4DV2F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv2F00
4LF6F 1J5EF 1XNQF 4JI5F 2KJVA 1XMQF 2RJZA 1HNXF 2VQFF 1B64A 1I94F 3T1HF 1IJEB 5BR8F 1FJGF 3OTOF 4DV2F 4B3RF 2UXDF 4JI3F 4DUZF 2UUAF 5LMNF 2E5LF 1XNRF 4DUYF 4DV7F 4LFBF 1IBLF 2UXBF 1LOUA 1VMBA 1IJFB 4JI6F 4LF7F 2KJWA 1G7CB 2UU9F 4DR1F 5IWAF 4LF4F 4JI0F 4DR5F 2HHHF 4GKKF 4DR3F 4GKJF 1N33F 4LF5F 2UUBF 4DV1F 1QJHA 4LFAF 4KHPF 2B7BB 4X64F 2UXCF 1F60B 4NXNF 4OX9F 4X66F 4AQYF 4LF8F 2YY3A 4DV3F 1GH8A 1FKAF 1N34F 4LF9F 4X62F 1CQNA 4K0KF 4JYAF 4JI1F 4JI2F 4NXMF 2VQEF 1HNZF 4JI7F 1CQMA 5AJ3F 2ZM6F 2J5AA 4DR4F 4DR6F 4YHHF 1G1XA 2B7CB 4B3SF 4DV6F 4JV5F 3R3TA 4B3MF 3ZZPA 1XMOF 4B3TF 4DV5F 4DV0F 1HNWF 1N32F 4DV4F 1HR0F 2BVZA 4DR2F 1IBKF 4LFCF 4DR7F 2UUCF 2F4VF 4X65F 4YY3F 4JI4F 2BXJA 1N36F 5LMUF 1RISA 1IBMF 4JI8F 3T1YF
chains in the Genus database with same CATH superfamily
4WP9A 2Q43A 4HLBA 1RXOB 3ITHA 2X3DA 4V1Ak 1MN9A 2ZBIA 1GQEA 3MM9A 4P7VA 1FE0A 4F0KA 1XTZA 2QA4G 2PMZD 3HD1A 1SL1A 3M9OB 2MQQA 4KV8B 4OI3A 2O5DA 2AX0A 4OYMA 4KAIA 5I42B 3GB0A 4WTYA 3RTVA 2H51B 1FJGF 3FEZA 3NEKA 4NZ0A 3UDEA 1W26A 2QT7A 4DEZA 2E9RX 1V6HA 1U2FA 2QLWA 1VQLS 4GKKJ 3DN9A 1XIQA 4K4XA 2R7WA 3OFGA 1RACB 1UEUA 4KT0C 5EN1A 3CJ3A 3DDKA 2KXHA 1RWMB 4U96A 5EGYA 2CZ4A 3R27A 4J37A 2UXCJ 2AJ2A 4OQJA 3VGUA 4DPWA 3GIMA 2KKHA 3DLEB 1NJXA 2IFXA 4RW4B 3M30B 4P2MA 4FS2A 2XQCA 2NXUA 3J7ZT 2BUNA 2ZVIA 2AGOA 1LFPA 1N54B 4YHHJ 1Y10A 4WFZA 1GXUA 1GTEA 2XS7A 1WKJA 2CDRB 1VMBA 2D1CA 4ZIVA 3G87A 2YWKA 5DG7A 1VQOS 5H9FJ 2UUWA 1FKOA 3IBFB 1KQFB 3GLJA 1VRUA 3JAMY 1DURA 2OD6A 3A8EA 4M5DB 2CPJA 3P3DA 1UWBB 3DLGB 3NG8A 3P4UB 5E0OA 3KJQB 5IWAF 1T11A 1S0NA 1RCXB 2BJ9A 2VPYB 4NLGA 3CCZA 3NNHA 2OTJS 3KJVA 2RQCA 4OYIA 1Q81T 3MPYA 1WNEA 1UAWA 1Y11A 1F1BB 2HURA 3VCDA 1R8PA 1FRMA 3CCTA 2KU7A 4K4TA 2VZ9A 1TELA 4P2FA 5KFXA 3HJFA 2M70A 2N3LA 2XMWA 1NEEA 2UXCF 2BMBA 2XHWA 1YJUA 4Y6IA 2EFPA 1S76D 8AT1B 1VGYA 2VG5A 4MMOA 2ILYA 3TARA 2VU5A 4J9RA 1VRTA 2ZH3A 4Z7CA 3JSMA 1GMWD 4C8ZA 1ZA2B 2AX1A 4OZNA 1C1BB 1LXJA 1D1UA 5DG8A 1EHWA 2H54B 3NGUA 3MAQA 1JKHA 5IC4B 2BBEA 4NA1A 3W62A 1V3RA 3MCMA 4ZJQA 1HKAA 1R8BA 5IC6B 5IQQA 4CT9A 1VC5A 1AUDA 4L72B 2HZVA 2Z0GA 2D3ZA 3UE2A 2GJIA 2W8KA 5C25A 2KFNA 5KFLA 2LVWA 4X4SA 1NHUA 1RT1B 3MTJA 3NGTA 1M5PC 1S1WB 4YHHF 1ZM9A 1KTVA 3T5HA 2YNIB 1V5IB 3PRBA 2ZUAA 4I2PA 2NYHA 2FLNA 3GPAA 4OHXA 3TX8A 3W5YA 4M5NA 1N32J 1IN0A 1R31A 3E3XA 3DU6A 2RRBA 2ZZNA 1UWBA 4TNOA 1DARA 2E1AA 4RKUC 1YVFA 2OPPA 1TK0A 2GVZA 5FLXU 3KJVB 1UZDA 2R9LA 1UVNA 1FJGJ 2Y8YA 4ECTA 3ISZA 2IYGA 1EKRA 2IDEA 3FBCA 4C6AA 2HQCA 3KUEA 4KE5A 4USKA 5KFAA 4F4XA 2E7WA 3OLBA 1JLGB 4DL3A 4NCAA 4KSEB 5CZXA 2WVBA 4X65F 4LBHA 1RA6A 4YY3F 1VBYA 3J7Z5 4RBTA 2AZ3A 2HVEA 3KOAA 2BYCA 4I64A 3E8OA 3P8BB 1B7YB 4J91A 4JI8F 1FE4A 3C15A 4ZPDA 3PNIA 3TA2A 4BCAA 4Z37A 4Q43A 2FC8A 1S6PB 4JI5F 1IR0A 3BGRB 2OEMA 3F0NA 4IQXA 3IR7B 2MZQA 4WJBA 4B02A 4AUKA 1GEHA 1FJCA 1U1MA 4CT8A 2B8PA 5D0RA 3LP2B 4MAKA 4F4KA 3MZIA 1WDDA 4O44B 2HAIA 3M9NB 1JWWA 4O23A 4E0DA 4LRBA 1K0TA 1P9QC 3P5BP 3KHRA 4TQSA 4RW8A 2RSQA 3HFZB 4N8NA 1KLMA 4QJVA 3G6YA 4EYIB 2E5LJ 1WI6A 4KKOA 1ZPVA 2QN6B 4U8YA 3TA0A 3U1LA 3KLVA 3M8SA 4F4ZA 4A8YA 1C1CB 2BM1A 2CQHA 4N77A 3IGVA 3PG9A 3QQCD 3M32A 2GMHA 4OLOA 4GVBB 4C48A 1MWQA 2HNDA 5C24B 3H2LA 3BEGB 3D9BA 3HDSA 4PKDB 1JLEB 2ROEA 3Q89A 3MR7A 1OJ4A 1FO1A 2N4CA 1IQTA 1WC6A 3DCAA 4X4PA 2DRAA 2A6MA 2H4WB 4LF6J 1CEZA 2BKOA 1IKVB 1FXRA 1RHQB 2VL1A 1I51B 3DM2A 3MD1A 2YWFA 3AHPA 3H90A 3KLEB 5HMXA 2AYGA 2YBVA 2VFTA 3MF5A 3D4JA 5IFMA 1T3NA 3D5MA 5KFHA 4MFBB 4CO5A 3UD4P 1SVDA 2JFDA 3IBWA 1T03B 2LMIA 3O2IA 1N5QA 4X4OA 2IA0A 4WKRA 3UI3A 1QM9A 2X51A 1Y0HA 4DV3J 4CCHA 2QA1A 3FFIA 3C15B 3LGNA 5AXLA 2CIMA 1O51A 2MSTA 1HBUA 1S72S 4H4MB 2NXNA 2W1BA 4TLQA 2CWKA 4YB5A 3U27A 4RR5A 2LYVA 2WAQD 1U02A 4IOAQ 2CPFA 2YNGB 3PRDA 3T1HJ 3TUJC 1ZAWA 2ZZTA 3MEEA 4EGLA 4HYKA 1YIJS 4NCGA 4AYBD 4A46A 1PIEA 2K1RA 4M1KA 3I4PA 3W63A 4OJHA 2PT0A 2E1CA 4NLRA 1FNXH 1RT6A 1IKXB 3KDOA 2P8IA 4F2RA 2DNPA 2IJFA 3D66A 2LQ5A 4KGVB 2WONA 3CNQP 4RW8B 4ZHRA 1RYSA 5IM0A 4Q0BA 2ZM6J 2Z56B 3V81B 3D28A 4L6V3 3R6GB 2EFOA 3T5LA 1RHKB 2GGPA 1Q4RA 3I32A 4IYQA 2QFJA 4JB8B 1EP4B 4WK3A 5CYMA 4WFNQ 2RUGA 1FWKA 4OZ2A 5E3PA 3ZC4A 2BOAA 3UR3C 3PJ9A 1RWNB 3CJSA 3QNWB 2DXDA 2JJ4D 1ZA1B 3DFEA 5A8WB 1H2TZ 5ETOA 2JLFA 3M9MB 2VBWA 3J81Y 1GMUA 4I68A 1KKHA 4AE5A 3ILIA 3LA0A 1C0TA 1RT4A 4WZMA 4IG0A 2UXDJ 3ZTRA 3DNCA 5KFMA 5GAHU 4UQGA 5B0EA 2HQIA 3GSDA 2R8HA 4OZ0A 4O3RA 1YSJA 2HHPA 5D78A 1FESA 4AQYJ 3HHLB 5H9EJ 1DZ5A 1VQ5S 3CCRS 3SSSA 1X4EA 3SI8A 2F4FA 4ED1A 5BJRA 5IT4A 2XZWA 2IC3B 4ZVUB 4ZITA 3TAQA 1R7IA 3Q23A 3I0SB 4PEOA 4NXMJ 5DJBA 2GQQA 4HACA 4PXBA 1REVB 2HEKA 5HK4A 4DV4J 1LW2A 2JEGA 3Q24A 1SB6A 1UCNA 2EFVA 4DSKA 3TZWA 1LWFA 3TVZA 1W2IA 1YJTA 2DGUA 1HIYA 4IDKB 2NXJA 3CJRA 3Q8RB 3NNCA 1FK9A 5ETMA 2HZAA 3OR2B 1IBLJ 2ZH8A 4UQTA 1S1TB 3E2EA 2V0NA 1Y3KA 2HQFA 5AXKA 5HI7A 1N34J 2E7XA 2YPYA 2KVIA 4CDIA 3Q8QB 1B64A 1D9DA 2O66A 3PW0A 3DGVA 3JTPA 3MAAB 1ZYQA 1VS3A 2VC0A 4EO8A 4EMDA 1RWUA 4NLDA 2RQMA 5J1NA 5CD4A 