1F2HA

Solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
169
structure length
169
Chain Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
total genus 35
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f2hA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
3DRYA 4L72B 3PRBA 3G87A 4WK3A 2R8JA 4X4QA 3ISNC 3MAHA 3Q2TC 1IN0A 2JDJA 1HBUB 3W66A 4USIA 2KHDA 1EIYB 3D68A 3MUVP 5L46A 4RU9A 1SKWA 1NJWA 2MYFA 3JS9A 2PI5A 3QRRA 4CDIA 1QUVA 1LOUA 1UPPA 2CVIA 2RMLA 4D3HA 1NDLA 1JKHA 2HQCA 3HDSA 1S6OA 3MM7B 4J9RA 4UY85 4J91A 3TUPA 1RWPB 5LSLA 1S7IA 2HHVA 2EBGA 3BBFA 3GB0A 4K4ZA 1J5EF 2Z2LA 5B0CA 1NK8A 4JB8B 4KHPJ 1TL1A 1RJJA 3I4PA 5DZ6A 5F0WA 4A8SA 2Q66A 3IRXB 2C3PA 2DGSA 3IS9B 4NPOA 2OHDA 2ZJPQ 2PSZA 2JLGA 1U1PA 2XULA 3RAXA 2VA3A 3PY8A 3THVA 4ZMMA 3F73A 1GMWA 3I0RB 5KFDA 1RAAB 2M3DA 1XMQF 4TNOA 4ZN1A 2M8HA 2QC3A 3GILA 4PXCA 2HG4A 2YY3A 5GAHI 2PA8D 3G6XA 3M7VA 4DR6J 3I87A 1VQ6S 4XO0A 2VUGA 3WDOA 3OPKA 2HGMA 4F2RA 5EN1A 1FRIA 4C0OC 1Q79A 5B0BA 1YI2S 3QLHB 4Q45A 1YBUA 5KFJA 5DDQC 3MM7A 2RUGA 1SH0A 2IRUA 3I31A 5SUHA 4DX5A 3F56A 2NXJA 2ZM6F 5D15A 3Q8VA 4WP3A 4ELVA 3TARA 1E6VB 1QY7A 2YKPA 4AYBD 4Q8FA 2BYCA 4AQYJ 1S0NA 3G8QA 3T6BA 3IRXA 5DETA 2XCPA 2KFYA 4C4WA 3DCAA 4WFNQ 1F2GA 2HBQB 5BJRA 4MKBA 1GK8A 2FJBB 1GEHA 4ICLA 3FDSA 1FVSA 1YZ7A 4YN3B 2ZH3A 1WNEA 1X4FA 3CDUA 3DLJA 4AXJA 4JI2J 2NYIA 3H98A 4OL8A 2EWHA 3DGPA 4R25A 4QWBA 2IYGA 1NSKL 4FXWA 4UTGA 3X3UA 4EEYA 3R1HA 2D3O1 3A8JA 4KFBA 1RBAA 3BQ1A 5DQIA 2FY1A 2JC1A 4F36A 5C42B 2J7UA 2L3MA 1O8BA 3GMGA 3HI9A 4NA2A 3HZEA 5LL6d 1HI1A 2FHKA 1RISA 4GVLA 3VVUA 2BJ3A 1P1LA 4F0HA 5KAKA 2ZHAA 1CG2A 1NCLA 5KFQA 2YPZA 2WRMA 1R3NA 1U2RA 3MD1A 4LIRA 3PR5B 1IR0A 2ZOMA 2ROEA 3BYPA 4DU8A 2EFOA 2LXUA 5KG2A 1JJ2R 3HO1A 2KL8A 3EVWA 4DR4J 2N4DA 1UVKA 4FNHA 3D5MA 1KOHA 3MEKA 4Z37A 3C6TA 1WEZA 2ZE2A 5KFLA 3T1HF 2HHXA 2IDLA 1KR4A 1N5TA 2GAHC 2HEKA 3PACA 4Y2KA 5J2PA 4A8WA 5H9FJ 1VQPS 2XMUA 2IMWP 2DH8A 2WVDA 3M8PB 3NGRA 4F8RA 3NXZA 1Y00A 3EXCX 2M8DB 1NDCA 3ULHA 4PUOB 4OQJA 2DR9A 2Z0GA 1VQNS 4IR9A 5KG0A 3V4IA 5E5NA 2DNPA 1SC4B 2CPHA 3D3BJ 3FFIA 2BANB 2IA0A 4CRJA 4JV5F 1CPZA 1S59A 1BLUA 4TY8A 3UN3A 1TR0A 1X4EA 2NSCA 2G2YA 2DTJA 3BPDA 5K8NA 4DPYA 3ZNJ1 1QAIA 2V5HG 1TK8A 4HVZA 3ET6B 3M2RB 3IRWP 2OPPB 4ZPDA 1EP4A 2QL7B 4USHA 3IAM9 3OV7A 3AOBA 1NJXA 1HPZB 1WSVA 4MIWA 4I6YA 3KK2B 5HMYA 2LQ5A 1TL1B 2Y1LB 1PBAA 1LQ9A 5ETNA 4EI2A 3Q22A 3R5JB 3IS9A 2OPQA 2PEBA 3RGIA 1FK9B 1MMLA 2CQCA 4K7QA 2VQEJ 1JLEA 1M1HA 1NLKL 2HURA 4OI2A 1RTDB 4OX9J 3TJ9A 3PRVA 2F4VJ 2WSFC 3LP1A 2ZC3A 3PTWA 3OUYB 3HK2A 4IOCQ 1S1WA 3W8GA 4DI6A 1XNRF 1KEKA 1VRUA 3VAMA 4NRTA 1C2PA 5KTQA 4DLGA 4WFYA 1B0VA 3ET6A 3M2RA 4IH5A 4ZJLA 1EP4B 3RRKA 3KJVB 1MROA 1RT2B 5IOLA 4JI4J 3G9CA 1K0TA 4LF1A 1N54B 3J81j 2VH7A 1TL5A 1GXTA 3DDNA 2FVQA 1RXOB 1V9OA 3C66A 1RBOB 2NS1B 3K2YA 3MMCB 1PAEX 1LXNA 2FPHX 4K5SA 5KG3A 3W62A 3KLHA 2MB0B 3SQOP 1S4FA 1R7IA 3NY0A 3C6UB 3W9JA 4LFAJ 2DISA 3N79A 4CLFA 4DV6F 2C3UA 1NDPA 1W26A 4C8YA 2VU5A 1LWFB 2F9DA 2AEFA 2WW8A 1YJ9S 3GYXB 3AD9C 1LK5A 2H5IB 2KT2A 2MKJA 2RJZA 2ACYA 3DI6A 5HQ8A 4FS1A 3JQJA 2QIFA 1PSDA 2BRLA 3SI8A 1GTEA 4P6QA 5C42A 3LOUA 2MZTA 3AD7C 3AOAA 1UL3A 4PWUA 4XAKA 4FZVA 1N36F 4DU7A 2DR5A 2PN6A 4UOGA 2DR8A 4DV6J 1TL7B 1JXLA 4AXIA 3QFWA 1T9UA 2UV8A 3EUNA 2H54B 2OO4A 2RH3A 2F1FA 2I5JB 3D1OA 2BE2B 3A3OB 5I3PA 3K5LA 1YJWS 2IM3A 4Y00A 3E01B 2V50A 3M6VA 1BQMB 1MWZA 5GADI 3IR6B 1N32F 4RUHA 2NXNA 5C25A 1FNXH 4MT1A 3GZ7A 2EFQA 4Q7AA 1M5HA 4DFPA 4LFCJ 1ZM4A 3QIPB 2FVSA 3K57A 2CQBA 3MMAB 4KJIA 3MUTP 1D9AA 3MEEB 1RADB 2Q6CA 2IDEA 5CABA 4PWDA 3H2LA 3LALA 2GFFA 3KLVA 2OUGA 1WHVA 1FHTA 2FTRA 1NDKA 4K4SA 2KJWA 2N3OA 3UW1A 3V6DA 3VAJA 2CPZA 3UE2A 4FF2A 3DLGB 2XG8A 1TAQA 3D0GE 1RAFB 2AJ2A 5KFFA 1D3WA 5J1EB 5HBMB 4DSEA 3L7OA 4RNNA 4ZP6A 1P9QC 2AJQA 2AX1A 1Y9OA 1OO0B 2Q79A 4K2JA 5EWGA 2HAIA 5K5MA 5T41A 5HN0A 2QYGA 2OPQB 4A8MP 2BANA 4DL7A 1NJIT 4PRFA 3MR2A 2F5GA 3QYYA 5J2QA 3IAS9 3MTKA 3EGZA 2QT7A 1YJ7A 2AYMA 2PA3A 2DXFA 2ZKTA 2BW7A 2KN4A 3GJTB 4K4YA 1PCAA 2MQLA 3RW7A 1QVGR 2NUUG 2IJRA 2HMIA 5A2QU 2ADCA 1X5SA 4RPFA 4MTPA 4DPWA 2VPWB 3TA2A 3I0SB 5KOWA 3BREA 4K8RA 3H40A 4NOHA 4U8YA 3MM5B 5D4OA 1XBWA 3TA1A 3HMJG 3CF5Q 5BR8F 1TMMA 4K5RA 3M9OB 3KJVA 3OTDA 3BSCA 5ETSA 4X4NA 2BBEA 4IQMA 2DEIA 2CJAA 2GHVC 4M5NA 5E3AA 2BKOA 3OFEA 2DXDA 1VJQA 2V94A 5DGAA 1SQGA 3X1LB 2HYIB 2RE1A 1HYSA 4ALZA 5J2MB 4ES2A 4RUCA 4CM0A 1FJCA 1L3TA 3CSKA 4ECSA 2E5HA 2W7OA 2H4WB 3C6UA 3CCES 1WI6A 2YH1A 3U1NA 4NXMF 1IJEB 1B99A 5C2GA 3CCUS 3OXLA 4UOFA 4WCEQ 4WIQA 2WB1D 2FZCB 3HFKA 3TX0A 1LFPA 1T95A 1HL6A 2A2DA 2Y0SD 2XQCA 2HFUA 3LA0A 2AF6A 2R7WA 1ZOTA 3LPYA 4NYZA 5DLGA 5FDLA 3HVRA 5T7LB 1JQGA 2G1HA 2DGWA 2LMIA 3NBPB 4YB5A 1MNEA 3D1QA 3QJJA 3PW2A 1MMDA 3CCMS 3GG1A 1X9MA 2FJEB 3L7PA 3NL0A 3J7ZT 1TKXB 5KT5A 3SSSA 3DLHA 1SH3A 1EKRA 3FCHA 2R8KA 3PZPA 2GS8A 1TKDA 5IV3A 4OHWA 1Q8BA 2CWKA 3NAIA 2W2OP 1NK5A 1HBMB 4DV0F 3TZXA 1BQNB 1FDAA 1U6ZA 2GJ2A 4ZLJA 2ZH2A 1XMBA 1HKAA 1ZTTA 1JX4A 3MOJB 3BBCA 3PYFA 2BOPA 4NYPA 2OEJA 2BOAA 3CJQA 4B9NA 1RAEB 3AB2B 3VZIA 1FVQA 1R89A 2YKMB 3ZNUA 5F8NA 2F9JA 3MPVA 4NX9A 3M8SA 2GC8A 1UA0A 2JHEA 4ED4A 1X60A 4ED6A 4C8ZA 4MKYA 4QU6A 1ACMB 1X5PA 1HNXJ 4GC7A 3R7NB 1OIAA 5FDLB 1GX5A 3C19A 3VF0B 2J6UA 4F3OA 2K8GA 2HGNA 4ECTA 5DG7A 3ILOA 1XNRJ 1GT8A 2ZBRA 4DL3A 1N33F 1HFEL 4LF8F 1RT3B 1XTZA 1Z1ZA 2HNDB 1VQKS 4C8OA 3BSAA 4ECXA 5CD4H 1GMWD 4JI5F 4ZLPA 2XHCA 4YFUA 2E29A 3M2UA 4L74A 2ZHBA 3GJQB 3T3FA 1D8ZA 4DQPA 4PPDA 5A0YB 2YWFA 1LNQA 3UR0A 4CWBA 1EHWA 4L6V3 3TAMB 3CCVS 4X64F 4ECZA 1FEHA 1S0MA 2ATCB 4P71A 5L38A 1MU2A 4LVOP 4USUA 3PW7A 1JLCB 1SC1B 4MYTA 1S6UA 3TUIC 1NHUA 3IWXA 4JV2A 2XLKA 2HSEB 1E6YA 3NRBA 3IGVA 4P7TA 2JEIA 5J2QB 3HD1A 3ZTPA 1TVRB 1U8SA 2HS3A 2OMOA 1FRJA 2E7VA 3D9BA 1JJCB 1KTVA 2ZVIA 3K5NA 3PX6A 1I94F 3T41A 2OELA 2FYXA 1X0PA 3CD7A 1U1QA 3HJFA 5KT3A 1KN6A 3DKDA 1N0UA 5IT9U 4ZJOA 2IJNA 1FRMA 1B70B 1SKSA 1I1GA 2HNDA 5IC6B 3Q8PB 4TYAA 4JI3J 1XIQA 3BBBA 4Z7YA 1WTBA 1AT1B 1Y5NB 4EBEA 3BKFA 1KQFB 3M32B 1PIEA 4WFXA 1DZ5A 1DLOB 1MW7A 4ZCLA 4AL7A 1IVZA 2F8HA 4U7UK 3T5LA 3M1VA 4K0KJ 3EYZA 1WHWA 5M2UA 4WFAQ 5ETLA 4CNZA 3T1HJ 2W9BA 2MKKA 2BMBA 4C98A 4AFFA 1WEYA 2J9DE 2V67A 2I8EA 3H42A 5HQMA 2A6MA 5I42B 2HFVA 3GR1A 2RIJA 1LWCB 3MM9A 2CDRB 4K4XA 1G6BA 3I0SA 1RDRA 3PFOA 4KPCA 5DJBA 2VBYA 4FPRA 4JV0A 1GQEA 4B9TA 2B9EA 1REGX 2M7SA 1EX8A 4PG7A 4G1IA 2PDAA 3S01A 1VIXA 2PIIA 1PC4A 2VBZA 4AL5A 2IPOB 5T7LA 3NBPA 4ED7A 5B0FA 1HW9A 1RSCA 1UMJA 5LXRA 2HZVA 1FXDA 1S1UA 5HO4A 2VJUA 2BQRA 1CEZA 6FDRA 4ZVPB 1FE0A 4NCBA 2O67A 4RW8A 1U1MA 1FWKA 1TL3B 2UUWA 2W9BB 4IH7A 2QL5B 5M2PA 2AJFE 2L9NA 4A8YA 1HBMA 2DJWA 3N6NA 4C3KA 4ZHRB 4PXDA 5HLFA 1C1BB 2VQEF 1UWAA 1VQ7S 4DV5J 3ETMA 3M9NB 2BACA 2YX4A 5IWAJ 5T14A 2QRRA 2W01A 2XEXA 4UQGA 1FKAF 3P6YC 3L7UA 1VQLS 3MXHP 3DXSX 1HWJA 1Y5LB 1UEVA 2QYCA 2GVZA 2ROGA 3BM7A 4B17A 8AT1B 3CJ2A 2R2SA 3CCZA 2BE7D 3P5TL 4K4VA 4LF4F 1XK8A 3QIDA 5BYSA 4LREA 2AKWB 1KHVA 4LRFA 1OY9A 4W90B 2V8HA 7FDRA 5ETPA 2MKIA 1J5OA 3MEDB 2HVIA 2A2CA 3TP2A 4QIGA 4DL5A 4EYHB 1L3UA 2HZCA 3NCQA 2K3KA 2V34A 1R8CA 3BSOA 4DN9A 2XS5A 1VFJA 2MTLA 2WBMA 3NS5A 1U25A 2UXCJ 1H38A 4QR2A 1FKPA 2K1RB 1DQ9A 1UTAA 3BV8A 1C0TA 1VRTA 3D28A 1G3OA 3CC4S 1FFSB 4N5SA 4YY3J 3IGNA 3KDNA 3TW0A 2UV8G 2CQPA 3JQMA 3MF5A 5HLFB 1AB8A 1YRXA 1FESA 2OSRA 4ILMA 1S79A 1N5SA 3H20A 4LSZB 4ZVRB 3GIKA 4ZP9A 3KUGA 3T1YF 1YBTA 3TVYA 5THWA 3HVAA 2IY5B 2AD9A 4TLRA 1YLXA 1RWMB 4WIIA 3Q8SB 4ECYA 3A13A 4GVBB 5ETOA 1FTRA 2ZBIA 3PX0A 1Z4UA 3OFHA 2DY9A 4KYZA 4LVNP 4W98A 4YS2A 1CJUB 1JNRB 1FRXA 1Q7LB 1F6TA 2CYYA 2RKIB 3BGOP 3MR7A 3SBMA 4U95A 2IHR1 3CNQP 5EGYA 2DPIA 1RI7A 3R2DJ 5SZTA 3R97A 2CNOB 2FJDB 2E5JA 2M70A 4TU7A 4EZ9A 1GX6A 1FFWB 3VALA 4RUBA 2MKCA 1S9EA 1WOSA 2VKRA 2WOMA 3BDEA 4TU8A 2R4FA 4ERDA 5KFYA 2UVWA 1S1VB 4KPYA 4LQ3A 2KM8C 1HMVA 3Q83A 2IJFA 4OI3A 3OR1A 4PWWA 1V5VA 4KKOB 4FF4A 1TVRA 1QDUB 2ZNZA 3TOQA 3ZC4A 2MGZA 2W2QP 2I6WA 4AT1B 1UA1A 2BM0A 4NLRA 4MMOA 1RTJB 1RWUA 4C48A 4KH1B 2BJEA 1KLNA 1S97A 2CA9A 1BY9A 1Q5YA 1FNOA 4NCGA 4P2SA 2U2FA 2HS4A 4Y6IA 3A8KA 3IXQA 1YHQS 5B0GA 4IOAQ 2EKYA 3GP9A 3KG1A 3W9IA 1FA0A 2XSJA 3CDBA 2VC1A 3BS9A 2DPJA 1GAOA 1Y5IB 2V2VA 3EX7B 2DNLA 3JQKA 2RVJA 4ZPCA 2WONB 4ECWA 3GCXP 5GAGI 1Y4ZB 4I6AA 4TKTA 1RAHB 2FHJA 1H6KX 2KVIA 4H4KA 1HBNA 1M5KC 4FKXA 2KFZA 2FHJD 2LQBA 3BKUA 4YR2A 2GVDB 2WK4A 2KG0A 1CJVB 1VLOA 2HHTA 3C14B 1KONA 2Q43A 3PW5A 4LRBA 1VC6A 3QAEA 1Q86T 1U1KA 1NKEA 1M90T 2ZWOA 1HQUB 4ES1A 2ZJRQ 1RAOA 1FERA 4NYOA 3OXFA 1U4BA 1FEEA 2L48A 1WC4A 1ZAXA 4I4BA 4LQ9A 2W8KA 2R2RA 2FZGB 5KT4A 1SJQA 2QJ3A 1P27B 3U27A 2EW9A 1QVFR 4DPXA 2X7IA 3EVMA 2RQKA 3VZHA 5CA5A 1JKHB 3R9LA 1OPZA 1M5VC 2JEGA 3BR9A 3QSIA 2P9EA 5CH7B 2AQ4A 4CYUB 3CD6S 4CO4A 1KFDA 3PEHA 4JV5J 3SCKE 5DQHA 3N4WA 2KH9A 1FO1A 2GO9A 4NLQA 2QSWA 2RNEA 4EO6A 2BR0A 4EMDA 4EU0A 2BQ3A 5DG9A 1U45A 1VRQC 4CO1A 3JYTB 2K1RA 4F67A 3UPFA 3SQGA 2FLLA 1UKUA 2LP4A 3BGFA 3C14A 4BC9A 5ETQA 2RDIA 2W25A 4WXOA 4OI4A 4OZ1A 3KKFA 1UFKA 3DOKA 4KGZB 1FD8A 1Q4RA 4O44A 3KLEB 4YP3A 4U8VA 3ZTOA 2DGOA 2FVPA 4DR7F 1OSDA 5F3TA 3M6UA 1R8PA 4NLPA 2WHOA 2BABA 2OMLA 3DRSB 2C28A 3OD2A 4RR5A 1SBRA 5LMUF 2LVWA 1CJTA 4DQQA 2W9AA 1TKTA 3CJRA 1WHXA 2D69A 2XI2A 3PEJA 2DNKA 2A1BA 4MIBA 2ASYA 3SV4A 1V3ZA 3AJ1A 4Y34A 5C7PA 1Q81T 2PE8A 1TQLA 2MPUA 2OAUA 3ONQA 3VV2B 4NLYA 1SJRA 1CSJA 3C16B 3W9HA 4CT9A 5LMNJ 4FYWB 3PVXA 3MM6B 2DEJA 4ZDNA 3PHEA 4DSKA 2D9OA 3M8ZA 3U7JA 2U1AA 2XLJA 4QYZK 4P72A 3TAPA 4OX9F 5F8HA 4ICLB 1AZSB 4R8UA 2IBOA 2PMZD 3TVZA 4LSNB 4RL1A 3S6EA 1TK0A 2N4CA 2V2ZA 3RAQA 2KZMA 4LSLB 2F3JA 2CDQA 2QLBB 4W92B 3TZYA 2QL9B 2R3VA 3K8WA 1RZMA 3HHDA 5A6PA 1IWAA 4LUBA 1CJUA 3I56S 1TZ0A 2H51B 4KV8A 4RW7A 3R2CJ 3OL7A 5D8HB 2IVMA 3ZO7A 3BQ0A 4QPTA 2ZH5A 2O5DA 3PR4A 1KLMB 2XBPA 4M5KA 4DUYJ 2HVEA 2LA4A 1TUWA 2HQFA 2WVFA 4PZVA 4CO0A 4RU2A 1LW2B 5KFMA 2UU9J 2C2MB 5J1NA 2UP1A 4HACA 1RHKB 1XR6A 2C2OB 2YPYA 3OFFA 