1S6OA

Solution structure and backbone dynamics of the apo-form of the second metal-binding domain of the menkes protein atp7a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6oA00
1R6YA 4A48A 1JWWA 1YJVA 2GGPB 3QMQA 2LXFA 4U9RA 4A46A 1OSDA 2RILA 1APSA 3LGMA 2FB0A 2BJDA 1U7LA 1MWYA 3GZ7A 3IWXA 2XMJA 5A6PA 2OKQA 2N7YA 1S6UA 2ROGA 2IFXA 2PD1A 3MCSA 1SQEA 4HH1A 2AW0A 1YJTA 3TRGA 2IYIA 2GCFA 2K1RB 5F0WA 2KT2A 1FE0A 2VH7A 3E8OA 3TNVA 2ROEA 1AW0A 1LQ9A 4QOTA 3HDSA 2ACYA 4HI1A 1Q8BA 4OJ3A 4YDXA 4HI2A 3F44A 4OJHA 2W4PA 2HFOA 2KYZA 2QLXA 1VQYA 2XMMA 2GO8A 2RMLA 3MZIA 2GGPA 5B0DA 3KNGA 3HX9A 1YJUA 1VQSA 1P6TA 2XMWA 1OQ6A 2HQIA 4OIXA 5B08A 4Q2MA 1FE4A 1AFJA 2LQ9A 2XMUA 4A47A 3CJKA 2W4DA 2N4CA 3KKFA 5B0EA 4Y2IA 1TZ0A 5A6WA 3WDOA 3HHLC 2CRLA 2AJ0A 5B0GA 4ZOSA 3LO3A 3LGNA 1KVIA 1TUVA 5K9FA 1TR0A 3HHLA 2ROPA 3KG1A 1SB6A 2AP6A 2K7KA 2IYGA 5B0CA 2QYCA 2OD4A 3QGPA 3T9NA 1WD6A 1FEEA 2OFHX 1KVJA 1CC8A 1URRA 1X8DA 1FVSA 4NL5A 1YG0A 2N4DA 3BR8A 3HHLD 2EW9A 2OP5A 3VTIA 5KAKA 1CC7A 1X0PA 1Y0HA 2HLTA 1TL4A 2JDJA 2OAUA 4A4JA 1K0VA 2BBEA 2KKHA 1KQKA 5B0FA 1Q53A 3I9ZA 1ULRA 4FNIA 4YEAA 1Y3JA 2OD6A 1X7VA 2G9OA 2GFFA 1Y3KA 3CJKB 1YRXA 1OPZA 2ASYA 2BJEA 3DCAA 1CPZA 1Y9OA 4DL0C 5T7LB 2RSQA 1N5VA 4NPOA 2RU9A 5F0UA 1TL5A 5IXUA 1W2IA 1YJRA 2Q3PA 4HH0A 4HL9A 3BB5A 4EFAC 3FRYA 1IUJA 4DPOA 2BUNA 2FTRA 2BYCA 1N5TA 2GA7A 2L3MA 3BN7A 2VV5A 5B09A 5B0AA 4DN9A 3UDCA 2HLUA 1N5SA 2XMVA 1FESA 3DXSX 1P8GA 2FHMA 2AJ1A 2W4CA 1V3ZA 4OJ1A 3HFKA 3IWLA 1S6OA 2ZDOA 1GXUA 2XMTA 3BGUA 2LDIA 1FD8A 2ZDPA 3BDEA 2HIQA 5T7LA 1XBWA 3FMBA 3TOQA 2OFGX 2K7JA 2GV1A 3BM7A 2PGCA 3HHLB 1Q4RA 4ZA1A 1AFIA 3HF5A 1OQ3A 2LQBA 2OMOA 1JK9B 1GXTA 2XMKA 3KG0A 1N5QA 2K2PA 1Q8LA 4OJGA 5B0BA 2KT3A 2HFNA 1MWZA 3FGVA 4Y2KA 2QLWA 1FVQA 4F67A 3K7RA 4Q2LA 1RJJA 2QIFA 3BF4A 2K1RA 1SI9A 4Y2MA 1QUPA 4FNHA 2FIUA
chains in the Genus database with same CATH superfamily
1TFWA 1KTVA 2E1CA 1U09A 3ZO7A 2FJDB 3KMSA 2IPOB 3QFHA 1N36J 3IO1A 4CO5A 3C6TA 3M2UB 4PABA 3ULHA 3QGHA 2FLLA 1RAEB 1S9GA 1UEKA 5LMNF 1HNZJ 1R0BG 5KFSA 5IM0A 2HHPA 3BKTA 3T5JA 1RAOA 1U49A 2E5JA 4LRAA 2BANA 4ETZA 1Q7YT 2YBVA 4C3LA 3NS7B 1D0EA 2DBBA 2GC8A 2BOPA 4ENOA 3HDSA 3LP0B 4IH7A 5DRKA 5KG1A 3T3FA 3CW2C 4RW7B 1HQUB 2B9YA 4ZPBA 5F8GA 1Y00A 1T0TV 1JLFA 3BPDA 3GG0A 2OPQB 3V4MA 4EO6A 2N3OA 4UY85 2AEMA 2RMLA 4ERDA 2GGPA 1FXRA 3R6LB 2GJ2A 5D4NA 1QVFR 4URSA 2XMWA 3SFUA 1FJGJ 1NK9A 5LXRA 2WOMA 4Q2MA 1VYAA 3M9NB 3R1LA 4C8OA 2J6UA 2G2YA 1LOUA 1TQLA 2DH8A 2MQ8A 2FZCB 3DNCA 4DXLA 4XK8C 4L73A 3HHLC 2MZQA 4OQJA 3SCLE 4NEYA 3UCUP 2YKMA 1RYRA 2BV3A 2Q6BA 2Y0SD 3GE9A 3MM8B 4DV1J 4FS2A 2DR7A 3CJQA 2H54B 3EVMA 4CRJA 2DYAA 3RW6A 2EPIA 3EE3A 3EXYA 1N5YA 5D15A 1RHJB 1RISA 2OPSA 2VU5A 4FF1A 3CWJA 2QLFB 4QBUA 1NK6A 4X4UA 3HVTA 2EK1A 1F5AA 4W90B 1HNWJ 3TUJC 3GB0A 1B0PA 1QUVA 5E5NA 3AXMA 3MPDA 2FLPA 1HWIA 1MMNA 3DDNA 1HBMB 3SCJE 4GRSA 4FKYA 3TA0A 1B7YB 4MKVA 1CQMA 2LDYA 4HTIA 3ZXWA 2BZ2A 3I9V9 3DLKB 3IFEA 3W61A 5A8WA 2I5JA 1N52B 2KKHA 1IKWB 2NPIA 2AGOA 3A12A 4QIGA 4WP9A 3N01A 4X62J 3PCOB 2OD6A 3M8YA 4ECUA 2EXUA 3DLGB 1BHNA 4PUOA 1T03B 3R5GA 4N77A 4AFFA 2Z2MA 1IJFB 2RNEA 2PIIA 4V19X 2R7QA 3CJTA 1EP4B 4F02A 2V0NA 2XMAA 1IXKA 2GHPA 2C2EA 1N33J 2BKPA 2AEJA 2IBOA 1TP7A 4DL2A 2PMHA 1IKVA 4GKKJ 5EWFA 3W65A 3VAJA 1DBDA 2J76E 2DHGA 5DZ7A 3ENQA 3O8WA 4C48A 5KFGA 2FTRA 4CLYA 2RDJA 1SC1B 4FF4A 1GXLA 2J6SA 2HVEA 3TVKA 3ZNUA 3TEGA 1YJ9S 1UVIA 1HHSA 1N32J 3D6HB 2MKSA 5K8OA 2MJUA 3HXMA 2HZCA 2C28A 4M95A 3CVKA 1DFDA 1V3ZA 1VK3A 4F04B 2OJ3A 5HBMA 1G4CA 3CC2S 1T9YA 3TANA 3GIMA 3N5BA 1O51A 3VVUA 2F8HA 1CPZA 3D6TB 2B51A 3BS9A 4I64A 4LJMA 4H4MA 1M5SA 2K7JA 1VDHA 2PGCA 4KC5A 2ZJRQ 4F25A 2HHWA 1WC6A 1GXTA 5A8RA 2XY5A 3QLHA 3G6XA 4F4XA 3CXCR 4JV5F 1YZ6A 3EGWB 1WOSA 1FT8A 1HNZF 1MWZA 2ZVSA 3A1YG 4GVBA 1FKAF 4CLLA 1Z4UA 1K0TA 4ZPVR 3AB4B 4M5DB 3JSYA 1S49A 3AT1B 4E2FB 3UD3P 1IBKF 1R6YA 1UVLA 2FHKA 2HWIA 3BSAA 5C7PA 1WTFA 2B6AB 2KHDA 4G1QA 4DHVA 2HWTA 3FZ2A 1X5TA 5HN0A 4AL6A 4IR9A 3A8JA 2V8DA 4N8NA 4A8WA 5HLFB 3ZZOA 1B64A 4ZCIA 5E33A 4PAAA 1BMQB 3HLUA 5A6PA 1QAJA 2GVDA 4C8NA 2JFDA 3JYTB 4LF4J 2KL8A 2M70A 2UZAA 3DLEA 2UU9F 3A3PB 4KTQA 4DPYA 3VR1A 1FRXA 3TNVA 1UETA 2X1BA 3PJWA 2RB7A 1HD1A 4DUYF 1FFGB 1H3DA 4HI1A 5HANA 1JX4A 2X1GA 3KLIB 4I7FA 4OV1A 3CULA 4OJHA 3F44A 1RXOB 2P9GA 3AD9C 1TK8A 2XMMA 4G3IA 2GO8A 4O3PA 1NK5A 1WG5A 1KSPA 2G0CA 2KFYA 3MTJA 1FE4A 4KGZB 3FC9A 1DRZA 1ZAXA 4KYZA 3C19A 5ETNA 2CPDA 3D67A 3S01A 3PEJA 4B17A 3E2EA 4PQUB 3KKFA 3R9LA 2RQMA 1Y5LB 1Z2ZA 1RAJA 2VFTA 3CCZA 1W2BR 3DKDA 4OX9J 3Q8RB 5EN1A 1FEHA 4FF3A 4H4MB 3SSSA 4DR7J 4JI0F 1JLGB 5KFBA 2ZOFA 3P96A 4WPAA 3C6UA 3DM2B 2ASLA 2BJ9A 2JEGA 1OJ4A 1N8RT 4HT7A 1LFWA 1RWWB 2HK3A 5K14A 4WTOB 5KT5A 2NZ4A 4J7CA 5J2MB 4W4MA 1RTIA 1UP1A 3T19A 5GAGI 2V94A 4DBQA 4ECYA 3M8PA 2DXEA 1U45A 2GIQA 3PIPQ 4RW9A 3IN5A 3M8RA 4ZHRB 1RAFB 2QGFB 3IS9A 2IDEA 3PNIA 2L9DA 4A4JA 2ASJA 2ZH8A 1Y5IB 2BMBA 3JXOA 3A8EA 1N88A 3QFWA 3X1LB 2GW8A 2UP1A 4CLKA 1N4LA 3M8WA 4KR0B 4LMZA 2GFFA 2CQPA 3DOKB 5C5JA 2DD8S 3FCVA 1H2VZ 2CQ1A 2XI3A 