1YLXA

Crystal structure of a protein of unknown function from bacillus stearothermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
100
structure length
100
Chain Sequence
MEFAPRSVVIEEFIDTLEPMMEAYGLDQVGIFEEHGEGNRYYVGYTINKDDEMITIHMPFVKNERGELALEKQEWTVRKDGREKKGFHSLQEAMEEVIHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APC35702
publication title Crystal structure of APC35702, a hypothetical protein from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
total genus 22
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18681 DUF5634 Family of unknown function (DUF5634)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1480 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GK1464-like 1ylxA00
1YLXA
chains in the Genus database with same CATH superfamily
1VQ4S 2BACA 3WC0A 3BR8A 2M52A 1IBCB 2GW8A 4AD6A 5AE2A 4F50A 2UVUA 4OZ2A 3NCQA 2AJFE 4Q44A 3P5BP 3MFHA 1Y3JA 5HATA 2EFGA 2FVPA 3CW2C 4I56A 2XS5A 3QWUA 4B02A 3UW1A 1EZZB 2AV5A 2Z30B 4BWJA 5CAAA 2J0SD 4ZITA 2RAQA 4N7TA 3EUNA 2E5LF 4LF4F 5JJBA 3CD5A 4CO5A 2RNEA 1FKOB 3CJ0A 5K5MA 4YDDB 4J9PA 2FB0A 3I0SB 2RDJA 3CCRS 2ACYA 2Z56B 3SSSA 4B3OB 1X9SA 4ED5A 2B6AA 2HBRB 1SKSA 2M8DB 7FD1A 3MM7A 2JLGA 2XS2A 2DGWA 4AL5A 1B0TA 2XI2A 3HCXA 1QDUB 1XMOF 3H42A 1DTQA 3KJVA 4IFYB 3J7ZT 3OUYB 4C97A 3IR5B 1FF2A 3DHWC 5F8NA 3TX8A 2DJWA 2I6WA 2QJ3A 1M0SA 4IFVA 1QY7A 2R7XA 4P10A 4PCQA 1TKZA 4YY3J 2C2DA 3K0JA 1CJUB 5KT4A 1W2BR 2BANB 1LV5A 3LF0A 2AX0A 1DBDA 3WZ0A 2GGPA 4FVMA 2HAFA 2NPIA 1S1TB 1S4FA 3QJPA 3TYTA 3JSBA 3BGUA 1S6QB 3D7SB 4YR3A 2AYEA 4HDHA 1RWMB 3KJFB 2QN6B 1HNWF 1RE1B 3PEHA 1LWCA 2B8QA 2H51B 1VQPS 2MQ8A 3SV3A 5T14A 1VRTB 4B08A 2EFPA 1MROB 3PM9A 3LWMA 4K4TA 2EKYA 4FYVB 3GFHA 2HNZA 3DRXA 4ZCKA 2V2QA 3UQSA 3FQLA 4ICLA 3TOQA 3SI8A 4C0BA 3MM9A 4KH1B 2NXCA 4PQUB 3PRVA 4XDDA 1R43A 2R7OA 1VLOA 3H2VE 1RUSA 2QLWA 4QR1A 1HFEL 4CTAA 2GVZB 3G8SA 4DV6F 3CCZA 2EC0A 4IOCQ 1GMVA 1IQTA 2G9OA 3NNAA 4DN0A 1BUXA 4ZP9A 4F0HA 4ZN1A 2JHEA 1T9TA 2XYPB 5HLFB 1XBWA 4LSLB 4ZDNA 5IWAF 1RWVB 2DEIA 1GX6A 1X7VA 4RW9A 3PHEA 5LT5A 1UPPA 4IDKB 4LF5J 2B3TB 2EBGA 1REGX 3M8QA 4A8QA 2ABYA 3VAMA 2PFDA 4USVA 2C42A 3IRWP 5ETQA 2KHDA 5HAOA 3H20A 2RH3A 1K44A 3CJ5A 1S6OA 3F0NA 5L8RC 4GKKJ 3TZYA 4X66J 2LEBA 1T05B 2HRYA 2ZNYA 2QLJB 3D4JA 4OLOA 2RQMA 2I1RA 2ZUGA 2DPJA 4GMKA 3D0HE 3WX4A 4HYKA 5B7WA 1EKRA 1S5ZA 3G6YA 1YI2S 3UFCX 2GMJA 2BABA 2AJQA 2N3OA 5F9LA 2VQFJ 4A8FA 2RQCA 1U6ZA 1V9OA 1U8WA 3BYPA 3GQCA 2J9DA 5A8KB 3P6YC 2HZVA 1WG1A 1FKOA 3T6BA 3RRGA 3RW6A 1UCNA 5KFRA 2FHJD 4DX8H 3RZAA 3I0SA 1FE4A 2CNOB 3BGFA 1VC6A 4B3OA 5HVHA 3JQJA 5LJ3Y 2MZSA 2VONA 4CLLA 3AFGA 2GJ2A 1PJ5A 3IWNC 3HK2A 3PXGa 3OL8A 4ELUA 3RG6A 5D0GA 5F8JA 2MQQA 2KTQA 3JTNA 2DHGA 1SL1A 5L9NA 1WJ9A 1FHTA 3OUYA 2DNZA 3EVOA 3C15B 1TMJA 4OZJA 4NMXA 3BN7A 3B4MA 1Q53A 4ZVPB 1S76D 4RW6B 5EDWA 1YBUA 2HG4A 2YQ1A 4ZIWA 2VQEJ 2LFVA 3NCPA 3KFWX 4X4VA 5F8MA 1SI9A 4A8YA 1ACMB 1PYSB 3NWGA 2XMVA 1NPKA 1ZZFA 3X3UA 5A8RB 3IA0A 1CJUA 2E44A 2BANA 3O8WA 5LSOA 3PYDA 3N6NA 3OJSA 4DR6J 4DSFA 3P96A 4Y3CA 2IDEA 4JOUA 1FCAA 5JVHQ 4C0HA 1S1TA 3TA0A 3VGTA 1VQ7S 4PXEA 1S6QA 4ENOA 1I6JA 4W92B 2XYGB 4NI2B 4Q5VA 4NYPA 4ZVRB 1BWVA 2ZHAA 4NLTA 4DDFA 2L3MA 3IN5A 1H98A 5RUBA 3IBWA 1JLQB 1HARA 1VRTA 1I94F 1MROA 1C4CA 2HEKA 4DCOB 2WVDA 3IWLA 5B09A 4Y00A 5IS2A 4LR8A 5DETA 2DO4A 3LGHA 3H98A 3HVWA 5HVFA 4PYDA 3ZTQA 1QLNA 4LVOP 2V8DA 3PFOA 5IT9U 2BJ7A 2EWHA 1ZETA 1EX8A 2WRMA 2VBWA 2B4VA 3GV5B 1U1LA 2VPZB 4DF4A 1HWIA 3QT5A 4WTOB 4LT6A 3J7YU 4PQUA 2BYCA 5C2CA 4DLGA 4K4XA 4OZ5A 1KD1T 2GVZA 4MAKA 4DL3A 3Q86A 2RRNA 2XHCA 4WPAA 2CQIA 1XNRF 3MPVA 3CMES 1GEHA 4QU7A 2KZZA 4WF9Q 2ZH3A 5HLFA 4I6AA 4LSLA 4ILRA 4A46A 4DCPB 4C9DA 1H72C 4XAKA 3MUMP 1TUWA 4IOBA 5KFCA 2HNDB 3R7SB 4PUOB 4IDKA 1F2GA 3FCVA 5M2PA 2DPIA 1AYEA 2D41A 4X4OA 4PAAA 4TKTA 2A18A 5E33A 4YB1P 3QGHA 3R7NB 3DGVA 2DXEA 1WHXA 2YKQA 5IT9Y 4GC6A 2XMTA 2AGOA 4J37A 1T05A 3N01A 3I9ZA 4O44B 2XMAA 2MZ1A 4RNMA 1SIWB 4LRBA 1CC7A 1LNQA 2VF3A 2PIIA 2XO6A 2H5IB 5KFJA 5L46A 5G4DA 2J0QD 1UEVA 3HHKA 1AA1B 5F0UA 4ZJQA 3NNCA 4KKOB 5D0EA 3NGSA 3B78A 2C1EB 2F7VA 2QFJA 5A8KA 2WVCA 5AE3A 4LUBA 3Q22A 5KOWA 4K4WA 1FNOA 3W5YA 2E5JA 2BR0A 3HP6A 4PPZA 2HRTA 5E0OA 1A0OB 4HL9A 3BO4A 1Q7YT 2LDIA 4UZCA 1XR6A 2XMMA 5KFOA 4JUZA 4TNOA 1SIZA 1KLMB 5CXTA 4USJC 4IQMA 2HQCA 3W61A 1TKTB 3L9ZA 4MKYA 4M5GA 5HQMA 3C15A 1GK8A 1BLUA 3I87A 3W9IA 5CD4A 4RW6A 1DJ0A 3HD2A 4BLGA 3BGOP 3VVTA 3GIIA 4AUKA 4Y0FA 2VG5B 3D1QA 3EPGA 3D6TB 3D0IE 4L73A 1VOMA 2W7AA 5J1EB 5A8RA 2BW7A 2Q66A 2QT7A 2KO1A 2XCAA 5C5JA 1WC1A 1EP4B 3W63A 1AROP 3KYLA 4ETXA 1NKBA 1YLXA 2CPXA 2FLLA 3W66A 2DY1A 2QC3A 3TANA 1FDBA 4NI2A 2Z2YB 1FVQA 4IO1A 3K7RA 4K0KJ 3CXCR 3VAHA 4TY9A 1XC9A 3HVTB 4C48A 1ZTWA 1JLQA 2YWEA 4Y6IA 5D0HA 3CF5Q 1D09B 2OKQA 3GCWP 2BOPA 3QRRA 3NLCA 3DU6A 1Y5LB 4MFBA 4ED6A 2XQCA 1JLCB 4QIGA 2IVYA 2J0WA 2E9TA 2LEPA 2ZH8A 4RX6A 2IHR1 1UFWA 2W7PA 5J2MB 1WF1A 3NS6A 3N79A 1YDLA 2BQUA 1F0XA 3CMAS 1HNZF 3BO2A 1TKXB 3VHQA 1NSPA 3ZZYA 2W4DA 4CYUB 4YR0A 4HTJA 5HMWA 2F65A 4N8OA 1Q16B 4LR9A 2WW4A 3TNVA 2BVZA 4MYUA 1D8YA 3ZZRA 4PXCA 2ZBCA 2CXEA 4TLRA 2KG1A 2ASJA 5A0YB 1DQ8A 2XWXA 3H5YA 2VU5A 2RIJA 2Y1RI 2DD8S 1VS3A 2D3ZA 1N54B 2XZWA 3QGGA 2IMWP 1VISA 2YH1A 1NAQA 5F3TA 2HNDA 2KRRA 4PUOA 2KYXA 4F4AA 1RAJA 2JLEA 2RMLA 4RKUC 2R3VA 3P8BB 8ATCB 1D9DA 4FF2A 1AW0A 1AFJA 1VCTA 1HNVB 3QRPA 1TKDA 2QA1A 3NMRA 1VC5A 1N32F 3JTOA 2IM3A 4O44A 3KHRA 2FJXA 4YR2A 3NNHA 3PJ9A 1YQHA 4JI8J 4NLSA 2ADBA 3FK4A 3BQ0A 1HBUB 5CQGA 3R8YA 2VZ9A 4JI1F 2LQBA 4KKOA 3KK1B 4DR1J 3BKTA 1ROFA 1KHVA 1RADB 4Y2AA 4OZ0A 2VA3A 1HBNB 4KHMA 1SJQA 1NH8A 3GG1A 4DR3J 3CCVS 5B0EA 2LLZA 1WC0A 4OZNA 3AJ1A 1TUGB 1DAXA 2XNQA 2YQ0A 3P45B 2QL7B 3W8PA 1EQMA 3HJFA 4LRFA 3ISZA 5KG0A 1B64A 5E7OB 5B0DA 2QEXS 4NYOA 3CD0A 1LWFB 3DXBA 5KT5A 1DFDA 5LXRA 2O67A 1KLMA 2I8EA 4DR2F 1WC5A 2XMKA 4K4SA 4JI5F 3GIMA 3M7VA 4OX8A 3K89A 1TKTA 3I0RB 3QT6A 4QU6A 4PWUA 2C2MB 1S79A 2Q3PA 4LF9J 1NJIT 4O23A 2NXEA 3GYNA 2HIYA 3QFWA 5KOXA 2AKWB 5B0AA 1U25A 2M9KA 3EGNA 3D67A 2K3KA 1GMUA 1N48A 2Q79A 4DWIA 4LFAJ 2E1AA 1MU2B 2ZZTA 2K7JA 2IRXA 1FEHA 4ETZA 4KAIA 1GNKA 1AXQA 1Y5NB 4TYBA 2HHUA 5J1EA 3FBFA 2KT2A 3D66A 4ZLLA 4Q0BB 1ICEB 3IM9A 2LECA 2E66A 2X1FA 2Y1JA 1EP4A 2J8AA 4NCGB 4WZMA 4RL1A 1CG2A 4Q8EA 4WFYA 2VFRA 3CO9A 1VBKA 2YX1A 1U45A 3W8GA 3DOKB 3W62A 3Q2TC 4WXWA 1IBMJ 2DXDA 4M63A 2DGQA 1Q5YA 4OV6A 2KI2A 4EYHB 1R31A 1GXLA 1NJYA 5KFXA 3HVTA 1RK8A 5EUHA 4NXMF 4C8YA 4WKRA 5KG7A 5KG5A 2AJ4A 4PXDA 5IQQA 4WWSA 4LF7J 4TY8B 2VPYB 3NL0A 2BDPA 2E7WA 1JLCA 2LXFA 2A2DA 1VR6A 3MM6B 1P9QC 1N5VA 2NS1B 1F3FA 5J2MA 4W90B 1RTZA 3JXOA 2XLKA 3R1LA 3R5BA 4GKJF 3CTRA 3E8OA 4FKYA 1HA1A 4FYDA 1TKXA 4IKAA 4Y34A 4F04B 1F5AA 2R7QA 4CYUA 3VAKA 3LP2B 4YOEA 2PT0A 5U47A 3T41A 3S6EA 4AT1B 3HPOA 1SKUB 1HWUA 3DYAB 5HN0A 5A0YA 4LF1A 3HT0A 1NK7A 4HR2A 1WG4A 4MIAA 4CLFA 4KRWA 2DNLA 3IAS9 3KLVA 1S49A 2C2RA 3RBEA 2RVJA 4B3RJ 2XZTB 4KSEB 3HFZB 1X9MA 5CABA 1LXJA 4F4XA 4FPIA 1YG0A 5AJ3F 4NYZA 2CQBA 1V5VA 1UPMB 5LM7E 4U7UD 3DDKA 1NMEB 1S9EB 4CH7A 3FSIA 4I6YA 3KMQA 1HNVA 3BYRA 4DV0J 2PA3A 5E3CA 2DGOA 4BDPA 3DXSX 4JI7J 1RB0A 1U02A 4ZPAA 1ZPVA 3PV8A 3R5AA 4OI4A 2MLYA 5LMUJ 1HBUA 1PIEA 3A1YG 2MZJA 3KK1A 3R6GB 2ZH9A 4DU8A 1YZ7A 3GONA 3M2RB 3TJ9A 1HBNA 4DV5J 1VC0A 1C0TB 4M95A 4I1TA 2OFHX 1JLGB 3MCMA 9RUBA 2HFNA 2QTWA 4DUZJ 5J2NB 4OX9J 2YNHA 1RWNB 1D3WA 1Q95G 3W5XA 3M8SA 1FESA 2B4PA 1V3ZA 3PX6A 1X0FA 3JTPA 3ETOA 2RUSA 1RT2A 1LWFA 2NUUG 5KFMA 4LRAA 3D6FB 1ZAWA 2XTJP 3TUZC 3HLUA 1F2HA 1I1GA 2NXJA 3K2YA 3NP5A 4PG4A 3BZQA 3GFXA 4PPDA 3I0RA 4EBEA 1TL4A 4U7CA 5KG2A 1HLWA 4P7TA 2ZFHA 1P27B 2E5IA 1BQMB 4DPWA 1FO1A 1Y0HA 1LKZA 2FJWA 4NL5A 2YY3A 1MU2A 2VUGA 1IKXB 2CQ4A 3G71S 2V69A 2W01A 3U1MA 2MTLA 3OLBA 1FA0A 1B99A 2A0FB 4Q0BA 5M2RA 2Q43A 3JB9k 3GJQB 4NCGA 2CQ2A 5KFSA 5GAHI 4AL6A 9ATCB 2F8MA 1FWLA 4YP3A 5KG6A 3DOKA 1B3TA 2CZ9A 2OEKA 2IJFA 1PCAA 2DNRA 2H9ZA 2O66A 2MZRA 4ZHRB 5GMKa 4B3TJ 3I4HX 2DXFA 2HBYB 4O4GB 1ZM4A 2YKAA 2FLOA 2YWKA 3GFZA 4QCLA 4CP5A 5BXIA 2VD3A 2ZC3A 4ED1A 4TY8A 1LK7A 2XHWA 5KFBA 4ZVQB 3M8RA 4B3SJ 4DG1B 1GTHA 3MM6A 2E7XA 2V9WA 4LFCJ 3KLFB 3T5LA 4LIWA 1VMBA 4GVBB 2F5GA 3WX8A 5DQGA 3UPFA 3MMCB 1DARA 4DFMA 1LWEB 4HLBA 4ECTA 3FSXA 3LP2A 1WELA 2YBVA 5E3AA 1TK0A 3DLBA 4YFUA 2CDRB 3V4MA 1HMVB 3DYAA 3W7BA 4DV3F 3KOAA 4A8WA 2JEIA 3MAQA 3DN9A 2FVSA 4J9LA 3TQ1A 5CD4H 2MDAA 3NGDA 2VDIA 4MKVA 1TMMA 1KRPA 4LF5F 3SZ2A 1H3DA 5EX0A 5K14B 4DN9A 3W1YC 1JXVA 4RUCA 1XN9A 3DLKB 1S9EA 2DRBA 3T5JA 2WB4A 4UW2A 4AFFA 5DDOC 2VB6A 3BF4A 2D3OR 3OR2B 4GKKF 1NUEA 1O5JA 3ET6B 4X66F 2QGFB 5GAGI 1ZYQA 2CYYA 2FGCA 2ALYB 1S6UA 3ZNUA 1VI7A 3PZPA 1RQ0A 2F3JA 4EK2A 2RE1A 4B3MJ 2R9LA 3PW7A 3Q2SC 1HQUB 2ZM6J 4O3NA 3M2RA 3TAPA 3V6KA 3CPWR 1BMQB 2A3JA 1FNXH 1C0TA 4F4YA 4DPOA 4N47A 4RU9A 2Z2ZA 1JLGA 3G96A 3BO3A 1T7PA 2JEJA 2W2QP 5J2NA 2F63A 4PQAA 1KOHA 2BA9A 3NKYA 2IY5B 1FX2A 4ZLNA 1HPZA 3VAIA 2AJ0A 2YKNA 2W7OA 2CQHA 3OL9A 4FNHA 3GV8B 2HHWA 4M5DB 4OMFG 4C2MA 2QSFA 2GJIA 4YEAA 1RLCL 2HHPA 1CC8A 1NRKA 4B9SA 2EI5A 2E9RX 1I51B 1WDDA 3A3OB 4Q2LA 3ZZUA 1SJRA 2Y9HA 2HHQA 2HFSA 1CQNA 4C8OA 2CPDA 1BQMA 3CJ4A 3G82B 5KT3A 3RR7A 3KDOA 1X4FA 2VQEF 1IKXA 1N33J 4URGA 2KT5A 1SH0A 1WHYA 2V34A 2I2YA 1YKWA 2B5JB 1IBLJ 4O3QA 1W7WA 1B0PA 2BXJA 2L48A 4U7UK 3BSAA 3GJSB 3M1VB 3GIJA 3IBCB 2MQLA 1MNEA 4XPCA 2V4QA 3GE9A 1Q78A 3OSNA 3ZZZA 4FZVA 3GR0A 3MDFA 2HHSA 2OFGX 3QIDA 2RU3A 2UVWA 2XSJA 4ZHRA 4O4GA 1SL0A 2UUCJ 3I4PA 3TVZA 4CCHA 2VA2A 1TL3B 1VJWA 5ADZA 2UUBF 2EFVA 4P9SA 4NA2A 3QLHB 4ZIVA 2K8GA 1WC3A 1A7GE 4DG1A 3K8WA 1EETB 2HLTA 4O3OA 5D8HB 4DV2J 4L3NA 3KLFA 3I56S 3RAQA 1PGZA 4NWBA 1S6PB 1NU4A 5CCLA 2AD9A 5LXYA 2VH7A 4UOGA 3MMCA 1LWEA 3GMGA 4OX6A 4UQTA 3OXFA 3QJLA 3I5BA 1SJ3P 3H40A 2JEGA 3PJWA 5DQHA 2HVIA 3PO4A 5F3ZA 4QIWD 1PJ6A 2HIQA 3EZOA 5ETMA 1HMVA 1TAUA 5KT2A 1CJTB 2M88A 3JS9A 3LAMA 4FF3A 3K59A 1FXRA 1R89A 2XYHB 1YIJS 2DGXA 5DG8A 2PE8A 3K5PA 4WTYA 5IV4A 2EPIA 1HWJA 3QO9B 3Q24A 3MR7A 1QTNB 1S0VA 2ZC4A 2IYIA 1U1PA 1APSA 1R6VA 