4D3GA

Structure of psta
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
78
Chain Sequence
HMKMIIAIVQDQDSQELADQLVKNNFRATKLATTNTTFLCGVNDDRVDEILSVINQTCGNRVGGATVFVMPVDAFHQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex Structure and Biochemical Characterization of the Staphylococcus Aureus Cyclic Di-AMP Binding Protein Psta, the Founding Member of a New Signal Transduction Protein Family
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
molecule keywords PSTA
total genus 17
structure length 78
sequence length 110
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4d3gA01
4WK1A 2PIIA 2J9CA 4CO1A 4CO5A 4E98A 1V9OA 1V3RA 5D4PA 2J9DE 1Q1KA 2XG8A 2GX8A 1VFJA 2EG1A 3N5BA 1UMJA 4OZJA 3T9ZA 4YB5A 3X3UA 3OPKA 2NS1B 1VHFA 1J2VA 3AA9A 1H3DA 4USHA 3BZQA 2NUHA 1NZAA 3TA2A 4CNZA 3HLUA 1GNKA 2XZWA 1O51A 5DRKA 2O67A 3O5TB 4C3MA 2O66A 4OZNA 4NYOA 4CO2A 5DS7A 4CO4A 5D4OA 3NCQA 3AA8A 4USIA 3O8WA 4YB6A 1UFLA 5L9NA 1HWUA 2ZFHA 2CZ4A 3MHYA 4R25A 1V6HA 1NAQA 3NCRA 2V5HG 3AH6A 2XULA 1P1LA 1V3SA 2DCLA 5D4NA 1NH8A 2E66A 4CO0A 3CE8A 4C3LA 4YB7A 2NUUG 1UKUA 3TA0A 1XK8A 1O5JA 2XBPA 4CNYA 4OZLA 3AHPA 4C3KA 2EG2A 3L7PA 4WK3A 4IYQA 1QY7A 2GW8A 4ZK7M 4Y6IA 3DFEA 3LF0A 4CO3A 3GSDA 4RWXA 4AFFA 2VD3A 1KR4A 3NCPA 3M05A 4NYPA 2RD5C 4RLEA 1OSCA 2ZOMA 4D3HA 2JJ4D 4RX6A 3TA1A 2J9DA 1UL3A 4D3GA 4RWWA 2Z0GA 4Y65A 4USJC 2J9EA 5D4LA 1PILA 1NH7A 2GNKA
chains in the Genus database with same CATH superfamily
1SIZA 1RHKB 4C8KA 4NXMJ 5F0UA 1IQZA 3IM8A 4E98A 3K57A 4TQSA 3AQPA 4H4OB 3G8TA 1S99A 1OYEA 1HNIB 2DIVA 3B4MA 1O6XA 3CJQA 3HVTB 5D4PA 2BJEA 2LVWA 1VGYA 4DFJA 1BE4A 1T9VA 1PJ6A 4JI2J 2XS7A 3MM7A 2QFIA 3C3LA 1UMJA 2V2ZA 3JYTA 3V5RA 1NK5A 2UUAJ 2VV5A 3JYTB 2CJAA 3QO9A 2AWZA 5DJBA 3KNAA 5I3UB 4J9PA 4HVZA 2NS1B 4HHHA 1GMWD 2XI2A 2VZ9A 4MIBA 1JKHB 3R5GA 1SH3A 3AOCA 3POTB 4O4RA 5DGBA 1SJ1A 4IOCQ 5L1KA 2C2RA 2BJ7A 2UUWA 2OTLS 1MLAA 5C25A 4O3QA 4I2QB 1HQUA 5B0DA 2CDRB 1RP5A 3I0RA 2BACA 1FX2A 3M8YA 3RBZA 3GU0A 2Y1RI 3D9BA 3H5SA 1AYEA 1EHWA 1M5VC 4RW7B 2YNHA 5DQIA 2XC9A 4TY8B 1SV5B 4NXNJ 1VK8A 1RHQB 1T9XA 4UOGA 2OUGA 1H7XA 4QIEA 4EGLA 5E3RA 2QA4G 3HSGA 4H4KA 3DI6A 2KYXA 3HCXA 2ACYA 5KG4A 3R97A 1QTMA 4P7TA 3GWCA 2HBZB 3CO9A 3PRBA 3UN2A 4OYXA 2HS0A 3G6YA 2APOA 2ACMA 1Y7PA 1U49A 1AB8A 4UOFA 2N7YA 5ETMA 5KFKA 4NI2B 2NPIA 2QZ8A 2V63A 1WDDA 1NJXA 4I7FB 2Y0SD 1MN9A 2FHMA 2OEMA 4OZNA 5D6GA 4F4ZA 3PX0A 1X0FA 4NRTA 1XR5A 3MCSA 2OFGX 3EYZA 1TZ0A 3DRXA 3M30A 1HARA 4OJGA 2XCAA 1D0EA 1H2TZ 1XNRJ 4OFZA 4ELUA 2VOPA 4DMZA 3T5KA 2V4JA 1T9YA 2M9KA 1PIEA 1IKWB 1DZ5A 4DSJA 4LREA 2JHEA 1P8GA 2VKZG 2FIUA 3MMCA 4WFYA 2Y1JA 5F9LA 3TVYA 2HFVA 4LRAA 5FD1A 4LMZA 2C3OA 1BWVA 1CJKA 2IAJB 4ZHRA 1W25A 4ZLPA 3GG1A 3OSPA 1WHWA 4RNNA 3C15A 3DM2B 4OI6A 2BYCA 3I6PA 5ETSA 1LWCA 2W8LA 4LSZB 1FEEA 2NZCA 3FCVA 4PG7A 4UF4A 3ENQA 3NOGA 4ZVOB 2V8GA 3JQMA 2XS5A 1T9WA 3FK4A 1UCNA 1NB7A 2IM2A 2QT7A 1FRHA 2G9OA 2LECA 2YBVA 1VJQA 4OZ1A 3TO8A 5BXIA 2XMTA 1VBXA 4RU2A 2L9NA 1K1SA 3HVAA 1RABB 2AF6A 1HKAA 5KFTA 1SKRA 1N0VC 3ADAC 3MD1A 4O44B 2ALYB 2GJ2A 1T0TV 2OO4A 3IG1A 1VBZA 4GMKA 5L39A 5H9FK 2G0CA 1HBUA 1ZAWA 4B3TJ 2XNRA 5IZHA 2F4FA 3ISZA 2R2TA 2UXCF 4G1IA 1LWFB 4ZCKA 1YDLA 4FYYB 4OZ0A 3MMAB 2X1GA 3CCTA 4M8LA 1REVB 1TL7B 3JAMU 1VQ9S 1U24A 1XQIA 2DGWA 3G87A 1VQ7S 1UL3A 1I1GA 2GC8A 3OL6A 1HNWF 3DDNA 4UOCA 3LALA 3SCJE 2HG4A 1OSDA 2IYIA 2QMXA 5GADU 2HSEB 4ED2A 1VQ5S 1NZ8A 2AT1B 4TN2A 3IAS9 3T1YJ 3RAXA 4A8KA 3R1LA 2Q3PA 1AA1B 2C3YA 4CT9A 5BR8F 1R8HA 2IIHA 1TKXA 2JH3A 3DOMA 2IC3A 3HX9A 1W2BR 2GGPA 3A3OB 5LSRA 4X62J 1RWXB 1V3RA 3OTOJ 1SL2A 5IT9U 3IRXA 3OTCA 3UO0A 5DDQC 4J90A 5HBMA 4DEZA 4DPWA 3K7RA 1D8ZA 4DXLA 1HW9A 1RYSA 3LANA 1RTHB 4JI1F 4LIRA 1T9TA 1VFJA 3GG0A 1T94A 2XNQA 4AQYJ 2ASJA 3TNVA 2ZJPQ 4LR7A 3N0VA 1F6TA 4OX7A 2N4DA 1NPPA 2W9BB 1RTJA 3I4HX 1YVFA 2H4WB 2A2DA 2MHEA 2J7UA 3QIDA 4OYZA 3T9NA 3M2VB 3K89A 3CJTA 3MPYA 4WBFA 2R8IA 3PEHA 2CG4A 2DITA 5J2QA 2FC9A 3Q8QB 2VOOA 2XLJA 2G1DA 3G96A 1BQMA 2O5DA 2X3GA 4DV0F 1XNQJ 4AL6A 1HNXJ 2E9TA 3K8WA 4WXWA 3QBCA 3MM5B 4DR3J 2GO9A 5DZ6A 2NXUA 3CJ5A 3K5MA 3LAMA 4RKUC 2HAIA 1F9EB 5LMUJ 2M5YA 3JSMA 4M95A 1K0TA 2QRRA 4MJKA 2NREA 1RWPB 1HR0J 3RB0A 3SBMA 1YQHA 4WYWA 1CEZA 2OMLA 2XZTB 2HVHA 3GCWP 4DV2J 1YI2S 1N5VA 2AJ4A 4ITSA 1FERA 1Q8IA 4Y0FA 3NAHA 3VALA 2WOMB 1IKVA 4O44A 1JLBA 3J7YU 1HW8A 2O66A 3HFVA 1HI0P 3K2YA 4BWMA 2W4PA 1HNVA 5EWFA 3WIVA 2DR6A 4DR4J 2XSJA 4DS4A 3U02A 2UU9F 4UOHA 2BE9B 5K5MA 2ZC3A 1ELOA 4G6VB 2P8IA 2HHUA 3JAMY 2KFNA 2YKPA 1KBRA 4KH0B 2YWEA 3GSIA 2D9PA 4MAKA 4P2FA 3CNQP 4DZ6A 4HHJA 5F8HA 2DNHA 1U0HA 5CABA 2ASLA 1RTJB 3CDAA 3EGZA 1GX5A 2FJAB 1F2HA 4FPIA 5I3PA 5HP1B 2WB4A 5HJXA 4IQMA 3MXHP 3TJAA 3AJ2A 3SCKE 3WDOA 4X4UA 1PSDA 2BBEA 1SJ4P 3HT0A 4KHPJ 3UPFA 2AMCB 3HFZB 4J9SA 1NSQA 3RB3A 2J6SA 5K14A 4YDXA 3CE8A 1QM9A 3GMGA 3MF5A 1X4DA 5KG5A 1VC0A 1HNIA 1RTDB 1RA6A 2C3UA 4LVNP 2PMWA 1NJZA 3BN4A 3BEGB 5IFMA 1C1BA 1ZM4A 4LT6A 4DV6F 1FJGF 4EMDA 2LQBA 3QT6A 1ZPVA 2CAJA 2CVIA 3F44A 4DR6F 2DNQA 2QA1A 1I3OB 3SI8A 1OS5A 4YB1P 2AJ2A 3MEGA 2C2NA 4JV5J 2Y0BB 3PFEA 1FO1A 3M8ZA 1FT8A 2V2KA 2BJ1A 4CH1A 