1VHFA

Crystal structure of periplasmic divalent cation tolerance protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'SLILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords periplasmic divalent cation tolerance protein
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vhfA00
3M05A 2JJ4D 2PIIA 3BZQA 4OZNA 1NAQA 2XULA 3O8WA 5D4OA 1NH7A 2E66A 4RWWA 4CO1A 2GW8A 5DRKA 4CO2A 3TA1A 2J9DE 2XBPA 1HWUA 3AA9A 1OSCA 1V3SA 2J9CA 2J9EA 4CO4A 2EG1A 3NCPA 4WK3A 5D4PA 1UFLA 4WK1A 2O67A 1VFJA 2ZFHA 4ZK7M 1H3DA 1UL3A 4Y6IA 4AFFA 1UKUA 3NCRA 2GNKA 2XG8A 2VD3A 4E98A 4NYOA 3TA2A 5L9NA 4Y65A 3HLUA 4RWXA 4IYQA 2O66A 3T9ZA 3OPKA 4YB6A 4CNYA 4OZLA 2RD5C 4CNZA 3AA8A 3GSDA 4D3HA 5DS7A 4OZJA 1NH8A 2XZWA 5D4NA 4USIA 3LF0A 3AHPA 1QY7A 1P1LA 2Z0GA 3DFEA 3L7PA 4YB7A 1UMJA 3AH6A 2CZ4A 1GNKA 3NCQA 1PILA 4CO5A 4C3LA 5D4LA 2J9DA 3O5TB 4CO0A 4D3GA 1KR4A 4RLEA 4RX6A 2GX8A 4C3KA 3CE8A 3TA0A 4USHA 1V6HA 2V5HG 4R25A 1V3RA 4NYPA 2EG2A 2NUHA 1XK8A 3X3UA 1NZAA 2NUUG 4C3MA 2NS1B 1O5JA 1O51A 1VHFA 2DCLA 3N5BA 1V9OA 1Q1KA 4USJC 4CO3A 2ZOMA 3MHYA 4YB5A 1J2VA
chains in the Genus database with same CATH superfamily
2RRAA 3TVKA 3CO0P 1FRJA 3AD8C 4DV1F 2KRRA 1RXOB 1N34J 1CQMA 5KG5A 1FD2A 2MHEA 2HNZB 3EVOA 2QMUB 3G6VA 3RW6A 2Y0BB 1OPIA 1K8AT 3UN2A 1NK5A 4NXMF 2DPIA 4Y00A 4DG1B 3MUMP 4R0EA 4EI2A 3KJFB 4DPUA 3I5CA 5B7WA 2BW2A 2JVOA 3H5YA 1KDNA 1JLQA 4PR6A 4RNFA 3PW2A 1U0HA 1IUJA 4KGZB 4B3SF 4KJIA 1RDRA 1TAQA 2WW8A 4WE1B 1RT6A 4AT1B 2EEYA 4DQRA 2YX1A 1RTHA 1M1GA 3RTVA 2KTQA 2YWWA 1VRQC 1JLFB 2MZ1A 2V34A 1IKYB 2P9CA 4JI0J 2NXEA 4OMFG 3K0JA 1I3OB 4OLPA 2YPZA 1NSAA 1SC4B 4ICLB 2QZ8A 2XMTA 3HP6A 3GIKA 1GXUA 1IKWA 3V6DB 3BPSP 2VBXA 4TU7A 2XZTB 4DSFA 2CDRB 1W26A 2QYGA 1O8BA 5J2MA 4N47A 4JV0A 1IBLJ 3T1AA 1I94F 2AGQA 4USTA 4ZVEA 2H48B 2MKYA 1MN9A 1TKXB 4C3LA 1L3VA 2K2PA 4JI7F 3HDSA 3UWTA 3OXLA 4PPZA 4NZ0A 4LRDA 3HCXA 2QLXA 4KBIA 4F4WA 4URQU 2WW4A 1NHKL 4JI4J 1HHQA 3OFGA 3S7RA 3VAMA 4IO9Q 2ACMA 2PFFB 1D0EA 2QE5A 2BRLA 3PYEA 1S59A 3LP0A 4DEZA 3SDEB 1Q79A 3PX0A 2WBRA 4IG3A 5A0YA 3UE2A 1F3VA 4DS5A 1B7YB 1S77D 2HBRB 3H2UB 2X1AA 1TUGB 4FXVA 1URRA 4HHJA 4WP3A 2I1RA 4WXOA 1CLFA 4OQJA 2ZE2B 3ZXWA 3TEHB 1XERA 1Y11A 1RGVA 3GU0A 3QSIA 3GYNA 3A8JA 1EAYC 1TV6A 5L1JA 5HI7A 3CCVS 1RCXB 2Z0GA 1FJGF 1U26A 1DLOA 3BR9A 3AH6A 2QFJA 4ZPBA 4JV5J 4YB1P 3MR6A 1OIAA 4V19J 2CIMA 3HX9A 3CIZA 1ZAVA 2CADA 1F5BA 5DJBA 3CDAA 2X1FA 2FIUA 4CTAA 1HQ2A 2H4YB 2KFZA 2GHVC 3IFEA 1FJEB 4UOHA 2BRKA 1BXNA 1RADB 2Q1LA 1JJHA 4EUVA 1RHKB 4DSLA 3DLBA 3MF5A 2HVIA 4JI2J 1YRXA 3W2VA 3EDRB 5D3GB 3LP1B 3GR0A 1TUWA 1HNWF 1HBMB 4O4RA 3EZ5A 1HQEA 1U02A 1RT7A 3FQKA 3BKTA 3M2VB 2L9WA 2C2RA 3GYGA 3J7Z5 4OJ1A 1VBKA 3EXCX 3AJ2A 1SQFA 3UW1A 4ERDA 2RRBA 3C19A 1LOUA 1RWNB 2Y0SD 4DHVA 4OZLA 4P6QA 4IUFA 3PDNA 3SSQA 5E3PA 4A8QA 1SJ3P 4RW6B 4H4MA 2RU3A 1WACA 3MECA 4I68A 4UQTA 4RLEA 5KFXA 2E44A 2EFNA 4TNOA 2DIVA 2P2CB 3DI6A 3IR6B 3MR7A 3T9NA 4NLGA 3BR8A 2JX2A 2C2MB 2MXYA 3NNAA 1VMBA 5K5MA 4ECRA 2YH1A 1X4CA 3QAEA 3DDIA 1NBEB 4DR4F 2HK3A 4KY3A 2XCAA 2YNFB 3P6YC 5LMNJ 1NUEA 1UZDA 1DAXA 1K9MT 3CGIA 4HR2A 2ZBCA 3EWGA 4TYBA 5CYJA 1TKDA 5IXUA 4PG6A 3OW2R 1SL1A 5IT4A 8RUCA 4AFFA 2Q3PA 3FCHA 1ZH5A 3D1OA 3GG1A 1TVRB 3MPWA 1LW2A 3NAHA 2GVDA 5DDRC 4CNYA 4C8LA 1EQ0A 1DY3A 2V2ZA 2IDEA 3BQ2A 3BGUA 1DARA 3RAXA 3BSOA 2B4VA 4ID5B 5HJXA 2JLGA 2AYEA 3IO1A 1UA0A 4WKYA 3GWCA 3KJQB 1J5EF 3MEEB 1LWFA 4F50A 2W2NP 2XSJB 3GFHA 3Q22A 1YZ7A 1AW0A 4J9KA 1JLFA 3FFIA 3MHYA 5DLFA 2R7OA 4EEYA 3LQVA 4FYWB 3R2CJ 2E5LJ 1NJWA 1A6LA 2B4UA 3D7SB 1WF0A 3NMRA 4DV3F 2PA3A 1ZTWA 1X5TA 4OZ2A 3KK2B 2BOPA 3BQ0A 1F9HA 5RUBA 2HGNA 3LAKA 1VQ6S 3OHBA 2VD3A 4XPEA 1S0VA 2RB7A 4KHRA 1T9XA 2I8EA 2QX0A 1U1PA 1SQEA 1LW0A 3CJQA 1RUSA 4EBDA 2IVYA 2BQRA 3EGVA 2OI2A 1N88A 4M5DB 1X9SA 3GB0A 2VC0A 1VK8A 3KLHA 1D9FA 4ECZA 4UTGA 4C9DA 2R2SA 3KHHA 2OEMA 4TY8A 2XLIA 2CJAA 2XS7A 2C2ZB 1TL1A 4OHYA 1WG1A 2HFOA 1DQ9A 3ENAA 5GMDA 4EYHB 3D68A 4FXWA 2ASYA 4BWJA 3M2RA 2JHEA 5HP1B 4J7CA 3TZWA 4KGXB 3FSIA 3ENQA 4DSEA 2VHGA 3MCNA 1R3NA 1V3SA 2HRYA 3QFWA 4HL9A 3GJSB 4K5RA 4ILLA 1FWLA 4LRAA 5A6WA 3I0RB 3BV8A 4DV2F 4I7FB 3PACA 3LA0A 4FBTA 3OHAA 3TQ1A 2QL9B 2MKKA 1VQNS 1W2IA 3PX4A 3SCIE 4LFBF 2AEMA 3X1LB 2YNGB 4QIGA 2CZ4A 2MZQA 4M63A 3A3NB 5L1LA 4U8YA 4U95A 1BLUA 1QE1A 3U02A 2KH9A 2AU0A 3ZTSA 4HEA9 3UD3P 4RW4A 4DV5F 3G71S 2V5HG 3POTB 3CVKA 1HMVB 1BY9A 3HI9A 4NXMJ 1GTEA 3MMCA 1ZM9A 1BWEA 1RKJA 1ICEB 4O4GB 5C24B 1JXLA 5DM6Q 4LF4F 5LSOA 4ZIWA 4NLWA 4YEAA 1HNIB 1WG5A 1YQHA 3K5OA 1NH7A 3GJTB 3LP1A 3WIVA 2C3UA 4ILMA 2LFVA 4B3SJ 2L9NA 3G82A 3JXOA 4LBIA 1PO6A 1S0OA 2QL5B 2F4VF 4ECWA 2C2OB 4DV7F 2DNLA 2JOQA 3ZZRA 3OV7A 4A46A 1L3UA 2R4FA 2DNGA 2YWGA 1RP5A 2F4FA 2Y8YA 2B5JA 5DGAA 2GJFA 5KT3A 2ADBA 1M5SA 2HW3A 1FKPA 3M4XA 4GVLA 3CPWR 5KFOA 2WHOA 5B0AA 5G0RB 5KFJA 1M1HA 1NZAA 4CLFA 1TELA 2EBGA 3M8YA 3W8GA 4IKAA 2VJUA 2AJFE 4JI3F 4PYDA 2BANB 4ZPTR 2Q6CA 2C28A 2XEXA 1IKVA 4OYMA 1HBNB 2L41A 1VLOA 1D9DA 5ETPA 1PAUB 3SQOP 1DQ8A 3DGVA 2H54B 3VHQA 3MR3A 2D41A 2J6UA 3N5FA 3G8SA 2E9TA 2EFOA 2A2DA 1Q4RA 4A8KA 2XGQA 5CCLA 