4NXNJ 3Q8YA 1CEZA 5L9XA 4BWMA 2QZ8A 1T03A 5K14A 1AB8A 3DLKA 3VAJA 4LR7A 1NB7A 3THPA 3OPKA 2GIQA 3I32A 1R0BG 1IWGA 1HQEB 3M4XA 1J27A 4AL7A 2V68A 4FXWA 1S48A 3FGVA 3OR2A 3HKZD 1UL3A 4E98A 3ET6A 3O1LA 4KPYA 2JNJA 3AAWB 1YBTA 3K5LA 2ZBIA 1CVJA 4DSEA 2VIHA 4OI6A 3FBEA 2I0XA 4PKDB 4UOHA 3NY0A 4PG6A 1HQUA 4TU8A 3M8WA 3KLGB 4X84A 1VBYA 1B7YB 1OYDA 5F8LA 3EMTA 2BX6A 3SV4A 1I3OB 4B9UA 3EM1A 3PO5A 2K06A 4DEZA 1FJ7A 1RT5B 3H8YA 2ZZNA 3TEGA 4X4NA 3A3PB 1X4EA 1DZ5A 2NQPA 4DOZA 3FZBA 1RAEB 4M5DA 2HBQB 4B9LA 5T7LB 3EX7B 3FEZA 1KC8T 1NH7A 1FI4A 3MR6A 3UI3A 5K9FA 2X1BA 3Q0AA 4KHPF 2EW9A 4USKA 1U2CA 3RB0A 1UVJA 2LKZA 5K8OA 4OIXA 2IA6A 1KOOA 5DO2A 1UEKA 1SH2A 2IC3B 3E01B 4K50A 1RI7A 2FQQB 2N4DA 1O0PA 3ELHA 3T9NA 3OJUA 1VYAA 3MR2A 1Q8KA 2B5JA 4DFPA 2GQCA 4KYZA 1SL2A 4KT0C 2ZWOA 1RAGB 3ISNC 3D1OA 3MEGB 3M1VA 3CD6S 3MTJA 1N0VC 3VAFA 2QMUB 4ZVUB 4H54A 3QYYA 5C25B 2DH8A 3ZTRA 1SXLA 4JI4J 5KG1A 1HBMB 4AQYF 2DR5A 4DJBA 2KVQE 4OI0A 2WVEA 2XM3A 4P71A 2MZTA 1S10A 1TL3A 4KR0B 2W24A 1IN0A 3HXMA 2Z2LA 3U27A 2ASLA 3QLHA 4OJGA 3HX9A 3GP9A 4PG8A 3WQPA 5DLFA 3IWXA 4LBIA 1EETA 4X2BA 3RRKA 1C0UB 1LFPA 2VODA 4HH0A 1NDKA 2C3PA 2JX2A 3CJSA 1S6PA 4X4SA 3MUTP 4TU7A 2OTLS 2MLXA 3W2VB 3AQPA 3BS9A 1R0CB 4M5LA 2NZCA 2QG9B 1XMBA 2VFVA 4E0DA 1MWZA 1IBKF 1U1QA 2ZBPA 1J5OA 2EXUA 2MMYA 2A2CA 4QPXA 2V2VA 5HJYA 2GQQA 4OLPA 3DC2A 5C7PA 3FBBA 4EU0A 2NSCA 2ZHOA 4OZ1A 1SUQB 1M5KC 3S7RA 1UWBB 2UXCJ 1UAWA 4DR5J 3QO9A 3HVRA 5C24B 4CLKA 1X5OA 2P8IA 4A48A 1JKHB 3HHDA 3BSOA 4C0OC 1UVLA 4WFZA 3UDEA 4WXOA 3TX0A 1KONA 5JUMA 4HI2A 3U1LA 1WKJA 3BBBA 1FJEB 2ZE2A 2PC6A 1HQEA 1AT1B 2GA7A 4MMOA 2CNNB 5GAHU 4FDFA 1DRZA 2ZOGA 4X4PA 1ZTTA 1JIHA 1GMWD 4KGVB 1YJRA 3LGMA 4CLSA 1ZAVA 4Y2IA 1XNQJ 3DOLB 4L74A 2J0XA 2NXNA 4P72A 4G6VB 4ECZA 3JQMA 3SIPB 5A2QU 4JI8F 2NR0A 1JQGA 1WORA 3L95X 4DX5A 4HT5A 1TVRB 2DB1A 3MD3A 3CDBA 1RCOB 4EWTA 3I9V9 2GS8A 3KLGA 2IBOA 4WP3A 2L9DA 1UP1A 1U2RA 1VK3A 4WFAQ 3B8HA 4O0IA 1V6HA 1VQMS 2CJAA 1N52B 1K47A 4P75A 2M70A 5LSRA 4B17A 1FJGJ 3V6DB 5AXNA 3HMJG 4WYWA 3MOJB 2ASDA 2JC1A 1RT5A 1UA0A 4A8XA 2Q6CA 1SH3A 2PD1A 2W25A 2E1PA 4FBUA 5BYRA 5GAEI 4FNIA 4XPEA 5DM7Q 4A8OA 5T7LA 4CIOA 4NASA 2J6UA 3BREA 5KT6A 1NK4A 4ZVHA 2OMOA 1G7CB 3S01A 2M2BA 5HSPA 2IFXA 1B70B 1NHKL 4LF9F 4WK3A 1DTTB 5FD1A 4IG0B 2YQ3A 3E01A 4LRDA 4DZ6A 2V50A 5A2QY 2GV1A 1Y4ZB 3OHAA 4LFAF 2OSQA 2EKNA 3TEHB 3QQCD 3IMQJ 5HO4A 3L7PA 3O5TB 1IKVB 4JYAJ 1P6TA 1OSCA 3UDLA 3WDOA 2VJVA 4ZVSB 1M5HA 2BRLA 3DLLQ 3MEGA 2ZOFA 1AUDA 3EGVA 5KFNA 2I38A 1N5TA 4JV0A 5BR8J 3O6QA 1UWAA 2UU9J 2Y0SD 2PDAA 2FHJA 3K5OA 3H90A 3HI9A 4PABA 2U2FA 3BEGB 1N5YB 4ZKAA 5B0GA 1UKUA 3W9HA 2B6AB 2VV5A 3FEXB 1HBMA 1FRMA 2CKWA 3MM7B 1PKUA 4PYAA 2DK2A 2Y8YA 1H2TZ 2KKHA 2HLUA 2WAQD 2FUG9 2CJBA 3LOUA 4O3RA 2HFZA 4CO3A 1C0UA 2N4CA 3SQOP 3T19A 2J76E 5HVGA 2FC9A 2R8IA 1LEOA 4Y2KA 4QJVA 5DQIA 3F44A 1RA6A 3IP0A 2UP1A 1R0AB 1S9GB 3W2VA 2DR6A 3OVBA 2YVSA 3R9LA 4OYAA 2YKPA 4ILMA 2MYFA 4PXBA 1R7IA 2ACMA 4K5SA 1UZDA 3R3TA 5IM0B 3CCLS 3GB0A 3PHTA 2J7KA 3DFEA 1UW9A 3PDNA 4NCAA 4DV4F 1X4GA 4NLQA 1SUQA 1U1RA 4QWBA 2H3EB 2EFOA 1ELOA 1UWBA 5HANA 1FFWB 5C24A 4KQZA 2J6SA 3EGWB 3FMWA 1JKHA 2P9GA 4DL4A 3TUPA 4QW8A 2B9YA 2PMWA 2F9JA 2R7VA 2HNZB 4ITSA 3HFKA 2F4VJ 3IO1A 2CA9A 2M3DA 4DV0F 2UXDJ 1TV6B 5I3QA 2WZ1A 1JK9B 2MLZA 2WW8A 3F41A 2GC8A 2P5VA 1KEKA 1FVSA 1KLNA 1U1OA 2DO0A 5E3QA 1NCLA 2CPFA 1XWLA 2BZ2A 2ADCA 2BQRA 1C4AA 1S0MA 4TLQA 4A8SA 1TVRA 4L72B 3PACA 2FC8A 2FDNA 4Q45A 4R5PB 2H54B 3R5GA 1UFKA 1J5EJ 4IO9Q 4K4UA 4C98A 3P4UB 4DV5F 1HNWJ 2LQ8A 4OI1A 3PNIA 4KPCA 1ULRA 4ES1A 1K8AT 2RB7A 3ENQA 3V6DA 2X7IA 4EFAC 2ZDPA 4JV1A 1EARA 3SMZA 1SC4B 2OUGA 1PBUA 2LXIA 2DHXA 4IRKA 3M8QB 1NDCA 5CYQB 4M94A 2Z8QA 2FHOB 2GFFA 3EPIA 2M8HA 4Q7AA 1JLEB 4JP8A 1T9UA 3BJYA 3HF5A 3A8IA 3R27A 4X65J 1HYSA 3KNGA 2K1RB 1DTTA 3LPEA 4IG0A 4ID5B 1WACA 3BDEA 2G2ZA 1OS5A 4OI3A 4NLPA 1K73T 1IKVA 4N5SA 3NGKA 4FS1A 2CQ3A 4ZVEA 4ELVA 3Q8SB 3UVJA 2P6TA 5DDQC 4RR5A 4ANEA 3A12A 3FKBA 4NE9C 2CJQA 3PYFA 4WFNQ 3EE3A 4TXSA 4YHHJ 4WYLA 2DRAA 6AT1B 4CNZA 3S8SA 3OTEA 3QZ8A 1N5YA 2QL5B 1YJUA 1IUJA 3QIPB 2YNIB 1MSWD 3IG1A 4JI2J 3JYTB 2F8EX 1NEEA 1BXNA 4MYTA 3R97A 3HHEA 3N6LA 4M5KA 5DJBA 2D3O1 2ZBRA 3GSIA 1YZ6A 3HHLC 5LMNF 1Y7PA 3KUHA 5IZHA 4J9NA 2AEFA 4OYXA 1UFLA 3TAQA 3IBFB 3AOAA 1UJ5A 1S97A 1V3RA 3CCQS 4NLGA 3ENAA 3ENWA 3I55S 4F4KA 2HK2A 1R0AA 2HVHA 1S9GA 1U49A 2L9NA 4NLDA 4JI0J 4NA3A 5KT7A 2VPXB 4I64A 4LF6F 4GRSA 4U67Q 1HQ2A 1Q8LA 4YB5A 1PO6A 1RU2A 4CH0S 3RGIA 1OYEA 3B54A 4HH1A 1G1XA 3BH7B 5CA5A 2GIFA 3HJVA 5IM0A 2ZVIA 2DGUA 2SXLA 5AT1B 3I82A 4QWAA 1UTAA 1Z2LA 2FVQA 2G1DA 3E51A 4J9VA 4RPFA 1FT8A 1OY8A 1RA7A 1TFWA 4C3MA 1FRHA 4DS4A 5HQ8A 3PIPQ 1R6YA 4C6AA 1NJZA 4K5RA 2I9SA 3Q8VA 2LEAA 2CUYA 3I6PA 2JFKA 2VHGA 1RGVA 4MKBA 2MKSA 1TV6A 1WSRA 3I96A 3TUIC 4J9MA 1N0UA 3KG4A 2DBBA 3N5BA 3GJTB 4RW8B 3CC7S 1PC4A 4KH0B 5CH7B 4PEOA 1T9WA 4ZK7M 2OO4A 2PGCA 4R0JA 3GG0A 3H5SA 2B43A 4TYAA 6FDRA 4B3MF 3ZFVA 2LU2A 2FTRA 3CNQP 1Z1ZA 4HKQA 2ZM6F 1VDHA 2WTFA 4R5PA 1NHUA 2OP5A 4CI0B 3AXKA 4U6PA 1FDDA 3IS9B 5KFDA 2JRSA 3N4WA 5HK4A 5KFPA 1H6KX 4Q8FA 5KFYA 1I94J 1JJHA 3SSRA 2AGQA 1X8DA 3QATA 1V5IB 1YJWS 5HI7A 3KG0A 1JB0C 1H2UX 4UTGA 4EI2A 5DGAA 2W9CB 1Z2ZA 4P7VA 1TUVA 2JJ4D 2Q6BA 2BKOA 4I6WA 5M2UA 2WCXA 1FTRA 5EN1A 4PWWA 2QYGA 5CYQA 3X1LB 1BE4A 1PBAA 2V67A 1JLEA 3ZZTA 1K9MT 3BBFA 1X31C 1S0OA 2FIUA 5ETVA 3NRBA 5L39A 5A6PA 2HYIB 4J9QA 2W9AA 1VBXA 2K1RA 2D74B 1XQIA 2GHWA 5LOQA 4ID5A 1UA1A 4X62J 1T3OA 1ZM3A 4I0WA 2UZAA 1KVJA 3H25A 3C8YA 3QPIA 3T6JA 2HHHJ 4ED4A 4DQSA 3LUYA 2BEFA 4UZBA 4DL7A 1K1SA 2CPJA 3HZEA 1HR0J 1IBLF 3EXCX 2KN4A 3PEJA 2YXLA 4CM2A 1UJ4A 1WI6A 4EO8A 5DLGA 5EHHA 1CQMA 2JSXA 3A8JA 1TK8A 1WEZA 5HROB 1YHQS 1Q1KA 3KLHB 3VWSA 3MOZA 4DR4J 4J9SA 4H4OB 4OYMA 1GTEA 2H5JB 4MJKA 1N34F 3QIPA 2IRYA 1H7XA 1YVFA 1JJCB 2B4OA 2YNIA 3ITHB 2IRUA 3JYTA 1SJ1A 3L09A 2GX8A 2OPSB 1KHWA 5B0CA 2HVEA 4I69A 4HEA9 1MWYA 3NEKA 3FRYA 2WK4A 3J80U 4ECWA 2OJ3A 1T9XA 2XMUA 4DV2F 3O44A 2RU9A 4HVZA 4P2XA 5I4MA 3N6MA 4YMEA 2HWHA 5D4NA 4G65A 2H4WB 5GAEU 3UNYA 2ZH7A 2XZDB 2CQ1A 1TFYA 1KTVA 1RWKB 4AYBD 5E3PA 2VOPA 5IV3A 1LOUA 2OPRB 4UY85 1OQ3A 1RHRB 3B82A 2O01C 2L9WA 4L3KA 3CO0P 3CDUA 3HM9A 1JLBB 3PKMA 4NXNF 4W4MA 2M4MA 1S1VB 1XR5A 2F8HA 5A76A 4XIUA 4MFBB 3J80Y 1S4EA 2DNGA 4J9RA 3R1HA 4E2FB 1M1KT 3KDNA 2W1BA 4CWBA 2HFOA 2CQGA 4FXDA 4U8YA 2ZZMA 3TZXA 3OL7A 2N7CA 2WVFA 1KS2A 1XK8A 3GLJA 3TVYA 4KJIA 1OWXA 4WIIA 4RBTA 3U1NA 3BH6B 3MMJA 4RW8A 1EIYB 2QRRA 4BC9A 1HBOB 1SQFA 3H59A 1EJ7L 4P74A 1FKAF 2V94A 3Q8RB 1RT1B 4ZVGA 1X4HA 1NLKL 4K4ZA 1KSPA 3R2DJ 2DHHA 1IJFB 4RW4B 3CMQA 2VKRA 2HVZA 3IS9A 1KKHA 5T41A 1UMJA 1WSVA 2Y1IA 2LA4A 1KVKA 4NMLA 1QUVA 3J7A1 1LFWA 1HKAA 2W9CA 2ZBQA 4CO2A 2GMHA 3G86A 1ZM2A 2HMIB 3C6UB 1T95A 2VJUA 3A4TA 1U0SA 2R7SA 2Y1LB 3TWZA 2BM0A 3MMAB 3TRGA 3VZHA 1YJ9S 1U24A 1S77D 1SBRA 2HQDA 2YX4A 3V4IB 1WNEA 2HZAA 3ENVA 1G4CA 1PYOB 4OQJA 4OYWA 1KR4A 1QD1A 5KFZA 1KFDA 7AT1B 2ERRA 4RNFA 2V8VA 1BC6A 2GO8A 2O3DA 1WD6A 4F3OA 4IH6A 4TN2A 3NG8A 2E1RA 1F1BB 1M90T 4GO7X 2R8HA 2C3MA 3PY8A 3T5HA 4O3PA 4C11B 2JOQA 1NJWA 1O51A 4ZPCA 3UE2A 3PYGA 1IXKA 5F8IA 5HROA 2ZHBA 5KFKA 1IR2A 3KLHA 3TR5A 4QOTA 2KHCA 1NK9A 4H4OA 1D9AA 1RKJA 4QBUA 2CPEA 3AODA 3AJ2A 3KK2B 2ZOMA 2UV8A 1XIQA 1BQNB 1HNXJ 3ITHA 4RUBA 5D4LA 1JNRB 3P49B 4FPRA 4C8KA 5DG9A 2OPSA 1LQ9A 4L75A 2FJAB 2QLXA 4KFBB 4LBHA 1D8ZA 2FD2A 4H4KC 4LF8F 5JVGQ 3DRYA 4QWCA 2KXFA 4BBYA 2FZGB 2H1YA 2E5HA 2RHSB 4WK1A 3W60A 5LL6d 1GQEA 1MW7A 5DRKA 4DPYA 3UWTA 3T1AA 4JI1J 1Y3KA 3ZZ0A 2AU0A 4X4QA 2F40A 2UUTA 2W8LA 3US5A 3G6ES 3O2IA 1QAJA 1RXOB 4MK7A 3J81j 2R8GA 1Z4UA 4X64J 4EZ9A 1IJEB 3UDVA 1W26A 2LQ5A 3ADAC 4WCEQ 1L3SA 2HSEB 3L4BC 3VGVA 2GQ2A 3MURP 4BCAA 1X5PA 1REVA 4ERDA 1MMNA 2OPRA 1JMTA 4LSNB 1PILA 4DR2J 3LO3A 3L3CA 3TA2A 2HBZB 1FTCA 3DHXA 3AD7C 3B6BA 4JI5J 1JLBA 4DUYJ 1ZA2B 4MH8A 2DCUB 2NCKL 5ITHA 2RJZA 3QGIA 4A4JA 2MSSA 5KG3A 2C3YA 1S1VA 2GHVC 4DI6A 4DR7F 2NZ4A 3EYZA 3THTA 3H2LA 4ZCIA 3ILOA 3A8EA 2WOMB 2FLNA 3IC1A 4DV1J 3F73A 2XY5A 4URQU 5B0FA 2CADA 4MK8A 5H9FJ 1RAAB 1XNQF 1RWXB 2UVVA 4NOHA 4FYXB 2IM0A 4EYIB 4OV1A 1HBOA 1L3TA 2F4FA 4J5OA 3OFHA 5KAKA 1RT1A 1N36F 5DS7A 2PA8D 3SDEB 5EWFA 1RTIB 2W9BB 2G2YA 4WP9A 4RW4A 4ZVFA 1YSJA 2AJ2A 3MM8B 2Z4PA 1XMQJ 3MZIA 4F0KA 5ETLA 3FRZA 4DF8A 1M5VC 3PYEA 1FJGF 4KTQA 2O5DA 1VHIA 2YWGA 5GMDA 1S99A 3BN4A 2BOAA 1NSQA 4RW7B 4EBDA 2DHSA 1NSAA 4UUXA 3R6LB 2RUGA 4O3SA 2HMIA 3C6UA 2B9XA 4DSIA 2QLFB 3MMAA 1X4AA 3K8VA 4ZP6A 5J2QB 2ZD1B 3CCSS 3V4IA 3I31A 3TA1A 1Q8IA 2AP6A 1HNIB 2XMWA 4OHZA 2RRAA 2XY6A 2HVDA 4YB6A 2JEFA 2F1FA 4CH1A 2QE5A 3AOCA 1Q81T 2IJRA 2DGSA 5KFUA 5L1LA 2JVOA 3EZUA 2UUAF 3MAHA 5KFIA 3AXMA 3CDWA 4NZ6A 1WTBA 3M9OB 2GAHC 1URRA 3CJ2A 3T1YF 3T9ZA 2WONB 4ED3A 4C11A 3P5TL 2LCWA 4ZVTB 2DR7A 4KGMA 4DX6A 3CCES 3PFEA 2HGMA 3DI6B 2DITA 2YNHB 5AJ3J 2B7CB 2EEYA 3GJRB 4ATNA 3MI7X 3LAKA 4I67A 3KK2A 2V4JB 3BBCA 3RBZA 1RT2B 4ECRA 1BQNA 5EGYA 1WC4A 3OW2R 3UD3P 3H4BA 3P3DA 5ETTA 4ECYA 1FEEA 4KFBA 3DCAA 5K20B 1VQLS 2AHOB 4OL8A 3HZGA 4AXIA 3IGNA 4F67A 2DYAA 4WZQA 3D54A 5CYJA 3E3XA 4R8UB 1OMSA 1XERA 5L1IA 3CDEA 1H73A 1SQGA 4USMA 3EWGA 4DZDA 5H9EJ 1GXUA 1RT6B 3SQGB 2B9EA 2HQIA 1LK5A 1W2IA 5ETNA 2X1GA 5IOLA 2IVMA 3A13A 3QBCA 5K8PA 2C28A 3BGLA 4V19X 2OGUA 3JQKA 4B9VA 4J91A 2ZNZA 1OPZA 3RUBL 1S72S 2DCLA 4K4VA 3HHLB 3VR1A 4RNHA 3MEKA 3CCJS 1SV5B 4ZP8A 3D2WA 2G0IA 4IRDA 4GO5X 4KV8B 1NZAA 4MTPA 1WEXA 3IM8A 5KFTA 1QJHA 4OYPA 2YNFB 1GXTA 3HD1A 4N76A 4LSNA 5A8WB 4JV5J 4DL6A 2FY1A 3PW4A 2HQ3A 5ETKA 5I42B 1IKWB 2IIHA 1ZH5A 2DH7A 1UW4A 3H5XA 4ILLA 3B4DA 1E6VB 4I68A 5HMZA 3OHBA 5MLCV 1FE0A 2MEWA 3D6MB 3MMBB 1DHMA 2WOMA 2P2CB 2F4VF 1Q82T 4WFBQ 2UXDF 4QW9A 1F9EB 2BJ1A 3M6UA 2AIRB 2ATLA 1NJXA 4C3LA 1P8GA 4UOFA 2MB0B 3HSJA 4YB7A 2QLBB 3GWCA 1J2VA 3RB3A 2JLFA 5C2GA 1LW0B 1OPIA 1Y5IB 3FFIB 4UY8T 2R42A 3SDEA 2ZWPA 1RTIA 2W9BA 3C2PA 4USHA 4IH7A 1VQKS 5E3RA 3MM8A 1J5EF 2D7SA 3M32B 2H4YB 5D3GB 2ZUAA 4ZA1A 1FX4A 4ANCA 3BM7A 1F5CA 4KGXB 1UVNA 1CULB 1RWWB 4M5NA 