1VHFA

Crystal structure of periplasmic divalent cation tolerance protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
SLILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords periplasmic divalent cation tolerance protein
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vhfA00
3AA9A 4USIA 3X3UA 2J9EA 5D4OA 4OZLA 3LF0A 4R25A 4USJC 1NZAA 1GNKA 3AA8A 1V3RA 3AHPA 2VD3A 2ZOMA 3NCRA 4YB6A 1V6HA 1UFLA 4D3GA 2XBPA 3N5BA 3MHYA 3TA1A 1KR4A 1V3SA 5DS7A 4NYPA 5D4LA 4WK1A 2GX8A 4YB7A 4USHA 3AH6A 1H3DA 1VFJA 2DCLA 1O51A 5L9NA 4RLEA 1PILA 2GW8A 2JJ4D 3HLUA 1NH7A 4D3HA 2RD5C 4CNYA 4OZNA 3TA0A 4C3MA 4Y65A 2XG8A 1UMJA 5D4NA 4C3KA 1UL3A 2V5HG 2Z0GA 1HWUA 4CNZA 5D4PA 4E98A 4CO2A 3NCPA 2NS1B 4OZJA 4YB5A 1XK8A 1NAQA 4CO5A 4CO0A 2ZFHA 3CE8A 2XZWA 3M05A 4WK3A 2NUUG 4CO1A 1P1LA 4RWXA 1O5JA 1QY7A 1NH8A 4RWWA 5DRKA 4ZK7M 4IYQA 2J9DA 2EG2A 2GNKA 1UKUA 3OPKA 2PIIA 3TA2A 2EG1A 1V9OA 2E66A 4CO3A 3NCQA 3GSDA 2J9CA 3BZQA 3T9ZA 1OSCA 4C3LA 4CO4A 2XULA 2O66A 4RX6A 3L7PA 4Y6IA 1Q1KA 2J9DE 2NUHA 4NYOA 1VHFA 4AFFA 2O67A 3O8WA 2CZ4A 3DFEA 3O5TB 1J2VA
chains in the Genus database with same CATH superfamily
1VC6A 1NU4A 4X62J 4F8RA 3LF0A 2GO9A 1FFGB 1FE0A 4BC9A 1X9WA 3L4BC 1RT7B 3OTCA 3PO5A 2DTJA 3MXHP 4ECWA 1RJJA 1WORA 1RTIB 2ZBQA 4LMZA 5B0AA 2CWXA 3GCXP 3CMAS 3CIZA 3W1YC 2MQMA 2QLBB 1UAWA 1RA6A 3V2UC 4NLQA 3T1YJ 3DRSA 1T0TV 1QSSA 2VODA 4LFAF 3TARA 2YY3A 1T95A 1NKCA 2RDJA 2HPUA 1VC0A 4C9DA 2VJVA 2OFGX 1VRQC 5KFGA 3DLGA 2ZFHA 2H51B 2E5JA 3HJFA 1YJVA 1ELOA 4CLWA 4PG6A 3E3XA 4GMKA 4ANEA 1BQXA 4ECQA 1OY6A 2VQEJ 1VQNS 1C0UA 4OX8A 2CQ1A 2CQHA 4QW8A 1DTTA 5KT6A 1ZETA 1GTHA 3ZNJ1 3GYNA 5HVFA 1KQKA 2MZJA 1TZ0A 3HPOA 4B3SF 2BR0A 1FA0A 1R3NA 3EVOA 3OVSA 1CS4A 1Y5IB 1A6LA 2BJ1A 4NASA 4WZMA 3OTDA 2DISA 3FBEA 2GJ2A 4H4KC 1S0VA 4Q43A 1BLUA 2WOMA 5GAGI 4QWDA 3KYLA 4ECXA 2IBOA 2VD3A 4U8VA 1OMSA 4NPOA 3CC4S 4A8WA 3J7Z5 1IKVA 5DG9A 1UPPA 4DR5J 4BBYA 1KEKA 2KG1A 4TLRA 1IKWB 1FD8A 1YK9A 4RBTA 5KOWA 1E6VB 2FZGB 2HVEA 3BGOP 1R8PA 4OHZA 1HYSA 3K5LA 1NK8A 5E2QA 5DDQC 1PJ7A 1U02A 3OXLA 5E33A 1FERA 3WC0A 2B51A 2EFOA 2RSQA 2GNKA 3TQEA 2Q1LA 4ZPBA 3GSDA 1SC1B 2ASJA 4DL4A 1KQSR 3TRGA 2OH2A 1FWPA 5IQQA 3TZYA 1RLCL 4I69A 2UXCF 4OI1A 5BYRA 3IXQA 5LMUJ 4GC7A 2QO3A 1WEXA 4OZLA 3TJAA 2UUCF 1RI7A 3R97A 3DGVA 2CPYA 2XZDB 2XSFA 2PEHA 4KIAA 4WXOA 4WYLA 3P96A 2ATLA 3MEEB 5LXYA 1YRXA 2V2KA 3EXCX 2AJ4A 3NAIA 1OSDA 1PSDA 1TKTA 2JJ4D 5F0WA 1SQGA 3M30B 2XLJA 1CULA 5GAGU 2CRLA 1WC5A 1SKWA 2JDJA 2QYGA 3PKYA 1ICEB 2XMVA 3PJWA 2PA8D 4UY8T 4H54A 2BUNA 2RDDA 1R7IA 5CH7B 5GMEA 1RYRA 2QRRA 3I32A 2HQGA 2BE2B 3IFEA 4ES3A 4UZCA 5F3TA 2OI2A 2IJFA 4FXWA 4ZVTB 4LF5J 2CNKB 2FLLA 2Y3YA 1SC6A 4WBFA 2FDNA 4DEZA 2DIUA 1FJ7A 3KG4A 3I96A 1FXLA 3UO0A 2EXUA 3PX4A 2CQ3A 2WVDA 4P74A 4CLSA 4ED8A 1K0VA 3MMCB 2GGPA 3NS6A 4QIEA 2MQQA 4H4KA 1RT5A 1EP4A 5DQGA 1FRHA 3UN2A 1PAEX 4IH7A 3OL7A 2I1RA 4K59A 1JLCB 2UXDF 1RWNB 3DOKA 3LP1B 2VU5A 1X5OA 2KM8C 2RRNA 3PYFA 2UUAF 1BXNA 4EYIB 2L9WA 3ENAA 1HARA 3AXMA 4CO5A 1NMEB 1LK5A 2FGOA 1BQMB 1U6BA 1U2RA 3MEDA 3ZXWA 2HHHF 3PXGa 1AYEA 1QTNB 1KOOA 4LF9J 3OHBA 3DRPB 3PG9A 4UQGA 4XAKA 1HWKA 3GSIA 1HNXJ 3B4MA 2VPYB 3TWZA 3HHNB 1ZZFA 4YY3F 3H5SA 2Y0SD 4URQU 3PY8A 3G87A 2D1CA 2PSZA 1JXVA 3PDNA 1NZAA 1WC0A 2HFUA 1JLGB 3OUYB 2G9OA 1FJCA 2M88A 2HKEA 5LT5A 4UT4A 1S49A 5IV4A 1H3DA 2VFTA 3OTEA 4HACB 3HVWA 4JI5F 4KSEB 1DLOA 2MJUA 1RE1B 1SC4B 4XK8C 2BJ9A 5A8KA 4DQQA 2ACYA 2CZ9A 3BKUA 2FGCA 1TR0A 1IBKJ 2DR5A 4IFYB 4ZLLA 4W90B 1T03B 2VF3A 4IRKA 1CJTB 1SQFA 5HL7Q 3H2VE 4ES1A 1TQLA 3NCQA 3KK3B 1Q78A 1K1QA 1J5OA 4MK8A 2KFNA 3CNQP 2I2YA 2DD8S 4AFFA 4I2PB 1JLAA 2W7OA 1S6PA 1OPIA 2WSFC 1X4CA 4NWBA 2WB4A 4IR9A 1RCXB 3LP0B 4PG4A 4CCHA 4JYAJ 4PWDB 1NEEA 2IM0A 1M5PC 2W4DA 3LAKA 2LCWA 3M1VB 4Y3CA 1ACMB 1RTZA 3PR4A 4HT7A 3SXLA 4IR1A 3JSBA 2DGXA 2H54B 2VOOA 2GW8A 2DHXA 1G3OA 4LSZB 4M5LA 3RAMA 2LQBA 3IS9B 3TA0A 2CKWA 4JI6F 1WHXA 1WDTA 2LEBA 3W62A 1TFYA 5E3PA 4F0KA 4CLUA 1LEOA 3HFKA 5KG0A 5CD4H 4IKAA 1S59A 1U4BA 4OX6A 2H3EB 3BGLA 1VIOA 2MMYA 1RK8A 2F9DA 5FDLB 1U1LA 4M5GA 1YJUA 3TOQA 3SQGB 2MKIA 1U6FA 3A8IA 1RAFB 3PTWA 5B0CA 3SSRA 3GTYX 3DCAA 1S9GA 1M5OC 5EWGA 2ZH5A 2ILZA 5IQ6A 1YIJS 2DKOB 1H2TZ 1NBEB 4LF2A 2HAIA 2V4RA 3P49B 2FLOA 4J9SA 2UVWA 1ULRA 4KAIA 3DU6A 2R9LA 1E6YB 2JEGA 4ICLA 4JBCA 3UE2A 4DPTA 1CJUA 1WOPA 3BSOA 4Z7CA 1R31A 3DYAA 4ECZA 1NSAA 2CNOB 1K0TA 1IXKA 1SJ4P 5C25A 3CXCR 3BPSP 1N88A 3C8YA 2NS1B 4RL1A 1NKEA 2CQPA 3NEKA 1OY9A 4IFVA 2MZRA 3P8BB 1QAYA 2L9DA 4EBEA 4BS2A 3HSDA 5AT1B 2E7WA 1QAIA 1U49A 2VG5B 1ZZNA 3MWBA 2XMAA 1RAHB 2ZZTA 3F41A 1S76D 4DFJA 3KDNA 4LF4F 3O8WA 2MQ8A 2LA6A 5KG4A 2XGQA 1S12A 4ZJOA 5B7WA 2H4WB 3DRSB 2HK2A 3DLKA 4L75A 1MWZA 4DFMA 1A9NB 4PR6A 1BWEA 4F04B 3RG6A 2YPZA 3WQPA 3DLGB 3HXMA 4B3SJ 4ID5A 1TV6A 4DSJA 3PEHA 1EIYB 1C0UB 5DETA 2HNYA 2X1FA 2HSEB 1DTTB 2NREA 3MR7A 3QAEA 2R8JA 3MPWA 1M1KT 1XEZA 2OTLS 3TUZC 3QSIA 1CS4B 4WP8A 1HFEL 1RHJB 4KE5A 1VQKS 2XZWA 2QA2A 1I94F 4RUHA 2LLZA 1DZ5A 1JLQA 3MEKA 1J5EF 1HL6A 3CCVS 2WOMB 4PXCA 2HZCA 1VQOS 1HWJA 1IKVB 2RNEA 1WC6A 4IOCQ 2YNGA 