4LFCJ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lfcJ00
3IMQJ 1HNXJ 4X66J 4JI5J 4B3RJ 4OX9J 4DR4J 2KVQE 3D3BJ 4NEYA 4LF8J 4JI6J 2UUAJ 3J80U 4JI3J 4DV2J 4LF5J 2HHHJ 3D3CJ 4AQYJ 4DR3J 4RJVA 2KL8A 1XNRJ 4DV3J 5IT9U 4DV4J 4LF6J 4DR5J 4LFAJ 1J5EJ 4NXMJ 3JAMU 2E5LJ 4HHUA 1IBLJ 2UU9J 1IBMJ 4JYAJ 5AJ3J 4DR2J 4DR7J 2UXCJ 1XMQJ 4GKJJ 2UXBJ 3W1YC 4LF9J 2ZM6J 1HR0J 4LFCJ 3T1YJ 2MTLA 5A2QU 2UXDJ 5IWAJ 1XNQJ 4DR1J 4DR6J 4DV6J 4JI4J 2MQ8A 4JI8J 3R2CJ 4LF7J 1N33J 4LFBJ 4X62J 4NXNJ 2VQEJ 4NEZA 3T1HJ 4V1Ak 4JV5J 4JI7J 5FLXU 1IBKJ 5LMNJ 3OTOJ 1N36J 4B3MJ 4JI1J 4B3SJ 4YY3J 4X64J 5LM7E 4X65J 4JI0J 5LMUJ 2UUBJ 4DV1J 4GKKJ 1XMOJ 1N32J 4K0KJ 3J81U 4KHPJ 4PWWA 2F4VJ 4YHHJ 1FJGJ 3R2DJ 2MEWA 1N34J 1HNZJ 4JI2J 4KYZA 4DV5J 1I94J 4B3TJ 3J7AN 5BR8J 4LF4J 1HNWJ 4DUZJ 2UUCJ 4DV7J 2VQFJ 4DUYJ 4DV0J 4KY3A
chains in the Genus database with same CATH superfamily
1U1OA 3DLKB 1DAXA 4KO0B 5C2GA 2ZZNA 4WFZA 4P7VA 1T9YA 1X4HA 3IRXB 4TVAB 1CULA 2JX2A 1KHWA 3PNIA 2CPFA 3N9UC 2E1PA 1FWLA 4GO5X 1REVB 3NLCA 1UETA 1F5BA 2IFXA 3LALA 3T5KA 3R8YA 4OX9J 3MR3A 2I38A 2EFGA 1PO6A 1X8DA 1QSSA 2D7SA 2BQRA 3DLLQ 1SI9A 3NGUA 3SCIE 3IR5B 4QJVA 3HHLA 3BH7B 1B0PA 1JJHA 1S1VB 4KC5A 4XPEA 4QWAA 4OI0A 2V8HA 7FD1A 4KHMA 4FNHA 2LU2A 4X4NA 1HKAA 2CPDA 3RBZA 2QA2A 4LF1A 2OPSA 5J2NB 3V6HA 3R27A 5IOLA 3RU0A 4DXLA 2QC3A 5KFEA 2ADBA 2DGUA 1TU0B 1RA7A 3CD0A 1UAWA 4YB7A 1U7LA 3EXYA 4G65A 4LJMA 1IQZA 4E98A 5F8IA 3KLEA 3VAIA 1GQEA 4B02A 4ZA1A 1FE0A 3IFEA 1IR2A 1UPMB 2ZH2A 5HLFB 3H0PA 1DFDA 2Y1RI 5KFHA 4I6WA 3MF5A 2BE2A 4IO9Q 1HHTP 2ADCA 2G0CA 2GJ2A 2HQGA 2XMJA 3DU6A 1RA6A 3CO0P 4IH7A 5F9LA 2XLIA 4M5LA 2CPIA 5SZTA 2PMZD 3GCWP 1ULRA 4GKJJ 8AT1B 2DHXA 4LF9J 3WBZA 3MPDA 2BV3A 1C1CB 1F0XA 2WVEA 5HROA 5F41A 5I3QA 3A3OB 3FZ2A 2DRBA 4K0KF 4B17A 1EQMA 3CCJS 1NK0A 4DPTA 4DJBA 1HHSA 2VASA 8ATCB 5K8PA 1QD1A 4A8XA 5J2QB 1FE4A 1XJWB 2JNJA 2X1BA 1T9TA 3NCQA 4H54A 2V2KA 2L9NA 5A6WA 1LWCA 4KFBA 2V94A 4X64F 3P8BB 1SJFA 3DDNA 1TL5A 2RF2A 2I8EA 2MKKA 4JI0F 3R5CA 2HQCA 3E51A 4DQRA 2CRLA 4NZ6A 5GAEU 1U2FA 2FJXA 4C8KA 3CC2S 4IRKA 1NK4A 1OO0B 1UJ5A 2B5JA 5KFIA 2HBYB 4M5KA 1DZ5A 1HD0A 1RCOB 4O44A 4J9KA 4F4ZA 4LSLA 1FWKA 1NSPA 5J2QA 2RH3A 4MKVA 1KQFB 3JYTA 3R5BA 3DI6A 1NPRA 2FUG9 4K8RA 2VIHA 4J37A 3BR8A 4P74A 2IM0A 2LECA 1LWEB 4O4RA 1QE1A 5KFNA 2WTFA 2ROPA 2I9SA 2D9PA 3UI3A 4FYWB 2CFXA 2G1DA 3KLIB 1YZ6A 5F8NA 3GIIA 5IM0B 2DEIA 4LSNB 2M88A 2VQEF 3OTCA 1H74A 3ZO7A 1RABB 2J0XA 1YLXA 1S57A 1CJUB 2DR6A 2FGCA 5DLGA 4B9SA 4M5JA 2R2TA 1TKDA 3V6DB 1NCLA 2KHDA 2RQMA 2VFVA 2VB6A 2NXCA 2V4JA 3CDUA 5D4PA 1CEZA 1VHIA 1GEHA 3R2DJ 3QFWA 2G0JA 1ZAXA 1UWBB 1ZAWA 1LWEA 1V3ZA 3PEHA 5KAKA 1NAQA 4HDHA 3TAQA 2WVCA 2C28A 4CLFA 2QA4G 2BJDA 1K1QA 3J7AN 2WOMA 3QSIA 4J9LA 3JQJA 4U67Q 3OL9A 1ZM2A 3CO9A 3PHTA 3T3FA 4WF9Q 4WK1A 3V4IA 2AYGA 4ED5A 1WG5A 3J7YI 1IR1A 1AFIA 3L7UA 2Y8YA 2IMOA 5H9FJ 1JLAB 3U1LA 1RXOB 2VQFF 5D4NA 5J2MA 4LR8A 2V4JB 2QYGA 3ULHA 3VF0B 4ZDNA 2YPZA 1WDDA 3NXZA 2HBZB 4HEA9 3GG1A 2QEXS 1X31C 1ZA2B 3PRBA 4NYPA 3HDSA 1NH7A 3DXBA 2BX6A 2WOMB 1HNXF 2WB4A 4OYZA 2E5IA 4ECQA 3FNNA 4DV5F 4IYQA 3KHRA 2XLJA 4O3PA 1R0CB 1WC1A 3BGUA 2H5JB 1S48A 4M5GA 3VAHA 4LREA 4DV2J 2XZWA 3MMCB 2FLPA 2VODA 1FX2A 1TL3A 3PJWA 4NYZA 3CB4A 3HHKA 1S4FA 4OZ2A 4C8LA 2MKCA 2KU7A 3BDPA 3VTIA 4DR3J 1JLCA 1RUSA 2H3EB 3D5MA 4FKXA 5GVQA 3U27A 2MQLA 2MQPA 3KLHA 1M90T 4CDIA 3KYLA 2NUUG 3CE8A 4P9SA 2A3JA 3FMBA 1VQMS 1FEHA 1Y7PA 4DV4J 3LAMA 4QU7A 3N28A 2CPJA 1VYAA 1S9EA 2GJFA 3NBPA 1M0SA 4P52A 1N88A 1GXLA 4CM0A 4CM2A 3KLGA 1BGXT 2R8IA 1TQLA 4UTGA 2R8GA 5KT4A 1PYTA 1EX8A 2QZ8A 4AL6A 1WHXA 2H5EA 5DRKA 1N5TA 3US5A 4ZKAA 1FFSB 1X4EA 2BM0A 2DJWA 5M2RA 1XR6A 1FJ7A 2CJAA 2CNNB 1CJTB 2EKNA 2IDEA 2MMYA 3MECA 3MM8B 3QIPA 1UZDA 3SSQA 2DNPA 1QJHA 4LFCJ 2G0IA 2MHEA 2MTLA 2OP5A 1RBLA 3WC0A 1I5OB 2D1CA 3OTOF 4J9PA 2FJWA 4K4VA 1TAUA 2VPYB 1PILA 3ISZA 1NZ8A 2ZWPA 4KRWA 3THTA 2EKYA 3EGNA 2OKQA 5HQMA 4JI4J 1SC4B 3TVYA 4MKAA 4PG4A 1KLMB 4DL4A 1NSAA 3FEXB 3GR0A 4MIBA 1J5EF 3KK3B 2R7XA 4ZCMA 1T9XA 5D0EA 2ZOGA 1MN7A 3TO8A 2IRXA 1WKKA 2HLUA 3B78A 2RVJA 4FYVB 4MAKA 5B0AA 5K20B 1SCJB 2K06A 3X3UA 1SKSA 2BE9B 1P9YA 4U8VA 1VMBA 4ZHRA 1GMUA 1VRTA 3A4TA 2QLFB 2W2OP 1D8ZA 2Q6CA 3KJNB 4KAIA 1XEZA 4P2MA 3LOUA 5G0RB 3D67A 4CP5A 4DR6F 2LXUA 1S59A 1OYDA 3PW4A 3EZUA 1LXJA 1RISA 2FZKB 1KQGB 2ACMA 1F1BB 3I4HX 3IBCB 4MTPA 4BLGA 3RJMB 3CF5Q 3W2WA 3N6LA 1VQ6S 1IKVA 3LAKA 3MMAB 3LGNA 4DF4A 1WDTA 1WWHA 2M9KA 1VQLS 5G4DA 2DBBA 1N32J 3PFEA 2XGPA 2Z2ZA 1NRKA 4DV0F 3VAGA 1CSJA 2F4VJ 1ELOA 1GTHA 4XAKA 2XULA 3B54A 1BHNA 1EKSA 5U47A 1RTIB 3TOQA 2QLBB 3KMSA 4O0NA 2GV1A 2MEWA 4JI2J 4K5SA 4LRFA 3UDCA 3BPDA 4URGA 4B3TF 4NLDA 2E66A 2K3KA 2UUAF 2OSQA 2ZC4A 1D3WA 1VBYA 4LRDA 3ENAA 1RWNB 5HL7Q 2QV6A 2A6MA 2IJFA 4O4GA 1JNRB 2DH8A 2GW8A 3MM7A 4LR7A 2GAHC 2DNQA 3I6PA 4J9MA 3C14B 5KG6A 4KY3A 3CCQS 1Y4ZB 4FS1A 3D1HA 4KHPF 2MQQA 5DDOC 2V2ZA 1ZPVA 1XERA 1RTDA 5HBMB 1T03A 3DU5A 1VQ5S 2VPZB 2BJEA 4Q7AA 4JI5F 4U7UD 2R7UA 1KD1T 2YKQA 4B3RF 1TV6A 1U02A 2CJ9A 2JVRA 3Q8UA 3AA9A 2VFUA 5JMNA 2XMVA 1UVLA 3CC4S 2J8AA 1DARA 2QMXA 3V6KA 5L39A 3U7JA 1Y00A 1O5JA 5GAEI 2JVOA 5KFUA 5ADZA 4OYMA 4M5DB 1YRUA 4WFYA 4FF1A 2VG5A 3R97A 4JB8B 5ETQA 1T11A 5HP1A 4FVCA 5KFBA 1WC5A 2NPIA 2IA0A 1UCNA 2V9KA 1VOMA 2MDAA 2VBZA 3C6TB 3NCRA 3P96A 2CQ2A 1MW7A 1XN9A 3NL0A 4QWBA 1XR7A 4XIUA 4N47A 2Y1JA 4L72B 5HVGA 4DCOB 2KB2A 4E2FB 4LFAJ 3LPEA 3BM7A 4NXMJ 3M2UA 4K2JA 1RWKB 2LFVA 3FEYB 1UZHA 4NMXA 4ZP7A 2QL7B 3TZYA 2W8LA 4DQQA 3FZBA 2CQBA 1FVQA 1HMVB 3C14A 3V4MA 4CNYA 5J1PA 4DQPA 2UXCJ 3I0RA 1E6VA 1A7GE 2PO4A 2BOPA 3N5BA 1HPZA 2AD9A 2HVEA 4ETZA 4QW9A 2VBXA 2FVSA 1CVJA 1WSVA 2MZRA 3W8GA 1PBUA 4AL7A 1QAJA 4ZLJA 1S0OA 5CYMB 2V8GA 1CS4B 2B8PA 1KC8T 2WBRA 3HPOA 2GJIA 2MQ8A 3LPYA 5I4MA 2YBVA 5A8RA 3CCMS 5KG2A 2RS8A 3SXLA 4K4WA 1VQ9S 5IXUA 3EX7B 4DSIA 1E6YB 1UL3A 4MFBA 4F4YA 2E5HA 2MKHA 4ZCLA 4IOAQ 1RE1B 4OZ1A 2O5DA 4PWUA 2C2ZB 1KEKA 4F4AA 2BANA 1RT6A 2MHNA 1FDBA 1FRLA 4LRAA 4WYLA 1VS3A 1NZAA 1WF2A 2ZEJA 3CPWR 4B9NA 4B9VA 2HFNA 2GHVC 2VU5A 1S77D 4S0MA 1D1UA 1WEZA 4RNMA 5DQHA 1S72S 2V50A 3KXDA 2J6UA 1EAYC 2IVFB 2EFOA 1KLNA 3Q0AA 2ZD1B 1NXIA 3M8PA 2V67A 5CCLA 4X65J 3U1MA 2KT2A 1SJRA 1FCAA 5D0RA 5AXLA 3T1HF 4RBUA 2JFKA 3M6XA 2BANB 1O51A 2FC9A 3I82A 3G6ES 4DUYF 2OH2A 1NJWA 1F5CA 3SQGB 1VBKA 5EUHA 4B3OB 3R5AA 4PWWA 4L3NA 2HFUA 5D15A 5H1SV 3OLAA 2AMCB 2VC1A 1KRPA 4Q5VA 1N6QB 2NSBA 3N6MA 2IRUA 3TEGA 4X4VA 5FD1A 2XSFA 4QYRA 3VZIA 1HFEL 4OYOA 3OV7A 2UZAA 5B08A 4Y34A 1L3UA 4RWWA 1K73T 1KDNA 5DS7A 5E3RA 1S76D 1VR6A 5DO2A 1JX4A 4R0EA 2RRBA 1RU2A 1X9SA 1AROP 4RBTA 3W66A 3SV3A 4ED6A 2R2UA 1WHWA 2EXUA 2OPRB 4DS4A 4JUZA 4OZNA 4KPCA 1VLOA 3O8WA 4BC7A 3Q23A 4DV7F 5KFGA 3BPSP 2LXFA 4E8UA 3MEEB 4R25A 1FESA 3DHXA 4EZ6A 1NK7A 1HARA 3F41A 3LWLA 4YB5A 5AE1A 2XS5A 4J9OA 4X66F 1H2UX 2ATCB 3SQOP 2WW8A 1UVJA 1U1RA 2ZNYA 3L9ZA 3PIOQ 1YJNS 1S79A 3M8WA 4NLQA 4NA3A 5F3ZA 4RWXA 1XQIA 1LWFB 3LP1A 4Q2LA 1WC3A 3ZZOA 5DDQC 4QWDA 3W3SA 1LW0A 2OO4A 1VJQA 1IBLF 2HHHF 2XMWA 4LF4F 2R4FA 2YWGA 2FC8A 3EICA 4KR0B 4DSEA 1JLGB 3IM8A 5LSOA 3GPAA 1JQGA 1TKZA 3K5PA 4OX8A 5E3QA 5IC6B 2D3ZA 3GMGA 2E5GA 2YNHB 2FVRA 1MSWD 2KT5A 4LF2A 3EDRB 3POTA 1QAIA 4TNOA 2VKZG 1VQYA 3OTDA 3UDEA 1TL1A 3WZ0A 1XNRJ 4ICLA 1IR0A 1BQMA 2HZAA 3DCAA 2IPOB 3ZZZA 3WC2A 2DPJA 1YI2S 1B0TA 2ZH6A 2JL9A 1JIHA 1U1LA 2VG6A 3DM2A 1AW0A 3AODA 3MM6A 4NLRA 4DL5A 4L74A 4TYBA 3AHPA 1GAOA 1RACB 3PXGa 2XC9A 3QRQA 2KZMA 2OEJA 3MMJA 2EBGA 2XYGB 1KBRA 1YJ7A 5ETVA 5IT0A 1AZSB 1HMVA 4J9UE 2VD3A 1M5SA 4M5MA 2LXIA 4B9TA 5GAGI 5HVHA 4PXBA 3HT0A 1SL2A 1NK5A 2ZZMA 4F02A 1RWOB 5DZ7A 1KTQA 3CDEA 1KTVA 2DPIA 5A2QU 4OZ3A 5HO4A 4DR1F 2RDJA 4O44B 5L8RC 1F2HA 4CYUA 4JI1F 4O3NA 3X1LB 2GQ2A 3VHQA 2YNGA 1LW0B 3VAJA 3ZTQA 1SL1A 2O01C 2W25A 3G4SS 1IUJA 1OPZA 4JV2A 2QJ3A 3PRDA 5ETRA 2V4RA 1S1UB 2WVDA 4A8FA 4ILLA 1C0UA 5ETMA 4ZLLA 3NNCA 2IY5B 1C4AA 5T7LB 3UE2A 4TU7A 2DXEA 3R6LB 4FKYA 4PKDB 2NPFA 4CTAA 4WE1A 1CBKA 7AT1B 2QIFA 1FHTA 3DYAA 3KUHA 1BXNA 3FSIA 3PO4A 4PXEA 4RKUC 2M0GB 3Q8RB 4KPYA 1UVMA 4ZPAA 4RPFA 2UXDF 4YQWA 4OMFG 2YKPA 2PT0A 5D0GA 1F9FA 3BREA 3HX9A 2IIHA 1VC5A 2YWWA 4L6V3 2R8HA 3WX8A 1WOOA 1YKWA 3MFIA 5KFPA 2DHAA 2UUBF 1S6QA 5LM7E 1UP1A 4UQGA 4C97A 3M6VA 1UMJA 4BCAA 5CH7B 1FRMA 5C2CA 1AB8A 4NA1A 3OW2R 4W92B 4FZVA 4OJ3A 2AJ4A 2BJ9A 4KT0C 2F8EX 2UUTA 4KV8B 5ETSA 3HHDA 3IXQA 3RGIA 5CD4H 3UCUP 2V8DA 4IQXA 2UUAJ 2AEFA 3ADAC 2OFGX 3CJ4A 2ALZA 3K0JA 3S6EA 4FBTA 3AT1B 1MU2B 1R8HA 3M32A 2HRUA 3BBBA 3MR2A 2WVBA 1RYSA 1AT1B 3MR6A 2QA4S 3GQCA 1Z1ZA 2HS3A 3P5TL 4KYZA 2AEJA 2L9DA 2JC1A 3S01A 1IWGA 1KVKA 4TYAA 2Z56B 1ZS6A 4CWBA 4DX8H 5MAOA 2C2RA 2WB1D 1U1QA 1NKEA 2WW4A 1U45A 1HNWF 1C1CA 4YB1P 5HROB 4IOCQ 3TNVA 2VQFJ 1K1SA 3DYAB 1Y5NB 3D6TB 5J2PA 4M95A 2E9RX 3PW5A 2FGOA 2H5IB 1CJTA 4DUTA 2P9CA 3PX6A 4M94A 3W61A 1JLEB 2HBQB 3CCWA 1T05B 2EG2A 4LT6A 1FK9B 4MT1A 4QWEA 3RR7A 1TVRB 1IJEB 3I5CA 3I56S 2BRLA 4A8YA 4M5NA 3J7ZT 2NYIA 2WSFC 1SKWA 4Z7YA 3LGHA 2CKWA 1SH3A 4C8ZA 1RT5B 2ASYA 2N4CA 1B99A 2GFFA 1X4DA 2BBEA 3CD5A 5HAOA 5GADU 4DV2F 3P5BP 5KFSA 2F1FA 3W60A 2ZC3A 5CZXA 1NPKA 4G1QB 5CCMA 3G96A 2X1FA 4AD6A 2A18A 3DRSB 2DGSA 3EVOA 4GVBB 4J9VA 4RU9A 2RAQA 4M1KA 4OI3A 3VQTA 3ZTRA 3NNHA 2EW9A 1PC5A 4HR2A 1S0NA 5A0YB 5KFDA 1BY9A 1NHUA 4ECYA 4CO0A 4ZIVA 4CLWA 1XBWA 3PW0A 1QE1B 3MEGA 1TVRA 3AD7C 3A1YG 4YS2A 1V9OA 3V6DA 4CLYA 4MIAA 1OJ4A 2MLXA 2ERRA 2B9XA 5HK4A 4DX6A 3DLEB 4ZVGA 1B64A 3CXCR 4PAAA 5ETOA 1RT5A 3OUYB 5JJBA 3CJ2A 1RDRA 3VALA 2AIRB 2LLZA 5FLXY 3S8SA 2AHOB 1SJ3P 4PPZA 4C0OC 4R5PB 2APOA 3SMZA 4ED7A 2FY1A 3BS9A 1GXUA 5HSPA 1HR0J 3R9LA 4PG5A 1JLEA 4CNZA 2C22A 2I0XA 2OPQA 3LP2B 5IWAJ 2R7TA 5E3PA 9ATCB 1HBNB 5C5JA 4QU6A 1H38A 2UV8A 4LF7F 3N01A 4RW7A 1RTHB 1V3RA 2GMLA 3B8HA 1IVZA 2CQ0A 2GVDB 1S6PB 4ITSA 2B6AB 1LOUA 2YKNB 4TLQA 3KJVB 4X62J 4ZVEA 1AXQA 3TWZA 2RKIA 1R0AA 2VZ9A 1ZM4A 2VA2A 4E0DA 1YK9A 1WC4A 2JEGA 2CA9A 2IJRA 5L9NA 5L1LA 5JUMA 1UKUA 3BGRA 1WSRA 2PA8D 4USJC 5LMNJ 4OYXA 2GQQA 3RW6A 3KHHA 3PW7A 2AZ1A 2DY1A 2JEIA 4A8SA 3MAAB 4RW9A 4PEOA 2L3MA 1RAFB 3LTOA 4Q2MA 1I6JA 1X7VA 4F8RA 2BDPA 5K5MA 3IRWP 1D09B 3A13A 4ZJOA 5BR8F 2J0QD 2LQ9A 4FDFA 8RUCA 1T95A 2CJKA 4DV1J 1PJ6A 1JK9B 2QL9B 1EKRA 1HWJA 2J7UA 2ZUGA 2FLOA 3KG1A 5T41A 3S7RA 3IWNC 4QR2A 4DEZA 1UFWA 2B3TB 5D6GA 1V5IB 3C16B 1W7WA 4LIWA 2E1AA 1Q0NA 3JS9A 2AJ2A 2C42A 2QLXA 3M32B 3Q24A 4QPXA 2QX0A 1UWAA 4C0HA 3MECB 2DHGA 3NGTA 