5J2NB

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
427
structure length
405
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
total genus 106
structure length 405
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB03
1JLBB 2YKMB 3DLGB 3G86A 5C24A 5JXSA 1VRTA 1N5YA 1J5OB 3PR4A 3M9MB 4F4WA 1LWEB 4KSEB 4NRTA 3V81B 4MH8A 3OLBA 3KHLA 2OH2A 1RTHA 3DYAB 4RW8A 5CYMA 3N6NA 3GIJA 4NYZA 5EDWA 2AGQA 1LWCB 2IM1A 3BGRA 2BRLA 5EUHA 1JLFB 5EWEA 4TXSA 2UVRA 3CO9A 4ZPAA 1ZTTA 1TV6A 2BRKA 1LWEA 1JLQB 2OPRB 3CJ0A 4O3OA 4RW7A 1C0TB 2JC1A 1HMVA 5KFDA 2UVVA 5KFMA 4O3SA 4DL6A 2ILYA 3QLHB 4H54A 1LWCA 3Q8RB 2R8IA 4WFYA 3BSOA 2B5JA 3V6DB 1JKHB 4H4OB 1LWFA 1R0AB 2JEFA 3C6TA 1T05A 2IAJB 3RB6A 3SFUA 4ECZA 2VG5B 5KFJA 3C6UA 3BREA 1FKOA 2J6TA 2HWHA 4DL7A 3JYTA 1NNDA 1S1UA 3QIPB 4MIBA 4RNFA 3VQSA 3KLHA 3D5MA 1S9EB 1C1BB 4H4MB 3UR0A 1RTIA 2IM0A 2FLNA 1TL1A 3NBPB 2HNYA 3HVAA 3ISND 1YVFA 4QW9A 3MR2A 1QAIA 4WE1B 3HHKA 4F50A 2XCPA 2W9AA 3CDWA 5KT5A 3DLKB 4K4SA 1RT1A 2WONA 4LSLA 2JC0A 1IKVB 1JLAB 5KFHA 4J9QA 3OSPA 3PJXA 2IBKA 4WFZA 4NLPA 4ECYA 2R2UA 1S9EA 1TL1B 3NBPA 2HNDA 3QIDA 4K4WA 1RTIB 2WRMA 4Y34A 4ZP6A 5KFZA 4IRDA 2FVPA 4NLXA 2J6UA 4IFYA 4MK7A 3KK1A 2V4RA 2IC3B 4IG3A 4IH6A 5T14A 4I2PB 4K4ZA 3RB3A 1IKYB 1EP4B 5EWGA 3I0RA 1S1VB 4O4RA 5L9XA 1GX6A 3I5AA 2VG7A 4R8UB 2WTFA 3MTKA 1HYSB 2EC0A 2I1RA 2ZE2B 4NLTA 1IKXA 2OPSB 3KK1B 4QPXA 1SV5B 4URSA 4XO0A 4RNHA 4MFBA 5D3GA 1KHVA 1D1UA 3BSNA 5K14A 1C1CA 3I0SA 3GIKA 2DPIA 1RT4B 4Q0BB 3MFHA 1RT3B 3KLFA 4OL8A 1SH0A 3GIMA 3GILA 2JLEA 3NGDA 1BQNA 1HYSA 4ECQA 3BGRB 3DLEA 1VRUB 1S0OA 2W9CA 1HNVB 3MEEB 3H40A 2AWZA 2RDJA 4ECTA 4R0EA 3BJYA 1N56A 3QGIA 4ED6A 4Q44A 4IFVB 1RTJB 1RTDA 2BQRA 3QO9A 3M8PB 3DRPA 2W8LA 3OL9A 3NAHA 2OPPB 4NLSA 4YQWA 3OHBA 3PW2A 4QWAA 1S0NA 5C25A 2HNDB 2BE2A 1D0EA 3HVWA 5DQGA 1JX4A 4G1QA 3MEEA 2QV6A 4XPEA 3PW4A 2W9CB 5KG3A 4TQRA 3V81A 4DL4A 1HARA 1MU2B 3KLIB 1C0UA 4O4GB 1R0AA 1KHWA 5KT7A 4FBTA 5C42B 5C5JA 2F8EX 3FFIA 4RNOA 2WCXA 3EZUA 3M8PA 3ITHB 3KJVB 4O3NA 1NHUA 3OL8A 4ED2A 4O44A 4ZMMA 5J1EA 5EWFA 2BANA 4ZVGA 1TL3B 3QZ7A 5J2QA 3CJ4A 4ZVEA 1LW0B 3PZPA 4K4UA 3MR5A 3LP2B 1JXLA 5KFVA 4K4VA 2R2RA 2XI2A 3V6JA 2AGPA 2IMWP 2BR0A 1BQMA 4DG1B 4U6PA 1IKXB 3OL6A 1JLCB 2B6AB 3DOLB 4ICLA 4NZ0A 3KLIA 4DL5A 1S1TB 2FJVA 3IS9A 4PQUA 1JLGA 3PW7A 3I0SB 4J9RA 4Y2CA 5DLFA 4FBUA 3QGGA 3HVTB 3IGNA 5HP1B 3V6DA 4U7CA 5I3UB 2W7OA 4IR1A 4JV2A 3FDSA 5KG5A 3G6VA 2IC3A 3DMJB 2B6AA 3DOLA 4ICLB 4YMEA 4RW4B 3KHGA 1RT7A 1KLMA 2XGQA 2D3ZA 4X2BA 4J9NA 2IJNA 2FJWA 3TVKA 1IKWB 3LP1A 1N48A 2VA3A 1FK9A 2RF2B 3SFGA 3KHRA 3E51A 2I5JA 4RW6A 3IS9B 5I42A 4G3IA 2E9RX 3LAKA 1S49A 1TVRB 5F9LA 4EBCA 2OPQA 4WZMA 4RUCA 2JEJA 2WB4A 4ID5A 4NRUA 5KFPA 4Q43A 5KG0A 1DLOA 4ECUA 4I2QB 1RA7A 3UQSA 5DQIA 4M94A 3DOKA 1IKWA 3LP1B 5KFKA 4YR3A 3RAXA 1FK9B 5KFFA 4O3PA 3UDLA 1SV5A 3TAMB 3DRRB 1TQLA 3DM2A 3ITHA 2HNZA 1RYRA 1WNEA 1TKXB 4K4YA 4EYIB 4IFYB 3T5KA 1HQUA 1QE1A 4MKAA 5F8HA 3BQ1A 1REVA 2YKNA 1QUVA 4KHRA 2XCAA 2WOMB 3EPGA 4J9OA 3C6TB 1T05B 4NLWA 1LWFB 3H5UA 2YNIA 4HKQA 3M9NB 3RB4A 4NLQA 2VG6A 5DG8A 1EP4A 5C24B 2C2RA 3FQLA 3DRPB 3TAMA 1QAJA 5F8GA 3I5CA 4KKOA 1U09A 3DM2B 3DDKA 5KG7A 4QWCA 1FKPB 4Q8EA 3KMQA 4NLUA 2QE5A 4H4MA 2YNGB 4EO6A 4URQU 3LANA 3V6KA 3IG1B 3MEDA 2XC9A 4ZVFA 2GC8A 1S1XB 4ZVHA 1JLFA 3IRXB 1S97A 4ZPCA 2UVUA 3FFIB 3T19A 2VG6B 4WE1A 2FLPA 4QW8A 4FS1A 1HMVB 4YP3A 1C0UB 1Z4UA 2RF2A 4JV0A 3FRZA 5L1IA 3RBDA 5KFLA 3CIZA 4TYBA 4EO8A 3GIIA 3CWJA 1JKHA 4H4OA 2GIQA 4GC7A 3KLEB 5J1EB 1T03B 4EEYA 2UVWA 2XGPA 4IFVA 4YR2A 2R8JA 3LAMA 1K1QA 4NLOA 3QO9B 5KFIA 5KFCA 5KG2A 3C6UB 3GYNA 1XR7A 5HROA 3PW5A 4B3OA 4ZP8A 4GC6A 5J2PB 3RBEA 1JLGB 5KFSA 4IQXA 4R8UA 4IRKA 1EETA 4G1QB 3KLGA 1TKZA 4WZQA 5KT3A 1UWBB 4EBEA 3LALA 1S6PB 3Q8QB 2XWYA 5DGAA 2ASLA 3MF5A 5F8IA 3QZ8A 3MEGA 2HNYB 5HBMB 3H5XA 3RAQA 5KFOA 3NKYA 2BANB 5KT6A 5J2QB 4TY8B 5KG4A 4MFBB 5D3GB 5KFTA 4QWDA 4ED1A 3MECB 3G6YA 5F8JA 3D28A 4ID5B 5KFGA 2FJXA 4Y3CA 4IKAA 4M95A 3T5HA 2VA2A 3KHHA 4O3QA 3DRSB 4PUOA 4RW9A 4MK8A 5KFBA 1OS5A 4J9SA 1HNVA 4ECSA 5DG7A 2ASDA 1RA6A 1VRUA 1LW2B 1S4FA 4F4ZA 1S1VA 3T1AA 4ED7A 4F4XA 1VRTB 1N5YB 1J5OA 1JIHA 1JLEB 3CJ3A 2WHOA 1IM4A 4NLVA 3ICLA 1RAJA 3DMJA 5KFEA 3V4IB 2ZE2A 1RTJA 1GX5A 4PWDA 3DRRA 2IA6A 5FDLB 3M8QB 4KAIA 3H4DA 4KO0B 3ISNC 4Y2AA 2UUWA 4WYLA 4TN2A 3Q8SB 2WOMA 4K4TA 4ZP9A 2OPSA 5J2MB 3KK2A 1TP7A 2WK4A 4Q45A 4TQSA 3MR6A 2W9BA 5C42A 1HQEB 4IOBA 1TVRA 2FLLA 5L1KA 4O4GA 1MU2A 1W25A 4NLYA 4ZP7A 5K14B 1S10A 2YNGA 1S9GB 3IGVA 3M8QA 2CJQA 3LP2A 2JEGA 4PWDB 3CDUA 3DOKB 5FDLA 3OSNA 3DLGA 1FKPA 3E01B 5J2NA 4TY9A 4ECRA 1S1WA 1T94A 3HKWA 4O3RA 1RTDB 3V6HA 2YNHB 1FKOB 4WXWA 4ED8A 2D7SA 2IAJA 5F8LA 3KLVA 4RZRA 2C2EA 1SH3A 4RNNA 3M9OB 5DQHA 3HVTA 1REVB 3GQCA 4IG0B 5DGBA 3H5SA 1HQUB 2RDIA 4HYKA 2FVCA 1CSJA 4MKBA 2V9WA 1SH2A 4XPCA 2AGOA 2YNHA 4ED3A 2FVRA 2ZKUA 3GV8B 5J2NB 2IM3A 1JLQA 3MR3A 1T03A 2ZD1B 5KG1A 4LSNA 4RW7B 4TYAA 5L1LA 2DPJA 1I6JA 1LW2A 4MIAA 3N6LA 1TL3A 1DTQA 2UUTA 1LW0A 4O44B 2D3UA 3CJ5A 1IKVA 3OLAA 4DL3A 1XR5A 3TQ1A 1JLAA 