1F2HA

Solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
169
structure length
169
Chain Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
publication title Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f2hA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
2E7XA 1VLYA 4OV6A 2QGFB 3ONQA 1HWKA 3D9BA 4ZPCA 1OPZA 5LJ3Y 1REGX 1Y4ZB 2WW8A 3ITHA 3WC0A 3LP0A 3W5ZA 4OHVA 1RTZA 4ZHRB 3KMQA 2F7VA 3EMTA 4ZVRB 5D0GA 1JLEA 4H4KA 1FVSA 3FRYA 5IOLA 4CLKA 4R8UA 2DH7A 4O4GB 2EXUA 5ETMA 1RGVA 1M1GA 4H4OA 1HMVB 1U2FA 3ILJA 3T41A 4GRSA 5ADZA 2M70A 1B0PA 1Y5LB 5HROA 5AXNA 4DFJA 1A7GE 3THVA 1EKSA 2B7BB 4HH0A 1HNWF 4U6PA 3H8YA 4MKVA 1EIYB 3HVWA 2C3PA 1OWXA 2ZH2A 2HHHJ 3T1YJ 3MM5B 5HVHA 3FBBA 2P5VA 3NWRA 4DDFA 2RF2A 3SBMA 1ZZNA 3P6YC 3IMQJ 3P3DA 4FS2A 4PYAA 2CZ9A 2ROGA 4M5LA 3IBFB 2QA4G 3OTEA 1X8DA 3DI6B 4M5IA 3DDIA 4GVBA 4LT6A 1TAUA 5D4NA 2YKQA 1H3DA 1U6FA 3LGHA 3KLIB 4CTAB 5KFBA 1RK8A 3DDNA 3O1LA 1X60A 3M6WA 1Q78A 3K17A 2DPIA 2BACA 2B6AA 3RZAA 2OI2A 1UWBA 2OD4A 2HLUA 1F9EB 2JLEA 1QSSA 5J2PA 5BR8J 4OL8A 5FLXU 4RL1A 1DLOB 4UW2A 3T9ZA 1D1UA 2GQCA 2JDJA 3UR0A 4GKKJ 3QLHB 3CDAA 1PILA 2HVDA 5K14A 1Q8BA 1RAFB 1RWKB 3HHDA 2KKHA 5DGBA 9ATCB 5JMNA 2MY7A 4QBUA 1Y7PA 2HEKA 3CW2C 3W5YA 3PY8A 4CI0B 5KFPA 4PUOB 1SJ3P 2QLBB 1IM4A 3I0RB 2VUGA 4RBVA 3MM7A 1FEHA 2QTWA 2HHTA 4DPOA 3HVAA 4Z7CA 3C15B 1AFIA 5KFTA 4DQIA 4DMZA 2C3YA 4USKA 2RQMA 4DX7A 2BJ9A 4U7UK 3HJFA 2VICA 4EUVA 4KHMA 1F9FA 2G4BA 1B7FA 2N82B 1R0BG 3IGNA 2HGLA 2W7OA 2EG2A 1EAYC 2W7AA 2KFNA 2VC0A 3RJMB 1N0VC 4QR2A 3EZOA 2XO6A 4FF2A 2XMUA 5D8HB 4F4ZA 1N5YB 1ZETA 4M5HA 2QLFB 4C8YA 2C2ZB 3HZEA 5IV4A 3OVBA 1DBDA 2VIHA 3P5TL 1T9VA 2HBQB 1EHWA 3TVZA 4JI4J 4JV5J 2F63A 2FJEB 1SJFA 1BY9A 1HHQA 4O3SA 2MZRA 2BBEA 2CZVC 5HK4A 3C6TB 1S1UA 3RR7A 4YOEA 2XY5A 2PT0A 4I64A 4Y65A 1H2UX 1LQ9A 4DQSA 3IS9A 2A18A 1WJ9A 2EFQA 2KTQA 2BVZA 1TK8A 2HSEB 3SDEB 3KOAA 4QW9A 4ZCMA 4L75A 1N88A 2ZBRA 4DHVA 2KG1A 1NHKL 3UCGA 1UP1A 3H42A 3S01A 5A8KA 2DNQA 3MFIA 1BQNB 2W4CA 3GFYA 4N76A 1KD1T 2XZDB 3C16B 1JXVA 4IOBA 3C3LA 2XI2A 3CCES 1WNEA 5EWFA 2DNGA 2J9CA 2DRDA 1NKBA 4TQRA 3O6QA 1NPPA 1SL0A 2Y1RI 2A2DA 1NSPA 4K50A 3CO9A 4QOTA 3Q8UA 5GMEA 2AF6A 4WK3A 4JI1J 5DG9A 5KFDA 5JVHQ 2W8KA 1JJHA 3ZTSA 5EDWA 2D1CA 1WOPA 2B3TB 3A3PB 1LFPA 1AW0A 3M8SA 3AD8C 2BOPA 1Q8KA 5F9NA 4J9MA 4UY8T 4UF4A 3NNCA 1FDAA 4Q45A 3V2UC 2R8GA 4GC6A 2U2FA 1CJKB 2KJVA 1HQUB 3BSCA 4QQBA 3DRSA 4CO3A 5HN0A 5DG7A 1RU1A 2ZE2A 2AHOB 1C0UA 1X5SA 2VQEF 2R7TA 2E5JA 4M5MA 1YRTA 2CG4A 1RISA 3M6UA 4JI3J 1IBCB 1U2RA 3HHKA 4DSFA 1OJ4A 3FDSA 1DTTA 4WP3A 1JLAB 3JAMY 5IC4B 3BGRA 3GYGA 3BPDA 2CNKB 2M52A 3IC1A 2IVMA 3TX8A 5B0GA 3HHLD 1SL2A 3M2RA 5IQ6A 2D7SA 5D3GA 4M1KA 3A3NB 4DR2F 1TL3A 4I56A 1QSYA 5A8WA 1LEOA 3C14B 2OTLS 4KHPF 2M9KA 3HSDA 2P6SA 4AD6A 2VFUA 2IDLA 2B43A 2DBBA 4ZVSB 3J7YI 1MWYA 4KY3A 3WQPA 1UEVA 2KH9A 1X7VA 4XDCA 2N3LA 2ZZMA 1RAAB 2ACYA 2YKMB 3UD4P 4F67A 1VRUB 2BJ1A 2E1PA 3A4TA 3T1HJ 1FEEA 2IYGA 3H5XA 3M30B 4K7QA 3I0SB 1RAJA 2MKKA 2X1FA 1S6UA 3MM8B 4HKQA 4LF6J 4PQUA 4LSLA 2IJRA 2EK1A 3T5JA 2DIUA 2MJUA 4ALZA 1CEZA 1YQHA 1TKTA 4ZA1A 2OIHA 2RNEA 4CYUA 1HNWJ 2GQ2A 3KNGA 2AV5A 1OPIA 2LYVA 4A8MP 1FA0A 4ES2A 3DYAA 2ROEA 4LFAF 2W9AA 2WSCC 4FZVA 2A1BA 2Q79A 4RZRA 1EKRA 3K58A 3PEJA 1RTHA 2H48B 2W9BA 1WC6A 3BEGB 3T5KA 3N79A 4Q2MA 1QAIA 3PX4A 3VALA 3V81B 4DU7A 2V63A 1NAQA 1HQEA 2XMWA 3VR1A 1F2HA 1HNXF 4IFYA 2JEFA 2H4WB 4WTYA 1HBUB 4OHZA 2H5EA 1FKOB 3FCVA 4G1PA 4YHHF 3RBZA 1OY9A 2E5GA 3VWSA 1LWXA 4CQ1A 5D78A 4CCHA 1JLQB 3QO9B 4ELTA 2D3ZA 1G1XA 1MU2A 3IM9A 3UN5A 3D54A 1X4CA 3UVJB 3VAIA 3M8QB 1FCAA 2MZSA 4OJ3A 1RP5A 5DZ7A 2F8HA 1URNA 2D3UA 2PFFB 3D3CJ 4DBQA 4JV1A 4UTGA 1Q1KA 2LQBA 4W4MA 2OJ3A 1S0OA 4J37A 1KDNA 3PXGa 4LMZA 1H6KX 4CLYA 1DARA 4CLUA 3F41A 4X4PA 3GMGA 1MN9A 3BYRA 2FLOA 1WWHA 4ED4A 1I94F 3QPIA 2BXJA 4V19J 3A8JA 2B9EA 2CQ0A 3P4UB 5CYJA 3K8VA 2UUWA 3RRKA 4XPCA 3ADAC 2CQPA 3R5CA 3DLLQ 1FESA 1BXNA 1MWZA 2J0XA 4DPYA 1NJYA 3OTDA 2Q3PA 1TKXB 2RH3A 2GZOA 3KXDA 3AA8A 2EG1A 3B4MA 2BUNA 3JSBA 1KVIA 1WF2A 1RDRA 3CJ5A 4YY3F 2YX4A 1B70B 1S1XB 3TVKA 2H54B 2IM0A 4BCAA 4EGLA 3GG1A 1KRPA 1HYSB 5CH7B 4HI2A 4TQSA 2VDIA 2OEKA 3MPDA 1C0TA 1S1VA 1VBZA 4RUBA 4WP8A 2DH9A 2HURA 3NLCA 1YDLA 4P7TA 1IBKF 1N0UA 2CJXB 1AT1B 2HZAA 3UD5A 3VAMA 2J6TA 4DV5F 3QSIA 4OYXA 3VAKA 3KJVB 4HHUA 3CCWA 2GVZA 3W2WA 2NPFA 4CIOA 1N6QB 4LR9A 3MEKA 1S4FA 1I51B 3IN5A 1WF1A 4KC5A 3BO2A 4O3OA 4I0WA 4I6AA 3E51A 3QAUA 2HNYA 3IWLA 4TN2A 3MR3A 4L3KA 3JYTB 4USWA 4LF1A 5AXLA 4BLGA 2JEIA 4LSNA 3NWGA 3MF5A 2J7UA 4F4XA 1EP4A 3HHNB 3BH7B 3ULHA 1VQ6S 1NSKL 4DQQA 3I82A 4ZVGA 3M8PA 1FFSB 3IBWA 2QLWA 1N34F 3L4BC 3WBZA 3GWCA 3ZO7A 4O23A 2GA7A 4LF7F 1JJCB 1T9TA 4JB8B 2WB1D 4RW9A 2F8MA 2MMYA 4B9MA 1TUVA 5L9XA 3CDUA 1FXLA 2RU9A 2LCWA 3MUVP 3K8WA 4ECTA 2BQRA 1RA7A 2VQFJ 1DAXA 2BANB 2V8VA 1ZM4A 3MOZA 3JSRA 1FKPA 2CJ9A 2F40A 1DRZA 4ELVA 1CBKA 4K4TA 4NI2A 1X4EA 2QFIA 2KXNB 2FHMA 3CVKA 1S6QB 1U1MA 4NPOA 4ANCA 2ATCB 5B0CA 1NM2A 2NUUG 1E6YA 2LXIA 1H73A 1H2VZ 5A8RA 4F4YA 3UCZP 4C3MA 2RQCA 4C3KA 2Q43A 1RUSA 3TUZC 3U7JA 1FF2A 2MSSA 1RT5B 4QYRA 2MQ8A 1VLOA 2UVRA 5I42B 2CRLA 3OHBA 1WDTA 2MKJA 1TMJA 2WW4A 4IKAA 3PRDA 1I1GA 2V8HA 4C8LA 4WFYA 5A0YB 2D3OR 3MEGA 2YKPA 4LQ3A 1EETB 2OHDA 1NNDA 2DY9A 1HPZA 2XI3A 3OW2R 2FZGB 4ECUA 2XS2A 1VQPS 2XYHB 4B17A 4DX8H 4RUAA 2FLPA 1JNRB 4Y3CA 2EFNA 1NJWA 3NOGA 1HARA 1T95A 3POTB 2VHGA 3U1NA 1UPMB 4DR3J 4WFNQ 5BYSA 5I3PA 2XZWA 4BHQA 2ZHBA 1RWVB 4K5SA 3Q24A 2DK2A 3J7ZT 3T19A 2RMLA 3I55S 3FCHA 3W3SA 1CJUB 4QIVA 4U7UD 4J9NA 5KG7A 2VC1A 3NXZA 1UJ6A 5CYMB 4IG3A 5ETQA 1QE1B 2DO4A 4HI1A 1R27B 4DUTA 5KFVA 1KC8T 3HO1A 3T1AA 4ZCLA 1GX6A 2G0JA 4K4VA 1T9WA 2IMOA 3NNHA 2UXCJ 2ZZTA 3ICLA 3CJ2A 1GX5A 3QLHA 2YWHA 3G2XA 3W62A 3OPKA 3CJSA 2W1BA 3R6LB 1VQMS 5IT9U 2MQPA 3CSKA 1T05A 5L39A 3QZ8A 3MCOA 1R8CA 2C2KB 5HI7A 2EK6A 3DOMB 3FVYA 1S9FA 1E6VB 4PUOA 4OJ1A 4FN5A 2PGCA 4IDKB 2J8SA 3S1TA 4G1QA 4LFAJ 4F25A 1JLFA 4MJKA 2AJFE 3PIPQ 1RT1B 3C15A 2BE7D 4A8QA 4TY8A 2DRBA 2QG9B 4YR2A 4NLSA 2QMXA 4MK7A 2JRSA 1NPKA 2SXLA 1TMMA 5G0RB 2X1BA 3LTOA 5C25A 3D6HB 4EZ6A 3IWXA 2I0XA 3MM9B 3F73A 5LSOA 1YIJS 2CYYA 2PA8D 4YB1P 1IKYB 4LREA 1HNXJ 4DSKA 1ZM9A 1XMOF 3NL0A 4YHHJ 3SZ2A 3H5SA 3RW6A 4FVCA 5GADU 3HPOA 4DQPA 4H4MA 2XGPA 3MD1A 3TA0A 2W9CA 1S79A 1QAJA 3KLFA 3LF0A 4JI5F 2B56A 3AOCA 1FRJA 2R7QA 3IBCB 2VV5A 1FKAF 1VC0A 3NCQA 1XNQF 5ETKA 2OPPA 3ZC4A 2N3OA 1V3RA 1RAIB 1B0VA 1XQIA 1T02A 2AGPA 2NUHA 6FD1A 2DHGA 3K5MA 3QFWA 2M5YA 2MLXA 2ALZA 4OLOA 4M5DB 1VYAA 4MYUA 2JH3A 5I3QA 2A3JA 2BKPA 1FRMA 4I7FB 3MHYA 1U25A 1K44A 1KLMB 3GV8B 4PYDA 1TKDA 3Q22A 4KHRA 4A8WA 3J80Y 1XMBA 2UUCF 5HP1B 4PWDA 2RU3A 2DJWA 3C66A 1IQZA 3CB4A 1TZ0A 3QT5A 3DLBA 3KDOA 5IT4A 1F5CA 2OUGA 3W7BA 1U6BA 1HA1A 3CJKB 3DDKA 3NP5A 1T03B 3OR2B 1FTRA 2G2ZA 3SCIE 5CQGA 2EW9A 3C16A 3CTRA 4G6VB 1X4AA 1HBMB 4OZLA 1KVKA 5SZTA 3QGPA 2YNIA 1S6PA 1WEXA 1K9MT 3V4IA 1YBTA 3MAAA 1BQMB 3AOAA 3VVUA 1JIHA 1KKHA 1VMBA 2DNPA 3MM6B 1NRKA 1SH2A 4ICLA 2NYIA 5KG6A 1QM9A 1REVB 2ZJRQ 4Q2LA 4P75A 2BW7A 3V6DA 1UEUA 2CQ3A 4LVOP 1KP6A 4KT0C 2YPZA 3UWTA 4WPAA 1HNZF 2WRMA 2Y9HA 3CF5Q 3J81U 4ZLLA 3FSXA 4O0NA 1VQOS 1IKXB 1KLNA 2OKQA 4B3MF 1UVMA 4DS4A 4N47A 3GJSB 3O3LA 1RSCA 2ZM6F 3E8OA 3CC2S 1S76D 1ZS6A 2ASYA 3M1VB 4K8RA 3W2VA 5MLCV 4PQAA 4FNHA 2VODA 2VASA 3Q23A 2PEHA 4DN9A 4WCEQ 2LECA 4H54A 3NOCA 3IXQA 4X4TA 7AT1B 1QVGR 4AE5A 2RJZA 2BYCA 4NRTA 3AH6A 4X66J 4LRAA 3BR9A 3TVYA 2FHOB 2V4JB 3PRBA 1VK8A 1MG7A 3RB0A 1FFGB 4OYOA 4JV2A 2CUYA 2F8EX 4NZ7A 2ZKTA 1UA0A 2FC9A 4YMEA 4HHJA 2VFRA 1RHRB 4OV1A 2XCPA 4FNIA 3SMZA 1XMQJ 1LWEB 3PFEA 3BGFA 2PI4A 3VHQA 3UN2A 4WXOA 3HD2A 3H2UB 3VZHA 2G2YA 1SPBP 1RT2B 1O8BA 3OUYB 2HHXA 3LWMA 3W8GA 1JWWA 4QPTA 1YSJA 1JXEA 1Q5YA 2OH2A 5J2QB 4DL2A 1M5HA 1HHSA 5DRKA 3KK2B 3M30A 4LF4J 2L9WA 4EK2A 3G8TA 4A8YA 1VQ5S 5JJBA 3VAFA 3BH6B 4YN3B 2GJIA 4M5JA 3SQGA 1N48A 4C9DA 1IR2A 3CC4S 1SIWB 1D9DA 3JSMA 1ZM2A 3BSAA 3CT9A 2AMCB 4EO6A 3SSRA 4YQWA 2GMHA 4P52A 4DR1F 3ZZZA 4USMA 3Q8PB 4ECQA 4ZVFA 1LXJA 2NSBA 1CJVA 2FYXA 3QRQA 4OI1A 4OMFG 2HS0A 2H4YB 2C3UA 4FF4A 2PIIA 4DFKA 4X64J 3ZTRA 1HD1A 1TVRB 1C1BA 5T41A 4DLEA 2FJBB 3MEDA 3AJ1A 2OSQA 1RBOB 2YKOA 2EFVA 2MKSA 4O0IA 6AT1B 4C0HA 2VBWA 2CZ4A 1SH0A 2ZVIA 3EYZA 1VQYA 3N4WA 3QGIA 1NB2A 2AT1B 4P2FA 2ZHOA 1HW9A 2XB2D 4BDPA 3FNNA 1RAHB 2M7SA 2NXCA 1B64A 5KG1A 5CYQB 1LW0B 4PR6A 3DC2A 1VQ7S 4H4KC 2HHQA 3AQPA 5DS7A 4QJVA 2VG7B 1YKWA 4OI2A 2DH8A 3IG1A 3J7AN 1FDNA 2W4DA 2EVZA 2UZAA 3BGLA 2QO3A 4DU8A 1IKVB 4OYPA 4ECVA 3SV4A 1YZ6A 1JLGB 2KYZA 2D41A 2LQ9A 1Q86T 5L1IA 3M6VA 5M2UA 4DS5A 4EEYA 1NDPA 2MTLA 1UKUA 1SV5A 4I68A 2RHQB 4J9OA 1U1NA 1S5ZA 5BYRA 3FUYA 3LQVA 3R7SB 5JVGQ 4FYDA 1P9YA 4TU7A 2GC8A 4J9LA 3SSQA 5ETOA 2JX2A 3WC2A 4KPCA 2GHPA 1NSQA 2WBMA 4WE1B 3H25A 3VGUA 1ZAWA 1TV6B 2FHJA 1XMOJ 2BW2A 3UI3A 2XTJP 3N5FA 2XMAA 3KK3B 4OZ1A 1YJTA 1U1LA 2KM8C 2HFZA 3S7RA 4P2SA 1VQ8S 2E5IA 1P27B 4RWXA 4KH1B 3EVWA 1HD0A 2X7IA 1XNQJ 1IBMJ 4K59A 3R8YA 1HWUA 2BX6A 2LA6A 3DM2A 2AJ2A 1CS4B 4Q0BB 2AJ4A 2GVDB 2ACMA 2BA9A 2OLWA 3FRZA 1WC1A 2MKHA 3OHAA 4W92B 1S9EA 4J9QA 4LSZB 2BJ8A 2E9ZA 4ECSA 3NGSA 4ELUA 2BQUA 4GKJJ 4XPEA 4PWUA 2E9RX 1QAXA 2KHDA 5C24B 2FJAB 3QGHA 3HD1A 2BQ3A 4FPRA 3SEOA 2HRUA 1R0AB 1FRLA 3QSYB 1O51A 1QTMA 4JI2J 1YLXA 1UFLA 2FIUA 4KQZA 3CMQA 1AZSB 3JYTA 4UOGA 4DEZA 2JOQA 4WJBA 3BPSP 5LM7E 4HVZA 5EHHA 5LXYA 1R3NA 3CCTA 1RT7A 2BE9B 5D0EA 4DV2F 2NQPA 1FT8A 2ADBA 1WG5A 3FQKA 5H9FK 3DLEB 4C11A 4ZP8A 2OTJS 3D6FB 3GTYX 4NXNF 2V69A 3HI9A 3ZNUA 1G7CB 3US5A 2ATLA 2R8HA 3H4DA 2V0NA 4C3LA 2LP4A 1DTQA 1U1QA 1T8EA 2YNFA 2MGZB 4NL5A 4O3NA 3UCUP 3PX6A 4CO2A 4GMKA 2E1MC 1UW4A 3UDLA 1QTNB 3M2VB 2V2ZA 4DR6F 4PZVA 4NXMF 4F3QA 4CO5A 3MEEB 3U27A 2G2OA 2Y8YA 3HVTB 2E5HA 5CAAA 4FDFA 1V3SA 1TL5A 3G82A 3D5MA 2FLLA 3KLGA 1WC5A 1F60B 1S49A 1IKWB 2ZD1B 1Q8LA 3M9MB 1NCLA 3TZXA 4J9RA 1J5OB 4ZVEA 3R5AA 2XCAA 1HNIB 4MK9A 3KDNA 5KT6A 2PD1A 2DGXA 3ETMA 