2CZ4A

Crystal structure of a putative pii-like signaling protein (ttha0516) from thermus thermophilus hb8
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
100
Chain Sequence
MDLVPLKLVTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGSRGIRSVDWEGQNIRLETIVSEEVALRILQRLQEEYFPHYAVIAYVENVWVVRGEKYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA0516
publication title Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 25
structure length 100
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cz4A00
3X3UA 1P1LA 3AA8A 2DCLA 4D3GA 4Y65A 1J2VA 3LF0A 4IYQA 2XULA 4RX6A 1UL3A 1V6HA 4R25A 2XZWA 3MHYA 2J9EA 4USIA 2NUUG 2GNKA 4RWXA 2ZOMA 1O51A 2CZ4A 4WK3A 2PIIA 1UFLA 4C3MA 5D4NA 4D3HA 4USHA 4CO3A 3L7PA 4WK1A 3M05A 1QY7A 3N5BA 5DRKA 2XBPA 2EG2A 3GSDA 2NS1B 3CE8A 1V3SA 2NUHA 1O5JA 2XG8A 4YB6A 3HLUA 4RWWA 4CNZA 2J9DE 1GNKA 3T9ZA 2V5HG 4AFFA 4YB5A 2E66A 5D4OA 4NYOA 5DS7A 4OZJA 1OSCA 1NH8A 3OPKA 4USJC 4C3LA 4CNYA 3BZQA 2VD3A 3NCPA 1UKUA 3NCRA 3TA1A 2GW8A 1UMJA 4NYPA 3AA9A 2RD5C 5D4LA 1VFJA 3AHPA 4CO1A 1NH7A 2Z0GA 3TA2A 4C3KA 1HWUA 1Q1KA 1VHFA 4YB7A 4OZNA 3NCQA 2O66A 4Y6IA 3O5TB 3O8WA 2O67A 1NAQA 4RLEA 2GX8A 1NZAA 4CO2A 1H3DA 1V9OA 1KR4A 4ZK7M 2JJ4D 1PILA 4OZLA 1V3RA 4CO4A 4E98A 3DFEA 1XK8A 2ZFHA 2J9DA 4CO0A 5L9NA 2J9CA 4CO5A 5D4PA 3AH6A 2EG1A 3TA0A
chains in the Genus database with same CATH superfamily
2QV6A 1IKXA 1FVSA 4OX6A 3HD2A 2ZBIA 1RT3A 4LFBJ 4MK7A 2QIFA 3D0GE 2VDIA 4DUZJ 1MMNA 3UN2A 1M0SA 1X9SA 2NR0A 3FEYB 3ZZUA 2B9YA 4BWMA 4ZHRA 4CLFA 4OHXA 2VOPA 4DX6A 3O1LA 5E3QA 1YWXA 3M05A 1LW0A 3RU0A 4JI3J 3CJKA 4DF4A 3IR5B 2OELA 3JB9k 2DKOB 1MMDA 4ECQA 4ZVHA 5FLXY 4CM0A 2AF6A 3R5DA 1RT7A 2E7XA 5HLFA 4KB7A 3P4UB 2CJQA 3OR1B 2XYGB 4C8MA 2XCPA 2NSBA 2DNGA 3ZTOA 3ITHB 1NCLA 2FJXA 1EZZB 1VYAA 4EZ9A 3PJ9A 2JVRA 3GWCA 1UJ6A 2BM0A 4TU7A 1NLKL 2H1YA 2UUBF 2AGQA 2PT0A 3IGNA 2ZBCA 3J80Y 4KT0C 1HWIA 4M5LA 1EP4A 2ZJPQ 3ZXWA 3V4IA 2ZOGA 2VA3A 3H59A 4LF4J 3QRRA 2CQDA 2V8PA 3TUZC 5GMDA 3MUVP 1HLWA 5A6PA 1A0OB 3T5JA 5LSOA 2RF2A 3JSYA 2GIQA 4PG8A 2FJEB 3C16A 2NUHA 4OX9F 1R8HA 1SV5A 1WG4A 5L46A 2BEFA 4EBEA 4BLGA 4ED8A 2GW8A 5KFSA 4NA3A 4Q0BA 2AX0A 1D1UA 3E3XA 1BY9A 2E9TA 5HBMB 2EC0A 4YY3F 4KHPJ 5LJ5Y 1R8AA 1RKIA 1Q8IA 4YOEA 3RZAA 4LF7J 2VQEF 3H2LA 2NSCA 1RT1B 2PI4A 5H9FJ 4URQU 4PG7A 3H7HB 2OI2A 3H20A 1NJIT 1F3VA 1LXNA 3BV8A 3S6EA 2ROPA 4QR0A 5AXKA 3M8QB 4O3QA 4QPTA 3C8YA 4WP9A 4R5PB 1ZETA 3PW5A 4LIWA 4CCHA 3J81U 4DN0A 4CIOA 3RR8A 1N5VA 5CYQA 4RWXA 1UEVA 2OIHA 4RW4B 3GG1A 5KFVA 1RAIB 2HFZA 2ZH6A 1JXLA 2ALYB 4ELUA 5IQQA 1EQ0A 4OJ3A 3MUTP 3UCZP 3DYAA 1J5OB 1ZYQA 1NKCA 1S0OA 3MECB 4JI8F 5C2CA 4K5RA 2NZ4A 3CD7A 1PAUB 4X4RA 1FJEB 5HROB 2VBXA 2OUGA 2DR5A 1LWFA 3R3TA 2XHWA 2W01A 1PGZA 3P5TL 1KHWA 3HVRA 3EE3A 3FQLA 4WFAQ 5K8OA 3PO4A 3M2RB 2GJFA 1UVIA 5D3GA 4CO5A 3D0IE 3DLGA 5KFQA 1NEEA 1JKHA 2BJEA 1J2VA 1HQEA 4C97A 3HVWA 1FKOB 5KFUA 4LF9J 4X4OA 3ZFVA 4B3RF 3D1OA 1V6HA 3T3FA 1TP7A 3O3LA 3B4MA 5GADI 3T19A 3NNAA 2GS8A 1HBMB 3MEEB 2WHOA 3AD8C 3CD6S 4OZ3A 2VPWB 4X65F 4NZ7A 1JNRB 1HNXJ 4ZP8A 1U49A 1B0VA 3T41A 4P52A 1FRKA 4O3SA 2J0QD 5G0RB 1EKRA 4BWJA 4YB6A 4YN3B 3I4PA 3B6BA 1GXLA 1DZ5A 4DOZA 2CPIA 4YQWA 5F8GA 4ELTA 1S59A 4I68A 4LSZB 2B43A 5D4LA 5F8NA 5HQ8A 2AJ0A 4MJKA 5KT7A 3JSRA 3BN4A 1U2RA 4OIXA 4U67Q 2DD8S 3K7RA 2IBKA 3UNGC 3SCLE 1Y3JA 4P9SA 2KXNB 3DRRB 3OTOJ 3QAUA 3MM9B 1LWEB 1B99A 3EZUA 1RAEB 4HDGA 2YX7A 2ZWPA 1U4BA 3FEXB 1O0PA 1WC1A 1HMVA 2VPYB 3ADAC 1N36F 1DQ9A 3ZTPA 5J2PA 1YGYA 2HFSA 1UEUA 2HW3A 4UW2A 2RNEA 2QFIA 2DB1A 1VQ9S 1V5VA 1X4HA 1AA1B 3DN9A 3I9V9 1FRLA 2DGVA 3D4JA 2BQRA 1JLGB 4Z7CA 1RU1A 2DR6A 2LXIA 3H2VE 2X7IA 5ETRA 5B0CA 5D0RA 3T1YJ 3BQ1A 1ACMB 3ZTRA 1YIJS 3EUNA 4G1QB 4OZ1A 1IQZA 3D3CJ 1YDLA 1NM2A 1H38A 4WP8A 4B9NA 4YDXA 1XNQF 3W2VB 4DL6A 1LW2A 1GTEA 2F4FA 1Q1KA 4B9VA 3HKZD 1RAAB 2ZWOA 2HGNA 1JLEA 4O4GA 3PYGA 4ZP6A 4WPAA 4ZMMA 2RVJA 3VGTA 2Y8WA 3P96A 5DQIA 2YNFB 5GAEU 3H5UA 2GCFA 3KLFA 3RUBL 1S72S 3A4TA 1IBMJ 2HGMA 4LR8A 5LL6d 2DY1A 4A48A 5KG0A 4B02A 1UPPA 5B0DA 4DV1F 4I2PB 2R8JA 1WDDA 4DX5A 3EWGA 4CLYA 3IR7B 3AQOA 1N5TA 3AJ1A 2I38A 5A8WB 2JX2A 4HLBA 2YQ3A 5GAGU 5DO2A 4KHRA 2KFZA 4LFCJ 2N4CA 5AE1A 1U2CA 3HLUA 3AODA 5B0EA 3Q0AA 2XMUA 4JB8B 4AXIA 1QSYA 2Y0BB 4JBCA 2LEBA 4CLTA 2V4JA 3BO4A 1FRHA 1M1KT 4CO2A 1QUVA 4OLPA 4ILLA 4YR2A 3TZZA 2KZZA 4DFMA 1N32J 1FXDA 1XERA 3LAKA 3DU6A 2XB2D 2VJUA 5JUMA 5MLCV 3WX4A 4USUA 2GHVC 4HVZA 4DCPB 4CQ1A 2K06A 2CZ4A 3KOAA 1SIZA 4FF2A 3FSYA 1S76D 4TN2A 3HFZB 3I0RB 4ZVQB 1FRJA 3L7OA 4DX7A 3VF0B 3J7ZT 3FFIA 3ZZPA 2CG8A 4OX7A 5D8HB 4AT1B 4PXBA 3KLHB 2R4FA 3K17A 2BUNA 4J9MA 2HG4A 1U47A 1OS5A 4K7QA 1VS3A 2EFNA 3ZZTA 3IWNC 4KKOA 1QAXA 2JHEA 2CA9A 2NZCA 1HNZF 4OV6A 3W2WB 3H98A 1XWLA 4IH6A 1RHUB 3K5MA 2VV5A 4WFYA 1EARA 1R7IA 4IR1A 3H2UB 1LFWA 1VCTA 4X4QA 1NDPA 5ITHA 2QL5B 4N8OA 2WB4A 4LBHA 1C1CB 3NBPA 3FRYA 2DHHA 2HNZA 5HVFA 1BWVA 2B7BB 2PN6A 3I4HX 3MR3A 2OFHX 2LP4A 2G2OA 4XAKA 4NLGA 1KNZA 3GSIA 1YBTA 3C6TA 4RPFA 3K57A 1KLMB 3OVBA 2XZWA 2V9KA 3Q8UA 3UDLA 2MHNA 4TU8A 4NZ0A 1FD8A 1S9GB 3CPWR 2BQUA 2CNOB 3OFGA 2PGCA 2IM3A 1V3SA 3L4BC 4AE5A 