1F2HA

Solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
169
structure length
169
Chain Sequence
b'MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
publication title Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 35
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f2hA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
2X51A 3SV4A 3DGVA 5B0FA 4R0EA 3AOCA 1JLBA 4QWDA 2ZH3A 4MTPA 1RTZA 2KYZA 3CCUS 2NXJA 4NLPA 2QEXS 1OWXA 2OPQA 1ZYQA 4DWIA 2OTJS 3P49B 3S6EA 1IKYA 3T6JA 1TL1B 4ED7A 5KFGA 1RT3B 3GYNA 1QUPA 5I42A 2Z56B 3QT8A 2BA9A 3KJFB 2HAFA 3AB2B 4NLRA 1RWXB 1CQNA 2G0CA 5D4NA 1M90T 1WF2A 4JI4F 1S59A 3OTBA 3MEEB 4ZOSA 3D1QA 1SB6A 4EK2A 4WXWA 4Q2LA 1TKTB 3BM7A 5ETTA 3FBFA 4OYPA 5M2PA 4KR0B 2YX4A 2B8QA 5DETA 1N5QA 1XMQJ 4YHHJ 4KHRA 4CTAA 3G8QA 2EC2A 1WKKA 4C0HA 1VI7A 3BPSP 4ALZA 4LBIA 2Z58B 3L7PA 2E29A 4DU8A 1N34J 1N32F 1RADB 1KFDA 3DLLQ 5I3PA 3EZOA 3HK2A 5K8NA 4OZ0A 4XTTA 1C2PA 2IYGA 4G1PA 3PHEA 1S1XA 2LECA 2WOMA 2DR9A 1LW2A 4NXNJ 3LP2B 3F44A 4O3RA 4DSKA 1YJRA 1DAXA 1RT1A 2AD9A 4DV7F 1NSAA 3EGVA 2Q6CA 2B9WA 5AXKA 4J9RA 1HWLA 4L75A 2I9SA 3R7NB 3OFHA 1VRTA 2V34A 5HO4A 1EX8A 4W4MA 1RGVA 4IQXA 4F4YA 5F3TA 1U7LA 2XYGB 9ATCB 2ZBIA 1LOUA 4HI2A 1DLOA 2K2PA 2RU9A 1G7CB 2V50A 2C2MB 1U8SA 4Z7CA 1RAHB 2X1GA 4DZDA 1S6QA 1OQ3A 5HN0A 2XMAA 4CYUB 1QE1B 2PIIA 2N7CA 4ED5A 5HMYA 4X66F 4DFKA 1S9GA 2HG4A 3SBMA 5B0BA 4U6PA 2CJAA 4LSZB 2B5JA 5A8KB 2BEFA 2F4VJ 4R5PA 1FT8A 3CCQS 2CYYA 3W3SA 4WFZA 1VQLS 1F9FA 1MN7A 4A47A 1HD1A 4FZVA 4H4MA 2XMWA 1I1GA 2ALYB 4X4VA 5F0WA 1SJ1A 5LM7E 4LF4J 1NZ8A 3PXGa 4ZITA 1JLCB 3QGHA 5HL7Q 4DQIA 3QWPA 4DL5A 4M95A 1VFJA 4HL9A 2HYIB 3FJ2A 1KTQA 2B9XA 3JTOA 3ZNUA 1SC6A 3HSDA 3R6GB 2D9PA 4ZCIA 2AW0A 3T19A 2VOPA 3D67A 2Y9HA 1MMDA 2XS5A 1PO6A 2R7OA 3KLGA 3QO9A 2HLTA 1M1HA 4F3QA 3UW1A 1F1BB 4QWEA 4URSA 4HT5A 3I55S 2HBYB 3IM9A 2V68A 2HHVA 3CCWA 4ES2A 2XGQA 2B4UA 1QLNA 5EWGA 1RHRB 2V4JA 4GKKJ 1C1CA 1L3UA 4JI0J 4ZJLA 2KXNB 2JFKA 3TX0A 2NYIA 2MKHA 4MYUA 1SQEA 2ILZA 4OQJA 3DHXA 2DGVA 1PAUB 1R0BG 1AA1B 1OY9A 3R5GA 3ET6B 1O6XA 3LP1A 4ED0A 4TLQA 4G1QB 4P73A 3L3CA 2RDJA 5LMNJ 4USIA 3FQKA 4MK9A 2R7VA 3FSXA 4LF6J 2VA3A 3GYGA 4NA3A 3A1YG 4N8NA 4ZPAA 3CEDA 1V3SA 4ID5A 1PBUA 2W4DA 3PEHA 1UW4A 2XLIA 2XHCA 3NGRA 1Q8BA 5D0RA 3NNCA 3O1LA 2ZC4A 3K89A 4DQPA 2IA6A 1K1SA 2WHOA 3NNHA 1GEHA 1RWPB 1K44A 1X31C 2GIQA 1WG1A 1PKUA 3QLHB 1N6QA 5DZ6A 3I5BA 5I3UA 3M2UA 1TZ0A 2BE2B 4NZ6A 1BY9A 1UWBA 3FQLA 3VWSA 5I4MA 3NP5A 3D1HA 2IRUA 2ZJPQ 2HNYA 4J9MA 5A6PA 1GK8A 2FZCB 1LNQA 1TUVA 4XPCA 3BBCA 2F1FA 1DTQA 5LMUF 2CJYB 3M32B 3QAUA 4PQAA 2BYCA 1U1NA 1J27A 4DPOA 2WVDA 2LKZA 3J80U 1WF0A 3CCMS 2Y0BB 3Q24A 1RT5B 3TEGA 4PQUA 3GJSB 3HZGA 3C2PA 3PW7A 4M5DA 1Z1ZA 2HGMA 2VQFJ 4R8UB 3BGRA 3PV8A 1UCNA 2QMXA 1N33J 2DTJA 5J2QA 2KZMA 3UD4P 3TANA 4RW7A 3JS9A 1PC5A 1BE4A 2EC0A 3TR5A 2GIRA 3HHNB 2Y1LB 1RA6A 1HQ2A 3KLVA 1X5OA 4KGZB 4DV0F 1VQMS 4X65J 5IS2A 5J1EB 3DOLA 1GQEA 4X4OA 2IYIA 4DQSA 3C16B 3M2VB 3S8SA 3DLBA 3RB0A 1T9UA 4LQ3A 4PXEA 2LMIA 4DS5A 4USKA 3B6BA 3IWNC 2X1FA 4OYMA 4V1Ak 2VL1A 1SQGA 1YLXA 2B43A 4L74A 1NK4A 1HKAA 1S7HA 4JI6F 2HIYA 3AFGA 3HHEA 1TL7A 2VDHA 4LSLB 2OPSA 3MAAA 3KMSA 2ZH9A 1FNXH 1X9WA 2JLGA 3MCOA 3P4UB 4WF9Q 1HI0P 3CB4A 3TYTA 1Q1KA 2VASA 1RWWB 1GX5A 3CC2S 3ZTQA 3CIMA 2FTRA 1AT1B 1UMJA 4Q0BB 4ED8A 2FC9A 4DV4F 2VBWA 2B4PA 4ILMA 2COLA 4ECQA 4K4ZA 3TZZA 3NS5A 3D4JA 2R7SA 2F4VF 2F63A 2HBQB 5EX0A 3KK1B 2R8GA 1ZTWA 2OUGA 4HLBA 2OELA 2OPPB 4GO5X 3C14B 1VS3A 1NCLA 4EFAC 3SEOA 5KFBA 3CD7A 2ZVSA 4C11A 2W2MP 2Z2MA 4CDIA 2DNPA 1UFKA 4FF2A 2K06A 1S48A 3BSNA 3GFZA 3EUNA 2HQCA 2H9ZA 2LFVA 4W90B 4LVOP 2DNNA 1UEVA 4IO1A 1HNVB 1Y5IB 1XJWB 3PHTA 3MDFA 1S5ZA 2JL9A 2I2YA 4UZCA 3VCDA 3MR7A 1TL1A 1W25A 2WSCC 3AT1B 3PO4A 4X64F 3DLJA 4F4AA 3H7HB 2JC1A 1YIJS 1RT6B 3MFHA 4USUA 2UXBJ 1UVMA 1MROA 4LF7F 1EZZB 2UVWA 3H25A 1OPZA 2XZDB 1PAEX 2AJ0A 2C2OB 1Z2LA 1SBRA 3FCWA 3GSIA 3L7UA 4ZLLA 1TKTA 3AA8A 2X1BA 3AJ1A 4RPFA 2ZHAA 1CC7A 2KB2A 1GAOA 5EX3A 1VIOA 2KTQA 1U1LA 3J81j 2V4RA 3BBBA 2YTCA 1XMOJ 2IAJA 5LMNF 3G6ES 5DDPC 3CTRA 1TUWA 3UD5A 3Q23A 1TFWA 3H2LA 4C3LA 2CPJA 3I0RB 5IOLA 5B0EA 4FYDA 1KN6A 4YQWA 1JLQB 3P45B 1ICEB 1V6HA 4FBUA 2DISA 2MZQA 2L48A 4Y2KA 3LP2A 3SCJE 4USMA 1EQMA 2JRSA 4IG0B 1NKCA 4CQ1A 4TY8B 4WE1A 1N88A 3G6XA 3MD3A 2QLJB 2MDAA 2QIFA 2QE5A 4MYTA 4DR5J 3HSGA 5DG9A 2CPIA 1VC5A 1H2UX 4IFVB 5CH7B 4IRKA 4JP8A 3OUYA 4IDKA 3EPIA 4ZP9A 4DL6A 4L73A 4HH0A 5KT5A 2MZSA 1JJCB 2BQ3A 2A2CA 2L9NA 3ILIA 1N8RT 1P9QC 2DY9A 3BYPA 5A8WA 5CCMA 5J1PA 3UDLA 2KJWA 1A7GE 3LPYA 3M8QA 3UCGA 1T3NA 3IC1A 1RWMB 2AT1B 2BABA 5K8OA 4LF8J 3FGVA 4CYUA 1QE1A 2AX0A 1KVJA 2CQCA 2RUGA 3EGNA 3W66A 1X0PA 3A3OB 3ENWA 4S0MA 3IN5A 1U1PA 3C8YA 1XMBA 2ZNZA 4KH1B 4YR3A 2Y1IA 5A8KA 1YRUA 2ZM6J 2M3DA 2PSZA 2ADCA 2YPZA 3MCSA 5HSPA 3K57A 4ZLJA 3POTA 3CULA 2VPXB 4RO0A 2UV8A 4IRCA 1A6LA 4RW4A 4M1KA 3U1NA 3VAJA 4DFJA 1HW9A 1RBOB 1VHFA 1JB0C 5B0DA 5KFYA 3PZPA 5HJYA 3KJQB 1PYTA 2M5YA 2WZ1A 3PYFA 2JLFA 4NX9A 3DNCA 2H3EB 4DPXA 1SH0A 3R2CJ 2QZ8A 2DH8A 2JVOA 3FFIB 1AB8A 2IJRA 1V5IB 3E01B 1HARA 3PW4A 1TK5A 1R0AB 1G4CA 5J2MA 3U02A 3GILA 3HHLA 2ZC3A 2YY3A 3GONA 2DR7A 3R8YA 1TTHB 1BQNA 2UUAJ 1T9TA 4ZIVA 1SH2A 3VAKA 4LFBJ 3MMAB 2B4OA 4QW9A 3I96A 1S6PA 2MXYA 4FXVA 2W9AA 3R5AA 1YJNS 3L9ZA 1OO0B 4PUOB 1JMTA 2QLFB 4G1QA 5CHCB 4U67Q 1VRQC 1IXKA 2XI2A 3PKYA 4OJ3A 2EBGA 4DXLA 3RG6A 1KOOA 4QIFA 2Z8QA 5HROB 5L1IA 2FHMA 1KLMB 1Q53A 4KPCA 1FXLA 2L41A 1Y7PA 2DRDA 4ES1A 1TR0A 5D8HB 2V2KA 3MM9B 2JNJA 4AQYJ 5AJ3J 5ETVA 4F2SA 1I94F 2GNKA 2IBKA 4CO0A 3BKTA 3QLHA 1FWPA 4ID8A 4H4KC 4HI1A 1U49A 2HFUA 4OYOA 5E3CA 1NJWA 4NPOA 1S4EA 3W63A 2ASLA 4M5LA 2A6OA 5DDQC 5A0YB 3W8GA 3DRPB 3CCJS 1O51A 2HK2A 3LOUA 4LMZA 4C8ZA 3IR7B 1CJKB 4PEOA 3MPVA 1JLEA 4JV5J 3M32A 2DY1A 4R25A 2CQ2A 5L46A 3AD7C 4K4XA 3KOAA 4BHQA 3PJXA 5KG5A 1RT5A 3R5CA 5D4OA 2V2VA 4Z37A 4TVAB 1YHQS 1YK9A 3CJSA 3VHQA 3E3XA 3FRZA 1H0HB 1IBKF 3EVWA 2KM8B 3MR5A 1M5HA 1XN9A 4J91A 5HANA 3W2WB 4I6AA 2RS2A 1VCTA 1LQ9A 2OFHX 3N5FA 3G96A 3DGPB 2I38A 2IJFA 1X8DA 1ZZNA 4ZVOB 2VJVA 3Q22A 3CMAS 2DJWA 5ETQA 4F36A 2VG6A 3KUEA 3M2VA 2VA2A 2V2QA 5K8PA 1B99A 3GJQB 2MHEA 1LKZA 2YH0A 1LWFA 3W9JA 4KC5A 4ZP8A 2VBYA 2VFTA 3IR5B 5KFRA 4KHMA 3EXYA 1K73T 4ENOA 2FLNA 4DR2J 5HVGA 1YQHA 1KS2A 3MMJA 1PCAA 4LF9J 2E5IA 3EM1A 2EFGA 2MPUA 4MIWA 3BQ0A 1IBLJ 2IC3A 3WDOA 1N0UA 1G1XA 2H5IB 2YNHB 3MTKA 1HWIA 1RAJA 5KG7A 3HMJG 3ZZZA 2OGUA 4LF5F 4A8KA 4HDHA 2LXUA 3JAMU 4KRWA 4KGXB 4USTA 1TV6A 1CLFA 3N79A 4LF8F 4WPAA 5KG6A 3MD1A 2BE9B 3PO5A 1FK9A 2MQLA 3UDVA 2NS1B 4J9PA 2AQ4A 2VPWB 1ZM9A 4B9VA 5I3QA 4JI5F 2AP6A 4C8KA 2IVFB 2HBZB 2FGCA 2CNOB 4DV6J 1BHNA 3DRYA 1DFDA 2RHQB 1H7WA 1WWHA 3QJJA 2Q3PA 2QTWA 1U09A 2KHCA 4W92B 1TK8A 2OPPA 1RE1B 2CG4A 2WAQD 5BYQA 2ZBCA 2HHQA 2GZOA 2F4FA 2F8HA 3S01A 3CDEA 1WJ9A 2O1PA 3RAQA 2ILYA 1T05A 1HNVA 2HVZA 4KKOA 3TUJC 4M5MA 3SI8A 4PYDA 2RMLA 1NK7A 2MZRA 1ZM3A 1KR4A 2AKWB 4F0KA 2BQUA 1RT6A 4A48A 4PXCA 3KG0A 3H5XA 3EDRB 1CC8A 2G4BA 1TKZB 2D9OA 1FKOB 1YSJA 4NI2A 1AYEA 4WYWA 1TMJA 2F3JA 4WP8A 1QAYA 5LJ5Y 1C4AA 1KRPA 2EBEA 4LFAF 2HNZA 1T9XA 3D1OA 4YUDA 2JOQA 4U95A 1ZH5A 2AYBA 4TU7A 1FJGF 4QW8A 3M1VB 2E7WA 3T5JA 2MQQA 2L3MA 1Y9OA 5H9EJ 3I32A 1VQ4S 1JQGA 4UUWA 5HMZA 4KQZA 1XNQF 3WZ0A 4DHVA 2C22A 4KPYA 4E8UA 1Q16B 1B7FA 2YQ3A 3NOGA 5M2UA 3HVAA 2DRBA 3US5A 5F9LA 2F5GA 5T14A 2N7YA 3R5BA 4FDFA 3RW6A 1S9FA 4I68A 4IOBA 4B9UA 3MECB 3JXOA 2VICA 1IR2A 4IG0A 3MEDB 3Q2SC 4TY8A 3MM8A 4LSNB 3J7AN 3VAFA 4RZRA 3KJNB 4WKRA 4UOCA 2MJNA 4F3OA 4HH1A 1EP4B 2DO0A 2YNIB 2EFQA 4LR7A 4GC7A 4ZMMA 2UUTA 1L3KA 3PX6A 1NK0A 5HBMA 3DI6B 1CEZA 2VQEJ 5D0EA 2V8HA 1RACB 5DGBA 1YVFA 2K3KA 1IBCB 4ED3A 3BGFA 5IQQA 4MKVA 2U2FA 1N5TA 4K8RA 3ILOA 3LP0B 2J7UA 2J0XA 4X4UA 2MSTA 5M2RA 1D1UA 1F2GA 1FWKA 3NMAA 4QCLA 3FCVA 5GAEI 1IKVB 2BANA 2Y8YA 3EDQB 1HD0A 2P6TA 3EPGA 1FVSA 4OX7A 4AD6A 2C42A 5CCLA 1X4HA 3MR6A 3J81Y 3KLIB 4Y2AA 1T02A 4RNOA 4HHJA 4K50A 5F8JA 5C42A 3KLFA 2I5JB 3H98A 2HRYA 5HMXA 1S57A 2VPYB 4RWWA 1MLAA 3LA0A 5KFJA 3W64A 1C0TB 5LOQA 2Y0SD 5BXIA 3LWMA 2BQRA 2J7WA 2K7JA 2P5VA 1DTTB 6AT1B 3DXBA 3UWTA 2AZ3A 2HHHF 5A76A 2V9KA 2XY5A 4DV5F 4I7FB 3HD1A 4I2PA 3IAS9 1Y11A 3PYDA 4OHZA 4RW6B 2R7XA 3JSYA 3NAHA 2EK6A 5KFEA 4LF2A 3OTCA 3MPDA 2RSQA 4A8YA 1MU2B 4RKUC 2MY8A 3CD0A 4LFCF 1PYSB 2PT0A 1RJJA 3FC9A 4RUAA 4YOEA 2UVRA 4YR2A 1KD1T 5AXNA 2E9TA 4RNNA 1RU1A 1RABB 3B4MA 2B4VA 3TARA 3CCZA 3O8WA 3TJAA 1ZAWA 2E5HA 2DNHA 2PMZD 2E5LF 1XNRF 3MUVP 2R2RA 2XMKA 3VALA 4QU7A 1U24A 3I0SB 4MT1A 3QT5A 2ZZNA 2D41A 5HMWA 2QMUB 4L6V3 5L1LA 1GMWD 4A8OA 3D6HB 3QJPA 5HROA 2FJAB 3QGPA 2F8MA 2KT3A 4FKXA 5CYMB 1KLMA 4FF1A 1ZM4A 3KNGA 4X4TA 2FZKB 3HVTB 2V8VA 3MM9A 1EAYC 4LRBA 5BR8F 4M94A 2DO4A 4CM2A 2HFSA 4DFMA 1NK5A 3VZIA 2XC9A 2DHXA 2P9EA 1Y5NB 3D2WA 2R42A 2BRKA 3N5BA 3KLEB 1HPZB 4PG5A 3TQ1A 3RRGA 5AT1B 1NJXA 4YDXA 3GIRA 2HWHA 4ECUA 3CF5Q 1IJEB 2F7VA 5A0YA 2ROEA 4KYZA 4ECRA 5U47A 4JI3F 3JSRA 1S0OA 2XMUA 4GMKA 4ED6A 2MKKA 4ZN3A 2E7XA 4M5NA 3GZ7A 1TK0A 5GAHI 3MM5B 2WW4A 4ELUA 2QLXA 2YKAA 2WW8A 2CUYA 2GHVC 1FRMA 1Q78A 3IBCB 1HWJA 1UEKA 3MI7X 5SUHA 2XG8A 1X0FA 4WU3A 4KE5A 2DEJA 2FZGB 4DG1A 3BKFA 3QFWA 3HPOA 2DGOA 4OX8A 2DNLA 3NXZA 2D69A 2E7VA 4DV1J 4YB6A 3R3TA 3NL0A 2KU7A 3Q8RB 1GTHA 4K4YA 3W2WA 1U1MA 4ECVA 1RT2B 2A6MA 2OJ3A 3CO0P 4K4UA 1WNEA 4N76A 3UD3P 4C0OC 1TL3B 2RQKA 3DGPA 2W7OA 1FNOA 4P2SA 2CDRB 4ZPDA 1WEZA 4YB1P 1QY7A 2HZCA 4B3TJ 2IRYA 1T8EA 4X62F 4OZ5A 4PYAA 4JYAF 2W2OP 3WX4A 4OI6A 2WB4A 2EVZA 3A8JA 2E1AA 5BYSA 3EYZA 2VODA 2W2QP 2VONA 2E5JA 3P6YC 5HJXA 2KZZA 5KFIA 1BC6A 1QSLA 5D77A 1HHTP 4JOUA 1X9SA 4RUBA 1UW9A 4FYVB 3M9MB 3EWGA 3JQKA 4IUFA 1XTZA 2YWGA 3QSIA 1DURA 5KFCA 2DCUB 3FCHA 1CS4B 5HI7A 2WSFC 1XIQA 5CD4A 3QIPB 1T95A 5DG8A 2LEAA 3TVZA 4DSJA 4Y6IA 5GAEU 5HVFA 3I31A 1WHXA 2JJ4D 4NCGB 2ZH5A 4DQRA 4PABA 4AT1B 1RK8A 2MLXA 3AY0A 2IMWP 3DYAA 1LEOA 1M5KC 5IV3A 3NGDA 1YTYA 2CPZA 3LPEA 3BSOA 3SFUA 2DKOB 1B4SA 