1VQ4S

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq4S00
2DGOA 2DNZA 4IO9Q 4F26A 2M52A 2M70A 1DRZA 1X5PA 2CPJA 5ITHA 3PIOQ 3G9CA 2X1BA 2MY8A 2LXIA 2DNLA 2KHCA 2KRRA 3ZZYA 1OO0B 2J76E 2HGLA 1HD1A 1KOOA 2QA4S 2FC9A 1U1NA 3UWTA 3L3CA 3UCGA 4CQ1A 3MUTP 2XS7A 1L3KA 5IQQA 3FEYB 1ZH5A 2F9JA 3VAKA 2GO9A 5HL7Q 4WFBQ 2KXHA 5DDRC 3CCMS 1G2EA 3TP2A 1FJ7A 2JVOA 2DGUA 5FJ4A 3S01A 2HGNA 2MZQA 3MDFA 3NS6A 1X5SA 2QEXS 1WF0A 1YWXA 3NMRA 3SXLA 3CPWR 3CCVS 4WFAQ 2V94A 4P6QA 1URNA 1R8PA 2KI2A 2MXYA 3P49B 1WEYA 2KG1A 1X5OA 1VQ8S 2KFYA 2N3OA 2RVJA 5LSOA 1O0PA 2CPYA 2KT5A 2UP1A 1U6BA 1M5VC 2XS5A 2MB0B 1VQPS 3FEXB 1WHXA 2FHOB 4UY8T 1Q7YT 2DK2A 1OIAA 2VONA 2YKAA 3G6ES 2L08A 4U67Q 1X0FA 2LXUA 2FPHX 2N82B 4UQTA 2WBRA 2KM8B 2M88A 5IFMA 3RW7A 2E5HA 1WI8A 2AYEA 3S8SA 2J8AA 5DM7Q 2D3OR 4YOEA 3ZZZA 2DNPA 2CQIA 5LJ5Y 4TLQA 2E44A 2A3JA 2DH9A 3P3DA 2CQ2A 3CCSS 3BO3A 2D9PA 2DISA 2DH7A 2DNYA 2CPEA 2DIUA 3SDEA 3OW2R 2B0GA 1M90T 4WFNQ 2KM8C 3EGNA 2DHAA 2K3KA 1YHQS 1UAWA 3UCUP 4WKRA 2E5GA 2OIHA 2MKCA 3S7RA 3SMZA 2KXFA 2LEAA 3CCES 1N54B 4LJMA 2MKSA 2HGMA 5BJRA 5DDPC 1U1QA 3B4MA 2CQ1A 2L41A 2CQCA 3D2WA 3VF0B 1QVGR 1RKJA 2PEHA 2ADCA 2KRBA 2DNGA 1B7FA 2KYXA 5GVQA 3EGZA 2LA4A 2DNMA 2SXLA 4IOAQ 2MMYA 2M0GB 2ZJQQ 2ZJRQ 3CCLS 3CC4S 3ULHA 3BEGB 1FO1A 3NS5A 1X4GA 3J7ZT 2J0QD 1H2TZ 2MPUA 1R8HA 2CPHA 3MURP 2MQNA 3Q2TC 2Q79A 2EVZA 1NJIT 1D9AA 2RRBA 1YIJS 1VBYA 2XNQA 2YTCA 3MOJB 2DH8A 1CVJA 2YH0A 2NLWA 2XNRA 5GAEU 2PE8A 1FHTA 1KD1T 1SJ3P 1SJFA 3G96A 2EK1A 1ZZFA 2DNQA 3THTA 1S79A 2M7SA 2AYBA 2X1AA 4F25A 1HD0A 1SXLA 1VC5A 5EN1A 1N8RT 1VQLS 2DITA 2MYFA 1AUDA 2CPFA 3G8SA 2CPIA 1X4DA 3IRWP 1PGZA 1FXLA 2RS8A 4PRFA 1X4AA 1DBDA 1JMTA 3VAGA 2DIVA 3G71S 2BOPA 1UFWA 2M4MA 1BY9A 3P5TL 4TU8A 2M8HA 2DNRA 3MD3A 4OZ1A 2KH9A 2HYIB 4BS2A 5GAHU 1U1PA 3H2VE 4WCEQ 3HI9A 3CMAS 1K73T 2DNOA 5IM0B 3R27A 2HZCA 1VQ7S 3MD1A 2CPDA 1Q86T 2CQ4A 4CH1A 2MQMA 2KU7A 2ZJPQ 2LECA 1WI6A 1H2UX 1KOHA 1A7GE 2LEBA 2YWKA 1M5PC 2DHSA 4Y0FA 3CC7S 2L9WA 2AD9A 5JVGQ 4CH0S 2OJ3A 3DXBA 2YH1A 2MJNA 2LMIA 2MQLA 1QVFR 2FC8A 1WHVA 3J7YU 2LYVA 2MKJA 3VALA 1YITS 2JWNA 2M2BA 3NNCA 5LJ3Y 2D9OA 1U6FA 1FJEB 2DO4A 4IUFA 2ERRA 4ED5A 4PR6A 1WF1A 5MLCV 2RNEA 1FJCA 2MGZB 1VQ4S 5GMKa 1OWXA 4WIIA 3MUMP 1QM9A 2MZTA 2DO0A 3K0JA 1WEZA 1WHYA 2E5JA 3UD3P 2E5IA 1P27B 2MZ1A 1VC0A 3CCUS 3CD6S 2F9DA 5LSLA 2JX2A 2M8DB 4ERDA 1U1RA 3NNAA 1P1TA 5DM6Q 1WHWA 3I55S 2LQ5A 1A9NB 2OTLS 1YTYA 4OZ0A 5CXTA 5CA5A 1DHMA 2MQQA 4V19X 1M5KC 2OSRA 3CCJS 2I38A 1YJWS 4LMZA 1N88A 1WG4A 4A8XA 1VQMS 4Z2XA 3US5A 2RUGA 3LPYA 5GADU 3JB9k 3LQVA 2X1GA 4EGLA 2K8GA 2CQBA 3UE2A 2DGVA 2DGQA 2N3LA 2CQHA 2OSQA 1N52B 1UW4A 2RS2A 2J0SD 2KN4A 2U1AA 4IOCQ 4FXVA 1JJ2R 2CPZA 2O3DA 1WELA 4WF9Q 2DNHA 3IWNC 2U2FA 3UCZP 1JJ4A 4CIOA 1YJNS 2MQOA 1YI2S 2KG0A 4YB1P 1FT8A 3MI7X 2ADBA 2LCWA 4TU9A 2RT3A 2MY7A 5JVHQ 2VODA 1VBZA 3EX7B 5GAGU 1S72S 2CQPA 3DLLQ 2DB1A 1XN9A 2G1DA 5H1SV 4W92B 2AYMA 1JJHA 2CQ0A 5CYJA 3CTRA 2DNKA 2JRSA 2MGZA 4Y00A 5LXRA 2FY1A 1WWHA 3CCQS 1SJ4P 5D78A 3VAJA 2G4BA 3BO4A 1K9MT 1Q82T 3BS9A 3VAHA 2LA6A 1DZ5A 2VOPA 2DGWA 1X4FA 3TYTA 2XS2A 2CQDA 3CC2S 3CF5Q 3MXHP 1WG1A 1YJ9S 4PKDB 1ZZNA 2LKZA 2MQPA 4C0OC 3VAMA 1X4CA 2MJUA 3HHNB 1U2FA 1X4HA 2F3JA 4W90B 2OTJS 2N7CA 3S6EA 2QFJA 2M9KA 2CQ3A 2MZJA 1UP1A 2MSTA 1VQ6S 3CUNA 4QU6A 4FXWA 3VAIA 5HO4A 2DGXA 1U1LA 1OPIA 5IM0A 3I56S 3BO2A 3V4MA 2I2YA 1M5OC 4C4WA 3Q2SC 2CJKA 2NZ4A 3B4DA 2DHXA 4J5OA 2XB2D 3THPA 5LXYA 5DDOC 2MZRA 4YUDA 2DGSA 4TU7A 2RRAA 1U1MA 3U1LA 3VAFA 1W2BR 1RK8A 2AYGA 1WF2A 3RW6A 2XSFA 1VQOS 4C7QA 4RU2A 1KC8T 3CMES 1U1KA 3R1HA 1PO6A 1VQNS 1HL6A 2DGTA 1NU4A 3SDEB 1FNXH 3MUVP 1SJRA 1M1KT 3PIPQ 2KXNB 2DNNA 2X1FA 5D77A 1KQSR 1SJQA 3TO8A 2CQGA 2RQCA 2KVIA 1WG5A 1VQ9S 3CCRS 2VOOA 2MHNA 2G0CA 2RQ4A 3G4SS 4LIRA 2MKHA 1IQTA 2DHGA 2MKIA 2RU3A 1WTBA 4M5DB 5DDQC 1X4BA 1K8AT 1VBXA 4QU7A 2GHPA 1U1OA 4F02A 1H2VZ 1Q81T 3G8TA 1X4EA 2JVRA 1VC6A 1H6KX 1VQKS 3U1MA 2MZSA 4ZKAA 2MKKA 2BZ2A 1X5TA 4QQBA 1VQ5S 3H2UB 3N9UC 1WEXA 3CXCR 1HA1A 3CULA 3UD4P 3NNHA 1F9FA 3R1LA 3P6YC 2CPXA 5DETA 4QPTA 2HVZA 2EK6A 1D8ZA 2MSSA 1NO8A
chains in the Genus database with same CATH superfamily
1C0TB 1IBLF 2AX1A 2M70A 4RNFA 4ES1A 3HVRA 1DRZA 4ZVPB 3W63A 3U1NA 3QT5A 2CPJA 1PJ5A 3QJLA 2FGCA 1P6TA 1S1XB 1S9GB 1WOOA 2BKNA 4KGVB 2MY8A 2LXIA 2NXEA 3WQPA 2DNLA 4TQRA 2W9BA 4HLBA 5F8HA 5KFSA 2HFZA 4C3KA 3JSMB 2LQ8A 4O3OA 4BWMA 2E1RA 3ICLA 4JI0F 3ZZYA 1MU2B 4V19J 1E6YB 1OO0B 2ASLA 2HGLA 3DI6B 3L7UA 3CJSA 3TJAA 2ZZNA 3VHQA 3J7A1 2HHPA 1KOOA 4PZVA 2FC9A 2DT9A 3TW0A 3E3XA 3UWTA 3JS9A 5CABA 3UN2A 4DUYF 3OFEA 4DR5J 2WSCC 1HNVB 1ULRA 1RWXB 4CQ1A 5EX0A 3MUTP 3J80U 2LQJA 4DUZF 1U2RA 1HI0P 2XS7A 1JX4A 3A1YG 4NCGA 4YQWA 2QLJB 2XQCA 2GGPB 2L48A 1RBOB 1H7WA 2OPPA 5KFLA 2APOA 3UDLA 4AE5A 5BXIA 3CCES 3TAQA 2GO9A 5HL7Q 2OI2A 2KXHA 2OPRB 1S1TA 3G87A 4GMKA 4HH1A 3PXGa 5D8HB 1FJ7A 4ZPVR 4RBTA 1IBMF 2FJDB 4U96A 2RILA 5A8KA 2MZQA 4I67A 4NCAA 4ZVSB 4ANCA 2VV5A 2Q43A 3W9IA 4X4OA 2YVSA 1YWXA 5LMNJ 2CXEA 1UEUA 2B51A 1B99A 2C3MA 1CC7A 3CB4A 4ES2A 3SXLA 