1VQ4S

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq4S00
5DETA 1M5PC 2HGLA 2LXIA 1WI6A 1X4GA 1X4EA 1VQ8S 1YTYA 3BO4A 1VQLS 2DGXA 2LXUA 3MI7X 2FPHX 5GADU 1K8AT 5FJ4A 1HA1A 2OSQA 4UQTA 2YH1A 2CPEA 3OW2R 1FO1A 2I2YA 4LJMA 3NS6A 2F9DA 2KM8C 1K9MT 3P49B 1HD0A 3UD3P 3RW7A 2KYXA 3S6EA 5MLCV 2MKJA 1UFWA 3HHNB 1VC0A 3NMRA 5DDOC 1WF0A 3G4SS 4TU9A 1X5OA 2MZJA 1X4FA 2HVZA 5CXTA 2O3DA 2X1FA 2M88A 2M52A 2J0QD 4W90B 1SJFA 1FJ7A 5D78A 1W2BR 2CQBA 1WG1A 2MKCA 3N9UC 4FXWA 3G8TA 2LEAA 5DM6Q 3CCRS 1WG5A 2DNPA 2ERRA 4IOCQ 4Z2XA 1ZZNA 2SXLA 1HD1A 1X5PA 2X1AA 1JJ2R 3MURP 1JMTA 3IWNC 3CCUS 1U1KA 3UCUP 2EK1A 1KOOA 2MGZB 2F9JA 2GO9A 2MQPA 2MXYA 1WHWA 2KXNB 1QVGR 2LYVA 2MKHA 3US5A 2E5GA 3SDEB 3R1HA 2V94A 3P5TL 2DGWA 2G0CA 2OTLS 3Q2SC 1ZH5A 4F25A 3UCZP 2WBRA 3UE2A 1DHMA 3VAJA 2U2FA 2JWNA 3CF5Q 2DB1A 1YHQS 1OPIA 2LA6A 2MGZA 1WHVA 2KXFA 3TO8A 2CQDA 2E5HA 2RVJA 2CPHA 5ITHA 3SDEA 3CXCR 2KI2A 2MZRA 3CD6S 3BEGB 2DK2A 4FXVA 4QPTA 2KN4A 4ZKAA 3CULA 2MKSA 1K73T 2HGMA 2X1BA 2CQ4A 3UCGA 1FNXH 3TYTA 1WEZA 1Q82T 2DHXA 2DNMA 2YH0A 5GAGU 3G8SA 3CCVS 1SJ4P 1VBZA 3U1LA 1FT8A 2HYIB 3VF0B 2RUGA 1VBYA 3SMZA 4V19X 2XNQA 3BS9A 1AUDA 3S8SA 4RU2A 2XS5A 2DNOA 3JB9k 3LQVA 2HGNA 2J76E 1VC5A 2DGSA 2DNKA 2K3KA 2CPFA 1PO6A 2CPZA 2ZJPQ 4CH1A 5LJ3Y 1WTBA 2D9OA 4PR6A 4PKDB 2RS2A 2QEXS 5CYJA 3CC7S 1N54B 1H2UX 1A7GE 2DH9A 2M2BA 2KRRA 1O0PA 1F9FA 1WEXA 3THTA 2M8DB 2MSTA 2ADBA 3RW6A 1M5OC 3R1LA 3CCES 4BS2A 2LEBA 3B4MA 1UP1A 3CUNA 3VAKA 2B0GA 1WEYA 1X5SA 1FHTA 4F02A 2KU7A 1U6FA 1H2VZ 1XN9A 2DHGA 1Q86T 1FJCA 3EX7B 1U1RA 2MQLA 1X4HA 1YJWS 1L3KA 2CQHA 2OJ3A 2DNNA 1H2TZ 3G71S 2DGUA 2DNLA 2NZ4A 4Y0FA 1VQ5S 2ADCA 2AYEA 2N3LA 4U67Q 2MKIA 3LPYA 5H1SV 2DNHA 3EGNA 2DISA 2AD9A 2XS7A 3IRWP 1X4CA 2KXHA 3MUMP 2K8GA 1OO0B 4C4WA 3Q2TC 4OZ1A 2PE8A 5DDPC 3ZZZA 2CQGA 2DH8A 1N8RT 4QU7A 3J7YU 1KD1T 2CPYA 1M90T 3G6ES 4TU7A 4Y00A 2N82B 3CC2S 1KC8T 5DM7Q 2MKKA 3PIPQ 1X4AA 1FJEB 1KQSR 2MQOA 3CMES 4ED5A 1B7FA 3CCLS 2OSRA 3CCQS 1YWXA 2MMYA 2CQ1A 2M70A 3B4DA 4M5DB 2DO0A 2J8AA 3VAGA 1VC6A 5HO4A 1D8ZA 2LCWA 2LA4A 3HI9A 3THPA 2DIVA 2M0GB 4WF9Q 1X0FA 4WFAQ 1VQ4S 1OWXA 2XS2A 2AYGA 1U1PA 2OTJS 1PGZA 2E5JA 5HL7Q 1ZZFA 1URNA 1U2FA 1VBXA 1X5TA 2CPIA 2MQMA 2MZTA 2AYBA 2RRBA 1VQOS 1WHXA 4WCEQ 3V4MA 2LKZA 2KRBA 1M5VC 2CQCA 2MJNA 1M1KT 4C0OC 2D9PA 1VQPS 5JVHQ 3MD3A 2DNYA 5GMKa 4IUFA 3VALA 2KM8B 1QVFR 3BO2A 1R8PA 3K0JA 4P6QA 2BOPA 1SXLA 1H6KX 2U1AA 3CC4S 3TP2A 2MYFA 1NU4A 2DIUA 1FXLA 2X1GA 5GAEU 4C7QA 2A3JA 2DGQA 2MPUA 4ERDA 2NLWA 1SJRA 5GVQA 4CH0S 1JJHA 1QM9A 3CCMS 2FC8A 2N3OA 4YUDA 3CCJS 3UD4P 3DLLQ 3R27A 2RS8A 3I55S 1SJQA 2ZJRQ 1X4BA 4WIIA 2CPXA 1S79A 3CMAS 3H2VE 2E5IA 5LJ5Y 2JVOA 1DRZA 1M5KC 1N52B 2F3JA 1VQMS 1P1TA 2M9KA 1HL6A 2HZCA 1DZ5A 4QQBA 3SXLA 2MY8A 1R8HA 2RQ4A 3MUVP 2G1DA 2E44A 2KT5A 2G4BA 4YB1P 5DDRC 1YITS 4QU6A 2ZJQQ 2CQIA 3NNAA 2FY1A 1YJNS 3H2UB 3ZZYA 1P27B 3BO3A 5BJRA 1KOHA 2DO4A 2KG0A 2DGOA 1CVJA 1YJ9S 1VQKS 2VOPA 4WFNQ 2PEHA 3MD1A 5IM0B 2DGTA 4CQ1A 3D2WA 1D9AA 2JX2A 2MQQA 4EGLA 2RRAA 2D3OR 1U1LA 2L08A 3VAFA 1VQ9S 1SJ3P 1WELA 2CQ3A 5IM0A 1X4DA 2J0SD 3NS5A 2VODA 1OIAA 1WHYA 2LECA 2MHNA 4YOEA 2OIHA 2MZSA 1U6BA 3FEXB 2RU3A 2DHAA 2RT3A 5CA5A 2KVIA 2L9WA 2I38A 4J5OA 1WI8A 4TLQA 1YI2S 5IFMA 5LSLA 2AYMA 2GHPA 3P3DA 2DNZA 2MJUA 3CPWR 3L3CA 4A8XA 4W92B 2QA4S 1S72S 3S7RA 1WF2A 4WFBQ 1N88A 3G96A 2VOOA 5GAHU 2EK6A 3MOJB 3MUTP 2VONA 1YIJS 2FC9A 4LMZA 4WKRA 3P6YC 1UW4A 2M4MA 1RK8A 2JRSA 2MZ1A 1U1QA 1VQ7S 5D77A 3UWTA 3S01A 4LIRA 2MSSA 5EN1A 2KHCA 1IQTA 2MZQA 2YWKA 2XNRA 2XSFA 2DNRA 3I56S 2KG1A 2CJKA 2CQ0A 2M7SA 2UP1A 3G9CA 1RKJA 2DGVA 5LXRA 2QFJA 3EGZA 1VQ6S 1VQNS 3MXHP 1JJ4A 3U1MA 1WG4A 2CPDA 3VAMA 2KH9A 1U1OA 4UY8T 2YTCA 5LSOA 1U1MA 1Q7YT 2JVRA 3VAHA 3PIOQ 1A9NB 1Q81T 2CQ2A 4IOAQ 3MDFA 2N7CA 2YKAA 3FEYB 1WF1A 4IO9Q 2DNGA 2M8HA 2MB0B 2MY7A 2XB2D 4OZ0A 5IQQA 2CPJA 4PRFA 2LQ5A 5LXYA 2CQPA 1BY9A 1WWHA 2BZ2A 2FHOB 4TU8A 2DH7A 2DHSA 2MQNA 3DXBA 1DBDA 3CTRA 2EVZA 2RNEA 2DITA 2LMIA 3NNCA 3NNHA 4F26A 5JVGQ 2KFYA 1UAWA 4CIOA 3CCSS 1NO8A 2Q79A 2L41A 1G2EA 2RQCA 5DDQC 2DNQA 3ULHA 1U1NA 3J7ZT 1NJIT 3VAIA
chains in the Genus database with same CATH superfamily
4MK7A 3W64A 1OYEA 3UR3C 2XO6A 1K9MT 4B3TJ 1HBUB 5H9FJ 3GIJA 1E6YA 4KIAA 4K4TA 4E8UA 2Q6CA 3G4SS 1KHVA 4CNZA 2HQGA 4OFZA 5HMWA 3TUJC 1FJ7A 1JLBA 2AX0A 4I2QA 2POKA 2ERRA 1ZM3A 1Q1KA 4PXDA 1Y9OA 1VRTB 1MU2A 1KOOA 3C46A 5HVFA 3BPSP 1RT3A 4B02A 3A8KA 1BMQB 3HVRA 2OTLS 2B51A 3M9OB 5B0DA 2H3EB 1CQMA 4LT6A 5KFIA 4TN2A 2WVDA 1U02A 3TYTA 1WEZA 2HFVA 2YH0A 1EP4A 3BN7A 4NZ0A 2NR0A 3V5RA 2B4UA 2HGNA 4YMEA 3L09A 1SV5A 2DGSA 3LANA 5BR8F 3HF5A 2LFVA 5ETVA 4KFBA 3RAQA 3KOAA 4OYZA 3OTBA 3MR5A 3ENQA 1O0PA 2XHCA 3CCWA 2VU5A 1WKLA 3EZUA 4MFBB 1WEYA 4ZVUB 1FHTA 5C42B 2ZH3A 3W2VA 1T9XA 1SC3B 4YN3B 5I3PA 5EWEA 2IBOA 3HFVA 1UWBA 2DNHA 2DISA 5ETSA 2KXHA 3K5LA 3H98A 4LF2A 1K1SA 3Q2TC 1T9VA 2VBWA 3T3FA 1C1BB 3R3TA 2NXNA 2DPIA 1ZS6A 1AZSB 3N6LA 3OR2A 2EWHA 1CJUA 4JB8B 3PIPQ 4DF8A 3HVWA 1FJEB 4B3MF 4EBEA 4P2MA 3KUHA 4KGMA 5KOWA 1JLCA 2DXFA 5KOXA 1FJGF 3L4BC 