5L1JA 3H59A 3KJVA 1K1SA 5DG9A 1S6PA 3FQKA 3RB0A 3IRXA 1TKZB 3BSAA 3H2LA 1S0MA 1BQMB 4DG1A 2HWIA 4KHMA 2XI3A 3JSMA 4PQUB 1DTQB 3H5YA 3I0RB 4JUZA 1IKYA 1C2PA 3FSIA 4I2PA 3MEGB 2YNFB 1JLBA 4IG3B 3JYTB 2HNZB 1DTTA 1SUQB 5HLFB 4QWBA 4J9MA 1TKTB 3MECA 3UPFA 4RU9A 4QWEA 5HP1A 5I3UA 4F4YA 1RT5A 3BSCA 5KFAA 3IN5A 2W8KA 4LQ3A 5KT4A 4B3OB 4Q8FA 4FS2A 2YKNB 1RT1B 3H4BA 1HPZA 1N6QB 4NLDA 5KFWA 4ECWA 1S6QB 5KG6A 3QYYA 3GV5B 4URGA 2B43A 2GIRA 2OPQB 1TKTA 2R8HA 2W7PA 1DTTB 5HLFA 1C0TA 4IDKA 5F8MA 1RT4A 2I5JB 4RUAA 4NLRA 1EETB 1C1CB 3KLGB 3KLFB 2D41A 4Q0BA 2AX0A 2OPRA 5KFRA 3GV7B 1RT5B 3BQ0A 1NHVA 1HNIA 2C28A 3V4IA 2CKWA 4WXOA 4I2QA 2YKMA 2ATLA 3DLEB 3PHEA 2AQ4A 1BQNB 2R2SA 3NL0A 3DI6B 4IH5A 1HQEA 2VG5A 3G6XA 5KFUA 4RW8B 1RT6B 3CJ2A 4K4XA 1RTHB 3DYAA 5CYMB 3KK3A 4KFBB 2JEIA 5KFYA 1QE1B 3CVKA 3KLHB 3N6MA 5C25B 2AX1A 3KNAA 3T5LA 1MMLA 4JV1A 3LP0A 4ECVA 3OHAA 4EYHB 1S48A 1JLEA 1S1WB 4DL2A 3E01A 4KE5A 4R5PB 2YNIB 4MK9A 4IG0A 1TV6B 3KMSA 4KFBA 2HMIB 1RDRA 3KK3B 2ILZA 4ECXA 4KKOB 1RT6A 5F8NA 3DLKA 4TLRA 4K50A 2WONB 4LSLB 2B5JB 1S1XA 2IJFA 4NCGA 5J2MA 3MFIA 3QLHA 3EPIA 1UWBA 1JLCA 3MEDB 2C22A 4J9LA 2FVSA 3IG1A 2RKIA 4KV8B 5CYQB 2C2DA 4R5PA 2HMIA 3I5BA 1S9GA 4ZPDA 3QIPA 2ZD1A 1S1UB 4KBIA 4IRCA 2E9ZA 4IDKB 3NAIA 5JUMA 4NCGB 2O5DA 4J9PA 3KLEA 4LQ9A 3T5JA 2BQ3A 2J6SA 2R8KA 1ZTWA 3JSMB 4ZPBA 2RKIB 4KV8A 5CYQA 3BR9A 5KT2A 4IR9A 4RNMA 3Q8PB 5J2PA 5KFXA 2V4QA 5HROB 3DRSA 4PUOB 3BQ2A 3DI6A 3OL7A 1KLMB 3PVXA 2AU0A 4EBDA 4YR0A 1RT2B 4RW4A 1SUQA 3CDEA 1RT3A 3QGHA 5KFNA 4RW6B 5I42B 2R8GA 2YNFA 4DEZA 3PJWA 2ALZA 1ZETA 4KO0A 4I7FB 5HBMA 2IM2A 4ZHRA 4LSNB 2FVQA 4IH7A 2ASJA 3KOAA 1DLOB 3SI8A 4NLGA 3NMAA 3LP0B 1S1TA 1RT2A 2W9BB 4WYWA 1S6QA 4J9KA 2BQUA 1HPZB 1N6QA 5KFQA 3KK2B 4WFXA 1S9FA 2E9TA 1N4LA 2VG7B 2HAIA 4TY8A 5F9NA 5DLGA 1HNIB 4RW9B 4ZHRB 3PW0A 1T3NA 4I7FA 4KB7A 1C1BA 1RYSA 2BE2B 1RT7B 3H98A 3PR5B 2V0NA 1TKXA 2R2TA 2OPPA 4ED0A 1XR6A
chains in the Genus database with same CATH superfamily
3DLGB 5A0YA 4N8NA 1X9MA 3VF0B 4F4WA 4B02A 2A3JA 2CJKA 4NRTA 1A0OB 4MH8A 1J27A 2G1DA 3OLBA 3KHLA 3DYAB 2MKSA 1KFSA 3GIJA 4UOGA 3IC1A 2IM1A 2ZH3A 1OY6A 2H51B 1S76D 2HVHA 2UVRA 3D66A 4KYZA 2BJ8A 2EI5A 4ZPAA 1NDPA 5LJ5Y 4OYXA 4JI0J 2OPRB 1HWKA 4O3OA 1C0TB 2OEKA 3GG1A 5E3CA 2DH9A 2MZJA 5KOWA 4DZDA 3BR8A 5KFDA 1K73T 1LWCA 5AXNA 2R8IA 4WFYA 2WVCA 2B5JA 2GJIA 3BSOA 4ZCKA 4H4OB 1IM6A 4PG4A 2XMWA 4C4WA 2JEFA 2VQEJ 3MMBB 2AT1B 3M2VB 3J7AN 1XWLA 2GMHA 1Y4ZB 5KFJA 2N4CA 3C6UA 4F0HA 2CPFA 1WG5A 2PI5A 3JYTA 1PJ6A 3PDNA 5T7LB 1M1KT 2HS4A 3EGNA 2AZ3A 3LPYA 3QIPB 4MIBA 2ZEJA 4DN9A 2P8IA 1JJ2R 1C1BB 2SXLA 1JNRB 5B7WA 1TL1A 1Q8LA 3Q8YA 1WSRA 1HBOB 3MR2A 2CPDA 1OMSA 4ZVQB 4WE1B 1JMTA 5H9FK 4RL1A 3NGRA 4CO5A 2K7KA 5D77A 3M2RB 2ROEA 3ZZ0A 2B3TB 3GFYA 2CFXA 1P6TA 4X66F 5KFHA 4J9QA 3PJXA 4C11B 4NLPA 4ECYA 1U45A 1BGXT 2UXDJ 3NBPA 3TJAA 2CNNB 3BPSP 3UN5A 1RTIB 2B4OA 1DQ8A 4IRDA 1Y5IB 4JI5J 1WI8A 3ENVA 3KJFB 3VAMA 1YRUA 1F5AA 1JQGA 4IFYA 2YWWA 3KK1A 3MM8A 4IH6A 4V1Ak 4I2PB 4LF4F 3GR0A 4K4ZA 1IKYB 1S6OA 3QFHA 4FNIA 4ES2A 4O4RA 5L9XA 5LSOA 1URNA 4KH0B 2VG7A 2FC9A 4A8FA 2C3YA 5D0HA 4F04B 2GVDB 4WK3A 5M2PA 1X4FA 1VK3A 9RUBA 4FVMA 1YKWA 1RAGB 2PA3A 3OR2B 3PNIA 3QBCA 4X64J 2QGFB 4QPXA 4BC7A 2YPZA 4RNHA 2FQQB 4DR1J 1R0CB 3U7JA 1D1UA 1IBLJ 4BHQA 3MAAA 4B08A 1VQKS 1C1CA 2DPIA 1UKUA 1RT3B 2FD2A 1B4SA 1TMMA 1SH0A 2DXFA 2OFGX 2MYFA 3I96A 3GIMA 3GILA 2V8VA 2C2NA 2JLEA 1RWPB 1X9SA 1BQNA 4ECQA 2AV5A 3BGRB 3CXCR 5EX0A 2WBMA 1WG1A 5E7OB 5HL7Q 1HNVB 2RDJA 1VMBA 4OZ0A 3WHIA 2FY1A 1VISA 2RH3A 2H4WB 4R0EA 5IQQA 3VTIA 3QGIA 2RILA 2NXUA 4Q44A 4IFVB 2LXIA 1B99A 3K5PA 4DX8H 4P6QA 3VGVA 3OJUA 3NAHA 1SI9A 1FTRA 1FRMA 2GS8A 4OYIA 3AD7C 1D9AA 3R7BB 3N5BA 2BE2A 4DS4A 5DQGA 1SKSA 3ZZOA 3TEGA 1WOPA 1U1QA 2VIHA 4ANDA 4ZVPB 1T02A 1U0SA 1RHUB 2EW9A 3L7PA 5KG3A 3V81A 4DV1J 3HHLD 3C2PA 4WKRA 2CADA 4M8LA 3KLIB 1R0AA 4FBTA 1KHWA 3G2XA 3G96A 1QDUB 3FFIA 4F36A 3TJ9A 1SB6A 1U7LA 1XTZA 3RYLA 1K0VA 4DOZA 4ED2A 4O3NA 1F5BA 1NCLA 2AYGA 4ZMMA 2C1EB 1B7YB 4EBDA 5LOQA 1N36J 5J2QA 2VQEF 4HR2A 3NXZA 2HVIA 2R2RA 4I1TA 3GG0A 3D6FB 2RSQA 4CYUB 2OJ3A 1BQMA 4DG1B 4U6PA 4QIFA 1H2UX 1I1GA 2KT3A 2EG2A 2R4FA 3IXQA 3DOLB 3OL6A 3K0JA 4NYOA 4MTPA 2YY3A 5DETA 4NZ0A 1WDTA 2FLOA 1S1TB 2Z56B 4DL5A 2KO1A 4GVBB 4RO0A 5J1NA 4Z37A 3BYRA 4I0WA 5DLFA 3PW7A 3EZOA 3HVTB 4FZVA 2HGLA 4J90A 4LFCF 3IGNA 1HW8A 4FVCA 1CBKA 2W7OA 5I3UB 2HG4A 1M5KC 3LTOA 4X4SA 4GKKJ 3DOLA 2YWEA 1YRXA 2MY7A 4C8NA 1H2TZ 4ED5A 2J9EA 3K8WA 1CVJA 3CD0A 1SL0A 1IQZA 1RWWB 3T3FA 2J0SD 4X2BA 1V9OA 2YKOA 4LR8A 2UXDF 1IKWB 1VCTA 3QT6A 3ULHA 3FJ2A 4FYVB 3SFGA 2BKOA 5D4LA 3TQEA 5HQMA 5I4MA 5I42A 3MM6B 2LVWA 1S49A 4X4TA 3FKBA 1L5UA 4WZMA 3CC2S 3A13A 5I3QA 2VQFF 3OTCA 4DR7F 2HHHF 3U02A 1FXRA 2A6OA 3LWMA 1RHJB 2OHDA 3UE2A 4OX8A 5A8RA 1PILA 5KFKA 1GNKA 4XK8C 2Z0GA 3HSZA 2XMKA 3O2IA 1LV5A 1SV5A 2MZRA 2K06A 3MM7A 5E3PA 3TAMB 1X4DA 3DRRB 2CJAA 2J8AA 2L48A 2V34A 5HANA 3CJ8A 3R97A 4CI0B 2HNZA 3FMBA 3ZZZA 4K4YA 3VAIA 2P6SA 2JZ5A 3B6BA 3D0IE 1ZAWA 4MKAA 2VC0A 4LF5F 4KHRA 2YKNA 3D67A 