4D3GA

Structure of psta
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
78
Chain Sequence
HMKMIIAIVQDQDSQELADQLVKNNFRATKLATTNTTFLCGVNDDRVDEILSVINQTCGNRVGGATVFVMPVDAFHQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSTA
publication title Complex Structure and Biochemical Characterization of the Staphylococcus Aureus Cyclic Di-AMP Binding Protein Psta, the Founding Member of a New Signal Transduction Protein Family
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 17
structure length 78
sequence length 110
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4d3gA01
2ZFHA 5L9NA 3M05A 1KR4A 2NUUG 4CO3A 4R25A 4USJC 4Y65A 2V5HG 3NCQA 1V6HA 1V3SA 4RX6A 1VHFA 2J9DA 4Y6IA 2E66A 1QY7A 2J9EA 4NYOA 4CO0A 5DS7A 3CE8A 2DCLA 3OPKA 3NCRA 3T9ZA 5D4LA 1UFLA 2GX8A 1UKUA 3BZQA 2RD5C 3X3UA 4CO4A 5D4NA 1UMJA 4CO5A 2O67A 4WK1A 1V3RA 4YB7A 4E98A 1XK8A 4NYPA 4RWWA 3TA0A 2NS1B 2ZOMA 5D4OA 3N5BA 3AH6A 3O8WA 1PILA 3TA2A 5D4PA 4CNZA 2JJ4D 4YB5A 1HWUA 1H3DA 3GSDA 1VFJA 4RLEA 4USHA 1GNKA 4OZJA 2VD3A 4OZNA 1P1LA 2Z0GA 2CZ4A 4D3GA 4ZK7M 2J9CA 2GW8A 2O66A 3LF0A 4CO1A 1Q1KA 1NZAA 1UL3A 2XULA 2NUHA 3AHPA 3HLUA 4USIA 4OZLA 4YB6A 3O5TB 2XBPA 2EG2A 2XG8A 4IYQA 4RWXA 4AFFA 3L7PA 2EG1A 4CNYA 1NH8A 1NAQA 2PIIA 2GNKA 4CO2A 2XZWA 2J9DE 1O5JA 3AA8A 3AA9A 4WK3A 3TA1A 1OSCA 1O51A 4C3LA 4D3HA 1J2VA 1V9OA 5DRKA 4C3KA 4C3MA 3NCPA 3DFEA 3MHYA 1NH7A
chains in the Genus database with same CATH superfamily
5GADI 2LU1A 5T41A 4NRUA 3PDNA 4DR2J 3CCVS 1RQ0A 3DRXA 2EFNA 4I2QA 5FDLA 1PAUB 3JQMA 4DUTA 3IWNC 4ZVOB 3B82A 2GX8A 2B56A 4X64J 2RD5C 3OQ2A 3IR7B 2G2ZA 1BC6A 4LBIA 4TU9A 4PG6A 1XMQF 1NSKL 4F2SA 5KG7A 5GAEI 2H48B 4RO0A 2L48A 1B4SA 1VQOS 4P2MA 3TARA 1RAEB 3T6JA 4DQSA 1SJ4P 1QM9A 2YKPA 4Q2MA 3OFFA 4IG0B 4J9SA 2KHCA 4CO1A 4B3OB 5JUMA 4K59A 2RRBA 1D8YA 3OTBA 3W1YC 4DBQA 2M70A 4LSZB 2JSXA 1EX8A 1TKZB 2QL7B 4ES3A 3KK2B 3TVZA 4ZCKA 5IC6B 3KDNA 3T1YJ 5T7LB 4ZP6A 4BS2A 3NEKA 2FZGB 2KTQA 1VC6A 2WSEC 4TLQA 3EWGA 2JEJA 2WB1D 1FWKA 2CPJA 1OY8A 4Y2CA 4KBIA 1MNEA 3EZOA 2CFXA 1SC6A 5GMKa 3A1YG 1HNWJ 2PA8D 2DGSA 1BWVA 1M1GA 2OGUA 3R7BB 1UMJA 4PPZA 3M8PA 2WOMB 2BZ2A 4ES2A 1MLAA 2DGTA 4ECVA 3HFKA 4KYZA 4YY3J 3LTOA 5CD4H 5SUHA 4XDDA 5KT2A 1LKZA 1JB0C 3MMBB 1EKSA 4DPOA 2RU3A 5KFPA 2DGUA 4X62J 1HBOA 2JC0A 2I5JB 3C3LA 2QYCA 4TVAB 2HIQA 2JWNA 4M5JA 4ZVFA 3VCDA 1WKKA 1PIEA 2W25A 3AAWB 4MK8A 1RT6A 3GIJA 1WHXA 4R5PB 1L5UA 1WC1A 3OL6A 2VODA 2KFYA 1U6BA 2GGPB 2PEHA 1QTNB 2C2KB 2NXUA 5ETMA 3A4TA 3ENAA 3LWMA 2UUTA 3SIPB 1N5YB 4HHJA 4CLUA 3CCQS 4TLRA 2UXBJ 2P6SA 1LFWA 1KQSR 1YX2A 3FZBA 4DR3F 3J80U 2XWXA 4M5KA 5H1SV 2MQMA 2HS3A 5HP1A 4WK1A 1NB2A 3MR7A 1WEZA 4EBEA 4P2SA 1L3TA 4O0IA 1WHVA 1H3DA 3Q83A 1SL2A 3ZZ0A 1RHQB 1VDHA 1LWFA 1KLMB 2EPIA 2BABA 2GO9A 3M6UA 2PI4A 2A18A 3UCZP 4DS4A 3GR0A 3D67A 4ED2A 1UVIA 5KTQA 4UOCA 3R97A 2UUAJ 3HX9A 4WU2A 4DSLA 5HQMA 1U8WA 1CSJA 3ONQA 2WONA 2LQ9A 1ZYQA 3BQ1A 3BO3A 2MB0B 4C8LA 4WWSA 3LW5C 3P8BB 4PG5A 2PE8A 2VKRA 3HP6A 2ZH6A 2ZHOA 2KZMA 3KYLA 4B3MJ 2VQFF 4DL7A 1RAJA 3FSXA 2F4VJ 3OLBA 2B0GA 1MU2B 5KG2A 4TXSA 1B0PA 1FX2A 2LQBA 5C2GA 3TAQA 2ZZNA 4N8NA 4DQPA 1F5BA 4ZPCA 1QAYA 1FNMA 2YNGB 5H9FJ 2B7CB 4M5HA 2K7KA 2ATLA 4USHA 2UUBF 2COLA 1ELOA 4ED4A 4E0DA 3CCJS 5DDQC 5HL7Q 3FCWA 3A3NB 3GMGA 4RNOA 5I3QA 4DR7F 4OZLA 1HR0F 5A8KA 4K0KJ 4GKJF 4LBPA 5LMNF 3A8KA 2UVVA 1HI0P 1YLXA 2GJ2A 3SSSA 1DAXA 1VGYA 1QAJA 3KHRA 3VR1A 2C3YA 5K14B 4DU8A 5KFQA 2HVDA 1VLOA 2HIYA 4C98A 4PKDB 3PYGA 2VF3A 3R5JB 3GTYX 1DRZA 3FSYA 3BSNA 1BY9A 1KVIA 5IOLA 1PBAA 3ITHA 5C42B 1Q8BA 2DO4A 3BKTA 5AJ3J 5IM0A 2YKNA 4J9QA 1H98A 3ZTOA 3D6FB 3R8YA 3TA2A 2VG5A 2EC0A 3MEEB 4FBTA 4ELVA 5I42B 3OVBA 1JLBA 4Q7AA 2WVDA 2IY5B 4YB6A 4EUVA 4ZJOA 4IFVA 5THWA 1BXNA 1M1KT 1CEZA 4GC6A 2HG4A 4ZCLA 4HEA9 4U6PA 3W8GA 3GWCA 5L1LA 3MM5A 3BGRA 4FYDA 1RAOA 2DHSA 3NGSA 4LF8J 3GZ7A 1NHUA 2LVWA 3DLLQ 4LF6F 1S9EA 1LXNA 3UPFA 2AU0A 3CEDA 4ZP7A 4P9SA 4WE1A 1FKPB 3LP0B 2AMCB 3TO8A 3K17A 1ZZNA 4CT9A 3Q8RB 4Y3CA 2HMIA 3Q8QB 2E9RX 4HT5A 4IKAA 3SDEA 2PMHA 1PC5A 4PG4A 1WC5A 3MMJA 4C8KA 4N56A 4DX5A 2FZKB 2PMWA 2PN6A 1RTJB 4RUBA 2FJWA 5B0AA 2RHSB 1S97A 3ICLA 2SXLA 3OVSA 4I2PB 4MAKA 2IC3A 4KAIA 4B17A 4LR7A 2W7OA 1BWEA 1F0XA 3C14B 4RW9B 2HK2A 4OZ3A 3AHPA 5A0YA 3MFHA 2MGZB 2QMUB 3R2CJ 2CNNB 2CWXA 3KUGA 4NLQA 7FD1A 4DV4J 4LMZA 1FWPA 3PFEA 2UVRA 1R6VA 5LMUF 3VAGA 2ZC4A 4OX9F 1O51A 5J1EB 4KFBA 1U47A 3THPA 4ECYA 2YPYA 4ZN1A 5I3PA 3LPYA 1KD1T 3CJ0A 1Z1ZA 3TX0A 1Z2ZA 1HBUB 1WTFA 5CA5A 5B0DA 2XNRA 2AJQA 3RR7A 4WPAA 4QYRA 1JWWA 2H3EB 2DXDA 4PQAA 2FHKA 5C25A 4RPFA 2BACA 3O44A 4KR0B 4HHHA 3L9ZA 2F3JA 4N77A 3DOMA 4XK8C 1U2CA 5JMNA 5K8NA 3CMAS 3V5RA 4ECTA 1CS4B 3MPYA 3R9LA 1CLFA 1FNXH 2DB1A 4QW9A 1YJ7A 2XYHB 3TAMA 2YNHA 2YQ3A 4NL5A 3DKDA 2W7PA 2MQOA 4KPYA 3TUJC 5CYQB 4YB1P 3RUBL 4OYBA 3PRDA 4MFBB 4NLDA 2ZNZA 5C5JA 3CB4A 4DFJA 2QA4S 1C0TB 1WKLA 4DV0F 4ZP8A 5DM7Q 1JQGA 3GJSB 4DV3J 4DV2F 5IT9Y 1QVFR 2Q6BA 1NSPA 4OJHA 2IVMA 3VQTA 1TAQA 5AE2A 1JLQB 2P2CB 3IRXA 3K7RA 2MZRA 1RI7A 2AX0A 1QDUB 1QAXA 3PJWA 4RW8B 1UTAA 1TV6B 2RUSA 5CCMA 4NPOA 3QT5A 2OPRB 1AXQA 1SC3B 2B6AA 2UUCJ 1RU2A 