2E1CA 3D54A 1H0HB 1OWXA 2XS2A 2WVCA 1XTZA 3UDCA 2W24A 4ECXA 2KL8A 2JLGA 4CH7A 4WCEQ 2C28A 3V4MA 2E66A 1FKPA 3DLGB 2DNYA 4ZHRA 3H59A 4ED8A 1O8BA 1H6KX 2ZM6F 1C2PA 4M5NA 4ERDA 2G9OA 2KO1A 2OP5A 1MWQA 3KMSA 3MTKA 1GMUA 2RKIA 2A6MA 2P6SA 2ZJRQ 1X4BA 3HJFA 1LXNA 5LJ5Y 4CCHA 1V3ZA 1ZBTA 4K4SA 2OELA 3BGRB 5EGYA 1AUSL 3B54A 1WNEA 2G4BA 2FLNA 4QU6A 5K14B 3M30A 3ONQA 4B3MJ 4RNOA 2K1RA 2APOA 2EFQA 5BJRA 1QAYA 4ELTA 3TVYA 2DTJA 4GKJJ 2B9WA 4NCBA 5LSRA 3B8HA 4DPTA 3C6UA 3GYNA 3MM7A 4OZJA 4ANDA 5HQMA 2XMKA 4B3RJ 4YS2A 1FDNA 2ZKTA 3A4TA 3I4PA 2MZSA 1ZM9A 3AJDA 3MPYA 1GT8A 4ZN1A 3C66A 5LT5A 4EUVA 1TV6B 1T03B 1S72S 2DRBA 3FBBA 3MEGB 1YIJS 1HNXF 3MMAA 2MDAA 1LEOA 4I69A 4LF9J 4OYAA 2DNRA 1G1XA 4ZMMA 4PPZA 2QFJA 4QR1A 2XLIA 3IG1A 2BANB 2HNZB 2AW0A 4IR9A 1PG5B 1NHVA 1VMBA 1ZAVA 4DV4F 3RB3A 1IBLJ 4XK8C 2VBXA 2QMUB 2IBKA 2DITA 3HHDA 2VFTA 2EFGA 1FD2A 4KY3A 2V50A 3DMJB 3ULHA 3DRSB 5HQLA 4KO0B 1X4EA 3QIDA 2HZAA 2WVFA 5GAEI 1MMNA 2LQ9A 3PW4A 4WU2A 2UVVA 2CPEA 3IRXA 2P8IA 3A13A 4FS1A 1XIQA 1HNXJ 1SH0A 1P9YA 1WF0A 1SKWA 3TAQA 3NGKA 5D0EA 1JWWA 4CP5A 3BH6B 1XNQF 4C8MA 3NCQA 1VK3A 3OTCA 3FFIA 4PEOA 4ZVQB 2AJ0A 2FGOA 3MOZA 1X5PA 4DR2F 5M2RA 2RDJA 2HIQA 3G2XA 3EJMA 4PUOB 2XEXA 1RT1B 2QSWA 4YB6A 2BRLA 1EJ7L 1IJEB 3UVJA 2EFPA 2EFOA 2U2FA 2NXEA 2KXFA 3GFHA 3X3UA 5ETMA 4QR2A 5EWFA 4U7UK 2V63A 2BKPA 3SFGA 2V9WA 3T1YJ 4FBTA 5THWA 2A6OA 1OJ4A 3R6GB 4ETZA 3DRRB 2DBBA 3EICA 5AXKA 2QEXS 4RJVA 3IAM9 3MR2A 1F9FA 2FZGB 2H4YB 3AQOA 2AGPA 4DI6A 3N5FA 5A2QU 1JLEB 2HPUA 4F02A 1XR7A 3FMBA 1NJYA 1XN9A 2GVZA 5A6PA 5HJXA 3NGTA 3OVBA 2BYCA 2I5JB 5J2MA 2KJWA 3ZTSA 2KHDA 3W9JA 3QWPA 5B0BA 3QGIA 3QNWB 3MCOA 4UUWA 2VB6A 2PE8A 2QJ3A 5I42B 3AJ2A 1RA6A 1YVFA 3A8JA 2HNDB 2E1PA 2G2YA 2Z0GA 1KQSR 3TUIC 3OTEA 2QA4G 3OJUA 2HHHF 1ZOTA 2ROEA 1S99A 3GSIA 3N4WA 5A8WA 2ATCB 4NLDA 4AL6A 2GMLA 2AYGA 3EPGA 8ATCB 1Z2LA 3R5DA 2GS8A 4B9TA 3MR6A 4HT7A 2KRBA 4DX8H 3KJFB 4C0OC 1QVFR 4USTA 3JQMA 1FKAF 1FCAA 4P6QA 5M2UA 7FDRA 1LWFB 1VJWA 2DIUA 4K4VA 2MPUA 5ETRA 1CLFA 2NLWA 1QM9A 3H5YA 4M95A 5KFPA 3AD9C 1RBAA 1U25A 3H5UA 3CJRA 2ZOFA 4ICLB 2ZD1A 2QLBB 4Y28C 2WTFA 4K2JA 2UXDF 2F63A 1H3DA 3DGPA 2WB1D 5DDRC 2EC0A 3GR0A 2ZH2A 1AFJA 2AZ1A 3LWMA 3CDUA 2VFRA 5EWGA 4ED3A 3ET6B 2R42A 3FCVA 5FIIA 1WOOA 5HK4A 3VAFA 4USHA 4Q8FA 4FNHA 4QYZK 4DSKA 5HMXA 2YWWA 3NS5A 4K4UA 4CO1A 3FEXB 4DL7A 2RJZA 5D4OA 3D3BJ 5HBMB 2GHPA 3PR5B 4FS2A 2Y9HA 4WIQA 3AOCA 3ZTPA 4KKOB 4OX6A 3GZ7A 4UY85 4N8NA 1URRA 1CEZA 1VBKA 3WC0A 4O3OA 3CJSA 1SB6A 2YWKA 2D41A 4J9RA 4XDDA 3F56A 4LQ9A 2UXDJ 2XYPB 1L5UA 1U2CA 4FVCA 2V4RA 1UJ6A 1RTZA 3D0IE 2WONA 2ZDOA 4PXBA 3CJQA 1EARA 3K89A 4G65A 2F4VF 3R8YA 2N7CA 5LMNF 4IO9Q 3BKTA 2KYZA 2MKYA 1WWHA 4LR9A 3RB6A 1N0UA 4M5HA 2Q79A 3K57A 5SZTA 4PXCA 4EZ9A 2ABYA 5CAAA 3QQCD 3VAIA 3N5BA 4K4YA 4NA3A 4DOZA 2BUNA 2WSEC 3V2UC 1RWWB 3QJJA 3ETOA 4Y6IA 1B3TA 1JQGA 3OW2R 3P96A 4PWUA 2XULA 2J7WA 2N4CA 1HQ2A 5KT7A 3FBEA 5IWAJ 3O8WA 3LGNA 3MM9A 4DPUA 5CABA 1RTJB 2O1PA 4PABA 3DLEA 4LR8A 4OJHA 3DRYA 1VRQC 4L3KA 3R7NB 3G82B 3SI8A 1TKZB 1XNRF 3IM9A 1JLGB 4F4WA 1VLOA 3LAMA 2F4VJ 2MGZB 5LMNJ 4NLYA 3NLCA 3US5A 1HQUA 3KK1A 1H7WA 3Q2SC 1OYDA 3J80U 3VAJA 3TAMA 4XDCA 1S1XA 1DTTB 3W60A 5E3PA 2AQ4A 1DY3A 2R4FA 5T14A 5D3GB 3OR1A 3UCGA 5DZ6A 3CCVS 2BQRA 2WCXA 3SSQA 3W3SA 2B43A 2GHWA 4RU2A 1HNZF 1OSCA 3AB2B 2F8EX 3ADAC 4DSEA 2XBPA 3C16B 4NLVA 4I67A 1I51B 5HVGA 3MZIA 4ZP9A 5L1KA 1WTBA 3D5MA 4PR6A 1S6PB 3B78A 2DYAA 2W2MP 3DLHA 2M8DB 2Y1JA 3RW6A 4DV2F 3SCKE 1PJ7A 4B3SJ 3BQ0A 2CVEA 2XGPA 2MQLA 1R0AB 1L3KA 2BE7D 4DCPB 3TZZA 4EK2A 2EPIA 3M9MB 4U67Q 1B0PA 3KHLA 1MN9A 1OO0B 4OYOA 4P2FA 3M2VB 4DCJB 4KGXB 4X64F 1KD1T 4NA1A 1LWCB 1FVQA 5D0HA 4U8VA 4ED5A 5M2PA 2GV1A 4DL2A 4LR7A 1D8ZA 2H48B 3HI9A 3BF4A 1S1TB 3D1QA 5E3CA 2NPFA 1DQ9A 2Q1LA 3QZ8A 2CFXA 1FNMA 1FDDA 1W2IA 3WBZA 4P10A 3PG9A 1U2FA 3DN9A 4RO0A 3M2UA 2H5EA 2MQMA 5L1JA 2X7IA 1FA0A 3PYFA 4KHMA 1R8PA 3TX8A 1FFWB 1X9WA 2YVSA 3KLFB 2YNGB 2YX7A 3N0VA 1S97A 5D15A 1N34J 4OLOA 2XM3A 2A3JA 1F1BB 3HHLB 1LW0A 3RRKA 3CCJS 3KLVA 3VVTA 1RTIA 3UN5A 3M8ZA 4ZLPA 4JV1A 4DV5F 2ACYA 1NSAA 1HL6A 4FN5A 4DV1F 1LWXA 1EZZB 4WP8A 1L3UA 1NDLA 2AWZA 4EI2A 3H2UB 2YKMA 3BO3A 4L6V3 3C14A 1IWAA 1GAOA 4N77A 1VHFA 5IM0B 3RB0A 2YX4A 4ILLA 2JX2A 4HI1A 2HHSA 1JLBB 5KFZA 2CQ3A 5CD4H 2LECA 1CC8A 5L39A 2VG7A 1KTVA 4C0HA 4JI1F 1Z4UA 1MU2B 3IGVA 3P3DA 3QT5A 4A8XA 2B4OA 1P9QC 1RT3B 1M1HA 4QWCA 4P75A 4JI6F 3MUTP 2C2OB 3HM9A 4LMZA 2YQ0A 2C3MA 3IR5B 1HWJA 1CS4A 3DHWC 2E1MC 4DQIA 2HWTA 4PXEA 4DV5J 4R5PA 2I6WA 4LBHA 5L9XA 4DV1J 3CDAA 1EP4B 4C9DA 1BUXA 5L46A 2JVRA 1Q81T 1S0MA 4IYQA 3C8YA 4H4KC 2CPJA 4KFBB 4R0EA 2CJQA 1N5YB 2WAQD 1WD6A 4K50A 1AXQA 1TFYA 2ILZA 4NXMJ 5CXTA 2YWFA 3UI3A 1VK8A 4JI4J 5DETA 1KQGB 1WI6A 1S1WA 4B17A 3GV5B 3MEDA 3QMQA 2UXBF 1QUPA 3NWGA 4LFAF 4QIGA 3SSSA 1X5OA 3OR2B 5A0YB 3VGSA 4E0DA 1CJUB 1VDHA 4OJ3A 3V4IB 2PC6A 2HQDA 3BREA 3G8TA 1BQMA 5KFTA 1RT2A 4IOCQ 4PCQA 3OBIA 3IWNC 1JLCB 3MMJA 3PACA 4ID5A 6FD1A 5F9NA 2EK1A 1R89A 3D6FB 3L95X 4KGKA 1KLMB 2R8IA 3CEDA 1WOPA 1WKJA 3WDOA 3R1HA 4L72B 