1F2HA

Solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
169
structure length
169
Chain Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
publication title Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 35
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f2hA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
1M1KT 2MQOA 2ILYA 2OEKA 3MFIA 3M32B 4ZA1A 3G71S 4DBQA 1W25A 4DV4J 5DDRC 1PKUA 4XDDA 3EXYA 4DF8A 2DHHA 1FI4A 3R5AA 2W2PP 2BX6A 2HQGA 4U8VA 1KNZA 1CJUB 2GAGC 3B54A 2BVZA 2DK2A 3TZXA 1H2UX 2XLIA 2FVCA 1XMBA 3IAS9 1WG4A 2AZ3A 1C2PA 2VBXA 1TL7B 2XY7A 2V63A 1S1UB 2OPQB 4W98A 1M5SA 5D8HB 4I6YA 4Y00A 4C8ZA 1LFWA 3AA8A 4KTQA 4Q44A 1NUEA 4ELUA 1UWBB 2RRNA 4AQYJ 3CIMA 3BBCA 4ZVHA 2B8PA 1RDRA 3SSRA 4RKUC 5HP1A 3W9IA 1Y5NB 2ZNYA 3ISND 2KI2A 2OTLS 4UZBA 2YNFB 2JOQA 3RRKA 2DNNA 4DQPA 1HMVB 2J9DE 5K5MA 2AU0A 1NHKL 5HL7Q 1Q95G 1NHUA 4B3RF 4E8UA 1F2HA 2MQ8A 2UUWA 2FLLA 4DG1B 3MAHA 2YWGA 3MM9B 3MUMP 3PM9A 4F4KA 2HWTA 1RYSA 5A2QY 4ZLJA 3KK2B 4DQIA 1T8EA 2MQQA 1GXUA 4F2RA 4RR5A 1PSDA 1HW8A 3CJ5A 1S6PB 1GH8A 2M7SA 5HI7A 4KBIA 3OD2A 3MFHA 1VC5A 1PBUA 2F4FA 1T02A 3GV7B 4Y0FA 1FRKA 5K8PA 3BO3A 2R7SA 4EZ9A 3A12A 3US5A 2KU7A 4GVBB 3A1YG 2BJ8A 3ZZ0A 5F0WA 1YK9A 1SJQA 5E3AA 5B08A 3D9BA 4O4RA 2JEGA 4N56A 2G2YA 4ID5B 3OTEA 4PXBA 1NPKA 2IA6A 1FWPA 1GTHA 2KTQA 1U0SA 3PO4A 2AV5A 3J7ZT 1UFWA 2E9ZA 4WZMA 4B02A 1DTTB 1IKYA 4WBFA 1RAAB 4RW7B 5MLCV 2CPDA 1S1XA 1CLFA 3BO4A 4EK2A 4YS2A 1SPBP 4LFAJ 2ZBPA 2L41A 4IR1A 4DN0A 2CQIA 5J2QB 3EUNA 3JQKA 2RQCA 4IOCQ 4I2PB 5KFKA 3SFUA 2E1MC 2CNOB 5A8WB 1LXJA 2KZZA 5L38A 4LQ3A 5JXSA 3NGDA 1U1OA 4KB7A 4NA1A 2FC8A 3U27A 5IT0A 3CCWA 2QTWA 2YKOA 3TQEA 2VDHA 2ZC3A 3HSJA 5LM7E 4EU0A 1RAIB 1X4HA 3OL7A 4DSLA 1RBOB 2XWYA 4IKAA 2MPUA 4WP3A 2QG9B 1PGZA 1DFDA 2BQ3A 2ZJPQ 8RUCA 4YEAA 1XEZA 2XZTB 2VFVA 1B0PA 2ILZA 2ZVSA 3M6XA 1GK8A 2DHSA 4DXLA 2RH3A 3MCNA 1KD1T 4QIEA 3NP5A 2DR5A 4A8FA 1QTNB 1RWNB 2JDJA 4RW6B 2GO8A 1NZ8A 1FK9A 4QYRA 1V3RA 2OGUA 3CVKA 5EWGA 5A8RB 1HBMA 4RWWA 5HSPA 1OY8A 2O67A 2Z2LA 2HNYA 1UEVA 3QWUA 3HSZA 4R0EA 4OV1A 3MD3A 1N5TA 4FF3A 3O8WA 5CAAA 4Q5VA 2FHMA 1B4SA 1JB0C 4FYWB 4OZ3A 4I67A 3P6YC 1JLCA 1N5YB 1UA1A 1RAOA 2XB2D 1PJ6A 5HVFA 4M95A 4XO0A 5F8MA 3D68A 3C6TA 2VF3A 2W1BA 3OBIA 3IP0A 2XWXA 1FWLA 4CP5A 1JXLA 2LQ5A 3OSPA 2QA2A 3DLJA 5DZ7A 2BMBA 2X1BA 2M9KA 1FX2A 2H9ZA 2BJ3A 4HI1A 5D3GA 3DN9A 2BANB 2CJXB 3DOLA 2EWHA 5KT3A 4C8YA 3LF0A 1HNVA 1HHTP 1RSCA 2K7KA 3SBMA 4JI2J 2YNGB 3DMJB 4GKJF 2KM8B 1UVJA 1VQKS 3MMJA 5F3ZA 1NK6A 1XBWA 4TU7A 1VQLS 3K57A 2GZOA 1VK3A 4I56A 1ACMB 4R0JA 5KOWA 4JP8A 3AOCA 2HHHJ 4J9NA 4YFUA 1JK9B 1X4GA 4IG3B 2GQCA 4JI5J 2W7PA 2H5EA 2JFKA 2Z57B 3MAQA 1HWUA 2L3MA 5I3PA 2XMMA 2XCAA 5KFBA 2EPIA 1KWMA 4Z2XA 1WC4A 4MKBA 2B8QA 1JJ2R 4O4GA 1XTZA 3BR8A 1IWAA 2IRXA 2HBYB 4TLRA 3DDKA 4C3LA 4U7UD 4U67Q 3GYGA 1XNQJ 3QIDA 4ZPTR 2H5JB 4QYZJ 5T7LB 2YVSA 5KFTA 2BW2A 4BC9A 1S6QA 4C3KA 2WSCC 9ATCB 1MMLA 3JTOA 5C24B 2R7OA 2XZDB 1TKTA 3L7PA 3TUZC 1IWGA 5KFVA 1VHIA 2NXNA 2L9WA 1UAWA 3KLGA 2DGQA 1M5VC 3S01A 5C25A 2HYIB 1I3OB 4K4VA 2QMUB 2EC0A 1IKXB 1XMQF 4C97A 4P6QA 5F8GA 4JB8B 2QFJA 1VQ5S 3SQGA 5AT1B 2E5HA 2DISA 2UXDF 3E2EA 3ZFVA 2RDDA 3T5LA 3IRWP 4PWDA 4GKKF 5E5NA 1VYAA 3EPGA 4K4YA 1EIYB 3G87A 4U95A 4OV6A 4DV7F 3KHHA 3EYZA 2J9DA 2KG1A 3MAAA 2GO9A 2GC8A 3MM8B 4Y2CA 4I2QA 4Y6IA 5J2PB 2I1RA 2VFTA 4P2FA 3AJ2A 1KSPA 1IQTA 1NK4A 5DQHA 1X7VA 2J7UA 2LFVA 2Z2ZA 2MDAA 3SCIE 1SJFA 1RAEB 3TZWA 3AQPA 4M5LA 5ETRA 2Y1RI 1ULRA 2LDYA 2X7IA 2X51A 3HI9A 3TZZA 4NCAA 3ET6B 5I42A 1XQIA 1YZ7A 3MHYA 5K20B 1IBLF 5LMUF 2U2FA 1K8AT 4ZN1A 1WTFA 2V4RA 2EKNA 1VQMS 3MEEA 4ILRA 2BABA 1J27A 2IC3A 2PGCA 3MECA 4C9DA 2VUGA 4X62F 3IWNC 1WKKA 4MIBA 2F40A 1VIOA 1QY7A 3G96A 4YB7A 3GV5B 1N48A 4IUFA 4M5DA 3HT0A 1UVNA 1E6YB 3TR5A 2KH9A 1U1MA 2YNHA 1U4BA 3KJVA 2HWHA 1VQNS 2VC0A 3ZTQA 3BBBA 3FMBA 3N6NA 3TNVA 2F9DA 4O0NA 1URRA 2DNRA 2HAFA 2BQRA 1M5KC 4WCEQ 1RT6B 2WAQD 4P7VA 1AA1B 3HX9A 1NK5A 1HBNA 4QWEA 4O3PA 4L76A 1NJWA 3RZAA 2K2PA 4RNMA 2PA3A 2ZE2B 1X4CA 3SSSA 2YH1A 2YY3A 4YOEA 2A0FB 4MFBB 2CJKA 4NCBA 2LVWA 1F6TA 4ZIVA 2CVIA 2RU3A 3OLAA 3G4SS 4F3OA 2HQDA 1D1UA 5F9LA 4NMXA 1OQ6A 3QZ7A 2QV6A 2GHVC 4ANDA 3MD1A 3KK3A 1HBUB 2JX2A 3BREA 2YWWA 5C2CA 2VC1A 4R8UB 1RLCL 2A6OA 4CO0A 1BQNA 3AODA 1W2BR 2FLOA 4ZVPB 1KQKA 2VIHA 1ZM4A 1WEXA 3CD6S 1TL1A 2B56A 2ZH7A 3IWXA 3G82A 1V3SA 1S1WB 2R7VA 2VBYA 3PKYA 4OFZA 3SZ2A 3G2XA 2XLKA 3AFGA 2AX0A 3QGHA 4TYAA 4MMOA 4UZCA 1LK5A 5SZTA 4MT1A 1S99A 2CPFA 1JXVA 2QIFA 4J90A 4CLTA 1PYSB 4CDIA 4RBUA 1N5QA 4M94A 1IUJA 5KG6A 4LFBJ 3W8GA 1REVB 3Q83A 2ATLA 3HPOA 3L7UA 2WB1D 3PRDA 4OYMA 4IOBA 3DLEA 1DLOA 2E5LJ 3GLJA 4U9RA 2R7TA 1YJ7A 3QLHA 1VBZA 4OI0A 3R7NB 1URNA 4JI6J 4KHRA 4LF6F 3HKWA 5HQMA 1HI1A 1BE4A 2AJ2A 3DRXA 3F41A 2ZBQA 3QO9A 4X4VA 1BWEA 1RT5B 1TMMA 3L9ZA 3MM7B 5LL6d 5KT2A 3Q8YA 3N9UC 3MPYA 2FVPA 2YWFA 1NZAA 3KHRA 2PFFB 3FK4A 4ES3A 2LXUA 3S8SA 3PJXA 2DGTA 1ZM2A 2EFPA 1N5SA 1FX4A 1HWJA 2FVSA 4NLSA 3PX6A 1FJGF 4N7TA 1HWLA 2AX1A 4OHVA 2JJ4D 3DLBA 4JI4F 3JQMA 2BRKA 1VRUB 1N8RT 4UOCA 1FNOA 3UI3A 2MHEA 1VQ6S 4RNOA 4RPFA 3DOMB 1GEHA 4OZ1A 4ZLLA 4ECQA 2XGPA 2G2ZA 3M6VA 4NPOA 2LECA 1Q1KA 1B3TA 1Y3KA 2HVEA 1TL5A 4J9UE 1ZZFA 3RAQA 3M30A 3HJVA 4NLVA 2JLEA 3EX7B 4L73A 1RHQB 1X9SA 5A0YA 2XS7A 2EFGA 2F8HA 4LRFA 1JLBA 1CS4B 1TKDA 2MKIA 1P9YA 3JQJA 4LF7F 2W7OA 1RTJB 1U0HA 2BE7D 3IA0A 5AJ3J 1Q16B 1VBKA 4AFFA 5GAHU 3N01A 2AEJA 3PEJA 3NCPA 1S9FA 3W2WA 4N41A 1RABB 1S77D 2BJEA 1YZ6A 1KP6A 3SCKE 1ZZNA 2Q6CA 2ZFHA 4L74A 2XMTA 4UOGA 5HP1B 3RAXA 2HGMA 4B3OB 4WYLA 1RXOB 3M9OB 4DR6F 3EE3A 2G1HA 5KFEA 4ED4A 3N79A 1T94A 3PHEA 1IVZA 4QWBA 3RR8A 1VC6A 3CEDA 1N56A 2R8GA 2MGZB 1NCLA 5M2UA 1OIAA 2EEYA 3HVTA 3MMCA 1SIZA 3UWTA 2VH7A 3UDLA 1Y11A 1NK7A 4FVMA 1R43A 4DLGA 2HBQB 1C0TA 5DLFA 3HHNB 2CKWA 2DNLA 2AW0A 2ZD1B 1LWEB 1TL3B 2MY8A 4I6WA 4ED1A 1Y7PA 1WWHA 4DHVA 4JV5F 1ZA1B 3DLGA 2OFHX 4J91A 4YY3F 2DNQA 3UCGA 3GJSB 4G1QB 1KBRA 2VD3A 2DY9A 3GCWP 4ED7A 1VRTA 1Z2ZA 1HPZB 3MR3A 2ASDA 3D4JA 1APSA 3TVYA 1OQ3A 2CQGA 1TUWA 3RAMA 5BYSA 3G8TA 4J5OA 2IVYA 2V68A 2ROEA 5HJXA 4DV4F 4O44A 4KIAA 1SJRA 3C19A 1IN0A 4PWWA 5J1EA 2YKNA 2MKKA 3J80U 5LSLA 1YG0A 1NU4A 2CZ4A 5B0EA 3BYRA 3EGVA 3DRRA 4JI8J 1IKYB 1QM9A 1ZM9A 3NCQA 2R7RA 3BKTA 1S1XB 3WX4A 3SYZA 1OPZA 3CJRA 3CDWA 5DG7A 3AQOA 4X4PA 2M3DA 3BR9A 3J81Y 2KG0A 3MUTP 4CYUB 4DX5A 1IBKF 2BKNA 4FS1A 3DM2B 4AQYF 3L3CA 2XG8A 4Q0BA 3OVAA 4A8OA 2KT2A 1AZSA 3H2LA 1D9AA 4ECYA 2HSEB 3WC0A 3NBPB 7FD1A 2H54B 1U1PA 3EDQB 5U47A 3R1HA 4YDXA 4KQZA 2Z0GA 1HFEL 1N52B 2XQCA 3EJMA 2LQ9A 2MB0B 2D3OR 5CQGA 4WU2A 1AYEA 2ASJA 1KVJA 4OI4A 4ED3A 4ILMA 1F1BB 2Z30B 2PC6A 3HHLB 2ZZNA 3PG9A 4GVLA 2F5GA 4WIIA 4IG0B 1UVMA 3P3DA 2XEXA 4KPYA 3R5CA 1SV5B 3QWPA 3BQ1A 1TAQA 4OIXA 2P6TA 5KFFA 2DXDA 3MCMA 1NH8A 3FRYA 3UD4P 3KG1A 2V8PA 2B7CB 2MKSA 2D41A 1ZPWX 2YQ0A 1JJCB 1RWWB 3TAMB 1MU2A 1P6TA 2HLTA 3CC7S 1FK9B 4LT6A 2WONB 3B8HA 4X64J 1QLNA 3ZC4A 3O2IA 5F8LA 3FGVA 2HNYB 4CTAA 1NXIA 1WHXA 2IM3A 3VZHA 3VAKA 2E1PA 1RADB 1RBLA 1RQ0A 3NMAA 1NK9A 1TQLA 4Q2LA 1OYEA 2HGNA 3ZXWA 2I8EA 4KV8A 2I9SA 4KPCA 5A6PA 2ZNZA 4HHJA 4NWBA 4IRDA 4LFAF 1HI8A 3C6TB 2D69A 4JI0F 2DH8A 2PEHA 2F8MA 2W4PA 4DPYA 2RQMA 2GS8A 4P2SA 3CSKA 4I69A 1FCAA 4MK7A 2GW8A 5DQIA 1C4CA 1IBCB 3VGVA 1H7XA 2EKYA 5D3GB 3DKDA 4J9LA 4PQUB 1RT4B 4ZOSA 3UD3P 2VFUA 1WORA 4J9KA 1RT3B 4OLPA 2HFNA 3RR7A 2XMWA 2AYEA 1PJ5A 4UT4A 1FD2A 1RK8A 1V6HA 3CMQA 3TVZA 1N0VC 2PO4A 5IS2A 3R5BA 2G1DA 4OHXA 1FXLA 2HVDA 1Q86T 2B6AA 3CJKA 4K4UA 1K1QA 5KAKA 1ZBTA 3GPAA 5M2RA 4K4ZA 4K5RA 1LW2A 2MLZA 1D9DA 2D9PA 1IKVA 2KZMA 4ZDNA 1YJWS 4NEZA 5DJBA 1FXRA 4KO0A 5IWAJ 1CJKB 2DR8A 1S48A 2FY1A 4RO0A 1TR0A 3DXBA 2ZJQQ 2RDIA 1UJ6A 3CCJS 1FDBA 2HRUA 1KTVA 1QD1A 3ZZOA 2JLGA 4J37A 1RHUB 2J5AA 4RW4A 3M2RB 2QLXA 3R8YA 4L75A 4ZPWR 2BV3A 2X1AA 5I3QA 2FLNA 4JI7J 3T5HA 4WXWA 2L9DA 3GTYX 3ILIA 1P27B 4FNIA 2VG7A 5C25B 1RHRB 4DR1J 2EBGA 3I9ZA 3K5PA 1N33J 1ZOTA 2LA6A 5IOLA 2CJ9A 4ENOA 4NMLA 4FF4A 2IHR1 4LR8A 4ERDA 2RU9A 1YJUA 4HDHA 2FY8A 3DLKA 2CPZA 4ZCMA 3CCUS 4QOTA 1EX8A 1X4DA 1M5PC 5KFNA 3OTDA 1K1SA 2BKPA 2HGLA 1SVDA 4JI2F 4CNYA 2B9WA 5ADZA 4QBUA 2BDPA 3MAAB 1WELA 2IRUA 1Q82T 4DU8A 4I2QB 5KFGA 3KWMA 3VQTA 4OI6A 1SKWA 3AY0A 3LPYA 5C2GA 2ZUGA 3B6BA 3M8PB 3KUHA 4NZ0A 3EVOA 2CDQA 4JI5F 1TUGB 2MKJA 3HD1A 4B3RJ 4DUYJ 3MI7X 3LWMA 2E66A 5FLXY 4A8KA 4FXWA 5D4PA 3AA9A 5T41A 2UZAA 4OZNA 1MROB 3M8RA 1JNRB 1SUQA 4OX6A 2RVJA 3E01B 4OZ5A 3SDEA 3QGGA 2BACA 2XYHB 2W9BA 1R8AA 2ZH9A 1UCNA 3VWSA 2V4JA 4DPXA 5I42B 3PFOA 4NXNJ 1BUXA 5JUMA 3C14A 1QE1B 5L1LA 3O3LA 1TVRA 3F73A 2NZ4A 4LSZB 2RRBA 4LF2A 5AE1A 1L3KA 1XNQF 1R89A 1N6QA 2DEJA 3BGFA 4ZHRA 3MEEB 2KT3A 3GU0A 2IC3B 4QR1A 3ENAA 3GCXP 3MECB 2R7QA 3PACA 2KFYA 4W92B 3I55S 1AFIA 1L3TA 1YLXA 4M5DB 5LJ5Y 1NB2A 4JI3J 2H65B 4TKTA 3PYEA 4WFXA 3RRGA 2YNHB 2Y0SD 3N0VA 1F0XA 1TELA 3EVWA 3NGUA 4ECWA 2Y8WA 4B08A 5LJ3Y 1F9EB 2HMIA 2I5JA 5IQ6A 3H59A 4USMA 4O3RA 5HBMA 1TMJA 1EP4A 4P2XA 3WX8A 3PJ9A 3BJYA 2HFOA 5B0BA 3V6HA 2E9TA 1HBNB 3GIIA 1RYRA 3KUEA 2B51A 3V4IA 1HQUA 2KL8A 3U02A 1YIJS 2LMIA 2UUCJ 4PEOA 3GILA 5KG0A 4ZVEA 4IQXA 1R8CA 4N47A 4RNFA 2QFIA 3MUVP 2HZVA 1U8SA 3UVJA 1SQFA 2XLJA 3AXMA 1X4BA 3GJQB 1T3OA 1T9TA 4OQJA 1FJ7A 4ELTA 2A3JA 3SIPB 1RAFB 2FJEB 4KHPJ 1B7FA 2C28A 4FBTA 3A8EA 5HQLA 2EK1A 3LP2A 5JMNA 4DSEA 3GJRB 4DFKA 3TJAA 4P72A 3CD5A 1HBOA 1CC7A 1NKBA 1MN9A 2Y0BB 3QGIA 2VG6A 4WF9Q 4ZLNA 2QMWA 5FD1A 3NGRA 2UVWA 1YHQS 1TL1B 3G82B 3CO9A 2R3VA 2Y1IA 3D66A 4ZPBA 2KXHA 3MGJA 1JLAA 1ROFA 2C2DA 3CULA 2LXFA 2XI2A 1DY3A 2F8EX 2CPXA 4H4KA 2V67A 2Y1LB 4ILLA 1RBAA 2QLBB 3LANA 3VF0B 1L3SA 4MIWA 2M0GB 1FEHA 4M5MA 2ZH5A 4DFPA 2WCXA 1QUPA 2HS0A 3QZ8A 5CZXA 2MKYA 3OPKA 3DLEB 1JLGA 4ECZA 3E51A 3P4UB 2C42A 1S9GA 3EGWB 2F9JA 4X2BA 2YWEA 3CT9A 3BGLA 1NSKL 3M2UB 5HK4A 3EVMA 5CCLA 1UJ5A 2B7BB 1U24A 2GVDA 1LW0A 1GFWB 1SC4B 1S97A 2MXYA 3FFIA 3MCOA 4DX8H 2MYFA 3DYAA 3HSDA 5FIIA 2BJ1A 1HNIB 2MKHA 