4LFCJ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lfcJ00
2UXCJ 4NXNJ 4LFCJ 2F4VJ 4NEZA 1N34J 2UXBJ 4LF9J 4X65J 4DR7J 2MEWA 5BR8J 1HNZJ 2VQEJ 4DV0J 4LF5J 4JI0J 4X62J 1IBLJ 3R2DJ 4DV6J 3R2CJ 5FLXU 4B3MJ 4RJVA 4LF6J 4DUZJ 2E5LJ 2ZM6J 1HNXJ 2UUAJ 4LF8J 1HR0J 4B3SJ 2KVQE 4JI5J 4X66J 4OX9J 4KHPJ 4DR6J 4YHHJ 5LMNJ 3J80U 2MQ8A 4NEYA 5A2QU 1XMOJ 2UUBJ 3J81U 4JI8J 1IBKJ 4LF4J 2UU9J 4X64J 4LF7J 4JI1J 2HHHJ 1FJGJ 1IBMJ 5AJ3J 3T1HJ 4JI4J 4DV4J 1XNQJ 3W1YC 1N33J 4AQYJ 4JI7J 4PWWA 4DV1J 4YY3J 4DV2J 1I94J 4KYZA 4DV3J 1N36J 3J7AN 5IT9U 4DR1J 2KL8A 2UXDJ 4DR5J 4JI3J 3OTOJ 4DUYJ 3D3CJ 4JI2J 4V1Ak 4GKKJ 2UUCJ 4K0KJ 3T1YJ 4KY3A 4DV7J 2VQFJ 4DV5J 3IMQJ 5LMUJ 4LFBJ 4HHUA 4NXMJ 3JAMU 4DR4J 5LM7E 4DR2J 4DR3J 2MTLA 4B3TJ 4JYAJ 3D3BJ 4LFAJ 4B3RJ 1XMQJ 4GKJJ 4JV5J 5IWAJ 4JI6J 1HNWJ 1XNRJ 1N32J 1J5EJ
chains in the Genus database with same CATH superfamily
3VAFA 1C1BA 1FRLA 3D0GE 4CWBA 4Y2MA 4ILMA 2V8VA 1JLQB 4LBIA 4C7QA 1IN0A 3DGPB 3OVAA 4K4VA 3N6NA 4U7CA 1FRHA 2XMAA 5KG2A 2DXEA 4WBFA 3W7BA 4B3MF 4MYTA 1DLOA 4O23A 4RBUA 1A7GE 2KB2A 5KFRA 4OYXA 4B9VA 2DPJA 3AXMA 5H1SV 4P2FA 3CCRS 1FDBA 1KP6A 3TA0A 4XO0A 4FBUA 4FVCA 2HHTA 4Y28C 3Q22A 3UD3P 1RBLA 1HQEA 3Q83A 4RU9A 4BC7A 3HZEA 2V6AA 3UCGA 2Y0SD 3T5LA 5B0DA 4Y2IA 3EWGA 1ZYQA 3KJFB 3QWUA 3SBMA 1N32F 1TK0A 2K1RA 4HVZA 1YZ6A 3HHEA 1KD1T 1HFEL 2ZUGA 2EG1A 5CQGA 3CVKA 2LQBA 2ALZA 1RBAA 1N32J 1YBUA 3M8QA 3TX0A 4LFCJ 2WONA 2FY1A 4OJ1A 3MOJB 2MKKA 2BJ3A 4NRTA 4NLTA 2AW0A 3QO9B 3FZBA 2KT5A 1S1WA 5CYMA 3IM8A 2K8GA 4DPXA 2CFXA 3V6DA 4ZJOA 2I9SA 3NGDA 3OT9A 4LF8J 4AQYF 1RT7B 4NZ6A 3LALA 4R5PA 2BJ7A 4Y2AA 1S1TB 4H4KC 2P9EA 3PIPQ 5LMNF 1RJJA 1FK9B 1OQ6A 2NREA 5ETLA 1T9UA 4NYZA 2HHHJ 2N4DA 1IKWA 1Q0NA 4AQYJ 2G0IA 4U96A 1LW0A 5DDQC 4KH0B 2IPOB 3MPVA 2R8GA 3CIZA 3FZ2A 2IFXA 3G2XA 4OL8A 2BABA 2KVIA 2DYAA 5LM7E 3FNNA 5A2QY 2GHVC 2IBKA 2XO6A 4DF4A 2F5GA 3BBBA 4OHWA 4LREA 5KFAA 2QA4S 3PW0A 4ANDA 2VA2A 3WX4A 2OUGA 2V8DA 1Q5VA 4RW7A 1ZM2A 4KO0B 2M9KA 3N9UC 4X4OA 2WBMA 1UJ5A 1Q86T 4RUHA 2ZM6F 5HMWA 3CCLS 1RQ0A 1HR0J 3SI8A 3LTOA 5KOWA 3L3CA 4ECVA 1RT3B 4X66F 4B9TA 1KHWA 4ECZA 4ELTA 2L9NA 4IDKA 2U2FA 1M5KC 1S6PA 4WK3A 4WJBA 2HQIA 5D15A 1IKVB 4YR0A 4B3OB 4C0OC 2HLTA 3C14B 3CD7A 4O3OA 1ULRA 1NDLA 3NS5A 3TOQA 2NYHA 4ZVRB 4CQ1A 4FXWA 4EYIB 2FZGB 2RD5C 3S1TA 2H5JB 1HNVB 1SJQA 1K1QA 2ZH4A 3KLVA 3K8WA 4C8OA 4MYUA 4GVLA 2XMUA 5HQ8A 1QSSA 4UTGA 1SI9A 5KG0A 2QE5A 1VIOA 4M63A 4KKOA 3I5AA 1UTAA 4KHMA 4HH0A 3OFHA 1I3OB 3OTCA 5KG1A 2ALYB 1SC4B 4ILLA 2UV8G 1S1UA 1DJ0A 1UP1A 4ZJQA 2ROGA 5ADZA 5IXUA 3RBDA 1QDUB 2F63A 2Y9HA 3GJTB 3TI0A 4KGXB 4QPXA 3MUTP 3MFHA 2COLA 3A13A 1YBTA 1CQNA 1JLAA 1X8DA 1P9YA 4Q8FA 5LXRA 4NEYA 4DQIA 3CULA 5AXKA 1PYTA 2I5JA 3O1LA 4CI0B 1KR4A 1L5UA 2HURA 3QIPB 1EHWA 4RX6A 1IQZA 5B0GA 2WOMA 1HNIB 1N36F 2CYYA 3D1HA 5J2NA 3R7BB 1VQMS 2MKIA 7FDRA 2MKSA 2OPSB 2ZITA 1S57A 2X1GA 1KTVA 3EGNA 4O3SA 3MM5B 1Y9OA 4JYAJ 2HGNA 4B3RJ 4QYZK 3VVTA 4PWDB 3PDNA 4EZ6A 2JOQA 3IG1B 4HDGA 2QSWA 3H4BA 2YVSA 3OVBA 1NDPA 2J0SD 1IUJA 3FKBA 2YH1A 1X4AA 1QD1A 5G0RB 3L7OA 1IBLF 3PEHA 3Q23A 1RT6B 4UOFA 1A9NB 1T3OA 2GFFA 5ETVA 2KHCA 2K7JA 4BBYA 4ZP7A 2DGTA 2XSJB 2AJ1A 2HAIA 3QJJA 4OX6A 4ETXA 4WFAQ 1ZAWA 3ET6A 3R5GA 3N5FA 4DU8A 3VAHA 4DL6A 3G6XA 2WB1D 4G1PA 2W2MP 4IRDA 2B8PA 2CQIA 3OXGA 2EBEA 3TANA 2QRRA 5IT9U 1S6QB 5AXLA 3KLEB 3FBEA 1VDHA 1XR5A 2O5DA 4W92B 3IRXB 4FXDA 3BGOP 1O51A 5EWGA 2FVPA 2MTLA 1NK4A 1FDDA 2OO4A 1ZTTA 2R7RA 3LQVA 3GFYA 2QLFB 4MT1A 3W9HA 3ENWA 1U0HB 3SMZA 1CG2A 1RABB 2QL7B 4DSJA 4UF4A 1GX5A 4M5HA 1R8AA 1JLCA 1RDRA 1HW9A 4OJ3A 3R97A 4Y65A 1ZM4A 2CQ3A 3IO1A 4B3SJ 2RQ4A 4ZHRB 2V2VA 4DPUA 2DNGA 1SJ4P 4YHHF 3W3SA 2LCWA 2L3MA 3CE8A 2APOA 3AQPA 1K0TA 1MW7A 3IM9A 4F0KA 3KFWX 1N5TA 1AFIA 3P5TL 3OSPA 4N41A 4QU7A 4NCBA 3CSKA 2B9WA 3GIIA 2YNFB 3M4XA 3CPWR 1UVKA 2OSQA 1T03B 3OBIA 4QPTA 3C6TA 2C3UA 3IGNA 1QJHA 3P49B 2KT2A 3DLLQ 3MZIA 3B8HA 1QAXA 2FUG9 5AXMA 2ZD1B 2FJEB 3OW2R 2MQLA 4Y3CA 1IKXB 5K8OA 2AYGA 3SIPB 1OSDA 2UXBF 2N3LA 2MGZB 3E51A 5K14B 4CH7A 2DITA 2YKMB 2RDJA 3QIDA 4GRSA 3MPWA 3ZZZA 2GGPA 4RJVA 5D0GA 3NKYA 2FVCA 2WTFA 2MSSA 4WK1A 2QMUB 4WFZA 3PKMA 2YQ1A 1KQFB 5F8JA 4RW8B 3AHPA 2I0XA 5HBMA 1D0EA 4EEYA 2AJ2A 2CZ4A 2FIUA 3CXCR 4CNYA 3T5HA 1FD2A 4P7TA 2BRLA 1IBMF 3HJVA 4DEZA 1JJ2R 2DR6A 4C48A 4AE5A 4CLLA 3PXGa 2CWKA 4PR6A 3UN2A 2E5GA 4DUYF 1MNEA 2VG6A 1R89A 1D9FA 2K06A 3T41A 4OI0A 2KXFA 2CQDA 2XG8A 5LSOA 4ZLLA 1WSVA 5F3ZA 4I2PB 3HHLA 3NS6A 3RR8A 4GC7A 3HHKA 1X5SA 5JVHQ 2FC9A 2CNOB 5GVQA 2HIYA 1K44A 2VPWB 4DR7J 5ITHA 3G82A 5C25A 3AY0A 2LECA 1RHQB 3T6BA 2PI5A 2K1RB 1SJRA 4C8LA 1CULA 4EBDA 1UW9A 3OR2B 2IVMA 5D78A 2BQUA 1JLGA 4DMZA 4K59A 3LWMA 1WC5A 2ZC4A 1NK5A 3I87A 2XS5A 1MU2B 1HBUA 4WFNQ 5CZXA 4KGKA 3GJRB 4C11B 4DR4F 1UEUA 2JEJA 2LEPA 4YDXA 2ZH9A 4DR1F 1S1WB 3QWPA 4DX6A 1SL1A 2JEFA 4LBPA 2BJ9A 1FRIA 1JXEA 4ZLJA 3HX9A 3S7RA 4KV8A 4DR4J 5DLGA 2H3EB 4MKYA 1WKLA 2E9TA 1K0VA 2XCPA 2AYBA 1VLOA 5AE1A 4F3QA 5A8WA 5L1IA 2ZKTA 1KC8T 3BQ2A 2DNRA 2UUBF 4OMFG 1BQXA 3D6FB 2UU9F 3IWLA 1T02A 1T9TA 5D0RA 1N6QA 4NZ7A 2BX6A 3R7SB 2UXDF 2OEMA 3C16B 2UUBJ 2UU9J 2HQGA 1UL3A 4CO2A 2DJWA 1VQOS 3F73A 2JHEA 2P9CA 1VRUB 3WQPA 1Y3JA 2UXDJ 1QY7A 4GVBA 1JWWA 3M30B 3D0IE 2Q1LA 1VLYA 4CLPA 4ANEA 2CG8A 3CD0A 3DRSA 5D77A 3G86A 5E3RA 4BC9A 3PYFA 2V50A 4A8YA 3K59A 2VF3A 2Q6CA 2C2OB 1HIYA 4DF8A 4DSKA 5BXIA 2ADBA 3RJMB 2Q66A 3D54A 4CO4A 4ETZA 1BQNB 5A0YA 4LF5F 3N5BA 3FQKA 4KQZA 3W2VB 1N33F 1VQ7S 4OHXA 2LEBA 4J37A 3I96A 4M5IA 2NXNA 2PD1A 3OTEA 3PFOA 2DVIA 3KMSA 4JOUA 3K5LA 3QGGA 2GAGC 3ILIA 5DGAA 4HT5A 1U26A 2ZC3A 1N33J 1CC8A 1HWKA 2FVQA 2F65A 4F50A 1F2HA 3CDAA 1N52B 2WHOA 1S1UB 1CJVB 3D66A 1SIWB 2HNDA 3ILLA 2ZEJA 4BDPA 3W9JA 4A8OA 3LP0A 5LMUF 1UVLA 2O67A 4CNZA 2IAJB 4GO7X 1ZA1B 4HLBA 1LWFA 1RBOB 1H0HB 3NAIA 4I7FA 4P73A 2V69A 2C2EA 2ZVIA 4M95A 4MH8A 5J1EA 4A8FA 2M88A 3CD6S 3VWSA 3QT6A 1R8PA 2P5VA 1TAUA 4W98A 2K3IA 2C2NA 2POKA 2QFIA 3PW7A 2QN6B 1BGXT 1FWLA 4I69A 1HBNA 5F9NA 2DHXA 3CCTA 4KJIA 2DGWA 5IT9Y 3TJ9A 1C4CA 3UNYA 5SZTA 1EP4B 4NYOA 4TU9A 4CO5A 3FBBA 1S6OA 2AWZA 4OZJA 4RZRA 1UVIA 1UWBA 2D7SA 3TA1A 3W5ZA 3KUGA 1LEOA 3CJKB 1Q8KA 3OD2A 2O1PA 3ENAA 2RRAA 4USIA 1FFGB 2V8HA 1S4FA 2UUCJ 4UOGA 3CW2C 3MOZA 3DOKB 5JVGQ 2BW2A 4H54A 4RBVA 3GZ7A 4KFBA 2LU2A 2HNYB 1UFKA 1VHFA 3NRBA 3DI6A 1VISA 1RAGB 2CJQA 3KDNA 1N34F 1TKTA 1YRTA 2DHSA 4WE1B 1Y7PA 3PYGA 1ZM3A 3UD4P 4OJHA 3BGUA 4P10A 3PNIA 3E2EA 1WKKA 1PSDA 3CJ5A 1E6VA 5KFZA 4OZNA 1B7FA 2ZZTA 4PQUA 1RT4B 6FDRA 1GTHA 1OMSA 2U1AA 2XLIA 4IG3A 4KH1B 2OFGX 5HSPA 3M6VA 4L76A 1LK5A 4EZ9A 1S77D 2XY5A 3RGIA 5DQHA 2DH9A 1RTIA 4CO3A 1Y4ZB 2HAFA 2JSXA 3H20A 4PWWA 3OFGA 5JUMA 2B6AB 3H8YA 1ZH5A 3SFGA 1XJWB 4ZVPB 3J7AN 1M1KT 3VZHA 4ZLNA 2YNIA 2KL8A 3OTOF 4F02A 4JI2J 1FD8A 2OPQA 1RLDA 4ID8A 4DV7F 2DKOB 4C3LA 3QT5A 1YWXA 4OX7A 3DRPA 1XMQJ 3KJNB 1ZPWX 4GKJF 3DRXA 3TX8A 5KFYA 1G2EA 3C46A 2RIJA 4DUZF 1SKUB 1F3FA 1D9AA 1S72S 2AEFA 3KJQB 3JYTA 2R7SA 5BR8J 1UWAA 2E5IA 2LA6A 1V3SA 1LOUA 3D5MA 3C6TB 4DUZJ 1GEHA 3HT3A 1RWNB 2HFVA 2DRDA 3CDUA 3M7VA 1WC4A 2MJUA 1WC6A 2XBPA 2M4MA 3I0RB 4A4JA 5HROA 4FBTA 4NOHA 3T1HJ 5I3UB 3M32A 2XLKA 5DDOC 8AT1B 1H2TZ 2CUYA 4L75A 1VQKS 1T94A 2BMBA 2NXUA 3UPFA 2HBYB 4ZLPA 3FCHA 3RB0A 1K8AT 1S7IA 1WOSA 2IMWP 2KI2A 1HHSA 2XMWA 3IXQA 1TKZB 1WDTA 5D3GB 3PEJA 3DM2B 1J27A 4KGVB 3MEKA 3G96A 1C0UA 4ZVSB 2ZH8A 3TARA 2KH9A 4RNNA 4PRFA 2JNJA 3GYNA 1FX4A 1ZZFA 1EB0A 1RISA 3HI9A 2QL5B 4ZPDA 1HI1A 2VG6B 2C2RA 5B7WA 4OLPA 3AQOA 2W25A 3I55S 1FKAF 4MKAA 3HHLB 3KLHA 3O5TB 5CYJA 5KFDA 2RNEA 3QT8A 3W1YC 3DOLB 3K2YA 2AMCB 2N3OA 4IOBA 4TN2A 3GV5B 2HZCA 3DLHA 3G82B 5C25B 1X4EA 4C8ZA 1BE4A 3BS9A 1IBCB 5HI7A 4H4OA 1TUVA 3PACA 5HMXA 5ETQA 1R27B 4ECRA 1GK8A 4ES3A 3C8YA 3B54A 1UFLA 3MR3A 2HK3A 1YG0A 5D0HA 2F4VF 5T41A 2DNOA 2RKIB 2VD3A 2PIIA 3UFCX 2VG7B 1V5IB 2OHDA 4ECXA 1VFJA 1AYEA 3PW5A 4UZCA 2XCAA 1AUSL 3BEGB 2N7CA 2PDAA 2XZTB 4PXEA 1H2VZ 3DRYA 3TVKA 4OZ0A 2KYXA 1XN9A 2K2PA 4I1TA 3OVSA 3B78A 1TR0A 4CT8A 1RGVA 1TVRB 1YLXA 3Q8PB 2DCLA 2CIMA 3LUYA 4J5OA 3HVAA 1U8SA 4DPTA 3AA9A 2IVFB 4KPCA 5B0BA 3MD1A 3P8BB 1KOOA 2B8QA 2L08A 5B0FA 2F40A 4QIVA 3K5MA 3MM7B 1N56A 3FEYB 4B17A 2BE2B 3HVRA 1SC6A 4DR3F 4N8OA 2CNKB 2J0WA 1DURA 2EG2A 3EVMA 2XLJA 2D1CA 3CCJS 1VCTA 2W2PP 2ZHOA 3FGVA 4WYWA 2MQNA 4ZPTR 1HYSB 2ZUAA 2VOOA 4WIIA 2C3MA 5C2CA 2KZZA 3HD1A 1YVFA 4YP3A 3MEDA 1ZOTA 1S4EA 1VIXA 1T7PA 1B0VA 2XYPB 2M3DA 3IS9B 4HHJA 3HK2A 2CWXA 2YTCA 1WC3A 1V3RA 4LJMA 3EICA 1IJEB 5KG7A 4P2XA 4JI8F 1H2UX 4LF7J 2YH0A 2VG5A 3P6YC 2FHOB 5AJ3F 3W2WA 2OPPA 2DY1A 4TU8A 4DV1F 2A10A 3QLHB 2IYGA 1MWZA 2HHXA 5HJXA 1LV5A 1S9EA 2MMYA 1S9GB 1MMDA 2BM1A 2VQFF 5ETOA 4J9UE 2NXJA 3ETOA 1S76D 3J7Z5 1M1GA 2ZNYA 2F3JA 3KTQA 4LR7A 1NU4A 4F4YA 1HNXF 2B0GA 3A8KA 4USKA 3MUVP 3HVWA 4FS2A 1NO8A 4M5JA 4JI0J 4TU7A 9ATCB 3SQOP 1J5OA 1ZPVA 1OO0B 5M2UA 4IO1A 4OYWA 4K4ZA 4PXBA 1TL4A 2XGQA 1HNXJ 3TYTA 2XQCA 1M5OC 1M5PC 2P9GA 1RHRB 1KLMA 4KHPJ 3BKTA 3QBCA 2I38A 5L9NA 4I7FB 3DHXA 3MMBB 3HSJA 5E3QA 4RNOA 3C15A 3HLUA 3RRGA 3PYDA 1B3TA 3DMJA 2ROEA 5J1EB 1SJ3P 4HT7A 2GO9A 1NK6A 1QM9A 3Q8YA 3PTWA 4DR5F 3CF5Q 3QT7A 5KAKA 2BKNA 2DCUB 1QSLA 2HGMA 2ZH3A 1HBNB 3MM6B 1X4BA 2VIHA 5HO4A 4LMZA 1PC5A 4LR9A 1IKYB 4G1QB 4DQSA 2ZNZA 4TQRA 2NS1B 2W9AA 3MPDA 2CPIA 1TU0B 2ACYA 2AGQA 1S0MA 3EZOA 2GVDB 5IM0A 2NZ4A 4HI2A 4DWIA 2Y8YA 4YN3B 1S99A 1HI8A 3CB4A 2E44A 5E7OB 4DX8H 3M9OB 3OXFA 5EWEA 1LW2A 2FLPA 4FDFA 3ZTPA 1ZETA 2VPXB 2JLEA 2WB4A 4NLOA 2M8DB 2N4CA 2RQCA 2J7UA 2W4PA 4RBTA 4I2QA 3HHDA 1RT5A 2XWYA 4P52A 1FT8A 3OHAA 1OPIA 5C24B 3RB3A 4B9UA 1XBWA 3W8PA 3HZGA 4U8VA 3GG0A 1I94F 5DJBA 2ZFHA 2R8IA 4GMKA 4PKDB 2D3OR 3KLFB 3W64A 3ITHA 3LGHA 4PUOA 2W2QP 2CPEA 3H5XA 4PZVA 5IQQA 1YBAA 1GMVA 3J80Y 4U7UK 1CJUA 4DR2F 2IMOA 5GAHI 4IO9Q 5IWAJ 2VV5A 4P9SA 3U27A 1DQ9A 3CUNA 1EARA 5GAEU 3NMRA 1OY8A 3PRVA 4TVAB 3R6LB 3PFEA 1WSRA 2R2RA 1FVQA 3HF5A 2DNNA 4DV0J 4FKYA 1DTTA 3MPUB 2JEGA 4O3RA 3NY0A 2YNGA 3K5NA 4R8UA 1K9MT 3B4DA 1UETA 3T3FA 2L48A 3TAMB 1TV6A 4LT6A 6AT1B 1NAQA 5ETMA 2RMLA 1U45A 1SH3A 1NK8A 2HHPA 3EXCX 1JKHB 3M05A 5FLXY 3HD2A 3MMCA 3EPGA 4XAKA 4JV0A 4J9QA 5F9LA 1WG4A 1U09A 3CDWA 4F4WA 1X9MA 4OI3A 1IM4A 4WTYA 3ZFVA 4NA2A 4ES2A 3LOUA 3SV3A 1NJZA 4J7CA 2XZWA 4R0EA 3PO5A 3H5YA 4CTAA 3HPOA 2FJXA 2FPHX 2PMHA 4CLFA 2W2OP 4DV6J 2B3TB 2UVUA 1WDDA 4DQQA 3JXOA 1VR6A 2AV5A 1WF2A 1FXRA 2DIUA 1TMJA 5IQ6A 3DLBA 3X1LB 3RR7A 3JTNA 2DEIA 4O4RA 