5ETPA 1N5VA 3Q22A 1GMVA 2AMCB 2IY5B 2I5JB 2UV8A 3IR5B 2DCLA 1BHNA 1JLQA 1FRJA 1U24A 2GC8A 2Q6BA 1NDLA 3ENAA 3M8PA 2B9YA 4XPCA 3KLHA 2CNNB 2L9NA 2NSCA 1RP5A 1TR0A 2B5JA 2DNOA 3ILLA 5HQLA 3TEGA 1KEKA 2ZNZA 2M88A 4F67A 5HLFB 1SPBP 1WEZA 1ZM3A 3TJAA 1Q7YT 1QLNA 4ZVTB 3SV3A 1SL2A 4X4VA 2R7XA 3H5XA 4G1PA 4M95A 1NB7A 4O44A 3ZXWA 4ED0A 3TQ1A 1WDTA 1RAHB 1HQEB 3UVJB 2K8GA 3OL7A 2ZH1A 2EG1A 4ETXA 5KFBA 1FWPA 2LLZA 1LFWA 1WI8A 4AT1B 1VBKA 4J9MA 5HQMA 4A8QA 4HVZA 4FN5A 1VQMS 4DG1B 4X84A 2R7UA 1CJUB 2W2NP 1Q5YA 4WTOB 3OUYB 2NS1B 4OZ3A 2ABYA 1SC6A 1LK5A 2V4JB 3QAEA 4L73A 4PG7A 4P9SA 2QSWA 4UF4A 4LRCA 4XIUA 4QWEA 4DHVA 1C2PA 2BJ3A 4LVNP 2AGPA 2EG2A 1R8CA 3OBIA 2HVHA 3RYLA 5DQHA 2XSJA 3K5OA 4KGXB 2RKIA 4AQYF 2B9EA 1EX8A 2FZKB 4KJIA 1P9YA 3NBPA 4CO4A 1A9NB 2WBMA 4B3OA 1FEEA 1OSCA 2DH7A 1BQXA 2V2VA 2ZBCA 3N5FA 3PEHA 5T41A 1U4BA 1N34F 1HNWF 1VQ6S 1RABB 3QT6A 1N5SA 3D54A 3GYXB 4I2QA 1FDDA 2IJNA 4WFBQ 4ECZA 1IUJA 4QZVB 1FD8A 4CM0A 1I94J 4K0KF 4JYAF 3VGVA 4ANEA 4JI1F 5L1JA 2VG6A 4JI2F 4F26A 4KGKA 4UW2A 3THTA 2FJWA 3HO1A 2CJ9A 2QX0A 1QAYA 2IM0A 2ASJA 2OH2A 4X4NA 3PRVA 4JYAJ 1S9EB 2LA6A 2KHCA 1FRHA 3PIOQ 4DL0C 1FRIA 2KL8A 2AEMA 1OS5A 2B6AA 2CNKB 2P6TA 3WIUA 4C0BA 1XNRJ 2WSFC 3LF0A 3BQ0A 3ZFVA 3OTEA 2ERRA 5KFFA 4MKAA 2YKOA 4UUXA 3OTCA 1HD1A 2Q1LA 4DR5J 3QGPA 3FMBA 1QVFR 2FD2A 3CCMS 2WONB 4Q0BB 3IWNC 4GC7A 3CPWR 1NK0A 5U47A 4QU7A 1M0SA 3Q8UA 3CGIA 2B51A 2BVZA 4P7TA 2QA2A 5L8RC 1SXLA 5KFOA 3OL8A 5F8IA 5KT6A 2MTLA 5LXYA 3PR5B 3RR7A 1DFDA 3A3OB 5E3QA 2HFZA 5DM7Q 1NZAA 3GTYX 2ZUGA 2F9JA 2VG5B 1SCJB 2VG7A 2WRMA 4ANCA 4DPXA 1AROP 3F73A 4RNOA 3JSBA 1NK6A 4HTIA 1F6TA 4DCJB 5JMNA 1S4FA 3QZ8A 4RO0A 2DGQA 3VAMA 2FJXA 1VK3A 1DQAA 3VVUA 2AT1B 4LF2A 1Y7PA 4TXSA 3W9HA 5GAEU 2JVRA 2ZNYA 4NXNJ 3CC4S 2EFGA 3MTKA 3G8TA 2EKNA 3B4DA 1R8HA 2VF3A 3RZAA 1NH8A 2W25A 5C25B 5D4NA 2LU2A 4DMZA 1M5KC 3T1HF 2H5IB 1RWPB 4B9TA 3M6VA 3DOKB 2LXIA 3IG1A 3NGDA 4LFCJ 5FJ4A 9ATCB 2JEJA 3LPYA 2GS8A 2KVQE 2XI2A 3VGSA 3CIMA 2YPZA 3RBXA 4F8RA 2RHQB 4AL6A 2CXEA 2GW8A 2OPQB 3M6UA 4GO7X 1IBCB 1Y3JA 4IOBA 2GIQA 1KONA 2BE9B 4C4WA 3AQOA 4NLTA 4OV6A 3CMES 5HROB 1UVMA 2PMHA 1T9WA 3UDLA 2V8GA 4NMXA 1CVJA 2VPWB 4P52A 5D3GB 3KDNA 1ZTTA 4QYZJ 2KM8B 3HX9A 1RBLA 8ATCB 4DL4A 1NM2A 1IBLF 4IR1A 4JI5J 1NSAA 3I87A 5KG0A 2BJ7A 1RJJA 1K9MT 3CJ4A 4F4WA 3HVAA 3QT5A 2I1RA 1XMQJ 4JI7J 3HT0A 1JLAB 3HHEA 4I56A 1TUGB 3CTRA 2UU9F 2JNJA 3KWMA 2CQCA 3KK2A 2BJ8A 1HMVA 1QDUB 5I3PA 3T5JA 4CNYA 3AODA 4PWWA 5K9FA 4TN2A 5HVFA 3BV8A 5EX3A 1JLQB 2ZH6A 5AXMA 3BBCA 1NNDA 3VALA 2HHVA 2XCAA 2RAQA 2UU9J 3H7HB 2PFDA 1HPZB 2F8EX 3NAIA 3QRPA 2QLJB 1BUXA 4RW4A 1VBXA 3P96A 4V19X 2Q66A 5BYQA 3RW7A 3G8QA 2LQJA 1CPZA 1HL6A 3ULHA 5CH7B 5EWGA 2R8JA 3M2VA 4PWDA 3LP2A 4C8MA 1L5UA 2XS2A 4LIRA 4KPYA 3CVKA 4U7CA 1D8ZA 1VQYA 2WCXA 2XEXA 4K4UA 1FKAF 2MDAA 3GJQB 1HARA 3HVRA 3HF5A 3L4BC 3ZZZA 5AE1A 5C42B 2WVDA 6FDRA 2W2PP 2XYHB 1T9TA 2OPSA 3OFEA 3BR9A 5HJYA 1S1XA 1GMWA 4RW9B 3RW6A 2MJUA 3VF0B 1HI0P 4FPRA 4LRFA 1YG0A 2MZRA 5F8MA 2CKWA 2MKSA 3R5JB 3U1MA 3CE8A 1HBMA 2CPHA 2MQNA 3FC9A 4OYOA 3K58A 2ZM6F 3MPVA 1X4BA 2XSJB 3BS9A 4MIAA 1C4AA 5G0RA 1EQ0A 2B7CB 4B3SF 3PM9A 1S99A 2EC0A 4JV5F 4ZLJA 1FKPB 5C2GA 3MM8A 5F41A 1MN7A 4L3NA 2FB0A 2KYXA 4J9QA 5EWFA 2OEJA 4DSLA 2COLA 3GV8B 3ENVA 2D9OA 4NI2A 5KFRA 2JRSA 3SCJE 5KT5A 5F8LA 3RBZA 4J9SA 1RWKB 3R1HA 2HWIA 2A18A 1N32F 3EJMA 2GJFA 3PHTA 4OIXA 2MLXA 3CDWA 3KUHA 5ETNA 4DFPA 1JJ2R 3BBBA 1L3UA 2HIQA 3MR2A 3CDUA 2UUTA 1RAOA 3K57A 2LEBA 5ETTA 3J80Y 2Z4PA 3K59A 2VBXA 4X4QA 2D74B 4ICLA 4DSIA 3ZNJ1 2J9EA 4G1QA 2L48A 3C66A 1G6BA 1CG2A 4JOUA 4ZPBA 5LMUF 4LR7A 1U0SA 2V50A 4QIWD 1TMMA 5EWEA 4ECYA 2OEKA 4LF6F 1VQ8S 1J5EJ 4KTQA 3R5CA 1IKXA 2R7SA 1NPKA 3DHWC 1N5YA 1Z1ZA 5DZ6A 1OWXA 4YR0A 1HQUB 3LP0B 3Q83A 3J81U 4U7UK 2RQ4A 3EZOA 2QLBB 2ZKTA 4BBYA 4PPZA 2B9WA 3DDNA 2Z2ZA 5B0BA 2IAJA 1YWXA 1PCAA 3FCVA 1FX2A 1TL1A 4IG3A 4HH0A 1JLGA 4UZCA 4DPYA 1D3WA 2J0XA 1RYRA 4ZP9A 3PXGa 4OV1A 5HJXA 1ELOA 4F3QA 1T9XA 2O3DA 2IM1A 2OHDA 3L7OA 2AZ1A 1K8AT 1QAIA 4ELVA 4DF8A 1H73A 3MCSA 4MTPA 1RKIA 4O0IA 1RT1A 1YLXA 2CPXA 4FNIA 5CCMA 4EWTA 3KHLA 3AJ2A 2Y8WA 1YHQS 3EPGA 1S1WA 5KFEA 2YTCA 4NI2B 4G1IA 2YKNA 2RS2A 2B8QA 3CMAS 4ER8A 4HH1A 2UXBF 2FHOB 4M5HA 4LJMA 3RRHA 2UUAJ 1N88A 2HNZA 5KFCA 2JZ5A 4RBUA 2LP4A 3BSAA 2OUGA 1S9GB 4R0EA 3W1YC 4B17A 5CYJA 2W4PA 2KM8C 2YWHA 3FSYA 2DB1A 3VAFA 4R0JA 1S97A 2IMWP 4ZVHA 2DXEA 3P45B 3FUYA 1C1CA 3MPWA 3S01A 4KGZB 1AYEA 2HS0A 2DPIA 1BD6A 2AJ0A 3OFFA 4CO2A 2VONA 2EXUA 3B8HA 3DXSX 2R8GA 1WOPA 2FZGB 3FQLA 3Q2SC 1RUSA 3ZTQA 1U0HA 3W9IA 2LCWA 2GVDA 1KC8T 3MCOA 3BKTA 3QIDA 1S1TA 4ES3A 1RDRA 4B3RJ 4I69A 4GO5X 1W25A 1MROA 2G2ZA 1S10A 2ASDA 1UJ4A 4NA2A 4ZOSA 1O8BA 3M8QA 2E44A 2XYGB 4OHWA 3Q8SB 1IQZA 1VIOA 4NRTA 4M5IA 5SZTA 3OPKA 2KG0A 4U7UD 3G6XA 1RHRB 3I31A 3MUVP 4KHRA 5ITHA 2HMIA 1U26A 1M5HA 2W2OP 5GADI 4WE1B 1MLAA 2YWEA 2GZOA 1B0PA 1WUUA 3DLKA 1R8AA 2W4CA 4O0NA 4WP8A 4ZPTR 4ZJLA 2VUGA 4ES1A 5IT0A 5AJ3F 2XY7A 3NL0A 1E6YB 2V2ZA 2HHUA 4PPDA 1X9WA 3EDQB 1HNVB 2DRBA 2CPYA 2UUBJ 1BWEA 1UFKA 