1RT4B 5GVQA 2HHWA 2W7AA 4ED6A 3QIPB 1RWVB 2HBYB 1DQ9A 1LWFA 4NX9A 4ID5A 3L09A 3PIPQ 3R1HA 5T7LA 1J5EF 1TFWA 2ZBRA 1BGXT 2MKJA 2DGVA 2HVZA 2YVSA 4RW8B 1KD1T 2VBZA 3H59A 2CPZA 4IG0A 1Y9OA 4J9VA 5F3TA 1S0MA 4ZCMA 2BABA 3KFWX 5D0HA 4LRFA 1YWXA 3EE3A 3U1MA 3A3PB 4NLSA 3V4IB 2EFGA 4NLDA 5M2UA 1SC3B 1JJCB 3QJJA 1PILA 3Q2TC 2PDAA 3M32A 5JJBA 3DXBA 2QLJB 4GVBB 4ZOSA 4ZIWA 2KXFA 3M1VA 4KGMA 3W8GA 4JI3F 1DTTB 2OPRA 3DRRA 1RTDA 1FHTA 2V68A 4LF8F 2BMBA 2V2QA 1N8RT 4PQUB 1RADB 2BE2B 3L9ZA 2VPXB 3OV7A 1TL4A 2ROEA 4AUKA 4LRDA 3U1LA 2ZVIA 2DNRA 1WOOA 2EFPA 1XWLA 3PDNA 3I0SB 2BOAA 1K47A 1R31A 1V5VA 2ZHOA 3FMBA 4YMEA 1JLFA 7FD1A 4Q43A 1CS4A 1D9AA 1SL0A 3JQKA 5B0FA 1PYOB 3SDEB 4BCAA 2FVRA 2ADCA 1SB6A 1LK7A 3CTRA 2ZVSA 3N79A 2F8MA 3RGIA 1BLUA 1HYSA 2GZOA 1ZS6A 4OZ3A 1UPMB 2WCXA 4CM2A 1H98A 1SQEA 3E51A 5D78A 3TX0A 5A0YB 2ZH6A 1Q78A 4FKYA 3AB2B 1OO0B 2CYYA 3HLUA 4FF2A 3UNYA 3ZZRA 4P75A 2IA0A 1VQYA 4A8YA 1IBCB 2W01A 2J7WA 2A10A 4PWDB 1M5SA 3N6LA 1JLGA 3EDQB 4OI3A 4DX5A 3MMAA 5IM0B 2E44A 3H0PA 3MR7A 4TLQA 2R2UA 3OW2R 2YY3A 4OJ1A 2GVDB 2YNGA 2YPYA 4C3MA 2JLFA 3GR0A 3MEDB 3D7SB 2FJEB 2E7VA 2OPSB 1JLAA 2YWHA 4CO2A 4BBYA 1PC4A 1ICEB 1NCLA 4E8UA 4OYIA 1CQNA 4J5OA 3O8WA 3DLBA 4W92B 3Q83A 1RT2A 2AZ1A 1X5TA 1FE4A 5L9NA 3DYAB 5DDOC 2KH9A 2ASYA 2EW9A 3GONA 3GV8B 3GPAA 2AYMA 4CLYA 1XN9A 2R8JA 1YHQS 4C6AA 1CS4B 3TUZC 1VQ8S 3SQGB 4I4BA 2R8KA 3RR7A 2N82B 1V6HA 2MZQA 3H8YA 1NAQA 3CC7S 4LF7J 3MI7X 3U27A 1CJKB 2HQIA 4NPOA 2ZH7A 1FWLA 1QDUB 2M70A 2PA8D 3I5CA 1H6KX 1YGYA 4Z7YA 1S49A 2MQMA 3HZGA 3DCAA 4DV7J 3AH6A 3BBFA 5KFAA 3N28A 1JWWA 1LKZA 1NH8A 3MEKA 4KPCA 4K0KF 2IA6A 2Z2MA 2GGPB 3HZEA 1XMOF 3PACA 4N8NA 4CQ1A 4KY3A 3K5NA 1QAJA 2GS8A 1RWMB 3K5PA 4HH1A 4OZ5A 4IR9A 3NP5A 1RTHA 2CPFA 4C0BA 1B64A 1A0OB 1SJ3P 2B7BB 2WONB 1S1XB 1SL1A 1IKYB 3MM9B 4OHWA 3KLHA 1TUVA 4HI1A 4X64J 1G1XA 3M2RA 3CCUS 4MH8A 2X1AA 5LSOA 1UVKA 1X4FA 1WF2A 1KLMB 1U1RA 2VB6A 3IWXA 2CQ4A 3KLFA 3ENAA 4ZK7M 3GE9A 3CD0A 4IRDA 2RRBA 4F26A 1QAXA 2VDIA 3GIMA 1UWBA 1Y10A 2GQQA 4GVLA 2XMMA 2VD3A 3FZBA 4O3SA 4J9NA 1YRTA 1REVA 5KFCA 3PR4A 2JEJA 2Y3YA 3RB4A 2ALZA 4K4UA 3JSMB 3TVZA 4PWDA 1FNOA 2JSXA 2AIRB 3M6UA 3E8OA 1DBDA 3AD8C 1WC5A 3LTOA 3EVOA 2BKPA 3C66A 5AXMA 2MQQA 3P45B 2CPJA 1T03B 3TVKA 2DO4A 1RHMB 2A6MA 3DOLA 3LW5C 3R2CJ 2B5JA 3VAJA 5L1JA 3RRGA 3CF5Q 2J9EA 1F3VA 5D4LA 3T6BA 1U1MA 1JXLA 1KNZA 3OD2A 4L3KA 4ANCA 1WC0A 3M8QA 2DGTA 3G82A 5C24A 4YY3J 2KG0A 4I0WA 2AYBA 2V9KA 1YJNS 2PIIA 1TL3A 4DSIA 2J9CA 2V2VA 4CO1A 2LU2A 3OFGA 1H73A 4Y3CA 5DG9A 4U7CA 2XMAA 1HD1A 4C11A 4OV1A 1UTAA 5MAOA 2FDNA 4H4OA 4FS2A 3EMTA 1NK4A 2UUCJ 4IH5A 2OSQA 2RB7A 4RW4A 3CJKB 3TZYA 1DQ8A 3CJKA 2ZITA 2B6AA 1JIHA 1VBKA 2ZH8A 5KFSA 3E3XA 4CYUB 5LMNJ 4KFBA 3VQSA 3GFZA 3LH2S 1XERA 3RJMB 2W8KA 4I6AA 4JOUA 3BO4A 4WKYA 2ZZNA 1HLWA 4ILMA 1H3DA 3VVTA 1UZHA 2DT9A 3HHKA 2H54B 4ES2A 4F7VA 3SV3A 3CEDA 1S10A 4DFKA 3BN7A 2XTJP 2DY9A 3FNNA 4CLWA 4H54A 4GC7A 3A8EA 4DG1A 1O0PA 2W9CB 1U1NA 1R0AB 1VQSA 2KVQE 3LP2B 5KFHA 3KHLA 4UQGA 1D09B 1BQNA 4FXDA 5ETLA 4LF5F 1AUSL 3VWSA 2N3LA 1FKOB 2EXUA 1PG5B 3GIRA 2H51B 5ETOA 4CLLA 4ECSA 2XMWA 3ITHB 3JTNA 4N41A 1UA1A 2JDJA 2JLGA 1RKJA 4ZVFA 1HQEB 3O5TB 3O44A 1BY9A 1U2CA 5KOWA 2MQPA 4NZ6A 4NI2A 2DGSA 2ZUGA 1QSSA 3NY0A 4OYOA 3G8QA 4WE1B 4RUHA 1DJ0A 5B09A 2HGLA 4DFMA 2RIJA 4USIA 2HGNA 1APSA 4YB6A 5DQGA 6FDRA 1UFLA 3DI6B 2W2OP 2PO4A 1V5IB 1A9NB 2J8AA 1S6UA 2J0QD 5K20B 4EFAC 1ZH5A 3KLGB 4PG5A 2V6AA 3T3FA 2AP6A 1RT6B 3VTIA 5IT4A 4R25A 3BSCA 4FYWB 1JXEA 2K1RA 3ZC4A 2VONA 3BF4A 4DR5J 5SUHA 2KFZA 3RBEA 5T41A 2R7TA 3P5BP 2FJVA 4PUOB 2ZHBA 3SSSA 4B17A 4FXVA 4NRUA 5KG7A 4IFYA 2YKAA 4URQU 2HLTA 3UNGC 4LBPA 2KXNB 3ELHA 3C6UB 2FTRA 4DR5F 2DR9A 4OI4A 2BRKA 1PCAA 1IKWA 1C4CA 1UKUA 3PJWA 1VIOA 3EGVA 2NXEA 3I82A 3PEJA 1CG2A 1WF0A 2ZWPA 2HBQB 2MKYA 2LEAA 4M5IA 1L3KA 1LXNA 3UR3C 3ZNUA 2ZH5A 1FXDA 1HBMB 2PC6A 3OFEA 2GVZB 4MKYA 2KT3A 1X8DA 4FBUA 3WC0A 4HLBA 1Q81T 5KFZA 4ICLA 3CMQA 3DGPB 3QATA 2EWHA 3DLEA 3OXFA 3CMES 3CWJA 2XMUA 5ETVA 1U25A 5CCMA 5IM0A 3DDIA 2ILZA 3S1TA 2M8DB 4C8YA 2OLWA 2YKQA 4MTPA 1J5EJ 2FLNA 3PW0A 3UCUP 4QBUA 1RT4A 4OX9J 1MWZA 5L46A 4ERDA 1IJFB 4GKJJ 1C2PA 2ROPA 2VBWA 4I6WA 1VISA 5J1PA 2L41A 4B08A 4EBCA 2G1HA 5HQMA 2K7JA 1NSAA 2W2QP 1S77D 2CQDA 3EZ5A 4ED4A 1VDHA 3DN9A 2B0GA 4WU3A 5GAGU 3QQCD 4Y65A 3EGWB 3ISND 3B4DA 3UDEA 2W2MP 2DGUA 4J37A 2UUBJ 3R2DJ 1HQ2A 4OYAA 2ZC4A 4PG4A 2RKIB 2VFUA 1GXLA 4EK2A 4B9LA 1S5ZA 4DX7A 5D3GA 3OVBA 4RW9A 4A47A 5DO2A 5HVHA 5LMNF 3G86A 4WXOA 2YTCA 4TNOA 4DUZF 3CPWR 2BKNA 3LGNA 3VZHA 4B3MF 3PKMA 1NJWA 1IQTA 1KOHA 3VR1A 2JC1A 1KHWA 1TL1A 2HFSA 3BGLA 4CYUA 4DOZA 1L3TA 3I0SA 3OXGA 4K59A 3JSRA 4O23A 4AE5A 1S97A 2XS2A 3FVYA 4Z2XA 2VG6A 4ZN3A 4KPYA 2LA4A 4YY3F 2JEIA 3ZTQA 3M2UB 1YBAA 3BZQA 3T5JA 2KN4A 5F8GA 2A18A 2K2PA 3NS5A 4B9TA 1IUJA 4OLOA 1GNKA 4RW6B 1MG7A 3R9LA 1YBTA 2GHPA 3H2LA 4B3RJ 2ZBPA 2OD4A 2R42A 1O51A 3HULA 4PQAA 2IVFB 4JYAF 2M88A 1S9EB 4F2RA 4DJBA 4A48A 2KZZA 4A8WA 1B3TA 2WW8A 3V6DB 1U1OA 3AAWB 2R9LA 5L1LA 3V6DA 4P74A 1H7WA 1WUUA 4USTA 4C7QA 1RAJA 1GAOA 1UEUA 4MIAA 4Y2KA 2MQOA 5GAGI 2QC3A 3QIPA 2R7UA 3O6QA 2QO3A 