5J2NB

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and dtmp at the n-(pre-translocation) site
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
427
structure length
405
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase, p66 domain
molecule tags Transferase/dna
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
total genus 106
structure length 405
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2nB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2nB03
4ZP9A 1S1WA 5D3GA 2OPSA 2RDIA 1JIHA 4NLUA 2HNDA 3RAXA 3GQCA 1D1UA 1MU2A 3ITHA 4ED0A 4J9SA 3TVKA 3NBPB 4I7FA 1XR7A 2RF2B 5DG7A 3DRSA 1DTTB 2ASLA 5F8LA 4RW4B 3QIPA 5C25B 1JLBB 4I2PA 1RT7B 1S1XA 1RTJA 1SUQA 2YNHA 1TKZB 3MECA 3HHKA 4ZHRB 3PJWA 1JLGB 1NHVA 5EDWA 3BJYA 4MKBA 2O5DA 3BSAA 1J5OB 2FLPA 2I1RA 5KT4A 3MEEB 3OSNA 4DL6A 2JEFA 1S1UB 5KT6A 5F8IA 1JLFA 3RBEA 2VG7A 5J2PB 4PUOB 1JLQA 5I3UB 3N6MA 1LW2B 2FJXA 2HNYB 2ZD1A 4B3OB 5DQHA 3M8QA 3G6XA 2AQ4A 3DOKA 3JYTA 4ED3A 3LALA 2C2RA 2I5JB 2HAIA 3NMAA 4IG3B 2D7SA 1RT2B 3LP0A 3DI6B 2OPQB 5KFGA 3T5KA 3NKYA 4H4OB 4KB7A 2FVQA 1NHUA 4ECSA 5HLFA 2D3UA 3PW5A 1RYRA 2HNDB 5HROB 3D28A 3UDLA 2D41A 2W9BB 4XPCA 2HMIB 5CYQA 1U09A 3LANA 3CJ3A 1N6QA 4NRTA 4EO6A 1HMVB 2YNFA 4EBDA 3MR2A 3RB4A 2BQRA 2ILYA 1S0OA 2UVWA 5CYQB 1C1BB 4KKOB 5KFJA 3QZ7A 3TQ1A 4LSNB 3T19A 1FK9B 4M95A 4EO8A 5KG7A 4ED7A 3DM2B 1JLAB 1N4LA 4R0EA 4R8UA 5L1IA 1UWBB 4QPXA 2IM0A 1RT4A 1HPZA 4WE1A 2BQUA 2B43A 5KFMA 1VRUA 4R8UB 3HVAA 3DM2A 2R2SA 1DTQA 3KJVA 2ZKUA 4K4ZA 3FFIA 1RTDA 1XR5A 4ZVHA 2AGPA 3Q8RB 3IRXB 2FJVA 1K1SA 5CYMB 3H40A 3RB6A 4IQXA 1RT1A 3KLFA 5F8HA 1TV6B 1RTHB 1S4FA 1REVB 1HQEB 5KG2A 3QZ8A 2VA3A 4IRKA 2V4QA 3CJ4A 3IGNA 1RT6A 3I0SA 3G86A 1HQEA 2ASDA 3C6UA 1N6QB 2R8HA 4IG0B 1J5OA 4ECTA 4RNHA 4MK7A 1TKZA 3MECB 1JLCA 4G1QB 4IDKB 5JUMA 3SFUA 1HARA 5L9XA 4GC7A 4TY9A 4DL7A 2B6AB 3EPGA 1UWBA 2IA6A 3DOLB 3PW2A 5I42A 4ICLB 2V4RA 4MK9A 1IM4A 5EWGA 4ZVFA 4ZP7A 3ICLA 2ZD1B 4B3OA 2XC9A 3LAKA 5DGAA 1JLQB 5I3UA 1T94A 4DL2A 1I6JA 4ED6A 4RW7A 1ZTTA 3LP2A 4K4VA 4NCGA 3DLGA 1ZETA 2HMIA 1LW0A 3CDWA 4WXOA 4WXWA 4GC6A 3FRZA 1JLGA 5HLFB 4NLTA 1RT7A 4ZMMA 1TKXA 3BGRA 1JLBA 3H2LA 1LWCA 2WOMB 4RW4A 4I2PB 3QO9B 1QAIA 5KFDA 3FDSA 3MFIA 2J6SA 5DQGA 2FLLA 3PJXA 4K4WA 4F4WA 3T5LA 3E01B 3KK2B 5KG0A 3RB3A 3H4DA 3VQSA 1S6QA 1JLCB 4NLQA 5EWFA 3PW0A 1DLOB 3UR0A 4OL8A 2AX0A 5KFWA 5KFCA 3DLEA 4Q43A 2R8JA 5J2MB 1S9GB 3V4IB 4M94A 5KFIA 3I5BA 5KFBA 4ED1A 4IH5A 4J9MA 3KLFB 2D3ZA 2B5JA 2WHOA 2WRMA 2BANA 5KFVA 5L1KA 3KOAA 3OHAA 4F4XA 1T05A 2VG6B 5HP1A 4RUCA 4MFBA 4KFBA 3QIPB 5KFZA 4QWCA 5F8MA 2YNIA 4IH6A 2WONB 5J2NB 2FVPA 5EWEA 2WOMA 5F9NA 3OL8A 1N56A 4KSEB 3IGVA 2JEGA 4RNFA 4Q44A 4Q8FA 5DG8A 4ED8A 3KLEA 4RNOA 4YR3A 4Q45A 4YR0A 1FK9A 2V0NA 5KG1A 1HNVB 4NLVA 5EUHA 4IH7A 3UPFA 3MR3A 3PW7A 1EP4B 4ECWA 2ASJA 4ECVA 3I0RA 3GYNA 4NLGA 4PQUB 3QIDA 2YNGA 5CYMA 3H59A 4MIAA 2OPRA 4QW8A 1SV5B 2GIQA 3DMJB 3QGHA 4JV1A 1TVRB 2JLEA 3DYAA 3FQLA 4NLRA 2IAJA 5C5JA 5F8JA 4IR9A 2CJQA 4O4GB 3IS9A 4NLYA 1C1CA 1FKOB 3PR4A 2JEJA 2BE2B 3DI6A 1C1CB 4XPEA 1HNIB 3NAHA 3V81B 4KFBB 3OHBA 4NLWA 1S1VB 3LAMA 1T05B 4U7CA 1RT5A 4NRUA 4ZVGA 2YKMA 2JC0A 2W9CA 2XI3A 1BQNA 3I0SB 1T3NA 2WTFA 3SI8A 4WZMA 3ISND 5KG3A 2AGQA 1OS5A 2IJFA 5JXSA 1S97A 1EP4A 4TYBA 4O3NA 4YR2A 3CVKA 3V6KA 4TY8B 1KHWA 3GIMA 2IM2A 4TYAA 3BQ1A 1LWFB 2VG5A 4URSA 1QE1A 4RW9A 1RA6A 4MK8A 1S0NA 3HKWA 1C0UA 1LWEB 3BQ0A 1HPZB 1S1TA 4WE1B 3GV5B 1D0EA 4ECXA 5T14A 2OPQA 2I5JA 4O4GA 1JXLA 4MFBB 1RT2A 4HYKA 2IAJB 3OSPA 2C2EA 1C2PA 1TVRA 3DYAB 3CIZA 4ZPCA 4NZ0A 3OL9A 4KAIA 1TKXB 2VG6A 2B5JB 1GX5A 1MU2B 3M8QB 3QGGA 4KV8B 3SFGA 3ISNC 2W8KA 3HVTA 1HYSB 5KFNA 3FSIA 1IKWB 1TP7A 1CSJA 1HMVA 1JX4A 3QGIA 4IFVB 2GC8A 4TQSA 2AGOA 5KFAA 5J1EB 3KHRA 3CO9A 3KLEB 1SUQB 4ZHRA 3D5MA 2IBKA 1RT3A 2YNHB 3TAMA 1N5YA 3E51A 3N6NA 3PHEA 3KK2A 4URQU 3Q8SB 2QV6A 3G6VA 4QWAA 2FJWA 2HWHA 3E01A 4Y3CA 2FVCA 3OLBA 2OH2A 5KT3A 2F8EX 4XO0A 3KLHB 5KFXA 5L1JA 1WNEA 1S1TB 3CWJA 2BQ3A 4JV0A 1SH0A 2R2UA 2ILZA 2HNYA 3KLGA 2BRKA 4O3SA 4K4XA 4K4SA 4PUOA 4EYHB 3RAQA 1IKXA 2HNZA 1S1WB 5D3GB 4ZP8A 2UVUA 3DLGB 2AWZA 4Q8EA 4IG0A 5J2MA 4ZP6A 3DDKA 5KFQA 3IN5A 3KLVA 2RKIB 1RT6B 3PW4A 2UVVA 3LP2B 2YKNA 4Q0BB 1IKXB 2HNZB 3PVXA 3HVTB 2R2TA 5KFHA 3PZPA 1BQNB 4KV8A 4H4MA 4J9QA 3MTKA 3CJ0A 1S9FA 1EETA 1C0TA 1T03A 2C2DA 5KT7A 4FBTA 3MEDB 4ICLA 2B6AA 1TQLA 3IG1A 2IM3A 3KMQA 3DOLA 2BRLA 3QO9A 1RYSA 2JC1A 1C0UB 2IC3A 5KFFA 3G6YA 4YQWA 3V6JA 2XWYA 4O3PA 2UUWA 2BR0A 3OL7A 1QE1B 4RW9B 1SH3A 2OPRB 1YVFA 3C6TA 1W25A 4DEZA 2ZE2B 2UUTA 4IOBA 4TLRA 1KLMB 2J6UA 3LP1A 3Q8PB 3Q8QB 3MR5A 3KHLA 1TL1B 1IKWA 5F9LA 5KFTA 2IJNA 1S0MA 4LSLB 3V6DA 1HYSA 3EPIA 3T1AA 1RTHA 5DGBA 4FS1A 2YKMB 4NLXA 4RUAA 1RTDB 3GV7B 2W9CB 2V9WA 2W9BA 3IRXA 3KJVB 1HQUA 3V81A 3FFIB 5DQIA 1JLEB 1HNIA 1JKHB 2DPJA 4O44B 5KFEA 1BQMB 3QLHB 3DRPB 4ID5B 3KK1B 2CKWA 3GIIA 4DL3A 3KK1A 2BE2A 2W7OA 3DRRB 3H5YA 3IG1B 5KFUA 1JLEA 1BQMA 3QLHA 4ID5A 4G1QA 4IDKA 1JKHA 5K14B 2FVSA 2WCXA 4Y34A 5KFYA 4EBCA 1EETB 3I5AA 5KG4A 4IRDA 3NGDA 1LW2A 1S9EA 2UVRA 5C24B 3KHGA 4J9LA 