2RF2B 1NPKA 5A2QY 1P1TA 3VZHA 3T1YF 4RLEA 3NKYA 1NXIA 3B8HA 4JI8J 4V19J 4JI2J 4LRDA 1KWMA 3QIDA 1W26A 1SPBP 4O3PA 2CPDA 3I5AA 4J7CA 1CJVA 3HSZA 3DLKB 3OR2B 5HP1A 2RDDA 3CW2C 4OJ1A 1JXEA 4L72B 4OZJA 5DQHA 1KEKA 3D6TB 2R9LA 4J9LA 1Q95G 1RBAA 1RAFB 4J90A 5GMDA 3CC7S 1X4EA 5KAKA 2MY7A 3M05A 4A8XA 2WONB 2C3MA 1RTJA 4NASA 4YP3A 4KFBB 4OV6A 4WP3A 4ZHRB 2RQMA 4G6VB 1APSA 4CZCA 3SSRA 3MMBB 4NLDA 2OLWA 2AEJA 2DXDA 2ZDOA 2GFFA 2JVRA 1ZAXA 1R6VA 1PC4A 1FKOA 2MTLA 4UOFA 1Y3JA 4KB7A 4YFUA 1O0PA 4ZPVR 5MLCV 3BEGB 4WTOB 1ZS6A 1CBKA 3MWBA 5FDLB 3WQPA 5H9FJ 1S1WB 2HS0A 2UP1A 1GMUA 1JLBB 4P2FA 1M5VC 1L5UA 1DRZA 2VPZB 2I6WA 2OPQB 3UDCA 4QR0A 4F7VA 3OFGA 1IQTA 3M30A 1CJTA 4OJGA 1IKYB 3FEYB 3F0NA 2UV8G 1NZAA 1S1UA 2ZNYA 5I42B 3P5BP 4ZPWR 2CJKA 4CO5A 1KNZA 3W5YA 2QA2A 5D6GA 4NLQA 4DX6A 3R1HA 1SH3A 2MYFA 4LSNA 3CC4S 2XWYA 4FNIA 3K5LA 1R31A 3N6NA 2R7WA 4C2MA 3OBIA 3GIKA 4CTAB 5LXYA 1EP4A 5RUBA 2YNIA 1Q7YT 1X5PA 3Q8QB 5GAHU 3GV5B 1O8BA 2D3O1 2MJUA 3KJVA 3MOJB 3PJ9A 1U6BA 2G9OA 4FS1A 1WHYA 1TAUA 4DSIA 4I6WA 4PXDA 4DCPB 1J2VA 1WI8A 4X4SA 3QT6A 2FPHX 2HVHA 4F4WA 1F3VA 1NBEB 3I82A 4CT8A 2YBVA 2Q6BA 2P6SA 3BREA 4HYKA 3TAMA 4A46A 5IWAJ 2WOMB 1Q5VA 5E3PA 1LW2B 4KH0B 1UA1A 1IKVA 4FYYB 4GRSA 1FVQA 3KYLA 4U8YA 1S49A 1RT1B 4KV8A 1VRUB 2MGZA 1ZPWX 3H4DA 3MUMP 3KLIA 3WIUA 2QT7A 1HFEL 4EEYA 1A0OB 2KO1A 1VRTB 1VQ9S 1C0TA 4LR8A 3P96A 4F50A 1RBLA 2O5DA 4ELVA 1RA7A 4ZP7A 3UQSA 4Q44A 4ZPTR 2J5AA 1DLOB 2GQCA 2JEGA 5CABA 1VHIA 5IC6B 2GMLA 2KVQE 3LGNA 2ZBRA 4I7FA 3DOMB 1UVIA 3DM2B 1S6QB 2FVSA 2ZJRQ 2L08A 4NEZA 1S6UA 3OV7A 1HNXF 4DLEA 1FJCA 3QQCD 3C6UA 4GKJJ 3PCOB 2BOPA 1S1TA 3ADAC 3QRRA 2RQ4A 5DQGA 3EGWB 1Z4UA 1S9GB 3WIVA 1D8ZA 4AL5A 4F25A 2OSQA 3PR4A 1X5SA 4ZIWA 2XSJB 5LJ3Y 1C1BA 4XDCA 2KG0A 3CIZA 2OSRA 2VIHA 4H4MB 4Q43A 3KK2A 5DRKA 3N0VA 4CT9A 3I0SA 3LALA 3MF5A 4EWTA 1RWVB 1X4BA 4I64A 5HK4A 2UXDF 4MAKA 1J5EF 1NEEA 3N6LA 1D9AA 3I5CA 2GIFA 1NHVA 2ZOMA 5HATA 4DR7J 2GJFA 3LGHA 2X1AA 1SI9A 4Z7YA 2FVPA 1Q86T 2XEXA 2PEBA 4O4GB 1KVKA 3GCXP 1F5CA 2MKJA 3QO9B 1QAIA 1RT7A 1H74A 1GTEA 3GV7B 4A8MP 5CQGA 4ECTA 5IC4B 3G87A 4DV2J 3CMES 2MHNA 3S1TA 4A8FA 1SJ4P 5F3ZA 3KLEA 1UZDA 2BM0A 3G8TA 4DL4A 2Z2LA 4NMXA 2F40A 4N56A 3M2RB 2HIQA 3NWGA 1WC4A 3UN3A 4CLFA 4DR4F 4QIWD 4PKDB 4DBQA 5KFMA 4DN9A 4NZ7A 1DQAA 3G2XA 3LP1B 1HHSA 5ETKA 5F8MA 1BWVA 2CQGA 3T6BA 3RAXA 4ZLPA 1YX2A 2OEKA 3ETMA 1G6BA 4WK1A 1WKJA 4CP5A 3VTIA 2V8PA 2CQHA 3TRGA 3H4BA 2NYHA 2E5GA 2J9DE 1R6YA 2KVIA 2RB7A 4OHXA 4A8SA 2AJ1A 2OO4A 3H42A 1N6QB 3ZZYA 5I3UB 1WG5A 4YEAA 3MCNA 3FK4A 1EKRA 4UY8T 1YBUA 3ZO7A 3CWJA 2P9CA 4NRUA 1IBMF 3UFCX 3ULHA 3DOKA 3JTNA 2HNYB 3CJ4A 1EARA 2PFFB 4ECZA 3MPUB 5T7LA 1RTHA 3J7YU 2FLOA 4UOGA 1DTQB 1CULA 2FHJA 3QPIA 1FJEB 3MMCA 2ZD1A 1BQMA 3PDNA 3TVKA 1SC1B 3DHWC 2YX1A 3UCZP 3SDEA 2VKRA 2H51B 1D9DA 2CIMA 1HR0J 1VQ6S 3J80Y 1R3NA 2CJ9A 1SUQA 1URRA 5LXRA 1MSWD 4M5DB 3UVJA 1NSPA 2EW9A 3FBCA 3CJKA 1RKJA 3BGRB 2GVZA 2J0WA 4PZVA 5KFSA 4N41A 5J2QB 2EFVA 4YY3F 1GXUA 3X3UA 1CS4A 1N36J 4RUCA 4AL7A 3A4TA 4RW7B 3I6PA 3QIPA 3OLBA 1MG7A 2I1RA 2NSCA 3A8IA 1SKWA 3SQOP 5IWAF 4X4NA 1S9EA 1FFWB 3GIMA 2Y1RI 2FJWA 1W2IA 4MKBA 2QLWA 4JV0A 1HBOB 2X7IA 2DNKA 3C19A 1JLFB 2CQ0A 1VR6A 1Y4ZB 3GG0A 3E8OA 3DRSB 3T1HF 3KXDA 2YWEA 2RF2A 2JLEA 2KFNA 4PG4A 2RHSB 3NBPB 3KUHA 2LU2A 2JDJA 3UR0A 1T94A 1NJZA 3CDBA 2CDQA 2XY6A 4QPTA 4BWJA 3MAAB 2AJ4A 4YB5A 4J9VA 4L3NA 3OL8A 2DPJA 5F8NA 1UVNA 4B3RF 4O0NA 1DQ9A 3NY0A 3MCMA 4L3KA 2V9WA 4NLOA 2QA1A 1MW7A 3U27A 4OFZA 2IJNA 3OVBA 2PFDA 3QGGA 3MM6A 5L1JA 5E3QA 1RZMA 3TNVA 1OYEA 1B3TA 3T5HA 1PSDA 3PW5A 2PD1A 3MM7A 3JYTB 2K7KA 4K7QA 1KBRA 2ERRA 3T9ZA 1UJ4A 5J1NA 1WACA 3EE3A 3R5DA 2R7RA 2ADBA 4QJVA 3DLEB 2FIUA 1S72S 1NKBA 1BWEA 4IOAQ 4NXMF 2BZ2A 3D6MB 3T9NA 3W61A 4YMEA 1KKHA 5C2GA 5JUMA 1NB2A 4PWWA 1REVB 1S1WA 2GHWA 2X3GA 4NLTA 2CPYA 1N56A 2GGPB 1SL1A 5D0HA 3A8KA 1CVJA 1PJ6A 2FJEB 3SQGA 4EGLA 1YJ7A 4X4RA 1RYRA 4P52A 4DV3J 2DH7A 2GJ2A 2MKSA 2RIJA 4UTGA 4B08A 1T03B 1NDCA 1NHUA 2W7PA 1MROB 1YDLA 3K8VA 2WSEC 3E51A 4HTIA 3HSJA 4BCAA 3CCES 3U1MA 2LQ8A 3CDUA 1OIAA 1WORA 3RB6A 2YXLA 6FDRA 2R8HA 2FJDB 4GC6A 2V5HG 1YWXA 4IH6A 3CJ2A 2Z30B 1WHWA 2WTFA 2PI4A 2UUBJ 4Y2IA 3BR9A 1PJ5A 2IAJB 1UFLA 4ER8A 5IT9U 4ZVQB 2DNZA 2AZ1A 3GG1A 4PCQA 3GIIA 2BXJA 2PC6A 1HI1A 3QNWB 1IWAA 1UETA 2ZH4A 3PX0A 4BC9A 3RB4A 4C0BA 2R2TA 1U0HA 1MWYA 4ANEA 1JNZB 2WB1D 2M0GB 3GFHA 5KT6A 3W2VB 4JB8B 4KSEB 4J9OA 1O5JA 4LR9A 1QVGR 1VRUA 3BH7B 4DCJB 2UU9F 2R7TA 4MH8A 1VYAA 3RB3A 5KFFA 5CD4H 2DNQA 4WE1B 3IAM9 5CYQA 5KG4A 2C3OA 1VQYA 3ETOA 3L4BC 3Q86A 1RLCL 3WC0A 1OMSA 2BVZA 2LEBA 3OUYB 4IDKB 3SCIE 1HNIA 2ZZMA 4CLLA 2E9RX 4KTQA 1SXLA 2WVEA 3DOMA 3DM2A 5A8WB 2QFIA 4PPDA 4DI6A 2NR0A 3M8QB 3PW0A 4DUYJ 1B0TA 5CYJA 3LO3A 1XERA 2KM8C 4JI1F 5DS7A 4OLPA 1NRKA 2YWKA 4TY9A 1IWGA 3CD5A 3DDKA 2RDIA 1UJ6A 2CWXA 2XSJA 4J9SA 3CVKA 1U8WA 2UXCF 3HULA 3L95X 3PRVA 4M5KA 4CLYA 3POTB 2R8IA 1M0SA 4RW4B 2DGWA 3D0HE 2GQ2A 4ZVRB 1BQXA 1JLAA 4F4ZA 1WELA 4ZVEA 3L7OA 4K0KF 2RUSA 1SJRA 3W5ZA 2ZUAA 4C8NA 4K59A 3KHLA 2UUCF 1RAAB 1VLYA 3D0IE 3UNGC 4DR1J 1RTIA 1RP5A 3H5UA 2QFJA 3TJ8A 2YKPA 2QSWA 2J0QD 3IS9B 4O4GA 2RH3A 3IGNA 4I56A 1Y0HA 2XO7A 1Q8KA 3I9V9 1NDPA 5J2MB 4MFBB 5ITHA 5AE2A 4ZPBA 4PG8A 3BGUA 3HHLB 1T7PA 3G8SA 4DUZF 2HVIA 3CNQP 1BQNB 2QO3A 2CFXA 3M2RA 3IRXB 5LSOA 2FLLA 1HYSA 2YKQA 1X60A 1EQ0A 4KGKA 1S6PB 4NYPA 5ETRA 2YKOA 1NDLA 3UI3A 1SJFA 2N82B 1ZA2B 2KFZA 2U1AA 3GJRB 5L8RC 1H2TZ 1HNZJ 4RWXA 2FC8A 1CG2A 3NG8A 4NLUA 3EVOA 1YZ7A 3AOAA 3MEGA 4ATNA 1C4CA 4ICLB 3PYGA 4KHPF 2XS7A 1KQFB 3HM9A 1F9EB 4AE5A 2DXEA 1SV5A 3K5OA 2QMWA 3NMRA 2XCPA 3ZC4A 1HNWJ 4DFPA 4ELTA 4URQU 2H4WB 2MQ8A 3BYRA 4AXIA 4NYOA 5KFPA 1KOHA 2NPIA 3J7ZT 1AROP 5KFNA 1HWUA 4Y2CA 4RNFA 1JLEB 2W9CB 2V0NA 5IV4A 4NEYA 1NU4A 3QZ7A 3B78A 1RUSA 3KLHA 4DX5A 4P7VA 1U1QA 2IBOA 3A3NB 2RNEA 3DDIA 1GMWA 2Y3YA 1UJ5A 1H2VZ 1XMQF 4YHHF 2NSBA 1FI4A 1WDTA 4OYXA 1N34F 1WHVA 3C15B 4GVBB 4OZ1A 5K20B 1YJWS 4I2QB 2LLZA 2EEYA 4DUTA 4QZVB 4NOHA 2H5JB 2DNRA 1K9MT 3HVWA 1F3FA 2HURA 2HMIA 2XNRA 4OI2A 4NZ0A 4NXNF 4K5RA 2VBXA 3MHYA 3ILLA 2NREA 2VG6B 4LQ9A 3DKDA 3UR3C 4J9QA 4F4KA 5C7PA 4QU6A 1HBOA 1JLFA 1RAGB 3KK3A 3MUTP 1LWFB 2AYEA 4OYAA 3DRSA 3VQTA 1ZTTA 1VC0A 3KFWX 4IG3A 3AQOA 2HSEB 4IH7A 3QATA 5B0AA 1HQEB 4HTJA 3V5RA 1Y00A 1IM4A 3NBPA 2M4MA 2KRBA 1FKAF 1VBYA 3AJ2A 2IC3B 2G1DA 1AFJA 4RUHA 5GAGI 2DB1A 2H54B 3PFOA 5J2NB 3HKWA 3OTEA 4AUKA 1I6JA 3CXCR 2QL5B 4FF4A 2J6UA 2EKYA 4ECSA 1NO8A 4USWA 4KO0A 3OVSA 3DFEA 2VFSA 1TV6B 1U45A 1RHQB 4X4PA 2EFPA 3JAMY 4D3GA 2FDNA 1YI2S 1FF2A 1V9OA 4O3OA 4DR3J 2ZH8A 4PG6A 1FK9B 1TP7A 3RUBL 2KT2A 2CQBA 2LQ9A 1S76D 2C2DA 3CJRA 5G0RB 4I69A 3O2IA 3JYTA 2K3IA 1UKUA 2ZEJA 3DLHA 2ZFHA 3M8WA 1N4LA 2DHSA 1DJ0A 1TQLA 3A12A 4EMDA 3DLEA 2XSFA 3AD8C 3RGIA 3CCTA 1X9MA 5E5NA 3ZTSA 2HWIA 4DSEA 5D0GA 2OHDA 1RB0A 2LDIA 3U1LA 1WTFA 2XBPA 1L3SA 4LF4F 1HMVA 1REVA 3M6VA 4CIOA 3CCVS 1XBWA 2GGPA 3IWLA 2WRMA 4ZVHA 1HBUA 4USJC 1T05B 1WC0A 2G1HA 4OZ3A 4Q8EA 4F67A 3NGKA 4KKOB 3LQVA 2PE8A 3OD2A 2FB0A 2LA4A 3HJFA 1LWEB 2YQ0A 3BPDA 1RWUA 5DJBA 3FBBA 2BJ8A 1T03A 3VGSA 1RU2A 2K8GA 1HI8A 2ACYA 2IDLA 3MOZA 1SJQA 1RCXB 3PTWA 3RBDA 2GW8A 4GKKF 4NI2B 4JI0F 3CCRS 3CCSS 5DZ7A 3LH2S 4H4OB 5DGAA 4CLWA 1WI6A 1LFPA 3BN7A 2HNDA 4WU2A 2HNZB 1WTBA 4JI4J 1VQNS 4C48A 2VH7A 1SKUB 2MQNA 4JV2A 1H73A 4B9MA 5K8MA 2R2SA 1HL6A 1RAOA 1R27B 4LF6F 2KRRA 2O3DA 2GQQA 4ZKAA 1WF1A 2D7SA 1OS5A 1B0VA 4B9TA 4MK7A 1OY8A 5KFXA 2ZDPA 1RISA 4RBTA 1N32J 2IY5B 3NEKA 2MB0B 2LQ5A 3R1LA 4X84A 5KFVA 4FPIA 2DEIA 4LF1A 1FTCA 3VVTA 3W2VA 3G9CA 1Y3KA 3Q89A 5KFQA 5K5MA 1IKXA 2ZH7A 4ILLA 2OKQA 3T3FA 2B51A 3MM8B 5K9FA 1P1LA 3GLJA 2QN6B 4OHWA 2M7SA 3TZXA 4YB7A 4CLTA 4TQSA 4HDGA 1U0SA 4DV7J 4DU7A 1RAIB 2CRLA 2V6AA 3M6UA 1VBKA 2DGQA 5HBMB 1V3RA 2VF3A 1YJVA 2IA0A 1R8HA 2A1BA 5L39A 2CG8A 2WVCA 4MJKA 1F5AA 1FESA 5KFTA 2BV3A 2HHPA 1S4FA 4LBHA 3ZZRA 5HVHA 2VQFF 1OQ6A 4WKYA 1UA0A 2H5EA 3AQPA 2BANB 5F9NA 5KFOA 1F5BA 4NLXA 3MAQA 1N33F 2XLJA 3QT7A 3VGVA 3EJMA 2KKHA 5C42B 3KLFB 2HHXA 2OD4A 4X66J 1X4DA 3NRBA 3FEXB 1LXJA 4LRFA 1RHMB 5H9EK 4UUXA 4B9NA 1UAWA 3Q8SB 3AD9C 3H40A 2LA6A 2C1EB 5A8RA 4X65F 2MKIA 4C8YA 1U25A 4A4JA 2OD6A 2VOOA 1P9YA 3T5LA 5F8GA 2BJ9A 3OJSA 5B09A 4DMZA 3VGUA 4DDFA 1Q0NA 4DPWA 2QA4G 4I2PB 3OPKA 3N01A 2XY7A 3W1YC 4OI4A 1H6KX 2DR6A 4ZJQA 2B3TB 4HKQA 3W5XA 4M63A 4B3SJ 5GAGU 1URNA 3HT3A 5KG2A 1U26A 3IS9A 1X4FA 3RBZA 4QYZJ 3D7SB 1N52B 1GXTA 1QM9A 2QC3A 3WBZA 2JFDA 4MFBA 2AGQA 1DBDA 1JK9B 1T9VA 2ROGA 4PWDA 5K14B 3OFFA 4DL0C 4ZVPB 3IRXA 4QWCA 4C98A 2B8PA 3TZWA 4CI0B 1QTMA 3H0PA 2VUGA 2IRXA 1VDHA 2FYXA 5L1KA 4CRJA 2C28A 5DDOC 2KDOA 2BRLA 4WIQA 7AT1B 3IBWA 5KT7A 4BLGA 1MN9A 5EWEA 2PDAA 5GMKa 5ETOA 2AV5A 4RW8A 1DZ5A 3C3LA 3KHRA 1SL2A 1R7IA 1HBMB 3OLAA 3M8SA 5KFLA 1JXVA 2V2ZA 4IO9Q 4OIXA 3CJQA 4ICLA 2N3LA 3OR1A 3TA1A 2Z4PA 1KONA 2BJEA 3AOBA 3W7BA 4YR0A 2C3UA 3LW5C 1Y5LB 2GMHA 2ZZTA 5THWA 4OHVA 4EO8A 4NA1A 3QZ8A 2DNOA 2Z0GA 4KJIA 1XR6A 1YITS 2CVIA 4HEA9 4G65A 1ZZFA 4B3OA 5ETPA 2MLYA 1FE0A 2XZTB 5CA5A 4OZ2A 4G1IA 4KIAA 2CZ9A 4P2XA 2M52A 2UXBF 2D3OR 1K8AT 1KSPA 3ICLA 2W9CA 1C0UB 2J9CA 3JQMA 1IKWB 4ED4A 3W65A 1YJTA 2W8LA 3FBEA 4BS2A 1U2RA 2H4YB 2VZ9A 1Q4RA 1FRJA 2KYXA 5LMUJ 3HJVA 1CPZA 2VDIA 3K58A 3I87A 1XQIA 2QRRA 1NLKL 4UZBA 2AYMA 1XMOF 2L9DA 2R3VA 3Q8UA 4DG1B 1U02A 1WC6A 4UOHA 2NQPA 3IG1B 4DX8H 3C15A 4GVBA 4I2QA 5KTQA 3CD6S 3HKZD 2Z57B 2V8DA 2J6SA 2FHKA 3V81A 3HT0A 4NCAA 5C24A 5F0UA 4FP9A 1HA1A 1LWCA 3RR8A 2XI3A 2GO8A 3UO0A 1VK8A 4YN3B 3C6TA 4PR6A 2GHPA 4EO6A 3SSQA 2Q43A 3W9IA 2OIHA 2FGOA 4DV0J 4UW2A 2AYGA 7FD1A 3J7A1 3I4HX 4ZCKA 4DR5F 1HQEA 3KHGA 2C3YA 4NYZA 2ROPA 1DHMA 2HLUA 5IM0A 5B0CA 3PIPQ 2JEIA 4M5GA 1VJWA 4OX6A 1U2CA 2HAIA 2GVDB 1RWKB 3LANA 1WOPA 1BUXA 3W60A 2RKIA 1OY6A 3HLUA 1WD6A 1NH7A 3OTOJ 5J2NA 3F41A 3KUGA 3K17A 1S1VA 3DLGB 3HX9A 1EB0A 1UP1A 1NPPA 4WZQA 2GO9A 3ZTRA 4WFBQ 2YKMB 1FEHA 3UDEA 4CH7A 4JI7J 2MEWA 3PIOQ 4K4WA 4JI6J 