2AKWB 3M1VB 4PZVA 4TY8A 1YDLA 1X4AA 4CI0B 3GV5B 3HLUA 2AIRB 3MUTP 3WDOA 1TP7A 1A0OB 2K3KA 4DLEA 2V9WA 4B3MF 4QR2A 1X5SA 3BKUA 5L1KA 3GYGA 1AB8A 3EGVA 4OL8A 4B9MA 1CBKA 5L9XA 3CULA 1JLEA 2J7UA 2JEFA 3K5LA 5B09A 4EFAC 1SBRA 4ATNA 2VQFJ 4DV4F 1UVKA 1NB2A 1S57A 3Q8VA 3CC2S 1HBMB 2EBGA 4PG8A 3GYNA 2CG8A 5KG1A 3PHEA 1UTAA 4F4AA 5KFKA 3O8WA 2OFHX 5CYMB 2V8HA 1BQMB 1GXLA 3BGUA 4UUWA 4YFUA 4PXDA 4N5SA 3MFHA 2AQ4A 5G0RB 1J5OB 4A8FA 4B9SA 1MMDA 4USUA 1FNMA 2QGFB 2VPXB 3KNGA 3QO9B 2ASLA 2L9DA 5B08A 2VQEJ 1SJFA 5KFPA 4MJKA 3CJKB 1FF2A 4CLPA 4TU8A 1RAFB 2KRBA 2ZHOA 2DPJA 2C2NA 2DCUB 4DL5A 2JL9A 4H4MA 4NE9C 2AP6A 1TL3A 1IR1A 1ZOTA 9RUBA 1KOOA 2QL9B 1TUVA 1VCTA 4A8OA 1V5VA 1HLWA 4ZCLA 2VQFF 1WTBA 1SUQA 3HFKA 3UDVA 4IQMA 1ZZFA 2XYPB 4WWSA 3UQSA 1JLCB 2RRNA 3R5GA 1B99A 2Z30B 5A6PA 1RK8A 1YGYA 1VFJA 5H9FK 3FBEA 4HR2A 4USWA 3HKWA 3CJTA 2MY8A 5B0CA 3BB5A 1LWFB 4FYYB 4LSLB 4DSFA 2PA3A 2MQ8A 1YITS 3JQJA 1LV5A 1RWWB 4CLWA 2VOPA 5ADZA 1EQMA 2M3DA 3KK3A 1U1RA 4QIEA 3B54A 3HULA 2WBRA 4A4JA 1KBRA 4RUAA 4ZCKA 2F9DA 4DV7F 1MG7A 5A6WA 2R7TA 1JQGA 3H25A 4EBDA 1FT8A 1RTHB 4RW6A 3W64A 1RI7A 1H74A 2RIJA 4CTAA 1LOUA 2U2FA 1JNRB 1VJWA 2VPZB 2QFIA 3DLJA 4GMKA 4ZJOA 4ED4A 1YJWS 1B7FA 4JV0A 4IRKA 4ECRA 3PVXA 2KZZA 1C1BA 5HP1A 4USMA 2XMAA 4JI0F 2MLYA 2RB7A 2BKPA 2XHCA 3SZ2A 1JJ4A 4KH0B 1RTDB 1ROFA 4TU9A 4M5KA 2VH7A 3P49B 1N33F 5I4MA 4CQ1A 4X2BA 2MKJA 2HNYA 2MKIA 2CQ2A 5THWA 2DGTA 2HG4A 4LFAF 1UPPA 1S1UA 3ZZ0A 4BDPA 1OMSA 1WJ9A 1XR7A 3BPSP 3GE9A 3JAMU 3JTOA 4NA3A 1IWGA 5CA5A 1Q82T 2IVMA 3BM7A 2V68A 4HDHA 4X66F 2NUUG 1XMBA 1CULB 3IAS9 5F0WA 1CSJA 1NK5A 3HHLA 3CCUS 1YI2S 2BJEA 3KG1A 5K8OA 5A0YB 4W92B 2GHPA 2JC1A 1FEHA 1HHQA 2IPOB 3ITHB 3MMJA 4HI1A 3V6HA 2J0QD 2XLKA 2DIVA 2B3TB 1EZZB 2DNQA 4IFVA 4Q2LA 4C0OC 4MK9A 4MT1A 4KHMA 1CC8A 3HHKA 4WBFA 4ZA1A 2UXBJ 4WZQA 3SQGA 3K5NA 2VJVA 2LQBA 3F56A 1NSPA 3IMQJ 3HHLC 3UR0A 3DRXA 3DMJA 3EPIA 4JI4J 1BLUA 2IIHA 4TYAA 5T7LB 3JSYA 5RUBA 4YR2A 3CC7S 3RBEA 4RPFA 5IQ6A 3LGMA 4RNFA 2FLLA 1SJ4P 3KUGA 4QCLA 3I9ZA 3VAHA 1YJNS 2HHXA 3HSJA 1RWOB 1P8GA 4HEA9 1H3DA 2RT3A 2XWYA 2ZD1A 4ID5A 1RTHA 4NLQA 1JK9B 1OY9A 1QE1B 2CADA 2HLTA 4AD6A 4ECVA 3AXKA 2ZHAA 1XMOF 2MLZA 2XNQA 3GG1A 1WEXA 5HBMB 2WTFA 2RH3A 1N5TA 3RUBL 2A10A 4OYBA 2YNGA 3IRWP 2KRRA 1RTDA 2HSEB 3W2VB 4R5PA 3BQ2A 3BN4A 1T94A 4LQ3A 1PYTA 1FKOB 3KLHB 2MHNA 2V34A 3SCIE 2R7QA 1S79A 5C5JA 1X5PA 3OJSA 1KLNA 4FF4A 1S0VA 2CQPA 4USVA 1BXNA 5D4PA 2B5JB 3KK1A 4ZVQB 2MKHA 3AQPA 4UZBA 2ZJQQ 3MOJB 5LMUJ 1S7IA 4BHQA 3BSCA 4PG6A 2VJUA 1IBMF 1KOHA 2W9AA 1LXNA 1P1TA 2DEIA 3ICLA 3ETMA 2XGQA 4UY8T 5C42A 4NPOA 5CHCB 3DHXA 5HATA 2FJAB 1M90T 1QTMA 1FRXA 2KJVA 1IWAA 3NS6A 1XR6A 4Q2MA 4Q8EA 3EXYA 3NAHA 4IFVB 4F04B 2DHHA 1U25A 4KPCA 2DY1A 1AA1B 5B0DA 3MHYA 1QSYA 1Q79A 3SQGB 3NLCA 4B3OB 2GGPB 3CCJS 3KLIB 3M8WA 2HKEA 3S6EA 3H5SA 1YBUA 2ZHBA 3V6DA 4C97A 2VDHA 3HVTB 3OTOF 1SKRA 1VIXA 3IFEA 2CG4A 1XR5A 1WHYA 2OPRA 2HBQB 4K59A 2YH0A 1JX4A 3A13A 1E6VA 3KKFA 4TKTA 3NBPB 3WQPA 3TZXA 2ZJRQ 1F5AA 5F9LA 4V19J 2E9TA 1APSA 4NLWA 2ZE2B 5D6GA 4ED2A 1RTZA 1S1VB 2LKZA 2GA7A 1LQ9A 3AD9C 4JI2J 1TL4A 5KFTA 5K8MA 4QPXA 1H38A 4CH1A 4C8LA 2WK4A 5G4DA 3G96A 1LWXA 2VFUA 2KJWA 3M6XA 3VGTA 2XLJA 5KT7A 3I0RB 3IM9A 2CQ0A 3NS7B 3HSZA 4WFYA 1X4HA 1LWCB 3FKBA 1E6YA 1X31C 1LW0B 2DT9A 3K17A 1HNVA 2RHSB 1IBMJ 2DGSA 3BO4A 1F9HA 3CDAA 3V81A 2EFNA 2NZCA 2VFVA 1TQLA 2OLWA 3JS9A 1VHFA 3R9LA 5HROA 2RQKA 4CM2A 4Y2AA 1HWUA 4OZ1A 4K4YA 2CAJA 3OJUA 1EP4A 3DDIA 2KYZA 4RWWA 4A8KA 2I5JA 3R2DJ 4OX9F 5BXIA 2ZH4A 4PCQA 1TK5A 4G6VB 3H98A 1HYSA 3C6TB 3IA0A 2QE5A 5FDLA 2UVRA 2X3GA 3LANA 4UOGA 3TRGA 2HBYB 1GH8A 3MAAA 2IVYA 3HK2A 1BQNA 5KFQA 3CO9A 3IM8A 4URGA 1LKZA 2YNHA 2MQPA 1HNIA 3PJXA 1FJ7A 3KLIA 5AXNA 2BA9A 2CRLA 4FS1A 3V6DB 3NOGA 4U6PA 2L3MA 4IH5A 4DR7J 2V8PA 3QIPB 3BYRA 1Q8LA 3EGNA 1K0VA 2ADCA 1NDCA 3GQCA 3SQOP 1X4FA 3AJDA 2DIUA 2FPHX 4LR9A 4EO6A 5M2PA 5J2QA 3I0SA 1XNQJ 2F4VJ 4QIFA 1MU2B 4FNHA 2MQMA 2HYIB 2CQ1A 2GQ2A 5LL6d 3MOZA 4LF9J 1IM4A 2HNZB 5FLXY 4C11B 3Q86A 4P6QA 3RB0A 2FDNA 1BMQB 2HNDB 3CO0P 4I6AA 5JJBA 1Y00A 3KG0A 5CYQB 3T5KA 3FEYB 2WZ1A 1QY7A 4B3TF 1BWVA 3I5CA 2Z2LA 4NLVA 2NPFA 4ETZA 1TL7A 1FX4A 4DPOA 5D15A 3L3CA 4ZPWR 4DV2J 3FDSA 5A8KA 1N56A 4YOEA 7FD1A 2DNGA 3OUYA 2M52A 2DHAA 2P9GA 2QC3A 1AUSL 1BY9A 1DTQB 3ET6B 3MM5B 3QBCA 2P9EA 3D2WA 5B0FA 5DLFA 2BQ3A 1JLAA 2XZDB 2ZJPQ 1Q8IA 1MSWD 3R7NB 3KK2B 2EK6A 3GR0A 4LFAJ 2W7OA 1L3SA 2DNLA 4ZDNA 3EWGA 5DDOC 3C6UA 2OD4A 3GFYA 1H72C 3N9UC 5EDWA 3CCQS 1NKBA 3G8SA 1CJKB 2U1AA 4CTAB 1WD6A 3T1YJ 2AJFE 1HBOA 1HWKA 1KS2A 3W61A 1NK8A 1FJEB 3PJWA 4C0HA 1FXDA 1PYOB 2YNHB 3WBZA 2VASA 4I2PB 5KTQA 3SYZA 5F9NA 5F8JA 1UEVA 3NOCA 2EC2A 4NLYA 5HVGA 3I56S 4ZLNA 3EZ5A 2BQRA 5B7WA 1QVGR 1HNXF 4EBEA 3AJ1A 2DY9A 3GCWP 5GMEA 4LF5J 2K1RB 4WXWA 1IBKJ 4WE1A 2NSBA 1R43A 2GNKA 2BRLA 4PYDA 2HVDA 2IM2A 1YZ6A 3P5TL 1ZM2A 2EVZA 3G9CA 1NZ8A 4ZN1A 1TMJA 4KC5A 4RW7A 3CUNA 4ELTA 2BE7D 4DX7A 2QL5B 1EKSA 2N82B 4DOZA 4Q8FA 5DRKA 4PWDB 4L74A 4LBPA 1PILA 1PJ7A 2XGPA 1RGVA 3CT9A 3D7SB 3M8ZA 3OXGA 2VIHA 1BGXT 