1VQ4S

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq4S00
5BJRA 2CQBA 1WG1A 2J8AA 2J76E 4QQBA 2MGZA 1N8RT 3PIOQ 3L3CA 3S7RA 3VAKA 2KVIA 2E5JA 5MLCV 4YB1P 1M1KT 3MOJB 5IFMA 2CQGA 4W90B 2QEXS 2MKCA 1K73T 1H6KX 2CPDA 2F3JA 2CQ3A 4ERDA 2MY8A 2MZTA 1OIAA 1X4EA 5HL7Q 4ZKAA 2D3OR 3Q2SC 3UCUP 2SXLA 1M90T 2YKAA 1SJQA 1KC8T 2M52A 1X5SA 1WHVA 3P49B 4QU7A 1UFWA 2DGUA 2I2YA 1FJCA 2ZJQQ 3UCZP 1YITS 2CQ4A 1WG4A 2CPEA 2MHNA 4IO9Q 2Q79A 3CCUS 3CCQS 3IRWP 5GAEU 2F9JA 3CMES 3G71S 4F02A 1WI8A 2DHAA 2MYFA 4IOAQ 2RRBA 3K0JA 1WHWA 2DNNA 2E5GA 2YWKA 2OSRA 3RW7A 3DXBA 4Y0FA 2MKSA 3VALA 1URNA 2DH8A 2RNEA 3CC2S 2K8GA 1X0FA 1KQSR 1JJ4A 2FHOB 3CCES 1FT8A 2U2FA 2MPUA 3MUVP 2M70A 2N82B 2GO9A 4EGLA 3VAIA 2BOPA 1VQNS 3EX7B 1WEZA 1X4GA 4CIOA 1OPIA 3ZZZA 3N9UC 4QU6A 1XN9A 2MSSA 1VC0A 1DRZA 1WELA 2LCWA 1HL6A 4OZ1A 2ZJRQ 2VOPA 1NU4A 2KG0A 2LYVA 1KOOA 1S72S 5JVGQ 4UY8T 1QVFR 2MQPA 1U2FA 1P1TA 2E5IA 4CQ1A 2MJUA 2OIHA 1HD0A 2ERRA 1FNXH 2J0SD 4WKRA 3ZZYA 3CCMS 2DGQA 2G1DA 2HVZA 3CF5Q 2KYXA 3FEYB 3BS9A 2DH9A 2UP1A 2KI2A 3S01A 3G6ES 1YWXA 2MZ1A 5JVHQ 4PR6A 3BEGB 2MGZB 1H2UX 4J5OA 2QFJA 3ULHA 2DNGA 2OSQA 1OWXA 2VOOA 2LA4A 4CH1A 3MUTP 1D9AA 2L41A 2DGWA 1U1QA 3CD6S 1HD1A 1HA1A 1X4CA 3EGZA 2FY1A 3MXHP 2MY7A 3P3DA 3G96A 4ED5A 1Q82T 1WF2A 2BZ2A 2AD9A 4OZ0A 5DDQC 2MSTA 4FXWA 3P6YC 2M88A 1VQ5S 4LIRA 2DITA 3OW2R 4LMZA 2KXNB 2F9DA 2LMIA 5FJ4A 4TLQA 5DETA 5HO4A 1WTBA 2MKKA 3UE2A 2M7SA 5GMKa 2FC9A 3VAMA 2QA4S 2M2BA 3BO3A 4C4WA 2M8DB 2CPFA 2XS5A 3S6EA 2EVZA 3US5A 3NNHA 2CQHA 3CUNA 2RT3A 2CQCA 1A7GE 2AYMA 5GAGU 2MQMA 1WF1A 2DGVA 2DNYA 1SJRA 4W92B 1K9MT 1VC5A 1DZ5A 3UWTA 2MKIA 3V4MA 5CA5A 2KXFA 1FJEB 1YJWS 1R8PA 2KXHA 3CC7S 2M8HA 2WBRA 2MMYA 5LJ3Y 5LSLA 1YI2S 1RKJA 2KFYA 2HYIB 1U1RA 1VQ9S 1DBDA 2DO4A 3D2WA 2GHPA 1YJNS 1U1KA 2MKHA 3CCLS 2CPHA 4U67Q 4TU8A 3MDFA 4TU9A 4PRFA 1QM9A 3SDEA 3R1HA 2CQ2A 3CMAS 2ADCA 2OTJS 5H1SV 2DGTA 5CXTA 2LKZA 4RU2A 1FO1A 2DH7A 1X5TA 2DNQA 3JB9k 1JJ2R 2JVOA 3H2UB 5GAHU 1UW4A 3UCGA 3CC4S 1VQOS 1W2BR 2V94A 2A3JA 2DNOA 2KU7A 2LEAA 5LSOA 4YOEA 1PGZA 1B7FA 2DIVA 2LECA 2KHCA 2PE8A 4Z2XA 1U1LA 4QPTA 1M5VC 5ITHA 2KM8C 2KM8B 2RVJA 2L08A 1OO0B 2RQCA 5LXYA 2RRAA 4F26A 4WFAQ 1JMTA 2D9PA 3CULA 1VBXA 4WFBQ 1SJ4P 2HGNA 2DHSA 2MQQA 2D9OA 1M5OC 4WF9Q 2XS2A 3VAFA 1FXLA 3VF0B 2KN4A 2CPYA 2RS8A 3CTRA 1N52B 2DNZA 1NO8A 2FPHX 3MUMP 2DHGA 2HZCA 1VBZA 2LA6A 2YH1A 2CPJA 1SXLA 2JVRA 3MD1A 2JX2A 3SMZA 5IM0B 1R8HA 1X4AA 1WEYA 3S8SA 4C7QA 1X4DA 4F25A 1WWHA 3NNCA 2LXUA 2ZJPQ 3G9CA 1U6BA 2MZQA 1JJHA 2NZ4A 1WI6A 2RQ4A 2EK6A 2DNMA 5DDPC 4P6QA 2XNQA 4UQTA 2DNHA 1ZZNA 1X5PA 4TU7A 3CCJS 4IUFA 1YTYA 1U1OA 1DHMA 2E5HA 1X4FA 5IM0A 1YHQS 5LXRA 2DGXA 2HGLA 1K8AT 3UD3P 2MZJA 2CJKA 3VAHA 3P5TL 3MURP 3MI7X 1WG5A 1U1PA 1M5KC 3UD4P 4PKDB 2DB1A 2XSFA 1VQLS 2XNRA 3NNAA 1VBYA 3R1LA 1SJFA 2VODA 3B4MA 1U6FA 5CYJA 1UAWA 2DHXA 1WHYA 3SDEB 3J7ZT 2KH9A 2M9KA 1P27B 1WEXA 1A9NB 2DISA 2MZRA 5GVQA 3TO8A 4WIIA 5DDRC 3NS6A 5D77A 2XS7A 2DNPA 2LEBA 1NJIT 1D8ZA 1O0PA 1WF0A 2X1FA 2B0GA 2N3OA 2KT5A 3B4DA 4A8XA 5LJ5Y 3LPYA 5IQQA 2KRBA 4M5DB 1Q81T 1Q86T 1X4BA 2MJNA 2MXYA 3VAGA 1U1NA 2CQ0A 2YH0A 2DNRA 2DGSA 3BO2A 2I38A 2CQIA 2CQ1A 3RW6A 2E44A 2M4MA 1H2VZ 1N54B 2O3DA 2MQLA 5EN1A 1H2TZ 2JWNA 5D78A 2KG1A 1BY9A 1YIJS 2DO0A 1VQ7S 3Q2TC 1U1MA 1F9FA 1WHXA 1ZH5A 4LJMA 2MQOA 1SJ3P 2N3LA 2DK2A 2U1AA 3CCVS 1ZZFA 3FEXB 4IOCQ 1G2EA 2X1AA 2L9WA 3BO4A 1VQ6S 1IQTA 1VQ4S 2PEHA 3IWNC 2YTCA 2DNKA 2VONA 2FC8A 3U1MA 2LXIA 2MZSA 1X4HA 4V19X 1CVJA 2LQ5A 2AYGA 2MB0B 4C0OC 3CPWR 1VQ8S 5DM7Q 2DGOA 2OTLS 3G8TA 5DM6Q 1UP1A 1YJ9S 2OJ3A 3THPA 1S79A 3CXCR 1KD1T 3NMRA 3LQVA 1FHTA 1KOHA 2G0CA 2K3KA 3PIPQ 2ADBA 1L3KA 2RU3A 3G8SA 3I55S 3TYTA 4YUDA 3VAJA 2CPZA 2AYBA 2N7CA 2NLWA 4Y00A 1VQPS 2X1BA 1RK8A 2EK1A 3CCSS 4WFNQ 1VQMS 4FXVA 3J7YU 4CH0S 2DNLA 2MKJA 1FJ7A 3DLLQ 2XB2D 1PO6A 3HI9A 1X5OA 2KRRA 3HHNB 1QVGR 2CQPA 2HGMA 3H2VE 2X1GA 2CPXA 2G4BA 5DDOC 4WCEQ 3I56S 3MD3A 3U1LA 3G4SS 2AYEA 2CQDA 4BS2A 1VC6A 3R27A 3CCRS 1Q7YT 5GADU 1VQKS 3NS5A 2DIUA 2M0GB 2J0QD 2JRSA 3THTA 1M5PC 3EGNA 2MQNA 1N88A 3TP2A 2RS2A 2CPIA 2RUGA 3SXLA 1AUDA
chains in the Genus database with same CATH superfamily
4B3SJ 4UZBA 2CQBA 1SUQA 4QQBA 2X51A 1J5OA 3ZTQA 1RWOB 4UTGA 4G1QB 2QEXS 2MKCA 1OY9A 1WC1A 2CQ3A 1ZBTA 2DY1A 2MZTA 2W9BA 1N0UA 3PRDA 2C2RA 1X5SA 4R5PA 2ZBRA 4OYOA 2MLXA 1HKAA 1Q53A 4NPOA 3AB2B 2GIFA 5D4LA 1WHWA 4OV1A 1C1BA 1NZAA 1RWXB 2DH8A 4JOUA 4QYRA 2R42A 1UJ4A 4DV1F 4WYLA 2U2FA 3VAIA 5I3QA 3ZZZA 1YK9A 1VQYA 3M8WA 1WELA 1DRZA 2W01A 4DN0A 2B6AB 4OZ1A 3OLBA 2V4JB 4R0JA 5DLFA 4O0IA 1S72S 1QVFR 3TANA 2R7RA 3IWXA 5KG2A 2VIHA 2QYGA 1ULRA 3DLJA 3H59A 2QN6B 5HBMA 5F41A 1YJTA 4PR6A 3N79A 3MMBA 4N56A 2AW0A 2D7SA 2W2QP 1WOSA 3KXDA 2VOOA 1HMVB 4DMZA 4JI2J 3CJTA 2YNHA 1UZHA 2V8GA 1GMWD 1XR5A 3H4BA 4LMZA 2UXBJ 5DETA 2IRUA 3CT9A 5HO4A 2W2PP 1Q0NA 1TFWA 3SCKE 2C3MA 1U2CA 4OYBA 3KMSA 3ENWA 3RR7A 2DNYA 1K9MT 4F0MA 4CLPA 4LFAJ 4JI3J 1EETB 3GJTB 4JI1J 2MMYA 2P6SA 1PG5B 1S59A 1WDDA 2W2NP 2B9YA 4CRJA 4ZOSA 4GC6A 3I0SA 2DO4A 1VQSA 2EBEA 4FS1A 1HWKA 