2N4CA 3OSNA 5E33A 4IOCQ 5IT4A 1TU0B 2Y8WA 4H54A 3PW2A 2ZWPA 2HFOA 4Y0FA 2B6AA 3DYAB 4U7UK 2CQ4A 2F9JA 5G0RA 5C25B 2ZM6F 4NL5A 3RU0A 1YJUA 4ZVUB 1HWKA 1VQOS 3BN4A 2MZ1A 1RWNB 4DV4J 3R97A 2EFNA 2UUWA 4IFYB 3RAMA 4ZP6A 3ZFVA 2DGTA 4RNMA 2HVDA 1YZ6A 4LRCA 1CJVB 3OL9A 5HP1B 5JMNA 4EU0A 1N54B 5LSLA 4TYAA 3UN2A 4OHYA 2H65B 2N3OA 1U4BA 4ED2A 5LT5A 4B3SF 2ZOGA 1UPPA 1EETB 2JZ5A 2FVRA 1FRHA 1LWEA 3JSBA 4XDDA 1RTJB 1S99A 2DGUA 3D5MA 4ITSA 3D3CJ 4TN2A 2BMBA 4QIGA 3ENVA 4PRFA 2RRAA 3MURP 4X64J 5E0OA 4P10A 4QOTA 2UUAF 2PEHA 4LFBF 3B82A 3AH6A 3EXCX 1PJ7A 2JHEA 2ABYA 4N77A 4H4OA 2BR0A 3M8YA 4LF7J 4O3NA 1D0EA 1U2FA 2A2DA 2BJ1A 3MTJA 1YJ9S 2OPRB 2YVSA 1DQ8A 2OMLA 2NUHA 2AEFA 4AFFA 5KFWA 1WC5A 2HFZA 2A3JA 1JX4A 2OEJA 1TL5A 2HQDA 2PMHA 1U1RA 2W9BB 1R8PA 5KT3A 3D9BA 3DMJA 1PBAA 3M30B 1CJTB 9RUBA 2HHUA 2XWXA 4DZ6A 1S1UB 1QD1A 4XPEA 4AQYF 5AJ3F 4Q45A 1YRXA 3G4SS 5ETNA 2M2BA 2B56A 1F6TA 2DK2A 2VG7A 2VU5A 1EJ7L 2WK4A 1U6FA 3VV2B 5F8IA 4OJHA 3TUZC 2FJVA 2YWWA 4FNHA 3HFZB 5D78A 2LCWA 3P3DA 2VKZG 1FFGB 4DF8A 1LFWA 4JV5F 4DS4A 2RRBA 4BWMA 3KJVB 1VIXA 2PA8D 3UN5A 3OL6A 1ZOTA 1CJUA 3BR8A 4Q2MA 4XIUA 1PG5B 4RU2A 1K0VA 1GXLA 2ZOFA 3P8BB 1QTNB 2BKNA 1TELA 2OEMA 3SCLE 2NXNA 1RT4A 4Q7AA 4FKYA 3TAMB 5EDWA 2YPYA 2CPFA 3CE8A 5HAOA 2M9KA 3WHIA 1TVRB 3U7JA 2GS8A 4KV8B 3HF5A 1RKIA 2MGZB 1NJYA 4OL8A 2H1YA 5H9FK 3CSKA 5E7OB 2QL7B 3O6QA 1AZSB 3D28A 1GNKA 2HHWA 2FUG9 3HFVA 4N7TA 4OLOA 3ENAA 4EZ9A 5C5JA 4ES3A 2ATLA 3D68A 2BJ7A 1HQUA 4QIVA 4DCOB 5FD1A 3OHAA 1B7YB 1TL4A 3QGIA 4DR2F 3BBFA 1VLOA 2O66A 2G2YA 1S97A 1KQKA 5IFMA 2GC8A 4FXWA 4LF9F 4DF4A 4D3HA 2C2KB 1IUJA 3JSMA 4DSFA 1IBLF 2ZBQA 2V67A 3TJ9A 3C6UB 2F8EX 1HLWA 4ZK7M 1IR1A 5AE3A 1S1TB 3OTOF 1JJHA 3X1LB 1SCJB 5KOWA 4EBEA 4CM0A 4OX9J 4JI7F 4E0DA 2RILA 2EXUA 5KG3A 2J0SD 3RR7A 4C3KA 5K14A 1C1BB 1L3VA 5DLGA 3JB9k 1NH8A 2DIUA 1G2EA 3KK2B 4YS2A 5AE1A 4C7QA 1T11A 2CZVC 1HHQA 4B9SA 4DQQA 2X3DA 5DO2A 1NK8A 4ZVGA 5FLXU 4CO4A 4TU8A 2DGSA 1Q8LA 4DV6F 1GFWB 3LAKA 2XMMA 1JLGA 1HBMA 4DN0A 4WFAQ 2CQ3A 4LUBA 2DCLA 1XR7A 1RT7B 2GA7A 2V63A 3THTA 3NAIA 3MXHP 1S0NA 3RRHA 1TKXB 2I0XA 3ILJA 2LYVA 3OQ2A 5HQ8A 4LVNP 4MIAA 2YKNA 2NPFA 4EI2A 4ANCA 4O4RA 2ZE2B 3L09A 4F26A 3GYXB 1WSRA 3AA9A 2V4QA 1YKWA 1I94J 4NLSA 4FYWB 3QMQA 5HQMA 2G0IA 1T9WA 3NOCA 4P2MA 1FEEA 2D3ZA 1GT8A 3H59A 4LREA 3B54A 2WVFA 1C0UA 1ELOA 1RT3A 3SMZA 3MEKA 1IKWA 1F0XA 5GVQA 3VQSA 4K4VA 1K0TA 2KL8A 1RTDB 1V5VA 2HRTA 2DGXA 2VC0A 3FDSA 1E6VB 1X5TA 4A8QA 2J9DA 3K59A 3MAHA 3MEEA 3R5JB 1REGX 4O44B 2VC1A 2KH9A 3GIJA 2OAUA 3IG1A 2SXLA 4UT4A 2R2UA 4QBUA 3CUNA 2NLWA 2OFGX 1R43A 2DH9A 2AJQA 3DOKB 4ANDA 2CWKA 3GMGA 1AW0A 4Q8FA 3V2UC 1IBKJ 3QSYB 1LV5A 1RCOB 3VF0B 5T7LB 1RTHB 2AF6A 4U96A 3CDWA 2JEFA 1CULB 4LBPA 1AFIA 2C2NA 2IM1A 2MZTA 3MMCB 1VJQA 2ZD1B 4PAAA 1BQMB 8RUCA 2LQBA 5F41A 4X4QA 4P72A 2K1RB 2W8KA 3SDEB 3ZXWA 1UPMB 3DU5A 1Q79A 1N5SA 5GADI 1SUQB 3M7VA 3M4XA 3PVXA 3IR6B 3UVJB 2VD3A 3OJUA 3CJKB 1KC8T 3FMWA 2GVDA 2Z2ZA 3KKFA 3IBFB 1R8CA 5A6WA 1R0CB 2GVZB 2RS8A 2VQEF 3R6LB 2LDYA 3HFKA 1JJ2R 3DLGA 3SZ2A 4OV1A 8ATCB 2YKMA 1FDDA 2E1RA 3BZQA 2QA4S 2P9GA 4NLGA 1UTAA 5DG7A 3ELHA 2YH1A 1OPIA 4CLUA 1SVDA 3GP9A 1S9EB 5ADZA 3RTVA 4LF5J 4U7UD 4Y2MA 1M5OC 3GR0A 5EHHA 1FWLA 2DR5A 4B02A 3BO2A 1TAQA 2LXIA 1Q82T 2ZBPA 3VAGA 2Q66A 5C25A 1BXNA 1IN0A 2F65A 1GH8A 1NM2A 1NK6A 1NSKL 2CJXB 1CSJA 7FDRA 1FRXA 3AJDA 3IP0A 4IFYA 1ROFA 4JI5J 2GAHC 1B64A 1XEZA 2QSFA 4DJBA 3PNIA 2XLKA 1NPRA 1F2HA 2XULA 2Y1JA 4L76A 4U7CA 2XZWA 4MIBA 4EYHB 2BJDA 3BB5A 2MLZA 3H2VE 1Q8IA 2G2OA 3JQJA 2W24A 3R9LA 4EYIB 4CO2A 1R8AA 3LTOA 5KT2A 4ECYA 1J5OB 3THPA 1JLCA 2HVEA 3HD2A 1EETA 4ZVTB 4OYWA 4WFXA 1LWXA 4NCBA 2B9YA 4NRTA 2AEMA 3BSCA 5IQ6A 1X4AA 3MM6B 1WEYA 5DM6Q 2E9ZA 4USVA 2W4PA 5B0GA 3NGSA 2LQJA 3M8PB 4OX9F 5SZTA 3MM7B 1JKHB 3K0JA 2P8IA 2AIRB 4F2RA 3G6YA 2BKOA 1FE4A 2ZKUA 4I67A 4EBDA 1RWOB 3NCRA 5EGYA 1FRIA 3NLCA 2FJBB 2HQ3A 1IJFB 2W25A 4ETXA 3OTDA 1KQGB 2OPRA 3TUIC 1ZETA 3W9HA 4DR6J 2QGFB 1UVJA 3FZ2A 5KFZA 5J2PB 2BDPA 2FHJD 5ETMA 3RRKA 2BACA 2DD8S 4LFAJ 2O01C 3ET6A 2W9BA 1JWWA 2BKPA 3PFEA 3SQGB 1FJGJ 2AMCB 2DITA 2V69A 4TQRA 1FCAA 4EUVA 2C3PA 2NXUA 3HHLC 2HK3A 3K7RA 4B3MJ 2APOA 4NA2A 4CCHA 3ZZUA 4J5OA 1XNQJ 1FX4A 1U1KA 1VBZA 2DXFA 2JSXA 1XWLA 1FA0A 4C8MA 4F0HA 1SKRA 4USHA 2D1CA 1SQFA 4Y3CA 3V4IB 3R27A 3Q2TC 3ZZOA 4J37A 4C4WA 3M6XA 2QLBB 3EZ5A 4DL2A 5HLFB 2BE2A 4DLGA 3T1AA 4WIIA 2R4FA 2ZHBA 2CADA 5BJRA 4FF3A 1U47A 4UY85 4ZPCA 5IT9Y 2N4DA 1VISA 2MQMA 1FO1A 3K5PA 3OVAA 1ACMB 2IM0A 3PKMA 4Y28C 3TZYA 3ISNC 4ZDNA 1U0HB 2QL9B 3AB4B 2XS2A 4NE9C 3IA0A 3QAEA 1NKEA 4DV1F 1TVRA 2CQPA 3T5KA 4YDDB 1MNEA 2VV5A 2WBRA 5CYQB 1AZSA 4R8UA 4RW9B 3HO1A 1SJ3P 4K2JA 3NWRA 4IKAA 1LXNA 2GAGC 3KMQA 2RRNA 1FRLA 3NGUA 4B3TF 1HNIB 3C46A 1LW0B 2HFVA 4WFYA 1WOSA 2FVQA 3NNAA 2XO6A 5GADU 2HGNA 3I56S 2IMOA 5J1EA 3HHKA 2C2RA 3C16A 4AXJA 4E2FB 2CPHA 2CJQA 1JIHA 5JVHQ 2HHHJ 2ZVIA 2ACMA 3TUPA 2CNKB 4DV5J 2HKEA 2HS3A 8AT1B 2NXEA 3GTYX 2HS4A 3BH6B 1D9FA 4LRAA 2FD2A 4RR5A 2G13A 4V19X 3QBCA 2EI5A 5F8LA 2DHHA 3MZIA 1X4CA 4LFCJ 5F8HA 1U48A 4HT7A 4LSLA 3KWMA 5DDRC 4IR1A 2OTLS 2NCKL 1VBXA 2R8JA 2O67A 2PGCA 2HEKA 1N5VA 1FKPB 2Q1LA 2L9WA 2ZH2A 4O0IA 3A3PB 2GX8A 3DC2A 3PG9A 1Q81T 3TAQA 2HHTA 1JLAB 4LIWA 2HFNA 2EPIA 3FVYA 3H5YA 2E5LJ 1XNRJ 5EN1A 4WK3A 2HWTA 4Q0BA 4UQGA 2CPXA 3KG4A 3FRYA 4DSLA 1ZA1B 4LJMA 3TVYA 3I4PA 3GWCA 1RTIB 4CNYA 3NS7B 4HACB 3SFGA 4M5HA 4JI8F 1T0TV 4JI2F 4DPYA 1DY3A 2YNGB 4C8OA 5CZVA 2JC0A 3Q8YA 6FD1A 4P9SA 3KK1A 3AAWB 4GVLA 4F04B 4PPZA 3C14A 2HHSA 2UVUA 3O44A 1V3ZA 1TKXA 2KXHA 3OXLA 1BMQB 2RD5C 3BKUA 1XC9A 2ZE2A 5BR8J 4LIRA 2I8EA 2RE1A 1HYSB 3GQCA 4IR9A 2AU0A 1ITPA 1FJ7A 4J9NA 3TOQA 1PYOB 1QAXA 2CNLB 4CO3A 3BV8A 1NB7A 3GE9A 2HRUA 1RI7A 4HHUA 2KI2A 3G82B 1MMNA 2ZHOA 1G3OA 4JI3J 3FEZA 4M5JA 3CJTA 3GJTB 2ZJQQ 3CDAA 1RTDA 1IQZA 4BC7A 2XMJA 3BQ1A 3KNAA 5L9XA 3MEGB 3RBXA 1E6VA 2WCXA 4I0WA 3FUYA 1S12A 4UF4A 4Y34A 4O44A 3CMQA 4DR6F 2HZVA 3VVUA 2QJ3A 1BD6A 4CLZA 1SV5B 4FBTA 4EZ6A 3SYZA 5LSRA 4BDPA 3ZNJ1 4OI3A 2DPIA 4J9UE 3V6JA 3UCUP 3I0RA 2H48B 2IM3A 4B3MF 3V6DB 3NGTA 1JLQA 1FDNA 2EG2A 1VQ8S 3PX4A 4U8VA 1I5OB 1WSVA 4ED1A 3OT9A 4CWBA 2ASDA 3KLHB 2B7CB 3ISZA 2K1RA 2ZKTA 1F60B 3HVRA 2QV6A 4FYXB 4HR2A 2CKWA 4CLKA 4X62J 3KG1A 2B7BB 1WKLA 4JYAJ 1FD2A 3EGZA 4PG7A 4MK8A 3G71S 4IQMA 2HQIA 2LEPA 2XNQA 5G4DA 4ZCLA 5IXUA 3GR1A 4KGMA 4IFVA 3UPFA 3SV3A 3W8PA 1H38A 3HHDA 4RNHA 2HMIB 3EX7B 3ZTPA 4JUZA 2CA9A 4C8LA 1VOMA 1TFYA 3ZZPA 3PY8A 3D6FB 1KLNA 1UVLA 1S7IA 3KK3B 3H20A 1R89A 1VQPS 3BO4A 2HW3A 2DNYA 1UWAA 4IG3B 2BM1A 1Q7LB 4TLRA 2BX6A 4ECXA 3PYEA 2W2PP 3LF0A 5IZHA 1OJ4A 2C2EA 4OZNA 5L9NA 3ZZ0A 2CQDA 3N6MA 3CJ8A 3T1YJ 1UL3A 1EIYB 2FQQB 5DM7Q 1I51B 4BBYA 1VQ5S 3PRDA 4ETZA 4KO0B 3K2YA 1J5OA 2CVEA 1SIWB 4GKJF 3IFEA 4N8OA 1X7VA 2DT9A 3V6KA 2ZUGA 2ZWOA 4M8LA 1A9NB 3MPWA 5D3GB 1PILA 3M8PA 4DOZA 2OMOA 3UNYA 3ITHB 1JKHA 4XK8C 3FFIA 1FDBA 4O23A 3E01A 3H8YA 2UVVA 4C6AA 3D54A 3AXKA 3EVMA 5KFUA 3DRRB 1R0AA 2CXEA 4FPRA 3FSIA 4ZCMA 3R2DJ 5L38A 1E6YB 2JX2A 3F73A 1HMVB 2VBZA 1FNMA 3MMAA 1SC3B 4KBIA 4X2BA 2E44A 5J2PA 3WX8A 1HBUB 4ZVFA 4TKTA 1F9HA 4ZS6A 2DBBA 4DR7F 4PUOA 1L3TA 2MSSA 3OFEA 5JJBA 1YGYA 1KP6A 1CQMA 2RAQA 2DVIA 2DR8A 4DV2F 5CXTA 3THVA 2W4CA 3RJMB 4B17A 3BS9A 1S0VA 3DDNA 1MWZA 3MPYA 1UFWA 1P6TA 2A10A 3V4IA 4OYBA 2MZJA 2R8KA 1M1KT 2FVCA 2CPEA 4CLPA 5HLFA 2WBMA 3W62A 4F8RA 1K1QA 1YBTA 2G2ZA 2HNDB 4NLVA 5D4LA 1DARA 5GMEA 5B08A 1QAJA 2DHGA 2LXFA 3KHHA 4ILRA 1RAEB 4DPTA 3DRPA 2RVJA 4OI0A 2RJZA 2QYCA 1N0VC 3NCQA 3CJ0A 1CJKA 3ONQA 3J7Z5 3SIPB 4WYLA 2LU1A 4B9LA 5LL6d 1N48A 4JV1A 2E1PA 3WC2A 2FJXA 1YBAA 3TAPA 2D74B 3S7RA 3DCAA 3VAIA 5C2CA 1IKXB 4Z2XA 1RSCA 4I4BA 5D4PA 1W2BR 4RW9A 4WP9A 2PN6A 1S6OA 4IH5A 1LK7A 1GMVA 1OSDA 3PACA 2HGLA 1NK9A 1IVZA 3N28A 2VG5B 4WXOA 1LW0A 5E2QA 4R0JA 3R7BB 5KFKA 2VJUA 4P75A 1S0MA 1VQ7S 1HR0F 2BJ3A 2J76E 1KHWA 4HHHA 4CLSA 2KN4A 1KDNA 1B0PA 1HNXJ 2EK1A 2BE7D 1FHTA 1N36F 3H2UB 2HZAA 2YNHA 3HI9A 1P27B 4NMLA 2BOAA 2GMJA 2DYAA 1UVKA 2AX1A 1FKPA 1YG0A 5A8RB 4KGVB 1WEXA 4RBUA 4P74A 4N47A 3GU0A 2YNFB 4C9DA 3O3LA 3NS6A 1PGZA 2EWHA 2AWZA 3VGTA 2AGOA 3G86A 1RDRA 1D09B 1KQSR 3HZEA 3CPWR 3QFHA 1NHKL 4MKAA 2KHDA 4HACA 3P5TL 2ZH1A 4HVZA 3NCPA 2VFRA 2UXDJ 2HPUA 1J5EJ 1VK3A 1HIYA 4NLYA 2YNGA 3M9OB 1TUGB 1WC3A 4TU9A 4K4TA 2KJVA 5D15A 2QG9B 3OW2R 1FRKA 3GFYA 1JNRB 2LVWA 2IIHA 4CNZA 3OXGA 2KFYA 3GB0A 4PWDB 2EG1A 2FY1A 2GJIA 1H7XA 1WOOA 1KVIA 3RBEA 2IDEA 4WCEQ 2A0FB 5KFDA 4MMOA 1NUEA 1WC1A 2QX0A 2RU3A 2DHAA 3CCLS 3BDEA 1VQKS 3BF4A 2POKA 3CO9A 2J6TA 1X4GA 4IYQA 2W2NP 4FVMA 4KT0C 4XO0A 1EKSA 3G82A 3TX8A 4DR4J 4RW8B 3GV8B 2NZCA 1NMEB 2MKYA 5DQIA 3AHPA 1U6ZA 4AL6A 2YWHA 1VQSA 4O3QA 1QUVA 2EKNA 4E98A 1TKZA 1HBNB 1QSYA 4IRDA 1Y10A 3GSDA 3SXLA 3OR1B 1UZHA 1N5YB 4P7TA 3C66A 3LAMA 2C2ZB 1SKSA 2YX7A 2VFUA 4OI1A 3M1VA 1S10A 4DV3F 3RYLA 3N4WA 3H5SA 3HXMA 4B3OB 1ZBTA 3FMBA 2M8DB 1ZAVA 3DN9A 2DIVA 5B7WA 1IBMJ 3V6DA 1QVFR 4ERDA 2VB6A 5KG1A 4QYZK 5DLFA 3K8WA 3UE2A 4DX7A 2A18A 5KFAA 2XCAA 4QIEA 4DEZA 4F3MA 3MECA 1IR0A 2AJ2A 3IRWP 4G3IA 3MEDA 3J7YI 2UUBF 3Q83A 4AYBD 1OYDA 3HCXA 1T9YA 1NSQA 2M8HA 3QRPA 1H98A 1T3OA 1VC6A 1H3DA 1Z2ZA 5AXMA 3QRQA 4K2XA 4QR1A 1ZM2A 2J7KA 4QWBA 2XHWA 4CH0S 2HQFA 5IT0A 4RL1A 3K5MA 2ZITA 2IHR1 3A8EA 1KTVA 3V81B 2BBEA 2HBRB 4ZA1A 3DI6A 5C24B 1K47A 2E66A 5FIIA 1LWCB 1QJHA 4YY3J 4W98A 2R7QA 3I9ZA 3A13A 3TQEA 1BLUA 3EZUA 5KG0A 3C6TB 1XR5A 3GFXA 3ENQA 3LP0A 1S1XB 3BDPA 3FZBA 3DRXA 3ZTOA 2KT5A 1FDAA 3HHLD 3BGLA 2E1CA 3DU6A 5KFHA 2FLPA 4RJVA 4RBVA 3DXSX 3J81U 1WDDA 3V4MA 5IM0B 4A8WA 3CGIA 3BGOP 2I5JA 3FSYA 2MQOA 3T1HJ 3H90A 2RKIB 1RHUB 2DNGA 1EHWA 3R7SB 5KT4A 2ALZA 1S1VB 3D3BJ 2F9DA 3FKBA 1DTTA 1LK5A 4DUYF 2XGPA 4OYZA 3RZAA 4QWAA 2NZ4A 3MGJA 4F02A 2E1MC 3IGVA 2J8SA 1PIEA 4GO7X 1AUSL 2XYPB 2V8GA 4B3RJ 2CJBA 5HQLA 4UQTA 3OHBA 4RW6A 1IM6A 2IM2A 3TA0A 2B6AB 2RQCA 5D3GA 3ISND 3ITHA 2XMTA 1MU2A 3EICA 5MAOA 3DRRA 4PXBA 2FY8A 4ZVSB 