5MAOA 1XNRJ 1Y3JA 3W7BA 2VFVA 2LEBA 2FTRA 4CI0B 2VOPA 3G6YA 1JJCB 4JI1F 3MEDB 4FP9A 1P1TA 2FHJA 2MKHA 2R8HA 4P2FA 3ENWA 2OAUA 1FRJA 4OI4A 2RE1A 3I6PA 2AJ1A 2ZBIA 2DNOA 2B9EA 3CJ8A 1CQNA 3IBWA 1VR6A 3FC9A 2RNEA 5KG5A 3HF5A 4NEYA 3DLEB 2XO7A 2YWKA 1R8CA 5A2QY 1U2FA 3T5HA 3QZ7A 4I67A 2OUGA 2NSBA 3RW6A 3LQVA 4DR3J 2M52A 1FJEB 3ILIA 1VCTA 1RJJA 4NLTA 2R4FA 3QSIA 1JLEB 1KC8T 4HKQA 1N54B 1P1LA 2J7WA 2F5GA 4C8YA 3FUYA 1T9XA 1S59A 3PYFA 1DFDA 2BE2B 4OYOA 4B3OA 5EHHA 4DF4A 3VVUA 2E7XA 3SCLE 1S10A 3OXGA 4V1Ak 1TKZA 1FTRA 4PWDB 1CVJA 3KK2A 2XYPB 2MPUA 1LW0B 3KJVB 3K0JA 1JXLA 3LPEA 2E1MC 4YDDB 5T7LA 2OLWA 3G6VA 1KVKA 3E2EA 2IM3A 4G1QB 3FFIB 2LKZA 1FRMA 1L3SA 2MQQA 2CPEA 2ZH3A 5D0HA 3BN7A 4NCBA 2W2PP 2FY1A 1H2TZ 2HNZA 2RQ4A 5BYRA 4M5GA 3IWLA 3BB5A 3GYXB 1KSPA 2VONA 4URSA 1CC8A 2CZ4A 2YQ0A 1R0CB 3MMBA 1VBYA 2BOPA 2DNMA 1VQLS 2I5JA 4CNYA 3BH7B 2K8GA 4PRFA 2J9DE 4B3TF 1HR0J 4GKJJ 2HHWA 3JSBA 2CDRB 5DLFA 4AT1B 2DGWA 4NA3A 2W2OP 3FEZA 1U1QA 1WOPA 4WKYA 2GGPA 1PYSB 4AXJA 5J2PB 3SZ2A 5HO4A 2QJ3A 4ZLJA 1N5YA 1U09A 4ZS6A 4YR2A 3TR5A 5F8NA 3QJJA 2N82B 5C24B 3CGIA 2RS8A 4BC7A 4S0MA 2AQ4A 2CJXB 3J81Y 2VPWB 2BJDA 3G8SA 2DNHA 5GAGU 2G2YA 3FMBA 2FDNA 2H54B 2M5YA 4X2BA 3WIUA 2C22A 2F8HA 4OV6A 4QU6A 2A10A 1KLMA 2CIMA 1R31A 3GJQB 4H4MB 3BQ0A 1KVJA 1YZ7A 3ZO7A 1VC5A 5B09A 1FE0A 4F4KA 2LEAA 4XDCA 2CQGA 1S6UA 2RSQA 3RB0A 1XR5A 1FVSA 2PSZA 5IV3A 3KTQA 4ZOSA 1S7IA 4DR1F 2NXEA 1HI8A 1K0TA 1NPKA 2R3VA 4J90A 2CNKB 2Y0SD 5DDPC 2DGXA 3TRGA 1G6BA 3V6KA 2N3OA 4QCLA 3IS9B 2YXLA 4CZCA 1N5VA 2I6WA 1IR0A 1Q7YT 3OXLA 1HKAA 4ATNA 4ZLPA 1MU2A 2HHVA 4WFYA 1M5PC 3HDSA 2KI2A 5AE3A 2V8HA 3AH6A 1T8EA 4FXVA 4CM0A 3DNCA 5HVGA 2YNGA 3JXOA 3GONA 2JLEA 4O3RA 5LSLA 3NY0A 4DI6A 5KT4A 1SQEA 4YR3A 4TU7A 1Q86T 4N47A 1Q82T 2J6TA 3F0NA 1EQMA 3TUPA 4U7UD 4CLTA 1YJVA 3MWBA 2WVCA 2RS2A 1SH3A 1C2PA 4K2JA 1SKSA 1S9GB 1KTQA 4KGXB 4P7TA 2P9GA 1EIYB 3H5SA 1XERA 5K14A 1XMOF 3W9HA 3N28A 5LMUJ 1N6QB 2L9NA 2YKOA 3M2VB 4Y65A 1JX4A 1PO6A 4NX9A 5ETPA 3NCRA 5DETA 1WOSA 2MZQA 5E7OB 2VASA 2BJ9A 4L73A 3L7UA 4EZ6A 1Q79A 4C8ZA 4AL5A 1DBDA 5E2QA 5C42A 2DRDA 3CCRS 4ID5B 1SCJB 3DI6B 4WFAQ 2NXNA 4J5OA 3ILLA 3OT9A 2QRRA 5KFXA 4CTAB 4AL7A 1X0PA 3DDKA 2ALZA 2CPXA 5I42A 5H9EJ 1U02A 3AODA 2DEIA 4M5IA 2QL9B 1VQMS 3MPVA 1FHTA 3ISND 2HHSA 1YVFA 4RUAA 1UEKA 6FDRA 3RBXA 1IBKF 3D6HB 4LF9J 1U1NA 1DLOB 1NAQA 4LF5F 3WX8A 1BGXT 2XMWA 3JSRA 4KC5A 3B6BA 2UV8A 1I5OB 4UW2A 5KFJA 5E3AA 1JMTA 2R9LA 3F73A 3SCJE 4MMOA 1KBRA 1S1XB 1SL0A 2RVJA 3KDOA 2OH2A 1QJHA 4I4BA 2QV6A 2E5IA 3IWXA 2Y3YA 5HQ8A 1FKPA 3LP0A 2GJIA 2D9PA 2FVRA 1WACA 1Q81T 5BJRA 3NKYA 1TKXB 1C1BB 3SMZA 2J7KA 1FTCA 2DR5A 4GC7A 3OR1B 3JTOA 1WC3A 2X3GA 3AB4B 1RTJA 4UT4A 1PSDA 7FDRA 1KOOA 1HD1A 4I2PA 4DV2J 4OX7A 4DEZA 2C2EA 1NZAA 3C14A 2J5AA 2NUHA 3OTEA 1RBLA 4RW9A 2M0GB 4TU8A 2MGZA 5KOXA 1B0VA 4PPDA 1YKWA 4HTIA 1RADB 1GT8A 4NLXA 4RZRA 1TKTA 1HA1A 1VQYA 2UZAA 5HQLA 3PZPA 3NNAA 5K8MA 2YVSA 1S99A 3GFYA 3EGZA 3FMWA 2HNDB 4OJGA 1D1UA 3TJ9A 1RAFB 5E3QA 5J1EA 3EVWA 4F4AA 3HHNB 1RWNB 4RJVA 1WJ9A 2OSQA 3OUYB 1NNDA 2DHGA 4NE9C 3UN2A 3D5MA 2R7WA 1HBUA 3N5FA 5BYSA 5D78A 2IYGA 3G87A 2J76E 1UZHA 3IA0A 2CRLA 4N8OA 2HZCA 3MR6A 3LP2A 2IDEA 2R2TA 3GIRA 1OY6A 4OZNA 2B9YA 3D2WA 2GO8A 2CWKA 3QSYB 2LQJA 2XBPA 2JEGA 4NEZA 2PDAA 3CVKA 1JLCA 2ZBCA 4DF8A 1N48A 3IAM9 1CS4A 2HGNA 1RSCA 3CCZA 4NLYA 1B64A 4RW6B 3DU5A 1NKBA 2HURA 3C6TB 4D3HA 1DTQB 5J1NA 1D9AA 1IKXB 1LW2B 1FWLA 1G2EA 5IXUA 1TL4A 2KT2A 5CYQA 3T1HJ 1N0UA 4LVOP 2BUNA 1Y10A 2HHUA 2DNYA 4UZBA 5GAHI 2Y1IA 4USJC 2V5HG 4MFBA 2QA2A 3EZ5A 4MYTA 1C0TA 1U0HB 4KPCA 4DZDA 3IM8A 4J7CA 2O67A 4XO0A 1YQHA 4CRJA 1KDNA 1RWPB 4F4WA 3M8RA 2CYYA 4FXWA 5DGBA 1T11A 2F65A 3U1NA 3CC4S 1JLQA 2IJNA 3UDEA 2JC1A 4Q8FA 4OHVA 1IR1A 2Q3PA 3MR2A 4EWTA 2KO1A 4RW8A 3Q8SB 2QA4G 3IFEA 5M2UA 1YRUA 2ILYA 3JTPA 1TV6A 3LAMA 4RW7B 2OPRA 1RT1B 3QJPA 2WBMA 5A8RB 2PO4A 3CCES 4DQIA 1NJYA 2VH7A 4CLKA 1DY3A 3FVYA 1IM6A 1YG0A 2XHWA 3MAAB 3MEDA 2YWEA 4HDGA 2D3UA 2IVFB 3OFGA 2A2CA 2RRAA 2XHCA 1OPIA 1QSYA 1ACMB 4AE5A 4IUFA 4KGVB 2W9BB 3NCQA 1H2VZ 1IN0A 4G6VB 2J9EA 1EKRA 2QYGA 3DLEA 3PW7A 3K8WA 1YK9A 1O0PA 1X0FA 2VV5A 4HI2A 4CWBA 4NASA 3RBZA 1OJ4A 2I8EA 1YIJS 2DRBA 1U4BA 3NAIA 1VBZA 1JLEA 3QT7A 4EYIB 2K3IA 2W9CB 2XTJP 1IKYA 3H5YA 2CAJA 3EE3A 3SBMA 2MKCA 2BE2A 2XYGB 1VRUB 1W26A 4WFBQ 2YKMB 1RHUB 3GV7B 2ALYB 5KFAA 2XMJA 4CLSA 2U1AA 4NMLA 4JI6J 4PWDA 1WHYA 4IOBA 4J9PA 1BHNA 1LW0A 3KJVA 2ZOFA 4WFNQ 1RKIA 4LFBJ 4KJIA 3QGGA 3RGIA 3LP1B 3V6DB 3NL0A 1HHQA 4ZJLA 2R2RA 2VPXB 1H72C 4G1QA 3FFIA 3T6BA 2QFJA 1YDLA 1C4CA 5IQQA 3T9NA 3I55S 2HZAA 1X7VA 3QFHA 2AP6A 1S49A 4NZ7A 1WWHA 4USTA 2DNRA 4LQ3A 3PXGa 2CKWA 5BXIA 2RB7A 3E8OA 1FDNA 2GAHC 3NMAA 2ACMA 1S7HA 4IDKB 1X4DA 5JJBA 2DR8A 1K47A 4OFZA 5F3ZA 3MUMP 4H4OB 4E2FB 1S72S 2VA3A 1WSVA 2HFZA 2UU9J 4UQTA 2KFZA 5DO2A 1X9SA 5IT9U 1F5CA 4A8SA 3HZGA 3UFCX 4ILRA 5DGAA 2PIIA 4CO2A 3MMCB 1M0SA 2WZ1A 2HW3A 1IQTA 3H59A 1H7XA 2A2DA 3D1QA 2MKJA 1UZDA 2QSFA 4M95A 4OMFG 3TZWA 2IJRA 3BR8A 2EFPA 4OZ1A 1FJCA 4CLLA 1C1CB 3MD1A 2HKEA 4NLVA 2EFQA 2LXIA 4WBFA 2E5LF 3E01B 2N7CA 2HQGA 5J2PA 3CMQA 4O3NA 1VQPS 