3JTNA 3P5TL 2H3EB 1NSQA 1WWHA 3DN9A 3LPEA 3IMQJ 4ID5A 5IM0B 1FTCA 2WVEA 4DPTA 4WTYA 1FRXA 2OUGA 1E6VB 1NPPA 1J5OB 1RBAA 3PYDA 2EC2A 4DQSA 4B9LA 3MEEA 1KTVA 1N6QB 2V8DA 4QU6A 3ELHA 4LFCJ 1FJGJ 4UY8T 2AT1B 3K89A 2AHOB 2FHOB 2LQJA 2CFXA 3JSBA 1C4AA 3UDLA 4YHHF 3FGVA 4ED4A 1U09A 3C8YA 1T02A 1O0PA 1IBKF 2VA2A 3KG4A 3QRRA 1FNXH 1L3KA 3VGSA 4O0IA 2V4JB 1V5VA 3KG0A 3OTDA 4ZVPB 3MUTP 3MMJA 5KT5A 1JKHB 1Y7PA 1WNEA 3N0VA 2COLA 1AUSL 2QL7B 3HZEA 1FRIA 1WF1A 4GKJJ 1NHVA 3AJ1A 2QEXS 2XB2D 3BSNA 2WVDA 2A0FB 4MKBA 2LA6A 2W4PA 1RWXB 2ZH1A 1S1VA 1L3TA 5MLCV 1U47A 3MM8B 2ALYB 2J7KA 2CUYA 4BDPA 4P72A 4M5JA 5IC4B 1NK6A 1REVB 1PIEA 2Z2MA 4NLVA 4WYWA 2MQQA 1SCJB 4ZPVR 5KFGA 2DGTA 3W2WB 2CVIA 5ETSA 2F9DA 2JDJA 1VI7A 2JJ4D 2M3DA 2VICA 1X4HA 3CJ8A 2QMWA 3F0NA 2J9DE 3M2UB 1RTJB 3A4TA 3JQKA 5J2NB 3THPA 2MQMA 4AXJA 2PEHA 2NCKL 4KGKA 4JYAJ 5F3ZA 3C6UB 4GO7X 1F2GA 4LF8J 4NLTA 2CRLA 4LQ3A 4TYAA 1H38A 4W92B 4I7FA 3DGPA 2ZH7A 4Q8EA 4FNHA 1V3ZA 2VL1A 3QT5A 4B9NA 4XK8C 5CZVA 2ZJRQ 1KQKA 1PILA 4X84A 5AJ3J 4MK8A 3CD5A 1WTBA 1U49A 1VOMA 3KK3A 3W3SA 2R2TA 2BE2A 4ED3A 4PXEA 2VQEF 3QJJA 4PXDA 5THWA 4DV4F 3HHLC 4MH8A 2Y1RI 3SSRA 2UVUA 4DX8H 1GAOA 4K0KJ 1HMVA 3FC9A 1KONA 3SV3A 4O4GA 3ZTOA 1WEZA 1VJWA 4AUKA 5C24A 4MIAA 4OV1A 3N28A 4EZ6A 4KRWA 2DNZA 3OL9A 2QLFB 4DX7A 1BHNA 1YWXA 4K4SA 2R8IA 1B70B 3CULA 1Z2LA 4WFNQ 1FEHA 3RRGA 3IR5B 4R0JA 5EN1A 4FNIA 3IR7B 4LSNB 5DG8A 4C8NA 3G87A 5CD4A 2PT0A 3GLJA 3G8QA 5F9LA 4W90B 1R43A 2APOA 3AODA 1RWWB 4KO0A 4NEYA 1FI4A 4DR3F 2RJZA 1MWYA 1TKTB 1PAEX 2IMOA 4LF1A 5J1NA 3FDSA 4DV3J 1HW8A 2F3JA 3TUPA 1SH3A 1E6YA 1NK4A 2JRSA 1SB6A 5LJ5Y 4MFBB 4C3KA 4LT6A 4G1PA 2ATLA 1RBLA 3KK1A 3I96A 1ZM3A 3SFUA 3VV2B 2LQBA 5KG1A 2W7OA 1TR0A 1VQLS 3BYPA 3C3LA 3GSIA 2NUUG 1M5OC 2DNPA 1YZ6A 2VB6A 3N6LA 1HNZF 2KB2A 4WYLA 3PYGA 2XQCA 3I4HX 3D3BJ 2HQDA 4F8RA 5IT9U 3FCWA 3B8HA 3MM6B 1RISA 1BQXA 4DPOA 3RBDA 2DISA 4X65F 4EO8A 4MAKA 4F3MA 1N5QA 5JXSA 3PY8A 5HN0A 1NK7A 2XHCA 4CM0A 5CYQB 3GSDA 3DYAA 2DY1A 1U6ZA 2V50A 1YI2S 5F41A 4A8WA 4Y0FA 1X9WA 2KVQE 4WFYA 3D5MA 1SJFA 3L7OA 5B09A 1ZAWA 3K17A 3D1HA 4QIVA 2F8EX 2Z2YB 1S1UB 1WC3A 1R6YA 2GX8A 3RU0A 2NZ4A 3J80Y 5BYRA 4KH0B 3R97A 4H4KA 1R27B 1NDKA 1PJ7A 3T5JA 1LEOA 3KLEA 1S1XB 2RS8A 1N6QA 2HNYB 3CWJA 4IFYA 5L8RC 4WPAA 1V9OA 1T03B 3GCXP 4KAIA 3FBCA 2BJ1A 1L5UA 3VF0B 3P45B 3OSNA 3UDCA 1XNQJ 4ETXA 1TK5A 2JEIA 3EPIA 2ZWOA 2ZD1B 2CQIA 4Y2MA 1NCLA 2EG1A 3QGHA 1HD0A 2MDAA 1H72C 1HI0P 4KPCA 3OR2A 2LCWA 1NH8A 3J7A1 4USIA 3VQTA 2UUAF 5HVHA 1JKHA 1T8EA 2IY5B 1FDAA 2ZH4A 1UTAA 2IJFA 4X4TA 1XTZA 1DTQB 5DETA 2OGUA 4Q45A 2VODA 1YVFA 2QA4S 1IXKA 2GC8A 2KJVA 1YX2A 2YWFA 2FUG9 2UXCF 1HNXF 2EW9A 4J9QA 3OTEA 2E5JA 3M9MB 3Q8RB 1N48A 2E9ZA 3NWGA 4OL8A 5KFPA 4UQGA 4NLDA 4DV7J 3TX0A 2HZCA 3DLEA 1PCAA 2WB4A 3QPIA 3MPUB 2F40A 1W25A 4ZVUB 3W2WA 2WTFA 1OY8A 4NCAA 3CJKA 4RNNA 4DQPA 2DD8S 3GFXA 2LP4A 3HFZB 1D09B 1BWVA 1TP7A 5KG4A 4EWTA 5LOQA 4LFAJ 1N0VC 3HHDA 2VF3A 3KMSA 3AQPA 1QTMA 1U1OA 4CH7A 2CWKA 4A8OA 4ECTA 1WHYA 2DNKA 1P6TA 1QAIA 1VCTA 3MAAA 2NQPA 1SKRA 3JTOA 5A76A 1SJ4P 5DS7A 2HPUA 1N56A 4L75A 4JI3J 2OFHX 3Q8VA 3BF4A 2BV3A 3B78A 5KAKA 4IRKA 3KFWX 4J5OA 1RT1B 4WBFA 1RBOB 1PBUA 1JLAA 3M32A 2IRXA 3WIUA 3QO9A 2LQ8A 2EFGA 2MJNA 2EWHA 2HURA 2KZMA 3TAMB 4LF9F 4RL1A 1YJNS 1EZZB 4B3OB 4B08A 4YOEA 1C1BA 1RI7A 3P8BB 2SXLA 2FD2A 4PXCA 2GO8A 4F26A 4MKAA 5I3PA 3RR8A 1HFEL 1U1LA 3T5HA 2HEKA 1LQ9A 5CXTA 1RAHB 1RWPB 2CNNB 1B99A 2VG7B 3NMAA 4KB7A 2W4CA 4WXWA 3BSCA 4ZKAA 1T9YA 3LWLA 2RQCA 5HAOA 4X4PA 2J0WA 3BDEA 2M9KA 1Q95G 3CTRA 3MGJA 2ROEA 4NCGB 5D4PA 3CD7A 4U6PA 3CCTA 3KLVA 1RHJB 1RU1A 4DUZJ 1AA1B 4JI5F 4Y65A 3PO4A 4DV6F 2BJ9A 4ZP6A 5GADU 4ATNA 4YB7A 1WI6A 3FEYB 2DH9A 4ZVRB 4KHMA 5KFUA 2RE1A 4O3NA 2XWYA 1BD6A 2MLZA 2IRYA 3MEGB 2A10A 4RW9B 2CQ2A 3MWBA 3B54A 1WJ9A 2HS3A 2KN4A 2CNLB 3ITHA 3HD1A 2MSSA 5E0OA 1RAAB 2WVCA 3O3LA 3R2DJ 1QSSA 4DV0J 4FZVA 1SPBP 2LU2A 2D69A 3C16B 4Q0BB 1FKOB 4MT1A 3M05A 2WOMA 2VZ9A 1XJWB 1RT5A 4DR1F 2DCUB 3DDNA 1RLCL 4FKYA 4F3QA 2I9SA 1OY6A 3IAS9 4A4JA 2MQOA 4M5NA 2ZFHA 2X1BA 2CDQA 1KVJA 3VAFA 4OYPA 2B9XA 3D67A 1ZA1B 3ISND 4YB6A 4AL7A 2V8PA 5DM7Q 4TN2A 2DR7A 1G7CB 2UVWA 3K8VA 4I2PB 4WP8A 1X31C 1R7IA 4WU3A 3DRRA 1U8WA 1X0FA 3CDWA 2F9JA 2WVFA 4F0MA 2XY7A 1CSJA 1SKSA 1B4SA 4NEZA 3FMWA 1SIWB 2YNHB 5HBMB 4XO0A 2N4DA 4DQIA 4YMEA 2Q79A 2KHDA 3O8WA 4Y2AA 3DHXA 1FF2A 3PCOB 5EWFA 2E5IA 3THVA 1VBYA 4KTQA 4Q2MA 3GPAA 2YH0A 3QFHA 4DLGA 3W5ZA 4FDFA 1XMQJ 1Y9OA 3HT0A 3IG1A 1VYAA 5LT5A 4DJBA 5F0UA 4CT8A 2QFIA 2B9EA 4KV8B 4WU2A 1AROP 2G2ZA 1HBOA 5GAHU 1P9QC 3OLBA 3BBBA 1MSWD 2FJWA 4JV2A 4PEOA 3U1MA 2DGXA 1ULRA 2GQ2A 4P2XA 2D3OR 2ROPA 2YY3A 2JH3A 4B9VA 4C97A 2O1PA 3TO8A 4AXIA 4RUHA 3GYXB 3M8RA 1QJHA 2OEJA 2IRUA 2YX7A 1RTIA 2CQHA 3LOUA 1G1XA 2ZITA 1C0TA 4HH1A 5F8GA 3MEKA 1Y5IB 3RAMA 1NDLA 1RAEB 1CJKB 4NLPA 3ETOA 4EK2A 4OZNA 2HHPA 2E66A 4JI1F 4R5PB 4AL5A 5KG3A 2G1HA 2HKEA 1Y5LB 4LBPA 3NY0A 1LWEB 5B08A 2QC3A 2PC6A 4G6VB 2LVWA 1U1QA 2UXDJ 2W25A 3PEJA 2NPIA 2OIHA 1I51B 3J81j 2CZVC 2EK6A 4Z7CA 1HNZJ 3SV4A 3IXQA 4YS2A 5A8KA 3RBEA 1X0PA 1X4DA 