2B5JB 2QYGA 2PO4A 5JXSA 4WFNQ 2XB2D 2ASJA 1MWQA 2R7UA 1E6YA 4R5PB 3F56A 3KDNA 1B70B 3PEJA 3TP2A 4QR2A 4NLWA 5E41A 1NDKA 3IXQA 1SIZA 1KHVA 2B0GA 4NXMJ 2XQCA 3HDSA 4OZLA 3TW0A 1RQ0A 1AXQA 3PM9A 4DR1F 5FJ4A 2BW7A 4TNOA 2FHOB 3ZZTA 4FXDA 3OL7A 4ECWA 3B4DA 3RW7A 2LP4A 3M9NB 1FTRA 1D3WA 4NWBA 2IFXA 3D0GE 3PRBA 5CYMA 3BJYA 2CAJA 4URGA 2D3UA 5E3RA 3KLGB 1BGXT 1M5SA 3HVTA 3MR3A 2IVMA 1VMBA 1JXLA 3TEHB 2KG1A 2EFOA 4F0MA 5E3AA 3KTQA 4KY3A 2W7AA 5EWFA 3FNNA 2AJFE 3BO3A 3PJWA 1SC4B 5EUHA 4LT6A 1HPZA 2BUNA 2V4JB 1C1CB 3SCKE 1FFSB 2P2CB 2XYHB 3M6WA 4QYRA 1HNZF 2AHOB 4WZMA 2DRAA 3DMJB 2GV1A 2VFVA 4DL3A 2G0JA 4O3SA 2CNNB 5ETSA 2PA3A 3IWXA 4TYBA 3LGMA 3MM5A 1P8GA 1WG4A 1WUUA 1JJ4A 3IO1A 1R8BA 3MR2A 2GCFA 5AXLA 3LWLA 4ID5B 2RT3A 4WTYA 3VR1A 4TXSA 4QQBA 1HNWF 2VG7B 3M8RA 1S79A 2ASYA 2NUUG 2ATCB 2M70A 4FS2A 2Q79A 1ZPVA 3M2UB 3HP6A 1UEUA 2PMWA 4Q5VA 2UU9J 3TA2A 1HW8A 1UWBB 1M1GA 4OMFG 1RT2A 3CJ3A 1KFSA 1TL3A 1QDUB 2VG5A 1CJUB 3GPAA 4MKYA 3JTPA 1FD8A 1TMMA 1RT4B 1RXOB 3Q8VA 3QWUA 2WVBA 3V6HA 3EMTA 3TWZA 4Y65A 1AUDA 2IPOB 2JWNA 5BYRA 2MQPA 1RLDA 3N9UC 4RX6A 4PQUB 1I3OB 3GCWP 3Q8PB 4PWUA 4JI1J 1FERA 1VGYA 3AXMA 2UZAA 4J9KA 4ZN1A 2VHGA 1W7WA 2OI2A 1D8YA 4I1TA 1S77D 2XM3A 2ZH6A 4FN5A 2W01A 5JVGQ 3OXFA 2J9EA 4C3MA 1NAQA 1RHJB 2PI5A 4C97A 1FXDA 3G6VA 2YNFA 2UXCJ 5H1SV 4KAIA 1H72C 4CO1A 2KXFA 1HQUB 3D66A 4DPUA 2BW2A 2IVYA 4Y00A 4NCGA 3VAMA 3MFIA 3DOLB 3CT9A 4M5IA 1YRTA 2J8AA 4WWSA 2YWFA 4K0KJ 4N5SA 2CZ4A 4K4SA 3JSMB 3CJ5A 2V94A 5A2QU 2UUCJ 5CAAA 3IM8A 4P71A 1ULRA 3E2EA 4EBCA 4OYIA 4XAKA 3VAHA 2OP5A 5T41A 2XTJP 3AODA 1FX2A 4FVCA 1Q5YA 2XMVA 3IMQJ 1MMLA 1GX6A 1TL7B 3T41A 4U9RA 2OPSB 3OSPA 3DLKA 3OR2A 4I6YA 4P6QA 5CZXA 2AGPA 2OH2A 1M5PC 4WJBA 1RYSA 4DR3F 4DUZJ 1XK8A 1RHKB 2CQIA 4RU9A 5KOXA 2MKCA 2JEJA 4DL7A 2CQ1A 4H4KA 1TKDA 4ZLNA 3LUYA 3QYYA 4WBFA 1U1OA 4QPXA 2M88A 3TI0A 2WONA 5FLXY 4KFBA 5ETLA 1NJIT 2NXCA 4ZHRA 1JLGB 1SL0A 2HQGA 3MMBA 4ZJOA 2DNMA 2B9EA 3QJLA 2W1BA 1QSSA 2YQ1A 4F4XA 1HBNA 3BQ2A 3K5NA 4K5SA 1NNDA 3Q0AA 4CH1A 3BSAA 1N5YA 3SSSA 3TO8A 2JH3A 2Z2YB 2MMYA 3O5TB 3M8ZA 4JBCA 4C11B 1OSCA 3KDOA 2YKNB 4KHPJ 1FXRA 5FDLA 3PR5B
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 2X51 A;  3SV4 A;  3DGV A;  5B0F A;  4R0E A;  3AOC A;  1JLB A;  4QWD A;  2ZH3 A;  4MTP A;  1RTZ A;  2KYZ A;  3CCU S;  2NXJ A;  4NLP A;  2QEX S;  1OWX A;  2OPQ A;  1ZYQ A;  4DWI A;  2OTJ S;  3P49 B;  3S6E A;  1IKY A;  3T6J A;  1TL1 B;  4ED7 A;  5KFG A;  1RT3 B;  3GYN A;  1QUP A;  5I42 A;  2Z56 B;  3QT8 A;  2BA9 A;  3KJF B;  2HAF A;  3AB2 B;  4NLR A;  1RWX B;  1CQN A;  2G0C A;  5D4N A;  1M90 T;  1WF2 A;  4JI4 F;  1S59 A;  3OTB A;  3MEE B;  4ZOS A;  3D1Q A;  1SB6 A;  4EK2 A;  4WXW A;  4Q2L A;  1TKT B;  3BM7 A;  5ETT A;  3FBF A;  4OYP A;  5M2P A;  4KR0 B;  2YX4 A;  2B8Q A;  5DET A;  1N5Q A;  1XMQ J;  4YHH J;  4KHR A;  4CTA A;  3G8Q A;  2EC2 A;  1WKK A;  4C0H A;  1VI7 A;  3BPS P;  4ALZ A;  4LBI A;  2Z58 B;  3L7P A;  2E29 A;  4DU8 A;  1N34 J;  1N32 F;  1RAD B;  1KFD A;  3DLL Q;  5I3P A;  3EZO A;  3HK2 A;  5K8N A;  4OZ0 A;  4XTT A;  1C2P A;  2IYG A;  4G1P A;  3PHE A;  1S1X A;  2LEC A;  2WOM A;  2DR9 A;  1LW2 A;  4NXN J;  3LP2 B;  3F44 A;  4O3R A;  4DSK A;  1YJR A;  1DAX A;  1RT1 A;  2AD9 A;  4DV7 F;  1NSA A;  3EGV A;  2Q6C A;  2B9W A;  5AXK A;  4J9R A;  1HWL A;  4L75 A;  2I9S A;  3R7N B;  3OFH A;  1VRT A;  2V34 A;  5HO4 A;  1EX8 A;  4W4M A;  1RGV A;  4IQX A;  4F4Y A;  5F3T A;  1U7L A;  2XYG B;  9ATC B;  2ZBI A;  1LOU A;  4HI2 A;  1DLO A;  2K2P A;  2RU9 A;  1G7C B;  2V50 A;  2C2M B;  1U8S A;  4Z7C A;  1RAH B;  2X1G A;  4DZD A;  1S6Q A;  1OQ3 A;  5HN0 A;  2XMA A;  4CYU B;  1QE1 B;  2PII A;  2N7C A;  4ED5 A;  5HMY A;  4X66 F;  4DFK A;  1S9G A;  2HG4 A;  3SBM A;  5B0B A;  4U6P A;  2CJA A;  4LSZ B;  2B5J A;  5A8K B;  2BEF A;  2F4V J;  4R5P A;  1FT8 A;  3CCQ S;  2CYY A;  3W3S A;  4WFZ A;  1VQL S;  1F9F A;  1MN7 A;  4A47 A;  1HD1 A;  4FZV A;  4H4M A;  2XMW A;  1I1G A;  2ALY B;  4X4V A;  5F0W A;  1SJ1 A;  5LM7 E;  4LF4 J;  1NZ8 A;  3PXG a;  4ZIT A;  1JLC B;  3QGH A;  5HL7 Q;  4DQI A;  3QWP A;  4DL5 A;  4M95 A;  1VFJ A;  4HL9 A;  2HYI B;  3FJ2 A;  1KTQ A;  2B9X A;  3JTO A;  3ZNU A;  1SC6 A;  3HSD A;  3R6G B;  2D9P A;  4ZCI A;  2AW0 A;  3T19 A;  2VOP A;  3D67 A;  2Y9H A;  1MMD A;  2XS5 A;  1PO6 A;  2R7O A;  3KLG A;  3QO9 A;  2HLT A;  1M1H A;  4F3Q A;  3UW1 A;  1F1B B;  4QWE A;  4URS A;  4HT5 A;  3I55 S;  2HBY B;  3IM9 A;  2V68 A;  2HHV A;  3CCW A;  4ES2 A;  2XGQ A;  2B4U A;  1QLN A;  5EWG A;  1RHR B;  2V4J A;  4GKK J;  1C1C A;  1L3U A;  4JI0 J;  4ZJL A;  2KXN B;  2JFK A;  3TX0 A;  2NYI A;  2MKH A;  4MYU A;  1SQE A;  2ILZ A;  4OQJ A;  3DHX A;  2DGV A;  1PAU B;  1R0B G;  1AA1 B;  1OY9 A;  3R5G A;  3ET6 B;  1O6X A;  3LP1 A;  4ED0 A;  4TLQ A;  4G1Q B;  4P73 A;  3L3C A;  2RDJ A;  5LMN J;  4USI A;  3FQK A;  4MK9 A;  2R7V A;  3FSX A;  4LF6 J;  2VA3 A;  3GYG A;  4NA3 A;  3A1Y G;  4N8N A;  4ZPA A;  3CED A;  1V3S A;  4ID5 A;  1PBU A;  2W4D A;  3PEH A;  1UW4 A;  2XLI A;  2XHC A;  3NGR A;  1Q8B A;  5D0R A;  3NNC A;  3O1L A;  2ZC4 A;  3K89 A;  4DQP A;  2IA6 A;  1K1S A;  2WHO A;  3NNH A;  1GEH A;  1RWP B;  1K44 A;  1X31 C;  2GIQ A;  1WG1 A;  1PKU A;  3QLH B;  1N6Q A;  5DZ6 A;  3I5B A;  5I3U A;  3M2U A;  1TZ0 A;  2BE2 B;  4NZ6 A;  1BY9 A;  1UWB A;  3FQL A;  3VWS A;  5I4M A;  3NP5 A;  3D1H A;  2IRU A;  2ZJP Q;  2HNY A;  4J9M A;  5A6P A;  1GK8 A;  2FZC B;  1LNQ A;  1TUV A;  4XPC A;  3BBC A;  2F1F A;  1DTQ A;  5LMU F;  2CJY B;  3M32 B;  3QAU A;  4PQA A;  2BYC A;  1U1N A;  1J27 A;  4DPO A;  2WVD A;  2LKZ A;  3J80 U;  1WF0 A;  3CCM S;  2Y0B B;  3Q24 A;  1RT5 B;  3TEG A;  4PQU A;  3GJS B;  3HZG A;  3C2P A;  3PW7 A;  4M5D A;  1Z1Z A;  2HGM A;  2VQF J;  4R8U B;  3BGR A;  3PV8 A;  1UCN A;  2QMX A;  1N33 J;  2DTJ A;  5J2Q A;  2KZM A;  3UD4 P;  3TAN A;  4RW7 A;  3JS9 A;  1PC5 A;  1BE4 A;  2EC0 A;  3TR5 A;  2GIR A;  3HHN B;  2Y1L B;  1RA6 A;  1HQ2 A;  3KLV A;  1X5O A;  4KGZ B;  4DV0 F;  1VQM S;  4X65 J;  5IS2 A;  5J1E B;  3DOL A;  1GQE A;  4X4O A;  2IYI A;  4DQS A;  3C16 B;  3M2V B;  3S8S A;  3DLB A;  3RB0 A;  1T9U A;  4LQ3 A;  4PXE A;  2LMI A;  4DS5 A;  4USK A;  3B6B A;  3IWN C;  2X1F A;  4OYM A;  4V1A k;  2VL1 A;  1SQG A;  1YLX A;  2B43 A;  4L74 A;  1NK4 A;  1HKA A;  1S7H A;  4JI6 F;  2HIY A;  3AFG A;  3HHE A;  1TL7 A;  2VDH A;  4LSL B;  2OPS A;  3MAA A;  3KMS A;  2ZH9 A;  1FNX H;  1X9W A;  2JLG A;  3MCO A;  3P4U B;  4WF9 Q;  1HI0 P;  3CB4 A;  3TYT A;  1Q1K A;  2VAS A;  1RWW B;  1GX5 A;  3CC2 S;  3ZTQ A;  3CIM A;  2FTR A;  1AT1 B;  1UMJ A;  4Q0B B;  4ED8 A;  2FC9 A;  4DV4 F;  2VBW A;  2B4P A;  4ILM A;  2COL A;  4ECQ A;  4K4Z A;  3TZZ A;  3NS5 A;  3D4J A;  2R7S A;  2F4V F;  2F63 A;  2HBQ B;  5EX0 A;  3KK1 B;  2R8G A;  1ZTW A;  2OUG A;  4HLB A;  2OEL A;  2OPP B;  4GO5 X;  3C14 B;  1VS3 A;  1NCL A;  4EFA C;  3SEO A;  5KFB A;  3CD7 A;  2ZVS A;  4C11 A;  2W2M P;  2Z2M A;  4CDI A;  2DNP A;  1UFK A;  4FF2 A;  2K06 A;  1S48 A;  3BSN A;  3GFZ A;  3EUN A;  2HQC A;  2H9Z A;  2LFV A;  4W90 B;  4LVO P;  2DNN A;  1UEV A;  4IO1 A;  1HNV B;  1Y5I B;  1XJW B;  3PHT A;  3MDF A;  1S5Z A;  2JL9 A;  2I2Y A;  4UZC A;  3VCD A;  3MR7 A;  1TL1 A;  1W25 A;  2WSC C;  3AT1 B;  3PO4 A;  4X64 F;  3DLJ A;  4F4A A;  3H7H B;  2JC1 A;  1YIJ S;  1RT6 B;  3MFH A;  4USU A;  2UXB J;  1UVM A;  1MRO A;  4LF7 F;  1EZZ B;  2UVW A;  3H25 A;  1OPZ A;  2XZD B;  1PAE X;  2AJ0 A;  2C2O B;  1Z2L A;  1SBR A;  3FCW A;  3GSI A;  3L7U A;  4ZLL A;  1TKT A;  3AA8 A;  2X1B A;  3AJ1 A;  4RPF A;  2ZHA A;  1CC7 A;  2KB2 A;  1GAO A;  5EX3 A;  1VIO A;  2KTQ A;  1U1L A;  3J81 j;  2V4R A;  3BBB A;  2YTC A;  1XMO J;  2IAJ A;  5LMN F;  3G6E S;  5DDP C;  3CTR A;  1TUW A;  3UD5 A;  3Q23 A;  1TFW A;  3H2L A;  4C3L A;  2CPJ A;  3I0R B;  5IOL A;  5B0E A;  4FYD A;  1KN6 A;  4YQW A;  1JLQ B;  3P45 B;  1ICE B;  1V6H A;  4FBU A;  2DIS A;  2MZQ A;  2L48 A;  4Y2K A;  3LP2 A;  3SCJ E;  4USM A;  1EQM A;  2JRS A;  4IG0 B;  1NKC A;  4CQ1 A;  4TY8 B;  4WE1 A;  1N88 A;  3G6X A;  3MD3 A;  2QLJ B;  2MDA A;  2QIF A;  2QE5 A;  4MYT A;  4DR5 J;  3HSG A;  5DG9 A;  2CPI A;  1VC5 A;  1H2U X;  4IFV B;  5CH7 B;  4IRK A;  4JP8 A;  3OUY A;  4IDK A;  3EPI A;  4ZP9 A;  4DL6 A;  4L73 A;  4HH0 A;  5KT5 A;  2MZS A;  1JJC B;  2BQ3 A;  2A2C A;  2L9N A;  3ILI A;  1N8R T;  1P9Q C;  2DY9 A;  3BYP A;  5A8W A;  5CCM A;  5J1P A;  3UDL A;  2KJW A;  1A7G E;  3LPY A;  3M8Q A;  3UCG A;  1T3N A;  3IC1 A;  1RWM B;  2AT1 B;  2BAB A;  5K8O A;  4LF8 J;  3FGV A;  4CYU A;  1QE1 A;  2AX0 A;  1KVJ A;  2CQC A;  2RUG A;  3EGN A;  3W66 A;  1X0P A;  3A3O B;  3ENW A;  4S0M A;  3IN5 A;  1U1P A;  3C8Y A;  1XMB A;  2ZNZ A;  4KH1 B;  4YR3 A;  2Y1I A;  5A8K A;  1YRU A;  2ZM6 J;  2M3D A;  2PSZ A;  2ADC A;  2YPZ A;  3MCS A;  5HSP A;  3K57 A;  4ZLJ A;  3POT A;  3CUL A;  2VPX B;  4RO0 A;  2UV8 A;  4IRC A;  1A6L A;  4RW4 A;  4M1K A;  3U1N A;  3VAJ A;  4DFJ A;  1HW9 A;  1RBO B;  1VHF A;  1JB0 C;  5B0D A;  5KFY A;  3PZP A;  5HJY A;  3KJQ B;  1PYT A;  2M5Y A;  2WZ1 A;  3PYF A;  2JLF A;  4NX9 A;  3DNC A;  2H3E B;  4DPX A;  1SH0 A;  3R2C J;  2QZ8 A;  2DH8 A;  2JVO A;  3FFI B;  1AB8 A;  2IJR A;  1V5I B;  3E01 B;  1HAR A;  3PW4 A;  1TK5 A;  1R0A B;  1G4C A;  5J2M A;  3U02 A;  3GIL A;  3HHL A;  2ZC3 A;  2YY3 A;  3GON A;  2DR7 A;  3R8Y A;  1TTH B;  1BQN A;  2UUA J;  1T9T A;  4ZIV A;  1SH2 A;  3VAK A;  4LFB J;  3MMA B;  2B4O A;  4QW9 A;  3I96 A;  1S6P A;  2MXY A;  4FXV A;  2W9A A;  3R5A A;  1YJN S;  3L9Z A;  1OO0 B;  4PUO B;  1JMT A;  2QLF B;  4G1Q A;  5CHC B;  4U67 Q;  1VRQ C;  1IXK A;  2XI2 A;  3PKY A;  4OJ3 A;  2EBG A;  4DXL A;  3RG6 A;  1KOO A;  4QIF A;  2Z8Q A;  5HRO B;  5L1I A;  2FHM A;  1KLM B;  1Q53 A;  4KPC A;  1FXL A;  2L41 A;  1Y7P A;  2DRD A;  4ES1 A;  1TR0 A;  5D8H B;  2V2K A;  3MM9 