2DCLA 4WYWA 2N3LA 1RTIA 2YKQA 2O5DA 3ELHA 2XTJP 1R8BA 2LQ8A 1FA0A 4XTTA 1QTMA 2N7CA 2WOMA 3BPSP 2F4VJ 4OI1A 2XCPA 3GMGA 3S7RA 2VQFJ 4FXVA 1DQAA 5HJYA 1K73T 2ZITA 3HHEA 1IM4A 4HHUA 1H0HB 3T9ZA 3W5XA 4CLYA 2FIUA 3IRXA 2W01A 1Q8KA 4RW8B 4JI1J 1RHJB 4HT5A 2D3ZA 4DQRA 1SJ4P 2W24A 4IRKA 2D9OA 3KK1B 4MKVA 5GAGU 2B9EA 5E0OA 3IFEA 4CT8A 1YJVA 1IR1A 2HHPA 1R8PA 3M30B 3ILOA 4OYWA 3SFGA 3A4TA 2PE8A 1S7HA 3EM1A 5A0YB 1FE4A 5C42A 2IIHA 3LP1B 2K1RB 2W9CA 1JLBB 1BWVA 3MMAA 5KFQA 1HQEA 4U6PA 3CCRS 4YUDA 1TU0B 3FMWA 2B0GA 5C7PA 1U0HB 3GFYA 5CHCB 3VV2B 4BLGA 3JSMA 1BD6A 2QL5B 4A48A 4ED0A 3PTWA 2E5LF 4C0OC 5F8IA 3J7A1 3OUYA 2XHWA 5AE2A 2N3OA 4Y2AA 2YBVA 3QSYB 1S1TA 3PYFA 4USTA 1G2EA 1YDLA 2R8IA 4J9SA 4N77A 3MR7A 1WKJA 2H3EB 2SXLA 2UXDJ 1RWOB 1HQ2A 4USJC 2DRBA 4GKKJ 1KLNA 2DO4A 1FRXA 3DDIA 1Z4UA 2HEKA 5D78A 4L6V3 1NJIT 2NZCA 1UVKA 3NG8A 2OLWA 3MMCB 2FJDB 4ZVOB 1R7IA 1NKCA 4DCOB 2W4DA 2KVIA 1PC4A 4RNHA 1SB6A 1KHWA 1LWCA 5D4NA 3W63A 3GFXA 5E3QA 3TA0A 2MSSA 3T5JA 2XY5A 4AYBD 3HHKA 2YH0A 4Y2MA 1RTHA 1NJXA 4O3NA 2BW7A 1F3VA 1ZM3A 1NO8A 1HNZF 1JLEA 1X9MA 2FVQA 4J9VA 1Q78A 4QYZK 3L95X 3MPWA 1PYTA 2UV8G 3KJFB 3GV8B 1SH3A 3PY8A 4ZCLA 5LMUJ 3TZYA 2FJVA 4KGMA 2XO7A 4IO1A 5HATA 4CQ1A 2IBOA 1C4AA 1PJ7A 2ZKTA 4C8KA 2VG5A 2KKHA 3T6BA 3KHLA 1RT1A 4TY8A 2HNDA 1VMBA 3R2CJ 3HZEA 1A0OB 1F9FA 1YQHA 3DI6A 2HK2A 2R2SA 3QBCA 1TTHB 4KHMA 2YPZA 3BM7A 3K0JA 3T3FA 3HCXA 3H90A 5EDWA 1QSLA 2QX0A 3C15B 2Q43A 2ZJRQ 3PDNA 4Q0BB 1WHWA 4LSLA 4NLTA 4IH6A 3NGSA 1AZSB 4K8RA 1UW9A 3FDSA 1FXDA 3NS6A 3D1QA 3AAWB 4N8OA 1T9WA 1S7IA 1JJHA 3ULHA 3IM8A 5RUBA 2HFVA 1NNDA 4QIWD 3HVRA 3MPDA 4WE1B 3CD0A 3HVWA 3CJ2A 3RBZA 1WC3A 4O0IA 1KLMA 4ELVA 2EI5A 4ANEA 3Q8QB 5B0CA 4AE5A 1FD8A 2E7VA 5KFLA 3T1HF 4DPUA 1NK0A 3IAM9 2ZOFA 3RTVA 4IFVB 1VHFA 3MEGA 1XR7A 1NLKL 2GIRA 3R3TA 2WK4A 4KKOB 2QSWA 2XY6A 1R31A 2CQCA 2GMHA 2GMJA 1O0PA 2G9OA 4CTAB 1BGXT 1DARA 3HF5A 3MPUB 2QJ3A 3MCSA 2HFSA 2NXCA 4USHA 2JC1A 4LVNP 1GT8A 3S6EA 3UW1A 3ZZRA 3NAIA 4JI8F 1R6YA 1S6OA 4KV8B 4CO2A 1KQGB 2DCUB 3W61A 1A9NB 2CA9A 2WBRA 3RU0A 3PYGA 4ZK7M 4K2JA 2NSCA 1GMUA 3AD8C 3SEOA 4A8QA 2J6UA 1Q5YA 1T9UA 1PYOB 4NI2A 4OX9F 4Q8FA 4OX7A 4HACA 5C5JA 2A2DA 1I51B 4FS2A 1FNMA 1B0VA 3NRBA 4PG5A 4P9SA 3G6XA 4PPDA 4C6AA 1HA1A 4WKYA 5D15A 3A3NB 2GGPB 4CO5A 3UCUP 3EGZA 4X4RA 4L3NA 2C3OA 4CLKA 1NRKA 4WFAQ 2OMLA 5H1SV 1Q5VA 2QYCA 2W8LA 1JX4A 4OI3A 4N76A 4RNNA 3L4BC 1S9EB 3M8YA 1X31C 3LP0B 2V8HA 1T9VA 1R3NA 4K4XA 4A8MP 3FBCA 3B4MA 2GJIA 1EB0A 3UNGC 5DG9A 4PKDB 5KG5A 5DRKA 4F4XA 1IJFB 2OPRA 3RBXA 3K17A 5H9FJ 1JKHA 3DOKA 2AYBA 1SBRA 3FZ2A 2RAQA 1IKVB 1N34J 3V6KA 4DR4J 2CG8A 2ZDOA 3GONA 4KO0B 1MNEA 3ETOA 4DL3A 1MN7A 1RT2B 4JI4J 5E2QA 4PG8A 2ROPA 4ALZA 2W2OP 3HP6A 1XIQA 3KLVA 2WHOA 4X4OA 1RAGB 2OPPA 4V19J 3NKYA 4I7FB 5ETMA 3OTBA 4RW4B 1VS3A 1WOSA 3MTKA 4LF8F 2M2BA 2V69A 2AYGA 3CJ0A 2YKMA 3MDFA 2HURA 2V2VA 3IR5B 2EC2A 4YQWA 4N8NA 4C11A 5ETOA 3Q8SB 3FCHA 4H4MA 1WC5A 2WVEA 2NPFA 2P5VA 2CQPA 1B7YB 3C6UA 2V5HG 3V5RA 4WK1A 3BSNA 5DO2A 1RKIA 1U25A 2CJBA 1UFLA 2DKOB 2FLPA 3CCZA 3BF4A 5CCMA 3QJPA 2M8DB 1CJTA 4DMZA 3OFEA 4LBPA 3UPFA 5A8KA 2UUAJ 4MYUA 1U45A 4ZPVR 2J0SD 4B17A 3BQ2A 2KHDA 3VCDA 4ED8A 5EX3A 1DTQA 3LUYA 2NUHA 5KFPA 1X8DA 2DNYA 1R6VA 2YWKA 1FFGB 6FD1A 3OTCA 3M2VA 5HLFB 1FDNA 2DNPA 3DRSA 5FDLB 4DUZJ 1SXLA 2CZ9A 4LUBA 4DL5A 1DJ0A 3FQLA 2QLWA 3M4XA 1SUQB 4IYQA 4QWDA 3SDEB 2W9BB 1CG2A 2KRRA 1U8WA 2YTCA 1VC0A 1SJ1A 2PIIA 3FBFA 1U09A 2X3GA 3G6ES 1DZ5A 4YY3J 3ZZPA 3A3OB 4DF4A 5CYQA 5D0RA 3SQOP 2CAJA 1F5CA 3OR2A 5I3UA 1N6QB 2C2EA 3P8BB 1RB0A 2IAJA 4ES2A 4E98A 5THWA 4DSFA 3H5XA 3TRGA 4QZVB 1C0UA 1YJTA 3MEDA 4AD6A 1AB8A 2GQQA 3IS9A 4JI7F 1FNXH 2DNKA 4FZVA 4ZP8A 2W25A 5HMZA 2RKIA 3PR5B 3RB6A 4ANCA 4P52A 2NSBA 4DR1F 1N33F 4B9NA 2AP6A 3DRPA 2OSRA 5M2PA 4Z37A 4NLUA 1NMEB 3KNGA 4LSNA 2RILA 4PCQA 3GR0A 1OPIA 3KLHA 1K44A 1H3DA 1ICEB 1S59A 2VFSA 2MTLA 2I2YA 1ZETA 2I5JB 3AH6A 1IBKJ 5HBMB 2P8IA 4RJVA 3CMES 3NNCA 4F4ZA 2IPOB 3R97A 4A4JA 4I0WA 1T9XA 5H9EJ 2R7WA 1FKOB 4CT9A 1CJUA 1HQUB 4A8SA 5D0EA 1YBTA 3BN7A 4NLQA 1SH2A 2CNNB 5B0DA 3J7YU 5CYMB 3PFEA 1TL7A 4DUYF 3Q8RB 4RW9B 3OL6A 2OPQA 4OMFG 2F65A 3EWGA 3V6DA 1X5OA 3UVJB 2JVOA 3FUYA 1NPPA 2D7SA 3P49B 5EN1A 3THTA 4K2XA 1XERA 4NXNF 2ZOGA 1ZAXA 3IGNA 2GX8A 3G8SA 2YNFA 3VAIA 1TK0A 1HMVA 3TEHB 4ZVGA 2ACMA 2VG6B 3VGUA 1KFDA 2OPSB 2UXCF 1Y3JA 2OSQA 4ECSA 1H38A 1RHMB 4WTOB 2PN6A 5KFWA 2GA7A 1G7CB 4DG1A 2RE1A 5B0FA 2VICA 4ICLA 1TKZB 2HQIA 3ILLA 3M1VB 2FJWA 3OVBA 3MR2A 4LF4F 5BYRA 3KK2A 4UY85 3PJWA 3CB4A 3JSRA 3KHGA 3GIJA 2J0XA 2FVRA 2YKAA 4C0BA 4JI3F 3OSNA 5EWFA 2H4YB 4WKRA 1S6PA 4FDFA 5HN0A 2I6WA 1CC8A 1U6FA 3QAUA 1S9GB 5MAOA 1L5UA 3FEYB 4DQQA 1WKLA 4RUBA 1D0EA 4JI0J 3NNHA 1SQEA 2ATCB 3RGIA 1BC6A 2N4DA 2BA9A 4GVBA 1U1QA 1FT8A 2OAUA 1HYSA 4J7CA 1J2VA 2R7UA 4K0KF 1LW0B 4ECUA 4ID5A 1VFJA 4O3SA 3RB4A 4EBEA 3DYAB 1X0PA 2UUCF 4DV0J 4RW7A 1RKJA 4KFBB 4LBHA 4AXJA 1RTIB 3HK2A 4Y34A 1UVIA 1RWVB 5J2QA 5ETLA 2BM1A 5GADU 2XSJA 1QJHA 3B82A 2VQEF 5A8WA 1P1LA 5LSOA 2ALZA 3TWZA 3FCWA 1PIEA 4EZ6A 1Y9OA 4KHPF 4Y65A 3BS9A 3L7OA 3IRXB 4ZLPA 1UZDA 2OI2A 1KR4A 2XHCA 3BYPA 3Q8UA 1BQMA 4WPAA 3QAEA 1YJRA 1FRHA 1BQXA 3UD5A 2IYGA 4EUVA 2L9NA 5B0GA 1T11A 3IM9A 4DZ6A 3T9NA 5DLGA 4DPWA 2YKPA 3PX4A 2CXEA 4LF9J 4QR0A 1KONA 3UR0A 5C42B 4NL5A 4KGXB 3MM6A 2DT9A 1OSDA 2F63A 2WVFA 2VPWB 1U2CA 3Q2SC 2W9CB 4ECTA 3MMAB 1HQEB 4F04B 5EGYA 2Q66A 4DX6A 1WI8A 2K8GA 3QRPA 1HI0P 1T03B 3T41A 3JSMB 5ETPA 4CNZA 2Y1JA 2HBZB 1OO0B 4FYXB 1FJCA 5BJRA 4TQSA 2B9YA 1YX2A 1FWKA 2ZDPA 4BC7A 2FGOA 2OMOA 2VKZG 4Z7YA 3ICLA 1SKUB 1YVFA 1P8GA 1S1TB 4ZKAA 2UVRA 4QWCA 4NLDA 3K2YA 4FP9A 2GQ2A 1XNRJ 3LGMA 2MHNA 4B9TA 3ENQA 4KH1B 3Q23A 4U7UK 5HQ8A 2V9KA 2EW9A 5HO4A 3SCLE 2XMKA 1VQ4S 4HL9A 3CDEA 3BGUA 3WIUA 3TP2A 1RACB 3J80Y 4QIFA 2MZTA 5CD4A 2BJDA 4NZ6A 4MTPA 3M6WA 3D0GE 3M9NB 5ETQA 3CCES 2F4VF 2VQFF 1EJ7L 4KT0C 2EG1A 2XC9A 1WSRA 3DDNA 3IWLA 5KFCA 1UJ4A 2AGQA 1N36F 4C8OA 3NNAA 4JI1F 4K50A 1RTHB 4G1IA 4ZVSB 4NCGB 2BANA 3CJSA 3FNNA 1IR0A 2IJFA 2PSZA 5ETVA 4Q7AA 2A6MA 2IM1A 4OJGA 4QIGA 2YNGA 3OW2R 1WD6A 2VBWA 3ZNJ1 1AW0A 2QN6B 2JH3A 3TVKA 3N4WA 1U1KA 2QZ8A 5KT5A 4ZJQA 2AJ0A 1GMWD 3VGTA 1X0FA 3RBEA 2BOAA 2DY1A 2V9WA 2CNLB 4RWXA 3EZUA 2O3DA 2VG5B 2FHJD 5L9NA 3RUBL 2MQNA 3MPVA 1RGVA 2HNDB 5L1JA 3CW2C 2BRLA 4H4OB 3QMQA 3DI6B 2DHXA 3HSGA 2MQLA 3I56S 2YX1A 3AD9C 2ZVIA 1HW9A 4FYYB 1KTQA 4K5SA 4WIQA 2FJXA 3N6LA 3CD7A 5F8JA 4TQRA 4CI0B 5KT4A 3FZBA 1RWKB 2JWNA 5HROB 3OXFA 5KFSA 4HR2A 1SKSA 1WUUA 2L48A 1JLFB 1UMJA 4HEA9 4I64A 2BM0A 5GMEA 1M0SA 2FHOB 3TA1A 4F0HA 3I31A 2DNGA 1WC1A 5LMNJ 2HVIA 1V5IB 2HW3A 2RSQA 3W8PA 3VTIA 4KGZB 1FTRA 2ZH2A 1O8BA 3W2VA 1KLMB 3D7SB 4JOUA 3LWLA 3OL8A 3LGHA 2JSXA 3LALA 2HRTA 5KG1A 1DQ9A 3W5ZA 1RE1B 1VQ9S 3B4DA 1RTDA 5KT6A 3HHLD 1U6ZA 2W9AA 4PZVA 5JJBA 4Y28C 7AT1B 2GVZB 4NE9C 4NA3A 2IM2A 4IDKB 3W66A 4PXCA 3AB4B 1XR6A 1HHSA 3LQVA 2ZZMA 1LQ9A 2CQ3A 3AT1B 5IM0B 2FYXA 4PG6A 5J2PA 1FEEA 3UDCA 1U48A 2HG4A 2N7YA 4C8LA 3CDAA 2OEJA 4FVCA 4CO4A 3D3BJ 2ZWOA 2KM8C 3V81B 4B3SJ 4NYZA 2MEWA 2CZVC 3R5JB 3UCZP 1OSCA 3ETMA 2DEIA 1WI6A 4MKYA 1EHWA 3I6PA 3NGTA 4XK8C 3CE8A 1EKRA 4CLFA 3I9V9 1IBMF 3TW0A 3IO1A 2WB4A 4J9RA 3OXLA 2IJRA 4HACB 3N6MA 3IBCB 5D4LA 5D4OA 2P2CB 5DGBA 5EWEA 1ZA2B 3VAGA 1RCOB 3UFCX 1KHVA 2E1RA 2HRYA 4HH0A 4F02A 1U47A 2N82B 3JYTA 1QVFR 1K9MT 3DGPB 4OZ2A 2WW8A 2ZM6F 1E6YA 2IFXA 2HHUA 3KLFA 1KFSA 2MQMA 2HS4A 3GIRA 2J76E 2RB7A 4GO5X 2QRRA 2KJVA 4HLBA 4NOHA 2VBZA 2Y8YA 5F8HA 3H8YA 3O1LA 2OPRB 2Z2YB 3ZZZA 2XS2A 3GIMA 1YRTA 3PYDA 3QT7A 1RT6A 3DOKB 4ZJOA 4RUCA 1WC0A 2IMWP 3CIZA 5B09A 2DXEA 2LEAA 1OJ4A 2JLFA 4DDFA 3W60A 2YPYA 1HWIA 4BBYA 1XK8A 2FJBB 2NR0A 5KFXA 3MURP 3LGNA 2ZWPA 5K14A 2RHQB 5ETNA 4DV2F 1VRQC 5DS7A 4MFBA 4OI2A 2FQQB 3TAPA 4JYAF 2NREA 5IT9U 2B9XA 2F7VA 2B43A 3NLCA 3BGOP 2GIQA 4F3MA 3FVYA 3MM5A 4MH8A 4QJVA 4NLRA 1S0NA 4NLYA 1C1CA 1YSJA 4MIAA 3W3SA 4C11B 5J2NA 4H4MB 3W65A 1FO1A 3D2WA 3C6UB 3Q22A 3OFHA 4WXOA 4Q43A 2ZHBA 1RAHB 2GIFA 4X4QA 3W64A 3GSDA 3O6QA 1X4EA 5K9FA 3EZ5A 3BSOA 1S1WA 2OELA 4A47A 1Q4RA 1CJTB 3QIPA 1QDUB 3PCOB 5D6GA 5A8KB 4UUWA 2C3YA 3G86A 4DL2A 4AL6A 1CPZA 3MTJA 1SC3B 4CIOA 4PPZA 3QJJA 3PXGa 3M8SA 3PV8A 2BQUA 1RT7B 4CRJA 2VU5A 1DTQB 3BSCA 3D28A 4C2MA 4ZIWA 1RP5A 3KLIA 2A2CA 1KQFB 2DJWA 2XYPB 4OYIA 3ZNUA 4LRBA 4CLWA 2DIUA 3IXQA 4QW9A 5KFOA 3LTOA 4P74A 4TVAB 2CVEA 3IG1B 2DGXA 4DZDA 3T5KA 1N34F 4ETXA 4DR4F 2ROGA 4UUXA 1Y10A 1YBUA 3KKFA 1RA7A 2DITA 3LPEA 5CYQB 1RT5A 4CWBA 5DM7Q 3MM7A 3I4PA 4WFYA 2NYHA 1WEYA 3WZ0A 1HNZJ 2D3UA 2QMXA 5GAHI 1HARA 1VQPS 4PXDA 2IDLA 3KDNA 4U96A 3SSQA 1NHVA 3OFFA 2Z56B 4NZ7A 2VZ9A 3FC9A 1LK7A 1JQGA 3NOCA 1GX5A 1S12A 1T05A 3IS9B 1SI9A 3OHAA 3TO8A 1UPMB 2RKIB 1AUDA 3Q89A 3LAMA 3M05A 1TUVA 2CG4A 3I96A 1FHTA 3DOMA 4LF1A 1X60A 2Z2MA 1YKWA 3KLHB 2C2OB 1UW4A 1QAJA 2E5JA 2HZCA 3BV8A 1WSVA 4ZJLA 3K8VA 1D8YA 3Q8VA 3M6UA 2UUAF 2LEBA 3QQCD 3KOAA 3PKMA 1FDDA 1V3ZA 3TUPA 5CZVA 4B3TJ 3NWGA 4DS5A 5J2MA 1CS4A 5CABA 2CNKB 3VAHA 1FFWB 2V8VA 3NAHA 2IA0A 5IT4A 1TZ0A 3G9CA 1RTJA 4M63A 4G6VB 2YX7A 5F0UA 1FVQA 3A8IA 4DUZF 3RBDA 2XI3A 3V6DB 2VOPA 4UOFA 4OJHA 2RS2A 1V9OA 1F5BA 5CH7B 4DL6A 4B3OA 2NPIA 3K8WA 4RU9A 1SC6A 3T1HJ 1Q8LA 1S4FA 2C2NA 3JB9k 2AJQA 4IH7A 2QA4G 1EQ0A 1MG7A 1O51A 1NM2A 2QA4S 4AL7A 3TX8A 4M5NA 2LLZA 3RB3A 2MGZA 2ZHAA 5KFJA 4RL1A 5L9XA 1L3UA 2CUYA 3DLHA 1Q53A 4OHWA 2BOPA 4ICLB 4NYPA 1DRZA 2ZD1A 1LWEA 2EFOA 1TL3A 1XWLA 3DU6A 3I0SA 3C16A 1GMWA 4G1QA 5BR8F 1XMOJ 2VJVA 2AHOB 3VGSA 2BJ7A 5CD4H 3U1NA 1HPZA 4OYBA 4OHZA 3MMBA 3Q8PB 4F2SA 2B3TB 1UEUA 2FHJA 2BXJA 3T6JA 4AL5A 2NS1B 4F3QA 1WC6A 1SH0A 4OX9J 1HYSB 1CJVA 2ADBA 2DH9A 2CYYA 5G0RA 1HL6A 5DDQC 4DL7A 1PAEX 5KFRA 2KDOA 2PI5A 4K4TA 1HIYA 4IQMA 4ZVRB 2DXFA 4FPIA 1VGYA 1YWXA 1NDKA 1KDNA 4DR3J 1XN9A 1PAUB 2JC0A 2XO6A 4KJIA 5GVQA 3DFEA 2XSJB 2COLA 4CYUA 1PO6A 1JJ4A 3DM2A 4QPTA 2Y9HA 1IKWA 1DAXA 5KT7A 1WOOA 4QPXA 2XMUA 2MKCA 3NBPA 3D67A 4DU7A 4RUAA 