1HBOB 3O6QA 1N0VC 3P3DA 1F9EB 1ZZNA 3CCMS 4TQSA 3J7A1 2ZDOA 4ELVA 4YMEA 1KN6A 1RTHB 4IG0A 3MEGA 4PPZA 3CDEA 2W7OA 1N5SA 2UV8A 3MHYA 1N0UA 2YWEA 3L4BC 1AFJA 5I42B 4O3NA 4ES1A 4GKKJ 3PJXA 2V9KA 5GAGU 1LNQA 3C66A 3D9BA 5IC6B 1RT1A 3D68A 4CM0A 2OTLS 4LSNA 2IYIA 2CQ4A 1EJ7L 1HWJA 1L3KA 3BGRB 3EYZA 2V68A 3FMWA 1BXNA 2HVIA 1Q79A 3C3LA 4CLWA 4M5NA 1SKSA 4DL3A 1SUQB 3G6ES 2YKQA 1P8GA 2QA1A 1Q1KA 5RUBA 3LPEA 5HVGA 1JLQA 1QUPA 4IH7A 2UVVA 2W24A 1ITPA 4YY3F 3DGPA 5D4LA 3M8YA 1Y3KA 2ZWPA 3CNQP 3JSMB 1I1GA 5KT2A 3TUJC 3V4MA 2VFUA 4DS5A 2D3UA 1CLFA 3D28A 4AYBD 1SJ1A 1YGYA 1OYEA 3G87A 2MLYA 4YY3J 2VFVA 3THTA 3MPYA 1T9XA 4X2BA 2G0CA 1RE1B 3IR7B 2QLBB 1HI0P 2RDDA 4HL9A 1ICEB 1Y0HA 1RWXB 4LVOP 1M0SA 1Y5IB 4HEA9 3WC0A 2HGLA 3TZXA 3ZXWA 3ENVA 1G6BA 4EI2A 2WAQD 2J0XA 2BJ1A 2XB2D 3DLGB 5DETA 4E0DA 4ZVOB 2IM1A 4WKRA 1M5SA 5A76A 4JB8B 5LJ3Y 3D1OA 5H9EJ 5KFSA 4ED7A 5M2RA 3ZTSA 2BA9A 5HAOA 4TXSA 1XIQA 1Q78A 2F7VA 1YITS 3D6TB 5JMNA 4ZVQB 4P2SA 4ZITA 2HS4A 4K0KF 3TJAA 1RT7A 2EC2A 4JI1F 3RB6A 4WP3A 4JI7J 4OYIA 1KRPA 1HPZB 4DV2J 1S1TA 3VR1A 4YUDA 2C2DA 1FK9A 1RWOB 1PO6A 2O3DA 5D8HB 4K0KJ 1ZBTA 1FKPB 2J9DE 4ED5A 4RW6B 2HWHA 3DNCA 4K4YA 2C3OA 5BYRA 2R7XA 2OEJA 4OFZA 3N6LA 1H3DA 1Z2LA 4XDDA 1S1XB 5THWA 3HMJG 2C28A 1JNRB 2E29A 1YDLA 3I82A 1LWCB 3BR8A 4PQAA 3A12A 1T9VA 3MGJA 1DBDA 1ROFA 1X4HA 4YFUA 4X64F 4RUBA 1FXLA 2UUAF 3H25A 2P6SA 4NLVA 1O6XA 2KVQE 1R6YA 1CEZA 4PG6A 5C42B 5KFWA 1WHWA 1YJWS 4YDDB 1WC0A 1MROB 2IJRA 4X64J 3DXSX 4DN0A 3BF4A 1VRTB 1RT3A 5K8PA 1SQEA 4ZN1A 3K8VA 1Z2ZA 1LWEB 3KUEA 3UR3C 4TLRA 3QRRA 4TKTA 3AOBA 5E33A 1FTRA 3CT9A 1IKVA 1NLKL 4ED0A 4AXJA 3RW6A 1B4SA 2OP5A 3C14A 2AYEA 1RWKB 4ECYA 1X4CA 1PIEA 2CADA 4LF1A 5KFGA 2MHEA 2HQ3A 4ID5B 2EFVA 1HNVA 4F4XA 4QOTA 1Q4RA 2AJ4A 3X3UA 5HL7Q 3C15B 2B4UA 2VL1A 5HMYA 4K8RA 3DMJB 2GVZA 4NZ0A 3JSBA 4XTTA 2E5LJ 4A8XA 3WDOA 3KHLA 2B9XA 3MAHA 1N4LA 1VC0A 4A8MP 1GXTA 5GAGI 3EVOA 5E3CA 1KTQA 2KFZA 3I5BA 3EE3A 1S1VB 4K4SA 3V4IB 3TQ1A 3AFGA 2X3DA 5AE2A 4IH6A 4OYBA 4ZIVA 1OSCA 3LP1B 4Z7CA 3TO8A 3HP6A 2HVZA 3FDSA 3Q8VA 3W62A 1WC1A 1KLNA 3QIPA 1GFWB 4DPYA 4A47A 4CH1A 1VYAA 2A6OA 4LF9F 2FHKA 1S0VA 2MZRA 2F9JA 1HNIA 1AROP 4USHA 4BLGA 3Q24A 3CMAS 2FLNA 2G1DA 1W7WA 3DLKB 3R27A 4X4NA 3MM5A 2OMOA 4LF9J 4DFJA 2MKYA 2MLXA 3M6UA 4K2JA 4N5SA 3AA8A 3GFHA 5A6WA 2G13A 3VGTA 4LIWA 1IXKA 4M5LA 2QLXA 3Q8QB 4OHYA 3IG1A 3JQJA 2IRUA 3SSRA 4RUAA 2FHMA 1RHMB 3UN3A 4NMLA 3DLEA 1W25A 2EPIA 2R7VA 4MFBB 4O44B 3J81U 4RW4B 5DDPC 5T7LB 4OZ1A 3E3XA 3WX8A 2JC1A 3ULHA 3MFIA 2XSJA 3KKFA 1JLEB 3IWNC 3G8QA 3GFXA 1RAFB 2P2CB 3PW2A 2QMWA 2KT3A 1ZAVA 1WEXA 2FVSA 2YNGB 1NMEB 4R8UB 2ABYA 2CPZA 2RVJA 4NLQA 5DM6Q 1S6QA 2ZBCA 5T14A 1HNWF 1N48A 2V2QA 5IV4A 1VBXA 1UFWA 4O4GB 1HNZF 2NSCA 3IA0A 2HLUA 3I4PA 2Y0BB 2DHGA 3HDSA 2E5HA 1U0HA 3GB0A 2N82B 1YRXA 1VI7A 1FE0A 2D3ZA 1PCAA 1XQIA 2RQMA 3THPA 3VAGA 1CJKB 1P1TA 3O3LA 2MXYA 2DGXA 1SBRA 3VV2B 1RB0A 2Y1JA 3V2UC 4ZHRA 1RLCL 2LQ8A 1WG5A 3B6BA 4I6WA 2G2OA 3V6KA 2YNFA 4ELUA 5L8RC 3RZAA 4CLKA 4U9RA 1T03A 4DX7A 1RWPB 2Z8QA 1FRXA 3IR5B 4RLEA 3NBPB 2XZDB 1QLNA 2FD2A 5I3QA 3LAKA 5DZ6A 1R0AB 4DQRA 1G4CA 3HFKA 4M1KA 2ZD1A 1TL3A 2OEKA 2H51B 2WVBA 3OTBA 3PYEA 1IKXA 1T05B 4OZ3A 3CCES 4NLSA 5A8KB 2XC9A 3WZ0A 4PG5A 5K14A 1OQ3A 2QIFA 2YKMA 3UW1A 1E6YB 4DSFA 2CDRB 2GZOA 3K7RA 2DNZA 3F41A 4E8UA 2VPZB 4QR2A 3TZWA 4QWAA 1TELA 1BQMB 3BN4A 5ETKA 5BYQA 4RW8A 4FF3A 2AQ4A 1TL5A 3ZNJ1 3HSDA 5KFKA 1AZSA 3H7HB 4UOCA 3GPAA 3O44A 4F3MA 1R0BG 1RTZA 3CCVS 1VQ6S 2J6TA 4KHRA 1WF1A 5LXYA 3FRYA 1BLUA 3DGVA 3PX6A 3TW0A 4I56A 3BZQA 3LP2B 2G2YA 3NGTA 1KFSA 4I2PA 4K4UA 1WD6A 4XPEA 4DU7A 1WWHA 2E1RA 1JIHA 1NEEA 1O5JA 4B3MJ 1JJCB 3UI3A 3HM9A 4M8LA 2CG4A 2NR0A 2ILYA 1VJQA 4ZCMA 4F36A 2I8EA 2VONA 1HMVB 1Y5NB 4UY85 3EDRB 3ILOA 1TKXB 4YR3A 4ZVHA 5KFMA 3NNAA 3OR2A 2V34A 1HBMB 3BR9A 2HRYA 2J6SA 3G4SS 1RHUB 1MU2A 2JLFA 4WTOB 3SYZA 3CMES 2HFUA 4C11A 4DV5F 3CDBA 4PPDA 2QA2A 3RW7A 5I3PA 3GYGA 3BKUA 4M5DB 1WORA 1DARA 2PEBA 2ASLA 5DLFA 1V9OA 2AT1B 2M52A 2CQ1A 2WVEA 2ZKUA 3UR0A 4C3KA 1DQAA 2GHWA 3N28A 3AD9C 2BOPA 3BGLA 3GU0A 3GJSB 2V67A 4DFPA 3MMJA 3D67A 2BXJA 1JNZB 2DT9A 5EDWA 1TK8A 3MR5A 4MIBA 5LMNJ 4TY9A 2MQ8A 4C0BA 4N77A 1RA7A 1HQUB 3EJMA 2NLWA 1FESA 1UEKA 2CPFA 2QFJA 3MR6A 5A8RB 4NXMF 2B7CB 4DJBA 1L3TA 2EI5A 3BDEA 3OSNA 2M7SA 2YKNB 1KS2A 1LFPA 3C16A 1KFDA 1S48A 2R7UA 1Q8BA 1CJTB 4NCGB 1KQKA 1Y10A 4N7TA 1JXLA 3QMQA 2HVEA 4YEAA 1WHXA 1LK7A 1VRUA 4NXMJ 2Z4PA 3GJQB 1IR0A 1RWUA 3FSXA 5F0UA 5KT3A 3M30A 1U1PA 4NI2B 1SJFA 1VC6A 1J5EF 2H4YB 2ATLA 1VQ4S 2NSBA 3CJ4A 2VOPA 4MK7A 1Y11A 4UY8T 1L3VA 2CQGA 2EXUA 2YX7A 4MIWA 3AJ1A 3A1YG 1H72C 2C2KB 1WI6A 4I64A 2FJAB 2DHAA 2A0FB 5LSRA 5IV3A 3AXKA 3P96A 4KRWA 1FRJA 2ZM6J 3NOGA 3BO3A 1BQNA 2JWNA 3EZ5A 1UJ4A 2EFPA 5JJBA 4X66J 5KFIA 4UUWA 5J2MB 3W2VA 2OMLA 2R7TA 5F8NA 2NPFA 2BJEA 4DSIA 2BEFA 3I56S 3QSIA 4OZ2A 4B9MA 5FIIA 1GT8A 2Q6BA 2NUUG 2GVZB 3HJFA 4NLPA 4QWCA 2HZAA 5DQIA 2RF2B 3GSIA 4YQWA 1NJWA 3G71S 2E5JA 4LQ3A 2XMMA 2VBXA 1CJVA 3BH7B 2DPIA 2M5YA 3GG1A 3M8WA 5DG9A 2JRSA 3QFHA 2CPDA 1EAYC 1XNRF 4N56A 5KT6A 4NEZA 1M5VC 3DC2A 1SC1B 1S7HA 1XK8A 4CYUB 2LP4A 3M2VB 2IAJA 2LXIA 5GADU 1RP5A 2HQFA 5LOQA 5KG4A 2HVHA 3QGHA 2P6TA 2FY8A 3H42A 3M8ZA 5L39A 3I0SB 3VQSA 3N0VA 2EKYA 4I68A 4N76A 2JEIA 1X4DA 4KB7A 4DR6F 4CCHA 4NLDA 3CCUS 3MD3A 4FPIA 5C2GA 5E3PA 4EWTA 2ZH1A 3T1YF 2DGVA 2AGPA 2GX8A 1EP4A 2XY6A 3CMQA 4F25A 1D1UA 1N36J 2UVRA 4F4AA 3MF5A 2MZJA 3HHLD 3I32A 3MEEB 4R25A 3T1YJ 3CC4S 3M9MB 3CJKA 3TUZC 5EN1A 2BBEA 4RL1A 2V0NA 2R2UA 4EO8A 4DZDA 3DLEB 3MCMA 4BCAA 2R42A 4IR1A 3MDFA 5KFJA 2EVZA 2W8LA 4PXDA 3K57A 3CC2S 2HBRB 3DOKA 2B9YA 4WFXA 4X4QA 4JUZA 1HD0A 4AL5A 3ONQA 2HNYA 3FQLA 2AJ0A 1IBLJ 3GIRA 4Q7AA 2VDHA 4G1IA 3M8PB 1X5OA 2BM0A 1JX4A 1YJUA 5F8GA 2BDPA 2X1AA 4WE1A 2ZBPA 2X3GA 2V9WA 4I4BA 2IC3A 4IFVB 4IKAA 2CRLA 3R5DA 2QZ8A 2G1HA 4ZVEA 2IM3A 1AW0A 4EMDA 4DL7A 3VGUA 2EEYA 1XMOF 2D69A 3BB5A 5EX3A 1V6HA 1RT4A 3H0PA 5HATA 1FKOB 2E9ZA 2QA4G 1S97A 3VGVA 3CJ8A 4ITSA 1YSJA 3C6UB 2HVDA 1NBEB 4DCJB 3W63A 2CNLB 3PRDA 2FJDB 1N5YB 1U1RA 3CCQS 2B6AA 2FQQB 5DDRC 1DHMA 1R8BA 1SL2A 5KFBA 4FZVA 2OH2A 3BBFA 3OLBA 3LO3A 1GTEA 1NH7A 1JLBB 1FX2A 2ASYA 5F3TA 3R9LA 4X62F 1FO1A 1TK5A 1TMMA 1JXVA 3HVTB 4FVMA 2H5EA 5SUHA 3MM8B 3L9ZA 5IZHA 2ZOGA 3GP9A 2GHPA 3ZO7A 2DR8A 2OKQA 1S0OA 4YHHJ 2XHWA 5KOXA 1WELA 3PHEA 3Q8RB 4LF4F 1RUSA 4B02A 2LU1A 3GIKA 5AE3A 1I6JA 2KO1A 1VS3A 1DZ5A 2WCXA 3M1VB 1NXIA 2JVRA 3I0RA 1GQEA 3I9V9 3MURP 1CSJA 1TL3B 3KYLA 1UVJA 1OJ4A 1U48A 3G6YA 4QW9A 1F9FA 5I3UA 2KM8B 3FEZA 2MJNA 3R1LA 1REVB 3VAIA 3CC7S 3MAQA 3DKDA 4K4TA 5BYSA 3T9ZA 4ZPWR 1RHKB 5HP1B 2UXBJ 2DR7A 4DG1B 1RCOB 4J9LA 1AZSB 4ICLB 2ZH6A 2FZCB 3DU6A 3RAQA 4IRKA 1TKZA 2WK4A 5B09A 3OLAA 1LXJA 5D3GA 3DM2A 4LSLA 4QIEA 3W61A 1AUDA 5KG3A 1APSA 1PYSB 2ZE2B 1F5AA 4QIWD 4Q44A 5A2QU 2C3PA 3OL7A 2IY5B 4EK2A 5E41A 1FNOA 1NJXA 1IBKF 1IBMJ 7FD1A 4X4RA 2ZZMA 1QVGR 1M5HA 3HFVA 4DUYJ 3FUYA 1DY3A 3DOLA 2Y1IA 2LEAA 5GADI 3CWJA 2C2MB 1Y5LB 2VBYA 2GJFA 2VU5A 4PCQA 2J0QD 4ZVGA 4JV5F 5L46A 2BW7A 3OQ2A 3R5BA 2BQ3A 4ZOSA 3RG6A 4CO1A 1C1CB 3KWMA 2XSFA 4X4SA 1C2PA 1BY9A 1P6TA 2RKIA 2ROPA 4FPRA 2FZKB 3QZ8A 2BKPA 4EYHB 3KLIB 2VG7A 1FNMA 1RAAB 2UUTA 2BVZA 1ZM9A 2L41A 1PBUA 2EW9A 2UUWA 4OZLA 5KT7A 3E01B 2VFTA 2R7OA 1MN9A 2LMIA 4DR1J 4DS4A 1TVRA 3VAKA 3SCIE 4Y00A 4KT0C 3POTB 1REGX 4M5KA 5CABA 4K2XA 5H9EK 3KJVB 1JB0C 3EMTA 2XNRA 3R8YA 3W66A 1CVJA 3HHNB 1MN7A 2DB1A 4RW9B 4QR1A 2X1BA 3MM7A 4H4MB 2BE2A 5CA5A 2V4JB 1X5TA 2V63A 3OUYB 2FGOA 4ED1A 2FGCA 2ZOFA 2EK6A 1Q8LA 1AXQA 1U0SA 3NCPA 2EBGA 2Z2ZA 1HYSA 1PKUA 4ALZA 1R6VA 5K5MA 1VQ9S 4CIOA 5CH7B 3OFFA 4ZPAA 4ZK7M 3IS9A 1NPKA 4KSEB 2NCKL 3JTPA 1HWUA 5J2PB 3W5XA 2BOAA 2CJKA 4RNMA 7AT1B 3SZ2A 2HNZA 4FYWB 3LANA 5DM7Q 4C8MA 2K7KA 4WP9A 3GMGA 3MM9B 2GNKA 3QLHA 5F0WA 1WHYA 1K1SA 5DZ7A 2CKWA 1QE1B 3BH6B 3MR7A 1VQPS 4AL6A 1S9GA 4D3GA 2VH7A 1NHKL 5F8MA 4Q0BB 3V6HA 3DXBA 3ENQA 1ACMB 3H5UA 1JLFB 3VQTA 3CCZA 3EPIA 3KLGB 2DISA 3GQCA 3HKWA 2VPYB 1VMBA 4LF5J 1KWMA 1I51B 4OV1A 3NGRA 3AD8C 1RK8A 4F4KA 4ILRA 3QFWA 3GILA 4P74A 2MYFA 3CJRA 1T95A 2CQ0A 2YWKA 3QATA 2MY8A 1WI8A 2OFHX 1RZMA 2J9EA 4NE9C 4OIXA 4DSLA 2ZJQQ 3S01A 1FJGF 4A48A 2GMLA 3H2UB 4LR8A 1DTQB 5DQGA 3RUBL 3KHHA 3D3CJ 3MMBA 2HMIB 3ZZRA 8ATCB 4YS2A 4K7QA 2YBVA 2B4PA 4PEOA 1OWXA 5LMUJ 5LT5A 1XMBA 2XS7A 2WRMA 3RRHA 1Q82T 1UEVA 4Q2MA 2AU0A 3RAXA 2YNHB 1NPRA 3MM6A 2AHOB 4F0MA 2J9CA 2HRTA 1IKYA 1WTFA 2V2KA 4G1QA 2W8KA 4OX9F 3JB9k 2WVFA 2YX4A 2YPYA 3W5YA 2YXLA 4A8WA 1UPPA 2XHCA 2GVDA 2CQCA 2DTJA 1X9SA 2B5JB 2GV1A 4DBQA 4OX9J 3NXZA 2RSQA 1R31A 4IYQA 3QYYA 4BWJA 3MTJA 3M2UB 1S5ZA 6FD1A 4IOCQ 1D8YA 2XS2A 3HSZA 2Z58B 4FNIA 3HKZD 3HULA 4NA1A 2IIHA 1K73T 3KMQA 5C24A 4IRCA 1NCLA 1PC4A 3UCUP 2NQPA 3GONA 3M6WA 2WVCA 3G6VA 3BO4A 2IC3B 4U8YA 1FE4A 1WOOA 4OI2A 4C0HA 3MAAB 3OJUA 3KLFA 2PSZA 1RTJB 4ECWA 2C1EB 2DH7A 2RU9A 2W01A 3GWCA 3VAMA 4LFCF 1X9WA 4OI6A 1N34J 3EGZA 1WOPA 2Z0GA 2ZVSA 5ETTA 3EXYA 3TR5A 1F3VA 2JH3A 1CS4B 2Y8WA 2AEMA 5HMZA 4ZVUB 4UQGA 1BWEA 3F44A 1HKAA 2IDEA 3TA2A 3K0JA 1R8CA 4LF8F 3LF0A 3NL0A 2VUGA 5D4PA 3UCZP 3J7YU 1VQ5S 3JTOA 4G65A 2MPUA 3OTDA 1KQGB 2PFFB 4CRJA 4NWBA 1D9DA 1RAIB 2DGQA 1FDNA 2B7BB 3L95X 2HHHF 3BREA 3G9CA 1U6ZA 3TAMA 1HA1A 2MKCA 4NX9A 4ZVFA 8RUCA 4HR2A 3OTOJ 3FEXB 2DNKA 2NZCA 5KFVA 4DV7J 3AAWB 2AD9A 4KIAA 1JKHA 2JX2A 2C22A 2CQBA 2FB0A 2RU3A 4GKJJ 4HACB 5HJYA 3HHLC 3BSOA 3GV7B 1AT1B 5CAAA 4DOZA 1RKJA 2MZQA 4OV6A 2MQMA 1TZ0A 1UKUA 1FVSA 5J2QB 1HARA 3VALA 5HQMA 3DYAB 3BM7A 2QYCA 1HR0F 1OIAA 3K17A 2HPUA 4KTQA 2Z57B 1U8WA 3NCRA 5M2PA 2D74B 1RHJB 5ETRA 1EETB 3IBFB 1HBOA 3E8OA 2PFDA 1RAJA 3QRQA 2FHJD 4LRCA 2OELA 1DAXA 3R5JB 4LSLB 4J90A 1RTHA 3PY8A 2WSFC 1GMUA 2AIRB 2KU7A 2KFNA 1IWGA 2DXFA 2UVWA 5I42A 2KRRA 4C97A 4OYPA 4KBIA 1CPZA 3GIMA 2EFOA 3G8TA 2VC0A 1YJNS 5KFUA 2PGCA 3AD7C 2AKWB 2KTQA 2NUHA 3R6GB 5FJ4A 4U95A 2PN6A 3C2PA 4CH0S 2WW4A 3SCLE 4AXIA 2M70A 4NRUA 2XMJA 3BGRA 2HKEA 3TVYA 4Q5VA 2DEJA 3CTRA 1SUQA 2B4OA 1IR1A 3I5CA 3H2VE 3ZZ0A 4FF2A 4PABA 4JI3F 1V3ZA 1K47A 4NLGA 3AB4B 4RNFA 2GS8A 2WW8A 4DN9A 4A8KA 4DX5A 3D0HE 2MHNA 3EVWA 4LIRA 4ZIWA 2XI3A 3QGPA 2HBQB 4BHQA 3JSMA 1N54B 4HI1A 1XTZA 2DRBA 2R8HA 1UW4A 4JI3J 4ZP8A 3QAEA 2HEKA 4C4WA 2MKHA 2BRKA 4NLWA 3FSYA 3FJ2A 2R3VA 4JYAF 2QX0A 4B3RF 4JP8A 4OHZA 4NPOA 1RT2B 3FFIB 2YQ0A 1NK9A 3M6XA 1U1MA 3T19A 2F4VJ 2ZH2A 4AT1B 4OI1A 1X0FA 3JQMA 4YB1P 3JSYA 1W26A 1F5BA 