4OX7A 3SI8A 3CCLS 2VPZB 1R6YA 2ZM6J 2HWHA 1U7LA 4ITSA 4IFVB 3BS9A 4WIIA 1HHTP 4CM0A 2RD5C 4ZVHA 4OHYA 2IC3B 4ES1A 4IOCQ 3CCVS 5E3QA 2NCKL 3LA0A 5HMWA 4LFCF 4KBIA 4WIQA 4RBTA 3AODA 3CCZA 2ADCA 4PRFA 2HZVA 3MPVA 2GNKA 2G13A 5KTQA 2ROPA 2ZITA 4EI2A 1Y5IB 1VISA 3ETOA 2OPRB 4EO8A 3MR5A 3IO1A 2BDPA 3OTOF 1NMEB 5HLFB 2L3MA 1UZHA 4RUCA 3NBPB 3DLHA 2DHHA 4DV6F 3PV8A 4DOZA 1CJUA 2C3OA 2V9KA 1BHNA 1CC7A 3GIKA 5D4OA 3RRGA 3PO5A 4NLVA 3ILIA 5F8NA 4WWSA 2DGOA 2BMBA 4BC7A 2Y0SD 1SC3B 1GAOA 5B0EA 3KWMA 4DFMA 1MW7A 3DOLA 1D8YA 4PG4A 4B9VA 2E29A 1VRQC 4J9UE 3MECB 3QJLA 1LOUA 3A13A 3PW7A 1OMSA 4YR0A 5IWAJ 4QWCA 4OZ2A 5GAGI 2IA0A 3CCUS 2O1PA 1WOSA 1S4EA 1S6OA 2FGOA 3VGTA 2RKIB 5IT9Y 4DZ6A 1F1BB 1K73T 4K2JA 2VFTA 3BKTA 3M8ZA 2OFGX 5ETLA 4PXEA 3AHPA 4DR5J 4IDKA 4WBFA 1CULB 3KUHA 5L1LA 2HIQA 2XSJB 1K1QA 4K0KJ 5KFNA 2D9PA 1Q0NA 2V8DA 1LV5A 2KYXA 3TRGA 2ZH8A 3AY0A 2CQBA 4ZP6A 1YBAA 3H90A 2ZOGA 3LAKA 4R5PA 4IH5A 1GFWB 2ZNYA 3IM8A 5E7OB 4WYWA 3BBCA 1RKIA 1X31C 2CFXA 4A8OA 4NOHA 1KOHA 3PKYA 4TLQA 4F7VA 4B3OB 3PHEA 3JAMU 3SCJE 2LDYA 2VBXA 2E7VA 5HJYA 2HHHF 2LMIA 3T1YF 3RRHA 3TA2A 2WHOA 4YB7A 3PZPA 4Y0FA 3TUJC 5DQGA 2KT3A 3T9NA 4ID5A 2LQJA 3NGTA 5KFRA 3OJUA 3KHGA 2MZQA 2YPYA 3BSNA 1UAWA 1W25A 3PYFA 4WK1A 4QIFA 1FXDA 4KO0B 4P7VA 4I7FA 5E3RA 1U6ZA 2MZ1A 1V5VA 3MTKA 2M8HA 2VG5A 2RILA 1ZPWX 5DZ6A 1BMQB 4E0DA 2HVHA 3FMWA 2N7YA 5DDPC 4IQXA 2PMHA 3CJQA 3AXKA 5A2QU 5AXKA 3BO3A 3RAXA 1ZTTA 4J90A 1RA6A 3ILOA 1NB7A 5E41A 1TAQA 4OHWA 3DRRA 4F8RA 1OQ6A 3ZTPA 2HBYB 3KLEB 3TR5A 4OYZA 5LMUJ 5BR8F 4EYIB 2ZHAA 2RQ4A 4USTA 1V9OA 4DR7F 3H98A 2ZDOA 5K8OA 4L76A 1LK7A 3FFIA 4ZCKA 1XC9A 4GKKF 4IR9A 3GILA 3R5GA 3M8RA 1XNRF 3PO4A 3T6JA 1FFWB 1LKZA 2VG6A 3R97A 2CQCA 2HK2A 5D15A 5E0OA 4DL3A 2F65A 4WKRA 2LXUA 2B9YA 4KIAA 3W61A 2FJWA 2CKWA 4LF8F 3PCOB 2PDAA 3R2CJ 1U0SA 1ZZFA 4O44A 2A6OA 1FDBA 4CM2A 1RBAA 1U1RA 1WG1A 1SL1A 3NCPA 5EGYA 2JHEA 1MMDA 4OI6A 1REVA 4F0HA 3I5BA 3G6ES 2P9EA 4QPXA 2EBEA 1S7IA 1WACA 4J91A 4GO7X 3PW4A 5ETVA 2KU7A 4YS2A 3QWUA 3GPAA 4LRFA 3BB5A 3UN3A 1NDCA 2AP6A 1O5JA 1PYSB 4CDIA 2PSZA 2BE2B 3M1VA 2O3DA 3CCRS 4YP3A 1VGYA 1A0OB 1M1HA 2R7VA 2VBZA 3KJNB 1XERA 4HHHA 2JLGA 2HW3A 4PEOA 5EUHA 4DV2J 3KG4A 4F04B 2HNZA 1KONA 5DLFA 2V68A 2WB4A 1P6TA 4KV8A 3D66A 1FDDA 4E98A 2FPHX 4J9SA 3M6XA 3B78A 4NCAA 4DR4J 4L6V3 2ZJPQ 4OZJA 1C1CA 2B8QA 4HT5A 2V2VA 2YNGA 4PG8A 3ZZ0A 1M0SA 2BV3A 4QYZJ 2AYGA 3TO8A 1QY7A 3HHLC 2CJQA 2DGTA 1HNVA 4MK8A 1H7XA 1TFYA 2IYIA 2UUTA 2I38A 3MMAA 5RUBA 3TZWA 3VAHA 3SQOP 2IM1A 4PABA 2E44A 1GEHA 3R3TA 5K8NA 5IZHA 3JTOA 3TJ8A 3CUNA 1RT4A 2R3VA 4JYAF 4I4BA 4AXJA 1VS3A 3HKZD 3W1YC 2DYAA 1K8AT 1VQ4S 2XNRA 3SV3A 3FSYA 5GAEI 1K47A 2R8KA 8AT1B 1Z4UA 4IG0A 3PJXA 1NKEA 4LFCJ 4G1IA 2UU9F 4DV7F 2GJ2A 2ZC3A 2L48A 3L9ZA 2V2QA 3VQTA 3KHRA 4JOUA 2Z8QA 1R0CB 1HBNA 1XN9A 3IP0A 2OPQB 2MQQA 2XHWA 2CJBA 4ECWA 1NH8A 1XEZA 5D6GA 3HSGA 3W5XA 4MKBA 3OTOJ 5C42B 5J1EB 2XZTB 2HMIA 2EC0A 5KFHA 2CQDA 2GCFA 1U0HA 2O66A 5HATA 2FD2A 4DV6J 5CHCB 2CQGA 3W9HA 3I31A 4MMOA 4OX9J 2WSEC 3DGPB 4Y2AA 1LW2A 4X62F 4ED1A 1NZ8A 5EWEA 5HSPA 3G87A 4JI3F 2KFZA 2DY1A 1K0VA 4RW4A 1NK8A 3HT3A 3MCMA 1HFEL 3TQEA 3LAMA 3OJSA 1O6XA 1VIXA 4AQYJ 1G2EA 1SI9A 1RABB 2YNHA 4Q43A 2FJVA 4CLZA 4KGZB 2BR0A 4RBUA 5AJ3J 3PEHA 2K8GA 3FBFA 1JLBB 2IAJB 1NSAA 5L38A 1KHWA 2QMUB 5L9NA 1RYRA 3TQ1A 1WDDA 3BYPA 3K5NA 1WC0A 3N6MA 4S0MA 4YUDA 2ZH1A 3WIUA 1PYTA 4NCGB 5THWA 3UR3C 1U45A 3FQLA 3Q8YA 2XEXA 4RW6A 1Y10A 3J7A1 4Y6IA 2MXYA 4CNZA 3LP1B 4WU2A 3T1HF 2QL9B 2W8LA 1NPRA 3R2DJ 3M32A 1RWNB 2HK3A 4I2QB 2HQDA 3FZBA 2UVWA 3DKDA 2QJ3A 4JV0A 2R7RA 1PKUA 4NASA 2AYMA 2VB6A 2RB7A 3CJRA 4LF6F 4A47A 4F0KA 2ABYA 3W60A 5F0WA 5KFXA 4MAKA 2AQ4A 2V50A 1YJUA 2UXDJ 3JS9A 3GFZA 2VF3A 3D4JA 3MPYA 5H1SV 3I96A 1RAEB 3IRWP 4PXCA 3I5AA 1FK9A 3OLBA 3ZTOA 3ZZUA 3GIJA 5D0HA 2XO7A 3PNIA 1U4BA 2GVDA 2A0FB 1GXLA 3IAS9 5EN1A 2GX8A 1Y0HA 4OX8A 3LP0B 2C2OB 2G1DA 1NXIA 4RU9A 1Q5VA 2QIFA 4YB6A 2ZJQQ 1JLEB 4LRBA 2H1YA 1NHUA 5C24A 1WKLA 1H38A 4ZK7M 4URQU 4R8UB 3C19A 1EQ0A 2NZ4A 3UNGC 3BR8A 3M4XA 5EWGA 1NO8A 3OFEA 5LXRA 2ZWOA 3EWGA 3C46A 5HROB 4DR7J 3E01B 4FXVA 4RW8A 3KG0A 5KT7A 3FBCA 1UPPA 3I9ZA 1WD6A 2HKEA 2HHVA 2IMWP 2DXFA 3PRVA 1F0XA 2Y3YA 1IM6A 4P73A 2HS3A 1XNRJ 1JB0C 3CO0P 2XMTA 2C3MA 4L72B 2RF2B 3LW5C 1MMNA 3EPIA 3BQ0A 4LBIA 3EM1A 2JEJA 3D67A 2FVRA 1T7PA 1WI8A 2UUAJ 4CT9A 5KFAA 4HTIA 1QDUB 4LF8J 1D3WA 3AQOA 1NJXA 3MUMP 5HJXA 3LP2A 3N28A 4WFBQ 3ZZPA 2EFGA 3W65A 5HANA 1M5KC 2JFDA 4UQGA 2PMZD 4DF4A 2W25A 3MEEA 3M9OB 1YHQS 2KVQE 3HVTA 4QU7A 2FVCA 4QR0A 5K20B 2B6AB 1CJTB 4ILRA 3CWJA 3WDOA 4KB7A 1UWBB 2MQNA 2KM8B 1Y9OA 2DXEA 4E8UA 4ZITA 4X65J 2RIJA 1ITPA 5J2PB 2UVVA 1U1PA 3N6LA 1L3VA 4LBHA 1F3FA 2AZ1A 2JC0A 4LFBJ 4CLPA 3OL7A 4IO9Q 5K14B 1VBXA 4YB5A 2HAFA 4ED8A 1BWEA 4IFVA 4FYXB 2LQ8A 3U02A 1L5UA 3BZQA 4RO0A 5IT0A 1PAUB 4FYWB 5KT2A 5B08A 4U95A 4KR0B 3DRXA 1JLCB 4R0JA 1S1WA 3MM7B 1X5PA 3F44A 2YXLA 2J0WA 1RWXB 4NLDA 2OMOA 3PFOA 2W4PA 4DV4J 2WOMA 5KFCA 1D09B 1FNMA 5HMZA 3FC9A 1KFSA 4DG1A 3KTQA 4JI6J 2R7XA 3D0GE 3PHTA 1JKHB 2LKZA 4PPZA 4USIA 2FC8A 3J80U 1AUSL 4I1TA 1R7IA 2CIMA 3QGGA 3NBPA 1MROB 2DGUA 4OI3A 3GIMA 5C2GA 4FPIA 1DZ5A 2NSCA 7FD1A 2YWGA 3NNAA 2VPYB 2OMLA 4DJBA 4OHXA 5A76A 3VCDA 3PKMA 3PYEA 2IBKA 1HWIA 2Z4PA 4MFBB 4DI6A 4OYMA 4K5RA 3GCWP 2B7CB 1BWVA 4FF1A 5LJ5Y 1GTEA 3EGNA 2F5GA 4RWWA 2GS8A 4JYAJ 4A8FA 3DOKA 1SQEA 5KFIA 3DRPB 3ELHA 3RW7A 2FZCB 1RCXB 2P2CB 1IXKA 2DR6A 1PBAA 2NXJA 1S1UB 4FYYB 2AIRB 2OO4A 3IS9B 2FTRA 1X9SA 3QAEA 2B4OA 2KN4A 2UU9J 3TUPA 3VVTA 2I8EA 4DV7J 4ZN3A 4TNOA 3IAM9 4ZPVR 2IDEA 1CC8A 2DCUB 3DLGA 2VQFF 3M05A 3M9NB 3PR4A 1RU2A 5B0FA 3V6KA 1GXTA 3OL8A 5FD1A 4LUBA 1R8BA 3W9JA 3KJFB 3BN4A 1MN7A 5A8KB 1KVJA 1RT3A 3DU5A 2JJ4D 2FGCA 3RUBL 3QFHA 4PG7A 2RDIA 2ZH5A 4URGA 2G0IA 3E2EA 1VQ9S 4M94A 2R9LA 2PO4A 4ENOA 1MWQA 2GW8A 2H5JB 4P74A 1P8GA 3ISND 4X62J 2AZ3A 1S0MA 1RLDA 5F3ZA 3OSNA 2OPSA 4B3OA 1Q95G 3MAHA 4NWBA 2N4DA 3QIPA 5E33A 2DR5A 2MKIA 3A3OB 2KDOA 1EJ7L 1S0VA 5B0AA 2E9TA 2DHAA 4FBTA 3AT1B 1WTFA 3NMRA 1KBRA 4KO0A 5ETNA 1N36J 5FJ4A 4DR3F 4DV1J 2YY3A 3AXMA 3TUIC 1KFDA 3ENAA 3KLVA 3GIRA 4QCLA 4QIEA 5KFFA 1YJNS 2JLFA 3LWLA 3IRXB 2GGPA 3ENVA 4W98A 3OTBA 3BBFA 5A2QY 1IUJA 2ZE2B 5CCLA 4C48A 2CPEA 2WVBA 1C0UB 5GMDA 5CCMA 3QATA 3LOUA 3M2UA 1RT6A 1YRXA 1WEYA 2F3JA 2I9SA 1DQAA 4DSLA 2POKA 2FVSA 1EB0A 1WSVA 1DTTB 1ZOTA 2XSFA 3THTA 1TK0A 2UXCF 1KR4A 5T7LA 3HCXA 3DLKA 1RHMB 1R8HA 4B3SJ 4N8NA 3QNWB 1RTIA 1W2BR 1VHIA 3D0HE 3MDFA 1N8RT 1S1TA 3TAMA 3R27A 1URRA 4HLBA 1JQGA 2WCXA 4ECYA 4UOHA 5L1KA 5D3GB 2XG8A 4O3PA 2J9EA 3DLJA 1M1KT 4DL6A 1RTDB 2BM1A 1IJEB 1TL3B 1FJEB 3SSSA 5LMNJ 1S59A 3EVOA 5DDQC 4ZPAA 3IA0A 2XBPA 3G71S 3QT7A 2DR7A 2PMWA 1HR0F 4DCPB 1B7YB 4RNMA 2H3EB 3Q89A 4FYVB 2XMKA 3BGUA 1WG4A 2CA9A 2KI2A 2ZDPA 1V5IB 1SKUB 2R2UA 3CNQP 3NCRA 2GHWA 2CPZA 1CQNA 2CPDA 4WZQA 2LQ5A 2V8PA 4NLTA 3C6UA 2J8AA 5F8MA 5KFLA 2QE5A 2QLJB 2MY8A 3SXLA 1X0PA 3GJTB 3HJVA 4LSLB 1BGXT 3PDNA 2PI5A 4U8YA 1VQLS 4OLPA 1VBKA 3MTJA 5KT4A 2C2DA 2HGNA 3GLJA 3H20A 2E7WA 1TKTB 5KG4A 4ATNA 2DNRA 4CYUB 5GADI 4IQMA 3SFUA 1JJ4A 2MPUA 3Q2SC 1SKWA 3DYAB 1VRTA 2KT2A 5ETPA 4BWMA 2HLTA 4LR8A 2QFJA 1RTHB 4L74A 5DQHA 1KS2A 4PG5A 5EX0A 4OZ0A 3HKWA 3BQ2A 3O8WA 2R8IA 3HSZA 3FK4A 1UVNA 1KQKA 5HMXA 3NKYA 4WFAQ 4RNFA 3KK1A 1PSDA 2KXHA 3B6BA 4NCBA 2LFVA 5JUMA 5AE3A 1HQEB 1PYOB 2EPIA 1C4AA 1UETA 2HPUA 4TKTA 4IFYB 4EFAC 4WTOB 2BEFA 1XIQA 1OYEA 2IJFA 1R6VA 1TTHB 2EBGA 3CJ8A 3H5YA 3WHIA 5J2MA 4CLFA 3BO4A 3TEHB 2DR8A 1MU2B 4DSJA 3UDEA 2HFNA 3TOQA 3WX4A 1VJQA 5KG3A 4K4ZA 2DT9A 2G1HA 1LWFB 1PJ6A 2JWNA 5FDLA 5KFUA 4ZDNA 2UXBJ 1YVFA 3GR1A 1RHQB 2DGVA 1UVIA 1YK9A 4IH7A 1GMVA 1NLKL 2XMJA 5HMYA 3A12A 1LWCA 3I9V9 1W7WA 2DR9A 2VPXB 5KFWA 4TXSA 4AXIA 2GAHC 1U8SA 4ZVQB 4QIWD 2YKNA 2UVUA 2OFHX 3MMCA 3EDQB 5IM0A 3R5BA 2I5JA 5EX3A 1PCAA 1L3SA 5K8PA 1GTHA 2ZVSA 3D68A 3Q0AA 4PAAA 2RVJA 3DXBA 2HFOA 3Q83A 4CLTA 4F36A 4ED2A 1P1LA 3IFEA 9RUBA 1HKAA 3D6TB 1U1OA 3V6HA 3FCWA 4RW7B 1GK8A 5CA5A 1RWWB 1FX4A 2RRAA 2CPHA 1CPZA 3CCMS 1XBWA 5HQLA 4DV3J 3DGPA 2I2YA 4DUYJ 1AYEA 5L46A 2MHNA 3OR1A 1KEKA 4EU0A 4X66F 4MH8A 1ULRA 2NREA 1N33J 2CVEA 4MT1A 2B51A 2EKYA 3L95X 3HHLB 2KFYA 3GV7B 4Z37A 2CPXA 2J0SD 4NLXA 3IGVA 2XYPB 1YZ7A 2D69A 1C0TB 3Q8VA 3P45B 4IO1A 1EARA 2CNNB 4B08A 1R8PA 4N56A 1LFWA 4LRCA 1XMQF 5KG0A 1JLBA 2VBYA 2Y8WA 3UE2A 3Q86A 2ZBPA 2GVZB 2BM0A 3GE9A 3W2WB 1QLNA 1YG0A 1FHTA 2A10A 2HNYB 3CCJS 1HIYA 1UWAA 4LF9J 3HP6A 4EBCA 3LP1A 5HO4A 3D6MB 4CLLA 4ED6A 1FJGJ 2K1RB 4I2PB 2CWKA 1HWLA 4LF4F 3GU0A 4ZHRA 4LSNB 3RAQA 4WU3A 4MTPA 4CT8A 5GAGU 1EP4B 4IUFA 4ZJQA 5K8MA 5GVQA 5KFQA 4ZMMA 2HVEA 4O4GA 3K0JA 4YEAA 2CWXA 3GYNA 1HMVA 2NZCA 1WC4A 4YDDB 3KHHA 2KT5A 1FI4A 4J5OA 3MOJB 3CIZA 5C5JA 4ILLA 3JXOA 4NA3A 1TQLA 3WZ0A 3OXLA 2YX7A 1RBLA 1V6HA 1KTVA 2DVIA 2IM2A 2JNJA 1N5QA 3MM5A 5F9LA 1ZA1B 3EUNA 4KKOB 3W66A 2MLZA 2AX0A 1PO6A 3CIMA 3H4BA 4DFPA 4OJHA 5KFYA 5KFZA 4C97A 4B9SA 1FKPB 3DI6A 1OYDA 1A6LA 4X64F 4NI2B 3GJRB 2W7PA 5I3UB 5AE1A 2Y0BB 3RTVA 2G0CA 3KLIA 2DNKA 1E6YB 2XC9A 4TLRA 4CTAA 4BC9A 2QZ8A 5A8RB 1X4DA 3D28A 4KGMA 4O3QA 4IRKA 3AJDA 3LANA 1OY6A 3GJQB 2K3IA 3E01A 3VQSA 3BJYA 1S10A 1DLOA 3L7UA 1TL7B 2V94A 2F4FA 3MEGB 3G6YA 4UUWA 4KAIA 3GCXP 1T94A 2MEWA 5B0DA 1HPZB 4UUXA 4ED0A 3A8EA 1X5OA 3U1MA 3H5UA 2ZEJA 2CQHA 2Q6BA 4NZ6A 3CDBA 4AFFA 2CPFA 2JEGA 3HT0A 2GIFA 4NMLA 3GFXA 4TU9A 5MAOA 2WVEA 3I0RA 1FD2A 2NPIA 3LGMA 4FXDA 2DNLA 3HFZB 1GNKA 1S57A 1T3NA 1RYSA 2HRTA 1QD1A 4ZN1A 3ZXWA 3K7RA 1HR0J 1Q7YT 2VKRA 3TZYA 1CJTA 1MNEA 4OYIA 4IG3B 2B5JB 2IIHA 2X3DA 3UQSA 5DQIA 3SFGA 2P8IA 4AUKA 2H51B 2IFXA 4B3RJ 3GYXB 1ACMB 1NZAA 2ZBQA 1KQFB 4DN0A 3AFGA 1R8AA 1L3TA 1IWGA 3RG6A 5IQQA 4DZDA 2L08A 1N5YA 2EI5A 3RB4A 1T05B 4B9NA 2AX1A 1Y00A 1WC3A 6FDRA 2BKOA 1TL1B 3MAQA 1IBMF 2OP5A 1JLCA 4G1QB 2XY7A 1JLFB 3OSPA 4EBDA 1SC1B 1YJRA 1Q16B 1RAOA 2HBRB 4Q8FA 4TY8B 4Q44A 5KFSA 3C6TA 2LEPA 3AA9A 1UVJA 4FF3A 5J1PA 