1F2HA

Solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
169
structure length
169
Chain Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
publication title Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 35
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f2hA00
1F2HA 1F3VA
chains in the Genus database with same CATH superfamily
3W66A 5B09A 1WC3A 4WYLA 4QU6A 4ECUA 4Q43A 3BSAA 2BJ3A 1N5YA 2AJFE 2RAQA 3UDEA 2P6TA 5HVFA 3JB9k 4JI3J 3A12A 4K59A 3DCAA 1EJ7L 2VJUA 2UVRA 2B4VA 4WU3A 4YUDA 4DQRA 2DGSA 3CULA 2OTJS 2AYEA 1Q5YA 4K0KF 5L46A 1GMVA 1DHMA 1N5SA 4PXCA 2HSEB 5CH7B 1X5SA 2W2PP 4ED1A 4X4UA 1YBAA 2MKJA 4A8SA 3SFUA 2MKSA 4DUZF 2VPZB 3PW7A 3MMBA 2NCKL 2MKHA 2W25A 1KNZA 2BQUA 1RTIA 5KG3A 4JB8B 4DR1J 3KLGA 2HFVA 1WORA 1NSPA 3MMCA 1FJ7A 1G1XA 1MMLA 2BJ8A 3HT0A 2O1PA 2LXUA 4F25A 2XB2D 1PBAA 1CBKA 4R0EA 1SJQA 4C0OC 1TUGB 2H54B 2IM1A 2QMXA 4IDKA 2MZJA 4NLVA 2FTRA 1RTHB 3DFEA 4Q0BA 4KKOA 5HJXA 5ETSA 4DF4A 1MROA 2AX0A 1N5YB 5DLGA 2ZFHA 2GQ2A 1TUWA 3L09A 3HT3A 3LO3A 1DRZA 4NLGA 2YX7A 5LM7E 4PCQA 2CQ4A 3PO4A 4LBIA 3HJVA 2IPOB 2IAJB 3C15A 4O3SA 1GMWA 2IJNA 1NUEA 4C8KA 3H2LA 3VAMA 1TMJA 2UVWA 3NCQA 4GRSA 2ZVSA 5KAKA 2CQDA 4X64F 4EZ6A 1S9EA 1FJGJ 1YX2A 3MMBB 1QUVA 3CDBA 4PG7A 2LCWA 2R7VA 2BE9B 1Q82T 2KJVA 3DC2A 1F9EB 3LH2S 2DR6A 5GAEI 1RTIB 1JQGA 4CH0S 1F2GA 2MQOA 3TA1A 2GMLA 4DFPA 4ZPCA 2OMOA 2YWGA 2ZOFA 3MMCB 5LMNF 5DGAA 3E51A 4B02A 4F4KA 4CLSA 1HHSA 1LXNA 3AFGA 3BO2A 2EFPA 1NJXA 4IDKB 1FCAA 1M5OC 1FRKA 4ER8A 2LMIA 4DSEA 4Q0BB 4KKOB 2ZE2B 3MPDA 3MM5A 1CULA 3QGHA 2BOAA 4ZLNA 4F4ZA 2C2NA 4JUZA 4UOFA 2PC6A 4GVBB 4AL6A 4PABA 1WC0A 5LSOA 1RWNB 5KFQA 1VRQC 3OXLA 3RZAA 5I3UA 3RU0A 4BC7A 3N6MA 2H3EB 5AT1B 2VPWB 3A8KA 2W4CA 3C15B 2C1EB 4J90A 4CI0B 2VUGA 3QPIA 1T8EA 3MUVP 2JEGA 4TYBA 2W9CA 3QGIA 3TWZA 4ILMA 4DSLA 1UFWA 1S9EB 3D0IE 2M52A 1VC5A 4WZQA 2DH7A 3IG1A 3OTBA 1LQ9A 5IV4A 2JHEA 5D6GA 4UZCA 2PEHA 4CIOA 3UN2A 4A46A 2KI2A 4ID5B 2DGTA 3D5MA 4LF7F 1NM2A 2I1RA 3FBCA 4M5JA 4CP5A 3OL8A 2Z0GA 1Q8IA 3MPYA 3C14A 1CC7A 3BB5A 3M8YA 5GAGI 1RAOA 5D0RA 3FBFA 2ROPA 1S0OA 1SIZA 2F3JA 2D74B 2JEJA 3ET6A 3HMJG 1UVKA 1KC8T 4WK3A 2OI2A 4PKDB 4O23A 3I0SB 1Q4RA 3KUHA 4LJMA 3AHPA 2FGOA 5HP1A 1CULB 4HDGA 3EPIA 1OPZA 3ZZRA 3Q8RB 3CJ4A 4I56A 2DHXA 4ES3A 2MLXA 4F2RA 3VQTA 2VBXA 1SI9A 5KT6A 3CCLS 1G4CA 4DF8A 2XZWA 2CPXA 1R8HA 3T1HJ 1N32J 2DO4A 1NSKL 2W9CB 5CZXA 1FRJA 3EZ5A 3T5JA 3QRRA 2XMTA 4ZVRB 2FHJA 1FFGB 3CVKA 4XPEA 4ZVGA 3B82A 1YTYA 4KSEB 2YPZA 4ED6A 3IG1B 1M0SA 1SQEA 4RW9A 3QATA 2Y8WA 4IG3A 1IQTA 4G65A 3GZ7A 2CNLB 4H4MA 1A0OB 2BUNA 1VIOA 1I94J 2HRTA 1N33J 2B4PA 4M5LA 2LA6A 2YNFA 2NUUG 2BR0A 1VK3A 1UZHA 3C14B 1L5UA 1SL0A 3QRPA 3QIDA 1NJWA 3O3LA 1BE4A 4OI3A 5DG8A 3QGGA 3KG4A 3ET6B 1FFSB 2XO7A 3H25A 1RWOB 2EK1A 1R0CB 1VQOS 1JX4A 2B9EA 3IRXA 2K1RA 2Q6BA 4N5SA 3NEKA 3FNNA 4TXSA 5HP1B 3RB0A 5DQIA 1R0BG 3RUBL 3C6UB 3ENAA 2QYCA 3KG0A 5HAOA 3P6YC 3LPEA 2Y1LB 3OTOF 1DQ8A 4DLEA 3DNCA 3EX7B 4B9UA 3G86A 1CJTB 1FFWB 2XEXA 1L3VA 1K73T 2NYHA 1PKUA 2CQCA 3R5DA 4XIUA 1X4BA 3NGRA 4MKYA 3KHRA 3VAFA 2VG5A 1ZAVA 4B17A 4P2MA 2G2OA 3W9JA 3T6BA 1UMJA 1VQ7S 4RW9B 3DLJA 1KKHA 3D6TB 4N56A 4IG3B 3R7NB 2P9EA 3QNWB 4NYOA 1MNEA 3QFHA 1QE1B 4H4MB 3HXMA 3GIJA 3I4HX 4OIXA 4NLSA 1F1BB 1VOMA 4F3OA 2Z58B 2XWXA 2YNFB 4URGA 3QFWA 1FERA 5HVHA 3AJ1A 4DG1A 4BS2A 2E5GA 2E5LF 1Y3KA 5IC6B 1LFPA 4OZNA 1X4CA 1PJ7A 2A10A 3MR3A 2XY7A 2GVDA 1O8BA 2PFFB 2K1RB 3GIRA 3KXDA 1FRXA 2Y3YA 1RSCA 4PAAA 4JI7F 3OSNA 1WTFA 4ZPWR 4LF6F 4B9TA 2K7JA 2V2KA 3JS9A 1VQLS 5KFIA 4JBCA 1WF2A 2EWHA 1SXLA 3JTOA 4XAKA 3TJAA 4TKTA 2FIUA 2AGOA 2VFSA 3DLEA 2ZH8A 2PN6A 2VKZG 2EW9A 4BBYA 3F41A 1NK0A 4EGLA 3VGSA 4YFUA 2DR5A 1UA0A 1AA1B 4OX7A 1CQNA 2AX1A 3IA0A 2YX1A 3OW2R 3TOQA 4DR5F 4AXIA 3PFOA 2VG5B 2QX0A 4Z2XA 2ZH3A 1WC4A 3HF5A 1FXLA 4FN5A 5KG0A 3CDAA 1KTQA 4P72A 4ZDNA 3AA9A 3BN4A 4CLPA 3KK1B 4ZPVR 2H5IB 2LEAA 4DR3J 4OYIA 4LBPA 4LT6A 2NLWA 1W26A 3R1HA 2ZKUA 3CJKA 2XMKA 4DZDA 4DG1B 5F8HA 4ED3A 3OHBA 2DR8A 4CLZA 1BQXA 2RSQA 1T03A 4X65F 5BJRA 1UZDA 3OBIA 2O5DA 5B0EA 1FKOA 2CPYA 4DV5F 3ZXWA 4JV5J 2KRRA 3M8RA 5CCLA 4QR0A 2ATCB 1FI4A 2UUBJ 2EFGA 2UVVA 5L8RC 4KHRA 3FGVA 1XNRF 1N5QA 3BGLA 5KFEA 3M6XA 4OMFG 3GJTB 1NKBA 1WELA 5IM0B 2FLNA 4OYAA 2AEJA 1CQMA 5LMNJ 2H4WB 4LR8A 4X62F 3P96A 5AE1A 2WRMA 2PI4A 4QU7A 4ZVFA 2M0GB 3VVUA 5I4MA 4PPDA 1S1VB 1CLFA 2RD5C 5HI7A 2MLYA 2IM3A 1VQ8S 2OFHX 4ZP7A 2B5JA 4NX9A 2YNGA 1SL1A 4LVNP 1EQ0A 1TKZA 2J7KA 3HZGA 2MPUA 4ES2A 1UPPA 3TO8A 1LEOA 3BSNA 2FZCB 1X31C 2ZNYA 5M2UA 3NGDA 1C1CA 4ITSA 4I67A 3CJKB 4IG0A 4NMXA 4OJ3A 3S1TA 3CIMA 1KHWA 1M5SA 2V69A 1S0NA 2GJIA 2RNEA 3ENVA 1CS4A 5HO4A 3NNCA 3QZ8A 1NPRA 1T03B 3HKZD 3W8PA 2R4FA 1X4EA 3NXZA 5BXIA 3WBZA 3ZZZA 3PXGa 1FKOB 2HHPA 3JSMA 2KKHA 4NXMJ 3FZBA 1NK8A 1PJ6A 3UCZP 1FRIA 3U1LA 4FBUA 3CNQP 4TY9A 2WONA 4R5PA 4EK2A 4YHHF 3GE9A 4YB1P 1RHQB 1HD0A 4HVZA 2DRDA 1IKWA 1C1BA 4RKUC 1WEXA 2YWKA 4EUVA 2VH7A 3U1NA 2AD9A 1FVQA 3ISND 2GQQA 5CCMA 1H98A 2FYXA 4CWBA 1XMQJ 4ZHRA 4B3SF 3IC1A 3A8JA 3BSCA 3MM7A 2C2OB 2XMUA 4EWTA 1R8PA 5ETMA 3US5A 3R97A 1PJ5A 3FEXB 4TU7A 4DV6F 4R8UA 5M2PA 1RAAB 3GV8B 2B5JB 2QE5A 2YNGB 2PA3A 3PW5A 2ZM6F 1OSDA 3JTPA 3PEJA 2CPJA 3I31A 4WXWA 1WG4A 3R7SB 3UCUP 3CCZA 1SC1B 1C1CB 1S9FA 3QAEA 4IG0B 3OPKA 2HW3A 3Q8VA 4Q2MA 1H74A 5AXLA 1CS4B 1KFDA 3ELHA 5KG1A 2XY5A 1RHKB 4DR6F 2N7YA 3ZTQA 2CQPA 3JSMB 4LRFA 4Q2LA 4TLRA 4DSKA 3IXQA 2XG8A 4YDDB 1EIYB 2MQPA 2ZBIA 3H5SA 4R5PB 4E98A 1HWKA 1YSJA 4DV4J 1HQEB 1I5OB 3OLAA 1B7YB 5DDQC 3UWTA 3UDLA 1C1BB 3OJSA 2ZHAA 4J9PA 1IKYA 1P6TA 3D2WA 2VFUA 2ZZTA 4OFZA 2DNLA 3S7RA 4F0MA 1UEKA 3TW0A 1U45A 2KXNB 2L41A 3B78A 4ZHRB 2NREA 3IN5A 2P9CA 1RT5A 4C8MA 3MM7B 2A2DA 4QCLA 2QO3A 3V6DA 2DK2A 5EN1A 2AEMA 4R8UB 3MAQA 3KJVA 1WACA 4C8LA 2E1RA 3M6UA 3MD1A 2V8HA 1QAXA 3OFFA 5HMZA 2ZH1A 1V3SA 1Z1ZA 3MCOA 2J6TA 4I4BA 4LUBA 3OL6A 2IJRA 1AUSL 2RHSB 1EB0A 4NZ6A 2GIQA 2XNRA 2QLWA 1GMWD 2WTFA 4RW4A 1AFJA 2JDJA 4MFBA 2KM8B 4B9SA 3OTOJ 2CFXA 5E3AA 4FXVA 1D9FA 4YB7A 1QVGR 2AU0A 1M90T 3LP0A 3CSKA 4PR6A 2J76E 1RTDB 1Q8BA 4HHJA 4MIWA 4IRCA 3DLGA 1QAYA 3VF0B 2L3MA 3LUYA 5DM6Q 3E8OA 4QOTA 1SJ4P 2C2KB 3HD2A 2DNMA 3GV7B 1GNKA 2QMWA 4RBUA 5J1PA 1U1PA 4CNZA 2GS8A 4ZVHA 4I69A 1ZTWA 2HURA 4DL0C 3DDIA 1IKYB 2BQRA 1S48A 2LVWA 5KFMA 1F0XA 2QEXS 2HBYB 5F8MA 3QO9A 3CJ2A 3V4MA 2V8GA 4ZPTR 3C2PA 4I2QA 3V6DB 2YKOA 3GSIA 1IR0A 1IBLF 3H8YA 3FSIA 1VBKA 2E9ZA 2CPFA 4HTJA 3O44A 4B3RF 4ELUA 3RRGA 1TK0A 2CNOB 3MD3A 3C16A 1QM9A 4L76A 3C19A 2HQ3A 3LW5C 1HA1A 5AE3A 1YHQS 3O8WA 4Y2KA 4OI1A 1VQSA 4RW4B 2BOPA 3THVA 1V3RA 2VASA 3B4DA 4V19X 3IAS9 1KQSR 4EYHB 2MSSA 4YMEA 2G13A 3EDQB 4OV6A 3DRXA 4MKAA 2DNRA 4PG6A 4NXNF 3LP0B 2VG7A 4CH7A 1VI7A 4WFZA 3CCJS 1B70B 5KOWA 4KY3A 2LEBA 3CC7S 2CJQA 2QZ8A 4IO9Q 3DLGB 3P4UB 1PC5A 2AWZA 1S6QA 1IBKJ 5DDOC 2G1HA 1FXDA 1YK9A 5AE2A 1VLOA 4NA1A 2CVEA 4L75A 1Q95G 3KLIA 2YVSA 2MKKA 5HJYA 3DU5A 3CCUS 1HFEL 2CPEA 2RILA 3BEGB 3Q83A 4DN9A 1PG5B 1N5TA 3BREA 1LFWA 4U9RA 2C3UA 4AYBD 1MWQA 2HS0A 2OIHA 1FWLA 3D1OA 4ZCIA 3VVTA 2JWNA 3QO9B 2CPIA 2G4BA 3AJ2A 3H42A 3IFEA 4HLBA 2ABYA 3QGPA 2VA3A 4XTTA 2DNNA 4I2QB 3PW0A 4WP3A 1VHIA 3DGPB 4ZVUB 4X65J 2Y9HA 1UAWA 4J9MA 2KG1A 1RWKB 4NCGB 3FRZA 4X66F 2CQ3A 5F8NA 3FK4A 4USUA 3JAMY 1Q86T 4OI2A 4KGKA 2XQCA 1GT8A 2LQ5A 3C16B 5IQ6A 1UEUA 3EWGA 2FJEB 4OZ5A 1SC4B 4WTYA 4OJ1A 1T0TV 5GADU 4JYAF 3HLUA 3IGVA 4F0KA 2FJWA 3LP2A 1HBUB 2CXEA 2HHWA 3WC0A 4KGMA 4NLOA 1XNRJ 2FHJD 5K14B 1HBNA 2VG7B 3F0NA 3CUNA 4ID8A 5FLXY 1YIJS 2I0XA 4FYWB 3RGIA 5DO2A 2LEPA 4ZCLA 1S6QB 4CTAA 1Q5VA 5C25A 4K2JA 1RT4A 1KQGB 3W9HA 1NO8A 3CT9A 1GXLA 4ECSA 2V2ZA 4URQU 2VQEF 1MSWD 2R2SA 4RUAA 2HMIB 4YS2A 1XR7A 3MR5A 3CCES 3DU6A 4RW7A 4NE9C 1DY3A 2RT3A 3NMAA 8AT1B 2KYXA 3HHLA 4O3NA 3R5JB 3ENWA 4FP9A 2VKRA 3M32A 2YKQA 1X5TA 4X4RA 1N54B 2G0JA 1ZM4A 4F8RA 1KOOA 1X0PA 4Q45A 1ULRA 3PR4A 3I5AA 3NGTA 4Y65A 5J2QA 4IH6A 1RAFB 1RISA 1HYSA 3JSYA 5HMYA 2RF2B 3MWBA 1SQGA 1T9WA 1HIYA 2QN6B 3MZIA 2NYIA 2NPFA 4QIWD 4DR4J 2CRLA 5J1NA 3JSRA 1OY8A 4OYOA 4KR0B 3SYZA 4P71A 2W01A 3BGRA 4W98A 2R3VA 3TI0A 4H4KA 2ZUGA 2PT0A 4A48A 2XLJA 1YJNS 9RUBA 4N41A 4QBUA 3JAMU 4B3SJ 4CTAB 2HS4A 4R0JA 5C25B 1IM4A 3KUEA 4KRWA 4IRDA 1RT4B 3EUNA 4MKBA 1M5PC 4RL1A 1AB8A 4AE5A 1SV5A 3A1YG 4GKJJ 4MH8A 2ZM6J 2XBPA 5ETTA 1TK8A 1RZMA 1OPIA 3FKBA 4LFCF 2QL9B 4HH1A 3M1VA 2J9CA 3R5AA 5FLXU 1G2EA 2OD6A 4RW7B 3SSQA 1S1XA 4X84A 3O6QA 3JSBA 1UKUA 3M32B 5F0UA 2JEIA 2WSEC 3SXLA 2PD1A 3Q8YA 1S6PA 3VWSA 1KONA 1KP6A 2MY8A 2IBOA 3UNGC 5J2QB 5HBMA 4LMZA 2YKMA 3O1LA 3QMQA 3O2IA 2JC1A 3J81j 2GAGC 2ZH4A 4ED4A 3CDWA 3P49B 1NB2A 1Q79A 2UXBF 2QLFB 5IS2A 2G0CA 3ZTSA 1S97A 1YVFA 2LQJA 3LF0A 1SUQA 8ATCB 2HHHJ 2J8SA 2ADBA 3BGRB 1FX4A 1EARA 3MMJA 4ZJOA 2AGQA 4Y28C 3CEDA 5DLFA 4Y6IA 3GTYX 4DQQA 3Q23A 2MB0B 2WW8A 5DG9A 2KT3A 2AV5A 4USTA 1SV5B 3D67A 2YKNA 5K5MA 3BZQA 2YWFA 4MT1A 3GV5B 4KHPF 1EZZB 5J1EA 3N6NA 3M1VB 4DL4A 1ZZNA 4Q5VA 4C98A 4NRTA 2ZZNA 4IOCQ 3ISNC 2ZH7A 1S1XB 2VF3A 4RZRA 2C2ZB 1B3TA 1N5VA 2MSTA 1FKPA 1LW2A 1B99A 4P10A 5KG5A 3UD5A 1S6PB 1RT1A 1U0SA 4FS2A 3NL0A 2FHMA 4ED5A 3JQMA 5HBMB 4WFXA 2VBYA 2YKMB 4RW8A 1TZ0A 5RUBA 2XGPA 4I6YA 4P74A 3BV8A 3UD4P 1FK9A 3AXKA 3RG6A 2I5JB 3RRHA 1F3FA 2OFGX 4HACB 2D1CA 2M88A 1U2RA 1SUQB 1S76D 1FE4A 2F5GA 1S57A 2CZVC 4UW2A 4LSNA 1C2PA 3G71S 3DLBA 4DR7F 1RGVA 1X9SA 4P75A 1GX5A 4QJVA 4GKKF 1U48A 2CJAA 3VV2B 4IH5A 4QWCA 4DLGA 5D8HB 3M8ZA 1IBLJ 4DPWA 2GVZA 5KFUA 2AF6A 1TU0B 4EBCA 4KH1B 3GFYA 3D1HA 2YKNB 2XHCA 3Q22A 3RB6A 3J7YI 4NI2B 4E0DA 3CDUA 3H5XA 2CNKB 5E0OA 2FLLA 4HTIA 3SQGB 2HVHA 1TKTA 1IR2A 2AP6A 1NAQA 1SJ3P 2IFXA 2F7VA 1V6HA 4YEAA 2HKEA 4A8YA 1T7PA 4O4GA 2E44A 4DN0A 1JLQA 1FKPB 2XZDB 1LW2B 4WZMA 4NXNJ 2EI5A 3KJFB 3K5MA 2XLIA 2MKCA 1H0HB 2QYGA 2J6UA 4ZN3A 5KFKA 1TMMA 4RW8B 5KFBA 3HVAA 4DV7F 1K0TA 1FK9B 4WFYA 4KPCA 1VHFA 3TJ8A 3DLKA 1H2VZ 4DMZA 2FC9A 2HK2A 1M1KT 1R8CA 3GCXP 1VYAA 2C42A 1FEEA 3QWUA 1P1TA 2DGUA 1ICEB 4YR2A 3DRPA 1RAGB 3ULHA 4I2PA 1WOSA 