1IBLJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1iblJ00
4JI6J 4HHUA 4DR1J 4PWWA 4LFAJ 4DV7J 5BR8J 4B3TJ 4X65J 4JI4J 1I94J 4B3RJ 4LFCJ 1N32J 4DR6J 2VQEJ 5A2QU 5LM7E 3IMQJ 4LF8J 4JI5J 4JI3J 4LFBJ 4KYZA 4KY3A 2HHHJ 4JI7J 2F4VJ 4JI1J 4JI0J 1IBKJ 4DR2J 4DV4J 1XMQJ 1N33J 2MQ8A 4X62J 2ZM6J 4LF6J 4B3MJ 4DR3J 4DV6J 4DV1J 2MTLA 4JYAJ 4K0KJ 2UUCJ 3D3CJ 2KL8A 1HR0J 4NEYA 5AJ3J 2UXDJ 3W1YC 4DUYJ 4DV0J 4AQYJ 2UXBJ 2UXCJ 4NEZA 3R2CJ 1HNWJ 2KVQE 5LMUJ 2VQFJ 2MEWA 3D3BJ 3T1YJ 4DV3J 2UUBJ 1XNQJ 4DUZJ 4V1Ak 1IBLJ 4DV5J 1J5EJ 4RJVA 4LF7J 4LF4J 4GKJJ 1HNZJ 1IBMJ 4B3SJ 5LMNJ 1N34J 4LF5J 3T1HJ 4OX9J 4JI2J 3J7AN 4JV5J 5IWAJ 2UU9J 4DR7J 1XNRJ 4GKKJ 1XMOJ 1FJGJ 4DR4J 4YHHJ 1N36J 2E5LJ 5FLXU 1HNXJ 3OTOJ 2UUAJ 4JI8J 3R2DJ 4DV2J 4X66J 4X64J 4NXMJ 3JAMU 4NXNJ 4LF9J 4YY3J 3J80U 4DR5J 4KHPJ 3J81U 5IT9U
chains in the Genus database with same CATH superfamily
2GVDB 3EZOA 4G1QB 2R7TA 1VRTA 1T05B 3R5DA 4KRWA 1AZSA 3PV8A 3CJ5A 5FDLA 4OYIA 3I4PA 1RWKB 1RT7A 2ZDPA 4OX8A 3VAJA 2YWWA 5D15A 1RAGB 1AUDA 2HNDA 1D9FA 1HD1A 5C25B 3OFEA 4RUBA 1U1RA 2AYGA 4OHYA 2YKQA 3KG1A 1EARA 1EKRA 1U02A 3P8BB 4DU8A 2OJ3A 2L9DA 2V63A 5KG7A 1MU2A 3PYGA 3ZZ0A 2GNKA 1WF2A 2GHWA 1YQHA 3LTOA 4IG3A 2WW4A 3I0SB 1VQMS 4LF2A 2V0NA 4O4GA 5ETMA 3ILLA 1VQ6S 1SQFA 3X3UA 2N7YA 1UETA 1RUSA 5HSPA 1SUQA 2CPHA 4X66J 4XTTA 2V94A 5F3TA 2B7BB 2HFSA 1NSKL 4DR5J 3N28A 1R0BG 3VTIA 1FTRA 5J2MB 1VC0A 5IT9U 5E41A 1EIYB 4DS5A 1JXVA 1RT6A 2DO4A 5IV3A 2QZ8A 1RT4A 4H4KA 3ICLA 2DB1A 5GAEU 2G1HA 2V4RA 3OW2R 3VQTA 3M8RA 2IA6A 3SQGA 1BQNB 1U24A 3BKFA 3KHLA 2CQBA 3P5TL 3HXMA 3M6UA 3RRGA 1XR5A 2P9EA 3TNVA 3PZPA 2OPSB 2EWHA 1WG5A 3FEXB 2ZOGA 2LEBA 4O23A 4EBEA 1RT2B 4TY8B 4ZITA 4FBUA 4CZCA 2W7AA 1NDLA 2JC1A 3AODA 3FBFA 5GAHU 1HWIA 3MZIA 3TAMB 2QRRA 4RNNA 4AYBD 4QR0A 3R7SB 3CCMS 4QWEA 4CLWA 1VI7A 3MEGA 3A3NB 4FPIA 2EC0A 2ZC3A 4HI2A 1ACMB 4FXVA 1VBYA 3MUTP 1SJRA 2ZWPA 4X64F 4DWIA 1YG0A 4X4UA 5H9FK 5KG1A 1EP4A 1LWEB 4RUAA 3D6HB 2WK4A 4UY85 4J9NA 3SEOA 1PSDA 3L3CA 1TKXA 5K8OA 3FKBA 4B9NA 4DPWA 4NCAA 4JI4J 3JSBA 1RYSA 3D68A 2D3UA 1RZMA 2FLNA 1FKPB 1OQ3A 4HH1A 4CQ1A 1WSRA 2BUNA 1T9XA 5A76A 4I4BA 1VLOA 3G6YA 2MKIA 1FRIA 3K8WA 3KUGA 4QBUA 2CZ9A 3NLCA 3DRPB 3DKDA 3HVAA 1RGVA 3CC4S 1RP5A 4NLRA 4AT1B 2I0XA 3DRRA 1G7CB 5I3UB 2QC3A 2ZH4A 3PNIA 3W1YC 3EXCX 2BACA 5LMUJ 2MPUA 5J1EA 1GQEA 2RUSA 2YKPA 4NLSA 1LXNA 4DV2F 3IWXA 1PC4A 3AQPA 1NLKL 3H5SA 2GJFA 4DSFA 1QE1B 1EETB 3S6EA 4I6AA 1D9AA 2MKSA 2NXNA 5HJXA 4W98A 3FZBA 2PEBA 5E2QA 2HFUA 2RQKA 3VAMA 1S5ZA 1TKDA 2XI2A 3KNAA 3N4WA 3CIMA 4TU7A 3GJSB 5M2PA 2BBEA 5AT1B 2R7RA 3C14A 4Q43A 3H2VE 4ED3A 4LF8J 3LANA 1AW0A 5JXSA 1RWVB 3Q2SC 1VQOS 1U1QA 2DGXA 3VALA 3VGSA 3MECB 2GMLA 2KYZA 1ZH5A 1FWKA 1X4BA 4TU8A 2RD5C 2KL8A 2C3UA 1N0VC 4P2XA 3O8WA 3R2CJ 1SQEA 3LA0A 3QPIA 2MJUA 4NI2A 3QGPA 2NR0A 3W61A 1UA0A 1UVJA 1HNZJ 1HBMA 3QIDA 2XCPA 3FMBA 3M2UB 2KFNA 4RWWA 4D3HA 3H2LA 5DS7A 1PBAA 2DNGA 2J7KA 3Q86A 3OVAA 5D0EA 2VJVA 1KDNA 2HHSA 3R6GB 3OTEA 4F02A 5I42B 4P72A 3AOBA 2OPQB 1BE4A 4Z37A 2UVRA 3QIPB 2DITA 2BE2A 4OX7A 3DLKA 4FS2A 4LSNB 2DHAA 4M5LA 1QSSA 3W9JA 2MZ1A 1U0HB 4LRBA 3HHLA 4WCEQ 1CJTB 4EI2A 2HHHJ 4ECTA 3O44A 5KFOA 3LP0A 2KXNB 2IC3A 2IA0A 3CCLS 5EX0A 4KAIA 4LREA 2BJ9A 2PE8A 3P3DA 1UZHA 1QAJA 4LUBA 4FVCA 3GONA 3KJQB 3EGZA 2E44A 3OR1B 3T1YJ 4IDKB 2AW0A 1T02A 1TR0A 3MD3A 1VBZA 1CS4B 1U1PA 3QJJA 4M94A 2J9EA 2PDAA 2QO3A 4FPRA 4BBYA 3KYLA 5DDRC 1IQZA 1A7GE 3H25A 2C3PA 1PAEX 1FJEB 4FXDA 2DH7A 1SB6A 2QMXA 4DR4F 2B51A 5L38A 5AXLA 2GX8A 2FVCA 3MURP 2X3GA 1D8YA 3G71S 1WKKA 3I87A 2ZITA 3TZZA 5D8HB 4Y6IA 3BR8A 5LJ5Y 1K44A 4E2FB 1XR6A 2HHPA 4MKAA 4WE1A 2CDRB 2VQFF 2F4FA 2YKNA 2FJBB 2UUBF 3HD1A 3UVJA 2CJAA 2CIMA 3BO4A 4MAKA 1S9GA 2IRUA 3KLGA 1UW4A 3T1HF 4UW2A 3SIPB 2I9SA 3QWUA 2BYCA 2XGPA 3K0JA 3G96A 4DV3J 2KN4A 1I1GA 1N48A 2KB2A 2HMIA 2V2ZA 1WORA 3M1VB 1G1XA 1VOMA 5BYRA 4YHHJ 1NSQA 2WONA 2WB4A 1WKLA 5HMZA 2JX2A 2M8HA 3KK3B 8RUCA 1X31C 1UFLA 4ZCIA 3W2WB 2ZZTA 3HDSA 1N5SA 1TKZA 1KHVA 3M9NB 3QT8A 4XO0A 5C7PA 4DUTA 3OXLA 5KT5A 4DR2F 1KOHA 3GSIA 4S0MA 4TYAA 3CJ8A 4K50A 2D41A 1PCAA 4F8RA 2FJVA 1CJKA 4PXDA 4RW4B 4KV8B 3MM5B 1YZ6A 4X4VA 3UN5A 1VRUB 2AZ3A 3D1QA 2QSFA 2U1AA 2UV8A 5F8NA 3T6BA 4ED2A 3IBCB 3HSZA 2PIIA 1WHYA 2JVOA 2V67A 2OD4A 1HW9A 4LR8A 3M6VA 4OHZA 1WDDA 4JV5F 4ZVSB 1DQ9A 2QA4S 2G1DA 3DLEA 4ECZA 2PT0A 4PWDA 4OZ0A 3E51A 4YS2A 4LRDA 3B4DA 1FF2A 3CO9A 4F4ZA 4WPAA 2HHXA 2V4JA 3R2DJ 3QZ7A 4X64J 2X1AA 1DTTA 1HNVA 4FP9A 2FVSA 4DMZA 3UPFA 3NGKA 5T14A 1N8RT 1JLGA 4WFZA 1U0SA 2B4OA 2MZRA 4DLEA 2CA9A 5AE1A 2HWTA 4ICLB 3CPWR 4F2RA 3CD6S 3TVKA 2HQGA 2KH9A 3LOUA 3L9ZA 4K4SA 1EB0A 3HO1A 3N6LA 4CT9A 5C42B 5DDPC 2GZOA 4ILLA 2W8LA 4DV4J 1RDRA 2YWKA 4NE9C 1PC5A 2DT9A 2HFVA 1NJWA 2BW2A 1UA1A 2ABYA 2AYEA 4QYZK 4MH8A 4EFAC 3WX8A 4I6YA 4KBIA 1YTYA 2KVQE 5DQGA 3B6BA 5MAOA 4WK3A 2OH2A 2VICA 5D4NA 3IC1A 4HLBA 2F8HA 3CSKA 4KJIA 2QYCA 3MOZA 4N56A 4QR2A 4CLLA 3LUYA 4CRJA 2AD9A 4L74A 1Q7LB 4HACB 4CLSA 3DHXA 3HI9A 3TX8A 2GW8A 5KOWA 1U7LA 3CNQP 1R0AA 1ICEB 4WFNQ 1YBUA 2ASDA 5CHCB 5B0GA 2B0GA 4HT7A 4OHXA 4GO7X 1S1TB 2F1FA 5E3AA 3DDIA 5CCMA 1FNMA 2KDOA 2P5VA 3TW0A 3MMAA 1WC6A 1RHUB 1U09A 2DH9A 2LXFA 4NL5A 2L3MA 3PW5A 2JEGA 3IP0A 3M30B 2FVQA 2XMJA 5EHHA 1J5EJ 2K7JA 1DTQB 4V19X 3AQOA 4YY3F 4NMLA 3MUVP 2NXUA 4ZPBA 4P71A 3GJRB 4ANCA 2L9NA 3RAMA 3I5CA 1KVIA 4ZLJA 4O3PA 3KHGA 4F4YA 1Q82T 4NXMF 2VQEF 5D3GA 1DFDA 4WP8A 3PR5B 2P6SA 5JUMA 2DEIA 4OQJA 1NDKA 3VZHA 5EN1A 2C22A 3M05A 4QU6A 2B4PA 5D77A 1U26A 2BV3A 3B8HA 4NZ7A 4FNHA 5KFQA 3Q8YA 1NO8A 4DX8H 2CADA 1Z1ZA 1HQUA 2VA2A 4GRSA 3KLIA 3N5FA 2IM2A 4A8FA 1VIXA 2WVCA 5GADU 2FGOA 4K2JA 2Z30B 3ZNUA 3OVSA 2HAIA 5HVHA 2PN6A 2W24A 3D4JA 1JX4A 3CVKA 3FFIA 3UR3C 1SKSA 5F8LA 4B3OB 4DR4J 1YK9A 2ZJRQ 4IH6A 3CIZA 4JP8A 1QY7A 1FO1A 4NA3A 4ZJLA 1RTDA 1JLAA 4K5RA 4JI1F 1T0TV 1OPIA 3HULA 3RBZA 4HDHA 1S0OA 4OZ5A 3M8WA 2XLJA 2WSCC 2XZTB 2CJYB 3OR2B 4B17A 4HHHA 4DUYF 3PKMA 3AD7C 4DOZA 1V9OA 1CULB 2H9ZA 3OV7A 1O0PA 3EE3A 2WOMA 2BA9A 2KT5A 3FVYA 2OELA 1HHTP 4C97A 2NCKL 3NAHA 3AHPA 1X4HA 3ETOA 4NYZA 4RUHA 2MKYA 1L3SA 1FA0A 4ZS6A 4C11A 2A6MA 1QSLA 3TEGA 1RACB 4KHRA 3CMES 1VQPS 1FEHA 3JXOA 1L3TA 1C1BB 3ZZOA 3J81j 2LQ8A 3SCKE 3UN2A 5DJBA 5J2NB 1RWNB 2ZUAA 2XZWA 4I2QB 2CDQA 2HSEB 4HHUA 2E9RX 2IVFB 2AMCB 3PHEA 5EDWA 3DOLB 4X65F 2BJ3A 1MROA 4L73A 2ZH8A 2ILYA 3NCRA 2XHCA 4LRAA 1UL3A 1NK5A 5KFEA 2LEPA 1RXOB 1T94A 1YI2S 2R7UA 3LPYA 2AV5A 2Q1LA 1X60A 1S1WB 5IWAF 4NLUA 5H9EJ 6AT1B 4FDFA 2NPFA 2ZHBA 4KTQA 1NKCA 4DUZJ 1HHSA 4ZP8A 4PG8A 3L7UA 2WW8A 3U1MA 2C2KB 2I5JB 2DNKA 2JEFA 1NSPA 3JSMA 3MCSA 2GIQA 3RJMB 1HWUA 1P1TA 1Q4RA 1B7FA 2YNIB 1JLEB 3J80U 1UVMA 4HI1A 2P9CA 1SBRA 2YNHA 3L95X 3R97A 2N3LA 1EJ7L 3NGRA 4MKVA 1FDBA 5D4LA 1CEZA 1FRLA 2GC8A 1X4GA 3W2VB 2EG2A 1HR0F 2Q43A 3UDCA 2DHGA 1M0SA 2DR7A 1F9EB 2D3OR 3IRWP 3BH7B 3BQ2A 1TAQA 3GJQB 1CVJA 4M5MA 3GZ7A 4F0HA 1N34F 2UUCJ 2M88A 1N6QB 3C19A 2W9CA 2AX0A 4ZVQB 4OZ2A 1Q0NA 2W2MP 2R7WA 2AYBA 2DGUA 4IRCA 3MM8A 1WF1A 4NYPA 2K06A 4ELUA 4WP3A 4ZVGA 4ETZA 4KHPF 2F5GA 3ZZYA 5GMDA 4RW7A 2HLUA 2H5JB 1SH2A 1Q79A 4ED1A 3VHQA 5F0WA 2EFGA 3N0VA 4QPTA 1DLOB 1KTQA 4CYUA 2B43A 4KC5A 3IGNA 4BLGA 3CDWA 1RABB 3ET6A 4DFPA 1S1XB 2AGQA 2RMLA 2M2BA 3IG1A 1B99A 2HNZB 3BO2A 1PIEA 1Y5IB 4JI0J 3MR7A 3DNCA 2CQCA 2PMHA 4ZVHA 2ACYA 4DBQA 4DV1J 3V4IB 3D0HE 3AJ2A 2QEXS 3MPUB 1OIAA 2VDHA 4URGA 2IBKA 1Y5LB 4C0HA 1U1LA 1C0TA 4U8YA 1GMWA 1S1VB 4ECVA 1Q86T 2K7KA 1Y0HA 1NK0A 1NJXA 2HNYA 4NA2A 2JOQA 3G8QA 4CM0A 3LALA 2W4CA 3J7A1 4ZP7A 1HNXJ 2ZH2A 4IOAQ 3CF5Q 5DRKA 4KQZA 4NXMJ 2DJWA 2HVEA 3BYPA 5K8MA 3MM7B 4W90B 3MMCB 1L5UA 3WBZA 4DSJA 1Y4ZB 3H98A 1FKOB 5IM0A 3Q89A 2RB7A 1UWBB 2HVZA 4LF6F 5CYJA 3OLBA 2A1BA 4FYYB 1VISA 4DDFA 1XTZA 2JDJA 2LXIA 1AZSB 3U27A 4U7UK 5FDLB 2QLXA 3TO8A 4UUWA 3CMAS 1UZDA 7FDRA 3ENQA 1MMLA 4RW6B 3C8YA 1L3UA 5HP1A 4NLDA 4LF5F 2ROEA 3AFGA 1IKYA 2HQFA 1TKTA 3J7YI 2KT3A 2L48A 2Z2YB 3G8SA 5I3QA 3QQCD 3UR0A 1WWHA 4HDGA 3KLVA 3B82A 4GKJJ 2DGSA 2DBBA 3A3OB 1SKUB 2H48B 4P2FA 3NGTA 3U1NA 1E6VB 4JI8J 2F3JA 3FEYB 2JFDA 4O3SA 1KNZA 2QN6B 2KHCA 2FUG9 3TUJC 1HI1A 2VKRA 4DR1J 1FK9B 1D1UA 3L7OA 4FN5A 1S97A 1I6JA 3O5TB 3BV8A 4DL4A 2K2PA 1RT6B 3EX7B 4X2BA 1RT4B 4ZP9A 4JI3J 2FB0A 3KLEA 3FCVA 2C28A 3DOKA 3GP9A 1RBOB 1Y3JA 4KO0B 5D6GA 4DQSA 2OTJS 1SVDA 3SDEB 1JNZB 4OJGA 2UU9F 2P6TA 1JNRB 1UEKA 1A6LA 3W9HA 4JUZA 3LGNA 2W1BA 4C3MA 5L1LA 1UVIA 5K9FA 1J27A 1J5OA 3BH6B 1KS2A 1LW2A 1YITS 4RPFA 2A6OA 5HLFA 3T41A 2Q3PA 2CWXA 1O5JA 4J9RA 2EK6A 3EVOA 4ELTA 1TL7B 2CNNB 2PMZD 4RU9A 2CQ4A 3PKYA 1TUGB 1F2HA 1FX2A 4MKBA 5DGAA 3M8ZA 1SJQA 4O3NA 1ZAXA 2W2OP 2R2RA 4X65J 1YHQS 4DPUA 3HF5A 1WF0A 4H4OB 3KJVB 5D78A 3BR9A 4NCBA 4FF4A 4KY3A 2YNGB 3GFHA 5E3PA 2NREA 4MIAA 1GMUA 4YR2A 5EUHA 1KP6A 3MAAB 3TI0A 3TAPA 2Q6CA 4J37A 1DY3A 4JI2F 2LLZA 3RB4A 3QAUA 1RQ0A 1PBUA 1WG1A 5IXUA 1HQEA 2AJFE 1PYTA 5J1EB 2VG6B 3ZZRA 3R6LB 2XYGB 1CJVA 3OBIA 4Y00A 4HEA9 3QO9B 2H51B 3PCOB 4G1PA 3VQSA 3LP1A 2J6SA 3ZTPA 1TL3A 4JBCA 1OO0B 4LFCF 4WIIA 3S1TA 2MLYA 3OPKA 2E1AA 3H5UA 1X4FA 4FYWB 1KQGB 2RSQA 4YOEA 2JC0A 1S99A 1U47A 4KFBA 3UI3A 1N52B 1S0MA 5LM7E 4PXCA 3DRSA 4ECYA 5IT9Y 1F3FA 5HI7A 4RL1A 2Z2ZA 4ZPVR 3RG6A 1W25A 4DG1B 3C14B 2R9LA 1F5BA 4TXSA 1WTFA 2EXUA 1OQ6A 4MKYA 4ZN1A 1BWVA 1YJVA 4EYIB 2KXFA 1YBAA 4DL3A 1T3NA 2POKA 2DR9A 1IBLJ 4NLGA 4OYBA 1Y9OA 3ENAA 1VC5A 5I3PA 4FYXB 3G87A 1R3NA 4QIVA 1RT5B 4B9SA 3AJDA 2AJ2A 3CDEA 4UOGA 1IVZA 3E01A 4PPZA 4CO0A 1NK4A 4NXNJ 4FF2A 1N5TA 1T8EA 2DHXA 3QZ8A 3M2VA 3Q24A 2RS8A 1ELOA 2LMIA 4JI6J 1URNA 3P6YC 2J76E 1MWQA 4J9MA 4ZVTB 2RU3A 1T9VA 3RAXA 1QDUB 2GV1A 2GMHA 1RT1A 4FF1A 4JI7J 2DNRA 4OYMA 4O3QA 3SZ2A 2N7CA 2ZVSA 3AOCA 1NH7A 4X62J 4HTIA 3G9CA 3MD1A 1Q5YA 1NDCA 3FC9A 3RGIA 2DRBA 1O8BA 2EI5A 4WKRA 1HFEL 3BDEA 4EZ9A 4DL2A 1XIQA 4USWA 4XPCA 1FJGF 2JVRA 1Y10A 1FESA 3TA0A 4DFMA 4OYZA 2RKIB 2Y1IA 4Y65A 2M8DB 4I6WA 3CD5A 3PYEA 2Y1RI 2F40A 1VQ5S 3IN5A 5J1PA 3W65A 1VLYA 2VODA 1RAIB 4B3TF 3FSIA 2QL5B 3G6ES 2V4QA 3PG9A 4ZVFA 1VCTA 2HHUA 3NS7B 4CO2A 3I96A 3LO3A 5HJYA 4V19J 4U96A 3E3XA 1HPZB 5A0YA 3MHYA 2BOAA 2ERRA 2M5YA 5SZTA 1HHQA 2CG8A 1RTIB 5HO4A 4Q0BA 4IFYA 5HN0A 2LU2A 3N6MA 1VK8A 1LWCB 4BWJA 1WELA 1AB8A 4WE1B 4ID8A 2ZVIA 3WDOA 2MY7A 1QJHA 4QJVA 4O3RA 3SCLE 3UVJB 4J7CA 4USVA 1NZAA 1P9YA 3CD0A 1RSCA 2FJXA 5IQQA 4DX5A 3PX6A 5CYMB 1JLCA 2OGUA 3K5OA 1UMJA 1FERA 2VU5A 1XMOJ 3UW1A 1CLFA 3BBBA 2IYIA 3OHBA 4CLFA 1RKIA 