1MMDA 2GC8A 4U67Q 3L7UA 5E3AA 4X65J 1F5CA 2UUWA 3DGVA 2UXCF 5E2QA 3DFEA 5AE3A 4I69A 3D68A 2F40A 1DY3A 4YB7A 1IN0A 2EBGA 2BJEA 3PZPA 2HHQA 3HLUA 4OHVA 4RZRA 2ZDOA 3K58A 3JYTA 4EI2A 3M8YA 2L08A 1S4FA 4YDXA 4F26A 2QYCA 1RWUA 2LDYA 2HZCA 3T3FA 2JL9A 1LWEA 3SMZA 5HI7A 2DRBA 9RUBA 4J9NA 1X4AA 3DDIA 4KHPJ 2B9XA 3KUGA 3QGGA 4B3MJ 4NXMF 2VFSA 4P6QA 2XNQA 1FRKA 2QO3A 1PIEA 4Q45A 1U8WA 2W25A 1X4FA 4DV3J 1CBKA 5IM0A 3O3LA 3GCXP 3MI7X 4MIAA 4O44A 2AIRB 2XNRA 3NNAA 1UWAA 1W25A 3MPVA 1WHYA 3BH7B 1RAHB 1FX4A 5CCMA 2F7VA 1YQHA 2FB0A 4NRUA 3M8RA 1U49A 3L09A 1JKHB 7FD1A 4K4UA 1F0XA 4A8XA 4IDKB 4KYZA 1PYTA 4MAKA 1Q86T 3D54A 3PX4A 1JWWA 3MTJA 2C3YA 2FLOA 3C16A 4I68A 1H2VZ 2D3O1 1O5JA 1IKYA 2FGOA 3PYEA 1I3OB 4NCBA 4J91A 2EFOA 4LJMA 3DYAA 4KAIA 2HRYA 3FEXB 3KOAA 1XR6A 2L9WA 3SV3A 2W8LA 4ZVUB 1CJUA 3PV8A 3GMGA 4YDDB 2FJWA 1X8DA 1NLKL 4KFBB 1FWPA 3R7NB 4DV0J 3M8ZA 2EG2A 2P6TA 1S79A 3FFIA 1JXEA 2AP6A 2G0CA 5DG9A 3R3TA 4FNIA 2C1EB 5I3UB 1YG0A 4IFYB 2VKZG 2X1BA 4A47A 2F8MA 3ITHB 4MT1A 2BJ9A 4JB8B 3LP2A 4KGVB 3BREA 3MEKA 4PPZA 2CQPA 1FDNA 4NOHA 1TL7A 3NS7B 2IM0A 4DV2F 3DOKA 4CT8A 2XLIA 3CCRS 3G82A 5GADU 4Y2MA 2IIHA 2LQJA 1RWWB 1PYOB 1R43A 3THVA 3CCWA 3OT9A 5BJRA 1N8RT 1HPZA 3N6MA 1FFGB 1M1KT 1SJ1A 4LF6J 4RX6A 2YKNA 4NZ0A 1NAQA 1S4EA 2I8EA 4WYWA 1ZTTA 2XSJB 2J0WA 3FBFA 2JLFA 1DLOA 4A8FA 5RUBA 3M9NB 3IGNA 1JLEB 4IG0A 3EUNA 4A4JA 3R7SB 3GJRB 3HVTA 3VTIA 4HACB 3VALA 2DR8A 1XK8A 2RNEA 3CDUA 1DJ0A 3DRPA 3GSIA 1FK9B 1VBKA 4L74A 1V3RA 1AZSA 3KUEA 1VQNS 4CIOA 4D3GA 1BMQB 2IAJB 3H5XA 4DV4F 1KLNA 4DL0C 3M32B 4DL5A 1NU4A 3QT7A 5IZHA 4LF5F 1NB7A 2V5HG 3KG0A 1B0PA 2FJVA 4MFBB 2RE1A 2LVWA 5GADI 1RDRA 1TVRB 1RAGB 2JEFA 5J1EA 1UA1A 3DGPA 1DTTA 4ALZA 1HI8A 2LQ8A 2XM3A 4NA1A 2PA8D 3TZXA 1GTHA 5CZXA 4CH1A 2E1RA 3EXYA 3QQCD 4ZPWR 1HA1A 1T0TV 2FY1A 3P3DA 1SC3B 3DLGB 1WACA 2W4DA 4LIRA 3W5XA 2ZC3A 2LMIA 2WVCA 3IM9A 2JDJA 3VAMA 1M5SA 2M8DB 1X9SA 1TK8A 2CQHA 1IJFB 1RBLA 2ZBQA 3C46A 3QAEA 3DDNA 3FZ2A 4ECWA 3HZEA 2VV5A 3DXSX 2WZ1A 4DR6F 1V9OA 2HS3A 5H9FK 1FJEB 4O3SA 4GVBB 3R2DJ 2XLKA 2HVEA 1U25A 1MMLA 2DKOB 2QMWA 1R6YA 1PC4A 2NXUA 3W3SA 2HHTA 2P9GA 5H9EK 3TEHB 4KHMA 3UR3C 2M5YA 2Z2YB 3CJ5A 4YP3A 2Q1LA 5E41A 4ZHRB 4M95A 3BGRB 2OGUA 3MZIA 4ER8A 5MAOA 5K8NA 2LEPA 3DDKA 5H9FJ 3VVUA 4LF8J 2XMUA 4DFKA 1TV6A 4DR3F 2AJ2A 5AXMA 1IR1A 2QV6A 3MR2A 1FXLA 2HBQB 4EFAC 1NEEA 3BYPA 2WVBA 3KWMA 2JX2A 3D0IE 2XI3A 1VOMA 2GW8A 2QLBB 5H9EJ 2CDQA 1O8BA 3NGKA 3IR7B 1SI9A 5KFDA 3AOAA 3MMCA 1WI6A 1TK0A 2BKNA 1YJUA 4TU7A 2DEJA 4KPYA 1OMSA 1DHMA 5BYRA 2ZZMA 3ZTOA 2UXDJ 2XSFA 1HBMB 3DRRB 1EJ7L 1GQEA 3BM7A 3FSIA 4FYXB 3MCNA 4DR1J 1UEUA 1N5YA 2R7UA 2YNGB 1WF0A 3QLHA 3QIPB 2KRBA 4LIWA 1LV5A 2DGSA 2YQ0A 2RAQA 3RW6A 5KOXA 3W8GA 1OY8A 1FF2A 1VCTA 2M3DA 2KG1A 3KLHB 1GH8A 2VFVA 2QSFA 1N34J 1FA0A 4Q8EA 4Y2KA 2U1AA 3T9ZA 4KKOA 3Q8PB 3DU6A 3BPDA 4MK8A 4OJ3A 3OR1A 4LQ9A 1SIWB 3JQKA 3IBCB 2CJQA 1Q7LB 4OI2A 4M1KA 3D0GE 1LW2A 2RDJA 2X3GA 3CJQA 1L3KA 1HNIA 5HROA 4P52A 1T9XA 3RAMA 2J5AA 1R27B 1R0CB 3ETMA 1VQPS 2EK1A 4FPIA 2GO8A 3EVMA 3EICA 4DCPB 4FXVA 3PW2A 3HHNB 2HGMA 3ET6A 3KK2B 4NCAA 1HHQA 2CPXA 3MAAB 3H7HB 4LT6A 4JI6J 3IWLA 2Y1LB 5K5MA 1VQKS 4P10A 3R5BA 2PMWA 1LXNA 5LXYA 1KDNA 2AJ1A 3OPKA 2QL9B 2KVIA 2CQGA 2W4CA 4Y34A 4RW4A 2ZUGA 4CT9A 1HQEA 2KZZA 4WP8A 2XO6A 1XMBA 2AWZA 2OEJA 2E1CA 3CCUS 3CMES 4G1QA 4F7VA 4IOAQ 2ZBIA 3MM6A 5LOQA 2AGPA 1UVNA 4ZITA 3E3XA 2HHHF 5F0WA 3AHPA 5U47A 1WOOA 1JJ4A 3CJKB 3CCES 3W9IA 3DI6B 4B9TA 3QSYB 4J9UE 4BC9A 5FLXU 3C3LA 4ZPAA 5J2MB 1RHJB 1FXDA 1FRIA 1VC0A 3AD8C 3SQOP 1XNQJ 2ZM6J 2Q3PA 4UY8T 2E5IA 4Q44A 5CYMB 3FZBA 2J0SD 2B43A 4KH0B 2CWXA 1M1HA 1NK7A 3H8YA 4A46A 5DQHA 1YWXA 2B6AA 4USTA 1H7WA 1MLAA 2YWHA 1YSJA 3J7A1 5D0GA 4M5KA 2CNNB 3IAS9 4FF2A 4LR9A 3LWMA 5E3QA 1S1VB 5J2PB 2BZ2A 5F3ZA 2ZNYA 1VQ5S 3UDCA 1C4CA 2YWFA 2VH7A 8AT1B 2YKPA 3I4PA 2XS5A 3T5JA 3PG9A 4RNNA 3H25A 2AYMA 2HQDA 1UPPA 4AXIA 1DQ9A 1C0TB 3L9ZA 3QWPA 1IKWB 4NLQA 4OL8A 1CULA 4MJKA 1Q5YA 2BM1A 3HFKA 4YMEA 4DWIA 3QWUA 5LJ3Y 2RMLA 5LSLA 1DBDA 4DPUA 4C97A 3DMJB 1F60B 4HHJA 4H4MB 3C14B 1EIYB 4M94A 1X9WA 1GMVA 2CQ2A 1CC7A 2MHEA 5IXUA 1HR0J 3KMQA 4CI0B 3H5SA 1UW4A 3UNGC 2CNOB 5LSOA 1JLBA 1V5IB 2DIVA 4P73A 3ILJA 4JI0J 5ETLA 3RUBL 4ZVEA 2V6AA 2XULA 1R8AA 4DPTA 1D0EA 2Z57B 2VG7B 1VK8A 4WF9Q 2CPYA 2VU5A 4DV1J 2DNZA 2FPHX 3PW7A 2ZH9A 2BABA 1XMQF 1X60A 1KFSA 1NNDA 2HHWA 4NLXA 1FJGF 1UFLA 4I56A 2YKQA 4ILRA 1S7IA 4DSFA 5C42A 2E5HA 4QIEA 5LT5A 1S99A 2IMWP 3C6UB 5T41A 2F4FA 4B3RJ 2M9KA 4ECZA 1NK5A 2R7TA 2X1FA 3D7SB 1YRUA 3RG6A 3TUIC 2ZH1A 1SV5A 2MJNA 1NK0A 2M4MA 3PY8A 3V6HA 1BY9A 3Q24A 3Q2TC 1EQ0A 3JQJA 4C9DA 3CCVS 3W5ZA 1VYAA 3HVAA 1N48A 1GAOA 1CJKB 3V81B 1HNZF 2J7WA 3GYGA 1XERA 3C15B 2LQ5A 4ED4A 2GVDA 2G1HA 2XO7A 4U7UK 2DGOA 1FKOB 2OTLS 3M9MB 2WSFC 5HAOA 4DLEA 3PYFA 1YJ9S 1IXKA 2K3IA 5L1KA 4Q43A 1FHTA 2DR9A 3EJMA 3IAM9 4PG5A 3VAJA 3J81j 3GTYX 3UI3A 3MR7A 3OL9A 1RK8A 4KFBA 4WTOB 5EDWA 2ZHBA 4LF9F 4MMOA 3M6XA 1GNKA 1IR2A 1QVGR 2YPZA 4B9UA 1HQ2A 2VL1A 1RCXB 2CNKB 5A6WA 2Y0SD 5J2QA 4CWBA 2QG9B 2JRSA 2Z2ZA 