4I4BA 3ILLA 4OYIA 2R7RA 3GV7B 3HHNB 2OPQB 4RW7A 4DV7F 5EWEA 4RUAA 2YPZA 2ZEJA 3DU5A 3S1TA 3MCSA 1MMLA 1G3OA 1DLOB 3NMAA 3W3SA 5A6WA 1T02A 3CJ8A 5J1PA 5J2QA 3G6VA 2ZD1A 2R7UA 2KL8A 2AX1A 4JI3J 3QAEA 2HRUA 1HNIA 4X65F 4ZN3A 1R27B 2J7UA 4F25A 2K3IA 3IRXB 3MPWA 2CFXA 1FRIA 2HNYB 4ECXA 2ZH6A 4KBIA 3CJKB 1F5BA 4B9TA 2DKOB 1IQZA 2XULA 2C3UA 4DV3J 5F0WA 5D15A 2VFTA 1Y00A 2EFNA 4P73A 2BMBA 2WONA 4ZJLA 1L3UA 2OLWA 2CQDA 2WSCC 3DI6A 4IRCA 2IPOB 1K1QA 4YHHF 2VL1A 3PIOQ 3DKDA 2X3DA 2MGZB 4V19J 4ZP7A 2QL9B 3EJMA 4F02A 1HPZB 2CJXB 4F2RA 2V4JA 2YKNB 3AB2B 3DLJA 1RP5A 3VGUA 1NK5A 3MGJA 2W2NP 2V2KA 5DM6Q 1IVZA 3SCJE 3CDAA 4JI2F 3PW0A 2DT9A 4A8KA 1P1LA 3BSCA 1UEUA 2Z57B 2XI3A 4QYZJ 2B0GA 1HD1A 3KK3B 2CQCA 4R8UA 4Q43A 3CCTA 4N41A 2FJBB 3F56A 1RWPB 1RT6A 1SC3B 2OI2A 2RDIA 3SQGA 4WKYA 4JI6J 4F36A 3M05A 2MPUA 4P2MA 1VQYA 4J9OA 3FVYA 1ITPA 4ES2A 1FKPB 1WTFA 2KXNB 2EG1A 4JI0F 4YY3F 5AXLA 2PEBA 3HHLA 4IQXA 4Q2MA 3D28A 1A9NB 3OFGA 1C1CB 3RTVA 1YTYA 1SV5A 1FERA 4KV8A 1FNMA 3QRQA 2YNFA 3AQOA 3MR3A 2KDOA 4F8RA 5A8WA 2V2ZA 4UUWA 3RU0A 4D3HA 3EICA 2MKJA 3R2CJ 3EDRB 4DFKA 1JXLA 1NM2A 2XSJB 5I42A 3NGTA 1IKWA 4ZPWR 4RBVA 4KO0B 4IFYA 1E6VA 3NGRA 1JJ2R 3M6VA 3ILIA 3CGIA 1FRKA 4ID8A 4CZCA 3MMBA 1HHTP 2XLIA 1VGYA 1NNDA 2BRKA 2N7YA 1E6YB 1W25A 2N3LA 4FF4A 1U2FA 3CJTA 1RBLA 4NEYA 4ALZA 4HTIA 2WVBA 4HACB 4FBTA 3SCKE 1FRJA 2GJFA 2PI4A 4QPTA 1LW0A 3FFIA 3TVKA 3LANA 3CCWA 1HI0P 3PRBA 3MPYA 2MSTA 4RZRA 5E2QA 3RJMB 4K2XA 4NLUA 3UDCA 1HWKA 1OSDA 2HS0A 2OPPB 2X3GA 2NUHA 2EC2A 3M32A 3OTOJ 1SQEA 3C46A 4ED8A 3LALA 4KGZB 3Q23A 1H38A 5D3GA 5HQLA 4DUTA 1XR7A 1CULA 4RWXA 5KFGA 3EZ5A 4URSA 3GCXP 3RBDA 4ZPTR 2UUBJ 2OPQA 3H5UA 1RAIB 2N82B 2Y8WA 1T03B 2HQFA 1DLOA 4O0NA 1L3KA 2CPZA 2LP4A 3WHIA 2E5GA 1Q4RA 1HL6A 5KG4A 1GMWA 2HS3A 1O8BA 2C2ZB 2PMZD 1KQGB 3ICLA 4EGLA 4L6V3 1ZPWX 2ZJPQ 1JX4A 4IYQA 2P6SA 4X62F 3IRXA 2R2RA 4N77A 2HNYA 3CJKA 4DHVA 4OHYA 2AYMA 2HHHF 1YBAA 3BSNA 4WE1B 3OR1B 1YRUA 2HAIA 4KB7A 5L1JA 1HR0F 2VQFF 2CIMA 2DNYA 3NOCA 3DMJB 5KFHA 2QSWA 2W4PA 3J81U 1URNA 3KKFA 2ZH5A 3KUEA 5HMYA 3DNCA 2WBMA 4F3MA 5EWGA 2R2UA 2AF6A 1MN9A 1NXIA 2YKOA 1ZA1B 3OQ2A 1V3SA 2MGZA 4DR4F 4F2SA 1GX5A 2KFNA 1MN7A 2DEJA 4U9RA 1VQNS 4PZVA 1VJQA 1QAIA 2Z0GA 2C3OA 2RHQB 4CQ1A 1RTDB 2JZ5A 4OHVA 2VBYA 1HHQA 1S7IA 2H48B 3K17A 4MIBA 2CJKA 2KJVA 1LXNA 2M7SA 2PEHA 2RSQA 2IMOA 3MTKA 1U47A 3KK3A 3GSDA 3CC4S 2V6AA 1RTJB 2AT1B 3MCNA 3H7HB 4I2QB 1UJ6A 5H9FK 1R8BA 2H65B 4MIWA 5D6GA 3CJ3A 5KFLA 2CJYB 1WI8A 3MXHP 1AFIA 2DNKA 1FKPA 2XGQA 5F41A 2AEMA 3FEYB 1KN6A 1RHUB 2PMHA 3J81Y 4FP9A 2G2OA 1C1CA 3QSIA 3KNAA 4DR6F 2DNHA 5EX3A 2XS7A 2IVFB 1BGXT 2ZJQQ 1YGYA 1VQOS 1RTHB 3OVSA 2H5EA 3ZO7A 1BWEA 3ZTSA 4YDXA 2FJDB 3OVAA 4OZ3A 3TW0A 2FJEB 4UF4A 1FRLA 2GVDB 3SEOA 4KHPJ 3JSMB 2MJUA 4OYZA 3M30B 3V81B 2DR9A 2IYGA 3MAAB 2A10A 4FYYB 4KO0A 4W98A 2B9WA 1RAHB 3D1HA 2ROEA 3BPSP 5CZXA 3CT9A 4LF2A 2R2TA 2PI5A 1DURA 2BJ9A 2CZVC 1E6YA 3UD4P 1RT3B 3AA9A 4HHUA 1U6BA 5HL7Q 2B51A 2JWNA 4M5JA 4HACA 1FFSB 3G8QA 1S57A 3RAMA 2XEXA 2UVRA 3Q83A 4WJBA 3TQEA 4C8MA 1SJFA 4LJMA 2M5YA 4DQQA 2X1AA 1J5OB 1QVFR 3EVMA 1RWUA 4N8NA 1U8SA 4LIRA 3VQTA 5DDPC 3MWBA 2OPPA 3NBPB 4AQYJ 3DOMB 1TL5A 1CLFA 1SB6A 3DGPB 4Y2MA 3AHPA 3G9CA 5CCMA 2IDLA 2OMLA 2GAGC 4F4ZA 1CPZA 3FSYA 2HURA 2JL9A 4XDCA 1Q0NA 2ZKTA 1Q79A 2EK1A 3G87A 3RRHA 4OHWA 2FHKA 2ZE2B 3M9MB 4WFXA 4OFZA 3FZ2A 1FXDA 1OY6A 4NA1A 2KRBA 2HFUA 3VQSA 3T1HJ 2Y3YA 2HGLA 3N0VA 2VOOA 1C1BB 1N56A 3WC2A 5H9EK 1TAQA 1RBOB 2RS8A 3LPYA 1IBKJ 1B4SA 4LQ9A 3JSYA 4F4WA 2KZMA 2QMXA 3FJ2A 1TELA 4CDIA 3OSPA 4WE1A 3OR1A 3LWLA 1CSJA 3N9UC 4ER8A 5J1NA 5KTQA 4NLWA 3DMJA 1Q8BA 4MK9A 1WOSA 2KXHA 3AJDA 4AE5A 4XK8C 1G6BA 1X60A 4LREA 2PO4A 1RKIA 1RACB 1M5OC 2J7WA 5G0RB 3MEEB 1ZOTA 1OO0B 2B8PA 1M1GA 5L1KA 1EQ0A 1HNXF 3MUVP 2CZ4A 3VAGA 2QIFA 4TVAB 4HHHA 1RTDA 3PR4A 1NPPA 2DH9A 1ZS6A 4CRJA 1KNZA 1SPBP 1RZMA 2DGTA 4ECVA 2MQOA 2VFUA 4C8ZA 3N5FA 1FDAA 3R5JB 1UVIA 2CJ9A 1YWXA 1F6TA 4QIFA 3POTB 1RTJA 1YJ7A 2CPHA 5H1SV 1IR1A 1RWOB 2HKEA 4I2QA 2YWHA 2J8SA 3UR3C 1NZ8A 3RR8A 1ZAXA 4EBCA 3GILA 2KM8C 2MQPA 4DL2A 3RB6A 2WHOA 3CUNA 2Q1LA 3NAIA 1KTQA 4OHXA 2OIHA 4X64F 1FK9B 4RNNA 4HHJA 2DHAA 2W4CA 4H4KA 3RYLA 2IM2A 4KIAA 2EK6A 2RF2B 1NK8A 1JJ4A 2AWZA 3OBIA 3T5KA 2ILYA 5E5NA 2HWIA 3KJQB 4OJ1A 1RTHA 1JWWA 2CQ0A 1SC1B 4J7CA 2AZ1A 2DY9A 3VCDA 4QR0A 3JSRA 4D3GA 1U4BA 1I5OB 2CNLB 3OXLA 4P6QA 1K0TA 1WDTA 4BS2A 3DRRB 4K0KF 2GVDA 1T8EA 2V4RA 3JSMA 1O6XA 4DUYF 4KE5A 3M30A 3V81A 3MAAA 4DSJA 5L38A 4GC7A 3QAUA 3CJQA 4LMZA 1H74A 4DLEA 4JV2A 3C19A 3GYXB 1RT7B 2UV8G 4QQBA 3OFEA 2CVIA 4Z37A 2DIVA 4U95A 5DGBA 4RO0A 4ZS6A 1NKCA 1RABB 2VG5A 2B7BB 4DV1F 1RT3A 2LQJA 2WBRA 5BJRA 3IAM9 4DCJB 5KFFA 2AQ4A 4LFBJ 3ILJA 1UVMA 3NGUA 2VBZA 2D69A 2DVIA 1M1HA 2OELA 1MG7A 2HWTA 2XBPA 4ECUA 4TQSA 3CIZA 4TU9A 3I5CA 3ULHA 3TAMB 2ZH2A 2HHTA 3NBPA 3NOGA 4WP8A 1XMQF 3DOMA 4WU3A 1MMDA 2A6MA 2V5HG 4CLTA 3GZ7A 4R25A 3SYZA 2A6OA 3DGPA 3ZC4A 2D1CA 4M5HA 1YRTA 4QIVA 1RBAA 1RJJA 2Z58B 2J6TA 2GIRA 3QFHA 2V63A 1DY3A 1GAOA 5D78A 1H2VZ 1KFSA 1U0HB 2XMJA 3KTQA 1KWMA 3FBCA 4ZPBA 3MHYA 4QYZK 2UXBJ 3W9JA 4YS2A 3BB5A 1QE1B 1F3VA 3W2WB 3CD7A 2DNPA 5ETOA 1C1BA 1Q5VA 1VBZA 2OHDA 1WHWA 3G4SS 4LSZB 3M9NB 1PAEX 1X5SA 4N56A 2YNGB 2BUNA 4IR9A 3L7UA 3EDQB 3Q8QB 1C2PA 2AYBA 4M5MA 1IM4A 4DV4J 4DR1F 1VQ8S 2HPUA 2QA4S 3G2XA 2APOA 1YRXA 3AT1B 2R7TA 2R8KA 4DR3F 3C6TB 2HFVA 3NS5A 4RU2A 2BKPA 2DR8A 3KLEB 3J7AN 5G0RA 3QJJA 1EHWA 5IT4A 2V8HA 1OY9A 3FC9A 3MEEA 1XTZA 1ZM9A 3K58A 4DU7A 3VF0B 2XB2D 2KVIA 2RDDA 1JXEA 5DDRC 3WIUA 2F9DA 3IR7B 1QSYA 4A47A 5K8NA 4DBQA 3D5MA 1OQ6A 5IQ6A 2L41A 3U7JA 2LU1A 1KQSR 3V6HA 3PG9A 2IA0A 2W2MP 3LP0B 1HWLA 3POTA 1HYSB 4DQPA 3THVA 2BE9B 4F0MA 3EGZA 1FRXA 1T9YA 1SKRA 4OI2A 4IOAQ 5CZVA 4U8VA 2G1HA 1H0HB 1RT4B 3UVJB 3IXQA 1DQAA 1FK9A 2UUWA 3TJ8A 1JLFB 1S1WB 1RAOA 2WSFC 1R8PA 4ZOSA 2RF2A 4FYWB 1FD8A 1TZ0A 3CCUS 2M0GB 1VQ6S 3V2UC 3H0PA 1VQSA 4HI1A 2LVWA 5B0BA 4PWDB 3HSDA 1D1UA 5B08A 3LA0A 5I3UB 1IR0A 4JV5F 1IBMF 4CLWA 2FJVA 2GMLA 3ISND 3DRRA 1RHJB 3DLGB 3IG1B 2XWYA 1RHKB 5JXSA 3Q8PB 3NCRA 1S12A 5ETSA 2QFIA 1FFGB 2CPIA 3DRSB 4LF7F 2BM1A 1RT7A 2BE2B 3NXZA 2C22A 3MR5A 3SXLA 3PRDA 3QT7A 5F9NA 4Z7YA 4CLUA 1VIXA 4RUHA 2W8KA 2QYCA 3FUYA 3GU0A 3UNGC 5SZTA 1R8CA 1WEYA 1T9VA 2E5LJ 4LF4J 2NYIA 3DDIA 3BGRB 4XTTA 2B4UA 1VRQC 3PX0A 4YN3B 1CJKB 5CYMB 3HDSA 3BQ2A 4A8MP 4G1IA 4FN5A 4B9NA 3UCZP 3TZZA 1WKLA 3TAMA 4CO1A 3GIKA 2MHEA 1AUSL 4V1Ak 2OTJS 2C2KB 1PC5A 7FDRA 1YX2A 3Q8UA 4PR6A 4DMZA 2XLJA 3HFVA 1RHQB 2JVRA 3D3BJ 5FDLB 4B3RF 1XMOJ 4ZCLA 4DS5A 1K0VA 5LMNJ 2GNKA 1FXLA 4OJHA 3R7BB 1U1NA 1U0HA 1VFJA 3CB4A 4EUVA 3UCUP 4HT7A 5FIIA 1NK0A 5DZ6A 1QE1A 3W2WA 2EG2A 2MY8A 4ZLJA 4LRCA 4JI7F 3CC2S 4JI3F 4NZ0A 2AGPA 4LF6J 3BQ1A 2FGOA 5F8GA 3H2UB 4JB8B 4IG3B 2D9OA 2YNGA 1XEZA 1T0TV 3KHHA 5LMUF 3R5CA 2WB1D 1S1XB 1QM9A 4OJ3A 4FS2A 2G0JA 5BYQA 2OD6A 4LBPA 2HS4A 2KB2A 1IKYB 2ILZA 4FKXA 3EXYA 4Z2XA 1YJTA 3GR1A 3AD9C 4CNYA 3C6TA 3MCOA 4S0MA 4DUZF 1VIOA 4OX9F 3KLEA 2CDQA 2U1AA 2FY8A 3WIVA 4BC7A 5LSLA 2L08A 1TR0A 3K57A 6FD1A 3M6WA 2OD4A 3AA8A 4AXJA 3SCLE 4KHRA 1KDNA 2WSEC 1CS4B 4F7VA 3DM2B 1KVIA 3UO0A 5C42B 3BPDA 1X4CA 5AXKA 2AMCB 2E1CA 2IBKA 2LQ9A 5E41A 3BV8A 3SBMA 3TO8A 2V0NA 3LP0A 3G6XA 2BJDA 2C2EA 2ASYA 2LYVA 3SFUA 4DV6J 4J9UE 2MKKA 2CAJA 4JI6F 1CJVB 2MQMA 2KFZA 3CWJA 5K8MA 4NPOA 2BKNA 4ED0A 1OJ4A 3RW7A 2BE7D 1U1KA 1X5TA 1PJ7A 1TTHB 4YQWA 2J9EA 1EKSA 3C3LA 1RT4A 2FLPA 3FCHA 3ZTPA 8AT1B 2PSZA 1JLFA 3V6JA 5IWAJ 1S1WA 3OL6A 4DQRA 5HJXA 3T3FA 3KMSA 1FJCA 2V8GA 1Y11A 2DNQA 1FWKA 4XO0A 4USUA 3OT9A 3UCGA 3H4DA 3W64A 1RU1A 3VALA 1X9WA 2K2PA 5DG7A 2NREA 1PG5B 4PWDA 2D3UA 5I3UA 5GADI 1P9YA 1TU0B 5GMEA 5AXMA 3DLGA 3MECB 4B3TF 5D77A 5IC4B 3OTBA 4F26A 2FVCA 4E8UA 2DNMA 4K7QA 3O3LA 1PSDA 1AZSB 3DRSA 5GVQA 3GYGA 4ZMMA 4H4MB 2BE2A 4K59A 4USWA 4RWWA 3D3CJ 4B3SF 2CPYA 4IUFA 4QWEA 4LFCF 2D9PA 3SSQA 1A6LA 3UN2A 4OYBA 3BKFA 2K7KA 1BD6A 5D4OA 3M2UB 3BGRA 4GVLA 4P2SA 3NAHA 1CJKA 2EFQA 1HW8A 2DRDA 1QSSA 5CYMA 3AH6A 4ECSA 1U48A 4DPTA 3BR9A 3W5ZA 3KHLA 3CEDA 2KFYA 1N34J 4CT8A 3LQVA 3OTOF 4WIQA 1HI1A 2MZQA 2XNRA 1Q7LB 5FDLA 3DLEB 2FZKB 3QMQA 1KP6A 2CWXA 2GHPA 1VQ5S 1WKKA 3PX4A 3QWPA 1BY9A 3KLIB 2HQGA 3DRPB 1N6QB 2KH9A 1QVGR 3AOBA 1WF0A 4P52A 2P9CA 3FDSA 2RD5C 1YJVA 2AYGA 1XJWB 4Y2CA 4G1QB 3GIRA 3ZXWA 4GVBA 1ZZNA 1FD2A 2DGVA 2DIUA 3VV2B 1VRUB 2G13A 3OV7A 2AEJA 4PRFA 2NLWA 1SC6A 3MEDB 1F60B 4IG3A 2VBXA 1T94A 4CO4A 3UN5A 1KBRA 3V5RA 5FLXU 3CCMS 1TL1B 1S1XA 1H7WA 5D0RA 1UETA 4MKAA 1U7LA 1JLAB 1IKYA 2W2OP 4X4RA 2YH0A 4C8LA 3FMBA 1PAUB 4RJVA 4FF1A 2IJNA 1U09A 1QAYA 1Y9OA 4NEZA 3PCOB 2R8JA 2ZH4A 3M2VB 4EMDA 1CBKA 3AY0A 1M5SA 3KUGA 2VICA 2MHNA 2EVZA 2JFDA 4ED2A 2RQ4A 3QZ7A 1RCXB 3TARA 1HIYA 2FYXA 3PVXA 2ROPA 3C14B 1VQ9S 2RILA 2QO3A 3AB4B 3FCWA 1CS4A 2BV3A 3DM2A 2I5JB 4C7QA 2E1MC 5C42A 2GCFA 4NLXA 2C2NA 5IC6B 2NPFA 2RS2A 1NSKL 2DTJA 2VG6B 4C4WA 3PKYA 2J5AA 2ZKUA 1UZHA 3TZWA 4YUDA 1WWHA 5FLXY 1CJVA 4M8LA 2E7VA 2LA6A 4BHQA 1N33F 1XNRJ 2AJ1A 2CWKA 4CO0A 1F9FA 3M6XA 2YX7A 2FVRA 1P1TA 1TK5A 1NDLA 3LP1B 2JH3A 2XC9A 3UR0A 3HO1A 2EBEA 1WHVA 2QX0A 3MPUB 3MM5B 4ZPDA 4C8NA 2ZDOA 2KM8B 2AW0A 2G0CA 2KT3A 1QUPA 4CT9A 3OLAA 2AZ3A 2V8PA 3MECA 3MF5A 4USIA 2JDJA 5THWA 2PN6A 1PYTA 5MAOA 1SVDA 3ZZOA 1R8HA 2UUCF 2YWFA 3SFGA 3OXGA 4K8RA 5CHCB 4G3IA 1AZSA 3QNWB 3CIMA 1S59A 2HZCA 2IAJB 2LXUA 4H4MA 1YITS 1HW9A 3G82A 3J7Z5 5I3PA 2CQPA 1NPRA 3M8PB 3MFIA 1N5QA 2R7WA 2Y0BB 3PW2A 3KHGA 4MT1A 2PFFB 3C66A 2X51A 3VZIA 3D6HB 3NWRA 2VDHA 2NXUA 3HHLD 4QR2A 2ROGA 1F9HA 3I5AA 2YWWA 2MXYA 4U96A 3K5MA 2BBEA 4ES3A 3LGNA 3M2UA 1X4DA 4ZLPA 1GFWB 3CVKA 2ZJRQ 1WOOA 2GZOA 3M8ZA 3NS7B 2G4BA 1WC6A 4DL0C 1S1UB 1TP7A 5F8HA 2W2PP 1WUUA 1REVB 2VASA 4NRTA 1NBEB 2QA4G 3CULA 4IH5A 1KQKA 3FNNA 1T3NA 1N4LA 2VC0A 1RDRA 4X4UA 3DLEA 4LF8J 2BQ3A 4WU2A 8RUCA 1IM6A 4P2FA 3L7OA 4OYOA 2QV6A 2RT3A 2J9DE 3KLIA 1YJNS 3DRPA 4NLVA 2ALZA 1M5PC 1N6QA 3JAMU 2HHXA 2IM1A 3DDNA 2FPHX 3TP2A 4O4RA 4G1QA 2Z2MA 2RKIB 3VGSA 3PJXA 3T1HF 5HBMB 2BJ3A 2XG8A 3RAXA 