4B3MJ 2HS4A 4LBPA 1KKHA 3O2IA 3K2YA 5CD4A 1VRUA 4CM2A 2OPQA 3H25A 3KDOA 1UZDA 4PEOA 4CNYA 3GYGA 3U1MA 4OI3A 3PR5B 2IHR1 3HULA 3GCWP 3T1HJ 4NMLA 3UDCA 1YJ7A 1FJGF 2O66A 1Y7PA 2B5JB 4MFBB 1HW9A 2R7TA 5AXNA 3W64A 1MWQA 2HRTA 4ANDA 5C25B 3SDEA 2M2BA 5IM0B 5KFJA 3C6UA 2N3OA 1Y10A 4X4TA 5KFAA 4UY85 1WSRA 1HI8A 2CZVC 3EGZA 3FC9A 2F4VF 1B64A 2ZBRA 2DNQA 2A10A 2GJIA 1ZPVA 1V3ZA 2RQCA 4ZPAA 3IAM9 1UA1A 3UD3P 1GH8A 4PR6A 2MKKA 4ZVPB 3GU0A 1TKTB 7AT1B 4J7CA 2R2SA 1FE0A 4OYMA 3DOMB 5KFHA 5HANA 1NZ8A 1ZBTA 2NQPA 3BH7B 4W98A 4R0EA 5FIIA 4NRTA 1F60B 2CQGA 3D6FB 5KT4A 3CNQP 4OJ1A 3TVYA 1SH2A 4IG3A 2KT3A 2DNYA 4KQZA 2XS7A 5BXIA 5J1EA 3PVXA 1WHVA 2I5JB 2XSJB 2X1FA 4O3RA 1X4AA 2MQLA 1HBUB 2M70A 1PJ6A 2D69A 1IUJA 3THPA 4URGA 2NYHA 1FEHA 2Y3YA 1WEXA 1R31A 4WZMA 2EXUA 5J2MB 1HNWJ 1H2UX 3I87A 1FFWB 4NXMF 1SC4B 3PG9A 2CFXA 4OMFG 2DR9A 2ZFHA 4URSA 1NJXA 1Y0HA 1YRXA 2C2MB 3A8KA 3UWTA 2VFUA 1U48A 4F3QA 4I67A 2Y9HA 3OR1A 2KTQA 2HFVA 4I6WA 4C48A 2G0JA 3HHDA 3D67A 2ZVIA 5D4NA 3WIUA 4JYAF 3WC2A 4LRCA 4KO0A 4DV5F 4NI2B 1N48A 4OI6A 4IFYB 4U9RA 2XEXA 1H6KX 2AP6A 2C2DA 4DL3A 2AYGA 2XG8A 3LGMA 4DG1A 4WFNQ 2QT7A 1JLAA 1GNKA 3NGTA 1H74A 5BR8F 4NLYA 2HQDA 4DUYF 4EU0A 2FDNA 1UWBB 1XNRJ 3DRPA 2XNQA 1X8DA 4TY8A 2HZCA 2WB1D 1S99A 4F3MA 3Q22A 3H4DA 2HNDB 4ZPCA 2ZJRQ 2AZ3A 4B9LA 3J7AN 3LP2B 5J2NB 3PW0A 3ZZOA 2FY1A 4A4JA 4OHZA 5ETKA 1RWPB 2DH8A 2KN4A 4F4YA 3CGIA 4S0MA 3MXHP 2UUAF 3KUHA 2XM3A 2ZBQA 1DHMA 3MHYA 3ILJA 3GYXB 1KWMA 4EI2A 4RUAA 2JSXA 3BBBA 3THVA 2NCKL 2D1CA 4CLSA 1W26A 2RHSB 3IWLA 5IT9Y 1HD1A 4DPOA 2UVVA 1LFPA 3RBEA 3M8QA 1OYEA 4NPOA 2G1HA 2MKIA 1DLOB 1WC5A 2DIUA 3OTDA 3D6MB 4XTTA 1XIQA 4RW4A 2FHMA 4UZBA 3BR8A 5KFYA 4CO1A 3FDSA 4HT5A 5ETNA 4WFBQ 1FFGB 1R27B 1D3WA 1TFWA 2E1RA 1RT6A 4KIAA 3I5CA 3V6JA 1BQNA 2VG6B 3OHBA 2A0FB 2WVEA 3HFKA 1T05A 4JI5F 4J9SA 3K59A 2OPSA 4QIEA 1WOPA 3KG1A 1H7XA 1P1TA 1YK9A 3F44A 1OO0B 3EICA 1HWLA 2SXLA 2D74B 5HSPA 4RW9B 3Q8QB 3TEGA 2CPZA 3DOKA 2ZOMA 2FGCA 3M2RA 3V6DA 2IIHA 1YSJA 4WWSA 5IC6B 4PUOA 3MAQA 2H48B 2MKJA 3RGIA 4DSIA 3J7Z5 5L1KA 3OL6A 4NEYA 3QGHA 2CWXA 3A8EA 1UVMA 2NREA 4Y28C 2XGPA 5GVQA 4PYDA 8RUCA 4TLRA 4NYOA 2F8EX 4TU9A 4LR9A 1ULRA 2DNPA 3DI6B 1NPRA 2PO4A 2HIQA 4PG4A 1RGVA 1HBNA 4DR1F 3OSPA 5F0WA 5KFWA 2RS2A 3Q8SB 4LF5J 1SCJB 2WVDA 1R8PA 2D41A 4HTJA 1NUEA 4B3TF 5G0RA 4DL7A 3NNCA 4AL7A 1LWCB 2R8KA 4LVOP 3N5FA 4DS4A 3SV3A 1TL7B 4QQBA 3BGUA 3I6PA 3QO9A 3PYDA 4UF4A 3OQ2A 4PQUA 3TEHB 1XMBA 1TKZB 4XDDA 4J9UE 4F36A 2CUYA 2CQCA 3L7UA 5K8PA 4X64J 1K9MT 4IR9A 4DFJA 2E5GA 3HSGA 3NLCA 4N47A 1WI6A 2KRRA 1GFWB 2CWKA 3UQSA 2CQBA 3GCXP 5MAOA 2ZH2A 9RUBA 5A8RA 3QWUA 1X5TA 1R89A 1L3TA 1JWWA 2M5YA 4DSEA 3MR6A 2O3DA 4OX9J 2GMHA 2EWHA 2C22A 4HH1A 2R8IA 3R7SB 3SI8A 2NPIA 1DAXA 1Q82T 4YB7A 3RG6A 1O8BA 2JEGA 3G9CA 4IDKB 2JJ4D 2EEYA 4TNOA 3IGVA 2BJ9A 5F3TA 1FK9A 1CJVB 3OW2R 2M9KA 3EDRB 1JLCB 2VFTA 3A3PB 4DQRA 2W2NP 3TNVA 4DZDA 3PFEA 1CQMA 2MQMA 4JI2J 2QL9B 2WAQD 4DSKA 2XULA 1E6VA 3LQVA 3CIMA 1RXOB 3CCQS 1SL1A 2F8MA 2CDRB 3N4WA 5DJBA 1HPZA 4OYOA 4ED2A 4USVA 1OSDA 2PDAA 3HHEA 4WYWA 4ECSA 4KGZB 2YNFA 3R8YA 4WJBA 4C0BA 4LRAA 1MWZA 3B82A 5HK4A 1SKSA 4AFFA 4GKJJ 1X7VA 3LP0A 1G4CA 4PWDA 2GGPB 3DDKA 3BZQA 3NCPA 3IM9A 2A3JA 5KFXA 1RSCA 3W3SA 4JI8J 1CG2A 4GKKF 4C3KA 1S6QB 4FYVB 3R6GB 3DLBA 4OHVA 2HHSA 2YWFA 3VV2B 2QSFA 4C8OA 4JI7F 2MSSA 3MPUB 2YKAA 1CJKB 3D66A 4IRDA 2MJNA 1D9FA 1LWXA 2AEFA 2XHCA 3QAEA 2JFDA 4IQXA 2G13A 3HZEA 4RU2A 1GMWD 3I0SB 1RWNB 2FJBB 3M1VB 4RX6A 2BZ2A 3W66A 2DGXA 3VAKA 1UP1A 3AB4B 3DRXA 2WBRA 2OPRB 1I1GA 1CULB 5KFFA 1RA6A 1RHJB 2B9XA 4GVLA 1RAJA 3ZZYA 3KKFA 2HQGA 4FPRA 1KEKA 2O01C 1QUPA 2M88A 2IM0A 3RRGA 3GQCA 2RRBA 3HDSA 2HMIA 2E5LJ 3M2UB 2LXUA 3PRDA 1OY8A 2W4CA 2D3OR 1M1HA 2YQ0A 2P8IA 4K0KF 4RLEA 5HMYA 2E1CA 1HWJA 3MOJB 4OZLA 1Q8BA 2W7OA 1BE4A 1LEOA 5GAHI 1U1LA 5B0FA 2FHJD 2DPIA 1YZ7A 4WFZA 1P8GA 2ATLA 3BO3A 2HAIA 4KR0B 3MCNA 4KRWA 3OXLA 4AD6A 2KZMA 2GQ2A 3R5GA 3AQPA 1VRTA 1O51A 4NOHA 1VIOA 1W2BR 4DV3F 3AD7C 2YWGA 2IDLA 4MKYA 4J9KA 1YJTA 1RHQB 2KKHA 3I82A 1KONA 3CO0P 3H90A 3MEDB 1UVLA 2ZUGA 4PYAA 4ZVEA 5IWAF 5E3RA 1U7LA 4KE5A 1FI4A 2CPFA 2PD1A 3MURP 1MNEA 3SSSA 4OYWA 2W7AA 4P6QA 3GLJA 1RTDB 1QE1B 3QT5A 2JEIA 3K5LA 2C2EA 1YJUA 8AT1B 4BDPA 4UZCA 4M5JA 3MAHA 3TARA 1NJZA 1HA1A 1RT4B 1EETB 2DK2A 3MPYA 2IYGA 2MQ8A 1K47A 2J9DA 2MY7A 1RTHB 5I42B 4IO9Q 2X3DA 4UTGA 4RNOA 3K89A 2ILYA 5K20B 3KG0A 2IVMA 4Y2IA 2I9SA 4ILRA 2EBGA 2B5JA 3MCOA 2HIYA 3G6YA 4NL5A 3JSMB 3QQCD 4PWWA 4J9LA 3GIJA 2ZHAA 2GMLA 4ZCKA 5IM0A 2JC1A 3M32B 2KM8B 1RT2A 1BC6A 2MB0B 2YBVA 3GZ7A 1ZM3A 1RWKB 4LRBA 3J81j 4DUTA 1S4FA 1R0AB 2NXEA 4KGKA 3AD9C 3KK2B 1RU2A 3NXZA 4C3LA 3PYFA 2L9DA 5GMKa 1CS4B 3GJTB 4P71A 1RHRB 3NWGA 1TKTA 4QIWD 2LMIA 2YVSA 2MZ1A 1FRMA 2ZH1A 1XQIA 3DRYA 3K8WA 2G2YA 2UUCJ 2PE8A 2BV3A 3QGGA 3FSIA 4L72B 1VQ8S 4JI1F 5E2QA 2LQ5A 1ZAWA 3W8GA 1KOOA 4RJVA 1TZ0A 2XSJA 2ASDA 4BC9A 1NO8A 5IC4B 1PBAA 5H9EK 4C9DA 4O3OA 4NCGB 1Q7LB 4D3GA 4CLLA 2KHDA 4LVNP 5CYMA 3SSRA 2RRNA 2BKNA 2XY7A 4RR5A 3HSZA 2WSFC 4DN9A 5EX0A 5L9XA 3KWMA 4F67A 1S9EB 3FZBA 2CQ2A 4U7UD 2OTJS 2V94A 3CULA 3ICLA 3M8RA 1SIWB 