4CYUB 2C3UA 2PSZA 1K73T 2A0FB 4QWAA 2N4DA 3KJFB 2V94A 2ZKUA 4MIBA 1X60A 3RU0A 1T7PA 4JUZA 5D8HB 2F8HA 1HNWJ 1IM6A 1PC5A 1PG5B 2Y1LB 2HFNA 1UKUA 1DTQA 1RZMA 3MM5A 2R7OA 2VKZG 3R8YA 1RWXB 3OSNA 2OSRA 2ZC4A 3BH7B 4LF4F 2FVSA 4Z7YA 5EHHA 2W9CB 1AXQA 4N8OA 4RZRA 4D3HA 2WB1D 3TP2A 1T95A 3EDRB 3V4IA 2C2RA 1SL0A 4PG4A 1NUEA 1U45A 4DFKA 2QZ8A 2QEXS 2CFXA 2DITA 3MPUB 4LF5F 1KLMB 5IV4A 3A8KA 1KR4A 3TR5A 1UW4A 5BYRA 5IS2A 3CCVS 3HT3A 2YKNB 3DLLQ 1K44A 2FUG9 2V8VA 3PW2A 2ATLA 2PIIA 2H3EB 4DCPB 3DI6A 4FKYA 3S1TA 2XC9A 1RU1A 4ZVOB 3OVSA 4IDKA 3V6KA 3QZ7A 2FLPA 2VA3A 3KLGB 2I2YA 3U1NA 1QAXA 1JLCA 3V2UC 3BO3A 4NLOA 5K5MA 2IDLA 2GHWA 4CNZA 3V5RA 5A8RB 1UMJA 3DOLB 3LWLA 4I6WA 3RAQA 1VI7A 1EIYB 2P6SA 3AD7C 4ZVGA 3LGHA 3LTOA 4TYBA 3POTA 3OTBA 3BN7A 5DM6Q 5IT9U 2XSFA 3P6YC 3HVWA 4F50A 1HYSB 1HQUA 4TLRA 1DAXA 5ETRA 2FVQA 1DRZA 3JQMA 3R3TA 5F8NA 3DRRA 2CJQA 3K8VA 5IXUA 3CCWA 1Y5LB 3TUIC 5GMDA 1UW9A 1NXIA 3M30A 4BWJA 5HP1B 2OJ3A 1RHUB 2PD1A 4CH7A 4DV0F 2HHSA 5IT9Y 4F4YA 4CZCA 3TAPA 3NWGA 2AYEA 3HP6A 3GCXP 2C22A 3RRGA 3OD2A 4MKYA 4W90B 5KFIA 1KNZA 2DR8A 1J27A 3O3LA 1SC4B 3UDCA 4DPTA 1QUPA 3J7YU 2PC6A 3DLKB 1HQEA 4QIGA 3UVJA 4DR2F 2BM0A 4C2MA 1X4GA 4F3MA 5LSOA 2BR0A 2BDPA 3E01B 2YKMB 4RUCA 4DR7F 4GKJJ 5IM0B 1F5CA 3RJMB 1HR0J 4DL6A 3M1VA 1IKWB 3FJ2A 4LSNA 1RT5B 3L7PA 2HZCA 4ZN3A 3TZZA 4K4WA 4OX6A 3W65A 3FEXB 2E1PA 2C2ZB 1KQKA 4FDFA 3OHAA 4HL9A 3D1HA 3MMCA 5E7OB 3LALA 1RT2A 4C8YA 2IYIA 1Q8BA 2AJQA 2FIUA 2QMUB 2WVEA 3WC0A 2QTWA 2ACMA 3DU5A 1VQSA 1TVRB 3JSRA 1XMQF 3DRSA 2UVVA 1U6FA 5J2PB 1H7XA 2FHJA 1WC3A 2BZ2A 3EVMA 4N7TA 3NMAA 1HQ2A 3FK4A 3MPDA 1IJEB 1HWLA 4Y65A 3CCLS 2DNKA 4UY85 4MIWA 2ZDPA 4XDDA 5HMWA 3SIPB 2R2TA 2GVDB 1FA0A 1QAJA 2VDIA 1WF1A 2ZBPA 2CQ4A 4QU6A 1RTIB 1H2VZ 1V9OA 3L9ZA 1P6TA 4ID5B 2OTLS 1FDNA 1MROB 3HKZD 1REVA 1HNXJ 3NP5A 4KQZA 1D9FA 3C3LA 1Q7LB 5HSPA 2JH3A 2PFFB 4LF8J 1HNIB 3DC2A 5CQGA 1GNKA 1SV5B 1RHJB 4WKYA 3FQKA 1F2GA 2VV5A 2ZEJA 5DQIA 2D3O1 2ZZMA 4K50A 2HFUA 2C2EA 3LP0A 3MGJA 2Y0BB 3TUZC 3CDBA 4DR1F 1RAIB 1WOOA 2ROPA 1UPMB 2J8SA 4NYOA 3L7UA 4PR6A 4QWBA 4DR3F 1Z2LA 3D67A 3M8YA 1IKWA 1C4CA 4H4KA 5CABA 1X5OA 4N56A 2VODA 3HCXA 2OMLA 1M1GA 1TL1B 2AEJA 1RQ0A 4Y34A 2KXFA 4KHPF 2POKA 3PX4A 4C11A 4U95A 2RRAA 4NMLA 4CYUA 2MPUA 2XULA 2DGWA 2DK2A 3MR6A 3LPEA 1TKDA 1SIWB 4PRFA 2ZOMA 4DR6F 4PUOA 3ZZOA 2Q6CA 2KXNB 4CLLA 1UJ5A 1F3FA 1GX5A 4HHJA 4MKBA 4C3MA 5A8KB 5HL7Q 4X4TA 4EI2A 1S6PA 2C3MA 6AT1B 3TANA 2M7SA 3BGRA 4FF1A 3TVYA 1CS4A 2JC0A 3KG4A 2CDQA 5KT2A 5EX0A 3W60A 3U7JA 5KFSA 3R7SB 3IGNA 5M2RA 5ETVA 1R3NA 2VB6A 3UWTA 1D8YA 1RAGB 2DKOB 1SH0A 3WC2A 3UO0A 3QGGA 4NCBA 4RLEA 2ZBQA 1R6YA 2YNFB 1YJRA 2D3UA 3ZTPA 2V2KA 4QBUA 4L75A 1HBOB 3CMQA 1G1XA 1CULA 5C2CA 3TO8A 3BJYA 2H65B 4ZP6A 3J7A1 3LO3A 4URQU 4E98A 4J7CA 4J9LA 2HWHA 3H42A 5E3RA 3VQTA 3RRKA 3DLBA 3UNGC 1DLOB 4K0KJ 2MSSA 5ETLA 1N36J 3OVBA 3NXZA 4NEYA 3DOMA 2F3JA 3MWBA 1UVIA 2R3VA 1NCLA 1NU4A 2BV3A 1LW0A 5D3GA 4K7QA 1T9YA 1LWCA 4EEYA 2XLIA 1I3OB 4RUHA 2PA8D 1JLFA 2L9WA 4C7QA 4PYAA 4YUDA 3K2YA 3VAJA 4AL7A 4KBIA 1NK9A 3T3FA 1XERA 4KY3A 2R8KA 4NLUA 1HMVB 4K4VA 1Q16B 1HW8A 5J1EA 1B0VA 2EFQA 4XTTA 2HGMA 3HM9A 4DQQA 1VQ9S 3C6TA 1H7WA 3M8PB 4RW6B 3H2VE 5KG5A 4Q45A 2F65A 4KIAA 1VRTB 1S9EA 4DL2A 2FJVA 1XNQF 2ATCB 2Z2YB 3HI9A 2XTJP 3DLHA 4YB1P 3B82A 4OFZA 4DX6A 2QL7B 5CAAA 4ZIWA 4LFBJ 3DRYA 1S59A 3QFWA 1KVIA 2FHMA 3G82B 2KHDA 4I0WA 4AL5A 4CH0S 2X1BA 4PXEA 2VICA 1URRA 4WP3A 2GIFA 3OL6A 5F8HA 3NWRA 4YS2A 5LJ3Y 2EKYA 1VDHA 2FGOA 4PG5A 4DV2F 4TY8B 1FTRA 2H5EA 2P5VA 1AZSB 1UETA 5KFDA 1UVJA 3RAXA 2W2MP 3TAMA 2MY7A 2HK3A 4YB7A 3ZTOA 1XEZA 2JLGA 2IRXA 4DUZF 3ILJA 5I3UB 4FKXA 4DUYF 2JSXA 4ZS6A 2OELA 2K7KA 2X7IA 3FGVA 2KN4A 2BE2A 3MAHA 3MEDA 1OYDA 2K06A 4OI4A 2HRYA 4ITSA 4E2FB 1REGX 3N6LA 4RJVA 3R7BB 4Y00A 1RHMB 4JP8A 4YDXA 3QLHA 4DFMA 1RT4B 2GVZB 2QO3A 1WF2A 4CLKA 2OKQA 3TQEA 3DRPA 4ERDA 3D3CJ 1QE1A 3M6WA 1GAOA 5DZ7A 2I6WA 1FDAA 2XM3A 2J0SD 4NZ6A 4LSZB 3MM7A 4ZK7M 4LRAA 3BZQA 1U7LA 3THVA 3DXBA 5LM7E 3THPA 1MWYA 4LQ9A 1JB0C 1RA7A 4J9UE 5GVQA 3GV7B 5H9EK 4DQIA 3QRQA 2HHWA 1TV6A 1YRUA 3DOKA 2F5GA 2AYMA 1CJKA 3PACA 3SDEB 1K47A 2NREA 4Q44A 4NZ7A 1S5ZA 2HGNA 2V69A 3IC1A 3QWUA 3G86A 4Y2MA 4QW8A 2O01C 4X64F 3BO2A 4F25A 2XI3A 1QUVA 2P9CA 1N48A 3IP0A 3NGSA 4E8UA 2JEIA 3ENWA 1AW0A 2IA6A 5K8PA 4EZ6A 1SJQA 3QGIA 3W2VA 4ZLLA 4R5PB 2DNYA 3KNAA 1OQ6A 4OZ5A 4ALZA 4A47A 3KHGA 3PW7A 3AA8A 2AGQA 1K1QA 1PJ6A 1NAQA 2QG9B 2DH9A 4KKOB 4Y2IA 3W5ZA 4ES2A 2VFSA 5GAEI 1KQGB 2YKPA 1S49A 2RF2A 3D1QA 4KYZA 2W7PA 4G3IA 2DRDA 3AT1B 3BKFA 3ISND 4WYWA 4YR3A 3VR1A 1XJWB 1SJ3P 1Q53A 4FBTA 1Y5NB 2CPZA 3IWLA 4DR4F 2W7AA 4CLYA 2ALZA 3I55S 2DHSA 2B43A 4IOCQ 2ZOFA 2HFSA 4HHUA 3UN3A 3AOCA 1BE4A 1TZ0A 4QIVA 2F1FA 4OZJA 4IO9Q 4N76A 2C2MB 4WU2A 2V4RA 2FJBB 3BR8A 3RB4A 3FSIA 4PQAA 2ZITA 1QTNB 2HQGA 3O1LA 3ZZPA 2VOOA 3AAWB 4QW9A 4NLXA 2YQ1A 1RBAA 3H0PA 3OTOJ 3W9JA 2V9KA 2W9CA 2JVOA 4WFAQ 4C98A 1ACMB 1NRKA 4R25A 1IBKF 3TUPA 3I5AA 1S9GA 2NCKL 3UN2A 1U1QA 4M5LA 2YNFA 2V5HG 3MFIA 2GMLA 4DUYJ 1S77D 1ZS6A 4I67A 1OYEA 3WIVA 