4NCBA 4CM0A 1VRUA 2OAUA 3C16B 2YTCA 2MKIA 4I7FB 4I2PB 4CLZA 4LQ3A 1YK9A 5HP1B 1SJ4P 3MEDA 4QIEA 3HVAA 1NHVA 5J2PB 1TL1A 4ZCMA 2MQNA 3R5DA 3OTCA 4OX7A 5IT0A 3K5NA 4HDGA 1CJTA 2VFSA 4IR1A 1JLAA 2ZH1A 3MPDA 2E29A 3DLHA 2KU7A 2DISA 5JMNA 4Y65A 1NKEA 2MJNA 4NLOA 2NYHA 3M2VA 4QWDA 4DSLA 4JBCA 4KY3A 2HK3A 2HGNA 1RISA 1TL7B 1EB0A 4OZLA 3TJAA 3PR5B 4ELTA 4DR7J 2YKMB 2P9EA 1S0NA 2C2OB 2CNKB 4DFJA 3C14A 1WOPA 3JAMY 4DSKA 2VG7B 3LW5C 4ECQA 2VC1A 3VTIA 2I5JA 1LW2B 1BQXA 1HNZJ 1D9FA 1ZBTA 2A1BA 2VG6A 5ETRA 4R0EA 1QSLA 4ED7A 2RQKA 1L5UA 3CJRA 4EEYA 4NRUA 4DXLA 3U02A 1N36J 1HI8A 4ZJOA 3ONQA 4NX9A 3GFYA 1NO8A 1G2EA 3RB4A 4NLRA 1MWQA 4B9MA 3UN3A 3GTYX 1KQFB 3G8TA 1NB2A 4X4TA 2B56A 3SCIE 3LP1A 1EAYC 2V9KA 3CE8A 3ZNJ1 2GO9A 1RSCA 3MM5A 1NK6A 1U1MA 2OEJA 2RRBA 3OFFA 1GH8A 3OD2A 4JI4F 2CG4A 4RBUA 4PG7A 3UD5A 4DPUA 2R2SA 2OSRA 1S9FA 1N32J 2XY7A 2ZITA 2BW2A 2J9CA 2OEMA 3VVUA 2CVEA 4RLEA 2IAJA 1HHSA 5D4PA 2IC3A 4FVCA 1X0PA 5DZ7A 2CG8A 3M8PA 1IWAA 2UUAJ 4EO6A 3ETMA 2XO7A 4J9KA 4K2JA 3T1YJ 3N28A 1N88A 3PTWA 1HD0A 4LFBF 4K4YA 4DX7A 1N8RT 1OIAA 4Z7CA 2MKYA 5BYSA 3A3NB 4NLYA 2E9ZA 3QGPA 1FWPA 5GAGU 2HHVA 4C3KA 2ZVSA 3Q89A 5KFEA 3QSYB 3KG1A 1T11A 2COLA 1S1UA 4UOCA 5C25A 2ATCB 3E2EA 3CSKA 3AD8C 3MD1A 3J7YI 2LMIA 4WBFA 3M8YA 2HW3A 2UXCF 1B7FA 4DR5F 3HSGA 2FZCB 4F3QA 5KFQA 1RHMB 4QZVB 3IGVA 5KFVA 3OTDA 1DTQB 1R8AA 3KJVB 1SKWA 3HSZA 2POKA 2KJWA 1QTMA 2KG0A 3ZZPA 4G1PA 4IFVB 4DQIA 2UXBF 2RKIA 4M1KA 5HBMA 1UVKA 1B0VA 1N5SA 1RYSA 1BHNA 4PG5A 3D9BA 1D0EA 1RAFB 3C16A 1TKZB 2XCPA 2DNNA 5GADU 1S7HA 1VHFA 1GT8A 4I7FA 3HT3A 4I2PA 4EZ6A 3TI0A 4TQRA 5HP1A 1RYRA 2QMWA 2CRLA 4CLPA 2GGPB 5J2PA 1Q86T 3BDPA 1WG5A 3KJNB 1QAXA 1X4BA 1JNZB 4ZPVR 1Y10A 4DPXA 2JC0A 1VLYA 3EVWA 2BJ8A 2DNOA 4Y28C 3KWMA 3W65A 3HKWA 1LWCB 2VPWB 1WF2A 5ETPA 4QYRA 2QA2A 4FXVA 3A8KA 4NXMJ 1TL7A 5AE1A 5KFWA 4L76A 2MKHA 5IFMA 1DQ9A 2YKMA 4LVNP 5SUHA 4CLYA 4J90A 2XSFA 5IXUA 4M5IA 2VG7A 3ZTOA 4DL5A 2NSBA 1VK8A 4ICLB 1LW2A 3BKUA 4UQGA 4GKJJ 3DOLA 3IR6B 2KYZA 3MM9B 2OH2A 3RBXA 1R3NA 1SCJB 1FDNA 2LDYA 1U6FA 4USTA 4CTAB 3IFEA 2YPYA 3GPAA 3QT8A 1LWXA 2XGPA 1MLAA 4RNOA 5HMXA 4KC5A 3FQKA 2VKZG 3WBZA 4JYAF 2R4FA 4KGKA 5KFAA 1RLDA 4UT4A 4ZVOB 1TQLA 4NZ7A 1NDPA 4ANDA 3D0GE 3D68A 2O1PA 2MKCA 3LH2S 3LTOA 4RW9B 3HULA 5FJ4A 5BR8F 4DV7J 1U26A 2UU9F 3TUJC 1L3VA 2MY7A 3KXDA 5LJ5Y 2BJEA 2FHMA 3PW5A
chains in the Genus database with same CATH topology
1YLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLX A; 
#chains in the Genus database with same CATH topology
 1VQ4 S;  2BAC A;  3WC0 A;  3BR8 A;  2M52 A;  1IBC B;  2GW8 A;  4AD6 A;  5AE2 A;  4F50 A;  2UVU A;  4OZ2 A;  3NCQ A;  2AJF E;  4Q44 A;  3P5B P;  3MFH A;  1Y3J A;  5HAT A;  2EFG A;  2FVP A;  3CW2 C;  4I56 A;  2XS5 A;  3QWU A;  4B02 A;  3UW1 A;  1EZZ B;  2AV5 A;  2Z30 B;  4BWJ A;  5CAA A;  2J0S D;  4ZIT A;  2RAQ A;  4N7T A;  3EUN A;  2E5L F;  4LF4 F;  5JJB A;  3CD5 A;  4CO5 A;  2RNE A;  1FKO B;  3CJ0 A;  5K5M A;  4YDD B;  4J9P A;  2FB0 A;  3I0S B;  2RDJ A;  3CCR S;  2ACY A;  2Z56 B;  3SSS A;  4B3O B;  1X9S A;  4ED5 A;  2B6A A;  2HBR B;  1SKS A;  2M8D B;  7FD1 A;  3MM7 A;  2JLG A;  2XS2 A;  2DGW A;  4AL5 A;  1B0T A;  2XI2 A;  3HCX A;  1QDU B;  1XMO F;  3H42 A;  1DTQ A;  3KJV A;  4IFY B;  3J7Z T;  3OUY B;  4C97 A;  3IR5 B;  1FF2 A;  3DHW C;  5F8N A;  3TX8 A;  2DJW A;  2I6W A;  2QJ3 A;  1M0S A;  4IFV A;  1QY7 A;  2R7X A;  4P10 A;  4PCQ A;  1TKZ A;  4YY3 J;  2C2D A;  3K0J A;  1CJU B;  5KT4 A;  1W2B R;  2BAN B;  1LV5 A;  3LF0 A;  2AX0 A;  1DBD A;  3WZ0 A;  2GGP A;  4FVM A;  2HAF A;  2NPI A;  1S1T B;  1S4F A;  3QJP A;  3TYT A;  3JSB A;  3BGU A;  1S6Q B;  3D7S B;  4YR3 A;  2AYE A;  4HDH A;  1RWM B;  3KJF B;  2QN6 B;  1HNW F;  1RE1 B;  3PEH A;  1LWC A;  2B8Q A;  2H51 B;  1VQP S;  2MQ8 A;  3SV3 A;  5T14 A;  1VRT B;  4B08 A;  2EFP A;  1MRO B;  3PM9 A;  3LWM A;  4K4T A;  2EKY A;  4FYV B;  3GFH A;  2HNZ A;  3DRX A;  4ZCK A;  2V2Q A;  3UQS A;  3FQL A;  4ICL A;  3TOQ A;  3SI8 A;  4C0B A;  3MM9 A;  4KH1 B;  2NXC A;  4PQU B;  3PRV A;  4XDD A;  1R43 A;  2R7O A;  1VLO A;  3H2V E;  1RUS A;  2QLW A;  4QR1 A;  1HFE L;  4CTA A;  2GVZ B;  3G8S A;  4DV6 F;  3CCZ A;  2EC0 A;  4IOC Q;  1GMV A;  1IQT A;  2G9O A;  3NNA A;  4DN0 A;  1BUX A;  4ZP9 A;  4F0H A;  4ZN1 A;  2JHE A;  1T9T A;  2XYP B;  5HLF B;  1XBW A;  4LSL B;  4ZDN A;  5IWA F;  1RWV B;  2DEI A;  1GX6 A;  1X7V A;  4RW9 A;  3PHE A;  5LT5 A;  1UPP A;  4IDK B;  4LF5 J;  2B3T B;  2EBG A;  1REG X;  3M8Q A;  4A8Q A;  2ABY A;  3VAM A;  2PFD A;  4USV A;  2C42 A;  3IRW P;  5ETQ A;  2KHD A;  5HAO A;  3H20 A;  2RH3 A;  1K44 A;  3CJ5 A;  1S6O A;  3F0N A;  5L8R C;  4GKK J;  3TZY A;  4X66 J;  2LEB A;  1T05 B;  2HRY A;  2ZNY A;  2QLJ B;  3D4J A;  4OLO A;  2RQM A;  2I1R A;  2ZUG A;  2DPJ A;  4GMK A;  3D0H E;  3WX4 A;  4HYK A;  5B7W A;  1EKR A;  1S5Z A;  3G6Y A;  1YI2 S;  3UFC X;  2GMJ A;  2BAB A;  2AJQ A;  2N3O A;  5F9L A;  2VQF J;  4A8F A;  2RQC A;  1U6Z A;  1V9O A;  1U8W A;  3BYP A;  3GQC A;  2J9D A;  5A8K B;  3P6Y C;  2HZV A;  1WG1 A;  1FKO A;  3T6B A;  3RRG A;  3RW6 A;  1UCN A;  5KFR A;  2FHJ D;  4DX8 H;  3RZA A;  3I0S A;  1FE4 A;  2CNO B;  3BGF A;  1VC6 A;  4B3O A;  5HVH A;  3JQJ A;  5LJ3 Y;  2MZS A;  2VON A;  4CLL A;  3AFG A;  2GJ2 A;  1PJ5 A;  3IWN C;  3HK2 A;  3PXG a;  3OL8 A;  4ELU A;  3RG6 A;  5D0G A;  5F8J A;  2MQQ A;  2KTQ A;  3JTN A;  2DHG A;  1SL1 A;  5L9N A;  1WJ9 A;  1FHT A;  3OUY A;  2DNZ A;  3EVO A;  3C15 B;  1TMJ A;  4OZJ A;  4NMX A;  3BN7 A;  3B4M A;  1Q53 A;  4ZVP B;  1S76 D;  4RW6 B;  5EDW A;  1YBU A;  2HG4 A;  2YQ1 A;  4ZIW A;  2VQE J;  2LFV A;  3NCP A;  3KFW X;  4X4V A;  5F8M A;  1SI9 A;  4A8Y A;  1ACM B;  1PYS B;  3NWG A;  2XMV A;  1NPK A;  1ZZF A;  3X3U A;  5A8R B;  3IA0 A;  1CJU A;  2E44 A;  2BAN A;  3O8W A;  5LSO A;  3PYD A;  3N6N A;  3OJS A;  4DR6 J;  4DSF A;  3P96 A;  4Y3C A;  2IDE A;  4JOU A;  1FCA A;  5JVH Q;  4C0H A;  1S1T A;  3TA0 A;  3VGT A;  1VQ7 S;  4PXE A;  1S6Q A;  4ENO A;  1I6J A;  4W92 B;  2XYG B;  4NI2 B;  4Q5V A;  4NYP A;  4ZVR B;  1BWV A;  2ZHA A;  4NLT A;  4DDF A;  2L3M A;  3IN5 A;  1H98 A;  5RUB A;  3IBW A;  1JLQ B;  1HAR A;  1VRT A;  1I94 F;  1MRO A;  1C4C A;  2HEK A;  4DCO B;  2WVD A;  3IWL A;  5B09 A;  4Y00 A;  5IS2 A;  4LR8 A;  5DET A;  2DO4 A;  3LGH A;  3H98 A;  3HVW A;  5HVF A;  4PYD A;  3ZTQ A;  1QLN A;  4LVO P;  2V8D A;  3PFO A;  5IT9 U;  2BJ7 A;  2EWH A;  1ZET A;  1EX8 A;  2WRM A;  2VBW A;  2B4V A;  3GV5 B;  1U1L A;  2VPZ B;  4DF4 A;  1HWI A;  3QT5 A;  4WTO B;  4LT6 A;  3J7Y U;  4PQU A;  2BYC A;  5C2C A;  4DLG A;  4K4X A;  4OZ5 A;  1KD1 T;  2GVZ A;  4MAK A;  4DL3 A;  3Q86 A;  2RRN A;  2XHC A;  4WPA A;  2CQI A;  1XNR F;  3MPV A;  3CME S;  1GEH A;  4QU7 A;  2KZZ A;  4WF9 Q;  2ZH3 A;  5HLF A;  4I6A A;  4LSL A;  4ILR A;  4A46 A;  4DCP B;  4C9D A;  1H72 C;  4XAK A;  3MUM P;  1TUW A;  4IOB A;  5KFC A;  2HND B;  3R7S B;  4PUO B;  4IDK A;  1F2G A;  3FCV A;  5M2P A;  2DPI A;  1AYE A;  2D41 A;  4X4O A;  4PAA A;  4TKT A;  2A18 A;  5E33 A;  4YB1 P;  3QGH A;  3R7N B;  3DGV A;  2DXE A;  1WHX A;  2YKQ A;  5IT9 Y;  4GC6 A;  2XMT A;  2AGO A;  4J37 A;  1T05 A;  3N01 A;  3I9Z A;  4O44 B;  2XMA A;  2MZ1 A;  4RNM A;  1SIW B;  4LRB A;  1CC7 A;  1LNQ A;  2VF3 A;  2PII A;  2XO6 A;  2H5I B;  5KFJ A;  5L46 A;  5G4D A;  2J0Q D;  1UEV A;  3HHK A;  1AA1 B;  5F0U A;  4ZJQ A;  3NNC A;  4KKO B;  5D0E A;  3NGS A;  3B78 A;  2C1E B;  2F7V A;  2QFJ A;  5A8K A;  2WVC A;  5AE3 A;  4LUB A;  3Q22 A;  5KOW A;  4K4W A;  1FNO A;  3W5Y A;  2E5J A;  2BR0 A;  3HP6 A;  4PPZ A;  2HRT A;  5E0O A;  1A0O B;  4HL9 A;  3BO4 A;  1Q7Y T;  2LDI A;  4UZC A;  1XR6 A;  2XMM A;  5KFO A;  4JUZ A;  4TNO A;  1SIZ A;  1KLM B;  5CXT A;  4USJ C;  4IQM A;  2HQC A;  3W61 A;  1TKT B;  3L9Z A;  4MKY A;  4M5G A;  5HQM A;  3C15 A;  1GK8 A;  1BLU A;  3I87 A;  3W9I A;  5CD4 A;  4RW6 A;  1DJ0 A;  3HD2 A;  4BLG A;  3BGO P;  3VVT A;  3GII A;  4AUK A;  4Y0F A;  2VG5 B;  3D1Q A;  3EPG A;  3D6T B;  3D0I E;  4L73 A;  1VOM A;  2W7A A;  5J1E B;  5A8R A;  2BW7 A;  2Q66 A;  2QT7 A;  2KO1 A;  2XCA A;  5C5J A;  1WC1 A;  1EP4 B;  3W63 A;  1ARO P;  3KYL A;  4ETX A;  1NKB A;  1YLX A;  2CPX A;  2FLL A;  3W66 A;  2DY1 A;  2QC3 A;  3TAN A;  1FDB A;  4NI2 A;  2Z2Y B;  1FVQ A;  4IO1 A;  3K7R A;  4K0K J;  3CXC R;  3VAH A;  4TY9 A;  1XC9 A;  3HVT B;  4C48 A;  1ZTW A;  1JLQ A;  2YWE A;  4Y6I A;  5D0H A;  3CF5 Q;  1D09 B;  2OKQ A;  3GCW P;  2BOP A;  3QRR A;  3NLC A;  3DU6 A;  1Y5L B;  4MFB A;  4ED6 A;  2XQC A;  1JLC B;  4QIG A;  2IVY A;  2J0W A;  2E9T A;  2LEP A;  2ZH8 A;  4RX6 A;  2IHR 1;  1UFW A;  2W7P A;  5J2M B;  1WF1 A;  3NS6 A;  3N79 A;  1YDL A;  2BQU A;  1F0X A;  3CMA S;  1HNZ F;  3BO2 A;  1TKX B;  3VHQ A;  1NSP A;  3ZZY A;  2W4D A;  4CYU B;  4YR0 A;  4HTJ A;  5HMW A;  2F65 A;  4N8O A;  1Q16 B;  4LR9 A;  2WW4 A;  3TNV A;  2BVZ A;  4MYU A;  1D8Y A;  3ZZR A;  4PXC A;  2ZBC A;  2CXE A;  4TLR A;  2KG1 A;  2ASJ A;  5A0Y B;  1DQ8 A;  2XWX A;  3H5Y A;  2VU5 A;  2RIJ A;  2Y1R I;  2DD8 S;  1VS3 A;  2D3Z A;  1N54 B;  2XZW A;  3QGG A;  2IMW P;  1VIS A;  2YH1 A;  1NAQ A;  5F3T A;  2HND A;  2KRR A;  4PUO A;  2KYX A;  4F4A A;  1RAJ A;  2JLE A;  2RML A;  4RKU C;  2R3V A;  3P8B B;  8ATC B;  1D9D A;  4FF2 A;  1AW0 A;  1AFJ A;  1VCT A;  1HNV B;  3QRP A;  1TKD A;  2QA1 A;  3NMR A;  1VC5 A;  1N32 F;  3JTO A;  2IM3 A;  4O44 A;  3KHR A;  2FJX A;  4YR2 A;  3NNH A;  3PJ9 A;  1YQH A;  4JI8 J;  4NLS A;  2ADB A;  3FK4 A;  3BQ0 A;  1HBU B;  5CQG A;  3R8Y A;  2VZ9 A;  4JI1 F;  2LQB A;  4KKO A;  3KK1 B;  4DR1 J;  3BKT A;  1ROF A;  1KHV A;  1RAD B;  4Y2A A;  4OZ0 A;  2VA3 A;  1HBN B;  4KHM A;  1SJQ A;  1NH8 A;  3GG1 A;  4DR3 J;  3CCV S;  5B0E A;  2LLZ A;  1WC0 A;  4OZN A;  3AJ1 A;  1TUG B;  1DAX A;  2XNQ A;  2YQ0 A;  3P45 B;  2QL7 B;  3W8P A;  1EQM A;  3HJF A;  4LRF A;  3ISZ A;  5KG0 A;  1B64 A;  5E7O B;  5B0D A;  2QEX S;  4NYO