1ZS6A 3I31A 3MCMA 3N6MA 5AXKA 3BKFA 2IRUA 3GFYA 3KG4A 3NXZA 3ZNJ1 1RTHB 3BEGB 1QVGR 2CPFA 4OZ1A 2O67A 4P74A 4E0DA 2Z4PA 4OI0A 4PUOB 1UEUA 3SXLA 4DSEA 1WSVA 3M4XA 2Y0BB 5E3AA 2B3TB 2ZHOA 4YB6A 2Q66A 2BYCA 4P2MA 1RT3B 2FJVA 4DV7J 5KFZA 1SIZA 4MJKA 2NUHA 4EK2A 1HI0P 1AROP 2HLUA 3FDSA 4WE1B 2QMWA 1F1BB 1KS2A 3H2UB 1R8CA 3MECA 2CFXA 5BYSA 1VISA 5MLCV 2P6TA 4DV6F 2ZDOA 3IG1B 1YGYA 2DNZA 3HI9A 3GV7B 3HVTB 3ETOA 3T5LA 2GMHA 1M1GA 3FRZA 2HFZA 2GV1A 1RT5A 3V6DB 3I0RA 3MMJA 2LECA 5CH7B 4HYKA 4DR5F 3OHBA 3VAIA 1CS4B 1S6PB 1N33F 4DCJB 1BD6A 2CNKB 2HAFA 2VPZB 2FVSA 1MN7A 4I7FB 3KLIA 3OJUA 4J5OA 4B3TJ 2RKIB 1RA7A 4P73A 2YVSA 2VBXA 2AHOB 2I8EA 4F67A 5L38A 1P1LA 3UDLA 5EWGA 3TI0A 2DVIA 4MKBA 2L08A 2WOMB 2VG5B 4DCOB 3J7YU 2XCPA 1AB8A 2R2TA 1WELA 5THWA 2W8KA 3OFHA 4HACB 4IFVB 4OLOA 3DU5A 3QMQA 4PQAA 4JUZA 2DPJA 1S1XB 2V2VA 3NCRA 1B4SA 1TKXB 3UDEA 3G6YA 1C1CB 1RLDA 3BSCA 2BJDA 1O8BA 3MM7A 3QQCD 3HFVA 3KLGA 1K73T 5GMKa 1VQ9S 2XB2D 3R2DJ 1F2GA 3M8QA 1R8AA 4NXMF 4IOAQ 1TFYA 1GH8A 1CQNA 4YR0A 2HGLA 5KOWA 4DV4J 1JLBA 4QWBA 3LP2B 2P6SA 3AFGA 3NY0A 4J9UE 2ROEA 5IM0B 5KFFA 3KTQA 4OX7A 1FRJA 2FJWA 4LF2A 2CQ4A 2D69A 2BACA 3SMZA 2YX7A 4RW4A 1GNKA 1F9FA 4LF5F 3MUTP 3MEKA 4QJVA 5A2QU 2H5JB 3D6MB 2LQ8A 3GJQB 4HHHA 4I2PA 2D9PA 1PJ6A 4ETXA 3KHHA 4M94A 1VQSA 1M5HA 1RAGB 3TAQA 4OIXA 3MGJA 2E1PA 2HFSA 2I9SA 3KDNA 5KT7A 3Q24A 4ED3A 3CJKA 1WORA 4ZP9A 4NEZA 4P7VA 2LU1A 4RKUC 5JVHQ 1DQAA 1YSJA 3NMAA 1TL1A 2AMCB 2PN6A 4YN3B 4RNFA 3KJVA 4KV8A 1D9AA 2R8KA 1RE1B 2EBEA 3U1NA 1IKYA 1YJ7A 3ETMA 3OFFA 5HVGA 4ED1A 3WIVA 3AAWB 2FJEB 3B78A 2QJ3A 2APOA 1M5PC 4DV5F 1K47A 2R7UA 2P5VA 2AP6A 2RT3A 3Q8YA 1UW9A 2NQPA 5B0CA 2RHSB 3VF0B 3DRPB 3M7VA 4JI7J 4F50A 1FRMA 4ECXA 1U1PA 4RUAA 3CCUS 2DK2A 2EK6A 4OX8A 2AU0A 2A0FB 3M30B 1HIYA 4IYQA 3NBPA 4LRCA 1NJWA 2IA6A 4FPRA 4OLPA 4YB1P 1CC7A 2ZZMA 2M7SA 2W1BA 4MIWA 5B0FA 3DLGA 3RJMB 2XS2A 3AQOA 2DIVA 1NJYA 1AYEA 3GJSB 3JS9A 4MIBA 3ICLA 1FJGF 2DR9A 4Y6IA 4LSNA 3L7OA 4C8ZA 1FWLA 3MFIA 3QWUA 5IZHA 3CCES 2DR8A 3NNHA 3GYNA 6AT1B 2JSXA 5T7LB 4CT9A 4FBUA 4NE9C 4NRUA 4GO7X 3QO9A 3MM6A 3TAMA 1I94J 2OTLS 2BE2B 3FSXA 4Y3CA 4ZJQA 5I3QA 1W2IA 1NH7A 3MPUB 3OTOF 1KQGB 2B4PA 4EFAC 4I67A 3FRYA 4CLTA 4DZ6A 2MQOA 1RTDA 3H5YA 5ETTA 4RX6A 1SVDA 1RAAB 2LA6A 3QWPA 5CYQB 3NMRA 2ERRA 4K5RA 2D3ZA 3NKYA 1WC4A 5DS7A 3DFEA 4BBYA 5JMNA 2MQPA 3I5BA 3OUYB 1ELOA 1GAOA 1RTJB 2KZZA 2AJ1A 2W4CA 1HKAA 2EFPA 3AY0A 4MK9A 1Q16B 2G0JA 3I0SA 5IV3A 4YQWA 1N0UA 2XSJA 3CCRS 3I5CA 5L39A 2CQDA 3MEEA 3W63A 1UA1A 1FD8A 1LEOA 2KRBA 1XMQJ 4K0KJ 1HA1A 4JV0A 1XBWA 2ZUGA 1U1RA 2UUCF 1VQOS 5J2PA 5E7OB 1U25A 3HHLB 3T6JA 4U7CA 3V6HA 1UTAA 2FGCA 3J81Y 1SQFA 1NJXA 2BR0A 1E6YA 3QGGA 3UI3A 1LWXA 2F7VA 1FF2A 3HVWA 3E01A 5IT9U 1JJ2R 5F8HA 4I2QA 4OZNA 2ILYA 1CULA 4P2SA 3H4BA 1FVQA 1RQ0A 1T02A 2OHDA 3R6GB 4Q2LA 1D8ZA 4RWWA 1WHVA 2LLZA 3M32A 2OKQA 1IJEB 5J2PB 4Y28C 5E3QA 3CDBA 5KG5A 4RWXA 1C4CA 3MEEB 1S0VA 4TNOA 2GAHC 4ECVA 1Q0NA 1G2EA 2QEXS 2HNZB 1BWVA 2QC3A 3OT9A 1SBRA 4QPXA 4B9TA 1S0NA 1FRIA 3OSPA 2VQFF 1EQMA 5FDLA 4X4TA 3FFIA 3OD2A 4QWDA 3GLJA 5CYQA 5IWAF 1NRKA 5M2PA 4S0MA 1B3TA 3K5OA 3HHNB 4OI3A 3RBXA 4KFBB 1L3KA 2W9AA 1AT1B 2R8IA 4DV4F 3C2PA 3TX0A 3W66A 1RTDB 1X5OA 2M5YA 3MR3A 3J81j 1V6HA 1X4HA 1OYDA 2HPUA 2BE2A 1HBUB 1LW0A 1LK7A 2Q6CA 3MMAA 2IAJA 2J9EA 4NX9A 1VBKA 2Z57B 2UXCJ 2Q79A 3TA2A 2J0SD 4WIIA 3HD1A 3IBWA 3K59A 3GYXB 2V9KA 2ABYA 4CZCA 3CPWR 3HVRA 1U1NA 5KFMA 3IR7B 2RE1A 1NH8A 2DRDA 3WDOA 2B7CB 2QLJB 2LP4A 3ITHB 4BC7A 5GAGU 5B0GA 3H2LA 4K4ZA 1HWUA 2C3OA 4FBTA 1NKBA 4B9SA 1U8WA 1FO1A 5J2QA 2V2ZA 2ZC3A 4OZ0A 3K5NA 1WNEA 4CLSA 1VRTA 3OR1A 5CYMB 3IAS9 1REVA 1WDDA 2MTLA 4ZS6A 3PV8A 1LWEB 2C2MB 2ZBQA 4D3HA 1D8YA 3DRPA 3QT6A 4KB7A 2PFDA 5GADU 1NDLA 4A8SA 2FHJD 1V9OA 2ZKUA 4NMLA 1ZA2B 4I69A 2QL5B 1RKJA 3TVZA 1IKYB 1Y0HA 4TXSA 3K5MA 3CJ4A 2KZMA 2WONA 5HJXA 1JXLA 4DV7F 1NHUA 3U1MA 3KYLA 4LBHA 1RHRB 4A8OA 4M5IA 2J7UA 3CJKB 4AT1B 4DZDA 2ZH4A 3JAMU 3P45B 1X4BA 2V2QA 1S59A 3DLBA 2CXEA 2GQQA 4NZ7A 3MTKA 1P1TA 1FKPB 3NWRA 3QYYA 5DQIA 2F4FA 1RBAA 2Y9HA 5CHCB 2CJQA 1KKHA 4KH1B 3V4IA 1WHYA 2EFOA 2YNIB 3OBIA 4ZVUB 1R6VA 1S1VB 3I4HX 2B8PA 2DHAA 1NM2A 4MKAA 1T3OA 4QCLA 1VLYA 2CWKA 3R5BA 5G0RA 3M8QB 4EMDA 1P8GA 4C8KA 1QAIA 3KLGB 2UXBJ 3N4WA 3C16A 3MHYA 3OSNA 1C1CA 4QWCA 3G9CA 1TKXA 3IP0A 3MM5A 3GFXA 4OHZA 4X84A 3KWMA 5KFWA 3EMTA 2C2DA 2MKHA 2DO4A 2CNOB 2UVWA 1W7WA 2C3YA 4A8FA 1MROA 2E5LJ 4UZBA 2AZ3A 2RKIA 3H40A 1Q8LA 1WKKA 3KLHA 2W24A 5J1PA 4K0KF 4DR5J 2BM1A 1S72S 4Z7YA 1MMDA 2HHVA 1VRUA 1FKOA 4OYBA 1PBUA 1PJ7A 2BW7A 2DNMA 4C7QA 1CJKA 5ETOA 3TUZC 3CO0P 2IFXA 1JLCA 1LWCA 2VB6A 1DAXA 2CG4A 4N7TA 4EO8A 1ACMB 4KIAA 4RNNA 5D4OA 3G86A 4JI8F 2XBPA 5KFIA 3W2WB 4A46A 4DV6J 1APSA 5ITHA 1MWYA 2EBGA 2OPRA 1YI2S 3HD2A 3E51A 4PYAA 3BV8A 3CMES 2XY6A 2IC3B 1JJHA 3DI6B 3MCSA 4K8RA 5D6GA 3J7A1 2OO4A 4FYXB 1WC1A 1XR7A 2QRRA 4R5PB 1MN9A 2OEMA 3A3NB 3VWSA 2DR5A 2C2OB 3FUYA 1AW0A 4QOTA 3FEYB 3GJRB 2UU9J 4ILLA 2DCLA 2BOAA 2IMWP 4HI2A 2OSQA 1RKIA 4B3SF 2KYZA 4LSLA 4LF8J 4U96A 3GILA 4ED7A 2VQFJ 2HQIA 4QWEA 1JLEA 