4DU7A 2HFVA 5D4LA 2DXFA 2HQCA 2X51A 1TKZA 1FDBA 2IBKA 1IKXA 4NLYA 5C2CA 3TOQA 1BGXT 1HI8A 2F8HA 4FPIA 3DMJB 4NXNJ 1N32J 2VG6B 2O01C 4RPFA 3EZOA 1VLYA 2CJ9A 5IQQA 5I3QA 3BO4A 3Q89A 4CLLA 2N4CA 4B3OA 3E2EA 1KFDA 4FKXA 2VC1A 4FN5A 1CS4B 3PHTA 3GMGA 2YWKA 2OPSA 2ZH5A 5EX3A 3J81Y 3NNCA 2XY5A 3D9BA 1FFGB 2U1AA 3DHWC 1K1SA 4CIOA 2AP6A 2VG7A 3D0GE 1NK9A 3TANA 1SJRA 2HFSA 1PYTA 4PQAA 3DKDA 3OTCA 2HQGA 4J9NA 3CCMS 2AEFA 2AYBA 4LF5F 2RIJA 2EPIA 4QWCA 4DX5A 2B9WA 3OT9A 3HD2A 2VG5B 1S6QB 1FD8A 4O3QA 5AE3A 2M4MA 3NOCA 4HHHA 2OD6A 1B7FA 3IWLA 2K7JA 3LGMA 3FRZA 4OYBA 5KFBA 1IR0A 3NOGA 5HVGA 3MM9A 4K4WA 1EP4B 1H2UX 3MR5A 3EGZA 4X64F 7FDRA 1UJ5A 2EBEA 1RZMA 2CXEA 1HPZB 1FDDA 2XGPA 4RW9A 3DLHA 3CC4S 5GAHI 2RSQA 1DZ5A 1KFSA 2UUCJ 3TAPA 3BN7A 3DC2A 4EO6A 1KKHA 4Q0BA 3T5KA 1NJXA 1VC5A 4FPRA 4DBQA 2XBPA 2RKIA 1Q8BA 4LIWA 3SMZA 1H2TZ 1RWKB 3AD7C 3NGKA 3VAJA 3EGNA 1HNXJ 3GIJA 2E7VA 5HJYA 3MI7X 1KRPA 1ZBTA 4UY85 1EB0A 5LSLA 1F0XA 1TQLA 4BHQA 2HHTA 2VBYA 4FVMA 4ECXA 3PHEA 1G6BA 3OXFA 2GIQA 3I31A 1XQIA 2MQPA 4LF6J 3RG6A 4I2PA 2I0XA 2GMLA 4KHPJ 2OPRB 4QOTA 2ZZTA 2IM3A 4TLQA 4PPDA 1RSCA 1C1CB 4ZPCA 4HT7A 4WWSA 1QD1A 4B17A 1UFKA 5CCMA 2W9BA 3MEDB 2FHMA 4CLYA 1S1WB 3OR1A 5K8NA 2NS1B 1UW4A 2IIHA 2DITA 2DCLA 3M7VA 5CYMA 4PRFA 1U1MA 3CCUS 2VJVA 1GX5A 1RYRA 3D28A 2DNOA 5L39A 3RBZA 2DEJA 4ALZA 3IC1A 4HACA 4OZ3A 1OO0B 4B9UA 3H98A 2ZC4A 2HZAA 1Y3JA 4LVOP 1K0VA 4CRJA 3QT8A 4JI0F 1S7IA 1ZS6A 1HYSB 4PABA 3CEDA 1B0VA 1X4FA 5L9NA 1IBMF 4RWXA 3R5GA 4KV8A 2QG9B 3M6VA 5H9EK 4UW2A 1X5OA 3UFCX 3F41A 2XS5A 5HMYA 1F6TA 3M8ZA 5I4MA 2Q6BA 1QVFR 4OJ3A 2V4QA 3HJFA 2Q43A 2ZUAA 1IBLF 4Y2IA 5E3RA 5DQHA 3DLKB 2ERRA 2HYIB 3NS7B 1PC4A 3UNYA 5KFAA 2E9RX 2CJBA 3VAIA 3MMBA 3J7AN 4JI4F 3UCZP 1WEXA 4OI6A 3E8OA 4OV6A 1X7VA 4PQUA 2HWTA 4IDKB 2FHJA 4TU8A 1MROB 4TKTA 2X7IA 2BDPA 2DR8A 2IJRA 2ILZA 5EWEA 3Q0AA 3ZTPA 3J80U 2DO0A 3MMAB 4KGMA 1LWEA 3D6HB 4Q5VA 2CPJA 2MZJA 3M6UA 1IQZA 3AB4B 4CLTA 3ZO7A 5L1IA 4PG7A 4HI2A 1NEEA 1N8RT 3MD1A 2W9CA 2VQFJ 1Q78A 2IVFB 4LIRA 2B0GA 3C6TB 3I9ZA 4RNOA 4DR1J 1JJCB 1IWAA 1R8PA 2C2NA 2VFTA 2G1DA 1YRUA 3AXKA 2PI4A 2R3VA 4YR2A 3GG0A 3GV5B 4USHA 4HLBA 2ZM6J 3EE3A 3VQSA 1HBUA 3TWZA 2VG6A 4NA2A 1HKAA 3LGHA 5HROA 4HDHA 3TARA 2OELA 3O44A 1U2CA 1CEZA 4RW7B 1CS4A 2C1EB 4RNHA 3UD5A 2HWIA 4F4YA 2JEGA 1HLWA 1WD6A 2CJKA 4HKQA 3PKYA 1S49A 2FJAB 3TA1A 3KNGA 3V4IA 3AOBA 2IC3A 1F60B 4JI2F 4K4TA 2AF6A 4MKYA 4PUOA 2AX0A 1AZSA 1JLQB 3HK2A 3DRSB 3N01A 3MTJA 1U0HB 4O3OA 4DCPB 3UNGC 2VG5A 2LXUA 1S6QA 4ZCLA 3OFFA 3IGNA 1JLEB 1SI9A 2ROGA 2JFDA 1RTHB 4ENOA 2A1BA 2BVZA 3OD2A 3DCAA 1EP4A 5FD1A 4X66F 4IOCQ 1VQKS 2AJQA 1CQNA 3HVTA 2JNJA 3KJVB 4USMA 4F25A 1B3TA 1HPZA 2IVMA 5F8LA 2Y1JA 2MQ8A 4DL3A 1KLMA 4WZMA 1VRUB 3CCQS 1LK7A 1HR0J 4ZCKA 3SXLA 2J6TA 2PIIA 1ELOA 4F3OA 2AGPA 3SQGA 5J2MB 3K57A 2VKRA 1JXVA 2W8LA 2W9AA 4X4QA 3T1HJ 2GIFA 2CJYB 4OZ0A 2O3DA 4PWDB 4WK3A 3JB9k 3CCWA 1SC3B 5LMNF 2JLEA 5J1EB 1N52B 3H8YA 2B7BB 3D0HE 4CNZA 4ED8A 3MZIA 4D3HA 4LBHA 4M1KA 3LF0A 3QZ7A 4X4NA 4N56A 3RB4A 1T11A 1DQAA 1S9GA 2H5JB 1QDUB 2ZBPA 2N7YA 4UZCA 3H2VE 1S79A 2YQ1A 1S9FA 2FHKA 3DRXA 3BBFA 3A3PB 1Q5YA 4IG3B 5A0YB 5J2PB 3GIMA 4WIIA 4QJVA 3CJ3A 3C15A 2FJBB 3CCLS 4TVAB 2AGOA 2EFQA 1JJ2R 1JK9B 1D9AA 2F1FA 4C48A 3S6EA 1RHRB 4ZLLA 2KFYA 3TRGA 3S1TA 4ZP8A 4C6AA 3BJYA 1YKWA 4XDDA 5T14A 2QN6B 1AFIA 2VPYB 1TV6B 2AJ2A 4V1Ak 1TL3A 2OMOA 1JIHA 1DLOB 1XMBA 5A2QU 1FVSA 3DXBA 3CJTA 4MMOA 1N33J 1Z2ZA 5K8MA 3H0PA 4ZLJA 5C7PA 2E5LF 2OPQA 2FQQB 5H9EJ 4CTAB 4LVNP 3JSMA 4QR1A 4OFZA 1TL4A 3R8YA 4O44B 1XR6A 1YIJS 2ZWPA 2UUWA 2GIRA 1VRTA 1WHWA 2A2CA 4ECYA 1REGX 1EARA 3DLGA 3CC7S 3W2VB 1NNDA 1UAWA 3NLCA 3BN4A 3HZGA 4FXDA 4LSLA 1HQEB 1QAJA 4E2FB 2HG4A 3MM5A 1RT7B 2FGCA 2BE7D 4P73A 4RJVA 1BC6A 1M5PC 1XR5A 4CWBA 4LQ9A 1H7WA 3FNNA 2DHGA 2VOPA 2QMXA 3W9HA 5T7LA 1S7HA 1ZETA 2HGLA 1H6KX 4WIQA 1APSA 4ZLNA 1EQMA 1MLAA 2Z2ZA 3JTPA 2XC9A 1PYSB 4H4MB 2KM8B 3TVYA 1SV5A 3NL0A 4JI6F 5KT6A 2HMIA 3MECB 3BS9A 3N6MA 3QIDA 1T05A 3PRVA 2BQ3A 3MPDA 3DI6B 3R5DA 3H59A 3KLFB 1FESA 4RKUC 3CW2C 5HMXA 1CPZA 4RW8A 5KFCA 5KFLA 3LH2S 3B6BA 2HBZB 3ENWA 3O1LA 4RBUA 3K2YA 4I0WA 2DNYA 3PO5A 4ZHRA 3EGWB 3DU5A 2K3KA 4ECUA 2ZHAA 2DR5A 2EXUA 2YKNB 2G9OA 2DB1A 2U2FA 4RW7A 3E3XA 5E41A 4XTTA 3FZ2A 3PVXA 2GGPA 2HS0A 3K59A 4I69A 1KWMA 4LF2A 1OS5A 3AXMA 2E1CA 2Y3YA 1LW2B 4F4ZA 2GVDB 2XM3A 1ZTTA 5IWAF 5DGBA 3WC2A 1VQMS 2E1AA 3H25A 4QYRA 2B7CB 1VQ8S 3KHGA 3GZ7A 4NL5A 2WCXA 3MR2A 3DRSA 2KFNA 1XC9A 2YTCA 5B0DA 2CPDA 4OYOA 4OZJA 1RT3A 1TMJA 3LPYA 1WKLA 5L1KA 1LWFB 3AB2B 1JLEA 1FCAA 1FJCA 3CJSA 1EKRA 4YR0A 3W60A 3AD9C 5E3AA 4QZVB 3VZIA 2V2VA 2DEIA 3FFIB 1VR6A 2LXFA 3QLHA 2R2RA 2KG1A 1EKSA 2LYVA 3BKFA 1Q7YT 2XMUA 3O2IA 2N7CA 3KJVA 2FLOA 3K8WA 3DOKA 1IBMJ 3QT7A 3SFGA 1LV5A 1VQYA 5A8RB 4NWBA 1VRUA 3N5BA 3KLIA 2NREA 4I64A 1BQNB 2GCFA 1ZM4A 5K20B 1U7LA 2EK1A 4CO1A 4DL0C 1RTDA 1TFWA 2RH3A 3I9V9 4NMXA 3PM9A 2W2MP 4DX6A 1YJTA 4CO4A 1LW0B 2RDIA 4PWDA 4M94A 3C66A 4ZN3A 4DR5J 5KG0A 2YPYA 3M8PA 5ETNA 4PG5A 5J1EA 1JMTA 3T9ZA 2DR6A 3KLHB 4AL6A 2HIYA 1EETA 3A12A 4TY8B 1UW9A 1ACMB 