3AD7C 4F4AA 3W8PA 2ZH6A 4ES3A 2BABA 4CH7A 1JKHA 1FRHA 5C25B 2PN6A 4GKJF 4DL4A 2L9NA 4FVMA 2C22A 1S0NA 3GFHA 3OVAA 3MD3A 1WKJA 1J5EJ 3SDEA 2X3GA 2NXEA 1QUVA 1U09A 2LU2A 3B54A 1MROA 2MHEA 2W24A 2VDHA 2HQCA 4JI2F 3PJ9A 2C2RA 4X4OA 2DXDA 4P2MA 3CDWA 2VOPA 4H4MB 1F2GA 2B4PA 2CPYA 1DY3A 4MFBA 2W9CB 3KLFB 5LT5A 4USHA 2VJUA 2LA4A 1BQNA 3D3BJ 1S99A 2E1RA 4CO4A 3H7HB 5LSLA 1VQKS 2GMLA 4DWIA 2OPPB 2P9CA 4GVLA 2PE8A 1NDKA 1VC6A 1S97A 3UD3P 4CO1A 3DRPA 5C2CA 4AL7A 2U1AA 4C0BA 4RNNA 2KXFA 4TYBA 4U96A 4I6WA 2VFSA 1X4HA 2F9JA 4P72A 3CJ0A 4IRDA 4DV0J 4PWDB 1SH3A 2RDDA 5F0UA 1TL4A 1CSJA 1PBUA 4KRWA 1RHKB 3HXMA 2GO9A 2IPOB 1KTQA 2ASDA 1OS5A 2UV8A 1U26A 2HHSA 2LVWA 5DJBA 2RE1A 4PG6A 4JI0J 1GQEA 4B9TA 3I5CA 4U8VA 3HVRA 1KQSR 3VGVA 2BRKA 5LSRA 4I67A 1N32F 1CJKA 5GAEU 1HQUA 1FNOA 1DQ9A 1G4CA 3BREA 4A48A 4XO0A 3X3UA 2R2RA 2HFSA 5GAHI 3U1LA 2YNIB 1S6PB 4F4WA 2V9WA 3V4IB 2FHJD 4J9KA 4U9RA 3MAAB 2MKYA 3NAHA 4IH6A 1YRUA 5C7PA 2WK4A 1O0PA 4HACB 4I69A 1JLAA 1ZBTA 3UO0A 5E3CA 3HFKA 3L09A 4NE9C 1W26A 4ICLB 2KHCA 4USVA 4ZLPA 2FJDB 5K9FA 3FZ2A 3V6DB 2Z56B 3N01A 2AGQA 2J6SA 4ZVPB 2XS7A 4B3TJ 3O5TB 3GG0A 3K5LA 3C14A 4R25A 4M5NA 5KFOA 2QRRA 1XR7A 4HEA9 2FUG9 3R9LA 4N77A 2XHCA 4WYLA 3OXFA 3IRXA 1NEEA 1LXNA 3R1HA 2MQLA 1SUQB 1CLFA 3BF4A 1NK5A 3W2VB 2YKMA 4GO5X 1R43A 3IR5B 2WONB 1VRUA 5KG2A 1C2PA 1FE4A 4WP9A 4DUZJ 4Q7AA 3I0SA 2GJFA 1NK9A 4DCOB 4P6QA 3ZZTA 3DU6A 3MM8A 5IWAF 3FEXB 3B82A 1S77D 5CABA 1NJZA 2JZ5A 2RT3A 2Y1LB 3P8BB 2E66A 1D8ZA 2HG4A 2DEIA 4TYAA 4WFZA 3MCSA 3THPA 1RTDA 4DR5F 2M8DB 5KG5A 3GSIA 3OT9A 2ZKUA 3MZIA 5HVGA 4DQRA 1FRKA 4K0KF 1GH8A 4WZMA 1M5OC 5DDOC 3CJ3A 1U49A 2JVOA 2WZ1A 3CE8A 1TELA 2VKZG 4ZJOA 3V81A 2DNMA 4CNYA 4NA1A 4NLWA 1APSA 4AL6A 3W64A 5J2NB 3FKBA 1HBUA 2AEFA 2JL9A 1FKOA 4A4JA 3EXYA 3SQGB 3O44A 1HI8A 1GT8A 5KOXA 3JSMB 2KRBA 3UW1A 1XTZA 4QWAA 5HQMA 4EZ9A 2UV8G 2DRAA 3FEYB 3UDVA 1JLQA 3QO9A 2AGOA 2MB0B 1QAYA 2IRYA 2RAQA 2WBRA 1FVQA 4ETZA 2DNOA 3RBXA 4J9PA 1GXUA 3UVJA 3WIVA 3M8QA 1SXLA 2IA6A 1Z1ZA 4EWTA 1BC6A 1CJVB 3H40A 3MXHP 4N8OA 1OY8A 4OZNA 5G4DA 1JJ2R 1KOOA 1NJIT 2CDQA 2IRXA 4JI7F 1ICEB 1PJ7A 2ZH3A 4L73A 5F8IA 4ZLNA 2J0QD 1C1BB 4ZIWA 2EFOA 2CPIA 3I32A 3MEDB 4OX6A 3ZZRA 3KHLA 4DL7A 3V6JA 2OAUA 3FJ2A 3BQ1A 2J9DE 3MR6A 4OI0A 5LMUF 1UVLA 4B9UA 4XK8C 2XYGB 2V67A 1TKXA 1ZAVA 1MLAA 2G9OA 4LRDA 3G4SS 4Z2XA 1RWPB 2BRLA 1IVZA 1LWFA 3QT8A 2MJNA 4PKDB 3IG1B 4K4XA 5B09A 1DJ0A 1S1XA 2DCLA 4M5GA 4TU8A 2R2TA 4QZVB 4C8ZA 2XY6A 4ZCIA 2DGQA 1OO0B 1HYSA 2LEAA 4KH0B 3TP2A 4ZPTR 2YX1A 4JI8F 4NX9A 1FNXH 2VD3A 1SV5B 5ETTA 3HLUA 3EGVA 2AYEA 5KOWA 4UY85 3DMJB 2B8PA 3KMSA 4CH1A 1UMJA 3SYZA 2FB0A 4IYQA 3KJVA 1U8WA 3IR6B 2DPJA 1N6QA 4B9LA 2K06A 2HQ3A 2QEXS 2VFVA 4LF5F 1U2CA 2Q66A 4RW7A 2H9ZA 1D9FA 3RB6A 3GZ7A 1R89A 1LNQA 5HQ8A 4K4YA 4DL5A 2H65B 5F8GA 1VQNS 3N9UC 2MLYA 4RU2A 2HWIA 3UFCX 3FMBA 1QJHA 3L3CA 2CNOB 4QU6A 2V5HG 2QA1A 3BDEA 3R6GB 2X51A 3HHLA 2FZKB 3TANA 3DM2B 1ZYQA 3NRBA 1RQ0A 4ZS6A 2EC2A 2LLZA 2XLIA 3EICA 4DR4F 5ETRA 1R31A 2AWZA 4ECZA 3C2PA 3BKFA 2NXUA 3DFEA 3IR7B 1S9EB 1M90T 2PEBA 2GIQA 4FBUA 3CCSS 1TP7A 3HM9A 4BWJA 5KFMA 5DGAA 4RUHA 4NLPA 1SKRA 1N5SA 1FRIA 4XIUA 2EKNA 2Z2MA 3O2IA 2BANA 1WF0A 1ZPVA 4QWEA 1RHJB 3HF5A 4ECXA 3EXCX 2ZH7A 2XNQA 5B0BA 3LALA 1UFKA 2IJNA 3T5LA 3EGWB 2V34A 4YDXA 1H7WA 1S6QA 2HWTA 1FE0A 2K1RA 4I2PA 3VTIA 4CH0S 1WHYA 2FVQA 4F2RA 1BLUA 3I56S 1RT7B 1RE1B 4ZVTB 5D77A 2B4VA 1N32J 2VU5A 3NAIA 4C11B 3KJQB 3CEDA 1EZZB 2QL5B 3ZFVA 1RT5A 4BS2A 1M5VC 4ZPDA 5I42A 1Y11A 3LPEA 3CULA 3ZZOA 2L41A 1DTQB 2YNFB 1KHVA 5KT3A 3MPWA 4JUZA 2GO8A 2BJDA 4X4UA 2N4CA 3PW2A 4URSA 2FJXA 3OTCA 1ZTWA 4K4WA 5A0YA 3J81j 4CRJA 3R5DA 1EETA 2ILYA 5H9FJ 1FTCA 4KKOA 1SQGA 5AE2A 4DX6A 3G82B 2C2NA 3KLGB 1EX8A 3K57A 3JSYA 2W2PP 1VI7A 2AKWB 1RWOB 4ED7A 3POTA 1RLCL 2RDJA 3DN9A 1RTJB 4KJIA 4NLRA 3PACA 5I3UA 1AB8A 4F26A 2W2NP 3OL6A 3HK2A 2HQIA 2M3DA 1BQXA 4OX9F 1JNZB 2RRNA 3NMAA 2C42A 5FIIA 1U48A 2VQEJ 2HNDB 5CYMA 5A6WA 5LL6d 3TYTA 3CJTA 4R0EA 1QE1A 2OD6A 2MZJA 4P71A 2YWFA 3UNYA 5DO2A 3KLHB 3NY0A 1TL7A 1RAGB 2K7KA 2GAGC 4AQYF 1KN6A 4OZ5A 3OFHA 1SJ1A 3TA1A 4NLYA 5AJ3F 1N52B 1N5VA 1B99A 1WUUA 3ENWA 1AUDA 4M95A 5E2QA 2I1RA 1X9MA 2BJEA 1VR6A 1N4LA 3DOMA 3QRPA 1E6VA 1XR6A 4DR2J 3J7YU 2RHSB 4KHPJ 4QW8A 3EE3A 1UFWA 1RHUB 3JQMA 2GIRA 2K3KA 5HVFA 4OI4A 4BBYA 5L8RC 1RT1A 2R4FA 1CG2A 3TJ9A 2HQFA 1B3TA 4OQJA 4LIWA 3B8HA 1AXQA 3G9CA 4RNHA 1NBEB 2J5AA 3M8YA 4UQTA 2JFKA 1HWJA 2W2OP 5G0RA 1G3OA 4MKYA 2B5JA 2IBOA 2Z57B 3TWZA 5GMKa 2KG0A 3OVSA 3DOLB 1DHMA 2KZMA 3MM9A 4GC7A 2WSFC 4PXBA 3AAWB 5FLXY 1IKYA 2VA2A 1AROP 1FXRA 1RADB 1S12A 1NK0A 1RCOB 2XGQA 3B4DA 2UP1A 2ZH9A 2DIVA 3HHEA 2XULA 2UXDF 2AJ1A 1SCJB 2E1AA 3CJ4A 1BD6A 3NS6A 5ITHA 1UEKA 3JB9k 2ZBCA 1VHFA 2OSRA 1Q8IA 3SIPB 4DPXA 3QJPA 4C8MA 1TL1A 2HVIA 1Q7LB 3AJ2A 3NS5A 2AEJA 2JVRA 4FKYA 1F6TA 3OXGA 3ZNJ1 4ZLJA 3ET6B 4USJC 3TARA 1G6BA 1K1SA 2XWXA 1UW9A 4M5DA 4RJVA 2VPWB 3RGIA 1WHVA 3L7PA 2Z58B 4NLGA 4UT4A 2KJWA 3TI0A 4JI7J 1KLMA 4IOAQ 4XAKA 2UUBF 1YJ9S 1PIEA 4R5PB 4IRCA 3ILLA 5HP1A 1ROFA 1UL3A 2MYFA 1Q82T 2CG8A 2WAQD 4P10A 1VC5A 1I5OB 1D9AA 1Q79A 1WORA 1FWLA 1SJ4P 5CD4A 5KT5A 4Y2MA 3M8WA 2HHWA 4J7CA 3TJAA 2NLWA 3CJKA 2WVFA 3JTPA 3BDPA 1T03A 3OR2A 4OIXA 1VK3A 4OYBA 2ZC4A 2QSFA 3KYLA 4X4VA 2GFFA 4MKAA 2AJ0A 4ID5B 3PW5A 3GR0A 1UJ4A 1HBMA 3H0PA 2Z30B 3HDSA 2D3O1 2UUAF 1FWKA 2IRUA 4PXDA 1WTBA 3G6VA 3RBDA 4C4WA 1BQMA 3DNCA 1HL6A 1FWPA 2D9OA 2VG5B 5T14A 5IFMA 2QL7B 3MM6A 5KFJA 3KFWX 1SB6A 1TKZB 1GMWD 4G65A 2R7OA 1HI0P 4JI8J 3NGUA 2CADA 2AD9A 1I94J 3OD2A 3DRRB 2X1GA 2F1FA 3G8QA 4X65F 3MFHA 2PA3A 3P96A 4RKUC 2FQQB 1F5AA 2BJ3A 2B9XA 1WHWA 1TU0B 1IKXA 4B02A 1SBRA 4LFBF 2EWHA 3FFIB 4LF5J 4C8OA 4DF8A 3CD6S 3CXCR 3NEKA 5E3PA 2VG6B 1S9GB 1S7HA 4ED3A 4HTJA 4TY9A 4OJGA 4YY3J 2MDAA 3A8IA 4NZ0A 3QZ7A 4X4RA 2ZH4A 3OLAA 4AYBD 1WKKA 4HACA 4HL9A 3CMES 3TNVA 4FS1A 2V4JA 4O44B 4HYKA 5B7WA 4DV4F 3ISNC 3MR2A 1RZMA 2K2PA 4KSEB 4Q8EA 1HW8A 4JI6F 1IBKJ 3LH2S 4YR3A 5CD4H 4UZBA 3J7Z5 1LWEA 3MMBB 1YJVA 3PIOQ 4HDHA 3Q2TC 4DV5J 3TW0A 4LVNP 4KTQA 3T5HA 3D7SB 3CD5A 2M2BA 3EZUA 1RT2A 2IVYA 3OUYA 3S6EA 1SUQA 3HX9A 2HFUA 2YWKA 3CCQS 2LXFA 4X4QA 2WONA 1IR0A 7FDRA 2M0GB 5J2QA 3I4HX 1WSRA 1RWMB 3KK2A 4QIGA 1YJWS 4G3IA 1T9XA 1OSDA 3TX0A 2N7CA 2HNZB 4KV8B 2ASJA 3D1QA 2PC6A 3TEGA 4DPWA 3G8SA 1N34J 4C7QA 1C1CB 1Y3JA 1SJQA 2YNGB 4LF7J 1YWXA 3PTWA 2B4UA 1NDLA 1TR0A 3HMJG 2DGWA 3RAMA 5F41A 2J6UA 3VV2B 4RLEA 4KFBB 1HNVB 3ZTQA 2Y1IA 1UTAA 3P49B 2DHSA 2WVCA 2FVPA 3MGJA 4F4KA 3PR5B 2J9DA 3X1LB 1FD8A 2ZFHA 1YI2S 3NGKA 3MMAB 2EEYA 2DTJA 1SC6A 5AT1B 4X84A 1TVRA 3ISZA 4LQ9A 2HFVA 4EMDA 5HBMB 5J2NA 1RT4B 3GP9A 1D0EA 3PM9A 2KVIA 1HQ2A 5H9EJ 2PFDA 2BKNA 1QUPA 2R8JA 2ZZNA 4ETXA 1U02A 5D0RA 1TFWA 1B0TA 1PAEX 4JBCA 4X2BA 1QVFR 1X9WA 4F50A 3RR8A 4IG0B 1WEZA 4N5SA 1VFJA 2HQGA 1LK5A 4M8LA 1IBLF 5CYQA 1LW0A 3BKUA 3D1HA 4CZCA 1H0HB 1PC4A 2VG7A 1HBNB 3G6XA 2FDNA 2C1EB 4K4UA 5E5NA 1N36F 4ERDA 4DV1F 4WXWA 2M88A 1JXLA 4DLGA 5BXIA 1GMWA 1IKVA 4PWWA 2CXEA 4LBPA 1VDHA 1HBOB 3BV8A 1YX2A 2HMIB 3QIDA 1JLGA 2J7WA 1RJJA 2IM3A 2YQ0A 1U0HB 2VOOA 2NYHA 1GMUA 3R7BB 4HT7A 4EBEA 2R7WA 2YH0A 3EGZA 2P9GA 1LW2B 2MQMA 3T3FA 2NR0A 3GB0A 3VF0B 5U47A 2CJAA 4U67Q 3RYLA 3K89A 2RSQA 3WX8A 4N41A 4D3HA 4ZJLA 3KNAA 5D4LA 4RW4B 4MIWA 1CQMA 5HL7Q 3FBEA 4WE1A 4B3SF 4Y2IA 2HYIB 1TV6A 2YNHB 4RNOA 4Y28C 3KK3A 4NEYA 4ZPWR 5L1JA 3C8YA 3D2WA 3AOBA 1YGYA 1RWUA 2VJVA 4O4RA 3MCNA 5LMNF 2YQ3A 4NLOA 5J1NA 1PC5A 4IR1A 4F3MA 3HSJA 1EQMA 2F4VF 1P9QC 4LF2A 5KFGA 1CS4A 4Q0BA 2IHR1 2BOAA 2R7SA 2XQCA 2VH7A 4RW6B 2I6WA 2ILZA 3DMJA 3ITHB 1A9NB 1KQGB 3W63A 2C2MB 3DRYA 1RI7A 3M32B 4ER8A 1FJCA 2COLA 2GQQA 2GV1A 4RX6A 2UUBJ 3CD7A 4LR7A 2CQ4A 4L3NA 4KGVB 1OSCA 1KNZA 1BUXA 2Q6CA 1R0AA 1T3OA 2FY8A 2C28A 3OBIA 2O67A 4H4OB 4Y2CA 1PGZA 1DQ8A 2YQ1A 4ZPBA 1AZSA 2ZWPA 3RU0A 1IQTA 4UOFA 3F0NA 3EVMA 4NLUA 1UCNA 4EYHB 4JI5J 2RS8A 3RB3A 3BGOP 3DLEA 2V4RA 4UOCA 1FK9B 4USUA 2KL8A 3QWPA 2MGZA 3CDEA 8ATCB 1Q4RA 3H59A 2A2CA 3D0IE 4PCQA 2MKCA 4GVBB 4HH1A 2R2SA 1Y3KA 1TUGB 5F3TA 3M2VA 4ZKAA 3JTNA 1JK9B 1B4SA 2RUSA 3L7OA 5DETA 1DURA 2E5LF 2YTCA 1TK5A 4TVAB 2UUCJ 3KG1A 1IWAA 3HZGA 1IKWA 1P1TA 2ZD1A 2IVFB 2CDRB 2DHXA 1J5OA 5K5MA 5M2PA 1HNIA 1T9UA 4Y2KA 1UA1A 4RW8B 1F9HA 1ZH5A 2CQIA 2YH1A 2CJKA 3MPUB 3NGDA 1FO1A 1UZDA 2J76E 2V2KA 3A8KA 2DKOB 2YVSA 2UXBF 1L3UA 2IC3A 3PX0A 2WTFA 4PPDA 1HI1A 2HIYA 2DNYA 2CPJA 3LP2B 5DM6Q 1ZAXA 1ZM3A 5F8HA 4WFXA 3QMQA 4FKXA 3EJMA 3BSOA 4OYWA 4ID8A 2ERRA 8RUCA 1WELA 1NU4A 2E1CA 3FSIA 3HULA 2Z2ZA 2OPRA 3FGVA 4QWDA 3P5BP 1F5BA 3I87A 1RTJA 5HLFA 2W01A 3QBCA 1HNZJ 1SQFA 4HR2A 2JC1A 3M7VA 3H2VE 4KGKA 2GHVC 2JSXA 2HHUA 2YBVA 1ELOA 3H2LA 4B3MJ 4A8XA 1M5PC 2YWWA 5GAHU 4QR1A 1RXOB 3IWNC 4ILMA 2Q1LA 2HRYA 2RQKA 4DV3F 2L9DA 4DUYF 4ZIVA 2HNDA 4Y34A 1F3VA 5CXTA 3SCLE 2CAJA 5ETSA 1N33F 3KLHA 4P2XA 3QYYA 5E3AA 3MR7A 1T11A 3MECA 1S1WB 3I6PA 2WOMB 2HVZA 1MSWD 3DGVA 2VL1A 3KKFA 2RKIA 4DG1B 2XMVA 4ZOSA 1NK6A 4N7TA 4Y00A 3VAJA 1YITS 3PYGA 3K5PA 1CULA 3LO3A 3DHXA 1W2IA 4C98A 4NYPA 1CVJA 3MI7X 2XSJA 1VCTA 3TAPA 3TAQA 3G96A 3AB2B 3GSDA 3EDRB 4K2XA 2DNNA 4CWBA 4LF9F 2V8GA 1K0TA 2D74B 2AU0A 4DL0C 1FJGF 3VGSA 4KGXB 4Q5VA 1SIZA 2GMJA 3NG8A 5M2RA 3AB4B 3LPYA 5SUHA 4ANEA 3JQJA 1SJRA 3CD0A 2BZ2A 2LU1A 5DLGA 4WF9Q 3EX7B 3DOKB 3BBBA 2FHKA 1T0TV 4DXLA 2OELA 1X0FA 2WVDA 4JP8A 1IJFB 3JQKA 3D1OA 2HAIA 1U1KA 4W90B 2O01C 4ZVUB 4OYAA 3QT6A 1X4BA 1FERA 3K59A 3CMAS 1YJ7A 4DR1J 1IBLJ 4J9VA 4KE5A 2QX0A 2R7UA 2RRBA 2OEJA 3V4MA 5DDRC 1S72S 1U47A 3DLGB 2BJ7A 3ET6A 3BM7A 2XM3A 2VZ9A 1AFJA 5KFKA 2NXNA 4V1Ak 1XJWB 1VQSA 1IN0A 4C6AA 5IXUA 1N54B 1NH7A 2Z2LA 4F3OA 4O3RA 1RT3B 2IY5B 2ZBIA 3RBEA 2YKAA 3MMJA 3CC7S 1J27A 3OFGA 4C8NA 3DRSB 3MWBA 3PG9A 2R42A 1NKCA 4FXWA 5A6PA 3I4PA 1WHXA 3KLEA 4CLSA 2KO1A 3N6NA 2OPSB 4LIRA 1J2VA 2MQOA 4MIAA 1BE4A 4KPYA 3DXSX 3BGRB 3QIPB 4XTTA 2LEBA 4C8KA 3K5OA 3SCKE 1MMLA 3MURP 4DCJB 4NLQA 4A46A 3M2RB 4ED5A 2MZTA 