3RYLA 4C8YA 2DNQA 2OI2A 4QWBA 4ZDNA 1U7LA 1NHUA 1B70B 4TYAA 3DLGA 1PG5B 2XEXA 3ETMA 3SSSA 3BGFA 1N5QA 3RU0A 3KXDA 4ZS6A 3N4WA 2CDQA 1PAEX 3TNVA 2QV6A 4EBEA 1P1LA 5DS7A 4RR5A 1KEKA 5DG8A 1SB6A 2K3KA 1C0TB 4QU6A 3IBWA 2FJVA 2HIQA 1GAOA 3QJLA 2GJIA 2A18A 3IFEA 1XERA 1HPZA 4NLRA 4QIGA 2IRXA 3K5OA 4DR3J 2LXFA 4Q45A 1CC7A 3RRKA 3PJ9A 1TL1A 4MKVA 2ERRA 3J7YI 2RHQB 1FKPA 2C3YA 5IT4A 2XM3A 4A8SA 4RW6A 2EFNA 4LRAA 2D9PA 2XYHB 1D3WA 2VHGA 1R43A 3KK2A 1IWAA 4TYBA 3H98A 3TWZA 2HNZB 2IRYA 3RB4A 1S59A 3LH2S 1RTDB 2XULA 1S1XA 1MWQA 1NM2A 5EHHA 1JK9B 5LJ5Y 4OYMA 4B3SF 1EIYB 1LWCA 2MQQA 3W60A 3DOMB 1Q7LB 3H4DA 3V81B 3MECB 4RWXA 4JI8J 2EFGA 3ZTRA 4PG8A 3CCWA 5AJ3J 3ADAC 2J8AA 4DV1J 3AB2B 3K89A 5C42A 2FHJA 3N79A 1KONA 1FEEA 1MROA 1U2RA 4M94A 2R2SA 2QL9B 5C5JA 2LFVA 1GXUA 3QPIA 4EU0A 2VQFJ 1VRTA 3JAMU 1X7VA 2X51A 2A6MA 2O66A 3VHQA 3SDEA 1H38A 1LWEA 4FNHA 1U1OA 3GR0A 1YKWA 2JZ5A 2GC8A 4MAKA 5B08A 4OQJA 3OV7A 5BJRA 4ED2A 3R5AA 1FRMA 3D1QA 3R2CJ 2OIHA 1U6FA 4WCEQ 3CEDA 1Q53A 1OY9A 4ID5A 1CBKA 1NK0A 4S0MA 2IA0A 2OPRB 3MCSA 1URRA 3OL8A 4DQPA 2ASJA 3GTYX 2E7XA 5GMDA 3BQ0A 3AOAA 2G0JA 4CT9A 2RAQA 3N01A 4MTPA 1SQFA 3KUHA 2MQOA 4LUBA 5CYQB 3IBCB 5E2QA 1FFSB 4IH5A 3BYPA 4E98A 4DR5J 2W2NP 2W9CB 3I4HX 1S1VA 2F8EX 3V4IA 3IR6B 4URGA 2HZVA 1C1BB 1KSPA 4IR9A 3LP1A 3I31A 1OY6A 5HLFA 2ADCA 2QEXS 2ZBQA 1KOHA 3A8IA 3NGUA 1H7WA 3GCWP 3CD5A 1UVNA 1DLOB 3BPSP 4LRBA 1IR2A 4L6V3 2NPIA 4DR7F 2QO3A 4B08A 3GSDA 2MZTA 1FEHA 4DZ6A 3WBZA 4FYVB 2MY7A 4A46A 3BSNA 3A3OB 3DLKA 2AX0A 3MXHP 1SH0A 1U1QA 2KDOA 1RYRA 4ZCLA 1HQEB 3PR5B 2PI4A 1TL7A 2Z56B 4ZJLA 3F56A 5DO2A 1S10A 4FXVA 5A6PA 3QZ7A 4KC5A 3WHIA 4PAAA 4ZP9A 1YTYA 1X4FA 4QBUA 2QMXA 4XPCA 1S0NA 1I94J 2OLWA 2QSFA 2VASA 4MFBA 3PG9A 4O44A 1X4GA 2WBRA 4RW4A 5T7LA 1FJCA 1O0PA 1NKEA 3M8QB 1KNZA 2WONB 2E1PA 3TAQA 3FCVA 5KFCA 1JLEA 4HTJA 5HVHA 4DR2J 4DPWA 1LFWA 1NJYA 2HFOA 1H74A 1SV5A 2ACMA 2CQPA 2HFNA 1F6TA 5CYMB 3V6DB 2RDIA 1ZTWA 1B0TA 4DL0C 4WXWA 2G4BA 4R5PB 3P5BP 3Q2TC 1VJWA 4DL5A 3JQKA 1U1NA 2DGUA 2H9ZA 5D6GA 4HDHA 3U1MA 1IKWB 4O4GA 1TUWA 1EX8A 2AJFE 4DHVA 2GQ2A 1LW0B 4USTA 3UD5A 5I4MA 4JV1A 3DRRA 2RJZA 4K4WA 1GX6A 3Q8SB 1V5VA 1O8BA 1CJKA 1VK8A 3QRPA 1EKRA 3LA0A 4F26A 4FYYB 4QIFA 2WZ1A 1WTBA 1UZHA 4CLZA 4F67A 4AL7A 2HK2A 3U1NA 1JJ4A 3MUMP 2BANA 3ZTOA 1M1HA 2OD4A 2F8MA 4FYXB 3QGIA 2BUNA 2J7KA 5EGYA 3P45B 4RW7B 1FNXH 5EX0A 4OYAA 1FCAA 3BN7A 3T6JA 2Z2LA 4KR0B 2KJWA 4L72B 3AH6A 1T11A 1PJ7A 3N6MA 3NBPA 2R8JA 2YWHA 1G7CB 4RO0A 1NUEA 4IDKB 4P2MA 1S6PB 1R0AA 3O8WA 2HHVA 2VKZG 3AODA 3NOCA 4IFYA 2H5IB 2BJ8A 2ZWOA 1MMLA 3S6EA 2WSCC 1T05A 2DBBA 2QTWA 2L9WA 5CXTA 2VBWA 2R8KA 5A8KA 1URNA 3WIUA 1TAQA 4N8NA 2Z2MA 1PJ5A 3BQ1A 2F9DA 2CQHA 4PXCA 2IHR1 3L7UA 5FDLA 4KYZA 1E6YA 1J2VA 2CVIA 2KG0A 2SXLA 3BKFA 2P8IA 1BQMA 3TUIC 2CVEA 4KKOB 3NNCA 4P71A 1RADB 4IOAQ 1QVFR 4CO0A 3M9NB 4F4ZA 3KHRA 4Z7YA 3PO4A 4G6VB 3IN5A 3VAJA 1HHTP 3L7PA 2RS8A 1VQLS 1T8EA 4K5SA 2Y3YA 2EK1A 3EGWB 4YB7A 4JI5F 1NK7A 4N47A 2LDIA 3ZZPA 1JLAB 2BE7D 1VRQC 4J9PA 4J9OA 1F60B 2V5HG 3LP2A 2ZJRQ 2I5JB 3CIMA 2QLWA 4JI5J 3GR1A 5F8IA 3FRZA 3UDLA 2HW3A 2WOMB 1R3NA 1WUUA 4NCAA 1GH8A 5KFLA 2CZ9A 2OJ3A 5J2NB 1NH8A 3GFZA 3TJ8A 4ED3A 1DRZA 3SV4A 2DY9A 4IQMA 1HMVA 5L1LA 2FYXA 4I67A 4HKQA 3Q2SC 1TKXA 4ED8A 2E1AA 1WJ9A 4UOHA 2UUCF 1YRUA 1WACA 4DFKA 1HBMA 1RAHB 2QYGA 3CGIA 3FBFA 4PG4A 1QTMA 2V4QA 2J8SA 2YWGA 3GIJA 3B4MA 3QNWB 2YPZA 2JDJA 2DH8A 1HLWA 1F1BB 2E7VA 2IDLA 3PHTA 1VQSA 3ISND 1WKJA 4ATNA 1MLAA 4M5DA 3KG0A 5CCMA 4MK8A 5HVFA 4MIAA 2NXCA 5KG6A 4QWEA 2HHUA 4J9KA 4CZCA 3SXLA 4ZA1A 1WHVA 3ET6B 1Q7YT 2CPJA 2DR9A 2J5AA 1NRKA 1L3UA 1U02A 5GAEI 4C8NA 2A2DA 4I6AA 4MJKA 2B9EA 2DO0A 3NWRA 4DUTA 2GJ2A 4ECSA 1TL1B 4JI1J 3JAMY 4DCPB 2G2ZA 3RBZA 3Q0AA 4V19X 3UVJA 1EZZB 3J81j 2ZH5A 1M90T 2JC0A 3KK2B 3EZUA 3BYRA 3VF0B 1HQUA 2YKAA 2HHSA 4JI2F 2G9OA 2IM2A 4ZPVR 5A8RA 3ZTQA 4LF2A 4WYLA 3A8EA 2JLGA 3KHGA 4TLQA 2YKNA 2NXEA 3D4JA 1SVDA 5DG7A 1NJIT 1XMQF 1CQMA 1MMNA 1OYDA 2W4CA 3MWBA 1CJTA 4NCGA 5CZVA 3FBCA 2HWIA 1JLCB 5K8NA 4P72A 5DRKA 3DLJA 4DDFA 3TP2A 3RBXA 1JQGA 5H9FJ 4EBCA 5BR8F 2FVRA 1C4AA 4NI2A 5KFNA 1U1LA 1NPPA 1WEZA 1X5PA 1YK9A 3ILJA 4WIQA 3TVZA 2E1MC 1BWVA 2UUAJ 4CP5A 2EFQA 4Y6IA 1TFWA 2R7WA 1R0CB 3SDEB 4QZVB 3J80U 2PC6A 3TZZA 2GIQA 3W65A 1OPZA 1YJ9S 3U02A 1PAUB 3KOAA 3T1HF 2VZ9A 1NSAA 3M8SA 1U25A 1KQSR 2BV3A 5J2MA 4G3IA 2F1FA 2PO4A 2LDYA 3NGKA 1MG7A 2RUSA 4F7VA 2BJDA 4V1Ak 2V94A 2PE8A 1Z1ZA 4K50A 5EWFA 4RNHA 2KZMA 4KGZB 1ELOA 3IP0A 2PEHA 3CJ2A 1DFDA 1U49A 1NDCA 4DLEA 2RF2A 4Z2XA 2GGPB 1W2BR 5E5NA 4W4MA 1AB8A 3GV8B 2M0GB 1RA6A 4ZKAA 2PA8D 2KRBA 3ZZOA 1VGYA 1YHQS 2XTJP 2PMZD 5HBMB 5FLXU 3FK4A 2F4FA 2R7QA 1R8HA 4ANCA 3R3TA 2YX1A 4CYUA 4A8QA 3M2VA 1TTHB 5HLFB 3ZZTA 3I9ZA 4CLYA 1FWKA 3TZYA 1H98A 3I0SA 1LKZA 3M2RA 5D0EA 1TFYA 4UW2A 3OJSA 3HSGA 5AT1B 1U24A 4PYDA 4LFBF 3D2WA 5LL6d 1GXLA 4XK8C 2ZZNA 4P7VA 4IUFA 1W2IA 2HQCA 2AJQA 2F8HA 2W4DA 4X84A 2AZ1A 2DO4A 4LBHA 3GCXP 1SPBP 3CO0P 4EUVA 1EQ0A 4LFBJ 3PVXA 4ENOA 2RH3A 4USWA 1TL7B 2VBZA 2CJBA 2BE9B 1U4BA 2VJUA 3LPYA 1N8RT 2MDAA 4DPOA 3MEEA 1VBYA 1Y00A 1U2CA 1CULB 2ZJPQ 2E9RX 3SQGA 1PBAA 4C8KA 1RWWB 2ZH7A 1JLGB 2CPHA 1HBUB 2BR0A 2CJ9A 3VTIA 1UJ6A 1JMTA 2QT7A 1YJ7A 2NYIA 1RWVB 4TNOA 1SV5B 1N5VA 3M8PA 2IVYA 4BWMA 5L1KA 3C19A 2DXDA 5GAHU 4IFVA 3HO1A 5HQLA 2LA4A 2HFSA 4E2FB 1VBZA 2PMWA 1I5OB 2GQQA 4KV8B 2VODA 2FJWA 3TEGA 2W7AA 2KXHA 5ETNA 3LGNA 2IBOA 2HG4A 1YI2S 3BV8A 2QGFB 2E7WA 1FKOA 4RU2A 3KK1A 3PX0A 5MLCV 1RCXB 2DHHA 3C6UA 5IC4B 3HXMA 5A8WB 3FCWA 4KGMA 4OI4A 1QAJA 1HNWJ 1N5YA 2MQPA 4HHHA 2DK2A 3DRRB 3H5SA 3CJSA 4KAIA 1HNZJ 1N6QB 2W9BA 1KBRA 2I2YA 3JS9A 3IGVA 3US5A 2AF6A 3UDVA 2KYZA 1X0PA 2XMTA 4M5MA 4GO5X 4FN5A 1RAOA 1FHTA 4J9VA 1JLBA 3CJ0A 2QG9B 1HQ2A 2BANB 2UP1A 1LQ9A 2PA3A 1ZS6A 2V4RA 3HVTA 3BSAA 2CQ2A 2LQJA 3IAS9 3MM8A 4Y2KA 4DLGA 4GVBB 3PCOB 2W7PA 1KDNA 2CJXB 4LF7F 5IFMA 1R7IA 2I1RA 2HQDA 3DRSB 2GIRA 1DQ8A 2H48B 4QWDA 2EWHA 3EDQB 1UPMB 2XI2A 3GLJA 2VDIA 2AYMA 1IVZA 4DL4A 2XYGB 4OZ5A 3M1VA 3NAHA 2B43A 1L3SA 3WC2A 3WIVA 4IFYB 4UT4A 1KVIA 3Q86A 1Q5YA 5L38A 5A0YB 3KG1A 1KVKA 2V8GA 3OPKA 5J1PA 3DN9A 3OXLA 2QLJB 1REVA 1SH2A 2MEWA 5FDLB 4JI0F 1FXDA 4NL5A 2OAUA 2ZBRA 5HP1A 3ZC4A 5IT0A 5CD4A 4JI4F 1HWIA 3ZZUA 4DG1A 2DR5A 4ICLA 2DNPA 4DV3F 1HW8A 2R4FA 2A3JA 4KHPF 2B4VA 3F0NA 3D6HB 3IC1A 1HD1A 2W1BA 2HNDB 2LYVA 1UMJA 1KKHA 2H1YA 2LLZA 4JI4J 1Q81T 2D9OA 3FC9A 4MK9A 1SCJB 3Q8UA 4RKUC 2ZE2A 3LP0B 4DV3J 1F9HA 3MMAA 2IA6A 3A3PB 2LXUA 1JJHA 3NLCA 3PRBA 5FD1A 1LWFB 3TRGA 5KFHA 4LQ9A 3KDOA 2KN4A 1S6UA 4FF4A 2VQEF 1NSKL 2X7IA 2UZAA 2ZBIA 1F0XA 1TUGB 2R2TA 4TY8A 3UNGC 4QCLA 2EC0A 4QR0A 3QSYB 5K20B 4WFYA 4QJVA 2PT0A 2AGOA 4GC6A 4JV2A 3MCOA 2VQEJ 2GW8A 3MI7X 2VJVA 2VICA 2M2BA 3A3NB 2J9DA 4F8RA 3ZZYA 1OS5A 1GMWD 2ZOMA 2RE1A 1HWLA 1UWBB 4QYZJ 2MSTA 1C1CA 1U47A 4ED4A 3DDKA 1UCNA 5K9FA 4HYKA 2D41A 4ED6A 1XC9A 3B82A 2CJAA 1PILA 2V2ZA 4NLUA 5F41A 2XO7A 3KLIA 4F04B 5L1JA 2QJ3A 1T9WA 3KNGA 4KFBB 2JL9A 3EUNA 4Z37A 5CD4H 3PV8A 1D8ZA 1RU2A 2AX1A 3DI6B 2I6WA 3E01A 3J7ZT 4DV5J 1TKTB 4WF9Q 3LW5C 4EGLA 5HN0A 2EKNA 5IWAF 5L9XA 2GQCA 2E1CA 3DHWC 3SEOA 3TQEA 4BS2A 3POTA 1RWMB 3TUPA 1E6VB 2HS0A 4PQUB 1IM6A 3EM1A 1X60A 1RU1A 2DIVA 3UVJB 3KJVA 4DV0F 4IG3B 4X4VA 1EQMA 1FDAA 4AD6A 1Q95G 4RW9A 4U6PA 4JBCA 1HHQA 4H4MA 1RTIB 4DSEA 1H6KX 2V4JA 3OUYA 3PX4A 1UAWA 2YNIB 5J1NA 1D09B 2OPQB 1KVJA 3R5CA 4DI6A 1VC5A 3QQCD 2HHQA 2MKJA 3K5PA 2HHWA 5C7PA 3DRPB 3SSQA 3W9IA 2MZ1A 4USJC 2YKOA 4C3MA 5J2PA 2Z30B 2XMKA 5U47A 4UZBA 2OTJS 3JYTB 3QAUA 3D3BJ 3OHBA 4O3PA 1NKBA 1P27B 1J5EJ 4MKBA 3HCXA 3UO0A 4ECUA 4LF6F 3MM9A 1EKSA 1HL6A 3RBEA 4C6AA 3CO9A 2OSRA 3OR1A 2JFDA 2IM0A 1QE1A 4WWSA 4YR2A 3A4TA 2KXNB 2LQ5A 2GMJA 1T9YA 4I0WA 4DV6F 4WU2A 1NDKA 5HROB 4Q0BA 4LF6J 2FLOA 1U1KA 4UQTA 4R0JA 1JLFA 2X1FA 3KG4A 3KLGA 1FWPA 3CJTA 3ISNC 3M32B 3HT0A 4WZQA 5D4OA 1WEYA 1SXLA 3UWTA 2HWTA 1RYSA 3DFEA 4K4XA 3MR2A 1FJ7A 1QAYA 4ZN3A 1VQYA 4PYAA 5F8HA 4FKXA 4UUXA 3L09A 5LSLA 3W8GA 3U7JA 4L3KA 4WPAA 1YZ7A 2RRBA 2WSEC 1NB7A 3LWLA 4YB6A 2KJVA 4GKKF 2J6UA 5G4DA 1PGZA 1G1XA 1DTQA 1XEZA 1C0UB 3J81Y 3KK3A 2JJ4D 2Q43A 2HMIA 1XNRJ 4CLUA 2KG1A 3NGSA 4CLTA 1T3NA 3M2RB 1FA0A 3R7NB 1FI4A 2FLLA 2VKRA 1GMWA 4M5GA 3THVA 1P9QC 2YNHA 2A1BA 1IJFB 4O0NA 5MAOA 2ZHAA 3KLHB 1FJEB 1RSCA 2MZSA 4OX8A 1S79A 2RHSB 2VFSA 3OFEA 3HFZB 1QSYA 4XIUA 1FF2A 4Y34A 3EX7B 1S9FA 4K5RA 2BQRA 4DR6J 1XR6A 1BHNA 4ZP6A 1A6LA 2IJFA 1UA0A 3PJWA 4NASA 4H4OB 1NNDA 2B5JA 3K58A 4F2SA 5CCLA 3SCJE 3SQGB 3M2UA 4V19J 3PZPA 1SC3B 3NCQA 1VQNS 4CDIA 2VB6A 2CPYA 5B0EA 3NNHA 3AJDA 4LSZB 4EFAC 4X4PA 1NZAA 4WP8A 4ERDA 2XMVA 5KFEA 3NMAA 2KHDA 3MAAA 2B56A 2N7YA 1RTJA 4EO6A 1TKDA 1PJ6A 4O0IA 3T1AA 4L74A 3FSIA 4WU3A 1B99A 2M8HA 5KTQA 3DCAA 1LWXA 5B0AA 5F8LA 3QJPA 1CS4A 4AUKA 3VGSA 2KM8C 3KK1B 2J76E 2RT3A 3BPDA 2Z2YB 2ILZA 4FS1A 1XMOJ 1UA1A 4LRDA 4J9RA 4WZMA 4NA3A 2BYCA 2CJYB 4ZVTB 4ZPCA 4JI7F 3QO9A 2XY7A 4DV2F 4U67Q 4RWWA 4LFAF 2W9BB 3AJ2A 4P6QA 3D7SB 5E3AA 3LGMA 1VBKA 3H90A 1RKIA 1MWYA 1YJRA 2FC8A 2Q3PA 4ECQA 4C2MA 2GCFA 1TP7A 1QTNB 4LFAJ 4D3HA 5KFOA 2KFYA 1ZAXA 4OYZA 2RB7A 3GYXB 2RRNA 3MEDB 3MCNA 1NZ8A 5EUHA 5D4NA 4B9SA 2GMHA 1FTCA 4RUCA 3OL9A 2AZ3A 1Q8IA 3RAMA 4AFFA 4FF1A 3UQSA 3BJYA 3LAMA 3PW4A 4X62J 4HACA 3R2DJ 3ELHA 3I6PA 3T5JA 3H40A 3GE9A 2B51A 4DFMA 2VG5B 4DL2A 4USMA 3W2WB 2OPPB 5J2QA 2E66A 2O01C 2XWXA 3UE2A 2AP6A 3R1HA 5JXSA 3DYAA 3T5KA 2H65B 4Q43A 3ICLA 2GIFA 4LF4J 5E0OA 1QUVA 2R9LA 1PYOB 1S9EB 2OGUA 4URSA 5DGBA 2RUGA 1LXNA 2BACA 4FYDA 1Q16B 4F3OA 4B3TF 1BMQB 1YJVA 4KO0A 2FDNA 2FJBB 1IQTA 4PWUA 2DNLA 2HRUA 1EETA 1KHVA 2RILA 4X65F 2DGOA 2YKPA 4B3TJ 3DDIA 2QC3A 2BZ2A 2VC1A 4QW8A 1J5OB 3SFUA 4C98A 2XGPA 4YB5A 3CJ3A 2VFRA 4F2RA 5B0CA 2A2CA 2LVWA 1H7XA 4H4KA 4X65J 4F0HA 4PG7A 2CZVC 2GO8A 4B3OA 1SKRA 1KLMB 2GA7A 3KNAA 3MMAB 1RXOB 4WKYA 5KT4A 2YWFA 4U7UD 2DNHA 3T9NA 1NHVA 2E5LF 4DV4F 3BO2A 1NSQA 1FRKA 2JFKA 1YJTA 2HS3A 4W90B 1FERA 1S12A 3BDPA 4L3NA 1IBKJ 4J9SA 2Y1LB 1S49A 4ZCKA 1WNEA 4DV4J 4TY8B 4X4TA 3DU5A 2H54B 4QQBA 3A8JA 1VK3A 2CXEA 2D3O1 4JI6F 3PM9A 4OHVA 3VCDA 4NLYA 3G8SA 4NXNF 5KFQA 3D6MB 4B9LA 5HK4A 4HHUA 3AT1B 5GMKa 4LRFA 5CHCB 3SCKE 5IM0B 4JV5J 4JI6J 1A0OB 4NXNJ 3NWGA 1LW2B 4DXLA 4WXOA 1WF0A 4J9MA 4RPFA 3PKYA 2RQKA 4L73A 4ZPBA 3H59A 1B64A 2HYIB 1RT2A 1SL0A 3FFIA 2JVOA 3V5RA 4CLSA 3JSRA 4I2QB 2ATCB 4WFBQ 1RT5B 4LVNP 2OPSA 2CPXA 3UN5A 1NKCA 5AXNA 5ETPA 2CA9A 4USUA 5KFFA 1AA1B 3IRWP 3FMBA 1YQHA 4FP9A 1RACB 1UZDA 3TEHB 4PWDA 3ITHB 3U1LA 4PUOB 5ETSA 1RI7A 4X4UA 5KG5A 2AEJA 1CJUB 3BBCA 5G0RA 2V8PA 1B0PA 1RT6A 2OD6A 4OLOA 1QAIA 2UXCF 2LQ9A 3EGVA 2VA3A 1Z4UA 1SIZA 3VZIA 2HFZA 4OJGA 2DGSA 2ASDA 4HH1A 1C0TA 1X31C 3IAM9 1G3OA 1T0TV 3CCSS 3NG8A 2DNYA 3S8SA 1DTTB 2UXCJ 1BD6A 4J91A 4ER8A 1U6BA 1TQLA 4NMXA 4NYPA 3TAPA 2DD8S 4Q8EA 3M8RA 2MB0B 1H73A 1TV6B 3KLEA 4ZCIA 2XNQA 1FFWB 4KE5A 1XNQF 2J7WA 2IJNA 3NP5A 3IRXA 1NB2A 1ZA2B 3NS7B 2YWWA 3PR4A 3P4UB 3AOCA 1UVMA 3MMCB 1XR7A 3ZNUA 3NEKA 4IQXA 1RTDA 3V6JA 3DDNA 2GAHC 1VOMA 1VHIA 4Y2CA 2DNMA 1XNQJ 5KT5A 2L9DA 3DOMA 3OR1B 2C42A 2Q79A 3V81A 3MECA 2LKZA 4CM2A 5H9FK 4KY3A 5IOLA 3IMQJ 1XWLA 4Q2LA 3H2LA 4YOEA 1BUXA 4USVA 4CTAB 2CAJA 2H4WB 4ZMMA 1WG1A 3UDCA 4C9DA 4NLXA 4MMOA 3UDEA 4KPYA 3MTKA 1B7YB 4HTIA 1BC6A 3FVYA 5GMEA 3PIOQ 2ZDPA 1F5CA 2BKOA 4QYRA 1NSPA 3O2IA 2CNNB 4XDCA 2YY3A 1SKWA 2MLZA 2RS2A 5IS2A 5K8MA 4I6YA 4ECTA 9RUBA 4OYOA 5KFXA 2C2ZB 4URQU 4IG0B 3MEGB 2WVDA 3Q89A 1U2FA 3KK3B 1VQ8S 3BSCA 4J9NA 2OPRA 1YX2A 1FJGJ 5KFPA 2MGZA 2FTRA 1GNKA 4DCOB 3ISZA 1F2GA 2HSEB 1YIJS 1RT1B 1N88A 4LSNB 4B9NA 1SQGA 1MSWD 3CJQA 3VVUA 1RAEB 4P75A 2Y1RI 2DRAA 3IWXA 5CYQA 3OL6A 2KKHA 2HBZB 4O3QA 4Y0FA 2ZHBA 2YQ3A 2W9CA 5KFTA 3RTVA 5HANA