2VG7B 2YNGB 5J2PA 5KFOA 4PQUA 5KFKA 4WYWA 3KMSA 4H54A 4LQ3A 4RZRA 4WFYA 2DPIA 3C6TB 1S6PA 2ZE2A 4I2QA 4WYLA 3T5HA 4KHMA 4MKAA 5HROA 1TKTA 4F50A 4Y2AA 1RTIA 4ZPAA 4MIBA 3CDEA 4O3OA 2WONA 1FKOA 5J2NA 5C25A 3IS9B 4IG3A 4EYIB 4IRCA 4O44A 3LP0B 3DRSB 5HP1B 4QWDA 3MEDA 1C0TB 1HQUB 4I7FB 1T03B 4RNNA 3BGRB 4RNMA 2BANB 4ECZA 1S48A 3KK3A 4WFXA 3I5CA 4NYZA 1IKYB 3BQ2A 4ECQA 4F4YA 4R5PA 1RA7A 4TQRA 3H5XA 4KBIA 4QWEA 1S1UA 3MEGA 4MH8A 3MEGB 3BSOA 4K4TA 1NNDA 1HNVA 3GIJA 4J9RA 1S6QB 1DLOA 4PWDB 3KLGB 5C42A 1SH2A 4O4RA 4FS2A 4ED2A 4K4UA 4JV2A 2WB4A 4KO0A 3KLHA 1Z4UA 3KLIA 4IFYB 2FVRA 1DTTA 3M8PB 2XGQA 2RF2A 4J9NA 3H5UA 3M8PA 4J9KA 3RBDA 2XGPA 4ECRA 3DOKB 3JYTB 3KLIB 4IFYA 3ITHB 4Y2CA 1KHVA 3MR6A 2E9RX 2EC0A 3NBPA 1RTIB 3H4BA 4FBUA 3QYYA 2RDJA 4U6PA 2FLNA 4H4MB 2W8LA 4KE5A 1QUVA 1IKVB 2OPSB 4J9PA 1FKPB 2YKNB 4Q0BA 5J1EA 4IFVA 2XCPA 5F8NA 4NLOA 5KFLA 3C6UB 3MEEA 5L1LA 4ZPBA 2GIRA 4ZVEA 3CJ2A 3HVWA 2JEIA 1IKYA 4EBEA 2J6TA 5C24A 4R5PB 4K4YA 2R2RA 1S9EB 1XR6A 5J2QA 1RAJA 2R8IA 1S1XB 4URGA 5I42B 4LQ9A 4RU9A 4RW8B 5KFPA 2ALZA 4WFZA 3JSMA 4J9OA 3MF5A 1VRUB 4QWBA 5KFRA 5KT2A 1S10A 4IR1A 4KO0B 1RT4B 4K50A 4EEYA 2XI2A 1LWEA 5KG6A 5C42B 1LWFA 2VG5B 1TKTB 3DLKB 1SV5A 3NAIA 1S6PB 5FDLA 1RDRA 3GV8B 4I2QB 1LW0B 4DL5A 3PR5B 4NCGB 4LSLA 3V6DB 3CJ5A 3BR9A 2QE5A 3UQSA 4RW7B 2YNFB 1ZTWA 3OL6A 4JUZA 1TV6A 5KFSA 3RB0A 3EZUA 3CDUA 3M9NB 3T5JA 4IKAA 3KK3B 1S1VA 5KT5A 5DG9A 4O3RA 4QW9A 4TN2A 4DG1A 5K14A 2R8KA 1VRTB 3DRRA 1R0AA 2OPPB 5KG5A 1TL3A 2AX1A 2AU0A 4NLDA 4TXSA 2C22A 4WZQA 1R0AB 3JSMB 4X2BA 2W7PA 2OPPA 3DMJA 1JLAA 3FQKA 4YP3A 5DLFA 4TY8A 1C1BA 4KKOA 3H98A 1S49A 2WK4A 4ZPDA 4LSNA 5DLGA 4G3IA 4RW6A 2IMWP 3KHHA 1QAJA 3V6HA 1N48A 3GIKA 2R8GA 2RKIA 1KLMA 1S9GA 4RW6B 1REVA 3V4IA 4NLSA 3KNAA 5F8GA 1RT1B 5FDLB 2XCAA 1RT5B 1FKPA 3OLAA 3DLKA 1IKVA 4NLPA 4O3QA 4ECYA 2IM1A 1DTQB 4HKQA 2W9AA 1MMLA 4KHRA 1K1QA 1RTJB 1GX6A 4H4OA 3N6LA 2IC3B 2YNIB 3DRPA 1TL3B 1VRTA 4DG1B 1LWCB 4RW8A 3BSNA 5J2QB 2VA2A 2C28A 3BREA 3NL0A 3H5SA 1RT3B 3TAMB 1N5YB 4PWDA 1JLFB 2E9TA 1TL1A 4YMEA 3I0RB 2ATLA 3GILA 3LP1B 3BSCA 3MFHA 3M9OB 4F4ZA 4ECUA 5HBMB 4DL4A 2E9ZA 3M9MB 5HBMA 2HWIA 3DLEB
chains in the Genus database with same CATH superfamily
2WVCA 1IBKJ 2HGNA 1S1WA 5D3GA 1NSKL 3UCGA 2RDIA 1NSAA 4C11B 3GQCA 3L7UA 4DPUA 4DBQA 4J9SA 4DZDA 2BVZA 4ED0A 2Y8YA 4DR7F 3AFGA 1AXQA 3MUMP 3AHPA 2R7QA 3UDCA 3ZTRA 7FDRA 4C8KA 1DTTB 1T9VA 4LRDA 4ZJOA 5KOWA 3X1LB 3MMBA 3C3LA 5K8OA 2AYEA 5ETKA 4NPOA 4DV7F 3FCVA 2XZTB 1TFYA 3W5ZA 1ZA1B 1UL3A 2XYPB 4DHVA 5IQQA 3K5LA 2RQCA 4DSKA 2MZTA 3MM5A 3MCMA 3PJWA 4J9VA 5LJ5Y 2FJAB 2QMUB 3BJYA 2PIIA 3RW7A 1YK9A 3M2RB 2HS4A 2F1FA 1J5OB 4F02A 1PG5B 5KT4A 1F3FA 3MEEB 4PRFA 1S1UB 2HFOA 5E0OA 4C4WA 1P9QC 2VASA 1ZAWA 4X64F 3CCRS 4AL6A 3RBEA 1MMNA 3DLLQ 3QAUA 5J2PB 1M1HA 1RAAB 2JJ4D 2VPWB 1KNZA 1YRXA 2HVIA 1VQLS 6FD1A 4ZCKA 3OJUA 2Y9HA 3MM6B 4ED3A 2C2RA 5D15A 4IQMA 1JJHA 2DXFA 2DGVA 3D6HB 3LTOA 4PZVA 3AQOA 4H4OB 4YHHJ 1NHUA 4DV0J 2HNDB 2PA3A 1C4CA 2RDDA 3M6WA 3D28A 1TMJA 2XZDB 4NI2A 2KT3A 3UDLA 4HEA9 4A46A 3DLHA 2DNKA 4XPCA 4OYPA 4NXNJ 4LF4J 4X4VA 3I31A 1IJEB 1WTFA 3LANA 2OD6A 4NRTA 4DF8A 4ELTA 2DR5A 4EBDA 1WC6A 4QIGA 4X4QA 4X4PA 4DSIA 3W2VA 5CABA 2LQ8A 2ILYA 2ZH4A 2BQRA 4KJIA 1UVKA 4CQ1A 1C1BB 4P2SA 3D6MB 3T19A 3TQ1A 1FK9B 4M95A 1P1TA 4EO8A 3FVYA 3B78A 3LUYA 5KG7A 4OYXA 3MHYA 4R0EA 2HRYA 2W7AA 1UWBB 2OIHA 1F3VA 1HPZA 1R6VA 1XEZA 2CJ9A 2B43A 3MM9B 1VRUA 2J9DA 2RMLA 3DGVA 3QBCA 3HVAA 4NWBA 3DM2A 1SQEA 4F25A 2E1CA 2KRRA 1GT8A 2IVYA 2Z2YB 1RWMB 4DPTA 1NHKL 1WEYA 3Q8RB 2FJVA 1K1SA 3H40A 4MYTA 4N8NA 5GAGI 4C8YA 1FEEA 1S4FA 3QZ8A 4IRKA 2HFNA 3BYPA 1NSPA 3N9UC 2V4QA 5D4OA 2D9PA 2EKNA 3IGNA 4AFFA 2D74B 1RT6A 4PR6A 2LDIA 3G86A 3PACA 5HVGA 1HBMA 1N6QB 2CPIA 4IG0B 3TA1A 1PBUA 1VMBA 1LWXA 4Q2LA 3RW6A 1TKZA 1JLCA 4IDKB 1VYAA 2G0IA 4CM0A 3HHLB 4F4AA 2KJVA 1IVZA 3PX4A 3GPAA 2XMUA 4JOUA 4KYZA 3VQTA 3W66A 1QDUB 4GC7A 4KTQA 2H4WB 2MQNA 4PXEA 3DOLB 2GJ2A 1WTBA 1S7HA 4ICLB 1IM4A 3K5OA 3R27A 4ZVFA 2R9LA 1UFLA 2CWKA 1WSRA 2HFZA 7FD1A 2ZD1B 1NPPA 2XC9A 5DGAA 3L09A 1WG5A 4FPIA 4J37A 4LT6A 3J7A1 5A76A 4W98A 2YH1A 3DHWC 3CNQP 1U6ZA 1ZTTA 5DM7Q 4DQRA 2F7VA 2FUG9 3C16B 3KUEA 4K4VA 1S99A 4F67A 4QPTA 1FDDA 1LW0A 2LYVA 2ZWPA 4WXOA 4ITSA 1F1BB 1KQGB 1F5BA 1MN9A 3KKFA 1JLGA 3BV8A 3TJ9A 2J9CA 3TUJC 1WF2A 1BLUA 3AB4B 3TZWA 4DFJA 1F0XA 5A6WA 3OQ2A 3PRVA 2HW3A 4FN5A 1JLBA 2W1BA 2DBBA 3MCOA 1HI1A 2VD3A 4I2PB 3MMBB 4KGMA 4YS2A 3K57A 4I1TA 2J6SA 1ACMB 4OYIA 4B3RF 4K4WA 4PG7A 3KK2B 2PT0A 3TAQA 2DNYA 2J8AA 5KG0A 1BUXA 1YQHA 2E1AA 2W2PP 4B9MA 3ILOA 3NGKA 7AT1B 2XNQA 4OL8A 1MLAA 2AX0A 4FXVA 2GVDB 5KFWA 2AT1B 4USHA 2Z56B 5I3PA 3SYZA 5DDOC 1VIXA 3UCUP 2VQFF 1R43A 5GMKa 1EIYB 3D54A 2UXCF 4NASA 1U45A 2J0WA 3GP9A 4OZ0A 3EDQB 2BDPA 2RE1A 2JLFA 1K0VA 2MHEA 4F8RA 1NXIA 2D3ZA 2GS8A 5EHHA 1VQNS 3OUYA 2VZ9A 1T05A 2VG6B 3BGFA 2CVIA 4QR1A 4RUCA 4MFBA 2BACA 2VQEJ 4KFBA 3QIPB 3CCUS 1YHQS 5F8MA 3EGZA 4C9DA 3Q24A 2YNIA 1F2GA 3ZZUA 2WONB 1Q79A 3OL8A 3FZBA 3IGVA 2GGPA 2JEGA 4P7TA 2G2YA 4Q44A 4Q8FA 3BEGB 3Q23A 2NREA 3C2PA 2CAJA 1A9NB 4NLVA 