1VHFA

Crystal structure of periplasmic divalent cation tolerance protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
SLILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords periplasmic divalent cation tolerance protein
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vhfA00
1NZAA 3AH6A 1O51A 2DCLA 2J9DE 4RWXA 3NCPA 3M05A 2J9CA 4R25A 2EG2A 2GW8A 2JJ4D 3TA2A 4CO2A 4Y65A 3TA0A 3O5TB 2PIIA 2XZWA 5DS7A 3T9ZA 1HWUA 3HLUA 5D4NA 1Q1KA 1NH7A 3L7PA 1J2VA 2GX8A 1H3DA 1V6HA 1NAQA 3TA1A 2XG8A 3BZQA 1UKUA 4CO5A 2VD3A 1V9OA 4ZK7M 1P1LA 1VHFA 1KR4A 5D4LA 2E66A 4WK3A 1UFLA 3O8WA 4CO1A 2NUHA 3X3UA 2O67A 4C3LA 3DFEA 4YB5A 3AHPA 4OZLA 3NCRA 4CNYA 4OZJA 4Y6IA 1GNKA 4USHA 4CO4A 4CO3A 4YB6A 1PILA 4USJC 3AA9A 3CE8A 2ZOMA 4USIA 4D3HA 5DRKA 4CNZA 1OSCA 1UMJA 1V3RA 1V3SA 4NYPA 4D3GA 4WK1A 4C3KA 2CZ4A 1XK8A 4OZNA 2V5HG 4C3MA 4IYQA 3MHYA 3N5BA 4RLEA 2J9DA 3LF0A 5L9NA 1VFJA 2XULA 3AA8A 2Z0GA 5D4OA 2NS1B 4YB7A 2ZFHA 5D4PA 4E98A 2EG1A 1O5JA 4AFFA 2O66A 2XBPA 3OPKA 3NCQA 2NUUG 4RWWA 1QY7A 2RD5C 3GSDA 4NYOA 4CO0A 4RX6A 1NH8A 2GNKA 1UL3A 2J9EA
chains in the Genus database with same CATH superfamily
1MMNA 2XTJP 3AD9C 4RBUA 3OFEA 4DV5F 1A7GE 5C42B 2HSEB 2IAJB 2H5JB 4F26A 2ZBQA 3LPYA 2VBWA 4OMFG 4EBCA 3MGJA 3FMBA 5ETOA 4WXOA 3T6JA 1BXNA 1DTTB 1IKYA 3NAHA 1ZAXA 4DSEA 3KHHA 1HBMB 3GP9A 1TMJA 4ED1A 3J7Z5 4DSLA 2UZAA 1BUXA 2V34A 3OXGA 3PNIA 3L7PA 4ZPAA 2QMXA 1TQLA 5KFZA 2ALZA 5ETMA 3M2RB 3EPGA 4DR6F 5DETA 1N5QA 4PYDA 1N32F 2XLIA 2QTWA 3BQ1A 3DGPB 1GXUA 1UWAA 3F0NA 3IGVA 1FRKA 2QYGA 4WU2A 5C24A 1YTYA 1VQNS 1QLNA 3FBBA 4HKQA 2ROPA 1G4CA 4NA3A 4QIEA 2K06A 4WFBQ 4ED2A 1O8BA 2MKKA 4FS1A 4DR3F 2UUBJ 4JI0F 3VVTA 4G65A 4LF9J 1O6XA 4QOTA 4WK3A 3UDCA 2YBVA 5H1SV 1RABB 1R8BA 3L95X 1S79A 2IDEA 5DJBA 3IM9A 2O67A 4LVNP 3MXHP 4HH1A 1OQ6A 2P6SA 3NRBA 4NLXA 2KDOA 1IBLF 3GMGA 1U09A 2GMHA 1D8ZA 2K3IA 4KKOA 1QAJA 4DPUA 2Q43A 4J5OA 2GFFA 1YJTA 2IRXA 4X4NA 3MCSA 2CQHA 4KY3A 3HT3A 1LQ9A 4QYRA 1FKAF 1NM2A 4CLFA 1JLBB 4JI1F 3BR9A 1S9GA 4DR3J 3DKDA 2POKA 3K5LA 2E5LJ 2NZCA 2UUBF 1KHVA 4YDXA 3V2UC 4C48A 1W2BR 2HHVA 4NZ0A 1MN9A 2IA0A 4J37A 4WPAA 2HBZB 4WZMA 4KFBB 5J2NB 2J0SD 3R1HA 3UI3A 5IQ6A 1S77D 3EDRB 3HVRA 2EFQA 1F9EB 1I3OB 1WSVA 3DLGA 4RW9A 1YJRA 4D3GA 2YVSA 3MD1A 4DL6A 3MMJA 4RR5A 1IBKJ 4C11B 4DWIA 4DSJA 1NXIA 2BM1A 4KE5A 4N47A 5D0GA 4X4QA 4A8OA 2DIVA 4IG3B 1XBWA 2XQCA 4C3MA 4K4YA 1VQ6S 1FNOA 2HBQB 4UUWA 4ZCKA 3VGSA 3DLHA 1UTAA 4LIRA 5I4MA 3ADAC 4KGXB 4Y3CA 3QJPA 5ETTA 2CPXA 2FTRA 1FRMA 2R42A 3DLJA 3LGMA 2Y3YA 4WYWA 4TQSA 4CDIA 2WOMA 2KI2A 3DRPA 2J6SA 1VRTB 3Q8PB 1WOOA 4X66J 4M5IA 1CQMA 3UDEA 3I0SA 2MQLA 3TUZC 2A18A 3P45B 1BQNB 2IIHA 4OJ1A 4QIVA 4X65F 4ELTA 2ZBCA 1TVRA 2IHR1 1Q8KA 2KRBA 1F5CA 2AU0A 2DIUA 3PRVA 4TNOA 1Q0NA 2GMLA 4ZLPA 1FNMA 3MM7B 3JYTA 2E1RA 2HGMA 3AB2B 2ASYA 2PDAA 4UTGA 1SC6A 4IQMA 1Q7LB 1C1BB 1NUEA 1C1CA 3MM8B 3NCQA 5KOWA 3BSNA 2DR9A 3KG1A 3THPA 2VA3A 2YX7A 3KUGA 2Y8YA 1ZETA 4DFMA 2VG5A 1R43A 1UL3A 2JZ5A 5E3CA 1S7HA 2M70A 1N5TA 3LP1A 2X1FA 4LF6J 1HARA 2V8VA 4JI2F 3W65A 2IY5B 1IR2A 4Q2MA 1DQ9A 1QDUB 3BEGB 1NHUA 1IKWA 3P3DA 1VBKA 2YWWA 2RKIA 2OIHA 4DV0F 3OXFA 4F3OA 1M5PC 4CIOA 3MR6A 4JI3F 2GJFA 3CO9A 4B3MJ 3R5DA 4KFBA 5KG6A 3M7VA 5J2NA 4CLUA 4DLEA 3FEYB 4ED8A 1HHTP 3VAJA 1WF2A 3J81Y 3BR8A 5K5MA 1IQZA 3CEDA 3VCDA 1IQTA 5T7LA 2HIYA 2U1AA 4DX8H 5A8KA 3D67A 2RHQB 4PXCA 1V6HA 1VISA 3FMWA 5KTQA 5IM0A 2KTQA 3HD1A 3TVKA 2MLXA 3WZ0A 2AGQA 2VQEF 3PXGa 1IM6A 3QFWA 1MROB 5KFLA 4ZCMA 1XR5A 3JTNA 4KYZA 3UNGC 2FD2A 5HL7Q 1SV5A 5DZ6A 2HMIA 1IKYB 2XNQA 3PTWA 1NK5A 3H5XA 2WBMA 1QVGR 1UEUA 1WEXA 4ID5A 4K4TA 4WZQA 2ZH7A 2RRBA 2RDJA 3CD5A 3TX8A 2E66A 3J7A1 3UD3P 3BQ0A 2JVOA 3C16B 2VFUA 3HHLB 3Q2TC 4LIWA 2R8IA 4A48A 2V4QA 3KUHA 4YMEA 3F73A 5IQQA 4NWBA 2HEKA 4OYOA 5IM0B 4E2FB 5K8MA 1HHQA 2E1PA 4OZJA 2PN6A 1WELA 1RT7B 2CPHA 2AEFA 3HKZD 3S01A 4PYAA 5J2MA 2ROGA 3TAQA 1OIAA 2OPQB 4K4ZA 1WORA 4URQU 3B54A 1R8PA 4OYMA 4DCOB 2KU7A 3QLHA 4F36A 3MOZA 4USJC 5DM7Q 1QJHA 3M2UB 3P5TL 3H2VE 2MKHA 4WE1A 5EN1A 2HHTA 1NMEB 3IWLA 4RW7A 3DHWC 5A8RA 2XMMA 1SH3A 4LF1A 1P8GA 4OV6A 4ED4A 1S0VA 3Q8VA 2EPIA 3QO9B 2YWGA 2OO4A 3PIPQ 3H5UA 3V6DB 2UVVA 1HBOB 2C2ZB 2RJZA 3NGKA 3PACA 1NDKA 4NMXA 4ZHRB 5GMKa 3R3TA 4RBVA 4BHQA 3KLHB 2WSFC 4MIWA 2AJFE 2B4VA 3PKYA 1NJXA 4B9UA 3NLCA 1MWZA 1XIQA 3FBEA 1U6ZA 3HULA 3CIZA 2DNLA 4DV4J 3MEGA 5EDWA 1WC0A 1Y9OA 3LWMA 1WC1A 3LGNA 3MDFA 2F8HA 4CT8A 4O3NA 3EZ5A 3SI8A 2F4VF 3MM6A 4B9LA 2KXFA 2YNGB 2QLBB 5KG0A 2WB1D 3HPOA 2IFXA 4FXWA 2VICA 3OBIA 3G86A 4HACB 2PA3A 5LMNJ 4I7FA 2HGLA 3AA8A 4G1QB 4ZHRA 3KLHA 1YIJS 3H25A 1RYSA 1FI4A 1LXJA 4JP8A 3ULHA 1SI9A 1BQXA 5B0AA 3G8SA 3QWUA 2DVIA 2OMOA 3D6TB 2OH2A 3QGGA 2ABYA 2EFGA 4EGLA 1RAAB 1VIXA 1H74A 1HW9A 1NSKL 2EG1A 2B43A 1RLDA 2M88A 4FPRA 4QPXA 2L41A 3NGTA 4AFFA 4CTAA 2R7OA 2MXYA 2MKCA 3GV7B 4DR7F 1KWMA 1GQEA 1EX8A 1SIZA 2FHOB 2H3EB 1Y4ZB 2XBPA 3BH7B 4BWJA 1RT5B 2EKYA 4XPCA 3T1YF 2XWYA 1TTHB 1B0VA 1LFWA 1LW2B 2PSZA 3FGVA 2DNKA 3MD3A 4O3OA 3OUYB 2X1BA 3VF0B 1DAXA 5J2QB 2MYFA 2MGZB 3HHEA 4M5HA 5F8NA 2NSBA 1YHQS 3JQJA 