4YHHJ 4G65A 3EVOA 3DU5A 2BRKA 1L3UA 4CH0S 2DHXA 3CSKA 1T9XA 1S6PB 2FJWA 2Q66A 2HLUA 1U02A 3U1NA 2UVWA 5HQLA 2WZ1A 4NZ6A 2NXNA 4E0DA 1SXLA 2W9BA 2AD9A 2CJBA 4NI2A 5FDLA 4C11A 1Q86T 4IFYA 1NZAA 3PYEA 1QSLA 4B9SA 5HP1B 2AU0A 1TUWA 4KYZA 4IFVA 4M94A 1KVKA 5RUBA 1NJYA 3DKDA 2H51B 2FHOB 2FPHX 3VAGA 1YBAA 1IKWB 5K8MA 1N33F 5ADZA 2HNYB 3V2UC 3MMAA 2CPXA 4DEZA 1I6JA 4ZA1A 1HQUB 3QFHA 2FYXA 3CCWA 1B4SA 1SL0A 4N56A 4L3NA 1S9FA 3R1LA 1U2FA 3SFUA 4QWAA 3AOBA 2OGUA 2R3VA 1NHKL 2XY5A 3DNCA 3TUJC 2Z2LA 1IXKA 2R7RA 2DXFA 2HQIA 5IZHA 4TYBA 3RYLA 2ZH3A 4ZVRB 3H5YA 2J6SA 2QMWA 4I0WA 4IOCQ 2NLWA 2LU1A 3TAMA 5L1LA 2EKNA 4DSLA 2ZC4A 2XNRA 2E5HA 3R2CJ 4JUZA 3BH6B 5ETVA 2V4QA 3KJVB 3OTBA 1OYDA 2AJ4A 3MMCA 4QWCA 4R8UA 3WX8A 1U1MA 3ELHA 2XC9A 1K1SA 5KTQA 2V0NA 3SCKE 1DTQA 3N6MA 4F4ZA 2DXDA 4U8YA 2BMBA 2HHHJ 2QMXA 4DU8A 4EGLA 1F5AA 1Q0NA 5JJBA 3ZTSA 5GMEA 2GO8A 3HSDA 4QR2A 2F4VJ 4USKA 2YTCA 1MN9A 3HCXA 2KXFA 1L3SA 2BOAA 4ZVOB 2CVIA 1NB7A 2RHQB 1H2VZ 3DOLA 3B78A 2ASJA 3QGIA 1U1KA 4JV0A 3AT1B 2P9CA 3N79A 3W9IA 1FD2A 3FRZA 1NH7A 4NA2A 4DSJA 3UN3A 5IT9U 3PRBA 5HMXA 4A8XA 3HHLC 4C8KA 3AY0A 3FMWA 2ZH5A 1VISA 2ZDPA 1UVKA 4K2XA 2IAJA 1RISA 2V9WA 3HT0A 2JZ5A 3KLVA 3HK2A 3JQKA 4BCAA 2DGQA 3QLHB 1FTRA 4HTIA 3DI6A 1U8WA 2HZVA 4LQ3A 2IYIA 2G9OA 2ZH9A 1RP5A 4N41A 3FGVA 4O23A 1LK5A 1HBOB 2UV8A 2KL8A 1RTJB 3P3DA 1RAOA 3OUYB 4JP8A 2UXDJ 2D3O1 3E01B 2WOMB 3HI9A 4EO6A 1TMJA 5KG7A 1LWCA 4PXDA 1PJ5A 1AZSA 3A8IA 1JX4A 2B4PA 2IY5B 3NG8A 2LFVA 4QIVA 4DV5J 4KY3A 1JLBB 3BGRB 3OPKA 2PA3A 3JAMY 1BQXA 1VLOA 3A13A 2EI5A 3T5HA 2VG5B 4NCAA 2LXFA 2XMJA 5LXYA 3FJ2A 1OJ4A 3RAQA 2L3MA 5BR8J 1JLFB 2AKWB 2BE2A 2CZ9A 4QW8A 1ZA2B 4J90A 4XK8C 1SKWA 1U1QA 2YNHB 4LSLA 4KTQA 3CF5Q 3HVAA 4L6V3 4QPXA 3POTB 4JI4F 4ZOSA 4ETXA 3NRBA 3EXYA 4IDKA 2LU2A 4BS2A 1Q8LA 5A6WA 4ZCIA 2YY3A 1L3VA 3JS9A 2ZZNA 1JLCA 2MQPA 5E7OB 5GAEI 4P72A 4ECUA 3K58A 2VHGA 2QG9B 4WYLA 2PI5A 4ECVA 4GO7X 4KFBB 1IQTA 2DO4A 5ETLA 1S6OA 4PPDA 3EPGA 1SBRA 1AFJA 4HKQA 3Q23A 2OMLA 1S48A 3VVUA 4JI0J 5B0BA 1CJTA 1S7HA 5T7LB 3TANA 3Q86A 4I2QB 2IRXA 1N54B 3FCVA 1FWLA 2PSZA 1FRXA 3UI3A 3GE9A 1R6YA 5L1JA 2LKZA 3HHNB 4L73A 5GAGI 1TKXB 5F8JA 5HL7Q 3WC0A 1PILA 4WU2A 3CJ4A 2K3IA 3BGFA 3Q24A 4TQSA 3GG0A 2V4RA 4PQAA 2J5AA 4USWA 1S6QA 3GR0A 3HJVA 1NSQA 1X4FA 2GZOA 1VC0A 4HDHA 3WBZA 1S1XB 4ILMA 4WZQA 1K73T 4DPUA 2WONA 1LOUA 2IDEA 1B7FA 1RDRA 3DLEB 2CYYA 2OEJA 4I64A 5E3CA 2W2OP 5C42A 1H72C 3MOZA 3NMRA 2KB2A 3RB0A 2POKA 2ZH7A 1NPKA 1F9EB 3PACA 3I32A 2RUGA 2M3DA 3TA2A 1UEKA 3FZ2A 3PO5A 2GHWA 1ZAXA 4JOUA 1V9OA 4DR1J 1HYSB 1QDUB 2IRYA 5F8IA 5D0GA 2ZZMA 1S1WA 3UDEA 3GFYA 3E2EA 1Q78A 1DJ0A 3KLEB 3N6LA 3DGPA 1KQFB 3R7BB 4H4KA 4F4AA 2A2CA 3GV7B 3TRGA 1C0UA 2BW7A 1WKLA 3RJMB 4X4PA 3LWLA 1B3TA 2MXYA 2RKIA 5KFCA 3A1YG 3DDIA 4ECXA 2D9PA 3M9MB 1U6BA 4DQIA 2N82B 5BYQA 1N4LA 4HR2A 2UZAA 4X66J 1HNIB 2B4OA 2ZH8A 2KG0A 3PIPQ 4WTYA 1NB2A 5D4OA 3GIIA 2IM2A 2MGZB 1WI8A 1IR0A 4JV5F 4IG0A 3CD5A 4MIAA 1SJ1A 4O44B 1JJ4A 2KYXA 3KNGA 1P6TA 1X4DA 2ZD1A 3R2DJ 3HXMA 1RABB 2HQFA 5HVGA 4NCBA 2R8GA 3OL8A 5B08A 1YJ9S 2ACYA 3GMGA 2XO7A 2M7SA 3SFGA 2HEKA 4TXSA 4KGXB 4FBUA 3DC2A 1I51B 2XMAA 1QE1A 1RHKB 3CMQA 4F25A 2U1AA 2PFFB 4NLUA 2VB6A 4MIWA 4LIRA 2N4DA 1PJ7A 4ZVTB 3BREA 2FLPA 2O5DA 2DITA 3QFWA 3BSAA 2YWEA 3ZZZA 3J7YU 1GXUA 2J8SA 2X3GA 1VK8A 4XIUA 4ECWA 3UVJB 1YBUA 3CTRA 1KD1T 1BXNA 3M32A 3NS7B 1KC8T 2MKCA 2KU7A 5FJ4A 3GJSB 3EXCX 4FVMA 2WBMA 1Q4RA 3U1LA 1TMMA 3KK3B 5KG1A 5KFKA 1VJWA 1QVGR 4DDFA 4ZVGA 2C1EB 3ET6A 2LDIA 3QGPA 1MLAA 4DV2J 2WRMA 2OH2A 4ZVUB 4K4XA 4YP3A 5IT0A 4JI7J 1CS4A 3KLIB 5ETMA 1S0MA 3DCAA 5L1IA 1DQAA 3ENWA 4ZLNA 2AZ1A 3M8YA 5LMUF 2AJ2A 5LXRA 2MQQA 4ZN1A 2WK4A 4PG5A 2YKMA 3OFHA 1YG0A 2E9RX 2XI3A 1RCOB 1C4CA 9ATCB 1T3OA 1S57A 2DGSA 2ZE2B 2A2DA 1UETA 3CD0A 2RUSA 4FXVA 3NGUA 2HK3A 4G1PA 4NCGA 2FB0A 1ZH5A 4DR7F 5J2QA 1U6FA 3S7RA 3QSYB 1RTIB 4ECYA 5KG2A 4ZPVR 4AQYF 1NK6A 3IRWP 5KOXA 2WW8A 3QZ7A 2KI2A 1S9EA 2BJDA 2BE9B 3BGLA 3L95X 1ZTTA 1B0PA 3LA0A 1S0NA 4PZVA 2I1RA 3Q8RB 2YQ1A 1JB0C 2GA7A 2AW0A 3JXOA 1V3RA 1RE1B 1KP6A 3D6TB 4WE1A 4OJGA 5DDQC 2AT1B 1SC1B 2VG7B 5C2GA 4RW8B 4A8MP 1QJHA 1KQKA 1HW8A 3OL9A 4O3PA 2GQQA 2I2YA 3HVTB 4LFBF 1Y11A 4FKYA 4RW7A 1CEZA 4DUZF 1KVJA 2FD2A 1UTAA 1TUGB 5L8RC 2F40A 4USHA 3TW0A 3M2VB 1HR0J 3GILA 4TY9A 3D0HE 2YKQA 3UE2A 2K1RB 4H4MA 3JYTB 3IFEA 3G8TA 4LF8F 3MAAA 3NMAA 1BHNA 2D3UA 1VQYA 2HNYA 2F9JA 4V19J 2ZC3A 1FX4A 1SH3A 3ULHA 1FF2A 1KFDA 1T94A 2CJAA 4F0HA 1IKVB 5E3PA 5CABA 4ZPWR 2Z58B 1RAFB 2W1BA 2HFNA 2V67A 1M1GA 2F65A 2NYIA 5L39A 3T6BA 4UOFA 5F9LA 3PIOQ 4DR6J 2J76E 3UR3C 3AJDA 1KS2A 4Q5VA 2C3MA 2WSEC 2W9CA 3PNIA 4LREA 5E33A 3CIZA 3NY0A 3LPYA 1T9UA 3M8SA 1UW9A 2OSRA 5LJ3Y 4Q44A 1R6VA 4NLDA 4F0MA 3MDFA 4ECTA 3NL0A 1IWGA 1FXRA 4CT8A 5DLGA 2V8HA 4ENOA 2AGOA 4DV6J 3R6LB 5K14B 2P6SA 4NASA 5CZVA 1TL1B 2NUUG 2FVSA 2PIIA 4BBYA 4FVCA 4C3MA 2C3OA 3HZGA 3IG1B 1P9YA 3K8VA 2C2RA 2LQ8A 1ICEB 4Z7YA 1M5OC 1FWKA 2P6TA 3H4BA 2DTJA 4F0KA 1Z2LA 3IXQA 2XLJA 2QO3A 3ONQA 1S79A 2VBZA 2VFRA 1N88A 2HWTA 1L5UA 3OR2B 4HHUA 3BDPA 4F04B 2XZDB 1NK0A 1H3DA 1KR4A 3CC2S 1IR1A 5KFDA 4QIFA 