5A8WB 3ZZYA 2O5DA 3OFFA 1UJ5A 3AD9C 1TKZA 2F4VJ 2ASLA 3EZ5A 2GGPB 2DEJA 1SC4B 2Y1JA 2J7KA 2XS5A 2P6TA 2V4QA 1TUWA 2F9DA 2FY1A 2B9WA 3MUTP 2HS4A 2QV6A 3QQCD 3M2UB 1RT6B 1H74A 2DNZA 1JMTA 5KAKA 4B3RF 4FP9A 4F0MA 5F8JA 4AT1B 1DFDA 3VZIA 1XK8A 3VAGA 5DM7Q 5T7LB 3DLKB 2QA4S 4Z7YA 2QSWA 4PQUB 1RTIB 2ZUGA 3F56A 2DO0A 2AW0A 2RS2A 3N5BA 3Q8QB 2BE2A 1S9GA 1FRXA 1S1TB 4UZCA 1KWMA 2QA2A 3TAMB 5IV3A 4ANDA 4RR5A 1YBUA 5HAOA 3V5RA 2OGUA 1X5TA 2QYGA 4QYZK 5F8LA 2QLXA 5AXMA 2DITA 1WI6A 5DG8A 1RKJA 1NUEA 2W9BB 4HDGA 2EFPA 4QWBA 3LGNA 2W2MP 1VOMA 1ZA2B 2YWEA 1SKSA 2ZOMA 3MMBA 2Z0GA 3LUYA 4DSIA 4RPFA 1UVKA 4NYOA 1J5EF 3J81Y 2E5LJ 3C6UB 1NK4A 2ZNZA 1AA1B 5BJRA 2VA3A 2V6AA 4DPTA 1NHVA 3FEZA 2HZCA 3GIIA 4C2MA 4ZP7A 4ECRA 3PYDA 2DB1A 5KFEA 3Q8RB 4F2SA 2XMMA 4NEZA 3KUEA 1FJ7A 4CP5A 3UPFA 2ALYB 2CNLB 4JI4F 1VRTB 3DCAA 4JV5F 1JX4A 3E3XA 1H2TZ 4DX5A 4NXNJ 3Q8SB 3TZZA 4ZVOB 4ZP9A 2CVIA 4NA2A 5IC6B 3BN7A 2FLNA 1VJWA 4E2FB 3PJWA 1H98A 1VIOA 1XR5A 3A1YG 1IR1A 3KK1B 1C4CA 2B0GA 1Y5NB 1VBYA 4I6YA 4DR6J 5D4PA 4OFZA 2CJYB 4NXMJ 2KB2A 2H5IB 4DV0F 1V3ZA 2M4MA 2HGMA 2VONA 3R1LA 5H9EK 4KFBA 4XDDA 2OPQA 1KSPA 2KRRA 2APOA 5IS2A 3NS7B 2QYCA 5C42A 4JI0F 4V19X 5J2MB 5J1EA 2AYBA 3GQCA 4WKYA 4AL5A 2RUGA 3OQ2A 3ENQA 2XWYA 3S8SA 2KZZA 5HBMA 1RB0A 2X1AA 1RACB 3QJJA 2DD8S 2MSTA 2DNHA 5FDLB 4YFUA 1I6JA 4K4SA 3NGRA 2Z2YB 1Z2LA 1HLWA 2ZUAA 2W2QP 1SVDA 1N56A 2C2EA 2QT7A 1WOOA 1L3KA 3K2YA 1LWCB 2HBZB 4A8KA 5JXSA 4F02A 1I3OB 1M5SA 2YKNB 4JI1F 2HHPA 3MMCB 4X4SA 1S1VB 5IM0B 2I5JB 3QRRA 2DISA 2QMWA 3DHWC 2XLJA 1OIAA 2IAJA 4B3TF 2OEMA 3HFVA 3N0VA 4MIBA 4LJMA 3GV5B 1YTYA 1QSLA 4NYZA 4OZ3A 1HBOA 5CZVA 3R5JB 5CZXA 4NCGA 4DPUA 1PJ5A 1Z2ZA 4KYZA 4D3GA 4NMXA 1OQ3A 2QC3A 4A8SA 1U24A 2ZOFA 4M63A 3UDCA 4U7CA 1NK7A 4M5KA 3PW0A 5LOQA 4X4NA 4CLWA 3T6BA 2CQ1A 4DSEA 3OR1B 4DUZF 4I2QA 3G86A 2K7JA 4NRUA 3OL9A 2AEMA 1H72C 3CPWR 3W9IA 3EPGA 2QN6B 3OV7A 1FX2A 3M8PB 1Q81T 1XWLA 5I4MA 3R7NB 4C0OC 2XLKA 2NS1B 4CO0A 1X4FA 3CGIA 2AJQA 1X4GA 4RW9B 1S48A 5BYQA 2A6MA 3KUGA 1T9YA 2DGSA 1PG5B 1Q53A 2LDIA 4P9SA 3GONA 3PVXA 4MYTA 2CQ2A 1N5TA
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 2E7X A;  1VLY A;  4OV6 A;  2QGF B;  3ONQ A;  1HWK A;  3D9B A;  4ZPC A;  1OPZ A;  5LJ3 Y;  1REG X;  1Y4Z B;  2WW8 A;  3ITH A;  3WC0 A;  3LP0 A;  3W5Z A;  4OHV A;  1RTZ A;  4ZHR B;  3KMQ A;  2F7V A;  3EMT A;  4ZVR B;  5D0G A;  1JLE A;  4H4K A;  1FVS A;  3FRY A;  5IOL A;  4CLK A;  4R8U A;  2DH7 A;  4O4G B;  2EXU A;  5ETM A;  1RGV A;  1M1G A;  4H4O A;  1HMV B;  1U2F A;  3ILJ A;  3T41 A;  4GRS A;  5ADZ A;  2M70 A;  1B0P A;  1Y5L B;  5HRO A;  5AXN A;  4DFJ A;  1A7G E;  3THV A;  1EKS A;  2B7B B;  4HH0 A;  1HNW F;  4U6P A;  3H8Y A;  4MKV A;  1EIY B;  3HVW A;  2C3P A;  1OWX A;  2ZH2 A;  2HHH J;  3T1Y J;  3MM5 B;  5HVH A;  3FBB A;  2P5V A;  3NWR A;  4DDF A;  2RF2 A;  3SBM A;  1ZZN A;  3P6Y C;  3IMQ J;  3P3D A;  4FS2 A;  4PYA A;  2CZ9 A;  2ROG A;  4M5L A;  3IBF B;  2QA4 G;  3OTE A;  1X8D A;  3DI6 B;  4M5I A;  3DDI A;  4GVB A;  4LT6 A;  1TAU A;  5D4N A;  2YKQ A;  1H3D A;  1U6F A;  3LGH A;  3KLI B;  4CTA B;  5KFB A;  1RK8 A;  3DDN A;  3O1L A;  1X60 A;  3M6W A;  1Q78 A;  3K17 A;  2DPI A;  2BAC A;  2B6A A;  3RZA A;  2OI2 A;  1UWB A;  2OD4 A;  2HLU A;  1F9E B;  2JLE A;  1QSS A;  5J2P A;  5BR8 J;  4OL8 A;  5FLX U;  4RL1 A;  1DLO B;  4UW2 A;  3T9Z A;  1D1U A;  2GQC A;  2JDJ A;  3UR0 A;  4GKK J;  3QLH B;  3CDA A;  1PIL A;  2HVD A;  5K14 A;  1Q8B A;  1RAF B;  1RWK B;  3HHD A;  2KKH A;  5DGB A;  9ATC B;  5JMN A;  2MY7 A;  4QBU A;  1Y7P A;  2HEK A;  3CW2 C;  3W5Y A;  3PY8 A;  4CI0 B;  5KFP A;  4PUO B;  1SJ3 P;  2QLB B;  1IM4 A;  3I0R B;  2VUG A;  4RBV A;  3MM7 A;  1FEH A;  2QTW A;  2HHT A;  4DPO A;  3HVA A;  4Z7C A;  3C15 B;  1AFI A;  5KFT A;  4DQI A;  4DMZ A;  2C3Y A;  4USK A;  2RQM A;  4DX7 A;  2BJ9 A;  4U7U K;  3HJF A;  2VIC A;  4EUV A;  4KHM A;  1F9F A;  2G4B A;  1B7F A;  2N82 B;  1R0B G;  3IGN A;  2HGL A;  2W7O A;  2EG2 A;  1EAY C;  2W7A A;  2KFN A;  2VC0 A;  3RJM B;  1N0V C;  4QR2 A;  3EZO A;  2XO6 A;  4FF2 A;  2XMU A;  5D8H B;  4F4Z A;  1N5Y B;  1ZET A;  4M5H A;  2QLF B;  4C8Y A;  2C2Z B;  3HZE A;  5IV4 A;  3OVB A;  1DBD A;  2VIH A;  3P5T L;  1T9V A;  2HBQ B;  1EHW A;  3TVZ A;  4JI4 J;  4JV5 J;  2F63 A;  2FJE B;  1SJF A;  1BY9 A;  1HHQ A;  4O3S A;  2MZR A;  2BBE A;  2CZV C;  5HK4 A;  3C6T B;  1S1U A;  3RR7 A;  4YOE A;  2XY5 A;  2PT0 A;  4I64 A;  4Y65 A;  1H2U X;  1LQ9 A;  4DQS A;  3IS9 A;  2A18 A;  1WJ9 A;  2EFQ A;  2KTQ A;  2BVZ A;  1TK8 A;  2HSE B;  3SDE B;  3KOA A;  4QW9 A;  4ZCM A;  4L75 A;  1N88 A;  2ZBR A;  4DHV A;  2KG1 A;  1NHK L;  3UCG A;  1UP1 A;  3H42 A;  3S01 A;  5A8K A;  2DNQ A;  3MFI A;  1BQN B;  2W4C A;  3GFY A;  4N76 A;  1KD1 T;  2XZD B;  3C16 B;  1JXV A;  4IOB A;  3C3L A;  2XI2 A;  3CCE S;  1WNE A;  5EWF A;  2DNG A;  2J9C A;  2DRD A;  1NKB A;  4TQR A;  3O6Q A;  1NPP A;  1SL0 A;  2Y1R I;  2A2D A;  1NSP A;  4K50 A;  3CO9 A;  4QOT A;  3Q8U A;  5GME A;  2AF6 A;  4WK3 A;  4JI1 J;  5DG9 A;  5KFD A;  5JVH Q;  2W8K A;  1JJH A;  3ZTS A;  5EDW A;  2D1C A;  1WOP A;  2B3T B;  3A3P B;  1LFP A;  1AW0 A;  3M8S A;  3AD8 C;  2BOP A;  1Q8K A;  5F9N A;  4J9M A;  4UY8 T;  4UF4 A;  3NNC A;  1FDA A;  4Q45 A;  3V2U C;  2R8G A;  4GC6 A;  2U2F A;  1CJK B;  2KJV A;  1HQU B;  3BSC A;  4QQB A;  3DRS A;  4CO3 A;  5HN0 A;  5DG7 A;  1RU1 A;  2ZE2 A;  2AHO B;  1C0U A;  1X5S A;  2VQE F;  2R7T A;  2E5J A;  4M5M A;  1YRT A;  2CG4 A;  1RIS A;  3M6U A;  4JI3 J;  1IBC B;  1U2R A;  3HHK A;  4DSF A;  1OJ4 A;  3FDS A;  1DTT A;  4WP3 A;  1JLA B;  3JAM Y;  5IC4 B;  3BGR A;  3GYG A;  3BPD A;  2CNK B;  2M52 A;  3IC1 A;  2IVM A;  3TX8 A;  5B0G A;  3HHL D;  1SL2 A;  3M2R A;  5IQ6 A;  2D7S A;  5D3G A;  4M1K A;  3A3N B;  4DR2 F;  1TL3 A;  4I56 A;  1QSY A;  5A8W A;  1LEO A;  3C14 B;  2OTL S;  4KHP F;  2M9K A;  3HSD A;  2P6S A;  4AD6 A;  2VFU A;  2IDL A;  2B43 A;  2DBB A;  4ZVS B;  3J7Y I;  1MWY A;  4KY3 A;  3WQP A;  1UEV A;  2KH9 A;  1X7V A;  4XDC A;  2N3L A;  2ZZM A;  1RAA B;  2ACY A;  2YKM B;  3UD4 P;  4F67 A;  1VRU B;  2BJ1 A;  2E1P A;  3A4T A;  3T1H J;  1FEE A;  2IYG A;  3H5X A;  3M30 B;  4K7Q A;  3I0S B;  1RAJ A;  2MKK A;  2X1F A;  1S6U A;  3MM8 B;  4HKQ A;  4LF6 J;  4PQU A;  4LSL A;  2IJR A;  2EK1 A;  3T5J A;  2DIU A;  2MJU A;  4ALZ A;  1CEZ A;  1YQH A;  1TKT A;  4ZA1 A;  2OIH A;  2RNE A;  4CYU A;  1HNW J;  2GQ2 A;  3KNG A;  2AV5 A;  1OPI A;  2LYV A;  4A8M P;  1FA0 A;  4ES2 A;  3DYA A;  2ROE A;  4LFA F;  2W9A A;  2WSC C;  4FZV A;  2A1B A;  2Q79 A;  4RZR A;  1EKR A;  3K58 A;  3PEJ A;  1RTH A;  2H48 B;  2W9B A;  1WC6 A;  3BEG B;  3T5K A;  3N79 A;  4Q2M A;  1QAI A;  3PX4 A;  3VAL A;  3V81 B;  4DU7 A;  2V63 A;  1NAQ A;  1HQE A;  2XMW A;  3VR1 A;  1F2H A;  1HNX F;  4IFY A;  2JEF A;  2H4W B;  4WTY A;  1HBU B;  4OHZ A;  2H5E A;  1FKO B;  3FCV A;  4G1P A;  4YHH F;  3RBZ A;  1OY9 A;  2E5G A;  3VWS A;  1LWX A;  4CQ1 A;  5D78 A;  4CCH A;  1JLQ B;  3QO9 B;  4ELT A;  2D3Z A;  1G1X A;  1MU2 A;  3IM9 A;  3UN5 A;  3D54 A;  1X4C A;  3UVJ B;  3VAI A;  3M8Q B;  1FCA A;  2MZS A;  4OJ3 A;  1RP5 A;  5DZ7 A;  2F8H A;  1URN A;  2D3U A;  2PFF B;  3D3C J;  4DBQ A;  4JV1 A;  4UTG A;  1Q1K A;  2LQB A;  4W4M A;  2OJ3 A;  1S0O A;  4J37 A;  1KDN A;  3PXG a;  4LMZ A;  1H6K X;  4CLY A;  1DAR A;  4CLU A;  3F41 A;  4X4P A;  3GMG A;  1MN9 A;  3BYR A;  2FLO A;  1WWH A;  4ED4 A;  1I94 F;  3QPI A;  2BXJ A;  4V19 J;  3A8J A;  2B9E A;  2CQ0 A;  3P4U B;  5CYJ A;  3K8V A;  2UUW A;  3RRK A;  4XPC A;  3ADA C;  2CQP A;  3R5C A;  3DLL Q;  1FES A;  1BXN A;  1MWZ A;  2J0X A;  4DPY A;  1NJY A;  3OTD A;  2Q3P A;  1TKX B;  2RH3 A;  2GZO A;  3KXD A;  3AA8 A;  2EG1 A;  3B4M A;  2BUN A;  3JSB A;  1KVI A;  1WF2 A;  1RDR A;  3CJ5 A;  4YY3 F;  2YX4 A;  1B70 B;  1S1X B;  3TVK A;  2H54 B;  2IM0 A;  4BCA A;  4EGL A;  3GG1 A;  1KRP A;  1HYS B;  5CH7 B;  4HI2 A;  4TQS A;  2VDI A;  2OEK A;  3MPD A;  1C0T A;  1S1V A;  1VBZ A;  4RUB A;  4WP8 A;  2DH9 A;  2HUR A;  3NLC A;  1YDL A;  4P7T A;  1IBK F;  1N0U A;  2CJX B;  1AT1 B;  2HZA A;  3UD5 A;  3VAM A;  2J6T A;  4DV5 F;  3QSI A;  4OYX A;  3VAK A;  3KJV B;  4HHU A;  3CCW A;  2GVZ A;  3W2W A;  2NPF A;  4CIO A;  1N6Q B;  4LR9 A;  3MEK A;  1S4F A;  1I51 B;  3IN5 A;  1WF1 A;  4KC5 A;  3BO2 A;  4O3O A;  4I0W A;  4I6A A;  3E51 A;  3QAU A;  2HNY A;  3IWL A;  4TN2 A;  3MR3 A;  4L3K A;  3JYT B;  4USW A;  4LF1 A;  5AXL A;  4BLG A;  2JEI A;  4LSN A;  3NWG A;  3MF5 A;  2J7U A;  4F4X A;  1EP4 A;  3HHN B;  3BH7 B;  3ULH A;  1VQ6 S;  1NSK L;  4DQQ A;  3I82 A;  4ZVG A;  3M8P A;  1FFS B;  3IBW A;  2QLW A;  1N34 F;  3L4B C;  3WBZ A;  3GWC A;  3ZO7 A;  4O23 A;  2GA7 A;  4LF7 F;  1JJC B;  1T9T A;  4JB8 B;  2WB1 D;  4RW9 A;  2F8M A;  2MMY A;  4B9M A;  1TUV A;  5L9X A;  3CDU A;  1FXL A;  2RU9 A;  2LCW A;  3MUV P;  3K8W A;  4ECT A;  2BQR A;  1RA7 A;  2VQF J;  1DAX A;  2BAN B;  2V8V A;  1ZM4 A;  3MOZ A;  3JSR A;  1FKP A;  2CJ9 A;  2F40 A;  1DRZ A;  4ELV A;  1CBK A;  4K4T A;  4NI2 A;  1X4E A;  2QFI A;  2KXN B;  2FHM A;  3CVK A;  1S6Q B;  1U1M A;  4NPO A;  4ANC A;  2ATC B;  5B0C A;  1NM2 A;  2NUU G;  1E6Y A;  2LXI A;  1H73 A;  1H2V Z;  5A8R A;  4F4Y A;  3UCZ P;  4C3M A;  2RQC A;  4C3K A;  2Q43 A;  1RUS A;  3TUZ C;  3U7J A;  1FF2 A;  2MSS A;  1RT5 B;  4QYR A;  2MQ8 A;  1VLO A;  2UVR A;  5I42 B;  2CRL A;  3OHB A;  1WDT A;  2MKJ A;  1TMJ A;  2WW4 A;  4IKA A;  3PRD A;  1I1G A;  2V8H A;  4C8L A;  4WFY A;  5A0Y B;  2D3O R;  3MEG A;  2YKP A;  4LQ3 A;  1EET B;  2OHD A;  1NND A;  2DY9 A;  1HPZ A;  2XI3 A;  3OW2 R;  2FZG B;  4ECU A;  2XS2 A;  1VQP S;  2XYH B;  4B17 A;  4DX8 H;  4RUA A;  2FLP A;  1JNR B;  4Y3C A;  2EFN A;  1NJW A;  3NOG A;  1HAR A;  1T95 A;  3POT B;  2VHG A;  3U1N A;  1UPM B;  4DR3 J;  4WFN Q;  5BYS A;  5I3P A;  2XZW A;  4BHQ A;  2ZHB A;  1RWV B;  4K5S A;  3Q24 A;  2DK2 A;  3J7Z T;  3T19 A;  2RML A;  3I55 S;  3FCH A;  3W3S A;  1CJU B;  4QIV A;  4U7U D;  4J9N A;  5KG7 A;  2VC1 A;  3NXZ A;  1UJ6 A;  5CYM B;  4IG3 A;  5ETQ A;  1QE1 B;  2DO4 A;  4HI1 A;  1R27 B;  4DUT A;  5KFV A;  1KC8 T;  3HO1 A;  3T1A A;  4ZCL A;  1GX6 A;  2G0J A;  4K4V A;  1T9W A;  2IMO A;  3NNH A;  2UXC J;  2ZZT A;  3ICL A;  3CJ2 A;  1GX5 A;  3QLH A;  2YWH A;  3G2X A;  3W62 A;  3OPK A;  3CJS A;  2W1B A;  3R6L B;  1VQM S;  5IT9 U;  2MQP A;  3CSK A;  1T05 A;  5L39 A;  3QZ8 A;  3MCO A;  1R8C A;  2C2K B;  5HI7 A;  2EK6 A;  3DOM B;  3FVY A;  1S9F A;  1E6V B;  4PUO A;  4OJ1 A;  4FN5 A;  2PGC A;  4IDK B;  2J8S A;  3S1T A;  4G1Q A;  4LFA J;  4F25 A;  1JLF A;  4MJK A;  2AJF E;  3PIP Q;  1RT1 B;  3C15 A;  2BE7 D;  4A8Q A;  4TY8 A;  2DRB A;  2QG9 B;  4YR2 A;  4NLS A;  2QMX A;  4MK7 A;  2JRS A;  1NPK A;  2SXL A;  1TMM A;  5G0R B;  2X1B A;  3LTO A;  5C25 A;  3D6H B;  4EZ6 A;  3IWX A;  2I0X A;  3MM9 B;  3F73 A;  5LSO A;  1YIJ S;  2CYY A;  2PA8 D;  4YB1 P;  1IKY B;  4LRE A;  1HNX J;  4DSK A;  1ZM9 A;  1XMO F;  3NL0 A;  4YHH J;  3SZ2 A;  3H5S A;  3RW6 A;  4FVC A;  5GAD U;  3HPO A;  4DQP A;  4H4M A;  2XGP A;  3MD1 A;  3TA0 A;  2W9C A;  1S79 A;  1QAJ A;  3KLF A;  3LF0 A;  4JI5 F;  2B56 A;  3AOC A;  1FRJ A;  2R7Q A;  3IBC B;  2VV5 A;  1FKA F;  1VC0 A;  3NCQ A;  1XNQ F;  5ETK A;  2OPP A;  3ZC4 A;  2N3O A;  1V3R A;  1RAI B;  1B0V A;  1XQI A;  1T02 A;  2AGP A;  2NUH A;  6FD1 A;  2DHG A;  3K5M A;  3QFW A;  2M5Y A;  2MLX A;  2ALZ A;  4OLO A;  4M5D B;  1VYA A;  4MYU A;  2JH3 A;  5I3Q A;  2A3J A;  2BKP A;  1FRM A;  4I7F B;  3MHY A;  1U25 A;  1K44 A;  1KLM B;  3GV8 B;  4PYD A;  1TKD A;  3Q22 A;  4KHR A;  4A8W A;  3J80 Y;  1XMB A;  2UUC F;  5HP1 B;  4PWD A;  2RU3 A;  2DJW A;  3C66 A;  1IQZ A;  3CB4 A;  1TZ0 A;  3QT5 A;  3DLB A;  3KDO A;  5IT4 A;  1F5C A;  2OUG A;  3W7B A;  1U6B A;  1HA1 A;  3CJK B;  3DDK A;  3NP5 A;  1T03 B;  3OR2 B;  1FTR A;  2G2Z A;  3SCI E;  5CQG A;  2EW9 A;  3C16 A;  3CTR A;  4G6V B;  1X4A A;  1HBM B;  4OZL A;  1KVK A;  5SZT A;  3QGP A;  2YNI A;  1S6P A;  1WEX A;  1K9M T;  3V4I A;  1YBT A;  3MAA A;  1BQM B;  3AOA A;  3VVU A;  1JIH A;  1KKH A;  1VMB A;  2DNP A;  3MM6 B;  1NRK A;  1SH2 A;  4ICL A;  2NYI A;  5KG6 A;  1QM9 A;  1REV B;  2ZJR Q;  4Q2L A;  4P75 A;  2BW7 A;  3V6D A;  1UEU A;  2CQ3 A;  4LVO P;  1KP6 A;  4KT0 C;  2YPZ A;  3UWT A;  4WPA A;  1HNZ F;  2WRM A;  2Y9H A;  3CF5 Q;  3J81 U;  4ZLL A;  3FSX A;  4O0N A;  1VQO S;  1IKX B;  1KLN A;  2OKQ A;  4B3M F;  1UVM A;  4DS4 A;  4N47 A;  3GJS B;  3O3L A;  1RSC A;  2ZM6 F;  3E8O A;  3CC2 S;  1S76 D;  1ZS6 A;  2ASY A;  3M1V B;  4K8R A;  3W2V A;  5MLC V;  4PQA A;  4FNH A;  2VOD A;  2VAS A;  3Q23 A;  2PEH A;  4DN9 A;  4WCE Q;  2LEC A;  4H54 A;  3NOC A;  3IXQ A;  4X4T A;  7AT1 B;  1QVG R;  4AE5 A;  2RJZ A;  2BYC A;  4NRT A;  3AH6 A;  4X66 J;  4LRA A;  3BR9 A;  3TVY A;  2FHO B;  2V4J B;  3PRB A;  1VK8 A;  1MG7 A;  3RB0 A;  1FFG B;  4OYO A;  4JV2 A;  2CUY A;  2F8E X;  4NZ7 A;  2ZKT A;  1UA0 A;  2FC9 A;  4YME A;  4HHJ A;  2VFR A;  1RHR B;  4OV1 A;  2XCP A;  4FNI A;  3SMZ A;  1XMQ J;  1LWE B;  3PFE A;  3BGF A;  2PI4 A;  3VHQ A;  3UN2 A;  4WXO A;  3HD2 A;  3H2U B;  3VZH A;  2G2Y A;  1SPB P;  1RT2 B;  1O8B A;  3OUY B;  2HHX A;  3LWM A;  3W8G A;  1JWW A;  4QPT A;  1YSJ A;  1JXE A;  1Q5Y A;  2OH2 A;  5J2Q B;  4DL2 A;  1M5H A;  1HHS A;  5DRK A;  3KK2 B;  3M30 A;  4LF4 J;  2L9W A;  4EK2 A;  3G8T A;  4A8Y A;  1VQ5 S;  5JJB A;  3VAF A;  3BH6 B;  4YN3 B;  2GJI A;  4M5J A;  3SQG A;  1N48 A;  4C9D A;  1IR2 A;  3CC4 S;  1SIW B;  1D9D A;  3JSM A;  1ZM2 A;  3BSA A;  3CT9 A;  2AMC B;  4EO6 A;  3SSR A;  4YQW A;  2GMH A;  4P52 A;  4DR1 F;  3ZZZ A;  4USM A;  3Q8P B;  4ECQ A;  4ZVF A;  1LXJ A;  2NSB A;  1CJV A;  2FYX A;  3QRQ A;  4OI1 A;  4OMF G;  2HS0 A;  2H4Y B;  2C3U A;  4FF4 A;  2PII A;  4DFK A;  4X64 J;  3ZTR A;  1HD1 A;  1TVR B;  1C1B A;  5T41 A;  4DLE A;  2FJB B;  3MED A;  3AJ1 A;  2OSQ A;  1RBO B;  2YKO A;  2EFV A;  2MKS A;  4O0I A;  6AT1 B;  4C0H A;  2VBW A;  2CZ4 A;  1SH0 A;  2ZVI A;  3EYZ A;  1VQY A;  3N4W A;  3QGI A;  1NB2 A;  2AT1 B;  4P2F A;  2ZHO A;  1HW9 A;  2XB2 D;  4BDP A;  3FNN A;  1RAH B;  2M7S A;  2NXC A;  1B64 A;  5KG1 A;  5CYQ B;  1LW0 B;  4PR6 A;  3DC2 A;  1VQ7 S;  4H4K C;  2HHQ A;  3AQP A;  5DS7 A;  4QJV A;  2VG7 B;  1YKW A;  4OI2 A;  2DH8 A;  3IG1 A;  3J7A N;  1FDN A;  2W4D A;  2EVZ A;  2UZA A;  3BGL A;  2QO3 A;  4DU8 A;  1IKV B;  4OYP A;  4ECV A;  3SV4 A;  1YZ6 A;  1JLG B;  2KYZ A;  2D41 A;  2LQ9 A;  1Q86 T;  5L1I A;  3M6V A;  5M2U A;  4DS5 A;  4EEY A;  1NDP A;  2MTL A;  1UKU A;  1SV5 A;  4I68 A;  2RHQ B;  4J9O A;  1U1N A;  1S5Z A;  5BYR A;  3FUY A;  3LQV A;  3R7S B;  5JVG Q;  4FYD A;  1P9Y A;  4TU7 A;  2GC8 A;  4J9L A;  3SSQ A;  5ETO A;  2JX2 A;  3WC2 A;  4KPC A;  2GHP A;  1NSQ A;  2WBM A;  4WE1 B;  3H25 A;  3VGU A;  1ZAW A;  1TV6 B;  2FHJ A;  1XMO J;  2BW2 A;  3UI3 A;  2XTJ P;  3N5F A;  2XMA A;  3KK3 B;  4OZ1 A;  1YJT A;  1U1L A;  2KM8 C;  2HFZ A;  3S7R A;  4P2S A;  1VQ8 S;  2E5I A;  1P27 B;  4RWX A;  4KH1 B;  3EVW A;  1HD0 A;  2X7I A;  1XNQ J;  1IBM J;  4K59 A;  3R8Y A;  1HWU A;  2BX6 A;  2LA6 A;  3DM2 A;  2AJ2 A;  1CS4 B;  4Q0B B;  2AJ4 A;  2GVD B;  2ACM A;  2BA9 A;  2OLW A;  3FRZ A;  1WC1 A;  2MKH A;  3OHA A;  4W92 B;  1S9E A;  4J9Q A;  4LSZ B;  2BJ8 A;  2E9Z A;  4ECS A;  3NGS A;  4ELU A;  2BQU A;  4GKJ J;  4XPE A;  4PWU A;  2E9R X;  1QAX A;  2KHD A;  5C24 B;  2FJA B;  3QGH A;  3HD1 A;  2BQ3 A;  4FPR A;  3SEO A;  2HRU A;  1R0A B;  1FRL A;  3QSY B;  1O51 A;  1QTM A;  4JI2 J;  1YLX A;  1UFL A;  2FIU A;  4KQZ A;  3CMQ A;  1AZS B;  3JYT A;  4UOG A;  4DEZ A;  2JOQ A;  4WJB A;  3BPS P;  5LM7 E;  4HVZ A;  5EHH A;  5LXY A;  1R3N A;  3CCT A;  1RT7 A;  2BE9 B;  5D0E A;  4DV2 F;  2NQP A;  1FT8 A;  2ADB A;  1WG5 A;  3FQK A;  5H9F K;  3DLE B;  4C11 A;  4ZP8 A;  2OTJ S;  3D6F B;  3GTY X;  4NXN F;  2V69 A;  3HI9 A;  3ZNU A;  1G7C B;  3US5 A;  2ATL A;  2R8H A;  3H4D A;  2V0N A;  4C3L A;  2LP4 A;  1DTQ A;  1U1Q A;  1T8E A;  2YNF A;  2MGZ B;  4NL5 A;  4O3N A;  3UCU P;  3PX6 A;  4CO2 A;  4GMK A;  2E1M C;  1UW4 A;  3UDL A;  1QTN B;  3M2V B;  2V2Z A;  4DR6 F;  4PZV A;  4NXM F;  4F3Q A;  4CO5 A;  3MEE B;  3U27 A;  2G2O A;  2Y8Y A;  3HVT B;  2E5H A;  5CAA A;  4FDF A;  1V3S A;  1TL5 A;  3G82 A;  3D5M A;  2FLL A;  3KLG A;  1WC5 A;  1F60 B;  1S49 A;  1IKW B;  2ZD1 B;  1Q8L A;  3M9M B;  1NCL A;  3TZX A;  4J9R A;  1J5O B;  4ZVE A;  3R5A A;  2XCA A;  1HNI B;  4MK9 A;  3KDN A;  5KT6 A;  2PD1 A;  2DGX A;  3ETM A;  4OX7 A;  3SI8 A;  3CCL S;  2VPZ B;  1R6Y A;  2ZM6 J;  2HWH A;  1U7L A;  4ITS A;  4IFV B;  3BS9 A;  4WII A;  1HHT P;  4CM0 A;  2RD5 C;  4ZVH A;  4OHY A;  2IC3 B;  4ES1 A;  4IOC Q;  3CCV S;  5E3Q A;  2NCK L;  3LA0 A;  5HMW A;  4LFC F;  4KBI A;  4WIQ A;  4RBT A;  3AOD A;  3CCZ A;  2ADC A;  4PRF A;  2HZV A;  3MPV A;  2GNK A;  2G13 A;  5KTQ A;  2ROP A;  2ZIT A;  4EI2 A;  1Y5I B;  1VIS A;  3ETO A;  2OPR B;  4EO8 A;  3MR5 A;  3IO1 A;  2BDP A;  3OTO F;  1NME B;  5HLF B;  2L3M A;  1UZH A;  4RUC A;  3NBP B;  3DLH A;  2DHH A;  4DV6 F;  3PV8 A;  4DOZ A;  1CJU A;  2C3O A;  2V9K A;  1BHN A;  1CC7 A;  3GIK A;  5D4O A;  3RRG A;  3PO5 A;  4NLV A;  3ILI A;  5F8N A;  4WWS A;  2DGO A;  2BMB A;  4BC7 A;  2Y0S D;  1SC3 B;  1GAO A;  5B0E A;  3KWM A;  4DFM A;  1MW7 A;  3DOL A;  1D8Y A;  4PG4 A;  4B9V A;  2E29 A;  1VRQ C;  4J9U E;  3MEC B;  3QJL A;  1LOU A;  3A13 A;  3PW7 A;  1OMS A;  4YR0 A;  5IWA J;  4QWC A;  4OZ2 A;  5GAG I;  2IA0 A;  3CCU S;  2O1P A;  1WOS A;  1S4E A;  1S6O A;  2FGO A;  3VGT A;  2RKI B;  5IT9 Y;  4DZ6 A;  1F1B B;  1K73 T;  4K2J A;  2VFT A;  3BKT A;  3M8Z A;  2OFG X;  5ETL A;  4PXE A;  3AHP A;  4DR5 J;  4IDK A;  4WBF A;  1CUL B;  3KUH A;  5L1L A;  2HIQ A;  2XSJ B;  1K1Q A;  4K0K J;  5KFN A;  2D9P A;  1Q0N A;  2V8D A;  1LV5 A;  2KYX A;  3TRG A;  2ZH8 A;  3AY0 A;  2CQB A;  4ZP6 A;  1YBA A;  3H90 A;  2ZOG A;  3LAK A;  4R5P A;  4IH5 A;  1GFW B;  2ZNY A;  3IM8 A;  5E7O B;  4WYW A;  3BBC A;  1RKI A;  1X31 C;  2CFX A;  4A8O A;  4NOH A;  1KOH A;  3PKY A;  4TLQ A;  4F7V A;  4B3O B;  3PHE A;  3JAM U;  3SCJ E;  2LDY A;  2VBX A;  2E7V A;  5HJY A;  2HHH F;  2LMI A;  3T1Y F;  3RRH A;  3TA2 A;  2WHO A;  4YB7 A;  3PZP A;  4Y0F A;  3TUJ C;  5DQG A;  2KT3 A;  3T9N A;  4ID5 A;  2LQJ A;  3NGT A;  5KFR A;  3OJU A;  3KHG A;  2MZQ A;  2YPY A;  3BSN A;  1UAW A;  1W25 A;  3PYF A;  4WK1 A;  4QIF A;  1FXD A;  4KO0 B;  4P7V A;  4I7F A;  5E3R A;  1U6Z A;  2MZ1 A;  1V5V A;  3MTK A;  2M8H A;  2VG5 A;  2RIL A;  1ZPW X;  5DZ6 A;  1BMQ B;  4E0D A;  2HVH A;  3FMW A;  2N7Y A;  5DDP C;  4IQX A;  2PMH A;  3CJQ A;  3AXK A;  5A2Q U;  5AXK A;  3BO3 A;  3RAX A;  1ZTT A;  4J90 A;  1RA6 A;  3ILO A;  1NB7 A;  5E41 A;  1TAQ A;  4OHW A;  3DRR A;  4F8R A;  1OQ6 A;  3ZTP A;  2HBY B;  3KLE B;  3TR5 A;  4OYZ A;  5LMU J;  5BR8 F;  4EYI B;  2ZHA A;  2RQ4 A;  4UST A;  1V9O A;  4DR7 F;  3H98 A;  2ZDO A;  5K8O A;  4L76 A;  1LK7 A;  3FFI A;  4ZCK A;  1XC9 A;  4GKK F;  4IR9 A;  3GIL A;  3R5G A;  3M8R A;  1XNR F;  3PO4 A;  3T6J A;  1FFW B;  1LKZ A;  2VG6 A;  3R97 A;  2CQC A;  2HK2 A;  5D15 A;  5E0O A;  4DL3 A;  2F65 A;  4WKR A;  2LXU A;  2B9Y A;  4KIA A;  3W61 A;  2FJW A;  2CKW A;  4LF8 F;  3PCO B;  2PDA A;  3R2C J;  1U0S A;  1ZZF A;  4O44 A;  2A6O A;  1FDB A;  4CM2 A;  1RBA A;  1U1R A;  1WG1 A;  1SL1 A;  3NCP A;  5EGY A;  2JHE A;  1MMD A;  4OI6 A;  1REV A;  4F0H A;  3I5B A;  3G6E S;  2P9E A;  4QPX A;  2EBE A;  1S7I A;  1WAC A;  4J91 A;  4GO7 X;  3PW4 A;  5ETV A;  2KU7 A;  4YS2 A;  3QWU A;  3GPA A;  4LRF A;  3BB5 A;  3UN3 A;  1NDC A;  2AP6 A;  1O5J A;  1PYS B;  4CDI A;  2PSZ A;  2BE2 B;  3M1V A;  2O3D A;  3CCR S;  4YP3 A;  1VGY A;  1A0O B;  