1S6OA

Solution structure and backbone dynamics of the apo-form of the second metal-binding domain of the menkes protein atp7a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6oA00
1CC7A 1TZ0A 2FHMA 1LQ9A 1YJVA 1S6UA 1TL5A 1TUVA 2N4DA 1MWYA 5B09A 1KQKA 3T9NA 2OAUA 5B0CA 1N5TA 1SI9A 1QUPA 1FEEA 1URRA 3KG1A 1Y3JA 3E8OA 2OFHX 1TR0A 1R6YA 2OP5A 3F44A 2KT2A 4NL5A 4NPOA 4DPOA 2FTRA 2N4CA 3BF4A 3HHLB 3IWLA 4Y2MA 5IXUA 2LQBA 1JWWA 2BJDA 1V3ZA 2LQ9A 2W4DA 2ZDPA 1RJJA 1P6TA 2ASYA 1SB6A 2FB0A 2IYGA 2K2PA 3DCAA 4OJ1A 3TOQA 1N5QA 1FD8A 4OJHA 4OIXA 1AFJA 2K7JA 2XMWA 5B0BA 1VQYA 1ULRA 1YRXA 3FMBA 4Y2KA 3VTIA 3HHLA 2RMLA 1APSA 2XMVA 2ACYA 2OD4A 2HIQA 1Q8BA 3TNVA 1FESA 4EFAC 3HHLC 2ROEA 3K7RA 1KVIA 2PGCA 3HFKA 4ZOSA 1X8DA 2BYCA 2RU9A 2BJEA 1FE4A 1U7LA 2HFNA 2ROGA 2K1RB 3CJKB 1CC8A 1GXUA 1X7VA 1AW0A 2AP6A 3LGMA 4HH0A 5B0AA 2W4CA 3QMQA 2PD1A 3BB5A 2RSQA 2CRLA 1YJUA 2OKQA 1AFIA 1OQ3A 1Q4RA 2QYCA 5K9FA 2K1RA 2IYIA 5F0WA 3BR8A 2KT3A 2AJ1A 2AW0A 2GGPB 2K7KA 2Q3PA 2ROPA 4FNIA 1FVSA 4A47A 4OJ3A 4Q2MA 2KKHA 2GFFA 1N5VA 2EW9A 2XMUA 1MWZA 3KKFA 4OJGA 5B0GA 4HL9A 2ZDOA 5A6WA 1VQSA 2AJ0A 5B0DA 3FGVA 1OPZA 3KNGA 4YDXA 3WDOA 1YJTA 2OMOA 3LGNA 1N5SA 3MCSA 5KAKA 3MZIA 3GZ7A 5B08A 3IWXA 2VH7A 3HX9A 3HF5A 5B0FA 2XMTA 2G9OA 2HFOA 2HQIA 3BDEA 5T7LB 4A46A 1OQ6A 2GA7A 1P8GA 4Q2LA 4F67A 2RILA 2QLXA 1WD6A 2XMJA 3FRYA 4HI2A 5F0UA 2HLUA 1K0VA 3HDSA 2IFXA 1GXTA 2BBEA 3HHLD 2VV5A 3BGUA 1YG0A 2LXFA 3CJKA 1YJRA 3UDCA 3BN7A 1Y3KA 1W2IA 1Q53A 5T7LA 2GCFA 1KVJA 4YEAA 1TL4A 2FIUA 2HLTA 2W4PA 4A48A 4A4JA 1Y0HA 2BUNA 4U9RA 1OSDA 3DXSX 2N7YA 3TRGA 1SQEA 2GO8A 2LDIA 1FE0A 1JK9B 1Q8LA 2JDJA 2GGPA 2XMMA 4HI1A 4ZA1A 1S6OA 4QOTA 1XBWA 1IUJA 4FNHA 1FVQA 4DN9A 3KG0A 2XMKA 4Y2IA 3BM7A 1X0PA 2L3MA 5B0EA 2KYZA 2OD6A 2QLWA 1CPZA 2OFGX 1Y9OA 2GV1A 5A6PA 3LO3A 3QGPA 3I9ZA 2QIFA 4HH1A 4DL0C
chains in the Genus database with same CATH superfamily
2ZE2A 5B09A 1OO0B 3JQJA 1SI9A 3KG1A 4DR1F 1IM6A 1LW0B 4PQUA 2ZD1B 1JXVA 2FDNA 2NLWA 2QC3A 5AXKA 5T14A 2YWGA 1VCTA 1XIQA 2HFUA 5K14A 2BW2A 4G1IA 4Y3CA 3BGFA 2CPEA 1FTCA 2HFNA 4ZVTB 3HMJG 1DURA 5B0AA 1OSCA 3E01B 4P2FA 1GMVA 1HNXJ 1RTHB 5IQQA 3HD2A 2E5LF 4B3RF 1RHMB 4P52A 4B9SA 1RAHB 4LRAA 5E3QA 2YKNB 2DXFA 3I5AA 4QPTA 2DHSA 3MAHA 2UUBF 2HS4A 3QRQA 1NSKL 1H38A 3ADAC 1TKZB 2HFZA 2DR9A 3HCXA 4BS2A 3OL9A 3R7SB 1KQSR 2BACA 3OBIA 2GVDB 4DV4F 2DY1A 5DS7A 4ZA1A 1ZBTA 4FBUA 3C66A 5CA5A 3BJYA 1S6PA 2OEMA 4LUBA 3Q8VA 2IM2A 1DTQA 1R27B 1SJRA 3DKDA 4LBHA 1UMJA 1PYOB 3HVTA 2LP4A 5KOWA 5CYQA 3C14A 4DQQA 3TOQA 3PRBA 1PJ7A 5KFFA 1NJXA 4L3NA 2OD4A 3G87A 5LSLA 2DB1A 3VCDA 3MMBB 1IKVA 1T11A 2M8DB 3FBCA 2VFTA 2FZCB 3UDEA 4ZPBA 1KEKA 4NLDA 2ZJQQ 4CO1A 1H6KX 1HW9A 2GNKA 2PI4A 3AOCA 2YKMA 2J7UA 3FGVA 3LTOA 1GTHA 4F4WA 2B43A 3N4WA 4RW6B 1UJ4A 5KFYA 2G1HA 4P72A 1X5TA 4R5PB 2RDJA 2V4JB 5LSOA 1IXKA 4XPCA 2MGZB 2AKWB 4V19J 3NRBA 4JI0F 1JK9B 1UZHA 4USKA 5LMUF 1PC4A 1QM9A 4LF6F 2FJXA 2IAJB 3BM7A 2ZWPA 1IQTA 5J2MB 1CPZA 4WFXA 2LQ5A 5EDWA 3DMJA 4DR7J 2D1CA 3N01A 4RL1A 1H7XA 2KT2A 2BDPA 1J5EJ 3CCSS 1RXOB 1VQ4S 2PEHA 4E0DA 3UCUP 2ZC4A 2DNKA 1WC0A 1YRTA 2GHVC 3SSRA 3R8YA 3BGLA 2HBYB 4RPFA 3KMQA 4JYAF 3JAMY 2DNOA 1FDNA 1MLAA 2CQCA 3F41A 3IBFB 4KJIA 2RRBA 2AF6A 2WK4A 5HQMA 4ED1A 3M8PB 5A6WA 2R7VA 5CCMA 5KFBA 1DTTA 1TVRB 4LBIA 2F63A 2D7SA 4KPYA 1DLOB 2JLFA 1K44A 5GAHI 1RWOB 4KY3A 3POTB 1S1WA 2Q43A 2R9LA 4A4JA 4MKBA 4ECVA 2MEWA 2HQGA 3V6HA 4GO5X 1U1QA 1C4CA 5KFZA 2BE7D 2OMLA 3DOKB 5J1EB 5B0EA 2B56A 3IC1A 4QR2A 2VQEF 3D5MA 2VA2A 4XIUA 5HLFA 1U4BA 1WSRA 3JTPA 1NH8A 1D9AA 2UUCF 4FN5A 3R2CJ 1YKWA 1M5KC 3A13A 4OJHA 2PO4A 4OIXA 2XYHB 1SL2A 3CJQA 2LXIA 3CD7A 3PR5B 3IBWA 5A8RA 2R2RA 2FJBB 2F9JA 1IWGA 4Y6IA 4MYTA 1FRJA 4OZ5A 4X2BA 4WP8A 1NB7A 5CABA 3EZUA 2V0NA 4HHJA 1OQ3A 3DLKB 4Y28C 1KLMB 2GAHC 3K2YA 1M5HA 4IG3B 3UD4P 4RWXA 3OFEA 3J7A1 3LA0A 4RUHA 4UOCA 1ZPVA 4JUZA 1H0HB 2E44A 3VZHA 4OZJA 2B4PA 2QT7A 2UU9F 5F8IA 2RQCA 3NBPA 2B8PA 3IGVA 2DHHA 1ZZFA 2B8QA 1S1TB 1N88A 1WG4A 4DV7F 3RW6A 2B4VA 2GGPA 2GHPA 4WE1B 1GAOA 5F8LA 1DRZA 3T5JA 3I96A 4BHQA 1NKBA 3W64A 2P9CA 3IA0A 1R0AB 3IG1B 4H4MA 4DPUA 4LF8F 3FFIB 2MDAA 4NCAA 3PFOA 1Z2LA 1X9MA 5E3PA 2KVIA 5IT9Y 3MDFA 2R42A 3MMAA 2RDIA 5KG4A 2NCKL 2FD2A 1JJ4A 3ZZZA 2JHEA 2X1FA 2J0QD 1X4CA 4JOUA 2H5EA 1ZAXA 4Y2AA 3QLHA 2HQDA 2X1BA 3M6XA 4BWMA 1HARA 2XMTA 2RNEA 3SMZA 2IBKA 2EG2A 2VV5A 1JJHA 3PW0A 1D9FA 1HQEA 5SUHA 3M8RA 3P4UB 3TVZA 2KDOA 2AT1B 2RU3A 2HWHA 1NDLA 1RWKB 3IBCB 1WTFA 1K73T 2Z4PA 2XMAA 1HD1A 2ZOFA 2ZH2A 2OAUA 4X64F 3QATA 1RTZA 4Y2MA 4X4VA 1N6QB 2VFRA 2W9BA 4LRBA 1X4BA 1JLBB 3THPA 2ZBIA 2E5LJ 4B3RJ 1CJTA 1HYSA 3S6EA 4KHMA 1HWIA 4OLPA 2FHJA 2MB0B 2EG1A 1RT6A 3R5CA 4WIQA 2UUBJ 2OPQB 3TZWA 1Q78A 4G1QA 2KG1A 2HHSA 4H4OA 4DSLA 4F0HA 1VHIA 4DV4J 4ZIVA 4HDGA 4E8UA 1U0SA 3CJKA 5K8OA 3EVOA 1HNZF 3TEHB 4OYPA 1D9DA 3ELHA 1P1TA 3K89A 2JWNA 4YDDB 4GC6A 3FZBA 1UFLA 2VKRA 3GQCA 4DCJB 4K4VA 4KKOB 1YBUA 4DPTA 3OVAA 2E1PA 5KT4A 1TUGB 3D6FB 4C8NA 3ZTSA 2XEXA 4M5KA 5E5NA 3M05A 3G71S 3WHIA 1KTVA 3BBBA 4WU3A 1UKUA 1EKSA 3GR1A 3C6TB 3QT6A 