4IH7A 2AJ4A 4X66J 1WG1A 2CQ1A 2X1GA 1RU1A 4DS5A 4JI5J 3PW7A 2JVOA 3VGSA 3W2VB 4ECWA 1TK0A 1D9DA 1OJ4A 3I0RA 3GYNA 4F36A 2G9OA 3Q8UA 3CCQS 4NLGA 4PQUB 2FPHX 1NK8A 2HHHF 4USKA 5CYMA 3MAHA 4OZNA 3H59A 1IM6A 2OPRA 1RI7A 2GO9A 3D6TB 2V2VA 3DMJB 3M8YA 3QGHA 3D2WA 3CO0P 3SCLE 2IAJA 2C3MA 4QIEA 2HK3A 2M70A 1S77D 1U7LA 3QNWB 4NLYA 2Z30B 2B4PA 3A12A 3PR4A 2JEJA 4XPEA 1HNIB 3NAHA 3W64A 3IWLA 5HJYA 1M5SA 4KFBB 2RD5C 2COLA 4P7VA 4J9UE 5RUBA 4DLGA 3FBCA 3LAMA 5DETA 2GCFA 3VHQA 3B4MA 1UJ6A 3L7PA 1H2UX 4ILLA 1RAOA 4S0MA 2W9CA 2XI3A 4OJ3A 1R0CB 3VVTA 1T3NA 2YWWA 1TL4A 3UN5A 2WTFA 1Q16B 4Z7YA 5F0WA 3SI8A 4BDPA 3ISND 2PDAA 2CZVC 1OS5A 1MMDA 4DDFA 3JAMY 1FTRA 4LBPA 5JXSA 2AGQA 1S97A 3KTQA 4DWIA 4U7UK 2R7SA 4JV5J 4A8YA 1DBDA 4CO3A 1R3NA 4HI2A 3BN4A 3NY0A 1LWFB 2VG5A 1H2TZ 1QE1A 4RW9A 4MK8A 4WJBA 4ID8A 3HKWA 1KQKA 1D3WA 3EGVA 3MPYA 4JI4J 2PEHA 4LR7A 1LWEB 3ET6B 2DNMA 1R7IA 3HHLC 3GV5B 2AJFE 2G1DA 1LXJA 3BQ0A 1M5OC 4GKJJ 4M8LA 2I5JA 4DOZA 3QJPA 2FJDB 2IAJB 4P73A 5GADI 1TVRA 3DYAB 4ZPCA 2K7KA 5B7WA 2LQ5A 4KAIA 3I9ZA 3HM9A 1S72S 2DGWA 1VQ6S 2NPFA 1MU2B 3M8QB 3KJQB 4L76A 3CUNA 3ISNC 3SZ2A 1B3TA 1A7GE 1O8BA 4ZCMA 4P6QA 2CFXA 2OD4A 3RAMA 3EGNA 2BJEA 2KVIA 4NMXA 3MOZA 2N3OA 3VZHA 5HMWA 4J5OA 3QGIA 3OVBA 2GC8A 3TX0A 3TZYA 2NXJA 3OFGA 5AE3A 5KFAA 3LQVA 4YY3J 2RU3A 2BA9A 1XJWB 4N77A 3TANA 2AGOA 2CPXA 1IR2A 2QT7A 3KLEB 3CO9A 1RAFB 1WC5A 3G8TA 1RT3A 2YNHB 3TAMA 2QLWA 2YQ1A 3PHEA 3VR1A 3V2UC 1VHFA 2HK2A 2QV6A 3VWSA 2C2OB 3MAQA 4DL0C 1HHSA 2FVCA 1YG0A 2LVWA 3MM7B 3PG9A 4DPYA 3JQJA 3DLBA 4MYUA 2HSEB 3KLHB 2DB1A 4HDGA 4OHXA 4DX7A 1XWLA 1S1TB 3CWJA 1AUSL 1SH0A 3OD2A 2ILZA 3KLGA 2Z2LA 1SKSA 4K4XA 3VCDA 3RAQA 1VOMA 3AOAA 4DZ6A 1YDLA 2IA0A 3PIOQ 1XNQJ 5LM7E 4DR6J 2DNHA 4B3TF 5J2MA 3IN5A 3DDKA 1VFJA 5B0EA 3KLVA 2RKIB 3PW4A 3L4BC 3C16A 3R7BB 2BKPA 1QLNA 3GCXP 5E5NA 3G71S 5KFHA 2JFDA 3PZPA 3OXFA 1BQNB 2EPIA 4KV8A 4U96A 4CT8A 2ZH8A 2KT5A 1Y5IB 3T41A 1T03A 1TL5A 4LF8J 2ZH6A 1QM9A 3MM8A 1TQLA 2MJNA 1SKRA 3DOLA 2W4PA 1RYSA 1WEZA 3M8ZA 4NZ7A 4PKDB 5HN0A 2ZOMA 1I94J 3UDEA 1PAUB 2APOA 2UUWA 3OL7A 1N32F 3PYDA 2MZQA 3GG1A 4XIUA 4ZN3A 2ZHOA 4IOBA 1H74A 1E6YA 1RWPB 2DNQA 3UWTA 4F04B 4C8ZA 1RHKB 2G2ZA 5A2QY 3MR5A 3KHLA 2IJRA 3QSIA 2KU7A 2EEYA 2DHGA 3MZIA 5KFTA 3VF0B 5H1SV 4LSLB 3KYLA 1RBAA 3T1AA 1CJVA 1RTHA 2YKMB 2ZVIA 3IAS9 4NLXA 4RUAA 3P4UB 3GV7B 3VV2B 2CXEA 3IRXA 1QAXA 2W9BA 1WHXA 4EK2A 2QSFA 3EM1A 4FYXB 3AD8C 2MKJA 3IBCB 4ES3A 5DQIA 2DPJA 4DSLA 4RJVA 5KFEA 2EFNA 1RUSA 4TVAB 1RWVB 4EU0A 2PE8A 3GR1A 4GRSA 2DEJA 4KT0C 2W7OA 1X0FA 3T9ZA 3K8VA 3IG1B 2CPEA 2K1RA 4ID5A 4WCEQ 4O0IA 4G1QA 1JKHA 2PN6A 1BE4A 2Y1JA 2VODA 1IQTA 2PA8D 3I5AA 5K8PA 1WF1A 4LVOP 1LW2A 2CQGA 1FERA 4ZOSA 5C24B 3FSYA 3PX6A 5J2PA 2XY5A 2MYFA 5KFOA 4YOEA 3HO1A 3DCAA 3KMSA 1UEKA 4MKYA 3K89A 3IA0A 2WVBA 4JP8A 5B08A 3TZZA 3CCLS 2L9DA 3M2VB 2XMKA 2DH9A 2JVRA 2V2ZA 4LRAA 2F3JA 2HLTA 1TL7B 3WC0A 2ZOGA 4WYLA 4X66F 3BB5A 2XMJA 2RS2A 2EI5A 2KVQE 2CQIA 1F9FA 4Y2AA 3ZFVA 1RCXB 1S5ZA 2FHMA 4OX8A 1NJXA 2VPZB 3CDEA 3CMAS 3DXBA 2WONA 2ABYA 4RBVA 1UZHA 2B4UA 3TYTA 2Q3PA 4UOFA 5EN1A 5KAKA 2ZFHA 4O44A 2CDRB 2DT9A 2MJUA 3CTRA 3US5A 3CPWR 3QRQA 1HQUB 4Z2XA 4XAKA 4RNNA 3BGRB 1S12A 2BANB 4AXIA 5M2PA 2XB2D 2LLZA 1V3SA 3M2UB 3I5CA 1IKYB 4ECQA 2W01A 4FYYB 2WW8A 2E7XA 4OHZA 3TX8A 3QSYB 3TAPA 1GK8A 1T02A 1FESA 2WSEC 3CCTA 2F40A 2MY7A 3DLJA 3U02A 3RGIA 1KD1T 1XN9A 3D3BJ 3NGTA 4FS2A 4PWDB 1T9XA 2V4JB 2XBPA 4L73A 4TKTA 2VBZA 1VQPS 3JTOA 4MIWA 1F60B 2HAFA 4KO0A 3KLHA 2O3DA 3QATA 2FVRA 1FI4A 4WIQA 1ZM3A 4ZA1A 3J81j 2XGQA 2EFOA 2MZRA 3O5TB 3OFEA 1S59A 4J9NA 4M5LA 1ZPWX 3H5UA 4KR0B 3RBDA 3VGUA 2XGPA 3DOKB 3JYTB 3KLIB 2CJYB 3CEDA 4FBUA 2VOPA 3PRDA 2LEPA 4ZIWA 4P2XA 1OY9A 4U8VA 3W62A 5IV3A 4LUBA 5ETMA 1P6TA 2Q6CA 4RBTA 2HHWA 4DQIA 4Q0BA 3KUHA 4IFVA 2XCPA 4ZJLA 1AFJA 4NLOA 2A0FB 1HBMB 1G2EA 4LFAF 3DKDA 5L1LA 4ZPBA 4HTIA 1BHNA 1LQ9A 4ZVEA 2DHAA 3HVWA 1WC4A 4QOTA 2WSCC 3A3NB 2IRXA 4K4YA 4ETXA 1R8PA 2F5GA 5J2QA 1VIOA 1S1XB 1S57A 1BGXT 2CPYA 1Q4RA 4URGA 1A6LA 4LQ9A 4RU9A 2FIUA 4WFZA 4UTGA 1HW8A 1UPPA 1X4HA 2X1BA 3D7SB 1PC4A 1ULRA 2FGCA 4IR1A 2J0SD 4K50A 1U1LA 2JHEA 3JSRA 1S0VA 4DV6J 3NCQA 1F5AA 4M5DA 4ZPTR 2HBRB 1FRHA 2XMTA 3NAIA 4UQTA 2X7IA 5IOLA 2HEKA 3GV8B 1LW0B 1ZZFA 1U0SA 3PR5B 2AD9A 4B9UA 2B9YA 2LKZA 4J91A 4UF4A 4LFBF 3CJ5A 4D3HA 3HMJG 2QE5A 1QVGR 1ZM2A 2YNFB 1F5CA 2UUCF 1N5VA 4X65J 3OL6A 4JI3F 4PEOA 3QJJA 3EZUA 3CDUA 5G4DA 4X62J 3MD3A 4WWSA 5CD4A 1YJRA 4IKAA 2CNLB 3TVYA 4NX9A 1U0HA 4QW9A 2VPYB 3RRGA 3BH7B 1VS3A 4DG1A 2IDLA 4KIAA 4JI7F 1U1NA 3C19A 1V9OA 2OELA 5H9FJ 3J80U 2CQ2A 2DIVA 1HA1A 3HD1A 2VICA 2MZ1A 4YFUA 2KH9A 4MT1A 1R0AB 4QIVA 4KH0B 4QR0A 1Z1ZA 2ASYA 4KQZA 3CCZA 3CJKA 3T6JA 1RK8A 2OPPA 4LF9F 2DITA 1Q5YA 4HT7A 4LFCF 2ZDOA 5H9EJ 2H65B 2QLJB 3P96A 1R6YA 2EKYA 2VFRA 5BXIA 5DLGA 1T11A 3T3FA 1HR0J 1HQ2A 4X4UA 2B9WA 4G3IA 5HANA 1FXLA 3M7VA 5K8MA 3U1MA 5A6PA 3MEKA 2N82B 1QAJA 4DX8H 2R8GA 3THPA 3SQGA 2V6AA 1S9GA 3OR1B 1CJTB 2ZZNA 4GO7X 1RT1B 2GVZA 4FF2A 2FHJA 2XCAA 1A0OB 3DLKA 1U4BA 1DZ5A 1IKVA 4O3QA 2M4MA 4OJGA 2X3GA 3UD3P 1IBKF 2K1RB 