1DJ0A 4QWAA 1TL1B 4K7QA 1S57A 1WSVA 3C14A 4L76A 4WFAQ 4ED7A 1KR4A 3HJVA 2ZH2A 2CWXA 4HVZA 4QU7A 5AXNA 2J5AA 3OQ2A 2VH7A 4OI3A 2B3TB 5J2PA 3M2RB 3KWMA 3M1VB 4I56A 3TX8A 3V81B 4A8YA 2NUHA 4YQWA 1Q7LB 3L7UA 3A1YG 4NLOA 1QSLA 2B6AA 3OFHA 3V6KA 5H9FK 3UDVA 2QA1A 4TLRA 2AV5A 5KFTA 2UP1A 2AJ0A 2QLBB 3T6BA 1FA0A 2E1RA 2AD9A 1D1UA 1YJUA 5KFKA 1F2HA 4LFCF 2VPZB 5LMUJ 4A8XA 3W7BA 2CQBA 2C2DA 2HQFA 5ETTA 3WBZA 3RW7A 4B9SA 1NM2A 3KOAA 4DI6A 3KLGA 1QE1B 3N79A 2VDIA 1LXJA 1EIYB 2ZH3A 4Q8FA 4RW4B 3HSDA 2DYAA 3UN3A 2XZWA 1UFWA 3L7PA 1GXTA 3D1QA 4HYKA 4KC5A 2ZJQQ 4OLOA 3TUZC 4O44A 3MMCB 3GIRA 4ZP7A 3RYLA 5C25A 4NI2A 2HZVA 1HNVA 5D78A 4X4OA 3HFKA 3P96A 4ZJLA 3EYZA 3EVMA 3N6NA 3MDFA 3FK4A 1GTHA 2PA8D 1OPZA 4GKJF 2E1MC 5AXMA 4L72B 2UUTA 3G82B 4AYBD 4P52A 4K59A 1O6XA 1TK8A 2ZOMA 2HVEA 2JVRA 4IQMA 1WKKA 1ZOTA 4F67A 1FWKA 4X66J 2X3GA 2FLNA 3TAQA 2Q66A 2ASJA 3H7HB 3ZZPA 1FRMA 5E3CA 1AB8A 4IG0A 2B5JB 4ZK7M 5ETMA 5T41A 4OYZA 1FKPB 4DCJB 4M8LA 4F0HA 2DHSA 2DNMA 3KHRA 3KLFA 4JYAF 2ZNZA 2JEJA 4RO0A 4LF8F 3W65A 4KKOB 3D6MB 3VVUA 2GS8A 3OVSA 4MK9A 3D3CJ 1GFWB 1CJTA 2HK2A 2MZSA 1M5HA 3QWPA 5GAEU 3UN5A 3MM7A 1IKVB 5AJ3F 2ZDOA 4K2XA 3P5BP 1PSDA 4ETZA 4HTIA 2YKNA 1S12A 4DFJA 1XIQA 2C3PA 3CUNA 4UOGA 3W66A 1HW9A 2RVJA 3H4BA 3LW5C 2V4RA 4OZ1A 1NO8A 2CPHA 4K0KF 3LAMA 4YDDB 2MTLA 2LMIA 3G96A 4CH1A 4P2FA 2BXJA 3HULA 8ATCB 2VOOA 3L3CA 2DPJA 1N5YA 1IJEB 2RHSB 4HHUA 1IWGA 4YUDA 5B0FA 3JS9A 3SCLE 3W1YC 3IN5A 5KFQA 1JX4A 4PXBA 4FS1A 3NCQA 1G3OA 1YHQS 2IA0A 1X9MA 1KC8T 2HQIA 2D3O1 4B9TA 3VZHA 2IHR1 2K8GA 2A6MA 5FJ4A 1V6HA 1VIOA 1H7XA 4ZCIA 2XLJA 3ZTRA 2RILA 1JLCA 1Q5VA 5HLFA 4UF4A 3TZZA 2KXFA 3I0SB 3QYYA 5A8RA 2V67A 1VBXA 4QQBA 4CQ1A 2I38A 2GVZB 2IM2A 4K8RA 3ZFVA 1YSJA 3ZC4A 3TEGA 3D4JA 2ABYA 2IAJA 3ZZZA 3FCVA 3ZZOA 1M1KT 1WSRA 2LEBA 1PG5B 1M5VC 1RWMB 2DH8A 3KUGA 1RYSA 1QM9A 1VQ7S 3CT9A 4F0KA 1UEVA 2KI2A 2RF2B 2H4WB 3OPKA 3R9LA 2XLKA 2E29A 1S1VB 2UXBJ 3PTWA 4RUAA 1VQOS 5AXKA 1B0TA 4N8OA 2JZ5A 3I82A 3K5LA 4R8UA 1YG0A 3OVBA 4B3TJ 3MD3A 4FBUA 4Y34A 2CQ4A 3M8SA 3BO2A 3FUYA 4CT9A 2VBWA 3DOMA 4MTPA 3ZZ0A 5CZXA 4JI6J 4DS4A 3LUYA 4DR7J 3QRQA 4QYZK 3M1VA 1CJVB 1P9YA 3V81A 1FE0A 2K06A 5H9FJ 2FJDB 2GZOA 7FD1A 3NS5A 4IFVA 4Q7AA 1FRLA 4WFXA 2Y1IA 3JSRA 1UA1A 3Q86A 1UVNA 4F4AA 2ZHBA 3QT6A 3DGPB 2BACA 5E2QA 2BJ7A 5GVQA 1NKEA 4OHZA 3NNHA 1HHSA 3RB0A 5GAEI 1JB0C 2V9WA 3DLJA 4TXSA 2RUGA 2BMBA 3KK3B 4GVBA 1OWXA 2BE2B 2YNIA 1XNQF 2IFXA 2R7WA 4NYOA 5IZHA 4ITSA 4GKKJ 5D77A 1C2PA 4DL2A 4MJKA 5ETOA 1VISA 1RKIA 1ROFA 2J0QD 1T0TV 3R5JB 4X4UA 5IWAJ 5AE2A 2ZH9A 4ER8A 2BBEA 4B9MA 1XBWA 2X1GA 1SL0A 2J8SA 3B4MA 2UV8A 2KO1A 1S9EA 1LKZA 1WHVA 3CMAS 3H2LA 1M5KC 3CJ5A 2J76E 3GQCA 5K9FA 3FBEA 4LSZB 2HHUA 4C11A 4EBEA 2MY7A 3DU6A 4G1QA 4KO0B 1MWQA 2BR0A 1TFYA 2E7XA 1CULA 1UZHA 3EDQB 4NE9C 1WC1A 3G2XA 1WC4A 3VCDA 2AWZA 1UKUA 4J9VA 2Z57B 1E6YB 3GV8B 1Q8IA 4LFAF 1R0AA 5DG9A 3KK1B 4EGLA 2POKA 2R7TA 3R5BA 5KFSA 4DR6J 1RAJA 1S6PA 2WSFC 2KT2A 3W5XA 4RBTA 3N9UC 1K47A 3CSKA 4KKOA 2YXLA 2DRBA 4DCOB 1LWXA 2UV8G 3WZ0A 4U7UD 4BBYA 1N36J 3H5SA 1KTQA 2AZ3A 1NKCA 1X5PA 1I5OB 4XDCA 5F8NA 3CCJS 3FKBA 4F4XA 3QGPA 2Y9HA 4QR0A 3SCKE 1SUQA 2KL8A 3OJSA 4TY9A 5L38A 3LP2A 3QGIA 3KYLA 1Q0NA 2FZCB 4GRSA 1HWUA 4K4VA 3DYAB 4DMZA 5KFRA 3FVYA 4BLGA 4WP9A 4OI1A 4TQSA 1F1BB 2KDOA 2UVVA 1HQUB 5A8WB 4KFBB 4RUBA 3TA2A 5CABA 2ZEJA 1ZM2A 2OSQA 4J9UE 1GEHA 3EXYA 1S6OA 3NBPA 6FD1A 3KLEB 4DFPA 3CCZA 4KYZA 3UR3C 4DUZF 1VK3A 4IFYB 3R6LB 4DWIA 4FYVB 5B0EA 1VJQA 2YKPA 2CA9A 5IS2A 4YR3A 1SJ1A 5B0BA 2MKCA 3M30A 1FK9A 1C4CA 1RA6A 3I0SA 5EUHA 3KG1A 2V2KA 3VGTA 3CJRA 5I42A 2HWHA 4H4OA 1K0TA 1X4EA 3QIPA 2GVZA 3OR2B 3IM9A 4AD6A 2DRAA 2CVEA 2LDIA 1RHMB 3F56A 1Q16B 3H90A 4C8MA 3BGFA 2OHDA 3K5PA 1YK9A 5B0GA 1S0MA 4DV0F 6AT1B 4UOCA 2MKIA 5AXLA 4RZRA 3ENVA 2XHWA 1K44A 1YITS 2RF2A 3R1LA 1FO1A 4CI0B 3P3DA 2DGOA 3PFEA 4C7QA 1N4LA 4NLRA 4A47A 2L3MA 4WKRA 1KSPA 4ELVA 1RACB 2JLFA 3DLEB 5ETLA 3CCES 3L4BC 4P7TA 4LUBA 1Y0HA 3CMQA 4P71A 3CJKB 3CE8A 4UUWA 3PX6A 2FZKB 4DN0A 3MOJB 2BJEA 5HVFA 4R25A 4QYZJ 4U67Q 1M0SA 4CDIA 1WOOA 1CJVA 4PYAA 1H74A 3ET6A 2VUGA 5C2GA 5KFMA 4WCEQ 5KFNA 1TUVA 1F3FA 3PZPA 3TI0A 2FVSA 3MAAB 1DTTB 5ETKA 3CJ4A 2KG0A 3RAQA 1N5VA 5E5NA 4GMKA 3H40A 2VKZG 3HSJA 2VIHA 1VQSA 5LXRA 5DZ6A 3AOCA 4F4KA 3G8TA 2MYFA 3QQCD 4J91A 1UVKA 3CCSS 2DY9A 4A8SA 5ETQA 3CC2S 1L3SA 4OYAA 1JLAB 3M32B 1LWCA 4J37A 3QO9B 2X3DA 2DKOB 4UUXA 1XNRJ 4OYXA 4CH0S 3G9CA 3AHPA 1NJIT 3FZBA 1F5AA 2LXIA 1XMQF 4N7TA 1GNKA 3MCSA 4I6YA 4L3NA 4PAAA 1C1BB 4O3RA 2C3OA 5KFHA 1ZA2B 2KXNB 2AW0A 4DU8A 4EYIB 2FVCA 4DXLA 1WHXA 2W7PA 3J7YU 3G86A 4QCLA 1P8GA 3SYZA 1KBRA 3R1HA 3TQEA 2DHAA 5J2QA 2W24A 4IR9A 4QWBA 1RWOB 1IQTA 1R0CB 1OQ3A 2RAQA 4DFKA 2V9KA 3VGUA 3CO9A 1EJ7L 3IRWP 4NLQA 2FB0A 3QMQA 3FJ2A 5CQGA 2LQ5A 2L08A 2C2EA 1NDCA 1CJUB 4ZVOB 2VASA 4ZA1A 2PE8A 2BABA 2UVRA 1RQ0A 1SH2A 1BQMA 5C42A 5DQGA 2KHCA 2CPFA 5LM7E 3U27A 1FXRA 4KQZA 1QVGR 3GCWP 3DFEA 4ZLPA 4USKA 4DQQA 2DNHA 3ITHB 2UXDF 4ZMMA 2M8DB 4ZIVA 1Q86T 4NASA 3FQLA 2FC9A 2XS2A 4QIFA 1U2RA 4U7CA 5KOXA 2WOMB 3OVAA 4H4KC 3EVWA 1RT5B 