2Y9HA 1WF1A 3JYTA 2QYGA 2A0FB 1T03B 4KSEB 3W65A 1BWVA 5FDLA 1TFYA 4JI0J 2CPZA 2JVRA 5EHHA 4KGVB 2ZE2B 3V81A 5LMUJ 4LF6J 3IM8A 3H2LA 3CC4S 1R0CB 1ZOTA 4B3TF 1RHQB 1Q5VA 3OFHA 1BQNB 1QE1A 2CJ9A 5D6GA 1Q1KA 5K14B 4M1KA 2FY8A 1CG2A 2VFUA 5I3PA 1OYDA 2D74B 4L6V3 2G0CA 5K8NA 3BSOA 2F3JA 2ZBRA 3DM2A 5KFNA 2QRRA 4JYAJ 2VC1A 2LQBA 3MFHA 1KONA 4M5HA 2EKNA 2XB2D 1SKUB 3L3CA 3AAWB 5CD4A 1Q8BA 2D3ZA 2LU2A 4TLQA 4F4ZA 5JVGQ 3RUBL 2BANA 1SJ1A 4DPWA 4OYAA 4M5IA 3D9BA 4QBUA 4M5LA 5SZTA 4M5GA 3CUNA 3EVWA 2KN4A 4X4QA 3QZ8A 2BEFA 5D4LA 4P75A 5B0FA 2DYAA 1RT1A 2YPZA 2ASDA 1YTYA 3MEEB 4ER8A 2VQEJ 1NEEA 3HVTB 4QW9A 2ZUGA 3H20A 1U24A 3NXZA 1U1LA 3TRGA 4C2MA 2HHVA 1IUJA 4C6AA 2IJNA 4HEA9 1IKVB 1UP1A 1CLFA 3KK3B 5CCLA 1S9GA 3TA2A 4CQ1A 5L38A 1JLCA 2BR0A 1N0VC 5GMDA 2OP5A 3D6HB 4PXCA 1KFSA 3HHLB 4DN0A 1VQ7S 3AJDA 1T8EA 3CMAS 1X4AA 3IMQJ 1ZAWA 4USIA 5AT1B 1I5OB 1XMOF 5J1NA 1SH3A 1H3DA 1NK9A 2K1RB 4RUAA 2NREA 3RB4A 2FLLA 2UVWA 3M8ZA 1DZ5A 1FXDA 2OKQA 2KFYA 3HZGA 2UU9J 1OPIA 1WG5A 2M4MA 1XNRF 2DH8A 3W2VA 3TP2A 1WF2A 3AB2B 2VH7A 5LXYA 3ZZ0A 4ZIWA 1QVFR 4PPDA 3TAPA 4Q2LA 2VPZB 2VONA 3GCWP 3RGIA 1SIWB 2G2YA 4JI5F 5J2QA 3KUHA 4ZVUB 1HNIA 1MMDA 4ZN1A 2F1FA 3HKZD 3FBBA 4C8LA 3HULA 2F4VJ 2M5YA 3IFEA 1VQ8S 3P45B 4F4YA 2HAIA 3MCNA 3F44A 1MNEA 2RF2A 1GEHA 4L76A 1SXLA 1Z2ZA 3LOUA 4EYHB 3CD6S 2C2EA 1LV5A 4PG8A 5CYMA 1DTTB 4ECTA 2Y1IA 5LT5A 3MI7X 1H7WA 3PX0A 2HZAA 3IRXB 3FEXB 3MM7A 1S1WB 3M7VA 2CNOB 1SL1A 1YJUA 1GXLA 4NLXA 3MEKA 2GMJA 1HBUA 4QZVB 3MAQA 1T05A 3P3DA 4OI6A 4DBQA 2P9EA 1EB0A 1RWVB 4M63A 1B7FA 2L41A 3ET6A 1SBRA 4ZS6A 2VD3A 3HSZA 4U8YA 1F3FA 1VRUB 1T94A 2U2FA 4RW8B 1JKHA 3NCQA 4X64J 3F73A 5EN1A 3MTJA 5ITHA 1N36F 4JV1A 2ZZMA 2L9DA 4MTPA 2XMKA 1N8RT 1KVKA 3NS7B 1JLAB 4KPCA 2MQLA 2HHUA 4KGKA 1X9SA 3G8QA 1MN7A 3BO2A 3ISND 2IMOA 1EETB 2CWXA 2KFNA 2MSTA 4ZCKA 2MQ8A 5DM6Q 2XSFA 2RQMA 2ZBQA 4YY3F 1IR0A 3AOAA 2HW3A 3K0JA 4DJBA 3RYLA 1GXUA 2DNLA 4YB1P 3R27A 2CZ9A 3PKMA 1NB2A 2GGPB 5EX3A 1X5OA 2NPFA 2CQGA 2W25A 2FUG9 4ZPTR 4ED8A 5GADU 1HKAA 1RSCA 4I2PA 3BPSP 3T19A 4ZJLA 2DNQA 4FZVA 4PG7A 4PWDA 2Z30B 3R5BA 3FBEA 2GCFA 4I68A 1QTMA 1JLEB 3KFWX 4C11A 2VG5A 4NEYA 3BV8A 4O4GB 4NZ7A 1ICEB 2YNIA 4WFZA 4OZ2A 2BJ9A 3T9ZA 2FJVA 4O0IA 3LWLA 1U1NA 1XR5A 3J80U 4PZVA 5ETQA 3G86A 4ZVFA 2VBWA 4IYQA 3LUYA 1SKWA 3QLHB 1JNRB 1C1BA 1U2RA 3OL8A 4F4XA 3RTVA 5BJRA 4J9RA 4I1TA 1T95A 1HQEB 2HWIA 2LA4A 1EP4A 3MD3A 1B0VA 2BMBA 1IKYA 4FNIA 4ECSA 4B3SF 1CSJA 4B3TJ 2Y0BB 2DNMA 4B9NA 1VBKA 5D4PA 1MWQA 1NK0A 4X4TA 1Q8IA 4M5JA 2W7OA 3OUYA 4DV5F 5E33A 3BDEA 4S0MA 1RCOB 2OPSA 1OWXA 4ZPWR 1LNQA 3ISNC 3C3LA 2RHQB 1UWBA 1ROFA 2HRUA 2FHJD 3T41A 3KOAA 3PHEA 4ZP6A 2W9BB 1Z1ZA 1F2GA 2HG4A 1S6OA 1WOPA 4DN9A 3BS9A 3TJ8A 3IAM9 1RA6A 1RAJA 3M9NB 2BQRA 5A8KB 2B9EA 4LFBF 2PSZA 3GB0A 4MAKA 2ZFHA 1DFDA 3I4PA 2JLGA 4G1QB 4DLGA 2MY8A 4H4OB 2J9CA 9ATCB 3BKFA 5JJBA 1SH2A 1ZTTA 3M9MB 1M1HA 3BQ0A 4WYLA 1C0UA 4CLUA 3CJKB 5KTQA 5IOLA 3DYAA 2WTFA 5D0RA 2YH1A 3DI6A 4K4WA 3UVJA 4W98A 2AJQA 4K2XA 5DM7Q 3TAMA 2MQNA 2VG6B 2RVJA 1FKOB 2HEKA 4YFUA 3MCSA 3M2VA 1WSVA 2G9OA 3PW2A 4WJBA 2KO1A 1FXLA 2HLUA 3X1LB 2XSJA 3RW7A 2FZKB 4RUCA 4F50A 3MURP 3NGKA 5E41A 3BSCA 4X4NA 3TANA 2LDIA 1RWMB 2E7XA 5HMZA 3BO3A 1S4FA 5KT7A 3KG4A 3JYTB 4K59A 2KRRA 4IDKA 3SQOP 4DPOA 1U6ZA 3H4DA 3W3SA 2UUWA 4P9SA 2ZOMA 2Q66A 2MPUA 3MM9A 2Y1JA 1JJ2R 2YX4A 1NLKL 2EK6A 1XNRJ 4LF7J 5D0GA 5H1SV 1PC5A 2M8HA 1CC8A 3NMRA 1QE1B 5HI7A 3J81U 4NRTA 1C2PA 3KHLA 3P8BB 3KHGA 5GAEI 3IR6B 2W2MP 4JI5J 4J9MA 3JSRA 2R2TA 5B0DA 2HK3A 2OMOA 3MZIA 2H5JB 1VQKS 1C0TB 5F41A 4X4SA 3CDAA 3A4TA 3TJAA 4ZCIA 2ZZTA 5I3UB 3A3PB 4FPIA 4DPYA 2COLA 3ILIA 3UR3C 2DEIA 2EEYA 3DLLQ 1T9TA 4JI1F 3UE2A 2JFKA 1OIAA 2LDYA 1NH7A 4DFMA 2ADCA 4R25A 3DFEA 4QCLA 2BOPA 1A6LA 2HBRB 4DDFA 4CRJA 4O3QA 2E9RX 2EBEA 2HIQA 4V1Ak 2D41A 5ETPA 1RT1B 4K50A 1QLNA 5JXSA 1S1XB 1UAWA 3MUMP 1LWFA 4GO7X 3KUEA 2VPXB 4J9PA 1ZA1B 4MIWA 2DGSA 3B82A 3SI8A 2FQQB 5C24A 3JSYA 5HVFA 1N5VA 1K0TA 4N56A 5B0GA 4LSNB 2LYVA 4ELTA 1S9GB 2V34A 2B9YA 2NUUG 3HSGA 3PIPQ 1N36J 1EJ7L 4PYAA 3I32A 1S49A 3Q0AA 2W8KA 1OJ4A 3MEGA 1FNMA 3MR6A 3AD9C 5CHCB 1KVJA 3CCLS 3E2EA 3TA1A 2BE9B 2DNRA 2E9TA 1RAIB 5FD1A 4MMOA 3PKYA 2R8KA 2RB7A 1SL0A 3LO3A 1GFWB 3BEGB 3ZNUA 2J8AA 3SBMA 4YY3J 4TQSA 3OR1A 4NCGA 3UR0A 3MEDB 2SXLA 4BBYA 4X65F 1RWWB 4KHPF 1F5BA 1F9HA 3OPKA 2ZWOA 4DEZA 4WFBQ 1HLWA 2GQ2A 3NGRA 4DS4A 3M30A 1U2CA 2B6AA 3MPVA 3FSYA 5J2QB 4WK1A 1WACA 4TXSA 1UJ5A 3R6LB 5KFOA 3Q2SC 3CT9A 4K2JA 2Y1RI 4I6WA 1U02A 3T1HF 1T9YA 2WW4A 1RT2A 4F3OA 2W1BA 1T9VA 3AQOA 2CQPA 4LRDA 4ZVHA 1U1PA 1EKRA 5CYMB 4J9SA 3D66A 2QFJA 4PR6A 2HQ3A 5KFTA 5GAHU 2W7PA 1CJVA 2L3MA 1K8AT 3OVSA 1R0BG 5JMNA 4MJKA 3L95X 4DSIA 3C8YA 2RS8A 2MKKA 4ERDA 3GIMA 2ZZNA 3UW1A 2KRBA 4OV1A 1HBUB 4QR0A 1D09B 4AXJA 2K2PA 3QFHA 4UQTA 4QJVA 3TX8A 3MAAA 3GIKA 4DV0F 4B3SJ 2IJFA 2YNFB 3L7OA 3US5A 1FE4A 3R5GA 4NLGA 3GIJA 1MN9A 3RBXA 3LANA 1VJWA 1JKHB 4NA1A 2AWZA 3G6YA 1AFIA 1DY3A 4OX7A 1RHUB 2E66A 1Q16B 2QG9B 1XN9A 2CQ2A 3V5RA 3H4BA 4LIWA 4F7VA 2YNHA 1KR4A 3PFEA 2XMJA 2FGOA 2WVFA 5LOQA 