1IBLJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1iblJ00
2MEWA 1J5EJ 4JI4J 4DR7J 4LFAJ 4DV4J 4KYZA 4YHHJ 4JI3J 4V1Ak 3J7AN 4X66J 2UU9J 3IMQJ 3OTOJ 2MQ8A 5IT9U 4KHPJ 2UUCJ 4NXNJ 2E5LJ 4DV2J 4JYAJ 4B3SJ 4DR3J 3JAMU 4KY3A 1IBKJ 3R2CJ 4YY3J 3W1YC 2KL8A 4X62J 4LFBJ 4B3TJ 4DV6J 1IBLJ 1HNZJ 4LF9J 4LF7J 5AJ3J 1XMOJ 5FLXU 1N32J 4GKKJ 2UXBJ 3J80U 4DR4J 3T1YJ 1N34J 1HNXJ 5IWAJ 5LMUJ 5A2QU 4DR1J 4LF4J 4JI0J 1N33J 1XNQJ 4NXMJ 1XMQJ 4NEZA 4JI5J 4JI6J 2MTLA 4JI8J 4K0KJ 2HHHJ 1I94J 2VQFJ 4DR6J 4DV1J 3D3BJ 4LFCJ 5LM7E 1IBMJ 3T1HJ 4JV5J 4DV3J 1XNRJ 2KVQE 5LMNJ 1HR0J 2UXCJ 4DV0J 4X64J 4X65J 4DV5J 2ZM6J 4HHUA 4DUYJ 2UXDJ 4JI1J 4RJVA 4LF8J 1N36J 4JI7J 4JI2J 2VQEJ 4AQYJ 1FJGJ 3J81U 4DV7J 4DR5J 2UUBJ 2F4VJ 4DUZJ 4B3RJ 3R2DJ 4PWWA 1HNWJ 5BR8J 2UUAJ 3D3CJ 4LF5J 4GKJJ 4DR2J 4LF6J 4B3MJ 4OX9J 4NEYA
chains in the Genus database with same CATH superfamily
1HWJA 1HR0F 4LBIA 4DQIA 3DOLA 1ZM9A 3IMQJ 4IOBA 1FDDA 2VG6A 1Q95G 1X4BA 4PEOA 3W61A 4QIFA 2U2FA 2ILYA 3DOLB 2CFXA 3TJ8A 2HNZA 5DO2A 4LF9J 3T3FA 1NZ8A 1NK8A 4Y00A 2NUUG 4FYDA 2OUGA 1BMQB 4JV0A 4C0HA 5ADZA 4MKYA 5IT4A 3MEGA 1QJHA 1D9FA 2NXJA 1HNVA 1BD6A 1E6VA 5IQ6A 1U4BA 1JXEA 1TK8A 9ATCB 1TFYA 3MEGB 4W4MA 5KFKA 1HPZA 1U09A 1ZH5A 4RJVA 2FZCB 1XTZA 1Q82T 3HZGA 1HPZB 1PCAA 3M6VA 3FK4A 1IR0A 1R89A 1EQMA 1D8YA 4ZPWR 2FYXA 3M2VA 4P73A 4YHHJ 5DRKA 1RTJA 2E7WA 2LQ8A 2FHJD 2UUBF 2RS2A 3M2VB 4PYAA 4WXOA 1QD1A 1RTJB 3P8BB 1FRJA 2K3IA 4DU7A 2CQ2A 4J9QA 1CJUB 2I8EA 1HNXJ 5KT3A 1C1BB 1T05B 3RU0A 4ZIWA 2BXJA 2CQ1A 1TL7B 1WHWA 5C42B 4URQU 1KR4A 2GVDB 5IV4A 4LF5F 2ROGA 5A8KB 2HFSA 4PXEA 5KFLA 1WD6A 3GCXP 4RNHA 2LXFA 4RL1A 3H4BA 1QVGR 3K5MA 3PFOA 5MAOA 2FHMA 4CIOA 4Q2MA 2AGPA 3D67A 5C2GA 2V4RA 5DDOC 3R27A 3MPWA 2YWWA 4FPIA 3UD5A 1GXTA 3M6UA 1AW0A 4X64F 2MZSA 3H98A 4DX5A 3D7SB 3BF4A 3K57A 4ENOA 4P2XA 3SCKE 4RW4A 3I5AA 4WBFA 2Z2MA 4NLQA 5E3CA 3IAS9 1YBAA 1FXLA 2DNMA 3HCXA 4PWDB 2HRUA 4OX6A 4IG3A 4CWBA 1KVKA 3GJRB 3FUYA 1VC6A 1XR5A 1OO0B 3SSSA 2QLJB 3ETMA 2CZ4A 4DS5A 2Z57B 3OL9A 3MEKA 2AX1A 4A48A 1C4AA 5SUHA 4GC6A 1HR0J 2BOPA 3ILJA 1VC0A 5KFEA 1XJWB 3VAMA 1B7YB 4I4BA 3G8SA 1WJ9A 2WVEA 4U6PA 3HO1A 3V5RA 3ILLA 2BJ7A 3TQEA 4ATNA 3R7NB 5D4LA 2JOQA 5K8NA 4PR6A 3CE8A 1UVLA 2MKYA 1K73T 2GW8A 4ZPVR 3RTVA 1IJEB 5K8MA 3GV8B 3LPYA 1XMQF 2VPWB 1X0PA 4P72A 3WQPA 2ZJQQ 3KMQA 1HKAA 1UFKA 2OMOA 4F26A 1WF0A 1FDNA 4EU0A 1CJTB 2C2MB 2KRBA 2DJWA 3BB5A 3W2WB 2GZOA 1LWFA 4K4UA 2EBEA 2UVWA 4DPYA 2HVHA 3VF0B 1UVKA 4DL6A 2APOA 3KG1A 1C0UB 1C4CA 5I3UA 1M5PC 3CSKA 1WSVA 5EWEA 4M5JA 3K5LA 2DBBA 4ED1A 5GAHI 1S10A 2XI2A 5GAEU 1VQ6S 4MIBA 3FQLA 4NMXA 2UUBJ 5CD4H 3M8QB 3MD3A 1X4GA 4GKJJ 2WBMA 2KXHA 4LQ3A 3N01A 4QU6A 2W1BA 1RISA 3H90A 1X4AA 2J7KA 1WACA 1Y4ZB 4F4AA 3BO2A 4NYOA 4J9NA 3MMCB 1NDPA 4WFYA 2N3LA 1TK5A 3NNHA 3ENQA 1JLCA 1TKZB 3T9NA 1HWUA 3DMJA 4YQWA 1NSPA 2DIVA 3CCSS 4NCBA 1FDAA 4Z7CA 2R7QA 4KHRA 4IFYB 1VLYA 3RW7A 4G3IA 3PXGa 1EARA 1P1TA 3RUBL 3AODA 3A8KA 2H4WB 4KB7A 2KU7A 1DJ0A 4LF7F 4ER8A 4NLUA 2MQMA 4X64J 2E9RX 4NXNF 3CCRS 5LXRA 1LW0B 3UFCX 2HWIA 2R42A 3RZAA 4OYMA 5L38A 2FD2A 2H3EB 4HYKA 4QR2A 3G96A 2DH8A 4DSFA 3SI8A 2BJ9A 3U1LA 4KQZA 2J7UA 3WC2A 4FNIA 1S1TA 2V8HA 1ZA1B 2ALZA 3DLJA 1NJXA 4Q8EA 3TA1A 3GCWP 3MTJA 1T11A 4OI6A 3C8YA 4HKQA 2WB1D 1MSWD 1HHSA 3DDKA 1GFWB 1F0XA 2DGQA 2D9PA 3KK1A 3PRDA 4ZKAA 3C16B 2F7VA 5D3GB 1QY7A 2FHOB 3EJMA 2M0GB 1CULA 3M8PA 1HW9A 3LP1A 1LXJA 3GFZA 3K8WA 3RB0A 4ECWA 4OX7A 2NPFA 3WZ0A 4MK9A 1RI7A 1N48A 4EGLA 1X4HA 4AE5A 1NJWA 4C11B 3BSNA 1P1LA 1Y5NB 3HFZB 1HMVA 2YKNA 2ASDA 3R7BB 4XK8C 3CB4A 4DU8A 3HVTA 1R0AA 3C6UA 1YZ7A 5HN0A 2BBEA 1B99A 1S4EA 1CEZA 3BEGB 4CYUA 1HMVB 1Q53A 3O5TB 3CJKB 3HVTB 2XNRA 1FO1A 3R3TA 2ZOFA 2I38A 2UXCF 2V63A 3M2UB 5GAGU 3R7SB 4KT0C 4YN3B 4DSKA 4UOFA 3EYZA 4ILRA 3CJ0A 2DISA 2VFTA 4N8NA 3MPYA 2Z56B 3H25A 5A6PA 1K1QA 3PCOB 2NPIA 3W60A 1D8ZA 4O0NA 3AT1B 2CZVC 2MKKA 5B0FA 3D66A 1T94A 4AD6A 2H5EA 4F4WA 5B0EA 5IT9Y 4B9LA 5G0RA 3MM9A 2RHSB 2DY9A 2CPHA 1OY6A 1RT5A 1HLWA 3W8PA 4OYOA 1WEXA 3MECA 1BWEA 3FBFA 5G0RB 3MM9B 2YNIA 3HT3A 5LMNJ 4PXDA 4XAKA 1SC6A 1GXLA 2FB0A 3KJVA 2NXEA 4ECRA 3THPA 3MECB 4KGKA 4KE5A 4J9RA 2XO7A 1FRMA 4I1TA 2OIHA 2L41A 4DL0C 4J37A 4NI2B 3D1OA 1ZYQA 1RAOA 3BGUA 3KKFA 5H9EJ 2J8AA 3J81Y 4ED6A 4JI7F 4ZP6A 2OD4A 3VGTA 4TYBA 3I31A 2XLKA 3EGZA 1PG5B 1X5PA 4M5NA 2L9DA 3FSIA 4ECXA 1BQMB 4UT4A 3CNQP 1WC1A 4LF7J 3PYFA 5L9XA 3MUMP 4NA2A 2XI3A 4NLWA 2VA2A 1XN9A 1YTYA 1QUPA 1VJWA 1X4CA 4WU2A 5EX0A 4ETXA 1O5JA 1NK0A 2C3OA 3TW0A 2MQQA 1FD2A 5KFDA 2F4FA 2C22A 4EZ6A 2V68A 1WKKA 3CCVS 1DHMA 3V6DB 1KSPA 2IM1A 4DPWA 1NH8A 3CULA 2GQQA 4UZBA 4DLEA 3P6YC 1FEEA 5L1IA 1CG2A 5B0DA 4RO0A 4E8UA 3D28A 5C7PA 4TKTA 1CSJA 2HGLA 3MOJB 2FUG9 3G71S 1SKWA 2OFGX 3HI9A 4Y2MA 2IIHA 3HULA 5L39A 2LQJA 3V4MA 1ZAXA 1LK7A 4TY8B 2LEPA 3TQ1A 2D3UA 1FJ7A 5IQQA 1KOHA 5H9FJ 4B9SA 1S49A 2ZNYA 2XS2A 4GMKA 1S1UA 1MLAA 3A3PB 5A6WA 4CH0S 2DR6A 2FVQA 5H9EK 1VYAA 4OMFG 1TKTB 1Y5LB 2H9ZA 2RAQA 3CCZA 1FHTA 4BWJA 2P6TA 4ERDA 1RCXB 5GMKa 2DNHA 2UV8G 1FNMA 2CVEA 1PIEA 2HHTA 3EM1A 2B7CB 2UXCJ 2M9KA 2E5IA 1Z4UA 3HKZD 1VK8A 2R7VA 1QTNB 3Q8QB 3GV7B 4E98A 1VQSA 1XR7A 2LU2A 5HSPA 2HBRB 4NYZA 1QE1A 2H51B 3MMAA 3ADAC 3ZTSA 2LXUA 1EKSA 3UN2A 1TV6A 2DPJA 1O8BA 5KT6A 4RZRA 2GS8A 2HHWA 5KFJA 2AJ0A 2KXNB 3TEHB 4O0IA 3L95X 2DO4A 2DHXA 1S5ZA 1DBDA 4K4YA 2AJFE 5C24A 4ZVFA 2I5JA 5AXNA 5B0GA 3CJ3A 2FZKB 4DX7A 5DGAA 4RW7A 3N6MA 1UETA 3DI6A 1S7HA 1G4CA 1FX4A 4Y65A 1K1SA 1UWAA 3E8OA 4IQMA 2WK4A 2EG1A 1FK9B 1L3SA 1MMDA 2J6TA 4MMOA 3VGSA 3T5KA 2GIFA 4DPOA 2NZCA 3CJRA 4U95A 2CNOB 1NK9A 2JC1A 2VBWA 3OBIA 4B3TF 5G4DA 1W25A 2CRLA 5H9FK 2E7VA 4NASA 2DKOB 3ITHA 1B0TA 4JI7J 5KFVA 4CO3A 3BSAA 3ZZZA 3IS9A 2VH7A 2W24A 3W2VA 2FJWA 4Z7YA 3KLFA 5KFNA 3ITHB 4C3KA 2MPUA 3FZBA 1SJ1A 2C2OB 2JLEA 1S0NA 2J9DA 4R8UB 1RABB 1NKEA 2OJ3A 1S7IA 4FF3A 3DC2A 4EBEA 3W5XA 5ETQA 4RX6A 1WG5A 2R8KA 1WTFA 4HHJA 1M5HA 3CC4S 1RSCA 3GJTB 1S0MA 1F9FA 4DFKA 2ZH1A 4X2BA 1VGYA 3OJUA 1CS4B 2LA6A 3FEZA 2XEXA 4TLQA 2ZHAA 2OO4A 2ADCA 4WIQA 3JXOA 1R8AA 2P6SA 3ISZA 1ZAVA 4OV1A 4ZPBA 4PRFA 4K4XA 2QC3A 3DXBA 3SDEB 3WDOA 3SYZA 2G1HA 2ZBIA 5HVHA 4WZMA 3TX8A 3NOGA 5I4MA 2ZHOA 1CLFA 1FD8A 4C0BA 4K4VA 5KFGA 3MM6A 4RWWA 2QA4S 7AT1B 1VRQC 3PTWA 3CIMA 2QL7B 1RTZA 2RB7A 2IVYA 4M5DB 3NMAA 2RQKA 3T1YF 5IC6B 4C8NA 3C15A 1N5TA 1KWMA 3ZZUA 4DV0F 2BRKA 4OYXA 4QJVA 3OJSA 2G0CA 2CPYA 1NDCA 3CO0P 4KHPJ 2OP5A 4Q44A 2R3VA 3C15B 2IA6A 2Z2LA 3H0PA 4ZPDA 2ZNZA 2W8KA 2D3ZA 1F5CA 2W4CA 2AEJA 1CJKB 8ATCB 4JI0J 5E3PA 4CLLA 2NZ4A 1FNXH 2CJQA 3UN5A 2CPEA 3ET6A 3OHAA 3D6FB 3CDEA 3TUJC 4DSJA 2HZCA 1HHQA 1M5SA 3C46A 1R7IA 2Z58B 2B8PA 5FDLA 5IM0B 2CQPA 4YUDA 3ET6B 1HARA 2DR7A 3QAUA 1VRUA 2ZC4A 4N7TA 2HS4A 4OYAA 3GTYX 2DGVA 4DG1A 1CQNA 2MZRA 4G1QB 1FRKA 5CCMA 3PO5A 1IBLF 1FXRA 3CCQS 1VRUB 1UVIA 4P2SA 1RBOB 5KOXA 4DR6F 4PPZA 5L1KA 3TAPA 4DG1B 4I0WA 3G86A 3M9MB 2D1CA 5DM6Q 2A3JA 3PW7A 4ES2A 4CH7A 1A7GE 5E7OB 1WKLA 1J5OA 3BV8A 2AJ1A 3MM5B 4B3TJ 3CJTA 3L09A 2Z2ZA 2VOPA 2NR0A 3ZTOA 3CDWA 2B4OA 3GE9A 1REGX 2Q1LA 2IHR1 4NPOA 4K8RA 4O4GB 5I3PA 3S8SA 4I7FB 3HZEA 1IM4A 1NHKL 2RKIB 3BN4A 1B64A 3H2UB 3VALA 3SCIE 4HEA9 2KVQE 3J7ZT 3QSIA 5ETLA 3GIIA 3H2LA 1Q0NA 5SZTA 1FJCA 3T1AA 3C6TB 2RJZA 4OHYA 1S9FA 1SC4B 4X62F 5T7LB 3R6LB 2K7KA 1UJ5A 4I2QA 2KN4A 5DJBA 1KFDA 8AT1B 1X4EA 3LGMA 3JSYA 4DPXA 2V2VA 3TRGA 4LRDA 2LECA 4U8YA 2KHCA 3OVSA 4QWBA 5F8NA 1AZSB 1AB8A 2F63A 1S6QA 1RT3A 3EX7B 3IG1B 1LWCA 2QO3A 3DRRA 2DD8S 1N6QA 1XWLA 1J5EF 1VQLS 2CQ0A 4A8KA 3OLAA 1S6QB 4ZVRB 1LWCB 2ABYA 1OJ4A 2DITA 1HNWF 2ZZTA 1JLEB 4WE1A 3D0GE 2IDLA 5HO4A 1R27B 4DX8H 3RAMA 1N5YB 3KMSA 3MPUB 1U02A 3VAIA 2QV6A 3M32A 2W2NP 4DV0J 4NRTA 1S72S 1RLCL 5KFYA 2Y1RI 1BC6A 3MR3A 4OYBA 3MMBB 1XNQF 1SL2A 5LJ5Y 4NWBA 1SUQA 3OUYB 5KT4A 1SCJB 1JNZB 5U47A 1RAEB 4I2PB 4TN2A 4CQ1A 3OR1A 5F8IA 4OZJA 1YJVA 4ID5A 2CJKA 4B9NA 3DRSB 1ACMB 3S7RA 2R2SA 1SUQB 3ILIA 1IUJA 2Z0GA 1RDRA 2VQEF 4UZCA 3D4JA 2ZH8A 3HX9A 4LVNP 2F4VF 4ZCKA 2DNLA 4WTOB 3HJVA 2HRTA 4UOCA 3OPKA 2V4JA 5HQLA 2VUGA 3ZNJ1 4B9VA 2ZWPA 4Q45A 2I1RA 2B9EA 5ETNA 4WFBQ 4Q43A 1ZM4A 4Y0FA 2YKMB 2YXLA 4YEAA 2QX0A 1VLOA 5GADI 1DFDA 5KFXA 4ZPTR 2NYHA 2XHCA 4DR6J 4M1KA 4CDIA 2QA2A 2XZWA 2KRRA 3DLLQ 4CLUA 2JX2A 4A8MP 2ZDOA 2KO1A 4C3MA 2AP6A 1S9EB 3QGHA 3VAFA 1S59A 2OLWA 5J2QB 2OD6A 1KC8T 4M5GA 2BA9A 2IBKA 2B4PA 2VG7B 4EWTA 1RWWB 1UP1A 2HFVA 2QG9B 4F4ZA 4DSEA 2Z2YB 5ETKA 2IJFA 2BW7A 1RKJA 2PMWA 1NH7A 1SC1B 1HBMA 1QAJA 3HF5A 1U48A 5BYSA 1BQXA 1UJ6A 2FGCA 3ZZOA 4NLGA 1MWZA 2VJUA 1HBMB 2DH7A 2MQNA 3CGIA 5ETVA 1SKSA 4FS1A 4KH0B 2QSFA 3TAMA 4B9TA 2RUSA 3AJ1A 3RYLA 4DCOB 2FLOA 5DLFA 4DQRA 2KM8C 1KQKA 3LP2A 3OD2A 1S1WA 1PILA 3DOKB 5HMZA 4C9DA 2IC3A 3J80Y 1YBUA 2UXBF 2KJVA 5E33A 3CIZA 3G87A 2B56A 3NMRA 2JL9A 4F4XA 1RHKB 3KLEB 3QGPA 1XEZA 2IC3B 1TK0A 4JI5F 4C8MA 2AJ4A 5J2MA 2HVDA 1I94F 2XM3A 3KJFB 3NS5A 1K9MT 1NDKA 3H4DA 4HI1A 3IP0A 1VOMA 3C3LA 3H59A 2OAUA 1J5EJ 1VQ4S 4W90B 3CJ2A 5K5MA 4EO8A 1VRTB 3J7A1 2I0XA 2HIQA 5KT7A 1NHUA 3AXMA 3SFGA 3L7PA 3DLGA 4IYQA 4P6QA 4LFCF 2DPIA 1JMTA 2B7BB 3DLEA 1XNQJ 3PEJA 1U49A 1GXUA 1K8AT 3MCSA 3GG1A 5DQHA 1T9WA 4WWSA 2RDDA 1YVFA 2QLBB 4LSZB 1SVDA 4J9MA 1NXIA 1WOOA 1IKXA 1TL5A 4X4NA 5E2QA 5K8OA 2F8MA 2DY1A 2J9DE 4M94A 2VQEJ 2VODA 2F4VJ 4Y2IA 4PKDB 1KD1T 4F50A 1RZMA 2GGPA 3DRPB 4ZLNA 3IXQA 2V8PA 3QIPA 3T5LA 3P45B 4DQSA 3OFHA 2V8DA 2GGPB 1B3TA 3R1HA 2C3YA 4A4JA 1S1VA 3IBWA 4DFMA 2DRBA 3RG6A 3AD9C 2PN6A 3BPDA 4YB6A 2MHEA 2H4YB 1FXDA 3X1LB 4FZVA 3EGNA 4PG5A 2YQ1A 3LW5C 4X66F 2YVSA 4ED2A 2HWHA 1HBUB 4UUXA 2HBZB 4DR3F 4N76A 4RW8A 2LEBA 1XIQA 4EK2A 3IM9A 3BDEA 1U25A 4BDPA 2CQ4A 2DIUA 4TQRA 3EWGA 4ANEA 1SI9A 1MNEA 4RW8B 4ZLPA 3GU0A 4OIXA 4WFAQ 5A0YB 1JNRB 2YTCA 5KFTA 5C25A 4X4SA 3F73A 2JHEA 2I2YA 3VR1A 2R8JA 3KFWX 4YFUA 1N5SA 4GO7X 4UW2A 3LQVA 4FPRA 4O3PA 4KPYA 4I64A 2XWYA 2AYEA 1D9AA 3NWGA 3VTIA 1KQSR 4AYBD 1KONA 3UD3P 4I69A 4FF2A 1APSA 4R5PB 4ZVHA 5HJYA 4DV3F 4MTPA 3JB9k 4YR2A 4O3OA 1IWGA 2X51A 3MAHA 3M1VA 2UXBJ 1F3VA 1N36F 2GJFA 1ZBTA 1N34J 1VK3A 4FXDA 1PJ5A 2CA9A 1ZS6A 5D4OA 3ISND 2KFYA 3M05A 2LKZA 4JI5J 1GT8A 3PYGA 4OX8A 3VHQA 3T9ZA 3N4WA 1UW9A 1I94J 1HNIB 1PJ7A 4ZK7M 4FKXA 3MWBA 2JVRA 1WG4A 3HHLC 5KFBA 3PJ9A 1MN9A 2QLXA 2ZZNA 1RWPB 3EICA 5CD4A 3B4MA 1RT6A 1NLKL 1H0HB 3KLGB 3FNNA 2DHSA 3M2RA 3K59A 2EFPA 3QMQA 4B3RJ 1Y7PA 4PXBA 4RUHA 4OFZA 1GAOA 3IBFB 5AXKA 1ITPA 2O01C 4QWDA 3BSOA 1QAIA 3M2RB 2G4BA 1V3ZA 