2PFDA 1XJWB 2XO7A 2V94A 4P6QA 1S4EA 4WWSA 4M5JA 5A8WB 5L8RC 2VQEJ 4LFCF 3ZNUA 1WEYA 2XYPB 1X5OA 3K8WA 1R6VA 1MWZA 3PO4A 1KHVA 3EWGA 4C8YA 2RVJA 5LSOA 2UVVA 1S6QB 1FE0A 2K1RB 2KT5A 4KHPJ 1SKUB 4OZ2A 4ZS6A 1U6BA 3T1YF 3AB2B 2JSXA 1FFGB 5K14B 4A8QA 2OEKA 4USWA 2JLGA 2RHSB 5CYMB 2HZAA 5EGYA 1JLCB 2IHR1 4ZIWA 1UA0A 2B8PA 3DU5A 5A8KB 3NOCA 2VG7B 1RU1A 1RLCL 2X3GA 1YG0A 3FVYA 1RHMB 5HQMA 1SL0A 3G6ES 2C3UA 2L08A 1H0HB 3MPDA 2WTFA 3H90A 3UNGC 1BHNA 2N82B 4J9PA 4UQTA 2KM8B 2M88A 4M5DA 4CO0A 4DSLA 5HK4A 4LFAJ 1KONA 2ZE2B 1KHWA 1YGYA 3FBBA 4QIFA 3HKWA 2E5HA 3ZTRA 1NK6A 2XBPA 3K89A 2XULA 1GNKA 3N5BA 5KFIA 1BWEA 4WJBA 3IS9B 4WK3A 5ETOA 2RRNA 1NDPA 2J9DE 4F36A 4X64J 3ZZZA 2YKMB 2YKOA 1LV5A 2DNPA 3P5BP 1JLFA 4OYZA 5I4MA 2YWEA 3TQ1A 2CQIA 3BDEA 3OPKA 4TLQA 5LJ5Y 1FKAF 1HNWJ 3ZZPA 5DZ6A 2A3JA 2DH9A 2YBVA 3ENWA 3G2XA 4K2JA 2VKRA 5EWGA 1FJGF 5EUHA 3CO9A 4YMEA 3OR1B 4ZVEA 4OLOA 2HRTA 1UFKA 1CJUA 4M5HA 3DN9A 2ZH3A 3PW5A 2XLKA 2BM0A 2CRLA 2ZWPA 1M90T 2KM8C 3KLHA 8RUCA 1YHQS 2O67A 2E5GA 3AB4B 4Z7CA 2XO6A 4YP3A 3PHEA 1IR1A 3S7RA 3VQSA 3WHIA 5KT4A 1NB7A 3RBEA 2ZHOA 3MEDB 4LF7J 1VJWA 3C16B 4LF9F 1MG7A 2OPRA 3SMZA 3N01A 2LEAA 4HACA 2B4VA 4LRDA 4P2SA 5HVFA 1SUQB 2MEWA 1N54B 3F44A 2A2CA 4KJIA 4F0MA 4LJMA 2ZNYA 1DFDA 1HMVA 5DDPC 2OGUA 4NL5A 3QBCA 4OZ5A 1UMJA 2YNGA 4DU7A 4KHRA 2L41A 3UQSA 2ASYA 2AX0A 3I96A 8AT1B 3QJJA 2HNYB 4WXOA 2EG2A 1SIWB 1R0CB 1X7VA 1CJVB 1R89A 4WP3A 4DN0A 1EAYC 2ZHBA 4ECQA 2C2OB 2CUYA 3I0SA 1S7HA 1U48A 5GVQA 2LA4A 2QIFA 3VTIA 3HXMA 3ENQA 4C48A 1JB0C 2OP5A 1IN0A 3MCMA 1ZM3A 1V3ZA 3GV5B 3OSNA 4ZCKA 2CZ4A 4NA2A 3ISND 4FVMA 1S9GA 4N7TA 4FN5A 3Q8VA 3DRPB 1RQ0A 3I5BA 5DJBA 2LVWA 3U02A 3PW0A 3PW7A 3NS5A 3J7ZT 4RW4A 4K4XA 3OVSA 2J0QD 3C8YA 3FSYA 1KQFB 4B9SA 2ZBCA 2EC0A 3BR8A 4NLOA 1NKCA 2PD1A 4DV2F 3Q2TC 2GQQA 1KLMB 3OXFA 2EVZA 4NLYA 3EPGA 1XMBA 3IG1B 4RW7A 1OQ3A 1D9AA 4U7CA 2OEMA 2V8PA 3TQEA 1VBYA 3G86A 5IWAJ 2VF3A 5KFWA 2HHXA 2Q1LA 4W4MA 4PG4A 1ZOTA 2AEMA 5GAEU 1U26A 2PE8A 2HMIB 1T9YA 4CO1A 3M2UA 2BEFA 4LF7F 5KFUA 2EK1A 4TVAB 2VJUA 2EKNA 2FGOA 3OHAA 2ZKUA 2HFVA 2DNQA 2RQMA 3IBWA 4IG0B 4USTA 4JI3J 5LM7E 2B6AB 4RNHA 2M7SA 4WFYA 4LBPA 4LF4F 5HN0A 2ALYB 1RT1A 2G0IA 2VB6A 3MAHA 2XWXA 3MM8A 1BD6A 3TWZA 4CI0B 1N8RT 1Q7YT 3T5LA 1VQLS 2DITA 2MYFA 3K5PA 1AUDA 2R2TA 3PO5A 3HX9A 3DKDA 3EZUA 1FDNA 1X4DA 4NX9A 3IRWP 5L1KA 4DQSA 2CJAA 1U47A 2GV1A 4TYBA 4KPYA 1FXLA 1VRUB 1HLWA 2OUGA 3TJ8A 1Y00A 3MEEB 5K8OA 3PR4A 3G6YA 1SI9A 1ZAXA 2Y0BB 3VAGA 2DIVA 3G71S 1KBRA 1RKIA 3KMSA 2ZOGA 1UFWA 1W26A 2M4MA 5KFFA 1FVSA 3P5TL 5D4OA 1NKBA 4OI0A 1KFSA 4C0BA 2GA7A 1R31A 3H59A 2KH9A 3H0PA 4QJVA 1JJCB 1HR0J 5GAHU 1FXRA 1B70B 1RAHB 1SQFA 1OQ6A 1R7IA 3TUPA 4IH5A 4H4MB 2HW3A 2JNJA 3GE9A 3IWLA 3V6JA 2AIRB 2HZCA 3T6BA 3MD1A 1JLBA 1NZ8A 4HHUA 1VHIA 2CQ4A 2W7AA 5L9XA 5A76A 3J81j 4CH1A 1RWPB 4PXEA 2W9BB 1Y4ZB 3D1OA 5DO2A 4DI6A 2AJFE 2ZBPA 3B78A 3CJ5A 4PWDA 1H2UX 3EE3A 3OXLA 2XMKA 3F41A 1TUGB 2NPIA 2RSQA 2HG4A 1M5PC 1FX2A 2DHSA 2GHWA 3QO9B 4U6PA 3PX0A 3OL8A 2L9WA 4G1IA 2AD9A 2IFXA 1SVDA 1F2GA 5IT9Y 3IRXB 4CH0S 4DV3J 4JI3F 2HVDA 4QCLA 2BM1A 3L4BC 4RW7B 1BQNB 1HI1A 2HFNA 3MPUB 3GR0A 5H9FK 4M5GA 3AJ2A 4KTQA 4DHVA 4LR8A 4LSZB 2NR0A 1W2IA 3TZXA 2MKJA 3VALA 2M2BA 3GIIA 2MLYA 5LJ3Y 3CJ0A 3RAMA 3EPIA 3D3BJ 2ZD1A 5KT3A 4ICLA 2EFVA 3PACA 4M8LA 1UVMA 5EX3A 4AXJA 2ERRA 4OZNA 2ZEJA 4ECTA 4BBYA 2KFZA 3PEJA 5MLCV 2VBXA 5ETQA 2W2OP 1FJCA 1PAEX 1OYEA 2YXLA 2HQFA 3MUMP 2AMCB 2OKQA 4WIIA 1QM9A 4IG3B 1TKZA 2DO0A 4HYKA 4FKYA 1RABB 2E5JA 1RT2A 5CH7B 2E5IA 3PRBA 1VC0A 2VFVA 5C42B 1HNZJ 3TUJC 1TKZB 2ZH9A 1SC4B 2GCFA 1KNZA 4KH0B 4F2SA 1Q8BA 4USMA 3DGPB 1J5OA 1AYEA 3UPFA 3H7HB 4P2MA 2UZAA 3IC1A 2R8IA 3MCOA 4EBDA 1Y5NB 2ZD1B 1VI7A 2QA2A 1P1TA 2BE9B 3TOQA 1C1BB 2XEXA 3LGMA 3PVXA 1D9DA 4RBVA 1GFWB 3GILA 1KVJA 3ZTSA 1S10A 2HFSA 1K1QA 1MN9A 5CXTA 4EZ6A 4KGZB 2HIQA 4F3OA 1M5KC 3M8PA 1VRTB 4RLEA 4DCPB 3DOKB 2AGPA 4O3PA 4URGA 2VFRA 1SKWA 2VPWB 1GMWD 3TEGA 4DCJB 4DV3F 1N5YB 2Z30B 1LWXA 4XDCA 2YX4A 5D0RA 4DR3F 1RT1B 2ZM6J 4A8XA 2QO3A 5C7PA 4ECRA 3NGTA 5DGAA 4DR7J 2Z8QA 3GMGA 1BQMB 1NZAA 2AU0A 1AW0A 3TA1A 3A4TA 4Z2XA 2R8GA 3DM2B 5GADU 4U9RA 1YZ7A 3H4DA 4CLPA 3JB9k 4UY85 4DUYJ 2DGVA 3RB4A 1ZETA 3ILIA 4LREA 4U8YA 1C1CB 1SH2A 3ZTPA 5HROA 3U7JA 1FF2A 2B9EA 3AD8C 4CLFA 3PW4A 2HVIA 4IFYA 1HBMB 2KHDA 4DV1J 2A2DA 2V2QA 4IOCQ 4ZJQA 4FXVA 1JJ2R 2DR8A 1O51A 2O3DA 4NLUA 3LGHA 3DOKA 2QMUB 4R5PA 2HNZA 3O2IA 3KJNB 1XERA 4B3SJ 3G6XA 1U8WA 1YJNS 4KKOB 2NS1B 4O44A 3NCRA 2XGPA 2KG0A 2VZ9A 1KS2A 2ADBA 2ZH8A 1NAQA 2RT3A 2DCLA 3PKMA 1CJKB 2J7KA 4NWBA 4DPWA 5LMNF 5JVHQ 3NGRA 3W8GA 1N5VA 2VG7A 1QAYA 4CZCA 2H5IB 2BQ3A 2YNIB 1RT5B 1VBZA 4AL7A 1Q5VA 3W66A 5IS2A 4I69A 4DFPA 2H48B 3RG6A 3A3PB 3W1YC 4OLPA 5GAGU 3RB3A 3DLLQ 4LFCJ 4FF4A 4F2RA 4F4WA 2WSEC 1VYAA 3IR6B 3CCRS 3SSRA 2B6AA 4CLTA 4TXSA 5CYJA 1PG5B 1CC8A 1QUVA 5D3GB 1RT4B 4KHPF 2Y3YA 4Y00A 4LT6A 4DR2F 2YQ3A 4XTTA 1RHRB 1CBKA 4DR3J 2ZM6F 3BGLA 1X9WA 4EK2A 1SJ4P 4PPDA 4ZVFA 4RW6A 5T41A 2UVWA 2YNFA 3FK4A 4OYBA 3V6DB 1LK7A 3C6TA 3BO4A 2NPFA 1Q82T 1F0XA 