3FBCA 4A47A 2XZWA 4ILRA 4R0JA 2MPUA 2N4CA 1EKRA 3CD7A 3J7YI 1NK0A 1KC8T 1J5OB 4DPXA 4N76A 1KONA 4O3SA 3CO9A 3IA0A 4I6YA 4QIWD 4OZJA 1D9DA 4CO3A 1RHKB 2PDAA 2XI2A 2B5JA 4GMKA 4MT1A 1MROB 1P27B 3B82A 1VLOA 1TR0A 2W2PP 2ROPA 1S48A 1ZZFA 3CTRA 4RW9B 4KKOA 5I3PA 4ECTA 2HHHF 3L4BC 4HKQA 1HBOB 2V67A 1U24A 2I0XA 4IG0A 4FVMA 2W7AA 2JWNA 3KLEA 1UFKA 2HK2A 1KN6A 1RWOB 2DNQA 2YNHB 4X4SA 5E3RA 4DX8H 3V6JA 1L3SA 1VR6A 3OR2A 3VTIA 1IWGA 4Z37A 3DLHA 3M8ZA 3ZTQA 4UW2A 3CIMA 2OAUA 4W92B 3D3BJ 4USKA 2V8HA 2BBEA 1TU0B 4KH0B 4U8YA 4WFNQ 3BN4A 4FYYB 4DR3J 3EGZA 2YX4A 2XWXA 4HR2A 1RT7A 3FBFA 1VI7A 3TVYA 4C0BA 3LAMA 4UY8T 1UCNA 3GV5B 2FC9A 3PVXA 3ZZZA 1IN0A 3OQ2A 2V63A 3R5CA 3CEDA 3KHGA 1AUDA 4IUFA 4B3RJ 3TA1A 3CMQA 1NDPA 4QYRA 4L72B 4OHYA 4JI3F 3D9BA 3OFEA 2B0GA 1YJRA 3MFHA 5BYQA 5BR8F 3QGIA 3TYTA 5L1JA 4ED5A 6FDRA 2NREA 2OI2A 1DQ9A 3AQPA 3G2XA 1OWXA 4NA1A 1EJ7L 1SUQA 2FJBB 4J9LA 2JEFA 2QG9B 3HSJA 2ZE2B 1XJWB 2D9OA 5IFMA 3PO5A 3FCHA 3N9UC 3RGIA 3TUIC 4PWDA 4KPCA 2CJAA 2RQKA 4J91A 5CXTA 2WB4A 3MEGB 2JHEA 3A3OB 4K7QA 4YS2A 1REVB 1Z1ZA 2B6AA 2QSWA 2ZDPA 4G1QB 2YPZA 3BDEA 4DV0J 1S0MA 4B3TF 4B9UA 3OTDA 2E5GA 4ZVEA 2AEFA 3TOQA 3FQKA 4F7VA 4WIQA 4ANDA 4M5DA 1FFWB 4YHHF 3GCWP 4WU3A 1FRHA 4RUBA 1N5QA 3SI8A 2V8VA 4TVAB 4Q5VA 4DQIA 1BQMB 5DG8A 3VV2B 4DV5J 1T8EA 4RNMA 3W62A 3OLBA 3DHWC 4D3GA 3FSIA 5D0RA 2H51B 3IGVA 2M4MA 4G1PA 4MK8A 3W3SA 4OZ3A 2FIUA 1LXJA 1FWPA 1JWWA 4NLSA 1LKZA 5AJ3F 5HO4A 4PXBA 4JYAF 1R31A 5IV4A 4RJVA 3POTA 1TK0A 2W25A 1JMTA 2VF3A 3BYPA 3IAM9 4FYWB 5J1EA 5DQHA 2Y8WA 3BH6B 1KLMB 5D0HA 4ZVFA 1NEEA 3MURP 1YJNS 3WC2A 4USVA 4KJIA 3BZQA 3CJ0A 1WUUA 2LMIA 4X66F 3FFIB 3O1LA 4IOBA 3GSDA 4LRBA 3RRKA 1RTZA 1X9WA 4OJ3A 2M8DB 2ZWOA 1SL2A 2HFOA 2QLXA 5LSRA 5HROA 3T6BA 2IRXA 2VFVA 2SXLA 1TAQA 3C14B 1JNRB 4IO9Q 2DGTA 4OHXA 1X4GA 4QQBA 2HGNA 4TU7A 1SJ1A 3HT3A 1YWXA 2WSFC 3UCZP 3QSYB 1BWEA 3RUBL 4NCBA 1QY7A 1R3NA 2HW3A 5AJ3J 2M88A 2D3UA 2HBZB 4EBCA 2C2NA 4M5NA 8AT1B 5KFHA 4WZMA 4M5KA 4DUTA 4JI2J 1IKWA 5L9NA 4CLWA 3MI7X 3H42A 5ETVA 5D0GA 1S79A 1HQEA 3UD4P 4RLEA 3GPAA 3QATA 2XYGB 4WFYA 2DT9A 4CCHA 2UUBF 2QYCA 4QR1A 1NUEA 1J2VA 1NXIA 2HHHJ 2GHVC 2AQ4A 2R7RA 2ZKTA 1RTJA 4X2BA 4NLTA 1YRUA 3LPEA 3M2VB 1V5IB 3EICA 2KVQE 1YLXA 3BR8A 3P3DA 3ZZTA 4KGVB 5KFQA 2KT5A 2A2DA 4RW6A 2DGVA 1VQLS 1S77D 2LU2A 2HEKA 1VK8A 3FEXB 3R1HA 2CAJA 1JKHA 1X4FA 2IA0A 4BWMA 2MLXA 2M52A 3IMQJ 5KFEA 3EVOA 4PWUA 4YR3A 4IKAA 1SPBP 2F5GA 4F3MA 2M3DA 5GAEU 1SKWA 1VHIA 1F6TA 2IY5B 3T5HA 1I5OB 2VFUA 1V3SA 1HPZA 2R7XA 2MY7A 2XG8A 3B4DA 4FVCA 4ZN3A 4ZIVA 1ZPVA 1HWLA 3MM9B 4DSLA 2EFQA 4KQZA 4OYPA 1N5VA 3IRXA 4WFZA 3PXGa 1BQNA 5KFNA 2VC1A 3FBEA 1OYEA 2XYPB 4H4OA 4NYOA 1M5VC 2R7OA 4KHRA 1HYSB 4OYWA 4WZQA 1IUJA 4E98A 4TYAA 2UVVA 3PRDA 3VZIA 4USHA 5CCMA 1RHQB 2FVPA 2I2YA 1IKXB 1N5TA 1PBAA 5HVHA 4LREA 3NGDA 1FTRA 1W25A 5LMNJ 2Y1IA 1VC6A 2DPIA 2VPYB 3A4TA 4TKTA 3TARA 2QV6A 1S1VA 1QSYA 2FVRA 2XC9A 2VC0A 5LMUF 4OJ1A 2ZZNA 1RSCA 5T41A 3Q8SB 2KFNA 4R25A 1CSJA 2DNYA 4JI5J 1S76D 5F8JA 3ET6B 1ZM3A 1NSPA 3VAKA 4TQSA 2QFJA 4RW8B 3CT9A 4DSKA 2HIQA 5T14A 2B9XA 1DTQB 1PKUA 1U8SA 1XEZA 3GR0A 1UPPA 1TV6A 2CQ3A 5HJYA 4GVLA 2BKOA 3JQKA 5E0OA 1OQ3A 1QSSA 3DN9A 3N6LA 4DJBA 3KG0A 2GZOA 3BBCA 1F9HA 4KV8B 1VBYA 4LF9J 4WF9Q 2DHHA 2MHNA 4JI0J 1E6VB 4N41A 2Z2ZA 1N54B 3OVSA 1MU2B 1UPMB 2C1EB 4HHJA 2UVUA 3F56A 4JI4J 5LJ5Y 2JLFA 1RWPB 2VPWB 4O4GA 2YY3A 2XYHB 2IVYA 3DOLB 2RU9A 4I56A 4RNHA 2O5DA 3NGTA 3PTWA 1DTQA 1SC3B 1WDTA 2OELA 1N32F 1S5ZA 4I2PB 4OYZA 5FLXY 5HL7Q 2IM2A 3OXFA 1NJZA 4F3OA 1T95A 2GVZB 1JXVA 2BE9B 2R4FA 2RJZA 2HHUA 3CD0A 4AQYF 1C4AA 4F4WA 3NS6A 1HBNB 2A1BA 2UUTA 3O5TB 4KHPJ 5IT4A 3BGOP 1DLOA 3EGNA 3DYAA 1CJUA 3I82A 1F5BA 2F8MA 3Q89A 3L95X 1NAQA 1EQ0A 2CQBA 1IKXA 2EFNA 2BRKA 2HS3A 3FK4A 1DQ8A 2KG1A 3MM7B 1HYSA 4YDXA 4RNOA 4QW9A 2M2BA 2MGZA 3RRHA 1RWNB 2GMLA 4PG6A 3VAMA 1FNMA 1RWKB 2HZVA 2XTJP 1S12A 1YJUA 3D1HA 3KLFB 3HSDA 4CT8A 2MQMA 1RAHB 1O6XA 3ZZUA 2PFFB 4ZVHA 2WRMA 2DKOB 3R27A 2ZWPA 3VQTA 2MLZA 4ZPCA 5HMZA 1EIYB 2N7CA 1HMVB 3MAHA 4HT5A 1RT1A 3MEDB 4QU7A 2CRLA 2AJ0A 2JLEA 1U26A 1X0FA 2F8EX 3ZC4A 3SEOA 4FKXA 5CAAA 3HKZD 3L3CA 5KFXA 1PILA 2IVFB 3RRGA 4RR5A 2E7XA 2K7KA 2KFZA 4JV5J 1PC5A 2FVCA 1RABB 1SH0A 4IOCQ 1HHQA 1M0SA 4Q0BB 3PACA 1HW8A 2FY8A 1S9EB 3BKUA 1T9UA 3T5KA 2ZBIA 1FRKA 1FEEA 1Q8KA 1QE1A 1ZPWX 2OFHX 4IFYB 1N48A 3F0NA 4NCGA 3UW1A 4UQGA 2VJVA 1ZYQA 2XZTB 3WX8A 2OP5A 2J8AA 5F3ZA 2LEAA 3R5AA 3IR5B 1RT3A 1U47A 1CULB 1QTNB 5J1NA 3I9ZA 2X1AA 1N56A 1NKEA 2Y1LB 4YEAA 1RHUB 3K89A 5EUHA 3LWLA 4PPZA 1KHWA 1Y7PA 4N5SA 3EUNA 2AIRB 2IJNA 4NXNJ 5MAOA 2RF2A 4U7UD 4NASA 5C2CA 3KDOA 3CCWA 2ASYA 2XGQA 3M9MB 2J9DE 1RTHA 1W26A 2MSSA 1Y9OA 3LUYA 4WYWA 4YR2A 2IRYA 3ENWA 5ETMA 2R2SA 1U0SA 4EZ9A 1FJ7A 4NCGB 1UZDA 4IFYA 2FLNA 4OYAA 1J5EJ 1NPPA 2NR0A 1XNQJ 3TJ8A 4NYZA 4CH7A 1IBLF 1WC3A 5KFAA 1KQSR 2LVWA 2ZOMA 2VQEF 1TK5A 3DRSB 1QJHA 4ECZA 4CH0S 4DPOA 2BUNA 2DEIA 3PHEA 1JXEA 2VBYA 2X51A 4MK7A 4ELTA 2W01A 2A6MA 1N6QB 1S1WB 4U7UK 3VAHA 1DHMA 1PG5B 3THVA 2UUWA 1SJ3P 3OL8A 3HSZA 1N36F 2PC6A 4WCEQ 1OS5A 1TKDA 