3KYLA 5B7WA 1UWAA 4OHYA 4ID5A 3UDLA 2OLWA 3GJRB 4C3MA 3V6DA 4I7FA 4LFBJ 1BC6A 4TYBA 2GHWA 4JV2A 4M5MA 3KLGA 3MR2A 2EK1A 1XEZA 5L1JA 3TA0A 2C28A 2FGCA 3QJPA 1NHKL 1HBMA 4TY8A 1NSPA 2WVDA 1RYSA 2AYMA 3GU0A 2C2ZB 4ECYA 4K5RA 4PYDA 3Q8PB 1BMQB 2XG8A 1FWKA 3J7AN 3ULHA 4K8RA 5B0BA 2OH2A 3CJTA 4DX8H 1FESA 5ADZA 1WC3A 3H5XA 2EFOA 4PWDB 2DHAA 3I5CA 4NOHA 3UI3A 5JVHQ 1GQEA 3GLJA 4DS5A 5DDPC 4WTYA 1DQAA 2QSWA 4MKVA 4C11B 1KQGB 2EC0A 1BLUA 2Z8QA 4EBEA 5J2PB 3SQGA 1YJ7A 4QYZJ 3EZ5A 2CA9A 4C8OA 1WEYA 1HWJA 1YJ9S 3HVWA 4ES2A 4KGMA 2Z57B 1HIYA 2NXJA 2W4PA 2FC9A 2IDEA 3L09A 2VF3A 4QR1A 2HRTA 2DD8S 2ALZA 4LR7A 2QIFA 4Q44A 3DRYA 3TWZA 4CH1A 2FVRA 3RR8A 3J7YU 3MWBA 2JZ5A 3D54A 4U8VA 4I6AA 3OFGA 3OR2A 2QO3A 4KFBA 3VVUA 3BF4A 3N0VA 3RJMB 3GV8B 1FD8A 3JQMA 3K8VA 5F8NA 3L7UA 2BXJA 1RT7B 2OPSB 4QWBA 3GJQB 2MZJA 3HVRA 4RKUC 2E5IA 4IO9Q 3PXGa 4J37A 1ZAVA 2C3OA 4LR9A 5EX0A 3SDEB 1FT8A 3WX4A 1A9NB 1VHFA 3WZ0A 2MHNA 4M95A 1NO8A 5EWGA 2YKOA 5D3GB 1FRHA 4JI1J 1VC5A 2W2QP 5LMNJ 1IKXA 5M2RA 1IJEB 2GMLA 4PWUA 5HROA 2ZNYA 4DV3J 3DYAB 1TL1A 5FLXU 4I2QA 3NEKA 3G4SS 1CULB 3UVJB 3TAMB 2FZGB 3H5YA 1UPPA 2R7RA 2RDDA 1JB0C 2UV8G 3M2VB 3W5XA 1O51A 4WYWA 1NSQA 2ZBCA 1X4FA 2PT0A 2XSJB 3Q23A 3N6NA 4UOGA 3G8TA 2YKQA 3QWPA 2H4WB 1HQUB 1FX4A 3ZZRA 2XY5A 2QGFB 5HP1B 4ZVPB 4OJ3A 8ATCB 3GMGA 2YBVA 4OLOA 3LP2A 2XS7A 1WD6A 3RAQA 4IDKB 4KR0B 2YQ0A 1QDUB 3R9LA 3G6VA 1Q53A 2WB4A 3ZZPA 3WIUA 2IRXA 4U96A 3KLIA 3MM9B 4USVA 4CO0A 4KYZA 4X65J 2CNKB 3TZYA 4U6PA 4KHPJ 5L1KA 4IKAA 4HH1A 2VBXA 4ZLLA 4MYUA 5IFMA 1NK4A 5IC4B 2QE5A 5KT6A 5I42B 5J2NA 4B3MF 4OJ1A 4PG4A 1RT5A 2FYXA 3VGSA 1LW0A 3W62A 5DG7A 4CLWA 2ZD1A 1BQMA 1VQNS 2WONB 3T1YF 4P10A 4DU8A 3SEOA 2M70A 2RRNA 4B08A 4U95A 2O67A 1WEZA 1KOOA 3VGUA 5DJBA 5KFIA 4MT1A 3DLJA 3RB0A 5DG8A 1NMEB 2VQFF 3E01A 1HI8A 4HL9A 1X0FA 2MKSA 4XO0A 2M7SA 4WKRA 1SVDA 2F7VA 1XMBA 2Q6BA 2AYGA 3PEJA 1V5VA 5E3RA 4EUVA 1RI7A 2VUGA 2C1EB 2O66A 1XERA 2MZTA 3O44A 4DMZA 2LXUA 1TKZA 3K17A 1VOMA 2R2UA 4HI1A 3PRVA 4PXDA 3U27A 1PAUB 2DPJA 4EU0A 1WC5A 3ENWA 3ETOA 3NNCA 1NJZA 1X4GA 3FUYA 4DV0J 1TKDA 2ZKUA 2CQ0A 1D0EA 2XGPA 3V4IA 2P9GA 3NAHA 2ZVSA 4CYUA 2J9EA 1FDAA 4NLYA 1KBRA 4DV6F 3NGSA 4OMFG 1KTQA 3N5BA 1UEKA 3CCZA 5BYQA 1EQMA 1VS3A 3CJ8A 1NHUA 5AJ3J 2EFPA 4DSFA 3UO0A 4XDDA 4J9QA 1NXIA 3HP6A 2NYHA 2UXCF 5KFHA 3EM1A 2VC0A 1DARA 3MMBA 5D4OA 2YNGB 4DX5A 4Q2MA 1M5VC 4YHHF 3EGWB 2PA8D 3H8YA 3NOCA 2CQ1A 3OR1B 1RWUA 1VQPS 1PGZA 4IQXA 3KJVB 1XR7A 4RW6A 2EPIA 4U7UD 5L9NA 2XM3A 1S0MA 1EX8A 4LBPA 4QYRA 2DR5A 4ECUA 2ILZA 2JDJA 4R5PA 4CO4A 2CJBA 2QV6A 4ETXA 3G96A 1N4LA 3M30B 2CJXB 2E1RA 3BGOP 4KH1B 1HBOB 4PUOB 4K4TA 3LQVA 2QA4S 3MMCA 3CCMS 2KB2A 1U49A 2DH9A 2IAJA 1S48A 4Y65A 2WSCC 4AQYF 2QL5B 3PACA 2I2YA 1KFDA 2XYGB 2XS2A 4UT4A 3LPYA 1RA7A 3M8QA 1PKUA 4RBVA 3SFGA 2AGOA 1FK9A 2BJ1A 2XHCA 1H74A 2QMWA 1DHMA 1N34F 2RSQA 3HFZB 5ETTA 3CCVS 1AROP 1PILA 1M5OC 1CJVB 3M1VB 2OSQA 3AOBA 4FF3A 2OO4A 3FQLA 3LGNA 5CAAA 4F4KA 1RK8A 1KWMA 2DT9A 3W2WB 2Z0GA 2H54B 1HR0F 2EXUA 1OQ6A 3W63A 3M8PA 2N3LA 3HDSA 5IQ6A 1VQLS 1QD1A 3DHWC 2W9AA 3MAAB 4DQPA 3POTA 5CD4H 2V2ZA 4MKAA 1GMUA 4C8MA 5IV3A 5A6PA 2UUTA 4QYZK 5HK4A 1AUDA 2J7WA 2R8HA 5J1EA 4UUXA 5DZ7A 2H5IB 3VHQA 4DZ6A 4ZVOB 1LFWA 1H73A 1RAFB 2UVUA 4CDIA 4YR2A 1IJFB 1F3VA 3TZXA 2F5GA 1VR6A 4ZOSA 3O2IA 3TUJC 3EWGA 3JS9A 3OQ2A 3V6DB 2XY6A 3TAQA 4I7FB 2KG0A 1HMVA 2EWHA 2K7KA 4YR3A 3OV7A 2CPIA 3P96A 4ALZA 4WU2A 4ES1A 2PIIA 1AB8A 3QIPA 4KO0B 2P5VA 1CEZA 1U25A 3I55S 1KLMA 1N5SA 3UNGC 4IG3A 5B08A 2IPOB 1YJWS 2GVZB 2HQIA 1HBMB 4NYZA 4TY8B 5LL6d 3KK2B 4L73A 3OD2A 4C9DA 1RWNB 4IFYB 3VWSA 1VMBA 3GTYX 2CPHA 2Y3YA 1WOSA 3PJ9A 1RAAB 3CCES 2XO7A 1SIZA 3Q24A 5KFVA 4Q7AA 2DGUA 4WE1A 2NYIA 3NGTA 2F4FA 4IG0A 4K4SA 1R3NA 3T9NA 1KD1T 1VQ6S 1R0AA 1WHYA 4IFVA 4DQIA 1QVGR 2CDQA 3GG0A 4CLLA 4K7QA 2UP1A 3V4MA 4DR2F 3KJFB 3NKYA 2DGWA 1RU2A 2WB1D 1G6BA 2ATCB 2V5HG 1DJ0A 1FRXA 2OJ3A 3D68A 2PD1A 3A8EA 3CJRA 2Y8WA 3I82A 4RU2A 3GFXA 1SKRA 3RAMA 4KV8B 3T6BA 1XMQF 1A7GE 5G4DA 2ZVIA 1TL7B 4LF1A 4NLTA 3MHYA 1NKCA 1RU1A 3CD0A 4CT8A 4HLBA 3OR2B 4R0EA 4KFBB 2LCWA 5A0YB 3CCRS 3D3CJ 4FYXB 2KU7A 2IVFB 4KBIA 1R8BA 4EEYA 2PEBA 3OTOF 4O3SA 3MR7A 1UEVA 5E0OA 4B3MJ 3BPDA 5KG7A 2LECA 2BA9A 2HAFA 4V19X 2YH0A 2KVQE 4FYWB 1R8AA 3T1YJ 3CJ0A 3IGNA 3CB4A 1U1MA 4UF4A 3DRPB 1N5QA 3RR7A 3ILOA 2GIFA 3WBZA 2ACYA 4ZK7M 2CG4A 1N6QA 4OZ3A 4R0JA 1YZ6A 1GK8A 4B9LA 5DGBA 4GVBB 4IH5A 2EFQA 3EGZA 2VJVA 1ZTWA 9RUBA 2QYCA 4P2SA 1S9EA 6AT1B 2AJ1A 5M2UA 2XY7A 2JEGA 5HROB 1HHQA 1YJTA 5HO4A 3Q2TC 2CPJA 3AXMA 5T7LB 3R5AA 1FKAF 3DDNA 4RNMA 2B7BB 2RHSB 7FDRA 3BN7A 3D4JA 3NP5A 3EPGA 4DR3F 1K1SA 3UNYA 4X66F 4DV6J 4DFKA 4TNOA 4FS1A 4DL0C 5KFEA 4JI3F 3BBCA 4RZRA 3HD1A 2HFVA 2UXCJ 2OUGA 2V8GA 3THVA 1P6TA 1QTNB 2LQ8A 1VQMS 3UN2A 3TZZA 2DNYA 3LP2B 3TNVA 3JAMU 2XO6A 1A0OB 5AE3A 4YHHJ 1HD0A 2M88A 1RE1B 3DGPA 1U45A 1UVJA 3KLIB 2KKHA 3C6TA 2JH3A 2P6TA 3BDPA 3TARA 2B9XA 4AL5A 1AUSL 1N5YB 4GKKF 1O5JA 3FK4A 4OYXA 4C3LA 2ZH1A 2JJ4D 1QY7A 2XGQA 4E2FB 4ILLA 3NAIA 4DOZA 5J2NB 3OHAA 1UJ6A 4G1PA 1RT5B 4U9RA 3J81Y 2JRSA 