1KDNA 4HL9A 4ICLB 1GK8A 5F8LA 2HWTA 1RT7A 3GYXB 4ETZA 3NWGA 4A8WA 3PR5B 4RBVA 1FTCA 2D7SA 4F26A 1EP4A 2JLEA 2F40A 2GVZB 3T3FA 4F2SA 4DPTA 4K4UA 3NBPA 1K44A 1O6XA 2GW8A 5CA5A 1JXVA 5D0GA 3I5BA 2QLXA 2FPHX 4LR9A 2VONA 2J9DE 4DWIA 1TKTB 1TKXA 2M9KA 4DSFA 1ZA2B 1PIEA 2FJVA 6FD1A 4PQUA 2LQBA 2RH3A 3V2UC 4G6VB 3EPGA 1R3NA 3OTDA 5D4PA 2X1BA 3IRWP 4PG5A 3I5CA 1JLQB 1JLCB 2DXDA 4LF5J 3GJRB 3RBDA 4LVOP 1NPKA 3SDEA 3CO0P 3THTA 3VAGA 1DLOA 1QSLA 2IA0A 1JKHA 1WDTA 1MLAA 5GMDA 2RVJA 3KLFA 1NBEB 1UEVA 1R6VA 2F8MA 2GMHA 4QYZJ 1E6VB 1ZH5A 2GAHC 2QFIA 2VQEJ 3DLKB 3GPAA 4JP8A 1B64A 4YN3B 4ZP8A 2HHXA 1T02A 4C0BA 2OEMA 4ETXA 3VZIA 3DRPB 2CAJA 4PYDA 3CD5A 3BDEA 1RT7B 5DQHA 2JH3A 1VLYA 4KT0C 4DCPB 1FF2A 1V9OA 3N01A 3PG9A 3ILIA 4UOCA 3G6YA 2PEBA 5SZTA 2QIFA 1UVNA 3NBPB 1H6KX 1N52B 5MAOA 3QIPA 4Y0FA 2IJFA 4Q8EA 1KLNA 4O3PA 3H0PA 4X2BA 2RQCA 5EHHA 3EXYA 1TKXB 4CM2A 3BPSP 1RTZA 2KFZA 3KLVA 5D78A 1U6ZA 3DMJA 3UO0A 4CRJA 1TTHB 1RHUB 4H54A 1FWPA 4X4VA 2HFZA 3ILJA 1HHQA 1KBRA 1A6LA 3PY8A 4OI4A 1HQ2A 3AB2B 4RUCA 4MIBA 2DNGA 2K2PA 4QYRA 4DX5A 5E3PA 3ZZUA 1DLOB 3FJ2A 1RA7A 2F1FA 3GILA 1IJFB 2HQDA 1JKHB 4LIWA 2BMBA 4QQBA 1N34F 1N6QB 2C3PA 5ETRA 2F8HA 4WP8A 1QSYA 1K47A 2L9DA 1KOHA 3NG8A 4CQ1A 2CDQA 4CLLA 2C22A 1AZSA 4GC6A 3BO3A 1LK7A 5CAAA 3QT7A 4IH7A 2X1GA 1O5JA 2QV6A 5A8WB 2FVCA 3GB0A 3FEZA 4WKYA 5GADI 3IR6B 3HJFA 3D6MB 2NQPA 1S1TA 1GTEA 3SMZA 1DTTA 1I51B 4CO5A 3R27A 1XNQF 3T1YF 2HHQA 5AXNA 4M5HA 2DGXA 4DXLA 2E1MC 2X7IA 2FQQB 4NCAA 4JI6F 1YZ7A 4FYVB 3POTA 2EBGA 5F9NA 1S77D 2M7SA 2XSJA 2C2DA 4U8VA 1TK5A 4JI8F 2DXEA 3EGWB 3K7RA 3S01A 3BYRA 4E8UA 5H9EK 3DMJB 2PO4A 4W92B 1LWEA 4P7TA 4A8FA 3KG1A 4LSZB 5E5NA 2YTCA 3R9LA 4LFAF 2K8GA 3DOMA 4OZJA 4LFBJ 2EEYA 3IMQJ 1JXEA 1W7WA 3MMAA 4DV1J 3VGVA 3NAHA 4M8LA 4HHHA 4XK8C 2QMUB 5CQGA 2BKOA 2EFOA 4LQ9A 1FE0A 3JTNA 4I6WA 1WF0A 4Y00A 2F4VF 1VQMS 3PYEA 3Q2SC 2P6SA 4DS4A 2R8KA 5KG4A 5F0WA 1R43A 2Z2LA 4EMDA 2GNKA 1GTHA 3OR2B 2FLOA 5IFMA 1HARA 1AZSB 4UTGA 4ZVTB 4ECTA 3AOCA 4MTPA 1NDPA 2L9NA 2MHNA 1SJFA 2PMHA 3C3LA 4F7VA 4K4YA 2HQGA 1OSCA 2HVEA 3I32A 2YX4A 2MQNA 1S1TB 3BH7B 1RLDA 3AY0A 3HHKA 1DTTB 3HO1A 4LRDA 1MN7A 2N4CA 2V4JA 3NOCA 5AJ3J 2J0WA 2HQCA 3EZOA 3POTB 4X4SA 1HWJA 5CYMA 2XSJB 4WFBQ 3HK2A 1FD2A 2C3MA 3DYAA 2CJXB 3BQ0A 5D15A 1SL2A 1U2CA 1LWEB 1HW9A 2U2FA 1TUVA 2XMVA 3IM8A 2ROGA 3TQEA 3DOMB 5HL7Q 1OS5A 3DRSA 3DOLB 3VR1A 4JI1F 2B43A 3MMAB 5D0HA 4O44A 1OJ4A 2BE2B 3F73A 4OHYA 4GKKJ 2WVEA 4JI4F 3B4MA 2AHOB 3DXSX 4O0IA 2MY7A 1W2IA 2HWHA 3M8WA 4LIRA 1PYOB 3HHLD 2AJ4A 2VHGA 4B9NA 2E5HA 4UOGA 3PYGA 4M5GA 2RDIA 4X4OA 2RUSA 2UZAA 2RQMA 1RHRB 3ZZYA 3EGVA 4K4TA 2ZHOA 4IQXA 4AXJA 5LMUJ 2HLTA 2VQFJ 2YWWA 4YQWA 2DHAA 1LW0A 1TVRA 3DOKA 2JEFA 2V4JB 5I42A 2KFYA 3SIPB 1MMDA 4DV2J 1FNMA 5IT0A 1FVSA 1RT3A 4ANDA 3MCNA 5CYMB 1UL3A 4YDXA 3TEGA 3HFKA 3L7PA 2COLA 1UW9A 4KAIA 1H7XA 1F5BA 3DYAB 3CPWR 3V6KA 1U47A 1N36J 2M3DA 1FD8A 1YI2S 4JI2F 3M9MB 2KXHA 3VGTA 4NL5A 2G1DA 3FFIA 5CZVA 2YQ3A 5DG7A 3R5GA 2Z2ZA 4CLKA 1URRA 1RKIA 2FVRA 2LECA 2OHDA 2OSRA 3NS7B 3IBWA 5DS7A 3UDCA 1KVJA 5B0BA 2XY6A 3GMGA 5EX3A 4JI0F 4ED0A 3ZC4A 4C3MA 2DKOB 3I82A 3VAHA 2JJ4D 1ZA1B 3CMAS 2W7PA 2QA4S 2KJWA 2BV3A 3A8IA 1G7CB 1MW7A 2DBBA 1F60B 1WKJA 3Q8QB 4PWUA 4J9RA 2E9RX 3DLHA 2EC0A 1X5OA 4B08A 1LW0B 1TVRB 3OFHA 3DOKB 4NMLA 4NZ0A 5HMXA 2C3YA 5I42B 2DNKA 3AJDA 2J0XA 3R3TA 1RT3B 1S49A 2JRSA 4O3OA 4QYZK 2EKYA 1RTHA 4JI5J 1HNWF 4C3KA 4B3TF 4B9LA 3A8EA 2YNIA 2RJZA 3BM7A 3FFIB 1ZAXA 1KHVA 1UVJA 4LF4J 2HRYA 3FVYA 5KFDA 1VBZA 2FHOB 4A8OA 2FB0A 3KMQA 4J9NA 3KFWX 4ERDA 4RWWA 3KHGA 1Z2ZA 2I38A 4NLTA 2DNYA 1U1LA 2IAJA 4ELVA 3NGSA 1FO1A 3I9ZA 4FKYA 5IWAJ 1S7HA 4DV0J 1CJUA 2V8VA 3WDOA 2FGCA 2RDJA 3HD1A 2GFFA 4MK8A 3MAAA 5A8KA 1IBCB 4ED2A 3M2UA 2EBEA 2BJ7A 4J9QA 1WC1A 1SB6A 2KL8A 1FHTA 1TV6A 2BXJA 2R7WA 3P8BB 1OQ3A 4A8QA 4TQSA 2YXLA 5CYQA 2EG2A 2Y0SD 2KYZA 4DCJB 5C42A 4N76A 4ZLJA 2WSFC 1U2FA 3T6JA 4MYUA 2MYFA 4TLQA 3MCSA 4HT5A 2KM8C 4FPRA 1NEEA 2OPPA 5CXTA 2L48A 1LXJA 1NZ8A 3GWCA 1LNQA 3J80Y 5AXMA 2ZE2A 2Z8QA 2YNIB 1PGZA 6FDRA 1Q53A 1SJ1A 2PI5A 4DEZA 3PW2A 4GVBA 1S99A 2UUCF 4WWSA 1RUSA 1MG7A 5B0CA 4WPAA 3MECA 3KK2A 4DDFA 3PKMA 1NK7A 2OTLS 1UA1A 5DM7Q 4QIFA 4DPYA 3PYFA 1IR1A 2MQ8A 4AT1B 2MLZA 4CLUA 2A2CA 2CQIA 2IVMA 3PIOQ 1CJUB 2HIYA 3JYTA 1P1LA 3W5YA 1AT1B 2DVIA 2OPSA 2UXDJ 3D1QA 1RU1A 1TL4A 2F65A 3MAAB 5A8KB 4FNIA 3M2UB 4DOZA 5ITHA 1PYTA 3D7SB 1S1UA 3TR5A 3H90A 1TV6B 4ANEA 5JJBA 4ID5A 1T9VA 1S0MA 5JVHQ 1R6YA 3GYGA 2E7VA 5CYQB 4ZJQA 3SCKE 3CDEA 4PQAA 5C42B 3N28A 1G3OA 1BD6A 3CJ3A 2FD2A 3FDSA 3KNGA 1W2BR 2JZ5A 1UJ4A 2CJBA 3Q8PB 3V6HA 1RK8A 3D3CJ 3UW1A 4KO0A 4KIAA 2XYPB 3PIPQ 4ECWA 2ILYA 2UV8G 4DZ6A 4HHUA 1J5EF 2G9OA 4ILRA 2AJ2A 1QD1A 2A6OA 2OPPB 5KFVA 2WCXA 2F9DA 3I0SA 2RRAA 1FA0A 3K58A 3BO4A 4QZVB 4KFBB 4BLGA 3RYLA 4ZP9A 1Q7YT 1REGX 5KG2A 4A47A 1WG5A 4Y34A 3NNAA 3LQVA 2ATLA 3VAIA 2UUAJ 1F3VA 1DAXA 3WZ0A 2H5EA 4A8XA 4AQYJ 3V81B 2XCAA 3MECB 3PFEA 4YB5A 3KK2B 2Q3PA 3IWXA 2DTJA 4KV8A 4ZLLA 3I0RA 4X4TA 3W64A 1NRKA 3MM9A 3CWJA 3M8QA 4WKRA 4O4RA 1TL5A 1XR5A 2HFUA 2FLPA 3JYTB 1S5ZA 1L3TA 1UJ6A 2K3KA 2N3LA 2KFNA 2OPSB 1SVDA 5FJ4A 4F4XA 3N79A 3D6HB 2VV5A 2QL5B 2XGQA 1K9MT 2RU3A 4UQGA 1GXTA 3EVMA 1S1UB 4TU9A 5KFAA 4CCHA 1I6JA 1D3WA 2NUHA 1RT2A 3W3SA 3FZ2A 2CZ9A 1IXKA 2VA2A 1U8WA 4J91A 4RUHA 3TAQA 4KO0B 5ETNA 3OFGA 4KH0B 3AOAA 4ECVA 4JV0A 1DARA 1C4AA 5G0RA 3KJNB 1Q1KA 4TVAB 3M9NB 1T94A 1NK4A 1J2VA 2UU9J 2B0GA 4B3OA 4DJBA 1HD1A 2GC8A 3MPVA 1BC6A 2Z2YB 3C6UA 1UVIA 4G1IA 1ZTTA 2LQ9A 3C8YA 2DIUA 1ZM2A 5E2QA 1S0VA 4OZ0A 4KV8B 3I0RB 1P8GA 1CJTA 1KVKA 4IOBA 1Y7PA 2NZCA 5A8RA 2QG9B 4AL7A 3PDNA 3MM9B 2DO0A 3M8QB 2EKNA 5GAEU 2K7KA 3OUYA 1VCTA 2PE8A 1KLMA 3R6LB 4LBHA 2VBZA 4USWA 5H9FK 2WBRA 3DM2B 4JI3F 4OHZA 4DU8A 1NDLA 1U8SA 4QIEA 2ASDA 2W4PA 3LALA 1QE1A 2B9WA 4OX9J 5KT5A 1VBXA 1YITS 2IC3A 3FBBA 1C0TA 4RUBA 3CD6S 3AH6A 2V2VA 1RT2B 2MKYA 2CJ9A 2ZUAA 4YY3J 2VIHA 3EVWA 2E1AA 1UVMA 4DR2J 1U6BA 2CQ0A 2XS5A 4HYKA 2OP5A 5LOQA 4OJHA 2ZITA 3GYNA 4P2FA 1HHTP 2BM1A 5G0RB 2ASJA 4TY8B 2M2BA 4ZCMA 2DCUB 3CJRA 3GIKA 4DR1F 3D54A 2VICA 1UP1A 4OHXA 3IGNA 4B3OB 2Z2MA 4IUFA 2HHTA 4KGXB 4Y2IA 1JJCB 3ETOA 1ZM9A 2DGVA 3BF4A 2OSQA 3NCRA 1K0VA 3LWLA 4C8OA 2OPRA 3CJ8A 4OZLA 5BR8J 4OZ3A 2JSXA 2NXEA 3FRYA 1E6YA 3PM9A 5A8RB 2CQ2A 4F4WA 3QBCA 2DNOA 3OUYB 2DRBA 1CSJA 2ZD1A 1KLMB 3C6TA 1TL7A 1N0VC 2EVZA 3HHLC 5B0FA 4YR3A 5M2RA 3Q8UA 3W2VA 4GVLA 3MR6A 1OMSA 4OZ2A 5E3RA 3HHNB 5KFOA 2BACA 1NSAA 3GIIA 5D4LA 4LF2A 4G1QA 5GAGU 1QUPA 3VQSA 1HNWJ 4OI0A 3KK1A 4F67A 4IO1A 2IC3B 1C0TB 4FVMA 5KT7A 2HBRB 3BDPA 2V94A 1U1NA 5ETVA 3HM9A 5L1KA 1FJGF 3FSYA 3QT6A 4I68A 4UQTA 4ZK7M 2VZ9A 1FESA 3ADAC 3H59A 3M8PA 2OKQA 5D3GB 2J0SD 4K0KJ 1T3OA 3FMWA 4H4KC 4B9VA 2RQKA 4NLQA 1VRUA 2W2MP 2I8EA 5GMKa 4NCBA 3OVSA 4IKAA 4DUZJ 2ZBCA 5EWFA 5JVGQ 2LYVA 3LOUA 3CGIA 2HZCA 3R2CJ 3CD7A 1LWXA 3TUJC 1YJVA 2G0IA 3N5BA 4J9LA 5K8NA 1NH7A 2OPRB 2D3OR 3V6JA 4N8OA 1LWCA 2ASYA 3UR0A 1M1GA 2NXNA 3H2VE 2P2CB 1E6YB 5IM0A 2W1BA 4WIIA 5JMNA 2WSCC 2KXFA 2F8EX 3U02A 2IVFB 2PMWA 1I1GA 2ZD1B 3CJTA 3C6TB 1TL7B 2O66A 1XERA 2CPZA 2DH9A 4UT4A 1FRHA 1HW8A 4OI6A 3EGNA 3TARA 1S1VA 4J9OA 3W2VB 4EBEA 1JJ4A 4EZ9A 4G1QB 1GH8A 1YBUA 4ZPAA 2UXCF 1VC0A 2KTQA 3W61A 1OYDA 3H2UB 1SKUB 5HLFA 1ZBTA 2R2TA 2AQ4A 3UDVA 1RHJB 1RQ0A 4FF3A 4CZCA 4ZPDA 2MXYA 1Z2LA 4C8YA 2Y1JA 4HDHA 2OEJA 3M8PB 3RW7A 2ACYA 2L08A 2ZDPA 3M05A 4PPZA 4P73A 4YP3A 1VRUB 2BDPA 1YJ7A 2DNQA 3I87A 4X64J 3J7Z5 4BWJA 3CCWA 4ECQA 2NSCA 4NEYA 3HHEA 1VRTA 2I9SA 1P9QC 5IZHA 2IHR1 3BS9A 1F6TA 1T9UA 1LWCB 2E9TA 1NK9A 3HVRA 2HS3A 3ITHB 3ILLA 1XQIA 1HI8A 3IR5B 2GJFA 2AW0A 4G1PA 1D0EA 4Y2MA 4MAKA 3HX9A 2D41A 3MPUB 1LOUA 3IP0A 4GMKA 3QLHA 3MFIA 1LKZA 1VQYA 1H38A 3NNHA 3UD3P 1KS2A 2D69A 2ZH5A 3NGUA 2A1BA 2AJQA 1VQ6S 3RR7A 4M1KA 2HGLA 3W5XA 1SKSA 1H73A 4ANCA 5HLFB 3T1HF 1N32F 3PJXA 2X51A 4ED8A 5KFTA 4LSLA 3GG0A 1CEZA 2R7SA 3HVTA 1N56A 4WU2A 2UV8A 2HK3A 1M5KC 3NKYA 3TUZC 2HYIB 1WSVA 3LAKA 1Q8LA 3QJJA 4K2XA 5E3CA 5ETPA 2EK6A 2XSFA 5D77A 4I6AA 3HSDA 1ZM3A 3ENQA 1SH2A 3W1YC 4NPOA 2ZHBA 3LA0A 2VPXB 2AEFA 1I94F 2EG1A 2DEIA 4K4SA 2POKA 4DL7A 2GX8A 2ZH6A 3FEYB 1N33F 1VRTB 4HEA9 2B9YA 3MOZA 1HQEA 4DPUA 1U24A 4F4AA 3H4BA 1U1MA 5IT9Y 4ENOA 2LDYA 2CA9A 3QSIA 3MXHP 4LF7J 1XR6A 4HR2A 1RLCL 2PGCA 4UF4A 4USIA 2RB7A 1WDDA 3NS6A 2DR7A 3NWRA 1SKWA 2WK4A 4UZBA 1XN9A 4K4VA 1RAIB 2YH0A 3MTJA 4NWBA 3QLHB 1NJIT 3TVKA 3TVZA 3VCDA 1AUDA 4ZCKA 4UY85 1N0UA 4NYZA 1NH8A 5C2CA 2VC1A 4ZOSA 4ZA1A 5HK4A 3M8SA 1NHUA 2HNDA 3A13A 3VAKA 3WQPA 3CO9A 1Y5IB 1FRMA 5F3ZA 4LSLB 3HVTB 5EGYA 1RBLA 3H40A 1HNZF 1HPZB 1U02A 4DU7A 2FJBB 2HAIA 1CC8A 4WFAQ 1KRPA 4WTOB 3J7A1 1PSDA 3BN7A 3C66A 3K0JA 1RTDA 1C0UA 3N4WA 1NCLA 2IRUA 2JOQA 1PYSB 1RACB 4V19J 3A3OB 4C8ZA 5LSLA 1RWWB 3GJSB 5EDWA 5J2MB 1WF1A 2HHSA 3I4PA 3K57A 1FKAF 4TQRA 4OHWA 1GMUA 3MCMA 5B08A 3G8TA 2NXJA 3BR8A 1Y3JA 3CC2S 2J7WA 3UNYA 4RNOA 3E3XA 3TZXA 4RPFA 1ZPVA 3SV4A 2XO6A 2ERRA 1U49A 1SJRA 2XS7A 4K4ZA 2HGNA 4EO8A 4F02A 1J27A 3DHWC 2UP1A 2YNHA 3OL9A 1XMOF 3T41A 3T9NA 1TELA 2N3OA 5HMWA 3MOJB 3CC4S 3H7HB 4LRCA 5KFFA 3CCRS 2MQMA 2HWIA 1NK6A 5IT9U 1U7LA 3RJMB 2HNDB 4S0MA 4HT7A 1CJKB 4ZVOB 5AXKA 3QWPA 3CCMS 4CO3A 3IO1A 4F0HA 3P3DA 2IMOA 1DTQB 2HQIA 4OX6A 3BBBA 2E5JA 1R89A 1V5IB 3UCGA 1UETA 4QR1A 4QIVA 3UI3A 1C0UB 2KH9A 1QVFR 4J5OA 1SC3B 3NS5A 2NXCA 3N6LA 5EWGA 1RAHB 1VJQA 1Q8KA 2WAQD 4DR3F 1U1QA 3HHDA 5LL6d 5L1IA 4CT9A 2MZSA 1HWLA 3TX0A 4NA3A 4DCOB 2XLKA 4K5RA 1HI1A 4KB7A 4WFNQ 2LFVA 3QT5A 3P5BP 1KSPA 2KT2A 3FCHA 1PAUB 5HQMA 3THPA 1WOOA 1VS3A 1WHWA 2HFSA 5KFHA 2KHCA 3M30A 2IRXA 1T9XA 1BHNA 3MDFA 5HATA 3W2WA 3R7BB 3A4TA 3WX8A 1TFWA 1SKRA 4D3HA 4N8NA 3ZTOA 3OJUA 1QTMA 3LGHA 3BPDA 4JV5F 2LU2A 2VU5A 4DPOA 2M5YA 2YNHB 2E5LJ 3DGPA 3CXCR 2NS1B 3IBCB 4U7UK 2LLZA 2GHPA 1G6BA 4RWXA 4NCGA 1H72C 4ZJLA 1LV5A 2LXFA 2UUBF 1BWVA 1NJYA 1UPMB 2F63A 1VDHA 2G2ZA 5KFCA 2IYIA 1WKKA 2IBKA 2GQCA 3SV3A 2ZWPA 3KLGB 3IS9A 4JI7J 4M5DA 3E2EA 4LF6J 3MHYA 