1DZ5A 4LVNP 3OL6A 1X4FA 2MKYA 1S48A 3C16A 3OT9A 3PJXA 4KIAA 1Q7LB 2CQDA 3O1LA 3CF5Q 4DF4A 3OFFA 4LRFA 1F2HA 2GAGC 3CJRA 2D1CA 2FVPA 4I4BA 4DR5F 4DJBA 1LW2A 1JK9B 1VJQA 2ZKTA 3GFYA 4FZVA 4B02A 1S1TB 1U0HB 1MN7A 1U2FA 1X4HA 2MJUA 2W4CA 3UW1A 2XCAA 1QSYA 4NZ7A 4QIVA 1PYTA 3FJ2A 1T9VA 2GGPA 4A8YA 2JDJA 2N7CA 2OTJS 1XEZA 4PWWA 1T3OA 2QFJA 3IR7B 1UJ6A 2QE5A 2DY9A 3MMAA 3PCOB 2MZJA 4ZPAA 3A3NB 3E01B 3W2WA 4O3QA 3G6VA 3KHHA 3CUNA 4MH8A 1VQ6S 3TAMA 4QU6A 2R7XA 2DGXA 4I2PA 2YWHA 3BSNA 4MK9A 1TR0A 2K2PA 2QTWA 3V6HA 1QJHA 1GMVA 2GW8A 3V6KA 1G3OA 2IJFA 3FCHA 5D6GA 4D3HA 2DRBA 1TL3A 2VD3A 3LW5C 3Q2SC 2GQCA 3CCTA 5JXSA 5CCLA 3OTOJ 2D3O1 1T05A 5CD4H 3DRRA 4ANEA 3Q89A 5ETRA 5F9LA 3MM6B 3FCWA 2K06A 3UDEA 5F3ZA 3DLKA 4G3IA 4DU8A 1TMMA 2XMUA 5DDOC 1S4FA 2MZRA 4DS5A 4PUOB 2A18A 1FK9B 3EGVA 4TU7A 2V34A 5EWEA 2XY7A 4Q45A 2V0NA 3KJFB 4OI3A 3I0RA 3P8BB 3ISNC 3DLEA 4F3QA 1WF2A 1XR6A 2PIIA 2XTJP 3VVTA 1AB8A 4X4SA 2UUAF 4ILLA 1PSDA 4LF2A 4F3MA 4C7QA 1ZM9A 4FBTA 2KZMA 3R2CJ 1SH3A 3MM9B 4FNHA 1U1KA 3H40A 2ZDOA 3KG1A 2NXCA 1OSDA 1S9EA 3MGJA 4IYQA 4LVOP 1NK7A 3BKFA 4USVA 1FNXH 5CYQB 1ZM4A 3D28A 3PIPQ 2PGCA 1YDLA 3BV8A 1VHFA 4NXMJ 2XI2A 1PC5A 4K4WA 1TAUA 2B3TB 3NP5A 2XSJA 3MTJA 4NOHA 3JSBA 5D77A 2H65B 3NG8A 4FS1A 4WFZA 3PW2A 1KQSR 1V5IB 2HFUA 2W25A 1BXNA 3BYRA 1C0UA 4PEOA 3ENAA 4WXWA 1S0MA 4CYUA 2E1CA 5CYQA 2AJQA 1HNXF 4YY3F 1SC1B 1WG5A 3PFOA 4H4KA 3MFIA 2FHKA 2OMLA 1FRXA 2GIFA 3G4SS 3OLAA 2W7OA 4ED1A 2VKZG 2ZUAA 4MIBA 1ZPVA 1R0AA 2WONB 3LP1B 1OSCA 2W2PP 1IQTA 2V2KA 1OMSA 4FYVB 2FJVA 2DEJA 3KHGA 5DDQC 5F0WA 4YEAA 3IM9A 4CLYA 5HMZA 3PNIA 1K8AT 4B3RJ 2GHPA 1Q78A 4LR7A 4YN3B 2EBGA 3D54A 5KFHA 4FBUA 3KKFA 4I2QB 3CNQP 1T0TV 2IPOB 3G8QA 5DLGA 4Z37A 1AROP 1Q79A 2P6TA 1IBKF 1H6KX 1IM6A 3OTCA 1VQKS 2BJ3A 3MPYA 2IRUA 3OV7A 4I2PB 9ATCB 3TAMB 1K47A 2WW8A 3NAIA 3JSMA 4B3TF 1WEXA 2BQUA 2N4CA 4O23A 3I5AA 1JXLA 3CULA 3UD4P 2J6SA 5RUBA 7FDRA 3R1LA 1R8AA 2I5JB 2ILZA 1YZ6A 1SUQA 2CPXA 4ZP6A 2XM3A 3IA0A 1L3TA 3KWMA 1S9EB 2HVZA 1UZHA 1VR6A 4P74A 3W61A 1NJZA 2CWKA 3MF5A 1B0PA 2XMTA 1D8ZA 1S79A 1C0TA 2E7VA 1VMBA 2DNZA 3MFHA 1WKLA 4QR1A 4AQYF 4FPIA 2DR5A 1X5PA 3LA0A 3RJMB 4ED2A 1TKXB 4I68A 3WX8A 4C0HA 4JI4J 1XR7A 3LGNA 2DY1A 3IP0A 5K8MA 5KG2A 5J2NA 3QRRA 5ITHA 2IDEA 1NK9A 1NM2A 1URRA 2YKNB 3DLKB 3AQOA 4ZPTR 4AUKA 1ZBTA 1O6XA 3IN5A 1N32F 2KRRA 4DL2A 5JMNA 3CDBA 3FNNA 3HMJG 2DYAA 1TTHB 2DRDA 4DEZA 3H25A 4OX9F 4LF4J 4K5RA 5IC6B 1OY9A 2J76E 2FZGB 3D67A 1FE4A 1HD1A 3EDQB 3EMTA 5CZVA 1XC9A 2UU9J 1U1NA 3PZPA 3AH6A 4ZJLA 2FDNA 2IDLA 2X3DA 4DF8A 3CE8A 2NSBA 4KO0A 3ZO7A 4DL4A 1LKZA 2J6TA 3SCLE 2XY6A 3CD5A 2PN6A 4F4XA 3SQGA 4UTGA 2JEFA 1B4SA 1L3KA 3R7BB 2XHCA 2P9EA 2XWYA 4LF1A 2D74B 1TVRA 3TRGA 2BR0A 3FEYB 2QL9B 3CJKB 3DLGA 4KFBB 4C8ZA 1CLFA 1J2VA 2QGFB 1PYSB 2V8GA 3EICA 5T7LB 4KRWA 4TY8B 5F8IA 3VAKA 5DDRC 1T9UA 3OFGA 4DSEA 2FJXA 3D6MB 3LP0B 1WKJA 3ITHB 2DGUA 3D0HE 5FJ4A 4OV1A 2HGNA 1S0VA 3MDFA 2BJDA 3RGIA 3HVTA 4DR2J 2G0JA 4DL3A 1N0VC 2WK4A 2QEXS 1FDDA 5E2QA 5B0DA 1F5CA 4CYUB 2GZOA 5HAOA 1QTMA 4NA1A 5IOLA 4WFAQ 1URNA 1R8PA 5IT9U 4RW9B 2MTLA 4RX6A 4C6AA 4C8LA 5C25B 3CW2C 4L76A 4W98A 1RTJB 5C2CA 2CPYA 4I0WA 2RH3A 3PYEA 5U47A 3T5KA 2PFFB 1KVIA 1C4CA 2QC3A 1N32J 2OEJA 2MB0B 3D6TB 2IJNA 2BJ1A 1B7YB 1S99A 1JQGA 4DQQA 5L9NA 1FDAA 1RT3B 5BR8J 3IFEA 2Y8YA 4KH1B 4UY8T 2DK2A 4MK7A 2PC6A 4CLSA 2VONA 2IC3B 5LT5A 2CJYB 2YKAA 4KGXB 4U67Q 3HDSA 2FPHX 1VLYA 4FF3A 1TL5A 2IY5B 4OX6A 2XYHB 4PPZA 3A8IA 4N47A 3QRPA 3UVJA 1SKSA 1F3FA 2HWHA 4N5SA 2P6SA 3FBEA 1CJTB 3DLBA 3IAM9 3KLFA 2HQCA 2MLXA 3NOGA 4LBHA 5D0GA 5C24B 2FB0A 1XNRJ 1TL3B 3GIJA 5ETVA 1HBMA 3BN4A 1Q8LA 3QGIA 2UXCF 4CP5A 2AEJA 3BGRA 1T3NA 1K0TA 3H98A 1MU2A 4QWCA 4CM2A 4GKKJ 1NXIA 5D4PA 5E5NA 3BQ0A 4ER8A 3CDUA 3JAMY 1RCOB 1HBNA 2P2CB 2QLBB 3DM2A 1RA6A 2D9PA 2DISA 2OPQB 2DH7A 2PO4A 4TYAA 5E3RA 4MMOA 2KJVA 2HWIA 1EX8A 3LPEA 4GC7A 3TJ9A 2DIUA 3LF0A 2VBWA 5EHHA 2IA6A 1FKOA 3Q0AA 3DMJA 3ISZA 3GYXB 2J5AA 4WFNQ 1IUJA 3EGNA 4ZPDA 3K5LA 4CO2A 2DHAA 4MKYA 3LH2S 1UAWA 1S6PA 1HNZF 3O5TB 2Z58B 4P52A 2CDQA 1DTQB 3T1YJ 3EZ5A 4J9UE 3WIVA 1HQEA 1FNOA 2FJEB 2KXFA 3LTOA 2YQ1A 1S1VA 2R4FA 3CSKA 4P2XA 4O4GB 1RAOA 2WHOA 4NI2B 2XZDB 3TZWA 5LSRA 3AJ1A 1IKVB 2GVZA 2HGMA 2YPYA 4URSA 2LXFA 5BJRA 1U1QA 4YY3J 4U8VA 1HPZA 3DGVA 1TUVA 3D2WA 1QVGR 3OL9A 4MFBB 1V3SA 1M5SA 1RKJA 2GQ2A 2PEHA 4OHWA 2WAQD 4NXNF 5BYQA 2KRBA 5HI7A 2P5VA 3SCJE 1RU2A 4JI7F 2LLZA 1B7FA 1FRJA 2RJZA 3M9OB 2BACA 2EFOA 3NWGA 4C98A 3EGZA 1ZTWA 2KT3A 2OELA 3NEKA 4IG3A 2V63A 3GG0A 1XNRF 5L38A 4PABA 1ELOA 3R3TA 4YB6A 1RWKB 1QUPA 3C15B 2YQ0A 3K5OA 2BW2A 4J91A 2AEFA 2ZBQA 5BYRA 1SL2A 2FTRA 2AYGA 2DBBA 1IKWB 3ZNJ1 1EB0A 1AT1B 3FDSA 4A8KA 3CC4S 3M8QB 4LUBA 2NXUA 3BEGB 2Z2LA 4O4GA 5I3UA 3HSGA 4P7TA 5A8RB 3OSPA 1UVNA 1N5QA 4MKVA 4O44B 2BKOA 2AJ0A 4GKJF 5M2UA 4K7QA 3N4WA 3FQKA 4G1PA 3U27A 2AQ4A 5F41A 1APSA 3PHTA 2JEJA 1ZAVA 2OD6A 1EKSA 2HAIA 4K0KJ 2Y1LB 2J7WA 4HVZA 2XNQA 3NBPB 2YTCA 2X51A 4KGKA 5F8NA 2NLWA 2XNRA 4L3NA 5IV4A 2QA1A 2XYGB 5K9FA 1RWMB 3LP2B 4ZPCA 4Q5VA 1SJ3P 5HQ8A 3MAAA 