5B0CA 4ZP6A 2WBRA 2DB1A 4F04B 1GFWB 4ZHRB 2PEBA 2QL7B 3HSJA 1T95A 4O3NA 3FZ2A 4NMLA 3ZNJ1 2HGMA 2L3MA 2FJDB 2B8PA 2Z2ZA 2RKIB 1S9FA 3PW0A 3VF0B 5E2QA 3SMZA 2CZ4A 2VFSA 2VC0A 4Z37A 4C8OA 2HVEA 2XS5A 1HNIB 2UXBJ 3NBPA 2CZ9A 3Q0AA 4LFAJ 1L3SA 4A8KA 2CPZA 4LF1A 4J91A 1YRUA 1U0SA 5KG6A 1IBKJ 4RW7A 1A7GE 2B9YA 4NLTA 4LFCF 3D0HE 2K1RB 2IDEA 2PA3A 5K8OA 4NRTA 2HS0A 4F7VA 5L8RC 4PPDA 2W2OP 2IYIA 4MKVA 1PKUA 3EX7B 3MM7B 3Q8UA 3MAAA 2NZ4A 5DGBA 2RHSB 4JV2A 3UPFA 1U0HA 3NCRA 1NB2A 2GIQA 1NHKL 1PYTA 2W4PA 4OZ2A 3IGNA 2BOAA 2VKZG 5G0RA 3AB4B 4ZPBA 3BGLA 4B3OA 3DDKA 4ANCA 2UXCJ 2HHXA 2CG4A 1ZAXA 3KLIB 5KG1A 2AHOB 5HO4A 4FDFA 3IN5A 2PFDA 4TYAA 1K47A 4A8OA 2XMWA 2JEGA 4PQUA 4J9PA 2FJBB 3IG1B 3ILJA 4NX9A 1T94A 3HFZB 3DU6A 4DBQA 1ACMB 1VQPS 5ETPA 3VWSA 1Q5YA 2AJ1A 3AAWB 4URQU 3W9IA 4RU9A 2QL9B 4O3PA 3R7SB 4RR5A 1VI7A 3FC9A 4X4VA 4B9NA 1HPZB 4LRBA 4TY9A 3K58A 4RUAA 3TJ8A 5J1NA 1WSVA 3M2RB 4IFYA 2HHPA 2Q6BA 3E51A 4O4GA 4CLFA 1VFJA 3H2VE 4USIA 4ILRA 1TKXA 2DPJA 2HZCA 1DZ5A 1FK9B 4HVZA 2KT5A 4DL3A 1UWAA 4MYTA 3GPAA 1IKYA 4IDKA 3IRXB 4DUTA 3ZZYA 1P27B 4DSIA 2DO4A 3HSDA 4ZA1A 1GNKA 3IBCB 2DGTA 2AX1A 2F8HA 1FXRA 5K20B 3BZQA 4EGLA 4HHJA 2D3OR 3J81j 1CG2A 1XERA 2ZBRA 2CRLA 3FFIB 5HJYA 2YXLA 1ZETA 1VLYA 5BYSA 5CA5A 1LK7A 5LSLA 2C3UA 4O0NA 4RBTA 4M8LA 3UVJB 3T1HJ 2VOOA 4DG1A 1BWVA 2D7SA 3HLUA 1FWPA 4ED0A 1Q0NA 2CJKA 5ETKA 3MM6A 1RWMB 3V6JA 1HQEA 4ANEA 1VQNS 4CI0B 3NAIA 1D9FA 1YJVA 5ETNA 2HEKA 4NEZA 1CJVA 4P52A 3LH2S 5F0WA 3GMGA 1SIZA 5AXLA 1WTFA 2XB2D 2Z30B 5KFAA 4W4MA 1RWUA 1IBCB 2FHJD 3T5KA 3FDSA 1YSJA 3JAMY 3CCSS 2J9CA 4MKAA 3OL9A 1NPPA 3PR4A 1SJ1A 1G2EA 4ZCLA 3IS9A 1Z2ZA 2DNQA 2BM1A 4DUYF 4USKA 4G1IA 2BE2A 1VQLS 5FJ4A 3MI7X 3OXGA 2R7VA 2OSQA 1JLQA 3UNYA 5J2MB 4IH6A 3JQJA 4IH7A 5H9EK 3RW7A 4DV3F 3MM5A 1TAUA 5DZ7A 4QCLA 1FX4A 2NYHA 2UVRA 1SQGA 3H90A 1HBUA 2J0QD 3I31A 2O01C 2XLJA 1PBAA 3QJLA 4DL0C 2Z57B 2X1AA 2VJVA 3HXMA 2C1EB 2YQ1A 3FUYA 1J5OB 2VQEJ 2ASLA 3GG1A 3W7BA 3GP9A 4QIEA 1V6HA 3OFFA 4TY8A 1WHWA 3W65A 1VRTA 3BSCA 5F8IA 1JKHB 3Q23A 1HBOB 1UVIA 2OEKA 3CD6S 3PJWA 4FXVA 4JI0F 5GMDA 2EW9A 1F2GA 4CNYA 1Q82T 2CDQA 4DSJA 1SJ4P 4DR3J 4V19X 4RNMA 2VPZB 1RISA 1NNDA 2G1HA 2ZD1B 2AJFE 2CJYB 2QMWA 1JXLA 4IG0A 3DGPB 2VG5A 1IR0A 2DD8S 3DXSX 5HATA 3I96A 2H51B 3D67A 6FDRA 3PJXA 3VGUA 2DHGA 3TA1A 4H54A 2RF2B 1RDRA 1PBUA 4LF4F 3ZZPA 2R7UA 4FYXB 4LVNP 2ADCA 3N28A 5C42A 2RDDA 1X4CA 4CLWA 4WKYA 4HTJA 2EC2A 5ETOA 1T8EA 5DDPC 3ZZZA 2CQGA 2DH8A 2R7SA 2KKHA 1N8RT 2DR6A 2ZBIA 1RAFB 1H73A 1M90T 4F67A 4JI0J 4LQ3A 3HT3A 5DM7Q 1ZTTA 1K44A 1S4FA 3O2IA 1TMJA 1ZYQA 1VR6A 1YDLA 1C1BA 3CCQS 1AZSA 4DSFA 2V2VA 2J0WA 5DLFA 5BYRA 3HHEA 3QGHA 4DR6F 4B9SA 1YJRA 4NWBA 2G2OA 3GYXB 1HLWA 1S4EA 1M5VC 3T6JA 3SEOA 2AGOA 4M5LA 2NQPA 3K0JA 3KHHA 2DHHA 4XAKA 4C2MA 2RQMA 3PHEA 3ZTQA 2V68A 2R7XA 1FXLA 4J9QA 5GVQA 2ZWOA 1WOSA 2FC8A 4LF4J 4FYVB 5AE2A 2Y8YA 2HZVA 4NZ6A 1S79A 1RE1B 3MPUB 2E5IA 4L75A 2R2SA 4DV6J 4AXIA 3NS7B 4AL7A 2B7CB 1BE4A 2D3ZA 1YITS 4ECWA 4A8FA 3PEHA 5KT6A 2NUUG 4PYDA 3I5BA 1GK8A 2IAJB 2D3UA 2XG8A 1KOHA 4IKAA 1R8BA 1SL1A 2IMWP 4I64A 3HDSA 3H0PA 2QYCA 2H9ZA 2MQ8A 1XR5A 4OV6A 4PG6A 2Z2LA 1TK0A 3AA8A 4WWSA 2F65A 3J7AN 5K8NA 1PC5A 3PYEA 3KLHB 2J0XA 3MFIA 5AXNA 3CJ3A 5T7LA 2ZHOA 3CPWR 1JNRB 3LGHA 1P1LA 2KTQA 3KK1B 2LXFA 3F41A 3VQSA 1VQ7S 2XCPA 1TV6A 2MSSA 3TVZA 1T03A 1IQTA 3TAMB 3C6TA 4DR1F 1RYRA 3CDWA 3M7VA 3OQ2A 4Q45A 2M7SA 5KFJA 2IVMA 2Z2YB 1VQ6S 3OR1B 3Q89A 4DX5A 3Q86A 3W63A 2L9DA 1KEKA 3VAMA 1SL0A 5KG4A 1MWZA 1GTHA 2XGQA 2GZOA 1X0PA 4KV8B 2EBEA 3ZFVA 2BANA 3JXOA 1WACA 1QAXA 1ZTWA 1KBRA 1ZM4A 1RBOB 2MY7A 5A6WA 4IQXA 2LMIA 1L3VA 4ZVGA 3AXKA 3NNCA 4K8RA 5HN0A 4C3KA 3ZZUA 1XEZA 1NJIT 2HGLA 3FEZA 2RDIA 4ZP7A 1X31C 2OLWA 1IBMJ 3ELHA 1G3OA 4ZVFA 3VCDA 5GADU 4MAKA 2X3GA 3DRSA 4KO0A 2CJBA 2HBQB 3UD3P 3KDNA 3BJYA 2JLEA 4A8YA 3JSYA 1KDNA 3HCXA 3HHLC 4DR1J 1RCOB 5L38A 1JX4A 1SJFA 2V67A 3D6TB 3N9UC 4V1Ak 2LQ8A 2BJ1A 4DUZF 2PI4A 1HWUA 4AFFA 4C8LA 3BSAA 2W7PA 3PY8A 2F9JA 3KJQB 3BDPA 2W9BB 4A46A 2E5GA 1S6OA 3B82A 3M2UB 4PUOA 2CADA 1RT1A 4F25A 3DRXA 4EYIB 1W25A 3GCWP 3MHYA 4DU8A 1RTHA 3KUEA 3ILLA 1OMSA 4ZKAA 2C2ZB 2CQ4A 2JLFA 2UUWA 2HBZB 2DHXA 2E7WA 4MK8A 1RTIB 5ETTA 1KVKA 5E3RA 4OI2A 4D3GA 1F5BA 4CDIA 3DI6B 4CH1A 4GMKA 3W62A 4G1QB 2V8GA 2HVHA 1MW7A 3BSNA 5CYJA 4CLZA 3N6NA 3BBFA 3R5CA 3DRRA 4USJC 1WEXA 3SIPB 2YKMB 1KFSA 2ADBA 4WU3A 2QTWA 2DEJA 3C14B 2Y1IA 1U47A 1J5EJ 2FVPA 1KKHA 2B0GA 1IKXA 3W5ZA 4IOBA 4RPFA 1NHUA 1YJWS 4DSLA 4URGA 5J1PA 1S7HA 2K06A 1LFWA 3SV3A 3UR0A 5H1SV 5KFMA 4CO0A 2XMTA 1RHMB 3OUYA 1NBEB 2DT9A 3PO4A 4NYZA 2I5JA 2ZVIA 4A48A 3GFZA 3NL0A 1K1QA 2W2QP 4Y00A 1UEVA 1KC8T 2DR5A 3QRRA 2OSRA 5I42A 3MMBB 1CS4B 4QWDA 3BB5A 4BC7A 3GV7B 4CTAB 3UFCX 4NPOA 2BDPA 2LA4A 1NK4A 3V6DA 4I4BA 2YKOA 1VQ4S 5A8KA 2OTJS 4F0KA 1JXEA 2RH3A 2UUTA 3TNVA 1VBXA 4DF4A 4GC7A 3UQSA 1KLNA 4G6VB 4DLGA 5JVHQ 3OSPA 3GR1A 4WZMA 1J2VA 1R8CA 3MMCB 5GAEU 2HKEA 3OHBA 3A3NB 2QA1A 1Q7LB 5FLXY 3QFWA 3MEKA 1LWFA 3QATA 4B9VA 3H4DA 1MMLA 3GLJA 1JLAA 4Y65A 1VQMS 3FVYA 2B56A 1H74A 1S1WB 