1OPZA 3FRZA 2HVIA 1T9UA 2V4JA 3PO4A 1HNZJ 4HT7A 5E33A 2PEBA 3T1YF 4NYZA 3PZPA 1YX2A 5L1IA 2MJNA 3NS5A 4ECXA 4DV6J 3EICA 1O0PA 4GC6A 2Y1JA 3KLGA 4Y28C 4YB6A 5DGBA 4CLSA 4J90A 3OXLA 4CLTA 4QR1A 1HBNA 3AY0A 2ILZA 3CW2C 4NEZA 4ZHRB 1XC9A 1S6QB 2Y3YA 3ELHA 5I3QA 2DGVA 2O67A 3JYTB 1VBZA 1A6LA 5HMYA 4YQWA 3V6JA 3JB9k 2DNZA 4K2XA 5KG4A 3ZZUA 3NGKA 5BR8F 3CJ2A 1EB0A 1S0MA 4TY9A 2HHQA 2D7SA 1WC0A 1WTFA 2BJDA 1JJHA 1WEYA 2HMIB 1SKUB 2FY1A 1JIHA 2CYYA 1F5BA 3RR8A 2MZSA 4P72A 2J0WA 1L3VA 3NKYA 4DN0A 1JXLA 4JI3F 2QMWA 1WORA 2Z58B 4RNNA 3UD3P 2E5LF 2MXYA 2UUAF 2AEFA 3PR4A 2N7YA 4G1QB 1CS4B 1NSQA 1YK9A 1XK8A 2A1BA 1RT7B 2AF6A 3OXFA 5KG7A 3TI0A 2B56A 4DR2J 2CZ9A 2PDAA 4HTJA 1P1LA 1NH7A 2I38A 3OR1B 3FNNA 4WYLA 3SFUA 3ZZYA 2N7CA 2XO7A 2V4QA 1U1KA 1Q78A 2QSFA 4DV0J 3QSIA 3CD0A 3KLFB 3MDFA 1B0TA 1R0AA 1ZZNA 3KK1B 4FF3A 2UVUA 4QYRA 2DTJA 3Q2TC 3GJSB 1U6BA 2HHHF 2ACYA 1TL7B 2FY8A 2LXFA 3R5BA 5CD4H 2XG8A 3H5YA 4EBCA 2MZJA 3H8YA 4KO0B 4OMFG 1KD1T 4DXLA 4O3SA 1WOSA 5DDPC 2DVIA 3QAUA 1SKWA 3MURP 4DV1F 1FERA 4ZMMA 1UA0A 4ED3A 3QRRA 4M5GA 4YN3B 3PW5A 1BQMA 2NZ4A 4NXNF 1RWVB 2HLUA 1RBOB 3L09A 5L39A 1TVRA 3QO9A 2YY3A 5D77A 2KB2A 3EYZA 2V67A 3HZGA 4DUTA 1A7GE 2ZD1B 4H4KC 2NQPA 3B78A 1T9VA 2I0XA 3D6MB 4J9PA 1JLFB 2F40A 1ZBTA 3ZO7A 2OAUA 1U49A 3AH6A 2EBEA 4ZCIA 3PX0A 3ENQA 3RBDA 2R2UA 4PQUB 3HZEA 4IH7A 5LJ5Y 3HSGA 2APOA 1SUQB 3ISNC 4JI0J 1FNOA 3CF5Q 1RTIA 1HNZF 2C3OA 2CQDA 1AT1B 4TVAB 3PKYA 4EYHB 2B9XA 4MH8A 4OJGA 2XWXA 2DNNA 3VV2B 1RKJA 1M1KT 2QYCA 1N4LA 1FD2A 2ZE2A 4F2SA 1IKYB 4KHPJ 2HS3A 4P74A 2C3YA 1TKZB 2J7WA 2WOMB 1OIAA 3R5DA 1RTJA 2D41A 3GU0A 4RW7B 1EETA 3MEEB 5HVHA 2IMOA 4UT4A 5E3AA 5L46A 2JOQA 3VZHA 3H5UA 2MKYA 1VLYA 4FXDA 1B4SA 2EI5A 4FPIA 2RNEA 3A3PB 3CEDA 3R6LB 5ETQA 1TFWA 2M8DB 4I7FB 2PMWA 4K2JA 4OJ1A 3DOLA 4WXOA 4Q7AA 2DXFA 1PJ5A 2KO1A 3I6PA 3T1AA 2UUCJ 4DV1J 2AJ4A 7AT1B 2ALYB 5KFWA 3NNAA 3IS9B 2J9DE 2H9ZA 2Q79A 5KG2A 4J9OA 2PEHA 3M32B 1B70B 3HD2A 4OYWA 5HQ8A 1Q1KA 1VK8A 2FHKA 4DZDA 3QWPA 5I3UA 3IRXB 2JLEA 3PCOB 1MMLA 2YWGA 3H59A 4M63A 5L9NA 1I94F 3WHIA 3QIPA 1WG5A 4OLPA 2V6AA 3JQKA 1SH3A 4UOHA 2HNYB 4D3GA 1F9EB 3G6VA 2BRKA 1EAYC 4IG0B 2LFVA 2CNLB 1PAEX 3T41A 4CO3A 1T05A 4KRWA 3VAKA 2B4UA 4Q5VA 1RAJA 5HANA 2JFKA 2LXUA 3MM7B 4NWBA 1X9SA 2XS5A 3DI6B 4NL5A 2HBZB 4ZCMA 2I9SA 5DETA 1EARA 1SQFA 1U1PA 2XBPA 3TW0A 2DYAA 2GO8A 5CYQA 5DDRC 1ZH5A 1H6KX 2QYGA 3IBCB 1W7WA 1ZAXA 1S1XB 3W7BA 4XO0A 3LUYA 3ZZRA 1MU2A 2DD8S 3J81j 3ZTSA 3HFVA 3SCLE 2DNMA 4ED5A 4LMZA 1KTQA 3DYAB 2FVCA 1UFWA 5K8NA 3C2PA 4K4SA 3KFWX 2K7JA 3HXMA 2MKCA 5T7LA 2CPDA 4QOTA 2B0GA 4HHHA 4DSEA 3DMJB 3LP1A 1V3ZA 3M2UA 3AD8C 2LEAA 4WIIA 3GG0A 1TKTA 1U0HB 2WSEC 3C6UB 1UWAA 3QT8A 2G13A 2DR5A 4FYXB 3Q0AA 4ZPCA 1PO6A 4JV1A 4J9KA 4LFBF 2CA9A 2J8AA 3MI7X 2RDJA 2E5JA 5E2QA 4IFYB 1IJFB 2XMUA 2YXLA 3WX4A 2X1AA 1UL3A 2C42A 1GK8A 2W01A 1CJVA 3W2WB 3GFHA 5GMKa 1G7CB 2MZTA 4KFBB 1IXKA 2KT2A 4MYTA 2BANB 5ETSA 5HBMA 1RSCA 4RU9A 3Q8PB 3PKMA 3K89A 4FF2A 5AE2A 3C14A 4G65A 3GIIA 4DUZJ 1FFWB 4WPAA 1ZAVA 4OYAA 4QPTA 4IUFA 3FBBA 3FSXA 3M4XA 4FYDA 2G1HA 1QD1A 4DV7J 3J7AN 3IAM9 4B9UA 1UP1A 4X65J 3M2RA 3PYGA 5DO2A 1LWEB 1U1NA 1C0TB 2BJ1A 2E29A 2RVJA 3QPIA 4ICLB 3N6NA 2QA4S 1F60B 2DO0A 4F0HA 1I6JA 1XBWA 5A76A 4MYUA 1RT5A 5LOQA 1NDPA 3BGFA 5HLFA 2R7VA 4F3OA 3B6BA 2G0IA 1B3TA 4RUBA 3OTDA 3MM6B 2HAFA 2RDDA 4ZVFA 1R0AB 1R0CB 1KHWA 3IG1B 4RX6A 4OX7A 2C1EB 2IBKA 3S8SA 1CQNA 3MM9B 3R5AA 3J80U 4DR4J 2LEPA 1DJ0A 1X8DA 2QLFB 1SKSA 1SH2A 2GMJA 3KMQA 4P2XA 5J2PA 4NXMF 4KV8A 3K5PA 1FRLA 2RS8A 2DR9A 2QMXA 3RG6A 1KRPA 4BS2A 4ED8A 4ELUA 3CSKA 2FQQB 3O6QA 4QYZK 3BYPA 1F2HA 1NHVA 1UFLA 3I4HX 4F0MA 1WSRA 4S0MA 2OI2A 3LAMA 4A8XA 2CZVC 3CD5A 3I9V9 4IH6A 4ZLPA 4DZ6A 2VA2A 1WC1A 3MCNA 2NR0A 1KN6A 1TKXA 4IFYA 3JTNA 2DJWA 3R2CJ 1JXVA 3BF4A 3EM1A 1X7VA 4KFBA 4AXJA 2MQOA 4CP5A 2QV6A 1HD0A 2PI4A 4A8WA 1TL3B 3PFOA 1KDNA 3FVYA 3C46A 1T03A 3TJ8A 5M2UA 4OYZA 5K14A 2IJRA 4MFBA 1N8RT 2GJ2A 1XWLA 5KG3A 2M0GB 2I8EA 4TQRA 2BACA 1YRTA 2ZBRA 4O4GA 5C7PA 2FGCA 2X1GA 3LQVA 2NYIA 1ITPA 4B3MJ 2MKKA 3US5A 1HFEL 1RLDA 2BKNA 4ZPVR 2HHTA 2GO9A 1NK7A 1GT8A 2GQCA 3SXLA 3R1LA 3OHBA 4ED7A 2BABA 2HPUA 3MECB 1IR2A 1T0TV 4DR1J 1J5EF 2DHXA 2ROGA 3GSIA 1X0PA 3CJ0A 5AJ3J 1R27B 3RB3A 1TK8A 2DO4A 4USTA 2J76E 2XMVA 4L3KA 2FHJD 2K2PA 3BREA 4LF7J 4PAAA 4DQSA 3EXCX 2AJ1A 3PDNA 2FYXA 1KSPA 4XK8C 4LBIA 4ZVSB 3CB4A 1Q86T 1URNA 1BC6A 3TWZA 4C3LA 4DLGA 3KJNB 3JSMB 4A8MP 2LQ8A 1ZETA 1X5TA 2HBRB 2IM3A 2XMMA 3D6FB 4KGMA 5MLCV 1RADB 2FTRA 1WWHA 2HGLA 4P75A 5F3ZA 3PV8A 1U48A 1G2EA 1SI9A 4B08A 3N5BA 1DBDA 1WC5A 1M5SA 5A8WA 2W9BB 4IRDA 4ILRA 3A8IA 5B0AA 5J2NB 2M9KA 3WZ0A 4DDFA 5H1SV 2EWHA 3LW5C 3PIPQ 4B3RF 3IXQA 4H4OA 5KFJA 2HW3A 3UPFA 1NLKL 1R0BG 2K3IA 2VBZA 4B3SJ 2RDIA 2D69A 4J5OA 3U02A 3A1YG 2DISA 2PO4A 3JXOA 5LT5A 2YX7A 1SC3B 5CCLA 5DQGA 3H40A 3UNYA 1RLCL 5KFUA 1VQPS 3EVOA 4P71A 4B3TJ 5A0YA 1LK7A 3CJ8A 3N79A 2B4VA 2IC3A 2DH8A 2BW7A 3A3NB 1U2CA 3EVWA 3AB2B 2ZH2A 3BSNA 2C2KB 3EMTA 1VRQC 3K7RA 1FVQA 3Q8YA 1Z2ZA 4C8KA 2YQ0A 2MEWA 3GIKA 4C3KA 4I1TA 