5IOLA

Crystal structure of nucleoside diphosphate kinase from schistosoma mansoni
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
b'PERTFIMVKPDGVQRGLVGEVIQRFERRGYKLVAIKMMHASEQLLQTHYEALKSLSFFPKLVAYMSSGPVVPMVFEGRKVVENGRTMLGATKPEASCPGSIRGDYCQDVGRNVVHGSDSTESANREINLWFSPQELCQYKQAVDPWIHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Characterization of a Schistosoma mansoni NDPK expressed in sexual and digestive organs.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 46
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 5iolA00
1LEOA 2DY9A 2ZUAA 1NSPA 3GPAA 1PAEX 1BHNA 3B54A 3PJ9A 4FKXA 3EVWA 1UCNA 3ZTRA 3ZTSA 1NSKL 3WX8A 3L7UA 3NGTA 3VGUA 4EK2A 1K44A 2VU5A 1S59A 1W7WA 3ELHA 3EVOA 3ZTQA 1LWXA 1S57A 4ANDA 1F3FA 3FCWA 1PKUA 3EICA 3FCVA 3VGTA 4DZ6A 2AZ1A 4DI6A 3FBFA 1WKLA 3BBCA 1VYAA 1U8WA 3VGSA 3EVMA 3DKDA 3PRVA 3ZTOA 2DYAA 2B8PA 1JXVA 3VVUA 4HR2A 1B4SA 1XIQA 3EMTA 4ANEA 1WKKA 2CWKA 4F4AA 3JS9A 1HLWA 3Q89A 3BBBA 1F6TA 1KDNA 4CP5A 3Q8VA 3ZTPA 3DDIA 3VGVA 1NHKL 3GP9A 1XQIA 5C7PA 2DXDA 3FBBA 3FKBA 1ZS6A 4ENOA 3Q86A 1NSQA 4F36A 3ENAA 4O0NA 2BEFA 4FKYA 3Q8UA 1NB2A 3EM1A 3Q83A 2NCKL 1MN7A 5IOLA 4WBFA 3VVTA 1NDPA 3FBCA 5CAAA 4KPCA 2HVEA 4C6AA 1B99A 1HHQA 4UOHA 1NLKL 3MPDA 5BXIA 1NDKA 1EHWA 3BH6B 3NGRA 1NDLA 1NCLA 1MN9A 1HIYA 4UOGA 1BE4A 2DXFA 3FBEA 2B8QA 1S5ZA 3NGUA 3ETMA 2BX6A 3Q8YA 3B6BA 3R9LA 5CABA 3G2XA 1NUEA 4UOFA 3BH7B 1NDCA 3NGSA 2DXEA 4W98A 2HVDA 1WKJA 4S0MA 3BBFA 1NPKA 1BUXA 3EE3A 2HURA 4ANCA 2AZ3A 3FC9A 3EJMA 4DUTA
chains in the Genus database with same CATH superfamily
