA 3NKYA 2ZH3A 3MM6A 5IV3A 4OX7A 2VONA 5HATA 3R2CJ 2BQ3A 2CQ4A 4LF5F 2W7AA 2KVIA 1U1KA 1FNMA 2DPJA 2F4VF 4GVBB 1C1BB 4DR1J 3WDOA 5I3QA 2B9XA 1NH8A 4CLFA 3G6VA 2FHMA 4NLPA 5GVQA 3J7YI 5F8JA 1ZETA 2LQBA 3RG6A 2IA6A 4ZHRB 3H20A 3CEDA 4ED2A 3HF5A 4BDPA 3KG4A 4IH5A 1KS2A 1HD0A 4WE1A 1JXVA 5IT9U 2OEKA 3DLKA 2OGUA 4H4MB 2J7WA 3C19A 2YWWA 3AJDA 3QJPA 1AROP 1VK8A 2F65A 4ATNA 4NEYA 1SJ3P 3ZO7A 3R8YA 2XHCA 1LW0A 4CLTA 3PYFA 3FFIB 1NHVA 2LVWA 3AJ1A 3QRQA 4F0KA 4YUDA 2B4PA 4KO0A 1SJ1A 4A46A 5E3AA 4I67A 3OR2B 2YX4A 2CQ0A 1JIHA 1RCOB 3W9IA 2RHQB 1F0XA 2K3KA 3MAQA 2R7UA 3UD3P 3OXLA 4OI1A 3N5BA 4HHJA 5AXNA 3GWCA 3MM7A 3GIKA 9RUBA 1WJ9A 3CXCR 1X9WA 2J7KA 4WE1B 2D1CA 4JYAF 4LQ9A 3D5MA 3S1TA 2XZWA 4PKDB 3ISNC 4ZVSB 3CGIA 1VIOA 1Q5VA 4HT7A 1Y11A 1HL6A 2F4FA 3NBPA 4Y0FA 2MMYA 4K0KJ 4CLUA 1B3TA 1ELOA 3R27A 1S1TA 4TLRA 4FDFA 4ZA1A 5M2UA 4YB5A 1RBLA 3ILLA 1MROB 4DUZJ 3ILOA 4RW6A 4MIWA 4UOCA 3SCIE 3D28A 1SL2A 3PTWA 1PILA 5JVGQ 4C8KA 3GV7B 1ACMB 4AQYF 4CLKA 2LEAA 3EYZA 4IQXA 4J9KA 5F8NA 3ENAA 5HMWA 2R2UA 4OI0A 1Q7YT 1XNRJ 1JJCB 3VGTA 1M1KT 3MM7B 3C15A 1FXLA 4IFVA 3GIMA 1A0OB 2ASJA 5HANA 4NYZA 2VHGA 3KDNA 4NL5A 4DR5J 1C0TA 3C6TA 2MKYA 1X4DA 2RQKA 4LFCJ 2EKYA 2R8IA 2QLBB 3FNNA 4DLGA 1RT5A 1U47A 2E9RX 4B9MA 2W2NP 1TKTB 2JJ4D 5DDQC 4OV6A 1OQ3A 4KPYA 2ZH5A 5E5NA 1TKXB 4H4OA 1I5OB 3B82A 3MTJA 2OPRB 3M6UA 1FXDA 2M2BA 4NCGB 2B4UA 1KVKA 3DGPA 4JI1J 1BY9A 2RB7A 3N6NA 2HKEA 5HMXA 4LF7J 2MQLA 4A8QA 5M2PA 3M9OB 4DV7F 1G2EA 3TR5A 1HMVB 4KV8B 2PDAA 1NPRA 1YG0A 1VBYA 1XR5A 3FVYA 3H2VE 3T9NA 4DJBA 1KN6A 1SBRA 3VGUA 4HT5A 1VQ6S 3IG1A 4MIAA 1WOPA 1IBMJ 3RAXA 1F5CA 1PAEX 2RU9A 4HLBA 2KZMA 3C6TB 3ET6A 4QIWD 2M4MA 2IVFB 1WKLA 2E5GA 2D3ZA 1IR2A 1F3VA 3R5BA 4ZLNA 1YSJA 1Y3JA 4F4YA 3UNYA 2X1BA 4GC6A 4UOGA 5U47A 2V69A 1GX5A 3N01A 2FC8A 4CO3A 2FY8A 1BWVA 4Y2MA 3IXQA 4QWDA 1S1WA 4WBFA 4K4TA 4EEYA 2HNYA 4H4OB 4I2PA 4FKXA 4ZLPA 1OY9A 1DFDA 1VMBA 4ECQA 2IY5B 1XMBA 2DY1A 3FEYB 3OR1A 3DGPB 1FDBA 2L9WA 2X1GA 3JSMB 3G4SS 1NNDA 1URRA 4OHXA 2DNYA 4ID5B 2P9CA 4WYLA 2FIUA 3Q8SB 5B0FA 1BQMA 3LGNA 2JHEA 1PYSB 4NCBA 1OO0B 1V6HA 3I9V9 2AJ0A 3MXHP 3IG1B 3MECA 4DX5A 5J2MB 1WSRA 3HSGA 1SKWA 2QZ8A 1JWWA 4DQRA 3BKFA 2CVEA 4OHWA 1UZDA 2WB4A 3PG9A 3GJRB 4EMDA 5FJ4A 5K20B 5LXRA 3SCLE 2VUGA 1PIEA 2HFOA 3IBFB 2XMAA 4X4TA 3FBCA 4QWCA 3D4JA 2X7IA 3RAMA 4P71A 1RTJA 3R2DJ 2H5EA 4USWA 1HR0F 3A8JA 1N0VC 2HFUA 1N32F 1N36F 3FSYA 1TQLA 5IT4A 1H7WA 3NP5A 4HH1A 3KJQB 4O4RA 2BYCA 1MMDA 5LT5A 1X60A 4DV0J 1IWAA 2MLYA 2ZBRA 4RLEA 1JXLA 4X4UA 2EK6A 2FVRA 1N5QA 3EVWA 1IQTA 2M70A 2J5AA 2ZITA 4NYOA 4IKAA 1UVMA 1LWCB 1HBUB 1X8DA 1WOOA 3A3PB 2OJ3A 4DL7A 5A8KA 1NRKA 4F0HA 2QFIA 1CBKA 5D0RA 4ZVTB 2OEJA 3AOCA 1R0AB 1OYDA 2I6WA 3VHQA 1VLYA 1UFWA 2WVDA 4CTAA 5GAHI 1KFSA 1RHKB 2DR8A 2C28A 5KFBA 4F25A 1S99A 3MUMP 2HHHJ 2CIMA 1QD1A 2ZOMA 4L6V3 2KN4A 2AV5A 3QT5A 1PC4A 1MNEA 2DRBA 5J2NB 4XDCA 1RP5A 1OWXA 4DV6J 1R6YA 3LF0A 5BYQA 2IPOB 2KM8B 5L1LA 5KT6A 1T02A 5KFLA 2EBEA 4P73A 1RWMB 1T3OA 3RBZA 3C66A 1JLGB 2PA8D 3QYYA 2L41A 4JI2F 4Y00A 3KJVB 4EU0A 4QZVB 4OI2A 1PJ7A 1GTEA 3VAHA 5C5JA 4J90A 4K5RA 5KG1A 2HK2A 4QR0A 1HQEA 5I3PA 3M2RA 4Q43A 2KO1A 1LWFB 1TTHB 4LSNA 4NZ6A 3I0RA 3D6TB 5DG9A 4KAIA 2F5GA 3T1HF 5CCLA 4OFZA 4ZS6A 4JI5F 1OJ4A 1RJJA 1HNVB 2HEKA 4MYUA 4JI7J 3SIPB 3D6HB 3CIZA 5ITHA 3LPYA 4PG7A 1QSYA 4N7TA 1FK9A 4FPRA 3J81U 4ZLJA 3V5RA 4TY8B 1WEZA 1FVSA 2YKMA 1HNIA 5KFUA 3M8RA 2DGVA 3K59A 5DZ7A 4JI6J 5B0GA 3MMCB 2H3EB 2XB2D 3G82A 4I69A 4DQQA 2BJ8A 2B0GA 4WP3A 4Z7YA 5GAGU 1YBUA 1JLQA 4B3OA 4ZVUB 1HNZF 4X62F 4DR2F 4NMXA 5L9XA 3CJRA 2IM3A 2DH8A 1ZTTA 1ZZFA 3PYGA 3A12A 2V8HA 4NYPA 1H0HB 3RR8A 4C8LA 2XMVA 1SI9A 4DV5F 5DRKA 1M5VC 4FYYB 2WOMA 3KLEB 2JC1A 2FC9A 2FTRA 1GT8A 3P4UB 2DPIA 3CJ4A 2JZ5A 3PEJA 4LSNB 2RUSA 4DPTA 4KFBB 2MXYA 2W8KA 1MWYA 2NSCA 3I5AA 3BKTA 1I94J 5KG4A 4LQ3A 3C6UA 1SL0A 3DRXA 2ZNZA 3KLFB 3BR9A 2FQQB 2CJ9A 2M0GB 3FCHA 3D66A 3V6DA 1N56A 1EB0A 8ATCB 5LJ5Y 1RHJB 3V81B 2CWXA 4K4SA 4ZVFA 4B9NA 3VAMA 1X7VA 3GIRA 2YKNB 4CYUA 1Q8IA 2EFNA 4EBEA 3ZXWA 1H2VZ 1RTZA 3OFEA 4B3OB 1R8HA 1H6KX 1F9EB 3EXCX 4ERDA 1FKOA 1X9SA 2KVQE 3RB0A 1FE0A 1N48A 1TL1A 1BQNA 1RT4A 2W4DA 2LQJA 2OSRA 2G9OA 3KJNB 4AE5A 4OMFG 4R8UA 1FT8A 1ZAWA 2VBYA 4R0EA 3IM8A 4PQUA 3G6ES 1U09A 4MMOA 3MMAB 3OFFA 2B4VA 3GV5B 3VAGA 2YX1A 2B7BB 3KOAA 3OQ2A 3NWRA 1W2BR 1NXIA 4QPTA 1CJTA 1X0FA 2FHOB 3M6WA 3FQLA 1VQKS 4NPOA 2JX2A 4B3MJ 1QDUB 2OELA 3GLJA 1MSWD 3V4IA 5KFEA 3PKYA 1S12A 3PNIA 4EUVA 3N0VA 3V6DB 1EP4A 2NR0A 2HZCA 5CCMA 4YR2A 3TAMB 3FZ2A 2IRUA 3IBWA 4JV2A 2PI5A 3BS9A 1KNZA 3OVAA 2FVCA 3I82A 4CYUB 3BQ0A 2FVSA 3NGTA 3IRXA 2LKZA 4C3LA 2BKOA 2ILYA 1KHWA 3M32A 1LFPA 4PRFA 2DNMA 3UWTA 2IM0A 1QTMA 4FYVB 3QAEA 1Y5IB 1G7CB 1TV6B 1QM9A 3LO3A 2MSSA 1MMLA 1TL3A 1TL1B 3W5ZA 2UXDF 1RT4B 3PW2A 4RO0A 4JBCA 3K0JA 1NM2A 4KGKA 3IO1A 3KUEA 3AXMA 4DV2J 2MDAA 2LXUA 1B0PA 5L1KA 3DRPA 3PRDA 4PQUB 1V9OA 4K4ZA 1S76D 2IA0A 5KFMA 5CD4A 1HNWF 3TEHB 1YDLA 1IKXA 1CJTB 3PJWA 1KVIA 4DR7F 3TZWA 1M0SA 2AD9A 1HA1A 3TAPA 5F8LA 1RBAA 1WELA 1NCLA 1SIWB 2PO4A 4ZPTR 3PZPA 3V4IB 2DCUB 3CD0A 4ANCA 4U8YA 3DU5A 3BO3A 2GIFA 2PC6A 3HVTA 4DPYA 3CULA 2EEYA 2H65B 3OPKA 3SMZA 5D6GA 2GO8A 4RNHA 4OZ3A 5DZ6A 3IS9A 5IV4A 1NK7A 1UA1A 2F8MA 3M32B 4DL2A 5J1EA 1YJTA 3T41A 1Z4UA 1F5AA 4NXMJ 2FGOA 2CQHA 1ZAVA 2OKQA 4ITSA 3WBZA 3HHLA 1TL3B 2JLGA 4XTTA 5B0CA 2UV8G 4YR3A 1YTYA 4NLOA 4C8MA 4B3TF 2BVZA 4F7VA 2XHWA 5IC4B 5L1IA 3US5A 2WZ1A 4OJHA 2I9SA 2DGSA 3PW0A 5L9NA 5BJRA 1D1UA 1IKXB 1OPZA 3BV8A 5B0AA 4CM2A 4DFKA 4R5PA 4OYIA 2UV8A 1FFSB 1RWKB 2L3MA 3HX9A 5B09A 2IRYA 2B7CB 2P9GA 4J9LA 3FGVA 2VOOA 5KAKA 4LF4F 4A47A 2D9PA 5AXLA 1FWPA 4O3OA 3PW7A 3NEKA 1JQGA 4RBTA 2LEBA 2VH7A 2AZ3A 2O01C 4DCOB 4U95A 2E5LJ 1ZAXA 3T6JA 4DV4J 3VVUA 3PJ9A 1HYSA 2ZZTA 3VALA 2DGWA 1UZHA 2QGFB 3C2PA 1T94A 4A8FA 1T9TA 2AEMA 2FJAB 3W64A 1XTZA 5G0RA 3OUYA 3SSSA 3JTPA 4DR4F 4X4VA 2CKWA 1NSAA 4H4KC 1NK5A 3OLAA 2CNKB 2CPIA 3KK1A 1ZBTA 3W2WA 5DLFA 1KLNA 3PY8A 1EZZB 2WBRA 2C1EB 2B9YA 2UZAA 2M52A 4I7FB 2XS5A 1N33J 4MKBA 1WF2A 3BREA 3UN5A 1TZ0A 4F4WA 1KSPA 2HHXA 1FERA 3RYLA 4PCQA 3KMSA 1WHYA 4IG3B 3OD2A 3FKBA 3LA0A 1LXJA 3P49B 4KC5A 2R8GA 1RB0A 3BBCA 1DZ5A 3W5YA 1CQMA 3QJLA 2X1AA 1JLCA 1TL7B 3CDBA 2Q6BA 1C0UA 3M30B 3KLHA 1H7XA 3DRSA 3G86A 5LOQA 3TX8A 2XULA 5LMNJ 5G0RB 4O3PA 1HBMA 1FTRA 3QATA 1ZPWX 4NZ0A 1FD2A 2MYFA 3RB3A 4ANDA 5GAEU 1VQ4S 1KFDA 5KG3A 4CNZA 3PW4A 2CQGA 3KK2B 3W2VB 5F3ZA 1FVQA 1S72S 5ETPA 5C2GA 3I87A 6FD1A 4C0BA 1Q82T 2HZAA 1D9AA 4KKOA 2WTFA 5DQHA 2RRAA 4PXDA 5K8NA 1CJUB 4B9LA 3N5FA 1FRIA 2E9TA 2YKPA 2RILA 2HHWA 1WKJA 1NDPA 3MR6A 1T9XA 1Z2ZA 1UEVA 1WC3A 4KGXB 5IS2A 1QUVA 4M5LA 4OQJA 4NLWA 3I5CA 1IJFB 1REVB 1WC1A 2OD6A 4P72A 3UCUP 4JV0A 5CXTA 1H2TZ 3MD1A 4WIIA 2A0FB 2KB2A 4HVZA 2J9DE 3KNAA 2Z0GA 1S57A 3C16B 1WKKA 5HMZA 4NASA 3KLHB 2RS2A 3D2WA 4YS2A 1Q53A 1SC3B 2GAGC 3AA8A 4ZVEA 1IR0A 3HP6A 5LM7E 2UVVA 1RCXB 4QR2A 1HBMB 1KHVA 1NB7A 1W26A 1CSJA 1FRLA 2XLJA 3Q22A 2F7VA 5ETSA 1HW9A 1WACA 2XLIA 2AMCB 2ZUAA 2D69A 1TELA 2IC3A 1OMSA 4RUCA 1WG4A 2DXDA 2EFOA 3KG0A 2F4VJ 2RRBA 1ZOTA 3W8GA 2ADBA 2VOPA 1P6TA 3I5BA 3BGRA 5A76A 3GCXP 5KT3A 4RW7A 4O4GB 1LXNA 4YDXA 5DJBA 2W9BA 1FEHA 2HS3A 2E5JA 2BW7A 3GG0A 2HQ3A 4K0KF 2D9OA 4Q2LA 3HPOA 1F9FA 1ZYQA 3CC4S 4ECXA 3X1LB 2VC1A 2ZHAA 1WORA 1S1UB 1LFWA 4DR3J 3UO0A 4BC9A 4DUZF 3O2IA 3DDKA 2K1RA 1VISA 2A3JA 4ER8A 4PQAA 2BX6A 1C4AA 3AH6A 1NK4A 4L73A 5CYMA 1X5OA 3RGIA 3T5LA 3H90A 2YNHB 4DFMA 3I31A 5I42A 2E29A 1WHVA 4QW9A 1JLAB 1XNRF 1UVKA 4TVAB 3K8VA 3SSQA 5BYSA 3W1YC 1DTQA 2HBZB 2CVIA 2UVUA 2MGZB 4CQ1A 2YH1A 4TYBA 3M9MB 4DR5F 1JKHB 3JB9k 4MKAA 4YY3J 5KFDA 5A0YB 3HZGA 2C3MA 2O1PA 4LFCF 3BGRB 4C11A 2W9BB 2YH0A 4AD6A 3Q8UA 4DUYJ 1VYAA 5KT4A 2QG9B 3UCZP 1HWUA 4ECZA 2A2DA 2XM3A 3NGSA 2MJUA 3BSCA 4TN2A 2F9DA 2XYPB 3R9LA 1ZA1B 2ZDPA 5CH7B 2MQOA 1S4EA 1LWXA 2K1RB 2BUNA 4WP9A 4WTYA 3UNGC 2J6TA 4YB6A 3LP2A 4OZ2A 7AT1B 3MWBA 3DI6B 2D3UA 4RUHA 4Q8EA 4JI1F 4X4QA 1U6FA 3NCRA 4LF7F 2BQRA 2XMMA 4OV1A 3W61A 5EDWA 1WHWA 4IOCQ 1N6QA 2LCWA 3ETOA 2ZKUA 4QIVA 3AT1B 1TMMA 5D0GA 5FDLA 5EHHA 4J9QA 1ZM2A 1U0SA 2BACA 5ETVA 3PEHA 2KKHA 2XYGB 4TU7A 3CDUA 3U27A 2UVRA 1NK8A 2R7SA 2ZBCA 5HVGA 3ONQA 4OLOA 4M5DB 4C11B 5HBMA 5E3CA 4WKYA 2VJUA 2JEJA 4FN5A 1K0VA 1P9QC 2YKQA 1UWBA 1VS3A 1F60B 3CJKB 5J2PA 1MLAA 1H73A 3OXGA 2OMOA 2NZCA 2O3DA 2W2OP 3MD3A 4QCLA 3WQPA 3D0HE 3H5XA 3RW6A 1S6PA 5B7WA 3MM9A 1RU1A 2E7WA 3KKFA 3QIPB 4YMEA 2LEPA 1JMTA 2UUBJ 2BE7D 2RHSB 5C42B 2K06A 3LP2B 4DPOA 4NEZA 2HHTA 4O3RA 3M8YA 4NA3A 3JQMA 3KUHA 2K2PA 1NB2A 3HZEA 3V2UC 4ZVQB 4CDIA 3NMRA 2M9KA 3SFUA 4Y6IA 1VQNS 1H3DA 2CQ2A 3MTKA 5T7LB 4DPUA 1YVFA 5EGYA 1S10A 1BQXA 3M7VA 4AXJA 5ETNA 4PAAA 2EWHA 4DX6A 2I38A 1GMUA 2AQ4A 2BOAA 3E3XA 5HQ8A 4DV7J 1BUXA 3O1LA 1YRTA 1REGX 3QPIA 3PX4A 1FFWB 4DU7A 4YDDB 3DMJA 4IRCA 4ZPVR 3E2EA 1U6BA 4NLDA 3CE8A 4TY9A 2QYGA 3IWNC 3PHTA 2VD3A 2D41A 4FXVA 2GFFA 4NLQA 2YWEA 2ZE2B 1VQYA 2Y1RI 2AJ2A 1WF1A 2YPYA 1B0VA 1J5OA 4NCAA 1K1SA 1RWOB 2I0XA 4DV0F 2LU1A 2F1FA 4IOBA 1N5YA 4J9SA 4LF9F 1F5BA 3Q89A 1RT2A 4NI2A 5AE1A 2C2DA 2QL9B 2B5JA 4CO4A 4DBQA 1ICEB 1XWLA 3KFWX 5KFZA 3NXZA 3MGJA 1XMOJ 1QAYA 1L3VA 2C3UA 3OFGA 4USHA 3QLHA 2KM8C 1S48A 1S6QA 1VRTB 3SZ2A 2XO6A 1RYRA 4AT1B 3BN7A 3DOMB 2FHJA 3W63A 2H5IB 2HHPA 1VQ7S 3I96A 2PFFB 2KTQA 4UQTA 2HHHF 4W90B 