1D9DA 3QATA 3M6XA 4K4ZA 2A6MA 2O5DA 1UA1A 3PG9A 3NL0A 3AD7C 4AXIA 5L46A 3IR5B 1SKRA 1UVMA 3TO8A 2YKOA 2XS5A 2WVDA 4G6VB 3SMZA 4GKKJ 3MUVP 1FEHA 3IRWP 1GEHA 2A1BA 2E1MC 3V4IB 4RU2A 4OZ1A 5KFRA 1HQUB 1NU4A 3S1TA 3MEDB 2HQCA 3CJSA 3O2IA 1UFLA 3BR9A 1FFWB 3BKUA 2ZJPQ 4O4RA 2XGPA 1U1OA 1RTIA 2XMKA 1U0HA 2DNKA 1Q16B 2IY5B 2Q6BA 5CYMA 4ZPCA 3R6GB 4I6AA 4JI8F 2JNJA 4HI2A 4DN0A 2B4VA 1UL3A 1JQGA 2HFZA 1LEOA 2CKWA 4DFJA 2IAJA 1B0PA 5CYMB 4YB1P 1RT4B 2ASJA 4IG0B 4CLYA 2MEWA 4WK1A 1HWIA 4N77A 3U7JA 4X66J 1VQ9S 2X3GA 2IAJB 2W9BA 1UWBA 3FRZA 3PRVA 1M0SA 4DR3J 3PZPA 1N52B 3Q8PB 2IVFB 3CCUS 1OSDA 3N6LA 4DQPA 2IYIA 1RHUB 3EUNA 4DUYF 2GA7A 3PW0A 5CAAA 2J0XA 1Q81T 1JLAA 3GJSB 4MYUA 4DZDA 4L75A 1HQEA 1Q8BA 1RT1A 4QCLA 1RXOB 2BE7D 4KRWA 5B0BA 2XSJA 3GYNA 2O3DA 4NA3A 3ZZYA 4ZLJA 1JB0C 2QIFA 4FYVB 1DTTA 1RT1B 3NCQA 1YJRA 4LF4F 2UVVA 5DDRC 1YKWA 2ACMA 3DOMB 2W2OP 1JK9B 1TL3A 2XSJB 5RUBA 1IXKA 1UZHA 3OFFA 4UY8T 3BZQA 3BYRA 4B3MJ 2JLFA 5CA5A 1QM9A 2IMOA 5F8MA 4MK8A 3OQ2A 2KG0A 4DF8A 4QPTA 2X1BA 1KTQA 2YKAA 4C97A 3D2WA 3IA0A 3QZ7A 5HMYA 3R5GA 1GMWD 3RJMB 2AYBA 2UVRA 3DGPB 1TFWA 1KFSA 3NS6A 3NGTA 1X60A 3WC0A 1RA7A 1KKHA 4USIA 5LL6d 2GVZA 2GMHA 3M8YA 1JIHA 1RTHB 1YRUA 1KHVA 2FJEB 1VQ7S 1D3WA 4ZCMA 3KHRA 2VKRA 3CDAA 2GJ2A 2JWNA 2KH9A 1QLNA 4DR7F 1BXNA 1GQEA 1OMSA 2PDAA 1T3NA 4I6WA 5GVQA 2GVZB 1OIAA 2XMUA 3OVBA 1UMJA 3JSRA 4FYWB 2OSRA 4ZHRB 4OI0A 4K0KF 2RF2A 2VHGA 3HXMA 2HNDA 2NREA 5K14A 4B3OA 1H72C 1NNDA 4DL4A 2VOOA 4LRFA 3Q86A 2WTFA 4LF8F 2KFZA 3SIPB 2DGWA 1FJGF 4NYPA 5CABA 4H54A 4QIVA 2EC0A 5KFFA 1AFIA 4P74A 1BUXA 1R6VA 4F67A 1R43A 2XMMA 4NRUA 5KFSA 4NA1A 4U7CA 2J7WA 2PEHA 4QWCA 3LPEA 3SEOA 4CNZA 4HTIA 3H5UA 4DS4A 2UU9F 4PG4A 2QYGA 5HBMA 3PIPQ 4DSIA 4DV2F 2JVOA 1NEEA 4JI8J 3KHLA 2VG5A 1RHJB 1JXLA 3FRYA 3QWUA 4ZCIA 2EI5A 3CVKA 2ZBRA 1WC3A 2F8HA 1WEYA 4LSLA 2RHQB 2VG5B 4IO1A 3M30A 5I42B 4GO5X 2WVFA 3GP9A 3G82A 2DR8A 3EGWB 3V6HA 4IR1A 3F44A 5LSOA 2DR5A 4ZITA 4DEZA 2VDIA 1G3OA 3OFEA 4K2XA 1UTAA 4CLWA 1AROP 4IRKA 1XNRF 5HL7Q 3Q8SB 3TYTA 1VIXA 3R5AA 1VC5A 1X5TA 2UXDF 2VFVA 4KTQA 1LOUA 3UCGA 4DZ6A 3OTEA 3QFWA 2G13A 2HKEA 3FFIA 3LP0B 2JFDA 2FJDB 2PFFB 2W01A 2WVCA 2K1RB 1RB0A 5JVGQ 3FFIB 1QTMA 2E66A 4LF4J 2HG4A 2IJRA 1NAQA 2FJAB 3N5FA 2ZH9A 2ZC3A 3MEEB 1UJ4A 2XWXA 2DHGA 2VL1A 4ZN1A 4JV2A 2J8SA 2YPYA 1WF2A 3I0SA 3OVAA 3NRBA 4DR1F 3G9CA 1TUGB 4LIWA 2W4PA 4DMZA 2V8GA 4B9UA 3KHGA 3ZZPA 1VBZA 2V69A 2CPFA 2W9CA 3KTQA 4DV1F 2HAIA 2BUNA 2HHQA 4NLTA 1L5UA 3CD7A 4EO6A 2R7UA 4ES3A 3UO0A 2YNHA 1RUSA 3PRBA 1KNZA 1QSLA 2N3OA 3RRGA 2HMIA 4RW9B 4DL5A 1WDTA 4M5LA 2R7TA 4LSNB 1Y9OA 1WHYA 4DX6A 3I9ZA 2QYCA 1G2EA 2DR9A 1MROB 2A18A 4K0KJ 3QLHA 1TAUA 1YDLA 1SXLA 4X4TA 1JJCB 4BBYA 4OHWA 3O44A 3TA0A 4OYPA 5EWFA 1R0BG 1JLQB 4F0KA 3DNCA 3JTPA 1S99A 1S48A 4UQTA 4C8OA 3TI0A 4LF8J 1GK8A 2WONB 1RTDB 1FJGJ 1S1XA 2PI5A 5HLFB 3CUNA 3Q8RB 4KPCA 4UF4A 3O6QA 5J2NA 5EDWA 1HBNB 4M8LA 4K4SA 3OL6A 3MAAA 5E3RA 2UU9J 3HD1A 1WC6A 2DGOA 4ZA1A 1FKPA 1U6BA 3SFUA 4MFBB 4DV2J 2ATLA 3DRXA 2Y8YA 2BE2B 2MLZA 3OSNA 2C2RA 3I0RA 4M5MA 3UVJB 2ACYA 1AUSL 1SV5A 5LOQA 5BR8F 1HIYA 4HL9A 4ZPAA 2JEFA 4O44A 4RUCA 2V8VA 5F3TA 2J0SD 3HHNB 4GVBA 3KOAA 4JI6J 4O44B 3D9BA 2ZE2A 1SQEA 1DLOA 1NBEB 2HAFA 2C2DA 3PKMA 1QVFR 2GIQA 1TVRA 1XNRJ 3BGRB 3A8IA 2FLPA 2DNPA 1Q5YA 2XSFA 4G1PA 2UXDJ 5IC4B 3HSGA 3Q83A 3RB3A 2XZDB 1U1RA 1FKOA 2R7OA 2FJBB 3RRHA 5DLGA 1KVJA 3GILA 2UVUA 1X7VA 2OTJS 3BGOP 1REVB 2YWKA 2K8GA 2M5YA 1FVSA 4H4OB 4NLVA 1SQFA 2N4DA 4IO9Q 5CZXA 1FKOB 4HDGA 2HW3A 1X9MA 2HHUA 1TU0B 2UUCJ 1IKYB 1SPBP 2GHPA 3UCUP 3VZHA 2J9EA 1JX4A 2XULA 4ECSA 3C2PA 1JLBA 1A9NB 2ZD1A 3HP6A 2RQ4A 4DR1J 2C1EB 2COLA 2ZH6A 2R2UA 5ETMA 1O6XA 2OPPB 2BJEA 2AEMA 2JDJA 4OYIA 3W62A 2EPIA 3A12A 5F9NA 4DV1J 1VFJA 2LP4A 4L6V3 3EPIA 2MY7A 2ZH3A 3AOCA 4X4RA 3OTOF 3FEXB 1RLDA 2A10A 4I56A 2AT1B 5A8WA 2OPRB 2BANB 3NLCA 5IFMA 2G2ZA 1YSJA 2AX0A 1URNA 3CXCR 3IAM9 1RGVA 2EFNA 2DGUA 2EKYA 3OTBA 3OT9A 1YLXA 5GMDA 2VG6B 2Q66A 5HAOA 5A8RA 2CAJA 1OWXA 1S9GA 2CPJA 4JI2F 5KFCA 3KK2A 5LJ3Y 3HDSA 4HH1A 1WG1A 3KJQB 1LQ9A 3EZOA 4ICLA 2HNZB 2ZFHA 3IRXA 4X4UA 3KWMA 1AUDA 5A8RB 1HA1A 2NXNA 1S9GB 4PG7A 1M5OC 1RT7A 4ALZA 3KK2B 3BQ2A 4ID8A 2OEJA 1B0VA 4LT6A 2OTLS 2Q3PA 3G6VA 1RWXB 3EDRB 3Q22A 3SQGA 3MDFA 4WYWA 1HNVB 2M88A 1E6VB 2K06A 2MZJA 1RT7B 3QGGA 1KP6A 4F8RA 2CG4A 3H42A 3OR2A 4A8XA 2AMCB 2BDPA 2CNLB 3QIDA 4RBUA 4WTYA 3JYTA 3HSZA 3AA8A 2AZ1A 2GCFA 3UE2A 4USHA 3OR2B 3QRPA 1N5VA 3BQ1A 1PO6A 2MYFA 3DXSX 3DDIA 2FZGB 1U2CA 3JYTB 1MMLA 4J90A 4PWUA 2MKSA 1FNOA 2R8GA 5BR8J 1OQ3A 4KH1B 5F41A 3ETOA 4Y2CA 2DCUB 2VFUA 1Q78A 2ZUGA 4OV6A 3CTRA 3I56S 4YDDB 1NB2A 3KLHA 1U1LA 3TZXA 3W5ZA 1YJNS 3UDLA 1IBMF 1RAGB 4IH5A 2K3KA 4LF6F 3A3NB 4NMLA 2W8LA 2YH1A 3ELHA 4J9VA 4HACA 3VZIA 3THVA 3QT6A 1KDNA 3AB4B 2P2CB 3LANA 2VIHA 5F0UA 5DS7A 4LRCA 1S6PA 2VC1A 3D1QA 1B7FA 4QOTA 4P52A 4NCGA 4KHMA 4WFXA 4HHUA 1WNEA 1MU2A 2HVZA 1QAXA 3I4HX 4QIEA 1CPZA 3BBFA 2XHWA 4CO2A 4TU9A 5M2RA 1JLFA 4KO0A 1NCLA 2QE5A 4KAIA 4A8SA 2EG2A 4KFBA 4ZJQA 4RW4B 3HHDA 4JV1A 2VA3A 1ICEB 1EKRA 4OLPA 2RRBA 4RWXA 3FBEA 4DQQA 3UCZP 2DK2A 4KFBB 4IG3B 3VV2B 3PHTA 2JZ5A 3AB2B 2OSQA 2OPSA 2KJWA 3LALA 4USMA 3H2VE 3QT8A 2KHDA 5K8PA 4KGVB 1PYOB 1L3KA 3VQTA 1OY8A 4B3SF 5B09A 4PQAA 4ECUA 2RRAA 3PHEA 4LFAF 3K5PA 2VPXB 2HURA 1HW8A 5ETRA 3GYGA 3JAMY 2XYGB 4JBCA 3CJ5A 1SB6A 3PM9A 3TVKA 1FVQA 1TZ0A 2RVJA 3K8VA 4JI2J 4UY85 3QJPA 5JUMA 4WF9Q 4J9UE 1P8GA 5FLXY 1VIOA 4F3MA 4A8WA 4I6YA 3SQOP 1NHVA 4Q7AA 2V2ZA 4ED0A 4JB8B 2IPOB 1WUUA 3KNAA 1DURA 4WK3A 3EXYA 3LWMA 3U27A 4K4WA 3KLIA 1M5KC 1DY3A 1VMBA 5CH7B 2Z8QA 3AH6A 1FWPA 2VU5A 1TL1A 2DO0A 1WEZA 1E6YA 1LWFB 3KLIB 1PYSB 2ZKTA 4CRJA 4AQYF 4ANCA 3BO3A 5GAGI 1TL1B 5KFUA 5C5JA 5I3UB 4JYAF 3HVAA 3OLBA 1E6YB 1OYEA 1EQ0A 3ZXWA 3D3BJ 1CC8A 4U7UK 4DCJB 1YWXA 1UPMB 2XMAA 2WOMA 3RBDA 4NX9A 3FSXA 3MMJA 2Y1JA 4YR3A 2YWGA 1NJZA 2VC0A 1R8PA 4L76A 2FC8A 5IV3A 3EZ5A 3G4SS 1UZDA 5HQ8A 4LF5J 3UDEA 2K7JA 4QIWD 4LF6J 2DNQA 3BDPA 4NLPA 4MIWA 1RCOB 3DLBA 1N33F 4F0HA 3TA2A 1VHFA 5KG0A 2KT3A 4OLOA 1Q7YT 2YBVA 1ZTTA 4L3KA 2KYXA 2YNFA 2PMHA 3TVYA 1JLCB 3DMJB 3WX8A 1IN0A 3PJWA 1JXVA 3HJFA 1V3SA 3AOBA 3OSPA 4PXCA 2HQGA 2YNFB 3CJ8A 5LSRA 2BJ3A 1RK8A 3GONA 2FHKA 3PR5B 4DUZF 3ZTRA 1FRHA 2G9OA 5K20B 3QGIA 3S01A 1H73A 4A8OA 4FP9A 2NUHA 2IBOA 4WFNQ 1UVNA 3CCJS 2FIUA 4AUKA 2P9CA 2AYGA 3MXHP 4D3GA 4LMZA 2A2DA 5DG7A 2AQ4A 2MLYA 3W9HA 2IDEA 1HD1A 3UW1A 1F9EB 1KLMA 1XMBA 4CO4A 1DRZA 1ZM3A 2ALYB 3CD0A 1A0OB 5IOLA 1S1TB 2ZEJA 3UNGC 1KVIA 2U1AA 2EFQA 2ATCB 1P27B 5KT5A 1ROFA 4DV7F 3NOCA 4CH1A 4B3SJ 1RHQB 4KY3A 3A3OB 5HI7A 1BGXT 2JEGA 3H40A 3IWLA 2FQQB 3NAHA 3UI3A 3BS9A 3KK1B 2FHJA 3L7UA 4IH7A 2P8IA 2J5AA 4NZ6A 4CLZA 5A2QU 2QLWA 2A0FB 2GMLA 1SH3A 3JQKA 1CULB 4U9RA 1SJFA 1GX6A 4DJBA 3M8PB 3LP1B 4LF1A 2ZOMA 2EEYA 5ETTA 3RB4A 1XMQJ 1BLUA 3D6MB 1CJVA 4JUZA 2QT7A 4KR0B 5L1JA 2AGQA 3OXLA 2X1GA 1IWAA 1PBAA 1F6TA 2YKNB 2X7IA 3TWZA 2J0QD 1R31A 1R0AB 3C6UB 4USUA 4ZVOB 2IRXA 4X4OA 4CYUB 1RQ0A 4J9SA 1Y10A 3MM7A 2R7SA 5CHCB 4KJIA 2DXFA 2VICA 2PT0A 2F5GA 2GHVC 2JC0A 4MIAA 1G7CB 4DV5F 4NE9C 3N79A 3BKFA 2MKJA 4BC7A 4JYAJ 2RU9A 3BPSP 2POKA 4OZ3A 3PY8A 5KFHA 3UPFA 4FBUA 3UR0A 3MGJA 2ZM6F 4RUAA 1FTCA 4CLFA 3KDOA 4NOHA 3L3CA 4F36A 3U1MA 3HPOA 5D78A 1RT5B 3V81A 2MGZA 2KVIA 1P9QC 1RHMB 2QFIA 1LWEA 3DLKA 1GH8A 4ZVEA 1C0TA 2YNIB 3KJVB 3V81B 1RBAA 2O67A 4A47A 2IRUA 5HROA 4USJC 3IO1A 2X1FA 1T3OA 1G1XA 1XMOF 3MM8A 5DDPC 5HROB 1H6KX 2XCAA 1L3VA 4PQUA 4QW8A 1UEUA 3G6XA 2Y1LB 4EBDA 3K5OA 4NXNJ 2QN6B 1GTHA 4KGMA 2HIYA 3MR5A 1YITS 4NLOA 3R5JB 3CF5Q 1LV5A 1LFPA 2MQLA 1SKUB 3D6HB 4NLDA 2BKNA 3DGVA 1S4FA 1K47A 4RW6A 4DV4F 2GMJA 1V6HA 1XR6A 1EAYC 3N5BA 3TZZA 5J1PA 2R8HA 4RW6B 4MKBA 1AT1B 5EN1A 4Y34A 1CC7A 3UNYA 2IYGA 3NCPA 3BKTA 2ZWOA 3AJ2A 3B8HA 4CP5A 1OS5A 3A8EA 3EVMA 1UCNA 4DV7J 3M4XA 1RWNB 4PUOA 4QU7A 1ELOA 4M5IA 4MT1A 1IVZA 2NSBA 4IDKA 3NBPA 2HVEA 1T9XA 1HYSA 1S0OA 2LLZA 4RKUC 1IM6A 1H2VZ 1TL4A 3VAKA 2R8IA 1O51A 1SBRA 2B3TB 3JAMU 2E5HA 1MW7A 2FGOA 3M8WA 2P5VA 1I1GA 4ETZA 2UUAF 2F3JA 1S1UB 2GHWA 3A4TA 4AT1B 5FLXU 1V5VA 3AQPA 3CWJA 1EIYB 2L48A 4ECVA 2BRLA 4WP8A 1IR2A 3V2UC 1F60B 1VQOS 1Q86T 2J6UA 3Q8UA 2PA8D 4H4MA 2YNGA 5KG6A 3H5XA 1RAFB 1M5VC 1EP4A 5HK4A 4DV5J 5HP1A 3RR7A 1HI8A 4NZ7A 1QE1B 3MMAB 4DBQA 4KGXB 3GG0A 1U26A 4DOZA 1TV6B 2QFJA 2BQRA 1LW2A 5HP1B 1YRXA 3IGVA 4B02A 3PW4A 3GIJA 1HNXF 4GRSA 3W9JA 1Y0HA 3ZZRA 5KFOA 5C24B 1F9HA 2HZAA 2I5JB 4TNOA 5THWA 4YB5A 5IZHA 4RW7B 2QSWA 4KKOA 4OZ2A 3C14A 2VPYB 3DI6B 1EETA 4Z2XA 4DR2F 4QR0A 1Q1KA 4YMEA 2NQPA 3D0IE 2RH3A 3C14B 3NY0A 1EETB 1S6OA 2QRRA 2WW4A 2MJNA 1TMJA 5KAKA 1N5QA 5BYQA 4ZS6A 1RWUA 2B9WA 4NLSA 5E5NA 4QW9A 5F8JA 5J2PA 3IS9B 5LMUF 1FWLA 4WU3A 1UPPA 1OSCA 4LR8A 3W2VB 1IKVA 2DXDA 3CMES 3KLFB 4TY9A 1KOOA 5J1EA 1Z1ZA 2ASYA 4IKAA 3I5CA 1IKVB 1WC5A 4QR1A 2BKPA 3NGRA 5C2CA 4DV4J 2VZ9A 3U02A 1EHWA 2IA0A 1UFWA 1S76D 2BVZA 4KIAA 2XY5A 4J9KA 4ZVUB 4K7QA 5EHHA 2AGOA 1JJ2R 1T9UA 2XCPA 4E2FB 2RU3A 1RACB 2ZVSA 1T7PA 4A8YA 2F40A 2AF6A 4RNNA 1WWHA 2RMLA 2XTJP 3DKDA 4WKYA 3H5YA 3HFVA 3PNIA 3KK3A 1VS3A 1F5BA 2KB2A 3W64A 2HVIA 3MM6B 5DQGA 2CWXA 3KK3B 1Q8LA 5AXMA 3GMGA 3OTCA 2WW8A 1HFEL 1WHVA 3NGSA 2X1AA 4MH8A 5D8HB 2E5JA 4RBVA 3TJ9A 4HDHA 1FCAA 4AL6A 3GZ7A 3VAHA 2UUAJ 1RADB 4Y28C 2MQPA 2RS8A 4D3HA 2GQCA 2IM3A 2XNQA 1T95A 2HRYA 4CM0A 1ZM2A 3OXFA 4OYZA 2DNZA 4JOUA 2MDAA 1JWWA 4CT8A 3HHEA 2B9XA 3QT7A 2W2PP 2MHNA 4EYHB 3TVZA 3POTA 4TQSA 1V3RA 4FBTA 4FXVA 1KEKA 5LSLA 3MFHA 3VWSA 3POTB 1CJUA 4ZP8A 6FDRA 1C1BA 1T05A 4C8KA 2PD1A 4GKJF 2Q6CA 3MFIA 4ZP7A 3Q24A 5FDLB 1TL7A 3F56A 4NL5A 5C42A 2GVDA 1ZZNA 4WFZA 4DCPB 5A8KA 2FY8A 5AJ3F 2D3O1 2HFNA 2G0IA 4GC7A 1Q4RA 4NXMF 4XPEA 3F0NA 3P5TL 1S57A 2B9YA 3JTOA 1N88A 5KFMA 2VJVA 2DNOA 4DR2J 2XGQA 4P71A 2E5GA 1H7XA 3K17A 4KSEB 1HI1A 1YJWS 5AT1B 5E3QA 3ZO7A 3E01A 1J5OB 2B8QA 4RUBA 4ZLLA 3BGFA 4ZVGA 5KFZA 3CCTA 4OJ1A 2Q79A 3ZFVA 2C3PA 4PWDA 2QMUB 1R6YA 3E01B 2N7CA 3SV3A 2G2OA 2HFOA 5LMUJ 1FDBA 4HTJA 2GFFA 3FC9A 2UUTA 3BR8A 2BZ2A 1PC4A 1IQZA 1S77D 2XMVA 2N82B 2KG1A 1IBKF 3QJLA 1DARA 3N28A 4WJBA 2EFVA 4HT5A 3R5DA 4YP3A 2F8EX 2LXIA 2AW0A 1TQLA 4FVCA 4C7QA 2CJAA 4ECTA 3HSJA 3BGLA 2E9TA 2IVMA 3W8GA 2DNYA 4I2QB 2DEJA 1N54B 1UKUA 3GR1A 4PWWA 3I4PA 2XBPA 1YGYA 1GX5A 4F2SA 1T02A 2IFXA 1RT3B 3B6BA 2VFSA 3CDBA 3ZZ0A 2XY7A 1IKWA 1KHWA 2F1FA 1TP7A 3DRRB 1SH2A 2MY8A 3KHHA 1N6QB 5F0WA 2ZHBA 3IC1A 5F8GA 1IKWB 4ZVSB 