4J9OA 4IUFA 4MMOA 2DB1A 4OJHA 2I6WA 4Z7YA 4NLWA 1VI7A 2VODA 1NU4A 3M9NB 2PC6A 2BUNA 1NHKL 4L3NA 4L76A 4V19J 4PCQA 3IBCB 2FJDB 1VQ9S 1R6YA 1X4EA 3MOJB 1AA1B 2LA4A 1GK8A 4QWCA 3ZTSA 4KKOA 2PFDA 5HATA 1KP6A 2B9WA 2QA1A 3LO3A 1DRZA 2VB6A 5IWAJ 4YHHF 4H4MA 3CJQA 2MQ8A 3DKDA 1ZM2A 4EO6A 4URQU 2ZH5A 4B9MA 3EVMA 3IG1B 2XC9A 3KTQA 2G1HA 3NG8A 1S1XB 2GQCA 1JLFA 2KI2A 3V4MA 1H7WA 2CAJA 3QFWA 1R7IA 4ZPCA 1UA0A 3MM5B 4OV1A 3LOUA 2VG6B 1EAYC 2FDNA 3CSKA 5AJ3F 2CXEA 1C0UB 1X4GA 1Z4UA 4QR1A 3GIRA 3M6WA 4P9SA 4CLPA 3SZ2A 1KKHA 2XMTA 1NRKA 1UJ6A 3RJMB 2B4PA 4DV1F 2H1YA 2GIQA 2XMAA 1F2HA 2E1CA 1S7IA 3GZ7A 4OV6A 5SZTA 3WX8A 1ZPVA 1K1QA 2KJVA 2VL1A 2HS0A 5KFIA 4AXJA 5KFCA 1EIYB 3CJRA 1XR7A 3GYNA 5T41A 2UXCF 1RU2A 5HAOA 3HPOA 5KFSA 1ROFA 4K5RA 4FNHA 1MWYA 1AYEA 4GVBA 3NCRA 1RBAA 1F9FA 3C46A 3LUYA 3OVAA 2WB1D 2XWYA 2ZWOA 2HVDA 3Q8QB 4DV5F 2HHTA 4OLPA 2QTWA 3QZ8A 4ZLNA 5HBMB 1F1BB 1RI7A 2L9WA 2ZUAA 1Q8IA 2DCUB 2WBRA 3NKYA 4U8VA 5CH7B 2MLZA 1F9EB 3FRYA 4LFCJ 1A9NB 5J2QB 5EN1A 3T41A 2RQMA 5D3GB 3RW7A 1WHXA 2DEJA 4G6VB 4PQAA 5F8JA 3DN9A 2ZUGA 4UZBA 5KFGA 1V3RA 1S4EA 3C14A 2DNLA 3KG1A 1RU1A 2W24A 4J7CA 2VA2A 1WKKA 4P52A 4YY3J 4O3QA 5I3PA 3DRSB 4MK8A 4RW9A 2H65B 4ECSA 5DG7A 1HNVA 1W26A 3G8QA 4MAKA 1KEKA 3GFZA 4F0MA 2XHWA 3SDEB 4DV7J 4P7VA 3MPVA 4ED7A 2GHWA 2KFZA 1N5YB 1J5OA 1HI8A 2ATCB 2EFGA 2XYGB 3CJ3A 3SXLA 2E5HA 4M5DB 5LSLA 1PBAA 5AXLA 2O3DA 3V4IB 4PR6A 4AL7A 2Q43A 3PY8A 4V19X 4LBPA 2RE1A 3NS7B 2V8HA 2N7CA 2J7WA 1F3VA 4FYWB 2M88A 4WYLA 2WOMA 2OMOA 2NS1B 2M3DA 4MYTA 5ETNA 3Q0AA 1U1PA 3TW0A 2IYGA 4H4KA 2HFVA 2HFSA 2DNYA 3MD1A 4W4MA 4UQTA 5K14B 4DV6J 4CIOA 1TELA 3IGVA 3QNWB 4ITSA 3M8QA 1NB7A 2DR8A 2W25A 4PWDB 5FDLA 3DLGA 1FKPA 3Q86A 2ZH2A 4ELVA 3HKWA 1ELOA 1WC3A 1NK8A 1RTDB 3CJTA 5BYQA 2RQKA 2ZBIA 4WXWA 1WKLA 4LFBF 1AT1B 3HJVA 4Y28C 1U8WA 1WHWA 1U8SA 2K1RA 5F8LA 4RZRA 4DSKA 2AJQA 3G8SA 4YHHJ 1WEXA 1HIYA 3KNGA 5CZVA 5DGBA 1HBUB 3NWRA 2YKAA 2RDIA 4E0DA 3EZ5A 4OYZA 4RKUC 4QJVA 1Z2LA 2PD1A 4RLEA 1XBWA 2ZKUA 2DR9A 4ELUA 1JLQA 2IBOA 1DURA 2ZD1B 3AAWB 1M5VC 2C3PA 2DPJA 2F4FA 2J0WA 3BKUA 2CUYA 2GQQA 4X4NA 2AF6A 5ETMA 3J7Z5 2D3UA 3EICA 5F3ZA 3OLAA 3PX0A 5HMZA 4K0KF 3E8OA 1JXVA 1XR5A 1ZM4A 2BACA 4DSEA 3TQ1A 1HD1A 3H59A 5DG9A 2ZWPA 2FGOA 1UW4A 2ZDPA 3HJFA 5L9NA 2MKIA 3PIPQ 4KHPF 3FQKA 4F2SA 3IRXA 2O66A 1TKZB 3BSAA 2V69A 3H2LA 2XQCA 1VDHA 1UEKA 2GJ2A 3W1YC 5F41A 4FF3A 3K89A 4ERDA 1UFWA 1VLYA 3I0RB 3ELHA 1WC4A 2HFOA 4I68A 1JLBA 2A1BA 5B0FA 1FI4A 2DY9A 2X1FA 1RAEB 2ZHAA 3BEGB 4DFJA 2VBYA 4C7QA 3UPFA 3R7SB 4QWEA 2HHQA 1VHIA 3D3CJ 3Q22A 1IVZA 4FYDA 1KFDA 2LQ5A 3B4DA 3BSCA 4BWMA 3CGIA 1G2EA 4B9NA 4X4QA 2FHKA 1D8YA 1B70B 3PO5A 1HPZA 2IRUA 5B0AA 3J81Y 1RAAB 2DNHA 3AA8A 1RGVA 1DTTB 1V5IB 4IDKA 5A76A 2R8HA 1AXQA 2X51A 3JTNA 1EETB 3KLGB 3KLFB 2D41A 2FHJA 2V50A 4X65J 2AX0A 3QMQA 3L09A 2OPRA 3CDAA 3IMQJ 4RBTA 1WUUA 3GV7B 4U9RA 1TUVA 1TKDA 2AMCB 2CQBA 3V4IA 2CKWA 3EUNA 4A8XA 5LXRA 4I2QA 4F25A 1UVJA 3PHEA 2AQ4A 2PA8D 5IC6B 1B0VA 3DI6B 2DGOA 2VG5A 2MQQA 1CEZA 4Q2MA 3DYAA 1IR1A 4KFBB 1E6YA 3DDNA 4G1PA 5ETTA 3EXCX 5KFYA 1RADB 4UT4A 4DLGA 3R6GB 1YLXA 1HQ2A 3N6MA 4CO1A 3HK2A 4M5HA 4I69A 4WU2A 2CQ0A 3TUIC 3OHAA 3D0GE 1S1WB 2MLXA 4DL2A 3DXBA 2B56A 2E5GA 4R5PB 2RHQB 2Z2LA 1LXNA 4BBYA 3HULA 3BBBA 3U1MA 1RKJA 2YTCA 3PRDA 4DS5A 1ICEB 2ILZA 2Z8QA 2UU9J 2YWGA 4O23A 4DQIA 2EXUA 4DHVA 4I6WA 3P45B 4NL5A 2WONB 1S1XA 4U96A 5J2MA 2GGPA 3D1HA 3MFIA 4ZN3A 3EPIA 2CA9A 2GCFA 1XMQF 1NK7A 1P1LA 1SQGA 2FVSA 2AJ0A 1QSYA 2NR0A 2FJEB 2IVFB 2B7BB 3W66A 1QVGR 1KQFB 4ZVSB 2OMLA 3CNQP 2DH7A 4OMFG 4HDGA 1S9GA 4JBCA 2N3OA 4JI2J 2RUSA 2ZD1A 4NEZA 4KBIA 4UZCA 2E9ZA 3R5GA 1VQ5S 2F7VA 2L9DA 2O5DA 1N33F 4IOAQ 4A8SA 2R8KA 2BQ3A 4CLZA 1FJCA 1V3ZA 3PRVA 2CPXA 3JSMB 2PGCA 5CYQA 3I9V9 3D6MB 3TEHB 2KRRA 1S7HA 3CW2C 5KFXA 4B9TA 2HHUA 1REGX 1RBLA 3TVZA 1TU0B 2E7XA 2XMMA 1YJRA 1KDNA 1PC5A 3JQKA 5DM6Q 4YR0A 5GAEI 3W8GA 5IM0B 5H9EJ 3CDEA 3HHLB 2HW3A 2HGNA 2HHPA 4OHWA 5HVHA 3DXSX 3PJWA 4DSLA 1WC1A 4YDDB 3MPDA 4I7FB 1Q0NA 2AZ1A 2ASJA 2ZVSA 4YEAA 1R8AA 5HJXA 3L3CA 2RT3A 4HI2A 3NMAA 1S1TA 2GX8A 3LGMA 4OI2A 2UP1A 2V4JB 4UOFA 2VBZA 1RWVB 1S6QA 2QX0A 3GYXB 4DR5J 2BQUA 3NOCA 4L6V3 4EFAC 2IDEA 2XM3A 2JLFA 5KFQA 4RWXA 4WFXA 2IA0A 2AEJA 1RP5A 2Z2ZA 4ZVRB 1JNZB 5AE2A 4DWIA 1HNIB 4ES3A 4RW9B 2F8MA 4HT7A 3DLHA 3HSJA 4CNYA 3H98A 2PO4A 2R2TA 4WP3A 2OPPA 2NSBA 1UPPA 4DL4A 1WD6A 2KM8B 2DBBA 1TFYA 2EPIA 3GP9A 2U1AA 2MDAA 3IBFB 2MB0B 4JI5F 1N5YA 1J5OB 1NEEA 1XERA 3M9MB 2ZZMA 3M6VA 4C8ZA 7AT1B 2FJBB 2OEMA 4YB6A 4C48A 3V81B 1WI6A 2N7YA 3D4JA 3TA2A 1Q5VA 3VVTA 2EFNA 2OH2A 1T9YA 4KIAA 3N6NA 2RD5C 3MI7X 4L74A 4NYZA 4MT1A 4A8QA 1DBDA 3HD2A 2G2ZA 4IYQA 4TXSA 3PO4A 3CO9A 1KBRA 5A2QU 2QJ3A 2X1BA 3UNYA 1LWEA 3H20A 3S7RA 5E41A 4N56A 4DUYJ 4MKYA 1UJ5A 1PG5B 4WTOB 1WDDA 1UJ4A 2CIMA 3H0PA 1YGYA 1IWAA 3POTB 1UEUA 3NLCA 2G2YA 5DDOC 4CZCA 4DR1F 4O3SA 2CWKA 3QLHB 2IHR1 1X4HA 3IBWA 4Y2IA 2AD9A 2LU1A 4R0JA 4DX6A 1IBMF 2NXJA 2HK3A 3CC4S 3NS6A 3AXKA 1YHQS 3BBFA 3MAHA 2ZOGA 2IAJB 2ZBRA 3RB6A 2YWKA 3GJRB 2LLZA 1NSPA 1N5VA 3KUHA 3BREA 