1VHFA

Crystal structure of periplasmic divalent cation tolerance protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
SLILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords periplasmic divalent cation tolerance protein
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Thermotoga maritima
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vhfA00
2XBPA 4AFFA 1UFLA 3M05A 1UKUA 4C3MA 3O8WA 1VFJA 1P1LA 4NYPA 2NUUG 3NCRA 4CO2A 2Z0GA 1NH8A 3X3UA 3O5TB 1J2VA 2J9DE 3NCPA 3LF0A 5D4LA 2XZWA 2CZ4A 2NS1B 3TA1A 4RWXA 1V3SA 2VD3A 3AA9A 1NH7A 1GNKA 3TA2A 4Y6IA 4C3KA 4CO1A 4USIA 3T9ZA 4CO0A 2JJ4D 4YB6A 3CE8A 4CNYA 2GX8A 4RX6A 2E66A 3AH6A 3BZQA 4USHA 1UL3A 3TA0A 5L9NA 4OZLA 1QY7A 4RLEA 5DS7A 4USJC 1UMJA 4IYQA 4CO3A 5D4NA 1PILA 3N5BA 4NYOA 1O51A 4YB5A 2O67A 4WK1A 3OPKA 3L7PA 1NZAA 5D4OA 2RD5C 3AA8A 4CO4A 4OZJA 4OZNA 4ZK7M 1H3DA 1V6HA 5DRKA 1NAQA 3HLUA 4D3GA 1Q1KA 2XG8A 4E98A 2GW8A 4CO5A 1OSCA 2EG1A 2GNKA 4RWWA 2XULA 2J9EA 4WK3A 3AHPA 5D4PA 4R25A 2NUHA 1XK8A 2PIIA 4C3LA 2EG2A 3GSDA 1VHFA 1O5JA 2V5HG 2ZFHA 1HWUA 1V9OA 2O66A 2ZOMA 3DFEA 1KR4A 4YB7A 3MHYA 2DCLA 4Y65A 3NCQA 4D3HA 2J9CA 1V3RA 2J9DA 4CNZA
chains in the Genus database with same CATH superfamily
2J0XA 3PYDA 3MM6B 1NK6A 1VQKS 3OLBA 3ILJA 1SCJB 5L1JA 1S10A 2GGPA 3MPWA 2YKMB 5L38A 4NZ0A 4XTTA 3TARA 3GYXB 1N5SA 3J80Y 4A8OA 2XWYA 3H2VE 1M5PC 3RRGA 1QAXA 2D3O1 4A8MP 1LWEA 2IRUA 3TRGA 3DRSB 4UF4A 5F8MA 1U1OA 5E3RA 2HVZA 2DRAA 1BQMB 1YZ7A 3PYEA 2ZH9A 3L4BC 3HHEA 3HVTB 4RNHA 3KHLA 3BZQA 1WEXA 2F9JA 2AMCB 3AB2B 4USJC 5DM7Q 2HWHA 2E7VA 4ZMMA 3GG1A 1SJ4P 1FFSB 2XMMA 4M63A 3C6TA 3OV7A 2G9OA 5HAOA 2XYHB 2VG7A 3MEGB 4IO9Q 1GH8A 3GIIA 1VHFA 1JLEA 3DLKA 4QIVA 3VCDA 5IQ6A 3DCAA 1HBNB 2C2EA 5EX3A 1JLFB 2GQQA 4X4UA 2ZD1B 1T9WA 3I4HX 3CB4A 3G86A 2OD6A 3ENVA 4KV8B 4MK7A 5HVHA 4PG5A 2BJDA 4URQU 1MG7A 3T5HA 3HCXA 3W5XA 2HHSA 4J5OA 2AJ1A 2HK3A 1CJUA 2ZVSA 2P2CB 2RDDA 2VONA 2AQ4A 2XS7A 4KPYA 1S57A 2V2VA 2AEJA 2XSJB 2MQMA 3C16B 3CULA 1Z2ZA 4PR6A 2Z30B 5DO2A 1LWFB 3QT6A 4DX8H 4GVBB 3SCJE 1AUSL 1HHSA 4CLYA 4CO3A 2GIFA 4FNIA 4YMEA 4DOZA 2DT9A 3A12A 4OIXA 4OZJA 3W9IA 5HLFA 5L8RC 1H3DA 1Q95G 3GFXA 4KT0C 2VQEJ 4YR3A 3O2IA 3OR2B 5JMNA 4EWTA 2YVSA 3BKTA 2ZH2A 4NPOA 4EU0A 2HAIA 2HQFA 4CM2A 4H4KA 4TU9A 3BQ2A 3EUNA 3LP2A 1HNXF 1NBEB 3KK1B 2QE5A 1XMQJ 1R43A 1SC3B 2ROEA 1T9YA 2IM2A 1X31C 5ETLA 4QR0A 2ZUAA 2RS8A 3TA1A 5KFLA 2XTJP 1HR0F 1XNQJ 1RWWB 4ZP9A 3BGLA 2CPZA 3W2WA 4PEOA 1R8HA 4YUDA 3UDCA 4RNNA 2VKRA 2HNZB 3FCHA 3WIVA 2DNYA 2K7JA 2Z56B 2WVBA 2QIFA 1TP7A 1A7GE 1IKWB 5I3UB 4ZKAA 4FNHA 1CJVA 3U02A 4ZIVA 5GADU 2DBBA 5HP1A 3KLIA 5F9NA 3IG1B 4DFKA 4LFBF 1RJJA 1IQZA 5E3PA 2B6AA 1KRPA 3CCJS 4KGXB 3RZAA 2ZE2A 2KZMA 3MPDA 3M1VA 3EXYA 3Q0AA 3O1LA 4WF9Q 5LXRA 5CYMA 4WE1B 2QSFA 4C11B 4WKYA 4HTJA 3Q8YA 2BKNA 2YWGA 3PG9A 3EDQB 3NAHA 2R2SA 3V5RA 1WC4A 4A8FA 2VD3A 2F4VF 2E29A 1U02A 4U9RA 3IBWA 1DQAA 1RLCL 2F8MA 2A3JA 4MKVA 1PJ7A 4ECYA 1FKPB 4H4OA 2MQPA 4JV5J 1RTHA 4J9QA 5F0WA 1S6PA 4DPTA 1U1MA 3OFHA 3MR5A 1CJKB 4EEYA 5DZ6A 3NKYA 1O8BA 2ACMA 3CCZA 3R7BB 2Q66A 3PW5A 1PJ6A 4AXJA 4ZPDA 1S0MA 2C2KB 3H59A 2ZWOA 1IN0A 2E5IA 2ADCA 4DSIA 2KL8A 3HHKA 3R5AA 3ELHA 2V8VA 3TAPA 1TKTB 2AWZA 1NK5A 4BBYA 2XULA 2F8EX 1NJIT 3K5NA 1T9VA 1UA1A 1HW9A 4PPDA 2FJEB 4OI2A 5KFTA 4DX6A 4U95A 4ECWA 3TNVA 2EK1A 5C42B 5CABA 3D1OA 2C2RA 2JLGA 1RT2B 1TKZA 2E9RX 3VTIA 2WB4A 1AYEA 4NEZA 1RT4B 3ZTQA 3CJ4A 1RAHB 1WOOA 4ZS6A 2CZVC 1RAEB 2M0GB 2OPQB 5L1IA 4B3RJ 4Y2KA 3UD5A 5DDPC 1OQ3A 5DG9A 3TUIC 2HLTA 1ELOA 5J2QB 2RU9A 4F3MA 1FWLA 3KNGA 1JLGB 3EX7B 4GKKJ 1N32F 2WSEC 4C0OC 1BHNA 3JB9k 3T6BA 1LXNA 2M9KA 2Z8QA 2NZ4A 2FB0A 4ELTA 3V6DA 2YX7A 3SV4A 5JUMA 1CBKA 4RO0A 1L3VA 5KFEA 2KZZA 4LRAA 3RJMB 3EGZA 1HKAA 3MECB 2BANB 3HFKA 3IM9A 1NU4A 4JI6F 3TJ8A 1HQUB 1Q0NA 3PJ9A 4Q2LA 1BE4A 3EGWB 4IG3B 3KLVA 3OXFA 3MM7A 3SDEA 1HFEL 4J90A 1RTIA 5A76A 1NK0A 4OZ0A 2XC9A 1NJZA 1RISA 3R6LB 4Q5VA 4JI2J 2V34A 3UFCX 3UN5A 2DNGA 4MH8A 5B0CA 4G65A 4QZVB 1QVFR 4F0KA 2DHGA 4DQRA 4RZRA 1I6JA 1FESA 4C6AA 2ABYA 3IR5B 2AX0A 1QM9A 3HHDA 4O3SA 1CPZA 4N56A 2QA1A 3N5BA 3H40A 1O51A 1NDPA 2EEYA 4IFVB 4L73A 4ZCIA 1RWOB 2C22A 3DGVA 1L3SA 1FD8A 1RU2A 2C3PA 3W8GA 3LWMA 1OSCA 3NWGA 3R5GA 3OR1A 4CZCA 4P74A 2XSFA 1K44A 1VJWA 1KVIA 4FF2A 2MTLA 4PXBA 4WWSA 4OZ1A 1KLMA 2B8PA 1UPMB 1NK8A 1ZAWA 4KGKA 4HHJA 1NK7A 4DV3F 1KTQA 2UXBJ 2F5GA 1AT1B 4LVNP 5CH7B 1F2HA 2B4PA 1MWZA 4MKAA 4PWWA 3HP6A 3UVJB 1HYSB 2WAQD 1C1BA 4MYUA 3X1LB 2DH9A 2DGVA 4Y6IA 4X4QA 5SUHA 3QT7A 2RU3A 5KG7A 4P73A 4DDFA 3MTKA 4ID5A 1DY3A 4DHVA 1HNZJ 4DR6F 1WC5A 1X5SA 3KK2A 1RHJB 3Q8PB 1H72C 3FCVA 2BUNA 1YJ7A 2OGUA 3QATA 4XDCA 3LO3A 3W66A 1WHXA 1F9EB 2E9ZA 4PYAA 5IQQA 5IC6B 3QO9A 3SFUA 2OELA 1SI9A 1B70B 4DN9A 2EC0A 3NBPB 1SIWB 3QJJA 1X4HA 3AD8C 5ETOA 1PGZA 4OHZA 2W7PA 1MMNA 2Q6CA 4B9VA 1Q8KA 4KHRA 2K1RA 3C15A 1ZH5A 4KH1B 3KWMA 2BE7D 1QJHA 1WKKA 1YSJA 2ZJRQ 2LLZA 3UDEA 3JSYA 1DRZA 2H5IB 1H73A 2D41A 4WFBQ 4ZVQB 1UJ6A 2MYFA 1FTCA 3D6HB 1FKAF 4NXMJ 1BD6A 3M2VA 3MMBB 3V2UC 1RYSA 3JSMA 1FRHA 3PW0A 4FYYB 5EX0A 4NYOA 1N5VA 4NA3A 2VFSA 3KNAA 