A;  3CD0 A;  1LWF B;  3DXB A;  5KT5 A;  1DFD A;  5LXR A;  2O67 A;  1KLM A;  2I8E A;  4DR2 F;  1WC5 A;  2XMK A;  4K4S A;  4JI5 F;  3GIM A;  3M7V A;  4OX8 A;  3K89 A;  1TKT A;  3I0R B;  3QT6 A;  4QU6 A;  4PWU A;  2C2M B;  1S79 A;  2Q3P A;  4LF9 J;  1NJI T;  4O23 A;  2NXE A;  3GYN A;  2HIY A;  3QFW A;  5KOX A;  2AKW B;  5B0A A;  1U25 A;  2M9K A;  3EGN A;  3D67 A;  2K3K A;  1GMU A;  1N48 A;  2Q79 A;  4DWI A;  4LFA J;  2E1A A;  1MU2 B;  2ZZT A;  2K7J A;  2IRX A;  1FEH A;  4ETZ A;  4KAI A;  1GNK A;  1AXQ A;  1Y5N B;  4TYB A;  2HHU A;  5J1E A;  3FBF A;  2KT2 A;  3D66 A;  4ZLL A;  4Q0B B;  1ICE B;  3IM9 A;  2LEC A;  2E66 A;  2X1F A;  2Y1J A;  1EP4 A;  2J8A A;  4NCG B;  4WZM A;  4RL1 A;  1CG2 A;  4Q8E A;  4WFY A;  2VFR A;  3CO9 A;  1VBK A;  2YX1 A;  1U45 A;  3W8G A;  3DOK B;  3W62 A;  3Q2T C;  4WXW A;  1IBM J;  2DXD A;  4M63 A;  2DGQ A;  1Q5Y A;  4OV6 A;  2KI2 A;  4EYH B;  1R31 A;  1GXL A;  1NJY A;  5KFX A;  3HVT A;  1RK8 A;  5EUH A;  4NXM F;  4C8Y A;  4WKR A;  5KG7 A;  5KG5 A;  2AJ4 A;  4PXD A;  5IQQ A;  4WWS A;  4LF7 J;  4TY8 B;  2VPY B;  3NL0 A;  2BDP A;  2E7W A;  1JLC A;  2LXF A;  2A2D A;  1VR6 A;  3MM6 B;  1P9Q C;  1N5V A;  2NS1 B;  1F3F A;  5J2M A;  4W90 B;  1RTZ A;  3JXO A;  2XLK A;  3R1L A;  3R5B A;  4GKJ F;  3CTR A;  3E8O A;  4FKY A;  1HA1 A;  4FYD A;  1TKX A;  4IKA A;  4Y34 A;  4F04 B;  1F5A A;  2R7Q A;  4CYU A;  3VAK A;  3LP2 B;  4YOE A;  2PT0 A;  5U47 A;  3T41 A;  3S6E A;  4AT1 B;  3HPO A;  1SKU B;  1HWU A;  3DYA B;  5HN0 A;  5A0Y A;  4LF1 A;  3HT0 A;  1NK7 A;  4HR2 A;  1WG4 A;  4MIA A;  4CLF A;  4KRW A;  2DNL A;  3IAS 9;  3KLV A;  1S49 A;  2C2R A;  3RBE A;  2RVJ A;  4B3R J;  2XZT B;  4KSE B;  3HFZ B;  1X9M A;  5CAB A;  1LXJ A;  4F4X A;  4FPI A;  1YG0 A;  5AJ3 F;  4NYZ A;  2CQB A;  1V5V A;  1UPM B;  5LM7 E;  4U7U D;  3DDK A;  1NME B;  1S9E B;  4CH7 A;  3FSI A;  4I6Y A;  3KMQ A;  1HNV A;  3BYR A;  4DV0 J;  2PA3 A;  5E3C A;  2DGO A;  4BDP A;  3DXS X;  4JI7 J;  1RB0 A;  1U02 A;  4ZPA A;  1ZPV A;  3PV8 A;  3R5A A;  4OI4 A;  2MLY A;  5LMU J;  1HBU A;  1PIE A;  3A1Y G;  2MZJ A;  3KK1 A;  3R6G B;  2ZH9 A;  4DU8 A;  1YZ7 A;  3GON A;  3M2R B;  3TJ9 A;  1HBN A;  4DV5 J;  1VC0 A;  1C0T B;  4M95 A;  4I1T A;  2OFH X;  1JLG B;  3MCM A;  9RUB A;  2HFN A;  2QTW A;  4DUZ J;  5J2N B;  4OX9 J;  2YNH A;  1RWN B;  1D3W A;  1Q95 G;  3W5X A;  3M8S A;  1FES A;  2B4P A;  1V3Z A;  3PX6 A;  1X0F A;  3JTP A;  3ETO A;  2RUS A;  1RT2 A;  1LWF A;  2NUU G;  5KFM A;  4LRA A;  3D6F B;  1ZAW A;  2XTJ P;  3TUZ C;  3HLU A;  1F2H A;  1I1G A;  2NXJ A;  3K2Y A;  3NP5 A;  4PG4 A;  3BZQ A;  3GFX A;  4PPD A;  3I0R A;  4EBE A;  1TL4 A;  4U7C A;  5KG2 A;  1HLW A;  4P7T A;  2ZFH A;  1P27 B;  2E5I A;  1BQM B;  4DPW A;  1FO1 A;  1Y0H A;  1LKZ A;  2FJW A;  4NL5 A;  2YY3 A;  1MU2 A;  2VUG A;  1IKX B;  2CQ4 A;  3G71 S;  2V69 A;  2W01 A;  3U1M A;  2MTL A;  3OLB A;  1FA0 A;  1B99 A;  2A0F B;  4Q0B A;  5M2R A;  2Q43 A;  3JB9 k;  3GJQ B;  4NCG A;  2CQ2 A;  5KFS A;  5GAH I;  4AL6 A;  9ATC B;  2F8M A;  1FWL A;  4YP3 A;  5KG6 A;  3DOK A;  1B3T A;  2CZ9 A;  2OEK A;  2IJF A;  1PCA A;  2DNR A;  2H9Z A;  2O66 A;  2MZR A;  4ZHR B;  5GMK a;  4B3T J;  3I4H X;  2DXF A;  2HBY B;  4O4G B;  1ZM4 A;  2YKA A;  2FLO A;  2YWK A;  3GFZ A;  4QCL A;  4CP5 A;  5BXI A;  2VD3 A;  2ZC3 A;  4ED1 A;  4TY8 A;  1LK7 A;  2XHW A;  5KFB A;  4ZVQ B;  3M8R A;  4B3S J;  4DG1 B;  1GTH A;  3MM6 A;  2E7X A;  2V9W A;  4LFC J;  3KLF B;  3T5L A;  4LIW A;  1VMB A;  4GVB B;  2F5G A;  3WX8 A;  5DQG A;  3UPF A;  3MMC B;  1DAR A;  4DFM A;  1LWE B;  4HLB A;  4ECT A;  3FSX A;  3LP2 A;  1WEL A;  2YBV A;  5E3A A;  1TK0 A;  3DLB A;  4YFU A;  2CDR B;  3V4M A;  1HMV B;  3DYA A;  3W7B A;  4DV3 F;  3KOA A;  4A8W A;  2JEI A;  3MAQ A;  3DN9 A;  2FVS A;  4J9L A;  3TQ1 A;  5CD4 H;  2MDA A;  3NGD A;  2VDI A;  4MKV A;  1TMM A;  1KRP A;  4LF5 F;  3SZ2 A;  1H3D A;  5EX0 A;  5K14 B;  4DN9 A;  3W1Y C;  1JXV A;  4RUC A;  1XN9 A;  3DLK B;  1S9E A;  2DRB A;  3T5J A;  2WB4 A;  4UW2 A;  4AFF A;  5DDO C;  2VB6 A;  3BF4 A;  2D3O R;  3OR2 B;  4GKK F;  1NUE A;  1O5J A;  3ET6 B;  4X66 F;  2QGF B;  5GAG I;  1ZYQ A;  2CYY A;  2FGC A;  2ALY B;  1S6U A;  3ZNU A;  1VI7 A;  3PZP A;  1RQ0 A;  2F3J A;  4EK2 A;  2RE1 A;  4B3M J;  2R9L A;  3PW7 A;  3Q2S C;  1HQU B;  2ZM6 J;  4O3N A;  3M2R A;  3TAP A;  3V6K A;  3CPW R;  1BMQ B;  2A3J A;  1FNX H;  1C0T A;  4F4Y A;  4DPO A;  4N47 A;  4RU9 A;  2Z2Z A;  1JLG A;  3G96 A;  3BO3 A;  1T7P A;  2JEJ A;  2W2Q P;  5J2N A;  2F63 A;  4PQA A;  1KOH A;  2BA9 A;  3NKY A;  2IY5 B;  1FX2 A;  4ZLN A;  1HPZ A;  3VAI A;  2AJ0 A;  2YKN A;  2W7O A;  2CQH A;  3OL9 A;  4FNH A;  3GV8 B;  2HHW A;  4M5D B;  4OMF G;  4C2M A;  2QSF A;  2GJI A;  4YEA A;  1RLC L;  2HHP A;  1CC8 A;  1NRK A;  4B9S A;  2EI5 A;  2E9R X;  1I51 B;  1WDD A;  3A3O B;  4Q2L A;  3ZZU A;  1SJR A;  2Y9H A;  2HHQ A;  2HFS A;  1CQN A;  4C8O A;  2CPD A;  1BQM A;  3CJ4 A;  3G82 B;  5KT3 A;  3RR7 A;  3KDO A;  1X4F A;  2VQE F;  1IKX A;  1N33 J;  4URG A;  2KT5 A;  1SH0 A;  1WHY A;  2V34 A;  2I2Y A;  1YKW A;  2B5J B;  1IBL J;  4O3Q A;  1W7W A;  1B0P A;  2BXJ A;  2L48 A;  4U7U K;  3BSA A;  3GJS B;  3M1V B;  3GIJ A;  3IBC B;  2MQL A;  1MNE A;  4XPC A;  2V4Q A;  3GE9 A;  1Q78 A;  3OSN A;  3ZZZ A;  4FZV A;  3GR0 A;  3MDF A;  2HHS A;  2OFG X;  3QID A;  2RU3 A;  2UVW A;  2XSJ A;  4ZHR A;  4O4G A;  1SL0 A;  2UUC J;  3I4P A;  3TVZ A;  4CCH A;  2VA2 A;  1TL3 B;  1VJW A;  5ADZ A;  2UUB F;  2EFV A;  4P9S A;  4NA2 A;  3QLH B;  4ZIV A;  2K8G A;  1WC3 A;  1A7G E;  4DG1 A;  3K8W A;  1EET B;  2HLT A;  4O3O A;  5D8H B;  4DV2 J;  4L3N A;  3KLF A;  3I56 S;  3RAQ A;  1PGZ A;  4NWB A;  1S6P B;  1NU4 A;  5CCL A;  2AD9 A;  5LXY A;  2VH7 A;  4UOG A;  3MMC A;  1LWE A;  3GMG A;  4OX6 A;  4UQT A;  3OXF A;  3QJL A;  3I5B A;  1SJ3 P;  3H40 A;  2JEG A;  3PJW A;  5DQH A;  2HVI A;  3PO4 A;  5F3Z A;  4QIW D;  1PJ6 A;  2HIQ A;  3EZO A;  5ETM A;  1HMV A;  1TAU A;  5KT2 A;  1CJT B;  2M88 A;  3JS9 A;  3LAM A;  4FF3 A;  3K59 A;  1FXR A;  1R89 A;  2XYH B;  1YIJ S;  2DGX A;  5DG8 A;  2PE8 A;  3K5P A;  4WTY A;  5IV4 A;  2EPI A;  1HWJ A;  3QO9 B;  3Q24 A;  3MR7 A;  1QTN B;  1S0V A;  2ZC4 A;  2IYI A;  1U1P A;  1APS A;  1R6V A;  4NXN J;  3Q8Y A;  1CEZ A;  5L9X A;  4BWM A;  2QZ8 A;  1T03 A;  5K14 A;  1AB8 A;  3DLK A;  3VAJ A;  4LR7 A;  1NB7 A;  3THP A;  3OPK A;  2GIQ A;  3I32 A;  1R0B G;  1IWG A;  1HQE B;  3M4X A;  1J27 A;  4AL7 A;  2V68 A;  4FXW A;  1S48 A;  3FGV A;  3OR2 A;  3HKZ D;  1UL3 A;  4E98 A;  3ET6 A;  3O1L A;  4KPY A;  2JNJ A;  3AAW B;  1YBT A;  3K5L A;  2ZBI A;  1CVJ A;  4DSE A;  2VIH A;  4OI6 A;  3FBE A;  2I0X A;  4PKD B;  4UOH A;  3NY0 A;  4PG6 A;  1HQU A;  4TU8 A;  3M8W A;  3KLG B;  4X84 A;  1VBY A;  1B7Y B;  1OYD A;  5F8L A;  3EMT A;  2BX6 A;  3SV4 A;  1I3O B;  4B9U A;  3EM1 A;  3PO5 A;  2K06 A;  4DEZ A;  1FJ7 A;  1RT5 B;  3H8Y A;  2ZZN A;  3TEG A;  4X4N A;  3A3P B;  1X4E A;  1DZ5 A;  2NQP A;  4DOZ A;  3FZB A;  1RAE B;  4M5D A;  2HBQ B;  4B9L A;  5T7L B;  3EX7 B;  3FEZ A;  1KC8 T;  1NH7 A;  1FI4 A;  3MR6 A;  3UI3 A;  5K9F A;  2X1B A;  3Q0A A;  4KHP F;  2EW9 A;  4USK A;  1U2C A;  3RB0 A;  1UVJ A;  2LKZ A;  5K8O A;  4OIX A;  2IA6 A;  1KOO A;  5DO2 A;  1UEK A;  1SH2 A;  2IC3 B;  3E01 B;  4K50 A;  1RI7 A;  2FQQ B;  2N4D A;  1O0P A;  3ELH A;  3T9N A;  3OJU A;  1VYA A;  3MR2 A;  1Q8K A;  2B5J A;  4DFP A;  2GQC A;  4KYZ A;  1SL2 A;  4KT0 C;  2ZWO A;  1RAG B;  3ISN C;  3D1O A;  3MEG B;  3M1V A;  3CD6 S;  3MTJ A;  1N0V C;  3VAF A;  2QMU B;  4ZVU B;  4H54 A;  3QYY A;  5C25 B;  2DH8 A;  3ZTR A;  1SXL A;  4JI4 J;  5KG1 A;  1HBM B;  4AQY F;  2DR5 A;  4DJB A;  2KVQ E;  4OI0 A;  2WVE A;  2XM3 A;  4P71 A;  2MZT A;  1S10 A;  1TL3 A;  4KR0 B;  2W24 A;  1IN0 A;  3HXM A;  2Z2L A;  3U27 A;  2ASL A;  3QLH A;  4OJG A;  3HX9 A;  3GP9 A;  4PG8 A;  3WQP A;  5DLF A;  3IWX A;  4LBI A;  1EET A;  4X2B A;  3RRK A;  1C0U B;  1LFP A;  2VOD A;  4HH0 A;  1NDK A;  2C3P A;  2JX2 A;  3CJS A;  1S6P A;  4X4S A;  3MUT P;  4TU7 A;  2OTL S;  2MLX A;  3W2V B;  3AQP A;  3BS9 A;  1R0C B;  4M5L A;  2NZC A;  2QG9 B;  1XMB A;  2VFV A;  4E0D A;  1MWZ A;  1IBK F;  1U1Q A;  2ZBP A;  1J5O A;  2EXU A;  2MMY A;  2A2C A;  4QPX A;  2V2V A;  5HJY A;  2GQQ A;  4OLP A;  3DC2 A;  5C7P A;  3FBB A;  4EU0 A;  2NSC A;  2ZHO A;  4OZ1 A;  1SUQ B;  1M5K C;  3S7R A;  1UWB B;  2UXC J;  1UAW A;  4DR5 J;  3QO9 A;  3HVR A;  5C24 B;  4CLK A;  1X5O A;  2P8I A;  4A48 A;  1JKH B;  3HHD A;  3BSO A;  4C0O C;  1UVL A;  4WFZ A;  3UDE A;  4WXO A;  3TX0 A;  1KON A;  5JUM A;  4HI2 A;  3U1L A;  1WKJ A;  3BBB A;  1FJE B;  2ZE2 A;  2PC6 A;  1HQE A;  1AT1 B;  2GA7 A;  4MMO A;  2CNN B;  5GAH U;  4FDF A;  1DRZ A;  2ZOG A;  4X4P A;  1ZTT A;  1JIH A;  1GMW D;  4KGV B;  1YJR A;  3LGM A;  4CLS A;  1ZAV A;  4Y2I A;  1XNQ J;  3DOL B;  4L74 A;  2J0X A;  2NXN A;  4P72 A;  4G6V B;  4ECZ A;  3JQM A;  3SIP B;  5A2Q U;  4JI8 F;  2NR0 A;  1JQG A;  1WOR A;  3L95 X;  4DX5 A;  4HT5 A;  1TVR B;  2DB1 A;  3MD3 A;  3CDB A;  1RCO B;  4EWT A;  3I9V 9;  2GS8 A;  3KLG A;  2IBO A;  4WP3 A;  2L9D A;  1UP1 A;  1U2R A;  1VK3 A;  4WFA Q;  3B8H A;  4O0I A;  1V6H A;  1VQM S;  2CJA A;  1N52 B;  1K47 A;  4P75 A;  2M70 A;  5LSR A;  4B17 A;  1FJG J;  3V6D B;  5AXN A;  3HMJ G;  4WYW A;  3MOJ B;  2ASD A;  2JC1 A;  1RT5 A;  1UA0 A;  4A8X A;  2Q6C A;  1SH3 A;  2PD1 A;  2W25 A;  2E1P A;  4FBU A;  5BYR A;  5GAE I;  4FNI A;  4XPE A;  5DM7 Q;  4A8O A;  5T7L A;  4CIO A;  4NAS A;  2J6U A;  3BRE A;  5KT6 A;  1NK4 A;  4ZVH A;  2OMO A;  1G7C B;  3S01 A;  2M2B A;  5HSP A;  2IFX A;  1B70 B;  1NHK L;  4LF9 F;  4WK3 A;  1DTT B;  5FD1 A;  4IG0 B;  2YQ3 A;  3E01 A;  4LRD A;  4DZ6 A;  2V50 A;  5A2Q Y;  2GV1 A;  1Y4Z B;  3OHA A;  4LFA F;  2OSQ A;  2EKN A;  3TEH B;  3QQC D;  3IMQ J;  5HO4 A;  3L7P A;  3O5T B;  1IKV B;  4JYA J;  1P6T A;  1OSC A;  3UDL A;  3WDO