3TP2A 1KVIA 3SI8A 5A6PA 2LU1A 2FLLA 3UVJA 3MUVP 4L3KA 3E01B 1HWIA 4NXNF 1HWKA 1N32F 5IFMA 2G4BA 2CQ3A 4Z2XA 2ZKTA 2ZJPQ 2R7VA 2FC8A 2OPPB 4F2SA 2F8MA 1BUXA 5L9XA 2I6WA 4W4MA 3F44A 1JLGA 3TR5A 1RAIB 2VFSA 5JVGQ 2HRTA 2G2OA 2E1PA 1G4CA 5KG2A 3L95X 2LQ9A 3TJ9A 2VFVA 1SXLA 3DRRB 3PW5A 2MHNA 5KT7A 1HQUA 5A8WA 4KFBA 2W2QP 2ZKUA 2RRNA 2WB1D 4NRTA 2HQ3A 1T95A 5KFEA 1MMNA 2Z58B 2PFDA 1UMJA 2VBZA 4C8ZA 1YJ7A 4OI0A 4J9RA 3KJNB 1HI1A 1X4AA 4U7UK 4PG4A 4CZCA 4FF3A 5IT9Y 3ZNJ1 5M2UA 4C2MA 3BGOP 1UVLA 1UEUA 4QW9A 3OTBA 5DDPC 3THTA 3V6HA 3IG1B 2GA7A 5HQ8A 4K2JA 3VTIA 4HTJA 4WTOB 1D3WA 1K1QA 1HBOB 2UUCF 4LR8A 2IBOA 2MKHA 5IV4A 2ZZMA 1FJ7A 4XPCA 2VFUA 1AXQA 1NKBA 1VFJA 1PGZA 3J7YI 4NA1A 2GHWA 1OJ4A 3M6XA 1IR2A 1MWZA 2UU9J 1F9EB 2MJUA 5D4NA 4X4VA 1P1LA 1RTIB 4RU9A 1C0TB 3U7JA 4F7VA 4ZCMA 4DPWA 1C0UA 1GMWA 4O3PA 5BR8J 2XMKA 1WOPA 4OJHA 2AYMA 3OUYA 3Q2TC 3PIPQ 1FERA 4DPYA 1RAOA 2ZOGA 3OBIA 1PC5A 3DRPB 3RRHA 2AX1A 3FMBA 3KUEA 4H54A 2HBYB 4LF6F 1CVJA 3L09A 4KHPF 4TU9A 1S1TA 1FX4A 4C8KA 3BBCA 3HXMA 1CC7A 3D6FB 1WC6A 4QWEA 3OTOJ 1S99A 4QW8A 4AQYJ 3GIIA 1HWLA 1MU2A 1S4FA 1JNRB 1RWVB 4CYUA 1DTTA 4CO2A 3CJ2A 3UI3A 4M5KA 3AJDA 3N4WA 5A8KB 2J7WA 3PRBA 2PI5A 5FDLA 2YX4A 1UFLA 1T9VA 1KHWA 1HHTP 2DXEA 1BQNA 1TKZB 4DR2J 3PJXA 1IKXB 4KR0B 3AFGA 3T1YJ 4JBCA 1FDNA 2HNZA 5E7OB 5K8PA 4CO5A 1WUUA 2HFZA 3K5MA 4IH6A 2OPSB 2BM0A 3CMES 3H4DA 2GQCA 4J9SA 4DG1A 2BA9A 2F63A 2KJWA 4I4BA 4ECSA 5SZTA 2GMHA 2QIFA 4DL7A 3KMQA 1S10A 3QNWB 1JQGA 1GMVA 1KVKA 4ECVA 3UCGA 2YWEA 1GXLA 3M6WA 4DN9A 2R7QA 3W9JA 4WE1A 2YVSA 2W8KA 5E3QA 1ZAXA 2BE9B 2MLXA 1CJUA 5I3UB 1AYEA 1IKYA 3W63A 1H3DA 2XYPB 3RUBL 4M95A 3MM9B 2Z2LA 4LR9A 5SUHA 2O66A 2R2UA 4ICLA 5AT1B 1VS3A 4XIUA 4NLXA 1N5TA 3SBMA 1KQSR 1F5CA 3V6DA 2B4PA 4QR2A 2V69A 3O5TB 2K3IA 3M8QB 4QPXA 2PDAA 3K58A 4IRDA 4DF8A 2VQFF 1T3OA 3VR1A 1R8HA 3GV7B 2ADCA 3W8PA 2FVRA 1H98A 1TKXA 2Z4PA 3KNAA 3TYTA 2C3YA 2ZDPA 2RKIB 4A48A 1IR1A 1AT1B 2OJ3A 1VHFA 1ZPWX 1CBKA 4LRFA 1XMOF 4A8FA 3E01A 4M5LA 1RJJA 3HHLD 2ZM6F 1NLKL 1OYDA 2FHJD 4ZDNA 2RNEA 5KG7A 1OYEA 2OPPA 4DZDA 1NXIA 2NZCA 4CCHA 3SDEA 3NCPA 1RT2B 2ZVIA 1DFDA 1TU0B 1G2EA 2C22A 3R3TA 3UPFA 2KRBA 3M9OB 2MQLA 2D3UA 4IYQA 3IWNC 4P74A 2CPZA 2W4DA 2BJ8A 4OIXA 1FT8A 1U24A 2W9BB 2LKZA 4ZP9A 3OR1B 1W7WA 4DL5A 2ZE2A 4YY3J 1NSKL 4JI8J 5CYMB 4DSKA 1QAXA 4L73A 2HSEB 3BSAA 3NS6A 2B51A 4RU2A 2OH2A 4HACB 3CDUA 4DV1J 2BM1A 2XI3A 2M2BA 5BYSA 4ANDA 1T94A 2H1YA 5HK4A 2OEKA 4CLWA 4DLEA 4V19X 2OAUA 3HVRA 4DL6A 1MG7A 5D0EA 4CLSA 3CD6S 2NXCA 5DDQC 2V6AA 2R42A 4OHWA 3AA9A 2J9CA 3WX8A 3NGRA 3RB6A 1HR0F 4RNMA 3LWMA 2V8VA 1VC6A 4KE5A 1TL7B 5DG7A 5D3GA 2NLWA 3B82A 1HBMA 4ZJOA 4ED1A 2JL9A 3T1HF 1GQEA 3M2VA 2HHSA 3A3OB 4OZ5A 4OJGA 3HKWA 3PXGa 3JAMY 2HAFA 2RQKA 4P2MA 3WDOA 2BEFA 4X62F 3MMBB 5GADI 2ZH6A 4PQUB 1JXEA 3HHLB 1RHQB 2AQ4A 2ACYA 4RW6A 3DRPA 3HSZA 5M2RA 2C42A 3R5AA 1DHMA 3Q24A 5BYQA 2B4OA 2OKQA 3MFIA 2M88A 3CF5Q 4B3RF 3I87A 2D1CA 1RAFB 4OX7A 4ED2A 1FXLA 2YWHA 5CD4H 2XULA 2YKMB 1NB2A 1Y4ZB 2GQQA 3JQJA 1U1KA 1H0HB 1VC0A 2BOAA 1FWPA 2M5YA 2B56A 3PEHA 4O3SA 2HNDB 3HSGA 2XO7A 2W9CB 2CZ9A 3DDKA 2OTLS 4JP8A 2J9EA 1I94J 2E5HA 1U25A 1LK5A 1N0UA 4CM2A 1JWWA 2EFVA 4M5MA 3I55S 4JI7J 3MTKA 2CQGA 2YNFA 3BPDA 4N41A 3PR5B 1FE4A 1HBUB 4N76A 3BO3A 1N33F 5HROB 2R9LA 2D7SA 1DRZA 2DVIA 4DFMA 3OJUA 2RDDA 1TVRA 1LNQA 3VWSA 4NA3A 1RABB 2MSTA 2GMJA 1CC8A 5HO4A 2ALZA 4QWDA 1IBCB 1RAGB 3V4IB 3W5YA 2IC3B 2ZHOA 2GO9A 3IP0A 2EVZA 3CXCR 4PUOB 2W01A 1AZSB 1BE4A 2F65A 2HRUA 3I6PA 4B3MF 1WC5A 1GX6A 2QA2A 1A0OB 5HANA 2XSJA 3H42A 2BKPA 2CNKB 3TNVA 5I3UA 2AYGA 4YN3B 1HIYA 2GNKA 1NK0A 2R8JA 3MFHA 5HQLA 2MZRA 3HVTB 4UOFA 3ILOA 4NMLA 2HHQA 3KK2A 3MPYA 3R7SB 7AT1B 4LF7F 2H65B 2BKOA 2YQ3A 3QGGA 5CAAA 2H9ZA 1KLMB 3M8QA 4MYTA 4FF4A 2ZH8A 2LEPA 3HFVA 2AKWB 1IM6A 2JC1A 4URSA 1SL2A 4U8VA 1TTHB 3D54A 1Q8KA 1FVQA 1WG4A 2VA3A 4WJBA 3SQGB 2Z56B 3BGRB 2HHHF 1HNWJ 1WEYA 1W2BR 1AFJA 5KFVA 3CCRS 4M5DA 1YJWS 3QJLA 3GFZA 1PJ6A 2YQ0A 3HVAA 4YB5A 1TAUA 3PYFA 1S0NA 4ID8A 2QGFB 2MMYA 1YTYA 2R7RA 4ZVTB 1UJ6A 3EUNA 2QSWA 2V63A 1UWBB 3LANA 3CDBA 1S9GB 2CKWA 1RT2A 4DUYF 1QAYA 2FZGB 1Q82T 1WELA 5E33A 3PJWA 3CB4A 3WQPA 2D9OA 5HP1A 2M7SA 4P2SA 1EX8A 5K8OA 3SEOA 1WF2A 1UWAA 2R7UA 2LA4A 1WKJA 3QAUA 3C15B 2DO4A 3CNQP 1GH8A 1T9UA 3PFOA 2FJVA 3DLLQ 5BXIA 3I0RA 2DGUA 2HLTA 3SIPB 1S72S 4DR4J 2KXHA 4WFZA 2DHHA 4NYZA 3DOLB 3WHIA 1NHUA 4BWMA 3IGVA 2YNGA 3FSYA 5D0GA 4G65A 4ZVFA 1TL3B 2W1BA 2BYCA 2HFNA 5BJRA 2DNQA 3RR7A 4FVCA 2CJXB 4ECQA 3V6JA 4PZVA 2OPQB 3ISNC 2ZBQA 2HHXA 2P6TA 3POTA 2R7SA 3JSMB 1S5ZA 2ZBRA 3NGDA 3GTYX 5DZ7A 3D2WA 1NSPA 2VDHA 1VRTB 1HNIA 1NZ8A 2FVQA 1TK0A 3M8WA 1TL7A 3DLGB 3A8KA 4FYXB 2RD5C 1SKUB 1J5EJ 4LSLB 5DLGA 3MM5B 4DR5F 4OHXA 2MEWA 1KQGB 4EMDA 4ED5A 4KSEB 2LDYA 3OL7A 3HHLA 3R27A 2HS4A 2PSZA 1YBAA 5T7LB 3TVZA 1UPMB 4C0BA 3BYRA 4LR7A 5F8HA 2F5GA 4ZITA 4QIEA 1SV5B 4E8UA 3HHNB 1N5SA 2HMIB 1T05B 3OLAA 3EMTA 3NKYA 4KGVB 1SJQA 3PNIA 1YBTA 4ES3A 3VAGA 4DF4A 2YKMA 4EFAC 1VQ9S 5G0RA 2OP5A 1UVMA 1RCOB 2HNDA 2OFGX 3JQMA 1PYOB 3ZZUA 4RW8B 1QTNB 3KDOA 4USUA 1JNZB 2BANA 