4DV2F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv2F00
1G1XA 4DR7F 4JI1F 1XMOF 4LF4F 5BR8F 1FKAF 2ZM6F 4DR4F 1FJGF 2UUCF 4LF5F 1IBKF 4LFCF 4DR2F 1J5EF 4DUYF 2E5LF 4DV3F 4DR6F 2VQFF 4X62F 4JYAF 4DV4F 2UXBF 1I94F 1XNRF 4JV5F 1IBLF 4DV6F 4DUZF 4DV0F 2KJVA 2UXDF 2UUAF 2KJWA 1IJFB 4DV1F 4B3MF 4LFAF 1IBMF 3T1YF 1QJHA 4B3SF 1N34F 2BXJA 4LF7F 2VQEF 4X64F 4AQYF 4B3RF 1GH8A 4DR1F 4NXNF 4JI6F 3R3TA 1XMQF 1N36F 4DR5F 1CQNA 4NXMF 4X65F 4JI5F 2UXCF 4LF6F 4OX9F 1B64A 4K0KF 1G7CB 5LMNF 4DV7F 2UUBF 1LOUA 3OTOF 4GKKF 1HNZF 4GKJF 1CQMA 2B7BB 4DV2F 4DR3F 4JI2F 4JI3F 4KHPF 4X66F 2YY3A 1F60B 4LFBF 1N33F 1HR0F 4DV5F 4LF8F 5IWAF 3T1HF 1IJEB 2B7CB 1HNWF 2F4VF 2UU9F 4YY3F 1HNXF 4LF9F 2RJZA 1RISA 5AJ3F 1XNQF 2HHHF 4JI7F 2BVZA 3ZZPA 2J5AA 4YHHF 5LMUF 1VMBA 4JI0F 4JI4F 4B3TF 4JI8F 1N32F
chains in the Genus database with same CATH superfamily
5KOXA 2ZEJA 3L4BC 4FPIA 4ICLA 1X4AA 3PW5A 2B43A 1RWPB 1FFSB 4IG0B 5E3CA 3BO4A 5KFNA 4B3TJ 2DJWA 3R5JB 5HQMA 4GO7X 5BR8J 4P7VA 2ZM6J 2UUCJ 2AMCB 4O3NA 3EGVA 4X4SA 4ETZA 3DLBA 1E6VB 3POTA 3RGIA 2HNZA 1HBOA 1R0BG 1ZOTA 2AV5A 3VZIA 3HKWA 2VU5A 5KT5A 4CRJA 1H2VZ 4JI3F 4DFPA 3LUYA 2IJRA 4C97A 3CMAS 1MU2B 2VJUA 2PFFB 5HL7Q 3AB2B 1T9YA 1NK4A 3I0SB 4J9NA 5HQ8A 3F56A 3ZZ0A 3DNCA 1YJVA 1V3SA 3K5LA 2WBRA 1KP6A 1W7WA 4HTIA 2FVCA 4Q44A 1VK3A 3IR5B 1F2HA 5I42B 5HANA 1FXLA 5KT2A 1RUSA 2JVOA 1CJVA 1ZS6A 1GMWA 2ZBCA 2VPZB 4B08A 3MEKA 3HLUA 1DLOA 2F1FA 1PJ6A 3F73A 3TJ9A 1WC4A 2RS2A 2IM1A 1S9GA 2FZGB 5GADU 2B8QA 3SSQA 4DF4A 3W9IA 2QG9B 2VDHA 3P6YC 4NCBA 3D4JA 1V3ZA 4QWEA 1I94J 3QMQA 3K2YA 2Q6BA 2FVPA 3RBXA 2CNNB 3W2VA 3TRGA 2B8PA 4AE5A 1M1KT 4LF6F 3UFCX 3BO3A 2CJXB 5AXLA 2LECA 2XSJB 4H4OB 2Y1RI 2ASLA 2BQ3A 3C6TA 4F67A 1PJ7A 2HVIA 4C2MA 3T1HF 1K0VA 2HNDB 3TX8A 3A4TA 2DNPA 1RT1B 4OX9J 2VG5A 4RUHA 5EDWA 2CPDA 1SJQA 4ZVUB 3DDKA 3GLJA 2H9ZA 3PHEA 2PEHA 5KT7A 1BY9A 2JDJA 2ZH9A 3FK4A 2RT3A 3QGPA 3V81B 3RBDA 1JK9B 4RW4B 4NMLA 1CSJA 2M0GB 5HAOA 2EKYA 4IQMA 2XWXA 3MPUB 3UW1A 4Z2XA 3Q0AA 2MKIA 4A8YA 2IY5B 3MAHA 4PG4A 4I1TA 5KT6A 1KBRA 4F25A 2W2MP 1I1GA 3FSYA 2MGZB 2B56A 5JUMA 1C0UB 2DXFA 1OQ6A 3TQ1A 1PCAA 4W90B 2XCAA 4AXJA 4EU0A 5KT3A 1Z4UA 2BJEA 4H4KA 5FD1A 3PEJA 2LEPA 5CHCB 2HIYA 5AXNA 4PG6A 3H5SA 1VS3A 1MROB 5IM0A 1IBMJ 1ZM4A 5G0RA 3E2EA 2QYGA 3DRRB 2A18A 1WKKA 3M32A 3SV3A 2MSSA 1TUGB 4A4JA 4Q0BA 1RT5B 2PDAA 4CLLA 3MM9A 3EPIA 1GXTA 4GKJJ 4C11B 3D66A 3IXQA 3RUBL 1IKVA 1N6QB 2XMWA 5GVQA 5LMUJ 1UEUA 1S76D 3HMJG 1WOOA 4JI0J 2NSBA 2YWKA 2R8KA 2V8VA 1CJUB 1FKPA 3EX7B 1JNZB 2ZWPA 2XS2A 2A0FB 4IUFA 1WWHA 3LQVA 4DR1F 5AXMA 4NXNF 4DPXA 1N36F 4F0HA 5DDQC 2KO1A 2CQ1A 3QO9B 5LM7E 2WCXA 4B3OA 4DJBA 2QEXS 1Q8IA 1EHWA 3RZAA 3N6LA 2FLPA 2AJ1A 2Z0GA 1PGZA 4OZ5A 3BSCA 2CG8A 4L3NA 4OV6A 3L3CA 2HQ3A 2ABYA 4OQJA 1OMSA 1FE0A 4ED3A 4NLVA 5D0HA 1HKAA 1W25A 4NLDA 1P1LA 3BM7A 4AYBD 4ITSA 3PV8A 2DNOA 2LQ8A 1S6PA 1CC8A 3A3PB 1NJXA 2H5IB 3U7JA 3KLVA 4OZ2A 2HGLA 3MMBB 1RT7B 2EC2A 3ENWA 4X84A 4DV5J 1WF0A 1UAWA 3RTVA 1EP4A 4LT6A 4K8RA 4EUVA 4EO8A 5I3PA 4QZVB 4DR4J 3RYLA 5JMNA 3MUVP 1HBMA 2FVSA 3DRSA 1RTJA 5ETMA 1YLXA 2K8GA 3CD6S 2PA8D 4CT8A 2LVWA 4B3SJ 3ZZZA 3VALA 3D3CJ 2MJUA 2R7XA 1S6QB 3MWBA 4KIAA 4USWA 1NSKL 1E6YA 2RIJA 4HT5A 3JSBA 4J91A 1OSDA 2X3DA 3MMAB 3DLGB 4M5HA 2JFDA 3ADAC 3JS9A 2O1PA 2C2KB 3CDEA 5MAOA 3UN3A 4CO3A 1RAJA 2UP1A 4KH1B 2DNRA 3H4BA 1X4BA 2OPQB 1V5VA 2AYBA 2VDIA 1KQSR 1C2PA 3AOAA 2BA9A 2AP6A 2ZZMA 4PWDB 4QYRA 4YHHJ 5IWAJ 2MQMA 2SXLA 2WB4A 4JP8A 1QJHA 3QNWB 1SBRA 2KXHA 3DRPA 2CDQA 2W9AA 4CO2A 3F44A 3KK3B 4RW7A 2HBYB 4I68A 5C24A 4N8OA 3QIPA 2UXDJ 5B0FA 3KHHA 3KUGA 5HVHA 2B6AB 3J7AN 5BYQA 2XULA 2W9BA 4ZP8A 2VC0A 3ZTOA 3OLBA 1K44A 1V9OA 4DV6J 2F9DA 4RWXA 4GC7A 4KGVB 3DCAA 3OPKA 2V63A 3NWRA 1TL7A 5HP1A 4CM0A 4ID5B 4KC5A 4I69A 3TA0A 4EFAC 1NEEA 3HHKA 4ANDA 1VR6A 1BE4A 2RHSB 1NJYA 2DRBA 1B70B 1U45A 1YDLA 4LF5F 4ZPWR 5CYJA 2DRDA 3C6UA 1S0NA 3LP0A 1URNA 3HVWA 5FDLA 2DK2A 3BGRB 4ED1A 3KLGB 4QWBA 1WOSA 3RAMA 4ZVTB 4U6PA 2IDEA 1HNVB 1PAUB 1CJKB 2NXJA 2VQFJ 3LWMA 2OFHX 3UVJB 3MM8B 4LIWA 1S10A 1S1WB 2GS8A 3OXLA 4A8OA 3HVTA 2LEBA 2DR7A 4KT0C 3ICLA 1VBXA 1X9SA 4QBUA 2XYGB 2MZSA 2WZ1A 3G8TA 2DT9A 2EC0A 4ECXA 2E5JA 4YDXA 3AQOA 3W62A 3G6VA 2KG1A 4NPOA 4O0IA 4ZVPB 2IC3A 1EARA 1RISA 1QSLA 3FSXA 2YH1A 1T9VA 4RW6B 1BQNB 2BABA 1LWFA 2NR0A 1DTQA 3OR2A 4LFBJ 4RNFA 2VASA 4O0NA 4F8RA 4F4YA 2PMWA 2HMIA 3GPAA 1P8GA 5C7PA 3QPIA 1J5EF 4NA2A 2WW4A 4BCAA 2X3GA 3B8HA 3PEHA 3V6JA 1TK5A 2MLZA 2YNHA 3TP2A 1SV5A 1HHTP 3FKBA 3SFGA 1MG7A 3KNAA 2ZUAA 4B02A 3C46A 2IFXA 3BQ1A 4LBHA 4DXLA 1H74A 3IGVA 2XZDB 3TEGA 1N8RT 4UY85 4JI1J 1VRUA 4NA3A 3S01A 2HIQA 2WOMA 3C16A 4DFMA 4ZCIA 1NB7A 4CLYA 4RNHA 2UVUA 2E44A 3D6FB 3WC0A 2D3O1 4DSKA 4JI7F 4EMDA 4L74A 1KR4A 4ZP9A 4W4MA 1IKYA 4J7CA 2ZITA 3A3OB 1T0TV 2UUWA 3DLKB 2B4UA 1LWEB 3IS9B 4GVBA 3MM5B 3HD1A 2MSTA 4EO6A 3P5TL 4IG3B 4U8YA 2JL9A 2X1AA 3MCMA 4U95A 3UCUP 2WBMA 1U0HA 1S59A 2PI4A 1RT6B 4IH6A 1MLAA 5KFIA 3I55S 1M5PC 4F4WA 4A8WA 4PUOA 4DV1J 1NUEA 3RBEA 2Y8WA 3O1LA 4ECSA 2CQ2A 4DMZA 2ZHOA 3CCUS 5CYMA 4DFKA 