4D3GA

Structure of psta
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
78
Chain Sequence
HMKMIIAIVQDQDSQELADQLVKNNFRATKLATTNTTFLCGVNDDRVDEILSVINQTCGNRVGGATVFVMPVDAFHQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PSTA
publication title Complex Structure and Biochemical Characterization of the Staphylococcus Aureus Cyclic Di-AMP Binding Protein Psta, the Founding Member of a New Signal Transduction Protein Family
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 17
structure length 78
sequence length 110
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4d3gA01
1NH7A 2E66A 5D4NA 2VD3A 1OSCA 1UMJA 4RLEA 3NCQA 1NH8A 4E98A 3MHYA 4CNZA 4CO3A 2Z0GA 3AH6A 4CO4A 1HWUA 1J2VA 3X3UA 4OZJA 3T9ZA 1V3SA 4OZNA 4CO1A 3BZQA 5D4OA 2J9DE 4CO2A 2J9DA 2ZOMA 3M05A 4WK3A 2XBPA 4USIA 2GW8A 2V5HG 4C3MA 2O66A 2JJ4D 1Q1KA 2DCLA 4AFFA 3L7PA 1QY7A 4USHA 1KR4A 2O67A 1XK8A 5DRKA 2XZWA 2XULA 2PIIA 4RWXA 3NCRA 2EG2A 4OZLA 4WK1A 4CNYA 1UL3A 1UKUA 2NS1B 2NUHA 4Y6IA 4RWWA 4CO0A 2GNKA 3HLUA 2GX8A 3TA1A 3N5BA 4ZK7M 2J9EA 1NAQA 1V6HA 4YB7A 1NZAA 3AA8A 5L9NA 4USJC 4CO5A 4D3HA 4NYPA 3O8WA 4RX6A 1O5JA 3DFEA 1P1LA 4C3LA 3NCPA 3LF0A 3OPKA 5DS7A 3TA2A 1O51A 3AHPA 1VFJA 2ZFHA 3CE8A 3O5TB 2EG1A 4YB6A 4IYQA 4Y65A 5D4PA 2J9CA 3TA0A 1PILA 3AA9A 5D4LA 1H3DA 1GNKA 4YB5A 2XG8A 2CZ4A 1UFLA 4R25A 1V9OA 2RD5C 3GSDA 4C3KA 4D3GA 4NYOA 1V3RA 2NUUG 1VHFA
chains in the Genus database with same CATH superfamily
1X4AA 4F3QA 1NH8A 3TUIC 4ALZA 4F2RA 2CJXB 3QT6A 1NNDA 2BE9B 4F4YA 3DNCA 3PEHA 1HWUA 4AXIA 2ALZA 2RKIA 2C3OA 3DOMA 4L76A 2V2VA 3MAQA 3QWUA 1R3NA 3I0RA 4RW9B 2PGCA 4X62J 1KN6A 1KR4A 3ET6A 2PEBA 3M32A 3MECB 1SL1A 2OD6A 4RR5A 3JB9k 1MMNA 4DSJA 2RS8A 4LRBA 3MF5A 2KG0A 2QX0A 1PSDA 3MTKA 1JX4A 2GX8A 3UDLA 3N5BA 3GU0A 4ZK7M 3UE2A 1CJUB 4YB7A 1FRIA 3J80U 4BCAA 5F0UA 2CQ4A 2UUBJ 2YNGA 1BQXA 1TKXB 3HT0A 3PYGA 4OHXA 3TJ9A 5DG9A 1VQ8S 3F44A 2ZWOA 1HI8A 2ZWPA 4TKTA 4ED5A 3BPSP 3UD5A 4A8FA 3V5RA 2BOPA 4DR4J 1VBYA 1UJ6A 3HULA 4KSEB 3PO5A 4B3MF 4ECUA 3MEEA 1HYSA 3TQEA 1ZS6A 1F5BA 1HWJA 2FZKB 3E51A 4OX9F 2HBZB 3DLKA 2NSBA 1RA7A 3W2VA 4DLEA 3DYAB 1JQGA 2QL9B 2MJUA 1NO8A 3ILJA 3RRKA 2QA1A 2MKIA 2DCLA 1H2VZ 2EFVA 2AKWB 1FJEB 2DNOA 4WKYA 2XO6A 1YLXA 2K2PA 2ABYA 1Y11A 4OZ5A 4EMDA 2Y1JA 5I42A 1NCLA 4X2BA 5LM7E 2VF3A 3SIPB 4ECXA 1K47A 5LSOA 3DKDA 2K7JA 1YKWA 3EJMA 4C6AA 2R2TA 3K59A 1K9MT 2H1YA 1R27B 1XR5A 3HHNB 2VC1A 3GJRB 5C25B 5KG5A 1S0OA 2CWXA 1IWGA 1RISA 4HEA9 4O4GA 5D4PA 2QL7B 2NQPA 3E01B 3DC2A 1ITPA 2HPUA 4C0OC 4KFBA 3EVMA 5ETNA 4WFZA 3T41A 5HLFB 2WVDA 1DQ8A 3CC4S 1SJ3P 2UUTA 3CCQS 2CYYA 3CJSA 1N4LA 1MG7A 1DHMA 5CH7B 5KFQA 4KE5A 3C6TA 5KFAA 1RT5A 3VZIA 3U7JA 5J2NA 4CO1A 2XY6A 2APOA 5DG8A 3R97A 2EK6A 5CQGA 4OHZA 4ED7A 2E7VA 4YY3F 2KYZA 2DVIA 4K0KJ 3HHLD 5HJYA 3NRBA 2OKQA 1NXIA 1FX4A 1R6VA 4PXEA 1V3ZA 1OJ4A 5HSPA 3RR8A 3CIZA 2YKMA 2VA3A 4DV5F 1P1LA 4F25A 3LGMA 4UQTA 3JS9A 3KLEB 2GGPA 2W9AA 2BKPA 2W4DA 3WDOA 3UFCX 3BJYA 4PR6A 3NS5A 5IWAF 3K17A 3K0JA 2KYXA 5GVQA 3MR6A 1KKHA 3OXLA 4ZVPB 2ZVSA 1WELA 4HHJA 1FE0A 4MK8A 2PT0A 2GAHC 2HNZB 3SCIE 2UXBF 5KG3A 4U6PA 1S97A 5GAEU 2NZCA 1RTJA 4GMKA 4A8XA 2CAJA 2VU5A 5LJ3Y 2VFUA 1JKHB 1YX2A 2RDIA 4JUZA 2ZBPA 3JXOA 2Z30B 2FJVA 1IQZA 1QY7A 2LU2A 3W9HA 1YVFA 2W2OP 2C3YA 3Q24A 3LP2A 1DLOB 3QATA 4AQYJ 4K4UA 2OMOA 1FEEA 5AE2A 3NGRA 1RCOB 4ZPVR 5B09A 1UPMB 5H9EK 3I87A 3OTCA 4UOHA 4M5IA 4NA2A 1HNIB 5E41A 3JSBA 1FNOA 4CTAB 3HK2A 3JTPA 4KIAA 3P5TL 4ZVEA 1GQEA 2FYXA 2YH1A 3IP0A 4HI2A 1VLYA 1YQHA 4ILLA 2C2MB 3T6JA 1AZSB 1HNWJ 1UFLA 2VQFF 3K5PA 4DFPA 2ILYA 1A7GE 1IN0A 1GX5A 3OR1A 4XPCA 1F9FA 4CQ1A 5G4DA 2ZBRA 4FF4A 4JI7J 5IFMA 2XLKA 4LREA 5JUMA 2RMLA 3HHEA 2DHHA 2BJEA 4UUWA 4IDKB 2KFNA 2ZBIA 1FX2A 4DR1F 3HHKA 3QIDA 2XGQA 2HAIA 2B7CB 4O23A 1YHQS 4I64A 1RWMB 3GMGA 3LAKA 1Q7YT 3M30B 2Z57B 1OY6A 4MTPA 4JYAJ 3FMWA 4OI0A 3MURP 3TRGA 3TARA 2KKHA 4PWWA 5HI7A 4DR7J 1HBOA 3GYNA 2XLJA 1EX8A 3TYTA 3CWJA 2B51A 3UW1A 5KAKA 4OHVA 3W3SA 2HFNA 1RYRA 1U2CA 3LPEA 4B17A 4WFXA 1NHVA 8RUCA 2WRMA 2QA2A 2QV6A 3UNGC 3N79A 3JSMB 3M2UA 1RHMB 5G0RA 1S9EA 5KFJA 3IRWP 3I96A 5M2PA 4NLVA 4LF7J 2RILA 1B3TA 2DTJA 2ZOFA 1N33J 3V6HA 4LRFA 4K4TA 3ZZPA 3MI7X 3UN5A 2XI3A 3WQPA 1SUQB 3P49B 3NY0A 2LKZA 1UVLA 2PIIA 3FKBA 1T94A 4IOAQ 3BBBA 4P2MA 1U09A 2V0NA 1NK5A 4KGXB 1S1WB 3TA1A 4Q8FA 3OLBA 4DPTA 4EZ6A 2AMCB 5B0EA 4RW7B 3OL7A 2B6AB 1QJHA 4Y00A 1RU1A 1T8EA 1KNZA 1IBKJ 3EGNA 5LJ5Y 2C42A 2CUYA 3EX7B 2AQ4A 2RUGA 3MD3A 2ZH7A 2C2DA 4N7TA 2GC8A 3A4TA 2CJYB 4ZHRA 3NS6A 4B3TJ 4Y2CA 2VOPA 2HBYB 4OLPA 2DR7A 2QT7A 2FHJD 2W9CA 4NE9C 4WFNQ 1XTZA 4R0JA 3D6MB 3J7YI 4RUBA 1XNQJ 3NMRA 1NDLA 1FERA 3AH6A 2HKEA 2J0QD 1GEHA 3POTB 4Q0BB 4RNOA 1SQEA 3QO9B 4C8OA 4OHWA 3I5AA 4RL1A 2K7KA 4DSFA 3KFWX 2FD2A 4M5JA 4WF9Q 2DB1A 2DNMA 2V68A 5L39A 5C24B 1KDNA 3HVAA 4DPXA 3BS9A 4QYRA 2V6AA 3OT9A 4KV8A 2EG2A 1G2EA 1TFYA 3KNAA 4ZVHA 1RABB 3B82A 1UKUA 1RUSA 3MM5B 4CZCA 2CPJA 5BR8F 3GIKA 5EHHA 2V2QA 1IBLJ 2FY1A 1I94F 3M8WA 4OJHA 1IQTA 3NGUA 2B4OA 4LFAJ 3BBFA 3RYLA 5IQQA 4C8ZA 2DRAA 2HG4A 1DFDA 2IMOA 1NPRA 1NKEA 2MTLA 2X1AA 2HFVA 4ZVTB 4DV1J 2J0XA 3MEDB 