1MMNA 2Q79A 2YNGB 2M52A 1H2VZ 1C4AA 2WSCC 4NL5A 2ZM6F 2FPHX 2WSEC 2R4FA 1RU1A 3EXCX 4QWBA 5KFOA 5F8MA 2UVWA 1MWQA 3TZXA 4GC6A 3IG1B 2XMKA 3R7BB 5E3QA 4OI1A 1N32F 2DYAA 4GO5X 3RAQA 4F04B 5H9EJ 1RA7A 2HURA 3LAKA 4U7UD 4XPEA 1SC1B 4RR5A 3P6YC 3W60A 3LA0A 3P96A 4ZIVA 2MDAA 2XLKA 3W9JA 2RRNA 2XCPA 3M9NB 5KTQA 3PCOB 2BV3A 3HSZA 5CYMA 3RRKA 4C8LA 1QJHA 3ZTSA 2V9WA 1Z1ZA 4ZCLA 3NBPB 4KE5A 4RJVA 5HP1A 4I1TA 1S1VA 3TOQA 2IMOA 1DTTA 4ANDA 2E5LF 2I8EA 1FXLA 1K0VA 3RYLA 1TU0B 2VUGA 1FKPA 4P71A 3M32B 5D77A 2Y8YA 4EWTA 2BX6A 3FFIB 4CLTA 4ZPCA 1TKXB 4X4SA 3HJFA 4WF9Q 3R6LB 4CRJA 3KLVA 2FZCB 2R7RA 1N6QA 2MKSA 1YJVA 2XQCA 2BQRA 2E5LJ 1F2GA 4Y2IA 3MCOA 3OT9A 3UE2A 3W2VB 3T1YF 1RLCL 4OZLA 4EO8A 1U47A 5GMEA 3BB5A 2C2EA 4F02A 4RNMA 2V8HA 4LRCA 3CJ4A 3B6BA 4N5SA 1TV6B 4DCJB 2FJBB 2W25A 1AZSA 3IBWA 3D2WA 1JK9B 3LP0B 3PRVA 1WEYA 1DTQA 2OPQB 2FC8A 2YNIB 3CVKA 3M9OB 1VBYA 3HSDA 3KLIA 1SC4B 4U95A 1Y5NB 2IFXA 1UZDA 3KLIB 1RDRA 2I6WA 1KFSA 5A6WA 3UI3A 1EX8A 3X1LB 2PFFB 4C8OA 2HNZA 2L9DA 4Y2CA 2IM0A 1JLGB 1SV5A 2DO0A 3GTYX 4RLEA 1RUSA 4ZVUB 3NNHA 1NHKL 2ZM6J 4ALZA 4PPDA 3M2RB 1UAWA 3RG6A 1XR6A 1VQ4S 4KC5A 3IMQJ 1BD6A 3GB0A 3HHLA 4Q7AA 4I2PB 3KLFB 4RNOA 3GYNA 2U1AA 4DV1J 3EDRB 1TKTA 4DHVA 3BDPA 2X1FA 3DOKA 1BUXA 1PBAA 5KG0A 4DQPA 4NCAA 1KN6A 4JYAJ 1D1UA 1RBOB 4ZP9A 2YKNB 3DC2A 4HDHA 1WSRA 1HNZF 5HLFA 3G8SA 3CXCR 2H5IB 3GIJA 3SIPB 2BANB 4IH6A 3CDWA 1WF1A 1VQOS 5LL6d 2J9DE 4OYWA 1PGZA 1N5TA 4DN9A 3M4XA 1U48A 2VJUA 4CCHA 3GIKA 5LM7E 3S6EA 2KJWA 2FHOB 1YRUA 4K8RA 4L73A 5HMXA 5IQQA 1QTNB 4OZJA 4O0IA 1TUGB 3IBCB 1KP6A 1S76D 2Z58B 1DURA 1HD0A 4F3MA 4TVAB 2MKCA 2VA2A 4JI7F 2G4BA 3CGIA 1WKKA 3H42A 3MCMA 4USHA 2QA4S 3ZZYA 1XC9A 1XBWA 3EWGA 1XNRF 4PQUA 4YR3A 2V4RA 4CTAA 1NDPA 1HWLA 1S7HA 1RSCA 3MD3A 4I64A 5HQ8A 5KFXA 1S9FA 3HXMA 4Z7CA 3GIIA 1M5OC 2GJFA 1M90T 1I94F 1JLCB 3B78A 1XTZA 1IBKF 1UEKA 3TP2A 4NLVA 2GAGC 4RBVA 3A13A 2LYVA 1GX6A 4CH7A 1NM2A 2PN6A 3SCLE 3GFYA 2YQ0A 3ITHA 1PC5A 1JNZB 4J7CA 3MUVP 5ETNA 2UXDJ 1EQ0A 4DF8A 3OFHA 1TK0A 5F8LA 3US5A 2B43A 1CC8A 1UWBB 5B7WA 2B7CB 3MEGB 1WEXA 3MM8B 4NYOA 4DSKA 4JI7J 3NWRA 1M0SA 3IN5A 3MR3A 2UXDF 2YNFA 2CPHA 3PJ9A 3MWBA 3BGOP 3D0IE 2XMJA 3C8YA 1U2FA 2KI2A 1HWUA 3N9UC 4WWSA 1T11A 3DNCA 2ZE2B 5L38A 2BQ3A 4DV3F 3CCZA 4F4YA 1W2IA 1Y5IB 5B08A 4N56A 4YDDB 2RS2A 1NSKL 1CPZA 1FI4A 4AXIA 1W26A 3PKYA 5KT3A 2O3DA 2VU5A 2WVFA 2OPPA 2RU9A 1Q8BA 3D6MB 3SMZA 2QTWA 2RF2A 1JLEA 2CFXA 3QPIA 4L72B 2RJZA 3C6UA 3D3CJ 5K9FA 3THTA 1ZAXA 3UWTA 3W65A 5DM6Q 2Q1LA 3PIOQ 5L1IA 4WZQA 4ECTA 2BJ3A 4UY8T 2ZEJA 4I69A 1G4CA 2JC0A 5K14B 1RJJA 3CSKA 4ETXA 2Z56B 2WB1D 4YB7A 2ZDOA 3Q89A 3ET6B 1R8CA 3QZ7A 2XY6A 3VAIA 5DDRC 1RT5A 2AGOA 3PYGA 2HQDA 1HPZA 3OXLA 4C8NA 8AT1B 2LP4A 5CZXA 4LF4J 2Y1IA 4DR4F 5J2MB 3NOCA 1FD8A 3I9ZA 1FX4A 2EG2A 2HHPA 3Q8UA 5U47A 2F7VA 5KFUA 1Q82T 2D9OA 2CZVC 3DGVA 3DMJB 3OTBA 4KTQA 1NJYA 4A46A 4FDFA 4CI0B 5T14A 4ECZA 2M2BA 3Q8VA 5ETKA 1BWEA 4NCGB 2MKIA 4LFAF 1OQ3A 1SC6A 3C6TB 3JSYA 5HVFA 1RHJB 4WIQA 3R5CA 4DV1F 5CAAA 2FD2A 3HHDA 5J2PB 3PO4A 2ZOMA 5C2GA 2WSFC 2Y9HA 3R5AA 2KL8A 4QCLA 5EGYA 2KT5A 3D6HB 2Z30B 3DLEB 3FRYA 2CQ3A 2DNPA 1BQMB 2Z0GA 4GO7X 1MU2B 4XDCA 3W5ZA 2OHDA 3HK2A 1FJCA 4LF6F 3MMBB 4GKKJ 3I96A 2UUTA 5F0WA 2AW0A 2BW7A 3IS9B 4WFZA 3M6WA 3Q2SC 2WVCA 2ZD1B 1HQUB 1D8YA 2CQCA 3TW0A 2CNOB 5IXUA 4ED8A 2L3MA 3Q8SB 4CO5A 1VRUB 1C1CB 2AEJA 1ZTTA 1FF2A 1A7GE 1SKUB 3KJFB 5CYQA 4F25A 5AE2A 5J1EA 3T1HF 1PO6A 2BE2A 1RXOB 2YPZA 1M5KC 1FKPB 4LQ9A 5KG2A 2LDYA 1VQLS 2XM3A 4E0DA 2QN6B 1RE1B 4NA3A 4LF6J 3N5BA 4B3OB 1UP1A 1N32J 4GKKF 4Y28C 2NLWA 3HHLC 3T41A 3BO2A 4DL6A 1TL1B 4BWJA 1K44A 1PJ5A 1T95A 4HYKA 3UVJB 3BV8A 5DG7A 1VQPS 2R7VA 4M5NA 4HEA9 2QYCA 1J2VA 1TAQA 2PD1A 1SJQA 2ZOFA 2XZDB 3M8PA 1QE1A 3QGGA 4OHVA 3R8YA 1VC6A 3HHNB 2H3EB 2O1PA 4FNHA 1KQFB 5H9FJ 3ZTPA 2RDDA 2BKOA 3F56A 5KG3A 2PGCA 4OJ3A 2FLOA 2FGOA 3BM7A 5GADI 3CDUA 2A6OA 2N4CA 3I31A 3MEEB 2FB0A 5B0GA 3ZTOA 5DQHA 4XAKA 1FNXH 3P49B 1AT1B 3UDCA 4KIAA 3M6VA 1TV6A 3IWLA 4ED1A 1FTRA 1OY9A 1S0VA 5FDLA 4PABA 2KTQA 3FQLA 2YKOA 5GMDA 1MMLA 4BDPA 3H98A 4MK9A 1E6VB 4C48A 2AYEA 4YS2A 5AE3A 1FTCA 2C2MB 2V8DA 3MM5A 2EBEA 4PG6A 5I42A 1FRIA 1EP4B 4WYLA 4L76A 1UFWA 1G6BA 2FVCA 3TQEA 4PEOA 4ECUA 1ZYQA 4H4MA 1WG4A 1Q8LA 4F36A 2KXHA 1EARA 1CJVA 1C0UA 3TZWA 4R5PB 1QUPA 1HMVB 2FHJA 3BS9A 3ONQA 3BYRA 2VFTA 1R8BA 3UVJA 2OSRA 3NMAA 1ULRA 1XR7A 3ETMA 4DV3J 5CYMB 4X64F 1CQMA 4FZVA 3BSNA 3G6XA 4PWUA 2C3MA 3UD4P 3QYYA 2DHXA 3DHWC 1YBUA 1KQGB 5CH7B 1HHSA 1FRKA 2HNYB 3THPA 2YX1A 3PVXA 2LA6A 1K8AT 4M1KA 3BPSP 4CDIA 1LFPA 3HFKA 3P4UB 4USUA 3TA0A 1F3FA 2V4JB 3BQ0A 3R6GB 3T5LA 4LSLA 4K0KJ 1I6JA 4GKJF 1KVKA 4DV7F 1N0UA 2VL1A 4WP9A 5D8HB 3OFFA 3MMCB 4OX9F 4LFCF 4DUZJ 5DDPC 2AJ0A 5F41A 3VGSA 4W98A 2EK1A 5AJ3J 4W4MA 4JI4F 2WHOA 1EETB 5LT5A 3CD6S 1ZM2A 2QJ3A 1HWJA 4IO1A 7FDRA 4A8MP 4NLTA 4XK8C 4ED7A 3VAGA 1SXLA 4KYZA 3KUGA 2OP5A 4RWXA 4WPAA 5J2NA 2DVIA 3NCPA 2CNLB 3M7VA 5J2PA 4TXSA 4RBTA 2RD5C 4KV8A 4CLUA 1QSLA 1RT3A 4JI0F 2B3TB 4KRWA 4HHUA 1RT3B 2QL9B 2CNKB 2HWIA 1F60B 1Y5LB 2RILA 3CJ8A 3BH6B 1IM6A 3JS9A 1S4FA 2F40A 3GR1A 1KTQA 3CC2S 7AT1B 