2J9DA 4Y2KA 3EE3A 4BC7A 3B4DA 2GMLA 2FHJD 4IFYB 1G3OA 4MIBA 3CCWA 4DV6F 2M88A 3UD4P 4CLLA 4DL5A 4M95A 3KWMA 2BKPA 2QA1A 4F2RA 2VG7A 1W2IA 4GO5X 2HFNA 3M8PA 1PYOB 3QZ8A 1GQEA 3N28A 5E41A 1U7LA 2P2CB 5KFTA 3T5JA 4UOHA 3OV7A 3P6YC 1WDDA 3M2UA 2FZGB 4QYRA 3IM9A 2RIJA 2V2ZA 4G1QA 1XN9A 5KFNA 3PJXA 2GA7A 1EARA 1QAJA 2DITA 3JQJA 1VOMA 4EFAC 1WF0A 2RDJA 1NJIT 5KOWA 3Q0AA 3CCMS 4K4WA 2QE5A 1PCAA 3QJJA 3ENWA 3T3FA 2J7UA 2DR9A 2CPEA 2CJQA 4B9TA 2UUWA 4QYZJ 2GVZB 4JI7F 2HLUA 2KDOA 2MZJA 2QC3A 4ZPBA 4F4KA 3GG1A 2P5VA 2RF2A 4FVCA 3RBEA 4JI6F 1L3SA 3HXMA 5E3PA 4ZK7M 2CJAA 3OTOJ 3RRKA 1FNOA 2YNFA 4DUTA 2ZD1A 2M7SA 2YNGA 1P8GA 2D7SA 4E8UA 1BWEA 3M2UB 3HCXA 1YX2A 4HYKA 1OSCA 4B9SA 2RDDA 3SSRA 2GGPB 4ICLA 3LP1A 2Z4PA 1UL3A 1SH2A 3VGSA 1FX4A 1HBOA 2ZZNA 1NEEA 5KFPA 1NKBA 1FKAF 3GPAA 3IMQJ 3BKUA 9ATCB 1NJWA 1I94F 4PXBA 3QZ7A 2V8GA 1GFWB 1QAIA 3GYNA 1JLBB 4ED5A 3SQOP 1HI0P 4NX9A 1OS5A 2YX7A 4ZVGA 4OYZA 1PAUB 3DOLA 3CCJS 1SQEA 2BBEA 3R1HA 2AW0A 5H9EJ 4J9PA 3DLJA 3MAAB 4F3OA 4DL3A 3NL0A 4ZDNA 4OZNA 4CLZA 5HLFB 1TVRB 2R2TA 1QVGR 1NSPA 2J6UA 2XWXA 2B8PA 4PXEA 5A2QU 4LIWA 2Z58B 1HWKA 2E7VA 1VJWA 4KRWA 3RB4A 2C22A 2FJXA 4PWDB 4DQIA 3GIJA 2A2CA 2IIHA 3R6LB 4ECVA 4OZJA 2HIQA 5I4MA 1RT3A 1HARA 2F8HA 5F8IA 3LQVA 3LP1B 4ZP9A 3E01A 3GFZA 1MMNA 2FJBB 3A3OB 2F9JA 3DLLQ 2KT5A 4CIOA 3JTOA 2MKJA 5ETLA 3PR4A 3CCLS 3POTB 2V9WA 4B3MF 3IN5A 1NJYA 4ZN3A 5HVFA 2VB6A 4RW8B 3OFHA 3FEZA 1Q8KA 4MK9A 5CA5A 4FF4A 5C24A 3BGLA 4E2FB 1RLDA 1XK8A 2LP4A 2E1AA 4PEOA 5H9EK 3DM2A 5KFQA 4X4NA 5DDOC 3H98A 4MKVA 1UFKA 2EI5A 2JNJA 2OHDA 3I32A 3BF4A 4RW9B 3PIOQ 5A8RA 4XIUA 3W3SA 3ETMA 1R3NA 2V6AA 2XEXA 1Y5NB 3C14B 1U0HB 3L7UA 3DRRA 4DV2F 1MU2B 1DLOA 2BM0A 3MUVP 2ADCA 2VPYB 4OX6A 1FKPA 3PR5B 3Q8YA 1RXOB 1S1VB 1SJ4P 3VF0B 4RL1A 2MKHA 1Q7LB 1DURA 4NLXA 4OZ0A 1FRKA 2BV3A 3KHRA 3K5MA 1NAQA 1E6YB 1TKZA 3D0GE 2DXEA 4A8KA 2ZBPA 1T9VA 2W9CB 3ZZZA 2LQ5A 3UFCX 2WVFA 4Y65A 2RSQA 2Q43A 2GNKA 1AA1B 2H51B 5KFRA 2B6AB 3NMAA 2KRBA 2YQ3A 3MEEA 5KFVA 1N34J 2B56A 1JX4A 4NWBA 2E5HA 2V4JA 4DMZA 3QT8A 2WVCA 1AT1B 2IYIA 1S77D 1Y10A 1FE4A 1IWGA 5E7OB 1XIQA 1YJNS 5DQGA 1R27B 2Y0BB 2DTJA 1RYSA 3ILJA 2D3OR 1JXEA 4USMA 3MCOA 2FJDB 5JUMA 2G0IA 1Y00A 5K14B 2HURA 5ETTA 4DFPA 4E0DA 4FZVA 3KLGB 1FWLA 2M5YA 5HROA 3KG1A 1VQ5S 1PC5A 4N47A 4N8NA 1U49A 2AYMA 3AHPA 5E33A 2E5LF 5HJXA 1KOHA 2RRNA 4YFUA 5LJ3Y 1VHIA 2IDLA 4K2JA 4DV4F 3OTCA 1QVFR 1IM6A 4JV1A 5LL6d 1HW8A 1D9DA 2XNQA 3DLEB 2QEXS 2X3DA 2ZOFA 3CCES 2HPUA 2GHWA 4DSKA 1SJFA 1N88A 2OEMA 1RQ0A 4M1KA 3NGKA 4WPAA 2KFYA 3TZZA 1OSDA 1TU0B 3GFHA 1BD6A 1VRQC 1GMVA 2QRRA 3D0IE 1FF2A 2HFSA 5GMDA 2V4JB 4K4XA 1S4FA 3KXDA 3QSIA 2E44A 3WHIA 2MZRA 2DKOB 5IM0A 2DNLA 2DT9A 4LF8J 4I68A 3AD8C 3GU0A 3T1YF 2IVMA 4DU8A 2OAUA 1L5UA 1EQ0A 3HVWA 1A6LA 1OYEA 2ZWOA 2DISA 3I0SB 1JB0C 4WK3A 1SXLA 3BQ2A 5B0BA 1N33F 1EETB 1RABB 1UJ4A 1R8BA 2E1CA 1GX6A 1TFYA 1LWEB 5IWAJ 2V50A 4ZOSA 2F8EX 3LWLA 2V8PA 3ICLA 3OXFA 4PYAA 1RT6B 3KDOA 4OHZA 2FVPA 1CC8A 3P96A 2H4YB 1V5VA 5K8MA 1VIXA 1TP7A 1SPBP 4FYXB 3D7SB 1RWWB 5B0DA 1Z1ZA 3LPEA 2FZKB 1KKHA 5CQGA 4Q7AA 1RAIB 3BPDA 4IRKA 3PX0A 4UTGA 1T11A 4H4KA 4PUOA 5L46A 5LMNF 1YRUA 4J9VA 2VPWB 4LR9A 4DG1B 4HACA 2RJZA 1KQFB 2OFGX 4KQZA 5FIIA 1SL1A 3ULHA 2L9DA 3G87A 4Z2XA 3P3DA 3MDFA 1OY8A 1UW9A 5K9FA 4NXNJ 1VDHA 1K0TA 2VZ9A 1RA7A 4YB7A 3GR1A 3G8SA 5F8GA 1RDRA 2DB1A 1ZH5A 2D3O1 3V4MA 1LNQA 4GVBA 3TVKA 3UN3A 1FX2A 1CJVB 1VBKA 4W92B 4K59A 1H74A 4ZVHA 4RU9A 2JOQA 1WOSA 2PI4A 2PIIA 3D6FB 3AB4B 1D8YA 3G8QA 4ZHRA 1QE1B 2KHDA 1KEKA 3JSYA 4IUFA 3K8WA 1HHQA 3AQPA 4TYAA 4I2QB 1T95A 1JJ2R 2W1BA 3K5LA 3QNWB 2VIHA 2GVDB 1VC6A 2IAJB 4H4MA 4M8LA 4D3HA 2I5JB 4U7CA 6AT1B 5D8HB 3GJSB 3HHEA 3MFHA 4LMZA 2G13A 2VV5A 2W2MP 4AL7A 4ZVOB 3AA9A 4PUOB 5B0EA 4JI0J 2XTJP 3WZ0A 3GMGA 5DG7A 3FFIA 3N4WA 4F3QA 4OI3A 4ECYA 2B3TB 4LJMA 4LIRA 4RNOA 4UY8T 2CJKA 4NE9C 1J5EJ 3OR2A 4RW4B 1SV5B 2OPPB 1U1LA 4J9RA 1UKUA 1GMWD 2RD5C 1OIAA 2V34A 2QSWA 1M5SA 2LXIA 1RT7B 3VQTA 2CNLB 1ZM3A 1NBEB 2NQPA 1NH7A 3NGUA 2I2YA 3QRPA 5IC6B 4KB7A 5KFXA 2BM1A 1IKWA 4DR3F 4DN0A 4FBUA 4NLRA 4FS2A 3BB5A 8RUCA 5EWEA 1RT1A 4CZCA 3CCQS 4K7QA 2HIYA 4TXSA 4O44A 3NAIA 2JVOA 4Y2IA 2MZTA 3FMBA 3HFZB 2JLFA 4G1IA 1PBUA 2WRMA 1MROA 2HVIA 1F6TA 1S0VA 2VBXA 1TUGB 1RWPB 2HNZB 2XSJB 3DFEA 2N4CA 3Q2TC 2Q3PA 4GO7X 3BBFA 3UR0A 5HMYA 2EW9A 4IOAQ 4P52A 4ZCMA 4L3KA 2ZDOA 2A6OA 1P1TA 4YY3F 3NLCA 1TL5A 1NHKL 2HYIB 4WP8A 2BDPA 2WBMA 2QL7B 5ETOA 3VAFA 4DUYF 2HS0A 4OIXA 1RAHB 2QO3A 1FRMA 4WFAQ 1UPMB 2YWHA 4QJVA 2GIRA 2CPFA 1IKWB 2WB1D 3DDIA 3WIUA 4C9DA 4LBIA 4ED3A 4CO0A 3IR5B 4V1Ak 3SDEB 1DQAA 1RT1B 3A8KA 1JK9B 4A4JA 1X5TA 2YVSA 1UVNA 2VODA 1RTHB 3R7BB 2QJ3A 2HHQA 2HQDA 4O44B 1O6XA 3I9ZA 4Z37A 5GADU 4XAKA 5SUHA 4GKKJ 1TKTA 1S49A 2NCKL 1B64A 5IQQA 2J9CA 3CB4A 1NKCA 3MUTP 1MN9A 4AUKA 4V19X 1TKXA 2NPIA 2Z57B 2OPRA 3IBCB 1VFJA 3ZTOA 4NCGA 2EFVA 1HBNB 3EUNA 2K3IA 3CJ8A 1S5ZA 4B3SJ 3VAJA 4QU7A 1S1XB 4CH1A 2FY1A 3NY0A 3CC2S 1HMVA 4KV8A 3UPFA 2LDIA 1I1GA 2HBRB 4Y3CA 2CA9A 2PGCA 1T05B 4MT1A 3H7HB 4CP5A 3EGVA 2HFVA 5DS7A 2HQFA 3ITHB 3OL7A 2N7CA 5ETQA 2V4QA 2V63A 3CF5Q 2UUBF 4BCAA 2MY8A 1S6OA 2IMOA 3CJQA 4OX9J 4I56A 2QTWA 3LGHA 5CD4H 4C7QA 5HP1B 4DCPB 4MKYA 2CPDA 3V6JA 4UQGA 4RWXA 4C4WA 2Z56B 4M5JA 1KLMA 4EO8A 1RU2A 6FDRA 5KFOA 4J37A 3EGZA 3LP0B 4I1TA 3ZNJ1 3FSIA 2JSXA 2CQBA 3D6MB 3D3CJ 5B08A 1YJWS 1RWNB 2Y1LB 2EFGA 2VDIA 3A4TA 2PE8A 4X65J 1LW2B 3CIMA 3MR2A 3JSMA 4PWWA 2RNEA 4ID5A 3M8QB 4ALZA 4DS5A 5A6WA 3DLHA 2DK2A 5J2MA 3KUGA 3CJ3A 2IMWP 1HI1A 1N8RT 2HMIA 3ZTQA 3FJ2A 3HD1A 2FLPA 2Y9HA 4X66J 5FLXY 4OZ1A 5KFYA 1WC5A 5F9NA 4EGLA 1PBAA 3JYTA 1H2UX 1YKWA 1VRUB 3TEGA 3H40A 4P74A 4RJVA 2GS8A 4C8OA 1O8BA 3KYLA 1KLMB 2KG0A 5CYQB 5F0WA 5HI7A 4J9NA 2UP1A 4DZDA 1RISA 3JXOA 1P9YA 3TI0A 1GH8A 3ZTRA 4RNNA 2WONB 2BE2A 1XMOF 1U6ZA 5DM7Q 4U67Q 1R6VA 3NCQA 1NLKL 3R1LA 1CQNA 2CDQA 4B3RJ 4M5MA 4URSA 4NLTA 2CQ1A 1LWCA 1HBUA 3VCDA 1UEUA 3HO1A 4KH1B 3J7YU 2XLKA 2HHUA 3OT9A 5HJYA 3NS6A 1F9HA 3MEGB 2GQCA 1R0AA 2HMIB 3RUBL 4LR8A 5I3UB 1RWVB 1Q16B 2AX1A 4ZPCA 1U1NA 1FDNA 2N3LA 5J2QB 1XEZA 4F8RA 4M94A 3JYTB 1R0CB 2VA3A 3DYAB 2BRLA 1O0PA 4BBYA 7FDRA 3EDQB 4WXOA 4NMLA 2RU3A 5KFKA 5J2NA 5JJBA 3QGHA 1URNA 1X5SA 3P5TL 2XMWA 3SV3A 5KFJA 2BE2B 5GMKa 1Q5YA 3VAKA 3MPDA 1JLGA 4WFZA 1RWXB 4LF9J 1K73T 3KJVA 2KI2A 4C2MA 1IVZA 2G0CA 2BJ3A 3PRBA 2ZH7A 4DL4A 4FYDA 3L9ZA 4EBCA 4P10A 3TZXA 2VASA 3L7OA 2EBGA 3ZZPA 2DVIA 1VLOA 3HHKA 3WX4A 1ITPA 1LWFA 3M6XA 2CJBA 3LAMA 4ES2A 2KZZA 3EMTA 3OTOF 2DHHA 3M9NB 4N56A 4AXIA 4W4MA 4OJ1A 4RUAA 3KNGA 4Y2AA 2OPSB 1DQ9A 4WFXA 1HNVA 4C97A 3G71S 3CCZA 1U1QA 4FXWA 3IWLA 3T9ZA 4WKRA 1K47A 2UUTA 4TY8A 4RWWA 3TRGA 4KHPJ 2R7QA 4LVNP 2WSCC 3HFKA 2KXHA 3MMCA 4OYMA 2VPZB 1HIYA 4P2XA 3M1VB 5LXYA 5D0HA 3OTDA 1YJRA 3F73A 2K8GA 1NK9A 2MQQA 3V6HA 2QA2A 1Y3KA 1V3SA 3CO9A 4FVMA 4O3NA 5KT5A 2JEIA 4OYOA 2ATLA 1VQOS 3KLEA 5G4DA 1IKYB 5MAOA 4OHVA 5D3GB 1U02A 3CDEA 3BO4A 3CWJA 1YBAA 2C42A 3GV8B 1OY6A 3AOBA 4KFBA 2MZ1A 4KGVB 1KONA 2XI2A 2EG2A 2E5IA 2F40A 1U8SA 4DZ6A 1IXKA 3KLFA 2HVDA 3QQCD 3MURP 2MQNA 2G2ZA 1DAXA 3QBCA 3V81A 2OTJS 4C8YA 1X4EA 1KD1T 1H38A 1QAXA 1JLEB 2CPXA 2DNNA 2YKNA 2R3VA 5L1JA 3NNAA 1M1HA 1AZSB 2XCPA 4LBHA 1HPZB 3KLVA 2XGPA 1U1RA 2YTCA 1YIJS 3PYDA 4QU6A 1FJCA 2AJ4A 1NJZA 2HLTA 1FA0A 1WSVA 3DOKB 2XI3A 4DQSA 4CLPA 3MMBA 4USVA 4PZVA 3GYGA 2R4FA 4OX8A 3PHEA 4DV1J 1IKVB 2QLWA 2KFZA 3R5DA 1A9NB 3GYXB 2DGQA 4NRTA 3CSKA 1NDCA 3MMAA 3LWMA 1L3UA 1VQSA 4RU2A 3THVA 3FC9A 5AE2A 3RTVA 2LFVA 2XY6A 2HK3A 2LECA 1FRXA 3SYZA 1DARA 2ZNYA 5DM6Q 2OMLA 2PT0A 3BR8A 5D77A 4NLGA 1WI6A 4M5GA 3TUIC 5THWA 2Q79A 4WJBA 5T41A 2C2OB 5GADI 5KT2A 4K2XA 4PG6A 2H5JB 2QFJA 2HVEA 5E0OA 3SQGB 1IM4A 3PW5A 8AT1B 2NYIA 1CLFA 3U1MA 3TAMA 4EI2A 1V3ZA 4WWSA 3HI9A 3DU6A 2W4PA 3UW1A 2NYHA 3BZQA 2SXLA 5DDRC 4PPZA 2HQCA 2V8VA 2IBKA 3AAWB 4Q2MA 4HR2A 2MKKA 3H25A 2DHAA 3DHXA 2VICA 3KJFB 3D9BA 3MM8A 1TV6A 3MMBB 1RI7A 4Y34A 3J7A1 5SZTA 3R3TA 2MZSA 4P2SA 2DHSA 2VG6B 4ETXA 2KU7A 1P1LA 3OL9A 3DDNA 4M5NA 3UI3A 4Q8FA 2YPZA 2EFQA 3MF5A 5F3TA 2DNZA 2U1AA 4DX8H 3TUJC 4RBUA 1R89A 2IM2A 4LFBJ 3RW7A 2HVZA 3CJ0A 1CG2A 3IWXA 1SCJB 4IH7A 4DN9A 4O3QA 4RNMA 3LALA 5K8OA 2CRLA 2DGXA 3RAQA 4WK1A 1N34F 2PMHA 5J1PA 4G3IA 3UDVA 4ELUA 1U2RA 1FD8A 3MHYA 2ERRA 5KFHA 3A3NB 4NRUA 3L4BC 3I4PA 2XS2A 2POKA 1XR6A 1NPPA 3TA2A 3NRBA 4G65A 4LUBA 3H0PA 2MKSA 3QFHA 2QLJB 3LGMA 3GIIA 1EX8A 2YNIB 2AYEA 3MM8B 4ZCLA 2XY5A 2ZJQQ 2P9EA 4EK2A 2UU9J 4USJC 3UCGA 1DTTB 3J80Y 1XR7A 3L3CA 4C0HA 3QO9B 1T03B 3SV4A 4N76A 4TU9A 4P75A 2YWGA 1D09B 2GMJA 3MR7A 2HRUA 1M5OC 2A1BA 3BDEA 3CNQP 5GAHU 2AIRB 1V3RA 3HFVA 1F2GA 2DNPA 4LRAA 3TVZA 1HD1A 1RTDB 2CG4A 1DRZA 4EYIB 3Q8VA 4CLSA 1U1OA 3WC2A 3PO5A 1S9GA 3DLGB 4LF8F 1DBDA 1MW7A 2WK4A 3J7ZT 2DR7A 1FO1A 2J8AA 1BMQB 1C1CB 2BJDA 4LFAJ 3R6GB 2WAQD 2DBBA 4LSLB 3AY0A 1ZS6A 4ED4A 4CO2A 2CFXA 3MCMA 2RKIB 4CM0A 4AFFA 4J9MA 4G1PA 3AD9C 1U2CA 2JVRA 1WDTA 5IWAF 3BH7B 2RQMA 3DCAA 2OLWA 3D1OA 2XYHB 2A6MA 3E51A 2K7JA 3TARA 2VG5B 1SIZA 1EQMA 1FJGJ 2KRRA 1R7IA 4I7FA 4DV3F 3PFOA 4IO1A 4EWTA 1S97A 1SB6A 3QWUA 2CUYA 1TFWA 3F0NA 1UTAA 5ETMA 4IG3A 2IJRA 2QT7A 2DNKA 3G6XA 4XO0A 3MCNA 3Q8RB 4ILMA 1S9GB 2QIFA 3IR6B 5CABA 2JC0A 2L48A 1KTVA 3MM6B 3ZC4A 3EICA 4NXNF 1UP1A 4QW8A 1TL7A 3M30A 5MLCV 2LA6A 1GK8A 3DN9A 4ENOA 5RUBA 2MLZA 3LAKA 