4BWMA 3VAHA 2CJXB 4ATNA 3B78A 1HQEB 3DLKA 1M5OC 2XZTB 2ZE2B 1S76D 2HFZA 2BJ8A 1QTNB 3S7RA 1J27A 1HNIA 2MGZB 1T03B 3FSIA 2W8LA 1RWVB 1KBRA 2VFRA 2ZJQQ 4QQBA 1RTJA 3M05A 2QTWA 4LRCA 2MDAA 3HSDA 4CO2A 3Q0AA 2HNZA 2HW3A 3HVWA 3HT0A 4ETXA 1GTHA 1RT6A 1WF1A 3M30B 4HI1A 1VLYA 4X65J 2BE9B 3Q86A 4RO0A 3LANA 1KDNA 1CULB 2IVYA 4YHHJ 1VJWA 3FFIB 4QR0A 2GAGC 1HQUA 2M0GB 2CQ1A 2ROPA 2XSJB 4J37A 3OSPA 3UO0A 4ZCKA 4X4UA 1KLMA 3SZ2A 2IVFB 2R7UA 4RUAA 1KTQA 3OJUA 2AYBA 2YTCA 1VIOA 4DUZJ 3KHLA 1ZPVA 2P6TA 4DX7A 3UDCA 3W60A 4KRWA 1U0HB 3C15B 2C2NA 5D0RA 1S48A 2HHPA 1M0SA 1Y7PA 3UQSA 1K44A 2W2MP 4CLLA 5JJBA 2Y1JA 1QTMA 1NH7A 3FZBA 1SCJB 1UJ6A 3GU0A 3ITHA 4KE5A 1IKYB 4FP9A 4OJ1A 4UUXA 4A8KA 4YDXA 2XMVA 4RW6B 3KLFA 1FK9A 3MPYA 5E7OB 1H7WA 2HNZB 4N8NA 3JYTA 3RU0A 4B3OA 1V3RA 4RNMA 3HHEA 2DH9A 5D0EA 5JMNA 5GAEU 4WXWA 2LECA 2FIUA 4Z7CA 1SL2A 2UXCF 4B3RJ 3KLEA 2QMWA 3E2EA 2HHSA 3HFVA 5ETKA 2MQ8A 2QA1A 1DHMA 3NAHA 4OLPA 3P3DA 4DHVA 2LXFA 1T9VA 2H4YB 2XGQA 2G0CA 4DCPB 1N52B 4USKA 1U6FA 4HHHA 4ZVSB 5B09A 3V81B 2VBWA 3MMBB 3GIIA 3IN5A 2CQIA 4I7FA 1MROB 2X1GA 4ECUA 4JV1A 5D77A 4N56A 3C16A 2RQ4A 5HP1B 2R2TA 4Q0BB 1T11A 1UW9A 3ITHB 1QM9A 1NPRA 4QBUA 4Z2XA 2RAQA 1QJHA 2D7SA 3GE9A 4EO8A 3KHGA 5A8WB 1ELOA 4WFZA 4NXNJ 1SXLA 2MZQA 2RRNA 5A76A 3M6WA 4FXVA 3RBZA 1XMOJ 2J9DA 3JSYA 2A0FB 1T9WA 3DRSA 5E2QA 1YDLA 1D1UA 2VBXA 2KYXA 2F7VA 2DO0A 1S12A 2F65A 4FN5A 4CLPA 4JI3F 2ZBPA 5B0DA 1R0AB 3GYNA 2DNYA 2PMHA 4MKAA 1NPPA 1IJFB 2AU0A 3FCVA 5GMKa 3UFCX 3MMBA 4KV8B 4RW7B 5IZHA 3JB9k 2DNZA 3MM8B 1G4CA 4I7FB 2ZEJA 3LH2S 4LR7A 3ZZUA 4USJC 4NL5A 1NPKA 2HVDA 2YX1A 4LF7F 1S6QA 2B9WA 4KGXB 4P2XA 4DV2F 5JXSA 8ATCB 1GNKA 2OH2A 5KFHA 1IR1A 3DM2B 1TUGB 4MIAA 4J9VA 3RUBL 4DS4A 1KQSR 4OI0A 3B54A 4OYXA 2O66A 3R27A 3CCTA 3G8SA 1N5YB 2W2NP 3A8EA 4WE1A 1IBLF 4BS2A 3TZWA 1HHQA 1TTHB 3M2VB 1KQGB 5BYQA 3PDNA 3AFGA 5GVQA 5L9XA 4AQYF 4P7VA 3KHHA 2VQFJ 1XR5A 2E5IA 2YVSA 3MMAA 2QMUB 2VF3A 3BPSP 5IQQA 3OL6A 2YKNB 1U6BA 4O3PA 9ATCB 5ITHA 5KT2A 3S1TA 4ECVA 1VQSA 2IFXA 4G1PA 2CIMA 4ZVHA 4E8UA 4F4KA 3TQEA 1NK7A 4FPIA 2ASJA 1LV5A 4QYRA 4F4AA 3HVTB 1RABB 4I2PA 3NGKA 2C1EB 2EFVA 3VQSA 1U1OA 1U48A 2PEHA 2F8EX 2HZAA 2VFSA 3VGUA 5KG7A 3ELHA 4JI0J 1OS5A 5B08A 1X4CA 4F0KA 2OFHX 4OI6A 2VG5B 1PYTA 4PG5A 2DGTA 3H2VE 2WB4A 3DN9A 4MFBB 5KFNA 1JLQA 3JSMB 4USWA 2E66A 4NLSA 1K1QA 2W4CA 3JSRA 3EICA 2QLJB 4JYAJ 4WF9Q 2OKQA 2JX2A 2CUYA 3BN4A 3T6JA 4DLEA 4O23A 3SDEA 4JI5J 5HJXA 4NLTA 1C1CB 2VD3A 1DBDA 4NZ0A 4M5DA 2VPZB 1VC0A 1RT4B 1ZAWA 1D9DA 1X5OA 1HWUA 4TLQA 1UVJA 2QE5A 2D1CA 2Z2ZA 2Z8QA 2YKOA 3CEDA 4PYDA 3FJ2A 4IDKA 2R7OA 4CH0S 4DZ6A 1VQMS 7FD1A 2GMJA 3MWBA 2RILA 4V19J 3LAMA 1P8GA 1N5VA 3K89A 1VMBA 2V8VA 2X51A 1XR7A 1M5PC 1FJEB 5HP1A 4I68A 1VQ9S 4ED5A 4Q0BA 4WP9A 4Y2IA 1WJ9A 3JSMA 3DRRB 5B0EA 2G2OA 4P75A 3HPOA 5L1LA 4X66F 4D3GA 1HQ2A 2YWGA 1G2EA 1S1XA 2COLA 2HIQA 3RJMB 4OYOA 5RUBA 3ICLA 3QMQA 3R5BA 2OEMA 1LFWA 1SL0A 4IFVA 3KWMA 2MQQA 3N28A 2R8GA 2RUSA 3PIPQ 3ENWA 2R7QA 4ZITA 4P9SA 4DSLA 4YOEA 2MLYA 4NLDA 1RGVA 1WORA 3MDFA 3KOAA 4CNYA 4KHPF 5K20B 1WC1A 2QA2A 3F41A 3UNGC 4BC7A 5A8WA 3CMQA 5I3UA 4O3OA 4R5PB 4K0KF 1HHTP 5K14A 2CQHA 2L9DA 1Y10A 2B9XA 3Q89A 4YB1P 3OVBA 3VWSA 2I1RA 3R5CA 4NLVA 4U96A 4U67Q 1N33J 2QLFB 1NUEA 2PT0A 3CCRS 1ZZNA 3C2PA 4C11B 1MG7A 2B4PA 1RU1A 1VGYA 1WC6A 2FC8A 3BB5A 3PG9A 3KK3B 1OQ6A 3CMES 2KFNA 1LWFA 4J9QA 1PG5B 2O1PA 4UF4A 3SFGA 4URQU 1F9FA 4MAKA 2QGFB 3CO0P 4K59A 2UUAF 4BBYA 4ANDA 1EETA 4JI4F 2R7XA 4PAAA 2J9CA 3UVJA 4HKQA 4LFBJ 1N34J 1WC5A 1O51A 4Q43A 4TY8B 2FLOA 4PPZA 2C3MA 3ENVA 3M8QA 1TL7A 3CJ5A 2ZITA 4R5PA 1KNZA 1NXIA 2GJIA 3LPEA 3SIPB 3THPA 2HFOA 2P2CB 3Q24A 3CD0A 2EG2A 4WP8A 2NXUA 2XNQA 3MGJA 4C0HA 3CPWR 1BHNA 1OY6A 3CJSA 3U1LA 4ZVGA 4LBPA 3P4UB 2V0NA 2EFPA 3E51A 3ZZYA 5E3QA 3QGHA 4MFBA 2YKNA 1RAGB 3V2UC 4TU9A 1CVJA 1ZA1B 2BVZA 3OR2A 2ZBCA 3V4IB 3OTCA 3QIPA 2CJQA 4DR1F 4A8QA 1JJHA 1YG0A 2KXNB 1RTDA 3EGVA 3MR6A 4NRUA 3W61A 2JFDA 2UUBF 1FJGF 2HNYA 1R0BG 1KHWA 1S1TB 2VC0A 4WTOB 5CYQA 3VAIA 1QD1A 1A0OB 3VTIA 1NAQA 1UEKA 2QZ8A 1S1WB 4M5DB 4ANCA 1V5IB 5IS2A 4LMZA 1RACB 1HBOA 1FX2A 1X4GA 1TUVA 4NEYA 3LW5C 4ZIWA 1RHUB 3DU6A 2XYHB 3I5CA 2VONA 3HKWA 2FHOB 2W2PP 1B3TA 2EBEA 4NCAA 2AHOB 1P6TA 3LQVA 2MLZA 5AXNA 1IKVB 5J1EA 1JK9B 3LP0A 6FD1A 1JLEB 3CCQS 4OX8A 1AROP 4S0MA 3QBCA 3UI3A 1UZDA 2KKHA 2KG1A 4DL4A 3GYGA 1FXLA 5KT7A 4CZCA 1RCXB 4P10A 4M94A 4P73A 3PYDA 2XY7A 4HHJA 4EGLA 4DR2F 2C2EA 4IRKA 4DEZA 1Y11A 2M2BA 3G2XA 2MY7A 3BO2A 1HD1A 1KP6A 4QW9A 4MYUA 3MR5A 4WKYA 1N34F 4IO1A 3H5XA 3VGVA 1KSPA 3UNYA 4WK1A 1JIHA 4ID5A 4A8OA 4WFBQ 2L41A 1FJ7A 2IM2A 3I9V9 5GMEA 3DRXA 3MAQA 4ED8A 2DNHA 4JOUA 2FJVA 4YEAA 3PX4A 3DRRA 4DF4A 2JH3A 3K58A 3MAAA 1D8YA 1DTTA 3MECA 1WD6A 4B3TF 4HDHA 5KOXA 3KXDA 3W2WA 4FDFA 3E01A 4L76A 4ZHRA 2ZH7A 1IBKF 2W7PA 4FYXB 2J6SA 1JMTA 2CJ9A 3Q8UA 5HQLA 5H9EK 1HNWF 2KI2A 1WOPA 1GH8A 4LFCF 4EUVA 3CD5A 2PD1A 2HK3A 1A7GE 2AGPA 1TAUA 2GHPA 3O3LA 2RHSB 3FMBA 1VBXA 2PC6A 4F0MA 2CKWA 2GO8A 3GCWP 1R0CB 3W8PA 3QJPA 4YQWA 2DRBA 3FVYA 4JBCA 1YSJA 2I5JA 1U49A 2BE2A 5E3PA 3V6HA 1C4AA 4OHVA 3W5YA 1N48A 2G13A 1H2UX 3KFWX 4CM2A 4YMEA 1HR0J 1SKUB 4A48A 2B56A 2QX0A 3R5GA 5D0HA 2ZD1B 1ZM9A 3QWPA 4HL9A 3E3XA 3GSDA 2DCUB 4EBDA 2LA6A 4PYAA 5KFTA 4I0WA 1NSAA 3RRHA 4WU2A 1NHVA 1JNZB 2CPXA 1DRZA 1EETB 1XJWB 5K8MA 3AB4B 3K59A 1FT8A 1ZS6A 2MJUA 4DFJA 1VR6A 2IMOA 4OMFG 5MAOA 3ZZZA 4TVAB 5CZVA 4XPCA 4I2QB 3ENQA 3JAMY 3J7Z5 2B6AA 3KJNB 3NCRA 5EDWA 4B3MJ 1S1TA 3CJTA 3BN7A 4PG8A 1NB2A 5U47A 2E7WA 4ZPBA 2KB2A 3HX9A 4CLSA 2VL1A 4IOBA 4LF7J 1FI4A 5DDOC 3QZ8A 5EX0A 4DSFA 1LKZA 1MMNA 1QE1B 2NLWA 2QLWA 3A4TA 3MM5A 4N8OA 4UOHA 5ETVA 2E5GA 2WOMB 5KFSA 4BWJA 1OQ3A 2CADA 3V6JA 5AXKA 3NGUA 4JP8A 2OTJS 3IBFB 2FDNA 3H2UB 1L3SA 4DZDA 1VHFA 3BO3A 5J2NA 2DYAA 3M8PA 3R6LB 5E3RA 2HRUA 3AJ2A 2C22A 3PXGa 2N7YA 2HHHF 5IWAF 1R27B 3JTNA 4QOTA 3TAQA 3HHNB 3OTEA 3PCOB 5KG6A 3US5A 1SKRA 1NK0A 2RD5C 4DG1B 1QUPA 4OI1A 2AZ3A 3NCPA 3NWRA 1S5ZA 4EK2A 3DXBA 1XC9A 1UWBB 4LF8J 1FKOB 2K06A 4JI1F 2J8AA 2DHGA 2AZ1A 3NGDA 1CBKA 3M8RA 2DGXA 2F8MA 1Q7YT 1O0PA 3I6PA 4MK8A 4IUFA 2POKA 4G65A 4PKDB 3UN5A 1SV5B 4Y0FA 1U1RA 3FSYA 4X4PA 3MOZA 1R6VA 4C0BA 2MEWA 3DLLQ 1HPZA 2HBZB 5JVHQ 1IBLJ 1RQ0A 4DR2J 3DMJA 3GFXA 1IXKA 1HYSB 4O4GA 5J2MA 1K8AT 4Y65A 5LXYA 2BJ1A 4KTQA 4H4MB 4OHYA 2R7VA 3SMZA 1TV6A 1YK9A 1EZZB 1DTTB 1GFWB 1UW4A 3MECB 4RNHA 2CPJA 2DRAA 3P96A 4HDGA 1YRTA 1R8HA 3LP1B 3OUYA 2VICA 1BQNA 2CZVC 2DK2A 5F8MA 2ZH1A 2BRKA 1JXEA 3H59A 4QIFA 4QW8A 1L3KA 3CJKA 1HNVA 2ERRA 3EM1A 4GC6A 2GIQA 1RBLA 1T9YA 2MLXA 3EDQB 1EKSA 3DC2A 3RW6A 1SV5A 4RBUA 4KGVB 4QIEA 2G9OA 2UUBJ 1SJ3P 1FJGJ 1M5SA 2B9YA 3AH6A 4LIWA 2HAFA 2LCWA 3OXGA 1SJFA 2AJ4A 4AUKA 2EC2A 4DV7J 3V6KA 2OEKA 4ZP8A 5KFGA 4QJVA 4AE5A 3HCXA 4OFZA 2E9ZA 2FVCA 2VFTA 3MMCA 1S1UB 3O6QA 3VCDA 3B82A 4F3QA 4AL6A 4ER8A 4G3IA 5HL7Q 4HTIA 3TRGA 2WVCA 3KDOA 4JYAF 3ZTRA 4JI7F 3AHPA 3NOGA 2GNKA 2Y0BB 3K7RA 1BWEA 5EWFA 4DV4J 1VS3A 1R43A 3JTPA 4LR8A 3MZIA 4OYMA 4EBCA 2GQ2A 3DI6B 2GMHA 5JVGQ 1D09B 5CQGA 4L3KA 1RT7A 1RT5A 2HWIA 3S8SA 2XTJP 2CRLA 4GKJJ 3IM9A 3D6MB 3TEGA 3PKYA 1U2CA 1Q8IA 2J0XA 4H4KC 5J2PB 1RUSA 1PJ6A 1PJ7A 4TQSA 4HT5A 4YY3F 2HBYB 4HYKA 3SFUA 2XSFA 2CQGA 2OI2A 2VG7A 2LEPA 2RU9A 2C3OA 3MCOA 1W2IA 1RK8A 1JLFA 2V4RA 4F4WA 4MH8A 2ZFHA 4IG3A 3RB3A 2ZDPA 4O3QA 3IG1A 2JJ4D 3CIZA 3TAMA 1BQMA 2K2PA 3RZAA 4ZPWR 1QE1A 2C2KB 5CHCB 4IKAA 1AZSA 4R8UB 1B4SA 1SIZA 3K5MA 4B3MF 3RAMA 2AYGA 4PXBA 2ZWPA 3VHQA 2XMAA 1HWLA 5E41A 5A6WA 1WDDA 4C8LA 1T05B 5DQGA 1ZM3A 3R7BB 2M52A 3WX8A 4WYLA 1DTQA 2FY8A 2NPIA 3LGNA 1XEZA 3L4BC 2B6AB 2BKNA 4CH1A 3M9MB 4GKKJ 2K3IA 2AMCB 3I5BA 3E8OA 2Z57B 4PR6A 1TK5A 3ZZRA 4DG1A 5I4MA 1YJNS 3W63A 3HKZD 4NWBA 3TANA 1XMQJ 4RNOA 2J0WA 1NK6A 2GX8A 2H65B 2GMLA 4JI2F 3T1AA 2A10A 4TY9A 1UAWA 2HWHA 4FNIA 4IFYB 5CCLA 3ZFVA 1FWLA 5D4LA 5DGBA 1H0HB 4IRCA 3WIUA 4KHMA 3AAWB 5J2NB 3GQCA 1N4LA 5DRKA 3HF5A 5DDRC 4DBQA 3CCLS 2XM3A 1RWWB 3DMJB 1S6PB 2P8IA 4M1KA 3LF0A 4UQTA 4DUYF 5DZ7A 3ZTSA 4H4MA 1HMVB 1DY3A 5KFCA 3W7BA 2P5VA 3B4DA 4ZK7M 4B9SA 2BEFA 2I38A 4OHZA 1C4CA 2XYGB 3ILLA 5EUHA 3T9ZA 2R7TA 3FQKA 1Y0HA 2V4QA 3O8WA 4HH0A 4OYBA 1F5CA 1C1BA 2DHAA 2VOOA 5LJ3Y 1HBUA 2B4OA 2B8QA 5HJYA 3PJ9A 3UWTA 2KVQE 2AEMA 4NXMJ 3OLAA 1HW8A 2WVEA 4B08A 2OTLS 2XWYA 3H4DA 2RT3A 3GJRB 5KFRA 2MHEA 3IP0A 2E1PA 5CAAA 4N41A 1S9GA 1DAXA 1TMJA 3H90A 2YWKA 3RBXA 1ZH5A 1CJKB 1A6LA 1U2FA 4Q5VA 4PXEA 4I69A 4IH6A 1N5QA 1WG5A 1FDBA 2VPXB 1IM4A 2WCXA 2G1DA 3NWGA 4CH7A 1X9SA 2BKPA 3KNGA 4LR9A 2VA2A 2MSSA 3GFZA 2EEYA 1F5BA 1YKWA 3R5AA 3QRPA 1TU0B 2H5EA 1WF0A 1JB0C 2BJ9A 1C0TB 3DFEA 1MLAA 5D4PA 5KFXA 1Z2LA 4EYIB 1F3FA 3SSQA 2GQQA 4R0EA 2J7WA 2IM0A 3IFEA 4ZVFA 4JI0F 3MEGA 1QSYA 4WYWA 3KG4A 3LP2B 2HLUA 1LK7A 3CJ8A 3HHLC 4DV3J 2X1FA 3HT3A 4KY3A 2LFVA 4MKVA 2ALYB 2AV5A 4QR1A 3VR1A 2W4DA 2QG9B 3ETOA 1FCAA 4LBIA 2QA4G 4LF5F 1NMEB 3MMJA 5A8KA 1URNA 2DCLA 2V2QA 4Q2LA 2B4VA 3HJVA 1I3OB 3KJQB 3J7A1 4RW9B 1E6VA 2PFDA 3SXLA 4ZN3A 2BA9A 3L95X 5ETMA 3I5AA 4IG3B 4C97A 4X84A 2CJYB 4HI2A 1OJ4A 3EDRB 3PFEA 4JUZA 2VODA 2WAQD 2ZHOA 3SQGB 1S9EB 2DIUA 2EFNA 4YR0A 1S10A 2E1MC 3KJFB 3PM9A 2ALZA 2YH0A 1S1VA 3DHWC 2IBKA 1OYEA 2HLTA 4B3RF 3EWGA 4YDDB 1Q0NA 3KG0A 4LF2A 5EWEA 1NH8A 1HNXF 3D6HB 4QWAA 1YWXA 3AQOA 4DXLA 2YNHB 1TL4A 1H7XA 2EG1A 1CC8A 4ANEA 4YHHF 2VG7B 3D6TB 3R1LA 2RRAA 1S0OA 3VQTA 3AY0A 1U26A 3CDWA 1I5OB 3LTOA 5AXLA 1CS4B 3J7YU 1NSQA 2FUG9 2Y3YA 4RLEA 3OJSA 1VQ5S 2DH7A 1NO8A 4NZ6A 1ZAVA 4U6PA 2VHGA 1IR2A 3A3PB 2GZOA 2C3YA 2FC9A 2RDDA 3EMTA 1VQ8S 5DM6Q 2KXHA 3F0NA 2F63A 2QLXA 2VDIA 4J7CA 1N5YA 3DLEB 2O01C 3EVOA 4TYBA 4C8MA 2LU1A 3FBEA 1HARA 1LWEB 5K9FA 4XIUA 2K7KA 2V4JA 1UPMB 4ZPAA 3I96A 4L75A 1DURA 5BR8J 3CMAS 2BQUA 2V8DA 4JI6J 2OSQA 3BYRA 4J5OA 5KFAA 2DR7A 1QSLA 2VOPA 4F7VA 5DLFA 3OL9A 3H5YA 2H1YA 3GV7B 4DV4F 5LSRA 2FGOA 4ZVTB 3CDAA 3G8TA 3A3NB 2QV6A 5AXMA 2YKQA 4HLBA 1GXLA 2DITA 2KJVA 3CJ0A 2D3OR 2ZZNA 4A8FA 