5J2NB

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
427
structure length
405
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 106
structure length 405
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB03
2OPPA 3H40A 1T05A 4NLGA 4TQRA 5DGAA 3OLBA 3BJYA 3MR2A 4IRKA 5KG2A 3MFHA 2JEFA 4K4XA 3I0SB 4KKOB 3BREA 5F8MA 1ZTWA 5KFPA 1JXLA 3IN5A 2R2UA 3TAMB 2UUWA 4ZPDA 2V9WA 3BSOA 4K4TA 4IR1A 4RW7B 2QE5A 2RF2A 4NLVA 5KFFA 3H4DA 4ZHRB 2XGPA 1QAIA 1S9GB 1SUQB 4NRUA 1QUVA 5KFYA 2OPSB 3DLGB 3KHHA 4KBIA 2VG5A 1LWCA 3KLIB 2HMIB 4O3SA 4WZMA 1JKHA 1LW0A 5DG9A 3N6LA 3MEEA 1S1TA 1S0OA 3JSMA 2XI3A 4RW9A 2EC0A 1NHVA 4IH7A 4JV2A 4DL4A 1C0UB 3I0SA 4TN2A 5KT7A 3KLGB 2JC1A 1XR7A 1VRUA 4IFVB 3DLEA 3CWJA 3BSCA 3GV5B 1RTDA 3TAMA 3CJ2A 5KFWA 4ED3A 2IC3B 2ILYA 4EYHB 3N6MA 3KK2A 1OS5A 4ZHRA 4URSA 5KG5A 2W9AA 1S9GA 2V0NA 2W9CA 1FKOB 4HKQA 5C25B 3CVKA 2OPSA 2WHOA 3HVWA 4MIAA 2HMIA 3LP1B 3KLIA 2E9ZA 2AGQA 4H4OA 4IFYB 3JYTB 3V4IB 2ALZA 4YR3A 3C6TB 5KFGA 5KFKA 4O4GB 3CJ4A 2J6TA 3BQ2A 3D28A 4JV0A 3PW7A 2HNZA 1RYSA 1C0UA 3KMSA 2RDJA 4DL2A 4MFBB 3OL9A 3KLGA 3NAIA 1RT4B 3H5YA 3MEGA 4MK7A 3GIIA 1ZETA 3HVTB 1TKXA 3LAKA 4IG0B 1S0MA 2IC3A 1KHVA 2OPQB 1HNVB 5KFXA 2FLLA 1FKOA 1SH3A 4IR9A 4NLTA 1RA6A 2WTFA 3DOLB 3HHKA 4NLWA 1N56A 1S0NA 3JYTA 4IFYA 3V4IA 2W7OA 3MECB 2ASDA 4WXOA 2IBKA 3C6TA 1IKYB 2E9RX 4O4GA 3G6XA 2JC0A 3BSNA 3ISNC 4RNNA 3DRSA 4IDKA 5F8NA 4LSLB 4TYBA 4FS1A 1N48A 4ZPAA 5J2PB 1RT4A 4O3NA 4NCGA 5DLFA 5J1EA 3HVTA 1JLAB 2R2RA 4MIBA 4IG0A 5HROB 1U09A 2W7PA 2J6SA 2R8GA 4ICLB 1S1VB 1TL3B 5T14A 3EPGA 2OPQA 1HNVA 4ED2A 3DDKA 1TKTB 4KO0B 4R5PB 2R8KA 2D7SA 5DQHA 3DOLA 1MU2A 3CDWA 1IM4A 5KFCA 2I1RA 3MECA 4ID5B 2I5JB 4I2QB 4NYZA 4Q43A 2XGQA 1IKYA 2AGOA 1LWEB 2W9BA 1ZTTA 1REVA 4PWDB 4J9MA 4YR2A 3KLFB 2FLNA 3Q8SB 3BGRB 1JLQB 4RNMA 2UVUA 1RAJA 4ZVEA 4WYLA 2CKWA 3OHBA 1DLOA 5KFHA 1YVFA 3SI8A 3ITHA 2UUTA 2R8HA 2R2TA 5J2PA 1T03A 4MK8A 1C2PA 5KG1A 4QWCA 3KHGA 3N6NA 2OPPB 3PW5A 2O5DA 2AWZA 5F8GA 3GIKA 3MR5A 3QIDA 1T3NA 1TL3A 1QE1A 5KT6A 4NLXA 3KK1B 4YQWA 2IM3A 2R8IA 2C2EA 5KFSA 4FS2A 3RB3A 4R5PA 1IKWB 4NLQA 4K4YA 1DTTB 3IGVA 1S97A 5C5JA 3HVAA 4O3PA 3KOAA 1BQNB 2I5JA 4ID5A 5K14B 4I2QA 3PJWA 2RF2B 3GILA 1LWEA 3IG1B 1TV6B 3KLFA 3BGRA 1JLQA 2B43A 1TL1A 2B6AB 4YP3A 3H5XA 5JXSA 4QWEA 3KMQA 1TP7A 2HAIA 3TQ1A 2DPIA 2FVRA 3OLAA 3T1AA 4O3OA 3G6YA 3QGIA 4RW9B 3DLKA 2BANB 5KFLA 4Q8EA 3KK1A 2JEJA 4DL7A 4NLRA 1GX6A 5L1KA 1HQUB 1IKWA 4ECWA 4DL3A 1S49A 4F4WA 1VRUB 4FBTA 3DLEB 4NLOA 1S1XA 2RDIA 1DTTA 3DI6B 1S9EB 1RTDB 5EUHA 2W8LA 5KT5A 4EBEA 5KFUA 1BQNA 5K14A 4LQ3A 3KK2B 5HP1B 1I6JA 2W9CB 3IG1A 1TV6A 4KE5A 3T5LA 2DPJA 4H4MB 4Q44A 2B6AA 1TQLA 4ZVFA 4FBUA 1N5YB 4EEYA 4ZMMA 2V4RA 4ZPCA 4KB7A 3RB4A 3M8QB 4H4OB 3KHRA 2FJXA 4ECQA 5DG8A 3I0RB 3OL7A 4ECZA 4G3IA 3IGNA 2BANA 4R8UB 2HNZB 3SFGA 4GC7A 3DMJB 1J5OB 2YNIB 4Y34A 1RTJB 1HQUA 1UWBA 3PR4A 3Q8RB 4EBDA 3MEGB 3EPIA 1S48A 1TKXB 3DI6A 1S9EA 4NRTA 4ED7A 2D3ZA 2VG7B 1C0TB 4K50A 3V6JA 3DRRA 3FQKA 4WYWA 3CO9A 5KFTA 5HP1A 5KFAA 4F4ZA 4H4MA 2AQ4A 2ZE2B 1DTQB 1C1BB 2IM2A 1S6QB 3I5AA 4NLPA 1N5YA 5KG4A 3M9MB 3BQ1A 2BE2B 3M8QA 2FJVA 1RTIB 3I0RA 2BQUA 3UDLA 1W25A 3DRSB 4IDKB 4R8UA 4KHMA 1JX4A 3DMJA 3V81B 1J5OA 1SH2A 2R8JA 2YNIA 1JLGB 5J2QB 1FK9A 1RTJA 2WONA 1N6QB 2HNYB 4NCGB 5J1EB 3EZUA 2VG7A 1C0TA 2YKMB 5F8JA 3QLHB 4ECTA 5EWEA 4F50A 5I3UA 4X2BA 2IJFA 1JLCA 2ZE2A 2FVQA 4LQ9A 2IMWP 1DTQA 1C1BA 1S6QA 1JLBB 1MU2B 3LAMA 3KJVB 2BE2A 1S1WA 2ILZA 1RTIA 1Z4UA 4QPXA 1IKVA 4XPEA 2GIQA 4U6PA 2W9BB 1REVB 4YR0A 4K4VA 3M8PB 4WE1B 1LW2B 3LALA 3NAHA 1DLOB 3V81A 2IJNA 4QW9A 4ECVA 4ECYA 1JLGA 5J2QA 3ITHB 1N6QA 4KHRA 4QWBA 2VA3A 2HNYA 1T03B 3QZ8A 2IM1A 1T94A 5F9NA 4IH6A 4KV8A 3CJ3A 3H59A 3PW2A 2OH2A 5CYMB 3V6DB 1HQEB 3LP0B 2QV6A 2YKMA 1QE1B 3QLHA 3KHLA 4J9PA 1HPZB 4Y2CA 5KG7A 5KFMA 3RAXA 1R0AB 4J9SA 5J2MA 2JEGA 2JEIA 1RDRA 1JLBA 5J2NB 5C42A 5F8LA 3KJVA 4K4UA 5DQGA 1FKPB 2UVRA 3CIZA 3CDUA 2R2SA 3G6VA 1HARA 4QW8A 3MF5A 1HNIB 4IQXA 3M8PA 4WE1A 3BR9A 2WCXA 3PZPA 1LW2A 3LP2B 1TL1B 3FFIB 2YNFA 4KAIA 5EDWA 3IS9A 3CJ0A 4Y2AA 3KK3B 5KFOA 4ECSA 2ASJA 2VA2A 5D3GA 2IM0A 4URQU 3DLKB 5CYMA 3V6DA 1HQEA 3LP0A 5KG6A 1CSJA 3D5MA 4TQSA 1HPZA 4R0EA 1RT5B 3E01B 1R0AA 4F4YA 3FRZA 4URGA 4EYIB 3MR6A 4KFBB 5J2NA 2FJWA 1S1XB 3ICLA 3GV7B 1LWFB 5EWGA 4HYKA 1FKPA 1TVRA 4OL8A 4DG1B 4O4RA 4ZP6A 5KFIA 4YMEA 5KFZA 1HNIA 3DYAB 4WFYA 4WFZA 4NLUA 3NGDA 2XCAA 2AU0A 4XO0A 3LP2A 3FFIA 2OPRB 3LANA 5KFBA 3GV8B 2RKIB 2YKNB 2ATLA 3KK3A 1SH0A 4ED0A 5KT3A 3FQLA 5KFNA 3TVKA 4M94A 5KFEA 3KLEA 2HWHA 3KLVA 1RT5A 3E01A 4TLRA 2WOMA 4RW6A 3RBDA 2FVPA 1K1SA 1UWBB 4M95A 1NNDA 4KFBA 3KLHA 5KT4A 4MKAA 1LWFA 2GIRA 2ASLA 4WFXA 3PJXA 4DG1A 1VRTB 4O3RA 3IRXB 4Q0BB 3DRPA 1S1UB 3DRRB 3M9OB 4DL5A 3DYAA 4O44B 3HKWA 5I42B 2OPRA 4K4WA 2UVVA 4ZVGA 2RKIA 4IH5A 2YKNA 4RU9A 3DM2A 4O3QA 2XWYA 3PW4A 3QGHA 4QWAA 5HBMA 4IG3B 2AX0A 4F4XA 4K4ZA 1FK9B 3CDEA 2WONB 1XR5A 2HWIA 4IRDA 2VG6A 2HNDB 1TKZA 4ED6A 3V6KA 2V4QA 2YNHA 4IKAA 3NBPA 1VRTA 4ED8A 3IRXA 4Q0BA 5HLFA 1S1UA 4JUZA 1JLFB 5KFRA 3PVXA 5I3UB 