1YJ9S 2M5YA 1EARA 1HI8A 2VB6A 2VICA 2IRUA 1QE1A 2RJZA 2Q6CA 1AB8A 3H7HB 1F2HA 1HYSB 3R27A 2OPSA 2JLFA 3NRBA 3AHPA 4F67A 4UZBA 3GYXB 5IZHA 2YNIB 4DSEA 2ZH8A 3I4HX 2UXCJ 2VC0A 1OJ4A 3G82A 1VR6A 4ZCIA 2DGSA 3Q0AA 4PG7A 2UUCJ 2FZCB 5LJ3Y 1WF1A 3DXBA 2CA9A 1KHWA 1TAQA 1UJ5A 4IH5A 3ENQA 1NHVA 3SV4A 1N33F 4X65F 1WNEA 2C1EB 4LBPA 4HI2A 4AT1B 2IVYA 2NLWA 1S9EA 1UZHA 1VBYA 5H9FK 3MM7A 3EVWA 2HMIB 2V8DA 3F44A 1Q53A 1CULB 1TK8A 2HHWA 2W2QP 4J37A 3AD9C 4QIWD 3M9MB 4DR3F 5A2QY 2ZVSA 4DSKA 4ZP8A 4N8NA 3AH6A 2O1PA 3J80U 3ZZPA 4ZITA 4R0EA 4F3QA 2XS5A 2CPIA 5D4NA 1FFWB 2F8HA 3EM1A 3RBDA 2BV3A 3U1MA 2AYEA 1VOMA 1H74A 2VONA 3NOGA 1GMVA 1VQYA 4WFBQ 3CMQA 2DR8A 2F63A 1NK5A 2B4VA 4F26A 2DHSA 4URGA 3LP2A 1HMVA 2W8KA 1B0TA 2UXDJ 1Y5LB 2GGPB 2IHR1 1FX4A 2M3DA 3FEZA 3CJKA 4QWAA 1EP4B 2UUAJ 2ERRA 1WG4A 3BSNA 1RHUB 2WVBA 1MMLA 1TFWA 1I51B 2IM3A 4Y2AA 3R2DJ 1M5HA 4Y2MA 1WOOA 2IRYA 4UY85 3DOKB 4N7TA 2HHHJ 4A8OA 2FVRA 3SCIE 3FZBA 5I42B 2MLXA 4I56A 1VRTB 2AJFE 2V2VA 4YR3A 4D3GA 4FVMA 4YN3B 4YY3J 3MEDB 2PGCA 3C6TA 1NHKL 1SVDA 3GR0A 5KG6A 2C2KB 1A0OB 2B4PA 2B7CB 1VI7A 2YWFA 3J7A1 4MAKA 4O3PA 1URNA 2IIHA 2M0GB 4P73A 1FTRA 4YHHJ 3KK1A 1NH8A 2DNOA 4JI5J 3M8RA 2ZHOA 5KT5A 3RB4A 4DPXA 1V9OA 3G6XA 2V6AA 3PW0A 3PFOA 3CCES 4CIOA 1OYEA 5HN0A 4NL5A 4JV0A 4G1PA 5CAAA 2HHXA 3T19A 4ED7A 2CQ2A 2JOQA 5KT4A 4NLSA 5L1LA 3GIJA 1DLOB 4F50A 2XY5A 5A8KB 3MOZA 4M8LA 3TI0A 1FVQA 4CDIA 2MKJA 5HBMA 1SL2A 2YKAA 4KQZA 4LSLA 3A13A 1KR4A 2GMJA 5D4LA 2OUGA 2CUYA 4OLPA 4DHVA 5IT4A 5L1KA 4I2QA 2HBZB 4ZVUB 1D9DA 3L7UA 3CUNA 4CLTA 2RD5C 4TYBA 1AFIA 2F7VA 4M95A 1RT1A 4ETZA 1J5OB 3N0VA 3VZIA 1Y11A 4IDKA 4HR2A 1KWMA 1JLAB 4CRJA 2GIFA 1S6PB 2EK1A 1WI6A 3GU0A 3O2IA 1U2CA 1H7XA 2UUTA 2MQLA 5EX3A 2WSEC 4MIBA 4DBQA 2W2NP 4JI6J 4W98A 3V4IB 1XJWB 5MLCV 2V63A 2I8EA 4FKXA 1FXDA 2VDHA 5A0YA 1JJ4A 2KYXA 2VH7A 2N7YA 5CYQA 3AY0A 6FD1A 3GE9A 2OEKA 2CNLB 5KT7A 2F4VF 3MPYA 2A3JA 2HS0A 3JSMB 3QYYA 3A3NB 4NLDA 4F3OA 4A46A 2BBEA 3PRVA 2HQDA 3IGNA 1TL5A 1XR7A 4QR1A 3SV3A 4NEZA 4AXJA 1VCTA 4FZVA 1V3SA 5JVGQ 1DQ9A 2X1BA 2KM8B 3X1LB 1PILA 5A76A 5KFBA 5DLGA 3N6LA 4WFZA 5KFJA 4PYAA 2XO6A 4ZVHA 1S4EA 2QJ3A 3TZZA 2XI2A 5F9NA 2E9TA 4N41A 1U1OA 3I4PA 4EZ6A 1KTVA 3BKFA 3KLFA 2DK2A 1CC8A 2XYHB 4L3NA 1UJ4A 4NX9A 3PHEA 1P1LA 2W4PA 1O5JA 1S9GB 4X66F 3AT1B 2E1AA 3ZZRA 5D0GA 3NGDA 2AJ2A 5HLFA 2GMLA 2KRRA 2XY6A 3W9HA 2R2TA 2YX4A 4ICLB 5IT9U 1HW8A 1CJUB 2ZBRA 1NDCA 3H40A 3MMBB 3DYAB 4NLPA 2DH7A 2C2EA 5C25B 1JLBA 2COLA 4DMZA 2JL9A 3IN5A 2Z2LA 2UXBJ 2BKNA 4IFVB 1ZA1B 2MKSA 4EFAC 2DGQA 2A10A 4NI2A 2QMUB 1FDNA 2QC3A 4LF4J 3V6KA 2CXEA 2DNMA 3MPDA 3SSQA 3KLGA 1FHTA 4USVA 5BYSA 2C2OB 3I6PA 3LGNA 4UUXA 2KRBA 4DSFA 1RAEB 2X3DA 1APSA 3J7AN 3HHLC 2Z2YB 3NAHA 1IM4A 2IBKA 2ZH7A 7FD1A 4CH0S 4RWXA 2ASLA 2ZEJA 3LGHA 1N5QA 1FWKA 3DLKB 4R8UA 2WBRA 5C2GA 1SI9A 2XCAA 2ZH2A 1Q8IA 3ISZA 2C42A 2BZ2A 3BBBA 1U0HA 4ZIVA 5LM7E 2NUHA 4FF3A 4ID5B 4WWSA 2DB1A 3VTIA 2MQPA 3BKTA 1TV6B 2B8QA 1QUVA 1I94J 1F2GA 1Y5NB 1J5EJ 2HNYB 3RR8A 3SQOP 2MXYA 4ZP9A 2HHPA 4KKOA 2ZOGA 5A8RB 1RXOB 5AJ3F 3T5HA 2IY5B 4P10A 4MH8A 3VAIA 3M2RB 3PACA 5HK4A 5DDRC 3L09A 4DG1A 4NLRA 4IO9Q 3LO3A 1YQHA 1XMBA 3MCSA 3CJRA 1X31C 4Q44A 2YNFA 3BGFA 3LPYA 5D0EA 3WIUA 1QE1B 1U8WA 2RQMA 4WE1A 4ZK7M 1N54B 3CDUA 2OPSB 3KFWX 2R7QA 2DNPA 3I9V9 3GFYA 4I1TA 1PGZA 4RUBA 1KQFB 3T9ZA 4QW9A 5K9FA 3UR0A 4B9UA 2W9AA 3SDEA 3M8PA 2ACMA 1QAJA 2YKOA 4Q0BB 4QIFA 3G82B 5CXTA 1N33J 4PYDA 4ZPCA 1N32J 4FP9A 4X65J 2CG4A 3IA0A 4ANCA 2FB0A 2G1DA 3KXDA 1XN9A 2KG0A 4ZJLA 4V1Ak 3TA1A 4ALZA 3FQLA 3MM8A 2XMWA 3U02A 2GVZA 2AEMA 1MNEA 2HQIA 5AXNA 1C1BA 2J8AA 4ZVPB 1WI8A 3A4TA 2KL8A 1FRLA 1SUQA 5KFAA 2WTFA 1TELA 1S9EB 4DR3J 3MM7B 1XK8A 4ZPVR 1Q79A 3VQSA 3CULA 4ID8A 1X4EA 2GC8A 5J2PA 3QT6A 4KC5A 3AQOA 2I5JA 4CLZA 1NK9A 2IYGA 2J9DE 2HGNA 3PJ9A 4RW7A 3FGVA 5F8HA 3H8YA 2A6OA 1YSJA 1J2VA 2B9EA 1GXLA 1VIXA 3HD1A 2D74B 1NK7A 2CG8A 4NLYA 2SXLA 4LR7A 4CZCA 2BOAA 1DURA 2V8VA 4ANDA 3UD5A 3OJUA 3W2VA 4JOUA 4J9RA 4DL0C 4HEA9 4F4ZA 4C8MA 3LP2B 1HMVB 3TUPA 2UV8A 2NXEA 4CNYA 2DNNA 2IVMA 4EYHB 3CJKB 2BJ7A 2HK3A 3RTVA 1RISA 2ZUGA 3IP0A 1RGVA 1UPMB 3W8PA 4RNMA 1U24A 4P6QA 1RWKB 3VQTA 1IBLF 5GADU 1CC7A 3T5LA 2MY8A 1KQGB 3Q83A 3FZ2A 4N76A 2K8GA 3HHEA 4NYOA 4WYWA 3M9OB 5B0BA 2O67A 3C6TB 2P2CB 3DLJA 4O3SA 4X64F 4ECTA 1FJEB 3IO1A 4PWUA 3VALA 4UOCA 4USJC 3OFFA 2J6UA 3QRPA 5GMKa 3C2PA 1S1WA 5CCMA 4NZ0A 1UVKA 2RILA 2G4BA 3KK1B 2GJIA 3RRGA 3BB5A 1WHYA 4ZCLA 4X4PA 5ETMA 2EBEA 1T9TA 1S1XA 1X5PA 1LWFB 2B6AA 4J7CA 3CCSS 2FY8A 4HHUA 2OGUA 5A8WA 4F0MA 4ECRA 3ICLA 3QFWA 3HKWA 2RT3A 3D7SB 4O0NA 2K3IA 4N47A 4Q5VA 3QSYB 5M2RA 1FEHA 5M2PA 1RTDB 1HBOA 5KFHA 1OPZA 2CADA 3QQCD 4LIWA 3W5XA 2Y1JA 4IQMA 4J9VA 5HBMB 5U47A 4OX9F 3DRRA 4LSLB 1YTYA 1HPZA 1RB0A 3RB6A 2OJ3A 1U1RA 2PE8A 4I2QB 1X5TA 5KFCA 3I5AA 3OLAA 2CZVC 1O6XA 4WFNQ 4XDCA 1RABB 4FKYA 1S1UA 4PXBA 1RT1B 4YFUA 2EFNA 4CLPA 4OYAA 2LU1A 4IDKB 4LF7F 2RKIA 2QE5A 2W24A 2ZOMA 4NMLA 4J91A 3EZUA 1S79A 3N01A 5DGAA 4USHA 1TUVA 2ZBIA 3SI8A 2M8DB 3B6BA 2ILYA 2F4VJ 3JQJA 2NR0A 1NDPA 3PJXA 1NJWA 4DPWA 8RUCA 2B9XA 