4QIEA 2HSEB 2XNQA 2UP1A 1LKZA 2DY9A 5HMXA 4HH1A 3PZPA 2C3UA 2B4PA 2DR9A 2MQMA 2EC0A 1EIYB 1NDPA 3CJKA 4EO6A 1U8WA 3CDWA 2ZH1A 1DJ0A 3OTEA 2DIVA 1DHMA 2AV5A 1RHQB 2CAJA 1FDDA 5J2PB 3CCLS 3IWXA 3QAEA 3Q8VA 2G2YA 4DR3F 3NGRA 1RK8A 4F0HA 2M4MA 3WIUA 1PG5B 2OUGA 1T02A 4HT5A 1IKYA 2RUGA 1DTTB 2AGQA 2PI4A 4USKA 2ZVIA 2DXDA 2WZ1A 1BLUA 3N0VA 2G9OA 5D0HA 3J81j 3KK3A 4DLGA 3LGMA 4B9UA 2PEBA 4DR4J 1B4SA 4U96A 4JI3F 4HL9A 4DR4F 1SV5A 2XYPB 2DGQA 3PHEA 3VAKA 4JI3J 4DUZF 1G2EA 1ACMB 3M8RA 2AU0A 3D3CJ 2GX8A 3AH6A 2UVRA 2R7RA 4ECTA 5G0RA 1RT1A 4PR6A 4TQSA 1TMJA 2NZ4A 4K4YA 3R5JB 3AFGA 4WYWA 4N56A 4DX7A 1JLFB 3I0SB 4O23A 3KHGA 5KG3A 3UNYA 2MQNA 1YZ7A 4LF6J 2WBMA 4ZVPB 3UDLA 3UNGC 3C2PA 2QMWA 2KO1A 2W2PP 4J9RA 1IKWB 2CQ3A 3DOLA 1YIJS 5GMKa 3IBFB 4FXDA 2CDRB 2SXLA 1HWKA 2U2FA 3R3TA 4IH6A 4C3MA 1PAUB 1IBMJ 2UU9J 5AJ3J 4CO2A 2ZH7A 4LF5F 3MOZA 3JAMY 2WAQD 1VQNS 2KVIA 3RR8A 4X4RA 1ZBTA 4DZDA 3MMBA 4UOHA 3W1YC 1XMQF 1X9MA 2IYGA 1NK6A 2XI3A 3OL6A 1IKYB 2HHPA 5AT1B 3T1YJ 2DNHA 2MGZA 1OQ6A 3VAMA 1R43A 1S9GB 2MSTA 4ZVRB 3HKWA 3QQCD 1NDKA 4CT9A 1U8SA 2E7WA 3CDBA 4DX5A 4B3MF 3C46A 4JI8F 3T5JA 3L3CA 4JI8J 1RTHA 2C3OA 4P71A 2WSEC 4RR5A 3SI8A 2OPPA 4LFAF 3TP2A 6AT1B 1BQNA 1W2IA 3BQ0A 3QWUA 4NLWA 1IM4A 5DGAA 2VG5B 3ZZRA 1LXNA 2J7WA 3L09A 2ZE2B 2IVMA 4H4KC 3H40A 2DISA 2FYXA 5J1NA 2MJNA 1BUXA 1XC9A 5FLXU 1VQOS 1TKTB 1NPPA 2F4VF 3E01B 4K4ZA 2D3OR 4ECUA 5KFYA 4ZITA 2IDLA 3PR4A 1KOHA 3BEGB 4L3KA 3RB4A 1U6BA 2V8PA 4BWMA 2XI2A 2RUSA 3OJSA 1N48A 1DY3A 3K17A 1JMTA 2HNDA 4JP8A 4YY3J 4URQU 4NWBA 4KGKA 2H48B 1SQFA 3MMAA 2XWYA 4OYPA 2EPIA 2MB0B 4V19X 2Q66A 1HL6A 3MMBB 3A8KA 3CJRA 1YJTA 4UZBA 1TL7B 2R7OA 1KR4A 5ETTA 4KKOA 2KFYA 2MY8A 4FYXB 1W2BR 1JKHB 1MWQA 2IHR1 3AY0A 1PGZA 2E44A 4YHHJ 3I0RB 3AXMA 2ZNZA 1IBKF 4WBFA 2GMHA 4NPOA 5HQLA 1N34F 4C4WA 5F3TA 3QT5A 3VVUA 1IXKA 4ZJLA 3WDOA 1U1KA 2G2OA 2C2KB 3HVAA 2CNKB 3M2UB 4OJ1A 2JFDA 1UA1A 1N56A 2HHWA 3JXOA 1FDNA 2KHCA 3FCWA 1H2TZ 4EBDA 1YTYA 1EP4A 3I96A 3HSZA 4F0KA 4X65F 1VDHA 2HWIA 3TZZA 2HMIA 4ED4A 3BSOA 4DV7J 3G6YA 2DRAA 2W7PA 2QT7A 2UUCF 3ONQA 4OV6A 3KK1B 2LP4A 1PKUA 2HGLA 2ZH8A 4K50A 3NRBA 1KQSR 4DG1A 2VDHA 2Y1IA 4PZVA 1RTDB 5LOQA 2HS4A 4Y28C 3T9NA 1HI8A 3O3LA 1PBAA 1XR5A 4X66J 2GHWA 2PSZA 5F9NA 2ZBPA 1RLCL 3C15B 3KG4A 4L75A 1KSPA 3M8PB 2ZOFA 4PABA 1HNVA 4PG6A 3L95X 2Y0SD 1WEYA 2RMLA 1RQ0A 4OX9F 4P72A 2BQ3A 1S1TB 4H4KA 2EG1A 4YEAA 5GAGU 5KFFA 5A8WB 1LW2B 1T94A 4ZLNA 2HHHJ 1X5TA 2YKMB 2HLTA 4MK8A 2POKA 1S1VA 3SQGA 1T3OA 3MWBA 1S1UA 1R7IA 1KHVA 2KJVA 1LK5A 2HS0A 3HZGA 3ITHA 3M30B 4WXWA 4Z7CA 2B4VA 3C66A 1MG7A 4NLUA 3BKFA 1FX4A 1YWXA 3DNCA 3R7BB 4KQZA 4P10A 3GZ7A 4XK8C 3CDAA 4I0WA 4ID5A 2VOPA 4WZMA 2WVFA 5D8HB 3PKMA 4ZN3A 4NCGA 1R27B 4A8MP 3C15A 2VFRA 4ECSA 4CYUB 2P2CB 2CZVC 4EK2A 4F04B 3W2VA 3G6XA 4IOBA 5KFVA 3FRYA 4F67A 4ERDA 2KFZA 3CMQA 3OR1A 4RW6A 1C0TA 1EB0A 1TELA 4DMZA 3G71S 4O3QA 4DPXA 1IBLJ 1VBZA 2DYAA 4CZCA 1U1NA 2E1MC 4USUA 1JXLA 1FFGB 3J7YU 2F4FA 2FHOB 4DHVA 2JLFA 1NJZA 1Q81T 3K58A 3QJLA 4P75A 3CCUS 5IT9Y 4OYAA 1FD2A 5E2QA 2UXBF 4LF9F 1IN0A 4RNOA 4NLTA 4ECRA 3IRXA 3MD3A 5D4LA 5ETLA 1HQUA 1GX5A 3OL7A 2IM3A 2O66A 2KRRA 1Q8LA 5DDRC 1R8BA 3D2WA 3DGPA 3EZOA 3NS7B 3VV2B 4WCEQ 2VONA 1NB7A 4Q45A 5KFKA 2HFSA 4QWCA 1T9UA 1CJVB 1C0TB 1RT2B 2EFPA 1QTMA 1NU4A 5LSRA 2FDNA 3QZ8A 1Q8KA 1YGYA 4OZJA 4OYIA 4DPWA 4MFBB 2EEYA 3GSIA 5AXNA 3T1HJ 3D6HB 3AQOA 3D0IE 3IGVA 4KH1B 1UEUA 4V1Ak 4HH0A 5B0FA 1TL4A 1UW9A 2VPXB 1QAXA 2OEMA 3MPVA 2BM1A 3LP0B 1H73A 1TKTA 1G4CA 4ID5B 4ZPVR 3FEZA 2MXYA 1N5YB 1NEEA 3IBWA 4C8MA 2GA7A 4PWDA 1C1BB 4RW8B 4DL6A 3QRPA 2V0NA 5LXRA 2FD2A 2VICA 1FNXH 3DRPA 2B51A 3V6JA 1M1HA 4DFMA 2DGWA 4ECWA 1SQEA 4X64J 3TANA 5IQ6A 1R8AA 3MM9A 3BSAA 5IC4B 4AXIA 3KLIA 2DR5A 2LEBA 3M6UA 2UUBJ 3H42A 4GKKJ 2YNIA 2QSWA 1G3OA 1SUQA 3NKYA 4X4PA 2XEXA 5E5NA 4A8WA 1KNZA 3IG1A 1U6FA 2W4DA 3W9HA 2IYIA 4I68A 5DJBA 1YSJA 4ILRA 4K0KJ 1U0HB 1WKLA 3D54A 2IC3B 2J5AA 4Y3CA 5KOWA 4B08A 5B0GA 5KFWA 4C0BA 2YNGB 4WWSA 1NO8A 2NLWA 4FXVA 1GXTA 3R7SB 2DITA 1OWXA 4USTA 3WQPA 3G6VA 4DS5A 1UWBA 2ZHAA 3RBEA 4C3LA 3PIPQ 3HHEA 4RUCA 1TFWA 3BBFA 3G8QA 2F8MA 1C0UB 1TR0A 4LF4J 5HI7A 3DLEA 3MM5B 1HNWJ 1ZPWX 1K9MT 4NOHA 1XTZA 1Y0HA 2CPYA 1OPIA 2BJ7A 2NXNA 2ILYA 2MPUA 3QGGA 4RL1A 4UW2A 3KHLA 4EUVA 1C4CA 1JLBA 4ES3A 2ZBIA 5KFOA 1NDLA 2YNFA 3RB6A 4NZ0A 5I3PA 1S7HA 3DRSA 4GVBA 5T7LA 3KJVA 3Q22A 2DO0A 1XNRF 2V5HG 2GMJA 3AJDA 3AB2B 1OMSA 2UVVA 3H90A 3SDEA 2Z2MA 1JJ2R 1UW4A 4AUKA 1KOOA 1QM9A 3G8TA 3SV4A 1R89A 1UVNA 1GK8A 1SC6A 3EGZA 4HACA 3OFEA 1FT8A 2J0WA 1MLAA 2I2YA 4KSEB 1R6YA 2DD8S 3EXCX 2HK2A 1S1WA 3T19A 1HLWA 1DLOB 1DQ8A 2MKYA 2ZZTA 3PYGA 3ZNUA 5L46A 5KFQA 5H9EK 4M63A 4MH8A 3TR5A 1CQNA 1CQMA 2FHMA 3FUYA 4CLTA 1HI1A 4GKJF 3T6BA 3MCSA 2MZSA 5E3CA 3HFKA 2RKIB 3QLHB 2CADA 2DKOB 4BS2A 4OHVA 2W2MP 2ASLA 5KTQA 2BABA 4RJVA 1VK3A 2V2VA 4F36A 5F8GA 1WTFA 2HMIB 1TL1B 4NI2A 2JOQA 5EDWA 3SDEB 2ZFHA 3TAPA 2LDYA 3CJTA 5KT5A 2XO7A 1HBNA 4I6AA 3GP9A 4DV4F 4DR5J 2IBOA 2BQUA 3MM5A 1FKAF 5D3GA 3O6QA 2Y9HA 2X1GA 3JSBA 1KLMA 2AJ0A 2ZJPQ 1TP7A 2YWHA 3BSCA 3IM9A 4KH0B 1TUWA 2YKNA 3NWRA 4DR2J 4DR7J 1TTHB 1NJIT 3M4XA 2LMIA 1QLNA 3EGVA 4CLZA 3OXFA 5B0DA 5BYSA 4ED0A 3V4IB 4FF4A 1M5PC 1VLYA 2ZVSA 3CIZA 1JNZB 3SIPB 2W2NP 4Q8FA 2K7KA 3LANA 1WJ9A 3SEOA 4DV3F 3ENVA 3GJTB 4Z37A 3J81Y 1HNIB 2LEPA 5CQGA 2HHUA 1EARA 3M2RA 4IFVA 1SB6A 4C7QA 4YR3A 4IRDA 1P1TA 2J9EA 4CCHA 4KJIA 1QVFR 4LF7J 1JWWA 3CNQP 2G2ZA 3H5SA 4LBHA 4IQMA 5HATA 4U7CA 4WFBQ 2F63A 4P2SA 1RWUA 1ZM3A 3PACA 4QQBA 4DU7A 4DPYA 2BEFA 3UR3C 2F8HA 3VCDA 4JV5J 2X7IA 1YRTA 3OJUA 2WCXA 3HSDA 5AXMA 2VFSA 4A48A 4LBPA 5KT6A 4KIAA 4CO4A 2W9CA 3DMJA 2R2SA 2WK4A 2HHVA 1YBTA 4HLBA 1WOPA 4KGZB 2BR0A 1QAYA 3MEDA 1U47A 3DLGA 3OTOJ 1FRXA 1BQXA 3UWTA 1Y10A 1Q1KA 1O0PA 3DI6B 4ETXA 1KWMA 5KT2A 1B3TA 1Q8BA 2FQQB 5C25A 2Q1LA 2CQIA 2HQFA 2RF2B 2B4UA 2B9EA 5CYQA 2JZ5A 3QO9A 1F9EB 4Y2KA 3TJ9A 2HAIA 3PO5A 5AE2A 3A8JA 2MKIA 3B4MA 4KGXB 3NNAA 3JSMA 1RU1A 2D3O1 2Z58B 1IBCB 2B7BB 4M5IA 5IV3A 4I2PA 4DV1F 2B5JB 4LUBA 3L7OA 4WZQA 3JB9k 1PIEA 4XPCA 1M5VC 3MEGB 1S6OA 3EPGA 3M9NB 2N4DA 1G6BA 1YJRA 3H5UA 3IWLA 4WU3A 3MM8A 2Y1LB 2QFJA 1XMBA 4ELTA 3PW2A 4DU8A 1YRXA 2N82B 4PUOB 2O67A 3TX0A 3VGSA 5DETA 5E33A 3HJFA 4RUAA 3UN3A 3DLBA 4JI6F 5H9EJ 1BC6A 4PXDA 4I69A 1RTJB 4P73A 3ZZYA 3GYGA 5KFAA 2YQ1A 5J1EB 4OYBA 1FTCA 4QW8A 1S97A 3Q8SB 2B6AA 3CC7S 2W9CB 2YNFB 5DGBA 1HQEB 2MZTA 2DNRA 1MMNA 1W25A 3MD1A 5EGYA 4MYUA 2BOAA 5HJYA 1SJ4P 4DSLA 4FVMA 3RZAA 2P6SA 2FZCB 1RAJA 5C42A 5E41A 4WP8A 4BWJA 4C6AA 2DNKA 1NUEA 2Q43A 3GWCA 3N5FA 4ZHRB 2VG7B 1VRTB 4TQRA 3UD4P 2IMWP 4UQTA 3BDEA 2Z57B 4WIIA 1RT4B 1ITPA 3FBFA 3RG6A 4DPUA 5J1EA 1BWVA 4WIQA 1TUVA 4YDXA 3IGNA 4AYBD 1Y3KA 5IFMA 3CMAS 3T1AA 2O1PA 3C19A 3NOGA 3UCGA 3OXGA 3CEDA 6FDRA 3DOKA 4G1QA 3HCXA 2HURA 1GTEA 2DRDA 3K8VA 5ETNA 3SSSA 5KFJA 2FVQA 1FNMA 3GR1A 2KI2A 2RB7A 1B70B 3MR5A 5L1KA 4I64A 2JLGA 2LEAA 2OHDA 4FP9A 2DT9A 3E01A 2GGPB 4J91A 5IT9U 1F3VA 2W9BA 1U25A 1CC8A 1S9GA 3GB0A 1I1GA 3SFUA 3PVXA 1VC6A 2KXHA 2HWTA 3AA8A 1YHQS 2CJYB 3I5AA 2YVSA 2YWFA 2R7QA 3P3DA 4DSKA 2V4QA 1J5EJ 4ER8A 4PRFA 2P5VA 2HQ3A 2ZWOA 3W65A 3P49B 3PYDA 4IR1A 1Y5IB 3F73A 2GIRA 4C8OA 4J5OA 2DXFA 3MCMA 4A46A 2ZM6J 2LQJA 1YG0A 2HVDA 5EWFA 3EPIA 4F4KA 5FDLB 3K5NA 4LQ3A 1RAEB 3G9CA 2XWXA 4HTIA 1JKHA 1S1XB 2J9DA 3A3PB 3UW1A 3UD5A 2AYBA 2J6TA 2BJ1A 2OEKA 3R1HA 4OHYA 3NWGA 5K9FA 2W8KA 1H3DA 2N3OA 1URNA 3QNWB 5ITHA 1NJYA 1NHVA 3DFEA 5F8LA 2RSQA 3OTBA 1NB2A 4IG0B 1VJWA 1C2PA 1RCXB 1U24A 1L5UA 4CH7A 3DLHA 1HBOB 2R8KA 2YX4A 2XHCA 5ETKA 3TJ8A 2C3PA 2XCAA 4DFPA 2A1BA 2WRMA 1R0AB 2KJWA 1CLFA 5AJ3F 4CRJA 2BKNA 3E2EA 1RKJA 4DN0A 3R5DA 3BZQA 2XGQA 2C2MB 2QMUB 3TYTA 3NP5A 2BXJA 4GO7X 5DZ6A 3H25A 5L9XA 3RB0A 3I0SA 1RT6B 2H65B 2HGNA 1AUSL 1SXLA 2RILA 1OSCA 3GONA 4H4MA 5FIIA 5SUHA 3T1YF 3PX0A 1GMWD 2DNZA 3RUBL 1IM6A 2RQ4A 2XYHB 2YH0A 3V81B 2B4OA 4LRBA 3M9MB 3EGWB 2VFTA 3KUEA 3O44A 4K5RA 4NASA 3DOMB 4K4TA 2HVHA 1KFDA 5HJXA 2AYMA 1QVGR 1HNVB 3TZXA 1E6VB 3IS9B 3GG0A 3W7BA 2FPHX 2E7XA 4ENOA 3GYXB 4QZVB 5HP1B 2F40A 2OPRA 3TW0A 4F4XA 3D4JA 4LVOP 1H72C 4NRUA 2AGPA 2ZITA 4KHPJ 1MMLA 2IAJB 2M2BA 1CJKB 2CZ9A 1U2RA 2RIJA 2VL1A 2P6TA 2PGCA 4YHHF 3CCES 2BE7D 3BGOP 5KFCA 3QPIA 1FKPA 3CW2C 1HYSA 1HNZJ 3HZEA 2H54B 1WUUA 1PAEX 3F44A 4NCGB 4P6QA 4DI6A 4HHHA 5T14A 1RT3B 2E7VA 5BYRA 1FNOA 1YITS 4O3SA 2CIMA 4I1TA 2AGOA 4TY8A 1X4GA 2KT3A 3VGVA 1TKXB 1D8YA 3KNAA 2ZH4A 1VK8A 2CXEA 4JBCA 5D4OA 5F8HA 1OQ3A 2Z30B 4XTTA 4XDCA 3LF0A 2H4WB 2ASDA 5LL6d 1HQEA 3ENWA 4I56A 4DUYJ 3AOBA 3TUIC 1F3FA 3LA0A 1ZAVA 1SBRA 3D6FB 3L4BC 4CO3A 2HIYA 3KLFA 1YBUA 2Z0GA 1NM2A 2OPSB 2X3GA 3VR1A 4DLEA 4LIRA 5J2NA 2AJQA 2CQ1A 2JRSA 1FDAA 3I31A 3SCJE 2W01A 1YJUA 4Q44A 3UDVA 3RYLA 1VCTA 4QR0A 3KWMA 2GIQA 1FA0A 4FF2A 4ELUA 1A0OB 3U02A 4NL5A 4LBIA 3B82A 4L73A 3I55S 2GNKA 4FF3A 4C8NA 1IBMF 4LF5J 4ED1A 2OTJS 3RAXA 2V69A 1UA0A 4FYYB 1TKZB 3W63A 4CLKA 2M7SA 4G3IA 4UY85 2YQ0A 1X5PA 1I51B 5DQGA 1AYEA 1T0TV 3M8ZA 3KLFB 5A8KB 4U6PA 3JSYA 3A12A 3C6TA 3OT9A 3QT6A 4GVLA 4USWA 2DH7A 1J27A 4NZ7A 4A4JA 3GIKA 2MZJA 3FDSA 4B3OA 1L3TA 4MIWA 2KG1A 2DVIA 3FSYA 2CPEA 7FDRA 3EYZA 3GFZA 1UVIA 3IR6B 2MQOA 5GADI 3BKTA 4C11A 4ZCIA 1DTQB 4I4BA 5KFLA 4WU2A 2PE8A 1FD8A 2MY7A 2ZBRA 3MM9B 2CPXA 2V9WA 1RAAB 1FI4A 3H2UB 3GFXA 2UXBJ 5F8JA 3D0HE 4J90A 3W62A 2CG8A 1WHVA 2DHSA 3M1VB 2DNGA 1EZZB 1S1XA 5GMDA 1YQHA 2W4CA 4ZPBA 5BYQA 4R0JA 4CT8A 3C3LA 3GLJA 4IG3A 1GFWB 2LA6A 2N7YA 5LJ5Y 4DR1J 2K2PA 3BO3A 3LUYA 3JTOA 1TMMA 2DH9A 3PJXA 3TEHB 1NBEB 1LWCB 2FHJD 2HGMA 2BKOA 2FIUA 2XZTB 4KFBB 4OJGA 3ZNJ1 4WKYA 3HLUA 2JEJA 3H20A 5KFMA 4NLVA 1GMVA 2YY3A 1EHWA 1R0BG 2CQCA 3ILOA 4PQUB 1UVKA 4F7VA 4OL8A 2AX0A 3K5LA 3TA1A 5IM0A 4DG1B 2XS7A 3QWPA 3NEKA 3OSPA 2FJVA 4NA2A 5A8WA 4ALZA 3EZ5A 2YKMA 2J8SA 1Z2ZA 2LA4A 2I1RA 3HHLC 1RHJB 2A0FB 1VQ8S 2D9OA 1NJXA 1REVA 3V81A 2W7AA 2BW7A 3FC9A 1M5HA 2ABYA 2L48A 4KO0A 2BMBA 2V2QA 1QUVA 3ZZPA 2ZDPA 4CI0B 1KFSA 2KFNA 1IKXA 3KKFA 1BQMB 4ED2A 4DFJA 2VF3A 3TUJC 4RU2A 5LMUJ 5KG5A 4JI0J 1R3NA 2ATLA 4DN9A 2XMUA 3OR1B 2DO4A 4MKBA 1RGVA 4RW6B 4CLUA 4YR2A 1LNQA 1HIYA 4GKKF 2PIIA 4WFNQ 3FJ2A 5DG7A 3CD6S 4KV8A 1N8RT 1K0TA 2WONA 3HFZB 4WFXA 4NLYA 2EK6A 1VIXA 2C2DA 2UVUA 5DG9A 2KRBA 3MUVP 1HWLA 2HNYB 4X4QA 4ZIWA 1F2GA 5KFRA 1CJVA 1RT2A 2HK3A 2OSRA 1REGX 2C1EB 1RB0A 4NI2B 4QIFA 4NCAA 5HMYA 4R8UB 1N0UA 1WEXA 1JJ4A 1APSA 2W24A 2A2DA 2OD4A 4KGMA 5BXIA 1P27B 