2UVWA 1RT6B 3ISND 4O44A 5CYQB 1HYSB 1XR6A 3RB0A 1JLCB 5I42A 4WXWA 1RT2A 5JUMA 3GIMA 3OL8A 4DL6A 1S1WB 3MTKA 3NMAA 3MEDB 1IKVB 3UQSA 5FDLB 1D0EA 1JLEB 2F8EX 3H2LA 5C24B 5KFJA 4G1QB 2C22A 1SV5B 4KKOA 3GYNA 2W8KA 3E51A 4IG3A 2C28A 4TY8B 4B3OB 4MKBA 2XCPA 2HNDA 4JV1A 1RT3B 4RW7A 2AGPA 1RYRA 4KV8B 4RW8B 3FSIA 4TYAA 4TY9A 1N4LA 1SUQA 1JLFA 1C1CB 2YNGB 4RW4B 4EBCA 2FVSA 1RT6A 3DLGA 2C2RA 5CYQA 1HYSA 5J2MB 3C6UB 4PQUB 3Q8PB 4H54A 5C42B 3QZ7A 4ECXA 2D3UA 5EWFA 3MEDA 3JSMB 1JIHA 5FDLA 1RTHB 1JLEA 5L9XA 4NZ0A 3PR5B 5C24A 1EP4B 4G1QA 1SV5A 5KFVA 3UR0A 2XC9A 5L1JA 1HMVB 2C2DA 3I5CA 4Y3CA 4I2PB 2YNFB 4TY8A 4IFVA 3IS9B 1MMLA 3H5UA 3OL6A 4B3OA 2J6UA 1RT3A 5D3GB 3H5SA 3GIJA 1RT7B 4TXSA 4RW8A 3MR3A 4RNOA 4ECUA 4RNFA 4J9OA 4J9KA 2CJQA 4J9LA 2YNGA 1C1CA 1KLMB 4RW4A 4ED1A 3RAQA 5C25A 3OSNA 1IKXB 1WNEA 3NL0A 4NLYA 4ZP8A 3LP1A 3C6UA 4EO8A 5L1LA 4J9RA 4PQUA 4MK9A 3FDSA 1D1UA 4NLSA 4RUAA 5F8HA 4QWDA 2JLEA 1TVRB 2ZKUA 3GQCA 1RTHA 4RUCA 5DGBA 1GX5A 1EP4A 3CJ5A 4RNHA 2IA6A 3KNAA 2WB4A 1HMVA 4MFBA 2WRMA 2D41A 5KG0A 1QAJA 1EETB 2XI2A 4I2PA 2BR0A 4ZVHA 3T5JA 2BQ3A 3V6HA 4K4SA 4U7CA 5KFDA 2IAJB 1RT7A 2E9TA 3KLEB 4PUOB 2BRKA 2FVCA 4ZPBA 1KLMA 4GC6A 5F9LA 5KFQA 2ZD1B 2WOMB 1IKXA 4RW6B 1K1QA 3VQSA 1KHWA 1NHUA 1BQMB 4LSNB 3M9NB 3KLHB 3BSAA 4IOBA 4ZP7A 3I5BA 3QIPB 3UPFA 2B5JB 3DOKB 3MFIA 3DRPB 3SFUA 1RT1B 4LSLA 4J9NA 3QO9B 3Q8QB 4I7FB 1S9FA 2FLPA 1S6PB 4ZP9A 3RB6A 3OSPA 4RZRA 1EETA 2WK4A 3G86A 5DQIA 1JLAA 3DM2B 1T05B 3QGGA 5HROA 3NKYA 2IAJA 4ICLA 5DLGA 1S10A 4IRCA 1S1VA 1RA7A 2GC8A 3PW0A 4PUOA 5KG3A 4Q8FA 3RBEA 3PHEA 5HBMB 1TKTA 4KO0A 3T19A 5L1IA 2ZD1A 3T5KA 4WZQA 3T5HA 2BRLA 1BQMA 4LSNA 4DEZA 2VG6B 4NLDA 1TKZB 5KT2A 4ECRA 4XPCA 1S4FA 2BQRA 3QIPA 2YNHB 2B5JA 3DOKA 3NBPB 4PWDA 5HLFB 4EO6A 5DG7A 3BQ0A 1RT1A 3QYYA 3OHAA 3QO9A 4Q45A 4I7FA 4KSEB 3H98A 1S6PA 2VG5B 1LWCB 5F8IA 1JKHB 1RT2B 1LW0B 2AX1A 3H4BA 3MEEB 1S1TB 4MH8A 4J9QA
chains in the Genus database with same CATH superfamily
5DGAA 2QA4S 3B4MA 4K2XA 1VQPS 1B64A 1RWOB 3IN5A 2VFVA 2UUWA 2V9WA 4IR1A 4RW7B 4ILRA 1PKUA 5D4OA 3J81j 2HFUA 1KS2A 3BM7A 5L8RC 1RU2A 4LVOP 2AW0A 3CWJA 3TAMA 4ZJOA 2W9AA 2F5GA 2HVIA 4TU8A 4KQZA 1TMMA 4NOHA 3Q2TC 3TUPA 1S72S 3C16A 3BQ2A 3KG0A 5IT9U 3BZQA 3OL9A 2ZH5A 2FD2A 4AYBD 2G0IA 3M8YA 3V4IA 1LOUA 1VQLS 1OPIA 3PO5A 3GJTB 1HFEL 2VDHA 3CD6S 3JXOA 1VRQC 4PYDA 1X4AA 5LOQA 3BV8A 1IM4A 2R3VA 3P3DA 1BMQB 1IKYA 2W9BA 3IFEA 1R8CA 2DNOA 2CKWA 1T8EA 1DLOA 2CPXA 2H65B 4P73A 3QIDA 2EWHA 1UVKA 1HBNA 2R8IA 4Y65A 4NL5A 3SQGB 3OXFA 1S97A 3AD9C 3KOAA 1BQNB 3PRVA 1X4EA 3ZC4A 3FK4A 3KYLA 2B6AB 3VQTA 2Y1IA 3EYZA 1V3RA 5L46A 2KT5A 2N7YA 4W90B 4F26A 2ZH6A 5EUHA 3M6XA 2XB2D 4EBEA 2UU9F 3KK2B 3DN9A 4FYDA 2ABYA 3I31A 2HKEA 3OVAA 3KUEA 4DF8A 4M5GA 4G3IA 4PPZA 1RAOA 3VALA 1UWBA 1KONA 1LXJA 3MEGB 4JI1J 2I8EA 4ENOA 2GQQA 2HLTA 3ENAA 3MD1A 1DTQB 2ACYA 1RTIB 2HHSA 3UDLA 3VHQA 4ZCKA 3S6EA 2O1PA 1N6QB 2AF6A 2ZOFA 4MYTA 4PG8A 3FJ2A 4F50A 5I3UA 2IJFA 3GSIA 1GMWA 2ILZA 2GIQA 4NMLA 1FNXH 1U2FA 3EWGA 2IJNA 4ECVA 3R2CJ 1T03B 3M1VB 2KL8A 1PJ7A 2VL1A 1TL7A 3CJ3A 1PBUA 3FCVA 2YWWA 2JEIA 1RDRA 5J2NB 3TW0A 3UDVA 2FDNA 3G6VA 1CJVA 1YRTA 1UW4A 4ZVQB 5LSLA 1ELOA 3EXCX 4PWWA 2UUAJ 1VQYA 3MDFA 5CD4H 3J81Y 3BKFA 3BBCA 2EPIA 4M8LA 4F4YA 4PQAA 1RQ0A 3CPWR 4HACA 4NLUA 3LQVA 3NS6A 4UW2A 3UNGC 1OO0B 2QMUB 3HT0A 1RHRB 1VR6A 3GJSB 4PKDB 1UETA 4RW6A 2NUHA 5A8KB 1VQOS 1VRTB 2ZHBA 3DYAA 3W8GA 2XS7A 3TARA 3V2UC 3R6GB 2UVVA 3GCXP 5F0WA 3PW4A 2BJ9A 2F4FA 1WHVA 2HNDB 3V6KA 4ED8A 1IBLJ 2QG9B 4OV1A 2ZZNA 1WG4A 3UD4P 1HYSB 2OP5A 3GPAA 5D0GA 3GIMA 1PO6A 1H2TZ 4WIIA 1S1WB 4CYUB 2E1RA 4B3OB 2QLXA 2ZNZA 1RT3B 1RYRA 4FYVB 3MAQA 1TUGB 1C1CB 4DL0C 3QZ7A 2OLWA 4BDPA 4NZ0A 2MJUA 1EP4B 1CQNA 2E1MC 4Y3CA 3HVRA 1T11A 5F3TA 2FC8A 3GIJA 1C4CA 1S57A 4CLTA 3OSNA 2HBQB 4EO8A 1Y5LB 4NLSA 2H54B 4U7UK 2BE7D 5DGBA 4ZVSB 2Y1JA 2XI2A 3I4HX 1K9MT 4N8OA 3IWNC 1NHUA 1IWAA 3R1HA 4QIFA 1WC0A 2KT3A 3ONQA 4ITSA 1S9FA 4UOFA 2L9WA 2MZSA 3OSPA 2GAGC 4FXWA 5HROA 4ES1A 4G1PA 1FE4A 3T19A 1LK5A 5T7LB 2V69A 1BUXA 4ECRA 2BQRA 2KJVA 1QTMA 2Y9HA 4Q45A 3Q24A 1WSVA 2J5AA 4V1Ak 1HWJA 2DK2A 3OTOF 1IUJA 2R2UA 3K8WA 3POTA 3UW1A 1S7IA 2DNRA 4I4BA 3I0SA 3KLGB 4OX6A 1RWXB 2DGOA 1TUVA 2YKOA 1NK8A 1JMTA 2Q66A 3PRDA 1VC6A 2ALZA 2J9DA 3HF5A 3AQOA 4NXMF 3NAIA 4EMDA 2IRYA 2E7XA 3LAKA 1PYOB 4B9SA 4NEYA 1Y9OA 3BS9A 1CJKB 4HVZA 4QR2A 4MTPA 2YBVA 3W2WA 3MPDA 2YTCA 5J1PA 2NYHA 3PDNA 1EIYB 3TVYA 1CEZA 2W7PA 2GHWA 4ZCMA 2MSTA 2LYVA 2K8GA 1JXEA 3ZTRA 2V4JB 3CDWA 4EK2A 2N3LA 3MECA 4NYZA 3PRBA 2AEFA 3UN3A 3GJQB 4RNMA 4P9SA 4YHHJ 2UUTA 3NGTA 3RYLA 4DV3J 4R0JA 3HJFA 3ILIA 4K4YA 3HVAA 4NZ6A 5A0YA 5FIIA 2YWFA 4LF6J 1A6LA 1H6KX 2HAIA 3T1AA 2EK1A 1AT1B 4RKUC 3OQ2A 2VQFF 4UZCA 2XY7A 4NLOA 3RW6A 3T1HJ 3IG1A 2DO4A 4H4OB 2K1RB 4JI8J 3CCZA 5HMZA 1YZ6A 4TU9A 4ED4A 5LXRA 4OJGA 3W63A 3O2IA 2RJZA 1QAXA 2ZE2B 2DRBA 2M52A 4J9VA 1WF0A 3OR2A 1CULA 1P27B 1CBKA 1V3ZA 4DUYJ 2DY1A 2CZ4A 3M2VB 4X64F 3KJVB 4TKTA 2OJ3A 1F5CA 5KOWA 2P2CB 2I9SA 4KHRA 4QWBA 3LOUA 5F9NA 4F02A 4XK8C 1FRJA 4K4UA 3MM6B 1WELA 