1R8BA 5GAGI 4YR0A 1SJFA 3GFXA 2F7VA 2VDIA 2DR8A 2CJ9A 1WEYA 2DCUB 3RR7A 5KFXA 2MQPA 4KGXB 2KVIA 1NDPA 2ZEJA 2C2OB 4DV0F 2OEJA 4AQYF 2ALZA 1EQMA 4IH5A 5F8HA 3IRXB 2AGPA 2XHWA 1EHWA 2DVIA 4NCGA 5L1KA 3H4DA 1X9MA 3IAM9 3QWPA 3AT1B 6FD1A 1HYSB 3KK1B 4MJKA 1DARA 2AJ0A 2EC2A 1HL6A 2HWIA 2GJ2A 5DG8A 1RAJA 3PFOA 3K7RA 2VV5A 1C4AA 4C8YA 3P45B 5T41A 1WOOA 2VOOA 3VVTA 4IRKA 4ZPAA 3TVZA 2MKKA 2BR0A 5KFSA 4UT4A 4KIAA 3GMGA 3LPEA 1KD1T 1QM9A 1SL1A 2V4JB 3KHHA 4ECUA 4NRTA 1NM2A 1K47A 5KG2A 1DTTB 4PWUA 4QIGA 2A10A 1FXLA 3MFIA 4LIWA 4B9MA 4CLZA 4TYBA 4FZVA 4KKOB 2MZSA 3IR5B 4B9UA 1REGX 7FD1A 4XDDA 2DNHA 3MEKA 3IM8A 3C16B 5KFGA 4O3OA 2ZZMA 3K59A 4RO0A 2O67A 5F3ZA 3DYAA 1KTVA 1TFWA 2QLBB 3ETMA 1OY8A 1GXTA 2UXCJ 4LR7A 1Q78A 4WYWA 3FRYA 2ZKUA 4I64A 2GGPA 4NLOA 2EKNA 1RT3A 5BYSA 1AROP 5K14B 2MJNA 5GMKa 2GIRA 1UW9A 1F0XA 1YBTA 3P5BP 3DRYA 1WHXA 4BC9A 2E5LJ 2X1FA 5HROB 1KLNA 1VQ8S 1BQXA 1DHMA 1TL1A 4RU2A 2EPIA 4NWBA 1NAQA 1K73T 1MN7A 2OPRB 4WU2A 4DSLA 4DXLA 1KLMB 4LFAJ 2XG8A 4OYWA 2RHQB 4B3RJ 4ED7A 1IWGA 1UKUA 1VQYA 2DNPA 2NQPA 1ROFA 2XMKA 2ZH9A 2ATCB 3LAKA 4KB7A 3KK2A 2C1EB 3IGVA 4DEZA 2NYIA 2V8DA 2HLTA 4DX6A 4MFBA 1UP1A 1H2VZ 1FJ7A 4WZQA 4JYAF 3KKFA 1JLBB 1B70B 3NKYA 4ZHRB 5AJ3J 3KDOA 1DJ0A 1SKWA 3M9MB 2B5JA 3EZ5A 4DPYA 1JKHA 2HQIA 2KO1A 5HBMA 3BSNA 4X66F 2FY1A 4LF7J 1V3SA 3TJ8A 3BBCA 1ZA1B 3I0RA 4DR5F 3DFEA 4KGMA 2HKEA 2CKWA 4IYQA 1NH8A 1LK5A 1DQ8A 3QGGA 2YH0A 3ZC4A 2Z0GA 4K4ZA 3SV3A 4PG5A 3P96A 4K7QA 4ES2A 1FDNA 1S9FA 2VF3A 3MEDB 1ZM9A 4BHQA 2XY7A 4ZJQA 1IM4A 2DRAA 2LA6A 4OI2A 5KTQA 2HHTA 4F67A 4OZ3A 2QMWA 3VGVA 2KM8C 1RHMB 3DU6A 2GVDA 4G1QA 4J9PA 2F8EX 1ZETA 4P10A 4PYDA 2G0IA 4X4SA 1OJ4A 1B3TA 4N5SA 2YKAA 2AEJA 1TAUA 2J8SA 4KSEB 5B09A 1V3ZA 4YFUA 2ZH3A 2LFVA 3MM6B 2VIHA 1H7WA 2VBXA 3AXMA 3CJ3A 3JQJA 3UFCX 3DGPA 2MQLA 2F63A 4V1Ak 2R7VA 3CULA 3I5BA 4PYAA 2VD3A 3I0SA 2DIVA 1LWFB 4ZJOA 1S4FA 2YKMB 1GX5A 4JI4F 2Z57B 2Z2MA 2RIJA 2Z2LA 4OYXA 3JQMA 1FCAA 4XPEA 1K9MT 2HBZB 3LW5C 4CNYA 3UO0A 5J2MA 1I94J 3BJYA 3RRHA 2VOPA 2J0XA 1M90T 1MSWD 3TYTA 4QYRA 4RNMA 5ETSA 4AD6A 5CCLA 4LFBJ 2OMLA 2L08A 2CQPA 4OV6A 1F1BB 4ANEA 3NMRA 5LMUF 3KFWX 4LJMA 1XMQF 1UPMB 1S9EB 3I56S 3GIMA 1BQNA 2XNQA 3FCWA 3EGWB 3PXGa 4L75A 3R5BA 3MTKA 5IC4B 1VYAA 1JLFB 1FRHA 2WOMB 3I31A 2OPSA 2B4UA 3OVBA 3CT9A 3DGVA 1SC6A 1SKRA 3M2RB 1RT2A 4TY8A 4F2SA 3G82B 1RLDA 1MNEA 5EX3A 2XY5A 3IXQA 4ZKAA 3POTB 1NJIT 3R5JB 2MQMA 4RW9B 2V34A 3TAMA 4ZA1A 2E66A 3CJ4A 4PAAA 5E33A 3MPVA 4LF8F 2ZWOA 3KG4A 1T7PA 2XBPA 4X4PA 1LW0B 3HT0A 4WK1A 2HWHA 1LWEA 5FIIA 3N5BA 1JB0C 4RNHA 4ZVEA 4U6PA 3TZXA 2BDPA 2RDIA 3I6PA 5GAEI 1FKPA 3FZ2A 3JYTB 4A8QA 2IIHA 4IOBA 4Y34A 3GFZA 2QG9B 1U1NA 1UWAA 3M7VA 4DV6J 2OIHA 2MZTA 1HNZF 4XIUA 3FUYA 2JNJA 2AZ1A 4Z2XA 2CUYA 3MGJA 3QGIA 3QJPA 3UD4P 1HNWJ 2G13A 1NK6A 4EWTA 2NLWA 7AT1B 1C1CB 1QTMA 5I3UA 5KFCA 1V5VA 2BABA 4MK8A 4NX9A 5BYQA 4OZ1A 2ZHAA 3BGRB 3T5KA 1HBUB 5F9LA 4DR7J 4R8UB 1XNRJ 3R1LA 1J2VA 5GAHI 1PGZA 3DN9A 2I6WA 4ILRA 2OSQA 1CQNA 2FHOB 2PSZA 5ETQA 2DKOB 1QE1A 1EETA 2C2ZB 2J8AA 1S49A 4CH1A 1F6TA 5CD4A 1R31A 2ZH5A 2G0CA 1KFSA 3CJRA 4A8SA 1RA7A 2WTFA 1R8AA 1ZZFA 4Q5VA 1IKWB 4JI5J 3OUYB 1HNIA 1IKXB 4CTAA 4DSIA 3T1YF 3Q23A 3DCAA 2YKOA 4OHWA 1YJ9S 2HIQA 2BJ8A 3G86A 2VASA 4GO5X 3MECA 1SL0A 5HMWA 4PQAA 4F4WA 5CD4H 3J7ZT 5LSOA 2RAQA 4DV5J 1CC8A 2W9CB 4EBCA 3EPIA 1KQKA 1QLNA 4DFKA 4A8KA 1IR0A 1ZM4A 2RU9A 4Q2MA 5LJ3Y 4K2XA 3WIVA 3KUHA 2VBZA 4YEAA 5L39A 2DCLA 2J0QD 1SC4B 2LKZA 4OV1A 1RAAB 3ILJA 2R42A 4NZ0A 2APOA 1MLAA 3M2UA 1NHVA 4FKYA 3TZWA 3MR6A 4WTYA 3GFYA 3CJQA 2V5HG 3FNNA 2K1RB 3LGHA 3OD2A 3GR0A 2JHEA 2YPYA 3VAFA 5U47A 4I1TA 2F8MA 2GJIA 3EPGA 1HBOB 1NUEA 1JJ4A 1N32F 3IS9B 2OPQA 5CZXA 3QIPA 4CYUB 5ADZA 1GT8A 1U6FA 3BGUA 1CG2A 1RAHB 5LOQA 4AXIA 5KFTA 2ASJA 4DV3F 3R5CA 4FBTA 1U0HA 1S6QB 3CWJA 3KNGA 4A47A 4BWMA 1OS5A 1CJTA 2J7WA 4B02A 3T6JA 4JYAJ 2G9OA 3NBPB 1VQ9S 4J9LA 3M32B 2XWYA 1YRTA 4YHHF 2WCXA 3BPSP 2O5DA 2DEJA 3V6KA 1U6BA 2FLLA 3OR1A 4QWAA 2IM3A 4NLPA 4IDKA 2RE1A 3UE2A 4OX9F 1RHQB 3TUPA 1DQAA 5B0CA 4M95A 2QYGA 1UCNA 4LF1A 1S1UB 1IWAA 1XQIA 2KXHA 4DSKA 3A8KA 2VG7B 4NLQA 3WQPA 2DPIA 3TUZC 4ZPWR 3LF0A 4PG7A 4ELVA 1UVNA 1QD1A 3D5MA 3J80Y 5BR8F 3AD8C 1P1LA 3CUNA 1WG4A 1PKUA 4HR2A 3JTNA 1R89A 4NLWA 1HKAA 3B54A 1NNDA 1ZM3A 4YN3B 2H4WB 4KH1B 2QV6A 4PXEA 3HSJA 3J81Y 3E8OA 4CWBA 4NEYA 2UXDJ 4AL6A 4QIFA 4C0BA 5RUBA 1YJUA 4EYHB 2MEWA 1RWWB 1XNQJ 5EWEA 3GQCA 9ATCB 4P7VA 3SFUA 2HK3A 4UQTA 2ATLA 2RJZA 4QR1A 3VZIA 4TNOA 2BQ3A 5IOLA 2GAHC 4GKKJ 2CNLB 3KXDA 4G6VB 4LVNP 2B9YA 3BREA 2FPHX 1NK8A 4LF9J 2DY1A 4AXJA 5HQMA 2IRXA 3KMQA 2Z58B 2L9WA 3RRKA 2HVHA 3KK3A 5D0GA 1QAYA 3W2WA 4DV4F 3NCPA 5E3CA 1PAUB 1E6YB 2W4DA 4WBFA 4CH0S 3MM9B 4X84A 1IR1A 2I38A 5DM6Q 4RW4A 4KV8A 1IBKJ 3MM5A 2CJKA 3HHKA 1XMQJ 1CJUB 1VQLS 2HBQB 1VRUA 3BEGB 1WOPA 3ITHB 1NHKL 1BWEA 3NNHA 2KG0A 1W26A 2HFZA 1TUVA 2BRLA 4QW8A 3DOKB 5D0HA 1FFWB 4K4XA 1SJ3P 4Y0FA 2QA4G 1KC8T 1HQ2A 3RZAA 1RA6A 2JRSA 4UTGA 2KM8B 2HS3A 1K1SA 1S6PB 3LP2A 1G6BA 3PRBA 2LA4A 2AX1A 4DSEA 3V2UC 3NRBA 2XLIA 2Y8YA 2JH3A 4F4KA 5HMYA 1T9YA 1NPPA 1HWLA 2ZBQA 5F0UA 4AL7A 2D74B 4CH7A 2BKNA 1RTJB 4IR1A 5KFHA 2N4CA 5DQHA 3I82A 2HG4A 3KLHB 2J9CA 4DR6J 2FJEB 4AE5A 4OYAA 4ICLA 5M2UA 2XYPB 4CLYA 1ZBTA 1VQSA 1D9DA 2XSFA 2YQ1A 1NPKA 4I7FB 3QSIA 5C42A 2QGFB 3CTRA 2ZUGA 1AXQA 2QL7B 4CO5A 4DR3J 1J5EF 2Z56B 1SV5B 2AEMA 3PJXA 2OD6A 3R3TA 3AH6A 3CDBA 3O1LA 3TJ9A 2HEKA 2IY5B 3VAKA 1KEKA 4I2PB 1RISA 1K0TA 3EXYA 2R8KA 1ZA2B 1H73A 2HPUA 4CO4A 2FDNA 1B64A 4CM2A 3F56A 4U95A 2XULA 1VQKS 2ZHOA 2XLKA 1ZAVA 3V5RA 3D2WA 4IFVB 3RBDA 3CCWA 4OJ1A 5DO2A 1APSA 2EW9A 1HMVB 1S7IA 4PABA 3IWNC 3W62A 2BMBA 5F8GA 3HFVA 4HACA 2GVZB 3FBEA 2XM3A 4P75A 4H54A 4P9SA 2ALYB 1ZZNA 3FDSA 2YBVA 4ZK7M 3KMSA 4GVBB 2HHQA 5CAAA 5H9FJ 4J90A 2FD2A 4KFBB 3NGDA 4TN2A 4AUKA 2E5IA 2FVRA 4NLXA 3CCES 4PR6A 1M1HA 3NS6A 2MHEA 3D28A 1S1TA 2K8GA 4P73A 1BQMA 4LRCA 2UXBJ 1U2CA 1IUJA 4ED5A 2QT7A 2EBGA 3BPDA 2WSFC 2B56A 5EWFA 4DPXA 2WBMA 3T9ZA 4B3SJ 3M30A 2V50A 1H3DA 2LDYA 4L3KA 2VB6A 1DTQA 2LU1A 3ISND 2EFVA 1X9SA 3V6DB 3SQOP 2NPIA 3JAMU 3BYRA 3E01B 4QPXA 4JV0A 3R5AA 2AJ1A 1BMQB 1D09B 2OMOA 2PO4A 1TK0A 4NLTA 3RYLA 1TP7A 4E0DA 5ITHA 1DZ5A 2VKZG 5JJBA 2Q6BA 1N32J 1XWLA 4USTA 4PQUB 2DISA 2DRDA 2FVPA 1IKVB 1ITPA 2V2VA 3C66A 4L76A 2PA3A 3W60A 2DGQA 2Q79A 2RQCA 2XO6A 4ERDA 1RTZA 3Q2TC 3ZTOA 1FDAA 3FBCA 2W9BB 3MMJA 1N4LA 5C24B 3M8SA 3Q8UA 1K1QA 2YNFB 1S57A 1PJ5A 4QIEA 3NP5A 3M8PB 3TQEA 1M5OC 3DI6B 2FTRA 3HHEA 2FZKB 4GC6A 4OX9J 4CI0B 2F65A 5HK4A 3DM2B 3MCNA 3OXFA 3OFHA 2MHNA 2V9WA 3C6UB 4CLPA 3MFHA 2WVBA 3BGFA 4RNOA 5HVFA 3SSQA 1VJQA 1BD6A 4B3OA 2W01A 3CCTA 3D6MB 2B6AB 5JVHQ 2KRRA 2AKWB 1SIZA 3BKUA 2WRMA 3PYDA 5BR8J 2OUGA 4Y2KA 3P49B 3C3LA 3MAHA 4WXOA 3R7BB 1F2GA 3HPOA 1LFPA 4ECQA 3RBXA 2E1PA 4MIBA 5BXIA 3PVXA 4F3MA 3OR2A 2GO9A 4DUZF 1AUSL 4DPTA 1X0FA 2YX7A 3D3CJ 3CDUA 3MMBB 1S0VA 4LVOP 3CCVS 5DG7A 1U8SA 5J2QB 1CULA 3D9BA 3L7PA 3PO4A 2PI5A 5DG9A 5KFBA 1GAOA 3HVWA 1BY9A 2XSJB 5LMNJ 1WTBA 2HAFA 1ZPWX 2F9JA 2AHOB 3PW4A 3M6XA 4P2MA 2VC1A 5GADI 1N36J 1ZS6A 3MR2A 4ILMA 3L09A 4J9VA 1M5KC 1JJHA 3CJTA 4UOCA 4Y2MA 5KFUA 2Y1JA 2EFQA 3V81B 1JJ2R 1C1BA 1SI9A 4PG4A 1Y7PA 3O2IA 2JEIA 2WAQD 4YB5A 4I2QA 1X4DA 2UUCF 4N47A 3CCQS 3T9NA 3DOLA 4IG0A 3SYZA 3TARA 3R7NB 3VAGA 3UCGA 1LEOA 4IRDA 4KGZB 4HKQA 2D3ZA 2IFXA 3HKWA 5J2PB 2J0SD 3FQLA 1ZTWA 4DZ6A 4PUOB 1T9WA 3KDNA 4WFAQ 2MQNA 4OI0A 3C15B 1S1WA 2CPZA 5A2QY 3A13A 1WI6A 2HYIB 2H3EB 2OPPB 2BJEA 3OT9A 4M5DB 3R1HA 5DETA 2DR5A 2BQUA 5KFPA 3N01A 2I5JA 2HRYA 1OMSA 4BDPA 3R5GA 4WWSA 5HQ8A 2R7QA 4K4UA 1CQMA 2ZE2B 2XGQA 3PY8A 1FXDA 4NMXA 3K5PA 2IVYA 1JLEA 4JI0F 3HVTB 4U7CA 1MG7A 2RQMA 3MTJA 2VG5B 2MGZB 2B9WA 2OHDA 4DV1F 2ZKTA 1U2FA 3G4SS 1REVB 4IO9Q 2JLFA 1X5TA 2CXEA 2R7OA 3RW7A 1L3KA 2QA1A 1QUVA 4N77A 2JJ4D 4FNIA 3W2VA 4R5PB 2ZM6J 1HI0P 4CO3A 4ZDNA 4B3MJ 2YVSA 1R7IA 3W5ZA 5E0OA 2L41A 1YJTA 5FD1A 2I8EA 4H4KC 2J9DE 3OLAA 5KFKA 3DOMA 1AA1B 4ETXA 4LQ9A 4RR5A 4C9DA 1HNXF 1X5SA 1N6QA 4UQGA 3QBCA 5M2RA 2OI2A 3CMQA 1M5HA 1JLQB 1RYRA 1Q5VA 2LECA 4OI1A 5A8RB 4QIWD 1NU4A 2V6AA 2KT2A 1Y11A 2DGTA 4R25A 4EU0A 1S59A 4MT1A 3OJSA 2MDAA 4PCQA 3GIIA 1HBNB 1RAOA 2YQ3A 4F26A 1BXNA 3LWLA 3PEHA 4PG6A 4DV7J 3H5YA 2FIUA 3I55S 2ASYA 2QMUB 4MIWA 3ZTSA 1VR6A 1UJ6A 2B8PA 2VFTA 2M9KA 3PW0A 1T03B 4MMOA 3TP2A 1RTHB 1S1XA 1N5QA 4QW9A 3U1LA 1XERA 4GKJF 2HNZA 2ASLA 2VL1A 1RAEB 4OIXA 5ETRA 2CVIA 4MFBB 4DHVA 3SBMA 5EWGA 3KJFB 3V4IA 3MUMP 3CJKB 5AE3A 3RUBL 4JI8F 1FEEA 2CPXA 4ZIWA 4XAKA 1FX4A 2XS5A 1NHUA 3CO0P 1NK9A 3QT7A 1N54B 1YJ7A 3K5LA 3B78A 4G3IA 1HA1A 3PHTA 1CPZA 3TVYA 4QYZJ 2P8IA 4DCOB 1S1VA 4LRFA 3HFKA 2A2CA 3ILIA 4DR1F 5C2CA 1X4EA 2OEMA 1HARA 1C4CA 4KGKA 3HJFA 3G2XA 4Q45A 2CQ2A 3SCJE 5ETLA 2XMUA 8ATCB 5D4OA 4JI3F 2DXDA 3CCUS 2VPXB 3ISZA 3MR3A 4YP3A 2VPYB 2Y8WA 3MM7A 5IQ6A 4OJHA 3OL8A 2PFDA 3MMCA 2X1BA 1HD0A 1FNOA 2FHMA 1FKOA 1V3RA 1UWBA 2MLZA 3LGMA 2W9AA 4P6QA 4Y2CA 4LBPA 4A8OA 4F04B 3M8QB 3VV2B 4F3OA 3I32A 5EGYA 5A8WB 3OTCA 3TEHB 3KLFB 1RJJA 2WHOA 2ZH7A 4GMKA 1KQSR 2H4YB 2FHJA 2HQ3A 5A8KB 3DC2A 2IDEA 4RW6A 3NNAA 2DXEA 3TUIC 1JK9B 5IS2A 3N6NA 2RNEA 2MMYA 2EBEA 4RBVA 4DQRA 3DMJB 1G3OA 5A6PA 3DGPB 1S12A 2PMWA 3GB0A 2HQCA 4OYPA 1PJ6A 1LWXA 4IH7A 2UUAJ 2CPJA 2HRUA 4ED0A 1U6ZA 2G2ZA 3EGNA 4K4YA 2OKQA 2IYGA 3BO3A 2B9EA 3W66A 2CJQA 1E6VA 2DNZA 2CJXB 2FJDB 3BF4A 3MCMA 4LSLB 3MPDA 1U45A 4B9TA 1AFJA 2RRAA 3PR4A 1KR4A 3EYZA 2M70A 2YWEA 1FK9A 2BM1A 1IQTA 1QAXA 2F4VJ 2D3O1 2M7SA 1UPPA 2V8HA 4Y3CA 3DDNA 4CLUA 2MZJA 4WYLA 1F3VA 2W8KA 1N5YB 3TOQA 3BN7A 3GG0A 3CCJS 4K0KF 2IAJB 3PFEA 3ZTRA 4IKAA 2JEJA 5KT2A 1GXUA 1S48A 3D0GE 4KO0A 2FLPA 3HHLC 3HMJG 3SDEA 3DLBA 3HHNB 3QLHB 1K0VA 4OYOA 3BGLA 1LXJA 2ZD1B 2DO0A 2JFKA 2J5AA 1OYEA 2RDJA 4K4TA 2AF6A 3T5HA 3Q8RB 1WC1A 3MI7X 3FGVA 2DXFA 3CB4A 1NB2A 3HHDA 3J81U 4UY8T 2UZAA 5DDOC 4EUVA 5A6WA 2O01C 1TL7A 1NCLA 2E1MC 4OHVA 4DJBA 4A8WA 2VBYA 4C3KA 2YWGA 1SJ1A 1S77D 2C2NA 4I67A 5KOXA 4ZLPA 2D9PA 1VFJA 3BKTA 4N76A 1EAYC 1KFDA 3OL7A 4NASA 4H4OA 3KJVA 4UUXA 2BX6A 3AB2B 1F60B 1FFGB 1IBLF 2YNGA 3MDFA 2MXYA 2IBOA 1NJYA 5ETNA 3GJTB 2FHKA 1KHWA 5L1JA 1RWMB 4ZIVA 2HBYB 3MR5A 3MF5A 1VGYA 3JSYA 5E3RA 4YB1P 2PA8D 3MAAA 3GIKA 2Y0SD 1QSYA 4ZVOB 2VFRA 4RJVA 4X4QA 5KFVA 1RWPB 4NXNF 3EDRB 4DX7A 3SCIE 4MYTA 2XI3A 3HSGA 3OSNA 1GK8A 4F0KA 4Z7CA 5L8RC 2Y9HA 5G0RB 4JI6F 1CC7A 3JS9A 2VG6A 1Y00A 2LDIA 1X4AA 4WJBA 3QO9A 2UVWA 1RI7A 