2IHR1 4AQYJ 1BQNA 4K5SA 1FWPA 2V8DA 1BQMB 2XLKA 2DIVA 2KYZA 2MTLA 4ES3A 2JEFA 2HVHA 1E6VB 2Q79A 1FEEA 4CO3A 3BO4A 1B0PA 1LEOA 4NLOA 1O6XA 1N34J 1TK0A 1UVKA 5FJ4A 1RQ0A 5KFSA 3TVYA 1TKTA 2R7WA 2W9CB 1OS5A 2DCLA 3KWMA 5C7PA 3HFKA 3C16A 4TU9A 2VPWB 4DX7A 4BWJA 1HR0J 2CRLA 2HVIA 2WAQD 3D1QA 4F0MA 2MLXA 3KKFA 2R2SA 3A8JA 4RNNA 2CZ4A 2J6UA 4ZVEA 5IZHA 1ELOA 3KNGA 3Q86A 4XK8C 5KFPA 3QPIA 1XNQF 3V4IB 2DNZA 4MK7A 4CYUB 3TO8A 3PYDA 2AZ1A 3MEEA 2L9WA 2LEPA 1RGVA 3HPOA 1JLGA 1GT8A 1ZETA 3R6GB 1M5SA 3CDEA 5IT9U 4RJVA 3KK3A 3MM8A 3AQPA 4P71A 3GR0A 3EMTA 4DG1B 4QPXA 3U1NA 1TK5A 4U7CA 3HHLA 4DUYF 3JTNA 1IBKF 2NXUA 2MLYA 4ENOA 1TP7A 3HVAA 1M1GA 1RACB 1Y5LB 3GJSB 2K8GA 2K1RA 1S10A 2M3DA 2HYIB 1PIEA 2NZ4A 1WC6A 2VZ9A 3A3OB 2G2OA 2KFZA 3HX9A 3MMCB 1SJQA 4LIRA 1BWEA 1NBEB 4EZ6A 5F0UA 1FERA 2P6SA 2ZH5A 2G1DA 4X84A 3EUNA 4K0KF 1KSPA 5L8RC 3GV7B 3OW2R 3M8QB 4HHHA 1LWEA 1YK9A 1FK9B 5DLFA 4DR2J 4OZ0A 3M4XA 2OIHA 4G65A 2MQOA 1S79A 2GQCA 2V63A 3IWNC 1QSYA 3PIOQ 1JLQA 3JSBA 1R8PA 1S97A 2CXEA 3PO5A 1SB6A 1S77D 2DEJA 2VBZA 1VQYA 4O23A 3NGUA 4HTJA 5BR8F 3QNWB 4MIAA 4CNZA 1XMQJ 3GSIA 3WX8A 4E98A 3H0PA 3UWTA 2KI2A 3IRXA 1SPBP 1SJFA 1ZZNA 2XNRA 4N47A 4IO1A 1EAYC 1GH8A 3J7Z5 3NG8A 1J27A 2J9DE 3OTOJ 4CLZA 1JMTA 1K0VA 1M90T 1WDDA 3DOLA 3SSSA 2R7SA 3UDCA 4UOHA 1VQ9S 4ZITA 5J1PA 1HQ2A 1VRUA 2NZCA 2VODA 4RW8A 3W7BA 2OD6A 1R89A 2J76E 2DCUB 4OZLA 1TL3A 3NLCA 3K5PA 4F02A 4C98A 3DDKA 1HMVB 3RBZA 3I31A 2AU0A 1JLAA 1FDBA 2KJVA 1LKZA 3QIPB 4NLWA 2DIUA 5LJ5Y 4CLYA 2UV8A 4OHVA 1EETA 1WC1A 2H3EB 4LSZB 4DR5J 2DPIA 3ENAA 1S7IA 4KIAA 1HWUA 3DRRA 2C3MA 1AT1B 3BB5A 1V3RA 3LP1B 3UDVA 4NEZA 3HLUA 3BR8A 4ZP7A 2RD5C 4DR3J 4DFPA 2YQ1A 3FCHA 4YDXA 2YWKA 3V2UC 3ZZYA 1B64A 4IG0B 4KTQA 4X66J 2E9ZA 4IFVB 2DTJA 1R43A 2ASJA 4OHZA 4AFFA 4YEAA 4A48A 4JI3J 1HBNB 4DL5A 2HGNA 2N7YA 1KRPA 4XTTA 2WBMA 4JI7F 2F4VF 1JLEA 4NE9C 5DDRC 4O4GA 4EMDA 1X60A 2OFHX 5E3AA 4B9TA 3P5BP 5EWFA 4DV1F 3RG6A 5A2QY 4ED2A 5ETVA 3FMBA 4USWA 2H4YB 3GWCA 2QL7B 1NK5A 1I51B 3CVKA 4HACA 2CVEA 1IBMF 1AW0A 3DGVA 3PDNA 4GKKJ 1S6QA 2HQFA 1U09A 5HVHA 3BZQA 2IYIA 4KAIA 3OXGA 1U1KA 3HFVA 1P1LA 2NQPA 2AX0A 3PYFA 3X3UA 3D0HE 3DC2A 4ZCLA 5KAKA 4TU8A 3GZ7A 4TLRA 3IR7B 2CQ3A 2E1MC 4A46A 2HNYB 3W5ZA 4F2SA 2UXBF 3BGUA 3SCIE 3QO9A 3ZTOA 3QBCA 3CCQS 1B70B 5KFGA 1N32J 2HVZA 2WSEC 3PX6A 3DU6A 3H5SA 4FKXA 2FVQA 3AA9A 2ALYB 3VV2B 2Q6CA 2V69A 4DSJA 4LFAF 2R3VA 1UL3A 4BC7A 2EFGA 1UW4A 4X4RA 1N54B 1S9EB 2IC3A 3W1YC 4LR8A 2A2DA 4FXWA 2HHWA 2W4DA 5A8KA 5C42A 3EICA 4D3HA 1K9MT 2XMVA 1U8WA 2G0JA 4EBCA 1RHRB 1YITS 4NZ6A 3QWUA 4PKDB 3RB3A 4P7TA 3NNAA 2MSSA 2HK2A 1XNQJ 2JEIA 4RW7A 5F8JA 3MD1A 2ZC3A 4A47A 4PG6A 4XAKA 1JX4A 2VICA 2PDAA 4XDCA 2KYXA 1FEHA 2VG6A 4F67A 1FKOA 1IKWB 3AB4B 1P27B 3SIPB 4DCOB 1RDRA 4WK3A 3V6JA 4JI4F 1MMNA 3KHHA 3THTA 3TEGA 5L1IA 3Q89A 1ZA2B 3R97A 3CGIA 4EWTA 4NLRA 6FD1A 1P9QC 2N4DA 2HQCA 3DGPB 4Q5VA 4DUYJ 1PYSB 3R3TA 1RTDA 1IBKJ 4M5NA 2XHWA 4JBCA 4H4KA 2N7CA 2DH7A 1QSLA 1D1UA 1AFJA 3K8WA 2MXYA 4USTA 1HW8A 1Q7LB 3DOMB 2RMLA 4LF4F 1VDHA 3LH2S 4NXNF 2CPDA 3I0SA 4J91A 2V6AA 1UPMB 1VISA 5HAOA 3FQKA 5KG2A 1U6FA 1W2BR 2HBZB 3P6YC 4QQBA 3NWGA 4H54A 2PA3A 3CJ4A 3F56A 4K0KJ 1X9WA 1XTZA 4NI2A 2C3PA 2G0IA 2KL8A 3H40A 2KT5A 3ONQA 3KXDA 2HIYA 1C0TA 2K06A 4QWCA 4GMKA 3SCJE 1OSDA 3MCMA 3MECB 4USMA 1BD6A 3DRSA 1TKTB 3K5LA 3VAGA 4X62J 2D9OA 5I3UA 2CJKA 3QJLA 4P7VA 3C16B 2IVYA 1Y11A 2HWTA 2QLWA 2AIRB 3AT1B 3U7JA 1CC7A 2HMIA 5BR8J 5B0CA 3PRDA 1FX2A 3IWLA 2ZHOA 2B4UA 2OGUA 3TJ9A 2DITA 2VFVA 5L9XA 2Y0SD 5DDOC 2NXEA 2CADA 4YN3B 3QYYA 2HZCA 3SCLE 1UETA 3M2UB 2RQ4A 2WBRA 1S1XA 2VASA 3IS9A 1B3TA 4NLPA 5KFJA 3TR5A 1JLGB 2H48B 4ANCA 3PW4A 1F60B 2BABA 3D6MB 4N5SA 2Z58B 4A8WA 4LSNA 4URGA 3FRYA 3TX0A 3P5TL 3HHLD 1K1QA 5GADI 5D0EA 2QTWA 3MM8B 4QIFA 3M6UA 1FJGF 5H9EK 5C25A 1MSWD 2EKYA 2HURA 4WKYA 1UA1A 3ITHB 2VHGA 3VAJA 3CJ2A 4N8NA 3HT0A 2W2OP 2POKA 4M5DA 3QRPA 2R7QA 1Y00A 3FKBA 5A8WB 5JUMA 3E8OA 3H59A 3PZPA 1R6YA 1KN6A 2AJFE 2HZVA 1WKJA 2OPPA 4Q0BB 3MEDA 4Y2KA 1JQGA 1RAEB 5I3QA 4LF7F 2CFXA 3MPWA 2MQPA 2V50A 1HI1A 5HBMB 5HN0A 4RU9A 5ETMA 3ZTPA 3S1TA 1L3KA 4WXWA 1KS2A 3PG9A 3FNNA 1YQHA 1LWEB 1RTIB 3FEYB 2VJUA 1VLYA 4IOAQ 1K47A 2BJ7A 4JI7J 2XULA 3EE3A 2DNHA 1JLQB 4OL8A 2E5JA 3CCWA 3VAHA 2QMXA 3CDBA 4B9UA 4TQRA 3KG0A 3HI9A 4DV1J 1PO6A 3KK1A 1L5UA 1T9WA 1TUWA 2FY1A 2DR8A 2MZRA 3PTWA 3PX4A 1U0HA 3Q8SB 3GFZA 4NPOA 1IBMJ 2PMWA 2FC8A 3FEZA 1HHSA 2HNZA 1T02A 3RZAA 3BYPA 1APSA 4FYVB 3TQEA 1S59A 3AHPA 3HHLC 2B0GA 4WP9A 1DAXA 2VDHA 2ZOGA 3DOLB 4KHRA 4B3OB 2YNFA 2B4OA 2ASLA 1X5PA 2UXBJ 2AW0A 1Q81T 4OHWA 1AA1B 5HSPA 4ZN3A 1FFGB 3GJTB 2YPYA 3IWXA 3S7RA 1RUSA 3N28A 1TL3B 2DRDA 3D0IE 1TV6B 1HWKA 3DRXA 3O5TB 4LFAJ 2H9ZA 1MU2A 1W2IA 4RWWA 2MZSA 2V2QA 2OELA 3VALA 1FVQA 2DISA 3UFCX 4J9LA 2HBQB 4I69A 4LSLB 3TVKA 2MJUA 3DRRB 1L3TA 5DQIA 1I1GA 3EX7B 4Z2XA 4ATNA 4URSA 2Y8YA 2AD9A 3JB9k 4QU6A 3GE9A 4LMZA 2ZDPA 4A8SA 1VI7A 2V9WA 1JLFA 3QIDA 1X8DA 4PQAA 4OI4A 3M9OB 2BM1A 3CDUA 2BJ8A 2C2DA 4OI2A 2MHEA 4KGXB 4Y00A 4C0OC 3TI0A 2F8EX 1TU0B 4ETZA 1VK8A 1KLNA 