2H4WB 2M3DA 4RJVA 3PEJA 4C6AA 3V6DA 2HLUA 2JX2A 3M6UA 2H5EA 4CO4A 3FRZA 1LKZA 3SDEB 1VQKS 4MKYA 4DG1B 2BW7A 2IHR1 3QSYB 2LQ9A 2XCAA 4HDHA 3AOBA 1MWZA 2HQIA 1YKWA 2FVPA 1S1UB 4OI6A 1VI7A 4IH5A 2YKNA 2UV8A 2ZM6J 1Q8LA 2WONB 3NGRA 3BO3A 2NXNA 1HNZF 1XR6A 3G71S 2BABA 4JI4J 5M2RA 1PAUB 1VISA 3W3SA 4JV1A 2AGPA 2D9PA 1G6BA 4RW4B 2P9GA 4C0BA 1XMOJ 2BOAA 2E5HA 3GR0A 1RTHB 1JLEA 3I5CA 4H4KC 3M05A 2XS2A 1REGX 1UCNA 2EKYA 4NLYA 4A4JA 2HGLA 1HWLA 2VPXB 3HX9A 3F56A 1KTQA 1PGZA 3KNAA 3DGVA 1EETB 3JTOA 4ALZA 5E5NA 1WC6A 3DHWC 4GKKJ 4I6WA 2YQ1A 5A2QY 3KLEB 2FVCA 5IM0A 5FJ4A 4LSLA 2IA0A 4ZP9A 3G86A 1X4FA 5HMYA 4F0KA 3TANA 1KBRA 4N56A 3AH6A 3TZYA 3IXQA 4USHA 2ZD1A 4QZVB 4N77A 2VG6B 2CNNB 3TAQA 3TJ8A 3NBPB 1PSDA 5ETRA 4MH8A 3FMBA 4GO5X 3H40A 4CI0B 1I3OB 5D77A 2JEFA 1FT8A 3BREA 1GAOA 2X7IA 3GU0A 5J1NA 3TAMB 5IV3A 3A8JA 5EN1A 1LW0A 1S0OA 3H2UB 1GK8A 1TAQA 2ROGA 4IH7A 4CRJA 2MEWA 4J91A 1E6YA 5H9FJ 1BWVA 4B02A 1Q95G 4EGLA 2JOQA 4F4AA 1CC7A 1M5VC 2Y0SD 4DUTA 2WHOA 3LP1B 3V4IB 2LU2A 3K5NA 1AB8A 2ZZMA 3PW7A 2HNZA 1S0MA 3K57A 3OT9A 3BBFA 3C2PA 2A1BA 4ZITA 1FKOA 3E8OA 4NLTA 1KOHA 5CD4A 2LXIA 1IKYB 4YDDB 3ZTPA 4C8ZA 2HS0A 1FHTA 4K8RA 2IYGA 2LXFA 2LQBA 5HANA 3RRHA 3EPGA 1HBNB 1HNVA 4KO0B 3U7JA 4D3GA 3DOLA 5KFCA 1UFWA 3JQKA 4KPYA 4J9MA 3Q8SB 5LJ5Y 4DR1F 3IR7B 4OX9J 4QU7A 5KG1A 1C2PA 2VASA 3FKBA 3GLJA 2HBZB 2R9LA 4M5JA 4BBYA 1H98A 3UI3A 3QAUA 4YB5A 2CPFA 1RTZA 3CCQS 3T6JA 3GILA 1X4GA 3FBCA 4C48A 5AE3A 4JI7F 3TQ1A 2G1DA 3AXKA 1WHXA 4JYAF 4Q8EA 1OY6A 3P96A 5I3PA 2H4YB 4WF9Q 3TEGA 4UQTA 5KT5A 4PZVA 2R7RA 4DI6A 4QYZJ 4FNHA 1RCXB 1AW0A 1S77D 4Q44A 2Z8QA 3JTNA 2B4PA 1SKUB 4ZCLA 3I55S 3DOMB 4C0HA 4IOCQ 3CO9A 1S12A 1NO8A 3JSRA 3I5AA 3SZ2A 3M8QA 1SC3B 1UAWA 2MYFA 1RTJA 1WEYA 2QFIA 1TL7B 1RAGB 2VG7A 1VQ6S 4DUZJ 1CJVB 1RB0A 4ECYA 2VKRA 2MKYA 2HFVA 2OH2A 4P2MA 3KHLA 3NRBA 2HWTA 2ZUGA 3HHLA 2E1AA 1U1NA 4CIOA 1URRA 2LMIA 3TNVA 3HSJA 4HACB 3NWGA 1CC8A 2BYCA 1LW2A 1RHKB 2J7UA 4ECSA 5D3GA 5CYMA 3CJKA 3D5MA 4LF5F 2CWXA 2K7KA 2FJWA 2KT2A 2W4PA 3D6HB 4E2FB 2H3EB 5KFIA 2YX1A 3DYAB 1WD6A 1Y3KA 3FFIA 5KFBA 2ATLA 3PJ9A 4Q5VA 2RAQA 1XWLA 2BJ8A 2VOOA 5DDPC 2OFHX 2H5IB 3AFGA 3NGUA 2WOMA 3D3BJ 3VCDA 2BDPA 4KFBA 2Y1LB 3M9OB 2UZAA 2FY1A 4B9VA 1L3TA 3DM2A 2KXNB 1QY7A 4OX8A 3S01A 2D69A 2QEXS 3GJRB 4FKXA 4IQMA 4JUZA 4AL7A 4QOTA 2FZGB 3MD3A 3OFGA 4IG3A 2VPYB 1IM6A 1OQ6A 5ETOA 1P8GA 1QLNA 2MHEA 1M5HA 2HVDA 3UD5A 4K0KJ 3EZ5A 4HT7A 1N0UA 5DM6Q 1CG2A 1JIHA 5FDLA 4ID8A 3PR5B 5KFVA 2BKNA 4X4QA 1Q5YA 2WSEC 3RG6A 4LSZB 2FY8A 3NL0A 1Z1ZA 1R31A 4DCOB 1XMBA 2RDDA 2XMTA 1YWXA 1RHMB 2X3DA 4DV6F 3NXZA 4LFAF 2EG1A 2DH7A 1N5TA 3B82A 3OBIA 2YPZA 4YB7A 5E7OB 3MPUB 3RB6A 3CDBA 3CXCR 2DNGA 4A8QA 1S10A 2E29A 4PG7A 1D9AA 5KG3A 4YB6A 3NCPA 3POTB 2EK6A 5H9EJ 4XIUA 3BQ0A 2YWKA 2F63A 2IDEA 1NK4A 2ZBPA 4IRKA 1EAYC 3I0SB 4DR2J 3NP5A 4ZPDA 2XGPA 3K8VA 3QGPA 3N6LA 2IVFB 2EC0A 3OR1A 4LF8J 1VIOA 3LW5C 2RNEA 1FVSA 1R89A 5KG5A 3BH7B 4IO1A 3M2UA 1SIZA 1G2EA 2AGQA 1FRKA 4QCLA 3MEKA 3G4SS 3R8YA 2NSCA 2GIFA 2JWNA 2O66A 5GMDA 2ZUAA 4JI2F 3VAHA 3M32A 4ILMA 3H5YA 2E5LF 1TKXA 2FHKA 4JI1F 5KFXA 2FLLA 1UW9A 4FPRA 1KD1T 3MECB 3UFCX 4ZN3A 4B3MJ 3R7SB 4FS1A 2N4DA 2XYHB 4NCGA 4IG0A 5CQGA 4ICLB 3CD5A 1URNA 2VC1A 3RTVA 1ZAXA 5IWAF 1VQ9S 1RAAB 3GZ7A 1IXKA 2MQOA 5DJBA 5A0YB 2DY9A 4ZVEA 2PMHA 3OUYA 1YVFA 1IWGA 3ITHA 2R2TA 4F2SA 2B9WA 3CCJS 4KTQA 3SXLA 1T3NA 4DPWA 5IZHA 4YQWA 2VKZG 2KFYA 5IFMA 3G82B 2E1PA 3ENWA 4LF7F 3ILOA 2RU3A 3IG1B 4ETZA 3BGRA 1JLQA 1HI1A 2FIUA 2ZVIA 1CVJA 3THPA 2HQ3A 5BYRA 3KK1A 4LBIA 1IKWA 5EX0A 2W8LA 3WX8A 1NPRA 2F4VF 2PDAA 1RHJB 3IR5B 2N3OA 2F9JA 3OR2B 1CULB 2B9XA 3PM9A 5H1SV 2OMLA 3DI6A 2UXBF 1U6BA 3V6JA 3QRQA 2AJQA 1S6UA 1TUWA 2GO9A 2VZ9A 4HTJA 3A3OB 1TU0B 2IPOB 2DBBA 3K5PA 2C3YA 3KTQA 5KAKA 1BXNA 4OZLA 4FYWB 1S59A 2XYGB 4DV2J 5G0RA 3SIPB 1ZA2B 4XDCA 5B7WA 2C2MB 3QZ8A 4PRFA 4M5DA 1ZS6A 3VTIA 3V6DB 4JI3F 3QLHA 3M30A 4D3HA 4Y2CA 1NH8A 3NOGA 4J9SA 4ZJLA 4YFUA 1CJTB 3AQPA 4KHPJ 3CIZA 3CDUA 4QW8A 5FLXU 1TL1B 5F0UA 3PKYA 2YNFA 2VFRA 1H2VZ 2ZH1A 4DN9A 4BC7A 3FUYA 1RJJA 3MR6A 8RUCA 5KFZA 2MZQA 4WFYA 1HD1A 3HHNB 3LP2A 2YKNB 2C3UA 3MM5A 1UKUA 3FQLA 4DMZA 3R2DJ 3I87A 2AV5A 2G9OA 2V8VA 2GIRA 4OZJA 3GP9A 2Z58B 2G0CA 2RQCA 2FPHX 4LFCF 2E7VA 4CH7A 2IMOA 1U47A 1WKKA 3D0HE 4LUBA 3CJQA 5I42A 2DHHA 2ZH4A 1JLEB 3GYNA 3BO2A 4WIQA 1Y11A 3MOJB 4MKBA 1S6OA 3UVJA 4RBUA 2HS3A 2X1AA 1FCAA 2HW3A 1RT6A 4B3TF 3Q8PB 1FJGJ 1UFKA 2VICA 1UZHA 2V9KA 2DGTA 5IT9Y 4I0WA 2CWKA 4ER8A 3BGOP 1FRMA 3CJ8A 5IM0B 2GHPA 2VBXA 3AOAA 3DDIA 1VK8A 3MPVA 1HMVA 1NAQA 2OHDA 1PC5A 4P52A 4NCAA 1SQGA 5KFDA 4MMOA 4X4NA 2ZD1B 2EI5A 3KLHB 1BWEA 3Q8QB 3IO1A 3A4TA 1RWNB 2B4UA 2WBMA 4M5HA 2WK4A 3OW2R 2CZ9A 5GAGI 4IRCA 1BY9A 2HGNA 1KWMA 2NR0A 3CW2C 3VR1A 4PG4A 4OIXA 5LM7E 1S4FA 4DXLA 3SMZA 3QFWA 2XSJA 1LW0B 2GMLA 1SC6A 2BJEA 2QMWA 4QPTA 1R8HA 4DV3F 1FVQA 1E6YB 1RAEB 1SL1A 4DU8A 5IT4A 5ETTA 3PXGa 4LF6F 3CEDA 2FZCB 3K7RA 1NHVA 2UXDJ 3BSCA 1F9HA 3T1HF 1S9GA 1FKOB 1U0HA 1IBKJ 2OPSA 3HVWA 3RR7A 3CJ4A 2J6TA 5B0CA 1RXOB 1PIEA 2D3O1 3CCLS 4USTA 