1M1H A;  2R7V A;  2VBZ A;  3KJN B;  1XER A;  4HHH A;  2JLG A;  2HW3 A;  4PEO A;  5EUH A;  4DV2 J;  3KG4 A;  4F04 B;  2HNZ A;  1KON A;  5DLF A;  2V68 A;  2WB4 A;  1P6T A;  4KV8 A;  3D66 A;  1FDD A;  4E98 A;  2FPH X;  4J9S A;  3M6X A;  3B78 A;  4NCA A;  4DR4 J;  4L6V 3;  2ZJP Q;  4OZJ A;  1C1C A;  2B8Q A;  4HT5 A;  2V2V A;  2YNG A;  4PG8 A;  3ZZ0 A;  1M0S A;  2BV3 A;  4QYZ J;  2AYG A;  3TO8 A;  1QY7 A;  3HHL C;  2CJQ A;  2DGT A;  1HNV A;  4MK8 A;  1H7X A;  1TFY A;  2IYI A;  2UUT A;  2I38 A;  3MMA A;  5RUB A;  3TZW A;  3VAH A;  3SQO P;  2IM1 A;  4PAB A;  2E44 A;  1GEH A;  3R3T A;  5K8N A;  5IZH A;  3JTO A;  3TJ8 A;  3CUN A;  1RT4 A;  2R3V A;  4JYA F;  4I4B A;  4AXJ A;  1VS3 A;  3HKZ D;  3W1Y C;  2DYA A;  1K8A T;  1VQ4 S;  2XNR A;  3SV3 A;  3FSY A;  5GAE I;  1K47 A;  2R8K A;  8AT1 B;  1Z4U A;  4IG0 A;  3PJX A;  1NKE A;  4LFC J;  4G1I A;  2UU9 F;  4DV7 F;  2GJ2 A;  2ZC3 A;  2L48 A;  3L9Z A;  2V2Q A;  3VQT A;  3KHR A;  4JOU A;  2Z8Q A;  1R0C B;  1HBN A;  1XN9 A;  3IP0 A;  2OPQ B;  2MQQ A;  2XHW A;  2CJB A;  4ECW A;  1NH8 A;  1XEZ A;  5D6G A;  3HSG A;  3W5X A;  4MKB A;  3OTO J;  5C42 B;  5J1E B;  2XZT B;  2HMI A;  2EC0 A;  5KFH A;  2CQD A;  2GCF A;  1U0H A;  2O66 A;  5HAT A;  2FD2 A;  4DV6 J;  5CHC B;  2CQG A;  3W9H A;  3I31 A;  4MMO A;  4OX9 J;  2WSE C;  3DGP B;  4Y2A A;  1LW2 A;  4X62 F;  4ED1 A;  1NZ8 A;  5EWE A;  5HSP A;  3G87 A;  4JI3 F;  2KFZ A;  2DY1 A;  1K0V A;  4RW4 A;  1NK8 A;  3HT3 A;  3MCM A;  1HFE L;  3TQE A;  3LAM A;  3OJS A;  1O6X A;  1VIX A;  4AQY J;  1G2E A;  1SI9 A;  1RAB B;  2YNH A;  4Q43 A;  2FJV A;  4CLZ A;  4KGZ B;  2BR0 A;  4RBU A;  5AJ3 J;  3PEH A;  2K8G A;  3FBF A;  1JLB B;  2IAJ B;  1NSA A;  5L38 A;  1KHW A;  2QMU B;  5L9N A;  1RYR A;  3TQ1 A;  1WDD A;  3BYP A;  3K5N A;  1WC0 A;  3N6M A;  4S0M A;  4YUD A;  2ZH1 A;  3WIU A;  1PYT A;  4NCG B;  5THW A;  3UR3 C;  1U45 A;  3FQL A;  3Q8Y A;  2XEX A;  4RW6 A;  1Y10 A;  3J7A 1;  4Y6I A;  2MXY A;  4CNZ A;  3LP1 B;  4WU2 A;  3T1H F;  2QL9 B;  2W8L A;  1NPR A;  3R2D J;  3M32 A;  1RWN B;  2HK3 A;  4I2Q B;  2HQD A;  3FZB A;  2UVW A;  3DKD A;  2QJ3 A;  4JV0 A;  2R7R A;  1PKU A;  4NAS A;  2AYM A;  2VB6 A;  2RB7 A;  3CJR A;  4LF6 F;  4A47 A;  4F0K A;  2ABY A;  3W60 A;  5F0W A;  5KFX A;  4MAK A;  2AQ4 A;  2V50 A;  1YJU A;  2UXD J;  3JS9 A;  3GFZ A;  2VF3 A;  3D4J A;  3MPY A;  5H1S V;  3I96 A;  1RAE B;  3IRW P;  4PXC A;  3I5A A;  1FK9 A;  3OLB A;  3ZTO A;  3ZZU A;  3GIJ A;  5D0H A;  2XO7 A;  3PNI A;  1U4B A;  2GVD A;  2A0F B;  1GXL A;  3IAS 9;  5EN1 A;  2GX8 A;  1Y0H A;  4OX8 A;  3LP0 B;  2C2O B;  2G1D A;  1NXI A;  4RU9 A;  1Q5V A;  2QIF A;  4YB6 A;  2ZJQ Q;  1JLE B;  4LRB A;  2H1Y A;  1NHU A;  5C24 A;  1WKL A;  1H38 A;  4ZK7 M;  4URQ U;  4R8U B;  3C19 A;  1EQ0 A;  2NZ4 A;  3UNG C;  3BR8 A;  3M4X A;  5EWG A;  1NO8 A;  3OFE A;  5LXR A;  2ZWO A;  3EWG A;  3C46 A;  5HRO B;  4DR7 J;  3E01 B;  4FXV A;  4RW8 A;  3KG0 A;  5KT7 A;  3FBC A;  1UPP A;  3I9Z A;  1WD6 A;  2HKE A;  2HHV A;  2IMW P;  2DXF A;  3PRV A;  1F0X A;  2Y3Y A;  1IM6 A;  4P73 A;  2HS3 A;  1XNR J;  1JB0 C;  3CO0 P;  2XMT A;  2C3M A;  4L72 B;  2RF2 B;  3LW5 C;  1MMN A;  3EPI A;  3BQ0 A;  4LBI A;  3EM1 A;  2JEJ A;  3D67 A;  2FVR A;  1T7P A;  1WI8 A;  2UUA J;  4CT9 A;  5KFA A;  4HTI A;  1QDU B;  4LF8 J;  1D3W A;  3AQO A;  1NJX A;  3MUM P;  5HJX A;  3LP2 A;  3N28 A;  4WFB Q;  3ZZP A;  2EFG A;  3W65 A;  5HAN A;  1M5K C;  2JFD A;  4UQG A;  2PMZ D;  4DF4 A;  2W25 A;  3MEE A;  3M9O B;  1YHQ S;  2KVQ E;  3HVT A;  4QU7 A;  2FVC A;  4QR0 A;  5K20 B;  2B6A B;  1CJT B;  4ILR A;  3CWJ A;  3WDO A;  4KB7 A;  1UWB B;  2MQN A;  2KM8 B;  1Y9O A;  2DXE A;  4E8U A;  4ZIT A;  4X65 J;  2RIJ A;  1ITP A;  5J2P B;  2UVV A;  1U1P A;  3N6L A;  1L3V A;  4LBH A;  1F3F A;  2AZ1 A;  2JC0 A;  4LFB J;  4CLP A;  3OL7 A;  4IO9 Q;  5K14 B;  1VBX A;  4YB5 A;  2HAF A;  4ED8 A;  1BWE A;  4IFV A;  4FYX B;  2LQ8 A;  3U02 A;  1L5U A;  3BZQ A;  4RO0 A;  5IT0 A;  1PAU B;  4FYW B;  5KT2 A;  5B08 A;  4U95 A;  4KR0 B;  3DRX A;  1JLC B;  4R0J A;  1S1W A;  3MM7 B;  1X5P A;  3F44 A;  2YXL A;  2J0W A;  1RWX B;  4NLD A;  2OMO A;  3PFO A;  2W4P A;  4DV4 J;  2WOM A;  5KFC A;  1D09 B;  1FNM A;  5HMZ A;  3FC9 A;  1KFS A;  4DG1 A;  3KTQ A;  4JI6 J;  2R7X A;  3D0G E;  3PHT A;  1JKH B;  2LKZ A;  4PPZ A;  4USI A;  2FC8 A;  3J80 U;  1AUS L;  4I1T A;  1R7I A;  2CIM A;  3QGG A;  3NBP A;  1MRO B;  2DGU A;  4OI3 A;  3GIM A;  5C2G A;  4FPI A;  1DZ5 A;  2NSC A;  7FD1 A;  2YWG A;  3NNA A;  2VPY B;  2OML A;  4DJB A;  4OHX A;  5A76 A;  3VCD A;  3PKM A;  3PYE A;  2IBK A;  1HWI A;  2Z4P A;  4MFB B;  4DI6 A;  4OYM A;  4K5R A;  3GCW P;  2B7C B;  1BWV A;  4FF1 A;  5LJ5 Y;  1GTE A;  3EGN A;  2F5G A;  4RWW A;  2GS8 A;  4JYA J;  4A8F A;  3DOK A;  1SQE A;  5KFI A;  3DRP B;  3ELH A;  3RW7 A;  2FZC B;  1RCX B;  2P2C B;  1IXK A;  2DR6 A;  1PBA A;  2NXJ A;  1S1U B;  4FYY B;  2AIR B;  2OO4 A;  3IS9 B;  2FTR A;  1X9S A;  3QAE A;  2B4O A;  2KN4 A;  2UU9 J;  3TUP A;  3VVT A;  2I8E A;  4DV7 J;  4ZN3 A;  4TNO A;  3IAM 9;  4ZPV R;  2IDE A;  1CC8 A;  2DCU B;  3DLG A;  2VQF F;  3M05 A;  3M9N B;  3PR4 A;  1RU2 A;  5B0F A;  3V6K A;  1GXT A;  3OL8 A;  5FD1 A;  4LUB A;  1R8B A;  3W9J A;  3KJF B;  3BN4 A;  1MN7 A;  5A8K B;  1KVJ A;  1RT3 A;  3DU5 A;  2JJ4 D;  2FGC A;  3RUB L;  3QFH A;  4PG7 A;  2RDI A;  2ZH5 A;  4URG A;  2G0I A;  3E2E A;  1VQ9 S;  4M94 A;  2R9L A;  2PO4 A;  4ENO A;  1MWQ A;  2GW8 A;  2H5J B;  4P74 A;  1P8G A;  3ISN D;  4X62 J;  2AZ3 A;  1S0M A;  1RLD A;  5F3Z A;  3OSN A;  2OPS A;  4B3O A;  1Q95 G;  3MAH A;  4NWB A;  2N4D A;  3QIP A;  5E33 A;  2DR5 A;  2MKI A;  3A3O B;  2KDO A;  1EJ7 L;  1S0V A;  5B0A A;  2E9T A;  2DHA A;  4FBT A;  3AT1 B;  1WTF A;  3NMR A;  1KBR A;  4KO0 A;  5ETN A;  1N36 J;  5FJ4 A;  4DR3 F;  4DV1 J;  2YY3 A;  3AXM A;  3TUI C;  1KFD A;  3ENA A;  3KLV A;  3GIR A;  4QCL A;  4QIE A;  5KFF A;  1YJN S;  2JLF A;  3LWL A;  3IRX B;  2GGP A;  3ENV A;  4W98 A;  3OTB A;  3BBF A;  5A2Q Y;  1IUJ A;  2ZE2 B;  5CCL A;  4C48 A;  2CPE A;  2WVB A;  1C0U B;  5GMD A;  5CCM A;  3QAT A;  3LOU A;  3M2U A;  1RT6 A;  1YRX A;  1WEY A;  2F3J A;  2I9S A;  1DQA A;  4DSL A;  2POK A;  2FVS A;  1EB0 A;  1WSV A;  1DTT B;  1ZOT A;  2XSF A;  3THT A;  1TK0 A;  2UXC F;  1KR4 A;  5T7L A;  3HCX A;  3DLK A;  1RHM B;  1R8H A;  4B3S J;  4N8N A;  3QNW B;  1RTI A;  1W2B R;  1VHI A;  3D0H E;  3MDF A;  1N8R T;  1S1T A;  3TAM A;  3R27 A;  1URR A;  4HLB A;  1JQG A;  2WCX A;  4ECY A;  4UOH A;  5L1K A;  5D3G B;  2XG8 A;  4O3P A;  2J9E A;  3DLJ A;  1M1K T;  4DL6 A;  1RTD B;  2BM1 A;  1IJE B;  1TL3 B;  1FJE B;  3SSS A;  5LMN J;  1S59 A;  3EVO A;  5DDQ C;  4ZPA A;  3IA0 A;  2XBP A;  3G71 S;  3QT7 A;  2DR7 A;  2PMW A;  1HR0 F;  4DCP B;  1B7Y B;  4RNM A;  2H3E B;  3Q89 A;  4FYV B;  2XMK A;  3BGU A;  1WG4 A;  2CA9 A;  2KI2 A;  2ZDP A;  1V5I B;  1SKU B;  2R2U A;  3CNQ P;  3NCR A;  2GHW A;  2CPZ A;  1CQN A;  2CPD A;  4WZQ A;  2LQ5 A;  2V8P A;  4NLT A;  3C6U A;  2J8A A;  5F8M A;  5KFL A;  2QE5 A;  2QLJ B;  2MY8 A;  3SXL A;  1X0P A;  3GJT B;  3HJV A;  4LSL B;  1BGX T;  3PDN A;  2PI5 A;  4U8Y A;  1VQL S;  4OLP A;  1VBK A;  3MTJ A;  5KT4 A;  2C2D A;  2HGN A;  3GLJ A;  3H20 A;  2E7W A;  1TKT B;  5KG4 A;  4ATN A;  2DNR A;  4CYU B;  5GAD I;  4IQM A;  3SFU A;  1JJ4 A;  2MPU A;  3Q2S C;  1SKW A;  3DYA B;  1VRT A;  2KT2 A;  5ETP A;  4BWM A;  2HLT A;  4LR8 A;  2QFJ A;  1RTH B;  4L74 A;  5DQH A;  1KS2 A;  4PG5 A;  5EX0 A;  4OZ0 A;  3HKW A;  3BQ2 A;  3O8W A;  2R8I A;  3HSZ A;  3FK4 A;  1UVN A;  1KQK A;  5HMX A;  3NKY A;  4WFA Q;  4RNF A;  3KK1 A;  1PSD A;  2KXH A;  3B6B A;  4NCB A;  2LFV A;  5JUM A;  5AE3 A;  1HQE B;  1PYO B;  2EPI A;  1C4A A;  1UET A;  2HPU A;  4TKT A;  4IFY B;  4EFA C;  4WTO B;  2BEF A;  1XIQ A;  1OYE A;  2IJF A;  1R6V A;  1TTH B;  2EBG A;  3CJ8 A;  3H5Y A;  3WHI A;  5J2M A;  4CLF A;  3BO4 A;  3TEH B;  2DR8 A;  1MU2 B;  4DSJ A;  3UDE A;  2HFN A;  3TOQ A;  3WX4 A;  1VJQ A;  5KG3 A;  4K4Z A;  2DT9 A;  2G1H A;  1LWF B;  1PJ6 A;  2JWN A;  5FDL A;  5KFU A;  4ZDN A;  2UXB J;  1YVF A;  3GR1 A;  1RHQ B;  2DGV A;  1UVI A;  1YK9 A;  4IH7 A;  1GMV A;  1NLK L;  2XMJ A;  5HMY A;  3A12 A;  1LWC A;  3I9V 9;  1W7W A;  2DR9 A;  2VPX B;  5KFW A;  4TXS A;  4AXI A;  2GAH C;  1U8S A;  4ZVQ B;  4QIW D;  2YKN A;  2UVU A;  2OFH X;  3MMC A;  3EDQ B;  5IM0 A;  3R5B A;  2I5J A;  5EX3 A;  1PCA A;  1L3S A;  5K8P A;  1GTH A;  2ZVS A;  3D68 A;  3Q0A A;  4PAA A;  2RVJ A;  3DXB A;  2HFO A;  3Q83 A;  4CLT A;  4F36 A;  4ED2 A;  1P1L A;  3IFE A;  9RUB A;  1HKA A;  3D6T B;  1U1O A;  3V6H A;  3FCW A;  4RW7 B;  1GK8 A;  5CA5 A;  1RWW B;  1FX4 A;  2RRA A;  2CPH A;  1CPZ A;  3CCM S;  1XBW A;  5HQL A;  4DV3 J;  3DGP A;  2I2Y A;  4DUY J;  1AYE A;  5L46 A;  2MHN A;  3OR1 A;  1KEK A;  4EU0 A;  4X66 F;  4MH8 A;  1ULR A;  2NRE A;  1N33 J;  2CVE A;  4MT1 A;  2B51 A;  2EKY A;  3L95 X;  3HHL B;  2KFY A;  3GV7 B;  4Z37 A;  2CPX A;  2J0S D;  4NLX A;  3IGV A;  2XYP B;  1YZ7 A;  2D69 A;  1C0T B;  3Q8V A;  3P45 B;  4IO1 A;  1EAR A;  2CNN B;  4B08 A;  1R8P A;  4N56 A;  1LFW A;  4LRC A;  1XMQ F;  5KG0 A;  1JLB A;  2VBY A;  2Y8W A;  3UE2 A;  3Q86 A;  2ZBP A;  2GVZ B;  2BM0 A;  3GE9 A;  3W2W B;  1QLN A;  1YG0 A;  1FHT A;  2A10 A;  2HNY B;  3CCJ S;  1HIY A;  1UWA A;  4LF9 J;  3HP6 A;  4EBC A;  3LP1 A;  5HO4 A;  3D6M B;  4CLL A;  4ED6 A;  1FJG J;  2K1R B;  4I2P B;  2CWK A;  1HWL A;  4LF4 F;  3GU0 A;  4ZHR A;  4LSN B;  3RAQ A;  4WU3 A;  4MTP A;  4CT8 A;  5GAG U;  1EP4 B;  4IUF A;  4ZJQ A;  5K8M A;  5GVQ A;  5KFQ A;  4ZMM A;  2HVE A;  4O4G A;  3K0J A;  4YEA A;  2CWX A;  3GYN A;  1HMV A;  2NZC A;  1WC4 A;  4YDD B;  3KHH A;  2KT5 A;  1FI4 A;  4J5O A;  3MOJ B;  3CIZ A;  5C5J A;  4ILL A;  3JXO A;  4NA3 A;  1TQL A;  3WZ0 A;  