1FKOA 1IJEB 3W2VA 3ZZTA 4KGVB 3I82A 3CCQS 3QRRA 3RR8A 1T8EA 2E5LJ 3KLHA 3D5MA 1S9EB 2BJ7A 2KZMA 1ZA2B 4H4MB 3UR0A 2IM0A 3OFGA 4ZVUB 2MXYA 3HVAA 4QW9A 1YVFA 3OFHA 3OTOJ 3B78A 2CJBA 3HHKA 1J5EF 3JAMU 3J7YU 3NNHA 2D3O1 3CDWA 3ZC4A 5IV4A 4DV7F 3MM8B 5KT5A 5A2QY 1RT1A 2HRTA 1IKVB 3CTRA 1CJUA 4B3RF 2UUBF 2O1PA 3QSIA 1RBOB 3R1HA 2R2UA 3EGVA 1KRPA 1U6ZA 2UUCJ 1S9EA 1AFJA 4CLWA 8AT1B 4K4WA 4Y34A 2WRMA 1MMDA 1WC5A 2APOA 4N76A 4NLXA 2HVZA 3J81j 5HVFA 1NPPA 3IWNC 3OVBA 2HIQA 4JV5J 2DHAA 5M2RA 5EWGA 2IVMA 2GZOA 2GAGC 1NK6A 3SDEA 4GKJF 3R1LA 1T11A 1Y00A 3MTKA 1Y3KA 4IOCQ 4DR4F 2I1RA 3MAQA 3M4XA 1Y0HA 5CQGA 4PG6A 2BYCA 2HFUA 1AZSB 4RBUA 4DR7J 4URSA 2GFFA 1FERA 5D3GA 1UVMA 2UXCJ 3EYZA 1XMOF 2YKPA 3C15A 3CD5A 5ETKA 1M1GA 2CVIA 4JI8F 3JAMY 3M6XA 4ZLLA 2Y3YA 3BSNA 4USKA 2YWHA 4Q0BB 1PYOB 5CD4A 1OWXA 1OYDA 3MTJA 4PXCA 2BMBA 4B3SF 4UUXA 4KGMA 2DTJA 5KAKA 1TL4A 3P8BB 1QLNA 2V4JA 4C0BA 1FRHA 1UAWA 5CCMA 2XB2D 4DV3J 1F9HA 3AXMA 4ZITA 3CULA 2W9CA 3H40A 4ECTA 2D74B 3DNCA 2Y1RI 3MAAB 3VZHA 1VQ4S 3CE8A 4PEOA 2FIUA 3BJYA 1A6LA 4K2JA 2L41A 4ED6A 5LJ3Y 3DOMB 3CD7A 4AUKA 3TA0A 4CLFA 2NQPA 3M8PB 2EC2A 4ANCA 1XMBA 1R8PA 2J9DE 2LCWA 1KQGB 1UZHA 5CCLA 4WFAQ 4QIVA 4YQWA 3JTOA 4WWSA 3FUYA 3L4BC 3MMBA 4LT6A 1UVNA 4XPEA 2C3OA 2ALYB 4BLGA 5ADZA 1C4AA 1Q7YT 4EZ9A 2AP6A 1V3SA 1MU2B 2YX7A 1C0UA 2Z57B 3MDFA 2F8EX 4RNOA 2WCXA 4PWUA 2V9KA 3GCXP 3FMWA 1RJJA 3ITHB 3KJVB 1NHUA 1PAUB 2EBGA 1D8ZA 5J1EA 2LU2A 2ZM6F 3WIVA 1UEVA 4ANEA 4DFMA 1N32J 4B3MJ 1YJTA 2HBRB 1LW0B 2Q3PA 5CYJA 3MR5A 3LP2B 1Q7LB 3ET6A 4HH0A 3GMGA 2QYCA 2XI2A 3O1LA 2B8QA 4NMLA 3M32B 5KFVA 3W63A 4AQYF 2IMWP 1KVIA 4QYRA 2QO3A 1GFWB 2NCKL 3AHPA 2EFQA 4ZJLA 2VFRA 1RHRB 5L38A 2W7AA 1CJTA 4LF7F 4PQUA 3JQMA 1OY8A 3I0SB 3EVWA 4M5IA 3SCLE 3QGGA 2E44A 2JOQA 2E1AA 1QVFR 1TK5A 3MOZA 4JV2A 3FDSA 3R2CJ 1YITS 2GHVC 1AUDA 3I87A 3BGFA 1GXUA 1T9WA 3ETOA 3DHWC 3KHGA 1KLMA 1BD6A 4N47A 4DUTA 2NPIA 4U95A 4ZKAA 5IZHA 1Q82T 3MCOA 3T6JA 5EGYA 2VA3A 1G3OA 3ZNJ1 2RF2B 4USJC 4HH1A 2E9RX 1U2CA 2LQBA 2Q1LA 2OPQA 1F0XA 3OR2A 4E98A 1YJ9S 4LFAF 4OI6A 1S5ZA 1VC5A 2W4PA 3OT9A 4NRUA 3IAS9 5ETOA 2FHOB 2RB7A 2IFXA 4PPDA 1X4BA 1FFSB 2OKQA 2U2FA 4I2QB 1RA7A 3A3NB 5KG0A 4J91A 2PI4A 1K0TA 2ZFHA 3KUEA 3LP1B 2DD8S 4YR3A 2RU9A 3RAXA 2AEMA 2RDDA 2V8DA 4O3PA 3UDLA 2GW8A 1EQMA 4DV5J 3F0NA 3MGJA 1VBZA 2FZKB 3OPKA 1HNWJ 8RUCA 2DCLA 4HVZA 1TKXB 3O3LA 4IFYB 3PFOA 3MMCB 4QOTA 6FDRA 3SSSA 3T5KA 1EARA 2MLYA 2L08A 5F8HA 2UVWA 3R5BA 3EPGA 1XMOJ 1T05B 2HS3A 1OSCA 1T9UA 1N5TA 1WOSA 1PKUA 2EFOA 4DV4J 3A8KA 2VICA 5FLXY 1VQ6S 4DQPA 4Q43A 3FQLA 1AUSL 1Q86T 3DRPB 2M5YA 5F8GA 4X4RA 1HBMB 2CVEA 3VR1A 3DM2B 4A8MP 4Q8EA 3BBCA 3KMQA 4NLUA 2EBEA 1FD8A 3WIUA 3V2UC 3MEDA 3DCAA 2J7KA 4KY3A 3TP2A 1F5CA 5E0OA 3IRXB 3QT8A 2QMWA 2UVUA 2AEFA 3FFIB 1SC4B 3GSDA 4LF1A 3I32A 4N77A 2FLPA 1HMVB 4YP3A 1X60A 2RF2A 3BGOP 2XULA 3FEXB 4KGXB 4JV0A 2HURA 1OQ3A 3FRZA 4Q2LA 3VV2B 1S0VA 3CIZA 1DZ5A 4TYBA 4OHYA 3GIIA 1N8RT 2M52A 4H4OA 3CWJA 2FJAB 4CP5A 3KLEB 4DV6F 3TUJC 3EDRB 3FC9A 5ETQA 7FD1A 2N82B 4NLOA 4YR2A 4AL6A 3AJDA 2AYBA 1PYTA 2AHOB 3C6UB 4M5JA 4DF4A 4DU8A 4GC6A 2HZVA 2FY8A 3OTBA 1FXDA 4CH1A 4R8UA 1IUJA 1NZ8A 3BO3A 1BWEA 1EETA 4G1QB 3KLGA 4OI3A 1TKZA 1Z1ZA 2DNZA 1UWBB 5KT3A 4EBEA 4OJ3A 1QSSA 2HHWA 2W2MP 2DITA 3VAFA 4BWJA 3TANA 3DHXA 5DDQC 4CLLA 5F8IA 2HNYB 1OPIA 2XY5A 1AFIA 3HHDA 4LJMA 1O6XA 4EWTA 3GONA 2RRBA 5C2GA 4NE9C 4TY8B 1NJXA 3BZQA 1MROA 1YBAA 1EX8A 3OFFA 4J9UE 3D28A 2BVZA 4C8YA 4ID5B 1OY9A 1RE1B 4L3KA 3ZTOA 3NMRA 4EK2A 2RU3A 1C4CA 1XNQJ 4N5SA 3LH2S 1KONA 3CDBA 5KFBA 2VFVA 2YQ1A 2IRXA 2VBWA 5DS7A 4YY3F 3HXMA 4J9SA 2ASDA 1NK9A 1VRUA 1LW2B 4F4ZA 3I4PA 4MIWA 1SC3B 2KT5A 4A48A 4BC9A 3IRWP 1HNXF 4CLUA 2K7JA 1JLEB 4NLVA 4YB1P 5ETVA 4ELTA 1G1XA 2JRSA 3ICLA 3DMJA 1UL3A 1YZ7A 5IT4A 2ZE2A 1TZ0A 4D3HA 4PWDA 1X5PA 4LIRA 4L75A 2CQ2A 1JJ4A 4DLEA 3M8QB 2IA6A 1W2BR 3DLBA 1ZZFA 4Y2AA 1RCXB 4QCLA 4TN2A 3BN7A 3Q8SB 3D68A 3H2VE 1UVLA 2GMLA 2OPSA 2RNEA 3KK2A 4TQSA 4NA1A 5GMDA 3MR6A 5C42A 1CG2A 4IOBA 2W9BA 1N5SA 3T1HF 1Y11A 4O4GA 1SL2A 1FFWB 2KU7A 5A6WA 1U02A 3HT3A 3VAJA 3BN4A 5E2QA 4FPIA 2XO6A 2DGWA 3EWGA 1S10A 4FF1A 2JEGA 2E5LF 4AL5A 1ZAXA 3TJ8A 2KJWA 2FZGB 2N3LA 2CDRB 3IO1A 3RBXA 5KOXA 4NXNF 2JWNA 4JP8A 4ECRA 1S1WA 1NJZA 4O3RA 5D4NA 2EK6A 2GQ2A 2NYHA 5A8KA 3TNVA 3KLVA 3CCVS 2C2EA 1W2IA 3K2YA 1SH3A 4UY85 5IT9U 5F0UA 1VRQC 2C2OB 2CQHA 2DHXA 2Y1LB 2ZBCA 3GJSB 3M2VA 4GVLA 4IG0B 4Y2KA 2ZKTA 5GADU 4B3RJ 2VKZG 2QMXA 1FHTA 2OP5A 4OJGA 3CCLS 4X62F 4HYKA 1CSJA 1KSPA 2DT9A 4MKBA 1SBRA 2VDIA 3KG4A 4P7TA 2ZJPQ 2E29A 4ED3A 3KYLA 1YJ7A 1B7FA 3ZZUA 3MR3A 5L1LA 4LSNA 2KYXA 4ILRA 4MIAA 1HWLA 2XSJA 3DDIA 4OIXA 1OIAA 1DTQA 2UUTA 1HHQA 4TKTA 4DV0F 2C2MB 3CJ5A 1IKVA 3X1LB 3AB2B 4ZA1A 1J2VA 3PRBA 4OFZA 5L1JA 3S8SA 2B0GA 3W7BA 3RB0A 3G87A 2F4VJ 2CQ1A 1SKWA 1NKBA 1S0MA 5K8NA 1SQFA 4DSFA 3FBEA 3H5YA 4DUYF 1MWQA 1NMEB 1VIOA 2V8PA 3M8YA 2FHMA 4JUZA 4OZJA 4IG3B 1BLUA 2P9GA 4DXLA 5A0YB 2ZJQQ 5HLFB 1SUQB 1OSDA 2D69A 2DYAA 1TKTB 1R3NA 3F56A 4RU9A 2KXNB 3ZTPA 4B3SJ 2XY6A 4CO4A 4F4YA 2FB0A 2AJFE 