4QIEA 4MK7A 1KHVA 1HNVB 5AXLA 1M90T 3DOLB 3HHKA 3UD3P 4RO0A 3CD7A 1NK6A 2L41A 1HWIA 2JC0A 4IDKA 3R5DA 1S1VB 2M4MA 3CGIA 3B4DA 2NXJA 2QO3A 1MU2A 2X1GA 1ZTTA 1FDBA 2B4OA 1ZM3A 2MKIA 2F65A 5F8GA 1SL2A 1TFYA 2VBZA 5KFSA 5MAOA 3SBMA 4I2QA 1LWEA 2I0XA 3ILLA 1XNRJ 5ADZA 3QRRA 3J7AN 4JI6F 2H51B 1ZOTA 2V34A 2HQDA 1S1XA 4ECWA 1JJ2R 5K14A 1JB0C 1VJWA 4HLBA 1KTVA 1GXUA 3VWSA 3K2YA 1AA1B 1UEUA 3Q22A 1TQLA 4NI2A 1UVIA 1FESA 2OEMA 3M8QB 5HMWA 4KRWA 5I4MA 1XIQA 2CQ2A 1JXVA 3D68A 1RTJB 1FJEB 1RKJA 4IYQA 1N5SA 2VG7B 3DRRA 4WYWA 5IC4B 3M9MB 4DR4J 3BQ1A 4V19X 2I2YA 1F3VA 3ZZOA 1B70B 2ROPA 2OO4A 3HHLB 2IDLA 3QT8A 1NDCA 2HQGA 1NUEA 3DU6A 1R43A 3G8SA 4XPEA 4JI4F 1LW2B 4OYPA 1PYTA 1FRIA 1VHFA 5CYMB 2DEIA 4QU6A 3CJKB 3PX0A 5KG7A 1VFJA 2CQDA 2MQQA 4AQYJ 3PZPA 3FFIB 4B3RF 1RAHB 1VC5A 1V9OA 4ZLLA 3IS9A 2VA2A 1B7FA 3P45B 2MGZA 1CSJA 3WBZA 1U24A 4KFBB 5U47A 6FD1A 1SCJB 4YMEA 1VHIA 2Q6BA 4I56A 4WFZA 1HD0A 2JNJA 3U1MA 5C2CA 4ZKAA 2MJNA 4MYUA 2XMAA 3KXDA 3VAGA 1QM9A 2GW8A 2OMOA 4WK3A 2Q6CA 1FEEA 2B7CB 1N34J 1DY3A 3HKWA 2JLGA 1HL6A 4WTOB 3FZ2A 3NGSA 4U9RA 3I56S 4IG3B 4DQPA 4F4XA 4K4ZA 1WG5A 1XNQJ 2M2BA 5DS7A 3IRXA 2VODA 5HLFA 2GQCA 4N7TA 1X8DA 1QSSA 5FDLB 2QA4G 1Q4RA 5ETPA 5BXIA 4QYZK 2PSZA 1R8AA 4RW7A 3DC2A 1R3NA 5A6PA 3C15A 2C2DA 4B9TA 3OL6A 1T9UA 3B6BA 5HAOA 1HA1A 5HMXA 3BO4A 5D0RA 3C6UA 2RSQA 4J9RA 5F8HA 2M88A 2UUBJ 3T1YJ 1IR0A 2RUSA 4KGXB 1E6VA 7AT1B 4FXDA 4DQIA 5A2QU 2NZCA 3V6HA 3VVUA 4CO2A 2GFFA 4Y6IA 2BZ2A 1ZBTA 5KFQA 4BS2A 5GADU 4IOBA 1RSCA 5EHHA 1T7PA 1WC3A 3SFUA 4TLQA 3GYGA 5IS2A 4ERDA 2LLZA 1FJCA 2XHCA 3ZTSA 1LNQA 4YOEA 2QSFA 3RBEA 3PHEA 4PAAA 4LSNA 5HN0A 1KC8T 3OHAA 3BGFA 4I68A 4ZDNA 3EJMA 3A3NB 4M5LA 3OR1B 1WG1A 1ACMB 1UJ5A 2GA7A 5K8PA 3GR1A 2OD6A 4PXDA 4K4TA 1VMBA 5DM7Q 2J8SA 1L3UA 3M2UB 5M2UA 3A8KA 3JAMY 4WZMA 1JWWA 2CPEA 3M32B 2MKHA 2MZTA 2NS1B 3OXLA 3KK2A 3VAIA 2DGQA 2DR9A 3K5OA 4FZVA 3QATA 2BKPA 2RQKA 1LQ9A 1D09B 1X9SA 3MEGA 1TFWA 4IG0B 4ZK7M 1GFWB 3M4XA 1EX8A 3BSNA 4BWMA 3P5TL 3OUYB 4TYBA 3EUNA 1QVGR 2Z2LA 5I3QA 3MXHP 1LXNA 3DLJA 4NEZA 3HFZB 2UUCJ 4Q43A 4DUZF 4DX7A 3LO3A 3BGRB 1JLQB 1RAJA 2RHSB 4DV4F 2BM1A 1T03A 3M1VA 3CT9A 1FDNA 3N6NA 1T0TV 2NSBA 1TL3A 3KK1B 2AT1B 1IBMF 1VDHA 1IKWB 2MPUA 4P74A 1RKIA 4O3PA 3PJWA 2GJIA 2HZCA 2OSQA 2PD1A 1VBZA 3OLAA 2QLBB 2MKCA 4WFNQ 2W2NP 1RWWB 4RWXA 2WVEA 4DL7A 4NYOA 1S49A 4OYWA 2P5VA 2MZRA 3DI6B 1ZM9A 4F3QA 2DPJA 3TO8A 5H9EK 1KR4A 3SYZA 3QAEA 4P7TA 3CTRA 1HQUA 2XS5A 1YK9A 4ZA1A 4DV1F 2D3ZA 4L76A 2QA2A 2WW8A 3FNNA 1R27B 3UCUP 2NYIA 2F40A 2PI5A 3I0RA 4OX7A 4C8LA 4CZCA 4R8UA 2R8JA 1AXQA 5IT0A 3SCJE 4FDFA 4M5DB 3CMAS 3MURP 3QLHB 4QBUA 2WSFC 2QN6B 1VQ8S 4J9UE 4ELTA 1S1WA 2CPYA 3I9V9 2KFZA 2FJBB 2K3KA 3R5GA 2VPZB 2Q3PA 5L9NA 1MN9A 4DSKA 3D4JA 2QC3A 4NXNJ 1FXDA 4BHQA 1JJHA 3M8PA 1NHKL 3LP2B 2PI4A 1UPMB 2N82B 3MM5B 1R6VA 3DLKB 4DV5J 3R5CA 1D3WA 3MMBA 4F3MA 1U4BA 4X4TA 2DXFA 3FC9A 1NDPA 3EMTA 3ELHA 4OL8A 2E44A 1XEZA 3NGDA 2COLA 2KHDA 5IQQA 2K7JA 4I6YA 2LDIA 2QYGA 2G4BA 2VPWB 4LRCA 5KFEA 2HVHA 2HHVA 1K73T 3ZTQA 1LWFA 3PJXA 3SSRA 2XO7A 5D6GA 1KQSR 2DRAA 2CUYA 5I42B 3SCKE 4QIWD 1DAXA 3ENQA 3M8ZA 3QGHA 1WHYA 4JOUA 5T7LA 4C8OA 3CDEA 3N28A 4A8XA 4O23A 1UA1A 5KFRA 2HURA 4WU3A 1RT6B 1JLCB 4YY3J 4DL6A 1AFJA 3CJSA 4UY85 3AD8C 5KFJA 3DRXA 3RUBL 1IJEB 3ZZ0A 3CCRS 5ETKA 1JLFA 4EBCA 2N4CA 3KNGA 1HMVB 4OHZA 2DXDA 1NRKA 2A3JA 5K5MA 1MMLA 3H5UA 3AT1B 3H5SA 3KJNB 5DDRC 4J9KA 2P9EA 4HI2A 1NZ8A 3BF4A 2DHAA 2F9DA 2EW9A 4ZVUB 1HBOA 5D0HA 3PV8A 1NDKA 2XEXA 1HR0F 3DDNA 4M63A 2BOPA 2KB2A 3PFOA 3QRPA 4DQQA 3BSAA 3EVWA 1HNXF 2XSJB 3ZZPA 2IAJA 1FNMA 3CCTA 5IV4A 5JMNA 5HBMB 2V4JA 1HLWA 1B0TA 4NLDA 4EO6A 1JNZB 2VBWA 2L08A 4PR6A 1UVNA 1YJNS 5AXKA 2VDIA 3MFHA 1BHNA 1VQ4S 3CCVS 3HSZA 1O8BA 1TKDA 1U1MA 5HQLA 1S9GB 1SUQB 2ZJRQ 1U0HB 2OPSB 1LWCA 1WJ9A 1WF2A 1ZYQA 2LKZA 4DL4A 4KYZA 5CZVA 4ED3A 1UEVA 3W9IA 5CH7B 1U1QA 1LK7A 1TR0A 1PC4A 2AP6A 3KLIA 4H4OA 3WDOA 1XMQJ 5KFGA 3DGPA 1FWLA 4DFPA 3AODA 3KMSA 2RDJA 4DL2A 4MFBB 2WVCA 2CA9A 2RT3A 2EBGA 3M2RA 4X4RA 4DQRA 4KC5A 4OYZA 4WXOA 3A8IA 5SUHA 4C9DA 2XG8A 3C66A 4K2JA 1FTRA 2AMCB 4C98A 4K7QA 3MMAA 2DNQA 4L3KA 3M2VA 4DR3F 4I2QB 4DV2F 2XMWA 1LWEB 4PWDB 4YR2A 2R7QA 4J5OA 1KOOA 2R8HA 2AZ3A 2PC6A 2AWZA 5KT6A 2NZ4A 4FS2A 3VGTA 4DV7J 2CJBA 2CPIA 4DFJA 4ID5A 5K14B 3GIRA 2RF2B 2ZBIA 3QJLA 2RRBA 1B99A 3LPEA 4NI2B 4XTTA 4JV5J 3C19A 4RW9B 3A8EA 5KFLA 2RS8A 2CG4A 5D78A 3UE2A 3CULA 4LF9F 3S1TA 2W9CB 1RACB 2V2VA 4DR6J 2XMJA 4GRSA 4WP3A 4Y34A 3CC7S 2KTQA 4ED7A 4OJ3A 3HT3A 4CLUA 2MTLA 1TTHB 2OIHA 5KG4A 1OYEA 3IP0A 3C14A 4JI5J 3TX0A 2WONA 2PGCA 2HQFA 1NSPA 1K8AT 1T9XA 1F1BB 2YH1A 2G2OA 2DNNA 3PACA 3FEYB 2IMWP 4L72B 4BC9A 1A0OB 1NM2A 4Y28C 1HHTP 5B0GA 4AFFA 4DBQA 2MLYA 2BA9A 2DO0A 3H59A 2MGZB 2XNRA 5CZXA 4J9PA 1KVIA 1N33F 1EARA 3ZZYA 5AXMA 4ATNA 3QPIA 2IM0A 4Y2MA 4CWBA 4FP9A 1FD2A 1Q78A 4CO5A 6AT1B 2OEJA 5EX3A 5KFNA 3KLEA 1DARA 2BX6A 3BPSP 3QBCA 1UTAA 5K8NA 4N41A 1R8BA 2CQHA 2KXHA 5KT4A 4USVA 2B9YA 3IRXB 1O51A 2J7KA 4CQ1A 4DSLA 1PILA 1XJWB 3ZNJ1 4ZVGA 3ENVA 4DF4A 4O3QA 2NPFA 2Z57B 