5IM0A 2V8PA 2WZ1A 1RKIA 4XK8C 1T3NA 1N56A 3TVKA 1KWMA 2YWWA 4GMKA 1S6PA 2IIHA 2VV5A 4WBFA 2Q3PA 4JI6F 3IC1A 4F3MA 2L9WA 4QPXA 2RS8A 3H25A 4OX7A 2Y1IA 1Q82T 2PFFB 3CULA 3HM9A 1KS2A 1Y3KA 2W1BA 3ENAA 1Z2ZA 3TA0A 3HD2A 2AWZA 2BX6A 2E7XA 2FHMA 3UDEA 3IWLA 5MLCV 1CJVA 3CJ4A 3OFGA 1WSRA 5AE3A 3OL8A 2V2KA 2JEJA 1TFWA 3MCNA 1LWCA 3MM9B 2C2DA 2ZH6A 2XC9A 3TEHB 3UD4P 1NB7A 2UUAJ 3DDKA 5HK4A 3SDEB 3NS6A 2OIHA 4PQUA 3T5HA 1Q95G 3M8WA 1N32J 3QJLA 2CZ9A 3NOCA 1D0EA 2YNGA 2UZAA 4OLOA 4KGKA 2VG6B 1Q16B 5KFZA 4DV2J 1WKJA 1BE4A 3CC2S 3QT8A 4CYUA 2YNIB 4Y2AA 2UVRA 3HZGA 4L3NA 4ZIVA 1MWYA 7AT1B 2P6SA 3MTJA 3PNIA 3W64A 4DN0A 1JLGB 5FLXY 2FJXA 2QEXS 4RW8B 2Y8YA 1VI7A 2DY1A 2LEAA 3HSZA 1TP7A 4Q2MA 2P9GA 2JWNA 1W7WA 3MM6A 4U7UD 2K7JA 4RW6A 1IBCB 1HNWJ 2EVZA 3TQ1A 2DNQA 3KTQA 1AFJA 3FUYA 3UDVA 2SXLA 4OV1A 5KFUA 4BHQA 1PGZA 4OYAA 2XZWA 1RTIB 3HSJA 2M4MA 2H9ZA 1EQMA 3GFYA 1CJTB 1WEXA 4IFVB 1N36J 4WJBA 5KG5A 4NLGA 1EARA 3VAKA 2B8PA 4A46A 2BXJA 3J7AN 1F1BB 4X66J 3L3CA 5G4DA 3V81A 5KFVA 3IWNC 2DHHA 3MEDA 4GKKF 5FIIA 3EGNA 1FRKA 3D1HA 3SEOA 3EPIA 5E0OA 5L1IA 3PW0A 2F4FA 3C8YA 4C8KA 1H3DA 1JLGA 2VDHA 2OPSA 4CI0B 3DNCA 1FKPB 2YWEA 4DPUA 1AA1B 4ZVOB 4IG0A 1APSA 1LW2A 2RQMA 3FBCA 2CNNB 1BQXA 2KXFA 5EX3A 3OQ2A 1UFWA 4IYQA 2X1AA 3MPDA 5GAHU 3ILIA 1WC3A 4DR5J 3MHYA 2AW0A 4F4XA 3VGSA 1H74A 3T1YJ 2J0QD 1T3OA 1NJZA 4CLZA 3RR7A 3O44A 3PYEA 3QFHA 5IT9Y 4KFBB 3PJXA 3POTA 1U24A 3MEEA 3R6GB 1CS4A 3AOCA 4UY8T 1SIWB 4I1TA 3BH6B 1KKHA 4FYVB 1LEOA 2MKSA 4OZ2A 2H5JB 1L3VA 1UCNA 4AD6A 1S57A 4FF3A 2EKNA 1K0VA 4IG0B 1YZ6A 2RF2B 1RT1A 2GJFA 3BJYA 3DGPB 5B0AA 3U1MA 1FD2A 2G2ZA 3N01A 5HBMA 4PG4A 3U02A 1B0TA 2UXBF 4O3RA 1UJ5A 3PW4A 4P2FA 1OY8A 1HWKA 1SJ1A 3UCUP 3FZ2A 2DGUA 3JAMU 3KK1A 5HI7A 4ITSA 4DWIA 3L09A 2E5LJ 4HH1A 5CYJA 1UVMA 4LRAA 4B3OB 1EJ7L 1UFLA 1HI0P 4NCGB 5GAEI 4F4YA 4DV7F 1REVB 1T02A 2OPRB 3A8IA 1VQOS 3BQ2A 1SJ4P 1LWXA 4URSA 1RCOB 5IV4A 2E44A 2W24A 3B4MA 2C2RA 2AGQA 4X2BA 3GIRA 4P74A 1YJVA 3EGWB 4Y2CA 1NBEB 2GIFA 1GMUA 2FZKB 3QT6A 2VZ9A 1XNQJ 2J5AA 4KIAA 3ZZ0A 2MKYA 1WG4A 4DCJB 3V4MA 3DOLB 1RHRB 1Y3JA 2ILYA 3D2WA 4OZNA 4DQRA 5HROA 1HR0F 4OV6A 2N82B 5D4NA 5DO2A 4M5LA 2CPYA 5IC4B 3ZZPA 2FB0A 3W5XA 2ZH8A 1M1KT 3GIJA 4DJBA 4PQUB 3NKYA 1KVIA 2MSTA 3D54A 2C42A 3LWMA 4J9UE 3DGVA 2CQ0A 3CGIA 5JUMA 1R6YA 1REVA 1RTHB 2OPRA 3NMAA 2EI5A 2LLZA 3W3SA 3W5ZA 2HQIA 2NREA 3IM8A 3QGGA 1HI8A 1UP1A 2OFGX 2WSCC 4CLKA 1FFGB 5KFIA 2V68A 4FBTA 1XNQF 1VRUB 3N0VA 4YUDA 3N5FA 3KHRA 3GJSB 3IR5B 2XY5A 4DSIA 2KHCA 3IO1A 4FXDA 2Z58B 1OSCA 3OW2R 4K4WA 3CE8A 1F60B 4HT7A 4LRDA 3CTRA 4M5MA 1NK9A 2KO1A 2XCAA 1SVDA 3RB4A 4DPTA 4HEA9 1U1LA 2XB2D 4NLWA 3OTBA 2J6TA 3PIOQ 5H1SV 2W9CB 2I2YA 1VC5A 1BC6A 4DV1F 2UUTA 4ED2A 2DVIA 4CP5A 3D0HE 3TWZA 4O3NA 4FF1A 3TUJC 4X4VA 2YNFA 4EWTA 4LF6J 1RTHA 3D3CJ 4NA3A 4X65F 4C3MA 4YB7A 4UUWA 3FRZA 2MMYA 5L1KA 2J9EA 4N76A 5GMDA 2GGPB 3PYGA 1TKTB 2DRDA 3SSRA 4K4TA 1VK3A 3BEGB 4M63A 2WTFA 2E9TA 1P9YA 2FD2A 1S6QB 3KUHA 2ZBQA 2QMXA 2QN6B 2RSQA 4M8LA 4RJVA 5AE1A 3DDIA 1VYAA 4RBTA 4CTAA 2B5JA 2JSXA 4TXSA 5K8OA 4IRDA 2OD4A 4NMXA 4QWEA 4F02A 5I3UB 2HPUA 4RNFA 4R0JA 1RT3A 3KLHB 3HVTA 3UN2A 3OLBA 3C6TB 4DR5F 3AQPA 1CLFA 4WE1B 1SUQA 2GCFA 2KT3A 4F50A 2NYHA 1RT1B 3K0JA 2Z30B 1N8RT 1JLBB 4KB7A 5A8RA 5KFPA 2GA7A 4FKYA 4ZPTR 1DQAA 2H48B 3PO5A 4FYYB 1FWPA 2RRBA 4F04B 4PUOA 2NXCA 1JLCA 3I9ZA 3CCSS 2B0GA 3PO4A 2DXEA 5DS7A 3CUNA 1XWLA 1VDHA 5KT6A 3EPGA 2J0SD 3FBBA 4TQRA 2D41A 3GG0A 3J81U 4DR6F 1VHIA 1WKKA 1N6QB 3VAGA 1PYOB 5F8LA 2V9KA 3WC0A 4TN2A 1VQYA 3HHKA 2XMJA 2CNKB 1C1CA 2VB6A 1RU2A 2B5JB 2R42A 3WBZA 1KD1T 2RF2A 4K50A 3G6VA 1NKBA 4DR3J 2XY6A 2BJDA 4DQSA 3NMRA 5FLXU 1S4EA 2HBRB 2ILZA 3QO9B 4CLTA 4O0NA 2VPYB 2JVRA 1TKZA 2VG5A 1ICEB 3M32A 2UU9F 1JLQB 1F9EB 2HK2A 3CWJA 3GTYX 2YX7A 2DNGA 4J9NA 2B3TB 4QCLA 3IBCB 4B3SJ 3TJAA 1FRHA 2GV1A 2KRRA 3L9ZA 5LMUJ 3G71S 2KM8B 2IAJB 2DNRA 3J81Y 1XQIA 2UUCF 1CULA 3M4XA 3V5RA 1JWWA 4DQIA 3QT7A 4MK9A 2XMKA 1RT4A 3ZZTA 3V6DB 5HVFA 1QSSA 4DUZF 4H4OB 5H9EJ 5CYQB 2JRSA 1R31A 4DOZA 1PJ5A 4GO7X 4ZLLA 4M5GA 2Z56B 2I9SA 2XYPB 2Z2YB 2YKAA 3R3TA 5HAOA 4M95A 3KUEA 1RT2A 1WACA 4CLYA 1L5UA 3LO3A 3RBEA 1S9FA 4OZLA 4NA1A 2E1CA 1G7CB 1ROFA 2PO4A 3TO8A 2XO7A 3CXCR 4J9LA 3GWCA 1H2TZ 2ADBA 4UZCA 4KAIA 4KGMA 3LGMA 1KFSA 3LP0B 1NZ8A 2R2UA 1Q78A 2KTQA 2XHWA 2UXDF 2ZUAA 1WHYA 2HHWA 2VIHA 2HVZA 1T7PA 1DFDA 4ILLA 2ZDOA 3O1LA 2HMIB 2ZM6J 1MN9A 1SQFA 3CC7S 2NPFA 4A8XA 3Q8QB 2YNFB 4IQXA 4FVMA 4RBVA 3KK3A 4I64A 4JI7J 2CQ4A 5M2RA 3FQLA 1NJYA 2NXEA 4URGA 3UR3C 4LFAF 4E0DA 2E1RA 1B7FA 1VK8A 3OTOJ 1TELA 1YJRA 3P45B 1NZAA 1HWIA 2CJBA 2Q1LA 3QWUA 1X4HA 4ZJQA 1SPBP 4ID5B 3UD3P 4IR1A 2EFGA 5K14B 3UVJB 2MZJA 3B6BA 2CAJA 4CTAB 1J5OB 1BWVA 1G1XA 2Z4PA 1TFYA 2RU3A 3RB0A 3BSNA 1WELA 1ZTWA 1UVLA 1VISA 2XZDB 4N77A 3LWLA 2DKOB 4NE9C 4FBUA 2LQ9A 2NSBA 4WPAA 3J7YI 4C2MA 4RZRA 1NSPA 3NGTA 3ZTQA 5C24B 5LOQA 4G1QA 2GGPA 2XWXA 2HHHJ 4V1Ak 1RHMB 5D78A 4OYPA 4BCAA 3G82B 4ZPVR 3NNAA 4OJHA 4PWDB 3MI7X 3WX4A 5HMWA 2V6AA 2ZOFA 3FCWA 4KC5A 4P2MA 4B3TJ 3WHIA 3KLGB 4ECRA 3LUYA 4PEOA 4HTJA 4PQAA 5E33A 4ECQA 2YQ1A 4I6WA 3BF4A 3NG8A 9RUBA 4ED1A 3G4SS 5D6GA 4USTA 2QSFA 2RKIA 1WOOA 1RTZA 2NCKL 3DLGA 2D3ZA 1BGXT 3H0PA 2AEJA 4ZVUB 1JLBA 1HBOB 4ENOA 5A8RB 4X4OA 3IG1B 1HLWA 4I67A 3K17A 2JLEA 4M5HA 1JJ4A 4X62F 1S7HA 3D67A 5CD4A 3M2UB 2MQNA 3M2VA 5CZXA 5BYRA 3T19A 2ZH9A 3OR2B 4N47A 2MXYA 4B9UA 3AD8C 5AJ3F 1FXRA 1PKUA 2AYEA 2ZNYA 1HNZJ 5KG1A 1O6XA 2RHQB 2VFUA 3G82A 3WQPA 4DMZA 4DFMA 1SC6A 2NUHA 4C9DA 4OZJA 1B0PA 3LGHA 2HGLA 2HNYB 4A47A 1X9WA 4FVCA 4B9LA 1S77D 4DR4F 1NKCA 4X62J 1DJ0A 4I2QA 1H73A 1OYDA 3MPWA 4OYZA 2V9WA 3EZUA 3QO9A 4H4OA 2BW2A 2HKEA 3CIMA 5F41A 1M1GA 1NM2A 4LT6A 2ZUGA 1U09A 5ETTA 4G6VB 1IKVA 5A0YA 1NNDA 4LF6F 1VQ4S 3FKBA 5IQ6A 3FNNA 3JXOA 1Q53A 3KK2A 3T5JA 3IA0A 4E98A 1QAYA 1MU2B 3AA8A 3M6XA 2IAJA 4PG6A 3OVSA 2ABYA 2RS2A 4QU7A 2HFSA 2ZVSA 3Q8RB 3A12A 3CW2C 4F25A 1HBNB 1WI8A 3AXMA 3OHAA 1QAJA 3WIVA 2XI3A 3MAAB 2UXBJ 2GVDA 2EC0A 2DR6A 2G0JA 2LKZA 1I94J 3VGTA 2V69A 1YIJS 4DX6A 3ISZA 1IBMF 2R8IA 4CQ1A 5I42A 2APOA 3AJDA 3GSIA 1EB0A 1UWBA 3ADAC 3PRDA 5ETRA 1X31C 3RRGA 4KR0B 1XMOF 1SI9A 3CCJS 1ZETA 3ZXWA 1RWKB 4QWDA 3OVAA 3HP6A 2UXDJ 1PAUB 2KZZA 1YRUA 4IDKB 3W1YC 2V8GA 2DNNA 2BM1A 1T94A 2WSEC 3GR0A 3N6LA 4ELUA 2BV3A 3PV8A 3Q2SC 3BDPA 2NQPA 4JI8J 4O0IA 1GMVA 3AODA 2WVBA 1X4AA 2XO6A 1RWOB 2BZ2A 3QAUA 3AT1B 3NLCA 3KMQA 1I6JA 1FNMA 2OGUA 2AJ0A 3O2IA 5FD1A 4RW4B 2FJAB 2CZ4A 1CQMA 3FMWA 3DLBA 5GAGU 5BXIA 2Z2MA 1FDDA 2D74B 2E9RX 4ED0A 2DT9A 2R8HA 4G1QB 3CO9A 2XS7A 1IKXA 5KFKA 1N88A 2CNLB 3DOKB 4O44B 4RX6A 3DOMB 3NS7B 3MFIA 2ZH4A 1SH2A 3SV3A 1F2HA 1WF2A 2F40A 3LAKA 3PHTA 3QZ7A 2X3GA 3CJKB 2UVUA 5F9LA 1RWXB 2ACMA 4RKUC 2JVOA 3KLGA 4J9KA 4DCOB 4P52A 4QYZJ 3GFHA 5C2CA 4O3SA 1DARA 3FEYB 3K5OA 1KC8T 1BD6A 2CWXA 4DFKA 1DQ8A 1YBAA 2LQJA 4QIVA 3T9NA 5AJ3J 2R9LA 4MK7A 2ZD1A 1PILA 2CJKA 4OIXA 5C24A 2BDPA 2EXUA 3PJWA 4LF9J 3DRPB 1KVJA 5F8IA 3G6YA 3TJ8A 1I51B 4RW4A 1UVIA 3H5SA 1LW0B 4KH0B 4K2XA 2GQCA 2MKHA 4KSEB 5KG4A 5AT1B 5C25B 2WW4A 5H9FK 4LSNA 4NLXA 2YBVA 2MQOA 1IKXB 5IT0A 3H5UA 6AT1B 3EZ5A 1YITS 4U7CA 3AA9A 1RP5A 3EJMA 4ZCIA 4EZ6A 1RT7B 2GHWA 2IC3A 3A1YG 4CLUA 1U02A 1NHKL 5KFOA 2R7RA 4NLUA 4J9PA 4X64J 3FBFA 5IT4A 3OT9A 1IQTA 3BKTA 2OD6A 1SC3B 4GVBA 3TX8A 2HRYA 3M8QB 1T9TA 1AUDA 2UUCJ 2Y9HA 3D0IE 1UJ4A 4WZQA 2AGOA 2KT5A 1VCTA 3SCJE 4LFBF 3WZ0A 3KLIA 1BMQB 1VRTB 1OPIA 2IYIA 4WU3A 1VOMA 4ZVQB 1RLDA 2J7KA 1DLOA 1H72C 2LDIA 3QATA 4HACB 2DGQA 2XMTA 4ZP7A 3N9UC 3M1VB 2MJNA 2E5LF 4DR7J 1K1SA 1WUUA 2D3UA 2M88A 3QNWB 8RUCA 4RWWA 2IA6A 3N5BA 3DLEA 3CCWA 2J8SA 4B02A 2Y8WA 4QWCA 3JTOA 1RE1B 2QFJA 1K47A 4WWSA 2KU7A 1ZA2B 1TV6B 1XN9A 2LEBA 3OR1B 2HVHA 1H2VZ 3H7HB 4NMLA 2XMWA 2RB7A 1FKOA 4USVA 2FLNA 5IFMA 2NR0A 5F8JA 4Y3CA 2JZ5A 4C3LA 2MHNA 4OHXA 5DG8A 4DL6A 5K8PA 5KFBA 4JI8F 2VJVA 3WC2A 2MY8A 2J76E 3BZQA 4OZ5A 4DV1J 1MSWD 4C6AA 4PABA 2ASLA 1HNVB 2QO3A 3P8BB 5L8RC 2HWTA 3RB6A 3BGUA 4IFYA 2VQFF 2N7CA 1RYRA 4O4GB 4L73A 4NI2B 1IM6A 1F0XA 2M5YA 2WBRA 3D7SB 2DGVA 2LXIA 4YB6A 3GV5B 1RYSA 2NZCA 2Q6BA 4O4RA 1IKWB 2G4BA 2A18A 2DBBA 4K4UA 3GLJA 1AYEA 3JSBA 3NGSA 1TL3A 1ZZFA 2VASA 3NP5A 2DNMA 3QGIA 2XMMA 2JNJA 4KBIA 3G96A 2LQ8A 3TYTA 3MFHA 3Q23A 3VVTA 3QSYB 3J80Y 1T8EA 4BDPA 2VKZG 5CYMB 3IMQJ 5HMZA 1WC0A 4GRSA 1ZPWX 3B8HA 4X4RA 1EAYC 4Y28C 3H4BA 1VBYA 3RR8A 1S0VA 3K5PA 2ATLA 1ZBTA 4Y2MA 3I4HX 3DOMA 2MZSA 3FSXA 4PCQA 3TUZC 5KFEA 1V3SA 2YNGB 1GXUA 3MD3A 2QA4S 5CCMA 1H98A 1NU4A 2FLPA 1JLAA 4ZOSA 3TNVA 4LF9F 4J9OA 2DHXA 4OYWA 2YNIA 1AXQA 4OZ0A 3H8YA 4QZVB 2P9CA 5IXUA 5EHHA 1RAJA 4NI2A 1IWGA 2EK1A 2QFIA 1FF2A 1R8BA 2B7BB 3EE3A 1WG1A 3UCGA 4BLGA 3SYZA 3HULA 1TKXA 1IKWA 2CPDA 2XLIA 1X5TA 4NASA 5C5JA 4J9MA 1C0UB 1WTFA 5KFWA 3UD5A 4KO0A 5D0GA 1N0VC 1JLFB 2AT1B 4ES3A 5J1PA 3T5KA 3W2WB 2L08A 3NEKA 2B43A 1KRPA 1F3VA 2CPEA 3D6FB 4GKJF 1AFIA 1LW0A 3EXYA 1RHQB 2V63A 2X1BA 2VFVA 5I3QA 2YWHA 1P1TA 2DHSA 3MR3A 2YKMA 2ASDA 4ID8A 3OSNA 4DX8H 3UCZP 1DTQB 2B4UA 4MJKA 2XNRA 1HNZF 2B7CB 3KYLA 1W25A 2HS0A 1NK4A 1ULRA 2JFKA 2ZC4A 1FTCA 3MM8A 2GIRA 2EPIA 3OTOF 3RTVA 2IM1A 3I82A 3GONA 4A4JA 3DRPA 4ILRA 4RWXA 1PO6A 2OPSB 2JOQA 1IQZA 2FQQB 2YQ0A 3KLIB 4KO0B 3W2VA 1U8WA 2PMWA 4J90A 4JI1J 3FEXB 2ZZMA 3CT9A 3EZOA 1YQHA 1X4DA 2O3DA 4H54A 4W4MA 2HQGA 3GV8B 1LXJA 5LMNF 3PKMA 2IC3B 1SQEA 3ISND 4M5IA 2HIYA 4ETZA 3G6ES 3ZZOA 1J5EJ 1JXVA 1UZHA 4XDDA 4X4SA 1E6YB 1Q8KA 1R8AA 3CB4A 3CDEA 2LDYA 3KNAA 4F4ZA 1WKLA 4DR3F 4X4TA 1URRA 1QLNA 5LT5A 2H3EB 4XPEA 4XDCA 1D9FA 1RB0A 2D9PA 2CPFA 4DPOA 4B9VA 2R7SA 2CPIA 2ZKUA 1YX2A 4CLWA 4USMA 1FE4A 1B64A 3FGVA 1FX4A 3I32A 2CQDA 5A2QY 2JEFA 4DF8A 4I2PB 5F9NA 1WDTA 3W65A 2NZ4A 2WONA 3W2VB 4F26A 1V6HA 1U0SA 1ZM2A 2HQ3A 2YXLA 5LM7E 3DYAB 2UVVA 2DNOA 3DU5A 4ZS6A 4DL0C 5HSPA 5G0RB 1QAXA 1Q8LA 1X4BA 5B7WA 1RWNB 4NLOA 1CJKA 1KVKA 1X7VA 4OYIA 1KQKA 4EFAC 3TI0A 4I56A 4ZA1A 1LWEA 4FYDA 3NNHA 3VAFA 3KK1B 4UZBA 