2RQ4A 3PYEA 4HL9A 1SKRA 3D54A 2VASA 1UETA 4F67A 5KT4A 4DV3F 4B3OB 1L3SA 4Q8FA 4FS2A 2YKNB 3H4BA 1H38A 1U0HB 3CPWR 1R6VA 3CJKA 3SV3A 2B43A 2GIRA 2OPQB 3SQOP 1FESA 1XJWB 2JFKA 2RS2A 4RUAA 2V6AA 1X8DA 4NLRA 3N0VA 4UOCA 4JI1J 1K8AT 5KFRA 1E6VB 2RVJA 3BQ0A 1NB2A 5IT0A 1HI1A 3AD8C 1QAXA 3W9JA 2Y1IA 3VWSA 1M5HA 3CB4A 1WJ9A 2YKMA 3CCZA 3I9ZA 1FCAA 1FWKA 3S01A 1YI2S 2NUHA 3NL0A 5AE1A 1XK8A 1CC7A 1VS3A 5G0RB 5KFUA 4DPTA 1Q78A 1UPMB 3K5OA 3G6XA 3ENWA 1KWMA 1IR0A 3CJ2A 4K4XA 1RTHB 5CYMB 3O6QA 4GRSA 2M7SA 4P71A 4JI3J 4LF8F 2JEIA 2ZM6J 2XS5A 1N32F 3T9ZA 2VFUA 2WVFA 4DR6F 4C0OC 2DGSA 4UQGA 1UMJA 3M6UA 2QG9B 2XZWA 3KDNA 4YDXA 4AQYJ 2I8EA 3LP0A 2NXNA 3AT1B 3A8IA 3BB5A 3MHYA 1RQ0A 1CLFA 3CCRS 4KE5A 4GKJJ 3KDOA 4LF6J 5DDPC 1S77D 1TV6B 1LWXA 4OZ5A 3GB0A 1HLWA 4BCAA 3KK3B 4K59A 1HWIA 1XC9A 1PIEA 4KKOB 1RT6A 4DCJB 2DRAA 2NLWA 2V2KA 2DNKA 1S99A 3R5JB 4LSLB 4WTYA 2G9OA 4K8RA 4WFNQ 4NCGA 2QLWA 1RZMA 3BO4A 1GXTA 2MZ1A 3ILJA 3PIOQ 2C22A 4JI6F 1CPZA 2HQIA 6FD1A 3IG1A 2CQ4A 4KV8B 4OHVA 1XMQJ 2NXEA 1WELA 2HMIA 5DJBA 1Q8BA 1S72S 2V94A 2AJ4A 2XMVA 3AA9A 3NY0A 4ZLJA 3L95X 5BYSA 1R8HA 4LF5J 1S79A 2M4MA 3NAIA 1PYSB 3J7A1 2HRUA 4NCGB 3QPIA 3RW6A 1H73A 4J9PA 2ROGA 2VFSA 4KGKA 4LQ9A 3HLUA 1ZTWA 1Y5NB 3O44A 3MXHP 4LRFA 3UCGA 1LNQA 2RKIB 4ZPBA 4X4PA 4NXMF 4DPUA 3Q8PB 4WP8A 4DV0J 5HROB 3DRSA 2NYIA 1VQYA 3MCMA 3MPUB 3HFKA 4P2SA 3SCIE 3OL7A 1P9YA 1Q81T 1RT2B 4RW4A 2OSRA 5BR8J 2KT2A 2PMWA 1KOHA 5I42B 3MM6A 4RU2A 3R2DJ 3PX4A 2YNFA 4DDFA 4W90B 2JEJA 3NEKA 1PAEX 3RUBL 1MNEA 3ENAA 4KO0A 3MPWA 1JJCB 1VYAA 4ZHRA 4ECZA 2J0QD 4AE5A 4U7UD 1WHYA 3ZZRA 2G2OA 2M70A 1VC6A 2UUAF 2NREA 1X9WA 1RT2A 5GAGU 1SJRA 3JS9A 4QIEA 4F3QA 2W9BB 2GO8A 1R8BA 4IO9Q 2JVRA 2DNNA 2Y1JA 3GCWP 1N4LA 3MR7A 1WF1A 5DLGA 2CPYA 4ZHRB 2DISA 2E1MC 4AYBD 1T3NA 4C9DA 4KB7A 2AJ1A 2F8HA 7FDRA 1CQNA 1RT7B 1JJHA 2VBXA 2Q6BA 4ZIVA 2V0NA 2Z58B 3M8ZA 3PR5B 4FF2A 2ACYA 2BW7A 4ZVEA 3H5UA 3PXGa 2HFNA 1FRLA 1H3DA 4OHXA 1Z2ZA 5D6GA 2QEXS 4F4KA 3G86A 3OR1A 3SBMA 1VRTA 3PR4A 1X31C 4FXDA 1OYEA 4KSEB 2MZQA 2ZOMA 3EX7B 4LBIA 1KD1T 3NCPA 5B0GA 2DNPA 4QIGA 3CCES 4X84A 4JV5F 9ATCB 2BX6A 4A46A 1LWCB 1BHNA 1H98A 4L72B 2VONA 2QMUB 1JLFB 2E1PA 2KYZA 2YVSA 1YJNS 3W65A 1TV6A 5IXUA 1MWZA 2BJ1A 2HYIB 1KQKA 1D3WA 3CJ0A 2DGUA 3GPAA 5LT5A 1SC6A 1WACA 5JMNA 5IM0A 1X4CA 3FGVA 2UVVA 5KFMA 4LRCA 1QAYA 2ILYA 4ZDNA 2YWFA 2HK2A 3W5XA 4DL6A 1YRTA 4UUWA 3V6DB 3K5NA 2QYGA 1LWFA 2MGZB 2JL9A 1R0AB 3HP6A 3VAHA 2AIRB 1K44A 1WWHA 1WHVA 3C6TA 2P9EA 3QWUA 4LF6F 4ZPVR 2HAFA 3SFUA 3GFHA 2CQGA 4F7VA 1HHTP 2UXBJ 3W5YA 2HZAA 2GHPA 3DU5A 2HWHA 2Z2MA 4DL7A 3GTYX 3N01A 1NLKL 2OGUA 5FLXU 2MQMA 3VQSA 1DFDA 4YFUA 3P3DA 2DNMA 2FLNA 1Q79A 4ETXA 3T1YJ 3M2UB 4WK1A 3KXDA 4LFBJ 3I6PA 3ILIA 3ISND 2GJFA 3UD3P 1HNZF 1QAIA 4QPTA 1H2VZ 4C8LA 4ZIWA 5CA5A 3CJKB 1TL7B 4K4SA 2MZSA 2JLGA 4LSLA 1ZM9A 2JC0A 4QIWD 1JLAB 1TK0A 4P72A 4LR7A 2VOOA 3JSRA 3BH7B 3F41A 1BY9A 3QIDA 3GJQB 2BDPA 2HNDA 2XO7A 4U7UK 5KFZA 1V6HA 2UUCF 4AXIA 3AJ1A 2FVPA 3H2UB 2F63A 1RLDA 3OTEA 5K8OA 2J6UA 1QJHA 4QR0A 2IC3B 4IG3A 1RB0A 4FXWA 5E3AA 2I38A 3VHQA 2BM0A 5D0RA 4A47A 5T14A 2W2QP 2RHSB 4KTQA 4DF8A 1S1VB 4BDPA 3I5AA 4DCOB 1IBKF 1PBUA 2R7VA 2G0CA 4J5OA 1NSAA 4ED0A 1H7XA 4CDIA 4RUHA 5E3RA 4KPYA 1WEZA 2E5JA 2MEWA 3AQPA 2R9LA 6AT1B 2ZE2B 3HHEA 4ZCIA 5E33A 2KKHA 4DR4J 2IIHA 1IKXA 4FPRA 1U1OA 3KK1B 2LFVA 2ZNZA 2W2PP 2ZNYA 2KH9A 1ZZNA 5H9FJ 3X3UA 1CJKB 1YTYA 4XO0A 5J1PA 4MFBA 1XEZA 4LVOP 2F3JA 3AOCA 5GAGI 2K2PA 3HHLC 4IQMA 2PE8A 2I0XA 5K14A 5AE3A 1E6VA 1JXEA 4WU3A 4B17A 3U1LA 3MFHA 3HHLA 3OVSA 4WJBA 1YG0A 3NGDA 3GYGA 1IQTA 3D3BJ 1VHFA 1HYSA 2XEXA 2VZ9A 5E3QA 1DY3A 3UNGC 1PGZA 1HBOA 1GT8A 3MEEB 3FNNA 5MLCV 3G4SS 3JXOA 1BXNA 1N56A 5CHCB 5BYRA 1MSWD 2EFVA 2YH0A 4B9LA 1RTJB 4NOHA 3PHTA 3TZYA 3QO9A 4CM2A 1HI0P 1YQHA 3WDOA 3OL9A 1VQOS 1CC8A 2HQDA 2OPPB 4NLSA 2XSFA 3G6ES 3PW2A 3ENQA 1S0NA 4OYPA 4X4UA 3IM9A 2BABA 2KM8C 1JX4A 4G1QA 3MEEA 2X3GA 3PW4A 2VKRA 1SJ1A 1NBEB 3M8SA 4DJBA 2ZZNA 1N54B 3D6HB 5K5MA 4TQRA 3N5FA 3PTWA 4O4GB 4X64F 5DO2A 3UW1A 2MHEA 2WVBA 2O01C 5C42B 2Z4PA 1FX2A 3UDVA 3J80Y 1N33J 3NGSA 4A8OA 3OL8A 3FBFA 3K8VA 2XLKA 3Q89A 4ZVGA 5L8RC 3QZ7A 1LOUA 2K8GA 1NSQA 5LMNJ 1U1RA 3PZPA 2DVIA 1XQIA 5FIIA 2LXFA 2OEJA 2C2KB 2BA9A 2DGXA 3A1YG 2AGPA 2BR0A 3QRPA 1IKXB 2MQNA 1I3OB 3QT7A 2ZZTA 1LK5A 3R5CA 3PG9A 2B6AB 4ICLA 2LQ8A 3UDEA 3T1HJ 3QJLA 3AB4B 2ZOFA 1VQSA 1W7WA 3K59A 5EX3A 5F0WA 5JVHQ 1UFKA 2F1FA 2VC1A 2FJVA 2JDJA 3IS9A 4FBUA 4ZJOA 4J9RA 1MLAA 1EZZB 2BV3A 2DKOB 2KVIA 2C3UA 3UR3C 1H6KX 1VQLS 4IR1A 1RACB 2DGVA 1WSVA 3ZTRA 3ZZYA 2IC3A 3BF4A 3DMJB 2B6AA 4ICLB 3QSYB 4YMEA 3MWBA 3CO0P 3M30B 3UI3A 4OX7A 1WOOA 3EE3A 2PIIA 4DX7A 2IJNA 2FJWA 3TVKA 3LP1A 4X4OA 2I2YA 2OO4A 1XN9A 3OQ2A 3RAMA 4RW6A 3IS9B 2GVZB 4JI3F 3LAKA 4LF8J 4G3IA 1RABB 4KH1B 3HD1A 2Y8WA 2J76E 2EWHA 3DRXA 2WB4A 4ID5A 3OV7A 1RAFB 3SQGA 1SJFA 1SL1A 1DLOA 5HMWA 4OZ1A 2YQ3A 1VQ8S 3UQSA 1QY7A 5DQIA 3BH6B 4M94A 1DARA 3N9UC 2ABYA 3P5TL 4W98A 4DUZJ 1FK9B 2P5VA 5KFFA 2A2DA 2F5GA 2M8DB 2UV8A 2ROPA 4HLBA 1RLCL 4UY8T 1TAUA 3BKTA 1S57A 3P4UB 