2VFRA 4LR9A 2JVOA 3I0SB 4FBUA 3CO0P 2VFSA 4XPCA 1R8BA 3KLFB 2R8JA 2HFNA 2QT7A 3DRRB 2QL5B 4CLPA 2M2BA 3HSZA 4C48A 5D4OA 3U27A 4F02A 4DU7A 2CPYA 1PILA 4C0OC 3HVRA 1NKEA 2BQ3A 3BO4A 4DLEA 1FRXA 1WC6A 3RBEA 2VD3A 1SIWB 2R7XA 2D69A 1OPZA 2VPYB 5BR8F 5A2QU 3BEGB 3EX7B 3FJ2A 2LCWA 2ROPA 4USKA 3QLHB 2QN6B 2VU5A 2HRUA 4X4PA 1Q95G 5L1KA 4DQQA 4H4MA 1B7YB 2QGFB 4DWIA 1KLNA 3VVTA 2XS5A 1KQGB 3D66A 3U1LA 2C3PA 2FJEB 3TQEA 2JRSA 5HVHA 4LF5J 5EX0A 2XLKA 2V8GA 1FESA 1PCAA 2XSJB 1RTHA 4MKAA 2FVPA 2IBOA 2D7SA 3R2DJ 3A8EA 4NYOA 4OI0A 1HNXF 3GG1A 3IS9A 2J0QD 2E29A 1D0EA 1OY9A 2DR7A 4ZPWR 1FERA 4ICLB 6FD1A 2I2YA 4LT6A 5DQGA 4JI8F 4NLGA 2EKYA 2AV5A 3GIIA 4OLPA 1R8PA 4Y0FA 2MHNA 1U1MA 2VOOA 5HJYA 2E9ZA 2NYHA 4A8MP 1KWMA 2FJAB 7AT1B 1RTZA 1WG4A 3AOCA 5B0FA 4ZVUB 2KT3A 4O4GB 5KFVA 3CD5A 1D09B 4FNHA 1H6KX 2EFOA 2DPIA 3TWZA 1OS5A 1RTDB 2KH9A 4DV7J 2XO6A 2B5JB 4OX6A 1Y0HA 3J7A1 3POTB 3TA1A 4DFMA 2OFGX 4HDHA 5B0EA 4PG7A 4QW8A 1S9GA 3QGHA 2MQPA 1T0TV 3UVJB 3H98A 2BX6A 3UR3C 5L9NA 1IWGA 4R0EA 1N6QA 2X1FA 1VHFA 3M2VA 3U1MA 2LDIA 4ZJQA 2IDLA 5KFYA 1WHWA 2HLTA 3BDPA 1AA1B 3HVAA 2FQQB 3UD4P 4ID5A 4Q45A 1UVJA 1VFJA 3DI6A 2LMIA 3LANA 1S1WA 1RT6B 4RUCA 1Q8IA 1CJTB 4CTAA 1AROP 3IGNA 5JVGQ 3HKZD 2DT9A 1TVRB 2YX1A 1NXIA 2W01A 3BPDA 4M5MA 1T03B 3CJ5A 3CD7A 3J81U 1U7LA 1DLOA 5F9LA 3R6GB 1FJGF 2EFVA 1B99A 2XMMA 2ZM6J 2XS2A 2YTCA 2CG4A 1DTTB 1UEUA 2DH8A 4C8OA 2LDYA 1S1XA 2NUUG 1OMSA 4QQBA 4RW4A 4N41A 4FPIA 3G4SS 4QR1A 1IJFB 3AD9C 1MN9A 3AOAA 1H38A 2MMYA 2L08A 1M5KC 3V81B 1QSSA 2XQCA 2K06A 1XMBA 2E1RA 1EP4B 2CQCA 1TKXA 3C19A 1C1BA 4DFKA 4NLPA 1T7PA 3OR1A 1U26A 5DG8A 3HT3A 1YRTA 3ZZTA 3MOZA 1S0MA 2MJUA 1J27A 3LF0A 2I1RA 3VGSA 2BXJA 1ZA1B 3D1HA 4R8UB 2P9EA 2YNFB 1B3TA 1SB6A 2RJZA 1K1QA 1HBMB 5KFEA 4W92B 4UOFA 3DC2A 1I51B 4LFCJ 4DZ6A 3A3OB 4ZHRB 5KG4A 2FZCB 3M7VA 2JHEA 5M2PA 2VJVA 3C15A 3O1LA 3CT9A 2HNDA 4JI4J 5HAOA 3TQ1A 1P9YA 1N0VC 5H9EK 4X4SA 2KFNA 3OUYA 1S4FA 2G0IA 3OTOF 2Q66A 2EBGA 2BM0A 1P8GA 1X5PA 3NS7B 1JXVA 4J9MA 4C9DA 4YB7A 1NK6A 3PW4A 1U1OA 2BYCA 1LK7A 1SL1A 1F6TA 2VBZA 4LVNP 2AEFA 5D4PA 2HHHJ 4YB5A 3ELHA 4EEYA 1BLUA 1OO0B 1VJWA 1F9EB 1GH8A 4UY85 1PYTA 3VQSA 2NSCA 4ZA1A 2V8VA 1CJVB 3KKFA 3F56A 2CQDA 5CCLA 4OYMA 2KRBA 2HWHA 3GG0A 1NDCA 5IZHA 2UP1A 4F2RA 9ATCB 2QLBB 4ZP9A 4RW6A 2MZJA 3CJ2A 4YMEA 3C6TA 1U6FA 4AL6A 1DTQA 3QGPA 3TUIC 4K4WA 4B3SF 1IKXA 1LW2A 3M9MB 4R25A 3CULA 2XSFA 1K9MT 2XC9A 1WF1A 2F8EX 4FYYB 2XGQA 1U0HA 4RWWA 3CJQA 5CAAA 3KK3B 3N5BA 1Y00A 2GJFA 1TELA 3VAMA 2NXJA 5KT5A 1ZZFA 1UWAA 4FXDA 3CW2C 2GW8A 3GYNA 1NLKL 3U7JA 2RKIB 2MY7A 4DPTA 5B0CA 3VAHA 3K5MA 1WNEA 4ZVQB 2LA4A 3NGDA 2MKIA 4RW7A 5FIIA 1RT1A 5A8RA 4K2XA 2DIVA 3N01A 1H7WA 3BF4A 1PKUA 3A13A 4B9LA 2DVIA 3MAAA 5DRKA 1S6QB 1YJWS 2LP4A 5HI7A 4ED5A 2DISA 3UD5A 2IC3B 2GV1A 1IJEB 2W9BA 4DHVA 1W7WA 3LAKA 4Q2LA 3SYZA 5D4LA 1YBUA 3UR0A 3CDAA 2E5LJ 4QWEA 2I0XA 3W65A 1NEEA 1RDRA 4P72A 1NJIT 2B4VA 3QYYA 2R7TA 3DLBA 2HQIA 2V67A 4ZVHA 1O6XA 1T05B 1N32J 1Q1KA 2ZE2B 4NZ0A 2R2SA 2FC8A 4KV8B 1R3NA 4J37A 8RUCA 4DL6A 3IGVA 3UN3A 2W9CA 2CZVC 3R7NB 5BYQA 1HHSA 4YP3A 1VRUA 4U7UK 1UAWA 2YKMA 1RAHB 2V4JB 1HNZJ 1S1UB 3RG6A 1R0AB 4DV1F 2C1EB 2DPJA 5AXKA 4W98A 3LP1A 3V6DA 3BKUA 1NK7A 3DXBA 3IMQJ 4M94A 2HFOA 3W8PA 5HBMB 2WVFA 3PX4A 1KRPA 4ED0A 1TL7A 1MW7A 1Q4RA 4A8FA 2DR9A 1VQ5S 1ZPVA 1RZMA 4F4YA 4IH6A 2RRNA 3DM2B 2UUWA 3RYLA 1RBAA 1IUJA 5KFRA 1HNXJ 1MROB 1SKUB 1RWXB 4DUZF 4K5RA 2QG9B 4DL4A 1SJQA 1W2IA 3CJ4A 3B4DA 1U0SA 2L9DA 2W2MP 4IDKA 2YNHB 2ZJQQ 1URRA 2HVZA 5KAKA 3WHIA 1CBKA 2X1GA 2ZD1B 4RR5A 1DARA 4U9RA 2OPSB 2BA9A 2ZH9A 4EI2A 3FCVA 1Q78A 2AW0A 4ZCIA 2XI3A 4JI7J 4MTPA 2GC8A 3SSQA 2M8HA 3KJQB 4OYWA 3H4DA 4KH1B 4UOGA 2PT0A 5KFDA 4Y2IA 5HANA 2OI2A 3M6WA 1UVMA 4WZQA 4WXOA 4WP8A 2OJ3A 1EZZB 2IMWP 4K4YA 5HN0A 3KMSA 1C1CA 4JI5F 2IM2A 3E01A 5L8RC 5DQIA 5KFNA 3VAIA 2BJ7A 5KFWA 2APOA 4MH8A 1H73A 3I0SA 3G6XA 1E6YB 3F44A 4NLUA 3KLEB 2HYIB 3KLFA 2ZNYA 1V3RA 3DRRA 3A12A 3CIMA 1RHJB 3VF0B 1I94J 5C2CA 4Q0BB 1I1GA 1HYSB 5D0GA 1WTBA 2Z0GA 4W90B 4KO0B 3DHWC 4LRBA 2IVYA 2AF6A 1RT5B 4Y28C 4K50A 1SKWA 4A47A 1RT4A 1NJXA 3QLHA 2N4DA 2G1HA 4LUBA 4B08A 2ZITA 5K20B 1VYAA 5K9FA 5A8WB 1AW0A 4C3KA 4ZVSB 4N76A 3FDSA 2H65B 4DR5F 3KLGB 3M05A 2W1BA 3PW2A 3B78A 4OV1A 4X4OA 2XSJA 3ADAC 2KJWA 5CXTA 4YN3B 4Y6IA 5CHCB 4URQU 3UNYA 1YJNS 3BH6B 4KHPJ 3V4IB 3FBCA 2W24A 2D3OR 3NP5A 2RQKA 4HI1A 4ICLA 4I69A 4NYPA 1JLGB 2GIRA 2PA3A 1VBXA 2DNQA 4ZPTR 2XCPA 2E5GA 3WIVA 3KHHA 2E7VA 3Q8YA 3N9UC 1S0NA 4KT0C 4ILLA 2H4YB 2VPZB 4Q43A 2GFFA 2C3MA 3JAMY 1P6TA 3ZZYA 4DR6F 3HLUA 4OI1A 3M8SA 2P6TA 1HWIA 2AWZA 4NXMF 4O4GA 2XGPA 2WW8A 2XB2D 4HLBA 5B08A 2EG1A 1SJFA 3Q0AA 1J5EJ 5EDWA 2HVHA 3THVA 3R5BA 1RTDA 1TUVA 3HKWA 2BRLA 3CJRA 3CNQP 2NLWA 1RCOB 4X4VA 2XY6A 2B5JA 3POTA 3QIPB 2R8GA 2AT1B 2HNZB 2ZH8A 4QR0A 2BBEA 3M8YA 2G1DA 3UVJA 2LFVA 3W62A 3MEGB 4FVMA 3K57A 3BM7A 3GJTB 2G0CA 4RBVA 3T41A 5E0OA 2OPQB 2X1AA 1NK8A 4DV5F 5DDOC 2HBQB 3UCGA 2EW9A 2VQEF 3GSIA 5GAGI 2DHHA 2VC0A 5KT6A 4YFUA 5K5MA 2RDJA 3M9NB 2DYAA 1ZAXA 1H0HB 1DURA 3ZZRA 1CJTA 5CZVA 2OPPB 1GTEA 1FFGB 4JI3F 3GR1A 1HI1A 3KLIB 4PWWA 1AT1B 