2EK6A 4DS5A 2A3JA 3GIMA 1XERA 4N7TA 5CYMA 4HR2A 1MN7A 3RG6A 3QRQA 5D3GA 3FRYA 2M9KA 3CVKA 4UOCA 5L1JA 4FS2A 2OLWA 1Q1KA 2AX0A 2ZOGA 3F44A 3HFZB 3LP2A 5LJ5Y 3D4JA 4GO5X 4DV3F 1S9GB 1KOOA 5F0UA 2RQCA 4DL2A 1JLAB 1SB6A 3DOLA 5HROB 1PYSB 4CO3A 1FRLA 2E1AA 3AXKA 1A9NB 3R8YA 1U1NA 1PBUA 3R7SB 1HNIB 2MQMA 5A8KB 3DYAA 3C15A 1U7LA 2OJ3A 2DO4A 1YGYA 3R5DA 3DHXA 2JL9A 2OP5A 3ILJA 1YJUA 4NZ7A 4RW9A 3RYLA 2JLFA 1UETA 3QGPA 4DUTA 2XGPA 3NNCA 4QIWD 2LYVA 3HHLD 3FC9A 4KT0C 2N3LA 2KRBA 4U9RA 3C46A 1S72S 2CG4A 5HATA 1W2BR 1RAIB 3MEGB 1X0FA 1X8DA 2FGCA 3G86A 3HSGA 5E3CA 3N6MA 2DD8S 4NEZA 1S1XB 4WTYA 1WWHA 3QQCD 5D3GB 1RHJB 3IR7B 3O5TB 1VBKA 3IBWA 2AIRB 2CQ2A 3FEZA 2GVZB 4OZ3A 1F9HA 1IUJA 4UW2A 4ZKAA 1U0HA 2CXEA 2W7AA 5ADZA 2VG6A 4YR3A 4B3SF 2LU2A 4DR1J 3KMSA 2HQDA 1AW0A 2AJ1A 1C0UA 1MWQA 2B51A 1NEEA 1T9XA 2BJ7A 2HHQA 1IKYA 5DM7Q 2MQPA 1Q5VA 2W4PA 2PI4A 3SCLE 5L9NA 1PC5A 2CVEA 3MURP 5AE2A 3I0RA 3QT5A 1F5AA 4C8NA 4C7QA 2C2ZB 4CT8A 2W9CA 2RDJA 3C3LA 2FVRA 1HD0A 1YTYA 4ELTA 2IRYA 2BUNA 5L39A 4E2FB 2ZZTA 4LSLA 4C11A 5F3ZA 4ZCMA 4LF4J 5GADU 1RT5B 1ZYQA 1RLCL 1RTIA 1U47A 2XS2A 4IO9Q 1BXNA 1YJTA 2YNHA 3MCSA 4KQZA 5HVHA 1EQ0A 3QLHA 4V19X 3HLUA 3CJ3A 1UVNA 4J9SA 2GW8A 1ITPA 2YQ3A 1J2VA 3M8YA 4WKRA 1HA1A 4OX6A 1HHSA 5DDPC 1RA6A 1B7YB 1UEUA 2CFXA 3TR5A 1K73T 2F4VF 3GPAA 3BH7B 4OJ3A 3SCIE 4F2SA 1HIYA 3TZZA 2G0IA 3HHLB 3Q8YA 3RBDA 4NXNF 3MPUB 1HQEA 3DLKB 2KDOA 1IBMJ 3BGRA 3UDLA 5FJ4A 4Q44A 1SUQB 4CCHA 3P49B 1T03A 5HMXA 5LSOA 3HXMA 2V4JB 1OWXA 2CG8A 1OMSA 2AP6A 5G0RA 3THTA 4CO5A 5HANA 5HVGA 1T05A 4B9MA 4DDFA 4KKOA 3FK4A 3K8VA 4UT4A 1AUSL 1R0AA 2X3DA 1RT6B 3M30A 4LJMA 3P5BP 1RA7A 3BGLA 3MCMA 2HHUA 4KHRA 2KYZA 1K9MT 1YVFA 2FJWA 4HHUA 3POTB 2CQ3A 2IRXA 2PGCA 4ZLNA 1T0TV 5IM0B 4DV0J 1N6QA 1IBKJ 1S99A 2DB1A 4CIOA 1VBZA 5F8GA 4DSJA 3BO4A 2I0XA 3DM2A 3QPIA 3OBIA 5CXTA 4DV5F 1NRKA 2MZ1A 2MZRA 1CQNA 2Y1RI 3HHLA 1O5JA 3J80U 1BUXA 3BGRB 4LBHA 2HFNA 1TKZB 2JC0A 3BR8A 4M5JA 1S49A 2OPPA 1RKJA 1SL1A 4Q8EA 4OJGA 3KLFB 4ED3A 3I55S 3OHBA 4ZVEA 4XTTA 2DIVA 1FDNA 3MUMP 4LF5J 4WZMA 2A6OA 1CC7A 2HRTA 3D66A
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 3DRY A;  4L72 B;  3PRB A;  3G87 A;  4WK3 A;  2R8J A;  4X4Q A;  3ISN C;  3MAH A;  3Q2T C;  1IN0 A;  2JDJ A;  1HBU B;  3W66 A;  4USI A;  2KHD A;  1EIY B;  3D68 A;  3MUV P;  5L46 A;  4RU9 A;  1SKW A;  1NJW A;  2MYF A;  3JS9 A;  2PI5 A;  3QRR A;  4CDI A;  1QUV A;  1LOU A;  1UPP A;  2CVI A;  2RML A;  4D3H A;  1NDL A;  1JKH A;  2HQC A;  3HDS A;  1S6O A;  3MM7 B;  4J9R A;  4UY8 5;  4J91 A;  3TUP A;  1RWP B;  5LSL A;  1S7I A;  2HHV A;  2EBG A;  3BBF A;  3GB0 A;  4K4Z A;  1J5E F;  2Z2L A;  5B0C A;  1NK8 A;  4JB8 B;  4KHP J;  1TL1 A;  1RJJ A;  3I4P A;  5DZ6 A;  5F0W A;  4A8S A;  2Q66 A;  3IRX B;  2C3P A;  2DGS A;  3IS9 B;  4NPO A;  2OHD A;  2ZJP Q;  2PSZ A;  2JLG A;  1U1P A;  2XUL A;  3RAX A;  2VA3 A;  3PY8 A;  3THV A;  4ZMM A;  3F73 A;  1GMW A;  3I0R B;  5KFD A;  1RAA B;  2M3D A;  1XMQ F;  4TNO A;  4ZN1 A;  2M8H A;  2QC3 A;  3GIL A;  4PXC A;  2HG4 A;  2YY3 A;  5GAH I;  2PA8 D;  3G6X A;  3M7V A;  4DR6 J;  3I87 A;  1VQ6 S;  4XO0 A;  2VUG A;  3WDO A;  3OPK A;  2HGM A;  4F2R A;  5EN1 A;  1FRI A;  4C0O C;  1Q79 A;  5B0B A;  1YI2 S;  3QLH B;  4Q45 A;  1YBU A;  5KFJ A;  5DDQ C;  3MM7 A;  2RUG A;  1SH0 A;  2IRU A;  3I31 A;  5SUH A;  4DX5 A;  3F56 A;  2NXJ A;  2ZM6 F;  5D15 A;  3Q8V A;  4WP3 A;  4ELV A;  3TAR A;  1E6V B;  1QY7 A;  2YKP A;  4AYB D;  4Q8F A;  2BYC A;  4AQY J;  1S0N A;  3G8Q A;  3T6B A;  3IRX A;  5DET A;  2XCP A;  2KFY A;  4C4W A;  3DCA A;  4WFN Q;  1F2G A;  2HBQ B;  5BJR A;  4MKB A;  1GK8 A;  2FJB B;  1GEH A;  4ICL A;  3FDS A;  1FVS A;  1YZ7 A;  4YN3 B;  2ZH3 A;  1WNE A;  1X4F A;  3CDU A;  3DLJ A;  4AXJ A;  4JI2 J;  2NYI A;  3H98 A;  4OL8 A;  2EWH A;  3DGP A;  4R25 A;  4QWB A;  2IYG A;  1NSK L;  4FXW A;  4UTG A;  3X3U A;  4EEY A;  3R1H A;  2D3O 1;  3A8J A;  4KFB A;  1RBA A;  3BQ1 A;  5DQI A;  2FY1 A;  2JC1 A;  4F36 A;  5C42 B;  2J7U A;  2L3M A;  1O8B A;  3GMG A;  3HI9 A;  4NA2 A;  3HZE A;  5LL6 d;  1HI1 A;  2FHK A;  1RIS A;  4GVL A;  3VVU A;  2BJ3 A;  1P1L A;  4F0H A;  5KAK A;  2ZHA A;  1CG2 A;  1NCL A;  5KFQ A;  2YPZ A;  2WRM A;  1R3N A;  1U2R A;  3MD1 A;  4LIR A;  3PR5 B;  1IR0 A;  2ZOM A;  2ROE A;  3BYP A;  4DU8 A;  2EFO A;  2LXU A;  5KG2 A;  1JJ2 R;  3HO1 A;  2KL8 A;  3EVW A;  4DR4 J;  2N4D A;  1UVK A;  4FNH A;  3D5M A;  1KOH A;  3MEK A;  4Z37 A;  3C6T A;  1WEZ A;  2ZE2 A;  5KFL A;  3T1H F;  2HHX A;  2IDL A;  1KR4 A;  1N5T A;  2GAH C;  2HEK A;  3PAC A;  4Y2K A;  5J2P A;  4A8W A;  5H9F J;  1VQP S;  2XMU A;  2IMW P;  2DH8 A;  2WVD A;  3M8P B;  3NGR A;  4F8R A;  3NXZ A;  1Y00 A;  3EXC X;  2M8D B;  1NDC A;  3ULH A;  4PUO B;  4OQJ A;  2DR9 A;  2Z0G A;  1VQN S;  4IR9 A;  5KG0 A;  3V4I A;  5E5N A;  2DNP A;  1SC4 B;  2CPH A;  3D3B J;  3FFI A;  2BAN B;  2IA0 A;  4CRJ A;  4JV5 F;  1CPZ A;  1S59 A;  1BLU A;  4TY8 A;  3UN3 A;  1TR0 A;  1X4E A;  2NSC A;  2G2Y A;  2DTJ A;  3BPD A;  5K8N A;  4DPY A;  3ZNJ 1;  1QAI A;  2V5H G;  1TK8 A;  4HVZ A;  3ET6 B;  3M2R B;  3IRW P;  2OPP B;  4ZPD A;  1EP4 A;  2QL7 B;  4USH A;  3IAM 9;  3OV7 A;  3AOB A;  1NJX A;  1HPZ B;  1WSV A;  4MIW A;  4I6Y A;  3KK2 B;  5HMY A;  2LQ5 A;  1TL1 B;  2Y1L B;  1PBA A;  1LQ9 A;  5ETN A;  4EI2 A;  3Q22 A;  3R5J B;  3IS9 A;  2OPQ A;  2PEB A;  3RGI A;  1FK9 B;  1MML A;  2CQC A;  4K7Q A;  2VQE J;  1JLE A;  1M1H A;  1NLK L;  2HUR A;  4OI2 A;  1RTD B;  4OX9 J;  3TJ9 A;  3PRV A;  2F4V J;  2WSF C;  3LP1 A;  2ZC3 A;  3PTW A;  3OUY B;  3HK2 A;  4IOC Q;  1S1W A;  3W8G A;  4DI6 A;  1XNR F;  1KEK A;  1VRU A;  3VAM A;  4NRT A;  1C2P A;  5KTQ A;  4DLG A;  4WFY A;  1B0V A;  3ET6 A;  3M2R A;  4IH5 A;  4ZJL A;  1EP4 B;  3RRK A;  3KJV B;  1MRO A;  1RT2 B;  5IOL A;  4JI4 J;  3G9C A;  1K0T A;  4LF1 A;  1N54 B;  3J81 j;  2VH7 A;  1TL5 A;  1GXT A;  3DDN A;  2FVQ A;  1RXO B;  1V9O A;  3C66 A;  1RBO B;  2NS1 B;  3K2Y A;  3MMC B;  1PAE X;  1LXN A;  2FPH X;  4K5S A;  5KG3 A;  3W62 A;  3KLH A;  2MB0 B;  3SQO P;  1S4F A;  1R7I A;  3NY0 A;  3C6U B;  3W9J A;  4LFA J;  2DIS A;  3N79 A;  4CLF A;  4DV6 F;  2C3U A;  1NDP A;  1W26 A;  4C8Y A;  2VU5 A;  1LWF B;  2F9D A;  2AEF A;  2WW8 A;  1YJ9 S;  3GYX B;  3AD9 C;  1LK5 A;  2H5I B;  2KT2 A;  2MKJ A;  2RJZ A;  2ACY A;  3DI6 A;  5HQ8 A;  4FS1 A;  3JQJ A;  2QIF A;  1PSD A;  2BRL A;  3SI8 A;  1GTE A;  4P6Q A;  5C42 A;  3LOU A;  2MZT A;  3AD7 C;  3AOA A;  1UL3 A;  4PWU A;  4XAK A;  4FZV A;  1N36 F;  4DU7 A;  2DR5 A;  2PN6 A;  4UOG A;  2DR8 A;  4DV6 J;  1TL7 B;  1JXL A;  4AXI A;  3QFW A;  1T9U A;  2UV8 A;  3EUN A;  2H54 B;  2OO4 A;  2RH3 A;  2F1F A;  2I5J B;  3D1O A;  2BE2 B;  3A3O B;  5I3P A;  3K5L A;  1YJW S;  2IM3 A;  4Y00 A;  3E01 B;  2V50 A;  3M6V A;  1BQM B;  1MWZ A;  5GAD I;  3IR6 B;  1N32 F;  4RUH A;  2NXN A;  5C25 A;  1FNX H;  4MT1 A;  3GZ7 A;  2EFQ A;  4Q7A A;  1M5H A;  4DFP A;  4LFC J;  1ZM4 A;  3QIP B;  2FVS A;  3K57 A;  2CQB A;  3MMA B;  4KJI A;  3MUT P;  1D9A A;  3MEE B;  1RAD B;  2Q6C A;  2IDE A;  5CAB A;  4PWD A;  3H2L A;  3LAL A;  2GFF A;  3KLV A;  2OUG A;  1WHV A;  1FHT A;  2FTR A;  1NDK A;  4K4S A;  2KJW A;  2N3O A;  3UW1 A;  3V6D A;  3VAJ A;  2CPZ A;  3UE2 A;  4FF2 A;  3DLG B;  2XG8 A;  1TAQ A;  3D0G E;  1RAF B;  2AJ2 A;  5KFF A;  1D3W A;  5J1E B;  5HBM B;  4DSE A;  3L7O A;  4RNN A;  4ZP6 A;  1P9Q C;  2AJQ A;  2AX1 A;  1Y9O A;  1OO0 B;  2Q79 A;  4K2J A;  5EWG A;  2HAI A;  5K5M A;  5T41 A;  5HN0 A;  2QYG A;  2OPQ B;  4A8M P;  2BAN A;  4DL7 A;  1NJI T;  4PRF A;  3MR2 A;  2F5G A;  3QYY A;  5J2Q A;  3IAS 9;  3MTK A;  3EGZ A;  2QT7 A;  1YJ7 A;  2AYM A;  2PA3 A;  2DXF A;  2ZKT A;  2BW7 A;  2KN4 A;  3GJT B;  4K4Y A;  1PCA A;  2MQL A;  3RW7 A;  1QVG R;  2NUU G;  2IJR A;  2HMI A;  5A2Q U;  2ADC A;  1X5S A;  4RPF A;  4MTP A;  4DPW A;  2VPW B;  3TA2 A;  3I0S B;  5KOW A;  3BRE A;  4K8R A;  3H40 A;  4NOH A;  4U8Y A;  3MM5 B;  5D4O A;  1XBW A;  3TA1 A;  3HMJ G;  3CF5 Q;  5BR8 F;  1TMM A;  4K5R A;  3M9O B;  3KJV A;  3OTD A;  3BSC A;  5ETS A;  4X4N A;  2BBE A;  4IQM A;  2DEI A;  2CJA A;  2GHV C;  4M5N A;  5E3A A;  2BKO A;  3OFE A;  2DXD A;  1VJQ A;  2V94 A;  5DGA A;  1SQG A;  3X1L B;  2HYI B;  2RE1 A;  1HYS A;  4ALZ A;  5J2M B;  4ES2 A;  4RUC A;  4CM0 A;  1FJC A;  1L3T A;  3CSK A;  4ECS A;  2E5H A;  2W7O A;  2H4W B;  3C6U A;  3CCE S;  1WI6 A;  2YH1 A;  3U1N A;  4NXM F;  1IJE B;  1B99 A;  5C2G A;  3CCU S;  3OXL A;  4UOF A;  4WCE Q;  4WIQ A;  2WB1 D;  2FZC B;  3HFK A;  3TX0 A;  1LFP A;  1T95 A;  1HL6 A;  2A2D A;  2Y0S D;  2XQC A;  2HFU A;  3LA0 A;  2AF6 A;  2R7W A;  1ZOT A;  3LPY A;  4NYZ A;  5DLG A;  5FDL A;  3HVR A;  5T7L B;  1JQG A;  2G1H A;  2DGW A;  2LMI A;  3NBP B;  4YB5 A;  1MNE A;  3D1Q A;  3QJJ A;  3PW2 A;  1MMD A;  3CCM S;  3GG1 A;  1X9M A;  2FJE B;  3L7P A;  3NL0 A;  3J7Z T;  1TKX B;  5KT5 A;  3SSS A;  3DLH A;  1SH3 A;  1EKR A;  3FCH A;  2R8K A;  3PZP A;  2GS8 A;  1TKD A;  5IV3 A;  4OHW A;  1Q8B A;  2CWK A;  3NAI A;  2W2O P;  1NK5 A;  1HBM B;  4DV0 F;  3TZX A;  1BQN B;  1FDA A;  1U6Z A;  2GJ2 A;  4ZLJ A;  2ZH2 A;  1XMB A;  1HKA A;  1ZTT A;  1JX4 A;  3MOJ B;  3BBC A;  3PYF A;  2BOP A;  4NYP A;  2OEJ A;  2BOA A;  3CJQ A;  4B9N A;  1RAE B;  3AB2 B;  3VZI A;  1FVQ A;  1R89 A;  2YKM B;  3ZNU A;  5F8N A;  2F9J A;  3MPV A;  4NX9 A;  3M8S A;  2GC8 A;  1UA0 A;  2JHE A;  4ED4 A;  1X60 A;  4ED6 A;  4C8Z A;  4MKY A;  4QU6 A;  1ACM B;  1X5P A;  1HNX J;  4GC7 A;  3R7N B;  1OIA A;  5FDL B;  1GX5 A;  3C19 A;  3VF0 B;  2J6U A;  4F3O A;  2K8G A;  2HGN A;  4ECT A;  5DG7 A;  3ILO A;  1XNR J;  1GT8 A;  2ZBR A;  4DL3 A;  1N33 F;  1HFE L;  4LF8 F;  1RT3 B;  1XTZ A;  1Z1Z A;  2HND B;  1VQK S;  4C8O A;  3BSA A;  4ECX A;  5CD4 H;  1GMW D;  4JI5 F;  4ZLP A;  2XHC A;  4YFU A;  2E29 A;  3M2U A;  4L74 