4AL6A 4LFCF 5D4NA 1NJIT 4JI4J 2KH9A 4WPAA 4OYIA 3MPYA 4B9VA 5KOXA 5CXTA 1WUUA 4N41A 1FXRA 5J2PA 4CTAB 1XJWB 2BVZA 4PAAA 2LQJA 1FKPB 1YG0A 4LF9F 3PV8A 3UD5A 2V8HA 2DO4A 2HLTA 2NPIA 2BUNA 2DGVA 1U2FA 4CM0A 3CMES 2WSFC 4IR1A 1FF2A 4QIGA 4HACB 5KG1A 1V9OA 2OFGX 3I9ZA 4J9VA 4TYAA 4LF4J 3D1HA 2ABYA 1S6QB 4NXNJ 2LA6A 2HRYA 1X4DA 3Q8RB 1VIOA 2G2ZA 1CJKB 2X3DA 4OX9F 4O4RA 4DQRA 4USHA 5IWAF 3HM9A 1JXLA 1W25A 3OTCA 4ZP9A 2QZ8A 3QO9B 4NWBA 1HWLA 2KXNB 2DGXA 1RT7A 2W4CA 2FJWA 4M94A 4NLUA 1G3OA 2DR6A 1FDDA 3CCTA 3AXKA 5KFKA 4NYPA 1TK8A 1SC6A 3HJFA 1ZM9A 3CXCR 2RUSA 3CSKA 4G6VB 2JL9A 1F2HA 3OJSA 1T3OA 4IRKA 3SDEA 2IC3B 1B99A 2BBEA 2RH3A 4N77A 4WZQA 2GW8A 3DLGB 5G0RA 5C42B 2F65A 2U1AA 3J7ZT 2XZWA 5D3GA 2AJ2A 5I4MA 1RTJA 2CKWA 2JC1A 4A8OA 5C2GA 5GAGU 2ERRA 1PSDA 3MPUB 4J9NA 2WZ1A 2BZ2A 5HQ8A 1LQ9A 1S6UA 3K5OA 4RW7B 1URRA 2V8VA 3HKWA 5D78A 4RBUA 4DL2A 4ED0A 4P2XA 1VQOS 3PY8A 2RIJA 2O01C 2CPYA 1CULA 3N79A 2IM3A 5F3ZA 3BH7B 3H7HB 4UY85 4MK8A 1R8CA 2Z2YB 4FBTA 1UEUA 2GJ2A 1M0SA 1XWLA 2MKCA 3ISZA 4RW9B 4NMLA 2YTCA 3QAEA 7AT1B 1WC4A 3FDSA 3W66A 2LVWA 3UN3A 1HQUA 1FJGJ 3VR1A 1RT4A 2D3O1 1SC3B 5HP1A 3LP0A 4CH7A 1RTDB 2YKPA 1YJRA 3B8HA 2IM0A 5IM0A 3CWJA 2P8IA 1BUXA 1FJEB 5KFAA 4A8MP 2R7OA 3I0SB 4B17A 2UXDF 2CUYA 2IVMA 2C42A 1S72S 2OSRA 2QA4G 1NAQA 2FLNA 3PW5A 1TKXB 1MROA 5I42A 3MM6A 2AV5A 4O3OA 4NI2B 1KVIA 4DCPB 4USUA 1T0TV 2RQKA 4PXBA 1X7VA 4CZCA 2WONA 1IM4A 2HGLA 3DRSB 5L1LA 4FPRA 3G2XA 2ZJRQ 2RRAA 2E5GA 5MAOA 2XNQA 2WCXA 4ZVSB 4WTOB 2WOMB 5LXRA 1RAOA 4F0KA 2WW8A 2HMIB 4P6QA 2W24A 1G2EA 1VRTA 3HHNB 5LMNF 3S8SA 3TYTA 2I8EA 1S0VA 2OHDA 3RRGA 1RB0A 3CIMA 4JV0A 1L3SA 5KFMA 4DV3F 2GV1A 2PMHA 2VU5A 1N52B 1S76D 1VBXA 4EBDA 4GRSA 3HSDA 1PYTA 1N5TA 4Q8EA 1SCJB 5ETNA 1U1RA 3BKTA 3IS9B 2V94A 4OYOA 3CPWR 4H4KC 4FF4A 4J5OA 5HVGA 2RKIA 2UZAA 1V6HA 3NOGA 3MXHP 1RKIA 1L3VA 4G3IA 1GNKA 1LW2B 1WHWA 3BSNA 4W92B 2LKZA 1NNDA 3Q8QB 3OSNA 5C25B 2VKZG 2YWWA 2FHKA 4K4YA 3AD7C 2A6MA 3TW0A 3GPAA 1RADB 4DX6A 3MM5A 2YNGA 3J81j 1C4AA 4M5DB 2NSCA 2ZBPA 1S9FA 4ZVRB 5KG0A 4ZKAA 2YWFA 2I38A 1E6YA 3NCPA 2OPPB 5HMWA 1QJHA 3PJXA 3KJVA 1F6TA 3D67A 4ILMA 1X0PA 1M1KT 1LXJA 3SSQA 2KHCA 5KT3A 2FHMA 2LEBA 3EPIA 2QLJB 1VYAA 1HBOA 3D2WA 1OYEA 2VIHA 4DR1J 3J7YI 4WFNQ 4PUOA 1R8HA 4LRFA 1BHNA 2JOQA 2W2PP 3K59A 3UCZP 4R8UA 4I4BA 2KTQA 3WIVA 5KG5A 4LFCJ 1X4EA 3LALA 2Y1LB 3DLBA 3T1AA 4NXMF 4NA2A 3PYGA 1ZH5A 2IDLA 3V6KA 5DETA 1Q4RA 5L39A 3VAFA 4LF9J 1R6VA 3KK1B 2EBGA 5EUHA 4DL7A 4IUFA 2AQ4A 3QSIA 1CS4A 1RWPB 1PAEX 2NR0A 1U0HB 3I0RA 2JC0A 3M1VA 2ZHAA 2MJNA 3LAMA 3F0NA 1JNZB 3W2WA 3K5MA 4B9MA 2HNZB 1VJQA 4O44B 3PVXA 3EXYA 3W61A 1PG5B 3OJUA 4DSKA 2LMIA 2R7XA 1YIJS 3KLFB 3MR3A 4DV2F 1S57A 4MFBA 4OX9J 3FCWA 4ED4A 4ZLJA 1X5SA 3QGPA 5IWAJ 2ZHBA 1O0PA 2E7WA 4IH6A 1FCAA 1NDPA 4CLSA 2GJFA 1WKLA 3GP9A 2HNDB 3R1LA 4PCQA 2LQ9A 4YB7A 3EVMA 5AJ3F 3C2PA 1FNOA 2PGCA 5F8HA 4FS2A 2YX1A 1EARA 1MU2B 3GILA 1AZSA 2MYFA 3EGNA 3DNCA 3VAMA 4CM2A 2CNNB 1BE4A 2ZH8A 1NRKA 4OJGA 3ENVA 4HKQA 4FXVA 4ITSA 4YP3A 1REVA 2YY3A 5RUBA 3W5YA 4RX6A 2XYPB 4ANDA 4KO0A 2DRBA 1P9YA 2IFXA 2DXEA 4EGLA 3QJJA 1CBKA 1WI6A 2GVZA 1FWLA 3KK2A 1YRUA 3R5JB 2BKOA 1WDTA 2G4BA 3O3LA 2RS2A 4IFYA 1JLFB 2JSXA 2YWHA 3GYXB 2J9DA 2XTJP 2DVIA 4YQWA 2BV3A 2HGMA 4PQUB 3N6LA 3M2RA 1NDKA 3MGJA 4BCAA 2IBOA 3MMJA 5MLCV 2ZM6F 1B4SA 3HXMA 3BQ2A 2YXLA 2A6OA 2I6WA 1RISA 1YRXA 4IOBA 5HQLA 2DGOA 3LW5C 4RNOA 4F3QA 3A12A 5HJXA 1QAJA 3H5UA 4LF5F 5L46A 3KNAA 4KV8A 4LQ3A 1DQ8A 3OLAA 4FF2A 2QLXA 2CIMA 4OYMA 1Q0NA 4F26A 2UXDJ 1TL7A 5AXNA 2A10A 2EFNA 3ILLA 3GSDA 2FIUA 1Y0HA 4DUTA 1UFKA 2IM1A 1Q8LA 3PYEA 1S6PB 1MW7A 1CQNA 5A0YA 1Q86T 2ZEJA 1DTQB 4OYZA 3EYZA 2W01A 1SJ3P 2VA3A 5CYQB 3C14B 3VQSA 2XWYA 3M32A 3CCJS 3KJNB 1KOHA 2J0XA 4QWAA 4NRUA 4U7UK 1GX5A 2ZNZA 4C7QA 2UUCJ 4MK9A 2ZKTA 4NX9A 1CQMA 2ZJPQ 4OX6A 1BXNA 1HI0P 3DRPA 2GIQA 3W9JA 2AX1A 2BYCA 5C2CA 2JFDA 2AYBA 3OTDA 3GIRA 5G0RB 5D8HB 2YKMB 4A8FA 4D3GA 3O8WA 5GMEA 5K9FA 1RTJB 4GVBA 4QIVA 2GFFA 2BE2A 2EW9A 2Q1LA 1VQ5S 4PRFA 4A8KA 3B4DA 3UQSA 1IR2A 1T7PA 4J7CA 1YHQS 3WQPA 4ZJOA 5IC6B 3CCUS 2J7KA 2NXCA 4HT7A 3ICLA 1X4HA 4ZPCA 5T7LA 4LREA 5E2QA 5HATA 3CJSA 4EYIB 1NU4A 4DV7J 3DMJB 4CCHA 1Q7YT 2FHOB 1XBWA 1HA1A 1HFEL 4DZDA 3PCOB 2RT3A 4P2MA 2XS5A 3N6MA 3MTKA 1FO1A 4LF8J 1TFWA 1Q95G 4QW8A 3LGHA 1TR0A 4JB8B 1UCNA 4IRCA 1NSAA 2HVEA 5KFRA 1HPZA 3NWRA 2DHXA 1QAYA 1RT4B 2BX6A 1U6BA 3LP0B 4AT1B 1TQLA 4JI2F 4TY9A 4EFAC 4XPEA 1UA0A 2X51A 1LK5A 5IM0B 2R7UA 2GO9A 1KP6A 5IT4A 3G8SA 2BJ3A 2RJZA 3QT5A 2QA2A 2Z2MA 4LQ9A 1D8YA 4HI2A 2QSFA 1RKJA 1REGX 4NMXA 2VL1A 1N5YA 2HFSA 3KJQB 2YX7A 2OI2A 4I67A 1HNVA 2QLFB 4F4AA 1Y7PA 2GO8A 3CJ3A 1MROB 3MM6B 2KM8B 5HLFB 4UW2A 5K5MA 3Q83A 2C2RA 2XLIA 3KTQA 2FJEB 2LEAA 4Y34A 1NKEA 2ZH4A 4JI8F 1SKSA 1Y3JA 4CLPA 1Y5IB 3I6PA 4NXMJ 2GQQA 1E6VA 5F8MA 2C2KB 5A8RB 2FB0A 2PC6A 4OYBA 1OY9A 4CO2A 3BGRA 4RUBA 2GIRA 1FRIA 2CQ4A 1W26A 3SV3A 1VRTB 2W9CA 1QAXA 3D6TB 1VK3A 2QMUB 2DNGA 5F3TA 1IBCB 7FD1A 4J90A 2AJ0A 4QU7A 2OEJA 3JSMA 3NBPB 3RRKA 4FVMA 4ELVA 2W2NP 2CDRB 1WWHA 2G13A 4DV2J 4DQSA 1MMLA 4FYDA 