1QE1A 3AY0A 3VVTA 3MR6A 4JB8B 3I5CA 3PFEA 2LDYA 4ZLJA 2V8DA 4ED4A 1BUXA 3OVAA 2N7YA 1DJ0A 2Y1RI 3CDEA 5ETSA 2P9CA 5KG0A 2EFVA 4DG1A 1NO8A 2HYIB 3W61A 1I51B 1NRKA 3CCVS 2A10A 1V3RA 5AE1A 2OFHX 3GMGA 5HMZA 3MUMP 4F0MA 4DPXA 2C3UA 2IM3A 5LMNJ 3DLGB 1Q53A 3TQEA 1M1KT 4CTAA 2EFGA 3PEJA 2CUYA 3NGUA 3G82B 2ZH6A 2UVWA 5AXNA 3D2WA 2LXFA 3HX9A 4J37A 3MM9A 1WEYA 5JVGQ 2QSWA 4IH7A 1F5AA 3DOMA 3FBEA 1MN9A 2BVZA 3FCWA 1FDNA 5B0AA 2C3MA 4OJ3A 5K8OA 4B9LA 3VAGA 2KM8B 1WHWA 2ZC3A 2AEMA 2J8SA 2I6WA 2ZM6J 4WTYA 2VDIA 3MMCA 1B0VA 3G71S 4DR7J 3TW0A 3VALA 4DV0J 1SL0A 1GT8A 3I9ZA 5E5NA 2IDLA 3RB3A 1HWKA 1YJUA 2BW7A 3SEOA 4H4MB 3WC2A 4ECUA 7FDRA 5HI7A 4JBCA 3GIKA 1HW8A 1KC8T 3GSDA 4NYZA 2XMUA 1RT6B 4QW8A 4XIUA 2WZ1A 4IUFA 5A0YA 3MAAA 2BACA 1XMBA 1LW2B 4JI4J 2Z2LA 1VIXA 1F3VA 4E0DA 4JI8F 5IXUA 5BR8J 1CLFA 4DSFA 4M8LA 4GRSA 5IWAF 4M5NA 2UVVA 3RGIA 3C8YA 3LH2S 1RT5A 1JXLA 4YY3F 1ZPVA 1C4CA 3GYGA 4ZVSB 5GMKa 5D78A 1PAEX 3PXGa 5CYQB 2KFZA 2IFXA 5F41A 3TA2A 3HHNB 2WONA 4DZDA 3PR5B 2DR8A 3UO0A 4OHVA 4FBTA 5A2QU 2QGFB 5A6WA 4IKAA 1GMVA 4GO7X 5LJ5Y 1V3ZA 4LUBA 2BJ8A 3VF0B 2GNKA 3TP2A 4ZPWR 3KG4A 1VQNS 1DQ9A 3R5DA 4UUXA 2BJ3A 2ZZTA 3FBCA 2ASJA 2LEAA 4UT4A 1GXUA 2FGCA 2DNZA 3EGVA 1REVB 2OLWA 1RT7B 3MWBA 3MAHA 3M2UB 4O44A 1KWMA 1MROB 4MYTA 3OW2R 2W01A 5ITHA 1HLWA 3BBFA 3Q8SB 1F5CA 3D0IE 1P1TA 1URRA 1CJTA 2VG5A 5L1LA 3QLHA 5L39A 1YRTA 1QSYA 4O3RA 3NMAA 2N3OA 1YJWS 1IQTA 4KC5A 2XB2D 1QAYA 1T03B 2O5DA 4LIRA 4DL2A 3FKBA 3QJPA 1FK9A 3VZIA 4AUKA 4X4NA 1UZDA 3L7PA 1OY8A 5HJXA 3NGKA 1KSPA 5IT4A 4ZK7M 1X9MA 2RF2B 3ZTRA 2C2MB 1G4CA 4Z7CA 1JJ4A 3D0GE 4C3LA 1EQ0A 2QMXA 2YWWA 3POTB 2HZCA 3NGDA 5HMYA 3G87A 3TZYA 2G1HA 5IT0A 2FZKB 4IOCQ 3VAHA 2HPUA 4I68A 3EXCX 3EM1A 4NYPA 2FLLA 3BEGB 4HR2A 4M5DA 2DHAA 4PG6A 3CDAA 2MY7A 3I6PA 4WJBA 3JTPA 1NZ8A 1PCAA 2Q79A 4PAAA 1JLCB 1JMTA 3DM2B 3I31A 3QSYB 1EARA 2HS3A 5EDWA 2XLJA 5U47A 4M5HA 1JIHA 2HNYB 3TWZA 2YNGA 1XN9A 1X0PA 2FVCA 1NM2A 1YWXA 5KOXA 1AROP 4KB7A 5KFGA 2OSRA 2DNPA 2J7KA 4OL8A 2GAHC 2YKPA 2CJKA 4ZVOB 3LGHA 3DLJA 5AE3A 2PI5A 3VAFA 2ERRA 3FRYA 3GFHA 1JLBA 3OLAA 1K9MT 2QEXS 4AQYF 4O0NA 3J81Y 1C0TB 3OSPA 1B0TA 2VUGA 4C48A 5E7OB 1TL5A 4DQQA 3OJSA 2L9WA 2MZTA 5GMEA 3T5LA 1UFKA 1AA1B 3KHRA 3EWGA 1NUEA 1N5YA 4Q45A 4F36A 2HBYB 4USTA 2YH0A 3D6FB 1XTZA 2PGCA 5I4MA 2AJ4A 2MSTA 1IKXB 1FJEB 2KT5A 2VHGA 1TAQA 2Q3PA 2PN6A 2LQBA 1X4GA 2YPYA 3KMQA 4OLOA 1S4FA 2RKIA 1DTTB 1U7LA 1Z1ZA 1IJFB 1N52B 3CDWA 4MIAA 1GXTA 3F0NA 3MM8B 4PABA 1S1XB 4GKJJ 2A0FB 4K0KJ 3GV5B 2MZ1A 3K58A 4OI6A 1QUVA 2BJ9A 2PD1A 3L7OA 4ELVA 1JK9B 1KEKA 1NDCA 1FRKA 1S0OA 3H7HB 2W7AA 3GYNA 5LSLA 4UQGA 3OUYA 1DLOB 1HWJA 2IPOB 4JYAF 5HROB 1AXQA 3B4MA 2J6SA 2IYGA 2CZ4A 3KUGA 3T5KA 1HNWJ 3QWPA 2IHR1 1LK7A 4DWIA 2APOA 4JI1J 2KFYA 2V8GA 1S1TA 1PYSB 5AXKA 2D1CA 4MKYA 3KLHB 1S9GB 2F8HA 1N32J 3MEDB 3EVMA 2V2KA 2KI2A 1REGX 1FD2A 4OZNA 1TUGB 4WFXA 3MR3A 5KFKA 1WI8A 3PVXA 1NPPA 1IBCB 1EX8A 4DV2F 2I5JB 2COLA 4J9PA 2HBZB 1SQEA 1F9HA 4O3OA 3TEGA 5KG5A 1D1UA 1HBOB 1S9FA 3RB4A 2IC3A 2FJXA 2KG0A 3CJ0A 4CLLA 5IFMA 3D6TB 4OJGA 3W60A 1HBMA 1D9AA 1ZYQA 2CIMA 1PYOB 2GFFA 2I38A 3JS9A 3TZZA 3JYTA 3P8BB 1V5IB 4JI6J 4L3NA 1N6QA 1XNRJ 4X4OA 2AKWB 2MZQA 5AE2A 4B3MJ 1H2UX 3MXHP 4F04B 5B08A 3ZTOA 2NS1B 2CPJA 1RE1B 5KFNA 1YQHA 2H9ZA 1RTJB 5ETRA 1B7FA 2HHHF 2J76E 1WG5A 2HIQA 1T02A 2P9EA 3HHLC 1JKHA 2GVZA 4CO0A 4JI0J 2FHJD 4OHYA 4I56A 3HVRA 4IG0A 2R8JA 1FJGF 1I94F 3HT0A 1Y3JA 4NOHA 4DR4F 2F40A 3I82A 2UV8G 5C24B 4WYLA 3K2YA 3I0RB 2P5VA 3TZWA 4DX5A 4LFAF 3NOCA 2CQBA 4WP3A 2DR7A 2BE9B 4ECXA 1RADB 3FZ2A 3B6BA 1R8BA 1SKUB 3IC1A 2KT2A 3R8YA 3RB6A 3NEKA 2ZFHA 4X84A 3HT3A 1LFWA 3RUBL 3UNGC 2D3ZA 1HBNA 1J5EJ 1PIEA 3QIPA 4K2JA 4EBCA 4QWCA 2DNHA 3HPOA 3GONA 2EFPA 4DV3J 2AW0A 3HULA 2BEFA 4OHXA 1HQ2A 1S1WA 4X65F 4DPYA 1NKEA 4ES1A 3MR7A 2ZC4A 3KLFA 3UR0A 1IKVB 1UEVA 3CJ3A 5D0EA 1JQGA 1KFDA 2XMVA 2HHUA 1UW4A 3KG0A 4L74A 2VBYA 2MLXA 4MJKA 2L08A 3QBCA 2ZHBA 3DLHA 4RW6A 1S1VB 2CQ2A 2JC0A 2ZITA 5ETNA 1OYDA 3AJDA 5ETQA 1U1KA 1SKWA 4O4GA 5LJ3Y 3DU6A 3GIMA 2IRYA 3M8PA 4IFYB 4FS1A 4B17A 2W1BA 2NCKL 1L3TA 1RK8A 2CZ9A 1BC6A 3UE2A 3DLBA 3KYLA 4K4SA 3MHYA 1KDNA 4F4AA 3B54A 4DR1J 4R8UA 1S1UB 2NXCA 1RBOB 4B08A 4LF4J 4JI3F 2VFVA 1IBKF 1L3UA 3A8KA 3EE3A 3KK1A 3LALA 5G4DA 1G3OA 3AQOA 1UZHA 2J9DE 1C2PA 3OL9A 3DRRA 5C7PA 1WORA 3RR7A 3PNIA 5J1NA 3KJVA 5DQIA 1FCAA 5CZVA 2R9LA 5JXSA 4X4PA 4FF4A 3M2RA 1IWGA 1QAIA 4CDIA 3S1TA 5BYRA 2R2TA 1S9EA 1RT1A 3JAMU 1SC1B 4RUCA 2UUWA 3CXCR 3VAIA 3FK4A 3GFZA 5G0RA 2J0WA 2JDJA 4CLFA 2Y1JA 2BJ1A 4DS5A 1IBLF 1VQLS 1KFSA 2MGZA 3IR6B 1NSKL 7FD1A 1SL1A 1X9WA 1GTHA 2AJ2A 3TZXA 3PYFA 3R97A 1RSCA 4UOCA 3UW1A 2PMZD 4B3SF 3OL7A 4DN0A 2ZJPQ 2RQKA 5C25B 4K8RA 3K5LA 3D5MA 4AL5A 3FSXA 4PUOA 1UFLA 2ZWPA 3SMZA 1PG5B 1RTDA 4P7VA 4NWBA 4HKQA 4ZPBA 2QLJB 4R5PB 1XEZA 1UETA 3AA9A 3Q89A 2FY8A 1PAUB 4DV4J 1TKXB 3J7Z5 4P71A 1CEZA 4L3KA 2OH2A 2LQJA 1PC4A 4ZVTB 2D7SA 3KUHA 2BJ7A 2QJ3A 4Z7YA 1U26A 4C97A 2YX4A 4ICLB 2V2QA 3FMBA 1BXNA 3AA8A 4ZJQA 3Q24A 4CYUB 3PKMA 2G0IA 4NRTA 2EG1A 1UEUA 5B0DA 2HAFA 1O5JA 2E1RA 4ZOSA 1FF2A 3ENWA 4KJIA 