4G1QB 4WFBQ 1RA6A 5IT9U 2H65B 2MY8A 3PHTA 5IZHA 3DCAA 1Z2ZA 3GIRA 3O1LA 3UDVA 1UWAA 2GMJA 1RA7A 1R3NA 2DO4A 3DKDA 2N82B 1D0EA 1SV5A 3CVKA 1AT1B 2MY7A 4WK1A 2DGTA 4FYDA 4MKBA 2XYHB 3QYYA 2HFZA 5B0EA 3QGIA 2A1BA 2F8HA 1NHKL 2FZGB 4K4YA 5HROA 2HS4A 2V67A 4CYUA 4NXNJ 2HVHA 3M2UA 4M5HA 4KV8A 4LF5F 4U6PA 2W2PP 1HI0P 5THWA 2ATLA 2GNKA 2W4PA 1UWBA 1VHFA 2P9GA 4ZVQB 4DUYF 4CM0A 3HHLA 2CRLA 4A8QA 2GQCA 1XTZA 5FDLB 4DCPB 2BW2A 3DXBA 3CC4S 4TU7A 1RWMB 4PR6A 1X60A 2HVDA 2A6OA 2BRLA 1NPKA 4QZVB 3H5YA 1R8CA 4E2FB 2OFGX 4WKYA 1RAHB 2OP5A 4M63A 4DR6J 2HNYA 2XZTB 1ZTTA 3CNQP 4YDDB 2MGZA 4USVA 2FHJD 4IG3B 2Z57B 1VYAA 2R7XA 1E6YA 3BQ1A 3KFWX 2BE2A 3FSXA 3M7VA 4DV3F 4DG1A 1X0PA 3UD3P 1XMBA 4CO1A 1C0UB 4WZQA 2VA3A 2DIUA 2PC6A 4NLTA 2K7KA 3UNGC 2MTLA 4F36A 5KG7A 5J2MB 2JFDA 2CG8A 4G3IA 4NX9A 3CJ4A 4LFCJ 1IN0A 1C2PA 4MTPA 5HMYA 4QWAA 3NCQA 3KLGA 2XYPB 2KZMA 3Q2SC 2HWTA 3HT0A 1ZETA 4LR7A 5BXIA 4KHPF 4FP9A 1N4LA 3P96A 1U2CA 1UKUA 3PFEA 2BOPA 4O0IA 4MJKA 3CCES 4C8ZA 4ZP6A 1T9UA 3HVRA 2RDDA 3DN9A 2FHKA 2KTQA 4RNOA 1SPBP 3AQPA 4MAKA 1G4CA 2FVSA 4ES2A 3ZTQA 3QATA 4LIWA 2QFIA 4DV7J 4J9KA 2XMUA 2VONA 2M7SA 5E3CA 1V3SA 3OXFA 2CPEA 3UE2A 3BS9A 3W9JA 2ADCA 1T03A 2BR0A 4K5RA 1FXRA 4RW7A 1HHSA 3FBBA 2V9WA 3OL7A 2EPIA 4KH1B 1NSQA 1TL7A 3LANA 1EP4A 1SV5B 4HYKA 1R8PA 1NDKA 4HEA9 1KD1T 1HIYA 5KG1A 5HROB 5K20B 2KFYA 3R7SB 5K8NA 4CYUB 1FKPA 2NUHA 2I1RA 3GLJA 3M2UB 5K14A 2E1CA 2MSTA 4KV8B 2GW8A 3CCUS 3N0VA 4UUWA 4F26A 1NH7A 5CZVA 2GAHC 2OEJA 1NKBA 1UPMB 1UWBB 4F25A 5DQGA 1N5QA 3AA9A 2EK1A 3HHLB 4N56A 1FF2A 2F9JA 4QWBA 3D7SB 3NMAA 4LIRA 4O4GA 3BREA 1RWKB 5KG3A 2F63A 2EKYA 3SCLE 1JLBA 3IM9A 2HNYB 5LOQA 2VASA 1FKAF 1KDNA 4WU2A 2B6AA 2MGZB 3AA8A 1ICEB 4DSJA 2PE8A 1HR0J 1UEVA 1E6YB 2BE2B 4DPWA 2LQJA 4MKVA 3CDWA 4DG1B 4WFXA 5AJ3J 1A6LA 1TK5A 2JWNA 1SJ3P 2BX6A 1JNRB 1N5VA 2HBYB 3G2XA 3ITHA 2C2ZB 3NCPA 2W9AA 3KLGB 2VG7A 4TN2A 3U1MA 2CIMA 3FRYA 2MQMA 4CNYA 2LYVA 3OR1A 2HBRB 2J76E 4JI2F 3LP1A 2XG8A 1UEUA 1OSDA 1B3TA 1RJJA 3EVMA 3AB4B 5GAHI 2B8PA 1MLAA 4M1KA 1RACB 4DLGA 2YNHA 1HW9A 1YK9A 5J1PA 4KC5A 4CM2A 4N76A 1X4EA 2DRAA 3HCXA 1N48A 3FUYA 1U02A 5GADI 1TL4A 3HHLD 4OI2A 3WC0A 3BV8A 1T03B 2W01A 4RNHA 2W24A 2W2OP 4RW7B 4OYPA 5HANA 3BF4A 3J7YU 5D0HA 4MK8A 4YHHF 3CWJA 1VOMA 2MHEA 2JSXA 2FHMA 1TL7B 1EP4B 1SCJB 2LFVA 1I5OB 4OYAA 4LFAF 4AL6A 2Q43A 3QFHA 2AEMA 2ZFHA 4PWWA 3WC2A 2VPYB 3I31A 2UP1A 3KJFB 2LLZA 5IM0A 2M0GB 2RHQB 1FKPB 4FXVA 4RWWA 3VAHA 5C2GA 4K0KF 6AT1B 4KTQA 5K14B 2IM0A 3BPDA 3NRBA 2VJUA 3MPVA 2EFVA 3VAMA 2HHXA 4NCBA 2CWXA 5KG6A 3CIMA 2MZRA 2B4PA 2CPYA 4OJHA 5FD1A 2KH9A 1FESA 4O3PA 1RHQB 4O4GB 3H5XA 4I56A 4AL5A 4K59A 2PDAA 4Z7YA 1RB0A 1P27B 3HD2A 2OSQA 1FE0A 5C24A 1NDPA 1JLBB 4NLGA 3QIDA 4TVAB 4K4XA 2VFTA 2B6AB 1Y5LB 2HBZB 4DJBA 3BM7A 2YXLA 1KQFB 4LF6F 1OIAA 2YQ3A 3R7BB 1U1QA 4BLGA 3JSRA 2JJ4D 2WVCA 5KFIA 3VAIA 3CW2C 1PIEA 2QFJA 2ZVIA 5D15A 1HNVA 5E41A 2HLTA 4DUZJ 5IQ6A 2D3O1 2CJAA 2LVWA 3ITHB 2B9EA 2RS8A 2VG7B 2V4QA 4I67A 1PC4A 2A3JA 4ZPCA 4U95A 4ANEA 4CCHA 4MK9A 3HKZD 4P2FA 2C3PA 5E0OA 3PYFA 4NRUA 4BWJA 3OR1B 2HPUA 4ZIWA 1PJ5A 4E8UA 3KLIA 1APSA 2C22A 4J9RA 2O67A 4PG7A 3CIZA 4CNZA 1MROA 1JQGA 4E0DA 4DCJB 1SVDA 5CAAA 2YNHB 1B99A 4H4KA 3FCHA 5JVGQ 3PW2A 4RX6A 4C0BA 3SCIE 1MW7A 1WHXA 2NLWA 2NXNA 1DFDA 3EGVA 4KRWA 1OSCA 3V4MA 2BE7D 2A2CA 3SZ2A 3FNNA 4OYOA 2IC3A 3AJDA 2V2QA 3ET6A 3LO3A 2YWKA 4BC7A 2G2OA 3B54A 1EKRA 1SKSA 2KG0A 1IBLF 4EK2A 3GWCA 5KFPA 2PO4A 2LQBA 4R5PA 1T9TA 2A2DA 2BKNA 2CQDA 4LF4F 2CNOB 1OY6A 1RTIA 2CWKA 1TMJA 2CQHA 1RAEB 1UVNA 5C25A 2AT1B 5IM0B 