2LA6A 5F8JA 1KQFB 1TVRA 1U1PA 2JFDA 4PAAA 1W25A 2BMBA 4LRAA 1N88A 1T03A 2CQ3A 2MSSA 4QPXA 2QZ8A 3GFHA 3UO0A 1YBAA 4NCAA 4CLZA 4XAKA 3N6LA 2KG0A 2BDPA 1DTTA 2AYMA 3PM9A 4QYZK 1V6HA 1GMWA 1N33J 4BLGA 1F2HA 4ZITA 2Y1RI 4B3SJ 3M2UB 1SBRA 3FQKA 3T9ZA 1IKVB 3MEKA 4IH7A 4AYBD 3V4MA 3V81A 3K58A 2ASDA 2PD1A 5G0RB 3JB9k 3HZEA 1EP4A 1KP6A 5D15A 3M6XA 5L39A 2A0FB 4ZVEA 3I56S 2R7SA 4I68A 1D8ZA 2Y1LB 1T3NA 2N7YA 5K8OA 5MLCV 4LF4J 1U1LA 3AD7C 3QWUA 4L3KA 2X51A 4R8UA 2YNFA 3PG9A 1TFYA 1HBMA 4ZKAA 4PYAA 3IO1A 1ICEB 2DK2A 3H90A 2AX1A 4GO5X 1FDBA 4NOHA 5HSPA 4B9VA 3CJKB 1FXRA 4DS5A 3AA9A 1NM2A 3IBCB 2HLUA 1HW8A 4ZHRA 2FJBB 3QIDA 3NS5A 2HNYA 3EZUA 1T95A 4ED7A 1TAUA 2QC3A 3KK1B 4GVLA 4KB7A 1GTHA 4XIUA 1RACB 5U47A 3RBDA 1X4CA 1LNQA 2F4FA 1QTMA 4DV6F 1XNQJ 2CUYA 1XC9A 4C11B 2VL1A 4NLOA 2CQIA 2N4CA 1XK8A 4OIXA 3SFUA 2Z4PA 1VBKA 4ETXA 2CVIA 3PW5A 1LOUA 1CJKB 3AQPA 3DOLB 1L3UA 2HBZB 3GLJA 3M2RB 4ELUA 1TL5A 4KHMA 1UL3A 3BSCA 4HH1A 2F63A 4JV1A 1V5VA 3W5YA 2DKOB 1CJVA 1JLAB 2ZBQA 4WCEQ 5EN1A 2VKZG 2AIRB 2Z57B 5FLXY 3CD0A 4Z37A 4DPWA 3GFZA 4PXDA 2VBXA 2FLOA 3ULHA 3MUVP 4JV5J 5GMDA 3MI7X 2OEMA 4J9UE 3B54A 2GIFA 1SJ3P 1T94A 4WIQA 3Q8VA 3UWTA 4DR2F 2DIUA 2H4WB 4C97A 4DV1J 4Z2XA 2U2FA 3TEGA 1FF2A 4F36A 5KFGA 5E5NA 3QZ8A 4X64F 2B8PA 4C2MA 2VDHA 2WVBA 1YRXA 2EK6A 3KK3A 1Q16B 4RBTA 3FBBA 3JSMB 2GMHA 2DNPA 2AYEA 1ZTWA 2YPZA 2J8SA 2YQ1A 4DUZJ 1CQMA 4P75A 2Z2MA 2B43A 4LFAF 4I1TA 2CJAA 2RKIA 1XQIA 3PO5A 3QQCD 3OTDA 4C8MA 1UP1A 2GVZB 2EXUA 4CYUB 3O6QA 4QWBA 1VJQA 4QIWD 1UJ5A 3JQJA 2VFUA 2VZ9A 2DHXA 1OYDA 1Z4UA 4MIWA 1S6QA 4F4XA 1VLYA 3AD8C 2R7RA 4ED6A 1REVB 2IFXA 4PXBA 2AGPA 4N5SA 2YX4A 3KLVA 4X4NA 5ETRA 2DGQA 5F8MA 3M8ZA 1LQ9A 3G82B 1S4EA 4OYXA 2RF2B 3MURP 1NK5A 5E33A 1X31C 1CPZA 4OYIA 3NRBA 4JI5J 1HNWF 3TA0A 1TR0A 5JVHQ 2ZZMA 1SUQB 4G1IA 1HWKA 2BOAA 4JV2A 4HACB 2ZUAA 1TMMA 4K4VA 4Q5VA 1TKTB 2CA9A 4FS2A 3QJLA 4U95A 4YY3F 3TI0A 4U96A 2MQLA 1T05A 2GHVC 2ZE2A 4RKUC 4KV8A 3PR5B 2QSWA 4X62F 1ZBTA 1IKWB 4BWMA 1RA7A 5ETKA 2DO0A 5LXRA 1RAIB 2MXYA 4A8YA 5D3GB 1QE1B 1OQ6A 2UXCJ 3ZC4A 2Z58B 2QMWA 5RUBA 3R27A 3CXCR 1IBLJ 2V4JA 1VQ9S 1QLNA 1S1UA 2HGLA 3HULA 1NDKA 1R0AA 1NH7A 4MIAA 3L3CA 3CDBA 3HM9A 1FDDA 1BUXA 3G9CA 3OW2R 5E3RA 3LP2B 1NCLA 1RYRA 1PYOB 2C2NA 2C2ZB 2FJDB 4IR1A 3TNVA 1LV5A 4EU0A 1WUUA 5HATA 5HBMA 2VBWA 2QIFA 3RRGA 1CJUB 2BJ3A 1XMQJ 3MF5A 1MWYA 4DX8H 2KJVA 4UUXA 3OD2A 2YKQA 5KFMA 4DCOB 1JLCB 1NBEB 3DM2A 3AQOA 1FK9B 1MROA 2JEIA 2KB2A 2JH3A 3ZXWA 4IG3B 4FF3A 2HRTA 2HQFA 2GAGC 3FCHA 3O5TB 4NWBA 1R27B 2ZD1A 5IC4B 4L3NA 4L75A 1TFWA 1F9HA 1HARA 2OPSA 4M8LA 4OX8A 2A1BA 4P74A 4DR6J 3IM9A 4X4QA 2DGOA 1WC0A 3HJFA 1HNIB 3HVTB 4G1PA 4ECQA 1AYEA 4ITSA 1PBUA 2E1PA 2J0XA 1WI8A 1F9FA 2QA1A 4ZVRB 2HFUA 4I56A 4DMZA 3M8QB 2OO4A 4B3MF 2BR0A 1T9YA 5DS7A 1GX5A 3ZNUA 1M5SA 2B3TB 2F4VF 3ZTQA 3GPAA 1LWEB 5ETVA 2RILA 5CABA 3VZIA 3EXCX 1E6YA 2B4UA 3KLEA 4RNMA 3CDUA 2C3UA 1QD1A 3CMES 4DXLA 3GQCA 4K4UA 1WOOA 3HT0A 4USWA 3TVKA 2KN4A 2JLFA 2D1CA 4Q0BA 1HYSA 2FGOA 2CADA 3AT1B 4DPYA 4KO0A 1RT5A 3AFGA 4NA1A 3W5XA 4MIBA 3BGOP 4V19J 4K0KF 4ENOA 1TUGB 2M3DA 4X65F 4UUWA 2LU2A 4IQMA 1T9VA 4HYKA 2IHR1 1V3ZA 4JI3J 1RU1A 2G13A 5A8WA 3SQGB 3SQOP 5KFSA 3I0RA 1K1SA 4E8UA 1S0OA 4B9TA 1XWLA 1YWXA 3KLGA 4EK2A 2CPHA 1K73T 3TJAA 3GU0A 5EUHA 3CTRA 2DCLA 2DH7A 1UA0A 1Y7PA 3G6ES 3TANA 3V4IA 1N52B 2VJUA 5KT3A 1IKYB 4CO5A 4RL1A 1VRQC 2O5DA 3Q8UA 2AJFE 4TYBA 1AUSL 3IG1B 3BYRA 4YDXA 1JLGA 2E1CA 5F0WA 1Q8LA 4BHQA 3CCUS 4H54A 4FS1A 4KRWA 2JNJA 1N36F 5DLGA 4NZ6A 1DZ5A 2MKSA 1DQ9A 3VZHA 3BYPA 5KFFA 2HFVA 2FY8A 2VFTA 2OELA 4B9UA 2YBVA 1ZH5A 2DCUB 4BC9A 2H5IB 1UFWA 3VAFA 3ENVA 1YJRA 1RE1B 2V63A 1XR7A 1GQEA 1Q7LB 3GB0A 4QIEA 3AA8A 4PUOB 2KVIA 4J9NA 1HBNB 3CPWR 1RBOB 5E41A 4C3LA 4LF8F 1X5SA 3QIPA 2VQFJ 1UA1A 2Z30B 2G2OA 1MMNA 4ECWA 4ALZA 2C28A 2IM0A 1N8RT 2CJYB 1SJ1A 3MEGA 2F7VA 3CIZA 3KOAA 3NXZA 4USMA 3ISZA 2AEJA 4RNNA 2OPQA 2XEXA 1NJZA 3PY8A 2XZTB 4O3PA 1VK8A 4JB8B 2GMLA 3QNWB 2UUBJ 1SVDA 1FRIA 3P45B 2AD9A 2EVZA 4DOZA 2BQUA 4MKYA 3HI9A 3DYAB 1APSA 4ZIVA 3FEYB 4DR7J 2LQ5A 4WYWA 5F9NA 1R0BG 2R42A 1N4LA 1NUEA 5LMNJ 4LSNB 3FZ2A 3LGHA 1ULRA 2XG8A 2OPPA 1OIAA 3UE2A 3VWSA 2KXNB 3KLIA 5CZXA 3UNGC 2GNKA 1EB0A 2ADBA 1OWXA 3OSPA 4J9OA 4DV4F 5F8GA 3NGKA 1GFWB 2HSEB 4J9VA 2DNZA 3NWGA 3MM6B 4U67Q 2L3MA 5KG1A 1URNA 1U2RA 2Q79A 1Y9OA 4IFYB 3DLKB 1GK8A 2YWGA 1SIZA 1M90T 4A8KA 3PW0A 3ILJA 2V0NA 3RRHA 4I6YA 1RISA 2ERRA 3K89A 3M2UA 5IQ6A 1IKVA 3X3UA 2OTLS 4CH7A 3DDNA 4PYDA 3NGTA 4DN0A 3PO4A 5G0RA 1WF2A 2FUG9 3CJTA 3UCUP 4OZ5A 3L4BC 1N34F 3PHTA 3KWMA 4YQWA 4M5LA 3H25A 4WIIA 3QO9B 2ROEA 3BS9A 2AYBA 4I7FB 4USVA 2KM8C 1RTHB 2BQRA 3MDFA 1ROFA 3I5BA 1AUDA 3TUZC 2AHOB 4LF6J 1X5TA 2CQBA 1OSCA 3CJKA 4TY8B 4LFAJ 5KFLA 4CT8A 1FXLA 3RAQA 1P27B 2ZVSA 3Q2SC 3VALA 1R8HA 1VK3A 3JAMU 2Y8YA 4DR4F 2ZH5A 1SV5B 3KK1A 1SC1B 2XMUA 2HVEA 1V5IB 3DN9A 3J7YU 3M32A 3H2LA 3QMQA 5J1PA 1WG5A 4DV3F 2HHXA 1NDPA 1PC4A 4C11A 2KM8B 3JSYA 4IOCQ 4RLEA 1IM4A 3R1LA 4QZVB 5HMWA 2R7VA 1CJKA 2J9CA 4NLSA 4I0WA 3JTNA 3DOLA 3QRRA 3M2RA 3OHBA 4QIVA 4A48A 4LF1A 2AJ4A 1R8AA 3IXQA 1JLAA 2M9KA 3MUTP 1VIXA 4RU2A 