2VZ9A 2OAUA 2E1RA 4JI7F 3D1OA 5IT4A 3PJ9A 4X62F 2EFNA 2CPEA 1ZOTA 1FXRA 2HBRB 1NZ8A 3HFZB 4UOHA 4N7TA 1VK3A 3OHAA 1N33J 4ATNA 1AYEA 2IJNA 3QAEA 1HNIB 2CPYA 2D1CA 4DG1A 2HFOA 4CTAB 4DS4A 2XMTA 2QL9B 2ZOFA 5C2GA 2MYFA 3D1HA 3C6TB 4EK2A 5MLCV 1H0HB 4RW8B 4HVZA 2RVJA 4ED6A 1FNXH 4NOHA 4FF3A 1TK8A 3MEEB 1HI8A 1RWOB 3LH2S 3FEZA 1OPZA 2COLA 4HHJA 2UV8G 5LSLA 3BGOP 4P2SA 2PI4A 3OTOJ 2MSSA 4AL5A 5T7LB 1RT5A 2D7SA 2NSBA 1G4CA 1VRTB 4QCLA 4O0NA 1K8AT 4CT8A 1NBEB 3VGUA 3H8YA 4R0JA 4WFBQ 1OSDA 4TKTA 1HLWA 2IJRA 3ZZPA 2GMJA 2CZ4A 1RT7B 2HGMA 2HFNA 3TJAA 2E9ZA 2HNDB 1VQ7S 2XTJP 4FYVB 4LQ3A 3UD5A 1IM6A 5B08A 5KG0A 3S01A 2EK1A 3ENVA 2DR6A 3ZO7A 1MN9A 4F7VA 4BS2A 2BANA 4PZVA 4OZJA 3R8YA 1MU2B 2KHDA 2YXLA 2UUTA 4IG3B 1NK7A 2JLEA 4NEZA 4ZCKA 4O4GB 1XMOF 1Q8BA 1YKWA 4EGLA 3D66A 2XEXA 4YR3A 2VUGA 3DRXA 3S8SA 1SUQB 1IBMF 2NSCA 2RKIA 3CCZA 3WIUA 4ITSA 4CCHA 3DXBA 2CQHA 2PD1A 4ZPCA 1KONA 4TQRA 1H2UX 1R8HA 1M5PC 3V4MA 4O44A 3NY0A 1R43A 3ENWA 3PACA 2VHGA 1IJEB 3A8EA 3W8GA 3EM1A 5HANA 3SQGB 4CLTA 1H98A 4DU7A 3GV5B 4RWXA 4MK9A 1N0UA 1DAXA 2BXJA 1U2RA 2QE5A 1HPZA 1TTHB 1T9UA 1T3OA 3OTBA 1RTIA 1FWPA 2OFGX 1NEEA 1LWCA 1Q81T 4P7TA 2ROPA 1SC1B 4USUA 5IFMA 2C2DA 1WEXA 5L1IA 3NL0A 1F5AA 5DLFA 3EVMA 4M5IA 4ED8A 3MEGB 2ZJQQ 4A8MP 3E2EA 2DYAA 2LP4A 1Z4UA 2Y0BB 3SSSA 1F5CA 2A0FB 1EP4B 1ULRA 5CYMA 1X7VA 1TKXB 2E5JA 4FS1A 3D54A 2KZZA 2R8JA 1FD8A 3HZGA 5K5MA 3FSXA 1LOUA 4D3GA 3DLHA 1ZAWA 2N4DA 5K20B 3ISNC 4ZP6A 5DQIA 1TMMA 2JLGA 2ZJPQ 2ILZA 2NXCA 3OSPA 2UXCF 2GS8A 5B0DA 3DRRB 4WFYA 1NPRA 3QJLA 2LEAA 2E5GA 2AWZA 3IRXA 2DNMA 2BZ2A 1NKEA 4K0KJ 3PJWA 1RKJA 1PJ7A 3WZ0A 1FTCA 3H5XA 1HYSA 3AAWB 3KK1A 2MQOA 2E5LF 4ZOSA 1WI8A 2E1CA 2ZFHA 1EX8A 4K4VA 3FSYA 2SXLA 3PO5A 2WZ1A 2RH3A 4USHA 3QRPA 1LK7A 4LFAF 3LP2B 2X3DA 3RU0A 4B3RF 4OI4A 2QLJB 2HVDA 4F50A 1PILA 2GQCA 2PGCA 4BC7A 1U48A 3C46A 1RE1B 3M4XA 3CDAA 3AJ1A 1SQGA 3H90A 2XWXA 2GHVC 3RB0A 1XR7A 4C8ZA 2AQ4A 4C7QA 1S0NA 3IMQJ 3H59A 2CNKB 3UCZP 1PG5B 5AJ3F 4KH0B 2U2FA 2XS2A 1WACA 4KKOA 3QT6A 2IJFA 4FVMA 3SSRA 4LF7F 1VC6A 1URRA 3CJ2A 3H42A 4N41A 2CQIA 5AE2A 2OEKA 4PRFA 2AEFA 4NI2B 3PW7A 2FGCA 3C16A 3KTQA 4ZCMA 2RUGA 1VDHA 1PO6A 2Z8QA 1HBMB 1FE4A 2XCAA 3PEJA 1WHWA 4NLVA 2G4BA 4A4JA 2WVFA 1VBXA 4DQPA 5LL6d 2CQGA 2DGWA 1HWKA 5GVQA 4B08A 5K14A 1GTEA 1TUWA 3QFHA 3NOCA 5LT5A 2K3IA 4DV2J 2DHSA 4K8RA 1FD2A 1YZ7A 1BGXT 3Q0AA 1R8CA 2G0JA 1B7YB 5HROA 3QGHA 2BE2B 3ZZZA 3DLKB 2R8HA 3N9UC 3HHLB 1VQNS 4KHMA 2J7UA 2OPRA 5A2QU 1QTNB 2V9KA 1S7HA 1KLMA 3IR6B 3LP0B 2IC3B 2V2KA 1RLCL 2LQ5A 3I9ZA 2W2NP 4MTPA 2PFFB 2X51A 3AD9C 3OL9A 5L9NA 1N88A 2CYYA 2IVMA 4ID5A 2WVDA 1V6HA 3IBWA 1G2EA 1H74A 5K8NA 2VBWA 1T11A 1JLBA 3EWGA 3ZFVA 4OZNA 4ZHRA 2H65B 3Q8QB 1BQMB 3BSOA 4KPCA 5KFRA 2VFSA 4C8MA 2MZQA 3J7AN 4LSZB 4CP5A 4TY9A 3AOAA 5CYQA 3GCXP 3BS9A 2LYVA 3IWLA 2AJ4A 1FT8A 2AJQA 4H4MA 1I94F 3RTVA 2CJBA 1O6XA 1TVRA 4ZMMA 3QRQA 3D0IE 3AXKA 4IQXA 4USJC 1BUXA 1UFWA 2ZBPA 2RS2A 4LFBF 3Q8VA 3K58A 3QYYA 4HL9A 2ZH6A 3EGVA 1S6UA 3D7SB 3MEDA 2QFIA 3A8IA 2YKNB 1NMEB 3LQVA 3OFGA 1VIOA 1U4BA 5H9EK 1Q8KA 2H5EA 1S9GB 4FKXA 3KLGB 3AA9A 2KFZA 2C3YA 3K89A 4QWDA 3DDKA 3PDNA 3JTPA 2YWHA 2HZCA 3M6WA 4IO1A 3W5XA 2HMIB 1EKSA 1RAFB 4ECXA 2YQ0A 5CQGA 3MM6A 2HHVA 3HX9A 4JOUA 1DRZA 2E5HA 1IBMJ 2WONB 2BE7D 1RCOB 3O3LA 2B4VA 1SH3A 3GILA 1FI4A 5B7WA 5KFMA 1TKZB 3VVUA 3ZZTA 4MYUA 1LWFA 4ALZA 2YKMA 2R2UA 2XB2D 3EVWA 4P74A 1CJKB 3PRDA 2FJWA 1WDTA 2ZOMA 1TU0B 2M4MA 5D0RA 1JJCB 4DV6F 3DU5A 4L72B 2C2MB 1WC0A 1TZ0A 3VAHA 3CE8A 2HGLA 5FLXY 1HNWF 2W7OA 3G8TA 4C8NA 4ANDA 3VF0B 3PYFA 1KKHA 1JXEA 3DLEB 1RBAA 3WC2A 4PWDB 4E8UA 4DR7F 1XNRF 3EUNA 3TX0A 3CCRS 2VQFJ 4Q8EA 2R7XA 1S9EA 2UUBJ 1O51A 2RT3A 3TANA 2OLWA 4XK8C 3SV4A 3L4BC 1JLFA 2R8IA 1B0PA 2M0GB 4I0WA 3T1HJ 5JVGQ 1HNVB 2YX4A 2J6TA 5HQLA 4CNZA 3M2RA 3H2UB 1JLGB 3G82A 4J9UE 2DGVA 2FZGB 2GQ2A 2DNLA 3POTA 2LQ9A 4RW9A 1FFSB 3WX4A 1U8WA 4JI5F 9RUBA 3K8VA 2ZH1A 2Z4PA 4PWWA 1Q95G 5IZHA 3JAMY 2NXEA 1FRMA 1MW7A 4NYOA 2CRLA 1UJ5A 1LW0A 1C0UA 3C2PA 1FRJA 4DR2J 2LXUA 2KFYA 3GSDA 4IG0B 4DV5F 1KRPA 2JWNA 3WHIA 3JYTA 1U49A 4HTJA 2HS4A 2CWKA 4Q2LA 2GCFA 2OSRA 4TLRA 1A9NB 3B4MA 4A8XA 5K8PA 1RHRB 4R0EA 5KG4A 1CBKA 1UJ4A 2QIFA 5G4DA 1C1CA 4JV5J 3G6VA 5GMEA 2QLFB 1C2PA 2E7WA 3BGRA 1HBUA 2LQBA 4R8UA 3SMZA 4E98A 2RF2A 2HZVA 4DL5A 4RBTA 1R0AB 1OSCA 1S76D 4C0OC 1QVFR 4EEYA 1QUPA 2A18A 1OWXA 3DLGA 3A8JA 3X1LB 1RB0A 3D67A 5E5NA 1XJWB 4OFZA 1YX2A 3UNGC 1XMBA 3MMAB 4WXWA 4ES1A 2W7PA 1HIYA 3CXCR 1IKWA 2ZZNA 3CD7A 3OUYA 1P6TA 4QQBA 2W2QP 5DGBA 1IKXA 2MTLA 4DF8A 5KFDA 3NGSA 4M1KA 4UF4A 3QATA 4USMA 3THPA 1X8DA 3P4UB 5B0BA 2PC6A 2GHPA 1R6VA 2YPZA 4RNFA 2GFFA 3DOMB 3GG1A 3EDQB 2XZDB 4WKYA 1WC4A 3CJ0A 1SJ4P 3V6JA 1TV6A 5D3GB 2IM1A 3BQ1A 1F9FA 3UDVA 2ACMA 5B0FA 3MPYA 1T05A 2I2YA 1B0VA 1U1KA 4LT6A 1T9TA 1YSJA 1WC5A 2R7SA 1GEHA 2OO4A 4RLEA 2ZBRA 4IQMA 2O66A 4AFFA 3N79A 1VJWA 2K1RA 4G65A 5C25A 2UXDF 4ECWA 5I4MA 1HBOA 2DH8A 3IS9A 2IPOB 4YQWA 1XNQF 1HQUB 5LXYA 2CG4A 2DNOA 4M5NA 1N56A 6FDRA 3KLIB 1EZZB 4J9QA 2GAGC 1YDLA 2QLWA 1S6QA 5IT0A 4ED4A 4GKKF 2BJDA 2G2YA 2N82B 3IAS9 3OTDA 3NBPA 3VCDA 4QZVB 3M32A 3FFIB 3QRRA 4LF9F 2CQDA 4LF4F 3VGTA 2MSTA 2D9OA 3NMAA 2HS0A 4ZN3A 1ZPVA 2DPJA 1R6YA 2CQ0A 1FRXA 4DPOA 2A2DA 5THWA 3O6QA 1RTDB 3NNCA 3AA8A 3NOGA 4FXWA 4YY3J 1JLAB 2KG1A 3UD3P 5H1SV 3RW6A 1WC3A 2RQ4A 1MMDA 1S1UA 4W4MA 2VJUA 4TU9A 2JL9A 1IBKF 5KFLA 1R8PA 2VG7A 1FWLA 4YDXA 2VQEJ 1MWYA 2QFJA 2QX0A 5KT3A 4JB8B 2ZNZA 4HYKA 3CGIA 3T1AA 4OJ3A 3DLLQ 1IBCB 3F41A 1OY9A 1WNEA 4ER8A 3GU0A 4JV1A 2CAJA 2P9GA 3PIOQ 3A3PB 3HZEA 3ELHA 3D3BJ 8AT1B 1RK8A 2BJ1A 2FY8A 3EICA 4C11B 3LAMA 4ZCLA 1UEUA 3TRGA 1NB7A 3IR7B 4MK7A 3ONQA 4ZPDA 4LMZA 1KQFB 3HT3A 2K3KA 1W2BR 4ZLLA 4URQU 3ZZUA 5KFJA 4DR6F 2IMWP 4DL7A 2UUWA 3AB4B 4URSA 1S79A 1MROB 3CC7S 3W9IA 2CPDA 2YTCA 4C98A 4DR3F 1X4CA 3DRPA 1X5PA 2O1PA 3TR5A 2EFPA 5E3QA 3IFEA 4USKA 4Z7YA 1E6YA 4KPYA 4JI1J 5DM7Q 1LNQA 1JXLA 3S7RA 3W5YA 3MM9A 4C8KA 2C42A 2UVVA 1ZTTA 4J9KA 3HLUA 2IRYA 2DHHA 4EMDA 1M5SA 3JQKA 1TL5A 5F8IA 3MWBA 1WUUA 1CJUA 4DUYJ 3ITHA 3CC2S 2XMMA 4A8YA 2XS7A 5KFFA 4J9SA 1H72C 1M1KT 3F44A 3JSMB 1GXLA 4Q44A 4DCPB 2YH1A 2RILA 1RWXB 2MY8A 1S6PA 1KOOA 2PEHA 5SUHA 2YNHB 3ADAC 3BSCA 2RDDA 2KKHA 4M5JA 1TELA 2MKHA 2RHSB 1Q7YT 1QAIA 1VS3A 1KSPA 1KVJA 4P52A 1RTJA 3M9OB 1CSJA 1S6OA 1ZYQA 1FVSA 3M8YA 1A0OB 2GA7A 1I5OB 3NXZA 2KRBA 4WIQA 3KLHA 4CO1A 5L9XA 2UXBF 2F9DA 1VMBA 3RB6A 1XEZA 1V5IB 4M5GA 3GIRA 4I7FA 4B3SF 3MM8B 5HAOA 3IM9A 5F8JA 2QSWA 2CPIA 1SV5A 4USIA 1RHJB 4EZ6A 3J7Z5 5IC6B 5L46A 1YRUA 2N3OA 4RW7B 2O3DA 2AYMA 1P9QC 4I2PA 5HL7Q 1SC3B 4ENOA 1EQ0A 5IWAJ 2NUHA 4O0IA 1W2IA 2DNYA 3Q83A 1Y3KA 5I42A 4KGVB 1IN0A 4ZLNA 4C48A 4NRUA 3GYXB 3LWMA 2C2RA 4ZVRB 2VFVA 4YDDB 3GCWP 4TQSA 4IFVA 3QSYB 1MWZA 4LSNA 3W7BA 1H2TZ 3UNYA 3ET6B 4X4RA 3Q8PB 3HHLD 1YIJS 1GTHA 4PPDA 4C3LA 1HMVA 4RBUA 3IG1B 2EVZA 4K4WA 1X9WA 5CZVA 5CABA 3Q8SB 1AT1B 2GVZA 3UDEA 2CNOB 3D6FB 4OZLA 4U8VA 1WKJA 4GVBA 3J7YU 2LQJA 4JV2A 3SI8A 4I68A 3EZUA 4FYDA 1SCJB 1FDDA 1C0TB 1HR0J 1ZM2A 3MPWA 1CS4A 4UZBA 2ADCA 2R4FA 3CCSS 4EO8A 5AXKA 2VH7A 2HNYB 3EJMA 3FMWA 4YB7A 3G6XA 2V8VA 3GIJA 4HH0A 4C8LA 5KG6A 3H7HB 1N34J 3T19A 1NXIA 1IR2A 3DLJA 1RWUA 2XMVA 1I3OB 4M63A 1KN6A 2DD8S 2ZDOA 4WZMA 4Q8FA 2Y3YA 2B9XA 1N5VA 1IJFB 2LCWA 1FHTA 3CJSA 1NJZA 4GVLA 2BVZA 4KHPJ 5IM0B 1S72S 1XC9A 3V6DA 4PEOA 2NYHA 3FRZA 2DGOA 1W7WA 2FQQB 2FYXA 4C8OA 2IHR1 4HT5A 2W25A 4EO6A 3MXHP 1RU1A 2V2QA 3GTYX 4OLPA 2QTWA 3GLJA 3QMQA 4OX6A 3HD2A 3HVRA 5HP1B 4RKUC 4OL8A 2ZBCA 3BQ0A 4PQUA 4NA1A 1IKYB 5KG5A 1TKTB 5HVGA 1IKVA 3TWZA 5LMNF 2BANB 5F41A 5KFAA 3GE9A 1GH8A 2JSXA 1N36F 2XY6A 1UTAA 2W9BA 3ILOA 2HIYA 3M1VA 1S10A 1B4SA 4LF4J 4CIOA 3PX4A 2FC9A 5C24A 2GIFA 3KUEA 1I51B 1AFIA 2YNFA 3RR8A 3M8PA 5DDQC 3T3FA 3IO1A 4OI3A 4OMFG 3DI6A 2YWFA 4ES3A 4DLGA 3K5NA 3R27A 2VONA 1JMTA 3DM2A 3RAQA 4KR0B 4ECSA 4GC7A 1FVQA 1D8ZA 3CEDA 1GNKA 1UFKA 3C6UA 2Y1LB 2HRTA 4O44B 2VC0A 2Q66A 1S4EA 2B6AA 2AIRB 1B0TA 1RADB 3US5A 3OL6A 3KLEB 2KTQA 3BN4A 3NCQA 4KYZA 4DF4A 5DZ7A 4DQIA 5HMXA 2R3VA 4LF6J 3W8PA 2D69A 3PTWA 2R2TA 2ADBA 2DNNA 4N8OA 1OYDA 1HWJA 1J5OB 1VBKA 1VQ4S 1LW2B 3MMBA 1XBWA 5KFWA 3OQ2A 5J2QA 5HLFB 4F0MA 5KAKA 4LF5J 3JB9k 2XNRA 1UEVA 3GV7B 2NZ4A 2XSJA 3THTA 2NS1B 2G2OA 4U9RA 1OY6A 4DL0C 5KT6A 3FCHA 4W92B 3I5AA 2BE9B 5B0AA 1Q53A 3VAIA 3GR1A 2YX1A 2HK2A 2WSEC 2WB1D 2B3TB 5CXTA 2E9TA 1DURA 3V81A 2ZM6F 2JZ5A 1L3VA 4B3MF 1SPBP 3BSAA 4LIRA 3MAQA 4N8NA 1QVGR 4B9LA 3GV8B 1GX6A 4DZDA 4NLYA 2VPZB 1U1MA 4QWBA 4ZPTR 1FE0A 4RZRA 2HZAA 2FZCB 3K17A 2C3MA 4WTOB 3KHRA 4Y2AA 2BKOA 2B8QA 1Q16B 1HQEB 1TK5A 5J2PA 1DBDA 5ETTA 3H4BA 3T5LA 2RRNA 4I56A 3NGUA 3HCXA 1VHFA 2E29A 1CJVB 3BBFA 1KVKA 4PUOA 3FBBA 3IBFB 4YMEA 1IXKA 3HSDA 3LP1B 4U67Q 1TL3B 3WC0A 3C15A 2UU9J 4J9OA 5DZ6A 2KU7A 1H7XA 4ZVUB 3NG8A 5F9NA 2NUUG 5FLXU 2EKYA 1WOSA 3HKZD 4DV7F 2EFOA 2BRKA 2OPPA 4M5DA 1VRQC 4J5OA 1BC6A 2EEYA 1PYOB 4LR9A 4IR9A 4PKDB 4C6AA 4X4TA 2XMAA 3F0NA 5JMNA 4QOTA 3HJVA 3DRSB 4QU7A 5KFYA 2ZE2A 4CDIA 3UQSA 4DQQA 3SFGA 4L3NA 3A4TA 5ETVA 3F73A 2ZC4A 2ZBIA 3HVTA 3OFFA 2MGZA 2VG5A 1RBLA 4LBIA 3TA2A 5DLGA 2MKJA 1REVA 3IA0A 1SIWB 3NWRA 2IDLA 4OLOA 1UVLA 2HHWA 4F36A 2AP6A 2C2EA 4O4RA 3K57A 2V8GA 4R5PA 3PX0A 4L6V3 5ETPA 2HURA 5ETOA 3Q22A 1NKBA 4JI2J 2MLXA 4F4AA 1NRKA 1Q8IA 1JLQA 2HQDA 2KJVA 3M2VB 4TVAB 1NSAA 4RX6A 5A8RA 2DIUA 1H38A 4C4WA 2FJAB 4A48A 3H20A 1Q1KA 4K59A 5CH7B 4CLKA 2CPFA 3VWSA 4G1IA 2AU0A 1HBNA 3ZXWA 1RT1B 4LFCJ 1BHNA 2WVEA 2V69A 2BW7A 2E7XA 1YVFA 1WSVA 4X4OA 2WBRA 3D6TB 4Y2IA 4KE5A 1UVKA 3BM7A 2BQRA 3UDLA 1T03A 1RTHA 3HM9A 2QJ3A 1RHKB 3JTOA 2UUAF 2W4PA 4ID5B 2FLOA 1TFYA 1TMJA 3GWCA 3OJUA 2BOPA 4M5KA 3CJKA 1LV5A 2DK2A 2I1RA 4F25A 2CZVC 3BZQA 5KT4A 4TLQA 3BDPA 2LVWA 1P8GA 2OTLS 5J1NA 4DL6A 3RBEA 5KFZA 1D3WA 5GAGU 5CYQB 1XN9A 1FJCA 3OXGA 1JIHA 1WJ9A 5KG3A 2J9DA 1SXLA 1U1OA 1T95A 5A0YB 4H4MB 1YGYA 2CVEA 1H6KX 2F4VF 2X7IA 2GQQA 1TVRB 2J0WA 4Q0BB 1YWXA 4IFYB 2VPWB 1Y5NB 1FRKA 1YLXA 1R0CB 3GYNA 5D4PA 4LBHA 2CQ1A 1WHVA 1LKZA 2MQQA 2UP1A 4YB6A 3TAQA 1YJRA 4M8LA 4RUCA 2V68A 3I9V9 5IV4A 1JWWA 2W2PP 2XQCA 3M8QA 4A46A 3GPAA 4UOFA 4IUFA 5A8WA 3KLFA 2ZNYA 2BM0A 2FHJD 3ZNJ1 1VHIA 1JLCB 5A8KA 2XMWA 2AGOA 4Y28C 4DN9A 2MKCA 4EBDA 1M1GA 5CA5A 1RU2A 3H0PA 1SH0A 4QWCA 1FJGJ 3FK4A 3QNWB 3TA1A 5J2NA 3DMJA 2YY3A 2XC9A 2KI2A 4IOCQ 2NXJA 2R8GA 2DNQA 2A3JA 4PXBA 1X5OA 3U7JA 2CQ3A 1Q8LA 3CW2C 3R9LA 3K5MA 4UZCA 4WP9A 2M52A 4B3TJ 3FQKA 3ZTQA 3MCOA 4NPOA 3DXSX 5KT7A 4LSLA 2UVUA 1FKAF 4NCGB 3EMTA 3V6HA 4ZVPB 2VFUA 2B7CB 4F4XA 2KYXA 2H5IB 2BKPA 4YUDA 1X0PA 1WD6A 5E7OB 1PYSB 4J91A 3KG0A 2BJ7A 1N5YA 1GMVA 1LFWA 2IAJA 4KT0C 4X4NA 3GYGA 5HATA 2MB0B 1P27B 3NWGA 3NAIA 4ECRA 2IM0A 2YNIA 3QLHA 4WF9Q 2FC8A 2ZD1A 2H54B 5KFNA 5LSRA 3TZYA 3A12A 4C2MA 3QT5A 1LQ9A 3THVA 1KBRA 2EG1A 3TQ1A 1N33F 3HP6A 1UAWA 5F8MA 3KJNB 1HW8A 1Z2ZA 2OP5A 2AT1B 3T5JA 2NZCA 4BCAA 3DYAB 1C0UB 1XK8A 5FJ4A 2MQ8A 4WFXA 3NEKA 2ROGA 3HK2A 3QFWA 2GGPB 2XO7A 1RT3B 4DV0J 4AQYJ 3UCUP 3DHWC 4OI6A 1M5VC 3U02A 3OTOF 4XDCA 1TQLA 2M3DA 3SXLA 4DCJB 1SL2A 3I4HX 4DI6A 2P2CB 3PIPQ 1YJNS 1JQGA 1RCXB 1D0EA 2CFXA 1TL1B 3VR1A 2X1GA 2R2SA 1YRXA 3PW2A 4DN0A 5AXMA 5AXNA 2DTJA 1DLOA 5G0RA 1TL4A 3KWMA 4DFJA 1Z2LA 1KWMA 2H1YA 2V8PA 3W63A 3W64A 2KJWA 5LXRA 2RF2B 2J6UA 2HGNA 3FJ2A 3KK2B 2E7VA 4M5HA 1R27B 3DLGB 3ULHA 2HHHF 2RRBA 5B0EA 3AY0A 2HVIA 4WU3A 4U7UD 3K2YA 2B5JB 2QA2A 1JKHB 1F9HA 2BEFA 5ETKA 2IMOA 1YJWS 1GMWD 5HBMB 3PM9A 2OFHX 3I0RB 2DY9A 1MMNA 3NS5A 4K5SA 3MOJB 3H40A 3A1YG 2XYHB 3UWTA 3C6TA 3UN3A 1GFWB 5C5JA 4B9VA 4RW8A 3BB5A 3RB3A 4I69A 5BJRA 3JSRA 3MEEA 1TV6B 2HW3A 1U25A 1WEZA 2VA3A 5KFIA 2GO8A 2C3OA 4NZ6A 3W3SA 5T7LA 1BLUA 2KZMA 3PRVA 4Q7AA 4F3QA 3KOAA