1HW8A 4BWJA 1WC1A 1TMMA 1TL1A 4CZCA 1DAXA 5HI7A 1S10A 3MEDB 4KE5A 3I4HX 4I1TA 1B7YB 5CD4A 2KFZA 1RHJB 5DS7A 3TQ1A 1U7LA 1VQ9S 4MJKA 1TK8A 3ET6A 3A3OB 3VGTA 4JI2J 1RT2B 2F40A 2Y1RI 4V19J 4KB7A 4U95A 2L9WA 2EBGA 2ZNYA 1G7CB 2AYMA 3E2EA 1S76D 2ZDPA 2A0FB 3G96A 3HVAA 2C2RA 3CIMA 2EK6A 4FPIA 3G8QA 3EVMA 3UWTA 5AJ3J 1S1VA 4KKOA 3RGIA 4GKKJ 4QWEA 4JI8J 2CPDA 2KH9A 4F3QA 2DR7A 1Q8IA 2BR0A 1A9NB 2UU9F 5B09A 3RBDA 1EKRA 2FHOB 3C2PA 1RT7A 5EUHA 2MQNA 2PMHA 3DXBA 4C8KA 2XTJP 3OVAA 3LF0A 3R5GA 4KPCA 1FRJA 2FGCA 3C15B 3ETMA 2IRXA 1TUGB 4LSZB 1KVIA 4JI5F 5CCLA 3QGPA 1YBUA 1O6XA 1HNWF 4BC9A 4Y2MA 1LW2B 3Q24A 1K8AT 4HTIA 1HA1A 1QDUB 1TZ0A 4FYDA 5DO2A 1IVZA 1KSPA 5EDWA 1VRUA 5C5JA 3O3LA 2KYXA 1LNQA 5A8RA 5KAKA 1Q53A 1W7WA 1FRIA 4OMFG 4EO6A 4KH0B 2Q43A 1UVMA 1ZA1B 5G0RB 5I3UA 2QLWA 3MAHA 1WG5A 5DG8A 4B3OB 4OHXA 1Z1ZA 1RTJA 5E33A 1HR0F 1RUSA 3C19A 4RUHA 4X4UA 3ISND 2DR9A 2GO9A 3G82A 2MXYA 2DEIA 2LLZA 4PQUB 1IWGA 1JLGA 1JK9B 3Q8PB 4J37A 3CJ4A 3IC1A 4ED4A 3NY0A 2JWNA 8RUCA 1YHQS 2MGZA 2XMJA 3Q8VA 2OKQA 4KHPJ 2CPHA 2B4VA 1NK7A 2MZRA 3BEGB 1N5TA 4M5JA 4NOHA 4JI5J 5DJBA 2MKSA 1HNWJ 5KG0A 2ZKUA 1QSYA 2DNMA 2JL9A 1UETA 1DTTA 1VBYA 1XJWB 3CJKB 3JB9k 1K0TA 4NXNJ 5FLXU 4EMDA 1VJQA 1VS3A 4CO4A 2BM0A 4JV5F 4L3NA 1RWNB 1R0CB 3JSBA 3D4JA 2M2BA 2E7XA 2KRRA 1RP5A 4IDKB 3QLHA 2W2NP 5KFHA 3VAKA 1X5SA 2JEFA 2A18A 4KR0B 2WHOA 4Q5VA 2GFFA 3ZZRA 2ZEJA 1NK9A 1U1RA 3U7JA 1R27B 4I7FB 2HSEB 2DNLA 4LF7J 2UUCF 4WK3A 2FYXA 4KYZA 3EYZA 4JBCA 1ELOA 2BACA 3PM9A 4LRAA 2KT3A 4RBVA 3G6ES 4TU7A 3CC2S 4RKUC 1X4AA 5SUHA 4O4RA 2C3YA 4DLEA 1HI0P 4NLGA 1TL3B 3R9LA 1LWCA 2LCWA 3MM6B 4FP9A 5HL7Q 4JV5J 5CZVA 2CNNB 3ILOA 3ISZA 2AJQA 2CJAA 2MZTA 2AGQA 1WHXA 4ZDNA 1IXKA 4LBIA 4KC5A 2MJNA 1CJVB 3K7RA 1M1KT 1FE0A 4YB5A 5DRKA 4IUFA 4Y34A 3RAXA 2IVFB 2HNYB 3GE9A 5CYQA 4CO3A 2VPWB 4HR2A 2VBYA 3Q8SB 1TP7A 1KVJA 4UZBA 4EEYA 4DXLA 1JJHA 3CCMS 4CO5A 3KLFA 2YNGA 1Q4RA 4WIIA 1F3FA 3IS9B 2F3JA 3M8SA 5IQ6A 3SXLA 1UFLA 2ZJQQ 1JLQB 1T05B 2YKPA 2RQKA 4WBFA 1RAOA 1VYAA 5C25A 4RUBA 5D4NA 1F5CA 2H4WB 4MH8A 1LWEA 2QRRA 3MM5B 3Q8QB 2C2EA 3MD1A 2C2NA 1UFKA 2IM3A 2NSBA 4TXSA 1N5QA 1RYSA 2B9XA 3TWZA 2L08A 1GMWA 2IJRA 4DR7J 1JLFA 5IM0A 2J0SD 4ES2A 3V81A 4PG4A 2WOMA 2HHQA 4ZIVA 4AE5A 4J5OA 4DPWA 2M5YA 4RNNA 4F4XA 2MJUA 1I1GA 4TY8B 2BABA 5D4PA 5KG2A 2V4JA 4AT1B 4QIWD 1UVNA 2OI2A 2V8PA 4HHUA 3MOJB 4U7UD 3RAMA 5KT5A 4ID8A 4OX8A 4Y3CA 1X9MA 5IC6B 4WKRA 2CJXB 2F4FA 2JRSA 5F8JA 2NREA 1REVA 4HACA 5D77A 4JYAJ 2RU9A 1D8YA 3RUBL 3LP0B 2G0JA 4DN9A 2BJ7A 2VV5A 2KG1A 2CQ0A 1RKJA 5D4LA 5LXRA 3RTVA 3HULA 2ROGA 3I0RB 2J6SA 1FDBA 1S0VA 1I6JA 3FBFA 3TX0A 1FI4A 2HFSA 1TL5A 2P5VA 4F0HA 1XMBA 2V8DA 1RT4A 4IG0B 4NZ7A 1RJJA 2BJ3A 3BDEA 4P7TA 2VG5B 4XTTA 2GMJA 5F8MA 3MFHA 1HBMB 1AW0A 2Y0BB 3OL8A 5J2NB 5EHHA 1N5YA 2LXIA 1SH2A 3IWLA 4Q2LA 5D0RA 1S5ZA 1LK5A 2DGXA 2DCUB 3M8PA 1S9EB 2YH1A 2IM2A 3NS6A 3IR7B 2F9DA 3CO0P 8AT1B 4HKQA 4QW9A 3S6EA 1QUVA 5CYMA 4X65F 3HHNB 4AXJA 2ZHBA 3M32B 2ZBQA 3DDIA 2C3OA 2CAJA 2LEAA 2ASJA 4C8ZA 2DNPA 2YY3A 5A0YA 5F3TA 2SXLA 2JDJA 3H25A 3V4IA 5GADI 2RB7A 3OXLA 2CG8A 1YJUA 4L73A 2MKHA 3SDEB 5AE3A 4FXDA 4HL9A 2DGWA 2G0CA 2RD5C 3UE2A 4ECRA 4RL1A 1TAQA 5BR8J 3BN4A 1U48A 2E5HA 1KLMA 2ATLA 3PV8A 4USVA 4W98A 4QPTA 3D6MB 2ZH1A 2WW8A 4CLUA 3HVTB 4OZLA 4OYIA 3RR8A 1DTQA 2VZ9A 1U4BA 4ZJQA 2WVBA 2K3KA 3K8VA 2ZOMA 1KS2A 4DCOB 2XMAA 2RS2A 1HNIA 1BLUA 5KFCA 3PFOA 2MSTA 2FZKB 2W8KA 1Q78A 4BS2A 2AP6A 2HAIA 5B0AA 3RBXA 4DPYA 5A2QY 2JFKA 1C0TB 2E1AA 4U7CA 2CDRB 1FXDA 1YBAA 3D68A 2UV8G 2PSZA 2W1BA 4F4KA 4DFKA 2EEYA 2GO8A 1LQ9A 1Q8LA 3HT0A 1FJGJ 3EGNA 1PJ5A 1RAIB 2C3PA 3AHPA 3RBZA 5T7LB 3R97A 2NCKL 3VTIA 2JH3A 1TKTB 3UDLA 3DLBA 1TVRA 2IC3B 2QA2A 3MECA 1YWXA 4G1PA 2DJWA 2ZM6J 2FJAB 3C6TB 3MF5A 1OY8A 2OUGA 5I4MA 2QZ8A 3UO0A 4DZ6A 2E5JA 1N56A 3KLIA 5KFSA 2AYBA 2LKZA 4FYWB 2RUSA 2C2DA 3OHAA 3D1OA 2VIHA 2IFXA 2V9KA 2MHEA 5KG3A 3A8EA 3MR7A 4RLEA 2FJXA 4C7QA 3KJVB 2N4DA 2I1RA 5IT9Y 2E9ZA 1SKUB 1WC3A 4QPXA 2AJ2A 3PVXA 3I55S 4A8SA 3IA0A 3CWJA 3FK4A 2JC1A 3MPWA 1HPZA 3PX0A 1N0VC 2UZAA 1XMOF 3M2RA 2IPOB 3NOCA 1B64A 1F3VA 2HURA 3EM1A 1HMVB 3NNAA 4QIVA 3VR1A 2HHWA 1YJNS 3PJ9A 1FK9A 2JC0A 1YJ9S 4F36A 4R25A 4CQ1A 1WDDA 1F2HA 2AT1B 3LTOA 4ZPTR 3IAS9 4PWDB 1AROP 4DX6A 1SJ3P 1Q5VA 1WUUA 3KNAA 1IR2A 3IFEA 4NYPA 3T5LA 5L9NA 5MAOA 2OPPA 2FJWA 5IFMA 4J9VA 2E5LF 1WF2A 3MCSA 5ETQA 3M6WA 2RIJA 4HI2A 2V34A 5HROA 5JXSA 4M5DA 2K7KA 5EN1A 4DV4J 1P8GA 2WSCC 4NE9C 2XNRA 2XSFA 1RTHB 5HANA 2AEFA 2XY6A 4JI7F 2QLFB 1XMOJ 1I3OB 2CZVC 4DV0F 2QG9B 1X60A 4BCAA 2J6UA 3G6XA 3W1YC 1WG4A 4DFJA 5D8HB 1HWLA 5LSOA 4IG3A 3M6UA 1JNZB 2YNFB 3D1HA 1U24A 2Z8QA 3NGUA 4ZLNA 3FEYB 2DNGA 4CLLA 2NS1B 4YR2A 3KK3B 5IC4B 1YRTA 3DGVA 1UA0A 3EGVA 3BKFA 1N48A 1UAWA 2D74B 3IR6B 1S0OA 2L41A 1XMQF 1IKXB 1XNQJ 5DGAA 1N5VA 1UCNA 4YHHF 1FFSB 4KTQA 3JSMA 2E5LJ 4DR2J 2GVDA 2NYIA 3H8YA 1XQIA 1N32F 2WVEA 4F0MA 4M94A 5MLCV 2MKJA 2E9RX 2WK4A 3OUYB 4P9SA 5AXMA 3H4BA 1UPMB 3HX9A 5D78A 1RABB 2FHJA 2XZWA 1QD1A 4WXWA 3IO1A 1JJ2R 1Y0HA 3TZWA 5K5MA 4QIFA 3OT9A 3F44A 3OD2A 