3T1YJ 4FF1A 1CJTA 4WE1B 3RAQA 4LRBA 3W2WA 5JXSA 3QZ8A 3ZTQA 4LRAA 4V19J 2V67A 3TANA 3M32B 3ZNUA 1C0UA 4AFFA 3P4UB 1L3UA 2NLWA 4WP9A 2PC6A 2CWKA 3HSDA 3QNWB 2PSZA 4FF4A 1TTHB 3OR1B 4ID5B 3QRQA 3GIMA 4G65A 2YPZA 4HT7A 3M8QA 2AD9A 4IH6A 1HL6A 2E9ZA 1ZPVA 4DUTA 4X65F 2V94A 4V1Ak 1U47A 3VQSA 2WSEC 1BHNA 3IGNA 3W66A 1X5SA 4KGZB 2JRSA 3W63A 5KTQA 2QEXS 2ZZMA 4HVZA 2V4JB 2QL5B 4R0JA 5LMNF 1IBLJ 3SZ2A 1M90T 3GFHA 5AJ3J 3MMCA 3UD4P 1KTVA 2DNGA 4W92B 4NLYA 1RWVB 3KUGA 1TKZA 3I55S 2KYZA 2R7WA 2AIRB 3TUPA 1NSAA 4NXMJ 2E5LF 3PACA 4EYIB 1NB7A 2E44A 3ENVA 3CMAS 2G1DA 3OL8A 2B6AA 4PYDA 4IFYA 2HLTA 2M8DB 4FXWA 1ULRA 2RQMA 2B6AB 3TZYA 4NZ0A 4A8FA 1LW0A 3EGVA 2H5JB 5CQGA 3H20A 5KG5A 1NSKL 5BYRA 1FX2A 2JJ4D 1Q5VA 3T19A 3DU6A 4FN5A 3I9V9 2P9GA 3MPDA 1NK6A 1VQMS 3GR0A 4OJ3A 1DQAA 2PEBA 4O3RA 1IBKJ 3DYAA 3EVWA 4X62J 3TAMB 2H5IB 3ENWA 4A8QA 3TZWA 2V5HG 1YG0A 4F3OA 3B78A 3JS9A 1H3DA 1VI7A 2WBRA 3KJNB 4ED4A 3SCLE 4B9MA 1S6UA 3DYAB 4XDDA 3C16A 3LP2B 1S1WB 1LWXA 5D3GA 3UWTA 5JMNA 3PO4A 1JLGA 4P2FA 3A8JA 1TUVA 3MZIA 2NYIA 2ROPA 2HGMA 5J2MB 4C11A 4F02A 3T41A 2KM8B 1XERA 3LH2S 1JLGB 1NK5A 1O0PA 1NK4A 5HMWA 4DI6A 1HNWJ 5HANA 4JV5F 1N4LA 3M8RA 4FKYA 1FESA 5KG1A 4M95A 2YY3A 2YQ0A 3CJKA 4MK7A 3I6PA 3M2UA 4ZVPB 2ZBPA 3DLGB 2RDIA 2L9NA 2AWZA 4XPCA 2GAGC 4LIRA 4L72B 3CC7S 3RGIA 5GAHU 3DLEB 2AJQA 2RSQA 2BV3A 5GMEA 3CMQA 3FMBA 2J76E 1X4DA 4OJGA 5L8RC 1U0SA 1GNKA 1CBKA 2FVPA 3WBZA 2DH9A 3LGNA 4OQJA 3QQCD 4I68A 3OV7A 2GO8A 1U7LA 5ETPA 4V19X 4RNFA 1IKXB 3QWPA 2LQ5A 4F2RA 1R3NA 4X65J 2VFRA 4GVLA 5D0HA 4RPFA 2YWFA 4BCAA 4TU8A 3HK2A 2VPZB 1GTEA 3OL7A 1H2TZ 4UTGA 3PW2A 3TOQA 2K2PA 3QIPB 2MB0B 4N5SA 3D3CJ 3NWRA 5H1SV 2DEIA 4DN9A 2OELA 4NI2A 3MPVA 1FF2A 1WORA 2BX6A 2VV5A 1S1VB 1S0VA 3M8SA 2R2TA 2E5LJ 1TKXA 4C8YA 4I67A 2Y0SD 4URSA 3OFGA 4YB7A 5DG9A 4J9OA 5D4PA 2NXCA 1TKXB 1BQMA 4RNOA 1T9YA 2HK2A 4OZ0A 4KC5A 2HQDA 4F7VA 4PCQA 3FBBA 2PE8A 3LAMA 4WCEQ 2HPUA 3W65A 3ZZTA 4ZJLA 4LFBF 2UV8A 1SL0A 4YOEA 4P2MA 2EW9A 3RAXA 3R1LA 5C25B 2VB6A 3HM9A 2AJ2A 2CQHA 4QYRA 2MKHA 4PZVA 2CQBA 4P10A 4CLPA 3V6DA 1UEKA 5A76A 2BACA 1Y3KA 3N0VA 2V4QA 4KYZA 3KXDA 2O66A 2LFVA 2KKHA 3HHKA 2GV1A 3GFXA 2BM1A 5KG2A 3NKYA 2QLFB 1VBXA 3R2CJ 2YX4A 3M1VB 3M6WA 1UVJA 2W2QP 3Q2TC 1NKBA 5JJBA 1HHTP 5HATA 1J2VA 4JI4F 4TY8A 5KG7A 4XO0A 4PABA 4JI3F 3DFEA 3GQCA 1MWQA 3GJQB 3SSQA 4OI1A 1SJRA 1U1QA 1TKTA 1FKAF 3MCOA 1RYSA 1FE4A 4MJKA 4LFCJ 4JV5J 3LWLA 3PV8A 2J0WA 2DCLA 5D77A 4Y3CA 2UP1A 1RT6B 2B5JA 4KHPF 3VGUA 5K9FA 3CJ4A 1I6JA 1UW4A 2XLJA 2ZUAA 3HHLA 2E29A 2HNYA 5L1LA 2BJDA 2FVCA 2OKQA 2B5JB 2BM0A 1PAUB 4OHVA 1Q8KA 2CQGA 3HHLB 2HHSA 3P49B 1RP5A 4JI0F 2HNYB 2RE1A 3BBCA 2FJXA 1WHXA 1WKJA 4FYYB 2ZOGA 4OJHA 3W7BA 4F3QA 2WHOA 5T41A 3W1YC 4B08A 5EX3A 3KYLA 3GWCA 4MYTA 4OX9F 4MAKA 1W2IA 4YR0A 4OZLA 2CNNB 1XK8A 2A2CA 5LT5A 1QDUB 2BKOA 1IR1A 3G6ES 1FK9A 4OZ5A 1ZAWA 1ZOTA 4DL7A 3MOZA 4N8OA 4F4YA 3Q23A 3Q0AA 1U6ZA 6FD1A 3CT9A 3JSBA 4F4KA 2HFUA 2FVSA 1RTIB 2GX8A 1K0TA 1U0HB 5F8LA 5CYQA 1PC5A 7FDRA 2MQOA 2W9AA 2W7OA 2HHPA 2A6OA 5CYQB 2W7AA 1WF1A 3Q2SC 4ZP9A 5HMXA 1LFWA 3I5BA 3T5JA 5I3QA 2DTJA 1RU1A 3D6TB 3RR8A 4A46A 1D09B 2W9BB 3PIOQ 1UWBB 4R8UA 3BJYA 2G2YA 5M2PA 2RUGA 1WDDA 3MCNA 1SC3B 1Y5IB 3QJJA 4LFBJ 4PG8A 3VAGA 2LEAA 3QPIA 3HLUA 4NCAA 1JLAB 4F0MA 1CS4A 1FI4A 3W9IA 1HQEB 3QBCA 4ED8A 4Z37A 4NEZA 4J7CA 4IFVA 1BY9A 5AE3A 2OH2A 1X8DA 1WELA 3R8YA 4LR7A 1IJFB 2W4DA 2EK1A 3VVUA 3FCVA 3QO9A 4OHZA 4M63A 1HNZF 1DTTB 3SDEA 4DV3J 1VQYA 2DT9A 4R25A 3NNCA 3CCWA 2JH3A 2C42A 4IFVB 4J9LA 3HVRA 1TL3B 1UEVA 3D5MA 3FVYA 1RAHB 2GIRA 2HQIA 1N36J 4ECQA 3NAIA 3GYXB 1SL1A 4RBTA 3QO9B 5E41A 4CNYA 5IXUA 2HBYB 3WHIA 3T1HF 4K5SA 4K50A 4M5DA 4U7UD 4JI4J 4HLBA 2GO9A 4JI3J 4HH0A 5EUHA 3I96A 2VBYA 4DF4A 2QA4G 1BWVA 2MQ8A 3TP2A 5D0GA 1RE1B 3H7HB 3CO9A 2HGNA 1AYEA 3WIVA 1UA0A 3V6KA 3J7Z5 1T9TA 1RAAB 2YH0A 4C0OC 4CCHA 3MCMA 4H4KC 2AKWB 1H98A 4K5RA 2DXEA 3BREA 3CDUA 3EZUA 3FKBA 1PSDA 1CJKA 3OXGA 3J7YI 1IQTA 1QSSA 4Y2KA 3MD1A 4LREA 2RIJA 4CZCA 2OGUA 4R0EA 4FYXB 2LU1A 3MI7X 4O3NA 5KFQA 5B08A 5IM0A 5IS2A 3VVTA 1ZPWX 4H4KA 1DTQA 1D0EA 2MSTA 2RF2B 3LA0A 2HNDB 2ERRA 4B3OB 5K14B 4E0DA 2VQFF 4G1QA 4IOCQ 3TUZC 1YRTA 2I9SA 1DTQB 1W26A 2EBGA 4OX9J 4NEYA 3DHWC 3UDCA 2FVRA 3NNAA 2KXFA 5IT9U 3R97A 3I82A 2PGCA 2QA1A 5AXLA 4USKA 1FWKA 4ZJOA 4TU7A 3K7RA 1NUEA 2C28A 3ISNC 3FDSA 5MLCV 3TAQA 3KUEA 1OPZA 2MLXA 1ZTWA 1DQ9A 3MM5A 4QZVB 5HBMB 1X4FA 2XY6A 4ED5A 2JSXA 3DCAA 3PJXA 5B0AA 3S6EA 1CQMA 5KG4A 2JEIA 3AAWB 1VDHA 1I5OB 4M5HA 5D0RA 4OI3A 1WI8A 5B7WA 4O4GA 4LSLB 4I7FA 4KV8A 2M52A 2XG8A 3M30B 1FJEB 1RBLA 2RKIA 1JKHA 3G82B 4EEYA 1YI2S 5DGBA 3QRRA 4DUYJ 1U6FA 4PAAA 3V6JA 2MZQA 1N0VC 3BO4A 3J81U 4KV8B 2DNNA 1JKHB 3C6TA 2D74B 4ED3A 2FLLA 4J5OA 1W7WA 5T7LA 4ITSA 3NXZA 4TYAA 1BQNA 2JEJA 3MUTP 2IM0A 2KT5A 1RWMB 5DZ7A 1H2UX 1B70B 3ENAA 1Y00A 1FTRA 1BQNB 1R8BA 1AZSA 4AL7A 2WVBA 2WCXA 1HNZJ 2OFHX 3IG1A 1QAYA 4Y2AA 4MKAA 4RU9A 2CYYA 3C66A 2KI2A 1M1GA 1TUWA 1WTBA 1RWOB 1HQ2A 1U8SA 1VQ5S 3QAEA 4BHQA 4YY3F 3B54A 3I0SB 4IUFA 1JLEA 3JTNA 3IWXA 3T1HJ 3OHBA 3OW2R 2D41A 3AA9A 1RT2A 3LTOA 3RBXA 3E3XA 1N5YA 2QTWA 4O3QA 4X84A 1ZA2B 4LQ9A 1LXNA 3BH7B 2ASLA 2FTRA 2RDJA 1RT2B 2W9CB 3RB6A 1J27A 3MMBA 3PR4A 2EVZA 2F9DA 3VAJA 3OUYA 4USVA 3FZ2A 3NG8A 2Y0BB 1N0UA 2HLUA 3LGHA 4I2PA 7FD1A 2YNHB 4DR7J 1A6LA 1PBUA 3J7AN 3DRSA 3G6YA 3DLHA 2OHDA 4NLRA 5F8HA 2HZVA 2BW2A 3SSRA 2HMIB 4ILMA 3ULHA 3AXKA 4M5KA 4UOGA 1KQGB 2GC8A 2YKQA 6AT1B 4Q2LA 2QL9B 2KZZA 4BC9A 3VCDA 4Y6IA 3KNGA 2VD3A 2EFOA 2E7XA 3GB0A 3U1NA 3DDNA 3Q8VA 4S0MA 3QLHB 5L9NA 4CLSA 4Q5VA 2IM2A 3LUYA 2AEFA 2Y3YA 5JVHQ 2YKMA 2VKZG 2VQFJ 1V5IB 4EBCA 1PJ6A 2QMWA 4OYWA 2Y1IA 2CQ3A 3US5A 4WIIA 3H8YA 3IM8A 3RBEA 4BS2A 2VONA 3I32A 1S1XB 2XYPB 4QWAA 4LJMA 1KQFB 4DFPA 1C2PA 3A13A 1S9EA 2GQ2A 3M7VA 2WAQD 3HHLD 5J2QA 3MR6A 5J2NB 2B4UA 2VG7A 3MAAB 2MXYA 1FKPB 2BQUA 3WIUA 2ZKUA 2DGXA 2M2BA 1KBRA 2H1YA 1RA6A 3I0RB 2WRMA 2V50A 3GPAA 1SV5B 5EGYA 2B43A 1OPIA 2EC2A 4OI4A 3BH6B 4RLEA 3PFEA 2CPXA 4W98A 2RRNA 4GVBB 3PYDA 4EZ9A 1GMWA 2WB4A 2ZE2B 2HEKA 3BSCA 1DLOB 3R5BA 4PG6A 2E1AA 2CZ9A 1TVRB 4WPAA 2XMTA 1IBCB 1F5AA 3KUHA 5F3ZA 2D3OR 3KG0A 3T5HA 3F41A 3DOKA 3AJDA 1YK9A 1AFJA 3DU5A 3AY0A 2CQIA 1NM2A 3RW6A 3DN9A 3KLEA 4B17A 2CG8A 1T0TV 4CLKA 3NS7B 4L3NA 1N34F 3HFKA 1FERA 1FA0A 3I87A 2OEKA 3AQOA 3B4DA 2L9WA 2UZAA 2DHHA 4C2MA 5HQMA 4CTAA 1VRTA 3GLJA 3E51A 4YY3J 2BEFA 1JLBB 1FE0A 1V9OA 2ZD1B 2XMJA 4IRDA 3FCHA 2HK3A 4DSLA 4CTAB 3H5SA 2QMXA 4ZDNA 4DPUA 5D6GA 3PW5A 2CPZA 2RD5C 2ZITA 2OPQA 3FEYB 2LYVA 2CUYA 4B3RF 1R8HA 4U8VA 4C3LA 4HHHA 1U1PA 3ZTPA 4DV6F 2R4FA 1RJJA 2OPQB 4ANDA 5LM7E 2KT2A 4K4TA 1NPRA 2LQBA 4DDFA 3TNVA 5A2QY 5A8WB 2Q43A 3ZC4A 1WC4A 1ZZFA 4ED7A 3MAQA 3D0HE 4XDCA 4CO1A 2FJVA 2NCKL 3PX0A 2HHHF 1NZAA 2QJ3A 4YS2A 1L3TA 4GKKF 1FRXA 3DRPA 5KFAA 2CDRB 1WSRA 2Z4PA 4N47A 3UQSA 3EVOA 2D7SA 5GADU 4ICLB 1CVJA 3IRXB 3BBBA 2F9JA 1FRLA 2PMZD 3EDQB 4N41A 3LO3A 4WYLA 1SJQA 3SQGB 1I3OB 3K0JA 1RAIB 2JLGA 4DL2A 2FDNA 4DPTA 3ONQA 3R9LA 4CO5A 5CCLA 1N8RT 2W7PA 1HBOA 2PI4A 4C48A 1HBUA 1MMNA 3MHYA 5CZVA 3PKYA 1NO8A 3K58A 3EXCX 3GSDA 1U24A 4HR2A 1HBOB 5B0CA 1F2GA 4RNMA 2D69A 4FVMA 1TR0A 4CLTA 4G1IA 2V9WA 2HBQB 2SXLA 4DXLA 5GAEI 5A0YA 1LK5A 1TELA 2CJXB 1YQHA 4WZQA 2VF3A 4AL5A 4CI0B 3DHXA 2FLNA 2XMWA 1WI6A 4J91A 3KLHB 2GJIA 3TUIC 1XBWA 4DR5F 5AE2A 3SV4A 3J81j 2MJUA 1NK7A 2B51A 3ILOA 4FDFA 3HD2A 2V9KA 1X9WA 5D0EA 1Z2ZA 4HACB 4R5PA 8RUCA 1PKUA 4F04B 1EB0A 4TLRA 2B0GA 1LNQA 1S6PB 4N56A 2OEMA 4NCGB 2XQCA 1GMVA 3D68A 2CIMA 3CCLS 1MN7A 2C3UA 4B3MF 1DAXA 1MG7A 4ECYA 4QIGA 3D1HA 4KBIA 2XLIA 3NGDA 1HNIA 1MU2B 4ES1A 3W3SA 4DR4F 1NRKA 2GAHC 3BQ0A 5E0OA 3K2YA 2R2RA 3GSIA 1JLFB 3RRKA 4KO0B 3Q8YA 1U2FA 2KTQA 3KLGA 2L08A 1F2HA 2ROEA 2AHOB 1AXQA 1JJHA 2N7YA 4OZNA 3KG4A 4LVOP 3HVWA 1H38A 4QWEA 4OI2A 4JI1F 3OTOJ 1I51B 4ZVQB 3TR5A 3NGUA 3D54A 3G8QA 2Y8WA 2OPSB 2KL8A 5DETA 1YX2A 2R7XA 4DV6J 1D1UA 1YBTA 2Y9HA 1RWKB 3JQJA 3NP5A 2CQDA 2W2MP 2W25A 1K0VA 3CD5A 1JJ4A 2R7RA 4C98A 1VBKA 2BMBA 2WSFC 2V0NA 3L7OA 2HHHJ 3IN5A 3V4IA 1U1MA 3IFEA 1B4SA 4ELUA 1M1HA 2ZBCA 1HQUA 1XQIA 2C2EA 2RQCA 3MEDA 1U1NA 2CNKB 1N32F 2BR0A 2RT3A 1YJ9S 4O23A 2E1RA 4URGA 5DDQC 1AA1B 5CYJA 2XB2D 1TAQA 4LF2A 4WXWA 3CC2S 2KDOA 3DM2A 4AXJA 4ZCLA 3MTKA 3Q89A 3RBZA 1M1KT 1RHRB 1VQNS 5ITHA 2MSSA 3AFGA 2BOAA 2M70A 2PFDA 3CCES 3DM2B 1NDLA 5T14A 2YQ3A 1RT4A 3PEHA 4IG0A 1SJ4P 2LMIA 5IT0A 2DYAA 5HVGA 3HT0A 4ELTA 2LDIA 2C2NA 2AYMA 4ZN3A 1R8CA 3G2XA 1KRPA 2LCWA 3BYPA 5FD1A 2ILZA 3CJQA 5FIIA 2BQ3A 1VQPS 1X31C 2MTLA 1P9YA 5KT2A 4LUBA 3TEGA 2ZJRQ 1GMUA 3SXLA 4JP8A 1YJTA 5DG8A 2WOMB 1WC0A 3GIRA 1IBMJ 2IRYA 4EMDA 1Q7LB 4DL3A 3IBCB 2HWTA 3IR7B 2D9OA 2V6AA 1PAEX 4DR5J 3P5BP 1X0FA 3QSYB 1Y11A 1T9VA 3DOMA 5KFIA 2E1PA 5M2UA 2M3DA 3G8TA 4ZIVA 3O3LA 2RNEA 2L3MA 4U96A 3TJAA 1VJQA 2E1CA 2WSCC 3CPWR 2BJ1A 2ADBA 1X5OA 1UAWA 3THTA 1EX8A 4ELVA 2LQ9A 4F25A 2MZ1A 5BJRA 4EUVA 3O8WA 1H7WA 3T6JA 2KFNA 3PX6A 3J80U 4DR4J 3DGPA 3W5YA 5D4NA 3JSMA 4U67Q 5HVFA 2MKIA 4QQBA 2G0JA 2XZTB 3DRYA 1NJYA 3JSMB 1Q8IA 3K89A 5KFWA 1RTHA 4NLXA 1KLMB 1U45A 2CPDA 2NSCA 5IWAF 4ZVTB 4XIUA 2YX7A 4JI1J 2GNKA 1VISA 2M4MA 5KFPA 2JFKA 1OY9A 4L73A 1FFGB 4FNHA 2DNRA 3MR7A 4ZHRA 4Q0BA 2ZH4A 1DQ8A 4CM2A 3FCWA 4K59A 1RKIA 2MKCA 4LFAJ 3P96A 1NKCA 4Q0BB 1VR6A 4IR9A 4IRCA 1QUVA 1YIJS 4X4QA 2EWHA 2QGFB 3P3DA 3AHPA 1NJIT 1N32J 5E3AA 5HJXA 4X4PA 3IR6B 1CJVB 2DHAA 3FBCA 2EK6A 2VBZA 2P9EA 2N4CA 5DZ6A 4LBHA 2HQ3A 3PYEA 1HI0P 2V2QA 3FMWA 3CW2C 3UDVA 3MF5A 2FY1A 5ETSA 1VCTA 3TARA 3MM7B 4AQYJ 3PX4A 3EPGA 4IQXA 3NEKA 2AU0A 5I42A 2IJNA 3OTDA 1SQGA 4ZOSA 2VBXA 3FGVA 3MR2A 3E2EA 4MKVA 3R2DJ 3LOUA 2V34A 3M9NB 3NCRA 2HHVA 2BE9B 2V2KA 5AE1A 1EZZB 2ZH7A 2C2ZB 1URRA 1T8EA 2KZMA 4CT9A 2ZDPA 1F3FA 3BM7A 1VQKS 2EKNA 4WP3A 4JI6F 2NS1B 3SCJE 2PO4A 2C2KB 2O1PA 2M7SA 4X4VA 4EFAC 2AV5A 2YX1A 4CO0A 2DVIA 4L74A 1XC9A 1VBYA 3A1YG 3LP0A 5FJ4A 1KLNA 5D15A 2MGZB 3CCMS 4P7VA 2K1RA 4PPDA 4TVAB 3ICLA 2CADA 1N33J 1LWEB 3DLKB 1NMEB 2BABA 2BJ8A 1C0TB 2VASA 2YWHA 2HQFA 3O1LA 3M8ZA 1Z2LA 4C8LA 2J6SA 3MEEA 5DM7Q 2CJYB 4XTTA 2OI2A 5CXTA 3N6NA 2UUCF 2QZ8A 2UUWA 4EI2A 2DRDA 2LA4A 1BE4A 3MM8B 3VGVA 1YZ6A 4DUZJ 1W2BR 4PQUB 1HD0A 5LXYA 3C19A 2PIIA 2ZH2A 2BYCA 5DQIA 1MWYA 2RILA 1RYRA 1N56A 2XO6A 2H65B 3WX4A 4ILLA 2DGTA 2LDYA 3MURP 2CQCA 1U1KA 1F1BB 4UUWA 1HWKA 3PDNA 3NGKA 2H54B 2XC9A 2XYHB 2XS7A 1Y3JA 4RW9A 1H74A 2MMYA 5BXIA 2H48B 5IWAJ 3J7YU 1PGZA 4QBUA 4DLGA 4LSNA 1PYTA 1EJ7L 2ZVIA 2EFGA 3UN3A 3X3UA 1R0CB 1X9SA 3CD6S 3L4BC 1MROA 3HKWA 3FJ2A 3B82A 1SIWB 4LF9F 3SBMA 1S79A 1KN6A 4RR5A 2CDQA 1FT8A 4QYZJ 1G6BA 4PUOB 1C1CA 1P6TA 5J1NA 3LAKA 1JLQA 4FS2A 3EE3A 3M9OB 4IDKB 2WONA 1RTDA 3NBPB 2ZBQA 3QT5A 1C1CB 2HSEB 5HLFA 3QFHA 4P7TA 3QYYA 1HYSB 4C4WA 2CXEA 2Z30B 1S97A 1HBNA 5F9LA 1SJ3P 4O3SA 2YKPA 4UQGA 2R9LA 4DWIA 2NXUA 4OL8A 4USTA 2C3MA 4MFBA 3GIKA 4BWMA 2BE2A 1ZETA 1S12A 3UVJA 4USWA 1KS2A 1SH0A 1T03A 2HS3A 3CEDA 4YHHF 4TXSA 5ETOA 2OMLA 3BN7A 3IWNC 2YWEA 4DHVA 1T03B 9RUBA 4H4MB 4Q8FA 2YNGB 2DRAA 2M8HA 4YDXA 4P75A 1EP4B 3JQMA 3AOAA 2VDHA 3N9UC 2J9CA 4LBPA 2ZM6J 2F65A 2HS0A 3BGRA 1FFSB 1TMMA 1DZ5A 3EMTA 1LW2B 2PA3A 2MZTA 1NSQA 4UOHA 2X3DA 3AD8C 2HHXA 2ZH5A 1WOSA 3L9ZA 1RU2A 3K5NA 3FQKA 1Q79A 1SIZA 1YJ7A 3KLVA 1NPPA 4QYZK 1REVA 1RAJA 2CJ9A 3FSYA 1U2RA 4KKOB 4H4OA 2WZ1A 4P9SA 3T6BA 4WKRA 3GV5B 2HYIB 1IKYA 3HMJG 4ECZA 2EXUA 2DGSA 3R5CA 4LR9A 1XMOJ 3GFYA 1YHQS 5KG3A 1LKZA 1OQ6A 2CJBA 2FPHX 5EWGA 1HWLA 1YJUA 4BLGA 1NPKA 4J9PA 3TX0A 1VQ8S 4IOAQ 4C8ZA 1K44A 2OPPA 5J2PB 1U8WA 3KDNA 1FRIA 1WOPA 5J1EB 1OYDA 3LF0A 1TKDA 3UR3C 2DB1A 2IMWP 2FC9A 2LVWA 4ZMMA 2CPIA 2CVIA 2I6WA 4QPXA 1VHIA 2OPRA 2AZ3A 4K2JA 2BANA 1QSYA 5KOWA 4OHXA 4C6AA 3PVXA