1NH8A 2UUCF 3PX0A 1XNRF 3DOKB 4OX9J 1LFPA 3MCOA 3OV7A 3M6VA 1FT8A 3M9OB 4DLGA 2B4PA 3OL9A 1FKOB 5ADZA 1FJ7A 1WC4A 2UVWA 5B0BA 2RDDA 4WP3A 1GAOA 1TL1B 2HGMA 3PYEA 3P49B 2HS0A 3D9BA 1RTIB 1V3SA 3TVYA 2CZ9A 1NZ8A 3LWLA 1PJ6A 1S1WB 4A8XA 3Q23A 5SZTA 1UKUA 3BZQA 5HMZA 1Y5LB 3WDOA 4Y2KA 3EDRB 3HHEA 2BANB 3FBFA 5CD4A 3DCAA 5L46A 2MSTA 4BBYA 3FGVA 4LQ9A 3W2WB 3OHAA 3BBBA 4UQGA 3JSMA 5CH7B 2QFIA 1RT7B 2VBYA 5LJ3Y 1HW9A 3TZYA 3P96A 3MMAB 5H9FK 3C16B 3ZZPA 1X5OA 2E9TA 1EETB 2F9JA 3L7PA 1F5AA 1ZOTA 4RW4B 4YS2A 2VB6A 2GVZA 2BW2A 2CQ4A 4CYUA 2BEFA 4QWDA 1VQ7S 4ES1A 5IFMA 2GCFA 3BV8A 3G8TA 5LSOA 3QWPA 1TL3B 2DBBA 2QLWA 3ZNJ1 1SH2A 2E1AA 3MFIA 1TU0B 4FYWB 3W9IA 3I5CA 4DV0J 1REVA 1IWAA 2JEFA 4WXWA 3ZZUA 3ET6B 3ETMA 4ZPAA 2J0WA 1RWWB 4QBUA 3G82A 3A8JA 2A6MA 2ZH7A 4ZIWA 4L74A 2RF2A 4O3SA 1U24A 3WC2A 4Y2AA 2KYXA 3TW0A 4F3QA 1G1XA 1A7GE 1BE4A 1KOHA 4ECXA 5KOWA 2AZ1A 4LRFA 2XMVA 1NK0A 3G96A 1MMDA 3R3TA 5LXYA 1SUQA 1HWJA 3MXHP 4KHRA 4HACA 2KRRA 3S8SA 4U8VA 2DJWA 1Y4ZB 3PTWA 4GVBB 2CPDA 3C15B 3QT8A 4WJBA 3JYTB 3P6YC 1U49A 2QMXA 2VIHA 4OHZA 4EO8A 2HWTA 4JI1J 2DNNA 4I6WA 3WX4A 4M5DB 2OKQA 2HHPA 1IKWA 5D3GA 4OI2A 2HPUA 2JFKA 1QE1A 2FD2A 2DR6A 4UOHA 4DCJB 4GO7X 4RBUA 2C3OA 3D1OA 1NJWA 2EI5A 4X65J 2IAJA 2Z2YB 4OLOA 4CLYA 1HMVB 2QTWA 3KXDA 2ASYA 3EGNA 3H2VE 1F1BB 5FLXU 2E66A 4ANCA 2DY9A 3QAEA 4HT7A 2KXHA 3QGIA 5KG3A 1KFDA 5KFCA 3N6NA 1SPBP 1CJUA 4JI0F 3AXKA 4C6AA 2W9AA 2AZ3A 2B51A 2IYIA 1YJUA 1KQKA 3RB4A 3O8WA 3Q24A 4WYLA 1BQMB 5D8HB 1FK9A 1FI4A 2A6OA 1YBTA 2WAQD 2CVEA 4OHXA 3S01A 4KGKA 2GIQA 1HQEB 1MWQA 3WBZA 4IG3A 3US5A 4MKVA 5IT0A 4NMXA 4ZVPB 2MDAA 4ILMA 4P7VA 5IS2A 3V2UC 1N36J 4ID8A 4DPXA 2CJQA 4IH5A 1NPPA 4F3OA 3PACA 3RAXA 2W7AA 1HNIA 3HVTA 1VQ4S 4WFZA 1K0VA 4G65A 1VIOA 1KR4A 5A76A 2WB4A 3I4HX 1FCAA 1X9MA 3M8QA 4WKRA 4NLWA 3EPGA 4DG1B 1EAYC 2GHWA 2K1RB 2ROGA 1AZSB 1JJHA 3G8QA 3W64A 3OVAA 2UVUA 4R0JA 3GIMA 2JX2A 1LWEA 4QPTA 2FPHX 4E98A 1RP5A 3HO1A 3TOQA 3OLAA 2Y8WA 4F26A 1IBMF 1N5TA 1GXTA 3D68A 3CF5Q 3BDEA 4CNZA 4TY9A 3SFGA 2YWFA 2F40A 3ZZOA 3PHEA 3R1HA 2Z2LA 1UVKA 5LSRA 3HD1A 3IAS9 5ETSA 2KU7A 3HCXA 3PEJA 2P9CA 4GMKA 2KDOA 3IP0A 3OL8A 4B3TJ 5KG6A 4IO1A 4LSLB 3SI8A 2VDIA 1X4AA 2EEYA 5LL6d 1NU4A 2H9ZA 3KJFB 1I6JA 2Y9HA 4DSIA 4QIFA 4Z7YA 4KIAA 3NNCA 2R2UA 2CQ2A 2ZDPA 4F50A 3SQGA 2HAIA 3GIKA 2ZUGA 4WF9Q 2K3KA 1YJ9S 2EBEA 3RZAA 1C0UB 2B9XA 1JKHB 1RB0A 2MZTA 4IQXA 4MK9A 3R7SB 3ZTPA 5I3UB 2Q43A 1TK8A 3I4PA 1DQAA 1QAIA 3IG1A 4A8WA 3QRPA 2DD8S 3AJ2A 3OTCA 1GNKA 1U1KA 1A6LA 3T5JA 1QUPA 2XZDB 3W5ZA 3SV4A 4NI2B 1N34J 1Q5YA 4EYHB 1RWKB 2FVCA 2AJ2A 4LF9F 1S0VA 2C42A 1MMLA 2MY8A 3V6HA 3L95X 4DSJA 4DR1J 1TL7B 4PUOA 2H1YA 1HBNA 4DL5A 4C3MA 4QOTA 1HNVB 3T1AA 3KG1A 3HHDA 2XM3A 5KFZA 3H2UB 3VV2B 1VISA 1TZ0A 3H42A 2BJ8A 1PJ7A 1QSLA 2NREA 4DR4J 2MZSA 3GV8B 1FE4A 5D4NA 3P5TL 3HXMA 5J2QB 3H20A 2POKA 1S79A 3O3LA 3QFWA 4PWUA 1YI2S 4FN5A 2D74B 3I9V9 1JXEA 4PG8A 1G4CA 1L3VA 1RHRB 4YEAA 3T5LA 3FRZA 4XTTA 2HBYB 3EGVA 4W4MA 3BO2A 4EFAC 2Z56B 3CC2S 3DYAA 2MYFA 1RKJA 1LWCB 3H5UA 1FXDA 3H40A 4IRDA 2FVQA 1FRKA 2OP5A 4LSNA 1T02A 2ZWPA 1M1HA 4H4KC 2O3DA 5DDRC 3AOBA 2GS8A 2XZWA 3KG0A 1T9TA 1TK5A 1JIHA 2OSRA 1M5OC 4F25A 4DN9A 5CYMB 2IBKA 1XMOJ 3MM6A 3LALA 1Q53A 4IFYA 3DLKA 3KNAA 1S1TB 5GMEA 1HPZB 4ED1A 2GQQA 1E6VB 4KQZA 2M88A 3EXYA 1FFSB 1R7IA 1RT3B 1GXLA 4YOEA 1R43A 3CWJA 1RT4B 2CQHA 4CIOA 2IA0A 3ISNC 2OMOA 3HK2A 3CCTA 2IPOB 2H51B 1WDDA 3PCOB 4BDPA 3R6LB 1RWVB 4LR8A 2FHOB 2F8MA 4USIA 1BQNB 3D28A 1IBKJ 2XNQA 3MTKA 4GKKF 3QO9A 1X9WA 2RH3A 2V50A 1AFIA 2KYZA 1YZ6A 3TAPA 4I7FA 2RMLA 2R8KA 6AT1B 2B9WA 4IG0A 1S6PB 2EK1A 5F41A 1RT2B 2VA2A 2ZC3A 1UVNA 4FF2A 4TY8A 3NCPA 4V19X 3UN5A 4A8QA 1WI6A 3FQLA 3DGPB 2ZH2A 3G2XA 2HRYA 2R7UA 4J9RA 1UWBB 3DRPB 3T1HF 2OEJA 3P3DA 1XJWB 5GADU 1SV5A 1M5HA 2R7QA 4EZ9A 4ERDA 4CCHA 1RGVA 1ZAWA 5KFKA 3BN4A 2CPZA 4J9KA 1WORA 4FVCA 4QIGA 2G0JA 5ETQA 3OFEA 1N5QA 1NDLA 5AXMA 1LWXA 1HWUA 4NLRA 3LH2S 1AB8A 5GAEU 2CQ1A 4JOUA 2KG1A 2OMLA 3QATA 3SXLA 3PRBA 4TQSA 3Q8PB 4PXEA 2WOMA 4DL2A 2BM1A 2PMZD 2NYIA 4C0HA 1WD6A 2ZHBA 2BRKA 1VMBA 4WZMA 3GFXA 1FO1A 1C4AA 3EM1A 1RUSA 1WSRA 3DOKA 1RHMB 2VG7B 4O23A 2FLNA 1B7FA 1Q5VA 1FKOA 4C8NA 1NO8A 3HHLD 2DNLA 4CM2A 4FKYA 4FZVA 2XCAA 3QRQA 2V6AA 1QVGR 1TL1A 3PYDA 4X66F 3AB2B 2M4MA 4DCPB 2HHTA 1RTIA 2PC6A 3DGVA 3UDCA 2V8DA 2MZ1A 3VGTA 4R5PA 3M30B 5L9XA 3HVWA 5I4MA 2GVDB 2ILZA 3LUYA 2ZJRQ 3MZIA 1HD0A 1ZS6A 2BANA 1FX4A 3B4MA 2ZKUA 4JI0J 1FD2A 3B8HA 1BMQB 1X4FA 3S1TA 2V2VA 2MKKA 5AE1A 3MD3A 3W2WA 1ZPWX 1RT7A 1X4HA 4JYAF 3MMAA 2WW4A 4P52A 5G4DA 2EG2A 2HZVA 3C16A 1KNZA 1EETA 1NHKL 3TX8A 2MLXA 1N56A 2BKPA 2LXUA 3OJUA 4LF2A 3MPUB 3W9JA 2X3DA 4WK3A 5HROB 1WKJA 3PFOA 1VRTB 2HQCA 1K8AT 4JI6F 4DL3A 3D3CJ 4LFBF 4O3OA 5DG9A 1GEHA 2M7SA 1VQKS 1TL3A 4MK7A 4M1KA 1W2BR 3S6EA 2QLFB 4UZCA 1SH0A 1FD8A 1F2GA 1X60A 4O4RA 3ET6A 3E3XA 1VOMA 2R7OA 3J81j 5L38A 2LYVA 3NAHA 1H74A 4DDFA 4ETZA 2CPIA 3CUNA 4IO9Q 1WEYA 4QJVA 2YH1A 2LEPA 3AJ1A 4F8RA 2G4BA 5B7WA 5LT5A 2JL9A 2NCKL 2YKAA 1IBMJ 1SI9A 3QBCA 4GVBA 4O3QA 2HNYB 1IXKA 3JYTA 2UU9F 4IYQA 1RAGB 4P6QA 1XR6A 1TTHB 3THTA 5B0GA 3MM9B 4K8RA 2FLPA 