3KJQB 3BBFA 1V5VA 5A0YB 3CDWA 1RWVB 2I9SA 5J2MB 1MW7A 2RRAA 1Q82T 3J81j 2YTCA 5E3AA 3NWGA 5KG7A 4XDDA 5DDOC 1MU2A 4OHYA 1KSPA 3TJ8A 2PMWA 3TX8A 1JJCB 2OKQA 2JEFA 3Q86A 1VQ4S 2EWHA 3QGIA 4L72B 1K1SA 4O4GA 5KFVA 1FKPA 1X4FA 4OV6A 2NXCA 2VG7A 2VA3A 1N48A 4X66J 1URRA 3HT0A 2UVUA 2ZJQQ 3D1HA 5F8MA 3KLFB 3RBXA 2W9CA 1RU2A 3ZTOA 1QUPA 5JVHQ 1R0AB 5C24A 4DL2A 2R7WA 4E2FB 3IR7B 3PRBA 4ECYA 1JLFB 3M8QA 3DXSX 4DQPA 2XYGB 2AU0A 4RW6A 4ZVQB 3PCOB 4F4KA 2AZ1A 1F60B 5HLFB 2C2ZB 3IWLA 1GTEA 2UP1A 1N6QA 4OL8A 1T3OA 3SZ2A 3R6GB 2GVDA 1RDRA 1KHVA 2LEPA 3QRRA 1JLBB 1ZOTA 3CGIA 3DLEA 1N34J 1X4BA 1RKIA 1RQ0A 1IN0A 1T9WA 2CPJA 4YR0A 3BO4A 5HMYA 1EQ0A 4NI2B 2BANB 1RUSA 1FK9A 2QL7B 3KLGB 2J7KA 3R3TA 4ZS6A 3D9BA 3P3DA 1S72S 2G0IA 2MY7A 2PC6A 1NNDA 3ULHA 2LQ9A 1RT7A 2V4JA 1U1QA 4WK1A 4YB7A 2PMHA 2PDAA 4R8UB 3C66A 2CJBA 2U2FA 4EK2A 2G2YA 2BYCA 1YG0A 2YKPA 4UF4A 3LQVA 3Q8PB 4QWBA 3UWTA 4YP3A 4OHXA 2K3KA 5AJ3J 4J9PA 2C2MB 1JNZB 5D77A 3CDEA 3WHIA 3OQ2A 4H4MA 2F5GA 4Z7YA 3HMJG 2YWGA 3MM9A 4OHWA 1QY7A 2XO7A 1B0VA 3SSSA 4KGZB 1GFWB 4OZ1A 2GHVC 5H1SV 3EDQB 1JX4A 5B0GA 3DLBA 3AODA 2XLIA 3ISNC 4DG1B 3DFEA 1HIYA 4R25A 2ZM6F 1VMBA 2OO4A 1F1BB 2NZ4A 2HBYB 1CJVA 4KO0A 4ZCMA 1S1TA 1LK7A 4BCAA 2XBPA 1WHWA 2OD4A 5HMXA 3BGRA 2XHCA 4DL6A 1NZ8A 4ELVA 5DG8A 2HWHA 3FBFA 3CEDA 2YKMA 2EFQA 1VC5A 2OAUA 2ZWOA 4NLGA 4ZJQA 3RW6A 3SCKE 3OL6A 4GVBA 3SDEB 3M8PB 4OIXA 1P9YA 3BV8A 4O0IA 3RRHA 3ILLA 4P2FA 5D6GA 1FNOA 2CJ9A 2EG1A 3MF5A 1RWMB 2HNDA 2CNNB 2FJXA 3PZPA 2W7AA 2J76E 2KVQE 1TL7A 3AOAA 3GLJA 3HJVA 4NCGB 4CP5A 4K4WA 4P7TA 1C1BB 2ROPA 3K7RA 3I56S 2QT7A 3ETOA 1KKHA 4ZLJA 3GFZA 4LBIA 3OSPA 3MUVP 4ZLNA 3CC7S 4A8QA 3SBMA 3V6JA 3MR6A 4YB6A 4JI2F 5ITHA 4PUOA 2V2QA 2RVJA 5HAOA 2FYXA 1BUXA 1YJRA 4FDFA 1SIWB 5J2PB 3ILJA 2U1AA 3BYRA 5K14A 2Z2MA 2I5JB 2AT1B 2DEJA 3V4MA 4RW7B 3W9IA 2EKYA 4M94A 1VYAA 2YBVA 4RJVA 2IMOA 3HHDA 5LOQA 3GIKA 1RAOA 3HK2A 3W2VB 4KPYA 2OTJS 2F1FA 4LFBF 4PRFA 1T7PA 2DGOA 1EHWA 4DOZA 1EQMA 1HR0F 3MI7X 3NKYA 5E7OB 2R8GA 2CQDA 3RU0A 2DO4A 4YEAA 1IBLJ 2VDIA 3LAMA 4DV3F 5CYJA 5LL6d 4I6YA 3M2VA 2DNZA 4ELUA 1QLNA 3HCXA 3VVTA 3NS5A 3CDAA 4DR4F 3D0IE 1P27B 3RW7A 2ROGA 3K8VA 4X64J 4P52A 5B0FA 2XYPB 2MSTA 2H5EA 1WUUA 2QL9B 2G2ZA 3GG1A 4B17A 3Q2TC 1SKUB 3ZZYA 1UWAA 3I0SA 1HNVA 2FIUA 3U27A 2QA1A 5GAHI 1PYOB 1RWXB 1OS5A 2IAJA 3W60A 3M2UA 3KMQA 1BQMA 3DDIA 3CD5A 1S1WB 3FMWA 4TLQA 2JSXA 4OJGA 1XC9A 5LJ5Y 4B3RJ 3ZTQA 3KG0A 2CJXB 4Y6IA 1G6BA 2FC8A 2QFJA 1UFWA 4N8OA 4KH1B 1WF0A 3HP6A 3BREA 4MTPA 1WTFA 3UI3A 4Y2KA 4GRSA 1S1XB 3PV8A 4P9SA 4NYZA 5CZXA 3BEGB 3QLHA 2B6AB 2AGOA 1UW4A 4U9RA 4B9TA 1LV5A 4OX9J 4LF9F 1CG2A 2AX0A 3W3SA 3GR1A 3OUYA 3CF5Q 2AF6A 1LFWA 1TVRA 3V5RA 1SB6A 2FHKA 3DRRB 4HACA 3G4SS 2XI3A 3ZTSA 4DWIA 1TK5A 5IM0A 4NCBA 2MYFA 4LF7J 2RF2A 1X7VA 2DCUB 3H98A 2AD9A 3FDSA 5FJ4A 5F41A 1R43A 1X4DA 1M5SA 2GCFA 1O8BA 1U8SA 4K4SA 1U25A 2YNHA 1NSQA 3OW2R 5HQMA 2NPIA 2J9CA 2RKIB 1AA1B 5HVHA 1NB2A 1U6ZA 3Q8RB 4N5SA 4WFXA 4B02A 2LXUA 3BJYA 4O3OA 4I7FA 4KHPF 2MZSA 1S6QB 3RB0A 2ROEA 1Q8KA 4I2PA 5IT0A 3GP9A 1HD1A 5JXSA 4PAAA 2D3OR 1RHMB 5HROA 3UCZP 1QTMA 2MKCA 2YQ1A 1R0CB 4ED5A 1BQNA 5IFMA 2CQBA 2DH9A 3EPIA 2AGQA 1MU2B 1T05B 1TKDA 1NPKA 1RA7A 5B0DA 1CEZA 3D1OA 2VBYA 2DNLA 3G6YA 4O4GB 4OJ1A 3OTBA 1DQAA 2D7SA 2NSCA 2CQCA 4K4VA 2HS3A 1FKPB 1IQZA 1VRUA 2QYCA 3HZGA 2VG7B 1NAQA 4JUZA 2BE9B 3CVKA 1M1HA 1TKXA 3S6EA 1SL1A 2ZNYA 1Q8LA 1PYTA 3VAMA 2UUWA 2YQ3A 2W9CB 3TR5A 3NG8A 1YJTA 5C24B 5FDLA 5HANA 2VG6A 3NBPA 2LQJA 3SQGA 5LSLA 4MK9A 1VBKA 3EZ5A 3A8EA 3M8QB 1MMDA 1RT4B 3CJ4A 3GJRB 4RW6B 3TO8A 3L95X 2EK6A 4QR2A 3CTRA 2B7BB 5KFSA 1WHVA 2GVDB 3HSZA 3NLCA 5ETVA 4C6AA 2KXNB 4YB1P 5C7PA 2J0QD 2QTWA 3M8WA 3SIPB 4JB8B 3KUEA 3DLEB 2RQKA 3NGUA 2E5IA 2YWHA 3H2UB 4DLEA 1VS3A 2HIYA 3VAGA 3N9UC 2AEFA 4IRDA 1GEHA 4BWMA 3G6VA 1FK9B 1LOUA 1M1GA 2NXNA 3UQSA 1UETA 4NRTA 3A3OB 3NGTA 4BC7A 2EG2A 4C0OC 5AE3A 4N56A 3MPUB 4ZP7A 3FEYB 1Q5VA 1BY9A 4C3LA 1T9VA 1K47A 2V4JB 4IRCA 2EBGA 2F8EX 2PD1A 4K2XA 1WEZA 3KTQA 2VG5A 4FXVA 1DARA 2W2OP 2BACA 2EC2A 3POTA 4DUZJ 3G2XA 2E5HA 5HVGA 2WAQD 1TP7A 1UP1A 2BJDA 1IBCB 1P1TA 5K5MA 1Q8BA 4ZVSB 1HNWF 3M8SA 3HO1A 4MIAA 1BD6A 1V6HA 2HHTA 1TMJA 2APOA 4H4MB 2DRBA 5KFIA 5H9FJ 2QSWA 3MM9B 2DCLA 1O51A 2XWXA 3D4JA 3DU5A 2GS8A 3DGPB 1S97A 2KB2A 5B08A 1RSCA 2ZVIA 2PFDA 2FQQB 2ZM6J 5LMNF 1KVJA 3HVTA 2MKKA 3E51A 3D6TB 4ZN1A 3Q2SC 1B70B 4CO0A 3W7BA 4DCJB 2WVFA 2BVZA 2Y8WA 2HZAA 3AFGA 4ILLA 4LR8A 3KDOA 2R3VA 4R5PA 4DV6F 3OPKA 3FRYA 3T6JA 4AXIA 1CJVB 4KO0B 4DUYF 3BZQA 1ZPWX 1S1TB 2ZNZA 1Q0NA 4J9NA 2FLPA 4OMFG 1FRMA 3BGRB 3J81Y 3MM5B 2HRYA 4TU7A 4EBDA 1YJWS 3DLLQ 4K4XA 4YOEA 1QVGR 2YKMB 3BR8A 3UCGA 1JJHA 1D0EA 4WPAA 4GVBB 2MGZA 1R27B 3RBEA 2AJ1A 4HLBA 4B3MF 5EHHA 2W25A 5KFTA 3Q8YA 4CH7A 2YNIA 2MQOA 2OD6A 5KFOA 3G86A 4DQRA 1TUWA 3BQ1A 2HNDB 3DRYA 2ZDOA 3K89A 4ERDA 5IS2A 2JNJA 1TL7B 2FUG9 4X4UA 1GK8A 4JI2J 2VBXA 1QSLA 3N5FA 4MK7A 1RKJA 1S6OA 2KZZA 1TTHB 4NOHA 1F9EB 2BXJA 1JNRB 3OL9A 4FS1A 4LUBA 3CT9A 1N8RT 4PUOB 3IG1A 3Q89A 3QMQA 2J7WA 4QYZK 4F02A 3H5UA 1OQ3A 3HX9A 4E0DA 4WFYA 4XPCA 5K14B 