3AD7C 1NMEB 3AJ1A 2LFVA 1RTIB 2VUGA 3F41A 3Q86A 3I32A 4YB7A 4DOZA 3V6KA 1RT1B 3MEDA 3O44A 1X9MA 1HMVA 2AT1B 1GXUA 4B02A 3I96A 3QO9B 2CG8A 4UOGA 2HURA 2ZH1A 2W7OA 3CF5Q 5T7LA 3EJMA 1RADB 5KOXA 2W9BB 1ZOTA 4A8XA 1TL3B 5K8MA 2VBZA 3PKMA 1S1TA 2WVCA 1UKUA 3EDQB 1XTZA 3ONQA 3US5A 2GO9A 4LFCJ 3QNWB 4ID5B 4NLWA 1F3VA 2M8HA 3CCSS 3L7UA 4M1KA 5IC4B 3FCWA 2I1RA 5LT5A 3H98A 2V68A 1KNZA 4ZCMA 4LF7F 2V50A 3NLCA 2CJYB 2AX1A 3CJSA 3U27A 4CO1A 1YJVA 3PR4A 2WK4A 4O3QA 1TKZA 4A8QA 1X5SA 4XO0A 3NWGA 4PWDB 4X65J 4GKJF 2VPXB 3OTOJ 1V3RA 3H4DA 4ZVSB 1H7WA 1YJTA 3PG9A 2DGXA 4C3MA 5RUBA 5D0EA 2CJBA 2KN4A 2QO3A 1RB0A 3ISZA 2GVDB 3OJSA 3IBCB 5CZVA 1DTTB 4HDHA 4LF1A 3UVJA 2XO7A 2ZM6J 5CCLA 4K2JA 5KT3A 5L1IA 1Q8BA 4DL4A 2AGPA 3SZ2A 1O5JA 2BXJA 4IDKB 4WXOA 4NA2A 1PCAA 4DN0A 2CPEA 1TUWA 3KUEA 3LP1B 1TV6B 1PYTA 2KI2A 1ZM2A 3EXCX 3U7JA 4ZITA 2ATLA 2GAGC 4RW8A 4GVBB 2ZNYA 2W2NP 1A6LA 4OYIA 3CCTA 3CSKA 2NYHA 2XNRA 4L6V3 1T9XA 3V2UC 5F9NA 4C98A 1GMWA 2G2ZA 5DM6Q 2OUGA 2NXUA 3T9ZA 5HMWA 1SQGA 3RBZA 4CWBA 5ETRA 3IR6B 5ETQA 2OD4A 5A76A 4C8LA 2NS1B 3QBCA 3H5SA 3MDFA 3KUHA 4KGKA 2QTWA 1S1XA 2E44A 2JEJA 1C0UB 3RB6A 3AOCA 2EW9A 2HHXA 2V5HG 3ZZ0A 1NHVA 2PEHA 1AXQA 3EPIA 2JDJA 3UDVA 2J0XA 3HVAA 4P71A 1Q86T 1WHXA 1TUGB 5DDRC 2XHCA 4Q8FA 2F4VJ 3NOCA 1FJEB 4C9DA 2D1CA 2Y3YA 2PEBA 2YXLA 5DG9A 3CB4A 2DY1A 5M2UA 4DSJA 4I6WA 2AV5A 1KEKA 1L3UA 2QLBB 1VFJA 1Y3KA 4TLQA 1S6PA 1JKHB 2KXFA 2EC2A 2W9CB 5KFTA 2X1FA 2R8JA 3C46A 3ISND 1CJTA 2E1RA 5CD4H 3G71S 1SV5B 1H73A 2W2OP 5IXUA 3VAFA 1I1GA 1UJ6A 2W7PA 3JTOA 4DV3F 1U1MA 4YDDB 2I5JB 3GG1A 3JSBA 5A8WB 2CIMA 2RIJA 4R5PA 2AWZA 4H4KA 3D7SB 2BJ3A 3CDUA 2ZITA 3TZWA 4JI2F 3W2VA 4BWJA 4DV2F 1HBMA 1U2FA 2H1YA 2XWYA 2DH7A 1ZM9A 2WVBA 4TY8A 1RLCL 1OY6A 2ATCB 4BHQA 1LXNA 3JTPA 2JLGA 2ZH3A 3QJPA 3IWLA 5KG6A 3PJ9A 3BO3A 1PO6A 2HVIA 4X4VA 1OIAA 1PGZA 4L74A 3ZTOA 4JB8B 2Z2YB 3QRRA 3FMBA 2ZH9A 1S99A 3K0JA 4FS1A 1N5YB 2BJ7A 5HP1B 3EM1A 4DR6J 2LQBA 2YKQA 3RZAA 1JLQA 3W9JA 2VD3A 3MM8A 1JJ4A 1D1UA 4AUKA 3RG6A 4EU0A 3KK2B 5A0YA 3TZZA 3I4PA 2GS8A 4I0WA 2BVZA 3MPWA 2WVFA 4NLQA 4OI1A 4DV1F 4KHPF 1VQNS 4ED4A 5GAEI 1FNOA 3K7RA 3WIUA 1NU4A 4I6AA 1TMMA 1KFSA 2Q3PA 3G87A 2DY9A 3OFGA 2MQNA 4XDCA 5DJBA 5I42B 2ZJPQ 2F4VF 2MY8A 3M8PB 4KGMA 1C0UA 4QIFA 5E3PA 1KLMA 2L48A 3MPYA 2GGPB 3LA0A 2YWKA 2XLJA 1Q7LB 2CUYA 3R5DA 3OV7A 3HP6A 4ZDNA 2YQ3A 5J2MA 1HQUA 5E3CA 1FK9B 2FB0A 4ZPTR 4J37A 1LW2B 3PY8A 4JI6J 3DM2A 3P8BB 5F41A 4X4PA 4QWAA 3PHTA 2VDIA 4UZCA 2LQJA 3TP2A 1JLAA 4YUDA 3T1HF 1SQEA 2NLWA 1WG1A 3NG8A 4DL7A 1YZ7A 1G7CB 2XZDB 3H90A 2YNIA 3D3CJ 2FYXA 8RUCA 1PJ5A 3VGSA 4ED8A 1BQMA 5H9FK 3J7AN 2KJVA 3EVWA 3TJAA 2HS4A 5D77A 1KTQA 3C6TB 2HGMA 3M2UA 4LBIA 3G8TA 1UVJA 4PQUA 2C3UA 1VS3A 3BQ0A 1T9VA 2ZZTA 4K2XA 3RU0A 1HR0F 3R3TA 4XPEA 3R5JB 4NCAA 3LP1A 1AFJA 3D4JA 3FJ2A 1CJVB 1RCXB 4IDKA 1BUXA 4TU9A 4J90A 3QIDA 2P2CB 1UWAA 3CJRA 5B0EA 3MEGA 3GIKA 4OL8A 4AL7A 1DZ5A 3RAXA 3NGKA 3NEKA 3GFHA 2CVEA 5D4LA 4ZKAA 1S7HA 2ZE2A 3AA8A 5H9EK 3UN2A 4CP5A 3L7PA 1S7IA 3N28A 4DV3J 3DLEB 1Q95G 1XR6A 3UN3A 5F9LA 1VQ6S 4K5SA 2XS7A 4L3NA 4PWWA 3JSMA 1IBMJ 1K9MT 1RT2A 5AE1A 2CPHA 4UUWA 2FJAB 2GMJA 3CJ2A 2HG4A 1ZAWA 3MR5A 3J80U 2IM1A 2ZEJA 1URRA 3CIZA 1F5CA 1FVSA 2VG6A 4OYOA 3H25A 1FXDA 2FGOA 4WTYA 5JUMA 2QA4S 4DQPA 3KFWX 5K8NA 4G65A 3NS5A 2HLTA 3D66A 3TR5A 1NDCA 4Q45A 1LV5A 2VHGA 4KT0C 1M90T 2LCWA 1XNRJ 5ETSA 3J7Z5 1VBZA 4ZP7A 1HI8A 4ANEA 1WHWA 1ULRA 4XPCA 1UVMA 4JV2A 1UMJA 1XK8A 4JV1A 4ZCKA 2DRBA 4IQXA 1HNVB 5FLXU 1YIJS 1S1TB 2HIYA 5AXNA 1R0AB 2C42A 4DR7F 1TL3A 1BY9A 1OPZA 3W1YC 4DUYJ 2HBYB 3OR2B 4RPFA 4Q7AA 3DRYA 2YNHA 2AD9A 1M1KT 2ZVIA 4BDPA 4LF9F 4LUBA 2UXDF 2YTCA 2VFSA 1WACA 5LJ3Y 2RQCA 5CQGA 4O44A 2J0QD 5KFKA 4M8LA 1NPKA 5E41A 1HNIB 5B09A 1H0HB 3BYRA 2XMVA 2POKA 2B5JB 5FDLB 5J2NB 2F9JA 5ETKA 3G96A 2R2RA 2HYIB 4JI5F 3DRSA 3FBBA 1NZ8A 1HR0J 1Q81T 1DY3A 1KOOA 4M5LA 4EYHB 1S6OA 3Q8QB 1IKVB 4DI6A 3HCXA 1J5OA 3OHAA 1RWMB 4ANCA 5KFOA 3HZEA 1J5EF 1EP4A 4LF6F 3RW7A 3UCGA 2V69A 3WQPA 2HNDA 3SCKE 4X66J 1C2PA 4I2QB 3AB2B 1KDNA 1RUSA 2CPZA 5B7WA 4X64F 1K1SA 2NSBA 1HLWA 4K4TA 4NXNF 1VQPS 4EEYA 1R27B 3DLKA 4P52A 5LM7E 4Y2MA 4L76A 2MSTA 1WWHA 4FNHA 4TLRA 4C11A 4O3RA 3RAQA 4TQRA 2QZ8A 4N8OA 1QE1B 3KXDA 1KVKA 1R7IA 2XSJB 2Z0GA 4OFZA 3WZ0A 2BA9A 2ZBCA 1ZETA 1U4BA 1U7LA 1SCJB 1SH3A 3GZ7A 3W2WA 3ZZRA 2OMLA 4NZ6A 2R7TA 5JXSA 1U6ZA 2OPSB 1JLCB 4DG1B 2K1RB 4CTAB 1CJKB 3PW2A 2XY7A 1TAUA 2WSCC 2NCKL 1TKTA 4WJBA 4U67Q 3GR1A 2UUBJ 3PEHA 2E5LF 3B6BA 1Q8IA 1SXLA 4NYPA 2W4PA 4USJC 2NUUG 3MM6B 2ILZA 2RRNA 3NAIA 4QIEA 1QDUB 4X62F 2QL9B 2PA8D 1NK7A 1GMVA 4USIA 1EHWA 1P6TA 1R8HA 4DS5A 1R89A 5HSPA 4XIUA 3GJTB 1L3TA 1YX2A 2Z2LA 1LK5A 3LTOA 2D3O1 1JLFB 3MAAA 4DR2F 2YNFB 4F26A 2OEKA 5CA5A 2KM8B 1RACB 2VASA 1GMWD 4ZPDA 2G4BA 4CLPA 2HNDB 1ROFA 2Q43A 3QIPB 1WSRA 2MLYA 3TEHB 4CI0B 1NSKL 1CJUB 1SB6A 3M30A 3RAMA 1FHTA 3UO0A 3KNAA 2AYEA 4PG4A 2WSEC 1Q1KA 3S8SA 4M5GA 3MXHP 1S9GB 2CPXA 1JJCB 2FZKB 3MMCB 3OTBA 5IOLA 3TZXA 2LQ5A 4ZJLA 4CQ1A 4F36A 3BH7B 1WJ9A 1TVRB 2RS2A 1HNIA 1Q82T 2MZTA 3OTEA 1H38A 2CPYA 