4TU9A 1HD0A 1IXKA 1TKXA 3NCRA 2KJWA 1BQMB 3OXGA 4PABA 1KC8T 1S1VA 2UXBJ 3AXKA 2QLJB 4CCHA 4DLEA 3R27A 2KN4A 5HVGA 3PZPA 1LWFA 3CCSS 3BSAA 3VQSA 1HBMB 3HHLA 2UP1A 3GSIA 2C3UA 2QL7B 4IG0A 4USKA 3OVSA 3I82A 2K3IA 3MM6B 1NDPA 3M8ZA 1SV5A 3OL9A 2Q79A 4MAKA 7FDRA 4FNHA 1YTYA 3GB0A 1JLCB 2OH2A 3I4HX 2LEPA 2BZ2A 1VISA 4LF8J 2DB1A 2E9RX 3BH6B 3TAMA 3J7Z5 3IBFB 1BHNA 1YITS 1A6LA 2Q6BA 2WONA 1S72S 2PMWA 2VL1A 3WHIA 3RJMB 4YN3B 4PQAA 3JS9A 3NOGA 1K0TA 4LF5J 3T19A 2AJ1A 3BKUA 1TL4A 4UTGA 2C22A 4GRSA 4BWMA 4ECXA 2QA1A 3TARA 3DOLB 2M52A 4A46A 4ER8A 1EAYC 4DV0F 2MJNA 3PIOQ 2WSFC 4DR5J 1HNVB 4CO3A 2JL9A 1T0TV 1UWAA 2C3MA 1FTCA 2P6SA 2V50A 2VFRA 3JTNA 4M5JA 1NJYA 4OYAA 1TFWA 4M5GA 5H9FK 3KXDA 4MYTA 2GJFA 2DGOA 3R6GB 1VQ8S 1D3WA 2BKOA 4ZVFA 5DG8A 1ZS6A 3ZTPA 2B4PA 2OUGA 2X3DA 2AMCB 3QT5A 3WIVA 1WDTA 1VQYA 4PQUA 4EBCA 2NXEA 1RT4A 2KT5A 4ZP6A 3CXCR 1WF2A 2JEJA 1RT3A 4O4GB 4Y3CA 3CF5Q 3HVAA 1VBYA 4LF9F 2E7WA 3PW0A 2OFGX 3OJUA 2CQHA 3D6FB 4XPEA 2CWXA 1QSSA 2C2RA 2RRAA 1T7PA 3EZOA 4P75A 1LNQA 1S6QB 1Y00A 3UN5A 4Q45A 2AIRB 3HHLC 1TKTB 4YB5A 3HKZD 4C3MA 2XGQA 2HNZA 4CH1A 1WG5A 3RB0A 5BYQA 2A18A 1Q7YT 3KLGB 2G0JA 3FJ2A 1N32J 3SV3A 2ZH4A 3HFVA 2I0XA 1CJKA 1EZZB 2IDEA 3JAMU 2HAIA 2DGWA 2EK6A 4LR9A 1Q8BA 2WTFA 3IR7B 1CSJA 1XNRF 3SQGB 2ZKUA 2FPHX 4PYDA 3W7BA 3N28A 4AUKA 3D1HA 2V8DA 3K5LA 4F0KA 4PWDB 2RQ4A 3CDBA 4DR2F 1FKPA 5SUHA 1VLOA 3W62A 3M2RA 2ZBIA 2UV8A 2KFZA 3KMQA 4O23A 3CCTA 2WW4A 4QU7A 3CWJA 3HXMA 2DR9A 4NRUA 4WP8A 6FDRA 2NYIA 3W2VB 1F9HA 2XSFA 3BGRA 5KG3A 5HANA 3LA0A 2RHSB 2XZWA 3PRVA 1PG5B 4G3IA 1KRPA 1Q79A 2RMLA 1UTAA 4H54A 5ITHA 3VALA 1RTDB 4DWIA 3N5BA 1RLDA 2H5IB 3WQPA 2U1AA 1I94F 3ZTRA 3AOAA 4I4BA 4OYPA 1NSAA 1DURA 2JZ5A 2CPEA 3OTOJ 1P9QC 4KRWA 1NBEB 1X4FA 4PG7A 2VDIA 3CPWR 4IFYA 5B7WA 3ZZYA 4L72B 3X3UA 3M8PA 2UXCJ 4OX8A 4M5IA 3JSBA 1S76D 1I5OB 5EUHA 3QPIA 1CULA 1MROA 2MLXA 1MMNA 4USIA 2O01C 3E01A 1LXNA 2EVZA 2FB0A 4LF4J 2CJYB 3MF5A 2BJ9A 3R9LA 1R0BG 2LKZA 4Z7CA 1R8HA 1QE1A 2RUSA 2HKEA 4ES1A 2J9CA 5JVGQ 2DNMA 4DSKA 2HVHA 4YMEA 4AT1B 3KJVB 1N0UA 3M7VA 2PI4A 2PA8D 2OTJS 5H9EK 3L09A 4OJ1A 3VZIA 5KFDA 1Z1ZA 1VDHA 4KC5A 4R5PA 3KMSA 4ZVQB 3JYTB 1FKAF 1KVIA 1Q8IA 2ZHOA 2J9EA 4K0KJ 5LMNF 2DNHA 4OYOA 2M70A 3LW5C 2GJ2A 3A8JA 2RIJA 3GWCA 1QSYA 1FRJA 2HPUA 3QFWA 4RLEA 3KLFB 3DLLQ 1JLQA 1WJ9A 2IMOA 3W9HA 2AYMA 2FZGB 4ID8A 4J9QA 1S0VA 4FKYA 3IN5A 3H4DA 3SI8A 3NMRA 4AXIA 4NEYA 1M5HA 2VQEJ 1X5SA 4ZMMA 1ZTWA 5AE3A 4CO1A 2O66A 2BBEA 5F8NA 4PAAA 4HTIA 1C1BA 2MZRA 4NYOA 2AQ4A 4TU8A 1HHQA 3M8QA 4KR0B 3KK3B 3POTA 2IVFB 4KE5A 4DL0C 4DV6J 3HO1A 3KNAA 3FRZA 1S79A 2FHKA 2MLYA 4LRAA 4FXDA 3ENVA 1F2GA 5K14B 1TV6A 4LRCA 4X65J 1T95A 1BQNB 1EARA 3D6TB 3NXZA 3K59A 4B3SF 5KG2A 1H72C 4DR7J 4J9OA 3MM5B 2BR0A 2UVVA 3GZ7A 2AJ4A 4FYDA 1VQ7S 2YXLA 3K58A 3HZGA 4QR2A 1C1CB 3KFWX 2CWKA 5J2NB 2J0QD 2MZ1A 4LR7A 2UVUA 3NL0A 5LOQA 1FRIA 3PW5A 1WNEA 4B9VA 1DLOB 1J5OA 5KOXA 4EWTA 3RYLA 2M88A 4P10A 5IXUA 3QIPB 2UU9J 3ITHA 3QLHB 3UR3C 1SIWB 3M9MB 3TANA 4UF4A 3W5YA 1IQZA 4ZPCA 3AD7C 1EKSA 3QO9B 4MK9A 2V6AA 3PW7A 3KLIB 2UUBJ 5GAGI 1HNWF 2O1PA 2Q3PA 5A2QU 2IYIA 2AZ1A 3TI0A 2ZBRA 4I1TA 1N54B 1KQSR 3M2UA 3OQ2A 1VJQA 1GQEA 8AT1B 1REGX 4DV1F 1N36J 4FBUA 3QNWB 3E3XA 1AROP 3FCVA 1SC1B 5GMDA 2HVZA 3I5CA 3ZZTA 3ZO7A 1HNIA 2OKQA 2B4VA 4N5SA 2J0WA 1VQSA 1SL2A 2CQ1A 3BZQA 4ITSA 3Q24A 3GP9A 4DOZA 3QYYA 3DHWC 2YQ3A 3UNYA 4KGKA 3FSYA 5KG4A 4X4TA 1T05B 3HFZB 2ZBCA 2HHXA 4HH1A 2BE2A 4E2FB 2POKA 3ISNC 9RUBA 4W90B 1IR2A 5DGAA 4X66F 4RW8A 1QAXA 1QAIA 4R25A 3KK1A 4YR0A 4RX6A 1CQNA 2CPYA 3HLUA 2GHPA 3W2WB 3T1YJ 3TQ1A 2AEFA 3U1LA 1MSWD 2M5YA 4ED6A 4EYIB 1OS5A 1B64A 1RTZA 4L3KA 2ACYA 1H2VZ 2KFNA 3IC1A 4F4AA 1RWUA 2A10A 3LP1A 3PW4A 2K1RA 1UZHA 5J2MB 2MZSA 3Q0AA 3VAFA 1B0TA 1FE0A 1S5ZA 1U26A 5IFMA 1X9WA 4P2MA 4JV2A 3D0IE 1NDLA 1GTEA 3FKBA 3CUNA 5J1NA 3HVTB 2PMHA 3TX0A 1R27B 1G6BA 2E5IA 2XNRA 2CQDA 1U1RA 2P9EA 1B70B 4K7QA 4C0HA 3G8QA 1C0TB 1RWPB 5EX0A 3BDPA 2MZQA 2W4CA 2HK3A 4QCLA 4B9SA 2JHEA 2EXUA 3CCLS 3RRHA 4KSEB 2PD1A 1UETA 5EHHA 3DLGB 2CJAA 3H5UA 2DR7A 2Z8QA 3BQ0A 4LFCF 1HR0F 3W9JA 1HNXJ 2ZH8A 4PUOA 2XULA 4S0MA 1VRTB 4DV5J 1H74A 4DN9A 3R6LB 4BHQA 2L08A 1J5EJ 2KYZA 2C3PA 4DV3J 4X4NA 2CQ4A 2IY5B 3G6YA 1UP1A 2OHDA 3GFZA 4RUHA 2A1BA 2EFQA 5LXYA 3H7HB 1JWWA 4O44B 1WF0A 1WDDA 3A3PB 2NXJA 5J1EB 4CM0A 2YKNB 3I0SB 1OYDA 2Y3YA 4TN2A 2V94A 1VLYA 2LCWA 4B3MF 4GMKA 3C16B 5HAOA 4LIWA 3P45B 2CQ2A 1TK5A 2V34A 3DRRB 4YHHF 4M5KA 1Q81T 3GYXB 4DI6A 2DH7A 3GIKA 1A7GE 3MMBB 4ETZA 1S0MA 4RBVA 4DUTA 3MXHP 4RZRA 1FRLA 2F3JA 1GX6A 4DPOA 2V2QA 2EBEA 1VI7A 2XMJA 3HD2A 3K5NA 1IBMJ 2CDRB 3CCVS 1UA0A 1O5JA 1RZMA 2DNZA 2ADCA 2KRBA 1CJVB 5G0RB 4B3TF 3DC2A 3I5AA 2DGVA 1CQMA 1GAOA 3J81j 1D8ZA 3CCQS 2M8HA 4ZCKA 1UPPA 1MWZA 3MEKA 3KYLA 3EDRB 2ZEJA 2LYVA 3I0RA 3AOBA 1UEKA 2ZM6J 3IGVA 3C15A 5CXTA 2D1CA 1IKWB 2C2ZB 3G6VA 3D54A 2WSEC 2VA2A 1R0AA 3NY0A 2MY7A 1E6VA 2DGSA 3I87A 4YR3A 2LDIA 1W26A 5CYJA 1YI2S 2G2OA 1TKXB 3ISZA 2VODA 3AHPA 2KO1A 4TNOA 5AXLA 6AT1B 1BMQB 2W2QP 5KTQA 4J9PA 4CLUA 2DYAA 1S1VB 3BH7B 3D6HB 3H2UB 1MU2B 3CC2S 2QGFB 5F3TA 4ZP9A 4BWJA 1LWFB 4DEZA 4WE1A 2V8GA 3C46A 2B5JA 2CRLA 2YNIA 4F0MA 4FN5A 1RUSA 2BE9B 2M4MA 2Q1LA 4DSJA 2GAHC 3H0PA 3DCAA 3ZZUA 2WVDA 3IMQJ 2XMAA 3WBZA 4WWSA 3O44A 3GG0A 2V4QA 4C98A 4DV2J 3VVUA 2E29A 4CLZA 1RCXB 4IFVA 4B9LA 4IOAQ 4JYAJ 1XMOF 1V5VA 4C8NA 2RF2A 2RD5C 1BY9A 1NEEA 2JFDA 2ZOMA 1HD1A 3DU5A 4KKOA 2G0CA 1U1NA 3FEXB 3NWRA 4V1Ak 1SJ3P 1MWYA 4U8YA 3UE2A 1FF2A 3EMTA 3D0HE 1CEZA 1UL3A 3KLEA 3H98A 2VPYB 1U6BA 2HHWA 1ELOA 1DHMA 2KYXA 3X1LB 4A8YA 3PIPQ 1K47A 4NLPA 4UQGA 3H2VE 1VOMA 2DRAA 3GE9A 4NLOA 4DR3F 3QSIA 4KAIA 5KFMA 2DGUA 3KJQB 1I6JA 3FEZA 1L3VA 2ALYB 3JTPA 5DM6Q 5JVHQ 4M8LA 1FFSB 2C2MB 4J9MA 1RWXB 4G65A 2HQCA 1RJJA 4EYHB 4TXSA 2DTJA 3NEKA 1KOHA 1U2FA 5DETA 4URQU 1D09B 2PEBA 1GNKA 2B6AB 3CJKB 3DRYA 2DVIA 4NXMJ 5KG7A 3K89A 4EO6A 1WEZA 1IJEB 3CTRA 2PT0A 3OR1A 2GGPA 4OYXA 5K8NA 1HLWA 1MMDA 1LW2B 3LOUA 2UXBF 2PDAA 2RUGA 3LH2S 3QT6A 4OLOA 4JV0A 4F67A 2VPXB 3CNQP 2R4FA 1S9EA 1KEKA 2WRMA 4KY3A 3LP0A 1EETA 4QW8A 2DD8S 3I5BA 2NXUA 2J8AA 2GFFA 2FGCA 4ZCIA 1S49A 3TUIC 1H7WA 1VJWA 3MR5A 2AGOA 2HNZB 5A6WA 1UVLA 3GR1A 2DPIA 4HYKA 2NQPA 3BBFA 1F3FA 1RT2A 2NCKL 2VG7B 4UOHA 4LF5F 2QE5A 2QT7A 2YX4A 1NAQA 1VCTA 3KG4A 3DLKB 1Y5IB 5ETKA 1H6KX 2RNEA 2KVQE 4I7FA 1FKPB 1LFPA 1N5VA 1W7WA 2FC9A 3CJ8A 4DR5F 2J8SA 3TJ8A 4CLSA 4USVA 3UDEA 4YDDB 4DJBA 1SL1A 3RW7A 4G1PA 3EPIA 1T9YA 3K5OA 4CH7A 3UO0A 4QIVA 4LMZA 4HKQA 3IR6B 4K4SA 4LRDA 5T14A 2JEFA 1P1TA 3BGRB 1XJWB 3E8OA 2LA4A 3OV7A 2HLUA 1RISA 5HVHA 4WJBA 5DZ6A 3R7BB 3CGIA 2XM3A 4WFNQ 3PX0A 2E1AA 2FDNA 3QATA 2XS5A 1YBAA 5DQGA 1RAJA 2DHAA 2V4JB 4E0DA 2X1GA 3DXSX 2APOA 3C14B 4JV1A 2VHGA 4HHHA 1H2TZ 1TVRB 4IFYB 4F8RA 2HHHF 3MR6A 3D3CJ 3R5GA 5L1IA 1VIXA 2K06A 2UUTA 4YB6A 5HLFA 1TP7A 3P5TL 2AD9A 5FDLA 2OD4A 4ZHRB 3FSIA 2GHWA 3P96A 3CC4S 1CULB 2N4CA 1S57A 2QYGA 4OL8A 5AXMA 3BN4A 2NLWA 2VKRA 4DCJB 1N32F 2DIVA 3P5BP 5BXIA 2V0NA 2AWZA 2E5GA 2ZUAA 3BPDA 5BR8J 2HS3A 2OP5A 1QVGR 4IR9A 5AXNA 3J7YI 4OZJA 4P7TA 2R2RA 5L39A 3HT3A 2HMIB 2LU2A 3M32A 4UY8T 4F4YA 3C8YA 4PXEA 1EP4B 4R5PB 5GMKa 2AT1B 5D0HA 4HDGA 4ZS6A 4WZQA 2YQ1A 5IC4B 2OIHA 1UKUA 4Y2KA 1NJZA 5IT9Y 3QRRA 4K59A 3V4IB 1JLQB 1FRMA 4XPCA 2K7JA 2CADA 3TUJC 4NLGA 4M1KA 2J6TA 3CCMS 3TOQA 3BO2A 2WBMA 2DO0A 4BS2A 1S1UA 2KXNB 1BLUA 3U1MA 1Y5LB 2FD2A 2QSFA 1ZTTA 1UFKA 4TLQA 1VK8A 2Z4PA 4X84A 4UW2A 1UWBA 1FDAA 1X4AA 1C1BB 5GAEI 1OWXA 3M8QB 2VA3A 5L46A 3OTOF 2MJUA 3POTB 3LP2B 4HVZA 3LO3A 4USUA 2IRYA 1FKOA 1T3NA 2HHTA 4MJKA 1HBOB 3OFGA 1TV6B 5IQQA 4BCAA 4IRCA 1WOPA 4ZPDA 5CYMA 4RW9A 3OLBA 3RW6A 4ZPAA 2W8KA 2QL9B 3KDOA 3QT8A 2IBKA 2JNJA 1G1XA 5KFAA 1JLAB 3MM9A 1FJEB 5GAEU 4FF1A 5J1PA 3DGVA 2DNOA 1H98A 4NA2A 5L8RC 2EFNA 1PC5A 2HIYA 2QLFB 1EQMA 3TEGA 2JEIA 1YGYA 2RT3A 3V6JA 2ASYA 3AB2B 1JLGB 2OPSA 2VV5A 1J5OB 2GV1A 2C2KB 1U7LA 1TK8A 4HT7A 4RBTA 1PCAA 2H51B 5GADI 3NS5A 1M1GA 4JUZA 3ITHB 2WVCA 4LREA 1TKZA 4PG4A 3M1VA 3RG6A 5FJ4A 2GVDB 5G4DA 4FYVB 3KG0A 3A13A 1NDCA 2MQPA 3MOZA 3FFIB 2BUNA 4QU6A 3F0NA 4X4UA 3EICA 1DTTA 2BYCA 5B0AA 2R2TA 2VB6A 2HIQA 2ZH6A 3C2PA 1AT1B 2W2MP 4DS4A 1GXLA 1RU1A 2WOMB 4I2PA 2LXIA 2J7KA 3W1YC 2ZH3A 4GC6A 4NRTA 3R2DJ 4ED5A 4Q2MA 4DL4A 1ZYQA 1AFJA 3PVXA 1N4LA 3CJ4A 2Z58B 4OJ3A 4DV6F 5CA5A 3HHDA 5I4MA 2AKWB 2D3O1 4X65F 4EMDA 4KFBA 3MOJB 4O3QA 4OYZA 1O6XA 2LU1A 2E7XA 2WVBA 4GKJJ 3FSXA 2GMLA 3QRQA 3H5YA 1NH7A 1S10A 2X1FA 2ZC4A 3DHXA 4DR7F 3AJ1A 5E41A 3HJFA 3PEHA 3HULA 4XAKA 4DQSA 1QUVA 1N88A 5F9NA 1MLAA 2GCFA 3R7SB 2BE2B 1OMSA 3BKFA 2G4BA 3ADAC 4URGA 4QQBA 3TA2A 1LKZA 3HM9A 3J81U 4PRFA 2JRSA 4FPRA 5HMYA 3THVA 2H48B 3D5MA 1WTBA 2OD6A 2LP4A 3B78A 1NPRA 2R9LA 5KFUA 1U2RA 3T1AA 3VR1A 3OUYB 5DDOC 4RW6A 2HZAA 4U7CA 1FVSA 4NLXA 2UU9F 5A8RA 2MZJA 3UDVA 4TY9A 2HHVA 4K4WA 1U02A 4XIUA 3GJTB 4F36A 1WACA 4Y2IA 2B4OA 4LIRA 1VR6A 5LT5A 3THPA 2AGPA 4EEYA 1JNZB 4DCPB 3FBBA 4CLPA 4LFBF 3HMJG 3MZIA 5LSRA 3D6MB 4DR2J 1T03A 2YWHA 2UUBF 4YR2A 4ZITA 1N5YA 5AXKA 1NSQA 3A8KA 2KB2A 4H4KC 4DPTA 3BEGB 4WP9A 2R8JA 4CLLA 4D3HA 1X5PA 4MKAA 4Q8EA 1SCJB 1TAUA 1LWCB 4JI6F 1XMQJ 1Y4ZB 1I1GA 3S1TA 2JVRA 1AXQA 3H5SA 4KYZA 4DFJA 4PYAA 1U1LA 5K8MA 1Q0NA 4OZ0A 3R1LA 3ENWA 2EFVA 4PUOB 1AUSL 3GYNA 2FJAB 1I94J 3QGPA 3GFHA 1RA6A 3GQCA 1NK8A 1FESA 1JLEB 4TYBA 4DV7J 3DMJA 1TFYA 1B99A 3OJSA 4USWA 1KVKA 1GMVA 3QFHA 2VJUA 3WC2A 4URSA 4C48A 3TJ9A 2QEXS 2IM0A 2QO3A 4IG3A 1S0OA 3V4MA 3CJQA 1LOUA 2XBPA 2B4UA 3C3LA 4NCGA 5K8OA 1RT1B 4NASA 4TY8B 1RWMB 2CPIA 2K3KA 2MSTA 4EFAC 4D3GA 4F25A 1M90T 5IV4A 2FZKB 1LV5A 2DBBA 4RU2A 5ETTA 3T1YF 1YJ9S 2P9CA 5E33A 5HMWA 2E1CA 3C66A 1HKAA 3JXOA 2OO4A 1NSPA 4LSLB 5E3RA 4WU3A 1KS2A 1IBLJ 3SV4A 2HBRB 1Q7LB 4P71A 1M5OC 4EO8A 1JMTA 5T7LA 1Y0HA 4UQTA 3V2UC 4LVOP 1KOOA 1G4CA 1WHVA 2HQ3A 5C24A 5AJ3F 5D0GA 2ZZTA 4H4OA 3I32A 4IH5A 3Q86A 4X62J 3DNCA 1MWQA 1ZPVA 3CJ3A 1U49A 3TYTA 3I0RB 4WFBQ 4ZVUB 3PRBA 2WZ1A 