chains in the Genus database with same CATH topology
4JI6J 4HHUA 4DR1J 4PWWA 4LFAJ 4DV7J 5BR8J 4B3TJ 4X65J 4JI4J 1I94J 4B3RJ 4LFCJ 1N32J 4DR6J 2VQEJ 5A2QU 5LM7E 3IMQJ 4LF8J 4JI5J 4JI3J 4LFBJ 4KYZA 4KY3A 2HHHJ 4JI7J 2F4VJ 4JI1J 4JI0J 1IBKJ 4DR2J 4DV4J 1XMQJ 1N33J 2MQ8A 4X62J 2ZM6J 4LF6J 4B3MJ 4DR3J 4DV6J 4DV1J 2MTLA 4JYAJ 4K0KJ 2UUCJ 3D3CJ 2KL8A 1HR0J 4NEYA 5AJ3J 2UXDJ 3W1YC 4DUYJ 4DV0J 4AQYJ 2UXBJ 2UXCJ 4NEZA 3R2CJ 1HNWJ 2KVQE 5LMUJ 2VQFJ 2MEWA 3D3BJ 3T1YJ 4DV3J 2UUBJ 1XNQJ 4DUZJ 4V1Ak 1IBLJ 4DV5J 1J5EJ 4RJVA 4LF7J 4LF4J 4GKJJ 1HNZJ 1IBMJ 4B3SJ 5LMNJ 1N34J 4LF5J 3T1HJ 4OX9J 4JI2J 3J7AN 4JV5J 5IWAJ 2UU9J 4DR7J 1XNRJ 4GKKJ 1XMOJ 1FJGJ 4DR4J 4YHHJ 1N36J 2E5LJ 5FLXU 1HNXJ 3OTOJ 2UUAJ 4JI8J 3R2DJ 4DV2J 4X66J 4X64J 4NXMJ 3JAMU 4NXNJ 4LF9J 4YY3J 3J80U 4DR5J 4KHPJ 3J81U 5IT9U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 J;  4HHU A;  4DR1 J;  4PWW A;  4LFA J;  4DV7 J;  5BR8 J;  4B3T J;  4X65 J;  4JI4 J;  1I94 J;  4B3R J;  4LFC J;  1N32 J;  4DR6 J;  2VQE J;  5A2Q U;  5LM7 E;  3IMQ J;  4LF8 J;  4JI5 J;  4JI3 J;  4LFB J;  4KYZ A;  4KY3 A;  2HHH J;  4JI7 J;  2F4V J;  4JI1 J;  4JI0 J;  1IBK J;  4DR2 J;  4DV4 J;  1XMQ J;  1N33 J;  2MQ8 A;  4X62 J;  2ZM6 J;  4LF6 J;  4B3M J;  4DR3 J;  4DV6 J;  4DV1 J;  2MTL A;  4JYA J;  4K0K J;  2UUC J;  3D3C J;  2KL8 A;  1HR0 J;  4NEY A;  5AJ3 J;  2UXD J;  3W1Y C;  4DUY J;  4DV0 J;  4AQY J;  2UXB J;  2UXC J;  4NEZ A;  3R2C J;  1HNW J;  2KVQ E;  5LMU J;  2VQF J;  2MEW A;  3D3B J;  3T1Y J;  4DV3 J;  2UUB J;  1XNQ J;  4DUZ J;  4V1A k;  1IBL J;  4DV5 J;  1J5E J;  4RJV A;  4LF7 J;  4LF4 J;  4GKJ J;  1HNZ J;  1IBM J;  4B3S J;  5LMN J;  1N34 J;  4LF5 J;  3T1H J;  4OX9 J;  4JI2 J;  3J7A N;  4JV5 J;  5IWA J;  2UU9 J;  4DR7 J;  1XNR J;  4GKK J;  1XMO J;  1FJG J;  4DR4 J;  4YHH J;  1N36 J;  2E5L J;  5FLX U;  1HNX J;  3OTO J;  2UUA J;  4JI8 J;  3R2D J;  4DV2 J;  4X66 J;  4X64 J;  4NXM J;  3JAM U;  4NXN J;  4LF9 J;  4YY3 J;  3J80 U;  4DR5 J;  4KHP J;  3J81 U;  5IT9 U; 
#chains in the Genus database with same CATH topology
 2GVD B;  3EZO A;  4G1Q B;  2R7T A;  1VRT A;  1T05 B;  3R5D A;  4KRW A;  1AZS A;  3PV8 A;  3CJ5 A;  5FDL A;  4OYI A;  3I4P A;  1RWK B;  1RT7 A;  2ZDP A;  4OX8 A;  3VAJ A;  2YWW A;  5D15 A;  1RAG B;  1AUD A;  2HND A;  1D9F A;  1HD1 A;  5C25 B;  3OFE A;  4RUB A;  1U1R A;  2AYG A;  4OHY A;  2YKQ A;  3KG1 A;  1EAR A;  1EKR A;  1U02 A;  3P8B B;  4DU8 A;  2OJ3 A;  2L9D A;  2V63 A;  5KG7 A;  1MU2 A;  3PYG A;  3ZZ0 A;  2GNK A;  1WF2 A;  2GHW A;  1YQH A;  3LTO A;  4IG3 A;  2WW4 A;  3I0S B;  1VQM S;  4LF2 A;  2V0N A;  4O4G A;  5ETM A;  3ILL A;  1VQ6 S;  1SQF A;  3X3U A;  2N7Y A;  1UET A;  1RUS A;  5HSP A;  1SUQ A;  2CPH A;  4X66 J;  4XTT A;  2V94 A;  5F3T A;  2B7B B;  2HFS A;  1NSK L;  4DR5 J;  3N28 A;  1R0B G;  3VTI A;  1FTR A;  5J2M B;  1VC0 A;  5IT9 U;  5E41 A;  1EIY B;  4DS5 A;  1JXV A;  1RT6 A;  2DO4 A;  5IV3 A;  2QZ8 A;  1RT4 A;  4H4K A;  3ICL A;  2DB1 A;  5GAE U;  2G1H A;  2V4R A;  3OW2 R;  3VQT A;  3M8R A;  2IA6 A;  3SQG A;  1BQN B;  1U24 A;  3BKF A;  3KHL A;  2CQB A;  3P5T L;  3HXM A;  3M6U A;  3RRG A;  1XR5 A;  2P9E A;  3TNV A;  3PZP A;  2OPS B;  2EWH A;  1WG5 A;  3FEX B;  2ZOG A;  2LEB A;  4O23 A;  4EBE A;  1RT2 B;  4TY8 B;  4ZIT A;  4FBU A;  4CZC A;  2W7A A;  1NDL A;  2JC1 A;  3AOD A;  3FBF A;  5GAH U;  1HWI A;  3MZI A;  3TAM B;  2QRR A;  4RNN A;  4AYB D;  4QR0 A;  3R7S B;  3CCM S;  4QWE A;  4CLW A;  1VI7 A;  3MEG A;  3A3N B;  4FPI A;  2EC0 A;  2ZC3 A;  4HI2 A;  1ACM B;  4FXV A;  1VBY A;  3MUT P;  1SJR A;  2ZWP A;  4X64 F;  4DWI A;  1YG0 A;  4X4U A;  5H9F K;  5KG1 A;  1EP4 A;  1LWE B;  4RUA A;  3D6H B;  2WK4 A;  4UY8 5;  4J9N A;  3SEO A;  1PSD A;  3L3C A;  1TKX A;  5K8O A;  3FKB A;  4B9N A;  4DPW A;  4NCA A;  4JI4 J;  3JSB A;  1RYS A;  3D68 A;  2D3U A;  1RZM A;  2FLN A;  1FKP B;  1OQ3 A;  4HH1 A;  4CQ1 A;  1WSR A;  2BUN A;  1T9X A;  5A76 A;  4I4B A;  1VLO A;  3G6Y A;  2MKI A;  1FRI A;  3K8W A;  3KUG A;  4QBU A;  2CZ9 A;  3NLC A;  3DRP B;  3DKD A;  3HVA A;  1RGV A;  3CC4 S;  1RP5 A;  4NLR A;  4AT1 B;  2I0X A;  3DRR A;  1G7C B;  5I3U B;  2QC3 A;  2ZH4 A;  3PNI A;  3W1Y C;  3EXC X;  2BAC A;  5LMU J;  2MPU A;  5J1E A;  1GQE A;  2RUS A;  2YKP A;  4NLS A;  1LXN A;  4DV2 F;  3IWX A;  1PC4 A;  3AQP A;  1NLK L;  3H5S A;  2GJF A;  4DSF A;  1QE1 B;  1EET B;  3S6E A;  4I6A A;  1D9A A;  2MKS A;  2NXN A;  5HJX A;  4W98 A;  3FZB A;  2PEB A;  5E2Q A;  2HFU A;  2RQK A;  3VAM A;  1S5Z A;  1TKD A;  2XI2 A;  3KNA A;  3N4W A;  3CIM A;  4TU7 A;  3GJS B;  5M2P A;  2BBE A;  5AT1 B;  2R7R A;  3C14 A;  4Q43 A;  3H2V E;  4ED3 A;  4LF8 J;  3LAN A;  1AW0 A;  5JXS A;  1RWV B;  3Q2S C;  1VQO S;  1U1Q A;  2DGX A;  3VAL A;  3VGS A;  3MEC B;  2GML A;  2KYZ A;  1ZH5 A;  1FWK A;  1X4B A;  4TU8 A;  2RD5 C;  2KL8 A;  2C3U A;  1N0V C;  4P2X A;  3O8W A;  3R2C J;  1SQE A;  3LA0 A;  3QPI A;  2MJU A;  4NI2 A;  3QGP A;  2NR0 A;  3W61 A;  1UA0 A;  1UVJ A;  1HNZ J;  1HBM A;  3QID A;  2XCP A;  3FMB A;  3M2U B;  2KFN A;  4RWW A;  4D3H A;  3H2L A;  5DS7 A;  1PBA A;  2DNG A;  2J7K A;  3Q86 A;  3OVA A;  5D0E A;  2VJV A;  1KDN A;  2HHS A;  3R6G B;  3OTE A;  4F02 A;  5I42 B;  4P72 A;  3AOB A;  2OPQ B;  1BE4 A;  4Z37 A;  2UVR A;  3QIP B;  2DIT A;  2BE2 A;  4OX7 A;  3DLK A;  4FS2 A;  4LSN B;  2DHA A;  4M5L A;  1QSS A;  3W9J A;  2MZ1 A;  1U0H B;  4LRB A;  3HHL A;  4WCE Q;  1CJT B;  4EI2 A;  2HHH J;  4ECT A;  3O44 A;  5KFO A;  3LP0 A;  2KXN B;  2IC3 A;  2IA0 A;  3CCL S;  5EX0 A;  4KAI A;  4LRE A;  2BJ9 A;  2PE8 A;  3P3D A;  1UZH A;  1QAJ A;  4LUB A;  4FVC A;  3GON A;  3KJQ B;  3EGZ A;  2E44 A;  3OR1 B;  3T1Y J;  4IDK B;  2AW0 A;  1T02 A;  1TR0 A;  3MD3 A;  1VBZ A;  1CS4 B;  1U1P A;  3QJJ A;  4M94 A;  2J9E A;  2PDA A;  2QO3 A;  4FPR A;  4BBY A;  3KYL A;  5DDR C;  1IQZ A;  1A7G E;  3H25 A;  2C3P A;  1PAE X;  1FJE B;  4FXD A;  2DH7 A;  1SB6 A;  2QMX A;  4DR4 F;  2B51 A;  5L38 A;  5AXL A;  2GX8 A;  2FVC A;  3MUR P;  2X3G A;  1D8Y A;  3G71 S;  1WKK A;  3I87 A;  2ZIT A;  3TZZ A;  5D8H B;  4Y6I A;  3BR8 A;  5LJ5 Y;  1K44 A;  4E2F B;  1XR6 A;  2HHP A;  4MKA A;  4WE1 A;  2CDR B;  2VQF F;  2F4F A;  2YKN A;  2FJB B;  2UUB F;  3HD1 A;  3UVJ A;  2CJA A;  2CIM A;  3BO4 A;  4MAK A;  1S9G A;  2IRU A;  3KLG A;  1UW4 A;  3T1H F;  4UW2 A;  3SIP B;  2I9S A;  3QWU A;  2BYC A;  2XGP A;  3K0J A;  3G96 A;  4DV3 J;  2KN4 A;  1I1G A;  1N48 A;  2KB2 A;  2HMI A;  2V2Z A;  1WOR A;  3M1V B;  1G1X A;  1VOM A;  5BYR A;  4YHH J;  1NSQ A;  2WON A;  2WB4 A;  1WKL A;  5HMZ A;  2JX2 A;  2M8H A;  3KK3 B;  8RUC A;  1X31 C;  1UFL A;  4ZCI A;  3W2W B;  2ZZT A;  3HDS A;  1N5S A;  1TKZ A;  1KHV A;  3M9N B;  3QT8 A;  4XO0 A;  5C7P A;  4DUT A;  3OXL A;  5KT5 A;  4DR2 F;  1KOH A;  3GSI A;  4S0M A;  4TYA A;  3CJ8 A;  4K50 A;  2D41 A;  1PCA A;  4F8R A;  2FJV A;  1CJK A;  4PXD A;  4RW4 B;  4KV8 B;  3MM5 B;  1YZ6 A;  4X4V A;  3UN5 A;  1VRU B;  2AZ3 A;  3D1Q A;  2QSF A;  2U1A A;  2UV8 A;  5F8N A;  3T6B A;  4ED2 A;  3IBC B;  3HSZ A;  2PII A;  1WHY A;  2JVO A;  2V67 A;  2OD4 A;  1HW9 A;  4LR8 A;  3M6V A;  4OHZ A;  1WDD A;  4JV5 F;  4ZVS B;  1DQ9 A;  2QA4 S;  2G1D A;  3DLE A;  4ECZ A;  2PT0 A;  4PWD A;  4OZ0 A;  3E51 A;  4YS2 A;  4LRD A;  3B4D A;  1FF2 A;  3CO9 A;  4F4Z A;  4WPA A;  2HHX A;  2V4J A;  3R2D J;  3QZ7 A;  4X64 J;  2X1A A;  1DTT A;  1HNV A;  4FP9 A;  2FVS A;  4DMZ A;  3UPF A;  3NGK A;  5T14 A;  1N8R T;  1JLG A;  4WFZ A;  1U0S A;  2B4O A;  2MZR A;  4DLE A;  2CA9 A;  5AE1 A;  2HWT A;  4ICL B;  3CPW R;  4F2R A;  3CD6 S;  3TVK A;  2HQG A;  2KH9 A;  3LOU A;  3L9Z A;  4K4S A;  1EB0 A;  3HO1 A;  3N6L A;  4CT9 A;  5C42 B;  5DDP C;  2GZO A;  4ILL A;  2W8L A;  4DV4 J;  1RDR A;  2YWK A;  4NE9 C;  1PC5 A;  2DT9 A;  2HFV A;  1NJW A;  2BW2 A;  1UA1 A;  2ABY A;  2AYE A;  4QYZ K;  4MH8 A;  4EFA C;  3WX8 A;  4I6Y A;  4KBI A;  1YTY A;  2KVQ E;  5DQG A;  3B6B A;  5MAO A;  4WK3 A;  2OH2 A;  2VIC A;  5D4N A;  3IC1 A;  4HLB A;  2F8H A;  3CSK A;  4KJI A;  2QYC A;  3MOZ A;  4N56 A;  4QR2 A;  4CLL A;  3LUY A;  4CRJ A;  2AD9 A;  4L74 A;  1Q7L B;  4HAC B;  4CLS A;  3DHX A;  3HI9 A;  3TX8 A;  2GW8 A;  5KOW A;  1U7L A;  3CNQ P;  1R0A A;  1ICE B;  4WFN Q;  1YBU A;  2ASD A;  5CHC B;  5B0G A;  2B0G A;  4HT7 A;  4OHX A;  4GO7 X;  1S1T B;  2F1F A;  5E3A A;  3DDI A;  5CCM A;  1FNM A;  2KDO A;  2P5V A;  3TW0 A;  3MMA A;  1WC6 A;  1RHU B;  1U09 A;  2DH9 A;  2LXF A;  4NL5 A;  2L3M A;  3PW5 A;  2JEG A;  3IP0 A;  3M30 B;  2FVQ A;  2XMJ A;  5EHH A;  1J5E J;  2K7J A;  1DTQ B;  4V19 X;  3AQO A;  4YY3 F;  4NML A;  3MUV P;  2NXU A;  4ZPB A;  4P71 A;  3GJR B;  4ANC A;  2L9N A;  3RAM A;  3I5C A;  1KVI A;  4ZLJ A;  4O3P A;  3KHG A;  4F4Y A;  1Q82 T;  4NXM F;  2VQE F;  5D3G A;  1DFD A;  4WP8 A;  3PR5 B;  2P6S A;  5JUM A;  2DEI A;  4OQJ A;  1NDK A;  3VZH A;  5EN1 A;  2C22 A;  3M05 A;  4QU6 A;  2B4P A;  5D77 A;  1U26 A;  2BV3 A;  3B8H A;  4NZ7 A;  4FNH A;  5KFQ A;  3Q8Y A;  1NO8 A;  4DX8 H;  2CAD A;  1Z1Z A;  1HQU A;  2VA2 A;  4GRS A;  