2VH7A 1Q95G 1PBUA 2KU7A 3AODA 3QWUA 2D3OR 2KDOA 3N6MA 4LBHA 3S7RA 2HBRB 1X5SA 2LXIA 5HROA 4WK1A 4IRCA 1Q53A 2J6TA 1N5SA 4EBDA 5EUHA 3HO1A 4RPFA 2UZAA 3R3TA 5KAKA 1B0VA 1NKEA 1LEOA 1X31C 5MLCV 2WVBA 4ED3A 1S6PA 2N3OA 2QYGA 3MPWA 2I5JB 2JVRA 4UTGA 1DQAA 1WWHA 3SQGA 3WC2A 1VRTA 5KFQA 2B6AB 3ZO7A 5KFYA 5K8NA 2GMHA 3J7YI 1WACA 3ULHA 5F9NA 5M2RA 2MY7A 2IJRA 2YQ3A 3FSIA 4IQXA 2Z57B 2IC3B 3MAHA 2OFHX 1F0XA 3V6HA 4A4JA 4GVBA 2X1BA 2NSCA 1TELA 2CWXA 3VVUA 2PFDA 3CJSA 5E3AA 3KYLA 4QIFA 2JWNA 1M5HA 4IG3A 4ZPAA 1QVFR 1NBEB 4F4KA 4M5MA 4TYBA 3OHBA 4ILLA 2KFYA 2OI2A 2AU0A 1YJ7A 4DL7A 3NGKA 5G0RB 1NJIT 3LQVA 2B9WA 2HWTA 1RT1B 2BA9A 3AB4B 3BGRB 3F41A 5DRKA 5KFBA 1WC6A 4UT4A 5LSLA 3PW7A 4GRSA 1M1KT 1YIJS 2P2CB 4G3IA 1HQEA 3I87A 1RTZA 2DXDA 2NXCA 1AXQA 2MKHA 1NK7A 2J5AA 1J27A 2QSWA 2VC1A 3CJ0A 2DHGA 3QLHB 1RBAA 3FC9A 4RW6A 1HBUB 5DS7A 5KFRA 5HMZA 3FSYA 3C2PA 1RAGB 3NNAA 1FA0A 1NMEB 3GZ7A 5KFNA 3AQOA 1JQGA 2GQ2A 3L7OA 5HSPA 5LXYA 4K4TA 4NLRA 3SFUA 1IWAA 2IDEA 5C42B 3VCDA 8ATCB 4O4GB 4MMOA 4C98A 2GHVC 4ZJQA 2VICA 4G1QB 3CCVS 2UUCF 1R0CB 1TKZB 4OYPA 1X9MA 1S4EA 3QNWB 1PJ7A 1WHXA 1JLEB 5BYRA 2UV8A 3J7Z5 4QYRA 5KFDA 1KTVA 2JRSA 1RAEB 2ZBQA 1LXJA 1U8SA 1REGX 1V3SA 2DCLA 2EFQA 2OPPB 3NBPA 1YRXA 4OX6A 3CMAS 4IFYB 4ES1A 4UZBA 3AY0A 2HWHA 2MEWA 2GIQA 1C1CA 2RQKA 1AFJA 1U0SA 2VFSA 2ZKUA 3QAEA 4C3LA 3I5AA 1AUDA 2NSBA 1Q79A 5HQLA 3TEHB 1CC7A 5GAHU 3CCRS 4U9RA 2DKOB 2FY8A 4KHPF 3RW6A 3KLGA 1FE0A 4HACA 3PX6A 1XIQA 2EFOA 1RT7B 4LJMA 4Z37A 2XLIA 4B9MA 1QUVA 3H7HB 4FS1A 2O01C 1B4SA 1S48A 1WD6A 2OELA 3L7PA 4H4KC 4O3RA 1SJFA 1FDNA 2MSSA 5JXSA 5F3ZA 3QRQA 3OUYA 4KO0A 1EAYC 1Q7YT 1YZ6A 2LQJA 5E3PA 3DXSX 4KO0B 2HAFA 4CO3A 1RAFB 3IP0A 4MKBA 4F2SA 1FFWB 1JX4A 4LFBF 2HHSA 1KR4A 2GO8A 4ZVPB 4TYAA 1RI7A 1X4EA 1UJ5A 3CCJS 2V8VA 2G2ZA 1UETA 4RW7A 3MDFA 2WVDA 1RQ0A 2ZUAA 1NEEA 3IBFB 3MEEA 1DFDA 2KKHA 3GQCA 3H40A 3EXYA 1QVGR 3OTDA 1TMJA 2GVZA 1JKHA 2HRUA 2C2ZB 2ZHAA 4LF1A 5EX3A 4DG1B 2W9CA 2B4PA 4NLXA 4FF1A 2XGQA 1SUQA 3E01B 2YKMA 2B56A 3KK2A 1G7CB 2HK3A 4ZLJA 4B3MJ 1Q86T 3ENWA 2YNHB 1WEZA 3KG4A 3QRRA 3DLGA 4LF2A 5KFGA 3HT3A 2MZ1A 3KLEA 3RU0A 3JTPA 1HNXF 2HS4A 4NLQA 2I5JA 4IOBA 2JLEA 2D3O1 2RQMA 1RGVA 1U0HB 1B99A 1Z2ZA 4R0EA 1IN0A 1M1HA 3SSRA 3AFGA 1YX2A 2MHNA 3FUYA 3H2VE 3RAMA 4C97A 1G3OA 2NYHA 1YTYA 1N4LA 2DR8A 2Q6CA 1SKSA 4RNFA 2HYIB 3MMBA 2BDPA 1H2UX 3OPKA 3IR5B 1X0PA 1VHFA 1UVJA 1WI6A 3AA9A 3FBEA 3GV7B 4EYIB 1IBMF 4WU2A 5GMKa 2J0SD 2BANA 3M8QB 4JI1J 3M30B 5KT6A 3EUNA 2M3DA 3GJQB 1R27B 2QG9B 3H2UB 4QOTA 1LQ9A 2C1EB 3WZ0A 1EKSA 1FKAF 3MECB 2BR0A 3IO1A 1H0HB 1IJEB 3C14A 3KOAA 4FNIA 2D3UA 4RO0A 2LKZA 2OEJA 1S9EA 1LV5A 2R8GA 1CJUA 2PEHA 1ZETA 3HVWA 4JV1A 2C28A 4DUYJ 1GT8A 3KK3B 3WHIA 2WZ1A 5FJ4A 2JOQA 1NK6A 4NYZA 3LWLA 4WFBQ 4MK8A 2V69A 3W61A 4V19J 2ZOGA 3D54A 3KNGA 2IM1A 1B7YB 4CLSA 3MURP 3D66A 4Y00A 2DNMA 2WBMA 3QGPA 4X4RA 3K5LA 4URGA 1RAOA 3NLCA 3SQOP 1C1BB 3PTWA 1Q0NA 2RHSB 4MKVA 4K4VA 4FYVB 2R2RA 2LDIA 4DSLA 5A8RB 3JSBA 2JVOA 3AD7C 2DGOA 3V6JA 4NLGA 4QWAA 4ZMMA 5DZ7A 3HD2A 4OHXA 1VJWA 1BQXA 4TQRA 2CIMA 4BC7A 4NWBA 5A2QU 1FRXA 4TKTA 4WJBA 3V4MA 1U1KA 2POKA 3DLKA 1LWEB 4J9UE 5LXRA 2YKNA 2N7CA 2XGPA 1RT2B 4PCQA 2ABYA 1NHVA 2R7SA 4H4MB 1U6FA 2KT2A 3IR6B 2CPDA 4ZLLA 3C46A 3MR6A 3TI0A 3IFEA 5J1EB 3CO0P 1NDCA 2H4YB 2XSJB 4NLPA 3K17A 3W9HA 4CNYA 4O3PA 3OL9A 2HNDA 3HKWA 3K58A 1WNEA 2I0XA 3CD5A 4A8XA 3TJ8A 5F8NA 1Q5YA 4JBCA 4PXEA 3OR2A 4WK3A 1O8BA 3LGMA 4QPTA 2HVIA 4DUTA 1S72S 2XSFA 2XO6A 2F9DA 2AEFA 1X9SA 2FLLA 4OL8A 1J5OA 3GJSB 1Y00A 2ROGA 4JV5F 2VA3A 2CQPA 2LXUA 3U7JA 3PM9A 3DLJA 4WP8A 5JVHQ 3DRSB 1T05B 2XHWA 3QGIA 4DV2F 1HI1A 2FJDB 4L75A 5J2NB 1QD1A 4D3HA 4X66F 1WSVA 1WC3A 1F9FA 1X7VA 4DPOA 3Q24A 1IBKJ 2CJQA 2GIFA 5KT5A 1JLCA 4HT5A 1NU4A 2FHJD 3AJ1A 3G6ES 1WG5A 2MLYA 4DCPB 5AJ3F 2V34A 2QIFA 3OL8A 1P9YA 2ZDPA 2AYGA 1BC6A 1H38A 4USWA 4LFCJ 3KXDA 2A1BA 5IV4A 4X4TA 4P10A 2W7OA 3MCNA 2R2SA 3PV8A 1VYAA 2IVYA 3DLKB 4ANEA 3KG0A 1IVZA 1KVJA 1Q7LB 4B9NA 3HHEA 5IC4B 4ECYA 3W62A 2CZ9A 2PE8A 4DR6J 4F50A 1Q1KA 1BMQB 2KRBA 3F73A 4EEYA 2NXJA 2XG8A 4NEZA 1WG1A 3EVMA 2YQ1A 3IA0A 4IR1A 2V0NA 2X7IA 3KJVA 1T8EA 3TZZA 3MOJB 4X4NA 1U1QA 4YB5A 6AT1B 2FY1A 4B3OA 3D5MA 4IFVA 1N5YB 2ZD1A 2UV8G 5DM7Q 2KHCA 3DRRB 3R7SB 1HNZJ 5K8MA 2Z8QA 1VR6A 4DDFA 5H9EK 1E6YA 3MAAA 3QT7A 4HTJA 1UJ4A 3DOMB 3ILJA 4U6PA 4FN5A 4PWWA 1IXKA 1TL7A 3EJMA 4A8OA 4NCBA 2HW3A 4J9OA 3VQTA 3ZZUA 4NXMF 2JFKA 1TTHB 1CJUB 3ZZTA 2V94A 2R8HA 1ZZNA 4DZDA 4EI2A 2E5IA 5A8WB 2WTFA 2ASDA 1FJEB 4DR3F 2FQQB 2UU9J 4Q0BA 2G13A 2AD9A 2HFUA 4PXBA 1XNQF 2WRMA 4TY9A 4XIUA 3QLHA 3QZ8A 3QFWA 1CJTB 4RL1A 2VKRA 5CZVA 3FRZA 1ZM3A 3J80Y 4ELTA 1DAXA 4KV8B 4QW8A 3NGUA 2YH0A 2MQLA 3KKFA 1AROP 4OYMA 4ZJLA 4CO4A 3NCQA 1VMBA 4M5DB 2VFRA 3ZFVA 4MYUA 5HJYA 2MLZA 2P9GA 4P52A 3TEGA 3N4WA 3EGNA 2RRAA 1RHUB 2I1RA 2DD8S 3MFHA 2IDLA 1HR0F 2MZRA 2KG1A 4WZMA 3Q8PB 2U2FA 3PHEA 3H4DA 2XY7A 2Q6BA 4EUVA 1T3NA 3H20A 3MM7B 3K8VA 3OTOF 2IRUA 3FEZA 1YK9A 1JB0C 2QLFB 2L9WA 1N5YA 1N56A 2QE5A 3RW7A 1URNA 1YG0A 4J9QA 4KSEB 3SSQA 5I4MA 2DJWA 2EKNA 2RF2B 3KMSA 2KZMA 1HHTP 4HR2A 2CPIA 1LOUA 4ZVTB 1W7WA 3IS9A 