1DLOA 3V6DB 3M8RA 3ZNUA 2VL1A 4NLSA 4ZS6A 5A8KB 3W9HA 3DNCA 1APSA 1FESA 4J9KA 1J5OA 2BE9B 1FTRA 2QC3A 1OPIA 3E8OA 1IUJA 3J80Y 3QJPA 3PW2A 4OQJA 1E6VB 2E1RA 1R0BG 3F0NA 1JKHA 3J7A1 1NSQA 4ZPWR 1HBOA 1EIYB 3U1LA 1EETB 1F9EB 3G87A 1RAAB 4O23A 3S8SA 1N6QB 2VA2A 4Z7YA 5IT9U 3LQVA 1JLAB 4RW6A 2CPFA 2P6TA 2XQCA 2FB0A 1FRKA 4OHWA 1SC4B 4WK1A 4M5GA 2HHTA 1TL1B 3CC7S 1IKWA 1V9OA 3K5OA 4QWBA 4DMZA 1T7PA 2O67A 1FX2A 4CLSA 5J2PB 1Y4ZB 3HKWA 2AU0A 4P2XA 1HWIA 2ZH9A 3HZEA 2KJVA 3OFHA 2Q66A 4AQYF 5D0GA 2HHHJ 2RE1A 1KP6A 4LREA 4G3IA 3CD5A 5KFBA 2QGFB 1FVSA 3NKYA 2J5AA 4K5SA 2OD6A 4ZOSA 5RUBA 2RF2A 3NCPA 2OFGX 4F4ZA 3DRPB 1RCXB 3CD0A 3HSZA 3CMES 2CWKA 3VGVA 1SUQA 1FKOB 3MPVA 1S1VB 4KGZB 3H20A 4DL6A 2Z58B 2Y0SD 2ZWPA 3BH7B 3PRVA 4XPCA 1ZZFA 1D09B 2CQCA 1FWKA 3KJNB 1YGYA 3TEGA 4ZVSB 3OLBA 2R7TA 4K7QA 2F1FA 4YR3A 4LSNB 3RG6A 4N41A 2VH7A 3QT7A 3DOKB 2FLLA 2VPXB 4URSA 1RT7B 2V8HA 3DLLQ 2RS8A 2FIUA 4H4MA 2V2ZA 4DL5A 4TKTA 4X62F 2JVOA 2XZDB 4YFUA 1F6TA 2M9KA 1H38A 2W9CA 4QQBA 4IH5A 2MLYA 1F9HA 3ICLA 3GJTB 3OTOF 1RHQB 4Q43A 1VRUB 2FY1A 3BR8A 3EMTA 2KG0A 4GVLA 5A8RB 3BGUA 1D3WA 5KFGA 2HQCA 4ECQA 3SYZA 3JYTA 2IAJA 2RRAA 4WFZA 1U1LA 5I3UB 4FF4A 3BQ2A 1KR4A 1FNOA 1IN0A 3AY0A 1WELA 5IZHA 1U6BA 1NRKA 1TUVA 4JOUA 4XIUA 1QY7A 5KFRA 2AV5A 4OL8A 4GC6A 3QO9A 2VUGA 1T9UA 3OJSA 4LSLB 5IXUA 2IHR1 4FVMA 1RAJA 2XMMA 1QTNB 3KLHA 3PEJA 2FC9A 1D9DA 1NDPA 3D9BA 4PZVA 4RX6A 1YZ6A 3W8GA 1OY6A 1RT6A 4MTPA 2R7RA 2GC8A 2IM1A 1R43A 3KG0A 4HYKA 3QIPB 4N8OA 2BBEA 2K2PA 4HHHA 1M0SA 1WORA 3PW7A 2PFFB 3OTOJ 2FVRA 2GJFA 1RXOB 1JB0C 1RLCL 5KTQA 4IOAQ 2B3TB 3PRDA 2MTLA 1LKZA 2W7AA 1N36F 3DHXA 1PILA 1DBDA 4KV8A 1XC9A 3Q83A 4ZVOB 2ZH8A 3GV8B 3M1VB 3QLHB 3E01A 3CB4A 4CYUA 2R7OA 5KFYA 3H7HB 1KNZA 1FWLA 1M5PC 3VV2B 1WDTA 2UUAF 5LMUF 1XNRJ 2FVQA 3PKYA 1HI1A 4N76A 2ZITA 4LJMA 3BYRA 2ZH5A 2UV8A 4HT5A 4D3HA 4Q0BA 4LFBF 1ZA2B 3NMRA 2VQFF 2HVZA 1DQ8A 2X1FA 2M88A 2BJDA 4ENOA 4MK9A 1UZDA 1UMJA 1HNVB 3RJMB 2ASYA 4B3TF 4GO5X 1CC7A 2B4PA 3AD7C 2V2KA 3KHGA 4DX7A 4WXOA 1HNZJ 1S6QA 3CF5Q 3K17A 1DQAA 1T9YA 1RT5B 2W9BA 1YK9A 2GQ2A 5H9FK 3AQPA 5CYQB 4QR0A 1HARA 3EXCX 4DV2J 2UUAJ 2R3VA 5LOQA 4DS5A 2ROPA 3KG4A 4C0BA 4LFBJ 2HG4A 3IP0A 2JOQA 2OD4A 3JTNA 2Y3YA 2VQFJ 2QYGA 2D9OA 3FBCA 9ATCB 5HLFA 2DH9A 3MR3A 1BHNA 2YPYA 3DI6A 5C25B 4F4YA 4X64J 1LWEB 4G1QA 4UT4A 4HDHA 3K5NA 1A6LA 1HBNB 1U6FA 1H2VZ 2P9EA 1Q86T 1PAUB 1CBKA 1NPKA 1Q95G 1X4HA 5HVHA 1JLFB 2Y1LB 4OX7A 3LPEA 4LIWA 4HH1A 2N3LA 3LPYA 1Q79A 3V81B 5KFQA 2ZFHA 2CYYA 3MUMP 4X4QA 2WOMB 5F8HA 1S77D 3GJQB 2ZZTA 2B6AA 3QBCA 3MPDA 2E7VA 3ZTRA 2GW8A 4ILMA 1FF2A 2ZH6A 1HYSA 1BQNB 2V4JB 3KYLA 4F2SA 3AT1B 3PNIA 1NZ8A 4A4JA 4EO8A 4M5IA 3CW2C 1B7FA 3CCLS 1MMDA 5CZXA 3AOAA 1REVB 4HACB 3I5AA 2VHGA 3VAGA 1Q8BA 2Q3PA 4CM2A 2FTRA 5K8PA 2B5JB 5J2QA 4OIXA 3MMBA 3RU0A 1URNA 4NA2A 4JUZA 4CTAA 4NCAA 1XWLA 4AD6A 4ZVHA 3UD5A 4OI6A 3BO2A 3UN2A 2BOPA 1SXLA 4LUBA 4NASA 1RT4B 2LDIA 2DGQA 4DV7F 3DCAA 4ES3A 2H1YA 1T9WA 3WZ0A 1FEEA 4TQSA 2KT2A 3MMCA 1EQ0A 1HWKA 1N52B 4X4NA 1SBRA 3GB0A 2KDOA 4CWBA 1M1GA 1R8HA 3MUVP 2HBRB 4YEAA 3M8PB 2HFNA 4JI1J 2HRYA 1FE4A 5CYMB 3EZ5A 2WSFC 3W2WB 2HLTA 3D2WA 4O44B 1T0TV 4X4OA 4JI6J 5KFUA 5E5NA 1RWKB 4J7CA 3FSYA 4ETXA 2OPSA 2BXJA 4OHZA 1CJTB 3U27A 1YG0A 3DYAA 2FY8A 3NGSA 3JSRA 3L9ZA 5KFNA 2QA4S 4GKJF 4ZN3A 4DV7J 1UVLA 2CNKB 4WZQA 4ITSA 3CT9A 2DKOB 4ECVA 1EHWA 1RK8A 1FRXA 4B3RF 1AYEA 3MCMA 4USMA 4KBIA 2HW3A 4WYWA 3I56S 3CJ8A 4WTYA 2DCLA 2GX8A 4NI2B 4WE1A 2QSFA 2LQJA 2XSJA 2GNKA 4CT8A 7FD1A 1NXIA 5F3ZA 4KRWA 1DTQB 2ALZA 4X2BA 2VDIA 9RUBA 4M63A 3R5BA 4LF9F 3O6QA 4IRCA 4PRFA 4F3OA 4TU8A 2RNEA 3M8QB 4EFAC 1TL7B 3I0SB 3GJSB 3WHIA 2VICA 3GFYA 3DOMA 3J7ZT 3BYPA 2JEIA 1NK6A 1U6ZA 2AJ4A 1VQ8S 2GQQA 3C15A 2WBMA 1IBLF 3CJTA 1KONA 1G4CA 1VC0A 1LW2A 3L7OA 3IMQJ 5BYQA 3FRZA 3Q22A 3UDEA 3CNQP 3MTJA 4AL5A 2M52A 1FTCA 3CSKA 3POTA 2OO4A 2ZBPA 5DM6Q 1DARA 1TVRB 2BJ9A 3TJAA 3KLEB 3MECB 1RWPB 1IJFB 4GVBA 3M4XA 1W26A 2V69A 3D66A 2R8HA 3H40A 1TL4A 2EKYA 3DM2B 3DOLA 4MIBA 3QRPA 1EB0A 2XC9A 2J8SA 1PYOB 3QWUA 1GH8A 2KVQE 3TA0A 4ER8A 5ITHA 2COLA 4OZ3A 3CXCR 3LOUA 2KN4A 4FPRA 4LFCJ 3DU5A 2CUYA 2XYGB 3IXQA 1Q8KA 1U8WA 2R7QA 1TR0A 4ECYA 3BS9A 4ATNA 4RW8B 4PAAA 2ZE2A 3CJKA 2DXDA 4ZVEA 4J9OA 2RHQB 3KFWX 2LVWA 1H2UX 5KG5A 3NGRA 5CHCB 4ED1A 3GIMA 3HZGA 4CT9A 3NMAA 1RHRB 3T1YF 3C3LA 1VQYA 1X7VA 4ZP8A 2CA9A 5KFOA 3PDNA 4Q8EA 2DNNA 2FVCA 1VOMA 1PSDA 2AYEA 2BW7A 4J9LA 7AT1B 3P45B 1VIOA 4I7FA 3LWLA 2OPPB 4RUCA 3IWXA 2QO3A 2QE5A 4LBPA 1HI8A 4LVOP 2Z2MA 4TVAB 5HROB 2PI5A 4M5DB 1IM6A 2C2MB 5D6GA 5HMZA 2HVIA 4X4PA 4ECTA 2FLOA 1TL3A 2YNIA 1NCLA 1NKCA 2CXEA 2NXUA 5B08A 2D9PA 3T1AA 4IG3B 3N79A 4EWTA 2U1AA 3CC4S 1QSLA 4Y2CA 3CCZA 4PQAA 4YB7A 4CH0S 3TVKA 2JNJA 2M3DA 2N3OA 2IA6A 2HNYA 2XWYA 1VGYA 3QRQA 1LOUA 4DL4A 2IDLA 3M6XA 2EXUA 5DG9A 4WTOB 3CJ2A 3GSDA 2LEPA 1GX6A 3CMAS 5IV4A 4ED2A 4TYBA 3PX6A 3FCWA 2MY8A 3HHKA 1QE1A 3HFKA 2IJNA 2E44A 1YRXA 1PIEA 3JSMB 2GVDB 2PD1A 3T6BA 2CQIA 5GAGI 2FHMA 1B4SA 2HBYB 1NKBA 2ZOGA 1NK0A 4EBCA 2VOPA 4B9LA 5HAOA 1T05A 2CWXA 