1S77D 5AT1B 1YRXA 4GVLA 1AUDA 3EPGA 3SCLE 1S1UA 3MGJA 2IVYA 4H54A 4ZP9A 3TNVA 1FKAF 3Q2SC 3UCUP 1M90T 1N5QA 4OJ1A 2KB2A 1Q1KA 1ZA2B 1MWQA 4RW9B 3R5DA 1M1GA 1WG4A 3TUJC 2HLTA 2RHSB 3G71S 2HNZB 4PUOA 1CJVB 2G2ZA 4DZDA 3SZ2A 1V6HA 1RHRB 2XSJA 1EP4B 3GFHA 2Q6BA 3K5NA 4ED2A 2ZWPA 3CCZA 3M30B 3R5JB 4ECSA 3PCOB 1OQ6A 3NGUA 3M2RB 3W2WB 5HLFA 4EGLA 4ZPTR 4JYAF 2CG8A 1RAJA 4P2SA 3WIUA 5D0HA 3BJYA 3M1VA 3OUYA 1NPKA 2YPYA 2KG0A 2XGQA 3ZZ0A 1FK9A 2CADA 3MMJA 5M2UA 2X3DA 2JEGA 4ID8A 2E5LJ 2IAJA 4RW8B 4M63A 1XR7A 4J9KA 2YX7A 4OLOA 2MZ1A 3M32A 2QFJA 4MFBA 1MROA 2BW7A 3D67A 3EGZA 4JI8F 2J6SA 3OQ2A 1V3SA 2FJAB 2IVFB 3W63A 3AAWB 4HHHA 2M2BA 1RBOB 3OFHA 1JX4A 3DLGA 4LSZB 3QPIA 3LGMA 3CD7A 4HH0A 3DNCA 4K2JA 4DL7A 5K8PA 2ZH8A 1YJWS 3CC7S 2LQ9A 1S1TB 3PRBA 2AEJA 1IWAA 5IT4A 2UVWA 4IG3B 1CJTA 1LOUA 3BGOP 3CDBA 2GHPA 1IBLF 2R8GA 1DTQA 3HJVA 5GMDA 2ADCA 2RKIA 4NLWA 3F56A 2QFIA 4GVBA 1VI7A 5GAHU 4GC7A 4ED3A 4N8OA 3WDOA 2ACMA 3PW4A 3CCTA 2V50A 2ZDPA 1HBOA 1VBXA 3BGRA 1F5BA 3M4XA 2ZHAA 1LEOA 3SYZA 3PX6A 3P5BP 1FD2A 1YJ7A 3U27A 2ZOMA 2VBXA 1R31A 4EO8A 4U8YA 1QY7A 1WKKA 4CO2A 4NL5A 2ZJPQ 4U8VA 1U6BA 5F8HA 1R89A 3GILA 2QMXA 4P9SA 4DCJB 2GAHC 2GJ2A 2VJVA 3W9HA 4GKKF 3ETOA 4YY3J 4IUFA 1NBEB 2HVHA 4USUA 4DFMA 1WSVA 4ZN1A 8RUCA 3OL8A 1AFIA 4R8UA 3O6QA 1D9FA 1UAWA 2DHXA 1P27B 2R9LA 1A9NB 3A3NB 5B0BA 2V0NA 2AJ4A 3MPWA 5GAHI 5IV4A 1Y5NB 2BE2B 3K2YA 5D8HB 4CDIA 2FZCB 2DNRA 2XHWA 3E8OA 1NB2A 3H40A 4J9PA 1SVDA 1QAXA 2JWNA 4MK7A 3LP1A 5M2RA 2MEWA 4NLTA 4HEA9 5DLGA 1NJWA 3OD2A 1AW0A 3VGTA 1S6UA 1D1UA 4EZ9A 3B6BA 4DSKA 4F3MA 1O51A 2AEFA 3JS9A 1IKVA 3G8TA 3BV8A 3MM7B 1SIZA 3TOQA 5KG0A 2P2CB 3PJ9A 4S0MA 1U4BA 3PFOA 3SBMA 4CM2A 1RA6A 1FEEA 2VFTA 3HZGA 5B0EA 2XWXA 3DOMA 2C2MB 2ASJA 1I5OB 2C2KB 1KTVA 2JJ4D 2OO4A 3DRSA 4ZN3A 2IFXA 3U1LA 2H9ZA 3BKFA 1GXTA 1Q7YT 1NUEA 2NXEA 1VFJA 6AT1B 2ASYA 4M5MA 4RU9A 4USVA 4FBTA 3BDEA 2MGZA 3K8VA 1HQUA 2YNIB 2OUGA 2WRMA 2H3EB 2QSWA 2XMMA 4OYPA 2CPDA 3GZ7A 2MY8A 4CO3A 4F4ZA 2VQEJ 3K7RA 4YHHJ 4DUYF 4LR8A 1G6BA 1YKWA 3FDSA 4OX9J 2ZJQQ 2UV8A 3EZUA 2CQ4A 3IP0A 4DEZA 1J5EF 4KY3A 2XMAA 1W2IA 2DYAA 2KJWA 5HANA 2ILZA 2RSQA 4ANEA 5KAKA 1E6VB 2DNNA 2HFNA 3WIVA 2MKSA 4HHUA 1Q5VA 1B3TA 1UWBB 3DLKB 3TA1A 1FT8A 3UN2A 1GXLA 4PCQA 1ZTWA 3TUPA 1OYEA 3AOBA 3CDEA 3C6TA 1VRQC 1CG2A 2DR5A 5F9NA 2H1YA 5DQGA 3AD9C 4FVMA 4NXNF 3IA0A 2J9DE 4F50A 1KOOA 1UETA 1P1TA 3VQTA 3DI6A 4NI2B 2IM2A 2V63A 4ED7A 3IBWA 2KYXA 4C48A 2DH9A 5C5JA 3CJRA 2C3PA 5EGYA 1Q8BA 4X4RA 1E6YB 4JV5J 5E7OB 4JV1A 2DEIA 1NZ8A 1D9AA 3CD6S 5K8MA 2ZBCA 2KXNB 2Y3YA 2B5JB 2MKKA 1QE1A 4XDCA 1N32F 1S9EB 1B0TA 1RTHB 3A8EA 1OY6A 4RW7B 1QSYA 3B78A 1K47A 2VJUA 2PEBA 3CSKA 2G9OA 3HFVA 1S1VA 2B4VA 5GAGU 4MYTA 5C25B 1SKRA 3D1HA 4USIA 3KK1B 4DQPA 1R8PA 1RA7A 5KFJA 2M8HA 1YI2S 5I4MA 2N4CA 3G86A 4BC7A 1Y7PA 4XTTA 5J1NA 1IKWA 3AJDA 2W9CB 4KIAA 4ETXA 2OTJS 4BWJA 3N01A 4KB7A 3FRYA 4DR4F 2HK2A 4LREA 2ALYB 2DH7A 4FBUA 4RR5A 2HVIA 3W62A 3VGSA 1OYDA 3DMJA 4N7TA 4H4MA 3C14A 3KNGA 2VG5B 3DOLB 3ENQA 3EM1A 2H5JB 4QPTA 3KUHA 4LR7A 2A6OA 4DN9A 2ZZNA 4IRKA 4DUZF 3EXCX 2VKRA 1T02A 2JFDA 5B09A 2D9PA 2GJFA 2HGNA 4UT4A 1UEVA 4AUKA 2MQQA 3VQSA 2A10A 3TUZC 5AJ3F 1UPMB 4DV7J 4DFPA 2DHGA 3CWJA 3PACA 3MEEB 4QZVB 4RBUA 5F9LA 5GAGI 1DARA 2UZAA 3D66A 2CWKA 2LXUA 2BRLA 3UPFA 3MEDB 2GAGC 4DDFA 5DDPC 4WP9A 5D0EA 1ZZNA 4LFBF 4V1Ak 4C11A 1S1XB 4R25A 2MZJA 1RACB 4OX6A 1MSWD 4QWBA 4C98A 1AA1B 1HW8A 3KJFB 4A8WA 1ZM2A 3EPIA 3LOUA 1PBAA 2GVZA 1ZOTA 1WEXA 1XC9A 3TO8A 1KQGB 2Y1JA 2G2YA 3UDVA 1O0PA 2XMTA 1HNWJ 3T1AA 1KSPA 3C6UA 1R0AB 2VD3A 3GPAA 2QRRA 4G1IA 2RB7A 5EN1A 4IH5A 2IA6A 2IDEA 4F67A 2CJ9A 1QAYA 1X7VA 1CC8A 3NCRA 1V3ZA 3UD5A 2H4YB 9ATCB 4PXBA 2XCPA 3FVYA 1B4SA 4WPAA 2H54B 5KFSA 3NL0A 2CA9A 4IRCA 5A2QU 2EKYA 4NMXA 4J90A 3FKBA 1BLUA 1RT3B 4E2FB 3TRGA 2BYCA 5JJBA 3DN9A 3FNNA 1A6LA 5T14A 2OPSB 3QO9B 2FLPA 5ETSA 5ETVA 1W26A 5CYQB 2ZD1B 1N5SA 1RT6B 3C15A 3B8HA 3CCSS 4A48A 1FKOA 4KJIA 3DLLQ 4RUHA 1PO6A 2MKYA 5J2NA 3LTOA 4P74A 3ZTSA 2CQDA 3NMAA 4IR9A 4EK2A 2FD2A 2XYPB 2WCXA 3UN3A 4DU7A 3SXLA 3HD2A 4TY9A 3KLIB 3KLFB 1RADB 4QIGA 2DPIA 1XMQJ 4F4WA 2B3TB 2OD6A 4O3PA 3HM9A 3KTQA 1RU1A 2MHNA 2HHUA 4JV2A 1JB0C 5KFOA 4TYBA 4NLDA 3K0JA 5FDLB 4DV6J 4N8NA 3MHYA 5ETKA 4X4PA 2B8QA 4RW9A 2K8GA 2H48B 4O0NA 4WP3A 2K2PA 1NH7A 3MCSA 4ZCIA 1HWLA 4F2RA 2IBKA 2EXUA 3M7VA 3FUYA 1OPIA 4ZIWA 1P1LA 4X64J 2ZJRQ 3GQCA 4QIFA 5IOLA 3OFGA 3PM9A 2NPFA 3W2WA 2MQPA 4CQ1A 2UUBF 3MEGB 3MM8B 2ZH4A 2B9WA 4LRDA 3TQEA 2VASA 4OI3A 1RTDB 3S01A 1BQXA 4NCGB 4NYPA 2HG4A 4KGXB 2UU9F 2CNLB 1YDLA 1WTFA 3OV7A 2LP4A 5LSRA 4QR0A 4L72B 3IN5A 1IBMF 3NGDA 2DGWA 3OHBA 1WD6A 3IRXB 1YRTA 2HK3A 4ZJQA 3EWGA 2GA7A 3LAMA 4A8QA 2IA0A 1HNVB 1HHSA 4C3MA 3H0PA 4ILMA 3Q8SB 2HNYB 2FC9A 3Q83A 2YKOA 4CCHA 1FNMA 2ZUAA 3CGIA 1LWFB 4OZ3A 3NY0A 4JI4J 3FRZA 4USJC 3QMQA 2DR7A 2I6WA 2DGVA 3KLGB 1SH0A 1U24A 4YB5A 4KGZB 2XMVA 2OMLA 5ETMA 4ZVGA 4L73A 1VLYA 1SPBP 2BE9B 4RWXA 4FF4A 1NDPA 1PCAA 3JAMU 2BJ3A 4DV5F 3LA0A 4DFJA 2DGTA 4K2XA 4RWWA 1X5TA 4AT1B 2GMHA 3DRXA 4IG3A 4XDDA 4DUTA 1R6VA 