chains in the Genus database with same CATH topology
2UXCJ 4NXNJ 4LFCJ 2F4VJ 4NEZA 1N34J 2UXBJ 4LF9J 4X65J 4DR7J 2MEWA 5BR8J 1HNZJ 2VQEJ 4DV0J 4LF5J 4JI0J 4X62J 1IBLJ 3R2DJ 4DV6J 3R2CJ 5FLXU 4B3MJ 4RJVA 4LF6J 4DUZJ 2E5LJ 2ZM6J 1HNXJ 2UUAJ 4LF8J 1HR0J 4B3SJ 2KVQE 4JI5J 4X66J 4OX9J 4KHPJ 4DR6J 4YHHJ 5LMNJ 3J80U 2MQ8A 4NEYA 5A2QU 1XMOJ 2UUBJ 3J81U 4JI8J 1IBKJ 4LF4J 2UU9J 4X64J 4LF7J 4JI1J 2HHHJ 1FJGJ 1IBMJ 5AJ3J 3T1HJ 4JI4J 4DV4J 1XNQJ 3W1YC 1N33J 4AQYJ 4JI7J 4PWWA 4DV1J 4YY3J 4DV2J 1I94J 4KYZA 4DV3J 1N36J 3J7AN 5IT9U 4DR1J 2KL8A 2UXDJ 4DR5J 4JI3J 3OTOJ 4DUYJ 3D3CJ 4JI2J 4V1Ak 4GKKJ 2UUCJ 4K0KJ 3T1YJ 4KY3A 4DV7J 2VQFJ 4DV5J 3IMQJ 5LMUJ 4LFBJ 4HHUA 4NXMJ 3JAMU 4DR4J 5LM7E 4DR2J 4DR3J 2MTLA 4B3TJ 4JYAJ 3D3BJ 4LFAJ 4B3RJ 1XMQJ 4GKJJ 4JV5J 5IWAJ 4JI6J 1HNWJ 1XNRJ 1N32J 1J5EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC J;  4NXN J;  4LFC J;  2F4V J;  4NEZ A;  1N34 J;  2UXB J;  4LF9 J;  4X65 J;  4DR7 J;  2MEW A;  5BR8 J;  1HNZ J;  2VQE J;  4DV0 J;  4LF5 J;  4JI0 J;  4X62 J;  1IBL J;  3R2D J;  4DV6 J;  3R2C J;  5FLX U;  4B3M J;  4RJV A;  4LF6 J;  4DUZ J;  2E5L J;  2ZM6 J;  1HNX J;  2UUA J;  4LF8 J;  1HR0 J;  4B3S J;  2KVQ E;  4JI5 J;  4X66 J;  4OX9 J;  4KHP J;  4DR6 J;  4YHH J;  5LMN J;  3J80 U;  2MQ8 A;  4NEY A;  5A2Q U;  1XMO J;  2UUB J;  3J81 U;  4JI8 J;  1IBK J;  4LF4 J;  2UU9 J;  4X64 J;  4LF7 J;  4JI1 J;  2HHH J;  1FJG J;  1IBM J;  5AJ3 J;  3T1H J;  4JI4 J;  4DV4 J;  1XNQ J;  3W1Y C;  1N33 J;  4AQY J;  4JI7 J;  4PWW A;  4DV1 J;  4YY3 J;  4DV2 J;  1I94 J;  4KYZ A;  4DV3 J;  1N36 J;  3J7A N;  5IT9 U;  4DR1 J;  2KL8 A;  2UXD J;  4DR5 J;  4JI3 J;  3OTO J;  4DUY J;  3D3C J;  4JI2 J;  4V1A k;  4GKK J;  2UUC J;  4K0K J;  3T1Y J;  4KY3 A;  4DV7 J;  2VQF J;  4DV5 J;  3IMQ J;  5LMU J;  4LFB J;  4HHU A;  4NXM J;  3JAM U;  4DR4 J;  5LM7 E;  4DR2 J;  4DR3 J;  2MTL A;  4B3T J;  4JYA J;  3D3B J;  4LFA J;  4B3R J;  1XMQ J;  4GKJ J;  4JV5 J;  5IWA J;  4JI6 J;  1HNW J;  1XNR J;  1N32 J;  1J5E J; 
#chains in the Genus database with same CATH topology
 3VAF A;  1C1B A;  1FRL A;  3D0G E;  4CWB A;  4Y2M A;  4ILM A;  2V8V A;  1JLQ B;  4LBI A;  4C7Q A;  1IN0 A;  3DGP B;  3OVA A;  4K4V A;  3N6N A;  4U7C A;  1FRH A;  2XMA A;  5KG2 A;  2DXE A;  4WBF A;  3W7B A;  4B3M F;  4MYT A;  1DLO A;  4O23 A;  4RBU A;  1A7G E;  2KB2 A;  5KFR A;  4OYX A;  4B9V A;  2DPJ A;  3AXM A;  5H1S V;  4P2F A;  3CCR S;  1FDB A;  1KP6 A;  3TA0 A;  4XO0 A;  4FBU A;  4FVC A;  2HHT A;  4Y28 C;  3Q22 A;  3UD3 P;  1RBL A;  1HQE A;  3Q83 A;  4RU9 A;  4BC7 A;  3HZE A;  2V6A A;  3UCG A;  2Y0S D;  3T5L A;  5B0D A;  4Y2I A;  3EWG A;  1ZYQ A;  3KJF B;  3QWU A;  3SBM A;  1N32 F;  1TK0 A;  2K1R A;  4HVZ A;  1YZ6 A;  3HHE A;  1KD1 T;  1HFE L;  2ZUG A;  2EG1 A;  5CQG A;  3CVK A;  2LQB A;  2ALZ A;  1RBA A;  1N32 J;  1YBU A;  3M8Q A;  3TX0 A;  4LFC J;  2WON A;  2FY1 A;  4OJ1 A;  3MOJ B;  2MKK A;  2BJ3 A;  4NRT A;  4NLT A;  2AW0 A;  3QO9 B;  3FZB A;  2KT5 A;  1S1W A;  5CYM A;  3IM8 A;  2K8G A;  4DPX A;  2CFX A;  3V6D A;  4ZJO A;  2I9S A;  3NGD A;  3OT9 A;  4LF8 J;  4AQY F;  1RT7 B;  4NZ6 A;  3LAL A;  4R5P A;  2BJ7 A;  4Y2A A;  1S1T B;  4H4K C;  2P9E A;  3PIP Q;  5LMN F;  1RJJ A;  1FK9 B;  1OQ6 A;  2NRE A;  5ETL A;  1T9U A;  4NYZ A;  2HHH J;  2N4D A;  1IKW A;  1Q0N A;  4AQY J;  2G0I A;  4U96 A;  1LW0 A;  5DDQ C;  4KH0 B;  2IPO B;  3MPV A;  2R8G A;  3CIZ A;  3FZ2 A;  2IFX A;  3G2X A;  4OL8 A;  2BAB A;  2KVI A;  2DYA A;  5LM7 E;  3FNN A;  5A2Q Y;  2GHV C;  2IBK A;  2XO6 A;  4DF4 A;  2F5G A;  3BBB A;  4OHW A;  4LRE A;  5KFA A;  2QA4 S;  3PW0 A;  4AND A;  2VA2 A;  3WX4 A;  2OUG A;  2V8D A;  1Q5V A;  4RW7 A;  1ZM2 A;  4KO0 B;  2M9K A;  3N9U C;  4X4O A;  2WBM A;  1UJ5 A;  1Q86 T;  4RUH A;  2ZM6 F;  5HMW A;  3CCL S;  1RQ0 A;  1HR0 J;  3SI8 A;  3LTO A;  5KOW A;  3L3C A;  4ECV A;  1RT3 B;  4X66 F;  4B9T A;  1KHW A;  4ECZ A;  4ELT A;  2L9N A;  4IDK A;  2U2F A;  1M5K C;  1S6P A;  4WK3 A;  4WJB A;  2HQI A;  5D15 A;  1IKV B;  4YR0 A;  4B3O B;  4C0O C;  2HLT A;  3C14 B;  3CD7 A;  4O3O A;  1ULR A;  1NDL A;  3NS5 A;  3TOQ A;  2NYH A;  4ZVR B;  4CQ1 A;  4FXW A;  4EYI B;  2FZG B;  2RD5 C;  3S1T A;  2H5J B;  1HNV B;  1SJQ A;  1K1Q A;  2ZH4 A;  3KLV A;  3K8W A;  4C8O A;  4MYU A;  4GVL A;  2XMU A;  5HQ8 A;  1QSS A;  4UTG A;  1SI9 A;  5KG0 A;  2QE5 A;  1VIO A;  4M63 A;  4KKO A;  3I5A A;  1UTA A;  4KHM A;  4HH0 A;  3OFH A;  1I3O B;  3OTC A;  5KG1 A;  2ALY B;  1SC4 B;  4ILL A;  2UV8 G;  1S1U A;  1DJ0 A;  1UP1 A;  4ZJQ A;  2ROG A;  5ADZ A;  5IXU A;  3RBD A;  1QDU B;  2F63 A;  2Y9H A;  3GJT B;  3TI0 A;  4KGX B;  4QPX A;  3MUT P;  3MFH A;  2COL A;  3A13 A;  1YBT A;  1CQN A;  1JLA A;  1X8D A;  1P9Y A;  4Q8F A;  5LXR A;  4NEY A;  4DQI A;  3CUL A;  5AXK A;  1PYT A;  2I5J A;  3O1L A;  4CI0 B;  1KR4 A;  1L5U A;  2HUR A;  3QIP B;  1EHW A;  4RX6 A;  1IQZ A;  5B0G A;  2WOM A;  1HNI B;  1N36 F;  2CYY A;  3D1H A;  5J2N A;  3R7B B;  1VQM S;  2MKI A;  7FDR A;  2MKS A;  2OPS B;  2ZIT A;  1S57 A;  2X1G A;  1KTV A;  3EGN A;  4O3S A;  3MM5 B;  1Y9O A;  4JYA J;  2HGN A;  4B3R J;  4QYZ K;  3VVT A;  4PWD B;  3PDN A;  4EZ6 A;  2JOQ A;  3IG1 B;  4HDG A;  2QSW A;  3H4B A;  2YVS A;  3OVB A;  1NDP A;  2J0S D;  1IUJ A;  3FKB A;  2YH1 A;  1X4A A;  1QD1 A;  5G0R B;  3L7O A;  1IBL F;  3PEH A;  3Q23 A;  1RT6 B;  4UOF A;  1A9N B;  1T3O A;  2GFF A;  5ETV A;  2KHC A;  2K7J A;  4BBY A;  4ZP7 A;  2DGT A;  2XSJ B;  2AJ1 A;  2HAI A;  3QJJ A;  4OX6 A;  4ETX A;  4WFA Q;  1ZAW A;  3ET6 A;  3R5G A;  3N5F A;  4DU8 A;  3VAH A;  4DL6 A;  3G6X A;  2WB1 D;  4G1P A;  2W2M P;  4IRD A;  2B8P A;  2CQI A;  3OXG A;  2EBE A;  3TAN A;  2QRR A;  5IT9 U;  1S6Q B;  5AXL A;  3KLE B;  3FBE A;  1VDH A;  1XR5 A;  2O5D A;  4W92 B;  3IRX B;  4FXD A;  3BGO P;  1O51 A;  5EWG A;  2FVP A;  2MTL A;  1NK4 A;  1FDD A;  2OO4 A;  1ZTT A;  2R7R A;  3LQV A;  3GFY A;  2QLF B;  4MT1 A;  3W9H A;  3ENW A;  1U0H B;  3SMZ A;  1CG2 A;  1RAB B;  2QL7 B;  4DSJ A;  4UF4 A;  1GX5 A;  4M5H A;  1R8A A;  1JLC A;  1RDR A;  1HW9 A;  4OJ3 A;  3R97 A;  4Y65 A;  1ZM4 A;  2CQ3 A;  3IO1 A;  4B3S J;  2RQ4 A;  4ZHR B;  2V2V A;  4DPU A;  2DNG A;  1SJ4 P;  4YHH F;  3W3S A;  2LCW A;  2L3M A;  3CE8 A;  2APO A;  3AQP A;  1K0T A;  1MW7 A;  3IM9 A;  4F0K A;  3KFW X;  1N5T A;  1AFI A;  3P5T L;  3OSP A;  4N41 A;  4QU7 A;  4NCB A;  3CSK A;  2B9W A;  3GII A;  2YNF B;  3M4X A;  3CPW R;  1UVK A;  2OSQ A;  1T03 B;  3OBI A;  4QPT A;  3C6T A;  2C3U A;  3IGN A;  1QJH A;  3P49 B;  2KT2 A;  3DLL Q;  3MZI A;  3B8H A;  1QAX A;  2FUG 9;  5AXM A;  2ZD1 B;  2FJE B;  3OW2 R;  2MQL A;  4Y3C A;  1IKX B;  5K8O A;  2AYG A;  3SIP B;  1OSD A;  2UXB F;  2N3L A;  2MGZ B;  3E51 A;  5K14 B;  4CH7 A;  2DIT A;  2YKM B;  2RDJ A;  3QID A;  4GRS A;  3MPW A;  3ZZZ A;  2GGP A;  4RJV A;  5D0G A;  3NKY A;  2FVC A;  2WTF A;  2MSS A;  4WK1 A;  2QMU B;  4WFZ A;  3PKM A;  2YQ1 A;  1KQF B;  5F8J A;  4RW8 B;  3AHP A;  2I0X A;  5HBM A;  1D0E A;  4EEY A;  2AJ2 A;  2CZ4 A;  2FIU A;  3CXC R;  4CNY A;  3T5H A;  1FD2 A;  4P7T A;  2BRL A;  1IBM F;  3HJV A;  4DEZ A;  1JJ2 R;  2DR6 A;  4C48 A;  4AE5 A;  4CLL A;  3PXG a;  2CWK A;  4PR6 A;  3UN2 A;  2E5G A;  4DUY F;  1MNE A;  2VG6 A;  1R89 A;  1D9F A;  2K06 A;  3T41 A;  4OI0 A;  2KXF A;  2CQD A;  2XG8 A;  5LSO A;  4ZLL A;  1WSV A;  5F3Z A;  4I2P B;  3HHL A;  3NS6 A;  3RR8 A;  4GC7 A;  3HHK A;  1X5S A;  5JVH Q;  2FC9 A;  2CNO B;  5GVQ A;  2HIY A;  1K44 A;  2VPW B;  4DR7 J;  5ITH A;  3G82 A;  5C25 A;  3AY0 A;  2LEC A;  1RHQ B;  3T6B A;  2PI5 A;  2K1R B;  1SJR A;  4C8L A;  1CUL A;  4EBD A;  1UW9 A;  3OR2 B;  2IVM A;  5D78 A;  2BQU A;  1JLG A;  4DMZ A;  4K59 A;  3LWM A;  1WC5 A;  2ZC4 A;  1NK5 A;  3I87 A;  2XS5 A;  1MU2 B;  1HBU A;  4WFN Q;  5CZX A;  4KGK A;  3GJR B;  4C11 B;  4DR4 F;  1UEU A;  2JEJ A;  2LEP A;  4YDX A;  2ZH9 A;  4DR1 F;  1S1W B;  3QWP A;  4DX6 A;  1SL1 A;  2JEF A;  4LBP A;  2BJ9 A;  1FRI A;  1JXE A;  4ZLJ A;  3HX9 A;  3S7R A;  4KV8 A;  4DR4 J;  5DLG A;  2H3E B;  4MKY A;  1WKL A;  2E9T A;  1K0V A;  2XCP A;  2AYB A;  1VLO A;  5AE1 A;  4F3Q A;  5A8W A;  5L1I A;  2ZKT A;  1KC8 T;  3BQ2 A;  2DNR A;  2UUB F;  4OMF G;  1BQX A;  3D6F B;  2UU9 F;  3IWL A;  1T02 A;  1T9T A;  5D0R A;  1N6Q A;  4NZ7 A;  2BX6 A;  3R7S B;  2UXD F;  2OEM A;  3C16 B;  2UUB J;  2UU9 J;  2HQG A;  1UL3 A;  4CO2 A;  2DJW A;  1VQO S;  3F73 A;  2JHE A;  2P9C A;  1VRU B;  3WQP A;  1Y3J A;  2UXD J;  1QY7 A;  4GVB A;  1JWW A;  3M30 B;  3D0I E;  2Q1L A;  1VLY A;  4CLP A;  4ANE A;  2CG8 A;  3CD0 A;  3DRS A;  5D77 A;  3G86 A;  5E3R A;  4BC9 A;  3PYF A;  2V50 A;  4A8Y A;  3K59 A;  2VF3 A;  2Q6C A;  2C2O B;  1HIY A;  4DF8 A;  4DSK A;  5BXI A;  2ADB A;  3RJM B;  2Q66 A;  3D54 A;  4CO4 A;  4ETZ A;  1BQN B;  5A0Y A;  4LF5 F;  3N5B A;  3FQK A;  4KQZ A;  3W2V B;  1N33 F;  1VQ7 S;  4OHX A;  2LEB A;  4J37 A;  3I96 A;  4M5I A;  2NXN A;  2PD1 A;  3OTE A;  3PFO A;  2DVI A;  3KMS A;  4JOU A;  3K5L A;  3QGG A;  2GAG C;  3ILI A;  5DGA A;  4HT5 A;  1U26 A;  2ZC3 A;  