3KLI A;  3N5F A;  2IM2 A;  4A8F A;  1VIX A;  2WVC A;  5GAD U;  2FGO A;  4K2J A;  2Z30 B;  3ZNU A;  3OVS A;  2HAI A;  5HVH A;  2PN6 A;  2W24 A;  3D4J A;  1JX4 A;  3CVK A;  3FFI A;  3UR3 C;  1SKS A;  5F8L A;  4B3O B;  4DR4 J;  1YK9 A;  2ZJR Q;  4IH6 A;  3CIZ A;  4JP8 A;  1QY7 A;  1FO1 A;  4NA3 A;  4ZJL A;  1RTD A;  1JLA A;  4K5R A;  4JI1 F;  1T0T V;  1OPI A;  3HUL A;  3RBZ A;  4HDH A;  1S0O A;  4OZ5 A;  3M8W A;  2XLJ A;  2WSC C;  2XZT B;  2CJY B;  3OR2 B;  4B17 A;  4HHH A;  4DUY F;  3PKM A;  3AD7 C;  4DOZ A;  1V9O A;  1CUL B;  2H9Z A;  3OV7 A;  1O0P A;  3EE3 A;  2WOM A;  2BA9 A;  2KT5 A;  3FVY A;  2OEL A;  1HHT P;  4C97 A;  2NCK L;  3NAH A;  3AHP A;  1X4H A;  3ETO A;  4NYZ A;  4RUH A;  2MKY A;  1L3S A;  1FA0 A;  4ZS6 A;  4C11 A;  2A6M A;  1QSL A;  3TEG A;  1RAC B;  4KHR A;  3CME S;  1VQP S;  1FEH A;  3JXO A;  1L3T A;  1C1B B;  3ZZO A;  3J81 j;  2LQ8 A;  3SCK E;  3UN2 A;  5DJB A;  5J2N B;  1RWN B;  2ZUA A;  2XZW A;  4I2Q B;  2CDQ A;  2HSE B;  4HHU A;  2E9R X;  2IVF B;  2AMC B;  3PHE A;  5EDW A;  3DOL B;  4X65 F;  2BJ3 A;  1MRO A;  4L73 A;  2ZH8 A;  2ILY A;  3NCR A;  2XHC A;  4LRA A;  1UL3 A;  1NK5 A;  5KFE A;  2LEP A;  1RXO B;  1T94 A;  1YI2 S;  2R7U A;  3LPY A;  2AV5 A;  2Q1L A;  1X60 A;  1S1W B;  5IWA F;  4NLU A;  5H9E J;  6AT1 B;  4FDF A;  2NPF A;  2ZHB A;  4KTQ A;  1NKC A;  4DUZ J;  1HHS A;  4ZP8 A;  4PG8 A;  3L7U A;  2WW8 A;  3U1M A;  2C2K B;  2I5J B;  2DNK A;  2JEF A;  1NSP A;  3JSM A;  3MCS A;  2GIQ A;  3RJM B;  1HWU A;  1P1T A;  1Q4R A;  1B7F A;  2YNI B;  1JLE B;  3J80 U;  1UVM A;  4HI1 A;  2P9C A;  1SBR A;  2YNH A;  3L95 X;  3R97 A;  2N3L A;  1EJ7 L;  3NGR A;  4MKV A;  1FDB A;  5D4L A;  1CEZ A;  1FRL A;  2GC8 A;  1X4G A;  3W2V B;  2EG2 A;  1HR0 F;  2Q43 A;  3UDC A;  2DHG A;  1M0S A;  2DR7 A;  1F9E B;  2D3O R;  3IRW P;  3BH7 B;  3BQ2 A;  1TAQ A;  3GJQ B;  1CVJ A;  4M5M A;  3GZ7 A;  4F0H A;  1N34 F;  2UUC J;  2M88 A;  1N6Q B;  3C19 A;  2W9C A;  2AX0 A;  4ZVQ B;  4OZ2 A;  1Q0N A;  2W2M P;  2R7W A;  2AYB A;  2DGU A;  4IRC A;  3MM8 A;  1WF1 A;  4NYP A;  2K06 A;  4ELU A;  4WP3 A;  4ZVG A;  4ETZ A;  4KHP F;  2F5G A;  3ZZY A;  5GMD A;  4RW7 A;  2HLU A;  2H5J B;  1SH2 A;  1Q79 A;  4ED1 A;  3VHQ A;  5F0W A;  2EFG A;  3N0V A;  4QPT A;  1DLO B;  1KTQ A;  4CYU A;  2B43 A;  4KC5 A;  3IGN A;  4BLG A;  3CDW A;  1RAB B;  3ET6 A;  4DFP A;  1S1X B;  2AGQ A;  2RML A;  2M2B A;  3IG1 A;  1B99 A;  2HNZ B;  3BO2 A;  1PIE A;  1Y5I B;  4JI0 J;  3MR7 A;  3DNC A;  2CQC A;  2PMH A;  4ZVH A;  2ACY A;  4DBQ A;  4DV1 J;  3V4I B;  3D0H E;  3AJ2 A;  2QEX S;  3MPU B;  1OIA A;  2VDH A;  4URG A;  2IBK A;  1Y5L B;  4C0H A;  1U1L A;  1C0T A;  4U8Y A;  1GMW A;  1S1V B;  4ECV A;  1Q86 T;  2K7K A;  1Y0H A;  1NK0 A;  1NJX A;  2HNY A;  4NA2 A;  2JOQ A;  3G8Q A;  4CM0 A;  3LAL A;  2W4C A;  3J7A 1;  4ZP7 A;  1HNX J;  2ZH2 A;  4IOA Q;  3CF5 Q;  5DRK A;  4KQZ A;  4NXM J;  2DJW A;  2HVE A;  3BYP A;  5K8M A;  3MM7 B;  4W90 B;  3MMC B;  1L5U A;  3WBZ A;  4DSJ A;  1Y4Z B;  3H98 A;  1FKO B;  5IM0 A;  3Q89 A;  2RB7 A;  1UWB B;  2HVZ A;  4LF6 F;  5CYJ A;  3OLB A;  2A1B A;  4FYY B;  1VIS A;  4DDF A;  1XTZ A;  2JDJ A;  2LXI A;  1AZS B;  3U27 A;  4U7U K;  5FDL B;  2QLX A;  3TO8 A;  4UUW A;  3CMA S;  1UZD A;  7FDR A;  3ENQ A;  1MML A;  4RW6 B;  3C8Y A;  1L3U A;  5HP1 A;  4NLD A;  4LF5 F;  2ROE A;  3AFG A;  1IKY A;  2HQF A;  1TKT A;  3J7Y I;  2KT3 A;  2L48 A;  2Z2Y B;  3G8S A;  5I3Q A;  3QQC D;  3UR0 A;  1WWH A;  4HDG A;  3KLV A;  3B82 A;  4GKJ J;  2DGS A;  2DBB A;  3A3O B;  1SKU B;  2H48 B;  4P2F A;  3NGT A;  3U1N A;  1E6V B;  4JI8 J;  2F3J A;  3FEY B;  2JFD A;  4O3S A;  1KNZ A;  2QN6 B;  2KHC A;  2FUG 9;  3TUJ C;  1HI1 A;  2VKR A;  4DR1 J;  1FK9 B;  1D1U A;  3L7O A;  4FN5 A;  1S97 A;  1I6J A;  3O5T B;  3BV8 A;  4DL4 A;  2K2P A;  1RT6 B;  3EX7 B;  4X2B A;  1RT4 B;  4ZP9 A;  4JI3 J;  2FB0 A;  3KLE A;  3FCV A;  2C28 A;  3DOK A;  3GP9 A;  1RBO B;  1Y3J A;  4KO0 B;  5D6G A;  4DQS A;  2OTJ S;  1SVD A;  3SDE B;  1JNZ B;  4OJG A;  2UU9 F;  2P6T A;  1JNR B;  1UEK A;  1A6L A;  3W9H A;  4JUZ A;  3LGN A;  2W1B A;  4C3M A;  5L1L A;  1UVI A;  5K9F A;  1J27 A;  1J5O A;  3BH6 B;  1KS2 A;  1LW2 A;  1YIT S;  4RPF A;  2A6O A;  5HLF A;  3T41 A;  2Q3P A;  2CWX A;  1O5J A;  4J9R A;  2EK6 A;  3EVO A;  4ELT A;  1TL7 B;  2CNN B;  2PMZ D;  4RU9 A;  2CQ4 A;  3PKY A;  1TUG B;  1F2H A;  1FX2 A;  4MKB A;  5DGA A;  3M8Z A;  1SJQ A;  4O3N A;  1ZAX A;  2W2O P;  2R2R A;  4X65 J;  1YHQ S;  4DPU A;  3HF5 A;  1WF0 A;  4H4O B;  3KJV B;  5D78 A;  3BR9 A;  4NCB A;  4FF4 A;  4KY3 A;  2YNG B;  3GFH A;  5E3P A;  2NRE A;  4MIA A;  1GMU A;  4YR2 A;  5EUH A;  1KP6 A;  3MAA B;  3TI0 A;  3TAP A;  2Q6C A;  4J37 A;  1DY3 A;  4JI2 F;  2LLZ A;  3RB4 A;  3QAU A;  1RQ0 A;  1PBU A;  1WG1 A;  5IXU A;  1HQE A;  2AJF E;  1PYT A;  5J1E B;  2VG6 B;  3ZZR A;  3R6L B;  2XYG B;  1CJV A;  3OBI A;  4Y00 A;  4HEA 9;  3QO9 B;  2H51 B;  3PCO B;  4G1P A;  3VQS A;  3LP1 A;  2J6S A;  3ZTP A;  1TL3 A;  4JBC A;  1OO0 B;  4LFC F;  4WII A;  3S1T A;  2MLY A;  3OPK A;  2E1A A;  3H5U A;  1X4F A;  4FYW B;  1KQG B;  2RSQ A;  4YOE A;  2JC0 A;  1S99 A;  1U47 A;  4KFB A;  3UI3 A;  1N52 B;  1S0M A;  5LM7 E;  4PXC A;  3DRS A;  4ECY A;  5IT9 Y;  1F3F A;  5HI7 A;  4RL1 A;  2Z2Z A;  4ZPV R;  3RG6 A;  1W25 A;  4DG1 B;  3C14 B;  2R9L A;  1F5B A;  4TXS A;  1WTF A;  2EXU A;  1OQ6 A;  4MKY A;  4ZN1 A;  1BWV A;  1YJV A;  4EYI B;  2KXF A;  1YBA A;  4DL3 A;  1T3N A;  2POK A;  2DR9 A;  1IBL J;  4NLG A;  4OYB A;  1Y9O A;  3ENA A;  1VC5 A;  5I3P A;  4FYX B;  3G87 A;  1R3N A;  4QIV A;  1RT5 B;  4B9S A;  3AJD A;  2AJ2 A;  3CDE A;  4UOG A;  1IVZ A;  3E01 A;  4PPZ A;  4CO0 A;  1NK4 A;  4NXN J;  4FF2 A;  1N5T A;  1T8E A;  2DHX A;  3QZ8 A;  3M2V A;  3Q24 A;  2RS8 A;  1ELO A;  2LMI A;  4JI6 J;  1URN A;  3P6Y C;  2J76 E;  1MWQ A;  4J9M A;  4ZVT B;  2RU3 A;  1T9V A;  3RAX A;  1QDU B;  2GV1 A;  2GMH A;  1RT1 A;  4FF1 A;  4JI7 J;  2DNR A;  4OYM A;  4O3Q A;  3SZ2 A;  2N7C A;  2ZVS A;  3AOC A;  1NH7 A;  4X62 J;  4HTI A;  3G9C A;  3MD1 A;  1Q5Y A;  1NDC A;  3FC9 A;  3RGI A;  2DRB A;  1O8B A;  2EI5 A;  4WKR A;  1HFE L;  3BDE A;  4EZ9 A;  4DL2 A;  1XIQ A;  4USW A;  4XPC A;  1FJG F;  2JVR A;  1Y10 A;  1FES A;  3TA0 A;  4DFM A;  4OYZ A;  2RKI B;  2Y1I A;  4Y65 A;  2M8D B;  4I6W A;  3CD5 A;  3PYE A;  2Y1R I;  2F40 A;  1VQ5 S;  3IN5 A;  5J1P A;  3W65 A;  1VLY A;  2VOD A;  1RAI B;  4B3T F;  3FSI A;  2QL5 B;  3G6E S;  2V4Q A;  3PG9 A;  4ZVF A;  1VCT A;  2HHU A;  3NS7 B;  4CO2 A;  3I96 A;  3LO3 A;  5HJY A;  4V19 J;  4U96 A;  3E3X A;  1HPZ B;  5A0Y A;  3MHY A;  2BOA A;  2ERR A;  2M5Y A;  5SZT A;  1HHQ A;  2CG8 A;  1RTI B;  5HO4 A;  4Q0B A;  4IFY A;  5HN0 A;  2LU2 A;  3N6M A;  1VK8 A;  1LWC B;  4BWJ A;  1WEL A;  1AB8 A;  4WE1 B;  4ID8 A;  2ZVI A;  3WDO A;  2MY7 A;  1QJH A;  4QJV A;  4O3R A;  3SCL E;  3UVJ B;  4J7C A;  4USV A;  1NZA A;  1P9Y A;  3CD0 A;  1RSC A;  2FJX A;  5IQQ A;  4DX5 A;  3PX6 A;  5CYM B;  1JLC A;  2OGU A;  3K5O A;  1UMJ A;  1FER A;  2VU5 A;  1XMO J;  3UW1 A;  1CLF A;  3BBB A;  2IYI A;  3OHB A;  4CLF A;  1RKI A;  1R8B A;  5GAG I;  4YR0 A;  1SJF A;  3GFX A;  2F7V A;  2VDI A;  2DR8 A;  2CJ9 A;  1WEY A;  2DCU B;  3RR7 A;  5KFX A;  2MQP A;  4KGX B;  2KVI A;  1NDP A;  2ZEJ A;  2C2O B;  4DV0 F;  2OEJ A;  4AQY F;  2ALZ A;  1EQM A;  4IH5 A;  5F8H A;  3IRX B;  2AGP A;  2XHW A;  1EHW A;  2DVI A;  4NCG A;  5L1K A;  3H4D A;  1X9M A;  3IAM 9;  3QWP A;  3AT1 B;  6FD1 A;  1HYS B;  3KK1 B;  4MJK A;  1DAR A;  2AJ0 A;  2EC2 A;  1HL6 A;  2HWI A;  2GJ2 A;  5DG8 A;  1RAJ A;  3PFO A;  3K7R A;  2VV5 A;  1C4A A;  4C8Y A;  3P45 B;  5T41 A;  1WOO A;  2VOO A;  3VVT A;  4IRK A;  4ZPA A;  3TVZ A;  2MKK A;  2BR0 A;  5KFS A;  4UT4 A;  4KIA A;  3GMG A;  3LPE A;  1KD1 T;  1QM9 A;  1SL1 A;  2V4J B;  3KHH A;  4ECU A;  4NRT A;  1NM2 A;  1K47 A;  5KG2 A;  1DTT B;  4PWU A;  4QIG A;  2A10 A;  1FXL A;  3MFI A;  4LIW A;  4B9M A;  4CLZ A;  4TYB A;  4FZV A;  4KKO B;  2MZS A;  3IR5 B;  4B9U A;  1REG X;  7FD1 A;  4XDD A;  2DNH A;  3MEK A;  3IM8 A;  3C16 B;  5KFG A;  4O3O A;  2ZZM A;  3K59 A;  4RO0 A;  2O67 A;  5F3Z A;  3DYA A;  1KTV A;  1TFW A;  2QLB B;  3ETM A;  1OY8 A;  1GXT A;  2UXC J;  4LR7 A;  1Q78 A;  4WYW A;  3FRY A;  2ZKU A;  4I64 A;  2GGP A;  4NLO A;  2EKN A;  1RT3 A;  5BYS A;  1ARO P;  5K14 B;  2MJN A;  5GMK a;  2GIR A;  1UW9 A;  1F0X A;  1YBT A;  3P5B P;  3DRY A;  1WHX A;  4BC9 A;  2E5L J;  2X1F A;  5HRO B;  1KLN A;  1VQ8 S;  1BQX A;  1DHM A;  1TL1 A;  4RU2 A;  2EPI A;  4NWB A;  1NAQ A;  1K73 T;  1MN7 A;  2OPR B;  4WU2 A;  4DSL A;  4DXL A;  1KLM B;  4LFA J;  2XG8 A;  4OYW A;  2RHQ B;  4B3R J;  4ED7 A;  1IWG A;  1UKU A;  1VQY A;  2DNP A;  2NQP A;  1ROF A;  2XMK A;  2ZH9 A;  2ATC B;  3LAK A;  4KB7 A;  3KK2 A;  2C1E B;  3IGV A;  4DEZ A;  2NYI A;  2V8D A;  2HLT A;  4DX6 A;  4MFB A;  1UP1 A;  1H2V Z;  1FJ7 A;  4WZQ A;  4JYA F;  3KKF A;  1JLB B;  1B70 B;  3NKY A;  4ZHR B;  5AJ3 J;  3KDO A;  1DJ0 A;  1SKW A;  3M9M B;  2B5J A;  3EZ5 A;  4DPY A;  1JKH A;  2HQI A;  2KO1 A;  5HBM A;  3BSN A;  4X66 F;  2FY1 A;  4LF7 J;  1V3S A;  3TJ8 A;  3BBC A;  1ZA1 B;  3I0R A;  4DR5 F;  3DFE A;  4KGM A;  2HKE A;  2CKW A;  4IYQ A;  1NH8 A;  1LK5 A;  1DQ8 A;  3QGG A;  2YH0 A;  3ZC4 A;  2Z0G A;  4K4Z A;  3SV3 A;  4PG5 A;  3P96 A;  4K7Q A;  4ES2 A;  1FDN A;  1S9F A;  2VF3 A;  3MED B;  1ZM9 A;  4BHQ A;  2XY7 A;  4ZJQ A;  1IM4 A;  2DRA A;  2LA6 A;  4OI2 A;  5KTQ A;  2HHT A;  4F67 A;  4OZ3 A;  2QMW A;  3VGV A;  2KM8 C;  1RHM B;  3DU6 A;  2GVD A;  4G1Q A;  4J9P A;  2F8E X;  1ZET A;  4P10 A;  4PYD A;  2G0I A;  4X4S A;  1OJ4 A;  1B3T A;  4N5S A;  2YKA A;  2AEJ A;  1TAU A;  2J8S A;  4KSE B;  5B09 A;  1V3Z A;  4YFU A;  2ZH3 A;  2LFV A;  3MM6 B;  2VIH A;  1H7W A;  2VBX A;  3AXM A;  3CJ3 A;  3JQJ A;  3UFC X;  3DGP A;  2MQL A;  2F63 A;  4V1A k;  2R7V A;  3CUL A;  3I5B A;  4PYA A;  2VD3 A;  3I0S A;  2DIV A;  1LWF B;  4ZJO A;  1S4F A;  2YKM B;  1GX5 A;  4JI4 F;  2Z57 B;  2Z2M A;  2RIJ A;  2Z2L A;  4OYX A;  3JQM A;  1FCA A;  4XPE A;  1K9M T;  2HBZ B;  3LW5 C;  4CNY A;  3UO0 A;  5J2M A;  1I94 J;  3BJY A;  3RRH A;  2VOP A;  2J0X A;  1M90 T;  1MSW D;  3TYT A;  4QYR A;  4RNM A;  5ETS A;  4AD6 A;  5CCL A;  4LFB J;  2OML A;  2L08 A;  