B;  2JNJ A;  4AQY J;  5AJ3 J;  5ETV A;  4F2S A;  1I94 F;  2GNK A;  2IBK A;  4CO0 A;  3BKT A;  3QLH A;  1FWP A;  4ID8 A;  4H4K C;  4HI1 A;  1U49 A;  2HFU A;  4OYO A;  5E3C A;  1NJW A;  4NPO A;  1S4E A;  3W63 A;  2ASL A;  4M5L A;  2A6O A;  5DDQ C;  5A0Y B;  3W8G A;  3DRP B;  3CCJ S;  1O51 A;  2HK2 A;  3LOU A;  4LMZ A;  4C8Z A;  3IR7 B;  1CJK B;  4PEO A;  3MPV A;  1JLE A;  4JV5 J;  3M32 A;  2DY1 A;  4R25 A;  2CQ2 A;  5L46 A;  3AD7 C;  4K4X A;  3KOA A;  4BHQ A;  3PJX A;  5KG5 A;  1RT5 A;  3R5C A;  5D4O A;  2V2V A;  4Z37 A;  4TVA B;  1YHQ S;  1YK9 A;  3CJS A;  3VHQ A;  3E3X A;  3FRZ A;  1H0H B;  1IBK F;  3EVW A;  2KM8 B;  3MR5 A;  1M5H A;  1XN9 A;  4J91 A;  5HAN A;  3W2W B;  4I6A A;  2RS2 A;  1VCT A;  1LQ9 A;  2OFH X;  3N5F A;  3G96 A;  3DGP B;  2I38 A;  2IJF A;  1X8D A;  1ZZN A;  4ZVO B;  2VJV A;  3Q22 A;  3CMA S;  2DJW A;  5ETQ A;  4F36 A;  2VG6 A;  3KUE A;  3M2V A;  2VA2 A;  2V2Q A;  5K8P A;  1B99 A;  3GJQ B;  2MHE A;  1LKZ A;  2YH0 A;  1LWF A;  3W9J A;  4KC5 A;  4ZP8 A;  2VBY A;  2VFT A;  3IR5 B;  5KFR A;  4KHM A;  3EXY A;  1K73 T;  4ENO A;  2FLN A;  4DR2 J;  5HVG A;  1YQH A;  1KS2 A;  3MMJ A;  1PCA A;  4LF9 J;  2E5I A;  3EM1 A;  2EFG A;  2MPU A;  4MIW A;  3BQ0 A;  1IBL J;  2IC3 A;  3WDO A;  1N0U A;  1G1X A;  2H5I B;  2YNH B;  3MTK A;  1HWI A;  1RAJ A;  5KG7 A;  3HMJ G;  3ZZZ A;  2OGU A;  4LF5 F;  4A8K A;  4HDH A;  2LXU A;  3JAM U;  4KRW A;  4KGX B;  4UST A;  1TV6 A;  1CLF A;  3N79 A;  4LF8 F;  4WPA A;  5KG6 A;  3MD1 A;  2BE9 B;  3PO5 A;  1FK9 A;  2MQL A;  3UDV A;  2NS1 B;  4J9P A;  2AQ4 A;  2VPW B;  1ZM9 A;  4B9V A;  5I3Q A;  4JI5 F;  2AP6 A;  4C8K A;  2IVF B;  2HBZ B;  2FGC A;  2CNO B;  4DV6 J;  1BHN A;  3DRY A;  1DFD A;  2RHQ B;  1H7W A;  1WWH A;  3QJJ A;  2Q3P A;  2QTW A;  1U09 A;  2KHC A;  4W92 B;  1TK8 A;  2OPP A;  1RE1 B;  2CG4 A;  2WAQ D;  5BYQ A;  2ZBC A;  2HHQ A;  2GZO A;  2F4F A;  2F8H A;  3S01 A;  3CDE A;  1WJ9 A;  2O1P A;  3RAQ A;  2ILY A;  1T05 A;  1HNV A;  2HVZ A;  4KKO A;  3TUJ C;  4M5M A;  3SI8 A;  4PYD A;  2RML A;  1NK7 A;  2MZR A;  1ZM3 A;  1KR4 A;  2AKW B;  4F0K A;  2BQU A;  1RT6 A;  4A48 A;  4PXC A;  3KG0 A;  3H5X A;  3EDR B;  1CC8 A;  2G4B A;  1TKZ B;  2D9O A;  1FKO B;  1YSJ A;  4NI2 A;  1AYE A;  4WYW A;  1TMJ A;  2F3J A;  4WP8 A;  1QAY A;  5LJ5 Y;  1C4A A;  1KRP A;  2EBE A;  4LFA F;  2HNZ A;  1T9X A;  3D1O A;  4YUD A;  2JOQ A;  4U95 A;  1ZH5 A;  2AYB A;  4TU7 A;  1FJG F;  4QW8 A;  3M1V B;  2E7W A;  3T5J A;  2MQQ A;  2L3M A;  1Y9O A;  5H9E J;  3I32 A;  1VQ4 S;  1JQG A;  4UUW A;  5HMZ A;  4KQZ A;  1XNQ F;  3WZ0 A;  4DHV A;  2C22 A;  4KPY A;  4E8U A;  1Q16 B;  1B7F A;  2YQ3 A;  3NOG A;  5M2U A;  3HVA A;  2DRB A;  3US5 A;  5F9L A;  2F5G A;  5T14 A;  2N7Y A;  3R5B A;  4FDF A;  3RW6 A;  1S9F A;  4I68 A;  4IOB A;  4B9U A;  3MEC B;  3JXO A;  2VIC A;  1IR2 A;  4IG0 A;  3MED B;  3Q2S C;  4TY8 A;  3MM8 A;  4LSN B;  3J7A N;  3VAF A;  4RZR A;  3KJN B;  4WKR A;  4UOC A;  2MJN A;  4F3O A;  4HH1 A;  1EP4 B;  2DO0 A;  2YNI B;  2EFQ A;  4LR7 A;  4GC7 A;  4ZMM A;  2UUT A;  1L3K A;  3PX6 A;  1NK0 A;  5HBM A;  3DI6 B;  1CEZ A;  2VQE J;  5D0E A;  2V8H A;  1RAC B;  5DGB A;  1YVF A;  2K3K A;  1IBC B;  4ED3 A;  3BGF A;  5IQQ A;  4MKV A;  2U2F A;  1N5T A;  4K8R A;  3ILO A;  3LP0 B;  2J7U A;  2J0X A;  4X4U A;  2MST A;  5M2R A;  1D1U A;  1F2G A;  1FWK A;  3NMA A;  4QCL A;  3FCV A;  5GAE I;  1IKV B;  2BAN A;  2Y8Y A;  3EDQ B;  1HD0 A;  2P6T A;  3EPG A;  1FVS A;  4OX7 A;  4AD6 A;  2C42 A;  5CCL A;  1X4H A;  3MR6 A;  3J81 Y;  3KLI B;  4Y2A A;  1T02 A;  4RNO A;  4HHJ A;  4K50 A;  5F8J A;  5C42 A;  3KLF A;  2I5J B;  3H98 A;  2HRY A;  5HMX A;  1S57 A;  2VPY B;  4RWW A;  1MLA A;  3LA0 A;  5KFJ A;  3W64 A;  1C0T B;  5LOQ A;  2Y0S D;  5BXI A;  3LWM A;  2BQR A;  2J7W A;  2K7J A;  2P5V A;  1DTT B;  6AT1 B;  3DXB A;  3UWT A;  2AZ3 A;  2HHH F;  5A76 A;  2V9K A;  2XY5 A;  4DV5 F;  4I7F B;  3HD1 A;  4I2P A;  3IAS 9;  1Y11 A;  3PYD A;  4OHZ A;  4RW6 B;  2R7X A;  3JSY A;  3NAH A;  2EK6 A;  5KFE A;  4LF2 A;  3OTC A;  3MPD A;  2RSQ A;  4A8Y A;  1MU2 B;  4RKU C;  2MY8 A;  3CD0 A;  4LFC F;  1PYS B;  2PT0 A;  1RJJ A;  3FC9 A;  4RUA A;  4YOE A;  2UVR A;  4YR2 A;  1KD1 T;  5AXN A;  2E9T A;  4RNN A;  1RU1 A;  1RAB B;  3B4M A;  2B4V A;  3TAR A;  3CCZ A;  3O8W A;  3TJA A;  1ZAW A;  2E5H A;  2DNH A;  2PMZ D;  2E5L F;  1XNR F;  3MUV P;  2R2R A;  2XMK A;  3VAL A;  4QU7 A;  1U24 A;  3I0S B;  4MT1 A;  3QT5 A;  2ZZN A;  2D41 A;  5HMW A;  2QMU B;  4L6V 3;  5L1L A;  1GMW D;  4A8O A;  3D6H B;  3QJP A;  5HRO A;  2FJA B;  3QGP A;  2F8M A;  2KT3 A;  4FKX A;  5CYM B;  1KLM A;  4FF1 A;  1ZM4 A;  3KNG A;  4X4T A;  2FZK B;  3HVT B;  2V8V A;  3MM9 A;  1EAY C;  4LRB A;  5BR8 F;  4M94 A;  2DO4 A;  4CM2 A;  2HFS A;  4DFM A;  1NK5 A;  3VZI A;  2XC9 A;  2DHX A;  2P9E A;  1Y5N B;  3D2W A;  2R42 A;  2BRK A;  3N5B A;  3KLE B;  1HPZ B;  4PG5 A;  3TQ1 A;  3RRG A;  5AT1 B;  1NJX A;  4YDX A;  3GIR A;  2HWH A;  4ECU A;  3CF5 Q;  1IJE B;  2F7V A;  5A0Y A;  2ROE A;  4KYZ A;  4ECR A;  5U47 A;  4JI3 F;  3JSR A;  1S0O A;  2XMU A;  4GMK A;  4ED6 A;  2MKK A;  4ZN3 A;  2E7X A;  4M5N A;  3GZ7 A;  1TK0 A;  5GAH I;  3MM5 B;  2WW4 A;  4ELU A;  2QLX A;  2YKA A;  2WW8 A;  2CUY A;  2GHV C;  1FRM A;  1Q78 A;  3IBC B;  1HWJ A;  1UEK A;  3MI7 X;  5SUH A;  2XG8 A;  1X0F A;  4WU3 A;  4KE5 A;  2DEJ A;  2FZG B;  4DG1 A;  3BKF A;  3QFW A;  3HPO A;  2DGO A;  4OX8 A;  2DNL A;  3NXZ A;  2D69 A;  2E7V A;  4DV1 J;  4YB6 A;  3R3T A;  3NL0 A;  2KU7 A;  3Q8R B;  1GTH A;  4K4Y A;  3W2W A;  1U1M A;  4ECV A;  1RT2 B;  2A6M A;  2OJ3 A;  3CO0 P;  4K4U A;  1WNE A;  4N76 A;  3UD3 P;  4C0O C;  1TL3 B;  2RQK A;  3DGP A;  2W7O A;  1FNO A;  4P2S A;  2CDR B;  4ZPD A;  1WEZ A;  4YB1 P;  1QY7 A;  2HZC A;  4B3T J;  2IRY A;  1T8E A;  4X62 F;  4OZ5 A;  4PYA A;  4JYA F;  2W2O P;  3WX4 A;  4OI6 A;  2WB4 A;  2EVZ A;  3A8J A;  2E1A A;  5BYS A;  3EYZ A;  2VOD A;  2W2Q P;  2VON A;  2E5J A;  3P6Y C;  5HJX A;  2KZZ A;  5KFI A;  1BC6 A;  1QSL A;  5D77 A;  1HHT P;  4JOU A;  1X9S A;  4RUB A;  1UW9 A;  4FYV B;  3M9M B;  3EWG A;  3JQK A;  4IUF A;  1XTZ A;  2YWG A;  3QSI A;  1DUR A;  5KFC A;  2DCU B;  3FCH A;  1CS4 B;  5HI7 A;  2WSF C;  1XIQ A;  5CD4 A;  3QIP B;  1T95 A;  5DG8 A;  2LEA A;  3TVZ A;  4DSJ A;  4Y6I A;  5GAE U;  5HVF A;  3I31 A;  1WHX A;  2JJ4 D;  4NCG B;  2ZH5 A;  4DQR A;  4PAB A;  4AT1 B;  1RK8 A;  2MLX A;  3AY0 A;  2IMW P;  3DYA A;  1LEO A;  1M5K C;  5IV3 A;  3NGD A;  1YTY A;  2CPZ A;  3LPE A;  3BSO A;  3SFU A;  2DKO B;  1B4S A;  2RF2 B;  1NPK A;  5A2Q Y;  1P1T A;  3VZH A;  3T1Y F;  4RLE A;  3NKY A;  1NXI A;  3B8H A;  4JI8 J;  4V19 J;  4JI2 J;  4LRD A;  1KWM A;  3QID A;  1W26 A;  1SPB P;  4O3P A;  2CPD A;  3I5A A;  4J7C A;  1CJV A;  3HSZ A;  3DLK B;  3OR2 B;  5HP1 A;  2RDD A;  3CW2 C;  4OJ1 A;  1JXE A;  4L72 B;  4OZJ A;  5DQH A;  1KEK A;  3D6T B;  2R9L A;  4J9L A;  1Q95 G;  1RBA A;  1RAF B;  4J90 A;  5GMD A;  3CC7 S;  1X4E A;  5KAK A;  2MY7 A;  3M05 A;  4A8X A;  2WON B;  2C3M A;  1RTJ A;  4NAS A;  4YP3 A;  4KFB B;  4OV6 A;  4WP3 A;  4ZHR B;  2RQM A;  4G6V B;  1APS A;  4CZC A;  3SSR A;  3MMB B;  4NLD A;  2OLW A;  2AEJ A;  2DXD A;  2ZDO A;  2GFF A;  2JVR A;  1ZAX A;  1R6V A;  1PC4 A;  1FKO A;  2MTL A;  4UOF A;  1Y3J A;  4KB7 A;  4YFU A;  1O0P A;  4ZPV R;  5MLC V;  3BEG B;  4WTO B;  1ZS6 A;  1CBK A;  3MWB A;  5FDL B;  3WQP A;  5H9F J;  1S1W B;  2HS0 A;  2UP1 A;  1GMU A;  1JLB B;  4P2F A;  1M5V C;  1L5U A;  1DRZ A;  2VPZ B;  2I6W A;  2OPQ B;  3UDC A;  4QR0 A;  4F7V A;  3OFG A;  1IQT A;  3M30 A;  1CJT A;  4OJG A;  1IKY B;  3FEY B;  3F0N A;  2UV8 G;  1NZA A;  1S1U A;  2ZNY A;  5I42 B;  3P5B P;  4ZPW R;  2CJK A;  4CO5 A;  1KNZ A;  3W5Y A;  2QA2 A;  5D6G A;  4NLQ A;  4DX6 A;  3R1H A;  1SH3 A;  2MYF A;  4LSN A;  3CC4 S;  2XWY A;  4FNI A;  3K5L A;  1R31 A;  3N6N A;  2R7W A;  4C2M A;  3OBI A;  3GIK A;  4CTA B;  5LXY A;  1EP4 A;  5RUB A;  2YNI A;  1Q7Y T;  1X5P A;  3Q8Q B;  5GAH U;  3GV5 B;  1O8B A;  2D3O 1;  2MJU A;  3KJV A;  3MOJ B;  3PJ9 A;  1U6B A;  2G9O A;  4FS1 A;  1WHY A;  1TAU A;  4DSI A;  4I6W A;  4PXD A;  4DCP B;  1J2V A;  1WI8 A;  4X4S A;  3QT6 A;  2FPH X;  2HVH A;  4F4W A;  1F3V A;  1NBE B;  3I82 A;  4CT8 A;  2YBV A;  2Q6B A;  2P6S A;  3BRE A;  4HYK A;  3TAM A;  4A46 A;  5IWA J;  2WOM B;  1Q5V A;  5E3P A;  1LW2 B;  4KH0 B;  1UA1 A;  1IKV A;  4FYY B;  4GRS A;  1FVQ A;  3KYL A;  4U8Y A;  1S49 A;  1RT1 B;  4KV8 A;  1VRU B;  2MGZ A;  1ZPW X;  3H4D A;  3MUM P;  3KLI A;  3WIU A;  2QT7 A;  1HFE L;  4EEY A;  1A0O B;  2KO1 A;  1VRT B;  1VQ9 S;  1C0T A;  4LR8 A;  3P96 A;  4F50 A;  1RBL A;  2O5D A;  4ELV A;  1RA7 A;  4ZP7 A;  3UQS A;  4Q44 A;  4ZPT R;  2J5A A;  1DLO B;  2GQC A;  2JEG A;  5CAB A;  1VHI A;  5IC6 B;  2GML A;  2KVQ E;  3LGN A;  2ZBR A;  4I7F A;  3DOM B;  1UVI A;  3DM2 B;  1S6Q B;  2FVS A;  2ZJR Q;  2L08 A;  4NEZ A;  1S6U A;  3OV7 A;  1HNX F;  4DLE A;  1FJC A;  3QQC D;  3C6U A;  4GKJ J;  3PCO B;  2BOP A;  1S1T A;  3ADA C;  3QRR A;  2RQ4 A;  5DQG A;  3EGW B;  1Z4U A;  1S9G B;  3WIV A;  1D8Z A;  4AL5 A;  4F25 A;  2OSQ A;  3PR4 A;  1X5S A;  4ZIW A;  2XSJ B;  5LJ3 Y;  1C1B A;  4XDC A;  2KG0 A;  3CIZ A;  2OSR A;  2VIH A;  4H4M B;  4Q43 A;  3KK2 A;  5DRK A;  3N0V A;  4CT9 A;  3I0S A;  3LAL A;  3MF5 A;  4EWT A;  1RWV B;  1X4B A;  4I64 A;  5HK4 A;  2UXD F;  4MAK A;  1J5E F;  1NEE A;  3N6L A;  1D9A A;  3I5C A;  2GIF A;  1NHV A;  2ZOM A;  5HAT A;  4DR7 J;  2GJF A;  3LGH A;  2X1A A;  1SI9 A;  4Z7Y A;  2FVP A;  1Q86 T;  2XEX A;  2PEB A;  4O4G B;  1KVK A;  3GCX P;  1F5C A;  2MKJ A;  3QO9 B;  1QAI A;  1RT7 A;  1H74 A;  1GTE A;  3GV7 B;  4A8M P;  5CQG A;  4ECT A;  5IC4 B;  3G87 A;  4DV2 J;  3CME S;  2MHN A;  3S1T A;  4A8F A;  1SJ4 P;  5F3Z A;  3KLE A;  1UZD A;  2BM0 A;  3G8T A;  4DL4 