2B7CB 1S1UA 3ZXWA 4EZ9A 4RW4A 3LWMA 4ED5A 3PNIA 1HNZJ 2IRYA 4GC7A 1H2VZ 2AHOB 3IXQA 2AYEA 4H4MB 2RKIB 3WC2A 5K20B 2V4RA 3NS5A 4UQGA 5CZVA 1TZ0A 1VGYA 4YS2A 1EHWA 2B51A 4WF9Q 3MMAB 3UCGA 4LT6A 1TTHB 2ASYA 3MM5B 2J0WA 4PABA 2X7IA 3AJ1A 2KM8C 3PM9A 8AT1B 5EGYA 4DG1A 2ATLA 1U7LA 5ETOA 1U48A 3HK2A 1FI4A 1E6YB 1Q5YA 4PPZA 2JVOA 3RAXA 1Y4ZB 2V2KA 4CO5A 3CEDA 3O1LA 4QWDA 1C1CA 3BR9A 4I56A 4O3RA 2VOOA 4WXOA 2I5JA 5IT0A 1SC4B 4UY8T 2M0GB 5KFCA 1RABB 1WEXA 2F9DA 1BGXT 1M5PC 2H51B 5K8PA 3Q8UA 3BN4A 1LFPA 3CJ5A 4FDFA 2PFDA 1BY9A 5HANA 1SQEA 1G7CB 4R8UB 4OFZA 4GVLA 1GMWA 2C2OB 3NGDA 2BQ3A 5DO2A 2ZM6J 3IP0A 4TKTA 5GVQA 3S01A 5LJ3Y 1YDLA 3ZO7A 2C2NA 1YVFA 1B0TA 1R7IA 1RT3A 4X4PA 3HZEA 1MWYA 4A8XA 5CYJA 3CC2S 3W9IA 4UOFA 3DXBA 3IM9A 3TUZC 4DR6F 3LF0A 3AJ2A 4WCEQ 1JWWA 2BJDA 1CJTB 1HYSB 1QUVA 1YBTA 4KB7A 1YJNS 4L74A 1RT6B 2CJYB 2PE8A 2MMYA 1CS4B 2ROEA 3D28A 3I0RB 4LF5J 1UFWA 2XCPA 2XZTB 2QEXS 1S12A 4F04B 2XLJA 1FHTA 4YR0A 1IR1A 4MFBB 4ZPAA 1FRMA 2V2VA 3PW7A 3U1MA 4WWSA 3NNHA 3AA8A 2J6SA 4PG5A 1RBOB 3AFGA 1Y3KA 1RBLA 5IS2A 3Q8YA 1FJ7A 1FJCA 2V9KA 3DXSX 3H2UB 2R8IA 2F8MA 1LK7A 3TUIC 1NK6A 2MZQA 1UVIA 2CAJA 2HVDA 1AZSB 3C15A 2BKPA 1QUPA 5KT2A 3EJMA 2EVZA 1N33F 1F1BB 4CLKA 4DFJA 1REVB 1RBAA 2VG7A 1XMOJ 5D0HA 3NL0A 3I5BA 2GX8A 2VB6A 3RBEA 2Z56B 1WJ9A 1ACMB 2CNLB 2QL9B 5FDLB 2UUAF 4ELUA 1FVSA 2CJQA 2AEJA 3V81B 3GONA 3KUGA 3LP1A 3K57A 3MR5A 1IN0A 4HTIA 1KHWA 2P2CB 4URQU 1X31C 3M2RB 4F36A 2MQQA 3KLEA 2O1PA 1LWCA 2DY9A 2QA1A 5C5JA 5E7OB 4EO6A 4WP3A 4KE5A 1RCXB 1FE0A 1TMMA 3CO9A 4ZVQB 1HBNA 3DM2B 1GTEA 2DO0A 3Q22A 4KT0C 2FLPA 4UZBA 3QZ7A 1ITPA 1TL5A 4JI2J 2A18A 2RUGA 3RRHA 1YX2A 2EI5A 4DSEA 3FJ2A 4ECWA 3BREA 3K58A 3J80Y 2DJWA 2H1YA 1Q8KA 5CH7B 4YB6A 1V5IB 1ZM2A 2BANB 2MKYA 1YGYA 4UTGA 4U67Q 1WKKA 4FP9A 5D77A 2VDIA 3R7NB 4C8YA 3T6JA 5ETLA 3TUPA 3ZFVA 4ID8A 2HS3A 3QT8A 1TMJA 2WVBA 3W8PA 3DLEA 4C0BA 1U8SA 3PR4A 4TVAB 3B78A 2XI2A 1S1VA 1NCLA 4GKJF 2E7VA 4KH0B 2OPRA 3DDIA 3M32B 3FVYA 2DNPA 4LF2A 3U1LA 4CIOA 4J9OA 1IWAA 5A76A 3G6XA 2HNYA 4JI8J 3EDRB 3JQKA 5AE1A 2C3YA 3M6VA 3SV4A 2VOPA 1JLCB 2LFVA 2CQHA 3U02A 3NMAA 3GFYA 3ZNJ1 5T41A 2F40A 3G6ES 2PN6A 4DF4A 4FYYB 3OFFA 2BE2B 5IXUA 2OTLS 3MOJB 1U47A 2E1AA 5DGAA 3OSPA 4N8OA 4OYWA 4DR5F 2V68A 3C6UA 3G82A 1YZ7A 2DXDA 2V4QA 2I1RA 4F8RA 5DRKA 2RAQA 1WELA 1ZM3A 4IH7A 3VVTA 4DF8A 3W2VB 3UN5A 1G4CA 3M8YA 1NZ8A 2KT3A 3CE8A 2I0XA 2CVIA 5DDQC 1UZDA 4ZJQA 4EK2A 2BRKA 2ZDOA 3OTEA 5KG6A 3KHRA 2PI5A 2BM0A 5F9LA 1S0NA 4IRDA 3B54A 1KNZA 2X1AA 1HNIB 1HPZB 3I4HX 2FJAB 1IKWA 3DHXA 1KKHA 3QSYB 4QOTA 3MCOA 1QAIA 1NPRA 4W4MA 3CW2C 3A8IA 4FXDA 2ZH9A 2KHDA 1H2TZ 2XBPA 2RF2B 2VBYA 2J0SD 3E3XA 3DU5A 1WHXA 2HHHF 3MPDA 2V8PA 3HHEA 3GV5B 2A3JA 2FTRA 1BQXA 4CNYA 1H98A 2NXNA 1XK8A 2O5DA 4QIEA 4ICLA 1RWXB 1HL6A 2JEJA 1SUQA 3MM7B 1SQGA 4ZLNA 3N5FA 4WBFA 3FSXA 3DOMA 3H90A 1HNVB 2IJRA 4JV5F 4AUKA 2YVSA 1IBLF 3KDOA 5GAEU 4BC9A 2N82B 4FKYA 4F25A 1T05B 1F9EB 2ROPA 5KFLA 2M2BA 2DRAA 2YWEA 3MUTP 1WORA 2ZH6A 2Z2LA 4MIBA 1Q82T 4AE5A 3N9UC 1ZYQA 3ET6B 2KZMA 1B7YB 2BKNA 2GA7A 4DV5J 4DXLA 2QFIA 3PEHA 3ZZUA 2R4FA 1XQIA 4MH8A 5DQGA 1N32F 2YQ3A 4DR6J 3DN9A 2VPYB 3KLHA 4BDPA 3BGRB 3QGGA 5KT5A 3B6BA 2WVEA 3MECA 5ETRA 4X4OA 3CD5A 1VFJA 4RNFA 4EI2A 1XR6A 1YI2S 2AGPA 2NUHA 1D3WA 4OZ1A 3BSAA 4C48A 5KFXA 3DLHA 1U26A 3G9CA 2CZVC 1RJJA 3CIZA 4J9UE 3JSMB 2CPFA 4O3NA 1S7HA 2JLEA 3K7RA 2GJIA 1EQ0A 2IIHA 2JX2A 3CC7S 2HHQA 1S1UB 4RW4B 1S0OA 1FFSB 1D8ZA 5M2PA 2X1GA 1FTRA 5F0WA 5DQHA 1AYEA 1ZS6A 3M2UA 4I2PB 4WFAQ 2EC2A 2PFFB 2HKEA 3CDWA 3EZOA 3HT3A 1PBAA 3FCVA 2ZH3A 2VG5B 3IO1A 1YLXA 4N76A 5KFDA 1I94F 2YNIB 4BLGA 2ZUAA 4USJC 5LM7E 4DR4F 2WHOA 3D0GE 2J6TA 2AEMA 1IVZA 1SJ4P 4OQJA 1N33J 2RE1A 2CG8A 3UPFA 4A8YA 3ITHA 3OVBA 1CJUA 1VRQC 4L75A 1Z4UA 1OY8A 4ZMMA 5A2QU 4NL5A 3CF5Q 4C3KA 2CQBA 4ED6A 1F9FA 3VGTA 1C1BB 1C1CB 5A8WA 3ZTQA 1TAQA 2KJWA 3I56S 2I5JB 1NK8A 3ZZTA 1Q79A 1ULRA 4RO0A 2UUAJ 1ZPWX 4AXIA 1HNWF 4Q0BA 1EP4B 1T9XA 3QAUA 5AXLA 4ECRA 1WTBA 1IKYB 1GMWD 5H9FJ 5LSRA 1WG1A 5HBMA 4ED7A 1DBDA 3KDNA 4UUWA 2UVVA 1SV5A 3OUYB 4F2RA 3SCKE 1RT3B 1UWBB 2J5AA 1RTIA 5U47A 1HHTP 4KQZA 3HHDA 1OY6A 1WF0A 4X62F 1NHVA 3ENQA 2ADBA 4ZHRA 3CNQP 2AGQA 4IOCQ 2O3DA 2R8JA 2ZH7A 3OLBA 1FA0A 2LLZA 1IQZA 1J5OA 2W7AA 2DKOB 2MKIA 4YOEA 5KFQA 5H9EJ 2CQIA 1SQFA 3W8GA 2DGQA 4JI6F 2D69A 1PJ5A 1C0UB 1R31A 4KC5A 2AJ4A 3K5NA 2QN6B 1O8BA 3A3NB 3DI6B 2BJEA 1S4EA 3BH6B 2ROGA 5BYRA 4TU7A 1UVMA 4RNHA 3W9HA 4GKJJ 4PXEA 1S99A 2FVPA 4CLTA 2R8GA 4MKYA 4LJMA 3BYRA 2BOAA 3GIIA 4DUZF 4ED3A 3T5LA 4B3OA 2XMUA 3T5KA 1FRLA 3RBDA 3BKUA 3FC9A 2CWKA 4O3PA 1I6JA 4OI3A 2DGTA 3WDOA 1YSJA 3NS6A 3NCRA 1G1XA 4HHUA 3QGHA 3C15B 3VAIA 3MOZA 2ACMA 2PMZD 1FNXH 3TQ1A 4C4WA 4HVZA 3FBFA 4NLSA 1WNEA 1PJ6A 2N3OA 2ILYA 1OMSA 2VG7B 3NY0A 4DL6A 1TV6A 2CPXA 1KC8T 2C2MB 4NLVA 1QSSA 5E3CA 3UD3P 2NSBA 1I3OB 3CULA 4CI0B 1KQKA 5CQGA 3H2VE 4L72B 1SH0A 4NCBA 2MKHA 2QJ3A 4LSLA 1NPKA 3AODA 3HO1A 2YKAA 3HJVA 5KFWA 5BXIA 3D1OA 2B5JA 3QRRA 1LXNA 3LPEA 1MG7A 2EFVA 5KFUA 2OTJS 4K4UA 4PEOA 3FRZA 3KLEB 1LWCB 2FLOA 2DK2A 1YBAA 