1HPZA 2D3UA 1BQNA 1KD1T 4YFUA 3BSOA 4C3MA 2PSZA 3BSCA 2OMOA 3A1YG 5GAGI 4OHWA 1VLYA 5KOWA 2DPJA 4FYXB 4OQJA 2OPSA 2DY9A 3IXQA 1L5UA 2IJFA 1WUUA 1JLAA 3OT9A 4QR1A 1DFDA 3PX6A 4YY3J 4P75A 4R0EA 2FDNA 2XMKA 4N76A 4J9SA 5IM0A 2CJAA 1EETA 2YNIB 2R7SA 3W8PA 2AT1B 3UCGA 2B43A 2C42A 4FYVB 3QIDA 5KFRA 2RQCA 5D77A 4PQUB 4EZ9A 1KQGB 4EK2A 4AD6A 1RWNB 3RAQA 4BWJA 1FKOB 2H48B 2CQDA 4TU7A 5LM7E 3PZPA 4ZDNA 5EHHA 4QPXA 2MHNA 3GCXP 4F3QA 2DR9A 1XQIA 1E6YA 2NZCA 1KQKA 5BJRA 4RNMA 2KVQE 3UD3P 4J9OA 3AB4B 2BZ2A 1U2RA 2VG6B 5E3AA 1X5PA 4DR5J 3KTQA 1T9XA 4TN2A 4IR9A 1FERA 2VFTA 2YTCA 1V3SA 4RW4A 3IAS9 1SV5A 3ETMA 2VQEF 1VQPS 2Y3YA 4Y2AA 3W9HA 1WEZA 3Q8UA 3IN5A 1FTRA 3PW7A 2QRRA 1UWBA 2HS4A 4USHA 2G2OA 4C98A 2DGOA 3I96A 3GIRA 4RUAA 2L41A 4EGLA 4MAKA 5J1PA 4ZP8A 2HNDB 1V6HA 1X5OA 3K89A 4RUHA 5J1EB 4KR0B 4CO5A 3N79A 1LWCB 1RAFB 4OX7A 3VR1A 4X64J 2FY1A 1YI2S 2Y9HA 2JC1A 1VC5A 1RQ0A 3LQVA 1XNQF 4YB7A 4MTPA 4C0BA 4NLOA 1IR0A 3NCQA 1EKSA 3CNQP 5F8IA 2LA4A 4TU8A 3UD4P 3DOLA 2UUCJ 4DUYJ 2H65B 4CH0S 3F56A 4FDFA 5FD1A 2DO0A 4YB1P 4ECTA 4TYBA 2DRDA 4HACA 2WOMB 3T3FA 2OPPA 1RAJA 3RB0A 2GVDB 2MDAA 4QWBA 1B0PA 2PEBA 3ILOA 1LW0B 1S76D 3ILLA 1VQ6S 4BC9A 4XO0A 4K4ZA 3MGJA 2I8EA 4CM0A 5F9LA 1VLOA 1N0VC 2OAUA 5DRKA 2BOPA 1I1GA 3K8WA 4ZP6A 3M9MB 1U09A 3FSIA 1SC4B 5DZ7A 2JLFA 1VGYA 2HVHA 1RHRB 2KHDA 1TU0B 2EFQA 4TQSA 1KQSR 5K5MA 2IDEA 2YBVA 3SFGA 1M0SA 4CT9A 2MLYA 4ZN1A 2D9PA 1DTQB 3NP5A 3VGSA 5B0FA 4JV5F 1WF1A 3F73A 5ETPA 4AE5A 2OEMA 1D9DA 4IDKB 1RDRA 2R8KA 3BBCA 1F1BB 2W9BB 3BF4A 4QIGA 2ZBRA 3FBBA 4J9VA 4DUZJ 3MI7X 4MK8A 1HMVA 2W8LA 3EPGA 4PG7A 1VRTA 2YKAA 3B8HA 1NPKA 2DR6A 3I0SB 1MNEA 4Z37A 1FVQA 2H5EA 1X60A 3PY8A 4LR9A 2G1DA 1TL3A 3GTYX 4RPFA 1M1GA 3D68A 1T05A 2VF3A 4WU2A 3MR2A 2CADA 3C66A 2HBRB 3I56S 2Q6BA 1XC9A 4B3RF 3TAMB 4H4KC 3DOKB 5M2PA 2R7QA 4TYAA 1G1XA 1H7WA 2G2ZA 3TJAA 1QTNB 1K1QA 1XWLA 3RAMA 1KLNA 2ZOGA 4ED6A 3BPSP 1FWKA 3MM5A 3HM9A 3BKUA 2MQ8A 2QA4S 1R8AA 1XR6A 5T7LB 4A8QA 4A8YA 1SVDA 3F41A 1D09B 3BR8A 2R2RA 4OX6A 1Q82T 3BH7B 1UFWA 3GPAA 4F3OA 2E5GA 4LQ3A 3OFFA 4KGZB 2H4YB 4OYIA 4WYWA 1VC6A 2QN6B 3B4DA 3OTOJ 2PFDA 1S12A 2HW3A 3DRPB 3M30A 1OY9A 2JLEA 3FBFA 3W64A 4JI7J 4M1KA 1IM6A 1F2GA 2LXIA 2ILYA 5F8JA 3FVYA 2RE1A 3ONQA 3Q8VA 2OFGX 1S6QA 1R0AA 4NZ6A 3ZZZA 3HJFA 1C4AA 3DFEA 4JI2F 2OO4A 2LQ5A 4ILRA 4PPZA 4DV2J 2XZDB 3E8OA 1VJQA 2OPRB 5I42A 1SC6A 3A4TA 3GLJA 4Z2XA 1YBAA 3S6EA 3OQ2A 1VRUB 2HHQA 4QWEA 1NJXA 2Z0GA 1NKCA 2ZBCA 4LBPA 2MZSA 5D4LA 1RAOA 3KLGA 3J7AN 2JL9A 3IS9A 4DR3J 4Q7AA 2GGPB 5C2CA 1EB0A 4CLWA 2C2ZB 2KXFA 5KT5A 2UXDF 3BO2A 2LQ8A 4FXWA 3P6YC 1Q7YT 9ATCB 5BYQA 3CDUA 1A6LA 1W26A 3IFEA 1LWEB 4TQRA 2VBXA 1FO1A 4P6QA 2HGMA 5DS7A 3C14A 3N28A 3JQJA 1RWMB 3BQ1A 2JEJA 3D28A 1U8SA 2C1EB 1FJGJ 1E6VA 4DF8A 1I94J 2J6TA 3J7ZT 4BS2A 2KKHA 4LFCJ 1WC0A 2CQ4A 1CS4A 3W5ZA 3S01A 2UXBF 4NI2B 4WCEQ 5KG4A 2HZVA 2X7IA 4JV1A 1H6KX 3N9UC 2WB1D 4O3PA 3R5JB 4HDGA 2BX6A 4EFAC 2ZH3A 3C6TB 2QMUB 2OHDA 2A2DA 1Q8BA 3PKYA 1APSA 3WZ0A 3GZ7A 3ZNUA 4DF4A 1JNZB 5H9EJ 4TY8A 2VG7B 2YWFA 1JLEB 4P10A 4DI6A 3DLKB 3DMJA 1QUPA 3DYAA 4KQZA 4ANCA 2CDQA 2GMHA 2UV8A 5CHCB 1HNZF 3ZO7A 1VC0A 2AU0A 1N48A 4RL1A 3S8SA 1VMBA 4YEAA 3E01A 2XO7A 5B0EA 4AL6A 2NXEA 2W4DA 1NH7A 1YHQS 2GQCA 4LF7J 4O0IA 4CLKA 1JLQA 2PA3A 4ZLLA 1CJUB 4DV7J 4CQ1A 4DL6A 3QNWB 1U6FA 3GE9A 5GAHI 2V4JA 1YLXA 1TZ0A 4NE9C 2QX0A 3CCTA 1SH0A 1Q16B 3P5BP 2WRMA 2JHEA 2WCXA 3QFWA 3LOUA 2NR0A 5HLFB 3H4DA 4IH5A 3QRQA 4IR1A 4NXMF 2DHXA 2XBPA 1W2BR 4HH1A 1P9YA 4DV1F 2ZBQA 2HGLA 4JI3J 2BJEA 3LP2B 4Y0FA 4CWBA 1XR7A 4CRJA 2GAGC 1U25A 2DR5A 4PZVA 4DXLA 3C6UA 4F25A 2NPIA 5A8RA 1KP6A 3AD9C 4LF9F 4EO8A 5FJ4A 2B51A 2N82B 1SH2A 1T3OA 5B0GA 3AQPA 3W2WB 1PILA 4YR2A 2E1CA 1C1CA 1N8RT 1S4EA 4QIEA 1YIJS 3VQTA 4NCGA 2GV1A 3D1HA 4USKA 2BKOA 3MF5A 5LMNF 2VJVA 3A3OB 1RWPB 4Q2MA 5GVQA 4P2MA 1RXOB 2RDJA 1CJVB 4QWDA 5HP1B 2NSCA 3FQLA 3G96A 3KLIB 3M7VA 3MD1A 2B6AB 2W2NP 3ZC4A 4U7UD 3IM8A 4CO2A 2R8IA 4G1QA 2BE2A 3NOGA 1YJVA 4H54A 2ZE2B 2MZRA 3IR7B 2LXUA 3M1VB 1KVKA 2ZM6F 2MLZA 2VBWA 5CYMB 3H4BA 2CA9A 4DR7F 4DV0F 3H5XA 4U8VA 3CT9A 4CI0B 3N6NA 2WVDA 1OYEA 1J5OA 2UU9J 3GB0A 2AJ0A 5HVFA 2UXCJ 1VR6A 3BN7A 2P9GA 1ITPA 3PIPQ 3TANA 4LF2A 3CMES 4G6VB 2DISA 2D74B 5K9FA 1YTYA 1SQFA 1FT8A 3D3BJ 1VIOA 4ID8A 4H4OB 4YP3A 4ETXA 1RTHB 4JI4F 4CO4A 2UUAJ 2MPUA 1S6PB 3HFVA 1RYRA 3G4SS 4LT6A 4OFZA 5FLXU 5BR8F 5HSPA 4RBTA 2P6SA 3IRXA 5D0RA 4I6AA 5F0UA 2ZOFA 3ET6A 4MMOA 2L9DA 1V9OA 4QR2A 2E1MC 5EWGA 3LAMA 4F0HA 4PG8A 3PJXA 4CLPA 4ANDA 4QQBA 1IR2A 5A8KA 2CPFA 2JWNA 4ZHRA 2QMWA 3FFIA 2C2OB 3CJ2A 1RWKB 2HZAA 3M6VA 5IOLA 1TKZB 2DNNA 5MLCV 2RRBA 1S79A 4RWXA 4GC6A 1K73T 3H25A 4F2RA 2ZBIA 5H9EK 1HD0A 3RTVA 1S99A 2HBQB 1D8YA 5EN1A 2DXDA 1N4LA 4WTOB 1EP4A 2KTQA 2FTRA 1KQFB 2ZZMA 3KDOA 2MKKA 4S0MA 1NCLA 1RHMB 2B9XA 2DHHA 3OPKA 1FE4A 3QAEA 3DGPA 3CGIA 4WU3A 5DETA 3B78A 2FHOB 1U24A 4OX9J 5FIIA 3V6DB 2R7UA 3HF5A 5HBMA 4LRBA 3AAWB 3LW5C 1T7PA 4LF8J 1WTFA 3W2VA 2DKOB 4DV6J 1SUQA 4GC7A 3M6WA 3BSNA 3SSRA 5E41A 1IWAA 2LA6A 2HURA 1HNVB 2HLUA 2L48A 1O6XA 3KLEA 1R7IA 1HNIA 1WC1A 3IA0A 4RW8A 1XR5A 