3HO1A 4QJVA 2ILYA 2OEKA 4TXSA 4ECXA 4DG1A 4USMA 4PG6A 3S1TA 1JLFA 4ZPBA 4DPOA 4XIUA 2F4VJ 2RQCA 5DS7A 2QIFA 2L9DA 1JMTA 1BHNA 1HNXJ 2C2NA 2OPRB 4WFYA 4BHQA 4PQUA 3JSMB 2WAQD 2DY9A 2IJNA 4PYDA 4DZ6A 5C2GA 4FYVB 3O1LA 4AL5A 3Q22A 5LMUJ 1JJHA 3CD0A 5A8KA 5CH7B 2XQCA 5HQMA 3CCJS 1Y5LB 3TAMB 2YNFA 4LF4J 2FZKB 4DXLA 1YHQS 5LXRA 2K1RB 1RQ0A 4DR2J 1QJHA 3QGPA 1TKTB 4ZVTB 2DB1A 2J9DA 4G1PA 4HLBA 1JJCB 2IJRA 3SDEB 1CS4B 1HWJA 2XY6A 2DD8S 4ID5B 3W64A 3ZFVA 4CYUB 3QNWB 2E29A 1HWIA 2UUCF 2KT5A 1VRTB 3B4DA 1JLGB 4M5DB 2E44A 4KHRA 3GU0A 2OELA 1KRPA 5K8OA 1B99A 3N6NA 1TK5A 1C1CB 3NGTA 5IT9U 2RQMA 2DK2A 2K06A 2IRYA 3LF0A 2JC1A 1VQ4S 4LSNB 2RRNA 3AODA 2PMZD 1SKWA 2D41A 5KT7A 2V2VA 2R7OA 4ECQA 2AYGA 3R8YA 1YZ6A 1IBLJ 2JHEA 3LQVA 2OMOA 1BQNB 1HLWA 5F3TA 4DQSA 1AT1B 5HVGA 2FJEB 4WU2A 4GO5X 4HTJA 1TUGB 2DNLA 4TY8B 3MM7A 4DPYA 1Q95G 3H2VE 4O23A 3WQPA 4UQGA 2VPZB 4HL9A 3M2UB 2AJFE 5M2PA 2GHWA 1QLNA 1VC6A 4EYHB 2YY3A 5LMNF 4PXEA 1NSPA 3EDRB 3B82A 1IBCB 3LPEA 4HR2A 1REVB 3SQGB 1P6TA 3AJ1A 3OSNA 4WBFA 2AJQA 4YEAA 1XMOJ 5D4NA 3K5PA 2BDPA 3R5CA 1OIAA 1BD6A 1WHVA 1FTCA 3CVKA 2DGUA 2I2YA 3QT8A 2CPEA 1G4CA 2JLEA 4IO9Q 4F4YA 4I2PB 3IRWP 3BZQA 3HT0A 1Y5IB 4B17A 1RTIB 3GIRA 1L3UA 2IBOA 3SFUA 1T03B 1K1SA 2FJDB 1S7HA 3FQKA 2AT1B 3AD7C 3TJ8A 3ADAC 3DLEB 4K50A 2UUAF 3PEJA 4NZ6A 1VR6A 1ZM3A 2GO9A 2HHPA 5E3PA 4PABA 5KG5A 2MTLA 2PN6A 3N9UC 2MSSA 2PI5A 1TKXB 1FE4A 2BRKA 3D28A 3NGSA 4RBVA 2KYZA 3BQ1A 2GX8A 4DHVA 4RUCA 3OLAA 5EWFA 5HJYA 4YQWA 2BJDA 4NA2A 1OWXA 5A8WB 4KO0B 3ZZOA 4EO6A 4PG4A 5FIIA 1WSRA 3SV4A 2MY7A 1Q82T 5DGBA 2HZVA 4G6VB 4OFZA 5KT5A 3QSIA 2M7SA 5ETQA 1FRMA 1I94F 3LUYA 2BV3A 5FD1A 2QLWA 3NNHA 4A8KA 1A7GE 2AZ3A 4UOCA 3P96A 3KJVA 3OXGA 4WE1B 5D4OA 3HHEA 2J9EA 1VGYA 5CZVA 3UWTA 1HBUB 3V4MA 3PYGA 2C2EA 2KXFA 4U9RA 3R2CJ 2KXHA 1IBKF 4DX8H 3IMQJ 3KYLA 3BGFA 3D6TB 1RAEB 3IM8A 4AXJA 1LFPA 2CJBA 1TR0A 1T9UA 4LF1A 5CD4A 3KK1A 4OLPA 4RU2A 4B9NA 4N77A 3FK4A 3CIZA 1WOPA 1JJ2R 4KV8A 1KHWA 2V94A 2HFOA 2HHXA 2KU7A 2W9CA 3D6HB 4CLFA 1YJVA 4AQYF 4Z2XA 2H4WB 2VUGA 1U1LA 3SCIE 3H5YA 1DAXA 6FD1A 1HI0P 2HHVA 2C2OB 1LQ9A 4ZDNA 2VFUA 5KTQA 1NHUA 3QZ8A 5ETNA 3MWBA 1LW0A 2VF3A 4DPWA 3TW0A 3G87A 1RT5B 2XS2A 2ZKTA 1L3VA 1NO8A 3TA0A 3M8QA 4DQRA 3GP9A 4H4OB 1WC6A 3IS9A 3TJAA 1S0OA 3F44A 3BQ2A 5E0OA 4MH8A 4NXNJ 3BSCA 2CFXA 2MLZA 4F2SA 5G0RB 4ICLB 2XY5A 2KFZA 2CDRB 3CNQP 4I6AA 3UDLA 4DSIA 3GLJA 2FVSA 1ZETA 3MEEA 2XGPA 3UD3P 4PG7A 2HBRB 4J9OA 4C8MA 3RBZA 1VHIA 1WG5A 4IOBA 4K4WA 3O2IA 1RT1B 3ZZRA 5KG7A 3MECA 2KH9A 1NK8A 1PC5A 4KC5A 2L48A 1IVZA 4NLYA 2DXFA 2YQ1A 1PYSB 3OJUA 1X4BA 1U1NA 4NASA 4J37A 3IFEA 3I32A 1BWVA 2P9EA 1ZAWA 1PJ5A 1N32J 2PGCA 3I4HX 5E3CA 1YIJS 2DO0A 2N3LA 2V68A 1PAEX 4IKAA 4LF7J 1VQ6S 1IQTA 1ZPWX 1R0AA 4DSEA 1VK3A 3RB0A 3FCHA 4NLSA 4K4ZA 4JI7F 2LXIA 4V19X 3QRRA 1C4AA 4DF4A 2A1BA 1REGX 1C0UB 1XNRJ 1UMJA 2HMIB 2ROEA 5DM6Q 3GV5B 4B3SF 3PEHA 1RKIA 3GFXA 2ADBA 4XPCA 2CPZA 1U47A 4KBIA 3VZIA 3GIKA 2W9AA 1GX5A 1RT3A 3NCPA 1S6OA 3HI9A 3R97A 3J81Y 3HSJA 1S10A 3QGIA 2OH2A 1RLDA 3OTEA 4LSLB 2OPSA 1KFDA 3ZXWA 3V6KA 5CYQA 2HQFA 2ZD1A 1RWPB 1RT6A 4RW6B 3FMBA 3OL6A 4WZMA 4CP5A 5J1PA 1PAUB 1OJ4A 2EI5A 3VZHA 2WONB 3QT5A 5IFMA 4ZS6A 4I7FB 3D3BJ 1NK4A 3R6LB 1H6KX 1X4EA 4FVCA 2HRTA 2M52A 3TR5A 4K4VA 2VFRA 3LP0B 3KLIA 5IC6B 4ZP8A 5LL6d 4OZJA 1RTJA 2RJZA 1H38A 2OPPB 4FXDA 2XYGB 3BBBA 1Y9OA 2E9RX 4PWDB 2GQ2A 3EZ5A 3HHLB 1WEZA 5FDLA 4JI2F 3CO9A 5L39A 4KH1B 4USWA 4X62J 2UXBF 2VQFJ 1N33J 1LFWA 3J80Y 3IG1B 1TL4A 3MFHA 4KGMA 3CF5Q 3FEYB 4F4KA 2FJXA 1FFWB 3G6ES 2FVPA 3RR8A 1SUQB 3I82A 1H2UX 3BKTA 1S9GA 1J5OB 5IWAJ 2OSQA 4JI3F 4LFAF 1IWGA 3MEGA 3MM8A 3GG1A 1XJWB 1JK9B 4JI1F 3MAQA 4QW9A 2L41A 3DU5A 1U1QA 1HD1A 4NLPA 3TAPA 1SQFA 2WVEA 1JLAB 2MSTA 3KHRA 1H7XA 3N28A 2KDOA 1NDLA 4TNOA 4X65F 2QA4S 3WC0A 3HCXA 5THWA 2CZVC 3IRXA 4CLSA 3F73A 5E5NA 2MQMA 4ZPCA 4Q0BA 1KVJA 2I1RA 1N5VA 1N6QB 2HNYA 3Q23A 5CA5A 1MWYA 1VS3A 3ICLA 1LWFA 3HSDA 1APSA 3W1YC 1XTZA 3RZAA 3OFFA 3KFWX 4QR1A 4FF1A 1JLQB 3MOZA 3MM5B 3RU0A 1RHUB 2CVEA 3E2EA 1KP6A 2KZMA 2BEFA 3FBBA 4PQAA 2G0JA 2Z8QA 2OAUA 1S6QA 4KHPF 4OHZA 3F0NA 1PGZA 4B3MF 1IKXA 3SSRA 3FBEA 3DCAA 3MMBB 3K59A 4CLYA 2KM8B 4DV3F 1OO0B 3RAXA 2VZ9A 4NWBA 1T7PA 4IYQA 1TL5A 3VAFA 2V69A 1IUJA 4I6YA 2YH1A 5KG3A 1SXLA 1LWXA 3ZZTA 1SL2A 5L9NA 3TI0A 4CLKA 4NEZA 4TN2A 4B9VA 2OPRA 5AE1A 2ROGA 2UUBJ 3LH2S 4WFXA 4AL7A 5HJXA 1YTYA 3E01B 4ANDA 3GYNA 3JSMA 2NUHA 2DGXA 2ZH5A 3EYZA 3MURP 1FWLA 1U1PA 3I0SB 3X1LB 3EZOA 2A18A 2VODA 4USKA 3VGUA 3GIIA 2FZGB 3KHHA 1HW9A 1NJIT 2B0GA 2BANA 4DV0F 1ICEB 1TKTA 4OZ5A 2MXYA 3SFGA 3DRYA 1CS4A 4OIXA 2O3DA 1FVSA 2AQ4A 2BUNA 2KL8A 4CYUA 1UVIA 3JYTB 3I5BA 1Q78A 4OJGA 3WHIA 1VRTA 3W2VA 2QL7B 2WB1D 4M5DA 2WVDA 1UVJA 3TJ9A 2YTCA 3IWNC 1F9EB 1YLXA 3JSBA 2AJ0A 3CMQA 3V6JA 1CVJA 1QDUB 1C1CA 5HP1A 4RO0A 2FLNA 3QYYA 4J9MA 2B4UA 4EWTA 1SKUB 1WC3A 3FC9A 3FEZA 4I0WA 3OSPA 4LSNA 3TYTA 4LF6F 2EW9A 4C8LA 2V2KA 2ATLA 1SKSA 4CH0S 3W8PA 4YN3B 2NXCA 2R8IA 4O44B 5DDOC 3L4BC 4BS2A 4DJBA 1I51B 5I42A 2WW4A 3R27A 3TP2A 4TY8A 4HDGA 1WG1A 2QE5A 