4O4GB 5HK4A 3W5XA 5EDWA 4NA3A 1Q53A 5KT6A 3T1AA 4IH5A 4ER8A 4HEA9 3D5MA 1YKWA 2ZHAA 3CUNA 2WONB 3BBFA 2AJFE 4O23A 3SQGA 1Y11A 4CH1A 3SDEB 2HQGA 1TVRA 1A0OB 4NLRA 1QSLA 1R0AA 3FQLA 3AJDA 2NYIA 4W98A 2QA4G 3MMCA 3ET6A 3QPIA 2QX0A 1ZBTA 4OZ5A 1EAYC 3QAUA 1LWEA 3OXGA 4RW4B 5E2QA 3V5RA 4GO5X 4LRFA 3VZHA 3OL7A 4YY3J 4J9NA 3SQOP 9ATCB 1XMBA 1I51B 4CNZA 1JLBB 2WW4A 5CYMA 4OX6A 4ICLA 4YMEA 2A6OA 4DN9A 4C4WA 1N0VC 2VG6B 3U02A 5I3UA 1FESA 1GTEA 1VMBA 2FUG9 3EGVA 2FHMA 2HAIA 4ZVRB 2PMZD 3GIJA 3SV4A 1UFLA 4H4OB 4DFKA 4EI2A 5GAHI 2F1FA 1GX5A 5HATA 3VGUA 2FHOB 3I6PA 3JSMB 4IFVA 3MM9A 2OFGX 2VG5A 3W8GA 4CM2A 1Q4RA 5C25A 1CBKA 2DNHA 2C2RA 5CABA 3OPKA 5HQ8A 1B7FA 2K2PA 1A7GE 4Q43A 1HL6A 3SBMA 1XR5A 2HFNA 1U2CA 2CNNB 2DCUB 3K8VA 3MOZA 1FCAA 2VICA 1F3FA 4FPIA 4A8YA 1CJVA 1CS4A 4ZVQB 5L1LA 4K4YA 1ZTWA 2ZH2A 2K1RA 1SI9A 2A2CA 1IR0A 1RT5B 4CTAA 1C0TB 2R42A 4DU8A 4YP3A 3OUYA 1S6QB 1UVKA 3P4UB 4AQYJ 4BS2A 2K8GA 1FJCA 1WF0A 5EX0A 4ZVGA 5DG7A 1RT4B 1B99A 3PYEA 2HNZA 2RILA 3PFOA 1NSAA 3LGMA 1QD1A 1NHKL 3UWTA 2UV8G 4N56A 2MDAA 2ZHBA 1FDNA 2KJWA 2L9WA 2XMJA 3CDEA 2GIRA 4IQMA 2GX8A 3RB0A 3RB4A 2HHQA 1R43A 1R8PA 3ZTPA 2E7WA 3GQCA 3RYLA 2U1AA 1HQEB 2IYIA 1WG4A 1WC0A 1HD0A 4AD6A 1FE0A 1JLAB 2E1MC 2OEJA 4P6QA 2RDIA 2B9EA 4OV6A 2R2UA 4ECWA 4ZVOB 5L8RC 4ECSA 1X9SA 4Q8EA 4J9RA 4F0MA 2UXDJ 3UPFA 3E01B 2CKWA 1YDLA 3A8KA 3DOMA 1I3OB 4WU2A 5DETA 1NK8A 2DGQA 3JQJA 1VQ5S 1VCTA 3BPSP 7FD1A 2LXIA 5A8KA 1K1QA 1UVNA 1GX6A 3CJ3A 3NAHA 2E7VA 5I42A 5A8KB 2CQIA 3B4MA 2IJFA 2AJ2A 4TYBA 4OX9F 3TW0A 2LQ9A 2YQ0A 5IT0A 1X4DA 3C14A 2W4DA 3SCIE 2D7SA 3H0PA 3BBBA 4F0KA 3KUGA 5HROB 2IBKA 2J9CA 3N0VA 3CJ5A 4ES1A 2E1AA 3I0SB 5IS2A 1T05A 2H48B 1U2RA 3TQEA 4ZOSA 4DDFA 1KWMA 4FXDA 1IBLJ 3G82B 3M1VA 3EZ5A 1U1LA 2VL1A 1LWFB 2B7BB 4ZHRA 6FD1A 1VGYA 3M2RA 4MFBA 1NDKA 3BR9A 3QZ8A 3C66A 2KXNB 2O01C 2I6WA 4O44B 2IYGA 3TQ1A 3TWZA 1S4EA 1AUSL 5K8PA 2CQHA 1I94F 1FX2A 4KO0A 5IQ6A 2BJ1A 1PAEX 3POTB 3PX0A 4CDIA 4JI6F 4CIOA 2CDRB 5DQGA 1HWJA 3TAMB 2JVRA 2RUSA 1URNA 4K4WA 2N4DA 4F4YA 2ALYB 1U1QA 2LXUA 2HRUA 1GFWB 5D4PA 2EEYA 5FIIA 5LSLA 1K0VA 1TL4A 4RZRA 1SIWB 1HNVA 5KT4A 5M2RA 1GT8A 1S4FA 3DMJA 4MYTA 3BGRA 1ZA1B 2COLA 4NLUA 1KD1T 3FEZA 4OZ2A 2BDPA 4DSFA 1SV5A 4OYMA 3B8HA 5DDQC 1CJTB 4DF4A 1S97A 5GMEA 4YY3F 1WI8A 1IQZA 1ZTTA 4KHMA 3DCAA 3D2WA 3NBPB 1FTCA 3CCJS 1IWAA 2AZ1A 2KM8C 3AOBA 4JI7F 2OPPB 2YWGA 1VIXA 1LNQA 2OLWA 2BM0A 2CQGA 2YKAA 2H65B 3KJFB 1MMLA 3GMGA 3N79A 4J9VA 4G6VB 2WVEA 4EWTA 3Q8PB 2HMIB 2JC1A 3G6VA 3HM9A 3PW5A 4O0IA 2F63A 3CD5A 4RBUA 3ILLA 1WKLA 2FY1A 3D1QA 1KOHA 3VCDA 1GQEA 3H20A 4WFAQ 3M6VA 3QZ7A 4QYZK 2EG1A 3M6XA 1EX8A 2KO1A 4J9PA 1VIOA 3KJVB 4P10A 3HK2A 5HLFA 4IRCA 3V81A 2N82B 1PIEA 3PFEA 2J7WA 1C1BA 2BKNA 4EYIB 3BGUA 3PYDA 3EWGA 3K2YA 2DITA 1VJWA 2KVIA 2QT7A 4TU8A 4LQ9A 2EKNA 2ZH5A 5KG4A 1AFIA 3X3UA 1R0CB 2OMOA 3A8IA 3AH6A 4WFXA 3SFGA 1OY9A 3BQ2A 1RT6B 3CE8A 4DR6F 4U8VA 2G1HA 3QLHB 1F0XA 4B9LA 1OSCA 4URGA 1IR1A 3BGLA 3ELHA 3I55S 4EBEA 3GV8B 2R7WA 3DGPB 1KFDA 4L3KA 1UL3A 2KDOA 1WTBA 2CNLB 3MWBA 3BDPA 1RA6A 2JZ5A 2KXHA 2QMUB 2RQ4A 4DR1J 2DR6A 4Z7CA 1M5OC 2LXFA 4F8RA 2AJ4A 1C1BB 3K8WA 3KLEB 1L5UA 5JVGQ 1F9EB 5HBMB 2H5IB 1DTTA 3QAEA 3HJFA 2HHSA 2YKNB 2ROGA 2O3DA 1Q78A 1WEXA 2DTJA 3IGNA 3MD1A 4HACA 4PG5A 4J9MA 4FYDA 1YVFA 2G0IA 4C97A 3TRGA 5GADI 2E9RX 2DH9A 2VH7A 3E8OA 4URQU 4KPYA 2RVJA 1SJ4P 1FX4A 1PAUB 2Z30B 3ISNC 4MIAA 1G6BA 3P5BP 5AT1B 5KG3A 3UQSA 4USMA 1TKZB 1VQ7S 5A0YB 3GSIA 2DGSA 4E8UA 5H9EJ 3P5TL 2KB2A 2CQ2A 2HFVA 3N6NA 1RYSA 1FRLA 1X60A 3I0RB 5C24B 1WOOA 2FD2A 2XMUA 1VOMA 1ITPA 3ZTRA 4K4UA 5D3GA 1T03A 1FDBA 1S0OA 2K3IA 1M5KC 1RAIB 2VKZG 3T1YF 3BGRB 5G4DA 3CDWA 5GMDA 4CO4A 4ID5A 4ZN1A 3CCQS 3CCVS 3LQVA 4TY8B 1GMUA 3PW4A 4DX5A 5H9FJ 2WTFA 5K9FA 4QZVB 2XSFA 2VONA 7AT1B 3EDRB 4PPDA 5KFYA 3TX8A 5DLFA 4RBVA 2IC3A 4ZP8A 4ZVTB 3SSQA 3M6UA 3BSNA 4CNYA 4JI3J 3P6YC 4PXCA 1WD6A 1YQHA 4KO0B 1X5PA 1D9FA 4LQ3A 1CC8A 2J8SA 4RL1A 2W2MP 2NSCA 3MF5A 4IH6A 4UT4A 3HHLD 3M8SA 2NXEA 2PT0A 2ZOGA 1X4EA 4OHVA 3T1YJ 4IRKA 1U48A 1S1WA 1NB2A 3HHEA 4O0NA 2W9CA 2MZ1A 1NZAA 1T9TA 1UFWA 4DR3F 1N6QA 2YWWA 2DXDA 1FFSB 2EVZA 3DOKA 2LEBA 2V8GA 1T11A 5DGBA 3QRPA 2XNQA 3QJJA 5D8HB 3FVYA 2GQCA 3LH2S 1IBCB 4Y00A 2YNGB 2QL7B 2ASDA 1OPIA 2A10A 3SV3A 3PX6A 2WHOA 3QJLA 3KJQB 2KU7A 1EKSA 2R3VA 2BJEA 2HVHA 1HQ2A 4U6PA 5KFVA 4AXIA 2BQRA 3THPA 1YRTA 2KYXA 3VGTA 4V19J 4FXWA 3IWNC 1L3VA 1SH2A 1TL5A 4KBIA 2BEFA 2UUAF 3MM5B 1GEHA 4DR4F 3KMQA 2DGWA 2QFIA 4RW7A 5K14B 3H8YA 3MPVA 2HZAA 2KTQA 3C6UB 2JJ4D 2GA7A 4IG3B 2BW2A 3G4SS 4DLGA 4CLZA 1SC6A 5C42A 1N5SA 4O4RA 4DR1F 2JH3A 2D41A 1HHTP 1O0PA 3DXSX 4PYDA 1RWVB 3T41A 3V4IB 2V8PA 2W8LA 3O3LA 4LFAF 2QN6B 2K3KA 1FKPA 2H5EA 2LDIA 2XMTA 3K17A 3QT8A 1H2UX 4LF7J 4Q0BA 4QU6A 5HQLA 4DF8A 1B70B 5CYJA 3CCMS 1XMOF 4LF8F 4JOUA 4K4SA 2C2KB 1N34F 4QR0A 3W60A 3HFZB 2XMKA 2HQFA 3PYFA 4OJGA 2KT3A 4DS4A 2VFRA 4ZLPA 2AYGA 2LKZA 2FHJA 3UVJB 4ZMMA 2B4UA 4WK3A 3NNAA 3ADAC 3LPYA 4B08A 4P2FA 4LR8A 2HKEA 2NXJA 1QUPA 3OTCA 4JYAJ 1MNEA 2B4OA 2DNNA 4L75A 4R8UA 4RUHA 3PRBA 5KG0A 4LR7A 