1NMEB 1ZZFA 4FF2A 4ID8A 2UUWA 4DZDA 3LP2A 1P8GA 3GV8B 2B7BB 3AJDA 3Q83A 2X1AA 2NXNA 4AQYJ 5B0FA 2AYBA 4LF5F 4DPXA 2V2ZA 3C19A 3CGIA 1N34J 1TFWA 2FQQB 2JZ5A 4M1KA 5KT7A 3HPOA 4X4UA 1VS3A 4P2FA 2JLFA 1NNDA 3N6NA 1JLAB 3DDNA 3KLFB 3N6MA 4ZCLA 2CPFA 4IDKA 2JC1A 3G8SA 4P71A 2EFGA 3K5MA 2CPIA 1HBOB 2RS8A 2RDIA 2R7UA 4KAIA 3M6WA 3MEEA 5F8MA 3GWCA 3I9ZA 1DBDA 4WKYA 1VRUA 1N5SA 3D6FB 2KB2A 4OZLA 5KFZA 4DV0F 2O66A 2BUNA 2MLZA 1X8DA 2I6WA 4DUTA 4KV8B 5ADZA 4ECSA 5HP1A 2FVQA 3SZ2A 3RRKA 4OX8A 1RT3A 2RE1A 2M8HA 2Q6BA 1KWMA 2DNRA 4ECWA 2HYIB 3MM8B 5KT5A 1L5UA 4BS2A 1FRKA 4QW8A 2AHOB 1U1PA 4HT5A 4WCEQ 4WK1A 3IBCB 1IKXA 2B9WA 2VPXB 5A6PA 3CMAS 1K73T 2AGOA 3D1QA 2W4PA 5LMUJ 3ENVA 4K0KF 3HFZB 4FDFA 4MIAA 3JYTB 2GX8A 2CPDA 4I6AA 2MHEA 1Q86T 1VIXA 4OMFG 3IM8A 4WU2A 1SC6A 2D41A 5B0GA 4DG1A 2LECA 1YVFA 3NY0A 2HVHA 1KOHA 3CDWA 4Q2LA 5HBMB 1RTHA 3SFGA 3MMBA 2ZUGA 2LEBA 2RF2B 5C5JA 2LDIA 3HHLD 2UUTA 2BANA 3WIUA 3BKUA 1VQSA 2OJ3A 2LDYA 5FDLA 1RUSA 1GTHA 2LP4A 2CVEA 4KGMA 3SSSA 4TQSA 2QA4G 4ZLJA 3T9NA 3OTOF 1WHVA 2G9OA 2WOMB 4XDDA 3M8WA 2LYVA 3IRXA 1T03A 1LK5A 2H9ZA 5IC4B 2R42A 4Y6IA 5M2RA 5E33A 2O01C 3BYPA 3EUNA 3ILJA 1U6FA 4P10A 4WIQA 3NGDA 4DQRA 1CJUB 5GMEA 3BGOP 4YR2A 3HHLA 5KFVA 1FJEB 2OPQA 4JI1J 2XG8A 3W65A 2H5JB 3D68A 1WF1A 2CG8A 3LWLA 5J2PA 4HT7A 3KLVA 1CSJA 2IYIA 3PX6A 1NHKL 4BLGA 2AV5A 2MGZB 3KNGA 2BVZA 4MAKA 2Z4PA 4ZP7A 1B3TA 3EZOA 1P27B 4LBIA 4J9KA 1UWAA 2Z2MA 3D0IE 3CD6S 1KDNA 1DLOB 3HULA 1WOSA 4X62J 2BKPA 2F9DA 2FUG9 4WYLA 3SYZA 1KP6A 1ICEB 2HQGA 2QMXA 1FWKA 1VK3A 1FTCA 5ETKA 1UTAA 3NNAA 4K4VA 4Y34A 1S6OA 5DM6Q 2F4VJ 4UOFA 1H72C 1YTYA 2OTLS 2VPZB 3FGVA 5KTQA 1DHMA 4USHA 4ZOSA 2CKWA 2DPJA 3JSYA 4DV7J 2F63A 2OSRA 2K7JA 2L9NA 1JLCA 4KC5A 2I38A 4NLTA 3MEGA 1RDRA 1FI4A 4F4YA 4WTOB 2L9DA 3L7OA 3HP6A 3QATA 3CT9A 2HAFA 4OX9J 2CA9A 3T1AA 5DQIA 1S6QA 5K8PA 5CAAA 4RUCA 1FFSB 2FZKB 4NMLA 1SH0A 4E0DA 4BCAA 4B3RF 1YRTA 2HQ3A 4O3NA 3MM7A 3GIRA 1IXKA 2K8GA 4H4OB 5KG4A 3TR5A 3UE2A 3TZYA 5KFEA 1ITPA 4YS2A 1BMQB 2NUHA 2N3LA 3DOLA 3PEHA 1UA1A 2OSQA 2OPSA 1N52B 2YNHA 2RS2A 1RTDB 1QSLA 4Y3CA 5DZ7A 4QWBA 2VG5B 4PQAA 5D4NA 2IVMA 3FCVA 1EJ7L 2AJ2A 1XWLA 5L1LA 4DV4J 4C8NA 4WF9Q 2M3DA 4L74A 1HHQA 2U2FA 1UW9A 2I0XA 4OL8A 4CIOA 2J0WA 2MQ8A 1T9XA 2RMLA 2XHWA 1RT6B 2ZE2A 3WX4A 2QMWA 3DRSA 3MI7X 4UZCA 2Q3PA 5HLFB 3DLGB 4KFBA 4TU9A 1Y3KA 1RT6A 4MYTA 3PYFA 4NCGB 2JFKA 2V4JA 2E9ZA 3G82A 5A2QU 3MMCB 2OMOA 2C28A 1XR5A 1YJVA 1I1GA 2G2OA 1WORA 3V5RA 5SZTA 3QWUA 3MCSA 3VVUA 1UVJA 3E2EA 3TNVA 1HNIB 2HFOA 4IFVA 2G1DA 5DS7A 2C1EB 1RYSA 3MR7A 2OPSB 5K14A 3EVWA 4ZPBA 3FBCA 3UO0A 1S49A 4DDFA 2EFPA 4UOHA 3QFHA 4UUXA 5A0YB 2Z57B 3KJVB 2CIMA 4DPTA 3KK3A 4E8UA 5LXRA 4NCBA 1WC4A 3RB0A 3BGUA 1X0PA 2F40A 4QWEA 3KK2A 3OR2B 4WE1B 3M8ZA 5D78A 4DOZA 3LAKA 4Y2CA 3RBZA 2FVCA 3MECB 5A8WA 3VAJA 1K9MT 1RTIB 4DLEA 3H2LA 1PJ6A 3W5ZA 4DFJA 2KZZA 4X2BA 2NYIA 2IVYA 3HVAA 4HACB 4NASA 3C66A 4QBUA 5CCMA 5IT0A 1L3UA 1VDHA 1RHQB 4WU3A 3P45B 3TYTA 4RU9A 4OI6A 2VOPA 1ROFA 4F50A 1WG1A 4X4NA 4PKDB 1ZZNA 1NPKA 3SV4A 1AA1B 2PA8D 4DV1F 4B9LA 4EUVA 2FJBB 4OHZA 1Y11A 3VR1A 3FRYA 1N4LA 3HHNB 5E0OA 2D7SA 4LF5J 4UUWA 4DR1J 1FRHA 3MOZA 2ALZA 2UUBJ 3N0VA 4F8RA 5GAHI 3GFXA 3KK2B 5ETTA 4CDIA 2RDDA 4WZQA 4X65J 2DXFA 1NJYA 1T05B 3FRZA 1KKHA 3D6HB 3PYGA 4IH6A 3VGVA 4Q8EA 3GJQB 4DL7A 4I7FB 3V4MA 3V81A 2I2YA 2YKMA 5FIIA 1Y7PA 4Q0BB 1HNIA 4OYPA 5B0AA 2CJKA 3R5JB 2HHUA 1FRLA 3B4DA 1XQIA 3R8YA 1HFEL 1T94A 2NQPA 2HK3A 3I87A 1NHUA 4M94A 3C6UB 3D5MA 1S1XA 4M63A 4OJ1A 5H9EK 1XMQF 3FMWA 1VGYA 4HEA9 2DGSA 4OYIA 1W7WA 3U1LA 3VAFA 1WSVA 2K7KA 1TAQA 5F0UA 2XSFA 3ETOA 1DURA 2QL5B 2J9CA 1HBUB 2W01A 1VQOS 1IWGA 1KC8T 3UFCX 3BH6B 3AODA 1VRQC 5HATA 2FYXA 4NZ0A 3R1HA 2BANB 1LFWA 4K59A 5CYMA 2E5LF 2DGTA 2ZC4A 2B4UA 3QWPA 3SDEB 1SBRA 3POTB 2CG4A 3DOLB 3OVAA 3MUVP 3Q23A 1M1KT 3C6TB 1C0UB 4XAKA 1FX4A 3C46A 2W1BA 2ZZMA 3RAQA 1F6TA 3OR2A 4M5IA 4WE1A 1D1UA 4JV2A 5IV3A 1GXLA 2PMHA 2X1FA 1N33J 2XI3A 1SQEA 3MZIA 2C2DA 1NJWA 1RT4A 2UUBF 6AT1B 5KFQA 1REVA 3L9ZA 1IKYA 1SJQA 2CNNB 4BC9A 3KK3B 1KR4A 4J9QA 2DPIA 1GH8A 3GJSB 2X7IA 1UFLA 1WC6A 3M6XA 1BUXA 3H8YA 3QAUA 4A47A 1N36F 1L3SA 1VQ9S 4ZK7M 1NHVA 3IR5B 3HHEA 3AOBA 4J9LA 1RTZA 1RT5A 3AA8A 4KYZA 2IM0A 4ZN1A 1VISA 3AFGA 5GADI 3MMCA 2RDJA 1MWYA 2VIHA 2QT7A 1NB2A 2MKHA 2RQKA 1ACMB 2C42A 3KDOA 2DHGA 1FK9A 3JQKA 4OZJA 4DPUA 2OPPB 2V4RA 1NSPA 1X4BA 1RT7B 1TK0A 1S7IA 1LOUA 2ZVSA 4YDDB 4QU7A 5KG6A 3GJTB 4JB8B 3DU6A 4DPYA 1EHWA 4F02A 4IDKB 1HYSB 4KSEB 2XZTB 4LSNA 3DDKA 5KG7A 4TY9A 3M1VA 2GIRA 2RIJA 1UVKA 2EG1A 1MMDA 3C14A 1E6VB 2BMBA 2EC2A 1Q95G 2NSCA 2B56A 4TN2A 4CH7A 3L95X 4NEYA 4QQBA 1IWAA 3W2WB 3QGPA 1RWNB 1RWWB 2GS8A 3KJQB 1T9TA 1HA1A 1Q4RA 1GXUA 1R0BG 5L39A 3M2VA 2EFQA 1RBAA 1H73A 2ZOMA 1S97A 2C3YA 3NNHA 2FVSA 3P6YC 3QPIA 1WSRA 5DETA 3HZGA 4DWIA 4IKAA 1TL4A 3FKBA 1QSSA 3MEGB 1RWVB 1LW2B 3Q86A 2RAQA 3F56A 2MSSA 1TL1B 1NO8A 4ZN3A 2V9KA 2P9GA 3D9BA 4IO9Q 2GJFA 3GONA 1S0OA 5FDLB 1LWEA 2M52A 1RHKB 1I94J 1DTTB 2KO1A 3B82A 1NK4A 2HWTA 1TV6A 4GVBB 2KKHA 4RPFA 3Q8PB 4JUZA 1CQMA 