3GJSB 5H9EK 3H5XA 2HMIA 1MG7A 1IBMF 4QWCA 5D8HB 1MWYA 5IWAF 4AQYF 5IC6B 3K58A 2E1PA 1KDNA 3N6MA 3ILIA 1VHIA 4LFBJ 4Q2MA 1S9FA 3KNAA 2D3O1 2R2UA 3Q22A 2HWTA 2FHMA 4ED3A 5E3RA 2P8IA 5T7LA 1R8AA 1HR0J 2IFXA 4LFCF 1R8BA 4DV3J 9ATCB 4I64A 5AXLA 4USUA 3EMTA 3K5NA 3FK4A 4JI4F 3MM6A 2BW7A 1WKJA 4DR4J 4CM2A 4KGMA 1LWXA 3UR3C 1RLDA 2E9RX 3DDKA 3TNVA 3M2VB 2B4UA 3THTA 2M9KA 1L3UA 1HI0P 1RHKB 2XWYA 3FSIA 1UJ6A 1PG5B 2DEIA 4M5KA 4K4UA 2BKOA 3MR2A 4OZ2A 3VF0B 1WSRA 1HHSA 1JKHA 3I0SB 1HNVB 3T6BA 3QZ8A 4G6VB 5I42A 3FBCA 3VAHA 3AQPA 2FVPA 1VRTA 3GONA 2IAJB 5B09A 3K57A 1CLFA 1UVJA 3QT5A 3M2UB 5K8PA 3M6VA 2HFSA 1HQEB 3AXKA 2V50A 4NZ6A 3T41A 1I3OB 1C1CA 5ETSA 2CJAA 2KI2A 3EPGA 2XS2A 1WOSA 1V3ZA 4K50A 4J9LA 2EKNA 3ZC4A 2XCPA 2VASA 4ZDNA 3WDOA 4QBUA 5KFZA 3MTJA 1VQ8S 1ZAWA 2AWZA 2ZITA 1WC1A 2AYGA 2BRKA 4DF8A 2P6SA 4ECUA 2JVOA 1DBDA 3QLHB 3GYGA 1NK0A 1FE4A 3G8QA 3DI6A 2E7XA 3O6QA 3FNNA 1OSCA 4OJHA 5EN1A 4TY8A 3PYDA 4RX6A 4LQ3A 4U7CA 2WK4A 2ZDPA 3E01A 2EEYA 2VBZA 3M6UA 4YHHF 1TVRB 3EZOA 1RT2A 1ZM3A 1FKOA 4CH1A 3NGKA 1OO0B 1HBNB 1X8DA 5IM0B 5MAOA 2GQQA 2RF2B 6FDRA 2Z30B 4FBTA 1DY3A 4DF4A 1RYSA 1Y00A 1YRUA 3QBCA 4KFBB 3QIDA 3CCUS 4KHPJ 2RHQB 2QLWA 3R5GA 2YNHB 4DX6A 4WF9Q 5CYMB 4TXSA 3TVKA 1SKRA 1KFDA 3QIPA 5L8RC 3V81A 1NSKL 3FRZA 4I7FB 2HBRB 1MLAA 3FQKA 4DSLA 3JTNA 3MR5A 4PEOA 1WDDA 4NE9C 3PYGA 2JWNA 1MN7A 1K44A 5AE1A 4FS2A 5HROB 3HVAA 2G0CA 4WKYA 2KTQA 1LXNA 1WC3A 3L7PA 3V4IA 1BQNB 4QZVB 3N28A 3FUYA 2HVHA 1IKXA 1MN9A 1FRJA 1N5YA 5SZTA 4V19J 3GV5B 3N4WA 4G65A 1PJ6A 3JSMA 1S0MA 1D1UA 1YZ7A 1VRUB 1H6KX 2V68A 3RAXA 1TKXB 3R5CA 3KLEA 3HLUA 4LQ9A 3H20A 5C2CA 1CVJA 1MWQA 3TZWA 3TAQA 4BWJA 3C6UB 1NHUA 2VG6B 1N56A 3NBPB 2XQCA 1S57A 1FD2A 1DFDA 3RR7A 2Q79A 2E1CA 3IBFB 1YBAA 4ED0A 1DTQB 1UA0A 3L9ZA 3RJMB 5E3CA 3UD3P 1RBOB 2XULA 4F0HA 2HVDA 4OJ3A 5CHCB 3FMBA 4C8LA 3CCJS 2EC0A 1KP6A 4M5MA 1RWUA 3LGMA 4K7QA 1V3RA 4DCPB 1SH2A 3MMBA 1I5OB 1VQPS 3G6ES 1RU1A 3NP5A 2KHDA 4RKUC 1F5AA 4O44A 2VUGA 2OMOA 4OI6A 4DN9A 4ZPDA 4K4ZA 3MMAA 1UEKA 2RB7A 1DJ0A 3R5DA 4RU9A 1D8YA 3W8GA 4ZVFA 4P72A 4RR5A 2AIRB 1I1GA 4B9VA 4FYXB 2LQ5A 1HNWJ 4DCOB 1T9YA 2MHNA 1L3TA 4LRDA 4KHRA 3H5YA 3CJTA 2UXBF 4HKQA 3POTB 2WZ1A 2NUUG 3BSAA 4X2BA 4RWWA 4LSNA 3JS9A 2DNQA 2MZQA 1YVFA 1SXLA 4XIUA 5LMNJ 3MFIA 1XNQF 3MEGA 4NA3A 2VZ9A 1UTAA 2IJNA 1VQ7S 3UDCA 1FNXH 1FNMA 1SCJB 2MLZA 1KN6A 4Y00A 4USIA 1ZA2B 5KAKA 4DV6J 2Y1RI 4K8RA 3ZZ0A 4DQIA 1RTJA 4J90A 4FBUA 3HVTB 1X9SA 4DUYJ 3A8KA 2B43A 3H4BA 2M4MA 2AYBA 2LDYA 4OYOA 5A8RA 2XTJP 1WKLA 3OFHA 3QGHA 3CJ3A 1PBUA 2GQ2A 1S7HA 1T02A 4JV5J 4R5PB 3D6HB 3TEHB 1KVKA 1BGXT 4LF1A 4F4YA 4AD6A 3M2RA 1VBXA 2HVIA 3KJFB 2ALZA 2DHGA 1HNZF 1M5VC 1VJQA 5G4DA 3W65A 2IMWP 4K5SA 3OTOJ 5HJXA 4B3MJ 4KV8A 3W2WB 5KFLA 2A0FB 5KT3A 3TUJC 4ER8A 4KT0C 5D78A 2KH9A 5F0UA 3IAS9 2JLGA 3E8OA 4QOTA 4CO3A 2MGZB 4EU0A 1JMTA 3RUBL 2CWKA 1B7FA 3A12A 2GA7A 1GXTA 1XR5A 3B8HA 3J7YI 4OZ0A 1X5SA 3JXOA 2ZHBA 2KFZA 4X4SA 2QL5B 2NXJA 3QO9A 4Q2LA 3LWLA 4ZIWA 4DPYA 2P9CA 4Q0BA 4I68A 3MCOA 1REVA 1FI4A 2JHEA 3TVZA 1HQUB 2QFIA 2AX1A 1HA1A 4U67Q 2C22A 3SCLE 4W92B 4A8FA 1FEEA 3UN5A 4CM0A 2LFVA 4W4MA 5HMWA 3R7SB 3EGNA 3W64A 3NY0A 3OXFA 3BO3A 1N32F 3MTKA 1EZZB 1S0OA 3KK2B 2HFNA 4DSIA 1IBMJ 4E98A 3IG1B 4JP8A 5IWAJ 1YGYA 4AQYJ 2RUSA 5EWEA 2E1MC 3JYTA 1IR1A 1MROB 3IBWA 5J1NA 3ZFVA 2HRUA 3BN4A 2FZKB 4RW8A 2D9PA 4LFCJ 2GHPA 5BJRA 2FHOB 3SFGA 1B99A 1JXEA 2XMTA 3AOCA 1PAUB 2F65A 4ZVEA 2LU2A 2E7VA 3EGWB 2DIVA 3FSXA 3GJTB 2K7KA 1QVFR 4JI4J 4NLXA 5T7LB 3TP2A 1OQ6A 4IOAQ 1YLXA 1QD1A 1S10A 4IQXA 5F8IA 3MM6B 3GJQB 3LTOA 3MOJB 2GIRA 4A8SA 3K2YA 4OYWA 2B3TB 3VVUA 1UEUA 1F0XA 4HH1A 2FC9A 3W5ZA 1DRZA 2B8PA 2Q3PA 1VK8A 3DOMB 1SBRA 1SJFA 3HFZB 4B9LA 4A47A 3LANA 4NZ7A 1RAIB 4MFBB 5HJYA 1Q7YT 2XMMA 2DGWA 1ZH5A 1JKHB 2PEBA 4DL5A 1JQGA 5KFKA 1PC4A 1WELA 2DITA 5EWFA 2AGPA 4WTOB 2KKHA 2R7RA 4LF6F 3RAQA 3IMQJ 2PI4A 3MZIA 2UUBF 1C1CB 2M70A 3D6MB 1XERA 1N36F 2CDRB 3GZ7A 3JSRA 1UFLA 2KVIA 1B3TA 2ZBPA 5F8JA 2EVZA 4CLYA 2WRMA 4DL3A 3MAAA 2JX2A 5L9NA 2YWEA 3OSNA 2Y8YA 2DNHA 3W61A 3DI6B 3LOUA 5D3GB 2K1RB 1YBUA 1UMJA 4G1QA 2DVIA 4C4WA 3R1LA 4TY8B 3CPWR 1LQ9A 2LA4A 2R8IA 2UVVA 2N82B 1LWFA 2HQFA 3E01B 3BDEA 2GAGC 1RHQB 1HWLA 5JUMA 1BMQB 1RT2B 1FKOB 2GAHC 2HGLA 4EI2A 3IR5B 4S0MA 1RTDA 1VGYA 4QR0A 4N77A 1SJ1A 2HIQA 4LREA 4ZVOB 1TMMA 2BW2A 4J9QA 2XMUA 2ZWPA 4DV4F 2GV1A 2OIHA 4GO7X 1HLWA 3HF5A 3EX7B 4F25A 4WU2A 3KHLA 2RMLA 3QIPB 4KY3A 4RNFA 3V81B 3HSGA 1WF2A 1VQ5S 2V94A 3ISND 4IG3A 3OBIA 3FJ2A 1Y0HA 4MMOA 4IH6A 4C8NA 1F5BA 1VLYA 4DR7F 1D8ZA 2C2NA 2CQ0A 2N4DA 3THVA 5L38A 4A8XA 5FLXU 1UL3A 4CNZA 2DHHA 4FXDA 2J7UA 5D15A 1KTQA 2XNRA 2J6TA 4ELTA 2X1GA 5HP1A 2B0GA 4OI2A 1IKXB 3OT9A 5K20B 1N5YB 5J2MA 2IJRA 2K06A 5D0HA 3HULA 3PKMA 1NDKA 3DHWC 4RO0A 4QU7A 1Q7LB 2WW4A 3DC2A 4ED6A 5KFXA 2RU9A 2R7VA 3GCWP 3KLEB 4NA2A 1NLKL 4OI0A 2R2RA 2WVCA 1X0PA 4PXEA 1KNZA 2MPUA 4OYZA 2GFFA 4Q8EA 3VCDA 2VIHA 2XMJA 2CPXA 1JWWA 2KDOA 2CAJA 2W4CA 3HI9A 1AZSB 2F8MA 2UV8G 1H72C 1R0AA 2CJYB 4KHMA 3F73A 2DT9A 4ZVRB 3GQCA 9RUBA 3BBCA 2L41A 3Q8UA 1JLFA 1Q81T 2AV5A 4MKYA 