1NH8A 1OY9A 3KK2A 3KTQA 1SC1B 4Z7CA 3EVOA 4MIAA 5C7PA 4P7VA 1YLXA 2R7WA 4Y2KA 1UEUA 1WI8A 1DLOB 4P71A 3TUZC 3L3CA 2IMOA 3NGDA 4ZLJA 3FSIA 3S1TA 5GAHU 2BA9A 2FD2A 1IR1A 2VONA 3MEEB 3P6YC 4ZK7M 2XI3A 4FNIA 3TZYA 1NH7A 2KHCA 3DLKB 3GONA 1CPZA 4CO2A 4NYOA 4Q2MA 4YY3F 5H9EJ 2BJEA 1JJ4A 3U1MA 3LP0A 3TAPA 4DZDA 4JI3F 3IBWA 2W2PP 3GCXP 4DUYJ 1NJXA 1Y7PA 4RW6B 3I0RA 4MMOA 2RSQA 4N5SA 3Q8RB 3VZHA 2NSCA 2V5HG 4DV3J 1IKWB 1T11A 1DJ0A 3G6YA 1AT1B 4L76A 1KN6A 4ZVRB 3CO9A 1RADB 2ZUAA 2E29A 3NAHA 4OJGA 3MM8A 1HBMA 1B0VA 5F0UA 4LF8F 3CCTA 2LXUA 2OEMA 5KG7A 1U49A 3RZAA 1UEKA 5J2NA 4IO1A 4F4AA 6AT1B 4RW4B 3SFUA 4HH0A 2GGPB 1NDCA 1SVDA 1Y3KA 2OPQA 1O51A 1S9EA 4R8UB 5EX3A 2O3DA 4W90B 4P72A 2Z4PA 2FUG9 5DQGA 1WG1A 4YY3J 3M32A 4AUKA 1SUQB 1DFDA 3O5TB 4B9MA 1ZZNA 1HD1A 3NXZA 4JI3J 3UN3A 2W9AA 2X51A 2UUBF 1YX2A 5IWAF 4ZIWA 1MWYA 2LYVA 1JJCB 4L74A 1KQFB 2YKNB 3P5TL 4LRCA 3UCZP 4FZVA 2J7KA 3OVSA 5B0GA 1H72C 1SH3A 2FVSA 3SDEA 3TJ9A 2C42A 5DQHA 2GQCA 2HQIA 3KUGA 1RWVB 1LV5A 3A12A 2VFVA 2HVDA 1WSRA 3KHRA 3FNNA 5J1EB 3DC2A 1PAEX 1RSCA 3DDNA 4LF8J 1CULA 3SCIE 2YPZA 1VBZA 3KLGA 4H4MB 3KWMA 4M5KA 4RWXA 3QAEA 1RBLA 3HVTA 3ENAA 2W9CB 1PO6A 2HFUA 4ECZA 1Y5NB 5LJ3Y 1RB0A 2P2CB 4F2RA 1P6TA 4BLGA 4OI3A 2C22A 1CJKB 2BVZA 3SZ2A 5FDLA 2OHDA 2VG6B 3GG0A 4K0KF 4O3QA 3CUNA 4EU0A 2AEJA 2GHVC 3OXFA 2A2DA 4ZITA 2KU7A 3JYTB 2HQFA 2UUBJ 3P8BB 1S1UB 3BGFA 1C4CA 1ZPWX 2QN6B 4ZCMA 2DGUA 4NCGA 1AFIA 1F0XA 1Y10A 3RR7A 2MKIA 1C0TA 4DR6J 4OZ1A 4B3SF 4I6YA 3QO9B 1KRPA 4A47A 1WJ9A 2MKKA 3U1NA 2XY5A 4I68A 1NKEA 4DR4F 2M70A 3G6VA 3FKBA 2DO0A 3M9NB 2CJ9A 1UJ4A 4OI0A 1RT6B 2C2KB 2N7YA 5HSPA 1TKTA 1VCTA 2HMIA 1GXLA 2IC3A 1EQMA 3M05A 3AXMA 1OSDA 2FDNA 1VQOS 4CLTA 1SC6A 2F8MA 4OHVA 3EXYA 3EUNA 1N4LA 3M6VA 2KM8B 1T02A 4K0KJ 2W25A 4WP3A 2X1GA 1B70B 2YWEA 3R6LB 4QYRA 2R2UA 3TOQA 3UD4P 1ZM2A 3R27A 3I32A 3CVKA 1SI9A 2YNHA 1PJ6A 1NLKL 5JMNA 3E01B 3OFGA 4CYUB 3H5XA 3KJVA 1ZPVA 3GYGA 2IIHA 5HP1B 3HMJG 3HJVA 4RW9A 3RBEA 1NJWA 1N34F 3VQTA 2ZC4A 4DR4J 2QIFA 3LW5C 4OJ1A 2DGOA 4LRFA 4IRDA 4Q0BB 1FRHA 4IQMA 3SCLE 1HMVA 3AOBA 2UVUA 4I2PB 3LP2A 1NEEA 1D1UA 3MWBA 2VA3A 2VODA 4DHVA 2DHAA 2HIYA 2KVIA 3OPKA 4PWDA 4K2XA 2CNLB 2PT0A 3GILA 3SQOP 3HHLD 4PG5A 1VISA 1S6QB 2G13A 4K59A 1UW4A 4C11B 1Y11A 2IVYA 1MG7A 4H4OA 2HRTA 5CQGA 2ZC3A 4FKXA 3NP5A 5KT4A 1Y00A 3G9CA 2DGVA 4FYYB 3R2CJ 1FRLA 2R8JA 4NLXA 4ELVA 1GMWD 1U1MA 5T41A 1FD8A 3QSYB 2QMXA 3J7Z5 2CQ2A 2K3IA 4ED6A 4IFVA 3KKFA 2VDHA 2LQ5A 2CQPA 5ETLA 5HLFB 2YNFA 4LF6F 1QJHA 3R5AA 3RRHA 3NOGA 4QJVA 3KK3A 3CGIA 3I5CA 3AA9A 1MN7A 4IR1A 3TZXA 4X4TA 1E6YB 2BQ3A 3N6MA 3T41A 4UQTA 4DUZJ 4OHYA 4ZPDA 3OLAA 3BKUA 5CH7B 3P49B 2YWGA 4I0WA 2BMBA 4GRSA 4I2QB 2DRDA 5DDOC 2JFDA 2B6AB 4KAIA 3BV8A 1HYSB 4C8YA 4NXMF 1C1CA 1W2BR 3RRGA 4JI4F 2LP4A 4FXWA 2D3O1 4WFXA 4Z2XA 1QAIA 2OGUA 2JZ5A 2HAFA 2LQBA 3CCUS 5F9LA 5KFXA 5J2QB 4XPEA 1GXTA 3OFEA 3WX8A 1R7IA 2L48A 2KXNB 4DFMA 2DXEA 2V94A 3MAQA 2RMLA 3FRYA 2J9EA 4LF6J 1SQEA 3TO8A 4XO0A 3CULA 1AB8A 4KHRA 4OI1A 2X1BA 1FNXH 1SV5B 1SIWB 5L1LA 4X4SA 5E41A 1E6VA 3HK2A 4F3MA 3NEKA 2J6TA 1MROA 1EETA 1XBWA 1N6QA 5KFVA 3KNGA 1N54B 2IRYA 2VC1A 4UOHA 1U8SA 2EG1A 3RYLA 3W2VB 1H98A 3QGGA 3CD7A 4NLUA 4Y2IA 3CCES 4QOTA 3PO5A 1QLNA 2LEBA 3KDOA 2L9NA 4NEYA 1UWBB 2F7VA 1H2TZ 4S0MA 3X1LB 4U8YA 1NK5A 5J2PA 5HMYA 3LP1A 1IBKF 2OPSB 2XS7A 4UOGA 3DYAB 4WJBA 1TU0B 5JJBA 4C8NA 2N82B 3EE3A 3SSRA 2JHEA 4PYAA 5C2GA 4ZCIA 3DRPA 4K4XA 3JS9A 2YKQA 4O0IA 2O66A 3LO3A 4WPAA 1S9GA 1VC6A 4O3SA 4OV1A 1Y5IB 3FQLA 2DIVA 4WF9Q 1PC4A 4WFAQ 2AIRB 2I9SA 1FKPB 1BC6A 3WC2A 1RQ0A 2NXJA 1FKOA 1HIYA 4WE1B 2B9EA 1Q16B 2XSJB 2CPIA 4O3RA 2RRBA 3KXDA 4K5RA 1S57A 3LUYA 2OFHX 2UXCF 1ITPA 2D69A 3ITHA 1UJ5A 1WC6A 1RWOB 1FFGB 2LDYA 1NUEA 1KFDA 4LSNA 3DOKA 3M30B 2DY9A 1RZMA 3DOMB 2NUHA 2VASA 3HD2A 3AFGA 3VZIA 1FDAA 3UNGC 2AKWB 2ZH4A 3C6UB 4C6AA 1U2RA 1C0UA 4USUA 1FEHA 4OZ5A 2IRUA 2XYHB 3W5XA 2FJEB 1U26A 2ZUGA 2ZNZA 1D9AA 3W66A 1WC0A 4PWWA 3POTB 4DPXA 3HPOA 1X4DA 2DVIA 2XMUA 4YOEA 2AF6A 4GVBB 1A0OB 4UOFA 1IKVA 4Q44A 3UDVA 3MMAB 1RA7A 3DOLB 3S7RA 3HSGA 3K5MA 5KFWA 4QBUA 4N47A 2UU9J 2WZ1A 4LSLA 2MZQA 4AYBD 2FQQB 2DY1A 5JUMA 4CLPA 4C3MA 3D28A 3CJ5A 2HS3A 3SQGA 1U1OA 2GAHC 3T1HF 1NMEB 3PX4A 3QIPA 4B9UA 2QFIA 5GAHI 4E2FB 2MB0B 2ZE2B 1V3RA 1BY9A 2BZ2A 2DH7A 1GQEA 4UZCA 1RTDA 5JVGQ 3H42A 1NO8A 3BPDA 4C97A 3TI0A 3I9V9 3TQEA 5DDQC 1U1NA 3AD8C 2ZZNA 4ZPVR 3ZXWA 2EKNA 2V0NA 3M1VA 1HR0J 2I2YA 2XZTB 1XR6A 3I6PA 1TUWA 1ROFA 1R6VA 1NB7A 1ICEB 1FERA 3L7PA 3HO1A 4F8RA 2CQBA 2OPRA 4DU7A 3LALA 3EVWA 1TKDA 4EYHB 3OL7A 2Y8WA 3CDBA 1TFWA 3UCUP 1RKIA 4KT0C 5F8NA 1RU1A 2YWHA 2ZH7A 1HNVA 1BWEA 4RBUA 2YNIB 3K5PA 4P2SA 3VHQA 4FF3A 4LRDA 1MNEA 3PYDA 1WHVA 3RB4A 1S0NA 4U6PA 2KI2A 2IA0A 5B7WA 2XWXA 3WX4A 5C24A 1K73T 1PYSB 2VQEF 2J9DA 1RT5A 2R9LA 2VPYB 4YDXA 1AUDA 4K4ZA 2WB4A 1Y3JA 2ZJPQ 4J9SA 2PDAA 1QE1B 1JXVA 1TQLA 4PKDB 2UUCJ 2ASDA 3TA2A 4NRUA 2GVZB 3THVA 3OV7A 1B99A 4DR3F 2ALYB 1X8DA 2Z56B 4ZJOA 4X66F 4YDDB 3PW5A 2BW2A 2VFUA 5E0OA 2P9GA 1L3TA 4TLRA 1U45A 2V2QA 3OL6A 2GCFA 2CQHA 3D0GE 