5HROA 3F56A 3SSRA 3EMTA 3ISZA 3T5LA 2CDRB 2R7XA 3OD2A 1WD6A 3OTCA 1GFWB 1HBUA 2APOA 2HAFA 2R8IA 5K14A 4OYPA 2IY5B 1RB0A 5B0AA 4RNHA 3HI9A 1VC6A 1D1UA 2L9WA 1UTAA 1ZPWX 1U1RA 4NA2A 2HVIA 4KJIA 1JNRB 4L3NA 2ZH2A 4DR5J 1KFSA 1BQNA 1MROB 3AOBA 3RB4A 1HR0F 2J9EA 3GSDA 2HG4A 2CG4A 2HVDA 2O01C 1SQFA 2OAUA 1UVLA 3ETMA 3EVOA 1OY6A 3D28A 3CCQS 1Y5LB 2UXCJ 2HMIA 3OSPA 3GIMA 3CJ0A 3ZTRA 3S6EA 1RJJA 2M70A 3GJQB 3M30B 1FNOA 1FDAA 3PRVA 5LSRA 1BXNA 3W2WB 3C46A 1NHKL 5ETOA 4NXMF 3TAPA 1H3DA 3GFXA 3WHIA 1BWEA 2HFNA 1K1QA 2MEWA 3BJYA 3S8SA 4M5IA 4PXDA 2CG8A 4NLXA 4DV5J 5KT2A 2Q66A 5L38A 2J9DA 4X4QA 1BY9A 1RA6A 2RF2A 3BQ1A 2OH2A 3IS9B 4M5DB 4L3KA 3VAJA 1Y10A 5HROB 4L73A 3PO5A 3DGVA 4P6QA 1XMQF 2C28A 3T1AA 1S4FA 3NMRA 4MYTA 3KHHA 2DNPA 2FJDB 3PACA 3QSYB 3TP2A 2W9BA 4FDFA 3M7VA 2DITA 4NYPA 3PYDA 4J9KA 2B8PA 4X62J 1WNEA 4BWMA 3SZ2A 4K4XA 1X60A 2CUYA 2QJ3A 1BQNB 4DS5A 2VOPA 3MM5B 2EXUA 4ZPBA 4EFAC 1RE1B 3LANA 5LJ3Y 1AYEA 1UWBA 4DPXA 2CQBA 4QR2A 2BJ1A 1TR0A 3B54A 1TAUA 3D0HE 1KWMA 1Y5NB 5I3UB 3CTRA 1REVA 1D09B 4C3LA 4ZITA 3DHXA 3CMES 1UFKA 1Y9OA 4WE1A 1OIAA 4ZP6A 2V6AA 5C7PA 5H1SV 4J9SA 2MZ1A 1S1WA 3G82A 2C3OA 5E7OB 2Q43A 3ZO7A 1T11A 2XNQA 3RBZA 2LDIA 4XDCA 4CLYA 1X4DA 4DV4F 4KC5A 5IQQA 1KN6A 4ZN1A 2OUGA 1D9AA 4URSA 3H98A 2RUGA 4YHHJ 4MK9A 3ZZPA 5KTQA 4YR0A 2QLJB 1VGYA 3HSJA 5KFXA 5E33A 3NGKA 3K89A 5SUHA 2ZJRQ 5L1LA 2W9BB 3BSOA 1GEHA 4DL6A 4QIGA 1JXLA 2N7CA 2DRAA 3P5TL 2CPDA 5C2GA 1IJEB 4EI2A 4QW8A 3K59A 4DV6J 1JLAA 4C7QA 4CH1A 1Q81T 4U96A 3KOAA 2FY1A 5EWEA 4QWAA 4DI6A 4GC7A 2H9ZA 3CD0A 1UWBB 1N88A 3HPOA 1T9YA 2H51B 1S7IA 4QWEA 2O3DA 1R8AA 3GLJA 2Z57B 1REVB 3NAIA 1GAOA 3OT9A 4WE1B 3RAMA 3TZYA 2R7OA 3AQOA 3NRBA 3OVBA 1LK5A 1HNZJ 4J37A 1S1WB 3G82B 4ZIWA 2AIRB 4KHMA 5IC4B 3I56S 1XEZA 1HL6A 3T9ZA 4DR6J 3KMSA 4PWWA 2F4FA 3ZFVA 2HHVA 1FDNA 2YY3A 3QQCD 4P9SA 5D4NA 1YJ9S 1U1OA 2PFDA 2IA6A 4DBQA 1VISA 1X5PA 3I6PA 4NLWA 4N47A 1APSA 2HHUA 2I5JA 1HNIA 3LPYA 1WC6A 2DNZA 5MLCV 4HACA 5DQGA 2BKNA 1VQ9S 1URNA 5H9EJ 4PYAA 3UR3C 1VQ4S 3QJLA 4FS1A 3M4XA 2AJ0A 1HQUA 1WHYA 3R6GB 3ONQA 2ZDOA 2O67A 1YRXA 3IRXB 1N4LA 2GIFA 2J5AA 4IR1A 1SH0A 3FCVA 4DL2A 1HWUA 1X4FA 1F9HA 1JLAB 1XMOJ 4PG4A 1I3OB 2MTLA 4X4PA 5E41A 3KHLA 1D8ZA 4NI2A 4ECXA 3AXMA 3FQKA 3T5HA 3CMQA 1NK5A 3SQGA 2PDAA 3CB4A 3EGZA 1R27B 2G2YA 3KDOA 2BRKA 1VQ5S 1P9YA 1IBKF 3M6WA 4FF4A 4XO0A 1DURA 2N82B 3PRBA 2BRLA 2BVZA 2Q6CA 3U7JA 2BQ3A 3IWNC 1Y4ZB 4RW6A 5HN0A 2E1CA 1QTNB 3EICA 2AKWB 2R8HA 1YZ6A 4DQPA 2KN4A 3MEDA 4DHVA 1QJHA 2WOMA 4NOHA 4N77A 1HNIB 4UOHA 3Q24A 4OYBA 2OLWA 3J7ZT 3M6VA 4C8NA 1NPPA 2VD3A 4Q8FA 2W2QP 2VPYB 3MAHA 4ZVSB 3Q2TC 1WHVA 4OQJA 2MZTA 2V2QA 3OFEA 4ATNA 1NB7A 2CKWA 4ALZA 2B9XA 3FUYA 4ICLA 5FDLA 2GVDB 1HQUB 1TL1A 2CJYB 3L7OA 3HFZB 2GCFA 2RRNA 2JNJA 2JX2A 3KJQB 4DUYF 2KHDA 2DISA 1CJVA 4WK1A 4MK7A 1EAYC 5KFLA 1RAJA 1Q16B 5L9XA 3OL7A 4B3RJ 4U95A 1PILA 4FYXB 2KRBA 1S79A 1VIXA 1S9GA 3MEKA 3DLEB 2IMWP 3I55S 2KB2A 3EJMA 3TNVA 2P5VA 2CQHA 4V1Ak 7FDRA 2D3O1 4QPTA 1OWXA 2CWKA 3N9UC 4EYIB 2J7UA 3CJSA 3VTIA 5GVQA 1DQAA 3D0GE 2DHHA 4WXOA 4YB6A 1JLCA 4RU9A 5ETKA 1SPBP 2NPIA 2HEKA 4RW6B 1QY7A 3LAMA 2LQ8A 1HR0J 2QT7A 1JJHA 1JLFA 3Q89A 4UUWA 3MEDB 1FTRA 2WOMB 2H1YA 3N0VA 1E6VA 4RBTA 3OQ2A 3FCWA 2DGWA 1KQKA 2AMCB 1FDDA 2ACMA 2VFTA 1KR4A 4PUOA 1JLGA 2CVIA 1FDBA 1KEKA 3WX4A 2MQQA 1WEYA 1WHXA 2E7WA 5FDLB 1TL1B 3OR1A 3GCWP 4MMOA 5A2QY 4RNNA 4CM0A 1CJVB 1WWHA 4DR4F 4DX6A 1H2TZ 4X66J 4RO0A 4F50A 3M2RA 3AQPA 2ZC4A 2GMJA 1S9GB 4OJGA 4ED7A 1MWZA 4UY8T 4JYAJ 5EX0A 2WHOA 3TANA 5ETQA 4XPCA 2ZVIA 5DZ7A 2GV1A 2XMMA 3RB3A 3D66A 5A6PA 4W90B 2CNNB 2B6AA 4IYQA 5F8JA 1H2UX 1JK9B 2R2UA 2VFVA 3UQSA 1F5CA 3DXBA 2CADA 4GKJF 4OYMA 4FBTA 2H5JB 1TKZB 2CYYA 1RDRA 2QA1A 2BA9A 3EXCX 3AD7C 1JLFB 3TZWA 1N6QA 3PX4A 3DLLQ 3BKUA 2I2YA 4MJKA 3W63A 2YPYA 1C4CA 1HNVA 2BE7D 2ASLA 1WI6A 1RHMB 3LTOA 2Z56B 4PUOB 1JLGB 2LA4A 2B4UA 5A8WA 3JQKA 2WVFA 4BC9A 3J7YU 3OR1B 2EC2A 4RX6A 1KTVA 4IRKA 4LR7A 3G2XA 1W25A 2EFQA 2GHWA 2VJVA 2IRYA 1X4AA 5BYQA 3R8YA 4PZVA 2RQ4A 3L9ZA 2WONB 4EO6A 3M2RB 4DV3F 5K20B 1IKWB 1RBAA 3RR8A 2AZ3A 3PNIA 2HHHF 3W9IA 1S72S 1HWIA 5FIIA 2DY1A 1X4GA 2ZC3A 2RMLA 1FJCA 2WBMA 3GFZA 3J7AN 3I96A 5F8GA 5A6WA 2OELA 3ZZOA 1NHVA 3TJ9A 3CE8A 3MF5A 3KK3A 4I0WA 2JFKA 2ZBQA 3MM8A 1AXQA 3DDNA 3KLEA 5A2QU 1IKXA 2QTWA 4GO5X 2B6AB 4CT8A 4WIQA 3AA8A 5DGBA 1S6UA 3Q0AA 4WYWA 1ELOA 4PG8A 4QPXA 1CVJA 2WB4A 3F44A 2AZ1A 3TUIC 1RWUA 4IFVA 4AD6A 1YJWS 4PWDA 3OR2A 3IR7B 2CPHA 1RAEB 3ICLA 1HNVB 5I3PA 1PBUA 4K4WA 2A6MA 4LFCJ 4K5SA 4JV2A 4FPIA 4O3RA 2AJ1A 1CG2A 2B7BB 1ZYQA 2GIRA 4H4OA 3WIVA 1D9DA 1BGXT 2XZTB 2OO4A 3HZEA 4U7UD 1OQ6A 5F3TA 2MMYA 1SCJB 5IT4A 5KFRA 1V5VA 3MTKA 2FJXA 4F3MA 2FY8A 3SCIE 1YGYA 3SQOP 3G6VA 2F9JA 3BYPA 2E29A 2KZMA 4KPYA 2UXBJ 3KK3B 1RT5B 4IR9A 3TVYA 3MM8B 3KLEB 3RBEA 4F04B 4KGVB 1IKXB 1MWYA 2B56A 4IFYA 3MURP 3DOLA 3EZUA 1WG1A 3M9OB 3KJVB 2DYAA 4IQMA 2BJ9A 2BE2A 4XDDA 3QZ7A 2ZJQQ 3PVXA 1U6FA 2BM0A 1N48A 5KG7A 2XI3A 3QJPA 1OY9A 4IFVB 1PO6A 1T05A 4PWDB 2NXUA 3H4DA 4Y2CA 4HI2A 5GAHU 3DN9A 7FD1A 2VFRA 4FF1A 4KQZA 4DX7A 4MFBB 2W7AA 4KHPJ 1EKRA 4OV1A 2P8IA 4OLPA 4F36A 1LWFA 4USHA 2CQGA 2WW4A 3TRGA 4H4OB 4NZ7A 3LP1A 1Z4UA 3T19A 4WP9A 2V4RA 2MJNA 3HVWA 2OMLA 3LGMA 1YDLA 4OHVA 5B0GA 3OXFA 1GXUA 3TA0A 2V50A 2M4MA 2WVBA 2DD8S 2W4DA 4AUKA 4TYAA 4B9MA 4NRUA 4EEYA 4AL5A 4U67Q 5KFPA 1XBWA 2FHKA 3K17A 1X0FA 2IYGA 2HBZB 1RU2A 1ZOTA 1JMTA 3BBCA 2BABA 1NMEB 2W8LA 5IXUA 4CLTA 1YJRA 4IFYB 3TYTA 2DCLA 4FZVA 3A3PB 2NSBA 2HNZA 2WVDA 1T9TA 1DFDA 4ZS6A 2VOOA 4DR7J 4USMA 4E2FB 4I64A 2HIQA 2E1PA 4CLFA 4OLOA 4C6AA 4DUYJ 2OGUA 2QFJA 1NU4A 1NLKL 1Q0NA 4OX8A 4C2MA 2GZOA 4USVA 3PV8A 1T05B 2VC0A 1M1HA 2VDIA 2UUTA 2K3IA 4UUXA 2FZGB 4ECYA 2FZKB 3SBMA 1MU2A 1LWFB 4LF5F 5C24A 3UVJA 4FXWA 1VMBA 4DL5A 1RWPB 3R5BA 5DDRC 3V5RA 3K2YA 4LQ3A 1TFYA 4WCEQ 4CYUA 3ZZ0A 2KG0A 3FQLA 5THWA 2GO9A 5D4OA 3LP1B 4ELTA 5B0DA 2XMWA 2ROEA 1YLXA 3TA2A 4HI1A 3AT1B 4DFKA 2HQFA 3KLIB 4M63A 3ZNJ1 5J2NA 3Q8SB 2FJAB 3SCLE 3CF5Q 2HLUA 2ADCA 1RXOB 1F9FA 3H20A 2JLFA 4P52A 1JLBA 4DV7J 1R31A 1S59A 3G96A 1H7WA 5H9FJ 1K8AT 4RNMA 4DL3A 2QLBB 3RBXA 1NJZA 2H4YB 5T41A 3K5OA 4M5NA 2PA8D 4MIAA 2ZBRA 1X9MA 1IN0A 2JC0A 3DRRA 3UN3A 1FX2A 1YJTA 3UN5A 2A18A 2HNZB 2FC8A 2XCPA 4KGZB 3GG1A 3R1LA 4GO7X 3L3CA 5LT5A 3HFVA 5U47A 2W7OA 2WB1D 1TKDA 2HGMA 3MM6A 3PHEA 3AD9C 1WC5A 4ZIVA 3EYZA 4A8KA 1F5AA 2W9AA 3LP2B 1VQKS 2IDLA 2XC9A 3VALA 1MU2B 5LXRA 1HBNB 3IBFB 3UVJB 5C24B 2E66A 2XS2A 5KFNA 1TQLA 3RRKA 4CYUB 4FVCA 5K8MA 3EE3A 1MMNA 2V34A 4FF2A 4Q44A 4J7CA 3LWMA 1JB0C 4U8YA 1RADB 4ES1A 3PCOB 2JFDA 5J2NB 2XTJP 1ZETA 5DDPC 2YKAA 3DKDA 1ZS6A 2QSWA 2B3TB 4WF9Q 3VHQA 5KG6A 1NZAA 2V0NA 1JLBB 2KO1A 1QSSA 1VK8A 2RU9A 2V8DA 1D8YA 2D9OA 3TAMA 1Q7LB 3HHLB 3BBFA 2YKPA 5IV3A 1U09A 1GX6A 3G6XA 1X9WA 1CPZA 3DRRB 1B7FA 1RYRA 5EUHA 1RWMB 5HQLA 2D3UA 5K8PA 4K8RA 4DQSA 2J0QD 1HYSB 1BLUA 1RT6A 2C2EA 1Y00A 1WI8A 2N4DA 3ZZTA 4Y3CA 1RCOB 3G9CA 1HLWA 3MM6B 3SFGA 4I1TA 2X1AA 2R8JA 3U1MA 3UFCX 5ETLA 2CIMA 4DV3J 1PCAA 2W2OP 4LFBF 3B6BA 2HZAA 2ILZA 1TL3A 3KNAA 2DY9A 2GO8A 2BKPA 1RP5A 4DV1F 2AYBA 4NEZA 3OLBA 1RI7A 4DSJA 3PJ9A 5A0YA 4O0NA 1SBRA 5KT4A 4LRAA 4Z7YA 3PZPA 3MGJA 3PJWA 2QSFA 3RAQA 3X3UA 3D9BA 4LF1A 1S12A 1EQMA 1U1KA 1XK8A 2FVSA 1PC4A 4Z7CA 5HSPA 4C9DA 3SSSA 3G4SS 4CNYA 3MEEA 3J81Y 1VQPS 2RS8A 1N34J 1IWAA 1RABB 1IBMF 5K9FA 2GHVC 3W60A 3TAMB 4KFBA 2HBQB 1YKWA 2HVZA 1VR6A 4PEOA 3RTVA 4NLPA 1YRUA 2OJ3A 2ALYB 2A0FB 1QAJA 4A8MP 2CQ1A 2AYGA 3V81A 4ZKAA 5AJ3F 4DSIA 3JXOA 4CO1A 1VJWA 1QDUB 2RDDA 4CLWA 1RT6B 4B3MF 2DPIA 1BQMA 2R8GA 1RWXB 1XMBA 2YWEA 2HRUA 3BKFA 4DFMA 4RR5A 5KFSA 1S4EA 1XNQJ 3T1YJ 3KTQA 1ZAWA 2W2NP 1SIWB 4YOEA 4JI6J 3CJ5A 3KWMA 2AGPA 1OYEA 2X3DA 2ZKTA 2BZ2A 1WTBA 4KE5A 1TL3B 4JI8J 1HI0P 3R5CA 3AAWB 1RWVB 1T95A 2IIHA 1NXIA 3N5FA 2MQLA 5CD4A 1YBTA 3RAXA 2H65B 2CJKA 3KKFA 3HSGA 2ZOGA 5A0YB 4LFAJ 2YBVA 1ZZFA 3UPFA 5F9LA 2DEJA 3MFHA 1JNZB 1QAIA 1F2HA 1FJEB 4OL8A 3LGNA 1UW4A 1RTJA 1RYSA 4O3QA 4RNFA 5CHCB 3B8HA 1EX8A 2IVYA 5J1EB 1J5OA 5JUMA 2F4VJ 3GR0A 2HNYA 3MEEB 1IM6A 1XJWB 2ZEJA 4M94A 3TQ1A 5HANA 2MZQA 2Y8YA 4C97A 4FYYB 4NLDA 2MHEA 5LXYA 3W7BA 2DNHA 4JV1A 1XIQA 1U4BA 5F8IA 5L1JA 2DR9A 5LMUF 4L74A 2J8AA 1A7GE 1M5VC 2VQFF 1R0AA 1BUXA 2V4QA 1SH3A 1RT1B 3PEHA 4HH0A 2A3JA 4MKVA 2V5HG 3NCPA 2NR0A 2K06A 2M8HA 2X1FA 2ALZA 4DV2F 2HPUA 2BANA 3K8VA 2HFOA 3J81U 1BQMB 1B0TA 5DETA 2RIJA 1BMQB 3OV7A 1IQZA 3PRDA 1YQHA 3J80U 1N36F 3L4BC 4ECRA 2ZH9A 1L3SA 1B0VA 5BYRA 3FC9A 1R7IA 2KT5A 4LF8F 3MR2A 1IUJA 1O51A 3DM2A 3WC2A 1RCXB 4LSNB 3DDKA 3EM1A 2R7UA 1UJ5A 3OTEA 3SEOA 1U25A 1SC6A 2MKIA 2XI2A 4ECZA 1NSQA 3TUPA 3ZNUA 5F41A 2C2RA 3ILOA 5A76A 3BH6B 3HCXA 9ATCB 4HKQA 4JI1J 2AT1B 4C48A 3O5TB 2IM0A 4RLEA 2OPQA 2Q1LA 1Y0HA 2BW7A 1RTJB 4DFJA 4WBFA 1HNXF 4JI4J 1J5OB 1TAQA 2HNYB 2VL1A 4TY8A 5L9NA 5CABA 2DXFA 4DX8H 2KVIA 5K8OA 3TZZA 3G87A 2R7TA 3I9V9 5KFZA 4PRFA 3W8GA 3K5LA 1VFJA 3D68A 4J9UE 4O4GB 2QA2A 1R0AB 1DQ9A 4TU8A 3IM9A 1M5HA 3PTWA 4K50A 4M95A 1WSRA 3PX0A 4WJBA 3GQCA 5T14A 3G8SA 2Y1RI 2BANB 1X8DA 4M5MA 4LF9F 2YWHA 2DGOA 2BYCA 2EFVA 2Y1IA 2EPIA 4JI5F 5KFJA 1FRLA 1AFIA 2LU1A 1B4SA 4U6PA 2D3ZA 3PW4A 3MR7A 1U26A 3FSXA 4TNOA 4NLUA 2PSZA 2PIIA 5T7LA 2LP4A 4LF4F 4I2PB 2MGZA 4AFFA 1UCNA 1O0PA 4CO4A 4JI2J 5HQ8A 3AD8C 2I6WA 3GU0A 5GAHI 3AODA 1XC9A 4FXDA 4NLYA 1EKSA 2BX6A 2YQ1A 1EP4B 2QA4G 1DZ5A 1ROFA 2OPQB 5IWAF 3BKTA 3CJQA 2JLGA 2M8DB 4DV0F 4P2SA 2RRBA 5J2PA 2E7XA 1XWLA 3ZTPA 3CCTA 3VZHA 3W62A 5JXSA 5D3GA 2FVPA 4JI0J 4OYWA 2RE1A 3VGUA 1FNXH 3K5NA 5B7WA 1IKVA 3DRYA 4PQUB 1HMVA 1VBYA 3WIUA 3MEGA 4FYDA 4OYXA 3KUGA 4NASA 3GR1A 1YG0A 3G6ES 3SDEB 4CO0A 4FNHA 8RUCA 3BGUA 2VDHA 4K7QA 2C2MB 1WUUA 3BGOP 2XYHB 3KLFB 3JQJA 1JJ2R 4ZMMA 3OVAA 2RKIA 3OHAA 2XMAA 3IAM9 1U0HA 1JIHA 7AT1B 3L95X 2DPJA 2DIVA 4ZLPA 1WOPA 5KFGA 2B7CB 2QC3A 2KVQE 1KD1T 5T7LB 2WVCA 3KYLA 2RS2A 2MGZB 2JVRA 1XTZA 3BR9A 4B3TJ 3U27A 2GGPA 4RJVA 1UWAA 5BYSA 2V63A 2LXIA 5KFWA 2R2RA 4W4MA 2V9KA 