2FJAB 4M5LA 3Q8VA 1WDDA 5C7PA 5IT9Y 1FFWB 3TX0A 1WC3A 2UVUA 1JMTA 4CT9A 5HO4A 2AV5A 2GCFA 3D1OA 3IR6B 4ZN3A 1IBMF 3EWGA 1F5CA 3GIMA 2O01C 3RRGA 4IR9A 2VPZB 5KFWA 3LTOA 2OKQA 1SJ1A 2J0XA 3U27A 2F8EX 3VZHA 4WFAQ 4UOFA 3M6UA 2ZH1A 2VH7A 3LP2A 4MKYA 5C24B 4EZ9A 1KFDA 1YBUA 2Y1IA 2IM2A 2BABA 4ILLA 3IRWP 1Q5VA 2E7VA 4N5SA 2CPDA 3PM9A 4O23A 4YB1P 1KQGB 1Q95G 1NZ8A 1NKEA 4AXIA 2IVMA 3RBEA 1HNVB 4ECWA 2J6UA 2YKOA 1PBUA 2IPOB 5KFOA 3O3LA 4F4KA 2QLBB 5BR8F 3A3OB 2KRRA 4P52A 1T9VA 3NKYA 3GCXP 1HYSA 2HZCA 4IKAA 3JTNA 3DOKA 3FEXB 2IYGA 3DGVA 4C98A 3AT1B 5A8WA 1XMOJ 1OY8A 3HJVA 2JH3A 2XY7A 2E5LJ 1IJFB 1S4FA 1FHTA 5K8OA 3OHAA 4DV2F 2QL9B 3R27A 4DV1J 5EX3A 3OTDA 5F8IA 2LCWA 3KLIB 3HHKA 3PX4A 3VV2B 2ZWPA 4DR3F 1RSCA 5L9NA 1MROB 4OX9F 3FZBA 4ETXA 2KM8B 1S1WA 3SSRA 2LECA 2C3UA 3TUPA 3MI7X 3OJSA 4OV6A 4ECUA 2OFHX 3IFEA 3S01A 3T5LA 4LFBF 3D0IE 4DSLA 5CYMA 4OHXA 1W2BR 1O5JA 1NK4A 3FBFA 5F8HA 1LWFA 2IC3B 2VKZG 2RB7A 3L09A 2B9XA 4OJGA 4Q8FA 2VBXA 3ET6B 1SC1B 4Y65A 4YQWA 1XK8A 1YZ6A 5GAGU 4DQQA 4KKOA 1IUJA 2FJVA 3GFYA 1B7FA 1HWJA 4R5PB 5D0GA 2O1PA 2CAJA 2H1YA 4Q2MA 3BPSP 2CQPA 3NG8A 1RTIB 1ZPVA 2DCUB 2X1AA 3BO2A 5C25B 5E3PA 4YR3A 3QQCD 2LA4A 2YKMA 1NCLA 4UOGA 5D4PA 1FNOA 3M4XA 2GVZA 2V69A 4PQAA 4Q2LA 1Q7LB 2VDIA 2QTWA 1H6KX 1K73T 3KDNA 5A8KA 2MZSA 4RL1A 1TU0B 4ED1A 1RABB 1PAUB 1JJ2R 5CCLA 4OZLA 3ENWA 2EK6A 3TW0A 2K3IA 1VLYA 3LP2B 1XERA 5J1EA 3T5JA 4CLYA 2DTJA 3DMJA 1UL3A 1WEZA 4NOHA 2L3MA 4QR2A 1WELA 2R8KA 3BO4A 2NS1B 5EWEA 3ZNJ1 4O3RA 2Y1JA 3K89A 2OAUA 3UDCA 1GFWB 3M8RA 4X66F 2LQ5A 4ZP7A 1D9AA 2XS5A 4YY3J 2OPRA 1L3KA 4RNNA 5AT1B 1GXUA 2R2TA 5ETKA 3BYPA 2OTLS 1HYSB 1U45A 2XY6A 4UZCA 3UI3A 4FS1A 2PA3A 4GKKJ 3DOKB 2P5VA 3HMJG 1RI7A 