3NWRA 3G71S 3KK2B 3DFEA 1VQ5S 2OMLA 4WYLA 1HBNA 3IRWP 4J9NA 3PXGa 3J81Y 1T9TA 4OYWA 5B0FA 1YKWA 3DKDA 2VKRA 5A8WB 3J7YU 4ECSA 4PG7A 1CQNA 3I9ZA 1HHQA 4NLWA 3ZTOA 2MMYA 4B08A 3P5BP 2A2CA 3EGWB 1OQ3A 2J8AA 1BQNA 2WRMA 3FSXA 3THPA 3WIVA 3GIKA 1R3NA 1TK5A 1CSJA 1REGX 2PN6A 1MLAA 2B5JA 5F8GA 3MD3A 4UOCA 2CKWA 1NM2A 2BKNA 2GIRA 3TP2A 5CCMA 1NU4A 4X66J 4MYUA 2FLPA 1RAEB 4IRKA 2JJ4D 5AT1B 4NLRA 3I87A 3CIZA 1KTQA 2CPXA 4Y2AA 1UVKA 1M5KC 2YX1A 1RAGB 2PA8D 3KG1A 2R8GA 3MM8B 4ED7A 4HDGA 2A10A 2OPQB 4MFBA 2F5GA 4WFNQ 4RZRA 2VJUA 3BBBA 3EDQB 1K0VA 2BKOA 3JQKA 4DV6F 2CVIA 2V6AA 4WP9A 3W2WA 4KJIA 3ZZTA 3PHTA 4O44A 3FMWA 2HS4A 2RU3A 2RT3A 4OYMA 2I38A 4I6AA 5K9FA 4TLQA 1YI2S 1GTEA 5E7OB 5EX0A 3O1LA 2OAUA 3CMQA 4WFBQ 2D1CA 3EWGA 4H4KA 1CJTA 1F60B 4ZVPB 1S6UA 3TARA 1U1QA 3HD1A 1BXNA 3K8WA 2XLKA 3CE8A 2WONB 3I82A 2EFVA 2G0IA 4C48A 3HP6A 3MXHP 1EAYC 3ENWA 2J7UA 2KZMA 3M8YA 4MKYA 3SCJE 1N33F 1CULB 2FZCB 3KLGB 4FF1A 1VQSA 5LM7E 1R8AA 3DLGA 1M5SA 1HW9A 1GEHA 4NI2A 5B0EA 3MDFA 4ECUA 4UTGA 5IQQA 3UW1A 3PTWA 1SQFA 3BR9A 1NJZA 3JAMU 3CTRA 2EVZA 4X65J 1BGXT 2IY5B 2RILA 1V5IB 4DDFA 5FDLB 2HWHA 4NLPA 4C98A 5U47A 1OQ6A 3BGRA 3PRBA 5IV3A 3M8QA 1TL7A 4M1KA 3I0SA 1YTYA 4YQWA 3BO4A 2W01A 5K14A 2DR8A 3FCHA 4I6WA 3MM9B 4NCGB 2XHWA 2KM8C 3DLEB 3PKMA 1HD0A 4DPOA 1QAJA 3QYYA 2KZZA 2NPIA 4TU9A 2MZJA 1RLDA 1X4FA 1KQKA 3L7UA 3TW0A 3J81U 3IBFB 4KSEB 1S49A 2KB2A 3CCRS 1WKKA 1N33J 4EZ6A 3JTOA 1IBMF 5L1IA 4USWA 3MURP 4DR5F 3F73A 2B7BB 1HQUB 1U1KA 2HMIB 4M5MA 4RNHA 2GJIA 3KLEA 2MQPA 4JP8A 3AJ1A 4DEZA 1S1XB 1HFEL 3MEGA 1D0EA 2GAGC 1BQXA 2VD3A 3DM2A 4TNOA 2LA6A 3HKZD 3SBMA 2ZVSA 2RVJA 2H54B 4A8MP 2P9CA 2DK2A 1H7XA 2IM0A 2XMVA 5C2CA 1TELA 2HNZA 3R2DJ 4HEA9 1FT8A 2H65B 2RUGA 4P74A 1T3OA 3ZZ0A 2XNQA 2YNHB 1IM4A 2DNOA 3K2YA 1VC5A 2LU2A 2HWIA 1NAQA 4P73A 4RWWA 1Y5LB 1YJ7A 2HHVA 4Q7AA 4RW9B 2G2ZA 4RW8A 5F8LA 1C4AA 1RHUB 3THTA 2R8KA 3B4MA 4DR5J 1SPBP 3DMJA 3E3XA 3AH6A 3W61A 3FQKA 2I0XA 4KPYA 3LP2B 2OJ3A 1RGVA 2PO4A 3GIRA 2ZHAA 4Y0FA 3A1YG 4OYBA 3T5HA 2AD9A 4ZPCA 4QU7A 1YQHA 1J5EF 3VVUA 5DLGA 2MQOA 5IOLA 1RWXB 3GQCA 4H4OB 4N56A 4DN0A 2QT7A 1VHIA 4CM0A 5KFDA 1X0FA 1PGZA 2PMWA 2R2TA 1RAHB 3TEHB 3V6KA 4BHQA 1R31A 5GMKa 2IJFA 4BWMA 1LW0B 1ZAWA 2HLUA 2ZBCA 4ES1A 5IT0A 1NDKA 1SL2A 4NLOA 4IFVB 1B0TA 5F41A 5LL6d 3A8IA 1HHSA 4FF2A 1FRMA 1OPZA 1U09A 2XI2A 3GJRB 4X84A 2AMCB 3T19A 1JIHA 2VF3A 2MLXA 2PGCA 3BBCA 1SJQA 1KWMA 4PG8A 4UW2A 2W4DA 3QZ7A 5KT3A 1DRZA 4J9UE 3EZOA 2HFOA 3PZPA 2RQ4A 4NLQA 4KQZA 2G1DA 4E98A 1UW9A 4YB1P 3P4UB 3T5JA 2MLZA 3QPIA 3CJ0A 3BQ1A 4CLKA 2QLJB 1CVJA 1JLEA 2OMOA 3TUPA 2R2RA 1WC4A 4OX9F 5AE1A 1T3NA 1X9SA 2VG7B 2MQQA 2XY7A 3ILIA 1C1CB 1F5AA 3MGJA 1RHKB 1OIAA 1WHYA 2MHNA 4EBDA 2B8QA 1I94F 3T9ZA 4JI7J 5HQ8A 1GX5A 4I56A 4N7TA 4DV0J 1N5SA 4DQSA 3EPIA 2GJ2A 1NSPA 4W92B 2HNDA 4KH1B 1XK8A 1N88A 4R5PB 2HFZA 3OSNA 3GIIA 2RRNA 3NRBA 4QW8A 4BBYA 3FJ2A 4JI2F 1SCJB 5FD1A 4MT1A 4DWIA 2UP1A 3MEEA 1IQZA 2J9DE 2FHKA 2BQUA 3EGZA 1YZ7A 3DLKA 1RI7A 1I5OB 1G6BA 1XMQJ 2KFNA 1O5JA 4NMXA 1EKSA 2JSXA 2QV6A 1Q7YT 1S48A 2YQ3A 4YHHJ 4K4WA 3LA0A 3NG8A 3PIOQ 3VAHA 2YKAA 2M8HA 4OX9J 5AJ3F 1MROB 4C3LA 5LXYA 4NL5A 1N32J 2HK2A 2X3DA 1UKUA 4OLPA 4DQRA 2H5JB 3NNHA 4GKKF 1SKRA 2LU1A 1UTAA 1R6YA 1UVJA 4JI8F 1S12A 4ZJLA 2RQCA 1I94J 4ICLA 2GIFA 3QSIA 2BJ8A 3ZO7A 3WQPA 1X4GA 4TQRA 4DQPA 2FPHX 5G4DA 4DFPA 5IS2A 3IM8A 1FO1A 4J90A 3LP1B 2WW4A 4J9MA 4CRJA 1UFWA 3BSOA 1BQMB 4KGVB 1VIXA 1HKAA 5KFLA 4OYXA 4RW4A 2GGPA 2AZ3A 2DRAA 2IYGA 4ID5B 2EFNA 2V4QA 2MKCA 5ADZA 4R8UA 1JMTA 1S9GB 3D3CJ 3GTYX 5E3QA 5HBMA 1QSSA 3R5JB 2HHUA 2ACMA 2QX0A 1QVGR 1V5VA 4UQGA 4OYPA 4FBUA 1ZH5A 5DQIA 2W4CA 1DHMA 4DJBA 4OZNA 3TR5A 4CLYA 2CQDA 4YP3A 3B6BA 3OTDA 4RNFA 2YKNA 4UUXA 1PCAA 4ZVTB 3WIUA 3TRGA 2HQ3A 3ITHB 3NBPB 1NSKL 5GAGU 5IT4A 5K8MA 3G8SA 2A1BA 2HYIB 3JTPA 3DLJA 4OI4A 4QYZJ 4A8WA 3ENVA 4RW7B 4AQYJ 5J1EA 3R7BB 2J76E 3GU0A 2DNKA 3H2LA 2GA7A 2AEMA 3PYGA 4U9RA 1NPRA 3GFXA 3PCOB 4KHPF 3QFHA 1UZHA 4A8QA 3D7SB 3M8WA 3LGMA 1S7IA 2VBZA 1LXJA 4YR0A 1YBTA 3ZC4A 1M5OC 3R1LA 1C0UB 1UP1A 3MAAB 2I8EA 1U0HB 1CJKA 2NXCA 1MSWD 1FJCA 4NXNF 2VG6A 2CNOB 4QZVB 4ZLLA 3H5SA 2K8GA 3ISNC 1S1UA 1IKVB 4C4WA 4QWAA 2EI5A 4U96A 2BEFA 2CPYA 2HRUA 2E9TA 2CQ1A 1NK8A 1TKZA 3B4DA 3SV4A 2ZZMA 2YBVA 4LF7F 4MKBA 2JEJA 2M0GB 1RU2A 1U1PA 1ULRA 5KFEA 3N01A 1WC5A 1X5TA 3SQGB 2BX6A 4X62J 1UPPA 3J7YI 2K7JA 2PIIA 3VALA 5KT2A 3TANA 1GXUA 4IFYB 4JV0A 2MYFA 4O4GB 3AODA 5I3QA 5D3GA 4R0JA 1SJRA 1RTDB 2RAQA 1TKXB 4ALZA 1YJTA 4YUDA 1NZAA 4DS4A 3G86A 3KMQA 4UF4A 4BDPA 3C16A 3LAKA 3EDRB 1IKYB 3W5YA 1P1TA 4WFYA 2W7OA 1KHWA 3FGVA 5GMEA 1S6PA 1GMVA 3O44A 4ZPAA 5HP1A 3FZBA 2UVWA 4F50A 4ZCKA 2GMHA 1VQKS 2XCAA 2PEHA 4X4RA 5BXIA 4HLBA 1EX8A 3V6HA 1R0AA 1HHTP 3QT8A 2V8VA 2BV3A 2OPRB 2O5DA 5E3AA 1DURA 4LF5F 3D6HB 2OIHA 1UA1A 4I2PA 2EG2A 4DG1B 3GWCA 3M2VA 1S59A 3BGOP 2DNZA 5DG7A 4MIWA 4DQQA 1RACB 2NZCA 5KFFA 4FKYA 1LFPA 3QAUA 2M4MA 1HQEB 2MZ1A 4DR7F 3S01A 1BD6A 1V3SA 5A76A 4LIRA 1SKSA 3W8PA 1N36J 1S1TA 1OS5A 2FJVA 3Q8YA 2BRKA 2W8LA 3PFEA 5C24B 2HK3A 4C11A 1TTHB 2QL5B 3A3PB 3U02A 1UL3A 4ELUA 2ILYA 2QLXA 2H5IB 4UY8T 1J27A 2YTCA 2XO7A 1M5HA 2OH2A 3BM7A 5LMUJ 4JYAF 1WF1A 3CDEA 4OZ0A 2MEWA 3ZZOA 2DHSA 3MCNA 3HHLA 3QT6A 4GO7X 1QTMA 4F26A 2CIMA 3K59A 3T9NA 2KFYA 4CIOA 2BE2B 5KFKA 4LF5J 2PMZD 1AA1B 2OEJA