A;  2Z2L A;  4NMX A;  2F40 A;  4N56 A;  3M2R B;  2HIQ A;  3NWG A;  1WC4 A;  3UN3 A;  4CLF A;  4DR4 F;  4QIW D;  4PKD B;  4DBQ A;  5KFM A;  4DN9 A;  4NZ7 A;  1DQA A;  3G2X A;  3LP1 B;  1HHS A;  5ETK A;  5F8M A;  1BWV A;  2CQG A;  3T6B A;  3RAX A;  4ZLP A;  1YX2 A;  2OEK A;  3ETM A;  1G6B A;  4WK1 A;  1WKJ A;  4CP5 A;  3VTI A;  2V8P A;  2CQH A;  3TRG A;  3H4B A;  2NYH A;  2E5G A;  2J9D E;  1R6Y A;  2KVI A;  2RB7 A;  4OHX A;  4A8S A;  2AJ1 A;  2OO4 A;  3H42 A;  1N6Q B;  3ZZY A;  5I3U B;  1WG5 A;  4YEA A;  3MCN A;  3FK4 A;  1EKR A;  4UY8 T;  1YBU A;  3ZO7 A;  3CWJ A;  2P9C A;  4NRU A;  1IBM F;  3UFC X;  3ULH A;  3DOK A;  3JTN A;  2HNY B;  3CJ4 A;  1EAR A;  2PFF B;  4ECZ A;  3MPU B;  5T7L A;  1RTH A;  3J7Y U;  2FLO A;  4UOG A;  1DTQ B;  1CUL A;  2FHJ A;  3QPI A;  1FJE B;  3MMC A;  2ZD1 A;  1BQM A;  3PDN A;  3TVK A;  1SC1 B;  3DHW C;  2YX1 A;  3UCZ P;  3SDE A;  2VKR A;  2H51 B;  1D9D A;  2CIM A;  1HR0 J;  1VQ6 S;  3J80 Y;  1R3N A;  2CJ9 A;  1SUQ A;  1URR A;  5LXR A;  1MSW D;  4M5D B;  3UVJ A;  1NSP A;  2EW9 A;  3FBC A;  3CJK A;  1RKJ A;  3BGR B;  2GVZ A;  2J0W A;  4PZV A;  5KFS A;  4N41 A;  5J2Q B;  2EFV A;  4YY3 F;  1GXU A;  3X3U A;  1CS4 A;  1N36 J;  4RUC A;  4AL7 A;  3A4T A;  4RW7 B;  3I6P A;  3QIP A;  3OLB A;  1MG7 A;  2I1R A;  2NSC A;  3A8I A;  1SKW A;  3SQO P;  5IWA F;  4X4N A;  1S9E A;  1FFW B;  3GIM A;  2Y1R I;  2FJW A;  1W2I A;  4MKB A;  2QLW A;  4JV0 A;  1HBO B;  2X7I A;  2DNK A;  3C19 A;  1JLF B;  2CQ0 A;  1VR6 A;  1Y4Z B;  3GG0 A;  3E8O A;  3DRS B;  3T1H F;  3KXD A;  2YWE A;  2RF2 A;  2JLE A;  2KFN A;  4PG4 A;  2RHS B;  3NBP B;  3KUH A;  2LU2 A;  2JDJ A;  3UR0 A;  1T94 A;  1NJZ A;  3CDB A;  2CDQ A;  2XY6 A;  4QPT A;  4BWJ A;  3MAA B;  2AJ4 A;  4YB5 A;  4J9V A;  4L3N A;  3OL8 A;  2DPJ A;  5F8N A;  1UVN A;  4B3R F;  4O0N A;  1DQ9 A;  3NY0 A;  3MCM A;  4L3K A;  2V9W A;  4NLO A;  2QA1 A;  1MW7 A;  3U27 A;  4OFZ A;  2IJN A;  3OVB A;  2PFD A;  3QGG A;  3MM6 A;  5L1J A;  5E3Q A;  1RZM A;  3TNV A;  1OYE A;  1B3T A;  3T5H A;  1PSD A;  3PW5 A;  2PD1 A;  3MM7 A;  3JYT B;  2K7K A;  4K7Q A;  1KBR A;  2ERR A;  3T9Z A;  1UJ4 A;  5J1N A;  1WAC A;  3EE3 A;  3R5D A;  2R7R A;  2ADB A;  4QJV A;  3DLE B;  2FIU A;  1S72 S;  1NKB A;  1BWE A;  4IOA Q;  4NXM F;  2BZ2 A;  3D6M B;  3T9N A;  3W61 A;  4YME A;  1KKH A;  5C2G A;  5JUM A;  1NB2 A;  4PWW A;  1REV B;  1S1W A;  2GHW A;  2X3G A;  4NLT A;  2CPY A;  1N56 A;  2GGP B;  1SL1 A;  5D0H A;  3A8K A;  1CVJ A;  1PJ6 A;  2FJE B;  3SQG A;  4EGL A;  1YJ7 A;  4X4R A;  1RYR A;  4P52 A;  4DV3 J;  2DH7 A;  2GJ2 A;  2MKS A;  2RIJ A;  4UTG A;  4B08 A;  1T03 B;  1NDC A;  1NHU A;  2W7P A;  1MRO B;  1YDL A;  3K8V A;  2WSE C;  3E51 A;  4HTI A;  3HSJ A;  4BCA A;  3CCE S;  3U1M A;  2LQ8 A;  3CDU A;  1OIA A;  1WOR A;  3RB6 A;  2YXL A;  6FDR A;  2R8H A;  2FJD B;  4GC6 A;  2V5H G;  1YWX A;  4IH6 A;  3CJ2 A;  2Z30 B;  1WHW A;  2WTF A;  2PI4 A;  2UUB J;  4Y2I A;  3BR9 A;  1PJ5 A;  2IAJ B;  1UFL A;  4ER8 A;  5IT9 U;  4ZVQ B;  2DNZ A;  2AZ1 A;  3GG1 A;  4PCQ A;  3GII A;  2BXJ A;  2PC6 A;  1HI1 A;  3QNW B;  1IWA A;  1UET A;  2ZH4 A;  3PX0 A;  4BC9 A;  3RB4 A;  4C0B A;  2R2T A;  1U0H A;  1MWY A;  4ANE A;  1JNZ B;  2WB1 D;  2M0G B;  3GFH A;  5KT6 A;  3W2V B;  4JB8 B;  4KSE B;  4J9O A;  1O5J A;  4LR9 A;  1QVG R;  1VRU A;  3BH7 B;  4DCJ B;  2UU9 F;  2R7T A;  4MH8 A;  1VYA A;  3RB3 A;  5KFF A;  5CD4 H;  2DNQ A;  4WE1 B;  3IAM 9;  5CYQ A;  5KG4 A;  2C3O A;  1VQY A;  3ETO A;  3L4B C;  3Q86 A;  1RLC L;  3WC0 A;  1OMS A;  2BVZ A;  2LEB A;  3OUY B;  4IDK B;  3SCI E;  1HNI A;  2ZZM A;  4CLL A;  2E9R X;  4KTQ A;  1SXL A;  2WVE A;  3DOM A;  3DM2 A;  5A8W B;  2QFI A;  4PPD A;  4DI6 A;  2NR0 A;  3M8Q B;  3PW0 A;  4DUY J;  1B0T A;  5CYJ A;  3LO3 A;  1XER A;  2KM8 C;  4JI1 F;  5DS7 A;  4OLP A;  1NRK A;  2YWK A;  4TY9 A;  1IWG A;  3CD5 A;  3DDK A;  2RDI A;  1UJ6 A;  2CWX A;  2XSJ A;  4J9S A;  3CVK A;  1U8W A;  2UXC F;  3HUL A;  3L95 X;  3PRV A;  4M5K A;  4CLY A;  3POT B;  2R8I A;  1M0S A;  4RW4 B;  2DGW A;  3D0H E;  2GQ2 A;  4ZVR B;  1BQX A;  1JLA A;  4F4Z A;  1WEL A;  4ZVE A;  3L7O A;  4K0K F;  2RUS A;  1SJR A;  3W5Z A;  2ZUA A;  4C8N A;  4K59 A;  3KHL A;  2UUC F;  1RAA B;  1VLY A;  3D0I E;  3UNG C;  4DR1 J;  1RTI A;  1RP5 A;  3H5U A;  2QFJ A;  3TJ8 A;  2YKP A;  2QSW A;  2J0Q D;  3IS9 B;  4O4G A;  2RH3 A;  3IGN A;  4I56 A;  1Y0H A;  2XO7 A;  1Q8K A;  3I9V 9;  1NDP A;  5J2M B;  4MFB B;  5ITH A;  5AE2 A;  4ZPB A;  4PG8 A;  3BGU A;  3HHL B;  1T7P A;  3G8S A;  4DUZ F;  2HVI A;  3CNQ P;  1BQN B;  2QO3 A;  2CFX A;  3M2R A;  3IRX B;  5LSO A;  2FLL A;  1HYS A;  2YKQ A;  1X60 A;  1EQ0 A;  4KGK A;  1S6P B;  4NYP A;  5ETR A;  2YKO A;  1NDL A;  3UI3 A;  1SJF A;  2N82 B;  1ZA2 B;  2KFZ A;  2U1A A;  3GJR B;  5L8R C;  1H2T Z;  1HNZ J;  4RWX A;  2FC8 A;  1CG2 A;  3NG8 A;  4NLU A;  3EVO A;  1YZ7 A;  3AOA A;  3MEG A;  4ATN A;  1C4C A;  4ICL B;  3PYG A;  4KHP F;  2XS7 A;  1KQF B;  3HM9 A;  1F9E B;  4AE5 A;  2DXE A;  1SV5 A;  3K5O A;  2QMW A;  3NMR A;  2XCP A;  3ZC4 A;  1HNW J;  4DFP A;  4ELT A;  4URQ U;  2H4W B;  2MQ8 A;  3BYR A;  4AXI A;  4NYO A;  5KFP A;  1KOH A;  2NPI A;  3J7Z T;  1ARO P;  5KFN A;  1HWU A;  4Y2C A;  4RNF A;  1JLE B;  2W9C B;  2V0N A;  5IV4 A;  4NEY A;  1NU4 A;  3QZ7 A;  3B78 A;  1RUS A;  3KLH A;  4DX5 A;  4P7V A;  1U1Q A;  2IBO A;  3A3N B;  2RNE A;  3DDI A;  1GMW A;  2Y3Y A;  1UJ5 A;  1H2V Z;  1XMQ F;  4YHH F;  2NSB A;  1FI4 A;  1WDT A;  4OYX A;  1N34 F;  1WHV A;  3C15 B;  4GVB B;  4OZ1 A;  5K20 B;  1YJW S;  4I2Q B;  2LLZ A;  2EEY A;  4DUT A;  4QZV B;  4NOH A;  2H5J B;  2DNR A;  1K9M T;  3HVW A;  1F3F A;  2HUR A;  2HMI A;  2XNR A;  4OI2 A;  4NZ0 A;  4NXN F;  4K5R A;  2VBX A;  3MHY A;  3ILL A;  2NRE A;  2VG6 B;  4LQ9 A;  3DKD A;  3UR3 C;  4J9Q A;  4F4K A;  5C7P A;  4QU6 A;  1HBO A;  1JLF A;  1RAG B;  3KK3 A;  3MUT P;  1LWF B;  2AYE A;  4OYA A;  3DRS A;  3VQT A;  1ZTT A;  1VC0 A;  3KFW X;  4IG3 A;  3AQO A;  2HSE B;  4IH7 A;  3QAT A;  5B0A A;  1HQE B;  4HTJ A;  3V5R A;  1Y00 A;  1IM4 A;  3NBP A;  2M4M A;  2KRB A;  1FKA F;  1VBY A;  3AJ2 A;  2IC3 B;  2G1D A;  1AFJ A;  4RUH A;  5GAG I;  2DB1 A;  2H54 B;  3PFO A;  5J2N B;  3HKW A;  3OTE A;  4AUK A;  1I6J A;  3CXC R;  2QL5 B;  4FF4 A;  2J6U A;  2EKY A;  4ECS A;  1NO8 A;  4USW A;  4KO0 A;  3OVS A;  3DFE A;  2VFS A;  1TV6 B;  1U45 A;  1RHQ B;  4X4P A;  2EFP A;  3JAM Y;  4D3G A;  2FDN A;  1YI2 S;  1FF2 A;  1V9O A;  4O3O A;  4DR3 J;  2ZH8 A;  4PG6 A;  1FK9 B;  1TP7 A;  3RUB L;  2KT2 A;  2CQB A;  2LQ9 A;  1S76 D;  2C2D A;  3CJR A;  5G0R B;  4I69 A;  3O2I A;  3JYT A;  2K3I A;  1UKU A;  2ZEJ A;  3DLH A;  2ZFH A;  3M8W A;  1N4L A;  2DHS A;  1DJ0 A;  1TQL A;  3A12 A;  4EMD A;  3DLE A;  2XSF A;  3AD8 C;  3RGI A;  3CCT A;  1X9M A;  5E5N A;  3ZTS A;  2HWI A;  4DSE A;  5D0G A;  2OHD A;  1RB0 A;  2LDI A;  3U1L A;  1WTF A;  2XBP A;  1L3S A;  4LF4 F;  1HMV A;  1REV A;  3M6V A;  4CIO A;  3CCV S;  1XBW A;  2GGP A;  3IWL A;  2WRM A;  4ZVH A;  1HBU A;  4USJ C;  1T05 B;  1WC0 A;  2G1H A;  4OZ3 A;  4Q8E A;  4F67 A;  3NGK A;  4KKO B;  3LQV A;  2PE8 A;  3OD2 A;  2FB0 A;  2LA4 A;  3HJF A;  1LWE B;  2YQ0 A;  3BPD A;  1RWU A;  5DJB A;  3FBB A;  2BJ8 A;  1T03 A;  3VGS A;  1RU2 A;  2K8G A;  1HI8 A;  2ACY A;  2IDL A;  3MOZ A;  1SJQ A;  1RCX B;  3PTW A;  3RBD A;  2GW8 A;  4GKK F;  4NI2 B;  4JI0 F;  3CCR S;  3CCS S;  5DZ7 A;  3LH2 S;  4H4O B;  5DGA A;  4CLW A;  1WI6 A;  1LFP A;  3BN7 A;  2HND A;  4WU2 A;  2HNZ B;  1WTB A;  4JI4 J;  1VQN S;  4C48 A;  2VH7 A;  1SKU B;  2MQN A;  4JV2 A;  1H73 A;  4B9M A;  5K8M A;  2R2S A;  1HL6 A;  1RAO A;  1R27 B;  4LF6 F;  2KRR A;  2O3D A;  2GQQ A;  4ZKA A;  1WF1 A;  2D7S A;  1OS5 A;  1B0V A;  4B9T A;  4MK7 A;  1OY8 A;  5KFX A;  2ZDP A;  1RIS A;  4RBT A;  1N32 J;  2IY5 B;  3NEK A;  2MB0 B;  2LQ5 A;  3R1L A;  4X84 A;  5KFV A;  4FPI A;  2DEI A;  4LF1 A;  1FTC A;  3VVT A;  3W2V A;  3G9C A;  1Y3K A;  3Q89 A;  5KFQ A;  5K5M A;  1IKX A;  2ZH7 A;  4ILL A;  2OKQ A;  3T3F A;  2B51 A;  3MM8 B;  5K9F A;  1P1L A;  3GLJ A;  2QN6 B;  4OHW A;  2M7S A;  3TZX A;  4YB7 A;  4CLT A;  4TQS A;  4HDG A;  1U0S A;  4DV7 J;  4DU7 A;  1RAI B;  2CRL A;  2V6A A;  3M6U A;  1VBK A;  2DGQ A;  5HBM B;  1V3R A;  2VF3 A;  1YJV A;  2IA0 A;  1R8H A;  2A1B A;  5L39 A;  2CG8 A;  2WVC A;  4MJK A;  1F5A A;  1FES A;  5KFT A;  2BV3 A;  2HHP A;  1S4F A;  4LBH A;  3ZZR A;  5HVH A;  2VQF F;  1OQ6 A;  4WKY A;  1UA0 A;  2H5E A;  3AQP A;  2BAN B;  5F9N A;  5KFO A;  1F5B A;  4NLX A;  3MAQ A;  1N33 F;  2XLJ A;  3QT7 A;  3VGV A;  3EJM A;  2KKH A;  5C42 B;  3KLF B;  2HHX A;  2OD4 A;  4X66 J;  1X4D A;  3NRB A;  3FEX B;  1LXJ A;  4LRF A;  1RHM B;  5H9E K;  4UUX A;  4B9N A;  1UAW A;  3Q8S B;  3AD9 C;  3H40 A;  2LA6 A;  2C1E B;  5A8R A;  4X65 F;  2MKI A;  4C8Y A;  1U25 A;  4A4J A;  2OD6 A;  2VOO A;  1P9Y A;  3T5L A;  5F8G A;  2BJ9 A;  3OJS A;  5B09 A;  4DMZ A;  3VGU A;  4DDF A;  1Q0N A;  4DPW A;  2QA4 G;  4I2P B;  3OPK A;  3N01 A;  2XY7 A;  3W1Y C;  4OI4 A;  1H6K X;  2DR6 A;  4ZJQ A;  2B3T B;  4HKQ A;  3W5X A;  4M63 A;  4B3S J;  5GAG U;  1URN A;  3HT3 A;  5KG2 A;  1U26 A;  3IS9 A;  1X4F A;  3RBZ A;  4QYZ J;  3D7S B;  1N52 B;  1GXT A;  1QM9 A;  2QC3 A;  3WBZ A;  2JFD A;  4MFB A;  2AGQ A;  1DBD A;  1JK9 B;  1T9V A;  2ROG A;  4PWD A;  5K14 B;  3OFF A;  4DL0 C;  4ZVP B;  3IRX A;  4QWC A;  4C98 A;  2B8P A;  3TZW A;  4CI0 B;  1QTM A;  3H0P A;  2VUG A;  2IRX A;  1VDH A;  2FYX A;  5L1K A;  4CRJ A;  2C28 A;  5DDO C;  2KDO A;  2BRL A;  4WIQ A;  7AT1 B;  3IBW A;  5KT7 A;  4BLG A;  1MN9 A;  5EWE A;  2PDA A;  5GMK a;  5ETO A;  2AV5 A;  4RW8 A;  1DZ5 A;  3C3L A;  3KHR A;  1SL2 A;  1R7I A;  1HBM B;  3OLA A;  3M8S A;  5KFL A;  1JXV A;  2V2Z A;  4IO9 Q;  4OIX A;  3CJQ A;  4ICL A;  2N3L A;  3OR1 A;  