3OXL A;  2YX7 A;  1RBL A;  1V6H A;  1KTV A;  2DVI A;  2IM2 A;  2JNJ A;  1N5Q A;  3MM5 A;  5F9L A;  1ZA1 B;  3EUN A;  4KKO B;  3W66 A;  2MLZ A;  2AX0 A;  1PO6 A;  3CIM A;  3H4B A;  4DFP A;  4OJH A;  5KFY A;  5KFZ A;  4C97 A;  4B9S A;  1FKP B;  3DI6 A;  1OYD A;  1A6L A;  4X64 F;  4NI2 B;  3GJR B;  2W7P A;  5I3U B;  5AE1 A;  2Y0B B;  3RTV A;  2G0C A;  3KLI A;  2DNK A;  1E6Y B;  2XC9 A;  4TLR A;  4CTA A;  4BC9 A;  2QZ8 A;  5A8R B;  1X4D A;  3D28 A;  4KGM A;  4O3Q A;  4IRK A;  3AJD A;  3LAN A;  1OY6 A;  3GJQ B;  2K3I A;  3E01 A;  3VQS A;  3BJY A;  1S10 A;  1DLO A;  3L7U A;  1TL7 B;  2V94 A;  2F4F A;  3MEG B;  3G6Y A;  4UUW A;  4KAI A;  3GCX P;  1T94 A;  2MEW A;  5B0D A;  1HPZ B;  4UUX A;  4ED0 A;  3A8E A;  1X5O A;  3U1M A;  3H5U A;  2ZEJ A;  2CQH A;  2Q6B A;  4NZ6 A;  3CDB A;  4AFF A;  2CPF A;  2JEG A;  3HT0 A;  2GIF A;  4NML A;  3GFX A;  4TU9 A;  5MAO A;  2WVE A;  3I0R A;  1FD2 A;  2NPI A;  3LGM A;  4FXD A;  2DNL A;  3HFZ B;  1GNK A;  1S57 A;  1T3N A;  1RYS A;  2HRT A;  1QD1 A;  4ZN1 A;  3ZXW A;  3K7R A;  1HR0 J;  1Q7Y T;  2VKR A;  3TZY A;  1CJT A;  1MNE A;  4OYI A;  4IG3 B;  2B5J B;  2IIH A;  2X3D A;  3UQS A;  5DQI A;  3SFG A;  2P8I A;  4AUK A;  2H51 B;  2IFX A;  4B3R J;  3GYX B;  1ACM B;  1NZA A;  2ZBQ A;  1KQF B;  4DN0 A;  3AFG A;  1R8A A;  1L3T A;  1IWG A;  3RG6 A;  5IQQ A;  4DZD A;  2L08 A;  1N5Y A;  2EI5 A;  3RB4 A;  1T05 B;  4B9N A;  2AX1 A;  1Y00 A;  1WC3 A;  6FDR A;  2BKO A;  1TL1 B;  3MAQ A;  1IBM F;  2OP5 A;  1JLC A;  4G1Q B;  2XY7 A;  1JLF B;  3OSP A;  4EBD A;  1SC1 B;  1YJR A;  1Q16 B;  1RAO A;  2HBR B;  4Q8F A;  4TY8 B;  4Q44 A;  5KFS A;  3C6T A;  2LEP A;  3AA9 A;  1UVJ A;  4FF3 A;  5J1P A;  3AD7 C;  4F4A A;  3W8P A;  2ZH6 A;  4ES3 A;  2BAB A;  4CH7 A;  1JKH A;  1FRH A;  5C25 B;  2PN6 A;  4GKJ F;  4DL4 A;  2L9N A;  4FVM A;  2C22 A;  1S0N A;  3GFH A;  3OVA A;  3MD3 A;  1WKJ A;  1J5E J;  3SDE A;  2X3G A;  2NXE A;  1QUV A;  1U09 A;  2LU2 A;  3B54 A;  1MRO A;  2MHE A;  2W24 A;  2VDH A;  2HQC A;  4JI2 F;  3PJ9 A;  2C2R A;  4X4O A;  2DXD A;  4P2M A;  3CDW A;  2VOP A;  4H4M B;  1F2G A;  2B4P A;  2CPY A;  1DY3 A;  4MFB A;  2W9C B;  3KLF B;  5LT5 A;  4USH A;  2VJU A;  2LA4 A;  1BQN A;  3D3B J;  1S99 A;  2E1R A;  4CO4 A;  3H7H B;  5LSL A;  1VQK S;  2GML A;  4DWI A;  2OPP B;  2P9C A;  4GVL A;  2PE8 A;  1NDK A;  1VC6 A;  1S97 A;  3UD3 P;  4CO1 A;  3DRP A;  5C2C A;  4AL7 A;  2U1A A;  4C0B A;  4RNN A;  2KXF A;  4TYB A;  4U96 A;  4I6W A;  2VFS A;  1X4H A;  2F9J A;  4P72 A;  3CJ0 A;  4IRD A;  4DV0 J;  4PWD B;  1SH3 A;  2RDD A;  5F0U A;  1TL4 A;  1CSJ A;  1PBU A;  4KRW A;  1RHK B;  3HXM A;  2GO9 A;  2IPO B;  1KTQ A;  2ASD A;  1OS5 A;  2UV8 A;  1U26 A;  2HHS A;  2LVW A;  5DJB A;  2RE1 A;  4PG6 A;  4JI0 J;  1GQE A;  4B9T A;  3I5C A;  4U8V A;  3HVR A;  1KQS R;  3VGV A;  2BRK A;  5LSR A;  4I67 A;  1N32 F;  1CJK A;  5GAE U;  1HQU A;  1FNO A;  1DQ9 A;  1G4C A;  3BRE A;  4A48 A;  4XO0 A;  3X3U A;  2R2R A;  2HFS A;  5GAH I;  3U1L A;  2YNI B;  1S6P B;  4F4W A;  2V9W A;  3V4I B;  2FHJ D;  4J9K A;  4U9R A;  3MAA B;  2MKY A;  3NAH A;  4IH6 A;  1YRU A;  5C7P A;  2WK4 A;  1O0P A;  4HAC B;  4I69 A;  1JLA A;  1ZBT A;  3UO0 A;  5E3C A;  3HFK A;  3L09 A;  4NE9 C;  1W26 A;  4ICL B;  2KHC A;  4USV A;  4ZLP A;  2FJD B;  5K9F A;  3FZ2 A;  3V6D B;  2Z56 B;  3N01 A;  2AGQ A;  2J6S A;  4ZVP B;  2XS7 A;  4B3T J;  3O5T B;  3GG0 A;  3K5L A;  3C14 A;  4R25 A;  4M5N A;  5KFO A;  2QRR A;  1XR7 A;  4HEA 9;  2FUG 9;  3R9L A;  4N77 A;  2XHC A;  4WYL A;  3OXF A;  3IRX A;  1NEE A;  1LXN A;  3R1H A;  2MQL A;  1SUQ B;  1CLF A;  3BF4 A;  1NK5 A;  3W2V B;  2YKM A;  4GO5 X;  1R43 A;  3IR5 B;  2WON B;  1VRU A;  5KG2 A;  1C2P A;  1FE4 A;  4WP9 A;  4DUZ J;  4Q7A A;  3I0S A;  2GJF A;  1NK9 A;  4DCO B;  4P6Q A;  3ZZT A;  3DU6 A;  3MM8 A;  5IWA F;  3FEX B;  3B82 A;  1S77 D;  5CAB A;  1NJZ A;  2JZ5 A;  2RT3 A;  2Y1L B;  3P8B B;  2E66 A;  1D8Z A;  2HG4 A;  2DEI A;  4TYA A;  4WFZ A;  3MCS A;  3THP A;  1RTD A;  4DR5 F;  2M8D B;  5KG5 A;  3GSI A;  3OT9 A;  2ZKU A;  3MZI A;  5HVG A;  4DQR A;  1FRK A;  4K0K F;  1GH8 A;  4WZM A;  1M5O C;  5DDO C;  3CJ3 A;  1U49 A;  2JVO A;  2WZ1 A;  3CE8 A;  1TEL A;  2VKZ G;  4ZJO A;  3V81 A;  2DNM A;  4CNY A;  4NA1 A;  4NLW A;  1APS A;  4AL6 A;  3W64 A;  5J2N B;  3FKB A;  1HBU A;  2AEF A;  2JL9 A;  1FKO A;  4A4J A;  3EXY A;  3SQG B;  3O44 A;  1HI8 A;  1GT8 A;  5KOX A;  3JSM B;  2KRB A;  3UW1 A;  1XTZ A;  4QWA A;  5HQM A;  4EZ9 A;  2UV8 G;  2DRA A;  3FEY B;  3UDV A;  1JLQ A;  3QO9 A;  2AGO A;  2MB0 B;  1QAY A;  2IRY A;  2RAQ A;  2WBR A;  1FVQ A;  4ETZ A;  2DNO A;  3RBX A;  4J9P A;  1GXU A;  3UVJ A;  3WIV A;  3M8Q A;  1SXL A;  2IA6 A;  1Z1Z A;  4EWT A;  1BC6 A;  1CJV B;  3H40 A;  3MXH P;  4N8O A;  1OY8 A;  4OZN A;  5G4D A;  1JJ2 R;  1KOO A;  1NJI T;  2CDQ A;  2IRX A;  4JI7 F;  1ICE B;  1PJ7 A;  2ZH3 A;  4L73 A;  5F8I A;  4ZLN A;  2J0Q D;  1C1B B;  4ZIW A;  2EFO A;  2CPI A;  3I32 A;  3MED B;  4OX6 A;  3ZZR A;  3KHL A;  4DL7 A;  3V6J A;  2OAU A;  3FJ2 A;  3BQ1 A;  2J9D E;  3MR6 A;  4OI0 A;  5LMU F;  1UVL A;  4B9U A;  4XK8 C;  2XYG B;  2V67 A;  1TKX A;  1ZAV A;  1MLA A;  2G9O A;  4LRD A;  3G4S S;  4Z2X A;  1RWP B;  2BRL A;  1IVZ A;  1LWF A;  3QT8 A;  2MJN A;  4PKD B;  3IG1 B;  4K4X A;  5B09 A;  1DJ0 A;  1S1X A;  2DCL A;  4M5G A;  4TU8 A;  2R2T A;  4QZV B;  4C8Z A;  2XY6 A;  4ZCI A;  2DGQ A;  1OO0 B;  1HYS A;  2LEA A;  4KH0 B;  3TP2 A;  4ZPT R;  2YX1 A;  4JI8 F;  4NX9 A;  1FNX H;  2VD3 A;  1SV5 B;  5ETT A;  3HLU A;  3EGV A;  2AYE A;  5KOW A;  4UY8 5;  3DMJ B;  2B8P A;  3KMS A;  4CH1 A;  1UMJ A;  3SYZ A;  2FB0 A;  4IYQ A;  3KJV A;  1U8W A;  3IR6 B;  2DPJ A;  1N6Q A;  4B9L A;  2K06 A;  2HQ3 A;  2QEX S;  2VFV A;  4LF5 F;  1U2C A;  2Q66 A;  4RW7 A;  2H9Z A;  1D9F A;  3RB6 A;  3GZ7 A;  1R89 A;  1LNQ A;  5HQ8 A;  4K4Y A;  4DL5 A;  2H65 B;  5F8G A;  1VQN S;  3N9U C;  2MLY A;  4RU2 A;  2HWI A;  3UFC X;  3FMB A;  1QJH A;  3L3C A;  2CNO B;  4QU6 A;  2V5H G;  2QA1 A;  3BDE A;  3R6G B;  2X51 A;  3HHL A;  2FZK B;  3TAN A;  3DM2 B;  1ZYQ A;  3NRB A;  1RQ0 A;  4ZS6 A;  2EC2 A;  2LLZ A;  2XLI A;  3EIC A;  4DR4 F;  5ETR A;  1R31 A;  2AWZ A;  4ECZ A;  3C2P A;  3BKF A;  2NXU A;  3DFE A;  3IR7 B;  1S9E B;  1M90 T;  2PEB A;  2GIQ A;  4FBU A;  3CCS S;  1TP7 A;  3HM9 A;  4BWJ A;  5KFM A;  5DGA A;  4RUH A;  4NLP A;  1SKR A;  1N5S A;  1FRI A;  4XIU A;  2EKN A;  2Z2M A;  3O2I A;  2BAN A;  1WF0 A;  1ZPV A;  4QWE A;  1RHJ B;  3HF5 A;  4ECX A;  3EXC X;  2ZH7 A;  2XNQ A;  5B0B A;  3LAL A;  1UFK A;  2IJN A;  3T5L A;  3EGW B;  2V34 A;  4YDX A;  1H7W A;  1S6Q A;  2HWT A;  1FE0 A;  2K1R A;  4I2P A;  3VTI A;  4CH0 S;  1WHY A;  2FVQ A;  4F2R A;  1BLU A;  3I56 S;  1RT7 B;  1RE1 B;  4ZVT B;  5D77 A;  2B4V A;  1N32 J;  2VU5 A;  3NAI A;  4C11 B;  3KJQ B;  3CED A;  1EZZ B;  2QL5 B;  3ZFV A;  1RT5 A;  4BS2 A;  1M5V C;  4ZPD A;  5I42 A;  1Y11 A;  3LPE A;  3CUL A;  3ZZO A;  2L41 A;  1DTQ B;  2YNF B;  1KHV A;  5KT3 A;  3MPW A;  4JUZ A;  2GO8 A;  2BJD A;  4X4U A;  2N4C A;  3PW2 A;  4URS A;  2FJX A;  3OTC A;  1ZTW A;  4K4W A;  5A0Y A;  3J81 j;  4CRJ A;  3R5D A;  1EET A;  2ILY A;  5H9F J;  1FTC A;  4KKO A;  1SQG A;  5AE2 A;  4DX6 A;  3G82 B;  2C2N A;  3KLG B;  1EX8 A;  3K57 A;  3JSY A;  2W2P P;  1VI7 A;  2AKW B;  1RWO B;  4ED7 A;  3POT A;  1RLC L;  2RDJ A;  3DN9 A;  1RTJ B;  4KJI A;  4NLR A;  3PAC A;  5I3U A;  1AB8 A;  4F26 A;  2W2N P;  3OL6 A;  3HK2 A;  2HQI A;  2M3D A;  1BQX A;  4OX9 F;  1JNZ B;  2RRN A;  3NMA A;  2C42 A;  5FII A;  1U48 A;  2VQE J;  2HND B;  5CYM A;  5A6W A;  5LL6 d;  3TYT A;  3CJT A;  4R0E A;  1QE1 A;  2OD6 A;  2MZJ A;  4P71 A;  2YWF A;  3UNY A;  5DO2 A;  3KLH B;  3NY0 A;  1TL7 A;  1RAG B;  2K7K A;  2GAG C;  4AQY F;  1KN6 A;  4OZ5 A;  3OFH A;  1SJ1 A;  3TA1 A;  4NLY A;  5AJ3 F;  1N52 B;  1N5V A;  1B99 A;  1WUU A;  3ENW A;  1AUD A;  4M95 A;  5E2Q A;  2I1R A;  1X9M A;  2BJE A;  1VR6 A;  1N4L A;  3DOM A;  3QRP A;  1E6V A;  1XR6 A;  4DR2 J;  3J7Y U;  2RHS B;  4KHP J;  4QW8 A;  3EE3 A;  1UFW A;  1RHU B;  3JQM A;  2GIR A;  2K3K A;  5HVF A;  4OI4 A;  4BBY A;  5L8R C;  1RT1 A;  2R4F A;  1CG2 A;  3TJ9 A;  2HQF A;  1B3T A;  4OQJ A;  4LIW A;  3B8H A;  1AXQ A;  3G9C A;  4RNH A;  1NBE B;  2J5A A;  3M8Y A;  4UQT A;  2JFK A;  1HWJ A;  2W2O P;  5G0R A;  1G3O A;  4MKY A;  2B5J A;  2IBO A;  2Z57 B;  3TWZ A;  5GMK a;  2KG0 A;  3OVS A;  3DOL B;  1DHM A;  2KZM A;  3MM9 A;  4GC7 A;  2WSF C;  4PXB A;  3AAW B;  5FLX Y;  1IKY A;  2VA2 A;  1ARO P;  1FXR A;  1RAD B;  1S12 A;  1NK0 A;  1RCO B;  2XGQ A;  3B4D A;  2UP1 A;  2ZH9 A;  2DIV A;  3HHE A;  2XUL A;  2UXD F;  2AJ1 A;  1SCJ B;  2E1A A;  3CJ4 A;  1BD6 A;  3NS6 A;  5ITH A;  1UEK A;  3JB9 k;  2ZBC A;  1VHF A;  2OSR A;  1Q8I A;  3SIP B;  4DPX A;  3QJP A;  4C8M A;  1TL1 A;  2HVI A;  1Q7L B;  3AJ2 A;  3NS5 A;  2AEJ A;  2JVR A;  4FKY A;  1F6T A;  3OXG A;  3ZNJ 1;  4ZLJ A;  3ET6 B;  4USJ C;  3TAR A;  1G6B A;  1K1S A;  2XWX A;  1UW9 A;  4M5D A;  4RJV A;  2VPW B;  3RGI A;  1WHV A;  3L7P A;  2Z58 B;  4NLG A;  4UT4 A;  2KJW A;  3TI0 A;  4JI7 J;  1KLM A;  4IOA Q;  4XAK A;  2UUB F;  1YJ9 S;  1PIE A;  4R5P B;  4IRC A;  3ILL A;  5HP1 A;  1ROF A;  1UL3 A;  2MYF A;  1Q82 T;  2CG8 A;  2WAQ D;  4P10 A;  1VC5 A;  1I5O B;  1D9A A;  1Q79 A;  1WOR A;  1FWL A;  1SJ4 P;  5CD4 A;  5KT5 A;  4Y2M A;  3M8W A;  2HHW A;  4J7C A;  3TJA A;  2NLW A;  3CJK A;  2WVF A;  3JTP A;  3BDP A;  1T03 A;  3OR2 A;  4OIX A;  1VK3 A;  4OYB A;  2ZC4 A;  2QSF A;  3KYL A;  4X4V A;  2GFF A;  4MKA A;  2AJ0 A;  4ID5 B;  3PW5 A;  3GR0 A;  1UJ4 A;  1HBM A;  3H0P A;  2Z30 B;  3HDS A;  2D3O 1;  2UUA F;  1FWK A;  2IRU A;  4PXD A;  1WTB A;  3G6V A;  3RBD A;  4C4W A;  1BQM A;  3DNC A;  1HL6 A;  1FWP A;  2D9O A;  2VG5 B;  5T14 A;  5IFM A;  2QL7 