2NR0A 2DIUA 2OPSB 2XS5A 1RWPB 3W1YC 1SQGA 1RLCL 5LMNJ 3QBCA 3T3FA 2PA3A 2Y8WA 2ZJPQ 1VQ7S 2AZ1A 4AL5A 1RKIA 3TZZA 2E9RX 4J91A 3KDNA 2VHGA 1UVNA 4RPFA 4NLUA 5DQGA 4GO7X 5L9XA 3HKWA 3W63A 2AJ2A 2WVBA 5FJ4A 2BKOA 4JP8A 4MKBA 1U25A 4WIQA 1VRTB 5D3GB 4NXNJ 2M9KA 7FDRA 2Y3YA 1B0TA 1NPPA 3VQTA 3A3OB 1WG4A 3KJFB 1RT2A 1Y5IB 3G8QA 3U1NA 3CJ0A 4K7QA 5E0OA 4H4KA 1XMQJ 4B9NA 3R5GA 4BC9A 2ZD1A 3H5SA 1S1UA 3WHIA 1GMVA 5EGYA 3F41A 2LMIA 2J9CA 1S48A 4KHMA 5DDRC 3WX4A 3M8YA 4PCQA 3M8RA 3G6XA 2UU9F 5A6PA 2FHKA 2RU3A 1F5CA 2F4VF 2EBEA 4NLYA 3DRSB 1LXNA 2DGVA 9RUBA 3CMES 1T9UA 2I6WA 1KVJA 3FBFA 4IRDA 2BRLA 4X4RA 1SVDA 4USWA 3KLGA 3OR2A 3AD8C 2YX1A 5FLXU 1YZ6A 2DNZA 2E1MC 1QE1B 3PRDA 4TQRA 2XY5A 3CXCR 2VV5A 3BGLA 4EYIB 1HR0J 2XSFA 4BHQA 4F04B 4DCPB 5B0DA 2AW0A 3CCSS 1KFDA 1D1UA 2UVRA 1XN9A 3MM8A 3EDQB 2MQQA 4MFBB 4ZA1A 4EGLA 4PUOA 3ELHA 4ED4A 2CVIA 5HBMB 1B7FA 4GC6A 2XWYA 4KTQA 4ELVA 1UWBA 2GQCA 4ZPCA 5D0EA 2N7YA 4K4ZA 2NYHA 4IRKA 2MZQA 1N6QA 1LWEB 1LWXA 2CJBA 4F26A 4LSZB 2PEHA 4OYMA 3RR7A 5BYRA 4H4MA 3W2WB 4ES3A 4UY8T 5HP1B 3K5MA 4ZPTR 1XMOF 1KLMA 4WZMA 3TX8A 1IUJA 4OZ0A 1FE4A 1R0BG 2B8QA 2DNGA 4DPWA 3M6UA 2RRBA 2RB7A 4C4WA 4QCLA 3HVRA 3UWTA 3D1QA 4X64J 5DZ6A 6FD1A 2IM1A 4HACB 4LUBA 2XMMA 4WFBQ 4LR7A 5CZXA 3BKUA 3L7PA 3CSKA 2B9YA 3KJQB 1Y5NB 3CCUS 4QWEA 2E7XA 5HATA 3CCJS 1HNZF 3QGIA 3TUJC 3CCVS 1RWNB 4X4UA 3TAPA 3A1YG 4X65F 1Q81T 1HD1A 4WTYA 5K8PA 3ICLA 2RHQB 2ZZNA 2WB1D 3M9NB 1O5JA 5E3RA 2MZRA 4MYTA 3SCLE 1U02A 3QQCD 5IT4A 5ITHA 3R3TA 1CVJA 5F9NA 5HO4A 3KHHA 4URSA 1PKUA 4OI4A 3HMJG 1Q78A 2ZZTA 1JLAA 5D0RA 2NXCA 2QFJA 5CD4A 3M2VB 4A46A 3CCWA 2VD3A 1FDNA 4K4WA 5E7OB 4CO3A 2VQEJ 4KBIA 3IR6B 1FK9B 2V63A 5J1EA 3HDSA 3OXGA 1RT7A 4W4MA 2G1DA 2WCXA 4DL0C 1L3KA 3QZ7A 3NAHA 5AXMA 4DV0F 1RSCA 3KG0A 2BRKA 2GJFA 4A47A 4NWBA 1VQ5S 4WKRA 1YITS 2R7OA 1WF0A 2MQOA 2YWHA 3CCTA 4MKVA 3ENQA 2CQHA 3FK4A 3TVYA 2HVZA 1IM4A 5B08A 3M2RA 5IV4A 1TKDA 4QQBA 3CEDA 2HGNA 3CD0A 5E3PA 3QJPA 3RZAA 1VRUB 4NMLA 3IS9B 1I6JA 3T1HF 1DZ5A 1W2BR 1RT4B 4WYWA 4E0DA 4TN2A 3A12A 4JI5J 1KBRA 3GCXP 1FD8A 2DIVA 1SJRA 2DNQA 3TWZA 2HRUA 2WSCC 3PRBA 1XERA 2AF6A 2MXYA 2YTCA 2JRSA 1OPIA 1UPPA 3TW0A 1NK4A 4DL5A 1BQMA 4IOBA 4N8OA 4ZVQB 1OQ6A 4FKXA 3QLHB 4JI3J 4YP3A 2B9EA 2OEKA 4ED8A 2YNIB 1HBNB 4EWTA 3IAS9 3PTWA 3ZZTA 3FCHA 4HH0A 2Q6BA 2FJDB 5HQLA 2DNLA 3VWSA 1S4EA 1R0CB 4YHHF 4B3RJ 3PRVA 2EC2A 4LF5F 2EFGA 4PG7A 5AT1B 1OYEA 3HP6A 3VGTA 3LP0A 3G96A 2ZDOA 3DLBA 2JOQA 3I0RB 4PWUA 2IA0A 3FRZA 4ZLNA 3ET6B 2GIQA 1FFGB 2FTRA 1Q8KA 2D9PA 2E9TA 3CJTA 2DPJA 2DXEA 1Z2LA 2I0XA 2ZH1A 4NA3A 3CJKA 2ZM6J 3KLHA 1FJ7A 1ZPWX 1D0EA 4F0HA 1RAJA 1SV5A 3AOAA 1V5VA 2FIUA 2LA6A 3KWMA 3V6KA 1JLBA 1TMMA 4RBTA 4X4QA 3KLIB 4KAIA 2KT5A 3ZTOA 2YWFA 4HL9A 4NZ7A 3ZZ0A 2YWEA 2V4RA 2BM0A 4M1KA 3NGDA 3TZYA 4J9QA 1JLFA 2HYIB 4C11A 2FVQA 3MPVA 1HYSB 3MFIA 4FYVB 3K89A 2BXJA 3MD1A 4OYBA 1RTIB 2CQPA 3ZZOA 4CLFA 4LJMA 1E6VA 3OJSA 5A8RB 5L9NA 1YJTA 3CCES 3V2UC 3B54A 4M5HA 1VQ6S 4NA1A 1Y4ZB 2OJ3A 3FBEA 1WTFA 3IFEA 2PA8D 4QWAA 1WC0A 2FUG9 2C2RA 3T19A 3L09A 2WAQD 2Y8YA 2G0IA 2IVFB 2LXIA 5SZTA 1EIYB 1BHNA 4X62F 1GXUA 3UVJA 4JI2F 5ETPA 1U49A 4NLQA 3SXLA 3IO1A 3QT5A 4OHYA 4F3MA 3R1LA 4JOUA 1PYSB 1KQSR 3M6WA 3NCRA 3V6DA 2X51A 3N9UC 5KFXA 2W2QP 2KJVA 1WHWA 4GVLA 3ZC4A 3CDWA 2HFSA 3TJAA 3MR2A 4M5DA 2FJWA 1JLCA 4F67A 1FWPA 1T9VA 2BANB 2ZE2A 3ZNUA 3MPDA 3C6TB 4WP9A 4ANEA 3HX9A 4Q45A 4JI1F 1NJYA 3DGPA 3TI0A 2SXLA 2OGUA 1R8CA 3DMJA 1GMUA 3U1MA 4HDGA 4QIFA 3MUMP 1DTQA 1VMBA 1HNXJ 4WZQA 3BH6B 5J2MA 4HDHA 3VALA 2GCFA 1V3RA 1EARA 1LW2B 4B08A 4X66J 2HQIA 3T1YJ 3I4HX 5KFGA 2E29A 4U8YA 4IH5A 2L9WA 2UXCF 2V8VA 3CW2C 1IBMJ 4KR0B 1LFWA 1QTNB 4LBPA 4I2PA 4G1IA 1CJVB 4F36A 1OY9A 4LT6A 2YKMB 2HMIB 1VOMA 2W2MP 1TP7A 2H4WB 5HROB 3HXMA 4DR6F 3SQOP 1S59A 5L1JA 3OFEA 1Q5YA 3AODA 1KHWA 1Y9OA 1X4GA 4PYDA 2RAQA 1NKBA 2W8KA 3Q8RB 3DLHA 3C15A 1APSA 2KM8B 3OXFA 2J6TA 4OV1A 4HT5A 1VQLS 3SMZA 1HI1A 2EFPA 1C2PA 2RDJA 4G65A 4C8MA 2R8GA 4USJC 3NGTA 4Z7YA 1AUDA 1IJFB 2HHVA 3G6VA 3SFUA 4EFAC 2E5IA 1D3WA 5GMKa 2KT2A 4FPRA 4FYXB 3FBCA 5CD4H 3VGUA 2CKWA 5F3TA 4KH1B 3NBPB 5KT4A 1UVMA 4J9MA 2MZSA 2I9SA 1NEEA 2OTJS 4OZJA 1HL6A 1V3SA 4NI2A 3DI6B 1FESA 1Q8IA 5J2PB 3LP1A 3FMBA 3SSSA 3PX4A 3AJ1A 2J0SD 2IVYA 1RT1B 2IRXA 2RH3A 5GAGI 4ZJQA 1TFWA 1U2RA 4RUHA 2HLUA 3KK2A 1S1TB 2VIHA 4Q2LA 3MECA 5D6GA 4CIOA 1PCAA 5DJBA 4NOHA 5K14A 4TYAA 3GWCA 3THVA 1CJUA 2OHDA 4NLRA 1TKXA 3V4MA 1XBWA 4OYXA 5KFZA 1SCJB 5AE3A 1YJUA 2RVJA 2D1CA 2ZHBA 2UUCF 5DGAA 1F3VA 1S49A 1CBKA 1KC8T 5F3ZA 2UVUA 1VC0A 2EK1A 2HNYB 3ILIA 1ZTWA 1FA0A 2DH8A 5F9LA 3K58A 3SI8A 3GZ7A 4MJKA 1EP4A 2OO4A 2V8GA 2BE7D 2YWKA 4DL4A 1G1XA 2Z8QA 3I5CA 3HSZA 1S9EB 4ZLPA 1S6PB 1VC6A 1N56A 1NAQA 4AL6A 3EXCX 4X4NA 3FFIA 1QUVA 1VQPS 1TL3B 2GO8A 1EQ0A 2DNYA 3W8PA 2OELA 4HHHA 3DRRB 1KVKA 1OYDA 5GADI 2IFXA 4DL7A 2JWNA 3O3LA 1WDTA 1OO0B 2RD5C 3K5NA 4NYOA 5LXRA 3BYPA 3AXKA 2CJAA 3PW5A 5D0HA 4K4YA 3H5YA 5C25A 3FNNA 4C97A 3RGIA 4YR3A 1N34F 1U4BA 1U1PA 1BWEA 2PC6A 3E01A 2QMXA 5D78A 3QAEA 2AJ0A 2GFFA 5HLFA 4U9RA 1HHTP 3K57A 1C4CA 4DQSA 4FN5A 1TKTB 2ROEA 1T05B 1AW0A 2P5VA 3PW4A 