2DJWA 1L3KA 1KVIA 3FBEA 3QIPB 4C0HA 2PMZD 1B0PA 2LKZA 5J2PB 2UXDF 2R42A 3V4IA 3X1LB 3H5YA 2DH8A 4U7CA 1GQEA 3L7UA 2SXLA 4Z37A 1T3NA 1IKVB 3GONA 3HDSA 1DJ0A 2QRRA 1HMVB 3M2VA 3GP9A 3A3NB 2R7RA 2OD4A 3MEGB 1HBOA 3R2DJ 1ACMB 5FD1A 4ZVQB 2XMJA 1S6OA 4BHQA 4QW9A 4OYZA 3OXGA 2ZBPA 4KYZA 4IOAQ 2B8QA 2BW2A 2FDNA 1AROP 4C11A 3H5UA 3W5ZA 1AW0A 3CIZA 3ITHA 4J9VA 4I7FA 2ZNZA 3HSZA 1S10A 1RBOB 1K1SA 5GMEA 1IWGA 2MZRA 3G8QA 3PKYA 3HULA 2RKIB 2V9WA 1NDKA 1WJ9A 1U0HB 1UFLA 3W65A 1P27B 2BJDA 2NZ4A 2DT9A 2UUAF 2B4OA 4BDPA 3SCJE 4ZVPB 1IBMJ 4AQYF 2BEFA 4L72B 4EU0A 2GGPB 2YH1A 4CDIA 2Q79A 5DRKA 2VODA 2XYGB 4USJC 2ZWOA 2DHSA 4QWDA 4RU2A 3CW2C 2B51A 2UUCJ 1TP7A 2DB1A 2MJUA 1MN9A 2DGQA 3D3BJ 2MDAA 4M5KA 4G3IA 3QRQA 5KOXA 1NDCA 1NNDA 2JL9A 3V4IB 4B3MJ 2DHGA 3NY0A 2Y0BB 5E3QA 1NKCA 2GJ2A 1R8BA 3K5PA 5ADZA 5L39A 2W24A 2RHQB 3M2VB 5IOLA 1DBDA 4D3GA 2HZVA 3MUTP 1HBOB 1FT8A 2XULA 1N8RT 3K8WA 2ZJPQ 2CZ4A 3KLHA 2X3GA 3P45B 3D4JA 1HBMA 2H48B 2IM2A 4C11B 3HP6A 2CWXA 4I7FB 1YWXA 1FWKA 4DUTA 4L6V3 1L3UA 2UU9F 1YJUA 2GA7A 1X7VA 3KDNA 2V67A 3NLCA 2VB6A 1A9NB 1FEHA 1OO0B 2XWYA 4F4YA 4PXBA 5I3QA 4QWBA 4NLRA 5C5JA 1HKAA 6AT1B 1J5EJ 1JWWA 4OZ1A 2VG6A 3MPWA 2U1AA 5HVGA 2AYMA 2ZOMA 3AB4B 1V3ZA 3T5KA 2JVOA 3PX6A 3CCVS 5LJ5Y 1YRTA 5CD4H 2FVQA 3BGFA 1EETA 4A4JA 1JLEA 3NP5A 1Y11A 2KZZA 1HPZA 3QAUA 4P7VA 3TX8A 2XHWA 2V68A 3QYYA 1IVZA 4CO2A 4N7TA 2QL7B 1NKEA 3E01A 2YQ0A 3HKWA 5D0EA 2Z30B 3EDRB 3DI6A 2Z4PA 2UVUA 3CCSS 4USKA 2XM3A 3GFHA 2D9PA 4PXEA 5KFYA 2ZZMA 4OX9F 2BBEA 5J2MA 2OEKA 1EHWA 4LF8J 2QGFB 3DRSB 4YY3F 1RKJA 1KQFB 4LREA 2KDOA 4DR2F 3KLHB 4KBIA 1WEZA 4O44B 4ILLA 1HBMB 1Q78A 3BQ2A 4ZVEA 4DQIA 3MI7X 5DZ6A 3TEHB 2BJEA 3SI8A 2W8KA 2V8PA 2WZ1A 1PAEX 3IWLA 2IDEA 4Y2AA 5DJBA 5G4DA 1HNXJ 2P9GA 3RW6A 4X4NA 3UE2A 4FKXA 4EBDA 2J6SA 4LRBA 3Q86A 2R9LA 2FUG9 3PHTA 2VG6B 1VQNS 5CYJA 5BR8F 4C4WA 1ITPA 1X4HA 4Q7AA 4BCAA 3D6FB 1CJKA 2R7QA 4TN2A 1EETB 2VBWA 3FMBA 1JLEB 1QLNA 3QT8A 2KU7A 3NOGA 1FXRA 4P2XA 1DTQA 3MUMP 4JOUA 4LF9J 2E5IA 3E01B 4F3QA 4KTQA 3DI6B 5KT3A 1WKLA 2EFNA 2UUWA 4R25A
chains in the Genus database with same CATH topology
1F2HA 1F3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2H A;  1F3V A; 
#chains in the Genus database with same CATH topology
 3W66 A;  5B09 A;  1WC3 A;  4WYL A;  4QU6 A;  4ECU A;  4Q43 A;  3BSA A;  2BJ3 A;  1N5Y A;  2AJF E;  2RAQ A;  3UDE A;  2P6T A;  5HVF A;  3JB9 k;  4JI3 J;  3A12 A;  4K59 A;  3DCA A;  1EJ7 L;  2VJU A;  2UVR A;  2B4V A;  4WU3 A;  4YUD A;  4DQR A;  2DGS A;  3CUL A;  2OTJ S;  2AYE A;  1Q5Y A;  4K0K F;  5L46 A;  1GMV A;  1DHM A;  1N5S A;  4PXC A;  2HSE B;  5CH7 B;  1X5S A;  2W2P P;  4ED1 A;  4X4U A;  1YBA A;  2MKJ A;  4A8S A;  3SFU A;  2MKS A;  4DUZ F;  2VPZ B;  3PW7 A;  3MMB A;  2NCK L;  2MKH A;  2W25 A;  1KNZ A;  2BQU A;  1RTI A;  5KG3 A;  4JB8 B;  4DR1 J;  3KLG A;  2HFV A;  1WOR A;  1NSP A;  3MMC A;  1FJ7 A;  1G1X A;  1MML A;  2BJ8 A;  3HT0 A;  2O1P A;  2LXU A;  4F25 A;  2XB2 D;  1PBA A;  1CBK A;  4R0E A;  1SJQ A;  4C0O C;  1TUG B;  2H54 B;  2IM1 A;  2QMX A;  4IDK A;  2MZJ A;  4NLV A;  2FTR A;  1RTH B;  3DFE A;  4Q0B A;  4KKO A;  5HJX A;  5ETS A;  4DF4 A;  1MRO A;  2AX0 A;  1N5Y B;  5DLG A;  2ZFH A;  2GQ2 A;  1TUW A;  3L09 A;  3HT3 A;  3LO3 A;  1DRZ A;  4NLG A;  2YX7 A;  5LM7 E;  4PCQ A;  2CQ4 A;  3PO4 A;  4LBI A;  3HJV A;  2IPO B;  2IAJ B;  3C15 A;  4O3S A;  1GMW A;  2IJN A;  1NUE A;  4C8K A;  3H2L A;  3VAM A;  1TMJ A;  2UVW A;  3NCQ A;  4GRS A;  2ZVS A;  5KAK A;  2CQD A;  4X64 F;  4EZ6 A;  1S9E A;  1FJG J;  1YX2 A;  3MMB B;  1QUV A;  3CDB A;  4PG7 A;  2LCW A;  2R7V A;  2BE9 B;  1Q82 T;  2KJV A;  3DC2 A;  1F9E B;  3LH2 S;  2DR6 A;  5GAE I;  1RTI B;  1JQG A;  4CH0 S;  1F2G A;  2MQO A;  3TA1 A;  2GML A;  4DFP A;  4ZPC A;  2OMO A;  2YWG A;  2ZOF A;  3MMC B;  5LMN F;  5DGA A;  3E51 A;  4B02 A;  4F4K A;  4CLS A;  1HHS A;  1LXN A;  3AFG A;  3BO2 A;  2EFP A;  1NJX A;  4IDK B;  1FCA A;  1M5O C;  1FRK A;  4ER8 A;  2LMI A;  4DSE A;  4Q0B B;  4KKO B;  2ZE2 B;  3MPD A;  3MM5 A;  1CUL A;  3QGH A;  2BOA A;  4ZLN A;  4F4Z A;  2C2N A;  4JUZ A;  4UOF A;  2PC6 A;  4GVB B;  4AL6 A;  4PAB A;  1WC0 A;  5LSO A;  1RWN B;  5KFQ A;  1VRQ C;  3OXL A;  3RZA A;  5I3U A;  3RU0 A;  4BC7 A;  3N6M A;  2H3E B;  5AT1 B;  2VPW B;  3A8K A;  2W4C A;  3C15 B;  2C1E B;  4J90 A;  4CI0 B;  2VUG A;  3QPI A;  1T8E A;  3MUV P;  2JEG A;  4TYB A;  2W9C A;  3QGI A;  3TWZ A;  4ILM A;  4DSL A;  1UFW A;  1S9E B;  3D0I E;  2M52 A;  1VC5 A;  4WZQ A;  2DH7 A;  3IG1 A;  3OTB A;  1LQ9 A;  5IV4 A;  2JHE A;  5D6G A;  4UZC A;  2PEH A;  4CIO A;  3UN2 A;  4A46 A;  2KI2 A;  4ID5 B;  2DGT A;  3D5M A;  4LF7 F;  1NM2 A;  2I1R A;  3FBC A;  4M5J A;  4CP5 A;  3OL8 A;  2Z0G A;  1Q8I A;  3MPY A;  3C14 A;  1CC7 A;  3BB5 A;  3M8Y A;  5GAG I;  1RAO A;  5D0R A;  3FBF A;  2ROP A;  1S0O A;  1SIZ A;  2F3J A;  2D74 B;  2JEJ A;  3ET6 A;  3HMJ G;  1UVK A;  1KC8 T;  4WK3 A;  2OI2 A;  4PKD B;  4O23 A;  3I0S B;  1Q4R A;  3KUH A;  4LJM A;  3AHP A;  2FGO A;  5HP1 A;  1CUL B;  4HDG A;  3EPI A;  1OPZ A;  3ZZR A;  3Q8R B;  3CJ4 A;  4I56 A;  2DHX A;  4ES3 A;  2MLX A;  4F2R A;  3VQT A;  2VBX A;  1SI9 A;  5KT6 A;  3CCL S;  1G4C A;  4DF8 A;  2XZW A;  2CPX A;  1R8H A;  3T1H J;  1N32 J;  2DO4 A;  1NSK L;  2W9C B;  5CZX A;  1FRJ A;  3EZ5 A;  3T5J A;  3QRR A;  2XMT A;  4ZVR B;  2FHJ A;  1FFG B;  3CVK A;  4XPE A;  4ZVG A;  3B82 A;  1YTY A;  4KSE B;  2YPZ A;  4ED6 A;  3IG1 B;  1M0S A;  1SQE A;  4RW9 A;  3QAT A;  2Y8W A;  4IG3 A;  1IQT A;  4G65 A;  3GZ7 A;  2CNL B;  4H4M A;  1A0O B;  2BUN A;  1VIO A;  1I94 J;  2HRT A;  1N33 J;  2B4P A;  4M5L A;  2LA6 A;  2YNF A;  2NUU G;  2BR0 A;  1VK3 A;  1UZH A;  3C14 B;  1L5U A;  1SL0 A;  3QRP A;  3QID A;  1NJW A;  3O3L A;  1BE4 A;  4OI3 A;  5DG8 A;  3QGG A;  3KG4 A;  3ET6 B;  1FFS B;  2XO7 A;  3H25 A;  1RWO B;  2EK1 A;  1R0C B;  1VQO S;  1JX4 A;  2B9E A;  3IRX A;  2K1R A;  2Q6B A;  4N5S A;  3NEK A;  3FNN A;  4TXS A;  5HP1 B;  3RB0 A;  5DQI A;  1R0B G;  3RUB L;  3C6U B;  3ENA A;  2QYC A;  3KG0 A;  5HAO A;  3P6Y C;  3LPE A;  2Y1L B;  3OTO F;  1DQ8 A;  4DLE A;  3DNC A;  3EX7 B;  4B9U A;  3G86 A;  1CJT B;  1FFW B;  2XEX A;  1L3V A;  1K73 T;  2NYH A;  1PKU A;  2CQC A;  3R5D A;  4XIU A;  1X4B A;  3NGR A;  4MKY A;  3KHR A;  3VAF A;  2VG5 A;  1ZAV A;  4B17 A;  4P2M A;  2G2O A;  3W9J A;  3T6B A;  1UMJ A;  1VQ7 S;  4RW9 B;  3DLJ A;  1KKH A;  3D6T B;  4N56 A;  4IG3 B;  3R7N B;  2P9E A;  3QNW B;  4NYO A;  1MNE A;  3QFH A;  1QE1 B;  4H4M B;  3HXM A;  3GIJ A;  3I4H X;  4OIX A;  4NLS A;  1F1B B;  1VOM A;  4F3O A;  2Z58 B;  2XWX A;  2YNF B;  4URG A;  3QFW A;  1FER A;  5HVH A;  3AJ1 A;  4DG1 A;  4BS2 A;  2E5G A;  2E5L F;  1Y3K A;  5IC6 B;  1LFP A;  4OZN A;  1X4C A;  1PJ7 A;  2A10 A;  3MR3 A;  2XY7 A;  2GVD A;  1O8B A;  2PFF B;  2K1R B;  3GIR A;  3KXD A;  1FRX A;  2Y3Y A;  1RSC A;  4PAA A;  4JI7 F;  3OSN A;  1WTF A;  4ZPW R;  4LF6 F;  4B9T A;  2K7J A;  2V2K A;  3JS9 A;  1VQL S;  5KFI A;  4JBC A;  1WF2 A;  2EWH A;  1SXL A;  3JTO A;  4XAK A;  3TJA A;  4TKT A;  2FIU A;  2AGO A;  2VFS A;  3DLE A;  2ZH8 A;  2PN6 A;  2VKZ G;  2EW9 A;  4BBY A;  3F41 A;  1NK0 A;  4EGL A;  3VGS A;  4YFU A;  2DR5 A;  1UA0 A;  1AA1 B;  4OX7 A;  1CQN A;  2AX1 A;  3IA0 A;  2YX1 A;  3OW2 R;  3TOQ A;  4DR5 F;  4AXI A;  3PFO A;  2VG5 B;  2QX0 A;  4Z2X A;  2ZH3 A;  1WC4 A;  3HF5 A;  1FXL A;  4FN5 A;  5KG0 A;  3CDA A;  1KTQ A;  4P72 A;  4ZDN A;  3AA9 A;  3BN4 A;  4CLP A;  3KK1 B;  4ZPV R;  2H5I B;  2LEA A;  4DR3 J;  4OYI A;  4LBP A;  4LT6 A;  2NLW A;  1W26 A;  3R1H A;  2ZKU A;  3CJK A;  2XMK A;  4DZD A;  4DG1 B;  5F8H A;  4ED3 A;  3OHB A;  2DR8 A;  4CLZ A;  1BQX A;  2RSQ A;  1T03 A;  4X65 F;  5BJR A;  1UZD A;  3OBI A;  2O5D A;  5B0E A;  1FKO A;  2CPY A;  4DV5 F;  3ZXW A;  4JV5 J;  2KRR A;  3M8R A;  5CCL A;  4QR0 A;  2ATC B;  1FI4 A;  2UUB J;  2EFG A;  2UVV A;  5L8R C;  4KHR A;  3FGV A;  1XNR F;  1N5Q A;  3BGL A;  5KFE A;  3M6X A;  4OMF G;  3GJT B;  1NKB A;  1WEL A;  5IM0 B;  2FLN A;  4OYA A;  2AEJ A;  1CQM A;  5LMN J;  2H4W B;  4LR8 A;  4X62 F;  3P96 A;  5AE1 A;  2WRM A;  2PI4 A;  4QU7 A;  4ZVF A;  2M0G B;  3VVU A;  5I4M A;  4PPD A;  1S1V B;  1CLF A;  2RD5 C;  5HI7 A;  2MLY A;  2IM3 A;  1VQ8 S;  2OFH X;  4ZP7 A;  2B5J A;  4NX9 A;  2YNG A;  1SL1 A;  4LVN P;  1EQ0 A;  1TKZ A;  2J7K A;  3HZG A;  2MPU A;  4ES2 A;  1UPP A;  3TO8 A;  1LEO A;  3BSN A;  2FZC B;  1X31 C;  2ZNY A;  5M2U A;  3NGD A;  1C1C A;  4ITS A;  4I67 A;  3CJK B;  4IG0 A;  4NMX A;  4OJ3 A;  3S1T A;  3CIM A;  1KHW A;  1M5S A;  2V69 A;  1S0N A;  2GJI A;  2RNE A;  3ENV A;  1CS4 A;  5HO4 A;  3NNC A;  3QZ8 A;  1NPR A;  1T03 B;  3HKZ D;  3W8P A;  2R4F A;  1X4E A;  3NXZ A;  5BXI A;  3WBZ A;  3ZZZ A;  3PXG a;  1FKO B;  2HHP A;  3JSM A;  2KKH A;  4NXM J;  3FZB A;  1NK8 A;  1PJ6 A;  3UCZ P;  1FRI A;  3U1L A;  4FBU A;  3CNQ P;  4TY9 A;  2WON A;  4R5P A;  4EK2 A;  4YHH F;  3GE9 A;  4YB1 P;  1RHQ B;  1HD0 A;  4HVZ A;  2DRD A;  1IKW A;  1C1B A;  4RKU C;  1WEX A;  2YWK A;  4EUV A;  2VH7 A;  3U1N A;  2AD9 A;  1FVQ A;  3ISN D;  2GQQ A;  5CCM A;  1H98 A;  2FYX A;  4CWB A;  1XMQ J;  4ZHR A;  4B3S F;  3IC1 A;  3A8J A;  3BSC A;  3MM7 A;  2C2O B;  2XMU A;  4EWT A;  1R8P A;  5ETM A;  3US5 A;  3R97 A;  1PJ5 A;  3FEX B;  4TU7 A;  4DV6 F;  4R8U A;  5M2P A;  1RAA B;  3GV8 B;  2B5J B;  2QE5 A;  2YNG B;  2PA3 A;  3PW5 A;  2ZM6 F;  1OSD A;  3JTP A;  3PEJ A;  2CPJ A;  3I31 A;  4WXW A;  1WG4 A;  3R7S B;  3UCU P;  3CCZ A;  1SC1 B;  1C1C B;  1S9F A;  3QAE A;  4IG0 B;  3OPK A;  2HW3 A;  3Q8V A;  4Q2M A;  1H74 A;  5AXL A;  1CS4 B;  1KFD A;  3ELH A;  5KG1 A;  2XY5 A;  1RHK B;  4DR6 F;  2N7Y A;  3ZTQ A;  2CQP A;  3JSM B;  4LRF A;  4Q2L A;  4TLR A;  4DSK A;  3IXQ A;  2XG8 A;  4YDD B;  1EIY B;  2MQP A;  2ZBI A;  3H5S A;  4R5P B;  4E98 A;  1HWK A;  1YSJ A;  4DV4 J;  1HQE B;  