1SQFA 2LU1A 1GXLA 2KYXA 1Q7YT 1XR5A 2VG6A 1T3OA 2DYAA 5AE2A 4ED6A 3NBPA 3U1LA 5FD1A 3C15B 3MTKA 1RBAA 1UFLA 1RBLA 3H2LA 4UTGA 1MWYA 4AL5A 4H4KA 1G3OA 2KRRA 4WWSA 4DS5A 1X5TA 4AT1B 2R7UA 1VCTA 2KFNA 1SKRA 3C6UB 1OY9A 1NB7A 1VBYA 3UR0A 1E6VB 2WVDA 4TXSA 5LMNJ 4YDXA 1Q0NA 4ECUA 2CJQA 1GH8A 3EM1A 5E2QA 1WNEA 4ZP8A 3ULHA 3LP1A 1IBKF 2CVEA 4A48A 3D2WA 2ZC3A 3K17A 3T5JA 4DSIA 2DGSA 1MLAA 3RW7A 1IKXA 2V63A 2CFXA 4LSNB 3IWLA 2UU9J 3M9NB 5DZ6A 2YKAA 4MT1A 3W5YA 1JJCB 1N32F 4DPOA 2GC8A 1B0VA 8ATCB 4KO0A 3MOZA 1F5BA 3Q8UA 2LVWA 2X1FA 1UP1A 2YNHB 1Y10A 5DG7A 4C4WA 4KSEB 1IBCB 1RT2B 3H4BA 5GVQA 3THTA 3UCZP 1UMJA 5DRKA 4OQJA 5GAGU 4KKOB 2MZJA 2RU9A 3ZFVA 2M7SA 4EZ9A 3CJRA 2ERRA 2O3DA 2AYBA 4RBVA 4NRUA 4A8OA 5KFYA 1FWKA 4FVCA 2VG5A 4OZ1A 3SQOP 1ULRA 1PG5B 4TN2A 3ET6A 1J5EF 1X4CA 4HHUA 4OYIA 4MIAA 2HMIA 3GSDA 2QJ3A 5D4NA 3OTEA 4HHJA 2QSWA 2ZOGA 3GIIA 3NNCA 3US5A 1FDAA 3DOMA 3JTPA 2C42A 5A8RB 3D66A 3FZBA 1WDTA 2DCLA 1TK0A 4NYPA 2PEHA 2CQBA 3E3XA 3C6TA 4DR4F 3HXMA 2W2MP 1VS3A 2ZH3A 3EZOA 3W60A 5BJRA 3N01A 3HVTA 1TL3B 3D67A 1U7LA 1TKTB 1V6HA 4OI1A 2QT7A 3TA0A 4WP8A 2XLIA 5J2PA 2QL7B 5FLXY 4MK8A 1D9DA 3KHGA 2W2QP 3RB3A 4R5PA 2PT0A 2CDRB 3MCNA 1KKHA 4OZ3A 4JBCA 4BWJA 2C2KB 3RAMA 1NJIT 2HFOA 1DBDA 1S7HA 3U1NA 3TUJC 3H5XA 2FVRA 4CNYA 1SL0A 1AUSL 1HQUB 2FZKB 3DLEB 2RDIA 1DTTA 1RTDB 4RX6A 3T5LA 1X4BA 4WK1A 2MSSA 4ZPCA 3QT5A 3O8WA 3N4WA 3I0RB 3T6BA 1VQ5S 1VQNS 4DLGA 1KSPA 5HJYA 4R8UB 3MAAB 3SFGA 3Q8RB 3PO4A 4BLGA 1WC5A 2HG4A 3GFYA 3VAMA 3Q89A 2W7AA 4HT5A 4L75A 1DHMA 2DNMA 4CT8A 2J7WA 1MNEA 5J1EB 2FJDB 2PE8A 2QLFB 4OHXA 1XNQF 1RLDA 2JLFA 2DR8A 2WB1D 4QR1A 1EHWA 3MWBA 1REVB 4YR0A 1P6TA 3M8PB 1I94F 2BXJA 4F8RA 2HIYA 2GCFA 4X66J 4DR7J 2AKWB 2U2FA 1ZPWX 1FE0A 8AT1B 3MMBB 1YRXA 3BBBA 1TL4A 1JLBA 5AE1A 2DHSA 5DQGA 2FGOA 1RE1B 4F2RA 5EDWA 2HFZA 4GVBA 5KG6A 3PHTA 3HLUA 4NWBA 1LWFB 1H0HB 3QFHA 2BE9B 2AJ2A 2UUBF 3T1YF 2EG2A 4USWA 1KQGB 1CLFA 1DQ8A 4K59A 4B9MA 2HWHA 4QR0A 1EJ7L 1GEHA 4Z7CA 2V94A 3TYTA 4TVAB 3T3FA 4NXMJ 4USMA 4B3SF 3LGMA 2H5JB 2IBOA 3IBWA 4IRDA 5G4DA 4IKAA 2GX8A 5BYQA 1JLFB 1RAIB 4O44A 1F9EB 5GMKa 5JUMA 1Y00A 4N8NA 3PYFA 3W65A 1M5KC 5J2MB 1RCOB 3CC2S 5ETLA 4OHWA 3NLCA 2U1AA 1HBOB 2AYGA 4TY8A 1EZZB 3PIPQ 4ZIVA 2V8HA 3MR3A 1NKEA 3LGNA 3G9CA 4MK9A 4QIGA 4P71A 2Q1LA 2GNKA 3TEHB 2FJAB 2BV3A 2RHQB 4GMKA 3ZZZA 4WP9A 2IAJB 3Q2SC 1RT7A 5F9LA 1K1QA 2DGVA 1U8SA 1XTZA 3A3PB 3P49B 4CO1A 2DGUA 4RR5A 2FLPA 3IAS9 3NCQA 4KT0C 4X62F 4ICLA 2YX4A 3J80U 1DQAA 3T5KA 3I82A 1IN0A 3HHDA 4S0MA 1TKZB 3QIPA 1N36F 1X4HA 3H98A 5F8IA 1LWCB 2QL9B 5F41A 1NK7A 1S0VA 5E41A 1X31C 3SI8A 1FRLA 2H9ZA 3OLBA 3MR2A 4K4XA 2CJXB 3G82A 2J0XA 1FNOA 5F8MA 3BSOA 5CCMA 3WZ0A 1FI4A 1R8PA 3JAMU 1EKSA 3KLIB 1JKHA 1NDLA 4K5SA 3JSMA 2XI3A 3BN4A 3DGPB 4JV2A 4NPOA 3OFEA 3K0JA 2CRLA 4IFVB 2E5JA 3M2RB 4UZBA 4ZHRA 3SV4A 1NK5A 5C25B 4OI0A 1F5AA 1DFDA 1GMVA 3PX4A 2CPDA 2DKOB 1ZETA 3FGVA 1F2HA 3MMAB 4OFZA 1NSKL 3LGHA 3RRGA 4OI2A 3SCLE 4ZPAA 1RI7A 1B4SA 2J6SA 3U27A 3DDKA 2R8KA 1SVDA 3KUHA 1YTYA 2I1RA 4ID5B 2HS4A 2AGOA 4DCPB 1A9NB 3O44A 2M9KA 2V2QA 3LH2S 1VLOA 2G0JA 3TI0A 3FVYA 1U1RA 2VC0A 2FGCA 2IM3A 1CJTA 2YWGA 1KQFB 3IGVA 3NMRA 4NXNF 1TL1A 3IA0A 4M1KA 1WORA 1V5IB 4AXIA 3H8YA 3VAJA 1F0XA 2UXCF 2BW2A 4FBTA 2A18A 1IQTA 3HO1A 1RU1A 1AZSB 2L9DA 4LQ3A 5B09A 2BMBA 1S76D 1FDDA 3QMQA 1XERA 2V6AA 3EGNA 3C14B 2ZH8A 2HHUA 5LMUJ 3EPIA 2RH3A 1N0VC 4MIWA 5E3RA 4FF4A 1U0SA 5KFTA 1YBUA 3B8HA 1A7GE 3LPYA 1T9TA 4X65F 2CQPA 3IBFB 4ZLNA 2KHCA 2LFVA 4KGZB 1HHSA 2XHWA 4NASA 3QNWB 3O6QA 5DO2A 4LVNP 1C1BA 2LQ5A 1Z4UA 4U6PA 4K4VA 1YJUA 1FTCA 1WSRA 3LALA 3NAHA 3CE8A 3RGIA 3RJMB 1NJYA 1GXTA 2QV6A 2YKMA 3OXGA 1QE1B 5IXUA 2MQLA 5E0OA 1YJRA 2MQPA 1HARA 3MGJA 4IQXA 4YUDA 4C7QA 4AXJA 4R25A 2B0GA 4Y2AA 2D1CA 3I96A 1M1GA 1Y3JA 3C3LA 4LMZA 2XULA 4URGA 4LRAA 3AB4B 2HIQA 2QFJA 4O4RA 3ZTOA 2RS2A 2H1YA 4LF4F 3KK3A 1XQIA 2V5HG 4U7UD 3TVKA 1CS4B 2DISA 1RT5A 1K1SA 3KLHA 4MKAA 2ASLA 4O3RA 4C3MA 4CH0S 4DL5A 2OPRA 4DCJB 2W4CA 4RL1A 5AT1B 2OTLS 2MY8A 1SPBP 2HWIA 3O5TB 1OQ3A 2B51A 3A12A 4C97A 1KEKA 3MCOA 4CLLA 2XO6A 1GMUA 4ETXA 2IY5B 4OHVA 2W8KA 5CYJA 2MLZA 3TX8A 2EFVA 3QSIA 2ZEJA 4P2XA 1YJWS 5K8MA 2VQEF 3VF0B 4H54A 4ECXA 2J0SD 2D3UA 4DR1J 4G1QA 2ZDOA 1RWPB 3FSYA 1IKXB 4KIAA 4DWIA 1HNWJ 1LFWA 1XMQF 1GX5A 1R0CB 2WB4A 2D41A 2ZWPA 2BR0A 4NX9A 2E9TA 4ZPBA 1Y7PA 2AJ0A 3UPFA 4K5RA 1YI2S 3DRPB 2CQIA 4RZRA 2R7XA 5DQIA 1Z2LA 1S1VA 2V8GA 3RZAA 4C8MA 3Q8YA 1XBWA 2YY3A 3FBEA 2PA3A 3FSXA 5BR8F 3QO9A 1U8WA 1S6PA 2IFXA 2VG5B 1DRZA 5CABA 4LT6A 1YJVA 1QSYA 4TQRA 2HZAA 3BJYA 1K47A 2AEMA 5EGYA 3AAWB 2D9OA 1S5ZA 5D4PA 3ET6B 4PXCA 3ZZUA 3H4DA 4U67Q 4A8KA 2WAQD 4KBIA 2HMIB 4O3SA 3OTCA 3K59A 4ZIWA 1WACA 1SJRA 1S1TA 2FLOA 3MM7A 4JV5F 4OYBA 1Q7LB 4UUWA 3JQMA 5KT7A 5KFWA 2RVJA 4HKQA 3W9JA 2RE1A 4WJBA 2K3IA 3THVA 2CNKB 3C6TB 2EVZA 2K2PA 3M6VA 1RYSA 4ZCIA 2CQ1A 3HVTB 2Z56B 1FX2A 4PG6A 1X0PA 4LF5J 1OY8A 1SH3A 2XLKA 4Y2KA 2JDJA 1N56A 4EWTA 3JYTA 2HFNA 4KH0B 3Q23A 3GCWP 1N48A 2JJ4D 5J2PB 2OELA 4JI5F 4I6AA 1FJ7A 4KGKA 1Y4ZB 4IO9Q 4DV0F 4DR5J 