4P9SA 3MEKA 3BM7A 3G2XA 3U02A 1R43A 4HEA9 2OH2A 4YP3A 4WZMA 2HHVA 1VQ8S 1S6UA 1NZ8A 3DHWC 2AX0A 3TZYA 3EXYA 3T1YJ 4PPDA 5KTQA 4DF4A 3K17A 3F41A 3KK2A 3W2VA 1TK0A 1YGYA 2B8QA 3DLKB 3BSNA 1YI2S 2DEIA 4CH0S 2MTLA 1GXTA 4LF2A 4ZVPB 2Q66A 4YR0A 2GJ2A 1YJUA 4C98A 2ZH6A 1SJRA 1Y0HA 5A6PA 1CJUA 1FDAA 4FNHA 4KJIA 2DNOA 3OW2R 1LK5A 3SI8A 2YKAA 1EJ7L 1XC9A 4JI0F 2KYZA 1CVJA 1LW0B 4WFYA 1H72C 4U7UK 2AP6A 3S7RA 4CLYA 1FRJA 1KR4A 5KG6A 1REVA 2MQ8A 5KFAA 1WWHA 2M8DB 2NREA 1UA0A 1X5PA 3DLBA 2FYXA 4KO0B 1R31A 1VBZA 3QT6A 2KT2A 4BWJA 3C3LA 3C16A 1J5EF 3D1QA 2CQIA 5K8PA 4UY85 1DJ0A 2ASYA 2Y3YA 3A8IA 5KFSA 1G4CA 2W7OA 1F1BB 1HQUA 4J91A 3FMWA 4NOHA 1VC0A 2J0SD 3HK2A 3G8TA 1Q0NA 1U26A 2XGQA 2UUCJ 3OHBA 3BDPA 4J9OA 1HI8A 4ZIVA 5KFFA 2I8EA 2ASDA 4FBTA 1NZAA 1SQFA 1PJ5A 1CJKA 4F02A 3I6PA 1N5VA 4PABA 2B4OA 4O4GA 2QLFB 4EBDA 4KTQA 3NBPB 2HGNA 4WYWA 2KL8A 4K4UA 4EZ6A 1S1TB 1FEEA 2PFDA 3TJ9A 2OPQA 1VJQA 4F67A 4URQU 2ROGA 1S1UA 2KG1A 2KYXA 3BGFA 1ZPVA 4RW6B 3K2YA 5EX3A 1W25A 5GAGI 3MI7X 4ED1A 3GJQB 2R2SA 1U1PA 4JI4J 4YN3B 3GQCA 2AF6A 2CADA 3R97A 3QGPA 3SBMA 4M5KA 4IYQA 2MQPA 4IR9A 2YNHA 2M3DA 4A8OA 2DH7A 1HQUB 2XMKA 1JLAA 4H54A 1U1MA 2DRDA 4EO6A 1RE1B 3C15B 4IFVB 5KFCA 1YK9A 2U2FA 3HDSA 3C8YA 2OO4A 3H5SA 2QMWA 3FEXB 2MGZA 1C0TB 4E98A 4DPXA 1JKHA 4CH7A 3L7PA 4X4PA 5A0YA 3I4HX 1CJKB 1N5SA 4DQPA 2HVHA 1RT5B 1S7HA 4Z7CA 2ZHOA 3ADAC 4CWBA 3J7AN 2OPQB 4DHVA 4GKKF 4ZLLA 1IUJA 4X64J 3K5OA 4F3MA 4R0JA 2I1RA 2VPXB 3ZTPA 2HGLA 3AQOA 4UUXA 2E9ZA 4FNIA 2NXCA 3DXBA 1QJHA 4ZIWA 3DI6A 2AKWB 2R7WA 2ILZA 4B3SF 4F4AA 2CYYA 2MB0B 4LRDA 2ZBIA 1YJ9S 4CNYA 5F8MA 2BJ1A 2FD2A 3FUYA 3JS9A 3AODA 4I0WA 3KHHA 4N5SA 3ET6B 3MZIA 3FCWA 2LDYA 2BANA 4M5DA 2L08A 1S9EA 5AXMA 2GJFA 2B43A 4OX9F 4KE5A 1EAYC 2K7KA 1ZM4A 1IJEB 5HL7Q 2AHOB 4ZMMA 3CJKA 5E3RA 2GQQA 2G1HA 2FDNA 2VKRA 2HRTA 5FLXU 1S1WB 1KVJA 2HNYB 3QIPA 3QT7A 4I2PB 2UXBJ 2M8HA 2X1FA 2XG8A 2RAQA 5C42A 5LSRA 3OR1B 4EYHB 4HDGA 1HHTP 4F36A 2ABYA 4X65F 4UOFA 2FGCA 3H2UB 1KDNA 1IR1A 3MR5A 2UXCJ 3PFEA 2OFHX 5JVHQ 4QQBA 4DWIA 1BQMB 4ELTA 2C3YA 3IGVA 3NOCA 4KY3A 3Q23A 4PG8A 3MECB 4OYBA 2XC9A 5T7LA 1YHQS 1I51B 2WHOA 3GCWP 4RKUC 4K4YA 2V94A 2N3OA 1IBKJ 1EHWA 2B9WA 2ZZMA 4X66F 2HW3A 2IRXA 2XZDB 2BANB 2MHNA 3HJVA 3NGDA 2BZ2A 1S9EB 1MG7A 2QSFA 4U8VA 1GXLA 3PRVA 5C2CA 1RTJB 1NK6A 4PG5A 2Y1IA 1Q8LA 4B08A 4DX7A 2HWIA 2VFTA 2ZBQA 4ZPAA 1RKIA 4ZPWR 1RAOA 4C8NA 5CZVA 3PX6A 2ZE2A 4YEAA 1CS4A 3PIPQ 3H5UA 1RA6A 2HS4A 1PSDA 3M4XA 4IDKA 1RHUB 3TAQA 4B3RF 1ULRA 5DETA 2R7RA 5IFMA 1HQ2A 3CCVS 5A8KB 3UVJA 2JFKA 1CULA 1SKSA 4ECUA 2P6SA 2JWNA 3EX7B 3HSDA 2GQ2A 3H4BA 2G2YA 5KG5A 4CTAB 3GONA 4UUWA 2V9KA 1VRTA 3DOMA 1RAJA 1YBTA 4W98A 3ZFVA 3W8PA 2YY3A 2DRAA 3EGNA 1X31C 4LT6A 4RPFA 3PACA 7FD1A 3NNCA 2O67A 2J76E 4IFYA 4ES3A 2HQGA 2PD1A 2XZTB 2BKNA 2VL1A 1BLUA 1B99A 3UD5A 2Z30B 1NSKL 4XPEA 1CS4B 2KJWA 1MWZA 2XCAA 3SXLA 2W01A 3B78A 4IDKB 2AYBA 4X2BA 2W9AA 3VQSA 2BABA 3ZNUA 2C3OA 3K57A 2V68A 3FQKA 4HI1A 4LVOP 5IT0A 1VBXA 3UVJB 2MHEA 5D4OA 1CULB 2DY9A 1GAOA 2W7PA 3OSNA 4P2FA 1HQEB 1XMQJ 3M2RB 2KXNB 4OYXA 2DD8S 2C2ZB 4DSIA 2ROPA 3CJ2A 3AOAA 4EZ9A 3I0RB 2HGMA 1A7GE 1U4BA 2H4WB 4U6PA 4N41A 4V19J 4ECRA 2X51A 2GVZA 5KOXA 4GVLA 3FZBA 4FXDA 3OSPA 1FK9B 5EX0A 3PV8A 4WCEQ 1FTCA 2YKMB 1HNIB 4ZJLA 2XMUA 1N52B 2RDIA 1JJHA 3ILIA 4KHPF 2FUG9 3K5PA 3HT0A 4ZPDA 4WF9Q 1NJXA 3G82B 2IYGA 2XNRA 4MTPA 4OL8A 3BO2A 1JLQB 1S59A 2WW4A 2DCLA 3HT3A 2IDEA 2RVJA 2ALYB 1R8AA 5J1NA 1SKUB 4OYAA 1KWMA 2MQMA 4DDFA 5C25A 1I6JA 2IJNA 5GAEI 2RE1A 2QX0A 2ZM6J 1SUQA 2R8HA 4AL6A 2GGPA 4ECTA 2JH3A 3S01A 3FBFA 2HBYB 2WOMB 1X4FA 1LKZA 2DIUA 2FJVA 5HK4A 1BHNA 4IO9Q 3H59A 1UFLA 4WFBQ 2HWTA 1NDLA 1UETA 3C6UB 1BE4A 3QMQA 2N7YA 2DJWA 3Q8PB 1JLBA 4OHYA 3RU0A 3K58A 5A2QY 1HWIA 2W4CA 1OQ6A 3S6EA 4CO1A 2OIHA 1N5TA 3IRWP 4WZQA 4ZP7A 3UDLA 2C2EA 1WHXA 1Y5LB 4C48A 4JI8J 4GKJJ 1IN0A 2G4BA 1T9YA 3D1HA 3MAAA 3K89A 3KLIA 5HLFA 1TVRA 2LMIA 4CRJA 1XJWB 4DL0C 1AUSL 1M1GA 3M8WA 4B17A 5C7PA 1B7YB 1FKOB 5LMUF 4IH6A 4P7VA 3SFGA 2V2KA 4BLGA 5C25B 4PWDA 5LSLA 2KH9A 4L75A 5CYJA 1V5IB 1BQNB 2ZWPA 1M5HA 4I6YA 4DV1F 1SUQB 3EVMA 4R8UB 3WIVA 1LOUA 1HWJA 3IGNA 4U7UD 4L72B 4M5IA 3CVKA 2W25A 2AJQA 4ELVA 2LA4A 1Y7PA 5IXUA 4A8SA 4K50A 3CD7A 3SEOA 3POTA 4MK7A 2E1MC 2V2VA 1RKJA 1P27B 2H9ZA 3CT9A 3F56A 4RW8A 4LSZB 4WIQA 2CQCA 4TNOA 3VWSA 1EP4B 4QYZK 3TANA 3U1NA 4KYZA 4Q44A 4JI3J 4FF1A 1SC6A 3OBIA 1CEZA 3NAHA 1XNQJ 2GJIA 4RR5A 1M5PC 3IRXB 3KLIB 3J81j 2PN6A 3KK3A 4J5OA 1U24A 1OPIA 4FPIA 3NS7B 4NA2A 1KC8T 1RZMA 2E1PA 3CCUS 2Y8YA 3OTEA 4RW9A 2ZFHA 2VFRA 2ZJPQ 2HHSA 2HFZA 3DGVA 3PYEA 2Z8QA 2Y1JA 2VJVA 1HNXJ 3A13A 4YHHJ 2ZC4A 1Z2LA 3C14A 2FLOA 2IM1A 1U0HA 1MU2A 3DRPB 2W24A 2RMLA 5IOLA 3W65A 3HHLD 4R25A 1RHQB 2FJEB 5KG0A 4KIAA 2FJWA 2PEHA 4RZRA 4LFBF 1Y9OA 2EK1A 1GXUA 4LRFA 4MAKA 2KHCA 4UZCA 3J80U 1S1VA 1ZM9A 2EC0A 3RJMB 4A8YA 5AJ3J 4P7TA 4ECSA 1WTBA 4G6VB 2ZJRQ 2X3GA 3FDSA 1C4CA 3HVTB 4FKYA 3TQEA 4LBPA 1E6YA 4ZCIA 1TK8A 1RAGB 2W9CA 3IS9B 1LQ9A 2BEFA 1N54B 2GHVC 2ZHBA 3RB6A 2BR0A 2B51A 2J9EA 2EFPA 3KK3B 1Q86T 5J1EB 4HKQA 2VQFJ 5KFWA 2B6AA 1TAQA 3QFWA
chains in the Genus database with same CATH topology
5IWAJ 4DV3J 2HHHJ 3R2CJ 4KHPJ 3R2DJ 5LMUJ 1IBKJ 2ZM6J 4DUZJ 3OTOJ 4B3SJ 4B3MJ 1I94J 4X65J 1XMQJ 1HNXJ 4YHHJ 4PWWA 3JAMU 2MEWA 2UUAJ 4JI7J 4B3RJ 2UXDJ 4DV5J 2VQEJ 4DR1J 3W1YC 5A2QU 2KL8A 5BR8J 1N33J 4DV6J 4B3TJ 3J81U 4LF9J 4DR4J 2F4VJ 2MQ8A 3J7AN 1IBLJ 4JI1J 3T1HJ 4YY3J 1N34J 4JI6J 4LF7J 1XMOJ 4LFAJ 4DV0J 1HNWJ 4X64J 4JI5J 1HR0J 1XNRJ 4LF5J 2E5LJ 4DV1J 5FLXU 4DUYJ 4JI4J 3J80U 4V1Ak 4X66J 4DR7J 2UU9J 1N32J 4DV7J 1N36J 5AJ3J 4DV4J 4JI0J 4HHUA 5IT9U 2UXBJ 4LF8J 4KYZA 4OX9J 3IMQJ 4AQYJ 4DR5J 4JI3J 1IBMJ 2KVQE 4DR3J 4RJVA 4NXMJ 4LF6J 4JI8J 4GKJJ 4GKKJ 4LF4J 4NXNJ 4DR6J 4LFBJ 4LFCJ 3T1YJ 1XNQJ 4NEYA 3D3BJ 4JV5J 2UXCJ 2UUCJ 1J5EJ 5LMNJ 4DV2J 1FJGJ 2UUBJ 4KY3A 5LM7E 4K0KJ 1HNZJ 4JI2J 4X62J 4JYAJ 4DR2J 2MTLA 2VQFJ 4NEZA 3D3CJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA J;  4DV3 J;  2HHH J;  3R2C J;  4KHP J;  3R2D J;  5LMU J;  1IBK J;  2ZM6 J;  4DUZ J;  3OTO J;  4B3S J;  4B3M J;  1I94 J;  4X65 J;  1XMQ J;  1HNX J;  4YHH J;  4PWW A;  3JAM U;  2MEW A;  2UUA J;  4JI7 J;  4B3R J;  2UXD J;  4DV5 J;  2VQE J;  4DR1 J;  3W1Y C;  5A2Q U;  2KL8 A;  5BR8 J;  1N33 J;  4DV6 J;  4B3T J;  3J81 U;  4LF9 J;  4DR4 J;  2F4V J;  2MQ8 A;  3J7A N;  1IBL J;  4JI1 J;  3T1H J;  4YY3 J;  1N34 J;  4JI6 J;  4LF7 J;  1XMO J;  4LFA J;  4DV0 J;  1HNW J;  4X64 J;  4JI5 J;  1HR0 J;  1XNR J;  4LF5 J;  2E5L J;  4DV1 J;  5FLX U;  4DUY J;  4JI4 J;  3J80 U;  4V1A k;  4X66 J;  4DR7 J;  2UU9 J;  1N32 J;  4DV7 J;  1N36 J;  5AJ3 J;  4DV4 J;  4JI0 J;  4HHU A;  5IT9 U;  2UXB J;  4LF8 J;  4KYZ A;  4OX9 J;  3IMQ J;  4AQY J;  4DR5 J;  4JI3 J;  1IBM J;  2KVQ E;  4DR3 J;  4RJV A;  4NXM J;  4LF6 J;  4JI8 J;  4GKJ J;  4GKK J;  4LF4 J;  4NXN J;  4DR6 J;  4LFB J;  4LFC J;  3T1Y J;  1XNQ J;  4NEY A;  3D3B J;  4JV5 J;  2UXC J;  2UUC J;  1J5E J;  5LMN J;  4DV2 J;  1FJG J;  2UUB J;  4KY3 A;  5LM7 E;  4K0K J;  1HNZ J;  4JI2 J;  4X62 J;  4JYA J;  4DR2 J;  2MTL A;  2VQF J;  4NEZ A;  3D3C J; 
#chains in the Genus database with same CATH topology
 1VQM S;  4ED6 A;  3TO8 A;  2PMZ D;  5CAA A;  3PXG a;  3HHL B;  3RBD A;  4MFB A;  2UU9 F;  1EIY B;  1WNE A;  3BSO A;  1G1X A;  2CJY B;  3JAM Y;  3PKM A;  2NPF A;  5BR8 J;  2AYG A;  4HL9 A;  1WEY A;  5D0E A;  1MWQ A;  1FES A;  2VFU A;  1IBL J;  2RH3 A;  1S0O A;  1F2H A;  4BHQ A;  2BRK A;  5AXK A;  3TWZ A;  3F44 A;  4XPC A;  4UZB A;  4R5P B;  3N9U C;  2ZH4 A;  3IFE A;  5K14 A;  4Y28 C;  3TNV A;  1D3W A;  3IA0 A;  2NXN A;  5KFG A;  3ZZU A;  3DRY A;  5KG7 A;  3KLG A;  2V0N A;  3NWG A;  3UN2 A;  4LF6 J;  2AGP A;  4QBU A;  4DR6 J;  1EKS A;  4FF3 A;  3ZZ0 A;  3O5T B;  2GW8 A;  3D3B J;  3OVB A;  2RS8 A;  4AYB D;  3H42 A;  3MPW A;  4MYT A;  4QPX A;  1D0E A;  2RQ4 A;  3EZ5 A;  2DNQ A;  1HYS B;  3BGO P;  3TQ1 A;  1FJ7 A;  3DLE A;  3LUY A;  2ROE A;  2COL A;  2OUG A;  2QN6 B;  4LFA F;  1CC7 A;  3OVS A;  3J7Z 5;  4O23 A;  4DR1 F;  4USU A;  2MEW A;  2UUA J;  4MFB B;  3OUY B;  2VQE J;  4OI6 A;  2NUH A;  1SQG A;  3H2L A;  1X4H A;  2V67 A;  4DXL A;  1TR0 A;  3KK1 B;  4IR1 A;  3W2W B;  1UEK A;  2RQC A;  1RGV A;  3U1L A;  3CJT A;  2EVZ A;  2E7X A;  3SCJ E;  5BYR A;  3PO4 A;  4DSE A;  3I0S A;  4C0O C;  2WCX A;  1FJG F;  1Q81 T;  2E1R A;  3LW5 C;  4A48 A;  4U9R A;  1X0P A;  3PDN A;  2VKZ G;  3OL8 A;  2R7T A;  3BGU A;  1EET A;  4RBV A;  1U45 A;  4OZ5 A;  2DNR A;  1X4A A;  1E6V A;  4QIF A;  4UW2 A;  3A8E A;  1LWE A;  4ZP6 A;  1S9F A;  3UQS A;  4JUZ A;  2MLX A;  2NUU G;  5EN1 A;  1RT6 A;  4JV5 J;  3OLB A;  4BS2 A;  4WU3 A;  5DO2 A;  1G6B A;  2XMJ A;  2CAJ A;  3HHD A;  1U8W A;  2NXU A;  4TLQ A;  1WUU A;  4RX6 A;  1JLC B;  4UST A;  2UVW A;  1Q8B A;  2BJ7 A;  4J9U E;  2R7X A;  1C0U B;  3CDA A;  3BYP A;  3DRS B;  5F8H A;  1XER A;  2OD4 A;  3AFG A;  3FBB A;  2ZVI A;  3E8O A;  2Z2L A;  4DG1 A;  2EXU A;  4HH0 A;  4ZIT A;  2ASL A;  1ZA2 B;  3GZ7 A;  2CNN B;  1QY7 A;  1BXN A;  3R7S B;  1UW4 A;  3WX8 A;  1YWX A;  1SC1 B;  3HM9 A;  1VQP S;  4YOE A;  3GSI A;  3BQ1 A;  4X4S A;  4LF5 J;  1Q4R A;  1X4G A;  4OYW A;  4K8R A;  4KKO B;  1CJV A;  4I6A A;  2ZC3 A;  2OP5 A;  1KQS R;  2DGU