5C2GA 2BV3A 4X4QA 1HNWF 5ETLA 3KLEA 1U6ZA 3LWMA 4RW6B 2B5JA 2HQDA 5D0EA 3M4XA 4QWDA 4QIEA 2KHCA 1EP4A 3DGPA 3C3LA 3IBFB 1QTNB 2XC9A 4DV4F 3BH7B 2WVCA 1O5JA 2E7XA 3VCDA 4DR6J 1NUEA 4JV0A 3B54A 3DLHA 1WDTA 3CDAA 4R0JA 4L6V3 4ILMA 2RKIB 1CG2A 4IO1A 2IA0A 4X4RA 1ZAWA 3GCXP 2QA4S 3L3CA 4RUAA 2W9CB 2V2VA 4Z7YA 3QT8A 1EP4B 3M05A 3UCGA 1JLGA 1HPZB 1PKUA 3LUYA 3M6VA 4H54A 3ZZRA 3FC9A 1IBKJ 3BKTA 3QAEA 3HHLB 5KFTA 4WP8A 1OJ4A 2BE2B 1RAAB 4X66J 4F0HA 3NMAA 2F9JA 1S1VB 3R5GA 3GTYX 1Q53A 1G2EA 3QGHA 3TX0A 3GYNA 3HD2A 2JVOA 3CDEA 5THWA 2YKQA 5HJYA 3HZEA 3PJ9A 2EPIA 4M5LA 2PA3A 3HT0A 3NS6A 1JXEA 3KYLA 3EM1A 4NE9C 1DQAA 1WF0A 3PRVA 2H54B 2HNDB 2R9LA 4JI5F 1BE4A 3CEDA 4HHJA 4OV6A 2FHJA 4NYPA 5HQLA 2HLTA 2YX1A 1H7XA 4DXLA 4ZVOB 3NWRA 3CPWR 2UVUA 4JI0J 2C3OA 4DG1B 2E5LJ 1S1UB 3B6BA 1S76D 1HBNB 3GB0A 3R6LB 2N3OA 4K8RA 2KFYA 3MR2A 1MNEA 2BDPA 1B0VA 1JLBB 2ILYA 4RNMA 3OQ2A 4HL9A 2RUSA 1BQMA 5ETPA 2UP1A 3MR3A 4H4MA 1WC0A 1LWFB 3W5YA 2XS5A 4LQ9A 4ELUA 2F4FA 4X4VA 5I42B 4B08A 3GG1A 3L7PA 3M1VB 4NA3A 1VQPS 1B64A 1VRTA 4RNOA 1FVQA 1OIAA 2AW0A 4FXDA 1CJTA 4HHHA 2HK2A 5F8LA 1X0FA 4ELTA 2LXUA 3UN3A 5AE3A 3JQMA 4NLGA 1F3VA 1C1BA 2VG6B 2H1YA 2WBRA 1Y5LB 3HJVA 3CJ2A 6FD1A 4DV7F 2COLA 3DOMA 5KG0A 5IFMA 4J9MA 4USJC 1LQ9A 2J8SA 4M5KA 2IC3A 3DHWC 2YWWA 3S8SA 1WI8A 2AYEA 4DV6J 2N7YA 4OJGA 3TVZA 3UNYA 5KFNA 5DM7Q 3V4IB 5G4DA 4YOEA 1NSKL 2YKPA 3AT1B 2J0XA 5KFAA 4CLZA 2W9CA 1IJFB 4K4SA 4F0KA 2XLIA 1UJ5A 4EBEA 2HHQA 4EU0A 4ENOA 1RWOB 3TEHB 2W7PA 3BPDA 2R8JA 2VASA 3W62A 3BSCA 2E44A 2WZ1A 3JXOA 4TKTA 4C97A 3W5XA 1TELA 4K50A 3TAPA 4JI8J 2CQ2A 5ETMA 1S1UA 2HRYA 3CJ3A 3BO3A 3RRGA 4DL5A 1JKHA 1UZDA 1YSJA 2DNYA 1WJ9A 1RWUA 5AXKA 3R9LA 3OXGA 4A8FA 2CPEA 4DL0C 2VC0A 2ZZTA 3OW2R 2CDRB 3BBFA 3FEZA 3UDCA 3J81Y 3MM5A 5T14A 1BQXA 4PXBA 3UCUP 1YJUA 4IRDA 2PI4A 3PTWA 3CJTA 1HBUA 2GNKA 3DRYA 3AD9C 3GSDA 5J2MB 3M32A 3KLGA 1KQKA 3R97A 4C9DA 5GMDA 2KFNA 2ZBIA 4J90A 1VLOA 2Z0GA 1DAXA 5F9NA 3H5YA 5T7LA 2ZHAA 4ECYA 3D4JA 2R7SA 3QO9A 3LO3A 4NLDA 1NDCA 4UW2A 1H38A 4PWDB 1S12A 2HVEA 3C6UA 3GFHA 5DQHA 3B4MA 2HZVA 2CQ1A 2CQCA 2IIHA 2VFSA 1R6YA 3BSAA 2OFHX 2CNKB 3Q8QB 3WBZA 3WDOA 2R2RA 4DV6F 2KYXA 1WD6A 3PRDA 1EQMA 4B9MA 2ZITA 3SQOP 2XLJA 1TL7B 3TARA 1CJVA 1QY7A 1HW9A 1QDUB 2SXLA 4LSNB 5F3TA 4E98A 5A2QY 1C4AA 1GAOA 1WC3A 5KFCA 2M0GB 2ZJQQ 3AXMA 1KTQA 2B5JB 4RWWA 2ZJRQ 3CCLS 4KQZA 2CJXB 3HHKA 3PDNA 2R8KA 4CLLA 4EO8A 1NPPA 4JV5J 3ILLA 1TV6B 1XK8A 3H20A 4GVBA 3KK1A 2Q66A 4PQUA 1R8HA 2CPHA 1U0SA 2KJWA 4IQMA 2MQNA 4R8UA 1QE1B 5L46A 4A8WA 2VDHA 4ZVHA 3MEKA 2PT0A 2CADA 5IQ6A 1EIYB 1KN6A 3M9MB 2V69A 3FFIA 1NJIT 4DR4F 1FDBA 3SEOA 5L1IA 3VZIA 3QFWA 2HHVA 4V1Ak 4AL6A 2ZWOA 1GMWA 2DH8A 3N28A 4MT1A 3MOJB 4CO5A 2CWXA 4NLPA 4UQGA 3M8RA 3ZZOA 1REVB 1FHTA 3VV2B 2IRYA 3W64A 4ED7A 1Q8KA 3G96A 4ED3A 1SJFA 2BRKA 4E2FB 2E1AA 1DJ0A 1G7CB 3GZ7A 4EFAC 3KTQA 5HVGA 3M2UB 1HHSA 3QIDA 2HMIA 2F5GA 5IT4A 2G2YA 2UV8G 5KFJA 5LOQA 3RZAA 2Q6CA 2R3VA 3POTA 4USIA 4K2XA 4ANDA 1IBLJ 4CNYA 4DSKA 3R5AA 3JQJA 5B7WA 2POKA 2H3EB 2DHHA 2HNDA 2ROPA 3GSIA 1VC5A 5EN1A 4Q2MA 5C24A 1NPRA 2VFUA 3P96A 4RZRA 3X3UA 4ED4A 4JP8A 3LP0A 1T9WA 4JOUA 4UOCA 3ZTOA 1Z2LA 2HS0A 1X4AA 3GP9A 4C3MA 3KLIA 3PYDA 4BWJA 4C11B 5B0BA 1JMTA 3FZ2A 4R25A 3CMQA 1YJTA 5IWAF 1AFIA 3RRHA 3OBIA 4L73A 4PYDA 2BW7A 1BY9A 4JV5F 1UETA 4X64F 1Z2ZA 4U7UK 4TU8A 1HIYA 2GMHA 4AYBD 4OZ1A 3MD3A 3BPSP 4EMDA 5GAEI 2GHVC 3FSIA 5D15A 3HI9A 3I0SB 1UVIA 1RTDA 1SJ1A 2DNOA 3ET6B 1B0TA 1HQUB 4L72B 5IM0B 3KHRA 3HSDA 2VC1A 4RW8A 1R3NA 4QW9A 4HI1A 1T8EA 3ELHA 1JWWA 2WVFA 3QIPB 4DR1F 1HWKA 2MQMA 2KU7A 3A13A 4B3MJ 3EYZA 5A6WA 4ZJOA 1WI6A 1HI8A 2WW4A 1A7GE 2F7VA 2YWKA 2V6AA 3PM9A 3VWSA 3CC7S 1UPPA 1D0EA 1FD8A 2B8QA 4CNZA 3JTPA 1RB0A 1TU0B 3DYAA 5LL6d 2FLPA 1QVFR 3DXBA 2YH1A 2OH2A 3HVTB 4USKA 2MJNA 2WBMA 2LMIA 5E3CA 5HMWA 2R7WA 2WSFC 2IM1A 3BBCA 1N0UA 1HNXJ 4NMXA 1JLQA 3SSQA 1AUSL 2VQEF 1FEEA 2C22A 2YPZA 3BBBA 1XTZA 1YITS 2JWNA 4J9VA 4YDXA 3NNCA 2F4VF 3QLHA 1EQ0A 3OVBA 3CJKA 1RTIA 4AFFA 2DO4A 3Q8UA 2V68A 4IUFA 4CO3A 2VPYB 5AE2A 3M2VB 3MM6A 3CIZA 3AHPA 1GTEA 3HD1A 2F1FA 2BE7D 2HRUA 4IH7A 1U09A 1VQ4S 4LF6F 4G65A 1OWXA 1IBCB 2ZBRA 3KJVA 2E29A 3W9JA 2K3IA 1HQUA 1WHYA 4CTAB 4Q0BA 3PFEA 4A8SA 3UD3P 1ZS6A 1YRUA 3VAMA 1E6YA 4CTAA 3OLBA 3IS9A 1SIZA 2VUGA 3E01A 5LSLA 1HYSA 1S57A 3MMAB 1LWCA 2JX2A 2NXJA 2WVBA 2YKNA 3MR6A 2Y0SD 2M8DB 5F8JA 4PCQA 4ERDA 4X4TA 1U1RA 2D69A 2YWGA 4KBIA 3QLHB 4B3TJ 3DRSB 5HLFA 1WHWA 3I55S 1V5VA 3Q22A 4DQPA 1A9NB 1U0HA 1YJRA 3UD5A 4J9RA 1X31C 5CA5A 2W2NP 1JLQB 2PDAA 2OFGX 2MQQA 1N36J 4N56A 3QZ8A 2ROEA 4K5SA 3NAHA 4IRCA 2L3MA 2JEGA 3CCJS 3HSZA 5FD1A 1FWLA 1K0VA 1KFDA 4DX5A 1ZPWX 3K59A 2QN6B 2ROGA 3MWBA 4G6VB 2ASDA 2C2NA 9RUBA 4B9TA 4ZHRB 1RAIB 2ACMA 1N88A 3DDIA 4CLKA 1WG4A 1VQMS 5KFPA 3KDNA 4OQJA 2K1RA 4N8OA 4OI4A 3ADAC 3W2VA 4DR6F 2GIQA 4EYHB 5K8NA 2RUGA 1SB6A 1TUWA 2DEIA 2CJQA 5KAKA 4H4KC 2DXEA 4F4ZA 3BREA 1U49A 3LQVA 4EWTA 2PSZA 4RUHA 2UXBF 3PR5B 1HWIA 1YBTA 4RW8B 4FF1A 2DGQA 1IKXB 5KG3A 2CQHA 1UW4A 4P73A 2JL9A 4RL1A 1LW0B 2VU5A 3NGUA 