4PQUA 1FERA 3PM9A 1N5SA 2FLNA 2QGFB 3GJQB 2FVCA 4N7TA 2C3MA 3GU0A 4OFZA 1RYRA 4A8KA 2DR8A 2EI5A 1PSDA 2AX1A 3MPYA 5C7PA 4DCJB 2CQDA 5KT3A 1OYEA 1C1BA 1Y5LB 3BKUA 3CCTA 3CJ8A 4RW8A 1B7FA 3UN5A 2HNYA 1KONA 2QA1A 5JVHQ 4HDGA 1N5YA 3IMQJ 1K8AT 4DFKA 1HWUA 2CQPA 2NQPA 1IKXB 3DKDA 3TVZA 1WTBA 3BR9A 4LF8F 3RBXA 1LEOA 3BYPA 2K3IA 2OELA 4PQAA 4WTOB 4LF8J 3KOAA 3PFOA 4UF4A 2IVYA 2H1YA 1Q7LB 3GYNA 1D0EA 2RU9A 2R42A 1EETA 2H4YB 2AQ4A 2CG4A 2DNYA 4U9RA 2KTQA 1U0HA 2OMOA 3N6NA 3ITHB 3M30A 3VGUA 4EEYA 2AWZA 3FCVA 1K44A 2YNHA 3UR0A 2OTLS 2ZH5A 1SUQB 1YJ9S 3MZIA 4KTQA 3KLVA 1TFYA 2CUYA 4TY9A 4CH0S 2ZHBA 4C3KA 1Q79A 4EI2A 5A0YA 3EDQB 4HT7A 4U95A 1X9WA 3QBCA 3BN7A 4DR5F 1Q82T 1D9DA 5HVFA 1S6QB 1RTZA 1O8BA 2B43A 4KGVB 2CJQA 3HM9A 1RAIB 3KLGB 2AP6A 2G13A 4MJKA 3HXMA 4ZPCA 1RZMA 4W98A 3PV8A 2YH1A 3IG1B 3HHLB 4ZVFA 2ROEA 4FPIA 2F9JA 4LVNP 1T7PA 3QATA 4IKAA 3V5RA 2XMAA 1NKBA 2AEMA 2DCLA 3H2VE 2CJXB 4LSNA 2EBEA 1KVIA 1N5QA 4Y2CA 3MAQA 2XY5A 1VQSA 3GTYX 2HQIA 3IAM9 1XNQJ 1WF0A 3O2IA 5J2MB 1ZTTA 1Y3JA 4TU9A 4RNNA 2A2CA 3P4UB 3K57A 1SJ1A 5MLCV 2Z2YB 3GJSB 1CG2A 3N79A 4OIXA 2PI5A 3QO9B 1Q78A 2HFOA 2L08A 3K7RA 4NXNJ 4OZ0A 2AW0A 4JOUA 2FB0A 3TAMB 3HULA 2QYCA 1F60B 5B0EA 3ISNC 2DCUB 2XMKA 3UVJA 4F3MA 4DR2F 1SIZA 4DR7F 1IQTA 4WP3A 1XIQA 1S0VA 4YOEA 1GMWA 1LFPA 1HR0F 1JLAA 3UCZP 1O6XA 4D3GA 4F2RA 4PWDB 4LFCF 2IBKA 2JSXA 4EZ9A 2J0SD 1SIWB 2CPHA 3KLHB 3JTNA 4DOZA 4B3SJ 4PG8A 4JI4F 4NLOA 1NNDA 2GQCA 2Y3YA 4TN2A 4DPOA 2E29A 5JVGQ 1KN6A 1L3KA 4ZVQB 2OAUA 3BO4A 1VRQC 3M2VB 3QGPA 5EWEA 3VGTA 1SC1B 1RT4A 2RDDA 1WD6A 1FKOB 3I32A 1DBDA 3HMJG 4ECZA 1IWAA 4I7FB 1VI7A 2EK1A 3Q83A 4LQ9A 2NXJA 5CAAA 1H2VZ 4YP3A 3J81U 1Q7YT 1WG4A 1XK8A 1FJGF 2OI2A 1OSDA 1FJGJ 2BKPA 3OD2A 1LQ9A 4EGLA 2HHTA 3KJQB 4AE5A 1UEVA 4IDKA 5F8MA 4ZVTB 3JQKA 2C2EA 1R8PA 2GGPA 3IR7B 2F3JA 1Q4RA 3OFHA 2XTJP 2KXNB 1FFWB 2Z4PA 1RAGB 2GS8A 1S9EB 3M8YA 3PRVA 4JV0A 3FGVA 1TK0A 2RE1A 2UVWA 1V5VA 3MCOA 4C8YA 3QJJA 2MKJA 1BWEA 3QIPB 4KBIA 2KH9A 1FXLA 2P9EA 4P2FA 2NXEA 2QG9B 3HSJA 4DV0J 4QR1A 3NMRA 4I2QB 5HN0A 1LV5A 3ZZTA 2HKEA 1T9VA 1UJ4A 3KDNA 2ZUAA 3T6JA 4QBUA 1U0SA 3AOAA 4RUHA 5DDPC 2ASJA 1N5VA 1RBOB 3R5GA 3WHIA 4USMA 1S6PA 5B09A 3TARA 2QO3A 4KE5A 2FZGB 4NLXA 2DK2A 1B7YB 1GX6A 4O3RA 4K4UA 2KVQE 2V68A 3JSMB 1FKOA 4OI4A 1S4EA 1CPZA 4EYHB 2HNZA 2I5JB 2VUGA 3GE9A 3CGIA 5CYQB 4N8OA 1M1GA 3ILLA 2DEJA 3SCKE 2ZJRQ 2R7VA 3HVTB 3OBIA 2YPYA 4HI2A 1HA1A 3AJ2A 5I3UA 3PKYA 2PD1A 1EJ7L 1DQAA 1TZ0A 3A8IA 4I2PB 4LR9A 5A2QY 1R8CA 3QT7A 1S10A 1JXEA 3RW7A 4EFAC 3DRRA 1ZH5A 1JLFA 9RUBA 4NYOA 5CYMA 5AE3A 1X4FA 4QPTA 3SYZA 4ANDA 3MUTP 3MOJB 3OQ2A 4WK3A 1R31A 4NLSA 2HW3A 3G86A 4F50A 3MMCA 1QUPA 2E5LJ 1N4LA 1PYSB 3EMTA 3MTJA 1QTNB 4Q43A 3CSKA 2G1HA 1HBOA 4F3QA 5KG1A 5LXYA 3NAHA 1QSYA 1U49A 3MURP 2UU9F 1P9QC 1FF2A 2KZZA 1M1KT 1X0FA 4ID8A 5IV4A 1N52B 3UPFA 2RU3A 1RTIA 3TQ1A 4OJHA 3RRHA 3MM7B 3HI9A 3UQSA 3W5XA 3UFCX 2B7CB 2PC6A 2NS1B 3AD8C 3CCVS 5K8MA 2A10A 2QFIA 3B4DA 2Q3PA 3HKZD 3NOCA 2FY8A 2NZCA 3DOMA 1B0VA 3TJAA 1QDUB 4NXMF 2R2RA 5CD4A 4LFBJ 2ZOMA 4EO8A 2VPWB 3CJ0A 3SBMA 4ZK7M 4TY8B 2GHPA 1TKXA 4ECXA 3AQPA 5LSLA 2B0GA 4JI7J 5ETPA 2MZQA 3OVBA 2CYYA 3VQSA 2RRAA 1KKHA 3D1QA 3DMJB 3M8QB 2XCPA 3GIMA 3ICLA 1FRKA 2OPQB 2W9BB 3UO0A 1TV6B 4CO5A 1YVFA 2XS2A 2K8GA 2GC8A 1RADB 3OFFA 1Y11A 4RZRA 3RRGA 1PC4A 1IKWA 3DOLB 4OLPA 3MXHP 1I3OB 1HW8A 2BRKA 2GVDA 4M8LA 5DLFA 5I42B 4N76A 5CA5A 1NH8A 1RHKB 2I6WA 5IS2A 4DL3A 1P8GA 3P45B 1S49A 1WOSA 1SPBP 3GV7B 3KTQA 1RT1B 2H51B 3PCOB 3TX8A 3TQEA 2N3LA 1H98A 2ZHOA 4ZVUB 3TA2A 2RNEA 1VQPS 4DSFA 4PYDA 4ZS6A 2VHGA 2P9GA 3OPKA 2RT3A 4RLEA 4X84A 3T9ZA 1RWVB 3QYYA 4ANCA 1ZZFA 3MAAA 3MTKA 4RW9B 2HVZA 5CYJA 4ECVA 1HNZF 3K59A 3SFGA 1N34J 2JH3A 4PUOA 1FTRA 2PEHA 2HWHA 3HHLD 3Q8QB 4JV1A 1I94F 5I42A 3Q2SC 4O3OA 2KYXA 2HBRB 1LK7A 2EWHA 5CZVA 2HRYA 4IH5A 1FXRA 4OZLA 4RO0A 1Q86T 4DUZJ 4C11B 1W26A 5JXSA 4YMEA 5E0OA 5FDLA 4IG0A 1QSLA 2QRRA 3M8QA 4ATNA 3BQ2A 2LDIA 2ZE2A 1PCAA 3MGJA 1CS4A 2EVZA 2LU1A 3K89A 4DL7A 2HVIA 3E3XA 2FJEB 4EMDA 4OHZA 3KK2A 2OPPB 1WF1A 1MNEA 3MCNA 1HNXJ 2HHXA 2FTRA 1VC0A 4ED8A 2HPUA 3ETMA 4TXSA 3DLJA 4UOCA 2R7WA 1SV5B 4F25A 3T5HA 5FJ4A 3ZTPA 2PDAA 4AT1B 1XWLA 3BGLA 3FBBA 1MROA 2CZ4A 1TAQA 5DG8A 3DOKB 4UUWA 2GZOA 4P2XA 3H7HB 2HZCA 4BHQA 4AQYJ 2V63A 3JTPA 3R2CJ 1Q16B 2FLLA 2CJBA 4UZCA 2MJUA 2KL8A 4KKOB 4AQYF 1HQ2A 2C3YA 2DGXA 3Q89A 2HFVA 4ZOSA 1ZOTA 2FJBB 1CJKA 4IG3B 4G1IA 3CCRS 3D7SB 1OIAA 1P6TA 2BVZA 4K4XA 2FHJA 3BJYA 2EFQA 3ENQA 3TUPA 5EX3A 3TI0A 3JAMU 4Y2AA 3PYEA 4Y65A 3H5YA 2NR0A 2Z2LA 2AKWB 3D28A 4HHUA 5L1JA 1WELA 1HD1A 4N5SA 4JYAJ 2YTCA 3FFIB 5DM6Q 4Q8EA 3H5XA 1X4CA 2UV8G 2ZJQQ 2ZKUA 2DHHA 1H7WA 3MUMP 3MPUB 4YDDB 2KM8B 4Y0FA 1VBXA 2B9WA 2CVEA 4QIVA 2MGZB 3KK2B 2X1AA 1SKRA 3NMAA 4DSJA 1NMEB 2VOOA 5EWGA 1P1LA 2R9LA 4C48A 1S6UA 4UT4A 2YXLA 4KHRA 2OD6A 4HI1A 4OQJA 1G1XA 1CC7A 4EWTA 4QYZK 2BJ3A 1N33F 2Q6BA 3R7NB 3R6GB 3BH6B 1H0HB 3G8SA 2B56A 2L41A 2IM2A 4OHWA 4F0MA 1NSQA 2CQ4A 4NEZA 1ICEB 1MWZA 2E9TA 1XMOF 2LVWA 1IJFB 2RS2A 4QOTA 4ANEA 1VQ4S 1JLGA 3PR5B 2P8IA 3G82A 4CTAB 4OI6A 4UOGA 4DL2A 3OSNA 2J76E 4H4MB 4K59A 4X4UA 3J7Z5 4Y2MA 1F9HA 1S7IA 2HRTA 3W5YA 2QN6B 5A8KA 2BZ2A 5A6PA 2HFZA 1PJ5A 3FBEA 3L7PA 3POTB 2NSCA 4JI1J 2OGUA 4ZVOB 4U8YA 1DTQA 3TUZC 1N36F 2D74B 4USVA 1LW2A 2PMHA 4P7TA 1BQNB 2NCKL 4A47A 3KLEB 3DDKA 5LMUF 4N8NA 3WX4A 2M3DA 4F2SA 1M5KC 3FFIA 3DHWC 2CVIA 1GH8A 2AZ3A 2BJ8A 3NGDA 1X4AA 2CWKA 4K7QA 1VRUB 4RW4A 3SCLE 4HKQA 5KG0A 1VFJA 5M2PA 3HVRA 1OY8A 1HQUB 4PYAA 1RBAA 3ELHA 2VC0A 1AUDA 2VBYA 1N54B 5KG7A 2JC0A 1TUGB 2VV5A 1RI7A 4ZCKA 1FKPB 1HYSB 4OX7A 3OXLA 1OY9A 4RNHA 3MPWA 2ILZA 3DDIA 3FK4A 4CLSA 1ZETA 2HHSA 2MLZA 1WC0A 3I87A 4MK7A 3CJ3A 1EP4B 2VG6B 1VISA 1WC6A 2W2QP 2ZKTA 1SH2A 2BE2B 1VRUA 4TLRA 2GIFA 4B9LA 1U2CA 3PDNA 3D0GE 5HANA 1RAOA 3G82B 1WKJA 3KUGA 3V2UC 4LRCA 3MAHA 1U6ZA 3A3NB 3CUNA 1WI6A 2KYZA 3OHBA 2D3UA 2GVZB 4DCPB 1AA1B 3QLHA 5AXKA 2QLJB 1U26A 1DURA 4CLPA 3FKBA 1V3SA 2K7JA 3HJVA 4EBCA 2ACYA 4DQIA 4WKRA 2F7VA 2RDIA 2Y0BB 3Q8YA 1RWWB 4IO1A 1Q95G 2DB1A 3RAMA 4MKYA 2U1AA 2X51A 2JWNA 4LSLB 3PTWA 2XNRA 2V6AA 4BBYA 3LWMA 4NEYA 4J7CA 1BE4A 2IA6A 4W90B 2H9ZA 2BA9A 3KNGA 4AXJA 1YJVA 2VDIA 3LP0A 3NAIA 3A8EA 3SSRA 3KK1A 4DZ6A 1TL3B 4C98A 2XY6A 4NLPA 1HBUA 2WONB 2DIUA 2PMWA 2QSFA 4PCQA 3TAMA 4CH1A 4QIWD 4R5PA 2E9ZA 1WG1A 2NREA 1K47A 2UUWA 3AD9C 4AFFA 1L3VA 1T8EA 2BUNA 2PN6A 2D69A 4FYDA 1Y9OA 2XZDB 1LWXA 2YKOA 3LW5C 4V19J 3LP2A 3TVKA 3MR7A 1MU2A 4XO0A 3AAWB 4M5HA 1RWPB 2EFVA 2QLWA 3I9V9 3FMWA 4FPRA 5BJRA 1J5OB 3I4PA 2Q79A 3G87A 4MK9A 3C8YA 5K8OA 4R8UA 1U4BA 5DQIA 4K2XA 3VAFA 2M70A 2HAFA 2CWXA 3BO2A 4OHXA 1ROFA 3NY0A 4UOFA 2LKZA 2CPZA 3KMQA 2N7CA 3UN2A 3IN5A 3DC2A 3CMES 1RT7B 1UTAA 3GSDA 1X60A 2DNLA 1YX2A 2YKAA 4I7FA 1MMDA 2UXDJ 4ZMMA 5HLFA 4ZN1A 3CJSA 3DLGB 4EU0A 4DV6J 1XNQF 3J7A1 4UUXA 5EN1A 3BB5A 3M2RB 2IRYA 4IFVB 4DV6F 1DLOA 1T05A 2XMMA 4QCLA 3CWJA 5B0CA 2KM8C 3QSYB 4URSA 1RSCA 1FRJA 3OR2B 4ZPWR 1YBAA 3FQKA 3K5OA 2M5YA 2VQEJ 4ZP6A 4FNIA 2CDQA 1KQKA 1NLKL 4OYWA 2CNOB 1RT7A 2RQCA 3OL8A 3QT8A 1EETB 2XB2D 1RWXB 3EE3A 1SKUB 4NE9C 4EYIB 3HO1A 2F5GA 4X2BA 4EBEA 2PA3A 1JLQA 1EQ0A 4OV1A 1MN9A 3CT9A 4HVZA 3IO1A 1GNKA 3PG9A 2W4PA 3AJ1A 5D3GB 3DRPB 2AT1B 2RJZA 3EJMA 1SQGA 1D9FA 5L1IA 4HHJA 2KN4A 2OFHX 2QL5B 3CTRA 1K0VA 1RHRB 3ZXWA 4NXNF 2F65A 2GCFA 3ET6A 4IRCA 2MYFA 4DL0C 1JLCB 2OLWA 3NGSA 2IM1A 3U1NA 1WORA 1HBMB 4WE1B 3W8PA 3O5TB 5LT5A 2NYHA 4N41A 3JSRA 2IC3A 1KVJA 1JLQB 2ZH9A 3ILIA 4HTJA 2Y8WA 3JYTB 1FJEB 4TU8A 3NBPB 4ZP8A 3OHAA 4DDFA 1G7CB 3CVKA 2BACA 4B3SF 2NXUA 1Q8IA 4GRSA 3HP6A 4F4WA 1SVDA 4J9NA 4DV5J 3RBDA 4FBUA 4RBVA 2M52A 1HNIA 3CJQA 5BR8J 4CO1A 5IQQA 3DGVA 2LQ5A 3UVJB 1U1PA 2KXFA 1WACA 2KDOA 3Q8PB 3CULA 2DNOA 3PX4A 1HI0P 1HBMA 5GAHU 2HQDA 2JDJA 2KKHA 2YX1A 5GAHI 2DTJA 1OY6A 3M8SA 4J9SA 2XQCA 3CCZA 3D68A 2E1RA 2WSCC 3EUNA 2FHKA 2GAGC 3H98A 3KFWX 3BYRA 3ZTSA 3FCHA 3M9OB 5C25B 4X4OA 1X5OA 5D78A 2M8HA 1VQ7S 1TK5A 2XMTA 3MEDB 2O3DA 3H2LA 2LYVA 3M2VA 3THVA 2PFFB 1U48A 2J6SA 3GCXP 4ZPTR 4JI6J 1S1WB 4PPDA 2MZ1A 1YDLA 1HHQA 2JLEA 4G6VB 1FXDA 5K14A 1Z4UA 1ZM9A 1D9AA 5E7OB 3TA0A 4C2MA 4A8QA 4ED3A 1CJUA 3FSXA 4ZVHA 2B9YA 3M6WA 4ELVA 1H7XA 2QTWA 1HWIA 1R6VA 2J9DE 2RRNA 3Q86A 4Y6IA 2G4BA 4RNFA 4DV3J 2XHWA 2YWEA 4NMLA 1JXVA 1FK9A 4YUDA 2RHSB 3HHNB 6FD1A 5KFTA 3I9ZA 2NUHA 2MKSA 2AF6A 3VZHA 3OVSA 4HACB 3RAQA 2XSJB 4XDDA 4J9QA 2DGVA 1NHKL 4NLGA 3KDOA 3W64A 2L9WA 4USHA 2DNNA 5K14B 2AJ1A 4X62F 1FWPA 1BMQB 5LJ3Y 3W2WB 1YJWS 2E5LF 4JV5F 3JQMA 1X0PA 5L38A 2RHQB 4I2QA 1N0VC 3W9JA 5IZHA 3BSNA 2VH7A 3NS5A 4DQSA 4FN5A 3PEJA 2ZH3A 2MLYA 3HD1A 4O0IA 3HD2A 3OFGA 1KP6A 5C42B 5IWAF 3C16A 3ZC4A 4X4SA 3H4DA 1RKIA 3UD3P 4G1PA 4DF8A 3ZZUA 2LCWA 3VWSA 4DR6J 4ZVSB 1KS2A 3ZTOA 2HHQA 1A6LA 1FO1A 4RW7B 4PG7A 4USIA 4ES1A 3CD7A 5A8RB 3OVAA 3GFHA 3F0NA 1FRIA 5KG4A 3OUYA 1SL0A 4BDPA 4LFBF 2VG7A 3BBCA 3GIRA 3OR2A 3NS6A 3QGIA 1MWYA 3K8WA 2EC2A 3CJKB 4DBQA 1E6YA 1FRHA 3PJ9A 1Z2LA 1QY7A 5I3UB 3QMQA 2UXCF 1ZTWA 4B9MA 2HNZB 2DNMA 2I5JA 1Q5VA 1Q53A 5HBMA 3TRGA 1T03B 3WIVA 2OIHA 2DGTA 3BGRB 1SJQA 5LMNF 3EVMA 2ZBQA 2FVPA 5CHCB 3HF5A 1F6TA 2ZBCA 5M2UA 3C6UB 3NGKA 1FEEA 1NK8A 4B3MJ 1T9WA 3HVWA 1NKCA 1DTTA 3VVTA 1H6KX 3S1TA 4RX6A 3HK2A 1AFJA 4OI2A 1A9NB 5B7WA 2VA3A 2BYCA 2CQHA 3IP0A 5C24B 3ET6B 4QYZJ 5H9FK 1N32F 1X4BA 3D66A 3NCPA 1WI8A 4F26A 1UFKA 5KFXA 1HW9A 3NG8A 1BD6A 3FVYA 4QIGA 1VGYA 3FRZA 5RUBA 2J7KA 1UPPA 3IAS9 3T41A 3P6YC 4NX9A 3LO3A 3ZZ0A 3RTVA 3N4WA 4WP9A 1HPZB 4IDKB 4JI2F 1RLDA 2F9DA 2XM3A 1N6QA 2D41A 3EM1A 3BV8A 4WTYA 1S99A 1UEKA 2OJ3A 4DWIA 1OS5A 1I94J 2JEFA 2YX7A 3IC1A 3QFHA 4MMOA 1TK8A 1RTJA 4B3TJ 3I5BA 3HT3A 2WHOA 4YN3B 3GIJA 1VQKS 1S12A 2C2NA 3ISND 5KOXA 3GV8B 3BQ1A 4F3OA 3BF4A 4WXOA 3J80Y 4TKTA 1MROB 2JJ4D 3W9IA 1T3NA 3GILA 4A8OA 3ILJA 2LQ8A 4GC7A 2FJAB 1JJCB 3IA0A 2HG4A 3FQLA 1S5ZA 3QZ7A 5KT7A 5A76A 2VKRA 4WJBA 2COLA 3KJFB 5E3AA 1RJJA 4IFYB 1NSKL 1VHFA 2R3VA 1Q5YA 3QAUA 4L76A 3PY8A 1CULB 4JI5J 4ZLPA 2R8JA 1U09A 1DRZA 1IKVB 1V6HA 4FS2A 3D3BJ 3DRXA 3W2VB 4B3RJ 4I6YA 5F0WA 3QIDA 5KFZA 2W9AA 2HNDB 3J80U 2XBPA 3AOCA 3GV5B 5CXTA 1FJCA 4O4GB 4CIOA 1NK9A 4YFUA 3HVTA 1SC3B 2ZM6F 2E1CA 3D9BA 2VBWA 4OZ5A 5CABA 2AYEA 3RB3A 1TL7A 3R1LA 4WPAA 2RQKA 2J9CA 2V34A 1RP5A 3GFYA 2EFNA 3DRRB 4D3HA 5HMZA 4Q0BA 1UJ6A 4BC9A 2KG0A 2IAJA 4LF6F 3MI7X 2GO9A 3OLBA 4IR9A 3EVWA 2ZD1A 2DGOA 2XSJA 2PFDA 3MDFA 2R7SA 2VJUA 2X3DA 2XO6A 3DN9A 1S9FA 3KG0A 3TZWA 2Z8QA 4ZP9A 1ZYQA 4OI1A 5IT4A 1ZZNA 4GC6A 4LSZB 4ZJQA 1NDCA 5HMWA 1RHUB 4PXCA 1XMQJ 1UFLA 3D6MB 4MYTA 1L3SA 4JI7F 3QRRA 2VJVA 4LMZA 2CQGA 2CNLB 2HZVA 1ZA1B 4C9DA 3CJ5A 3F56A 3BGFA 4OX6A 4IFYA 3EWGA 1VIOA 3M7VA 3LH2S 3MFHA 4I67A 1FVSA 1U1MA 1RT3A 3MEEA 3THPA 2W7OA 5DM7Q 4NRTA 2ROGA 1GT8A 3ZFVA 4YY3F 2HIQA 2MSSA 3BN4A 1URRA 1RAHB 3K2YA 5D77A 1S0MA 1SH0A 2OMLA 3QGHA 2K1RA 4W4MA 3SZ2A 4AL5A 2B8QA 4Y2IA 2LQBA 4M5DA 4CLLA 4Z2XA 3QJPA 5F0UA 1N33J 3FBCA 4GMKA 4HYKA 4RUBA 4JYAF 3GJRB 2YNIB 1S1TA 2IJNA 2XY7A 4RW4B 2BW2A 5EHHA 4Q0BB 4YB6A 2ALYB 1IBKJ 1WHYA 2M8DB 2GVZA 3C6UA 3W5ZA 1N36J 3B6BA 2GO8A 4Y00A 2YWKA 3D1OA 4ES2A 3HFVA 3MHYA 4X4TA 1M5OC 3LQVA 2JHEA 2K1RB 3RRKA 4H4OB 4UY8T 2XG8A 1WNEA 4CQ1A 2ZDOA 3H4BA 3M05A 2QE5A 5B0BA 5C24A 1RWMB 1LWFA 1JB0C 1F5AA 3ETOA 3IS9A 3LP1B 2DR7A 4ZPDA 3G2XA 3H8YA 3E8OA 3O1LA 4YR0A 2C2OB 3K5MA 1XMOJ 3PYFA 1AZSA 1DQ9A 5K8NA 1LFWA 3AXKA 4ILMA 1X5SA 1HBUB 3DXSX 4U7UK 4OLOA 4K4SA 3MEKA 3DM2B 3CCSS 4FXWA 3DLKA 5HQ8A 1J2VA 4IUFA 2RD5C 2HEKA 2W1BA 3H59A 4H4OA 4ICLB 4KB7A 4N77A 3DRYA 5THWA 3AB4B 1PYOB 3Q2TC 3MM6B 2YQ3A 1RHMB 1J5OA 1PJ7A 2UUCJ 3CIMA 2A6OA 3M1VA 5EX0A 2XLKA 4WFAQ 2E5JA 2AJFE 2FJDB 1JLBB 3T5LA 5GMEA 4NCBA 2V8VA 2HYIB 3DGPB 3HSGA