2HQ3A 3MM7B 5LSRA 4DS4A 1GQEA 4DQPA 4IOAQ 3SDEB 4IO1A 2MQNA 1RTIB 1JJCB 1RKIA 2QLXA 4WFAQ 1U2CA 3PW2A 1RACB 1VCTA 1Y7PA 3SZ2A 2E5HA 5KT7A 1RAAB 4RLEA 4F2SA 2GIRA 2ATCB 5KFMA 4NMXA 3CCUS 4Y3CA 2XMWA 2F9DA 3PV8A 4GO5X 2DITA 1GFWB 4OZ3A 5HATA 3ZZRA 3OFEA 1M5SA 2EKYA 4TLQA 2DEJA 3MOJB 4C0HA 1H2VZ 3TVYA 4DQIA 2V94A 5E3CA 3TVZA 1H74A 4U96A 3DRYA 3MMAA 5HJYA 2ROPA 2HMIA 2OEKA 2DH8A 2V9WA 3SQGA 1U47A 3CJKA 5J2MA 4W90B 1KLMB 3KXDA 3ULHA 4USWA 4DPUA 2XZWA 4DR2J 2DD8S 1SIZA 3QT5A 3I87A 3KK3A 4F4YA 1SJ1A 4P52A 4ED0A 1N34J 3D6MB 1U1PA 2M4MA 4YS2A 4AYBD 1RAGB 3IGNA 1C1BB 4XDDA 3OTEA 2VA3A 4YHHJ 2F3JA 3JTOA 3NNHA 4OZ5A 1VBYA 1DBDA 1Y0HA 3DI6A 5HANA 3RAXA 4BC7A 1BLUA 4ID5B 4NASA 4ITSA 5D0HA 5CZXA 2DNKA 3M32A 1IKYA 4A8WA 3N0VA 2CYYA 3KK2B 5FDLA 2BA9A 2JOQA 1CVJA 1JB0C 4DLEA 4R0JA 4F50A 2ASYA 3P96A 1QTMA 2HQDA 3QO9B 2BM1A 1F0XA 4ELUA 5MAOA 3AOCA 4AT1B 4F4ZA 3N6LA 2FJAB 5HQLA 2AYGA 1FRJA 5K8NA 2K1RB 3C15B 4ZA1A 1WHVA 4X66J 4TY9A 2KJVA 1MWYA 2XS2A 1X4CA 2HQCA 1F9FA 3NS7B 3RBEA 1NLKL 1UP1A 3TUZC 3EGNA 3AD7C 4KE5A 5CXTA 4YR0A 1CSJA 3WHIA 5EGYA 3CE8A 4N77A 1AFIA 4L75A 3H98A 3E51A 1S7HA 4GKJF 1RCXB 3M2VB 4K0KF 2FVSA 2X3DA 4Y2IA 2YPZA 2ZH8A 2AGOA 3JSMB 2DPIA 3GJRB 4CP5A 4M5LA 1AW0A 4OYAA 1UW9A 4B3OA 4J9NA 1HNWF 3ZXWA 3ENQA 1IM4A 4M95A 1TUVA 4JI1F 2Z4PA 5D8HB 5IZHA 4DG1B 1LOUA 2XZTB 5KFXA 1M1HA 1WHYA 3R2CJ 4IH6A 4B3TJ 1VBZA 1HIYA 1H38A 3NG8A 4CTAB 1FJCA 2BW2A 4B9UA 2PT0A 1A9NB 4A4JA 4QU6A 3MM9B 2DNQA 4FF1A 3DOMB 2AEFA 4QOTA 5BXIA 1C0UB 3ADAC 1X4FA 3CCWA 3VVUA 4DV5J 4NX9A 1NAQA 3MAQA 1Q1KA 2OJ3A 1ZS6A 3HHLA 1XNRF 3MMCB 3SXLA 2EVZA 3AHPA 2BV3A 4B3MF 1TAUA 5AJ3J 2V67A 2CPIA 2VC1A 3CJ8A 1LNQA 1HQEA 2OKQA 4LF1A 2QFJA 3QRRA 2M2BA 2HIYA 2KM8C 2ZH1A 2IAJA 4FBUA 1FFGB 1LK5A 2W9CA 1GX5A 4JI0F 2DXEA 3CCLS 1CQNA 2CKWA 5A0YB 5F3TA 2IMOA 3MAAB 2XM3A 1UJ4A 2OP5A 4J9KA 2LEBA 4KHMA 1UPPA 2CNKB 2AD9A 2NYHA 3V4MA 3PHTA 3NWRA 3TI0A 1U1RA 3MCMA 1RT5B 1M5HA 3CCQS 4HVZA 2AYBA 3RW7A 4PCQA 9RUBA 2UXDJ 2IBOA 1WD6A 2WONB 3ZZPA 4LJMA 1FRIA 2XWXA 2CQCA 2VFRA 1NK9A 2GO9A 1RT3A 1UVJA 2FLNA 1EZZB 3KHGA 1TUWA 4C4WA 2EBGA 2ALYB 1J5EF 2GZOA 1IR1A 3H8YA 5ADZA 5DG8A 1R8PA 2IJNA 2JFDA 1KHVA 1F60B 2R8GA 1YRXA 2B5JA 1OSDA 2F4FA 2R7TA 1FI4A 3EDRB 2LQ9A 4WP9A 1VBXA 3O44A 5DG7A 3I9V9 4I7FA 2PE8A 4E8UA 1YK9A 3BJYA 1HA1A 2VH7A 1TK5A 1GMWD 1FEHA 2DNRA 5LL6d 1U48A 3F44A 4ED7A 4MIWA 4O44B 1LWXA 2CJXB 4ZLNA 1VQMS 2J6UA 1UVIA 3M8QA 2RAQA 1QD1A 2MMYA 4PXCA 2VG5B 3R9LA 2CDRB 3QLHB 3MOZA 4U67Q 4V1Ak 4MFBA 2KXNB 1UMJA 2ZBPA 2DGWA 1GAOA 5HQ8A 4KFBA 4WFYA 4DR1F 4TXSA 2XEXA 3KJFB 2ZZNA 4LF4F 1Y10A 1FK9B 3PDNA 4YOEA 1PBUA 4RWWA 1UCNA 4LSLA 4P7TA 4G1PA 2XLKA 2Z2MA 2MHEA 4NLWA 2ILZA 4M5JA 4I6WA 2CXEA 2BR0A 3TVKA 4ZVGA 5KT3A 1HBUA 1VHIA 4RW9A 4AFFA 4JUZA 3EVOA 2LP4A 5C2GA 4CT8A 4ZIWA 2CQ1A 5DGAA 1RWUA 4OI1A 1QLNA 3BPDA 4F4KA 2RUGA 4F8RA 4DV1J 4KO0A 4ED3A 3V4IA 1R8CA 3DLEA 4M5DB 2AGPA 4KIAA 3LGNA 1RHKB 4Q0BA 2E9TA 3HD1A 1SJFA 4DL7A 4LF9J 1FEEA 3SV3A 3BDPA 4AL7A 5D4NA 4X2BA 1FA0A 1AFJA 2V68A 3DRXA 4YN3B 2ASDA 2GCFA 3WX8A 4NLXA 4EI2A 3IMQJ 2NXJA 4WXWA 1NKBA 2YNGB 2QL7B 1TFYA 2Y1IA 2VPZB 2V4QA 4QJVA 3GIJA 2PIIA 2DNOA 2EG2A 1PBAA 1Q86T 4ZPCA 1YG0A 4ZPTR 2AHOB 2A1BA 3SCIE 1FVSA 4X4TA 3CVKA 2ZVIA 4IRCA 3G6VA 3G8SA 4FF3A 1U0HA 2JH3A 4DV4F 4C8MA 2HS0A 2NUUG 3BQ0A 1Q8LA 3R1LA 1FDDA 2F1FA 2VDHA 4XK8C 3CSKA 1JLBB 1BGXT 2XI2A 2YKNA 2W4PA 4WBFA 1TV6A 2RJZA 3T1YF 4EYHB 1DZ5A 1Q78A 2CPHA 2L3MA 3G6YA 3MCNA 3H5YA 3AJ2A 1PC5A 2QTWA 2DRBA 1N5YB 2E66A 5M2RA 2AJQA 5B7WA 2WHOA 1TK8A 5KTQA 6AT1B 2IBKA 4DSJA 2BOAA 2Y8WA 3JAMY 1CC7A 2FC9A 1NZAA 1KS2A 2GJ2A 5KFBA 2FHJA 4ALZA 1LXJA 1AB8A 3QJLA 3CUNA 5JJBA 3GR0A 2HRTA 2VICA 8AT1B 2BQUA 3K5MA 2RKIB 2DJWA 3BB5A 4DEZA 2CFXA 3FQKA 4NCBA 2N4DA 4HLBA 2FZCB 1NDLA 2KHCA 1ZOTA 1KOOA 5B0BA 4Y00A 1RI7A 2CRLA 3KDNA 2CG4A 4OJ1A 3BGRA 4XPCA 3BS9A 4FKXA 2CQGA 4TVAB 3BGFA 4EBEA 3OUYB 3VAJA 1WJ9A 2KN4A 4N5SA 4ED2A 5HK4A 2FLPA 1OWXA 4F7VA 1K0VA 3R7SB 4RW7A 3NAIA 2YNFA 2BBEA 1HHQA 1S1TB 3TX0A 3R2DJ 3PM9A 3PCOB 2PDAA 3PFOA 2DYAA 3A3PB 3L09A 4DR5F 2MY8A 3BO3A 5A8WA 4RNFA 1BWEA 5KG6A 1T9UA 4KH0B 3CIMA 3AJ1A 4A48A 3BYRA 1SXLA 2BDPA 3R3TA 3OXLA 3BGOP 3H0PA 2E5LJ 3HZEA 2IC3B 4KBIA 1HBMB 4OYWA 3O5TB 1TVRA 1BWVA 2N3LA 3JYTB 2POKA 4RBVA 4ETZA 1N6QB 2R4FA 3VHQA 4OV1A 3T1HF 1VISA 2BM0A 5L46A 4CO1A 2JNJA 4CLUA 1URNA 4X64F 1N54B 2RT3A 1DAXA 4DQSA 2LDIA 3G8TA 3CO9A 4KHPJ 1JKHB 2GVZB 1X7VA 3CJTA 1TMMA 2JEGA 3Q2SC 1S48A 2IM0A 2LEPA 4IG0B 4J9MA 2FC8A 2AIRB 3W5YA 4LBHA 2UUCF 4DUYF 1RWVB 3MEKA 1TL7A 3G8QA 2HRUA 5E0OA 3T9NA 5CYJA 1WF0A 4JV0A 2RHSB 1ZA1B 4NI2A 4U8YA 2AZ1A 3JSRA 2CQIA 3VAMA 1ZETA 1U6BA 4LSNA 4QYZJ 4DFPA 3CJSA 4KKOA 2EI5A 1RBAA 3W62A 3W9JA 4PWDA 2QV6A 4I2PA 1YJ9S 2W2MP 5KFPA 3NS6A 2V69A 1VFJA 3LP0A 2ZJQQ 4FVCA 3MEEA 3ENAA 2ZHOA 3IWNC 4MKBA 4HL9A 2ZUGA 2CNLB 2RILA 3QIPB 3MUTP 1MSWD 5I3PA 1UWAA 1K0TA 2VJUA 4USIA 1S1WB 2H3EB 5J2PA 3KLFB 2YNHA 3HSZA 1QY7A 2X3GA 3CDBA 2ROGA 4B9NA 4RW6B 2LFVA 1AZSA 1X4DA 2AGQA 1ZZNA 1Y3KA 4E98A 3OTBA 4O4GB 4JP8A 3K57A 1S59A 3NS5A 3THPA 2A2CA 1X9SA 3SSQA 4I2QA 3M8PB 4LMZA 