4LF8F 2LQ5A 3C15B 1HQEA 3JTNA 2RKIA 3Q8RB 2YNFB 4ZVHA 2CQHA 1U6FA 4DV2J 2KH9A 3AA8A 4OJ3A 3HSDA 1WTBA 1W26A 3IG1A 4QW9A 1UVKA 3C3LA 5DDOC 1MWYA 1TZ0A 1B99A 1WJ9A 2NZ4A 3H4DA 2H4WB 3DGVA 1BQXA 1VBYA 2V6AA 2R7SA 5KAKA 3V4IA 3BZQA 4P2XA 2QA1A 3DGPA 3SDEB 5KG3A 2GMHA 3IBCB 1FD2A 4P2FA 1T95A 1WELA 4DR6J 2W8KA 3K5OA 3V2UC 2VG7A 1IBCB 2KL8A 3ELHA 1BQMA 5H9FJ 1HBUA 4X66F 4DF8A 3I9V9 3FC9A 3NS5A 1S72S 2DNLA 2LP4A 4OI1A 1UTAA 3R5GA 5D77A 4CT9A 2OEJA 2DRAA 3NGUA 2MKYA 3PW0A 4GKKJ 1FO1A 1ZPVA 2QLXA 1PYOB 3W5ZA 1DURA 3LALA 4URSA 1TFYA 1C1CA 3PKYA 4KQZA 4Y0FA 3C8YA 4AL5A 3PDNA 3OTBA 4OFZA 3I5BA 1RCXB 1B0PA 3EVWA 5AE1A 4Q2MA 5DLGA 3JYTB 4G6VB 4CLSA 3GR0A 4NLPA 4M5MA 1IKXA 5DG7A 1N32J 2GGPB 2JVRA 1VOMA 4QU6A 1K9MT 1XMOJ 1T11A 2KRBA 1RAAB 1QY7A 2M52A 4MKAA 4DV3J 1FDDA 1K1SA 3JSRA 4HI2A 2XO6A 1YZ7A 1M5OC 5KG6A 1VQSA 4M63A 1CQNA 4OHWA 4J9KA 3GV7B 4D3HA 3TARA 1UJ5A 1UJ4A 5SZTA 3MPVA 1ITPA 4URGA 2J6UA 4OYMA 1B3TA 3ITHA 2WHOA 1HLWA 4F3OA 1NH7A 1U09A 1GQEA 2CQDA 3MHYA 4USVA 3JQMA 4OV1A 4K4SA 2UUBJ 2KZMA 2RNEA 2XQCA 2FJEB 1SJRA 5F8LA 2R8HA 3G82A 2KB2A 1RT3A 3W63A 1YG0A 4ZPDA 5ETRA 1M5KC 4O3QA 2RQCA 2ADBA 4TNOA 5EGYA 2X1FA 3N79A 3NBPA 3TUZC 4CP5A 2UUAF 1G6BA 1UETA 4W98A 1KD1T 2QX0A 3LO3A 3M9NB 3MTJA 5KFQA 4Y2CA 5HN0A 3AOBA 3V6HA 4NCGB 1D09B 1SVDA 3VF0B 2DR6A 4EWTA 1FXDA 3L9ZA 3TVYA 2DNQA 2HGNA 1YJRA 1YBUA 4O3SA 1WI8A 2KT3A 2YKNB 3TNVA 4AT1B 3H20A 4PG8A 1SC3B 5HMYA 3N0VA 2FC9A 2GVZB 2A10A 2AX1A 1Q7YT 2DNKA 4QR1A 4ELVA 2COLA 3UPFA 4WFAQ 5KFZA 4DSIA 1O6XA 3VGTA 4M1KA 2LLZA 3BEGB 1CULA 3CCQS 3OT9A 5I4MA 3CD7A 1KLMB 2RB7A 2FHJA 2M7SA 4DX6A 1FE4A 3OHBA 3BGUA 3OL9A 2XMAA 2ZH3A 1BUXA 4ZMMA 2QGFB 2AD9A 3ZZYA 3P96A 1PC5A 1BLUA 4N41A 1TV6A 3SYZA 4CWBA 5L1JA 4RR5A 4YEAA 2DPJA 2N7CA 5GAGI 2GIRA 2WVFA 4ES1A 4MFBA 1FVSA 5B7WA 4QWDA 2U1AA 1JNRB 4P71A 2QL9B 3KYLA 4OHYA 1LEOA 4ZCMA 3M30B 3MCSA 1N5VA 2HBRB 1KLNA 3HHLC 3H5UA 4DL5A 4G1QA 4ZHRA 2E1RA 3PACA 4DV0J 1OPIA 4N7TA 5DQHA 4WPAA 4FKYA 2ATCB 3T9NA 4WE1B 3DI6A 1VQ7S 2LQBA 5E3QA 2OMLA 2J0SD 4HACA 1Y5IB 1FRMA 1RTHB 2D41A 2XZWA 3SSSA 2IYGA 4PPZA 2EFGA 3QFHA 2NUUG 1WEZA 4RNNA 4TU7A 4B9NA 3JSMA 2BZ2A 3TJ8A 2HZVA 1PIEA 2W2PP 1J5OB 1JLQA 1ZYQA 2GCFA 1NPPA 2FVRA 1RAIB 2O5DA 2AIRB 2DB1A 2RS8A 1FCAA 1OS5A 1T05A 1JKHB 4DX8H 2W24A 4X62F 2POKA 2GQ2A 1R8CA 4OZ0A 7FD1A 4ED6A 4QR0A 1CBKA 3N6NA 2YWHA 1QE1B 3FEXB 3SQOP 1TKXA 3GZ7A 4C8KA 3ILJA 2V8HA 4CTAB 3W2WA 4FPRA 3GILA 3W66A 3UN5A 1BC6A 2HAIA 2MQOA 1RXOB 2XHWA 4B3MJ 4C4WA 3CCWA 2V9KA 1JX4A 2HQCA 8RUCA 3KLFA 3BDEA 1KNZA 3AJDA 4N8NA 3THPA 2MY7A 4LMZA 3MEEB 1HBNB 1FX2A 2B7CB 4FYVB 5DG9A 1C0TB 1X4HA 1RADB 2R2RA 3A8IA 4OI3A 3BV8A 4NZ7A 3HO1A 1UVJA 2AT1B 3CPWR 4CLFA 1S57A 1XBWA 2CFXA 1MN7A 3ZTPA 1G3OA 2P9CA 4OI0A 3MD1A 3P5BP 3P4UB 3R8YA 1YX2A 3UCZP 1NM2A 4N5SA 1YBTA 3PYDA 1Q8BA 2J7UA 5D3GA 4OYZA 3K5PA 2J6TA 2VC1A 3BBBA 3PFOA 1ZM3A 5B0BA 3KJQB 3RR8A 5B0EA 3CXCR 2HZAA 3R3TA 5KFKA 1S1VA 2EFOA 4PABA 3EUNA 4BC7A 3DYAA 2UUTA 1UVLA 3GV8B 3VVTA 4LSLA 1S1UA 1HWJA 3WBZA 1TR0A 1Q95G 3UI3A 4C3MA 2I9SA 2DVIA 3IM8A 3KK2A 2J7KA 2N4DA 3OTCA 4KKOB 4LR7A 3NKYA 2CVEA 2DGTA 1Q81T 4DOZA 4RW8B 1N33J 1XERA 2XY7A 4DS5A 1OY9A 3FZBA 5A6PA 2V50A 5EUHA 4HHJA 2VV5A 1NHUA 3IGNA 4LFCF 1NSQA 2EWHA 3DLEA 1FD8A 2IDLA 2RRBA 1SL1A 3T6JA 1SJ1A 2A6MA 2HK2A 4O44B 2DR5A 1LQ9A 2GNKA 2NSCA 3EVMA 4IFVB 4DV4J 4I7FA 2ZE2A 4DZDA 2F40A 2OELA 4RX6A 1OY6A 2CJ9A 1EQMA 2JLGA 1RAHB 3OTOF 3TAMA 1UPMB 2RUSA 1F60B 1WG1A 1JJHA 3SQGA 1N56A 2DH7A 5C25B 3FGVA 2N4CA 4L73A 3TVKA 3MAAA 2CPEA 2X1GA 1S77D 2QLJB 3FDSA 1WDDA 3U1NA 2HLTA 1XNQF 1GMUA 1K73T 1UP1A 5L46A 2EI5A 2DR9A 4XPEA 4OYBA 3QAEA 3C14A 1N5SA 1RLCL 1WHWA 2Q79A 2W9CA 2NYHA 2HEKA 3M6XA 3U1LA 2IRUA 2BOAA 1JMTA 4I2QA 1N5YA 4PYDA 5J2QA 2MKSA 5T14A 1S1XB 4CCHA 4BHQA 3IAM9 1U1LA 2CDRB 2C2MB 2XMTA 5ETLA 2C2NA 1LV5A 2QRRA 1RA6A 3QRQA 1R43A 4WFBQ 3VAIA 1XN9A 4DR3F 2DYAA 2YXLA 1KRPA 3R27A 4XO0A 3Q23A 4G3IA 2YKOA 4X4TA 5L1IA 1NBEB 3VTIA 3O3LA 1SJ4P 3BGLA 3JQKA 4WP3A 4JV1A 2DGXA 4QW8A 5T7LB 3R2DJ 5DQGA 1X4EA 2CIMA 3UD3P 2G1DA 4ATNA 4B9SA 1A0OB 1SKWA 1OQ3A 4LVNP 1WTFA 3EZ5A 5AE3A 4YUDA 2NPFA 4LF6J 1Y00A 1GFWB 1GXUA 2KFZA 5AJ3J 5HJXA 4AUKA 1YWXA 3US5A 2V4QA 2QSFA 5KOWA 1YI2S 2HBZB 4LFAF 1N4LA 4ZPVR 2R9LA 2E9ZA 2DEIA 1ZTTA 1YJWS 3H0PA 4X4RA 1UKUA 2QA4S 1H6KX 1AB8A 2DHXA 3IRXA 3DMJA 4AL7A 3MPDA 1YITS 4A8XA 2EXUA 1HHSA 2H5JB 4EYHB 1RHUB 2PMHA 3MAQA 1DQAA 2GZOA 1QVGR 4CLKA 3ENAA 2DITA 2WW8A 4CNZA 3QJLA 4OYOA 1X4DA 2IMOA 2YNIB 2MLXA 4KPYA 5CA5A 2BANA 4UOGA 5C42A 1FT8A 2DY1A 3Q8SB 2ASJA 1LW2B 3G9CA 1FK9B 1UL3A 4IFYA 2KTQA 3D3BJ 2MJNA 3HFKA 3W60A 1SQEA 3ZFVA 2FJVA 1HHQA 2L3MA 2HQFA 2A2CA 1PG5B 4PAAA 4C9DA 1UW9A 3HHDA 3H42A 2HWTA 4WTOB 1IR0A 3KNGA 4F2SA 2B5JB 2KM8B 1QSSA 3CVKA 1ZAWA 1M1HA 2J7WA 1TL1B 1FTCA 2XGPA 3CC2S 3PCOB 3UE2A 4Q43A 2R7OA 1VQYA 3GJSB 1XMQJ 3MEGA 3QGGA 1SUQB 1R8HA 4FYXB 3W5YA 3SZ2A 1IKWA 4NXNJ 3W1YC 1VQ8S 4ZJLA 2HZCA 3OR1B 4P2MA 2LU2A 1U1MA 1LW0B 4LBPA 1RYRA 2HS4A 1FRXA 2QSWA 3NGSA 1T03B 2LDIA 2ZH7A 5D0EA 4ED5A 3CDWA 2WONA 1UVNA 1RKJA 3MOZA 4ECTA 