3JYTA 4DQSA 3MR7A 3RR8A 4FZVA 4WBFA 5HQMA 3KLVA 3D68A 1XC9A 4NLGA 5BJRA 3TO8A 5K20B 2GIFA 2ZD1B 3BREA 5GVQA 4M5JA 5L46A 5ADZA 1T7PA 2YWFA 2JC0A 3R7SB 1Q5VA 5LSOA 4ILMA 5F3TA 4C8MA 1VRTB 3OR1B 3VGVA 5AE3A 2AJQA 2DNRA 2GJFA 3H2VE 2GCFA 1AA1B 3AA9A 3MCOA 5F0WA 2EFVA 2HBRB 4EUVA 4Y0FA 1DLOB 5J2QB 1LQ9A 1SJFA 1XNQF 2EI5A 4B3MF 1NK4A 3NRBA 2YWEA 3DXBA 3UFCX 1I6JA 2ZC4A 3KHLA 4DFJA 5A8RB 5B0DA 4DX6A 4J9OA 2WAQD 3Q23A 3H59A 2JNJA 2F3JA 1OQ6A 2WZ1A 3SSRA 3DOLA 3GFZA 2RDDA 4C2MA 2W9BA 2BRLA 2EKYA 2GJIA 3FMWA 2MXYA 2N3LA 4LRDA 1SKUB 2IAJB 1RI7A 1S9FA 1SKRA 3OL9A 5DGAA 3EZUA 2JL9A 2M0GB 4NI2B 4BCAA 2PA3A 4U95A 3VVTA 3D54A 1ZH5A 3NGSA 3EZOA 4I68A 2IMOA 2YKPA 1TUVA 4ZLNA 1YBTA 2DGOA 5K5MA 4M63A 4AE5A 2XCAA 4J9SA 4DL5A 3KG1A 3C3LA 2WBRA 4N47A 2XM3A 2XO6A 5AXMA 3AODA 1RHMB 4ELUA 3CCLS 4MKYA 3QGPA 1Y4ZB 3K5PA 5HAOA 3F73A 1WEZA 4I4BA 5SZTA 2HFUA 1UJ4A 4MH8A 4USTA 2KHCA 3UR0A 3KK1A 1BC6A 4Y34A 2RUGA 2O1PA 2ZUAA 4I1TA 4NZ0A 5C42B 5KAKA 3DDIA 2V4QA 5FJ4A 1QAYA 4PG8A 2V6AA 3NCPA 3QIPA 4PG7A 4HHUA 3HHKA 2NXCA 1IM6A 2RF2B 2O66A 1AZSB 1NLKL 3FZBA 4MYUA 3AOAA 2YNFA 2PE8A 4RUCA 2CA9A 1WC5A 1BQNB 3DC2A 1RWXB 2ADCA 2DEJA 3R97A 8ATCB 5AXLA 2RS8A 3C15A 4DCPB 4Y2AA 4DL0C 4DPWA 2RRAA 1U0HA 1PYSB 2RSQA 1QTMA 3KOAA 1WOPA 4KRWA 1RBOB 1HNWF 2YNGA 4Z2XA 2ZH6A 2X7IA 1WEYA 3DRRB 1Z2LA 4HH0A 3J80Y 3W9IA 2J9DA 1S9EA 1YTYA 2E29A 4Y65A 4CYUA 1TKTB 3Q8VA 2IDLA 1K8AT 1VQ8S 2OGUA 3LF0A 4P9SA 4USUA 3GP9A 4RW6B 5B0AA 4EZ6A 1XNRF 4LT6A 4WYLA 4PR6A 3G8QA 3CDAA 2KRRA 2YKMB 2K06A 3A13A 3Q83A 4QIVA 4H54A 2MJNA 2UV8A 1TL7A 3DRRA 3MUVP 5HP1A 3IBFB 3IRWP 1P9YA 3DU6A 5LXYA 2XQCA 3GTYX 2DNOA 4C0HA 3HHDA 3H5XA 4RU9A 4X4OA 4C11B 4ED2A 4UTGA 4QW8A 3ILJA 1P9QC 1Y5NB 3KLFA 3M05A 1RCOB 2MZJA 4NLXA 4LSNB 2HRYA 2HQDA 2IM0A 1XQIA 5SUHA 2OPQA 5F8MA 5DDPC 1Q79A 2Z58B 3PW7A 2OIHA 4LF4F 1X4AA 3WBZA 4G1IA 1AZSA 3W64A 5IWAJ 3LP0A 1IM4A 1H74A 1S1UB 1UEVA 1UJ5A 1XERA 2BX6A 4WP8A 1KQFB 2JFKA 4ATNA 4ES3A 3JB9k 5D3GB 2E9ZA 1EZZB 1H72C 2BANB 2FVQA 4JI8J 5C24A 3ILOA 3GCXP 3LAKA 1ZZNA 1FNXH 1KRPA 5HMXA 2V2KA 2MEWA 4B9VA 4AL5A 3W7BA 4NMXA 2VODA 1HBNA 2LA4A 2LYVA 1KBRA 1MW7A 3PW0A 1IBKJ 4RU2A 1D09B 5HMYA 4QYZJ 4PCQA 3IWXA 4ITSA 4DPUA 4F4ZA 2YH0A 3BO2A 2ZH7A 2P9CA 2HVDA 5BYRA 4NLYA 1MWQA 3CGIA 2IJRA 3R2CJ 3FKBA 1M1HA 3NOGA 2E5IA 2KT2A 3D28A 3DLJA 2ADBA 4F4KA 4NRTA 2FLOA 1F60B 5J1EB 3M9OB 2B9WA 4P2XA 1TL1B 2QE5A 2X3DA 2BQUA 5EX3A 1RDRA 2C2ZB 5LOQA 3Q0AA 2CVIA 4Q44A 3HZGA 4TY9A 5KG2A 3KHRA 2VJUA 1UW4A 4DQQA 2UUCJ 4GKJJ 2FZGB 2UXBF 1FDAA 5B08A 3BGFA 1JQGA 3AHPA 1OMSA 2EFGA 4MAKA 4OHWA 5LL6d 4ELVA 4UOCA 4CO2A 4UUXA 1PC4A 2ZNZA 3AXKA 3WX4A 4LIWA 4DX7A 4F2RA 1HARA 2YPYA 1HNXF 4V1Ak 5A6WA 1RT6A 3Q8UA 3W9HA 2MMYA 2NZCA 2F65A 5DM7Q 1QAXA 1K44A 2DHSA 4LF5J 1G3OA 4X4QA 1B0TA 3LP2A 1XWLA 2RAQA 1Y10A 3UD5A 3MR6A 4C8YA 4HLBA 4WKRA 4PXEA 2HQCA 3NP5A 1KHVA 4LIRA 3V81B 1S10A 4NXMJ 2VBWA 3CNQP 4QR2A 4AXJA 4YOEA 1RT2B 2CQCA 1RBLA 1X8DA 2CZ9A 1JB0C 3IRXB 2OH2A 1YG0A 4HVZA 4R8UB 3HSGA 2WW8A 3WHIA 3D0GE 4ZVPB 2VG7B 1HPZB 3N5FA 2G1DA 3NGRA 1FERA 1RP5A 3OLAA 4C3KA 4CO0A 1RZMA 4DV2J 2W2QP 3TAPA 1KQKA 2LEPA 5EWEA 2WVDA 2FJXA 2JX2A 4IO1A 2CDQA 1NO8A 2V34A 2HHTA 1J27A 4J9KA 4WFBQ 3DGVA 3R8YA 4ZP6A 1YRXA 3V6DA 2DXFA 4KY3A 4YHHJ 3OW2R 3JTNA 2M9KA 3M2VA 2B43A 4NPOA 2CQ0A 2L41A 4NLVA 3IG1A 2R7SA 5DO2A 1VQKS 2MKIA 3DMJB 2QSFA 3MECB 5KTQA 4FXVA 4DV0F 2CZ4A 1RU1A 2YWHA 4WE1A 3BO4A 1EETA 4USWA 3BSOA 2B56A 2EWHA 2MKCA 2Y1RI 2MKKA 4YB5A 3KK3A 1CVJA 4B3OA 3QT5A 2BABA 3E3XA 4IG3A 4DEZA 3I87A 5AE2A 2CYYA 2CADA 4DPTA 3BJYA 1EB0A 1LW2A 1PSDA 2VKRA 1SJQA 5F8NA 1FK9A 2G2OA 3MR2A 4P72A 4ECRA 4PZVA 2VOOA 4GC7A 1VQMS 4X64J 1FWKA 3OL6A 2CJ9A 3BM7A 4ZA1A 1SL1A 4DR2J 2Z56B 2J6TA 3PJXA 1LWFA 1VBXA 1XIQA 3BQ1A 1WKJA 1U6FA 3DDKA 1JK9B 4J9QA 3ZFVA 4LF6J 2HQ3A 4B3RF 1KP6A 1XMOJ 1CLFA 3IXQA 4ZPAA 2RU3A 3IC1A 3KK2A 2A3JA 4R0EA 2AYBA 4X4RA 3O2IA 4LFAJ 1JLQB 1XN9A 2DNKA 3VALA 2BQ3A 3GIRA 1RJJA 5EHHA 2QIFA 3BF4A 3IS9B 2WCXA 1JLEB 3H5UA 2X3GA 4OI6A 4WK1A 2E9TA 4LBPA 4A48A 4EGLA 3I56S 2HNYB 3G6ES 3P49B 4AYBD 2H3EB 2OTJS 3MD3A 4U9RA 4F4AA 4LVNP 3D0HE 3VAGA 2DRAA 1GK8A 2GHWA 3HULA 2XS5A 2N7YA 1S6UA 2NPFA 4YFUA 2PD1A 3HKWA 1JLGA 4ZIWA 4HH1A 5HVFA 1VC0A 2CPIA 3W2VB 2ZM6F 2XULA 2A18A 1UZHA 5BR8J 1B0VA 1T94A 3DI6A 1EETB 2CWXA 2AYMA 3NL0A 1PYOB 1RK8A 3G8SA 2V4JA 1VHFA 3VQSA 4X65F 1RT4A 3Q2SC 2RRBA 3J81U 3PDNA 3KNGA 2ZBRA 3LGHA 1V5VA 1REGX 4JBCA 1LWCB 1C0TA 5IT9Y 3EPGA 3ILIA 4MTPA 3GU0A 2D3OR 1FKOB 1HI1A 1VRUB 3LOUA 4IR1A 4ID8A 4Y2IA 3TZYA 1NJIT 2QA1A 2YX1A 1IR2A 4HDGA 3PYGA 2QMXA 3HJVA 1GTHA 4UF4A 2I38A 4B3SJ 3NCQA 2HRTA 4DU7A 3HPOA 4ZCLA 3WC0A 2VG7A 1H2TZ 1SUQB 3GIIA 3OVBA 1MLAA 4O3OA 4LFBF 2KG0A 1DURA 1T3NA 2YKNA 2BJ8A 5ETLA 3VHQA 2DNLA 3UR3C 1YJWS 2JVOA 4H4KC 5A2QY 2C22A 1XMQF 3QSIA 3C16B 4F3QA 4WKYA 1SJRA 2WB1D 1NPRA 1WF1A 3PR5B 1KVJA 2RHQB 2GQ2A 4RBTA 3JSRA 2G13A 4FP9A 3HO1A 2PSZA 4ICLB 3DGPA 3GYGA 4IRDA 5DDOC 4RO0A 5HI7A 4UOHA 1T9WA 2U2FA 4MMOA 4BLGA 1VQ4S 2AF6A 2Y8YA 2H4YB 1FXLA 1S57A 2NXNA 1RT7B 5LMUJ 4KGXB 2XHWA 1Y3JA 2G9OA 2AKWB 