chains in the Genus database with same CATH topology
2MEWA 1J5EJ 4JI4J 4DR7J 4LFAJ 4DV4J 4KYZA 4YHHJ 4JI3J 4V1Ak 3J7AN 4X66J 2UU9J 3IMQJ 3OTOJ 2MQ8A 5IT9U 4KHPJ 2UUCJ 4NXNJ 2E5LJ 4DV2J 4JYAJ 4B3SJ 4DR3J 3JAMU 4KY3A 1IBKJ 3R2CJ 4YY3J 3W1YC 2KL8A 4X62J 4LFBJ 4B3TJ 4DV6J 1IBLJ 1HNZJ 4LF9J 4LF7J 5AJ3J 1XMOJ 5FLXU 1N32J 4GKKJ 2UXBJ 3J80U 4DR4J 3T1YJ 1N34J 1HNXJ 5IWAJ 5LMUJ 5A2QU 4DR1J 4LF4J 4JI0J 1N33J 1XNQJ 4NXMJ 1XMQJ 4NEZA 4JI5J 4JI6J 2MTLA 4JI8J 4K0KJ 2HHHJ 1I94J 2VQFJ 4DR6J 4DV1J 3D3BJ 4LFCJ 5LM7E 1IBMJ 3T1HJ 4JV5J 4DV3J 1XNRJ 2KVQE 5LMNJ 1HR0J 2UXCJ 4DV0J 4X64J 4X65J 4DV5J 2ZM6J 4HHUA 4DUYJ 2UXDJ 4JI1J 4RJVA 4LF8J 1N36J 4JI7J 4JI2J 2VQEJ 4AQYJ 1FJGJ 3J81U 4DV7J 4DR5J 2UUBJ 2F4VJ 4DUZJ 4B3RJ 3R2DJ 4PWWA 1HNWJ 5BR8J 2UUAJ 3D3CJ 4LF5J 4GKJJ 4DR2J 4LF6J 4B3MJ 4OX9J 4NEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEW A;  1J5E J;  4JI4 J;  4DR7 J;  4LFA J;  4DV4 J;  4KYZ A;  4YHH J;  4JI3 J;  4V1A k;  3J7A N;  4X66 J;  2UU9 J;  3IMQ J;  3OTO J;  2MQ8 A;  5IT9 U;  4KHP J;  2UUC J;  4NXN J;  2E5L J;  4DV2 J;  4JYA J;  4B3S J;  4DR3 J;  3JAM U;  4KY3 A;  1IBK J;  3R2C J;  4YY3 J;  3W1Y C;  2KL8 A;  4X62 J;  4LFB J;  4B3T J;  4DV6 J;  1IBL J;  1HNZ J;  4LF9 J;  4LF7 J;  5AJ3 J;  1XMO J;  5FLX U;  1N32 J;  4GKK J;  2UXB J;  3J80 U;  4DR4 J;  3T1Y J;  1N34 J;  1HNX J;  5IWA J;  5LMU J;  5A2Q U;  4DR1 J;  4LF4 J;  4JI0 J;  1N33 J;  1XNQ J;  4NXM J;  1XMQ J;  4NEZ A;  4JI5 J;  4JI6 J;  2MTL A;  4JI8 J;  4K0K J;  2HHH J;  1I94 J;  2VQF J;  4DR6 J;  4DV1 J;  3D3B J;  4LFC J;  5LM7 E;  1IBM J;  3T1H J;  4JV5 J;  4DV3 J;  1XNR J;  2KVQ E;  5LMN J;  1HR0 J;  2UXC J;  4DV0 J;  4X64 J;  4X65 J;  4DV5 J;  2ZM6 J;  4HHU A;  4DUY J;  2UXD J;  4JI1 J;  4RJV A;  4LF8 J;  1N36 J;  4JI7 J;  4JI2 J;  2VQE J;  4AQY J;  1FJG J;  3J81 U;  4DV7 J;  4DR5 J;  2UUB J;  2F4V J;  4DUZ J;  4B3R J;  3R2D J;  4PWW A;  1HNW J;  5BR8 J;  2UUA J;  3D3C J;  4LF5 J;  4GKJ J;  4DR2 J;  4LF6 J;  4B3M J;  4OX9 J;  4NEY A; 
#chains in the Genus database with same CATH topology
 1HWJ A;  1HR0 F;  4LBI A;  4DQI A;  3DOL A;  1ZM9 A;  3IMQ J;  4IOB A;  1FDD A;  2VG6 A;  1Q95 G;  1X4B A;  4PEO A;  3W61 A;  4QIF A;  2U2F A;  2ILY A;  3DOL B;  2CFX A;  3TJ8 A;  2HNZ A;  5DO2 A;  4LF9 J;  3T3F A;  1NZ8 A;  1NK8 A;  4Y00 A;  2NUU G;  4FYD A;  2OUG A;  1BMQ B;  4JV0 A;  4C0H A;  5ADZ A;  4MKY A;  5IT4 A;  3MEG A;  1QJH A;  1D9F A;  2NXJ A;  1HNV A;  1BD6 A;  1E6V A;  5IQ6 A;  1U4B A;  1JXE A;  1TK8 A;  9ATC B;  1TFY A;  3MEG B;  4W4M A;  5KFK A;  1HPZ A;  1U09 A;  1ZH5 A;  4RJV A;  2FZC B;  1XTZ A;  1Q82 T;  3HZG A;  1HPZ B;  1PCA A;  3M6V A;  3FK4 A;  1IR0 A;  1R89 A;  1EQM A;  1D8Y A;  4ZPW R;  2FYX A;  3M2V A;  4P73 A;  4YHH J;  5DRK A;  1RTJ A;  2E7W A;  2LQ8 A;  2FHJ D;  2UUB F;  2RS2 A;  3M2V B;  4PYA A;  4WXO A;  1QD1 A;  1RTJ B;  3P8B B;  1FRJ A;  2K3I A;  4DU7 A;  2CQ2 A;  4J9Q A;  1CJU B;  2I8E A;  1HNX J;  5KT3 A;  1C1B B;  1T05 B;  3RU0 A;  4ZIW A;  2BXJ A;  2CQ1 A;  1TL7 B;  1WHW A;  5C42 B;  4URQ U;  1KR4 A;  2GVD B;  5IV4 A;  4LF5 F;  2ROG A;  5A8K B;  2HFS A;  4PXE A;  5KFL A;  1WD6 A;  3GCX P;  4RNH A;  2LXF A;  4RL1 A;  3H4B A;  1QVG R;  3K5M A;  3PFO A;  5MAO A;  2FHM A;  4CIO A;  4Q2M A;  2AGP A;  3D67 A;  5C2G A;  2V4R A;  5DDO C;  3R27 A;  3MPW A;  2YWW A;  4FPI A;  3UD5 A;  1GXT A;  3M6U A;  1AW0 A;  4X64 F;  2MZS A;  3H98 A;  4DX5 A;  3D7S B;  3BF4 A;  3K57 A;  4ENO A;  4P2X A;  3SCK E;  4RW4 A;  3I5A A;  4WBF A;  2Z2M A;  4NLQ A;  5E3C A;  3IAS 9;  1YBA A;  1FXL A;  2DNM A;  3HCX A;  4PWD B;  2HRU A;  4OX6 A;  4IG3 A;  4CWB A;  1KVK A;  3GJR B;  3FUY A;  1VC6 A;  1XR5 A;  1OO0 B;  3SSS A;  2QLJ B;  3ETM A;  2CZ4 A;  4DS5 A;  2Z57 B;  3OL9 A;  3MEK A;  2AX1 A;  4A48 A;  1C4A A;  5SUH A;  4GC6 A;  1HR0 J;  2BOP A;  3ILJ A;  1VC0 A;  5KFE A;  1XJW B;  3VAM A;  1B7Y B;  4I4B A;  3G8S A;  1WJ9 A;  2WVE A;  4U6P A;  3HO1 A;  3V5R A;  3ILL A;  2BJ7 A;  3TQE A;  4ATN A;  3R7N B;  5D4L A;  2JOQ A;  5K8N A;  4PR6 A;  3CE8 A;  1UVL A;  2MKY A;  1K73 T;  2GW8 A;  4ZPV R;  3RTV A;  1IJE B;  5K8M A;  3GV8 B;  3LPY A;  1XMQ F;  2VPW B;  1X0P A;  4P72 A;  3WQP A;  2ZJQ Q;  3KMQ A;  1HKA A;  1UFK A;  2OMO A;  4F26 A;  1WF0 A;  1FDN A;  4EU0 A;  1CJT B;  2C2M B;  2KRB A;  2DJW A;  3BB5 A;  3W2W B;  2GZO A;  1LWF A;  4K4U A;  2EBE A;  2UVW A;  4DPY A;  2HVH A;  3VF0 B;  1UVK A;  4DL6 A;  2APO A;  3KG1 A;  1C0U B;  1C4C A;  5I3U A;  1M5P C;  3CSK A;  1WSV A;  5EWE A;  4M5J A;  3K5L A;  2DBB A;  4ED1 A;  5GAH I;  1S10 A;  2XI2 A;  5GAE U;  1VQ6 S;  4MIB A;  3FQL A;  4NMX A;  2UUB J;  5CD4 H;  3M8Q B;  3MD3 A;  1X4G A;  4GKJ J;  2WBM A;  2KXH A;  4LQ3 A;  3N01 A;  4QU6 A;  2W1B A;  1RIS A;  3H90 A;  1X4A A;  2J7K A;  1WAC A;  1Y4Z B;  4F4A A;  3BO2 A;  4NYO A;  4J9N A;  3MMC B;  1NDP A;  4WFY A;  2N3L A;  1TK5 A;  3NNH A;  3ENQ A;  1JLC A;  1TKZ B;  3T9N A;  1HWU A;  3DMJ A;  4YQW A;  1NSP A;  2DIV A;  3CCS S;  4NCB A;  1FDA A;  4Z7C A;  2R7Q A;  4KHR A;  4IFY B;  1VLY A;  3RW7 A;  4G3I A;  3PXG a;  1EAR A;  1P1T A;  3RUB L;  3AOD A;  3A8K A;  2H4W B;  4KB7 A;  2KU7 A;  1DJ0 A;  4LF7 F;  4ER8 A;  4NLU A;  2MQM A;  4X64 J;  2E9R X;  4NXN F;  3CCR S;  5LXR A;  1LW0 B;  3UFC X;  2HWI A;  2R42 A;  3RZA A;  4OYM A;  5L38 A;  2FD2 A;  2H3E B;  4HYK A;  4QR2 A;  3G96 A;  2DH8 A;  4DSF A;  3SI8 A;  2BJ9 A;  3U1L A;  4KQZ A;  2J7U A;  3WC2 A;  4FNI A;  1S1T A;  2V8H A;  1ZA1 B;  2ALZ A;  3DLJ A;  1NJX A;  4Q8E A;  3TA1 A;  3GCW P;  3MTJ A;  1T11 A;  4OI6 A;  3C8Y A;  4HKQ A;  2WB1 D;  1MSW D;  1HHS A;  3DDK A;  1GFW B;  1F0X A;  2DGQ A;  2D9P A;  3KK1 A;  3PRD A;  4ZKA A;  3C16 B;  2F7V A;  5D3G B;  1QY7 A;  2FHO B;  3EJM A;  2M0G B;  1CUL A;  3M8P A;  1HW9 A;  3LP1 A;  1LXJ A;  3GFZ A;  3K8W A;  3RB0 A;  4ECW A;  4OX7 A;  2NPF A;  3WZ0 A;  4MK9 A;  1RI7 A;  1N48 A;  4EGL A;  1X4H A;  4AE5 A;  1NJW A;  4C11 B;  3BSN A;  1P1L A;  1Y5N B;  3HFZ B;  1HMV A;  2YKN A;  2ASD A;  3R7B B;  4XK8 C;  3CB4 A;  4DU8 A;  3HVT A;  1R0A A;  3C6U A;  1YZ7 A;  5HN0 A;  2BBE A;  1B99 A;  1S4E A;  1CEZ A;  3BEG B;  4CYU A;  1HMV B;  1Q53 A;  3O5T B;  3CJK B;  3HVT B;  2XNR A;  1FO1 A;  3R3T A;  2ZOF A;  2I38 A;  2UXC F;  2V63 A;  3M2U B;  5GAG U;  3R7S B;  4KT0 C;  4YN3 B;  4DSK A;  4UOF A;  3EYZ A;  4ILR A;  3CJ0 A;  2DIS A;  2VFT A;  4N8N A;  3MPY A;  2Z56 B;  3H25 A;  5A6P A;  1K1Q A;  3PCO B;  2NPI A;  3W60 A;  1D8Z A;  4O0N A;  3AT1 B;  2CZV C;  2MKK A;  5B0F A;  3D66 A;  1T94 A;  4AD6 A;  2H5E A;  4F4W A;  5B0E A;  5IT9 Y;  4B9L A;  5G0R A;  3MM9 A;  2RHS B;  2DY9 A;  2CPH A;  1OY6 A;  1RT5 A;  1HLW A;  3W8P A;  4OYO A;  1WEX A;  3MEC A;  1BWE A;  3FBF A;  5G0R B;  3MM9 B;  2YNI A;  3HT3 A;  5LMN J;  4PXD A;  4XAK A;  1SC6 A;  1GXL A;  2FB0 A;  3KJV A;  2NXE A;  4ECR A;  3THP A;  3MEC B;  4KGK A;  4KE5 A;  4J9R A;  2XO7 A;  1FRM A;  4I1T A;  2OIH A;  2L41 A;  4DL0 C;  4J37 A;  4NI2 B;  3D1O A;  1ZYQ A;  1RAO A;  3BGU A;  3KKF A;  5H9E J;  2J8A A;  3J81 Y;  4ED6 A;  4JI7 F;  4ZP6 A;  2OD4 A;  3VGT A;  4TYB A;  3I31 A;  2XLK A;  3EGZ A;  1PG5 B;  1X5P A;  4M5N A;  2L9D A;  3FSI A;  4ECX A;  1BQM B;  4UT4 A;  3CNQ P;  1WC1 A;  4LF7 J;  3PYF A;  5L9X A;  3MUM P;  4NA2 A;  2XI3 A;  4NLW A;  2VA2 A;  1XN9 A;  1YTY A;  1QUP A;  1VJW A;  1X4C A;  4WU2 A;  5EX0 A;  4ETX A;  1O5J A;  1NK0 A;  2C3O A;  3TW0 A;  2MQQ A;  1FD2 A;  5KFD A;  2F4F A;  2C22 A;  4EZ6 A;  2V68 A;  1WKK A;  3CCV S;  1DHM A;  3V6D B;  1KSP A;  2IM1 A;  4DPW A;  1NH8 A;  3CUL A;  2GQQ A;  4UZB A;  4DLE A;  3P6Y C;  1FEE A;  5L1I A;  1CG2 A;  5B0D A;  4RO0 A;  4E8U A;  3D28 A;  5C7P A;  4TKT A;  1CSJ A;  2HGL A;  3MOJ B;  2FUG 9;  3G71 S;  1SKW A;  2OFG X;  3HI9 A;  4Y2M A;  2IIH A;  3HUL A;  5L39 A;  2LQJ A;  3V4M A;  1ZAX A;  1LK7 A;  4TY8 B;  2LEP A;  3TQ1 A;  2D3U A;  1FJ7 A;  5IQQ A;  1KOH A;  5H9F J;  4B9S A;  1S49 A;  2ZNY A;  2XS2 A;  4GMK A;  1S1U A;  1MLA A;  3A3P B;  5A6W A;  4CH0 S;  2DR6 A;  2FVQ A;  5H9E K;  1VYA A;  4OMF G;  1TKT B;  1Y5L B;  2H9Z A;  2RAQ A;  3CCZ A;  1FHT A;  4BWJ A;  2P6T A;  4ERD A;  1RCX B;  5GMK a;  2DNH A;  2UV8 G;  1FNM A;  2CVE A;  1PIE A;  2HHT A;  3EM1 A;  2B7C B;  2UXC J;  2M9K A;  2E5I A;  1Z4U A;  3HKZ D;  1VK8 A;  2R7V A;  1QTN B;  3Q8Q B;  3GV7 B;  4E98 A;  1VQS A;  1XR7 A;  2LU2 A;  5HSP A;  2HBR B;  4NYZ A;  1QE1 A;  2H51 B;  3MMA A;  3ADA C;  3ZTS A;  2LXU A;  1EKS A;  3UN2 A;  1TV6 A;  2DPJ A;  1O8B A;  5KT6 A;  4RZR A;  2GS8 A;  2HHW A;  5KFJ A;  2AJ0 A;  2KXN B;  3TEH B;  4O0I A;  3L95 X;  2DO4 A;  2DHX A;  1S5Z A;  1DBD A;  4K4Y A;  2AJF E;  5C24 A;  4ZVF A;  2I5J A;  5AXN A;  5B0G A;  3CJ3 A;  2FZK B;  4DX7 A;  5DGA A;  4RW7 A;  3N6M A;  1UET A;  3DI6 A;  1S7H A;  1G4C A;  1FX4 A;  4Y65 A;  1K1S A;  1UWA A;  3E8O A;  4IQM A;  2WK4 A;  2EG1 A;  1FK9 B;  1L3S A;  1MMD A;  2J6T A;  4MMO A;  3VGS A;  3T5K A;  2GIF A;  4DPO A;  2NZC A;  3CJR A;  4U95 A;  2CNO B;  1NK9 A;  2JC1 