1RTJB 2YNIA 3BPDA 1RAEB 3F41A 3NCQA 1I5OB 5I42A 4DWIA 3FCHA 1QJHA 1R6VA 3C16A 1U2RA 4P2SA 1CLFA 4LUBA 2E5GA 2G0CA 2OGUA 4BC7A 1OQ3A 3ZZTA 3IWXA 3ZNUA 1S0OA 4IO1A 3DRSB 4KH1B 4ANDA 4IKAA 2A2CA 3CDEA 2A6OA 3EX7B 1VQ4S 1C0UA 2IHR1 3PFEA 3T9ZA 1RU2A 1OY8A 3OFHA 4JI8J 3UFCX 5FIIA 1K1SA 2WVFA 3NGRA 2IVFB 3X3UA 1NMEB 1VQKS 4ZP7A 2MQLA 4RU2A 4DL7A 1VC0A 1DY3A 1ICEB 3MMBB 4O3QA 4NYPA 3H2UB 3KMSA 2IBOA 2C2DA 1YKWA 4A8SA 1Z4UA 4X66J 4OX9J 4QQBA 1ULRA 3W5XA 4DF4A 3CJQA 3E01A 4DR6J 1FFSB 1FCAA 3D0HE 3QSYB 2HRUA 4ILMA 3MR5A 4HKQA 1RT3B 2JHEA 4F02A 1T3OA 1VHIA 5D0EA 1CJTB 1F0XA 1HHSA 2DNHA 2XZTB 3G82A 3GZ7A 5DLGA 1NSKL 5KT3A 3OR1A 3G4SS 4JV2A 1UJ6A 1NJZA 6FD1A 4LR8A 2OPSB 2DGXA 3KLFA 3EUNA 3DGPA 3UW1A 2RU3A 1S12A 4FP9A 3RB6A 1GX6A 5FDLB 2NLWA 3HSDA 3V4MA 1TUWA 1FFGB 2LDIA 3GWCA 2XY6A 5KFZA 2FVRA 4B9NA 1Q95G 1BQNB 3K8WA 4XDCA 1FI4A 2RMLA 2RD5C 2V8DA 1OO0B 3SMZA 2MGZB 3TAMB 3H20A 1FXLA 1DQ8A 2Z57B 1DTTA 2O1PA 4W98A 4DR3J 2UUCF 2DHGA 4GVBA 5C24A 4ECSA 3MEGB 4NLSA 4DQPA 2ADBA 2L08A 3MEDB 4I6YA 1N6QA 4K4ZA 1S4EA 2BXJA 2RKIB 4XAKA 1TKXB 3NY0A 1S6UA 4A48A 1C0UB 2KG1A 2KZMA 2J6UA 4FYVB 2OSQA 1CC7A 2VHGA 5J1PA 2EEYA 1DQ9A 4CIOA 2OP5A 3DLEA 3M8QB 1U6ZA 4C8NA 4CRJA 4Y0FA 2GHVC 4ZVRB 3E51A 4DX5A 5FD1A 3MXHP 2J9CA 3A12A 1S1VA 2Y1RI 2QIFA 2VD3A 2VG6B 3TYTA 4LIWA 5KFYA 5LSRA 1NKEA 4WIQA 4DPUA 4CLUA 1TV6B 1U8SA 1HA1A 2Q3PA 3DOMB 4KR0B 4O4GB 4IRCA 1RT6B 3SDEA 4B9LA 3M2RB 3N6MA 4PXCA 1H2UX 2XY5A 1LW2B 4IR9A 3HHDA 2FLOA 2KDOA 3ET6A 4ECWA 1MMNA 4USHA 2XMTA 4K5SA 3W8GA 3EGZA 3POTB 4OI1A 3FZBA 1KP6A 3FRYA 4HT5A 1ZPWX 4ID8A 4I4BA 1U1OA 4JV5J 1N5YB 5LSLA 4ZVEA 3N28A 2ASYA 2CJYB 2R42A 3KTQA 3PW4A 4I7FA 4OHYA 3DGPB 4DU8A 1LNQA 4FVMA 4RW9A 4U67Q 2WW8A 4DX8H 1U8WA 5EUHA 1W2BR 3K0JA 2DR6A 3MUMP 3TOQA 3VTIA 4L76A 4RWXA 1HW9A 2MHEA 2MGZA 1VJQA 4RNMA 3CCSS 2HHHJ 2E9ZA 2HFOA 3MMAB 5B0GA 2G9OA 2KT3A 4M94A 4DFJA 4GKKF 3UCUP 5J2NA 4GKJF 3NCPA 2OMOA 4M8LA 1TTHB 2DNRA 3BH6B 4U9RA 4DCOB 4O3PA 1S6OA 3GILA 3MM8B 3T9NA 2QLXA 2VC1A 5JVGQ 3C8YA 2JDJA 1D0EA 4QWCA 4DS4A 3TX0A 1L3KA 3UCZP 1Q8KA 3D0GE 5JXSA 5LXRA 4MK7A 4DV5J 1RT2B 1YTYA 3HPOA 4OI0A 3N4WA 3MMCB 4USJC 1LEOA 3J7YI 4LF9F 2WSCC 2CWXA 3UN5A 2AW0A 1SJ1A 3TNVA 2C3PA 4CLZA 2LECA 3RAMA 4CO1A 1S6QA 2KI2A 3GFZA 3OT9A 2EK1A 4OYPA 4PABA 5IOLA 4O3OA 1U1LA 3VVTA 2F8MA 4LSLA 3R97A 4JI7F 2PI5A 1VQNS 2ZH5A 5L1LA 3QJLA 1VOMA 1MW7A 3LP1B 1QSSA 1FK9B 2DR7A 1PGZA 1M1HA 2J9DA 4HDGA 4DV6F 1JNZB 1ZM4A 4YDDB 2E5HA 3AOBA 4YMEA 3DRPB 4ZKAA 1KFSA 3WX8A 2GCFA 2B4PA 3QATA 4X62J 5GADU 3W3SA 3D6HB 4IG3B 2W8LA 3C14B 3FZ2A 1Q5VA 4EK2A 3H4BA 3G71S 2M5YA 2B4OA 1S9FA 4ILLA 3MMAA 4UOCA 4NCGB 4OI6A 4X4RA 2N3OA 4OHZA 3VZIA 4LFCF 3LAKA 3DLGA 5D4OA 2IRUA 1VRUB 2UZAA 2E1MC 3QGHA 1O5JA 3TJ9A 4CLFA 3O44A 3H4DA 4J9NA 1AFIA 1SJRA 3TEHB 2F4VF 2ZOGA 1WELA 1Y4ZB 5A8RA 1SQEA 1N52B 1TKZA 2PN6A 2WHOA 2WOMA 4LREA 2L41A 4DG1A 1PBUA 4J9VA 1TL5A 4LF4J 2MB0B 1VLOA 3D0IE 3EZUA 5CZVA 2M2BA 1HI8A 5KFVA 3CD6S 3VAIA 2A2DA 2CUYA 2LU1A 4R8UA 2J6TA 1RB0A 3MM6A 2G1DA 1HI1A 4DJBA 1G3OA 3IN5A 2EW9A 2ZWPA 2PGCA 5KOWA 4PUOB 3GJRB 3K5MA 1PSDA 3I96A 2FJDB 1JMTA 3OQ2A 5GAHI 1MNEA 2BX6A 2E66A 1S7HA 2LA4A 2NXEA 5DG9A 4DQRA 2FC9A 1Y5IB 2E5IA 1SC1B 3QT7A 1XQIA 4Y2CA 3UD5A 3DM2B 3KYLA 1H98A 4I2QB 5GAGU 1U47A 1JKHB 2RE1A 3C16B 2YX1A 3MEGA 4YEAA 1FTCA 1J5OA 2AD9A 1N6QB 1NDKA 3ADAC 4GRSA 2W2QP 5IWAJ 3V4IB 3TVKA 5E41A 3T6BA 2W4DA 3N0VA 3VWSA 2CQIA 2JWNA 2OO4A 1KQSR 4YP3A 1JXEA 5J2QB 4P73A 1KFDA 1L3TA 3PTWA 1WHWA 2E7VA 1XNRF 2HVZA 2LDYA 2WVCA 5IZHA 2JX2A 1O6XA 2NUHA 3GONA 4JBCA 4BWMA 3SEOA 2VKRA 1NBEB 1OPIA 3GIRA 2HRTA 4XPEA 1RCOB 1RAAB 3OVAA 2YH1A 2KFYA 3PX6A 3NRBA 3CWJA 1WG1A 1DLOA 2R7RA 1FWLA 2R8IA 3OR2A 3D1OA 5SUHA 1YQHA 5K14B 4DN9A 1UVLA 3GJTB 5J2MA 1I1GA 4UOFA 4HACB 3OW2R 1F3VA 4Z2XA 2OPPB 2MMYA 3SSQA 5IV3A 4LF1A 1YRXA 1JLBA 3OLAA 2YQ3A 3BDPA 2RF2B 3BGLA 5D4LA 4ZPAA 1G4CA 2GIRA 2UUBF 2J6SA 1NPRA 3PY8A 2G4BA 2B7BB 3ILOA 1T02A 5LMNJ 4F7VA 2Y1IA 3AA9A 1KWMA 2RUSA 4F36A 5BYSA 5J1EB 1HBNB 3EE3A 3CCES 5F8GA 1NKCA 3HJVA 1AFJA 3JYTA 1ZTWA 4P10A 1XMOJ 2F7VA 3VAGA 3MR3A 2J7KA 3D68A 2AWZA 5GAGI 1YZ7A 3GFXA 2UV8G 4NLPA 3I5BA 1HWIA 1NO8A 4OZLA 3VHQA 2XCPA 2C28A 2AHOB 2AU0A 1T05B 2FVPA 2HWTA 2PE8A 4X62F 2GFFA 2H4YB 2DEJA 2ZWOA 3BGOP 5KAKA 1KVJA 2EPIA 3FBFA 4QR0A 3CD7A 3HHLD 3L95X 4FZVA 4WFXA 4ZP8A 1PKUA 2MZ1A 3BSOA 2AV5A 2BEFA 1QSLA 3ONQA 4OHVA 3AOAA 3B4MA 2H1YA 4RL1A 2E1RA 4JI6J 1FDBA 2GAHC 2R4FA 4FVCA 5L38A 5HMZA 2XB2D 3D3BJ 3QJPA 2VBYA 4JI3J 3D6TB 3N01A 3LWMA 2OPQA 5F3TA 2YWWA 4MKVA 3G2XA 2H48B 3MD3A 2RILA 1UEKA 4MK8A 1R89A 2X1FA 2KFZA 2BE2B 1OSDA 2CVEA 1P27B 5ETKA 2CQ3A 2Z8QA 3TZYA 5J2MB 4M5MA 4DV5F 1NJIT 5JVHQ 2AYBA 2DGOA 1HR0F 3QLHB 2VFRA 2D3OR 1JLBB 3A4TA 4GVLA 1XN9A 2KH9A 4N47A 1CJVB 3W2WA 3O5TB 3VQSA 8RUCA 3KLEA 1YJ7A 2ZVSA 3M2UB 1X0FA 1UZHA 3SCKE 4JI4F 1TKTB 2HS4A 3I82A 1UA1A 2KTQA 3QJJA 1N36F 1RISA 3IR6B 2XMKA 2Y9HA 2CQGA 5K20B 2CQBA 2A3JA 2RU9A 3M8RA 2QRRA 2MYFA 1YBAA 3BDEA 5F0UA 4RNHA 4PWUA 2H5JB 5AT1B 1GTHA 1VC6A 1WF0A 4NX9A 4PQUA 1F9FA 4Y2KA 1FVSA 1VR6A 