1ZAWA 3GJSB 5L1LA 3AH6A 5I3UA 1U49A 1T95A 3JS9A 2YH1A 2HFZA 2Q6CA 2CADA 4RWXA 5B0DA 4WCEQ 3RB3A 3FRYA 1S59A 1UFWA 3M6WA 1NJIT 4CTAB 2O01C 1P9YA 1SUQB 2ZHOA 4ILRA 3T5JA 3HSJA 3K59A 4Y65A 3Q22A 4C11A 2HVHA 4H4MA 1YRTA 3KJFB 2R7UA 2ALYB 2XCPA 1CJVB 3SYZA 2GV1A 3I4HX 2AYEA 2X51A 2JL9A 4UOGA 2QLXA 3FFIA 2CNLB 5D15A 2G2ZA 3O2IA 4DV6F 4K50A 2DRAA 2RVJA 1AFIA 3T9NA 4R0EA 3ENAA 4DQSA 2QJ3A 4P9SA 3QT6A 4QR2A 3KMSA 4EZ6A 1Z1ZA 4PCQA 4LF7F 2LLZA 2L9WA 3MEGB 1JQGA 4RBTA 1YKWA 3DOMA 3HHNB 1N0UA 3CJ2A 2BQ3A 4M8LA 3QAUA 1KVIA 3M8QB 5DG8A 1NNDA 1YRXA 3MFHA 4JI6F 3CULA 2RF2B 2XHWA 3EX7B 2HVDA 1TK8A 1JX4A 1RAGB 2CPJA 3HCXA 3VHQA 3ZTSA 3OV7A 5F0UA 4HI1A 1K1QA 1VHIA 1Y5NB 1XNQJ 5A0YA 4JB8B 1X0FA 5HK4A 2JEGA 5KAKA 5T14A 1DQAA 1Y0HA 1HBUB 2WZ1A 2VQFF 1JLCB 4BC9A 4MFBA 4IFYB 2C2MB 1U1KA 4JYAF 3E8OA 1E6YA 4N41A 1WF1A 1I94J 3K5MA 1RBOB 2KJWA 4W92B 3D5MA 2WW4A 3LOUA 1IKXB 1FA0A 2CJAA 3ICLA 3KXDA 4F3MA 1GNKA 1S9EA 1HWKA 1KDNA 3A8EA 1KP6A 2XY6A 2PO4A 3JQMA 3UW1A 4V19J 3JTPA 4GKJF 4KKOB 1TKZA 3AA9A 4ICLB 1SQGA 2XNRA 4DF4A 2IC3B 4USIA 3KFWX 1ULRA 2BXJA 1HD0A 1WEZA 2G9OA 1C2PA 2HQDA 2MZSA 1B70B 4FNHA 2CQ4A 1SJFA 4HR2A 1RAEB 2XI2A 2EFPA 2DGUA 3M8PA 3DRPB 3WC0A 3V4IA 1U2FA 2FLNA 3BSAA 1SH2A 3VTIA 5F8MA 4Q8FA 4JI8J 3H4DA 3CWJA 3CJKA 2FVSA 2XMTA 5LJ5Y 4DBQA 3VGTA 3TUPA 1B7YB 2W2OP 3TOQA 3JQKA 1CS4A 5A8KB 1B4SA 4M94A 4DR4J 1UVMA 4L3NA 3N79A 2W8LA 3C14A 5HQMA 4WBFA 3FJ2A 1PGZA 4ZLJA 2CQDA 3PJXA 4QPTA 2XZDB 3IMQJ 3O3LA 5IV4A 4X2BA 3HZGA 4Y2AA 4OYPA 4N56A 4ZVEA 4OI0A 3WX8A 3CJRA 3OR2B 2R2SA 1B0TA 1RAIB 4OX7A 2HHWA 4DPXA 4CM0A 3C6UB 1IJFB 3MAAA 5GADU 2QMUB 3DDKA 4L73A 1GXLA 1SJ3P 1N34J 3P49B 1V5IB 1Y10A 2B4OA 3R9LA 2HWIA 1PCAA 1ZOTA 2KHDA 3I0SB 2RILA 4U8YA 3OR1B 1T0TV 2OPPB 3LAMA 3VAHA 1X9MA 2KL8A 3ZZRA 3W8PA 3M9OB 3R8YA 3D0GE 1Z2LA 2I5JA 5GAHU 2AQ4A 3IBWA 2CKWA 1QY7A 5D6GA 2AF6A 3TAPA 5D77A 5LXYA 1MNEA 3OVAA 2B4PA 2B6AB 4ZPVR 1S6PA 5EGYA 2UU9J 3MPWA 4PG8A 1H7XA 4PG4A 2HZVA 1TK5A 4LFCJ 2BJ8A 2OI2A 3DYAB 2KG1A 4LFBF 3IRXA 3RAQA 1PIEA 4L6V3 1LW0A 4LSZB 3UQSA 3KK1A 1S1VB 1U0SA 3JYTB 1NSAA 4LVOP 1S48A 3DLGB 2NREA 3A8KA 1CG2A 2YWHA 2V8HA 1U1RA 3O5TB 2VUGA 2VU5A 1CQNA 2LKZA 2UXCJ 2G13A 5IWAF 2ZOGA 1FO1A 4CLZA 5B0GA 5F9NA 2R8HA 1TL7A 2YKMB 4PUOA 4JV5F 4TQRA 1FTRA 2HS0A 3BN7A 5IC4B 1SPBP 5H9FJ 5KFJA 3W7BA 4TU7A 1RXOB 4J9SA 3DRYA 1Q81T 4C98A 2KYXA 3J7YI 1M5HA 4ZCLA 1TELA 3HMJG 5HO4A 1EAYC 3T1HJ 1NAQA 3I4PA 1HMVB 5AXMA 4DR4F 1M1KT 2DEIA 1U8WA 1YJ9S 1UKUA 4CO5A 3FQKA 4USUA 5L46A 1JLEA 2W8KA 1RT7A 2NXEA 3UCZP 2E44A 1RGVA 2E1AA 3IFEA 4M5JA 5AE3A 3A3NB 2ACMA 2CQ2A 2ZVSA 2AD9A 4F2SA 3MMCA 4FP9A 1Q82T 3S6EA 3R7SB 4DL2A 1RT4A 2BKNA 4O4RA 3PYDA 2RE1A 1X4FA 2ZJQQ 4FF2A 4YDDB 3X3UA 3IG1B 1RT1B 4ECYA 5EWEA 3H40A 1T94A 3TI0A 4RO0A 4PR6A 1Y00A 3OUYA 3TZYA 1C4CA 4Y34A 4AE5A 4U8VA 2JSXA 3V81A 2V68A 2QA4G 1LFPA 1RKIA 2DH7A 2W1BA 1TL5A 4MYTA 4DCPB 4ALZA 1NB2A 4NASA 3UD5A 4EBEA 1WKJA 2KT5A 2QLJB 2RAQA 5KFAA 4X4OA 1D1UA 1XR7A 4QWDA 3MEEB 1DTTA 3NP5A 3SV4A 4G3IA 1RWMB 2DNHA 4USKA 4B9MA 2HBRB 1V3SA 1SUQA 2B9XA 2PMWA 1IJEB 4C3KA 5A8RB 2AYMA 1H72C 2IRUA 2XMJA 3ZXWA 3M9MB 1EARA 2HW3A 3SIPB 1P6TA 1S1TA 3GR1A 2RT3A 4MKVA 2LA4A 1R0BG 2BM0A 4I4BA 5L8RC 4KHMA 2CJKA 4IR1A 3HI9A 5I3QA 5FDLA 4OHWA 1MU2A 2GHWA 4QBUA 2CQPA 3FDSA 4M95A 3GU0A 1VBXA 2KM8C 3IRWP 3IGNA 3KLEB 4HLBA 2OSRA 1JK9B 1FX4A 2ZKTA 4ZMMA 4ZJQA 1M5OC 3T3FA 3KNGA 5KFFA 1JXEA 2DGSA 1NJYA 4K2JA 2OP5A 1D3WA 5LOQA 2WVBA 3I5BA 1PBAA 3CJSA 4C0OC 4JI4J 4UUXA 4NCGA 3R1LA 3RJMB 3M8YA 4UW2A 3BKTA 3OFHA 3VZIA 4E98A 4GO7X 6FD1A 2EFNA 1RT2B 2CNKB 2ZITA 1HNXF 1UZHA 5KFMA 5J2MB 2K7KA 4LRDA 4UQGA 2DO0A 1UETA 4AD6A 1RWPB 4GVBB 1KFSA 1FDBA 3TVZA 1XMQJ 1CBKA 1GX5A 2X3DA 2H1YA 3KK3A 4JI5F 2XS2A 2GNKA 3BH6B 1X31C 4HI2A 1WKKA 1PC4A 1JLFA 1N6QB 3BF4A 3EDQB 2UU9F 1YZ6A 4TY8A 4K4XA 2BQUA 1LK7A 1G7CB 5HVFA 4IG0A 2L9NA 1D9FA 3B4MA 1JNRB 2VBYA 4DV1J 2GCFA 2OTJS 1DLOA 3DM2B 3IN5A 3KLIB 3CCWA 3SCKE 3TJ8A 2AJ2A 1PAUB 4RW6A 3R5CA 4CP5A 3CB4A 1FJEB 1RTJA 3JSRA 2QL7B 1PBUA 5B0BA 5FLXU 2NXCA 2YKPA 4DR1J 2IM2A 4K8RA 2UXBF 3ENVA 4OZ1A 3W60A 5I3UB 1S97A 2KXNB 4LQ9A 1BQMA 2W4DA 3JAMY 1L3TA 1JXVA 2CPIA 1JJHA 1JKHB 1J5EJ 2DNRA 4UOHA 5FJ4A 1YWXA 1REGX 2EI5A 2KYZA 2QYCA 2XG8A 2XMWA 1VRUA 2F9JA 1LW2A 2WHOA 4OYBA 1MLAA 3PRBA 1RTIA 3M8ZA 3FUYA 4FN5A 5HMWA 5I42B 4E8UA 3KMQA 2HVIA 3D4JA 3FKBA 4RNNA 3KDOA 3MMAA 2WSCC 1HI8A 4OI2A 2CJ9A 1RBAA 3CD0A 1EKRA 1FDAA 3MECA 3QAEA 2WVEA 4IDKA 4QQBA 1DQ8A 5BR8F 4XO0A 1KR4A 5B7WA 2NPFA 3HZEA 1U02A 2I38A 2ZKUA 2YKQA 3NGRA 3H8YA 3KHGA 1X4GA 4B3SF 2WK4A 4DXLA 2CFXA 2R7VA 1REVB 2RS2A 5F9LA 3IAM9 1GTEA 4ED0A 1M5VC 1VGYA 1SC4B 1X4AA 3H90A 1X0PA 2VFVA 2PI5A 4I1TA 3PX4A 1CC7A 4JOUA 1SXLA 1S6PB 4DCJB 3PW7A 3D6HB 3AOCA 2V2ZA 1PYSB 3AODA 1S49A 1OWXA 4U95A 4USHA 5CABA 1Q8IA 3WQPA 1FJGJ 1SL2A 4ZA1A 3CO0P 2Z8QA 4LRBA 2G2YA 4EI2A 3K5OA 3FQLA 2ZHBA 3W9JA 4CH0S 4P7VA 1N5SA 1KLMB 2CJQA 2KXHA 3DLKA 3EJMA 4TY9A 2KT3A 4B3OA 5HJXA 4KHPF 2JNJA 4X4VA 1I5OB 3QIDA 5E3PA 4UY8T 2JH3A 3HFVA 4LRFA 1NDPA 1RSCA 2OSQA 3EM1A 5THWA 5LL6d 9ATCB 1VYAA 5KG7A 2W7PA 1ZYQA 