A;  1E6V B;  4PR6 A;  4DSJ A;  4IG0 A;  3HMJ G;  4B02 A;  1QE1 A;  1NU4 A;  2VFS A;  2B9E A;  4LF1 A;  4I2Q A;  2DEJ A;  5ADZ A;  5CZX A;  2ZOG A;  3NCP A;  4A8M P;  4ED7 A;  3JQK A;  2ZKT A;  2GVD A;  2IAJ A;  2Z2M A;  3UR3 C;  4DV3 J;  2I5J A;  4JOU A;  3LTO A;  2XSF A;  2V2Q A;  1R8C A;  1PO6 A;  4QIG A;  3K7R A;  5LSO A;  2Q6C A;  4NZ7 A;  5D4N A;  1SVD A;  1Q1K A;  2MKC A;  2XO7 A;  2XS7 A;  4ILR A;  3NNH A;  1F3F A;  2XWY A;  1S79 A;  1T7P A;  2Y8W A;  3PCO B;  4Y2C A;  2AWZ A;  2EG1 A;  3K5N A;  4RNF A;  3P5B P;  1SKR A;  3GTY X;  2G2O A;  1FI4 A;  2V8D A;  3KTQ A;  4RUB A;  3ENV A;  1IBC B;  2UUC F;  3Q8Q B;  5HAO A;  2IC3 B;  1C2P A;  3GFY A;  4RW4 A;  1SV5 A;  2OPP A;  2LQ8 A;  3OHA A;  5IT9 Y;  3RBX A;  5HQM A;  2BJE A;  3CO0 P;  4HTI A;  3ISN D;  4RW7 B;  4KT0 C;  2CPJ A;  1RT7 A;  4IG0 B;  4CI0 B;  2H54 B;  4ILL A;  4KR0 B;  4KSE B;  4FS1 A;  4JYA J;  1VC5 A;  4U96 A;  1AB8 A;  3QAU A;  2H48 B;  2RT3 A;  2F3J A;  4ZN1 A;  1VQ9 S;  2VF3 A;  2VBW A;  4ETZ A;  4QOT A;  2N4D A;  4JI4 F;  3MR3 A;  3CD5 A;  1FHT A;  3TOQ A;  2ATC B;  1YJ7 A;  4X84 A;  5CYM B;  1FCA A;  2NZ4 A;  3MPU B;  2BOP A;  1LV5 A;  1RHM B;  3I56 S;  5I42 B;  3H8Y A;  4D3G A;  4KHR A;  2VC0 A;  1AXQ A;  3EVO A;  4HHH A;  3GIL A;  4GMK A;  1GMW A;  2HNZ A;  2QMU B;  2XSJ A;  1DTQ B;  3EZO A;  1IBM F;  4KH0 B;  1O5J A;  1FWK A;  3R5A A;  3TP2 A;  3FRY A;  5L38 A;  4LRC A;  4AQY J;  1PG5 B;  2G0J A;  2ZVS A;  3WC0 A;  1U2F A;  1HFE L;  2C2R A;  3CCS S;  2WVE A;  5AE3 A;  4I4B A;  2NSB A;  2DHX A;  3AJ2 A;  3CMQ A;  3CJ5 A;  3B4M A;  1WG1 A;  5HVH A;  5D15 A;  4X64 F;  2KXF A;  2BXJ A;  5D4P A;  4F4Z A;  4FF2 A;  1RSC A;  1ROF A;  3B6B A;  5DDP C;  3SDE A;  2Y0S D;  2CXE A;  1AYE A;  1UJ6 A;  4OLP A;  1UWA A;  1RTH A;  2ACY A;  3GP9 A;  3HVR A;  2FB0 A;  5T14 A;  2HWH A;  5ETR A;  2CZ4 A;  2CDR B;  1N6Q B;  3W9H A;  4WFN Q;  4QR1 A;  1VK3 A;  1SJQ A;  5FDL B;  3CTR A;  4DLE A;  1Y4Z B;  3GE9 A;  1PYT A;  4CLW A;  3CME S;  4NA1 A;  4X4O A;  2CQ3 A;  3HLU A;  1JLF A;  1HBN A;  3H5Y A;  1CPZ A;  1S1X A;  5HBM B;  2ZH8 A;  4P2M A;  4XK8 C;  1TL4 A;  3NGR A;  1B70 B;  1YZ7 A;  1UWB B;  2GAH C;  5J2P B;  1T05 A;  4CT9 A;  1BGX T;  1IQZ A;  3IAM 9;  4OZL A;  3ITH A;  1S6P B;  3MM9 B;  2GV1 A;  2VFV A;  3TVY A;  1SH0 A;  3W60 A;  1BC6 A;  2CG8 A;  4DEZ A;  4UF4 A;  3RRH A;  2UXB F;  1NK0 A;  1WG5 A;  2C2N A;  3CJS A;  2AGQ A;  1B7F A;  1X4C A;  3RR7 A;  1D9F A;  2MZQ A;  5HP1 A;  4QIE A;  2R9L A;  2GZO A;  3N79 A;  4DCJ B;  2UXC F;  1RTI A;  4WXW A;  1S7I A;  2P6T A;  2IHR 1;  4IQM A;  3VAI A;  5FD1 A;  5HN0 A;  3LP0 A;  4USI A;  3MOJ B;  2GHP A;  3TJ8 A;  1AFJ A;  1ZZN A;  4N8O A;  3T1A A;  2FPH X;  4GC7 A;  1IBK F;  2DYA A;  3BH6 B;  5E2Q A;  1JLF B;  2IBO A;  3M2V A;  2CJX B;  1TK5 A;  3DKD A;  1LW2 A;  4HDH A;  5D78 A;  1W7W A;  4Q45 A;  4YB1 P;  2AGO A;  1I3O B;  3M8Q A;  2IFX A;  1FRH A;  1WD6 A;  2D74 B;  2ZH1 A;  3IAS 9;  1DY3 A;  4DOZ A;  1MN7 A;  1TKD A;  3DMJ B;  3RRG A;  4MH8 A;  1D8Z A;  3T5K A;  1X9M A;  2MY7 A;  2HND A;  3GJT B;  1NDK A;  2YQ0 A;  2QV6 A;  1DHM A;  4ANE A;  2BMB A;  5KFI A;  3HHN B;  3G96 A;  2AEJ A;  2NLW A;  4ZVR B;  2ZUG A;  1RAE B;  3NS5 A;  1J5O B;  3OJU A;  4WU2 A;  4J7C A;  1DQ8 A;  3D67 A;  1VRU A;  2A10 A;  2QL5 B;  3VV2 B;  1TMJ A;  1J2V A;  1GNK A;  3R5G A;  3W7B A;  1N5Y B;  2YWK A;  3UDE A;  1HR0 J;  3TYT A;  4F2S A;  5F0U A;  1RTI B;  5DGB A;  1N32 J;  1RT2 B;  5CYQ A;  1UVI A;  1N36 J;  2CPH A;  4NI2 B;  3O44 A;  1JJ4 A;  4ZCK A;  2BJ9 A;  1KQG B;  5F9L A;  1NPK A;  2B5J B;  2NS1 B;  3CC7 S;  4LR7 A;  2WON A;  3THP A;  5EUH A;  1S0N A;  3VVT A;  3QLH B;  3GB0 A;  1YLX A;  1QTN B;  3M2V B;  2JDJ A;  2HAI A;  1S6Q B;  3R5J B;  4LRB A;  4TQR A;  3TA1 A;  1RHR B;  2DGO A;  2R42 A;  2J0Q D;  3VTI A;  1UCN A;  2Q1L A;  2G1D A;  2MPU A;  2YQ1 A;  2BE9 B;  3GR0 A;  2H1Y A;  1WTF A;  3CCT A;  2JRS A;  3MPV A;  5L39 A;  1T3N A;  3L09 A;  5HO4 A;  3FRZ A;  4UT4 A;  3HKZ D;  2HBQ B;  2AEF A;  3JSB A;  2HQI A;  5KT7 A;  4LRE A;  3MEG A;  4WTO B;  1EKR A;  5AT1 B;  1RK8 A;  3G9C A;  2HND B;  3IC1 A;  5I3U A;  2CPY A;  1RBO B;  2O66 A;  1KOO A;  1NHU A;  4KBI A;  2F63 A;  2J8S A;  5HSP A;  2VG7 B;  5J2Q A;  2JFD A;  1PKU A;  1QSL A;  3M8P B;  3DYA A;  1T9W A;  4A8W A;  1U25 A;  4KGM A;  3TW0 A;  3ELH A;  4ZJQ A;  1KBR A;  3ZZO A;  3EPI A;  3FK4 A;  4HHU A;  5CHC B;  3N6M A;  3BYR A;  2RUG A;  4G1Q B;  1TUW A;  4MJK A;  1YQH A;  3ZTS A;  2QYC A;  3QGG A;  1XMQ F;  1GEH A;  1VHF A;  2MST A;  1N4L A;  4Q0B A;  1FJE B;  3PM9 A;  2DXF A;  2V4R A;  3EM1 A;  2PA3 A;  3OL6 A;  1WC6 A;  2APO A;  3Q2S C;  3NG8 A;  1PGZ A;  2GC8 A;  4JI2 J;  2W2P P;  2WW8 A;  3QSY B;  3MAH A;  4HTJ A;  1UMJ A;  4FP9 A;  3MFI A;  1T8E A;  3AB2 B;  1YZ6 A;  1SH3 A;  2LXF A;  5K5M A;  3O8W A;  2AZ1 A;  1LK7 A;  3UDC A;  1K44 A;  2DR6 A;  3S8S A;  2XQC A;  5DLG A;  1B0T A;  4L3N A;  2CQD A;  2RF2 B;  2EC2 A;  3HD2 A;  3FSX A;  5JXS A;  5L8R C;  3MPY A;  3BSA A;  3T1H J;  2LYV A;  3QGI A;  3FBE A;  2HZV A;  2MKI A;  4JI5 J;  4TU8 A;  2YNF B;  1JNZ B;  2ZD1 B;  2OPS A;  2KT3 A;  2YNG B;  2VDH A;  4JP8 A;  1VQL S;  3A1Y G;  2FLN A;  3LH2 S;  2WSF C;  3AXK A;  4DI6 A;  4S0M A;  1RUS A;  4C6A A;  2DHG A;  4FYW B;  2ZM6 F;  3BBB A;  2FVQ A;  5A8W A;  4JB8 B;  3R5C A;  3CMA S;  4ICL B;  1SC4 B;  1QUP A;  2J6S A;  2HRY A;  3SCK E;  4Q0B B;  3M1V A;  1HBO B;  3P45 B;  1AFI A;  2XY7 A;  3IR7 B;  2L9N A;  2IJF A;  4O3S A;  3FCV A;  3UE2 A;  1HNZ J;  1WI8 A;  4X62 J;  1KRP A;  4DR2 J;  2CZ9 A;  3KHG A;  2YWF A;  4NLS A;  2ZEJ A;  2DNG A;  2DR5 A;  4ZP8 A;  3X3U A;  3LOU A;  1WC0 A;  1YRX A;  2DNH A;  4DV5 J;  1YIT S;  1RAA B;  5D4L A;  1NSQ A;  3DOL B;  3M6V A;  2HSE B;  3D68 A;  3VZI A;  1Q79 A;  1IKY A;  3J81 Y;  5D3G A;  1O51 A;  4ED0 A;  3ZZY A;  4JI8 F;  3EGW B;  4GKJ F;  4PWU A;  4KGZ B;  3M8S A;  1FXR A;  3VGV A;  2OTL S;  4QWB A;  2OI2 A;  1L3K A;  3VR1 A;  3HUL A;  1UPP A;  3NOG A;  2CNO B;  2W2Q P;  4M63 A;  3QRR A;  3Q86 A;  1B4S A;  3BN4 A;  3M05 A;  3R7N B;  2J0W A;  2P8I A;  3DC2 A;  4C3K A;  3O3L A;  1HKA A;  1LEO A;  1RT3 B;  5A8W B;  4NLU A;  5DQI A;  1HLW A;  3W62 A;  5GME A;  4ZJO A;  1JLE A;  3E01 B;  1VCT A;  1M90 T;  1AZS A;  1XBW A;  5JMN A;  1S0M A;  5EWG A;  1HPZ A;  2QA4 S;  2JEG A;  4L74 A;  1GTH A;  4TQS A;  2GX8 A;  4OYP A;  1KTQ A;  1AUD A;  4IRD A;  2JLE A;  2DO4 A;  4I6W A;  3DOK A;  2ALZ A;  3ENQ A;  4F4X A;  1T9U A;  1R0B G;  2GCF A;  1WEX A;  1IKV A;  4F0M A;  3EZU A;  3THT A;  3RZA A;  1AW0 A;  3KHL A;  1QLN A;  2DO0 A;  4PXC A;  3O6Q A;  1U48 A;  4K5S A;  5C24 B;  4C8Z A;  4KHM A;  4JI3 F;  2GMH A;  4NLV A;  3Q83 A;  4AL5 A;  1XNQ F;  3DM2 B;  2N82 B;  1KQK A;  2AJ1 A;  1QSS A;  4DSF A;  5KG2 A;  3EWG A;  1ZTW A;  1VR6 A;  3JSR A;  3CPW R;  3QID A;  2AU0 A;  3C46 A;  2R8K A;  4OI4 A;  4ECW A;  2OSQ A;  2AT1 B;  4NXM F;  4DFJ A;  5A8R B;  1J27 A;  3SQG A;  1X4B A;  4I64 A;  4DL6 A;  5H1S V;  1HNX F;  4YHH F;  5EWF A;  1JNR B;  3DRR B;  4N77 A;  2A18 A;  4BWM A;  2WVB A;  1DLO B;  4TKT A;  4HI2 A;  2QLX A;  4OJG A;  3BEG B;  2PMW A;  3GFX A;  1NO8 A;  4PYD A;  1NUE A;  2Z2Z A;  3MM5 A;  3CD6 S;  4KPC A;  1FKP B;  3BJY A;  5LMU J;  1R8P A;  2YXL A;  2GO9 A;  5E3Q A;  3JAM U;  1T0T V;  2UXD J;  5AJ3 F;  5IQ6 A;  2VG6 A;  1H98 A;  2CZV C;  3HHL C;  1UVL A;  2XMT A;  4O0I A;  1WC4 A;  4DSL A;  3ZZR A;  2J0X A;  1Q78 A;  3W9J A;  1TKZ B;  1UAW A;  3HJF A;  2LQ9 A;  1HNW J;  3G6Y A;  4DR7 J;  3HSJ A;  4B9V A;  2R2R A;  2AJF E;  3AD7 C;  4F04 B;  1K9M T;  1HHS A;  2VQF F;  2ACM A;  2CPZ A;  2NXJ A;  2YBV A;  3MEE B;  3GSD A;  2KFN A;  2GIQ A;  4ED8 A;  3KMQ A;  2LU2 A;  3U7J A;  3EPG A;  2HAF A;  1TUV A;  4L76 A;  5H9F J;  4A8X A;  5BR8 F;  4URG A;  5DG8 A;  2JEF A;  2WSE C;  4CO5 A;  1FNX H;  2Z2Y B;  1IBL F;  4Q5V A;  3T6B A;  3ISZ A;  4B9U A;  5DGA A;  5ETK A;  3MM5 B;  5HQL A;  2BW2 A;  2LLZ A;  2ZH9 A;  1NKE A;  1YJV A;  2YNI A;  3QWP A;  3Q24 A;  1K1Q A;  2IVY A;  4ZKA A;  3D54 A;  2BA9 A;  2XBP A;  4C3M A;  1DTT A;  1VI7 A;  3H4D A;  2E66 A;  4B3T J;  3W66 A;  3OJS A;  5HRO B;  1RAF B;  4ID8 A;  4CT8 A;  1T03 A;  3OTB A;  3QO9 A;  4LF6 F;  2CQP A;  2PEB A;  4F50 A;  3JTN A;  4DR6 F;  4O0N A;  1K8A T;  3TUZ C;  2CWK A;  3PVX A;  2HG4 A;  4MK8 A;  3EJM A;  3MED A;  2FHK A;  1M5K C;  2ZH2 A;  5F41 A;  3TUP A;  1RAC B;  4X4R A;  4USK A;  3TX0 A;  1UJ5 A;  3DXS X;  2EPI A;  4CCH A;  3MMJ A;  2W8L A;  2NXE A;  3CCR S;  1Q95 G;  2C2K B;  1RTD A;  4LF4 J;  4OJ3 A;  3V6K A;  2C2M B;  2UUA F;  3TJA A;  4K4V A;  1NME B;  3EDR B;  2VQE F;  3CW2 C;  4GRS A;  3W5X A;  5IM0 B;  2FLL A;  3DLG A;  5H9F K;  2VBZ A;  3IP0 A;  4ES1 A;  4PG4 A;  3P8B B;  2C3P A;  1C1C A;  1FFG B;  3ZZT A;  1FDD A;  3B54 A;  2KJV A;  2MJN A;  3T19 A;  1TAU A;  3LAN A;  4M5H A;  1XQI A;  3HSZ A;  1C1B A;  1APS A;  4LSL A;  2R7V A;  1VGY A;  3T5H A;  4NLY A;  2RKI A;  3L95 X;  4XDD A;  3HVA A;  4DR4 J;  4YQW A;  4QWA A;  5M2R A;  3VZH A;  3DNC A;  2R7O A;  3TA0 A;  2DH9 A;  1PJ6 A;  2BQU A;  5BXI A;  2O5D A;  5IZH A;  4F26 A;  2YKO A;  