5ETOA 1YRXA 2DRDA 1UVJA 1JNRB 3R7SB 3AD9C 2CQIA 2ZITA 3FC9A 4USTA 1R89A 5I4MA 3HFZB 1YDLA 3H8YA 4DUYJ 2VA2A 1QSSA 2V8DA 3RAXA 2Q1LA 3H20A 2GO9A 4YQWA 2QLWA 3QRPA 1R0AA 1M5OC 3A13A 3R2CJ 5K9FA 1JLGB 4NL5A 3HVTA 1HWLA 1NJIT 3BV8A 3H4DA 2KVQE 2RHSB 1Q0NA 2L41A 2EFQA 4CNZA 2VBYA 1Q5VA 4OYOA 1T02A 2P9GA 2DNPA 1TL1B 1C0UB 3GG0A 1RAHB 3TOQA 2P2CB 3PJ9A 4IFVB 1R6YA 2DGWA 4FZVA 4C0HA 4DSEA 2Z2LA 1FXDA 5AXLA 2HNZA 3PV8A 3ZTRA 2POKA 2QLJB 3SV3A 4LF9F 1WNEA 2ERRA 1DLOA 1NHUA 2CPHA 3KDOA 2DEIA 1MWQA 3IN5A 4FVCA 1S79A 2A0FB 3OVBA 3CULA 2A10A 3H98A 3G8TA 2IDLA 1S9FA 3KUEA 3QSYB 2BQ3A 4QPTA 1KD1T 1QAYA 2F1FA 2OSRA 1HNIA 4CLWA 5HMZA 4C3KA 1RDRA 3HVWA 4HI1A 4K59A 2DR8A 4N41A 1CULB 2IJRA 2LEAA 4OJGA 1RACB 1MNEA 4ECTA 1AZSA 3IXQA 1GTEA 2F3JA 3T9ZA 5KFYA 4IG0B 2LCWA 1DBDA 5DDQC 5CYJA 4YFUA 1UFKA 3KJVA 1NRKA 5KFVA 3D0HE 2FC9A 1BLUA 2IVMA 1X4FA 2KU7A 3BKTA 3VAMA 1TQLA 1IJEB 3ZZZA 3G6ES 4ED3A 4OFZA 4X4OA 2UUAJ 4IDKA 1OWXA 5E3CA 1IVZA 2O01C 4CWBA 3CCLS 3W62A 5F8LA 1LEOA 1U8SA 2DR9A 3CCMS 1FF2A 2DT9A 3M30A 3TA2A 3IWNC 4KC5A 3BEGB 1RHKB 4LF8J 2G2OA 2CQBA 2P6SA 5J2QB 2FHMA 2NUUG 2HHWA 4E2FB 4OJ1A 4HLBA 4OYPA 2IY5B 2V94A 1QSYA 2YKNA 3MM8B 2D3UA 2FGOA 2KDOA 3D67A 5A2QY 1DTTA 1GK8A 3JSMA 1X5TA 3AAWB 1JNZB 3PX6A 2ZOMA 4R5PB 2C2ZB 3BBCA 2XTJP 4O0IA 2K06A 4K4XA 2KTQA 4AFFA 4GKKJ 3H5XA 1VDHA 1SH0A 3BR8A 2VJVA 1WC5A 4V19X 4RO0A 1L3VA 1RXOB 1EETA 3QSIA 2ACMA 1KLMB 2QLXA 4S0MA 1SUQA 1PAEX 3K7RA 2IJFA 1S6QB 5MAOA 3PVXA 4U7UD 1P9YA 3J7YU 3L9ZA 4A8MP 5K8MA 3PFOA 3LGNA 4ZP8A 2XYGB 5DG7A 1FWLA 4AE5A 3OTDA 4FKYA 4RW7A 5KG6A 3C19A 2B6AA 4DF8A 1NK9A 1X0PA 3T5JA 1YJVA 3GSDA 2ADCA 3VR1A 1UMJA 2J7UA 4KHRA 4DQIA 2Q6CA 2DJWA 4QIGA 1AT1B 3AJ2A 4DUZF 3M6XA 3PCOB 2CZ9A 5E3QA 3GG1A 3T5KA 1JWWA 3CDUA 2XYPB 4ENOA 3Q8YA 3D1HA 4RWXA 4LF4F 1JLAB 2BJ7A 1M5VC 2P8IA 3PO4A 2V2KA 1EKRA 4MK7A 1MW7A 5C24A 4RBVA 5F8NA 5D15A 1YBUA 2CNNB 4W98A 1N32J 3DXBA 4A4JA 4ZPWR 3IBFB 3DRPB 5KFOA 2R4FA 5J1EB 3BF4A 3RBEA 3MM5A 3SCJE 4B3SF 3IA0A 2PO4A 2WOMB 2JEGA 1B64A 1X5PA 4DI6A 1TZ0A 2HBRB 4E98A 2CDQA 1D09B 4U7CA 1DAXA 1FKAF 2DH9A 3OVSA 2AZ3A 5HQMA 1J2VA 1EAYC 3MEDA 2ZJRQ 3OL8A 1RBAA 3EGWB 2AIRB 1OIAA 4PABA 2FGCA 1NJXA 1X60A 4U8VA 3V6JA 1NMEB 2CPXA 3ONQA 2W01A 4W92B 3EICA 3LAMA 3CD5A 2KHCA 2DBBA 3OL9A 2QIFA 2LVWA 2VFSA 1T11A 2D3ZA 2JLFA 2VB6A 1RTZA 4CCHA 1IKXA 4DL3A 3D28A 1WHYA 4F3OA 4CLKA 1DURA 2XSJB 1YRTA 1BQMB 4AL7A 3EPGA 1VRTA 5D3GA 4NLWA 2XMUA 4X4VA 3KG4A 2XHCA 3Q8QB 5T14A 3G82A 2M4MA 1Q79A 2WW4A 3TR5A 2HRYA 4UOCA 2UXDF 4NASA 3I31A 2R7SA 1U24A 4G6VB 1J5OB 4OX7A 4P2SA 2G1HA 3RB4A 3Q0AA 2EWHA 1U1LA 4IFYB 5CCLA 3HHDA 1FFSB 2RS2A 1N36J 3DRSA 2RQ4A 4NYZA 2OMLA 1RA6A 1S1XB 4FYYB 4C3MA 5KTQA 1QAJA 4NMXA 2YH0A 1RHQB 3DM2B 3JQKA 4WTOB 3VAHA 2RRNA 3D1OA 4Y3CA 4IQMA 4DV7F 1SV5B 5GAHI 1QE1A 4TU8A 1NK0A 1SBRA 3N0VA 4GKJJ 1R8BA 1REVA 1D9AA 1FD2A 3DDIA 3G8SA 3AT1B 2O3DA 2QLBB 2ZVIA 1HW9A 2CNLB 2VODA 4MFBA 3TVZA 4LMZA 3KHGA 3GFZA 3WBZA 1NJWA 5HBMA 1JLFB 1QDUB 4XO0A 4ECYA 2MDAA 1RWVB 4M5LA 4DFJA 1VC5A 4F4AA 3OW2R 3I6PA 3Q2SC 4FS2A 3UPFA 3IC1A 1QLNA 5BYQA 1WTBA 4CH7A 3NNAA 4EO6A 1UA1A 2UV8G 5HP1A 1CQMA 2VPWB 3VF0B 3TO8A 4EYHB 2VBXA 5KFPA 5JMNA 4QZVB 1FRKA 2MB0B 2ACYA 2VH7A 4PZVA 1WI6A 3I9V9 3Q83A 3I56S 2A6MA 4NCGA 1YJRA 1N5VA 2R8HA 4ATNA 2KRBA 3Q89A 2W7OA 4HACA 5KT5A 2F40A 4RU9A 4Q5VA 2WBMA 3S6EA 2XMWA 1WOOA 1URRA 1NZAA 4I56A 1RWKB 5M2UA 3UVJB 2E1AA 2U2FA 3T9NA 3PW0A 4F8RA 2JH3A 1UEVA 1Y0HA 1X4CA 3OPKA 3Q2TC 1PYTA 2MPUA 1VFJA 1B0PA 2ZDPA 1VQ4S 4I7FB 1SL0A 1CEZA 4TLQA 4B3OB 4N77A 4TQSA 3KK1B 1VBKA 3OV7A 5B7WA 4NLDA 1SXLA 4KHPF 1AB8A 1OSDA 1SH2A 4LSNB 2AU0A 2QO3A 3JTNA 5HMYA 4H4OA 1CS4A 1TAQA 2JEFA 1Y10A 4RW8B 3DMJB 4O3RA 2MQ8A 2H65B 4E8UA 2AEFA 3TANA 3RRGA 3CDEA 3OTBA 2E7WA 4B3MJ 1FK9A 5J2MB 3UCGA 5AXNA 2MZTA 1LW0A 2E5HA 4DCJB 3QRRA 1ELOA 4NRTA 4QYZK 2BJ1A 2FVPA 5D0GA 3HD1A 4PYAA 4OX9J 2ASLA 1RYSA 2IRYA 4QR2A 1XEZA 4Y0FA 2F63A 5JXSA 4ZCMA 3ITHB 2LP4A 3IWLA 2N4CA 3J7AN 3MAAB 4RBUA 2BABA 3ZO7A 3E3XA 4BC7A 1IKVA 3ZZRA 1T0TV 3I0SB 1VK8A 3G86A 5KT3A 4F2SA 4WWSA 4DV4F 4JV1A 3EGZA 4UY85 2QZ8A 4MKYA 3IS9A 5FDLA 1KP6A 1RAOA 1RT4A 2QE5A 5IT0A 5F8HA 4USKA 1LXJA 4DX8H 2CQ2A 1FNMA 4IKAA 3JSRA 5ETMA 1GMWA 3AQOA 3V81B 2CADA 5EWEA 4F0KA 1BD6A 1KRPA 3OTOF 3W9JA 4TLRA 2IDEA 1WHVA 2D69A 2IM3A 2FLNA 4ZPDA 3WX8A 2YNIA 1HBNA 1FJGF 3ILOA 4RU2A 3LP1B 3HM9A 3T1AA 4C9DA 3G71S 2HS0A 1Q53A 1S57A 1RAIB 5F8MA 4EI2A 2WTFA 5B0GA 1SJ4P 4J9RA 1X9WA 2ZHOA 4OMFG 4YY3J 4LQ9A 1RWXB 1U1RA 4YEAA 6FDRA 3KK2B 4IR1A 4AUKA 5KFEA 4RJVA 2R3VA 4C8LA 1F9EB 4LF1A 4KT0C 1UVKA 2CPFA 4DV5J 5K14B 2XM3A 2YPYA 4ERDA 1JK9B 4ZLLA 2IMWP 3EZUA 2OPRB 1AFIA 4FP9A 5ETLA 5BXIA 4X4PA 5IWAJ 5CA5A 1BE4A 1WF1A 4HH1A 2DGUA 4TNOA 3KLIA 2NREA 4UQGA 1HA1A 1RWWB 2G0JA 4Y6IA 2A18A 2AYBA 1NK6A 3LWLA 2AYMA 5CYMA 3RAQA 2H5JB 2UXBJ 2GV1A 1S9GA 3RBZA 4DG1B 3GIIA 3GP9A 3UI3A 4K4VA 3B4DA 2V67A 5THWA 3NKYA 4X4SA 4C2MA 1RBOB 5KFDA 2Z4PA 3UCUP 1RTIA 4CLYA 4YR0A 4IO9Q 2RJZA 1EP4B 5A8RA 2NYIA 1H73A 3GYGA 4ZOSA 1WEYA 4JV5F 2OPPA 2DGQA 1TTHB 3R8YA 4PRFA 2CA9A 1HFEL 5KFWA 4MYUA 4UT4A 3D68A 1I3OB 2HRTA 4L73A 2FVCA 3MR5A 