5HP1A 4K0KF 1KS2A 2DNZA 2ZNYA 4WK1A 1RT3B 2CZ4A 4OYXA 1FNXH 3KLFB 5AXNA 3IBCB 1M90T 1KHWA 2ZJPQ 1KONA 3I5CA 5D3GA 5CH7B 2EK6A 1TKZB 3G4SS 3VAGA 3M1VA 2VFTA 5DDQC 1IM4A 3ZZYA 1TKXA 2HG4A 3SFUA 1AA1B 4R0JA 5DDPC 4MK9A 2ATCB 2AJQA 2B7CB 3ENWA 1S4FA 3CT9A 1NBEB 2I5JB 3GIRA 3AFGA 1HW8A 4ED5A 4Q8EA 4DUTA 3RG6A 4OHVA 1RK8A 1NDCA 2L3MA 5D4OA 2F8EX 5G4DA 1YVFA 5HATA 4X62F 2R8JA 3VGVA 3QSIA 1JLCA 3DN9A 3PW5A 1NCLA 1MMLA 2ZEJA 2BMBA 4OI6A 2IYIA 5J2PB 3OL9A 4WKRA 3OFGA 3BO3A 4DF8A 3VZHA 3IO1A 2MQMA 5LMUF 3MMCB 3KJNB 1RT6A 1TMMA 1Q78A 4JI4F 2YPYA 4WF9Q 1NLKL 2MLZA 2O66A 2WW8A 2FJEB 3H59A 4J9VA 2G2OA 3UNYA 4F4AA 3Q8SB 1FX2A 2NXNA 2HVZA 3G87A 1G6BA 4TLQA 3J81U 3N6LA 5CQGA 3BSOA 1RHQB 3GFZA 4RWWA 1U48A 1HNXJ 3IWNC 4FDFA 3NOCA 2QA2A 3ET6A 2Y1JA 4QW9A 2LU2A 3EUNA 3IA0A 3W9IA 4DUZJ 5DZ7A 3AJ1A 4RUBA 5DQGA 4HVZA 5HI7A 1ROFA 4ED7A 3NWGA 1VR6A 2MDAA 4DU8A 4K7QA 4WFYA 3Q24A 1PO6A 2J9DE 4DSFA 2FJVA 2QL5B 3I6PA 4J9LA 4PQUB 1GMUA 1XMOF 4PG6A 4TKTA 1T05B 3DLLQ 2DPJA 2EK1A 4DZ6A 1H6KX 3GSIA 2BE2B 2ACYA 2CA9A 2W9CB 2RIJA 5KFIA 2XMUA 5B0CA 1R27B 4HL9A 4BLGA 1UVKA 3DGVA 5JJBA 1T3NA 2BKPA 4KGZB 2M2BA 5DQHA 4LBHA 5CHCB 4IUFA 2IVFB 1WDTA 4P2FA 4V19X 2F63A 4KRWA 2IPOB 4TY8B 3CXCR 5ETKA 3ITHB 1B7FA 2VODA 5HMZA 2D74B 2XHCA 2LQ5A 2ERRA 4RU2A 3BGRA 2CNNB 3EXYA 1HA1A 1BWVA 1M5SA 4LF7J 3UFCX 4O4GA 1QD1A 5F41A 5HBMB 4USTA 2OEJA 4I2QB 5LXRA 3UE2A 3DLEA 3SCIE 5L39A 3KDNA 2C3YA 3K7RA 2DGQA 2AEMA 4NLVA 2OHDA 4M5LA 4U7CA 2RHSB 5C2CA 2C28A 5C42A 5E3QA 3GCXP 4ZLNA 3MEEA 1C0TA 3MM9A 2BUNA 1ITPA 1Y7PA 1VJWA 1FFGB 2B4UA 3G82A 3HHLD 2HQFA 3ISZA 4TLRA 4YN3B 3TUIC 2EBEA 2K2PA 2XGQA 2B9EA 1RU2A 2ZBIA 4DS5A 4GKKJ 1NK9A 2WSEC 4RNFA 4Q5VA 2B5JA 1RTIB 5I42A 4ZPBA 1KQGB 2GHVC 5KOXA 3PHTA 3UR0A 2WONB 1RCXB 1JLAB 1X5PA 4RUHA 4Z2XA 3BPSP 1HNIA 1RJJA 4GO5X 5AXLA 4CZCA 5GADI 2UXBJ 1N33F 2VKRA 1S7IA 3AJ2A 3AT1B 4ZP6A 2IM1A 4DUYF 5M2RA 1YBAA 2MB0B 4GKJJ 3KNAA 2FPHX 3P6YC 2GIQA 1ZH5A 4OI1A 2Z2LA 1RTZA 2MY8A 1CJVA 2M7SA 2CQIA 2V8GA 1HHSA 4HTJA 5KFEA 4K4SA 2ILZA 1WG4A 2MPUA 1VCTA 1ZA2B 2EFVA 3QRQA 3US5A 4DV7J 3P8BB 4KB7A 2ZUGA 5GAHI 4XDDA 1HLWA 1VC5A 3H4BA 1RACB 5KFSA 3RR7A 2EFOA 3GG1A 1HNZF 4P6QA 2Y8WA 4DOZA 3FVYA 1VK3A 1HMVA 2IJFA 3HSGA 1S72S 2X7IA 2ZC3A 3TRGA 5C24B 2VG6A 1DURA 2IDLA 4IH7A 3AQOA 2NSCA 4UQTA 3CCRS 4DS4A 1U26A 2LEPA 2D3OR 2DR5A 2VOOA 1HQUB 1WOSA 1F0XA 4A46A 2H4YB 4NRUA 1FDDA 2QX0A 3IXQA 1PC5A 3TZWA 2W01A 4I64A 3OJUA 4DFJA 4AQYF 4HT5A 2P9CA 4MFBB 4JYAJ 1JMTA 3D2WA 1H73A 1X5TA 3CCQS 2JLGA 2DNQA 1SKWA 4X62J 3W2WB 1N6QA 4QW8A 3WBZA 4LMZA 4EO6A 1E6VB 2W24A 2E5HA 4ANCA 4K5SA 3C46A 4U7UK 4B9NA 5ETQA 3F44A 5H9EJ 4TXSA 4LR8A 3B6BA 3C66A 9RUBA 2VQEJ 1RTHB 4GRSA 5CYMA 4CYUB 2E5LF 3M9NB 3ZTQA 3DXSX 2CQ1A 1NK8A 2YKAA 1F3FA 4NL5A 4JI2J 1KNZA 3BSCA 1HIYA 5T7LB 2HHHJ 2L48A 1N52B 2CVIA 4OFZA 4PXEA 3B82A 3DOLA 4CT9A 2D7SA 2HFNA 3K17A 5ADZA 1SC1B 2CPZA 5HMXA 3LO3A 1UFKA 4DV0J 5ETPA 3RUBL 3M8PB 3V4IB 1H2UX 2BACA 3K57A 2IA6A 3E01A 2XSJB 2J9CA 4B3MF 3OTEA 2V2QA 3G96A 3Q0AA 3PVXA 2BVZA 3H0PA 3OD2A 4OYIA 2G0JA 1F1BB 1P9QC 4KT0C 4ID5B 4M5GA 3KLFA 2G1HA 2D3UA 5KFVA 1XMOJ 5L9XA 3BDEA 1DARA 3TQEA 2QA1A 4J9UE 3PHEA 1TUGB 1FJCA 5IWAJ 2VHGA 3RZAA 1FRXA 1BE4A 3BBBA 3MEDB 2VL1A 2UUAJ 3PW4A 4YEAA 2GX8A 2DEJA 1R0AA 1SKSA 3VR1A 3W66A 2CPYA 2LXUA 3TW0A 3I96A 5CYQA 3TVYA 5CCMA 5L1IA 2FVPA 2EEYA 2N4DA 2HK2A 3V81B 1VJQA 2IVMA 4LFAJ 1S6OA 4LSLA 2NQPA 5LMNF 2RH3A 2M4MA 4PZVA 3FRZA 2APOA 3JSMA 1RTJB 2YQ1A 3T41A 4IRDA 3NGSA 4U6PA 1V9OA 4YB1P 3OR1A 4C8ZA 1GMWA 5D4LA 2HLUA 4OZ5A 3LAKA 1KQSR 2DD8S 4H4KC 3TAMB 3GQCA 1X7VA 2HS3A 3LUYA 5HAOA 3ZTOA 2XGPA 1YQHA 3R6GB 1S1UB 2KM8B 2DRBA 4S0MA 2GA7A 3SCLE 2DGWA 5BJRA 3M6VA 1MROA 2V9WA 1VQOS 1OPZA 3ZZOA 3MURP 1Q8LA 1UPMB 2VA2A 3RB6A 2KFZA 4MKAA 2YQ3A 4XTTA 3TP2A 3IRXB 4DMZA 3G6YA 1PYOB 2W2MP 3CCJS 4DQIA 3MM6B 1G3OA 1PILA 1YX2A 2AWZA 1UZDA 2WCXA 4H54A 4CYUA 4JI7J 2B9YA 2E7XA 3LA0A 4YP3A 4P71A 4ZP7A 3PW2A 2JVRA 1TL1A 3PFOA 2W9CA 2FHKA 2IRYA 2FVQA 1NB7A 3TJ9A 3LALA 1V3RA 1U0HA 1BQNA 4ECRA 1YBTA 2R8GA 2FUG9 3K8VA 2XS5A 1B3TA 2V6AA 2DISA 3TZZA 4A8YA 5A8WB 1VQKS 4XPEA 2R2TA 1GEHA 3ITHA 2VPYB 1N54B 3PJWA 2LECA 3PYGA 2I6WA 2DGXA 3DMJA 2FLLA 4WFNQ 1AYEA 3W63A 1TUWA 2B8PA 2XULA 4O3PA 4BWMA 1XNRF 3L3CA 1YI2S 2R7TA 2HNDB 5IFMA 5KT4A 4DL4A 1FESA 1S76D 3J7AN 3B78A 4EK2A 2XYPB 4J9KA 3ISND 4A8QA 4GC6A 3QBCA 3CDBA 4F50A 2VV5A 4O0IA 4NMLA 4ILLA 2Z57B 4J9OA 1NKCA 2Y9HA 1IKVB 3HVAA 3HHLA 4BBYA 2J5AA 2WAQD 3CJQA 5D3GB 4I69A 4FXDA 1PG5B 3BB5A 2R7SA 2BANA 1A9NB 3KJVB 2BQRA 2V4JB 2BJ3A 1X5OA 2XY7A 1U1PA 4PQUA 4B3SJ 5BYRA 2VPXB 3NS7B 3A8JA 2GS8A 1WSRA 3GFHA 4MAKA 4KAIA 4URGA 1JLBA 2CAJA 1UJ5A 2ZJRQ 4NZ6A 3NXZA 3C8YA 1FWLA 2VH7A 2W4PA 3F56A 2LYVA 4C8MA 3ZTPA 5CAAA 4QWAA 3HP6A 1HNZJ 5IT0A 3VAFA 4GMKA 2I8EA 1EB0A 3IAS9 4YUDA 2CZVC 4FKXA 2J7UA 4UF4A 4ZLLA 3N28A 4OI3A 1EIYB 3UPFA 3CUNA 2EVZA 4DN0A 2CWKA 4L74A 2YWKA 2QN6B 3EGVA 3B8HA 3HFZB 3V6KA 1AUDA 2VONA 3I55S 1OQ3A 1VS3A 2XYHB 1NJWA 3LANA 4FBUA 3TA0A 5A2QY 4NOHA 2VPZB 1D8YA 2JX2A 3VWSA 4OHYA 4LRCA 1SC3B 5A6WA 3D3CJ 3VVUA 3PR4A 4IH5A 1APSA 