1HFEL 5T7LA 3IO1A 1BXNA 3LALA 2COLA 4DR2J 1HWLA 1S97A 2ZH2A 3BBFA 4FF2A 1OJ4A 2AJFE 3DLJA 5IT0A 1VGYA 3HHLC 1WC6A 3LOUA 1QJHA 3NWGA 3IA0A 2DT9A 1N34F 3RYLA 2JC0A 4ECTA 1N56A 3CJ5A 3EUNA 1YBAA 1SQFA 4NYZA 4DI6A 4F4ZA 1N0VC 2C3MA 4G65A 3CC2S 3V6HA 1S1WB 1U7LA 1T11A 4MFBA 3J80U 3FSYA 3VVUA 3BR8A 1EZZB 4EYIB 2XI3A 3D1HA 3CCMS 2YKAA 2YWWA 1NKCA 4QYRA 2HK2A 2J8SA 1P1LA 4M5DA 5CYMB 1LWEA 3JQJA 5KT3A 2LKZA 1CULA 3DC2A 1LWFB 2RKIA 2BEFA 1S9FA 2RQCA 4CO3A 2R42A 5EWGA 2FY1A 2GVDA 1FJ7A 2FLLA 2CG4A 2ZBCA 1N32F 4B3RJ 5H9EJ 1F60B 3SFGA 1M5SA 3KMQA 5FJ4A 1S6UA 4AQYF 1DHMA 2WBMA 3LGNA 4J7CA 5G0RA 2YKMB 3LGMA 2YQ0A 1S59A 2ZH9A 5DLFA 1RHRB 4KE5A 2DNLA 1U8WA 2DR5A 4P75A 4ITSA 3ADAC 5DGBA 5JVHQ 5A8KB 4CQ1A 4B9NA 1HHTP 3NS7B 1S77D 4F4AA 3E2EA 2JLFA 2JX2A 3GJRB 5IXUA 5GAEI 3MAAA 2E5GA 3LPYA 4J91A 5J1EB 1IBCB 2XY5A 2LXUA 4LF9F 4AXJA 4CWBA 4GO7X 1RBOB 1XR6A 3W8GA 2LA6A 1RUSA 3BGFA 3RUBL 3MM8A 3M8YA 3TVYA 4UW2A 2E1MC 3PKMA 4DR4F 1RT4A 2CQBA 1S1UA 1LW2A 3B4DA 2V6AA 3G8QA 2VQEJ 1K1QA 2GIRA 1X5OA 2OPRB 3I5CA 4CO5A 1SXLA 5HATA 2YNIA 4LF5J 3IS9A 3MM6A 3HFVA 1KR4A 3QT6A 3DRPA 1WF1A 1S6PA 2XWYA 2NXJA 4HT7A 5T7LB 3E51A 4B9VA 2G0CA 4DUYJ 1FRKA 1NO8A 3R1LA 1RLCL 3WZ0A 4PQUA 3PR4A 2FD2A 3DLEA 2V34A 2QMWA 5ETNA 3V6JA 4DSEA 4RU2A 3OTOJ 2MYFA 4X4QA 4HI2A 1N36F 3QPIA 2ZH3A 1KS2A 2ALYB 1NM2A 1X9SA 5H1SV 3MEDA 4WPAA 2MSSA 2HNZA 1G7CB 3NCRA 4MFBB 1F5AA 1VFJA 4U7UK 2UXCF 5KFXA 4ED7A 1IKWA 2BJDA 1YJRA 3Q8SB 1LWEB 1RWXB 1NK6A 1JLFA 1H7WA 1CULB 2RKIB 3BGUA 4C97A 2R4FA 1LFPA 1X0FA 2AWZA 4ZOSA 2ZOGA 4QIGA 1CQNA 1RAAB 1RWNB 3SI8A 4ZK7M 1BQMA 3GONA 2DO0A 3L7OA 1KHWA 5G0RB 3UW1A 2VQFF 1H2VZ 4PWDB 2W7PA 3OUYA 3IWLA 1OQ3A 4DL0C 1HA1A 5DJBA 1D1UA 3R97A 