2QZ8A 1GX6A 3N6LA 1JJCB 2IC3B 4CZCA 3OTOJ 1VC0A 3HHEA 5LMUF 2I2YA 1CVJA 2VBXA 3D1OA 3NGSA 1HNXJ 5D8HB 3MURP 3K5PA 5L8RC 3P6YC 2AJ0A 3EYZA 1RXOB 3NL0A 2GMHA 1T9TA 1Y11A 4DQPA 2E5IA 2QN6B 3C14A 4P52A 2QA4S 2ATLA 3I0RB 3GILA 3CJ8A 3M9OB 4ECUA 4LF1A 3W3SA 3DOMA 3POTA 2OGUA 2R4FA 4X2BA 2UXBJ 2BJ1A 4AXJA 3WBZA 4X64J 2HNDA 1HNZF 2NR0A 3Q86A 1MU2A 2H48B 3ITHA 1DFDA 4Y2IA 3TVKA 4J90A 1XR7A 1DAXA 2MQ8A 4OV1A 5DG7A 3E8OA 3DRSA 1NPKA 1HWIA 1OYDA 2DY1A 3KXDA 2XMMA 1RT7B 5L46A 1KOHA 1RTJA 2HHPA 2H4YB 1U02A 2YX1A 1X4BA 2NXEA 1SIWB 2O5DA 3GYXB 1FT8A 1F9EB 2CRLA 3N4WA 4USMA 4YB1P 2FLPA 3ZZTA 1FXRA 4NXNF 4MJKA 3M2RA 2AP6A 4CYUB 1FE0A 4PUOB 2ROEA 1JLQA 5I3UB 1G6BA 2QLFB 3GFYA 4B3OB 5DQHA 3UR3C 5MLCV 1PBAA 3DOKA 3JYTA 2G0CA 2I5JB 2HAIA 3R2CJ 1M0SA 1RB0A 3D9BA 4YR0A 4M5MA 2H51B 3DI6B 3TOQA 2HZVA 2OPQB 1S6UA 1UW4A 3T5KA 5IT9U 4KB7A 3RU0A 1Y0HA 1EKSA 3PO4A 3PW5A 2D3UA 3L7OA 1Z2LA 1XMOF 4PABA 2BJDA 2CPDA 1T0TV 2LQJA 2R7VA 2HMIB 1U09A 2QYCA 1P9YA 3NGRA 4OLPA 3J7Z5 2HHUA 1N6QA 2M8DB 9ATCB 3EVWA 2V63A 4RKUC 1NKEA 1HMVB 2CJXB 2JDJA 2VPXB 1KFSA 1CG2A 2UVWA 4ETZA 2NYHA 5CYQB 4KKOB 3O44A 2MKCA 2Y3YA 1XIQA 4ZLPA 4LSNB 3J81U 1RSCA 4CLWA 4ZPVR 4FZVA 3DM2B 3GG0A 4QR2A 2A10A 1VQ5S 1RKJA 2XHWA 4PYAA 5DRKA 1FJGJ 3O1LA 4OX7A 2PD1A 1CQNA 1R8CA 2AZ3A 2GMJA 2XZWA 3AD7C 4JI6F 1IUJA 1WORA 2R2SA 4DPWA 3KJVA 4DR2F 1X60A 3SMZA 2UXDJ 1XR5A 1RTDA 4FKXA 1NK7A 1NKCA 5IS2A 2NUHA 1HBNA 3KLFA 4LREA 1FDNA 5HMXA 1REVB 2J7WA 3TRGA 2L08A 5KG2A 5DDQC 1U49A 1D8YA 4DV6F 3R1HA 2X1FA 1L3TA 4ES2A 1SJFA 1D8ZA 2L48A 4F4KA 2ASDA 2ACMA 1QAYA 1D9FA 2DNOA 1Y10A 4RNHA 1FKAF 3MECB 1U26A 3DDIA 1RHUB 1YGYA 4PXBA 2ZH7A 1S76D 4I69A 1TAQA 2BM0A 1HARA 1T8EA 2QLBB 4DL7A 2B6AB 1YZ6A 3PW2A 1X9MA 5I42A 6FDRA 4M5KA 1CLFA 4MK9A 2XM3A 5EWGA 1G1XA 4CNYA 5ETRA 4DU7A 4ZP7A 2NZ4A 4O23A 3ICLA 2WB1D 3IAM9 4CDIA 3OJSA 2MQQA 1VBYA 2E1RA 3BS9A 1NU4A 2NLWA 2VC1A 2OLWA 4OQJA 2D3O1 1NEEA 2DKOB 4UOHA 5B0DA 3DGPA 4LFCJ 3NNHA 1YIJS 4XK8C 3DLGA 3LPEA 1ZETA 1N34J 3G82A 4X84A 4ZPWR 2VONA 1IWGA 2YKQA 2ERRA 3FRZA 3RG6A 1AFIA 4DR7J 1OY6A 2QEXS 2BJ3A 1APSA 2XYHB 5HLFB 3BO3A 4ZMMA 1TKXA 2YWHA 4NOHA 3PXGa 4DFKA 3H2LA 3P45B 4LIRA 1R27B 5AJ3J 1GTHA 5KFDA 3FDSA 3W9IA 4DV7J 4DR1J 1KDNA 1FRLA 3OTBA 4OYWA 3ZZYA 4ZVOB 3TQEA 2HVHA 3B82A 1S6QA 4RUBA 4DV5J 4NEZA 4ILRA 2ZM6J 1JK9B 3FK4A 2MLZA 3OTOF 3GIRA 3UR0A 1YTYA 1NJZA 3POTB 1FJ7A 5KFCA 2H1YA 1S9GB 2MLYA 3Q2SC 2ZVSA 3OFFA 4M1KA 4DCJB 9RUBA 2YXLA 2DRDA 5G0RB 4ED1A 3GFZA 4P71A 4DS4A 1L3SA 3M8WA 4CCHA 3MMJA 4UOCA 2WBRA 5D4PA 1SL2A 1CEZA 2B5JA 2WHOA 1HBOB 2AKWB 2E1MC 2WRMA 3SCKE 3OHAA 1Q8BA 1VQOS 2HHHJ 2LXUA 4RBUA 3PM9A 1JJ4A 2DTJA 1MW7A 2NS1B 4ZVRB 3ULHA 2P8IA 2HBYB 3SV4A 2QIFA 3O2IA 2DGSA 1HWKA 3AT1B 5J2NB 2FVPA 2WOMA 3F56A 1LNQA 5F9NA 2UXBF 3MCNA 1N56A 4KSEB 2EW9A 3RTVA 1HNZJ 3W1YC 3NG8A 1NJIT 1M5VC 1FNMA 2J8SA 2BABA 4RNOA 4C7QA 1HFEL 1FK9A 1K8AT 1AW0A 2V0NA 3CMES 5LXRA 1L3KA 4UY85 4OX9J 3W61A 2KYZA 3VAKA 3PEJA 1DY3A 3EMTA 3AXMA 5IFMA 1N8RT 3FBFA 3QIDA 1I3OB 2CQ4A 3S6EA 1UJ4A 1YJUA 1XMQF 4MIAA 1YRUA 3QMQA 2DK2A 1SV5B 2Q6BA 2K8GA 2V68A 3A8EA 4JV1A 5C5JA 3I56S 1PILA 5F8JA 1WHYA 4NLRA 4OZ3A 2VOOA 3DRYA 4JI2F 2CJQA 5ETSA 3VTIA 1TUWA 2GJIA 1S4EA 2NSCA 1C1CA 2K06A 2N4DA 3CD0A 3MM9A 3DI6A 1C1CB 2Y8WA 2ZZTA 1Q82T 3V81B 2C3UA 1NO8A 3UVJB 2QX0A 5ITHA 2UUBF 3M6VA 4NRUA 4EFAC 2KB2A 1HIYA 3D68A 4OLOA 2JC0A 4ZVGA 4DPOA 4ELUA 1BQNA 3W7BA 1KQSR 2KTQA 3TARA 3T1YJ 1XQIA 1MROA 1X7VA 1URNA 4WZMA 4Q7AA 1OYEA 1SXLA 2MHNA 2VJUA 1FNXH 3O6QA 1NK0A 4TYBA 2QL5B 1UCNA 2I0XA 2J7UA 2Y0BB 3OR2A 4TYAA 4DUZF 4URSA 3T1HJ 3JQKA 2MSSA 2QFIA 1F6TA 1C0UA 1ZM9A 2BM1A 2F8MA 4ECXA 1S1TA 4C0HA 3M9MB 2E5GA 5T14A 5ETTA 4O4GA 3B54A 4Y28C 3HI9A 1RT2A 1D9AA 3EZOA 4CM2A 4HYKA 3NXZA 4NZ0A 2QSWA 2VFSA 4DR3J 2VG6A 1GX5A 1PC5A 2DGTA 3HHLD 4KV8B 1N0VC 2LDYA 4ZVPB 1U1OA 4CO5A 2EK6A 3HVTA 5KFNA 3FSIA 2QGFB 1PO6A 4LIWA 1TP7A 3FEXB 1HMVA 2BUNA 4JI6J 4USWA 2I8EA 4OV6A 3CCVS 3TR5A 4TQSA 3JTNA 1Y3JA 4DR6F 4LR8A 5HATA 5J1EB 3KHRA 4CLSA 3D5MA 1UVMA 1IR0A 2MDAA 2AJ1A 2H5JB 1Q5VA 4URQU 1VLOA 3KK2A 4PPDA 4QWAA 2FJWA 2HWHA 1M1KT 5LXYA 1J5EJ 3E01A 3OLBA 2RU9A 5KT3A 3MUVP 2R7TA 4F7VA 1RBLA 4HHJA 4C11A 2HNYA 2BRKA 4O3SA 3N28A 2KFZA 3CE8A 4FXWA 2O66A 1IBLJ 3PFOA 1S1WB 5D3GB 1EAYC 3BPSP 2ACYA 4F0MA 3O8WA 2AWZA 2UVUA 2PI4A 1CJTA 1HI8A 2JRSA 2BV3A 4L3NA 4ZP6A 5KFQA 1H98A 3DGPB 2JZ5A 5GAHU 5A8WA 2CPZA 4LSZB 1IKXB 2HNZB 2HQIA 3GJQB 2KG1A 5JJBA 2FHJD 3OW2R 3CJ0A 4LRCA 1RLDA 3IRWP 2CZ4A 4M5GA 4ZS6A 2A2CA 1FA0A 2KXFA 1N34F 2HBQB 1U6FA 3MEDB 3RBZA 2B6AA 2IM3A 3IG1A 1MWZA 3ZZOA 4HI1A 3J7YU 1ICEB 4DV3J 5ETQA 2DHHA 3IO1A 1SL0A 1IJFB 3VAHA 1NH8A 2IC3A 4OHVA 1DQAA 1RP5A 5THWA 5KFFA 3G6YA 3V6JA 1KC8T 2WBMA 3FJ2A 3GE9A 5JVHQ 4PWWA 5AJ3F 1JWWA 2OPRB 5EGYA 2ZE2B 2ROGA 2YQ0A 3DOMB 4AQYF 2KYXA 4M63A 5GMEA 1T9UA 3H2UB 3Q8QB 3OTDA 1W2IA 1SJ1A 2DO4A 1FX2A 1IKWA 3NS7B 5F9LA 2DR7A 1S0MA 2JOQA 1T3OA 2SXLA 1X4AA 3RRKA 1AZSB 2AEJA 4P72A 5DGBA 4XDCA 4UUXA 3SBMA 3FFIB 1V5VA 2DJWA 2NSBA 4DJBA 1JKHB 4O44B 5HJXA 1CJUA 4RO0A 1ZA2B 3DRXA 4OYMA 2WZ1A 2EVZA 2OO4A 4GKKJ 2MSTA 5F0UA 3DRRB 