A;  2VJV A;  4ZVS B;  1M5H A;  2BRL A;  3DLL Q;  3MEG A;  2ZOF A;  1AUD A;  3EGV A;  5KFN A;  2I38 A;  1N5T A;  4JV0 A;  5BR8 J;  3O6Q A;  1UWA A;  2UU9 J;  2Y0S D;  2PDA A;  2FHJ A;  3K5O A;  3H90 A;  3HI9 A;  4PAB A;  2U2F A;  3BEG B;  1N5Y B;  4ZKA A;  5B0G A;  1UKU A;  3W9H A;  2B6A B;  2VV5 A;  3FEX B;  1HBM A;  1FRM A;  2CKW A;  3MM7 B;  1PKU A;  4PYA A;  2DK2 A;  2Y8Y A;  1H2T Z;  2KKH A;  2HLU A;  2WAQ D;  2FUG 9;  2CJB A;  3LOU A;  4O3R A;  2HFZ A;  4CO3 A;  1C0U A;  2N4C A;  3SQO P;  3T19 A;  2J76 E;  5HVG A;  2FC9 A;  2R8I A;  1LEO A;  4Y2K A;  4QJV A;  5DQI A;  3F44 A;  1RA6 A;  3IP0 A;  2UP1 A;  1R0A B;  1S9G B;  3W2V A;  2DR6 A;  3OVB A;  2YVS A;  3R9L A;  4OYA A;  2YKP A;  4ILM A;  2MYF A;  4PXB A;  1R7I A;  2ACM A;  4K5S A;  1UZD A;  3R3T A;  5IM0 B;  3CCL S;  3GB0 A;  3PHT A;  2J7K A;  3DFE A;  1UW9 A;  3PDN A;  4NCA A;  4DV4 F;  1X4G A;  4NLQ A;  1SUQ A;  1U1R A;  4QWB A;  2H3E B;  2EFO A;  1ELO A;  1UWB A;  5HAN A;  1FFW B;  5C24 A;  4KQZ A;  2J6S A;  3EGW B;  3FMW A;  1JKH A;  2P9G A;  4DL4 A;  3TUP A;  4QW8 A;  2B9Y A;  2PMW A;  2F9J A;  2R7V A;  2HNZ B;  4ITS A;  3HFK A;  2F4V J;  3IO1 A;  2CA9 A;  2M3D A;  4DV0 F;  2UXD J;  1TV6 B;  5I3Q A;  2WZ1 A;  1JK9 B;  2MLZ A;  2WW8 A;  3F41 A;  2GC8 A;  2P5V A;  1KEK A;  1FVS A;  1KLN A;  1U1O A;  2DO0 A;  5E3Q A;  1NCL A;  2CPF A;  1XWL A;  2BZ2 A;  2ADC A;  2BQR A;  1C4A A;  1S0M A;  4TLQ A;  4A8S A;  1TVR A;  4L72 B;  3PAC A;  2FC8 A;  2FDN A;  4Q45 A;  4R5P B;  2H54 B;  3R5G A;  1UFK A;  1J5E J;  4IO9 Q;  4K4U A;  4C98 A;  3P4U B;  4DV5 F;  1HNW J;  2LQ8 A;  4OI1 A;  3PNI A;  4KPC A;  1ULR A;  4ES1 A;  1K8A T;  2RB7 A;  3ENQ A;  3V6D A;  2X7I A;  4EFA C;  2ZDP A;  4JV1 A;  1EAR A;  3SMZ A;  1SC4 B;  2OUG A;  1PBU A;  2LXI A;  2DHX A;  4IRK A;  3M8Q B;  1NDC A;  5CYQ B;  4M94 A;  2Z8Q A;  2FHO B;  2GFF A;  3EPI A;  2M8H A;  4Q7A A;  1JLE B;  4JP8 A;  1T9U A;  3BJY A;  3HF5 A;  3A8I A;  3R27 A;  4X65 J;  1HYS A;  3KNG A;  2K1R B;  1DTT A;  3LPE A;  4IG0 A;  4ID5 B;  1WAC A;  3BDE A;  2G2Z A;  1OS5 A;  4OI3 A;  4NLP A;  1K73 T;  1IKV A;  4N5S A;  3NGK A;  4FS1 A;  2CQ3 A;  4ZVE A;  4ELV A;  3Q8S B;  3UVJ A;  2P6T A;  5DDQ C;  4RR5 A;  4ANE A;  3A12 A;  3FKB A;  4NE9 C;  2CJQ A;  3PYF A;  4WFN Q;  3EE3 A;  4TXS A;  4YHH J;  4WYL A;  2DRA A;  6AT1 B;  4CNZ A;  3S8S A;  3OTE A;  3QZ8 A;  1N5Y A;  2QL5 B;  1YJU A;  1IUJ A;  3QIP B;  2YNI B;  1MSW D;  3IG1 A;  4JI2 J;  3JYT B;  2F8E X;  1NEE A;  1BXN A;  4MYT A;  3R97 A;  3HHE A;  3N6L A;  4M5K A;  5DJB A;  2D3O 1;  2ZBR A;  3GSI A;  1YZ6 A;  3HHL C;  5LMN F;  1Y7P A;  3KUH A;  5IZH A;  4J9N A;  2AEF A;  4OYX A;  1UFL A;  3TAQ A;  3IBF B;  3AOA A;  1UJ5 A;  1S97 A;  1V3R A;  3CCQ S;  4NLG A;  3ENA A;  3ENW A;  3I55 S;  4F4K A;  2HK2 A;  1R0A A;  2HVH A;  1S9G A;  1U49 A;  2L9N A;  4NLD A;  4JI0 J;  4NA3 A;  5KT7 A;  2VPX B;  4I64 A;  4LF6 F;  4GRS A;  4U67 Q;  1HQ2 A;  1Q8L A;  4YB5 A;  1PO6 A;  1RU2 A;  4CH0 S;  3RGI A;  1OYE A;  3B54 A;  4HH1 A;  1G1X A;  3BH7 B;  5CA5 A;  2GIF A;  3HJV A;  5IM0 A;  2ZVI A;  2DGU A;  2SXL A;  5AT1 B;  3I82 A;  4QWA A;  1UTA A;  1Z2L A;  2FVQ A;  2G1D A;  3E51 A;  4J9V A;  4RPF A;  1FT8 A;  1OY8 A;  1RA7 A;  1TFW A;  4C3M A;  1FRH A;  4DS4 A;  5HQ8 A;  3PIP Q;  1R6Y A;  4C6A A;  1NJZ A;  4K5R A;  2I9S A;  3Q8V A;  2LEA A;  2CUY A;  3I6P A;  2JFK A;  2VHG A;  1RGV A;  4MKB A;  2MKS A;  1TV6 A;  1WSR A;  3I96 A;  3TUI C;  4J9M A;  1N0U A;  3KG4 A;  2DBB A;  3N5B A;  3GJT B;  4RW8 B;  3CC7 S;  1PC4 A;  4KH0 B;  5CH7 B;  4PEO A;  1T9W A;  4ZK7 M;  2OO4 A;  2PGC A;  4R0J A;  3GG0 A;  3H5S A;  2B43 A;  4TYA A;  6FDR A;  4B3M F;  3ZFV A;  2LU2 A;  2FTR A;  3CNQ P;  1Z1Z A;  4HKQ A;  2ZM6 F;  1VDH A;  2WTF A;  4R5P A;  1NHU A;  2OP5 A;  4CI0 B;  3AXK A;  4U6P A;  1FDD A;  3IS9 B;  5KFD A;  2JRS A;  3N4W A;  5HK4 A;  5KFP A;  1H6K X;  4Q8F A;  5KFY A;  1I94 J;  1JJH A;  3SSR A;  2AGQ A;  1X8D A;  3QAT A;  1V5I B;  1YJW S;  5HI7 A;  3KG0 A;  1JB0 C;  1H2U X;  4UTG A;  4EI2 A;  5DGA A;  2W9C B;  1Z2Z A;  4P7V A;  1TUV A;  2JJ4 D;  2Q6B A;  2BKO A;  4I6W A;  5M2U A;  2WCX A;  1FTR A;  5EN1 A;  4PWW A;  2QYG A;  5CYQ A;  3X1L B;  1BE4 A;  1PBA A;  2V67 A;  1JLE A;  3ZZT A;  1K9M T;  3BBF A;  1X31 C;  1S0O A;  2FIU A;  5ETV A;  3NRB A;  5L39 A;  5A6P A;  2HYI B;  4J9Q A;  2W9A A;  1VBX A;  2K1R A;  2D74 B;  1XQI A;  2GHW A;  5LOQ A;  4ID5 A;  1UA1 A;  4X62 J;  1T3O A;  1ZM3 A;  4I0W A;  2UZA A;  1KVJ A;  3H25 A;  3C8Y A;  3QPI A;  3T6J A;  2HHH J;  4ED4 A;  4DQS A;  3LUY A;  2BEF A;  4UZB A;  4DL7 A;  1K1S A;  2CPJ A;  3HZE A;  1HR0 J;  1IBL F;  3EXC X;  2KN4 A;  3PEJ A;  2YXL A;  4CM2 A;  1UJ4 A;  1WI6 A;  4EO8 A;  5DLG A;  5EHH A;  1CQM A;  2JSX A;  3A8J A;  1TK8 A;  1WEZ A;  5HRO B;  1YHQ S;  1Q1K A;  3KLH B;  3VWS A;  3MOZ A;  4DR4 J;  4J9S A;  4H4O B;  4OYM A;  1GTE A;  2H5J B;  4MJK A;  1N34 F;  3QIP A;  2IRY A;  1H7X A;  1YVF A;  1JJC B;  2B4O A;  2YNI A;  3ITH B;  2IRU A;  3JYT A;  1SJ1 A;  3L09 A;  2GX8 A;  2OPS B;  1KHW A;  5B0C A;  2HVE A;  4I69 A;  4HEA 9;  1MWY A;  3NEK A;  3FRY A;  2WK4 A;  3J80 U;  4ECW A;  2OJ3 A;  1T9X A;  2XMU A;  4DV2 F;  3O44 A;  2RU9 A;  4HVZ A;  4P2X A;  5I4M A;  3N6M A;  4YME A;  2HWH A;  5D4N A;  4G65 A;  2H4W B;  5GAE U;  3UNY A;  2ZH7 A;  2XZD B;  2CQ1 A;  1TFY A;  1KTV A;  1RWK B;  4AYB D;  5E3P A;  2VOP A;  5IV3 A;  1LOU A;  2OPR B;  4UY8 5;  1OQ3 A;  1RHR B;  3B82 A;  2O01 C;  2L9W A;  4L3K A;  3CO0 P;  3CDU A;  3HM9 A;  1JLB B;  3PKM A;  4NXN F;  4W4M A;  2M4M A;  1S1V B;  1XR5 A;  2F8H A;  5A76 A;  4XIU A;  4MFB B;  3J80 Y;  1S4E A;  2DNG A;  4J9R A;  3R1H A;  4E2F B;  1M1K T;  3KDN A;  2W1B A;  4CWB A;  2HFO A;  2CQG A;  4FXD A;  4U8Y A;  2ZZM A;  3TZX A;  3OL7 A;  2N7C A;  2WVF A;  1KS2 A;  1XK8 A;  3GLJ A;  3TVY A;  4KJI A;  1OWX A;  4WII A;  4RBT A;  3U1N A;  3BH6 B;  3MMJ A;  4RW8 A;  1EIY B;  2QRR A;  4BC9 A;  1HBO B;  1SQF A;  3H59 A;  1EJ7 L;  4P74 A;  1FKA F;  2V94 A;  3Q8R B;  1RT1 B;  4ZVG A;  1X4H A;  1NLK L;  4K4Z A;  1KSP A;  3R2D J;  2DHH A;  1IJF B;  4RW4 B;  3CMQ A;  2VKR A;  2HVZ A;  3IS9 A;  1KKH A;  5T41 A;  1UMJ A;  1WSV A;  2Y1I A;  2LA4 A;  1KVK A;  4NML A;  1QUV A;  3J7A 1;  1LFW A;  1HKA A;  2W9C A;  2ZBQ A;  4CO2 A;  2GMH A;  3G86 A;  1ZM2 A;  2HMI B;  3C6U B;  1T95 A;  2VJU A;  3A4T A;  1U0S A;  2R7S A;  2Y1L B;  3TWZ A;  2BM0 A;  3MMA B;  3TRG A;  3VZH A;  1YJ9 S;  1U24 A;  1S77 D;  1SBR A;  2HQD A;  2YX4 A;  3V4I B;  1WNE A;  2HZA A;  3ENV A;  1G4C A;  1PYO B;  4OQJ A;  4OYW A;  1KR4 A;  1QD1 A;  5KFZ A;  1KFD A;  7AT1 B;  2ERR A;  4RNF A;  2V8V A;  1BC6 A;  2GO8 A;  2O3D A;  1WD6 A;  4F3O A;  4IH6 A;  4TN2 A;  3NG8 A;  2E1R A;  1F1B B;  1M90 T;  4GO7 X;  2R8H A;  2C3M A;  3PY8 A;  3T5H A;  4O3P A;  4C11 B;  2JOQ A;  1NJW A;  1O51 A;  4ZPC A;  3UE2 A;  3PYG A;  1IXK A;  5F8I A;  5HRO A;  2ZHB A;  5KFK A;  1IR2 A;  3KLH A;  3TR5 A;  4QOT A;  2KHC A;  1NK9 A;  4H4O A;  1D9A A;  1RKJ A;  4QBU A;  2CPE A;  3AOD A;  3AJ2 A;  3KK2 B;  2ZOM A;  2UV8 A;  1XIQ A;  1BQN B;  1HNX J;  3ITH A;  4RUB A;  5D4L A;  1JNR B;  3P49 B;  4FPR A;  4C8K A;  5DG9 A;  2OPS A;  1LQ9 A;  4L75 A;  2FJA B;  2QLX A;  4KFB B;  4LBH A;  1D8Z A;  2FD2 A;  4H4K C;  4LF8 F;  5JVG Q;  3DRY A;  4QWC A;  2KXF A;  4BBY A;  2FZG B;  2H1Y A;  2E5H A;  2RHS B;  4WK1 A;  3W60 A;  5LL6 d;  1GQE A;  1MW7 A;  5DRK A;  4DPY A;  3UWT A;  3T1A A;  4JI1 J;  1Y3K A;  3ZZ0 A;  2AU0 A;  4X4Q A;  2F40 A;  2UUT A;  2W8L A;  3US5 A;  3G6E S;  3O2I A;  1QAJ A;  1RXO B;  4MK7 A;  3J81 j;  2R8G A;  1Z4U A;  4X64 J;  4EZ9 A;  1IJE B;  3UDV A;  1W26 A;  2LQ5 A;  3ADA C;  4WCE Q;  1L3S A;  2HSE B;  3L4B C;  3VGV A;  2GQ2 A;  3MUR P;  4BCA A;  1X5P A;  1REV A;  4ERD A;  1MMN A;  2OPR A;  1JMT A;  4LSN B;  1PIL A;  4DR2 J;  3LO3 A;  3L3C A;  3TA2 A;  2HBZ B;  1FTC A;  3DHX A;  3AD7 C;  3B6B A;  4JI5 J;  1JLB A;  4DUY J;  1ZA2 B;  4MH8 A;  2DCU B;  2NCK L;  5ITH A;  2RJZ A;  3QGI A;  4A4J A;  2MSS A;  5KG3 A;  2C3Y A;  1S1V A;  2GHV C;  4DI6 A;  4DR7 F;  2NZ4 A;  3EYZ A;  3THT A;  3H2L A;  4ZCI A;  3ILO A;  3A8E A;  2WOM B;  2FLN A;  3IC1 A;  4DV1 J;  3F73 A;  2XY5 A;  4URQ U;  5B0F A;  2CAD A;  4MK8 A;  5H9F J;  1RAA B;  1XNQ F;  1RWX B;  2UVV A;  4NOH A;  4FYX B;  2IM0 A;  4EYI B;  4OV1 A;  1HBO A;  1L3T A;  2F4F A;  4J5O A;  3OFH A;  5KAK A;  1RT1 A;  1N36 F;  5DS7 A;  2PA8 D;  3SDE B;  5EWF A;  1RTI B;  2W9B B;  2G2Y A;  4WP9 A;  4RW4 A;  4ZVF A;  1YSJ A;  2AJ2 A;  3MM8 B;  2Z4P A;  1XMQ J;  3MZI A;  4F0K A;  5ETL A;  3FRZ A;  4DF8 A;  1M5V C;  3PYE A;  1FJG F;  4KTQ A;  2O5D A;  1VHI A;  2YWG A;  5GMD A;  1S99 A;  3BN4 A;  2BOA A;  1NSQ A;  4RW7 B;  4EBD A;  2DHS A;  1NSA A;  4UUX A;  3R6L B;  2RUG A;  4O3S A;  2HMI A;  3C6U A;  2B9X A;  4DSI A;  2QLF B;  3MMA A;  1X4A A;  3K8V A;  4ZP6 A;  5J2Q B;  2ZD1 B;  3CCS S;  3V4I A;  3I31 A;  3TA1 A;  1Q8I A;  2AP6 A;  1HNI B;  2XMW A;  4OHZ A;  2RRA A;  2XY6 A;  2HVD A;  4YB6 A;  2JEF A;  2F1F A;  4CH1 A;  2QE5 A;  3AOC A;  1Q81 T;  2IJR A;  2DGS A;  5KFU A;  5L1L A;  2JVO A;  3EZU A;  2UUA F;  3MAH A;  5KFI A;  3AXM A;  3CDW A;  4NZ6 A;  1WTB A;  3M9O B;  2GAH C;  1URR A;  3CJ2 A;  3T1Y F;  3T9Z A;  2WON B;  4ED3 A;  4C11 A;  3P5T L;  2LCW A;  4ZVT B;  2DR7 A;  4KGM A;  4DX6 A;  3CCE S;  3PFE A;  2HGM A;  3DI6 B;  2DIT A;  2YNH B;  5AJ3 J;  2B7C B;  2EEY A;  3GJR B;  4ATN A;  3MI7 X;  3LAK A;  4I67 A;  3KK2 A;  2V4J B;  3BBC A;  3RBZ A;  1RT2 B;  4ECR A;  1BQN A;  5EGY A;  1WC4 A;  3OW2 R;  3UD3 P;  3H4B A;  3P3D A;  5ETT A;  4ECY A;  1FEE A;  4KFB A;  3DCA A;  5K20 B;  1VQL S;  2AHO B;  4OL8 A;  3HZG A;  4AXI A;  3IGN A;  4F67 A;  2DYA A;  4WZQ A;  3D54 A;  5CYJ A;  3E3X A;  4R8U B;  1OMS A;  1XER A;  5L1I A;  3CDE A;  1H73 A;  1SQG A;  4USM