A;  2ZHB A;  3GJQ B;  3T3F A;  1D8Z A;  4DQP A;  4PPD A;  5A0Y B;  2YWF A;  1LNQ A;  3UR0 A;  4CWB A;  1EHW A;  4L6V 3;  3TAM B;  3CCV S;  4X64 F;  4ECZ A;  1FEH A;  1S0M A;  2ATC B;  4P71 A;  5L38 A;  1MU2 A;  4LVO P;  4USU A;  3PW7 A;  1JLC B;  1SC1 B;  4MYT A;  1S6U A;  3TUI C;  1NHU A;  3IWX A;  4JV2 A;  2XLK A;  2HSE B;  1E6Y A;  3NRB A;  3IGV A;  4P7T A;  2JEI A;  5J2Q B;  3HD1 A;  3ZTP A;  1TVR B;  1U8S A;  2HS3 A;  2OMO A;  1FRJ A;  2E7V A;  3D9B A;  1JJC B;  1KTV A;  2ZVI A;  3K5N A;  3PX6 A;  1I94 F;  3T41 A;  2OEL A;  2FYX A;  1X0P A;  3CD7 A;  1U1Q A;  3HJF A;  5KT3 A;  1KN6 A;  3DKD A;  1N0U A;  5IT9 U;  4ZJO A;  2IJN A;  1FRM A;  1B70 B;  1SKS A;  1I1G A;  2HND A;  5IC6 B;  3Q8P B;  4TYA A;  4JI3 J;  1XIQ A;  3BBB A;  4Z7Y A;  1WTB A;  1AT1 B;  1Y5N B;  4EBE A;  3BKF A;  1KQF B;  3M32 B;  1PIE A;  4WFX A;  1DZ5 A;  1DLO B;  1MW7 A;  4ZCL A;  4AL7 A;  1IVZ A;  2F8H A;  4U7U K;  3T5L A;  3M1V A;  4K0K J;  3EYZ A;  1WHW A;  5M2U A;  4WFA Q;  5ETL A;  4CNZ A;  3T1H J;  2W9B A;  2MKK A;  2BMB A;  4C98 A;  4AFF A;  1WEY A;  2J9D E;  2V67 A;  2I8E A;  3H42 A;  5HQM A;  2A6M A;  5I42 B;  2HFV A;  3GR1 A;  2RIJ A;  1LWC B;  3MM9 A;  2CDR B;  4K4X A;  1G6B A;  3I0S A;  1RDR A;  3PFO A;  4KPC A;  5DJB A;  2VBY A;  4FPR A;  4JV0 A;  1GQE A;  4B9T A;  2B9E A;  1REG X;  2M7S A;  1EX8 A;  4PG7 A;  4G1I A;  2PDA A;  3S01 A;  1VIX A;  2PII A;  1PC4 A;  2VBZ A;  4AL5 A;  2IPO B;  5T7L A;  3NBP A;  4ED7 A;  5B0F A;  1HW9 A;  1RSC A;  1UMJ A;  5LXR A;  2HZV A;  1FXD A;  1S1U A;  5HO4 A;  2VJU A;  2BQR A;  1CEZ A;  6FDR A;  4ZVP B;  1FE0 A;  4NCB A;  2O67 A;  4RW8 A;  1U1M A;  1FWK A;  1TL3 B;  2UUW A;  2W9B B;  4IH7 A;  2QL5 B;  5M2P A;  2AJF E;  2L9N A;  4A8Y A;  1HBM A;  2DJW A;  3N6N A;  4C3K A;  4ZHR B;  4PXD A;  5HLF A;  1C1B B;  2VQE F;  1UWA A;  1VQ7 S;  4DV5 J;  3ETM A;  3M9N B;  2BAC A;  2YX4 A;  5IWA J;  5T14 A;  2QRR A;  2W01 A;  2XEX A;  4UQG A;  1FKA F;  3P6Y C;  3L7U A;  1VQL S;  3MXH P;  3DXS X;  1HWJ A;  1Y5L B;  1UEV A;  2QYC A;  2GVZ A;  2ROG A;  3BM7 A;  4B17 A;  8AT1 B;  3CJ2 A;  2R2S A;  3CCZ A;  2BE7 D;  3P5T L;  4K4V A;  4LF4 F;  1XK8 A;  3QID A;  5BYS A;  4LRE A;  2AKW B;  1KHV A;  4LRF A;  1OY9 A;  4W90 B;  2V8H A;  7FDR A;  5ETP A;  2MKI A;  1J5O A;  3MED B;  2HVI A;  2A2C A;  3TP2 A;  4QIG A;  4DL5 A;  4EYH B;  1L3U A;  2HZC A;  3NCQ A;  2K3K A;  2V34 A;  1R8C A;  3BSO A;  4DN9 A;  2XS5 A;  1VFJ A;  2MTL A;  2WBM A;  3NS5 A;  1U25 A;  2UXC J;  1H38 A;  4QR2 A;  1FKP A;  2K1R B;  1DQ9 A;  1UTA A;  3BV8 A;  1C0T A;  1VRT A;  3D28 A;  1G3O A;  3CC4 S;  1FFS B;  4N5S A;  4YY3 J;  3IGN A;  3KDN A;  3TW0 A;  2UV8 G;  2CQP A;  3JQM A;  3MF5 A;  5HLF B;  1AB8 A;  1YRX A;  1FES A;  2OSR A;  4ILM A;  1S79 A;  1N5S A;  3H20 A;  4LSZ B;  4ZVR B;  3GIK A;  4ZP9 A;  3KUG A;  3T1Y F;  1YBT A;  3TVY A;  5THW A;  3HVA A;  2IY5 B;  2AD9 A;  4TLR A;  1YLX A;  1RWM B;  4WII A;  3Q8S B;  4ECY A;  3A13 A;  4GVB B;  5ETO A;  1FTR A;  2ZBI A;  3PX0 A;  1Z4U A;  3OFH A;  2DY9 A;  4KYZ A;  4LVN P;  4W98 A;  4YS2 A;  1CJU B;  1JNR B;  1FRX A;  1Q7L B;  1F6T A;  2CYY A;  2RKI B;  3BGO P;  3MR7 A;  3SBM A;  4U95 A;  2IHR 1;  3CNQ P;  5EGY A;  2DPI A;  1RI7 A;  3R2D J;  5SZT A;  3R97 A;  2CNO B;  2FJD B;  2E5J A;  2M70 A;  4TU7 A;  4EZ9 A;  1GX6 A;  1FFW B;  3VAL A;  4RUB A;  2MKC A;  1S9E A;  1WOS A;  2VKR A;  2WOM A;  3BDE A;  4TU8 A;  2R4F A;  4ERD A;  5KFY A;  2UVW A;  1S1V B;  4KPY A;  4LQ3 A;  2KM8 C;  1HMV A;  3Q83 A;  2IJF A;  4OI3 A;  3OR1 A;  4PWW A;  1V5V A;  4KKO B;  4FF4 A;  1TVR A;  1QDU B;  2ZNZ A;  3TOQ A;  3ZC4 A;  2MGZ A;  2W2Q P;  2I6W A;  4AT1 B;  1UA1 A;  2BM0 A;  4NLR A;  4MMO A;  1RTJ B;  1RWU A;  4C48 A;  4KH1 B;  2BJE A;  1KLN A;  1S97 A;  2CA9 A;  1BY9 A;  1Q5Y A;  1FNO A;  4NCG A;  4P2S A;  2U2F A;  2HS4 A;  4Y6I A;  3A8K A;  3IXQ A;  1YHQ S;  5B0G A;  4IOA Q;  2EKY A;  3GP9 A;  3KG1 A;  3W9I A;  1FA0 A;  2XSJ A;  3CDB A;  2VC1 A;  3BS9 A;  2DPJ A;  1GAO A;  1Y5I B;  2V2V A;  3EX7 B;  2DNL A;  3JQK A;  2RVJ A;  4ZPC A;  2WON B;  4ECW A;  3GCX P;  5GAG I;  1Y4Z B;  4I6A A;  4TKT A;  1RAH B;  2FHJ A;  1H6K X;  2KVI A;  4H4K A;  1HBN A;  1M5K C;  4FKX A;  2KFZ A;  2FHJ D;  2LQB A;  3BKU A;  4YR2 A;  2GVD B;  2WK4 A;  2KG0 A;  1CJV B;  1VLO A;  2HHT A;  3C14 B;  1KON A;  2Q43 A;  3PW5 A;  4LRB A;  1VC6 A;  3QAE A;  1Q86 T;  1U1K A;  1NKE A;  1M90 T;  2ZWO A;  1HQU B;  4ES1 A;  2ZJR Q;  1RAO A;  1FER A;  4NYO A;  3OXF A;  1U4B A;  1FEE A;  2L48 A;  1WC4 A;  1ZAX A;  4I4B A;  4LQ9 A;  2W8K A;  2R2R A;  2FZG B;  5KT4 A;  1SJQ A;  2QJ3 A;  1P27 B;  3U27 A;  2EW9 A;  1QVF R;  4DPX A;  2X7I A;  3EVM A;  2RQK A;  3VZH A;  5CA5 A;  1JKH B;  3R9L A;  1OPZ A;  1M5V C;  2JEG A;  3BR9 A;  3QSI A;  2P9E A;  5CH7 B;  2AQ4 A;  4CYU B;  3CD6 S;  4CO4 A;  1KFD A;  3PEH A;  4JV5 J;  3SCK E;  5DQH A;  3N4W A;  2KH9 A;  1FO1 A;  2GO9 A;  4NLQ A;  2QSW A;  2RNE A;  4EO6 A;  2BR0 A;  4EMD A;  4EU0 A;  2BQ3 A;  5DG9 A;  1U45 A;  1VRQ C;  4CO1 A;  3JYT B;  2K1R A;  4F67 A;  3UPF A;  3SQG A;  2FLL A;  1UKU A;  2LP4 A;  3BGF A;  3C14 A;  4BC9 A;  5ETQ A;  2RDI A;  2W25 A;  4WXO A;  4OI4 A;  4OZ1 A;  3KKF A;  1UFK A;  3DOK A;  4KGZ B;  1FD8 A;  1Q4R A;  4O44 A;  3KLE B;  4YP3 A;  4U8V A;  3ZTO A;  2DGO A;  2FVP A;  4DR7 F;  1OSD A;  5F3T A;  3M6U A;  1R8P A;  4NLP A;  2WHO A;  2BAB A;  2OML A;  3DRS B;  2C28 A;  3OD2 A;  4RR5 A;  1SBR A;  5LMU F;  2LVW A;  1CJT A;  4DQQ A;  2W9A A;  1TKT A;  3CJR A;  1WHX A;  2D69 A;  2XI2 A;  3PEJ A;  2DNK A;  2A1B A;  4MIB A;  2ASY A;  3SV4 A;  1V3Z A;  3AJ1 A;  4Y34 A;  5C7P A;  1Q81 T;  2PE8 A;  1TQL A;  2MPU A;  2OAU A;  3ONQ A;  3VV2 B;  4NLY A;  1SJR A;  1CSJ A;  3C16 B;  3W9H A;  4CT9 A;  5LMN J;  4FYW B;  3PVX A;  3MM6 B;  2DEJ A;  4ZDN A;  3PHE A;  4DSK A;  2D9O A;  3M8Z A;  3U7J A;  2U1A A;  2XLJ A;  4QYZ K;  4P72 A;  3TAP A;  4OX9 F;  5F8H A;  4ICL B;  1AZS B;  4R8U A;  2IBO A;  2PMZ D;  3TVZ A;  4LSN B;  4RL1 A;  3S6E A;  1TK0 A;  2N4C A;  2V2Z A;  3RAQ A;  2KZM A;  4LSL B;  2F3J A;  2CDQ A;  2QLB B;  4W92 B;  3TZY A;  2QL9 B;  2R3V A;  3K8W A;  1RZM A;  3HHD A;  5A6P A;  1IWA A;  4LUB A;  1CJU A;  3I56 S;  1TZ0 A;  2H51 B;  4KV8 A;  4RW7 A;  3R2C J;  3OL7 A;  5D8H B;  2IVM A;  3ZO7 A;  3BQ0 A;  4QPT A;  2ZH5 A;  2O5D A;  3PR4 A;  1KLM B;  2XBP A;  4M5K A;  4DUY J;  2HVE A;  2LA4 A;  1TUW A;  2HQF A;  2WVF A;  4PZV A;  4CO0 A;  4RU2 A;  1LW2 B;  5KFM A;  2UU9 J;  2C2M B;  5J1N A;  2UP1 A;  4HAC A;  1RHK B;  1XR6 A;  2C2O B;  2YPY A;  3OFF A;  4BWM A;  3VAH A;  2CJX B;  4ATN A;  3B78 A;  1HQE B;  3DLK A;  1M5O C;  2XZT B;  2ZE2 B;  1S76 D;  2HFZ A;  2BJ8 A;  1QTN B;  3S7R A;  1J27 A;  1HNI A;  2MGZ B;  1T03 B;  3FSI A;  2W8L A;  1RWV B;  1KBR A;  2VFR A;  2ZJQ Q;  4QQB A;  1RTJ A;  3M05 A;  2QTW A;  4LRC A;  2MDA A;  3HSD A;  4CO2 A;  3Q0A A;  2HNZ A;  2HW3 A;  3HVW A;  3HT0 A;  4ETX A;  1GTH A;  1RT6 A;  1WF1 A;  3M30 B;  4HI1 A;  1VLY A;  4X65 J;  2BE9 B;  3Q86 A;  4RO0 A;  3LAN A;  1KDN A;  1CUL B;  2IVY A;  4YHH J;  1VJW A;  3FFI B;  4QR0 A;  2GAG C;  1HQU A;  2M0G B;  2CQ1 A;  2ROP A;  2XSJ B;  4J37 A;  3OSP A;  3UO0 A;  4ZCK A;  4X4U A;  1KLM A;  3SZ2 A;  2IVF B;  2R7U A;  4RUA A;  1KTQ A;  3OJU A;  2AYB A;  2YTC A;  1VIO A;  4DUZ J;  3KHL A;  1ZPV A;  2P6T A;  4DX7 A;  3UDC A;  3W60 A;  4KRW A;  1U0H B;  3C15 B;  2C2N A;  5D0R A;  1S48 A;  2HHP A;  1M0S A;  1Y7P A;  3UQS A;  1K44 A;  2W2M P;  4CLL A;  5JJB A;  2Y1J A;  1QTM A;  1NH7 A;  3FZB A;  1SCJ B;  1UJ6 A;  3GU0 A;  3ITH A;  4KE5 A;  1IKY B;  4FP9 A;  4OJ1 A;  4UUX A;  4A8K A;  4YDX A;  2XMV A;  4RW6 B;  3KLF A;  1FK9 A;  3MPY A;  5E7O B;  1H7W A;  2HNZ B;  4N8N A;  3JYT A;  3RU0 A;  4B3O A;  1V3R A;  4RNM A;  3HHE A;  2DH9 A;  5D0E A;  5JMN A;  5GAE U;  4WXW A;  2LEC A;  2FIU A;  4Z7C A;  1SL2 A;  2UXC F;  4B3R J;  3KLE A;  2QMW A;  3E2E A;  2HHS A;  3HFV A;  5ETK A;  2MQ8 A;  2QA1 A;  1DHM A;  3NAH A;  4OLP A;  3P3D A;  4DHV A;  2LXF A;  1T9V A;  2H4Y B;  2XGQ A;  2G0C A;  4DCP B;  1N52 B;  4USK A;  1U6F A;  4HHH A;  4ZVS B;  5B09 A;  3V81 B;  2VBW A;  3MMB B;  3GII A;  3IN5 A;  2CQI A;  4I7F A;  1MRO B;  2X1G A;  4ECU A;  4JV1 A;  5D77 A;  4N56 A;  3C16 A;  2RQ4 A;  5HP1 B;  2R2T A;  4Q0B B;  1T11 A;  1UW9 A;  3ITH B;  1QM9 A;  1NPR A;  4QBU A;  4Z2X A;  2RAQ A;  1QJH A;  2D7S A;  3GE9 A;  4EO8 A;  3KHG A;  5A8W B;  1ELO A;  4WFZ A;  4NXN J;  1SXL A;  2MZQ A;  2RRN A;  5A76 A;  3M6W A;  4FXV A;  3RBZ A;  1XMO J;  2J9D A;  3JSY A;  2A0F B;  1T9W A;  3DRS A;  5E2Q A;  1YDL A;  1D1U A;  2VBX A;  2KYX A;  2F7V A;  2DO0 A;  1S12 A;  2F65 A;  4FN5 A;  4CLP A;  4JI3 F;  2ZBP A;  5B0D A;  1R0A B;  3GYN A;  2DNY A;  2PMH A;  4MKA A;  1NPP A;  1IJF B;  2AU0 A;  3FCV A;  5GMK a;  3UFC X;  3MMB A;  4KV8 B;  4RW7 B;  5IZH A;  3JB9 k;  2DNZ A;  3MM8 B;  1G4C A;  4I7F B;  2ZEJ A;  3LH2 S;  4LR7 A;  3ZZU A;  4USJ C;  4NL5 A;  1NPK A;  2HVD A;  2YX1 A;  4LF7 F;  1S6Q A;  2B9W A;  4KGX B;  4P2X A;  4DV2 F;  5JXS A;  8ATC B;  1GNK A;  2OH2 A;  5KFH A;  1IR1 A;  3DM2 B;  1TUG B;  4MIA A;  4J9V A;  3RUB L;  4DS4 A;  1KQS R;  4OI0 A;  3B54 A;  4OYX A;  2O66 A;  3R27 A;  3CCT A;  3G8S A;  1N5Y B;  2W2N P;  3A8E A;  4WE1 A;  1IBL F;  4BS2 A;  3TZW A;  1HHQ A;  1TTH B;  3M2V B;  1KQG B;  5BYQ A;  3PDN A;  3AFG A;  5GVQ A;  5L9X A;  4AQY F;  4P7V A;  3KHH A;  2VQF J;  1XR5 A;  2E5I A;  2YVS A;  3MMA A;  2QMU B;  2VF3 A;  3BPS P;  5IQQ A;  3OL6 A;  2YKN B;  1U6B A;  4O3P A;  9ATC B;  5ITH A;  5KT2 A;  3S1T A;  4ECV A;  1VQS A;  2IFX A;  4G1P A;  2CIM A;  4ZVH A;  4E8U A;  4F4K A;  3TQE A;  1NK7 A;  4FPI A;  2ASJ A;  1LV5 A;  4QYR A;  4F4A A;  3HVT B;  1RAB B;  4I2P A;  3NGK A;  2C1E