2KXFA 4ZVGA 3QFWA 2Q3PA 5DLGA 1MWZA 3HHKA 1VC0A 3FMWA 3T1HJ 3VF0B 4C8ZA 1RLDA 2QLBB 3H98A 1VBYA 4CH0S 1NJWA 2XWXA 5F9NA 4CTAA 2HHHJ 5HL7Q 5EWEA 2M52A 1RTHA 3BBFA 1FKPA 3BQ1A 2X3GA 4CT9A 4NYOA 2L48A 4L3KA 1PCAA 2GS8A 3AH6A 2YKNA 4RBTA 1TUVA 2ZITA 3L7PA 5CZXA 4DWIA 2CJAA 3MFIA 2A2CA 5ETKA 2H65B 4JV5J 3DLEB 4KGZB 1NJYA 2GVDA 5HJYA 1IBLJ 4OI0A 1N0UA 2K7JA 4RR5A 1S1VB 1CJKA 3RB6A 2R7TA 2GZOA 1NZAA 3R2DJ 1UW9A 1LWFB 4I0WA 3AY0A 2OPRB 3LAKA 4JP8A 5C24B 2AP6A 2K3IA 5FIIA 4K4ZA 4C0HA 4AL7A 2IRUA 3I9V9 2XC9A 3VGVA 3OXFA 3QT7A 4ZPVR 1J2VA 4C8KA 1KQFB 2BRLA 4HDHA 3MEGB 4OHXA 2C3UA 1L3UA 3IR5B 2W8LA 4NZ0A 3GFHA 2FVSA 2FPHX 3A1YG 1LWXA 2D3UA 3R7BB 3C6UB 1Y10A 3G82B 3DLGA 4DI6A 1TELA 8RUCA 4NCGB 2APOA 2C22A 2XZDB 3RU0A 2FVCA 4ZP8A 1CVJA 2V4JA 4HT5A 5FLXY 2IYGA 1F0XA 2MGZA 2L9NA 3WC0A 2B6AB 4ZLPA 3VTIA 3CTRA 1FRKA 4I6YA 1TAUA 2RU9A 5BYSA 5J2MA 4CLFA 4OZNA 3JXOA 4Y2CA 3I87A 3ILJA 4ECZA 1SC1B 2DR7A 2V67A 1GX6A 1F5AA 4IR9A 1RT2B 4Y0FA 1N56A 4RW9A 1I94J 4DR4J 4WZMA 2WVCA 1HNXF 3E51A 4W90B 2M9KA 3R5DA 2B3TB 1XC9A 3C19A 3GCXP 4O0NA 3OT9A 4B02A 4ICLB 1UVNA 2XMMA 1SUQB 4RLEA 4CWBA 2HSEB 4Z7CA 1TVRA 4FVCA 3OL6A 1HNWJ 1NDCA 1DLOA 3PO4A 2CYYA 3CO0P 1NPPA 5DG9A 2E1CA 1WHVA 3VAKA 2CQDA 2N4CA 2WRMA 4Q8FA 1DQ9A 2XMWA 4NLQA 1ZM4A 1N48A 2GC8A 3DOKA 4DHVA 1TKXA 4OI1A 4OX8A 5D15A 4HH0A 2MLZA 3OTBA 1U1OA 4Q43A 3SFUA 4DL3A 2BQUA 2DHGA 3KLHB 2OEKA 2YNHB 4ECXA 2I9SA 4ANEA 1JIHA 1OPZA 2A1BA 4ID5B 1FD2A 3EGVA 3HF5A 3FSIA 1H2UX 1Y5NB 1LOUA 3B4MA 1P8GA 2E29A 3C46A 4Z37A 2XI3A 2WOMA 5H9FK 4A8QA 3KLGB 3DLKA 4N7TA 5F8GA 2MZ1A 3A8KA 4JI6J 2Z2ZA 1RHJB 1Y9OA 2F8HA 2KXHA 2K3KA 2HHPA 2GAGC 4Z7YA 3D3BJ 1NK7A 1AXQA 4C97A 4TN2A 4NA3A 4UZCA 4ZCMA 3D7SB 3W60A 1V3ZA 2GMHA 4NASA 3DCAA 1S1TA 4J9KA 2DNNA 4DR7F 3IRWP 2AEFA 5K8MA 1VC6A 2XCAA 4DPXA 4DUZJ 4LRCA 1W7WA 1F5CA 5AXMA 1JJCB 3QGIA 3IAS9 3QQCD 2FJDB 1J5EF 3IG1A 3LGMA 2QX0A 4F3MA 1EIYB 3T5HA 3P49B 3SQGB 3FFIA 1LW2A 2UVRA 2B9WA 4LVNP 2IMWP 4PWWA 1VQSA 1CJUB 2DBBA 4YUDA 3H42A 2D9PA 4M8LA 1WOOA 2IA0A 2HFOA 2RILA 5HMXA 2KZZA 1RP5A 1RAGB 1WI8A 5IV4A 3OL7A 3OHBA 1RLCL 4LVOP 2HPUA 4DU7A 1T3NA 3ZTRA 3EDQB 3AD8C 4FNHA 3SYZA 4Y2IA 1NM2A 3H25A 1RHKB 2XQCA 2E5HA 1YJVA 3ZC4A 2D3OR 3MUVP 3KLVA 1SV5B 1EZZB 4ILRA 1RYRA 3FZ2A 4ZDNA 4K4XA 3L9ZA 1H72C 3IN5A 3T3FA 4ZPDA 1YWXA 3HSJA 3ETMA 1URNA 4Q45A 1VBZA 3QMQA 4OV6A 2MY7A 3SXLA 5DZ6A 1VLOA 5KG3A 2AZ3A 4ZHRB 3VQTA 1UVLA 3M6WA 2VQFJ 2VFSA 3PHTA 5ETSA 3O6QA 1JLBA 1J5OB 1V3SA 3EXCX 1IKXB 3M8WA 1NUEA 3OXLA 2LXFA 2AMCB 4P73A 2L08A 4AD6A 2OPQA 4QIWD 1TL1B 3L4BC 4O44A 4I2QB 5GAGI 1KHVA 3MF5A 5HMYA 3KLFA 1UTAA 2MKJA 3ZZOA 2BW7A 4IQMA 2J8SA 6FDRA 1T9UA 4HR2A 3GYNA 4ECQA 2IY5B 4YMEA 3GG1A 4AYBD 4EO8A 4KRWA 2HNDA 1RZMA 2HS0A 4YB5A 4X4UA 4KKOA 1FFWB 1PBUA 2JNJA 2MQMA 3M8SA 4DLEA 2NS1B 5THWA 4FF1A 5AE2A 3GYGA 3VZIA 1KDNA 2HHTA 1GXTA 3SZ2A 2HHXA 4DL4A 4HYKA 1TL4A 5GMKa 2IA6A 1JXEA 3KMSA 1T03A 4I64A 2LU1A 3R1HA 2B5JB 4WIIA 4CP5A 1S5ZA 4QWEA 3CMQA 3JTOA 1VIXA 3PJWA 4P74A 4WFYA
chains in the Genus database with same CATH topology
2ZE2A 5CZVA 1TZ0A 5B09A 1OO0B 1VGYA 4DSIA 3C8YA 2RS8A 1UL3A 2MKKA 4BC7A 2EFGA 1SI9A 4ERDA 3KG1A 4DR1F 1UW4A 2B51A 1N54B 1S9EB 2IC3A 4X4RA 3GIMA 2ZZNA 4WF9Q 3MMAB 3UCGA 3UW1A 2A2DA 2KRBA 1LW0B 4FXWA 1HBUB 4LT6A 4OV1A 4PQUA 2HHWA 4QR0A 2ZD1B 2W4DA 2NLWA 2FDNA 5AXKA 4AXJA 5A8KA 2K2PA 5T14A 2ASYA 2YWGA 5C42A 3MM5B 2J0WA 4UQTA 4QJVA 4D3HA 3TX8A 3GIKA 1K9MT 5K14A 2BW2A 2XMVA 3AJ1A 4DV0F 4EBCA 2IJFA 2YNFB 3L7OA 3PM9A 4G1IA 2KM8C 1YITS 4Y3CA 4NZ6A 3US5A 5EGYA 3QWUA 3BGFA 4DG1A 2CPEA 1FE4A 2ATLA 1FTCA 1U7LA 2HFNA 4PKDB 3RB3A 4NLGA 4P7TA 3GIJA 1U48A 3HMJG 3HK2A 1E6YB 1DURA 5B0AA 3LANA 1OSCA 4PPZA 3NNAA 2MSSA 3E01B 1VJWA 2JVOA 1JKHB 4NA1A 2AWZA 2JEIA 4RW7A 3G6YA 1AFIA 3RAXA 5F8JA 1RTHB 3MD1A 5IQQA 4OX7A 2ZC3A 1Y4ZB 2V2KA 4A47A 2E66A 4CO5A 3CEDA 3O1LA 4QWDA 1C1CA 2E5LF 4B3RF 1Q16B 4PG6A 3BR9A 4XAKA 4I56A 4O3RA 2VOOA 1XN9A 2CQ2A 4WXOA 3V5RA 2I5JA 5IT0A 3H4BA 4B9SA 4LIWA 1JX4A 4UY8T 2M0GB 5KFCA 2YNHA 5E3QA 2YKNB 2PDAA 1KR4A 4XDCA 2KYXA 3I5AA 4QPTA 1FEHA 1WEXA 2DHSA 2VG6A 2F9DA 3MAHA 2UUBF 4F67A 2HS4A 1BGXT 2XMJA 3PFEA 1FKOA 1IKWB 2FGOA 1M5PC 1H38A 1TKZB 2HFZA 3KYLA 5K8PA 2DR9A 5B7WA 4BS2A 4OHYA 3OL9A 4ID5A 3UDLA 1KQSR 2OLWA 3AB4B 3BN4A 1LFPA 4C3MA 3CJ5A 1P27B 2BACA 3V6DA 3OBIA 1RDRA 1BY9A 4WK3A 3V6JA 4JI4F 1SQEA 4I7FA 1G7CB 4R8UB 1MMNA 4DV4F 1BC6A 4OFZA 3KHHA 5DS7A 3THTA 4TYBA 4ZA1A 3NGDA 2BQ3A 5DO2A 5L1IA 1ZBTA 2GHWA 4TKTA 5GVQA 3S01A 5LJ3Y 4FBUA 4JV2A 3C66A 3KLGA 5CA5A 3MR2A 3CGIA 3BJYA 1YVFA 4EWTA 1B0TA 4NLRA 1S6PA 2EK1A 6FD1A 1R7IA 1RT3A 1XEZA 4X4PA 1P9QC 4LUBA 5L1JA 2N4DA 3HZEA 3TA0A 2C28A 1MWYA 2FGCA 2IM2A 4A8XA 5CYJA 3QJPA 4Q5VA 3CC2S 1DTQA 1HBMA 1R27B 1SJRA 4TY8A 3DXBA 3R3TA 3TUZC 1RTDA 4DR6F 1RYSA 2AYMA 4ECYA 2XHWA 3LF0A 4K5RA 4JBCA 3AJ2A 3Q8PB 4H4KA 4WCEQ 1UMJA 1JWWA 2XG8A 2BJDA 3HVTA 1HYSB 5KOWA 2N7CA 5CYQA 1QUVA 4DQQA 3ULHA 2DH7A 3TOQA 4KB7A 1YJNS 1QSLA 3PRBA 1D1UA 1AFJA 5B0BA 3K8WA 2MXYA 5KFFA 1NJXA 1HW8A 1Q7LB 4L3NA 2RMLA 1RT6B 4LF4F 2OD4A 2PE8A 2OH2A 2MMYA 