A;  3EWG A;  4DZD A;  5H9E J;  1GXU A;  1RT6 B;  3SQG B;  2B9E A;  2HQI A;  1LK5 A;  1W2I A;  5ETN A;  2X1G A;  5IOL A;  2IVM A;  3A13 A;  3QBC A;  5K8P A;  2C28 A;  3BGL A;  4V19 X;  2OGU A;  3JQK A;  4B9V A;  4J91 A;  2ZNZ A;  1OPZ A;  3RUB L;  1S72 S;  2DCL A;  4K4V A;  3HHL B;  3VR1 A;  4RNH A;  3MEK A;  3CCJ S;  1SV5 B;  4ZP8 A;  3D2W A;  2G0I A;  4IRD A;  4GO5 X;  4KV8 B;  1NZA A;  4MTP A;  1WEX A;  3IM8 A;  5KFT A;  1QJH A;  4OYP A;  2YNF B;  1GXT A;  3HD1 A;  4N76 A;  4LSN A;  5A8W B;  4JV5 J;  4DL6 A;  2FY1 A;  3PW4 A;  2HQ3 A;  5ETK A;  5I42 B;  1IKW B;  2IIH A;  1ZH5 A;  2DH7 A;  1UW4 A;  3H5X A;  4ILL A;  3B4D A;  1E6V B;  4I68 A;  5HMZ A;  3OHB A;  5MLC V;  1FE0 A;  2MEW A;  3D6M B;  3MMB B;  1DHM A;  2WOM A;  2P2C B;  2F4V F;  1Q82 T;  4WFB Q;  2UXD F;  4QW9 A;  1F9E B;  2BJ1 A;  3M6U A;  2AIR B;  2ATL A;  1NJX A;  4C3L A;  1P8G A;  4UOF A;  2MB0 B;  3HSJ A;  4YB7 A;  2QLB B;  3GWC A;  1J2V A;  3RB3 A;  2JLF A;  5C2G A;  1LW0 B;  1OPI A;  1Y5I B;  3FFI B;  4UY8 T;  2R42 A;  3SDE A;  2ZWP A;  1RTI A;  2W9B A;  3C2P A;  4USH A;  4IH7 A;  1VQK S;  5E3R A;  3MM8 A;  1J5E F;  2D7S A;  3M32 B;  2H4Y B;  5D3G B;  2ZUA A;  4ZA1 A;  1FX4 A;  4ANC A;  3BM7 A;  1F5C A;  4KGX B;  1UVN A;  1CUL B;  1RWW B;  4M5N A;  4I4B A;  3ILL A;  4OYI A;  2R7R A;  3GV7 B;  3HHN B;  2OPQ B;  4RW7 A;  4DV7 F;  5EWE A;  4RUA A;  2YPZ A;  2ZEJ A;  3DU5 A;  3S1T A;  3MCS A;  1MML A;  1G3O A;  1DLO B;  3NMA A;  3W3S A;  5A6W A;  1T02 A;  3CJ8 A;  5J1P A;  5J2Q A;  3G6V A;  2ZD1 A;  2R7U A;  2KL8 A;  2AX1 A;  4JI3 J;  3QAE A;  2HRU A;  1HNI A;  4X65 F;  4ZN3 A;  1R27 B;  2J7U A;  4F25 A;  2K3I A;  3IRX B;  3MPW A;  2CFX A;  1FRI A;  2HNY B;  4ECX A;  2ZH6 A;  4KBI A;  3CJK B;  1F5B A;  4B9T A;  2DKO B;  1IQZ A;  2XUL A;  2C3U A;  4DV3 J;  5F0W A;  5D15 A;  2VFT A;  1Y00 A;  2EFN A;  4P73 A;  2BMB A;  2WON A;  4ZJL A;  1L3U A;  2OLW A;  2CQD A;  2WSC C;  3DI6 A;  4IRC A;  2IPO B;  1K1Q A;  4YHH F;  2VL1 A;  3PIO Q;  3DKD A;  2X3D A;  2MGZ B;  4V19 J;  4ZP7 A;  2QL9 B;  3EJM A;  4F02 A;  1HPZ B;  2CJX B;  4F2R A;  2V4J A;  2YKN B;  3AB2 B;  3DLJ A;  1RP5 A;  3VGU A;  1NK5 A;  3MGJ A;  2W2N P;  2V2K A;  5DM6 Q;  1IVZ A;  3SCJ E;  3CDA A;  4JI2 F;  3PW0 A;  2DT9 A;  4A8K A;  1P1L A;  3BSC A;  1UEU A;  2Z57 B;  2XI3 A;  4QYZ J;  2B0G A;  1HD1 A;  3KK3 B;  2CQC A;  4R8U A;  4Q43 A;  3CCT A;  4N41 A;  2FJB B;  3F56 A;  1RWP B;  1RT6 A;  1SC3 B;  2OI2 A;  2RDI A;  3SQG A;  4WKY A;  4JI6 J;  4F36 A;  3M05 A;  2MPU A;  4P2M A;  1VQY A;  4J9O A;  3FVY A;  1ITP A;  4ES2 A;  1FKP B;  1WTF A;  2KXN B;  2EG1 A;  4JI0 F;  4YY3 F;  5AXL A;  2PEB A;  3HHL A;  4IQX A;  4Q2M A;  3D28 A;  1A9N B;  3OFG A;  1C1C B;  3RTV A;  1YTY A;  1SV5 A;  1FER A;  4KV8 A;  1FNM A;  3QRQ A;  2YNF A;  3AQO A;  3MR3 A;  2KDO A;  4F8R A;  5A8W A;  2V2Z A;  4UUW A;  3RU0 A;  4D3H A;  3EIC A;  2MKJ A;  3R2C J;  3EDR B;  4DFK A;  1JXL A;  1NM2 A;  2XSJ B;  5I42 A;  3NGT A;  1IKW A;  4ZPW R;  4RBV A;  4KO0 B;  4IFY A;  1E6V A;  3NGR A;  1JJ2 R;  3M6V A;  3ILI A;  3CGI A;  1FRK A;  4ID8 A;  4CZC A;  3MMB A;  1HHT P;  2XLI A;  1VGY A;  1NND A;  2BRK A;  2N7Y A;  1E6Y B;  1W25 A;  2N3L A;  4FF4 A;  1U2F A;  3CJT A;  1RBL A;  4NEY A;  4ALZ A;  4HTI A;  2WVB A;  4HAC B;  4FBT A;  3SCK E;  1FRJ A;  2GJF A;  2PI4 A;  4QPT A;  1LW0 A;  3FFI A;  3TVK A;  3LAN A;  3CCW A;  1HI0 P;  3PRB A;  3MPY A;  2MST A;  4RZR A;  5E2Q A;  3RJM B;  4K2X A;  4NLU A;  3UDC A;  1HWK A;  1OSD A;  2HS0 A;  2OPP B;  2X3G A;  2NUH A;  2EC2 A;  3M32 A;  3OTO J;  1SQE A;  3C46 A;  4ED8 A;  3LAL A;  4KGZ B;  3Q23 A;  1H38 A;  5D3G A;  5HQL A;  4DUT A;  1XR7 A;  1CUL A;  4RWX A;  5KFG A;  3EZ5 A;  4URS A;  3GCX P;  3RBD A;  4ZPT R;  2UUB J;  2OPQ A;  3H5U A;  1RAI B;  2N82 B;  2Y8W A;  1T03 B;  2HQF A;  1DLO A;  4O0N A;  1L3K A;  2CPZ A;  2LP4 A;  3WHI A;  2E5G A;  1Q4R A;  1HL6 A;  5KG4 A;  1GMW A;  2HS3 A;  1O8B A;  2C2Z B;  2PMZ D;  1KQG B;  3ICL A;  4EGL A;  4L6V 3;  1ZPW X;  2ZJP Q;  1JX4 A;  4IYQ A;  2P6S A;  4X62 F;  3IRX A;  2R2R A;  4N77 A;  2HNY A;  3CJK A;  4DHV A;  4OHY A;  2AYM A;  2HHH F;  1YBA A;  3BSN A;  4WE1 B;  3OR1 B;  1YRU A;  2HAI A;  4KB7 A;  5L1J A;  1HR0 F;  2VQF F;  2CIM A;  2DNY A;  3NOC A;  3DMJ B;  5KFH A;  2QSW A;  2W4P A;  3J81 U;  1URN A;  3KKF A;  2ZH5 A;  3KUE A;  5HMY A;  3DNC A;  2WBM A;  4F3M A;  5EWG A;  2R2U A;  2AF6 A;  1MN9 A;  1NXI A;  2YKO A;  1ZA1 B;  3OQ2 A;  1V3S A;  2MGZ A;  4DR4 F;  4F2S A;  1GX5 A;  2KFN A;  1MN7 A;  2DEJ A;  4U9R A;  1VQN S;  4PZV A;  1VJQ A;  1QAI A;  2Z0G A;  2C3O A;  2RHQ B;  4CQ1 A;  1RTD B;  2JZ5 A;  4OHV A;  2VBY A;  1HHQ A;  1S7I A;  2H48 B;  3K17 A;  4MIB A;  2CJK A;  2KJV A;  1LXN A;  2M7S A;  2PEH A;  2RSQ A;  2IMO A;  3MTK A;  1U47 A;  3KK3 A;  3GSD A;  3CC4 S;  2V6A A;  1RTJ B;  2AT1 B;  3MCN A;  3H7H B;  4I2Q B;  1UJ6 A;  5H9F K;  1R8B A;  2H65 B;  4MIW A;  5D6G A;  3CJ3 A;  5KFL A;  2CJY B;  1WI8 A;  3MXH P;  1AFI A;  2DNK A;  1FKP A;  2XGQ A;  5F41 A;  2AEM A;  3FEY B;  1KN6 A;  1RHU B;  2PMH A;  3J81 Y;  4FP9 A;  2G2O A;  1C1C A;  3QSI A;  3KNA A;  4DR6 F;  2DNH A;  5EX3 A;  2XS7 A;  2IVF B;  1BGX T;  2ZJQ Q;  1YGY A;  1VQO S;  1RTH B;  3OVS A;  2H5E A;  3ZO7 A;  1BWE A;  3ZTS A;  4YDX A;  2FJD B;  3OVA A;  4OZ3 A;  3TW0 A;  2FJE B;  4UF4 A;  1FRL A;  2GVD B;  3SEO A;  4KHP J;  3JSM B;  2MJU A;  4OYZ A;  3M30 B;  3V81 B;  2DR9 A;  2IYG A;  3MAA B;  2A10 A;  4FYY B;  4KO0 A;  4W98 A;  2B9W A;  1RAH B;  3D1H A;  2ROE A;  3BPS P;  5CZX A;  3CT9 A;  4LF2 A;  2R2T A;  2PI5 A;  1DUR A;  2BJ9 A;  2CZV C;  1E6Y A;  3UD4 P;  1RT3 B;  3AA9 A;  4HHU A;  1U6B A;  5HL7 Q;  2B51 A;  2JWN A;  4M5J A;  4HAC A;  1FFS B;  3G8Q A;  1S57 A;  3RAM A;  2XEX A;  2UVR A;  3Q83 A;  4WJB A;  3TQE A;  4C8M A;  1SJF A;  4LJM A;  2M5Y A;  4DQQ A;  2X1A A;  1J5O B;  1QVF R;  3EVM A;  1RWU A;  4N8N A;  1U8S A;  4LIR A;  3VQT A;  5DDP C;  3MWB A;  2OPP A;  3NBP B;  4AQY J;  3DOM B;  1TL5 A;  1CLF A;  1SB6 A;  3DGP B;  4Y2M A;  3AHP A;  3G9C A;  5CCM A;  2IDL A;  2OML A;  2GAG C;  4F4Z A;  1CPZ A;  3FSY A;  2HUR A;  2JL9 A;  4XDC A;  1Q0N A;  2ZKT A;  1Q79 A;  2EK1 A;  3G87 A;  3RRH A;  4OHW A;  2FHK A;  2ZE2 B;  3M9M B;  4WFX A;  4OFZ A;  3FZ2 A;  1FXD A;  1OY6 A;  4NA1 A;  2KRB A;  2HFU A;  3VQS A;  3T1H J;  2Y3Y A;  2HGL A;  3N0V A;  2VOO A;  1C1B B;  1N56 A;  3WC2 A;  5H9E K;  1TAQ A;  1RBO B;  2RS8 A;  3LPY A;  1IBK J;  1B4S A;  4LQ9 A;  3JSY A;  4F4W A;  2KZM A;  2QMX A;  3FJ2 A;  1TEL A;  4CDI A;  3OSP A;  4WE1 A;  3OR1 A;  3LWL A;  1CSJ A;  3N9U C;  4ER8 A;  5J1N A;  5KTQ A;  4NLW A;  3DMJ A;  1Q8B A;  4MK9 A;  1WOS A;  2KXH A;  3AJD A;  4AE5 A;  4XK8 C;  1G6B A;  1X60 A;  4LRE A;  2PO4 A;  1RKI A;  1RAC B;  1M5O C;  2J7W A;  5G0R B;  3MEE B;  1ZOT A;  1OO0 B;  2B8P A;  1M1G A;  5L1K A;  1EQ0 A;  1HNX F;  3MUV P;  2CZ4 A;  3VAG A;  2QIF A;  4TVA B;  4HHH A;  1RTD A;  3PR4 A;  1NPP A;  2DH9 A;  1ZS6 A;  4CRJ A;  1KNZ A;  1SPB P;  1RZM A;  2DGT A;  4ECV A;  2MQO A;  2VFU A;  4C8Z A;  3N5F A;  1FDA A;  3R5J B;  1UVI A;  2CJ9 A;  1YWX A;  1F6T A;  4QIF A;  3POT B;  1RTJ A;  1YJ7 A;  2CPH A;  5H1S V;  1IR1 A;  1RWO B;  2HKE A;  4I2Q A;  2YWH A;  2J8S A;  3UR3 C;  1NZ8 A;  3RR8 A;  1ZAX A;  4EBC A;  3GIL A;  2KM8 C;  2MQP A;  4DL2 A;  3RB6 A;  2WHO A;  3CUN A;  2Q1L A;  3NAI A;  1KTQ A;  4OHX A;  2OIH A;  4X64 F;  1FK9 B;  4RNN A;  4HHJ A;  2DHA A;  2W4C A;  4H4K A;  3RYL A;  2IM2 A;  4KIA A;  2EK6 A;  2RF2 B;  1NK8 A;  1JJ4 A;  2AWZ A;  3OBI A;  3T5K A;  2ILY A;  5E5N A;  2HWI A;  3KJQ B;  4OJ1 A;  1RTH A;  1JWW A;  2CQ0 A;  1SC1 B;  4J7C A;  2AZ1 A;  2DY9 A;  3VCD A;  4QR0 A;  3JSR A;  4D3G A;  1U4B A;  1I5O B;  2CNL B;  3OXL A;  4P6Q A;  1K0T A;  1WDT A;  4BS2 A;  3DRR B;  4K0K F;  2GVD A;  1T8E A;  2V4R A;  3JSM A;  1O6X A;  4DUY F;  4KE5 A;  3M30 A;  3V81 A;  3MAA A;  4DSJ A;  5L38 A;  4GC7 A;  3QAU A;  3CJQ A;  4LMZ A;  1H74 A;  4DLE A;  4JV2 A;  3C19 A;  3GYX B;  1RT7 B;  2UV8 G;  4QQB A;  3OFE A;  2CVI A;  4Z37 A;  2DIV A;  4U95 A;  5DGB A;  4RO0 A;  4ZS6 A;  1NKC A;  1RAB B;  2VG5 A;  2B7B B;  4DV1 F;  1RT3 A;  2LQJ A;  2WBR A;  5BJR A;  3IAM 9;  4DCJ B;  5KFF A;  2AQ4 A;  4LFB J;  3ILJ A;  1UVM A;  3NGU A;  2VBZ A;  2D69 A;  2DVI A;  1M1H A;  2OEL A;  1MG7 A;  2HWT A;  2XBP A;  4ECU A;  4TQS A;  3CIZ A;  4TU9 A;  3I5C A;  3ULH A;  3TAM B;  2ZH2 A;  2HHT A;  3NBP A;  3NOG A;  4WP8 A;  1XMQ F;  3DOM A;  4WU3 A;  1MMD A;  2A6M A;  2V5H G;  4CLT A;  3GZ7 A;  4R25 A;  3SYZ A;  2A6O A;  3DGP A;  3ZC4 A;  2D1C A;  4M5H A;  1YRT A;  4QIV A;  1RBA A;  1RJJ A;  2Z58 B;  2J6T A;  2GIR A;  3QFH A;  2V63 A;  1DY3 A;  1GAO A;  5D78 A;  1H2V Z;  1KFS A;  1U0H B;  2XMJ A;  3KTQ A;  1KWM A;  3FBC A;  4ZPB A;  3MHY A;  4QYZ K;  2UXB J;  3W9J A;  4YS2 A;  3BB5 A;  1QE1 B;  1F3V A;  3W2W B;  3CD7 A;  2DNP A;  5ETO A;  1C1B A;  1Q5V A;  1VBZ A;  2OHD A;  1WHW A;  3G4S S;  4LSZ B;  3M9N B;  1PAE X;  1X5S A;  4N56 A;  2YNG B;  2BUN A;  4IR9 A;  3L7U A;  3EDQ B;  3Q8Q B;  1C2P A;  2AYB A;  4M5M A;  1IM4 A;  4DV4 J;  4DR1 F;  1VQ8 S;  2HPU A;  2QA4 S;  3G2X A;  2APO A;  1YRX A;  3AT1 B;  2R7T A;  2R8K A;  4DR3 F;  3C6T B;  2HFV A;  3NS5 A;  4RU2 A;  2BKP A;  2DR8 A;  3KLE B;  3J7A N;  5G0R A;  3QJJ A;  1EHW A;  5IT4 A;  2V8H A;  1OY9 A;  3FC9 A;  3MEE A;  1XTZ A;  1ZM9 A;  3K58 A;  4DU7 A;  3VF0 B;  2XB2 D;  2KVI A;  2RDD A;  1JXE A;  5DDR C;  3WIU A;  2F9D A;  3IR7 B;  1QSY A;  4A47 A;  5K8N A;  4DBQ A;  3D5M A;  1OQ6 A;  5IQ6 A;  2L41 A;  3U7J A;  2LU1 A;  1KQS R;  3V6H A;  3PG9 A;  2IA0 A;  2W2M P;  3LP0 B;  1HWL A;  3POT A;  1HYS B;  4DQP A;  3THV A;  2BE9 B;  4F0M A;  3EGZ A;  1FRX A;  1T9Y A;  1SKR A;  4OI2 A;  4IOA Q;  5CZV A;  4U8V A;  2G1H A;  1H0H B;  1RT4 B;  3UVJ B;  3IXQ A;  1DQA