4DF4A 2E1AA 4KGKA 4QIGA 2OGUA 3M1VB 1TK8A 4ZN1A 1JJ2R 3KWMA 2DPJA 2G0IA 1VRUA 4I2PA 2H1YA 3MM6A 1NO8A 2CQ1A 5HATA 2DR7A 2XBPA 1SH2A 4Y2MA 1R0BG 3ZZZA 1HMVA 4BC9A 4J9KA 2KJVA 2K1RB 2RS8A 4B3TF 2QL7B 3ILLA 3E2EA 3PFOA 3HVRA 4IO9Q 4DU8A 3O2IA 4ES3A 3TAQA 4ILRA 1NKCA 2JNJA 4ED0A 1WHVA 3LP1A 3H4BA 2FVPA 4ZP8A 5KFJA 2ZBCA 3PYFA 1YLXA 3R5DA 3HI9A 3CB4A 4KKOA 4NCGA 4UUWA 3UN5A 3CCSS 3K5OA 3OR1B 3M05A 4KB7A 4NYPA 3FJ2A 1BQNB 3FGVA 5H1SV 4ECRA 4MYTA 2XY5A 2LQ5A 4O3OA 4LFAJ 3GV5B 2L08A 2CJKA 3Q23A 3W2VA 2NCKL 4DR2F 1RT5B 1T7PA 3IR7B 4KGXB 3EPIA 4J9MA 1C0TB 5FIIA 3EZOA 3OVSA 1F5AA 1D9DA 4B3RF 4B02A 2I9SA 2B4OA 3BDEA 3ILIA 4B3SJ 3J80U 1AZSB 2CADA 2MJUA 3I56S 3V2UC 4Q8FA 1YJRA 3IGNA 2RUSA 5IV3A 2BW2A 1R0AA 4X4OA 1L3VA 3D28A 3I0RB 4OJHA 1MROB 3WIUA 5LJ3Y 4RUAA 4W90B 4JI3J 1VQ6S 5EHHA 3BYPA 3MM6B 2BVZA 3VZIA 5KFLA 1FDDA 4CWBA 2DH7A 2LLZA 5CCLA 1ZA1B 4CIOA 2AEMA 3ETOA 5KFWA 2YWKA 4Q2MA 2EBGA 2IJNA 4G1PA 4O4GA 3UW1A 1GK8A 5A76A 5AE1A 3LWMA 1RT6A 1DY3A 2EFNA 3G82B 2IRXA 4QYZJ 1S1VB 4EYHB 3NL0A 3PNIA 1PYSB 3WX4A 1T03A 1X5PA 1KHVA 2HQCA 1QSYA 1FK9A 1Y3JA 2PI4A 1Z4UA 2B5JB 1X4AA 4CNZA 1OWXA 4QU6A 4EU0A 5EX0A 1MWYA 2M7SA 4LSNB 4NLUA 3DYAA 2RNEA 3KHHA 5HLFB 4C4WA 4JI6F 4C0HA 5C24B 4EZ9A 4K2JA 1H74A 4DWIA 2W1BA 4X65F 3ZNJ1 4DPXA 2LQ9A 4OV6A 3N01A 2F8EX 4DLEA 1TQLA 1ZOTA 3PR5B 1RU2A 1SPBP 5A8KB 5B0CA 2W9AA 1S1UB 1X60A 4ZVGA 2HMIB 4K4SA 4HH0A 4DN0A 4PRFA 2E1CA 3D6TB 3IWNC 1GXTA 2EC0A 3OUYB 2OPQA 3PW4A 4CH0S 1KRPA 1S9GB 3ILOA 4USKA 1N34J 2BM1A 1ZZFA 1I94J 1TUWA 3LP2A 2J0XA 2FVSA 4IRKA 2CDQA 3HP6A 4K4ZA 3C6TA 2ATCB 3EICA 5AT1B 4F67A 3M8RA 2HK2A 5ETTA 4WFNQ 1FKOA 3S01A 3HJVA 4DS5A 2UUAF 1S1XA 3UDLA 2ZH9A 3JTOA 1RZMA 3PG9A 4JV2A 1CVJA 3MHYA 3DMJA 2GQCA 2DIUA 2XEXA 1WC4A 4KQZA 5HO4A 2BJ8A 3THVA 4IH7A 2E1RA 2YWGA 5KFVA 2WAQD 4I68A 3NCRA 4DL5A 2EPIA 2NYIA 4OMFG 2HS3A 3C16A 2JEGA 1ZPWX 3C16B 1R7IA 1SBRA 1S1WA 2YX4A 1TK5A 4ZPTR 2Y8WA 1S1WB 3G71S 4IFVB 2RDJA 1TKDA 1WJ9A 2E66A 2VIHA 3KLEB 1XMQF 4CO0A 4URSA 2YX7A 4A8SA 1X5OA 4AL7A 1RKIA 2RQCA 3ENVA 4G1QA 4ECWA 2QEXS 2VBXA 5KFEA 2LEPA 2BOPA 3FSXA 2QA2A 4C11B 3HMJG 5ETQA 1OMSA 5D0RA 3NMRA 5HI7A 4ZPBA 4RUCA 3MEDA 2MMYA 4ZVQB 3TYTA 3BR9A 1NLKL 1UVNA 4PKDB 4X84A 2Z2LA 5JVGQ 2QX0A 3SV4A 2GW8A 3V4IA 2CQIA 4RUBA 4ED5A 1GQEA 1KDNA 5LMUF 5KT4A 2DISA 3DFEA 1YSJA 2MTLA 3DRSA 4DV5F 2MKKA 4ZA1A 1NXIA 1T05A 5D0EA 4C2MA 3C14B 2CUYA 5HMWA 5HL7Q 1S79A 1KC8T 3T6JA 3J7A1 1NK9A 2VDHA 4DL0C 3L3CA 2E1MC 2A2CA 2B51A 2EEYA 4TLRA 3M9MB 2J7KA 1VLOA 1VLYA 1RAAB 3ZZOA 4LF5J 2W4DA 4DU7A 2CXEA 1URRA 1UW9A 2WW4A 2BQUA 2ATLA 2BUNA 4YOEA 3TWZA 2VODA 1U02A 1M5PC 4FF4A 3G2XA 3HD1A 5J2QB 2E5HA 3I32A 3FMWA 1RTIB 1S1TA 3TAMA 5J1NA 5L9XA 1FJ7A 4OQJA 4P9SA 1KONA 3DM2A 2AKWB 1V9OA 4UUXA 4V1Ak 2FZGB 4JB8B 4KBIA 5KFIA 1GEHA 1IKYA 3MM9A 4DQQA 3CT9A 1XMQJ 1SKWA 1FRLA 4Q8EA 1PAEX 3VGTA 1S6PB 3PX4A 5IC6B 3QGHA 5ETRA 1C0UB 3GCXP 3W8PA 5KT7A 2DY1A 1GTHA 1FXRA 3PW2A 1FNMA 4L6V3 2CJXB 2D1CA 4LUBA 1ZA2B 3X3UA 1TKTB 2AGPA 2OH2A 1TKZA 2FHKA 4JI8F 3RRHA 5KG6A 1MW7A 4F3QA 1OYDA 4PUOA 4CM0A 1R3NA 3BSAA 5BYSA 3TUIC 4ENOA 2QMUB 4MT1A 3BJYA 1OPIA 4F0MA 1NZAA 2UXCJ 2DB1A 5M2PA 3M6XA 2FVQA 2OPRB 2G2OA 2W2NP 4LRBA 1LW2A 1P27B 2F3JA 3NWGA 4FVMA 3UN3A 5F8IA 5ETPA 4RU9A 2RKIA 3TX8A 2F4VF 3S8SA 1G2EA 3VAMA 4G65A 1WELA 4K2XA 4WIIA 4U67Q 1TVRA 2FJXA 1HWKA 2W24A 2RSQA 3BR8A 1HA1A 1N52B 4Y34A 3G9CA 2RH3A 3SEOA 5C2CA 1HL6A 2DK2A 1ROFA 3GP9A 2VJVA 1VCTA 1S9GA 3K59A 1QAYA 9RUBA 4F4AA 4CLFA 2XYGB 4BLGA 4F3OA 3DGPA 2PMZD 3W5YA 3OR2B 2OD6A 2J8SA 2DGXA 3OR1A 5D4OA 2WONA 5IQ6A 4CTAB 2F9JA 3PYEA 1R6YA 5IT9Y 1EZZB 1TP7A 1F5CA 2ZZTA 4WTYA 1SH0A 5C25B 3M8SA 2DH8A 2F8HA 3OTEA 2FGCA 5CA5A 5SZTA 2HEKA 5CYJA 2DPIA 4N7TA 2XWYA 3QSYB 1QLNA 1HPZB 1M1GA 4TY8A 3HDSA 1UVMA 3BGUA 1HBNB 1Z2LA 2DTJA 1WC1A 2BJ9A 2LU1A 4YEAA 2VG5B 4OHYA 4JI5F 2KYZA 1NPRA 3FZ2A 5L8RC 2VBYA 2ZH2A 3H5UA 1SJRA 4RBUA 1ACMB 1Y11A 3CJRA 5G4DA 1NDLA 1OQ6A 3POTA 5JMNA 1XMOJ 2DRBA 4BS2A 4LF9F 4HL9A 5DG8A 3PW5A 4N8OA 4NASA 4DQSA 2IBKA 2MYFA 4LBIA 1U6ZA 4QWEA 4PXDA 4DR1F 2Q66A 3Q8RB 1EQMA 2V67A 5CXTA 1RBLA 5EN1A 2NUUG 1KWMA 3NGTA 3NXZA 2MXYA 4LF7F 1HWIA 3DOLB 2RMLA 1EP4A 9ATCB 2EFVA 3I55S 4ZVEA 2RUGA 4B3SF 2EC2A 2JFDA 3IM9A 2UUBF 1NPKA 2GJIA 2COLA 2ZKTA 4JP8A 1GMWA 2HVEA 4DPTA 5EWGA 4R5PA 3KHGA 1HBOA 2OJ3A 1MU2A 5DGAA 1WOPA 4FXWA 1V3ZA 3DOKB 4M63A 3A3NB 2D7SA 4NOHA 3T19A 1S1UA 1N33J 2P5VA 1JLQB 2HPUA 2WOMA 4Y6IA 1K73T 4QW9A 1WORA 3QFHA 3D68A 1NSPA 1GTEA 2UP1A 1HNVB 1XEZA 5KFFA 3OVAA 3N5FA 3W7BA 5FLXU 1RACB 3IXQA 4ELVA 1OY8A 2HFNA 2JJ4D 2RT3A 2MLXA 2NQPA 5HN0A 2FLPA 3MECA 1RT1A 3OHAA 2HFZA 1P6TA 1Q16B 4NMLA 4QIVA 4RWWA 2IHR1 2AX1A 2XYPB 3BPDA 3F0NA 4FVCA 4HACB 4XTTA 4OLPA 1YZ7A 3KDNA 2RHQB 2HRTA 4USJC 4F0HA 3SZ2A 2CWKA 4IG3B 1T02A 1NH7A 1K9MT 2PI5A 3IAM9 2YWWA 2D69A 2R7QA 3PYDA 5A0YA 2MGZB 4JI8J 1X4CA 3VHQA 5CD4H 1SIWB 1EB0A 3BGFA 1S0OA 3CD7A 3NGDA 2HHHJ 3RTVA 2CNNB 2OEKA 2IJFA 1IKXA 2YXLA 3D1QA 3KUHA 3NGSA 4DSFA 1R43A 1CBKA 4X2BA 4NZ0A 5ITHA 4WKRA 4DV4F 4OHZA 3D4JA 2WVEA 2UVRA 4QYZK 3H5XA 2R3VA 2W2PP 3ISNC 4LF8J 2HQFA 1MNEA 1ITPA 2NUHA 1NK8A 2CQ0A 1FVSA 