4NEYA 1UVKA 3ICLA 5GMDA 3OBIA 5D3GA 5T41A 5LMUJ 5K8MA 4DUZF 4QU7A 3C2PA 1HARA 5DGBA 5HMWA 5J2NA 1H98A 1S72S 1X4BA 3DC2A 2OEJA 4R8UB 3TEHB 3HSGA 4LF5J 3QZ7A 3I55S 5K14A 3ITHA 1T3NA 2KG1A 1R0CB 4RU2A 2Y0SD 2ZNZA 4ZCMA 3LUYA 3DRRB 2CPDA 1JXEA 1CULA 3KJVB 2XGPA 2IRXA 3VAKA 2WSFC 1Q5VA 2MB0B 5KT2A 4LF6J 3M2RB 2M8HA 2L9NA 2BYCA 4RUBA 2IM1A 2HWIA 1S9EB 5ETMA 1RT1B 1EAYC 2M8DB 3ETOA 5G0RB 3DXSX 3TUJC 3V81B 1YITS 1TTHB 3DN9A 2LKZA 2MGZB 1K47A 3GWCA 2F65A 4QWAA 3D9BA 3K7RA 1MU2A 2RS2A 1B64A 2PEHA 3BM7A 4BWMA 1JJHA 3V6JA 2FGOA 3MCSA 3EZUA 5KFDA 4V19J 3OTOF 4CLSA 4IRKA 2NQPA 3L9ZA 4PUOB 2KJWA 3A8IA 4GVLA 3EZOA 2M88A 2MKHA 2GIQA 2OTJS 4JI7F 3DHWC 3SQOP 1RTDB 4WKRA 2DIUA 3TX8A 1Q7LB 2EFOA 2JJ4D 1S7IA 2FJBB 4M5GA 2CJ9A 3LP1A 3U1MA 4NXNJ 4NLUA 1FXDA 2F7VA 2XY7A 1S6OA 4OZLA 1EIYB 3M4XA 3N5FA 4LBIA 3W65A 1S97A 2DY1A 1EKRA 4DCPB 1TL1A 2O67A 3UN2A 1Q4RA 1JWWA 4UTGA 2MJUA 1TKDA 3AFGA 3NY0A 1RU1A 1ZAVA 2VPYB 1LV5A 3MM6A 4DR3F 3HMJG 2LU2A 3NL0A 2YKMA 3JTNA 4PG4A 3TO8A 4CNZA 2JZ5A 4E2FB 4HI1A 2JVRA 3GG0A 4DMZA 3JSBA 4EO6A 3M8RA 1HPZB 2B56A 1D9FA 4NCAA 2FPHX 1BQNB 3DHXA 3CCSS 3DRSA 3FUYA 1BQMA 4QYZK 2QYGA 4OYXA 3HVTA 1YDLA 4LFCF 2OPSB 2YXLA 3BREA 4B02A 5DM6Q 3HKWA 2W4CA 1JLAB 3GFYA 1UTAA 4DU7A 2KT3A 3ISND 4ZVUB 1NJYA 5IM0B 2W2OP 1EETB 4LVOP 4ZN3A 1HWIA 3MEGA 4LSZB 4PXEA 1KNZA 3HSJA 3P3DA 2EBEA 3H42A 4N8NA 1XMOJ 4FPIA 3RRHA 2B3TB 2FJVA 1Q5YA 3THVA 3Q8QB 1JLFA 2HKEA 2ZD1A 4ZVHA 1BMQB 4KV8A 1WKJA 3MDFA 4LF7F 1UVNA 3ZZYA 1P9QC 2HFOA 3MURP 2GJIA 2Z2ZA 1N0UA 4DV7F 2B9YA 2BXJA 4W4MA 1TFWA 1L3KA 1HNVA 5HO4A 2Z2YB 1VOMA 1Y11A 1E6YB 4L72B 4IRDA 1FNMA 2XSJA 4K4WA 3C16A 5KFHA 3M8SA 3CC4S 3QFHA 2OD4A 2ZKTA 1FJ7A 1SJQA 1LWFA 3BKFA 1CQMA 2W24A 2JEFA 1BY9A 2ZKUA 4FXDA 4GVBA 4UY8T 1IBMJ 5AXLA 4P72A 4DPOA 3IGVA 4RW4B 4J91A 4HDHA 2FIUA 4ZVRB 1UL3A 3D0HE 1SV5B 3OR2A 3QRPA 5LXYA 1UWBB 2HQGA 2I2YA 3RG6A 2C3OA 1T8EA 1B99A 2R7XA 3HZGA 4ZVEA 3A8JA 3VGVA 2QG9B 3UN3A 2ALZA 2CJYB 3PX4A 2GA7A 4LQ9A 2AX1A 2O1PA 4DJBA 4ZJLA 4XAKA 2WW4A 2A6OA 1LKZA 2X1FA 3CCES 3MCOA 5THWA 4X4VA 3AOBA 3V6KA 5JVHQ 4USMA 3RW6A 1FRMA 3CJRA 2NSBA 2XYPB 4ZCLA 2RUSA 5ETKA 5D6GA 3DOLB 3VWSA 3G2XA 4EYIB 1WF2A 1ZM2A 1TMJA 4NLQA 4LR7A 3I5AA 2HNZA 1KTVA 5DDOC 5IT9U 2IVMA 3HVAA 4HACB 3FZBA 4CNYA 3FRZA 3AH6A 2VIHA 2OPPB 2O3DA 1LFPA 4MT1A 1IKWA 1NSAA 3AXMA 5I3UA 3QPIA 1I5OB 3C3LA 2OMLA 1RLDA 4KY3A 2WVEA 4WIQA 3OVSA 2NXNA 4CH7A 3IG1A 1A0OB 4OLPA 4ERDA 1X8DA 3IBFB 3PO4A 3HLUA 2XY6A 1S6UA 2XG8A 1Z2LA 4A46A 4R25A 4EBDA 2I0XA 4HI2A 4P2FA 3QGIA 4WE1A 1ZBTA 4C11A 2H5JB 2B0GA 1NXIA 4FZVA 2VL1A 2G0JA 2UU9F 2KRRA 2UXCF 2E5JA 3V6HA 2J5AA 4IQXA 5KFCA 1J2VA 2UP1A 2AZ3A 1PSDA 5EUHA 3U1LA 1FKPA 2UUAF 1MN7A 3CTRA 3CIZA 3QGHA 1OY6A 3RBZA 3UDVA 5KG2A 2I1RA 1CJKA 2BKPA 3MFIA 4BCAA 3T1YJ 3MFHA 4ECRA 4DL0C 1ZM3A 4KTQA 2MKSA 5C5JA 2EW9A 3ZZOA 4Q43A 1NEEA 4FKYA 5CCLA 4I4BA 3CD5A 1RGVA 2QA2A 2FHKA 1NHVA 2YQ0A 1TKTA 3CCMS 3DU5A 1HMVB 1S0VA 4YB5A 1VRTB 4DZ6A 1HL6A 3GSIA 2H51B 1Y5IB 3LA0A 3OTDA 4C9DA 4DCJB 1RA7A 2UUBF 5C42A 3TUPA 1TL3B 1RT2A 4EUVA 2V4RA 4ECZA 1SH3A 1NSPA 1RT4A 3FEYB 3HI9A 1T05B 1WDDA 4P9SA 2B7CB 4M5KA 3SCKE 3LANA 4NLVA 2OPQA 3W1YC 4W92B 3NCRA 2WBRA 4HH0A 3BYPA 2XCPA 3Q22A 3J80U 2H1YA 3U1NA 8RUCA 5J2QA 1JLGA 5KFYA 2VQFJ 3VV2B 3MM5B 3AODA 3ISNC 5LOQA 4OX9F 3EPIA 4Y28C 2CPYA 4M5MA 1T9TA 5AXMA 2HFSA 3FMWA 2A6MA 2E7WA 4LF8F 2JRSA 1WNEA 2DK2A 4DV6F 4NLSA 1EHWA 3ZZ0A 1SBRA 1C0UA 2MKIA 1NK4A 2W25A 3MECA 3IBCB 2BANA 2DB1A 2HWTA 2QLWA 3M30B 4HHHA 5FLXY 4QCLA 2J7UA 2QLFB 4DPWA 1XK8A 1HQUA 5IS2A 1WI6A 2HVIA 4IG3A 3ZTSA 4FYDA 1G6BA 3UI3A 3PIOQ 2XO6A 3CMAS 2J9CA 3KHHA 4QIWD 2RNEA 1S6QB 1R0AB 2XHCA 2NYIA 3M05A 2YKOA 2DXFA 4DX7A 4TLRA 5I42B 2QL5B 2DHSA 4KPCA 2K06A 4WP8A 4WPAA 3TOQA 4PRFA 2DO4A 3MUVP 1U8WA 1VBKA 4ZITA 3KLGB 2FJDB 3IS9B 6FDRA 2V2ZA 1LEOA 5D0GA 3T1HJ 1UA0A 4IFVA 1RABB 3TA0A 2KXHA 1Y00A 3E2EA 3GJTB 2F63A 4K4TA 2RVJA 3M8WA 2K2PA 2ADBA 4C8YA 1YVFA 5HL7Q 4WFZA 3EMTA 1DHMA 3PEHA 3FEZA 3GV7B 3Q23A 4V19X 3C14B 4K59A 1Y5LB 2QFIA 2OTLS 4WFNQ 1E6VB 1IUJA 3NGSA 5CD4A 1U0SA 3WDOA 2C2DA 4ZVFA 3WBZA 6FD1A 1CS4B 4DR2F 5DLGA 3TAQA 1W7WA 3FSYA 1N34F 3WC0A 2CJQA 4RJVA 3UVJA 1HYSA 4A47A 4TY8B 2V8HA 3CMQA 4YHHF 3CC7S 2QC3A 2IJRA 3HSDA 4FS2A 3HFZB 2VC0A 1FX4A 4U7CA 3DMJB 3DYAB 1KKHA 2J0SD 2PA8D 3OTCA 2FQQB 3SSSA 1D3WA 2FLOA 2V63A 2DNMA 3E01B 4DL5A 3FJ2A 3CEDA 3NXZA 2BQRA 2X1BA 1JLQB 2LCWA 2EK6A 5KFOA 5DQGA 2NREA 2HFVA 1H0HB 2BRKA 4CLTA 1D0EA 3NBPA 1YX2A 1Z4UA 2YY3A 2XNQA 3US5A 2HFUA 2V4JB 3DKDA 4X66F 3HHLD 8ATCB 3FNNA 3MMJA 2V5HG 3U7JA 1R6VA 1KR4A 4DU8A 4OYOA 4O23A 4Q44A 2UVRA 1ULRA 3O8WA 3M6UA 4WZQA 1WSRA 3A13A 3X3UA 3HO1A 1W2IA 2MEWA 3H2LA 2RDIA 3MMBA 2X1GA 4FYWB 1W25A 2B4UA 2A18A 1G7CB 3D4JA 2QZ8A 3DLLQ 2R7RA 3SI8A 4K4UA 1HNXJ 2CPXA 2KYZA 3MTJA 3C6UB 1WC3A 4C7QA 2FHMA 4F4XA 2ACYA 5A8RB 4ER8A 1Y5NB 1T0TV 3FGVA 1HR0J 2C2NA 1GX6A 2GO8A 5KFFA 5F8NA 4J9RA 1FE0A 1P8GA 4P2SA 1ZM4A 3I32A 1KVJA 1U1QA 3OJUA 1C1CB 2MXYA 4YQWA 3M6XA 4ZPAA 1YKWA 4EMDA 3T19A 1GXLA 3QT8A 4MIBA 4N41A 4NCGB 5BYSA 4B3TF 3CW2C 3DLGA 5KFUA 1X5TA 3SCLE 3HVWA 3RYLA 3NGRA 