3MCSA 4MT1A 3B82A 2OD6A 1T7PA 3OL8A 3T5HA 1W2IA 5AXKA 2CXEA 3CMES 3MEEA 4MIBA 1XMQF 1O6XA 5KFFA 1GT8A 3MAAB 2WK4A 2WTFA 3HKWA 3TA2A 3P49B 4J9MA 2YNGA 1ELOA 3I56S 2GMLA 4Q8EA 2CNNB 1S10A 2M9KA 3MM8B 2FHOB 1HKAA 4LF7J 3TWZA 4DF4A 2K2PA 1RT4B 1S1UB 4R0EA 1LW2B 2WSFC 1FI4A 1URNA 4JI7J 3FCVA 2FGCA 3HX9A 3N9UC 2E7WA 4R25A 3CC7S 2IVFB 2R9LA 2XGPA 2YNIB 2GHVC 4NWBA 4IR1A 2K7JA 3IS9B 4TY9A 3I5BA 2J8AA 3MM6B 3SEOA 2RRBA 2VOOA 2D69A 3ZZ0A 3MMBA 3DRPB 4UY8T 3DGPA 1S6PB 2OO4A 3VCDA 4B9LA 2RT3A 2YKNA 3GV8B 2ZKTA 2VFUA 4PQUB 3DLEB 1YITS 3OTCA 4PYDA 4NLXA 2FLOA 3GTYX 4DR7F 3CEDA 3R5JB 2I8EA 2ZM6F 3PYEA 1XEZA 5DO2A 3BH6B 1CLFA 3KXDA 4EO8A 4OI4A 1HNXF 3TRGA 2IRXA 1FK9A 3FMWA 4Y2AA 2HHWA 4P10A 3MEDB 3J81U 2HNZB 3BJYA 3HSJA 2IMOA 4JBCA 3VZIA 5K8PA 2Z56B 1UVLA 1IKWB 1RHUB 1IXKA 2JL9A 3NBPA 4QYZK 4GRSA 1BLUA 1JLFB 1QD1A 2D3OR 2CZ9A 3EZUA 2I38A 2DY1A 4ECSA 2XBPA 4FPIA 4ZCKA 4JV2A 5DGAA 1WACA 1U26A 4NLYA 1DQ9A 2B9WA 4DV5J 1FX4A 2M2BA 4C48A 3FMBA 2XO7A 1FDNA 3JTOA 5F8MA 5DZ7A 4ED3A 4USWA 2XZDB 1UA1A 2CPXA 1ACMB 3ISND 1BQMB 3OHBA 2ZOMA 2DHHA 3MM7A 5KT2A 2OSRA 4J9OA 2XCAA 1RHKB 4ID5B 2NPFA 3OUYB 3PR5B 4KO0A 3E8OA 2VKRA 3KNAA 4M8LA 3MFHA 3AODA 5HQMA 3M8SA 2BM0A 3HFZB 5KFZA 2CUYA 4H4KC 2EFQA 5HVGA 5E3AA 3MAHA 4ECZA 4CT8A 3NGDA 3EZ5A 4AL7A 4KGXB 4V19X 3MEEB 4LF1A 1TKXA 2RHSB 3C8YA 2DR7A 3QT8A 3GR0A 1UPPA 3TZYA 1QTNB 4RUCA 2LU2A 2ROGA 1DAXA 3I0SA 5LMUF 4P6QA 4YHHJ 1P9YA 2KT3A 2HG4A 1SI9A 3PRVA 2V8VA 2FLNA 5H9FJ 4GC6A 1F2GA 4ETZA 1GNKA 1T3NA 4CI0B 2E1PA 1K47A 3CJ0A 2GA7A 2JLEA 1RWPB 3N6NA 4FBTA 4F3QA 2HHQA 1G2EA 5E2QA 3GFXA 3MECA 3VAJA 3PW0A 3A1YG 4CH7A 1NK9A 2HRYA 3OR2A 1Q7YT 4DHVA 2BJ1A 3BB5A 3MMBB 2PMWA 3HZEA 3DGPB 1TL3A 4B3OA 