1HBUA 4ZPCA 4MYUA 1TKXB 1LV5A 2B8QA 5FIIA 1SIWB 2QV6A 4U96A 3V4MA 4LF8J 3RYLA 5KT2A 4J9MA 4KSEB 1RAJA 3M2VB 3OTOJ 1Y3JA 1WNEA 2FIUA 2BE9B 4OLOA 1W7WA 1HNVA 5CCLA 2ZBRA 2NYHA 3GILA 1S9EB 2M9KA 4DU7A 1KEKA 1VC6A 3S8SA 4DV2J 1T8EA 3O6QA 4KTQA 1T7PA 2FGCA 2GC8A 2MQNA 3O1LA 2YXLA 2B56A 3U7JA 4UT4A 4QZVB 2V94A 2IC3A 1RWXB 2A6MA 2RDDA 4WXWA 4M1KA 2RB7A 1A0OB 1R7IA 1SV5B 4NLRA 4EFAC 2J6UA 3BO2A 1YSJA 2XWXA 3MECB 4IDKB 1XWLA 1UJ4A 2MQOA 2RNEA 3NNHA 3DI6B 1YRUA 2VDIA 3D3BJ 3K5NA 2JOQA 4Z37A 2D1CA 3MR5A 1RCOB 1WC6A 1VQ9S 4ZVPB 2EBGA 3Q23A 2QLWA 2H54B 1JLEB 3DGPA 5E0OA 5K9FA 5JVGQ 1IR0A 2ASDA 2VF3A 3MF5A 1VLYA 5KFRA 1TUVA 4O3SA 4CLSA 2C22A 2DY1A 3G6VA 5KT5A 1WWHA 4QIWD 4KH1B 1EKSA 5DGAA 4O3QA 3KG0A 4DL7A 3CIMA 4WFXA 3RAXA 2EC0A 2V2KA 5KFWA 5AJ3J 4I56A 4F0MA 1S6QB 1GX6A 4LRAA 1YZ7A 1W2IA 4P75A 4RW6B 4X84A 4WTOB 4L72B 5GAEI 5DRKA 3Q83A 4CI0B 1N8RT 4O23A 4PAAA 1RA6A 1JLQB 2H5EA 4ECZA 1FXLA 5L1JA 1G2EA 4AT1B 4LF5J 1MW7A 4DPYA 2UUCJ 3PY8A 5K14A 1RZMA 1SBRA 2FHJA 4RJVA 1RA7A 2J0QD 2QZ8A 5KT6A 2XO6A 2QEXS 3KG4A 2FDNA 3TYTA 3HVTB 2MJUA 3UN5A 4AL7A 1HQ2A 5JVHQ 2DBBA 4EMDA 5AJ3F 2R7XA 1VFJA 3D68A 3DRXA 3IC1A 3NS5A 5CYMB 4C8LA 2DH9A 2ROEA 4IRKA 1QE1B 1S1WA 1ICEB 3PYFA 1SKUB 1F9FA 4KHRA 5IOLA 1ELOA 1YJVA 3PJ9A 3QGIA 2VG7A 4DX5A 5D0EA 3GIIA 4NXNF 1K1SA 2UXCF 2HRTA 1GMWD 2C42A 4OYWA 5ITHA 4YB7A 3CJKB 1KVKA 2CNOB 2Z30B 3R5GA 1JXLA 1SL0A 3KLVA 4IRCA 5EWFA 2QC3A 1K9MT 1RI7A 3CVKA 4J7CA 1NDLA 3C6UA 1UJ6A 3KYLA 4UY85 4QYZJ 1SJ4P 4B17A 2KFYA 2AT1B 2BR0A 2XSJA 4ANEA 1PAEX 5J2PA 3OPKA 3G6ES 3HKWA 4AUKA 3RRKA 2HQ3A 4GKKF 4KGMA 3ELHA 4NA1A 4KPCA 4ZVGA 4WE1B 1LOUA 4LFBJ 3QSYB 4WP3A 3QNWB 1S57A 5EX3A 1N5YB 2NZ4A 2V8DA 2VPWB 3OLAA 3GV8B 4NCGB 2DHSA 1HWLA 2MMYA 1FVSA 1GTHA 2AJ1A 4ANDA 2Z2YB 1NK6A 2YNIB 1A6LA 2OFHX 1BMQB 5AE1A 1RT2A 5HQ8A 3QGPA 3MUMP 3BN4A 4CLTA 3A12A 3R7BB 4LFAF 4PRFA 4Y2KA 4X64J 1KRPA 5KFOA 2MZRA 4ZDNA 2XLJA 5F8LA 4YR3A 3MFIA 2ZH1A 3Q89A 1KKHA 3BV8A 4EYIB 3VAIA 2M52A 1YBUA 1RTDB 4A47A 1VC0A 3MMBB 1RADB 3I0RB 5BXIA 3BYPA 3LP1B 1H2VZ 3MWBA 1TL7B 3N5FA 2GGPA 3I31A 2VKZG 3TO8A 1CJUA 1X8DA 4CRJA 4DR5J 2J8AA 3PCOB 2B5JB 5K20B 3NEKA 3M8SA 2DR8A 2UXDF 4FF4A 1B64A 4UOFA 2CVEA 2K1RB 1HBOA 2BE7D 1KOOA 2GJIA 4F7VA 4J9RA 2IVYA 3H7HB 4QYZK 3R5BA 4YHHF 2HZCA 1P27B 2FZGB 4MMOA 4UOCA 3FZBA 4ZK7M 1KLNA 1U25A 3IM8A 2ZH9A 1S0OA 1QTNB 1LK5A 1IKVA 2H4WB 4C0BA 3L7OA 4IO9Q 4ZVFA 4QU6A 2ZZNA 3CJTA 1Q4RA 1U4BA 4JV2A 4ECUA 3W2VB 2LVWA 2NLWA 3OVSA 4X4UA 5ETNA 2R2RA 1SJQA 1LKZA 1GK8A 2DITA 2GHPA 3R6LB 1ZS6A 4KIAA 1K44A 4CLLA 2E5GA 1RAOA 1J5OB 3KOAA 3QFHA 4MT1A 3DHXA 1U7LA 4KGVB 2YKOA 3MCNA 4BC7A 2IM0A 2ZOMA 4RUCA 4P73A 2AP6A 1AZSA 3NY0A 4FNIA 4H4MB 3BO4A 4RZRA 1UA1A 4W90B 4DFPA 3FCVA 2LP4A 4NI2B 5LM7E 3WC2A 4DV2F 4DR7J 4CNZA 3EMTA 3CCMS 3NG8A 3FFIB 4PQAA 2E9TA 3EZUA 5HN0A 3X1LB 1FF2A 4OL8A 2A2CA 1OJ4A 3RAMA 3OSNA 1RWOB 1U2RA 2V9KA 4X65J 3MUVP 4K4VA 2JEJA 3I5AA 3OHAA 4NXMJ 3SSQA 1HPZA 4A4JA 4RW8A 1C0UB 3MPDA 3F41A 5J2QA 2OPQA 1VQMS 2IJNA 1LNQA 4G1QA 2GIRA 2GQ2A 4ZITA 1YGYA 3THVA 4E0DA 5GMEA 1UVLA 2J9DA 2EC2A 3P5BP 2RRAA 1EJ7L 1EQMA 5F3TA 1FFSB 8RUCA 4XIUA 3CMAS 2AYGA 1BGXT 1RAHB 3RBXA 1RWNB 4OYZA 2NR0A 2ASJA 2DHGA 3CMES 3QQCD 1RWVB 3I32A 1ZPWX 3N01A 4OV1A 2ATLA 2CUYA 3TANA 3G82B 1R8CA 3D66A 3QT8A 3GYGA 2CQ3A 6FDRA 3RTVA 3PX0A 1HPZB 3CGIA 4B02A 3POTB 2AW0A 3Q86A 1RQ0A 2MQQA 2ILYA 4WJBA 1UEVA 2PFDA 4ZKAA 3HSZA 5GAGI 4B3TJ 4OX8A 4BDPA 1VOMA 3H98A 3UVJA 4ERDA 5DDRC 4B9SA 3OVBA 3KWMA 1U45A 3M8WA 2YNGA 1VQ8S 1XN9A 4KC5A 1S10A 2O5DA 1FJ7A 4F0KA 5IXUA 4IOCQ 2R8KA 3GJQB 1FEHA 3EWGA 3ILIA 4I7FB 2OPPA 5CD4A 5E33A 1BQMB 2MTLA 1UW9A 4NX9A 2YWEA 1OPIA 1FKPB 1OYDA 1K73T 1Q7YT 2DXEA 4DV1F 2PMZD 3POTA 1VBZA 1J5OA 1T11A 4ES2A 1UWBA 2RS8A 4R25A 4DV5J 2KT2A 2MKYA 4J91A 4ZVHA 2JC1A 3MAAB 4NZ7A 1NK4A 8AT1B 3PO5A 2R3VA 1FRJA 1FXRA 3WIVA 1HQEA 2WRMA 4LT6A 4AQYJ 3DRSB 5D4NA 2XCAA 1QVFR 3R7NB 2DT9A 2LFVA 3GZ7A 3LP0A 3FK4A 3C19A 4XDCA 4ZVQB 2Y1IA 1RU1A 2AZ3A 3OR2A 1SH0A 1OY9A 2V63A 3C3LA 2RDIA 1Q53A 2GAHC 2V4RA 3BZQA 4U7UD 2QO3A 4GVBA 2KVIA 2M8DB 3NOGA 1DRZA 1BWEA 1DTQB 3M30A 5BYQA 4NYZA 4N76A 2RU9A 3ZC4A 3M2RA 4RKUC 5F8JA 1X9SA 1F60B 1HI0P 1V3ZA 2HFOA 2DH8A 2OEKA 2BANB 1RDRA 2IJRA 4L75A 3CCUS 3A13A 4CM2A 1UPPA 1KSPA 2XZTB 3CW2C 1F2GA 1N48A 2B7BB 3GWCA 2LXFA 3OXLA 1TV6B 4ES1A 1S1XB 3O44A 1UA0A 4ED6A 1WD6A 3AHPA 3NCRA 4ID8A 3CJ4A 3U27A 4CNYA 1AXQA 4M5NA 2FJXA 4DL0C 1U1NA 3PEJA 2GVDB 3ONQA 3VGUA 4DN9A 3BPDA 4IO1A 3R27A 1TFWA 2KFNA 2XLKA 4YOEA 3JXOA 3BGLA 5H9FK 2DHXA 2N3OA 1JNZB 2J6TA 1RP5A 2OELA 3GJRB 1KD1T 2C2NA 4C7QA 2GZOA 3OHBA 2UVRA 1KTQA 2GJ2A 3D1OA 4ZPTR 1ZAVA 4IR9A 1VQLS 4ELVA 2QFIA 4KO0A 2UUTA 1IXKA 4H4OA 1IUJA 1WF0A 1VMBA 2DRDA 2PE8A 3AJDA 2NXJA 4IFYA 4WWSA 1B99A 3UN3A 3W2VA 3WHIA 2I2YA 4NXNJ 3G9CA 4NYPA 4FZVA 4G1IA 2JWNA 2YNFA 1N36J 1UVJA 2OJ3A 1XK8A 5FLXY 3ZZZA 3ETOA 5FDLB 4TU9A 1OY6A 4F4XA 4P2MA 2YNHB 3H2UB 1F6TA 3W61A 1U47A 4NCAA 3CDAA 2JHEA 3CD6S 4W4MA 1HNVB 2FC9A 2WOMB 3NGUA 5KFTA 1NPKA 2J8SA 3MTKA 3W5XA 3M6UA 1WDDA 4LSNB 2CRLA 4QJVA 3BGOP 5L9NA 4X4SA 1TZ0A 1L3VA 3OTOF 