1FVQA 1E6VA 1LW0A 1Q8KA 1TL3B 1N88A 2IPOB 1Y0HA 1B0PA 2MZTA 4RW9B 1F1BB 2CA9A 2DNYA 2XHCA 2E5GA 4ZS6A 4ID5B 3NNCA 5HMYA 2GIRA 1LFWA 2CJ9A 4AYBD 5A8KA 4NA1A 1NDKA 1RWUA 3P3DA 4EZ6A 2AJQA 3H25A 3QAUA 1R89A 2O67A 4KT0C 2VQEJ 3TARA 1RCOB 2AV5A 2QL5B 2WK4A 3D6FB 4OIXA 2Z4PA 2HRYA 2F63A 3HF5A 3MPDA 4YP3A 3KK3A 2CVEA 4WCEQ 2LMIA 2KHDA 4CZCA 1CJTA 3Q8YA 1EIYB 2ZZMA 4YHHF 4ZLNA 3J81U 3TUJC 1S0NA 4XDDA 2DCUB 3KDOA 1DTQB 2X51A 2YNIA 3LP1B 3Q22A 1SQGA 2C42A 4ZDNA 4NLWA 3QJPA 1VHIA 5HVGA 4RZRA 1IBLF 1FRMA 1P1TA 4PZVA 2GHWA 5I3QA 5B0AA 3I5BA 3H5YA 2ZFHA 2CZ4A 3DRYA 2V50A 4FKXA 4ICLB 4KAIA 2BE7D 3MAQA 4DV6J 1JLFB 1FJGJ 1B7FA 1IR0A 4RW4B 3ZTRA 3W5XA 3ZXWA 4CLPA 2JX2A 3HHLD 3FCHA 3O3LA 1HBMA 2IYGA 4NE9C 3W1YC 2XWXA 3NS6A 4YR0A 4IOAQ 4I67A 3PHTA 3B8HA 3FKBA 1ZM9A 1DRZA 2XULA 4X4PA 1RTIA 1S1TB 1X4HA 3L4BC 1JMTA 3HM9A 3CCQS 3MUMP 3R5JB 1MN7A 2EVZA 5CYQB 5LJ5Y 3AOBA 1LWEA 4OX8A 5DLGA 1FESA 4HDGA 4WFXA 1SVDA 1FDBA 1VS3A 3OLBA 4J91A 1DHMA 1WOSA 4K4XA 3FCWA 3VAHA 4M94A 4P6QA 2UXBF 3BQ2A 3OLAA 1X4GA 5E5NA 2MJNA 2H65B 3MR5A 2JL9A 3NKYA 4LR8A 2BRLA 1L3UA 2QLXA 1VQNS 3MOZA 2PT0A 4I7FA 2UVUA 3FBCA 4ZVHA 4X66J 3LF0A 1VI7A 1U4BA 4R8UA 4AFFA 3SCIE 3AD9C 1TR0A 2EKYA 4NLOA 1OSCA 2HHTA 2F1FA 2CQHA 3D0HE 5G0RA 1U1PA 5AXLA 3KJVB 4RX6A 3OBIA 4YFUA 4YHHJ 1WHYA 3UR0A 1UJ6A 5A2QY 4JI6J 1TFYA 1S6OA 4D3GA 4QWCA 3TQ1A 2HVDA 2H48B 3M2VA 5AXNA 1N5QA 3QT5A 1LK5A 2E7WA 4Q44A 1KQKA 2VQEF 1K1QA 3QO9B 2PSZA 1WI8A 4L3NA 2ZJRQ 3J81Y 3WQPA 2GNKA 4WP3A 3DDKA 4C0OC 3CCLS 3M2UA 1LWCB 4M5LA 4ZJOA 5KOXA 2UVVA 2RE1A 1S6QA 1N6QB 3RB6A 3CC4S 3AXKA 1U6BA 2GAHC 5HBMB 3PZPA 3NRBA 4J9LA 1I51B 1JJHA 4LVOP 4F0KA 3VGUA 1PYTA 2CPXA 1UW4A 3W2WA 4J9RA 1FRJA 1U26A 2GV1A 2CRLA 3MPVA 5E3CA 1KS2A 1U45A 4KJIA 2L48A 2C3PA 4USMA 3NS7B 2HZCA 3T9ZA 3PJXA 2HIQA 2V8PA 4KR0B 1LNQA 1CJVB 4X62F 2B8PA 5D15A 5IWAF 1CLFA 1RLDA 2CJBA 4NA2A 4ATNA 1GMUA 3HPOA 4ID8A 2AZ3A 3D1HA 3TAMB 4FYDA 5D3GB 2MY8A 5E41A 5C5JA 4U96A 2IY5B 4IDKB 1VQMS 5A8RA 4DR2J 2DR5A 3ZZPA 3MMJA 2P6TA 1S12A 1YJWS 2XZWA 4QU7A 4RW8A 1HNWJ 3DRPA 3WX8A 4ZVRB 3MFIA 5RUBA 4AD6A 3V81B 1FWKA 4YR2A 4U8VA 1GH8A 2IM3A 3OQ2A 4DL3A 4HKQA 2PA3A 4UY85 4DFPA 3QSIA 3QJLA 2CQ2A 2R7XA 1L5UA 1UVLA 2HQGA 3TANA 3OJUA 4I6YA 1RK8A 3NAIA 5K8PA 4CLZA 3VGVA 2KM8B 4HI2A 2B9YA 4DQIA 2FUG9 3A1YG 3DU6A 2KRRA 1T3OA 3TRGA 1S7IA 3A8KA 1BHNA 4M5GA 4Q2LA 4K5SA 1TVRB 4NLYA 5GAHI 4TU8A 2RU3A 3BH7B 3TUPA 5CQGA 1HHQA 2Y1LB 1IBMJ 2RAQA 3CCWA 1IR2A 1N54B 3PRDA 4ECVA 1B0TA 1N33F 3SFGA 2J6UA 3FEXB 3HSJA 1SQFA 4AT1B 2DH9A 1Q5VA 3RZAA 3EZUA 3KUEA 2K3IA 3QWPA 4ZCIA 5CHCB 2CPEA 2Z2YB 4I2QA 1U1LA 2HIYA 1HIYA 4FPRA 1OPZA 2DNOA 2BXJA 6FD1A 1P1LA 1VOMA 2YH1A 1YJTA 5I3UA 2DNZA 2OKQA 2XB2D 3J81j 1DLOB 2ZH3A 4FYXB 2VC0A 3MTKA 2D41A 4HTIA 1R8AA 5E2QA 3CCES 1QAIA 2VQFF 2R7OA 2YNFB 5A6PA 4S0MA 3KJQB 4CP5A 1HBNA 3UD5A 2PMHA 4DPUA 2C22A 2ZE2A 2NXNA 4TU7A 4LF9J 1NUEA 2VF3A 3AHPA 1SCJB 3UCGA 3IRWP 3PO5A 1NB2A 1XJWB 2BM0A 5KG1A 1D3WA 1FD2A 2Q43A 2DEJA 2HZVA 4NMXA 2GFFA 2DRAA 4E2FB 2EI5A 2OTJS 4JUZA 5DLFA 1JLAB 1LWXA 5GAEI 3RR8A 3W3SA 2DXEA 1JLQA 3AJDA 3GSDA 2DGQA 4ER8A 4WFAQ 3LPYA 5T7LB 1GFWB 2DXFA 3Q86A 4M5JA 2ZH1A 2R7WA 4PG8A 4IUFA 3Q0AA 4LSNA 2HZAA 4YN3B 2UXBJ 2AQ4A 2QGFB 1X4BA 5B0BA 2M0GB 2G0JA 4HT7A 2XO7A 3KG1A 4Q0BB 3UFCX 2AX0A 2C2OB 2ZJQQ 3QT8A 1ZBTA 2HKEA 4NXNF 4DR7J 3BGRA 2B4UA 3KLHB 4KHRA 4X4VA 4OI0A 3W63A 2RQ4A 4PPZA 4ZP7A 2CQBA 1L3SA 1RISA 1KLMA 3BREA 3KJNB 1SI9A 2BEFA 4YQWA 3LUYA 1DLOA 2A3JA 2DNLA 4ZHRB 2KB2A 3A4TA 2LEBA 4ZVSB 4KGVB 1IKXB 1MROA 4ETZA 2LXFA 3AT1B 1YITS 3R5BA 1RWKB 2VG5A 4P2MA 5IT0A 2K3KA 3PXGa 2GCFA 3TAPA 3MR2A 2EG1A 3W64A 4O3NA 4XO0A 2ZBIA 4DR7F 1PAUB 3KMQA 1RHRB 3CDEA 1NK0A 3CDBA 3T5HA 1JJ4A 2VFVA 1RAHB 2QLWA 1C0TA 2W4CA 3BBBA 4DSEA 4QIWD 1RWNB 1FCAA 1NHUA 1AFIA 2K8GA 3P8BB 5AXKA 4UQTA 2H5JB 5LOQA 3NGRA 3MZIA 3KHRA 3NEKA 4PAAA 3BO3A 2MSTA 2MPUA 2D3ZA 3BKTA 2D74B 4IKAA 3EX7B 3MM8A 4O0NA 4K4YA 4P2SA 1KKHA 1WKJA 4ZPDA 5HROB 3G6VA 2HNZB 2DBBA 1S57A 3MGJA 3HHLB 2VG7A 4R8UB 4N77A 3OSNA 4M5KA 1FFGB 3MTJA 4P73A 4MFBB 1IBLJ 2ERRA 4LIWA 2MQNA 4N76A 4QR2A 2F65A 2J0WA 2CQGA 1VIXA 1MMDA 4B9SA 3BSOA 3V6KA 2BJDA 3A12A 4MKAA 3C19A 3PY8A 4F8RA 2VQFJ 2HLUA 2BZ2A 4KGZB 3CULA 2YWFA 3H90A 1UFKA 4QR1A 3AA8A 2IVMA 1F9HA 2B9EA 4DQRA 5B0EA 1KFDA 4LR9A 3FFIA 4DV0J 2W9BA 3VF0B 3KTQA 2F5GA 2ILYA 1IM4A 1T9UA 2IBOA 2OAUA 3D67A 3FEYB 2RDIA 3ZZ0A 1YJUA 4Y2AA 2HNDB 1N36J 1R8PA 2AHOB 2MZSA 3KK1B 2LFVA 8RUCA 3KK1A 3KK2B 4ZP6A 1WTFA 3BKUA 3T1AA 3UCZP 1I5OB 5D4NA 4PYDA 5K8OA 4AQYF 1EJ7L 1UA0A 1MSWD 1JNRB 3TR5A 1CULA 1WTBA 1S6QB 1RB0A 2CKWA 2RVJA 4PR6A 1CULB 3FDSA 1YJ9S 4B9UA 3JQJA 4DV4J 1KSPA 5JUMA 3QMQA 4USVA 2MGZA 2PEBA 3GLJA 2HHXA 4Q45A 1WDTA 4RNHA 3CJ2A 1VQKS 1RCXB 2DEIA 5BR8J 5IS2A 2E5JA 2VPZB 4OZ2A 3L95X 4L74A 1JLBB 3UDVA 4KHMA 1Y3KA 2P6SA 4C3KA 1Q4RA 5D0GA 3VAFA 2NZ4A 2HGMA 4IYQA 2K7KA 1IR1A 1SUQB 1A6LA 1JXVA 1P9QC 3A8IA 3E01A 3EVWA 3CIMA 1FFSB 3FBBA 3IGVA 2G2YA 3GFHA 4NZ7A 1NRKA 3D1OA 3UQSA 4JI0J 3JB9k 4ZPVR 3RUBL 3LGHA 4K4WA 4WE1A 1IKVB 4Q5VA 1ZAVA 2DNKA 3JXOA 3B54A 2IRYA 4K7QA 1IWGA 4DUYF 1CSJA 1X9WA 4IG0B 2VASA 3DRPB 3MUTP 