B;  2EFV A;  3VQS A;  1U1O A;  1U48 A;  2PEH A;  2F8E X;  2HZA A;  2VFS A;  3VGU A;  5KG7 A;  3ELH A;  4JI0 J;  1OS5 A;  5B08 A;  1X4C A;  4F0K A;  2OFH X;  4OI6 A;  2VG5 B;  1PYT A;  4PG5 A;  2DGT A;  3H2V E;  2WB4 A;  3DN9 A;  4MFB B;  5KFN A;  1JLQ A;  3JSM B;  4USW A;  2E66 A;  4NLS A;  1K1Q A;  2W4C A;  3JSR A;  3EIC A;  2QLJ B;  4JYA J;  4WF9 Q;  2OKQ A;  2JX2 A;  2CUY A;  3BN4 A;  3T6J A;  4DLE A;  4O23 A;  3SDE A;  4JI5 J;  5HJX A;  4NLT A;  1C1C B;  2VD3 A;  1DBD A;  4NZ0 A;  4M5D A;  2VPZ B;  1VC0 A;  1RT4 B;  1ZAW A;  1D9D A;  1X5O A;  1HWU A;  4TLQ A;  1UVJ A;  2QE5 A;  2D1C A;  2Z2Z A;  2Z8Q A;  2YKO A;  3CED A;  4PYD A;  3FJ2 A;  4IDK A;  2R7O A;  4CH0 S;  4DZ6 A;  1VQM S;  7FD1 A;  2GMJ A;  3MWB A;  2RIL A;  4V19 J;  3LAM A;  1P8G A;  1N5V A;  3K89 A;  1VMB A;  2V8V A;  2X51 A;  1XR7 A;  1M5P C;  1FJE B;  5HP1 A;  4I68 A;  1VQ9 S;  4ED5 A;  4Q0B A;  4WP9 A;  4Y2I A;  1WJ9 A;  3JSM A;  3DRR B;  5B0E A;  2G2O A;  4P75 A;  3HPO A;  5L1L A;  4X66 F;  4D3G A;  1HQ2 A;  2YWG A;  1G2E A;  1S1X A;  2COL A;  2HIQ A;  3RJM B;  4OYO A;  5RUB A;  3ICL A;  3QMQ A;  3R5B A;  2OEM A;  1LFW A;  1SL0 A;  4IFV A;  3KWM A;  2MQQ A;  3N28 A;  2R8G A;  2RUS A;  3PIP Q;  3ENW A;  2R7Q A;  4ZIT A;  4P9S A;  4DSL A;  4YOE A;  2MLY A;  4NLD A;  1RGV A;  1WOR A;  3MDF A;  3KOA A;  4CNY A;  4KHP F;  5K20 B;  1WC1 A;  2QA2 A;  3F41 A;  3UNG C;  4BC7 A;  5A8W A;  3CMQ A;  5I3U A;  4O3O A;  4R5P B;  4K0K F;  1HHT P;  5K14 A;  2CQH A;  2L9D A;  1Y10 A;  2B9X A;  3Q89 A;  4YB1 P;  3OVB A;  3VWS A;  2I1R A;  3R5C A;  4NLV A;  4U96 A;  4U67 Q;  1N33 J;  2QLF B;  1NUE A;  2PT0 A;  3CCR S;  1ZZN A;  3C2P A;  4C11 B;  1MG7 A;  2B4P A;  1RU1 A;  1VGY A;  1WC6 A;  2FC8 A;  3BB5 A;  3PG9 A;  3KK3 B;  1OQ6 A;  3CME S;  2KFN A;  1LWF A;  4J9Q A;  1PG5 B;  2O1P A;  4UF4 A;  3SFG A;  4URQ U;  1F9F A;  4MAK A;  2QGF B;  3CO0 P;  4K59 A;  2UUA F;  4BBY A;  4AND A;  1EET A;  4JI4 F;  2R7X A;  4PAA A;  2J9C A;  3UVJ A;  4HKQ A;  4LFB J;  1N34 J;  1WC5 A;  1O51 A;  4Q43 A;  4TY8 B;  2FLO A;  4PPZ A;  2C3M A;  3ENV A;  3M8Q A;  1TL7 A;  3CJ5 A;  2ZIT A;  4R5P A;  1KNZ A;  1NXI A;  2GJI A;  3LPE A;  3SIP B;  3THP A;  2HFO A;  2P2C B;  3Q24 A;  3CD0 A;  2EG2 A;  4WP8 A;  2NXU A;  2XNQ A;  3MGJ A;  4C0H A;  3CPW R;  1BHN A;  1OY6 A;  3CJS A;  3U1L A;  4ZVG A;  4LBP A;  3P4U B;  2V0N A;  2EFP A;  3E51 A;  3ZZY A;  5E3Q A;  3QGH A;  4MFB A;  2YKN A;  1RAG B;  3V2U C;  4TU9 A;  1CVJ A;  1ZA1 B;  2BVZ A;  3OR2 A;  2ZBC A;  3V4I B;  3OTC A;  3QIP A;  2CJQ A;  4DR1 F;  4A8Q A;  1JJH A;  1YG0 A;  2KXN B;  1RTD A;  3EGV A;  3MR6 A;  4NRU A;  3W61 A;  2JFD A;  2UUB F;  1FJG F;  2HNY A;  1R0B G;  1KHW A;  1S1T B;  2VC0 A;  4WTO B;  5CYQ A;  3VAI A;  1QD1 A;  1A0O B;  3VTI A;  1NAQ A;  1UEK A;  2QZ8 A;  1S1W B;  4M5D B;  4ANC A;  1V5I B;  5IS2 A;  4LMZ A;  1RAC B;  1HBO A;  1FX2 A;  1X4G A;  1TUV A;  4NEY A;  3LW5 C;  4ZIW A;  1RHU B;  3DU6 A;  2XYH B;  3I5C A;  2VON A;  3HKW A;  2FHO B;  2W2P P;  1B3T A;  2EBE A;  4NCA A;  2AHO B;  1P6T A;  3LQV A;  2MLZ A;  5AXN A;  1IKV B;  5J1E A;  1JK9 B;  3LP0 A;  6FD1 A;  1JLE B;  3CCQ S;  4OX8 A;  1ARO P;  4S0M A;  3QBC A;  3UI3 A;  1UZD A;  2KKH A;  2KG1 A;  4DL4 A;  3GYG A;  1FXL A;  5KT7 A;  4CZC A;  1RCX B;  4P10 A;  4M94 A;  4P73 A;  3PYD A;  2XY7 A;  4HHJ A;  4EGL A;  4DR2 F;  2C2E A;  4IRK A;  4DEZ A;  1Y11 A;  2M2B A;  3G2X A;  2MY7 A;  3BO2 A;  1HD1 A;  1KP6 A;  4QW9 A;  4MYU A;  3MR5 A;  4WKY A;  1N34 F;  4IO1 A;  3H5X A;  3VGV A;  1KSP A;  3UNY A;  4WK1 A;  1JIH A;  4ID5 A;  4A8O A;  4WFB Q;  2L41 A;  1FJ7 A;  2IM2 A;  3I9V 9;  5GME A;  3DRX A;  3MAQ A;  4ED8 A;  2DNH A;  4JOU A;  2FJV A;  4YEA A;  3PX4 A;  3DRR A;  4DF4 A;  2JH3 A;  3K58 A;  3MAA A;  1D8Y A;  1DTT A;  3MEC A;  1WD6 A;  4B3T F;  4HDH A;  5KOX A;  3KXD A;  3W2W A;  4FDF A;  3E01 A;  4L76 A;  4ZHR A;  2ZH7 A;  1IBK F;  2W7P A;  4FYX B;  2J6S A;  1JMT A;  2CJ9 A;  3Q8U A;  5HQL A;  5H9E K;  1HNW F;  2KI2 A;  1WOP A;  1GH8 A;  4LFC F;  4EUV A;  3CD5 A;  2PD1 A;  2HK3 A;  1A7G E;  2AGP A;  1TAU A;  2GHP A;  3O3L A;  2RHS B;  3FMB A;  1VBX A;  2PC6 A;  4F0M A;  2CKW A;  2GO8 A;  3GCW P;  1R0C B;  3W8P A;  3QJP A;  4YQW A;  2DRB A;  3FVY A;  4JBC A;  1YSJ A;  2I5J A;  1U49 A;  2BE2 A;  5E3P A;  3V6H A;  1C4A A;  4OHV A;  3W5Y A;  1N48 A;  2G13 A;  1H2U X;  3KFW X;  4CM2 A;  4YME A;  1HR0 J;  1SKU B;  4A48 A;  2B56 A;  2QX0 A;  3R5G A;  5D0H A;  2ZD1 B;  1ZM9 A;  3QWP A;  4HL9 A;  3E3X A;  3GSD A;  2DCU B;  4EBD A;  2LA6 A;  4PYA A;  5KFT A;  4I0W A;  1NSA A;  3RRH A;  4WU2 A;  1NHV A;  1JNZ B;  2CPX A;  1DRZ A;  1EET B;  1XJW B;  5K8M A;  3AB4 B;  3K59 A;  1FT8 A;  1ZS6 A;  2MJU A;  4DFJ A;  1VR6 A;  2IMO A;  4OMF G;  5MAO A;  3ZZZ A;  4TVA B;  5CZV A;  4XPC A;  4I2Q B;  3ENQ A;  3JAM Y;  3J7Z 5;  2B6A A;  3KJN B;  3NCR A;  5EDW A;  4B3M J;  1S1T A;  3CJT A;  3BN7 A;  4PG8 A;  1NB2 A;  5U47 A;  2E7W A;  4ZPB A;  2KB2 A;  3HX9 A;  4CLS A;  2VL1 A;  4IOB A;  4LF7 J;  1FI4 A;  5DDO C;  3QZ8 A;  5EX0 A;  4DSF A;  1LKZ A;  1MMN A;  1QE1 B;  2NLW A;  2QLW A;  3A4T A;  3MM5 A;  4N8O A;  4UOH A;  5ETV A;  2E5G A;  2WOM B;  5KFS A;  4BWJ A;  1OQ3 A;  2CAD A;  3V6J A;  5AXK A;  3NGU A;  4JP8 A;  2OTJ S;  3IBF B;  2FDN A;  3H2U B;  1L3S A;  4DZD A;  1VHF A;  3BO3 A;  5J2N A;  2DYA A;  3M8P A;  3R6L B;  5E3R A;  2HRU A;  3AJ2 A;  2C22 A;  3PXG a;  2N7Y A;  2HHH F;  5IWA F;  1R27 B;  3JTN A;  4QOT A;  3TAQ A;  3HHN B;  3OTE A;  3PCO B;  5KG6 A;  3US5 A;  1SKR A;  1NK0 A;  2RD5 C;  4DG1 B;  1QUP A;  4OI1 A;  2AZ3 A;  3NCP A;  3NWR A;  1S5Z A;  4EK2 A;  3DXB A;  1XC9 A;  1UWB B;  4LF8 J;  1FKO B;  2K06 A;  4JI1 F;  2J8A A;  2DHG A;  2AZ1 A;  3NGD A;  1CBK A;  3M8R A;  2DGX A;  2F8M A;  1Q7Y T;  1O0P A;  3I6P A;  4MK8 A;  4IUF A;  2POK A;  4G65 A;  4PKD B;  3UN5 A;  1SV5 B;  4Y0F A;  1U1R A;  3FSY A;  4X4P A;  3MOZ A;  1R6V A;  4C0B A;  2MEW A;  3DLL Q;  1HPZ A;  2HBZ B;  5JVH Q;  1IBL J;  1RQ0 A;  4DR2 J;  3DMJ A;  3GFX A;  1IXK A;  1HYS B;  4O4G A;  5J2M A;  1K8A T;  4Y65 A;  5LXY A;  2BJ1 A;  4KTQ A;  4H4M B;  4OHY A;  2R7V A;  3SMZ A;  1TV6 A;  1YK9 A;  1EZZ B;  1DTT B;  1GFW B;  1UW4 A;  3MEC B;  4RNH A;  2CPJ A;  2DRA A;  3P96 A;  4HDG A;  1YRT A;  1R8H A;  3LP1 B;  3OUY A;  2VIC A;  1BQN A;  2CZV C;  2DK2 A;  5F8M A;  2ZH1 A;  2BRK A;  1JXE A;  3H59 A;  4QIF A;  4QW8 A;  1L3K A;  3CJK A;  1HNV A;  2ERR A;  3EM1 A;  4GC6 A;  2GIQ A;  1RBL A;  1T9Y A;  2MLX A;  3EDQ B;  1EKS A;  3DC2 A;  3RW6 A;  1SV5 A;  4RBU A;  4KGV B;  4QIE A;  2G9O A;  2UUB J;  1SJ3 P;  1FJG J;  1M5S A;  2B9Y A;  3AH6 A;  4LIW A;  2HAF A;  2LCW A;  3OXG A;  1SJF A;  2AJ4 A;  4AUK A;  2EC2 A;  4DV7 J;  3V6K A;  2OEK A;  4ZP8 A;  5KFG A;  4QJV A;  4AE5 A;  3HCX A;  4OFZ A;  2E9Z A;  2FVC A;  2VFT A;  3MMC A;  1S1U B;  3O6Q A;  3VCD A;  3B82 A;  4F3Q A;  4AL6 A;  4ER8 A;  4G3I A;  5HL7 Q;  4HTI A;  3TRG A;  2WVC A;  3KDO A;  4JYA F;  3ZTR A;  4JI7 F;  3AHP A;  3NOG A;  2GNK A;  2Y0B B;  3K7R A;  1BWE A;  5EWF A;  4DV4 J;  1VS3 A;  1R43 A;  3JTP A;  4LR8 A;  3MZI A;  4OYM A;  4EBC A;  2GQ2 A;  3DI6 B;  2GMH A;  5JVG Q;  1D09 B;  5CQG A;  4L3K A;  1RT7 A;  1RT5 A;  2HWI A;  3S8S A;  2XTJ P;  2CRL A;  4GKJ J;  3IM9 A;  3D6M B;  3TEG A;  3PKY A;  1U2C A;  1Q8I A;  2J0X A;  4H4K C;  5J2P B;  1RUS A;  1PJ6 A;  1PJ7 A;  4TQS A;  4HT5 A;  4YY3 F;  2HBY B;  4HYK A;  3SFU A;  2XSF A;  2CQG A;  2OI2 A;  2VG7 A;  2LEP A;  2RU9 A;  2C3O A;  3MCO A;  1W2I A;  1RK8 A;  1JLF A;  2V4R A;  4F4W A;  4MH8 A;  2ZFH A;  4IG3 A;  3RB3 A;  2ZDP A;  4O3Q A;  3IG1 A;  2JJ4 D;  3CIZ A;  3TAM A;  1BQM A;  2K2P A;  3RZA A;  4ZPW R;  1QE1 A;  2C2K B;  5CHC B;  4IKA A;  1AZS A;  4R8U B;  1B4S A;  1SIZ A;  3K5M A;  4B3M F;  3RAM A;  2AYG A;  4PXB A;  2ZWP A;  3VHQ A;  2XMA A;  1HWL A;  5E41 A;  5A6W A;  1WDD A;  4C8L A;  1T05 B;  5DQG A;  1ZM3 A;  3R7B B;  2M52 A;  3WX8 A;  4WYL A;  1DTQ A;  2FY8 A;  2NPI A;  3LGN A;  1XEZ A;  3L4B C;  2B6A B;  2BKN A;  4CH1 A;  3M9M B;  4GKK J;  2K3I A;  2AMC B;  3I5B A;  3E8O A;  2Z57 B;  4PR6 A;  1TK5 A;  3ZZR A;  4DG1 A;  5I4M A;  1YJN S;  3W63 A;  3HKZ D;  4NWB A;  3TAN A;  1XMQ J;  4RNO A;  2J0W A;  1NK6 A;  2GX8 A;  2H65 B;  2GML A;  4JI2 F;  3T1A A;  2A10 A;  4TY9 A;  1UAW A;  2HWH A;  4FNI A;  4IFY B;  5CCL A;  3ZFV A;  1FWL A;  5D4L A;  5DGB A;  1H0H B;  4IRC A;  3WIU A;  4KHM A;  3AAW B;  5J2N B;  3GQC A;  1N4L A;  5DRK A;  3HF5 A;  5DDR C;  4DBQ A;  3CCL S;  2XM3 A;  1RWW B;  3DMJ B;  1S6P B;  2P8I A;  4M1K A;  3LF0 A;  4UQT A;  4DUY F;  5DZ7 A;  3ZTS A;  4H4M A;  1HMV B;  1DY3 A;  5KFC A;  3W7B A;  2P5V A;  3B4D A;  4ZK7 M;  4B9S A;  2BEF A;  2I38 A;  4OHZ A;  1C4C A;  2XYG B;  3ILL A;  5EUH A;  3T9Z A;  2R7T A;  3FQK A;  1Y0H A;  2V4Q A;  3O8W A;  4HH0 A;  4OYB A;  1F5C A;  1C1B A;  2DHA A;  2VOO A;  5LJ3 Y;  1HBU A;  2B4O A;  2B8Q A;  5HJY A;  3PJ9 A;  3UWT A;  2KVQ E;  2AEM A;  4NXM J;  3OLA A;  1HW8 A;  2WVE A;  4B08 A;  2OTL S;  2XWY A;  3H4D A;  2RT3 A;  3GJR B;  5KFR A;  2MHE A;  3IP0 A;  2E1P A;  5CAA A;  4N41 A;  1S9G A;  1DAX A;  1TMJ A;  3H90 A;  2YWK A;  3RBX A;  1ZH5 A;  1CJK B;  1A6L A;  1U2F A;  4Q5V A;  4PXE A;  4I69 A;  4IH6 A;  1N5Q A;  1WG5 A;  1FDB A;  2VPX B;  1IM4 A;  2WCX A;  2G1D A;  3NWG A;  4CH7 A;  1X9S A;  2BKP A;  3KNG A;  4LR9 A;  2VA2 A;  2MSS A;  3GFZ A;  2EEY A;  1F5B A;  1YKW A;  3R5A A;  3QRP A;  1TU0 B;  2H5E A;  1WF0 A;  1JB0 C;  2BJ9 A;  1C0T B;  3DFE A;  1MLA A;  5D4P A;  5KFX A;  1Z2L A;  4EYI B;  1F3F A;  3SSQ A;  2GQQ A;  4R0E A;  2J7W A;  2IM0 A;  3IFE A;  4ZVF A;  4JI0 F;  3MEG A;  1QSY A;  4WYW A;  3KG4 A;  3LP2 B;  2HLU A;  1LK7 A;  3CJ8 A;  3HHL C;  4DV3 J;  2X1F A;  