3PHTA 3FFIB 3UDEA 1OQ3A 1RI7A 1C4AA 1GFWB 3BN7A 2EC0A 5L1KA 2FJAB 5AJ3F 2VJUA 2HK3A 3A3PB 2XULA 3CTRA 2VQFJ 2DHXA 1RBLA 2UUWA 1YBTA 2LDIA 2YX4A 1S7IA 2BW7A 5FIIA 4RWWA 1F1BB 2VOOA 5FD1A 2KXHA 3OL6A 2HNDA 4ED0A 2HHSA 4RUCA 3GJTB 2YVSA 1PG5B 4NXMF 4JI8F 4FYDA 2RSQA 1HMVB 1SJFA 4DR1J 1RJJA 2CPDA 3FBBA 2BANA 1PBUA 4NEYA 5LXYA 1SKUB 4RUAA 1ZZFA 4LR9A 2R7TA 3CDBA 2Z2ZA 3J7Z5 3R9LA 4YDDB 4F4ZA 4QU6A 4A8KA 3PW7A 3P45B 4FF1A 4LRAA 4Y2IA 2KO1A 2D7SA 2ALYB 4JI6F 1UAWA 2M0GB 4RKUC 4ILRA 2ZC3A 2OFHX 4G3IA 4CLPA 2XEXA 1LW2A 4DUTA 1RE1B 4DV3F 3BM7A 2QSWA 2JLGA 3RU0A 1KHVA 2VBWA 2F4FA 1X5SA 1ZA2B 1R0AB 2DGSA 1CJVA 3JYTB 4ED1A 1J5EF 4Q2MA 2HMIA 3HVTB 2NUHA 2IM0A 1KTQA 2MKYA 5DLFA 2FLLA 5HROA 1TVRA 2NXNA 2B7BB 1FDAA 2ZH6A 4F4WA 1H98A 9ATCB 2E44A 2MGZB 5A2QU 2QG9B 1LK5A 1T3OA 3SDEA 4LFCF 1TKZA 2A1BA 2A3JA 3BGRB 4YB1P 1N54B 4EK2A 4OQJA 3FUYA 5IT9Y 5GAGU 4C8YA 4FNHA 2QYCA 3DN9A 1TELA 1O0PA 4BDPA 3I5BA 2MYFA 1XJWB 4DS5A 2HHTA 5CCMA 3B4MA 3BDEA 2O5DA 1A9NB 3KK3B 4CLTA 2J7KA 2PDAA 3NBPA 2MZJA 2QGFB 3OVAA 1UW4A 3US5A 4B9VA 3WC2A 2XZWA 3MCMA 4XDDA 3M6VA 1ZETA 3DI6A 3AXMA 2ZBCA 4KY3A 3CJ3A 5J2PA 2ZC4A 3AOBA 4BLGA 2D41A 5IXUA 1IR0A 1RT1A 2I1RA 3CCZA 3R5DA 4KKOB 2BM1A 3ETOA 3N4WA 4ZN3A 4FYWB 2DITA 4GC7A 1LK7A 3R7BB 1CJTB 2BOAA 3BSAA 4I4BA 1KWMA 1S1TA 1IM6A 3KJVB 1SIWB 1S5ZA 5T41A 2ADBA 3BO3A 1WJ9A 2ZJQQ 3CJRA 2L9NA 2DISA 2YX7A 1H72C 1HQUB 1WUUA 1T03A 1QD1A 2DYAA 2EVZA 4OX8A 4DV2F 3GLJA 1FI4A 5BR8J 1M5HA 3PHEA 1VCTA 2DY1A 4X4TA 1I94J 2NZ4A 3BB5A 3D6FB 1YGYA 4OZNA 3KTQA 2MKCA 2XC9A 4LF6F 5CHCB 2IAJA 4PPZA 5ETVA 3AD7C 3VTIA 2C2NA 3BO4A 1IXKA 4I6AA 4ED6A 2MKHA 3NWRA 2BQRA 4Y2KA 1SPBP 2HNYA 5GADU 4LQ3A 4I6YA 3NNHA 4LR8A 2Q3PA 2C2EA 4CO0A 3TAMB 2YKNB 5KG4A 2BDPA 3H2UB 2PN6A 1HHQA 1DTTB 3P96A 3KJNB 4OJ3A 4M95A 1S6PA 3J81j 2R7XA 1TL3A 3HSGA 2ZEJA 2VG7B 1OY8A 4DFKA 4J9OA 1XNRF 3B78A 3DRRA 2GMJA 3EWGA 4ELTA 1HKAA 1EETB 4KB7A 4DDFA 4RW4A 2LQ5A 2BMBA 4YOEA 2DHAA 4IR9A 2ROGA 4P7TA 3LOUA 4ZMMA 2AP6A 1WC6A 1HI0P 3BR9A 2KZMA 1V5IB 2HURA 3DLEB 5CYQB 2JFDA 2UU9J 2F4VJ 3MM7A 2DHSA 1B70B 1WI8A 1HWKA 3QT8A 1TKTA 1T05A 3NG8A 4HTIA 1NSPA 3QIPB 4UZCA 2QL5B 1LKZA 4KQZA 2JZ5A 4ZJOA 3DLLQ 3FRYA 3AB2B 2LEBA 3ISZA 2BV3A 4J9SA 2FDNA 4FXDA 4NLPA 1VQSA 3NMAA 5CABA 1FKOA 1HNVB 2W1BA 1PYOB 1SC4B 3G87A 5KFUA 1QAXA 2B3TB 2YNFB 3ZTQA 3HT3A 1HIYA 3D66A 1V9OA 2J5AA 3MTJA 5AXKA 2HIYA 3MMCB 2VG5B 1RAAB 3T6BA 2R8JA 2C22A 3MCNA 3HPOA 2BE2A 4F4KA 2J6UA 1JLGA 1CC7A 3DOLB 2X3GA 2F9JA 4WXWA 3OUYA 2YXLA 1RP5A 3BQ2A 2A2CA 1LOUA 3FSXA 2COLA 4AYBD 2XY7A 4PKDB 4I2QA 2DNNA 1TL1A 1C0UA 4FPIA 4WIIA 4CM0A 4TXSA 1XMOJ 4IFVA 3H90A 4P52A 1ZM3A 3C16A 3MMJA 1TUWA 3DU5A 2HFZA 5RUBA 3BSOA 2KL8A 2ZKTA 2GMHA 1MROB 2F8HA 1VLOA 2BJDA 3DFEA 1RT3B 3LF0A 4OI2A 3W5YA 4TY9A 4ECZA 4ZIWA 3M8PA 1HNZJ 5KT6A 2V50A 4B9LA 3SSRA 1RK8A 1GNKA 1TK5A 2MKSA 1MN9A 5HVHA 3B8HA 4X65J 1SJ1A 1XWLA 2HHHF 3L7UA 2I5JA 2N82B 5HMWA 4ELUA 3O1LA 5ADZA 1IKXB 1TU0B 4U67Q 2AD9A 3D0GE 3EE3A 2B4PA 3LA0A 1CULA 3SZ2A 3DDKA 2BW2A 1H2UX 3ENAA 3R6GB 2X3DA 2DGXA 2XMVA 5F8IA 3RW6A 3G82B 4YUDA 1EB0A 2ASYA 2HVDA 4IG0A 4CNYA 4NPOA 4QR0A 4U95A 2FJBB 3MMBB 5KFIA 2R7UA 4J9NA 4GRSA 3NXZA 2GVZB 2B9XA 4R0EA 2VUGA 1U6FA 1MLAA 4Z7CA 2BYCA 4D3HA 1YSJA 2NXUA 2OAUA 4G1PA 2IHR1 2BZ2A 3CNQP 1N52B 3MUVP 3MM6B 1CC8A 2B8PA 4DV0J 2P6TA 2WVFA 3N5FA 1T7PA 1XR7A 3Q8VA 2YKQA 2AGQA 4RNFA 1KQKA 3GPAA 3FDSA 3MPYA 2JEIA 1GT8A 3I9ZA 1H0HB 2H5IB 3H4BA 1REVB 5J2QA 3IGVA 3M8SA 4KO0B 3W64A 3MMAA 1HPZA 3H59A 4AT1B 1E6YA 3FCWA 3CO9A 4W90B 4EZ9A 3GR0A 4XK8C 2BJ3A 3N6MA 3T1HJ 2OSQA 1PJ7A 4P7VA 2G2ZA 3M1VB 2CXEA 1Y00A 2GIFA 3KLFB 4R5PA 1RLDA 4F02A 1NSQA 2MKKA 4JI4F 4M5GA 3AA8A 1G3OA 3H25A 2MSSA 2PD1A 1F2HA 3F73A 1U1KA 2DR5A 1S6QA 1U45A 1W2IA 4PG6A 1D9FA 1N0VC 2E5LF 3K8WA 4NCGB 1ZOTA 3QYYA 2DEJA 2WZ1A 4YHHJ 5LSRA 3CC2S 2R8IA 4LF5J 1JXLA 3EVOA 1BQNB 1HBMB 1HWIA 2JVOA 2BQUA 3HJVA 1YJWS 1WHXA 2OIHA 4FF2A 7AT1B 4USHA 2O67A 2HZCA 4JI0F 4MIWA 1U1MA 4HVZA 3VGSA 5MLCV 4O3PA 3HSJA 2ZUAA 5IM0B 4ANDA 3GV8B 3F56A 3GB0A 3PXGa 5LMUF 2EFOA 4G1QB 5SUHA 2ZNZA 1UJ5A 1Y3KA 5F0WA 1FRJA 4L3NA 2OI2A 3DLJA 1C1BA 3N6NA 5KG0A 2V9KA 4K5SA 2KT3A 3H0PA 2CNKB 4H4KC 2P9EA 4FF3A 3D3BJ 4H4OB 2PMZD 1CS4B 4DR5F 4WP8A 4OYWA 4DSIA 5JVHQ 1GTHA 1YIJS 4WE1A 2RNEA 2JSXA 1IR2A 3DRPA 2E1PA 5B0CA 3D4JA 2QYGA 1LW0B 4MK9A 4Y34A 1KFSA 4ZVUB 1X4DA 3OFFA 3C14B 5H9EJ 2LU1A 3MZIA 2HFOA 1JJ2R 4FBUA 5A8KA 3PYFA 4A8SA 4L72B 2GIRA 2WOMA 2LQ9A 4CLUA 2VZ9A 4DQPA 1FKPB 1M1KT 2XI2A 4DR3F 1RB0A 4DPYA 1PGZA 2XLIA 1KVIA 3P5BP 3E2EA 4LIWA 2V69A 1B4SA 1LWFB 3CGIA 3P8BB 1IKVB 3TUPA 3JSYA 3IRXB 3W8GA 2ZH3A 3S7RA 4ZCIA 4NLSA 4QIEA 3KG1A 2XZDB 4DU7A 4JI2J 2ZBQA 5FDLB 4O3QA 2N3LA 3Q8PB 4CLLA 3DOKB 4NYPA 2Q79A 3RB0A 4IG3A 4DZ6A 2D74B 3CB4A 1PBAA 4DL6A 1VS3A 3UDVA 3HZEA 2VL1A 1SQFA 4PWDA 1U2FA 1RZMA 4DJBA 2HBQB 3I55S 2XSJA 1N48A 5F41A 2BUNA 2DK2A 2X1FA 1QUPA 1TL5A 2GQQA 1ZH5A 2Q43A 1ZYQA 3VAGA 4OI6A 3D2WA 3L3CA 3UD4P 2HWHA 3A3NB 5KFMA 4YR2A 4JI1J 2O1PA 5KOXA 3C8YA 1KTVA 4L6V3 5GAHU 1J5OA 4DX5A 4DFMA 2KRRA 3OFGA 2DGTA 1N88A 4DEZA 8AT1B 1CQNA 3MEKA 4IFYA 1GXTA 4LFBF 2WVEA 2FPHX 2GS8A 5DETA 