4DF8 A;  1RLC L;  4DPW A;  4JV5 F;  1L3T A;  3HKW A;  4DS4 A;  3MED B;  1UVJ A;  3M8Z A;  1RWU A;  3N6L A;  2VG5 A;  1RAD B;  2R8J A;  2EKN A;  3I55 S;  3CDW A;  3BPS P;  2QA4 G;  3CUN A;  2PSZ A;  3MOZ A;  1N0U A;  2V5H G;  3MCS A;  1HWL A;  2VA2 A;  3B8H A;  2JL9 A;  2DGT A;  4P6Q A;  2QMX A;  2FZC B;  4HAC B;  1KP6 A;  2VU5 A;  4QWE A;  2DIV A;  3NKY A;  2ZH3 A;  3MM6 A;  5IV3 A;  4OX7 A;  2VON A;  5HAT A;  3R2C J;  2BQ3 A;  2CQ4 A;  4LF5 F;  2W7A A;  2KVI A;  1U1K A;  1FNM A;  2DPJ A;  2F4V F;  4GVB B;  1C1B B;  4DR1 J;  3WDO A;  5I3Q A;  2B9X A;  1NH8 A;  4CLF A;  3G6V A;  2FHM A;  4NLP A;  5GVQ A;  3J7Y I;  5F8J A;  1ZET A;  2LQB A;  3RG6 A;  2IA6 A;  4ZHR B;  3H20 A;  3CED A;  4ED2 A;  3HF5 A;  4BDP A;  3KG4 A;  4IH5 A;  1KS2 A;  1HD0 A;  4WE1 A;  1JXV A;  5IT9 U;  2OEK A;  3DLK A;  2OGU A;  4H4M B;  2J7W A;  3C19 A;  2YWW A;  3AJD A;  3QJP A;  1ARO P;  1VK8 A;  2F65 A;  4ATN A;  4NEY A;  1SJ3 P;  3ZO7 A;  3R8Y A;  2XHC A;  1LW0 A;  4CLT A;  3PYF A;  3FFI B;  1NHV A;  2LVW A;  3AJ1 A;  3QRQ A;  4F0K A;  4YUD A;  2B4P A;  4KO0 A;  1SJ1 A;  4A46 A;  5E3A A;  4I67 A;  3OR2 B;  2YX4 A;  2CQ0 A;  1JIH A;  1RCO B;  3W9I A;  2RHQ B;  1F0X A;  2K3K A;  3MAQ A;  2R7U A;  3UD3 P;  3OXL A;  4OI1 A;  3N5B A;  4HHJ A;  5AXN A;  3GWC A;  3MM7 A;  3GIK A;  9RUB A;  1WJ9 A;  3CXC R;  1X9W A;  2J7K A;  4WE1 B;  2D1C A;  4JYA F;  4LQ9 A;  3D5M A;  3S1T A;  2XZW A;  4PKD B;  3ISN C;  4ZVS B;  3CGI A;  1VIO A;  1Q5V A;  4HT7 A;  1Y11 A;  1HL6 A;  2F4F A;  3NBP A;  4Y0F A;  2MMY A;  4K0K J;  4CLU A;  1B3T A;  1ELO A;  3R27 A;  1S1T A;  4TLR A;  4FDF A;  4ZA1 A;  5M2U A;  4YB5 A;  1RBL A;  3ILL A;  1MRO B;  4DUZ J;  3ILO A;  4RW6 A;  4MIW A;  4UOC A;  3SCI E;  3D28 A;  1SL2 A;  3PTW A;  1PIL A;  5JVG Q;  4C8K A;  3GV7 B;  1ACM B;  4AQY F;  4CLK A;  2LEA A;  3EYZ A;  4IQX A;  4J9K A;  5F8N A;  3ENA A;  5HMW A;  2R2U A;  4OI0 A;  1Q7Y T;  1XNR J;  1JJC B;  3VGT A;  1M1K T;  3MM7 B;  3C15 A;  1FXL A;  4IFV A;  3GIM A;  1A0O B;  2ASJ A;  5HAN A;  4NYZ A;  2VHG A;  3KDN A;  4NL5 A;  4DR5 J;  1C0T A;  3C6T A;  2MKY A;  1X4D A;  2RQK A;  4LFC J;  2EKY A;  2R8I A;  2QLB B;  3FNN A;  4DLG A;  1RT5 A;  1U47 A;  2E9R X;  4B9M A;  2W2N P;  1TKT B;  2JJ4 D;  5DDQ C;  4OV6 A;  1OQ3 A;  4KPY A;  2ZH5 A;  5E5N A;  1TKX B;  4H4O A;  1I5O B;  3B82 A;  3MTJ A;  2OPR B;  3M6U A;  1FXD A;  2M2B A;  4NCG B;  2B4U A;  1KVK A;  3DGP A;  4JI1 J;  1BY9 A;  2RB7 A;  3N6N A;  2HKE A;  5HMX A;  4LF7 J;  2MQL A;  4A8Q A;  5M2P A;  3M9O B;  4DV7 F;  1G2E A;  3TR5 A;  1HMV B;  4KV8 B;  2PDA A;  1NPR A;  1YG0 A;  1VBY A;  1XR5 A;  3FVY A;  3H2V E;  3T9N A;  4DJB A;  1KN6 A;  1SBR A;  3VGU A;  4HT5 A;  1VQ6 S;  3IG1 A;  4MIA A;  1WOP A;  1IBM J;  3RAX A;  1F5C A;  1PAE X;  2RU9 A;  4HLB A;  2KZM A;  3C6T B;  3ET6 A;  4QIW D;  2M4M A;  2IVF B;  1WKL A;  2E5G A;  2D3Z A;  1IR2 A;  1F3V A;  3R5B A;  4ZLN A;  1YSJ A;  1Y3J A;  4F4Y A;  3UNY A;  2X1B A;  4GC6 A;  4UOG A;  5U47 A;  2V69 A;  1GX5 A;  3N01 A;  2FC8 A;  4CO3 A;  2FY8 A;  1BWV A;  4Y2M A;  3IXQ A;  4QWD A;  1S1W A;  4WBF A;  4K4T A;  4EEY A;  2HNY A;  4H4O B;  4I2P A;  4FKX A;  4ZLP A;  1OY9 A;  1DFD A;  1VMB A;  4ECQ A;  2IY5 B;  1XMB A;  2DY1 A;  3FEY B;  3OR1 A;  3DGP B;  1FDB A;  2L9W A;  2X1G A;  3JSM B;  3G4S S;  1NND A;  1URR A;  4OHX A;  2DNY A;  4ID5 B;  2P9C A;  4WYL A;  2FIU A;  3Q8S B;  5B0F A;  1BQM A;  3LGN A;  2JHE A;  1PYS B;  4NCB A;  1OO0 B;  1V6H A;  3I9V 9;  2AJ0 A;  3MXH P;  3IG1 B;  3MEC A;  4DX5 A;  5J2M B;  1WSR A;  3HSG A;  1SKW A;  2QZ8 A;  1JWW A;  4DQR A;  3BKF A;  2CVE A;  4OHW A;  1UZD A;  2WB4 A;  3PG9 A;  3GJR B;  4EMD A;  5FJ4 A;  5K20 B;  5LXR A;  3SCL E;  2VUG A;  1PIE A;  2HFO A;  3IBF B;  2XMA A;  4X4T A;  3FBC A;  4QWC A;  3D4J A;  2X7I A;  3RAM A;  4P71 A;  1RTJ A;  3R2D J;  2H5E A;  4USW A;  1HR0 F;  3A8J A;  1N0V C;  2HFU A;  1N32 F;  1N36 F;  3FSY A;  1TQL A;  5IT4 A;  1H7W A;  3NP5 A;  4HH1 A;  3KJQ B;  4O4R A;  2BYC A;  1MMD A;  5LT5 A;  1X60 A;  4DV0 J;  1IWA A;  2MLY A;  2ZBR A;  4RLE A;  1JXL A;  4X4U A;  2EK6 A;  2FVR A;  1N5Q A;  3EVW A;  1IQT A;  2M70 A;  2J5A A;  2ZIT A;  4NYO A;  4IKA A;  1UVM A;  1LWC B;  1HBU B;  1X8D A;  1WOO A;  3A3P B;  2OJ3 A;  4DL7 A;  5A8K A;  1NRK A;  4F0H A;  2QFI A;  1CBK A;  5D0R A;  4ZVT B;  2OEJ A;  3AOC A;  1R0A B;  1OYD A;  2I6W A;  3VHQ A;  1VLY A;  1UFW A;  2WVD A;  4CTA A;  5GAH I;  1KFS A;  1RHK B;  2DR8 A;  2C28 A;  5KFB A;  4F25 A;  1S99 A;  3MUM P;  2HHH J;  2CIM A;  1QD1 A;  2ZOM A;  4L6V 3;  2KN4 A;  2AV5 A;  3QT5 A;  1PC4 A;  1MNE A;  2DRB A;  5J2N B;  4XDC A;  1RP5 A;  1OWX A;  4DV6 J;  1R6Y A;  3LF0 A;  5BYQ A;  2IPO B;  2KM8 B;  5L1L A;  5KT6 A;  1T02 A;  5KFL A;  2EBE A;  4P73 A;  1RWM B;  1T3O A;  3RBZ A;  3C66 A;  1JLG B;  2PA8 D;  3QYY A;  2L41 A;  4JI2 F;  4Y00 A;  3KJV B;  4EU0 A;  4QZV B;  4OI2 A;  1PJ7 A;  1GTE A;  3VAH A;  5C5J A;  4J90 A;  4K5R A;  5KG1 A;  2HK2 A;  4QR0 A;  1HQE A;  5I3P A;  3M2R A;  4Q43 A;  2KO1 A;  1LWF B;  1TTH B;  4LSN A;  4NZ6 A;  3I0R A;  3D6T B;  5DG9 A;  4KAI A;  2F5G A;  3T1H F;  5CCL A;  4OFZ A;  4ZS6 A;  4JI5 F;  1OJ4 A;  1RJJ A;  1HNV B;  2HEK A;  4MYU A;  4JI7 J;  3SIP B;  3D6H B;  3CIZ A;  5ITH A;  3LPY A;  4PG7 A;  1QSY A;  4N7T A;  1FK9 A;  4FPR A;  3J81 U;  4ZLJ A;  3V5R A;  4TY8 B;  1WEZ A;  1FVS A;  2YKM A;  1HNI A;  5KFU A;  3M8R A;  2DGV A;  3K59 A;  5DZ7 A;  4JI6 J;  5B0G A;  3MMC B;  2H3E B;  2XB2 D;  3G82 A;  4I69 A;  4DQQ A;  2BJ8 A;  2B0G A;  4WP3 A;  4Z7Y A;  5GAG U;  1YBU A;  1JLQ A;  4B3O A;  4ZVU B;  1HNZ F;  4X62 F;  4DR2 F;  4NMX A;  5L9X A;  3CJR A;  2IM3 A;  2DH8 A;  1ZTT A;  1ZZF A;  3PYG A;  3A12 A;  2V8H A;  4NYP A;  1H0H B;  3RR8 A;  4C8L A;  2XMV A;  1SI9 A;  4DV5 F;  5DRK A;  1M5V C;  4FYY B;  2WOM A;  3KLE B;  2JC1 A;  2FC9 A;  2FTR A;  1GT8 A;  3P4U B;  2DPI A;  3CJ4 A;  2JZ5 A;  3PEJ A;  4LSN B;  2RUS A;  4DPT A;  4KFB B;  2MXY A;  2W8K A;  1MWY A;  2NSC A;  3I5A A;  3BKT A;  1I94 J;  5KG4 A;  4LQ3 A;  3C6U A;  1SL0 A;  3DRX A;  2ZNZ A;  3KLF B;  3BR9 A;  2FQQ B;  2CJ9 A;  2M0G B;  3FCH A;  3D66 A;  3V6D A;  1N56 A;  1EB0 A;  8ATC B;  5LJ5 Y;  1RHJ B;  3V81 B;  2CWX A;  4K4S A;  4ZVF A;  4B9N A;  3VAM A;  1X7V A;  3GIR A;  2YKN B;  4CYU A;  1Q8I A;  2EFN A;  4EBE A;  3ZXW A;  1H2V Z;  1RTZ A;  3OFE A;  4B3O B;  1R8H A;  1H6K X;  1F9E B;  3EXC X;  4ERD A;  1FKO A;  1X9S A;  2KVQ E;  3RB0 A;  1FE0 A;  1N48 A;  1TL1 A;  1BQN A;  1RT4 A;  2W4D A;  2LQJ A;  2OSR A;  2G9O A;  3KJN B;  4AE5 A;  4OMF G;  4R8U A;  1FT8 A;  1ZAW A;  2VBY A;  4R0E A;  3IM8 A;  4PQU A;  3G6E S;  1U09 A;  4MMO A;  3MMA B;  3OFF A;  2B4V A;  3GV5 B;  3VAG A;  2YX1 A;  2B7B B;  3KOA A;  3OQ2 A;  3NWR A;  1W2B R;  1NXI A;  4QPT A;  1CJT A;  1X0F A;  2FHO B;  3M6W A;  3FQL A;  1VQK S;  4NPO A;  2JX2 A;  4B3M J;  1QDU B;  2OEL A;  3GLJ A;  1MSW D;  3V4I A;  5KFE A;  3PKY A;  1S12 A;  3PNI A;  4EUV A;  3N0V A;  3V6D B;  1EP4 A;  2NR0 A;  2HZC A;  5CCM A;  4YR2 A;  3TAM B;  3FZ2 A;  2IRU A;  3IBW A;  4JV2 A;  2PI5 A;  3BS9 A;  1KNZ A;  3OVA A;  2FVC A;  3I82 A;  4CYU B;  3BQ0 A;  2FVS A;  3NGT A;  3IRX A;  2LKZ A;  4C3L A;  2BKO A;  2ILY A;  1KHW A;  3M32 A;  1LFP A;  4PRF A;  2DNM A;  3UWT A;  2IM0 A;  1QTM A;  4FYV B;  3QAE A;  1Y5I B;  1G7C B;  1TV6 B;  1QM9 A;  3LO3 A;  2MSS A;  1MML A;  1TL3 A;  1TL1 B;  3W5Z A;  2UXD F;  1RT4 B;  3PW2 A;  4RO0 A;  4JBC A;  3K0J A;  1NM2 A;  4KGK A;  3IO1 A;  3KUE A;  3AXM A;  4DV2 J;  2MDA A;  2LXU A;  1B0P A;  5L1K A;  3DRP A;  3PRD A;  4PQU B;  1V9O A;  4K4Z A;  1S76 D;  2IA0 A;  5KFM A;  5CD4 A;  1HNW F;  3TEH B;  1YDL A;  1IKX A;  1CJT B;  3PJW A;  1KVI A;  4DR7 F;  3TZW A;  1M0S A;  2AD9 A;  1HA1 A;  3TAP A;  5F8L A;  1RBA A;  1WEL A;  1NCL A;  1SIW B;  2PO4 A;  4ZPT R;  3PZP A;  3V4I B;  2DCU B;  3CD0 A;  4ANC A;  4U8Y A;  3DU5 A;  3BO3 A;  2GIF A;  2PC6 A;  3HVT A;  4DPY A;  3CUL A;  2EEY A;  2H65 B;  3OPK A;  3SMZ A;  5D6G A;  2GO8 A;  4RNH A;  4OZ3 A;  5DZ6 A;  3IS9 A;  5IV4 A;  1NK7 A;  1UA1 A;  2F8M A;  3M32 B;  4DL2 A;  5J1E A;  1YJT A;  3T41 A;  1Z4U A;  1F5A A;  4NXM J;  2FGO A;  2CQH A;  1ZAV A;  2OKQ A;  4ITS A;  3WBZ A;  3HHL A;  1TL3 B;  2JLG A;  4XTT A;  5B0C A;  2UV8 G;  4YR3 A;  1YTY A;  4NLO A;  4C8M A;  4B3T F;  2BVZ A;  4F7V A;  2XHW A;  5IC4 B;  5L1I A;  3US5 A;  2WZ1 A;  4OJH A;  2I9S A;  2DGS A;  3PW0 A;  5L9N A;  5BJR A;  1D1U A;  1IKX B;  1OPZ A;  3BV8 A;  5B0A A;  4CM2 A;  4DFK A;  4R5P A;  4OYI A;  2UV8 A;  1FFS B;  1RWK B;  2L3M A;  3HX9 A;  5B09 A;  2IRY A;  2B7C B;  2P9G A;  4J9L A;  3FGV A;  2VOO A;  5KAK A;  4LF4 F;  4A47 A;  2D9P A;  5AXL A;  1FWP A;  4O3O A;  3PW7 A;  3NEK A;  1JQG A;  4RBT A;  2LEB A;  2VH7 A;  2AZ3 A;  2O01 C;  4DCO B;  4U95 A;  2E5L J;  1ZAX A;  3T6J A;  4DV4 J;  3VVU A;  3PJ9 A;  1HYS A;  2ZZT A;  3VAL A;  2DGW A;  1UZH A;  2QGF B;  3C2P A;  1T94 A;  4A8F A;  1T9T A;  2AEM A;  2FJA B;  3W64 A;  1XTZ A;  5G0R A;  3OUY A;  3SSS A;  3JTP A;  4DR4 F;  4X4V A;  2CKW A;  1NSA A;  4H4K C;  1NK5 A;  3OLA A;  2CNK B;  2CPI A;  3KK1 A;  1ZBT A;  3W2W A;  5DLF A;  