1ITPA 5KFUA 4QYZJ 1WACA 1PCAA 3PKMA 5K14B 2EG2A 2FHOB 4PXCA 2WCXA 4OI0A 2RRNA 3TW0A 3ZC4A 3H42A 3CW2C 3W9HA 3NGDA 3ELHA 1S9EA 2ZH1A 3M2VA 4JYAF 2Q43A 2HURA 4PQUA 4JI0F 4WYWA 1R31A 3VGVA 3O3LA 5MAOA 2ZHBA 4B08A 3FC9A 4F3QA 1YZ7A 2RB7A 3HJFA 1CPZA 3PTWA 1FCAA 5AXKA 4C97A 3C6TB 1VISA 3K7RA 2ZJRQ 2DR9A 1I51B 4I2QA 4N47A 4LBHA 4KHMA 4OYZA 4U67Q 4ZLJA 2OI2A 2POKA 5D78A 2OSRA 1TKTA 4F50A 3H0PA 4M5DB 5A8RA 4EZ9A 3ZTPA 4YEAA 2G0JA 5J2NA 1FKOA 4FNIA 4FYVB 5C25A 4WKRA 4IG3A 5CCLA 1UFWA 2MGZA 4EYIB 4DFMA 2CQHA 3GB0A 2RHQB 2UP1A 5HP1B 4QWDA 1C0TB 1RAIB 4I7FB 2GO8A 1UEUA 2P2CB 3KK3A 2DNLA 2IYGA 4ZVQB 4PG8A 4JI2J 2FGOA 5CZVA 2KKHA 5HAOA 3QRRA 3CJQA 1FVSA 1RA7A 2H5EA 3A3OB 3H5XA 4HL9A 4QWEA 2ZNYA 3NNCA 4MH8A 2LFVA 3VZIA 4WKYA 3BSOA 4K4TA 3GCWP 3HSDA 1HNVA 2UUBJ 1WDTA 3GIJA 4LFAJ 2DY9A 3KDNA 3KUGA 3EVOA 5HVHA 5E41A 1CQMA 1F2HA 2GQQA 3D1HA 3E3XA 4J9RA 1DLOA 3KLGB 5GADU 4OHWA 1HD0A 4I0WA 2QL9B 4KRWA 3HP6A 3KJNB 4BHQA 3VAJA 4ED2A 4F2SA 2HHSA 3NS6A 2Q1LA 1B64A 4EI2A 1Z4UA 1UETA 2F9DA 2RQKA 3CDBA 3CF5Q 3M8PB 1N36F 4OHYA 4RU2A 2RF2A 3M8PA 1O5JA 4J9KA 1RHQB 3DXSX 3KOAA 2YTCA 2F63A 1HD1A 4L75A 3NBPA 1RTIB 3AODA 3QYYA 5E3QA 2RDJA 1X5TA 2QA1A 1YBTA 2FLNA 2CADA 2W8LA 5T41A 1QUVA 5AT1B 1Q7YT 1RABB 4B3TJ 3QT5A 3D1QA 2YKNB 5GAEU 5J1EA 2VIHA 5F8NA 1SQFA 3C15A 4FKYA 1S7IA 3PIPQ 1M90T 3J7AN 2KFYA 2AEMA 4OI2A 4K0KF 3EVMA 3TEHB 3HPOA 2GIRA 1JNZB 2GHWA 4OMFG 4F26A 5BR8F 2PI5A 4LF8F 4R5PB 3R1LA 2F4VF 1WDDA 4LVNP 3W9JA 4W4MA 1ZM4A 2YPZA 3BGUA 2B4OA 1FTCA 4X62F 5I42B 1J2VA 1RWWB 1E6VB 3PY8A 3DU6A 2EBEA 2ALZA 2V2KA 5IWAF 5KT2A 1QY7A 2EWHA 1S10A 2UUAJ 4IOCQ 1UVLA 2XI2A 1VLYA 3AOBA 4MKVA 3I55S 1ROFA 1FDBA 3DLKB 1S6PB 1FVQA 4R0JA 5FDLA 1CJVB 2KT2A 3V6DB 3IR7B 2FQQB 2PGCA 3J7ZT 2DXEA 5IT9Y 4RW7B 3N79A 5HO4A 1ZTWA 2BW2A 4MMOA 4LRFA 4JUZA 4AD6A 2FC8A 4YDDB 1IBLF 3M9NB 4O0NA 3R5DA 4O3RA 1H6KX 1VRTB 1FRXA 3S01A 3TVZA 2OPPB 4BBYA 4HHHA 2AX1A 2AU0A 4K5RA 4NLDA 5IM0B 4CO4A 5CAAA 1HWLA 3JSMB 1MSWD 3ENQA 1NZ8A 3M30B 3DMJA 1JLAA 1RAGB 4CRJA 1R8AA 5DLFA 5B0GA 8ATCB 4TY8A 1C1BA 3A4TA 4A8XA 2ZH5A 2P9GA 1RWUA 3GJTB 4I6AA 4DV3F 4IUFA 1WI8A 1MNEA 3I4HX 4AT1B 2IMWP 1GFWB 3FBEA 2HQDA 2AW0A 2VUGA 2F8HA 2Z8QA 1ZAXA 2XY7A 5F8GA 1X9WA 4PAAA 3OLAA 1RBOB 2V9KA 3GU0A 4NI2B 4NLPA 3G2XA 2CDQA 4DQSA 1WF0A 2IM1A 4HKQA 5B0AA 2W9AA 4KHRA 4DFPA 4NEYA 4H4OA 4KGXB 1HI0P 1G4CA 2YNIB 3BF4A 1CJUB 1Y5LB 2CQCA 1VGYA 1SIZA 3NP5A 2CJAA 1VRTA 4OX6A 5AXLA 1LWCB 1NUEA 2VKZG 4RW8A 2KI2A 1TAUA 4CWBA 3H5SA 1EHWA 1RT3B 3TAMB 3M4XA 4PWDA 2H5IB 1VQYA 1VQ4S 4G6VB 4NA2A 2OUGA 1IXKA 2NXCA 4WBFA 3BSCA 3MD1A 4LBIA 2MKYA 2YX4A 2WAQD 4CYUA 1MN7A 5HQMA 1SKWA 4JI1F 2E9ZA 2XLKA 4NL5A 5D0HA 3SCJE 4DXLA 4A8SA 1WOSA 5HK4A 2P6TA 1BXNA 4ZP9A 1EKRA 2ZKTA 5IQ6A 2KXHA 2OPSA 2CQDA 2XSJA 4RUHA 3NCRA 1JIHA 1BMQB 1MWQA 2M7SA 2MKSA 3QPIA 5ETVA 1KQFB 3WX8A 1W2BR 1NKBA 1YJNS 5U47A 1N54B 4I7FA 2DISA 2RF2B 3CMQA 4C8LA 2ZBRA 3CSKA 2ASLA 1TK8A 4DX5A 5F8LA 2EFGA 4RW4B 3W2WB 5C25B 3D4JA 1JLBB 1BQXA 4WP9A 2V5HG 4ZKAA 4A8FA 4I2PA 4M5JA 1GMWA 4DV1J 1SUQA 3M32B 4TU8A 3TUPA 1TKZB 3A3PB 4BC7A 4USUA 3AJ1A 1XMOJ 1JLGB 4FXDA 1NHVA 5L1IA 2YKPA 3BSAA 2I1RA 3OSNA 1KP6A 4JBCA 2M0GB 5KT6A 4F0HA 5F8IA 2ZHAA 1MROB 2B7CB 2NXNA 5E7OB 3UE2A 5L38A 3CCJS 2DR8A 2ZWOA 3MGJA 2ZBQA 1UJ5A 2HNYB 5LL6d 2ZD1A 3IWXA 1V3ZA 3M8QA 4BLGA 5FIIA 5LT5A 4UQGA 1WWHA 2KG0A 3NMAA 4DCPB 4IG3B 2QTWA 2LQBA 1RT2B 3IFEA 1FFSB 5E3RA 4DUYJ 1L3VA 2I38A 2N3LA 2GAGC 4C3LA 2E5LJ 3RR7A 4L6V3 3C66A 4DR5F 4ECSA 2OTLS 1DURA 5HROB 4QU7A 3S7RA 5J1NA 2JX2A 2FLOA 4QIWD 2W9BB 1ZYQA 3UN3A 1OWXA 3RBXA 1KVKA 5CYQA 3J80Y 1RAHB 2CG4A 4OYOA 1L5UA 4Q2MA 5IV4A 2YNFA 2BZ2A 2BKNA 3MR2A 1HLWA 3PHTA 2X1AA 4JYAJ 1FXDA 3RB4A 2OAUA 1LKZA 1QUPA 1WSVA 2V69A 3C14B 5KFJA 4YN3B 3CT9A 1K0TA 2HBZB 2MKHA 3ONQA 1RTZA 1XC9A 4ED7A 3G6ES 2V8GA 4J7CA 1HHQA 4R8UA 1VJWA 2FJEB 4LF9J 2B0GA 2CNNB 1RT4A 2PSZA 3ZTOA 3FKBA 3F73A 5KFMA 2HVZA 2RT3A 1UVIA 2H9ZA 4CLUA 5JVGQ 1TK5A 2ZNZA 3W5YA 2G2OA 4IYQA 3UD4P 1CS4A 1DTQA 2ZKUA 2LEBA 3IR6B 4ZVHA 3OXGA 5H9FK 1FO1A 3AOCA 1U47A 1P27B 5CYMB 2AIRB 4TNOA 4YUDA 1RT1A 5F8HA 2EC2A 2VA3A 1RTHB 3B8HA 5E33A 1HQEB 2JL9A 2AYBA 1X5SA 4L74A 5DDRC 4F3OA 1WELA 2OEJA 5GAEI 3I0SA 2CJKA 2WVFA 3PX0A 2R8HA 2IIHA 4Y0FA 2KXNB 3WQPA 1J5OA 1RZMA 2P9EA 4P2MA 4EMDA 4ECTA 1EZZB 4MK7A 4ZIVA 4CLPA 1V6HA 2FY8A 3HFKA 4B9TA 2XS2A 4G1QB 3AA9A 1VJQA 1KTVA 8AT1B 3THTA 2ZH2A 4K0KJ 3EPGA 2IA6A 1FRKA 3MM6A 1B4SA 3CCSS 5DO2A 2XS5A 2ATCB 4DV2F 2XS7A 4IO1A 1QJHA 4DN0A 4ZDNA 3LAKA 3KG0A 1T94A 2W4CA 1PJ6A 4DU8A 5J1PA 3U1LA 4RW7A 2MY8A 3LP2A 1SCJB 3B4DA 2J5AA 1W26A 2VBYA 4GVLA 3CDWA 2JLGA 5BYQA 1U2RA 3NRBA 5CH7B 2DCUB 1WC0A 2GGPB 1RT7A 1RACB 4C0BA 3BGRA 1LWCA 2WOMB 4RW4A 1WKLA 1CULA 4I64A 1RE1B 3SQOP 1M5HA 2RS8A 5DQGA 3MFIA 2L3MA 2VU5A 3BZQA 3PDNA 3PJXA 3VVUA 3ZZZA 2FLLA 4I67A 4DV4F 1X4EA 3RB3A 3H4DA 1J27A 3VQSA 1N52B 4NA3A 2BE9B 1B99A 1EJ7L 2U1AA 2JNJA 5EWFA 3PW0A 4CNZA 5L9NA 1DLOB 2HHVA 2QYGA 3OVSA 1IBMJ 5ETOA 4Q43A 4RL1A 3DFEA 2PEBA 3NWGA 4Y65A 1GNKA 2CWXA 2P5VA 3PJ9A 3R97A 3T9NA 5KFIA 3HX9A 3D66A 2YWGA 4IH5A 5FLXU 3BDPA 1ZH5A 4OJ1A 