2G2YA 5F8GA 1S1XA 1KOHA 2CQ1A 2KG1A 2B43A 2UXCJ 2PFDA 5KG2A 4JV2A 4PEOA 3DM2A 3J7A1 4CDIA 3GFHA 3QPIA 3QJJA 2Y1IA 1TUGB 5EX3A 1U1NA 4CYUB 2E5JA 1A6LA 2H4YB 1UWAA 3D9BA 4Q44A 4ECSA 3NCPA 2KHDA 2U1AA 3H2VE 4URGA 4DR6J 2NPFA 1N5TA 4FXVA 1WORA 5A76A 3PJWA 1XQIA 2V8PA 3AFGA 5CYMB 1MU2A 1S9GB 4ANCA 1JLEB 3GV5B 1HHSA 4DR2F 4O44B 3R5AA 4UF4A 2QA4G 3W66A 3DU6A 2GW8A 2W7AA 3K5OA 4DV6F 2IC3B 1IWAA 1NK7A 3OTEA 3TQ1A 3PJXA 1LWCB 5IC6B 4OZLA 2OPPB 1AROP 4PQAA 2XYHB 5IT9U 4OYIA 2OTLS 2M8DB 2BKNA 1UTAA 3EVWA 2VDHA 3HSDA 2RDDA 3PEJA 1S72S 3TVKA 4QW8A 4YS2A 4M63A 3IBCB 3CJQA 2RQKA 2KJWA 1VIXA 2FZCB 3PY8A 2XGPA 1BUXA 2IIHA 1B7YB 2M5YA 2X7IA 3O5TB 1TK8A 1PILA 3PR5B 2WONB 5EWFA 4ZP9A 1L5UA 5H9FK 1WG5A 1FXRA 3THTA 3KLVA 4EO8A 2ZNYA 2JVRA 1S6UA 2R2UA 4I7FA 3Q23A 3O2IA 1R8PA 4I69A 2HNDB 4B3OA 2YQ0A 2UUBF 3KK1A 1N8RT 1JLQB 5T7LB 5CZVA 3HI9A 2MJNA 4LSNA 3IR7B 2C28A 4Q7AA 1NB7A 2B9WA 5L38A 3HFKA 2UUCJ 4DR4F 4OZ3A 4RW8A 1K0VA 4LVOP 3ADAC 2J76E 2E1RA 1XIQA 3L7OA 5IZHA 1S0NA 4DF4A 4FVMA 2YBVA 2JC1A 4F4XA 3BDPA 3BSCA 1WEXA 1FTCA 3WC0A 2XZTB 4NLXA 1VQOS 2PMHA 3TEGA 2CNOB 4P74A 2RRAA 2I8EA 3DLGB 2QMUB 1VHFA 1DJ0A 3ITHA 1NH7A 1MMDA 4GVBB 2HZVA 3BGOP 3MAAA 4NRUA 3HHLC 3BSNA 2HS4A 4HHUA 1TVRB 5K8NA 3CMAS 3QJLA 4O4RA 3KUGA 4R8UB 3I0SA 3BZQA 3FSIA 3SDEB 4ICLB 3T5HA 1SB6A 2XNRA 1TKZB 4ZCLA 3SV4A 3IWXA 3HO1A 1CLFA 1F6TA 1ZM4A 3PACA 3E8OA 1N34J 4DX6A 4KGZB 5EWGA 2DNKA 1MSWD 2CZVC 3MEGB 5KFKA 1R43A 3RJMB 2K1RA 4A48A 3QGHA 1N5YB 3ZTPA 3V81A 3CJ4A 3B6BA 4ITSA 1Z1ZA 5L1IA 4B9MA 2DCUB 4UOGA 1VK3A 3N01A 3MR3A 2V9WA 3IR5B 3RW7A 1D8YA 1O6XA 3HZGA 3Q8UA 3GILA 4N76A 1ZAWA 1WOPA 1R8HA 5BJRA 1K8AT 3UR0A 3MCOA 1CPZA 2XMJA 2D9OA 2MHEA 4ZVSB 3GE9A 2XQCA 4IRCA 2LFVA 4TY8A 4PG5A 4K0KF 3C6UB 2PFFB 2JHEA 2ZH9A 1NK8A 2MQMA 3KXDA 4MAKA 3VAFA 3ETMA 4L75A 1TAUA 2ATCB 1P6TA 2HQCA 3RBXA 1T03B 2BBEA 4QIVA 2GVDA 5DM6Q 4M94A 1WSRA 2R7WA 2Z2YB 1WDDA 2D3O1 2OPRA 2CWKA 3WZ0A 4ILMA 1NLKL 3S8SA 4NX9A 5DDPC 1H38A 4K50A 2G0CA 2HHXA 2XMAA 1S0MA 1TR0A 1NSKL 3O6QA 2OP5A 5DQHA 1X4EA 1UEUA 3UN2A 4N47A 2IAJB 1WC1A 1QVFR 1VGYA 4DSKA 4YB6A 4DG1A 2CG4A 3QWPA 3RB6A 4LF9J 2IBKA 5KFTA 4AQYF 3HJFA 1FJCA 4A8QA 4ZLJA 4RNMA 2G13A 2V4QA 2RQCA 5K20B 3DDNA 4USUA 4H54A 1YI2S 2YKPA 4N56A 4DSLA 4N5SA 4PXCA 4YN3B 2L9DA 4JV0A 5ETTA 2VC0A 2HK2A 1NUEA 2RU9A 1MWYA 1HW8A 1GAOA 1Z2ZA 2PE8A 4PG4A 3EUNA 1HNWF 2OPQA 2FVSA 2HWTA 5I3QA 3P3DA 1GMWD 1VQ9S 4RW4B 4Y2AA 1HQEA 5ETSA 4P2FA 1H74A 4C7QA 1KONA 4LRDA 3C2PA 3MFHA 1T9XA 4OYZA 4ZP7A 1VJQA 4JI7F 5J1PA 2CQ3A 1X0FA 2V4JB 3AQPA 3DHXA 4I68A 1F3FA 1JJ4A 1NB2A 4J90A 2L48A 5KFSA 3MM7B 1Z4UA 3IAM9 1HMVA 1DQAA 1S77D 1CJKB 4KRWA 2UV8A 3BH7B 3SQGB 1G6BA 1ZM9A 2XHWA 4P73A 4MMOA 3CVKA 4EBCA 4JYAF 2PI5A 1PJ6A 3RAMA 1ZA1B 1Q82T 3IMQJ 3I32A 2MLXA 2J9DA 4P9SA 4DR7F 2AGPA 4C98A 1SKSA 1FKOB 1T9WA 2PI4A 3CMQA 2F8MA 2HSEB 1G4CA 1RAGB 2R42A 1S12A 2X1BA 1WOSA 1F5AA 5HL7Q 1RAFB 3IG1A 2H48B 2VFRA 3QGPA 1SH3A 2J9EA 1KSPA 2CQGA 1ZM2A 2BE2B 3JYTA 4DL2A 3M4XA 4LF7F 1UZDA 3OUYB 1N33F 2QA4S 4NLGA 5DS7A 1O51A 2FLPA 3PM9A 2XCPA 2VPXB 1C1CB 2EI5A 4I2QB 4BS2A 1YJ9S 4EU0A 4MH8A 4YB5A 1YK9A 2DH7A 2MGZA 4DMZA 3DHWC 1T9TA 3BGRA 3C16B 4C8KA 4EUVA 2GJ2A 2HAFA 2GHPA 2AEJA 1P9QC 1M1GA 5ETQA 2W8LA 1VQNS 2J9DE 1RWUA 2IYGA 4PQUB 2EEYA 1IBKF 3M8PB 1X9MA 3GJSB 5L1LA 1JIHA 1WG1A 1U6ZA 1PJ5A 3KK3A 4KPYA 2EFNA 4UZBA 1U0SA 4B3TF 3SFGA 1F0XA 2I5JB 2Y0BB 2MQPA 2J8SA 3PYDA 3ZZUA 2W24A 3VV2B 5HMXA 4DUZJ 4OZ2A 3CT9A 4DWIA 4RW6B 3FJ2A 1XNQF 3J81U 2FY8A 4DU8A 1ACMB 4X84A 1K1SA 2BJ9A 3PG9A 2LQ8A 3MAHA 4XTTA 2VICA 4KKOA 2MY8A 4F0MA 4LF4J 2ZFHA 3OJUA 2WB4A 5IS2A 2NXJA 3D7SB 2DNRA 2JL9A 4QJVA 1CJTA 5KT7A 1NBEB 1ZZNA 1RT6B 4MKAA 4RLEA 3K8VA 5C2CA 4LIRA 3W5ZA 1TV6B 1SC1B 5DGBA 2KXNB 5A0YB 2Z0GA 1PC5A 2R7QA 4L74A 1Q4RA 1HQUA 4XIUA 4B3SJ 4J37A 1IBLF 3H7HB 3FGVA 2ZH8A 5EX0A 1RTHB 3P6YC 4WK3A 2AHOB 2YY3A 3NL0A 4LFAF 2OD4A 2OUGA 4QW9A 4P10A 4J9KA 5I3UB 4ECQA 3M8ZA 2VDIA 4WCEQ 2XCAA 2LXUA 5C5JA 4DV1F 5HVGA 1N0UA 4OX6A 4MIAA 2B4VA 4ZPBA 3C46A 5LMNF 5H9FJ 2GJIA 4ZVOB 2A6OA 1WF2A 7FD1A 1REGX 3MMAB 1HPZB 1E6YB 3TAMA 1OPZA 2RF2B 5DM7Q 1WKKA 3D5MA 2D3OR 5HK4A 2VASA 3WIUA 3R7NB 4R25A 2MMYA 4P72A 1B0VA 2E66A 2BVZA 1UETA 3PR4A 3PNIA 4U7UK 2VKRA 4PPDA 4P71A 3M8QB 1PO6A 3HD2A 2VG7A 4NXNF 1T95A 2K3KA 2AYEA 3LO3A 2YNHA 3K5LA 2RT3A 2XBPA 4C48A 1XMQF 1FFWB 1KLNA 3L4BC 2UXDJ 4LBIA 4KJIA 3W9IA 1DY3A 3JQMA 1H2TZ 4ZN1A 4PXDA 1JMTA 5KFHA 1U0HB 2DKOB 3U1LA 3VVTA 1BMQB 3M9MB 3DLEA 3JAMY 5CYQA 5K8OA 4ID5B 3OLAA 3ULHA 1YZ7A 1K0TA 3MCSA 4NCAA 4URQU 4ED2A 2KXFA 2HQGA 1D9DA 2QEXS 1KQGB 2WK4A 5HN0A 4I67A 4OI1A 1TL4A 3DRYA 3BQ0A 3QIPA 1QTMA 2G4BA 1TL7B 5DQIA 1R7IA 4ECVA 4DV7J 1HR0F 3V4IA 2OFGX 4J7CA 1HNVA 2ZOGA 3LGHA 4CM2A 2IPOB 2GMLA 3QGGA 2YNFA 1PC4A 2B5JB 2YQ1A 1C1BB 1RKJA 2F65A 1IKWB 4OZ1A 3MMCA 1K44A 2VG5A 4NZ0A 4DZDA 1AUSL 2FJXA 1C0TB 4WE1B 4ES2A 2CIMA 3HCXA 3FQKA 2Y1RI 4CLSA 3DOLA 4DPOA 2VG6B 3BPDA 1U47A 4TU9A 1WWHA 3SCKE 2K8GA 5DLGA 2DY9A 5A8KB 3UQSA 2Y9HA 3S01A 3M7VA 2CRLA 3O8WA 1Q8LA 1RTDB 4UUXA 5A8WA 4C3LA 4X64F 4QOTA 5B0BA 4KH0B 2W2NP 3IM9A 1MROA 3BKFA 3AOCA 3RBDA 1FNXH 1SC6A 3D54A 