1KLN A;  3PY8 A;  1EZZ B;  2WBR A;  2C1E B;  2B9Y A;  2UZA A;  2M52 A;  4I7F B;  2XS5 A;  1N33 J;  4MKB A;  1WF2 A;  3BRE A;  3UN5 A;  1TZ0 A;  4F4W A;  1KSP A;  2HHX A;  1FER A;  3RYL A;  4PCQ A;  3KMS A;  1WHY A;  4IG3 B;  3OD2 A;  3FKB A;  3LA0 A;  1LXJ A;  3P49 B;  4KC5 A;  2R8G A;  1RB0 A;  3BBC A;  1DZ5 A;  3W5Y A;  1CQM A;  3QJL A;  2X1A A;  1JLC A;  1TL7 B;  3CDB A;  2Q6B A;  1C0U A;  3M30 B;  3KLH A;  1H7X A;  3DRS A;  3G86 A;  5LOQ A;  3TX8 A;  2XUL A;  5LMN J;  5G0R B;  4O3P A;  1HBM A;  1FTR A;  3QAT A;  1ZPW X;  4NZ0 A;  1FD2 A;  2MYF A;  3RB3 A;  4AND A;  5GAE U;  1VQ4 S;  1KFD A;  5KG3 A;  4CNZ A;  3PW4 A;  2CQG A;  3KK2 B;  3W2V B;  5F3Z A;  1FVQ A;  1S72 S;  5ETP A;  5C2G A;  3I87 A;  6FD1 A;  4C0B A;  1Q82 T;  2HZA A;  1D9A A;  4KKO A;  2WTF A;  5DQH A;  2RRA A;  4PXD A;  5K8N A;  1CJU B;  4B9L A;  3N5F A;  1FRI A;  2E9T A;  2YKP A;  2RIL A;  2HHW A;  1WKJ A;  1NDP A;  3MR6 A;  1T9X A;  1Z2Z A;  1UEV A;  1WC3 A;  4KGX B;  5IS2 A;  1QUV A;  4M5L A;  4OQJ A;  4NLW A;  3I5C A;  1IJF B;  1REV B;  1WC1 A;  2OD6 A;  4P72 A;  3UCU P;  4JV0 A;  5CXT A;  1H2T Z;  3MD1 A;  4WII A;  2A0F B;  2KB2 A;  4HVZ A;  2J9D E;  3KNA A;  2Z0G A;  1S57 A;  3C16 B;  1WKK A;  5HMZ A;  4NAS A;  3KLH B;  2RS2 A;  3D2W A;  4YS2 A;  1Q53 A;  1SC3 B;  2GAG C;  3AA8 A;  4ZVE A;  1IR0 A;  3HP6 A;  5LM7 E;  2UVV A;  1RCX B;  4QR2 A;  1HBM B;  1KHV A;  1NB7 A;  1W26 A;  1CSJ A;  1FRL A;  2XLJ A;  3Q22 A;  2F7V A;  5ETS A;  1HW9 A;  1WAC A;  2XLI A;  2AMC B;  2ZUA A;  2D69 A;  1TEL A;  2IC3 A;  1OMS A;  4RUC A;  1WG4 A;  2DXD A;  2EFO A;  3KG0 A;  2F4V J;  2RRB A;  1ZOT A;  3W8G A;  2ADB A;  2VOP A;  1P6T A;  3I5B A;  3BGR A;  5A76 A;  3GCX P;  5KT3 A;  4RW7 A;  4O4G B;  1LXN A;  4YDX A;  5DJB A;  2W9B A;  1FEH A;  2HS3 A;  2E5J A;  2BW7 A;  3GG0 A;  2HQ3 A;  4K0K F;  2D9O A;  4Q2L A;  3HPO A;  1F9F A;  1ZYQ A;  3CC4 S;  4ECX A;  3X1L B;  2VC1 A;  2ZHA A;  1WOR A;  1S1U B;  1LFW A;  4DR3 J;  3UO0 A;  4BC9 A;  4DUZ F;  3O2I A;  3DDK A;  2K1R A;  1VIS A;  2A3J A;  4ER8 A;  4PQA A;  2BX6 A;  1C4A A;  3AH6 A;  1NK4 A;  4L73 A;  5CYM A;  1X5O A;  3RGI A;  3T5L A;  3H90 A;  2YNH B;  4DFM A;  3I31 A;  5I42 A;  2E29 A;  1WHV A;  4QW9 A;  1JLA B;  1XNR F;  1UVK A;  4TVA B;  3K8V A;  3SSQ A;  5BYS A;  3W1Y C;  1DTQ A;  2HBZ B;  2CVI A;  2UVU A;  2MGZ B;  4CQ1 A;  2YH1 A;  4TYB A;  3M9M B;  4DR5 F;  1JKH B;  3JB9 k;  4MKA A;  4YY3 J;  5KFD A;  5A0Y B;  3HZG A;  2C3M A;  2O1P A;  4LFC F;  3BGR B;  4C11 A;  2W9B B;  2YH0 A;  4AD6 A;  3Q8U A;  4DUY J;  1VYA A;  5KT4 A;  2QG9 B;  3UCZ P;  1HWU A;  4ECZ A;  2A2D A;  2XM3 A;  3NGS A;  2MJU A;  3BSC A;  4TN2 A;  2F9D A;  2XYP B;  3R9L A;  1ZA1 B;  2ZDP A;  5CH7 B;  2MQO A;  1S4E A;  1LWX A;  2K1R B;  2BUN A;  4WP9 A;  4WTY A;  3UNG C;  2J6T A;  4YB6 A;  3LP2 A;  4OZ2 A;  7AT1 B;  3MWB A;  3DI6 B;  2D3U A;  4RUH A;  4Q8E A;  4JI1 F;  4X4Q A;  1U6F A;  3NCR A;  4LF7 F;  2BQR A;  2XMM A;  4OV1 A;  3W61 A;  5EDW A;  1WHW A;  4IOC Q;  1N6Q A;  2LCW A;  3ETO A;  2ZKU A;  4QIV A;  3AT1 B;  1TMM A;  5D0G A;  5FDL A;  5EHH A;  4J9Q A;  1ZM2 A;  1U0S A;  2BAC A;  5ETV A;  3PEH A;  2KKH A;  2XYG B;  4TU7 A;  3CDU A;  3U27 A;  2UVR A;  1NK8 A;  2R7S A;  2ZBC A;  5HVG A;  3ONQ A;  4OLO A;  4M5D B;  4C11 B;  5HBM A;  5E3C A;  4WKY A;  2VJU A;  2JEJ A;  4FN5 A;  1K0V A;  1P9Q C;  2YKQ A;  1UWB A;  1VS3 A;  1F60 B;  3CJK B;  5J2P A;  1MLA A;  1H73 A;  3OXG A;  2OMO A;  2NZC A;  2O3D A;  2W2O P;  3MD3 A;  4QCL A;  3WQP A;  3D0H E;  3H5X A;  3RW6 A;  1S6P A;  5B7W A;  3MM9 A;  1RU1 A;  2E7W A;  3KKF A;  3QIP B;  4YME A;  2LEP A;  1JMT A;  2UUB J;  2BE7 D;  2RHS B;  5C42 B;  2K06 A;  3LP2 B;  4DPO A;  4NEZ A;  2HHT A;  4O3R A;  3M8Y A;  4NA3 A;  3JQM A;  3KUH A;  2K2P A;  1NB2 A;  3HZE A;  3V2U C;  4ZVQ B;  4CDI A;  3NMR A;  2M9K A;  3SFU A;  4Y6I A;  1VQN S;  1H3D A;  2CQ2 A;  3MTK A;  5T7L B;  4DPU A;  1YVF A;  5EGY A;  1S10 A;  1BQX A;  3M7V A;  4AXJ A;  5ETN A;  4PAA A;  2EWH A;  4DX6 A;  2I38 A;  1GMU A;  2AQ4 A;  2BOA A;  3E3X A;  5HQ8 A;  4DV7 J;  1BUX A;  3O1L A;  1YRT A;  1REG X;  3QPI A;  3PX4 A;  1FFW B;  4DU7 A;  4YDD B;  3DMJ A;  4IRC A;  4ZPV R;  3E2E A;  1U6B A;  4NLD A;  3CE8 A;  4TY9 A;  2QYG A;  3IWN C;  3PHT A;  2VD3 A;  2D41 A;  4FXV A;  2GFF A;  4NLQ A;  2YWE A;  2ZE2 B;  1VQY A;  2Y1R I;  2AJ2 A;  1WF1 A;  2YPY A;  1B0V A;  1J5O A;  4NCA A;  1K1S A;  1RWO B;  2I0X A;  4DV0 F;  2LU1 A;  2F1F A;  4IOB A;  1N5Y A;  4J9S A;  4LF9 F;  1F5B A;  3Q89 A;  1RT2 A;  4NI2 A;  5AE1 A;  2C2D A;  2QL9 B;  2B5J A;  4CO4 A;  4DBQ A;  1ICE B;  1XWL A;  3KFW X;  5KFZ A;  3NXZ A;  3MGJ A;  1XMO J;  1QAY A;  1L3V A;  2C3U A;  3OFG A;  4USH A;  3QLH A;  2KM8 C;  1S48 A;  1S6Q A;  1VRT B;  3SZ2 A;  2XO6 A;  1RYR A;  4AT1 B;  3BN7 A;  3DOM B;  2FHJ A;  3W63 A;  2H5I B;  2HHP A;  1VQ7 S;  3I96 A;  2PFF B;  2KTQ A;  4UQT A;  2HHH F;  4W90 B;  2J9D A;  4Y2K A;  3EE3 A;  4BC7 A;  3B4D A;  2GML A;  2FHJ D;  4IFY B;  1G3O A;  4MIB A;  3CCW A;  4DV6 F;  2M88 A;  3UD4 P;  4CLL A;  4DL5 A;  4M95 A;  3KWM A;  2BKP A;  2QA1 A;  4F2R A;  2VG7 A;  1W2I A;  4GO5 X;  2HFN A;  3M8P A;  1PYO B;  3QZ8 A;  1GQE A;  3N28 A;  5E41 A;  1U7L A;  2P2C B;  5KFT A;  3T5J A;  4UOH A;  3OV7 A;  3P6Y C;  1WDD A;  3M2U A;  2FZG B;  4QYR A;  3IM9 A;  2RIJ A;  2V2Z A;  4G1Q A;  1XN9 A;  5KFN A;  3PJX A;  2GA7 A;  1EAR A;  1QAJ A;  2DIT A;  3JQJ A;  1VOM A;  4EFA C;  1WF0 A;  2RDJ A;  1NJI T;  5KOW A;  3Q0A A;  3CCM S;  4K4W A;  2QE5 A;  1PCA A;  3QJJ A;  3ENW A;  3T3F A;  2J7U A;  2DR9 A;  2CPE A;  2CJQ A;  4B9T A;  2UUW A;  4QYZ J;  2GVZ B;  4JI7 F;  2HLU A;  2KDO A;  2MZJ A;  2QC3 A;  4ZPB A;  4F4K A;  3GG1 A;  2P5V A;  2RF2 A;  4FVC A;  3RBE A;  4JI6 F;  1L3S A;  3HXM A;  5E3P A;  4ZK7 M;  2CJA A;  3OTO J;  3RRK A;  1FNO A;  2YNF A;  4DUT A;  2ZD1 A;  2M7S A;  2YNG A;  1P8G A;  2D7S A;  4E8U A;  1BWE A;  3M2U B;  3HCX A;  1YX2 A;  4HYK A;  1OSC A;  4B9S A;  2RDD A;  3SSR A;  2GGP B;  4ICL A;  3LP1 A;  2Z4P A;  1UL3 A;  1SH2 A;  3VGS A;  1FX4 A;  1HBO A;  2ZZN A;  1NEE A;  5KFP A;  1NKB A;  1FKA F;  3GPA A;  3IMQ J;  3BKU A;  9ATC B;  1NJW A;  1I94 F;  4PXB A;  3QZ7 A;  2V8G A;  1GFW B;  1QAI A;  3GYN A;  1JLB B;  4ED5 A;  3SQO P;  1HI0 P;  4NX9 A;  1OS5 A;  2YX7 A;  4ZVG A;  4OYZ A;  1PAU B;  3DOL A;  3CCJ S;  1SQE A;  2BBE A;  3R1H A;  2AW0 A;  5H9E J;  4J9P A;  3DLJ A;  3MAA B;  4F3O A;  4DL3 A;  3NL0 A;  4ZDN A;  4OZN A;  4CLZ A;  5HLF B;  1TVR B;  2R2T A;  1QVG R;  1NSP A;  2J6U A;  2XWX A;  2B8P A;  4PXE A;  5A2Q U;  4LIW A;  2Z58 B;  1HWK A;  2E7V A;  1VJW A;  4KRW A;  3RB4 A;  2C22 A;  2FJX A;  4PWD B;  4DQI A;  3GIJ A;  2A2C A;  2IIH A;  3R6L B;  4ECV A;  4OZJ A;  2HIQ A;  5I4M A;  1RT3 A;  1HAR A;  2F8H A;  5F8I A;  3LQV A;  3LP1 B;  4ZP9 A;  3E01 A;  3GFZ A;  1MMN A;  2FJB B;  3A3O B;  2F9J A;  3DLL Q;  2KT5 A;  4CIO A;  3JTO A;  2MKJ A;  5ETL A;  3PR4 A;  3CCL S;  3POT B;  2V9W A;  4B3M F;  3IN5 A;  1NJY A;  4ZN3 A;  5HVF A;  2VB6 A;  4RW8 B;  3OFH A;  3FEZ A;  1Q8K A;  4MK9 A;  5CA5 A;  4FF4 A;  5C24 A;  3BGL A;  4E2F B;  1RLD A;  1XK8 A;  2LP4 A;  2E1A A;  4PEO A;  5H9E K;  3DM2 A;  5KFQ A;  4X4N A;  5DDO C;  3H98 A;  4MKV A;  1UFK A;  2EI5 A;  2JNJ A;  2OHD A;  3I32 A;  3BF4 A;  4RW9 B;  3PIO Q;  5A8R A;  4XIU A;  3W3S A;  3ETM A;  1R3N A;  2V6A A;  2XEX A;  1Y5N B;  3C14 B;  1U0H B;  3L7U A;  3DRR A;  4DV2 F;  1MU2 B;  1DLO A;  2BM0 A;  3MUV P;  2ADC A;  2VPY B;  4OX6 A;  1FKP A;  3PR5 B;  3Q8Y A;  1RXO B;  1S1V B;  1SJ4 P;  3VF0 B;  4RL1 A;  2MKH A;  1Q7L B;  1DUR A;  4NLX A;  4OZ0 A;  1FRK A;  2BV3 A;  3KHR A;  3K5M A;  1NAQ A;  1E6Y B;  1TKZ A;  3D0G E;  2DXE A;  4A8K A;  2ZBP A;  1T9V A;  2W9C B;  3ZZZ A;  2LQ5 A;  3UFC X;  2WVF A;  4Y65 A;  2RSQ A;  2Q43 A;  2GNK A;  1AA1 B;  2H51 B;  5KFR A;  2B6A B;  3NMA A;  2KRB A;  2YQ3 A;  3MEE A;  5KFV A;  1N34 J;  2B56 A;  1JX4 A;  4NWB A;  2E5H A;  2V4J A;  4DMZ A;  3QT8 A;  2WVC A;  1AT1 B;  2IYI A;  1S77 D;  1Y10 A;  1FE4 A;  1IWG A;  5E7O B;  1XIQ A;  1YJN S;  5DQG A;  1R27 B;  2Y0B B;  2DTJ A;  1RYS A;  3ILJ A;  2D3O R;  1JXE A;  4USM A;  3MCO A;  2FJD B;  5JUM A;  2G0I A;  1Y00 A;  5K14 B;  2HUR A;  5ETT A;  4DFP A;  4E0D A;  4FZV A;  3KLG B;  1FWL A;  2M5Y A;  5HRO A;  3KG1 A;  1VQ5 S;  1PC5 A;  4N47 A;  4N8N A;  1U49 A;  2AYM A;  3AHP A;  5E33 A;  2E5L F;  5HJX A;  1KOH A;  2RRN A;  4YFU A;  5LJ3 Y;  1VHI A;  2IDL A;  4K2J A;  4DV4 F;  3OTC A;  1QVF R;  1IM6 A;  4JV1 A;  5LL6 d;  1HW8 A;  1D9D A;  2XNQ A;  3DLE B;  2QEX S;  2X3D A;  2ZOF A;  3CCE S;  2HPU A;  2GHW A;  4DSK A;  1SJF A;  1N88 A;  2OEM A;  1RQ0 A;  4M1K A;  3NGK A;  4WPA A;  2KFY A;  3TZZ A;  1OSD A;  1TU0 B;  3GFH A;  1BD6 A;  1VRQ C;  1GMV A;  2QRR A;  3D0I E;  1FF2 A;  2HFS A;  5GMD A;  2V4J B;  4K4X A;  1S4F A;  3KXD A;  3QSI A;  2E44 A;  3WHI A;  2MZR A;  2DKO B;  5IM0 A;  2DNL A;  2DT9 A;  4LF8 J;  4I68 A;  3AD8 C;  3GU0 A;  3T1Y F;  2IVM A;  4DU8 A;  2OAU A;  1L5U A;  1EQ0 A;  3HVW A;  1A6L A;  1OYE A;  2ZWO A;  2DIS A;  3I0S B;  1JB0 C;  4WK3 A;  1SXL A;  3BQ2 A;  5B0B A;  1N33 