3HT3 A;  4KY3 A;  2LFV A;  4MKV A;  2ALY B;  2AV5 A;  4QR1 A;  3VR1 A;  2W4D A;  2QG9 B;  3ETO A;  1FCA A;  4LBI A;  2QA4 G;  4LF5 F;  1NME B;  3MMJ A;  5A8K A;  1URN A;  2DCL A;  2V2Q A;  4Q2L A;  2B4V A;  3HJV A;  1I3O B;  3KJQ B;  3J7A 1;  4RW9 B;  1E6V A;  2PFD A;  3SXL A;  4ZN3 A;  2BA9 A;  3L95 X;  5ETM A;  3I5A A;  4IG3 B;  4C97 A;  4X84 A;  2CJY B;  4HI2 A;  1OJ4 A;  3EDR B;  3PFE A;  4JUZ A;  2VOD A;  2WAQ D;  2ZHO A;  3SQG B;  1S9E B;  2DIU A;  2EFN A;  4YR0 A;  1S10 A;  2E1M C;  3KJF B;  3PM9 A;  2ALZ A;  2YH0 A;  1S1V A;  3DHW C;  2IBK A;  1OYE A;  2HLT A;  4B3R F;  3EWG A;  4YDD B;  1Q0N A;  3KG0 A;  4LF2 A;  5EWE A;  1NH8 A;  1HNX F;  3D6H B;  4QWA A;  1YWX A;  3AQO A;  4DXL A;  2YNH B;  1TL4 A;  1H7X A;  2EG1 A;  1CC8 A;  4ANE A;  4YHH F;  2VG7 B;  3D6T B;  3R1L A;  2RRA A;  1S0O A;  3VQT A;  3AY0 A;  1U26 A;  3CDW A;  1I5O B;  3LTO A;  5AXL A;  1CS4 B;  3J7Y U;  1NSQ A;  2FUG 9;  2Y3Y A;  4RLE A;  3OJS A;  1VQ5 S;  2DH7 A;  1NO8 A;  4NZ6 A;  1ZAV A;  4U6P A;  2VHG A;  1IR2 A;  3A3P B;  2GZO A;  2C3Y A;  2FC9 A;  2RDD A;  3EMT A;  1VQ8 S;  5DM6 Q;  2KXH A;  3F0N A;  2F63 A;  2QLX A;  2VDI A;  4J7C A;  1N5Y A;  3DLE B;  2O01 C;  3EVO A;  4TYB A;  4C8M A;  2LU1 A;  3FBE A;  1HAR A;  1LWE B;  5K9F A;  4XIU A;  2K7K A;  2V4J A;  1UPM B;  4ZPA A;  3I96 A;  4L75 A;  1DUR A;  5BR8 J;  3CMA S;  2BQU A;  2V8D A;  4JI6 J;  2OSQ A;  3BYR A;  4J5O A;  5KFA A;  2DR7 A;  1QSL A;  2VOP A;  4F7V A;  5DLF A;  3OL9 A;  3H5Y A;  2H1Y A;  3GV7 B;  4DV4 F;  5LSR A;  2FGO A;  4ZVT B;  3CDA A;  3G8T A;  3A3N B;  2QV6 A;  5AXM A;  2YKQ A;  4HLB A;  1GXL A;  2DIT A;  2KJV A;  3CJ0 A;  2D3O R;  2ZZN A;  4A8F A;  5IM0 A;  2V8P A;  2WZ1 A;  1RKI A;  4XK8 C;  1T3N A;  1N56 A;  3TVK A;  1KWM A;  2YWW A;  4GMK A;  1S6P A;  2IIH A;  2VV5 A;  4WBF A;  2Q3P A;  4JI6 F;  3IC1 A;  4F3M A;  2L9W A;  4QPX A;  2RS8 A;  3H25 A;  4OX7 A;  2Y1I A;  1Q82 T;  2PFF B;  3CUL A;  3HM9 A;  1KS2 A;  1Y3K A;  2W1B A;  3ENA A;  1Z2Z A;  3TA0 A;  3HD2 A;  2AWZ A;  2BX6 A;  2E7X A;  2FHM A;  3UDE A;  3IWL A;  5MLC V;  1CJV A;  3CJ4 A;  3OFG A;  1WSR A;  5AE3 A;  3OL8 A;  2V2K A;  2JEJ A;  1TFW A;  3MCN A;  1LWC A;  3MM9 B;  2C2D A;  2ZH6 A;  2XC9 A;  3TEH B;  3UD4 P;  1NB7 A;  2UUA J;  3DDK A;  5HK4 A;  3SDE B;  3NS6 A;  2OIH A;  4PQU A;  3T5H A;  1Q95 G;  3M8W A;  1N32 J;  3QJL A;  2CZ9 A;  3NOC A;  1D0E A;  2YNG A;  2UZA A;  4OLO A;  4KGK A;  2VG6 B;  1Q16 B;  5KFZ A;  4DV2 J;  1WKJ A;  1BE4 A;  3CC2 S;  3QT8 A;  4CYU A;  2YNI B;  4Y2A A;  2UVR A;  3HZG A;  4L3N A;  4ZIV A;  1MWY A;  7AT1 B;  2P6S A;  3MTJ A;  3PNI A;  3W64 A;  4DN0 A;  1JLG B;  5FLX Y;  2FJX A;  2QEX S;  4RW8 B;  2Y8Y A;  1VI7 A;  2DY1 A;  2LEA A;  3HSZ A;  1TP7 A;  4Q2M A;  2P9G A;  2JWN A;  1W7W A;  3MM6 A;  4U7U D;  2K7J A;  4RW6 A;  1IBC B;  1HNW J;  2EVZ A;  3TQ1 A;  2DNQ A;  3KTQ A;  1AFJ A;  3FUY A;  3UDV A;  2SXL A;  4OV1 A;  5KFU A;  4BHQ A;  1PGZ A;  4OYA A;  2XZW A;  1RTI B;  3HSJ A;  2M4M A;  2H9Z A;  1EQM A;  3GFY A;  1CJT B;  1WEX A;  4IFV B;  1N36 J;  4WJB A;  5KG5 A;  4NLG A;  1EAR A;  3VAK A;  2B8P A;  4A46 A;  2BXJ A;  3J7A N;  1F1B B;  4X66 J;  3L3C A;  5G4D A;  3V81 A;  5KFV A;  3IWN C;  2DHH A;  3MED A;  4GKK F;  5FII A;  3EGN A;  1FRK A;  3D1H A;  3SEO A;  3EPI A;  5E0O A;  5L1I A;  3PW0 A;  2F4F A;  3C8Y A;  4C8K A;  1H3D A;  1JLG A;  2VDH A;  2OPS A;  4CI0 B;  3DNC A;  1FKP B;  2YWE A;  4DPU A;  1AA1 B;  4ZVO B;  4IG0 A;  1APS A;  1LW2 A;  2RQM A;  3FBC A;  2CNN B;  1BQX A;  2KXF A;  5EX3 A;  3OQ2 A;  1UFW A;  4IYQ A;  2X1A A;  3MPD A;  5GAH U;  3ILI A;  1WC3 A;  4DR5 J;  3MHY A;  2AW0 A;  4F4X A;  3VGS A;  1H74 A;  3T1Y J;  2J0Q D;  1T3O A;  1NJZ A;  4CLZ A;  3RR7 A;  3O44 A;  3PYE A;  3QFH A;  5IT9 Y;  4KFB B;  3PJX A;  3POT A;  1U24 A;  3MEE A;  3R6G B;  1CS4 A;  3AOC A;  4UY8 T;  1SIW B;  4I1T A;  3BH6 B;  1KKH A;  4FYV B;  1LEO A;  2MKS A;  4OZ2 A;  2H5J B;  1L3V A;  1UCN A;  4AD6 A;  1S57 A;  4FF3 A;  2EKN A;  1K0V A;  4IG0 B;  1YZ6 A;  2RF2 B;  1RT1 A;  2GJF A;  3BJY A;  3DGP B;  5B0A A;  3U1M A;  1FD2 A;  2G2Z A;  3N01 A;  5HBM A;  4PG4 A;  3U02 A;  1B0T A;  2UXB F;  4O3R A;  1UJ5 A;  3PW4 A;  4P2F A;  1OY8 A;  1HWK A;  1SJ1 A;  3UCU P;  3FZ2 A;  2DGU A;  3JAM U;  3KK1 A;  5HI7 A;  4ITS A;  4DWI A;  3L09 A;  2E5L J;  4HH1 A;  5CYJ A;  1UVM A;  4LRA A;  4B3O B;  1EJ7 L;  1UFL A;  1HI0 P;  4NCG B;  5GAE I;  4F4Y A;  4DV7 F;  1REV B;  1T02 A;  2OPR B;  3A8I A;  1VQO S;  3BQ2 A;  1SJ4 P;  1LWX A;  4URS A;  1RCO B;  5IV4 A;  2E44 A;  2W24 A;  3B4M A;  2C2R A;  2AGQ A;  4X2B A;  3GIR A;  4P74 A;  1YJV A;  3EGW B;  4Y2C A;  1NBE B;  2GIF A;  1GMU A;  2FZK B;  3QT6 A;  2VZ9 A;  1XNQ J;  2J5A A;  4KIA A;  3ZZ0 A;  2MKY A;  1WG4 A;  4DCJ B;  3V4M A;  3DOL B;  1RHR B;  1Y3J A;  2ILY A;  3D2W A;  4OZN A;  4DQR A;  5HRO A;  1HR0 F;  4OV6 A;  2N82 B;  5D4N A;  5DO2 A;  4M5L A;  2CPY A;  5IC4 B;  3ZZP A;  2FB0 A;  3W5X A;  2ZH8 A;  1M1K T;  3GIJ A;  4DJB A;  4PQU B;  3NKY A;  1KVI A;  2MST A;  3D54 A;  2C42 A;  3LWM A;  4J9U E;  3DGV A;  2CQ0 A;  3CGI A;  5JUM A;  1R6Y A;  1REV A;  1RTH B;  2OPR A;  3NMA A;  2EI5 A;  2LLZ A;  3W3S A;  3W5Z A;  2HQI A;  2NRE A;  3IM8 A;  3QGG A;  1HI8 A;  1UP1 A;  2OFG X;  2WSC C;  4CLK A;  1FFG B;  5KFI A;  2V68 A;  4FBT A;  1XNQ F;  1VRU B;  3N0V A;  4YUD A;  3N5F A;  3KHR A;  3GJS B;  3IR5 B;  2XY5 A;  4DSI A;  2KHC A;  3IO1 A;  4FXD A;  2Z58 B;  1OSC A;  3OW2 R;  4K4W A;  3CE8 A;  1F60 B;  4HT7 A;  4LRD A;  3CTR A;  4M5M A;  1NK9 A;  2KO1 A;  2XCA A;  1SVD A;  3RB4 A;  4DPT A;  4HEA 9;  1U1L A;  2XB2 D;  4NLW A;  3OTB A;  2J6T A;  3PIO Q;  5H1S V;  2W9C B;  2I2Y A;  1VC5 A;  1BC6 A;  4DV1 F;  2UUT A;  4ED2 A;  2DVI A;  4CP5 A;  3D0H E;  3TWZ A;  4O3N A;  4FF1 A;  3TUJ C;  4X4V A;  2YNF A;  4EWT A;  4LF6 J;  1RTH A;  3D3C J;  4NA3 A;  4X65 F;  4C3M A;  4YB7 A;  4UUW A;  3FRZ A;  2MMY A;  5L1K A;  2J9E A;  4N76 A;  5GMD A;  2GGP B;  3PYG A;  1TKT B;  2DRD A;  3SSR A;  4K4T A;  1VK3 A;  3BEG B;  4M63 A;  2WTF A;  2E9T A;  1P9Y A;  2FD2 A;  1S6Q B;  3KUH A;  2ZBQ A;  2QMX A;  2QN6 B;  2RSQ A;  4M8L A;  4RJV A;  5AE1 A;  3DDI A;  1VYA A;  4RBT A;  4CTA A;  2B5J A;  2JSX A;  4TXS A;  5K8O A;  4IRD A;  2OD4 A;  4NMX A;  4QWE A;  4F02 A;  5I3U B;  2HPU A;  4RNF A;  4R0J A;  1RT3 A;  3KLH B;  3HVT A;  3UN2 A;  3OLB A;  3C6T B;  4DR5 F;  3AQP A;  1CLF A;  4WE1 B;  1SUQ A;  2GCF A;  2KT3 A;  4F50 A;  2NYH A;  1RT1 B;  3K0J A;  2Z30 B;  1N8R T;  1JLB B;  4KB7 A;  5A8R A;  5KFP A;  2GA7 A;  4FKY A;  4ZPT R;  1DQA A;  2H48 B;  3PO5 A;  4FYY B;  1FWP A;  2RRB A;  4F04 B;  4PUO A;  2NXC A;  1JLC A;  3I9Z A;  3CCS S;  2B0G A;  3PO4 A;  2DXE A;  5DS7 A;  3CUN A;  1XWL A;  1VDH A;  5KT6 A;  3EPG A;  2J0S D;  3FBB A;  4TQR A;  2D41 A;  3GG0 A;  3J81 U;  4DR6 F;  1VHI A;  1WKK A;  1N6Q B;  3VAG A;  1PYO B;  5F8L A;  2V9K A;  3WC0 A;  4TN2 A;  1VQY A;  3HHK A;  2XMJ A;  2CNK B;  1C1C A;  2VB6 A;  1RU2 A;  2B5J B;  2R42 A;  3WBZ A;  1KD1 T;  2RF2 A;  4K50 A;  3G6V A;  1NKB A;  4DR3 J;  2XY6 A;  2BJD A;  4DQS A;  3NMR A;  5FLX U;  1S4E A;  2HBR B;  2ILZ A;  3QO9 B;  4CLT A;  4O0N A;  2VPY B;  2JVR A;  1TKZ A;  2VG5 A;  1ICE B;  3M32 A;  2UU9 F;  1JLQ B;  1F9E B;  2HK2 A;  3CWJ A;  3GTY X;  2YX7 A;  2DNG A;  4J9N A;  2B3T B;  4QCL A;  3IBC B;  4B3S J;  3TJA A;  1FRH A;  2GV1 A;  2KRR A;  3L9Z A;  5LMU J;  3G71 S;  2KM8 B;  2IAJ B;  2DNR A;  3J81 Y;  1XQI A;  2UUC F;  1CUL A;  3M4X A;  3V5R A;  1JWW A;  4DQI A;  3QT7 A;  4MK9 A;  2XMK A;  1RT4 A;  3ZZT A;  3V6D B;  5HVF A;  1QSS A;  4DUZ F;  4H4O B;  5H9E J;  5CYQ B;  2JRS A;  1R31 A;  4DOZ A;  1PJ5 A;  4GO7 X;  4ZLL A;  4M5G A;  2Z56 B;  2I9S A;  2XYP B;  2Z2Y B;  2YKA A;  3R3T A;  5HAO A;  4M95 A;  3KUE A;  1RT2 A;  1WAC A;  4CLY A;  1L5U A;  3LO3 A;  3RBE A;  1S9F A;  4OZL A;  4NA1 A;  2E1C A;  1G7C B;  1ROF A;  2PO4 A;  3TO8 A;  2XO7 A;  3CXC R;  4J9L A;  3GWC A;  1H2T Z;  2ADB A;  4UZC A;  4KAI A;  4KGM A;  3LGM A;  1KFS A;  3LP0 B;  1NZ8 A;  2R2U A;  1Q78 A;  2KTQ A;  2XHW A;  2UXD F;  2ZUA A;  1WHY A;  2HHW A;  2VIH A;  2HVZ A;  1T7P A;  1DFD A;  4ILL A;  2ZDO A;  3O1L A;  2HMI B;  2ZM6 J;  1MN9 A;  1SQF A;  3CC7 S;  2NPF A;  4A8X A;  3Q8Q B;  2YNF B;  4IQX A;  4FVM A;  4RBV A;  3KK3 A;  4I64 A;  4JI7 J;  2CQ4 A;  5M2R A;  3FQL A;  1NJY A;  2NXE A;  4URG A;  3UR3 C;  4LFA F;  4E0D A;  2E1R A;  1B7F A;  1VK8 A;  3OTO J;  1TEL A;  1YJR A;  3P45 B;  1NZA A;  1HWI A;  2CJB A;  2Q1L A;  3QWU A;  1X4H A;  4ZJQ A;  1SPB P;  4ID5 B;  3UD3 P;  4IR1 A;  2EFG A;  5K14 B;  3UVJ B;  2MZJ A;  3B6B A;  2CAJ A;  4CTA B;  1J5O B;  1BWV A;  1G1X A;  2Z4P A;  1TFY A;  2RU3 A;  3RB0 A;  3BSN A;  1WEL A;  1ZTW A;  1UVL A;  1VIS A;  2XZD B;  4N77 A;  3LWL A;  2DKO B;  4NE9 C;  4FBU A;  2LQ9 A;  2NSB A;  4WPA A;  3J7Y I;  4C2M A;  4RZR A;  1NSP A;  3NGT A;  3ZTQ A;  5C24 B;  5LOQ A;  4G1Q A;  2GGP A;  2XWX A;  2HHH J;  4V1A k;  1RHM B;  5D78 A;  4OYP A;  4BCA A;  3G82 B;  4ZPV R;  3NNA A;  4OJH A;  4PWD B;  3MI7 X;  3WX4 A;  5HMW A;  2V6A A;  2ZOF A;  3FCW A;  4KC5 A;  4P2M A;  4B3T J;  3WHI A;  3KLG B;  4ECR A;  3LUY A;  4PEO A;  4HTJ A;  4PQA A;  5E33 A;  4ECQ A;  2YQ1 A;  4I6W A;  3BF4 A;  3NG8 A;  9RUB A;  4ED1 A;  3G4S S;  5D6G A;  4UST A;  2QSF A;  2RKI A;  1WOO A;  1RTZ A;  2NCK L;  3DLG A;  2D3Z A;  1BGX T;  3H0P A;  2AEJ A;  4ZVU B;  1JLB A;  1HBO B;  4ENO A;  5A8R B;  4X4O A;  3IG1 B;  1HLW A;  4I67 A;  3K17 A;  2JLE A;  4M5H A;  1JJ4 A;  4X62 F;  1S7H A;  3D67 A;  5CD4 A;  3M2U B;  2MQN A;  3M2V A;  5CZX A;  5BYR A;  3T19 A;  2ZH9 A;  3OR2 B;  4N47 A;  2MXY A;  4B9U A;  3AD8 C;  5AJ3 F;  1FXR A;  1PKU A;  2AYE A;  2ZNY A;  1HNZ J;  5KG1 A;  1O6X