2MKJA 3VHQA 3M2RB 3B82A 2V4JB 1VFJA 1WF1A 4F4XA 4DUYJ 2DO0A 2OPSA 1JLBA 3J7YI 2YNGA 4UOFA 5C5JA 2XBPA 2OAUA 4Y6IA 4DCPB 4TU9A 2XLJA 3MR6A 1N0VC 1KOHA 1IWAA 4CO0A 4B3RJ 5CD4H 3HKZD 2E7VA 1HPZA 1FWKA 4RBVA 2ZUGA 3NNCA 3EVOA 4TLQA 2FGOA 2HNYA 1NRKA 2HFOA 1Q82T 1L3SA 2YX4A 3MM7A 4OIXA 2BKNA 1SC1B 2WVDA 4LF4F 4I0WA 3BR9A 1EJ7L 2VBYA 3KLEA 4YMEA 2XMJA 1EB0A 1U49A 4ILRA 4JV5F 4ANCA 1NKCA 4FNIA 1SH3A 1V5IB 3KMQA 1T3OA 3A3NB 7FDRA 2IM3A 5J2NA 4CM2A 2UVWA 3KOAA 4Q2LA 3LP2B 2CPZA 2BBEA 4LF7F 4DL7A 3D7SB 3RBZA 4KGXB 1FFWB 2J9EA 2MQ8A 1TKTA 1RTIB 1DTTA 2D3UA 2M3DA 2GV1A 4JB8B 1CPZA 4CO1A 2O3DA 2VQEJ 4LIRA 3FBCA 2VBXA 3GE9A 4HHHA 4OJGA 4C8ZA 2CA9A 4ECRA 1QTNB 2OUGA 2VHGA 2RDDA 2L08A 4KFBB 2DR8A 3ETMA 3K57A 2HHHF 2IVYA 4IDKB 4L75A 4DG1B 4I67A 2XMMA 5T41A 1DQ8A 4RL1A 1Q79A 4DU8A 4OX8A 2IAJA 5J1EA 3JAMU 5A8KA 1NDPA 1S1TB 4FF3A 2V69A 1VBKA 3T5KA 3IBWA 5CXTA 3WDOA 3FMWA 2KZZA 2DHGA 2UVVA 4Y34A 2RQ4A 5A8WA 4DI6A 2RF2B 4OI2A 2F63A 1JLAA 5LL6d 2FLNA 4PQUB 2W01A 3IWLA 4WP8A 2HURA 3TO8A 4G1IA 3QJPA 4GC6A 1KDNA 1JLGA 4AQYF 3HP6A 5HBMA 2Z2YB 3B4MA 4FF2A 5B08A 3ONQA 1YKWA 1A6LA 5D4PA 3TZZA 3M05A 4P72A 1L3KA 5JVGQ 3DOKB 2VZ9A 2RUGA 2EFNA 5K20B 2QO3A 1LWXA 5L38A 4BLGA 4WFXA 3I4PA 2ZC3A 1HA1A 3QLHB 1NCLA 1APSA 1X4GA 2XB2D 4DV7J 2HWHA 2I2YA 3OTDA 1VYAA 4OZNA 2DO4A 5A2QU 3SXLA 4WYLA 4J9UE 4B3TF 3HT3A 2R2SA 1IR1A 5IT4A 5BR8F 2ZM6F 3GSIA 1GEHA 3QATA 2UUCF 1N0UA 4PXBA 2VG6A 1BWEA 3N4WA 1S48A 1M0SA 5A0YB 4KB7A 4KGKA 1N48A 4C6AA 3HHNB 1FJGJ 2OPRA 2N3LA 3W5XA 1YQHA 4PXCA 2B4OA 4LSNB 2XO7A 3H2LA 2JHEA 3F0NA 2CQ0A 2MQLA 2GVDB 1T9XA 3OFGA 5E3RA 2Y0BB 1X60A 3KJFB 3FQKA 1CC7A 2J76E 2DEJA 2GAGC 4HL9A 4RU2A 4OYWA 2DNNA 3W61A 2PIIA 2FIUA 3GQCA 2ALZA 5B09A 2WK4A 2JC1A 5D4NA 5IXUA 2OMOA 3I0RA 3AY0A 1HNZJ 5F3ZA 1HI0P 1RGVA 2YQ1A 4E0DA 3TOQA 4ZN1A 2GO9A 1NJIT 4ANEA 4DU7A 1YJ9S 4HKQA 3R7NB 4USJC 4NRTA 3IAS9 3VAKA 4ECWA 2NXCA 1I94F 4PPDA 2DGOA 2C3PA 4QIVA 4ED8A 3M2UA 2BE2B 3ZTRA 1AUDA 1J27A 3HZGA 3ILLA 3NS7B 2VONA 3CDAA 2CG4A 4F3MA 2IBKA 2OLWA 2QFJA 3I96A 5FIIA 3GR1A 2FHKA 5KFHA 3KJVA 2LMIA 4OX9F 3UDLA 3QZ7A 1S6UA 3TW0A 3J7YU 4FXVA 4K4TA 2HS0A 4NRUA 3MR5A 4J9VA 5HI7A 3GIRA 3SI8A 2F5GA 3KMSA 1TUWA 1LWCA 2WRMA 1Q0NA 3M9MB 2F4VF 2UVRA 1NDCA 1FRKA 4FN5A 4DQIA 3AD8C 2JJ4D 4R5PA 1YGYA 4EZ6A 4AFFA 3ZZOA 3KLHB 3UNYA 3M9OB 5KFYA 3E3XA 1MNEA 4FVCA 3O2IA 1HYSA 1X31C 4URQU 1GX6A 2DHAA 4DUZF 2OP5A 4KO0A 5HMXA 4H54A 4LF8J 3O6QA 1HNIA 3DFEA 4ED2A 2IJFA 4YR2A 4HH1A 2NREA 1H2TZ 3D28A 1Q8LA 3ZXWA 1G2EA 1X5PA 5I3QA 4F36A 4Z7YA 1Q5YA 3WX4A 2D1CA 3N28A 4BWJA 1NK6A 3I56S 4KV8B 4J9SA 1UA1A 3MEDA 3HHLA 1JLCB 1RTDB 3HDSA 2K1RB 4MMOA 5KFGA 5EX3A 1B4SA 4JOUA 5SUHA 2VIHA 1GX5A 1LK7A 1VLOA 1VIXA 3CJKB 2CVIA 2FVQA 3GG0A 4Q7AA 4QWAA 4A8SA 1KHWA 4NI2B 3RB3A 3J81U 4M5KA 1NK7A 3LOUA 5LMUF 4YB5A 4JI0F 2AZ1A 1BGXT 4TU8A 2OO4A 5KTQA 2GFFA 3NCQA 1R0AB 2OD6A 4KH0B 5F41A 1AZSA 2CPXA 4AL6A 2V8GA 5ETVA 3FBFA 3GIMA 3A8KA 4K4XA 4ZN3A 4X66J 3AODA 4V19X 1WEYA 4X4UA 5F8MA 3GYXB 3OUYB 2P2CB 4HTJA 3NXZA 5HK4A 3M2VB 1H72C 2HQDA 3CGIA 2H51B 1FKOB 4C0OC 4FF4A 1DARA 2CKWA 2XMKA 1CJTA 4DR5F 4OZLA 3R5DA 1U1QA 3CE8A 2BM1A 1SL0A 2ADCA 3LP1A 3NMRA 2M88A 2CZVC 5F8IA 3P3DA 4L3KA 2E9TA 4J9PA 4CH1A 1TAQA 4DLEA 4YS2A 1ICEB 2BV3A 2DKOB 3RJMB 3PNIA 2JC0A 2OD4A 3HF5A 3AOCA 4ED7A 4ZVSB 1RT2A 3EGNA 2CJKA 3AAWB 1HIYA 4USMA 4B9UA 3HX9A 1YSJA 3DM2A 4NEZA 4DR4F 5J2PA 1P9YA 3T6BA 3QIDA 3KK1B 8AT1B 2M8HA 3L7OA 1VRTA 3I31A 4J90A 2QLBB 4Q5VA 3AQPA 1U48A 1JLFA 2RDJA 1EAYC 2R7UA 4DBQA 3K17A 4B3SF 3MR2A 4H4MA 4ZKAA 4FXWA 1TK8A 3ISZA 5E33A 3CSKA 5KFUA 2OGUA 3KG0A 1QUVA 4ZVFA 2QIFA 3TZWA 1MMLA 2HRTA 4QJVA 3FFIB 1PO6A 1N34J 2ASYA 5IT0A 2XY5A 1OIAA 2MB0B 3HHLD 3OTEA 3GYGA 3G6XA 3DDIA 1OWXA 4RW9A 2AHOB 1KVJA 4NLQA 3IA0A 3W64A 5IV4A 3G71S 4ZVOB 2UU9F 4IOBA 1HWLA 2GQCA 3KUEA 3ETOA 3QBCA 1HI8A 4Y28C 4JI2J 3Q8YA 4KHMA 5GMDA 2GQQA 3Q89A 3SCKE 1N5TA 3CO0P 4YHHF 3DOLB 1TVRB 3VWSA 2BOPA 2RAQA 2WB1D 5CYQB 4YB7A 4QIWD 1TK0A 3BSAA 3QGIA 2C1EB 3Q22A 1EETA 3JTOA 8ATCB 2DY9A 2G0JA 2ZWOA 2QL7B 4DFJA 4TQSA 3CMQA 3CF5Q 4OHXA 5K8NA 2B3TB 1QAJA 2K06A 2UXDF 3M1VB 4FZVA 4C0HA 1PKUA 3GIKA 1JXEA 2RDIA 1FDBA 2FY8A 1YJ7A 4DR2J 4R0JA 2DGWA 2BACA 2BJ9A 1VC6A 1XJWB 3RRKA 2YTCA 2LXFA 1NH8A 3DXBA 2RD5C 1JIHA 3MMCB 4CO4A 3D0IE 3GCWP 4IRDA 4TYBA 2H48B 3BF4A 1WC1A 1HFEL 1H38A 3X1LB 3FCHA 5K14B 2YKMA 2ZD1B 3M8QA 3OSNA 3KTQA 3MM6A 3CCZA 4WU3A 2YWFA 1P6TA 3CCLS 5CZVA 4CYUA 3TEHB 4I2PB 3TI0A 2OPPA 2DD8S 1X9MA 2FHOB 1VQOS 1S99A 3P45B 1RHRB 3KLIB 2KRRA 5KG7A 2WVCA 1TUVA 4IR1A 4QCLA 2Q6CA 4KJIA 2D7SA 1KFSA 5A8RB 5ITHA 1HW9A 4FNHA 3VQSA 1F5BA 1YJUA 2VQFF 4QOTA 4KGZB 4Y2MA 3PW7A 4KSEB 1S6OA 4RKUC 3BSOA 1X8DA 2DIVA 1MWZA 4FS2A 3V6DA 1U26A 5HVGA 1PJ5A 1T7PA 1AA1B 3E01A 1XNRJ 1KVKA 3R5BA 3AJ1A 3CTRA 3G4SS 1GMVA 2MQNA 5HLFB 1WSRA 5CCLA 1NK5A 1HQUB 4K59A 4ZK7M 3BN7A 5HROA 4IYQA 2C2OB 5I3UA 3PY8A 3PM9A 1JLEA 4LFBF 4WTYA 3QAUA 2BE9B 2GJ2A 2R7RA 2G0IA 3CD5A 3H7HB 4MKVA 3ZTSA 4X65J 1HWUA 1NMEB 1LKZA 2MQPA 3QRPA 2ZBRA 2D74B 1BXNA 2E1AA 1KKHA 2FJWA 4QU7A 1QDUB 2B9EA 