3LH2S 4DX8H 1FESA 5ADZA 5LSLA 2ROEA 3D28A 3H5XA 2DB1A 3I0RB 2EFOA 3VCDA 3MMBB 1IKVA 1UFWA 4NXNF 2CPDA 3I0SA 2DHAA 4NOHA 3I5CA 4PWDB 2M8DB 3UI3A 2XCPA 2VFTA 5JVHQ 1GQEA 3FQKA 2QEXS 4ZPBA 1KEKA 4DS5A 5DDPC 4WTYA 1DQAA 4NLDA 2ZJQQ 2QSWA 5KG2A 1U6FA 4C11B 2XLJA 1W2BR 4CO1A 1FHTA 4YR0A 1H6KX 1KQGB 2EC0A 3P6YC 4QQBA 1HW9A 1BLUA 2GNKA 2Z8QA 2PI4A 4EBEA 2YKMA 4MFBB 5J2PB 3SQGA 4ZPAA 3NWGA 1FRMA 4H54A 2PA3A 3CJ4A 2J7UA 4QYZJ 3F56A 3FGVA 1X9WA 3EZ5A 1GTHA 4F4WA 1XTZA 3PW7A 2B43A 4C8OA 3N4WA 4RW6B 3U1MA 1UJ4A 5KFYA 2C3PA 1WEYA 3NNHA 1HWJA 1YJ9S 3AA8A 1X5TA 3HVWA 3H40A 4ES2A 2J6SA 2KT5A 3ONQA 4KGMA 4PG5A 4R5PB 2RDJA 1Y3KA 2V4JB 5LSOA 1IXKA 1C0TA 4XPCA 5IS2A 2W4PA 2MGZB 4QWCA 2FC9A 4GMKA 1FJCA 3SCJE 1FJ7A 1OSDA 2V9KA 3DXSX 3MECB 4V19J 3H2UB 3NRBA 4JI0F 2R8IA 1BD6A 2F8MA 1TKTB 3DRSA 1LK7A 3K5LA 1JK9B 3TUIC 1NK6A 5LMUF 3L09A 1PC4A 2D9OA 3VAGA 1QM9A 5I3UA 2CJKA 4LF6F 3QJLA 4QR1A 4P7VA 2FJXA 2DD8S 2IAJB 2MZQA 2IVYA 3BM7A 2ALZA 1UVIA 2HWTA 1IQTA 5J2MB 2QLWA 1CPZA 4WFXA 2LQ5A 5EDWA 3DMJA 2QIFA 4Q44A 3U7JA 3DRYA 2D1CA 1CC7A 3N01A 4CH1A 2FVRA 2HMIA 3RR8A 3J7YU 5B0CA 3MWBA 1QUPA 2JZ5A 3D54A 4I6AA 3OFGA 1H7XA 2KT2A 3PRDA 3OR2A 5KT2A 2QO3A 2BDPA 4KFBA 2EVZA 3BF4A 3N0VA 3IWLA 3CCSS 1N33F 2ZHOA 2B4UA 1VQ4S 2DITA 2PEHA 4E0DA 3GV8B 4DFJA 1REVB 2VFVA 5L9XA 3UCUP 1FD8A 3K8VA 5F8NA 2VG7A 2Y0SD 2ZC4A 2DNKA 5DDOC 1YRTA 2GHVC 3SSRA 2BXJA 1RT7B 3BGLA 3NL0A 2OPSB 3QYYA 3I5BA 3KMQA 2HZCA 2GX8A 2VB6A 4QWBA 3RBEA 4JYAF 3SCLE 1UETA 2MZJA 3HVRA 3M2UB 3JAMY 4RKUC 2DNOA 2E5IA 2RQ4A 1FDNA 4IO9Q 3PXGa 5FDLB 2UUAF 2WBRA 1S1XA 2CQCA 4J37A 4ELUA 1FVSA 3F41A 2CJQA 2VASA 1ZAVA 2C3OA 3IS9A 3V81B 4KJIA 2RRBA 2AF6A 2WK4A 4NLPA 5KFJA 3TR5A 3LP1A 1JLGB 4ED1A 3K57A 3MR5A 3M8PB 5A6WA 1IN0A 5EX0A 4HTIA 3SDEB 3PW4A 1KHWA 2R7VA 5CCMA 1FT8A 4URQU 1DTTA 1F60B 1TVRB 2BABA 3WX4A 5KFBA 1A9NB 4N5SA 2D7SA 1VHFA 3WZ0A 2MHNA 4KPYA 3M2RB 4A8WA 1DLOB 2JLFA 4LSNA 4M95A 1NO8A 4URGA 5EWGA 3FRYA 2YKOA 5GAHI 5D3GB 3P5TL 2MQQA 3HHLD 1K1QA 5GADI 1FRHA 3KLEA 3MM8B 1VC5A 2O1PA 1LWCA 4QIFA 2QA1A 3POTB 1S1WA 3M6UA 1FJGF 1IKXA 2Q43A 5C5JA 5E7OB 4A4JA 2EKYA 4EO6A 4WKYA 5C25A 4MKBA 2R9LA 1UA1A 1MSWD 4KE5A 4ECVA 3ITHB 1FE0A 3V6HA 4GO5X 1U1QA 1C4CA 5M2RA 5KFZA 3CO9A 3VAJA 3CJ2A 4N8NA 2OMLA 3DOKB 1IJEB 1HBNA 2POKA 3DM2B 1GTEA 5J1EB 5B0EA 2B56A 2DO0A 3Q22A 3IC1A 2GMLA 4PWUA 4QR2A 2VQEF 3D5MA 2VA2A 4LFAF 4M5DA 4KT0C 4XIUA 5HROA 2R7QA 2FLPA 1Y00A 2ZNYA 5HLFA 3DYAB 5A8WB 3QZ7A 1U4BA 1TL1A 1TL5A 2A18A 5JUMA 3JTPA 4I2QA 2RUGA 3E8OA 3G4SS 3H59A 3PZPA 1R6YA 1NH8A 1KN6A 3RRHA 2EI5A 1D9AA 2AJFE 2UUCF 4FN5A 3TAMB 3H5YA 3FJ2A 4ECWA 4DSEA 2OPPA 3BREA 4Q0BB 1M5KC 2R7RA 3MEDA 3K58A 3J80Y 4OJHA 2PO4A 4OIXA 2DJWA 1SL2A 1JB0C 5CH7B 4Y2KA 4YB6A 2UV8G 1ZM2A 2LXIA 3CD7A 3M2VB 2BANB 1O51A 3PR5B 3IBWA 4WYWA 5A8RA 2R2RA 2FJBB 2F9JA 2ZBCA 1YGYA 5I3QA 1X4FA 4LF7F 2CFXA 3MPWA 2MQPA 4U67Q 4Y6IA 4FP9A 1HI1A 4MYTA 5HBMB 1FRJA 4OZ5A 5HN0A 1NB7A 4X2BA 5D77A 2PT0A 2XSJB 3Q23A 4RU9A 3N6NA 3G8TA 3EZUA 3S1TA 2V0NA 2YKQA 3QWPA 1HQUB 4HHJA 1L3KA 4C8YA 3T6JA 1OQ3A 3DLKB 4WXWA 4Y28C 3ZZRA 1KS2A 2XY5A 3ZFVA 4ID8A 1KLMB 5HP1B 4OJ3A 3K2YA 1M5HA 4IG3B 2HS3A 3UD4P 4RWXA 3OFEA 3FNNA 3DLEA 4C0BA 3J7A1 1U8SA 3PR4A 3GMGA 1YQHA 1LWEB 1RTIB 4RUHA 3FEYB 3B78A 4UOCA 1ZPVA 2XI2A 1VLYA 4JUZA 1H0HB 4IOAQ 1S1VA 4OLOA 4GKJF 3LP2A 2E44A 3VZHA 4OZJA 2XS7A 2OPRA 1WD6A 2B4PA 2QT7A 3M32B 2XULA 3RAQA 3FVYA 2UU9F 5F8IA 4IDKB 3NBPA 4KR0B 2RQCA 2DNPA 3IGVA 2DNHA 1JLQB 4OL8A 2E5JA 3U1LA 4CIOA 3G6VA 4J9OA 1Q53A 3CCWA 3G6XA 1ZZFA 2HNYA 1S1TB 2WB4A 3ZZPA 1N88A 1WG4A 3VAHA 2IRXA 4DV7F 3RW6A 2QMXA 2B4VA 3KLIA 3MM9B 4CO0A 2GGPA 2GHPA 5AE1A 4WE1B 3CDBA 2C3YA 3M6VA 1GAOA 4B9UA 5F8LA 4TQRA 3KG0A 3HI9A 3SV4A 1PO6A 1DRZA 4U6PA 1JLCB 2VOPA 3T5JA 5L1KA 3I96A 3KK1A 4BHQA 1NKBA 1L5UA 2CQHA 2P9CA 3IA0A 3U02A 1R0AB 3IG1B 4H4MA 4IKAA 2FY1A 3GFYA 2VBXA 4HH1A 3NMAA 2DR8A 5T41A 2F40A 2MZRA 4LF8F 3G6ES 2PN6A 3PX4A 4DF4A 3FFIB 3Q8SB 4MYUA 5IFMA 3GFZA 1NK4A 4NPOA 3OFFA 2QE5A 5KT6A 5I42B 2MDAA 4NCAA 3PFOA 1Z2LA 1X9MA 2BE2B 5E3PA 5J2NA 2KVIA 5IXUA 2OTLS 5IT9Y 3MOJB 4B3MF 2FC8A 3FEZA 4OJ1A 1U47A 1HHSA 1RT5A 3MDFA 4PG4A 2E1AA 2HNZA 1T02A 3MMAA 3RZAA 5DGAA 2RDIA 3OSPA 4N8OA 5KG4A 1LW0A 1APSA 5DG7A 4DR5F 2ZD1A 3HHLC 3AHPA 1BQMA 3C6UA 1VQNS 2B0GA 2WONB 3T1YF 1DAXA 2FD2A 2ZOGA 1JJ4A 3SEOA 3ZZZA 2JHEA 2X1FA 3DOLB 2V4QA 4KHRA 2J0QD 2I1RA 4F8RA 5DRKA 2M70A 4B3OB 2RRNA 1WELA 1X4CA 1ZM3A 4JOUA 2YNFA 4B08A 2B4OA 2ASLA 2H5EA 1WEZA 1ZAXA 1KOOA 2O67A 4IH7A 5DJBA 5KFIA 4DF8A 3DLJA 3W2VB 4Y2AA 1X5PA 3RB0A 2KT3A 2AW0A 3CE8A 2I0XA 1Q81T 2CVIA 4OHWA 5DG8A 5DDQC 2VQFF 3E01A 1HI8A 4HL9A 1X0FA 2BRKA 2ZDOA 3OTEA 5KG6A 2MKSA 3QLHA 2M7SA 4XO0A 4WKRA 3KHRA 2PI5A 2BM0A 2F7VA 2X1BA 3M6XA 1XMBA 5F9LA 1S0NA 2Q6BA 4BWMA 3IWXA 2AYGA 4IRDA 3S7RA 3N28A 1HARA 2XMTA 1TL3B 1KNZA 2X1AA 3PEJA 3D0IE 2RNEA 5E3RA 3SMZA 2IBKA 2EG2A 1HNIB 4EUVA 2VV5A 1JJHA 1TV6B 1HWKA 3DRXA 1RI7A 2VUGA 3O5TB 3PW0A 1D9FA 1HPZB 2H9ZA 1MU2A 1W2IA 2O66A 1XERA 4RWWA 1HQEA 2MZTA 3I4HX 5SUHA 2FJAB 3M8RA 1IKWA 3O44A 4DMZA 2LXUA 2MZSA 3DHXA