chains in the Genus database with same CATH topology
3IMQJ 1HNXJ 4X66J 4JI5J 4B3RJ 4OX9J 4DR4J 2KVQE 3D3BJ 4NEYA 4LF8J 4JI6J 2UUAJ 3J80U 4JI3J 4DV2J 4LF5J 2HHHJ 3D3CJ 4AQYJ 4DR3J 4RJVA 2KL8A 1XNRJ 4DV3J 5IT9U 4DV4J 4LF6J 4DR5J 4LFAJ 1J5EJ 4NXMJ 3JAMU 2E5LJ 4HHUA 1IBLJ 2UU9J 1IBMJ 4JYAJ 5AJ3J 4DR2J 4DR7J 2UXCJ 1XMQJ 4GKJJ 2UXBJ 3W1YC 4LF9J 2ZM6J 1HR0J 4LFCJ 3T1YJ 2MTLA 5A2QU 2UXDJ 5IWAJ 1XNQJ 4DR1J 4DR6J 4DV6J 4JI4J 2MQ8A 4JI8J 3R2CJ 4LF7J 1N33J 4LFBJ 4X62J 4NXNJ 2VQEJ 4NEZA 3T1HJ 4V1Ak 4JV5J 4JI7J 5FLXU 1IBKJ 5LMNJ 3OTOJ 1N36J 4B3MJ 4JI1J 4B3SJ 4YY3J 4X64J 5LM7E 4X65J 4JI0J 5LMUJ 2UUBJ 4DV1J 4GKKJ 1XMOJ 1N32J 4K0KJ 3J81U 4KHPJ 4PWWA 2F4VJ 4YHHJ 1FJGJ 3R2DJ 2MEWA 1N34J 1HNZJ 4JI2J 4KYZA 4DV5J 1I94J 4B3TJ 3J7AN 5BR8J 4LF4J 1HNWJ 4DUZJ 2UUCJ 4DV7J 2VQFJ 4DUYJ 4DV0J 4KY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMQ J;  1HNX J;  4X66 J;  4JI5 J;  4B3R J;  4OX9 J;  4DR4 J;  2KVQ E;  3D3B J;  4NEY A;  4LF8 J;  4JI6 J;  2UUA J;  3J80 U;  4JI3 J;  4DV2 J;  4LF5 J;  2HHH J;  3D3C J;  4AQY J;  4DR3 J;  4RJV A;  2KL8 A;  1XNR J;  4DV3 J;  5IT9 U;  4DV4 J;  4LF6 J;  4DR5 J;  4LFA J;  1J5E J;  4NXM J;  3JAM U;  2E5L J;  4HHU A;  1IBL J;  2UU9 J;  1IBM J;  4JYA J;  5AJ3 J;  4DR2 J;  4DR7 J;  2UXC J;  1XMQ J;  4GKJ J;  2UXB J;  3W1Y C;  4LF9 J;  2ZM6 J;  1HR0 J;  4LFC J;  3T1Y J;  2MTL A;  5A2Q U;  2UXD J;  5IWA J;  1XNQ J;  4DR1 J;  4DR6 J;  4DV6 J;  4JI4 J;  2MQ8 A;  4JI8 J;  3R2C J;  4LF7 J;  1N33 J;  4LFB J;  4X62 J;  4NXN J;  2VQE J;  4NEZ A;  3T1H J;  4V1A k;  4JV5 J;  4JI7 J;  5FLX U;  1IBK J;  5LMN J;  3OTO J;  1N36 J;  4B3M J;  4JI1 J;  4B3S J;  4YY3 J;  4X64 J;  5LM7 E;  4X65 J;  4JI0 J;  5LMU J;  2UUB J;  4DV1 J;  4GKK J;  1XMO J;  1N32 J;  4K0K J;  3J81 U;  4KHP J;  4PWW A;  2F4V J;  4YHH J;  1FJG J;  3R2D J;  2MEW A;  1N34 J;  1HNZ J;  4JI2 J;  4KYZ A;  4DV5 J;  1I94 J;  4B3T J;  3J7A N;  5BR8 J;  4LF4 J;  1HNW J;  4DUZ J;  2UUC J;  4DV7 J;  2VQF J;  4DUY J;  4DV0 J;  4KY3 A; 
#chains in the Genus database with same CATH topology
 1U1O A;  3DLK B;  1DAX A;  4KO0 B;  5C2G A;  2ZZN A;  4WFZ A;  4P7V A;  1T9Y A;  1X4H A;  3IRX B;  4TVA B;  1CUL A;  2JX2 A;  1KHW A;  3PNI A;  2CPF A;  3N9U C;  2E1P A;  1FWL A;  4GO5 X;  1REV B;  3NLC A;  1UET A;  1F5B A;  2IFX A;  3LAL A;  3T5K A;  3R8Y A;  4OX9 J;  3MR3 A;  2I38 A;  2EFG A;  1PO6 A;  1X8D A;  1QSS A;  2D7S A;  2BQR A;  3DLL Q;  1SI9 A;  3NGU A;  3SCI E;  3IR5 B;  4QJV A;  3HHL A;  3BH7 B;  1B0P A;  1JJH A;  1S1V B;  4KC5 A;  4XPE A;  4QWA A;  4OI0 A;  2V8H A;  7FD1 A;  4KHM A;  4FNH A;  2LU2 A;  4X4N A;  1HKA A;  2CPD A;  3RBZ A;  2QA2 A;  4LF1 A;  2OPS A;  5J2N B;  3V6H A;  3R27 A;  5IOL A;  3RU0 A;  4DXL A;  2QC3 A;  5KFE A;  2ADB A;  2DGU A;  1TU0 B;  1RA7 A;  3CD0 A;  1UAW A;  4YB7 A;  1U7L A;  3EXY A;  4G65 A;  4LJM A;  1IQZ A;  4E98 A;  5F8I A;  3KLE A;  3VAI A;  1GQE A;  4B02 A;  4ZA1 A;  1FE0 A;  3IFE A;  1IR2 A;  1UPM B;  2ZH2 A;  5HLF B;  3H0P A;  1DFD A;  2Y1R I;  5KFH A;  4I6W A;  3MF5 A;  2BE2 A;  4IO9 Q;  1HHT P;  2ADC A;  2G0C A;  2GJ2 A;  2HQG A;  2XMJ A;  3DU6 A;  1RA6 A;  3CO0 P;  4IH7 A;  5F9L A;  2XLI A;  4M5L A;  2CPI A;  5SZT A;  2PMZ D;  3GCW P;  1ULR A;  4GKJ J;  8AT1 B;  2DHX A;  4LF9 J;  3WBZ A;  3MPD A;  2BV3 A;  1C1C B;  1F0X A;  2WVE A;  5HRO A;  5F41 A;  5I3Q A;  3A3O B;  3FZ2 A;  2DRB A;  4K0K F;  4B17 A;  1EQM A;  3CCJ S;  1NK0 A;  4DPT A;  4DJB A;  1HHS A;  2VAS A;  8ATC B;  5K8P A;  1QD1 A;  4A8X A;  5J2Q B;  1FE4 A;  1XJW B;  2JNJ A;  2X1B A;  1T9T A;  3NCQ A;  4H54 A;  2V2K A;  2L9N A;  5A6W A;  1LWC A;  4KFB A;  2V94 A;  4X64 F;  3P8B B;  1SJF A;  3DDN A;  1TL5 A;  2RF2 A;  2I8E A;  2MKK A;  4JI0 F;  3R5C A;  2HQC A;  3E51 A;  4DQR A;  2CRL A;  4NZ6 A;  5GAE U;  1U2F A;  2FJX A;  4C8K A;  3CC2 S;  4IRK A;  1NK4 A;  1OO0 B;  1UJ5 A;  2B5J A;  5KFI A;  2HBY B;  4M5K A;  1DZ5 A;  1HD0 A;  1RCO B;  4O44 A;  4J9K A;  4F4Z A;  4LSL A;  1FWK A;  1NSP A;  5J2Q A;  2RH3 A;  4MKV A;  1KQF B;  3JYT A;  3R5B A;  3DI6 A;  1NPR A;  2FUG 9;  4K8R A;  2VIH A;  4J37 A;  3BR8 A;  4P74 A;  2IM0 A;  2LEC A;  1LWE B;  4O4R A;  1QE1 A;  5KFN A;  2WTF A;  2ROP A;  2I9S A;  2D9P A;  3UI3 A;  4FYW B;  2CFX A;  2G1D A;  3KLI B;  1YZ6 A;  5F8N A;  3GII A;  5IM0 B;  2DEI A;  4LSN B;  2M88 A;  2VQE F;  3OTC A;  1H74 A;  3ZO7 A;  1RAB B;  2J0X A;  1YLX A;  1S57 A;  1CJU B;  2DR6 A;  2FGC A;  5DLG A;  4B9S A;  4M5J A;  2R2T A;  1TKD A;  3V6D B;  1NCL A;  2KHD A;  2RQM A;  2VFV A;  2VB6 A;  2NXC A;  2V4J A;  3CDU A;  5D4P A;  1CEZ A;  1VHI A;  1GEH A;  3R2D J;  3QFW A;  2G0J A;  1ZAX A;  1UWB B;  1ZAW A;  1LWE A;  1V3Z A;  3PEH A;  5KAK A;  1NAQ A;  4HDH A;  3TAQ A;  2WVC A;  2C28 A;  4CLF A;  2QA4 G;  2BJD A;  1K1Q A;  3J7A N;  2WOM A;  3QSI A;  4J9L A;  3JQJ A;  4U67 Q;  3OL9 A;  1ZM2 A;  3CO9 A;  3PHT A;  3T3F A;  4WF9 Q;  4WK1 A;  3V4I A;  2AYG A;  4ED5 A;  1WG5 A;  3J7Y I;  1IR1 A;  1AFI A;  3L7U A;  2Y8Y A;  2IMO A;  5H9F J;  1JLA B;  3U1L A;  1RXO B;  2VQF F;  5D4N A;  5J2M A;  4LR8 A;  2V4J B;  2QYG A;  3ULH A;  3VF0 B;  4ZDN A;  2YPZ A;  1WDD A;  3NXZ A;  2HBZ B;  4HEA 9;  3GG1 A;  2QEX S;  1X31 C;  1ZA2 B;  3PRB A;  4NYP A;  3HDS A;  1NH7 A;  3DXB A;  2BX6 A;  2WOM B;  1HNX F;  2WB4 A;  4OYZ A;  2E5I A;  4ECQ A;  3FNN A;  4DV5 F;  4IYQ A;  3KHR A;  2XLJ A;  4O3P A;  1R0C B;  1WC1 A;  3BGU A;  2H5J B;  1S48 A;  4M5G A;  3VAH A;  4LRE A;  4DV2 J;  2XZW A;  3MMC B;  2FLP A;  2VOD A;  1FX2 A;  1TL3 A;  3PJW A;  4NYZ A;  3CB4 A;  3HHK A;  1S4F A;  4OZ2 A;  4C8L A;  2MKC A;  2KU7 A;  3BDP A;  3VTI A;  4DR3 J;  1JLC A;  1RUS A;  2H3E B;  3D5M A;  4FKX A;  5GVQ A;  3U27 A;  2MQL A;  2MQP A;  3KLH A;  1M90 T;  4CDI A;  3KYL A;  2NUU G;  3CE8 A;  4P9S A;  2A3J A;  3FMB A;  1VQM S;  1FEH A;  1Y7P A;  4DV4 J;  3LAM A;  4QU7 A;  3N28 A;  2CPJ A;  1VYA A;  1S9E A;  2GJF A;  3NBP A;  1M0S A;  4P52 A;  1N88 A;  1GXL A;  4CM0 A;  4CM2 A;  3KLG A;  1BGX T;  2R8I A;  1TQL A;  4UTG A;  2R8G A;  5KT4 A;  1PYT A;  1EX8 A;  2QZ8 A;  4AL6 A;  1WHX A;  2H5E A;  5DRK A;  1N5T A;  3US5 A;  4ZKA A;  1FFS B;  1X4E A;  2BM0 A;  2DJW A;  5M2R A;  1XR6 A;  1FJ7 A;  2CJA A;  2CNN B;  1CJT B;  2EKN A;  2IDE A;  2MMY A;  3MEC A;  3MM8 B;  3QIP A;  1UZD A;  3SSQ A;  2DNP A;  1QJH A;  4LFC J;  2G0I A;  2MHE A;  2MTL A;  2OP5 A;  1RBL A;  3WC0 A;  1I5O B;  2D1C A;  3OTO F;  4J9P A;  2FJW A;  4K4V A;  1TAU A;  2VPY B;  1PIL A;  3ISZ A;  1NZ8 A;  2ZWP A;  4KRW A;  3THT A;  2EKY A;  3EGN A;  2OKQ A;  5HQM A;  4JI4 J;  1SC4 B;  3TVY A;  4MKA A;  4PG4 A;  1KLM B;  4DL4 A;  1NSA A;  3FEX B;  3GR0 A;  4MIB A;  1J5E F;  3KK3 B;  2R7X A;  4ZCM A;  1T9X A;  5D0E A;  2ZOG A;  1MN7 A;  3TO8 A;  2IRX A;  1WKK A;  2HLU A;  3B78 A;  2RVJ A;  4FYV B;  4MAK A;  5B0A A;  5K20 B;  1SCJ B;  2K06 A;  3X3U A;  1SKS A;  2BE9 B;  1P9Y A;  4U8V A;  1VMB A;  4ZHR A;  1GMU A;  1VRT A;  3A4T A;  2QLF B;  2W2O P;  1D8Z A;  2Q6C A;  3KJN B;  4KAI A;  1XEZ A;  4P2M A;  3LOU A;  5G0R B;  3D67 A;  4CP5 A;  4DR6 F;  2LXU A;  1S59 A;  1OYD A;  3PW4 A;  3EZU A;  1LXJ A;  1RIS A;  2FZK B;  1KQG B;  2ACM A;  1F1B B;  3I4H X;  3IBC B;  4MTP A;  4BLG A;  3RJM B;  3CF5 Q;  3W2W A;  3N6L A;  1VQ6 S;  1IKV A;  3LAK A;  3MMA B;  3LGN A;  4DF4 A;  1WDT A;  1WWH A;  2M9K A;  1VQL S;  5G4D A;  2DBB A;  1N32 J;  3PFE A;  2XGP A;  2Z2Z A;  1NRK A;  4DV0 F;  3VAG A;  1CSJ A;  2F4V J;  1ELO A;  1GTH A;  4XAK A;  2XUL A;  3B54 A;  1BHN A;  1EKS A;  5U47 A;  1RTI B;  3TOQ A;  2QLB B;  3KMS A;  4O0N A;  2GV1 A;  2MEW A;  4JI2 J;  4K5S A;  4LRF A;  3UDC A;  3BPD A;  4URG A;  4B3T F;  4NLD A;  2E66 A;  2K3K A;  2UUA F;  2OSQ A;  2ZC4 A;  1D3W A;  1VBY A;  4LRD A;  3ENA A;  1RWN B;  5HL7 Q;  2QV6 A;  2A6M A;  2IJF A;  4O4G A;  1JNR B;  2DH8 A;  2GW8 A;  3MM7 A;  4LR7 A;  2GAH C;  2DNQ A;  3I6P A;  4J9M A;  3C14 B;  5KG6 A;  4KY3 A;  3CCQ S;  1Y4Z B;  4FS1 A;  3D1H A;  4KHP F;  2MQQ A;  5DDO C;  2V2Z A;  1ZPV A;  1XER A;  1RTD A;  5HBM B;  1T03 A;  3DU5 A;  1VQ5 S;  2VPZ B;  2BJE A;  4Q7A A;  4JI5 F;  4U7U D;  2R7U A;  1KD1 T;  2YKQ A;  4B3R F;  1TV6 A;  1U02 A;  2CJ9 A;  2JVR A;  3Q8U A;  3AA9 A;  2VFU A;  5JMN A;  2XMV A;  1UVL A;  3CC4 S;  2J8A A;  1DAR A;  2QMX A;  3V6K A;  5L39 A;  3U7J A;  1Y00 A;  1O5J A;  5GAE I;  2JVO A;  5KFU A;  5ADZ A;  4OYM A;  4M5D B;  1YRU A;  4WFY A;  4FF1 A;  2VG5 A;  3R97 A;  4JB8 B;  5ETQ A;  1T11 A;  5HP1 A;  4FVC A;  5KFB A;  1WC5 A;  2NPI A;  2IA0 A;  1UCN A;  2V9K A;  1VOM A;  2MDA A;  2VBZ A;  3C6T B;  3NCR A;  3P96 A;  2CQ2 A;  1MW7 A;  1XN9 A;  3NL0 A;  4QWB A;  1XR7 A;  4XIU A;  4N47 A;  2Y1J A;  4L72 B;  5HVG A;  4DCO B;  2KB2 A;  4E2F B;  4LFA J;  3LPE A;  3BM7 A;  4NXM J;  3M2U A;  4K2J A;  1RWK B;  2LFV A;  3FEY B;  1UZH A;  4NMX A;  4ZP7 A;  2QL7 B;  3TZY A;  2W8L A;  4DQQ A;  3FZB A;  2CQB A;  1FVQ A;  1HMV B;  3C14 A;  3V4M A;  4CNY A;  5J1P A;  4DQP A;  2UXC J;  3I0R A;  1E6V A;  1A7G E;  2PO4 