3SFGA 2RJZA 3M2VB 3MMBA 4WF9Q 1HHTP 1VYAA 3GMGA 3G6ES 3DKDA 5JUMA 4USIA 2QJ3A 1YJ9S 1FRKA 1TAQA 3EGWB 3GR1A 4FYWB 3SV4A 1X9MA 2FZCB 4M5DA 3W66A 2XNRA 3OL9A 1HPZA 2R2RA 1KHVA 1S1UB 3AXMA 3FCWA 3X1LB 2V63A 1FHTA 2NPIA 2V2QA 5HO4A 1HWJA 2KT5A 4EU0A 2B6AB 2YKAA 4OI2A 1WC4A 1CJUA 4DU7A 2XO6A 1D09B 4KO0A 1VISA 2WB4A 3AB4B 2UXDF 2ZH9A 2BW2A 1MWZA 3M7VA 4R8UB 2ZDOA 2YKQA 5KOXA 3IRXA 2M4MA 3M05A 3PO5A 3QFHA 3MEKA 1OY6A 2HQDA 3CJ5A 1NPPA 2VG7B 5LMNF 3GIJA 3PYFA 3KXDA 5T14A 3PYDA 1YJVA 4WU3A 3ETOA 3DRRB 4N41A 4JI6F 2IAJB 4LVOP 2WW4A 3IS9A 1FKPA 5E5NA 3T6JA 4LF7F 5KT4A 1TAUA 4ECUA 3FMWA 3AFGA 4DI6A 4QWDA 2CJBA 4ED6A 5MAOA 4DS5A 1N0UA 4TU7A 1DTTB 1V3SA 3TA1A 4DR5F 3HVTA 2Z2MA 4K5RA 2OIHA 2NXCA 4O3NA 3NCRA 1WHXA 2OPRB 1GXTA 2OFGX 5DDQC 4C8OA 1NHKL 2CJXB 3OSPA 3CJKA 1GFWB 1E6VB 2GAGC 4H4OB 2YKMA 3KHHA 1NJYA 4DBQA 2HFVA 4X64J 4FXWA 1D9AA 1Q0NA 1KVKA 1YBTA 4LSNB 2GV1A 1AZSA 2HIYA 2LQ9A 2W24A 2CPEA 2P2CB 1IKYA 3GP9A 4LT6A 4M5JA 3SSRA 4LF8F 4OX8A 1VQ7S 3BBFA 3HHNB 2BQUA 2UP1A 1EETB 1PAUB 1WHVA 3S7RA 2IRYA 3W8PA 4DV3F 1JJCB 4JI1J 4Y3CA 2Y0SD 4ENOA 1S48A 1RE1B 3I0RA 2CJAA 5E3CA 5DGAA 2UVWA 5KG6A 4W4MA 5DS7A 1PYSB 2ZFHA 3PEJA 4RBVA 1TFYA 2C2OB 2F63A 4U8VA 2CPIA 3PYEA 2G2YA 2D9PA 1U09A 1WSVA 1X4CA 4H54A 4O4RA 1WKKA 5D0GA 1IKVA 5AE3A 2VQEF 4C9DA 1Y9OA 4WK1A 2FJEB 2CVIA 4WCEQ 1M5VC 4HI2A 2CJKA 4BC9A 1PC4A 3IO1A 3MECA 1CQMA 3KK3B 1IVZA 1J2VA 1N0VC 2J5AA 2BOPA 4K8RA 5CXTA 1SIZA 5A2QY 4ZVPB 7FDRA 3UCGA 3OV7A 2R2SA 1TU0B 3F44A 4OYXA 4BLGA 3CIZA 3NMRA 1PBAA 4CWBA 2XMJA 1EJ7L 1LWEA 4NASA 4URSA 3FFIB 4EUVA 4YY3J 1M5OC 4NRUA 1H0HB 1HBUB 3HMJG 4OJ3A 3LOUA 2DBBA 2BANA 5BR8J 5A2QU 4FBUA 4FXVA 1RT7A 1SV5A 1WACA 5HN0A 3LH2S 3SBMA 1X4DA 3C19A 3A8JA 4LRDA 5HAOA 4ECQA 1WKLA 3RGIA 2W9BA 4CO0A 2HQ3A 4NOHA 5KFGA 2CNOB 3QMQA 4B9VA 1DHMA 2SXLA 5D0HA 3T19A 2G0JA 5KFNA 4DSJA 2YX4A 4EZ9A 1N33J 4UTGA 2GX8A 4AFFA 2M8HA 1NJWA 1RT3A 2ZH7A 2ZC3A 2YVSA 4AXIA 4KB7A 1T8EA 1SQGA 2HK2A 4X4UA 3QYYA 1NK4A 3CXCR 1CJTA 2G2OA 3DYAA 1WG4A 3BQ1A
chains in the Genus database with same CATH topology
2Q43A 4HLBA 3ITHA 2ZBIA 1GQEA 3MM9A 4P7VA 1FE0A 1XTZA 2QA4G 2PMZD 1SL1A 3M9OB 2MQQA 4KV8B 4OI3A 2O5DA 2AX0A 4KAIA 5I42B 3GB0A 4WTYA 3RTVA 1FJGF 3FEZA 4NZ0A 2QT7A 4DEZA 2E9RX 1V6HA 1U2FA 2QLWA 1VQLS 3DN9A 4K4XA 2R7WA 3OFGA 1UEUA 4KT0C 5EN1A 3CJ3A 3DDKA 2KXHA 5EGYA 2CZ4A 3R27A 4J37A 4OQJA 3GIMA 2KKHA 3DLEB 1NJXA 2IFXA 4RW4B 3M30B 4FS2A 2NXUA 3J7ZT 2BUNA 2AGOA 1LFPA 1N54B 4WFZA 1GXUA 1GTEA 2XS7A 2D1CA 1VMBA 5DG7A 1VQOS 2YWKA 5H9FJ 2UUWA 1FKOA 1KQFB 3JAMY 4YR2A 1VRUA 2QFJA 1DURA 2OD6A 3A8EA 4M5DB 2CPJA 3P3DA 1UWBB 3DLGB 3NG8A 5E0OA 5IWAF 1S0NA 2VPYB 4NLGA 3NNHA 3CCZA 2OTJS 3KJVA 2RQCA 1Q81T 3MPYA 1WNEA 1UAWA 3VCDA 1R8PA 1FRMA 3CCTA 2KU7A 4K4TA 2VZ9A 5KFXA 3HJFA 2M70A 2N3LA 2XMWA 1NEEA 2UXCF 2XHWA 1YJUA 4Y6IA 2EFPA 1S76D 1VGYA 2VG5A 4MMOA 2ILYA 3TARA 4J9RA 1VRTA 2ZH3A 3JSMA 4C8ZA 2AX1A 4OZNA 1C1BB 1LXJA 1D1UA 5DG8A 3MAQA 1D0EA 1JKHA 5DQHA 2BBEA 4NA1A 3VAKA 1V3RA 3PW2A 1L5UA 1R8BA 5IQQA 4CT9A 1AUDA 1VC5A 4L72B 2Z0GA 2D3ZA 3UE2A 2GJIA 2KFNA 5C25A 5KFLA 2LVWA 4X4SA 1NHUA 1RT1B 3MTJA 1M5PC 1S1WB 4YHHF 1ZM9A 1KTVA 3T5HA 2YNIB 3PRBA 4I2PA 2FLNA 4OHXA 3TX8A 1IN0A 1R31A 3E3XA 3DU6A 2RRBA 2ZZNA 1UWBA 4TNOA 1DARA 2E1AA 4RKUC 1YVFA 2OPPA 1TK0A 1UVNA 3KJVB 2R9LA 4ECTA 3ISZA 2IYGA 5KFAA 4KE5A 4F4XA 2E7WA 3OLBA 1JLGB 4DL3A 4NCAA 4KSEB 5CZXA 4X65F 1RA6A 4YY3F 1VBYA 3J7Z5 4RBTA 3KOAA 2BYCA 4I64A 3E8OA 4JI8F 1FE4A 4ZPDA 3TA2A 3PNIA 4BCAA 4Z37A 4Q43A 2FC8A 1S6PB 4JI5F 1IR0A 3BGRB 4IQXA 3IR7B 2MZQA 4WJBA 4B02A 4AUKA 1FJCA 1U1MA 4CT8A 4F4KA 3LP2B 4MAKA 3MZIA 3M9NB 4O44B 2HAIA 1JWWA 4O23A 4E0DA 1K0TA 1P9QC 3KHRA 4TQSA 4RW8A 2RSQA 4N8NA 4QJVA 1KLMA 3G6YA 4EYIB 1WI6A 4KKOA 1ZPVA 3TA0A 3KLVA 3U1LA 4F4ZA 3M8SA 4A8YA 1C1CB 2BM1A 2CQHA 4N77A 3IGVA 3M32A 2GMHA 4OLOA 5C24B 2HNDA 3H2LA 3BEGB 3HDSA 4PKDB 1JLEB 2ROEA 1FO1A 2N4CA 1IQTA 3DCAA 4X4PA 2DRAA 1CEZA 1IKVB 1FXRA 2VL1A 3DM2A 3MD1A 2YWFA 3AHPA 3KLEB 5HMXA 2AYGA 2VFTA 3MF5A 5IFMA 1T3NA 3D5MA 5KFHA 4MFBB 4CO5A 3UD4P 2JFDA 3IBWA 1T03B 2LMIA 3O2IA 1N5QA 4X4OA 2IA0A 4WKRA 3UI3A 1QM9A 2X51A 1Y0HA 4CCHA 2QA1A 3FFIA 3LGNA 5AXLA 2CIMA 1O51A 2MSTA 1HBUA 1S72S 4H4MB 4YB5A 4TLQA 3U27A 2LYVA 2WAQD 4IOAQ 2CPFA 2YNGB 3PRDA 1YIJS 3TUJC 1ZAWA 4EGLA 3MEEA 4HYKA 4NCGA 4AYBD 4A46A 2K1RA 4M1KA 3I4PA 4OJHA 2PT0A 2E1CA 4NLRA 1FNXH 1RT6A 1IKXB 4F2RA 2DNPA 2IJFA 4ZHRA 2LQ5A 4RW8B 2WONA 1RYSA 4Q0BA 5IM0A 3V81B 3D28A 4L6V3 2EFOA 3T5LA 2GGPA 1Q4RA 3I32A 4IYQA 1EP4B 4WK3A 5CYMA 4WFNQ 2RUGA 5E3PA 3ZC4A 3UR3C 2JJ4D 3DFEA 5A8WB 3M9MB 1H2TZ 2JLFA 2VBWA 3J81Y 4I68A 4AE5A 4WZMA 1C0TA 1RT4A 4IG0A 3DNCA 5KFMA 5GAHU 4UQGA 5B0EA 2HQIA 3GSDA 2R8HA 4OZ0A 4O3RA 1YSJA 2HHPA 5D78A 1FESA 5H9EJ 3HHLB 1DZ5A 1VQ5S 3CCRS 3SSSA 1X4EA 3SI8A 4ED1A 5BJRA 5IT4A 2XZWA 2IC3B 3TAQA 1R7IA 3Q23A 3I0SB 5DJBA 2GQQA 4PXBA 1REVB 1LW2A 2JEGA 3Q24A 1SB6A 2EFVA 4DSKA 1LWFA 3TVZA 1W2IA 1YJTA 2DGUA 4IDKB 3Q8RB 3NNCA 1FK9A 3OR2B 2ZH8A 4UQTA 1S1TB 3E2EA 2V0NA 1Y3KA 5AXKA 5HI7A 2E7XA 2KVIA 3Q8QB 1B64A 1D9DA 