1FXLA 2P9CA 3S6EA 1WNEA 3BS9A 1RYRA 4NA2A 1HQUA 1ZAVA 1RWNB 4YB7A 4DR5F 1AW0A 2DIVA 1LKZA 2IPOB 2VU5A 2XNQA 1QUVA 1U1LA 1T7PA 2WOMB 1HBUA 2CQ3A 3C6TB 3ISZA 3VCDA 4I64A 3K5MA 2AW0A 3D1OA 2DY1A 2P2CB 1LWFB 1S59A 2YNIA 4HKQA 1UFLA 3OD2A 2CPJA 4ID8A 5DG8A 2R7RA 3W9IA 3RB4A 2HQCA 1EP4A 4PXBA 1FFGB 3VQTA 5C24B 1CULB 3HX9A 4NX9A 4USTA 3UN2A 1HWUA 2C2RA 1CQMA 2ZHBA 1GMWA 3TAMA 2CG8A 1U09A 3I5CA 3DDKA 3UD4P 1P27B 1IBCB 1FKPB 2W2OP 1WKJA 2RAQA 3IR5B 3K58A 3CCSS 2HQFA 2OD4A 2OTJS 1T3OA 3V6KA 3K7RA 5F3TA 2CJXB 3DLJA 4ZVFA 4TU7A 4ZVHA 1S97A 2HHHJ 1XNRF 4OX6A 3OXFA 1N34J 2OIHA 4LRAA 1HD0A 3T19A 1DQ9A 4NI2A 1X5TA 3MUMP 4QW8A 3VAGA 4EZ6A 3NS5A 5GAHI 1MG7A 4NA3A 3IAM9 5GAEU 4JI1F 1N0VC 4GMKA 2QLFB 1UTAA 1KVJA 4EEYA 1JKHA 5J1EB 1T03B 1AB8A 2MKCA 3M1VB 5HK4A 3VVUA 1M0SA 3IM8A 1NO8A 3TUZC 4A8KA 1NJYA 5HMYA 3BDEA 3DOMA 3IR6B 5B0DA 3K5LA 2R8JA 3IA0A 5IFMA 4ILMA 3BM7A 3J7ZT 1M5OC 4KJIA 1EHWA 1YBTA 5J2PB 2RRNA 4ZCLA 4B9VA 3W60A 2WZ1A 2MSSA 5D4PA 4PG7A 3ZNUA 4DV2F 2W01A 1SPBP 3S1TA 3PKYA 1N36F 1S6PB 3WZ0A 1DJ0A 2Z2YB 1JWWA 3Q8VA 5K9FA 3AD9C 2BJDA 3MEGA 4ENOA 4LIWA 3RAQA 4LF9F 3RRGA 1MN9A 4UW2A 2OLWA 4HT5A 5KT6A 2CJYB 4J37A 1M90T 5EWFA 4ED1A 2MQLA 4QWDA 1KQSR 1X5SA 5HVGA 2XWXA 4M5DA 3TZZA 4X65F 3K57A 1VBKA 5IQ6A 2PEHA 1TK8A 2FJXA 2EFPA 1QD1A 4Y3CA 4IKAA 3W2WA 3T5HA 4ZK7M 2W1BA 3KHHA 3R5DA 2MSTA 4PUOA 3P6YC 3DLLQ 1G6BA 1OS5A 1XNQF 4P2FA 4C0HA 4ZOSA 4QYZJ 2F4VF 3T1AA 2X1AA 1U49A 4OYBA 4ER8A 5D4OA 3FVYA 1IM4A 3PFEA 5KFEA 3KG0A 3MM7B 1GX5A 1RTJA 2DH8A 5FD1A 1L3TA 5CAAA 1YJWS 2D9PA 5FDLB 2BM1A 4FF4A 1T95A 2ZDOA 4DUZF 2QLBB 3ISNC 1HL6A 1N5QA 2QC3A 2X3DA 3FK4A 1DQAA 4CLTA 4K4TA 3CUNA 1SXLA 3QT5A 4LSZB 4ZP9A 4DL0C 1ZH5A 1TP7A 1F60B 2WK4A 2DEIA 1FX4A 2DRDA 4OQJA 1HQEB 1CS4A 4DI6A 2R7TA 4CT8A 2FLLA 4ZJQA 1MU2A 1W25A 2CZ4A 4WIIA 1U6BA 1GH8A 4ZP7A 2YBVA 3US5A 3QWPA 2KFNA 2YNGA 4P75A 2H5IB 2LDYA 3JSBA 4DQQA 5K20B 5GMKa 2LQJA 1IR2A 3LP2A 3BGUA 3ET6B 1U1MA 3UD5A 4F0KA 3CDUA 4ZCMA 3WX4A 3E01B 4TY9A 1ZS6A 3K17A 1B0TA 3Q2SC 3V6HA 4R25A 1FKOB 3PX6A 4ED8A 4USUA 2WAQD 1NJIT 2IAJA 2HWTA 3ILLA 3RR7A 2EG1A 2HHXA 2B7CB 2V5HG 3B54A 4E8UA 3FSYA 1REVB 1JK9B 5L39A 4YB5A 2BEFA 3PM9A 4WFBQ 4OI1A 4C3LA 2FVCA 3V5RA 5IWAF 2RRAA 2YNHA 2DNRA 2FVRA 4Y2MA 1N34F 4M5GA 2VQFJ 3CMAS 1JB0C 3Q24A 5J2NB 2LP4A 3V6JA 1WC6A 2FUG9 3SMZA 5KG1A 4RW7B 4I56A 2HVEA 3A12A 3IWXA 3N6LA 4ZS6A 1ZOTA 3F44A 3WC2A 4JI7J 1LW0A 5CD4H 3RU0A 4YOEA 3KUGA 4JYAF 2DGQA 4DL3A 1RWOB 4ZN1A 1JLAA 3M2RA 3KJVA 1K1SA 4MKVA 4YS2A 2JNJA 1RK8A 3H7HB 4YUDA 3DU6A 1BQMB 4DG1A 2PT0A 2DGTA 4BS2A 3C3LA 1GTEA 1ZBTA 2HWIA 1Q5YA 4CYUA 2H5JB 3GR1A 4PQUB 3HI9A 1FVQA 3PYGA 5THWA 3WQPA 4I67A 2KTQA 2L9NA 3JQJA 4B3MF 3FSIA 2HLUA 4CLYA 3MEGB 2YNFB 3R3TA 4WBFA 3TZWA 3JYTB 2HNZB 3B8HA 4USVA 4QWBA 1QM9A 4J9MA 1NK5A 4ED4A 3MECA 3DGPA 2CPZA 2W4DA 5HQLA 4DU7A 5HP1A 4LR9A 2Q6CA 2VPZB 5LL6d 5I3UA 4M5KA 5E5NA 1IBLF 2QRRA 1RT5A 3AJ2A 5KFAA 4ZLPA 4QZVB 3IN5A 3LQVA 5B0EA 3DC2A 3EDQB 3KKFA 1CJVA 3EMTA 3H25A 2J9CA 5CXTA 3MUTP 5H1SV 1RT1B 2E66A 1TR0A 2G0JA 2ZC4A 4NLDA 4DX5A 2DO4A 4MJKA 1S6QB 5KG6A 4ECWA 1H72C 2WVDA 1I5OB 2GNKA 2VF3A 4URGA 1TKTA 1AROP 1FJEB 3CIMA 5HLFA 4M63A 1C0TA 4N7TA 4CH7A 2NSCA 1YIJS 1RAIB 4EGLA 1C1CB 1FRKA 1Y5LB 1BMQB 2E5IA 2J9DA 4Q0BA 2X7IA 4CNZA 1QTMA 1LXJA 3EGZA 2CQDA 1RT5B 1NHVA 1HNIA 4CLSA 2C28A 2FYXA 3OR1B 2PDAA 4NWBA 4OYWA 4WXOA 1VJQA 1VQ7S 2ATLA 4Z7CA 3T9NA 1BQNB 3J80U 3H90A 4IH5A 3HHNB 1HQEA 1CS4B 1YDLA 3FCVA 4GO7X 3W2VB 4PWWA 2BKPA 4K7QA 3CCMS 3AOAA 1RT6B 1YZ6A 2QZ8A 3CMQA 3SSRA 4L73A 4WKYA 3KK3A 4YN3B 3SSQA 1F2GA 2B4VA 1QE1B 2W2NP 2Q66A 3NNCA 3KLHB 3LA0A 2AX1A 3KNAA 4JI4F 1IBMJ 2KRBA 1M5SA 1MMLA 4F3OA 1VQPS 5GADI 2LA6A 2R7UA 1MMNA 3UFCX 4ECVA 5GMEA 1S48A 4PG5A 1FNMA 4HEA9 2XYHB 2WSFC 1RSCA 1WF0A 2IDLA 2YNIB 3C15B 3PACA 4IG0A 2ZC3A 4RX6A 3L7UA 1RDRA 4FXVA 4DQSA 3CCUS 2LEBA 3LF0A 4DSJA 4PKDB 1HA1A 5F8NA 2LDIA 4TLRA 2C42A 3RBZA 2IJFA 3QLHA 1QUPA 3GWCA 1YX2A 4I6YA 1JLCA 4OX9J 2P6TA 3MURP 1T9TA 4OLOA 1NKCA 4J9LA 1GEHA 1GMWD 2RKIA 2C2DA 4R5PA 4ZPWR 3OXGA 2NXCA 2D9OA 3THTA 1U6FA 3QIPA 3QAEA 4LRBA 3R8YA 1L3UA 2MJUA 2V68A 4M5MA 4DPXA 4IRCA 1IWGA 1O51A 1Q53A 2V67A 5T7LA 4W92B 2MTLA 2V2QA 2Q79A 2F9JA 2KVQE 3M1VA 3R6LB 3W8PA 5JUMA 1NXIA 4PAAA 3VGTA 4PABA 3T5JA 1NK4A 3CD6S 5DRKA 2DNOA 1X0PA 2GIFA 3EGWB 2QA4S 1WG4A 2ZH9A 4KV8A 3ADAC 4EU0A 2CNLB 4KT0C 2OAUA 1Q8KA 2K1RB 4OZ3A 5J2PA 4RNMA 4N8OA 4NXMJ 3BV8A 1RXOB 1FWLA 3DI6A 4USWA 4TU9A 1TL5A 2AU0A 1I94J 1O5JA 1P1TA 2H54B 3M30A 4OX9F 2ZJRQ 2ASYA 1SUQA 1LFPA 1Y9OA 1RT3A 3A8JA 3CEDA 3QGHA 5MAOA 5KFNA 4DEZA 2DHSA 4DPYA 3NNAA 4HTJA 2IM2A 1NKEA 4LSNB 1PO6A 3EVOA 1DLOB 3E3XA 3SI8A 3SQGB 3I56S 1UZDA 2CQIA 3LP0B 1P8GA 3HT0A 4C2MA 2MHNA 2RIJA 4WYWA 5HQ8A 1N88A 5LXYA 3A4TA 1HPZB 4J9KA 2KL8A 1GMVA 1HNZJ 2OFHX 1KN6A 2E9TA 1RWUA 1GAOA 2HAIA 2VG7B 1FWPA 2QLXA 4TY8A 3CC7S 1PCAA 4OYMA 1YJUA 2BJEA 3UWTA 4EI2A 3VALA 4I7FA 2BJ3A 3PW0A 1C1BA 3JSYA 1X5OA 2V8GA 1O0PA 2BE2B 1TTHB 3BGLA 3TVYA 2BKNA 3UDCA 4CO3A 2HPUA 2G4BA 2VPYB 3LGNA 4IO1A 5AXKA 4F26A 4DFKA 4F8RA 1JLBB 2YKMB 