2VQFJ 3BZQA 2U1AA 1RADB 2CPZA 1WELA 3M30B 4NLSA 2W8KA 4X84A 4HI2A 3HM9A 1QE1A 4TNOA 1FRMA 1TKTB 4WTYA 1RSCA 1C2PA 3OHBA 1PBUA 2V4JB 1CJKA 3DLEB 3ZZTA 2MQOA 1YI2S 2CYYA 3IO1A 5G0RA 3VGUA 3KK1B 1FT8A 3KG0A 1N48A 3KLIB 2QLFB 1RHUB 4NLVA 4DX8H 4X62F 1WC1A 2MY7A 3O44A 3T19A 4EZ9A 4OI1A 2I1RA 3O8WA 2ZH5A 2ATCB 2LQ9A 2DJWA 2HNZB 3ILOA 3T9ZA 2QSFA 1IR2A 2H4YB 2DR6A 3EX7B 4ECXA 4N41A 5K20B 2XMMA 1RA7A 2DB1A 1OY6A 3WC2A 4IFYB 4W92B 4DL6A 2AYMA 3DC2A 4ZCIA 1NK0A 1QAJA 2DR7A 1J27A 2QZ8A 2P9CA 3A8EA 3CTRA 4J9SA 3UR0A 3DRXA 3QNWB 2IJRA 4ECZA 1DARA 4DMZA 4FVCA 2XSJB 3AQPA 2FY1A 4LF8F 3CCQS 3MPWA 1XMOF 2VJVA 1RAEB 3FSXA 4JI2F 1KSPA 2IAJB 3S1TA 2JFDA 4C2MA 3MAQA 1G1XA 3VAHA 4OHYA 2LA6A 2OHDA 1AFJA 4XPCA 2FJAB 4K4ZA 4ETXA 4L3KA 2HS3A 2QSWA 3D1HA 2WOMA 5E3AA 4QIWD 3CC2S 2I9SA 4HH0A 3MXHP 1YJ9S 2B9YA 3M8PB 3AA9A 4C0OC 1F9HA 1NBEB 3MM5B 4A8OA 5E41A 3QQCD 4XK8C 2F3JA 2BJEA 4TLRA 4W90B 4PUOA 4K4UA 4IR9A 4P9SA 3UI3A 1M1HA 2C2ZB 1RTHB 5AT1B 4LFBJ 4ZP8A 4QYZK 1Z1ZA 5HVHA 4CCHA 1T7PA 3FQLA 3S6EA 3BR9A 2F8HA 1JLGB 4L75A 5KOWA 3DRRB 2Z2ZA 2P8IA 1YX2A 3FMBA 4M5NA 7FD1A 3JYTA 5AXMA 1GT8A 1RGVA 1U1LA 2IBKA 3RUBL 1KTVA 3J7AN 4PXDA 5IM0A 5C42A 2WRMA 2XGQA 3I56S 1S1WB 4KPCA 3MPVA 1M5OC 2CZ9A 3M2RA 5I3QA 4ECUA 2B43A 3A8KA 4OYMA 2C2RA 4J5OA 2XB2D 1PC4A 2GJ2A 2GO8A 3HLUA 4O0NA 1SC3B 4ITSA 3T5HA 1NLKL 4K4TA 1MSWD 2NUUG 1F5BA 5LXYA 4XPEA 2LU1A 1YBUA 2RRAA 3K8VA 4C11A 2D3ZA 4PG7A 2HHHF 4EI2A 4RJVA 2N4DA 1W2BR 1RK8A 1CS4A 2HIYA 4KKOA 4JI2J 3J7YI 5J1EB 1JXVA 1R27B 4WBFA 5B09A 2V8VA 2HHHJ 1RZMA 4NZ6A 4DSFA 1GQEA 5J2QB 1JLAA 4OIXA 5KFOA 1S0NA 1H98A 3O6QA 4HTJA 1N56A 3GYGA 1PO6A 3LANA 3WZ0A 1TKDA 1HL6A 1DY3A 3J7Z5 1NU4A 2RF2A 4OYAA 5HROB 3DFEA 1SJRA 3GJRB 4EYIB 2B4OA 5JUMA 2FHMA 1DQ8A 2G2ZA 2ZC3A 3MM7B 4H4OA 4WP9A 4O3SA 1FEHA 4OYXA 1T02A 3OUYA 1QLNA 4JYAF 1F1BB 1MW7A 1WDDA 1QAIA 4D3GA 3TO8A 1U8SA 1U24A 2PMWA 4FYXB 5KT2A 5D3GA 3BGRB 2KVIA 3TANA 2NCKL 1FNMA 4BC7A 4JI6F 3HF5A 5KFRA 2DXDA 1HWUA 1T11A 2MHNA 3FFIB 3N6LA 2RQ4A 4MJKA 1UL3A 1S6UA 4YR0A 2CJ9A 2ZDPA 3FUYA 3RU0A 2B7CB 3VGSA 2W2QP 4ZLNA 2YWFA 3NGKA 4QR0A 2BBEA 2FIUA 2GVDB 1N6QA 3CD7A 4DBQA 4Q43A 3BSOA 2KDOA 2MKIA 1NH8A 1NKEA 2QLXA 2HBRB 5I3UB 1HARA 4JV1A 2KL8A 5F8GA 1N6QB 4RNNA 2GVDA 1F60B 1VBXA 4Y2MA 1TK8A 1FWPA 2V8DA 3UR3C 1GXTA 1U1OA 2UXDJ 2B9XA 3O3LA 1H2VZ 1Q81T 1EARA 3EJMA 3A12A 5E7OB 4O4RA 4JI4F 2ZH1A 4CRJA 5KFMA 2KTQA 1JNZB 2FHJD 3HKZD 2IVFB 1MROB 4EO6A 4DUZJ 2RKIA 2G1HA 3DXSX 4OJ3A 1S1WA 1S9FA 1RT2B 2MZSA 2WB4A 3AOCA 4F4AA 2F65A 4ZKAA 1VQYA 2MKKA 3HSJA 2BQRA 4NYZA 1A6LA 4PG6A 2DVIA 4FS2A 4WPAA 2JC0A 4ZIVA 4NEZA 2VL1A 4ZA1A 3RBXA 3CXCR 3I6PA 3JAMU 1U4BA 1K44A 2HSEB 5KOXA 3BQ1A 4LRAA 4ICLB 1F9FA 4NI2A 2XMVA 2Z2YB 4RO0A 1KQGB 2QLWA 1WKKA 3UN5A 1DTTA 3Q8YA 1CULB 3QSYB 3HO1A 5SUHA 2ZH4A 4O3RA 4UF4A 1FESA 1DTQA 1N34F 4I6WA 1FXDA 2DGOA 4ZLPA 4F26A 1MLAA 3ONQA 3PX4A 1CS4B 1CULA 2VBZA 4U95A 1BLUA 2RB7A 2UXBJ 1RACB 4DZ6A 3NKYA 3BM7A 3N5FA 4GKKF 2WVEA 4CT8A 1RXOB 3DRPA 5HBMA 1AXQA 3PIOQ 4YB5A 3G9CA 2X1BA 2B4PA 1S77D 2FD2A 3K5NA 2H4WB 2LFVA 3SFUA 4AL5A 3TZZA 5BYSA 2FZCB 1GK8A 3TA0A 4NLWA 4HDGA 1Q5YA 2QYCA 4Q44A 4DLGA 1ZA1B 2R7TA 4DV5F 1VIOA 1RHJB 2VH7A 1OPZA 1UWBB 3FBFA 2R7OA 2HS4A 1TMJA 4ZVTB 5HJXA 1CEZA 2V67A 2YNGB 1UEVA 3JTNA 5DG7A 5HP1B 4NXMF 4F4KA 1Q8IA 3ZC4A 4QOTA 1WOPA 1IKVA 5LMUF 1X9SA 1R43A 5IQQA 1HW8A 3SCIE 3UVJB 1JIHA 1IQZA 4OJHA 1ZH5A 2R8HA 3EXCX 4UOGA 1P9QC 3GCWP 1RP5A 2AJ1A 2VG6A 1OYDA 4PG8A 4WFBQ 3CCMS 1HQEB 3HFVA 2HURA 3D3CJ 1M5HA 3MEDA 4RUBA 3TP2A 5EWFA 2VHGA 2E7WA 3JTOA 3QRQA 2EWHA 4LR9A 3S01A 1TL1A 2A1BA 3M30A 4C8OA 1X5SA 3BDPA 4XIUA 1UPMB 2EEYA 1Y5IB 3BJYA 3PKYA 3KLHB 1FJGJ 4WYWA 1LXJA 3OD2A 3NMRA 1RYRA 1RAJA 2I5JA 4ZVGA 3CCVS 3QT7A 4ES3A 4NPOA 4LF6J 2Y9HA 4YFUA 3Q8RB 1NDKA 2JH3A 3D66A 4Y2KA 2KI2A 5KFDA 1GX6A 2MXYA 1XNQF 2H5EA 2KG1A 4B9NA 3DLJA 3OUYB 1VQ8S 2UXCJ 3D7SB 3MAAB 1O0PA 1QAXA 2C2MB 4FP9A 4J7CA 4YB7A 4ATNA 5CHCB 1JLFB 3I5CA 3EVOA 1V6HA 1I6JA 4LF9J 2HHTA 1PIEA 1M5VC 5J1PA 1K1SA 4B17A 3DCAA 3OTDA 1GX5A 3FEXB 1KLNA 1WHXA 2F8MA 3HVWA 4NYOA 2FHOB 5M2PA 2DR9A 3HHLC 3N79A 4K4YA 1EZZB 3G82B 2Y1JA 5J1EA 3CCZA 5KG1A 3QT6A 1NK8A 1RT7A 2ACYA 4B3MF 2KVQE 2OAUA 1NH7A 2HQIA 3TUIC 3M7VA 3ZXWA 1TVRB 1HWLA 2HKEA 2LEPA 4LIWA 1NK5A 4LQ3A 1X60A 2CAJA 3RW7A 3W3SA 1PILA 1PJ7A 1O8BA 1TKTA 4G1QB 2J8AA 1T95A 2J9EA 3PJWA 4KR0B 2M5YA 1UJ4A 4A46A 4RKUC 2D3OR 1X9MA 4OYWA 3RR7A 2DRAA 3M2RB 3NXZA 3W9HA 1UKUA 1LW0A 3DNCA 2YNHB 4NXNJ 1WTFA 1I51B 1IKYB 5CQGA 3RTVA 1YJ7A 3CCSS 3P3DA 4QWAA 2IYGA 4CLWA 1NEEA 1NJXA 4FKXA 1VCTA 1FERA 1IR0A 4QPXA 5KFGA 5J2NB 2BRLA 4OYOA 3SDEA 3QJPA 5B08A 2B0GA 2BJ8A 2KT2A 2K3KA 1LWEB 4GVLA 1U45A 2FVRA 3J81U 3GFZA 2XMAA 1EKRA 2OIHA 4I6YA 2MKCA 3M9NB 4WKRA 3A8JA 1KLMA 2XCPA 5FLXU 4C8MA 4ZVUB 1U7LA 5CZXA 3MR5A 2W2MP 1PBAA 2OD4A 3CJ4A 1HQ2A 2W8LA 2V9WA 4R0EA 3OJUA 2MKSA 3H4BA 2CNLB 2EBEA 2PEBA 3VGTA 1LWCB 4JI6J 1V9OA 3VF0B 2EFNA 3QIPA 2HBZB 4KO0B 2ADCA 2DNGA 2FLOA 2W9AA 2J6UA 2AP6A 4ELVA 1SV5A 3K7RA 4ALZA 3TVKA 4LF8J 1A0OB 4WZMA 3DI6A 3H5SA 3TUZC 2BJ9A 4RR5A 