2RKIB 1RT3A 3DOMB 1HBUA 1FXLA 1FO1A 2MY7A 2QJ3A 1AA1B 1IKYA 3NEKA 3KOAA 3M32B 1YG0A 3J7ZT 3SBMA 1GX6A 3GJQB 2J6SA 4P75A 1S0VA 2BJ8A 4IG3B 1U8WA 3TZWA 1H7WA 2HHPA 3G2XA 3FZBA 3RRHA 3VAIA 1X9SA 2MQLA 4PWDB 5HAOA 3GFYA 3A8JA 5GMEA 3HHLA 4LBHA 1Q8BA 2YNGB 4HT7A 2G9OA 2AT1B 5HANA 4WK1A 3PFEA 5KOWA 2ZHAA 4KHPJ 2XS2A 4O0NA 1V6HA 3DGVA 3BO2A 5C42A 1U7LA 2HEKA 2LYVA 2MEWA 3EYZA 2VQEF 4RX6A 3PKYA 3MMBA 2XO7A 5KG7A 3MEEB 1UEKA 2GVZA 2DNHA 3CD7A 1DRZA 4IOCQ 4LSLA 3CJ8A 3LQVA 3DLKB 1SIZA 3MGJA 1AYEA 2EKYA 2XG8A 1WACA 2FJEB 3NLCA 5D77A 3OHAA 3W2VB 1RADB 5D4NA 4NLTA 3MM6A 1EZZB 4DQRA 4PAAA 1P1TA 5KFBA 3M9OB 2V34A 3X3UA 2M7SA 2BEFA 3LANA 4PG8A 2HS3A 3QFWA 5I42B 3FSYA 1RGVA 1J27A 5JVGQ 5IC4B 3GTYX 4KO0A 1NKCA 3QT7A 4DV4J 2EBGA 4WXOA 3VCDA 4CH0S 1FVSA 2W9BA 4JI5F 1TUVA 4EBEA 4I1TA 4O3OA 2XMKA 4O4GB 4KPCA 1MU2B 2LEPA 3SSQA 3QRQA 2WSFC 5EDWA 3M1VA 3KLFA 4KFBB 2YWWA 4LRCA 1OMSA 1ZAXA 1TK0A 1RHJB 3GIJA 5KFLA 3OTOJ 2CQCA 5CAAA 2DO4A 1Q16B 4RNNA 4JI3F 1RT5B 5J2NB 4DLGA 3CUNA 4J9LA 1QAIA 2IYIA 1NU4A 4CO4A 1FJGJ 2DRBA 3SYZA 4FNIA 5KFCA 3GR1A 4B3RF 5L46A 1KS2A 4KYZA 3G6YA 1M5SA 1X5OA 2F9DA 4QBUA 3QFHA 5BYSA 3UN3A 1BQNA 1HBMA 2N3OA 5LL6d 3CF5Q 3EXYA 3FEZA 2YKOA 2NPIA 2ZM6F 2CVEA 2GGPB 1UA0A 3PW2A 5IM0A 5E5NA 1VISA 3R27A 1O8BA 4Z2XA 4G1QA 1LV5A 3NS7B 4CI0B 4B9SA 3FEYB 4NEZA 3DCAA 3TAQA 3W5XA 3GQCA 2AYGA 2HLTA 2BX6A 1RHRB 4CP5A 2MZ1A 1ICEB 3GIRA 1K1QA 1RTJB 3MM9A 2OH2A 3NCQA 2UZAA 1U48A 1BWVA 2MKJA 1S1VA 4DXLA 2JDJA 2E9ZA 3LP2B 1FEHA 3TZXA 3A8KA 1S10A 2DGOA 1MWZA 1SL2A 3C14A 2P9CA 3BN4A 1Q1KA 4J9PA 4QR1A 4JV5J 2LA4A 4WJBA 1VJWA 2CPIA 3BGUA 3MOJB 4HTJA 3MPUB 1FKPA 4M5NA 3W60A 1H6KX 3I4PA 2NS1B 4XDCA 3PZPA 2M2BA 1M1HA 5GAEI 1LWFA 1NDPA 4QWCA 2CQDA 3IRXA 5AJ3J 1WEZA 2X1GA 4WU2A 4B9UA 1L3TA 4WP3A 1PIEA 4RW9A 2YPZA 2E1CA 1BXNA 2FHJA 5B0FA 4Q8EA 3EDRB 3OR1B 3DOKA 2YKAA 1JJHA 4C8NA 2HHUA 3EMTA 4ZITA 1FT8A 1P27B 2AX0A 2HVEA 1RQ0A 2K1RB 5GMDA 4UOFA 4O3NA 1F60B 4NXMJ 4JI8J 5LSLA 3NGSA 4DPUA 5D4OA 2HVHA 2CPZA 5D8HB 2IA6A 2FQQB 4IQXA 4U96A 2R7RA 4F50A 2VPYB 2XB2D 1Y7PA 2N7CA 3THPA 1HBOB 1HNXF 4JI6J 2ATLA 1ZTTA 2RQMA 3GONA 1VBXA 4X66F 1SKWA 2QC3A 4OLOA 3T1YF 2VPZB 2ZH4A 3A8IA 2AV5A 4O3SA 4TY8B 2XNQA 4DV3J 1BC6A 1IBCB 2KFZA 4ER8A 1M5KC 1IBMF 2HGMA 3VAKA 2UVVA 3DYAA 1S99A 3MPWA 3M2UB 1RU2A 5I3PA 5G0RB 3F0NA 1VIOA 2WVCA 2HQFA 3GYXB 2R2SA 3LPYA 1EJ7L 4UW2A 1J5EJ 1H7XA 3FVYA 4CT8A 2HIQA 4RNHA 4CYUA 2CPEA 1G7CB 1JB0C 3EZ5A 2GVDB 4FXWA 3DXSX 3TEHB 1SC3B 2Z56B 4ZIVA 2CDRB 1XMBA 5A6WA 2AGOA 1U26A 4USMA 2L08A 3Q22A 2NLWA 4IH6A 4LVNP 1GXLA 1YJNS 2YWGA 1FRLA 3ENWA 4LFCJ 3KKFA 4ZS6A 4QPXA 2Y1LB 1HARA 1EKSA 1JLEA 4FS1A 1R8AA 2FC8A 4O44A 2CPYA 3QMQA 4HKQA 2F5GA 2QLFB 2IC3A 2GNKA 4ZJLA 4IUFA 1RAEB 1W7WA 1LWCA 3VQSA 1VQYA 2M3DA 4ZHRB 2H5EA 2AJFE 4FBTA 4ZKAA 5KFNA 2R2RA 3CIMA 1SJQA 3CD6S 1NPKA 1VRQC 4CRJA 3OBIA 2FB0A 5KFFA 1AFJA 3R5CA 2W9CB 3UCZP 2FHOB 3AHPA 4B9TA 2ASDA 3VAJA 4D3GA 4KGVB 3MOZA 2ZH2A 1UFWA 2VKZG 2JEJA 3J80Y 2OPQB 2BA9A 1UCNA 2W25A 2XMTA 1HQEB 1ULRA 2WONA 3QNWB 3D3CJ 4KV8B 1DARA 8ATCB 4TU7A 3DRXA 3ZZYA 4BBYA 4WFAQ 3KHLA 3MXHP 3KLEA 1U6BA 1S7HA 1WKLA 1XK8A 2AX1A 3KHRA 5KT2A 2AJ1A 3OSPA 4DV2J 1JLQA 4NLOA 3KMSA 3EM1A 3IGNA 5T7LA 1NDCA 4BWMA 2PSZA 4CT9A 3NOCA 1N5SA 4ES1A 2W4PA 3GIMA 3T5LA 1XR6A 3VVUA 2BACA 2UP1A 4LF6J 1NJZA 2M88A 4BWJA 2E5GA 1X7VA 4OIXA 2GQ2A 3H42A 1JKHA 2QMWA 1GH8A 1K73T 2QFIA 3ZTSA 3D0IE 1SKRA 4ZPAA 2GA7A 2CZ4A 2DXDA 2LQBA 2EKNA 4CO5A 2LQJA 3MDFA 3IG1B 2AJ4A 3MR7A 1JJCB 2EW9A 1F2GA 5EN1A 2W2PP 4KGKA 2VFTA 5E2QA 3DLGA 3SEOA 4DS4A 4CTAA 3KUHA 4P6QA 4GVBA 2EXUA 5ETRA 1WSVA 3QAUA 2V8HA 3OHBA 3AY0A 1XNRJ 1OS5A 4ZVRB 4R8UA 3ZNJ1 2PMWA 1RT2B 1UL3A 2W4CA 4ICLA 4ECRA 2CJQA 3KMQA 2H3EB 3HLUA 4QU7A 3PIOQ 2ZD1B 2HQ3A 1S1UB 2RUSA 3WIVA 4DOZA 5C2GA 4C0BA 3MEGA 3VZHA 4A8WA 3LWMA 2M70A 2VBZA 1N5YA 5LT5A 2CG8A 1YTYA 2A2DA 3BREA 1H3DA 4GO5X 4ID8A 2J8AA 3EPIA 1QSLA 1RWOB 1S76D 1A0OB 4Y2MA 4V1Ak 2VONA 3P4UB 1FCAA 3G9CA 3NNCA 3KLGB 5C7PA 3OR2B 4OYAA 1QVGR 3H5UA 2C1EB 5LOQA 2C3PA 4J9UE 3JAMU 3C3LA 2ZZMA 5DO2A 4DUYF 4ZDNA 3BGFA 1I1GA 4A8OA 4P2XA 2O66A 3LW5C 1WD6A 2FLOA 2NSCA 2JC0A 2DXFA 1FTRA 5DRKA 1Q95G 2CQ0A 3C6UA 3ISND 4PUOB 4DX7A 1ROFA 1AXQA 2ZKUA 3NGKA 4WPAA 2MLYA 1UWBB 2ILZA 3PX0A 1L3UA 4I0WA 1N6QB 1RCXB 2NCKL 2OEJA 1IR1A 1T9YA 2CFXA 1YRUA 5IOLA 3W61A 1EQMA 4WBFA 2YQ3A 4H4MB 3W65A 3ENVA 4M8LA 1VR6A 2KB2A 3Q86A 3UR3C 1M0SA 5H1SV 3VGVA 4Y65A 3PDNA 2OEMA 2WHOA 3QZ8A 3ZFVA 1WC3A 2FVRA 3R1HA 3D6HB 2RIJA 4N8NA 3I82A 1S1WA 3HKZD 4MT1A 2IRUA 1HD0A 1Q7LB 5KG1A 4JB8B 1XC9A 3TP2A 3IBWA 2MQNA 2DR6A 2CJKA 3AB4B 2HHHJ 5K5MA 3TNVA 1WC4A 3MWBA 1FHTA 2HWIA 3D6TB 1FDDA 4OL8A 1M5PC 1Y3JA 4XAKA 4OI3A 1S6OA 2CJ9A 1W25A 1NM2A 1R31A 4ECWA 3ISNC 2LLZA 1S4FA 1UW9A 3POTA 4Q0BA 3QO9A 3HFVA 2KM8C 2YNHB 2DHGA 2KVIA 2HFUA 3H2LA 4A8YA 3PYEA 1VQMS 2KZZA 1UJ4A 3CJ2A 3AJDA 5E3AA 2IJNA 3NP5A 4L3KA 4DHVA 1X31C 4QYZJ 1ZBTA 1LQ9A 3N6LA 5M2RA 2V4JA 2HZAA 1RT7B 2HQDA 3BQ1A 2UUAF 1CSJA 1FDBA 2V2ZA 4UTGA 1X8DA 1CJKA 3CPWR 2AWZA 1W26A 3CJ5A 3VHQA 2HW3A 4EBDA 3SQGA 2JX2A 1I5OB 3TUZC 4HYKA 1NZ8A 1UZHA 2GZOA 1JXEA 3NAIA 3CDAA 4M5MA 