2NZCA 3MOJB 3AY0A 1RP5A 2O67A 4J9LA 2EC0A 1HBNA 4UOGA 3DYAB 4QU7A 1UFWA 3SQGA 2BQUA 2UVVA 2B4OA 3TQ1A 1S48A 2ZH3A 1KKHA 2WOMA 4ELTA 2PA3A 4K5RA 2F65A 4NLUA 3M8SA 1WKLA 3EMTA 2D1CA 3N5FA 3AOCA 4IFVB 5BR8J 1URNA 2Z4PA 4X66J 5A8RA 1JQGA 3JTOA 2CZ4A 5IC4B 1LK7A 1NKBA 5KFRA 3GSDA 1T03A 1X4GA 1T95A 2XG8A 3BH6B 2LCWA 1SL1A 1UCNA 4OYMA 2G2OA 5DZ6A 2OIHA 5HMYA 4AYBD 1KEKA 2P8IA 3IGVA 1ZAXA 2O1PA 3WBZA 4OI4A 4WKRA 3G82B 2G1DA 2N7YA 4HTIA 2R7QA 1CPZA 5L38A 3EGWB 1TKXA 3HSGA 5ETRA 4NE9C 3R5AA 4ZCMA 1VRUB 4YR3A 3QBCA 1TFYA 3DHWC 3U02A 1S97A 2LA4A 2YKNB 3PO5A 2HWHA 2XZTB 1X4CA 3FCVA 3PNIA 2V2QA 5DDQC 4ZVHA 4X4QA 2D69A 5KFYA 2XEXA 2AX0A 4C4WA 2D3UA 2QTWA 4KTQA 4H4KA 2EVZA 2HZAA 4LFCJ 3TZWA 2CQCA 4ECYA 4IG0B 1B70B 1T9WA 1LNQA 2A2CA 2VG6B 3OTOJ 4I2QA 1DZ5A 1N36J 2MKIA 3M6WA 3MMAA 3PKMA 3T1YJ 2BE7D 4WFZA 2XLJA 1AZSB 5LMNJ 4LF8F 3PHEA 5DZ7A 4WE1A 4G3IA 4CTAA 1YJNS 4K4XA 1XIQA 3BBFA 4FKXA 4OYAA 1S1WB 2GS8A 4BWMA 1RLCL 2NSBA 3UCGA 1VQOS 5J1EB 1DTTB 2DNOA 3MPYA 3RBEA 2KHCA 2X7IA 2APOA 3MR3A 1PKUA 4O3RA 3U7JA 4LF2A 2ZEJA 3Q8YA 2UXDF 2IY5B 3WX8A 3LANA 4Y2CA 5KFZA 1FVQA 3ONQA 4DR1F 4CO0A 3RYLA 2B4PA 2L3MA 4C8KA 2DHHA 4C7QA 1WWHA 2PFFB 1CSJA 3GIMA 1RT5A 1LKZA 5AE2A 3KLEA 1AUSL 4MYUA 4ANCA 4PZVA 1R3NA 2EWHA 4KSEB 2DRDA 2ZNZA 1CEZA 4H4OA 2DXEA 1K8AT 2HGLA 1Q79A 3VGVA 2GNKA 1U09A 2KVQE 4FN5A 4NLVA 1JNZB 2EPIA 3BB5A 3WZ0A 2CYYA 5GVQA 4OHWA 2JFKA 4OMFG 5D3GA 2EC2A 4K8RA 2HWTA 2VPXB 2CQ0A 2RQKA 1NM2A 2I38A 5A76A 3OL7A 2GQCA 1GK8A 2YWWA 2A6MA 1H2TZ 3ILLA 2HQIA 3F41A 3HFZB 5D78A 2J6UA 4N5SA 1MN7A 5D0RA 4DL6A 1TV6B 4FYYB 4MKVA 3NXZA 4JI6F 3U1MA 4DL2A 4F3QA 2MZSA 1QAJA 5KFMA 4F0KA 2ZC4A 2CJYB 5DM7Q 3OJSA 4EBDA 1SCJB 3MFIA 1Z4UA 2QLXA 5KOWA 2RILA 2FUG9 2VA2A 4X4VA 1MWZA 1FFSB 2N7CA 1B7YB 4ETZA 2NLWA 3Q8UA 4JI5J 4UZCA 1DFDA 2PD1A 2V4JA 4XO0A 3CJ3A 2C22A 2VICA 3A4TA 3JTPA 1TTHB 3PXGa 4X2BA 5IV3A 1Q8IA 4P2FA 2ZBPA 4OZNA 2MQNA 4CLUA 4QCLA 3BR9A 2RS2A 3KKFA 4F04B 2I5JB 2J8AA 4FYDA 2J76E 1RAIB 1KNZA 3PIOQ 3I6PA 5MLCV 4K59A 4CH7A 4MKBA 3H5UA 2N4DA 1HMVA 4RW6A 1F9HA 1NXIA 4B3TF 4BLGA 3T41A 5IS2A 5KFEA 2DPJA 4ZKAA 4YB6A 4KKOB 1XNQF 4GKJJ 2FYXA 1D9DA 2ZM6F 2E1PA 4NYZA 2Q79A 1AFJA 2WONA 3OR1B 4I7FA 2YX4A 2RU9A 2OSRA 3GV7B 8ATCB 4Y0FA 1IM4A 2YWGA 1K0TA 4DR5J 3D9BA 3LP0A 2BMBA 1LW2B 1QUVA 1EETA 2GIQA 4F3OA 5HROB 4UOHA 5K14B 4NA3A 2Z0GA 5DG7A 1BGXT 1XN9A 2J8SA 3TEGA 4I6WA 1NMEB 3ET6B 2MJUA 2JH3A 4JV0A 4DI6A 1H73A 3CJ8A 4P72A 3PKYA 3OVBA 3HHLA 5HVFA 1LK5A 3LO3A 5KFTA 3UW1A 2UP1A 4LQ3A 2YKMB 1U0SA 4OYIA 1D3WA 1QTMA 4FF3A 3ULHA 2IC3B 4H4KC 5KFGA 2NS1B 4RNFA 1V5VA 1HQEB 3H2LA 5FJ4A 2CG4A 4TLQA 3NWGA 3UE2A 5GMEA 5GMKa 4D3HA 1UJ6A 3V2UC 3Q8VA 1HR0F 3MM6B 2E1MC 4UW2A 1VIOA 1JLAA 3FQLA 1EQMA 4W92B 2E66A 2RDDA 4C0HA 2Q6CA 4JI0F 3RTVA 2ATCB 3T5LA 4CZCA 1ZM9A 3G8QA 3POTB 3TX8A 1U1KA 4TU8A 3MDFA 1KHVA 5B0AA 1QM9A 1N6QA 3R1HA 2HKEA 1AXQA 4ES3A 1JKHA 1VIXA 1FO1A 4I1TA 1IQZA 3CC4S 1JLQA 4IDKA 1W2BR 3MM5A 2PC6A 4Z7YA 4ZPDA 4YOEA 4NLRA 2WVFA 4LVOP 2IM3A 2KJVA 2WK4A 4IQMA 1F5AA 7AT1B 4WFAQ 2WW8A 2ZWOA 5FLXY 1EKSA 1VJQA 1S9FA 4B3RF 4ECTA 3CTRA 2LA6A 1HI1A 2UXCJ 4P7TA 3MD1A 2E7VA 1T9YA 3E51A 1WEYA 1X4DA 4F25A 3R7BB 3G9CA 2ZITA 5D15A 4Q7AA 4RUBA 2KT3A 2HAFA 1CULB 4KRWA 5F8MA 3GCWP 3GJQB 4C0BA 5I3UA 3LALA 4IFYA 5KFAA 3FGVA 3ITHA 1Y11A 3OR2B 2R7WA 1RT7B 2OD4A 3CDAA 3R1LA 2DISA 2MZRA 4HKQA 4WK3A 3E01A 4DLGA 4WIIA 3KK3B 3LPYA 2AV5A 2R2SA 5IQQA 1Y0HA 4PWWA 3CB4A 5CABA 1JLBB 4NXMJ 2HNDB 5C7PA 1U8SA 4QIWD 5F8JA 2R7XA 2H65B 4X4UA 3G6XA 2QA1A 3MR5A 3GG0A 3AB4B 1SJ3P 1ZZFA 3G6VA 1Q4RA 2XCAA 4E98A 3KHGA 3PW5A 2PMHA 4OYZA 3AXKA 1JLEA 2IDLA 1S6PB 4HACA 2OJ3A 2CXEA 2J6TA 2LXFA 4N47A 5KFWA 3G8SA 4N41A 1RYSA 1Q16B 5C42B 2XZWA 3V4IB 3RB4A 1T3OA 4WFNQ 2VBZA 1UTAA 2XB2D 5EUHA 1WC0A 3KJQB 4DQIA 1UJ5A 4HI2A 1KLMB 4Y2IA 4WCEQ 2OPQB 1T05B 2MDAA 1RABB 1A0OB 2GHVC 4W98A 1RE1B 3IC1A 1BXNA 1TVRA 3TWZA 4YS2A 2CPIA 1FDBA 1K44A 1R8CA 2DCLA 3WC2A 1L3TA 4CO4A 3T19A 1SV5B 4RLEA 1M5HA 4W90B 1K73T 2D3OR 1SJQA 3NKYA 3M6UA 5B0FA 5KFKA 3UCZP 2OKQA 5L9XA 3GIJA 1RWNB 4DV2J 3RGIA 2B9EA 2E5LF 4NZ7A 2GVDB 3EE3A 4Y3CA 4RNOA 2DVIA 4ZVPB 2XC9A 1KQSR 2PSZA 4AE5A 4Y65A 2MLYA 3L95X 3HHLC 2BXJA 1RUSA 1EHWA 4PYAA 1KTQA 4ZP7A 4IFVA 3CO0P 1G3OA 3Q86A 2QA4G 2VOPA 1RT4B 2LYVA 2RD5C 1U2FA 2V9WA 6FDRA 1I6JA 2CJXB 4AL6A 2B7BB 2DGQA 3DLBA 3BDPA 5J2QB 2LLZA 3OVAA 4ZHRA 3HKWA 2XYHB 5SZTA 2AGOA 4X4SA 3NBPB 3BEGB 2PIIA 1S1UB 2Q43A 1HYSB 4OX8A 3ZZPA 3CJ2A 4ENOA 4DS4A 2EFGA 2HSEB 3Q8RB 4RPFA 4ED5A 2FIUA 3MPDA 3G96A 2IPOB 4DV4J 3P6YC 2M88A 1I1GA 3RRKA 4LF5J 5KFVA 1VRUA 5EX3A 1WDTA 3BO3A 4PUOB 1KQFB 3S6EA 3U1NA 2BQRA 2ZOFA 3MR6A 3LAKA 4FPRA 2GFFA 1K0VA 1G1XA 4WU3A 5F8IA 4NLOA 5HLFB 1NK6A 4B3OB 3SI8A 5A6PA 2ALZA 2B8PA 2IRXA 4HVZA 4QWEA 2VG6A 3M1VB 3CW2C 1HBMA 1XEZA 3DRRA 3OUYB 2CPHA 1NSAA 3ZO7A 1U0HB 2YVSA 3HHKA 1FESA 3JB9k 2YNGA 3OBIA 2ZE2B 4ZCKA 3EDQB 3O8WA 4HI1A 3QIPA 5KFIA 3LW5C 1Q8LA 1S1WA 2LECA 4URGA 4DR6J 2GGPB 4DS5A 1RSCA 4OYWA 1H0HB 5D6GA 2EKNA 4YY3F 1MROB 2KM8C 3KLHA 1U02A 3DC2A 4NEYA 2Y8YA 4PAAA 3K5LA 