3GIMA 3D54A 2CVIA 1RACB 3VR1A 2VPWB 2VFUA 2HWIA 4WK3A 2ASYA 2HFVA 3MGJA 3BH6B 4DV0F 3IR6B 3MPVA 4DQSA 3DKDA 4LT6A 3VGTA 4O44B 3DM2A 1YKWA 2H48B 4KJIA 3MMAB 1H7WA 1IKYA 1RBAA 1VK3A 1HKAA 3CDBA 4HVZA 2BANA 4ES2A 3PRDA 3H42A 3AA8A 2ZJPQ 2ZC3A 4WCEQ 4F4WA 1FKAF 2FY1A 1N34F 4J9UE 1XNQJ 5DM6Q 4WIIA 2DGVA 3MHYA 2EFVA 5KFMA 4NYPA 2WONA 2BQUA 4Y0FA 2X51A 2DBBA 4RUAA 2G13A 4LSNB 4JI7F 1AROP 3MEGB 5B0EA 4LRAA 2CPFA 1X4GA 3CJSA 4QJVA 1SIZA 4DI6A 4X4QA 2C3OA 4RBUA 5KTQA 1YITS 1YZ6A 1H2UX 1SKSA 2QG9B 4KRWA 1S77D 2EI5A 1KOHA 1XBWA 4KGXB 3RBZA 3JTPA 1RTJB 3TEGA 4B3OA 3HZEA 1UW9A 4IO1A 1WC4A 4RU2A 1HNZJ 4CLKA 2BOPA 5CA5A 3AB2B 1N5VA 2H5IB 4U7UK 1W2IA 4H4OA 5BYQA 4P75A 5DS7A 2QZ8A 1U1KA 5F9LA 2ZHAA 4ECSA 1HW9A 1LKZA 2FJVA 2WW8A 3S1TA 3Q8SB 2AJ0A 1HQ2A 3OVBA 1K9MT 2UVRA 4KV8B 3ENWA 1YJNS 3PHTA 4JV1A 3JAMY 2CPZA 2E5GA 5KFNA 1U7LA 4I6AA 1S0NA 2IM2A 2A2CA 1NJZA 2R4FA 2PMZD 1Q86T 5JMNA 2W01A 4YDDB 3UCUP 3KWMA 3C16A 3QO9B 3VGVA 4IOBA 2QSFA 5DRKA 3NGRA 2AJQA 1B4SA 1REVB 1RT3A 5HSPA 3FVYA 1Q4RA 2YQ0A 1FRXA 3LPEA 4NLVA 4FPIA 3BS9A 3KKFA 1ZAXA 2XSJA 1LXJA 3R7BB 4MKAA 5CD4A 4C11A 3A8JA 4EWTA 4ZVGA 4RNNA 4U95A 3IM8A 4JI3F 4NCGA 2ZH4A 1YHQS 4M5NA 2W9BB 1PYSB 3CCQS 3BDPA 1KBRA 1LW0A 1SJRA 2Z57B 1PIEA 4ED4A 3NGSA 5E0OA 3EXYA 1UCNA 3JYTB 4LVNP 5J2QA 3UDEA 5F8GA 3CB4A 2OHDA 1GAOA 2GX8A 4OYBA 3FCHA 1JLEB 2O01C 2VJUA 4RW8B 1NJIT 1IQTA 1H2VZ 4OZNA 3EJMA 2AP6A 1FF2A 2RRBA 2F40A 2YX1A 5EDWA 1F5CA 4CI0B 3HHLA 4U7UD 4TYAA 3PM9A 1KS2A 5DG7A 1T9UA 4YQWA 1B7YB 3NCPA 2DR9A 2P5VA 3TAMA 3SYZA 4Y28C 4OX7A 5DLFA 4OYPA 2J9DA 3P6YC 1UKUA 2ZOFA 3CD0A 3VAJA 3TX0A 1EETA 4F7VA 4B9SA 5L9XA 3CCRS 4I4BA 4RW4A 1SJQA 3OV7A 3J81U 3LALA 1EAYC 4K5RA 2JLEA 2Y0BB 4YUDA 3QT7A 4DL7A 2CZ4A 2LXIA 2KO1A 1FO1A 2IA0A 3GIRA 3PIPQ 3M8YA 4NEYA 1UWBA 2BQ3A 1U1MA 3QNWB 4PKDB 1CBKA 3OXGA 1TL3A 2YX7A 5KG1A 2IC3A 5EGYA 3BPDA 3KLHB 2L3MA 1XMOF 1CJKA 4GVLA 4PPDA 4I6WA 4ITSA 2OLWA 2W7PA 4LF6J 2M8HA 3KHGA 3Q23A 2UUBJ 4B3TF 4CTAA 4IUFA 1N36J 1QAXA 3CJ5A 3NNAA 3NS7B 1KRPA 4ZHRA 4EMDA 5KFRA 3S01A 5F8LA 3D0GE 3CCWA 3KUHA 3CW2C 3GWCA 4F3MA 3BQ0A 4KTQA 2WCXA 4TQSA 4B08A 1Y10A 2FLNA 2JVRA 1QDUB 2IDLA 2VFVA 2HHVA 3IC1A 3MAAB 3UNGC 1KVIA 2M7SA 4LR9A 3QJJA 1HD0A 3PFEA 2RQCA 3AJ2A 1H38A 2JC0A 1ZTTA 2MSSA 3CJ8A 4G1QB 3M6XA 5DM7Q 4TVAB 4LFAJ 1U09A 4C7QA 2E1RA 3ET6A 1O0PA 1UVNA 2ZH9A 4B3RF 5J2NA 2DRDA 2IPOB 4DV4J 1RCOB 5KFYA 4K4TA 3WX8A 4EEYA 3WZ0A 5K8OA 3O3LA 4ZPAA 4C3MA 3US5A 2FJWA 3GPAA 3G8SA 3S7RA 2DY1A 1AW0A 2A6MA 4RZRA 2ZJRQ 4PXDA 4AUKA 1EB0A 3MAQA 1M0SA 4ZCKA 1UVMA 2BE7D 1WJ9A 1B64A 4DR7J 3BF4A 1Z4UA 3DRXA 4JI1F 5ETOA 4Y34A 4UOGA 3D5MA 3GG0A 1EKSA 5K8NA 3KHHA 2HYIB 4KBIA 3UPFA 2VL1A 4IG3B 1MMNA 2A2DA 2AZ3A 1GMWA 1ZTWA 4L74A 4HI1A 2DNGA 2DGUA 1DHMA 1AXQA 1S6QA 3CD6S 3Q8VA 2RAQA 4DZ6A 1RT6A 2NQPA 1KC8T 3OFGA 5D0RA 2XLKA 4MYUA 4P71A 5HP1B 4J9KA 4DX8H 3M32A 4JI8F 3HHKA 3F56A 3CJQA 4RLEA 4PQAA 3MUTP 4O23A 4PPZA 2CPDA 2ADBA 3G8TA 3KJNB 2I6WA 2XB2D 1WEYA 1T05A 3PX0A 3P5TL 1P6TA 3KHRA 3FSYA 4DR6F 2H1YA 2RUGA 4CT9A 2F9JA 3M05A 4CO1A 4USMA 2GZOA 1Q95G 1BC6A 2L9NA 3PVXA 2R7SA 3KLVA 2PIIA 3TA2A 1XIQA 2ALYB 5GMDA 1T8EA 3TYTA 3R9LA 2J6SA 2H4YB 4DXLA 2MQNA 4PCQA 1H73A 2C2DA 1P9QC 4ATNA 4F4XA 2IA6A 3CJ0A 3O1LA 5HQLA 4DS4A 4DV0J 2ZH6A 2YPYA 3DOLA 4HYKA 2WBMA 5L39A 1WWHA 1RT4A 2XGPA 4L76A 1TKTB 3H4DA 2ADCA 2MEWA 2QV6A 4LIRA 2EFGA 1D9FA 3TW0A 2MHEA 3AAWB 1D9AA 3DN9A 2BJEA 4URSA 3V6DA 1U1PA 3LH2S 3D0HE 1LNQA 4EZ9A 3ADAC 3DM2B 3OD2A 3DMJA 3T5JA 1IKYB 1QSYA 4I67A 2YVSA 1FDAA 3AJDA 2PN6A 4JI7J 2B9YA 4X4NA 4O3QA 4QIGA 3OJSA 1REGX 1TKZA 3D3BJ 3EGVA 4PWWA 3U7JA 3UW1A 3W63A 3WX4A 2O66A 2WONB 5IC4B 3D1QA 4E8UA 3NMRA 1IM6A 3O44A 2R42A 1SC3B 1L3VA 2MDAA 2IRXA 5D4OA 2VC1A 2M2BA 1RT5B 2VKZG 4PG8A 1OYDA 1FWLA 4J5OA 4OYMA 3WC2A 4QYZJ 2VBWA 1YBTA 3BH7B 4AL5A 2MZTA 3VAFA 2E5LF 3UFCX 3B4DA 4DUZF 3K5OA 4B3OB 5H9EJ 2KXFA 5BR8F 3DGPA 3FBBA 4M63A 1MSWD 3QWPA 1NM2A 1JK9B 2QIFA 5DQHA 3MDFA 1VDHA 2OEJA 4C8YA 4U96A 4H4OB 4ZN3A 2BEFA 2WHOA 4K0KF 4JV2A 1NK6A 3NXZA 2VQFF 2MKHA 3QJPA 5AE2A 5DDPC 3DLHA 5IV3A 2HQ3A 2V4QA 1FFSB 3GILA 2FJEB 3HM9A 1IJFB 1TK0A 1U2FA 3N6NA 3WBZA 2HS4A 3RGIA 1GH8A 1IR2A 4TNOA 4DLGA 2FHJA 2CJKA 3MD1A 2BX6A 2PI5A 5AXKA 1JIHA 3KNGA 3QT8A 1FJGF 1X4AA 3MM5A 4KR0B 5GAEI 2W8LA 1FCAA 1GNKA 3B82A 2VOPA 2KU7A 4DDFA 1U26A 4J9OA 5FIIA 4KGVB 3EYZA 1S4FA 2FVCA 2RHSB 3I82A 3C16B 4DX7A 1FT8A 4TQRA 2BKPA 2KHCA 3PW5A 1S5ZA 1RT3B 3T3FA 3OR1A 1N0UA 5I3UA 2BABA 4JI3J 3DHXA 2V8GA 3CMES 1H0HB 3CIMA 3A1YG 3OL8A 4DV7F 2XSJB 2ZC4A 2X7IA 4KH0B 4DV2F 4C11B 2OPRA 2V8HA 4MIWA 1TU0B 2AHOB 3I9ZA 1GX5A 1LW0B 1NO8A 3CCTA 5IOLA 5J2QB 4CO4A 1CQNA 1SQEA 2VHGA 2ATCB 1G4CA 4DFPA 2Y9HA 3V6HA 3GFXA 1F3VA 4YS2A 4NA1A 2BM0A 1BE4A 1X0FA 1RBLA 3T1HF 5G0RA 2BDPA 1D09B 5T14A 3ETMA 3HHLB 2LKZA 2H5JB 1U48A 4L6V3 1AT1B 3BM7A 5ETRA 1ROFA 3TAMB 3KMSA 3C46A 1TAUA 2KT2A 2RS8A 1SH3A 4F2SA 4HHHA 2DPIA 1D3WA 2ZH1A 5GAEU 2JC1A 2V34A 1J27A 1EETB 2A1BA 2GO8A 2MJNA 4RW4B 4M5DA 1NKBA 3KOAA 2QEXS 2Z0GA 1PCAA 4LBHA 5JJBA 3D6FB 2OPQA 1N5TA 2FJAB 1ITPA 3D2WA 1S6UA 2AQ4A 1G2EA 1XTZA 