1N33 J;  1CC8 A;  1HWK A;  2FVQ A;  2F65 A;  4F50 A;  1F2H A;  3CDA A;  1N52 B;  2WHO A;  1S1U B;  1CJV B;  3D66 A;  1SIW B;  2HND A;  3ILL A;  2ZEJ A;  4BDP A;  3W9J A;  4A8O A;  3LP0 A;  5LMU F;  1UVL A;  2O67 A;  4CNZ A;  2IAJ B;  4GO7 X;  1ZA1 B;  4HLB A;  1LWF A;  1RBO B;  1H0H B;  3NAI A;  4I7F A;  4P73 A;  2V69 A;  2C2E A;  2ZVI A;  4M95 A;  4MH8 A;  5J1E A;  4A8F A;  2M88 A;  3CD6 S;  3VWS A;  3QT6 A;  1R8P A;  2P5V A;  1TAU A;  4W98 A;  2K3I A;  2C2N A;  2POK A;  2QFI A;  3PW7 A;  2QN6 B;  1BGX T;  1FWL A;  4I69 A;  1HBN A;  5F9N A;  2DHX A;  3CCT A;  4KJI A;  2DGW A;  5IT9 Y;  3TJ9 A;  1C4C A;  3UNY A;  5SZT A;  1EP4 B;  4NYO A;  4TU9 A;  4CO5 A;  3FBB A;  1S6O A;  2AWZ A;  4OZJ A;  4RZR A;  1UVI A;  1UWB A;  2D7S A;  3TA1 A;  3W5Z A;  3KUG A;  1LEO A;  3CJK B;  1Q8K A;  3OD2 A;  2O1P A;  3ENA A;  2RRA A;  4USI A;  1FFG B;  2V8H A;  1S4F A;  2UUC J;  4UOG A;  3CW2 C;  3MOZ A;  3DOK B;  5JVG Q;  2BW2 A;  4H54 A;  4RBV A;  3GZ7 A;  4KFB A;  2LU2 A;  2HNY B;  1UFK A;  1VHF A;  3NRB A;  3DI6 A;  1VIS A;  1RAG B;  2CJQ A;  3KDN A;  1N34 F;  1TKT A;  1YRT A;  2DHS A;  4WE1 B;  1Y7P A;  3PYG A;  1ZM3 A;  3UD4 P;  4OJH A;  3BGU A;  4P10 A;  3PNI A;  3E2E A;  1WKK A;  1PSD A;  3CJ5 A;  1E6V A;  5KFZ A;  4OZN A;  1B7F A;  2ZZT A;  4PQU A;  1RT4 B;  6FDR A;  1GTH A;  1OMS A;  2U1A A;  2XLI A;  4IG3 A;  4KH1 B;  2OFG X;  5HSP A;  3M6V A;  4L76 A;  1LK5 A;  4EZ9 A;  1S77 D;  2XY5 A;  3RGI A;  5DQH A;  2DH9 A;  1RTI A;  4CO3 A;  1Y4Z B;  2HAF A;  2JSX A;  3H20 A;  4PWW A;  3OFG A;  5JUM A;  2B6A B;  3H8Y A;  1ZH5 A;  3SFG A;  1XJW B;  4ZVP B;  3J7A N;  1M1K T;  3VZH A;  4ZLN A;  2YNI A;  2KL8 A;  3OTO F;  4F02 A;  4JI2 J;  1FD8 A;  2OPQ A;  1RLD A;  4ID8 A;  4DV7 F;  2DKO B;  4C3L A;  3QT5 A;  1YWX A;  4OX7 A;  3DRP A;  1XMQ J;  3KJN B;  1ZPW X;  4GKJ F;  3DRX A;  3TX8 A;  5KFY A;  1G2E A;  3C46 A;  2RIJ A;  4DUZ F;  1SKU B;  1F3F A;  1D9A A;  1S72 S;  2AEF A;  3KJQ B;  3JYT A;  2R7S A;  5BR8 J;  1UWA A;  2E5I A;  2LA6 A;  1V3S A;  1LOU A;  3D5M A;  3C6T B;  4DUZ J;  1GEH A;  3HT3 A;  1RWN B;  2HFV A;  2DRD A;  3CDU A;  3M7V A;  1WC4 A;  2MJU A;  1WC6 A;  2XBP A;  2M4M A;  3I0R B;  4A4J A;  5HRO A;  4FBT A;  4NOH A;  3T1H J;  5I3U B;  3M32 A;  2XLK A;  5DDO C;  8AT1 B;  1H2T Z;  2CUY A;  4L75 A;  1VQK S;  1T94 A;  2BMB A;  2NXU A;  3UPF A;  2HBY B;  4ZLP A;  3FCH A;  3RB0 A;  1K8A T;  1S7I A;  1WOS A;  2IMW P;  2KI2 A;  1HHS A;  2XMW A;  3IXQ A;  1TKZ B;  1WDT A;  5D3G B;  3PEJ A;  3DM2 B;  1J27 A;  4KGV B;  3MEK A;  3G96 A;  1C0U A;  4ZVS B;  2ZH8 A;  3TAR A;  2KH9 A;  4RNN A;  4PRF A;  2JNJ A;  3GYN A;  1FX4 A;  1ZZF A;  1EB0 A;  1RIS A;  3HI9 A;  2QL5 B;  4ZPD A;  1HI1 A;  2VG6 B;  2C2R A;  5B7W A;  4OLP A;  3AQO A;  2W25 A;  3I55 S;  1FKA F;  4MKA A;  3HHL B;  3KLH A;  3O5T B;  5CYJ A;  5KFD A;  2RNE A;  3QT8 A;  3W1Y C;  3DOL B;  3K2Y A;  2AMC B;  2N3O A;  4IOB A;  4TN2 A;  3GV5 B;  2HZC A;  3DLH A;  3G82 B;  5C25 B;  1X4E A;  4C8Z A;  1BE4 A;  3BS9 A;  1IBC B;  5HI7 A;  4H4O A;  1TUV A;  3PAC A;  5HMX A;  5ETQ A;  1R27 B;  4ECR A;  1GK8 A;  4ES3 A;  3C8Y A;  3B54 A;  1UFL A;  3MR3 A;  2HK3 A;  1YG0 A;  5D0H A;  2F4V F;  5T41 A;  2DNO A;  2RKI B;  2VD3 A;  2PII A;  3UFC X;  2VG7 B;  1V5I B;  2OHD A;  4ECX A;  1VFJ A;  1AYE A;  3PW5 A;  4UZC A;  2XCA A;  1AUS L;  3BEG B;  2N7C A;  2PDA A;  2XZT B;  4PXE A;  1H2V Z;  3DRY A;  3TVK A;  4OZ0 A;  2KYX A;  1XN9 A;  2K2P A;  4I1T A;  3OVS A;  3B78 A;  1TR0 A;  4CT8 A;  1RGV A;  1TVR B;  1YLX A;  3Q8P B;  2DCL A;  2CIM A;  3LUY A;  4J5O A;  3HVA A;  1U8S A;  4DPT A;  3AA9 A;  2IVF B;  4KPC A;  5B0B A;  3MD1 A;  3P8B B;  1KOO A;  2B8Q A;  2L08 A;  5B0F A;  2F40 A;  4QIV A;  3K5M A;  3MM7 B;  1N56 A;  3FEY B;  4B17 A;  2BE2 B;  3HVR A;  1SC6 A;  4DR3 F;  4N8O A;  2CNK B;  2J0W A;  1DUR A;  2EG2 A;  3EVM A;  2XLJ A;  2D1C A;  3CCJ S;  1VCT A;  2W2P P;  2ZHO A;  3FGV A;  4WYW A;  2MQN A;  4ZPT R;  1HYS B;  2ZUA A;  2VOO A;  4WII A;  2C3M A;  5C2C A;  2KZZ A;  3HD1 A;  1YVF A;  4YP3 A;  3MED A;  1ZOT A;  1S4E A;  1VIX A;  1T7P A;  1B0V A;  2XYP B;  2M3D A;  3IS9 B;  4HHJ A;  3HK2 A;  2CWX A;  2YTC A;  1WC3 A;  1V3R A;  4LJM A;  3EIC A;  1IJE B;  5KG7 A;  4P2X A;  4JI8 F;  1H2U X;  4LF7 J;  2YH0 A;  2VG5 A;  3P6Y C;  2FHO B;  5AJ3 F;  3W2W A;  2OPP A;  2DY1 A;  4TU8 A;  4DV1 F;  2A10 A;  3QLH B;  2IYG A;  1MWZ A;  2HHX A;  5HJX A;  1LV5 A;  1S9E A;  2MMY A;  1S9G B;  1MMD A;  2BM1 A;  2VQF F;  5ETO A;  4J9U E;  2NXJ A;  3ETO A;  1S76 D;  3J7Z 5;  1M1G A;  2ZNY A;  2F3J A;  3KTQ A;  4LR7 A;  1NU4 A;  4F4Y A;  1HNX F;  2B0G A;  3A8K A;  4USK A;  3MUV P;  3HVW A;  4FS2 A;  1NO8 A;  4M5J A;  4JI0 J;  4TU7 A;  9ATC B;  3SQO P;  1J5O A;  1ZPV A;  1OO0 B;  5M2U A;  4IO1 A;  4OYW A;  4K4Z A;  4PXB A;  1TL4 A;  2XGQ A;  1HNX J;  3TYT A;  2XQC A;  1M5O C;  1M5P C;  2P9G A;  1RHR B;  1KLM A;  4KHP J;  3BKT A;  3QBC A;  2I38 A;  5L9N A;  4I7F B;  3DHX A;  3MMB B;  3HSJ A;  5E3Q A;  4RNO A;  3C15 A;  3HLU A;  3RRG A;  3PYD A;  1B3T A;  3DMJ A;  2ROE A;  5J1E B;  1SJ3 P;  4HT7 A;  2GO9 A;  1NK6 A;  1QM9 A;  3Q8Y A;  3PTW A;  4DR5 F;  3CF5 Q;  3QT7 A;  5KAK A;  2BKN A;  2DCU B;  1QSL A;  2HGM A;  2ZH3 A;  1HBN B;  3MM6 B;  1X4B A;  2VIH A;  5HO4 A;  4LMZ A;  1PC5 A;  4LR9 A;  1IKY B;  4G1Q B;  4DQS A;  2ZNZ A;  4TQR A;  2NS1 B;  2W9A A;  3MPD A;  2CPI A;  1TU0 B;  2ACY A;  2AGQ A;  1S0M A;  3EZO A;  2GVD B;  5IM0 A;  2NZ4 A;  4HI2 A;  4DWI A;  2Y8Y A;  4YN3 B;  1S99 A;  1HI8 A;  3CB4 A;  2E44 A;  5E7O B;  4DX8 H;  3M9O B;  3OXF A;  5EWE A;  1LW2 A;  2FLP A;  4FDF A;  3ZTP A;  1ZET A;  2VPX B;  2JLE A;  2WB4 A;  4NLO A;  2M8D B;  2N4C A;  2RQC A;  2J7U A;  2W4P A;  4RBT A;  4I2Q A;  3HHD A;  1RT5 A;  2XWY A;  4P52 A;  1FT8 A;  3OHA A;  1OPI A;  5C24 B;  3RB3 A;  4B9U A;  1XBW A;  3W8P A;  3HZG A;  4U8V A;  3GG0 A;  1I94 F;  5DJB A;  2ZFH A;  2R8I A;  4GMK A;  4PKD B;  2D3O R;  3KLF B;  3W64 A;  3ITH A;  3LGH A;  4PUO A;  2W2Q P;  2CPE A;  3H5X A;  4PZV A;  5IQQ A;  1YBA A;  1GMV A;  3J80 Y;  4U7U K;  1CJU A;  4DR2 F;  2IMO A;  5GAH I;  4IO9 Q;  5IWA J;  2VV5 A;  4P9S A;  3U27 A;  1DQ9 A;  3CUN A;  1EAR A;  5GAE U;  3NMR A;  1OY8 A;  3PRV A;  4TVA B;  3R6L B;  3PFE A;  1WSR A;  2R2R A;  1FVQ A;  3HF5 A;  2DNN A;  4DV0 J;  4FKY A;  1DTT A;  3MPU B;  2JEG A;  4O3R A;  3NY0 A;  2YNG A;  3K5N A;  4R8U A;  1K9M T;  3B4D A;  1UET A;  3T3F A;  2L48 A;  3TAM B;  1TV6 A;  4LT6 A;  6AT1 B;  1NAQ A;  5ETM A;  2RML A;  1U45 A;  1SH3 A;  1NK8 A;  2HHP A;  3EXC X;  1JKH B;  3M05 A;  5FLX Y;  3HD2 A;  3MMC A;  3EPG A;  4XAK A;  4JV0 A;  4J9Q A;  5F9L A;  1WG4 A;  1U09 A;  3CDW A;  4F4W A;  1X9M A;  4OI3 A;  1IM4 A;  4WTY A;  3ZFV A;  4NA2 A;  4ES2 A;  3LOU A;  3SV3 A;  1NJZ A;  4J7C A;  2XZW A;  4R0E A;  3PO5 A;  3H5Y A;  4CTA A;  3HPO A;  2FJX A;  2FPH X;  2PMH A;  4CLF A;  2W2O P;  4DV6 J;  2B3T B;  2UVU A;  1WDD A;  4DQQ A;  3JXO A;  1VR6 A;  2AV5 A;  1WF2 A;  1FXR A;  2DIU A;  1TMJ A;  5IQ6 A;  3DLB A;  3X1L B;  3RR7 A;  3JTN A;  2DEI A;  4O4R A;  1HBO B;  3O6Q A;  1N0V C;  3P3D A;  1F9E B;  1ZZN A;  3CCM S;  4TQS A;  3J7A 1;  2ZDO A;  4ELV A;  4YME A;  1KN6 A;  1RTH B;  4IG0 A;  3MEG A;  4PPZ A;  3CDE A;  2W7O A;  1N5S A;  2UV8 A;  3MHY A;  1N0U A;  2YWE A;  3L4B C;  1AFJ A;  5I42 B;  4O3N A;  4ES1 A;  4GKK J;  3PJX A;  2V9K A;  5GAG U;  1LNQ A;  3C66 A;  3D9B A;  5IC6 B;  1RT1 A;  3D68 A;  4CM0 A;  2OTL S;  4LSN A;  2IYI A;  2CQ4 A;  1EJ7 L;  1HWJ A;  1L3K A;  3BGR B;  3EYZ A;  2V68 A;  3FMW A;  1BXN A;  2HVI A;  1Q79 A;  3C3L A;  4CLW A;  4M5N A;  1SKS A;  4DL3 A;  1SUQ B;  3G6E S;  2YKQ A;  1P8G A;  2QA1 A;  1Q1K A;  5RUB A;  3LPE A;  5HVG A;  1JLQ A;  1QUP A;  4IH7 A;  2UVV A;  2W24 A;  1ITP A;  4YY3 F;  3DGP A;  5D4L A;  3M8Y A;  1Y3K A;  2ZWP A;  3CNQ P;  3JSM B;  1I1G A;  5KT2 A;  3TUJ C;  3V4M A;  2VFU A;  4DS5 A;  2D3U A;  1CLF A;  3D28 A;  4AYB D;  1SJ1 A;  1YGY A;  1OYE A;  3G87 A;  2MLY A;  4YY3 J;  2VFV A;  3THT A;  3MPY A;  1T9X A;  4X2B A;  2G0C A;  1RE1 B;  3IR7 B;  2QLB B;  1HI0 P;  2RDD A;  4HL9 A;  1ICE B;  1Y0H A;  1RWX B;  4LVO P;  1M0S A;  1Y5I B;  4HEA 9;  3WC0 A;  2HGL A;  3TZX A;  3ZXW A;  3ENV A;  1G6B A;  4EI2 A;  2WAQ D;  2J0X A;  2BJ1 A;  2XB2 D;  3DLG B;  5DET A;  4E0D A;  4ZVO B;  2IM1 A;  4WKR A;  1M5S A;  5A76 A;  4JB8 B;  5LJ3 Y;  3D1O A;  5H9E J;  5KFS A;  4ED7 A;  5M2R A;  3ZTS A;  2BA9 A;  5HAO A;  4TXS A;  1XIQ A;  1Q78 A;  2F7V A;  1YIT S;  3D6T B;  5JMN A;  4ZVQ B;  4P2S A;  4ZIT A;  2HS4 A;  4K0K F;  3TJA A;  1RT7 A;  2EC2 A;  4JI1 F;  3RB6 A;  4WP3 A;  4JI7 J;  4OYI A;  1KRP A;  1HPZ B;  4DV2 J;  1S1T A;  3VR1 A;  4YUD A;  2C2D A;  1FK9 A;  1RWO B;  1PO6 A;  2O3D A;  5D8H B;  4K0K J;  1ZBT A;  1FKP B;  2J9D E;  4ED5 A;  4RW6 B;  2HWH A;  3DNC A;  4K4Y A;  2C3O A;  5BYR A;  2R7X A;  2OEJ A;  4OFZ A;  3N6L A;  1H3D A;  1Z2L A;  4XDD A;  1S1X B;  5THW A;  3HMJ G;  2C28 A;  1JNR B;  2E29 A;  1YDL A;  3I82 A;  1LWC B;  3BR8 A;  4PQA A;  3A12 A;  1T9V A;  3MGJ A;  1DBD A;  1ROF A;  1X4H A;  4YFU A;  4X64 F;  4RUB A;  1FXL A;  2UUA F;  3H25 A;  2P6S A;  4NLV A;  1O6X A;  2KVQ E;  1R6Y A;  1CEZ A;  4PG6 A;  5C42 B;  5KFW A;  1WHW A;  1YJW S;  4YDD B;  1WC0 A;  1MRO B;  2IJR A;  4X64 J;  3DXS X;  4DN0 A;  3BF4 A;  1VRT B;  1RT3 A;  5K8P A;  1SQE A;  4ZN1 A;  3K8V A;  1Z2Z A;  1LWE B;  3KUE A;  3UR3 C;  4TLR A;  3QRR A;  4TKT A;  3AOB A;  5E33 A;  1FTR A;  3CT9 A;  1IKV A;  1NLK L;  4ED0 A;  4AXJ A;  3RW6 A;  1B4S A;  2OP5 A;  3C14 A;  2AYE A;  1RWK B;  4ECY A;  1X4C A;  1PIE A;  2CAD A;  4LF1 A;  5KFG A;  2MHE A;  2HQ3 A;  4ID5 B;  2EFV A;  1HNV A;  4F4X A;  4QOT A;  1Q4R A;  2AJ4 A;  3X3U A;  5HL7 Q;  3C15 B;  2B4U A;  2VL1 A;  5HMY A;  4K8R A;  3DMJ B;  2GVZ A;  4NZ0 A;  3JSB A;  4XTT A;  2E5L J;  4A8X A;  3WDO A;  3KHL A;  2B9X A;  3MAH A;  1N4L A;  1VC0 A;  4A8M P;  1GXT A;  5GAG I;  3EVO A;  5E3C A;  1KTQ A;  2KFZ A;  3I5B A;  3EE3 A;  1S1V B;  4K4S A;  3V4I B;  3TQ1 A;  3AFG A;  2X3D A;  5AE2 A;  4IH6 A;  4OYB A;  4ZIV A;  1OSC A;  3LP1 B;  4Z7C A;  3TO8 A;  3HP6 A;  2HVZ A;  3FDS A;  3Q8V A;  3W62 A;  1WC1 A;  1KLN A;  3QIP A;  1GFW B;  4DPY A;  