1IVZA 1U6BA 2RH3A 4UQTA 4FYVB 5I4MA 4K50A 1HWKA 2Z8QA 3S7RA 2VZ9A 3QT7A 4NOHA 2MQLA 2XLKA 2FQQB 1MG7A 5U47A 1X4CA 5C2GA 1CEZA 2MKYA 1H98A 3O6QA 3SQGB 5IQQA 4EBDA 1YHQS 4ECQA 3K58A 2PO4A 2OSRA 5EGYA 5H1SV 2HWHA 5L1KA 2R7VA 3SYZA 5F0UA 4C6AA 4FDFA 2HBQB 4C0OC 5KFDA 3T1HJ 1SKSA 1BXNA 3FNNA 1YBUA 4IG0B 4Y2CA 3W5YA 3ZTSA 3TUPA 1H6KX 1FA0A 4HTJA 5IC6B 1HBOA 1TELA 2P9EA 4ZJOA 5CZXA 3W5ZA 3BN7A 4KKOB 1BE4A 2VV5A 4P75A 3RBEA 3CC4S 3CJ8A 2MQQA 4P7TA 2EG2A 3CC7S 1VRQC 2CJXB 2IHR1 4UOFA 2XEXA 1NCLA 1NBEB 2DHXA 3FSYA 4TN2A 2HMIA 2HS0A 4XAKA 4ZLLA 4CYUB 3PZPA 3J7ZT 4K59A 3RTVA 2ALZA 1RGVA 2OPPA 2VA3A 3R7BB 3MAQA 5CD4A 1WF2A 2E5HA 3THTA 2XGPA 2PI4A 4LSLB 2DB1A 1NSQA 1S1UA 3L09A 1NB7A 2V9WA 3ITHA 5DZ6A 1SC4B 1IBMF 3KJNB 2V4JB 5L9XA 3MAAB 5JJBA 2B8QA 2XLIA 4FF2A 3FGVA 3PRVA 3RR7A 2DNPA 2AX0A 1RWUA 2QLWA 2V4RA 2CJKA 2P8IA 3DRXA 2ZBPA 4DUZJ 2MB0B 4JI1F 1UA0A 1A9NB 3DLLQ 4B9MA 4K4XA 1VC5A 3RB3A 4PKDB 2FPHX 4A8KA 4KSEB 3UNGC 1HBUA 1LW0B 2OPRB 4DUZF 4JI1J 4DFPA 2EC0A 4BC9A 1OSDA 1TL7B 5ETPA 4F2SA 1MSWD 1OY8A 2F9DA 3JAMY 4PEOA 3DHXA 2HNYA 5F8IA 5BXIA 3D6FB 4MFBB 4DG1A 3M2RB 2AW0A 3EYZA 2VQEJ 1UAWA 1ZAVA 1LFPA 3G82A 3M1VB 1X31C 3GONA 2ACYA 3EX7B 1U1OA 4LSZB 2VA2A 1T05B 1U1KA 1FI4A 1SL0A 2RD5C 5F8LA 3KLHB 1TTHB 1ICEB 3MZIA 4WXWA 2DGUA 1VQYA 2DIUA 3D0IE 1QLNA 2R8GA 2D74B 3L9ZA 3QRQA 7FDRA 2HSEB 1U0HB 2L9NA 3W8PA 2MZSA 3HX9A 3PO4A 1WI6A 3M32B 3C15B 2JEIA 2F40A 2YKOA 2J0WA 3GWCA 3H7HB 4OZLA 2WBMA 4OMFG 2GNKA 5KFRA 1JNZB 2R9LA 3LWMA 4ED6A 2IVMA 2KH9A 4DL3A 1U02A 1KR4A 3M6WA 5KFLA 3AJ2A 1YBAA 1TZ0A 5KG7A 3MUMP 3DOMB 4JI4F 3SIPB 2QYGA 4PRFA 2YH1A 3ZZPA 4DMZA 1E6YB 2Q1LA 1BQXA 2J5AA 3C8YA 3LO3A 4KE5A 3LGNA 3RBDA 4PXDA 5G0RB 3B54A 1RU2A 4DFMA 1KVIA 3LANA 3CMAS 3HHLA 4B3OB 2ZFHA 3KK3B 1Q5YA 5D78A 4NLOA 3PKYA 2MKJA 3Q2TC 2CPJA 1BLUA 3KK1B 4GKKF 2DNGA 4B3MJ 3T9NA 3UE2A 1IQTA 9RUBA 1NKCA 2MHEA 2PMWA 3PIOQ 1FD2A 4M5HA 4K4VA 4CLFA 2J7KA 2QA2A 4NL5A 3ENAA 5J2NA 3NNCA 5KFPA 1VJQA 4CLUA 4DWIA 1S6QA 3PM9A 5GAHU 1UWBA 2CZVC 1X0PA 2MZRA 4NLDA 3D1OA 4WP3A 3I5AA 3MCNA 5FD1A 4ZPWR 3U1LA 2H4WB 2HVZA 3R7NB 4OI2A 4FNIA 3LALA 2H9ZA 1F2HA 4NI2A 4LVOP 1BGXT 1X7VA 3IM8A 2AGQA 4NWBA 3S1TA 4DR4J 2UXCF 4FN5A 4B9NA 2PI5A 5C25B 4DSIA 2YQ1A 3TJ9A 2DISA 2VDHA 1G1XA 1HW9A 4LFBJ 2FC8A 2DJWA 3K57A 3ENVA 2ZJQQ 3MMBB 3MOJB 2MGZB 5KT2A 1R8BA 1DARA 4O3NA 4HL9A 4M5MA 3UNYA 3BB5A 2E66A 2JRSA 1N34J 3Q22A 4DL6A 2MYFA 3LW5C 4DLEA 5I3UB 3AD8C 3HT0A 4GC6A 2DO0A 1NNDA 5DLGA 2L3MA 3CD6S 3ZZYA 2C3PA 3IM9A 4NLPA 1KLNA 1YK9A 3S6EA 3UDCA 3DYAB 3NGUA 4ZLJA 3HMJG 3K5LA 1TMJA 3JQMA 1EARA 4ALZA 1HNXJ 4XDDA 5KFJA 4QPTA 3OXLA 1DJ0A 3HFKA 4ED0A 2ZD1A 2GVZA 2Y1JA 1OO0B 2IM3A 4X4NA 3MMBA 4XTTA 1H7XA 4A8MP 4KAIA 4CM0A 1YITS 2VOPA 4ES2A 4LFCF 4JP8A 3SDEA 1HFEL 1FDDA 3OVAA 3HF5A 1D3WA 1ZM4A 3MMAB 1MU2A 1QM9A 4WWSA 4ZK7M 2VIHA 4F0HA 5KFCA 1E6VA 4DQRA 2UUAJ 2JOQA 3PX4A 5B0BA 2FDNA 2UVRA 2ACMA 4OYXA 2BE7D 1JIHA 2B4VA 2IIHA 4OI4A 4Y2KA 4KFBA 2C3MA 3UN5A 1UWBB 1CG2A 2R8HA 5KFUA 4LR9A
chains in the Genus database with same CATH topology
1TFWA 1KTVA 2E1CA 1U09A 2FJDB 3KMSA 3IO1A 4CO5A 3C6TA 3M2UB 3ULHA 3QGHA 2FLLA 1S9GA 5LMNF 5KFSA 5IM0A 2HHPA 3T5JA 1U49A 2E5JA 2BANA 4ETZA 1Q7YT 4C3LA 1D0EA 2BOPA 2DBBA 2GC8A 3HDSA 3LP0B 4IH7A 5DRKA 5KG1A 3T3FA 4RW7B 5F8GA 1HQUB 2B9YA 4ZPBA 4J9QA 1Y00A 3GG0A 1JLFA 4EO6A 1N8RT 2OPQB 3V4MA 2N3OA 4UY85 4ERDA 2RMLA 2HHXA 2GGPA 1FXRA 1QVFR 2GJ2A 5D4NA 4URSA 2XMWA 3SFUA 1NK9A 5LXRA 2WOMA 4Q2MA 3M9NB 3R1LA 4C8OA 2J6UA 1LOUA 1TQLA 2DH8A 3DNCA 4XK8C 3HHLC 2MZQA 4OQJA 3SCLE 1RYRA 3UCUP 2YKMA 3QJLA 2BV3A 2Q6BA 2Y0SD 3GE9A 3MM8B 4FS2A 2DR7A 3RW6A 2EPIA 3EXYA 1N5YA 1RISA 2OPSA 4FF1A 3CWJA 4QBUA 1NK6A 4X4UA 3HVTA 2EK1A 1F5AA 4W90B 3TUJC 3GB0A 1B0PA 1QUVA 5E5NA 2FLPA 1HWIA 1MMNA 3DDNA 1HBMB 3SCJE 3TA0A 2V9WA 1CQMA 2LDYA 4HTIA 2BZ2A 3I9V9 3DLKB 3IFEA 5A8WA 2I5JA 1N52B 2KKHA 1IKWB 2NPIA 2AGOA 4QIGA 3N01A 2OD6A 4ECUA 3DLGB 4PUOA 1T03B 4AFFA 4N77A 4V19X 2Z2MA 1IJFB 2RNEA 2PIIA 2R7QA 1EP4B 4F02A 2V0NA 1IXKA 2GHPA 2C2EA 2IBOA 1TP7A 4DL2A 2PMHA 1IKVA 5EWFA 3VAJA 1DBDA 2J76E 2DHGA 3ENQA 3O8WA 5KFGA 2FTRA 2RDJA 4FF4A 1GXLA 2J6SA 3TVKA 1YJ9S 1UVIA 1HHSA 2MKSA 5K8OA 2MJUA 3HXMA 2HZCA 2C28A 4M95A 3CVKA 1DFDA 1V3ZA 1VK3A 2OJ3A 5HBMA 3CC2S 3TANA 3GIMA 3N5BA 1O51A 2F8HA 1CPZA 2B51A 3BS9A 4I64A 4LJMA 4H4MA 1M5SA 2K7JA 4KC5A 2PGCA 2ZJRQ 4F25A 2HHWA 5A8RA 1GXTA 2XY5A 3QLHA 3G6XA 4F4XA 3CXCR 4JV5F 3EGWB 1FT8A 1HNZF 1MWZA 2ZVSA 3A1YG 1FKAF 1Z4UA 1K0TA 4ZPVR 3AB4B 4M5DB 3JSYA 1S49A 3UD3P 1IBKF 1R6YA 1UVLA 2FHKA 2HWIA 3BSAA 1WTFA 2B6AB 2KHDA 4G1QA 4DHVA 2HWTA 3FZ2A 1X5TA 5HN0A 4AL6A 4IR9A 2V8DA 4N8NA 4A8WA 5HLFB 3ZZOA 1B64A 4ZCIA 5E33A 5A6PA 3HLUA 1QAJA 4C8NA 2JFDA 3JYTB 2M70A 2UZAA 3DLEA 2UU9F 4KTQA 3VR1A 1FRXA 3TNVA 1UETA 2X1BA 3PJWA 2RB7A 1HD1A 4DUYF 1H3DA 4HI1A 3CULA 1JX4A 2X1GA 3KLIB 4I7FA 4OV1A 4OJHA 3F44A 2P9GA 1TK8A 2XMMA 4G3IA 2GO8A 4O3PA 1NK5A 1WG5A 1KSPA 2G0CA 2KFYA 3MTJA 1FE4A 1DRZA 1ZAXA 4B17A 2CPDA 3S01A 3PEJA 3E2EA 4PQUB 3KKFA 2RQMA 1Y5LB 1Z2ZA 1RAJA 2VFTA 3CCZA 1W2BR 3Q8RB 5EN1A 