2CQP A;  4OV6 A;  1F1B B;  4ANE A;  3NMR A;  5LMU F;  3KFW X;  4LJM A;  1XMQ F;  1UPM B;  1S9E B;  3I56 S;  3GIM A;  1BQN A;  2XNQ A;  3FCW A;  3EGW B;  3PXG a;  4L75 A;  3R5B A;  3MTK A;  5IC4 B;  1VYA A;  1JLF B;  1FRH A;  2WOM B;  3I31 A;  2OPS A;  2B4U A;  3OVB A;  3CT9 A;  3DGV A;  1SC6 A;  1SKR A;  3M2R B;  1RT2 A;  4TY8 A;  4F2S A;  3G82 B;  1RLD A;  1MNE A;  5EX3 A;  2XY5 A;  3IXQ A;  4ZKA A;  3POT B;  1NJI T;  3R5J B;  2MQM A;  4RW9 B;  2V34 A;  3TAM A;  4ZA1 A;  2E66 A;  3CJ4 A;  4PAA A;  5E33 A;  3MPV A;  4LF8 F;  2ZWO A;  3KG4 A;  1T7P A;  2XBP A;  4X4P A;  1LW0 B;  3HT0 A;  4WK1 A;  2HWH A;  1LWE A;  5FII A;  3N5B A;  1JB0 C;  4RNH A;  4ZVE A;  4U6P A;  3TZX A;  2BDP A;  2RDI A;  3I6P A;  5GAE I;  1FKP A;  3FZ2 A;  3JYT B;  4A8Q A;  2IIH A;  4IOB A;  4Y34 A;  3GFZ A;  2QG9 B;  1U1N A;  1UWA A;  3M7V A;  4DV6 J;  2OIH A;  2MZT A;  1HNZ F;  4XIU A;  3FUY A;  2JNJ A;  2AZ1 A;  4Z2X A;  2CUY A;  3MGJ A;  3QGI A;  3QJP A;  3UD4 P;  1HNW J;  2G13 A;  1NK6 A;  4EWT A;  2NLW A;  7AT1 B;  1C1C B;  1QTM A;  5I3U A;  5KFC A;  1V5V A;  2BAB A;  4MK8 A;  4NX9 A;  5BYQ A;  4OZ1 A;  2ZHA A;  3BGR B;  3T5K A;  1HBU B;  5F9L A;  4DR7 J;  4R8U B;  1XNR J;  3R1L A;  1J2V A;  5GAH I;  1PGZ A;  3DN9 A;  2I6W A;  4ILR A;  2OSQ A;  1CQN A;  2FHO B;  2PSZ A;  5ETQ A;  2DKO B;  1QE1 A;  1EET A;  2C2Z B;  2J8A A;  1S49 A;  4CH1 A;  1F6T A;  5CD4 A;  1R31 A;  2ZH5 A;  2G0C A;  1KFS A;  3CJR A;  4A8S A;  1RA7 A;  2WTF A;  1R8A A;  1ZZF A;  4Q5V A;  1IKW B;  4JI5 J;  3OUY B;  1HNI A;  1IKX B;  4CTA A;  4DSI A;  3T1Y F;  3Q23 A;  3DCA A;  2YKO A;  4OHW A;  1YJ9 S;  2HIQ A;  2BJ8 A;  3G86 A;  2VAS A;  4GO5 X;  3MEC A;  1SL0 A;  5HMW A;  4PQA A;  4F4W A;  5CD4 H;  3J7Z T;  5LSO A;  2RAQ A;  4DV5 J;  1CC8 A;  2W9C B;  4EBC A;  3EPI A;  1KQK A;  1QLN A;  4DFK A;  4A8K A;  1IR0 A;  1ZM4 A;  2RU9 A;  4Q2M A;  5LJ3 Y;  4K2X A;  3WIV A;  3KUH A;  2VBZ A;  4YEA A;  5L39 A;  2DCL A;  2J0Q D;  1SC4 B;  2LKZ A;  4OV1 A;  1RAA B;  3ILJ A;  2R42 A;  4NZ0 A;  2APO A;  1MLA A;  3M2U A;  1NHV A;  4FKY A;  3TZW A;  3MR6 A;  4WTY A;  3GFY A;  3CJQ A;  2V5H G;  3FNN A;  2K1R B;  3LGH A;  3OD2 A;  3GR0 A;  2JHE A;  2YPY A;  3VAF A;  5U47 A;  4I1T A;  2F8M A;  2GJI A;  3EPG A;  1HBO B;  1NUE A;  1JJ4 A;  1N32 F;  3IS9 B;  2OPQ A;  5CZX A;  3QIP A;  4CYU B;  5ADZ A;  1GT8 A;  1U6F A;  3BGU A;  1CG2 A;  1RAH B;  5LOQ A;  4AXI A;  5KFT A;  2ASJ A;  4DV3 F;  3R5C A;  4FBT A;  1U0H A;  1S6Q B;  3CWJ A;  3KNG A;  4A47 A;  4BWM A;  1OS5 A;  1CJT A;  2J7W A;  4B02 A;  3T6J A;  4JYA J;  2G9O A;  3NBP B;  1VQ9 S;  4J9L A;  3M32 B;  2XWY A;  1YRT A;  4YHH F;  2WCX A;  3BPS P;  2O5D A;  2DEJ A;  3V6K A;  1U6B A;  2FLL A;  3OR1 A;  4QWA A;  2IM3 A;  4NLP A;  4IDK A;  2RE1 A;  3UE2 A;  4OX9 F;  1RHQ B;  3TUP A;  1DQA A;  5B0C A;  4M95 A;  2QYG A;  1UCN A;  4LF1 A;  1S1U B;  1IWA A;  1XQI A;  2KXH A;  4DSK A;  3A8K A;  2VG7 B;  4NLQ A;  3WQP A;  2DPI A;  3TUZ C;  4ZPW R;  3LF0 A;  4PG7 A;  4ELV A;  1UVN A;  1QD1 A;  3D5M A;  3J80 Y;  5BR8 F;  3AD8 C;  1P1L A;  3CUN A;  1WG4 A;  1PKU A;  4HR2 A;  3JTN A;  1R89 A;  4NLW A;  1HKA A;  3B54 A;  1NND A;  1ZM3 A;  4YN3 B;  2H4W B;  4KH1 B;  2QV6 A;  4PXE A;  3HSJ A;  3J81 Y;  3E8O A;  4CWB A;  4NEY A;  2UXD J;  4AL6 A;  4QIF A;  4C0B A;  5RUB A;  1YJU A;  4EYH B;  2MEW A;  1RWW B;  1XNQ J;  5EWE A;  3GQC A;  9ATC B;  4P7V A;  3SFU A;  2HK3 A;  4UQT A;  2ATL A;  2RJZ A;  4QR1 A;  3VZI A;  4TNO A;  2BQ3 A;  5IOL A;  2GAH C;  4GKK J;  2CNL B;  3KXD A;  4G6V B;  4LVN P;  2B9Y A;  3BRE A;  2FPH X;  1NK8 A;  4LF9 J;  2DY1 A;  4AXJ A;  5HQM A;  2IRX A;  3KMQ A;  2Z58 B;  2L9W A;  3RRK A;  2HVH A;  3KK3 A;  5D0G A;  1QAY A;  3W2W A;  4DV4 F;  3NCP A;  5E3C A;  1PAU B;  1E6Y B;  2W4D A;  4WBF A;  4CH0 S;  3MM9 B;  4X84 A;  1IR1 A;  2I38 A;  5DM6 Q;  4RW4 A;  4KV8 A;  1IBK J;  3MM5 A;  2CJK A;  3HHK A;  1XMQ J;  1CJU B;  1VQL S;  2HBQ B;  1VRU A;  3BEG B;  1WOP A;  3ITH B;  1NHK L;  1BWE A;  3NNH A;  2KG0 A;  1W26 A;  2HFZ A;  1TUV A;  2BRL A;  4QW8 A;  3DOK B;  5D0H A;  1FFW B;  4K4X A;  1SJ3 P;  4Y0F A;  2QA4 G;  1KC8 T;  1HQ2 A;  3RZA A;  1RA6 A;  2JRS A;  4UTG A;  2KM8 B;  2HS3 A;  1K1S A;  1S6P B;  3LP2 A;  1G6B A;  3PRB A;  2LA4 A;  2AX1 A;  4DSE A;  3V2U C;  3NRB A;  2XLI A;  2Y8Y A;  2JH3 A;  4F4K A;  5HMY A;  1T9Y A;  1NPP A;  1HWL A;  2ZBQ A;  5F0U A;  4AL7 A;  2D74 B;  4CH7 A;  2BKN A;  1RTJ B;  4IR1 A;  5KFH A;  2N4C A;  5DQH A;  3I82 A;  2HG4 A;  3KLH B;  2J9C A;  4DR6 J;  2FJE B;  4AE5 A;  4OYA A;  4ICL A;  5M2U A;  2XYP B;  4CLY A;  1ZBT A;  1VQS A;  1D9D A;  2XSF A;  2YQ1 A;  1NPK A;  4I7F B;  3QSI A;  5C42 A;  2QGF B;  3CTR A;  2ZUG A;  1AXQ A;  2QL7 B;  4CO5 A;  4DR3 J;  1J5E F;  2Z56 B;  1SV5 B;  2AEM A;  3PJX A;  2OD6 A;  3R3T A;  3AH6 A;  3CDB A;  3O1L A;  3TJ9 A;  2HEK A;  2IY5 B;  3VAK A;  1KEK A;  4I2P B;  1RIS A;  1K0T A;  3EXY A;  2R8K A;  1ZA2 B;  1H73 A;  2HPU A;  4CO4 A;  2FDN A;  1B64 A;  4CM2 A;  3F56 A;  4U95 A;  2XUL A;  1VQK S;  2ZHO A;  2XLK A;  1ZAV A;  3V5R A;  3D2W A;  4IFV B;  3RBD A;  3CCW A;  4OJ1 A;  5DO2 A;  1APS A;  2EW9 A;  1HMV B;  1S7I A;  4PAB A;  3IWN C;  3W62 A;  2BMB A;  5F8G A;  3HFV A;  4HAC A;  2GVZ B;  3FBE A;  2XM3 A;  4P75 A;  4H54 A;  4P9S A;  2ALY B;  1ZZN A;  3FDS A;  2YBV A;  4ZK7 M;  3KMS A;  4GVB B;  2HHQ A;  5CAA A;  5H9F J;  4J90 A;  2FD2 A;  4KFB B;  3NGD A;  4TN2 A;  4AUK A;  2E5I A;  2FVR A;  4NLX A;  3CCE S;  4PR6 A;  1M1H A;  3NS6 A;  2MHE A;  3D28 A;  1S1T A;  2K8G A;  4P73 A;  1BQM A;  4LRC A;  2UXB J;  1U2C A;  1IUJ A;  4ED5 A;  2QT7 A;  2EBG A;  3BPD A;  2WSF C;  2B56 A;  5EWF A;  4DPX A;  2WBM A;  3T9Z A;  4B3S J;  3M30 A;  2V50 A;  1H3D A;  2LDY A;  4L3K A;  2VB6 A;  1DTQ A;  2LU1 A;  3ISN D;  2EFV A;  1X9S A;  3V6D B;  3SQO P;  2NPI A;  3JAM U;  3BYR A;  3E01 B;  4QPX A;  4JV0 A;  3R5A A;  2AJ1 A;  1BMQ B;  1D09 B;  2OMO A;  2PO4 A;  1TK0 A;  4NLT A;  3RYL A;  1TP7 A;  4E0D A;  5ITH A;  1DZ5 A;  2VKZ G;  5JJB A;  2Q6B A;  1N32 J;  1XWL A;  4UST A;  4PQU B;  2DIS A;  2DRD A;  2FVP A;  1IKV B;  1ITP A;  2V2V A;  3C66 A;  4L76 A;  2PA3 A;  3W60 A;  2DGQ A;  2Q79 A;  2RQC A;  2XO6 A;  4ERD A;  1RTZ A;  3Q2T C;  3ZTO A;  1FDA A;  3FBC A;  2W9B B;  3MMJ A;  1N4L A;  5C24 B;  3M8S A;  3Q8U A;  1K1Q A;  2YNF B;  1S57 A;  1PJ5 A;  4QIE A;  3NP5 A;  3M8P B;  3TQE A;  1M5O C;  3DI6 B;  2FTR A;  3HHE A;  2FZK B;  4GC6 A;  4OX9 J;  4CI0 B;  2F65 A;  5HK4 A;  3DM2 B;  3MCN A;  3OXF A;  3OFH A;  2MHN A;  2V9W A;  3C6U B;  4CLP A;  3MFH A;  2WVB A;  3BGF A;  4RNO A;  5HVF A;  3SSQ A;  1VJQ A;  1BD6 A;  4B3O A;  2W01 A;  3CCT A;  3D6M B;  2B6A B;  5JVH Q;  2KRR A;  2AKW B;  1SIZ A;  3BKU A;  2WRM A;  3PYD A;  5BR8 J;  2OUG A;  4Y2K A;  3P49 B;  3C3L A;  3MAH A;  4WXO A;  3R7B B;  1F2G A;  3HPO A;  1LFP A;  4ECQ A;  3RBX A;  2E1P A;  4MIB A;  5BXI A;  3PVX A;  4F3M A;  3OR2 A;  2GO9 A;  4DUZ F;  1AUS L;  4DPT A;  1X0F A;  2YX7 A;  3D3C J;  3CDU A;  3MMB B;  1S0V A;  4LVO P;  3CCV S;  5DG7 A;  1U8S A;  5J2Q B;  1CUL A;  3D9B A;  3L7P A;  3PO4 A;  2PI5 A;  5DG9 A;  5KFB A;  1GAO A;  3HVW A;  1BY9 A;  2XSJ B;  5LMN J;  1WTB A;  2HAF A;  1ZPW X;  2F9J A;  2AHO B;  3PW4 A;  3M6X A;  4P2M A;  2VC1 A;  5GAD I;  1N36 J;  1ZS6 A;  3MR2 A;  4ILM A;  3L09 A;  4J9V A;  1M5K C;  1JJH A;  3CJT A;  4UOC A;  4Y2M A;  5KFU A;  2Y1J A;  2EFQ A;  3V81 B;  1JJ2 R;  1C1B A;  1SI9 A;  4PG4 A;  1Y7P A;  3O2I A;  2JEI A;  2WAQ D;  4YB5 A;  4I2Q A;  1X4D A;  2UUC F;  4N47 A;  3CCQ S;  3T9N A;  3DOL A;  4IG0 A;  3SYZ A;  3TAR A;  3R7N B;  3VAG A;  3UCG A;  1LEO A;  4IRD A;  4KGZ B;  4HKQ A;  2D3Z A;  2IFX A;  3HKW A;  5J2P B;  2J0S D;  3FQL A;  1ZTW A;  4DZ6 A;  4PUO B;  1T9W A;  3KDN A;  4WFA Q;  2MQN A;  4OI0 A;  3C15 B;  1S1W A;  2CPZ A;  5A2Q Y;  3A13 A;  1WI6 A;  2HYI B;  2H3E B;  2OPP B;  2BJE A;  3OT9 A;  4M5D B;  3R1H A;  5DET A;  2DR5 A;  2BQU A;  5KFP A;  3N01 A;  2I5J A;  2HRY A;  1OMS A;  4BDP A;  3R5G A;  4WWS A;  5HQ8 A;  2R7Q A;  4K4U A;  1CQM A;  2ZE2 B;  2XGQ A;  3PY8 A;  1FXD A;  4NMX A;  3K5P A;  2IVY A;  1JLE A;  4JI0 F;  3HVT B;  4U7C A;  1MG7 A;  2RQM A;  3MTJ A;  2VG5 B;  2MGZ B;  2B9W A;  2OHD A;  4DV1 F;  2ZKT A;  1U2F A;  3G4S S;  1REV B;  4IO9 Q;  2JLF A;  1X5T A;  2CXE A;  2R7O A;  3RW7 A;  1L3K A;  2QA1 A;  1QUV A;  4N77 A;  2JJ4 D;  4FNI A;  3W2V A;  4R5P B;  2ZM6 J;  1HI0 P;  4CO3 A;  4ZDN A;  4B3M J;  2YVS A;  1R7I A;  3W5Z A;  5E0O A;  2L41 A;  1YJT A;  5FD1 A;  2I8E A;  4H4K C;  2J9D E;  3OLA A;  5KFK A;  3DOM A;  1AA1 B;  4ETX A;  4LQ9 A;  4RR5 A;  4C9D A;  1HNX F;  1X5S A;  1N6Q A;  4UQG A;  3QBC A;  5M2R A;  2OI2 A;  3CMQ A;  1M5H A;  1JLQ B;  1RYR A;  1Q5V A;  2LEC A;  4OI1 A;  5A8R B;  4QIW D;  1NU4 A;  2V6A A;  2KT2 A;  1Y11 A;  2DGT A;  4R25 A;  4EU0 A;  1S59 A;  4MT1 A;  3OJS A;  2MDA A;  4PCQ A;  3GII A;  1HBN B;  1RAO A;  2YQ3 A;  4F26 A;  1BXN A;  3LWL A;  3PEH A;  4PG6 A;  4DV7 J;  3H5Y A;  2FIU A;  3I55 S;  2ASY A;  2QMU B;  4MIW A;  3ZTS A;  1VR6 A;  1UJ6 A;  2B8P A;  2VFT A;  2M9K A;  3PW0 A;  1T03 B;  4MMO A;  3TP2 A;  1RTH B;  1S1X A;  1N5Q A;  4QW9 A;  3U1L A;  1XER A;  4GKJ F;  2HNZ A;  2ASL A;  2VL1 A;  1RAE B;  4OIX A;  5ETR A;  2CVI A;  4MFB B;  4DHV A;  3SBM A;  5EWG A;  3KJF B;  3V4I A;  3MUM P;  3CJK B;  5AE3 A;  3RUB L;  4JI8 F;  1FEE A;  2CPX A;  4ZIW A;  4XAK A;  1FX4 A;  2XS5 A;  1NHU A;  3CO0 P;  1NK9 A;  3QT7 A;  1N54 B;  1YJ7 A;  3K5L A;  3B78 A;  4G3I A;  1HA1 A;  3PHT A;  1CPZ A;  3TVY A;  4QYZ J;  2P8I A;  4DCO B;  1S1V A;  4LRF A;  3HFK A;  2A2C A;  3ILI A;  4DR1 F;  5C2C A;  1X4E A;  2OEM A;  1HAR A;  1C4C A;  4KGK A;  3HJF A;  3G2X A;  4Q45 A;  2CQ2 A;  3SCJ E;  5ETL A;  2XMU A;  8ATC B;  5D4O A;  4JI3 F;  2DXD A;  3CCU S;  2VPX B;  3ISZ A;  3MR3 A;  4YP3 A;  2VPY B;  2Y8W A;  3MM7 A;  5IQ6 A;  4OJH A;  3OL8 A;  2PFD A;  3MMC A;  2X1B A;  1HD0 A;  1FNO A;  2FHM A;  1FKO A;  1V3R A;  1UWB A;  2MLZ A;  3LGM A;  2W9A A;  4P6Q A;  4Y2C A;  4LBP A;  4A8O A;  4F04 B;  3M8Q B;  3VV2 B;  4F3O A;  3I32 A;  5EGY A;  5A8W B;  3OTC A;  3TEH B;  3KLF B;  1RJJ A;  2WHO A;  2ZH7 A;  4GMK A;  1KQS R;  2H4Y B;  2FHJ A;  2HQ3 A;  