4DL0C 5CH7B 2CUYA 2F9JA 3R1HA 4ALZA 4OL8A 1X0FA 3GJRB 2VFUA 3PJWA 2WVBA 2HWIA 1RT4A 3S1TA 3B4DA 5JXSA 1EX8A 2OSQA 1IBLJ 1KQGB 1VQKS 1S9EB 2DISA 2R7TA 4AXIA 4NZ0A 4N56A 4FDFA 4NLOA 4P52A 4IG0A 1HMVB 1PBUA 1QTMA 2AW0A 1D0EA 3IFEA 5DZ7A 1R27B 3PTWA 4KTQA 4F0KA 1MN9A 4NEYA 1CS4B 3FZ2A 2G13A 1E6VA 3H90A 3BPSP 2DCLA 3T41A 2CNKB 4PZVA 1VRQC 4DWIA 4JI8F 1SH0A 4J9OA 3AJ2A 2AJFE 4LUBA 4TYAA 1NHVA 3WHIA 1RWKB 2J0WA 4Y00A 3CWJA 5KFVA 1MU2A 1JJ2R 4RBTA 3DOMB 2J0QD 4NLWA 1Q8KA 4ZDNA 3I0SA 1GAOA 1UVIA 3BH7B 4DV1F 2KFYA 1AT1B 1WC5A 2R8IA 3D1OA 5DS7A 2DNYA 4RNOA 2QV6A 2E1PA 2UXBJ 4NMXA 5I42A 2JRSA 1UEVA 2QN6B 1FJCA 2MQQA 2JFKA 2QA2A 3UO0A 2IM0A 1SJFA 1D9FA 2EEYA 4DV2F 1S5ZA 3GIJA 4A8KA 3JAMY 1HR0F 2P8IA 5KFSA 2EKNA 4FF1A 3IC1A 2H65B 1SC6A 5EX0A 3SCJE 2CJBA 3AD9C 3NWGA 4KAIA 1TTHB 4DQSA 2CNOB 3CJ3A 2DGVA 1P9QC 4EK2A 3HM9A 4BWMA 2AYGA 4WFZA 1FXRA 2M4MA 2XSJA 3EGWB 4H4OA 5KFDA 2F8EX 1WG5A 5KG5A 3BGFA 1F5CA 3MDFA 1Y3JA 1D9AA 1UZDA 4DR6F 3OTOJ 4X4PA 4OX6A 4XK8C 4RLEA 3PR4A 1MSWD 2VPWB 2RU3A 2EG1A 4MK9A 2HNDA 3W8PA 2YWEA 2E1MC 1RT1A 4XTTA 2E5HA 2EG2A 2AF6A 3GSDA 2CQ4A 1BHNA 1WDTA 1TL3B 1ROFA 2R8JA 4USIA 4F4KA 2MPUA 5L9XA 3UN2A 3BR8A 2X1BA 1FDNA 3QT5A 2CJQA 3KUHA 4DLGA 3V81A 4RW4A 3CC7S 5A2QY 3MR3A 4U8VA 1REGX 4GKKF 1CQMA 2VL1A 2MHEA 2ZHBA 1U24A 3CJ4A 2MGZA 2AEFA 1C0UA 5D8HB 4OYPA 1QM9A 4MAKA 2EBEA 3TVZA 2A6OA 4UQGA 2ZVIA 2Z58B 1P1TA 1N32F 2CPFA 1GT8A 3EXCX 1XMOF 2IVMA 2MZTA 4NCAA 1NAQA 4DV3F 1VQ4S 2HAFA 1RWMB 2YKPA 3D68A 2HKEA 1MROA 2R7QA 4F3QA 1U6ZA 2I5JB 3DRRA 2FGCA 3U02A 4UUXA 2OEKA 2OJ3A 3EMTA 4ELTA 3TR5A 2H1YA 3BN4A 3DKDA 2ZKUA 3B78A 2AZ3A 2ZOFA 4C8OA 4YQWA 4KY3A 1RT5A 2GJIA 3T1YJ 2UUBF 1WUUA 3MXHP 1S12A 2V5HG 4CH7A 4C11A 1I3OB 1N6QA 2VH7A 1CJUA 1FERA 4USKA 3MECB 3H5XA 4JI5J 2BRLA 2YPYA 3CCSS 2Y1JA 1C1BB 3UD5A 3R6LB 4X4OA 2XTJP 1U1NA 3CW2C 2AJ0A 1U47A 4EGLA 2CWKA 3QO9A 1MMNA 3MPYA 1TAUA 4FBUA 2YWGA 2R42A 4M5DB 1FKAF 3DU5A 1NJWA 2P5VA 2QMWA 4I64A 5M2RA 3PO4A 4RUBA 4WKYA 3SV4A 5KFWA 2AGQA 2AX0A 1RWOB 2LQ9A 4DR7J 4O4GB 3OJUA 3OLAA 2OKQA 4CIOA 1WKLA 1HI1A 2RRNA 1O0PA 3CB4A 2LYVA 3N5BA 1LFWA 2V0NA 1YTYA 1TKZB 5KFEA 2KG0A 1ZA2B 4NZ6A 3MMBA 1RT7A 2DNMA 3RW6A 2YQ3A 3M8PB 3MOJB 4C0BA 2PMZD 4ZVQB 3R1LA 2UZAA 4ECVA 5DM7Q 3ET6B 4TY8B 2OFGX 5EWFA 5J2MB 4DX5A 2V8PA 3HCXA 3K0JA 5L1LA 3D6MB 2J9DE 4QIEA 2CPJA 3EE3A 2KVQE 1VCTA 1TU0B 2XYPB 4QYZK 1VQ5S 1S6QA 4UY8T 3BYPA 4R8UB 2FLOA 1KVIA 4DV0F 2OTLS 4PXDA 3MMAA 3DC2A 3JTPA 3DLGA 4KGMA 1ZZFA 2VFVA 1UWBB 2WSFC 4HHUA 1REVB 1WC0A 5C2CA 3U1MA 1TELA 1RJJA 2XGQA 4HYKA 3CIMA 2OPQA 4P6QA 4ZITA 2XLKA 3J81Y 4ES3A 1J2VA 1UCNA 4ICLB 4RNMA 4FP9A 4PWDA 1RSCA 3AD7C 2HW3A 3VGUA 4JI6J 4Y2AA 2GMLA 1KOOA 4DS4A 1YJNS 4QIFA 4FKXA 1VIOA 2DH8A 4QYZJ 2ZC4A 2EFQA 4MKYA 3KK3A 5F8JA 3LANA 3POTB 1RWWB 2HNZB 1HBOB 4IO9Q 3GV5B 2B6AA 3PHTA 2LCWA 3VCDA 2OHDA 2K3KA 3CT9A 4LJMA 1RI7A 5K8OA 3NMAA 1NSPA 2ZJPQ 2J9CA 1FDAA 4ZPCA 2W7AA 3EM1A 2LQJA 4K4WA 4MIBA 4B3MF 1C4CA 4GVLA 2A1BA 3C2PA 4C48A 5MLCV 2BXJA 2F4FA 1RWUA 4OZ1A 4ID5A 3HZEA 3J80U 1RK8A 1RKIA 4WXWA 1F3FA 4WZQA 1WOPA 4CI0B 3MFHA 1N52B 1CJVB 4LF4J 1MMDA 2NXNA 4TKTA 4FYYB 1LOUA 4IH7A 2J6SA 2YY3A 1DLOB 2LKZA 1QLNA 4M5NA 2ZHAA 5E0OA 3CNQP 2HVZA 3KKFA 5ETNA 3BGRA 4P2SA 3KLGA 3WX8A 2BRKA 1S9GB 3EGZA 2UXCJ 2KM8C 2AU0A 4CQ1A 2RQKA 5GAHI 3M8RA 3G87A 1HNVA 1KTVA 3RB4A 1CJKA 1F2GA 4DPYA 3UVJA 2MKHA 3MM8A 4RWWA 1BMQB 3NOGA 1S1WA 1SIZA 4K4ZA 3UR3C 1C4AA 2HHUA 1UFKA 3MURP 1FEHA 3W2VB 1X5OA 1CG2A 2R4FA 2J9DA 2LA6A 1JJ4A 2HHTA 2G2OA 2G2ZA 2VPXB 3WIVA 3NP5A 1R6VA 1QD1A 1YIJS 4S0MA 3C6TB 2A2DA 3PRDA 2ZFHA 2Q43A 3OL6A 4OZJA 1FJ7A 4KPCA 3CMES 1RQ0A 9ATCB 1IN0A 3CIZA 1KEKA 2AYEA 2XMVA 3CCRS 4RW6A 1BQNA 1IUJA 2VG5B 2C3UA 3BBFA 2V2ZA 1RHMB 2XC9A 2YPZA 2WSEC 1TP7A 4WU2A 3KDNA 1ZAXA 2O66A 2XCPA 4YDDB 1U2CA 3OV7A 3W9HA 1WF2A 5DJBA 3NAIA 2M5YA 3CDBA 5IC4B 4ZOSA 1DY3A 2BMBA 1U8WA 3GYNA 1K1QA 1N33F 1IXKA 2I1RA 4JUZA 5LJ3Y 1S4EA 3S7RA 5H1SV 1IJEB 4XDDA 2MY8A 2H3EB 5DETA 4K0KJ 1RHKB 3GU0A 1FRHA 3PJ9A 4AQYJ 2HHQA 4DUTA 1FRIA 3I9ZA 1SIWB 4ERDA 4LQ9A 2GHVC 3O44A 2F7VA 1QVFR 4OI4A 1Z2LA 2V34A 4DV4F 4ZLNA 4A8MP 2D3OR 2U2FA 2ZH5A 4LR9A 5GMEA 2GW8A 3H59A 1X0PA 2C2ZB 3ZTQA 1MWQA 4AD6A 5IM0B 2B4VA 3EDRB 3VAHA 2ZJQQ 2RQMA 1IBKJ 3IP0A 5G0RB 1Y3KA 1HW8A 2MYFA 1L3VA 1Y4ZB 3M32B 3UWTA 5L8RC 5KG1A 3GG1A 3K7RA 2VUGA 3NLCA 4Q0BB 4ZIVA 1NZAA 3D5MA 3DLKA 2BR0A 1LWEA 4CLWA 3MM9B 4P74A 3CJ5A 3IS9A 2QYCA 1AFIA 3MM5A 1IKVB 3GFXA 4IG3A 5KG4A 2R3VA 2ZBIA 3PXGa 4NXMJ 1HNXF 4G1PA 1FKPB 3HT0A 3G6ES 1G4CA 4LVOP 1RT6A 2ZDPA 3IN5A 1WD6A 4WK3A 1RTZA 1RAEB 3AB4B 5LXRA 4NLXA 5E3AA 1HNWJ 4B3OB 4LRAA 1SL2A 4DPUA 4HLBA 3C15A 3NOCA 3RB6A 3E8OA 4CLZA 2YNFA 1M5SA 3Q24A 1KONA 1QAYA 4ES2A 2FJBB 1RABB 2ZH8A 2NZCA 5U47A 2AQ4A 2FJDB 3N9UC 1FRJA 1AROP 3K89A 3CJQA 5HJYA 2OEMA 3IWNC 1S6PB 4K50A 2ROGA 3RRHA 1V3RA 3SDEA 1T3NA 1EP4B 2W7PA 1GXLA 1Q78A 5AJ3F 1HBMB 2XM3A 3DRSB 4OJHA 3AXKA 3EJMA 4M8LA 1RTJB 1UMJA 5L39A 1H3DA 1N88A 2BUNA 1KC8T 1DJ0A 1RYSA 4ECQA 4LR8A 3TUIC 2EPIA 1Q7LB 1Q53A 2BYCA 1OJ4A 3CD0A 4CNYA 3WQPA 1E6YB 2E66A 