A;  2VBW A;  3OBI A;  4B3T F;  5G4D A;  1W25 A;  2CRL A;  5H9F K;  2E7V A;  4NAS A;  2DKO B;  3ITH A;  1B0T A;  4JI7 J;  5KFV A;  4CO3 A;  3BSA A;  3ZZZ A;  3IS9 A;  2VH7 A;  2W24 A;  3W2V A;  2FJW A;  4Z7Y A;  3KLF A;  5KFN A;  3ITH B;  4C3K A;  2MPU A;  3FZB A;  1SJ1 A;  2C2O B;  2JLE A;  1S0N A;  2J9D A;  4R8U B;  1RAB B;  1NKE A;  2OJ3 A;  1S7I A;  4FF3 A;  3DC2 A;  4EBE A;  3W5X A;  5ETQ A;  4RX6 A;  1WG5 A;  2R8K A;  1WTF A;  4HHJ A;  1M5H A;  3CC4 S;  1RSC A;  3GJT B;  1S0M A;  1F9F A;  4DFK A;  2ZH1 A;  4X2B A;  1VGY A;  3OJU A;  1CS4 B;  2LA6 A;  3FEZ A;  2XEX A;  4TLQ A;  2ZHA A;  2OO4 A;  2ADC A;  4WIQ A;  3JXO A;  1R8A A;  2P6S A;  3ISZ A;  1ZAV A;  4OV1 A;  4ZPB A;  4PRF A;  4K4X A;  2QC3 A;  3DXB A;  3SDE B;  3WDO A;  3SYZ A;  2G1H A;  2ZBI A;  5HVH A;  4WZM A;  3TX8 A;  3NOG A;  5I4M A;  2ZHO A;  1CLF A;  1FD8 A;  4C0B A;  4K4V A;  5KFG A;  3MM6 A;  4RWW A;  2QA4 S;  7AT1 B;  1VRQ C;  3PTW A;  3CIM A;  2QL7 B;  1RTZ A;  2RB7 A;  2IVY A;  4M5D B;  3NMA A;  2RQK A;  3T1Y F;  5IC6 B;  4C8N A;  3C15 A;  1N5T A;  1KWM A;  3ZZU A;  4DV0 F;  2BRK A;  4OYX A;  4QJV A;  3OJS A;  2G0C A;  2CPY A;  1NDC A;  3CO0 P;  4KHP J;  2OP5 A;  4Q44 A;  2R3V A;  3C15 B;  2IA6 A;  2Z2L A;  3H0P A;  4ZPD A;  2ZNZ A;  2W8K A;  2D3Z A;  1F5C A;  2W4C A;  2AEJ A;  1CJK B;  8ATC B;  4JI0 J;  5E3P A;  4CLL A;  2NZ4 A;  1FNX H;  2CJQ A;  3UN5 A;  2CPE A;  3ET6 A;  3OHA A;  3D6F B;  3CDE A;  3TUJ C;  4DSJ A;  2HZC A;  1HHQ A;  1M5S A;  3C46 A;  1R7I A;  2Z58 B;  2B8P A;  5FDL A;  5IM0 B;  2CQP A;  4YUD A;  3ET6 B;  1HAR A;  2DR7 A;  3QAU A;  1VRU A;  2ZC4 A;  4N7T A;  2HS4 A;  4OYA A;  3GTY X;  2DGV A;  4DG1 A;  1CQN A;  2MZR A;  4G1Q B;  1FRK A;  5CCM A;  3PO5 A;  1IBL F;  1FXR A;  3CCQ S;  1VRU B;  1UVI A;  4P2S A;  1RBO B;  5KOX A;  4DR6 F;  4PPZ A;  5L1K A;  3TAP A;  4DG1 B;  4I0W A;  3G86 A;  3M9M B;  2D1C A;  5DM6 Q;  2A3J A;  3PW7 A;  4ES2 A;  4CH7 A;  1A7G E;  5E7O B;  1WKL A;  1J5O A;  3BV8 A;  2AJ1 A;  3MM5 B;  4B3T J;  3CJT A;  3L09 A;  2Z2Z A;  2VOP A;  2NR0 A;  3ZTO A;  3CDW A;  2B4O A;  3GE9 A;  1REG X;  2Q1L A;  2IHR 1;  4NPO A;  4K8R A;  4O4G B;  5I3P A;  3S8S A;  4I7F B;  3HZE A;  1IM4 A;  1NHK L;  2RKI B;  3BN4 A;  1B64 A;  3H2U B;  3VAL A;  3SCI E;  4HEA 9;  2KVQ E;  3J7Z T;  3QSI A;  5ETL A;  3GII A;  3H2L A;  1Q0N A;  5SZT A;  1FJC A;  3T1A A;  3C6T B;  2RJZ A;  4OHY A;  1S9F A;  1SC4 B;  4X62 F;  5T7L B;  3R6L B;  2K7K A;  1UJ5 A;  4I2Q A;  2KN4 A;  5DJB A;  1KFD A;  8AT1 B;  1X4E A;  3LGM A;  3JSY A;  4DPX A;  2V2V A;  3TRG A;  4LRD A;  2LEC A;  4U8Y A;  2KHC A;  3OVS A;  4QWB A;  5F8N A;  1AZS B;  1AB8 A;  2F63 A;  1S6Q A;  1RT3 A;  3EX7 B;  3IG1 B;  1LWC A;  2QO3 A;  3DRR A;  2DD8 S;  1N6Q A;  1XWL A;  1J5E F;  1VQL S;  2CQ0 A;  4A8K A;  3OLA A;  1S6Q B;  4ZVR B;  1LWC B;  2ABY A;  1OJ4 A;  2DIT A;  1HNW F;  2ZZT A;  1JLE B;  4WE1 A;  3D0G E;  2IDL A;  5HO4 A;  1R27 B;  4DX8 H;  3RAM A;  1N5Y B;  3KMS A;  3MPU B;  1U02 A;  3VAI A;  2QV6 A;  3M32 A;  2W2N P;  4DV0 J;  4NRT A;  1S72 S;  1RLC L;  5KFY A;  2Y1R I;  1BC6 A;  3MR3 A;  4OYB A;  3MMB B;  1XNQ F;  1SL2 A;  5LJ5 Y;  4NWB A;  1SUQ A;  3OUY B;  5KT4 A;  1SCJ B;  1JNZ B;  5U47 A;  1RAE B;  4I2P B;  4TN2 A;  4CQ1 A;  3OR1 A;  5F8I A;  4OZJ A;  1YJV A;  4ID5 A;  2CJK A;  4B9N A;  3DRS B;  1ACM B;  3S7R A;  2R2S A;  1SUQ B;  3ILI A;  1IUJ A;  2Z0G A;  1RDR A;  2VQE F;  4UZC A;  3D4J A;  2ZH8 A;  3HX9 A;  4LVN P;  2F4V F;  4ZCK A;  2DNL A;  4WTO B;  3HJV A;  2HRT A;  4UOC A;  3OPK A;  2V4J A;  5HQL A;  2VUG A;  3ZNJ 1;  4B9V A;  2ZWP A;  4Q45 A;  2I1R A;  2B9E A;  5ETN A;  4WFB Q;  4Q43 A;  1ZM4 A;  4Y0F A;  2YKM B;  2YXL A;  4YEA A;  2QX0 A;  1VLO A;  5GAD I;  1DFD A;  5KFX A;  4ZPT R;  2NYH A;  2XHC A;  4DR6 J;  4M1K A;  4CDI A;  2QA2 A;  2XZW A;  2KRR A;  3DLL Q;  4CLU A;  2JX2 A;  4A8M P;  2ZDO A;  2KO1 A;  4C3M A;  2AP6 A;  1S9E B;  3QGH A;  3VAF A;  1S59 A;  2OLW A;  5J2Q B;  2OD6 A;  1KC8 T;  4M5G A;  2BA9 A;  2IBK A;  2B4P A;  2VG7 B;  4EWT A;  1RWW B;  1UP1 A;  2HFV A;  2QG9 B;  4F4Z A;  4DSE A;  2Z2Y B;  5ETK A;  2IJF A;  2BW7 A;  1RKJ A;  2PMW A;  1NH7 A;  1SC1 B;  1HBM A;  1QAJ A;  3HF5 A;  1U48 A;  5BYS A;  1BQX A;  1UJ6 A;  2FGC A;  3ZZO A;  4NLG A;  1MWZ A;  2VJU A;  1HBM B;  2DH7 A;  2MQN A;  3CGI A;  5ETV A;  1SKS A;  4FS1 A;  4KH0 B;  2QSF A;  3TAM A;  4B9T A;  2RUS A;  3AJ1 A;  3RYL A;  4DCO B;  2FLO A;  5DLF A;  4DQR A;  2KM8 C;  1KQK A;  3LP2 A;  3OD2 A;  1S1W A;  1PIL A;  3DOK B;  5HMZ A;  4C9D A;  2IC3 A;  3J80 Y;  1YBU A;  2UXB F;  2KJV A;  5E33 A;  3CIZ A;  3G87 A;  2B56 A;  3NMR A;  2JL9 A;  4F4X A;  1RHK B;  3KLE B;  3QGP A;  1XEZ A;  2IC3 B;  1TK0 A;  4JI5 F;  4C8M A;  2AJ4 A;  5J2M A;  2HVD A;  1I94 F;  2XM3 A;  3KJF B;  3NS5 A;  1K9M T;  1NDK A;  3H4D A;  4HI1 A;  3IP0 A;  1VOM A;  3C3L A;  3H59 A;  2OAU A;  1J5E J;  1VQ4 S;  4W90 B;  3CJ2 A;  5K5M A;  4EO8 A;  1VRT B;  3J7A 1;  2I0X A;  2HIQ A;  5KT7 A;  1NHU A;  3AXM A;  3SFG A;  3L7P A;  3DLG A;  4IYQ A;  4P6Q A;  4LFC F;  2DPI A;  1JMT A;  2B7B B;  3DLE A;  1XNQ J;  3PEJ A;  1U49 A;  1GXU A;  1K8A T;  3MCS A;  3GG1 A;  5DQH A;  1T9W A;  4WWS A;  2RDD A;  1YVF A;  2QLB B;  4LSZ B;  1SVD A;  4J9M A;  1NXI A;  1WOO A;  1IKX A;  1TL5 A;  4X4N A;  5E2Q A;  5K8O A;  2F8M A;  2DY1 A;  2J9D E;  4M94 A;  2VQE J;  2VOD A;  2F4V J;  4Y2I A;  4PKD B;  1KD1 T;  4F50 A;  1RZM A;  2GGP A;  3DRP B;  4ZLN A;  3IXQ A;  2V8P A;  3QIP A;  3T5L A;  3P45 B;  4DQS A;  3OFH A;  2V8D A;  2GGP B;  1B3T A;  3R1H A;  2C3Y A;  4A4J A;  1S1V A;  3IBW A;  4DFM A;  2DRB A;  3RG6 A;  3AD9 C;  2PN6 A;  3BPD A;  4YB6 A;  2MHE A;  2H4Y B;  1FXD A;  3X1L B;  4FZV A;  3EGN A;  4PG5 A;  2YQ1 A;  3LW5 C;  4X66 F;  2YVS A;  4ED2 A;  2HWH A;  1HBU B;  4UUX A;  2HBZ B;  4DR3 F;  4N76 A;  4RW8 A;  2LEB A;  1XIQ A;  4EK2 A;  3IM9 A;  3BDE A;  1U25 A;  4BDP A;  2CQ4 A;  2DIU A;  4TQR A;  3EWG A;  4ANE A;  1SI9 A;  1MNE A;  4RW8 B;  4ZLP A;  3GU0 A;  4OIX A;  4WFA Q;  5A0Y B;  1JNR B;  2YTC A;  5KFT A;  5C25 A;  4X4S A;  3F73 A;  2JHE A;  2I2Y A;  3VR1 A;  2R8J A;  3KFW X;  4YFU A;  1N5S A;  4GO7 X;  4UW2 A;  3LQV A;  4FPR A;  4O3P A;  4KPY A;  4I64 A;  2XWY A;  2AYE A;  1D9A A;  3NWG A;  3VTI A;  1KQS R;  4AYB D;  1KON A;  3UD3 P;  4I69 A;  4FF2 A;  1APS A;  4R5P B;  4ZVH A;  5HJY A;  4DV3 F;  4MTP A;  3JB9 k;  4YR2 A;  4O3O A;  1IWG A;  2X51 A;  3MAH A;  3M1V A;  2UXB J;  1F3V A;  1N36 F;  2GJF A;  1ZBT A;  1N34 J;  1VK3 A;  4FXD A;  1PJ5 A;  2CA9 A;  1ZS6 A;  5D4O A;  3ISN D;  2KFY A;  3M05 A;  2LKZ A;  4JI5 J;  1GT8 A;  3PYG A;  4OX8 A;  3VHQ A;  3T9Z A;  3N4W A;  1UW9 A;  1I94 J;  1HNI B;  1PJ7 A;  4ZK7 M;  4FKX A;  3MWB A;  2JVR A;  1WG4 A;  3HHL C;  5KFB A;  3PJ9 A;  1MN9 A;  2QLX A;  2ZZN A;  1RWP B;  3EIC A;  5CD4 A;  3B4M A;  1RT6 A;  1NLK L;  1H0H B;  3KLG B;  3FNN A;  2DHS A;  3M2R A;  3K59 A;  2EFP A;  3QMQ A;  4B3R J;  1Y7P A;  4PXB A;  4RUH A;  4OFZ A;  1GAO A;  3IBF B;  5AXK A;  1ITP A;  2O01 C;  4QWD A;  3BSO A;  1QAI A;  3M2R B;  2G4B A;  1V3Z A;  1D9D A;  3QAT A;  3M6X A;  4K4Z A;  2A6M A;  2O5D A;  1UA1 A;  3PG9 A;  3NL0 A;  3AD7 C;  4AXI A;  5L46 A;  3IR5 B;  1SKR A;  1UVM A;  3TO8 A;  2YKO A;  2XS5 A;  2WVD A;  4G6V B;  3SMZ A;  4GKK J;  3MUV P;  1FEH A;  3IRW P;  1GEH A;  2A1B A;  2E1M C;  3V4I B;  4RU2 A;  4OZ1 A;  5KFR A;  1HQU B;  1NU4 A;  3S1T A;  3MED B;  2HQC A;  3CJS A;  3O2I A;  1UFL A;  3BR9 A;  1FFW B;  3BKU A;  2ZJP Q;  4O4R A;  2XGP A;  1U1O A;  1RTI A;  2XMK A;  1U0H A;  2DNK A;  1Q16 B;  2IY5 B;  2Q6B A;  5CYM A;  4ZPC A;  3R6G B;  4I6A A;  4JI8 F;  2JNJ A;  4HI2 A;  4DN0 A;  2B4V A;  1UL3 A;  1JQG A;  2HFZ A;  1LEO A;  2CKW A;  4DFJ A;  2IAJ A;  1B0P A;  5CYM B;  4YB1 P;  1RT4 B;  2ASJ A;  4IG0 B;  4CLY A;  2MEW A;  4WK1 A;  1HWI A;  4N77 A;  3U7J A;  4X66 J;  1VQ9 S;  2X3G A;  2IAJ B;  2W9B A;  1UWB A;  3FRZ A;  3PRV A;  1M0S A;  4DR3 J;  3PZP A;  1N52 B;  3Q8P B;  2IVF B;  3CCU S;  1OSD A;  3N6L A;  4DQP A;  2IYI A;  1RHU B;  3EUN A;  4DUY F;  2GA7 A;  3PW0 A;  5CAA A;  2J0X A;  1Q81 T;  1JLA A;  3GJS B;  4MYU A;  4DZD A;  4L75 A;  1HQE A;  1Q8B A;  1RT1 A;  4QCL A;  1RXO B;  2BE7 D;  4KRW A;  5B0B A;  2XSJ A;  3GYN A;  2O3D A;  4NA3 A;  3ZZY A;  4ZLJ A;  1JB0 C;  2QIF A;  4FYV B;  1DTT A;  1RT1 B;  3NCQ A;  1YJR A;  4LF4 F;  2UVV A;  5DDR C;  1YKW A;  2ACM A;  3DOM B;  2W2O P;  1JK9 B;  1TL3 A;  2XSJ B;  5RUB A;  1IXK A;  1UZH A;  3OFF A;  4UY8 T;  3BZQ A;  3BYR A;  4B3M J;  2JLF A;  5CA5 A;  1QM9 A;  2IMO A;  5F8M A;  4MK8 A;  3OQ2 A;  2KG0 A;  4DF8 A;  4QPT A;  2X1B A;  1KTQ A;  2YKA A;  4C97 A;  3D2W A;  3IA0 A;  3QZ7 A;  5HMY A;  3R5G A;  1GMW D;  3RJM B;  2AYB A;  2UVR A;  3DGP B;  1TFW A;  1KFS A;  3NS6 A;  3NGT A;  1X60 A;  3WC0 A;  1RA7 A;  1KKH A;  4USI A;  5LL6 d;  2GVZ A;  2GMH A;  3M8Y A;  1JIH A;  1RTH B;  1YRU A;  1KHV A;  2FJE B;  1VQ7 S;  1D3W A;  4ZCM A;  3KHR A;  2VKR A;  3CDA A;  2GJ2 A;  2JWN A;  2KH9 A;  1QLN A;  4DR7 F;  1BXN A;  1GQE A;  1OMS A;  2PDA A;  1T3N A;  4I6W A;  5GVQ A;  2GVZ B;  1OIA A;  2XMU A;  3OVB A;  1UMJ A;  3JSR A;  4FYW B;  2OSR A;  4ZHR B;  4OI0 A;  4K0K F;  2RF2 A;  2VHG A;  3HXM A;  2HND A;  2NRE A;  5K14 A;  4B3O A;  1H72 C;  1NND A;  4DL4 A;  2VOO A;  4LRF A;  3Q86 A;  2WTF A;  4LF8 F;  2KFZ A;  3SIP B;  2DGW A;  1FJG F;  4NYP A;  5CAB A;  4H54 A;  4QIV A;  2EC0 A;  5KFF A;  1AFI A;  4P74 A;  1BUX A;  1R6V A;  4F67 A;  1R43 A;  2XMM A;  4NRU A;  5KFS A;  4NA1 A;  4U7C A;  2J7W A;  2PEH A;  4QWC A;  3LPE A;  3SEO A;  4CNZ A;  4HTI A;  3H5U A;  4DS4 A;  2UU9 F;  4PG4 A;  2QYG A;  5HBM A;  3PIP Q;  4DSI A;  4DV2 F;  2JVO A;  1NEE A;  4JI8 J;  3KHL A;  2VG5 A;  1RHJ B;  1JXL A;  3FRY A;  3QWU A;  4ZCI A;  2EI5 A;  3CVK A;  2ZBR A;  1WC3 A;  2F8H A;  1WEY A;  4LSL A;  2RHQ B;  2VG5 B;  4IO1 A;  3M30 A;  5I42 B;  4GO5 X;  2WVF A;  3GP9 A;  3G82 A;  2DR8 A;  3EGW B;  3V6H A;  4IR1 A;  3F44 A;  5LSO A;  2DR5 A;  4ZIT A;  4DEZ A;  2VDI A;  1G3O A;  3OFE A;  4K2X A;  1UTA A;  4CLW A;  1ARO P;  4IRK A;  1XNR F;  5HL7 Q;  3Q8S B;  3TYT A;  1VIX A;  3R5A A;  1VC5 A;  1X5T A;  2UXD F;  2VFV A;  4KTQ A;  1LOU A;  3UCG A;  4DZ6 