1SV5B 1TP7A 4NLRA 4B3OB 2HPUA 4NLQA 2DNMA 3SCKE 4DQIA 5ETNA 4OX7A 4IOAQ 2MMYA 3NRBA 4YHHJ 1SQGA 1XIQA 3CD0A 2CZVC 4KY3A 4ED8A 3VQTA 2E9RX 4QYRA 3ULHA 2A0FB 4ILRA 1FO1A 1X4GA 3F0NA 1YRXA 3TI0A 4JI1F 3ZZ0A 4ZVRB 2WVDA 3KUGA 1H2TZ 1W25A 2MPUA 1T03B 3MURP 1LNQA 3L09A 4CT9A 1R0AB 2Q79A 1D8YA 1JLEA 3TX8A 3KHLA 5BR8F 1FFWB 2RRBA 2QV6A 4I1TA 3GR1A 1YIJS 2VG5A 3T6JA 5IZHA 3EXYA 4DS4A 1CVJA 2YH0A 5H9EJ 5E3PA 5DRKA 3OR1A 2YNFB 3V6DA 4EEYA 1KD1T 2CFXA 3HCXA 5C25A 1YLXA 3SBMA 5MAOA 1ZTTA 2E9TA 3THTA 3T41A 2HBYB 3GIMA 4PAAA 2ATLA 1R8CA 1TZ0A 3ET6A 3IWXA 3R5BA 4F25A 1HD0A 3BGFA 2VBYA 5E3QA 1UCNA 1SXLA 4ZHRA 1BWVA 1Y3JA 2Y1RI 3ETMA 3FZBA 3GLJA 4I2QA 3MM9A 1G6BA 3M8SA 2YNIA 1JLEB 2GC8A 2G13A 1BC6A 4G1QA 4ZLLA 3ITHA 4R8UB 2KYZA 3I82A 2GAHC 4OFZA 4CM0A 4U7UD 1PGZA 1J5EJ 3KFWX 1F9EB 4TY8A 3H5UA 1XMOJ 4P7VA 4PRFA 3HFKA 1Q0NA 3ZFVA 4MKAA 2ABYA 4OHVA 3SI8A 3PV8A 4C8KA 2VFTA 3SQGB 4PXCA 2WONA 2BOPA 3VZHA 1YK9A 4EBCA 1RE1B 2UU9F 3NL0A 4R5PB 3D0GE 4ZP9A 4ZPWR 2E1MC 1VBKA 1IVZA 5DQGA 1I3OB 2VDIA 3H2VE 4ECVA 4B3OA 3KXDA 2QFIA 3K0JA 1RAGB 4I7FA 1SKRA 2EXUA 4NLXA 3R27A 5GAGI 1VQ7S 4LFBF 4DR4J 3R6GB 3ZTQA 1TK5A 4NRTA 5J2PB 2CJBA 2ZJPQ 1OY8A 4J9OA 1YQHA 1L3VA 1RJJA 3CO0P 4LFAF 5FLXY 3K17A 4LRBA 4PWUA 7AT1B 1VOMA 2BA9A 3R7NB 1M0SA 4Y0FA 4USUA 3NBPA 4JI7J 3IGNA 2QRRA 5KFXA 5KFBA 5JVGQ 4WFXA 1F5AA 3CCWA 3M32B 2R7QA 3KMQA 4DR7F 3OTEA 2MQLA 3NS7B 2FC8A 1REGX 2J9DA 2LU2A 4FYWB 4P75A 5HSPA 4O0IA 3J7YU 4DV0J 2C2EA 1XNQJ 3DYAB 3I0RB 1OS5A 4KHMA 2D9OA 1DQ9A 1UEKA 4HR2A 5J1NA 5K5MA 4ED0A 1LEOA 2C2KB 2DTJA 2DKOB 1Y9OA 3MECA 3T3FA 4X4PA 4KT0C 4LSLB 4YR3A 4AT1B 2GMLA 4PR6A 2E66A 3GIKA 2Y1IA 4ED5A 1HNVA 1Z4UA 2RNEA 3GU0A 4OZ3A 5D0HA 5IXUA 2HLUA 1S59A 5I3PA 4QYZJ 1UWBA 2FY8A 5A0YA 5GMKa 4IQXA 2MZTA 3J80Y 3X1LB 1WEZA 5DG8A 1SCJB 4GC6A 2JHEA 3KG4A 1WACA 1EETB 2MZ1A 3CCUS 4IFVB 4F04B 1NSQA 4CWBA 4P72A 2BX6A 4XO0A 4J9NA 4RWXA 3V2UC 4Y2IA 4ZMMA 3NLCA 5KG5A 3V4IA 3F73A 4GO7X 2IBOA 5HANA 3W60A 3P49B 2GVZB 3MCNA 2AZ1A 3DOMB 5CD4A 2BABA 1GEHA 3T1HJ 3QYYA 4DFMA 4HDHA 2LQ5A 2VA3A 3EGWB 4OZ0A 1HBOA 2ZFHA 5H9FJ 4A48A 2ASJA 4BDPA 3Q8SB 3GPAA 4V19X 1IM4A 4HKQA 1U25A 4ZCMA 1PYOB 1UVLA 1YKWA 2V8HA 1YJWS 3THVA 1ZYQA 2AGQA 3DMJB 3CIMA 3E8OA 4GO5X 4IOBA 4LMZA 1LWFA 3MMBB 3LALA 1RAFB 2DCUB 2QL7B 4N8NA 3Q24A 3CJQA 1I94F 2MDAA 3W8PA 3I4HX 3US5A 2J7UA 1R8BA 3LPYA 3HK2A 3LAMA 2A6MA 4DSIA 2X1GA 3RAXA 4EGLA 1D09B 3AAWB 2CQBA 1WC5A 3JSRA 2UXDF 2V4QA 3E51A 3DHXA 1GMUA 2R2SA 2DD8S 2AWZA 4KE5A 5DGBA 2ZOFA 3OL7A 2VA2A 2J0SD 1FKPA 2KN4A 1MROA 3NCQA 1AZSB 5DG9A 2UVRA 1FCAA 2PMZD 2IM3A 2I8EA 3B8HA 2FLNA 3T5JA 4KV8A 2DNHA 3IWNC 3UCZP 1JJ4A 2PI5A 4GKJJ 1NSAA 4PQUB 2FLLA 4YB1P 3HT3A 1D9FA 2Y8WA 2BE2A 2LCWA 2V5HG 4GRSA 4FYDA 4JBCA 2WCXA 3PY8A 1PAUB 4LRCA 3WC0A 4F7VA 1N33F 2VODA 3SV3A 3T1HF 4MTPA 1DLOA 3LOUA 1FRIA 2Z56B 3QMQA 2CQPA 1S72S 2BJ7A 4PG5A 1TL7A 1XN9A 4S0MA 1FKPB 3TA2A 1VK8A 3I9V9 3QSIA 3W7BA 4C3LA 5H1SV 4YHHF 1JJHA 2CQ0A 4X65F 1C1CA 4N77A 2BXJA 1KEKA 3HHDA 2XZWA 4DSJA 2DNKA 2JRSA 1IJEB 1P9YA 2HEKA 3IGVA 3ZZUA 2MGZA 4JI5J 2YY3A 4JYAJ 3QGGA 4KB7A 3C2PA 3I4PA 1WWHA 5KFYA 3AXKA 2UUAJ 1WNEA 2A10A 3RR8A 1N5TA 2G4BA 2ZNZA 3R7SB 3KLEB 3BS9A 4OHXA 3AY0A 2JLEA 1RBLA 4MK8A 4AD6A 4DN9A 5B0CA 2HHWA 2ZH7A 2DGWA 1N5YA 2GJIA 3OTBA 2XS2A 3KLGB 5J2MA 3IG1A 4HTIA 4DV5J 1ZA2B 5JJBA 5J2QA 2HBQB 2LKZA 1HR0F 2MQPA 1BQNA 1Y0HA 1SPBP 3MMJA 5B0EA 3KUHA 1X4CA 2E1PA 2VQFF 2RU9A 4ETZA 1TFYA 3H5XA 2V50A 1H3DA 1FKOB 5AXNA 5A8RA 4FYYB 2F8EX 2O1PA 3IXQA 4ID5B 5AE1A 1XBWA 2QYGA 4IRKA 3GQCA 3BB5A 1JKHB 3BQ2A 1IKWA 3K57A 4Q8FA 1P1LA 3I31A 1QD1A 2M9KA 2CQ3A 3EVMA 1UP1A 2MSTA 2UV8A 4UT4A 1SL1A 4FXWA 3VAIA 5HO4A 4B9VA 1OPIA 2ZVIA 2AZ3A 3H42A 3M8YA 4NRUA 3BO2A 1YBAA 4DCOB 3C14B 4J37A 4C4WA 2BOAA 4ZDNA 1WUUA 2GFFA 2NZ4A 2DHXA 2HNYA 2QJ3A 4QIGA 3EDRB 4MFBA 1IBMJ 4URQU 4I64A 3THPA 1PCAA 2JOQA 4LSLA 4RBUA 1HMVB 3MHYA 2CNOB 3CJ8A 3K2YA 1KVKA 5AXLA 4ID5A 3QZ7A 1MMNA 4YUDA 5L1JA 4JI8F 2AJ4A 5AJ3F 4A8MP 1U1MA 2JJ4D 4OI2A 4F67A 2O5DA 2RHQB 3HJFA 1NDLA 4Q7AA 3RW6A 3PG9A 1RI7A 4DX6A 2GMJA 2AKWB 1HKAA 4RU2A 1S6PB 3R5DA 3CMES 2QG9B 1AZSA 2W4DA 4Y28C 2NREA 2EKYA 4N76A 5I42A 1VQNS 1S5ZA 3CWJA 4MYUA 3K58A 1MMLA 1Q16B 1NRKA 4A4JA 2JEIA 2R7VA 3R2DJ 1M1GA 3KUEA 2WB1D 3IMQJ 3R5CA 4ZVQB 2IAJA 2ZH6A 1LXNA 4PYAA 2UUCJ 4FPRA 4IG0A 1U2CA 2IMOA 1RTJA 3CVKA 3TVYA 2KXNB 2HHSA 1LFPA 2DNNA 5KT6A 2VICA 4MIWA 2IRXA 2CVIA 4RW9A 2YX7A 5D4LA 1CPZA 2A6OA 2CQGA 1HHTP 4FNIA 1FA0A 2RQCA 1FD2A 4QZVB 1RCXB 2EI5A 3UDVA 1E6VA 4DX7A 1XMQJ 2FJWA 2VOOA 3MTKA 4DPOA 2G0CA 3RB6A 2XMWA 1NCLA 4ZITA 1VFJA 3OJSA 3A3OB 1Y10A 1KRPA 4LIRA 2H51B 3KNAA 1MWQA 5EDWA 2EW9A 2RD5C 3NGSA 4QR2A 4RW4B 3OFHA 2RU3A 1WTBA 4M5DB 3BN7A 4M5MA 1JNRB 2OLWA 1H74A 1Q1KA 1U02A 3M8QA 5G0RB 4DFKA 3LP1A 1I5OB 2NZCA 3GV7B 3AOAA 4Y65A 1J5OB 4I56A 3C15A 5AJ3J 2IM2A 5ETSA 1HWJA 1RISA 2XMJA 2OO4A 2D3UA 3P4UB 2QX0A 1G4CA 2JVRA 1V3RA 1X4EA 3NCPA 3G8TA 1VC6A 3I32A 2C3PA 1EETA 1CQNA 4UZBA 3V81B 3AD7C 3U1MA 4CLUA 4DV2J 2AF6A 2W24A 2BZ2A 1X5TA 4BHQA 4MKBA 1TQLA 3SIPB 4AXIA 1VQ5S 3H2UB 2IMWP 4B3SF 3RYLA 3N9UC 4M95A 2XY5A 4IR1A 1D3WA 2LQBA 4Y2AA 3W2VB 5DLFA 3RBDA 2UUCF 3KOAA 2NYHA 4CO4A 3M6UA 5HMXA 5KFKA 2AT1B 3BF4A 8ATCB 5HMYA 1ZM2A 1TKXA 1FTRA 4QPTA 6FDRA 2ZH2A 2EK6A 2R2UA 1BGXT 2R7RA 1RLDA 4ED6A 1J5EF 4B9UA 3IAS9 2BYCA 4X66F