F;  1EET B;  1RAB B;  1UJ4 A;  1R8B A;  2E1C A;  1GX6 A;  1TFY A;  1LWE B;  5IWA J;  2V50 A;  4ZOS A;  2F8E X;  3LWL A;  2V8P A;  3ICL A;  3OXF A;  4PYA A;  1RT6 B;  3KDO A;  4OHZ A;  2FVP A;  1CC8 A;  3P96 A;  2H4Y B;  1V5V A;  5K8M A;  1VIX A;  1TP7 A;  1SPB P;  4FYX B;  3D7S B;  1RWW B;  5B0D A;  1Z1Z A;  3LPE A;  2FZK B;  1KKH A;  5CQG A;  4Q7A A;  1RAI B;  3BPD A;  4IRK A;  3PX0 A;  4UTG A;  1T11 A;  4H4K A;  4PUO A;  5L46 A;  5LMN F;  1YRU A;  4J9V A;  2VPW B;  4LR9 A;  4DG1 B;  4HAC A;  2RJZ A;  1KQF B;  2OFG X;  4KQZ A;  5FII A;  1SL1 A;  3ULH A;  2L9D A;  3G87 A;  4Z2X A;  3P3D A;  3MDF A;  1OY8 A;  1UW9 A;  5K9F A;  4NXN J;  1VDH A;  1K0T A;  2VZ9 A;  1RA7 A;  4YB7 A;  3GR1 A;  3G8S A;  5F8G A;  1RDR A;  2DB1 A;  1ZH5 A;  2D3O 1;  3V4M A;  1LNQ A;  4GVB A;  3TVK A;  3UN3 A;  1FX2 A;  1CJV B;  1VBK A;  4W92 B;  4K59 A;  1H74 A;  4ZVH A;  4RU9 A;  2JOQ A;  1WOS A;  2PI4 A;  2PII A;  3D6F B;  3AB4 B;  1D8Y A;  3G8Q A;  4ZHR A;  1QE1 B;  2KHD A;  1KEK A;  3JSY A;  4IUF A;  3K8W A;  1HHQ A;  3AQP A;  4TYA A;  4I2Q B;  1T95 A;  1JJ2 R;  2W1B A;  3K5L A;  3QNW B;  2VIH A;  2GVD B;  1VC6 A;  2IAJ B;  4H4M A;  4M8L A;  4D3H A;  2I5J B;  4U7C A;  6AT1 B;  5D8H B;  3GJS B;  3HHE A;  3MFH A;  4LMZ A;  2G13 A;  2VV5 A;  2W2M P;  4AL7 A;  4ZVO B;  3AA9 A;  4PUO B;  5B0E A;  4JI0 J;  2XTJ P;  3WZ0 A;  3GMG A;  5DG7 A;  3FFI A;  3N4W A;  4F3Q A;  4OI3 A;  4ECY A;  2B3T B;  4LJM A;  4LIR A;  4RNO A;  4UY8 T;  2CJK A;  4NE9 C;  1J5E J;  3OR2 A;  4RW4 B;  1SV5 B;  2OPP B;  1U1L A;  4J9R A;  1UKU A;  1GMW D;  2RD5 C;  1OIA A;  2V34 A;  2QSW A;  1M5S A;  2LXI A;  1RT7 B;  3VQT A;  2CNL B;  1ZM3 A;  1NBE B;  2NQP A;  1NH7 A;  3NGU A;  2I2Y A;  3QRP A;  5IC6 B;  4KB7 A;  5KFX A;  2BM1 A;  1IKW A;  4DR3 F;  4DN0 A;  4FBU A;  4NLR A;  4FS2 A;  3BB5 A;  8RUC A;  5EWE A;  1RT1 A;  4CZC A;  3CCQ S;  4K7Q A;  2HIY A;  4TXS A;  4O44 A;  3NAI A;  2JVO A;  4Y2I A;  2MZT A;  3FMB A;  3HFZ B;  2JLF A;  4G1I A;  1PBU A;  2WRM A;  1MRO A;  2HVI A;  1F6T A;  1S0V A;  2VBX A;  1TUG B;  1RWP B;  2HNZ B;  2XSJ B;  3DFE A;  2N4C A;  3Q2T C;  2Q3P A;  4GO7 X;  3BBF A;  3UR0 A;  5HMY A;  2EW9 A;  4IOA Q;  4P52 A;  4ZCM A;  4L3K A;  2ZDO A;  2A6O A;  1P1T A;  4YY3 F;  3NLC A;  1TL5 A;  1NHK L;  2HYI B;  4WP8 A;  2BDP A;  2WBM A;  2QL7 B;  5ETO A;  3VAF A;  4DUY F;  2HS0 A;  4OIX A;  1RAH B;  2QO3 A;  1FRM A;  4WFA Q;  1UPM B;  2YWH A;  4QJV A;  2GIR A;  2CPF A;  1IKW B;  2WB1 D;  3DDI A;  3WIU A;  4C9D A;  4LBI A;  4ED3 A;  4CO0 A;  3IR5 B;  4V1A k;  3SDE B;  1DQA A;  1RT1 B;  3A8K A;  1JK9 B;  4A4J A;  1X5T A;  2YVS A;  1UVN A;  2VOD A;  1RTH B;  3R7B B;  2QJ3 A;  2HHQ A;  2HQD A;  4O44 B;  1O6X A;  3I9Z A;  4Z37 A;  5GAD U;  4XAK A;  5SUH A;  4GKK J;  1TKT A;  1S49 A;  2NCK L;  1B64 A;  5IQQ A;  2J9C A;  3CB4 A;  1NKC A;  3MUT P;  1MN9 A;  4AUK A;  4V19 X;  1TKX A;  2NPI A;  2Z57 B;  2OPR A;  3IBC B;  1VFJ A;  3ZTO A;  4NCG A;  2EFV A;  1HBN B;  3EUN A;  2K3I A;  3CJ8 A;  1S5Z A;  4B3S J;  3VAJ A;  4QU7 A;  1S1X B;  4CH1 A;  2FY1 A;  3NY0 A;  3CC2 S;  1HMV A;  4KV8 A;  3UPF A;  2LDI A;  1I1G A;  2HBR B;  4Y3C A;  2CA9 A;  2PGC A;  1T05 B;  4MT1 A;  3H7H B;  4CP5 A;  3EGV A;  2HFV A;  5DS7 A;  2HQF A;  3ITH B;  3OL7 A;  2N7C A;  5ETQ A;  2V4Q A;  2V63 A;  3CF5 Q;  2UUB F;  4BCA A;  2MY8 A;  1S6O A;  2IMO A;  3CJQ A;  4OX9 J;  4I56 A;  2QTW A;  3LGH A;  5CD4 H;  4C7Q A;  5HP1 B;  4DCP B;  4MKY A;  2CPD A;  3V6J A;  4UQG A;  4RWX A;  4C4W A;  2Z56 B;  4M5J A;  1KLM A;  4EO8 A;  1RU2 A;  6FDR A;  5KFO A;  4J37 A;  3EGZ A;  3LP0 B;  4I1T A;  3ZNJ 1;  3FSI A;  2JSX A;  2CQB A;  3D6M B;  3D3C J;  5B08 A;  1YJW S;  1RWN B;  2Y1L B;  2EFG A;  2VDI A;  3A4T A;  2PE8 A;  4X65 J;  1LW2 B;  3CIM A;  3MR2 A;  3JSM A;  4PWW A;  2RNE A;  4ID5 A;  3M8Q B;  4ALZ A;  4DS5 A;  5A6W A;  3DLH A;  2DK2 A;  5J2M A;  3KUG A;  3CJ3 A;  2IMW P;  1HI1 A;  1N8R T;  2HMI A;  3ZTQ A;  3FJ2 A;  3HD1 A;  2FLP A;  2Y9H A;  4X66 J;  5FLX Y;  4OZ1 A;  5KFY A;  1WC5 A;  5F9N A;  4EGL A;  1PBA A;  3JYT A;  1H2U X;  1YKW A;  1VRU B;  3TEG A;  3H40 A;  4P74 A;  4RJV A;  2GS8 A;  4C8O A;  1O8B A;  3KYL A;  1KLM B;  2KG0 A;  5CYQ B;  5F0W A;  5HI7 A;  4J9N A;  2UP1 A;  4DZD A;  1RIS A;  3JXO A;  1P9Y A;  3TI0 A;  1GH8 A;  3ZTR A;  4RNN A;  2WON B;  2BE2 A;  1XMO F;  1U6Z A;  5DM7 Q;  4U67 Q;  1R6V A;  3NCQ A;  1NLK L;  3R1L A;  1CQN A;  2CDQ A;  4B3R J;  4M5M A;  4URS A;  4NLT A;  2CQ1 A;  1LWC A;  1HBU A;  3VCD A;  1UEU A;  3HO1 A;  4KH1 B;  3J7Y U;  2XLK A;  2HHU A;  3OT9 A;  5HJY A;  3NS6 A;  1F9H A;  3MEG B;  2GQC A;  1R0A A;  2HMI B;  3RUB L;  4LR8 A;  5I3U B;  1RWV B;  1Q16 B;  2AX1 A;  4ZPC A;  1U1N A;  1FDN A;  2N3L A;  5J2Q B;  1XEZ A;  4F8R A;  4M94 A;  3JYT B;  1R0C B;  2VA3 A;  3DYA B;  2BRL A;  1O0P A;  4BBY A;  7FDR A;  3EDQ B;  4WXO A;  4NML A;  2RU3 A;  5KFK A;  5J2N A;  5JJB A;  3QGH A;  1URN A;  1X5S A;  3P5T L;  2XMW A;  3SV3 A;  5KFJ A;  2BE2 B;  5GMK a;  1Q5Y A;  3VAK A;  3MPD A;  1JLG A;  4WFZ A;  1RWX B;  4LF9 J;  1K73 T;  3KJV A;  2KI2 A;  4C2M A;  1IVZ A;  2G0C A;  2BJ3 A;  3PRB A;  2ZH7 A;  4DL4 A;  4FYD A;  3L9Z A;  4EBC A;  4P10 A;  3TZX A;  2VAS A;  3L7O A;  2EBG A;  3ZZP A;  2DVI A;  1VLO A;  3HHK A;  3WX4 A;  1ITP A;  1LWF A;  3M6X A;  2CJB A;  3LAM A;  4ES2 A;  2KZZ A;  3EMT A;  3OTO F;  2DHH A;  3M9N B;  4N56 A;  4AXI A;  4W4M A;  4OJ1 A;  4RUA A;  3KNG A;  4Y2A A;  2OPS B;  1DQ9 A;  4WFX A;  1HNV A;  4C97 A;  3G71 S;  3CCZ A;  1U1Q A;  4FXW A;  3IWL A;  3T9Z A;  4WKR A;  1K47 A;  2UUT A;  4TY8 A;  4RWW A;  3TRG A;  4KHP J;  2R7Q A;  4LVN P;  2WSC C;  3HFK A;  2KXH A;  3MMC A;  4OYM A;  2VPZ B;  1HIY A;  4P2X A;  3M1V B;  5LXY A;  5D0H A;  3OTD A;  1YJR A;  3F73 A;  2K8G A;  1NK9 A;  2MQQ A;  3V6H A;  2QA2 A;  1Y3K A;  1V3S A;  3CO9 A;  4FVM A;  4O3N A;  5KT5 A;  2JEI A;  4OYO A;  2ATL A;  1VQO S;  3KLE A;  5G4D A;  1IKY B;  5MAO A;  4OHV A;  5D3G B;  1U02 A;  3CDE A;  3BO4 A;  3CWJ A;  1YBA A;  2C42 A;  3GV8 B;  1OY6 A;  3AOB A;  4KFB A;  2MZ1 A;  4KGV B;  1KON A;  2XI2 A;  2EG2 A;  2E5I A;  2F40 A;  1U8S A;  4DZ6 A;  1IXK A;  3KLF A;  2HVD A;  3QQC D;  3MUR P;  2MQN A;  2G2Z A;  1DAX A;  3QBC A;  3V81 A;  2OTJ S;  4C8Y A;  1X4E A;  1KD1 T;  1H38 A;  1QAX A;  1JLE B;  2CPX A;  2DNN A;  2YKN A;  2R3V A;  5L1J A;  3NNA A;  1M1H A;  1AZS B;  2XCP A;  4LBH A;  1HPZ B;  3KLV A;  2XGP A;  1U1R A;  2YTC A;  1YIJ S;  3PYD A;  4QU6 A;  1FJC A;  2AJ4 A;  1NJZ A;  2HLT A;  1FA0 A;  1WSV A;  3DOK B;  2XI3 A;  4DQS A;  4CLP A;  3MMB A;  4USV A;  4PZV A;  3GYG A;  2R4F A;  4OX8 A;  3PHE A;  4DV1 J;  1IKV B;  2QLW A;  2KFZ A;  3R5D A;  1A9N B;  3GYX B;  2DGQ A;  4NRT A;  3CSK A;  1NDC A;  3MMA A;  3LWM A;  1L3U A;  1VQS A;  4RU2 A;  3THV A;  3FC9 A;  5AE2 A;  3RTV A;  2LFV A;  2XY6 A;  2HK3 A;  2LEC A;  1FRX A;  3SYZ A;  1DAR A;  2ZNY A;  5DM6 Q;  2OML A;  2PT0 A;  3BR8 A;  5D77 A;  4NLG A;  1WI6 A;  4M5G A;  3TUI C;  5THW A;  2Q79 A;  4WJB A;  5T41 A;  2C2O B;  5GAD I;  5KT2 A;  4K2X A;  4PG6 A;  2H5J B;  2QFJ A;  2HVE A;  5E0O A;  3SQG B;  1IM4 A;  3PW5 A;  8AT1 B;  2NYI A;  1CLF A;  3U1M A;  3TAM A;  4EI2 A;  1V3Z A;  4WWS A;  3HI9 A;  3DU6 A;  2W4P A;  3UW1 A;  2NYH A;  3BZQ A;  2SXL A;  5DDR C;  4PPZ A;  2HQC A;  2V8V A;  2IBK A;  3AAW B;  4Q2M A;  4HR2 A;  2MKK A;  3H25 A;  2DHA A;  3DHX A;  2VIC A;  3KJF B;  3D9B A;  3MM8 A;  1TV6 A;  3MMB B;  1RI7 A;  4Y34 A;  3J7A 1;  5SZT A;  3R3T A;  2MZS A;  4P2S A;  2DHS A;  2VG6 B;  4ETX A;  2KU7 A;  1P1L A;  3OL9 A;  3DDN A;  4M5N A;  3UI3 A;  4Q8F A;  2YPZ A;  2EFQ A;  3MF5 A;  5F3T A;  2DNZ A;  2U1A A;  4DX8 H;  3TUJ C;  4RBU A;  1R89 A;  2IM2 A;  4LFB J;  3RW7 A;  2HVZ A;  3CJ0 A;  1CG2 A;  3IWX A;  1SCJ B;  4IH7 A;  4DN9 A;  4O3Q A;  4RNM A;  3LAL A;  5K8O A;  2CRL A;  2DGX A;  3RAQ A;  4WK1 A;  1N34 F;  2PMH A;  5J1P A;  4G3I A;  3UDV A;  4ELU A;  1U2R A;  1FD8 A;  3MHY A;  2ERR A;  5KFH A;  3A3N B;  4NRU A;  3L4B C;  3I4P A;  2XS2 A;  2POK A;  1XR6 A;  1NPP A;  3TA2 A;  3NRB A;  4G65 A;  4LUB A;  3H0P A;  2MKS A;  3QFH A;  2QLJ B;  3LGM A;  3GII A;  1EX8 A;  2YNI B;  2AYE A;  3MM8 B;  4ZCL A;  2XY5 A;  2ZJQ Q;  2P9E A;  4EK2 A;  2UU9 J;  4USJ C;  3UCG A;  1DTT B;  3J80 Y;  1XR7 A;  3L3C A;  4C0H A;  3QO9 B;  1T03 B;  3SV4 A;  4N76 A;  4TU9 A;  4P75 A;  2YWG A;  1D09 B;  2GMJ A;  3MR7 A;  2HRU A;  1M5O C;  2A1B A;  3BDE A;  3CNQ P;  5GAH U;  2AIR B;  1V3R A;  3HFV A;  1F2G A;  2DNP A;  4LRA A;  3TVZ A;  1HD1 A;  1RTD B;  2CG4 A;  1DRZ A;  4EYI B;  3Q8V A;  4CLS A;  1U1O A;  3WC2 A;  3PO5 A;  1S9G A;  3DLG B;  4LF8 F;  1DBD A;  1MW7 A;  2WK4 A;  3J7Z T;  2DR7 A;  1FO1 A;  2J8A A;  1BMQ B;  1C1C B;  2BJD A;  4LFA J;  3R6G B;  2WAQ D;  2DBB A;  4LSL B;  3AY0 A;  1ZS6 A;  4ED4 A;  4CO2 A;  2CFX A;  3MCM A;  2RKI B;  4CM0 A;  4AFF A;  4J9M A;  4G1P A;  3AD9 C;  1U2C A;  2JVR A;  1WDT A;  5IWA F;  3BH7 B;  2RQM A;  3DCA A;  2OLW A;  3D1O A;  2XYH B;  2A6M A;  3E51 A;  2K7J A;  3TAR A;  2VG5 B;  1SIZ A;  1EQM A;  1FJG J;  2KRR A;  1R7I A;  4I7F A;  4DV3 F;  3PFO A;  4IO1 A;  4EWT A;  1S97 A;  1SB6 