3A1YG 3ISND 3V5RA 1HFEL 3EVOA 2CPJA 4NX9A 2GV1A 5L1JA 3HK2A 4ZCLA 1ROFA 2WTFA 3BBCA 3K57A 2RQ4A 3A8KA 1CQMA 4RKUC 3TX0A 1SH2A 4DCOB 4LRBA 3TVZA 4PG8A 1T94A 4DR3J 1CJTB 3ZNJ1 3RRHA 3KK2A 4PKDB 1X9MA 3MAAA 1DTQB 3OTBA 1VBYA 3D0HE 1U6FA 2KO1A 3J7ZT 4U7UD 2RKIB 3PFEA 2ZVIA 4PXDA 3KG4A 5DDRC 5CD4H 3GWCA 2RHQB 2C3OA 1NDCA 3ZC4A 1Q81T 3HT3A 3NLCA 3W65A 1SC4B 4RUAA 1HBOB 2HBYB 4U96A 1WHXA 4CLLA 2HVDA 2YBVA 2RUSA 3BGUA 1W7WA 2NQPA 2ZVSA 2EG1A 4V19J 3QIDA 1T8EA 3ENVA 1WC4A 3W9JA 2W4PA 3HMJG 1RCOB 1Z2ZA 1H72C 2UVUA 4NYOA 2BR0A 3NMRA 3D6FB 1KOHA 2K3KA 3CJKA 4HT7A 3JXOA 2ROPA 2ZH7A 3RJMB 5J2MA 2VQEF 2BJ7A 2VPWB 4YHHF 1FJ7A 4OX9F 4R8UB 3K5MA 2G4BA 4OJHA 5CYMA 1RHQB 2B7CB 2EFPA 3G4SS 2AYEA 3OXLA 1LWCB 5F0UA 2J0QD 2VC1A 3HULA 1N88A 4KGKA 4FZVA 2DBBA 3QFWA 1SC1B 2E5JA 5K20B 2K7KA 5HQ8A 1QSLA 3C8YA 2F3JA 3LP1B 2BACA 2F8HA 5J2PA 3JTNA 2I5JA 5CQGA 1N0VC 1YITS 3NCQA 3AH6A 4QOTA 4LBIA 5F8NA 1VLOA 2HW3A 1YVFA 2F5GA 4QR2A 2UVRA 2E5GA 2OI2A 5KT6A 2POKA 2FY8A 1BC6A 2AZ1A 3DXBA 1IKVB 2XI2A 3DLHA 2HQGA 1C0TA 4ZVRB 3PJXA 5B0DA 3Q8QB 1OQ3A 4JV5F 4ILLA 2BOPA 2QA2A 4CO5A 1NKCA 3DOMB 3H20A 5F8LA 1F2HA 3DM2B 2HLUA 4ZIVA 3CD5A 4C3KA 4WZQA 3DRSB 1HD0A 1G7CB 1MMNA 1FNXH 5K14A 2AF6A 5EWGA 1PJ7A 4QWDA 4DR7F 2WHOA 3AA9A 1QTNB 2KI2A 2HHHJ 4Q8FA 5BYSA 3OVSA 2HIQA 2MGZB 1UW9A 5ETTA 5LM7E 1HQUB 4P2XA 2KHDA 1UVKA 4MIBA 3QT6A 2VG7A 1RT2B 2YKMA 1TKZB 4ECUA 3OW2R 2F9DA 1NSKL 1FD8A 2C28A 5EHHA 3PTWA 3AT1B 2IC3A 4B9SA 4KQZA 3US5A 3CUNA 2UV8G 2W1BA 4L75A 4QIVA 4LVNP 2HURA 4USHA 4KT0C 3NOGA 1SJRA 1VC5A 2H51B 1RI7A 3IO1A 3D5MA 5L8RC 2F1FA 2HYIB 1U1RA 2R4FA 3C6TB 1VQ9S 1SC6A 3VCDA 2HEKA 2MKHA 3CCLS 4TU9A 5D4PA 4F4AA 3TZYA 4HDHA 4DV7F 4F8RA 3PR4A 3LGHA 3A3OB 5G4DA 1MN9A 5AXKA 4A8YA 3H2UB 4B3TJ 3FBCA 3KLVA 3POTA 5C2CA 1RU2A 4HH1A 5DG8A 4TLRA 4KR0B 1SH3A 1B7FA 1UFKA 2G0IA 1CQNA 4KE5A 4IRDA 3SSSA 4OI6A 3HSZA 1FCAA 3ELHA 1UL3A 3NWRA 2W24A 4L76A 3DHXA 2ZFHA 1CJKA 1QE1B 1JLCB 3V81A 4JBCA 5DJBA 2W7PA 2O01C 2J9CA 3GONA 1TL3B 1R8HA 2J0XA 4YR2A 1NPRA 4CLZA 1HNWF 1KR4A 3T6JA 3QFHA 2DJWA 2ASLA 1P9QC 4UQTA 3SCJE 3PX0A 1T11A 5KFQA 1M5KC 5KT3A 2BKOA 4JP8A 1VQLS 4O4GB 1SJFA 4B02A 4DSLA 1U26A 2BOAA 5HQLA 2HS4A 1NJYA 2YQ3A 2HAIA 5DO2A 3M8PB 5IQ6A 1RHKB 1KN6A 3OR2A 3CDWA 1D8ZA 2WSCC 2Z2LA 1BUXA 1RT7A 2PDAA 4RBTA 5F8GA 1FJGJ 2YH0A 1RWKB 3TVKA 3K8WA 1RZMA 1KBRA 3R5GA 1TAQA 3AQOA 3KK3A 1S0NA 1ZH5A 4AFFA 2L9NA 2RH3A 1OPZA 3I9V9 1G2EA 1XQIA 2HNDA 1MU2B 3OFEA 2KTQA 2HNZA 1CJVA 4K4SA 1X4HA 1CLFA 3FJ2A 4ELUA 4Q2MA 1EP4A 4O3OA 5BXIA 3KDOA 3M30A 3M2RA 2AYBA 2GMJA 4IR1A 4ZLJA 1NHVA 4C11B 1WNEA 4QPXA 5JXSA 1Y3JA 1VQMS 3J7YU 1S6PA 4FDFA 1NK9A 2R3VA 4NMLA 2GVZB 4ES2A 4ZVSB 1HNZJ 3K5OA 1SQGA 1T9VA 3V4IA 4RW8A 1WORA 4DV6F 1NJXA 3RRGA 2IVMA 3H42A 3I87A 1JIHA 2HQ3A 1KLMA 3S7RA 5L1IA 3VAKA 2GMLA 2YX1A 1Y3KA 1FEHA 2OPQA 1T05A 4ATNA 1FXRA 3MCMA 3QJJA 4QW8A 1S0VA 2VA3A 2C42A 4ERDA 1U2RA 4LF9J 4P75A 2PT0A 2SXLA 4X64F 3RBXA 3GYXB 3QGHA 2H5IB 5CAAA 3AQPA 3VHQA 2I0XA 2DHAA 5T7LB 2BA9A 3RW7A 3HX9A 2QX0A 3CJ4A 1HHTP 2FHMA 4J9RA 1RGVA 4CNZA 2FDNA 2JC0A 3GR1A 1VJWA 2MPUA 3I5CA 1KONA 2FHKA 1S1TA 3EX7B 4DU8A 1C2PA 4QU6A 3ZZUA 2VC0A 3J7YI 4DSJA 3NG8A 1RAOA 2VB6A 5J2NB 1ACMB 2NPIA 2WBMA 2FLLA 3ZTPA 4FS2A 5KFPA 1UKUA 4C2MA 2AU0A 4JI4F 2KT2A 3MM9B 3UVJB 4TQRA 5JVHQ 5A2QY 5L1LA 1QUPA 1RT4A 2GZOA 2XHCA 4B9MA 2LQBA 2BJ1A 2Y8WA 4JYAJ 1TQLA 2W7AA 1GT8A 4MIWA 2VHGA 4LBPA 2QT7A 1DQAA 1WF2A 1BQMB 4FKYA 3NBPA 3H4DA 1X31C 1HYSA 2R8KA 2NCKL 4I4BA 4K0KF 5C24B 3TA2A 1T3NA 1F2GA 3CJ0A 5HVHA 4AD6A 3NAIA 5KG6A 4ZJLA 4ZVFA 1QD1A 1EKRA 3UN5A 2WBRA 3TAQA 5KFFA 2F4VF 2V8PA 3UQSA 4JI8J 4PPDA 3UFCX 4M8LA 5KFCA 4TYAA 2FVRA 1ITPA 3G2XA 1HNXF 4B3OA 4GMKA 2JNJA 1R7IA 2AHOB 2BE2A 2HPUA 3NEKA 5LMUF 3HHLD 3M2VB 4P71A 1KVIA 2E9ZA 1KS2A 2PE8A 5KFBA 1U0HA 1T9TA 2FHJD 5ITHA 4YR0A 4ED6A 3JSYA 1J2VA 2NYIA 3QRPA 5KFUA 4LF4F 2CVIA 4LUBA 3OTDA 2ZE2A 1FI4A 3CULA 4OV6A 4DR2F 4WFBQ 3J7AN 2ASDA 4OHXA 2GGPA 2R2TA 2OP5A 3R6GB 2XMWA 4ZVQB 2G13A 1YBTA 1VDHA 3I0RB 4U6PA 1FRXA 2XTJP 5B08A 2NZ4A 4ZMMA 5JMNA 4OHYA 3G6YA 3BN7A 4WXOA 4EZ6A 4OI0A 1GEHA 4P7VA 1TELA 2A2DA 4GO7X 3QAUA 1S57A 1NJZA 3PW0A 3VVTA 2EFVA 2QGFB 3KJNB 3AXMA 4LBHA 3HVRA 3BN4A 2NR0A 4QBUA 3VAGA 2QZ8A 3BSAA 2BX6A 1TKDA 2YNIA 4DG1B 4GKKJ 4QWCA 2MQLA 1YX2A 1JLFB 3PO4A 3T1HF 4X4OA 3VWSA 1FWKA 2Z56B 1RISA 2QC3A 4EMDA 1TL1B 1NCLA 2DNKA 2VONA 2FC8A 2DTJA 3I9ZA 4WKYA 3JAMY 4PQUB 1E6VA 1ZYQA 1PJ6A 3UNYA 2LU2A 3DKDA 3CPWR 2RIJA 3IR6B 5EX0A 4WK1A 4C8OA 3IBFB 2QLJB 1Y00A 4W4MA 5A8KB 1UWBA 3DLKA 2RU3A 2Z30B 3I55S 4YUDA 1TU0B 1XMOF 1UEKA 2E1AA 2YNFB 3JQMA 2OFGX 1NHKL 2DRAA 5CHCB 3P8BB 2KRRA 2X1GA 2PO4A 5AXLA 3JSRA 4M5LA 1JXVA 4NI2A 2HRUA 2DIUA 4L3KA 2M0GB 4ZA1A 2ZH2A 1YZ7A 4YB1P 4NLGA 1E6YA 1RHMB 1GMWA 1LWCA 4DL4A 3V6DB 2YXLA 4B08A 2JEJA 4CM0A 2YKAA 3P49B 4A8OA 1FJCA 2B5JA 3CCQS 1S9EA 1RTHA 4F02A 1FKPB 2MYFA 4RW7A 2RRBA 2HQCA 3ZTRA 3A3PB 3KG1A 2FVCA 3QZ7A 3A13A 5C25A 2QMUB 3N4WA 4O3NA 1F1BB 3QRQA 5A0YB 5HK4A 1M0SA 4ZP6A 4Z7CA 2YWEA 2M70A 2N82B 1DQ8A 2R7VA 5ETOA 4DUYJ 1S12A 1EARA 5KFLA 