A;  3OTE A;  3QFW A;  2G13 A;  2HKE A;  3FFI A;  3LP0 B;  2JFD A;  2FJD B;  2PFF B;  2W01 A;  2WVC A;  2K1R B;  1RB0 A;  5JVG Q;  3FFI B;  1QTM A;  2E66 A;  4LF4 J;  2HG4 A;  2IJR A;  1NAQ A;  2FJA B;  3N5F A;  2ZH9 A;  2ZC3 A;  3MEE B;  1UJ4 A;  2XWX A;  2DHG A;  2VL1 A;  4ZN1 A;  4JV2 A;  2J8S A;  2YPY A;  1WF2 A;  3I0S A;  3OVA A;  3NRB A;  4DR1 F;  3G9C A;  1TUG B;  4LIW A;  2W4P A;  4DMZ A;  2V8G A;  4B9U A;  3KHG A;  3ZZP A;  1VBZ A;  2V69 A;  2CPF A;  2W9C A;  3KTQ A;  4DV1 F;  2HAI A;  2BUN A;  2HHQ A;  4NLT A;  1L5U A;  3CD7 A;  4EO6 A;  2R7U A;  4ES3 A;  3UO0 A;  2YNH A;  1RUS A;  3PRB A;  1KNZ A;  1QSL A;  2N3O A;  3RRG A;  2HMI A;  4RW9 B;  4DL5 A;  1WDT A;  4M5L A;  2R7T A;  4LSN B;  1Y9O A;  1WHY A;  4DX6 A;  3I9Z A;  2QYC A;  1G2E A;  2DR9 A;  1MRO B;  2A18 A;  4K0K J;  3QLH A;  1TAU A;  1YDL A;  1SXL A;  4X4T A;  1JJC B;  4BBY A;  4OHW A;  3O44 A;  3TA0 A;  4OYP A;  5EWF A;  1R0B G;  1JLQ B;  4F0K A;  3DNC A;  3JTP A;  1S99 A;  1S48 A;  4UQT A;  4C8O A;  3TI0 A;  4LF8 J;  1GK8 A;  2WON B;  1RTD B;  1FJG J;  1S1X A;  2PI5 A;  5HLF B;  3CUN A;  3Q8R B;  4KPC A;  4UF4 A;  3O6Q A;  5J2N A;  5EDW A;  1HBN B;  4M8L A;  4K4S A;  3OL6 A;  3MAA A;  5E3R A;  2UU9 J;  3HD1 A;  1WC6 A;  2DGO A;  4ZA1 A;  1FKP A;  1U6B A;  3SFU A;  4MFB B;  4DV2 J;  2ATL A;  3DRX A;  2Y8Y A;  2BE2 B;  2MLZ A;  3OSN A;  2C2R A;  3I0R A;  4M5M A;  3UVJ B;  2ACY A;  1AUS L;  1SV5 A;  5LOQ A;  5BR8 F;  1HIY A;  4HL9 A;  4ZPA A;  2JEF A;  4O44 A;  4RUC A;  2V8V A;  5F3T A;  2J0S D;  3HHN B;  4GVB A;  3KOA A;  4JI6 J;  4O44 B;  3D9B A;  2ZE2 A;  1SQE A;  1DLO A;  1NBE B;  2HAF A;  2C2D A;  3PKM A;  1QVF R;  2GIQ A;  1TVR A;  1XNR J;  3BGR B;  3A8I A;  2FLP A;  2DNP A;  1Q5Y A;  2XSF A;  4G1P A;  2UXD J;  5IC4 B;  3HSG A;  3Q83 A;  3RB3 A;  2XZD B;  1U1R A;  1FKO A;  2R7O A;  2FJB B;  3RRH A;  5DLG A;  1KVJ A;  3GIL A;  2UVU A;  1X7V A;  2OTJ S;  3BGO P;  1REV B;  2YWK A;  2K8G A;  2M5Y A;  1FVS A;  4H4O B;  4NLV A;  1SQF A;  2N4D A;  4IO9 Q;  5CZX A;  1FKO B;  4HDG A;  2HW3 A;  1X9M A;  2HHU A;  1TU0 B;  2UUC J;  1IKY B;  1SPB P;  2GHP A;  3UCU P;  3VZH A;  2J9E A;  1JX4 A;  2XUL A;  4ECS A;  3C2P A;  1JLB A;  1A9N B;  2ZD1 A;  3HP6 A;  2RQ4 A;  4DR1 J;  2C1E B;  2COL A;  2ZH6 A;  2R2U A;  5ETM A;  1O6X A;  2OPP B;  2BJE A;  2AEM A;  2JDJ A;  4OYI A;  3W62 A;  2EPI A;  3A12 A;  5F9N A;  4DV1 J;  1VFJ A;  2LP4 A;  4L6V 3;  3EPI A;  2MY7 A;  2ZH3 A;  3AOC A;  4X4R A;  3OTO F;  3FEX B;  1RLD A;  2A10 A;  4I56 A;  2AT1 B;  5A8W A;  2OPR B;  2BAN B;  3NLC A;  5IFM A;  2G2Z A;  1YSJ A;  2AX0 A;  1URN A;  3CXC R;  3IAM 9;  1RGV A;  2EFN A;  2DGU A;  2EKY A;  3OTB A;  3OT9 A;  1YLX A;  5GMD A;  2VG6 B;  2Q66 A;  5HAO A;  5A8R A;  2CAJ A;  1OWX A;  1S9G A;  2CPJ A;  4JI2 F;  5KFC A;  3KK2 A;  5LJ3 Y;  3HDS A;  4HH1 A;  1WG1 A;  3KJQ B;  1LQ9 A;  3EZO A;  4ICL A;  2HNZ B;  2ZFH A;  3IRX A;  4X4U A;  3KWM A;  1AUD A;  5A8R B;  1HA1 A;  2NXN A;  1S9G B;  4PG7 A;  1M5O C;  1RT7 A;  4ALZ A;  3KK2 B;  3BQ2 A;  4ID8 A;  2OEJ A;  1B0V A;  4LT6 A;  2OTL S;  2Q3P A;  3G6V A;  1RWX B;  3EDR B;  3Q22 A;  3SQG A;  3MDF A;  4WYW A;  1HNV B;  2M88 A;  1E6V B;  2K06 A;  2MZJ A;  1RT7 B;  3QGG A;  1KP6 A;  4F8R A;  2CG4 A;  3H42 A;  3OR2 A;  4A8X A;  2AMC B;  2BDP A;  2CNL B;  3QID A;  4RBU A;  4WTY A;  3JYT A;  3HSZ A;  3AA8 A;  2AZ1 A;  2GCF A;  3UE2 A;  4USH A;  3OR2 B;  3QRP A;  1N5V A;  3BQ1 A;  1PO6 A;  2MYF A;  3DXS X;  3DDI A;  2FZG B;  1U2C A;  3JYT B;  1MML A;  4J90 A;  4PWU A;  2MKS A;  1FNO A;  2R8G A;  5BR8 J;  1OQ3 A;  4KH1 B;  5F41 A;  3ETO A;  4Y2C A;  2DCU B;  2VFU A;  1Q78 A;  2ZUG A;  4OV6 A;  3CTR A;  3I56 S;  4YDD B;  1NB2 A;  3KLH A;  1U1L A;  3TZX A;  3W5Z A;  1YJN S;  3UDL A;  1IBM F;  1RAG B;  4IH5 A;  2K3K A;  4LF6 F;  3A3N B;  4NML A;  2W8L A;  2YH1 A;  3ELH A;  4J9V A;  4HAC A;  3VZI A;  3THV A;  3QT6 A;  1KDN A;  3AB4 B;  2P2C B;  3LAN A;  2VIH A;  5F0U A;  5DS7 A;  4LRC A;  1S6P A;  2VC1 A;  3D1Q A;  1B7F A;  4QOT A;  4P52 A;  4NCG A;  4KHM A;  4WFX A;  4HHU A;  1WNE A;  1MU2 A;  2HVZ A;  1QAX A;  3I4H X;  4QIE A;  1CPZ A;  3BBF A;  2XHW A;  4CO2 A;  4TU9 A;  5M2R A;  1JLF A;  4KO0 A;  1NCL A;  2QE5 A;  4KAI A;  4A8S A;  2EG2 A;  4KFB A;  4ZJQ A;  4RW4 B;  3HHD A;  4JV1 A;  2VA3 A;  1ICE B;  1EKR A;  4OLP A;  2RRB A;  4RWX A;  3FBE A;  4DQQ A;  3UCZ P;  2DK2 A;  4KFB B;  4IG3 B;  3VV2 B;  3PHT A;  2JZ5 A;  3AB2 B;  2OSQ A;  2OPS A;  2KJW A;  3LAL A;  4USM A;  3H2V E;  3QT8 A;  2KHD A;  5K8P A;  4KGV B;  1PYO B;  1L3K A;  3VQT A;  1OY8 A;  4B3S F;  5B09 A;  4PQA A;  4ECU A;  2RRA A;  3PHE A;  4LFA F;  3K5P A;  2VPX B;  2HUR A;  1HW8 A;  5ETR A;  3GYG A;  3JAM Y;  2XYG B;  4JBC A;  3CJ5 A;  1SB6 A;  3PM9 A;  3TVK A;  1FVQ A;  1TZ0 A;  2RVJ A;  3K8V A;  4JI2 J;  4UY8 5;  3QJP A;  5JUM A;  4WF9 Q;  4J9U E;  1P8G A;  5FLX Y;  1VIO A;  4F3M A;  4A8W A;  4I6Y A;  3SQO P;  1NHV A;  4Q7A A;  2V2Z A;  4ED0 A;  4JB8 B;  2IPO B;  1WUU A;  3KNA A;  1DUR A;  4WK3 A;  3EXY A;  3LWM A;  3U27 A;  4K4W A;  3KLI A;  1M5K C;  1DY3 A;  1VMB A;  5CH7 B;  2Z8Q A;  3AH6 A;  1FWP A;  2VU5 A;  1TL1 A;  2DO0 A;  1WEZ A;  1E6Y A;  1LWF B;  3KLI B;  1PYS B;  2ZKT A;  4CRJ A;  4AQY F;  4ANC A;  3BO3 A;  5GAG I;  1TL1 B;  5KFU A;  5C5J A;  5I3U B;  4JYA F;  3HVA A;  3OLB A;  1E6Y B;  1OYE A;  1EQ0 A;  3ZXW A;  3D3B J;  1CC8 A;  4U7U K;  4DCJ B;  1YWX A;  1UPM B;  2XMA A;  2WOM A;  3RBD A;  4NX9 A;  3FSX A;  3MMJ A;  2Y1J A;  4YR3 A;  2YWG A;  1NJZ A;  2VC0 A;  1R8P A;  4L76 A;  2FC8 A;  5IV3 A;  3EZ5 A;  3G4S S;  1UZD A;  5HQ8 A;  4LF5 J;  3UDE A;  2K7J A;  4QIW D;  4LF6 J;  2DNQ A;  3BDP A;  4NLP A;  4MIW A;  1RCO B;  3DLB A;  1N33 F;  4F0H A;  3TA2 A;  1VHF A;  5KG0 A;  2KT3 A;  4OLO A;  1Q7Y T;  2YBV A;  1ZTT A;  4L3K A;  2KYX A;  2YNF A;  2PMH A;  3TVY A;  1JLC B;  3DMJ B;  3WX8 A;  1IN0 A;  3PJW A;  1JXV A;  3HJF A;  1V3S A;  3AOB A;  3OSP A;  4PXC A;  2HQG A;  2YNF B;  3CJ8 A;  5LSR A;  2BJ3 A;  1RK8 A;  3GON A;  2FHK A;  3PR5 B;  4DUZ F;  3ZTR A;  1FRH A;  2G9O A;  5K20 B;  3QGI A;  3S01 A;  1H73 A;  4A8O A;  4FP9 A;  2NUH A;  2IBO A;  4WFN Q;  1UVN A;  3CCJ S;  2FIU A;  4AUK A;  2P9C A;  2AYG A;  3MXH P;  4D3G A;  4LMZ A;  2A2D A;  5DG7 A;  2AQ4 A;  2MLY A;  3W9H A;  2IDE A;  1HD1 A;  3UW1 A;  1F9E B;  1KLM A;  1XMB A;  4CO4 A;  1DRZ A;  1ZM3 A;  2ALY B;  3CD0 A;  1A0O B;  5IOL A;  1S1T B;  2ZEJ A;  3UNG C;  1KVI A;  2U1A A;  2EFQ A;  2ATC B;  1P27 B;  5KT5 A;  1ROF A;  4DV7 F;  3NOC A;  4CH1 A;  4B3S J;  1RHQ B;  4KY3 A;  3A3O B;  5HI7 A;  1BGX T;  2JEG A;  3H40 A;  3IWL A;  2FQQ B;  3NAH A;  3UI3 A;  3BS9 A;  3KK1 B;  2FHJ A;  3L7U A;  4IH7 A;  2P8I A;  2J5A A;  4NZ6 A;  4CLZ A;  5A2Q U;  2QLW A;  2A0F B;  2GML A;  1SH3 A;  3JQK A;  1CUL B;  4U9R A;  1SJF A;  1GX6 A;  4DJB A;  3M8P B;  3LP1 B;  4LF1 A;  2ZOM A;  2EEY A;  5ETT A;  3RB4 A;  1XMQ J;  1BLU A;  3D6M B;  1CJV A;  4JUZ A;  2QT7 A;  4KR0 B;  5L1J A;  2AGQ A;  3OXL A;  2X1G A;  1IWA A;  1PBA A;  1F6T A;  2YKN B;  2X7I A;  3TWZ A;  2J0Q D;  1R31 A;  1R0A B;  3C6U B;  4USU A;  4ZVO B;  2IRX A;  4X4O A;  4CYU B;  1RQ0 A;  4J9S A;  1Y10 A;  3MM7 A;  2R7S A;  5CHC B;  4KJI A;  2DXF A;  2VIC A;  2PT0 A;  2F5G A;  2GHV C;  2JC0 A;  4MIA A;  1G7C B;  4DV5 F;  4NE9 C;  3N79 A;  3BKF A;  2MKJ A;  4BC7 A;  4JYA J;  2RU9 A;  3BPS P;  2POK A;  4OZ3 A;  3PY8 A;  5KFH A;  3UPF A;  4FBU A;  3UR0 A;  3MGJ A;  2ZM6 F;  4RUA A;  1FTC A;  4CLF A;  3KDO A;  4NOH A;  3L3C A;  4F36 A;  3U1M A;  3HPO A;  5D78 A;  1RT5 B;  3V81 A;  2MGZ A;  2KVI A;  1P9Q C;  1RHM B;  2QFI A;  1LWE A;  3DLK A;  1GH8 A;  4ZVE A;  1C0T A;  2YNI B;  3KJV B;  3V81 B;  1RBA A;  2O67 A;  4A47 A;  2IRU A;  5HRO A;  4USJ C;  3IO1 A;  2X1F A;  1T3O A;  1G1X A;  1XMO F;  3MM8 A;  5DDP C;  5HRO B;  1H6K X;  2XCA A;  1L3V A;  4PQU A;  4QW8 A;  1UEU A;  3G6X A;  2Y1L B;  4EBD A;  3K5O A;  4NXN J;  2QN6 B;  1GTH A;  4KGM A;  2HIY A;  3MR5 A;  1YIT S;  4NLO A;  3R5J B;  3CF5 Q;  1LV5 A;  1LFP A;  2MQL A;  1SKU B;  3D6H B;  4NLD A;  2BKN A;  3DGV A;  1S4F A;  1K47 A;  4RW6 A;  4DV4 F;  2GMJ A;  1V6H A;  1XR6 A;  1EAY C;  3N5B A;  3TZZ A;  5J1P A;  2R8H A;  4RW6 B;  4MKB A;  1AT1 B;  5EN1 A;  4Y34 A;  1CC7 A;  3UNY A;  2IYG A;  3NCP A;  3BKT A;  2ZWO A;  3AJ2 A;  3B8H A;  4CP5 A;  1OS5 A;  3A8E A;  3EVM A;  1UCN A;  4DV7 J;  3M4X A;  1RWN B;  4PUO A;  4QU7 A;  1ELO A;  4M5I A;  4MT1 A;  1IVZ A;  2NSB A;  4IDK A;  3NBP A;  2HVE A;  1T9X A;  1HYS A;  1S0O A;  2LLZ A;  4RKU C;  1IM6 A;  1H2V Z;  1TL4 A;  3VAK A;  2R8I A;  1O51 A;  1SBR A;  2B3T B;  3JAM U;  2E5H A;  1MW7 A;  2FGO A;  3M8W A;  2P5V A;  1I1G A;  4ETZ A;  2UUA F;  2F3J A;  1S1U B;  2GHW A;  3A4T A;  4AT1 B;  5FLX U;  1V5V A;  3AQP A;  3CWJ A;  1EIY B;  2L48 A;  4ECV A;  2BRL A;  4WP8 A;  1IR2 A;  3V2U C;  1F60 B;  1VQO S;  1Q86 T;  2J6U A;  3Q8U A;  2PA8 D;  4H4M A;  2YNG A;  5KG6 A;  3H5X A;  1RAF B;  1M5V C;  1EP4 A;  5HK4 A;  4DV5 J;  5HP1 A;  3RR7 A;  1HI8 A;  4NZ7 A;  1QE1 B;  3MMA B;  4DBQ A;  4KGX B;  3GG0 A;  1U26 A;  4DOZ A;  1TV6 B;  2QFJ A;  2BQR A;  1LW2 A;  5HP1 B;  1YRX A;  3IGV A;  4B02 A;  3PW4 A;  3GIJ A;  1HNX F;  4GRS A;  3W9J A;  1Y0H A;  3ZZR A;  5KFO A;  5C24 B;  1F9H A;  2HZA A;  2I5J B;  4TNO A;  5THW A;  4YB5 A;  5IZH A;  4RW7 B;  2QSW A;  4KKO A;  4OZ2 A;  3C14 A;  2VPY B;  3DI6 B;  1EET A;  4Z2X A;  4DR2 F;  4QR0 A;  1Q1K A;  4YME A;  2NQP A;  3D0I E;  2RH3 A;  3C14 B;  3NY0 A;  1EET B;  1S6O A;  2QRR A;  2WW4 A;  2MJN A;  1TMJ A;  5KAK A;  1N5Q A;  5BYQ A;  4ZS6 A;  1RWU A;  2B9W A;  4NLS A;  5E5N A;  4QW9 A;  5F8J A;  5J2P A;  3IS9 B;  5LMU F;  1FWL A;  4WU3 A;  1UPP A;  1OSC A;  4LR8 A;  3W2V B;  1IKV A;  2DXD A;  3CME S;  3KLF B;  4TY9 A;  1KOO A;  5J1E A;  1Z1Z A;  2ASY A;  4IKA A;  3I5C A;  1IKV B;  1WC5 A;  4QR1 A;  2BKP A;  3NGR A;  5C2C A;  4DV4 J;  2VZ9 A;  3U02 A;  1EHW A;  2IA0 A;  1UFW A;  1S76 D;  2BVZ A;  4KIA A;  2XY5 A;  4J9K A;  4ZVU B;  4K7Q A;  5EHH A;  2AGO A;  1JJ2 R;  1T9U A;  2XCP A;  4E2F B;  2RU3 A;  1RAC B;  2ZVS A;  1T7P A;  4A8Y A;  2F40 A;  2AF6 A;  4RNN A;  1WWH A;  2RML A;  2XTJ P;  3DKD A;  4WKY A;  3H5Y A;  3HFV