4GKJF 4J9MA 1Y7PA 3KLFB 2KFNA 5A8KB 2BANA 1B0VA 5BYSA 4PG5A 3NLCA 4F4XA 2F4VJ 2FB0A 1N5QA 4LF7J 2IVFB 5HP1A 2A1BA 1X9SA 3K17A 4JI1J 1H73A 1URRA 5KFZA 2MGZB 4QWCA 2UZAA 3HT0A 3Q89A 3TEGA 1KS2A 3EUNA 4WFBQ 3LW5C 2O01C 3UFCX 3WIVA 2GAHC 2VF3A 5DG8A 4USIA 3KLEA 3GJRB 4YR3A 4CLTA 4YY3F 2AEFA 2CYYA 3IBFB 4GO5X 1JQGA 5D77A 1HW9A 4UT4A 2IRUA 4Q45A 1HNVB 1YJ9S 5EUHA 3MR3A 1H2VZ 1NJYA 3OPKA 2J7KA 4QBUA 3HSJA 2MKIA 2BYCA 3SDEA 2LQ9A 3RJMB 1BWEA 1EARA 2RILA 2YNGA 4B9VA 5BJRA 1NCLA 2RUGA 2XEXA 5F3ZA 3QFWA 3R5BA 3BDEA 3CC4S 1H3DA 1U2CA 3ILJA 3MMAB 2V67A 1OY8A 2RIJA 1TVRB 2JLEA 3DYAA 2VFUA 3FQLA 4HH1A 4C2MA 1VQ9S 2OHDA 4IR9A 1FJGF 4O4GB 4FP9A 1NM2A 3RUBL 1FKOB 2MLXA 2BE2B 2HQGA 3M1VA 1TKDA 3U27A 4CLYA 2J9DE 3HHNB 4EWTA 3BYRA 1OPIA 4NXMF 3OHBA 4NLWA 1S1VB 1X4CA 2MZSA 4U7CA 1RT5A 2KJWA 1R8HA 3IP0A 2YKMA 1NB2A 3I0SB 2E5LF 2LCWA 2O1PA 2RAQA 5KG3A 4ILMA 2UV8A 2HQCA 2IJFA 5IC4B 5CHCB 1T9WA 3VAFA 1EP4A 4O3NA 1LFWA 3C15B 4WPAA 3GTYX 3CVKA 3PFEA 1KHWA 2F4FA 4AL5A 5L39A 2IM2A 1UP1A 3MM5B 1FWKA 2KRBA 1RA6A 1FX4A 1S0NA 2MEWA 2Q79A 1I94F 3NMRA 2YWEA 1T9YA 2XWXA 2YY3A 1Q78A 2VH7A 4ENOA 4I68A 4WE1B 2HPUA 1OO0B 1SBRA 2K7JA 4NYPA 1JXLA 5DS7A 1VCTA 2XG8A 1E6VA 4MFBB 1UW9A 1X5PA 1Q8KA 3OSPA 2C2EA 2W2QP 3CIZA 3LWLA 3T6BA 5CD4H 1UPMB 2B56A 3QGGA 3JTPA 4I6WA 4QIFA 2W8KA 2VQEF 2BJ9A 4N5SA 2AHOB 3IR5B 2KN4A 3Q22A 4ER8A 3FMBA 1QSYA 2XNRA 1Y4ZB 2R3VA 1JX4A 2VDIA 2IVMA 1F9HA 2CPHA 2AF6A 2ALYB 1LV5A 1Q1KA 4W92B 1GXLA 4ZHRA 3BPDA 2MKKA 1N5YA 4CH0S 4PG6A 2ZJQQ 3G6VA 3NCPA 3HK2A 2OEKA 2OH2A 3AA8A 4ZK7M 1YJTA 4RWXA 2F8EX 3UDVA 4XO0A 1XK8A 1YSJA 4BCAA 4N56A 5L1JA 1Y5NB 2QMWA 3MAAA 4DV5F 3W60A 3HFZB 2R2UA 3ISZA 3UD5A 1JXEA 3JQMA 5IC6B 4ED4A 1W7WA 1XERA 4ZVUB 4K4SA 4EYHB 2R7WA 4U8YA 5D0EA 1X8DA 1IKXA 2HNZA 3TWZA 4ZP8A 2N4CA 3DLGB 4QJVA 5LSRA 2CQBA 4Q8EA 3M6XA 4KGKA 2V8VA 2YBVA 1GXTA 1RT6B 3SQGB 2HLUA 3LP2B 1PYOB 1NRKA 4Q0BB 1I5OB 3BKUA 4NZ6A 3R5CA 4PQAA 3V4MA 3LOUA 2R2TA 4FDFA 4HVZA 3M2UA 3PVXA 3JB9k 2EFPA 4H4MA 4OYBA 2L9NA 3MTKA 1C0TA 3P5BP 2C2DA 1PIEA 1TMMA 5KT7A 4FBTA 4JV5F 3C8YA 4HACB 5B0CA 3MDFA 1REGX 1Q8LA 4J9PA 4DSFA 1CULB 1KLNA 3KMQA 4ED5A 2JC1A 3R3TA 3U1NA 2WW4A 5C7PA 5IT4A 4CI0B 3BR8A 1YRTA 4JI8F 3I32A 5DM6Q 2XY6A 2BX6A 3ILLA 4GKKF 2CPJA 3EGWB 4O3PA 4JI4F 4GMKA 2V94A 1QE1B 4RW9B 2D69A 1YVFA 5B0FA 1GAOA 3VAIA 2UUTA 5GVQA 2Q66A 2KDOA 3E2EA 1Y00A 4TLRA 3VAGA 1Q53A 1KLMB 2J6UA 3LP1A 2EFVA 3Q8PB 1XMQJ 1T7PA 1LK7A 4GVBA 2IJNA 1KR4A 1HYSA 3GJSB 1UKUA 4GC6A 1AT1B 3G8QA 2QA4G 4KH1B 2W9CB 1IBMF 1RTDB 2IHR1 2V9WA 3IM9A 2P9CA 3SEOA 1X31C 1HQUA 3V81A 2O67A 3UNYA 3OV7A 1RWOB 3UVJA 1HNIA 3SXLA 1VHIA 1BQMB 3QLHB 3DRPB 3KK1B 2CKWA 3N5BA 2LXIA 3GIIA 1RCOB 2AJQA 3KK1A 2QFJA 1UA1A 4B17A 4YDXA 3RZAA 3H5YA 2LU2A 1JLEA 4DQQA 4BS2A 4Y34A 4IDKA 2FVSA 1SKUB 5KFYA 5LMNJ 4EBCA 4X4RA 1EETB 3TUZC 3JXOA 3MTJA 4HH0A 1EX8A 5KG4A 2WVEA 3KHGA 4J9LA 3ETOA 2YNGB 2Z58B 3GYGA 3N01A 2HKEA 4H54A 2BJ7A 4K5SA 2C1EB 1RADB 4PYDA 4WFYA 3SDEB 1U1MA 5D4NA 4C8MA 4DSJA 1RU2A 3DN9A 3W8PA 3ZO7A 2CIMA 2HQFA 4PWUA 3Q8YA 4WP8A 3T5HA 4LF6F 4MKAA 4N8OA 3R7NB 3THVA 1XNQF 1N5TA 1XNRJ 3OTCA 4PPZA 1B0TA 2ZJPQ 4ALZA 2DGXA 2Z4PA 2HHXA 4WTYA 4QYZK 3F44A 1FD2A 3HJVA 4I4BA 4IRCA 3LP0B 2YX7A 3EDRB 4LFBJ 1R89A 1N36J 1WC3A 3TJAA 3KFWX 4JI3J 3MPUB 2XO7A 4WFXA 4F4YA 1XBWA 3MPVA 4TQRA 4B3SJ 3NWRA 1YJVA 2DNZA 2ZITA 2UU9J 5E3AA 1NNDA 1U25A 3HFVA 1N32J 2BW7A 2RJZA 2JSXA 2GVDA 1V3RA 2V34A 1S6QB 4O4RA 4NCAA 1SH2A 3I6PA 4UZCA 3PNIA 4K4UA 3WDOA 2BE7D 5CYJA 2GFFA 4IFYB 2C3YA 1HNWF 1DTTA 1IR1A 4C3MA 2LMIA 3KNGA 1FE4A 2KHCA 3FSXA 5A0YA 2L41A 4WF9Q 1KHVA 3MR6A 4LF5J 3IMQJ 3H4BA 3SIPB 5AXMA 2EBGA 2VHGA 4KE5A 1B0PA 5LSOA 2RQ4A 3BO2A 3GZ7A 2IY5B 1EQ0A 3WX4A 4HDHA 5KFLA 5SUHA 3MEEA 4K8RA 2GQ2A 3EXCX 1Q81T 1S6OA 1DHMA 3CJ2A 2JEIA 5LMUJ 3ZZPA 1IKYA 4BWMA 4EBEA 4RR5A 1K9MT 2J6TA 4FF4A 3H7HB 2HQ3A 1S9EB 2K3IA 1RLCL 4CLKA 3EXYA 3OXLA 2HVDA 3FEZA 1IN0A 3FGVA 4WK3A 2R8IA 1HNXF 3CULA 3MAAB 4RW8B 4K7QA 2OEMA 2C3OA 2YVSA 3DC2A 5B0BA 3WC2A 4CTAA 3JSMA 1WJ9A 4K2JA 2F65A 3AB2B 4QWBA 5KFRA 4J9OA 2X51A 1RT4B 3D67A 4K2XA 3GONA 4P2FA 4WFAQ 4EEYA 1T95A 3LA0A 3L3CA 3EE3A 1UA0A 1ZAVA 5C42B 1LWFA 2VG5B 1TKTB 3LF0A 3LGMA 4RLEA 1NAQA 1SV5A 4ANEA 5HSPA 1ELOA 2OMOA 2GVZB 1RDRA 1X0PA 2BJ8A 3FMWA 4DV0F 4USVA 4CLZA 3CGIA 3UW1A 4LSLA 1K44A 2EK1A 3BR9A 3FUYA 1YBAA 5K8NA 2ZH3A 3ENVA 2HZCA 3L9ZA 2AYMA 1TV6A 5KFSA 1TZ0A 2W2MP 4PG4A 2B7BB 2IMOA 5BYRA 4M5IA 5D0GA 2ZH9A 5DG9A 2NPIA 2PMWA 4LF2A 5E3PA 3ZXWA 5B09A 3GSDA 3OUYB 1U1QA 5K14A 3HULA 1BC6A 5KG5A 5T7LA 3FCHA 3BO4A 4CH7A 3ZTSA 1YKWA 4A8MP 2IDEA 4Y6IA 3MMCB 2RSQA 2C22A 3QJLA 2GZOA 2MZJA 1UZDA 4WZQA 2V8PA 3MPWA 4ZVTB 1B70B 1QTNB 3ENWA 3H90A 3W8GA 5D0RA 2VJVA 2NYIA 2A6MA 3HCXA 3OR2B 4YP3A 2HYIB 4OFZA 1X4GA 1N33J 4KKOA 1HBOA 5F41A 2WK4A 5I4MA 4JI0J 4LSNA 1WG4A 4A48A 2AYGA 4A4JA 4RW6A 2ADBA 1RWKB 3KG1A 3KHHA 3EX7B 4JI8J 2PMZD 1NK4A 3GIKA 3GSIA 2RKIA 1CJKA 5A2QU 1KLMA 3V4IA 1WOPA 1REVA 2D9OA 4NLSA 3G9CA 3NNAA 2OJ3A 2CJBA 2DIUA 4MTPA 1FKPA 2DPIA 2GMLA 3IWNC 3HXMA 4KY3A 4ECYA 3K59A 1QTMA 3Q2TC 2BXJA 1RKIA 1MMLA 3M32A 4DPXA 