1XMOJ 1UWBB 1YRTA 4X4OA 3NOCA 4QIVA 1S1VA 4B3TJ 1UEVA 4AL7A 2IDEA 3TZXA 4DV1F 2DGTA 1TL3B 2VFRA 2YKNA 3NNHA 2C3UA 3OR2A 2IC3B 1S99A 1RWPB 1I6JA 1CJKB 5RUBA 3BYPA 3O5TB 4KB7A 5HO4A 2WB1D 2LXFA 4M5IA 4M5JA 4CTAB 2V2ZA 5J1EA 3VGUA 3QGPA 3GB0A 4NRUA 2IM1A 1YDLA 4FF4A 3EUNA 4ZHRB 5FLXY 4QWEA 2RH3A 2QN6B 3U1NA 4WP3A 3R6LB 4DZDA 3HT3A 5LSOA 3MURP 3VV2B 1WSVA 3LWMA 4ED1A 3PR5B 1HQEA 1YWXA 2YKQA 4RUCA 4OZ3A 3U1LA 2Y1IA 2JEIA 4DU7A 4QQBA 3QFHA 4C8ZA 1DQ8A 2QLXA 3T9NA 1C0TA 2RIJA 3EWGA 1LWCA 3G71S 2HG4A 2UZAA 2ZD1A 3Q8QB 4MJKA 4X84A 2DH8A 1FRIA 3GFHA 3ET6B 1CPZA 2X3GA 2HNZA 1UFKA 3CSKA 5J2NB 3NMAA 4ZA1A 3TUIC 3T5KA 2DNKA 2DXEA 2KJVA 3QATA 4NXMF 2DR7A 3K8WA 2ZKTA 3KJVA 4GKJF 2N4CA 4JI1J 3BQ2A 1GX6A 5EX0A 1SH0A 4ZP6A 3I0RA 3ZTRA 2ZKUA 1HBNA 2DPJA 2DYAA 1RTHA 4EO6A 2RDIA 4HH0A 2W2MP 2LP4A 3QRQA 4RNOA 3EVMA 3PW2A 4KFBA 3PW7A 3D3CJ 3UVJA 3D67A 1N52B 2Z2ZA 4ZMMA 3TAPA 2Z58B 5CYMA 1T94A 1VQSA 1IJEB 3OFEA 1JLQB 3PYEA 3TVYA 3G9CA 1NPPA 4YB5A 2D69A 3C15A 4NLWA 2DY9A 4YR2A 4JI8J 5GAHU 1L3KA 2OPPA 2YNGB 1LFPA 4FF2A 1RT6B 3RB3A 4OYXA 2AMCB 2Q6BA 1VQ6S 4L73A 3M32B 2D3ZA 2K7JA 3KLIA 4DR6J 3ONQA 4DFKA 3UD4P 4ILMA 2R7TA 2QA4G 4U6PA 1NUEA 2XNQA 3MMJA 3VAKA 2J9EA 1SPBP 2MKYA 2HRTA 4AYBD 2L48A 4A48A 3T1AA 4TN2A 4Q45A 4FPRA 2NYIA 1NSPA 2B5JA 1V5IB 4HTJA 4EO8A 1LWEA 2X1AA 2C3MA 4J9MA 1IVZA 2EFPA 4EGLA 2AW0A 2WVEA 3KG1A 2RE1A 5T41A 1NH7A 1R8HA 4ZKAA 5L1JA 5E5NA 3M8ZA 4TY9A 4WFAQ 3VWSA 1SV5A 3W5YA 4DPUA 3GIIA 2P6TA 2XEXA 2HFZA 1VLOA 3QPIA 1RWWB 1F3FA 3C6UA 8AT1B 3UNYA 1KONA 1R6YA 2DR6A 3P45B 1HWIA 3Q24A 2HAFA 1YJ7A 5GADI 1VQMS 1GMUA 3DOLB 2HLUA 4WP9A 3IM9A 4OZ5A 2RQ4A 2P9GA 4MYTA 4DX5A 2ZH3A 2ZZMA 1DTQA 4ED2A 1VHFA 1KLMA 4Z2XA 1EKRA 1Y3KA 2B4OA 1VJWA 4M1KA 3R8YA 2WSCC 4HL9A 3V6DB 2AYMA 4UTGA 1Z1ZA 4LF8F 2E44A 1X60A 3ITHA 3DMJB 1T3NA 3CCLS 4A8KA 2JEJA 3SMZA 3EICA 5C42A 4QPTA 4DR2F 2BJ3A 4RW9A 3PW4A 2N7CA 1XQIA 2B9WA 1RAJA 1TKZB 1FESA 1W7WA 4DV5F 4CT8A 1K8AT 2KT3A 4WIQA 4A4JA 1NJXA 4P2MA 4DR1F 2OFHX 3JTOA 2H9ZA 3EDRB 4CO2A 4C48A 4AE5A 1B0PA 1A7GE 1WG5A 2RS2A 3QJLA 4QPXA 4NMXA 2LDIA 5KT2A 2E5LJ 4NLUA 5I4MA 2FTRA 2NXUA 5KFUA 3W9JA 4DU8A 4XTTA 5BR8J 4GC6A 2XMKA 3R5BA 1HNIA 2BQRA 4M5HA 2P9EA 1IR0A 3AJ1A 2D9OA 1TL1A 2H65B 1Q5YA 2XZTB 1QJHA 4CYUA 5ADZA 4K0KJ 1UVIA 3BSCA 2VQFJ 4WXWA 3X3UA 1SJ3P 5ETTA 1FTCA 1Y7PA 2OSQA 2VPXB 3D66A 4Q8FA 4LRFA 3BR9A 3NCRA 3FEXB 5E41A 3CWJA 3R5AA 2QX0A 4O3NA 5KG2A 2VV5A 1FJGJ 4JI0F 2AEJA 2XG8A 2M52A 2CQ4A 2OP5A 1IWAA 2V5HG 4IG0A 3W66A 1IUJA 2YH0A 3MCMA 4BHQA 4RNHA 2KT5A 2QLJB 4OI3A 4AL6A 4FYWB 1WACA 4C0HA 3ELHA 3I5CA 4JV5F 1ZAVA 3W2WA 4FYVB 4KYZA 2FD2A 5CQGA 4G1IA 3PIOQ 4USWA 4O4RA 4LJMA 4DV7J 3OTOF 4ZPWR 3AD7C 2KN4A 2O5DA 4DV2J 1RADB 3OR1B 5I3UB 2QMWA 1P8GA 3TANA 2BRLA 5KG3A 2EW9A 1W25A 4TU9A 1HQUA 2MLYA 2OPRB 2PO4A 2CPEA 2DNRA 4HTIA 4LVOP 4OV1A 2VA2A 4ENOA 1KLNA 1PKUA 2CQIA 3T1HJ 3IGVA 1U45A 1N0VC 1ZYQA 3IWNC 3NWRA 3C14A 4QYRA 5D4PA 3IRWP 1F9FA 1NK4A 2G1HA 3KK2A 3R2CJ 2CDQA 2EPIA 3THPA 5G0RB 2L08A 4PQUA 7FDRA 1MROA 3M7VA 2HLTA 1Z2LA 2Z8QA 4YDXA 2LVWA 2XS7A 3VHQA 2ZE2A 5CYQB 3HVRA 3IBCB 2CIMA 5DZ6A 1Q1KA 4CLFA 1LW2A 2HHQA 2J0WA 4ETXA 1SL0A 2IVFB 1F6TA 3AA9A 2CYYA 1GQEA 1T11A 1HBMA 4M5DB 4XO0A 4C97A 2R8KA 2UU9F 4GKKF 2OPQB 3RRKA 2OEMA 5BXIA 3P5BP 3M4XA 4DV1J 3OLBA 1RZMA 3LW5C 3ZZOA 2G2OA 4ZLPA 2BA9A 3P4UB 3PO4A 4HHJA 2V9WA 3JAMU 1Q16B 4GO5X 5FD1A 1VFJA 2R2SA 1ZS6A 7AT1B 2KYZA 4F4AA 1S1VB 3AD8C 4NXNF 2ASDA 3BN7A 2YKNB 2Z4PA 1HWUA 4DPOA 1W26A 3OR2B 2MZ1A 1WKKA 4FNIA 3FFIA 1UZDA 5THWA 2V69A 3DOMA 2KJWA 3JB9k 3UDVA 3MAHA 5HQ8A 1XMQF 3K59A 4IYQA 1TL4A 2LYVA 3IRXA 3PNIA 5KG5A 5J1EB 4KPCA 4NLOA 5ETPA 3CD7A 3I87A 4MKBA 4MFBA 2YWKA 4UQTA 4QU6A 1PBAA 3HDSA 3AB4B 4EUVA 2IYIA 2Q43A 1R8CA 3CJ2A 3OHAA 4ZOSA 4FVCA 3LUYA 1BHNA 2J5AA 2HEKA 3TQ1A 3MECA 5KOXA 2C28A 3ILOA 3IAM9 2R7OA 1TUGB 1AUSL 3N79A 4MT1A 4DUTA 4A8MP 5KFEA 4Q7AA 1C4AA 3L3CA 1XNRF 1HBUA 4R0JA 1R6VA 5A6WA 1VISA 1C0TB 1LWCB 1RWOB 3VZHA 2ZD1B 2O3DA 1Y9OA 3C19A 3H25A 2BMBA 4NXMJ 3H2LA 3HFVA 4OHVA 3EE3A 2QGFB 5LXRA 2HNZB 4GKJJ 3F0NA 5D3GA 2K1RA 2HZVA 1VQ9S 1WD6A 2OELA 2ZZNA 4K2JA 1ZM9A 3HHLD 1PJ5A 2J0XA 4G3IA 1IWGA 1RTIA 1HHQA 5KFFA 2LQ8A 1U47A 1JB0C 3R5JB 4X62F 4DS5A 5KFWA 3J7ZT 3KJVB 4FF1A 4B9NA 4USKA 3R7NB 1U0HB 2V8PA 3CO9A 4LRBA 3I0RB 2BM1A 3SEOA 3K5PA 4ILRA 1RTHB 4UOFA 5ETLA 3NNCA 2N3OA 2N3LA 4KKOB 3SCJE 3UVJB 4B9MA 1KD1T 2GIQA 2QA4S 4I0WA 1L5UA 3T1YF 4RBVA 2LMIA 2E9ZA 1XR6A 1FDBA 1YI2S 3D28A 2DNYA 3C15B 2YXLA 4FN5A 2VPZB 2NPFA 1JJ2R 2W2PP 3K5MA 2OPPB 3J80Y 4D3HA 8ATCB 2VQEF 4KGKA 3I31A 5ETKA 3L7OA 1JXLA 4WJBA 2CPHA 2YNFB 2GMHA 1HI1A 3D68A 3KLIB 2QLFB 4UW2A 2QMXA 4WE1B 1VBZA 1FVSA 4Z37A 3MR3A 2CJQA 1IKWA 2Z56B 1E6VA 1RAAB 4OLOA 1CSJA 4TU8A 2B5JB 4WKRA 2V9KA 4K4YA 4OI4A 1LWEB 3H90A 3B78A 4P2XA 4DR5F 3BGUA 5A6PA 2GHWA 1NJYA 4XPEA 4C2MA 4U8YA 2D3UA 1YX2A 2V67A 4PZVA 4FYYB 5J1PA 4ECVA 2R7XA 2A18A 4L3KA 3E2EA 1G7CB 5DQIA 1SV5B 3H59A 4OQJA 3MM8B 2XM3A 3HKZD 2Q66A 5SUHA 1Y4ZB 4HDHA 2GVZB 1GT8A 3UDLA 1M90T 5CABA 1DAXA 1SUQB 2CVEA 1RP5A 1NPRA 2HURA 2W1BA 4USTA 4UUWA 1AZSA 4LF8J 