4A8WA 1VQ4S 2EK6A 1YLXA 3W5ZA 5A2QY 1BUXA 3PCOB 4CO0A 1AB8A 3V6HA 2KHCA 2J0SD 4C0OC 1P1LA 3SCIE 3PX0A 1N5YA 2EC2A 2VL1A 1G7CB 4P2XA 3GFXA 4DQSA 4USIA 5M2UA 2BABA 3MM8B 3LUYA 4M5NA 3KMSA 3Q8PB 1U0HB 2V2QA 4C8YA 4RW6B 1XC9A 3SQGB 2HBZB 3UCUP 3QLHA 5LOQA 4YFUA 1Q53A 3G2XA 4F4WA 2DNNA 3CCVS 4LJMA 2EFOA 2WVBA 2IMWP 4MH8A 2IC3A 2E66A 1REVA 3V5RA 5E41A 3JSBA 3R5BA 2KO1A 3DRSA 3CCMS 4Y2AA 1S0VA 1QD1A 5HATA 4OI1A 1S1VB 2CJKA 3CVKA 1QAYA 2KJVA 3W62A 4I69A 2Z0GA 1HWUA 3RRHA 4GVBB 1B70B 1FNOA 4M1KA 4LRFA 2H5JB 1L3KA 2XLKA 2GVDA 2F5GA 1GAOA 3MM7A 2FY8A 1RT5B 3W65A 1IKXB 1NDLA 2MDAA 1RT3B 3C19A 3BGRA 3G6VA 2FTRA 4F8RA 1XMOF 4G3IA 1W7WA 2VG5A 2F63A 2DPJA 1TK8A 3AJ2A 1YRUA 4ZHRB 4IRCA 3N9UC 1N34J 4CZCA 5LT5A 4HH0A 2HLTA 5HJYA 1WHWA 1YI2S 5HVHA 3FBBA 2DCUB 1LW0B 2QN6B 3DMJA 3BKTA 5CD4H 1R43A 3GV5B 4WXOA 5KFIA 2AJ1A 1VQ7S 3T6JA 3W9JA 1RT7B 1WC6A 2LA6A 4CNZA 3DDNA 4CI0B 1TVRA 5HLFB 3POTA 1TTHB 1KBRA 4B3SJ 4OZ2A 3QT8A 4QIGA 4HI1A 4V1Ak 3V4MA 3ISZA 3IP0A 4UY8T 2QLXA 1Y5NB 1WELA 4WXWA 1TV6A 3IN5A 1K1QA 2Z56B 5HN0A 2MHEA 2DYAA 3T5KA 2BA9A 3G96A 4EBCA 2IMOA 1SUQB 3PTWA 4K4SA 4C7QA 3JAMU 1EP4B 1C2PA 3S01A 4P2SA 2CQPA 3OTOF 5D15A 5I4MA 4W90B 5T7LA 2E7WA 3UO0A 1I94J 4CH1A 3V4IB 4ICLB 1AUSL 1G1XA 4OL8A 2BJ7A 2P9EA 4C4WA 2Y1RI 2AJQA 2VQFF 2OLWA 3RAMA 1WWHA 1UW4A 4JI6J 1TKXA 2RF2B 3ENAA 1X5OA 1C4AA 3C15B 3C16B 1TK0A 3R27A 2UVRA 1S49A 2CRLA 2PEHA 2MLZA 4TQRA 3KHHA 1U8SA 2VKRA 3G8SA 3OVSA 3IS9A 1N8RT 3OV7A 4GC6A 2DBBA 1N5QA 4QYZK 3I56S 3QT6A 3ENVA 1T02A 3WHIA 1N0UA 1YJVA 4DV4J 1H0HB 4CYUA 4U96A 1G6BA 1RLCL 4ECZA 2Y1IA 1S1UA 4LFAJ 4G6VB 5H1SV 1X4EA 4FYWB 3EM1A 3BO2A 1S5ZA 2ZUAA 4LQ9A 3IM8A 3W60A 4X62J 2EFGA 2JC0A 2OEKA 5ETSA 1Q8KA 1HARA 2J9CA 4ZKAA 3PXGa 2HVIA 2OP5A 2DCLA 3TUIC 2HURA 5CYQB 4A8YA 1IBMF 3NOCA 3BKUA 4P2MA 2J9EA 1FCAA 1IBLF 1TKDA 3SIPB 1FT8A 3CCSS 2ASLA 4P2FA 2CNKB 3DYAB 3LAMA 3IRXB 1MG7A 1WHYA 4DR3J 1Q95G 4K4ZA 4F26A 1IN0A 4DL4A 2YKPA 1TK5A 2HVEA 3V81A 4J9PA 1M90T 1F0XA 2V69A 3PRVA 1A9NB 3KDNA 5A0YB 3M30B 1LWFB 1ZS6A 1FJCA 1F2HA 3KJQB 2DEIA 2JNJA 5EWEA 4C8NA 1RADB 1X31C 2V34A 4ANEA 2R42A 4OZNA 5KT5A 2R7VA 5D77A 5D3GB 5BYRA 2HRUA 2DO0A 3CJ8A 1R8BA 4WKYA 2N3LA 2VBYA 1JKHB 3GIRA 1HQEB 3RW7A 1B7YB 3V6KA 2HPUA 4P74A 1NPPA 3KJNB 5DZ7A 3MEKA 2OFGX 5JXSA 4WCEQ 1XJWB 1C1BA 1TL3A 4CLKA 1OWXA 2DNKA 4A47A 4L76A 4JI4J 2W2MP 4OI0A 5M2RA 2GHPA 2IPOB 2EBEA 5I3UA 4FF4A 5JVHQ 2JOQA 3MM6A 2DGWA 1M5HA 3SCJE 1ZM9A 1SC3B 1RBOB 4U7UK 4DJBA 4RWWA 4BC7A 2AYBA 2QLBB 3M6UA 1V5IB 1N52B 3PW2A 2UU9J 2HRYA 1ROFA 2MPUA 1R8CA 1O6XA 2P5VA 2L9NA 5CAAA 1NBEB 1X0PA 2K7KA 3VGVA 2W4DA 4DQPA 1HMVB 3PW4A 4U6PA 1QAIA 4A8KA 3QNWB 5J2PB 2XYPB 3NGKA 2FGOA 3GV8B 2RH3A 3PHTA 3MMBA 2ZOFA 4FN5A 1AXQA 4FF3A 1DFDA 2QLWA 2MYFA 3SEOA 4PCQA 3NGSA 2EG2A 4FNHA 1VDHA 2GQCA 1SI9A 2FJVA 3HM9A 3EYZA 3T9ZA 4DLGA 4DV0J 3R97A 2GVZA 4RBUA 2XS5A 5AE3A 4DSFA 1JLEB 3NAIA 4O4GB 2K2PA 3AHPA 4K8RA 4EZ6A 3FSXA 5EX3A 6FD1A 2IFXA 3ENQA 1HHTP 5KFLA 2LQJA 1XR5A 4LF6J 3A3NB 3KLFB 2QRRA 2LQ9A 3Q2TC 2KXHA 4I6AA 1DURA 1J5EF 1TUVA 4NLWA 2BACA 2VC0A 4ER8A 4B17A 1N56A 2MMYA 4LT6A 2H54B 2DGOA 5D0EA 2IA0A 3GJQB 2Y1JA 1LKZA 3C14A 1FNMA 5HAOA 2UXBJ 2Q6BA 5F0UA 2ZJQQ 2GC8A 1KRPA 3MR2A 3D6HB 3Q89A 1KTQA 2CPHA 2BOPA 5ETQA 4QOTA 2QE5A 3MTKA 4H54A 2JFKA 1N6QA 1XEZA 2FZKB 2V4JB 4AYBD 4Q8EA 2VH7A 2CPJA 2L48A 2RIJA 2VUGA 4PPZA 1RLDA 4K4VA 1PKUA 1CVJA 1SJ3P 5F8MA 2LEAA 1SJ4P 2DHGA 4M5DB 3C2PA 1J27A 3D2WA 1HNWF 3UD5A 3RAXA 2VASA 1PIEA 1JLQA 2UXCF 1T9YA 1U09A 5C5JA 1I5OB 2ZM6F 5LSRA 3GJRB 3P8BB 2APOA 4OHWA 4KV8B 1VQLS 5H9EJ 5AXMA 1FHTA 2UUTA 5EWGA 3FFIB 2FVPA 3N01A 1RCXB 3NKYA 4RBVA 2BJ1A 3N5BA 2V50A 1SVDA 4I7FB 1RQ0A 2X1BA 4UQTA 2E1PA 3DGVA 2DRAA 4ITSA 4NXNF 4X4UA 4FBTA 1D8ZA 4KKOB 1P27B 2ZNZA 1CJUB 4ED1A 3IMQJ 3TQEA 4XPEA 2DNOA 3ZZRA 1HD0A 1URNA 3D54A 4O0NA 3NBPB 4A8FA 2DGUA 4ELVA 1MROB 1WG1A 2HNZB 2HVZA 1IVZA 2ROGA 2KFYA 3ITHA 1M5SA 2MLXA 4HT7A 4M8LA 2COLA 1XK8A 3C6TB 5U47A 1CQNA 2VC1A 3NWRA 2HAFA 2UUWA 1ZM2A 3MFHA 3OR2A 5M2PA 2G0CA 4QU6A 2YKNB 1NHVA 2MZRA 3NS6A 3K5PA 3TR5A 2EVZA 1UVJA 3MFIA 2CG4A 2O1PA 1RZMA 2Z2YB 1TAUA 5LMUJ 3CCJS 4EFAC 1VRUB 4DHVA 2OPQB 2DNMA 2CAJA 5K5MA 1U45A 4UOGA 2OD4A 5AT1B 2V5HG 1JJ2R 3AXKA 1VIXA 2BKOA 3HD1A 4F4XA 1S10A 4LF2A 1RYSA 3VAHA 5DG7A 3IBWA 3NOGA 3VGSA 3BGOP 4RW6A 2CQHA 4M5IA 3SDEB 3SQGA 2PC6A 3D9BA 2VPXB 3C6UB 4UQGA 4HACB 4F2RA 2B4VA 4QW9A 4AQYJ 5KFZA 5HBMA 2RJZA 3KMQA 1UFWA 1DBDA 5D4PA 1D09B 3A8JA 1YJRA 3CJ3A 3OFFA 4M95A 1Y4ZB 1WTBA 4DR2F 2YNGB 2FVCA 1RT1A 1Q79A 1E6YB 1D0EA 1KDNA 1QLNA 5DM6Q 2LCWA 1GQEA 1HWKA 2GNKA 5A2QU 3LOUA 1QM9A 1RT5A 4R5PA 4CO3A 4YUDA 3L7PA 2CNLB 4WFXA 2B7CB 2EKYA 4IG3B 2NS1B 2J7KA 1JXVA 2G2ZA 2HBRB 5J1EB 1U1RA 1GMWA 3KUGA 3QT7A 3NP5A 3VR1A 3VQSA 2CQIA 1GT8A 2LYVA 4U95A 3VWSA 2V2ZA 2M8HA 3C66A 4MK9A 1U1OA 1Z2ZA 3K5NA 1W2IA 1J5OA 3G8QA 4LF8J 5A76A 3R5AA 3MECA 1NNDA 3VGUA 4F3OA 1DARA 5CQGA 2MEWA 2ILZA 4FXDA 5HROA 4RNNA 2KJWA 2YPZA 4Z37A 1F2GA 3GFHA 4LF5F 3MWBA 3GIMA 1KSPA 4CO4A 3W5YA 1SJQA 1GK8A 4LBIA 1Q7YT 3IWXA 1DQ8A 1JIHA 2L08A 3N6NA 3SMZA 4N5SA 4FKXA 1N0VC 4LRDA 4KO0B 2I0XA 1FKOA 4NX9A 