1DQ8A 4C8MA 3H4BA 2ZH1A 3WDOA 4NX9A 1IKXA 3H20A 3BDEA 2ERRA 3H40A 1R0AB 3PR4A 5HROA 1YRUA 3CJTA 1E6VB 5KFHA 1CBKA 2LQBA 1OY6A 1CVJA 2HFUA 3MEGB 3EGNA 4F26A 4XDCA 2W7AA 1HNXF 1JLFA 4DV5F 3H42A 1J5EF 1G3OA 4DV3F 2CPJA 2CJQA 1M1HA 3HDSA 3KUGA 2EG2A 3MM8A 2B5JB 2YNIB 3ILJA 4FF2A 1MW7A 4KH0B 1X5TA 4I68A 2FUG9 3J7AN 4LBIA 4WK3A 4B9MA 2CQBA 4EBDA 1SL0A 2OEMA 2LQJA 4LJMA 1HWKA 2FZCB 2G13A 4ED2A 3SCJE 1ITPA 1WG1A 2R7XA 3SMZA 2RF2B 1KKHA 3SXLA 2F1FA 1DBDA 2R42A 2GVZA 4JBCA 4IDKA 2NUUG 5KFYA 3VAJA 3VHQA 2ABYA 3ET6A 8ATCB 1XC9A 2DR6A 4QWAA 2H1YA 5IM0A 5L1KA 3M8WA 4NI2B 2VPZB 4X4SA 3TAQA 5E3CA 3KLEB 4BDPA 2D74B 2VOOA 3CO0P 5A76A 3D1OA 1W2IA 3V81A 5ETSA 2H4WB 3H25A 1LEOA 2R2UA 2KXFA 2CPHA 2CIMA 2R8KA 4DX7A 4EI2A 4WFZA 3F44A 2BEFA 3OHBA 5FLXU 1RU2A 3PNIA 3K7RA 3F56A 5DDPC 4EGLA 5D77A 2V2ZA 3GG1A 3ZTSA 2G0IA 4A8XA 1HNWJ 1H73A 3O5TB 4F7VA 1KN6A 3JAMY 1QAYA 4DSIA 4IO9Q 3OR1B 1VBXA 1JKHB 1SKRA 2J7WA 4B9UA 5IC6B 3DGPA 4ZP7A 2HHQA 1LWXA 4DV1J 4LF6J 2OJ3A 4ATNA 3CDUA 2I38A 2XMVA 5KFZA 2V2KA 3CMAS 4A8WA 3PO5A 3UN2A 1FERA 3KTQA 1EETB 3N5FA 2ZE2A 4HTJA 2XNQA 2E44A 4FKXA 1D9FA 3VVTA 4ZVTB 2OPPB 1SQGA 3MWBA 2RS8A 4M5HA 5F41A 1Z2LA 4PWUA 2IVMA 4GC7A 1ZAVA 2XYGB 2PFDA 4C4WA 4C7QA 2YKMB 1WHYA 1FJGJ 1JIHA 1RHKB 4O3OA 1HBUA 4X64F 4X66J 2CFXA 2VONA 3PHTA 2W2NP 3AJDA 4R8UA 1GXTA 2HWIA 3LAKA 4YB1P 1F5AA 1NB7A 2IJNA 2DRDA 1YRXA 4NLWA 2HHSA 4OZLA 2AF6A 4KGVB 1F60B 3HFKA 5HMXA 1BXNA 3ONQA 1S4EA 1IM6A 2VASA 2RDJA 1JXEA 4OHYA 2CQ0A 5E3PA 1R0CB 1K0VA 1ZH5A 1PILA 2RQKA 4LF7J 1REVA 4V19X 2QC3A 3M2VB 3DRSB 1XR5A 1YJNS 3ZTOA 5KFIA 2P9GA 3KJNB 2RJZA 4NXMF 2FTRA 4GO7X 4ECVA 3FQKA 4YP3A 5IZHA 3NGKA 4CH0S 4CZCA 4F50A 3EXCX 4WTYA 3PW2A 4DFMA 4ZN3A 4F4WA 2HFZA 3OT9A 1RT7A 5LXRA 2C1EB 4DR6J 5IV3A 2PMZD 1WF1A 4LFCJ 1HR0J 2KHCA 2GNKA 4CM2A 2HQFA 4P73A 3FBEA 3JSYA 3R5DA 3OR2B 5E7OB 5I3UB 4W4MA 1OY9A 3NS7B 2IAJB 1NKEA 2DPJA 1RI7A 1C0UB 3U7JA 3MEDB 2J6SA 3IG1A 3Q2TC 4HI2A 4MK8A 4PR6A 3UQSA 1ZAWA 1PBAA 5IWAF 3IBWA 2DHGA 4JV5J 4B3MJ 1VRUA 4I6AA 3DRPB 3BB5A 2ASLA 1VQOS 2R8HA 2AEMA 4LSNB 4YHHJ 3VAMA 4LQ9A 3K5MA 2AJFE 3QJLA 2MMYA 1S6UA 4ECRA 3UN3A
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 1M1K T;  2MQO A;  2ILY A;  2OEK A;  3MFI A;  3M32 B;  4ZA1 A;  3G71 S;  4DBQ A;  1W25 A;  4DV4 J;  5DDR C;  1PKU A;  4XDD A;  3EXY A;  4DF8 A;  2DHH A;  1FI4 A;  3R5A A;  2W2P P;  2BX6 A;  2HQG A;  4U8V A;  1KNZ A;  1CJU B;  2GAG C;  3B54 A;  2BVZ A;  2DK2 A;  3TZX A;  1H2U X;  2XLI A;  2FVC A;  1XMB A;  3IAS 9;  1WG4 A;  2AZ3 A;  1C2P A;  2VBX A;  1TL7 B;  2XY7 A;  2V63 A;  1S1U B;  2OPQ B;  4W98 A;  1M5S A;  5D8H B;  4I6Y A;  4Y00 A;  4C8Z A;  1LFW A;  3AA8 A;  4KTQ A;  4Q44 A;  1NUE A;  4ELU A;  1UWB B;  2RRN A;  4AQY J;  3CIM A;  3BBC A;  4ZVH A;  2B8P A;  1RDR A;  3SSR A;  4RKU C;  5HP1 A;  3W9I A;  1Y5N B;  2ZNY A;  3ISN D;  2KI2 A;  2OTL S;  4UZB A;  2YNF B;  2JOQ A;  3RRK A;  2DNN A;  4DQP A;  1HMV B;  2J9D E;  5K5M A;  2AU0 A;  1NHK L;  5HL7 Q;  1Q95 G;  1NHU A;  4B3R F;  4E8U A;  1F2H A;  2MQ8 A;  2UUW A;  2FLL A;  4DG1 B;  3MAH A;  2YWG A;  3MM9 B;  3MUM P;  3PM9 A;  4F4K A;  2HWT A;  1RYS A;  5A2Q Y;  4ZLJ A;  3KK2 B;  4DQI A;  1T8E A;  2MQQ A;  1GXU A;  4F2R A;  4RR5 A;  1PSD A;  1HW8 A;  3CJ5 A;  1S6P B;  1GH8 A;  2M7S A;  5HI7 A;  4KBI A;  3OD2 A;  3MFH A;  1VC5 A;  1PBU A;  2F4F A;  1T02 A;  3GV7 B;  4Y0F A;  1FRK A;  5K8P A;  3BO3 A;  2R7S A;  4EZ9 A;  3A12 A;  3US5 A;  2KU7 A;  4GVB B;  3A1Y G;  2BJ8 A;  3ZZ0 A;  5F0W A;  1YK9 A;  1SJQ A;  5E3A A;  5B08 A;  3D9B A;  4O4R A;  2JEG A;  4N56 A;  2G2Y A;  4ID5 B;  3OTE A;  4PXB A;  1NPK A;  2IA6 A;  1FWP A;  1GTH A;  2KTQ A;  1U0S A;  3PO4 A;  2AV5 A;  3J7Z T;  1UFW A;  2E9Z A;  4WZM A;  4B02 A;  1DTT B;  1IKY A;  4WBF A;  1RAA B;  4RW7 B;  5MLC V;  2CPD A;  1S1X A;  1CLF A;  3BO4 A;  4EK2 A;  4YS2 A;  1SPB P;  4LFA J;  2ZBP A;  2L41 A;  4IR1 A;  4DN0 A;  2CQI A;  5J2Q B;  3EUN A;  3JQK A;  2RQC A;  4IOC Q;  4I2P B;  5KFK A;  3SFU A;  2E1M C;  2CNO B;  5A8W B;  1LXJ A;  2KZZ A;  5L38 A;  4LQ3 A;  5JXS A;  3NGD A;  1U1O A;  4KB7 A;  4NA1 A;  2FC8 A;  3U27 A;  5IT0 A;  3CCW A;  2QTW A;  2YKO A;  3TQE A;  2VDH A;  2ZC3 A;  3HSJ A;  5LM7 E;  4EU0 A;  1RAI B;  1X4H A;  3OL7 A;  4DSL A;  1RBO B;  2XWY A;  4IKA A;  2MPU A;  4WP3 A;  2QG9 B;  1PGZ A;  1DFD A;  2BQ3 A;  2ZJP Q;  8RUC A;  4YEA A;  1XEZ A;  2XZT B;  2VFV A;  1B0P A;  2ILZ A;  2ZVS A;  3M6X A;  1GK8 A;  2DHS A;  4DXL A;  2RH3 A;  3MCN A;  1KD1 T;  4QIE A;  3NP5 A;  2DR5 A;  4A8F A;  1QTN B;  1RWN B;  2JDJ A;  4RW6 B;  2GO8 A;  1NZ8 A;  1FK9 A;  4QYR A;  1V3R A;  2OGU A;  3CVK A;  5EWG A;  5A8R B;  1HBM A;  4RWW A;  5HSP A;  1OY8 A;  2O67 A;  2Z2L A;  2HNY A;  1UEV A;  3QWU A;  3HSZ A;  4R0E A;  4OV1 A;  3MD3 A;  1N5T A;  4FF3 A;  3O8W A;  5CAA A;  4Q5V A;  2FHM A;  1B4S A;  1JB0 C;  4FYW B;  4OZ3 A;  4I67 A;  3P6Y C;  1JLC A;  1N5Y B;  1UA1 A;  1RAO A;  2XB2 D;  1PJ6 A;  5HVF A;  4M95 A;  4XO0 A;  5F8M A;  3D68 A;  3C6T A;  2VF3 A;  2W1B A;  3OBI A;  3IP0 A;  2XWX A;  1FWL A;  4CP5 A;  1JXL A;  2LQ5 A;  3OSP A;  2QA2 A;  3DLJ A;  5DZ7 A;  2BMB A;  2X1B A;  2M9K A;  1FX2 A;  2H9Z A;  2BJ3 A;  4HI1 A;  5D3G A;  3DN9 A;  2BAN B;  2CJX B;  3DOL A;  2EWH A;  5KT3 A;  4C8Y A;  3LF0 A;  1HNV A;  1HHT P;  1RSC A;  2K7K A;  3SBM A;  4JI2 J;  2YNG B;  3DMJ B;  4GKJ F;  2KM8 B;  1UVJ A;  1VQK S;  3MMJ A;  5F3Z A;  1NK6 A;  1XBW A;  4TU7 A;  1VQL S;  3K57 A;  2GZO A;  1VK3 A;  4I56 A;  1ACM B;  4R0J A;  5KOW A;  4JP8 A;  3AOC A;  2HHH J;  4J9N A;  4YFU A;  1JK9 B;  1X4G A;  4IG3 B;  2GQC A;  4JI5 J;  2W7P A;  2H5E A;  2JFK A;  2Z57 B;  3MAQ A;  1HWU A;  2L3M A;  5I3P A;  2XMM A;  2XCA A;  5KFB A;  2EPI A;  1KWM A;  4Z2X A;  1WC4 A;  4MKB A;  2B8Q A;  1JJ2 R;  4O4G A;  1XTZ A;  3BR8 A;  1IWA A;  2IRX A;  2HBY B;  4TLR A;  3DDK A;  4C3L A;  4U7U D;  4U67 Q;  3GYG A;  1XNQ J;  3QID A;  4ZPT R;  2H5J B;  4QYZ J;  5T7L B;  2YVS A;  5KFT A;  2BW2 A;  4BC9 A;  1S6Q A;  4C3K A;  2WSC C;  9ATC B;  1MML A;  3JTO A;  5C24 B;  2R7O A;  2XZD B;  1TKT A;  3L7P A;  3TUZ C;  1IWG A;  5KFV A;  1VHI A;  2NXN A;  2L9W A;  1UAW A;  3KLG A;  2DGQ A;  1M5V C;  3S01 A;  5C25 A;  2HYI B;  1I3O B;  4K4V A;  2QMU B;  2EC0 A;  1IKX B;  1XMQ F;  4C97 A;  4P6Q A;  5F8G A;  4JB8 B;  2QFJ A;  1VQ5 S;  3SQG A;  5AT1 B;  2E5H A;  2DIS A;  2UXD F;  3E2E A;  3ZFV A;  2RDD A;  3T5L A;  3IRW P;  4PWD A;  4GKK F;  5E5N A;  1VYA A;  3EPG A;  4K4Y A;  1EIY B;  3G87 A;  4U95 A;  4OV6 A;  4DV7 F;  3KHH A;  3EYZ A;  2J9D A;  2KG1 A;  3MAA A;  2GO9 A;  2GC8 A;  3MM8 B;  4Y2C A;  4I2Q A;  4Y6I A;  5J2P B;  2I1R A;  2VFT A;  4P2F A;  3AJ2 A;  1KSP A;  1IQT A;  1NK4 A;  5DQH A;  1X7V A;  2J7U A;  2LFV A;  2Z2Z A;  2MDA A;  3SCI E;  1SJF A;  1RAE B;  3TZW A;  3AQP A;  4M5L A;  5ETR A;  2Y1R I;  1ULR A;  2LDY A;  2X7I A;  2X51 A;  3HI9 A;  3TZZ A;  4NCA A;  3ET6 B;  5I42 A;  1XQI A;  1YZ7 A;  3MHY A;  5K20 B;  1IBL F;  5LMU F;  2U2F A;  1K8A T;  4ZN1 A;  1WTF A;  2V4R A;  2EKN A;  1VQM S;  3MEE A;  4ILR A;  2BAB A;  1J27 A;  2IC3 A;  2PGC A;  3MEC A;  4C9D A;  2VUG A;  4X62 F;  3IWN C;  1WKK A;  4MIB A;  2F40 A;  1VIO A;  1QY7 A;  3G96 A;  4YB7 A;  3GV5 B;  1N48 A;  4IUF A;  4M5D A;  3HT0 A;  1UVN A;  1E6Y B;  3TR5 A;  2KH9 A;  1U1M A;  2YNH A;  1U4B A;  3KJV A;  2HWH A;  1VQN S;  2VC0 A;  3ZTQ A;  3BBB A;  3FMB A;  3N6N A;  3TNV A;  2F9D A;  4O0N A;  1URR A;  2DNR A;  2HAF A;  2BQR A;  1M5K C;  4WCE Q;  1RT6 B;  2WAQ D;  4P7V A;  1AA1 B;  3HX9 A;  1NK5 A;  1HBN A;  4QWE A;  4O3P A;  4L76 A;  1NJW A;  3RZA A;  2K2P A;  4RNM A;  2PA3 A;  2ZE2 B;  1X4C A;  3SSS A;  2YH1 A;  2YY3 A;  4YOE A;  2A0F B;  4MFB B;  2CJK A;  4NCB A;  2LVW A;  1F6T A;  4ZIV A;  2CVI A;  2RU3 A;  3OLA A;  3G4S S;  4F3O A;  2HQD A;  1D1U A;  5F9L A;  4NMX A;  1OQ6 A;  3QZ7 A;  2QV6 A;  2GHV C;  4AND A;  3MD1 A;  3KK3 A;  1HBU B;  2JX2 A;  3BRE A;  2YWW A;  5C2C A;  2VC1 A;  4R8U B;  1RLC L;  2A6O A;  4CO0 A;  1BQN A;  3AOD A;  1W2B R;  2FLO A;  4ZVP B;  1KQK A;  2VIH A;  1ZM4 A;  1WEX A;  3CD6 S;  1TL1 A;  2B56 A;  2ZH7 A;  3IWX A;  3G82 A;  1V3S A;  1S1W B;  2R7V A;  2VBY A;  3PKY A;  4OFZ A;  3SZ2 A;  3G2X A;  2XLK A;  3AFG A;  2AX0 A;  3QGH A;  4TYA A;  4MMO A;  4UZC A;  1LK5 A;  5SZT A;  4MT1 A;  1S99 A;  2CPF A;  1JXV A;  2QIF A;  4J90 A;  4CLT A;  1PYS B;  4CDI A;  4RBU A;  1N5Q A;  4M94 A;  1IUJ A;  5KG6 A;  4LFB J;  3W8G A;  1REV B;  3Q83 A;  2ATL A;  3HPO A;  3L7U A;  2WB1 D;  3PRD A;  4OYM A;  4IOB A;  3DLE A;  1DLO A;  2E5L J;  3GLJ A;  4U9R A;  2R7T A;  1YJ7 A;  3QLH A;  1VBZ A;  4OI0 A;  3R7N B;  1URN A;  4JI6 J;  4KHR A;  4LF6 F;  3HKW A;  5HQM A;  1HI1 A;  1BE4 A;  2AJ2 A;  3DRX A;  3F41 A;  2ZBQ A;  3QO9 A;  4X4V A;  1BWE A;  1RT5 B;  1TMM A;  3L9Z A;  3MM7 B;  5LL6 d;  5KT2 A;  3Q8Y A;  3N9U C;  3MPY A;  2FVP A;  2YWF A;  1NZA A;  3KHR A;  2PFF B;  3FK4 A;  4ES3 A;  2LXU A;  3S8S A;  3PJX A;  2DGT A;  1ZM2 A;  2EFP A;  1N5S A;  1FX4 A;  1HWJ A;  2FVS A;  4NLS A;  3PX6 A;  1FJG F;  4N7T A;  1HWL A;  2AX1 A;  4OHV A;  2JJ4 D;  3DLB A;  4JI4 F;  3JQM A;  2BRK A;  1VRU B;  1N8R T;  4UOC A;  1FNO A;  3UI3 A;  2MHE A;  1VQ6 S;  4RNO A;  4RPF A;  3DOM B;  1GEH A;  4OZ1 A;  4ZLL A;  4ECQ A;  2XGP A;  2G2Z A;  3M6V A;  4NPO A;  2LEC A;  1Q1K A;  1B3T A;  1Y3K A;  2HVE A;  1TL5 A;  4J9U E;  1ZZF A;  3RAQ A;  3M30 A;  3HJV A;  4NLV A;  2JLE A;  3EX7 B;  4L73 A;  1RHQ B;  1X9S A;  5A0Y A;  2XS7 A;  2EFG A;  2F8H A;  4LRF A;  1JLB A;  1CS4 B;  1TKD A;  2MKI A;  1P9Y A;  3JQJ A;  4LF7 F;  2W7O A;  1RTJ B;  1U0H A;  2BE7 D;  3IA0 A;  5AJ3 J;  1Q16 B;  1VBK A;  4AFF A;  5GAH U;  3N01 A;  2AEJ A;  3PEJ A;  3NCP A;  1S9F A;  3W2W A;  4N41 A;  1RAB B;  1S77 D;  2BJE A;  1YZ6 A;  1KP6 A;  3SCK