1NHVA 3H5XA 4M5DA 1OQ3A 3NBPB 1UW9A 1DHMA 2BE7D 1OYEA 1X8DA 1YTYA 3DXSX 3PEHA 2ZFHA 3UQSA 3HHKA 5EX3A 4CO3A 1HMVA 5KT7A 2HAFA 1JNZB 4ECRA 1NKCA 3KMQA 1SQGA 3LO3A 4WTOB 2NR0A 3ILOA 1Y11A 3DMJB 4DJBA 1T9UA 9RUBA 2ASJA 2CXEA 4ZVGA 4PCQA 1NPRA 4EGLA 1RA6A 2NZCA 1LEOA 1ZETA 3LGMA 2B7BB 3R5GA 3SCIE 1BQMA 5D0EA 2MJNA 1RLDA 1HQEA 1Y5NB 3BPSP 3OSNA 3KJNB 4NXNF 3EYZA 4DFPA 4F0KA 3MEEA 3KLHB 1O5JA 4MT1A 1REGX 4YR0A 2ATCB 5KG0A 2J0SD 1XIQA 4C4WA 1X4GA 1JK9B 3W60A 2XMAA 2L41A 1U8SA 4USUA 3F41A 3FRYA 2J9DA 2PFFB 4CO0A 1JLFB 2ZBPA 3NMRA 3JQKA 4DG1A 3HFZB 4B9NA 1NB7A 2K1RA 1AZSA 2FB0A 1XEZA 4YHHF 3NWRA 3T3FA 3GILA 4DSKA 2JLGA 1A0OB 3PKMA 2VC1A 4ED3A 4PQUB 1P9QC 1UPMB 1UCNA 3HSJA 2I38A 3CO9A 1KONA 2NZ4A 4RWXA 1S1VB 1ZA2B 3FK4A 3ZTRA 1Y5IB 2CQ0A 2W2QP 4DV7F 3W2VB 4LSLA 2YY3A 3CDEA 3C6UB 5D77A 3HSGA 4B3RF 3Q86A 3EICA 4OYZA 4U8YA 1U45A 3MPWA 4UF4A 2FC9A 2VHGA 1VQSA 2HS4A 4MYUA 1K44A 4FDFA 2CQPA 1ZM2A 4JP8A 5F3TA 1KKHA 5HLFB 3BJYA 1A9NB 4NYZA 1C0UA 1BD6A 2W4CA 1JKHA 2RIJA 1ZM3A 3AY0A 4F7VA 2OHDA 4G3IA 2V9WA 4F0MA 5I3UA 1ITPA 2PFDA 2EFGA 1Z2LA 3I82A 2ZEJA 5F8LA 5BR8J 1PJ5A 2PEBA 1HWLA 4HVZA 2XY5A 3C46A 1CG2A 1HL6A 4I64A 3GP9A 1GMWD 4X84A 2NPFA 5EWEA 2AGQA 2N3LA 2KZZA 1HQ2A 2M8DB 3DRSB 3MM7B 3FBEA 2CNOB 4NI2A 4ZPDA 3TYTA 4GKKJ 3CCLS 3DLGB 1TQLA 4FYXB 1SKRA 4FF4A 1F60B 4PZVA 5HMYA 2YH0A 2ZOGA 3G71S 4JV0A 2D3ZA 2ZKTA 2GHPA 1VC0A 1HNVA 2ZM6F 5KFUA 4B02A 2VICA 2W4PA 4CP5A 3QT6A 1LK5A 1EQ0A 3CE8A 2GQCA 3K8VA 4QU7A 2MEWA 5A6WA 2ZH1A 5HJXA 4JI8J 2WCXA 4NCGB 2D3O1 3NG8A 2GA7A 3IR5B 5J2QA 1J5OB 4J91A 3MECB 4LIWA 3J7ZT 3W61A 2MTLA 4OHYA 2IRXA 3BQ2A 4ZK7M 1EHWA 3AJDA 4A4JA 4WTYA 4CLWA 1LWCA 4F3MA 3BREA 4IR9A 3OR2B 1PAEX 4ZMMA 1FA0A 1UPPA 4KE5A 1VQNS 3K5LA 2E5HA 5FD1A 4LFCF 3J7AN 1S48A 3CDWA 3DLJA 3WQPA 5DZ6A 2Q6CA 4AQYF 3U02A 1YITS 4LRCA 4J9LA 5M2RA 5CYMA 3K2YA 3EVMA 2MHEA 3HHLC 1IQZA 4EMDA 2CNLB 5J2NB 5KFTA 1D9DA 2VUGA 1S1TA 1HPZA 4JI4F 3RAMA 5IV4A 1TUWA 1TMJA 3X1LB 2BJ1A 1RAAB 1E6VA 2DTJA 2RQMA 4X66J 5T14A 3MAQA 4M5NA 1RT3A 4P73A 4EBDA 3I32A 4H4KA 1HQUB 3BR9A 2V2QA 3IBFB 2HHHF 1CULB 1RYSA 3GCXP 4O44B 2ZZTA 5E3CA 1KFSA 2XWYA 2ASLA 4ANDA 2KT5A 1RWMB 4MJKA 3HHLB 3PKYA 5E3PA 3I0RB 3BBFA 1BQNA 3HMJG 5CYJA 3V6JA 3G86A 5LOQA 4ER8A 2W2NP 1RHKB 1FJGJ 2Y1JA 2Y0BB 1VI7A 4JYAJ 2KKHA 3O2IA 4JI2F 4FYVB 1S6PA 3CSKA 1RT2A 4K4XA 3DFEA 1F3VA 3D6TB 4DSEA 1NMEB 2F9DA 3MOJB 2XMTA 3MTJA 2OIHA 3DGPA 4I6AA 3RU0A 1UWBA 3DRPA 2HK3A 1UETA 4X4RA 4F04B 4PXCA 2HHQA 3IN5A 1I3OB 5LJ5Y 2I9SA 4FF1A 2NQPA 2VG6B 1PGZA 3FEXB 2JJ4D 4NA2A 5F8HA 5J2MB 1IVZA 3MR5A 1M5VC 3IR6B 5AXNA 4KKOB 4DQRA 4WU3A 3I5AA 4ZDNA 4DUYF 3HJVA 3EJMA 1SXLA 4OQJA 2D9OA 4RNFA 4AFFA 3VGUA 2QE5A 1UW4A 4ED8A 1X4EA 3MM8B 2Z2ZA 3EUNA 3MR3A 2AYGA 3QAUA 4KGMA 2VG7A 3KFWX 3D0GE 2J6UA 4P10A 3EMTA 5A6PA 3D54A 1Y3KA 1FDAA 4K4ZA 2HQ3A 3OTOJ 3ZZZA 2P5VA 3R5CA 2YNIB 2HFSA 1UFKA 3L7OA 1NRKA 2C2RA 3UDVA 1FNOA 1FKAF 1XN9A 3D6MB 2L9WA 1G3OA 2OD4A 1D3WA 3FKBA 3M30A 5F8IA 3VHQA 2GVDA 3MPDA 2EWHA 2LQ8A 2D41A 2J8AA 4F67A 4X4TA 4LBHA 3OL7A 1WELA 4XPEA 4BCAA 5DQHA 3M1VB 4D3GA 5AXLA 4LRDA 5ETOA 1GMVA 5C24A 5DZ7A 1N32F 1R6YA 1CC7A 4OYPA 2A3JA 2E7WA 3J7Z5 2PI5A 1H2UX 2K2PA 3VAJA 3J80Y 2ZJPQ 3CCSS 3EDQB 1WEXA 3I96A 4JUZA 1U1RA 3UDLA 4QWCA 1MN7A 1R89A 2C2DA 4NXNJ 1HNZF 1FEEA 4TQRA 4URGA 5HROA 3UW1A 1VRTA 4L76A 1UJ6A 2RAQA 2V34A 2CPFA 3Q2TC 4I2QB 5FDLB 3CJSA 2V9KA 3TZZA 1RABB 3J7YI 1PG5B 2IA6A 3OPKA 2BVZA 5IWAF 2CJBA 4N7TA 2FIUA 2B8QA 1T9WA 2UXDF 3CD6S 3S7RA 5HVFA 4OHWA 2GZOA 2DH9A 5C7PA 4UY8T 3C8YA 3GSDA 4M63A 4U7CA 1KS2A 4YUDA 2V4QA 2FYXA 2EC2A 3WC0A 2AEMA 3MAHA 2V68A 3HPOA 4YHHJ 2XULA 2AGOA 5ETNA 1G7CB 2E5JA 2YWWA 4IRKA 1YHQS 3GCWP 1ZAVA 2ACYA 2KL8A 3SSRA 1U25A 3TP2A 2QLXA 4JI7F 3MM9A 4QYZJ 3PV8A 2X7IA 3NBPA 1KHVA 2HVIA 3M32B 2FLLA 4LF7F 1D9FA 1FRHA 2HBRB 3L09A 1B0TA 5HK4A 2ZWOA 1NK4A 1MSWD 3IC1A 2YWHA 1JNRB 2E44A 2FHJD 4L6V3 2Q1LA 3K5NA 4B3RJ 2DXEA 4K5SA 2MKYA 5KFBA 4DX7A 2V2KA 3M8PB 2DHAA 4CH0S 3BGLA 4CQ1A 2IM1A 2DXFA 4P2XA 4Q44A 3DMJA 4FPRA 2OD6A 1JJ2R 3LGNA 2NS1B 4TN2A 4CDIA 2FHMA 4HR2A 1Q0NA 4IOAQ 3I87A 2B4OA 4Z7CA 1I94F 1ZTTA 1Q8KA 4ELTA 4UTGA 1HIYA 2IRUA 4LREA 1B70B 1HBOB 3N4WA 3MCNA 2RT3A 2MQNA 3P5BP 3PX6A 2O1PA 4WFXA 2H5JB 3KUHA 5JXSA 2RHQB 4CH1A 1NSAA 3R5DA 1S77D 1HLWA 3Q89A 1S76D 3KLHA 2ZVIA 3SEOA 3H8YA 3UD3P 1V9OA 3GV5B 5ITHA 2JZ5A 4ECSA 2K7JA 2DITA 2XI2A 1AFJA 3MCMA 2O01C 4HHUA 3T19A 4ZVTB 3LOUA 4PR6A 2W8KA 5DJBA 3A8IA 3H4BA 2WHOA 2CG8A 4KSEB 3NNHA 2JDJA 5EWFA 3PRVA 5HP1B 1JLFA 4KHPF 4OZ0A 3RTVA 1RWUA 3KHGA 3BBCA 4LJMA 3D0IE 3RRKA 2AJ0A 4OI6A 4KTQA 4OJ3A 4F0HA 1LWFB 5IT4A 1S9FA 4L72B 3BGUA 4PQUA 2ABYA 2BKOA 1RCXB 3T1YF 2QLJB 4QWAA 4OZ2A 4RU9A 2WONB 1NK9A 1S1VA 3DHXA 2FVSA 1OSDA 2V8PA 2YX7A 1J5EF 3PIPQ 4X4UA 3NGRA 1JJ4A 2HWIA 3W2VA 4ZLLA 3OJSA 8AT1B 3PR4A 3C6UA 1S6OA 4ECUA 3ETOA 4B9SA 2EKNA 3LA0A 4OYAA 1S12A 1GX6A 4AQYJ 1SQFA 2H5EA 3KG4A 3K5PA 3EGWB 2WRMA 5HLFA 2DY1A 3KHLA 1KTVA 1WF0A 2PGCA 1TKDA 2XMKA 2IRYA 3N79A 3NOGA 5KFOA 3ZFVA 4ANEA 1TP7A 2CDQA 2ADCA 1TK0A 2HEKA 2XY7A 2O66A 2V4RA 3TEHB 1HFEL 5A8KB 3BSAA 2IAJB 4CLFA 1L3KA 2CJ9A 1N5SA 3DRSA 3MM7A 