chains in the Genus database with same CATH topology
1C0TB 1IBLF 2AX1A 2M70A 4RNFA 4ES1A 3HVRA 1DRZA 3U1NA 2CPJA 3QJLA 2FGCA 1P6TA 1S1XB 1S9GB 2MY8A 2LXIA 4TQRA 2DNLA 2W9BA 4HLBA 5F8HA 5KFSA 2HFZA 4C3KA 3JSMB 4O3OA 4BWMA 2E1RA 3ICLA 4JI0F 3ZZYA 1MU2B 4V19J 1E6YB 1OO0B 2ASLA 2HGLA 3DI6B 2ZZNA 3J7A1 2HHPA 1KOOA 2FC9A 2DT9A 3TW0A 3E3XA 3UWTA 4DUYF 3OFEA 2WSCC 1HNVB 1ULRA 4CQ1A 5EX0A 3MUTP 2LQJA 4DUZF 1U2RA 1HI0P 2XS7A 1JX4A 3A1YG 4NCGA 4YQWA 4X2BA 2GGPB 2L48A 5KFLA 1H7WA 2OPPA 3UDLA 2APOA 4AE5A 3TAQA 2GO9A 5HL7Q 4HH1A 2KXHA 2OPRB 1S1TA 4GMKA 3PXGa 5D8HB 1FJ7A 4ZPVR 4RBTA 1IBMF 2FJDB 2RILA 5A8KA 2MZQA 4I67A 4NCAA 2VV5A 2Q43A 4X4OA 2YVSA 1YWXA 1UEUA 2B51A 2C3MA 1CC7A 3CB4A 4ES2A 3SXLA 2XO7A 2V94A 4P6QA 5A8WB 5L8RC 4LFCF 1WEYA 3K8WA 1X5OA 3PO4A 1MWZA 1KHVA 4C8YA 2RVJA 5LSOA 2UVVA 1S6QB 1FE0A 2K1RB 2KT5A 4ZS6A 1U6BA 3T1YF 3AB2B 2JSXA 5K14B 4A8QA 2JLGA 5CYMB 5EGYA 1JLCB 2IHR1 1UA0A 3DU5A 5A8KB 4ECTA 1Q7YT 2VG7B 3FVYA 2X3GA 1YG0A 1SL0A 3G6ES 2C3UA 2L08A 1H0HB 2WTFA 4J9PA 3UNGC 2N82B 4UQTA 2KM8B 2M88A 4M5DA 4CO0A 4DSLA 1KONA 2ZE2B 1KHWA 1YGYA 4QIFA 3HKWA 2E5HA 1NK6A 2XBPA 5KFIA 2XULA 1GNKA 3N5BA 1BWEA 4WJBA 3IS9B 4WK3A 2RRNA 2J9DE 3ZZZA 2YKMB 2YKOA 1LV5A 2DNPA 1JLFA 5I4MA 2YWEA 3TQ1A 2CQIA 3BDEA 3OPKA 4TLQA 5LJ5Y 1FKAF 3ZZPA 2A3JA 2DH9A 3ENWA 5EWGA 1FJGF 2VKRA 5EUHA 3CO9A 4YMEA 3OR1B 4ZVEA 4OLOA 2ZH3A 3DN9A 3PW5A 2XLKA 2BM0A 2CRLA 1M90T 2KM8C 3KLHA 1YHQS 2O67A 2E5GA 3AB4B 4YP3A 3PHEA 3S7RA 3VQSA 5KT4A 1NB7A 4LF9F 3RBEA 2ZHOA 3MEDB 1VJWA 2OPRA 3SMZA 3N01A 2LEAA 4P2SA 2B4VA 3CCES 1SUQB 1N54B 3F44A 2A2CA 4KJIA 4LJMA 2ZNYA 1DFDA 1HMVA 5DDPC 4NL5A 4OZ5A 1UMJA 2YNGA 2L41A 4KHRA 3UQSA 2ASYA 2AX0A 3I96A 3QJJA 2HNYB 4WXOA 2EG2A 1SIWB 1X7VA 1R89A 4DN0A 2ZHBA 4ECQA 3I0SA 1S7HA 1U48A 5GVQA 2LA4A 2QIFA 3VTIA 3HXMA 3ENQA 1JB0C 2OP5A 1IN0A 1ZM3A 1V3ZA 3GV5B 3OSNA 4ZCKA 2CZ4A 4NA2A 3ISND 4FVMA 1S9GA 4FN5A 3DRPB 1RQ0A 3I5BA 5DJBA 2LVWA 3U02A 3PW0A 3PW7A 3NS5A 3J7ZT 4RW4A 4K4XA 3OVSA 2J0QD 3C8YA 3FSYA 1KQFB 4B9SA 2ZBCA 2EC0A 3BR8A 4NLOA 1NKCA 2PD1A 4DV2F 3Q2TC 2GQQA 1KLMB 3OXFA 2EVZA 4NLYA 3EPGA 1XMBA 3IG1B 4RW7A 1OQ3A 1D9AA 4U7CA 1VBYA 3G86A 2HHXA 5KFWA 2Q1LA 4PG4A 1ZOTA 5GAEU 1U26A 2PE8A 2HMIB 4LF7F 4CO1A 3M2UA 5KFUA 2EK1A 2FGOA 3OHAA 2ZKUA 2DNQA 2RQMA 3IBWA 4IG0B 2B6AB 4RNHA 2M7SA 4WFYA 5HN0A 1RT1A 2VB6A 3MAHA 2XWXA 3MM8A 1BD6A 4CI0B 1N8RT 3T5LA 1VQLS 2DITA 2MYFA 3K5PA 1AUDA 2R2TA 3PO5A 3HX9A 3EZUA 1FDNA 1X4DA 4NX9A 3IRWP 5L1KA 4DQSA 2CJAA 1U47A 2GV1A 4TYBA 4KPYA 1FXLA 1VRUB 1Y00A 3MEEB 5K8OA 3PR4A 3G6YA 1SI9A 1ZAXA 3VAGA 2DIVA 3G71S 1RKIA 3KMSA 2ZOGA 1UFWA 2M4MA 5KFFA 1FVSA 3P5TL 5D4OA 1NKBA 4OI0A 1KFSA 4C0BA 2GA7A 1R31A 3H59A 2KH9A 5F8NA 4QJVA 5GAHU 1FXRA 1OQ6A 1R7IA 4IH5A 4H4MB 2HW3A 3GE9A 3IWLA 3V6JA 2HZCA 3T6BA 3MD1A 1JLBA 2F4VF 5L9XA 2CQ4A 2W7AA 4CH1A 2W9BB 4PXEA 1Y4ZB 3D1OA 5DO2A 2AJFE 3B78A 3CJ5A 4PWDA 1H2UX 3OXLA 2XMKA 3F41A 2NPIA 2RSQA 2HG4A 1M5PC 2DHSA 2GHWA 3QO9B 4U6PA 3PX0A 3OL8A 2L9WA 4G1IA 2AD9A 2IFXA 1F2GA 5IT9Y 3IRXB 4CH0S 4JI3F 4QCLA 2BM1A 4RW7B 1BQNB 1HI1A 2HFNA 3GR0A 3AJ2A 4KTQA 4DHVA 2NR0A 1W2IA 2MKJA 3VALA 2M2BA 3GIIA 5LJ3Y 3CJ0A 3RAMA 3EPIA 2ZD1A 5KT3A 4ICLA 2EFVA 3PACA 4M8LA 1UVMA 5EX3A 4AXJA 2ERRA 4OZNA 4BBYA 2KFZA 3PEJA 5MLCV 2VBXA 1FJCA 4HYKA 3MUMP 2OKQA 4WIIA 3K0JA 1QM9A 4IG3B 1TKZA 2DO0A 2E5JA 1RT2A 5CH7B 2E5IA 3PRBA 1VC0A 2VFVA 5C42B 3TUJC 1TKZB 2ZH9A 2GCFA 1KNZA 4F2SA 1Q8BA 1J5OA 3UPFA 2UZAA 3IC1A 2R8IA 4EBDA 1Y5NB 2ZD1B 1VI7A 2QA2A 1P1TA 3TOQA 1C1BB 2XEXA 3LGMA 3PVXA 1D9DA 4RBVA 3GILA 1KVJA 1S10A 5CXTA 1K1QA 4EZ6A 2HIQA 4F3OA 1M5KC 3M8PA 1VRTB 4RLEA 3DOKB 2AGPA 4O3PA 4URGA 2VFRA 1SKWA 2VPWB 4DV3F 1N5YB 4XDCA 2YX4A 4DR3F 1RT1B 4A8XA 2QO3A 4ECRA 5DGAA 2Z8QA 3GMGA 1BQMB 1NZAA 2AU0A 1AW0A 3TA1A 4Z2XA 2R8GA 3DM2B 5GADU 4U9RA 3H4DA 3JB9k 4UY85 2DGVA 3RB4A 1ZETA 1C1CB 1SH2A 4F2RA 5HROA 3U7JA 1FF2A 3PW4A 2HVIA 4IFYA 1HBMB 2KHDA 2A2DA 4IOCQ 4FXVA 1JJ2R 2DR8A 1O51A 2O3DA 4NLUA 4R5PA 3DOKA 4LF4F 2HNZA 3O2IA 1XERA 3G6XA 1YJNS 4KKOB 2NS1B 4O44A 3NCRA 2XGPA 2KG0A 2VZ9A 1KS2A 2ADBA 2ZH8A 1NAQA 2RT3A 2DCLA 3PKMA 2J7KA 4NWBA 5LMNF 5JVHQ 1N5VA 2VG7A 1QAYA 4CZCA 2BQ3A 2YNIB 1RT5B 1VBZA 4AL7A 5IS2A 4DFPA 4I69A 3RB3A 5GAGU 4OLPA 3DLLQ 4FF4A 4F4WA 2WSEC 3IR6B 3SSRA 2B6AA 5CYJA 4TXSA 5D3GB 4LQ3A 1CC8A 1QUVA 4KHPF 1RT4B 4Y00A 4LT6A 4DR2F 2YQ3A 1X9WA 2ZM6F 3BGLA 1SJ4P 4PPDA 4ZVFA 4RW6A 5T41A 2UVWA 2YNFA 3V6DB 1LK7A 3C6TA 3BO4A 2NPFA 1Q82T 1F0XA 1DZ5A 4LVNP 3OL6A 1X4FA 3PJXA 1S48A 4KIAA 4DF4A 1Q7LB 2CQDA 3O1LA 3CF5Q 3OFFA 2D1CA 4I4BA 4DR5F 4DJBA 1LW2A 1JK9B 3GFYA 2ZKTA 4FZVA 4B02A 3VAMA 1S1TB 2MJUA 1U2FA 1X4HA 2XCAA 2W4CA 3UW1A 1QSYA 4NZ7A 4QIVA 3FJ2A 2GGPA 4A8YA 2JDJA 2N7CA 2OTJS 1XEZA 1T3OA 2QFJA 3IR7B 1UJ6A 2QE5A 3MMAA 4ZPAA 2MZJA 3E01B 3W2WA 4O3QA 3G6VA