1SUQA 2XWXA 2V8GA 4HHHA 1FDDA 4DG1B 1JLAB 1HBMA 1VQSA 3MEEA 3R5CA 4Q7AA 2EPIA 2ZEJA 3DLHA 4X64F 2FHJA 3P49B 4DR4F 1F9HA 3H8YA 3TAPA 4ICLA 2B4UA 4OI4A 1JK9B 4ZJOA 3KJFB 3TVKA 4DL0C 1EAYC 3DRPB 4TY8B 3C15A 4ZIVA 1HI1A 4ZLLA 3B54A 4ZPTR 3CJSA 2DIVA 2CVEA 2UUBJ 1A6LA 1F1BB 2YKOA 3GONA 3G6XA 2NXCA 4DR5F 1S6UA 5IXUA 3HHLD 3GIKA 2GFFA 4DMZA 5ETTA 2LVWA 3DRRA 1SQGA 3MM9A 1LWEA 1HHQA 1Y5LB 2LLZA 2J7WA 4M5HA 1HNVB 1R3NA 1YVFA 2I6WA 2GAHC 3SQOP 5KAKA 4JI2F 3SBMA 3ISNC 4RNFA 2V2KA 4NEZA 1VQ6S 3DXBA 3H42A 1X5SA 4WIQA 4ECRA 2H3EB 3GFZA 4CTAB 4KPCA 1NK9A 3HSJA 2XBPA 4DF8A 2E1MC 4HYKA 3TX8A 1IBCB 2WW4A 1JLGA 4DS5A 1FERA 1FO1A 4ERDA 4OYIA 2E1AA 2HK2A 4OZJA 1QAJA 4MYTA 4G1QA 4GKJF 2J0XA 1RT6B 4YY3J 1UAWA 2YX1A 3EX7B 1BQNB 3M4XA 3IRXA 1WNEA 3W2VA 2VQEJ 1T05B 3DXSX 4FXWA 1S7IA 2OPSB 1T7PA 3G87A 5A0YA 2ZVSA 3M30A 1H7WA 3G86A 2HQCA 3D68A 3DOKB 3V6DB 4JV2A 3TOQA 1XMOJ 4PUOB 4C8ZA 1IM4A 4Y2KA 3QJJA 4I4BA 3CEDA 2RB7A 3R1HA 5L38A 1TFYA 2XLIA 4I2PA 2J7UA 1T9VA 4IOAQ 4DPYA 3H0PA 2WVFA 2MSTA 2JRSA 5A8WA 2ADCA 1HBNB 1T03B 3QRQA 3LWMA 2YWWA 2QA1A 2KYZA 2KG1A 4W4MA 3US5A 1VFJA 1REGX 5CA5A 2PEBA 1VK3A 4IO1A 4MAKA 4CWBA 2E5LF 3KLGB 1RJJA 1TQLA 2M4MA 1HKAA 1QTNB 1RBLA 3M8PB 2LEPA 3J7YI 2XSFA 3MCSA 2JLFA 2C3YA 2W24A 1VQOS 3QO9B 3A12A 3CCTA 2M8DB 4PQUB 4RUHA 4P75A 3TWZA 4B3RJ 2RQMA 1IKYB 1KTVA 2CXEA 4X65J 4MT1A 4M5MA 1XR6A 2E29A 4Q8FA 3LO3A 3E8OA 4KHMA 2VQFJ 1S97A 5A8KB 4ED7A 1PC4A 3LGNA 2DR7A 5DGAA 5A8RB 1XMQF 1G2EA 2C2ZB 2F1FA 1Q81T 3I0RA 5KFNA 4Q43A 1W25A 2BR0A 4PKDB 4KH1B 2AWZA 2J9DE 3F41A 1K8AT 4WF9Q 4FYDA 2VD3A 5J1PA 3TO8A 1U1PA 5K8NA 4KGVB 3KLHA 2XMWA 1SJRA 3DLKB 3UNYA 2G1DA 2VOOA 2MZTA 1FK9B 3M9OB 2B6AB 2K7JA 2DHSA 1BGXT 1VQKS 1ZZNA 1WF0A 3W2WA 3MUMP 4J37A 1NKBA 1X5PA 1N36J 2ZKUA 1U24A 3AOAA 3AH6A 1E6VB 3TJAA 1C1CA 5LMNF 2CIMA 2VDHA 1HPZB 2H65B 1TR0A 2EFQA 5IOLA 2MKYA 5DGBA 4R25A 5KG5A 5KG3A 3U02A 1F9FA 3CC4S 3P6YC 2HS3A 1KLMA 4V19X 1VQPS 1IBLJ 3CWJA 3LP0B 4PWDB 4RKUC 3MI7X 3G71S 2FJAB 1S9GA 3HF5A 1YJNS 3CO9A 3MEGB 2ALZA 1D8YA 1XNQJ 4F50A 1ZA1B 1NU4A 1NH8A 4PRFA 5KT3A 1UWAA 3OJUA 3T5LA 3IO1A 1MU2B 3O44A 1SKRA 2C2KB 3CT9A 4WKRA 4ZDNA 3BQ0A 2QL7B 2HHVA 1IM6A 1GX5A 2UUCF 2ZKTA 4MFBA 4HHJA 4WIIA 1KVIA 1WEZA 1VQNS 1AYEA 5C25A 5C7PA 3CDWA 3EPIA 3TZXA 1VRQC 1RTZA 4DV1J 3LF0A 5E5NA 1VHIA 4M5DA 2E9ZA 3MCMA 2Y0SD 3I9ZA 2PMWA 1FA0A 3I5BA 2RAQA 5LSLA 3P45B 4DV7F 2ACMA 4Y2CA 1U26A 3TZWA 2QJ3A 2YNIB 1FE4A 4NA1A 3DOMA 1T9TA 5D6GA 3EVMA 1ZOTA 1DRZA 2HZAA 2HMIB 4KV8A 3GTYX 3CB4A 3KNAA 4YHHF 4ED0A 4USJC 1H98A 3GR1A 4DI6A 2I5JA 3BM7A 2JEJA 1QTMA 2YPYA 1HBUA 4I7FA 5ETPA 3OBIA 3W61A 2XWYA 4ES3A 2CADA 2Q6CA 1QSSA 1FWPA 2RSQA 5J2MA 3DHWC 3Q83A 4WU3A 4DCJB 4ID8A 4AXJA 1CJUA 3PKMA 3D28A 3HX9A 4PG6A 3RBDA 3L9ZA 2Z4PA 4Y65A 1Q5YA 3FEZA 1VRTB 2ZITA 2D9OA 3S1TA 3AFGA 1U0SA 4NMXA 2E7VA 4ZITA 3M6XA 2FIUA 4QWDA 4ZPDA 2JWNA 2XMTA 3NEKA 1MROA 3RR7A 3KTQA 4W92B 2YWKA 2QLFB 3M7VA 1UJ4A 2A18A 3SZ2A 4I6YA 2H5EA 2MJUA 3BN7A 3PR4A 1C0TB 1IR2A 2GMJA 1K0VA 4H4KC 1PYTA 4CRJA 2JH3A 3RB4A 3OD2A 2R7OA 2YKNA 4C6AA 1FEEA 1OSCA 2VONA 3IBCB 4ZP9A 3MD3A 4DX8H 5CH7B 2C3UA 1HNZJ 1LXJA 1VR6A 4B3OB 5CYJA 1VHFA 2ATCB 2DNLA 1N5SA 2B51A 1YHQS 1DTTB 2G0IA 1UWBA 2HHUA 1RWWB 4FZVA 4ZP7A 4YR0A 5BJRA 2HNDA 1U25A 1X4CA 3FBFA 3QJLA 1OQ6A 3LP2A 4NLOA 5J2NA 5I3PA 4F4KA 1J5EJ 1FESA 2HHHF 3ILLA 3MR7A 4FPIA 4HACA 1RT2B 1MMLA 3LANA 3CDAA 4OYPA 1ITPA 2GIRA 2KRBA 1Y3KA 2ZHBA 2J0WA 1EHWA 1RWOB 2YNGA 1OY9A 2W2PP 4G1IA 4P7VA 1IJFB 1E6YA 4K4YA 4YEAA 2C3PA 1WG5A 4QWBA 4KAIA 5AJ3F 2VPZB 3R9LA 3CC7S 1FJGJ 1LQ9A 2W7PA 4NYPA 1DLOA 5T41A 2C2NA 3WIVA 1Z4UA 1YITS 1KLNA 2OPPB 3HFVA 4NLPA 1EIYB 3CXCR 1X4GA 2H4WB 4MK8A 3PEHA 4YMEA 4GC7A 1FFSB 2QGFB 1NSPA 2VG6A 2FLLA 4DFPA 1RI7A 5CYMB 2YX4A 1FXLA 1YKWA 3KG4A 2VODA 2HKEA 3ETOA 1FKPB 4CLUA 4RNMA 1EB0A 1U1NA 2KM8C 2UXCJ 4CDIA 2ZNYA 2XMKA 2W8KA 2VA2A 1VQMS 2CPEA 4CH7A 1HQ2A 2ZM6J 3KFWX 1Y00A 3A3OB 2UXDF 1ZPWX 4RW9A 3KXDA 2DRDA 2ADBA 5KG4A 1XN9A 5DDPC 1H73A 4L75A 3AB2B 4OYZA 4DQQA 2QLJB 4DXLA 4DCOB 4ZLPA 2AHOB 1B0TA 3DM2B 2W9BB 1WTFA 5FDLB 4C11B 4NXNJ 2RD5C 4NLTA 4EMDA 2IM1A 3KK1B 4NXMJ 1WC0A 3BSOA 2Z2MA 4IFVB 2M0GB 3JTNA 5C24B 3K5OA 1FDBA 1RAGB 3OLBA 4MIBA 4I56A 1UVNA 4K4UA 1F5BA 3MMAB 2R8HA 1Q5VA 3FCHA 2GV1A 1F5CA 4UOCA 2XQCA 2B3TB 2RILA 4A46A 5FLXU 1OY6A 2HWHA 1TL7A 2FLNA 2JVOA 5E0OA 1JNZB 2FHKA 4JYAJ 2CKWA 3W9HA 7FD1A 4ED3A 5F41A 5DZ6A 4WK1A 2VIHA 1TKZA 3CMES 2P9GA 3PEJA 1NSKL 1HNVA 1EQMA 3TAMB 4DUYJ 4OZ0A 4NLQA 7FDRA 2BE7D 3J80U 5KFOA 1OPZA 4IOBA 4JI0F 4DPWA 3HKWA 3MMCB 3AOCA 4EO8A 4DPTA 3GP9A 4R8UB 4CTAA 4N7TA 4AL5A 3IR6B 3WQPA 1AW0A 3FKBA 1PO6A 3OVAA 5H9FK 1DTQB 5EHHA 5AXLA 2Z8QA 3M6VA 1LNQA 5BYSA 3BEGB 2EG1A 3TA0A 4B9TA 1CJVA 2UUAJ 3OSNA 2MQOA 2RS8A 3QIDA 1R0BG 4K2JA 1S77D 3G82B 3BSNA 3D5MA 2BKPA 4EEYA 1HHSA 3CCZA 3VAFA 2J6UA 4DR2J 5CXTA 3OTEA 1UFLA 3DOLB 4WTOB 2YXLA 5DRKA 1FTCA 1BD6A 3FNNA 2MY8A 2VKZG 1WJ9A 2G4BA 1M5PC 2CJ9A 1QVFR 2HHTA 3HJFA 2FC9A 2PA8D 2BJ8A 2DNHA 2MQNA 1VLYA 5JVGQ 4CLZA 1UMJA 1YTYA 1X4BA 5DDRC 3L3CA 4QYZJ 2UP1A 3RRKA 2GGPA 5IS2A 2IAJB 2WSCC 3D3BJ 3EVWA 3ILOA 2QC3A 2BRLA 3MGJA 3PV8A 