2V94A 2LECA 3GE9A 5F0UA 3D7SB 2WTFA 4Y00A 1WG1A 2NXCA 1J2VA 2BKNA 2GQ2A 2WK4A 4DR5J 2X1BA 3DLGA 2UXBF 4OI3A 1XTZA 2JVRA 4Y34A 4TNOA 5L1IA 2XLJA 3H0PA 4JI2J 2WSFC 3FSIA 2QEXS 3K5OA 4RX6A 1RWOB 4HTJA 3N6MA 1WDTA 5ETTA 1N33F 3ITHB 1UFLA 5CQGA 4CO4A 3MCSA 5IM0B 3KUEA 4MKBA 2YKNB 4HH0A 1HHTP 3R5AA 4NCGA 3VAKA 3CCWA 2V2ZA 3EVOA 2JOQA 2VG5B 4K4TA 4JBCA 4PEOA 2OFHX 4WP9A 1J5OA 4P71A 3DRYA 8ATCB 2F1FA 3W66A 3MECA 1U48A 5KFIA 2RUGA 1JLBB 3HD2A 4Y2MA 4ZLNA 2UUAF 3RB3A 4HL9A 4IFVB 4NXMJ 5L1JA 3P4UB 4LF4F 4K4SA 4AD6A 3BSOA 3PJXA 3OBIA 2Z8QA 5D0RA 3HSDA 4RUHA 3OR2A 4A8OA 5GVQA 3MM5B 3BGRB 1YJTA 1UVLA 3GYGA 4DUYJ 1S9EB 3GJRB 2DNGA 4GRSA 5EWGA 3KNGA 3C2PA 1GXUA 4WE1B 2WSCC 2GMJA 2MLZA 2LXFA 2HMIB 3SDEB 1VQ8S 2XS7A 4EO6A 1O8BA 5J2NA 2WBRA 1DQ8A 2J7UA 3VGVA 1ZM4A 3M8WA 3CCMS 2NPIA 3UI3A 3DU6A 5GAHU 3QPIA 4DV5J 3PNIA 1BQXA 3AXMA 1LXJA 2VQEJ 1XNQF 4ECZA 3A3PB 1XBWA 2ZDOA 2OTJS 2ZHAA 4ZN3A 2FJVA 2ZOMA 3FNNA 1FVQA 2IIHA 3NS6A 1YSJA 4DX6A 3DLHA 2MLYA 1HQUA 2BW7A 2BV3A 4B9MA 1CULA 3RW7A 5A0YB 1SC4B 4O44A 5AT1B 3VTIA 4DL0C 4FNIA 1QUVA 3W3SA 2G9OA 3HHLA 3NOCA 2LLZA 1VS3A 3N0VA 5ETLA 1UJ4A 2OEKA 5EGYA 5FJ4A 3PJ9A 4TYAA 5K8PA 4Q8EA 4KH0B 3NLCA 4KFBB 2RQCA 4LIRA 5DM6Q 2P8IA 1VHIA 5KFHA 3K59A 4JV5F 2FGCA 2W4DA 2DGVA 2IMOA 4OJ1A 1IR2A 3OXFA 4C0BA 5HMXA 4DSFA 2IJFA 5AJ3F 1SJRA 2HQDA 2UV8G 3Q22A 2DNKA 3RJMB 1MG7A 1DJ0A 1S5ZA 3ENQA 2BJEA 1F3FA 2DEJA 1FEHA 3RB6A 4FKXA 2RDIA 4K7QA 3E51A 5C25B 3CJ3A 2XLIA 1RK8A 4QR2A 2R8IA 2ZH4A 5D6GA 5IWAJ 3T5KA 2V69A 3M4XA 2VG6A 4PABA 3DOMB 3IRWP 3H7HB 3ZTSA 5J2MA 2UXDJ 3BGFA 4KKOA 4ZCMA 5DG7A 2KVQE 1T3OA 1NSQA 3C66A 1U6ZA 3PVXA 1MWZA 4DPUA 3W63A 3JS9A 4EBCA 2RU9A 3I31A 1IBCB 3TAMB 4A46A 3D3BJ 3BKFA 3WZ0A 4NRTA 2AKWB 1GMUA 2C2OB 3MM8A 3CC7S 4ZPVR 4H4OA 2C2MB 4ZPBA 2KHDA 1KEKA 4AUKA 3HFVA 1YGYA 2W8LA 1KN6A 5LM7E 3EPIA 1RLCL 3MMCA 4KY3A 4DV6J 4LF7J 1QY7A 1RXOB 1FRLA 2YNIA 1UEVA 1EJ7L 2KXFA 4C7QA 3DDIA 4TKTA 3D0HE 2BE9B 2WVEA 1VQ6S 4O0NA 4IRCA 3MGJA 1ZM9A 3PIOQ 3IRXB 1S57A 4KGZB 4F4ZA 4OZJA 4BWJA 4AXIA 3TZXA 2QX0A 3OFHA 1EARA 4OL8A 3M1VA 1KHWA 2ZBRA 3SCKE 2B6AB 2CJKA 2MQ8A 2QO3A 3SV3A 3RR8A 3TJ8A 3NGUA 2DRAA 3I9ZA 2FJXA 2UXCF 1FFWB 4RNHA 1X4BA 1IBLF 3D4JA 2J6SA 3MHYA
chains in the Genus database with same CATH topology
4F4XA 4LFBF 4O3OA 5GADI 2LU1A 1VLYA 5T41A 5DG9A 2M7SA 1VQKS 4NRUA 3PDNA 1TL3A 2R7RA 4ED6A 1REVB 2IFXA 1RQ0A 3DRXA 4PXBA 4AE5A 3CCVS 4IUFA 2EFNA 4MK7A 2AGPA 2W9BB 4M1KA 1W2BR 3NCQA 1H2VZ 1IN0A 2YX4A 3S6EA 4N5SA 3KLVA 4G6VB 4X4NA 1SH0A 1FD8A 4I2QA 2DGQA 5FDLA 1F2GA 5F8MA 2J9EA 4O4RA 1LQ9A 3IWNC 3DLEA 2RF2B 3B82A 3E3XA 2GX8A 3MURP 1VOMA 2B56A 2R7OA 3K8WA 3PW7A 2RD5C 1NK5A 1O0PA 5L38A 5E33A 2VV5A 1X0FA 3OQ2A 3IR7B 4HI2A 1CPZA 2LYVA 1BC6A 3NRBA 1HNWF 4TU9A 3NAHA 4PG6A 1XMQF 4F2SA 5KG7A 3TA0A 4DDFA 4ETZA 5GAEI 2CPIA 1TR0A 3CUNA 2L48A 4IO9Q 2I8EA 5JVHQ 1VQOS 2ZZMA 3TARA 3T6JA 1SUQB 1WEYA 4G1IA 1YIJS 4QJVA 1HWKA 2DRBA 4JV2A 4DQSA 2YH1A 1U4BA 2LEPA 3AJ1A 4K4VA 4F8RA 3NAIA 1SJ4P 4Q5VA 1TKTB 1QM9A 2G4BA 5B7WA 2YKPA 4Q2MA 4FS2A 3OFFA 5LT5A 1VBZA 3QJLA 4IG0B 4J9SA 4YY3F 1JLEA 2JL9A 4EYIB 2KHCA 2YKAA 4CO1A 4B3OB 2K3IA 3TI0A 1SI9A 2W9CB 1IKYA 3H5YA 2MQLA 1T05A 2GHVC 4O3QA 5JUMA 2HNYB 2ZE2A 2MKCA 1IXKA 4RKUC 4K59A 4KV8A 2BE2A 3PR5B 2RRBA 1D8YA 3OTBA 3JYTA 4DBQA 2UU9F 2QSWA 4X62F 2M70A 1ZBTA 4IYQA 4P6QA 1VRUB 1XR6A 2JSXA 1IKWB 1TKZB 3THTA 4ES3A 4BWMA 1RA7A 2MXYA 2DO0A 5LXRA 4WFBQ 2YKMB 4A8YA 5D3GB 5B0GA 3KK2B 3TVZA 3MM9B 1QE1B 3GV7B 2FLPA 1NHVA 5KFAA 3H5XA 4M5DA 1OQ3A 1OQ6A 3NBPB 3ZC4A 4ZCKA 2XMJA 2QMWA 1DHMA 2U1AA 3R27A 4NMLA 3CXCR 4PWDA 1WHYA 4IOBA 5T7LB 4J9PA 1X8DA 4ZP6A 4BS2A 1LW0A 2V4JA 3KJVA 1YTYA 2ZOFA 1VQ9S 4WFNQ 1RKIA 2KTQA 1QLNA 1S1UA 3DXSX 4KJIA 3QGGA 2HGLA 3LP1B 3V6DB 3NL0A 3PEHA 1R0AA 1NH7A 4MIAA 2ZFHA 1VC6A 3L3CA 3CDBA 3UQSA 3HHKA 3HM9A 2R2RA 2VPXB 2WSEC 1FDDA 3G9CA 4TLQA 4G1QA 3FFIA 5EX3A 3OW2R 5E3RA 3T6BA 2QFJA 4CO3A 2JEJA 1HMVA 3LP2B 5KT7A 1RYRA 2WB1D 5IQQA 1C4CA 3T9NA 2CPJA 2FJDB 4Y2CA 3I55S 4KBIA 1JNZB 4ECRA 1MNEA 1NKCA 4IR1A 3KMQA 1X7VA 3TNVA 1LV5A 4EU0A 2AP6A 1S49A 2CFXA 3LO3A 1SC6A 5GMKa 5HBMA 2VBWA 4NZ7A 1WWHA 2QIFA 3A1YG 3RRGA 2NR0A 2PA8D 2DGSA 3DMJB 2DNRA 4DJBA 1UMJA 4LQ3A 4PPZA 3MF5A 2ASJA 1MWYA 4DX8H 3M8PA 2KJVA 2WOMB 4UUXA 4ZVGA 4PCQA 3PXGa 2CKWA 2BZ2A 2RB7A 2YKQA 4EGLA 4ES2A 5KFMA 1JLCB 3E8OA 1FDNA 1RA6A 2DGTA 3DM2A 3NMAA 3AQOA 1FK9B 4ECVA 1S7HA 1MROA 3HFKA 4IDKB 1X4DA 5JJBA 5CD4H 2DR8A 2JEIA 1ZETA 5SUHA 4XDDA 5KT2A 3LGMA 1LKZA 2KB2A 2B7BB 2JH3A 3SCIE 1BQMA 1JB0C 3MMBB 4IG3B 4OFZA 4FF3A 5F3ZA 2MJNA 4DPOA 3MUMP 4H4OB 2RU3A 1S72S 2VA3A 2HFZA 5KFPA 2DGUA 4UQTA 2KFZA 1HBOA 1HQEA 2I5JB 2JC0A 5DO2A 1X9SA 3FCHA 3O5TB 3C3LA 1Y5NB 4NWBA 1R27B 2ZD1A 2QYCA 1F5CA 4A8SA 4L3NA 2HIQA 3OSNA 2JWNA 1TFWA 4ZVFA 4NXNF 1HARA 3VCDA 3HZGA 3EYZA 3UFCX 2OPSA 4DFPA 4ILRA 5DGAA 2PIIA 4M8LA 4CO2A 3MEEA 2W25A 3MMCB 3KLHB 1M0SA 2HW3A 3AAWB 4OX8A 2A1BA 1IQTA 3H59A 1O5JA 1H7XA 4MK8A 4X4QA 2A2DA 2DGOA 3D1QA 1RT6A 3HJFA 2MKJA 3GIJA 1HNIB 2QSFA 3HVTB 4G1PA 4M95A 4YR0A 4ECQA 4OMFG 1WHXA 4ITSA 4R5PB 1L5UA 5KG0A 2J0SD 3OL6A 2J0XA 1WI8A 2VODA 2KFYA 3BR8A 