E;  1ZZN A;  2Q6C A;  2ZFH A;  4L74 A;  2XMT A;  4UOG A;  5HP1 B;  3RAX A;  2HGM A;  4B3O B;  4WYL A;  1RXO B;  3M9O B;  4DR6 F;  3EE3 A;  2G1H A;  5KFE A;  4ED4 A;  3N79 A;  1T94 A;  3PHE A;  1IVZ A;  4QWB A;  3RR8 A;  1VC6 A;  3CED A;  1N56 A;  2R8G A;  2MGZ B;  1NCL A;  5M2U A;  1OIA A;  2EEY A;  3HVT A;  3MMC A;  1SIZ A;  3UWT A;  2VH7 A;  3UDL A;  1Y11 A;  1NK7 A;  4FVM A;  1R43 A;  4DLG A;  2HBQ B;  1C0T A;  5DLF A;  3HHN B;  2CKW A;  2DNL A;  2AW0 A;  2ZD1 B;  1LWE B;  1TL3 B;  2MY8 A;  4I6W A;  4ED1 A;  1Y7P A;  1WWH A;  4DHV A;  4JV5 F;  1ZA1 B;  3DLG A;  2OFH X;  4J91 A;  4YY3 F;  2DNQ A;  3UCG A;  3GJS B;  4G1Q B;  1KBR A;  2VD3 A;  2DY9 A;  3GCW P;  4ED7 A;  1VRT A;  1Z2Z A;  1HPZ B;  3MR3 A;  2ASD A;  3D4J A;  1APS A;  3TVY A;  1OQ3 A;  2CQG A;  1TUW A;  3RAM A;  5BYS A;  3G8T A;  4J5O A;  2IVY A;  2V68 A;  2ROE A;  5HJX A;  4DV4 F;  4O44 A;  4KIA A;  1SJR A;  3C19 A;  1IN0 A;  4PWW A;  5J1E A;  2YKN A;  2MKK A;  3J80 U;  5LSL A;  1YG0 A;  1NU4 A;  2CZ4 A;  5B0E A;  3BYR A;  3EGV A;  3DRR A;  4JI8 J;  1IKY B;  1QM9 A;  1ZM9 A;  3NCQ A;  2R7R A;  3BKT A;  1S1X B;  3WX4 A;  3SYZ A;  1OPZ A;  3CJR A;  3CDW A;  5DG7 A;  3AQO A;  4X4P A;  2M3D A;  3BR9 A;  3J81 Y;  2KG0 A;  3MUT P;  4CYU B;  4DX5 A;  1IBK F;  2BKN A;  4FS1 A;  3DM2 B;  4AQY F;  3L3C A;  2XG8 A;  4Q0B A;  3OVA A;  4A8O A;  2KT2 A;  1AZS A;  3H2L A;  1D9A A;  4ECY A;  2HSE B;  3WC0 A;  3NBP B;  7FD1 A;  2H54 B;  1U1P A;  3EDQ B;  5U47 A;  3R1H A;  4YDX A;  4KQZ A;  2Z0G A;  1HFE L;  1N52 B;  2XQC A;  3EJM A;  2LQ9 A;  2MB0 B;  2D3O R;  5CQG A;  4WU2 A;  1AYE A;  2ASJ A;  1KVJ A;  4OI4 A;  4ED3 A;  4ILM A;  1F1B B;  2Z30 B;  2PC6 A;  3HHL B;  2ZZN A;  3PG9 A;  4GVL A;  2F5G A;  4WII A;  4IG0 B;  1UVM A;  3P3D A;  2XEX A;  4KPY A;  3R5C A;  1SV5 B;  3QWP A;  3BQ1 A;  1TAQ A;  4OIX A;  2P6T A;  5KFF A;  2DXD A;  3MCM A;  1NH8 A;  3FRY A;  3UD4 P;  3KG1 A;  2V8P A;  2B7C B;  2MKS A;  2D41 A;  1ZPW X;  2YQ0 A;  1JJC B;  1RWW B;  3TAM B;  1MU2 A;  1P6T A;  2HLT A;  3CC7 S;  1FK9 B;  4LT6 A;  2WON B;  3B8H A;  4X64 J;  1QLN A;  3ZC4 A;  3O2I A;  5F8L A;  3FGV A;  2HNY B;  4CTA A;  1NXI A;  1WHX A;  2IM3 A;  3VZH A;  3VAK A;  2E1P A;  1RAD B;  1RBL A;  1RQ0 A;  3NMA A;  1NK9 A;  1TQL A;  4Q2L A;  1OYE A;  2HGN A;  3ZXW A;  2I8E A;  4KV8 A;  2I9S A;  4KPC A;  5A6P A;  2ZNZ A;  4HHJ A;  4NWB A;  4IRD A;  4LFA F;  1HI8 A;  3C6T B;  2D69 A;  4JI0 F;  2DH8 A;  2PEH A;  2F8M A;  2W4P A;  4DPY A;  2RQM A;  2GS8 A;  4P2S A;  3CSK A;  4I69 A;  1FCA A;  4MK7 A;  2GW8 A;  5DQI A;  1C4C A;  1IBC B;  3VGV A;  1H7X A;  2EKY A;  5D3G B;  3DKD A;  4J9L A;  4PQU B;  1RT4 B;  4ZOS A;  3UD3 P;  2VFU A;  1WOR A;  4J9K A;  1RT3 B;  4OLP A;  2HFN A;  3RR7 A;  2XMW A;  2AYE A;  1PJ5 A;  4UT4 A;  1FD2 A;  1RK8 A;  1V6H A;  3CMQ A;  3TVZ A;  1N0V C;  2PO4 A;  5IS2 A;  3R5B A;  2G1D A;  4OHX A;  1FXL A;  2HVD A;  1Q86 T;  2B6A A;  3CJK A;  4K4U A;  1K1Q A;  5KAK A;  1ZBT A;  3GPA A;  5M2R A;  4K4Z A;  4K5R A;  1LW2 A;  2MLZ A;  1D9D A;  2D9P A;  1IKV A;  2KZM A;  4ZDN A;  1YJW S;  4NEZ A;  5DJB A;  1FXR A;  4KO0 A;  5IWA J;  1CJK B;  2DR8 A;  1S48 A;  2FY1 A;  4RO0 A;  1TR0 A;  3DXB A;  2ZJQ Q;  2RDI A;  1UJ6 A;  3CCJ S;  1FDB A;  2HRU A;  1KTV A;  1QD1 A;  3ZZO A;  2JLG A;  4J37 A;  1RHU B;  2J5A A;  4RW4 A;  3M2R B;  2QLX A;  3R8Y A;  4L75 A;  4ZPW R;  2BV3 A;  2X1A A;  5I3Q A;  2FLN A;  4JI7 J;  3T5H A;  4WXW A;  2L9D A;  3GTY X;  3ILI A;  1P27 B;  4FNI A;  2VG7 A;  5C25 B;  1RHR B;  4DR1 J;  2EBG A;  3I9Z A;  3K5P A;  1N33 J;  1ZOT A;  2LA6 A;  5IOL A;  2CJ9 A;  4ENO A;  4NML A;  4FF4 A;  2IHR 1;  4LR8 A;  4ERD A;  2RU9 A;  1YJU A;  4HDH A;  2FY8 A;  3DLK A;  2CPZ A;  4ZCM A;  3CCU S;  4QOT A;  1EX8 A;  1X4D A;  1M5P C;  5KFN A;  3OTD A;  1K1S A;  2BKP A;  2HGL A;  1SVD A;  4JI2 F;  4CNY A;  2B9W A;  5ADZ A;  4QBU A;  2BDP A;  3MAA B;  1WEL A;  2IRU A;  1Q82 T;  4DU8 A;  4I2Q B;  5KFG A;  3KWM A;  3VQT A;  4OI6 A;  1SKW A;  3AY0 A;  3LPY A;  5C2G A;  2ZUG A;  3B6B A;  3M8P B;  3KUH A;  4NZ0 A;  3EVO A;  2CDQ A;  4JI5 F;  1TUG B;  2MKJ A;  3HD1 A;  4B3R J;  4DUY J;  3MI7 X;  3LWM A;  2E66 A;  5FLX Y;  4A8K A;  4FXW A;  5D4P A;  3AA9 A;  5T41 A;  2UZA A;  4OZN A;  1MRO B;  3M8R A;  1JNR B;  1SUQ A;  4OX6 A;  2RVJ A;  3E01 B;  4OZ5 A;  3SDE A;  3QGG A;  2BAC A;  2XYH B;  2W9B A;  1R8A A;  2ZH9 A;  1UCN A;  3VWS A;  2V4J A;  4DPX A;  5I42 B;  3PFO A;  4NXN J;  1BUX A;  5JUM A;  3C14 A;  1QE1 B;  5L1L A;  3O3L A;  1TVR A;  3F73 A;  2NZ4 A;  4LSZ B;  2RRB A;  4LF2 A;  5AE1 A;  1L3K A;  1XNQ F;  1R89 A;  1N6Q A;  2DEJ A;  3BGF A;  4ZHR A;  3MEE B;  2KT3 A;  3GU0 A;  2IC3 B;  4QR1 A;  3ENA A;  3GCX P;  3MEC B;  2R7Q A;  3PAC A;  2KFY A;  4W92 B;  3I55 S;  1AFI A;  1L3T A;  1YLX A;  4M5D B;  5LJ5 Y;  1NB2 A;  4JI3 J;  2H65 B;  4TKT A;  3PYE A;  4WFX A;  3RRG A;  2YNH B;  2Y0S D;  3N0V A;  1F0X A;  1TEL A;  3EVW A;  3NGU A;  4ECW A;  2Y8W A;  4B08 A;  5LJ3 Y;  1F9E B;  2HMI A;  2I5J A;  5IQ6 A;  3H59 A;  4USM A;  4O3R A;  5HBM A;  1TMJ A;  1EP4 A;  4P2X A;  3WX8 A;  3PJ9 A;  3BJY A;  2HFO A;  5B0B A;  3V6H A;  2E9T A;  1HBN B;  3GII A;  1RYR A;  3KUE A;  2B51 A;  3V4I A;  1HQU A;  2KL8 A;  3U02 A;  1YIJ S;  2LMI A;  2UUC J;  4PEO A;  3GIL A;  5KG0 A;  4ZVE A;  4IQX A;  1R8C A;  4N47 A;  4RNF A;  2QFI A;  3MUV P;  2HZV A;  1U8S A;  3UVJ A;  1SQF A;  2XLJ A;  3AXM A;  1X4B A;  3GJQ B;  1T3O A;  1T9T A;  4OQJ A;  1FJ7 A;  4ELT A;  2A3J A;  3SIP B;  1RAF B;  2FJE B;  4KHP J;  1B7F A;  2C28 A;  4FBT A;  3A8E A;  5HQL A;  2EK1 A;  3LP2 A;  5JMN A;  4DSE A;  3GJR B;  4DFK A;  3TJA A;  4P72 A;  3CD5 A;  1HBO A;  1CC7 A;  1NKB A;  1MN9 A;  2Y0B B;  3QGI A;  2VG6 A;  4WF9 Q;  4ZLN A;  2QMW A;  5FD1 A;  3NGR A;  2UVW A;  1YHQ S;  1TL1 B;  3G82 B;  3CO9 A;  2R3V A;  2Y1I A;  3D66 A;  4ZPB A;  2KXH A;  3MGJ A;  1JLA A;  1ROF A;  2C2D A;  3CUL A;  2LXF A;  2XI2 A;  1DY3 A;  2F8E X;  2CPX A;  4H4K A;  2V67 A;  2Y1L B;  4ILL A;  1RBA A;  2QLB B;  3LAN A;  3VF0 B;  1L3S A;  4MIW A;  2M0G B;  1FEH A;  4M5M A;  2ZH5 A;  4DFP A;  2WCX A;  1QUP A;  2HS0 A;  3QZ8 A;  5CZX A;  2MKY A;  3OPK A;  3DLE B;  1JLG A;  4ECZ A;  3E51 A;  3P4U B;  2C42 A;  1S9G A;  3EGW B;  2F9J A;  4X2B A;  2YWE A;  3CT9 A;  3BGL A;  1NSK L;  3M2U B;  5HK4 A;  3EVM A;  5CCL A;  1UJ5 A;  2B7B B;  1U24 A;  2GVD A;  1LW0 A;  1GFW B;  1SC4 B;  1S97 A;  2MXY A;  3FFI A;  3MCO A;  4DX8 H;  2MYF A;  3DYA A;  3HSD A;  5FII A;  2BJ1 A;  1HNI B;  2MKH A;  2DCL A;  4WYW A;  2N3L A;  1RTI A;  2YKQ A;  2O5D A;  3ELH A;  2XTJ P;  1R8B A;  2LQ8 A;  1FA0 A;  4XTT A;  1QTM A;  2N7C A;  2WOM A;  3BPS P;  2F4V J;  4OI1 A;  2XCP A;  3GMG A;  3S7R A;  2VQF J;  4FXV A;  1DQA A;  5HJY A;  1K73 T;  2ZIT A;  3HHE A;  1IM4 A;  4HHU A;  1H0H B;  3T9Z A;  3W5X A;  4CLY A;  2FIU A;  3IRX A;  2W01 A;  1Q8K A;  4RW8 B;  4JI1 J;  1RHJ B;  4HT5 A;  2D3Z A;  4DQR A;  1SJ4 P;  2W24 A;  4IRK A;  2D9O A;  3KK1 B;  4MKV A;  5GAG U;  2B9E A;  5E0O A;  3IFE A;  4CT8 A;  1YJV A;  1IR1 A;  2HHP A;  1R8P A;  3M30 B;  3ILO A;  4OYW A;  3SFG A;  3A4T A;  2PE8 A;  1S7H A;  3EM1 A;  5A0Y B;  1FE4 A;  5C42 A;  2IIH A;  3LP1 B;  2K1R B;  2W9C A;  1JLB B;  1BWV A;  3MMA A;  5KFQ A;  1HQE A;  4U6P A;  3CCR S;  4YUD A;  1TU0 B;  3FMW A;  2B0G A;  5C7P A;  1U0H B;  3GFY A;  5CHC B;  3VV2 B;  4BLG A;  3JSM A;  1BD6 A;  2QL5 B;  4A48 A;  4ED0 A;  3PTW A;  2E5L F;  4C0O C;  5F8I A;  3J7A 1;  3OUY A;  2XHW A;  5AE2 A;  2N3O A;  4Y2A A;  2YBV A;  3QSY B;  1S1T A;  3PYF A;  4UST A;  1G2E A;  1YDL A;  2R8I A;  4J9S A;  4N77 A;  3MR7 A;  1WKJ A;  2H3E B;  2SXL A;  2UXD J;  1RWO B;  1HQ2 A;  4USJ C;  2DRB A;  4GKK J;  1KLN A;  2DO4 A;  1FRX A;  3DDI A;  1Z4U A;  2HEK A;  5D78 A;  4L6V 3;  1NJI T;  2NZC A;  1UVK A;  3NG8 A;  2OLW A;  3MMC B;  2FJD B;  4ZVO B;  1R7I A;  1NKC A;  4DCO B;  2W4D A;  2KVI A;  1PC4 A;  4RNH A;  1SB6 A;  1KHW A;  1LWC A;  5D4N A;  3W63 A;  3GFX A;  5E3Q A;  3TA0 A;  2MSS A;  3T5J A;  2XY5 A;  4AYB D;  3HHK A;  2YH0 A;  4Y2M A;  1RTH A;  1NJX A;  4O3N A;  2BW7 A;  1F3V A;  1ZM3 A;  1NO8 A;  1HNZ F;  1JLE A;  1X9M A;  2FVQ A;  4J9V A;  1Q78 A;  4QYZ K;  3L95 X;  3MPW A;  1PYT A;  2UV8 G;  3KJF B;  3GV8 B;  1SH3 A;  3PY8 A;  4ZCL A;  5LMU J;  3TZY A;  2FJV A;  4KGM A;  2XO7 A;  4IO1 A;  5HAT A;  4CQ1 A;  2IBO A;  1C4A A;  1PJ7 A;  2ZKT A;  4C8K A;  2VG5 A;  2KKH A;  3T6B A;  3KHL A;  1RT1 A;  4TY8 A;  2HND A;  1VMB A;  3R2C J;  3HZE A;  1A0O B;  1F9F A;  1YQH A;  3DI6 A;  2HK2 A;  2R2S A;  3QBC A;  1TTH B;  4KHM A;  2YPZ A;  3BM7 A;  3K0J A;  3T3F A;  3HCX A;  3H90 A;  5EDW A;  1QSL A;  2QX0 A;  3C15 B;  2Q43 A;  2ZJR Q;  3PDN A;  4Q0B B;  1WHW A;  4LSL A;  4NLT A;  4IH6 A;  3NGS A;  1AZS B;  4K8R A;  1UW9 A;  3FDS A;  1FXD A;  3NS6 A;  3D1Q A;  3AAW B;  4N8O A;  1T9W A;  1S7I A;  1JJH A;  3ULH A;  3IM8 A;  5RUB A;  2HFV A;  1NND A;  4QIW D;  3HVR A;  3MPD A;  4WE1 B;  3CD0 A;  3HVW A;  3CJ2 A;  3RBZ A;  1WC3 A;  4O0I A;  1KLM A;  4ELV A;  2EI5 A;  4ANE A;  3Q8Q B;  5B0C A;  4AE5 A;  1FD8 A;  2E7V A;  5KFL A;  3T1H F;  4DPU A;  1NK0 A;  3IAM 9;  2ZOF A;  3RTV A;  4IFV B;  1VHF A;  3MEG A;  1XR7 A;  1NLK L;  2GIR A;  3R3T A;  2WK4 A;  4KKO B;  2QSW A;  2XY6 A;  1R31 A;  2CQC A;  2GMH A;  2GMJ A;  1O0P A;  2G9O A;  4CTA B;  1BGX T;  1DAR A;  3HF5 A;  3MPU B;  2QJ3 A;  3MCS A;  2HFS A;  2NXC A;  4USH A;  2JC1 A;  4LVN P;  1GT8 A;  3S6E A;  3UW1 A;  3ZZR A;  3NAI A;  4JI8 F;  1R6Y A;  1S6O A;  4KV8 B;  4CO2 A;  1KQG B;  2DCU B;  3W61 A;  1A9N B;  2CA9 A;  2WBR A;  3RU0 A;  3PYG A;  4ZK7 M;  4K2J A;  2NSC A;  1GMU A;  3AD8 C;  3SEO A;  4A8Q A;  2J6U A;  1Q5Y A;  1T9U A;  1PYO B;  4NI2 A;  4OX9 F;  4Q8F A;  4OX7 A;  