1I5O B;  3OLA A;  1B7Y B;  5DDQ C;  3UWT A;  3UDL A;  1C1B B;  3OJS A;  2ZHA A;  4J9P A;  1IKY A;  1P6T A;  3D2W A;  2VFU A;  2ZZT A;  4OFZ A;  2DNL A;  3S7R A;  4F0M A;  1UEK A;  3TW0 A;  1U45 A;  2KXN B;  2L41 A;  3B78 A;  4ZHR B;  2NRE A;  3IN5 A;  2P9C A;  1RT5 A;  4C8M A;  3MM7 B;  2A2D A;  4QCL A;  2QO3 A;  3V6D A;  2DK2 A;  5EN1 A;  2AEM A;  4R8U B;  3MAQ A;  3KJV A;  1WAC A;  4C8L A;  2E1R A;  3M6U A;  3MD1 A;  2V8H A;  1QAX A;  3OFF A;  5HMZ A;  2ZH1 A;  1V3S A;  1Z1Z A;  3MCO A;  2J6T A;  4I4B A;  4LUB A;  3OL6 A;  2IJR A;  1AUS L;  2RHS B;  1EB0 A;  4NZ6 A;  2GIQ A;  2XNR A;  2QLW A;  1GMW D;  2WTF A;  4RW4 A;  1AFJ A;  2JDJ A;  4MFB A;  2KM8 B;  4B9S A;  3OTO J;  2CFX A;  5E3A A;  4FXV A;  1D9F A;  4YB7 A;  1QVG R;  2AU0 A;  1M90 T;  3LP0 A;  3CSK A;  4PR6 A;  2J76 E;  1RTD B;  1Q8B A;  4HHJ A;  4MIW A;  4IRC A;  3DLG A;  1QAY A;  3VF0 B;  2L3M A;  3LUY A;  5DM6 Q;  3E8O A;  4QOT A;  1SJ4 P;  2C2K B;  3HD2 A;  2DNM A;  3GV7 B;  1GNK A;  2QMW A;  4RBU A;  5J1P A;  1U1P A;  4CNZ A;  2GS8 A;  4ZVH A;  4I69 A;  1ZTW A;  2HUR A;  4DL0 C;  3DDI A;  1IKY B;  2BQR A;  1S48 A;  2LVW A;  5KFM A;  1F0X A;  2QEX S;  2HBY B;  5F8M A;  3QO9 A;  3CJ2 A;  3V4M A;  2V8G A;  4ZPT R;  3C2P A;  4I2Q A;  3V6D B;  2YKO A;  3GSI A;  1IR0 A;  1IBL F;  3H8Y A;  3FSI A;  1VBK A;  2E9Z A;  2CPF A;  4HTJ A;  3O44 A;  4B3R F;  4ELU A;  3RRG A;  1TK0 A;  2CNO B;  3MD3 A;  3C16 A;  1QM9 A;  4L76 A;  3C19 A;  2HQ3 A;  3LW5 C;  1HA1 A;  5AE3 A;  1YHQ S;  3O8W A;  4Y2K A;  4OI1 A;  1VQS A;  4RW4 B;  2BOP A;  3THV A;  1V3R A;  2VAS A;  3B4D A;  4V19 X;  3IAS 9;  1KQS R;  4EYH B;  2MSS A;  4YME A;  2G13 A;  3EDQ B;  4OV6 A;  3DRX A;  4MKA A;  2DNR A;  4PG6 A;  4NXN F;  3LP0 B;  2VG7 A;  4CH7 A;  1VI7 A;  4WFZ A;  3CCJ S;  1B70 B;  5KOW A;  4KY3 A;  2LEB A;  3CC7 S;  2CJQ A;  2QZ8 A;  4IO9 Q;  3DLG B;  3P4U B;  1PC5 A;  2AWZ A;  1S6Q A;  1IBK J;  5DDO C;  2G1H A;  1FXD A;  1YK9 A;  5AE2 A;  1VLO A;  4NA1 A;  2CVE A;  4L75 A;  1Q95 G;  3KLI A;  2YVS A;  2MKK A;  5HJY A;  3DU5 A;  3CCU S;  1HFE L;  2CPE A;  2RIL A;  3BEG B;  3Q83 A;  4DN9 A;  1PG5 B;  1N5T A;  3BRE A;  1LFW A;  4U9R A;  2C3U A;  4AYB D;  1MWQ A;  2HS0 A;  2OIH A;  1FWL A;  3D1O A;  4ZCI A;  3VVT A;  2JWN A;  3QO9 B;  2CPI A;  2G4B A;  3AJ2 A;  3H42 A;  3IFE A;  4HLB A;  2ABY A;  3QGP A;  2VA3 A;  4XTT A;  2DNN A;  4I2Q B;  3PW0 A;  4WP3 A;  1VHI A;  3DGP B;  4ZVU B;  4X65 J;  2Y9H A;  1UAW A;  4J9M A;  2KG1 A;  1RWK B;  4NCG B;  3FRZ A;  4X66 F;  2CQ3 A;  5F8N A;  3FK4 A;  4USU A;  3JAM Y;  1Q86 T;  4OI2 A;  4KGK A;  2XQC A;  1GT8 A;  2LQ5 A;  3C16 B;  5IQ6 A;  1UEU A;  3EWG A;  2FJE B;  4OZ5 A;  1SC4 B;  4WTY A;  4OJ1 A;  1T0T V;  5GAD U;  4JYA F;  3HLU A;  3IGV A;  4F0K A;  2FJW A;  3LP2 A;  1HBU B;  2CXE A;  2HHW A;  3WC0 A;  4KGM A;  4NLO A;  1XNR J;  2FHJ D;  5K14 B;  1HBN A;  2VG7 B;  3F0N A;  3CUN A;  4ID8 A;  5FLX Y;  1YIJ S;  2I0X A;  4FYW B;  3RGI A;  5DO2 A;  2LEP A;  4ZCL A;  1S6Q B;  4CTA A;  1Q5V A;  5C25 A;  4K2J A;  1RT4 A;  1KQG B;  3W9H A;  1NO8 A;  3CT9 A;  1GXL A;  4ECS A;  2V2Z A;  4URQ U;  2VQE F;  1MSW D;  2R2S A;  4RUA A;  2HMI B;  4YS2 A;  1XR7 A;  3MR5 A;  3CCE S;  3DU6 A;  4RW7 A;  4NE9 C;  1DY3 A;  2RT3 A;  3NMA A;  8AT1 B;  2KYX A;  3HHL A;  4O3N A;  3R5J B;  3ENW A;  4FP9 A;  2VKR A;  3M32 A;  2YKQ A;  1X5T A;  4X4R A;  1N54 B;  2G0J A;  1ZM4 A;  4F8R A;  1KOO A;  1X0P A;  4Q45 A;  1ULR A;  3PR4 A;  3I5A A;  3NGT A;  4Y65 A;  5J2Q A;  4IH6 A;  1RAF B;  1RIS A;  1HYS A;  3JSY A;  5HMY A;  2RF2 B;  3MWB A;  1SQG A;  1T9W A;  1HIY A;  2QN6 B;  3MZI A;  2NYI A;  2NPF A;  4QIW D;  4DR4 J;  2CRL A;  5J1N A;  3JSR A;  1OY8 A;  4OYO A;  4KR0 B;  3SYZ A;  4P71 A;  2W01 A;  3BGR A;  4W98 A;  2R3V A;  3TI0 A;  4H4K A;  2ZUG A;  2PT0 A;  4A48 A;  2XLJ A;  1YJN S;  9RUB A;  4N41 A;  4QBU A;  3JAM U;  4B3S J;  4CTA B;  2HS4 A;  4R0J A;  5C25 B;  1IM4 A;  3KUE A;  4KRW A;  4IRD A;  1RT4 B;  3EUN A;  4MKB A;  1M5P C;  4RL1 A;  1AB8 A;  4AE5 A;  1SV5 A;  3A1Y G;  4GKJ J;  4MH8 A;  2ZM6 J;  2XBP A;  5ETT A;  1TK8 A;  1RZM A;  1OPI A;  3FKB A;  4LFC F;  2QL9 B;  4HH1 A;  3M1V A;  2J9C A;  3R5A A;  5FLX U;  1G2E A;  2OD6 A;  4RW7 B;  3SSQ A;  1S1X A;  4X84 A;  3O6Q A;  3JSB A;  1UKU A;  3M32 B;  5F0U A;  2JEI A;  2WSE C;  3SXL A;  2PD1 A;  3Q8Y A;  1S6P A;  3VWS A;  1KON A;  1KP6 A;  2MY8 A;  2IBO A;  3UNG C;  5J2Q B;  5HBM A;  4LMZ A;  2YKM A;  3O1L A;  3QMQ A;  3O2I A;  2JC1 A;  3J81 j;  2GAG C;  2ZH4 A;  4ED4 A;  3CDW A;  3P49 B;  1NB2 A;  1Q79 A;  2UXB F;  2QLF B;  5IS2 A;  2G0C A;  3ZTS A;  1S97 A;  1YVF A;  2LQJ A;  3LF0 A;  1SUQ A;  8ATC B;  2HHH J;  2J8S A;  2ADB A;  3BGR B;  1FX4 A;  1EAR A;  3MMJ A;  4ZJO A;  2AGQ A;  4Y28 C;  3CED A;  5DLF A;  4Y6I A;  3GTY X;  4DQQ A;  3Q23 A;  2MB0 B;  2WW8 A;  5DG9 A;  2KT3 A;  2AV5 A;  4UST A;  1SV5 B;  3D67 A;  2YKN A;  5K5M A;  3BZQ A;  2YWF A;  4MT1 A;  3GV5 B;  4KHP F;  1EZZ B;  5J1E A;  3N6N A;  3M1V B;  4DL4 A;  1ZZN A;  4Q5V A;  4C98 A;  4NRT A;  2ZZN A;  4IOC Q;  3ISN C;  2ZH7 A;  1S1X B;  2VF3 A;  4RZR A;  2C2Z B;  1B3T A;  1N5V A;  2MST A;  1FKP A;  1LW2 A;  1B99 A;  4P10 A;  5KG5 A;  3UD5 A;  1S6P B;  1RT1 A;  1U0S A;  4FS2 A;  3NL0 A;  2FHM A;  4ED5 A;  3JQM A;  5HBM B;  4WFX A;  2VBY A;  2YKM B;  4RW8 A;  1TZ0 A;  5RUB A;  2XGP A;  4I6Y A;  4P74 A;  3BV8 A;  3UD4 P;  1FK9 A;  3AXK A;  3RG6 A;  2I5J B;  3RRH A;  1F3F A;  2OFG X;  4HAC B;  2D1C A;  2M88 A;  1U2R A;  1SUQ B;  1S76 D;  1FE4 A;  2F5G A;  1S57 A;  2CZV C;  4UW2 A;  4LSN A;  1C2P A;  3G71 S;  3DLB A;  4DR7 F;  1RGV A;  1X9S A;  4P75 A;  1GX5 A;  4QJV A;  4GKK F;  1U48 A;  2CJA A;  3VV2 B;  4IH5 A;  4QWC A;  4DLG A;  5D8H B;  3M8Z A;  1IBL J;  4DPW A;  2GVZ A;  5KFU A;  2AF6 A;  1TU0 B;  4EBC A;  4KH1 B;  3GFY A;  3D1H A;  2YKN B;  2XHC A;  3Q22 A;  3RB6 A;  3J7Y I;  4NI2 B;  4E0D A;  3CDU A;  3H5X A;  2CNK B;  5E0O A;  2FLL A;  4HTI A;  3SQG B;  2HVH A;  1TKT A;  1IR2 A;  2AP6 A;  1NAQ A;  1SJ3 P;  2IFX A;  2F7V A;  1V6H A;  4YEA A;  2HKE A;  4A8Y A;  1T7P A;  4O4G A;  2E44 A;  4DN0 A;  1JLQ A;  1FKP B;  2XZD B;  1LW2 B;  4WZM A;  4NXN J;  2EI5 A;  3KJF B;  3K5M A;  2XLI A;  2MKC A;  1H0H B;  2QYG A;  2J6U A;  4ZN3 A;  5KFK A;  1TMM A;  4RW8 B;  5KFB A;  3HVA A;  4DV7 F;  1K0T A;  1FK9 B;  4WFY A;  4KPC A;  1VHF A;  3TJ8 A;  3DLK A;  1H2V Z;  4DMZ A;  2FC9 A;  2HK2 A;  1M1K T;  1R8C A;  3GCX P;  1VYA A;  2C42 A;  1FEE A;  3QWU A;  1P1T A;  2DGU A;  1ICE B;  4YR2 A;  3DRP A;  1RAG B;  3ULH A;  4I2P A;  1WOS A;  1KDN A;  4HL9 A;  4ICL B;  1GK8 A;  5F8L A;  2HWT A;  1RT7 A;  3GYX B;  4ETZ A;  3NWG A;  4A8W A;  3PR5 B;  4RBV A;  1FTC A;  2D7S A;  4F26 A;  1EP4 A;  2JLE A;  2F40 A;  2GVZ B;  3T3F A;  4F2S A;  4DPT A;  4K4U A;  3NBP A;  1K44 A;  1O6X A;  2GW8 A;  5CA5 A;  1JXV A;  5D0G A;  3I5B A;  2QLX A;  2FPH X;  4LR9 A;  2VON A;  2J9D E;  4DWI A;  1TKT B;  1TKX A;  2M9K A;  4DSF A;  1ZA2 B;  1PIE A;  2FJV A;  6FD1 A;  4PQU A;  2LQB A;  2RH3 A;  3V2U C;  4G6V B;  3EPG A;  1R3N A;  3OTD A;  5D4P A;  2X1B A;  3IRW P;  4PG5 A;  3I5C A;  1JLQ B;  1JLC B;  2DXD A;  4LF5 J;  3GJR B;  3RBD A;  4LVO P;  1NPK A;  3SDE A;  3CO0 P;  3THT A;  3VAG A;  1DLO A;  1QSL A;  2IA0 A;  1JKH A;  1WDT A;  1MLA A;  5GMD A;  2RVJ A;  3KLF A;  1NBE B;  1UEV A;  1R6V A;  2F8M A;  2GMH A;  4QYZ J;  1E6V B;  1ZH5 A;  2GAH C;  2QFI A;  2VQE J;  3DLK B;  3GPA A;  4JP8 A;  1B64 A;  4YN3 B;  4ZP8 A;  2HHX A;  1T02 A;  4C0B A;  2OEM A;  4ETX A;  3VZI A;  3DRP B;  2CAJ A;  4PYD A;  3CD5 A;  3BDE A;  1RT7 B;  5DQH A;  2JH3 A;  1VLY A;  4KT0 C;  4DCP B;  1FF2 A;  1V9O A;  3N01 A;  3PG9 A;  3ILI A;  4UOC A;  3G6Y A;  2PEB A;  5SZT A;  2QIF A;  1UVN A;  3NBP B;  1H6K X;  1N52 B;  5MAO A;  3QIP A;  4Y0F A;  2IJF A;  4Q8E A;  1KLN A;  4O3P A;  3H0P A;  4X2B A;  2RQC A;  5EHH A;  3EXY A;  1TKX B;  4CM2 A;  3BPS P;  1RTZ A;  2KFZ A;  3KLV A;  5D78 A;  1U6Z A;  3DMJ A;  3UO0 A;  4CRJ A;  1TTH B;  1RHU B;  4H54 A;  1FWP A;  4X4V A;  2HFZ A;  3ILJ A;  1HHQ A;  1KBR A;  1A6L A;  3PY8 A;  4OI4 A;  1HQ2 A;  3AB2 B;  4RUC A;  4MIB A;  2DNG A;  2K2P A;  4QYR A;  4DX5 A;  5E3P A;  3ZZU A;  1DLO B;  3FJ2 A;  1RA7 A;  2F1F A;  3GIL A;  1IJF B;  2HQD A;  1JKH B;  4LIW A;  2BMB A;  4QQB A;  1N34 F;  1N6Q B;  2C3P A;  5ETR A;  2F8H A;  4WP8 A;  1QSY A;  1K47 A;  2L9D A;  1KOH A;  3NG8 A;  4CQ1 A;  2CDQ A;  4CLL A;  2C22 A;  1AZS A;  4GC6 A;  3BO3 A;  1LK7 A;  5CAA A;  3QT7 A;  4IH7 A;  2X1G A;  1O5J A;  2QV6 A;  5A8W B;  2FVC A;  3GB0 A;  3FEZ A;  4WKY A;  5GAD I;  3IR6 B;  3HJF A;  3D6M B;  2NQP A;  1S1T A;  1GTE A;  3SMZ A;  1DTT A;  1I51 B;  4CO5 A;  3R27 A;  1XNQ F;  3T1Y F;  2HHQ A;  5AXN A;  4M5H A;  2DGX A;  4DXL A;  2E1M C;  2X7I A;  2FQQ B;  4NCA A;  4JI6 F;  1YZ7 A;  4FYV B;  3POT A;  2EBG A;  5F9N A;  1S77 D;  2M7S A;  2XSJ A;  2C2D A;  4U8V A;  1TK5 A;  4JI8 F;  2DXE A;  3EGW B;  3K7R A;  3S01 A;  3BYR A;  4E8U A;  5H9E K;  3DMJ B;  2PO4 A;  4W92 B;  1LWE A;  4P7T A;  4A8F A;  3KG1 A;  4LSZ B;  5E5N A;  2YTC A;  3R9L A;  4LFA F;  2K8G A;  3DOM A;  4OZJ A;  4LFB J;  2EEY A;  3IMQ J;  1JXE A;  1W7W A;  3MMA A;  4DV1 J;  3VGV A;  3NAH A;  4M8L A;  4HHH A;  4XK8 C;  2QMU B;  5CQG A;  2BKO A;  2EFO A;  4LQ9 A;  1FE0 A;  3JTN A;  4I6W A;  1WF0 A;  4Y00 A;  2F4V F;  1VQM S;  3PYE A;  3Q2S C;  2P6S A;  4DS4 A;  2R8K A;  5KG4 A;  5F0W A;  1R43 A;  2Z2L A;  4EMD A;  2GNK A;  1GTH A;  3OR2 B;  2FLO A;  5IFM A;  1HAR A;  1AZS B;  4UTG A;  4ZVT B;  4ECT A;  3AOC A;  4MTP A;  1NDP A;  2L9N A;  2MHN A;  1SJF A;  2PMH A;  3C3L A;  4F7V A;  4K4Y A;  2HQG A;  1OSC A;  2HVE A;  3I32 A;  2YX4 A;  2MQN A;  1S1T B;  3BH7 B;  1RLD A;  3AY0 A;  3HHK A;  1DTT B;  3HO1 A;  4LRD A;  1MN7 