1N34F 3OT9A 4DSIA 2E5JA 3KJQB 2GGPB 3OL8A 2PC6A 3DU6A 5CZXA 5F0WA 4Y2CA 2D9PA 5D0RA 5K14B 3CCZA 4R8UA 2HBYB 1TKTB 1XNRJ 2NS1B 3EXCX 3H5SA 5KG1A 3TEHB 4JV1A 3UCGA 2ZFHA 2N82B 1HNWF 4AL5A 1JJCB 1NPPA 2UV8A 1HBMA 2KO1A 3FBFA 4TYAA 1VRTA 2HVEA 5D78A 4FYVB 1DLOB 2P2CB 3DM2A 3EE3A 3UN2A 4ER8A 1RKJA 3QRPA 3J7YU 4P2XA 2C3MA 2J7WA 4V1Ak 2DB1A 3CCLS 5K8PA 3OW2R 2E9ZA 3ILOA 4WFZA 5ETLA 1KFDA 2KRRA 4DUZF 4A8MP 3NMAA 5HROA 4I6AA 4ZN1A 2BOPA 3EZOA 3RU0A 4NYOA 4MK8A 3QJJA 4I68A 4IG3A 5CXTA 1CJKA 2DXDA 1UW4A 2DKOB 3GFYA 3MPVA 4ZJOA 2LQJA 5C25B 5MLCV 1X4EA 2HHHF 5EX0A 2ZDPA 4F0HA 1D9AA 3BM7A 1U0HB 2DR6A 4RNMA 1N33J 2NXUA 1UVIA 3M05A 4OX9F 3PX6A 2L08A 4DG1A 3DDNA 4NEZA 4I67A 3SSSA 4CO2A 4LBIA 5JUMA 3GTYX 2R7QA 3PV8A 2DO4A 2XZWA 2RU3A 4ELUA 4F8RA 2FHMA 1NSPA 4LF2A 5KFGA 3T9ZA 3QJLA 5E5NA 1R31A 4IG0B 4BCAA 3I56S 3WX4A 3J80U 4A8SA 3LPEA 4JI3J 4JI0J 1IKWB 4ZP8A 1H98A 5C25A 3TUJC 1XC9A 1X4DA 1L5UA 1GT8A 4CLPA 1S4EA 4OQJA 1TFYA 2AHOB 3GONA 4B3TF 2YNHA 2YKMA 4PUOB 2VG7B 2ZOFA 4PKDB 4C8NA 5KFNA 1I94F 1IBLJ 2BV3A 3FC9A 4MIAA 4U9RA 5HLFB 1FERA 3MEKA 2ZH6A 2KZMA 1OS5A 2LXIA 2XMKA 3HX9A 3DRRA 2FY1A 2VZ9A 4WIIA 1QSYA 3BGFA 3MUTP 1T3OA 2ZH8A 1FT8A 2F4FA 4DR1F 4TU8A 3MAHA 3KTQA 2Q1LA 2GO9A 5SUHA 4R8UB 2DR7A 1ZTWA 1M1GA 4LQ3A 2K1RA 2QIFA 3MM5B 1RB0A 5A76A 5C2GA 4ECSA 1U1OA 2W9AA 2B0GA 5U47A 1TVRB 2ZWOA 4FYWB 4DPTA 2OD6A 2QRRA 1CJUB 3DFEA 3FSYA 1FDNA 1WHYA 5CYQB 1S9GB 4DDFA 3QIPB 1AW0A 4Q43A 2KN4A 4O4GB 3C6TA 1SKRA 2YPZA 4K2XA 4UZCA 1EP4A 4JI8F 4ETZA 2D3O1 1N5YA 4C8KA 4O3RA 1KQFB 2W4CA 1IBMJ 1RHMB 1CC8A 3FCWA 3HSDA 1M5KC 3FEZA 2GIFA 1S5ZA 2HWTA 4F3QA 1DZ5A 1YK9A 4OZ2A 1HL6A 4DL5A 4IQXA 1FRHA 1JJ4A 4AYBD 2KJVA 1NZ8A 2ZNZA 1Z2ZA 4USWA 5HQLA 4HT7A 2OUGA 1RT3A 4U67Q 2HNYA 2AZ1A 1QUPA 4HDHA 1S1XA 5KFXA 3U1LA 4D3HA 2BE2A 3D1QA 8ATCB 4J9NA 1WOPA 1OSCA 1ZPVA 3IS9A 1TL4A 2IAJA 4PWDA 3GE9A 1YITS 2QGFB 4RNOA 3DLKB 5EWGA 4B3OB 1KLMA 1K47A 3HVWA 5AT1B 1QAIA 2CYYA 3W64A 1KBRA 2LEAA 3L4BC 2OMLA 5FD1A 4LF5F 2Q6BA 1OY8A 4KV8A 2HWHA 4GVLA 1ZBTA 3AQPA 2MLYA 3W5ZA 2ZM6J 1XEZA 3NNCA 4NLGA 4C8YA 1S12A 2MHEA 4NLOA 3D6FB 1Q95G 2DGTA 3G8TA 3AB4B 2LMIA 5J1EA 2WVDA 2MZQA 5IV3A 1N32J 3SDEB 1WG5A 2Z0GA 5HJYA 3FSXA 4K0KJ 4PWDB 4QU7A 1D0EA 1X4CA 1ZZNA 1ZM2A 3FEXB 5LT5A 1RYRA 4DSKA 1C0UA 1T9XA 3SXLA 4ECXA 5ETVA 1SJRA 3M8RA 5DM6Q 2HMIB 2ZM6F 2VOPA 3KKFA 1I51B 2FJBB 5B0EA 4DPWA 3KHLA 1U24A 3G71S 3V6DA 2IMWP 1Z4UA 1NU4A 2ZE2A 3PDNA 2FZCB 2DJWA 3S1TA 2VBXA 4O44A 3Q8RB 2HNDA 1P1TA 1VRUB 2Y0SD 1X4HA 1JJ2R 3GSDA 3MPUB 4FYXB 1NH8A 1WC3A 2RRNA 3CNQP 4KQZA 3E3XA 1NZAA 1HFEL 5L38A 4CLWA 1WHXA 3ET6B 4P2SA 3MZIA 3TWZA 2PI4A 4DV7F 3UVJB 3OJSA 2LEBA 4FS2A 3K2YA 1SCJB 2CZ9A 2I9SA 4LJMA 2ZDOA 3EPIA 1HR0J 3IWXA 1TAQA 4KBIA 1IWGA 2F1FA 4RW4A 3PR5B 2VJVA 2JEFA 5HVHA 5DQIA 4H4KA 3LW5C 3G2XA 1AUSL 2PMHA 1Q5YA 2DNPA 2Q79A 4EYHB 1J5EF 5L1KA 3D0HE 4JI7F 3PIOQ 4P10A 4I6WA 2LQ9A 1XERA 4WTYA 4NCBA 6AT1B 3NBPB 3M2UA 3RBZA 2FVCA 1H3DA 3HHKA 2ZH3A 3TA1A 1TL3B 2C3PA 2RSQA 1S9FA 3NNAA 1X9WA 1D09B 3I9V9 3AXMA 3NGDA 4UZBA 3SFGA 1T03B 4EEYA 1O0PA 4QWCA 1K0VA 2W2NP 2QSWA 3MM9B 3I0RA 1TKDA 2WBRA 1U8SA 2F8MA 3T5HA 2UUWA 2YKNA 1LWCB 4MKBA 2EWHA 2J0WA 5KFHA 1RT6B 3K58A 2I1RA 3EGWB 4LREA 4LF4F 1NKEA 3BKFA 2R9LA 3DLEB 2SXLA 2XI3A 2F7VA 3E01B 3GYXB 2ZWPA 3LQVA 3L9ZA 4I2QA 4IOBA 4NPOA 4M5DA 2RMLA 2X1GA 4MIBA 2FJAB 4NI2A 4KH0B 5M2UA 2FLPA 1URRA 2AMCB 1Q16B 2HPUA 1YG0A 4YB5A 3AOAA 2YH0A 3R5AA 3QRRA 3UWTA 2Q66A 1MG7A 1NK0A 5G0RB 4ICLA 2AJ4A 5AE2A 3EYZA 1FKPA 1BLUA 1MWQA 2D9OA 2F9DA 2GMJA 2KH9A 2QA4S 4RU9A 4Q0BB 2RUSA 3C14B 3MEDA 2F4VJ 2DNGA 3VQSA 1UAWA 1BC6A 2J0XA 3LP2B 1R3NA 3THTA 2W9BB 2VIHA 1T9VA 2PFFB 2N3LA 4ZVRB 1LEOA 2H65B 3I87A 3W1YC 4K5RA 4ECQA 2L9DA 3DRSA 3SQGA 4WIQA 2W25A 2NPIA 4DG1B 1D9DA 4HHUA 3VALA 5A0YB 1FRLA 4KO0B 4Y2MA 2COLA 3T5KA 3U02A 3EVMA 3MMBA 1IBKF 2OPSA 5JXSA 2KVQE 3QGHA 2PEBA 1Q86T 3L09A 4A8KA 2ZH2A 5HLFA 1WEYA 5EUHA 1FD8A 2HURA 2DXFA 3HD2A 4NLSA 3QZ7A 2WTFA 5GVQA 2AX0A 3CMQA 3QPIA 4M5MA 1GMVA 2ZD1B 3PYEA 2VASA 2WONA 1JLQA 4PG5A 2BDPA 2Z56B 3FBCA 3ISNC 3LH2S 5LMUJ 1N88A 1TV6A 1XTZA 2GAGC 4B3RF 5D4PA 3NWRA 3A3OB 1EHWA 1OO0B 3GG0A 1DJ0A 3BYRA 2ZVIA 1W25A 2OPRA 4ZPWR 4K4UA 4KGKA 3C15B 3N9UC 2N7CA 2GVDA 1NJZA 3UR3C 2M3DA 3VAKA 2H51B 3EVWA 5IC6B 4ED3A 1F2HA 4HACA 2M5YA 3HHDA 4OZ0A 3SBMA 5HBMA 2M0GB 5E3AA 1SQEA 4XK8C 4A8WA 5G0RA 4J9PA 3C2PA 1KTVA 1OSDA 3LP0B 3W3SA 3DMJB 1RBLA 2YX1A 2PGCA 3P4UB 4B9TA 1CVJA 4PWWA 4M63A 3KJVA 3GCWP 2E29A 3R2CJ 1VRQC 2ZZTA 1PJ6A 4YQWA 4KPYA 2CG4A 2EG2A 2GW8A 2LA6A 2Z2MA 2GVZB 3ZZPA 1N56A 1BHNA 3M32A 2A3JA 3M30B 3N6NA 5HVGA 4YY3F 2LQBA 4LR9A 5KG5A 3BDPA 3QO9A 5M2PA 3CC4S 7FD1A 1UWBB 3JSYA 5A6PA 1X60A 3BGUA 3PEHA 3W2WA 1U1QA 1NH7A 1GFWB 2X1AA 3RBEA 3PZPA 1XJWB 2BJ9A 1NPRA 1WJ9A 2BX6A 5RUBA 2HNZB 4DUYJ 4ETXA 1JLGA 1QAXA 3G6XA 2N7YA 1HWJA 3OL6A 1H2TZ 2BKOA 4ZP9A 1Q5VA 2J76E 2R2UA 5HROB 1T9WA 4XAKA 3TARA 2HHXA 1XMBA 1PJ7A 2VDHA 1FFWB 1IN0A 3CC7S 2RKIB 4ZS6A 2DTJA 3A3PB 2MZJA 2DNYA 2VD3A 1WG1A 3IG1A 3HXMA 4ENOA 3HM9A 2HRUA 1VHFA 2I0XA 2Z4PA 3GIKA 4OYAA 5KG4A 2D3ZA 1TR0A 4LSLB 