4HAC A;  5C5J A;  2A2D A;  1I51 B;  4FS2 A;  1FNM A;  1B0V A;  3NRB A;  4PG5 A;  4P9S A;  3G6X A;  4PPD A;  4C6A A;  1HA1 A;  4WKY A;  5D15 A;  3A3N B;  2GGP B;  4CO5 A;  3UCU P;  3EGZ A;  4X4R A;  4L3N A;  2C3O A;  4CLK A;  1NRK A;  4WFA Q;  2OML A;  5H1S V;  1Q5V A;  2QYC A;  2W8L A;  1JX4 A;  4OI3 A;  4N76 A;  4RNN A;  3L4B C;  1S9E B;  3M8Y A;  1X31 C;  3LP0 B;  2V8H A;  1T9V A;  1R3N A;  4K4X A;  4A8M P;  3FBC A;  3B4M A;  2GJI A;  1EB0 A;  3UNG C;  5DG9 A;  4PKD B;  5KG5 A;  5DRK A;  4F4X A;  1IJF B;  2OPR A;  3RBX A;  3K17 A;  5H9F J;  1JKH A;  3DOK A;  2AYB A;  1SBR A;  3FZ2 A;  2RAQ A;  1IKV B;  1N34 J;  3V6K A;  4DR4 J;  2CG8 A;  2ZDO A;  3GON A;  4KO0 B;  1MNE A;  3ETO A;  4DL3 A;  1MN7 A;  1RT2 B;  4JI4 J;  5E2Q A;  4PG8 A;  2ROP A;  4ALZ A;  2W2O P;  3HP6 A;  1XIQ A;  3KLV A;  2WHO A;  4X4O A;  1RAG B;  2OPP A;  4V19 J;  3NKY A;  4I7F B;  5ETM A;  3OTB A;  4RW4 B;  1VS3 A;  1WOS A;  3MTK A;  4LF8 F;  2M2B A;  2V69 A;  2AYG A;  3CJ0 A;  2YKM A;  3MDF A;  2HUR A;  2V2V A;  3IR5 B;  2EC2 A;  4YQW A;  4N8N A;  4C11 A;  5ETO A;  3Q8S B;  3FCH A;  4H4M A;  1WC5 A;  2WVE A;  2NPF A;  2P5V A;  2CQP A;  1B7Y B;  3C6U A;  2V5H G;  3V5R A;  4WK1 A;  3BSN A;  5DO2 A;  1RKI A;  1U25 A;  2CJB A;  1UFL A;  2DKO B;  2FLP A;  3CCZ A;  3BF4 A;  5CCM A;  3QJP A;  2M8D B;  1CJT A;  4DMZ A;  3OFE A;  4LBP A;  3UPF A;  5A8K A;  2UUA J;  4MYU A;  1U45 A;  4ZPV R;  2J0S D;  4B17 A;  3BQ2 A;  2KHD A;  3VCD A;  4ED8 A;  5EX3 A;  1DTQ A;  3LUY A;  2NUH A;  5KFP A;  1X8D A;  2DNY A;  1R6V A;  2YWK A;  1FFG B;  6FD1 A;  3OTC A;  3M2V A;  5HLF B;  1FDN A;  2DNP A;  3DRS A;  5FDL B;  4DUZ J;  1SXL A;  2CZ9 A;  4LUB A;  4DL5 A;  1DJ0 A;  3FQL A;  2QLW A;  3M4X A;  1SUQ B;  4IYQ A;  4QWD A;  3SDE B;  2W9B B;  1CG2 A;  2KRR A;  1U8W A;  2YTC A;  1VC0 A;  1SJ1 A;  2PII A;  3FBF A;  1U09 A;  2X3G A;  3G6E S;  1DZ5 A;  4YY3 J;  3ZZP A;  3A3O B;  4DF4 A;  5CYQ A;  5D0R A;  3SQO P;  2CAJ A;  1F5C A;  3OR2 A;  5I3U A;  1N6Q B;  2C2E A;  3P8B B;  1RB0 A;  2IAJ A;  4ES2 A;  4E98 A;  5THW A;  4DSF A;  3H5X A;  3TRG A;  4QZV B;  1C0U A;  1YJT A;  3MED A;  4AD6 A;  1AB8 A;  2GQQ A;  3IS9 A;  4JI7 F;  1FNX H;  2DNK A;  4FZV A;  4ZP8 A;  2W25 A;  5HMZ A;  2RKI A;  3PR5 B;  3RB6 A;  4ANC A;  4P52 A;  2NSB A;  4DR1 F;  1N33 F;  4B9N A;  2AP6 A;  3DRP A;  2OSR A;  5M2P A;  4Z37 A;  4NLU A;  1NME B;  3KNG A;  4LSN A;  2RIL A;  4PCQ A;  3GR0 A;  1OPI A;  3KLH A;  1K44 A;  1H3D A;  1ICE B;  1S59 A;  2VFS A;  2MTL A;  2I2Y A;  1ZET A;  2I5J B;  3AH6 A;  1IBK J;  5HBM B;  2P8I A;  4RJV A;  3CME S;  3NNC A;  4F4Z A;  2IPO B;  3R97 A;  4A4J A;  4I0W A;  1T9X A;  5H9E J;  2R7W A;  1FKO B;  4CT9 A;  1CJU A;  1HQU B;  4A8S A;  5D0E A;  1YBT A;  3BN7 A;  4NLQ A;  1SH2 A;  2CNN B;  5B0D A;  3J7Y U;  5CYM B;  3PFE A;  1TL7 A;  4DUY F;  3Q8R B;  4RW9 B;  3OL6 A;  2OPQ A;  4OMF G;  2F65 A;  3EWG A;  3V6D A;  1X5O A;  3UVJ B;  2JVO A;  3FUY A;  1NPP A;  2D7S A;  3P49 B;  5EN1 A;  3THT A;  4K2X A;  1XER A;  4NXN F;  2ZOG A;  1ZAX A;  3IGN A;  2GX8 A;  3G8S A;  2YNF A;  3VAI A;  1TK0 A;  1HMV A;  3TEH B;  4ZVG A;  2ACM A;  2VG6 B;  3VGU A;  1KFD A;  2OPS B;  2UXC F;  1Y3J A;  2OSQ A;  4ECS A;  1H38 A;  1RHM B;  4WTO B;  2PN6 A;  5KFW A;  2GA7 A;  1G7C B;  4DG1 A;  2RE1 A;  5B0F A;  2VIC A;  4ICL A;  1TKZ B;  2HQI A;  3ILL A;  3M1V B;  2FJW A;  3OVB A;  3MR2 A;  4LF4 F;  5BYR A;  3KK2 A;  4UY8 5;  3PJW A;  3CB4 A;  3JSR A;  3KHG A;  3GIJ A;  2J0X A;  2FVR A;  2YKA A;  4C0B A;  4JI3 F;  3OSN A;  5EWF A;  2H4Y B;  4WKR A;  1S6P A;  4FDF A;  5HN0 A;  2I6W A;  1CC8 A;  1U6F A;  3QAU A;  1S9G B;  5MAO A;  1L5U A;  3FEY B;  4DQQ A;  1WKL A;  4RUB A;  1D0E A;  4JI0 J;  3NNH A;  1SQE A;  2ATC B;  3RGI A;  1BC6 A;  2N4D A;  2BA9 A;  4GVB A;  1U1Q A;  1FT8 A;  2OAU A;  1HYS A;  4J7C A;  1J2V A;  2R7U A;  4K0K F;  1LW0 B;  4ECU A;  4ID5 A;  1VFJ A;  4O3S A;  3RB4 A;  4EBE A;  3DYA B;  1X0P A;  2UUC F;  4DV0 J;  4RW7 A;  1RKJ A;  4KFB B;  4LBH A;  4AXJ A;  1RTI B;  3HK2 A;  4Y34 A;  1UVI A;  1RWV B;  5J2Q A;  5ETL A;  2BM1 A;  5GAD U;  2XSJ A;  1QJH A;  3B82 A;  2VQE F;  5A8W A;  1P1L A;  5LSO A;  2ALZ A;  3TWZ A;  3FCW A;  1PIE A;  4EZ6 A;  1Y9O A;  4KHP F;  4Y65 A;  3BS9 A;  3L7O A;  3IRX B;  4ZLP A;  1UZD A;  2OI2 A;  1KR4 A;  2XHC A;  3BYP A;  3Q8U A;  1BQM A;  4WPA A;  3QAE A;  1YJR A;  1FRH A;  1BQX A;  3UD5 A;  2IYG A;  4EUV A;  2L9N A;  5B0G A;  1T11 A;  3IM9 A;  4DZ6 A;  3T9N A;  5DLG A;  4DPW A;  2YKP A;  3PX4 A;  2CXE A;  4LF9 J;  4QR0 A;  1KON A;  3UR0 A;  5C42 B;  4NL5 A;  4KGX B;  3MM6 A;  2DT9 A;  1OSD A;  2F63 A;  2WVF A;  2VPW B;  1U2C A;  3Q2S C;  2W9C B;  4ECT A;  3MMA B;  1HQE B;  4F04 B;  5EGY A;  2Q66 A;  4DX6 A;  1WI8 A;  2K8G A;  3QRP A;  1HI0 P;  1T03 B;  3T41 A;  3JSM B;  5ETP A;  4CNZ A;  2Y1J A;  2HBZ B;  1OO0 B;  4FYX B;  1FJC A;  5BJR A;  4TQS A;  2B9Y A;  1YX2 A;  1FWK A;  2ZDP A;  4BC7 A;  2FGO A;  2OMO A;  2VKZ G;  4Z7Y A;  3ICL A;  1SKU B;  1YVF A;  1P8G A;  1S1T B;  4ZKA A;  2UVR A;  4QWC A;  4NLD A;  3K2Y A;  4FP9 A;  2GQ2 A;  1XNR J;  3LGM A;  2MHN A;  4B9T A;  3ENQ A;  4KH1 B;  3Q23 A;  4U7U K;  5HQ8 A;  2V9K A;  2EW9 A;  5HO4 A;  3SCL E;  2XMK A;  1VQ4 S;  4HL9 A;  3CDE A;  3BGU A;  3WIU A;  3TP2 A;  1RAC B;  3J80 Y;  4QIF A;  2MZT A;  5CD4 A;  2BJD A;  4NZ6 A;  4MTP A;  3M6W A;  3D0G E;  3M9N B;  5ETQ A;  3CCE S;  2F4V F;  2VQF F;  1EJ7 L;  4KT0 C;  2EG1 A;  2XC9 A;  1WSR A;  3DDN A;  3IWL A;  5KFC A;  1UJ4 A;  2AGQ A;  1N36 F;  4C8O A;  3NNA A;  4JI1 F;  4K50 A;  1RTH B;  4G1I A;  4ZVS B;  4NCG B;  2BAN A;  3CJS A;  3FNN A;  1IR0 A;  2IJF A;  2PSZ A;  5ETV A;  4Q7A A;  2A6M A;  2IM1 A;  4OJG A;  4QIG A;  2YNG A;  3OW2 R;  1WD6 A;  2VBW A;  3ZNJ 1;  1AW0 A;  2QN6 B;  2JH3 A;  3TVK A;  3N4W A;  1U1K A;  2QZ8 A;  5KT5 A;  4ZJQ A;  2AJ0 A;  1GMW D;  3VGT A;  1X0F A;  3RBE A;  2BOA A;  2DY1 A;  2V9W A;  2CNL B;  4RWX A;  3EZU A;  2O3D A;  2VG5 B;  2FHJ D;  5L9N A;  3RUB L;  2MQN A;  3MPV A;  1RGV A;  2HND B;  5L1J A;  3CW2 C;  2BRL A;  4H4O B;  3QMQ A;  3DI6 B;  2DHX A;  3HSG A;  2MQL A;  3I56 S;  2YX1 A;  3AD9 C;  2ZVI A;  1HW9 A;  4FYY B;  1KTQ A;  4K5S A;  4WIQ A;  2FJX A;  3N6L A;  3CD7 A;  5F8J A;  4TQR A;  4CI0 B;  5KT4 A;  3FZB A;  1RWK B;  2JWN A;  5HRO B;  3OXF A;  5KFS A;  4HR2 A;  1SKS A;  1WUU A;  2L48 A;  1JLF B;  1UMJ A;  4HEA 9;  4I64 A;  2BM0 A;  5GME A;  1M0S A;  2FHO B;  3TA1 A;  4F0H A;  3I31 A;  2DNG A;  1WC1 A;  5LMN J;  2HVI A;  1V5I B;  2HW3 A;  2RSQ A;  3W8P A;  3VTI A;  4KGZ B;  1FTR A;  2ZH2 A;  1O8B A;  3W2V A;  1KLM B;  3D7S B;  4JOU A;  3LWL A;  3OL8 A;  3LGH A;  2JSX A;  3LAL A;  2HRT A;  5KG1 A;  1DQ9 A;  3W5Z A;  1RE1 B;  1VQ9 S;  3B4D A;  1RTD A;  5KT6 A;  3HHL D;  1U6Z A;  2W9A A;  4PZV A;  5JJB A;  4Y28 C;  7AT1 B;  2GVZ B;  4NE9 C;  4NA3 A;  2IM2 A;  4IDK B;  3W66 A;  4PXC A;  3AB4 B;  1XR6 A;  1HHS A;  3LQV A;  2ZZM A;  1LQ9 A;  2CQ3 A;  3AT1 B;  5IM0 B;  2FYX A;  4PG6 A;  5J2P A;  1FEE A;  3UDC A;  1U48 A;  2HG4 A;  2N7Y A;  4C8L A;  3CDA A;  2OEJ A;  4FVC A;  4CO4 A;  3D3B J;  2ZWO A;  2KM8 C;  3V81 B;  4B3S J;  4NYZ A;  2MEW A;  2CZV C;  3R5J B;  3UCZ P;  1OSC A;  3ETM A;  2DEI A;  1WI6 A;  4MKY A;  1EHW A;  3I6P A;  3NGT A;  4XK8 C;  3CE8 A;  1EKR A;  4CLF A;  3I9V 9;  1IBM F;  3TW0 A;  3IO1 A;  2WB4 A;  4J9R A;  3OXL A;  2IJR A;  4HAC B;  3N6M A;  3IBC B;  5D4L A;  5D4O A;  2P2C B;  5DGB A;  5EWE A;  1ZA2 B;  3VAG A;  1RCO B;  3UFC X;  1KHV A;  2E1R A;  2HRY A;  4HH0 A;  4F02 A;  1U47 A;  2N82 B;  3JYT A;  1QVF R;  1K9M T;  3DGP B;  4OZ2 A;  2WW8 A;  2ZM6 F;  1E6Y A;  2IFX A;  2HHU A;  3KLF A;  1KFS A;  2MQM A;  2HS4 A;  3GIR A;  2J76 E;  2RB7 A;  4GO5 X;  2QRR A;  2KJV A;  4HLB A;  4NOH A;  2VBZ A;  2Y8Y A;  5F8H A;  3H8Y A;  3O1L A;  2OPR B;  2Z2Y B;  3ZZZ A;  2XS2 A;  3GIM A;  1YRT A;  3PYD A;  3QT7 A;  1RT6 A;  3DOK B;  4ZJO A;  4RUC A;  1WC0 A;  2IMW P;  3CIZ A;  5B09 A;  2DXE A;  2LEA A;  1OJ4 A;  2JLF A;  4DDF A;  3W60 A;  2YPY A;  1HWI A;  4BBY A;  1XK8 A;  2FJB B;  2NR0 A;  5KFX A;  3MUR P;  3LGN A;  2ZWP A;  5K14 A;  2RHQ B;  5ETN A;  4DV2 F;  1VRQ C;  5DS7 A;  4MFB A;  4OI2 A;  2FQQ B;  3TAP A;  4JYA F;  2NRE A;  5IT9 U;  2B9X A;  2F7V A;  2B43 A;  3NLC A;  3BGO P;  2GIQ A;  4F3M A;  3FVY A;  3MM5 A;  4MH8 A;  4QJV A;  4NLR A;  1S0N A;  4NLY A;  1C1C A;  1YSJ A;  4MIA A;  3W3S A;  4C11 B;  5J2N A;  4H4M B;  3W65 A;  1FO1 A;  3D2W A;  3C6U B;  3Q22 A;  3OFH A;  4WXO A;  4Q43 A;  2ZHB A;  1RAH B;  2GIF A;  4X4Q A;  3W64 A;  3GSD A;  3O6Q A;  1X4E A;  5K9F A;  3EZ5 A;  3BSO A;  1S1W A;  2OEL A;  4A47 A;  1Q4R A;  1CJT B;  3QIP A;  1QDU B;  3PCO B;  5D6G A;  5A8K B;  4UUW A;  2C3Y A;  3G86 A;  4DL2 A;  4AL6 A;  1CPZ A;  3MTJ A;  1SC3 B;  4CIO A;  4PPZ A;  3QJJ A;  3PXG a;  3M8S A;  3PV8 A;  2BQU A;  1RT7 B;  4CRJ A;  2VU5 A;  1DTQ B;  3BSC A;  3D28 A;  4C2M A;  4ZIW A;  1RP5 A;  3KLI A;  2A2C A;  1KQF B;  2DJW A;  2XYP B;  4OYI A;  3ZNU A;  4LRB A;  4CLW A;  2DIU A;  3IXQ A;  4QW9 A;  5KFO A;  3LTO A;  4P74 A;  4TVA B;  2CVE A;  3IG1 B;  2DGX A;  4DZD A;  3T5K A;  1N34 F;  4ETX A;  4DR4 F;  2ROG A;  4UUX A;  1Y10 A;  1YBU A;  3KKF A;  1RA7 A;  2DIT A;  3LPE A;  5CYQ B;  1RT5 A;  4CWB A;  5DM7 Q;  3MM7 A;  3I4P A;  4WFY A;  2NYH A;  1WEY A;  3WZ0 A;  1HNZ J;  2D3U A;  2QMX A;  5GAH I;  1HAR A;  1VQP S;  4PXD A;  2IDL A;  3KDN A;  4U96 A;  3SSQ A;  1NHV A;  3OFF A;  2Z56 B;  4NZ7 A;  2VZ9 A;  3FC9 A;  1LK7 A;  1JQG A;  3NOC A;  1GX5 A;  1S12 A;  1T05 A;  3IS9 B;  1SI9 A;  3OHA A;  3TO8 A;  1UPM B;  2RKI B;  1AUD A;  3Q89 A;  3LAM A;  3M05 A;  1TUV A;  2CG4 A;  3I96 A;  1FHT A;  3DOM A;  4LF1 A;  1X60 A;  2Z2M A;  1YKW A;  3KLH B;  2C2O B;  