A;  2N4C A;  2V4J A;  3NOC A;  5AJ3 J;  2J0W A;  2HQC A;  3EZO A;  3POT B;  4X4S A;  1HWJ A;  5CYM A;  2XSJ B;  4WFB Q;  3HK2 A;  1FD2 A;  2C3M A;  3DYA A;  2CJX B;  3BQ0 A;  5D15 A;  1SL2 A;  1U2C A;  1LWE B;  1HW9 A;  2U2F A;  1TUV A;  2XMV A;  3IM8 A;  2ROG A;  3TQE A;  3DOM B;  5HL7 Q;  1OS5 A;  3DRS A;  3DOL B;  3VR1 A;  4JI1 F;  2B43 A;  3MMA B;  5D0H A;  4O44 A;  1OJ4 A;  2BE2 B;  3F73 A;  4OHY A;  4GKK J;  2WVE A;  4JI4 F;  3B4M A;  2AHO B;  3DXS X;  4O0I A;  2MY7 A;  1W2I A;  2HWH A;  3M8W A;  4LIR A;  1PYO B;  3HHL D;  2AJ4 A;  2VHG A;  4B9N A;  2E5H A;  4UOG A;  3PYG A;  4M5G A;  2RDI A;  4X4O A;  2RUS A;  2UZA A;  2RQM A;  1RHR B;  3ZZY A;  3EGV A;  4K4T A;  2ZHO A;  4IQX A;  4AXJ A;  5LMU J;  2HLT A;  2VQF J;  2YWW A;  4YQW A;  2DHA A;  1LW0 A;  1TVR A;  3DOK A;  2JEF A;  2V4J B;  5I42 A;  2KFY A;  3SIP B;  1MMD A;  4DV2 J;  1FNM A;  5IT0 A;  1FVS A;  1RT3 A;  4AND A;  3MCN A;  5CYM B;  1UL3 A;  4YDX A;  3TEG A;  3HFK A;  3L7P A;  2COL A;  1UW9 A;  4KAI A;  1H7X A;  1F5B A;  3DYA B;  3CPW R;  3V6K A;  1U47 A;  1N36 J;  2M3D A;  1FD8 A;  1YI2 S;  4JI2 F;  3M9M B;  2KXH A;  3VGT A;  4NL5 A;  2G1D A;  3FFI A;  5CZV A;  2YQ3 A;  5DG7 A;  3R5G A;  2Z2Z A;  4CLK A;  1URR A;  1RKI A;  2FVR A;  2LEC A;  2OHD A;  2OSR A;  3NS7 B;  3IBW A;  5DS7 A;  3UDC A;  1KVJ A;  5B0B A;  2XY6 A;  3GMG A;  5EX3 A;  4JI0 F;  4ED0 A;  3ZC4 A;  4C3M A;  2DKO B;  3I82 A;  3VAH A;  2JJ4 D;  1ZA1 B;  3CMA S;  2W7P A;  2QA4 S;  2KJW A;  2BV3 A;  3A8I A;  1G7C B;  1MW7 A;  2DBB A;  1F60 B;  1WKJ A;  3Q8Q B;  4PWU A;  4J9R A;  2E9R X;  3DLH A;  2EC0 A;  1X5O A;  4B08 A;  1LW0 B;  1TVR B;  3OFH A;  3DOK B;  4NML A;  4NZ0 A;  5HMX A;  2C3Y A;  5I42 B;  2DNK A;  3AJD A;  2J0X A;  3R3T A;  1RT3 B;  1S49 A;  2JRS A;  4O3O A;  4QYZ K;  2EKY A;  1RTH A;  4JI5 J;  1HNW F;  4C3K A;  4B3T F;  4B9L A;  3A8E A;  2YNI A;  2RJZ A;  3BM7 A;  3FFI B;  1ZAX A;  1KHV A;  1UVJ A;  4LF4 J;  2HRY A;  3FVY A;  5KFD A;  1VBZ A;  2FHO B;  4A8O A;  2FB0 A;  3KMQ A;  4J9N A;  3KFW X;  4ERD A;  4RWW A;  3KHG A;  1Z2Z A;  2I38 A;  4NLT A;  2DNY A;  1U1L A;  2IAJ A;  4ELV A;  3NGS A;  1FO1 A;  3I9Z A;  4FKY A;  5IWA J;  1S7H A;  4DV0 J;  1CJU A;  2V8V A;  3WDO A;  2FGC A;  2RDJ A;  3HD1 A;  2GFF A;  4MK8 A;  3MAA A;  5A8K A;  1IBC B;  4ED2 A;  3M2U A;  2EBE A;  2BJ7 A;  4J9Q A;  1WC1 A;  1SB6 A;  2KL8 A;  1FHT A;  1TV6 A;  2BXJ A;  2R7W A;  3P8B B;  1OQ3 A;  4A8Q A;  4TQS A;  2YXL A;  5CYQ A;  2EG2 A;  2Y0S D;  2KYZ A;  4DCJ B;  5C42 A;  4N76 A;  4ZLJ A;  2WSF C;  1U2F A;  3T6J A;  4MYU A;  2MYF A;  4TLQ A;  3MCS A;  4HT5 A;  2KM8 C;  4FPR A;  1NEE A;  2OPP A;  5CXT A;  2L48 A;  1LXJ A;  1NZ8 A;  3GWC A;  1LNQ A;  3J80 Y;  5AXM A;  2ZE2 A;  2Z8Q A;  2YNI B;  1PGZ A;  6FDR A;  1Q53 A;  1SJ1 A;  2PI5 A;  4DEZ A;  3PW2 A;  4GVB A;  1S99 A;  2UUC F;  4WWS A;  1RUS A;  1MG7 A;  5B0C A;  4WPA A;  3MEC A;  3KK2 A;  4DDF A;  3PKM A;  1NK7 A;  2OTL S;  1UA1 A;  5DM7 Q;  4QIF A;  4DPY A;  3PYF A;  1IR1 A;  2MQ8 A;  4AT1 B;  2MLZ A;  4CLU A;  2A2C A;  2CQI A;  2IVM A;  3PIO Q;  1CJU B;  2HIY A;  3JYT A;  1P1L A;  3W5Y A;  1AT1 B;  2DVI A;  2OPS A;  2UXD J;  3D1Q A;  1RU1 A;  1TL4 A;  2F65 A;  3MAA B;  5A8K B;  4FNI A;  3M2U B;  4DOZ A;  5ITH A;  1PYT A;  3D7S B;  1S1U A;  3TR5 A;  3H90 A;  1TV6 B;  4ANE A;  5JJB A;  4ID5 A;  1T9V A;  1S0M A;  5JVH Q;  1R6Y A;  3GYG A;  2E7V A;  5CYQ B;  4ZJQ A;  3SCK E;  3CDE A;  4PQA A;  5C42 B;  3N28 A;  1G3O A;  1BD6 A;  3CJ3 A;  2FD2 A;  3FDS A;  3KNG A;  1W2B R;  2JZ5 A;  1UJ4 A;  2CJB A;  3Q8P B;  3V6H A;  1RK8 A;  3D3C J;  3UW1 A;  4KO0 A;  4KIA A;  2XYP B;  3PIP Q;  4ECW A;  2ILY A;  2UV8 G;  4DZ6 A;  4HHU A;  1J5E F;  2G9O A;  4ILR A;  2AJ2 A;  1QD1 A;  2A6O A;  2OPP B;  5KFV A;  2WCX A;  2F9D A;  3I0S A;  2RRA A;  1FA0 A;  3K58 A;  3BO4 A;  4QZV B;  4KFB B;  4BLG A;  3RYL A;  4ZP9 A;  1Q7Y T;  1REG X;  5KG2 A;  4A47 A;  1WG5 A;  4Y34 A;  3NNA A;  3LQV A;  2ATL A;  3VAI A;  2UUA J;  1F3V A;  1DAX A;  3WZ0 A;  2H5E A;  4A8X A;  4AQY J;  3V81 B;  2XCA A;  3MEC B;  3PFE A;  4YB5 A;  3KK2 B;  2Q3P A;  3IWX A;  2DTJ A;  4KV8 A;  4ZLL A;  3I0R A;  4X4T A;  3W64 A;  1NRK A;  3MM9 A;  3CWJ A;  3M8Q A;  4WKR A;  4O4R A;  1TL5 A;  1XR5 A;  2HFU A;  2FLP A;  3JYT B;  1S5Z A;  1L3T A;  1UJ6 A;  2K3K A;  2N3L A;  2KFN A;  2OPS B;  1SVD A;  5FJ4 A;  4F4X A;  3N79 A;  3D6H B;  2VV5 A;  2QL5 B;  2XGQ A;  1K9M T;  2RU3 A;  4UQG A;  1GXT A;  3EVM A;  1S1U B;  4TU9 A;  5KFA A;  4CCH A;  1I6J A;  1D3W A;  2NUH A;  1RT2 A;  3W3S A;  3FZ2 A;  2CZ9 A;  1IXK A;  2VA2 A;  1U8W A;  4J91 A;  4RUH A;  3TAQ A;  4KO0 B;  5ETN A;  3OFG A;  4KH0 B;  3AOA A;  4ECV A;  4JV0 A;  1DAR A;  1C4A A;  5G0R A;  3KJN B;  1Q1K A;  4TVA B;  3M9N B;  1T94 A;  1NK4 A;  1J2V A;  2UU9 J;  2B0G A;  4B3O A;  4DJB A;  1HD1 A;  2GC8 A;  3MPV A;  1BC6 A;  2Z2Y B;  3C6U A;  1UVI A;  4G1I A;  1ZTT A;  2LQ9 A;  3C8Y A;  2DIU A;  1ZM2 A;  5E2Q A;  1S0V A;  4OZ0 A;  4KV8 B;  3I0R B;  1P8G A;  1CJT A;  1KVK A;  4IOB A;  1Y7P A;  2NZC A;  5A8R A;  2QG9 B;  4AL7 A;  3PDN A;  3MM9 B;  2DO0 A;  3M8Q B;  2EKN A;  5GAE U;  2K7K A;  3OUY A;  1VCT A;  2PE8 A;  1KLM A;  3R6L B;  4LBH A;  2VBZ A;  4USW A;  5H9F K;  2WBR A;  3DM2 B;  4JI3 F;  4OHZ A;  4DU8 A;  1NDL A;  1U8S A;  4QIE A;  2ASD A;  2W4P A;  3LAL A;  1QE1 A;  2B9W A;  4OX9 J;  5KT5 A;  1VBX A;  1YIT S;  2IC3 A;  3FBB A;  1C0T A;  4RUB A;  3CD6 S;  3AH6 A;  2V2V A;  1RT2 B;  2MKY A;  2CJ9 A;  2ZUA A;  4YY3 J;  2VIH A;  3EVW A;  2E1A A;  1UVM A;  4DR2 J;  1U6B A;  2CQ0 A;  2XS5 A;  4HYK A;  2OP5 A;  5LOQ A;  4OJH A;  2ZIT A;  3GYN A;  4P2F A;  1HHT P;  2BM1 A;  5G0R B;  2ASJ A;  4TY8 B;  2M2B A;  4ZCM A;  2DCU B;  3CJR A;  3GIK A;  4DR1 F;  3D54 A;  2VIC A;  1UP1 A;  4OHX A;  3IGN A;  4B3O B;  2Z2M A;  4IUF A;  2HHT A;  4KGX B;  4Y2I A;  1JJC B;  3ETO A;  1ZM9 A;  2DGV A;  3BF4 A;  2OSQ A;  3NCR A;  1K0V A;  3LWL A;  4C8O A;  2OPR A;  3CJ8 A;  4OZL A;  5BR8 J;  4OZ3 A;  2JSX A;  2NXE A;  3FRY A;  1E6Y A;  3PM9 A;  5A8R B;  2CQ2 A;  4F4W A;  3QBC A;  2DNO A;  3OUY B;  2DRB A;  1CSJ A;  2ZD1 A;  1KLM B;  3C6T A;  1TL7 A;  1N0V C;  2EVZ A;  3HHL C;  5B0F A;  4YR3 A;  5M2R A;  3Q8U A;  3W2V A;  4GVL A;  3MR6 A;  1OMS A;  4OZ2 A;  5E3R A;  3HHN B;  5KFO A;  2BAC A;  1NSA A;  3GII A;  5D4L A;  4LF2 A;  4G1Q A;  5GAG U;  1QUP A;  3VQS A;  1HNW J;  4OI0 A;  3KK1 A;  4F67 A;  4IO1 A;  2IC3 B;  1C0T B;  4FVM A;  5KT7 A;  2HBR B;  3BDP A;  2V94 A;  1U1N A;  5ETV A;  3HM9 A;  5L1K A;  1FJG F;  3FSY A;  3QT6 A;  4I68 A;  4UQT A;  4ZK7 M;  2VZ9 A;  1FES A;  3ADA C;  3H59 A;  3M8P A;  2OKQ A;  5D3G B;  2J0S D;  4K0K J;  1T3O A;  3FMW A;  4H4K C;  4B9V A;  2RQK A;  4NLQ A;  1VRU A;  2W2M P;  2I8E A;  5GMK a;  4NCB A;  3OVS A;  4IKA A;  4DUZ J;  2ZBC A;  5EWF A;  5JVG Q;  2LYV A;  3LOU A;  3CGI A;  2HZC A;  3R2C J;  3CD7 A;  1LWX A;  3TUJ C;  1YJV A;  2G0I A;  3N5B A;  4J9L A;  5K8N A;  1NH7 A;  2OPR B;  2D3O R;  3V6J A;  4N8O A;  1LWC A;  2ASY A;  3UR0 A;  1M1G A;  2NXN A;  3H2V E;  2P2C B;  1E6Y B;  5IM0 A;  2W1B A;  4WII A;  5JMN A;  2WSC C;  2KXF A;  2F8E X;  3U02 A;  2IVF B;  2PMW A;  1I1G A;  2ZD1 B;  3CJT A;  3C6T B;  1TL7 B;  2O66 A;  1XER A;  2CPZ A;  2DH9 A;  4UT4 A;  1FRH A;  1HW8 A;  4OI6 A;  3EGN A;  3TAR A;  1S1V A;  4J9O A;  3W2V B;  4EBE A;  1JJ4 A;  4EZ9 A;  4G1Q B;  1GH8 A;  1YBU A;  4ZPA A;  2UXC F;  1VC0 A;  2KTQ A;  3W61 A;  1OYD A;  3H2U B;  1SKU B;  5HLF A;  1ZBT A;  2R2T A;  2AQ4 A;  3UDV A;  1RHJ B;  1RQ0 A;  4FF3 A;  4CZC A;  4ZPD A;  2MXY A;  1Z2L A;  4C8Y A;  2Y1J A;  4HDH A;  2OEJ A;  3M8P B;  3RW7 A;  2ACY A;  2L08 A;  2ZDP A;  3M05 A;  4PPZ A;  4P73 A;  4YP3 A;  1VRU B;  2BDP A;  1YJ7 A;  2DNQ A;  3I87 A;  4X64 J;  3J7Z 5;  4BWJ A;  3CCW A;  4ECQ A;  2NSC A;  4NEY A;  3HHE A;  1VRT A;  2I9S A;  1P9Q C;  5IZH A;  2IHR 1;  3BS9 A;  1F6T A;  1T9U A;  1LWC B;  2E9T A;  1NK9 A;  3HVR A;  2HS3 A;  3ITH B;  3ILL A;  1XQI A;  1HI8 A;  3IR5 B;  2GJF A;  2AW0 A;  4G1P A;  1D0E A;  4Y2M A;  4MAK A;  3HX9 A;  2D41 A;  3MPU B;  1LOU A;  3IP0 A;  4GMK A;  3QLH A;  3MFI A;  1LKZ A;  1VQY A;  1H38 A;  3NNH A;  3UD3 P;  1KS2 A;  2D69 A;  2ZH5 A;  3NGU A;  2A1B A;  2AJQ A;  1VQ6 S;  3RR7 A;  4M1K A;  2HGL A;  3W5X A;  1SKS A;  1H73 A;  4ANC A;  5HLF B;  3T1H F;  1N32 F;  3PJX A;  2X51 A;  4ED8 A;  5KFT A;  4LSL A;  3GG0 A;  1CEZ A;  2R7S A;  3HVT A;  1N56 A;  4WU2 A;  2UV8 A;  2HK3 A;  1M5K C;  3NKY A;  3TUZ C;  2HYI B;  1WSV A;  3LAK A;  1Q8L A;  3QJJ A;  4K2X A;  5E3C A;  5ETP A;  2EK6 A;  2XSF A;  5D77 A;  4I6A A;  3HSD A;  1ZM3 A;  3ENQ A;  1SH2 A;  3W1Y C;  4NPO A;  2ZHB A;  3LA0 A;  2VPX B;  2AEF A;  1I94 F;  2EG1 A;  2DEI A;  4K4S A;  2POK A;  4DL7 A;  2GX8 A;  2ZH6 A;  3FEY B;  1N33 F;  1VRT B;  4HEA 9;  2B9Y A;  3MOZ A;  1HQE A;  4DPU A;  1U24 A;  4F4A A;  3H4B A;  1U1M A;  5IT9 Y;  4ENO A;  2LDY A;  2CA9 A;  3QSI A;  3MXH P;  4LF7 J;  1XR6 A;  4HR2 A;  1RLC L;  2PGC A;  4UF4 A;  4USI A;  2RB7 A;  1WDD A;  3NS6 A;  2DR7 A;  3NWR A;  1SKW A;  2WK4 A;  4UZB A;  1XN9 A;  4K4V A;  1RAI B;  2YH0 A;  3MTJ A;  4NWB A;  3QLH B;  1NJI T;  3TVK A;  3TVZ A;  3VCD A;  1AUD A;  4ZCK A;  4UY8 5;  1N0U A;  4NYZ A;  1NH8 A;  5C2C A;  2VC1 A;  4ZOS A;  4ZA1 A;  5HK4 A;  3M8S A;  1NHU A;  2HND A;  3A13 A;  3VAK A;  3WQP A;  3CO9 A;  1Y5I B;  1FRM A;  5F3Z A;  4LSL B;  3HVT B;  5EGY A;  1RBL A;  3H40 A;  1HNZ F;  1HPZ B;  1U02 A;  4DU7 A;  2FJB B;  2HAI A;  1CC8 A;  4WFA Q;  1KRP A;  4WTO B;  3J7A 1;  1PSD A;  3BN7 A;  3C66 A;  3K0J A;  1RTD A;  1C0U A;  3N4W A;  1NCL A;  2IRU A;  2JOQ A;  1PYS B;  1RAC B;  4V19 J;  3A3O B;  4C8Z A;  5LSL A;  1RWW B;  3GJS B;  5EDW A;  5J2M B;  1WF1 A;  2HHS A;  3I4P A;  3K57 A;  1FKA F;  