1RTJB 2ZC4A 1NLKL 2M52A 4NCBA 3D6FB 2GV1A 3DRPA 1TL3B 1HBUA 3G8SA 2XTJP 1GXUA 2FZCB 4DG1B 2A18A 1QSSA 2U2FA 2VA2A 5J2QB 3FNNA 3MPDA 3BREA 3H25A 4NE9C 1WI6A 2CZ9A 1JLFB 1PYTA 4DV1F 3OT9A 1TL1A 2E9TA 1UWAA 4CP5A 3LP1B 1VK8A 3GLJA 3X3UA 4ZITA 5JMNA 5HBMB 3MFHA 4F4ZA 4DL4A 3OL9A 2PFFB 2DH7A 4CO2A 5HBMA 2B3TB 3PCOB 4V19J 3PKYA 2RNEA 4ZLNA 3DLEB 1FDAA 3V5RA 2CNKB 2GNKA 2ZDPA 4KHPF 4NLUA 3RAXA 2IFXA 2B51A 2P6SA 1D1UA 4DR2J 1FNOA 2R7OA 3RR8A 2J0QD 2UXDF 1GMVA 3NBPB 3Q8VA 3QT7A 3AXKA 5IM0A 1AROP 4X65F 1BY9A 1KBRA 2HRTA 3QIPA 3M6UA 2GHVC 1WKKA 4LF6J 1XNRF 2KM8C 2HG4A 1S1XA 4DUYF 4JI7J 1NDPA 3NEKA 2YNHA 3MECA 3HHKA 4ZHRB 1AB8A 2HRUA 3QFHA 4FYWB 4MKBA 2ZUGA 2HWTA 3A1YG 3PYGA 3ZZRA 5EDWA 2XMAA 2JEFA 1PJ5A 2MB0B 4DL6A 1LFPA 1TTHB 1KONA 1JLFA 1M1GA 1NMEB 1RQ0A 2RUSA 3PYFA 4P75A 2VG7A 4C6AA 5CA5A 3M8RA 3KWMA 2VQFJ 3N6MA 4FPRA 4AUKA 1LW2B 2FJXA 2XQCA 1P8GA 3K0JA 1YITS 3A8KA 1NDLA 3G6XA 1UVJA 2AQ4A 4HLBA 5HMZA 3LALA 5E2QA 2RRAA 1WKJA 1RISA 2D7SA 2ZBIA 2PFDA 3LP0A 2OP5A 4UUWA 4I6YA 5KFGA 3WZ0A 3NKYA 3EWGA 2FVQA 3FZ2A 4R25A 5FLXY 3J7YI 5HLFA 1KWMA 1RYRA 2QG9B 2CA9A 2HFVA 3PV8A 1SL1A 1FWLA 2CQ3A 2D41A 2E5JA 4Z7CA 1HNWJ 4FYDA 1FWPA 2JFKA 2AV5A 3G82B 2CQ0A 2QJ3A 3TJ8A 3CJ3A 4KGVB 2C2NA 4N7TA 5CCMA 3LWMA 4EO6A 1GH8A 4CLLA 3CB4A 1LXNA 2VDHA 3QT6A 4LF5F 2GIFA 2YKAA 2IPOB 5I3QA 1PGZA 1S0OA 4XDDA 1FJEB 1X5OA 3QZ7A 2E5HA 2V2QA 3P3DA 3HT3A 3Q0AA 4FVCA 1GMUA 3NOCA 4RPFA 1NK6A 1I1GA 2W2NP 4P9SA 3EICA 3R6LB 2XLIA 2DGOA 3D0HE 1KTQA 2QC3A 3AD9C 1JLAB 1N4LA 1DJ0A 1CS4B 1K47A 1UFKA 2C2MB 2FYXA 2XULA 3CJKB 2IM0A 4QPXA 2BEFA 3AJ2A 2R7RA 1VQKS 4WE1A 3BKFA 5HI7A 1SC4B 4CH1A 1HKAA 1SJ4P 4R8UB 1H72C 4OYAA 1NH7A 2G13A 3TA2A 4K4ZA 2DRBA 3FFIA 2C2ZB 2AGPA 4LF4F 3IRXB 1TL7A 4NYOA 3RB6A 1WOOA 2E29A 2CPFA 4Y2MA 1NZAA 4OZJA 1TV6B 1AZSA 3SSRA 3OR1A 5DZ6A 1CJKB 1FRIA 3IC1A 3IM8A 3CJ4A 3BBBA 3BM7A 1SJQA 4Y2KA 4USTA 4B9LA 2FZKB 1M5PC 1HQEA 2MQOA 3C6UA 2QLXA 2VL1A 1RHMB 5ADZA 3TI0A 5HL7Q 2FY1A 2OFGX 1JXVA 2KL8A 2Z0GA 2Z2ZA 4H4KC 3SV3A 1TU0B 1G7CB 2D1CA 2H54B 5JUMA 2W24A 3SFUA 1K73T 5L9XA 3OBIA 4E98A 4TY9A 8RUCA 1YLXA 3WHIA 1SI9A 1UWBA 1Z2ZA 1RWXB 3DNCA 3MM7A 2V4RA 1JMTA 2DGQA 4WIIA 5LOQA 3QGPA 2DHXA 3MWBA 5HQ8A 3AAWB 4B3OA 2M88A 1JLQB 5I3UA 5ETNA 2KZMA 5K20B 1QD1A 4DL2A 2A6OA 1VQ8S 1I6JA 4ED6A 2MQLA 1NK5A 2BQUA 2Z57B 2VC0A 1NB7A 4CIOA 4NCGA 1Q7LB 2LP4A 2N7YA 3UCZP 2HMIA 5D4LA 4OI6A 4HR2A 3ADAC 5KTQA 4WXWA 3P5TL 1LEOA 2QRRA 3PYEA 3P8BB 1WHVA 1OQ3A 4NLTA 5IZHA 3QWPA 4E0DA 2Y1RI 3EZ5A 1EQMA 2RVJA 4YB7A 3QO9B 1QAIA 4LF7F 3MCSA 4HACA 5M2RA 4F4WA 3TUIC 3MM8B 3T1YF 3AJDA 2GW8A 3T5LA 3E01B 2HVEA 3PO5A 2G1HA 1H0HB 4B3MF 4KPYA 3FCWA 1M5KC 4BWJA 4DSEA 1JLCB 4NLQA 2V4JA 3R5GA 1U48A 1O51A 3QQCD 1VQMS 3LO3A 3ZZ0A 1SC1B 4LR9A 4DUZJ 3DLEA 2AZ1A 2DD8S 2LU1A 3K2YA 4Z37A 2YQ3A 3H20A 5J2MB 3V4IB 1OMSA 3FBBA 3I9V9 2R8JA 3C46A 4M94A 4EUVA 2DYAA 2BKOA 3I5BA 5KFBA 3RRHA 4I56A 4AL7A 2FDNA 4C0OC 2M3DA 3ENAA 1G3OA 1XTZA 3F0NA 2A2DA 5KFVA 4DI6A 4E8UA 2EXUA 2L9WA 3HF5A 4OI4A 5L1KA 1DARA 4B3RJ 3PEHA 4KGZB 2DNNA 3W2WA 4WU2A 1OSCA 5D6GA 2XMWA 2DXDA 4IH6A 5EWEA 4KHPJ 4PXDA 2XYGB 1GTEA 4AE5A 4X4NA 3HHLA 4ED8A 5FD1A 1UAWA 3R5AA 3CD5A 2A3JA 3U7JA 3LH2S 5K9FA 5KG1A 1IWAA 4NXMJ 2ZZMA 3UPFA 2UXCJ 2M5YA 1EP4B 1N5SA 2D3OR 2ASJA 1HWUA 3GR0A 4ECVA 2J76E 1KSPA 1QSLA 3P49B 3HHDA 3GFXA 2XLJA 2W25A 3BH6B 4DN9A 3N5FA 1D09B 3K58A 1AUDA 2W4DA 4QW8A 3MOJB 2GIQA 3FRYA 3G87A 3R9LA 1UEVA 1U1KA 3LGHA 1TELA 2QA2A 1VBZA 3IS9A 3TP2A 3OTEA 4ES1A 3H8YA 1FRJA 2PC6A 2ZBCA 2GX8A 1VDHA 4G1PA 2RH3A 5M2UA 1N0UA 2LECA 4PCQA 1T05B 1SJ3P 4JI5F 1X4DA 3TNVA 1UVNA 4ZLLA 2MTLA 3CXCR 3CJRA 1YWXA 2PMHA 4DR1F 4HTJA 3B6BA 5CZXA 2Y0SD 1KRPA 1O6XA 4WU3A 1FRMA 4QQBA 1PAEX 3M05A 2LEAA 4X4TA 2M8HA 4YR2A 2GA7A 2ZM6F 4F2RA 1PJ7A 2HS3A 3V6KA 4TY8B 1H7WA 3GIMA 4OZ5A 3BQ1A 2B4VA 5CQGA 3W63A 2HGMA 1YJWS 3M30A 1NSQA 3RYLA 1GQEA 3H2VE 4X4SA 1RHJB 1HPZB 4B9SA 1DRZA 1D0EA 1PYSB 2QL7B 4DV2J 1V5IB 2OPQA 1VC5A 1U1RA 2FZGB 4N41A 4UY8T 4AQYJ 1FF2A 3K5MA 1C2PA 3D0IE 3GFHA 4HHUA 1TKXB 2HFSA 2B5JB 4RNFA 3SFGA 1OIAA 2H3EB 1Q95G 1B7FA 1RHRB 1HYSB 3MI7X 3QAEA 1ZS6A 4E2FB 1IKWB 5DDPC 2HHTA 1CSJA 4TLQA 2HGLA 1R0BG 3HDSA 2XMVA 4IFVB 2DR6A 1N88A 5IT0A 2IYIA 4V19X 1U8WA 1SUQB 3LGNA 4OX9F 1ZOTA 2IBKA 5E3CA 1FD8A 3E51A 3N6NA 5GMDA 3Q8SB 1NBEB 4L72B 1GEHA 3MUTP 2GJFA 1L3UA 4Y3CA 4DV4J 3JS9A 3JAMU 4IO9Q 2MXYA 4CTAB 3M8SA 3R2DJ 3QRPA 4IOAQ 5KFXA 2JWNA 1WNEA 5HVFA 5FJ4A 2BQ3A 1NJWA 4JV0A 3NOGA 4WK1A 4DUTA 2XO6A 2B8QA 4BC9A 3A8IA 2R42A 3CDAA 2Y1IA 2HIQA 2LA4A 2G4BA 4PUOA 2HS0A 4FNHA 2I6WA 5G0RA 5IXUA 4MAKA 4IG0A 4USJC 1Y3KA 1SC6A 4DMZA 2UVVA 1SPBP 4QU6A 2NXUA 3ETMA 2VFTA 2YKNA 3D3CJ 1RAEB 2BMBA 3JSBA 1KOOA 3HVTB 1WC1A 2C2KB 2RHSB 3DDNA 3ILIA 2J0XA 5GAGU 1VBXA 2R7UA 4J9QA 2Z2MA 4X4OA 1S9FA 4K59A 1KN6A 1OPZA 3CD6S 2DGUA 1EETA 4LRBA 4NA1A 4ERDA 4UOGA 4ICLA 3UN2A 4A8OA 5AE1A 4HT5A 2E7WA 4Y00A 2BRLA 3QO9A 1AYEA 1HHTP 2VFVA 1AA1B 1MWYA 2YPYA 1C0UB 3MMCA 4P74A 4C8OA 3CC7S 4YQWA 3T1HF 2BOAA 2XWYA 2OSQA 2BR0A 4P10A 4ZJQA 2KO1A 2UV8G 1ZPVA 4C48A 1SH3A 2E1PA 4KPCA 3C6TA 4OI3A 1W25A 3KG4A 4DEZA 