A;  2BOP A;  3N5B A;  1HPZ A;  2AD9 A;  2HVE A;  4ETZ A;  4QW9 A;  2VBX A;  2FVS A;  1CVJ A;  1WSV A;  2MZR A;  3W8G A;  1PBU A;  4AL7 A;  1QAJ A;  4ZLJ A;  1S0O A;  5CYM B;  2V8G A;  1CS4 B;  2B8P A;  1KC8 T;  2WBR A;  3HPO A;  2GJI A;  2MQ8 A;  3LPY A;  5I4M A;  2YBV A;  5A8R A;  3CCM S;  5KG2 A;  2RS8 A;  3SXL A;  4K4W A;  1VQ9 S;  5IXU A;  3EX7 B;  4DSI A;  1E6Y B;  1UL3 A;  4MFB A;  4F4Y A;  2E5H A;  2MKH A;  4ZCL A;  4IOA Q;  1RE1 B;  4OZ1 A;  2O5D A;  4PWU A;  2C2Z B;  1KEK A;  4F4A A;  2BAN A;  1RT6 A;  2MHN A;  1FDB A;  1FRL A;  4LRA A;  4WYL A;  1VS3 A;  1NZA A;  1WF2 A;  2ZEJ A;  3CPW R;  4B9N A;  4B9V A;  2HFN A;  2GHV C;  2VU5 A;  1S77 D;  4S0M A;  1D1U A;  1WEZ A;  4RNM A;  5DQH A;  1S72 S;  2V50 A;  3KXD A;  2J6U A;  1EAY C;  2IVF B;  2EFO A;  1KLN A;  3Q0A A;  2ZD1 B;  1NXI A;  3M8P A;  2V67 A;  5CCL A;  4X65 J;  3U1M A;  2KT2 A;  1SJR A;  1FCA A;  5D0R A;  5AXL A;  3T1H F;  4RBU A;  2JFK A;  3M6X A;  2BAN B;  1O51 A;  2FC9 A;  3I82 A;  3G6E S;  4DUY F;  2OH2 A;  1NJW A;  1F5C A;  3SQG B;  1VBK A;  5EUH A;  4B3O B;  3R5A A;  4PWW A;  4L3N A;  2HFU A;  5D15 A;  5H1S V;  3OLA A;  2AMC B;  2VC1 A;  1KRP A;  4Q5V A;  1N6Q B;  2NSB A;  3N6M A;  2IRU A;  3TEG A;  4X4V A;  5FD1 A;  2XSF A;  4QYR A;  3VZI A;  1HFE L;  4OYO A;  3OV7 A;  2UZA A;  5B08 A;  4Y34 A;  1L3U A;  4RWW A;  1K73 T;  1KDN A;  5DS7 A;  5E3R A;  1S76 D;  1VR6 A;  5DO2 A;  1JX4 A;  4R0E A;  2RRB A;  1RU2 A;  1X9S A;  1ARO P;  4RBT A;  3W66 A;  3SV3 A;  4ED6 A;  2R2U A;  1WHW A;  2EXU A;  2OPR B;  4DS4 A;  4JUZ A;  4OZN A;  4KPC A;  1VLO A;  3O8W A;  4BC7 A;  3Q23 A;  4DV7 F;  5KFG A;  3BPS P;  2LXF A;  4E8U A;  3MEE B;  4R25 A;  1FES A;  3DHX A;  4EZ6 A;  1NK7 A;  1HAR A;  3F41 A;  3LWL A;  4YB5 A;  5AE1 A;  2XS5 A;  4J9O A;  4X66 F;  1H2U X;  2ATC B;  3SQO P;  2WW8 A;  1UVJ A;  1U1R A;  2ZNY A;  3L9Z A;  3PIO Q;  1YJN S;  1S79 A;  3M8W A;  4NLQ A;  4NA3 A;  5F3Z A;  4RWX A;  1XQI A;  1LWF B;  3LP1 A;  4Q2L A;  1WC3 A;  3ZZO A;  5DDQ C;  4QWD A;  3W3S A;  1LW0 A;  2OO4 A;  1VJQ A;  1IBL F;  2HHH F;  2XMW A;  4LF4 F;  2R4F A;  2YWG A;  2FC8 A;  3EIC A;  4KR0 B;  4DSE A;  1JLG B;  3IM8 A;  5LSO A;  3GPA A;  1JQG A;  1TKZ A;  3K5P A;  4OX8 A;  5E3Q A;  5IC6 B;  2D3Z A;  3GMG A;  2E5G A;  2YNH B;  2FVR A;  1MSW D;  2KT5 A;  4LF2 A;  3EDR B;  3POT A;  1QAI A;  4TNO A;  2VKZ G;  1VQY A;  3OTD A;  3UDE A;  1TL1 A;  3WZ0 A;  1XNR J;  4ICL A;  1IR0 A;  1BQM A;  2HZA A;  3DCA A;  2IPO B;  3ZZZ A;  3WC2 A;  2DPJ A;  1YI2 S;  1B0T A;  2ZH6 A;  2JL9 A;  1JIH A;  1U1L A;  2VG6 A;  3DM2 A;  1AW0 A;  3AOD A;  3MM6 A;  4NLR A;  4DL5 A;  4L74 A;  4TYB A;  3AHP A;  1GAO A;  1RAC B;  3PXG a;  2XC9 A;  3QRQ A;  2KZM A;  2OEJ A;  3MMJ A;  2EBG A;  2XYG B;  1KBR A;  1YJ7 A;  5ETV A;  5IT0 A;  1AZS B;  1HMV A;  4J9U E;  2VD3 A;  1M5S A;  4M5M A;  2LXI A;  4B9T A;  5GAG I;  5HVH A;  4PXB A;  3HT0 A;  1SL2 A;  1NK5 A;  2ZZM A;  4F02 A;  1RWO B;  5DZ7 A;  1KTQ A;  3CDE A;  1KTV A;  2DPI A;  5A2Q U;  4OZ3 A;  5HO4 A;  4DR1 F;  2RDJ A;  4O44 B;  5L8R C;  1F2H A;  4CYU A;  4JI1 F;  4O3N A;  3X1L B;  2GQ2 A;  3VHQ A;  2YNG A;  1LW0 B;  3VAJ A;  3ZTQ A;  1SL1 A;  2O01 C;  2W25 A;  3G4S S;  1IUJ A;  1OPZ A;  4JV2 A;  2QJ3 A;  3PRD A;  5ETR A;  2V4R A;  1S1U B;  2WVD A;  4A8F A;  4ILL A;  1C0U A;  5ETM A;  4ZLL A;  3NNC A;  2IY5 B;  1C4A A;  5T7L B;  3UE2 A;  4TU7 A;  2DXE A;  3R6L B;  4FKY A;  4PKD B;  2NPF A;  4CTA A;  4WE1 A;  1CBK A;  7AT1 B;  2QIF A;  1FHT A;  3DYA A;  3KUH A;  1BXN A;  3FSI A;  3PO4 A;  4PXE A;  4RKU C;  2M0G B;  3Q8R B;  4KPY A;  1UVM A;  4ZPA A;  4RPF A;  2UXD F;  4YQW A;  4OMF G;  2YKP A;  2PT0 A;  5D0G A;  1F9F A;  3BRE A;  3HX9 A;  2IIH A;  1VC5 A;  2YWW A;  4L6V 3;  2R8H A;  3WX8 A;  1WOO A;  1YKW A;  3MFI A;  5KFP A;  2DHA A;  2UUB F;  1S6Q A;  5LM7 E;  1UP1 A;  4UQG A;  4C97 A;  3M6V A;  1UMJ A;  4BCA A;  5CH7 B;  1FRM A;  5C2C A;  1AB8 A;  4NA1 A;  3OW2 R;  4W92 B;  4FZV A;  4OJ3 A;  2AJ4 A;  2BJ9 A;  4KT0 C;  2F8E X;  2UUT A;  4KV8 B;  5ETS A;  3HHD A;  3IXQ A;  3RGI A;  5CD4 H;  3UCU P;  2V8D A;  4IQX A;  2UUA J;  2AEF A;  3ADA C;  2OFG X;  3CJ4 A;  2ALZ A;  3K0J A;  3S6E A;  4FBT A;  3AT1 B;  1MU2 B;  1R8H A;  3M32 A;  2HRU A;  3BBB A;  3MR2 A;  2WVB A;  1RYS A;  1AT1 B;  3MR6 A;  2QA4 S;  3GQC A;  1Z1Z A;  2HS3 A;  3P5T L;  4KYZ A;  2AEJ A;  2L9D A;  2JC1 A;  3S01 A;  1IWG A;  1KVK A;  4TYA A;  2Z56 B;  1ZS6 A;  4CWB A;  4DX8 H;  5MAO A;  2C2R A;  2WB1 D;  1U1Q A;  1NKE A;  2WW4 A;  1U45 A;  1HNW F;  1C1C A;  4YB1 P;  5HRO B;  4IOC Q;  3TNV A;  2VQF J;  1K1S A;  3DYA B;  1Y5N B;  3D6T B;  5J2P A;  4M95 A;  2E9R X;  3PW5 A;  2FGO A;  2H5I B;  1CJT A;  4DUT A;  2P9C A;  3PX6 A;  4M94 A;  3W61 A;  1JLE B;  2HBQ B;  3CCW A;  1T05 B;  2EG2 A;  4LT6 A;  1FK9 B;  4MT1 A;  4QWE A;  3RR7 A;  1TVR B;  1IJE B;  3I5C A;  3I56 S;  2BRL A;  4A8Y A;  4M5N A;  3J7Z T;  2NYI A;  2WSF C;  1SKW A;  4Z7Y A;  3LGH A;  2CKW A;  1SH3 A;  4C8Z A;  1RT5 B;  2ASY A;  2N4C A;  1B99 A;  2GFF A;  1X4D A;  2BBE A;  3CD5 A;  5HAO A;  5GAD U;  4DV2 F;  3P5B P;  5KFS A;  2F1F A;  3W60 A;  2ZC3 A;  5CZX A;  1NPK A;  4G1Q B;  5CCM A;  3G96 A;  2X1F A;  4AD6 A;  2A18 A;  3DRS B;  2DGS A;  3EVO A;  4GVB B;  4J9V A;  4RU9 A;  2RAQ A;  4M1K A;  4OI3 A;  3VQT A;  3ZTR A;  3NNH A;  2EW9 A;  1PC5 A;  4HR2 A;  1S0N A;  5A0Y B;  5KFD A;  1BY9 A;  1NHU A;  4ECY A;  4CO0 A;  4ZIV A;  4CLW A;  1XBW A;  3PW0 A;  1QE1 B;  3MEG A;  1TVR A;  3AD7 C;  3A1Y G;  4YS2 A;  1V9O A;  3V6D A;  4CLY A;  4MIA A;  1OJ4 A;  2MLX A;  2ERR A;  2B9X A;  5HK4 A;  4DX6 A;  3DLE B;  4ZVG A;  1B64 A;  3CXC R;  4PAA A;  5ETO A;  1RT5 A;  3OUY B;  5JJB A;  3CJ2 A;  1RDR A;  3VAL A;  2AIR B;  2LLZ A;  5FLX Y;  3S8S A;  2AHO B;  1SJ3 P;  4PPZ A;  4C0O C;  4R5P B;  2APO A;  3SMZ A;  4ED7 A;  2FY1 A;  3BS9 A;  1GXU A;  5HSP A;  1HR0 J;  3R9L A;  4PG5 A;  1JLE A;  4CNZ A;  2C22 A;  2I0X A;  2OPQ A;  3LP2 B;  5IWA J;  2R7T A;  5E3P A;  9ATC B;  1HBN B;  5C5J A;  4QU6 A;  1H38 A;  2UV8 A;  4LF7 F;  3N01 A;  4RW7 A;  1RTH B;  1V3R A;  2GML A;  3B8H A;  1IVZ A;  2CQ0 A;  2GVD B;  1S6P B;  4ITS A;  2B6A B;  1LOU A;  2YKN B;  4TLQ A;  3KJV B;  4X62 J;  4ZVE A;  1AXQ A;  3TWZ A;  2RKI A;  1R0A A;  2VZ9 A;  1ZM4 A;  2VA2 A;  4E0D A;  1YK9 A;  1WC4 A;  2JEG A;  2CA9 A;  2IJR A;  5L9N A;  5L1L A;  5JUM A;  1UKU A;  3BGR A;  1WSR A;  2PA8 D;  4USJ C;  5LMN J;  4OYX A;  2GQQ A;  3RW6 A;  3KHH A;  3PW7 A;  2AZ1 A;  2DY1 A;  2JEI A;  4A8S A;  3MAA B;  4RW9 A;  4PEO A;  2L3M A;  1RAF B;  3LTO A;  4Q2M A;  1I6J A;  1X7V A;  4F8R A;  2BDP A;  5K5M A;  3IRW P;  1D09 B;  3A13 A;  4ZJO A;  5BR8 F;  2J0Q D;  2LQ9 A;  4FDF A;  8RUC A;  1T95 A;  2CJK A;  4DV1 J;  1PJ6 A;  1JK9 B;  2QL9 B;  1EKR A;  1HWJ A;  2J7U A;  2ZUG A;  2FLO A;  3KG1 A;  5T41 A;  3S7R A;  3IWN C;  4QR2 A;  4DEZ A;  1UFW A;  2B3T B;  5D6G A;  1V5I B;  3C16 B;  1W7W A;  4LIW A;  2E1A A;  1Q0N A;  3JS9 A;  2AJ2 A;  2C42 A;  2QLX A;  3M32 B;  3Q24 A;  4QPX A;  2QX0 A;  1UWA A;  4C0H A;  3MEC B;  2DHG A;  3NGT A;  4QIE A;  2HSE B;  2XNQ A;  2UP1 A;  1LKZ A;  2DY9 A;  5HMX A;  4HH1 A;  3PZP A;  2C3U A;  2B4P A;  2DR9 A;  2MQM A;  2EC0 A;  1EIY B;  1NDP A;  3CJK A;  4EO6 A;  1U8W A;  3CDW A;  2ZH1 A;  1DJ0 A;  3OTE A;  2DIV A;  1DHM A;  2AV5 A;  1RHQ B;  2CAJ A;  1FDD A;  5J2P B;  3CCL S;  3IWX A;  3QAE A;  3Q8V A;  2G2Y A;  4DR3 F;  3NGR A;  1RK8 A;  4F0H A;  2M4M A;  3WIU A;  1PG5 B;  2OUG A;  1T02 A;  4HT5 A;  1IKY A;  2RUG A;  1DTT B;  2AGQ A;  2PI4 A;  4USK A;  2ZVI A;  2DXD A;  2WZ1 A;  1BLU A;  3N0V A;  2G9O A;  5D0H A;  3J81 j;  3KK3 A;  4DLG A;  3LGM A;  4B9U A;  2PEB A;  4DR4 J;  1B4S A;  4U96 A;  4JI3 F;  4HL9 A;  4DR4 F;  1SV5 A;  2XYP B;  2DGQ A;  3PHE A;  3VAK A;  4JI3 J;  4DUZ F;  1G2E A;  1ACM B;  3M8R A;  2AU0 A;  3D3C J;  2GX8 A;  3AH6 A;  2UVR A;  2R7R A;  4ECT A;  5G0R A;  1RT1 A;  4PR6 A;  4TQS A;  1TMJ A;  2NZ4 A;  4K4Y A;  3R5J B;  3AFG A;  4WYW A;  4N56 A;  4DX7 A;  1JLF B;  3I0S B;  4O23 A;  3KHG A;  5KG3 A;  3UNY A;  2MQN A;  1YZ7 A;  4LF6 J;  2WBM A;  4ZVP B;  3UDL A;  3UNG C;  3C2P A;  2QMW A;  2KO1 A;  2W2P P;  4J9R A;  1IKW B;  2CQ3 A;  3DOL A;  1YIJ S;  5GMK a;  3IBF B;  4FXD A;  2CDR B;  2SXL A;  1HWK A;  2U2F A;  3R3T A;  4IH6 A;  4C3M A;  1PAU B;  1IBM J;  2UU9 J;  5AJ3 J;  4CO2 A;  2ZH7 A;  4LF5 F;  3MOZ A;  3JAM Y;  2WAQ D;  1VQN S;  2KVI A;  3RR8 A;  4X4R A;  1ZBT A;  4DZD A;  3MMB A;  4UOH A;  3W1Y C;  1XMQ F;  1X9M A;  2IYG A;  1NK6 A;  2XI3 A;  3OL6 A;  1IKY B;  2HHP A;  5AT1 B;  3T1Y J;  2DNH A;  2MGZ A;  1OQ6 A;  3VAM A;  1R43 A;  1S9G B;  2MST A;  4ZVR B;  3HKW A;  3QQC D;  1NDK A;  4CT9 A;  1U8S A;  2E7W A;  3CDB A;  4DX5 A;  4B3M F;  3C46 A;  4JI8 F;  3T5J A;  3L3C A;  4JI8 J;  1RTH A;  2C3O A;  4P71 A;  2WSE C;  4RR5 A;  3SI8 A;  2OPP A;  4LFA F;  3TP2 A;  6AT1 B;  1BQN A;  1W2I A;  3BQ0 A;  3QWU A;  4NLW A;  1IM4 A;  5DGA A;  2VG5 B;  3ZZR A;  1LXN A;  2J7W A;  3L09 A;  2ZE2 B;  2IVM A;  4H4K C;  3H40 A;  2DIS A;  2FYX A;  5J1N A;  2MJN A;  1BUX A;  1XC9 A;  5FLX U;  1VQO S;  1TKT B;  1NPP A;  2F4V F;  3E01 B;  4K4Z A;  2D3O R;  4ECU A;  5KFY A;  4ZIT A;  2IDL A;  3PR4 A;  1KOH A;  3BEG B;  4L3K A;  3RB4 A;  1U6B A;  2V8P A;  4BWM A;  2XI2 A;  2RUS A;  3OJS A;  1N48 A;  1DY3 A;  3K17 A;  1JMT A;  2HND A;  4JP8 A;  4YY3 J;  4URQ U;  4NWB A;  4KGK A;  2H48 B;  1SQF A;  3MMA A;  2XWY A;  4OYP A;  2EPI A;  2MB0 B;  4V19 X;  2Q66 A;  1HL6 A;  3MMB B;  3A8K A;  3CJR A;  1YJT A;  4UZB A;  1TL7 B;  2R7O A;  1KR4 A;  5ETT A;  4KKO A;  2KFY A;  2MY8 A;  4FYX B;  1W2B R;  1JKH B;  1MWQ A;  2IHR 1;  3AY0 A;  1PGZ A;  2E44 A;  4YHH J;  3I0R B;  3AXM A;  2ZNZ A;  1IBK F;  4WBF A;  2GMH A;  4NPO A;  5HQL A;  1N34 F;  4C4W A;  5F3T A;  3QT5 A;  3VVU A;  1IXK A;  4ZJL A;  3WDO A;  1U1K A;  2G2O A;  2C2K B;  3HVA A;  2CNK B;  3M2U B;  4OJ1 A;  2JFD A;  1UA1 A;  1N56 A;  2HHW A;  3JXO A;  1FDN A;  2KHC A;  3FCW A;  1H2T Z;  4EBD A;  1YTY A;  1EP4 A;  3I96 A;  3HSZ A;  4F0K A;  4X65 F;  1VDH A;  2HWI A;  3TZZ A;  2HMI A;  4ED4 A;  3BSO A;  4DV7 J;  3G6Y A;  2DRA A;  2W7P A;  2QT7 A;  2UUC F;  3ONQ A;  4OV6 A;  3KK1 B;  2LP4 