1VDHA 1Q86T 5FLXY 1HWIA 2F4VJ 4RJVA 4RU9A 3CEDA 2IRXA 1VK8A 2GA7A 2XI2A 1PBAA 4ZIWA 4ZPTR 1F1BB 4HH0A 5EHHA 2FY1A 2EFPA 4EYIB 2DNGA 4J9QA 3JYTA 2K7KA 2HQGA 1PSDA 1CLFA 3NS6A 2GGPA 4DUZJ 5EWGA 1UFLA 2MZJA 1ZH5A 2Z4PA 3QRRA 3DRPB 2B9YA 4ED4A 5CCMA 3A8JA 4RW7B 3UR0A 5GAHU 2P6SA 2CQGA 5C24B 3QIPB 1R31A 3D1QA 4RUCA 3PYEA 1U1KA 1X4CA 3PG9A 3M6UA 2W9BB 3LH2S 4MJKA 3OVSA 4ZVGA 2VODA 3W65A 4JI4J 4TQRA 2Z2ZA 1UJ6A 3CUNA 1GH8A 1TL7B 4O4RA 5A6WA 3EXYA 5HP1B 4JYAJ 4O23A 1XMQF 3Q8PB 4DSFA 5B0DA 1GMWD 5DDPC 4CH0S 2BJ7A 2CQBA 1FEEA 5LMNF 3J81j 1WKJA 1SB6A 1IVZA 3UDEA 4CLPA 2IYIA 1M90T 1NDKA 3M6VA 3PW2A 3C6UB 2BE7D 3D9BA 3LP0B 3TANA 2CPHA 5FDLB 3TUPA 1TQLA 4LF9F 4NCGA 1OO0B 4OX7A 3HI9A 4WFNQ 4P75A 3NL0A 3R5CA 2ZKTA 4EI2A 4K4YA 4HVZA 3CC4S 4DR5J 1HD1A 2E5IA 4B9MA 3HVTB 2YKNA 1FTRA 4CLTA 5F8HA 2IMWP 3CJTA 2GVZA 4DUYF 3NAHA 2LU1A 3PYGA 3LW5C 4D3GA 1R8AA 2FJAB 1PYSB 2JLEA 1FRLA 4DZ6A 1WG4A 5DZ6A 1KLMA 1SC4B 2IC3B 1U2RA 4B3RF 4DX7A 1LWFB 1DTQB 5IT9U 2W25A 2CZ4A 4WP9A 3OR2B 3HHEA 2Z57B 3I5AA 2HMIB 3GONA 4QPTA 4NLRA 2PGCA 4P9SA 2KFNA 4PYAA 4X64J 2WSCC 3ISND 1EIYB 3BSNA 2HHPA 4IRKA 1SPBP 1VQ9S 4QWCA 3FVYA 4DSEA 5L1KA 4LBIA 2V2VA 5ETPA 2YNHB 1A9NB 1SV5B 4YY3F 4X4VA 3A12A 1RACB 4YP3A 3M30A 4C3KA 3T1AA 4DSLA 3RW7A 3DRYA 5G4DA 1DBDA 4KHPJ 4A46A 5K8MA 3LGHA 1VQLS 1IM6A 4PG5A 3HPOA 4HDGA 4WE1A 4G65A 5B0GA 3QWUA 1VQMS 2XI3A 2CJAA 3NGDA 1VRUB 1RTHA 2FHMA 2IA0A 4HT7A 2LFVA 1GTEA 2WOMB 4NWBA 3C16B 2CWXA 1SKRA 2NXUA 3V4MA 4K7QA 5DO2A 2UU9J 1FNOA 1J5OA 4U7UD 2MKKA 2VQEF 3ZNUA 3Q2SC 2AJ2A 2VBZA 2L9NA 2JNJA 2XEXA 2DGQA 3VV2B 4U96A 3H5YA 3QQCD 4KR0B 3R97A 4EBDA 4UZCA 2HHWA 1KN6A 1S0VA 2KN4A 1JKHA 3GFYA 2V9WA 1IKYB 1RWXB 3BGOP 2ZBPA 3MPWA 1IWGA 4K2JA 1RLDA 2W4DA 3S6EA 2ALYB 2DH9A 2D69A 3QYYA 4GVBB 4ETXA 4C8LA 1QE1A 3R7BB 1UVMA 1R0CB 2DGUA 4CTAA 3H2VE 1U0HB 4JI3J 2XMUA 2ROPA 2W4CA 3GFHA 2K3IA 5GAGU 1F3VA 4PUOB 1TMJA 2Z30B 2AJQA 2Z56B 9RUBA 2E7WA 2BW7A 5CYMB 3MEEA 1HBNA 3R6GB 2HHXA 3K5NA 1U4BA 1HQEB 2RKIB 1C0TA 3VAJA 3A8EA 4C8MA 1XIQA 1JXVA 4F50A 1PILA 2C2RA 3J7A1 3IR7B 2EFVA 4Y2IA 2MEWA 2ILYA 1Y11A 4ECUA 2YKQA 2CRLA 3IG1B 4YB6A 2VA3A 1VHIA 4DV7F 1FJEB 3GP9A 3L95X 2R2UA 4F4ZA 3L09A 2I8EA 4V1Ak 3V4IB 1AUSL 4MH8A 2HRUA 3DGPB 1SCJB 2C2EA 4DCJB 1RHJB 5FJ4A 2MZ1A 2NPIA 1OYDA 2VG7B 2VPYB 3M8WA 3T1HJ 3B54A 4TN2A 4NL5A 3LPYA 1FJGF 2GHWA 1BQMB 3PYFA 1V6HA 1HBUB 4OI6A 2MTLA 3M4XA 3B6BA 5KT4A 5E41A 2HPUA 2PC6A 4NYOA 2M2BA 4KKOA 1X5SA 2BKOA 2XS5A 4V19J 3P8BB 4RW8A 3BKUA 3H98A 1C1CB 5LSLA 3D0HE 2ROEA 3I82A 4UOHA 4M5GA 1HNZF 2HBQB 5DLFA 4LF2A 1ZM9A 4IQXA 4IH5A 4NYZA 2NQPA 4DPWA 4L72B 2CXEA 1IKXB 4O44A 3OD2A 4IFVA 2NXEA 1X9WA 1R8PA 1H0HB 2IA6A 3BBCA 5B0CA 5F8GA 1VMBA 3KXDA 3OVAA 5KFBA 3NG8A 4J5OA 2CPYA 3TJAA 3J80Y 4ILLA 4LF1A 4RPFA 3ZZTA 3NCRA 1WSVA 4PXEA 2QC3A 3ITHB 3VAMA 1LXNA 2ACYA 2AEMA 5C25A 2E1CA 1ELOA 4U7CA 1UFWA 5THWA 2YBVA 3EYZA 2E7XA 4ZVRB 3VAGA 1AYEA 3T5HA 4NX9A 4UOCA 1AW0A 4DL4A 1FFGB 2G0CA 4C7QA 4OHVA 4JI8J 2XYHB 1NHKL 2YWWA 3SEOA 2Y9HA 4P10A 3G6YA 1K8AT 1FF2A 3Q8QB 3G82B 1RT3B 2B7BB 2KYZA 2IIHA 2B51A 4DR1J 3V5RA 4PR6A 3NBPB 1N36J 2EK6A 3FEYB 4WBFA 4F02A 3MF5A 3KG4A 3CO9A 4NYPA 4YR0A 1OYEA 1S1XA 1Q4RA 3A13A 2LEAA 1QSYA 4ZJOA 3MMJA 4X4QA 1SH2A 1DAXA 3R7SB 4HI1A 2F8HA 5KFTA 4ZJQA 5H9FK 1UPPA 2P9GA 1HR0J 1WHVA 1CULB 4WKRA 1NJZA 5T7LA 1CEZA 3E51A 2VA2A 2R7WA 2DPIA 3D2WA 2NCKL 1KTQA 2YKAA 2DTJA 3CJ2A 3O5TB 3O8WA 4QR2A 1YRUA 3H8YA 4TXSA 1TV6B 3HVAA 3OXGA 3OJSA 2HG4A 4M5IA 4CLUA 2ZNZA 1R7IA 1W2IA 3HSGA 4MFBB 3BJYA 1LFPA 2Q66A 2PA3A 1KQFB 2P9EA 2Y3YA 3I6PA 1LK5A 3HFZB 3IBFB 4PCQA 4K5SA 2L9WA 2OI2A 4TY9A 1NB2A 2BVZA 1TL5A 1UWAA 1XQIA 4FYDA 2J5AA 3ULHA 4G1QB 4ZHRB 2WAQD 4DQQA 4B9TA 4ECYA 1NXIA 5GMKa 3DI6B 4DSJA 4WJBA 1XWLA 4B9LA 2E5LF 3R9LA 2QMXA 4U7UK 4HACB 5CZXA 3MTKA 5IQ6A 4M94A 1H98A 2VFRA 1IJFB 1Q5VA 3IO1A 4ELUA 2YNIA 2AWZA 3PO5A 4ILMA 4WF9Q 3JSMB 2MXYA 3GIIA 2CADA 1WC6A 5GAEI 1JLQB 4P73A 3SSRA 2I38A 3HK2A 2VB6A 3R2CJ 3CJSA 4MYTA 5F3TA 3TAPA 4IOCQ 4K4UA 5IV3A 1LW2A 4MKBA 1FK9A 3F41A 4NLYA 3BO2A 1T05B 1G7CB 5KFRA 1L3TA 3GCXP 5IOLA 2Y8YA 4FBTA 3SCLE 2G9OA 5CQGA 1TMMA 4XAKA 1Y5NB 1XR5A 5F8NA 2KHDA 1ACMB 3R5AA 4N77A 1UA0A 4J37A 1TKXB 2B9XA 2ASDA 1PC4A 2W2QP 3W2WB 4OYXA 3NY0A 2B5JA 3PVXA 1VI7A 3W8GA 3S8SA 2GX8A 2LA4A 4UTGA 2K7JA 2RE1A 3RAXA 2HHVA 5LT5A 1TL1A 3OQ2A 4E8UA 3KLFB 1ZZNA 5DGBA 3TWZA 4PQAA 5AXKA 4DL3A 3HFVA 2BJ8A 5D0RA 2YH0A 1XK8A 1N34F 3K59A 1SUQA 4LF5J 2Z8QA 1FNXH 2RHQB 1FVQA 1ZPWX 3GFZA 3DHWC 3PX4A 4FXDA 3OR1A 2I0XA 1T9WA 4NOHA 3CJ8A 4MIWA 1LW0A 2C3MA 3LA0A 5KG2A 2FTRA 4WCEQ 2BX6A 1T03A 3ZZRA 2IRYA 4JI2F 1NK8A 3K8VA 2PEBA 1Q16B 5E3PA 3GWCA 1Y0HA 3M2RA 4K5RA 2V4JA 1YZ6A 2J8SA 3PIPQ 5D3GB 2RH3A 1LNQA 2F65A 2ACMA 5A76A 3EZOA 3G8SA 1M5HA 3VGSA 1YK9A 4K2XA 4J9MA 4LRCA 1L3UA 1S1VB 1D3WA 3TA1A 7AT1B 3DYAB 5LSRA 3DLLQ 4A8QA 2HFZA 2LXIA 4LSLB 3CCVS 3D67A 2OH2A 3TUJC 4DR2F 3M8ZA 5KFMA 4WXOA 3VGVA 1FWLA 1S1UB 2FQQB 1UW4A 3LGNA 3ENVA 2KJVA 5ETQA 1JWWA 3OXFA 2KT5A 3KK2B 2LXUA 1AXQA 3W9JA 1QAIA 4DEZA 3D1HA 1J5EJ 2JEIA 2QE5A 3CCTA 4ECZA 