1CBKA 2CG8A 1JB0C 5H9EK 5EX3A 4B3MJ 4DR4F 3OFHA 2HFUA 2DRAA 1RWNB 3VALA 4DR3F 1TL1B 4UZBA 2V8HA 1BWVA 2ROPA 3NGUA 3V6DA 3S8SA 4DR4J 3SSSA 3EPIA 4EGLA 2Y1LB 4FS1A 2UUCJ 4WTOB 3KJVB 2CQPA 2DEIA 3KDOA 4L3KA 1JLEB 1H38A 5ETLA 4RX6A 1Q8IA 4ID5B 3I82A 1JNRB 4A47A 4DL3A 1RGVA 3K8WA 2BE2A 3M1VB 4XTTA 1EB0A 1CC7A 1BQMA 3QLHA 5DZ7A 3F41A 3NS5A 4FF3A 2NCKL 1TUVA 1U0HB 2HHQA 2R7XA 1J5EF 5BR8J 4UW2A 1Y9OA 3SSQA 4IRDA 1C4AA 1VQ7S 2UVRA 2FC9A 4ANDA 5LSLA 4A8KA 2VG7B 1HR0F 5KFKA 4LQ3A 2BOPA 4ZN1A 4RZRA 2CVEA 1YBUA 4EZ6A 1E6YB 3A8JA 4B3SF 3TO8A 2DHSA 3HD2A 5IWAJ 1S6PA 2UUAF 3D0GE 2ZE2A 3CJTA 4ANCA 1TFWA 1HL6A 5HROA 1U8SA 5HMYA 2ADCA 2GQCA 2ZOFA 4H4KA 4TU7A 1YJ7A 2AJ2A 1U24A 1S79A 3IBWA 1RTIA 3KJFB 4ZPAA 4MIBA 2PO4A 4O3OA 1U2FA 2KHDA 5A0YB 3IS9B 1CC8A 2QO3A 1Q86T 3DRSB 2WSFC 3MEDA 1T03B 1VBKA 3GMGA 3S1TA 4RNMA 2V50A 4W90B 2ZUAA 1S48A 1VK3A 4ECZA 2E7VA 1KVIA 3MR7A 4NYZA 1P1LA 3BQ2A 2J9EA 4B02A 4R5PA 1DQ9A 3CIMA 2NZCA 4KBIA 1S1UA 2NQPA 3DHXA 2W2OP 3MEGA 3HLUA 2ZC3A 4OI1A 2LXFA 1XMBA 1ZBTA 3MEGB 1B7YB 1NK9A 2FHKA 4M5NA 3BN7A 2JH3A 2MPUA 4YHHF 5C42A 1KFDA 2YH0A 4ZCLA 3HKZD 4OJHA 2EFQA 4WP3A 3G96A 1UMJA 4JV2A 2WB4A 1KKHA 3W65A 1RJJA 2OTJS 3KLIA 3CD7A 4G65A 1VC6A 4OZ2A 4LMZA 1ZZNA 3BBFA 3JSYA 4ECRA 4IFYA 4Y2CA 3ITHB 1IBCB 2E9RX 2EC0A 4NMLA 4G1IA 4OZLA 5A8RB 3AQPA 2B9XA 4U6PA 4TU9A 4H4MB 3ZNJ1 3R5JB 3G4SS 1KVJA 1FEHA 1IKVB 2OPSB 1HWJA 1SJRA 3HZGA 1FKPB 4CO1A 5A8WB 1YX2A 2FTRA 1NDKA 4LJMA 3L95X 4IQXA 3C6UB 2I9SA 2DO0A 3CCES 3R6GB 1IQZA 3DU5A 4WFNQ 1BD6A 3IXQA 4QZVB 2BBEA 4ZVSB 5C24A 3I4PA 3MXHP 4QCLA 2R2RA 1WHWA 1XR6A 2K3KA 2MMYA 2ZEJA 1RAJA 1PSDA 3HZEA 3R8YA 4ATNA 2KM8B 1JJ2R 1SQGA 3BBCA 3ZTQA 4N76A 3GWCA 4D3GA 1SB6A 5KFPA 2B9EA 4FVMA 1U6BA 2M9KA 4F0KA 3AH6A 1VRUB 3MF5A 3VGTA 2VB6A 3ET6A 4KO0B 2EG1A 2WVDA 1LK5A 2IRYA 3AY0A 3CCWA 1O0PA 1WD6A 5F3TA 1FFGB 2FJBB 1LWEA 5CXTA 1FFWB 2YWKA 4OIXA 5KG6A 2OMLA 4CT9A 2XSJB 4U9RA 5KOXA 4A8WA 4I2QB 2C42A 1SVDA 2M2BA 4F3MA 4DL5A 1VI7A 3OVAA 1OSDA 4DX6A 4NCGB 1N33F 2K2PA 4C8NA 3CJSA 5SZTA 3UQSA 1X4FA 4KC5A 5DJBA 3SCIE 3I96A 1WUUA 3BGLA 3HSGA 1UTAA 2DNPA 1VQSA 3HSZA 4U95A 2AMCB 3RB0A 4A8QA 3K5NA 2DVIA 3T5JA 3KK3B 1S1VA 2VKRA 4RWWA 2VV5A 2GHPA 4QYRA 5ETPA 4TN2A 5KT5A 2CUYA 2DCLA 4YB6A 2DH8A 2R8KA 3DRRA 1R0AA 2OFHX 3FEYB 1TL3A 1HBUB 2E66A 4TXSA 3UNGC 5LMNF 1VR6A 2NUUG 5T7LB 3HVRA 1GMWD 3Q83A 2W7PA 3CC2S 2DNGA 4U7UD 3MMAA 1DQ8A 1WEXA 3J81Y 3FQKA 1U1PA 5K5MA 3BKTA 3H98A 4ZPDA 5A8KA 1S49A 1TR0A 2LA6A 3ZNUA 3I87A 3R7SB 4DCOB 4C3KA 1NDCA 5AXNA 2IBOA 4GVBB 5EX0A 3V6HA 2KZZA 3VAMA 1N48A 2V8DA 2C3PA 2N7CA 4RW6B 3KNAA 2HIYA 4ZCIA 1HBNB 5FDLB 1NPRA 3UO0A 3TZXA 1RT5B 1Q0NA 3PRBA 4CO0A 1LOUA 3QT8A 3EJMA 2QMXA 2HZAA 2XHCA 1DTQB 4V1Ak 1PKUA 4DR5J 1K1QA 1MG7A 2YKOA 3A13A 4DLEA 4YB5A 3N0VA 3CCMS 2XSFA 2VBWA 3QWUA 2FD2A 5HQLA 1QVFR 1VRQC 1FHTA 1TUGB 4B9NA 2MQPA 2F9JA 4ELVA 1H7XA 5LJ3Y 3W5XA 3BGOP 2X3DA 2E44A 3BSNA 2CNOB 2MQMA 3LPYA 5GAHI 2B8PA 2C28A 1N5YB 1KEKA 4C98A 4AYBD 4DF4A 2RRBA 4OZ1A 2UU9F 1OQ6A 1FJCA 3TA0A 4YMEA 4FF1A 1YI2S 2RQMA 1R8BA 4M5HA 2ZBPA 3UI3A 5AE2A 2OKQA 2YWFA 5C2CA 4CLFA 5C2GA 4JB8B 3WIUA 2DNRA 4Q5VA 2HWIA 1SC3B 6AT1B
chains in the Genus database with same CATH topology
2HGNA 1S1WA 5D3GA 3UCGA 2RDIA 4C11B 3GQCA 4ED0A 4DBQA 4J9SA 2BVZA 4DR7F 1AXQA 3MUMP 3AHPA 2R7QA 3UDCA 7FDRA 4C8KA 1DTTB 5KOWA 3X1LB 3MMBA 3C3LA 5K8OA 2AYEA 4NPOA 4DV7F 1TFYA 3K5LA 1UL3A 4DHVA 5IQQA 2RQCA 4DSKA 2MZTA 3MM5A 5LJ5Y 3PJWA 2FJAB 3BJYA 2PIIA 3RW7A 3M2RB 2HS4A 2F1FA 1J5OB 4F02A 5KT4A 3MEEB 4PRFA 1S1UB 2HFOA 5E0OA 4C4WA 1P9QC 2VASA 1ZAWA 4X64F 3CCRS 4AL6A 3RBEA 1MMNA 3DLLQ 3QAUA 5J2PB 2JJ4D 4K0KF 2VPWB 1YRXA 2HVIA 1VQLS 6FD1A 4ZCKA 3OJUA 3MM6B 4ED3A 2C2RA 4IQMA 1JJHA 2DGVA 3AQOA 4H4OB 1NHUA 2HNDB 2PA3A 1C4CA 3M6WA 1YI2S 3D28A 3UDLA 2KT3A 3DLHA 4HEA9 4A46A 2DNKA 4XPCA 4X4VA 3I31A 1IJEB 1WTFA 3LANA 2OD6A 4NRTA 4DF8A 4ELTA 2DR5A 4EBDA 4DSIA 4QIGA 4X4QA 4X4PA 4KJIA 3W2VA 2BQRA 2ZH4A 2ILYA 1UVKA 4CQ1A 1C1BB 4P2SA 3TQ1A 3T19A 1FK9B 4M95A 1P1TA 4EO8A 3FVYA 3B78A 3LUYA 5KG7A 3MHYA 4R0EA 2HRYA 2W7AA 1UWBB 2OIHA 1HPZA 2CJ9A 1XEZA 3MM9B 2B43A 4NWBA 1VRUA 2J9DA 2RMLA 2BQUA 3HVAA 2E1CA 3DM2A 1SQEA 4F25A 2KRRA 1GT8A 2IVYA 1WEYA 3Q8RB 2FJVA 1K1SA 3H40A 4MYTA 4N8NA 5GAGI 4C8YA 1FEEA 1S4FA 3QZ8A 4IRKA 2HFNA 3N9UC 2V4QA 5D4OA 2D9PA 3IGNA 4AFFA 2D74B 1RT6A 4PR6A 2LDIA 3G86A 3PACA 1HBMA 1N6QB 2CPIA 4IG0B 3TA1A 1VMBA 4Q2LA 3RW6A 1TKZA 1JLCA 4IDKB 3HHLB 2KJVA 3PX4A 4JOUA 2XMUA 4GC7A 4KTQA 3VQTA 2MQNA 4PXEA 3DOLB 2GJ2A 1WTBA 1S7HA 4ICLB 1IM4A 3K5OA 3R27A 4ZVFA 2R9LA 1UFLA 2HFZA 7FD1A 2ZD1B 5DGAA 2XC9A 3L09A 1WG5A 4J37A 4LT6A 3J7A1 2YH1A 3DHWC 1U6ZA 1ZTTA 5DM7Q 4DQRA 2F7VA 2FUG9 4K4VA 1S99A 4F67A 4QPTA 1FDDA 1LW0A 2LYVA 4WXOA 4ITSA 1KQGB 4GC6A 1F5BA 3KKFA 3TUJC 1JLGA 4F2SA 1S77D 2J9CA 1WF2A 1BLUA 3AB4B 4DFJA 1F0XA 5A6WA 3OQ2A 2HW3A 4FN5A 1JLBA 2DBBA 1HI1A 2VD3A 4I2PB 3MMBB 4KGMA 3K57A 4I1TA 2J6SA 4B3RF 4K4WA 4PG7A 3KK2B 2PT0A 3TAQA 2DNYA 2J8AA 5KG0A 1YQHA 2E1AA 4B9MA 3NGKA 2XNQA 4OL8A 2AX0A 4FXVA 5KFWA 4USHA 5I3PA 3SYZA 5DDOC 1VIXA 3UCUP 2VQFF 1R43A 5GMKa