A;  1FK9 A;  2UUW A;  3TJ8 A;  1JLF B;  1S1W B;  1RAO A;  2WSF C;  1R8P A;  4ZOS A;  2RF2 A;  4FYW B;  1FD8 A;  1TZ0 A;  3CCU S;  2M0G B;  1VQ6 S;  3V2U C;  3H0P A;  1VQS A;  4HI1 A;  2LVW A;  5B0B A;  4PWD B;  3HSD A;  1D1U A;  5B08 A;  3LA0 A;  5I3U B;  1IR0 A;  4JV5 F;  1IBM F;  4CLW A;  2FJV A;  2GML A;  3ISN D;  3DRR A;  1RHJ B;  3DLG B;  3IG1 B;  2XWY A;  1RHK B;  5JXS A;  3Q8P B;  3NCR A;  1S12 A;  5ETS A;  2QFI A;  1FFG B;  2CPI A;  3DRS B;  4LF7 F;  2BM1 A;  1RT7 A;  2BE2 B;  3NXZ A;  2C22 A;  3MR5 A;  3SXL A;  3PRD A;  3QT7 A;  5F9N A;  4Z7Y A;  4CLU A;  1VIX A;  4RUH A;  2W8K A;  2QYC A;  3FUY A;  3GU0 A;  3UNG C;  5SZT A;  1R8C A;  1WEY A;  1T9V A;  2E5L J;  4LF4 J;  2NYI A;  3DDI A;  3BGR B;  4XTT A;  2B4U A;  1VRQ C;  3PX0 A;  4YN3 B;  1CJK B;  5CYM B;  3HDS A;  3BQ2 A;  4A8M P;  4G1I A;  4FN5 A;  4B9N A;  3UCZ P;  3TZZ A;  1WKL A;  3TAM A;  4CO1 A;  3GIK A;  2MHE A;  1AUS L;  4V1A k;  2OTJ S;  2C2K B;  1PC5 A;  7FDR A;  1YX2 A;  3Q8U A;  4PR6 A;  4DMZ A;  2XLJ A;  3HFV A;  1RHQ B;  2JVR A;  3D3B J;  5FDL B;  4B3R F;  1XMO J;  4ZCL A;  4DS5 A;  1K0V A;  5LMN J;  2GNK A;  1FXL A;  4OJH A;  3R7B B;  1U1N A;  1U0H A;  1VFJ A;  3CB4 A;  4EUV A;  3UCU P;  4HT7 A;  5FII A;  1NK0 A;  5DZ6 A;  1QE1 A;  3W2W A;  2EG2 A;  2MY8 A;  4ZLJ A;  4LRC A;  4JI7 F;  3CC2 S;  4JI3 F;  4NZ0 A;  2AGP A;  4LF6 J;  3BQ1 A;  2FGO A;  5F8G A;  3H2U B;  4JB8 B;  4IG3 B;  2D9O A;  2YNG A;  1XEZ A;  1T0T V;  3KHH A;  5LMU F;  3R5C A;  2WB1 D;  1S1X B;  1QM9 A;  4OJ3 A;  4FS2 A;  2G0J A;  5BYQ A;  2OD6 A;  4LBP A;  2HS4 A;  2KB2 A;  1IKY B;  2ILZ A;  4FKX A;  3EXY A;  4Z2X A;  1YJT A;  3GR1 A;  3AD9 C;  4CNY A;  3C6T A;  3MCO A;  4S0M A;  4DUZ F;  1VIO A;  4OX9 F;  3KLE A;  2CDQ A;  2U1A A;  2FY8 A;  3WIV A;  4BC7 A;  5LSL A;  2L08 A;  1TR0 A;  3K57 A;  6FD1 A;  3M6W A;  2OD4 A;  3AA8 A;  4AXJ A;  3SCL E;  4KHR A;  1KDN A;  2WSE C;  1CS4 B;  4F7V A;  3DM2 B;  1KVI A;  3UO0 A;  5C42 B;  3BPD A;  1X4C A;  5AXK A;  2AMC B;  2E1C A;  2IBK A;  2LQ9 A;  5E41 A;  3BV8 A;  3SBM A;  3TO8 A;  2V0N A;  3LP0 A;  3G6X A;  2BJD A;  2C2E A;  2ASY A;  2LYV A;  3SFU A;  4DV6 J;  4J9U E;  2MKK A;  2CAJ A;  4JI6 F;  1CJV B;  2MQM A;  2KFZ A;  3CWJ A;  5K8M A;  4NPO A;  2BKN A;  4ED0 A;  1OJ4 A;  3RW7 A;  2BE7 D;  1U1K A;  1X5T A;  1PJ7 A;  1TTH B;  4YQW A;  2J9E A;  1EKS A;  3C3L A;  1RT4 A;  2FLP A;  3FCH A;  3ZTP A;  8AT1 B;  2PSZ A;  1JLF A;  3V6J A;  5IWA J;  1S1W A;  3OL6 A;  4DQR A;  5HJX A;  3T3F A;  3KMS A;  1FJC A;  2V8G A;  1Y11 A;  2DNQ A;  1FWK A;  4XO0 A;  4USU A;  3OT9 A;  3UCG A;  3H4D A;  3W64 A;  1RU1 A;  3VAL A;  1X9W A;  2K2P A;  5DG7 A;  2NRE A;  1PG5 B;  4PWD A;  2D3U A;  5I3U A;  5GAD I;  1P9Y A;  1TU0 B;  5GME A;  5AXM A;  3DLG A;  3MEC B;  4B3T F;  5D77 A;  5IC4 B;  3OTB A;  4F26 A;  2FVC A;  4E8U A;  2DNM A;  4K7Q A;  3O3L A;  1PSD A;  1AZS B;  3DRS A;  5GVQ A;  3GYG A;  4ZMM A;  4H4M B;  2BE2 A;  4K59 A;  4USW A;  4RWW A;  3D3C J;  4B3S F;  2CPY A;  4IUF A;  4QWE A;  4LFC F;  2D9P A;  3SSQ A;  1A6L A;  3UN2 A;  4OYB A;  3BKF A;  2K7K A;  1BD6 A;  5D4O A;  3M2U B;  3BGR A;  4GVL A;  4P2S A;  3NAH A;  1CJK A;  2EFQ A;  1HW8 A;  2DRD A;  1QSS A;  5CYM A;  3AH6 A;  4ECS A;  1U48 A;  4DPT A;  3BR9 A;  3W5Z A;  3KHL A;  3CED A;  2KFY A;  1N34 J;  4CT8 A;  3LQV A;  3OTO F;  4WIQ A;  1HI1 A;  2MZQ A;  2XNR A;  1Q7L B;  5FDL A;  3DLE B;  2FZK B;  3QMQ A;  1KP6 A;  2CWX A;  2GHP A;  1VQ5 S;  1WKK A;  3PX4 A;  3QWP A;  1BY9 A;  3KLI B;  2HQG A;  3DRP B;  1N6Q B;  2KH9 A;  1QVG R;  3AOB A;  1WF0 A;  4P52 A;  2P9C A;  3FDS A;  2RD5 C;  1YJV A;  2AYG A;  1XJW B;  4Y2C A;  4G1Q B;  3GIR A;  3ZXW A;  4GVB A;  1ZZN A;  1FD2 A;  2DGV A;  2DIU A;  3VV2 B;  1VRU B;  2G13 A;  3OV7 A;  2AEJ A;  4PRF A;  2NLW A;  1SC6 A;  3MED B;  1F60 B;  4IG3 A;  2VBX A;  1T94 A;  4CO4 A;  3UN5 A;  1KBR A;  3V5R A;  5FLX U;  3CCM S;  1TL1 B;  1S1X A;  1H7W A;  5D0R A;  1UET A;  4MKA A;  1U7L A;  1JLA B;  1IKY A;  2W2O P;  4X4R A;  2YH0 A;  4C8L A;  3FMB A;  1PAU B;  4RJV A;  4FF1 A;  2IJN A;  1U09 A;  1QAY A;  1Y9O A;  4NEZ A;  3PCO B;  2R8J A;  2ZH4 A;  3M2V B;  4EMD A;  1CBK A;  3AY0 A;  1M5S A;  3KUG A;  2VIC A;  2MHN A;  2EVZ A;  2JFD A;  4ED2 A;  2RQ4 A;  3QZ7 A;  1RCX B;  3TAR A;  1HIY A;  2FYX A;  3PVX A;  2ROP A;  3C14 B;  1VQ9 S;  2RIL A;  2QO3 A;  3AB4 B;  3FCW A;  1CS4 A;  2BV3 A;  3DM2 A;  2I5J B;  4C7Q A;  2E1M C;  5C42 A;  2GCF A;  4NLX A;  2C2N A;  5IC6 B;  2NPF A;  2RS2 A;  1NSK L;  2DTJ A;  2VG6 B;  4C4W A;  3PKY A;  2J5A A;  2ZKU A;  1UZH A;  3TZW A;  4YUD A;  1WWH A;  5FLX Y;  1CJV A;  4M8L A;  2E7V A;  2LA6 A;  4BHQ A;  1N33 F;  1XNR J;  2AJ1 A;  2CWK A;  4CO0 A;  1F9F A;  3M6X A;  2YX7 A;  2FVR A;  1P1T A;  1TK5 A;  1NDL A;  3LP1 B;  2JH3 A;  2XC9 A;  3UR0 A;  3HO1 A;  2EBE A;  1WHV A;  2QX0 A;  3MPU B;  3MM5 B;  4ZPD A;  4C8N A;  2ZDO A;  2KM8 B;  2AW0 A;  2G0C A;  2KT3 A;  1QUP A;  4CT9 A;  3OLA A;  2AZ3 A;  2V8P A;  3MEC A;  3MF5 A;  4USI A;  2JDJ A;  5THW A;  2PN6 A;  1PYT A;  5MAO A;  1SVD A;  3ZZO A;  1R8H A;  2UUC F;  2YWF A;  3SFG A;  3OXG A;  4K8R A;  5CHC B;  4G3I A;  1AZS A;  3QNW B;  3CIM A;  1S59 A;  2HZC A;  2IAJ B;  2LXU A;  4H4M A;  1YIT S;  1HW9 A;  3G82 A;  3J7Z 5;  5I3P A;  2CQP A;  1NPR A;  3M8P B;  3MFI A;  1N5Q A;  2R7W A;  2Y0B B;  3PW2 A;  3KHG A;  4MT1 A;  2PFF B;  3C66 A;  2X51 A;  3VZI A;  3D6H B;  3NWR A;  2VDH A;  2NXU A;  3HHL D;  4QR2 A;  2ROG A;  1F9H A;  3I5A A;  2YWW A;  2MXY A;  4U96 A;  3K5M A;  2BBE A;  4ES3 A;  3LGN A;  3M2U A;  1X4D A;  4ZLP A;  1GFW B;  3CVK A;  2ZJR Q;  1WOO A;  2GZO A;  3M8Z A;  3NS7 B;  2G4B A;  1WC6 A;  4DL0 C;  1S1U B;  1TP7 A;  5F8H A;  2W2P P;  1WUU A;  1REV B;  2VAS A;  4NRT A;  1NBE B;  2QA4 G;  3CUL A;  4IH5 A;  1KQK A;  3FNN A;  1T3N A;  1N4L A;  2VC0 A;  1RDR A;  4X4U A;  3DLE A;  4LF8 J;  2BQ3 A;  4WU2 A;  8RUC A;  1IM6 A;  4P2F A;  3L7O A;  4OYO A;  2QV6 A;  2RT3 A;  2J9D E;  3KLI A;  1YJN S;  3DRP A;  4NLV A;  2ALZ A;  1M5P C;  1N6Q A;  3JAM U;  2HHX A;  2IM1 A;  3DDN A;  2FPH X;  3TP2 A;  4O4R A;  4G1Q A;  2Z2M A;  2RKI B;  3VGS A;  3PJX A;  3T1H F;  5HBM B;  2BJ3 A;  2XG8 A;  3RAX A;  4NCB A;  4CM0 A;  1VRU A;  2OAU A;  3C16 B;  2YTC A;  2MKI A;  4I7F B;  4I2P B;  4CLZ A;  4LQ3 A;  1YK9 A;  5HP1 B;  1SJ4 P;  3MED A;  4QIE A;  3HVA A;  1NHV A;  5J2P B;  1TL1 A;  4ZCM A;  2MQN A;  3R5D A;  3OTC A;  4OX7 A;  5IT0 A;  3K5N A;  4HDG A;  1CJT A;  2VFS A;  4IR1 A;  1JLA A;  2ZH1 A;  3MPD A;  2E29 A;  3DLH A;  2KU7 A;  2DIS A;  5JMN A;  4Y65 A;  1NKE A;  2MJN A;  4NLO A;  2NYH A;  3M2V A;  4QWD A;  4DSL A;  4JBC A;  4KY3 A;  2HK3 A;  2HGN A;  1RIS A;  1TL7 B;  1EB0 A;  4OZL A;  3TJA A;  3PR5 B;  4ELT A;  4DR7 J;  2YKM B;  2P9E A;  1S0N A;  2C2O B;  2CNK B;  4DFJ A;  3C14 A;  1WOP A;  3JAM Y;  4DSK A;  2VG7 B;  3LW5 C;  4ECQ A;  2VC1 A;  3VTI A;  2I5J A;  1LW2 B;  1BQX A;  1HNZ J;  1D9F A;  1ZBT A;  2A1B A;  2VG6 A;  5ETR A;  4R0E A;  1QSL A;  4ED7 A;  2RQK A;  1L5U A;  3CJR A;  4EEY A;  4NRU A;  4DXL A;  3U02 A;  1N36 J;  1HI8 A;  4ZJO A;  3ONQ A;  4NX9 A;  3GFY A;  1NO8 A;  1G2E A;  3RB4 A;  4NLR A;  1MWQ A;  4B9M A;  3UN3 A;  3GTY X;  1KQF B;  3G8T A;  1NB2 A;  4X4T A;  2B56 A;  3SCI E;  3LP1 A;  1EAY C;  2V9K A;  3CE8 A;  3ZNJ 1;  2GO9 A;  1RSC A;  3MM5 A;  1NK6 A;  1U1M A;  2OEJ A;  2RRB A;  3OFF A;  1GH8 A;  3OD2 A;  4JI4 F;  2CG4 A;  4RBU A;  4PG7 A;  3UD5 A;  4DPU A;  2R2S A;  2OSR A;  1S9F A;  1N32 J;  2XY7 A;  2ZIT A;  2BW2 A;  2J9C A;  2OEM A;  3VVU A;  2CVE A;  4RLE A;  2IAJ A;  1HHS A;  5D4P A;  2IC3 A;  4FVC A;  1X0P A;  5DZ7 A;  2CG8 A;  3M8P A;  1IWA A;  2UUA J;  4EO6 A;  3ETM A;  2XO7 A;  4J9K A;  4K2J A;  3T1Y J;  3N28 A;  1N88 A;  3PTW A;  1HD0 A;  4LFB F;  4K4Y A;  4DX7 A;  1N8R T;  1OIA A;  4Z7C A;  2MKY A;  5BYS A;  3A3N B;  4NLY A;  2E9Z A;  3QGP A;  1FWP A;  5GAG U;  2HHV A;  4C3K A;  2ZVS A;  3Q89 A;  5KFE A;  3QSY B;  3KG1 A;  1T11 A;  2COL A;  1S1U A;  4UOC A;  5C25 A;  2ATC B;  3E2E A;  3CSK A;  3AD8 C;  3MD1 A;  3J7Y I;  2LMI A;  4WBF A;  3M8Y A;  2HW3 A;  2UXC F;  1B7F A;  4DR5 F;  3HSG A;  2FZC B;  4F3Q A;  5KFQ A;  1RHM B;  4QZV B;  3IGV A;  5KFV A;  3OTD A;  1DTQ B;  1R8A A;  3KJV B;  1SKW A;  3HSZ A;  2POK A;  2KJW A;  1QTM A;  2KG0 A;  3ZZP A;  4G1P A;  4IFV B;  4DQI A;  2UXB F;  2RKI A;  4M1K A;  5HBM A;  1UVK A;  1B0V A;  1N5S A;  1RYS A;  1BHN A;  4PG5 A;  3D9B A;  1D0E A;  1RAF B;  3C16 A;  1TKZ B;  2XCP A;  2DNN A;  5GAD U;  1S7H A;  1VHF A;  1GT8 A;  4I7F A;  3HT3 A;  4I2P A;  4EZ6 A;  3TI0 A;  4TQR A;  5HP1 A;  1RYR A;  2QMW A;  2CRL A;  4CLP A;  2GGP B;  5J2P A;  1Q86 T;  3BDP A;  1WG5 A;  3KJN B;  1QAX A;  1X4B A;  1JNZ B;  4ZPV R;  1Y10 A;  4DPX A;  2JC0 A;  1VLY A;  3EVW A;  2BJ8 A;  2DNO A;  4Y28 C;  3KWM A;  3W65 A;  3HKW A;  1LWC B;  2VPW B;  1WF2 A;  5ETP A;  4QYR A;  2QA2 A;  4FXV A;  3A8K A;  4NXM J;  1TL7 A;  5AE1 A;  5KFW A;  4L76 A;  2MKH A;  5IFM A;  1DQ9 A;  2YKM A;  4LVN P;  5SUH A;  4CLY A;  4J90 A;  2XSF A;  5IXU A;  4M5I A;  2VG7 A;  3ZTO A;  4DL5 A;  2NSB A;  1VK8 A;  4ICL B;  1LW2 A;  3BKU A;  4UQG A;  4GKJ J;  3DOL A;  3IR6 B;  2KYZ A;  3MM9 B;  2OH2 A;  3RBX A;  1R3N A;  1SCJ B;  1FDN A;  2LDY A;  1U6F A;  4UST A;  4CTA B;  3IFE A;  2YPY A;  3GPA A;  3QT8 A;  1LWX A;  2XGP A;  1MLA A;  4RNO A;  5HMX A;  4KC5 A;  3FQK A;  2VKZ G;  3WBZ A;  4JYA F;  2R4F A;  4KGK A;  5KFA A;  1RLD A;  4UT4 A;  4ZVO B;  1TQL A;  4NZ7 A;  1NDP A;  4AND A;  3D0G E;  3D68 A;  2O1P A;  2MKC A;  3LH2 S;  3LTO A;  4RW9 B;  3HUL A;  5FJ4 A;  5BR8 F;  4DV7 J;  1U26 A;  2UU9 F;  3TUJ C;  1L3V A;  2MY7 A;  3KXD A;  5LJ5 Y;  2BJE A;  2FHM A;  3PW5 A; 
#chains in the Genus database with same CATH homology
 1YLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...