B;  3MM6 A;  5KFJ A;  3KFW X;  1SB6 A;  1TKZ B;  1GMW D;  4G65 A;  2R7O A;  1HI0 P;  4JI8 J;  3NGU A;  2CAD A;  2AD9 A;  1I94 J;  3OD2 A;  3DRR B;  2X1G A;  2F1F A;  3G8Q A;  4X65 F;  3MFH A;  2PA3 A;  3P96 A;  4RKU C;  2FQQ B;  1F5A A;  2BJ3 A;  2B9X A;  1WHW A;  1TU0 B;  1IKX A;  4B02 A;  1SBR A;  4LFB F;  2EWH A;  3FFI B;  4LF5 J;  4C8O A;  4DF8 A;  3CD6 S;  3CXC R;  3NEK A;  5E3P A;  2VG6 B;  1S9G B;  1S7H A;  4ED3 A;  4HTJ A;  4TY9 A;  4OJG A;  4YY3 J;  2MDA A;  3A8I A;  4NZ0 A;  3QZ7 A;  4X4R A;  2ZH4 A;  3OLA A;  4AYB D;  1WKK A;  4HAC A;  4HL9 A;  3CME S;  3TNV A;  4FS1 A;  2V4J A;  4O44 B;  4HYK A;  5B7W A;  4DV4 F;  3ISN C;  3MR2 A;  1RZM A;  2K2P A;  4KSE B;  4Q8E A;  1HW8 A;  4JI6 F;  1IBK J;  3LH2 S;  4YR3 A;  5CD4 H;  4UZB A;  3J7Z 5;  1LWE A;  3MMB B;  1YJV A;  3PIO Q;  4HDH A;  3Q2T C;  4DV5 J;  3TW0 A;  4LVN P;  4KTQ A;  3T5H A;  3D7S B;  3CD5 A;  2M2B A;  3EZU A;  1RT2 A;  2IVY A;  3OUY A;  3S6E A;  1SUQ A;  3HX9 A;  2HFU A;  2YWK A;  3CCQ S;  2LXF A;  4X4Q A;  2WON A;  1IR0 A;  7FDR A;  2M0G B;  5J2Q A;  3I4H X;  1WSR A;  1RWM B;  3KK2 A;  4QIG A;  1YJW S;  4G3I A;  1T9X A;  1OSD A;  3TX0 A;  2N7C A;  2HNZ B;  4KV8 B;  2ASJ A;  3D1Q A;  2PC6 A;  3TEG A;  4DPW A;  3G8S A;  1N34 J;  4C7Q A;  1C1C B;  1Y3J A;  1SJQ A;  2YNG B;  4LF7 J;  1YWX A;  3PTW A;  2B4U A;  1NDL A;  1TR0 A;  3HMJ G;  2DGW A;  3RAM A;  5F41 A;  2J6U A;  3VV2 B;  4RLE A;  4KFB B;  1HNV B;  3ZTQ A;  2Y1I A;  1UTA A;  3P49 B;  2DHS A;  2WVC A;  2FVP A;  3MGJ A;  4F4K A;  3PR5 B;  2J9D A;  3X1L B;  1FD8 A;  2ZFH A;  1YI2 S;  3NGK A;  3MMA B;  2EEY A;  2DTJ A;  1SC6 A;  5AT1 B;  4X84 A;  1TVR A;  3ISZ A;  4LQ9 A;  2HFV A;  4EMD A;  5HBM B;  5J2N A;  1RT4 B;  3GP9 A;  1D0E A;  3PM9 A;  2KVI A;  1HQ2 A;  5H9E J;  2PFD A;  2BKN A;  1QUP A;  2R8J A;  2ZZN A;  4ETX A;  1U02 A;  5D0R A;  1TFW A;  1B0T A;  1PAE X;  4JBC A;  4X2B A;  1QVF R;  1X9W A;  4F50 A;  3RR8 A;  4IG0 B;  1WEZ A;  4N5S A;  1VFJ A;  2HQG A;  1LK5 A;  4M8L A;  1IBL F;  5CYQ A;  1LW0 A;  3BKU A;  3D1H A;  4CZC A;  1H0H B;  1PC4 A;  2VG7 A;  1HBN B;  3G6X A;  2FDN A;  2C1E B;  4K4U A;  5E5N A;  1N36 F;  4ERD A;  4DV1 F;  4WXW A;  2M88 A;  1JXL A;  4DLG A;  5BXI A;  1GMW A;  1IKV A;  4PWW A;  2CXE A;  4LBP A;  1VDH A;  1HBO B;  3BV8 A;  1YX2 A;  2HMI B;  3QID A;  1JLG A;  2J7W A;  1RJJ A;  2IM3 A;  2YQ0 A;  1U0H B;  2VOO A;  2NYH A;  1GMU A;  3R7B B;  4HT7 A;  4EBE A;  2R7W A;  2YH0 A;  3EGZ A;  2P9G A;  1LW2 B;  2MQM A;  3T3F A;  2NR0 A;  3GB0 A;  3VF0 B;  5U47 A;  2CJA A;  4U67 Q;  3RYL A;  3K89 A;  2RSQ A;  3WX8 A;  4N41 A;  4D3H A;  4ZJL A;  3KNA A;  5D4L A;  4RW4 B;  4MIW A;  1CQM A;  5HL7 Q;  3FBE A;  4WE1 A;  4B3S F;  4Y2I A;  2HYI B;  1TV6 A;  2YNH B;  4RNO A;  4Y28 C;  3KK3 A;  4NEY A;  4ZPW R;  5L1J A;  3C8Y A;  3D2W A;  3AOB A;  1YGY A;  1RWU A;  2VJV A;  4O4R A;  3MCN A;  5LMN F;  2YQ3 A;  4NLO A;  5J1N A;  1PC5 A;  4IR1 A;  4F3M A;  3HSJ A;  1EQM A;  2F4V F;  1P9Q C;  4LF2 A;  5KFG A;  1CS4 A;  4Q0B A;  2IHR 1;  2BOA A;  2R7S A;  2XQC A;  2VH7 A;  4RW6 B;  2I6W A;  2ILZ A;  3DMJ A;  3ITH B;  1A9N B;  1KQG B;  3W63 A;  2C2M B;  3DRY A;  1RI7 A;  3M32 B;  4ER8 A;  1FJC A;  2COL A;  2GQQ A;  2GV1 A;  4RX6 A;  2UUB J;  3CD7 A;  4LR7 A;  2CQ4 A;  4L3N A;  4KGV B;  1OSC A;  1KNZ A;  1BUX A;  2Q6C A;  1R0A A;  1T3O A;  2FY8 A;  2C28 A;  3OBI A;  2O67 A;  4H4O B;  4Y2C A;  1PGZ A;  1DQ8 A;  2YQ1 A;  4ZPB A;  1AZS A;  2ZWP A;  3RU0 A;  1IQT A;  4UOF A;  3F0N A;  3EVM A;  4NLU A;  1UCN A;  4EYH B;  4JI5 J;  2RS8 A;  3RB3 A;  3BGO P;  3DLE A;  2V4R A;  4UOC A;  1FK9 B;  4USU A;  2KL8 A;  3QWP A;  2MGZ A;  3CDE A;  8ATC B;  1Q4R A;  3H59 A;  2A2C A;  3D0I E;  4PCQ A;  2MKC A;  4GVB B;  4HH1 A;  2R2S A;  1Y3K A;  1TUG B;  5F3T A;  3M2V A;  4ZKA A;  3JTN A;  1JK9 B;  1B4S A;  2RUS A;  3L7O A;  5DET A;  1DUR A;  2E5L F;  2YTC A;  1TK5 A;  4TVA B;  2UUC J;  3KG1 A;  1IWA A;  3HZG A;  1IKW A;  1P1T A;  2ZD1 A;  2IVF B;  2CDR B;  2DHX A;  1J5O A;  5K5M A;  5M2P A;  1HNI A;  1T9U A;  4Y2K A;  1UA1 A;  4RW8 B;  1F9H A;  1ZH5 A;  2CQI A;  2YH1 A;  2CJK A;  3MPU B;  3NGD A;  1FO1 A;  1UZD A;  2J76 E;  2V2K A;  3A8K A;  2DKO B;  2YVS A;  2UXB F;  1L3U A;  2IC3 A;  3PX0 A;  2WTF A;  4PPD A;  1HI1 A;  2HIY A;  2DNY A;  2CPJ A;  3LP2 B;  5DM6 Q;  1ZAX A;  1ZM3 A;  5F8H A;  4WFX A;  3QMQ A;  4FKX A;  3EJM A;  3BSO A;  4OYW A;  4ID8 A;  2ERR A;  8RUC A;  1WEL A;  1NU4 A;  2E1C A;  3FSI A;  3HUL A;  2Z2Z A;  2OPR A;  3FGV A;  4QWD A;  3P5B P;  1F5B A;  3I87 A;  1RTJ A;  5HLF A;  2W01 A;  3QBC A;  1HNZ J;  1SQF A;  4HR2 A;  2JC1 A;  3M7V A;  3H2V E;  4KGK A;  2GHV C;  2JSX A;  2HHU A;  2YBV A;  1ELO A;  3H2L A;  4B3M J;  4A8X A;  1M5P C;  2YWW A;  5GAH U;  4QR1 A;  1RXO B;  3IWN C;  4ILM A;  2Q1L A;  2HRY A;  2RQK A;  4DV3 F;  2L9D A;  4DUY F;  4ZIV A;  2HND A;  4Y34 A;  1F3V A;  5CXT A;  3SCL E;  2CAJ A;  5ETS A;  1N33 F;  3KLH A;  4P2X A;  3QYY A;  5E3A A;  3MR7 A;  1T11 A;  3MEC A;  1S1W B;  3I6P A;  2WOM B;  2HVZ A;  1MSW D;  3DGV A;  2VL1 A;  3KKF A;  2RKI A;  4DG1 B;  2XMV A;  4ZOS A;  1NK6 A;  4N7T A;  4Y00 A;  3VAJ A;  1YIT S;  3PYG A;  3K5P A;  1CUL A;  3LO3 A;  3DHX A;  1W2I A;  4C98 A;  4NYP A;  1CVJ A;  3MI7 X;  2XSJ A;  1VCT A;  3TAP A;  3TAQ A;  3G96 A;  3AB2 B;  3GSD A;  3EDR B;  4K2X A;  2DNN A;  4CWB A;  4LF9 F;  2V8G A;  1K0T A;  2D74 B;  2AU0 A;  4DL0 C;  1FJG F;  3VGS A;  4KGX B;  4Q5V A;  1SIZ A;  2GMJ A;  3NG8 A;  5M2R A;  3AB4 B;  3LPY A;  5SUH A;  4ANE A;  3JQJ A;  1SJR A;  3CD0 A;  2BZ2 A;  2LU1 A;  5DLG A;  4WF9 Q;  3EX7 B;  3DOK B;  3BBB A;  2FHK A;  1T0T V;  4DXL A;  2OEL A;  1X0F A;  2WVD A;  4JP8 A;  1IJF B;  3JQK A;  3D1O A;  2HAI A;  1U1K A;  4W90 B;  2O01 C;  4ZVU B;  4OYA A;  3QT6 A;  1X4B A;  1FER A;  3K59 A;  3CMA S;  1YJ7 A;  4DR1 J;  1IBL J;  4J9V A;  4KE5 A;  2QX0 A;  2R7U A;  2RRB A;  2OEJ A;  3V4M A;  5DDR C;  1S72 S;  1U47 A;  3DLG B;  2BJ7 A;  3ET6 A;  3BM7 A;  2XM3 A;  2VZ9 A;  1AFJ A;  5KFK A;  2NXN A;  4V1A k;  1XJW B;  1VQS A;  1IN0 A;  4C6A A;  5IXU A;  1N54 B;  1NH7 A;  2Z2L A;  4F3O A;  4O3R A;  1RT3 B;  2IY5 B;  2ZBI A;  3RBE A;  2YKA A;  3MMJ A;  3CC7 S;  1J27 A;  3OFG A;  4C8N A;  3DRS B;  3MWB A;  3PG9 A;  2R42 A;  1NKC A;  4FXW A;  5A6P A;  3I4P A;  1WHX A;  3KLE A;  4CLS A;  2KO1 A;  3N6N A;  2OPS B;  4LIR A;  1J2V A;  2MQO A;  4MIA A;  1BE4 A;  4KPY A;  3DXS X;  3BGR B;  3QIP B;  4XTT A;  2LEB A;  4C8K A;  3K5O A;  3SCK E;  1MML A;  3MUR P;  4DCJ B;  4NLQ A;  4A46 A;  3M2R B;  4ED5 A;  2MZT A;  5A8W B;  3ZZY A;  2O5D A;  3OFF A;  1UJ5 A;  3AD9 C;  1TKZ A;  2F4V J;  2ASL A;  3EZ5 A;  2GGP B;  2DEJ A;  1SC4 B;  2Y1J A;  2J7K A;  2XS5 A;  2P6T A;  2V4Q A;  1TUW A;  2F9D A;  2FY1 A;  2B9W A;  3MUT P;  2HS4 A;  2QV6 A;  3QQC D;  3M2U B;  1RT6 B;  1H74 A;  2DNZ A;  1JMT A;  5KAK A;  4B3R F;  4FP9 A;  4F0M A;  5F8J A;  4AT1 B;  1DFD A;  3VZI A;  1XK8 A;  3VAG A;  5DM7 Q;  5T7L B;  3DLK B;  2QA4 S;  4Z7Y A;  2QSW A;  4PQU B;  1RTI B;  2ZUG A;  3F56 A;  2DO0 A;  2AW0 A;  2RS2 A;  3N5B A;  3Q8Q B;  2BE2 A;  1S9G A;  1FRX A;  1S1T B;  4UZC A;  1KWM A;  2QA2 A;  3TAM B;  5IV3 A;  4AND A;  4RR5 A;  1YBU A;  5HAO A;  3V5R A;  2OGU A;  1X5T A;  2QYG A;  4QYZ K;  5F8L A;  2QLX A;  5AXM A;  2DIT A;  1WI6 A;  5DG8 A;  1RKJ A;  1NUE A;  2W9B B;  4HDG A;  2EFP A;  4QWB A;  3LGN A;  2W2M P;  1VOM A;  1ZA2 B;  2YWE A;  1SKS A;  2ZOM A;  3MMB A;  2Z0G A;  3LUY A;  4DSI A;  4RPF A;  1UVK A;  4NYO A;  1J5E F;  3J81 Y;  2E5L J;  3C6U B;  1NK4 A;  2ZNZ A;  1AA1 B;  5BJR A;  2VA3 A;  2V6A A;  4DPT A;  1NHV A;  3FEZ A;  2HZC A;  3GII A;  4C2M A;  4ZP7 A;  4ECR A;  3PYD A;  2DB1 A;  5KFE A;  3Q8R B;  4F2S A;  2XMM A;  4NEZ A;  3KUE A;  1FJ7 A;  4CP5 A;  3UPF A;  2ALY B;  2CNL B;  4JI4 F;  1VRT B;  3DCA A;  4JV5 F;  1JX4 A;  3E3X A;  1H2T Z;  4DX5 A;  4NXN J;  3Q8S B;  3TZZ A;  4ZVO B;  4ZP9 A;  2CVI A;  4NA2 A;  5IC6 B;  3BN7 A;  2FLN A;  1VJW A;  4E2F B;  3PJW A;  1H98 A;  1VIO A;  1XR5 A;  3A1Y G;  1IR1 A;  3KK1 B;  1C4C A;  2B0G A;  1Y5N B;  1VBY A;  4I6Y A;  4DR6 J;  5D4P A;  4OFZ A;  2CJY B;  4NXM J;  2KB2 A;  2H5I B;  4DV0 F;  1V3Z A;  2M4M A;  2HGM A;  2VON A;  3R1L A;  5H9E K;  4KFB A;  4XDD A;  2OPQ A;  1KSP A;  2KRR A;  2APO A;  5IS2 A;  3NS7 B;  2QYC A;  5C42 A;  4JI0 F;  4V19 X;  5J2M B;  5J1E A;  2AYB A;  3GQC A;  4WKY A;  4AL5 A;  2RUG A;  3OQ2 A;  3ENQ A;  2XWY A;  3S8S A;  2KZZ A;  5HBM A;  1RB0 A;  2X1A A;  1RAC B;  3QJJ A;  2DD8 S;  2MST A;  2DNH A;  5FDL B;  4YFU A;  1I6J A;  4K4S A;  3NGR A;  2Z2Y B;  1Z2L A;  1HLW A;  2ZUA A;  2W2Q P;  1SVD A;  1N56 A;  2C2E A;  2QT7 A;  1WOO A;  1L3K A;  3K2Y A;  1LWC B;  2HBZ B;  4A8K A;  5JXS A;  4F02 A;  1I3O B;  1M5S A;  2YKN B;  4JI1 F;  2HHP A;  3MMC B;  4X4S A;  1S1V B;  5IM0 B;  2I5J B;  3QRR A;  2DIS A;  2QMW A;  3DHW C;  2XLJ A;  1OIA A;  2IAJ A;  4B3T F;  2OEM A;  3HFV A;  3N0V A;  4MIB A;  4LJM A;  3GV5 B;  1YTY A;  1QSL A;  4NYZ A;  4OZ3 A;  1HBO A;  5CZV A;  3R5J B;  5CZX A;  4NCG A;  4DPU A;  1PJ5 A;  1Z2Z A;  4KYZ A;  4D3G A;  4NMX A;  1OQ3 A;  2QC3 A;  4A8S A;  1U24 A;  2ZOF A;  4M63 A;  3UDC A;  4U7C A;  1NK7 A;  4M5K A;  3PW0 A;  5LOQ A;  4X4N A;  4CLW A;  3T6B A;  2CQ1 A;  4DSE A;  3OR1 B;  4DUZ F;  4I2Q A;  3G86 A;  2K7J A;  4NRU A;  3OL9 A;  2AEM A;  1H72 C;  3CPW R;  3W9I A;  3EPG A;  2QN6 B;  3OV7 A;  1FX2 A;  3M8P B;  1Q81 T;  1XWL A;  5I4M A;  3R7N B;  4C0O C;  2XLK A;  2NS1 B;  4CO0 A;  1X4F A;  3CGI A;  2AJQ A;  1X4G A;  4RW9 B;  1S48 A;  5BYQ A;  2A6M A;  3KUG A;  1T9Y A;  2DGS A;  1PG5 B;  1Q53 A;  2LDI A;  4P9S A;  3GON A;  3PVX A;  4MYT A;  2CQ2 A;  1N5T A; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...