A;  3QWU A;  2CUY A;  1TFW A;  3F0N A;  1UTA A;  5ETM A;  4IG3 A;  2IJR A;  2QT7 A;  2DNK A;  3G6X A;  4XO0 A;  3MCN A;  3Q8R B;  4ILM A;  1S9G B;  2QIF A;  3IR6 B;  5CAB A;  2JC0 A;  2L48 A;  1KTV A;  3MM6 B;  3ZC4 A;  3EIC A;  4NXN F;  1UP1 A;  4QW8 A;  1TL7 A;  3M30 A;  5MLC V;  2LA6 A;  1GK8 A;  3DN9 A;  4ENO A;  5RUB A;  2MLZ A;  3LAK A;  4P9S A;  3MEK A;  3BM7 A;  3G2X A;  3U02 A;  1R43 A;  4HEA 9;  2OH2 A;  4YP3 A;  4WZM A;  2HHV A;  1VQ8 S;  1S6U A;  1NZ8 A;  3DHW C;  2AX0 A;  3TZY A;  3EXY A;  3T1Y J;  4PPD A;  5KTQ A;  4DF4 A;  3K17 A;  3F41 A;  3KK2 A;  3W2V A;  1TK0 A;  1YGY A;  2B8Q A;  3DLK B;  3BSN A;  1YI2 S;  2DEI A;  4CH0 S;  2MTL A;  1GXT A;  4LF2 A;  4ZVP B;  2Q66 A;  4YR0 A;  2GJ2 A;  1YJU A;  4C98 A;  2ZH6 A;  1SJR A;  1Y0H A;  5A6P A;  1CJU A;  1FDA A;  4FNH A;  4KJI A;  2DNO A;  3OW2 R;  1LK5 A;  3SI8 A;  2YKA A;  1EJ7 L;  1XC9 A;  4JI0 F;  2KYZ A;  1CVJ A;  1LW0 B;  4WFY A;  1H72 C;  4U7U K;  2AP6 A;  3S7R A;  4CLY A;  1FRJ A;  1KR4 A;  5KG6 A;  1REV A;  2MQ8 A;  5KFA A;  1WWH A;  2M8D B;  2NRE A;  1UA0 A;  1X5P A;  3DLB A;  2FYX A;  4KO0 B;  1R31 A;  1VBZ A;  3QT6 A;  2KT2 A;  4BWJ A;  3C3L A;  3C16 A;  1J5E F;  3D1Q A;  2CQI A;  5K8P A;  4UY8 5;  1DJ0 A;  2ASY A;  2Y3Y A;  3A8I A;  5KFS A;  1G4C A;  2W7O A;  1F1B B;  1HQU A;  4J91 A;  3FMW A;  4NOH A;  1VC0 A;  2J0S D;  3HK2 A;  3G8T A;  1Q0N A;  1U26 A;  2XGQ A;  2UUC J;  3OHB A;  3BDP A;  4J9O A;  1HI8 A;  4ZIV A;  5KFF A;  2I8E A;  2ASD A;  4FBT A;  1NZA A;  1SQF A;  1PJ5 A;  1CJK A;  4F02 A;  3I6P A;  1N5V A;  4PAB A;  2B4O A;  4O4G A;  2QLF B;  4EBD A;  4KTQ A;  3NBP B;  2HGN A;  4WYW A;  2KL8 A;  4K4U A;  4EZ6 A;  1S1T B;  1FEE A;  2PFD A;  3TJ9 A;  2OPQ A;  1VJQ A;  4F67 A;  4URQ U;  2ROG A;  1S1U A;  2KG1 A;  2KYX A;  3BGF A;  1ZPV A;  4RW6 B;  3K2Y A;  5EX3 A;  1W25 A;  5GAG I;  3MI7 X;  4ED1 A;  3GJQ B;  2R2S A;  1U1P A;  4JI4 J;  4YN3 B;  3GQC A;  2AF6 A;  2CAD A;  3R97 A;  3QGP A;  3SBM A;  4M5K A;  4IYQ A;  2MQP A;  4IR9 A;  2YNH A;  2M3D A;  4A8O A;  2DH7 A;  1HQU B;  2XMK A;  1JLA A;  4H54 A;  1U1M A;  2DRD A;  4EO6 A;  1RE1 B;  3C15 B;  4IFV B;  5KFC A;  1YK9 A;  2U2F A;  3HDS A;  3C8Y A;  2OO4 A;  3H5S A;  2QMW A;  3FEX B;  2MGZ A;  1C0T B;  4E98 A;  4DPX A;  1JKH A;  4CH7 A;  3L7P A;  4X4P A;  5A0Y A;  3I4H X;  1CJK B;  1N5S A;  4DQP A;  2HVH A;  1RT5 B;  1S7H A;  4Z7C A;  2ZHO A;  3ADA C;  4CWB A;  3J7A N;  2OPQ B;  4DHV A;  4GKK F;  4ZLL A;  1IUJ A;  4X64 J;  3K5O A;  4F3M A;  4R0J A;  2I1R A;  2VPX B;  3ZTP A;  2HGL A;  3AQO A;  4UUX A;  2E9Z A;  4FNI A;  2NXC A;  3DXB A;  1QJH A;  4ZIW A;  3DI6 A;  2AKW B;  2R7W A;  2ILZ A;  4B3S F;  4F4A A;  2CYY A;  2MB0 B;  4LRD A;  2ZBI A;  1YJ9 S;  4CNY A;  5F8M A;  2BJ1 A;  2FD2 A;  3FUY A;  3JS9 A;  3AOD A;  4I0W A;  3KHH A;  4N5S A;  3ET6 B;  3MZI A;  3FCW A;  2LDY A;  2BAN A;  4M5D A;  2L08 A;  1S9E A;  5AXM A;  2GJF A;  2B43 A;  4OX9 F;  4KE5 A;  1EAY C;  2K7K A;  1ZM4 A;  1IJE B;  5HL7 Q;  2AHO B;  4ZMM A;  3CJK A;  5E3R A;  2GQQ A;  2G1H A;  2FDN A;  2VKR A;  2HRT A;  5FLX U;  1S1W B;  1KVJ A;  2HNY B;  3QIP A;  3QT7 A;  4I2P B;  2UXB J;  2M8H A;  2X1F A;  2XG8 A;  2RAQ A;  5C42 A;  5LSR A;  3OR1 B;  4EYH B;  4HDG A;  1HHT P;  4F36 A;  2ABY A;  4X65 F;  4UOF A;  2FGC A;  3H2U B;  1KDN A;  1IR1 A;  3MR5 A;  2UXC J;  3PFE A;  2OFH X;  5JVH Q;  4QQB A;  4DWI A;  1BQM B;  4ELT A;  2C3Y A;  3IGV A;  3NOC A;  4KY3 A;  3Q23 A;  4PG8 A;  3MEC B;  4OYB A;  2XC9 A;  5T7L A;  1YHQ S;  1I51 B;  2WHO A;  3GCW P;  4RKU C;  4K4Y A;  2V94 A;  2N3O A;  1IBK J;  1EHW A;  2B9W A;  2ZZM A;  4X66 F;  2HW3 A;  2IRX A;  2XZD B;  2BAN B;  2MHN A;  3HJV A;  3NGD A;  2BZ2 A;  1S9E B;  1MG7 A;  2QSF A;  4U8V A;  1GXL A;  3PRV A;  5C2C A;  1RTJ B;  1NK6 A;  4PG5 A;  2Y1I A;  1Q8L A;  4B08 A;  4DX7 A;  2HWI A;  2VFT A;  2ZBQ A;  4ZPA A;  1RKI A;  4ZPW R;  1RAO A;  4C8N A;  5CZV A;  3PX6 A;  2ZE2 A;  4YEA A;  1CS4 A;  3PIP Q;  3H5U A;  1RA6 A;  2HS4 A;  1PSD A;  3M4X A;  4IDK A;  1RHU B;  3TAQ A;  4B3R F;  1ULR A;  5DET A;  2R7R A;  5IFM A;  1HQ2 A;  3CCV S;  5A8K B;  3UVJ A;  2JFK A;  1CUL A;  1SKS A;  4ECU A;  2P6S A;  2JWN A;  3EX7 B;  3HSD A;  2GQ2 A;  3H4B A;  2G2Y A;  5KG5 A;  4CTA B;  3GON A;  4UUW A;  2V9K A;  1VRT A;  3DOM A;  1RAJ A;  1YBT A;  4W98 A;  3ZFV A;  3W8P A;  2YY3 A;  2DRA A;  3EGN A;  1X31 C;  4LT6 A;  4RPF A;  3PAC A;  7FD1 A;  3NNC A;  2O67 A;  2J76 E;  4IFY A;  4ES3 A;  2HQG A;  2PD1 A;  2XZT B;  2BKN A;  2VL1 A;  1BLU A;  1B99 A;  3UD5 A;  2Z30 B;  1NSK L;  4XPE A;  1CS4 B;  2KJW A;  1MWZ A;  2XCA A;  3SXL A;  2W01 A;  3B78 A;  4IDK B;  2AYB A;  4X2B A;  2W9A A;  3VQS A;  2BAB A;  3ZNU A;  2C3O A;  3K57 A;  2V68 A;  3FQK A;  4HI1 A;  4LVO P;  5IT0 A;  1VBX A;  3UVJ B;  2MHE A;  5D4O A;  1CUL B;  2DY9 A;  1GAO A;  2W7P A;  3OSN A;  4P2F A;  1HQE B;  1XMQ J;  3M2R B;  2KXN B;  4OYX A;  2DD8 S;  2C2Z B;  4DSI A;  2ROP A;  3CJ2 A;  3AOA A;  4EZ9 A;  3I0R B;  2HGM A;  1A7G E;  1U4B A;  2H4W B;  4U6P A;  4N41 A;  4V19 J;  4ECR A;  2X51 A;  2GVZ A;  5KOX A;  4GVL A;  3FZB A;  4FXD A;  3OSP A;  1FK9 B;  5EX0 A;  3PV8 A;  4WCE Q;  1FTC A;  2YKM B;  1HNI B;  4ZJL A;  2XMU A;  1N52 B;  2RDI A;  1JJH A;  3ILI A;  4KHP F;  2FUG 9;  3K5P A;  3HT0 A;  4ZPD A;  4WF9 Q;  1NJX A;  3G82 B;  2IYG A;  2XNR A;  4MTP A;  4OL8 A;  3BO2 A;  1JLQ B;  1S59 A;  2WW4 A;  2DCL A;  3HT3 A;  2IDE A;  2RVJ A;  2ALY B;  1R8A A;  5J1N A;  1SKU B;  4OYA A;  1KWM A;  2MQM A;  4DDF A;  5C25 A;  1I6J A;  2IJN A;  5GAE I;  2RE1 A;  2QX0 A;  2ZM6 J;  1SUQ A;  2R8H A;  4AL6 A;  2GGP A;  4ECT A;  2JH3 A;  3S01 A;  3FBF A;  2HBY B;  2WOM B;  1X4F A;  1LKZ A;  2DIU A;  2FJV A;  5HK4 A;  1BHN A;  4IO9 Q;  3H59 A;  1UFL A;  4WFB Q;  2HWT A;  1NDL A;  1UET A;  3C6U B;  1BE4 A;  3QMQ A;  2N7Y A;  2DJW A;  3Q8P B;  1JLB A;  4OHY A;  3RU0 A;  3K58 A;  5A2Q Y;  1HWI A;  2W4C A;  1OQ6 A;  3S6E A;  4CO1 A;  2OIH A;  1N5T A;  3IRW P;  4WZQ A;  4ZP7 A;  3UDL A;  2C2E A;  1WHX A;  1Y5L B;  4C48 A;  4JI8 J;  4GKJ J;  1IN0 A;  2G4B A;  1T9Y A;  3D1H A;  3MAA A;  3K89 A;  3KLI A;  5HLF A;  1TVR A;  2LMI A;  4CRJ A;  1XJW B;  4DL0 C;  1AUS L;  1M1G A;  3M8W A;  4B17 A;  5C7P A;  1B7Y B;  1FKO B;  5LMU F;  4IH6 A;  4P7V A;  3SFG A;  2V2K A;  4BLG A;  5C25 B;  4PWD A;  5LSL A;  2KH9 A;  4L75 A;  5CYJ A;  1V5I B;  1BQN B;  2ZWP A;  1M5H A;  4I6Y A;  4DV1 F;  1SUQ B;  3EVM A;  4R8U B;  3WIV A;  1LOU A;  1HWJ A;  3IGN A;  4U7U D;  4L72 B;  4M5I A;  3CVK A;  2W25 A;  2AJQ A;  4ELV A;  2LA4 A;  1Y7P A;  5IXU A;  4A8S A;  4K50 A;  3CD7 A;  3SEO A;  3POT A;  4MK7 A;  2E1M C;  2V2V A;  1RKJ A;  1P27 B;  2H9Z A;  3CT9 A;  3F56 A;  4RW8 A;  4LSZ B;  4WIQ A;  2CQC A;  4TNO A;  3VWS A;  1EP4 B;  4QYZ K;  3TAN A;  3U1N A;  4KYZ A;  4Q44 A;  4JI3 J;  4FF1 A;  1SC6 A;  3OBI A;  1CEZ A;  3NAH A;  1XNQ J;  2GJI A;  4RR5 A;  1M5P C;  3IRX B;  3KLI B;  3J81 j;  2PN6 A;  3KK3 A;  4J5O A;  1U24 A;  1OPI A;  4FPI A;  3NS7 B;  4NA2 A;  1KC8 T;  1RZM A;  2E1P A;  3CCU S;  2Y8Y A;  3OTE A;  4RW9 A;  2ZFH A;  2VFR A;  2ZJP Q;  2HHS A;  2HFZ A;  3DGV A;  3PYE A;  2Z8Q A;  2Y1J A;  2VJV A;  1HNX J;  3A13 A;  4YHH J;  2ZC4 A;  1Z2L A;  3C14 A;  2FLO A;  2IM1 A;  1U0H A;  1MU2 A;  3DRP B;  2W24 A;  2RML A;  5IOL A;  3W65 A;  3HHL D;  4R25 A;  1RHQ B;  2FJE B;  5KG0 A;  4KIA A;  2FJW A;  2PEH A;  4RZR A;  4LFB F;  1Y9O A;  2EK1 A;  1GXU A;  4LRF A;  4MAK A;  2KHC A;  4UZC A;  3J80 U;  1S1V A;  1ZM9 A;  2EC0 A;  3RJM B;  4A8Y A;  5AJ3 J;  4P7T A;  4ECS A;  1WTB A;  4G6V B;  2ZJR Q;  2X3G A;  3FDS A;  1C4C A;  3HVT B;  4FKY A;  3TQE A;  4LBP A;  1E6Y A;  4ZCI A;  1TK8 A;  1RAG B;  2W9C A;  3IS9 B;  1LQ9 A;  2BEF A;  1N54 B;  2GHV C;  2ZHB A;  3RB6 A;  2BR0 A;  2B51 A;  2J9E A;  2EFP A;  3KK3 B;  1Q86 T;  5J1E B;  4HKQ A;  2VQF J;  5KFW A;  2B6A A;  1TAQ A;  3QFW A; 
#chains in the Genus database with same CATH homology
 5IWA J;  4DV3 J;  2HHH J;  3R2C J;  4KHP J;  3R2D J;  5LMU J;  1IBK J;  2ZM6 J;  4DUZ J;  3OTO J;  4B3S J;  4B3M J;  1I94 J;  4X65 J;  1XMQ J;  1HNX J;  4YHH J;  4PWW A;  3JAM U;  2MEW A;  2UUA J;  4JI7 J;  4B3R J;  2UXD J;  4DV5 J;  2VQE J;  4DR1 J;  3W1Y C;  5A2Q U;  2KL8 A;  5BR8 J;  1N33 J;  4DV6 J;  4B3T J;  3J81 U;  4LF9 J;  4DR4 J;  2F4V J;  2MQ8 A;  3J7A N;  1IBL J;  4JI1 J;  3T1H J;  4YY3 J;  1N34 J;  4JI6 J;  4LF7 J;  1XMO J;  4LFA J;  4DV0 J;  1HNW J;  4X64 J;  4JI5 J;  1HR0 J;  1XNR J;  4LF5 J;  2E5L J;  4DV1 J;  5FLX U;  4DUY J;  4JI4 J;  3J80 U;  4V1A k;  4X66 J;  4DR7 J;  2UU9 J;  1N32 J;  4DV7 J;  1N36 J;  5AJ3 J;  4DV4 J;  4JI0 J;  4HHU A;  5IT9 U;  2UXB J;  4LF8 J;  4KYZ A;  4OX9 J;  3IMQ J;  4AQY J;  4DR5 J;  4JI3 J;  1IBM J;  2KVQ E;  4DR3 J;  4RJV A;  4NXM J;  4LF6 J;  4JI8 J;  4GKJ J;  4GKK J;  4LF4 J;  4NXN J;  4DR6 J;  4LFB J;  4LFC J;  3T1Y J;  1XNQ J;  4NEY A;  3D3B J;  4JV5 J;  2UXC J;  2UUC J;  1J5E J;  5LMN J;  4DV2 J;  1FJG J;  2UUB J;  4KY3 A;  5LM7 E;  4K0K J;  1HNZ J;  4JI2 J;  4X62 J;  4JYA J;  4DR2 J;  2MTL A;  2VQF J;  4NEZ A;  3D3C J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...