2M7SA 3G82A 3DDNA 3J7YI 2W2PP 3LGMA 3QZ8A 4ILMA 2R7OA 1FWPA 2VOOA 1ZPWX 3CCRS 1KN6A 4NZ7A 1VQ9S 4LFBJ 4O3NA 4DV5F 2CQ0A 3BDEA 4G1QB 5K8PA 2BE2B 1VQYA 4O4RA 2XY5A 3I5BA 1WKLA 2GHPA 4K5RA 4I0WA 5AJ3F 2GJFA 4RX6A 3B82A 3GQCA 5DLFA 2JSXA 2KB2A 4L6V3 1R27B 3M8YA 2J0QD 4IYQA 4H4MA 2IVYA 1J5OB 3OVBA 2HHTA 4ECSA 2YQ3A 2ZH4A 1RT6A 2F4VJ 4KAIA 1JX4A 3KUEA 4P2XA 3QQCD 2HFZA 4RR5A 3AT1B 3H5UA 3UNYA 3BBBA 5KFQA 1LW2A 2VZ9A 2ZOMA 5M2UA 4ED8A 2YWHA 1LQ9A 3CJ5A 3IRXB 1P6TA 2H4WB 1X0FA 2EWHA 5IV4A 3ET6B 2E1AA 1UKUA 4L76A 2AP6A 3N6MA 2ASLA 1NH8A 4J9LA 3OSNA 5CYQA 2JEIA 5A8KB 5E2QA 2CNNB 2MSSA 4ZHRB 3PW4A 1HI1A 3LPYA 1U2FA 3FFIB 2HSEB 1ZTWA 4JI5F 4ZVPB 1RA6A 3MPYA 2N7CA 2RRAA 3R7NB 1S5ZA 2YX1A 4QIFA 4DFMA 1SB6A 1XIQA 2DVIA 2PI4A 2U2FA 2WVFA 2BRLA 1NDKA 1EP4B 4UQTA 3MD3A 1UJ5A 4KGVB 3AXKA 3ZFVA 3CO0P 1DQ8A 4NLYA 5GAGU 4I6YA 3QSIA 4TKTA 1H2TZ 3OXGA 4YDDB 2OUGA 2B9WA 2MKCA 1SQGA 2IYIA 2HHWA 4ANEA 1NHKL 1RTZA 4C2MA 3DGPB 5LSOA 1SJ3P 1VS3A 5CA5A 1REVA 1Y9OA 1RT7A 2Y0BB 4Y65A 2DNLA 3M2UA 2KDOA 3UQSA 5HBMB 5K20B 1MROA 3AOAA 3PYGA 2HVDA 3W2VB 2E1PA 1SUQB 1NB7A 1PKUA 4LRFA 4PWUA 3HDSA 3OL8A 1N56A 3G6ES 3KLEB 2WBMA 4C8KA 2YH1A 1HNIB 1T03A 2B4OA 3CJQA 3NRBA 2YWEA 1ZM9A 1FRXA 4RW8B 4C3KA 4PYDA 3GJQB 5H9FJ 4O3QA 4HEA9 4X62F 1S49A 2V6AA 1RUSA 4YDXA 2W9AA 2RF2A 4X4SA 1T94A 1YBTA 3K17A 3POTA 2XI3A 2XMJA 4OV6A 1WSVA 5KFSA 4UUWA 1JXVA 3JQMA 3RRKA 3P4UB 2XS5A 3THTA 4KRWA 1U1LA 2IMWP 4I64A 1WDTA 1WC6A 1UEKA 4I69A 3VGUA 1RB0A 3MMAB 3MZIA 3D67A 2GC8A 2P6TA 1UVLA 2R7VA 4DCOB 2ZDPA 2M70A 4K7QA 2HMIB 3OHAA 1JLCA 3PR4A 3DM2A 1NB2A 3H5SA 3PO5A 3QYYA 2K8GA 3IP0A 3SQGB 1OMSA 3CJKB 2XLIA 5J2MB 2FYXA 2HNYA 1VDHA 2XMAA 4UOFA 4U7UK 1N33F 3UPFA 1R0BG 3BSAA 2DEIA 2HRYA 1MW7A 4UOHA 4OJHA 3W3SA 2IVFB 1YZ6A 3KK3B 2C28A 2HGNA 2I9SA 1X4AA 4DSLA 3ZZUA 3KKFA 2FD2A 4D3GA 2O01C 1P27B 3T1AA 3DI6B 2RHQB 1RBLA 2EXUA 5H1SV 2RH3A 1C0TA 1WOSA 4DR6J 3M32B 1VQ8S 1IKYB 3BV8A 1RKJA 1TELA 2QA4G 2NXUA 5FDLB 4OYPA 3PHEA 5EWFA 3EJMA 4DSKA 2XCAA 2QYCA 3R27A 4NA1A 5GAEI 4HYKA 3H20A 3P5TL 1MMLA 4DFJA 2UZAA 4JOUA 1IKXA 4C8NA 4USVA 4K4YA 1CG2A 4DSEA 3K5PA 1EJ7L 3HXMA 5CCMA 4WIIA 4Y2CA 2K3KA 3ZNJ1 1M5OC 1PJ5A 2HHPA 2U1AA 2MKYA 2G13A 1VQ5S 3NNAA 1DTTA 1OPIA 4NLRA 1HD1A 5KG1A 3FDSA 4FPRA 4WK1A 3MM8A 1TL4A 1Q81T 4ENOA 3ISZA 1VRQC 1RAIB 1BQXA 1S0NA 1S1XA 2IIHA 4WK3A 2WVCA 2DTJA 1YJTA 1CC8A 3ZZTA 3BN4A 2DGTA 2Z57B 3W63A 1NHUA 4UW2A 2UUBJ 4LRDA 3V81A 4PQAA 4HHUA 1B4SA 2VOPA 1DLOA 4D3HA 1B7YB 3CD0A 2FZGB 3BGUA 2VBZA 5HROA 1QSSA 2VB6A 2ZH5A 4B3OB 1F6TA 1TK0A 1FFWB 2OI2A 3KOAA 2WW8A 3IWXA 3L7UA 2PMWA 1PO6A 1ACMB 2QLBB 5F3ZA 3CWJA 3M8ZA 3KLHA 4HT7A 1S9GA 4FXVA 2Z58B 2VPXB 1GMWA 3MEDA 3MPVA 2KYXA 3MPUB 3QGPA 4J9UE 2AF6A 2JVOA 1JJ2R 1N36F 1VQ7S 2I5JA 2XHWA 4M94A 2E5LF 2CWXA 1HBOA 4QBUA 2NLWA 3Q8RB 4DL4A 5H9FK 3K8VA 3E3XA 3R5BA 3VGTA 4DBQA 2HFNA 3D66A 3J7YU 3R5CA 3I4PA 3HHLB 3P45B 4Y2MA 4KGMA 1D8ZA 2FUG9 1HQEB 3HK2A 1RTJA 1QAJA 1M5VC 2DGSA 5KAKA 1Q79A 2IA0A 3D3CJ 3LF0A 4G3IA 2IAJB 4CCHA 3SBMA 3PX0A 3U27A 2ZEJA 4F02A 4KHPF 2W9CB 3L3CA 4UOGA 3N4WA 1GMUA 5A2QY 2M5YA 4HT5A 1RWXB 2LECA 2N4CA 5C24A 4NLPA 1QVGR 4LRCA 1MMDA 2CJBA 4JI8J 3I0RA 5KFZA 1OO0B 5IWAJ 5HVGA 1T11A 4N47A 1TQLA 2JX2A 1X4EA 2HHVA 5ETVA 2GHVC 3D54A 4F4WA 5L9XA 2M3DA 5D4OA 2YKQA 3OR1B 2VKZG 4X4RA 3UR3C 4BHQA 4CLZA 1RT3B 4K50A 1ZTTA 1WG4A 1Q8IA 3D7SB 2QL9B 1FHTA 2XGQA 2CQPA 4KSEB 2PC6A 4OI4A 2VASA 4J7CA 2RMLA 3PRBA 3CD6S 3UDLA 3PTWA 3JXOA 3CD7A 4F67A 4IQMA 2ZDOA 2B5JB 1IKVA 4ZJOA 4QPTA 4N8OA 3KJNB 4BDPA 4I7FB 4NRUA 3M9OB 1S1VA 5CAAA 2J7WA 1KONA 4K4VA 3OD2A 3TJ9A 4XPEA 3HJVA 1U49A 5F8HA 4URSA 2RSQA 3DXBA 2H54B 2VPWB 4IFYA 2CPEA 2M52A 2HHXA 2FVPA 3M8QB 2QT7A 1VK8A 4PXDA 5LMUF 2KRBA 5AT1B 4FN5A 2Y8YA 1T95A 2DGUA 1SL2A 2HG4A 4MFBB 3LPEA 2KVIA 4KFBB 3D1QA 2KU7A 4UZBA 3M9NB 5DDRC 1R3NA 1S1UA 2DGXA 4LF5F 4GMKA 3IWLA 4RU9A 2CQ3A 5IC4B 4Q8FA 1U4BA 1XMQF 4LSLB 1ZZFA 2RB7A 4ECQA 1U1NA 3J81U 5CQGA 1HWLA 5SZTA 1IJEB 3H2UB 1MLAA 2NPFA 2AYEA 4K2XA 5GAHU 4LF6F 3NMRA 1G2EA 1HBUB 4RW9B 2LMIA 2KO1A 2R42A 4OYBA 4MK9A 2EPIA 3LWLA 1RHQB 5KT4A 3RU0A 3UCUP 1HI8A 5IV3A 4UZCA 2IY5B 2W8KA 2QO3A 4KO0B 2MJNA 3V4IB 2VU5A 1TR0A 3DLEB 4NMLA 3LTOA 1N5QA 4FVMA 3J81j 2AYMA 2Y1LB 1DARA 4Q0BB 1QE1B 3HKZD 5KFWA 3QGGA 1RZMA 1AUDA 5D4PA 5C25A 1IXKA 2XYGB 2CVIA 2FVQA 2CQHA 2OIHA 4I67A 2X51A 1V5VA 2K3IA 4W98A 4AXIA 2B7BB 1HHTP 3DDKA 3WIUA 1U45A 1VK3A 1GEHA 4FP9A 1KBRA 1K8AT 2YWKA 2GMLA 1FNXH 2EKNA 4R5PA 4NXNF 2D3OR 4DUTA 4TNOA 1FDAA 5F8LA 3UWTA 1XBWA 4ZCKA 4F26A 1U0HB 1Y4ZB 3C19A 5I3QA 3O3LA 1R89A 3Q2TC 1TKXA 2MZJA 2DH7A 1WACA 1R31A 4NA2A 3NGTA 2SXLA 4IOBA 1U6ZA 1RP5A 2YKNB 4URGA 4AQYJ 1TV6B 2XMTA 4ICLA 4QW9A 5F8GA 2C3YA 4WZMA 4Q8EA 3GU0A 5L9NA 1NSQA 4C8OA 3O6QA 4CYUA 2B9EA 4ZP7A 2LVWA 1OS5A 4NLGA 2D9OA 2PMHA 2RIJA 3GR1A 5L1KA 4LREA 1JNRB 4ES2A 5EWEA 3CC2S 3RBDA 3KMSA 1FXLA 2NUHA 4ZPVR 4NL5A 1NPRA 2P8IA 2B4VA 4OI3A 2E7XA 3IAM9 2DCLA 2RQ4A 4C8ZA 1KOHA 1VYAA 2GHWA 5GAEU 1OIAA 2CVEA 1FDBA 2MKJA 3C46A 1RCOB 4C8LA 3OL6A 4CIOA 2YNIA 3ZTPA 3DNCA 4G1IA 2R7WA 4ED5A 2EFNA 5KFIA 1PYTA 4QYRA 4GKKF 