A;  1PKU A;  2HGL A;  2ZH8 A;  4K50 A;  3NRB A;  1KQS R;  4DG1 A;  2VDH A;  2Y1I A;  4PZV A;  1RTD B;  5LOQ A;  2HS4 A;  4Y28 C;  3T9N A;  1HI8 A;  3O3L A;  1PBA A;  1XR5 A;  4X66 J;  2GHW A;  2PSZ A;  5F9N A;  2ZBP A;  1RLC L;  3C15 B;  3KG4 A;  4L75 A;  1KSP A;  3M8P B;  2ZOF A;  4PAB A;  1HNV A;  4PG6 A;  3L95 X;  2Y0S D;  1WEY A;  2RML A;  1RQ0 A;  4OX9 F;  4P72 A;  2BQ3 A;  1S1T B;  4H4K A;  2EG1 A;  4YEA A;  5GAG U;  5KFF A;  5A8W B;  1LW2 B;  1T94 A;  4ZLN A;  2HHH J;  1X5T A;  2YKM B;  2HLT A;  4MK8 A;  2POK A;  1S1V A;  3SQG A;  1T3O A;  3MWB A;  1S1U A;  1R7I A;  1KHV A;  2KJV A;  1LK5 A;  2HS0 A;  3HZG A;  3ITH A;  3M30 B;  4WXW A;  4Z7C A;  2B4V A;  3C66 A;  1MG7 A;  4NLU A;  3BKF A;  1FX4 A;  1YWX A;  3DNC A;  3R7B B;  4KQZ A;  4P10 A;  3GZ7 A;  4XK8 C;  3CDA A;  4I0W A;  4ID5 A;  2VOP A;  4WZM A;  2WVF A;  5D8H B;  3PKM A;  4ZN3 A;  4NCG A;  1R27 B;  4A8M P;  3C15 A;  2VFR A;  4ECS A;  4CYU B;  2P2C B;  2CZV C;  4EK2 A;  4F04 B;  3W2V A;  3G6X A;  4IOB A;  5KFV A;  3FRY A;  4F67 A;  4ERD A;  2KFZ A;  3CMQ A;  3OR1 A;  4RW6 A;  1C0T A;  1EB0 A;  1TEL A;  4DMZ A;  3G71 S;  4O3Q A;  4DPX A;  1IBL J;  1VBZ A;  2DYA A;  4CZC A;  1U1N A;  2E1M C;  4USU A;  1JXL A;  1FFG B;  3J7Y U;  2F4F A;  2FHO B;  4DHV A;  2JLF A;  1NJZ A;  1Q81 T;  3K58 A;  3QJL A;  4P75 A;  3CCU S;  5IT9 Y;  4OYA A;  1FD2 A;  5E2Q A;  2UXB F;  4LF9 F;  1IN0 A;  4RNO A;  4NLT A;  4ECR A;  3IRX A;  3MD3 A;  5D4L A;  5ETL A;  1HQU A;  1GX5 A;  3OL7 A;  2IM3 A;  2O66 A;  2KRR A;  1Q8L A;  5DDR C;  1R8B A;  3D2W A;  3DGP A;  3EZO A;  3NS7 B;  3VV2 B;  4WCE Q;  2VON A;  1NB7 A;  4Q45 A;  5KFK A;  2HFS A;  4QWC A;  1T9U A;  1CJV B;  1C0T B;  1RT2 B;  2EFP A;  1QTM A;  1NU4 A;  5LSR A;  2FDN A;  3QZ8 A;  1Q8K A;  1YGY A;  4OZJ A;  4OYI A;  4DPW A;  4MFB B;  2EEY A;  3GSI A;  5AXN A;  3T1H J;  3D6H B;  3AQO A;  3D0I E;  3IGV A;  4KH1 B;  1UEU A;  4V1A k;  4HH0 A;  5B0F A;  1TL4 A;  1UW9 A;  2VPX B;  1QAX A;  2OEM A;  3MPV A;  2BM1 A;  3LP0 B;  1H73 A;  1TKT A;  1G4C A;  4ID5 B;  4ZPV R;  3FEZ A;  2MXY A;  1N5Y B;  1NEE A;  3IBW A;  4C8M A;  2GA7 A;  4PWD A;  1C1B B;  4RW8 B;  4DL6 A;  3QRP A;  2V0N A;  5LXR A;  2FD2 A;  2VIC A;  1FNX H;  3DRP A;  2B51 A;  3V6J A;  1M1H A;  4DFM A;  2DGW A;  4ECW A;  1SQE A;  4X64 J;  3TAN A;  5IQ6 A;  1R8A A;  3MM9 A;  3BSA A;  5IC4 B;  4AXI A;  3KLI A;  2DR5 A;  2LEB A;  3M6U A;  2UUB J;  3H42 A;  4GKK J;  2YNI A;  2QSW A;  1G3O A;  1SUQ A;  3NKY A;  4X4P A;  2XEX A;  5E5N A;  4A8W A;  1KNZ A;  3IG1 A;  1U6F A;  2W4D A;  3W9H A;  2IYI A;  4I68 A;  5DJB A;  1YSJ A;  4ILR A;  4K0K J;  1U0H B;  1WKL A;  3D54 A;  2IC3 B;  2J5A A;  4Y3C A;  5KOW A;  4B08 A;  5B0G A;  5KFW A;  4C0B A;  2YNG B;  4WWS A;  1NO8 A;  2NLW A;  4FXV A;  1GXT A;  3R7S B;  2DIT A;  1OWX A;  4UST A;  3WQP A;  3G6V A;  4DS5 A;  1UWB A;  2ZHA A;  3RBE A;  4C3L A;  3PIP Q;  3HHE A;  4RUC A;  1TFW A;  3BBF A;  3G8Q A;  2F8M A;  1C0U B;  1TR0 A;  4LF4 J;  5HI7 A;  3DLE A;  3MM5 B;  1HNW J;  1ZPW X;  1K9M T;  4NOH A;  1XTZ A;  1Y0H A;  2CPY A;  1OPI A;  2BJ7 A;  2NXN A;  2ILY A;  2MPU A;  3QGG A;  4RL1 A;  4UW2 A;  3KHL A;  4EUV A;  1C4C A;  1JLB A;  4ES3 A;  2ZBI A;  5KFO A;  1NDL A;  2YNF A;  3RB6 A;  4NZ0 A;  5I3P A;  1S7H A;  3DRS A;  4GVB A;  5T7L A;  3KJV A;  3Q22 A;  2DO0 A;  1XNR F;  2V5H G;  2GMJ A;  3AJD A;  3AB2 B;  1OMS A;  2UVV A;  3H90 A;  3SDE A;  2Z2M A;  1JJ2 R;  1UW4 A;  4AUK A;  1KOO A;  1QM9 A;  3G8T A;  3SV4 A;  1R89 A;  1UVN A;  1GK8 A;  1SC6 A;  3EGZ A;  4HAC A;  3OFE A;  1FT8 A;  2J0W A;  1MLA A;  2I2Y A;  4KSE B;  1R6Y A;  2DD8 S;  3EXC X;  2HK2 A;  1S1W A;  3T19 A;  1HLW A;  1DLO B;  1DQ8 A;  2MKY A;  2ZZT A;  3PYG A;  3ZNU A;  5L46 A;  5KFQ A;  5H9E K;  4M63 A;  4MH8 A;  3TR5 A;  1CQN A;  1CQM A;  2FHM A;  3FUY A;  4CLT A;  1HI1 A;  4GKJ F;  3T6B A;  3MCS A;  2MZS A;  5E3C A;  3HFK A;  2RKI B;  3QLH B;  2CAD A;  2DKO B;  4BS2 A;  4OHV A;  2W2M P;  2ASL A;  5KTQ A;  2BAB A;  4RJV A;  1VK3 A;  2V2V A;  4F36 A;  5F8G A;  1WTF A;  2HMI B;  1TL1 B;  4NI2 A;  2JOQ A;  5EDW A;  3SDE B;  2ZFH A;  3TAP A;  2LDY A;  3CJT A;  5KT5 A;  2XO7 A;  1HBN A;  4I6A A;  3GP9 A;  4DV4 F;  4DR5 J;  2IBO A;  2BQU A;  3MM5 A;  1FKA F;  5D3G A;  3O6Q A;  2Y9H A;  2X1G A;  3JSB A;  1KLM A;  2AJ0 A;  2ZJP Q;  1TP7 A;  2YWH A;  3BSC A;  3IM9 A;  4KH0 B;  1TUW A;  2YKN A;  3NWR A;  4DR2 J;  4DR7 J;  1TTH B;  1NJI T;  3M4X A;  2LMI A;  1QLN A;  3EGV A;  4CLZ A;  3OXF A;  5B0D A;  5BYS A;  4ED0 A;  3V4I B;  4FF4 A;  1M5P C;  1VLY A;  2ZVS A;  3CIZ A;  1JNZ B;  3SIP B;  2W2N P;  4Q8F A;  2K7K A;  3LAN A;  1WJ9 A;  3SEO A;  4DV3 F;  3ENV A;  3GJT B;  4Z37 A;  3J81 Y;  1HNI B;  2LEP A;  5CQG A;  2HHU A;  1EAR A;  3M2R A;  4IFV A;  1SB6 A;  4C7Q A;  4YR3 A;  4IRD A;  1P1T A;  2J9E A;  4CCH A;  4KJI A;  1QVF R;  4LF7 J;  1JWW A;  3CNQ P;  2G2Z A;  3H5S A;  4LBH A;  4IQM A;  5HAT A;  4U7C A;  4WFB Q;  2F63 A;  4P2S A;  1RWU A;  1ZM3 A;  3PAC A;  4QQB A;  4DU7 A;  4DPY A;  2BEF A;  3UR3 C;  2F8H A;  3VCD A;  4JV5 J;  2X7I A;  1YRT A;  3OJU A;  2WCX A;  3HSD A;  5AXM A;  2VFS A;  4A48 A;  4LBP A;  5KT6 A;  4KIA A;  4CO4 A;  2W9C A;  3DMJ A;  2R2S A;  2WK4 A;  2HHV A;  1YBT A;  4HLB A;  1WOP A;  4KGZ B;  2BR0 A;  1QAY A;  3MED A;  1U47 A;  3DLG A;  3OTO J;  1FRX A;  1BQX A;  3UWT A;  1Y10 A;  1Q1K A;  1O0P A;  3DI6 B;  4ETX A;  1KWM A;  5KT2 A;  1B3T A;  1Q8B A;  2FQQ B;  5C25 A;  2Q1L A;  2CQI A;  2HQF A;  2RF2 B;  2B4U A;  2B9E A;  5CYQ A;  2JZ5 A;  3QO9 A;  1F9E B;  4Y2K A;  3TJ9 A;  2HAI A;  3PO5 A;  5AE2 A;  3A8J A;  2MKI A;  3B4M A;  4KGX B;  3NNA A;  3JSM A;  1RU1 A;  2D3O 1;  2Z58 B;  1IBC B;  2B7B B;  4M5I A;  5IV3 A;  4I2P A;  4DV1 F;  2B5J B;  4LUB A;  3L7O A;  4WZQ A;  3JB9 k;  1PIE A;  4XPC A;  1M5V C;  3MEG B;  1S6O A;  3EPG A;  3M9N B;  2N4D A;  1G6B A;  1YJR A;  3H5U A;  3IWL A;  4WU3 A;  3MM8 A;  2Y1L B;  2QFJ A;  1XMB A;  4ELT A;  3PW2 A;  4DU8 A;  1YRX A;  2N82 B;  4PUO B;  2O67 A;  3TX0 A;  3VGS A;  5DET A;  5E33 A;  3HJF A;  4RUA A;  3UN3 A;  3DLB A;  4JI6 F;  5H9E J;  1BC6 A;  4PXD A;  4I69 A;  1RTJ B;  4P73 A;  3ZZY A;  3GYG A;  5KFA A;  2YQ1 A;  5J1E B;  4OYB A;  1FTC A;  4QW8 A;  1S97 A;  3Q8S B;  2B6A A;  3CC7 S;  2W9C B;  2YNF B;  5DGB A;  1HQE B;  2MZT A;  2DNR A;  1MMN A;  1W25 A;  3MD1 A;  5EGY A;  4MYU A;  2BOA A;  5HJY A;  1SJ4 P;  4DSL A;  4FVM A;  3RZA A;  2P6S A;  2FZC B;  1RAJ A;  5C42 A;  5E41 A;  4WP8 A;  4BWJ A;  4C6A A;  2DNK A;  1NUE A;  2Q43 A;  3GWC A;  3N5F A;  4ZHR B;  2VG7 B;  1VRT B;  4TQR A;  3UD4 P;  2IMW P;  4UQT A;  3BDE A;  2Z57 B;  4WII A;  1RT4 B;  1ITP A;  3FBF A;  3RG6 A;  4DPU A;  5J1E A;  1BWV A;  4WIQ A;  1TUV A;  4YDX A;  3IGN A;  4AYB D;  1Y3K A;  5IFM A;  3CMA S;  3T1A A;  2O1P A;  3C19 A;  3NOG A;  3UCG A;  3OXG A;  3CED A;  6FDR A;  3DOK A;  4G1Q A;  3HCX A;  2HUR A;  1GTE A;  2DRD A;  3K8V A;  5ETN A;  3SSS A;  5KFJ A;  2FVQ A;  1FNM A;  3GR1 A;  2KI2 A;  2RB7 A;  1B70 B;  3MR5 A;  5L1K A;  4I64 A;  2JLG A;  2LEA A;  2OHD A;  4FP9 A;  2DT9 A;  3E01 A;  2GGP B;  4J91 A;  5IT9 U;  1F3V A;  2W9B A;  1U25 A;  1CC8 A;  1S9G A;  3GB0 A;  1I1G A;  3SFU A;  3PVX A;  1VC6 A;  2KXH A;  2HWT A;  3AA8 A;  1YHQ S;  2CJY B;  3I5A A;  2YVS A;  2YWF A;  2R7Q A;  3P3D A;  4DSK A;  2V4Q A;  1J5E J;  4ER8 A;  4PRF A;  2P5V A;  2HQ3 A;  2ZWO A;  3W65 A;  3P49 B;  3PYD A;  4IR1 A;  1Y5I B;  3F73 A;  2GIR A;  4C8O A;  4J5O A;  2DXF A;  3MCM A;  4A46 A;  2ZM6 J;  2LQJ A;  1YG0 A;  2HVD A;  5EWF A;  3EPI A;  4F4K A;  5FDL B;  3K5N A;  4LQ3 A;  1RAE B;  3G9C A;  2XWX A;  4HTI A;  1JKH A;  1S1X B;  2J9D A;  3A3P B;  3UW1 A;  3UD5 A;  2AYB A;  2J6T A;  2BJ1 A;  2OEK A;  3R1H A;  4OHY A;  3NWG A;  5K9F A;  2W8K A;  1H3D A;  2N3O A;  1URN A;  3QNW B;  5ITH A;  1NJY A;  1NHV A;  3DFE A;  5F8L A;  2RSQ A;  3OTB A;  1NB2 A;  4IG0 B;  1VJW A;  1C2P A;  1RCX B;  1U24 A;  1L5U A;  4CH7 A;  3DLH A;  1HBO B;  2R8K A;  2YX4 A;  2XHC A;  5ETK A;  3TJ8 A;  2C3P A;  2XCA A;  4DFP A;  2A1B A;  2WRM A;  1R0A B;  2KJW A;  1CLF A;  5AJ3 F;  4CRJ A;  2BKN A;  3E2E A;  1RKJ A;  4DN0 A;  3R5D A;  3BZQ A;  2XGQ A;  2C2M B;  2QMU B;  3TYT A;  3NP5 A;  2BXJ A;  4GO7 X;  5DZ6 A;  3H25 A;  5L9X A;  3RB0 A;  3I0S A;  1RT6 B;  2H65 B;  2HGN A;  1AUS L;  1SXL A;  2RIL A;  1OSC A;  3GON A;  4H4M A;  5FII A;  5SUH A;  3T1Y F;  3PX0 A;  1GMW D;  2DNZ A;  3RUB L;  1IM6 A;  2RQ4 A;  2XYH B;  2YH0 A;  3V81 B;  2B4O A;  4LRB A;  3M9M B;  3EGW B;  2VFT A;  3KUE A;  3O44 A;  4K5R A;  4NAS A;  3DOM B;  4K4T A;  2HVH A;  1KFD A;  5HJX A;  2AYM A;  1QVG R;  1HNV B;  3TZX A;  1E6V B;  3IS9 B;  3GG0 A;  3W7B A;  2FPH X;  2E7X A;  4ENO A;  3GYX B;  4QZV B;  5HP1 B;  2F40 A;  2OPR A;  3TW0 A;  4F4X A;  3D4J A;  4LVO P;  1H72 C;  4NRU A;  2AGP A;  2ZIT A;  4KHP J;  1MML A;  2IAJ B;  2M2B A;  1CJK B;  2CZ9 A;  1U2R A;  2RIJ A;  2VL1 A;  2P6T A;  2PGC A;  4YHH F;  3CCE S;  2BE7 D;  3BGO P;  5KFC A;  3QPI A;  1FKP A;  3CW2 C;  1HYS A;  1HNZ J;  3HZE A;  2H54 B;  1WUU A;  1PAE X;  3F44 A;  4NCG B;  4P6Q A;  4DI6 A;  4HHH A;  5T14 A;  1RT3 B;  2E7V A;  5BYR A;  1FNO A;  1YIT S;  4O3S A;  2CIM A;  4I1T A;  2AGO A;  4TY8 A;  1X4G A;  2KT3 A;  3VGV A;  1TKX B;  1D8Y A;  3KNA A;  2ZH4 A;  1VK8 A;  2CXE A;  4JBC A;  5D4O A;  5F8H A;  1OQ3 A;  2Z30 B;  4XTT A;  4XDC A;  3LF0 A;  2H4W B;  2ASD A;  5LL6 d;  1HQE A;  3ENW A;  4I56 A;  4DUY J;  3AOB A;  3TUI C;  1F3F A;  3LA0 A;  1ZAV A;  1SBR A;  3D6F B;  3L4B C;  4CO3 A;  2HIY A;  3KLF A;  1YBU A;  2Z0G A;  1NM2 A;  2OPS B;  2X3G A;  3VR1 A;  4DLE A;  4LIR A;  5J2N A;  2AJQ A;  2CQ1 A;  2JRS A;  1FDA A;  3I31 A;  3SCJ E;  2W01 A;  1YJU A;  4Q44 A;  3UDV A;  3RYL A;  1VCT A;  4QR0 A;  3KWM A;  2GIQ A;  1FA0 A;  4FF2 A;  4ELU A;  1A0O B;  3U02 A;  4NL5 A;  4LBI A;  3B82 A;  4L73 A;  3I55 S;  2GNK A;  4FF3 A;  4C8N A;  1IBM F;  4LF5 J;  4ED1 A;  2OTJ S;  3RAX A;  2V69 A;  1UA0 A;  4FYY B;  1TKZ B;  3W63 A;  4CLK A;  2M7S A;  4G3I A;  4UY8 5;  2YQ0 A;  1X5P A;  1I51 B;  5DQG A;  1AYE A;  1T0T V;  3M8Z A;  3KLF B;  5A8K B;  4U6P A;  3JSY A;  3A12 A;  3C6T A;  3OT9 A;  3QT6 A;  4GVL A;  4USW A;  2DH7 A;  1J27 A;  4NZ7 