3W3SA 4K4VA 2NUHA 5DDRC 3NRBA 2QJ3A 1I6JA 1RE1B 1DQ9A 1ZTWA 4NLSA 3DLEB 4U9RA 4M95A 4YR3A 1L5UA 3LP2A 4HEA9 3U27A 3H40A 1O8BA 5E2QA 2V8DA 2QL5B 4I7FB 3AFGA 3D0GE 2ZE2B 1WC3A 3CCJS 1JXLA 1RTIA 3VAFA 3MI7X 2VOOA 3TAMB 1T9UA 5D15A 3NGKA 5CAAA 1XNRF 1RA7A 2AGPA 4JI7J 1VQ6S 4O3OA 5DGAA 2WTFA 3SQGB 2ATLA 4KFBA 4Q8EA 3MAAB 2CYYA 4IDKA 4DG1A 5IC6B 4WK1A 1U1PA 4A8FA 4PKDB 4JV0A 3MD3A 3KJNB 4X65F 3CULA 4NASA 1S1TA 1IQTA 2FZCB 2HFUA 3ILOA 3C14B 4USUA 4WYWA 2VBWA 2W9CB 2RF2A 3OHAA 2KHCA 2FJXA 4PQUA 4I2QB 3FMBA 1N5YB 2JSXA 5J2QB 1PAEX 2K2PA 2HFVA 2D3ZA 1NK9A 4MYUA 3FEZA 3AT1B 1EKRA 3PKMA 1KSPA 1Q1KA 2XY6A 1U7LA 2M8DB 1ZA1B 2VD3A 1G1XA 5D78A 3WC2A 2HRYA 3HVRA 1XC9A 3DOKA 1F0XA 5IT9Y 1LXJA 2DNZA 4OMFG 1IBLF 2DHHA 1PYTA 1IBMF 3VVUA 3QLHA 2FHJD 5DG8A 3BREA 4OLPA 2JLFA 4RBUA 2QLFB 3QT8A 2FLLA 2DXDA 1EQ0A 2W1BA 1KHVA 5GAEU 3D6TB 1B64A 4Y65A 1GK8A 3JB9k 2QLWA 4Q45A 3QZ8A 4GKJF 1D1UA 4GMKA 2BDPA 4DDFA 4UQTA 1VQPS 4DQRA 1VQNS 4QPXA 1Y5LB 2B9WA 5A0YA 1WEXA 4LSNA 2O01C 1W2BR 2RSQA 3DDNA 5HMZA 5L9NA 1F9EB 2QFIA 3CJRA 2GVDA 2VF3A 4ZCLA 3I87A 4B17A 3PR5B 4A48A 3SMZA 2JEFA 3TQEA 3IRXB 1N54B 3DMJB 5BXIA 1XEZA 5AE2A 2UXBF 2HS3A 4C8NA 2KT2A 5EWEA 3BB5A 2MMYA 4DN9A 2ILZA 3RAQA 1URRA 3BH6B 1RBLA 1A7GE 1WHXA 2GAHC 3FBBA 1B0VA 2MZRA 3UD4P 4LSZB 2HFNA 4P7TA 2BANB 5C42B 4XDCA 2AJ4A 4IFYB 4KRWA 2KXNB 5B0AA 4NA1A 3V6KA 3PZPA 2DIUA 3HSJA 3QSIA 3OL8A 2ZH1A 1Y10A 2V2QA 2VICA 2BE2A 5KFLA 2EVZA 4DV5F 1U2FA 3PX6A 1R8BA 4Z7CA 5KG0A 1D9DA 3LWLA 3HJVA 1F9FA 4NLGA 3JXOA 5K9FA 1SJ3P 3I4HX 3ZZPA 3HD2A 1FHTA 1SI9A 2JZ5A 4ZPAA 4USHA 2UV8G 5KFAA 4BS2A 4ZLPA 4N47A 1S4FA 4IKAA 4YB1P 2H54B 1M1GA 3RB0A 4KBIA 5ETTA 2GIFA 1S9FA 2QT7A 2Q3PA 3GJQB 4YN3B 3MEGB 1S0OA 4QIGA 1BWVA 2JEJA 3I5CA 3ZC4A 1HNXJ 2MHNA 3BYRA 3FRZA 5JVHQ 2BJDA 1IKWB 1F9HA 2KDOA 2XSFA 3KHGA 2UUAJ 2YX1A 1X7VA 4HDHA 2KKHA 1B7FA 2CQIA 3KLHA 2GMJA 2ZBQA 4ZP7A 4DPOA 2JEGA 3KHRA 3NNHA 2WONB 5IWAF 4F2RA 4F7VA 4XPCA 3QFWA 1XR6A 2FC8A 4WWSA 3PW4A 1HARA 1KQKA 2OPSB 4USTA 4I4BA 4I6YA 4KV8A 3OFHA 2CNLB 1JLBB 2ZOMA 4NE9C 2YNGB 4FVMA 1JLCA 1RTDA 2JOQA 1NPRA 3ENQA 2K1RA 2HLUA 3ISNC 4DHVA 3FBEA 4Y2KA 2R7VA 2HK3A 1HPZB 3PJXA 4DV6F 2IHR1 2VFTA 4DL2A 5H9EK 1K47A 5HO4A 2AEJA 2FYXA 3CJKA 2C28A 5LXYA 3BS9A 3M8SA 1K0TA 3T1YF 4CDIA 1QAXA 4NI2A 3P49B 1NPKA 2HNYB 1ZBTA 3TYTA 3VR1A 5EN1A 5C2GA 1VHFA 3MM7B 4A47A 2CQCA 2N82B 4F26A 2XWYA 3WIUA 2J8AA 3BPDA 1R0AA 4JI5F 1TKDA 3I32A 4H4KC 3GJTB 1WI6A 2BEFA 2AYMA 3KLEB 2DHSA 2KI2A 4WIIA 4E98A 2Y0SD 3OUYA 2PO4A 1OSCA 1VLYA 5J2NB 3M2VA 1BD6A 1U8SA 1JB0C 1FKOA 4ID8A 1NO8A 1GNKA 3NEKA 4O3PA 2C42A 5D6GA 3BKTA 5H9EJ 4ZLJA 2V2KA 4DR7F 3LGMA 3PRBA 4OJ1A 1TKTB 3DHXA 1DTTB 1S7IA 4N76A 2A3JA 1D8ZA 2BM0A 2JX2A 2QMUB 2FPHX 5M2PA 1RBOB 4M5LA 3VQTA 1Z1ZA 5BYSA 2N7YA 1OY8A 3IM9A 3ZNJ1 1X4FA 4KHRA 4RO0A 4LRFA 1SKSA 4X62J 3T5JA 2IVFB 1R6YA 1CVJA 4BDPA 2IAJB 3AH6A 3N01A 5J1EB 5A8KB 3KK1A 3MUTP 3EWGA 2V4RA 1XR7A 2QTWA 5E7OB 5A8WB 2HHSA 5D4LA 3G96A 1JLAB 4MT1A 1FESA 2HVEA 3FJ2A 1WORA 2Z2MA 4F04B 1RWVB 2JH3A 1XMBA 1JLGB 2RILA 5D4OA 1SKUB 2GO8A 2DCUB 4ENOA 2ZJRQ 5HBMB 5F0WA 3OFEA 2I6WA 4JI1F 3THTA 4ZA1A 3FFIA 1RDRA 1N5QA 4U67Q 5J1PA 4YFUA 2B4PA 2ZH6A 2BJ1A 4R0EA 5LMNJ 1VC5A 4PG7A 2YX7A 5D0GA 3GMGA 1Y7PA 4EZ9A 2ZVSA 1MW7A 2XNQA 3CCMS 3QSYB 4LF9J 1I5OB 3JSYA 5FLXU 4JI6F 3DOLA 1TVRA 4CO5A 3RG6A 2GC8A 4ER8A 5CYQA 4OHZA 2QZ8A 4I6AA 1FWPA 3T9ZA 4PWUA 1U0SA 4DQPA 1HD0A 1O51A 4PWWA 1R3NA 4IR9A 3TX0A 2JWNA 3SFUA 3M1VA 3T5LA 2VG6B 4LQ3A 4GRSA 2O67A 2GIQA 2AKWB 4GO5X 1NU4A 1S7HA 2CQPA 3QT7A 2RMLA 3X3UA 2PSZA 2OPRB 3NCPA 5HMWA 1FX4A 4BBYA 4UF4A 3KDOA 3MMCA 3J7ZT 1NDLA 2G4BA 3UQSA 5E5NA 1UEKA 3CCES 1HL6A 2V94A 3Q8UA 5BJRA 3QJJA 3EPGA 4X4NA 2MKCA 3J7Z5 5K14A 2PD1A 2M9KA 2ZD1A 1M5VC 1WHYA 2L9DA 3LF0A 1F5AA 1S79A 2ZOGA 3Q83A 4OYAA 4TVAB 4I2PA 3TAQA 5KFXA 4YY3J 4FYWB 1YBAA 2M70A 2IJNA 4LFCJ 5HQLA 3W7BA 3I0RB 3KLIA 1R89A 5A8RA 2UXCF 4C8YA 3M7VA 1NNDA 4ZS6A 3PFEA 3M2UB 2HVHA 1B0TA 2BQRA 1NLKL 3MCNA 1U1OA 3MCOA 5LOQA 2E29A 2PE8A 3UDCA 3HSZA 3LPEA 1SQFA 5IS2A 5HLFA 2HYIB 1H7WA 1XTZA 3KJVB 4I6WA 1HQUA 3KFWX 1KS2A 3TZYA 3OBIA 3MUMP 1XNQJ 2UV8A 2R8GA 3RU0A 3K8WA 1T9TA 1LWCB 1S49A 4B9VA 3LTOA 4ED0A 4OZ3A 3UCGA 1ZETA 1RHQB 3DXSX 2QA4G 4RUAA 3NNAA 2RRAA 4MTPA 1GTHA 2CZ9A 2BJ3A 4R5PB 4K0KF 2XLIA 1U1RA 1VGYA 1YHQS 1ZAVA 2BW2A 2AGOA 2F3JA 3MR7A 3MZIA 2PI5A 3EDQB 2VKRA 1HYSB 2ZZNA 4PEOA 3PRVA 4KO0B 5BYRA 2NS1B 5HVFA 1HNIB 1IM4A 4I56A 2KYXA 2OTJS 3FCWA 1UZHA 5CD4A 3QGHA 3BKFA 2E9RX 5J1NA 4NLTA 1ZM2A 4DR3J 2MLYA 2RVJA 4EBCA 2XG8A 1NKBA 3FSIA 4ZP6A 1S9EA 1DFDA 3MEDB 1H73A 3HHLB 1RAFB 4ZPBA 5M2UA 1IBKF 2YQ0A 3CDUA 1I51B 4LRBA 1HMVA 1T02A 1DHMA 4EBEA 4F0MA 2VKZG 4DN0A 1RB0A 3PIOQ 5KFOA 1RAOA 3BQ2A 4UW2A 1FNMA 2MDAA 4QQBA 1CS4A 2EK1A 5ETKA 1DRZA 2W8LA 1VBZA 3OVBA 4J9LA 2V68A 3FUYA 1JQGA 1YVFA 6FD1A 3QWPA 4L76A 5KFJA 4NXMF 1Y9OA 4LFAJ 5F9LA 3KHLA 4MIAA 5HATA 3K5MA 1AZSB 2Q1LA 2FUG9 3T19A 2CAJA 1AFJA 4C3LA 5IFMA 3DOMA 2H5EA 1FA0A 3M6WA 3H2UB 3ZZUA 3D54A 5IZHA 4KYZA 4RZRA 1HNWF 4UZBA 2EBGA 3OL7A 2HQIA 2N3OA 2OIHA 2L41A 