5IOLA 3EZUA 1NRKA 5EX0A 1HBNA 1IVZA 3BB5A 1XMOJ 4ZHRB 4ANCA 5LMUF 2WZ1A 3D6TB 4LMZA 1TZ0A 4OX6A 2JEFA 2EKYA 4J9PA 3Q23A 2FVPA 2FY1A 5IC6B 1P27B 3TUIC 3VGVA 2GGPB 3IRXB 3HPOA 2N3LA 2OLWA 3QBCA 2PO4A 4EBCA 5IQ6A 1HD1A 3IS9B 4Y2KA 5IM0A 2XMVA 5HL7Q 5D15A 4N77A 2VV5A 4PWWA 2BUNA 3MOZA 3T3FA 1E6VA 1J5OA 4DV2J 4IR1A 2CPYA 5ADZA 1R8AA 3A8EA 5HQMA 2MGZB 1YRTA 1RT3B 2RS2A 5KG6A 4LFBJ 1VGYA 1KN6A 5EGYA 4MIBA 2P9GA 4U96A 2HHVA 1KD1T 1UL3A 4KH1B 5D0HA 5F0WA 1S4EA 2BX6A 1T9TA 2QRRA 4L6V3 4J9MA 4LREA 3QLHB 1ZZFA 1FFSB 2E5GA 2WONB 1T7PA 3CIMA 4DV5J 4FS2A 2FJXA 5DO2A 3DOKB 2CG4A 1DURA 4HT5A 1UETA 3UO0A 2V4JA 3KLIB 3DRYA 5KOWA 4LF4J 2C3MA 4ANEA 2FTRA 1WDTA 1GMUA 1VQ4S 2W7AA 4Q2LA 2KT3A 1RTDB 4Y28C 2ZUGA 3BGRA 1ZPVA 1XK8A 2B43A 1QSYA 4L74A 5EHHA 5D8HB 4ZVHA 1O5JA 5FLXY 4C8YA 2R7XA 2WSCC 4IRCA 1J2VA 3ILIA 2PMWA 4NZ6A 1OSDA 3M8PB 2CNOB 3HO1A 3MM8A 3Q83A 4ED6A 3W64A 4X62J 2F4VJ 2FPHX 1REVA 1EETB 1FEEA 3GFYA 1UWBA 4OYIA 2ZOFA 5IV3A 2BZ2A 3C14B 3DNCA 2BQUA 3BREA 3HLUA 2WSEC 2AJ4A 3UR0A 4ZVQB 4B3RJ 2B8QA 1B64A 2GFFA 3MAQA 1SKWA 1VQ5S 3M2UA 1RTJA 2RQ4A 1QY7A 2FLPA 1QLNA 3IAM9 5DDOC 5J2NA 2IDLA 2XWXA 4I6AA 5B0CA 3C6UA 2B6AB 4FYYB 2OD4A 2XNRA 1YJRA 1OQ6A 2ZVSA 4ES2A 3BQ1A 3DOLA 5FIIA 5ITHA 1RLDA 3AAWB 3FEZA 3PKMA 2CAJA 3D0IE 4JOUA 5KFIA 5J1PA 2DR9A 2DJWA 1TMMA 3KLGB 2MB0B 2R8GA 1U0SA 3TZYA 2OMLA 5F9NA 3QRPA 1MNEA 4ZPWR 1FTRA 2UUBF 4P75A 5C25B 2WK4A 4NI2B 3I56S 2PN6A 2EC0A 1HNVB 2GHPA 2DRDA 4C0HA 1Z4UA 3FSXA 2CQCA 1RWUA 3GJRB 3TJAA 4LSNA 4B3MJ 2VFRA 4K4UA 2EI5A 5JMNA 2PMHA 1KQFB 4KT0C 2I5JB 2UXBF 2YKAA 4MK7A 4FYDA 4Q43A 4UT4A 3E51A 3G4SS 1TKTA 5KT2A 4S0MA 1OY9A 1FFWB 4E0DA 4B3TF 4X4RA 3MURP 2KT5A 4WFBQ 3I5BA 1SC1B 3BKUA 3LO3A 4YHHJ 4NRUA 3NGTA 2ILYA 1UJ4A 2L9DA 4IG0B 1IBKJ 5A2QY 4MFBA 1S6UA 4LF7J 3NEKA 3HVWA 4DR7F 2A6OA 2VPXB 2CPXA 2ASDA 2F7VA 3P4UB 2R8HA 5JUMA 4J9LA 1U48A 1M90T 3AT1B 3P49B 4URGA 5AE1A 2HHHJ 3S8SA 2QLWA 2XG8A 1NMEB 5K14B 4QIWD 2YBVA 3MM6A 2NSBA 1CJTB 1R89A 1ZYQA 3MM7B 3ZZTA 1X4BA 3KXDA 2M8HA 2IMWP 2GV1A 2KVIA 2HAIA 2DBBA 4C98A 4G1IA 4K4YA 4EZ9A 2AEJA 4P9SA 1X5SA 1FKAF 1JLBB 3L9ZA 1WI8A 2QA4G 5CYQA 1UPPA 4GKKF 4DUYJ 2J0SD 3IRXA 2J8AA 2CG8A 5LJ3Y 2J7UA 4KPYA 3HHEA 3LTOA 2GAGC 1Q81T 1N54B 1GK8A 3IS9A 4Z7YA 5F3TA 1A9NB 3U1NA 2GJIA 6FDRA 3Q8UA 4I6WA 1S1UA 3NG8A 2DK2A 1HWJA 2JWNA 2QV6A 3JAMU 1N5YB 2GW8A 1SBRA 3NP5A 2ZBIA 1A7GE 2D3ZA 2HVDA 1S1XA 2OO4A 2HNYA 2MGZA 1V5IB 3KTQA 2XNQA 1RB0A 2O67A 4KIAA 3ZNUA 1T03A 3PG9A 3QSYB 2QT7A 2FYXA 2BJDA 3PIOQ 1YBUA 3PR4A 9ATCB 2VQEJ 2ZD1A 4YDXA 1R0BG 4DV4J 3KKFA 1YLXA 1SVDA 5KFYA 2NXUA 1VHIA 1JLCB 2WONA 1RE1B 3PW4A 5HLFB 1YGYA 3K7RA 2P8IA 2QSFA 3SSSA 4ZOSA 1KLNA 5C5JA 2QLJB 2FDNA 2NYHA 4DR6F 2IAJB 3GONA 3X3UA 1KOHA 4WF9Q 1DTQA 1R8CA 4CLPA 3B4DA 4JB8B 1NJYA 2W2PP 4PCQA 1N36F 3C46A 1MMLA 2DTJA 2Y1LB 2VPWB 3UD4P 2QO3A 4DOZA 4CLUA 4USWA 3GILA 2V2QA 3ZZYA 3J81U 4DR3J 5LXYA 4R8UB 2RUSA 3K5NA 2DHXA 3PW7A 9RUBA 1GT8A 4K4ZA 4ZS6A 5JVHQ 1Z1ZA 3NGUA 3HKZD 4U9RA 2IYIA 3DOMB 2HVHA 3AOAA 3JSYA 3IBCB 3ICLA 5DQIA 4IOAQ 1S76D 3MXHP 4BCAA 2PGCA 1RT4B 4W98A 4HI1A 2XCPA 2D9PA 2V94A 3VALA 1IN0A 2JFKA 1ZZNA 4C0OC 4IFVB 3NGSA 1KS2A 1WORA 1RTZA 5CHCB 3J7ZT 5EDWA 2EKNA 1RT1A 3PRDA 1XEZA 2VU5A 1SC6A 3SZ2A 1T9WA 3JYTB 4X65J 3Q2SC 4GVBB 3SCJE 2YNIB 5HMWA 3TAMA 3OL6A 4IO1A 4X4SA 1UCNA 2PEBA 3QZ8A 3T41A 2FY8A 2B9YA 2C2KB 3IA0A 1LFWA 4J9OA 1K73T 2UZAA 1URNA 2KM8C 1JJ4A 2AMCB 4RR5A 1HA1A 3NCRA 4MKVA 1QUVA 3ISZA 1LXNA 1U6BA 1NDPA 4XAKA 5HATA 4X2BA 2KKHA 4AE5A 1I1GA 3ADAC 2NPFA 1UEKA 4NCGA 1S9EB 1T3NA 4DPXA 2DGQA 4Y3CA 4JV1A 1X60A 1BMQB 1NK8A 4EU0A 3ETMA 3MCOA 4NX9A 4GC6A 2I5JA 2WAQD 2CQDA 3MCMA 3G6XA 4C4WA 1AUDA 4C11B 1KNZA 1MN7A 2AJ1A 2KYXA 4G1QB 1O51A 2ZC3A 1CULB 4DL4A 4DZ6A 4PG8A 4USJC 1Y5NB 2KYZA 2RT3A 1NAQA 2XYHB 2Y8WA 5IT0A 3MEGA 2OSRA 2CPEA 2HGMA 1KEKA 1OSCA 3T19A 1R0AB 1VDHA 2DGWA 2RDJA 2UUAJ 2QJ3A 1H2VZ 1S6PB 1XR7A 1Y10A 2DGVA 2WBMA 2KU7A 4OX9F 3C16A 3GP9A 3W62A 1FKOA 2HBQB 5G4DA 2RU9A 2RQMA 2DT9A 4NPOA 5K14A 4RBVA 4YFUA 5LSRA 2UXCJ 3IBWA 3QATA 2NXJA 4MIWA 2BW7A 1PBAA 2AIRB 3EX7B 2E7WA 1UVIA 1FXDA 1SUQB 5HSPA 2G0JA 4LRCA 1N34F 4FP9A 5GMKa 4IOBA 4YP3A 1JLBA 1XNRF 3C2PA 2WVBA 1H73A 3LP2B 5U47A 3TA0A 5F8IA 4ZVGA 2YKOA 4F36A 1Y00A 3T5LA 2CQ1A 4I2QB 1XWLA 3I5AA 3A13A 3RGIA 4F02A 2IJNA 2CYYA 1U2FA 4LRBA 4OX8A 3TJ8A 4K4XA 1J27A 3HHKA 2K1RB 1VBZA 1VIXA 4K5SA 1S97A 4HDGA 5KT4A 2NXNA 4O23A 3EJMA 2YNHA 5HBMA 3D66A 3T6JA 4ZPAA 3NBPB 4WK1A 3NRBA 4DDFA 4IQXA 3FRYA 1RA7A 1TL5A 3EICA 4NOHA 3TZXA 1MMDA 2XTJP 3BM7A 1FRHA 2G0CA 2MQNA 2YKQA 4OYWA 5KTQA 3AA8A 2R8KA 3DM2B 4ZJQA 2P6SA 3Q8PB 2ZZNA 3U1LA 1U1RA 4LF9J 3M30B 2G13A 1FK9B 1KOOA 1Q53A 4TQRA 3IBFB 5I42B 4H4OB 2UUBJ 3ILLA 4ILRA 3QIPB 1D8YA 2G2YA 2D74B 1RK8A 4NYPA 1FNMA 2P9EA 2LLZA 3RJMB 3F73A 1UVJA 4MYUA 1WTFA 1WOSA 2HVZA 4IH5A 2H51B 3H20A 3Q8YA 1ITPA 3CJ0A 2XYGB 2MPUA 4JI5J 1I6JA 4DV6J 3BDPA 2QTWA 1KHVA 3GE9A 2J6SA 3RBXA 4IH7A 1CJKA 3US5A 1FNOA 2OTJS 1RU2A 8AT1B 4P10A 4DSJA 4R5PA 4QPTA 1YDLA 2LECA 4FF2A 2AZ1A 3LGNA 3MAHA 4DUTA 3DXSX 1U8SA 2N3OA 2XSFA 1P1TA 1RT4A 3BEGB 3FEXB 