1S1VA 2V50A 3O8WA 2EKNA 4KR0B 4MTPA 4RPFA 4URSA 4CO1A 3LWLA 1NO8A 2OFGX 2G4BA 1HNIB 2B3TB 2HQGA 3AOBA 4FKYA 4DJBA 2MSSA 4IFVA 4N7TA 3W8GA 1SJ1A 1T03A 1IWAA 4FF3A 3S7RA 2DPIA 4Y28C 4FXVA 3AD7C 2OEMA 3BGRB 4WP9A 2HFUA 1YJWS 4MJKA 3DOKA 1K0TA 1AB8A 3HT0A 4I6YA 3T5LA 1RWUA 2UV8G 4DZDA 3MCMA 2BJEA 2HHQA 4KV8B 1S6UA 3ZTRA 2HZAA 1R0AB 3D7SB 2MKSA 2DK2A 3D1HA 3CDUA 3GLJA 5HANA 1KQKA 4X4PA 1T9UA 2ASLA 5C7PA 3JB9k 4QR0A 3GB0A 2BEFA 3DI6A 1HQEB 2IYGA 3VQTA 2XO7A 3KLGB 1EZZB 2OGUA 4P52A 3RBDA 1DBDA 3R2DJ 3OTBA 2FGOA 4JV0A 1HBNB 2FVRA 1LWFA 1R6VA 2LDIA 1F5AA 2U2FA 1ZZFA 4M5KA 1RT4B 1VIOA 5KFDA 2HRYA 3HFKA 1JLAA 4NLTA 5LJ3Y 2JEIA 4DI6A 4DR2F 2NYIA 2KB2A 2E1CA 4F2RA 3RB0A 2HQCA 3QLHB 5KFCA 2JRSA 4EWTA 1FKOA 5A8WA 2CQ0A 3ILLA 2VFSA 2F5GA 5H9EK 1T9TA 1CS4B 2MHNA 3GFXA 2F65A 4FYYB 1IVZA 4O44B 4HTIA 2JFDA 2MQPA 3HVTA 1TL3A 2IBOA 3WIUA 3BREA 1HD1A 1ZA1B 4ECTA 1HYSB 1LWFB 2CQCA 3CD7A 1IR1A 3NKYA 2HK3A 5J1PA 1QTMA 4MKYA 3MM5A 1OMSA 2C2RA 1GAOA 2FYXA 4M5DB 5KFBA 2RUGA 4LFCF 2FC8A 3U1MA 4I2PA 1FTCA 5J1NA 3T1AA 2ZBPA 1G1XA 1O5JA 2CPEA 2QG9B 3QT7A 4ZVOB 3LTOA 2HAIA 1IBCB 4C4WA 1HR0F 2VQFJ 3TJAA 2P5VA 2CJYB 1HKAA 4AXIA 2GQCA 3CC2S 1WHVA 1ACMB 2DYAA 4ZVUB 2D41A 1DFDA 1L3UA 1LW0B 3ILJA 3KK1B 3PFEA 1HI1A 3QT5A 1IKXA 3E51A 2BZ2A 4ZCIA 4YHHJ 3KK2A 1QSSA 4CCHA 3N6MA 4L3KA 1DHMA 1JKHA 4MH8A 5SZTA 3A4TA 1O51A 2XY5A 3ZNUA 1MSWD 3DOKB 5DGBA 1CEZA 1V5VA 2DHHA 4DL3A 1FRIA 3C15A 4N8OA 1RWKB 3QYYA 4DQRA 3FSIA 4N77A 2JJ4D 2YWFA 1U1MA 5B08A 4RUAA 3RRGA 1WI6A 2G1DA 4F02A 2RQKA 2PIIA 1KOHA 4CLKA 5DS7A 3DRRB 3OTCA 1L3KA 1HWUA 1SVDA 2MKJA 2OTLS 3HLUA 5DLGA 1I6JA 4OZ3A 2HLTA 1Q1KA 4DR6J 2QMWA 1WI8A 3ZO7A 3UCUP 1WHWA 2K7JA 4PXBA 2AGPA 3N0VA 5KFQA 5B0FA 3W5YA 1N5VA 1R8AA 3MCOA 3GJTB 3MMAB 4P74A 5F8GA 3MAQA 4TVAB 3DC2A 5BYSA 4DQQA 2VBZA 2BYCA 2X3GA 1KC8T 1RLCL 3CSKA 2Z2ZA 3NAIA 5KG2A 3M2VA 5GAEU 2KKHA 3V6JA 4BS2A 1FKOB 3JSBA 2IM3A 4R5PA 4DX6A 2YQ0A 1VQ4S 1PKUA 4HH0A 1E6YB 3PO4A 1REVA 2NCKL 4NLWA 3E2EA 4NXMF 2P9EA 3NMRA 4LBPA 1WTFA 1HYSA 2R4FA 2ZHAA 1TU0B 2P9GA 4CQ1A 3AY0A 4ZPDA 3JSMB 3NL0A 3MR2A 4NLYA 3CCSS 5T41A 1PSDA 4X4RA 4NLDA 4QCLA 3ZZTA 3H2LA 2UVWA 3IS9B 1LXNA 2A2DA 3K89A 3MTJA 2ZH5A 4Y6IA 1SL1A 1CULA 2PA8D 5DG7A 3CJ0A 2WB4A 5CYJA 1RUSA 1EETB 4X66F 2QFJA 1S1UA 3GR0A 4CO4A 2G0CA 1OYEA 1RTDA 5D0HA 1R89A 1X4BA 1IBMF 4NRTA 4IOAQ 3TR5A 4J90A 1N0VC 4F4YA 2AGOA 2BW7A 4LF4J 2V4JA 3TAMA 2FLOA 2P6TA 4F04B 4IFVB 4C2MA 3J7ZT 4USMA 1H7WA 3TEGA 1YJNS 2FJDB 1T9YA 2YKNB 5HMYA 2OAUA 3PKMA 2CXEA 3BQ2A 2UVUA 2HNYB 1S6QA 3CDWA 4B3RJ 2OPRB 4OZNA 4WKYA 2ZZMA 2YX4A 4WYLA 2B6AA 2MKIA 1YJ7A 1VQSA 2C2KB 4Q45A 4PEOA 4RNHA 2Y0BB 2O3DA 1WTBA 4HHJA 1M0SA 2HHUA 2UXDJ 1ZM4A 2JFKA 2KHCA 2QT7A 2V2VA 2YY3A 3OQ2A 2XMAA 2XC9A 1EQ0A 4G1PA 2CDRB 1DY3A 2OLWA 1FWPA 5A2QU 3M1VB 4KJIA 3IBFB 1RHKB 1FJGF 2IMOA 2E1MC 2H5IB 2RQMA 2YNFB 3Q8UA 4C97A 3V5RA 1WKLA 3OFFA 2MQ8A 2JC0A 3PM9A 4LUBA 4MK7A 4P7TA 4B08A 2OPSB 1ZTTA 1XQIA 1N4LA 4GC7A 3M4XA 4ES3A 1KN6A 4OJHA 4FVCA 5K8NA 2MZ1A 4Y0FA 2XSFA 4ATNA 4C8OA 4O0NA 3CTRA 2VB6A 3D28A 4OJ3A 3KK3B 3A8IA 3T6BA 4DFKA 2DNOA 3CF5Q 2GVZA 3D0IE 4DQPA 2K3KA 2ZD1A 4DPOA 5F3ZA 4Q0BA 1QM9A 2BJDA 2G0IA 1LWEA 3DU5A 3UDLA 3ZZ0A 5CA5A 3TZXA 1R8HA 2HKEA 4CO0A 1I1GA 4RX6A 4LF6F 2Q3PA 1Q8BA 2W9BA 3GIJA 7AT1B 1RHRB 2K8GA 2CIMA 2HFSA 1WC5A 3AD8C 4NLUA 4QR1A 2J9EA 2UUCF 2DCLA 3KHRA 1ZM3A 2XYGB 3V6HA 2FQQB 2Y1RI 4DV3F 4N8NA 2GQQA 1NSQA 2CWXA 1QUVA 1TAUA 1NHVA 3UO0A 3J80Y 2JLEA 2FB0A 3WDOA 3RR8A 1CSJA 1W26A 2A0FB 3ETMA 2B51A 4PXDA 2QSFA 5AXKA 1C0TB 4ZVTB 1YDLA 3CJ8A 4ZIVA 1H0HB 1S99A 2WVCA 2HFVA 3EGNA 1J27A 4CLYA 2MY7A 4OIXA 4ECVA 1J2VA 1QE1A 1S1WB 2Y1LB 5ETRA 1VLOA 3HJFA 4YR2A 3DYAA 2QL9B 1VI7A 4Z7YA 2C2OB 1TP7A 4DV3J 4EUVA 1NKBA 2OKQA 2XEXA 4QWBA 3IR5B 5F8HA 5DLFA 4EO8A 4YR0A 2Z58B 1F5BA 1MU2B 3DNCA 1H38A 4C9DA 2D69A 4X4TA 3Q8YA 2C2DA 2A1BA 1WC4A 2HQIA 1RT1A 5HP1B 4FYDA 2AIRB 5GMDA 5DO2A 2BBEA 2XM3A 4LF8F 4TYBA 3IR6B 1P1LA 2ZE2B 4OX6A 4F4WA 3RGIA 4DLGA 4ECWA 1NRKA 4RL1A 3D6MB 1HNWJ 1RAFB 1LWCA 1VQYA 2HGNA 1SQFA 4WFAQ 4YFUA 2PD1A 2FJWA 4DR5F 5KT7A 4OZLA 2YTCA 3MR3A 2E7VA 2OD4A 1RISA 2LDYA 2JLFA 2XS7A 3MPYA 5DG9A 1VDHA 5IS2A 2FY8A 2HS4A 1F9HA 4CO3A 1C1CB 4A8FA 1S1TB 4YB6A 4HHHA 1CJTB 3TQ1A 4FBTA 3OSPA 5E2QA 5F8IA 2V67A 3DXBA 2AEJA 3M32B 3CCES 3GIMA 3VV2B 2HHPA 3RRHA 1L3SA 1FK9B 1N36F 4RW4B 1FXDA 1MWYA 2PEHA 3CCTA 3B4DA 2F40A 5GAGU 4F4ZA 2XMVA 2FZKB 3HDSA 4CH1A 4I0WA 3T1YJ 2N4CA 3ZFVA 4DEZA 2W7OA 2QLFB 2E5IA 3QWPA 3CJ5A 5E41A 3IR7B 2MSTA 2A10A 3KLIA 4YY3J 4I2PB 4OJGA 2BW2A 3KLGA 3NBPA 3W62A 1Y5LB 1M1HA 1R0CB 5IZHA 1CJTA 2V69A 1XR6A 3KLEA 4IYQA 4DV6J 3RB4A 5JMNA 3T19A 3BKUA 3N5BA 4EU0A 3D54A 3GPAA 1B0PA 2WVFA 1JLFB 3I82A 3PG9A 1VK8A 2ADBA 4Q7AA 3HF5A 3W9HA 4Z7CA 4RW8B 1VQ7S 1QAYA 1C1BA 3MM8A 4OI4A 2O1PA 3A1YG 4C0HA 3BBFA 5DDOC 4LR7A 3JAMU 5KFYA 4X64F 1PJ5A 2AX1A 4FPIA 4JUZA 1T05A 2DY9A 4G6VB 7FDRA 3MR7A 1S0NA 3K8WA 1U6FA 2V0NA 4Q2LA 3TX0A 3HK2A 3R97A 1K8AT 4P72A 5EHHA 1KVJA 4CH7A 1WACA 1RHUB 3GV5B 4J9QA 2DHAA 1MN7A 3OTDA 3EVOA 5I3PA 4Q44A 2VJUA 2CJBA 2DCUB 4DX7A 5HSPA 3EGZA 1GH8A 