A;  3PNI A;  3KK3 A;  1VS3 A;  1F5B A;  2KB2 A;  3W64 A;  2HVI A;  3MM6 B;  5DQG A;  2CWX A;  3KK3 B;  1Q8L A;  5AXM A;  3GMG A;  3OTC A;  2WW8 A;  1HFE L;  1WHV A;  3NGS A;  2X1A A;  4MH8 A;  5D8H B;  2E5J A;  4RBV A;  3TJ9 A;  4HDH A;  1FCA A;  4AL6 A;  3GZ7 A;  3VAH A;  2UUA J;  1RAD B;  4Y28 C;  2MQP A;  2RS8 A;  4D3H A;  2GQC A;  2IM3 A;  2XNQ A;  1T95 A;  2HRY A;  4CM0 A;  1ZM2 A;  3OXF A;  4OYZ A;  2DNZ A;  4JOU A;  2MDA A;  1JWW A;  4CT8 A;  3HHE A;  2B9X A;  3QT7 A;  2W2P P;  2MHN A;  4EYH B;  3TVZ A;  3POT A;  4TQS A;  1V3R A;  4FBT A;  4FXV A;  1KEK A;  5LSL A;  3MFH A;  3VWS A;  3POT B;  1CJU A;  4ZP8 A;  6FDR A;  1C1B A;  1T05 A;  4C8K A;  2PD1 A;  4GKJ F;  2Q6C A;  3MFI A;  4ZP7 A;  3Q24 A;  5FDL B;  1TL7 A;  3F56 A;  4NL5 A;  5C42 A;  2GVD A;  1ZZN A;  4WFZ A;  4DCP B;  5A8K A;  2FY8 A;  5AJ3 F;  2D3O 1;  2HFN A;  2G0I A;  4GC7 A;  1Q4R A;  4NXM F;  4XPE A;  3F0N A;  3P5T L;  1S57 A;  2B9Y A;  3JTO A;  1N88 A;  5KFM A;  2VJV A;  2DNO A;  4DR2 J;  2XGQ A;  4P71 A;  2E5G A;  1H7X A;  3K17 A;  4KSE B;  1HI1 A;  1YJW S;  5AT1 B;  5E3Q A;  3ZO7 A;  3E01 A;  1J5O B;  2B8Q A;  4RUB A;  4ZLL A;  3BGF A;  4ZVG A;  5KFZ A;  3CCT A;  4OJ1 A;  2Q79 A;  3ZFV A;  2C3P A;  4PWD A;  2QMU B;  1R6Y A;  3E01 B;  2N7C A;  3SV3 A;  2G2O A;  2HFO A;  5LMU J;  1FDB A;  4HTJ A;  2GFF A;  3FC9 A;  2UUT A;  3BR8 A;  2BZ2 A;  1PC4 A;  1IQZ A;  1S77 D;  2XMV A;  2N82 B;  2KG1 A;  1IBK F;  3QJL A;  1DAR A;  3N28 A;  4WJB A;  2EFV A;  4HT5 A;  3R5D A;  4YP3 A;  2F8E X;  2LXI A;  2AW0 A;  1TQL A;  4FVC A;  4C7Q A;  2CJA A;  4ECT A;  3HSJ A;  3BGL A;  2E9T A;  2IVM A;  3W8G A;  2DNY A;  4I2Q B;  2DEJ A;  1N54 B;  1UKU A;  3GR1 A;  4PWW A;  3I4P A;  2XBP A;  1YGY A;  1GX5 A;  4F2S A;  1T02 A;  2IFX A;  1RT3 B;  3B6B A;  2VFS A;  3CDB A;  3ZZ0 A;  2XY7 A;  1IKW A;  1KHW A;  2F1F A;  1TP7 A;  3DRR B;  1SH2 A;  2MY8 A;  3KHH A;  1N6Q B;  5F0W A;  2ZHB A;  3IC1 A;  5F8G A;  1IKW B;  4ZVS B;  3T1Y J;  4FF1 A;  1CJT A;  4WE1 B;  3RAQ A;  4LRB A;  3W2W A;  5JXS A;  3QZ8 A;  3ZTQ A;  4LRA A;  4V19 J;  2V67 A;  3TAN A;  3M32 B;  3ZNU A;  1C0U A;  4AFF A;  3P4U B;  1L3U A;  2NLW A;  4WP9 A;  2PC6 A;  2CWK A;  3HSD A;  3QNW B;  2PSZ A;  4FF4 A;  1TTH B;  3OR1 B;  4ID5 B;  3QRQ A;  3GIM A;  4G65 A;  2YPZ A;  4HT7 A;  3M8Q A;  2AD9 A;  4IH6 A;  1HL6 A;  2E9Z A;  1ZPV A;  4DUT A;  4X65 F;  2V94 A;  4V1A k;  1U47 A;  3VQS A;  2WSE C;  1BHN A;  3IGN A;  3W66 A;  1X5S A;  4KGZ B;  2JRS A;  3W63 A;  5KTQ A;  2QEX S;  2ZZM A;  4HVZ A;  2V4J B;  2QL5 B;  4R0J A;  5LMN F;  1IBL J;  3SZ2 A;  1M90 T;  3GFH A;  5AJ3 J;  3MMC A;  3UD4 P;  1KTV A;  2DNG A;  4W92 B;  4NLY A;  1RWV B;  3KUG A;  1TKZ A;  3I55 S;  2KYZ A;  2R7W A;  2AIR B;  3TUP A;  1NSA A;  4NXM J;  2E5L F;  3PAC A;  4EYI B;  1NB7 A;  2E44 A;  3ENV A;  3CMA S;  2G1D A;  3OL8 A;  2B6A A;  4PYD A;  4IFY A;  2HLT A;  2M8D B;  4FXW A;  1ULR A;  2RQM A;  2B6A B;  3TZY A;  4NZ0 A;  4A8F A;  1LW0 A;  3EGV A;  2H5J B;  5CQG A;  3H20 A;  5KG5 A;  1NSK L;  5BYR A;  1FX2 A;  2JJ4 D;  1Q5V A;  3T19 A;  3DU6 A;  4FN5 A;  3I9V 9;  2P9G A;  3MPD A;  1NK6 A;  1VQM S;  3GR0 A;  4OJ3 A;  1DQA A;  2PEB A;  4O3R A;  1IBK J;  3DYA A;  3EVW A;  4X62 J;  3TAM B;  2H5I B;  3ENW A;  4A8Q A;  3TZW A;  2V5H G;  1YG0 A;  4F3O A;  3B78 A;  3JS9 A;  1H3D A;  1VI7 A;  2WBR A;  3KJN B;  4ED4 A;  3SCL E;  4B9M A;  1S6U A;  3DYA B;  4XDD A;  3C16 A;  3LP2 B;  1S1W B;  1LWX A;  5D3G A;  3UWT A;  5JMN A;  3PO4 A;  1JLG A;  4P2F A;  3A8J A;  1TUV A;  3MZI A;  2NYI A;  2ROP A;  2HGM A;  5J2M B;  4C11 A;  4F02 A;  3T41 A;  2KM8 B;  1XER A;  3LH2 S;  1JLG B;  1NK5 A;  1O0P A;  1NK4 A;  5HMW A;  4DI6 A;  1HNW J;  5HAN A;  4JV5 F;  1N4L A;  3M8R A;  4FKY A;  1FES A;  5KG1 A;  4M95 A;  2YY3 A;  2YQ0 A;  3CJK A;  4MK7 A;  3I6P A;  3M2U A;  4ZVP B;  2ZBP A;  3DLG B;  2RDI A;  2L9N A;  2AWZ A;  4XPC A;  2GAG C;  4LIR A;  4L72 B;  3CC7 S;  3RGI A;  5GAH U;  3DLE B;  2AJQ A;  2RSQ A;  2BV3 A;  5GME A;  3CMQ A;  3FMB A;  2J76 E;  1X4D A;  4OJG A;  5L8R C;  1U0S A;  1GNK A;  1CBK A;  2FVP A;  3WBZ A;  2DH9 A;  3LGN A;  4OQJ A;  3QQC D;  4I68 A;  3OV7 A;  2GO8 A;  1U7L A;  5ETP A;  4V19 X;  4RNF A;  1IKX B;  3QWP A;  2LQ5 A;  4F2R A;  1R3N A;  4X65 J;  2VFR A;  4GVL A;  5D0H A;  4RPF A;  2YWF A;  4BCA A;  4TU8 A;  3HK2 A;  2VPZ B;  1GTE A;  3OL7 A;  1H2T Z;  4UTG A;  3PW2 A;  3TOQ A;  2K2P A;  3QIP B;  2MB0 B;  4N5S A;  3D3C J;  3NWR A;  5H1S V;  2DEI A;  4DN9 A;  2OEL A;  4NI2 A;  3MPV A;  1FF2 A;  1WOR A;  2BX6 A;  2VV5 A;  1S1V B;  1S0V A;  3M8S A;  2R2T A;  2E5L J;  1TKX A;  4C8Y A;  4I67 A;  2Y0S D;  4URS A;  3OFG A;  4YB7 A;  5DG9 A;  4J9O A;  5D4P A;  2NXC A;  1TKX B;  1BQM A;  4RNO A;  1T9Y A;  2HK2 A;  4OZ0 A;  4KC5 A;  2HQD A;  4F7V A;  4PCQ A;  3FBB A;  2PE8 A;  3LAM A;  4WCE Q;  2HPU A;  3W65 A;  3ZZT A;  4ZJL A;  4LFB F;  2UV8 A;  1SL0 A;  4YOE A;  4P2M A;  2EW9 A;  3RAX A;  3R1L A;  5C25 B;  2VB6 A;  3HM9 A;  2AJ2 A;  2CQH A;  4QYR A;  2MKH A;  4PZV A;  2CQB A;  4P10 A;  4CLP A;  3V6D A;  1UEK A;  5A76 A;  2BAC A;  1Y3K A;  3N0V A;  2V4Q A;  4KYZ A;  3KXD A;  2O66 A;  2LFV A;  2KKH A;  3HHK A;  2GV1 A;  3GFX A;  2BM1 A;  5KG2 A;  3NKY A;  2QLF B;  1VBX A;  3R2C J;  2YX4 A;  3M1V B;  3M6W A;  1UVJ A;  2W2Q P;  3Q2T C;  1NKB A;  5JJB A;  1HHT P;  5HAT A;  1J2V A;  4JI4 F;  4TY8 A;  5KG7 A;  4XO0 A;  4PAB A;  4JI3 F;  3DFE A;  3GQC A;  1MWQ A;  3GJQ B;  3SSQ A;  4OI1 A;  1SJR A;  1U1Q A;  1TKT A;  1FKA F;  3MCO A;  1RYS A;  1FE4 A;  4MJK A;  4LFC J;  4JV5 J;  3LWL A;  3PV8 A;  2J0W A;  2DCL A;  5D77 A;  4Y3C A;  2UP1 A;  1RT6 B;  2B5J A;  4KHP F;  3VGU A;  5K9F A;  3CJ4 A;  1I6J A;  1UW4 A;  2XLJ A;  2ZUA A;  3HHL A;  2E29 A;  2HNY A;  5L1L A;  2BJD A;  2FVC A;  2OKQ A;  2B5J B;  2BM0 A;  1PAU B;  4OHV A;  1Q8K A;  2CQG A;  3HHL B;  2HHS A;  3P49 B;  1RP5 A;  4JI0 F;  2HNY B;  2RE1 A;  3BBC A;  2FJX A;  1WHX A;  1WKJ A;  4FYY B;  2ZOG A;  4OJH A;  3W7B A;  4F3Q A;  2WHO A;  5T41 A;  3W1Y C;  4B08 A;  5EX3 A;  3KYL A;  3GWC A;  4MYT A;  4OX9 F;  4MAK A;  1W2I A;  4YR0 A;  4OZL A;  2CNN B;  1XK8 A;  2A2C A;  5LT5 A;  1QDU B;  2BKO A;  1IR1 A;  3G6E S;  1FK9 A;  4OZ5 A;  1ZAW A;  1ZOT A;  4DL7 A;  3MOZ A;  4N8O A;  4F4Y A;  3Q23 A;  3Q0A A;  1U6Z A;  6FD1 A;  3CT9 A;  3JSB A;  4F4K A;  2HFU A;  2FVS A;  1RTI B;  2GX8 A;  1K0T A;  1U0H B;  5F8L A;  5CYQ A;  1PC5 A;  7FDR A;  2MQO A;  2W9A A;  2W7O A;  2HHP A;  2A6O A;  5CYQ B;  2W7A A;  1WF1 A;  3Q2S C;  4ZP9 A;  5HMX A;  1LFW A;  3I5B A;  3T5J A;  5I3Q A;  2DTJ A;  1RU1 A;  3D6T B;  3RR8 A;  4A46 A;  1D09 B;  2W9B B;  3PIO Q;  1UWB B;  4R8U A;  3BJY A;  2G2Y A;  5M2P A;  2RUG A;  1WDD A;  3MCN A;  1SC3 B;  1Y5I B;  3QJJ A;  4LFB J;  4PG8 A;  3VAG A;  2LEA A;  3QPI A;  3HLU A;  4NCA A;  1JLA B;  4F0M A;  1CS4 A;  1FI4 A;  3W9I A;  1HQE B;  3QBC A;  4ED8 A;  4Z37 A;  4NEZ A;  4J7C A;  4IFV A;  1BY9 A;  5AE3 A;  2OH2 A;  1X8D A;  1WEL A;  3R8Y A;  4LR7 A;  1IJF B;  2W4D A;  2EK1 A;  3VVU A;  3FCV A;  3QO9 A;  4OHZ A;  4M63 A;  1HNZ F;  1DTT B;  3SDE A;  4DV3 J;  1VQY A;  2DT9 A;  4R25 A;  3NNC A;  3CCW A;  2JH3 A;  2C42 A;  4IFV B;  4J9L A;  3HVR A;  1TL3 B;  1UEV A;  3D5M A;  3FVY A;  1RAH B;  2GIR A;  2HQI A;  1N36 J;  4ECQ A;  3NAI A;  3GYX B;  1SL1 A;  4RBT A;  3QO9 B;  5E41 A;  4CNY A;  5IXU A;  2HBY B;  3WHI A;  3T1H F;  4K5S A;  4K50 A;  4M5D A;  4U7U D;  4JI4 J;  4HLB A;  2GO9 A;  4JI3 J;  4HH0 A;  5EUH A;  3I96 A;  2VBY A;  4DF4 A;  2QA4 G;  1BWV A;  2MQ8 A;  3TP2 A;  5D0G A;  1RE1 B;  3H7H B;  3CO9 A;  2HGN A;  1AYE A;  3WIV A;  1UA0 A;  3V6K A;  3J7Z 5;  1T9T A;  1RAA B;  2YH0 A;  4C0O C;  4CCH A;  3MCM A;  4H4K C;  2AKW B;  1H98 A;  4K5R A;  2DXE A;  3BRE A;  3CDU A;  3EZU A;  3FKB A;  1PSD A;  1CJK A;  3OXG A;  3J7Y I;  1IQT A;  1QSS A;  4Y2K A;  3MD1 A;  4LRE A;  2RIJ A;  4CZC A;  2OGU A;  4R0E A;  4FYX B;  2LU1 A;  3MI7 X;  4O3N A;  5KFQ A;  5B08 A;  5IM0 A;  5IS2 A;  3VVT A;  1ZPW X;  4H4K A;  1DTQ A;  1D0E A;  2MST A;  2RF2 B;  3LA0 A;  2HND B;  2ERR A;  4B3O B;  5K14 B;  4E0D A;  2VQF F;  4G1Q A;  4IOC Q;  3TUZ C;  1YRT A;  2I9S A;  1DTQ B;  1W26 A;  2EBG A;  4OX9 J;  4NEY A;  3DHW C;  3UDC A;  2FVR A;  3NNA A;  2KXF A;  5IT9 U;  3R97 A;  3I82 A;  2PGC A;  2QA1 A;  5AXL A;  4USK A;  1FWK A;  4ZJO A;  4TU7 A;  3K7R A;  1NUE A;  2C28 A;  3ISN C;  3FDS A;  5MLC V;  3TAQ A;  3KUE A;  1OPZ A;  2MLX A;  1ZTW A;  1DQ9 A;  3MM5 A;  4QZV B;  5HBM B;  1X4F A;  2XY6 A;  4ED5 A;  2JSX A;  3DCA A;  3PJX A;  5B0A A;  3S6E A;  1CQM A;  5KG4 A;  2JEI A;  3AAW B;  1VDH A;  1I5O B;  4M5H A;  5D0R A;  4OI3 A;  1WI8 A;  5B7W A;  4O4G A;  4LSL B;  4I7F A;  4KV8 A;  2M52 A;  2XG8 A;  3M30 B;  1FJE B;  1RBL A;  2RKI A;  1JKH A;  3G82 B;  4EEY A;  1YI2 S;  5DGB A;  3QRR A;  4DUY J;  1U6F A;  4PAA A;  3V6J A;  2MZQ A;  1N0V C;  3BO4 A;  3J81 U;  4KV8 B;  2DNN A;  1JKH B;  3C6T A;  2D74 B;  4ED3 A;  2FLL A;  4J5O A;  1W7W A;  5T7L A;  4ITS A;  3NXZ A;  4TYA A;  1BQN A;  2JEJ A;  3MUT P;  2IM0 A;  2KT5 A;  1RWM B;  5DZ7 A;  1H2U X;  1B70 B;  3ENA A;  1Y00 A;  1FTR A;  1BQN B;  1R8B A;  1AZS A;  4AL7 A;  2WVB A;  2WCX A;  1HNZ J;  2OFH X;  3IG1 A;  1QAY A;  4Y2A A;  4MKA A;  4RU9 A;  2CYY A;  3C66 A;  2KI2 A;  1M1G A;  1TUW A;  1WTB A;  1RWO B;  1HQ2 A;  1U8S A;  1VQ5 S;  3QAE A;  4BHQ A;  4YY3 F;  3B54 A;  3I0S B;  4IUF A;  1JLE A;  3JTN A;  3IWX A;  3T1H J;  3OHB A;  3OW2 R;  2D41 A;  3AA9 A;  1RT2 A;  3LTO A;  3RBX A;  3E3X A;  1N5Y A;  2QTW A;  4O3Q A;  4X84 A;  1ZA2 B;  4LQ9 A;  1LXN A;  3BH7 B;  2ASL A;  2FTR A;  2RDJ A;  1RT2 B;  2W9C B;  3RB6 A;  1J27 A;  3MMB A;  3PR4 A;  2EVZ A;  2F9D A;  3VAJ A;  3OUY A;  4USV A;  3FZ2 A;  3NG8 A;  2Y0B B;  1N0U A;  2HLU A;  3LGH A;  4I2P A;  7FD1 A;  2YNH B;  4DR7 J;  1A6L A;  1PBU A;  3J7A N;  3DRS A;  3G6Y A;  3DLH A;  2OHD A;  4NLR A;  5F8H A;  2HZV A;  2BW2 A;  3SSR A;  2HMI B;  4ILM A;  3ULH A;  3AXK A;  4M5K A;  4UOG A;  1KQG B;  2GC8 A;  2YKQ A;  6AT1 B;  4Q2L A;  2QL9 B;  2KZZ A;  4BC9 A;  3VCD A;  4Y6I A;  3KNG A;  2VD3 A;  2EFO A;  2E7X A;  3GB0 A;  3U1N A;  3DDN A;  3Q8V A;  4S0M A;  3QLH B;  5L9N A;  4CLS A;  4Q5V A;  2IM2 