4LF8F 2OPSA 3M2RB 2DD8S 3V4IB 2L3MA 3S1TA 4Z37A 3BYRA 2WW8A 2EPIA 2Z58B 3JQJA 4QWDA 5L8RC 2J7WA 4YMEA 4XPEA 3TJ8A 2R9LA 2HHQA 2HGLA 2UVWA 4AXJA 4K8RA 4Y28C 1UVIA 1TMJA 5CXTA 2H51B 2JNJA 3RB3A 5HVFA 4TVAB 5IQ6A 5JJBA 1KOOA 3UDCA 4ETZA 3H40A 5IV3A 3LALA 2BR0A 4GKKF 1VBZA 2DPIA 1LFPA 2QSFA 4PXBA 2B0GA 4JI4J 1C1CA 5AE1A 2C3UA 3UD3P 3LTOA 1NHKL 3W7BA 2ZH5A 4USVA 1X4BA 4CO2A 3K2YA 3M05A 5A8WB 1BY9A 2V5HG 4NCBA 4B02A 3RTVA 2E5LJ 3GV7B 3GCWP 4FDFA 4MIBA 2R7VA 1U1OA 1HBUB 1N5QA 1PAUB 4PQUA 1YJ7A 3LP0B 1VQKS 3NWGA 3PKMA 2KH9A 3HF5A 2VFVA 5B0AA 1YWXA 1IKYB 1ZPVA 1JXVA 3LUYA 3R5JB 3C66A 2K3IA 1MN7A 1DQ9A 3OQ2A 2MLZA 3CJKB 2I38A 3KLHB 4JI0J 4IH7A 1B99A 1VI7A 3CE8A 4NZ6A 4RW6A 5U47A 3TA0A 1JLBB 3HHLB 4ZCKA 5LMUJ 3LH2S 4I6WA 1YBAA 4DN9A 1OSCA 2LECA 2Z2MA 3CC7S 2AEMA 2C3MA 2LXFA 3MHYA 2DO0A 4WYLA 5DZ7A 5C42B 3CO0P 3FZ2A 2R8KA 4DR5J 1N32F 1RT6A 2IBOA 2M52A 1NSAA 3GFXA 2KN4A 4C11B 3RG6A 2HVIA 3UO0A 2OLWA 1LWEA 2JJ4D 1TV6A 3UNYA 5F8JA 4TYBA 5A0YA 2C2KB 2ZUGA 4IO1A 4LSLB 2W7PA 1URNA 1E6VB 1L3SA 2QN6B 4Q43A 1RTHA 4RZRA 3W2WA 4V19J 1EHWA 2M8HA 1FVQA 4OV6A 5DDOC 4HR2A 3FQLA 2H54B 3KYLA 4DR3J 5ETKA 5I3UA 4WFYA 2B56A 1Y5LB 4J5OA 4K4SA 1FRMA 1FRXA 1P8GA 1VYAA 3O44A 2ASJA 2C2OB 4ZP6A 3ZXWA 3R2DJ 5KFRA 4QWBA 1U1QA 2WSEC 2RE1A 2RF2A 2W9BB 4DQQA 2QRRA 1CG2A 3PIPQ 5E33A 4WU3A 3V6DB 2FZGB 1BGXT 3RUBL 4CLZA 2J0WA 5EUHA 2LDYA 4M5DB 3M8QA 2H9ZA 1JLCB 2JFKA 1FRHA 1X4HA 2Q66A 4M5KA 3X1LB 4CH1A 2ZE2B 3M2VA 4DBQA 1I51B 1M90T 1KQFB 2XWXA 4AD6A 3L95X 3DGPB 3MUTP 3U27A 5J1NA 4ZVFA 3ILLA 4K2JA 2MSTA 5HJXA 1LNQA 1DTQB 1FWKA 4DN0A 4K2XA 2GHVC 1WKJA 1KEKA 3OD2A 2F7VA 5FLXY 4JBCA 1N36F 4ETXA 1UP1A 1U0HA 3J81Y 4LFBJ 2Y0SD 1T3NA 4ID5A 3U02A 5D4LA 3G4SS 2KI2A 4J9VA 4I2PB 1QM9A 3FEXB 4K5RA 3EGVA 3EZOA 3NOGA 3R6LB 3FCVA 2N4DA 1NDKA 1VHIA 3R5BA 1HLWA 1TL7A 5HQ8A 1SI9A 2I2YA 2QTWA 3GSIA 4GKJF 3C15B 4USIA 2GAGC 4LF2A 2MHNA 3KNGA 1VRUA 6AT1B 2B5JA 3N28A 2NXEA 4ZVGA 1IKWA 1RHUB 3TX0A 3MM9B 4KGMA 4F7VA 1C0TA 2WBRA 2KFYA 2AJQA 1S1VB 4EEYA 4DR2J 3JTOA 2XS7A 3IM8A 2B4UA 1HQ2A 2VG6A 4DV6J 1F9HA 2IM2A 1D8ZA 4QIWD 2GHWA 3A8EA 4DCOB 3Q8SB 2JLEA 2EG1A 4IYQA 1ZAVA 4YDXA 3QLHA 3AA9A 1Q86T 3OSNA 1MMLA 2ROPA 3CCRS 4NI2B 2F8EX 3OFHA 1RTDA
chains in the Genus database with same CATH topology
4ELTA 3V4IA 5AE3A 1X4AA 1YJUA 1EETB 2OFGX 4KB7A 2RVJA 2D1CA 2ZHBA 4F3QA 1NH8A 1HNVA 2ZOGA 3TUIC 4ALZA 4DDFA 2UUCF 4F2RA 4RW4A 2GMLA 3QGGA 2LQ5A 1NNDA 4F4YA 5DGAA 2YNFA 4YOEA 3DNCA 1S49A 3PEHA 1PC4A 2B5JB 2DHAA 1HWUA 4IR9A 1KC8T 1C1BB 5F3ZA 1RKJA 2UVUA 2ROGA 1VC0A 4P7TA 4AXIA 2ALZA 2EK1A 2RKIA 3LOUA 2C3OA 4ZMMA 1IKWB 3DOMA 2HNYB 4OZ1A 1ZTWA 1FA0A 3MAQA 2AP6A 2DH8A 1HI0P 3MMCA 5F9LA 2VG5A 3QWUA 4NZ0A 3BR9A 1R3NA 3I0RA 4RW9B 3K58A 3SI8A 2PGCA 1KN6A 2FJXA 1C0TB 3GZ7A 4MJKA 2KZMA 1KR4A 4WE1B 4ES2A 3M32A 3MECB 1EP4A 1SL1A 2OD6A 2CIMA 3DLEB 5CYQB 2JFDA 3FQKA 2Y1RI 3JB9k 2OO4A 3MM7A 3DOLA 4DPOA 2DHSA 1MMNA 2V8GA 2VG6B 4DSJA 1WI8A 2RS8A 1HWKA 2YWKA 3MF5A 4DL4A 2KG0A 1G1XA 1U47A 2Z8QA 1PSDA 3MTKA 3I5CA 1JX4A 4TU9A 1TKTA 2GX8A 1S9EB 4ZLPA 1WWHA 3SCKE 1S6PB 1VC6A 3UDLA 1T05A 3N5BA 2K8GA 3NG8A 4HTIA 4ZK7M 5DLGA 1N56A 3UE2A 1NAQA 4YB7A 1FRIA 3QIPB 4BCAA 4AL6A 3EXCX 4X4NA 1LKZA 3FFIA 1QUVA 5F0UA 5A8KB 1VQPS 2CQ4A 1TL3B 2GO8A 3UQSA 2DNYA 2YNGA 4KQZA 1BQXA 1TKXB 2JZ5A 3DLLQ 3S01A 5F8JA 4OHXA 2CRLA 3FRYA 3O8WA 1Q8LA 3AB2B 2LEBA 3DRRB 1RTDB 3ISZA 2BV3A 4UUXA 5A8WA 5DG9A 4J9SA 4C3LA 1VQ8S 2FDNA 3F44A 4X64F 4QOTA 4FXDA 5GADI 2IFXA 4NLPA 1VQSA 5B0BA 3NMAA 1FKOA 1HNVB 1HI8A 4TKTA 4ED5A 5KFUA 1MROA 1QAXA 4DL7A 2JWNA 2B3TB 2YNFB 3O3LA 4A8FA 3V5RA 3RBDA 3HT3A 1FNXH 2BOPA 1SC6A 1OO0B 1V9OA 3D54A 2RD5C 3K5NA 1UJ6A 4NYOA 1VBYA 5LXRA 2RKIB 4KSEB 1RT3A 3PO5A 1HBUA 4B3MF 2CJAA 4ECUA 3PW5A 2J5AA 4K4YA 3H5YA 5C25A 3MEEA 3FNNA 3MTJA 4C97A 1FXLA 5AXKA 1HYSA 3MMCB 1F5BA 2VG5B 1FO1A 1HWJA 2MY7A 4YR3A 1N34F 1U4BA 1U1PA 1BWEA 3T6BA 1IKYA 3E51A 4OX9F 2PC6A 3DLKA 2C22A 3HPOA 2NSBA 2R8JA 3M32B 3KOAA 1YG0A 3E01A 3J7ZT 2BE2A 2QMXA 1GX6A 4F4KA 2J6UA 2J6SA 5D78A 3QAEA 1S0VA 2AJ0A 2GFFA 1JLGA 1CC7A 1RA7A 2X3GA 3DOLB 4IG3B 3W2VA 4DLEA 5HLFA 2F9JA 3DYAB 4WXWA 4U9RA 3OUYA 1RP5A 1H7WA 2HHPA 3BQ2A 1HHTP 3K57A 2A2CA 1C4CA 1LOUA 2MJUA 1NO8A 3FSXA 3FZBA 4DQSA 4FN5A 1TKTB 2COLA 2QA1A 3RRKA 2MKIA 3RRHA 2ROEA 4AYBD 3VAIA 2DCLA 1X9SA 1T05B 2XY7A 2MQLA 1AW0A 2P5VA 4PKDB 4PWDB 4I2QA 3PW4A 1H2VZ 2EFVA 3GFYA 3HHLA 1YRXA 2DNNA 1TL1A 1C0UA 1FJEB 2DNOA 4WKYA 1Q8BA 2YNGB 4HT7A 4WIIA 2G9OA 1UVJA 1JNRB 4WK1A 4TXSA 4IFVA 2K2PA 2ABYA 3PFEA 4OZ5A 5KOWA 2Y1JA 2CQIA 2ZITA 5I42A 4X2BA 2ZHAA 1ZM3A 1R89A 2XS2A 3MMJA 3DU5A 4ECXA 1V6HA 2HFZA 5I4MA 3BSOA 3BO2A 5C42A 5LSOA 2ZKTA 2GMHA 2K7JA 1MROB 1U7LA 2F8HA 3H8YA 2LYVA 3EYZA 2R2TA 2VQEF 2BJDA 4RX6A 3DFEA 3K59A 3PKYA 1K9MT 2VA2A 1R27B 1RT3B 1XR5A 3MMBA 3HHNB 2VC1A 2XO7A 1QSSA 2V8DA 5KG7A 5C25B 3MEEB 3RAXA 3LF0A 4OI2A 2Q1LA 5KG5A 3CD7A 2DNHA 3H20A 4TY9A 4ECZA 1S0OA 2GO9A 1RISA 4IOCQ 1DRZA 3M8PA 4YQWA 4HEA9 4O4GA 2QLWA 5KT6A 5D4PA 4B9LA 4LSLA 3LQVA 2NQPA 3DLKB 1R0AA 3SSRA 1RK8A 1SIZA 3MGJA 3E01B 1GNKA 3DC2A 2EKYA 2XG8A 1TK5A 2HPUA 2MKSA 1M5OC 4C0OC 4KFBA 5K9FA 