2M70A 2PD1A 5M2PA 4ELUA 1FX2A 3G6ES 4CO0A 2CQPA 3ET6B 2J0XA 3TUJC 4D3GA 3R7NB 1Q8LA 5GMEA 2XMMA 2HFUA 3OSPA 2BKNA 2MY8A 2RHQB 3TW0A 2NSCA 4CLZA 1QUPA 3EPGA 1X8DA 3WC0A 3R6GB 4ZVSB 3CDEA 2K7KA 4C3MA 3ILJA 2RMLA 1PKUA 4CO3A 3JYTA 2ASLA 3DMJA 4CP5A 4ES1A 1B0PA 5KFZA 4F2RA 4JV5F 3NXZA 1LWCB 2MLYA 5H1SV 1U1NA 4BC9A 5KFDA 2G0IA 4NZ7A 3RZAA 1KP6A 3QWUA 2O5DA 2XMJA 5GAGU 4ELTA 4M5GA 3I4PA 2FGOA 5FLXU 2V8HA 4NCBA 3UCUP 2HHWA 5ETVA 3CD0A 2IM0A 5F8JA 1FHTA 1NU4A 3OFEA 1VQPS 3KDNA 5J2QB 2DNNA 1NPKA 1U45A 2UU9F 1UP1A 4RX6A 3H5XA 2A18A 3FBBA 3PV8A 2HLUA 4LJMA 4M5IA 1RT6B 1R31A 2XY6A 4JUZA 2ATCB 1V3RA 3BH6B 2I2YA 3O6QA 2DXDA 2HIQA 5BR8F 2CQ0A 2B8PA 4USVA 1NPRA 3V4MA 4ZPDA 1CG2A 2BJ3A 4DSIA 3R5CA 4N5SA 2WRMA 3IM8A 1BQMB 5C42B 3BZQA 4GC7A 1X4GA 5D4OA 4HH0A 3UDEA 4BC7A 2V68A 2CPIA 5DRKA 3RB3A 1IKWB 5MAOA 3OTOF 2M0GB 5D0RA 2L48A 4AQYF 5EWGA 2V8GA 4Y6IA 4GO5X 2XI2A 2KZZA 2P5VA 5ETRA 2JC0A 2XMWA 2EFPA 3EM1A 4RUCA 4PKDB 2GJ2A 3KUHA 3HM9A 3PW0A 1XN9A 4OHVA 2J9DA 2MKSA 4DR2F 3H5UA 4WZQA 3GR1A 3UVJB 1GMWD 4C8OA 3M9NB 2DIUA 3T1YF 4G3IA 3MPVA 5CH7B 4Q44A 3HT3A 4PWUA 4M5HA 4OI2A 4JI1J 1RHUB 4F04B 1WDDA 4I2QA 1JLGB 5KFFA 2ZNYA 3LP0B 3NWRA 2N82B 3UQSA 2OPRA 3HF5A 3LALA 1Q1KA 2IA6A 1C1CA 3ZTQA 2MZTA 2CJQA 2IYGA 2K1RA 2XMAA 4RWWA 3WX4A 2H5EA 3KHLA 3W9IA 3MEDA 3AY0A 1S1WA 1FRKA 3PJ9A 1U6FA 1IM4A 3OL8A 2H5IB 3ULHA 3QJPA 3VVTA 4I67A 3I32A 1MW7A 2DGSA 2NR0A 1PJ5A 2IM1A 4I1TA 2DNRA 4CLKA 4P7VA 3DM2A 1YJ9S 2A3JA 1HYSA 3Q8SB 1R6VA 2DH7A 4Z37A 4Y2CA 2QYCA 4J90A 2Z30B 2FJEB 1SQGA 4K50A 5GAGI 2IPOB 1EHWA 3FBFA 1S48A 2NYIA 5JJBA 1R8BA 5HMZA 2GAHC 3NAIA 4OI4A 4LF5J 2VONA 5CA5A 3DLKA 1IJFB 3BH7B 4A8MP 3V2UC 3OXGA 2MKJA 1Y3KA 2Z8QA 1YJVA 1C0UB 4IDKA 3A8IA 5L46A 1HL6A 1MROA 4E98A 2PMZD 1U4BA 3OUYB 4X64J 3BGLA 4O0NA 1LFPA 3RRKA 1HARA 1SH0A 4B02A 3IWXA 5D6GA 2V0NA 2XZDB 3MMAA 3G6YA 1DBDA 4QBUA 4UZBA 1SIZA 3ONQA 3Q8QB 5F8MA 1S1TB 4NLUA 2LEAA 1WC0A 3W61A 1OMSA 4ED0A 1NB7A 3HMJG 2JSXA 2M52A 4BS2A 4OX9J 4NLSA 5KFWA 3VAKA 1MU2B 3C6TA 2EG2A 4CYUB 3VAHA 2XO6A 5LL6d 4ZN1A 1F9FA 4YY3F 3AQOA 4JI8F 4FF1A 3R7BB 5FDLB 3V5RA 4N8NA 3S01A 2W2OP 3GJQB 1D8ZA 1NJZA
chains in the Genus database with same CATH topology
2RRAA 3M05A 2WOMA 3TVKA 2VZ9A 4ECQA 3ZFVA 1YSJA 3ZC4A 3V6JA 1RT5A 2OPQB 4DR1F 1FRJA 4DV1F 2DCUB 3ISNC 2ABYA 2IAJA 3DDNA 2HHXA 2P6TA 3POTA 3ZZZA 2KRRA 4F3QA 2R7SA 3JSMB 1CQMA 5KG5A 1FD2A 2MHEA 3ZZOA 1M1KT 2I9SA 2HNZB 2LEBA 1M5VC 3IAS9 3NGDA 4A4JA 2MQOA 2DH8A 2ZFHA 2X1BA 3D2WA 1QM9A 1RYSA 2CDQA 3G6VA 3CT9A 1VQ7S 1VRTB 3RW6A 1UEVA 1KVJA 1OPIA 3VAFA 1HNIA 2B9XA 2KI2A 2RF2B 2FVQA 1TK0A 1K8AT 3DLGB 1NK5A 4NXMF 3OPKA 3ISND 2DPIA 4YB6A 2XLKA 2E29A 4Y00A 4DG1B 4AL7A 1S1VB 3MUMP 2RD5C 4R0EA 4RUAA 1VQOS 5DM7Q 4TN2A 2DR7A 3I5CA 4LSLB 5AXKA 5DLGA 1B0TA 5B7WA 2BW2A 1G7CB 4N8OA 2JZ5A 3I82A 3K5LA 2JVOA 3MM5B 4DR5F 4R8UA 1YG0A 2UVWA 3OVBA 3K8VA 4I2PB 3MD3A 3H5YA 1R7IA 4FBUA 1JLQA 4WU3A 4OHXA 4PR6A 4RNFA 4Y34A 2CQ4A 3M8SA 3DRRA 3BO2A 1KQGB 3PW2A 1IUJA 4CT9A 2VBWA 4KSEB 4ED5A 1X0FA 3DOMA 4B3SF 1RDRA 4KJIA 3CDWA 2F9JA 2LDYA 4MTPA 3ZZ0A 5CZXA 3OL7A 2XY7A 3HHLA 3R27A 1TAQA 4DS4A 2WW8A 2HS4A 4WE1B 3LUYA 2PSZA 1CSJA 1YBAA 1SKSA 5T7LB 1RT6A 3TVZA 3M1VA 4DQRA 3FMWA 3V81A 4C0BA 1FE0A 2YX1A 1SIWB 1RTHA 2YNHB 5H9FJ 5HBMB 5F8HA 4XO0A 2N4DA 3RTVA 2FJDB 7FD1A 4DQIA 2KTQA 4QIEA 1SV5B 4E8UA 1JLFB 3HHNB 3NS5A 1N5SA 2MZ1A 2HMIB 1IKYB 4IFVA 4Q7AA 4YMEA 2P9CA 1FRLA 2Q79A 4WFXA 2Y1IA 1T05B 4OMFG 3JSRA 3OLAA 1UA1A 3NKYA 1SJQA 3PNIA 1UVNA 4ES3A 3VAGA 2KHDA 3O8WA 4DF4A 2ZHBA 4Y2AA 2YKMA 4EFAC 1VQ9S 3K0JA 5G0RA 3DHXA 1FF2A 4OLPA 2OP5A 2BACA 5E2QA 5GVQA 5EWFA 1NKEA 2E5IA 3THVA 1VBYA 4ICLB 4KTQA 1UVMA 4Q2MA 4OHZA 2QZ8A 2HNDA 2XMTA 3NNHA 2OFGX 2YH0A 1HHSA 3HP6A 3GIKA 3RB0A 1GXUA 3ZZUA 1JB0C 5GAEI 4RW8B 1IKWA 4DLGA 3V6DB 2V9WA 2VBXA 3DLJA 4TXSA 1Y9OA 2RUGA 4TU7A 1JNZB 4DSFA 3IG1A 3KK3B 2BANA 1OWXA 2BE2B 2YNIA 5LT5A 4DJBA 1XNQF 5F0UA 2IFXA 1O8BA 3EZUA 4CT8A 5J2MA 4KV8B 4NYOA 4N47A 2R7WA 5IZHA 1NRKA 5EX0A 4JV0A 4WU2A 1HBNA 1AROP 4ITSA 3BB5A 1HBOA 5GAHU 1P9QC 3T1AA 3OLBA 4ZHRB 1I94F 2AGQA 5LMUF 2FJWA 5D77A 1MSWD 4JV2A 4ZVEA 4LMZA 1C2PA 4DL2A 3U1MA 2DGXA 4MJKA 1TZ0A 1TKXB 4C3LA 1RKIA 2K2PA 4OX6A 1L3VA 1ROFA 1ULRA 3HDSA 2J0QD 4JI7F 3UWTA 4X4UA 3OXLA 5AE2A 2ZH9A 2JEFA 2GQ2A 4PPZA 4NZ0A 2D3OR 2EKYA 2QLXA 2ROPA 4J9PA 3Q23A 2YY3A 4KBIA 4F4WA 2FVPA 2BBEA 2JH3A 4URQU 2FY1A 1P27B 3TUIC 2GGPB 4B9MA 4B9VA 4C97A 1XBWA 2O1PA 3OFGA 3S7RA 2X1GA 3IRXB 3TO8A 3VAMA 1SL0A 4IO9Q 3B4MA 4AXIA 3HPOA 4RUHA 3GYXB 2PFFB 2UV8A 3M8RA 1QJHA 2KO1A 2N3LA 2IRUA 2OLWA 2YX7A 1RTIA 2CQHA 2PO4A 1S9EA 3LOUA 4EBCA 2QE5A 1D0EA 1LKZA 2BRLA 5IQ6A 1WHVA 1G1XA 2ZITA 3CMAS 1HD1A 1C0TA 3IS9B 4HH1A 3H2LA 1M5KC 3LP0A 4DEZA 5F8GA 3MEKA 4Y2KA 3CJ5A 3SDEB 1Q79A 2J76E 1Y5IB 2XMVA 5IM0A 3PX0A 5HL7Q 3GQCA 4N77A 2VV5A 5K9FA 3RAMA 2WBRA 4IG3A 2BUNA 3MOZA 4NLPA 3ETOA 5A0YA 3UE2A 3T3FA 2HHUA 4OZNA 4C11A 1E6VA 4DS5A 2HHPA 4EBEA 2E66A 4JI1F 1J5OA 4R5PB 2MY7A 4AL5A 3DU6A 4IR1A 5KG3A 2CPYA 5ADZA 4G1QA 1R8AA 3A8EA 1S77D 4KO0B 3H2UB 2MGZB 2X1AA 1YRTA 1RT3B 1Y5LB 2RS2A 5KG6A 