5A8K B;  3DC2 A;  2IDE A;  4RW6 A;  3NNA A;  2DXE A;  3TUI C;  1JK9 B;  5IS2 A;  3N6N A;  2RNE A;  2MMY A;  2EBE A;  4RBV A;  4DQR A;  3DMJ B;  1G3O A;  5A6P A;  3DGP B;  1S12 A;  2PMW A;  3GB0 A;  2HQC A;  4OYP A;  1PJ6 A;  1LWX A;  4IH7 A;  2UUA J;  2CPJ A;  2HRU A;  4ED0 A;  1U6Z A;  2G2Z A;  3EGN A;  4K4Y A;  2OKQ A;  2IYG A;  3BO3 A;  2B9E A;  3W66 A;  2CJQ A;  1E6V A;  2DNZ A;  2CJX B;  2FJD B;  3BF4 A;  3MCM A;  4LSL B;  3MPD A;  1U45 A;  4B9T A;  1AFJ A;  2RRA A;  3PR4 A;  1KR4 A;  3EYZ A;  2M70 A;  2YWE A;  1FK9 A;  2BM1 A;  1IQT A;  1QAX A;  2F4V J;  2D3O 1;  2M7S A;  1UPP A;  2V8H A;  4Y3C A;  3DDN A;  4CLU A;  2MZJ A;  4WYL A;  1F3V A;  2W8K A;  1N5Y B;  3TOQ A;  3BN7 A;  3GG0 A;  3CCJ S;  4K0K F;  2IAJ B;  3PFE A;  3ZTR A;  4IKA A;  2JEJ A;  5KT2 A;  1GXU A;  1S48 A;  3D0G E;  4KO0 A;  2FLP A;  3HHL C;  3HMJ G;  3SDE A;  3DLB A;  3HHN B;  3QLH B;  1K0V A;  4OYO A;  3BGL A;  1LXJ A;  2ZD1 B;  2DO0 A;  2JFK A;  2J5A A;  1OYE A;  2RDJ A;  4K4T A;  2AF6 A;  3T5H A;  3Q8R B;  1WC1 A;  3MI7 X;  3FGV A;  2DXF A;  3CB4 A;  1NB2 A;  3HHD A;  3J81 U;  4UY8 T;  2UZA A;  5DDO C;  4EUV A;  5A6W A;  2O01 C;  1TL7 A;  1NCL A;  2E1M C;  4OHV A;  4DJB A;  4A8W A;  2VBY A;  4C3K A;  2YWG A;  1SJ1 A;  1S77 D;  2C2N A;  4I67 A;  5KOX A;  4ZLP A;  2D9P A;  1VFJ A;  3BKT A;  4N76 A;  1EAY C;  1KFD A;  3OL7 A;  4NAS A;  4H4O A;  3KJV A;  4UUX A;  2BX6 A;  3AB2 B;  1F60 B;  1FFG B;  1IBL F;  2YNG A;  3MDF A;  2MXY A;  2IBO A;  1NJY A;  5ETN A;  3GJT B;  2FHK A;  1KHW A;  5L1J A;  1RWM B;  4ZIV A;  2HBY B;  3MR5 A;  3MF5 A;  1VGY A;  3JSY A;  5E3R A;  4YB1 P;  2PA8 D;  3MAA A;  3GIK A;  2Y0S D;  1QSY A;  4ZVO B;  2VFR A;  4RJV A;  4X4Q A;  5KFV A;  1RWP B;  4NXN F;  3EDR B;  4DX7 A;  3SCI E;  4MYT A;  2XI3 A;  3HSG A;  3OSN A;  1GK8 A;  4F0K A;  4Z7C A;  5L8R C;  2Y9H A;  5G0R B;  4JI6 F;  1CC7 A;  3JS9 A;  2VG6 A;  1Y00 A;  2LDI A;  1X4A A;  4WJB A;  3QO9 A;  2UVW A;  1RI7 A;  2VZ9 A;  2OAU A;  2E1R A;  4JI7 F;  3D1O A;  5IT4 A;  3PJ9 A;  4X62 F;  2EFN A;  2CPE A;  1ZOT A;  1FXR A;  2HBR B;  1NZ8 A;  3HFZ B;  4UOH A;  4N7T A;  1VK3 A;  3OHA A;  1N33 J;  4ATN A;  1AYE A;  2IJN A;  3QAE A;  1HNI B;  2CPY A;  2D1C A;  4DG1 A;  2HFO A;  4CTA B;  4DS4 A;  2XMT A;  2QL9 B;  2ZOF A;  5C2G A;  2MYF A;  3D1H A;  3C6T B;  4EK2 A;  5MLC V;  1H0H B;  4RW8 B;  4HVZ A;  2RVJ A;  4ED6 A;  1FNX H;  4NOH A;  4FF3 A;  1TK8 A;  3MEE B;  1HI8 A;  1RWO B;  3LH2 S;  3FEZ A;  1OPZ A;  2COL A;  4HHJ A;  2UV8 G;  5LSL A;  3BGO P;  4P2S A;  2PI4 A;  3OTO J;  2MSS A;  4AL5 A;  5T7L B;  1RT5 A;  2D7S A;  2NSB A;  1G4C A;  1VRT B;  4QCL A;  4O0N A;  1K8A T;  4CT8 A;  1NBE B;  3VGU A;  3H8Y A;  4R0J A;  4WFB Q;  1OSD A;  4TKT A;  1HLW A;  2IJR A;  3ZZP A;  2GMJ A;  2CZ4 A;  1RT7 B;  2HGM A;  2HFN A;  3TJA A;  2E9Z A;  2HND B;  1VQ7 S;  2XTJ P;  4FYV B;  4LQ3 A;  3UD5 A;  1IM6 A;  5B08 A;  5KG0 A;  3S01 A;  2EK1 A;  3ENV A;  2DR6 A;  3ZO7 A;  1MN9 A;  4F7V A;  4BS2 A;  2BAN A;  4PZV A;  4OZJ A;  3R8Y A;  1MU2 B;  2KHD A;  2YXL A;  2UUT A;  4IG3 B;  1NK7 A;  2JLE A;  4NEZ A;  4ZCK A;  4O4G B;  1XMO F;  1Q8B A;  1YKW A;  4EGL A;  3D66 A;  2XEX A;  4YR3 A;  2VUG A;  3DRX A;  3S8S A;  1SUQ B;  1IBM F;  2NSC A;  2RKI A;  3CCZ A;  3WIU A;  4ITS A;  4CCH A;  3DXB A;  2CQH A;  2PD1 A;  4ZPC A;  1KON A;  4TQR A;  1H2U X;  1R8H A;  1M5P C;  3V4M A;  4O44 A;  3NY0 A;  1R43 A;  3ENW A;  3PAC A;  2VHG A;  1IJE B;  3A8E A;  3W8G A;  3EM1 A;  5HAN A;  3SQG B;  4CLT A;  1H98 A;  4DU7 A;  3GV5 B;  4RWX A;  4MK9 A;  1N0U A;  1DAX A;  2BXJ A;  1U2R A;  2QE5 A;  1HPZ A;  1TTH B;  1T9U A;  1T3O A;  3OTB A;  1RTI A;  1FWP A;  2OFG X;  1NEE A;  1LWC A;  1Q81 T;  4P7T A;  2ROP A;  1SC1 B;  4USU A;  5IFM A;  2C2D A;  1WEX A;  5L1I A;  3NL0 A;  1F5A A;  5DLF A;  3EVM A;  4M5I A;  4ED8 A;  3MEG B;  2ZJQ Q;  4A8M P;  3E2E A;  2DYA A;  2LP4 A;  1Z4U A;  2Y0B B;  3SSS A;  1F5C A;  2A0F B;  1EP4 B;  1ULR A;  5CYM A;  1X7V A;  1TKX B;  2E5J A;  4FS1 A;  3D54 A;  2KZZ A;  2R8J A;  1FD8 A;  3HZG A;  5K5M A;  3FSX A;  1LOU A;  4D3G A;  3DLH A;  1ZAW A;  2N4D A;  5K20 B;  3ISN C;  4ZP6 A;  5DQI A;  1TMM A;  2JLG A;  2ZJP Q;  2ILZ A;  2NXC A;  3OSP A;  2UXC F;  2GS8 A;  5B0D A;  3DRR B;  4WFY A;  1NPR A;  3QJL A;  2LEA A;  2E5G A;  2AWZ A;  3IRX A;  2DNM A;  2BZ2 A;  1NKE A;  4K0K J;  3PJW A;  1RKJ A;  1PJ7 A;  3WZ0 A;  1FTC A;  3H5X A;  1HYS A;  3AAW B;  3KK1 A;  2MQO A;  2E5L F;  4ZOS A;  1WI8 A;  2E1C A;  2ZFH A;  1EX8 A;  4K4V A;  3FSY A;  2SXL A;  3PO5 A;  2WZ1 A;  2RH3 A;  4USH A;  3QRP A;  1LK7 A;  4LFA F;  3LP2 B;  2X3D A;  3RU0 A;  4B3R F;  4OI4 A;  2QLJ B;  2HVD A;  4F50 A;  1PIL A;  2GQC A;  2PGC A;  4BC7 A;  1U48 A;  3C46 A;  1RE1 B;  3M4X A;  3CDA A;  3AJ1 A;  1SQG A;  3H90 A;  2XWX A;  2GHV C;  3RB0 A;  1XR7 A;  4C8Z A;  2AQ4 A;  4C7Q A;  1S0N A;  3IMQ J;  3H59 A;  2CNK B;  3UCZ P;  1PG5 B;  5AJ3 F;  4KH0 B;  2U2F A;  2XS2 A;  1WAC A;  4KKO A;  3QT6 A;  2IJF A;  4FVM A;  3SSR A;  4LF7 F;  1VC6 A;  1URR A;  3CJ2 A;  3H42 A;  4N41 A;  2CQI A;  5AE2 A;  2OEK A;  4PRF A;  2AEF A;  4NI2 B;  3PW7 A;  2FGC A;  3C16 A;  3KTQ A;  4ZCM A;  2RUG A;  1VDH A;  1PO6 A;  2Z8Q A;  1HBM B;  1FE4 A;  2XCA A;  3PEJ A;  1WHW A;  4NLV A;  2G4B A;  4A4J A;  2WVF A;  1VBX A;  4DQP A;  5LL6 d;  2CQG A;  2DGW A;  1HWK A;  5GVQ A;  4B08 A;  5K14 A;  1GTE A;  1TUW A;  3QFH A;  3NOC A;  5LT5 A;  2K3I A;  4DV2 J;  2DHS A;  4K8R A;  1FD2 A;  1YZ7 A;  1BGX T;  3Q0A A;  1R8C A;  2G0J A;  1B7Y B;  5HRO A;  3QGH A;  2BE2 B;  3ZZZ A;  3DLK B;  2R8H A;  3N9U C;  3HHL B;  1VQN S;  4KHM A;  2J7U A;  2OPR A;  5A2Q U;  1QTN B;  2V9K A;  1S7H A;  1KLM A;  3IR6 B;  3LP0 B;  2IC3 B;  2V2K A;  1RLC L;  2LQ5 A;  3I9Z A;  2W2N P;  4MTP A;  2PFF B;  2X51 A;  3AD9 C;  3OL9 A;  5L9N A;  1N88 A;  2CYY A;  2IVM A;  4ID5 A;  2WVD A;  1V6H A;  3IBW A;  1G2E A;  1H74 A;  5K8N A;  2VBW A;  1T11 A;  1JLB A;  3EWG A;  3ZFV A;  4OZN A;  4ZHR A;  2H65 B;  3Q8Q B;  1BQM B;  3BSO A;  4KPC A;  5KFR A;  2VFS A;  4C8M A;  2MZQ A;  3J7A N;  4LSZ B;  4CP5 A;  4TY9 A;  3AOA A;  5CYQ A;  3GCX P;  3BS9 A;  2LYV A;  3IWL A;  2AJ4 A;  1FT8 A;  2AJQ A;  4H4M A;  1I94 F;  3RTV A;  2CJB A;  1O6X A;  1TVR A;  4ZMM A;  3QRQ A;  3D0I E;  3AXK A;  4IQX A;  4USJ C;  1BUX A;  1UFW A;  2ZBP A;  2RS2 A;  4LFB F;  3Q8V A;  3K58 A;  3QYY A;  4HL9 A;  2ZH6 A;  3EGV A;  1S6U A;  3D7S B;  3MED A;  2QFI A;  3A8I A;  2YKN B;  1NME B;  3LQV A;  3OFG A;  1VIO A;  1U4B A;  5H9E K;  1Q8K A;  2H5E A;  1S9G B;  4FKX A;  3KLG B;  3AA9 A;  2KFZ A;  2C3Y A;  3K89 A;  4QWD A;  3DDK A;  3PDN A;  3JTP A;  2YWH A;  2HZC A;  3M6W A;  4IO1 A;  3W5X A;  2HMI B;  1EKS A;  1RAF B;  4ECX A;  2YQ0 A;  5CQG A;  3MM6 A;  2HHV A;  3HX9 A;  4JOU A;  1DRZ A;  2E5H A;  1IBM J;  2WON B;  2BE7 D;  1RCO B;  3O3L A;  2B4V A;  1SH3 A;  3GIL A;  1FI4 A;  5B7W A;  5KFM A;  1TKZ B;  3VVU A;  3ZZT A;  4MYU A;  1LWF A;  4ALZ A;  2YKM A;  2R2U A;  2XB2 D;  3EVW A;  4P74 A;  1CJK B;  3PRD A;  2FJW A;  1WDT A;  2ZOM A;  1TU0 B;  2M4M A;  5D0R A;  1JJC B;  4DV6 F;  3DU5 A;  4L72 B;  2C2M B;  1WC0 A;  1TZ0 A;  3VAH A;  3CE8 A;  2HGL A;  5FLX Y;  1HNW F;  2W7O A;  3G8T A;  4C8N A;  4AND A;  3VF0 B;  3PYF A;  1KKH A;  1JXE A;  3DLE B;  1RBA A;  3WC2 A;  4PWD B;  4E8U A;  4DR7 F;  1XNR F;  3EUN A;  3TX0 A;  3CCR S;  2VQF J;  4Q8E A;  2R7X A;  1S9E A;  2UUB J;  1O51 A;  2RT3 A;  3TAN A;  2OLW A;  4XK8 C;  3SV4 A;  3L4B C;  1JLF A;  2R8I A;  1B0P A;  2M0G B;  4I0W A;  3T1H J;  5JVG Q;  1HNV B;  2YX4 A;  2J6T A;  5HQL A;  4CNZ A;  3M2R A;  3H2U B;  1JLG B;  3G82 A;  4J9U E;  2DGV A;  2FZG B;  2GQ2 A;  2DNL A;  3POT A;  2LQ9 A;  4RW9 A;  1FFS B;  3WX4 A;  1U8W A;  4JI5 F;  9RUB A;  3K8V A;  2ZH1 A;  2Z4P A;  4PWW A;  1Q95 G;  5IZH A;  3JAM Y;  2NXE A;  1FRM A;  1MW7 A;  4NYO A;  2CRL A;  1UJ5 A;  1LW0 A;  1C0U A;  3C2P A;  1FRJ A;  4DR2 J;  2LXU A;  2KFY A;  3GSD A;  4IG0 B;  4DV5 F;  1KRP A;  2JWN A;  3WHI A;  3JYT A;  1U49 A;  4HTJ A;  2HS4 A;  2CWK A;  4Q2L A;  2GCF A;  2OSR A;  4TLR A;  1A9N B;  3B4M A;  4A8X A;  5K8P A;  1RHR B;  4R0E A;  5KG4 A;  1CBK A;  1UJ4 A;  2QIF A;  5G4D A;  1C1C A;  4JV5 J;  3G6V A;  5GME A;  2QLF B;  1C2P A;  2E7W A;  3BGR A;  1HBU A;  2LQB A;  4R8U A;  3SMZ A;  4E98 A;  2RF2 A;  2HZV A;  4DL5 A;  4RBT A;  1R0A B;  1OSC A;  1S76 D;  4C0O C;  1QVF R;  4EEY A;  1QUP A;  2A18 A;  1OWX A;  3DLG A;  3A8J A;  3X1L B;  1RB0 A;  3D67 A;  5E5N A;  1XJW B;  4OFZ A;  1YX2 A;  3UNG C;  1XMB A;  3MMA B;  4WXW A;  4ES1 A;  2W7P A;  1HIY A;  3CXC R;  1IKW A;  2ZZN A;  3CD7 A;  3OUY A;  1P6T A;  4QQB A;  2W2Q P;  5DGB A;  1IKX A;  2MTL A;  4DF8 A;  5KFD A;  3NGS A;  4M1K A;  4UF4 A;  3QAT A;  4USM A;  3THP A;  1X8D A;  3P4U B;  5B0B A;  2PC6 A;  2GHP A;  1R6V A;  2YPZ A;  4RNF A;  2GFF A;  3DOM B;  3GG1 A;  3EDQ B;  2XZD B;  4WKY A;  1WC4 A;  3CJ0 A;  1SJ4 P;  3V6J A;  1TV6 A;  5D3G B;  2IM1 A;  3BQ1 A;  1F9F A;  3UDV A;  2ACM A;  5B0F A;  3MPY A;  1T05 A;  2I2Y A;  1B0V A;  1U1K A;  4LT6 A;  1T9T A;  1YSJ A;  1WC5 A;  2R7S A;  1GEH A;  2OO4 A;  4RLE A;  2ZBR A;  4IQM A;  2O66 A;  4AFF A;  3N79 A;  1VJW A;  2K1R A;  4G65 A;  5C25 A;  2UXD F;  4ECW A;  5I4M A;  1HBO A;  2DH8 A;  3IS9 A;  2IPO B;  4YQW A;  1XNQ F;  1HQU B;  5LXY A;  2CG4 A;  2DNO A;  4M5N A;  1N56 A;  6FDR A;  3KLI B;  1EZZ B;  4J9Q A;  2GAG C;  1YDL A;  2QLW A;  1S6Q A;  5IT0 A;  4ED4 A;  4GKK F;  2BJD A;  2G2Y A;  2N82 B;  3IAS 9;  3OTD A;  3NBP A;  3VCD A;  4QZV B;  3M32 A;  3FFI B;  3QRR A;  4LF9 F;  2CQD A;  4LF4 F;  3VGT A;  2MST A;  2D9O A;  3NMA A;  2HS0 A;  4ZN3 A;  1ZPV A;  2DPJ A;  1R6Y A;  2CQ0 A;  1FRX A;  4DPO A;  2A2D A;  5THW A;  3O6Q A;  1RTD B;  3NNC A;  3AA8 A;  3NOG A;  4FXW A;  4YY3 J;  1JLA B;  2KG1 A;  3UD3 P;  5H1S V;  3RW6 A;  1WC3 A;  2RQ4 A;  1MMD A;  1S1U A;  4W4M A;  2VJU A;  4TU9 A;  2JL9 A;  1IBK F;  5KFL A;  1R8P A;  2VG7 A;  1FWL A;  4YDX A;  2VQE J;  1MWY A;  2QFJ A;  2QX0 A;  5KT3 A;  4JB8 B;  2ZNZ A;  4HYK A;  3CGI A;  3T1A A;  4OJ3 A;  3DLL Q;  1IBC B;  3F41 A;  1OY9 A;  1WNE A;  4ER8 A;  3GU0 A;  4JV1 A;  2CAJ A;  2P9G A;  3PIO Q;  3A3P B;  3HZE A;  3ELH A;  3D3B J;  8AT1 B;  