5DQIA 4E2FB 1Z2ZA 1D8YA 2W4PA 4MK7A 2CQ3A 1VC0A 5KFCA 3KWMA 1CJTB 3SBMA 2D9OA 2DXEA 1NZ8A 4MK8A 1U25A 1JJCB 2YVSA 3HJFA 2FD2A 3LP1B 3AA9A 3MGJA 2J0XA 1B7YB 3NGRA 1X5TA 2EW9A 3T3FA 5IQQA 2CJYB 4ZLLA 2PT0A 3K58A 4JV2A 5ETOA 1SQGA 4Z37A 3DLJA 3EICA 2BQUA 3L7UA 1RT2B 2Y1LB 5KFPA 5KFFA 1F6TA 1RU1A 1RBAA 3CJ0A 3IR6B 3DM2B 4J9RA 2G2YA 5J2PB 1IR2A 3SCIE 3OSPA 4DPTA 4PRFA 1VRTB 2ZH2A 5F0UA 5DRKA 3ILIA 2NYIA 3C66A 1JLFB 4KE5A 2HFSA 2VFSA 3Q2TC 2RJZA 1TL3A 3L7PA 2RU9A 4H4MB 3N5FA 1OPZA 4X2BA 2IPOB 2WVEA 3LAKA 4Y3CA 4WZMA 4F4AA 4CZCA 3FQLA 3RRGA 4M5JA 3G86A 1RP5A 2C3OA 1NSAA 2HSEB 3Q8VA 2B0GA 3GTYX 1RZMA 3C19A 1FI4A 5GADI 1P27B 4IOAQ 3THVA 4JBCA 3FCVA 2KJWA 4RW9B 2ZZTA 5RUBA 1HWKA 1RWNB 2PFDA 4OYIA 1VJWA 3SIPB 4O3RA 3KG1A 3PX0A 2E5GA 4L6V3 3D6HB 6FDRA 3H25A 2FB0A 4DL6A 3DN9A 1U02A 2H4YB 1EETB 1O5JA 1KWMA 3TA2A 2HGMA 3EZUA 5F9NA 3VZHA 3IRWP 3NGTA 1RCOB 2I5JA 1H2UX 6AT1B 2IM2A 3IWXA 2C3YA 4C98A 2FZKB 4JI4F 4IRCA 4Q8FA 3ZO7A 2X51A 2X7IA 4NLUA 5AT1B 2ZDOA 1NK0A 1T94A 5LSOA 1WNEA 3IMQJ 4JYAF 5JJBA 3G8QA 2G1HA 2YKMB 4R25A 3WZ0A 1YJTA 3M8QB 3G2XA 1VJQA 3MM6B 2KU7A 3MECA 3FNNA 2Z2LA 3DU6A 4CYUB 1C1BA 2BKPA 3BQ0A 1RAGB 2OPPB 4YOEA 2C2DA 5ETSA 3BDPA 1RU2A 4XIUA 4LRDA 2XNRA 3LAMA 4JV5J 4HR2A 1VISA 2NLWA 4ZVEA 2CPIA 4M5DA 3RR7A 5DM6Q 1EZZB 4LF7J 4IO1A 2E5LJ 4EEYA 2W2NP 4FS1A 2W2OP 3GB0A 4O4GA 2GJFA 4UT4A 1NKEA 3V6DB 2P6TA 3HULA 3E01B 3OW2R 5ADZA 4TLRA 1EKSA 2Y1IA 1T8EA 2R2TA 1TKZA 3FRYA 2C22A 2VOPA 4ZCKA 1ULRA 2FDNA 2V67A 5HROB 3DRXA 3UDVA 2ZH4A 2HHHJ 3HXMA 3A1YG 5I3UB 1YRTA 3M8PA 1JLEB 1H7XA 4LREA 1DZ5A 3AXMA 1WACA 4WFYA 1HQ2A 2GHPA 4OLOA 3ET6A 2ZNYA 1TL4A 4TY8A 3OFFA 3DLHA 5HSPA 5J2MA 3N6MA 4X64F 4UUWA 3Q86A 2OSRA 4DCOB 1SXLA 5K8PA 4WIQA 3AHPA 2DNHA 2XZTB 3MFIA 2IBOA 2XS7A 2MZQA 2APOA 3TZXA 1IQZA 5CABA 2KVIA 5LJ5Y 2D9PA 4W92B 4R8UA 4KHPF 1U6BA 4BC9A 5K5MA 2KXFA 3JQJA 2DBBA 2F8MA 2W7OA 1YRXA 3M8YA 2ERRA 1UWBA 2VJVA 1REVA 1S97A 3QT6A 2LDYA 2DGSA 2L48A 2HVDA 2PN6A 1QUPA 2XHCA 1RT4B 1TFWA 1KFDA 1S0MA 3UNGC
chains in the Genus database with same CATH topology
1GT8A 4XPEA 3EXCX 3RAXA 5KOXA 2HHVA 1XMOF 5LT5A 1TL1A 2IVMA 3QAEA 1X4AA 4ICLA 2MZTA 3OQ2A 4E8UA 3PW5A 1NAQA 2B43A 4NCAA 3KLFB 4DV3F 1VQ4S 1N5SA 1WHWA 2Q79A 2W9CA 1ZZNA 2YKPA 3M6XA 5DGBA 4IG0B 3U1LA 2IRUA 4PQAA 5E3CA 3BO4A 5KFNA 2DJWA 5AXKA 4DL3A 1JMTA 1MROA 4I2QA 2R7QA 4F3QA 1U6ZA 2I5JB 4GO7X 2YH0A 1N5YA 1XK8A 4P7VA 1N34F 5J2QA 3K59A 1SUQA 4O3NA 3DRRA 2MKSA 5T14A 2Z8QA 2FGCA 1S1XB 4CCHA 4X4SA 1FNXH 4ETZA 3U02A 1FVQA 3DLBA 1ZPWX 1E6VB 3GFZA 3POTA 4UUXA 4BHQA 2OJ3A 3DHWC 3IAM9 1U1LA 4ELTA 3PX4A 4FXDA 3TR5A 3BN4A 2HNZA 2ZKUA 3OR1A 1HBOA 2I0XA 2XMTA 3B78A 1ZOTA 2AV5A 4NOHA 3VZIA 1LV5A 4MIWA 2ZOFA 4C8OA 1LW0A 4YQWA 2C3MA 2QRRA 1RA6A 1RT5A 2GJIA 3HKWA 1R43A 5KG2A 2FTRA 5KT5A 4WCEQ 4WFBQ 2UUBF 3MXHP 1T03A 2V5HG 3VAIA 4CH7A 3ZZRA 1XN9A 4DR3F 2IRYA 1H2VZ 4JI2F 4JI3F 4C11A 3K8VA 4DFPA 1NK8A 3LUYA 1KRPA 3R27A 1N6QA 4C97A 1Q16B 3CMAS 4XO0A 1MU2B 3Q23A 5E3PA 4G3IA 2YKOA 4X4TA 2PFFB 5L1IA 5HL7Q 3AB2B 2VH7A 1NK4A 3I0SB 3GWCA 1Y0HA 3M2RA 4K5RA 1FERA 2V4JA 4J9NA 3H5XA 3MECB 3VTIA 3O3LA 2BRLA 5HQ8A 1SJ4P 3BGLA 3F56A 3ZZ0A 3PIPQ 3DNCA 5D3GB 3CCSS 2Y1JA 2RH3A 1C1BB 1YJVA 4JV1A 1V3SA 2DGXA 4QW8A 5T7LB 3G8SA 2WBRA 1M5HA 1X4EA 5DQGA 4X4OA 3K5LA 2CIMA 1U1NA 3UD3P 2G1DA 4K2XA 4HTIA 2FVCA 4J9MA 2AJ0A 4Q44A 4ATNA 1VK3A 4B9SA 3IR5B 1U47A 4EGLA 1L3UA 1S1VB 3QO9A 1MMNA 1D3WA 5I42B 1SKWA 3MPYA 3TA1A 1OQ3A 4LVNP 1TAUA 3DYAB 5LSRA 2YWGA 4FBUA 1FXLA 1WTFA 5KT2A 3EZ5A 3DLLQ 2JVOA 5AE3A 4M5DB 4YUDA 4A8QA 1FKAF 2HFZA 2ZBCA 2NPFA 3DU5A 2LXIA 4LSLB 3CCVS 1NJWA 2OH2A 1Y00A 2P5VA 2VPZB 3TUJC 4DR2F 4B08A 3MEKA 1GXUA 5KFMA 4WXOA 2KFZA 3HLUA 2QMWA 4I64A 5M2RA 3PO4A 1DLOA 1S1UB 4WKYA 1UW4A 3SV4A 3LGNA 5KFWA 2F1FA 3F73A 3ENVA 4AUKA 2AGQA 1YWXA 2AX0A 3US5A 2KJVA 2V4QA 2QSFA 1JWWA 2RS2A 2IM1A 5KOWA 1YI2S 2LQ9A 1S9GA 5GADU 4LFAF 3OXFA 1N4LA 4O4GB 3SSQA 4DF4A 3OJUA 2KT5A 3KK2B 3OLAA 2LXUA 1AXQA 4ZPVR 2R9LA 3P6YC 1QAIA 2OKQA 4DEZA 3D1HA 4NCBA 4CIOA 1V3ZA 4QWEA 2E9ZA 3QMQA 1HI1A 2RRNA 3K2YA 1O0PA 2Q6BA 2FVPA 3CB4A 1ZTTA 2LYVA 1YJWS 4X4RA 4ZCKA 3N5BA 2JEIA 1UKUA 3W2VA 3TRGA 2QE5A 3CCTA 4AE5A 4ECZA 3W3SA 4K4VA 2QA4S 1H6KX 1M1KT 2NUHA 5DDRC 1LFWA 4LF6F 2V0NA 3UFCX 2DHXA 3IRXA 3BO3A 3NRBA 5AXLA 2LECA 3DMJA 2XSJB 4AL7A 1YTYA 1I6JA 4H4OB 1TKZB 2Y1RI 5KFEA 2KG0A 2ASLA 4NZ6A 4A8XA 1YITS 3MMBA 2BQ3A 1DQ9A 1RT7A 3C6TA 1HHSA 4EYHB 1ZTWA 2DNMA 4NLSA 3RW6A 4F67A 2PMHA 2YQ3A 3DLEB 3M8PB 2HVIA 3MAQA 1DQAA 4U9RA 4C0BA 3MOJB 2PMZD 4M95A 4C2MA 4YR3A 1QVGR 3T1HF 1K0VA 3R1LA 2HNDB 3TX8A 2UZAA 4ECVA 2DITA 2DNPA 1RT1B 1L5UA 2WW8A 4CNZA 3LP2A 4HEA9 3QJLA 1X4DA 2IMOA 2VG5A 3U27A 3H40A 5DM7Q 1O8BA 2YNIB 5E2QA 4RUHA 5EDWA 2CPDA 4TY8B 2OFGX 1SJQA 5EWFA 5J2MB 2V8DA 3DDKA 4KPYA 2H9ZA 5CA5A 3PHEA 2PEHA 4I7FB 3K0JA 3D0GE 2BANA 2ZE2B 5C42A 3CCJS 5KT7A 5L1LA 1FT8A 1JXLA 1BY9A 3Q8SB 2J9DE 1RTIA 4QIEA 3VAFA 1LW2B 2ASJA 3G9CA 2CPJA 2JDJA 1FK9B 1UL3A 3MI7X 2ZH9A 2RT3A 4IFYA 2VOOA 3QGPA 2KTQA 3V81B 3RBDA 1JK9B 4RW4B 4NMLA 1CSJA 2MJNA 1VQ5S 2M0GB 