2BR0A 1TFYA 1LWEB 4FXVA 2E7XA 1URRA 5B08A 4HHJA 1VGYA 1KN6A 5EGYA 2PC6A 2I1RA 4G6VB 4WXOA 2LVWA 4MIBA 1CLFA 4OQJA 2P9GA 2HHVA 2ZE2B 1U1QA 1KD1T 3VCDA 1UL3A 2AWZA 1UKUA 1XERA 5F0WA 2W25A 2QRRA 1RGVA 3PEJA 2NPIA 2OIHA 1E6YB 3GV8B 1Q8IA 4L6V3 4J9MA 3GYNA 4LFAF 2CZVC 2EK6A 3QLHB 1TV6A 5L1JA 3SV4A 5HI7A 3CCVS 3IXQA 1R0AA 2Z0GA 5DG9A 1FJGF 1U26A 3KK1B 5A8KA 3RBEA 1ZZFA 2E5GA 2WONB 1T7PA 1DLOA 3BR9A 4EGLA 3AH6A 3CIMA 2POKA 2R7TA 3R5BA 5KFSA 2QFJA 4ZPBA 1RAJA 1X0PA 1X4DA 4FS2A 2FJXA 1S6PA 5DO2A 4YB1P 3DOKB 2WSFC 2CG4A 5D4LA 2KT2A 3MR6A 1OIAA 4RBTA 4V19J 2CIMA 2X51A 3N9UC 1TKZA 1FDBA 3HX9A 3CSKA 2IBKA 1DURA 3CIZA 4HT5A 4KKOA 1UETA 1ZAVA 2V4JA 1IKXA 3KLIB 4NLYA 3DRYA 2DRBA 3TOQA 5KOWA 1BGXT 2UV8G 1F5BA 2C3MA 1HI8A 2F8HA 5DJBA 3WZ0A 3CDAA 2X1FA 2FIUA 4CTAA 3DMJB 2FTRA 2KFZA 4BBYA 2W7AA 1VQ4S 3H5SA 1KTQA 2GHVC 2VG6B 1NKCA 1X5PA 3IFEA 4Q2LA 2O01C 1FJEB 1VLYA 2CJ9A 2KT3A 2BRKA 4XDCA 4Y28C 5IQQA 5I3QA 2ZUGA 3CCJS 3BO4A 1RTDB 5F8NA 3BGRA 4F4XA 2N4CA 1ZPVA 4B3OA 1XK8A 3E2EA 2B43A 2Q1LA 1JJHA 3QGPA 1QSYA 1KFDA 4EUVA 2VC1A 4FN5A 4DSLA 3DLBA 4QR0A 3GMGA 2YWKA 3SCKE 2OPSA 3MF5A 5EHHA 2HVIA 4ZVHA 1SUQA 1O5JA 5D8HB 5FLXY 2ZH5A 4C8YA 5EX3A 2R7XA 2WSCC 3OJSA 4TY9A 5L38A 3J81Y 1YRXA 3NNCA 3W2VA 2XY5A 3LP2A 4IRCA 3QGIA 3KYLA 1J2VA 4NZ6A 1OSDA 2U1AA 3DHWC 1K1SA 5D3GB 4CIOA 3LP1B 3GR0A 3M8PB 3HO1A 2AP6A 2VG7A 3D0GE 1NK9A 1HNWF 1HBMB 3MM8A 4ED6A 3TANA 4O4RA 1SJRA 3EZ5A 1HQEA 4PQAA 1HWUA 1RT7A 2FPHX 3DYAB 4K4VA 4DMZA 3OTCA 3FQKA 1REVA 5KFRA 3M2VB 1EETB 3FVYA 4J9NA 2L9WA 2C2RA 3J7Z5 3CCMS 1FEEA 4OI1A 4TQSA 3GFYA 1UWBA 4OJ1A 2AYBA 4LF5F 2RIJA 2EPIA 3AJ2A 3EXCX 2KDOA 3UW1A 4QWCA 4ERDA 2RRBA 2UVVA 2ZOFA 2BZ2A 2B9WA 1LOUA 1HQUB 2Y0SD 5A8WB 3DNCA 4KFBB 2EC0A 2BQUA 3TA2A 3BREA 2VG5B 3HLUA 2WSEC 4DHVA 1ZM2A 2OSQA 2AJ4A 3UR0A 1S6QB 4OZLA 1FD8A 4P6QA 4O3QA 5AE3A 3PDNA 2GFFA 2M4MA 4IUFA 1B64A 2OD6A 3MAQA 1SKWA 1VQ5S 3M2UA 1B7FA 1RTJA 2RQ4A 3SSQA 3IWLA 2K7JA 1QY7A 3LGMA 5E3PA 2FLPA 1QLNA 3EXYA 3IAM9 5DDOC 1S6OA 4A8QA 5J2NA 4RW6B 1SJ3P 4H4MA 3NBPA 3FRZA 2XWXA 5KFBA 1IR0A 4I6AA 2RU3A 1WACA 5B0CA 3MECA 3C6UA 2B6AB 6FD1A 3KLEB 3CCZA 4DFPA 4I68A 3UR3C 4DUZF 4UQTA 2OD4A 3MM9A 1VK3A 4IFYB 4K4WA 2XNRA 1YJRA 1OQ6A 2ZVSA 1EP4B 4RLEA 2E44A 5KFXA 1H2UX 2EFNA 4TNOA 4ES2A 2DIVA 3MR5A 3EGZA 4X64F 3DI6A 4DWIA 7FDRA 3IR6B 3BQ1A 1UJ5A 2EBEA 3T9NA 3DOLA 5FIIA 4NLGA 5ITHA 3BR8A 5B0EA 2JX2A 2YKPA 3AAWB 2MXYA 1HPZB 5IS2A 1FDDA 4YR3A 2XGPA 1SJ1A 3NNAA 1VMBA 4RW9A 5K5MA 5B0BA 4ECRA 2YH1A 2MKCA 3M30A 1X4CA 3FEZA 1FK9A 3PKMA 3QAEA 3D0IE 1C4CA 1RA6A 4JOUA 5KFIA 3DLHA 5J1PA 2DR9A 3I0SA 3CC4S 4DR4F 5EUHA 5GAHI 2RSQA 3KG1A 2V2KA 2DJWA 1DZ5A 1KFSA 3TAPA 5I42A 2HWHA 3BN7A 4H4OA 3DC2A 4EO6A 1K0TA 1X4EA 3QIPA 2XCAA 3KLGB 2YNFB 4Q0BA 2MB0B 2R8GA 3P6YC 3T5KA 3OR2B 1NJXA 1VC5A 2OMLA 5F9NA 2DRAA 4FPRA 2CVEA 2LDIA 1DAXA 4DBQA 3CGIA 1K9MT 1MNEA 2XBPA 4ZPWR 3F56A 2RKIA 1Q16B 1Q8BA 2ZBCA 4C8MA 4LIWA 3BGFA 3SMZA 1FTRA 1H2TZ 3K5PA 4TYBA 5CYJA 3NGKA 3VAJA 3EGNA 5B0GA 1TKDA 1S0MA 2UUBF 4DV0F 4UOCA 5IXUA 3GIJA 4PG6A 2MKIA 5AXLA 3OW2R 4RZRA 3MI7X 1SL1A 5IT4A 5C25B 3ENVA 4AFFA 2Q3PA 2WK4A 2XHWA 1KRPA 1ZBTA 3FCHA 4UY85 5LSLA 1F0XA 3D1OA 3I56S 2PN6A 3GG1A 1ZH5A 1HNVB 1TVRB 1TQLA 2GHPA 1LW2A 2RF2A 3MPWA 3NAHA 4BHQA 5DDRC 3R1LA 1FO1A 4C0HA 2HHTA 4CI0B 4CNYA 4C8LA 1Z4UA 2VBYA 3FSXA 2CQCA 3P3DA 1RWUA 2DGOA 3PFEA 4FVMA 4C7QA 4ECXA 1N4LA 4NLRA 3PHEA 4A47A 4Q0BB 1G6BA 3OXFA 3BQ2A 2L3MA 2GIQA 4LSNA 4WKRA 3I31A 1KSPA 3BGUA 4ELVA 1DARA 3RAXA 2VFRA 3BSOA 2JLFA 2MQPA 4K4UA 2B4VA 2EI5A 4ID5B 3DLEB 4I2PA 2I0XA 3CCES 2GMLA 2OPRB 2PMHA 4QOTA 4P7TA 1KQFB 4KT0C 2IM3A 4TLQA 2I5JB 4PPDA 2JLGA 2AYEA 3IO1A 4LUBA 2UXBF 1UA0A 1C1CB 1Y0HA 2YKAA 4MK7A 4ZPCA 4FYDA 4WKYA 3GWCA 3CJKB 4Q43A 3CE8A 4UUWA 3PX6A 4HT7A 3E51A 1J5EF 4DN0A 4B17A 3MOJB 2BJEA 3MEEB 4R25A 3G4SS 1TKTA 5KT2A 1LWFA 4QYZJ 4F50A 5CCMA 2W9BA 3MEDB 2FHMA 4U67Q 1M0SA 2XSJB 4E0DA 4B3TF 1S1WB 3GFHA 3Q22A 4X4RA 3MURP 2KT5A 4WFBQ 3I5BA 3OR1A 5K8NA 3LO3A 4NRUA 2ILYA 2NS1B 1UW4A 2VUGA 2DITA 2DCLA 1UJ4A 5KFMA 4WCEQ 1AW0A 5CYMA 4J9KA 4PRFA 1JLFA 1U1MA 2L9DA 4IG0B 5KFNA 3CCUS 3FFIA 1TUVA 3MHYA 5A2QY 1GX5A 4MFBA 1RYRA 3PZPA 1S6UA 3D28A 2DNOA 3HVWA 5DLFA 4DR7F 2R7OA 5L39A 2VPXB 2CPXA 2ASDA 3TI0A 2FVSA 2F7VA 3LQVA 4ALZA 4EEYA 3IC1A 1DTTB 2R8HA 1NJWA 1A6LA 3CJ4A 5JUMA 4J9LA 2KG0A 2B4UA 1U48A 1OO0B 3RAQA 1M90T 1N5VA 1WF0A 5E5NA 3NMRA 4B9UA 4DV3F 3H98A 4GMKA 2PA3A 3H40A 2VKZG 1ZTWA 1X5TA 3P49B 2ZC4A 1VQSA 1Y3JA 4LVOP 5LXRA 1K0VA 3KK2B 4URGA 2BOPA 4F4KA 4JI0F 3BQ0A 3G8TA 2MYFA 1HYSB 5AE1A 1UVKA 3CCSS 3CEDA 3S8SA 2QLWA 4A8SA 2HGNA 3LAKA 1VQ6S 2XG8A 3CC2S 3OHBA 2VD3A 1L3SA 1B0VA 1X4FA 5K14B 5L9NA 1IBMF 1JLAB 3M32B 4RWXA 1LWCA 4J37A 3QO9B 4QIWD 4KV8A 3M6VA 3MM6A 2NSBA 4XPEA 1R89A 4UUXA 1ZYQA 3MM7B 4CH0S 4UW2A 3G9CA 1X5OA 3AHPA 1X4BA 3UFCX 2RB7A 4KHRA 3ZZTA 1S0VA 1NJIT 2M8HA 3FZBA 3F41A 1F5AA 2I8EA 1U1PA 2XS5A 2LXIA 2IMWP 5HMYA 1SQEA 2GV1A 1XMQF 1LW0A 2KVIA 2HAIA 1GNKA 4EBDA 5I4MA 2IVYA 3MCSA 2DBBA 4I6YA 2BQRA 2Q6BA 4L3NA 4C98A 1QVFR 4OJ3A 1C1BB 2V4QA 1N88A 3HJFA 4G1IA 4O3RA 2C3OA