1WACA 2FJEB 3B8HA 1JLGB 3NLCA 1SJ1A 4NL5A 1XWLA 3HVTA 4WFZA 5D77A 3OHAA 2HHHF 3W2VB 5HLFB 1HWLA 1NJIT 2I5JA 5D4NA 4NLTA 1DQ8A 2N82B 3H4DA 3MM6A 5HMWA 3CC4S 1SJ3P 2UUTA 4DQRA 2L41A 2EFQA 4CNZA 3CCQS 2VBYA 2CYYA 4ELUA 1P1TA 1T02A 2P9GA 1N4LA 3O1LA 5ADZA 5KFBA 1IKXB 3M9OB 1DHMA 2DNPA 2M7SA 3LANA 5CH7B 1TL1B 1C0UB 3X3UA 4PG8A 5KFQA 4U67Q 2AD9A 3GG0A 3C6TA 4KE5A 5KFAA 1RT5A 3TOQA 3VZIA 3U7JA 5J2NA 3D0GE 4CO1A 2B4PA 2XY6A 2HS3A 4IFVB 3DDKA 3SZ2A 2BW2A 1H2UX 5I42B 1R6YA 2DGWA 3FSYA 4FZVA 4C0HA 1RGVA 5JVGQ 4DSEA 2DGXA 2XMVA 5F8IA 2APOA 3RW6A 2Z2LA 1FXDA 5DG8A 5AXLA 4YUDA 2ASYA 2HNZA 4IG0A 4KO0A 2EK6A 5CQGA 4CNYA 4OHZA 3PV8A 1NKCA 2EBGA 4WXOA 3VCDA 2POKA 4NPOA 4CH0S 4QR0A 2FJBB 3MMBB 4ED7A 3SV3A 5KFIA 4LF9F 2R7UA 1FVSA 2W9BA 4J9NA 4YY3F 2KYZA 4JI5F 1TUVA 2DVIA 4EBEA 1WNEA 2ERRA 2B9XA 4I1TA 3HHLD 4R0EA 4O3OA 2XMKA 4O4GB 2VUGA 3NRBA 1U6FA 1MU2B 2LEPA 2OKQA 1DLOA 1NHUA 3SSQA 2WSFC 2CPHA 5EDWA 2BYCA 3M1VA 4D3HA 4PXEA 1YSJA 3IN5A 2NXUA 1V3ZA 1S79A 2OAUA 4FVCA 4KFBB 3KLFA 4G1PA 3OVBA 3RR8A 3CULA 2A10A 2IHR1 3CIZA 2YKMA 3H98A 3G8TA 2VA3A 2BZ2A 4DV5F 1P1LA 1S9FA 1N52B 4F25A 3MUVP 3LGMA 4UQTA 3MM6B 1CC8A 2BQ3A 4QPTA 3KLEB 1KD1T 1QAYA 2GGPA 2P6TA 1ZAXA 2F1FA 2W9AA 1TK0A 2W4DA 2OSRA 3N5FA 1T7PA 3WDOA 1HNIA 3GIJA 1XR7A 3UFCX 5KFLA 3BJYA 4PR6A 2CQCA 3NS5A 2DO4A 1Q16B 5IWAF 5HMZA 2YKQA 4RNNA 4C3KA 1RDRA 2AGQA 4JI3F 1RT5B 5J2NB 3HVWA 4RNFA 3K0JA 4HI1A 2KYXA 4K59A 1KQKA 2DR8A 4DLGA 4N41A 5GVQA 3CUNA 3FDSA 3MPYA 2LEAA 3MR6A 4J9LA 4OJGA 1QAIA 2JEIA 1GT8A 3OXLA 2IYIA 2ZVSA 1WELA 1MNEA 1NU4A 3I9ZA 4CO4A 4ECTA 4HHJA 1H0HB 2DRBA 1FE0A 3IXQA 4MK8A 1GTEA 3H4BA 2PT0A 3SYZA 2F3JA 4FNIA 1REVB 5J2QA 5KFCA 3T9ZA 5KFYA 3GR1A 3IGVA 2HNZB 3M8SA 4B3RF 4IG0B 3SCIE 2LCWA 4KO0B 5KG3A 1KS2A 4U6PA 1L3VA 2UXBF 1S97A 1DBDA 3MMAA 1HPZA 5DDQC 5CYJA 5GAEU 4YFUA 3G6YA 1RTJA 3H59A 4GMKA 4A8XA 5LJ3Y 1M5SA 1E6YA 2VFUA 1JKHB 1X5OA 2F9DA 3CO9A 4QBUA 3KJVA 2RDIA 4W90B 4JUZA 4EZ9A 1NRKA 5KFVA 3GR0A 1IQZA 2FJVA 3D0HE 4XK8C 1QY7A 2LU2A 5BYSA 1YVFA 3N6MA 2OSQA 2FC9A 2C3YA 3Q24A 1BLUA 2IVMA 4P7VA 1X4FA 1DLOB 2KU7A 3LP2A 3VAMA 1BQNA 1HBMA 1TQLA 1IJEB 3ZZZA 2N3OA 3M1VB 4K4UA 5LL6d 1Y00A 3G6ES 3KLFB 3CF5Q 3EXYA 4ED3A 2OMOA 3FEZA 4R5PA 1FEEA 2YKOA 4OFZA 5AE2A 4X4OA 4F02A 4ZPVR 5B09A 4IDKA 2NPIA 1OWXA 3I87A 3OTCA 2ZM6F 2MKKA 5E3CA 2CVEA 4JI4F 2GGPB 1UA0A 2O01C 3AA8A 4NA2A 1HNIB 3PW2A 5IM0A 5E5NA 1G3OA 5E41A 3CCLS 3R27A 1O8BA 4Z2XA 3JSBA 1FNOA 4G1QA 4CTAB 1LV5A 3H25A 4CI0B 5F8LA 4B9SA 1U8SA 2MSSA 2PD1A 3FEYB 2DR9A 3HK2A 3JTPA 3CCMS 1FF2A 2DT9A 3DCAA 3F73A 3M30A 4KIAA 3TA2A 3P5TL 3TAQA 1U1KA 4ZVEA 1GQEA 2DR5A 2YH1A 1S6QA 1U45A 1W2IA 4PG6A 1D9FA 4HI2A 1VLYA 1YQHA 3GQCA 3IWNC 4KC5A 1N0VC 3BEGB 4ILLA 3T6JA 2E5LF 3K8WA 4NCGB 2AYGA 2CQBA 2HLTA 1ZOTA 1UFLA 3QYYA 2P6SA 5J2QB 2FHMA 2NUUG 2MZ1A 2HHWA 2VQFF 3K5PA 1K1QA 1RTJB 3MM9A 4OJ1A 2OH2A 4DFPA 4HLBA 3NCQA 2V94A 2UZAA 1QSYA 5LSRA 2YKNA 2ILYA 3MM8B 2R8IA 3CC2S 1A7GE 1IN0A 1U48A 1GX5A 2D3UA 2FGOA 2MKJA 2KDOA 1JXLA 1S1VA 3OR1A 2JDJA 4XPCA 1F9FA 5A2QY 4CQ1A 5G4DA 2E9ZA 4FF4A 3LP2B 1BQNB 1HBMB 5IFMA 2XLKA 1FEHA 1DTTA 5JUMA 1S10A 2DGOA 1MWZA 1HWIA 3JSMA 1X5TA 2RMLA 3HHEA 2JVOA 1SL2A 3AAWB 1JNZB 3PX6A 2ZOMA 4R5PB 2BQUA 2BJEA 2P9CA 1YJWS 1WHXA 4O0IA 4UUWA 4K4XA 2OIHA 4IDKB 3BN4A 1Q1KA 4FF2A 2KTQA 2KFNA 4AFFA 4USHA 4J9PA 4QR1A 2ZBIA 2O67A 2HZCA 2LA4A 4WJBA 4DR1F 3H5XA 4JI0F 4MIWA 1SH0A 1VJWA 2CPIA 3HHKA 1U1MA 4HVZA 3BGUA 5MLCV 3MOJB 3BR8A 4O3PA 4HTJA 3QIDA 2XGQA 2HAIA 1FKPA 2B7CB 5IM0B 4O23A 3GV8B 3F56A 4I64A 1YHQS 1H6KX 3I4PA 4V19X 3GB0A 2NS1B 3PXGa 5LMUF 2EFOA 3GMGA 3LAKA 4G1QB 2ZNZA 4XDCA 1EETA 5SUHA 1UJ5A 1Y3KA 3PZPA 1KLMB 1Q7YT 2QLXA 2M2BA 3M30B 1SUQA 3K7RA 4MTPA 5GAEI 5F0WA 1FRJA 4L3NA 1LWFA 2IJFA 1S6QB 3FMWA 4OI0A 3DLJA 4QWCA 3TRGA 5MAOA 1C1BA 3MURP 3PVXA 3N6NA 5KG0A 2V9KA 4K5SA 3TARA 2KKHA 2KT3A 5HI7A 4H4KC 1HBOA 2CQDA 3GYNA 2XLJA 2P9EA 4FF3A 3IRXA 3J7YU 3TYTA 1WEZA 2X1GA 4A8MP 4H4OB 3CWJA 4WU2A 2PMZD 5K8MA 4B9UA 2B51A 4DR5F 1L3TA 3PFOA 3LGNA 4RW9A 3UW1A 2E1CA 4DSIA 5JVHQ 1GTHA 2FHJA 5B0FA 5KAKA 4ZP8A 1YIJS 4OHVA 3W3SA 2HFNA 2RNEA 4WE1A 2JSXA 5DG7A 4AE5A 3OTDA 4RW7A 5KG6A 1RYRA 4Q8EA 2B6AA 4DF8A 1NK9A 1X0PA 4B17A 3T5JA 4WFXA 1NHVA 3OR1B 3DOKA 3DRPA 2YKAA 5B0CA 2WRMA 2QA2A 1JJHA 1YJVA 2QV6A 3UNGC 3N79A 3GSDA 4C8NA 2HHUA 1LW0B 2ADCA 4MK9A 1FT8A 3VR1A 3JSMB 4Y34A 3M2UA 1KFSA 5G0RA 1UMJA 1S9EA 1X4DA 3OFFA 1P27B 5KFJA 3IRWP 2AX0A 2J7UA 2LU1A 5H9EJ 4KHRA 3MZIA 2HFOA 1JJ2R 3I96A 1RQ0A 4DQIA 2K1RB 4FBUA 2Q6CA 2DJWA 4QIGA 4NLVA 5A8KA 5M2PA 4A8SA 4O3NA 2RILA 4L72B 2GIRA 1F60B 2WOMA 3AJ2A 2LQ9A 5LSLA 2DTJA 2ZOFA 4DUZF 3M6XA 3V6HA 2VZ9A 4DQPA 1FKPB 1M1KT 4K4TA 2XI2A 4DR3F 3ZZPA 5D4OA 2HVHA 3MI7X 5E3QA 1PGZA 2XLIA 1KVIA 3GG1A 2CPZA 3E2EA 3T5KA 1JWWA 2XI3A 3CDUA 5D8HB 4LIWA 2IA6A 1SUQB 4IQXA 3P49B 2R7RA 2LKZA 3D1HA 1LWFB 1UVLA 2PIIA 4RWXA 4F50A 2VPYB 3CGIA 4LF4F 1T94A 4IOAQ 2XB2D 1Y7PA 1JLAB 1IKVB 2N7CA 3JSYA 3THPA 1M5VC 1HBOB 1HNXF 1U09A 3IRXB 2ATLA 3PO4A 2V0NA 2ZH3A 1ZTTA 3S7RA 2RQMA 1NK5A 1S1WB 2V2KA 4ZCIA 4NLSA 4QIEA 3KG1A 1VBXA 3TA1A 4MK7A 4X66F 1SKWA 4OLOA 1MW7A 5C24A 4Q8FA