4R5PB 2ZBQA 3AY0A 1FRXA 2LQJA 2XBPA 2XWXA 3GG0A 4A8FA 1VGYA 3D1HA 4P75A 4DPUA 2OPPB 1HQ2A 3PW5A 3GIKA 1WDDA 2C2EA 2FTRA 3IMQJ 4LR7A 5M2PA 1DTTB 2HK3A 3L7UA 2ZH9A 1KFSA 3PIOQ 3DLBA 3KLFA 5BYSA 2HHXA 4YP3A 4DQSA 2KZZA 4LJMA 4GKJF 2IRXA 3NS7B 3M8SA 2RMLA 1RADB 4NLRA 2JFDA 2HHWA 2ZBCA 2ZNYA 4DL3A 1PBAA 3DNCA 4KE5A 2HRTA 4FBUA 2DJWA 5GAHI 2FJXA 4PEOA 4ECZA 2WZ1A 3TAPA 3IGNA 2OI2A 4GC7A 4EBDA 4F67A 1S48A 4FNIA 5JJBA 5KFAA 4JI0F 2EFGA 3JSYA 2YQ0A 4ZVRB 2KI2A 1RLCL 1W25A 4USKA 3J7ZT 1OIAA 2V67A 3DMJA 1IQZA 1SH2A 4AUKA 3VAFA 4DV6J 1HWUA 4LFAJ 3TR5A 3R5JB 5EWEA 3HM9A 2QTWA 1M1HA 1JLBB 4EUVA 1O5JA 4QQBA 2BE2A 2W2PP 1HHQA 3UWTA 1F6TA 1RWKB 1CJUA 4DS4A 4DFMA 2VA3A 4GVBB 5AXNA 1D9FA 3P5BP 3VZIA 2YPYA 4X4VA 4WE1A 2MKJA 3GWCA 1KP6A 2CAJA 2LEAA 3FEZA 3PYGA 3DLLQ 5LMNF 1R0AA 3CMQA 5EWGA 4HYKA 1VLYA 3AJDA 3EVOA 5GAEU 2AU0A 4XO0A 2YWHA 3LANA 1FXRA 1EQ0A 3AB2B 3TQEA 4ZJQA 3CCES 3KLVA 4P7VA 2QZ8A 3C46A 5K20B 3AD7C 3IAM9 2UP1A 3BKUA 1I1GA 4O44B 4PPDA 3HJVA 4PABA 2KYZA 3IM8A 4QWAA 4JI2J 2E5LJ 2B7BB 1FK9B 2DNZA 3R5BA 3A1YG 4Q0BA 3FBFA 3PVXA 2AYEA 1TELA 3R3TA 4EI2A 1H7WA 3BB5A 2BJ3A 2CADA 3TZWA 1HBMB 1WTFA 3N5FA 4TY8B 1Y5IB 4KV8B 4TY9A 1DZ5A 2QX0A 1UJ6A 4ZPWR 5IWAJ 1YQHA 1R7IA 1U26A 3QT6A 1BQXA 4OI4A 5C24A 1SV5A 5A76A 3H7HB 4C8YA 2HAFA 2Z4PA 1RT7B 4OZ0A 4RW8A 2OUGA 4CLPA 1G1XA 2GQ2A 4LF7J 3HMJG 2GGPB 4OLPA 4PCQA 4RUAA 4ES3A 1TVRB 4WTYA 1GNKA 2YKPA 2P6SA 4I2PA 7FD1A 3UN2A 1VQMS 3DCAA 2LA6A 5F3ZA 4CLSA 1U48A 2F4VJ 3I5BA 3QIPB 2JHEA 4J9NA 2QIFA 3RBZA 1NJXA 1WUUA 3PTWA 2DR6A 1U25A 3LTOA 2Q79A 4PUOA 4WZQA 3KWMA 2UXBJ 2B5JA 2VIHA 3QYYA 1SI9A 4P2FA 3EDQB 1JKHB 3JSMB 2XZWA 2UUAF 4YS2A 2GMHA 3AA9A 2QA1A 4QYRA 1MROA 4ZHRB 3KHHA 2VHGA 2DR5A 2LEBA 2BVZA 3R27A 2CPZA 1P1LA 4JI3J 2FHJD 2KM8C 1OS5A 4URSA 3W62A 1U1LA 1FERA 1Q81T 4YR3A 1SKWA 2M8HA 2NXEA 1GQEA 4DX6A 3I32A 1IBLF 1Y5NB 2J9EA 4KH1B 5B0BA 2WTFA 1HWKA 2IBKA 3A13A 3G6XA 4RNNA 4HEA9 2Z0GA 3OPKA 1JLAB 2OPQA 2GHVC 1U1OA 2D7SA 1JQGA 3DFEA 1IR1A 3H20A 5KFHA 4LFCJ 2PFFB 4X66F 4DR7F 1AYEA 1NBEB 4LFBJ 3DLHA 5C5JA 5E3CA 2HVEA 3BYRA 4CLYA 2QRRA 2KM8B 5CCLA 3G6YA 3DLKA 4U8YA 4F36A 2KXFA 1ROFA 5MLCV 2ASYA 2DNPA 1NK0A 1VRUB 3CNQP 1SJ3P 1P9YA 4B3TJ 1XC9A 4HH0A 3RB4A 4KB7A 5DG8A 3OL7A 2CJKA 2R7VA 2JZ5A 2YKQA 2DNHA 2E1CA 4NRTA 1S9EA 4F4ZA 5HP1A 4P6QA 3AHPA 3D7SB 4KGVB 1C1BB 3J7YI 2FJVA 4KJIA 6FDRA 3CDAA 3W8PA 3DRSB 4C11B 1JX4A 4RLEA 3OTDA 2B3TB 2YKMB 4ECTA 3SSQA 2B56A 1JLCA 4M5MA 4LQ9A 3LAMA 4CLZA 4NZ7A 3HP6A 4C3LA 2CYYA 3O3LA 2IM1A 1T94A 4U95A 2NUUG 1UZDA 3AOCA 1KRPA 2EC2A 1OPZA 2UVRA 2R2SA 1YJTA 4LRFA 4EZ6A 3SEOA 4KAIA 3KK3B 4X84A 1ZZNA 1FEHA 4UQGA 2ADBA 5AJ3J 1RT5B 3CF5Q 3TUZC 5SZTA 4DPYA 3VGUA 1HNIA 3BKTA 1UVMA 2OPRB 3Q86A 3PX6A 2QGFB 4ED0A 3KFWX 1F3FA 3TA2A 1NCLA 3E01A 1WHWA 3RBDA 2XMMA 2XM3A 4WFXA 2CQ3A 3MPWA 2RKIA 4YHHF 3SCIE 1BD6A 2MMYA 5HBMA 3R6LB 2AX0A 3EGWB 4X4UA 3DXSX 1D8ZA 4RU2A 3NEKA 1RWVB 3MM9A 5HSPA 3OL8A 3ISZA 4ZVPB 1IKVB 2J8AA 1XK8A 4ZN1A 4G1QB 3R9LA 2C28A 4Z7YA 3TA1A 2XCPA 1N4LA 1SUQA 4RPFA 1X9WA 3MM8A 3GONA 5C42B 2UV8G 3H90A 4JI8F 5C7PA 3J7Z5 2DVIA 3HULA 1WEZA 4RNOA 3ZZRA 4PYAA 3W2VA 3Q0AA 1WI6A 4RUCA 4OHYA 4RNHA 4RBTA 3BGUA 4USJC 4MFBA 2DHXA 2MKKA 4JI6J 1KLMA 4DUYF 2CQCA 3RU0A 4ZP7A 4AE5A 4DSEA 4OZ2A 2Y1RI 3CUNA 3QO9B 1S6PB 4CLWA 4WFBQ 3G6ES 3QGGA 2HBYB 1RA7A 1VYAA 5JVHQ 3TP2A 3HK2A 3T5HA 2VJVA 2HHHJ 3DOKA 1BE4A 4PWDA 1MSWD 2KVIA 2PN6A 3GFHA 1FD8A 1S1TB 1T05A 3MM7B 4WKYA 2YQ3A 3BDPA 2Z2YB 1OYDA 1QSLA 4NE9C 2RF2A 2C2OB 4OMFG 1QUVA 1X0FA 3DLGB 5A6WA 4UY8T 5DG9A 2A6OA 5HL7Q 4RW9A 4UOHA 2X1BA 1RABB 2AJ4A 3G8TA 3T9NA 3EICA 1ICEB 1K0VA 2DNLA 3N6MA 2W9CA 5CHCB 2YX7A 3JYTB 2PO4A 4Y0FA 3D28A 5ETSA 2ZM6F 4B3RJ 3HZGA 1W26A 1M5OC 4I1TA 2IC3A 5LMUF 2MKSA 5GADI 4YN3B 4C2MA 3ILJA 4IR9A 1N5QA 3FBBA 1PCAA 5A8WA 4NLWA 4IFYA 1SJ1A 2E9RX 4DDFA 2DNYA 5T14A 1IVZA 1CQMA 1HBUB 1XMOF 3MPYA 3P4UB 3KLFB 3S8SA 4WYLA 3OHBA 3D1QA 4B17A 1RWUA 1WKLA 4UF4A 4NLXA 2P6TA 1OMSA 3O1LA 3HSDA 2I5JA 2QYCA 2R7WA 1L5UA 1JK9B 2XMUA 1O0PA 3OFFA 4W4MA 4DN0A 4QWEA 2VV5A 4O3OA 1WF1A 3F41A 4GKKF 2GS8A 2W01A 3AXMA 4J7CA 1Q1KA 2AHOB 1TV6A 3PCOB 3V4MA 4EEYA 3C16B 1FFSB 3DMJB 2M8DB 3WIUA 1B0PA 2C2ZB 4H4MA 2RQMA 3TUIC 2IM2A 1N5YA 2WBRA 2BE2B 2L48A 4W92B 5IC6B 1CJUB 3HHEA 2YNIA 2A6MA 3OTBA 3VGSA 3EVMA 5ETVA 5T41A 2ZHAA 1RP5A 2E5IA 1S6QA 3TJ9A 4QPXA 4G6VB 2W9BB 1G4CA 4WE1B 4LIWA 2W24A 1DLOB 3V81A 4QW9A 2DTJA 4IH6A 4OV6A 2BM0A 3PW2A 2CQGA 5KFMA 1R0AB 3R7BB 2DNKA 3EE3A 3ZO7A 1X5SA 3KG1A 4URQU 1FF2A 3LP0A 4EU0A 4R0EA 4F3OA 1HKAA 3HD1A 2ZFHA 2MY7A 1U49A 3FRYA 4FF2A 2OGUA 1HNWF 1NKCA 1N54B 3T9ZA 3GV8B 2NLWA 5KT3A 4CH1A 2DXEA 2AYMA 3PY8A 4HI1A 1UWBB 3J80Y 1T9WA 3E2EA 1P9QC 3QWUA 4I69A 3LUYA 2P8IA 1NMEB 3CSKA 4Q0BB 1HI0P 4OX9F 3PYDA 3R5AA 2HSEB 4BCAA 9ATCB 3CD0A 1WC1A 1KN6A 1NLKL 3V5RA 1WI8A 4U96A 4CTAA 2YNHA 1FX4A 4GO7X 5I3UB 3EGZA 2UVWA 4J37A 1RT2A 4WFAQ 3OV7A 2VF3A 1NPPA 3NMAA 3UQSA 4C8KA 4FYYB 3GE9A 2F8EX 5C24B 2SXLA 1SV5B 4KKOA 2KZMA 2EBEA 4KPCA 4RW8B 3FSIA 3DHXA 3SV3A 4L74A 2J76E 2C2RA 5CYQA 2DEJA 5EWFA 3D3CJ 2DGXA 