2VG7B 1LW0B 2XI3A 3A8JA 1RT7A 3GJTB 5THWA 5FLXY 5A8WA 1N34F 4JI4J 3J7AN 2XMVA 1HBOB 2DHAA 2J9DA 2GMLA 4P2XA 5IWAJ 4FF3A 1U8WA 2EK6A 3CW2C 3D0GE 4MFBA 1GMVA 1KEKA 3W9IA 5KT2A 2VHGA 1GXUA 2VG6B 3QRPA 5KFPA 2X3DA 2AJ1A 3LP0A 1OIAA 3NG8A 4XPCA 1U7LA 4OYBA 2KM8C 4X65J 2KO1A 2QMWA 4MK7A 5ADZA 1E6YB 1VRQC 2H9ZA 3HKZD 4M5HA 2DHHA 3GYGA 4TU9A 4JI5J 4C9DA 1QE1B 3RBDA 1UVIA 1RYRA 3P5TL 4DX8H 4AXJA 1OJ4A 1DARA 4DBQA 2OMOA 2GX8A 2QSFA 2NPFA 3HVTA 4R0JA 1PKUA 1TL5A 1FEHA 1UEVA 5E0OA 5E33A 4EBEA 3BBCA 1S59A 4C8ZA 2IAJA 2I2YA 4U8YA 2QV6A 4DR1J 4DX6A 2GA7A 1NKBA 1TMMA 2SXLA 3L7UA 3IC1A 3M8WA 3RBXA 4ZITA 5I42B 3W66A 4QPXA 3AOAA 3TA2A 2E9RX 5BYQA 4M5DA 2I38A 4CLKA 4F4WA 2FYXA 2DRDA 1VK3A 5BJRA 4QQBA 2ADBA 2ZWOA 4DCOB 4ECQA 3D3BJ 1Y4ZB 3R7NB 4QR0A 2FJWA 2NR0A 1ZTWA 1WKLA 3K0JA 2GMJA 1KVIA 5C7PA 4LFBJ 1AW0A 2WBRA 4I56A 2AGQA 4DL4A 3VAKA 4N47A 4ZKAA 4KKOB 2ZNYA 3B82A 2HQ3A 1FWPA 1FK9B 2MQ8A 3BKFA 3I4PA 3EPGA 4CT8A 4LSLB 1TAUA 2B4VA 2A0FB 3MAAB 5EWEA 3LPEA 3OJSA 4AL5A 2OIHA 2B9XA 4JV0A 2QFJA 2XYHB 4B9VA 2FZKB 2B8QA 1LW2B 3LO3A 2VPYB 3N6NA 4BHQA 4YUDA 3SDEA 5CD4A 1D9FA 1VRTB 2J76E 2KVIA 2M4MA 3ET6A 1F5BA 4KH1B 4QJVA 2AJFE 4X4QA 4DV5J 4LQ3A 4KFBB 4P7VA 1EKRA 1RAIB 1U2RA 4OI2A 3CIZA 3LOUA 2ZNZA 3VV2B 5J2MA 3DLLQ 3FQKA 2W7PA 2F4VJ 2LQ8A 3GJRB 3MPUB 2E7XA 4UW2A 2V5HG 3SYZA 4ECXA 3AXMA 2HHVA 5F8JA 2JEFA 4FP9A 4PXCA 1R6VA 3ICLA 3IRXB 4DLGA 1H72C 4U7UK 4JI2F 3T1HJ 1UWAA 3OL7A 2YKMB 3FBFA 5HAOA 3W2WB 1B70B 1NNDA 3J7ZT 3C15B 4V19X 3GFXA 3G4SS 3BQ1A 1HI8A 1KQSR 1HFEL 5HK4A 1N36F 3DLGB 3R27A 1XK8A 1RWOB 4UZCA 4EO6A 4K5RA 2ZH4A 1OY6A 5C42A 2HHQA 1O5JA 4P72A 2MZJA 2LCWA 4QWDA 1YKWA 2C2KB 5GAEU 5FDLB 1KOOA 3CJ3A 2JZ5A 2CG8A 1KLNA 2K06A 2HFOA 1N48A 1RWWB 2CPYA 2M8HA 4ZPWR 1QY7A 2P9EA 2IMWP 2VPWB 3CCMS 1U09A 1UPPA 2GVDA 1BXNA 4NEYA 2E29A 4DI6A 3UD3P 3DLHA 4DL2A 4FBTA 3WBZA 2CJYB 2MB0B 2OPSA 3GILA 2Z2ZA 4LF4F 4K50A 3DKDA 4QZVB 4IDKA 2DHSA 5IOLA 3TA1A 3TJ9A 3U1NA 1VC5A 2DNNA 4MIWA 4DPYA 2DNGA 5DETA 5KFMA 2E1PA 2QLBB 3DU5A 3EM1A 5EDWA 2V4QA 2HMIA 5E7OB 4A8QA 2C2DA 1XMBA 1FDAA 2P9CA 4WTOB 4F4XA 3V81A 4PYAA 3I9V9 5HANA 2H5EA 4C8MA 3CUNA 1J5OB 2E9ZA 4A8FA 3SXLA 2HNYA 1EETA 3O1LA 3GYXB 1HYSB 3DHXA 2HHHF 3M8PB
chains in the Genus database with same CATH topology
1SIZA 4C8KA 5F0UA 1IQZA 4E98A 3K57A 4TQSA 3AQPA 4H4OB 3G8TA 1S99A 1HNIB 2DIVA 3B4MA 3HVTB 5D4PA 2C28A 2BJEA 2LVWA 1VGYA 4DFJA 2XS7A 3MM7A 3C3LA 1UMJA 3JYTA 3V5RA 1NK5A 2VV5A 3JYTB 2CJAA 3QO9A 2AWZA 5DJBA 3KNAA 5I3UB 4J9PA 4HVZA 2NS1B 2XI2A 2VZ9A 2R8HA 4MIBA 1JKHB 4O4RA 1SH3A 4IOCQ 3POTB 5DGBA 1SJ1A 2OTLS 5L1KA 2C2RA 2UUWA 5C25A 4O3QA 4I2QB 1HQUA 5B0DA 1RP5A 3I0RA 2BACA 3KK2B 1SKWA 1M5VC 2Y1RI 3H5SA 4RW7B 2YNHA 5DQIA 2XC9A 4TY8B 1SV5B 1VK8A 4QIEA 1H7XA 4EGLA 5E3RA 2QA4G 4H4KA 3DI6A 2KYXA 5KG4A 2ACYA 1QTMA 3G6YA 3GWCA 3CO9A 3PRBA 1U49A 2HS0A 2APOA 1Y7PA 2N7YA 5KFKA 2NPIA 2QZ8A 1NJXA 4I7FB 2Y0SD 2FHMA 5D6GA 4OZNA 4F4ZA 3PX0A 1X0FA 4NRTA 1XR5A 3MCSA 2OFGX 3EYZA 1TZ0A 3DRXA 3M30A 1HARA 4OJGA 2XCAA 1D0EA 1H2TZ 4OFZA 4ELUA 2VOPA 3T5KA 2V4JA 2M9KA 1IKWB 1DZ5A 4DSJA 2JHEA 1P8GA 2VKZG 2FIUA 3MMCA 4WFYA 2Y1JA 5F9LA 3TVYA 5FD1A 4LMZA 2C3OA 2IAJB 4ZHRA 1W25A 4ZLPA 3GG1A 3OSPA 1WHWA 4RNNA 3DM2B 4OI6A 2BYCA 3I6PA 1LWCA 2W8LA 1FEEA 4PG7A 3ENQA 2V8GA 2XS5A 1NB7A 2IM2A 2QT7A 1FRHA 2G9OA 2LECA 4OZ1A 3TO8A 1VBXA 2XMTA 4RU2A 2L9NA 1K1SA 3HVAA 2AF6A 5KFTA 1SKRA 1N0VC 3MD1A 4O44B 2GJ2A 2OO4A 3IG1A 1VBZA 4GMKA 5L39A 2G0CA 1HBUA 1ZAWA 2XNRA 5IZHA 3ISZA 2R2TA 2UXCF 4G1IA 1LWFB 4ZCKA 4OZ0A 3MMAB 2X1GA 3CCTA 4M8LA 1REVB 1VQ9S 1U24A 2DGWA 1VQ7S 1UL3A 1I1GA 2GC8A 3OL6A 1HNWF 3DDNA 4UOCA 3LALA 3SCJE 2HG4A 1OSDA 2IYIA 2QMXA 5GADU 4ED2A 4TN2A 3IAS9 3RAXA 4A8KA 3R1LA 2Q3PA 2C3YA 4CT9A 5BR8F 1R8HA 1TKXA 2JH3A 3DOMA 2IC3A 3HX9A 1W2BR 2GGPA 5LSRA 1V3RA 1SL2A 3IRXA 3OTCA 4DEZA 5DDQC 5HBMA 1RYSA 3K7RA 1D8ZA 1HW9A 4JI1F 3LANA 1RTHB 4LIRA 1VFJA 3GG0A 1T94A 2XNQA 2ASJA 3TNVA 2ZJPQ 3N0VA 4OX7A 2N4DA 2W9BB 1RTJA 3I4HX 1YVFA 2A2DA 2MHEA 2J7UA 3QIDA 3T9NA 3M2VB 3MPYA 2R8IA 3PEHA 2CG4A 2DITA 5J2QA 2FC9A 3Q8QB 2VOOA 2XLJA 2G1DA 3G96A 1BQMA 2O5DA 2X3GA 4DV0F 2E9TA 4AL6A 3K8WA 4WXWA 3MM5B 2GO9A 3K5MA 2NXUA 3CJ5A 3LAMA 4RKUC 2HAIA 2M5YA 3JSMA 4M95A 1K0TA 2QRRA 4MJKA 2NREA 3RB0A 1YQHA 4WYWA 1CEZA 2OMLA 2HVHA 1YI2S 1N5VA 2AJ4A 4ITSA 1FERA 1Q8IA 4Y0FA 3NAHA 3VALA 2WOMB 1IKVA 4O44A 1JLBA 3J7YU 1HW8A 2O66A 1HI0P 3K2YA 4BWMA 2W4PA 1HNVA 5EWFA 2XSJA 4DS4A 3U02A 2UU9F 5K5MA 2ZC3A 1ELOA 4G6VB 2HHUA 3JAMY 2YKPA 4MAKA 2YWEA 2D9PA 5F8HA 4HHJA 3EGZA 2DNHA 2ASLA 1RTJB 3CDAA 1GX5A 2FJAB 5I3PA 5HP1B 2WB4A 4IQMA 3MXHP 3AJ2A 3SCKE 3WDOA 4X4UA 1PSDA 2BBEA 1SJ4P 3UPFA 4J9SA 3RB3A 2J6SA 5K14A 4YDXA 3CE8A 1QM9A 3GMGA 3MF5A 1X4DA 5KG5A 1VC0A 1HNIA 1RTDB 1RA6A 2C3UA 4LVNP 1NJZA 3BN4A 3BEGB 5IFMA 1C1BA 1ZM4A 4LT6A 4DV6F 1FJGF 2LQBA 1ZPVA 2CVIA 3F44A 4DR6F 2DNQA 2QA1A 3SI8A 1OS5A 4YB1P 3MEGA 3PFEA 1FO1A 1FT8A 2V2KA 4CH1A 1RT4B 5GVQA 2HHWA 2W7AA 4ED6A 3QIPB 1DQ9A 1LWFA 4NX9A 4ID5A 3L09A 3PIPQ 3R1HA 5T7LA 1J5EF 1TFWA 1BGXT 2MKJA 2DGVA 2HVZA 2YVSA 4RW8B 1KD1T 2VBZA 3H59A 2CPZA 4IG0A 1Y9OA 5F3TA 1S0MA 4ZCMA 