chains in the Genus database with same CATH topology
2BM1A 1N5VA 4MK7A 4X4TA 4YHHF 1E6YB 4DUYF 4G1IA 2BQ3A 2BE2A 3N6MA 4KTQA 1VQLS 3JSMA 3MI7X 5FJ4A 3OXGA 2R7VA 2NYIA 2OSQA 1JLQA 4UQTA 3UR3C 3H8YA 4OHYA 4ZPDA 5J2MB 3OLAA 4IH6A 1K9MT 1N32F 4IH7A 1HBUB 5CH7B 5H9FJ 3GIJA 3P49B 4M94A 2YWGA 4I0WA 3RW7A 5MLCV 2MKJA 1E6YA 4DV3F 4KIAA 2E9RX 2WK4A 3MM5A 4I2QB 4E8UA 4K4TA 5DDOC 2Q6CA 2JFDA 3OUYB 1KHVA 3G4SS 1TAUA 2B6AB 4CNZA 4KAIA 4OFZA 5HMWA 4QCLA 3TUJC 5AXMA 2UVRA 3H4BA 1HBUA 1HYSB 4C8YA 2J0QD 3I31A 4NXMF 3HX9A 1FJ7A 5D78A 1C1CA 2O01C 1W2BR 3RRGA 4JI4F 1JLBA 2AX0A 4I2QA 4FXWA 2XLJA 2FHJA 2POKA 2XZWA 3QJLA 4WFXA 2ERRA 4WXWA 1ZM3A 4Z2XA 3IO1A 4DL0C 1QAIA 1Q1KA 2X1AA 1JJ2R 1Y0HA 2JZ5A 4PXDA 5K5MA 4QIFA 1Y9OA 3F44A 3HXMA 1J5OB 2LQBA 3CCUS 1DLOA 1VRTB 3V6DB 1MU2A 2ASLA 3GG1A 3M8RA 5F9LA 3W7BA 2VL1A 4NLSA 1V6HA 4QIEA 1KOOA 4ZS6A 5KFXA 5A8KB 1GXTA 3OFEA 4XPEA 1R7IA 3OFFA 4TY8A 2L48A 3DNCA 3C46A 1WHWA 2KXNB 1APSA 4DFMA 1FESA 4J9KA 1RT3A 4B02A 2V94A 3MAQA 2RMLA 3FRYA 3HVRA 1J5OA 2J9EA 2OTLS 2B51A 1FTRA 1VRTA 3BSCA 3M9OB 1SQEA 5B0DA 1OPIA 3E8OA 1IUJA 3TO8A 3J80Y 5F8IA 1JKHB 3Q23A 3QJPA 1CQMA 1HBOB 3PW2A 4XO0A 1UVIA 3CD6S 3PJWA 4LT6A 5KFIA 4FXVA 4TN2A 4JI0F 4OQJA 3CULA 2EW9A 1E6VB 2E1RA 1F2GA 4KHRA 4OI1A 2X1BA 4CNYA 1FNXH 3TYTA 1SV5B 1WEZA 1Q82T 1SIWB 2YH0A 1JKHA 2CDQA 3J7A1 1EP4A 3BN7A 1SJ4P 4DSJA 4ZPWR 1HBOA 5L1LA 3U1LA 1EETB 4X4SA 4V19X 4NZ0A 4RNMA 5E41A 2VPZB 4O23A 3S8SA 1N6QB 2VA2A 2NR0A 1E6VA 1RISA 1NNDA 3V5RA 3LQVA 3HK2A 2B4UA 2HGNA 1JLAB 2ZD1B 4F3MA 4YMEA 3L09A 1SV5A 2AJFE 2DGSA 3LANA 4RW6A 5BR8F 2CPFA 2P6TA 2QMWA 2J6TA 2R7SA 3HF5A 2FB0A 1JXLA 1MROA 1EETA 1FRKA 4OHWA 4KFBA 4WK1A 1XBWA 4IG0A 3RAQA 3KOAA 1N6QA 5KFVA 2HHTA 1TL1B 3CC7S 3KNGA 1N54B 2VG5A 1IKWA 2IRYA 3OTBA 2VC1A 1U8SA 1IR0A 2DD8S 2EG1A 3DXSX 3ENQA 3RYLA 3MR5A 3I96A 1O0PA 1V9OA 3W2VB 3K5OA 1H98A 3CCWA 3CD7A 3QGGA 4QWBA 4NLUA 4DMZA 4Y2IA 3CCES 1T7PA 3EZUA 2O67A 4QOTA 3PO5A 1QLNA 2LEBA 4MFBB 5J2PB 1Y4ZB 1WEYA 2L9NA 3HKWA 6FDRA 2AU0A 3PJXA 1HWIA 1FHTA 2ZH9A 3HZEA 5C42B 2ZH3A 2KJVA 1UWBB 2DHGA 3OFHA 2Q66A 4AQYF 3W2VA 3TA1A 4H54A 2F7VA 2RF2B 1RDRA 2RE1A 5I3PA 1H2TZ 4LF4F 3ZZPA 3X1LB 1NK5A 5J2PA 5EWEA 2R7UA 5HMYA 4G3IA 3CD5A 4LVNP 5KFBA 1FVSA 3NKYA 3N28A 2ADCA 5C42A 3LP1A 2IBOA 2J5AA 1IBKF 1UWBA 2DNHA 2DISA 4K5SA 2OD6A 2OPSB 1X4CA 2XS7A 2KXHA 4WKYA 4ZOSA 3K5LA 3H98A 4HTJA 2RF2A 3NCPA 1K1SA 1T8EA 3DYAB 3Q2TC 2VBWA 5DDPC 2OFGX 1C1BB 3ZZZA 3R3TA 2CQGA 2DH8A 2KKHA 3DRPB 4WJBA 4F4ZA 3N6LA 2ZBIA 3OR2A 5JJBA 4C8NA 2DPIA 2EWHA 3CD0A 1M90T 4F67A 2N82B 4LQ3A 3HT3A 5DM7Q 1ZTTA 3PIPQ 4DF8A 3HVWA 1S4FA 3O2IA 1FJEB 4B3MF 4EBEA 3CMES 1ZYQA 3SSRA 2JHEA 1C1BA 3CCQS 4ZCIA 1SUQA 3DRPA 4K4XA 2YKQA 4O0IA 2O66A 3LO3A 4DSFA 4KGMA 2J0WA 1FKOB 3MPVA 5KOWA 1S9GA 5DLFA 1S1VB 1VC6A 1JLCA 5KOXA 4O3SA 3H20A 4OV1A 4DL6A 1FJGF 1Y5IB 2Y0SD 3FQLA 5BYRA 2DIVA 2E1CA 4WF9Q 3D54A 1H0HB 1PC4A 3HHEA 3QGHA 4WFAQ 2I9SA 1FKPB 1OWXA 2XS2A 4DR6F 1BC6A 3WC2A 1XTZA 3UDCA 1RQ0A 2W24A 4XPCA 1ZZFA 4B9SA 1FKOA 1YJRA 4NWBA 4WE1B 4ECXA 1Q16B 2XSJB 3GYXB 2CPIA 4O3RA 2RRBA 4CH7A 2JLGA 4WCEQ 2C28A 3V4MA 4K5RA 1M5VC 2CQCA 3T6JA 3SEOA 2E66A 1FKPA 3LUYA 2AGOA 3DLGB 1YGYA 2DNYA 2NQPA 4ZHRA 2OFHX 3OLBA 2R7TA 3H59A 3K0JA 3KHHA 4ED8A 1O8BA 2UXCF 4XAKA 2F1FA 4YR3A 1H6KX 4C2MA 4LSNB 2RQMA 4N41A 3PHEA 2ZM6F 2VH7A 3DOKB 2R7XA 1FXLA 2FLLA 1C2PA 2VPXB 3ITHA 4J9QA 4URSA 4ERDA 1UJ5A 5GVQA 1RT7B 2G9OA 2KO1A 2OP5A 3KMSA 2FC8A 3MTKA 2V8HA 2RKIA 3DLLQ 2LDYA 1KFDA 2RS8A 2P6SA 4LSNA 2FIUA 5AE2A 4H4MA 2ZJRQ 1X4BA 3DOKA 4DL5A 3HJFA 1LXNA 4NZ6A 1S79A 3M30B 4TKTA 2E5IA 5LJ5Y 4X62F 4CCHA 1V3ZA 1ZBTA 2JVOA 4K4SA 3BGRB 4YFUA 5EGYA 4AXIA 2M9KA 2NUHA 2VASA 2R2SA 2W9CA 1H38A 3T3FA 1WNEA 4QQBA 4AL7A 3VZIA 2B7CB 4IH5A 2G4BA 2D3ZA 2FLNA 1YITS 4QU6A 5K14B 4ECWA 3ICLA 1FDAA 3M30A 3UNGC 4A8FA 3PEHA 5KT6A 3OTOF 3ONQA 2NUUG 2ZH4A 4Q43A 3I5BA 4RNOA 1VRUB 2IAJB 2K1RA 3C6UB 2FY1A 2APOA 2D3UA 2XG8A 2EFQA 3BR8A 5BJRA 1QAYA 1KOHA 4IKAA 2KG0A 1U2RA 1C0UA 1R8BA 1FEHA 3BGUA 5A8RB 1D3WA 5KFGA 4OZ5A 4ELTA 2IRUA 3TVYA 1SL1A 2IMWP 2FJEB 2DTJA 1U26A 4I64A 2ZUGA 3HDSA 2ZNZA 2B9WA 4ECQA 1D9AA 3SYZA 4NCBA 3JYTA 5LSRA 2QYCA 2H9ZA 3B8HA 2IAJA 3C6UA 4LMZA 3GYNA 1XR5A 2RRAA 4WFZA 1U1LA 3MM7A 4OZJA 3POTB 3HPOA 5I3UB 4FF4A 4PG6A 3BQ2A 1KR4A 1FNOA 1IN0A 2XMKA 2Z2LA 3AY0A 1TK0A 1WELA 3AA8A 1FDNA 1X4DA 2ZKTA 2DVIA 5IZHA 2XMUA 4YOEA 2AF6A 3I4PA 2MZSA 1U6BA 5K8NA 1NRKA 1ZM9A 3MPYA 1PC5A 1TUVA 1IKVA 4Q44A 3KLHB 4JOUA 1GT8A 4XIUA 2J0XA 3MFIA 5AXNA 3CJ3A 1QY7A 5T7LA 5KFRA 2AV5A 3C66A 4OL8A 3MMAB 4GC6A 3QO9A 5LT5A 4EUVA 1RA7A 2ZHOA 3DOLB 1TV6B 3CPWR 1T03B 2VUGA 1S72S 2DRBA 3S7RA 3OJSA 1JNRB 4LSLB 5IXUA 2IHR1 3K5MA 1P1LA 1RAJA 4FVMA 5KFWA 2XMMA 3MEGB 3KLHA 4QBUA 2KTQA 3KK1B 3PEJA 2LXFA 4N47A 2FC9A 1YIJS 1HNXF 1D9DA 3F41A