3UCGA 4JI5J 2OJ3A 3QJPA 3UR0A 1T03A 2OMOA 1FNXH 4NYZA 4ZJQA 3CCRS 4QYRA 1HFEL 1CJKA 2BANB 2CPYA 3KLGA 4EYIB 4RUCA 4OI2A 3I0SA 3TUPA 5KFRA 3M1VA 4NLSA 1YJWS 1AZSB 4B08A 3M8PA 3RBXA 3UFCX 5JMNA 4DWIA 3NGRA 3W7BA 3HHKA 1XR7A 2VICA 3EZ5A 2OPRA 1HL6A 4EWTA 2Q1LA 1IKYA 2V2VA 1CULA 2AYEA 3QATA 4X66F 1NMEB 4DR4J 1GX6A 3GPAA 2H4YB 5LM7E 4EK2A 5B7WA 3UPFA 2BE2B 2QTWA 1SQFA 1GMVA 3BBCA 5A8KA 4B3TJ 5G4DA 1IWAA 3M2UA 5DG8A 3VZHA 4LSLB 2AQ4A 2UV8G 1AUDA 3OJSA 1D9DA 4OLOA 3HP6A 1NK7A 2Z57B 1YZ6A 4X4NA 1VMBA 1VBZA 3T9NA 4C0HA 4DR5J 3DLKA 5HQMA 4RL1A 3BR9A 3ETMA 3TQ1A 3NS5A 2B6AA 1JMTA 2X1AA 3W63A 1TELA 3PJWA 2V8DA 4TLQA 2PMHA 1RAHB 4D3HA 3BKFA 3VAJA 1A7GE 2C28A 1M5VC 4KBIA 4J9OA 1BQMB 2GO9A 2W4PA 3PW7A 2J6TA 2BX6A 1CJTB 1O5JA 1RACB 3PFOA 3PY8A 3MEDA 4ZPBA 5EGYA 2BM1A 3NCRA 4R0JA 2XGQA 3JQJA 2BW2A 3RBZA 4HI2A 1VC5A 5IV4A 1FJ7A 2W25A 3B4DA 2DVIA 2BYCA 2OHDA 5GADU 3DLJA 5I3QA 4NE9C 1CPZA 1OIAA 3QYYA 1RTDA 1EX8A 3MEGA 2OTLS 2R7QA 1I3OB 1KQGB 4JV1A 1RT4A 1EETA 4Q2LA 4DV2F 4FS1A 3BDEA 1MU2A 1NHUA 4RU9A 1EJ7L 2A1BA 1FDAA 3VCDA 1RTHA 5I42A 3WZ0A 2FC8A 2WONB 1UPMB 2VFSA 3LP1B 2HBYB 2FZGB 3JTPA 3TI0A 3Q2SC 3JSMA 5C42B 3TVZA 1TAQA 3M9NB 1IBKF 5DETA 1WD6A 1RK8A 3SV4A 4DPXA 4DL5A 2HSEB 5KFGA 3DHXA 4U8VA 3M8WA 4Y3CA 3D1HA 1NK5A 3MZIA 2FZCB 3OXGA 1R0AA 4QWEA 5HMWA 4X4VA 2BXJA 3OLAA 4GKKJ 2H5IB 2KDOA 3KK2A 5E3AA 3R5JB 3L09A 8ATCB 4ANCA 4J9NA 5SUHA 2YNIA 1S1WB 2BQ3A 3TJ9A 4U7CA 3F56A 3CUNA 3EGNA 3DGPB 1S1TB 2IBOA 1SQEA 5T14A 1VC6A 1WF1A 2MTLA 4AL6A 2DH9A 1RBAA 3M6WA 5IQ6A 1NJWA 5L9NA 1C0UB 4PXCA 1CSJA 2ZDOA 3FQKA 2RKIB 2X1GA 1SJFA 4PAAA 3MPVA 5D78A 4K5SA 4A8OA 1R0CB 4OV1A 4ATNA 2BDPA 1P9QC 3CW2C 2QA4S 1RKJA 4X84A 1SPBP 2WCXA 2J8AA 4ALZA 4PABA 3GSDA 1TU0B 3G4SS 2NXUA 1HR0F 2MZQA 2XMVA 1FDNA 3CJQA 4IG0B 3CDBA 1XMQJ 3N28A 3M8ZA 2QA4G 2QA2A 4O0IA 1WHXA 5F8LA 3EGVA 1RA7A 4K0KJ 1S6PA 3VZIA 1PBUA 3KHLA 3KHGA 4CT9A 2ZD1B 3MPDA 2N7CA 2IRUA 2DR8A 2HS0A 1C0TA 2B56A 3BPSP 3JTOA 2IVFB 1NSAA 2X51A 4DR6F 1ZAVA 4AUKA 2Y8YA 4E98A 3MM5B 3TAQA 2CQ3A 1VI7A 5DQHA 5HP1A 3BS9A 4ZCMA 5EDWA 4C2MA 2JLEA 4B3OA 2AEJA 3QMQA 2VJVA 4E8UA 3FCWA 3OL7A 1DTTA 1NK8A 4JI3F 4DV3J 1IKWA 3BB5A 5LMNJ 4DV6F 2OAUA 4LSNB 5KFPA 2GIFA 1TL5A 2JLGA 1HQUA 3CJ2A 3U27A 3LPEA 5IWAJ 2Y1LB 2IVYA 3HT3A 4YB1P 3W8PA 1SKUB 3BQ2A 3UW1A 2VZ9A 3S8SA 3NAHA 5SZTA 3FBCA 3CJTA 3CJ0A 2F8HA 1EKSA 2V63A 1U6ZA 4ED4A 3D7SB 3P5BP 3MPWA 1WEYA 4ZN3A 5KFEA 3ET6B 1RHMB 2CDQA 3KJVA 4OFZA 1RWXB 5CCMA 3HMJG 4MTPA 3HHLB 4J9RA 4Q45A 4LF4F 4MKAA 4CP5A 2RDIA 4CLPA 1WOSA 1OMSA 1M5KC 2YKMB 3EZOA 4DBQA 2OPPA 1OPIA 5D0HA 4OX8A 4H4OB 2QYCA 3D1QA 4UUWA 2ZHOA 4LF1A 4J5OA 4RO0A 5J2QB 3OT9A 2DXEA 4GMKA 1T8EA 1SC6A 4NLXA 2V6AA 4FS2A 3AXMA 4ES1A 3I96A 1FKPA 4A8QA 3SXLA 4DLEA 3UDVA 4DV7J 3FBEA 2Q3PA 4QJVA 4GRSA 1T95A 4KHPF 4P10A 6AT1B 3THTA 4LF7F 2OEMA 4QCLA 2W8LA 2Z2ZA 4JI1J 4FYXB 4WE1B 3QIPB 4XDCA 3C46A 3LGHA 2IJNA 4K4WA 5AE2A 4ID5B 3DM2A 1MW7A 2HBQB 4IKAA 3OXFA 5HJXA 4F02A 3TP2A 2CQ4A 2HFUA 1NXIA 1KQSR 4N76A 4RW7B 4RNHA 4QU7A 3BBFA 2HHQA 3KK1A 1Y5IB 3BPDA 4USMA 1ZZFA 1N34F 3I5AA 1XTZA 4M63A 1HBOA 1WC3A 5C24A 1RTJA 3OUYA 4H4MB 1NRKA 2RRAA 2JEFA 5IV3A 4A8SA 3E01A 2WOMA 3MAAB 2ERRA 4MMOA 1PYSB 4O3NA 1QY7A 1RB0A 2OD6A 2A6MA 3RB3A 4DFKA 4LUBA 2R2RA 4OYAA 3WDOA 2XO6A 2E5IA 4DU7A 2HHPA 4WP3A 1WC4A 5HO4A 4K59A 2XCAA 4IH7A 4B3SF 3OFEA 1ELOA 1JLBA 3BJYA 1RUSA 1YRTA 2C42A 1UCNA 2W9CB 1H2TZ 2KVQE 3PX4A 3O6QA 1FVQA 1JLFA 4LF9F 3CCES 2CPDA 1X60A 4TVAB 3MTJA 1N33J 3CJKB 4RUBA 3AA8A 2FLOA 1PC5A 2R7UA 2XZTB 2YNHA 2KFNA 1HIYA 2R7XA 1NDKA 4NLVA 1I94F 1HNXF 1UL3A 1S4EA 3F73A 4ZIWA 5CCLA 1BWEA 2U2FA 5DDOC 4IH5A 4JI6F 5F9NA 2AGPA 3IAS9 4PXEA 4C8LA 2EK1A 2FVRA 3T1AA 5J1NA 2V8VA 4J9VA 4KH0B 1CC8A 3KYLA 4DZ6A 5ETOA 2Q79A 3B8HA 2YH1A 1WKJA 2E44A 3G82A 2HHXA 4KFBA 2ROEA 3IA0A 1GTHA 1FRIA 5THWA 4N8NA 3E51A 2RT3A 2MZSA 1AROP 4F2SA 2ZZTA 4MKVA 5AJ3J 1ZM4A 2MZJA 4DV4F 4I2QA 1GXTA 1Y9OA 4IQMA 1FKAF 2F7VA 4KC5A 4KGMA 2ZBPA 1RWVB 3J81Y 2LECA 4LFAF 3VTIA 1YQHA 2K3KA 1N5YB 4N77A 2D3ZA 2MKHA 1AFIA 4X62F 2BVZA 2C2OB 4HL9A 1SV5B 3FK4A 1Q16B 1VBYA 4IYQA 1TL4A 5K9FA 2W2QP 2Z30B 2B9EA 4EUVA 2KT5A 4Y0FA 4OJHA 3H40A 4OYBA 3U7JA 3GYNA 3JQMA 3T1YF 5CHCB 2QYGA 4NWBA 4Q0BB 5KOWA 2QX0A 4ZJLA 3H5XA 2DNRA 4ZLJA 1S1XA 2IC3B 2HYIB 1WOOA 4CLWA 1REVB 4QR1A 3ZTQA 4DR3F 5KFTA 2BANA 1BLUA 3DRSB 5B0AA 2WVCA 4MKBA 3VVTA 5KT2A 4ED6A 3DLEA 2FQQB 3F0NA 1VJQA 3IC1A 2DT9A 3CDUA 2KVIA 2RQ4A 4UUXA 2RMLA 2E5JA 4M5KA 1UJ5A 2GVDB 3MM7B 3NCQA 2O67A 2ASYA 1JXEA 4L3KA 2EFVA 1T3NA 5KT6A 2ABYA 2DNZA 3ZNJ1 4QZVB 3GB0A 3CMAS 2AIRB 3I31A 3N0VA 3DLLQ 2IJRA 2N7YA 1VBXA 1HYSA 2FJDB 2PFDA 2PMZD 3VQTA 5FD1A 3HO1A 3Q8VA 4DL2A 2GJ2A 3PKYA 3MMJA 4ZVFA 2MKSA 3DMJB 2HWIA 3KLEA 3FVYA 4B9MA 4IUFA 1K0TA 3TJ8A 2R7SA 2DEJA 2R2TA 4LFCF 2RE1A 4YS2A 1LV5A 2ZH4A 4ES2A 4YDDB 1CLFA 1WACA 3ISND 1TVRB 2R2UA 1FX2A 4QBUA 2B8PA 3C3LA 5KFMA 4YB5A 4MYUA 4ZVSB 3I55S 1XBWA 1TV6B 3MR5A 3VHQA 3DLGB 3G6ES 1HNIA 3SYZA 4FF1A 3LW5C 1PCAA 4B9UA 3ZZ0A 5F8HA 2HFOA 2VFVA 2UU9F 2MGZA 4X2BA 3MD1A 2DGTA 1YX2A 2D7SA 1S12A 1NAQA 2OSQA 1N32F 2GX8A 1MWYA 2AEMA 1BMQB 1BQMA 3NGDA 