A;  3LUY A;  2AEF A;  2Y3Y A;  5JVH Q;  2YKM A;  2VKZ G;  2VQF J;  1V5I B;  4EBC A;  1PJ6 A;  2QMW A;  4OYW A;  2Y1I A;  2CQ3 A;  3US5 A;  4WII A;  3H8Y A;  3IM8 A;  3RBE A;  4BS2 A;  2VON A;  3I32 A;  1S1X B;  2XYP B;  4QWA A;  4LJM A;  1KQF B;  4DFP A;  1C2P A;  3A13 A;  1S9E A;  2GQ2 A;  3M7V A;  2WAQ D;  3HHL D;  5J2Q A;  3MR6 A;  5J2N B;  2B4U A;  2VG7 A;  3MAA B;  2MXY A;  1FKP B;  2BQU A;  3WIU A;  2ZKU A;  2DGX A;  2M2B A;  1KBR A;  2H1Y A;  1RA6 A;  3I0R B;  2WRM A;  2V50 A;  3GPA A;  1SV5 B;  5EGY A;  2B43 A;  1OPI A;  2EC2 A;  4OI4 A;  3BH6 B;  4RLE A;  3PFE A;  2CPX A;  4W98 A;  2RRN A;  4GVB B;  3PYD A;  4EZ9 A;  1GMW A;  2WB4 A;  2ZE2 B;  2HEK A;  3BSC A;  1DLO B;  3R5B A;  4PG6 A;  2E1A A;  2CZ9 A;  1TVR B;  4WPA A;  2XMT A;  1IBC B;  1F5A A;  3KUH A;  5F3Z A;  2D3O R;  3KG0 A;  3T5H A;  3F41 A;  3DOK A;  3AJD A;  1YK9 A;  1AFJ A;  3DU5 A;  3AY0 A;  2CQI A;  1NM2 A;  3RW6 A;  3DN9 A;  3KLE A;  4B17 A;  2CG8 A;  1T0T V;  4CLK A;  3NS7 B;  4L3N A;  1N34 F;  3HFK A;  1FER A;  1FA0 A;  3I87 A;  2OEK A;  3AQO A;  3B4D A;  2L9W A;  2UZA A;  2DHH A;  4C2M A;  5HQM A;  4CTA A;  1VRT A;  3GLJ A;  3E51 A;  4YY3 J;  2BEF A;  1JLB B;  1FE0 A;  1V9O A;  2ZD1 B;  2XMJ A;  4IRD A;  3FCH A;  2HK3 A;  4DSL A;  4CTA B;  3H5S A;  2QMX A;  4ZDN A;  4DPU A;  5D6G A;  3PW5 A;  2CPZ A;  2RD5 C;  2ZIT A;  2OPQ A;  3FEY B;  2LYV A;  2CUY A;  4B3R F;  1R8H A;  4U8V A;  4C3L A;  4HHH A;  1U1P A;  3ZTP A;  4DV6 F;  2R4F A;  1RJJ A;  2OPQ B;  4AND A;  5LM7 E;  2KT2 A;  4K4T A;  1NPR A;  2LQB A;  4DDF A;  3TNV A;  5A2Q Y;  5A8W B;  2Q43 A;  3ZC4 A;  1WC4 A;  1ZZF A;  4ED7 A;  3MAQ A;  3D0H E;  4XDC A;  4CO1 A;  2FJV A;  2NCK L;  3PX0 A;  2HHH F;  1NZA A;  2QJ3 A;  4YS2 A;  1L3T A;  4GKK F;  1FRX A;  3DRP A;  5KFA A;  2CDR B;  1WSR A;  2Z4P A;  4N47 A;  3UQS A;  3EVO A;  2D7S A;  5GAD U;  4ICL B;  1CVJ A;  3IRX B;  3BBB A;  2F9J A;  1FRL A;  2PMZ D;  3EDQ B;  4N41 A;  3LO3 A;  4WYL A;  1SJQ A;  3SQG B;  1I3O B;  3K0J A;  1RAI B;  2JLG A;  4DL2 A;  2FDN A;  4DPT A;  3ONQ A;  3R9L A;  4CO5 A;  5CCL A;  1N8R T;  2W7P A;  1HBO A;  2PI4 A;  4C48 A;  1HBU A;  1MMN A;  3MHY A;  5CZV A;  3PKY A;  1NO8 A;  3K58 A;  3EXC X;  3GSD A;  1U24 A;  4HR2 A;  1HBO B;  5B0C A;  1F2G A;  4RNM A;  2D69 A;  4FVM A;  1TR0 A;  4CLT A;  4G1I A;  2V9W A;  2HBQ B;  2SXL A;  4DXL A;  5GAE I;  5A0Y A;  1LK5 A;  1TEL A;  2CJX B;  1YQH A;  4WZQ A;  2VF3 A;  4AL5 A;  4CI0 B;  3DHX A;  2FLN A;  2XMW A;  1WI6 A;  4J91 A;  3KLH B;  2GJI A;  3TUI C;  1XBW A;  4DR5 F;  5AE2 A;  3SV4 A;  3J81 j;  2MJU A;  1NK7 A;  2B51 A;  3ILO A;  4FDF A;  3HD2 A;  2V9K A;  1X9W A;  5D0E A;  1Z2Z A;  4HAC B;  4R5P A;  8RUC A;  1PKU A;  4F04 B;  1EB0 A;  4TLR A;  2B0G A;  1LNQ A;  1S6P B;  4N56 A;  2OEM A;  4NCG B;  2XQC A;  1GMV A;  3D68 A;  2CIM A;  3CCL S;  1MN7 A;  2C3U A;  4B3M F;  1DAX A;  1MG7 A;  4ECY A;  4QIG A;  3D1H A;  4KBI A;  2XLI A;  3NGD A;  1HNI A;  1MU2 B;  4ES1 A;  3W3S A;  4DR4 F;  1NRK A;  2GAH C;  3BQ0 A;  5E0O A;  3K2Y A;  2R2R A;  3GSI A;  1JLF B;  3RRK A;  4KO0 B;  3Q8Y A;  1U2F A;  2KTQ A;  3KLG A;  2L08 A;  1F2H A;  2ROE A;  2AHO B;  1AXQ A;  1JJH A;  2N7Y A;  4OZN A;  3KG4 A;  4LVO P;  3HVW A;  1H38 A;  4QWE A;  4OI2 A;  4JI1 F;  3OTO J;  1I51 B;  4ZVQ B;  3TR5 A;  3NGU A;  3D54 A;  3G8Q A;  2Y8W A;  2OPS B;  2KL8 A;  5DET A;  1YX2 A;  2R7X A;  4DV6 J;  1D1U A;  1YBT A;  2Y9H A;  1RWK B;  3JQJ A;  3NP5 A;  2CQD A;  2W2M P;  2W25 A;  1K0V A;  3CD5 A;  1JJ4 A;  2R7R A;  4C98 A;  1VBK A;  2BMB A;  2WSF C;  2V0N A;  3L7O A;  2HHH J;  3IN5 A;  3V4I A;  1U1M A;  3IFE A;  1B4S A;  4ELU A;  1M1H A;  2ZBC A;  1HQU A;  1XQI A;  2C2E A;  2RQC A;  3MED A;  1U1N A;  2CNK B;  1N32 F;  2BR0 A;  2RT3 A;  1YJ9 S;  4O23 A;  2E1R A;  4URG A;  5DDQ C;  1AA1 B;  5CYJ A;  2XB2 D;  1TAQ A;  4LF2 A;  4WXW A;  3CC2 S;  2KDO A;  3DM2 A;  4AXJ A;  4ZCL A;  3MTK A;  3Q89 A;  3RBZ A;  1M1K T;  1RHR B;  1VQN S;  5ITH A;  2MSS A;  3AFG A;  2BOA A;  2M70 A;  2PFD A;  3CCE S;  3DM2 B;  1NDL A;  5T14 A;  2YQ3 A;  1RT4 A;  3PEH A;  4IG0 A;  1SJ4 P;  2LMI A;  5IT0 A;  2DYA A;  5HVG A;  3HT0 A;  4ELT A;  2LDI A;  2C2N A;  2AYM A;  4ZN3 A;  1R8C A;  3G2X A;  1KRP A;  2LCW A;  3BYP A;  5FD1 A;  2ILZ A;  3CJQ A;  5FII A;  2BQ3 A;  1VQP S;  1X31 C;  2MTL A;  1P9Y A;  5KT2 A;  4LUB A;  3TEG A;  2ZJR Q;  1GMU A;  3SXL A;  4JP8 A;  1YJT A;  5DG8 A;  2WOM B;  1WC0 A;  3GIR A;  1IBM J;  2IRY A;  4EMD A;  1Q7L B;  4DL3 A;  3IBC B;  2HWT A;  3IR7 B;  2D9O A;  2V6A A;  1PAE X;  4DR5 J;  3P5B P;  1X0F A;  3QSY B;  1Y11 A;  1T9V A;  3DOM A;  5KFI A;  2E1P A;  5M2U A;  2M3D A;  3G8T A;  4ZIV A;  3O3L A;  2RNE A;  2L3M A;  4U96 A;  3TJA A;  1VJQ A;  2E1C A;  2WSC C;  3CPW R;  2BJ1 A;  2ADB A;  1X5O A;  1UAW A;  3THT A;  1EX8 A;  4ELV A;  2LQ9 A;  4F25 A;  2MZ1 A;  5BJR A;  4EUV A;  3O8W A;  1H7W A;  3T6J A;  2KFN A;  3PX6 A;  3J80 U;  4DR4 J;  3DGP A;  3W5Y A;  5D4N A;  3JSM A;  4U67 Q;  5HVF A;  2MKI A;  4QQB A;  2G0J A;  2XZT B;  3DRY A;  1NJY A;  3JSM B;  1Q8I A;  3K89 A;  5KFW A;  1RTH A;  4NLX A;  1KLM B;  1U45 A;  2CPD A;  2NSC A;  5IWA F;  4ZVT B;  4XIU A;  2YX7 A;  4JI1 J;  2GNK A;  1VIS A;  2M4M A;  5KFP A;  2JFK A;  1OY9 A;  4L73 A;  1FFG B;  4FNH A;  2DNR A;  3MR7 A;  4ZHR A;  4Q0B A;  2ZH4 A;  1DQ8 A;  4CM2 A;  3FCW A;  4K59 A;  1RKI A;  2MKC A;  4LFA J;  3P96 A;  1NKC A;  4Q0B B;  1VR6 A;  4IR9 A;  4IRC A;  1QUV A;  1YIJ S;  4X4Q A;  2EWH A;  2QGF B;  3P3D A;  3AHP A;  1NJI T;  1N32 J;  5E3A A;  5HJX A;  4X4P A;  3IR6 B;  1CJV B;  2DHA A;  3FBC A;  2EK6 A;  2VBZ A;  2P9E A;  2N4C A;  5DZ6 A;  4LBH A;  2HQ3 A;  3PYE A;  1HI0 P;  2V2Q A;  3FMW A;  3CW2 C;  3UDV A;  3MF5 A;  2FY1 A;  5ETS A;  1VCT A;  3TAR A;  3MM7 B;  4AQY J;  3PX4 A;  3EPG A;  4IQX A;  3NEK A;  2AU0 A;  5I42 A;  2IJN A;  3OTD A;  1SQG A;  4ZOS A;  2VBX A;  3FGV A;  3MR2 A;  3E2E A;  4MKV A;  3R2D J;  3LOU A;  2V34 A;  3M9N B;  3NCR A;  2HHV A;  2BE9 B;  2V2K A;  5AE1 A;  1EZZ B;  2ZH7 A;  2C2Z B;  1URR A;  1T8E A;  2KZM A;  4CT9 A;  2ZDP A;  1F3F A;  3BM7 A;  1VQK S;  2EKN A;  4WP3 A;  4JI6 F;  2NS1 B;  3SCJ E;  2PO4 A;  2C2K B;  2O1P A;  2M7S A;  4X4V A;  4EFA C;  2AV5 A;  2YX1 A;  4CO0 A;  2DVI A;  4L74 A;  1XC9 A;  1VBY A;  3A1Y G;  3LP0 A;  5FJ4 A;  1KLN A;  5D15 A;  2MGZ B;  3CCM S;  4P7V A;  2K1R A;  4PPD A;  4TVA B;  3ICL A;  2CAD A;  1N33 J;  1LWE B;  3DLK B;  1NME B;  2BAB A;  2BJ8 A;  1C0T B;  2VAS A;  2YWH A;  2HQF A;  3O1L A;  3M8Z A;  1Z2L A;  4C8L A;  2J6S A;  3MEE A;  5DM7 Q;  2CJY B;  4XTT A;  2OI2 A;  5CXT A;  3N6N A;  2UUC F;  2QZ8 A;  2UUW A;  4EI2 A;  2DRD A;  2LA4 A;  1BE4 A;  3MM8 B;  3VGV A;  1YZ6 A;  4DUZ J;  1W2B R;  4PQU B;  1HD0 A;  5LXY A;  3C19 A;  2PII A;  2ZH2 A;  2BYC A;  5DQI A;  1MWY A;  2RIL A;  1RYR A;  1N56 A;  2XO6 A;  2H65 B;  3WX4 A;  4ILL A;  2DGT A;  2LDY A;  3MUR P;  2CQC A;  1U1K A;  1F1B B;  4UUW A;  1HWK A;  3PDN A;  3NGK A;  2H54 B;  2XC9 A;  2XYH B;  2XS7 A;  1Y3J A;  4RW9 A;  1H74 A;  2MMY A;  5BXI A;  2H48 B;  5IWA J;  3J7Y U;  1PGZ A;  4QBU A;  4DLG A;  4LSN A;  1PYT A;  1EJ7 L;  2ZVI A;  2EFG A;  3UN3 A;  3X3U A;  1R0C B;  1X9S A;  3CD6 S;  3L4B C;  1MRO A;  3HKW A;  3FJ2 A;  3B82 A;  1SIW B;  4LF9 F;  3SBM A;  1S79 A;  1KN6 A;  4RR5 A;  2CDQ A;  1FT8 A;  4QYZ J;  1G6B A;  4PUO B;  1C1C A;  1P6T A;  5J1N A;  3LAK A;  1JLQ A;  4FS2 A;  3EE3 A;  3M9O B;  4IDK B;  2WON A;  1RTD A;  3NBP B;  2ZBQ A;  3QT5 A;  1C1C B;  2HSE B;  5HLF A;  3QFH A;  4P7T A;  3QYY A;  1HYS B;  4C4W A;  2CXE A;  2Z30 B;  1S97 A;  1HBN A;  5F9L A;  1SJ3 P;  4O3S A;  2YKP A;  4UQG A;  2R9L A;  4DWI A;  2NXU A;  4OL8 A;  4UST A;  2C3M A;  4MFB A;  3GIK A;  4BWM A;  2BE2 A;  1ZET A;  1S12 A;  3UVJ A;  4USW A;  1KS2 A;  1SH0 A;  1T03 A;  2HS3 A;  3CED A;  4YHH F;  4TXS A;  5ETO A;  2OML A;  3BN7 A;  3IWN C;  2YWE A;  4DHV A;  1T03 B;  9RUB A;  4H4M B;  4Q8F A;  2YNG B;  2DRA A;  2M8H A;  4YDX A;  4P75 A;  1EP4 B;  3JQM A;  3AOA A;  2VDH A;  3N9U C;  2J9C A;  4LBP A;  2ZM6 J;  2F65 A;  2HS0 A;  3BGR A;  1FFS B;  1TMM A;  1DZ5 A;  3EMT A;  1LW2 B;  2PA3 A;  2MZT A;  1NSQ A;  4UOH A;  2X3D A;  3AD8 C;  2HHX A;  2ZH5 A;  1WOS A;  3L9Z A;  1RU2 A;  3K5N A;  3FQK A;  1Q79 A;  1SIZ A;  1YJ7 A;  3KLV A;  1NPP A;  4QYZ K;  1REV A;  1RAJ A;  2CJ9 A;  3FSY A;  1U2R A;  4KKO B;  4H4O A;  2WZ1 A;  4P9S A;  3T6B A;  4WKR A;  3GV5 B;  2HYI B;  1IKY A;  3HMJ G;  4ECZ A;  2EXU A;  2DGS A;  3R5C A;  4LR9 A;  1XMO J;  3GFY A;  1YHQ S;  5KG3 A;  1LKZ A;  1OQ6 A;  2CJB A;  2FPH X;  5EWG A;  1HWL A;  1YJU A;  4BLG A;  1NPK A;  4J9P A;  3TX0 A;  1VQ8 S;  4IOA Q;  4C8Z A;  1K44 A;  2OPP A;  5J2P B;  1U8W A;  3KDN A;  1FRI A;  1WOP A;  5J1E B;  1OYD A;  3LF0 A;  1TKD A;  3UR3 C;  2DB1 A;  2IMW P;  2FC9 A;  2LVW A;  4ZMM A;  2CPI A;  2CVI A;  2I6W A;  4QPX A;  1VHI A;  2OPR A;  2AZ3 A;  4K2J A;  2BAN A;  1QSY A;  5KOW A;  4OHX A;  4C6A A;  3PVX A; 
#chains in the Genus database with same CATH homology
 2MEW A;  1J5E J;  4JI4 J;  4DR7 J;  4LFA J;  4DV4 J;  4KYZ A;  4YHH J;  4JI3 J;  4V1A k;  3J7A N;  4X66 J;  2UU9 J;  3IMQ J;  3OTO J;  2MQ8 A;  5IT9 U;  4KHP J;  2UUC J;  4NXN J;  2E5L J;  4DV2 J;  4JYA J;  4B3S J;  4DR3 J;  3JAM U;  4KY3 A;  1IBK J;  3R2C J;  4YY3 J;  3W1Y C;  2KL8 A;  4X62 J;  4LFB J;  4B3T J;  4DV6 J;  1IBL J;  1HNZ J;  4LF9 J;  4LF7 J;  5AJ3 J;  1XMO J;  5FLX U;  1N32 J;  4GKK J;  2UXB J;  3J80 U;  4DR4 J;  3T1Y J;  1N34 J;  1HNX J;  5IWA J;  5LMU J;  5A2Q U;  4DR1 J;  4LF4 J;  4JI0 J;  1N33 J;  1XNQ J;  4NXM J;  1XMQ J;  4NEZ A;  4JI5 J;  4JI6 J;  2MTL A;  4JI8 J;  4K0K J;  2HHH J;  1I94 J;  2VQF J;  4DR6 J;  4DV1 J;  3D3B J;  4LFC J;  5LM7 E;  1IBM J;  3T1H J;  4JV5 J;  4DV3 J;  1XNR J;  2KVQ E;  5LMN J;  1HR0 J;  2UXC J;  4DV0 J;  4X64 J;  4X65 J;  4DV5 J;  2ZM6 J;  4HHU A;  4DUY J;  2UXD J;  4JI1 J;  4RJV A;  4LF8 J;  1N36 J;  4JI7 J;  4JI2 J;  2VQE J;  4AQY J;  1FJG J;  3J81 U;  4DV7 J;  4DR5 J;  2UUB J;  2F4V J;  4DUZ J;  4B3R J;  3R2D J;  4PWW A;  1HNW J;  5BR8 J;  2UUA J;  3D3C J;  4LF5 J;  4GKJ J;  4DR2 J;  4LF6 J;  4B3M J;  4OX9 J;  4NEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...