3K0JA 3NNCA 3BGRB 1XMOF 1S77D 3S7RA 3SIPB 4Y34A 4JI5J 3BH6B 4PQUA 2AV5A 3T9ZA 1VQOS 2DCUB 2E44A 5T14A 5LT5A 5E3QA 1UVMA 4JYAJ 3BR9A 2ZHAA 2HEKA 5DQHA 1FKOA 2LYVA 2W7OA 1YRUA 5KFAA 2V0NA 1WG1A 4OZ2A 4RW7B 1EQMA 3FC9A 2YNFB 2MQOA 4A8SA 5E33A 2FJWA 4DL3A 3H90A 2Q43A 2O66A 1MWQA 3EYZA 4N7TA 3J7A1 3CF5Q 2VG6A 4BLGA 3T41A 2UUTA 4HTIA 1SKSA 3QAUA 5A8WB 1F5BA 1IBMF 3K5OA 2W2QP 3BO4A 2VFUA 4RKUC 1DURA 5KFVA 3VQSA 3R6GB 3G6XA 2ZNYA 3CPWR 2R3VA 3WQPA 1CJTB 3OHBA 4USUA 1OPZA 1ZAXA 4ES3A 4RNOA 1YBUA 2V9KA 1XJWB 1YGYA 3UCZP 1TVRB 1WWHA 1FXRA 3Q86A 1GTEA 3G9CA 2ZH7A 4CH1A 2GX8A 1XERA 2HNDA 3ILIA 1N5TA 4X62J 1VQ4S 5J1EA 1HI0P 3GV8B 1LWCA 2BMBA 4ECVA 2BABA 2HHHJ 1IVZA 5RUBA 4EZ6A 2J9EA 3R1HA 2VA2A 1UAWA 2GMJA 2CWKA 2V50A 3N01A 5GADI 1OQ6A 4OYZA 3KJQB 2HK2A 1TL7B 1YJNS 1R6YA 2JFKA 1OJ4A 4DR4J 2FVRA 3OFGA 3PRDA 4LFAJ 4LSNB 4OYMA 4KKOB 1P1LA 5A6PA 5HQMA 2WOMA 2V8PA 3GILA 5DDQC 4LIWA 1QSLA 4PWDB 4K4XA 3SYZA 2G4BA 2G0CA 2GVDA 2WK4A 4I2PB 3LAKA 4OX8A 5HN0A 4M5IA 2B8QA 1LW0A 3LP0B 4ZLPA 2OSQA 3MEEB 3WX4A 2PO4A 1GNKA 4K5SA 3IO1A 4NLDA 3TYTA 2BQ3A 3P49B 2Q1LA 2LU1A 1WELA 2G2YA 4B9MA 1RHUB 2KFNA 1N33J 1M5KC 2EC2A 5J2PB 4X65J 2RD5C 2YNHB 3GP9A 2HVEA 3HD2A 3GCWP 2GW8A 4ATNA 1NNDA 2AJFE 3RR8A 1NMEB 1AZSB 1HWUA 1DTQA 3PACA 4B9TA 3GJSB 2ATLA 4ED1A 4A8XA 2YQ1A 3W7BA 5ETTA 4I2QB 2KH9A 3PRVA 4JV2A 2GQ2A 4IDKA 3QMQA 1N88A 2W9BA 3IRWP 5D3GB 2CG8A 1ZA2B 1F3FA 3NCPA 1GK8A 2GS8A 1VI7A 5J2NB 2MQQA 3A3NB 1J27A 3EZ5A 2RQMA 3I0SA 1ROFA 1FNOA 2DGQA 4PKDB 4WXOA 5IT9Y 2R2UA 1IBKJ 5K14B 3ITHB 4OI0A 4LR8A 3TQ1A 2DIVA 1ICEB 3Q83A 2D69A 3EICA 1M90T 3RBXA 1VQSA 1H7XA 1CULB 2IA6A 2VV5A 4ILLA 1QDUB 3K59A 2CAJA 1FRLA 4A8KA 3PJWA 4DLGA 3T5JA 3TAMA 3KG1A 3DOKA 5KT6A 5D15A 4B9SA 1SJRA 3DDIA 2UVUA 4I1TA 4RBUA 3L95X 2VQFF 3T6JA 4UY85 2HQIA 4NLTA 2RRNA 5T7LA 1KHWA 1IBLJ 2WTFA 4OMFG 4KYZA 1I3OB 1B3TA 1MU2B 2J8AA 7AT1B 3TR5A 1YJRA 1WTBA 2XQCA 2MQLA 2K7KA 3EVWA 4B3SJ 2CNOB 5KFJA 2PFFB 3FEXB 5DJBA 3DRPA 1O0PA 4YB6A 1SPBP 5CD4H 5HMXA 3JQKA 1K1SA 1FX2A 3A8EA 2WSCC 5B09A 3LP1B 1SKRA 1N36J 3VZHA 3QWUA 1TL1B 2OPRA 2XNRA 3KFWX 2X1AA 4U6PA 2VODA 2R8HA 1NJWA 5KG3A 1WOPA 1VRUA 3NLCA 2J9DA
chains in the Genus database with same CATH topology
2IAJA 2J0XA 4B08A 3MM6B 4O23A 4FBUA 1NK6A 1LK5A 2W9CA 4JI3F 2VFVA 1VQKS 1GX5A 4Q44A 1IBKF 1L3UA 1ULRA 3O8WA 3M6UA 4JI0F 3OLBA 2UVRA 4WZQA 5L1JA 1S10A 2GGPA 3MPWA 2YKMB 3CCLS 1CQNA 3KK1A 2CKWA 3LALA 5L38A 5A0YB 5F3TA 2IMOA 3X3UA 5G4DA 4NZ0A 1G3OA 3AQOA 1UJ4A 2J9DE 2OP5A 4J9KA 2LEBA 1C2PA 3OL9A 4KHMA 3DRRA 3HO1A 1W2IA 3TARA 3GYXB 1N5SA 3H2LA 3J80Y 3RR7A 4A8OA 2RDIA 2AD9A 2XWYA 3H2VE 3MMBA 3PNIA 5J1NA 2X1GA 3KJVA 1M5PC 3V4MA 3RRGA 1W25A 2B4UA 2A18A 1G7CB 1QAXA 5DQIA 1FCAA 1LWEA 2IRUA 2QZ8A 4A8MP 3TI0A 5CZVA 3DLLQ 1U1RA 3TRGA 2R7RA 1RT5B 3DRSB 3SI8A 2R9LA 1M5HA 5JXSA 5F8MA 4X4PA 1U1OA 3M2RA 4FF4A 5E3RA 4K4UA 3CCQS 2HVZA 2DRAA 4HVZA 1BQMB 2CPXA 2ZH9A 2KYZA 2AYBA 3RW7A 1QAIA 3HHEA 3HVTB 3MTJA 4RNHA 4PCQA 3KHLA 3S1TA 3C6UB 5BYRA 3BZQA 1WEXA 2R2TA 2F9JA 1S9EA 2IBOA 1WD6A 1RT1A 4C7QA 2FHMA 4F4XA 3AB2B 2WONB 4USJC 3ZZPA 5DM7Q 2ACYA 5A8RB 2HWHA 4LJMA 1Y5NB 1FRIA 4RUCA 2UUWA 3CXCR 3VAIA 2XWXA 4ZMMA 2CQCA 3GFZA 3FGVA 3GG1A 2VFRA 5G0RA 2J0WA 1SJ4P 1NK9A 2GO9A 2JDJA 1RT3A 1UVJA 2FLNA 3KHGA 2Y1JA 4C4WA 1GX6A 4DS5A 1IBLF 2EBGA 1VQLS 2XMMA 2GO8A 4M63A 5KFFA 2MGZA 1J5EF 1KFSA 3IR6B 3C6TA 4J9RA 5F8NA 1FE0A 1P8GA 4P2SA 1ZM4A 3OV7A 7FD1A 3I32A 1SL1A 1X9WA 1KVJA 3H8YA 1GTHA 2G9OA 5ADZA 3OJUA 1U1QA 1C1CB 5DG8A 2MXYA 4YQWA 3M6XA 1R8PA 2VG7A 3MEGB 4ZPAA 4IO9Q 1GH8A 3GIIA 3T19A 1GXLA 1VHFA 1JLEA 2IJNA 4UOCA 2JFDA 3DLKA 4MIBA 3UW1A 1KHVA 4N41A 4NCGB 5BYSA 4B3TF 2PMZD 1F60B 2R8GA 4B3SF 3OL7A 4DN0A 4QIVA 3VCDA 1YRXA 5IQ6A 2ZJPQ 3DLGA 5KFUA 2RQKA 1X5TA 3DCAA 3SCLE 3HVWA 1HBNB 2C2EA 5C25B 3RYLA 2B5JA 5EX3A 1JLFB 1OSDA 2GQQA 2M7SA 2R7TA 2ZD1B 3K5LA 4X4UA 3D5MA 4AL5A 3I4HX 3DDNA 3FSXA 3J7YI 2LQ9A 4PUOA 3LGMA 1UFLA 3QZ8A 3CB4A 3G86A 3SMZA 4ILMA 2OD6A 2R7OA 1VBXA 3O44A 5DG7A 3ENVA 3I9V9 4I7FA 2PE8A 4E8UA 4KV8B 2VOOA 4MK7A 3BJYA 1HA1A 1RTDA 1ZPWX 2VH7A 4PG5A 1TK5A 2BJDA 3CCRS 4P7VA 1KN6A 4NZ7A 1FEHA 1VQ9S 4URQU 4NWBA 2DNRA 3T5HA 4HKQA 4ZPBA 2HHSA 5LL6d 4J5OA 4O3NA 2AJ1A 1U48A 3F44A 4R5PB 4DV5F 2ZVSA 2CQ0A 3BDEA 4G1QB 5K8PA 2VONA 2AQ4A 1XEZA 1UETA 4ED7A 2BE2B 3AA9A 1VQYA 4MIWA 2XS7A 4O4RA 4KPYA 4O44B 2XY5A 3I5BA 2XSJB 2GHPA 1VQMS 2MQMA 4K5RA 2J6UA 1UVIA 3M8QA 3CULA 1Z2ZA 4I0WA 1TKXB 4PR6A 5AJ3F 5DO2A 2MMYA 4PXCA 4RX6A 3J7Z5 3B82A 3GQCA 1LWFB 1CEZA 2VG5B 2OH2A 5DLFA 3QLHB 3MOZA 2LQJA 1PC4A 4U67Q 2JSXA 2KB2A 4DX8H 4L6V3 1R27B 3SCJE 4MFBA 1HHSA 2D7SA 2KXNB 2J0QD 1UMJA 4IYQA 4CO3A 2DGWA 4H4MA 2IVYA 1U26A 1GAOA 4C97A 5HQ8A 1J5OB 3OVBA 2YX4A 4FNIA 4KFBA 4WFYA 4DR1F 4ICLB 4YMEA 4DOZA 4TXSA 2HHTA 2DT9A 2XEXA 4ECSA 2YQ3A 3FMBA 3AA8A 4OIXA 4OZJA 2ZH4A 5HLFA 2ZZNA 5L8RC 3Q24A 1H3DA 4LF4F 1RT6A 3GFXA 4KT0C 4KAIA 1FK9B 3PDNA 4YR3A 3O2IA 1JX4A 3OR2B 3PKMA 4YOEA 4EWTA 2HFZA 2YVSA 4NRTA 2EG1A 4RWWA 4LSLA 3H5UA 4P7TA 1UEUA 4G1PA 5B0DA 5KFQA 2XLKA 1LW2A 1O5JA 2E1RA 2MHEA 2Z2MA 4NPOA 4ZOSA 4NLWA 2ZH2A 2VZ9A 