4TQR A;  4OHW A;  1GMU A;  3MCM A;  5B08 A;  3G8T A;  2NXJ A;  3BR8 A;  1Y3J A;  3CC2 S;  2J7W A;  3UNY A;  4RNO A;  3E3X A;  3TZX A;  4RPF A;  1ZPV A;  3SV4 A;  2XO6 A;  2ERR A;  1U49 A;  1SJR A;  2XS7 A;  4K4Z A;  2HGN A;  4EO8 A;  4F02 A;  1J27 A;  3DHW C;  2UP1 A;  2YNH A;  3OL9 A;  1XMO F;  3T41 A;  3T9N A;  1TEL A;  2N3O A;  5HMW A;  3MOJ B;  3CC4 S;  3H7H B;  4LRC A;  5KFF A;  3CCR S;  2MQM A;  2HWI A;  1NK6 A;  5IT9 U;  1U7L A;  3RJM B;  2HND B;  4S0M A;  4HT7 A;  1CJK B;  4ZVO B;  5AXK A;  3QWP A;  3CCM S;  4CO3 A;  3IO1 A;  4F0H A;  3P3D A;  2IMO A;  1DTQ B;  2HQI A;  4OX6 A;  3BBB A;  2E5J A;  1R89 A;  1V5I B;  3UCG A;  1UET A;  4QR1 A;  4QIV A;  3UI3 A;  1C0U B;  2KH9 A;  1QVF R;  4J5O A;  1SC3 B;  3NS5 A;  2NXC A;  3N6L A;  5EWG A;  1RAH B;  1VJQ A;  1Q8K A;  2WAQ D;  4DR3 F;  1U1Q A;  3HHD A;  5LL6 d;  5L1I A;  4CT9 A;  2MZS A;  1HWL A;  3TX0 A;  4NA3 A;  4DCO B;  2XLK A;  4K5R A;  1HI1 A;  4KB7 A;  4WFN Q;  2LFV A;  3QT5 A;  3P5B P;  1KSP A;  2KT2 A;  3FCH A;  1PAU B;  5HQM A;  3THP A;  1WOO A;  1VS3 A;  1WHW A;  2HFS A;  5KFH A;  2KHC A;  3M30 A;  2IRX A;  1T9X A;  1BHN A;  3MDF A;  5HAT A;  3W2W A;  3R7B B;  3A4T A;  3WX8 A;  1TFW A;  1SKR A;  4D3H A;  4N8N A;  3ZTO A;  3OJU A;  1QTM A;  3LGH A;  3BPD A;  4JV5 F;  2LU2 A;  2VU5 A;  4DPO A;  2M5Y A;  2YNH B;  2E5L J;  3DGP A;  3CXC R;  2NS1 B;  3IBC B;  4U7U K;  2LLZ A;  2GHP A;  1G6B A;  4RWX A;  4NCG A;  1H72 C;  4ZJL A;  1LV5 A;  2LXF A;  2UUB F;  1BWV A;  1NJY A;  1UPM B;  2F63 A;  1VDH A;  2G2Z A;  5KFC A;  2IYI A;  1WKK A;  2IBK A;  2GQC A;  3SV3 A;  2ZWP A;  3KLG B;  3IS9 A;  4JI7 J;  4M5D A;  3E2E A;  4LF6 J;  3MHY A;  5HRO A;  3F56 A;  3SSR A;  3EMT A;  3ISZ A;  3T5L A;  2CDR B;  2R7X A;  3OD2 A;  1WD6 A;  3OTC A;  1GFW B;  1HBU A;  2APO A;  2HAF A;  2R8I A;  5K14 A;  4OYP A;  2IY5 B;  1RB0 A;  5B0A A;  4RNH A;  3HI9 A;  1VC6 A;  1D1U A;  2L9W A;  1UTA A;  1ZPW X;  1U1R A;  4NA2 A;  2HVI A;  4KJI A;  1JNR B;  4L3N A;  2ZH2 A;  4DR5 J;  1KFS A;  1BQN A;  1MRO B;  3AOB A;  3RB4 A;  1HR0 F;  2J9E A;  3GSD A;  2HG4 A;  2CG4 A;  2HVD A;  2O01 C;  1SQF A;  2OAU A;  1UVL A;  3ETM A;  3EVO A;  1OY6 A;  3D28 A;  3CCQ S;  1Y5L B;  2UXC J;  2HMI A;  3OSP A;  3GIM A;  3CJ0 A;  3ZTR A;  3S6E A;  1RJJ A;  2M70 A;  3GJQ B;  3M30 B;  1FNO A;  1FDA A;  3PRV A;  5LSR A;  1BXN A;  3W2W B;  3C46 A;  1NHK L;  5ETO A;  4NXM F;  3TAP A;  1H3D A;  3GFX A;  3WHI A;  1BWE A;  2HFN A;  1K1Q A;  2MEW A;  3BJY A;  3S8S A;  4M5I A;  4PXD A;  2CG8 A;  4NLX A;  4DV5 J;  5KT2 A;  2Q66 A;  5L38 A;  2J9D A;  4X4Q A;  1BY9 A;  1RA6 A;  2RF2 A;  3BQ1 A;  2OH2 A;  3IS9 B;  4M5D B;  4L3K A;  3VAJ A;  1Y10 A;  5HRO B;  4L73 A;  3PO5 A;  3DGV A;  4P6Q A;  1XMQ F;  2C28 A;  3T1A A;  1S4F A;  3NMR A;  4MYT A;  3KHH A;  2DNP A;  2FJD B;  3PAC A;  3QSY B;  3TP2 A;  2W9B A;  4FDF A;  3M7V A;  2DIT A;  4NYP A;  3PYD A;  4J9K A;  2B8P A;  4X62 J;  1WNE A;  4BWM A;  3SZ2 A;  4K4X A;  1X60 A;  2CUY A;  2QJ3 A;  1BQN B;  4DS5 A;  2VOP A;  3MM5 B;  2EXU A;  4ZPB A;  4EFA C;  1RE1 B;  3LAN A;  5LJ3 Y;  1AYE A;  1UWB A;  4DPX A;  2CQB A;  4QR2 A;  2BJ1 A;  1TR0 A;  3B54 A;  1TAU A;  3D0H E;  1KWM A;  1Y5N B;  5I3U B;  3CTR A;  1REV A;  1D09 B;  4C3L A;  4ZIT A;  3DHX A;  3CME S;  1UFK A;  1Y9O A;  4WE1 A;  1OIA A;  4ZP6 A;  2V6A A;  5C7P A;  5H1S V;  4J9S A;  2MZ1 A;  1S1W A;  3G82 A;  2C3O A;  5E7O B;  2Q43 A;  3ZO7 A;  1T11 A;  2XNQ A;  3RBZ A;  2LDI A;  4XDC A;  4CLY A;  1X4D A;  4DV4 F;  4KC5 A;  5IQQ A;  1KN6 A;  4ZN1 A;  2OUG A;  1D9A A;  4URS A;  3H98 A;  2RUG A;  4YHH J;  4MK9 A;  3ZZP A;  5KTQ A;  4YR0 A;  2QLJ B;  1VGY A;  3HSJ A;  5KFX A;  5E33 A;  3NGK A;  3K89 A;  5SUH A;  2ZJR Q;  5L1L A;  2W9B B;  3BSO A;  1GEH A;  4DL6 A;  4QIG A;  1JXL A;  2N7C A;  2DRA A;  3P5T L;  2CPD A;  5C2G A;  1IJE B;  4EI2 A;  4QW8 A;  3K59 A;  4DV6 J;  1JLA A;  4C7Q A;  4CH1 A;  1Q81 T;  4U96 A;  3KOA A;  2FY1 A;  5EWE A;  4QWA A;  4DI6 A;  4GC7 A;  2H9Z A;  3CD0 A;  1UWB B;  1N88 A;  3HPO A;  1T9Y A;  2H51 B;  1S7I A;  4QWE A;  2O3D A;  1R8A A;  3GLJ A;  2Z57 B;  1REV B;  3NAI A;  1GAO A;  3OT9 A;  4WE1 B;  3RAM A;  3TZY A;  2R7O A;  3AQO A;  3NRB A;  3OVB A;  1LK5 A;  1HNZ J;  4J37 A;  1S1W B;  3G82 B;  4ZIW A;  2AIR B;  4KHM A;  5IC4 B;  3I56 S;  1XEZ A;  1HL6 A;  3T9Z A;  4DR6 J;  3KMS A;  4PWW A;  2F4F A;  3ZFV A;  2HHV A;  1FDN A;  2YY3 A;  3QQC D;  4P9S A;  5D4N A;  1YJ9 S;  1U1O A;  2PFD A;  2IA6 A;  4DBQ A;  1VIS A;  1X5P A;  3I6P A;  4NLW A;  4N47 A;  1APS A;  2HHU A;  2I5J A;  1HNI A;  3LPY A;  1WC6 A;  2DNZ A;  5MLC V;  4HAC A;  5DQG A;  2BKN A;  1VQ9 S;  1URN A;  5H9E J;  4PYA A;  3UR3 C;  1VQ4 S;  3QJL A;  4FS1 A;  3M4X A;  2AJ0 A;  1HQU A;  1WHY A;  3R6G B;  3ONQ A;  2ZDO A;  2O67 A;  1YRX A;  3IRX B;  1N4L A;  2GIF A;  2J5A A;  4IR1 A;  1SH0 A;  3FCV A;  4DL2 A;  1HWU A;  1X4F A;  1F9H A;  1JLA B;  1XMO J;  4PG4 A;  1I3O B;  2MTL A;  4X4P A;  5E41 A;  3KHL A;  1D8Z A;  4NI2 A;  4ECX A;  3AXM A;  3FQK A;  3T5H A;  3CMQ A;  1NK5 A;  3SQG A;  2PDA A;  3CB4 A;  3EGZ A;  1R27 B;  2G2Y A;  3KDO A;  2BRK A;  1VQ5 S;  1P9Y A;  1IBK F;  3M6W A;  4FF4 A;  4XO0 A;  1DUR A;  2N82 B;  3PRB A;  2BRL A;  2BVZ A;  2Q6C A;  3U7J A;  2BQ3 A;  3IWN C;  1Y4Z B;  4RW6 A;  5HN0 A;  2E1C A;  1QTN B;  3EIC A;  2AKW B;  2R8H A;  1YZ6 A;  4DQP A;  2KN4 A;  3MED A;  4DHV A;  1QJH A;  2WOM A;  4NOH A;  4N77 A;  1HNI B;  4UOH A;  3Q24 A;  4OYB A;  2OLW A;  3J7Z T;  3M6V A;  4C8N A;  1NPP A;  2VD3 A;  4Q8F A;  2W2Q P;  2VPY B;  3MAH A;  4ZVS B;  3Q2T C;  1WHV A;  4OQJ A;  2MZT A;  2V2Q A;  3OFE A;  4ATN A;  1NB7 A;  2CKW A;  4ALZ A;  2B9X A;  3FUY A;  4ICL A;  5FDL A;  2GVD B;  1HQU B;  1TL1 A;  2CJY B;  3L7O A;  3HFZ B;  2GCF A;  2RRN A;  2JNJ A;  2JX2 A;  3KJQ B;  4DUY F;  2KHD A;  2DIS A;  1CJV A;  4WK1 A;  4MK7 A;  1EAY C;  5KFL A;  1RAJ A;  1Q16 B;  5L9X A;  3OL7 A;  4B3R J;  4U95 A;  1PIL A;  4FYX B;  2KRB A;  1S79 A;  1VIX A;  1S9G A;  3MEK A;  3DLE B;  2IMW P;  3I55 S;  2KB2 A;  3EJM A;  3TNV A;  2P5V A;  2CQH A;  4V1A k;  7FDR A;  2D3O 1;  4QPT A;  1OWX A;  2CWK A;  3N9U C;  4EYI B;  2J7U A;  3CJS A;  3VTI A;  5GVQ A;  1DQA A;  3D0G E;  2DHH A;  4WXO A;  4YB6 A;  1JLC A;  4RU9 A;  5ETK A;  1SPB P;  2NPI A;  2HEK A;  4RW6 B;  1QY7 A;  3LAM A;  2LQ8 A;  1HR0 J;  2QT7 A;  1JJH A;  1JLF A;  3Q89 A;  4UUW A;  3MED B;  1FTR A;  2WOM B;  2H1Y A;  3N0V A;  1E6V A;  4RBT A;  3OQ2 A;  3FCW A;  2DGW A;  1KQK A;  2AMC B;  1FDD A;  2ACM A;  2VFT A;  1KR4 A;  4PUO A;  1JLG A;  2CVI A;  1FDB A;  1KEK A;  3WX4 A;  2MQQ A;  1WEY A;  1WHX A;  2E7W A;  5FDL B;  1TL1 B;  3OR1 A;  3GCW P;  4MMO A;  5A2Q Y;  4RNN A;  4CM0 A;  1CJV B;  1WWH A;  4DR4 F;  4DX6 A;  1H2T Z;  4X66 J;  4RO0 A;  4F50 A;  3M2R A;  3AQP A;  2ZC4 A;  2GMJ A;  1S9G B;  4OJG A;  4ED7 A;  1MWZ A;  4UY8 T;  4JYA J;  5EX0 A;  2WHO A;  3TAN A;  5ETQ A;  4XPC A;  2ZVI A;  5DZ7 A;  2GV1 A;  2XMM A;  3RB3 A;  3D66 A;  5A6P A;  4W90 B;  2CNN B;  2B6A A;  4IYQ A;  5F8J A;  1H2U X;  1JK9 B;  2R2U A;  2VFV A;  3UQS A;  1F5C A;  3DXB A;  2CAD A;  4GKJ F;  4OYM A;  4FBT A;  2H5J B;  1TKZ B;  2CYY A;  1RDR A;  2QA1 A;  2BA9 A;  3EXC X;  3AD7 C;  1JLF B;  3TZW A;  1N6Q A;  3PX4 A;  3DLL Q;  3BKU A;  2I2Y A;  4MJK A;  3W63 A;  2YPY A;  1C4C A;  1HNV A;  2BE7 D;  2ASL A;  1WI6 A;  1RHM B;  3LTO A;  2Z56 B;  4PUO B;  1JLG B;  2LA4 A;  2B4U A;  5A8W A;  3JQK A;  2WVF A;  4BC9 A;  3J7Y U;  3OR1 B;  2EC2 A;  4RX6 A;  1KTV A;  4IRK A;  4LR7 A;  3G2X A;  1W25 A;  2EFQ A;  2GHW A;  2VJV A;  2IRY A;  1X4A A;  5BYQ A;  3R8Y A;  4PZV A;  2RQ4 A;  3L9Z A;  2WON B;  4EO6 A;  3M2R B;  4DV3 F;  5K20 B;  1IKW B;  1RBA A;  3RR8 A;  2AZ3 A;  3PNI A;  2HHH F;  3W9I A;  1S72 S;  1HWI A;  5FII A;  2DY1 A;  1X4G A;  2ZC3 A;  2RML A;  1FJC A;  2WBM A;  3GFZ A;  3J7A N;  3I96 A;  5F8G A;  5A6W A;  2OEL A;  3ZZO A;  1NHV A;  3TJ9 A;  3CE8 A;  3MF5 A;  3KK3 A;  4I0W A;  2JFK A;  2ZBQ A;  3MM8 A;  1AXQ A;  3DDN A;  3KLE A;  5A2Q U;  1IKX A;  2QTW A;  4GO5 X;  2B6A B;  4CT8 A;  4WIQ A;  3AA8 A;  5DGB A;  1S6U A;  3Q0A A;  4WYW A;  1ELO A;  4PG8 A;  4QPX A;  1CVJ A;  2WB4 A;  3F44 A;  2AZ1 A;  3TUI C;  1RWU A;  4IFV A;  4AD6 A;  1YJW S;  4PWD A;  3OR2 A;  3IR7 B;  2CPH A;  1RAE B;  3ICL A;  1HNV B;  5I3P A;  1PBU A;  4K4W A;  2A6M A;  4LFC J;  4K5S A;  4JV2 A;  4FPI A;  4O3R A;  2AJ1 A;  1CG2 A;  2B7B B;  1ZYQ A;  2GIR A;  4H4O A;  3WIV A;  1D9D A;  1BGX T;  2XZT B;  2OO4 A;  3HZE A;  4U7U D;  1OQ6 A;  5F3T A;  2MMY A;  1SCJ B;  5IT4 A;  5KFR A;  1V5V A;  3MTK A;  2FJX A;  4F3M A;  2FY8 A;  3SCI E;  1YGY A;  3SQO P;  3G6V A;  2F9J A;  3BYP A;  2E29 A;  2KZM A;  4KPY A;  2UXB J;  3KK3 B;  1RT5 B;  4IR9 A;  3TVY A;  3MM8 B;  3KLE B;  3RBE A;  4F04 B;  4KGV B;  1IKX B;  1MWY A;  2B56 A;  4IFY A;  3MUR P;  3DOL A;  3EZU A;  1WG1 A;  3M9O B;  3KJV B;  2DYA A;  4IQM A;  2BJ9 A;  2BE2 A;  4XDD A;  3QZ7 A;  2ZJQ Q;  3PVX A;  1U6F A;  2BM0 A;  1N48 A;  5KG7 A;  2XI3 A;  3QJP A;  1OY9 A;  4IFV B;  1PO6 A;  1T05 A;  4PWD B;  2NXU A;  3H4D A;  4Y2C A;  4HI2 A;  5GAH U;  3DN9 A;  7FD1 A;  2VFR A;  4FF1 A;  4KQZ A;  4DX7 A;  4MFB B;  2W7A A;  4KHP J;  1EKR A;  4OV1 A;  2P8I A;  4OLP A;  4F36 A;  1LWF A;  4USH A;  2CQG A;  2WW4 A;  3TRG A;  4H4O B;  4NZ7 A;  3LP1 A;  1Z4U A;  3T19 A;  4WP9 A;  2V4R A;  2MJN A;  3HVW A;  2OML A;  3LGM A;  1YDL A;  4OHV A;  5B0G A;  3OXF A;  1GXU A;  3TA0 A;  2V50 A;  2M4M A;  2WVB A;  2DD8 S;  2W4D A;  4AUK A;  4TYA A;  4B9M A;  4NRU A;  4EEY A;  4AL5 A;  4U67 Q;  5KFP A;  1XBW A;  2FHK A;  3K17 A;  1X0F A;  2IYG A;  2HBZ B;  1RU2 A;  1ZOT A;  1JMT A;  3BBC A;  2BAB A;  1NME B;  2W8L A;  5IXU A;  4CLT A;  1YJR A;  4IFY B;  3TYT A;  2DCL A;  4FZV A;  