2MZTA 1NEEA 2BJ7A 1VQPS 5J1EB 4FF1A 3UD4P 2AKWB 2CQGA 5C5JA 3JTOA 3P96A 1JIHA 4ZN3A 1JWWA 2BABA 2HYIB 2P8IA 2C1EB 2AJ0A 3SEOA 3H42A 2VG6B 3SCJE 2DGOA 1XMQF 1AROP 2HNZA 3I9ZA 2W7AA 3RW7A 4PWUA 3DLBA 4EZ9A 1UVNA 2M8HA 3NCPA 2UP1A 2W2QP 4K4WA 1U1LA 3U1NA 1ZM9A 1HBNA 2AYBA 4RW9B 3DCAA 3TA2A 1AFJA 2BRLA 2LQ8A 1UEKA 2CQBA 2FHJD 4RW7B 5IT4A 3MM7A 1TK0A 4WP8A 1CPZA 1FK9A 1VBYA 2VC1A 2XB2D 2YNIA 2DGVA 1MMDA 3GYNA 4DHVA 4F25A 3KK2B 4PPDA 1F3VA 1URNA 1FHTA 4IKAA 3FCHA 3TNVA 2A6OA 2VG5B 1VQ5S 3AXKA 2RF2A 4JI6J 1WUUA 3HO1A 3KUEA 5E7OB 4N5SA 4DR2J 2HIQA 5LSRA 3C6TB 1RTHA 2H48B 3ZZUA 3VAMA 2ADCA 2UUAF 3K0JA 2GO8A 1S0MA 4QIGA 1NHKL 3ZNJ1 2LU1A 3D9BA 3FZ2A 3CCVS 3C16A 1FEEA 5ETSA 2ZUAA 1JLGB 2C3UA 4PPZA 3J81j 1JB0C 3SV3A 4C6AA 4F4KA 4LF9F 2DNMA 4Y00A 3L7UA 4PABA 4QWEA 2V8PA 4W98A 3AAWB 3DDIA 4NEYA 3CDEA 4CWBA 2CG8A 2CDQA 4HDGA 5MAOA 5IT9U 1UFLA 4H4OB 5KFUA 3SQOP 5BR8J 2NUHA 1Y5IB 4C3LA 3LGHA 5LSLA 2BOAA 4ZIWA 3IP0A 2EXUA 4JI5J 1Y3KA 2CPDA 4AL6A 3M8QA 1CJKB 1HQUA 4IH6A 5K8OA 4JI1J 4R5PB 3BJYA 1AZSB 4L76A 4ZJLA 4PG7A 3SSRA 2PT0A 4NE9C 5KFPA 1RT5A 4USVA 1BD6A 3SZ2A 4WU3A 4OX9J 1YJUA 3CE8A 2MGZA 1QSLA 2QE5A 4A8XA 2VC0A 1EP4B 2MJNA 4OHZA 4B9VA 5B09A 4ZOSA 4ITSA 2BRKA 4ILMA 1FE4A 3ENQA 4NLPA 2RQCA 2HHSA 1UMJA 3EICA 2EW9A 1Q79A 3HHLC 1LWXA 3SMZA 5KFKA 3CPWR 3OLBA 4KHPJ 2BA9A 4HEA9 1RWWB 1X5SA 1TL1B 1U2CA 2E9RX 1RE1B 1HWIA 2BJ1A 2V5HG 3Q2SC 1Y11A 2MEWA 3G8QA 3PRDA 4K59A 2B9WA 5IT9Y 4EBDA 1CLFA 2KZZA 3MHYA 4RLEA 2IBKA 2H9ZA 3LP2A 3MI7X 3R5JB 5E3RA 3LF0A 3UDVA 5LSOA 1BY9A 3QIPA 4TN2A 3PW0A 1UCNA 1LWEB 3Q8QB 1CULB 2J7KA 2CJXB 3BBCA 1PYTA 1YLXA 3MOJB 2F3JA 1FD2A 2RQ4A 1AT1B 2ZC4A 4OHXA 1R6YA 3SQGB 1XNQF 2CPFA 3QMQA 4LSNA 4HYKA 3QZ8A 1FWKA 1E6VA 1GXTA 5KG3A 4NLQA 2ZH4A 2E7WA 3M6XA 4DV4F 4JV5J 1T02A 3CJ3A 1FCAA 4F67A 2DNNA 5CZVA 1FVQA 3FNNA 2R7WA 3SDEA 5KT3A 1RHJB 3BS9A 4NA2A 2R7RA 1TKTA 3OL7A 4Y2IA 1NK7A 2C3OA 3RW6A 4OLPA 3H5YA 3T1HF 1EETA 4QIFA 3DOMB 2W2PP 3HJVA 2KG0A 2HAFA 2AV5A 3QATA 3N4WA 3NS6A 3DOLB 2NUUG 4JBCA 2JDJA 2RD5C 1FE0A 4ZVSB 4AXJA 1DTQA 5D8HB 1UP1A 2VFRA 1C4AA 1SB6A 3H20A 4FVMA 5CD4H 4YS2A 2C2EA 3K5PA 1U6BA 2LCWA
chains in the Genus database with same CATH topology
1MMNA 4RBUA 3OFEA 4DV5F 1A7GE 5C42B 2IAJB 4F26A 3LPYA 2VBWA 4OMFG 4EBCA 3MGJA 3FMBA 4WXOA 3T6JA 1DTTB 1IKYA 3NAHA 1ZAXA 4DSEA 3KHHA 1HBMB 4ED1A 3J7Z5 4DSLA 2UZAA 3OXGA 3PNIA 3L7PA 4ZPAA 2QMXA 1TQLA 5KFZA 2ALZA 3EPGA 3M2RB 4DR6F 5DETA 1N5QA 1N32F 2XLIA 3BQ1A 1GXUA 4WU2A 3IGVA 5C24A 1FRKA 1YTYA 1QLNA 1VQNS 4HKQA 2ROPA 4NA3A 4QIEA 4WFBQ 4ED2A 1O8BA 2MKKA 4FS1A 4DR3F 4JI0F 4WK3A 4QOTA 3UDCA 5H1SV 3L95X 1R8BA 5DJBA 1S79A 2O67A 4LVNP 3MXHP 4HH1A 1OQ6A 2P6SA 3NRBA 4NLXA 2KDOA 1IBLF 3GMGA 1U09A 2GMHA 1D8ZA 2K3IA 4KKOA 1QAJA 2Q43A 4J5OA 2GFFA 1YJTA 2IRXA 4X4NA 3MCSA 2CQHA 3HT3A 1LQ9A 4QYRA 1FKAF 1JLBB 4JI1F 3BR9A 1S9GA 2UUBF 2POKA 3K5LA 1KHVA 4YDXA 3V2UC 1W2BR 2HHVA 4NZ0A 2IA0A 4J37A 4WZMA 4KFBB 5J2NB 2J0SD 3R1HA 3UI3A 5IQ6A 1S77D 3HVRA 2EFQA 3DLGA 1D9FA 4RW9A 1YJRA 4D3GA 2YVSA 3MD1A 4DL6A 3MMJA 4DWIA 4C11B 4DSJA 2BM1A 4KE5A 4N47A 4X4QA 4A8OA 2DIVA 4IG3B 1XBWA 4K4YA 4C3MA 1VQ6S 1FNOA 4UUWA 4ZCKA 3DLHA 4LIRA 5I4MA 4Y3CA 2CPXA 2FTRA 1FRMA 3DLJA 3LGMA 4WYWA 4TQSA 2WOMA 2KI2A 3DRPA 2J6SA 1VRTB 3Q8PB 1CQMA 3I0SA 2MQLA 3TUZC 2A18A 4OJ1A 1BQNB 4QIVA 4X65F 4ELTA 2ZBCA 1TVRA 2IHR1 2KRBA 1F5CA 2AU0A 2DIUA 4TNOA 2GMLA 4ZLPA 1FNMA 3MM7B 3JYTA 2E1RA 2HGMA 3AB2B 2ASYA 2PDAA 1SC6A 4IQMA 1Q7LB 1C1BB 3MM8B 1C1CA 3NCQA 5KOWA 3BSNA 2DR9A 3KG1A 3THPA 2VA3A 2YX7A 1ZETA 4DFMA 2VG5A 1R43A 1UL3A 2JZ5A 5E3CA 1S7HA 2M70A 1N5TA 3LP1A 2X1FA 1HARA 2V8VA 4JI2F 4Q2MA 1DQ9A 3BEGB 1NHUA 1IKWA 3P3DA 2OIHA 2RKIA 4DV0F 3OXFA 4F3OA 1M5PC 4CIOA 3MR6A 4JI3F 3CO9A 3R5DA 4KFBA 5KG6A 5J2NA 4DLEA 3FEYB 4ED8A 1HHTP 3VAJA 1WF2A 3J81Y 3BR8A 5K5MA 1IQZA 3CEDA 3VCDA 1IQTA 5T7LA 2U1AA 4DX8H 5A8KA 4PXCA 1V6HA 5KTQA 3FMWA 5IM0A 2KTQA 3TVKA 3WZ0A 2AGQA 2VQEF 3PXGa 1MROB 5KFLA 4ZCMA 1XR5A 3JTNA 3UNGC 5HL7Q 2FD2A 1SV5A 2HMIA 1IKYB 2XNQA 1NK5A 2WBMA 1QVGR 1UEUA 1WEXA 4ID5A 4K4TA 4WZQA 2ZH7A 2RRBA 2RDJA 3CD5A 3TX8A 2E66A 3J7A1 3UD3P 3BQ0A 2JVOA 3HHLB 2VFUA 3Q2TC 4LIWA 2R8IA 4A48A 2V4QA 4YMEA 3F73A 5IQQA 4NWBA 5IM0B 5K8MA 4OZJA 2PN6A 1WELA 1RT7B 2CPHA 3HKZD 3S01A 5J2MA 2ROGA 3TAQA 1OIAA 2OPQB 4K4ZA 4URQU 1R8PA 2KU7A 3QLHA 3MOZA 4USJC 5DM7Q 1QJHA 3M2UB 3P5TL 3H2VE 2MKHA 4WE1A 5EN1A 2HHTA 3IWLA 4RW7A 3DHWC 5A8RA 2XMMA 1SH3A 1P8GA 1S0VA 2EPIA 3QO9B 2YWGA 2OO4A 3PIPQ 3H5UA 3V6DB 2UVVA 1HBOB 2RJZA 3NGKA 3PACA 4ZHRB 5GMKa 3KLHB 3R3TA 4RBVA 4BHQA 2WSFC 4MIWA 2AJFE 2B4VA 3PKYA 1NJXA 4B9UA 3NLCA 1MWZA 1U6ZA 3CIZA 2DNLA 3MEGA 5EDWA 1Y9OA 3LWMA 3MDFA 3LGNA 3SI8A 2F8HA 4CT8A 4O3NA 3EZ5A 2F4VF 3MM6A 4B9LA 2KXFA 2YNGB 5KG0A 2WB1D 3HPOA 2IFXA 4FXWA 3OBIA 3G86A 2PA3A 4I7FA 2HGLA 3AA8A 4G1QB 4ZHRA 3KLHA 1YIJS 3H25A 1RYSA 1LXJA 3ULHA 1SI9A 1BQXA 5B0AA 3G8SA 3QWUA 2DVIA 2OMOA 2OH2A 3QGGA 2ABYA 2EFGA 4EGLA 1VIXA 1HW9A 2EG1A 2B43A 4QPXA 2M88A 4FPRA 2L41A 4AFFA 4CTAA 2R7OA 2MXYA 2MKCA 3GV7B 4DR7F 1SIZA 1GQEA 2FHOB 4BWJA 2XBPA 1Y4ZB 3T1YF 4XPCA 1RT5B 