1HL6A 3GR0A 3IR5B 2PFDA 1J5EJ 2HIYA 4URQU 5IT9Y 1KVKA 4M5NA 1GTEA 4WIQA 7FDRA 1B0VA 1OS5A 2RF2B 4X4NA 3ZZYA 4PWUA 3CCMS 2LFVA 3CE8A 2OHDA 1TUVA 4FYWB 4C8YA 3DM2A 1RTZA 3NGRA 2VG5A 3DOLA 5JUMA 3Q0AA 1IR0A 1S49A 3K17A 1YBUA 3J7Z5 3KHLA 2AD9A 1FRHA 2DITA 4RNHA 4GRSA 4F4XA 1BWEA 2VBWA 2W2OP 1WTBA 3WX4A 4MKYA 4M5HA 5E33A 3AA8A 1KWMA 3NOCA 2QL5B 1RWMB 1PBUA 4R0EA 2C2DA 1SB6A 1RT2A 1OSDA 1TKZA 3MEDA 5DGAA 4BBYA 4EBEA 1TAUA 4OI1A 4RNMA 4YFUA 2F8EX 4X84A 1S1XA 3GV8B 2KFYA 2BBEA 4QYZK 2V67A 3BYRA 2OFHX 5HMXA 3CMAS 4OZLA 2NREA 2IYIA 2LDIA 2JVOA 2WSEC 4F36A 2LEAA 2IJFA 1FRJA 1HARA 1EAYC 2RRAA 2WB4A 2DHSA 1N56A 2Z58B 3QJLA 4UUWA 4QYZJ 1RBAA 2KN4A 1VBZA 4DR4J 4J9QA 2JVRA 2ZZTA 4RJVA 1YJRA 3HVWA 4EEYA 3KJVB 1ZM4A 3PR5B 4C3LA 2MZQA 5KT4A 2DXDA 1JLCA 2DNHA 3HJFA 3QO9A 4DUZJ 5BYQA 5KG4A 1TL3A 4DR7J 2JLGA 2CJKA 3VAHA 4ED0A 5E3RA 4LRAA 2GJIA 4LF7F 1AB8A 1VISA 5AJ3J 3B4MA 3M6VA 4ES1A 1EZZB 2P5VA 1TMJA 1O6XA 4Y28C 5AXNA 3ILOA 3NS6A 5D77A 3ZNUA 3BF4A 2DNPA 4IH6A 4U7CA 4KV8B 1XNRF 2N3OA 1R8BA 1Z2LA 3BSNA 2XY7A 4O4GA 3KLFA 4KPCA 2NXJA 1XBWA 2ACYA 2CQIA 3A12A 1HWUA 5HATA 1N54B 4LFBJ 3M8PA 1F9FA 1LW0B 1SBRA 3NRBA 4ECRA 4IO1A 4M5JA 3ILIA 1YGYA 2O5DA 3M8QB 4EYIB 2F63A 3HPOA 2K7JA 2ZHOA 2MB0B 4DX6A 3IS9B 4FP9A 2W7OA 4IQXA 1GFWB 1UP1A 3O44A 3THPA 3UDEA 2HFSA 5L46A 5HN0A 4XAKA 4WJBA 1MU2A 1YBAA 2DT9A 5DQIA 1LXJA 2EEYA 1UVMA 4ZPVR 1X5OA 2V4RA 2HS0A 2A0FB 3I56S 2BJ8A 3MECB 2NXNA 3Q89A 2DR6A 3D1QA 3SIPB 3HXMA 3NS5A 4DOZA 1S0MA 2W9BB 3THTA 5HSPA 1RTDA 1SQEA 2XZDB 3FMWA 4R5PB 3MF5A 4NCGA 1Z1ZA 4Y2AA 1XWLA 5CCLA 2FQQB 1ZAVA 3FCWA 1J27A 2JZ5A 1DURA 3AJ2A 1F3FA 3AFGA 1C1BB 5SUHA 4ZK7M 1KC8T 3KDNA 4J7CA 1HNVA 3P45B 4X62F 3PJWA 2FGCA 3OHAA 2BVZA 2VQFF 1GXUA 1N33F 3N0VA 2F9JA 3X3UA 2HHSA 3OXFA 2GIRA 3D4JA 2NYHA 1D8YA 4UY85 2GQQA 3KLGA 3CC2S 1X0FA 2XMKA 5IWAF 1FE0A 1WUUA 5T7LA 1FTRA 4I67A 4M5GA 4ZLNA 5HBMB 1R0BG 3MTKA 1NRKA 3ISZA 2C2ZB 4C6AA 3RB6A 1RAAB 4JUZA 3UR0A 2CJAA 1F3VA 1QAIA 3MPUB 2HVZA 3GB0A 2YNHB 1WJ9A 4MTPA 2V4QA 3LWLA 4I64A 1WC5A 2QLFB 4K4YA 4ZLPA 3GJSB 4J5OA 1RB0A 2C3UA 1TMMA 2V2ZA 2Y0BB 3MUTP 4CNYA 2Y1IA 3MM9A 4Z37A 5I3PA 3UVJA 3W61A 1NH8A 3IXQA 4OZ0A 1N4LA 4FXWA 3QATA 4M5IA 2W2MP 3HHDA 2CPFA 3T5HA 1UZDA 3PDNA 2RT3A 3B54A 4CO1A 2V8DA 1RTJB 2GCFA 3A8IA 1BQMA 1WF1A 2UU9J 1B64A 4IH7A 1ELOA 1N5TA 5C24A 1Q8KA 3TAMA 2FVQA 3W5YA 1IBMJ 1VHFA 2K1RA 3D2WA 1GMUA 2COLA 5B0CA 3D1OA 2R7SA 4XK8C 3SDEA 2D74B 1RAFB 5ADZA 4ZJOA 2LKZA 4ID5A 4QWAA 1KQKA 3GE9A 4ED1A 2EFQA 2BKPA 3BQ0A 2DNQA 4RL1A 1FRLA 1AROP 3HF5A 1JLGA 2A3JA 3TARA 4HT5A 2KKHA 4URSA 2FJBB 3CEDA 1S9GB 1M5VC 1TUWA 3T6BA 4TQSA 2RVJA 1LWEB 2V34A 4ELVA 5ETPA 2AEMA 4XPEA 3W7BA 1SJ4P 2E7WA 1JXLA 3M2VA 4O3QA 4Q2LA 4DV5J 2RS8A 3K89A 4CLWA 2R8JA 4ITSA 5IM0B 1EX8A 4C8NA 1RYRA 3C66A 4Q0BB 1BQNA 3CIMA 2EK6A 3D3CJ 1ZS6A 4K5SA 4EBCA 1U1OA 3MAHA 2HBZB 4DF8A 4OQJA 4EU0A 1ZA1B 3KNAA 1MNEA 3I0RA 1U45A 4X4TA 2VPYB 3M2UA 3C16B 2NSCA 5DRKA 2E9TA 2HWIA 3BSOA 3LGNA 1IKYB 1OSCA 2XS7A 2LEBA 1AYEA 1Y10A 1NPPA 1S6QB 1REVA 1NDKA 1IKXB 3BO2A 1CJUB 3HP6A 4K0KJ 3T9NA 5KG1A 2UUTA 2B51A 3N5BA 2XWYA 4L6V3 5HMWA 1H98A 3FFIB 2X1AA 3BO4A 4I2PA 4FNHA 2OEMA 2PEHA 2CAJA 4WWSA 4O4RA 1RTIA 1U6ZA 4J9VA 4N76A 4C0OC 2D3ZA 4ZLLA 2UUCJ 3RB3A 3LP2B 1D09B 1KD1T 3DLEA 1TL7B 3QJPA 3PIPQ 1TL1A 2Y1RI 4DL3A 3L7PA 1F6TA 2HFVA 2Z2MA 3DOKB 3ISNC 4TKTA 1TZ0A 4DPXA 2MQ8A 4PXCA 1L3SA 2MKJA 2ZOGA 1HPZB 2CZ9A 3EVWA 1WKJA 3MD3A 2PI4A 1NKEA 5KFXA 2FTRA 1QSSA 1M5PC 3EGNA 2BANB 3BGLA 5HMZA 5BR8F 2RDIA 2R8HA 2V8VA 4X66F 1FERA 3L3CA 3I96A 1DLOB 1HIYA 4OYXA 5A8WA 4KO0A 3M9OB 4OX7A 2CIMA 4K7QA 5K9FA 3SEOA 5HL7Q 1BE4A 3W66A 1URRA 3HVTB 3NAHA 3W2VB 4A8SA 2AGQA 5EWEA 2HFUA 4LRCA 3DRPB 3HDSA 1UVLA 5GAEU 2R2RA 2E7XA 1U7LA 5IT0A 1WI8A 3V6DA 2VBYA 2YWKA 5HP1B 3BPSP 3C19A 3PYDA 2I9SA 1HBUA 2FHOB 3H98A 2W8KA 4E0DA 3MUVP 1FKPA 2DCUB 2V8HA 2AMCB 3ENAA 3SSQA 1FNOA 3DGPB 4L3NA 3M05A 2BQ3A 5JVGQ 5A0YA 2IM1A 2ERRA 2JOQA 3W60A 4MKAA 1S76D 5I42B 4LFCF 2AKWB 2BM0A 2Y9HA 3BS9A 1P8GA 3PHTA 3T1HJ 3OTOF 3HKZD 4E8UA 4UF4A 4LRFA 1N36F 2J7UA 2DNGA 2UUAJ 2Q66A 3T1YF 1JNRB 2RF2A 4Q5VA 1P9YA 2CRLA 2J7KA 3MXHP 2ZKUA 1TP7A 1HBNB 1RXOB 1SL0A 3GFZA 5GAEI 1X0PA 3BKUA 5B0GA 2ABYA 2WOMB 4TVAB 1VMBA 1N34F 3T5KA 2CUYA 5A8RB 5G0RA 4ICLA 4DQQA 3NP5A 1K1QA 4NRTA 1FDAA 1RKJA 4WTYA 1MG7A 1RT1A 4PRFA 2O66A 3RAQA 5H1SV 5CXTA 2EFNA 2H5EA 1I94J 5KFHA 1H74A 1S5ZA 4MK9A 3FSYA 2XMJA 3I31A 3C2PA 2JSXA 4DBQA 4Y6IA 1IBKJ 4UOFA 3PVXA 3J81U 3D6MB 1IJEB 4BCAA 4BDPA 4DX7A 3MMCB 2LU1A 2D9OA 3FSXA 4F0HA 4DX5A 1M5OC 3VF0B 1PSDA 1N52B 3MUMP 3HD1A 3R9LA 5KT2A 2XBPA 1C0UA 3GFYA 1UA0A 2HMIA 3S8SA 3NNCA 3CJSA 4I2QB 4AQYJ 2DNMA 4UUXA 3MMAB 1X5PA 2VDHA 4EUVA 2IHR1 3VV2B 1N5YB 3P5TL 4CLTA 4B9LA 3QLHB 2KFNA 3UD4P 2HFZA 1FDDA 4CTAB 1EB0A 2QJ3A 5CYJA 4ECVA 1H3DA 2ZH6A 4LSLA 3PRVA 4G65A 4K4TA 4C8ZA 2V9KA 3I5AA 1RJJA 1U48A 2CKWA 5LJ5Y 4HYKA 1MW7A 3O5TB 3BR8A 2AX1A 2JEIA 1FX2A 2CQ1A 3UO0A 2BW2A 3RBDA 4OZ2A 1GX6A 4ZVOB 3TVYA 2B56A 1VQ7S 4JI5F 1IM6A 1U1MA 4P2MA 4ED8A 2MQOA 2OLWA 2P9CA 3J80U 4IOCQ 3EGVA 3VR1A 1HNIB 1Y4ZB 3MCOA 4PEOA 1VQ8S 3L7OA 2OPPA 3CXCR 4PWDA 3OTCA 3KLEB 3P4UB 2NUUG 2IMOA 4Y00A 3N6LA 4A8MP 2R2UA 2FHJA 5B7WA 1NSQA 4GKJF 3TZZA 1RWVB 4WXWA 3IG1A 4JI7J 1PILA 5KFNA 4RW4B 3A8JA 4J9SA 1L5UA 1ZPVA 5D3GB 2VDIA 4U95A 2IYGA 3H90A 2RUGA 4DR5F