2O66A 3PW0A 3JTPA 1ZYQA 1VS3A 2VC0A 4EO8A 1RWUA 4NLDA 2RQMA 5J1NA 1N5VA 3Q22A 2I5JB 2UV8A 3IR5B 1FRJA 1JLQA 1U24A 2DCLA 2GC8A 3M8PA 2Q6BA 3KLHA 4XPCA 4DL5A 2B9YA 2L9NA 2NSCA 1RP5A 1TR0A 2B5JA 2DNOA 1KEKA 5LMNF 5HLFB 1SL2A 2ZNZA 2M88A 4F67A 1WEZA 1ZM3A 1QLNA 1Q7YT 3SV3A 4X4VA 2R7XA 3H5XA 4G1PA 4M95A 1NB7A 4O44A 4ED0A 3TQ1A 1HQEB 2K8GA 3OL7A 2ZH1A 2EG1A 4ETXA 5KFBA 2LLZA 1LFWA 1WI8A 4J9MA 4A8QA 4HVZA 4FN5A 1VQMS 4DG1B 4X84A 2R7UA 3OUYB 2NS1B 2ABYA 2V4JB 1SC6A 1LK5A 3QAEA 4PG7A 4XIUA 3H25A 2QSWA 4QWEA 4DHVA 1C2PA 4LVNP 2AGPA 2EG2A 1R8CA 3OBIA 2HVHA 3RYLA 2XSJA 3K5OA 4AQYF 2RKIA 4KJIA 3NBPA 4CO4A 2WBMA 4B3OA 1FEEA 1OSCA 2DH7A 1BQXA 2ZBCA 3N5FA 3PEHA 5T41A 1U4BA 1N34F 1VQ6S 4I2QA 1N5SA 3D54A 3GYXB 4WFBQ 1FDDA 2IJNA 4ECZA 1IUJA 4QZVB 1FD8A 4K0KF 4JYAF 4JI1F 5L1JA 2VG6A 4JI2F 4F26A 4KGKA 4UW2A 3THTA 2FJWA 3HO1A 2CJ9A 1QAYA 2IM0A 2ASJA 2OH2A 4X4NA 1S9EB 2LA6A 2KHCA 1FRHA 3PIOQ 4DL0C 1FRIA 2P6TA 1OS5A 2B6AA 4C0BA 2WSFC 3LF0A 3BQ0A 3ZFVA 3OTEA 2ERRA 5KFFA 4MKAA 2YKOA 4UUXA 3OTCA 1HD1A 2Q1LA 3QGPA 3FMBA 1QVFR 2FD2A 3CCMS 2WONB 4Q0BB 3IWNC 4GC7A 3CPWR 1NK0A 5U47A 4QU7A 1M0SA 3CGIA 2B51A 2BVZA 4P7TA 2QA2A 5L8RC 1SXLA 5KFOA 3OL8A 5F8IA 5KT6A 5LXYA 3PR5B 3RR7A 1DFDA 5E3QA 2HFZA 5DM7Q 1NZAA 2ZUGA 2F9JA 2VG5B 2VG7A 2WRMA 1AROP 3F73A 4RNOA 3JSBA 1NK6A 4HTIA 1S4FA 3QZ8A 2FJXA 2DGQA 3VAMA 1VK3A 1DQAA 1Y7PA 4TXSA 5GAEU 2JVRA 2ZNYA 3CC4S 2EFGA 3MTKA 3G8TA 3B4DA 3RZAA 1R8HA 4QWCA 5C25B 1NH8A 2W25A 3CCES 5D4NA 2LU2A 4DMZA 1M5KC 3T1HF 4B9TA 3M6VA 3DOKB 2LXIA 3IG1A 3NGDA 5FJ4A 2JEJA 3LPYA 2XI2A 4F8RA 3CIMA 4AL6A 2GW8A 2OPQB 3M6UA 4GO7X 4IOBA 1Y3JA 4C4WA 2GIQA 1KONA 3AQOA 4NLTA 3CMES 5HROB 1UVMA 2PMHA 3UDLA 2V8GA 1CVJA 2VPWB 5D3GB 1ZTTA 4QYZJ 2KM8B 3HX9A 4DL4A 1IBLF 4IR1A 5KG0A 3I87A 1RJJA 1K9MT 3CJ4A 4F4WA 3HVAA 2I1RA 1JLAB 3HHEA 4I56A 3CTRA 2UU9F 3KWMA 2CQCA 3KK2A 1HMVA 5I3PA 3T5JA 4CNYA 5K9FA 4TN2A 5EX3A 1JLQB 2ZH6A 5AXMA 3VALA 1NNDA 2HHVA 2XCAA 1HPZB 2F8EX 3NAIA 4RW4A 1VBXA 3P96A 4V19X 2Q66A 5BYQA 3RW7A 3G8QA 2LQJA 1CPZA 1HL6A 3ULHA 5CH7B 5EWGA 2R8JA 3M2VA 4PWDA 3LP2A 4C8MA 2XS2A 4LIRA 4KPYA 3CVKA 4U7CA 1D8ZA 1VQYA 2WCXA 2XEXA 4K4UA 1FKAF 2MDAA 1HARA 3HVRA 3HF5A 5AE1A 3ZZZA 5C42B 6FDRA 3OFEA 2OPSA 3BR9A 1S1XA 4RW9B 3RW6A 2MJUA 3VF0B 1HI0P 4FPRA 1YG0A 2MZRA 5F8MA 2CKWA 2MKSA 3U1MA 3CE8A 1HBMA 2CPHA 2MQNA 3K58A 2ZM6F 3MPVA 1X4BA 2XSJB 3BS9A 4MIAA 1C4AA 5G0RA 2B7CB 4B3SF 3PM9A 1S99A 2EC0A 4JV5F 1FKPB 3MM8A 5F41A 4L3NA 2FB0A 2KYXA 4J9QA 5EWFA 4DSLA 2COLA 3GV8B 3ENVA 2D9OA 5KFRA 2JRSA 3SCJE 5KT5A 5F8LA 4J9SA 3R1HA 2HWIA 2A18A 1N32F 4OIXA 3CDWA 4DFPA 1JJ2R 1L3UA 2HIQA 3CDUA 2UUTA 3K57A 2LEBA 3J80Y 2Z4PA 3K59A 2VBXA 4X4QA 2D74B 4ICLA 4DSIA 2J9EA 4G1QA 2L48A 3C66A 1G6BA 1CG2A 4JOUA 4ZPBA 5LMUF 4QIWD 4LF6F 5EWEA 4ECYA 1VQ8S 4KTQA 3R5CA 1IKXA 2R7SA 3DHWC 1N5YA 1Z1ZA 1OWXA 4YR0A 1HQUB 3LP0B 4U7UK 2RQ4A 2ZKTA 4BBYA 4PPZA 2B9WA 3DDNA 5B0BA 2IAJA 1YWXA 4IG3A 1TL1A 1RYRA 4HH0A 1JLGA 1D3WA 2J0XA 4ZP9A 3PXGa 4OV1A 4F3QA 1ELOA 2O3DA 2IM1A 3L7OA 1QAIA 4ELVA 4DF8A 3MCSA 4MTPA 1RKIA 4O0IA 1RT1A 2CPXA 4FNIA 5CCMA 4EWTA 3KHLA 3AJ2A 1YHQS 3EPGA 1S1WA 5KFEA 2YTCA 2RS2A 4G1IA 2YKNA 3CMAS 4HH1A 2UXBF 2FHOB 3RRHA 4LJMA 1N88A 2HNZA 5KFCA 2JZ5A 4RBUA 3BSAA 5CYJA 4B17A 1S9GB 4R0EA 2W4PA 2KM8C 2YWHA 3FSYA 2DB1A 3VAFA 4R0JA 1S97A 2IMWP 4ZVHA 1C1CA 3MPWA 3S01A 2HS0A 1BD6A 2AJ0A 3OFFA 4CO2A 2VONA 3B8HA 2R8GA 3DXSX 3FQLA 3Q2SC 2LCWA 1KC8T 3QIDA 1S1TA 4ES3A 1RDRA 4I69A 4GO5X 1W25A 1MROA 1S10A 2ASDA 1UJ4A 4NA2A 4ZOSA 1O8BA 3M8QA 2E44A 4OHWA 3Q8SB 1IQZA 1VIOA 4NRTA 5SZTA 2KG0A 3OPKA 3G6XA 3I31A 3MUVP 4KHRA 5ITHA 2HMIA 1U26A 1M5HA 5GADI 4WE1B 2YWEA 4ZPTR 1B0PA 3DLKA 4ES1A 1R8AA 2W4CA 2XY7A 2VUGA 5IT0A 5AJ3F 3NL0A 2HHUA 1E6YB 4PPDA 1X9WA 1HNVB 2DRBA 2CPYA 1BWEA 3M1VB 4TY8A 1X4AA 4CI0B 3GV5B 3HLUA 3MUTP 3WDOA 1TP7A 2K3KA 4DLEA 2V9WA 4B3MF 4QR2A 1X5SA 5L1KA 4OL8A 4B9MA 5L9XA 3CULA 1JLEA 2J7UA 2JEFA 3K5LA 5B09A 4EFAC 1SBRA 4ATNA 4DV4F 1UVKA 3CC2S 1HBMB 2EBGA 4PG8A 3GYNA 5KG1A 5KFKA 3PHEA 3O8WA 2OFHX 5CYMB 2V8HA 1BQMB 1GXLA 3BGUA 4YFUA 4N5SA 4PXDA 3MFHA 2AQ4A 5G0RB 1J5OB 4B9SA 1MMDA 1FNMA 3KNGA 2VPXB 3QO9B 2ASLA 2L9DA 5B08A 1SJFA 5KFPA 4MJKA 3CJKB 1FF2A 4TU8A 2ZHOA 2KRBA 2DPJA 2DCUB 2JL9A 4H4MA 2AP6A 1TL3A 1ZOTA 1KOOA 1TUVA 4A8OA 2VQFF 4ZCLA 1WTBA 1SUQA 3HFKA 4IQMA 1ZZFA 3UQSA 1JLCB 2RRNA 5A6PA 1RK8A 1YGYA 1VFJA 3HKWA 2MY8A 5B0CA 3BB5A 1LWFB 4LSLB 4DSFA 2PA3A 1YITS 1LV5A 2VOPA 5ADZA 2M3DA 1U1RA 3KK3A 4QIEA 2WBRA 4A4JA 4RUAA 4ZCKA 2F9DA 4DV7F 5A6WA 2R7TA 4EBDA 1FT8A 1RTHB 4RW6A 4CTAA 1RI7A 2ZHBA 2RIJA 1K8AT 1LOUA 2U2FA 1JNRB 1VJWA 2VPZB 4GMKA 3DLJA 1YJWS 1B7FA 4JV0A 4IRKA 4ECRA 3PVXA 2KZZA 1C1BA 5HP1A 4JI0F 1JJ4A 2RB7A 1RTDB 3SZ2A 1ROFA 4TU9A 1N33F 2VH7A 3P49B 4X2BA 5I4MA 4CQ1A 2MKJA 2HNYA 2MKIA 2CQ2A 5THWA 2DGTA 2HG4A 4LFAF 1S1UA 3ZZ0A 4BDPA 3GE9A 1XR7A 3JTOA 4NA3A 5CA5A 1Q82T 2IVMA 3BM7A 4HDHA 4X66F 2NUUG 1XMBA 3IAS9 5F0WA 1CSJA 1NK5A 3HHLA 3CCUS 1YI2S 2BJEA 3KG1A 5K8OA 5A0YB 4W92B 2GHPA 2JC1A 1FEHA 3MMJA 4HI1A 3ITHB 2J0QD 3V6HA 2XLKA 2DIVA 2B3TB