2BABA 3KFWX 1YWXA 3U1MA 3V4IB 4NLSA 2EFGA 4NLDA 5M2UA 3QJJA 1PILA 3Q2TC 2PDAA 3M32A 5JJBA 3DXBA 4ZOSA 2KXFA 3M1VA 4KGMA 4JI3F 1FHTA 1DTTB 2OPRA 3DRRA 1RTDA 4LF8F 1N8RT 4PQUB 2BE2B 3OV7A 2VPXB 1TL4A 2ROEA 4AUKA 3U1NA 3U1LA 3PDNA 2DNRA 3G6ES 2EFPA 1XWLA 2UVWA 3I0SB 1R31A 2ZHOA 3FMBA 4YMEA 1JLFA 7FD1A 1D9AA 1SL0A 5B0FA 3SDEB 4BCAA 2FVRA 2ADCA 1SB6A 3CTRA 1LK7A 2ZVSA 3N79A 2F8MA 1HYSA 1BLUA 2WCXA 1H98A 1SQEA 3E51A 5D78A 5A0YB 2ZH6A 1Q78A 3AB2B 1OO0B 2CYYA 3HLUA 4FF2A 3ZZRA 2IA0A 1VQYA 4A8YA 2J7WA 2A10A 4PWDB 1M5SA 3N6LA 1JLGA 4OI3A 3MMAA 5IM0B 2E44A 4TLQA 2R2UA 3OW2R 2YY3A 4OJ1A 2YNGA 4C3MA 2JLFA 3GR0A 3MEDB 2FJEB 2OPSB 1JLAA 2YWHA 4CO2A 4BBYA 1PC4A 4E8UA 3DLBA 1CQNA 4J5OA 3O8WA 4W92B 1RT2A 5L9NA 1X5TA 1FE4A 5DDOC 3DYAB 2KH9A 2ASYA 2EW9A 3GV8B 2AYMA 2R8JA 1XN9A 3TUZC 1VQ8S 3RR7A 3SQGB 4I4BA 2R8KA 2N82B 1V6HA 2MZQA 3H8YA 1NAQA 3MI7X 3U27A 2HQIA 4NPOA 2ZH7A 2M70A 2PA8D 3I5CA 1H6KX 1YGYA 1S49A 2MQMA 3HZGA 3DCAA 3AH6A 5KFAA 3N28A 1JWWA 1LKZA 1NH8A 3MEKA 4K0KF 2IA6A 2Z2MA 2GGPB 3HZEA 1XMOF 3PACA 4N8NA 4CQ1A 3K5NA 1QAJA 3K5PA 4HH1A 4OZ5A 4IR9A 3NP5A 1RTHA 2CPFA 4C0BA 1B64A 1SJ3P 2B7BB 2WONB 1S1XB 1SL1A 1IKYB 3MM9B 4OHWA 3KLHA 1TUVA 4HI1A 1G1XA 3M2RA 3CCUS 4MH8A 2X1AA 5LSOA 1UVKA 1X4FA 1WF2A 1KLMB 1U1RA 2VB6A 3IWXA 2CQ4A 3KLFA 4ZK7M 3GE9A 3CD0A 4IRDA 2RRBA 4F26A 1QAXA 3GIMA 1UWBA 2GQQA 2XMMA 2VD3A 3FZBA 4O3SA 4J9NA 1YRTA 1REVA 5KFCA 3PR4A 2JEJA 3RB4A 2ALZA 4K4UA 3JSMB 3TVZA 4PWDA 1FNOA 2JSXA 3M6UA 3E8OA 1DBDA 3C66A 5AXMA 2MQQA 2CPJA 1T03B 3TVKA 2DO4A 3DOLA 3LW5C 2B5JA 3VAJA 5L1JA 3RRGA 3CF5Q 2J9EA 5D4LA 3T6BA 1U1MA 1JXLA 1KNZA 5C24A 3M8QA 2DGTA 4I0WA 2V9KA 1YJNS 2PIIA 1TL3A 4DSIA 2J9CA 4U7CA 4CO1A 2LU2A 3OFGA 4Y3CA 5DG9A 1HD1A 4C11A 4OV1A 5MAOA 2FDNA 4H4OA 4FS2A 1NK4A 4IH5A 2OSQA 2RB7A 4RW4A 3CJKB 1DQ8A 3CJKA 2ZITA 2B6AA 1JIHA 2ZH8A 5KFSA 3E3XA 4KFBA 3VQSA 3GFZA 3LH2S 1XERA 2W8KA 4I6AA 4JOUA 3BO4A 4WKYA 2ZZNA 4ILMA 1H3DA 2DT9A 3HHKA 4ES2A 3SV3A 3CEDA 1S10A 4DFKA 3BN7A 3FNNA 4GC7A 4H54A 3A8EA 4DG1A 1O0PA 2W9CB 1U1NA 1R0AB 1VQSA 3LP2B 5KFHA 3KHLA 4UQGA 1BQNA 4FXDA 4LF5F 3VWSA 2N3LA 1FKOB 4ECSA 2XMWA 3ITHB 3JTNA 1UA1A 2JDJA 2JLGA 1RKJA 4ZVFA 1HQEB 3O5TB 3O44A 1BY9A 5KOWA 2MQPA 4NZ6A 2DGSA 2ZUGA 1QSSA 3G8QA 4WE1B 4RUHA 1DJ0A 5B09A 2HGLA 4DFMA 2RIJA 4USIA 2HGNA 1APSA 4YB6A 5DQGA 6FDRA 1UFLA 3DI6B 2PO4A 1A9NB 2J8AA 1S6UA 2J0QD 4EFAC 1ZH5A 3KLGB 4PG5A 3T3FA 1RT6B 2AP6A 3VTIA 5IT4A 4R25A 3BSCA 1JXEA 2K1RA 3ZC4A 2VONA 3BF4A 5SUHA 2KFZA 3RBEA 5T41A 2R7TA 2FJVA 2ZHBA 3SSSA 4B17A 4FXVA 4NRUA 5KG7A 4IFYA 2YKAA 4URQU 2HLTA 3UNGC 2KXNB 3C6UB 2FTRA 4DR5F 2DR9A 4OI4A 2BRKA 1IKWA 1C4CA 1UKUA 3PJWA 1VIOA 3PEJA 3I82A 1CG2A 1WF0A 2ZH5A 2LEAA 1L3KA 1LXNA 3UR3C 1FXDA 1HBMB 2PC6A 3OFEA 4MKYA 2KT3A 1X8DA 4FBUA 3WC0A 4HLBA 1Q81T 5KFZA 4ICLA 3CMES 2EWHA 3DLEA 3OXFA 3CWJA 2XMUA 5CCMA 1U25A 5IM0A 2M8DB 4C8YA 2ILZA 3S1TA 2OLWA 2YKQA 4MTPA 2FLNA 3PW0A 3UCUP 4QBUA 1RT4A 1MWZA 4ERDA 1IJFB 1C2PA 2ROPA 2VBWA 4I6WA 5J1PA 2L41A 4EBCA 4B08A 2K7JA 1S77D 2CQDA 3EZ5A 3DN9A 4WU3A 2B0GA 5GAGU 4Y65A 3EGWB 3ISND 3B4DA 2DGUA 4J37A 2ZC4A 4PG4A 2VFUA 2RKIB 1GXLA 4B9LA 5D3GA 3OVBA 4RW9A 4A47A 5DO2A 5LMNF 3G86A 4WXOA 2YTCA 4TNOA 4DUZF 3LGNA 3VZHA 4B3MF 1NJWA 1IQTA 1KOHA 3VR1A 2JC1A 1KHWA 1TL1A 3BGLA 4DOZA 1L3TA 3I0SA 3OXGA 4K59A 3JSRA 4O23A 4AE5A 1S97A 2XS2A 3FVYA 4Z2XA 2VG6A 4KPYA 2LA4A 4YY3F 2JEIA 3M2UB 1YBAA 3BZQA 3T5JA 2KN4A 5F8GA 2A18A 2K2PA 3NS5A 4B9TA 1IUJA 4OLOA 1GNKA 4RW6B 2GHPA 3H2LA 2OD4A 2IVFB 1O51A 4PQAA 4JYAF 2M88A 1S9EB 4F2RA 4DJBA 4A48A 4A8WA 2WW8A 3V6DB 1U1OA 3AAWB 2R9LA 5L1LA 3V6DA 1H7WA 4C7QA 1RAJA 1GAOA 1UEUA 4MIAA 4Y2KA 2MQOA 5GAGI 2R7UA 3QIPA 3O6QA 2QO3A 1MMNA 2Q79A 2YNGB 2M52A 1H2VZ 1C4AA 2WSCC 4NL5A 2ZM6F 2FPHX 2WSEC 2R4FA 3EXCX 4QWBA 5KFOA 5F8MA 4GC6A 3IG1B 2XMKA 4OI1A 5E3QA 1N32F 4GO5X 3RAQA 5H9EJ 1RA7A 3LAKA 4XPEA 3P6YC 2XLKA 3P96A 2MDAA 2RRNA 2XCPA 3M9NB 5KTQA 2BV3A 3RRKA 5CYMA 4C8LA 1QJHA 2V9WA 1Z1ZA 4ZCLA 3NBPB 4KE5A 5HP1A 4I1TA 1S1VA 3TOQA 2IMOA 1DTTA 2E5LF 2I8EA 1FXLA 1K0VA 3RYLA 2VUGA 1FKPA 5D77A 3M32B 4EWTA 3FFIB 4ZPCA 1TKXB 4X4SA 3HJFA 4WF9Q 3KLVA 2R7RA 1N6QA 2MKSA 1YJVA 2BQRA 1F2GA 4Y2IA 3T1YF 3UE2A 3W2VB 4OZLA 4EO8A 1U47A 3BB5A 2C2EA 4RNMA 2V8HA 3CJ4A 4N5SA 1TV6B 3D2WA 2FJBB 2W25A 3IBWA 4K4VA 1JK9B 3LP0B 1VBYA 1WEYA 1DTQA 2OPQB 2FC8A 2YNIB 3CVKA 3M9OB 3KLIA 1Y5NB 2IFXA 3KLIB 1RDRA 5A6WA 3UI3A 3X1LB 2PFFB 4C8OA 2HNZA 2L9DA 4Y2CA 2IM0A 1JLGB 1SV5A 2DO0A 4RLEA 3NNHA 4ALZA 4PPDA 3M2RB 1UAWA 1XR6A 1VQ4S 4KC5A 1BD6A 3GB0A 3HHLA 4Q7AA 4I2PB 3KLFB 4RNOA 3GYNA 2U1AA 1TKTA 4DHVA 3BDPA 2X1FA 3DOKA 5KG0A 4NCAA 4DQPA 1KN6A 1D1UA 4ZP9A 2YKNB 3DC2A 4HDHA 1HNZF 5HLFA 3G8SA 3CXCR 3GIJA 2BANB 4IH6A 3CDWA 1WF1A 1VQOS 5LL6d 2J9DE 1PGZA 1N5TA 4DN9A 3M4XA 1U48A 4CCHA 3GIKA 3S6EA 2KJWA 2FHOB 1YRUA 5HMXA 5IQQA 4OZJA 4O0IA 1DURA 1HD0A 4F3MA 2VA2A 2MKCA 4JI7F 2G4BA 3CGIA 2QA4S 4USHA 3ZZYA 1XC9A 1XBWA 4PQUA 1XNRF 4YR3A 2V4RA 4CTAA 1HWLA 1S7HA 1S9FA 3MD3A 4I64A 5HQ8A 5KFXA 3HXMA 3GIIA 1M5OC 1M90T 1I94F 1JLCB 3B78A 1XTZA 1IBKF 3TP2A 4NLVA 4RBVA 2LYVA 1GX6A 4CH7A 2PN6A 3SCLE 1KFSA 3GFYA 3DLHA 3ITHA