3TA1 A;  2Z4P A;  1KON A;  2BJE A;  3AOB A;  3W7B A;  4YR0 A;  2C3U A;  3LW5 C;  1Y5L B;  2GMH A;  2ZZT A;  5THW A;  4OHV A;  4EO8 A;  4NA1 A;  3QZ8 A;  2DNO A;  2Z0G A;  4KJI A;  1XR6 A;  1YIT S;  2CVI A;  4HEA 9;  4G65 A;  1ZZF A;  4B3O A;  5ETP A;  2MLY A;  1FE0 A;  2XZT B;  5CA5 A;  4OZ2 A;  4G1I A;  4KIA A;  2CZ9 A;  4P2X A;  2M52 A;  2UXB F;  2D3O R;  1K8A T;  1KSP A;  3ICL A;  2W9C A;  1C0U B;  2J9C A;  3JQM A;  1IKW B;  4ED4 A;  3W65 A;  1YJT A;  2W8L A;  3FBE A;  4BS2 A;  1U2R A;  2H4Y B;  2VZ9 A;  1Q4R A;  1FRJ A;  2KYX A;  5LMU J;  3HJV A;  1CPZ A;  2VDI A;  3K58 A;  3I87 A;  1XQI A;  2QRR A;  1NLK L;  4UZB A;  2AYM A;  1XMO F;  2L9D A;  2R3V A;  3Q8U A;  4DG1 B;  1U02 A;  1WC6 A;  4UOH A;  2NQP A;  3IG1 B;  4DX8 H;  3C15 A;  4GVB A;  4I2Q A;  5KTQ A;  3CD6 S;  3HKZ D;  2Z57 B;  2V8D A;  2J6S A;  2FHK A;  3V81 A;  3HT0 A;  4NCA A;  5C24 A;  5F0U A;  4FP9 A;  1HA1 A;  1LWC A;  3RR8 A;  2XI3 A;  2GO8 A;  3UO0 A;  1VK8 A;  4YN3 B;  3C6T A;  4PR6 A;  2GHP A;  4EO6 A;  3SSQ A;  2Q43 A;  3W9I A;  2OIH A;  2FGO A;  4DV0 J;  4UW2 A;  2AYG A;  7FD1 A;  3J7A 1;  3I4H X;  4ZCK A;  4DR5 F;  1HQE A;  3KHG A;  2C3Y A;  4NYZ A;  2ROP A;  1DHM A;  2HLU A;  5IM0 A;  5B0C A;  3PIP Q;  2JEI A;  4M5G A;  1VJW A;  4OX6 A;  1U2C A;  2HAI A;  2GVD B;  1RWK B;  3LAN A;  1WOP A;  1BUX A;  3W60 A;  2RKI A;  1OY6 A;  3HLU A;  1WD6 A;  1NH7 A;  3OTO J;  5J2N A;  3F41 A;  3KUG A;  3K17 A;  1S1V A;  3DLG B;  3HX9 A;  1EB0 A;  1UP1 A;  1NPP A;  4WZQ A;  2GO9 A;  3ZTR A;  4WFB Q;  2YKM B;  1FEH A;  3UDE A;  4CH7 A;  4JI7 J;  2MEW A;  3PIO Q;  4K4W A;  4JI6 J;  2N4C A;  3OSN A;  5E33 A;  4IOC Q;  5IT4 A;  1TU0 B;  2Y8W A;  4H54 A;  3PW2 A;  2ZWP A;  2HFO A;  4Y0F A;  2B6A A;  3DYA B;  4U7U K;  2CQ4 A;  2F9J A;  5G0R A;  5C25 B;  2ZM6 F;  4NL5 A;  3RU0 A;  1YJU A;  4ZVU B;  1HWK A;  1VQO S;  3BN4 A;  2MZ1 A;  1RWN B;  4DV4 J;  3R97 A;  2EFN A;  2UUW A;  4IFY B;  3RAM A;  4ZP6 A;  3ZFV A;  2DGT A;  4RNM A;  2HVD A;  1YZ6 A;  4LRC A;  1CJV B;  3OL9 A;  5HP1 B;  5JMN A;  4EU0 A;  1N54 B;  5LSL A;  4TYA A;  3UN2 A;  4OHY A;  2H65 B;  2N3O A;  1U4B A;  4ED2 A;  5LT5 A;  4B3S F;  2ZOG A;  1UPP A;  1EET B;  2JZ5 A;  2FVR A;  1FRH A;  1LWE A;  3JSB A;  4XDD A;  1RTJ B;  1S99 A;  2DGU A;  3D5M A;  4ITS A;  3D3C J;  4TN2 A;  2BMB A;  4QIG A;  3ENV A;  4PRF A;  2RRA A;  3MUR P;  4X64 J;  5E0O A;  4P10 A;  4QOT A;  2UUA F;  2PEH A;  4LFB F;  3B82 A;  3AH6 A;  3EXC X;  1PJ7 A;  2JHE A;  2ABY A;  4N77 A;  4H4O A;  2BR0 A;  3M8Y A;  4LF7 J;  4O3N A;  1D0E A;  1U2F A;  2A2D A;  2BJ1 A;  3MTJ A;  1YJ9 S;  2OPR B;  2YVS A;  1DQ8 A;  2OML A;  2NUH A;  2AEF A;  4AFF A;  5KFW A;  1WC5 A;  2HFZ A;  2A3J A;  1JX4 A;  2OEJ A;  1TL5 A;  2HQD A;  2PMH A;  1U1R A;  2W9B B;  1R8P A;  5KT3 A;  3D9B A;  3DMJ A;  1PBA A;  3M30 B;  1CJT B;  9RUB A;  2HHU A;  2XWX A;  4DZ6 A;  1S1U B;  1QD1 A;  4XPE A;  4AQY F;  5AJ3 F;  4Q45 A;  1YRX A;  3G4S S;  5ETN A;  2M2B A;  2B56 A;  1F6T A;  2DK2 A;  2VG7 A;  2VU5 A;  1EJ7 L;  2WK4 A;  1U6F A;  3VV2 B;  5F8I A;  4OJH A;  3TUZ C;  2FJV A;  2YWW A;  4FNH A;  3HFZ B;  5D78 A;  2LCW A;  3P3D A;  2VKZ G;  1FFG B;  4DF8 A;  1LFW A;  4JV5 F;  4DS4 A;  2RRB A;  4BWM A;  3KJV B;  1VIX A;  2PA8 D;  3UN5 A;  3OL6 A;  1ZOT A;  1CJU A;  3BR8 A;  4Q2M A;  4XIU A;  1PG5 B;  4RU2 A;  1K0V A;  1GXL A;  2ZOF A;  3P8B B;  1QTN B;  2BKN A;  1TEL A;  2OEM A;  3SCL E;  2NXN A;  1RT4 A;  4Q7A A;  4FKY A;  3TAM B;  5EDW A;  2YPY A;  2CPF A;  3CE8 A;  5HAO A;  2M9K A;  3WHI A;  1TVR B;  3U7J A;  2GS8 A;  4KV8 B;  3HF5 A;  1RKI A;  2MGZ B;  1NJY A;  4OL8 A;  2H1Y A;  5H9F K;  3CSK A;  5E7O B;  2QL7 B;  3O6Q A;  1AZS B;  3D28 A;  1GNK A;  2HHW A;  2FUG 9;  3HFV A;  4N7T A;  4OLO A;  3ENA A;  4EZ9 A;  5C5J A;  4ES3 A;  2ATL A;  3D68 A;  2BJ7 A;  1HQU A;  4QIV A;  4DCO B;  5FD1 A;  3OHA A;  1B7Y B;  1TL4 A;  3QGI A;  4DR2 F;  3BBF A;  1VLO A;  2O66 A;  2G2Y A;  1S97 A;  1KQK A;  5IFM A;  2GC8 A;  4FXW A;  4LF9 F;  4DF4 A;  4D3H A;  2C2K B;  1IUJ A;  3JSM A;  4DSF A;  1IBL F;  2ZBQ A;  2V67 A;  3TJ9 A;  3C6U B;  2F8E X;  1HLW A;  4ZK7 M;  1IR1 A;  5AE3 A;  1S1T B;  3OTO F;  1JJH A;  3X1L B;  1SCJ B;  5KOW A;  4EBE A;  4CM0 A;  4OX9 J;  4JI7 F;  4E0D A;  2RIL A;  2EXU A;  5KG3 A;  2J0S D;  3RR7 A;  4C3K A;  5K14 A;  1C1B B;  1L3V A;  5DLG A;  3JB9 k;  1NH8 A;  2DIU A;  1G2E A;  3KK2 B;  4YS2 A;  5AE1 A;  4C7Q A;  1T11 A;  2CZV C;  1HHQ A;  4B9S A;  4DQQ A;  2X3D A;  5DO2 A;  1NK8 A;  4ZVG A;  5FLX U;  4CO4 A;  4TU8 A;  2DGS A;  1Q8L A;  4DV6 F;  1GFW B;  3LAK A;  2XMM A;  1JLG A;  1HBM A;  4DN0 A;  4WFA Q;  2CQ3 A;  4LUB A;  2DCL A;  1XR7 A;  1RT7 B;  2GA7 A;  2V63 A;  3THT A;  3NAI A;  3MXH P;  1S0N A;  3RRH A;  1TKX B;  2I0X A;  3ILJ A;  2LYV A;  3OQ2 A;  5HQ8 A;  4LVN P;  4MIA A;  2YKN A;  2NPF A;  4EI2 A;  4ANC A;  4O4R A;  2ZE2 B;  3L09 A;  4F26 A;  3GYX B;  1WSR A;  3AA9 A;  2V4Q A;  1YKW A;  1I94 J;  4NLS A;  4FYW B;  3QMQ A;  5HQM A;  2G0I A;  1T9W A;  3NOC A;  4P2M A;  1FEE A;  2D3Z A;  1GT8 A;  3H59 A;  4LRE A;  3B54 A;  2WVF A;  1C0U A;  1ELO A;  1RT3 A;  3SMZ A;  3MEK A;  1IKW A;  1F0X A;  5GVQ A;  3VQS A;  4K4V A;  1K0T A;  2KL8 A;  1RTD B;  1V5V A;  2HRT A;  2DGX A;  2VC0 A;  3FDS A;  1E6V B;  1X5T A;  4A8Q A;  2J9D A;  3K59 A;  3MAH A;  3MEE A;  3R5J B;  1REG X;  4O44 B;  2VC1 A;  2KH9 A;  3GIJ A;  2OAU A;  3IG1 A;  2SXL A;  4UT4 A;  2R2U A;  4QBU A;  3CUN A;  2NLW A;  2OFG X;  1R43 A;  2DH9 A;  2AJQ A;  3DOK B;  4AND A;  2CWK A;  3GMG A;  1AW0 A;  4Q8F A;  3V2U C;  1IBK J;  3QSY B;  1LV5 A;  1RCO B;  3VF0 B;  5T7L B;  1RTH B;  2AF6 A;  4U96 A;  3CDW A;  2JEF A;  1CUL B;  4LBP A;  1AFI A;  2C2N A;  2IM1 A;  2MZT A;  3MMC B;  1VJQ A;  2ZD1 B;  4PAA A;  1BQM B;  8RUC A;  2LQB A;  5F41 A;  4X4Q A;  4P72 A;  2K1R B;  2W8K A;  3SDE B;  3ZXW A;  1UPM B;  3DU5 A;  1Q79 A;  1N5S A;  5GAD I;  1SUQ B;  3M7V A;  3M4X A;  3PVX A;  3IR6 B;  3UVJ B;  2VD3 A;  3OJU A;  3CJK B;  1KC8 T;  3FMW A;  2GVD A;  2Z2Z A;  3KKF A;  3IBF B;  1R8C A;  5A6W A;  1R0C B;  2GVZ B;  2RS8 A;  2VQE F;  3R6L B;  2LDY A;  3HFK A;  1JJ2 R;  3DLG A;  3SZ2 A;  4OV1 A;  8ATC B;  2YKM A;  1FDD A;  2E1R A;  3BZQ A;  2QA4 S;  2P9G A;  4NLG A;  1UTA A;  5DG7 A;  3ELH A;  2YH1 A;  1OPI A;  4CLU A;  1SVD A;  3GP9 A;  1S9E B;  5ADZ A;  3RTV A;  4LF5 J;  4U7U D;  4Y2M A;  1M5O C;  3GR0 A;  5EHH A;  1FWL A;  2DR5 A;  4B02 A;  3BO2 A;  1TAQ A;  2LXI A;  1Q82 T;  2ZBP A;  3VAG A;  2Q66 A;  5C25 A;  1BXN A;  1IN0 A;  2F65 A;  1GH8 A;  1NM2 A;  1NK6 A;  1NSK L;  2CJX B;  1CSJ A;  7FDR A;  1FRX A;  3AJD A;  3IP0 A;  4IFY A;  1ROF A;  4JI5 J;  2GAH C;  1B64 A;  1XEZ A;  2QSF A;  4DJB A;  3PNI A;  2XLK A;  1NPR A;  1F2H A;  2XUL A;  2Y1J A;  4L76 A;  4U7C A;  2XZW A;  4MIB A;  4EYH B;  2BJD A;  3BB5 A;  2MLZ A;  3H2V E;  1Q8I A;  2G2O A;  3JQJ A;  2W24 A;  3R9L A;  4EYI B;  4CO2 A;  1R8A A;  3LTO A;  5KT2 A;  4ECY A;  1J5O B;  3THP A;  1JLC A;  2HVE A;  3HD2 A;  1EET A;  4ZVT B;  4OYW A;  4WFX A;  1LWX A;  4NCB A;  2B9Y A;  4NRT A;  2AEM A;  3BSC A;  5IQ6 A;  1X4A A;  3MM6 B;  1WEY A;  5DM6 Q;  2E9Z A;  4USV A;  2W4P A;  5B0G A;  3NGS A;  2LQJ A;  3M8P B;  4OX9 F;  5SZT A;  3MM7 B;  1JKH B;  3K0J A;  2P8I A;  2AIR B;  4F2R A;  3G6Y A;  2BKO A;  1FE4 A;  2ZKU A;  4I67 A;  4EBD A;  1RWO B;  3NCR A;  5EGY A;  1FRI A;  3NLC A;  2FJB B;  2HQ3 A;  1IJF B;  2W25 A;  4ETX A;  3OTD A;  1KQG B;  2OPR A;  3TUI C;  1ZET A;  3W9H A;  4DR6 J;  2QGF B;  1UVJ A;  3FZ2 A;  5KFZ A;  5J2P B;  2BDP A;  2FHJ D;  5ETM A;  3RRK A;  2BAC A;  2DD8 S;  4LFA J;  2O01 C;  3ET6 A;  2W9B A;  1JWW A;  2BKP A;  3PFE A;  3SQG B;  1FJG J;  2AMC B;  2DIT A;  2V69 A;  4TQR A;  1FCA A;  4EUV A;  2C3P A;  2NXU A;  3HHL C;  2HK3 A;  3K7R A;  4B3M J;  2APO A;  4NA2 A;  4CCH A;  3ZZU A;  4J5O A;  1XNQ J;  1FX4 A;  1U1K A;  1VBZ A;  2DXF A;  2JSX A;  1XWL A;  1FA0 A;  4C8M A;  4F0H A;  1SKR A;  4USH A;  2D1C A;  1SQF A;  4Y3C A;  3V4I B;  3R27 A;  3Q2T C;  3ZZO A;  4J37 A;  4C4W A;  3M6X A;  2QLB B;  3EZ5 A;  4DL2 A;  5HLF B;  2BE2 A;  4DLG A;  3T1A A;  4WII A;  2R4F A;  2ZHB A;  2CAD A;  5BJR A;  4FF3 A;  1U47 A;  4UY8 5;  4ZPC A;  5IT9 Y;  2N4D A;  1VIS A;  2MQM A;  1FO1 A;  3K5P A;  3OVA A;  1ACM B;  2IM0 A;  3PKM A;  4Y28 C;  3TZY A;  3ISN C;  4ZDN A;  1U0H B;  2QL9 B;  3AB4 B;  2XS2 A;  4NE9 C;  3IA0 A;  3QAE A;  1NKE A;  4DV1 F;  1TVR A;  2CQP A;  3T5K A;  4YDD B;  1MNE A;  2VV5 A;  2WBR A;  5CYQ B;  1AZS A;  4R8U A;  4RW9 B;  3HO1 A;  1SJ3 P;  4K2J A;  3NWR A;  4IKA A;  1LXN A;  2GAG C;  3KMQ A;  2RRN A;  1FRL A;  3NGU A;  4B3T F;  1HNI B;  3C46 A;  1LW0 B;  2HFV A;  4WFY A;  1WOS A;  2FVQ A;  3NNA A;  2XO6 A;  5GAD U;  2HGN A;  3I56 S;  2IMO A;  5J1E A;  3HHK A;  2C2R A;  3C16 A;  4AXJ A;  4E2F B;  2CPH A;  2CJQ A;  1JIH A;  5JVH Q;  2HHH J;  2ZVI A;  2ACM A;  3TUP A;  2CNK B;  4DV5 J;  2HKE A;  2HS3 A;  8AT1 B;  2NXE A;  3GTY X;  2HS4 A;  3BH6 B;  1D9F A;  4LRA A;  2FD2 A;  4RR5 A;  2G13 A;  4V19 X;  3QBC A;  2EI5 A;  5F8L A;  2DHH A;  3MZI A;  1X4C A;  4LFC J;  5F8H A;  1U48 A;  4HT7 A;  4LSL A;  3KWM A;  5DDR C;  4IR1 A;  2OTL S;  2NCK L;  1VBX A;  2R8J A;  2O67 A;  2PGC A;  2HEK A;  1N5V A;  1FKP B;  2Q1L A;  2L9W A;  2ZH2 A;  4O0I A;  3A3P B;  2GX8 A;  3DC2 A;  3PG9 A;  1Q81 T;  3TAQ A;  2HHT A;  1JLA B;  4LIW A;  2HFN A;  2EPI A;  3FVY A;  3H5Y A;  2E5L J;  1XNR J;  5EN1 A;  4WK3 A;  2HWT A;  4Q0B A;  4UQG A;  2CPX A;  3KG4 A;  3FRY A;  4DSL A;  1ZA1 B;  4LJM A;  3TVY A;  3I4P A;  3GWC A;  1RTI B;  4CNY A;  3NS7 B;  4HAC B;  3SFG A;  4M5H A;  4JI8 F;  1T0T V;  4JI2 F;  4DPY A;  1DY3 A;  2YNG B;  4C8O A;  5CZV A;  2JC0 A;  3Q8Y A;  6FD1 A;  4P9S A;  3KK1 A;  3AAW B;  4GVL