4A47 A;  4CH1 A;  1VYA A;  2A6O A;  4LF9 F;  2FHK A;  1S0V A;  2MZR A;  2F9J A;  1HNI A;  1ARO P;  4USH A;  4BLG A;  3Q24 A;  3CMA S;  2FLN A;  2G1D A;  1W7W A;  3DLK B;  3R27 A;  4X4N A;  3MM5 A;  2OMO A;  4LF9 J;  4DFJ A;  2MKY A;  2MLX A;  3M6U A;  4K2J A;  4N5S A;  3AA8 A;  3GFH A;  5A6W A;  2G13 A;  3VGT A;  4LIW A;  1IXK A;  4M5L A;  2QLX A;  3Q8Q B;  4OHY A;  3IG1 A;  3JQJ A;  2IRU A;  3SSR A;  4RUA A;  2FHM A;  1RHM B;  3UN3 A;  4NML A;  3DLE A;  1W25 A;  2EPI A;  2R7V A;  4MFB B;  4O44 B;  3J81 U;  4RW4 B;  5DDP C;  5T7L B;  4OZ1 A;  3E3X A;  3WX8 A;  2JC1 A;  3ULH A;  3MFI A;  2XSJ A;  3KKF A;  1JLE B;  3IWN C;  3G8Q A;  3GFX A;  1RAF B;  2P2C B;  3PW2 A;  2QMW A;  2KT3 A;  1ZAV A;  1WEX A;  2FVS A;  2YNG B;  1NME B;  4R8U B;  2ABY A;  2CPZ A;  2RVJ A;  4NLQ A;  5DM6 Q;  1S6Q A;  2ZBC A;  5T14 A;  1HNW F;  1N48 A;  2V2Q A;  5IV4 A;  1VBX A;  1UFW A;  4O4G B;  1HNZ F;  2NSC A;  3IA0 A;  2HLU A;  3I4P A;  2Y0B B;  2DHG A;  3HDS A;  2E5H A;  1U0H A;  3GB0 A;  2N82 B;  1YRX A;  1VI7 A;  1FE0 A;  2D3Z A;  1PCA A;  1XQI A;  2RQM A;  3THP A;  3VAG A;  1CJK B;  1P1T A;  3O3L A;  2MXY A;  2DGX A;  1SBR A;  3VV2 B;  1RB0 A;  2Y1J A;  3V2U C;  4ZHR A;  1RLC L;  2LQ8 A;  1WG5 A;  3B6B A;  4I6W A;  2G2O A;  3V6K A;  2YNF A;  4ELU A;  5L8R C;  3RZA A;  4CLK A;  4U9R A;  1T03 A;  4DX7 A;  1RWP B;  2Z8Q A;  1FRX A;  3IR5 B;  4RLE A;  3NBP B;  2XZD B;  1QLN A;  2FD2 A;  5I3Q A;  3LAK A;  5DZ6 A;  1R0A B;  4DQR A;  1G4C A;  3HFK A;  4M1K A;  2ZD1 A;  1TL3 A;  2OEK A;  2H51 B;  2WVB A;  3OTB A;  3PYE A;  1IKX A;  1T05 B;  4OZ3 A;  3CCE S;  4NLS A;  5A8K B;  2XC9 A;  3WZ0 A;  4PG5 A;  5K14 A;  1OQ3 A;  2QIF A;  2YKM A;  3UW1 A;  1E6Y B;  4DSF A;  2CDR B;  2GZO A;  3K7R A;  2DNZ A;  3F41 A;  4E8U A;  2VPZ B;  4QR2 A;  3TZW A;  4QWA A;  1TEL A;  1BQM B;  3BN4 A;  5ETK A;  5BYQ A;  4RW8 A;  4FF3 A;  2AQ4 A;  1TL5 A;  3ZNJ 1;  3HSD A;  5KFK A;  1AZS A;  3H7H B;  4UOC A;  3GPA A;  3O44 A;  4F3M A;  1R0B G;  1RTZ A;  3CCV S;  1VQ6 S;  2J6T A;  4KHR A;  1WF1 A;  5LXY A;  3FRY A;  1BLU A;  3DGV A;  3PX6 A;  3TW0 A;  4I56 A;  3BZQ A;  3LP2 B;  2G2Y A;  3NGT A;  1KFS A;  4I2P A;  4K4U A;  1WD6 A;  4XPE A;  4DU7 A;  1WWH A;  2E1R A;  1JIH A;  1NEE A;  1O5J A;  4B3M J;  1JJC B;  3UI3 A;  3HM9 A;  4M8L A;  2CG4 A;  2NR0 A;  2ILY A;  1VJQ A;  4ZCM A;  4F36 A;  2I8E A;  2VON A;  1HMV B;  1Y5N B;  4UY8 5;  3EDR B;  3ILO A;  1TKX B;  4YR3 A;  4ZVH A;  5KFM A;  3NNA A;  3OR2 A;  2V34 A;  1HBM B;  3BR9 A;  2HRY A;  2J6S A;  3G4S S;  1RHU B;  1MU2 A;  2JLF A;  4WTO B;  3SYZ A;  3CME S;  2HFU A;  4C11 A;  4DV5 F;  3CDB A;  4PPD A;  2QA2 A;  3RW7 A;  5I3P A;  3GYG A;  3BKU A;  4M5D B;  1WOR A;  1DAR A;  2PEB A;  2ASL A;  5DLF A;  1V9O A;  2AT1 B;  2M52 A;  2CQ1 A;  2WVE A;  2ZKU A;  3UR0 A;  4C3K A;  1DQA A;  2GHW A;  3N28 A;  3AD9 C;  2BOP A;  3BGL A;  3GU0 A;  3GJS B;  2V67 A;  4DFP A;  3MMJ A;  3D67 A;  2BXJ A;  1JNZ B;  2DT9 A;  5EDW A;  1TK8 A;  3MR5 A;  4MIB A;  5LMN J;  4TY9 A;  2MQ8 A;  4C0B A;  4N77 A;  1RA7 A;  1HQU B;  3EJM A;  2NLW A;  1FES A;  1UEK A;  2CPF A;  2QFJ A;  3MR6 A;  5A8R B;  4NXM F;  2B7C B;  4DJB A;  1L3T A;  2EI5 A;  3BDE A;  3OSN A;  2M7S A;  2YKN B;  1KS2 A;  1LFP A;  3C16 A;  1KFD A;  1S48 A;  2R7U A;  1Q8B A;  1CJT B;  4NCG B;  1KQK A;  1Y10 A;  4N7T A;  1JXL A;  3QMQ A;  2HVE A;  4YEA A;  1WHX A;  1LK7 A;  1VRU A;  4NXM J;  2Z4P A;  3GJQ B;  1IR0 A;  1RWU A;  3FSX A;  5F0U A;  5KT3 A;  3M30 A;  1U1P A;  4NI2 B;  1SJF A;  1VC6 A;  1J5E F;  2H4Y B;  2ATL A;  1VQ4 S;  2NSB A;  3CJ4 A;  2VOP A;  4MK7 A;  1Y11 A;  4UY8 T;  1L3V A;  2CQG A;  2EXU A;  2YX7 A;  4MIW A;  3AJ1 A;  3A1Y G;  1H72 C;  2C2K B;  1WI6 A;  4I64 A;  2FJA B;  2DHA A;  2A0F B;  5LSR A;  5IV3 A;  3AXK A;  3P96 A;  4KRW A;  1FRJ A;  2ZM6 J;  3NOG A;  3BO3 A;  1BQN A;  2JWN A;  3EZ5 A;  1UJ4 A;  2EFP A;  5JJB A;  4X66 J;  5KFI A;  4UUW A;  5J2M B;  3W2V A;  2OML A;  2R7T A;  5F8N A;  2NPF A;  2BJE A;  4DSI A;  2BEF A;  3I56 S;  3QSI A;  4OZ2 A;  4B9M A;  5FII A;  1GT8 A;  2Q6B A;  2NUU G;  2GVZ B;  3HJF A;  4NLP A;  4QWC A;  2HZA A;  5DQI A;  2RF2 B;  3GSI A;  4YQW A;  1NJW A;  3G71 S;  2E5J A;  4LQ3 A;  2XMM A;  2VBX A;  1CJV A;  3BH7 B;  2DPI A;  2M5Y A;  3GG1 A;  3M8W A;  5DG9 A;  2JRS A;  3QFH A;  2CPD A;  1EAY C;  1XNR F;  4N56 A;  5KT6 A;  4NEZ A;  1M5V C;  3DC2 A;  1SC1 B;  1S7H A;  1XK8 A;  4CYU B;  2LP4 A;  3M2V B;  2IAJ A;  2LXI A;  5GAD U;  1RP5 A;  2HQF A;  5LOQ A;  5KG4 A;  2HVH A;  3QGH A;  2P6T A;  2FY8 A;  3H42 A;  3M8Z A;  5L39 A;  3I0S B;  3VQS A;  3N0V A;  2EKY A;  4I68 A;  4N76 A;  2JEI A;  1X4D A;  4KB7 A;  4DR6 F;  4CCH A;  4NLD A;  3CCU S;  3MD3 A;  4FPI A;  5C2G A;  5E3P A;  4EWT A;  2ZH1 A;  3T1Y F;  2DGV A;  2AGP A;  2GX8 A;  1EP4 A;  2XY6 A;  3CMQ A;  4F25 A;  1D1U A;  1N36 J;  2UVR A;  4F4A A;  3MF5 A;  2MZJ A;  3HHL D;  3I32 A;  3MEE B;  4R25 A;  3T1Y J;  3CC4 S;  3M9M B;  3CJK A;  3TUZ C;  5EN1 A;  2BBE A;  4RL1 A;  2V0N A;  2R2U A;  4EO8 A;  4DZD A;  3DLE B;  3MCM A;  4BCA A;  2R42 A;  4IR1 A;  3MDF A;  5KFJ A;  2EVZ A;  2W8L A;  4PXD A;  3K57 A;  3CC2 S;  2HBR B;  3DOK A;  2B9Y A;  4WFX A;  4X4Q A;  4JUZ A;  1HD0 A;  4AL5 A;  3ONQ A;  2HNY A;  3FQL A;  2AJ0 A;  1IBL J;  3GIR A;  4Q7A A;  2VDH A;  4G1I A;  3M8P B;  1X5O A;  2BM0 A;  1JX4 A;  1YJU A;  5F8G A;  2BDP A;  2X1A A;  4WE1 A;  2ZBP A;  2X3G A;  2V9W A;  4I4B A;  2IC3 A;  4IFV B;  4IKA A;  2CRL A;  3R5D A;  2QZ8 A;  2G1H A;  4ZVE A;  2IM3 A;  1AW0 A;  4EMD A;  4DL7 A;  3VGU A;  2EEY A;  1XMO F;  2D69 A;  3BB5 A;  5EX3 A;  1V6H A;  1RT4 A;  3H0P A;  5HAT A;  1FKO B;  2E9Z A;  2QA4 G;  1S97 A;  3VGV A;  3CJ8 A;  4ITS A;  1YSJ A;  3C6U B;  2HVD A;  1NBE B;  4DCJ B;  3W63 A;  2CNL B;  3PRD A;  2FJD B;  1N5Y B;  1U1R A;  3CCQ S;  2B6A A;  2FQQ B;  5DDR C;  1DHM A;  1R8B A;  1SL2 A;  5KFB A;  4FZV A;  2OH2 A;  3BBF A;  3OLB A;  3LO3 A;  1GTE A;  1NH7 A;  1JLB B;  1FX2 A;  2ASY A;  5F3T A;  3R9L A;  4X62 F;  1FO1 A;  1TK5 A;  1TMM A;  1JXV A;  3HVT B;  4FVM A;  2H5E A;  5SUH A;  3MM8 B;  3L9Z A;  5IZH A;  2ZOG A;  3GP9 A;  2GHP A;  3ZO7 A;  2DR8 A;  2OKQ A;  1S0O A;  4YHH J;  2XHW A;  5KOX A;  1WEL A;  3PHE A;  3Q8R B;  4LF4 F;  1RUS A;  4B02 A;  2LU1 A;  3GIK A;  5AE3 A;  1I6J A;  2KO1 A;  1VS3 A;  1DZ5 A;  2WCX A;  3M1V B;  1NXI A;  2JVR A;  3I0R A;  1GQE A;  3I9V 9;  3MUR P;  1CSJ A;  1TL3 B;  3KYL A;  1UVJ A;  1OJ4 A;  1U48 A;  3G6Y A;  4QW9 A;  1F9F A;  5I3U A;  2KM8 B;  3FEZ A;  2MJN A;  3R1L A;  1REV B;  3VAI A;  3CC7 S;  3MAQ A;  3DKD A;  4K4T A;  5BYS A;  3T9Z A;  4ZPW R;  1RHK B;  5HP1 B;  2UXB J;  2DR7 A;  4DG1 B;  1RCO B;  4J9L A;  1AZS B;  4ICL B;  2ZH6 A;  2FZC B;  3DU6 A;  3RAQ A;  4IRK A;  1TKZ A;  2WK4 A;  5B09 A;  3OLA A;  1LXJ A;  5D3G A;  3DM2 A;  4LSL A;  4QIE A;  3W61 A;  1AUD A;  5KG3 A;  1APS A;  1PYS B;  2ZE2 B;  1F5A A;  4QIW D;  4Q44 A;  5A2Q U;  2C3P A;  3OL7 A;  2IY5 B;  4EK2 A;  5E41 A;  1FNO A;  1NJX A;  1IBK F;  1IBM J;  7FD1 A;  4X4R A;  2ZZM A;  1QVG R;  1M5H A;  3HFV A;  4DUY J;  3FUY A;  1DY3 A;  3DOL A;  2Y1I A;  2LEA A;  5GAD I;  3CWJ A;  2C2M B;  1Y5L B;  2VBY A;  2GJF A;  2VU5 A;  4PCQ A;  2J0Q D;  4ZVG A;  4JV5 F;  5L46 A;  2BW7 A;  3OQ2 A;  3R5B A;  2BQ3 A;  4ZOS A;  3RG6 A;  4CO1 A;  1C1C B;  3KWM A;  2XSF A;  4X4S A;  1C2P A;  1BY9 A;  1P6T A;  2RKI A;  2ROP A;  4FPR A;  2FZK B;  3QZ8 A;  2BKP A;  4EYH B;  3KLI B;  2VG7 A;  1FNM A;  1RAA B;  2UUT A;  2BVZ A;  1ZM9 A;  2L41 A;  1PBU A;  2EW9 A;  2UUW A;  4OZL A;  5KT7 A;  3E01 B;  2VFT A;  2R7O A;  1MN9 A;  2LMI A;  4DR1 J;  4DS4 A;  1TVR A;  3VAK A;  3SCI E;  4Y00 A;  4KT0 C;  3POT B;  1REG X;  4M5K A;  5CAB A;  4K2X A;  5H9E K;  3KJV B;  1JB0 C;  3EMT A;  2XNR A;  3R8Y A;  3W66 A;  1CVJ A;  3HHN B;  1MN7 A;  2DB1 A;  4RW9 B;  4QR1 A;  2X1B A;  3MM7 A;  4H4M B;  2BE2 A;  5CA5 A;  2V4J B;  1X5T A;  2V63 A;  3OUY B;  2FGO A;  4ED1 A;  2FGC A;  2ZOF A;  2EK6 A;  1Q8L A;  1AXQ A;  1U0S A;  3NCP A;  2EBG A;  2Z2Z A;  1HYS A;  1PKU A;  4ALZ A;  1R6V A;  5K5M A;  1VQ9 S;  4CIO A;  5CH7 B;  3OFF A;  4ZPA A;  4ZK7 M;  3IS9 A;  1NPK A;  4KSE B;  2NCK L;  3JTP A;  1HWU A;  5J2P B;  3W5X A;  2BOA A;  2CJK A;  4RNM A;  7AT1 B;  3SZ2 A;  2HNZ A;  4FYW B;  3LAN A;  5DM7 Q;  4C8M A;  2K7K A;  4WP9 A;  3GMG A;  3MM9 B;  2GNK A;  3QLH A;  5F0W A;  1WHY A;  1K1S A;  5DZ7 A;  2CKW A;  1QE1 B;  3BH6 B;  3MR7 A;  1VQP S;  4AL6 A;  1S9G A;  4D3G A;  2VH7 A;  1NHK L;  5F8M A;  4Q0B B;  3V6H A;  3DXB A;  3ENQ A;  1ACM B;  3H5U A;  1JLF B;  3VQT A;  3CCZ A;  3EPI A;  3KLG B;  2DIS A;  3GQC A;  3HKW A;  2VPY B;  1VMB A;  4LF5 J;  1KWM A;  1I51 B;  4OV1 A;  3NGR A;  3AD8 C;  1RK8 A;  4F4K A;  4ILR A;  3QFW A;  3GIL A;  4P74 A;  2MYF A;  3CJR A;  1T95 A;  2CQ0 A;  2YWK A;  3QAT A;  2MY8 A;  1WI8 A;  2OFH X;  1RZM A;  2J9E A;  4NE9 C;  4OIX A;  4DSL A;  2ZJQ Q;  3S01 A;  1FJG F;  4A48 A;  2GML A;  3H2U B;  4LR8 A;  1DTQ B;  5DQG A;  3RUB L;  3KHH A;  3D3C J;  3MMB A;  2HMI B;  3ZZR A;  8ATC B;  4YS2 A;  4K7Q A;  2YBV A;  2B4P A;  4PEO A;  1OWX A;  5LMU J;  5LT5 A;  1XMB A;  2XS7 A;  2WRM A;  3RRH A;  1Q82 T;  1UEV A;  4Q2M A;  2AU0 A;  3RAX A;  2YNH B;  1NPR A;  3MM6 A;  2AHO B;  4F0M A;  2J9C A;  2HRT A;  1IKY A;  1WTF A;  2V2K A;  4G1Q A;  2W8K A;  4OX9 F;  3JB9 k;  2WVF A;  2YX4 A;  2YPY A;  3W5Y A;  2YXL A;  4A8W A;  1UPP A;  2XHC A;  2GVD A;  2CQC A;  2DTJ A;  1X9S A;  2B5J B;  2GV1 A;  4DBQ A;  4OX9 J;  3NXZ A;  2RSQ A;  1R31 A;  4IYQ A;  3QYY A;  4BWJ A;  3MTJ A;  3M2U B;  1S5Z A;  6FD1 A;  4IOC Q;  1D8Y A;  2XS2 A;  3HSZ A;  2Z58 B;  4FNI A;  3HKZ D;  3HUL A;  4NA1 A;  2IIH A;  1K73 T;  3KMQ A;  5C24 A;  4IRC A;  1NCL A;  1PC4 A;  3UCU P;  2NQP A;  3GON A;  3M6W A;  2WVC A;  3G6V A;  3BO4 A;  2IC3 B;  4U8Y A;  1FE4 A;  1WOO A;  4OI2 A;  4C0H A;  3MAA B;  3OJU A;  3KLF A;  2PSZ A;  1RTJ B;  4ECW A;  2C1E B;  2DH7 A;  2RU9 A;  2W01 A;  3GWC A;  3VAM A;  4LFC F;  1X9W A;  4OI6 A;  1N34 J;  3EGZ A;  1WOP A;  2Z0G A;  2ZVS A;  5ETT A;  3EXY A;  3TR5 A;  1F3V A;  2JH3 A;  1CS4 B;  2Y8W A;  2AEM A;  5HMZ A;  4ZVU B;  4UQG A;  1BWE A;  3F44 A;  1HKA A;  2IDE A;  3TA2 A;  3K0J A;  1R8C A;  