1FF2A 2HAIA 3ENWA 2ILZA 2ZOMA 4EU0A 4KJIA 4I6WA 5M2UA 4ED8A 2YWHA 2BR0A 1HPZA 1LQ9A 3CJ5A 3TVKA 4H4KA 3IRXB 4ZVGA 4TU9A 3BQ2A 1P6TA 2D3UA 1BQNA 3EUNA 1KD1T 4YFUA 5KT3A 1X0FA 3LP2A 1HBUA 1HNXF 4RW9A 2EWHA 4AFFA 3KK1B 2E1AA 2QE5A 3BSOA 1R43A 1UKUA 4C3MA 2PSZA 2ROEA 3BSCA 4JUZA 2AP6A 2OMOA 3A1YG 3N6MA 5GAGI 4OHWA 2ASLA 1VLYA 1NH8A 5KOWA 2DPJA 4OQJA 4J9LA 2OPSA 3OSNA 3IXQA 2IM2A 5CYQA 2JEIA 5A8KB 5E2QA 4CT8A 1L5UA 2IJFA 2CQ1A 5DGAA 4QR0A 1JLAA 1RWUA 2MSSA 4OI1A 4ZHRB 4QR1A 3PW4A 1QLNA 2RS8A 3TA1A 4F4KA 1HI1A 3LPYA 2RUGA 1U2FA 5KFLA 4F8RA 3FFIB 4KO0A 1HR0F 1ZTWA 1DFDA 4ED3A 4JI5F 1RA6A 3MPYA 3PX6A 2N7CA 4ZP9A 3V4IA 1R8CA 2RRAA 3BGLA 3DLEA 4R0EA 4M5DB 2AGPA 2CPZA 2FDNA 2XMKA 4KIAA 3W2WA 4J9SA 5IM0A 4N76A 2CJAA 1EETA 2YNIB 3LGNA 2R7SA 4Q0BA 1R8HA 2YX1A 4QIFA 4YUDA 2E9TA 4DFMA 1SB6A 3UCGA 1SJFA 2B43A 3UDCA 4RNNA 4DL7A 2VKRA 2C42A 2HNZB 1FEEA 3SV3A 3FCHA 3BDPA 2DVIA 3QIDA 4AL7A 5D4NA 5KFRA 2RQCA 2PI4A 4X2BA 2U2FA 5D77A 4PQUB 1FA0A 2DNYA 2K7JA 4EZ9A 2BRLA 1EP4B 1AFJA 1KQGB 3DRXA 2ASDA 2GCFA 4NLXA 4UQTA 2QIFA 3MD3A 1TP7A 1A7GE 1UJ5A 1IKWB 3ZFVA 4WXWA 1DQ8A 4NLYA 5GAGU 2YNGB 4I6YA 4ZKAA 4FNHA 5I3UB 4TKTA 3RAQA 1NKBA 1H2TZ 3OXGA 4YDDB 1TFYA 4BWJA 3U02A 5GADU 2B9WA 2Y1IA 1FKOB 2DBBA 5HP1A 2VPZB 2MKCA 3KLIA 5F9NA 2V4QA 2IYIA 4QJVA 3IG1B 2HHWA 2CQDA 4DFKA 4TU7A 3GIJA 2PIIA 4LFBF 2DNOA 1RJJA 2EG2A 1IQZA 4C2MA 1Q86T 5LSOA 5E3PA 1SJ3P 4ZPCA 3PZPA 1VS3A 4ZDNA 1YG0A 2B6AA 1KRPA 5CA5A 4ZPTR 5EHHA 3CCJS 4QPXA 2MHNA 1REVA 3RZAA 1Y9OA 1RT7A 2A1BA 4Y65A 2DNLA 4F3QA 3M2UA 3SCIE 2ZE2A 2KDOA 1FVSA 3UQSA 5HBMB 4X4TA 2DR9A 2KZMA 3CVKA 1MROA 1E6YA 3M1VA 4IRCA 3EXYA 3Q0AA 1KQKA 5BJRA 4RNMA 3G8SA 3G6VA 4FF3A 3UD3P 4J9OA 3O1LA 4WF9Q 2JH3A 4DV4F 5LXRA 3AB4B 4C8MA 5CYMA 3W2VB 2HS0A 4WE1B 2BZ2A 2NUUG 1U2RA 2VG6B 3BQ0A 1SUQB 1Q8LA 2QSFA 5E3AA 4C11B 1NB7A 4WKYA 3R1LA 1X5PA 4HTJA 1FDDA 2F1FA 4XK8C 3KTQA 3CSKA 4TN2A 1JLBB 2YWGA 1BGXT 4PWUA 2XI2A 4IR9A 2YKNA 3HDSA 2W4PA 3OL8A 1N56A 1TV6A 1FERA 3NAHA 3G6ES 3KLEB 2RJZA 2VFTA 2WBMA 2YTCA 2R2SA 4C8KA 2YH1A 3V5RA 1V3SA 1HNIB 4RW4A 3T1YF 1T03A 2B4OA 4EYHB 1DZ5A 3NRBA 2YWEA 4A8FA 1Q78A 2VD3A 3IAS9 2F4VF 1ZM9A 2CPHA 2L3MA 1FRXA 1SV5A 2E29A 4RW8B 3G6YA 2VQEF 1VQPS 4U9RA 4Y2AA 4C3KA 1WEZA 3IBWA 1DQAA 3H5YA 2F8MA 2A3JA 3IN5A 1FTRA 5H9FJ 4O3QA 4HEA9 3AJ2A 4ECYA 1PC5A 2QRRA 1FKPB 3PW7A 4X62F 1UWBA 2HS4A 4H4OA 1N5YB 2MQPA 2DRBA 1S49A 2E66A 1RTHA 5M2RA 4J9QA 2AJQA 5B7WA 4USHA 4YDXA 2W9AA 5F0WA 2WHOA 1TK8A 5KTQA 1S6PA 1U1MA 3OFHA 3MR5A 2IBKA 4C98A 4EEYA 4DSJA 2DGOA 3NKYA 2RF2A 3I96A 1O8BA 3CCZA 4RUAA 2L41A 4X4SA 3JAMY 2Q66A 3PW5A 4EGLA 4MAKA 5J1PA 1CC7A 4ZP8A 4AXJA 1T94A 2FC9A 1NZAA 1KS2A 2GJ2A 2HNDB 4ZPDA 5KFBA 1S0MA 3H59A 1V6HA 2FHJA 3POTA 2XI3A 1IN0A 2E5IA 2ADCA 4DSIA 2XMJA 3HHKA 1X5OA 3R5AA 4ALZA 1LXJA 4RUHA 2V8VA 3TAPA 3QJLA 5J1EB 1TKTB 3CUNA 2AWZA 1NK5A 4KR0B 5KFSA 4BBYA 3N79A 3GR0A 4UUWA 4CO5A 5JJBA 2XULA 2F8EX 1LWCB 1NJIT 3RRKA 3K5NA 4OX7A 2XS5A 3VR1A 2BQUA 2FY1A 3K5MA 1YI2S 1UA1A 3THTA 2JC1A 1HW9A 2RKIB 4PPDA 2FJEB 4OI2A 1RQ0A 1VC5A 4KRWA 5KFTA 2DJWA 1U1LA 3LQVA 2IMWP 1XNQF 3BB5A 4I64A 4YB7A 2CFXA 3FQKA 3TNVA 4DEZA 4ECWA 4NCBA 2N4DA 4MTPA 4C0BA 2EK1A 4NLOA 1IR0A 3NCQA 4I69A 4HLBA 5C42B 3D1OA 2C2RA 5F8IA 2JLGA 1RT2B 1TKZA 2LA4A 4TU8A 2E9RX 2KHCA 3VTIA 2WB4A 3UD4P 1ZOTA 3DOLA 3MMAB 1KOOA 5B0BA 4Y00A 3MZIA 2GC8A 1RT4B 2P6TA 3CJ4A 1UVLA 2R7VA 4CH0S 3F56A 1RI7A 2CRLA 2ZDPA 2M70A 5FD1A 2HMIB 3OHAA 4OJ1A 2CG4A 2DO0A 4ZS6A 1JLCA 3BGRA 4YB1P 3PR4A 2CZVC 4XPCA 3DM2A 3BS9A 2M0GB 4ECTA 2CQGA 3H5SA 3PO5A 4TYBA 2OPQB 5L1IA 3QYYA 2K8GA 4Y2KA 5DDPC 3SQGB 3BGFA 1OQ3A 3CJKB 4EBEA 3OUYB 5DG9A 3TUIC 2WOMB 3T3FA 2XLIA 2OPPA 2HLTA 5J2MB 3VAJA 1ELOA 2HNYA 1RAJA 2KN4A 3RB0A 4N5SA 5J2QB 2MDAA 4U7UK 4QWBA 2RU9A 4ED2A 4F3MA 1N33F 1B0PA 3KNGA 1JLGB 3UPFA 3EX7B 1N32F 2FLPA 1LW0B 1OWXA 2WSEC 1S76D 4C0OC 3BSAA 3JB9k 3T6BA 2HRYA 1MW7A 4OJHA 1LXNA 1K0VA 3W3SA 2M9KA 4RW7A 3NAIA 2IVFB 1VQ6S 4BC9A 3KK3B 2YNFA 4XO0A 4K4ZA 2BBEA 3MGJA 2C28A 2I8EA 2Z8QA 2NZ4A 2HGNA 2FB0A 4ELTA 1S1TB 2I9SA 5F9LA 1X4AA 3V6DA 3PM9A 2YX7A 3SV4A 4DSLA 5JUMA 3ZZUA 3KKFA 2FD2A 1N0VC 2OAUA 2PDAA 5DRKA 1L3VA 3PFOA 4D3GA 2BOPA 5KFEA 2O01C 1P27B 3L09A 3T1AA 2KZZA 1I1GA 4DR5F 2MY8A 3DI6B 3K8WA 3BO3A 4ZP6A 3M9MB 3EGZA 1U09A 5A8WA 3FSIA 4RNFA 5H1SV 1BWEA 2RH3A 3MECB 1C0TA 5KG6A 2BANB 3HFKA 2JLFA 1VGYA 3CIMA 3M32B 1VQ8S 1IKYB 1NU4A 2HVHA 2KHDA 3AJ1A 1RKJA 2QA4G 2NXUA 2EFQA 4A48A 5FDLB 4JI6F 4TQSA 1HQUB 1SXLA 3PHEA 4Q2LA 1KQSR 5K5MA 2BDPA 5EWFA 4DSKA 3EGWB 3SFGA 1M0SA 3R3TA 3OXLA 4IG3B 4CT9A 2XCAA 3OXFA 3KLVA 3MM7A 2D9PA 1DTQB 3NP5A 3HZEA 3SDEA 2IC3B 2QYCA 5B0FA 1HFEL 4JV5F 1WF1A 1RTIA 4KBIA 3R27A 1HBMB 3F73A 4NA1A 1NK0A 4AE5A 3O5TB 1TVRA 5GAEI 4HYKA 1D9DA 3H20A 3P5TL 4OZ0A 2XC9A 1NJZA 2N3LA 1MMLA 4IDKB 1RDRA 3JYTB 1RISA 2UZAA 4JOUA 4DFJA 2POKA 4Q5VA 1IKXA 2R8KA 4RBVA 4ETZA 3UFCX 2W9BB 1N6QB 4C8NA 2R4FA 4K4YA 1CG2A 3BF4A 4OV1A 2DNGA 4QIGA 4DSEA 3T1HF 4MH8A 5B0CA 3K5PA 4QZVB 2BM0A 3MI7X 1QVFR 2DHGA 4CO1A 3HXMA 4MK8A 1HMVA 5CCMA 2W8LA 1URNA 4DQRA 3EPGA 4X64F 4WIIA 4RZRA 1I6JA 4PG7A 1VRTA