A;  2RHQ B;  2VFU A;  3G82 A;  3WQP A;  4DMZ A;  4DFM A;  1SC6 A;  2NUH A;  4C9D A;  4OZJ A;  1B0P A;  3LGH A;  2HGL A;  2HNY B;  4A47 A;  1X9W A;  4FVC A;  4B9L A;  1S77 D;  4DR4 F;  1NKC A;  4X62 J;  1DJ0 A;  4I2Q A;  1H73 A;  1OYD A;  3MPW A;  4OYZ A;  2V9W A;  3EZU A;  3QO9 A;  4H4O A;  2BW2 A;  2HKE A;  3CIM A;  5F41 A;  1M1G A;  1NM2 A;  4LT6 A;  2ZUG A;  1U09 A;  5ETT A;  4G6V B;  1IKV A;  5A0Y A;  1NND A;  4LF6 F;  1VQ4 S;  3FKB A;  5IQ6 A;  3FNN A;  3JXO A;  1Q53 A;  3KK2 A;  3T5J A;  3IA0 A;  4E98 A;  1QAY A;  1MU2 B;  3AA8 A;  3M6X A;  2IAJ A;  4PG6 A;  3OVS A;  2ABY A;  2RS2 A;  4QU7 A;  2HFS A;  2ZVS A;  3Q8R B;  3A12 A;  3CW2 C;  4F25 A;  1HBN B;  1WI8 A;  3AXM A;  3OHA A;  1QAJ A;  3WIV A;  2XI3 A;  3MAA B;  2UXB J;  2GVD A;  2EC0 A;  2DR6 A;  2G0J A;  2LKZ A;  1I94 J;  3VGT A;  2V69 A;  1YIJ S;  4DX6 A;  3ISZ A;  1IBM F;  2R8I A;  4CQ1 A;  5I42 A;  2APO A;  3AJD A;  3GSI A;  1EB0 A;  1UWB A;  3ADA C;  3PRD A;  5ETR A;  1X31 C;  3RRG A;  4KR0 B;  1XMO F;  1SI9 A;  3CCJ S;  1ZET A;  3ZXW A;  1RWK B;  4QWD A;  3OVA A;  3HP6 A;  2UXD J;  1PAU B;  2KZZ A;  1YRU A;  4IDK B;  3W1Y C;  2V8G A;  2DNN A;  2BM1 A;  1T94 A;  2WSE C;  3GR0 A;  3N6L A;  4ELU A;  2BV3 A;  3PV8 A;  3Q2S C;  3BDP A;  2NQP A;  4JI8 J;  4O0I A;  1GMV A;  3AOD A;  2WVB A;  1X4A A;  2XO6 A;  1RWO B;  2BZ2 A;  3QAU A;  3AT1 B;  3NLC A;  3KMQ A;  1I6J A;  1FNM A;  2OGU A;  2AJ0 A;  3O2I A;  5FD1 A;  4RW4 B;  2FJA B;  2CZ4 A;  1CQM A;  3FMW A;  3DLB A;  5GAG U;  5BXI A;  2Z2M A;  1FDD A;  2D74 B;  2E9R X;  4ED0 A;  2DT9 A;  2R8H A;  4G1Q B;  3CO9 A;  2XS7 A;  1IKX A;  5KFK A;  1N88 A;  2CNL B;  3DOK B;  4O44 B;  4RX6 A;  3DOM B;  3NS7 B;  3MFI A;  2ZH4 A;  1SH2 A;  3SV3 A;  1F2H A;  1WF2 A;  2F40 A;  3LAK A;  3PHT A;  3QZ7 A;  2X3G A;  3CJK B;  2UVU A;  5F9L A;  1RWX B;  2ACM A;  4RKU C;  2JVO A;  3KLG A;  4J9K A;  4DCO B;  4P52 A;  4QYZ J;  3GFH A;  5C2C A;  4O3S A;  1DAR A;  3FEY B;  3K5O A;  1KC8 T;  1BD6 A;  2CWX A;  4DFK A;  1DQ8 A;  1YBA A;  2LQJ A;  4QIV A;  3T9N A;  5AJ3 J;  2R9L A;  4MK7 A;  2ZD1 A;  1PIL A;  2CJK A;  4OIX A;  5C24 A;  2BDP A;  2EXU A;  3PJW A;  4LF9 J;  3DRP B;  1KVJ A;  5F8I A;  3G6Y A;  3TJ8 A;  1I51 B;  4RW4 A;  1UVI A;  3H5S A;  1LW0 B;  4KH0 B;  4K2X A;  2GQC A;  2MKH A;  4KSE B;  5KG4 A;  5AT1 B;  5C25 B;  2WW4 A;  5H9F K;  4LSN A;  4NLX A;  2YBV A;  2MQO A;  1IKX B;  5IT0 A;  3H5U A;  6AT1 B;  3EZ5 A;  1YIT S;  4U7C A;  3AA9 A;  1RP5 A;  3EJM A;  4ZCI A;  4EZ6 A;  1RT7 B;  2GHW A;  2IC3 A;  3A1Y G;  4CLU A;  1U02 A;  1NHK L;  5KFO A;  2R7R A;  4NLU A;  4J9P A;  4X64 J;  3FBF A;  5IT4 A;  3OT9 A;  1IQT A;  3BKT A;  2OD6 A;  1SC3 B;  4GVB A;  3TX8 A;  2HRY A;  3M8Q B;  1T9T A;  1AUD A;  2UUC J;  2Y9H A;  3D0I E;  1UJ4 A;  4WZQ A;  2AGO A;  2KT5 A;  1VCT A;  3SCJ E;  4LFB F;  3WZ0 A;  3KLI A;  1BMQ B;  1VRT B;  1OPI A;  2IYI A;  4WU3 A;  1VOM A;  4ZVQ B;  1RLD A;  2J7K A;  1DLO A;  1H72 C;  2LDI A;  3QAT A;  4HAC B;  2DGQ A;  2XMT A;  4ZP7 A;  3N9U C;  3M1V B;  2MJN A;  2E5L F;  4DR7 J;  1K1S A;  1WUU A;  2D3U A;  2M88 A;  3QNW B;  8RUC A;  4RWW A;  2IA6 A;  3N5B A;  3DLE A;  3CCW A;  2J8S A;  4B02 A;  2Y8W A;  4QWC A;  3JTO A;  1RE1 B;  2QFJ A;  1K47 A;  4WWS A;  2KU7 A;  1ZA2 B;  1TV6 B;  1XN9 A;  2LEB A;  3OR1 B;  2HVH A;  1H2V Z;  3H7H B;  4NML A;  2XMW A;  2RB7 A;  1FKO A;  4USV A;  2FLN A;  5IFM A;  2NR0 A;  5F8J A;  4Y3C A;  2JZ5 A;  4C3L A;  2MHN A;  4OHX A;  5DG8 A;  4DL6 A;  5K8P A;  5KFB A;  4JI8 F;  2VJV A;  3WC2 A;  2MY8 A;  2J76 E;  3BZQ A;  4OZ5 A;  4DV1 J;  1MSW D;  4C6A A;  4PAB A;  2ASL A;  1HNV B;  2QO3 A;  3P8B B;  5L8R C;  2HWT A;  3RB6 A;  3BGU A;  4IFY A;  2VQF F;  2N7C A;  1RYR A;  4O4G B;  4L73 A;  4NI2 B;  1IM6 A;  1F0X A;  2M5Y A;  2WBR A;  3D7S B;  2DGV A;  2LXI A;  4YB6 A;  3GV5 B;  1RYS A;  2NZC A;  2Q6B A;  4O4R A;  1IKW B;  2G4B A;  2A18 A;  2DBB A;  4K4U A;  3GLJ A;  1AYE A;  3JSB A;  3NGS A;  1TL3 A;  1ZZF A;  2VAS A;  3NP5 A;  2DNM A;  3QGI A;  2XMM A;  2JNJ A;  4KBI A;  3G96 A;  2LQ8 A;  3TYT A;  3MFH A;  3Q23 A;  3VVT A;  3QSY B;  3J80 Y;  1T8E A;  4BDP A;  2VKZ G;  5CYM B;  3IMQ J;  5HMZ A;  1WC0 A;  4GRS A;  1ZPW X;  3B8H A;  4X4R A;  1EAY C;  4Y28 C;  3H4B A;  1VBY A;  3RR8 A;  1S0V A;  3K5P A;  2ATL A;  1ZBT A;  4Y2M A;  3I4H X;  3DOM A;  2MZS A;  3FSX A;  4PCQ A;  3TUZ C;  5KFE A;  1V3S A;  2YNG B;  1GXU A;  3MD3 A;  2QA4 S;  5CCM A;  1H98 A;  1NU4 A;  2FLP A;  1JLA A;  4ZOS A;  3TNV A;  4LF9 F;  4J9O A;  2DHX A;  4OYW A;  2YNI A;  1AXQ A;  4OZ0 A;  3H8Y A;  4QZV B;  2P9C A;  5IXU A;  5EHH A;  1RAJ A;  4NI2 A;  1IWG A;  2EK1 A;  2QFI A;  1FF2 A;  1R8B A;  2B7B B;  3EE3 A;  1WG1 A;  3UCG A;  4BLG A;  3SYZ A;  3HUL A;  1TKX A;  1IKW A;  2CPD A;  2XLI A;  1X5T A;  4NAS A;  5C5J A;  4J9M A;  1C0U B;  1WTF A;  5KFW A;  3UD5 A;  4KO0 A;  5D0G A;  1N0V C;  1JLF B;  2AT1 B;  4ES3 A;  5J1P A;  3T5K A;  3W2W B;  2L08 A;  3NEK A;  2B43 A;  1KRP A;  1F3V A;  2CPE A;  3D6F B;  4GKJ F;  1AFI A;  1LW0 A;  3EXY A;  1RHQ B;  2V63 A;  2X1B A;  2VFV A;  5I3Q A;  2YWH A;  1P1T A;  2DHS A;  3MR3 A;  2YKM A;  2ASD A;  4ID8 A;  3OSN A;  4DX8 H;  3UCZ P;  1DTQ B;  2B4U A;  4MJK A;  2XNR A;  1HNZ F;  2B7C B;  3KYL A;  1W25 A;  2HS0 A;  1NK4 A;  1ULR A;  2JFK A;  2ZC4 A;  1FTC A;  3MM8 A;  2GIR A;  2EPI A;  3OTO F;  3RTV A;  2IM1 A;  3I82 A;  3GON A;  4A4J A;  3DRP A;  4ILR A;  4RWX A;  1PO6 A;  2OPS B;  2JOQ A;  1IQZ A;  2FQQ B;  2YQ0 A;  3KLI B;  4KO0 B;  3W2V A;  1U8W A;  2PMW A;  4J90 A;  4JI1 J;  3FEX B;  2ZZM A;  3CT9 A;  3EZO A;  1YQH A;  1X4D A;  2O3D A;  4H54 A;  4W4M A;  2HQG A;  3GV8 B;  1LXJ A;  5LMN F;  3PKM A;  2IC3 B;  1SQE A;  3ISN D;  4M5I A;  2HIY A;  4ETZ A;  3G6E S;  3ZZO A;  1J5E J;  1JXV A;  1UZH A;  4XDD A;  4X4S A;  1E6Y B;  1Q8K A;  1R8A A;  3CB4 A;  3CDE A;  2LDY A;  3KNA A;  4F4Z A;  1WKL A;  4DR3 F;  4X4T A;  1URR A;  1QLN A;  5LT5 A;  2H3E B;  4XPE A;  4XDC A;  1D9F A;  1RB0 A;  2D9P A;  2CPF A;  4DPO A;  4B9V A;  2R7S A;  2CPI A;  2ZKU A;  1YX2 A;  4CLW A;  4USM A;  1FE4 A;  1B64 A;  3FGV A;  1FX4 A;  3I32 A;  2CQD A;  5A2Q Y;  2JEF A;  4DF8 A;  4I2P B;  5F9N A;  1WDT A;  3W65 A;  2NZ4 A;  2WON A;  3W2V B;  4F26 A;  1V6H A;  1U0S A;  1ZM2 A;  2HQ3 A;  2YXL A;  5LM7 E;  3DYA B;  2UVV A;  2DNO A;  3DU5 A;  4ZS6 A;  4DL0 C;  5HSP A;  5G0R B;  1QAX A;  1Q8L A;  1X4B A;  5B7W A;  1RWN B;  4NLO A;  1CJK A;  1KVK A;  1X7V A;  4OYI A;  1KQK A;  4EFA C;  3TI0 A;  4I56 A;  4ZA1 A;  1LWE A;  4FYD A;  3NNH A;  3VAF A;  3KK1 B;  4UZB A;  2EK6 A;  4DS5 A;  2A3J A;  3GIM A;  1XER A;  4N7T A;  5CYM A;  4HR2 A;  1MN7 A;  3RG6 A;  3QRQ A;  5D3G A;  3FRY A;  2M9K A;  3CVK A;  4UOC A;  5L1J A;  4FS2 A;  2OLW A;  1Q1K A;  2AX0 A;  2ZOG A;  3F44 A;  3HFZ B;  3LP2 A;  5LJ5 Y;  3D4J A;  4GO5 X;  4DV3 F;  1S9G B;  1KOO A;  5F0U A;  2RQC A;  4DL2 A;  1JLA B;  1SB6 A;  3DOL A;  5HRO B;  1PYS B;  4CO3 A;  1FRL A;  2E1A A;  3AXK A;  1A9N B;  3R8Y A;  1U1N A;  1PBU A;  3R7S B;  1HNI B;  2MQM A;  5A8K B;  3DYA A;  3C15 A;  1U7L A;  2OJ3 A;  2DO4 A;  1YGY A;  3R5D A;  3DHX A;  2JL9 A;  2OP5 A;  3ILJ A;  1YJU A;  4NZ7 A;  4RW9 A;  3RYL A;  2JLF A;  1UET A;  3QGP A;  4DUT A;  2XGP A;  3NNC A;  4QIW D;  2LYV A;  3HHL D;  3FC9 A;  4KT0 C;  2N3L A;  2KRB A;  4U9R A;  3C46 A;  1S72 S;  2CG4 A;  5HAT A;  1W2B R;  1RAI B;  3MEG B;  1X0F A;  1X8D A;  2FGC A;  3G86 A;  3HSG A;  5E3C A;  3N6M A;  2DD8 S;  4NEZ A;  1S1X B;  4WTY A;  1WWH A;  3QQC D;  5D3G B;  1RHJ B;  3IR7 B;  3O5T B;  1VBK A;  3IBW A;  2AIR B;  2CQ2 A;  3FEZ A;  2GVZ B;  4OZ3 A;  1F9H A;  1IUJ A;  4UW2 A;  4ZKA A;  1U0H A;  2CXE A;  2W7A A;  5ADZ A;  2VG6 A;  4YR3 A;  4B3S F;  2LU2 A;  4DR1 J;  3KMS A;  2HQD A;  1AW0 A;  2AJ1 A;  1C0U A;  1MWQ A;  2B51 A;  1NEE A;  1T9X A;  2BJ7 A;  2HHQ A;  1IKY A;  5DM7 Q;  2MQP A;  1Q5V A;  2W4P A;  2PI4 A;  3SCL E;  5L9N A;  1PC5 A;  2CVE A;  3MUR P;  5AE2 A;  3I0R A;  3QT5 A;  1F5A A;  4C8N A;  4C7Q A;  2C2Z B;  4CT8 A;  2W9C A;  2RDJ A;  3C3L A;  2FVR A;  1HD0 A;  1YTY A;  4ELT A;  2IRY A;  2BUN A;  5L39 A;  4E2F B;  2ZZT A;  4LSL A;  4C11 A;  5F3Z A;  4ZCM A;  4LF4 J;  5GAD U;  1RT5 B;  1ZYQ A;  1RLC L;  1RTI A;  1U47 A;  2XS2 A;  4IO9 Q;  1BXN A;  1YJT A;  2YNH A;  3MCS A;  4KQZ A;  5HVH A;  1EQ0 A;  3QLH A;  4V19 X;  3HLU A;  3CJ3 A;  1UVN A;  4J9S A;  2GW8 A;  1ITP A;  2YQ3 A;  1J2V A;  3M8Y A;  4WKR A;  1HA1 A;  4OX6 A;  1HHS A;  5DDP C;  1RA6 A;  1B7Y B;  1UEU A;  2CFX A;  3TR5 A;  1K73 T;  2F4V F;  3GPA A;  3BH7 B;  4OJ3 A;  3SCI E;  4F2S A;  1HIY A;  3TZZ A;  2G0I A;  3HHL B;  3Q8Y A;  3RBD A;  4NXN F;  3MPU B;  1HQE A;  3DLK B;  2KDO A;  1IBM J;  3BGR A;  3UDL A;  5FJ4 A;  4Q44 A;  1SUQ B;  4CCH A;  3P49 B;  1T03 A;  5HMX A;  5LSO A;  3HXM A;  2V4J B;  1OWX A;  2CG8 A;  1OMS A;  2AP6 A;  5G0R A;  3THT A;  4CO5 A;  5HAN A;  5HVG A;  1T05 A;  4B9M A;  4DDF A;  4KKO A;  3FK4 A;  3K8V A;  4UT4 A;  1AUS L;  1R0A A;  2X3D A;  1RT6 B;  3M30 A;  4LJM A;  3P5B P;  1RA7 A;  3BGL A;  3MCM A;  2HHU A;  4KHR A;  2KYZ A;  1K9M T;  1YVF A;  2FJW A;  4HHU A;  3POT B;  2CQ3 A;  2IRX A;  2PGC A;  4ZLN A;  1T0T V;  5IM0 B;  4DV0 J;  1N6Q A;  1IBK J;  1S99 A;  2DB1 A;  4CIO A;  1VBZ A;  5F8G A;  4DSJ A;  3BO4 A;  2I0X A;  3DM2 A;  3QPI A;  3OBI A;  5CXT A;  4DV5 F;  1NRK A;  2MZ1 A;  2MZR A;  1CQN A;  2Y1R I;  3HHL A;  1O5J A;  3J80 U;  1BUX A;  3BGR B;  4LBH A;  2HFN A;  1TKZ B;  2JC0 A;  3BR8 A;  4M5J A;  1S49 A;  2OPP A;  1RKJ A;  1SL1 A;  4Q8E A;  4OJG A;  3KLF B;  4ED3 A;  3I55 S;  3OHB A;  4ZVE A;  4XTT A;  2DIV A;  1FDN A;  3MUM P;  4LF5 J;  4WZM A;  2A6O A;  1CC7 A;  2HRT A;  3D66 A; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...