1WORA 4UOHA 4KSEB 4O44A 2FVQA 5EUHA 4XPCA 1VQ5S 2IJFA 4Y00A 2QFJA 4Y2MA 1KOHA 1NDCA 4L74A 1RWMB 2UVUA 4TYAA 1OQ3A 2XY6A 1MN7A 1ZTWA 2DRBA 3VAIA 1WUUA 3FMBA 1VOMA 3IS9B 3QPIA 2B0GA 2RDDA 3ZC4A 3TX0A 3EMTA 2XYHB 4NLRA 1F6TA 2WTFA 5DS7A 4CYUB 4FNIA 4FDFA 3LP1A 4DV0F 1S1UB 3AA9A 2B9WA 1DY3A 2BBEA 3UVJA 3CCLS 1APSA 4Y6IA 4LMZA 2VF3A 5KFBA 2AX1A 4K50A 2YH0A 5DQGA 2Q43A 4LF6F 3QZ8A 3KK3A 1HI0P 1NKEA 4FYYB 2CJXB 3CCUS 2VU5A 2NPFA 3X3UA 4I1TA 1UA0A 2LQBA 3UN5A 3LALA 3KLIA 2HHWA 5DLFA 2OKQA 2JL9A 4J91A 4Q2MA 2UXBF 4WK3A 3V81B 1S1TA 4B3MF 1LW2B 2DHAA 3CE8A 2XMMA 3QRPA 2ZE2A 2V68A 3UD4P 4OZ5A 2HQ3A 3T1HF 3ZNUA 4IRKA 3CJ5A 1X0FA 1F3FA 3PM9A 1UKUA 1AT1B 3RB6A 3RW6A 1URRA 3R7NB 1RTIA 2H9ZA 1CC7A 3O5TB 3J7A1 2AV5A 3FUYA 2DH7A 3RTVA 2VBWA 3PHEA 1VBKA 5KG6A 2F9DA 2EW9A 3TYTA 3TZYA 2NXJA 1X9MA 1KN6A 2XS2A 4NRUA 3KUEA 3SSQA 3BYPA 4TKTA 1GEHA 5DM7Q 4J9QA 2RDJA 1JQGA 5DG9A 1C1BB 1TL3B 1NK4A 4USTA 4O4RA 2VG7A 4RW8A 4PWUA 4LR7A 1SB6A 2M52A 3BSCA 2DISA 5I3UB 3HPOA 3HVTA 3MM6B 4P73A 3PJXA 3MM5A 2KT2A 2XI2A 2B8QA 1T11A 1CBKA 3M2VA 1KHVA 1PG5B 2K1RA 2AMCB 3JYTA 2F3JA 4JV5J 2JDJA 5HI7A 3W1YC 2QZ8A 1Z1ZA 2CQ0A 4KJIA 3BF4A 4LSNA 4UT4A 3PZPA 1SL2A 3KHRA 2YWHA 5F3ZA 3PX6A 3EGWB 1IKVA 4Y34A 2BJ3A 1UFKA 5EWFA 3K0JA 3MMBB 2FUG9 1WF2A 3VALA 4YR3A 2L9WA 3EJMA 2RU9A 2L41A 3OHAA 2RQKA 3CJRA 2R7WA 3MF5A 1WKKA 1KFSA 2A6OA 3OTCA 2QSWA 4OHYA 2GAGC 2XTJP 5K14A 1TL1A 3HHLA 4K4TA 6FDRA 3BYRA 5B0GA 2AYMA 3ZO7A 2GVZB 3X1LB 4EYHB 3IG1A 3QWPA 1X9WA 4ED5A 2DJWA 4OYXA 2HVDA 4P7TA 1XNRF 3W5XA 1IBKJ 4H4OA 3QBCA 3VAMA 5GAHU 1D9AA 4E2FB 3TA1A 4ZS6A 1RWUA 1GMUA 2P2CB 4GO5X 4OQJA 4M5GA 4KPYA 1IJEB 3O8WA 3EDQB 2I8EA 3H5SA 3LTOA 2CQ1A 2QMUB 2K8GA 4ETZA 5IT4A 2IA6A 2AJFE 2LA4A 2EFPA 1T9WA 3C14B 3ILIA 4WBFA 1VGYA 2HVHA 1PYOB 2LDYA 5CZXA 2DY9A 1MSWD 3QIPA 1T0TV 4F7VA 3IBFB 2HGLA 4ID5A 1N6QB 3NNHA 1K44A 1SH0A 3QSIA 3MM8A 4DR7J 1U0HA 3LH2S 5B09A 3AAWB 4X4SA 5EN1A 4C98A 2RU3A 4EBDA 1LK7A 2QEXS 5HMZA 1UZHA 1WDTA 4Z2XA 4ZCLA 1JJCB 3Q8YA 2OO4A 4XO0A 2R9LA 3PDNA 4BHQA 1PAEX 4RBTA 1JLQB 4HEA9 1S1VA 2KH9A 4ZK7M 4GVBA 1RYRA 5IFMA 2CNNB 4RZRA 1G3OA 1WSVA 2CJYB 2MLYA 3DFEA 1JJHA 3CDEA 2W9AA 4FP9A 1PSDA
chains in the Genus database with same CATH topology
4B9TA 3V6KA 2QV6A 2ILYA 2HPUA 1IKXA 1FVSA 3KG0A 4OX6A 2IVMA 2ZBIA 1RT3A 4Y2IA 2I9SA 3OSNA 2MQOA 2RS8A 4MK7A 4ILRA 3QIDA 2EBGA 2QIFA 2B5JA 3D0GE 1S77D 3G6YA 1MMNA 3BSNA 1M0SA 4NL5A 3MEKA 2OFGX 5JXSA 3D5MA 4WCEQ 1X9SA 2NR0A 3FEYB 3ZZUA 3JSMB 2B9YA 4BWMA 4ZHRA 4EEYA 1HHSA 1C1BA 1TL3A 3CCZA 3VAFA 2J6UA 4J9LA 3GIJA 1OWXA 2ZHAA 2DNKA 4OHXA 2GMLA 4ZCKA 4A47A 5CXTA 5IM0A 2VOPA 2JC1A 3OTEA 1UFLA 3M32B 2KM8B 3O1LA 1RT2A 5E3QA 3DOLB 1BC6A 1YWXA 3M05A 2MB0B 3GZ7A 1LW0A 5DRKA 3RU0A 4OI0A 5M2RA 1FTCA 2GHPA 1ZM3A 1BD6A 3FNNA 2MY8A 3CJKA 2EBEA 5I3UA 4DF4A 4FF4A 1S4FA 1R0AB 2VKZG 5JVHQ 2JOQA 3MM6A 2DGWA 1M5HA 2G4BA 3IR5B 3SCJE 1ZM9A 1M5PC 4U7UK 2CJ9A 3JB9k 4DJBA 1QVFR 1MMDA 4RWWA 4ECQA 4BC7A 2AYBA 2HHTA 4KGKA 4ZVHA 5FLXY 2AF6A 3KK2B 3R5DA 3HJFA 2FC9A 1RT7A 3M6UA 4C3LA 2E7XA 1N52B 2L9DA 3PW2A 2PA8D 2DNHA 2MQNA 1VLYA 5JVGQ 5GMKa 1YTYA 1UMJA 1X4BA 5HLFA 5DDRC 2HRYA 3NWGA 1TKTA 3L3CA 4QYZJ 1ROFA 4QIWD 2MPUA 4KB7A 2UP1A 3RRKA 2GGPA 2LMIA 2CJQA 1R8CA 2YVSA 2MZ1A 2P5VA 5IS2A 1FRMA 3OR1B 2ZH1A 2IAJB 3DRYA 2WSCC 4C8MA 2L9NA 2XCPA 2NSBA 3K8WA 2DNGA 3ITHB 1X0PA 2PE8A 2FJXA 4EZ9A 2BV3A 2K7KA 2BRLA 3MGJA 3QGGA 3FSIA 3PV8A 4L72B 3UCGA 2W4DA 1VQ8S 4JI1F 2JVRA 5E2QA 4DQPA 2LQ5A 3GWCA 1UJ6A 1HMVB 1ZAWA 3PW4A 2OJ3A 3QJPA 2BM0A 4U6PA 4TU7A 1QAIA 4A8KA 1KOOA 2UUBF 5J2PB 2AGQA 3UR0A 3NGKA 1T03A 2OMOA 1TZ0A 2FGOA 2PT0A 3IGNA 4NYZA 2XSJA 1FNXH 2ZBCA 2ASDA 4BC9A 3J80Y 4KT0C 3CCRS 1NO8A 1HWIA 3GV8B 4QYRA 2RH3A 1HFEL 4C9DA 4O3OA 4NCGB 1Q7LB 4D3GA 2BANB 1EP4A 3MMBA 2ZOFA 4FN5A 2CPYA 2KHDA 4LVNP 3KLGA 2ZJPQ 1AXQA 5CYMA 3SSRA 4FF3A 2RRNA 3V4IA 4EYIB 2ZOGA 4RUCA 4OI2A 2VA3A 2XY7A 3H59A 3I0SA 1DFDA 5KFRA 3M1VA 2WSFC 4NLSA 1YJWS 2CQDA 3TUZC 4B08A 3MUVP 4DN9A 5EX0A 3M8PA 2QLWA 2MYFA 5A6PA 3UFCX 5L9XA 4PCQA 3KWMA 3SEOA 4F67A 3T5JA 4DWIA 1S9EB 2RF2A 5LSOA 3FZBA 2CQ2A 2EG2A 4FNHA 3W7BA 2OTJS 2V94A 3HHKA 3CULA 3JSYA 1XR7A 2GQCA 2GIQA 3ICLA 2FJEB 4PG8A 1SI9A 3M8RA 2NUHA 4OX9F 1R8HA 3EZ5A 1SV5A 1SIWB 2FJVA 2OPRA 3HM9A 1HL6A 3EYZA 1WG4A 2Q1LA 3DU5A 3T9ZA 4EWTA 2BRKA 1L3UA 4DLGA 4CH0S 2DHXA 4EBEA 3CSKA 1IKYA 2AYEA 4X66F 4ED8A 1S6PB 4RBUA 2XS5A 1GX6A 5AE3A 2FJWA 2GW8A 5KFSA 4DSFA 2Q66A 2HLUA 5B7WA 1JLEB 4NA3A 3U1NA 3UPFA 3NAIA 2BE2B 4O4GB 4Q0BA 2UVWA 2K2PA 3AHPA 2AX0A 4NZ6A 5A8KA 4EZ6A 1D1UA 3FSXA 3E3XA 1BY9A 4E0DA 5EX3A 2E9TA 6FD1A 1SXLA 2W9BA 2AD9A 2CJBA 5HBMB 5FDLA 4C11A 5G4DA 2EC0A 4YY3F 5LJ5Y 1Q86T 2IFXA 3ENQA 4IFYA 3M2UA 1NZAA 1R8AA 1HHTP 5KFLA 5DG8A 2LQJA 1RKIA 1Q8IA 1XR5A 3RZAA 3VZHA 4LSLB 1QSLA 4YOEA 3KLFB 2QRRA 2VQEF 5HP1B 2LQ9A 2AQ4A 4B9SA 3H2LA 2UV8G 3Q2TC 2KXHA 1AUDA 3OJSA 4I6AA 2AU0A 1DURA 4OLOA 1D9DA 3HP6A 2NSCA 1J5EF 1RT1B 1NK7A 2PI4A 4IFVA 1TUVA 4NLWA 5H9FJ 2BACA 4URQU 4M94A 4PG7A 4X4NA 3H20A 1NJIT 2VC0A 1LXNA 1VMBA 1VBZA 4B17A 1N56A 1NJYA 2MMYA 3S6EA 2FHOB 2FPHX 4LT6A 3VAGA 1YBAA 2ROPA 4QR0A 3T9NA 5AXKA 