2EKYA 4LF7F 2XWYA 1B0VA 1LFWA 1LW2B 2PSZA 3FGVA 2DNKA 3MD3A 4O3OA 3OUYB 2X1BA 3VF0B 1DAXA 5J2QB 2MYFA 2MGZB 3HHEA 5F8NA 2NSBA 1YHQS 1ZAWA 5L1LA 3AH6A 5I3UA 1U49A 1T95A 2YH1A 2HFZA 2Q6CA 4RWXA 5B0DA 4WCEQ 3RB3A 3FRYA 1NJIT 1UFWA 3M6WA 4CTAB 2O01C 1SUQB 2ZHOA 3T5JA 4ILRA 3K59A 4Y65A 3Q22A 4C11A 2HVHA 4H4MA 1YRTA 2R7UA 3SYZA 2GV1A 3I4HX 2AYEA 2X51A 2JL9A 4DV6F 2QLXA 3FFIA 4K50A 3O2IA 2DRAA 2RVJA 1AFIA 3T9NA 4R0EA 4DQSA 4EZ6A 4QR2A 3KMSA 1Z1ZA 4PCQA 2LLZA 2L9WA 3MEGB 4RBTA 3HHNB 3DOMA 1N0UA 3CJ2A 2BQ3A 4M8LA 3QAUA 1KVIA 3M8QB 5DG8A 1NNDA 1YRXA 3MFHA 4JI6F 3CULA 2RF2B 2XHWA 3EX7B 1TK8A 1JX4A 2CPJA 5F0UA 4HI1A 1K1QA 1Y5NB 5A0YA 1X0FA 2JEGA 5KAKA 5T14A 1DQAA 1Y0HA 1HBUB 2VQFF 1JLCB 4BC9A 4MFBA 4IFYB 4JYAF 1U1KA 3E8OA 1E6YA 4N41A 1WF1A 3K5MA 2KJWA 4W92B 3D5MA 3LOUA 1IKXB 1FA0A 2CJAA 3ICLA 4F3MA 1GNKA 1S9EA 1HWKA 3A8EA 2XY6A 2PO4A 3UW1A 4V19J 3JTPA 4GKJF 4KKOB 1TKZA 3AA9A 4ICLB 2XNRA 4DF4A 2IC3B 4USIA 3KFWX 1ULRA 2BXJA 1HD0A 1WEZA 2G9OA 1C2PA 2MZSA 4FNHA 2CQ4A 1SJFA 2XI2A 2EFPA 2DGUA 3M8PA 3DRPB 3WC0A 3V4IA 1U2FA 2FLNA 3BSAA 1SH2A 3VTIA 5F8MA 4Q8FA 3H4DA 3CWJA 3CJKA 2FVSA 2XMTA 5LJ5Y 4DBQA 5A8KB 3TOQA 4M94A 1UVMA 4L3NA 3N79A 2W8LA 3FJ2A 1PGZA 2CQDA 3PJXA 4QPTA 3O3LA 4X2BA 1FHTA 3HZGA 4Y2AA 4N56A 4ZVEA 4OI0A 3OR2B 2R2SA 2HHWA 1B0TA 4OX7A 3C6UB 1IJFB 1SJ3P 5GADU 3DDKA 1GXLA 3P49B 2B4OA 2HWIA 1ZOTA 2KHDA 3I0SB 2RILA 3OR1B 2OPPB 3VAHA 3LAMA 1X9MA 3ZZRA 3M9OB 3D0GE 1Z2LA 2I5JA 5GAHU 2AQ4A 3IBWA 2CKWA 1QY7A 5D6GA 2AF6A 3TAPA 5D77A 5LXYA 1MNEA 3OVAA 2B4PA 2B6AB 4ZPVR 1S6PA 5EGYA 3MPWA 4PG8A 1H7XA 4PG4A 3DYAB 2KG1A 4LFBF 3IRXA 3RAQA 4L6V3 1LW0A 3UQSA 3KK1A 1S1VB 3JYTB 4LVOP 1S48A 3DLGB 2NREA 1CG2A 2YWHA 2V8HA 1U1RA 3O5TB 2VUGA 1CQNA 2LKZA 2G13A 5IWAF 2ZOGA 1FO1A 5B0GA 5F9NA 2R8HA 2YKMB 4PUOA 4JV5F 4TQRA 1FTRA 2HS0A 3BN7A 5H9FJ 5KFJA 4TU7A 1U1OA 3W7BA 4J9SA 1Q81T 3DRYA 4C98A 2KYXA 3J7YI 1M5HA 4ZCLA 3HMJG 5HO4A 1NAQA 3I4PA 1HMVB 5AXMA 4DR4F 1M1KT 1YJ9S 1UKUA 4CO5A 3FQKA 1JLEA 2W8KA 1RT7A 3UCZP 2E44A 1RGVA 2E1AA 3IFEA 5AE3A 2CQ2A 2ZVSA 2AD9A 4F2SA 3MMCA 4FP9A 1Q82T 3S6EA 4DL2A 1RT4A 4O4RA 2RE1A 1X4FA 2ZJQQ 4FF2A 4YDDB 3X3UA 3IG1B 1RT1B 4ECYA 5EWEA 3H40A 1T94A 3TI0A 4PR6A 1Y00A 3OUYA 1C4CA 4Y34A 4AE5A 3V81A 2JSXA 2QA4G 1LFPA 1RKIA 2DH7A 1TL5A 4MYTA 4ALZA 4EBEA 2KT5A 5KFAA 4X4OA 1XR7A 4QWDA 3MEEB 1DTTA 3NP5A 3SV4A 4G3IA 2DNHA 4B9MA 1V3SA 1SUQA 2B9XA 1IJEB 4C3KA 5A8RB 2AYMA 2IRUA 2XMJA 3M9MB 2HW3A 1P6TA 1S1TA 3GR1A 2RT3A 2LA4A 2BM0A 5L8RC 4I4BA 4KHMA 2CJKA 4IR1A 3HI9A 5I3QA 5FDLA 4OHWA 1MU2A 2GHWA 4QBUA 2CQPA 3FDSA 4M95A 1VBXA 2KM8C 3IRWP 3IGNA 3KLEB 4HLBA 2OSRA 1JK9B 4ZMMA 2ZKTA 1M5OC 3T3FA 3KNGA 5KFFA 1JXEA 2DGSA 1NJYA 2OP5A 1D3WA 3I5BA 4C0OC 4UUXA 4NCGA 3R1LA 4UW2A 3VZIA 3OFHA 4E98A 4GO7X 6FD1A 2EFNA 1RT2B 1HNXF 2ZITA 5KFMA 5J2MB 2K7KA 4UQGA 2DO0A 1UETA 1KFSA 1FDBA 3TVZA 4JI5F 1GX5A 3KK3A 2XS2A 2GNKA 4HI2A 1PC4A 1JLFA 1N6QB 3BF4A 2UU9F 4TY8A 4K4XA 2BQUA 1LK7A 1G7CB 4IG0A 2L9NA 3B4MA 1JNRB 2VBYA 2GCFA 2OTJS 1DLOA 3DM2B 3IN5A 3KLIB 3CCWA 3SCKE 4RW6A 3R5CA 3CB4A 1FJEB 1RTJA 3JSRA 5B0BA 2UXBF 2YKPA 2IM2A 3ENVA 4OZ1A 5I3UB 1S97A 2KXNB 4LQ9A 1BQMA 2W4DA 3JAMY 1L3TA 2CPIA 1JJHA 1JKHB 2DNRA 5FJ4A 1YWXA 2EI5A 2KYZA 2QYCA 2XMWA 2XG8A 2ZH6A 1VRUA 2F9JA 1LW2A 2WHOA 3PRBA 1RTIA 4FN5A 5I42B 2HVIA 5HMWA 4E8UA 3KMQA 4RNNA 3MMAA 2WSCC 1HI8A 4OI2A 2CJ9A 3MECA 3CD0A 1FDAA 3QAEA 4IDKA 5BR8F 4QQBA 4XO0A 1DQ8A 1KR4A 5B7WA 2NPFA 3HZEA 2I38A 2ZKUA 4B3SF 2YKQA 1KN6A 3H8YA 3KHGA 1X4GA 2R7VA 2WK4A 2CFXA 1REVB 2RS2A 5F9LA 3IAM9 1GTEA 4ED0A 1M5VC 1VGYA 1X4AA 1X0PA 2VFVA 2PI5A 4I1TA 3PX4A 1CC7A 4JOUA 1SXLA 1S6PB 3PW7A 1S49A 1OWXA 4USHA 1Q8IA 1SL2A 4ZA1A 2Z8QA 2ZHBA 3K5OA 3FQLA 4CH0S 4P7VA 1N5SA 1KLMB 2CJQA 2KXHA 3DLKA 4TY9A 4B3OA 2KT3A 4KHPF 4UY8T 3QIDA 5E3PA 2JH3A 5LL6d 5KG7A 4U67Q 2OSQA 2W7PA 5THWA 1U1LA 1ZYQA 4K0KF 5HP1A 1KS2A 2DNZA 2ZNYA 4WK1A 1RT3B 2CZ4A 1FNXH 3KLFB 5AXNA 1M90T 1KHWA 2ZJPQ 1KONA 3I5CA 5D3GA 5CH7B 2EK6A 1TKZB 3G4SS 3VAGA 3M1VA 2VFTA 5DDQC 1IM4A 3ZZYA 1TKXA 2HG4A 3SFUA 4R0JA 5DDPC 4MK9A 2AJQA 2B7CB 3ENWA 1S4FA 3CT9A 2I5JB 4ED5A 1HW8A 4Q8EA 4OHVA 1RK8A 2L3MA 5D4OA 5G4DA 2F8EX 4X62F 1YVFA 2R8JA 1JLCA 3DN9A 3PW5A 4OI6A 1MMLA 5J2PB 3OL9A 4WKRA 2IYIA 3OFGA 3BO3A 4DF8A 3VZHA 3IO1A 2MQMA 5LMUF 3MMCB 1RT6A 1Q78A 4JI4F 4WF9Q 2O66A 2WW8A 3H59A 2FJEB 3Q8SB 4TLQA 2HVZA 1G6BA 3N6LA 5CQGA 3BSOA 4RWWA 3GFZA 1U48A 3IWNC 2QA2A 2Y1JA 4QW9A 2LU2A 3EUNA 3IA0A 3AJ1A 5DQGA 4HVZA 5HI7A 1ROFA 4ED7A 3NWGA 2MDAA 1PO6A 4WFYA 3Q24A 2FJVA 2J9DE 4DSFA 3I6PA 4J9LA 4PQUB 1XMOF 4PG6A 4TKTA 1T05B 3DLLQ 2DPJA 2EK1A 1H6KX 2BE2B 2ACYA 2W9CB 2RIJA 5KFIA 2XMUA 5B0CA 1R27B 4HL9A 5JJBA 1UVKA 1T3NA 2M2BA 5DQHA 4IUFA 5CHCB 2IVFB 4KRWA 4TY8B 3CXCR 3ITHB 1B7FA 2VODA 5HMZA 2D74B 4RU2A 2LQ5A 3BGRA 3EXYA 1HA1A 1M5SA 3UFCX 4O4GA 5F41A 5HBMB 5LXRA 4I2QB 3UE2A 3DLEA 3SCIE 5L39A 2C3YA 3K7RA 2DGQA 4NLVA 4U7CA 2C28A 5C42A 5E3QA 3MEEA 1C0TA 3MM9A 2BUNA 1Y7PA 1VJWA 2B4UA 3HHLD 3ISZA 4TLRA 3TUIC 2EBEA 2K2PA 2XGQA 2ZBIA 4DS5A 1NK9A 2WSEC 4RNFA 4Q5VA 2B5JA 1RTIB 5I42A 4ZPBA 1KQGB 2GHVC 5KOXA