A;  4F04 B;  4PPZ A;  3C14 A;  2HHS A;  2UVU A;  3O44 A;  1V3Z A;  1TKX A;  2KXH A;  3OXL A;  1BMQ B;  2RD5 C;  3BKU A;  1XC9 A;  2ZE2 A;  5BR8 J;  4LIR A;  2I8E A;  2RE1 A;  1HYS B;  3GQC A;  4IR9 A;  2AU0 A;  1ITP A;  1FJ7 A;  4J9N A;  3TOQ A;  1PYO B;  1QAX A;  2CNL B;  4CO3 A;  3BV8 A;  1NB7 A;  3GE9 A;  2HRU A;  1RI7 A;  4HHU A;  2KI2 A;  3G82 B;  1MMN A;  2ZHO A;  1G3O A;  4JI3 J;  3FEZ A;  4M5J A;  3CJT A;  3GJT B;  2ZJQ Q;  3CDA A;  1RTD A;  1IQZ A;  4BC7 A;  2XMJ A;  3BQ1 A;  3KNA A;  5L9X A;  3MEG B;  3RBX A;  1E6V A;  2WCX A;  4I0W A;  3FUY A;  1S12 A;  4UF4 A;  4Y34 A;  4O44 A;  3CMQ A;  4DR6 F;  2HZV A;  3VVU A;  2QJ3 A;  1BD6 A;  4CLZ A;  1SV5 B;  4FBT A;  4EZ6 A;  3SYZ A;  5LSR A;  4BDP A;  3ZNJ 1;  4OI3 A;  2DPI A;  4J9U E;  3V6J A;  3UCU P;  3I0R A;  2H48 B;  2IM3 A;  4B3M F;  3V6D B;  3NGT A;  1JLQ A;  1FDN A;  2EG2 A;  1VQ8 S;  3PX4 A;  4U8V A;  1I5O B;  1WSV A;  4ED1 A;  3OT9 A;  4CWB A;  2ASD A;  3KLH B;  2B7C B;  3ISZ A;  2K1R A;  2ZKT A;  1F60 B;  3HVR A;  2QV6 A;  4FYX B;  4HR2 A;  2CKW A;  4CLK A;  4X62 J;  3KG1 A;  2B7B B;  1WKL A;  4JYA J;  1FD2 A;  3EGZ A;  4PG7 A;  4MK8 A;  3G71 S;  4IQM A;  2HQI A;  2LEP A;  2XNQ A;  5G4D A;  4ZCL A;  5IXU A;  3GR1 A;  4KGM A;  4IFV A;  3UPF A;  3SV3 A;  3W8P A;  1H38 A;  3HHD A;  4RNH A;  2HMI B;  3EX7 B;  3ZTP A;  4JUZ A;  2CA9 A;  4C8L A;  1VOM A;  1TFY A;  3ZZP A;  3PY8 A;  3D6F B;  1KLN A;  1UVL A;  1S7I A;  3KK3 B;  3H20 A;  1R89 A;  1VQP S;  3BO4 A;  2HW3 A;  2DNY A;  1UWA A;  4IG3 B;  2BM1 A;  1Q7L B;  4TLR A;  2BX6 A;  4ECX A;  3PYE A;  2W2P P;  3LF0 A;  5IZH A;  1OJ4 A;  2C2E A;  4OZN A;  5L9N A;  3ZZ0 A;  2CQD A;  3N6M A;  3CJ8 A;  3T1Y J;  1UL3 A;  1EIY B;  2FQQ B;  5DM7 Q;  1I51 B;  4BBY A;  1VQ5 S;  3PRD A;  4ETZ A;  4KO0 B;  3K2Y A;  1J5O A;  2CVE A;  1SIW B;  4GKJ F;  3IFE A;  4N8O A;  1X7V A;  2DT9 A;  3V6K A;  2ZUG A;  2ZWO A;  4M8L A;  1A9N B;  3MPW A;  5D3G B;  1PIL A;  3M8P A;  4DOZ A;  2OMO A;  3UNY A;  3ITH B;  1JKH A;  4XK8 C;  3FFI A;  1FDB A;  4O23 A;  3E01 A;  3H8Y A;  2UVV A;  4C6A A;  3D54 A;  3AXK A;  3EVM A;  5KFU A;  3DRR B;  1R0A A;  2CXE A;  4FPR A;  3FSI A;  4ZCM A;  3R2D J;  5L38 A;  1E6Y B;  2JX2 A;  3F73 A;  1HMV B;  2VBZ A;  1FNM A;  3MMA A;  1SC3 B;  4KBI A;  4X2B A;  2E44 A;  5J2P A;  3WX8 A;  1HBU B;  4ZVF A;  4TKT A;  1F9H A;  4ZS6 A;  2DBB A;  4DR7 F;  4PUO A;  1L3T A;  2MSS A;  3OFE A;  5JJB A;  1YGY A;  1KP6 A;  1CQM A;  2RAQ A;  2DVI A;  2DR8 A;  4DV2 F;  5CXT A;  3THV A;  2W4C A;  3RJM B;  4B17 A;  3BS9 A;  1S0V A;  3DDN A;  1MWZ A;  3MPY A;  1UFW A;  1P6T A;  2A10 A;  3V4I A;  4OYB A;  2MZJ A;  2R8K A;  1M1K T;  2FVC A;  2CPE A;  4CLP A;  5HLF A;  2WBM A;  3W62 A;  4F8R A;  1K1Q A;  1YBT A;  2G2Z A;  2HND B;  4NLV A;  5D4L A;  1DAR A;  5GME A;  5B08 A;  1QAJ A;  2DHG A;  2LXF A;  3KHH A;  4ILR A;  1RAE B;  4DPT A;  3DRP A;  2RVJ A;  4OI0 A;  2RJZ A;  2QYC A;  1N0V C;  3NCQ A;  3CJ0 A;  1CJK A;  3ONQ A;  3J7Z 5;  3SIP B;  4WYL A;  2LU1 A;  4B9L A;  5LL6 d;  1N48 A;  4JV1 A;  2E1P A;  3WC2 A;  2FJX A;  1YBA A;  3TAP A;  2D74 B;  3S7R A;  3DCA A;  3VAI A;  5C2C A;  1IKX B;  4Z2X A;  1RSC A;  4I4B A;  5D4P A;  1W2B R;  4RW9 A;  4WP9 A;  2PN6 A;  1S6O A;  4IH5 A;  1LK7 A;  1GMV A;  1OSD A;  3PAC A;  2HGL A;  1NK9 A;  1IVZ A;  3N28 A;  2VG5 B;  4WXO A;  1LW0 A;  5E2Q A;  4R0J A;  3R7B B;  5KFK A;  2VJU A;  4P75 A;  1S0M A;  1VQ7 S;  1HR0 F;  2BJ3 A;  2J76 E;  1KHW A;  4HHH A;  4CLS A;  2KN4 A;  1KDN A;  1B0P A;  1HNX J;  2EK1 A;  2BE7 D;  1FHT A;  1N36 F;  3H2U B;  2HZA A;  2YNH A;  3HI9 A;  1P27 B;  4NML A;  2BOA A;  2GMJ A;  2DYA A;  1UVK A;  2AX1 A;  1FKP A;  1YG0 A;  5A8R B;  4KGV B;  1WEX A;  4RBU A;  4P74 A;  4N47 A;  3GU0 A;  2YNF B;  4C9D A;  3O3L A;  3NS6 A;  1PGZ A;  2EWH A;  2AWZ A;  3VGT A;  2AGO A;  3G86 A;  1RDR A;  1D09 B;  1KQS R;  3HZE A;  3CPW R;  3QFH A;  1NHK L;  4MKA A;  2KHD A;  4HAC A;  3P5T L;  2ZH1 A;  4HVZ A;  3NCP A;  2VFR A;  2UXD J;  2HPU A;  1J5E J;  1VK3 A;  1HIY A;  4NLY A;  2YNG A;  3M9O B;  1TUG B;  1WC3 A;  4TU9 A;  4K4T A;  2KJV A;  5D15 A;  2QG9 B;  3OW2 R;  1FRK A;  3GFY A;  1JNR B;  2LVW A;  2IIH A;  4CNZ A;  3OXG A;  2KFY A;  3GB0 A;  4PWD B;  2EG1 A;  2FY1 A;  2GJI A;  1H7X A;  1WOO A;  1KVI A;  3RBE A;  2IDE A;  4WCE Q;  2A0F B;  5KFD A;  4MMO A;  1NUE A;  1WC1 A;  2QX0 A;  2RU3 A;  2DHA A;  3CCL S;  3BDE A;  1VQK S;  3BF4 A;  2POK A;  3CO9 A;  2J6T A;  1X4G A;  4IYQ A;  2W2N P;  4FVM A;  4KT0 C;  4XO0 A;  1EKS A;  3G82 A;  3TX8 A;  4DR4 J;  4RW8 B;  3GV8 B;  2NZC A;  1NME B;  2MKY A;  5DQI A;  3AHP A;  1U6Z A;  4AL6 A;  2YWH A;  1VQS A;  4O3Q A;  1QUV A;  2EKN A;  4E98 A;  1TKZ A;  1HBN B;  1QSY A;  4IRD A;  1Y10 A;  3GSD A;  3SXL A;  3OR1 B;  1UZH A;  1N5Y B;  4P7T A;  3C66 A;  3LAM A;  2C2Z B;  1SKS A;  2YX7 A;  2VFU A;  4OI1 A;  3M1V A;  1S10 A;  4DV3 F;  3RYL A;  3N4W A;  3H5S A;  3HXM A;  4B3O B;  1ZBT A;  3FMB A;  2M8D B;  1ZAV A;  3DN9 A;  2DIV A;  5B7W A;  1IBM J;  3V6D A;  1QVF R;  4ERD A;  2VB6 A;  5KG1 A;  4QYZ K;  5DLF A;  3K8W A;  3UE2 A;  4DX7 A;  2A18 A;  5KFA A;  2XCA A;  4QIE A;  4DEZ A;  4F3M A;  3MEC A;  1IR0 A;  2AJ2 A;  3IRW P;  4G3I A;  3MED A;  3J7Y I;  2UUB F;  3Q83 A;  4AYB D;  1OYD A;  3HCX A;  1T9Y A;  1NSQ A;  2M8H A;  3QRP A;  1H98 A;  1T3O A;  1VC6 A;  1H3D A;  1Z2Z A;  5AXM A;  3QRQ A;  4K2X A;  4QR1 A;  1ZM2 A;  2J7K A;  4QWB A;  2XHW A;  4CH0 S;  2HQF A;  5IT0 A;  4RL1 A;  3K5M A;  2ZIT A;  2IHR 1;  3A8E A;  1KTV A;  3V81 B;  2BBE A;  2HBR B;  4ZA1 A;  3DI6 A;  5C24 B;  1K47 A;  2E66 A;  5FII A;  1LWC B;  1QJH A;  4YY3 J;  4W98 A;  2R7Q A;  3I9Z A;  3A13 A;  3TQE A;  1BLU A;  3EZU A;  5KG0 A;  3C6T B;  1XR5 A;  3GFX A;  3ENQ A;  3LP0 A;  1S1X B;  3BDP A;  3FZB A;  3DRX A;  3ZTO A;  2KT5 A;  1FDA A;  3HHL D;  3BGL A;  2E1C A;  3DU6 A;  5KFH A;  2FLP A;  4RJV A;  4RBV A;  3DXS X;  3J81 U;  1WDD A;  3V4M A;  5IM0 B;  4A8W A;  3CGI A;  3BGO P;  2I5J A;  3FSY A;  2MQO A;  3T1H J;  3H90 A;  2RKI B;  1RHU B;  2DNG A;  1EHW A;  3R7S B;  5KT4 A;  2ALZ A;  1S1V B;  3D3B J;  2F9D A;  3FKB A;  1DTT A;  1LK5 A;  4DUY F;  2XGP A;  4OYZ A;  3RZA A;  4QWA A;  2NZ4 A;  3MGJ A;  4F02 A;  2E1M C;  3IGV A;  2J8S A;  1PIE A;  4GO7 X;  1AUS L;  2XYP B;  2V8G A;  4B3R J;  2CJB A;  5HQL A;  4UQT A;  3OHB A;  4RW6 A;  1IM6 A;  2IM2 A;  3TA0 A;  2B6A B;  2RQC A;  5D3G A;  3ISN D;  3ITH A;  2XMT A;  1MU2 A;  3EIC A;  5MAO A;  3DRR A;  4PXB A;  2FY8 A;  4ZVS B;  2B5J B;  2QYG A;  2PO4 A;  5JXS A;  4WFN Q;  2XB2 D;  2ASJ A;  1MWQ A;  2R7U A;  1E6Y A;  4R5P B;  3F56 A;  3KDN A;  1B70 B;  3PEJ A;  3TP2 A;  4QR2 A;  4NLW A;  5E41 A;  1NDK A;  3IXQ A;  1SIZ A;  1KHV A;  2B0G A;  4NXM J;  2XQC A;  3HDS A;  4OZL A;  3TW0 A;  1RQ0 A;  1AXQ A;  3PM9 A;  4DR1 F;  5FJ4 A;  2BW7 A;  4TNO A;  2FHO B;  3ZZT A;  4FXD A;  3OL7 A;  4ECW A;  3B4D A;  3RW7 A;  2LP4 A;  3M9N B;  1FTR A;  1D3W A;  4NWB A;  2IFX A;  3D0G E;  3PRB A;  5CYM A;  3BJY A;  2CAJ A;  4URG A;  2D3U A;  5E3R A;  3KLG B;  1BGX T;  1M5S A;  3HVT A;  3MR3 A;  2IVM A;  1VMB A;  1JXL A;  3TEH B;  2KG1 A;  2EFO A;  4F0M A;  5E3A A;  3KTQ A;  4KY3 A;  2W7A A;  5EWF A;  3FNN A;  2AJF E;  3BO3 A;  3PJW A;  1SC4 B;  5EUH A;  4LT6 A;  1HPZ A;  2BUN A;  2V4J B;  1C1C B;  3SCK E;  1FFS B;  2P2C B;  2XYH B;  3M6W A;  4QYR A;  1HNZ F;  2AHO B;  4WZM A;  2DRA A;  3DMJ B;  2GV1 A;  2VFV A;  4DL3 A;  2G0J A;  4O3S A;  2CNN B;  5ETS A;  2PA3 A;  3IWX A;  4TYB A;  3LGM A;  3MM5 A;  1P8G A;  1WG4 A;  1WUU A;  1JJ4 A;  3IO1 A;  1R8B A;  3MR2 A;  2GCF A;  5AXL A;  3LWL A;  4ID5 B;  2RT3 A;  4WTY A;  3VR1 A;  4TXS A;  4QQB A;  1HNW F;  2VG7 B;  3M8R A;  1S79 A;  2ASY A;  2NUU G;  2ATC B;  2M70 A;  4FS2 A;  2Q79 A;  1ZPV A;  3M2U B;  3HP6 A;  1UEU A;  2PMW A;  4Q5V A;  2UU9 J;  3TA2 A;  1HW8 A;  1UWB B;  1M1G A;  4OMF G;  1RT2 A;  3CJ3 A;  1KFS A;  1TL3 A;  1QDU B;  2VG5 A;  1CJU B;  3GPA A;  4MKY A;  3JTP A;  1FD8 A;  1TMM A;  1RT4 B;  1RXO B;  3Q8V A;  3QWU A;  2WVB A;  3V6H A;  3EMT A;  3TWZ A;  4Y65 A;  1AUD A;  2IPO B;  2JWN A;  5BYR A;  2MQP A;  1RLD A;  3N9U C;  4RX6 A;  4PQU B;  1I3O B;  3GCW P;  3Q8P B;  4PWU A;  4JI1 J;  1FER A;  1VGY A;  3AXM A;  2UZA A;  4J9K A;  4ZN1 A;  2VHG A;  1W7W A;  2OI2 A;  1D8Y A;  4I1T A;  1S77 D;  2XM3 A;  2ZH6 A;  4FN5 A;  2W01 A;  5JVG Q;  3OXF A;  2J9E A;  4C3M A;  1NAQ A;  1RHJ B;  2PI5 A;  4C97 A;  1FXD A;  3G6V A;  2YNF A;  2UXC J;  5H1S V;  4KAI A;  1H72 C;  4CO1 A;  2KXF A;  1HQU B;  3D66 A;  4DPU A;  2BW2 A;  2IVY A;  4Y00 A;  4NCG A;  3VAM A;  3MFI A;  3DOL B;  3CT9 A;  4M5I A;  1YRT A;  2J8A A;  4WWS A;  2YWF A;  4K0K J;  4N5S A;  2CZ4 A;  4K4S A;  3JSM B;  3CJ5 A;  2V94 A;  5A2Q U;  2UUC J;  5CAA A;  3IM8 A;  4P71 A;  1ULR A;  3E2E A;  4EBC A;  4OYI A;  4XAK A;  3VAH A;  2OP5 A;  5T41 A;  2XTJ P;  3AOD A;  1FX2 A;  4FVC A;  1Q5Y A;  2XMV A;  3IMQ J;  1MML A;  1GX6 A;  1TL7 B;  3T41 A;  4U9R A;  2OPS B;  3OSP A;  3DLK A;  3OR2 A;  4I6Y A;  4P6Q A;  5CZX A;  2AGP A;  2OH2 A;  1M5P C;  4WJB A;  1RYS A;  4DR3 F;  4DUZ J;  1XK8 A;  1RHK B;  2CQI A;  4RU9 A;  5KOX A;  2MKC A;  2JEJ A;  4DL7 A;  2CQ1 A;  4H4K A;  1TKD A;  4ZLN A;  3LUY A;  3QYY A;  4WBF A;  1U1O A;  4QPX A;  2M88 A;  3TI0 A;  2WON A;  5FLX Y;  4KFB A;  5ETL A;  1NJI T;  2NXC A;  4ZHR A;  1JLG B;  1SL0 A;  2HQG A;  3MMB A;  4ZJO A;  2DNM A;  2B9E A;  3QJL A;  2W1B A;  1QSS A;  2YQ1 A;  4F4X A;  1HBN A;  3BQ2 A;  3K5N A;  4K5S A;  1NND A;  3Q0A A;  4CH1 A;  3BSA A;  1N5Y A;  3SSS A;  3TO8 A;  2JH3 A;  2Z2Y B;  2MMY A;  3O5T B;  3M8Z A;  4JBC A;  4C11 B;  1OSC A;  3KDO A;  2YKN B;  4KHP J;  1FXR A;  5FDL A;  3PR5 B; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...