1UW4 A;  1QAJ A;  2E5J A;  2HZC A;  3BV8 A;  1WSV A;  4ZJL A;  3K8V A;  1D8Y A;  3Q8V A;  3M6U A;  2UUA F;  2LEB A;  3QQC D;  3KOA A;  3PKM A;  1FDD A;  1V3Z A;  3TUP A;  5CZV A;  4B3T J;  3NWG A;  4DS5 A;  5J2M A;  1CS4 A;  5CAB A;  2CNK B;  3VAH A;  1FFW B;  2V8V A;  3NAH A;  2IA0 A;  5IT4 A;  1TZ0 A;  3G9C A;  1RTJ A;  4M63 A;  4G6V B;  2YX7 A;  5F0U A;  1FVQ A;  3A8I A;  4DUZ F;  3RBD A;  2XI3 A;  3V6D B;  2VOP A;  4UOF A;  4OJH A;  2RS2 A;  1V9O A;  1F5B A;  5CH7 B;  4DL6 A;  4B3O A;  2NPI A;  3K8W A;  4RU9 A;  1SC6 A;  3T1H J;  1Q8L A;  1S4F A;  2C2N A;  3JB9 k;  2AJQ A;  4IH7 A;  2QA4 G;  1EQ0 A;  1MG7 A;  1O51 A;  1NM2 A;  2QA4 S;  4AL7 A;  3TX8 A;  4M5N A;  2LLZ A;  3RB3 A;  2MGZ A;  2ZHA A;  5KFJ A;  4RL1 A;  5L9X A;  1L3U A;  2CUY A;  3DLH A;  1Q53 A;  4OHW A;  2BOP A;  4ICL B;  4NYP A;  1DRZ A;  2ZD1 A;  1LWE A;  2EFO A;  1TL3 A;  1XWL A;  3DU6 A;  3I0S A;  3C16 A;  1GMW A;  4G1Q A;  5BR8 F;  1XMO J;  2VJV A;  2AHO B;  3VGS A;  2BJ7 A;  5CD4 H;  3U1N A;  1HPZ A;  4OYB A;  4OHZ A;  3MMB A;  3Q8P B;  4F2S A;  2B3T B;  1UEU A;  2FHJ A;  2BXJ A;  3T6J A;  4AL5 A;  2NS1 B;  4F3Q A;  1WC6 A;  1SH0 A;  4OX9 J;  1HYS B;  1CJV A;  2ADB A;  2DH9 A;  2CYY A;  5G0R A;  1HL6 A;  5DDQ C;  4DL7 A;  1PAE X;  5KFR A;  2KDO A;  2PI5 A;  4K4T A;  1HIY A;  4IQM A;  4ZVR B;  2DXF A;  4FPI A;  1VGY A;  1YWX A;  1NDK A;  1KDN A;  4DR3 J;  1XN9 A;  1PAU B;  2JC0 A;  2XO6 A;  4KJI A;  5GVQ A;  3DFE A;  2XSJ B;  2COL A;  4CYU A;  1PO6 A;  1JJ4 A;  3DM2 A;  4QPT A;  2Y9H A;  1IKW A;  1DAX A;  5KT7 A;  1WOO A;  4QPX A;  2XMU A;  2MKC A;  3NBP A;  3D67 A;  4DU7 A;  4RUA A;  4TU9 A;  1HD0 A;  1IXK A;  1TKX A;  3NCR A;  2KJW A;  1BQM B;  3OXG A;  4PAB A;  1KC8 T;  1S1V A;  2UXB J;  3AXK A;  2QLJ B;  4CCH A;  4DLE A;  3R27 A;  2KN4 A;  5HVG A;  3PZP A;  1LWF A;  3CCS S;  3BSA A;  3VQS A;  1HBM B;  3HHL A;  2UP1 A;  3GSI A;  2C3U A;  2QL7 B;  4IG0 A;  4USK A;  3OVS A;  3I82 A;  2K3I A;  3MM6 B;  1NDP A;  3M8Z A;  1SV5 A;  3OL9 A;  2Q79 A;  4MAK A;  7FDR A;  4FNH A;  1YTY A;  3GB0 A;  1JLC B;  2OH2 A;  3I4H X;  2LEP A;  2BZ2 A;  1VIS A;  4LF8 J;  2DB1 A;  2E9R X;  3BH6 B;  3TAM A;  3J7Z 5;  3IBF B;  1BHN A;  1YIT S;  1A6L A;  2Q6B A;  2WON A;  1S72 S;  2PMW A;  2VL1 A;  3WHI A;  3RJM B;  4YN3 B;  4PQA A;  3JS9 A;  3NOG A;  1K0T A;  4LF5 J;  3T19 A;  2AJ1 A;  3BKU A;  1TL4 A;  4UTG A;  2C22 A;  4GRS A;  4BWM A;  4ECX A;  2QA1 A;  3TAR A;  3DOL B;  2M52 A;  4A46 A;  4ER8 A;  1EAY C;  4DV0 F;  2MJN A;  3PIO Q;  2WSF C;  4DR5 J;  1HNV B;  4CO3 A;  2JL9 A;  1T0T V;  1UWA A;  2C3M A;  1FTC A;  2P6S A;  2V50 A;  2VFR A;  3JTN A;  4M5J A;  1NJY A;  4OYA A;  1TFW A;  4M5G A;  5H9F K;  3KXD A;  4MYT A;  2GJF A;  2DGO A;  3R6G B;  1VQ8 S;  1D3W A;  2BKO A;  4ZVF A;  5DG8 A;  1ZS6 A;  3ZTP A;  2B4P A;  2OUG A;  2X3D A;  2AMC B;  3QT5 A;  3WIV A;  1WDT A;  1VQY A;  4PQU A;  4EBC A;  2NXE A;  1RT4 A;  2KT5 A;  4ZP6 A;  3CXC R;  1WF2 A;  2JEJ A;  1RT3 A;  4O4G B;  4Y3C A;  3CF5 Q;  3HVA A;  1VBY A;  4LF9 F;  2E7W A;  3PW0 A;  2OFG X;  3OJU A;  2CQH A;  3D6F B;  4XPE A;  2CWX A;  1QSS A;  2C2R A;  2RRA A;  1T7P A;  3EZO A;  4P75 A;  1LNQ A;  1S6Q B;  1Y00 A;  3UN5 A;  4Q45 A;  2AIR B;  3HHL C;  1TKT B;  4YB5 A;  3HKZ D;  4C3M A;  2XGQ A;  2HNZ A;  4CH1 A;  1WG5 A;  3RB0 A;  5BYQ A;  2A18 A;  1Q7Y T;  3KLG B;  2G0J A;  3FJ2 A;  1N32 J;  3SV3 A;  2ZH4 A;  3HFV A;  2I0X A;  1CJK A;  1EZZ B;  2IDE A;  3JAM U;  2HAI A;  2DGW A;  2EK6 A;  4LR9 A;  1Q8B A;  2WTF A;  3IR7 B;  1CSJ A;  1XNR F;  3SQG B;  2ZKU A;  2FPH X;  4PYD A;  3W7B A;  3N28 A;  4AUK A;  3D1H A;  2V8D A;  3K5L A;  4F0K A;  4PWD B;  2RQ4 A;  3CDB A;  4DR2 F;  1FKP A;  5SUH A;  1VLO A;  3W62 A;  3M2R A;  2ZBI A;  2UV8 A;  2KFZ A;  3KMQ A;  4O23 A;  3CCT A;  2WW4 A;  4QU7 A;  3CWJ A;  3HXM A;  2DR9 A;  4NRU A;  4WP8 A;  6FDR A;  2NYI A;  3W2V B;  1F9H A;  2XSF A;  3BGR A;  5KG3 A;  5HAN A;  3LA0 A;  2RHS B;  2XZW A;  3PRV A;  1PG5 B;  4G3I A;  1KRP A;  1Q79 A;  2RML A;  1UTA A;  4H54 A;  5ITH A;  3VAL A;  1RTD B;  4DWI A;  3N5B A;  1RLD A;  2H5I B;  3WQP A;  2U1A A;  1I94 F;  3ZTR A;  3AOA A;  4I4B A;  4OYP A;  1NSA A;  1DUR A;  2JZ5 A;  2CPE A;  3OTO J;  1P9Q C;  4KRW A;  1NBE B;  1X4F A;  4PG7 A;  2VDI A;  3CPW R;  4IFY A;  5B7W A;  3ZZY A;  4L72 B;  3X3U A;  3M8P A;  2UXC J;  4OX8 A;  4M5I A;  3JSB A;  1S76 D;  1I5O B;  5EUH A;  3QPI A;  1CUL A;  1MRO A;  2MLX A;  1MMN A;  4USI A;  2O01 C;  3E01 A;  1LXN A;  2EVZ A;  2FB0 A;  4LF4 J;  2CJY B;  3MF5 A;  2BJ9 A;  3R9L A;  1R0B G;  2LKZ A;  4Z7C A;  1R8H A;  1QE1 A;  2RUS A;  2HKE A;  4ES1 A;  2J9C A;  5JVG Q;  2DNM A;  4DSK A;  2HVH A;  4YME A;  4AT1 B;  3KJV B;  1N0U A;  3M7V A;  2PI4 A;  2PA8 D;  2OTJ S;  5H9E K;  3L09 A;  4OJ1 A;  3VZI A;  5KFD A;  1Z1Z A;  1VDH A;  4KC5 A;  4R5P A;  3KMS A;  4ZVQ B;  3JYT B;  1FKA F;  1KVI A;  1Q8I A;  2ZHO A;  2J9E A;  4K0K J;  5LMN F;  2DNH A;  4OYO A;  2M70 A;  3LW5 C;  2GJ2 A;  3A8J A;  2RIJ A;  3GWC A;  1QSY A;  1FRJ A;  2HPU A;  3QFW A;  4RLE A;  3KLF B;  3DLL Q;  1JLQ A;  1WJ9 A;  2IMO A;  3W9H A;  2AYM A;  2FZG B;  4ID8 A;  4J9Q A;  1S0V A;  4FKY A;  3IN5 A;  3H4D A;  3SI8 A;  3NMR A;  4AXI A;  4NEY A;  1M5H A;  2VQE J;  1X5S A;  4ZMM A;  1ZTW A;  5AE3 A;  4CO1 A;  2O66 A;  2BBE A;  5F8N A;  4PAA A;  4HTI A;  1C1B A;  2MZR A;  4NYO A;  2AQ4 A;  4TU8 A;  1HHQ A;  3M8Q A;  4KR0 B;  3KK3 B;  3POT A;  2IVF B;  4KE5 A;  4DL0 C;  4DV6 J;  3HO1 A;  3KNA A;  3FRZ A;  1S79 A;  2FHK A;  2MLY A;  4LRA A;  4FXD A;  3ENV A;  1F2G A;  5K14 B;  1TV6 A;  4LRC A;  4X65 J;  1T95 A;  1BQN B;  1EAR A;  3D6T B;  3NXZ A;  3K59 A;  4B3S F;  5KG2 A;  1H72 C;  4DR7 J;  4J9O A;  3MM5 B;  2BR0 A;  2UVV A;  3GZ7 A;  2AJ4 A;  4FYD A;  1VQ7 S;  2YXL A;  3K58 A;  3HZG A;  4QR2 A;  1C1C B;  3KFW X;  2CWK A;  5J2N B;  2J0Q D;  2MZ1 A;  4LR7 A;  2UVU A;  3NL0 A;  5LOQ A;  1FRI A;  3PW5 A;  1WNE A;  4B9V A;  1DLO B;  1J5O A;  5KOX A;  4EWT A;  3RYL A;  2M88 A;  4P10 A;  5IXU A;  3QIP B;  2UU9 J;  3ITH A;  3QLH B;  3UR3 C;  1SIW B;  3M9M B;  3TAN A;  4UF4 A;  3W5Y A;  1IQZ A;  4ZPC A;  3AD7 C;  1EKS A;  3QO9 B;  4MK9 A;  2V6A A;  3PW7 A;  3KLI B;  2UUB J;  5GAG I;  1HNW F;  2O1P A;  2Q3P A;  5A2Q U;  2IYI A;  2AZ1 A;  3TI0 A;  2ZBR A;  4I1T A;  1N54 B;  1KQS R;  3M2U A;  3OQ2 A;  1VJQ A;  1GQE A;  8AT1 B;  1REG X;  4DV1 F;  1N36 J;  4FBU A;  3QNW B;  3E3X A;  1ARO P;  3FCV A;  1SC1 B;  5GMD A;  2HVZ A;  3I5C A;  3ZZT A;  3ZO7 A;  1HNI A;  2OKQ A;  2B4V A;  4N5S A;  2J0W A;  1VQS A;  1SL2 A;  2CQ1 A;  3BZQ A;  4ITS A;  3Q24 A;  3GP9 A;  4DOZ A;  3QYY A;  3DHW C;  2YQ3 A;  3UNY A;  4KGK A;  3FSY A;  5KG4 A;  4X4T A;  1T05 B;  3HFZ B;  2ZBC A;  2HHX A;  4HH1 A;  2BE2 A;  4E2F B;  2POK A;  3ISN C;  9RUB A;  4W90 B;  1IR2 A;  5DGA A;  4X66 F;  4RW8 A;  1QAX A;  1QAI A;  4R25 A;  3KK1 A;  4YR0 A;  4RX6 A;  1CQN A;  2CPY A;  3HLU A;  2GHP A;  3W2W B;  3T1Y J;  3TQ1 A;  2AEF A;  3U1L A;  1MSW D;  2M5Y A;  4ED6 A;  4EYI B;  1OS5 A;  1B64 A;  1RTZ A;  4L3K A;  2ACY A;  1H2V Z;  2KFN A;  3IC1 A;  4F4A A;  1RWU A;  2A10 A;  3LP1 A;  3PW4 A;  2K1R A;  1UZH A;  5J2M B;  2MZS A;  3Q0A A;  3VAF A;  1B0T A;  1FE0 A;  1S5Z A;  1U26 A;  5IFM A;  1X9W A;  4P2M A;  4JV2 A;  3D0I E;  1NDL A;  1GTE A;  3FKB A;  3CUN A;  5J1N A;  3HVT B;  2PMH A;  3TX0 A;  1R27 B;  1G6B A;  2E5I A;  2XNR A;  2CQD A;  1U1R A;  2P9E A;  1B70 B;  4K7Q A;  4C0H A;  3G8Q A;  1C0T B;  1RWP B;  5EX0 A;  3BDP A;  2MZQ A;  2W4C A;  2HK3 A;  4QCL A;  4B9S A;  2JHE A;  2EXU A;  3CCL S;  3RRH A;  4KSE B;  2PD1 A;  1UET A;  5EHH A;  3DLG B;  2CJA A;  3H5U A;  2DR7 A;  2Z8Q A;  3BQ0 A;  4LFC F;  1HR0 F;  3W9J A;  1HNX J;  2ZH8 A;  4PUO A;  2XUL A;  4S0M A;  1VRT B;  4DV5 J;  1H74 A;  4DN9 A;  3R6L B;  4BHQ A;  2L08 A;  1J5E J;  2KYZ A;  2C3P A;  4DV3 J;  4X4N A;  2CQ4 A;  2IY5 B;  3G6Y A;  1UP1 A;  2OHD A;  3GFZ A;  4RUH A;  2A1B A;  2EFQ A;  5LXY A;  3H7H B;  1JWW A;  4O44 B;  1WF0 A;  1WDD A;  3A3P B;  2NXJ A;  5J1E B;  4CM0 A;  2YKN B;  3I0S B;  1OYD A;  2Y3Y A;  4TN2 A;  2V94 A;  1VLY A;  2LCW A;  4B3M F;  4GMK A;  3C16 B;  5HAO A;  4LIW A;  3P45 B;  2CQ2 A;  1TK5 A;  2V34 A;  3DRR B;  4YHH F;  4M5K A;  1Q81 T;  3GYX B;  4DI6 A;  2DH7 A;  3GIK A;  1A7G E;  3MMB B;  4ETZ A;  1S0M A;  4RBV A;  4DUT A;  3MXH P;  4RZR A;  1FRL A;  2F3J A;  1GX6 A;  4DPO A;  2V2Q A;  2EBE A;  1VI7 A;  2XMJ A;  3HD2 A;  3K5N A;  1IBM J;  2CDR B;  3CCV S;  1UA0 A;  1O5J A;  1RZM A;  2DNZ A;  2ADC A;  2KRB A;  1CJV B;  5G0R B;  4B3T F;  3DC2 A;  3I5A A;  2DGV A;  1CQM A;  1GAO A;  3J81 j;  1D8Z A;  3CCQ S;  2M8H A;  4ZCK A;  1UPP A;  1MWZ A;  3MEK A;  3KYL A;  3EDR B;  2ZEJ A;  2LYV A;  3I0R A;  3AOB A;  1UEK A;  2ZM6 J;  3IGV A;  3C15 A;  5CXT A;  2D1C A;  1IKW B;  2C2Z B;  3G6V A;  3D54 A;  2WSE C;  2VA2 A;  1R0A A;  3NY0 A;  2MY7 A;  1E6V A;  2DGS A;  3I87 A;  4YR3 A;  2LDI A;  1W26 A;  5CYJ A;  1YI2 S;  2G2O A;  1TKX B;  3ISZ A;  2VOD A;  3AHP A;  2KO1 A;  4TNO A;  5AXL A;  6AT1 B;  1BMQ B;  2W2Q P;  5KTQ A;  4J9P A;  4CLU A;  2DYA A;  1S1V B;  3BH7 B;  3D6H B;  3H2U B;  1MU2 B;  3CC2 S;  2QGF B;  5F3T A;  4ZP9 A;  4BWJ A;  1LWF B;  4DEZ A;  4WE1 A;  2V8G A;  3C46 A;  2B5J A;  2CRL A;  2YNI A;  4F0M A;  4FN5 A;  1RUS A;  2BE9 B;  2M4M A;  2Q1L A;  4DSJ A;  2GAH C;  3H0P A;  3DCA A;  3ZZU A;  2WVD A;  3IMQ J;  2XMA A;  3WBZ A;  4WWS A;  3O44 A;  3GG0 A;  2V4Q A;  4C98 A;  4DV2 J;  3VVU A;  2E29 A;  4CLZ A;  1RCX B;  4IFV A;  4B9L A;  4IOA Q;  4JYA J;  1XMO F;  1V5V A;  4C8N A;  2RF2 A;  2RD5 C;  1BY9 A;  1NEE A;  2JFD A;  2ZOM A;  1HD1 A;  3DU5 A;  4KKO A;  2G0C A;  1U1N A;  3FEX B;  3NWR A;  4V1A k;  1SJ3 P;  1MWY A;  4U8Y A;  3UE2 A;  1FF2 A;  3EMT