1IKWB 4C0HA 2DGOA 5K8MA 1N33F 3M8QB 5ADZA 2HNYB 2IA0A 3DLKA 2Y1JA 4O3QA 3V2UC 1LKZA 1FNMA 4QPTA 3C8YA 3MMAA 2CPXA 4DEZA 4R5PB 2Q6BA 3BR9A 1ZETA 1I6JA 4ZA1A 1HQUB 3TQ1A 3NS5A 5F0UA 2B6AA 3PW5A 2ZJQQ 1JMTA 4LIWA 4CCHA 2X1AA 1SL0A 3CCWA 2GC8A 4N56A 4L3NA 4DN0A 1S9FA 4CIOA 1KRPA 1N5VA 5CYQA 3MR2A 3RR8A 4RWXA 1UEVA 3PJWA 4RW4B 2V8DA 3GG1A 4TLQA 2PMHA 5KFVA 3R1LA 2OIHA 1U2FA 1KTQA 2HFZA 4D3HA 2CPHA 3SFUA 2BOPA 2ZH6A 4QWAA 1JXLA 4QOTA 3VAJA 1A7GE 2C28A 4ELUA 2QE5A 5IQQA 1M5VC 4OJ3A 2XY5A 4KBIA 3MUTP 3DNCA 4J9OA 3UCZP 1BQMB 2GO9A 2W4PA 3DYAA 3MTKA 3TUJC 1J5OB 1ZYQA 1NKCA 3PW7A 4H54A 2J6TA 2Z2LA 1O5JA 2JFKA 1N6QA 3PFOA 1IXKA 1XEZA 1S0OA 2R7RA 3MECB 3PY8A 3MEDA 4JI8F 4ZPBA 2V4JB 2BM1A 2HQIA 5EGYA 4AYBD 4K5RA 4Q8EA 5IZHA 2NZ4A 4TYBA 3RYLA 3CD7A 3H5YA 2ZH3A 2J6SA 2VH7A 2QMWA 2CPJA 3NCRA 4R0JA 4I0WA 4X4RA 4IOCQ 2XGQA 2L48A 2NLWA 2RIJA 5HROB 1FJEB 2VBXA 2VUGA 2BW2A 4PPZA 2LU1A 2DR5A 1LWFA 3TAMA 5L1LA 3R3TA 2XHWA 4HI2A 1VC5A 2ZC4A 4DSLA 1CVJA 2XNRA 4K4VA 1FJ7A 1SJ3P 5F8MA 2W25A 1PGZA 2LEAA 2E5HA 3P5TL 3B4DA 4JUZA 2V4QA 1SJ4P 2BYCA 3KJVB 3OTBA 1KHWA 2DHGA 2DVIA 4M5DB 3DLJA 5GADU 5I3QA 3MMCA 2AJ4A 3HVRA 3C2PA 3FQLA 4QWCA 4R8UA 3D2WA 4WFAQ 1CPZA 5K8OA 1OIAA 1HNWF 3PO4A 3QYYA 1U1MA 1RTDA 2XC9A 3M2RB 3MEGA 3RAXA 1K1SA 2OTLS 2VASA 5KTQA 1UVIA 1JLQA 2V0NA 5D3GA 2R7QA 3SCKE 1DTQA 2UXCF 4CO5A 1KQGB 3D0IE 3N6MA 4F4ZA 1U09A 3DLGA 5C5JA 4JV1A 5KFQA 1RT4A 2ZM6F 1EETA 1NEEA 4Q2LA 5LSRA 4DV2F 1JKHA 3BDEA 1MU2A 1NHUA 4FS1A 2BJEA 1J2VA 1HQEA 4RU9A 4C97A 2A1BA 1FDAA 2APOA 2QMXA 1RTHA 3HVWA 1F5AA 1FKOB 5KFUA 3VCDA 4EGLA 4OHWA 5I42A 4KV8B 4X4OA 1VQLS 5JJBA 5H9EJ 3ZFVA 4B3RF 5AXMA 3D1OA 1V6HA 3T3FA 3WZ0A 1TP7A 2GO8A 3O3LA 3B4MA 2FC8A 2WONB 4QR2A 1FHTA 5GADI 3T19A 3NNAA 2UUTA 2VFSA 3LP1B 5EWGA 1HBMB 3MEEB 2YTCA 3FFIB 2WHOA 3CD6S 2KXFA 1L3SA 2VPWB 4X65F 2FVPA 3N01A 3NKYA 3JTPA 1JNRB 4NZ7A 4RBVA 3TI0A 3Q2SC 3JSMA 2CVIA 5C42B 3TVZA 1TAQA 3N5BA 4ZP8A 3M9NB 1U49A 4I7FB 1B0VA 1WD6A 1RQ0A 5DETA 2X1BA 1IBKF 4UQTA 1FRKA 1RK8A 4O3SA 3SV4A 2J0QD 1NB7A 4DL5A 2DRAA 1H2VZ 5KFGA 3DOLA 4ITSA 3DHXA 5G0RB 4BWJA 4NXNF 4X4UA 4Y3CA 4FBTA 4YB6A 3D1HA 1NK5A 3I4PA 3B78A 2ASJA 1D8ZA 1GXLA 4KKOB 3MZIA 3OXGA 1DZ5A 4DOZA 2CPIA 1P27B 3QGIA 2ZNZA 4YQWA 1R0AA 4QWEA 5HMWA 1U1KA 4JV0A 4X4VA 2BXJA 3OLAA 2P9CA 3N79A 5F8GA 4ED1A 1FD2A 4ELTA 3FRZA 4I68A 2KDOA 2B43A 3KK2A 5D4LA 4XPEA 5F8NA 2DNOA 5HQ8A 3ZZRA 2AJ0A 5E3AA 1NH7A 3L09A 4NA2A 4MJKA 5KT7A 3JSRA 1HD0A 3BN4A 1U2RA 4OIXA 4U67Q 4J9NA 4DSJA 1URNA 2DD8S 3PRBA 3K7RA 2IBKA 3D54A 3UNGC 3SCLE 3NBPB 5HMXA 4A8XA 3HHLC 5SUHA 4A8FA 2YNIA 4C8KA 1S1WB 1Y3JA 3AY0A 3FMWA 2BQ3A 2DGUA 4ELVA 2ZH5A 2KXNB 4U7CA 3F56A 3CUNA 1MROB 2ZDPA 1UVKA 3DRRB 1WG1A 2HNZB 2IAJA 1RISA 3EGNA 4K2XA 2V9WA 1S1TB 3QAUA 2IBOA 2HVZA 2ROGA 2KFYA 1SQEA 5T14A 1VC6A 3MM9B 1WF1A 1M5SA 1LWEB 2JZ5A 2DH9A 3EZUA 3ITHA 4AL6A 4HT7A 4HDGA 3M6WA 3KLVA 2YX7A 5IQ6A 3HK2A 4BCAA 2DGQA 2COLA 4M8LA 1U4BA 1XK8A 3FEXB 3QLHB 1NJWA 5L9NA 1O0PA 1C0UB 1FTRA 4HTIA 3DI6A 4PXCA 1HMVA 2VPYB 3C6TB 1CSJA 1N36F 1DQ9A 5U47A 1CQNA 4LQ3A 2VC1A 2ZDOA 2IYIA 1YGYA 5J2PA 2G9OA 3FQKA 1RP5A 2RKIB 2X1GA 2ZH9A 1SJFA 2UUWA 4N41A 3MPVA 3FGVA 4O23A 1UEUA 2HW3A 1ZM2A 1LK5A 1HBOB 2UV8A 3MFHA 3P3DA 1RTJB 3OR2A 5D78A 4K5SA 3OUYB 5M2PA 4UW2A 4A8OA 2G0CA 4QU6A 2YKNB 4OV1A 4ATNA 2BDPA 3E01B 2RNEA 1P9QC 1NHVA 2WOMB 2MZRA 3NS6A 2QA4S 2DB1A 3K5PA 1RKJA 1VQ9S 3TR5A 1X4HA 3HI9A 3DN9A 4X84A 2EVZA 4EO6A 3I9V9 1FRLA 1UVJA 3MFIA 2CG4A 2DGVA 2O1PA 2J8AA 2WCXA 4ALZA 2BQRA 1JLGB 5KG7A 1LWCA 2LXIA 3H2VE 1TAUA 4PXDA 3CCJS 3GSDA 4EFAC 1VRUB 3G4SS 4DHVA 1JX4A 2NXUA 5B0CA 2OPQB 2B4PA 2DNMA 1HR0F 2MZQA 3BQ1A 5K5MA 1U45A 1YIJS 3EUNA 4G1QB 3NG8A 4OZ1A 2OD4A 2XMVA 1IQZA 1FDNA 2V5HG 1JJ2R 1H38A 4QIVA 1VIXA 4IG0B 3CDBA 1JLBB 4F4XA 3BGRB 3OPKA 2PA3A 1S10A 3JAMY 4B9NA 1BQXA 1RYSA 4YDXA 2EI5A 3VAHA 5DG7A 1XNQF 3T5HA 3N28A 2VG5B 3W2VB 3IBWA 2QA2A 2QA4G 4NCAA 4O0IA 4DL6A 2LXFA 1WHXA 5F8LA 2XMJA 5LXYA 1RA7A 3FJ2A 2CQHA 4RW6A 1LW2A 3RAQA 1GTEA 1S6PA 3VZIA 3KHLA 1Q1KA 3KHGA 2L3MA 3SDEB 3HKZD 3SQGA 4CT9A 4B9VA 2PC6A 2ZD1B 2VPXB 3C6UB 2N7CA 1JLFB 4UQGA 2HGNA 2IRUA 1JLEA 2DR8A 2BE2A 4O4GA 2HS0A 1C0TA 2B56A 4F2RA 2B4VA 4QW8A 3JTOA 4QW9A 2IVFB 5KFZA 4ZP6A 2X51A 4ZMMA 4XK8C 2RVJA 4DR6F 5HBMA 2RJZA 1SKWA 1U1QA 3P96A 5DQIA 1ZAVA 3KMQA 2YNHB 2YNFB 4AUKA 1UFWA 4E98A 5GAEU 3MM5B 1DBDA 3TAQA 3H5UA 4LSLA 2CQ3A 1VI7A 2GCFA 5D4PA 5DQHA 3KLFA 5HP1A 4KTQA 3CF5Q 3BS9A 1YJRA 1S72S 3CJ3A 4ZCMA 3HVAA 5EDWA 3OFFA 4M95A 1Y4ZB 2HGMA 4L6V3 1WTBA 4DR2F 2YNGB 2FVCA 4QPXA 4C2MA 1RT1A 2JLEA 4B3OA 5LL6d 1Q79A 1E6YB 3POTB 4A48A 1D0EA 4JI4F 3QMQA 4ZOSA 4ETXA 1QLNA 5KG0A 4B02A 3NRBA 4E8UA 5DM6Q 2LCWA 3EXYA 3OL7A 1GQEA 5B0DA 1DTTA 1HWKA 4DV1F 1NK8A 4I2PB 4IDKA 4JI3F 2GNKA 2LU2A 1IKWA 3BB5A 2R8JA 4BS2A 1Q8LA 5A6WA 4DV6F 4ZCIA 2OAUA 3LOUA 2YY3A 4LSNB 1QM9A 5KFPA 1RT5A 4R5PA 1L3VA 4CO3A 1TL5A 4YUDA 3L7PA 1HQUA 2JLGA 3CJ2A 3U27A 3IR7B 2ZZNA 1JLCA 3AQOA 1N5TA 3AJ1A 2I38A 4WFXA 5E7OB 5A8WB 2JX2A 2B7CB 5GAEI 2MQPA 2EKYA 4HLBA 2NS1B 2YQ3A 4IG3B 2J7KA 5GAGU 3K58A 4ECUA 4WYLA 2IVYA 5J1EB 3HT3A 4YB1P 2PI5A 1U1RA 4ECVA</