1F9FA 1U6BA 2GGPB 2PEHA 2EFPA 4C4WA 4OZ1A 1X4GA 1JK9B 1FJCA 2NXUA 1C1CB 3MD1A 2QA1A 4NLVA 3LWMA 2EFQA 2UUTA 1N5YB 4HHJA 2LXIA 2L41A 4I56A 4DMZA 2E5LF 3E01B 3M8QB 2N7CA 1U8SA 2OO4A 3F41A 3CCQS 3FRYA 4TLRA 5J2PA 4B3MF 1VQPS 4O3NA 2P6SA 2J9DA 2BR0A 1LFWA 1KQSR 2PFFB 4CO0A 3FZBA 5DS7A 4DR3F 1GX5A 1JLFB 2VFRA 1M5SA 2JVOA 2XWXA 3I0SB 4FBUA 2B3TB 2VFSA 4XPCA 2F4VF 3NMRA 5H1SV 1R8BA 2MQMA 3KLFB 1LWEB 2R8JA 4DG1A 2RILA 2HFNA 4B9NA 1NB7A 2QT7A 2K1RA 3VZIA 3EXCX 3DRRB 2HS3A 5HP1A 4WK1A 2FB0A 1E6YA 2M2BA 2B4UA 3KLEA 1XEZA 4RNMA 3CDUA 1WEZA 2C3UA 4EBEA 5D4OA 3U27A 4F02A 2HYIB 4YHHF 4P2SA 2CPYA 3CMES 3GQCA 1PILA 4K4UA 1L3TA 3T3FA 4O0IA 3GILA 4DSKA 4C0OC 1WHVA 3HVRA 1H3DA 3TVKA 2BQ3A 1NKEA 3BO4A 4DLEA 2JLGA 2KN4A 1FRXA 3PKMA 3RBEA 2VD3A 1SIWB 2JLFA 1SL2A 3ZZ0A 2R7XA 1OPZA 2VPYB 2D1CA 4Q0BA 2VC1A 4ED3A 4PQUB 1HYSA 2FGOA 5BR8F 1P9QC 1LWFA 1KLMB 2EPIA 2BABA 3BEGB 2GO9A 4KO0A 3EX7B 3M6UA 3FJ2A 2A18A 2PI4A 2LCWA 3UCZP 4DS4A 3GR0A 1RT5A 2ROPA 3QLHB 4ED2A 4NA1A 2HRUA 4X4PA 1UVIA 5KTQA 5L1KA 2I38A 3CO9A 1KONA 4DQQA 2NZ4A 4RWXA 4H4MA 4UOCA 1S1VB 4MIBA 4V19J 4K0KF 3HX9A 2M3DA 4WU2A 4X65F 4DSLA 4UUWA 4DWIA 2LU2A 1KLNA 4IQMA 1Y5IB 1CSJA 2CQ0A 4HYKA 2IHR1 4DV7F 1V3ZA 3ONQA 1KQGB 2WONA 2XS5A 2LQ9A 3W2VB 4LSLA 1ZYQA 2YY3A 3BQ1A 3U1LA 3BO3A 2C3PA 2FJEB 3CDEA 3C6UB 5D77A 2MB0B 4C8LA 3LW5C 2JRSA 4B3RF 2G13A 4PG5A 5EX0A 2PE8A 2XLKA 5A8WA 3SQGB 5KFSA 2VKRA 3HP6A 2V8GA 3I0RA 3MPWA 2ZH6A 1U45A 2ZHOA 1FESA 1K1SA 2FC9A 4E8UA 1S0OA 2KZMA 1VQSA 4B9TA 3KYLA 1XWLA 2HS4A 2XSJB 2VQFF 4DL7A 4MYUA 1YWXA 3KLGA 2VOPA 2CPHA 2CQPA 1RAJA 1RTHA 1ZM2A 5F3TA 1K73T 4MKAA 2FVPA 2IBOA 3FSXA 2D7SA 5EUHA 5HLFB 3A8EA 4NYOA 3OLBA 3CTRA 3BJYA 4OI0A 1A9NB 2DCLA 2DH7A 1UA0A 1HNXF 3GG1A 3IS9A 1Y7PA 4NYZA 2J0QD 2E29A 1D0EA 2B0GA 2DR7A 1MU2B 4ZPWR 5KG2A 3G6ES 1C0UA 1BD6A 2W4CA 3TANA 4TXSA 1B0PA 3V4IA 1N52B 2LQBA 1FERA 1JKHA 4ICLB 6FD1A 2I2YA 5KT3A 1IKYB 3TAQA 2ZZNA 4LT6A 4CO5A 5DQGA 2O5DA 4N8NA 2RIJA 1ZM3A 2EKYA 4JI8F 4NLGA 3AY0A 2AV5A 4DQPA 1F5BA 3GIIA 2AJFE 4ZPCA 4TYBA 3IG1B 1QAYA 1FNMA 2YNGB 4YDXA 5H9FJ 4G3IA 2B7CB 4OLPA 5I3UA 2V9WA 1JLGA 1R8PA 4Y0FA 2EFGA 1Z2LA 2E1CA 2MHNA 5F0WA 2K7KA 3I82A 1Q8LA 1U1MA 2VOOA 2ATLA 4USHA 4BHQA 2UUBF 2E9ZA 5F8LA 3CCUS 2COLA 1ELOA 4A8MP 4H54A 4FS1A 1HWLA 4E0DA 3CCJS 4KRWA 5DDQC 2FJAB 4HVZA 5HL7Q 5DLGA 2XY5A 1N36F 3GMGA 3C46A 1WG4A 4NZ6A 5B0FA 1DZ5A 2MKSA 1DQ9A 3VZHA 1CG2A 1HL6A 5KFFA 4RNOA 2VFTA 2KT3A 5I3QA 4DR7F 4I64A 4O4GB 5KFVA 4B9UA 1ZH5A 4OZLA 2DCUB 4BC9A 3CD5A 4X84A 1HR0F 5A8KA 2NPFA 4GKJF 5EWEA 2AGQA 4FNHA 1UFWA 3VAFA 1H6KX 2N3LA 3ENVA 5LMNF 2KZZA 2EFOA 2DPIA 1YJRA 1XR7A 2M8DB 2UVVA 3DRSB 3MM7B 1OS5A 1HI0P 1RTDB 2KH9A 4ZPDA 2GJ2A 3SSSA 1DAXA 3TYTA 1GQEA 2B5JB 4OX6A 1Q7LB 1Y0HA 3GB0A 4QIEA 3AA8A 4PUOB 3J7A1 2KVIA 3POTB 3TA1A 1HBNB 4J9NA 3CCLS 3CPWR 4DFMA 2OFGX 1VGYA 1QAJA 3KHRA 3VR1A 3DLGB 1TQLA 4HDHA 1SKRA 5E41A 4FF4A 2C3YA 4C3LA 5B0EA 1F60B 5HMYA 2YH0A 4PG7A 4QW8A 5K14B 2ZOGA 4LF8F 3G71S 1S9GA 3QGHA 2MQPA 4JV0A 2D3ZA 2ZKTA 2GHPA 5KFQA 1X5SA 3QIPA 1UA1A 3H98A 3UR3C 5L9NA 1VC0A 4R0EA 4C98A 4PKDB 1MMNA 1HNVA 2ZM6F 4ECWA 5KFUA 4ALZA 4B02A 2IM0A 2C28A 1N8RT 1SJ1A 2W4PA 1N6QA 2X1FA 1LK5A 1VHFA 3M2VA 3MEGA 2F7VA 3CIZA 3CE8A 2GQCA 3KOAA 3K8VA 3U1MA 1DRZA 2LDIA 3FSYA 4QU7A 3ISZA 3BSNA 1BY9A 4RNNA 1KVIA 5A6WA 2ZH1A 2OPQA 2XEXA 1NJZA 3ITHA 3PY8A 5C42B 1Q8BA 5KFYA 2WCXA 4NCGB 1WHWA 2DO4A 3NG8A 2GA7A 4O3PA 3IR5B 1VK8A 5IM0A 2YKNA 5J2QA 2HLTA 1J5OB 3BDPA 4J9QA 1H98A 3HVAA 2GMLA 3TA2A 3MECB 3UD4P 1FRIA 4ID5A 4Q45A 2VG5A 4LIWA 3J7ZT 1UVJA 2EC0A 3MEEB 1VFJA 3DI6A 2LMIA 3LANA 2AD9A 4OHYA 2EVZA 4DOZA 2BQUA 4MKYA 3HI9A 3DYAB 2J6UA 4FBTA 1APSA 2IRXA 3BQ2A 4ELVA 5I42B 1S1WA 1RT6B 3FEYB 4ZK7M 3OVBA 4RUCA 1Q8IA 2LQ5A 4WYWA 1JLBA 4Q7AA 4CTAA 5F9NA 1AROP 3IGNA 1N4LA 4A4JA 5JVGQ 4LSNB 4WTYA 4YB6A 4EUVA 1LWCA 4IFVA 3BREA 3FZ2A 3HKZD 5THWA 2DT9A 4F3MA 1ULRA 1TVRB 4IR9A 3OR2B 2XG8A 2OPPA 2YX1A 1M1KT 1CEZA 4GC6A 1OIAA 4ZMMA 1FA0A 3UE2A 3VWSA 2HG4A 2KXNB 3KLIA 5CZXA 4KE5A 3UNGC 1T03B 1VQNS 2GNKA 4ZCLA 3CJ5A 3CD7A 4HEA9 2ADBA 1U7LA 4U6PA 1OWXA 3K5LA 2E5HA 1DLOA 5FD1A 3OSPA 3GWCA 5L1LA 4J9OA 5F9LA 4DV4F 4LFCF 5F8GA 3MM5A 3BGRA 4FYDA 3NGKA 1FJGF 1S48A 2DHSA 3CDWA 3DLJA 3GZ7A 2DNZA 3NWGA 2Q6CA 1NHUA 2EFVA 2LVWA 3MM6B 4AQYF 4U67Q 2L3MA 3U02A 3DLLQ 5KG1A 4LF6F 1URNA 1YITS 1U2RA 1S9EA 2Q79A 4J9LA 1Y9OA 4IFYB 3DLKB 1LXNA 3UPFA 2AU0A 3CEDA 5M2RA 2XMMA 5CYMA 3K2YA 4ZP7A 2XS2A 4KPYA 2YTCA 2CG4A 2MHEA 1DTTB 2YWGA 1UEUA 3HHLC 2DH8A 4C8OA 2LDYA 1S1XA 1IQZA 2NUUG 4WE1A 1FKPB 3LP0B 1SIZA 3TO8A 1M90T 5J2NB 5KFTA 4A8KA 1D9DA 3PW0A 4QQBA 1ZZNA 2VUGA 4RW4A 1S1TA 4N41A 2V0NA 4CT9A 3RRHA 1HPZA 4I6YA 4Y3CA 3Q8RB 2HMIA 1RISA 3G4SS 3Q8QB 3RAMA 4JI4F 4QR1A 4HT5A 4IKAA 3SDEA 2E9RX 1IJFB 3X1LB 2PMHA 1PC5A 4PG4A 1H38A 2ERRA 3MMJA 2MMYA 2L08A 4C8KA 1M5KC 1E6VA 3V81B 4N56A 2DTJA 1QSSA 2RQMA 3M2UA 5IQ6A 1XMBA 2E1RA 1IKVA 3X3UA 5T14A 3MAQA 2OTLS 1EP4B 2PN6A 2CQCA 1TKXA 1C1BA 1RTJB 4DFKA 4CH7A 4NLPA 3DDNA 2FJWA 5B0AA 1T7PA 1RT3A 1S97A 3ICLA 2SXLA 4DN0A 3OVSA 5G0RA 3PO4A 3OR1A 1WF2A 4I2PB 4MAKA 2FUG9 2IC3A 1U26A 5DG8A 4EBDA 4KAIA 3I32A