A;  3D0H E;  1CEZ A;  1UL3 A;  3KLE A;  3H98 A;  2VPY B;  1U6B A;  2HHW A;  1ELO A;  1DHM A;  2KYX A;  3X1L B;  4A8Y A;  3PIP Q;  1K47 A;  4NLP A;  4UQG A;  3H2V E;  1VOM A;  2DRA A;  3GE9 A;  4NLO A;  4DR3 F;  3QSI A;  4KAI A;  5KFM A;  2DGU A;  3KJQ B;  1I6J A;  3FEZ A;  1L3V A;  2ALY B;  3JTP A;  5DM6 Q;  5JVH Q;  4M8L A;  1FFS B;  2C2M B;  4J9M A;  1RWX B;  4G65 A;  2HQC A;  1RJJ A;  4EYH B;  4TXS A;  2DTJ A;  3NEK A;  1KOH A;  1U2F A;  5DET A;  4URQ U;  1D09 B;  2PEB A;  1GNK A;  2B6A B;  3CJK B;  3DRY A;  2DVI A;  4NXM J;  5KG7 A;  3K89 A;  4EO6 A;  1WEZ A;  1IJE B;  3CTR A;  2PT0 A;  3OR1 A;  2GGP A;  4OYX A;  5K8N A;  1HLW A;  1MMD A;  1LW2 B;  3LOU A;  2UXB F;  2PDA A;  2RUG A;  3LH2 S;  3QT6 A;  4OLO A;  4JV0 A;  4F67 A;  2VPX B;  3CNQ P;  2R4F A;  1S9E A;  1KEK A;  2WRM A;  4KY3 A;  3LP0 A;  1EET A;  4QW8 A;  2DD8 S;  3I5B A;  2NXU A;  2J8A A;  2GFF A;  2FGC A;  4ZCI A;  1S49 A;  3TUI C;  1H7W A;  1VJW A;  3MR5 A;  2AGO A;  2HNZ B;  5A6W A;  1UVL A;  3GR1 A;  2DPI A;  4HYK A;  2NQP A;  3BBF A;  1F3F A;  1RT2 A;  2NCK L;  2VG7 B;  4UOH A;  4LF5 F;  2QE5 A;  2QT7 A;  2YX4 A;  1NAQ A;  1VCT A;  3KG4 A;  3DLK B;  1Y5I B;  5ETK A;  1H6K X;  2RNE A;  2KVQ E;  4I7F A;  1FKP B;  1LFP A;  1N5V A;  1W7W A;  2FC9 A;  3CJ8 A;  4DR5 F;  2J8S A;  3TJ8 A;  4CLS A;  4USV A;  3UDE A;  4YDD B;  4DJB A;  1SL1 A;  3RW7 A;  4G1P A;  3EPI A;  1T9Y A;  3K5O A;  4CH7 A;  3UO0 A;  4QIV A;  4LMZ A;  4HKQ A;  3IR6 B;  4K4S A;  4LRD A;  5T14 A;  2JEF A;  1P1T A;  3BGR B;  1XJW B;  3E8O A;  2LA4 A;  3OV7 A;  2HLU A;  1RIS A;  5HVH A;  4WJB A;  5DZ6 A;  3R7B B;  3CGI A;  2XM3 A;  4WFN Q;  3PX0 A;  2E1A A;  2FDN A;  3QAT A;  2XS5 A;  1YBA A;  5DQG A;  1RAJ A;  2DHA A;  2V4J B;  4E0D A;  2X1G A;  3DXS X;  2APO A;  3C14 B;  4JV1 A;  2VHG A;  4HHH A;  1H2T Z;  1TVR B;  4IFY B;  4F8R A;  2HHH F;  3MR6 A;  3D3C J;  3R5G A;  5L1I A;  1VIX A;  2K06 A;  2UUT A;  4YB6 A;  5HLF A;  1TP7 A;  3P5T L;  2AD9 A;  5FDL A;  2OD4 A;  4ZHR B;  3FSI A;  2GHW A;  3P96 A;  3CC4 S;  1CUL B;  2N4C A;  1S57 A;  2QYG A;  4OL8 A;  5AXM A;  3BN4 A;  2NLW A;  2VKR A;  4DCJ B;  1N32 F;  2DIV A;  3P5B P;  5BXI A;  2V0N A;  2AWZ A;  2E5G A;  2ZUA A;  3BPD A;  5BR8 J;  2HS3 A;  2OP5 A;  1QVG R;  4IR9 A;  5AXN A;  3J7Y I;  4OZJ A;  4P7T A;  2R2R A;  5L39 A;  3HT3 A;  2HMI B;  2LU2 A;  3M32 A;  4UY8 T;  4F4Y A;  3C8Y A;  4PXE A;  1EP4 B;  4R5P B;  5GMK a;  2AT1 B;  5D0H A;  4HDG A;  4ZS6 A;  4WZQ A;  2YQ1 A;  5IC4 B;  2OIH A;  1UKU A;  4Y2K A;  1NJZ A;  5IT9 Y;  3QRR A;  4K59 A;  3V4I B;  1JLQ B;  1FRM A;  4XPC A;  2K7J A;  2CAD A;  3TUJ C;  4NLG A;  4M1K A;  2J6T A;  3CCM S;  3TOQ A;  3BO2 A;  2WBM A;  2DO0 A;  4BS2 A;  1S1U A;  2KXN B;  1BLU A;  3U1M A;  1Y5L B;  2FD2 A;  2QSF A;  1ZTT A;  1UFK A;  4TLQ A;  1VK8 A;  2Z4P A;  4X84 A;  4UW2 A;  1UWB A;  1FDA A;  1X4A A;  1C1B B;  5GAE I;  1OWX A;  3M8Q B;  2VA3 A;  5L46 A;  3OTO F;  2MJU A;  3POT B;  3LP2 B;  4HVZ A;  3LO3 A;  4USU A;  2IRY A;  1FKO A;  1T3N A;  2HHT A;  4MJK A;  1HBO B;  3OFG A;  1TV6 B;  5IQQ A;  4BCA A;  4IRC A;  1WOP A;  4ZPD A;  5CYM A;  4RW9 A;  3OLB A;  3RW6 A;  4ZPA A;  2W8K A;  2QL9 B;  3KDO A;  3QT8 A;  2IBK A;  2JNJ A;  1G1X A;  5KFA A;  1JLA B;  3MM9 A;  1FJE B;  5GAE U;  4FF1 A;  5J1P A;  3DGV A;  2DNO A;  1H98 A;  4NA2 A;  5L8R C;  2EFN A;  1PC5 A;  2HIY A;  2QLF B;  1EQM A;  3TEG A;  2JEI A;  1YGY A;  2RT3 A;  3V6J A;  2ASY A;  3AB2 B;  1JLG B;  2OPS A;  2VV5 A;  1J5O B;  2GV1 A;  2C2K B;  1U7L A;  1TK8 A;  4HT7 A;  4RBT A;  1PCA A;  2H51 B;  5GAD I;  3NS5 A;  1M1G A;  4JUZ A;  3ITH B;  2WVC A;  4LRE A;  1TKZ A;  4PG4 A;  3M1V A;  3RG6 A;  5FJ4 A;  2GVD B;  5G4D A;  4FYV B;  3KG0 A;  3A13 A;  1NDC A;  2MQP A;  3MOZ A;  3FFI B;  2BUN A;  4QU6 A;  3F0N A;  4X4U A;  3EIC A;  1DTT A;  2BYC A;  5B0A A;  2R2T A;  2VB6 A;  2HIQ A;  2ZH6 A;  3C2P A;  1AT1 B;  2W2M P;  4DS4 A;  1GXL A;  1RU1 A;  2WOM B;  4I2P A;  2LXI A;  2J7K A;  3W1Y C;  2ZH3 A;  4GC6 A;  4NRT A;  3R2D J;  4ED5 A;  4Q2M A;  4DL4 A;  1ZYQ A;  1AFJ A;  3PVX A;  1N4L A;  3CJ4 A;  2Z58 B;  4OJ3 A;  4DV6 F;  5CA5 A;  3HHD A;  5I4M A;  2AKW B;  2D3O 1;  4X65 F;  4EMD A;  4KFB A;  3MOJ B;  4O3Q A;  4OYZ A;  1O6X A;  2LU1 A;  2E7X A;  2WVB A;  4GKJ J;  3FSX A;  2GML A;  3QRQ A;  3H5Y A;  1NH7 A;  1S10 A;  2X1F A;  2ZC4 A;  3DHX A;  4DR7 F;  3AJ1 A;  5E41 A;  3HJF A;  3PEH A;  3HUL A;  4XAK A;  4DQS A;  1QUV A;  1N88 A;  5F9N A;  1MLA A;  2GCF A;  3R7S B;  2BE2 B;  1OMS A;  3BKF A;  2G4B A;  3ADA C;  4URG A;  4QQB A;  3TA2 A;  1LKZ A;  3HM9 A;  3J81 U;  4PRF A;  2JRS A;  4FPR A;  5HMY A;  3THV A;  2H48 B;  3D5M A;  1WTB A;  2OD6 A;  2LP4 A;  3B78 A;  1NPR A;  2R9L A;  5KFU A;  1U2R A;  3T1A A;  3VR1 A;  3OUY B;  5DDO C;  4RW6 A;  2HZA A;  4U7C A;  1FVS A;  4NLX A;  2UU9 F;  5A8R A;  2MZJ A;  3UDV A;  4TY9 A;  2HHV A;  4K4W A;  1U02 A;  4XIU A;  3GJT B;  4F36 A;  1WAC A;  4Y2I A;  2B4O A;  4LIR A;  1VR6 A;  5LT5 A;  3THP A;  2AGP A;  4EEY A;  1JNZ B;  4DCP B;  3FBB A;  4CLP A;  4LFB F;  3HMJ G;  3MZI A;  5LSR A;  3D6M B;  4DR2 J;  1T03 A;  2YWH A;  2UUB F;  4YR2 A;  4ZIT A;  1N5Y A;  5AXK A;  1NSQ A;  3A8K A;  2KB2 A;  4H4K C;  4DPT A;  3BEG B;  4WP9 A;  2R8J A;  4CLL A;  4D3H A;  1X5P A;  4MKA A;  4Q8E A;  1SCJ B;  1TAU A;  1LWC B;  4JI6 F;  1XMQ J;  1Y4Z B;  1I1G A;  3S1T A;  2JVR A;  1AXQ A;  3H5S A;  4KYZ A;  4DFJ A;  4PYA A;  1U1L A;  5K8M A;  1Q0N A;  4OZ0 A;  3R1L A;  3ENW A;  2EFV A;  4PUO B;  1AUS L;  3GYN A;  2FJA B;  1I94 J;  3QGP A;  3GFH A;  1RA6 A;  3GQC A;  1NK8 A;  1FES A;  1JLE B;  4TYB A;  4DV7 J;  3DMJ A;  1TFY A;  1B99 A;  3OJS A;  4USW A;  1KVK A;  1GMV A;  3QFH A;  2VJU A;  3WC2 A;  4URS A;  4C48 A;  3TJ9 A;  2QEX S;  2IM0 A;  2QO3 A;  4IG3 A;  1S0O A;  3V4M A;  3CJQ A;  1LOU A;  2XBP A;  2B4U A;  3C3L A;  4NCG A;  5K8O A;  1RT1 B;  4NAS A;  4TY8 B;  1RWM B;  2CPI A;  2K3K A;  2MST A;  4EFA C;  4D3G A;  4F25 A;  1M90 T;  5IV4 A;  2FZK B;  1LV5 A;  2DBB A;  4RU2 A;  5ETT A;  3T1Y F;  1YJ9 S;  2P9C A;  5E33 A;  5HMW A;  2E1C A;  3C66 A;  1HKA A;  3JXO A;  2OO4 A;  1NSP A;  4LSL B;  5E3R A;  4WU3 A;  1KS2 A;  1IBL J;  3SV4 A;  2HBR B;  1Q7L B;  4P71 A;  1M5O C;  4EO8 A;  1JMT A;  5T7L A;  1Y0H A;  4UQT A;  3V2U C;  4LVO P;  1KOO A;  1G4C A;  1WHV A;  2HQ3 A;  5C24 A;  5AJ3 F;  5D0G A;  2ZZT A;  4H4O A;  3I32 A;  4IH5 A;  3Q86 A;  4X62 J;  3DNC A;  1MWQ A;  1ZPV A;  3CJ3 A;  1U49 A;  3TYT A;  3I0R B;  4WFB Q;  4ZVU B;  3PRB A;  2WZ1 A;  1DQ8 A;  4C8M A;  3H4B A;  2ZH1 A;  3WDO A;  4NX9 A;  1IKX A;  3H20 A;  3BDE A;  2ERR A;  3H40 A;  1R0A B;  3PR4 A;  5HRO A;  1YRU A;  3CJT A;  1E6V B;  5KFH A;  1CBK A;  2LQB A;  1OY6 A;  1CVJ A;  2HFU A;  3MEG B;  3EGN A;  4F26 A;  4XDC A;  2W7A A;  1HNX F;  1JLF A;  4DV5 F;  3H42 A;  1J5E F;  1G3O A;  4DV3 F;  2CPJ A;  2CJQ A;  1M1H A;  3HDS A;  3KUG A;  2EG2 A;  3MM8 A;  2B5J B;  2YNI B;  3ILJ A;  4FF2 A;  1MW7 A;  4KH0 B;  1X5T A;  4I68 A;  2FUG 9;  3J7A N;  4LBI A;  4WK3 A;  4B9M A;  2CQB A;  4EBD A;  1SL0 A;  2OEM A;  2LQJ A;  4LJM A;  1HWK A;  2FZC B;  2G13 A;  4ED2 A;  3SCJ E;  1ITP A;  1WG1 A;  2R7X A;  3SMZ A;  2RF2 B;  1KKH A;  3SXL A;  2F1F A;  1DBD A;  2R42 A;  2GVZ A;  4JBC A;  4IDK A;  2NUU G;  5KFY A;  3VAJ A;  3VHQ A;  2ABY A;  3ET6 A;  8ATC B;  1XC9 A;  2DR6 A;  4QWA A;  2H1Y A;  5IM0 A;  5L1K A;  3M8W A;  4NI2 B;  2VPZ B;  4X4S A;  3TAQ A;  5E3C A;  3KLE B;  4BDP A;  2D74 B;  2VOO A;  3CO0 P;  5A76 A;  3D1O A;  1W2I A;  3V81 A;  5ETS A;  2H4W B;  3H25 A;  1LEO A;  2R2U A;  2KXF A;  2CPH A;  2CIM A;  2R8K A;  4DX7 A;  4EI2 A;  4WFZ A;  3F44 A;  2BEF A;  3OHB A;  5FLX U;  1RU2 A;  3PNI A;  3K7R A;  3F56 A;  5DDP C;  4EGL A;  5D77 A;  2V2Z A;  3GG1 A;  3ZTS A;  2G0I A;  4A8X A;  1HNW J;  1H73 A;  3O5T B;  4F7V A;  1KN6 A;  3JAM Y;  1QAY A;  4DSI A;  4IO9 Q;  3OR1 B;  1VBX A;  1JKH B;  1SKR A;  2J7W A;  4B9U A;  5IC6 B;  3DGP A;  4ZP7 A;  2HHQ A;  1LWX A;  4DV1 J;  4LF6 J;  2OJ3 A;  4ATN A;  3CDU A;  2I38 A;  2XMV A;  5KFZ A;  2V2K A;  3CMA S;  4A8W A;  3PO5 A;  3UN2 A;  1FER A;  3KTQ A;  1EET B;  3N5F A;  2ZE2 A;  4HTJ A;  2XNQ A;  2E44 A;  4FKX A;  1D9F A;  3VVT A;  4ZVT B;  2OPP B;  1SQG A;  3MWB A;  2RS8 A;  4M5H A;  5F41 A;  1Z2L A;  4PWU A;  2IVM A;  4GC7 A;  1ZAV A;  2XYG B;  2PFD A;  4C4W A;  4C7Q A;  2YKM B;  1WHY A;  1FJG J;  1JIH A;  1RHK B;  4O3O A;  1HBU A;  4X64 F;  4X66 J;  2CFX A;  2VON A;  3PHT A;  2W2N P;  3AJD A;  4R8U A;  1GXT A;  2HWI A;  3LAK A;  4YB1 P;  1F5A A;  1NB7 A;  2IJN A;  2DRD A;  1YRX A;  4NLW A;  2HHS A;  4OZL A;  2AF6 A;  4KGV B;  1F60 B;  3HFK A;  5HMX A;  1BXN A;  3ONQ A;  1S4E A;  1IM6 A;  2VAS A;  2RDJ A;  1JXE A;  4OHY A;  2CQ0 A;  5E3P A;  1R0C B;  1K0V A;  1ZH5 A;  1PIL A;  2RQK A;  4LF7 J;  1REV A;  4V19 X;  2QC3 A;  3M2V B;  3DRS B;  1XR5 A;  1YJN S;  3ZTO A;  5KFI A;  2P9G A;  3KJN B;  2RJZ A;  4NXM F;  2FTR A;  4GO7 X;  4ECV A;  3FQK A;  4YP3 A;  5IZH A;  3NGK A;  4CH0 S;  4CZC A;  4F50 A;  3EXC X;  4WTY A;  3PW2 A;  4DFM A;  4ZN3 A;  4F4W A;  2HFZ A;  3OT9 A;  1RT7 A;  5LXR A;  2C1E B;  4DR6 J;  5IV3 A;  2PMZ D;  1WF1 A;  4LFC J;  1HR0 J;  2KHC A;  2GNK A;  4CM2 A;  2HQF A;  4P73 A;  3FBE A;  3JSY A;  3R5D A;  3OR2 B;  5E7O B;  5I3U B;  4W4M A;  1OY9 A;  3NS7 B;  2IAJ B;  1NKE A;  2DPJ A;  1RI7 A;  1C0U B;  3U7J A;  3MED B;  2J6S A;  3IG1 A;  3Q2T C;  4HI2 A;  4MK8 A;  4PR6 A;  3UQS A;  1ZAW A;  1PBA A;  5IWA F;  3IBW A;  2DHG A;  4JV5 J;  4B3M J;  1VRU A;  4I6A A;  3DRP B;  3BB5 A;  2ASL A;  1VQO S;  2R8H A;  2AEM A;  4LSN B;  4YHH J;  3VAM A;  4LQ9 A;  3K5M A;  2AJF E;  3QJL A;  2MMY A;  1S6U A;  4ECR A;  3UN3 A; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...