4I6AA 4XDCA 5C24A 3IFEA 5JXSA 4CQ1A 5DM7Q 4DCPB 2A0FB 1LWEB 4TU8A 3M7VA 1LFWA 5DZ6A 4DSIA 2XTJP 3AY0A 1RTHA 4RW8A 5CYMA 5JVGQ 3P49B 4QU6A 2HFZA 3O8WA 1NDCA 5EDWA 2AGQA 3BGRA 2MKHA 1VGYA 4KRWA 1D9DA 3RGIA 1J5EJ 1FO1A 3M05A 2KN4A 1U0HA 2BRLA 4USHA 1U47A 4RUBA 4C3KA 5EUHA 5EWEA 3W3SA 1M5PC 4U8YA 4PG8A 1GXLA 1RHMB 1ZTTA 2QN6B 2ZH7A 3TARA 1NAQA 1B0PA 2BRKA 2FZCB 3L7OA 4HHJA 4F4AA 5IS2A 2UUBJ 1TFWA 2XMUA 3PYDA 1JLQB 3ZO7A 2HEKA 3OFEA 2MKKA 4RW7A 2JC1A 2ZH1A 2M8HA 1HMVA 2DK2A 2XLIA 1FDNA 1U26A 2CDQA 4H54A 4OI4A 5B08A 3Q8RB 2VDHA 2LECA 5LMNF 5LMUJ 3HF5A 1JKHB 1UWAA 1NPKA 3N4WA 2IRYA 1SJ4P 2JVOA 2DXDA 4AFFA 1T05A 3HCXA 4RR5A 3RG6A 2DR6A 4MYUA 3H42A 1Q1KA 1KTQA 4I4BA 4XAKA 4B3TF 4JB8B 1YWXA 4KGZB 2VG5B 5EHHA 2J6TA 2PFFB 4H4KC 2HKEA 2H4YB 2CJ9A 1ZYQA 1FJGJ 1VK8A 2VHGA 1NNDA 1D9FA 1S1UA 2UU9F 3SCKE 4CTAB 1KOOA 5ETPA 4RNFA 3D7SB 4UTGA 2D3OR 2QA2A 3BKFA 1WTBA 1RTIA 4WIQA 2YH1A 3NBPB 2HNYA 3A8EA 2KFYA 2CWXA 3M8RA 3T1YF 4JI8J 1HWJA 2DHGA 3D6TB 4P2XA 4F50A 2XCPA 1Y10A 3OJSA 4CO0A 2W9AA 3THVA 3DLKB 4HHHA 4OZLA 4G65A 2WONA 5ETRA 1PSDA 4Y00A 5KTQA 3OSPA 2MPUA 1IJFB 1MROB 2MJNA 3MCNA 3G9CA 2IBKA 5U47A 4WFZA 1N0UA 1UA1A 2QL7B 3MM9A 2ZH6A 3FEYB 2ZH8A 1TL1B 2OELA 2R42A 3C16B 4ZP6A 5D8HB 2YXLA 2ZVIA 2YPYA 1ZPWX 1F3FA 3MUVP 4E2FB 1ACMB 4PZVA 1FKAF 2W4CA 4KR0B 3QJJA 4MK7A 2V4RA 1BE4A 1TMJA 1UP1A 3PKMA 1T9VA 2AJ2A 1KC8T 3PV8A 3FZ2A 1NZAA 3RB3A 1EP4B 2CRLA 3HO1A 3I0RA 1HNWF 1GX6A 3MM9B 1FVSA 3W62A 4HHUA 1E6YB 2VV5A 2B9YA 1H74A 5CZXA 4R8UB 2WTFA 2RQCA 4DR3J 1R27B 3KWMA 1HYSB 3I55S 2H48B 2EC0A 4O0NA 1DHMA 3EM1A 1NDLA 1FEHA 4NLTA 4FYXB 3HKZD 2OPSB 4P74A 2RJZA 1SV5B 5DZ7A 1HBNA 3ILOA 1G7CB 5DDRC 2J7UA 2JFDA 1KHVA 2ADBA 2MY8A 1L3KA 3OTOF 1EJ7L 2BBEA 3I0SA 4O0IA 3GIKA 1RT4B 2XY7A 2R7SA 3QATA 1FD2A 3KLFA 4OL8A 1Y3JA 1VC0A 4RBVA 2LYVA 2IJRA 1EQ0A 2OSQA 2AKWB 3A3OB 1FRJA 2KG0A 4F2RA 1FEEA 3DLEA 1IXKA 1VRUB 1S0OA 1ITPA 3W64A 3AODA 4LF9J 3PEJA 1WF2A 3ONQA 3N28A 2AWZA 5AXMA 1BWVA 4LF7J 2FGCA 4Y65A 3THPA 1BQXA 1XIQA 2ZHOA 4CCHA 3TX8A 2HLTA 1RTDA 2E7VA 1HBMA 2BQRA 3D9BA 3DRPA 1U24A 4JYAJ 2W8LA 1RCOB 2PMHA 3OHBA 4QWAA 2A18A 5C25A 2HNDB 1D0EA 3HVWA 3TOQA 2QV6A 2W9CB 4OI0A 1B3TA 2VH7A 1TAQA 4OZNA 1HARA 2MMYA 5ITHA 5KT7A 3MM5A 2H9ZA 4PPZA 1T0TV 5C5JA 4NI2B 3NRBA 4M5NA 4FN5A 1U48A 3HSDA 1YK9A 3EZUA 3M8PA 3AFGA 3TYTA 1OQ6A 5D0EA 1R31A 2R7WA 1U2RA 4NCAA 3UCUP 4O44A 1VIXA 2QL9B 2WW8A 2BANA 2F65A 2CQPA 1TL3B 3M2UA 3NCQA 4GO5X 3CJ4A 5HI7A 1EB0A 3U27A 5M2UA 1JXLA 3LPEA 4K4UA 4G1IA 4LF4J 4B3TJ 4K4VA 4CLKA 2XG8A 5B0BA 4P10A 3G82A 3G8TA 4EUVA 2DXEA 1JLCB 1FA0A 2O67A 1VQMS 2HZCA 1TL7A 4DZ6A 3KLIA 4FP9A 1CULA 1SCJB 4TNOA 1GQEA 1O8BA 1JLGA 3MMAB 4Y2CA 2Y0SD 2XS2A 1NJWA 4B9SA 4CM0A 4HTIA 1D09B 5HP1B 2H5EA 3JTPA 2CPEA 3V6DA 2COLA 2J0XA 4C8MA 4U7CA 4XTTA 3VGSA 5KG5A 3G6VA 3U1NA 3IWLA 2WW4A 1KLNA 1SVDA 4RW4B 1LEOA 1RT7A 2XZDB 3NP5A 2KXFA 2XGQA 2D3ZA 1SIWB 2CQCA 2XLJA 2VPXB 4J9NA 3NWGA 2R7OA 2J5AA 2CPHA 3VGUA 5A8RB 1N48A 1HNXJ 3C19A 2XMJA 1FK9A 1RTZA 4LUBA 4U67Q 3KHRA 1X7VA 3E51A 1U1KA 4ILLA 2I5JA 3TWZA 1K9MT 1WC0A 2KG1A 3TO8A 1TVRB 5F9LA 4DR2J 2VJVA 4EBCA 1ULRA 1SIZA 3C14B 2Y0BB 2R3VA 3GU0A 3KFWX 3LW5C 4RPFA 5KFPA 4RUCA 4WCEQ 1KR4A 5BR8F 4ECUA 4XIUA 4C6AA 3QJPA 2A6MA 1R43A 2BOAA 4NZ7A 4QR2A 3DOKA 1IKWA 4JI7F 5BJRA 3PYFA 2JH3A 4DR3F 3PCOB 4OYAA 5IV3A 2JSXA 1TQLA 4QBUA 3DM2A 4HACB 3ITHA 1NDKA 3OUYB 4CH0S 4EYIB 4WPAA 3GFXA 1LQ9A 4ALZA 2QA4G 3MMJA 1KNZA 3H8YA 1QE1A 3BQ1A 1REVA 4NXNJ 2XCAA 2B9EA 3Q23A 1RAOA 3TR5A 4F02A 4C98A 4QQBA 2OI2A 1HR0F 3CT9A 2VG6A 4NLQA 2CPIA 1RAHB 3CCWA 5AT1B 2HQGA 1YJVA 2JHEA 2JJ4D 3UO0A 4HACA 4EMDA 1U4BA 1RISA 1QAJA 5KG7A 3SV4A 3NGTA 4FDFA 3QAUA 2OTLS 2QE5A 4JI2F 4LREA 2KZZA 2YNGB 1Q16B 3LANA 4LVNP 5ETSA 1AZSA 2KHCA 3MEKA 4LFAJ 2C2ZB 3E2EA 2GC8A 3OW2R 2XHCA 3B4MA 2UV8G 1FDDA 3FEZA 2B51A 4WE1A 2DNGA 4FKXA 4FS1A 3TAQA 2NZCA 4S0MA 3GLJA 5GVQA 5L1IA 3C8YA 4TVAB 5KFLA 2GO9A 3RBDA 3NGUA 2POKA 4USIA 1X4AA 4EO8A 2MGZA 1UVKA 2R7QA 3VZIA 4GC7A 3PJ9A 3I4HX 1NUEA 2CYYA 2XGPA 3G71S 3VAKA 4IFVA 4FYYB 3LAMA 3QO9B 1QTNB 3M32A 5RUBA 5KG2A 2ZBQA 5HROA 3NOGA 3PW5A 4B3OA 4ZP8A 3RBEA 4IQXA 4IRKA 1JLGB 3MMAA 3C66A 2KDOA 4ATNA 4A8WA 2VOPA 2MQOA 2YX4A 3SIPB 1PC4A 3OTDA 3W2WB 1CJTB 3D2WA 4WZQA 3LALA 1HHSA 1NPRA 1RWMB 3Q8UA 5HMXA 3TI0A 2R7XA 1M1HA 2A2CA 3DRYA 2LQ9A 5DGAA 4JOUA 2ASLA 3MF5A 3BDPA 2FPHX 2RUGA 3CCJS 2E7WA 2CG4A 2X1GA 3AOBA 4NMXA 5IC4B 2CZ9A 1Y7PA 5K8MA 5KFOA 2DR7A 3H5XA 2MKYA 2BANB 1NH7A 2ZBPA 1SJ3P 1ZM3A 3KJQB 4C3MA 5KG4A 4MFBB 4OYOA 5D78A 5KFTA 1CJUB 3MECB 2LEAA 3DGPB 2WSEC 5BXIA 3G6YA 3SYZA 1BC6A 3ZXWA 4OZ2A 4M95A 1UVIA 3NGKA 4P2MA 1NM2A 2BW2A 2IYIA 3R9LA 3AH6A 2GV1A 2D1CA 1K47A 2KXHA 4C8OA 1RA6A 4RJVA 1S4FA 1SC1B 5SUHA 1S1VA 5LSRA 1UW9A 3QGPA 2RS8A 2HBYB 1VRTB 3EJMA 1JIHA 3FCHA 4X66J 4F4XA 2XZTB 4A8YA 2AYMA 2WHOA 1U1NA 3CCTA 4PXDA 5A6PA 3HDSA 1FNXH 4Q5VA 1RAJA 2UZAA 3GJTB 4DQRA 2HBZB 2OD6A 3DRRA 2GAHC 2H3EB 4KAIA 3LGHA 1WEYA 2LKZA 4KO0B 3H4DA 2A10A 4OHZA 5C2CA 3R5AA 4DFPA 2DO0A 2JX2A 2MZTA 2UUWA 1R89A 3BPDA 1R8CA 3OXLA 1IBKJ 1RHQB 