1S6QA 3HFKA 4UY8T 2EKYA 4IQMA 3TAMB 2XWXA 3UW1A 4R8UB 3NGKA 4Z2XA 3Q0AA 1RA7A 2MKIA 1XNRF 4A8YA 2FLOA 1KVIA 3MAHA 2AGPA 1VQ6S 1SQEA 4PG4A 4I1TA 4O3OA 5KT6A 3ZFVA 4DV0F 2FJVA 2OTLS 2L3MA 4PXDA 3MMAA 3DC2A 4F25A 3JTPA 3DLGA 4KGMA 5DGAA 2WTFA 3SQGB 2A2CA 2ATLA 4KFBA 1I1GA 3FSYA 4C9DA 1ZZFA 2MGZB 2VFVA 1UWBB 2B56A 5JUMA 1C0UB 2WSFC 4Q8EA 3HHDA 2CYYA 1REVB 4IDKA 3U1MA 4DG1A 2HWTA 4WK1A 1OQ6A 1RJJA 1IR0A 3KNGA 1U1PA 4PKDB 4JV0A 4A8FA 4F2SA 3MD3A 2B5JB 2KM8B 2XGQA 4HYKA 1QSSA 3CIMA 3CVKA 2OPQA 4P6QA 3TQ1A 2XLKA 3J81Y 4X65F 3CULA 4W90B 1ZAWA 2XCAA 1S1TA 4ES3A 4AXJA 2J7WA 1IQTA 1J2VA 1TL1B 4ICLB 4RNMA 4EU0A 4FP9A 5KT3A 1Z4UA 1FTCA 4PWDA 2XGPA 4WYWA 3CC2S 2HW3A 2BJEA 3UE2A 4Q43A 2VBWA 1VQYA 2R7OA 4H4KA 3PEJA 5FD1A 2LEPA 2W9CB 4Y2AA 2GMLA 5CHCB 1KOOA 2RF2A 3OHAA 4DS4A 2KHCA 1YJNS 2FJXA 5AXNA 4PG6A 3H5SA 4QIFA 3MEGA 4PQUA 1VS3A 1VIOA 2DH8A 1MROB 4I2QB 5IM0A 3FMBA 3QGGA 1N5YB 1ZM4A 4QYZJ 2ZC4A 2EFQA 5G0RA 4MKYA 3E2EA 2JSXA 5J2QB 1SUQB 1R8HA 3DRRB 3KK3A 5F8JA 2K2PA 2A18A 2D3ZA 1NK9A 3SZ2A 1IKWA 4MYUA 3M32A 3FEZA 3LANA 3POTB 3PKMA 1KSPA 1Q1KA 2XY6A 1VQ8S 1U7LA 2HZCA 2M8DB 2HNZB 3SV3A 3OR1B 1HBOB 4IO9Q 2MSSA 1G1XA 2LU2A 2VD3A 4A4JA 3GV5B 2B6AA 4Q0BA 1U1MA 5D78A 3WC2A 1LW0B 2LCWA 2HRYA 3HVRA 3VCDA 3DOKA 1XC9A 1RT5B 2K3KA 1RYRA 2HS4A 1F0XA 3CT9A 1FRXA 2QSWA 4LJMA 5IT9Y 1RI7A 2PDAA 5K8OA 1LXJA 3NMAA 2DNZA 1T03B 3MM9A 3EPIA 1GXTA 2ZJPQ 2LDIA 2ZH7A 2J9CA 4C11B 1FDAA 3IXQA 1IKVA 4OMFG 1N6QB 4ZPCA 2XMWA 4ED5A 3CDWA 1IBLF 2WONA 5GVQA 2W7AA 1UEUA 1S76D 3HMJG 2LQJA 1UVNA 1RKJA 2NSBA 3MOZA 4K4WA 4MIBA 4B3MF 4ECTA 2YWKA 2R8KA 1C4CA 2MKJA 2V8VA 3M2RB 1IBMF 3B82A 3QLHA 2A1BA 2FHJD 2V4JB 1FKPA 1VFJA 3C2PA 3EX7B 1WF1A 1JNZB 5MLCV 5DG8A 2XS2A 2BXJA 3BREA 1RWUA 4IUFA 4OLPA 4F4XA 1WWHA 2JLFA 4OZ1A 3LQVA 4ID5A 4RBUA 4DR1F 2DO0A 3HZEA 5AXMA 1RK8A 4NXNF 1RKIA 4WXWA 2OPSA 4WZQA 1N36F 5DDQC 2KO1A 4CI0B 1JLBA 2CQ1A 3MFHA 3QO9B 3J7YI 2FLLA 2YNGA 1KHVA 5GAEU 1N52B 2WCXA 4B3OA 5C5JA 2XBPA 1B64A 2OAUA 1MMDA 4Y65A 4DJBA 3JB9k 4TKTA 2QLWA 1LOUA 4Y6IA 4TU9A 2QEXS 2XLJA 3MR6A 1Q8IA 1N0VC 4Q45A 3QZ8A 1D1UA 4GKJF 1KOHA 4GMKA 3RZAA 3N6LA 4IH7A 2FLPA 2YY3A 2AJ1A 2J6SA 2BDPA 1DLOB 4CO0A 2LKZA 2Z0GA 3HKZD 4UQTA 4DDFA 5CD4H 4DQRA 1HPZA 4OZ5A 1VQPS 1PGZA 1VQNS 1QLNA 2ZHAA 3BSCA 4RBVA 2ZUGA 5E0OA 3NNCA 2HVZA 3KKFA 3BGRA 4TLQA 4QPXA 4P2SA 1Y5LB 3KLGA 2BRKA 2B9WA 2FGOA 1S9GB 5A0YA 4L3NA 3EGZA 3L3CA 2HQ3A 2KM8C 1WEXA 4CQ1A 2RQKA 5GAHI 2AU0A 3M8RA 1HNVA 2HNYA 1KTVA 1NRKA 2ABYA 2HFOA 4LSNA 4OQJA 3RB4A 1F2GA 1FE0A 1Q82T 4ED3A 2O01C 1W2BR 2RSQA 3DDNA 5HMZA 5L9NA 1L3SA 2MKHA 2YX4A 3MM8A 4RWWA 4NLVA 3MM7A 1S1WA 1W25A 1SIZA 4K4ZA 4OIXA 3UR3C 1C4AA 2HHUA 4NLDA 4B17A 4ZCLA 1P1LA 3BM7A 3I87A 3MURP 4AYBD 1FEHA 3W2VB 1X5OA 1CG2A 2R4FA 3PR5B 4ITSA 2J9DA 4LF4F 3PV8A 2DNOA 2LA6A 1JJ4A 4A48A 3SMZA 2HHTA 4I0WA 2JEFA 3BR9A 3IRXB 2VBYA 1S6PA 2VPXB 1CC8A 1N54B 3DMJB 1NJXA 1XEZA 3KLEA 5AE2A 3NP5A 4YMEA 3U7JA 2XMJA 2UXBF 1YIJS 2HS3A 3KLVA 2HGLA 3MMBB 1U49A 4ILRA 1RT7B 2KT2A 3C6TB 4C8NA 1NKCA 4JV5F 2A2DA 4FNIA 1SH3A 3PRDA 3KMQA 2ZFHA 3ENWA 5EWEA 1T3OA 3BB5A 2Q43A 2MMYA 7FDRA 3OL6A 4OZJA 4X84A 4DN9A 2IM3A 2ILZA 5J2NA 1WF0A 3RAQA 1FJ7A 1UAWA 1URRA 3RTVA 3CMES 1RQ0A 1EP4A 4LT6A 2UVWA 3KOAA 1IN0A 3CIZA 1KEKA 4EUVA 4EO8A 4Q2LA 5I3PA 4QZVB 3RYLA 2AYEA 2XMVA 3CCRS 3MUVP 1HBMA 3LP2B 2FVSA 4RW6A 1BQNA 1A7GE 1IUJA 2CPZA 2VG5B 2BBEA 2C3UA 3DRSA 1WHXA 4DL7A 4LF7F 1B0VA 1RTJA 2MZRA 5KFDA 2XC9A 2WSEC 3UD4P 1TP7A 2HFNA 4P7TA 4WU2A 2BANB 1ZAXA 2J9EA 2O66A 5C42B 2K8GA 2XCPA 1TKTA 4YDDB 4XDCA 1RTIB 2PA8D 3CD6S 3OV7A 4CT8A 1DTTA 2D3UA 1WF2A 5DJBA 2M3DA 2GV1A 2LVWA 2AJ4A 4IFYB 4KRWA 3NAIA 2KXNB 3ZZZA 3VALA 5B0AA 1CPZA 4NA1A 4CO1A 2M5YA 2MJUA 3V6KA 2R7XA 1S6QB 2O3DA 3CDBA 3PZPA 2DIUA 3MWBA 4KIAA 4LIRA 4ZOSA 3OL8A 2ZH1A 1E6YA 2RIJA 2VBXA 4HT5A 3GE9A 3GYNA 1K1QA 2BE2A 1IXKA 2I1RA 3JSBA 2EVZA 4JUZA 5KFLA 5LJ3Y 4DV5F 4OJGA 1U2FA 3PX6A 1OSDA 1R8BA 4C8ZA 3MMAB 3S7RA 5KG0A 5H1SV 1IJEB 3DLGB 4XDDA 4ECRA 2JFDA 2MY8A 2L08A 5DETA 4KFBB 2DR8A 2O1PA 5MAOA 3CDEA 1D9DA 3LWLA 4CO3A 3K57A 1F9FA 2HHHF 2IVYA 4IDKB 4DG1B 4NLGA 4I67A 1FRHA 1RAJA 2XMMA 5T41A 1N32F 5K9FA 1SJ3P 3I4HX 3ZZPA 2HHQA 2UP1A 1FRIA 1FHTA 1SI9A 3I9ZA 2JZ5A 1SIWB 2DNRA 4LQ9A 4ERDA 1DQ8A 4ZPAA 1Q79A 4USHA 2UV8G 3H4BA 5KFAA 1X4BA 2OPQB 2GHVC 4OX8A 2IAJA 4BS2A 4ZLPA 5J1EA 2AYBA 5A8KA 4N47A 1S1TB 3O44A 2F7VA 1KQSR 4FF3A 1C2PA 1QVFR 1S4FA 2BA9A 4IKAA 4YB1P 4OI4A 2AP6A 2ZZMA 3T5KA 1Z2LA 4PWDB 3IBWA 4DV4F 3RB0A 5CXTA 3WDOA 3FMWA 2U2FA 2DHGA 4KBIA 4A8MP 2D3OR 4Y34A 2RQ4A 2ZH5A 2UVVA 5A8WA 2GW8A 3H59A 1X0PA 4QYRA 2RF2B 4OI2A 1S9FA 2QT7A 1JLAA 5LL6d 2FLNA 2Q3PA 4PQUB 2MQMA 3IWLA 3MEGB 1S0OA 2SXLA 2WB4A 3TO8A 1QJHA 4QIGA 4G1IA 5IM0B 1SBRA 2B4VA 2KXHA 3QJPA 2JEJA 3I5CA 3VAHA 2ZJQQ 3DRPA 3ZC4A 4GC6A 2RQMA 2MHNA 2CDQA 1JLGA 3FRZA 5G0RB 2W9AA 5JVHQ 4AQYF 4CO2A 3HP6A 3F44A 1Y3KA 3KK3B 1HW8A 5HBMA 2MYFA 4RW7A 4I68A 3B4MA 1Y4ZB 2BJDA 1L3VA 1IKWB 3M32B 3UWTA 2KDOA 5L8RC 5KG1A 3GG1A 5C24A 5B08A 3K7RA 2VUGA 3NLCA 2XSFA 3QIPA 4N8OA 3KHGA 3ONQA 1A6LA 1X7VA