4LF8 F;  3LF0 A;  3NL0 A;  2VUG A;  5D4P A;  3UCZ P;  3J7Y U;  1VQ5 S;  3JTO A;  4G65 A;  2MPU A;  3OTD A;  1KQG B;  2PFF B;  4CRJ A;  4NWB A;  1D9D A;  1RAI B;  2DGQ A;  1FDN A;  2B7B B;  3L95 X;  2HHH F;  3BRE A;  3G9C A;  1U6Z A;  3TAM A;  1HA1 A;  2MKC A;  4NX9 A;  4ZVF A;  8RUC A;  4HR2 A;  3OTO J;  3FEX B;  2DNK A;  2NZC A;  5KFV A;  4DV7 J;  3AAW B;  2AD9 A;  4KIA A;  1JKH A;  2JX2 A;  2C22 A;  2CQB A;  2FB0 A;  2RU3 A;  4GKJ J;  4HAC B;  5HJY A;  3HHL C;  3BSO A;  3GV7 B;  1AT1 B;  5CAA A;  4DOZ A;  1RKJ A;  2MZQ A;  4OV6 A;  2MQM A;  1TZ0 A;  1UKU A;  1FVS A;  5J2Q B;  1HAR A;  3VAL A;  5HQM A;  3DYA B;  3BM7 A;  2QYC A;  1HR0 F;  1OIA A;  3K17 A;  2HPU A;  4KTQ A;  2Z57 B;  1U8W A;  3NCR A;  5M2P A;  2D74 B;  1RHJ B;  5ETR A;  1EET B;  3IBF B;  1HBO A;  3E8O A;  2PFD A;  1RAJ A;  3QRQ A;  2FHJ D;  4LRC A;  2OEL A;  1DAX A;  3R5J B;  4LSL B;  4J90 A;  1RTH A;  3PY8 A;  2WSF C;  1GMU A;  2AIR B;  2KU7 A;  2KFN A;  1IWG A;  2DXF A;  2UVW A;  5I42 A;  2KRR A;  4C97 A;  4OYP A;  4KBI A;  1CPZ A;  3GIM A;  2EFO A;  3G8T A;  2VC0 A;  1YJN S;  5KFU A;  2PGC A;  3AD7 C;  2AKW B;  2KTQ A;  2NUH A;  3R6G B;  5FJ4 A;  4U95 A;  2PN6 A;  3C2P A;  4CH0 S;  2WW4 A;  3SCL E;  4AXI A;  2M70 A;  4NRU A;  2XMJ A;  3BGR A;  2HKE A;  3TVY A;  4Q5V A;  2DEJ A;  3CTR A;  1SUQ A;  2B4O A;  1IR1 A;  3I5C A;  3H2V E;  3ZZ0 A;  4FF2 A;  4PAB A;  4JI3 F;  1V3Z A;  1K47 A;  4NLG A;  3AB4 B;  4RNF A;  2GS8 A;  2WW8 A;  4DN9 A;  4A8K A;  4DX5 A;  3D0H E;  2MHN A;  3EVW A;  4LIR A;  4ZIW A;  2XI3 A;  3QGP A;  2HBQ B;  4BHQ A;  3JSM A;  1N54 B;  4HI1 A;  1XTZ A;  2DRB A;  2R8H A;  1UW4 A;  4JI3 J;  4ZP8 A;  3QAE A;  2HEK A;  4C4W A;  2MKH A;  2BRK A;  4NLW A;  3FSY A;  3FJ2 A;  2R3V A;  4JYA F;  2QX0 A;  4B3R F;  4JP8 A;  4OHZ A;  4NPO A;  1RT2 B;  3FFI B;  2YQ0 A;  1NK9 A;  3M6X A;  1U1M A;  3T19 A;  2F4V J;  2ZH2 A;  4AT1 B;  4OI1 A;  1X0F A;  3JQM A;  4YB1 P;  3JSY A;  1W26 A;  1F5B A;  3RYL A;  4C8Y A;  2DNQ A;  2OI2 A;  4QWB A;  4ZDN A;  1U7L A;  1NHU A;  1B70 B;  4TYA A;  3DLG A;  1PG5 B;  2XEX A;  3ETM A;  3SSS A;  3BGF A;  1N5Q A;  3RU0 A;  3KXD A;  4ZS6 A;  3N4W A;  2CDQ A;  1PAE X;  3TNV A;  2QV6 A;  4EBE A;  1P1L A;  5DS7 A;  4RR5 A;  1KEK A;  5DG8 A;  1SB6 A;  2K3K A;  1C0T B;  4QU6 A;  3IBW A;  2FJV A;  2HIQ A;  1GAO A;  3QJL A;  2GJI A;  2A18 A;  3IFE A;  1XER A;  1HPZ A;  4NLR A;  4QIG A;  2IRX A;  3K5O A;  4DR3 J;  2LXF A;  4Q45 A;  1CC7 A;  3RRK A;  3PJ9 A;  1TL1 A;  4MKV A;  2ERR A;  3J7Y I;  2RHQ B;  1FKP A;  2C3Y A;  5IT4 A;  2XM3 A;  4A8S A;  4RW6 A;  2EFN A;  4LRA A;  2D9P A;  2XYH B;  1D3W A;  2VHG A;  1R43 A;  3KK2 A;  1IWA A;  4TYB A;  3H98 A;  3TWZ A;  2HNZ B;  2IRY A;  3RB4 A;  1S59 A;  3LH2 S;  1RTD B;  2XUL A;  1S1X A;  1MWQ A;  1NM2 A;  5EHH A;  1JK9 B;  5LJ5 Y;  4OYM A;  4B3S F;  1EIY B;  1LWC A;  2MQQ A;  3W60 A;  3DOM B;  1Q7L B;  3H4D A;  3V81 B;  3MEC B;  4RWX A;  4JI8 J;  2EFG A;  3ZTR A;  4PG8 A;  3CCW A;  5AJ3 J;  3ADA C;  2J8A A;  4DV1 J;  3AB2 B;  3K89 A;  5C42 A;  2FHJ A;  3N79 A;  1KON A;  1FEE A;  1MRO A;  1U2R A;  4M94 A;  2R2S A;  2QL9 B;  5C5J A;  2LFV A;  1GXU A;  3QPI A;  4EU0 A;  2VQF J;  1VRT A;  3JAM U;  1X7V A;  2X51 A;  2A6M A;  2O66 A;  3VHQ A;  3SDE A;  1H38 A;  1LWE A;  4FNH A;  1U1O A;  3GR0 A;  1YKW A;  2JZ5 A;  2GC8 A;  4MAK A;  5B08 A;  4OQJ A;  3OV7 A;  5BJR A;  4ED2 A;  3R5A A;  1FRM A;  3D1Q A;  3R2C J;  2OIH A;  1U6F A;  4WCE Q;  3CED A;  1Q53 A;  1OY9 A;  4ID5 A;  1CBK A;  1NK0 A;  4S0M A;  2IA0 A;  2OPR B;  3MCS A;  1URR A;  3OL8 A;  4DQP A;  2ASJ A;  3GTY X;  2E7X A;  5GMD A;  3BQ0 A;  3AOA A;  2G0J A;  4CT9 A;  2RAQ A;  3N01 A;  4MTP A;  1SQF A;  3KUH A;  2MQO A;  4LUB A;  5CYQ B;  3IBC B;  5E2Q A;  1FFS B;  4IH5 A;  3BYP A;  4E98 A;  4DR5 J;  2W2N P;  2W9C B;  3I4H X;  1S1V A;  2F8E X;  3V4I A;  3IR6 B;  4URG A;  2HZV A;  1C1B B;  1KSP A;  4IR9 A;  3LP1 A;  3I31 A;  1OY6 A;  5HLF A;  2ADC A;  2QEX S;  2ZBQ A;  1KOH A;  3A8I A;  3NGU A;  1H7W A;  3GCW P;  3CD5 A;  1UVN A;  1DLO B;  3BPS P;  4LRB A;  1IR2 A;  4L6V 3;  2NPI A;  4DR7 F;  2QO3 A;  4B08 A;  3GSD A;  2MZT A;  1FEH A;  4DZ6 A;  3WBZ A;  4FYV B;  2MY7 A;  4A46 A;  3BSN A;  3A3O B;  3DLK A;  2AX0 A;  3MXH P;  1SH0 A;  1U1Q A;  2KDO A;  1RYR A;  4ZCL A;  1HQE B;  3PR5 B;  2PI4 A;  1TL7 A;  2Z56 B;  4ZJL A;  3F56 A;  5DO2 A;  1S10 A;  4FXV A;  5A6P A;  3QZ7 A;  4KC5 A;  3WHI A;  4PAA A;  4ZP9 A;  1YTY A;  1X4F A;  4QBU A;  2QMX A;  4XPC A;  1S0N A;  1I94 J;  2OLW A;  2QSF A;  2VAS A;  4MFB A;  3PG9 A;  4O44 A;  1X4G A;  2WBR A;  4RW4 A;  5T7L A;  1FJC A;  1O0P A;  1NKE A;  3M8Q B;  1KNZ A;  2WON B;  2E1P A;  3TAQ A;  3FCV A;  5KFC A;  1JLE A;  4HTJ A;  5HVH A;  4DR2 J;  4DPW A;  1LFW A;  1NJY A;  2HFO A;  1H74 A;  1SV5 A;  2ACM A;  2CQP A;  2HFN A;  1F6T A;  5CYM B;  3V6D B;  2RDI A;  1ZTW A;  1B0T A;  4DL0 C;  4WXW A;  2G4B A;  4R5P B;  3P5B P;  3Q2T C;  1VJW A;  4DL5 A;  3JQK A;  1U1N A;  2DGU A;  2H9Z A;  5D6G A;  4HDH A;  3U1M A;  1IKW B;  4O4G A;  1TUW A;  1EX8 A;  2AJF E;  4DHV A;  2GQ2 A;  1LW0 B;  4UST A;  3UD5 A;  5I4M A;  4JV1 A;  3DRR A;  2RJZ A;  4K4W A;  1GX6 A;  3Q8S B;  1V5V A;  1O8B A;  1CJK A;  1VK8 A;  3QRP A;  1EKR A;  3LA0 A;  4F26 A;  4FYY B;  4QIF A;  2WZ1 A;  1WTB A;  1UZH A;  4CLZ A;  4F67 A;  4AL7 A;  2HK2 A;  3U1N A;  1JJ4 A;  3MUM P;  2BAN A;  3ZTO A;  1M1H A;  2OD4 A;  2F8M A;  4FYX B;  3QGI A;  2BUN A;  2J7K A;  5EGY A;  3P45 B;  4RW7 B;  1FNX H;  5EX0 A;  4OYA A;  1FCA A;  3BN7 A;  3T6J A;  2Z2L A;  4KR0 B;  2KJW A;  4L72 B;  3AH6 A;  1T11 A;  1PJ7 A;  3N6M A;  3NBP A;  2R8J A;  2YWH A;  1G7C B;  4RO0 A;  1NUE A;  4IDK B;  4P2M A;  1S6P B;  1R0A A;  3O8W A;  2HHV A;  2VKZ G;  3AOD A;  3NOC A;  4IFY A;  2H5I B;  2BJ8 A;  2ZWO A;  1MML A;  3S6E A;  2WSC C;  1T05 A;  2DBB A;  2QTW A;  2L9W A;  5CXT A;  2VBW A;  2R8K A;  5A8K A;  1URN A;  3WIU A;  1TAQ A;  4N8N A;  2Z2M A;  1PJ5 A;  3BQ1 A;  2F9D A;  2CQH A;  4PXC A;  2IHR 1;  3L7U A;  5FDL A;  4KYZ A;  1E6Y A;  1J2V A;  2CVI A;  2KG0 A;  2SXL A;  3BKF A;  2P8I A;  1BQM A;  3TUI C;  2CVE A;  4KKO B;  3NNC A;  4P71 A;  1RAD B;  4IOA Q;  1QVF R;  4CO0 A;  3M9N B;  4F4Z A;  3KHR A;  4Z7Y A;  3PO4 A;  4G6V B;  3IN5 A;  3VAJ A;  1HHT P;  3L7P A;  2RS8 A;  1VQL S;  1T8E A;  4K5S A;  2Y3Y A;  2EK1 A;  3EGW B;  4YB7 A;  4JI5 F;  1NK7 A;  4N47 A;  2LDI A;  3ZZP A;  1JLA B;  2BE7 D;  1VRQ C;  4J9P A;  4J9O A;  1F60 B;  2V5H G;  3LP2 A;  2ZJR Q;  2I5J B;  3CIM A;  2QLW A;  4JI5 J;  3GR1 A;  5F8I A;  3FRZ A;  3UDL A;  2HW3 A;  2WOM B;  1R3N A;  1WUU A;  4NCA A;  1GH8 A;  5KFL A;  2CZ9 A;  2OJ3 A;  5J2N B;  1NH8 A;  3GFZ A;  3TJ8 A;  4ED3 A;  1DRZ A;  3SV4 A;  2DY9 A;  4IQM A;  1HMV A;  5L1L A;  2FYX A;  4I67 A;  4HKQ A;  3Q2S C;  1TKX A;  4ED8 A;  2E1A A;  1WJ9 A;  4UOH A;  2UUC F;  1YRU A;  1WAC A;  4DFK A;  1HBM A;  1RAH B;  2QYG A;  3CGI A;  3FBF A;  4PG4 A;  1QTM A;  2V4Q A;  2J8S A;  2YWG A;  3GIJ A;  3B4M A;  3QNW B;  2YPZ A;  2JDJ A;  2DH8 A;  1HLW A;  1F1B B;  2E7V A;  2IDL A;  3PHT A;  1VQS A;  3ISN D;  1WKJ A;  4ATN A;  1MLA A;  4M5D A;  3KG0 A;  5CCM A;  4MK8 A;  5HVF A;  4MIA A;  2NXC A;  5KG6 A;  4QWE A;  2HHU A;  4J9K A;  4CZC A;  3SXL A;  4ZA1 A;  1WHV A;  3ET6 B;  1Q7Y T;  2CPJ A;  2DR9 A;  2J5A A;  1NRK A;  1L3U A;  1U02 A;  5GAE I;  4C8N A;  2A2D A;  4I6A A;  4MJK A;  2B9E A;  2DO0 A;  3NWR A;  4DUT A;  2GJ2 A;  4ECS A;  1TL1 B;  4JI1 J;  3JAM Y;  4DCP B;  2G2Z A;  3RBZ A;  3Q0A A;  4V19 X;  3UVJ A;  1EZZ B;  3J81 j;  2ZH5 A;  1M90 T;  2JC0 A;  3KK2 B;  3EZU A;  3BYR A;  3VF0 B;  1HQU A;  2YKA A;  2HHS A;  4JI2 F;  2G9O A;  2IM2 A;  4ZPV R;  5A8R A;  3ZTQ A;  4LF2 A;  4WYL A;  3A8E A;  2JLG A;  3KHG A;  4TLQ A;  2YKN A;  2NXE A;  3D4J A;  1SVD A;  5DG7 A;  1NJI T;  1XMQ F;  1CQM A;  1MMN A;  1OYD A;  2W4C A;  3MWB A;  1CJT A;  4NCG A;  5CZV A;  3FBC A;  2HWI A;  1JLC B;  5K8N A;  4P72 A;  5DRK A;  3DLJ A;  4DDF A;  3TP2 A;  3RBX A;  1JQG A;  5H9F J;  4EBC A;  5BR8 F;  2FVR A;  1C4A A;  4NI2 A;  5KFN A;  1U1L A;  1NPP A;  1WEZ A;  1X5P A;  1YK9 A;  3ILJ A;  4WIQ A;  3TVZ A;  2E1M C;  1BWV A;  2UUA J;  4CP5 A;  2EFQ A;  4Y6I A;  1TFW A;  2R7W A;  1R0C B;  3SDE B;  4QZV B;  3J80 U;  2PC6 A;  3TZZ A;  2GIQ A;  3W65 A;  1OPZ A;  1YJ9 S;  3U02 A;  1PAU B;  3KOA A;  3T1H F;  2VZ9 A;  1NSA A;  3M8S A;  1U25 A;  1KQS R;  2BV3 A;  5J2M A;  4G3I A;  2F1F A;  2PO4 A;  2LDY A;  3NGK A;  1MG7 A;  2RUS A;  4F7V A;  2BJD A;  4V1A k;  2V94 A;  2PE8 A;  1Z1Z A;  4K50 A;  5EWF A;  4RNH A;  2KZM A;  4KGZ B;  1ELO A;  3IP0 A;  2PEH A;  3CJ2 A;  1DFD A;  1U49 A;  1NDC A;  4DLE A;  2RF2 A;  4Z2X A;  2GGP B;  1W2B R;  5E5N A;  4W4M A;  1AB8 A;  3GV8 B;  2M0G B;  1RA6 A;  4ZKA A;  2PA8 D;  2KRB A;  3ZZO A;  1VGY A;  1YHQ S;  2XTJ P;  2PMZ D;  5HBM B;  5FLX U;  3FK4 A;  2F4F A;  2R7Q A;  1R8H A;  4ANC A;  3R3T A;  2YX1 A;  4CYU A;  4A8Q A;  3M2V A;  1TTH B;  5HLF B;  3ZZT A;  3I9Z A;  4CLY A;  1FWK A;  3TZY A;  1H98 A;  3I0S A;  1LKZ A;  3M2R A;  5D0E A;  1TFY A;  4UW2 A;  3OJS A;  3HSG A;  5AT1 B;  1U24 A;  4PYD A;  4LFB F;  3D2W A;  5LL6 d;  1GXL A;  4XK8 C;  2ZZN A;  4P7V A;  4IUF A;  1W2I A;  2HQC A;  2AJQ A;  2F8H A;  2W4D A;  4X84 A;  2AZ1 A;  2DO4 A;  4LBH A;  3GCX P;  1SPB P;  3CO0 P;  4EUV A;  1EQ0 A;  4LFB J;  3PVX A;  4ENO A;  2RH3 A;  4USW A;  1TL7 B;  2VBZ A;  2CJB A;  2BE9 B;  1U4B A;  2VJU A;  3LPY A;  1N8R T;  2MDA A;  4DPO A;  3MEE A;  1VBY A;  1Y00 A;  1U2C A;  1CUL B;  2ZJP Q;  2E9R X;  3SQG A;  1PBA A;  4C8K A;  1RWW B;  2ZH7 A;  1JLG B;  2CPH A;  1HBU B;  2BR0 A;  2CJ9 A;  3VTI A;  1UJ6 A;  1JMT A;  2QT7 A;  1YJ7 A;  2NYI A;  1RWV B;  4TNO A;  1SV5 B;  1N5V A;  3M8P A;  2IVY A;  4BWM A;  5L1K A;  3C19 A;  2DXD A;  5GAH U;  4IFV A;  3HO1 A;  5HQL A;  2LA4 A;  2HFS A;  4E2F B;  1VBZ A;  2PMW A;  1I5O B;  2GQQ A;  4KV8 B;  2VOD A;  2FJW A;  3TEG A;  2W7A A;  2KXH A;  5ETN A;  3LGN A;  2IBO A;  2HG4 A;  1YI2 S;  3BV8 A;  2QGF B;  2E7W A;  1FKO A;  4RU2 A;  3KK1 A;  3PX0 A;  5MLC V;  1RCX B;  2DHH A;  3C6U A;  5IC4 B;  3HXM A;  5A8W B;  3FCW A;  4KGM A;  4OI4 A;  1QAJ A;  1HNW J;  1N5Y A;  2MQP A;  4HHH A;  2DK2 A;  3DRR B;  