A;  4A4J A;  3GIK A;  2MZJ A;  3FDS A;  4B3O A;  1L3T A;  4MIW A;  2KG1 A;  2DVI A;  3FSY A;  2CPE A;  7FDR A;  3EYZ A;  3GFZ A;  1UVI A;  3IR6 B;  2MQO A;  5GAD I;  3BKT A;  4C11 A;  4ZCI A;  1DTQ B;  4I4B A;  5KFL A;  4WU2 A;  2PE8 A;  1FD8 A;  2MY7 A;  2ZBR A;  3MM9 B;  2CPX A;  2V9W A;  1RAA B;  1FI4 A;  3H2U B;  3GFX A;  2UXB J;  5F8J A;  3D0H E;  4J90 A;  3W62 A;  2CG8 A;  1WHV A;  2DHS A;  3M1V B;  2DNG A;  1EZZ B;  1S1X A;  5GMD A;  1YQH A;  2W4C A;  4ZPB A;  5BYQ A;  4R0J A;  4CT8 A;  3C3L A;  3GLJ A;  4IG3 A;  1GFW B;  2LA6 A;  2N7Y A;  5LJ5 Y;  4DR1 J;  2K2P A;  3BO3 A;  3LUY A;  3JTO A;  1TMM A;  2DH9 A;  3PJX A;  3TEH B;  1NBE B;  1LWC B;  2FHJ D;  2HGM A;  2BKO A;  2FIU A;  2XZT B;  4KFB B;  4OJG A;  3ZNJ 1;  4WKY A;  3HLU A;  2JEJ A;  3H20 A;  5KFM A;  4NLV A;  1GMV A;  2YY3 A;  1EHW A;  1R0B G;  2CQC A;  3ILO A;  4PQU B;  1UVK A;  4F7V A;  4OL8 A;  2AX0 A;  3K5L A;  3TA1 A;  5IM0 A;  4DG1 B;  2XS7 A;  3QWP A;  3NEK A;  3OSP A;  2FJV A;  4NA2 A;  5A8W A;  4ALZ A;  3EZ5 A;  2YKM A;  2J8S A;  1Z2Z A;  2LA4 A;  2I1R A;  3HHL C;  1RHJ B;  2A0F B;  1VQ8 S;  2D9O A;  1NJX A;  1REV A;  3V81 A;  2W7A A;  2BW7 A;  3FC9 A;  1M5H A;  2ABY A;  2L48 A;  4KO0 A;  2BMB A;  2V2Q A;  1QUV A;  3ZZP A;  2ZDP A;  4CI0 B;  1KFS A;  2KFN A;  1IKX A;  3KKF A;  1BQM B;  4ED2 A;  4DFJ A;  2VF3 A;  3TUJ C;  4RU2 A;  5LMU J;  5KG5 A;  4JI0 J;  1R3N A;  2ATL A;  4DN9 A;  2XMU A;  3OR1 B;  2DO4 A;  4MKB A;  1RGV A;  4RW6 B;  4CLU A;  4YR2 A;  1LNQ A;  1HIY A;  4GKK F;  2PII A;  4WFN Q;  3FJ2 A;  5DG7 A;  3CD6 S;  4KV8 A;  1N8R T;  1K0T A;  2WON A;  3HFZ B;  4WFX A;  4NLY A;  2EK6 A;  1VIX A;  2C2D A;  2UVU A;  5DG9 A;  2KRB A;  3MUV P;  1HWL A;  2HNY B;  4X4Q A;  4ZIW A;  1F2G A;  5KFR A;  1CJV A;  1RT2 A;  2HK3 A;  2OSR A;  1REG X;  2C1E B;  1RB0 A;  4NI2 B;  4QIF A;  4NCA A;  5HMY A;  4R8U B;  1N0U A;  1WEX A;  1JJ4 A;  1APS A;  2W24 A;  2A2D A;  2OD4 A;  4KGM A;  5BXI A;  1P27 B;  4PQU A;  1FER A;  3PM9 A;  1N5S A;  2FLN A;  2QGF B;  3GJQ B;  2FVC A;  4N7T A;  2C3M A;  3GU0 A;  4OFZ A;  1RYR A;  4A8K A;  2DR8 A;  2EI5 A;  1PSD A;  2AX1 A;  3MPY A;  5C7P A;  4DCJ B;  2CQD A;  5KT3 A;  1OYE A;  1C1B A;  1Y5L B;  3BKU A;  3CCT A;  3CJ8 A;  4RW8 A;  1B7F A;  3UN5 A;  2HNY A;  1KON A;  2QA1 A;  5JVH Q;  4HDG A;  1N5Y A;  3IMQ J;  1K8A T;  4DFK A;  1HWU A;  2CQP A;  2NQP A;  1IKX B;  3DKD A;  3TVZ A;  1WTB A;  3BR9 A;  4LF8 F;  3RBX A;  1LEO A;  3BYP A;  2K3I A;  2OEL A;  4PQA A;  4WTO B;  4LF8 J;  3KOA A;  3PFO A;  4UF4 A;  2IVY A;  2H1Y A;  1Q7L B;  3GYN A;  1D0E A;  2RU9 A;  2R42 A;  1EET A;  2H4Y B;  2AQ4 A;  2CG4 A;  2DNY A;  4U9R A;  2KTQ A;  1U0H A;  2OMO A;  3N6N A;  3ITH B;  3M30 A;  3VGU A;  4EEY A;  2AWZ A;  3FCV A;  1K44 A;  2YNH A;  3UR0 A;  2OTL S;  2ZH5 A;  1SUQ B;  1YJ9 S;  3MZI A;  4KTQ A;  3KLV A;  1TFY A;  2CUY A;  4TY9 A;  4CH0 S;  2ZHB A;  4C3K A;  1Q79 A;  4EI2 A;  5A0Y A;  3EDQ B;  4HT7 A;  4U95 A;  1X9W A;  3QBC A;  3BN7 A;  4DR5 F;  1Q82 T;  1D9D A;  5HVF A;  1S6Q B;  1RTZ A;  1O8B A;  2B43 A;  4KGV B;  2CJQ A;  3HM9 A;  1RAI B;  3KLG B;  2AP6 A;  2G13 A;  4MJK A;  3HXM A;  4ZPC A;  1RZM A;  4W98 A;  3PV8 A;  2YH1 A;  3IG1 B;  3HHL B;  4ZVF A;  2ROE A;  4FPI A;  2F9J A;  4LVN P;  1T7P A;  3QAT A;  4IKA A;  3V5R A;  2XMA A;  1NKB A;  2AEM A;  2DCL A;  3H2V E;  2CJX B;  4LSN A;  2EBE A;  1KVI A;  1N5Q A;  4Y2C A;  3MAQ A;  2XY5 A;  1VQS A;  3GTY X;  2HQI A;  3IAM 9;  1XNQ J;  1WF0 A;  3O2I A;  5J2M B;  1ZTT A;  1Y3J A;  4TU9 A;  4RNN A;  2A2C A;  3P4U B;  3K57 A;  1SJ1 A;  5MLC V;  2Z2Y B;  3GJS B;  1CG2 A;  3N79 A;  4OIX A;  2PI5 A;  3QO9 B;  1Q78 A;  2HFO A;  2L08 A;  3K7R A;  4NXN J;  4OZ0 A;  2AW0 A;  4JOU A;  2FB0 A;  3TAM B;  3HUL A;  2QYC A;  1F60 B;  5B0E A;  3ISN C;  2DCU B;  2XMK A;  3UVJ A;  4F3M A;  4DR2 F;  1SIZ A;  4DR7 F;  1IQT A;  4WP3 A;  1XIQ A;  1S0V A;  4YOE A;  1GMW A;  1LFP A;  1HR0 F;  1JLA A;  3UCZ P;  1O6X A;  4D3G A;  4F2R A;  4PWD B;  4LFC F;  2IBK A;  2JSX A;  4EZ9 A;  2J0S D;  1SIW B;  2CPH A;  3KLH B;  3JTN A;  4DOZ A;  4B3S J;  4PG8 A;  4JI4 F;  4NLO A;  1NND A;  2GQC A;  2Y3Y A;  4TN2 A;  4DPO A;  2E29 A;  5JVG Q;  1KN6 A;  1L3K A;  4ZVQ B;  2OAU A;  3BO4 A;  1VRQ C;  3M2V B;  3QGP A;  5EWE A;  3VGT A;  1SC1 B;  1RT4 A;  2RDD A;  1WD6 A;  1FKO B;  3I32 A;  1DBD A;  3HMJ G;  4ECZ A;  1IWA A;  4I7F B;  1VI7 A;  2EK1 A;  3Q83 A;  4LQ9 A;  2NXJ A;  5CAA A;  1H2V Z;  4YP3 A;  3J81 U;  1Q7Y T;  1WG4 A;  1XK8 A;  1FJG F;  2OI2 A;  1OSD A;  1FJG J;  2BKP A;  3OD2 A;  1LQ9 A;  4EGL A;  2HHT A;  3KJQ B;  4AE5 A;  1UEV A;  4IDK A;  5F8M A;  4ZVT B;  3JQK A;  2C2E A;  1R8P A;  2GGP A;  3IR7 B;  2F3J A;  1Q4R A;  3OFH A;  2XTJ P;  2KXN B;  1FFW B;  2Z4P A;  1RAG B;  2GS8 A;  1S9E B;  3M8Y A;  3PRV A;  4JV0 A;  3FGV A;  1TK0 A;  2RE1 A;  2UVW A;  1V5V A;  3MCO A;  4C8Y A;  3QJJ A;  2MKJ A;  1BWE A;  3QIP B;  4KBI A;  2KH9 A;  1FXL A;  2P9E A;  4P2F A;  2NXE A;  2QG9 B;  3HSJ A;  4DV0 J;  4QR1 A;  3NMR A;  4I2Q B;  5HN0 A;  1LV5 A;  3ZZT A;  2HKE A;  1T9V A;  1UJ4 A;  3KDN A;  2ZUA A;  3T6J A;  4QBU A;  1U0S A;  3AOA A;  4RUH A;  5DDP C;  2ASJ A;  1N5V A;  1RBO B;  3R5G A;  3WHI A;  4USM A;  1S6P A;  5B09 A;  3TAR A;  2QO3 A;  4KE5 A;  2FZG B;  4NLX A;  2DK2 A;  1B7Y B;  1GX6 A;  4O3R A;  4K4U A;  2KVQ E;  2V68 A;  3JSM B;  1FKO A;  4OI4 A;  1S4E A;  1CPZ A;  4EYH B;  2HNZ A;  2I5J B;  2VUG A;  3GE9 A;  3CGI A;  5CYQ B;  4N8O A;  1M1G A;  3ILL A;  2DEJ A;  3SCK E;  2ZJR Q;  2R7V A;  3HVT B;  3OBI A;  2YPY A;  4HI2 A;  1HA1 A;  3AJ2 A;  5I3U A;  3PKY A;  2PD1 A;  1EJ7 L;  1DQA A;  1TZ0 A;  3A8I A;  4I2P B;  4LR9 A;  5A2Q Y;  1R8C A;  3QT7 A;  1S10 A;  1JXE A;  3RW7 A;  4EFA C;  3DRR A;  1ZH5 A;  1JLF A;  9RUB A;  4NYO A;  5CYM A;  5AE3 A;  1X4F A;  4QPT A;  3SYZ A;  4AND A;  3MUT P;  3MOJ B;  3OQ2 A;  4WK3 A;  1R31 A;  4NLS A;  2HW3 A;  3G86 A;  4F50 A;  3MMC A;  1QUP A;  2E5L J;  1N4L A;  1PYS B;  3EMT A;  3MTJ A;  1QTN B;  4Q43 A;  3CSK A;  2G1H A;  1HBO A;  4F3Q A;  5KG1 A;  5LXY A;  3NAH A;  1QSY A;  1U49 A;  3MUR P;  2UU9 F;  1P9Q C;  1FF2 A;  2KZZ A;  1M1K T;  1X0F A;  4ID8 A;  5IV4 A;  1N52 B;  3UPF A;  2RU3 A;  1RTI A;  3TQ1 A;  4OJH A;  3RRH A;  3MM7 B;  3HI9 A;  3UQS A;  3W5X A;  3UFC X;  2B7C B;  2PC6 A;  2NS1 B;  3AD8 C;  3CCV S;  5K8M A;  2A10 A;  2QFI A;  3B4D A;  2Q3P A;  3HKZ D;  3NOC A;  2FY8 A;  2NZC A;  3DOM A;  1B0V A;  3TJA A;  1QDU B;  4NXM F;  2R2R A;  5CD4 A;  4LFB J;  2ZOM A;  4EO8 A;  2VPW B;  3CJ0 A;  3SBM A;  4ZK7 M;  4TY8 B;  2GHP A;  1TKX A;  4ECX A;  3AQP A;  5LSL A;  2B0G A;  4JI7 J;  5ETP A;  2MZQ A;  3OVB A;  2CYY A;  3VQS A;  2RRA A;  1KKH A;  3D1Q A;  3DMJ B;  3M8Q B;  2XCP A;  3GIM A;  3ICL A;  1FRK A;  2OPQ B;  2W9B B;  3UO0 A;  1TV6 B;  4CO5 A;  1YVF A;  2XS2 A;  2K8G A;  2GC8 A;  1RAD B;  3OFF A;  1Y11 A;  4RZR A;  3RRG A;  1PC4 A;  1IKW A;  3DOL B;  4OLP A;  3MXH P;  1I3O B;  1HW8 A;  2BRK A;  2GVD A;  4M8L A;  5DLF A;  5I42 B;  4N76 A;  5CA5 A;  1NH8 A;  1RHK B;  2I6W A;  5IS2 A;  4DL3 A;  1P8G A;  3P45 B;  1S49 A;  1WOS A;  1SPB P;  3GV7 B;  3KTQ A;  1RT1 B;  2H51 B;  3PCO B;  3TX8 A;  3TQE A;  2N3L A;  1H98 A;  2ZHO A;  4ZVU B;  3TA2 A;  2RNE A;  1VQP S;  4DSF A;  4PYD A;  4ZS6 A;  2VHG A;  2P9G A;  3OPK A;  2RT3 A;  4RLE A;  4X84 A;  3T9Z A;  1RWV B;  3QYY A;  4ANC A;  1ZZF A;  3MAA A;  3MTK A;  4RW9 B;  2HVZ A;  5CYJ A;  4ECV A;  1HNZ F;  3K59 A;  3SFG A;  1N34 J;  2JH3 A;  4PUO A;  1FTR A;  2PEH A;  2HWH A;  3HHL D;  3Q8Q B;  4JV1 A;  1I94 F;  5I42 A;  3Q2S C;  4O3O A;  2KYX A;  2HBR B;  1LK7 A;  2EWH A;  5CZV A;  2HRY A;  4IH5 A;  1FXR A;  4OZL A;  4RO0 A;  1Q86 T;  4DUZ J;  4C11 B;  1W26 A;  5JXS A;  4YME A;  5E0O A;  5FDL A;  4IG0 A;  1QSL A;  2QRR A;  3M8Q A;  4ATN A;  3BQ2 A;  2LDI A;  2ZE2 A;  1PCA A;  3MGJ A;  1CS4 A;  2EVZ A;  2LU1 A;  3K89 A;  4DL7 A;  2HVI A;  3E3X A;  2FJE B;  4EMD A;  4OHZ A;  3KK2 A;  2OPP B;  1WF1 A;  1MNE A;  3MCN A;  1HNX J;  2HHX A;  2FTR A;  1VC0 A;  4ED8 A;  2HPU A;  3ETM A;  4TXS A;  3DLJ A;  4UOC A;  2R7W A;  1SV5 B;  4F25 A;  3T5H A;  5FJ4 A;  3ZTP A;  2PDA A;  4AT1 B;  1XWL A;  3BGL A;  3FBB A;  1MRO A;  2CZ4 A;  1TAQ A;  5DG8 A;  3DOK B;  4UUW A;  2GZO A;  4P2X A;  3H7H B;  2HZC A;  4BHQ A;  4AQY J;  2V63 A;  3JTP A;  3R2C J;  1Q16 B;  2FLL A;  2CJB A;  4UZC A;  2MJU A;  2KL8 A;  4KKO B;  4AQY F;  1HQ2 A;  2C3Y A;  2DGX A;  3Q89 A;  2HFV A;  4ZOS A;  1ZOT A;  2FJB B;  1CJK A;  4IG3 B;  4G1I A;  3CCR S;  3D7S B;  1OIA A;  1P6T A;  2BVZ A;  4K4X A;  2FHJ A;  3BJY A;  2EFQ A;  3ENQ A;  3TUP A;  5EX3 A;  3TI0 A;  3JAM U;  4Y2A A;  3PYE A;  4Y65 A;  3H5Y A;  2NR0 A;  2Z2L A;  2AKW B;  3D28 A;  4HHU A;  5L1J A;  1WEL A;  1HD1 A;  4N5S A;  4JYA J;  2YTC A;  3FFI B;  5DM6 Q;  4Q8E A;  3H5X A;  1X4C A;  2UV8 G;  2ZJQ Q;  2ZKU A;  2DHH A;  1H7W A;  3MUM P;  3MPU B;  4YDD B;  2KM8 B;  4Y0F A;  1VBX A;  2B9W A;  2CVE A;  4QIV A;  2MGZ B;  3KK2 B;  2X1A A;  1SKR A;  3NMA A;  4DSJ A;  1NME B;  2VOO A;  5EWG A;  1P1L A;  2R9L A;  4C48 A;  1S6U A;  4UT4 A;  2YXL A;  4KHR A;  2OD6 A;  4HI1 A;  4OQJ A;  1G1X A;  1CC7 A;  4EWT A;  4QYZ K;  2BJ3 A;  1N33 F;  2Q6B A;  3R7N B;  3R6G B;  3BH6 B;  1H0H B;  3G8S A;  2B56 A;  2L41 A;  2IM2 A;  4OHW A;  4F0M A;  1NSQ A;  2CQ4 A;  4NEZ A;  1ICE B;  1MWZ A;  2E9T A;  1XMO F;  2LVW A;  1IJF B;  2RS2 A;  4QOT A;  4ANE A;  1VQ4 S;  1JLG A;  3PR5 B;  2P8I A;  3G82 A;  4CTA B;  4OI6 A;  4UOG A;  4DL2 A;  3OSN A;  2J76 E;  4H4M B;  4K59 A;  4X4U A;  3J7Z 5;  4Y2M A;  1F9H A;  1S7I A;  2HRT A;  3W5Y A;  2QN6 B;  5A8K A;  2BZ2 A;  5A6P A;  2HFZ A;  1PJ5 A;  3FBE A;  3L7P A;  3POT B;  2NSC A;  4JI1 J;  2OGU A;  4ZVO B;  4U8Y A;  1DTQ A;  3TUZ C;  1N36 F;  2D74 B;  4USV A;  1LW2 A;  2PMH A;  4P7T A;  1BQN B;  2NCK L;  4A47 A;  3KLE B;  3DDK A;  5LMU F;  4N8N A;  3WX4 A;  2M3D A;  4F2S A;  1M5K C;  3FFI A;  3DHW C;  2CVI A;  1GH8 A;  2AZ3 A;  2BJ8 A;  3NGD A;  1X4A A;  2CWK A;  4K7Q A;  1VRU B;  4RW4 A;  3SCL E;  4HKQ A;  5KG0 A;  1VFJ A;  5M2P A;  3HVR A;  1OY8 A;  1HQU B;  4PYA A;  1RBA A;  3ELH A;  2VC0 A;  1AUD A;  2VBY A;  1N54 B;  5KG7 A;  2JC0 A;  1TUG B;  2VV5 A;  1RI7 