1FEHA 4FF3A 4H4MB 3SSSA 4JI0F 1JLGB 5KFBA 2ZOFA 3P96A 3C6UA 3DM2B 2ASLA 2JEGA 4HT7A 1LFWA 5K14A 5KT5A 5J2MB 1RTIA 1UP1A 3T19A 5GAGI 2V94A 4DBQA 4ECYA 3M8PA 1U45A 2GIQA 3PIPQ 4RW9A 3IN5A 3M8RA 4ZHRB 3PNIA 2ASJA 3IS9A 2L9DA 4A4JA 2ZH8A 1Y5IB 3A8EA 1N88A 3X1LB 2GW8A 2UP1A 4KR0B 4LMZA 2GFFA 2CQPA 3DOKB 5C5JA 2DD8S 3FSIA 1H2VZ 2CQ1A 2XI3A 3I31A 3N6MA 5AXKA 3KG4A 2IRUA 3GFYA 1RTHB 3BEGB 1QVGR 2CPFA 4OZ1A 2O67A 4E0DA 2Z4PA 4OI0A 4PUOB 1UEUA 3SXLA 4DSEA 3M4XA 5E3AA 2B3TB 2ZHOA 4YB6A 2Q66A 2BYCA 1RT3B 2FJVA 5KFZA 1SIZA 4MJKA 2NUHA 1HI0P 1AROP 2HLUA 3FDSA 4WE1B 2QMWA 1KS2A 3H2UB 4DV6F 1R8CA 3MECA 2CFXA 5BYSA 5MLCV 2P6TA 2ZDOA 3IG1B 1YGYA 2DNZA 3HI9A 3GV7B 3HVTB 3ETOA 3T5LA 2GMHA 3FRZA 2HFZA 2GV1A 1RT5A 3V6DB 3I0RA 3MMJA 5CH7B 4HYKA 4DR5F 3OHBA 3VAIA 1N33F 1S6PB 1BD6A 2VPZB 2FVSA 4I7FB 3KLIA 3OJUA 4J5OA 2RKIB 1RA7A 2YVSA 2VBXA 4F67A 2I8EA 5L38A 5EWGA 1P1LA 3UDLA 3TI0A 2DVIA 4MKBA 2L08A 2WOMB 2VG5B 3J7YU 2R2TA 1Q82T 1WELA 5THWA 2W8KA 3OFHA 4IFVB 4OLOA 4PQAA 3DU5A 3QMQA 4JUZA 2DPJA 1S1XB 3NCRA 1TKXB 3G6YA 1C1CB 3BSCA 2BJDA 1O8BA 3MM7A 3KLGA 1K73T 2XB2D 1VQ9S 5GMKa 1F2GA 3M8QA 1R8AA 4NXMF 4IOAQ 1TFYA 1GH8A 1CQNA 4YR0A 2HGLA 5KOWA 1JLBA 4QWBA 3LP2B 2P6SA 3KTQA 5KFFA 2ROEA 5IM0B 4OX7A 1FRJA 2FJWA 2CQ4A 2BACA 3SMZA 2YX7A 4RW4A 1GNKA 1F9FA 4LF5F 3MUTP 3MEKA 4QJVA 3KHHA 2X1FA 4I2PA 2D9PA 4ETXA 4M94A 1VQSA 1M5HA 3TAQA 4OIXA 3MGJA 2I9SA 3Q24A 5KT7A 4ED3A 3CJKA 4ZP9A 4P7VA 2LU1A 4RKUC 5JVHQ 1DQAA 1YSJA 3NMAA 1TL1A 2PN6A 4RNFA 3KJVA 4KV8A 1D9AA 2R8KA 2EBEA 3U1NA 1IKYA 4ED1A 3OFFA 3AAWB 2FJEB 3B78A 1M5PC 2APOA 2R7UA 4DV5F 2P5VA 2AP6A 2RT3A 2NQPA 5B0CA 3VF0B 3DRPB 4F50A 1FRMA 4ECXA 1U1PA 4RUAA 3CCUS 2DK2A 2EK6A 4OX8A 2AU0A 3M30B 4IYQA 2IA6A 3NBPA 1NJWA 4FPRA 4OLPA 4YB1P 1CC7A 2ZZMA 2M7SA 4MIWA 5B0FA 3DLGA 2XS2A 3AQOA 2DIVA 1NJYA 4MIBA 3ICLA 1FJGF 2DR9A 4Y6IA 4LSNA 3L7OA 4C8ZA 3MFIA 3QWUA 5IZHA 3CCES 2DR8A 3NNHA 3GYNA 2JSXA 5T7LB 4CT9A 4NRUA 4GO7X 3QO9A 3MM6A 3TAMA 2OTLS 2BE2B 3FSXA 4Y3CA 5I3QA 1W2IA 1NH7A 3OTOF 1KQGB 2B4PA 4EFAC 4I67A 3FRYA 1RTDA 2MQOA 3H5YA 4RX6A 2LA6A 3QWPA 5CYQB 3NMRA 2ERRA 4K5RA 2D3ZA 3NKYA 5DS7A 3DFEA 4BBYA 2MQPA 3OUYB 3I5BA 1ELOA 1GAOA 1RTJB 2KZZA 2AJ1A 2W4CA 3AY0A 2EFPA 1N4LA 4MK9A 1Q16B 3I0SA 4YQWA 3CCRS 1N0UA 2XSJA 3I5CA 5L39A 2CQDA 3MEEA 1UA1A 1FD8A 2KRBA 1HA1A 4JV0A 1XBWA 2ZUGA 1U1RA 2UUCF 1VQOS 5J2PA 5E7OB 1U25A 3HHLB 3T6JA 4U7CA 3V6HA 2FGCA 3J81Y 1NJXA 2BR0A 1E6YA 3QGGA 3UI3A 2F7VA 1FF2A 3HVWA 3E01A 1JJ2R 5F8HA 4I2QA 4OZNA 2ILYA 3H4BA 4P2SA 2LECA 1FVQA 1RQ0A 1T02A 4Q2LA 4RWWA 1D8ZA 1WHVA 2LLZA 3M32A 2OKQA 1IJEB 5J2PB 4Y28C 5E3QA 3CDBA 5KG5A 4RWXA 1C4CA 3MEEB 1S0VA 4TNOA 4ECVA 1G2EA 2QEXS 2HNZB 1SBRA 4QPXA 4B9TA 1S0NA 1FRIA 3OSPA 2VQFF 5FDLA 4X4TA 3FFIA 5CYQA 5IWAF 1NRKA 5M2PA 3K5OA 4OI3A 3C2PA 4KFBB 1L3KA 2W9AA 2R8IA 4DV4F 1RTDB 1X5OA 2M5YA 3MR3A 1V6HA 1X4HA 2HPUA 2BE2A 1HBUB 1LW0A 1LK7A 2Q6CA 3MMAA 2IAJA 2J9EA 4NX9A 2Q79A 3TA2A 2J0SD 4WIIA 3IBWA 3K59A 3GYXB 2V9KA 2ABYA 4CZCA 3CPWR 3HVRA 1U1NA 5KFMA 3IR7B 2RE1A 1NH8A 3WDOA 2B7CB 4BC7A 3ITHB 5GAGU 5B0GA 3H2LA 4K4ZA 1HWUA 2C3OA 1NKBA 4B9SA 5J2QA 1FO1A 2ZC3A 4OZ0A 3K5NA 1WNEA 1VRTA 3OR1A 5CYMB 3IAS9 1REVA 4ZS6A 3PV8A 1LWEB 1D8YA 4D3HA 3DRPA 4KB7A 5GADU 4A8SA 2FHJD 1V9OA 2ZKUA 4NMLA 4I69A 1RKJA 3TVZA 1IKYB 1Y0HA 4TXSA 3K5MA 3CJ4A 2KZMA 2WONA 1JXLA 4DV7F 1NHUA 3U1MA 3KYLA 4A8OA 2J7UA 3CJKB 2ZH4A 1X4BA 3DLBA 2GQQA 4NZ7A 3MTKA 1P1TA 1FKPB 3QYYA 5DQIA 5CHCB 2CJQA 3V4IA 1WHYA 2EFOA 2YNIB 3OBIA 1S1VB 3I4HX 2DHAA 4MKAA 1T3OA 4QCLA 1VLYA 3R5BA 5G0RA 3M8QB 4C8KA 1P8GA 1QAIA 3KLGB 3N4WA 3MHYA 3OSNA 3G9CA 1C1CA 4QWCA 1TKXA 3MM5A 3GFXA 4OHZA 4X84A 3KWMA 5KFWA 2C2DA 2MKHA 2DO4A 2UVWA 2C3YA 4A8FA 1MROA 2RKIA 3H40A 1Q8LA 3KLHA 2W24A 5J1PA 4K0KF 2BM1A 1S72S 2HHVA 1MMDA 1VRUA 1FKOA 4C7QA 2DNMA 3TUZC 1JLCA 2IFXA 1LWCA 2VB6A 1DAXA 2CG4A 4EO8A 4KIAA 4RNNA 5D4OA 3G86A 4JI8F 2XBPA 5KFIA 3W2WB 4A46A 1APSA 5ITHA 1MWYA 2EBGA 2OPRA 1YI2S 3E51A 3CMES 2XY6A 2IC3B 1JJHA 3DI6B 3MCSA 5D6GA 3J7A1 2OO4A 1XR7A 2QRRA 4R5PB 3VWSA 2DR5A 1AW0A 4QOTA 3FEYB 4ILLA 2DCLA 2IMWP 4HI2A 2OSQA 1RKIA 4B3SF 2KYZA 4LSLA 3GILA 4ED7A 2HQIA 4QWEA 1JLEA 4A47A 2XZWA 4ILRA 4R0JA 2MPUA 2N4CA 1J5OB 3CD7A 3J7YI 1NK0A 1KC8T 4N76A 1KONA 4O3SA 3CO9A 3IA0A 4I6YA 4QIWD 4OZJA 1D9DA 4CO3A 2XI2A 2PDAA 2B5JA 4GMKA 1MROB 1P27B 3B82A 1TR0A 2ROPA 1S48A 1ZZFA 3CTRA 4RW9B 4KKOA 5I3PA 4ECTA 2HHHF 4HKQA 1HBOB 1U24A 2I0XA 4IG0A 4FVMA 2W7AA 2JWNA 3KLEA 1KN6A 2DNQA 2YNHB 4X4SA 5E3RA 4DX8H 3V6JA 1L3SA 3OR2A 3VTIA 4Z37A 3DLHA 4UW2A 3CIMA 2OAUA 4W92B 2V8HA 2BBEA 4WFNQ 3BN4A 3EGZA 2YX4A 2XWXA 1RT7A 1VI7A 3TVYA 4C0BA 3LAMA 4UY8T 3GV5B 2FC9A 3PVXA 3ZZZA 1IN0A 3OQ2A 3KHGA 3R5CA 3CEDA 1AUDA 3TA1A 4QYRA 4L72B 4OHYA 4JI3F 3OFEA 2B0GA 1YJRA 3MFHA 5BYQA 5BR8F 3QGIA 3TYTA 5L1JA 4ED5A 6FDRA 2NREA 1DQ9A 3AQPA 1OWXA 4NA1A 4J9LA 1SUQA 2FJBB 2JEFA 2ZE2B 2D9OA 5IFMA 3PO5A 3FCHA 3N9UC 3TUIC 4PWDA 2CJAA 2RQKA 5CXTA 2WB4A 3MEGB 2JHEA 1REVB 1Z1ZA 2B6AA 2QSWA 2ZDPA 4G1QB 3BDEA 1S0MA 4B3TF 4B9UA 3OTDA 2E5GA 4ZVEA 3TOQA 3FQKA 4M5DA 4YHHF 4WU3A