3H5S A;  3CJS A;  4KAI A;  1HNZ J;  1N6Q B;  2W9B A;  1KBR A;  2I2Y A;  3JS9 A;  3IGV A;  3US5 A;  2AF6 A;  3UDV A;  2KYZ A;  1X0P A;  2XMT A;  4M5M A;  4GO5 X;  4FN5 A;  1RAO A;  1FHT A;  4J9V A;  1JLB A;  3CJ0 A;  2QG9 B;  1HQ2 A;  2BAN B;  2UP1 A;  1LQ9 A;  2PA3 A;  1ZS6 A;  2V4R A;  3HVT A;  3BSA A;  2CQ2 A;  2LQJ A;  3IAS 9;  3MM8 A;  4Y2K A;  4DLG A;  4GVB B;  3PCO B;  2W7P A;  1KDN A;  2CJX B;  4LF7 F;  5IFM A;  1R7I A;  2I1R A;  2HQD A;  3DRS B;  2GIR A;  1DQ8 A;  2H48 B;  4QWD A;  2EWH A;  3EDQ B;  1UPM B;  2XI2 A;  3GLJ A;  2VDI A;  2AYM A;  1IVZ A;  4DL4 A;  2XYG B;  4OZ5 A;  3M1V A;  3NAH A;  2B43 A;  1L3S A;  3WC2 A;  3WIV A;  4IFY B;  4UT4 A;  1KVI A;  3Q86 A;  1Q5Y A;  5L38 A;  5A0Y B;  3KG1 A;  1KVK A;  2V8G A;  3OPK A;  5J1P A;  3DN9 A;  3OXL A;  2QLJ B;  1REV A;  1SH2 A;  2MEW A;  5FDL B;  4JI0 F;  1FXD A;  4NL5 A;  2OAU A;  2ZBR A;  5HP1 A;  3ZC4 A;  5IT0 A;  5CD4 A;  4JI4 F;  1HWI A;  3ZZU A;  4DG1 A;  2DR5 A;  4ICL A;  2DNP A;  4DV3 F;  1HW8 A;  2R4F A;  2A3J A;  4KHP F;  2B4V A;  3F0N A;  3D6H B;  3IC1 A;  1HD1 A;  2W1B A;  2HND B;  2LYV A;  1UMJ A;  1KKH A;  2H1Y A;  2LLZ A;  4JI4 J;  1Q81 T;  2D9O A;  3FC9 A;  4MK9 A;  1SCJ B;  3Q8U A;  4RKU C;  2ZE2 A;  3LP0 B;  4DV3 J;  1F9H A;  3MMA A;  2IA6 A;  3A3P B;  2LXU A;  1JJH A;  3NLC A;  3PRB A;  5FD1 A;  1LWF B;  3TRG A;  5KFH A;  4LQ9 A;  3KDO A;  2KN4 A;  1S6U A;  4FF4 A;  2VQE F;  1NSK L;  2X7I A;  2UZA A;  2ZBI A;  1F0X A;  1TUG B;  2R2T A;  4TY8 A;  3UNG C;  4QCL A;  2EC0 A;  4QR0 A;  3QSY B;  5K20 B;  4WFY A;  4QJV A;  2PT0 A;  2AGO A;  4GC6 A;  4JV2 A;  3MCO A;  2VQE J;  2GW8 A;  3MI7 X;  2VJV A;  2VIC A;  2M2B A;  3A3N B;  2J9D A;  4F8R A;  3ZZY A;  1OS5 A;  1GMW D;  2ZOM A;  2RE1 A;  1HWL A;  1UWB B;  4QYZ J;  2MST A;  1C1C A;  1U47 A;  4ED4 A;  3DDK A;  1UCN A;  5K9F A;  4HYK A;  2D41 A;  4ED6 A;  1XC9 A;  3B82 A;  2CJA A;  1PIL A;  2V2Z A;  4NLU A;  5F41 A;  2XO7 A;  3KLI A;  4F04 B;  5L1J A;  2QJ3 A;  1T9W A;  3KNG A;  4KFB B;  2JL9 A;  3EUN A;  4Z37 A;  5CD4 H;  3PV8 A;  1D8Z A;  1RU2 A;  2AX1 A;  3DI6 B;  2I6W A;  3E01 A;  3J7Z T;  4DV5 J;  1TKT B;  4WF9 Q;  3LW5 C;  4EGL A;  5HN0 A;  2EKN A;  5IWA F;  5L9X A;  2GQC A;  2E1C A;  3DHW C;  3SEO A;  3TQE A;  4BS2 A;  3POT A;  1RWM B;  3TUP A;  1E6V B;  2HS0 A;  4PQU B;  1IM6 A;  3EM1 A;  1X60 A;  1RU1 A;  2DIV A;  3UVJ B;  3KJV A;  4DV0 F;  4IG3 B;  4X4V A;  1EQM A;  1FDA A;  4AD6 A;  1Q95 G;  4RW9 A;  4U6P A;  4JBC A;  1HHQ A;  4H4M A;  1RTI B;  4DSE A;  1H6K X;  2V4J A;  3OUY A;  3PX4 A;  1UAW A;  2YNI B;  5J1N A;  1D09 B;  2OPQ B;  1KVJ A;  3R5C A;  4DI6 A;  1VC5 A;  3QQC D;  2HHQ A;  2MKJ A;  3K5P A;  2HHW A;  5C7P A;  3DRP B;  3SSQ A;  3W9I A;  2MZ1 A;  4USJ C;  2YKO A;  4C3M A;  5J2P A;  2Z30 B;  2XMK A;  5U47 A;  4UZB A;  2OTJ S;  3JYT B;  3QAU A;  3D3B J;  3OHB A;  4O3P A;  1NKB A;  1P27 B;  1J5E J;  4MKB A;  3HCX A;  3UO0 A;  4ECU A;  4LF6 F;  3MM9 A;  1EKS A;  1HL6 A;  3RBE A;  4C6A A;  3CO9 A;  2OSR A;  3OR1 A;  2JFD A;  2IM0 A;  1QE1 A;  4WWS A;  4YR2 A;  3A4T A;  2KXN B;  2LQ5 A;  2GMJ A;  1T9Y A;  4I0W A;  4DV6 F;  4WU2 A;  1NDK A;  5HRO B;  4Q0B A;  4LF6 J;  2FLO A;  1U1K A;  4UQT A;  4R0J A;  1JLF A;  2X1F A;  3KG4 A;  3KLG A;  1FWP A;  3CJT A;  3ISN C;  3M32 B;  3HT0 A;  4WZQ A;  5D4O A;  1WEY A;  1SXL A;  3UWT A;  2HWT A;  1RYS A;  3DFE A;  4K4X A;  3MR2 A;  1FJ7 A;  1QAY A;  4ZN3 A;  1VQY A;  4PYA A;  5F8H A;  4FKX A;  4UUX A;  3L09 A;  5LSL A;  3W8G A;  3U7J A;  4L3K A;  4WPA A;  1YZ7 A;  2RRB A;  2WSE C;  1NB7 A;  3LWL A;  4YB6 A;  2KJV A;  4GKK F;  2J6U A;  5G4D A;  1PGZ A;  1G1X A;  1DTQ A;  1XEZ A;  1C0U B;  3J81 Y;  3KK3 A;  2JJ4 D;  2Q43 A;  2HMI A;  1XNR J;  4CLU A;  2KG1 A;  3NGS A;  4CLT A;  1T3N A;  3M2R B;  1FA0 A;  3R7N B;  1FI4 A;  2FLL A;  2VKR A;  1GMW A;  4M5G A;  3THV A;  1P9Q C;  2YNH A;  2A1B A;  1IJF B;  4O0N A;  5MAO A;  2ZHA A;  3KLH B;  1FJE B;  1RSC A;  2MZS A;  4OX8 A;  1S79 A;  2RHS B;  2VFS A;  3OFE A;  3HFZ B;  1QSY A;  4XIU A;  1FF2 A;  4Y34 A;  3EX7 B;  1S9F A;  4K5R A;  2BQR A;  4DR6 J;  1XR6 A;  1BHN A;  4ZP6 A;  1A6L A;  2IJF A;  1UA0 A;  3PJW A;  4NAS A;  4H4O B;  1NND A;  2B5J A;  3K58 A;  4F2S A;  5CCL A;  3SCJ E;  3SQG B;  3M2U A;  4V19 J;  3PZP A;  1SC3 B;  3NCQ A;  1VQN S;  4CDI A;  2VB6 A;  2CPY A;  5B0E A;  3NNH A;  3AJD A;  4LSZ B;  4EFA C;  4X4P A;  1NZA A;  4WP8 A;  4ERD A;  2XMV A;  5KFE A;  3NMA A;  2KHD A;  3MAA A;  2B56 A;  2N7Y A;  1RTJ A;  4EO6 A;  1TKD A;  1PJ6 A;  4O0I A;  3T1A A;  4L74 A;  3FSI A;  4WU3 A;  1B99 A;  2M8H A;  5KTQ A;  3DCA A;  1LWX A;  5B0A A;  5F8L A;  3QJP A;  1CS4 A;  4AUK A;  3VGS A;  2KM8 C;  3KK1 B;  2J76 E;  2RT3 A;  3BPD A;  2Z2Y B;  2ILZ A;  4FS1 A;  1XMO J;  1UA1 A;  4LRD A;  4J9R A;  4WZM A;  4NA3 A;  2BYC A;  2CJY B;  4ZVT B;  4ZPC A;  4JI7 F;  3QO9 A;  2XY7 A;  4DV2 F;  4U67 Q;  4RWW A;  4LFA F;  2W9B B;  3AJ2 A;  4P6Q A;  3D7S B;  5E3A A;  3LGM A;  1VBK A;  3H90 A;  1RKI A;  1MWY A;  1YJR A;  2FC8 A;  2Q3P A;  4ECQ A;  4C2M A;  2GCF A;  1TP7 A;  1QTN B;  4LFA J;  4D3H A;  5KFO A;  2KFY A;  1ZAX A;  4OYZ A;  2RB7 A;  3GYX B;  2RRN A;  3MED B;  3MCN A;  1NZ8 A;  5EUH A;  5D4N A;  4B9S A;  2GMH A;  1FTC A;  4RUC A;  3OL9 A;  2AZ3 A;  1Q8I A;  3RAM A;  4AFF A;  4FF1 A;  3UQS A;  3BJY A;  3LAM A;  3PW4 A;  4X62 J;  4HAC A;  3R2D J;  3ELH A;  3I6P A;  3T5J A;  3H40 A;  3GE9 A;  2B51 A;  4DFM A;  2VG5 B;  4DL2 A;  4USM A;  3W2W B;  2OPP B;  5J2Q A;  2E66 A;  2O01 C;  2XWX A;  3UE2 A;  2AP6 A;  3R1H A;  5JXS A;  3DYA A;  3T5K A;  2H65 B;  4Q43 A;  3ICL A;  2GIF A;  4LF4 J;  5E0O A;  1QUV A;  2R9L A;  1PYO B;  1S9E B;  2OGU A;  4URS A;  5DGB A;  2RUG A;  1LXN A;  2BAC A;  4FYD A;  1Q16 B;  4F3O A;  4B3T F;  1BMQ B;  1YJV A;  4KO0 A;  2FDN A;  2FJB B;  1IQT A;  4PWU A;  2DNL A;  2HRU A;  1EET A;  1KHV A;  2RIL A;  4X65 F;  2DGO A;  2YKP A;  4B3T J;  3DDI A;  2QC3 A;  2BZ2 A;  2VC1 A;  4QW8 A;  1J5O B;  3SFU A;  4C98 A;  2XGP A;  4YB5 A;  3CJ3 A;  2VFR A;  4F2R A;  5B0C A;  2A2C A;  2LVW A;  1H7X A;  4H4K A;  4X65 J;  4F0H A;  4PG7 A;  2CZV C;  2GO8 A;  4B3O A;  1SKR A;  1KLM B;  2GA7 A;  3KNA A;  3MMA B;  1RXO B;  4WKY A;  5KT4 A;  2YWF A;  4U7U D;  2DNH A;  3T9N A;  1NHV A;  2E5L F;  4DV4 F;  3BO2 A;  1NSQ A;  1FRK A;  2JFK A;  1YJT A;  2HS3 A;  4W90 B;  1FER A;  1S12 A;  3BDP A;  4L3N A;  1IBK J;  4J9S A;  2Y1L B;  1S49 A;  4ZCK A;  1WNE A;  4DV4 J;  4TY8 B;  4X4T A;  3DU5 A;  2H54 B;  4QQB A;  3A8J A;  1VK3 A;  2CXE A;  2D3O 1;  4JI6 F;  3PM9 A;  4OHV A;  3VCD A;  4NLY A;  3G8S A;  4NXN F;  5KFQ A;  3D6M B;  4B9L A;  5HK4 A;  4HHU A;  3AT1 B;  5GMK a;  4LRF A;  5CHC B;  3SCK E;  5IM0 B;  4JV5 J;  4JI6 J;  1A0O B;  4NXN J;  3NWG A;  1LW2 B;  4DXL A;  4WXO A;  1WF0 A;  4J9M A;  4RPF A;  3PKY A;  2RQK A;  4L73 A;  4ZPB A;  3H59 A;  1B64 A;  2HYI B;  1RT2 A;  1SL0 A;  3FFI A;  2JVO A;  3V5R A;  4CLS A;  3JSR A;  4I2Q B;  2ATC B;  4WFB Q;  1RT5 B;  4LVN P;  2OPS A;  2CPX A;  3UN5 A;  1NKC A;  5AXN A;  5ETP A;  2CA9 A;  4USU A;  5KFF A;  1AA1 B;  3IRW P;  3FMB A;  1YQH A;  4FP9 A;  1RAC B;  1UZD A;  3TEH B;  4PWD A;  3ITH B;  3U1L A;  4PUO B;  5ETS A;  1RI7 A;  4X4U A;  5KG5 A;  2AEJ A;  1CJU B;  3BBC A;  5G0R A;  2V8P A;  1B0P A;  1RT6 A;  2OD6 A;  4OLO A;  1QAI A;  2UXC F;  2LQ9 A;  3EGV A;  2VA3 A;  1Z4U A;  1SIZ A;  3VZI A;  2HFZ A;  4OJG A;  2DGS A;  2ASD A;  4HH1 A;  1C0T A;  1X31 C;  3IAM 9;  1G3O A;  1T0T V;  3CCS S;  3NG8 A;  2DNY A;  3S8S A;  1DTT B;  2UXC J;  1BD6 A;  4J91 A;  4ER8 A;  1U6B A;  1TQL A;  4NMX A;  4NYP A;  3TAP A;  2DD8 S;  4Q8E A;  3M8R A;  2MB0 B;  1H73 A;  1TV6 B;  3KLE A;  4ZCI A;  2XNQ A;  1FFW B;  4KE5 A;  1XNQ F;  2J7W A;  2IJN A;  3NP5 A;  3IRX A;  1NB2 A;  1ZA2 B;  3NS7 B;  2YWW A;  3PR4 A;  3P4U B;  3AOC A;  1UVM A;  3MMC B;  1XR7 A;  3ZNU A;  3NEK A;  4IQX A;  1RTD A;  3V6J A;  3DDN A;  2GAH C;  1VOM A;  1VHI A;  4Y2C A;  2DNM A;  1XNQ J;  5KT5 A;  2L9D A;  3DOM A;  3OR1 B;  2C42 A;  2Q79 A;  3V81 A;  3MEC A;  2LKZ A;  4CM2 A;  5H9F K;  4KY3 A;  5IOL A;  3IMQ J;  1XWL A;  4Q2L A;  3H2L A;  4YOE A;  1BUX A;  4USV A;  4CTA B;  2CAJ A;  2H4W B;  4ZMM A;  1WG1 A;  3UDC A;  4C9D A;  4NLX A;  4MMO A;  3UDE A;  4KPY A;  3MTK A;  1B7Y B;  4HTI A;  1BC6 A;  3FVY A;  5GME A;  3PIO Q;  2ZDP A;  1F5C A;  2BKO A;  4QYR A;  1NSP A;  3O2I A;  2CNN B;  4XDC A;  2YY3 A;  1SKW A;  2MLZ A;  2RS2 A;  5IS2 A;  5K8M A;  4I6Y A;  4ECT A;  9RUB A;  4OYO A;  5KFX A;  2C2Z B;  4URQ U;  4IG0 B;  3MEG B;  2WVD A;  3Q89 A;  1U2F A;  3KK3 B;  1VQ8 S;  3BSC A;  4J9N A;  2OPR A;  1YX2 A;  1FJG J;  5KFP A;  2MGZ A;  2FTR A;  1GNK A;  4DCO B;  3ISZ A;  1F2G A;  2HSE B;  1YIJ S;  1RT1 B;  1N88 A;  4LSN B;  4B9N A;  1SQG A;  1MSW D;  3CJQ A;  3VVU A;  1RAE B;  4P75 A;  2Y1R I;  2DRA A;  3IWX A;  5CYQ A;  3OL6 A;  2KKH A;  2HBZ B;  4O3Q A;  4Y0F A;  2ZHB A;  2YQ3 A;  2W9C A;  5KFT A;  3RTV A;  5HAN A; 
#chains in the Genus database with same CATH homology
 2UXC J;  4NXN J;  4LFC J;  2F4V J;  4NEZ A;  1N34 J;  2UXB J;  4LF9 J;  4X65 J;  4DR7 J;  2MEW A;  5BR8 J;  1HNZ J;  2VQE J;  4DV0 J;  4LF5 J;  4JI0 J;  4X62 J;  1IBL J;  3R2D J;  4DV6 J;  3R2C J;  5FLX U;  4B3M J;  4RJV A;  4LF6 J;  4DUZ J;  2E5L J;  2ZM6 J;  1HNX J;  2UUA J;  4LF8 J;  1HR0 J;  4B3S J;  2KVQ E;  4JI5 J;  4X66 J;  4OX9 J;  4KHP J;  4DR6 J;  4YHH J;  5LMN J;  3J80 U;  2MQ8 A;  4NEY A;  5A2Q U;  1XMO J;  2UUB J;  3J81 U;  4JI8 J;  1IBK J;  4LF4 J;  2UU9 J;  4X64 J;  4LF7 J;  4JI1 J;  2HHH J;  1FJG J;  1IBM J;  5AJ3 J;  3T1H J;  4JI4 J;  4DV4 J;  1XNQ J;  3W1Y C;  1N33 J;  4AQY J;  4JI7 J;  4PWW A;  4DV1 J;  4YY3 J;  4DV2 J;  1I94 J;  4KYZ A;  4DV3 J;  1N36 J;  3J7A N;  5IT9 U;  4DR1 J;  2KL8 A;  2UXD J;  4DR5 J;  4JI3 J;  3OTO J;  4DUY J;  3D3C J;  4JI2 J;  4V1A k;  4GKK J;  2UUC J;  4K0K J;  3T1Y J;  4KY3 A;  4DV7 J;  2VQF J;  4DV5 J;  3IMQ J;  5LMU J;  4LFB J;  4HHU A;  4NXM J;  3JAM U;  4DR4 J;  5LM7 E;  4DR2 J;  4DR3 J;  2MTL A;  4B3T J;  4JYA J;  3D3B J;  4LFA J;  4B3R J;  1XMQ J;  4GKJ J;  4JV5 J;  5IWA J;  4JI6 J;  1HNW J;  1XNR J;  1N32 J;  1J5E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...