3ZNUA 1Z2ZA 3ENVA 3FKBA 4CLLA 2JFDA 2MTLA 1ZBTA 1AUDA 3MEEA 1KLMB 3S8SA 2HBQB 2CFXA 5LMUF 2OMLA 3DNCA 1XWLA 2DXFA 2NZCA 1WTBA 1EX8A 4DR2J 3FCVA 4NCAA 2HW3A 1HHTP 2KZMA 3MFHA 3M30A 2E66A 1OWXA 3ITHB 4DV5J 4WTYA 4FYDA 4WU3A 3CCMS 1FDDA 5KFDA 3RYLA 4DR1J 3QWUA 2FVSA 5C42B 3K0JA 2ZBCA 1NDLA 4RW9B 5AXMA 2MB0B 3IWXA 2CQGA 1GMWD 4MKVA 1CQMA 2I38A 5LSRA 2BE2A 5HATA 2J0SD 2AKWB 4C8KA 1R0BG 3DDNA 4EBCA 1NB7A 2DJWA 3RZAA 5ETQA 1F9HA 1Y3JA 1FXRA 5M2UA 3GMGA 1G1XA 4TKTA 2NSBA 1HNIB 4LF5F 2J8SA 2HHSA 2FPHX 4F2RA 1NXIA 3MMCA 1TL1B 3FCWA 4CYUB 3CE8A 5CCLA 4BDPA 2G0JA 1X4HA 5DO2A 2YH1A 5K8MA 4JI0J 1JLCA 2VFSA 3HD2A 3JSYA 5HI7A 3WIVA 3LP1A 5E3QA 4A8YA 2KFYA 3MD3A 4P2SA 1S7IA 2R7UA 3QAUA 4P7VA 1PC5A 3UN3A 3H0PA 1N4LA 2POKA 1C2PA 1ZM4A 5EUHA 4IG0B 1UA1A 2LEAA 2HQCA 3DRPA 3AOBA 2F4FA 4NLTA 3HSJA 4X4RA 3NL0A 3MUMP 3M9NB 4CWBA 2FVQA 2E29A 5A8WB 2JH3A 4Y65A 3FC9A 4C3KA 2ABYA 5A2QU 3PX6A 4X4TA 1UVLA 1HNXF 5CZVA 4ZPTR 2Y1LB 1JLGA 1S48A 2JRSA 1HBOB 4Y2CA 5F3ZA 3JQMA 3ZTPA 1R89A 1OIAA 2RU3A 1HPZB 4CQ1A 4C98A 3A3PB 3JQKA 5L1IA 2XY7A 3MCNA 5ETNA 3CC2S 3PEJA 5I3QA 2GQCA 1OY8A 4PG5A 2PFFB 2LECA 1S1UB 1FRKA 4DJBA 1NRKA 4Y2IA 4IFYA 5GVQA 5IT9Y 1T03A 1CJTA 2XC9A 3K17A 3M6WA 2OSRA 4BLGA 3C14B 1ZPVA 3KK3A 2B56A 4LRCA 3R1HA 2W9BA 3ZZTA 1IBKF 4PABA 2V0NA 3CCZA 2C2RA 4F36A 5KFQA 2NCKL 1RAGB 3OVAA 4PQUB 1KFSA 5L46A 1PO6A 2F3JA 1JLEA 3SFUA 2ZE2B 3LP0A 2I0XA 3ZO7A 2XHWA 3C3LA 1M5KC 4PWDA 2D41A 3ZZZA 1H98A 2UU9J 5DZ7A 4GKKJ 2DRAA 2GJFA 3M1VA 4C8OA 1LW2B 5IXUA 4RPFA 5C5JA 2DXDA 2FJBB 1HBMB 4JYAF 2HHUA 5F8NA 3IS9A 4NXNJ 4QCLA 3QGGA 3VGSA 1NCLA 1C4CA 4FNHA 6AT1B 3J7YU 1ZM2A 4YMEA 1EJ7L 2KXHA 2C3YA 3B54A 3EGZA 2HVZA 3G96A 2FHJD 1XMQJ 2JFKA 4HT5A 1RHRB 1W2BR 2R8HA 1WG1A 5HMZA 5DGBA 3FFIB 5KFPA 5I3PA 2ZUAA 3N5BA 1QM9A 1L3SA 2BJ8A 1VQLS 2DO0A 2VKRA 5DJBA 2PT0A 1GXUA 1N5SA 2HFOA 3IRXB 1K73T 4HDGA 1T9XA 4C0BA 4OFZA 3KLHA 1N6QB 3ZZUA 3GV8B 4DN0A 2FJDB 3TJ9A 2YWWA 1X9MA 1XNRJ 4WZQA 2NYHA 4OZJA 2HGMA 2DHAA 3QZ7A 1AFJA 3MECB 4V19X 2PA3A 1E6YA 1U1NA 3KUGA 4OYIA 3I5BA 3GV7B 1BWVA 3BO2A 3I55S 1U0SA 3LA0A 1HBUB 2K2PA 2JZ5A 4O3RA 2C3PA 4UOHA 4X4VA 3CO0P 1FX2A
chains in the Genus database with same CATH topology
3KNGA 1VC6A 1NU4A 1FJGF 1FRJA 1N5YA 1GXLA 1VIXA 1X4AA 3MM5A 4KR0B 4F8RA 3LF0A 5GAEI 2D74B 2GO9A 2W8LA 1NK7A 4NLYA 1FE0A 5SZTA 4V19J 1FCAA 4BC9A 1GNKA 3GV5B 3N4WA 1X9WA 2SXLA 3B82A 2VOPA 2KU7A 4CZCA 1RT7B 3OTCA 1DURA 4DDFA 1U26A 4J9OA 5FIIA 3JSMA 1S0MA 1D1UA 3EYZA 2V8VA 3PO5A 1VRUB 2DTJA 1S4FA 3MXHP 3OJUA 3W2VA 4JOUA 2FVCA 4J9RA 1H6KX 4ECWA 3I82A 4DL0C 1RJJA 4HEA9 1RTIB 1FT8A 4TQRA 4F4ZA 4C8MA 3LP2B 4LMZA 1HMVB 5B0AA 3RAXA 1TKXB 3R5CA 3KLEA 2KHCA 3PW5A 1RT3B 2UV8A 3HLUA 3CMAS 4LQ9A 3H20A 3T3FA 3OR1A 1N0UA 3CIZA 4CNYA 5I3UA 2BABA 2MQMA 2DNNA 2IVMA 1UAWA 3DHXA 2V8GA 4EYHB 1RA6A 3V2UC 1CVJA 4NLQA 3TAQA 4BWJA 3CMES 1H0HB 3CIMA 3DRSA 1QSSA 2VODA 4LFAF 3A1YG 3TARA 3OL8A 3CJKB 3C6UB 1NHUA 2YY3A 1T95A 2VG6B 1N56A 3NBPB 1NKCA 4DV7F 2XSJB 2RDJA 2HPUA 2ZC4A 3RTVA 1VC0A 4C9DA 1RISA 2ZUGA 2OFGX 5KFGA 3DLGA 2ZFHA 4DV2F 2E5JA 4C11B 3HJFA 2OPRA 1FD2A 1RGVA 1DFDA 2V8HA 1YJVA 1ELOA 4RNMA 4MIWA 3RR7A 4PG6A 1U24A 3I9ZA 2Q79A 4P6QA 1GX5A 3E3XA 4GMKA 4ECQA 1BQXA 1IBLF 3VQTA 1YBAA 2E1CA 4ED0A 5GADU 1CC7A 1LW0B 3T5LA 1VQNS 2MY8A 1DTQB 1NO8A 1UA0A 1C0UA 1KQGB 3CCTA 4OX8A 2CQ1A 2CQHA 4QW8A 1DTTA 5KT6A 5J2QB 3FZ2A 1GTHA 4CO4A 1ZETA 5E3CA 1CQNA 1SQEA 3UD3P 3GYNA 2XULA 1KQKA 4N76A 2K8GA 4DFPA 3HHEA 2MZJA 1TZ0A 3GFXA 3HPOA 3V6HA 4B3SF 4NYOA 4WYWA 3M9OB 2BR0A 1FA0A 1R3NA 4NA1A 2BM0A 3OVSA 5B0BA 4OJ3A 2O67A 3C6TB 1Y5IB 1A6LA 4WZMA 3DLJA 3OTDA 5CHCB 3FMBA 1X0FA 4C8LA 4O3SA 2DISA 3CCJS 4X64F 4ECTA 3T1HF 3IO1A 4PWUA 5G0RA 2GJ2A 1FJEB 2BDPA 2EC0A 4H4KC 1S0VA 3VALA 4UOCA 4DLEA 1RWUA 4USJC 3OFFA 5T14A 3HHLB 3LGMA 4Q43A 1V3RA 1BLUA 2J6UA 2LKZA 1U48A 1SH2A 3MMBA 4L6V3 3BM7A 2WOMA 5GMKa 5GAGI 4QWDA 3KYLA 4ECXA 1VQPS 3C2PA 2IBOA 2VD3A 1ROFA 1S1WA 3G6ES 3NP5A 3TAMB 5CCMA 4NPOA 2KHDA 3KMSA 4A8WA 3CC4S 3C46A 1TAUA 4NZ0A 4RKUC 1F5AA 1UVKA 2KT2A 1IKVA 4O44A 2VUGA 3J7Z5 2RILA 5DG9A 2OMOA 4OI6A 4DN9A 2RS8A 4ZPDA 4BBYA 4K4ZA 1KEKA 2G4BA 3KK1B 1SH3A 2GJIA 2KG1A 3MMAA 3RRGA 4TLRA 2RB7A 3BB5A 1IKWB 1FD8A 1WHYA 1DJ0A 3R5DA 4RBTA 4F2SA 4ZCLA 4X4PA 1D3WA 4RU9A 2DPIA 2EBEA 5KOWA 2ZH1A 5GAEU 2JC1A 1S1XA 1E6VB 1D8YA 1EETB 2A1BA 2GO8A 4ZVFA 1R8PA 2MJNA 1X5PA 4RW4B 4M5DA 4OHZA 1LWFB 2B6AA 1NKBA 3CCSS 2QEXS 3KOAA 1I1GA 4B9VA 2Z0GA 2LQ5A 1HYSA 5A8WA 3K5LA 1NK8A 5E2QA 5JJBA 4ECRA 2MHNA 3ICLA 1L3TA 5DDQC 3HKWA 4KHRA 2OPQA 2RT3A 1N5TA 3H5YA 3OXLA 5E33A 2FJAB 2K3IA 4N47A 3D2WA 4Q5VA 2UXBF 4HKQA 3POTB 1S6UA 5M2RA 1FEHA 5M2PA 1RTDB 2AQ4A 2NUUG 3BSAA 1FERA 3WC0A 4X2BA 1G2EA 2B51A 4RWWA 1HBOA 2EFOA 1XTZA 2RSQA 4LSNA 5KFHA 2GNKA 1OPZA 2Q1LA 1UWBB 4LIWA 1YRTA 4ZPBA 2DNQA 2MZQA 4X4OA 2Y1JA 1YVFA 1SXLA 3GSDA 4IQMA 2ASJA 4XIUA 4QIVA 5HBMB 1S1VA 5U47A 4OX9F 4DL4A 1UEVA 3DRRA 4AL7A 1KQSR 3TRGA 4LSLB 3MFIA 1YTYA 1HPZA 1XNQF 3MEGA 4NA3A 4DV1F 2DGTA 1TL3B 2VFRA 2YKNA 2OH2A 2VZ9A 3NNHA 2IJNA 1VQ7S 3UDCA 2C3UA 3RB6A 1FNXH 5IQQA 2OJ3A 1FNMA 3OR2A 