4FYXB 2HHTA 4DV4J 2EFPA 2GV1A 2XC9A 1WOSA 4I2PB 1WEXA 2MLXA 1IBMJ 1YJ9S 2YNGA 5D4LA 4PG5A 3R7NB 3UDEA 1D1UA 1SJ4P 3HFVA 2R4FA 5KG0A 2GJ2A 5A8RA 4ZS6A 4PUOB 1RHUB 4M5KA 1LFPA 4RW6B 2N7CA 3NS5A 2QLJB 2B5JB 1K0TA 4J90A 3MFIA 2H48B 3NKYA 2G13A 5DLGA 1TKTA 4DR5F 2G2ZA 3JB9k 4DV1J 1BQMA 1FFWB 4DEZA 4XPCA 1MROB 2EKNA 4KR0B 2FUG9 2APOA 3MMCA 4RUBA 4LBHA 2V8DA 4DOZA 2LEPA 2EFOA 4NLGA 2XMVA 2POKA 4LIRA 2ZDPA 3RR8A 3UDCA 1JXLA 2OAUA 3FCHA 1FXLA 3OJSA 1QDUB 2OEKA 2R7OA 2MQMA 5KFFA 4ED5A 2J9CA 3D9BA 1APSA 1QD1A 4ZVTB 3MEEA 3NG8A 4WCEQ 2RRAA 3EXYA 1TK8A 1GMWD 2JC1A 3ZZTA 1XR7A 1GTHA 4ILLA 3DLEA 1RTDA 3M8WA 1M5PC 2VB6A 2V0NA 2BJDA 2FB0A 2XNQA 1WOPA 2CDQA 1VJQA 3G87A 5L38A 1H72C 3MAAA 5B0AA 1KQKA 1NPKA 3G2XA 2KVQE 2JSXA 4I67A 1WC4A 1H38A 2OPQB 1OWXA 1QAYA 1B3TA 2HPUA 4FVMA 4C0OC 1S4EA 3GMGA 4O4GA 2D74B 1SB6A 2HYIB 1BGXT 1U6ZA 1UVLA 4O0NA 4FN5A 1RT4A 1YBAA 3H25A 5J1EA 4W98A 2XY5A 5HROB 3FCWA 3WC2A 2KKHA 3KJFB 1VQ7S 2MQ8A 4OJHA 4K0KF 3MUTP 2XGQA 1REVA 2NREA 2WVFA 2X51A 3UN5A 3KG4A 2E5GA 1HIYA 2AEJA 5HJXA 2WW4A 3CMES 1FWPA 4HDGA 2VFSA 3QJJA 3CO0P 3H0PA 4X4OA 2Z30B 1HI8A 2W2OP 2ZVSA 5JXSA 1TP7A 5B0DA 3QGIA 1TMJA 2XLJA 3PYEA 4OYAA 5CAAA 1GX6A 1JNRB 4ES2A 1S9EB 2FC9A 3UNYA 4N76A 5HP1B 2ACMA 2DRDA 4ZVFA 2G2YA 4ZMMA 5HO4A 4ECQA 2A10A 3BYPA 2K06A 1J2VA 4UOCA 1NJZA 4K50A 1O6XA 4UUXA 2AQ4A 1ZPVA 4ELUA 4NLPA 7FDRA 3GTYX 3W2WB 5ITHA 5GAHU 4KHMA 1J5OA 4A8MP 1T95A 1EKRA 1HR0J 4DR2F 1U2CA 4HHHA 4DX8H 1F2GA 1FKAF 4L73A 3K89A 1HNXJ 3MI7X 4LF8F 1JLGA 5J2QA 2VBYA 2HNYA 2DIVA 1X5PA 4KY3A 1VBKA 1VBXA 5J2MA 3OFHA 4E0DA 1NKBA 5F8LA 3K58A 2GO8A 4FXVA 4Y2IA 3Q83A 2JVRA 1HNIB 1NXIA 2FQQB 3D54A 2PA8D 3R97A 3IBCB 3NNHA 2ASJA 1N88A 1HQEA 4I64A 1HPZA 3E01B 5HVGA 3R1LA 3GV7B 4HL9A 2JVOA 4ZP6A 4B3MF 3MMJA 1CPZA 3MUVP 2RKIB 3RBXA 3Q8VA 3VZHA 2YXLA 3ETMA 4TLRA 3M8RA 2ALYB 4AD6A 2CNLB 2A2DA 4KGMA 3H2VE 2HGMA 1RWMB 3BGLA 3MM9B 4K4WA 2FHMA 3UR3C 2MHNA 1TKZA 4HTIA 2V4QA 1UJ4A 4LRDA 4MAKA 4TNOA 5KOXA 3MM8B 4WXWA 3RB0A 4V19J 1Q86T 2C3PA 1U1KA 4DLEA 4PXBA 2OKQA 4TYAA 4NA3A 3OD2A 2CPHA 5B0FA 2BKOA 5KTQA 4DR3J 4C3KA 3I6PA 1UPPA 3W2VB 4DPTA 1T9VA 3NCRA 4IFVA 4CM2A 2XSFA 2HVZA 4JB8B 4J9OA 3W1YC 2BJ1A 2R7SA 1KLMB 3RAQA 1SJFA 5C25A 5L1LA 4P72A 3P8BB 4F04B 3OJUA 2ATCB 2IRUA 3J81U 4ZLJA 4U7CA 2QMXA 1OJ4A 4DJBA 3VQSA 1KHWA 1YJ7A 4LF9J 2ZH2A 3DOKB 2MXYA 5LT5A 2B8PA 1LEOA 1T05B 3PNIA 1MW7A 4Q8FA 1DJ0A 1NK9A 2BRLA 4XDDA 2P9CA 4KHPF 1R6YA 1FA0A 1SKSA 1Q8BA 2VOPA 3F44A 5IQ6A 2AX1A 4USIA 4J9QA 1KDNA 2CVIA 3L09A 3N0VA 1YRUA 1VC0A 1ZTWA 1KNZA 3S7RA 4LFBF 4NLVA 3NNAA 3TZZA 1KLNA 3X3UA 3BDEA 4Q2LA 2KDOA 4ANEA 4LREA 2IC3B 1AZSA 2AIRB 2BACA 1N33J 5A8WB 2VONA 4IFYB 5KFKA 4LF2A 1YX2A 1C0UA 1KVJA 5IOLA 3PKMA 2PMZD 2CZVC 3JS9A 3HSGA 4LSLB 4UT4A 4MIBA 2R8GA 1U09A 4E8UA 3TJAA 4DSFA 4ED2A 1YGYA 2DB1A 3N79A 2I5JB 1B7YB 1FJGF 3OVSA 2FLNA 3AJ1A 2LXUA 2O5DA 4OLOA 1QE1A 4A8SA 5HVFA 2HFSA 3MAHA 3W66A 1TV6B 3M7VA 3L7PA 2B43A 3KUGA 2DPIA 2GAHC 1ZAVA 4OYMA 4CCHA 3IM9A 2CJAA 3HZEA 5AJ3F 1U2RA 1TK5A 1WOOA 5KFUA 3W5XA 2ZZTA 2MQNA 4H4MB 1N5YB 4JP8A 3KHRA 5HVHA 2BANA 1CS4A 2HNZB 3TVZA 2YNIB 1YIJS 3PR4A 2WSCC 1H73A 3MCMA 2F8HA 4X4PA 3LA0A 1S6QB 5HQMA 1VK3A 2RRNA 3NOCA 2HQCA 4L6V3 3L9ZA 3V81B 2CIMA 4IUFA 3EZUA 1C0TA 4X2BA 1V5VA 1N52B 1W7WA 4CO0A 1Q53A 2BJ7A 3J7YU 1N32J 2UXDF 2XMKA 3FEXB 4QIVA 3LP0B 3TWZA 4FF3A 2BBEA 2IVYA 2JEGA 1MWQA 4FPIA 2GZOA 3MUMP 3MTJA 4OJ1A 3K5LA 1F60B 3CJ0A 5KFOA 5K8OA 2XQCA 3HHLC 4TQSA 4E98A 3L7OA 2V8PA 4NCBA 5LJ3Y 3L95X 1RUSA 4EYIB 2DT9A 4P10A 1FKPA 1RAFB 1SH0A 1Q79A 5ETQA 2VD3A 3B78A 3VAKA 1J5EJ 4CDIA 2NPIA 4M95A 1NNDA 1YSJA 4CTAB 3FMWA 3DRPA 2ZC4A 1VIXA 1YHQS 1NEEA 1QUPA 1KFDA 2LDYA 1FO1A 4B9UA 2C2NA 2ZHOA 1NU4A 2GVDA 2Y8WA 5HATA 3D0IE 1RISA 2HHHF 5CYQB 1FRHA 3GB0A 1D0EA 1XNRF 2QLWA 2C22A 2NXCA 4FKYA 1PYSB 2YNGB 2ZITA 5H9FK 1NB2A 3MEDA 2W1BA 3W64A 5D0EA 4CP5A 2AZ1A 2J6UA 5D3GB 2F8MA 4AL6A 3JQJA 4J9LA 2KRBA 4DSJA 1JJ4A 4PQUA 4A8YA 3FDSA 2ZKUA 3GQCA 5E33A 4ZVHA 4O0IA 4NA2A 4MKVA 4K4SA 5CXTA 2QL5B 2JRSA 4GC6A 3W7BA 2WOMB 1BLUA 1EQMA 1BQMB 4F25A 1MN7A 3MMCB 2KJWA 2RIJA 3DM2B 4F0HA 3AA8A 5DETA 5L1IA 1U45A 1L3SA 5KT2A 4YB1P 4AQYF 1RT1A 1M0SA 4I7FA 2ZJPQ 4B9LA 1FFGB 3MEEB 2OPPA 2GVZA 3LF0A 3UCGA 5KFPA 1YZ7A 4ANDA 3EGVA 4ZOSA 1QAIA 1VQSA 4YEAA 1TL5A 5LSOA 1NH7A 4G65A 5K9FA 5GMEA 1I94J 2B9EA 2V2ZA 2OTJS 2F3JA 4U8VA 3W9HA 3CJ2A 1S99A 2ILYA 4EYHB 1N34F 1T9YA 4OZ5A 4UOGA 3VVTA 1NZAA 3DRYA 4O4GB 3HHLD 4JV0A 1WTBA 2DR7A 2MZ1A 1TZ0A 1RT4B 1VOMA 4M5IA 2ZBRA 4IOAQ 1PJ6A 3L4BC 2Y8YA 1RA6A 1S0NA 2W7OA 2ASDA 1H2UX 4N47A 4USUA 1L3VA 2RB7A 3ISNC 2RILA 2C3MA 1X7VA 3GFZA 4ZPVR 5DLFA 2VH7A 2R2RA 1QTNB 4XAKA 2A2CA 1U02A 5DQHA 1IJFB 2M5YA 2IVMA 2UVUA 2DITA 2X3GA 1SC1B 2EFQA 5D8HB 3N5BA 2DCUB 4X4SA 4QWCA 4B3SJ 3EDRB 4OYOA 1Q5VA 1Q8IA 3MR5A 2LP4A 3OTOJ 3M6WA 2ZH7A 2ZJQQ 1EB0A 3WIVA 4NLQA 3HCXA 4DZ6A 2LECA 2NQPA 2PMWA 3D6TB 3L3CA 3KMQA 3BEGB 4A8WA 3H42A 1PJ5A 3HKZD 5DZ7A 1ZA1B 2LCWA 5L1KA 2CJYB 5LXYA 4CLKA 1GT8A 3SQGA 4ANCA 1BQNA 2CPJA 2HRYA 1QJHA 4LR8A 1I6JA 1HW9A 3HDSA 4C8NA 2B6AA 2V4RA 