1RK8 A;  2BJ1 A;  2FY8 A;  3EIC A;  4C11 B;  3LAM A;  4ZCL A;  1UEU A;  3TRG A;  1NB7 A;  3IR7 B;  4MK7 A;  3ONQ A;  4ZPD A;  4LMZ A;  1KQF B;  3HT3 A;  2K3K A;  1W2B R;  4ZLL A;  4URQ U;  3ZZU A;  5KFJ A;  4DR6 F;  2IMW P;  4DL7 A;  2UUW A;  3AB4 B;  4URS A;  1S79 A;  1MRO B;  3CC7 S;  3W9I A;  2CPD A;  2YTC A;  4C98 A;  4DR3 F;  1X4C A;  3DRP A;  1X5P A;  2O1P A;  3TR5 A;  2EFP A;  5E3Q A;  3IFE A;  4USK A;  4Z7Y A;  1E6Y A;  4KPY A;  4JI1 J;  5DM7 Q;  1LNQ A;  1JXL A;  3S7R A;  3W5Y A;  3MM9 A;  4C8K A;  2C42 A;  2UVV A;  1ZTT A;  4J9K A;  3HLU A;  2IRY A;  2DHH A;  4EMD A;  1M5S A;  3JQK A;  1TL5 A;  5F8I A;  3MWB A;  1WUU A;  1CJU A;  4DUY J;  3ITH A;  3CC2 S;  2XMM A;  4A8Y A;  2XS7 A;  5KFF A;  4J9S A;  1H72 C;  1M1K T;  3F44 A;  3JSM B;  1GXL A;  4Q44 A;  4DCP B;  2YH1 A;  2RIL A;  1RWX B;  2MY8 A;  1S6P A;  1KOO A;  2PEH A;  5SUH A;  2YNH B;  3ADA C;  3BSC A;  2RDD A;  2KKH A;  4M5J A;  1TEL A;  2MKH A;  2RHS B;  1Q7Y T;  1QAI A;  1VS3 A;  1KSP A;  1KVJ A;  4P52 A;  1RTJ A;  3M9O B;  1CSJ A;  1S6O A;  1ZYQ A;  1FVS A;  3M8Y A;  1A0O B;  2GA7 A;  1I5O B;  3NXZ A;  2KRB A;  4WIQ A;  3KLH A;  4CO1 A;  5L9X A;  2UXB F;  2F9D A;  1VMB A;  3RB6 A;  1XEZ A;  1V5I B;  4M5G A;  3GIR A;  4I7F A;  4B3S F;  3MM8 B;  5HAO A;  3IM9 A;  5F8J A;  2QSW A;  2CPI A;  1SV5 A;  4USI A;  1RHJ B;  4EZ6 A;  3J7Z 5;  5IC6 B;  5L46 A;  1YRU A;  2N3O A;  4RW7 B;  2O3D A;  2AYM A;  1P9Q C;  4I2P A;  5HL7 Q;  1SC3 B;  4ENO A;  1EQ0 A;  5IWA J;  2NUH A;  4O0I A;  1W2I A;  2DNY A;  3Q83 A;  1Y3K A;  5I42 A;  4KGV B;  1IN0 A;  4ZLN A;  4C48 A;  4NRU A;  3GYX B;  3LWM A;  2C2R A;  4ZVR B;  2VFV A;  4YDD B;  3GCW P;  4TQS A;  4IFV A;  3QSY B;  1MWZ A;  4LSN A;  3W7B A;  1H2T Z;  3UNY A;  3ET6 B;  4X4R A;  3Q8P B;  3HHL D;  1YIJ S;  1GTH A;  4PPD A;  4C3L A;  1HMV A;  4RBU A;  3IG1 B;  2EVZ A;  4K4W A;  1X9W A;  5CZV A;  5CAB A;  3Q8S B;  1AT1 B;  2GVZ A;  3UDE A;  2CNO B;  3D6F B;  4OZL A;  4U8V A;  1WKJ A;  4GVB A;  3J7Y U;  2LQJ A;  4JV2 A;  3SI8 A;  4I68 A;  3EZU A;  4FYD A;  1SCJ B;  1FDD A;  1C0T B;  1HR0 J;  1ZM2 A;  3MPW A;  1CS4 A;  4UZB A;  2ADC A;  2R4F A;  3CCS S;  4EO8 A;  5AXK A;  2VH7 A;  2HNY B;  3EJM A;  3FMW A;  4YB7 A;  3G6X A;  2V8V A;  3GIJ A;  4HH0 A;  4C8L A;  5KG6 A;  3H7H B;  1N34 J;  3T19 A;  1NXI A;  1IR2 A;  3DLJ A;  1RWU A;  2XMV A;  1I3O B;  4M63 A;  1KN6 A;  2DD8 S;  2ZDO A;  4WZM A;  4Q8F A;  2Y3Y A;  2B9X A;  1N5V A;  1IJF B;  2LCW A;  1FHT A;  3CJS A;  1NJZ A;  4GVL A;  2BVZ A;  4KHP J;  5IM0 B;  1S72 S;  1XC9 A;  3V6D A;  4PEO A;  2NYH A;  3FRZ A;  2DGO A;  1W7W A;  2FQQ B;  2FYX A;  4C8O A;  2IHR 1;  4HT5 A;  2W25 A;  4EO6 A;  3MXH P;  1RU1 A;  2V2Q A;  3GTY X;  4OLP A;  2QTW A;  3GLJ A;  3QMQ A;  4OX6 A;  3HD2 A;  3HVR A;  5HP1 B;  4RKU C;  4OL8 A;  2ZBC A;  3BQ0 A;  4PQU A;  4NA1 A;  1IKY B;  5KG5 A;  1TKT B;  5HVG A;  1IKV A;  3TWZ A;  5LMN F;  2BAN B;  5F41 A;  5KFA A;  3GE9 A;  1GH8 A;  2JSX A;  1N36 F;  2XY6 A;  1UTA A;  2W9B A;  3ILO A;  2HIY A;  3M1V A;  1S10 A;  1B4S A;  4LF4 J;  4CIO A;  3PX4 A;  2FC9 A;  5C24 A;  2GIF A;  3KUE A;  1I51 B;  1AFI A;  2YNF A;  3RR8 A;  3M8P A;  5DDQ C;  3T3F A;  3IO1 A;  4OI3 A;  4OMF G;  3DI6 A;  2YWF A;  4ES3 A;  4DLG A;  3K5N A;  3R27 A;  2VON A;  1JMT A;  3DM2 A;  3RAQ A;  4KR0 B;  4ECS A;  4GC7 A;  1FVQ A;  1D8Z A;  3CED A;  1GNK A;  1UFK A;  3C6U A;  2Y1L B;  2HRT A;  4O44 B;  2VC0 A;  2Q66 A;  1S4E A;  2B6A A;  2AIR B;  1B0T A;  1RAD B;  3US5 A;  3OL6 A;  3KLE B;  2KTQ A;  3BN4 A;  3NCQ A;  4KYZ A;  4DF4 A;  5DZ7 A;  4DQI A;  5HMX A;  2R3V A;  4LF6 J;  3W8P A;  2D69 A;  3PTW A;  2R2T A;  2ADB A;  2DNN A;  4N8O A;  1OYD A;  1HWJ A;  1J5O B;  1VBK A;  1VQ4 S;  1LW2 B;  3MMB A;  1XBW A;  5KFW A;  3OQ2 A;  5J2Q A;  5HLF B;  4F0M A;  5KAK A;  4LF5 J;  3JB9 k;  2XNR A;  1UEV A;  3GV7 B;  2NZ4 A;  2XSJ A;  3THT A;  2NS1 B;  2G2O A;  4U9R A;  1OY6 A;  4DL0 C;  5KT6 A;  3FCH A;  4W92 B;  3I5A A;  2BE9 B;  5B0A A;  1Q53 A;  3VAI A;  3GR1 A;  2YX1 A;  2HK2 A;  2WSE C;  2WB1 D;  2B3T B;  5CXT A;  2E9T A;  1DUR A;  3V81 A;  2ZM6 F;  2JZ5 A;  1L3V A;  4B3M F;  1SPB P;  3BSA A;  4LIR A;  3MAQ A;  4N8N A;  1QVG R;  4B9L A;  3GV8 B;  1GX6 A;  4DZD A;  4NLY A;  2VPZ B;  1U1M A;  4QWB A;  4ZPT R;  1FE0 A;  4RZR A;  2HZA A;  2FZC B;  3K17 A;  2C3M A;  4WTO B;  3KHR A;  4Y2A A;  2BKO A;  2B8Q A;  1Q16 B;  1HQE B;  1TK5 A;  5J2P A;  1DBD A;  5ETT A;  3H4B A;  3T5L A;  2RRN A;  4I56 A;  3NGU A;  3HCX A;  1VHF A;  2E29 A;  1CJV B;  3BBF A;  1KVK A;  4PUO A;  3FBB A;  3IBF B;  4YME A;  1IXK A;  3HSD A;  3LP1 B;  4U67 Q;  1TL3 B;  3WC0 A;  3C15 A;  2UU9 J;  4J9O A;  5DZ6 A;  2KU7 A;  1H7X A;  4ZVU B;  3NG8 A;  5F9N A;  2NUU G;  5FLX U;  2EKY A;  1WOS A;  3HKZ D;  4DV7 F;  2EFO A;  2BRK A;  2OPP A;  4M5D A;  1VRQ C;  4J5O A;  1BC6 A;  2EEY A;  1PYO B;  4LR9 A;  4IR9 A;  4PKD B;  4C6A A;  4X4T A;  2XMA A;  3F0N A;  5JMN A;  4QOT A;  3HJV A;  3DRS B;  4QU7 A;  5KFY A;  2ZE2 A;  4CDI A;  3UQS A;  4DQQ A;  3SFG A;  4L3N A;  3A4T A;  5ETV A;  3F73 A;  2ZC4 A;  2ZBI A;  3HVT A;  3OFF A;  2MGZ A;  2VG5 A;  1RBL A;  4LBI A;  3TA2 A;  5DLG A;  2MKJ A;  1REV A;  3IA0 A;  1SIW B;  3NWR A;  2IDL A;  4OLO A;  1UVL A;  2HHW A;  4F36 A;  2AP6 A;  2C2E A;  4O4R A;  3K57 A;  2V8G A;  4R5P A;  3PX0 A;  4L6V 3;  5ETP A;  2HUR A;  5ETO A;  3Q22 A;  1NKB A;  4JI2 J;  2MLX A;  4F4A A;  1NRK A;  1Q8I A;  1JLQ A;  2HQD A;  2KJV A;  3M2V B;  4TVA B;  1NSA A;  4RX6 A;  5A8R A;  2DIU A;  1H38 A;  4C4W A;  2FJA B;  4A48 A;  3H20 A;  1Q1K A;  4K59 A;  5CH7 B;  4CLK A;  2CPF A;  3VWS A;  4G1I A;  2AU0 A;  1HBN A;  3ZXW A;  1RT1 B;  4LFC J;  1BHN A;  2WVE A;  2V69 A;  2BW7 A;  2E7X A;  1YVF A;  1WSV A;  4X4O A;  2WBR A;  3D6T B;  4Y2I A;  4KE5 A;  1UVK A;  3BM7 A;  2BQR A;  3UDL A;  1T03 A;  1RTH A;  3HM9 A;  2QJ3 A;  1RHK B;  3JTO A;  2UUA F;  2W4P A;  4ID5 B;  2FLO A;  1TFY A;  1TMJ A;  3GWC A;  3OJU A;  2BOP A;  4M5K A;  3CJK A;  1LV5 A;  2DK2 A;  2I1R A;  4F25 A;  2CZV C;  3BZQ A;  5KT4 A;  4TLQ A;  3BDP A;  2LVW A;  1P8G A;  2OTL S;  5J1N A;  4DL6 A;  3RBE A;  5KFZ A;  1D3W A;  5GAG U;  5CYQ B;  1XN9 A;  1FJC A;  3OXG A;  1JIH A;  1WJ9 A;  5KG3 A;  2J9D A;  1SXL A;  1U1O A;  1T95 A;  5A0Y B;  4H4M B;  1YGY A;  2CVE A;  1H6K X;  2F4V F;  2X7I A;  2GQQ A;  1TVR B;  2J0W A;  4Q0B B;  1YWX A;  4IFY B;  2VPW B;  1Y5N B;  1FRK A;  1YLX A;  1R0C B;  3GYN A;  5D4P A;  4LBH A;  2CQ1 A;  1WHV A;  1LKZ A;  2MQQ A;  2UP1 A;  4YB6 A;  3TAQ A;  1YJR A;  4M8L A;  4RUC A;  2V68 A;  3I9V 9;  5IV4 A;  1JWW A;  2W2P P;  2XQC A;  3M8Q A;  4A46 A;  3GPA A;  4UOF A;  4IUF A;  5A8W A;  3KLF A;  2ZNY A;  2BM0 A;  2FHJ D;  3ZNJ 1;  1VHI A;  1JLC B;  5A8K A;  2XMW A;  2AGO A;  4Y28 C;  4DN9 A;  2MKC A;  4EBD A;  1M1G A;  5CA5 A;  1RU2 A;  3H0P A;  1SH0 A;  4QWC A;  1FJG J;  3FK4 A;  3QNW B;  3TA1 A;  5J2N A;  3DMJ A;  2YY3 A;  2XC9 A;  2KI2 A;  4IOC Q;  2NXJ A;  2R8G A;  2DNQ A;  2A3J A;  4PXB A;  1X5O A;  3U7J A;  2CQ3 A;  1Q8L A;  3CW2 C;  3R9L A;  3K5M A;  4UZC A;  4WP9 A;  2M52 A;  4B3T J;  3FQK A;  3ZTQ A;  3MCO A;  4NPO A;  3DXS X;  5KT7 A;  4LSL A;  2UVU A;  1FKA F;  4NCG B;  3EMT A;  3V6H A;  4ZVP B;  2VFU A;  2B7C B;  4F4X A;  2KYX A;  2H5I B;  2BKP A;  4YUD A;  1X0P A;  1WD6 A;  5E7O B;  1PYS B;  4J91 A;  3KG0 A;  2BJ7 A;  1N5Y A;  1GMV A;  1LFW A;  2IAJ A;  4KT0 C;  4X4N A;  3GYG A;  5HAT A;  2MB0 B;  1P27 B;  3NWG A;  3NAI A;  4ECR A;  2IM0 A;  2YNI A;  3QLH A;  4WF9 Q;  2FC8 A;  2ZD1 A;  2H54 B;  5KFN A;  5LSR A;  3TZY A;  3A12 A;  4C2M A;  3QT5 A;  1LQ9 A;  3THV A;  1KBR A;  2EG1 A;  3TQ1 A;  1N33 F;  3HP6 A;  1UAW A;  5F8M A;  3KJN B;  1HW8 A;  1Z2Z A;  2OP5 A;  2AT1 B;  3T5J A;  2NZC A;  4BCA A;  3DYA B;  1C0U B;  1XK8 A;  5FJ4 A;  2MQ8 A;  4WFX A;  3NEK A;  2ROG A;  3HK2 A;  3QFW A;  2GGP B;  2XO7 A;  1RT3 B;  4DV0 J;  4AQY J;  3UCU P;  3DHW C;  4OI6 A;  1M5V C;  3U02 A;  3OTO F;  4XDC A;  1TQL A;  2M3D A;  3SXL A;  4DCJ B;  1SL2 A;  3I4H X;  4DI6 A;  2P2C B;  3PIP Q;  1YJN S;  1JQG A;  1RCX B;  1D0E A;  2CFX A;  1TL1 B;  3VR1 A;  2X1G A;  2R2S A;  1YRX A;  3PW2 A;  4DN0 A;  5AXM A;  5AXN A;  2DTJ A;  1DLO A;  5G0R A;  1TL4 A;  3KWM A;  4DFJ A;  1Z2L A;  1KWM A;  2H1Y A;  2V8P A;  3W63 A;  3W64 A;  2KJW A;  5LXR A;  2RF2 B;  2J6U A;  2HGN A;  3FJ2 A;  3KK2 B;  2E7V A;  4M5H A;  1R27 B;  3DLG B;  3ULH A;  2HHH F;  2RRB A;  5B0E A;  3AY0 A;  2HVI A;  4WU3 A;  4U7U D;  3K2Y A;  2B5J B;  2QA2 A;  1JKH B;  1F9H A;  2BEF A;  5ETK A;  2IMO A;  1YJW S;  1GMW D;  5HBM B;  3PM9 A;  2OFH X;  3I0R B;  2DY9 A;  1MMN A;  3NS5 A;  4K5S A;  3MOJ B;  3H40 A;  3A1Y G;  2XYH B;  3UWT A;  3C6T A;  3UN3 A;  1GFW B;  5C5J A;  4B9V A;  4RW8 A;  3BB5 A;  3RB3 A;  4I69 A;  5BJR A;  3JSR A;  3MEE A;  1TV6 B;  2HW3 A;  1U25 A;  1WEZ A;  2VA3 A;  5KFI A;  2GO8 A;  2C3O A;  4NZ6 A;  3W3S A;  5T7L A;  1BLU A;  2KZM A;  3PRV A;  4Q7A A;  4F3Q A;  3KOA A; 
#chains in the Genus database with same CATH homology
 4JI6 J;  4HHU A;  4DR1 J;  4PWW A;  4LFA J;  4DV7 J;  5BR8 J;  4B3T J;  4X65 J;  4JI4 J;  1I94 J;  4B3R J;  4LFC J;  1N32 J;  4DR6 J;  2VQE J;  5A2Q U;  5LM7 E;  3IMQ J;  4LF8 J;  4JI5 J;  4JI3 J;  4LFB J;  4KYZ A;  4KY3 A;  2HHH J;  4JI7 J;  2F4V J;  4JI1 J;  4JI0 J;  1IBK J;  4DR2 J;  4DV4 J;  1XMQ J;  1N33 J;  2MQ8 A;  4X62 J;  2ZM6 J;  4LF6 J;  4B3M J;  4DR3 J;  4DV6 J;  4DV1 J;  2MTL A;  4JYA J;  4K0K J;  2UUC J;  3D3C J;  2KL8 A;  1HR0 J;  4NEY A;  5AJ3 J;  2UXD J;  3W1Y C;  4DUY J;  4DV0 J;  4AQY J;  2UXB J;  2UXC J;  4NEZ A;  3R2C J;  1HNW J;  2KVQ E;  5LMU J;  2VQF J;  2MEW A;  3D3B J;  3T1Y J;  4DV3 J;  2UUB J;  1XNQ J;  4DUZ J;  4V1A k;  1IBL J;  4DV5 J;  1J5E J;  4RJV A;  4LF7 J;  4LF4 J;  4GKJ J;  1HNZ J;  1IBM J;  4B3S J;  5LMN J;  1N34 J;  4LF5 J;  3T1H J;  4OX9 J;  4JI2 J;  3J7A N;  4JV5 J;  5IWA J;  2UU9 J;  4DR7 J;  1XNR J;  4GKK J;  1XMO J;  1FJG J;  4DR4 J;  4YHH J;  1N36 J;  2E5L J;  5FLX U;  1HNX J;  3OTO J;  2UUA J;  4JI8 J;  3R2D J;  4DV2 J;  4X66 J;  4X64 J;  4NXM J;  3JAM U;  4NXN J;  4LF9 J;  4YY3 J;  3J80 U;  4DR5 J;  4KHP J;  3J81 U;  5IT9 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...