4CO2A 3J81U 4PXEA 5J2MB 2GGPB 4D3GA 2DJWA 4Q45A 3JB9k 3KJNB 3W9HA 2ZITA 1TVRA 4LMZA 5L1KA 1TUWA 2EVZA 1BUXA 2LEPA 2WVEA 4NLYA 3RZAA 1RHKB 2ERRA 3POTA 1NSKL 1S9GB 1GMUA 1VBYA 1G4CA 1IN0A 2BJ9A 2CJQA 3HFZB 2NZ4A 2XYPB 4LBHA 3DOKB 1V5VA 2V63A 4AT1B 3OSNA 2ADCA 1EKRA 4DBQA 5JJBA 5J2NA 2MQPA 4JI6J 3R7NB 1T94A 3N79A 4GKKF 5B0CA 2YNHB 3SCJE 1RYSA 4XDDA 2QIFA 2HRYA 4ZPTR 2N4DA 2D7SA 2J8SA 1FRIA 3UVJB 2BOPA 1FTCA 2BZ2A 3MZIA 2HBQB 3M9OB 5DQHA 3HVTA 2HQ3A 3GQCA 1SQEA 3AQOA 3H5SA 1VLOA 1HQUB 2Y9HA 2XNRA 1B64A 2V9WA 1SH2A 2HHVA 4XPCA 2AGOA 1KVKA 2K3KA 3CMES 3EXYA 2FHJD 3IR7B 2IMOA 3MPYA 3GV8B 3FSXA 4DPWA 2IM3A 2B4UA 4OJ1A 1T03A 2QFIA 4Z2XA 1YBUA 4TYAA 1FF2A 5D15A 5GAHU 1I6JA 1LW2A 1EKSA 1VOMA 2EKYA 2DIUA 1TL3A 3QQCD 4ES1A 4KQZA 2FC8A 4O44B 1HKAA 3DGVA 3D1QA 2CNKB 4KHPJ 1P9QC 2GA7A 3BYPA 3WC0A 1S6PA 2B9XA 3TAPA 3RRKA 2GVZA 3UN3A 4DN0A 5K8PA 2RMLA 1QSLA 3Q2TC 4KPCA 3G82B 4Q7AA 1TUGB 4NCBA 2QLJB 1H0HB 2M9KA 4KHMA 1CJVB 2XI3A 3JSMA 1HFEL 1DTQB 4Y6IA 3M8WA 3R27A 3HVRA 2XSJB 4DR2F 1IKYA 1C2PA 1FNOA 3P96A 1FE0A 4I2PA 2QSWA 2XBPA 2KB2A 4NZ6A 2EEYA 2E1RA 2F9DA 2VUGA 3ZFVA 3OUYA 1DTTA 1MN7A 5IT9Y 2NPFA 3GE9A 1VJWA 5ETLA 4QYZK 1A7GE 4NASA 2DNQA 1T9XA 2GVDA 5C7PA 2WSCC 2Z30B 5L46A 3RRHA 1SKUB 2W8KA 4LQ3A 5H9EK 4K2XA 4HI1A 4PYAA 5LM7E 1Q4RA 5IOLA 1VQNS 1N6QB 2FTRA 5KFWA 1FJGF 3QYYA 5A8KB 3GV5B 4RNNA 2W7PA 2QL5B 4WF9Q 4UF4A 5HSPA 1URRA 1RT4A 2I5JB 4CT9A 5F8MA 2L3MA 2HGMA 3W61A 2I9SA 2AYEA 4USMA 4QU7A 4M5LA 4CRJA 3FBBA 2BE7D 3DFEA 2LXUA 2VD3A 3TZXA 3F73A 1R0BG 1NK0A 1UCNA 3DLEB 3T6BA 1FE4A 3FCWA 4HDHA 4A4JA 1OO0B 2R2SA 1PJ5A 3HZEA 3TX0A 4RW8B 3LWLA 5HJYA 5FJ4A 4DMZA 3ZTQA 3WBZA 2Y8YA 1U25A 4JI0F 1FDAA 2PEBA 4RWWA 3HSGA 3CVKA 4J9VA 1NH8A 2OUGA 5C25B 2GMJA 4M1KA 1FT8A 1HBNB 1WTFA 3TRGA 8ATCB 3T5LA 2YKQA 2MKJA 1SJQA 4TLQA 3B82A 4JV1A 4JI4J 4X4VA 3ETMA 4EYHB 1WORA 1JLEA 1GTHA 2PSZA 4K0KJ 3P5BP 1U2FA 4C8KA 3E01A 2BE9B 2DR5A 1ZA1B 4PRFA 4C97A 1DAXA 4MK9A 3KMSA 4KFBA 2HMIB 4AD6A 4B9UA 2V2ZA 4ECXA 1N52B 4C11A 3SEOA 4ETZA 4N41A 3DLKA 2IVYA 3MCSA 3TUPA 2KHDA 3A3PB 4K50A 1APSA 4Y0FA 2QT7A 2B5JB 1S6UA 2CZVC 5CABA 2UUAJ 2PMZD 2M2BA 3BO2A 1UWBA 1VBXA 3MEDB 1KTVA 1RKIA 1KS2A 1PJ7A 4ZVTB 3W5ZA 5CYQB 5G4DA 3I5BA 2G0IA 4ZPDA 4CTAA 1L3VA 2EK1A 2EKNA 1RWXB 1S1UB 4NYPA 4IDKB 4NEYA 2HIYA 3KLEA 2J6SA 1S12A 1I94F 1XNRJ 4X62J 2DHHA 5HN0A 5D0GA 1HW9A 2CNOB 3BR9A 1VR6A 3FZBA 5KT2A 4IR9A 4DR6J 3UVJA 2IY5B 4ZVOB 2XS7A 4LF2A 3HMJG 2V4QA 5LMUF 4PUOB 1RUSA 2K3IA 4PYDA 4WP9A 3BQ2A 2F40A 3PVXA 1KLMB 2C3MA 5G0RA 1F6TA 2HSEB 3FBCA 5A8WB 5AJ3J 2VPWB 1RWKB 1OPZA 3TA1A 4F3MA 2ZH4A 2YX1A 1I51B 4RW6B 2VJUA 2NUUG 3I31A 2R8GA 1ZETA 2ALZA 3C16A 5HBMA 2M0GB 2FVQA 3GSIA 4LRDA 4IH7A 3J7YI 3HM9A 3KOAA 3Q83A 4DPOA 2DRBA 4NLGA 1YSJA 1MW7A 3O5TB 2PN6A 1VFJA 4FKYA 2ACMA 5A8WA 1LK7A 2LMIA 4NPOA 1N6QA 2G13A 4DV2J 1X0FA 1HR0J 2VFTA 3KK2B 4UOHA 1S9FA 3HFVA 3UCZP 3CF5Q 2HHSA 2YQ0A 2QFJA 4DV4F 1Q95G 2QSFA 3D0HE 2B8PA 3IP0A 1OJ4A 3OBIA 5F9NA 1FDBA 3PEHA 5HO4A 4CWBA 4K5SA 4KC5A 3QRQA 2V2VA 3L9ZA 1FRXA 2BXJA 3CJSA 3HZGA 3MMCA 1CJKA 3ZZPA 5B09A 3RTVA 1TKXA 4P73A 3MD3A 1XR6A 2UXBF 1FJ7A
chains in the Genus database with same CATH topology
3DLGB 5A0YA 4N8NA 1X9MA 3VF0B 4F4WA 4B02A 2A3JA 2CJKA 4NRTA 4MH8A 3OLBA 2G1DA 3KHLA 3DYAB 2MKSA 1KFSA 3GIJA 3IC1A 2IM1A 2ZH3A 2HVHA 2UVRA 2EI5A 4ZPAA 5LJ5Y 2OPRB 1HWKA 4O3OA 1C0TB 3GG1A 5E3CA 2DH9A 2MZJA 5KOWA 5KFDA 3BR8A 1K73T 1LWCA 5AXNA 2R8IA 4WFYA 3BSOA 2B5JA 2GJIA 4ZCKA 4H4OB 4PG4A 2XMWA 4C4WA 2JEFA 3MMBB 3M2VB 1XWLA 2GMHA 1Y4ZB 5KFJA 2N4CA 3C6UA 2CPFA 1WG5A 2PI5A 3JYTA 3PDNA 5T7LB 1M1KT 2HS4A 3EGNA 3LPYA 3QIPB 4MIBA 4DN9A 1JJ2R 1C1BB 2SXLA 1JNRB 5B7WA 1TL1A 1Q8LA 1HBOB 3MR2A 2CPDA 4WE1B 1JMTA 4CO5A 2K7KA 5D77A 3M2RB 2ROEA 3ZZ0A 2B3TB 3GFYA 2CFXA 1P6TA 4X66F 5KFHA 4J9QA 3PJXA 4C11B 4NLPA 4ECYA 1U45A 1BGXT 3NBPA 4IRDA 1RTIB 2B4OA 1DQ8A 1Y5IB 1WI8A 3ENVA 3VAMA 1YRUA 1F5AA 4IFYA 3KK1A 3MM8A 4IH6A 4I2PB 4LF4F 3GR0A 4K4ZA 1IKYB 1S6OA 4FNIA 4ES2A 4O4RA 5L9XA 1URNA 2VG7A 2FC9A 4A8FA 2C3YA 4WK3A 5M2PA 1X4FA 1VK3A 4FVMA 3OR2B 2PA3A 3PNIA 4QPXA 4BC7A 4RNHA 3U7JA 1D1UA 4BHQA 4B08A 1VQKS 1C1CA 2DPIA 1UKUA 1RT3B 2FD2A 2OFGX 3I96A 1SH0A 3GIMA 2MYFA 3GILA 2V8VA 2JLEA 1X9SA 1BQNA 4ECQA 2AV5A 3BGRB 3CXCR 5EX0A 2WBMA 1WG1A 5E7OB 5HL7Q 1HNVB 2RDJA 1VMBA 4OZ0A 2FY1A 2RH3A 4R0EA 5IQQA 3VTIA 3QGIA 2RILA 2NXUA 4Q44A 4IFVB 2LXIA 3K5PA 4DX8H 4P6QA 3OJUA 3NAHA 1SI9A 1FTRA 1FRMA 1D9AA 3N5BA 2BE2A 4DS4A 5DQGA 1SKSA 3ZZOA 1U1QA 1T02A 5KG3A 4WKRA 2EW9A 3L7PA 3C2PA 3V81A 3HHLD 4M8LA 3KLIB 1R0AA 4FBTA 1KHWA 3G96A 3FFIA 1K0VA 1SB6A 1U7LA 1XTZA 3RYLA 4DOZA 4ED2A 4O3NA 1F5BA 2AYGA 4ZMMA 5J2QA 2VQEF 2HVIA 2R2RA 4I1TA 3GG0A 2OJ3A 2RSQA 1BQMA 4DG1B 4U6PA 4QIFA 1H2UX 1I1GA 2KT3A 2EG2A 2R4FA 3IXQA 3DOLB 3OL6A 3K0JA 4NYOA 4MTPA 2YY3A 5DETA 4NZ0A 2FLOA 1S1TB 4DL5A 2KO1A 5J1NA 4Z37A 3PW7A 4I0WA 5DLFA 3HVTB 4FZVA 2HGLA 4LFCF 3IGNA 1HW8A 4FVCA 2W7OA 5I3UB 2HG4A 1M5KC 4X4SA 3DOLA 2YWEA 1YRXA 2MY7A 4C8NA 1H2TZ 4ED5A 2J9EA 3K8WA 1CVJA 3CD0A 1SL0A 1IQZA 4X2BA 3T3FA 2J0SD 1V9OA 2YKOA