A;  4ZCK A;  1FKP B;  1HYS B;  4OX7 A;  3OXL A;  1OY9 A;  4RNH A;  3MPW A;  2ILZ A;  3DDI A;  3FK4 A;  4CLS A;  1ZET A;  2HHS A;  2MLZ A;  1WC0 A;  3I87 A;  4MK7 A;  3CJ3 A;  1EP4 B;  2VG6 B;  1VIS A;  1WC6 A;  2W2Q P;  2ZKT A;  1SH2 A;  2BE2 B;  1VRU A;  4TLR A;  2GIF A;  4B9L A;  1U2C A;  3PDN A;  3D0G E;  5HAN A;  1RAO A;  3G82 B;  1WKJ A;  3KUG A;  3V2U C;  4LRC A;  3MAH A;  1U6Z A;  3A3N B;  3CUN A;  1WI6 A;  2KYZ A;  3OHB A;  2D3U A;  2GVZ B;  4DCP B;  1AA1 B;  3QLH A;  5AXK A;  2QLJ B;  1U26 A;  1DUR A;  4CLP A;  3FKB A;  1V3S A;  2K7J A;  3HJV A;  4EBC A;  2ACY A;  4DQI A;  4WKR A;  2F7V A;  2RDI A;  2Y0B B;  3Q8Y A;  1RWW B;  4IO1 A;  1Q95 G;  2DB1 A;  3RAM A;  4MKY A;  2U1A A;  2X51 A;  2JWN A;  4LSL B;  3PTW A;  2XNR A;  2V6A A;  4BBY A;  3LWM A;  4NEY A;  4J7C A;  1BE4 A;  2IA6 A;  4W90 B;  2H9Z A;  2BA9 A;  3KNG A;  4AXJ A;  1YJV A;  2VDI A;  3LP0 A;  3NAI A;  3A8E A;  3SSR A;  3KK1 A;  4DZ6 A;  1TL3 B;  4C98 A;  2XY6 A;  4NLP A;  1HBU A;  2WON B;  2DIU A;  2PMW A;  2QSF A;  4PCQ A;  3TAM A;  4CH1 A;  4QIW D;  4R5P A;  2E9Z A;  1WG1 A;  2NRE A;  1K47 A;  2UUW A;  3AD9 C;  4AFF A;  1L3V A;  1T8E A;  2BUN A;  2PN6 A;  2D69 A;  4FYD A;  1Y9O A;  2XZD B;  1LWX A;  2YKO A;  3LW5 C;  4V19 J;  3LP2 A;  3TVK A;  3MR7 A;  1MU2 A;  4XO0 A;  3AAW B;  4M5H A;  1RWP B;  2EFV A;  2QLW A;  3I9V 9;  3FMW A;  4FPR A;  5BJR A;  1J5O B;  3I4P A;  2Q79 A;  3G87 A;  4MK9 A;  3C8Y A;  5K8O A;  4R8U A;  1U4B A;  5DQI A;  4K2X A;  3VAF A;  2M70 A;  2HAF A;  2CWX A;  3BO2 A;  4OHX A;  1ROF A;  3NY0 A;  4UOF A;  2LKZ A;  2CPZ A;  3KMQ A;  2N7C A;  3UN2 A;  3IN5 A;  3DC2 A;  3CME S;  1RT7 B;  1UTA A;  3GSD A;  1X60 A;  2DNL A;  1YX2 A;  2YKA A;  4I7F A;  1MMD A;  2UXD J;  4ZMM A;  5HLF A;  4ZN1 A;  3CJS A;  3DLG B;  4EU0 A;  4DV6 J;  1XNQ F;  3J7A 1;  4UUX A;  5EN1 A;  3BB5 A;  3M2R B;  2IRY A;  4IFV B;  4DV6 F;  1DLO A;  1T05 A;  2XMM A;  4QCL A;  3CWJ A;  5B0C A;  2KM8 C;  3QSY B;  4URS A;  1RSC A;  1FRJ A;  3OR2 B;  4ZPW R;  1YBA A;  3FQK A;  3K5O A;  2M5Y A;  2VQE J;  4ZP6 A;  4FNI A;  2CDQ A;  1KQK A;  1NLK L;  4OYW A;  2CNO B;  1RT7 A;  2RQC A;  3OL8 A;  3QT8 A;  1EET B;  2XB2 D;  1RWX B;  3EE3 A;  1SKU B;  4NE9 C;  4EYI B;  3HO1 A;  2F5G A;  4X2B A;  4EBE A;  2PA3 A;  1JLQ A;  1EQ0 A;  4OV1 A;  1MN9 A;  3CT9 A;  4HVZ A;  3IO1 A;  1GNK A;  3PG9 A;  2W4P A;  3AJ1 A;  5D3G B;  3DRP B;  2AT1 B;  2RJZ A;  3EJM A;  1SQG A;  1D9F A;  5L1I A;  4HHJ A;  2KN4 A;  2OFH X;  2QL5 B;  3CTR A;  1K0V A;  1RHR B;  3ZXW A;  4NXN F;  2F65 A;  2GCF A;  3ET6 A;  4IRC A;  2MYF A;  4DL0 C;  1JLC B;  2OLW A;  3NGS A;  2IM1 A;  3U1N A;  1WOR A;  1HBM B;  4WE1 B;  3W8P A;  3O5T B;  5LT5 A;  2NYH A;  4N41 A;  3JSR A;  2IC3 A;  1KVJ A;  1JLQ B;  2ZH9 A;  3ILI A;  4HTJ A;  2Y8W A;  3JYT B;  1FJE B;  4TU8 A;  3NBP B;  4ZP8 A;  3OHA A;  4DDF A;  1G7C B;  3CVK A;  2BAC A;  4B3S F;  2NXU A;  1Q8I A;  4GRS A;  3HP6 A;  4F4W A;  1SVD A;  4J9N A;  4DV5 J;  3RBD A;  4FBU A;  4RBV A;  2M52 A;  1HNI A;  3CJQ A;  5BR8 J;  4CO1 A;  5IQQ A;  3DGV A;  2LQ5 A;  3UVJ B;  1U1P A;  2KXF A;  1WAC A;  2KDO A;  3Q8P B;  3CUL A;  2DNO A;  3PX4 A;  1HI0 P;  1HBM A;  5GAH U;  2HQD A;  2JDJ A;  2KKH A;  2YX1 A;  5GAH I;  2DTJ A;  1OY6 A;  3M8S A;  4J9S A;  2XQC A;  3CCZ A;  3D68 A;  2E1R A;  2WSC C;  3EUN A;  2FHK A;  2GAG C;  3H98 A;  3KFW X;  3BYR A;  3ZTS A;  3FCH A;  3M9O B;  5C25 B;  4X4O A;  1X5O A;  5D78 A;  2M8H A;  1VQ7 S;  1TK5 A;  2XMT A;  3MED B;  2O3D A;  3H2L A;  2LYV A;  3M2V A;  3THV A;  2PFF B;  1U48 A;  2J6S A;  3GCX P;  4ZPT R;  4JI6 J;  1S1W B;  4PPD A;  2MZ1 A;  1YDL A;  1HHQ A;  2JLE A;  4G6V B;  1FXD A;  5K14 A;  1Z4U A;  1ZM9 A;  1D9A A;  5E7O B;  3TA0 A;  4C2M A;  4A8Q A;  4ED3 A;  1CJU A;  3FSX A;  4ZVH A;  2B9Y A;  3M6W A;  4ELV A;  1H7X A;  2QTW A;  1HWI A;  1R6V A;  2J9D E;  2RRN A;  3Q86 A;  4Y6I A;  2G4B A;  4RNF A;  4DV3 J;  2XHW A;  2YWE A;  4NML A;  1JXV A;  1FK9 A;  4YUD A;  2RHS B;  3HHN B;  6FD1 A;  5KFT A;  3I9Z A;  2NUH A;  2MKS A;  2AF6 A;  3VZH A;  3OVS A;  4HAC B;  3RAQ A;  2XSJ B;  4XDD A;  4J9Q A;  2DGV A;  1NHK L;  4NLG A;  3KDO A;  3W64 A;  2L9W A;  4USH A;  2DNN A;  5K14 B;  2AJ1 A;  4X62 F;  1FWP A;  1BMQ B;  5LJ3 Y;  3W2W B;  1YJW S;  2E5L F;  4JV5 F;  3JQM A;  1X0P A;  5L38 A;  2RHQ B;  4I2Q A;  1N0V C;  3W9J A;  5IZH A;  3BSN A;  2VH7 A;  3NS5 A;  4DQS A;  4FN5 A;  3PEJ A;  2ZH3 A;  2MLY A;  3HD1 A;  4O0I A;  3HD2 A;  3OFG A;  1KP6 A;  5C42 B;  5IWA F;  3C16 A;  3ZC4 A;  4X4S A;  3H4D A;  1RKI A;  3UD3 P;  4G1P A;  4DF8 A;  3ZZU A;  2LCW A;  3VWS A;  4DR6 J;  4ZVS B;  1KS2 A;  3ZTO A;  2HHQ A;  1A6L A;  1FO1 A;  4RW7 B;  4PG7 A;  4USI A;  4ES1 A;  3CD7 A;  5A8R B;  3OVA A;  3GFH A;  3F0N A;  1FRI A;  5KG4 A;  3OUY A;  1SL0 A;  4BDP A;  4LFB F;  2VG7 A;  3BBC A;  3GIR A;  3OR2 A;  3NS6 A;  3QGI A;  1MWY A;  3K8W A;  2EC2 A;  3CJK B;  4DBQ A;  1E6Y A;  1FRH A;  3PJ9 A;  1Z2L A;  1QY7 A;  5I3U B;  3QMQ A;  2UXC F;  1ZTW A;  4B9M A;  2HNZ B;  2DNM A;  2I5J A;  1Q5V A;  1Q53 A;  5HBM A;  3TRG A;  1T03 B;  3WIV A;  2OIH A;  2DGT A;  3BGR B;  1SJQ A;  5LMN F;  3EVM A;  2ZBQ A;  2FVP A;  5CHC B;  3HF5 A;  1F6T A;  2ZBC A;  5M2U A;  3C6U B;  3NGK A;  1FEE A;  1NK8 A;  4B3M J;  1T9W A;  3HVW A;  1NKC A;  1DTT A;  3VVT A;  1H6K X;  3S1T A;  4RX6 A;  3HK2 A;  1AFJ A;  4OI2 A;  1A9N B;  5B7W A;  2VA3 A;  2BYC A;  2CQH A;  3IP0 A;  5C24 B;  3ET6 B;  4QYZ J;  5H9F K;  1N32 F;  1X4B A;  3D66 A;  3NCP A;  1WI8 A;  4F26 A;  1UFK A;  5KFX A;  1HW9 A;  3NG8 A;  1BD6 A;  3FVY A;  4QIG A;  1VGY A;  3FRZ A;  5RUB A;  2J7K A;  1UPP A;  3IAS 9;  3T41 A;  3P6Y C;  4NX9 A;  3LO3 A;  3ZZ0 A;  3RTV A;  3N4W A;  4WP9 A;  1HPZ B;  4IDK B;  4JI2 F;  1RLD A;  2F9D A;  2XM3 A;  1N6Q A;  2D41 A;  3EM1 A;  3BV8 A;  4WTY A;  1S99 A;  1UEK A;  2OJ3 A;  4DWI A;  1OS5 A;  1I94 J;  2JEF A;  2YX7 A;  3IC1 A;  3QFH A;  4MMO A;  1TK8 A;  1RTJ A;  4B3T J;  3I5B A;  3HT3 A;  2WHO A;  4YN3 B;  3GIJ A;  1VQK S;  1S12 A;  2C2N A;  3ISN D;  5KOX A;  3GV8 B;  3BQ1 A;  4F3O A;  3BF4 A;  4WXO A;  3J80 Y;  4TKT A;  1MRO B;  2JJ4 D;  3W9I A;  1T3N A;  3GIL A;  4A8O A;  3ILJ A;  2LQ8 A;  4GC7 A;  2FJA B;  1JJC B;  3IA0 A;  2HG4 A;  3FQL A;  1S5Z A;  3QZ7 A;  5KT7 A;  5A76 A;  2VKR A;  4WJB A;  2COL A;  3KJF B;  5E3A A;  1RJJ A;  4IFY B;  1NSK L;  1VHF A;  2R3V A;  1Q5Y A;  3QAU A;  4L76 A;  3PY8 A;  1CUL B;  4JI5 J;  4ZLP A;  2R8J A;  1U09 A;  1DRZ A;  1IKV B;  1V6H A;  4FS2 A;  3D3B J;  3DRX A;  3W2V B;  4B3R J;  4I6Y A;  5F0W A;  3QID A;  5KFZ A;  2W9A A;  2HND B;  3J80 U;  2XBP A;  3AOC A;  3GV5 B;  5CXT A;  1FJC A;  4O4G B;  4CIO A;  1NK9 A;  4YFU A;  3HVT A;  1SC3 B;  2ZM6 F;  2E1C A;  3D9B A;  2VBW A;  4OZ5 A;  5CAB A;  2AYE A;  3RB3 A;  1TL7 A;  3R1L A;  4WPA A;  2RQK A;  2J9C A;  2V34 A;  1RP5 A;  3GFY A;  2EFN A;  3DRR B;  4D3H A;  5HMZ A;  4Q0B A;  1UJ6 A;  4BC9 A;  2KG0 A;  2IAJ A;  4LF6 F;  3MI7 X;  2GO9 A;  3OLB A;  4IR9 A;  3EVW A;  2ZD1 A;  2DGO A;  2XSJ A;  2PFD A;  3MDF A;  2R7S A;  2VJU A;  2X3D A;  2XO6 A;  3DN9 A;  1S9F A;  3KG0 A;  3TZW A;  2Z8Q A;  4ZP9 A;  1ZYQ A;  4OI1 A;  5IT4 A;  1ZZN A;  4GC6 A;  4LSZ B;  4ZJQ A;  1NDC A;  5HMW A;  1RHU B;  4PXC A;  1XMQ J;  1UFL A;  3D6M B;  4MYT A;  1L3S A;  4JI7 F;  3QRR A;  2VJV A;  4LMZ A;  2CQG A;  2CNL B;  2HZV A;  1ZA1 B;  4C9D A;  3CJ5 A;  3F56 A;  3BGF A;  4OX6 A;  4IFY A;  3EWG A;  1VIO A;  3M7V A;  3LH2 S;  3MFH A;  4I67 A;  1FVS A;  1U1M A;  1RT3 A;  3MEE A;  3THP A;  2W7O A;  5DM7 Q;  4NRT A;  2ROG A;  1GT8 A;  3ZFV A;  4YY3 F;  2HIQ A;  2MSS A;  3BN4 A;  1URR A;  1RAH B;  3K2Y A;  5D77 A;  1S0M A;  1SH0 A;  2OML A;  3QGH A;  2K1R A;  4W4M A;  3SZ2 A;  4AL5 A;  2B8Q A;  4Y2I A;  2LQB A;  4M5D A;  4CLL A;  4Z2X A;  3QJP A;  5F0U A;  1N33 J;  3FBC A;  4GMK A;  4HYK A;  4RUB A;  4JYA F;  3GJR B;  2YNI B;  1S1T A;  2IJN A;  2XY7 A;  4RW4 B;  2BW2 A;  5EHH A;  4Q0B B;  4YB6 A;  2ALY B;  1IBK J;  1WHY A;  2M8D B;  2GVZ A;  3C6U A;  3W5Z A;  1N36 J;  3B6B A;  2GO8 A;  4Y00 A;  2YWK A;  3D1O A;  4ES2 A;  3HFV A;  3MHY A;  4X4T A;  1M5O C;  3LQV A;  2JHE A;  2K1R B;  3RRK A;  4H4O B;  4UY8 T;  2XG8 A;  1WNE A;  4CQ1 A;  2ZDO A;  3H4B A;  3M05 A;  2QE5 A;  5B0B A;  5C24 A;  1RWM B;  1LWF A;  1JB0 C;  1F5A A;  3ETO A;  3IS9 A;  3LP1 B;  2DR7 A;  4ZPD A;  3G2X A;  3H8Y A;  3E8O A;  3O1L A;  4YR0 A;  2C2O B;  3K5M A;  1XMO J;  3PYF A;  1AZS A;  1DQ9 A;  5K8N A;  1LFW A;  3AXK A;  4ILM A;  1X5S A;  1HBU B;  3DXS X;  4U7U K;  4OLO A;  4K4S A;  3MEK A;  3DM2 B;  3CCS S;  4FXW A;  3DLK A;  5HQ8 A;  1J2V A;  4IUF A;  2RD5 C;  2HEK A;  2W1B A;  3H59 A;  4H4O A;  4ICL B;  4KB7 A;  4N77 A;  3DRY A;  5THW A;  3AB4 B;  1PYO B;  3Q2T C;  3MM6 B;  2YQ3 A;  1RHM B;  1J5O A;  1PJ7 A;  2UUC J;  3CIM A;  2A6O A;  3M1V A;  5EX0 A;  2XLK A;  4WFA Q;  2E5J A;  2AJF E;  2FJD B;  1JLB B;  3T5L A;  5GME A;  4NCB A;  2V8V A;  2HYI B;  3DGP B;  3HSG A; 
#chains in the Genus database with same CATH homology
 3IMQ J;  1HNX J;  4X66 J;  4JI5 J;  4B3R J;  4OX9 J;  4DR4 J;  2KVQ E;  3D3B J;  4NEY A;  4LF8 J;  4JI6 J;  2UUA J;  3J80 U;  4JI3 J;  4DV2 J;  4LF5 J;  2HHH J;  3D3C J;  4AQY J;  4DR3 J;  4RJV A;  2KL8 A;  1XNR J;  4DV3 J;  5IT9 U;  4DV4 J;  4LF6 J;  4DR5 J;  4LFA J;  1J5E J;  4NXM J;  3JAM U;  2E5L J;  4HHU A;  1IBL J;  2UU9 J;  1IBM J;  4JYA J;  5AJ3 J;  4DR2 J;  4DR7 J;  2UXC J;  1XMQ J;  4GKJ J;  2UXB J;  3W1Y C;  4LF9 J;  2ZM6 J;  1HR0 J;  4LFC J;  3T1Y J;  2MTL A;  5A2Q U;  2UXD J;  5IWA J;  1XNQ J;  4DR1 J;  4DR6 J;  4DV6 J;  4JI4 J;  2MQ8 A;  4JI8 J;  3R2C J;  4LF7 J;  1N33 J;  4LFB J;  4X62 J;  4NXN J;  2VQE J;  4NEZ A;  3T1H J;  4V1A k;  4JV5 J;  4JI7 J;  5FLX U;  1IBK J;  5LMN J;  3OTO J;  1N36 J;  4B3M J;  4JI1 J;  4B3S J;  4YY3 J;  4X64 J;  5LM7 E;  4X65 J;  4JI0 J;  5LMU J;  2UUB J;  4DV1 J;  4GKK J;  1XMO J;  1N32 J;  4K0K J;  3J81 U;  4KHP J;  4PWW A;  2F4V J;  4YHH J;  1FJG J;  3R2D J;  2MEW A;  1N34 J;  1HNZ J;  4JI2 J;  4KYZ A;  4DV5 J;  1I94 J;  4B3T J;  3J7A N;  5BR8 J;  4LF4 J;  1HNW J;  4DUZ J;  2UUC J;  4DV7 J;  2VQF J;  4DUY J;  4DV0 J;  4KY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...