3A3P B;  2NSB A;  2HNZ A;  2WVD A;  1T9T A;  1DFD A;  4ZS6 A;  2VOO A;  4DR7 J;  4USM A;  4E2F B;  4I64 A;  2HIQ A;  2E1P A;  4CLF A;  4OLO A;  4C6A A;  4DUY J;  2OGU A;  2QFJ A;  1NU4 A;  1NLK L;  1Q0N A;  4OX8 A;  4C2M A;  2GZO A;  4USV A;  3PV8 A;  1T05 B;  2VC0 A;  1M1H A;  2VDI A;  2UUT A;  2K3I A;  4UUX A;  2FZG B;  4ECY A;  2FZK B;  3SBM A;  1MU2 A;  1LWF B;  4LF5 F;  5C24 A;  3UVJ A;  4FXW A;  1VMB A;  4DL5 A;  1RWP B;  3R5B A;  5DDR C;  3V5R A;  3K2Y A;  4LQ3 A;  1TFY A;  4WCE Q;  4CYU A;  3ZZ0 A;  2KG0 A;  3FQL A;  5THW A;  2GO9 A;  5D4O A;  3LP1 B;  4ELT A;  5B0D A;  2XMW A;  2ROE A;  1YLX A;  3TA2 A;  4HI1 A;  3AT1 B;  4DFK A;  2HQF A;  3KLI B;  4M63 A;  3ZNJ 1;  5J2N A;  3Q8S B;  2FJA B;  3SCL E;  3CF5 Q;  2HLU A;  2ADC A;  1RXO B;  1F9F A;  3H20 A;  2JLF A;  4P52 A;  1JLB A;  4DV7 J;  1R31 A;  1S59 A;  3G96 A;  1H7W A;  5H9F J;  1K8A T;  4RNM A;  4DL3 A;  2QLB B;  3RBX A;  1NJZ A;  2H4Y B;  5T41 A;  3K5O A;  4M5N A;  2PA8 D;  4MIA A;  2ZBR A;  1X9M A;  1IN0 A;  2JC0 A;  3DRR A;  3UN3 A;  1FX2 A;  1YJT A;  3UN5 A;  2A18 A;  2HNZ B;  2FC8 A;  2XCP A;  4KGZ B;  3GG1 A;  3R1L A;  4GO7 X;  3L3C A;  5LT5 A;  3HFV A;  5U47 A;  2W7O A;  2WB1 D;  1TKD A;  2HGM A;  3MM6 A;  3PHE A;  3AD9 C;  1WC5 A;  4ZIV A;  3EYZ A;  4A8K A;  1F5A A;  2W9A A;  3LP2 B;  1VQK S;  2IDL A;  2XC9 A;  3VAL A;  1MU2 B;  5LXR A;  1HBN B;  3IBF B;  3UVJ B;  5C24 B;  2E66 A;  2XS2 A;  5KFN A;  1TQL A;  3RRK A;  4CYU B;  4FVC A;  5K8M A;  3EE3 A;  1MMN A;  2V34 A;  4FF2 A;  4Q44 A;  4J7C A;  3LWM A;  1JB0 C;  4U8Y A;  1RAD B;  4ES1 A;  3PCO B;  2JFD A;  5J2N B;  2XTJ P;  1ZET A;  5DDP C;  2YKA A;  3DKD A;  1ZS6 A;  2QSW A;  2B3T B;  4WF9 Q;  3VHQ A;  5KG6 A;  1NZA A;  2V0N A;  1JLB B;  2KO1 A;  1QSS A;  1VK8 A;  2RU9 A;  2V8D A;  1D8Y A;  2D9O A;  3TAM A;  1Q7L B;  3HHL B;  3BBF A;  2YKP A;  5IV3 A;  1U09 A;  1GX6 A;  3G6X A;  1X9W A;  1CPZ A;  3DRR B;  1B7F A;  1RYR A;  5EUH A;  1RWM B;  5HQL A;  2D3U A;  5K8P A;  4K8R A;  4DQS A;  2J0Q D;  1HYS B;  1BLU A;  1RT6 A;  2C2E A;  1Y00 A;  1WI8 A;  2N4D A;  3ZZT A;  4Y3C A;  1RCO B;  3G9C A;  1HLW A;  3MM6 B;  3SFG A;  4I1T A;  2X1A A;  2R8J A;  3U1M A;  3UFC X;  5ETL A;  2CIM A;  4DV3 J;  1PCA A;  2W2O P;  4LFB F;  3B6B A;  2HZA A;  2ILZ A;  1TL3 A;  3KNA A;  2DY9 A;  2GO8 A;  2BKP A;  1RP5 A;  4DV1 F;  2AYB A;  4NEZ A;  3OLB A;  1RI7 A;  4DSJ A;  3PJ9 A;  5A0Y A;  4O0N A;  1SBR A;  5KT4 A;  4LRA A;  4Z7Y A;  3PZP A;  3MGJ A;  3PJW A;  2QSF A;  3RAQ A;  3X3U A;  3D9B A;  4LF1 A;  1S12 A;  1EQM A;  1U1K A;  1XK8 A;  2FVS A;  1PC4 A;  4Z7C A;  5HSP A;  4C9D A;  3SSS A;  3G4S S;  4CNY A;  3MEE A;  3J81 Y;  1VQP S;  2RS8 A;  1N34 J;  1IWA A;  1RAB B;  1IBM F;  5K9F A;  2GHV C;  3W60 A;  3TAM B;  4KFB A;  2HBQ B;  1YKW A;  2HVZ A;  1VR6 A;  4PEO A;  3RTV A;  4NLP A;  1YRU A;  2OJ3 A;  2ALY B;  2A0F B;  1QAJ A;  4A8M P;  2CQ1 A;  2AYG A;  3V81 A;  4ZKA A;  5AJ3 F;  4DSI A;  3JXO A;  4CO1 A;  1VJW A;  1QDU B;  2RDD A;  4CLW A;  1RT6 B;  4B3M F;  2DPI A;  1BQM A;  2R8G A;  1RWX B;  1XMB A;  2YWE A;  2HRU A;  3BKF A;  4DFM A;  4RR5 A;  5KFS A;  1S4E A;  1XNQ J;  3T1Y J;  3KTQ A;  1ZAW A;  2W2N P;  1SIW B;  4YOE A;  4JI6 J;  3CJ5 A;  3KWM A;  2AGP A;  1OYE A;  2X3D A;  2ZKT A;  2BZ2 A;  1WTB A;  4KE5 A;  1TL3 B;  4JI8 J;  1HI0 P;  3R5C A;  3AAW B;  1RWV B;  1T95 A;  2IIH A;  1NXI A;  3N5F A;  2MQL A;  5CD4 A;  1YBT A;  3RAX A;  2H65 B;  2CJK A;  3KKF A;  3HSG A;  2ZOG A;  5A0Y B;  4LFA J;  2YBV A;  1ZZF A;  3UPF A;  5F9L A;  2DEJ A;  3MFH A;  1JNZ B;  1QAI A;  1F2H A;  1FJE B;  4OL8 A;  3LGN A;  1UW4 A;  1RTJ A;  1RYS A;  4O3Q A;  4RNF A;  5CHC B;  3B8H A;  1EX8 A;  2IVY A;  5J1E B;  1J5O A;  5JUM A;  2F4V J;  3GR0 A;  2HNY A;  3MEE B;  1IM6 A;  1XJW B;  2ZEJ A;  4M94 A;  3TQ1 A;  5HAN A;  2MZQ A;  2Y8Y A;  4C97 A;  4FYY B;  4NLD A;  2MHE A;  5LXY A;  3W7B A;  2DNH A;  4JV1 A;  1XIQ A;  1U4B A;  5F8I A;  5L1J A;  2DR9 A;  5LMU F;  4L74 A;  2J8A A;  1A7G E;  1M5V C;  2VQF F;  1R0A A;  1BUX A;  2V4Q A;  1SH3 A;  1RT1 B;  3PEH A;  4HH0 A;  2A3J A;  4MKV A;  2V5H G;  3NCP A;  2NR0 A;  2K06 A;  2M8H A;  2X1F A;  2ALZ A;  4DV2 F;  2HPU A;  2BAN A;  3K8V A;  2HFO A;  3J81 U;  1BQM B;  1B0T A;  5DET A;  2RIJ A;  1BMQ B;  3OV7 A;  1IQZ A;  3PRD A;  1YQH A;  3J80 U;  1N36 F;  3L4B C;  4ECR A;  2ZH9 A;  1L3S A;  1B0V A;  5BYR A;  3FC9 A;  1R7I A;  2KT5 A;  4LF8 F;  3MR2 A;  1IUJ A;  1O51 A;  3DM2 A;  3WC2 A;  1RCX B;  4LSN B;  3DDK A;  3EM1 A;  2R7U A;  1UJ5 A;  3OTE A;  3SEO A;  1U25 A;  1SC6 A;  2MKI A;  2XI2 A;  4ECZ A;  1NSQ A;  3TUP A;  3ZNU A;  5F41 A;  2C2R A;  3ILO A;  5A76 A;  3BH6 B;  3HCX A;  9ATC B;  4HKQ A;  4JI1 J;  2AT1 B;  4C48 A;  3O5T B;  2IM0 A;  4RLE A;  2OPQ A;  2Q1L A;  1Y0H A;  2BW7 A;  1RTJ B;  4DFJ A;  4WBF A;  1HNX F;  4JI4 J;  1J5O B;  1TAQ A;  2HNY B;  2VL1 A;  4TY8 A;  5L9N A;  5CAB A;  2DXF A;  4DX8 H;  2KVI A;  5K8O A;  3TZZ A;  3G87 A;  2R7T A;  3I9V 9;  5KFZ A;  4PRF A;  3W8G A;  3K5L A;  1VFJ A;  3D68 A;  4J9U E;  4O4G B;  2QA2 A;  1R0A B;  1DQ9 A;  4TU8 A;  3IM9 A;  1M5H A;  3PTW A;  4K50 A;  4M95 A;  1WSR A;  3PX0 A;  4WJB A;  3GQC A;  5T14 A;  3G8S A;  2Y1R I;  2BAN B;  1X8D A;  4M5M A;  4LF9 F;  2YWH A;  2DGO A;  2BYC A;  2EFV A;  2Y1I A;  2EPI A;  4JI5 F;  5KFJ A;  1FRL A;  1AFI A;  2LU1 A;  1B4S A;  4U6P A;  2D3Z A;  3PW4 A;  3MR7 A;  1U26 A;  3FSX A;  4TNO A;  4NLU A;  2PSZ A;  2PII A;  5T7L A;  2LP4 A;  4LF4 F;  4I2P B;  2MGZ A;  4AFF A;  1UCN A;  1O0P A;  4CO4 A;  4JI2 J;  5HQ8 A;  3AD8 C;  2I6W A;  3GU0 A;  5GAH I;  3AOD A;  1XC9 A;  4FXD A;  4NLY A;  1EKS A;  2BX6 A;  2YQ1 A;  1EP4 B;  2QA4 G;  1DZ5 A;  1ROF A;  2OPQ B;  5IWA F;  3BKT A;  3CJQ A;  2JLG A;  2M8D B;  4DV0 F;  4P2S A;  2RRB A;  5J2P A;  2E7X A;  1XWL A;  3ZTP A;  3CCT A;  3VZH A;  3W62 A;  5JXS A;  5D3G A;  2FVP A;  4JI0 J;  4OYW A;  2RE1 A;  3VGU A;  1FNX H;  3K5N A;  5B7W A;  1IKV A;  3DRY A;  4PQU B;  1HMV A;  1VBY A;  3WIU A;  3MEG A;  4FYD A;  4OYX A;  3KUG A;  4NAS A;  3GR1 A;  1YG0 A;  3G6E S;  3SDE B;  4CO0 A;  4FNH A;  8RUC A;  3BGU A;  2VDH A;  4K7Q A;  2C2M B;  1WUU A;  3BGO P;  2XYH B;  3KLF B;  3JQJ A;  1JJ2 R;  4ZMM A;  3OVA A;  2RKI A;  3OHA A;  2XMA A;  3IAM 9;  1U0H A;  1JIH A;  7AT1 B;  3L95 X;  2DPJ A;  2DIV A;  4ZLP A;  1WOP A;  5KFG A;  2B7C B;  2QC3 A;  2KVQ E;  1KD1 T;  5T7L B;  2WVC A;  3KYL A;  2RS2 A;  2MGZ B;  2JVR A;  1XTZ A;  3BR9 A;  4B3T J;  3U27 A;  2GGP A;  4RJV A;  1UWA A;  5BYS A;  2V63 A;  2LXI A;  5KFW A;  2R2R A;  4W4M A;  2V9K A;  2DJW A;  1L3K A;  1KVI A;  3FBE A;  3QIP B;  4C0H A;  2PMZ D;  1B0P A;  2LKZ A;  5J2P B;  2UXD F;  2R42 A;  3V4I A;  3X1L B;  3H5Y A;  2DH8 A;  4U7C A;  1GQE A;  3L7U A;  2SXL A;  4Z37 A;  1T3N A;  1IKV B;  3GON A;  3HDS A;  1DJ0 A;  2QRR A;  1HMV B;  3M2V A;  3GP9 A;  3A3N B;  2R7R A;  2OD4 A;  3MEG B;  1HBO A;  3R2D J;  1ACM B;  5FD1 A;  4ZVQ B;  2XMJ A;  1S6O A;  4BHQ A;  4QW9 A;  4OYZ A;  3OXG A;  2ZBP A;  4KYZ A;  4IOA Q;  2B8Q A;  2BW2 A;  2FDN A;  1ARO P;  4C11 A;  3H5U A;  3W5Z A;  1AW0 A;  3CIZ A;  3ITH A;  4J9V A;  4I7F A;  2ZNZ A;  3HSZ A;  1S10 A;  1RBO B;  1K1S A;  5GME A;  1IWG A;  2MZR A;  3G8Q A;  3PKY A;  3HUL A;  2RKI B;  2V9W A;  1NDK A;  1WJ9 A;  1U0H B;  1UFL A;  3W65 A;  1P27 B;  2BJD A;  2NZ4 A;  2DT9 A;  2UUA F;  2B4O A;  4BDP A;  3SCJ E;  4ZVP B;  1IBM J;  4AQY F;  2BEF A;  4L72 B;  4EU0 A;  2GGP B;  2YH1 A;  4CDI A;  2Q79 A;  5DRK A;  2VOD A;  2XYG B;  4USJ C;  2ZWO A;  2DHS A;  4QWD A;  4RU2 A;  3CW2 C;  2B51 A;  2UUC J;  1TP7 A;  2DB1 A;  2MJU A;  1MN9 A;  2DGQ A;  3D3B J;  2MDA A;  4M5K A;  4G3I A;  3QRQ A;  5KOX A;  1NDC A;  1NND A;  2JL9 A;  3V4I B;  4B3M J;  2DHG A;  3NY0 A;  2Y0B B;  5E3Q A;  1NKC A;  2GJ2 A;  1R8B A;  3K5P A;  5ADZ A;  5L39 A;  2W24 A;  2RHQ B;  3M2V B;  5IOL A;  1DBD A;  4D3G A;  2HZV A;  3MUT P;  1HBO B;  1FT8 A;  2XUL A;  1N8R T;  3K8W A;  2ZJP Q;  2CZ4 A;  3KLH A;  2X3G A;  3P45 B;  3D4J A;  1HBM A;  2H48 B;  2IM2 A;  4C11 B;  3HP6 A;  2CWX A;  4I7F B;  1YWX A;  1FWK A;  4DUT A;  4L6V 3;  1L3U A;  2UU9 F;  1YJU A;  2GA7 A;  1X7V A;  3KDN A;  2V67 A;  3NLC A;  2VB6 A;  1A9N B;  1FEH A;  1OO0 B;  2XWY A;  4F4Y A;  4PXB A;  5I3Q A;  4QWB A;  4NLR A;  5C5J A;  1HKA A;  6AT1 B;  1J5E J;  1JWW A;  4OZ1 A;  2VG6 A;  3MPW A;  2U1A A;  5HVG A;  2AYM A;  2ZOM A;  3AB4 B;  1V3Z A;  3T5K A;  2JVO A;  3PX6 A;  3CCV S;  5LJ5 Y;  1YRT A;  5CD4 H;  2FVQ A;  3BGF A;  1EET A;  4A4J A;  1JLE A;  3NP5 A;  1Y11 A;  2KZZ A;  1HPZ A;  3QAU A;  4P7V A;  3TX8 A;  2XHW A;  2V68 A;  3QYY A;  1IVZ A;  4CO2 A;  4N7T A;  2QL7 B;  1NKE A;  3E01 A;  2YQ0 A;  3HKW A;  5D0E A;  2Z30 B;  3EDR B;  3DI6 A;  2Z4P A;  2UVU A;  3CCS S;  4USK A;  2XM3 A;  3GFH A;  2D9P A;  4PXE A;  5KFY A;  2ZZM A;  4OX9 F;  2BBE A;  5J2M A;  2OEK A;  1EHW A;  4LF8 J;  2QGF B;  3DRS B;  4YY3 F;  1RKJ A;  1KQF B;  4LRE A;  2KDO A;  4DR2 F;  3KLH B;  4KBI A;  1WEZ A;  4O44 B;  4ILL A;  1HBM B;  1Q78 A;  3BQ2 A;  4ZVE A;  4DQI A;  3MI7 X;  5DZ6 A;  3TEH B;  2BJE A;  3SI8 A;  2W8K A;  2V8P A;  2WZ1 A;  1PAE X;  3IWL A;  2IDE A;  4Y2A A;  5DJB A;  5G4D A;  1HNX J;  2P9G A;  3RW6 A;  4X4N A;  3UE2 A;  4FKX A;  4EBD A;  2J6S A;  4LRB A;  3Q86 A;  2R9L A;  2FUG 9;  3PHT A;  2VG6 B;  1VQN S;  5CYJ A;  5BR8 F;  4C4W A;  1ITP A;  1X4H A;  4Q7A A;  4BCA A;  3D6F B;  1CJK A;  2R7Q A;  4TN2 A;  1EET B;  2VBW A;  3FMB A;  1JLE B;  1QLN A;  3QT8 A;  2KU7 A;  3NOG A;  1FXR A;  4P2X A;  1DTQ A;  3MUM P;  4JOU A;  4LF9 J;  2E5I A;  3E01 B;  4F3Q A;  4KTQ A;  3DI6 B;  5KT3 A;  1WKL A;  2EFN A;  2UUW A;  4R25 A; 
#chains in the Genus database with same CATH homology
 1F2H A;  1F3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...