chains in the Genus database with same CATH topology
2CQBA 1WG1A 2HQ3A 4FBTA 1SUQA 3BDEA 4QQBA 2MGZA 1KLMA 2X51A 3S7RA 5L1IA 2QE5A 2GMLA 3VAKA 2YX1A 1J5OA 3K8VA 1Y3KA 1FEHA 2OPQA 1T05A 1HQUA 4ATNA 3MOJB 1FXRA 2YNIB 2WRMA 4G1QB 3QJJA 4QW8A 1S0VA 2QEXS 2MKCA 2QSWA 2XMMA 3AY0A 2C42A 2VA3A 2CPDA 3GZ7A 2CQ3A 1RP5A 1ZBTA 4ERDA 2O67A 2MY8A 4CO3A 2MZTA 1U2RA 2W9BA 4F4ZA 4J9LA 1N0UA 3K7RA 3PRDA 2PT0A 2SXLA 4X64F 1HBNA 4DUYF 2C2RA 2EC0A 1X5SA 4R5PA 1G6BA 3DYAB 3FDSA 4QU7A 1UFWA 2ZJQQ 2UV8A 3EZUA 3GYXB 2CQ4A 3SQGA 4DEZA 1J5EF 3QGHA 2BQUA 2UVVA 3AQPA 1W2IA 2B4OA 1Q53A 1S48A 3TQ1A 2I0XA 2KJWA 2ZH3A 4NPOA 2ILZA 2RSQA 3AB2B 2DHAA 5KAKA 5T7LB 2BA9A 2WOMA 4ELTA 5D4LA 2PA3A 1E6VB 4K5RA 1WHWA 2DNNA 2HFNA 4OV1A 1C1BA 4NLUA 3RW7A 1NZAA 3M8SA 3HX9A 2D1CA 2MKSA 3N5FA 4IFVB 3CJ4A 1URNA 1HHTP 2DH8A 2Z4PA 4JOUA 5A8RA 3JTOA 2FHMA 4J9RA 1RGVA 4CNZA 2CZ4A 1UWBB 4QYRA 1UJ4A 2FDNA 3DLKB 1LK7A 2JC0A 3GR1A 4DV1F 4WYLA 3TA1A 1FT8A 1NKBA 5KFRA 2U2FA 1VJWA 2MPUA 3I5CA 3GSDA 1KONA 2FHKA 1GXLA 3VAIA 4PCQA 5I3QA 1S1TA 1ZTWA 3EX7B 1X4GA 1T03A 1T95A 3CDEA 3ZZZA 3C6TA 2XG8A 1CG2A 2DR5A 1C2PA 4QU6A 3ZZUA 2VC0A 5F9NA 4DN0A 1VQYA 3NG8A 1WELA 3J7YI 1DRZA 4DSJA 2B6AB 2LCWA 4OZ1A 1SL1A 3OLBA 2V4JB 5DQGA 4R0JA 4NXNF 4FVMA 5DLFA 3IA0A 2J9DE 4F50A 2VB6A 4O0IA 1KOOA 1S72S 1QVFR 3TANA 2R7RA 1UETA 3IWXA 5J2NB 1P1TA 5KG2A 2OIHA 2NPIA 5HMYA 2WBMA 3VQTA 4AYBD 1KEKA 2FLLA 3DI6A 3IGVA 1ZAXA 2IM2A 2O1PA 4FS2A 5KFPA 3WBZA 4OI4A 4WKRA 1UKUA 4C2MA 1ULRA 2AU0A 4ED7A 2G1DA 3IBWA 2N7YA 4JI4F 3DLJA 2KYXA 2KT2A 3MM9B 3H59A 4HTIA 2R7QA 2DH9A 1CPZA 5HBMA 5C5JA 5L38A 3EGWB 4TQRA 5JVHQ 5F41A 5A2QY 5L1LA 2C3PA 1QUPA 1TKXA 1YJTA 1RT4A 4PR6A 3R5AA 4ZCMA 3N79A 1VRUB 5EGYA 1Q8BA 4X4RA 4YR3A 3MMBA 4N56A 4B9MA 1E6YB 1TFYA 2AW0A 2D7SA 2LQBA 3DHWC 3U02A 5E7OB 1S97A 2VOOA 2LA4A 2YKNB 3PO5A 4JV1A 2HWHA 1HMVB 4DMZA 1D9AA 3CD6S 1TQLA 5K8MA 2W7AA 1X4CA 2YNHA 1GT8A 4MIWA 2QT7A 1DQAA 3PNIA 2ZBCA 1WF2A 1BQMB 5DDQC 4ZVHA 2V8GA 1XR5A 3NBPA 3H4BA 4LMZA 2KXNB 3H4DA 5DETA 2IRUA 3CT9A 5HO4A 2B5JB 4X4QA 2MKKA 1QE1A 1HYSA 2R8KA 4XDCA 4I4BA 5KFYA 2XEXA 1S9EB 4K0KF 2AX0A 4C4WA 5C24B 1N32F 1B0TA 1RTHB 2D3UA 1TFWA 4KTQA 3SCKE 4H4KA 3TA2A 3A8EA 2EVZA 1T3NA 1F2GA 4RW7B 1QSYA 2C3MA 3B78A 3CJ0A 2CQCA 4ECYA 4IG0B 3CSKA 2G9OA 1S1VA 2B4VA 2A2CA 2VG6B 5GAGU 4MYTA 5C25B 3KMSA 3ENWA 3NAIA 3RR7A 1SKRA 4I2QA 2DNYA 5KG6A 3D1HA 1K9MT 4ZVFA 4USIA 3KK1B 1DZ5A 2MKIA 3M6WA 3MMAA 3PKMA 4DQPA 1EETB 1R8PA 1RA7A 4WFZA 5KFJA 2XLJA 2M8HA 2WBRA 3QJPA 2MMYA 3TAQA 2P6SA 5KFFA 1YI2S 2F4VF 3UQSA 2B9YA 5I4MA 4LF8F 4ZOSA 4PPDA 2N4CA 3G86A 3UFCX 4GC6A 3PHEA 4M8LA 4BC7A 3I0SA 4WE1A 2DO4A 4G3IA 1VQSA 5KFCA 1Y7PA 2EBEA 4TYAA 2FVRA 4CTAA 1YJNS 4FS1A 1HWKA 4K4XA 5J1NA 1HNXF 1IKWA 1MMDA 2GC8A 4KIAA 4U67Q 2W9CB 4ETXA 1S1WB 2OTJS 4BWJA 4B3OA 5E3AA 4GMKA 4BWMA 3N01A 1F5CA 2UUWA 1R7IA 4KB7A 3FRYA 4DR4F 2UXCF 5E2QA 3DFEA 5AE3A 2NSBA 2DH7A 4FBUA 2HVIA 4I69A 3UCGA 2F40A 1VQOS 2BE2A 5J1EB 2HPUA 4YB7A 1DTTB 1IN0A 2DNOA 2EBGA 3MPYA 3DMJA 2BJEA 5LMUF 4H4MA 3PZPA 3HHLD 3M2VB 1KVIA 3KNGA 3RBEA 2E9ZA 1KS2A 2VG5B 3DOLB 3ENQA 2KHCA 2PE8A 5KFBA 2HHQA 4QPTA 2FHJD 5ITHA 4YR0A 4ED6A 4DN9A 3HLUA 4OHVA 3JSYA 4RZRA 1J2VA 2ZDOA 2ZZNA 4IRKA 2APOA 2NYIA 4DUZF 3K58A 3EXCX 5KFUA 3JYTA 2VKRA 3MR3A 4LF4F 2CVIA 1T02A 2L08A 4LUBA 1S4FA 3OTDA 2JFDA 4YDXA 4O3RA 3U7JA 5B09A 2ZE2A 4F26A 2D9PA 3CULA 4DR2F 2QYCA 1RWUA 4WFBQ 2UXDF 2HGNA 1UEVA 2LDYA 4AUKA 3LANA 2MQQA 4Y2CA 3VQSA 2ASDA 2A10A 4OHXA 3TUZC 5AJ3F 5KFZA 1FVQA 3ONQA 2GGPA 4DR1F 4DFPA 2DHGA 2HZCA 2R2TA 3T3FA 2JL9A 2OP5A 3CWJA 4CO0A 3RYLA 2B4PA 2XMWA 3PACA 2G13A 2L3MA 3MEEB 1LWEA 3SMZA 5HI7A 4QZVB 2DRBA 4C8KA 4J9NA 1X4AA 4RBUA 5F9LA 4C7QA 3I0RB 5GAGI 1DARA 1WWHA 2B9XA 1FRXA 2LXUA 2UZAA 4U6PA 2PFFB 2BRLA 1CSJA 3UPFA 1RT5A 3GIMA 1LKZA 3QGGA 5B08A 2NZ4A 3MEDB 4ZMMA 4NXMF 5AE2A 4DDFA 3KLEA 5DDPC 4MYUA 2VFSA 3BN7A 4P6QA 4WXOA 3G6YA 2XNQA 4OHYA 1R3NA 1FRKA 2QO3A 1ZZNA 4EZ6A 4OI0A 4LFBF 4Q45A 2EWHA 4C11A 4KSEB 2ZNZA 2W25A 4P7VA 1CEZA 4H4OA 1X4FA 2A2DA 5IM0A 1K8AT 2HGLA 1S1XB 4R25A 2MZJA 1Q79A 3O3LA 4OX6A 1MSWD 4QWBA 2GNKA 3MI7X 4GO7X 4C98A 1U09A 1HW8A 4MIAA 3QAUA 4FN5A 4NLVA 4O44A 1ZM2A 4A8WA 1NJZA 3PW0A 1JNZB 3EPIA 2XNRA 3NNAA 3LOUA 2EPIA 1W25A 3MPVA 1WHYA 2EFVA 3BB5A 1ZOTA 3WZ0A 1WEXA 2CYYA 5CCMA 2F7VA 1YQHA 5GVQA 2FB0A 4NRUA 4OHWA 3M8RA 3TO8A 1XC9A 2JFKA 1U49A 3L09A 4OMFG 1KQGB 3HVRA 1JKHB 2Y1JA 3BN4A 7FD1A 2NR0A 4K4UA 5D3GA 1F0XA 4HDGA 1O0PA 2XMTA 2HWTA 2VPXB 4A8XA 4IDKB 4QBUA 4MAKA 1Q86T 3D54A 3VAGA 2QZ8A 2CQ0A 3PX4A 3T1AA 1JWWA 1KSPA 3BSAA 2RQKA 3C6UA 3MTJA 2C3YA 1R0AB 1TKDA 2FLOA 2I38A 2VD3A 2QRRA 2YNIA 3OL7A 4DG1B 4G1IA 4I68A 2GQCA 1H2VZ 2RB7A 4QWCA 2MQLA 5EN1A 1H2TZ 4IH5A 1O5JA 1JLFB 2IA6A 2HQIA 1IKYA 3F41A 5D78A 3PO4A 2J6UA 2FGOA 4F67A 2CJ9A 4NCBA 4N5SA