2IC3B 1S99A 1U1RA 4I69A 2PE8A 4I2QB 2UXCF 1X5TA 4OI1A 5BYRA 5KFCA 3IXQA 1I6JA 3I5AA 3OLAA 2CZVC 1KN6A 4Y00A 4GC7A 4WFNQ 4XDCA 2QO3A 3O5TB 1WEXA 4KB7A 5HO4A 2WB1D 2LXFA 4USIA 1S1UA 4OZLA 4PXBA 1RT1B 2UUCF 5KAKA 4YFUA 1RI7A 2EFNA 2Y1RI 3ZZ0A 2LU1A 4CTAB 4DQIA 1RTJA 5J1EA 2CPYA 4FBUA 3HVTB 1X9SA 2XSFA 3QGPA 2PEHA 4KIAA 4WXOA 4WYLA 3GB0A 4IDKB 4LF7F 3P96A 4NRUA 2RKIA 2B43A 2QE5A 2W24A 2IM1A 2ZOMA 3MEEB 4NMLA 5LXYA 3H4BA 4FF4A 1YRXA 2V2KA 3EUNA 3EZUA 2M4MA 4ZHRB 5FLXY 2AYBA 1S79A 3N01A 5DGAA 4QWEA 2LDYA 3EXCX 2RH3A 5A8RA 4USHA 3U1NA 2AJ4A 3NAIA 3OFHA 1TUVA 2ZBIA 3QGHA 3CJ3A 1OSDA 1PSDA 1TKTA 2GQ2A 3HT3A 1S7HA 5LSOA 1T02A 3SI8A 4R5PB 2JJ4D 2M8DB 3MURP 2ILYA 5F0WA 1BGXT 3M30B 4F4YA 2NR0A 3PJXA 3M2RA 2XLJA 1NJWA 3LWMA 4ED1A 5GAGU 1VBXA 2CRLA 2B9XA 2HVIA 2ALZA 2DHGA 1SKWA 1HNZF 3PR5B 2JDJA 3PKYA 1M5VC 1HQEA 5A0YB 5G4DA 1YWXA 2XMVA 3CDWA 3PJWA 2I9SA 2YKQA 4RUCA 3U1LA 2Y1IA 2IMWP 4K5SA 2PA8D 4UY8T 4H54A 5J2MB 1MW7A 2JEIA 2BUNA 4KV8A 2RRAA 1R7IA 4QQBA 4C8ZA 3W2WB 1DQ8A 5CH7B 5KFLA 1Q82T 2QLXA 5KT3A 3T9NA 3TUJC 4KT0C 1C0TA 2RIJA 1LWCA 2YTCA 3G71S 5E3AA 1RYRA 2QRRA 3NWGA 5D78A 2KH9A 2HG4A 2UZAA 5F0UA 2ZD1A 5KG7A 3IAS9 2JLGA 4XDDA 5DDOC 1MU2A 3I32A 4OHYA 3Q8QB 1KSPA 3E8OA 4MJKA 4X84A 2DH8A 4QOTA 1FRIA 4CO3A 2BE2B 2MGZB 3IFEA 3GFHA 4ES3A 3TX8A 1CPZA 2X3GA 4EU0A 1JMTA 5F3TA 2OKQA 2HNZA 2JEFA 1B7FA 2IJFA 2GA7A 4FXWA 1GXTA 1XR5A 3B8HA 3J7YI 1VQ4S 2FLLA 2EWHA 3QGIA 4L72B 1K1SA 4O4GA 4OZ0A 1X5SA 3CSKA 5J2NB 2ZHBA 3NMAA 5KFVA 1FKPA 1X4FA 2KFZA 1SC6A 4ZA1A 3TUIC 2VG7A 4X4SA 3T5KA 2DNKA 2VA3A 2FDNA 4DEZA 1N48A 2DIUA 3QO9A 1FJ7A 2KJVA 3KG4A 4Q2LA 3LWLA 3I96A 4NXMF 1URRA 1FXLA 2DR7A 3K8WA 2ZKTA 2P9CA 4Q0BA 4I68A 3KJVA 4GKJF 1REVA 2JHEA 3TVZA 2UVUA 1HQUB 2N4CA 2ZJQQ 3PX4A 3D1HA 2CQ3A 5F8MA 2AX1A 1HA1A 4U67Q 4ED8A 3KLFB 1GX6A 5EX0A 1SH0A 4ZP6A 3BQ2A 1K0VA 3MMCB 2GGPA 2C22A 3I0RA 3SCLE 2W9CA 2ZKUA 1HBNA 3NS6A 2DPJA 4QIEA 2MQQA 4H4KA 4W92B 1QUPA 5JVHQ 1R0AB 1RT5A 5C24A 1EP4A 5DQGA 1FRHA 1RTHA 4DL2A 2R7WA 4EO6A 4A8FA 1FEEA 4IH7A 2RDIA 4HH0A 3OL7A 3IR7B 3PRBA 2I1RA 4K59A 4ECYA 4RNOA 5HMWA 1JLFB 3M8QA 3PW2A 3DXSX 4KFBA 1JLCB 3EGNA 2UXDF 3PW7A 4DQPA 3OXFA 2AU0A 3DOKA 3LP1B 3BO3A 1N52B 4RW6A 3MTKA 1N32F 1S0OA 3KK2B 4F4KA 1X5OA 1F60B 4ZMMA 2HFNA 3TAPA 2KM8C 4DSIA 5HLFB 2RRNA 5CYMA 1T94A 4E98A 3IG1B 3IWLA 1VQSA 1IJEB 3OFEA 2UUAF 1GTEA 1YGYA 1JLQB 2UP1A 5EWEA 1N6QA 3TVYA 4OL8A 2E1MC 4EYIB 3JYTA 3G9CA 2L9WA 1HARA 4YB5A 1T3OA 4CO5A 1MROB 4NLWA 1LK5A 3SZ2A 2FGOA 3IBWA 5J1NA 4YR2A 3ZFVA 1BQMB 2HRUA 3BN4A 1U6BA 5GAHU 1U2RA 1RDRA 1KHVA 4RW8A 3MEDA 1L3KA 2LEPA 2OPPA 1JLBB 2HHHF 1ZOTA 2D9PA 3CGIA 2YNGB 3PXGa 3DLEA 1KOOA 1LFPA 2GHPA 1X4BA 4FF2A 1RKIA 3DRPB 5BJRA 3OHBA 1RT6B 2FHOB 3SFGA 3RB3A 1RQ0A 1IN0A 1JXEA 2Q6BA 4UQGA 2CPJA 4YR0A 1VQ6S 2XMTA 4XAKA 1HWKA 3B4MA 2VPYB 3M32B 3HHNB 3BO4A 5HMYA 1ZZFA 2D3ZA 2K7JA 4ZVEA 2LU2A 4YY3F 3KLIA 3EGWB 2DIVA 3ONQA 3H5SA 4DFKA 2BANB 3UD4P 4ILMA 2Y0SD 2R7TA 4URQU 3FSXA 2K7KA 1QVFR 2QA4G 3PY8A 1FK9A 2D1CA 4NLXA 4U6PA 3KLGB 5T7LB 2XNQA 2PSZA 2J7KA 3MMJA 3R3TA 3VAKA 4ZS6A 2J9EA 4AYBD 3PDNA 3TP2A 2L48A 3P3DA 1NZAA 4A48A 1S72S 1OQ6A 3T1AA 2MY7A 4IOAQ 4TN2A 4Q45A 4FPRA 2NYIA 2PC6A 1NNDA 1JLGB 3ULHA 2B5JA 2LQ9A 3OUYB 2G9OA 4HTJA 4EO8A 1S10A 2M88A 4IQXA 1FJCA 1LWEA 1RT7A 2V4JA 5F8IA 3MM6B 2X1AA 1U1QA 3MOJB 2C3MA 4WK1A 4YB7A 2EFPA 5LT5A 4J9MA 2GIRA 1S49A 1H3DA 4A8SA 4EGLA 2VFTA 3OTEA 2PMHA 2PDAA 2AW0A 3HVWA 3K2YA 2B3TB 3KG1A 2RE1A 3C66A 5T41A 4R8UB 2CJBA 2U2FA 4JI5F 1NH7A 1R8HA 1UEUA 1F0XA 4HH1A 2BYCA 4KSEB 4ZKAA 5L1JA 1DLOA 2FC9A 2MJUA 1YG0A 5E5NA 2YKPA 3LQVA 5A8KA 3Q8PB 4XK8C 4TY9A 4WFAQ 4DQQA 1DRZA 3VWSA 4QWBA 1SV5A 2Q3PA 3UWTA 1VK8A 4YP3A 3GIIA 2ACYA 4OHXA 1SBRA 2P6TA 2XEXA 2HFZA 1SJFA 2K3KA 3QPIA 2FGCA 4J9PA 1TR0A 2DR5A 1JNZB 4B9LA 5D77A 3CDEA 4IFYB 3C6UA 3OQ2A 4H4MA 4W90B 1KONA 3HMJG 1T03B 4A47A 1R6YA 2YWGA 3MM9A 4OHWA 4IRKA 1QY7A 3LANA 4NZ7A 2XO7A 1Q7YT 4MFBB 2XMMA 1HWIA 1B0VA 3Q24A 5HL7Q 2DGWA 3H2VE 3SSSA 5GADI 1VQMS 3DOLB 4ES1A 1TQLA 2HLUA 1ZH5A 3NCQA 3KK3B 4OZ5A 2RQ4A 2P9GA 4OZ1A 1JKHB 4MYTA 2GHVC 4DL5A 5KFKA 5H1SV 1PC4A 1Q78A 1K1QA 1J5OA 4MK8A 2KFNA 1JX4A 2I2YA 2ZH3A 2ZZMA 5B0GA 2DD8S 1WELA 2DITA 1DTQA 5EWFA 3DLBA 4ED2A 2XLIA 1VHFA 1KLMA 3ISNC 4AFFA 2AGPA 4I2PB 1JLAA 4Z2XA 2W7OA 2KKHA 1Y3KA 2B4OA 4DG1B 1S6PA 1VJWA 1OPIA 4M1KA 2WSFC 3DFEA 2R7RA 2WSCC 4HL9A 4LF6F 3RAQA 3V6DB 1X4CA 4NWBA 2WB4A 2PI4A 4IR9A 2AYMA 3LP0B 1Z1ZA 3MZIA 4PG4A 2UUBF 1C1CB 4R25A 2M70A 2ZM6F 4CCHA 4LF8F 2E44A 1VMBA 2OO4A 4PWDB 1NEEA 2IM0A 1XERA 1M5PC 2NZ4A 2W4DA 1N36F 3LAKA 2LCWA 3DMJB 3ITHA 3M1VB 4KO0A 1T3NA 3GZ7A 3JSRA 4Y3CA 4ZCMA 3CCLS 1S1TA 1LK7A 4BCAA 1UFLA 2XBPA 2KVIA 1WHWA 3PR4A 2OD4A 4HT7A 3SXLA 5F8JA 4IR1A 2EVZA 5HMXA 4A8KA 2JEJA 3BGRA 3JSBA 3SMZA 2WRMA 4DL3A 2DGXA 5C42A 2JX2A 5L9NA 4DL6A 2VOOA 2GW8A 4QPTA 4DR2F 2YWEA 4RW9A 3OSNA 2DHXA 3PW4A 1G3OA 2N7CA 4ELVA 2DNHA 5DG8A 3RAMA 2HWHA 3CEDA 2B9WA 1RAJA 2LQBA 3DI6B 1TKZB 1FESA 2CKWA 3IS9B 3LOUA 3TA0A 4JI6F 2K1RB 2YKMA 5D3GB 4DV5F 2EFQA 1UMJA 4CT8A 1WHXA 1VC5A 4G1QA 2DVIA 2OAUA 1K8AT 2KT3A