2J0WA 4Y00A 2BEFA 1OSCA 1UL3A 1IR2A 3IRWP 1J5OB 1UA0A 4FF1A 1TKXB 5HK4A 4WPAA 1SBRA 3FQKA 2Y0BB 5HI7A 2BQUA 3ETOA 3TOQA 3QT7A 1X4DA 3KJQB 1JLGB 5J2QB 1FK9A 3DXBA 2HNYB 4NCGB 5THWA 3QQCD 4OZNA 5F8JA 2FVQA 1DTQA 3CCUS 1RTIA 1Q82T 2FHJA 1HBMA 3CCMS 2HK2A 1N6QA 3ITHB 5JVGQ 2F1FA 4X62J 4KV8A 1ZAWA 2PIIA 3X1LB 1HQEB 1HPZB 3W61A 1ZZFA 1T02A 1OSDA 3D6FB 1N36J 5E3AA 3BR9A 2WCXA 1SQEA 2XYPB 2RQ4A 2VQFJ 3CCWA 1G7CB 1XN9A 2AJFE 2WVBA 2GGPA 5J2NA 2KN4A 1TVRA 2GMJA 1Z2ZA 5HQ8A 2OD4A 3D0GE 4A46A 4F0MA 2DH9A 4DU7A 4Q7AA 3OVBA 3CC4S 3LWLA 4M94A 2Z2ZA 1DURA 4CNZA 1YITS 2L3MA 1D8YA 2NCKL 2FJEB 2UUCF 4LF1A 2MDAA 3PG9A 1UEKA 1N5VA 3RRKA 2VFTA 3I9ZA 2HHQA 3TZXA 5A8KA 2DIUA 1VRTA 1J27A 1U1PA 1ZM2A 1MG7A 2ADCA 4X64J 3ISND 2KG0A 2FYXA 2KU7A 4PXEA 5G0RB 4F4KA 4LRBA 2YWEA 3E51A 4A47A 2HNDA 4DHVA 2CNOB 3U02A 3M30B 3WX4A 3P6YC 1HYSA 2OFGX 2HEKA 1UWAA 2E7WA 4CYUA 2YNFB 4B3OA 1RT3A 5DDQC 4RNFA 1C1CA 4ED1A 2E66A 5C2GA 4TU7A 4HR2A 1P1TA 4QWDA 2Z2MA 1EP4A 4LR9A 2WRMA 1YG0A 1QAJA 4OYXA 3GFXA 4RWWA 3WC0A 2AJ1A 2UXCJ 2BRKA 1RZMA 2O01C 4LBPA 1I51B 4N5SA 1JLAA 2ZKTA 1RGVA 5ETNA 1K44A 1L3KA 3MR7A 2VU5A 2PEBA 3D1OA 1HNZJ 3IR6B 2MB0B 1SIWB 3WHIA 4X65J 1N8RT 2C3OA 1GTEA 3GYXB 5KG2A 5LL6d 4DV5F 1F9FA 4WU2A 2LA4A 2KG1A 1KVKA 3UVJB 2QE5A 1U6FA 1DQ9A 3J7A1 3HFKA 3D6MB 3BN7A 2XY6A 1C0UB 3MZIA 1X9MA 1VRUA 3GV5B 3ZNUA 1AFIA 2J0QD 2W25A 3CVKA 2E9ZA 2EEYA 2YH0A 5LSRA 4WKRA 1LV5A 3KLGA 2R42A 4ZVOB 3BH6B 3DU5A 2EFNA 3LWMA 4YY3F 2VFUA 1BC6A 3NY0A 3DRSA 4C11A 5F8NA 5E3PA 4LF4J 1WKJA 4O3NA 9RUBA 1CJKA 2M70A 2F7VA 4DZDA 4B08A 1YBTA 1NSAA 3N9UC 3DKDA 3W5ZA 2AD9A 2IJRA 2Y3YA 4DPXA 2IYIA 2A0FB 2HRUA 2LQ8A 4DX5A 1I5OB 3CIMA 1Y0HA 1YLXA 2VUGA 3KDOA 3BPDA 2BANB 2GJFA 3VV2B 1AROP 2KO1A 4CO3A 3UO0A 2JEJA 4F4WA 3TRGA 3WQPA 3PFEA 2CJ9A 1X60A 3HD2A 2VQEJ 1NSQA 2C1EB 1W2IA 4F7VA 1X5OA 2I6WA 2DH8A 2G1HA 4WBFA 4GVLA 3G8QA 3IC1A 2XZDB 2Q43A 1C0TB 3F0NA 2DHGA 3NGKA 1LWXA 1Q8KA 2FHOB 2K1RA 1QVFR 2HHPA 4IDKB 3T41A 1ZH5A 3CB4A 1TAUA 1WWHA 2V2KA 1RK8A 3I4PA 2ZE2A 2CG8A 1MU2B 5RUBA 2NXUA 1IKVA 2DD8S 4EFAC 3IWXA 4CLFA 5E3QA 1M1KT 2B8QA 2RD5C 3RAXA 3ADAC 1RBOB 5C42A 3KJVA 1FKPB 1PAEX 3JSBA 5BR8J 3MF5A 4ZPTR 2O67A 2RUGA 4JI7J 2JFKA 2VJUA 2DGWA 1YDLA 2B4VA 4Z37A 4JYAJ 1MMDA 3KDNA 3MHYA 3HI9A 1MMNA 5ETMA 4ELVA 3ICLA 1S1XB 1H7XA 2JH3A 2L9NA 3MM6A 4QJVA 3KKFA 3AJ2A 2EXUA 2CQ0A 2HBRB 4PWUA 1ZM4A 3C8YA 2BUNA 1H3DA 5CA5A 3CCSS 4CT9A 3SDEA 2JL9A 2GVDB 4G1IA 1Q16B 4DG1A 3DRRB 1W2BR 3PEHA 4M5NA 1HW8A 1UVJA 1R0BG 2W4DA 3EX7B 4RU9A 3CJTA 2XWYA 4L3NA 1SC4B 4DV7F 2XZTB 1S1UA 2V68A 4ZLPA 4P2SA 2PFDA 4OI3A 3G96A 3MEDB 2J9DE 3QWPA 5L39A 1M5SA 1ITPA 3NWRA 3BR8A 4DV0J 4NA1A 2D3OR 2FVSA 3DLGA 4PQUB 3K5MA 5L9XA 4MJKA 2YVSA 4DR6F 5L1JA 3HPOA 2ZWOA 3IS9B 3F73A 1V3SA 3GG1A 2XTJP 3VGVA 2HZVA 4HH1A 4NMXA 4RW4A 1SXLA 2ZOMA 2I38A 5GAEI 1S79A 2JLEA 4DFKA 1RTHA 3CJ5A 2IA6A 3ZXWA 1NJWA 4GKJJ 2BQ3A 1AUDA 4Z2XA 5B08A 5B0EA 3B54A 4CM0A 2CQ4A 1RT1B 4I7FB 2IIHA 5DDOC 3MCSA 1EETA 2GVZB 5D15A 2V50A 2KH9A 3PW0A 2CXEA 4Q2MA 3SSSA 1HBUA 1SJQA 4B9NA 1RHQB 2OSRA 2R7TA 4JI0J 5HLFB 4RUHA 3QJPA 1C4AA 1H74A 2M0GB 2ROEA
chains in the Genus database with same CATH topology
4NLGA 2XMVA 1FRLA 5DGAA 2BJEA 2QMWA 2H9ZA 4QPTA 2QA4S 3OLBA 3B4MA 3MR2A 2POKA 4K4XA 1R8HA 4LIRA 4DV3F 1FVQA 2J0XA 1E6YB 2ZDPA 1FNOA 4K2XA 5F8MA 1VQPS 3UDCA 3RR8A 1B64A 1JXLA 2OAUA 2VFVA 3FCHA 3IN5A 2UUWA 3OJSA 2V9WA 3BSOA 1FXLA 1SL1A 4IR1A 4RW7B 5CCMA 2R7OA 4ILRA 2MQMA 5KFFA 3WZ0A 1R8PA 4ED5A 2J9CA 1APSA 5D4OA 3KLIB 5IT4A 3PXGa 4LF6F 1JKHA 1KS2A 3BM7A 4K5SA 3MEEA 3CEDA 3JSMA 2XI3A 3BN4A 5L8RC 3K7RA 3NG8A 1NHVA 4JV2A 4WCEQ 2RRAA 3EXYA 1TK8A 4NPOA 4LVOP 2JC1A 3ZZTA 1XR7A 3OFEA 3K0JA 1GTHA 4IFVB 3DLEA 2AW0A 2CRLA 2E5JA 1RTDA 3BSCA 3TAMA 3CWJA 1M5PC 3M2RB 2VB6A 4ZHRA 3T1HF 2W9AA 1S9GA 2V0NA 1FKOB 3SV4A 1NK5A 5C25B 2HVIA 4TU8A 2OPSA 3HVWA 2BJDA 4KQZA 2FB0A 2XNQA 4NOHA 4OI0A 2CDQA 3RR7A 3Q2TC 1F5AA 1DFDA 1S72S 3CJ4A 3PX4A 2J6TA 3BQ2A 5L38A 3KG0A 5B0CA 5B0AA 2CPDA 1KQKA 3BZQA 3CCLS 3OL9A 4QIEA 4MK7A 1ZETA 3FGVA 2ZH5A 2FD2A 2JSXA 4AYBD 4I67A 1KHVA 1H38A 2OPQB 1OWXA 3MMAB 1HNVB 1QAYA 5AXLA 1M90T 4OFZA 3DOLB 3HHKA 3UD3P 2HPUA 4FVMA 3CD7A 3V4IA 1NK6A 2L41A 1HWIA 4C0OC 1LOUA 3GMGA 4O4GA 1OPIA 2D74B 1VQLS 3PO5A 2JC0A 3RRGA 4IDKA 1SB6A 3R5DA 4OI2A 2HYIB 1BGXT 1HFEL 3CD6S 1U6ZA 1UVLA 3SCLE 4ZPAA 4FN5A 1RT4A 1YBAA 1RI7A 3H25A 5J1EA 2XY5A 5HROB 2J6SA 1S1VB 2M4MA 3WC2A 1X4AA 3CGIA 2KKHA 3U27A 3B4DA 3DDKA 2R8KA 1VQ7S 2QO3A 1MU2A 1IM4A 1YTYA 2X1GA 3P3DA 2I1RA 4OJHA 4K0KF 4ID5B 3MUTP 2XGQA 1IKYA 2HS4A 2AGOA 2W9BA 1A9NB 1ZTTA 1REVA 3IFEA 3O44A 1FDBA 2NREA 2B4OA 1R8CA 2DNOA 2X51A 2CKWA 1T8EA 1DLOA 1ZM3A 3KG4A 2M9KA 3LH2S 2CPXA 2E5GA 2MKIA 3CMES 3TI0A 5F8GA 4HDGA 3FVYA 3QIDA 2EWHA 2VFSA 1U1RA 3QJJA 1UVKA 2VC0A 1SL2A 1HBNA 1TFYA 2VBZA 2FGCA 2IM3A 2R8IA 5KFSA 5MAOA 4Y65A 4NL5A 2YWGA 3SQGB 3OXFA 1KQFB 3IGVA 1S97A 3NMRA 3KOAA 1BQNB 4X4OA 4I2QA 1X4EA 4NXNF 1LWEA 1HI8A 3ZC4A 2ZVSA 3KYLA 2I0XA 1TL1A 2B6AB 3VQTA 2Y1IA 3IA0A 4M1KA 5JXSA 3EYZA 1TP7A 1V3RA 5B0DA 2KT5A 3QGIA