2ZC4A 1D8YA 5GAHU 2YKNB 3EGZA 3JSYA 1RYSA 1EETA 4U67Q 2ZITA 2QEXS 3LAMA 3O2IA 2WVEA 4DEZA 5LL6d 2XEXA 1Y00A 1CSJA 4C0HA 2W1BA 2B7CB 5KFJA 2Z2ZA 4PYAA 1FK9B 3TOQA 2BYCA 3T6BA 6FD1A 2MPUA 2PIIA 3NMRA 2NXUA 4MIWA 1VDHA 3NBPB 4OI6A 4LR8A 4HH1A 4CP5A 3ZZPA 3WQPA 1FKOA 3VAFA 3CMQA 4C3LA 2CJQA 2QLXA 4BC9A 1VQPS 2DNHA 1GTEA 1FERA 5E7OB 4YP3A 2UUCJ 4QW8A 4QCLA 3J80Y 1VK3A 4WIQA 1XR7A 2OTJS 4WE1A 4ZPAA 1WKJA 3PRBA 3MM7B 1Q53A 2CPIA 1VLOA 2GJIA 1JLGA 4KO0B 2WCXA 1D8ZA 1KC8T 2F8MA 3CD7A 1WDTA 2GMHA 5AE3A 2GX8A 2UUBF 2XSJA 1R8BA 3UNYA 2QV6A 2FJDB 3SDEA 1YRTA 4KHRA 1TKXB 2YKPA 1V9OA 1VQ9S 4EU0A 3X1LB 4X64F 3CT9A 1KLNA 4JYAJ 1PJ6A 3MHYA 1AUDA 3Q24A 3I0SB 3ZZZA 3PKYA 2R7OA 1GXLA 4M5NA 2KB2A 2QL7B 1PJ7A 4A8MP 1AFJA 3TAPA 1M90T 3DHXA 4ER8A 2JOQA 2Y8WA 1O0PA 3R1HA 3HF5A 2D7SA 1F2HA 5C42A 2E9TA 2YWEA 4EBDA 1FFSB 1M5VC 1G3OA 1YZ7A 4QU6A 4PXBA 3RAXA 4DQRA 4Y2CA 7FDRA 1JXEA 4M5KA 3TA0A 1CJVA 1WOSA 4R0JA 4RNMA 3IBCB 4YS2A 3PNIA 3MECB 1RHMB 2KJWA 3KK1A 1CS4A 3OR2B 2ASLA 5CH7B 2EXUA 3IBWA 2H4YB 2ZUAA 3OTEA 4L75A 1TL3B 1BHNA 1NAQA 4YUDA 4B3OB 5DQHA 3CJTA 4ZLPA 3HXMA 3V2UC 2X3DA 4DFMA 5JXSA 1FXLA 3UN3A 2MQLA 3FGVA 2MKIA 3CCVS 4UY85 4KR0B 3VALA 3HD1A 3C46A 4ZVEA 1FJGF 3IP0A 1NPRA 2BOAA 5KFYA 1TL1A 5A0YA 3G71S 1JWWA 2C3YA 3AB2B 1RHJB 2Y8YA 3UR0A 2UUAF 3QJPA 2BJ3A 2DH9A 3A8IA 4HDGA 3W64A 4WBFA 2DKOB 1I51B 2ZEJA 2HLUA 1Q8BA 3AOAA 3A8EA 2ZZNA 5BR8J 4LREA 2WW4A 4N77A 1PG5B 1MN9A 1FKOB 4ZLLA 2F4FA 2XHWA 3VHQA 4ZJOA 2QE5A 2GV1A 1U1LA 1S76D 4TKTA 4NLOA 3QSYB 2VG6A 1FRIA 1N5SA 3MDFA 3CCQS 4WFZA 4JI6F 1BMQB 3U1LA 1UZDA 3J7AN 3P4UB 1GMUA 3AHPA 4DPXA 1QTMA 1S57A 1H38A 4WE1B 1TV6A 4KGKA 2VHGA 1ITPA 3RW6A 4F0MA 2AJQA 4ED4A 1QVGR 3UD5A 4RO0A 1JLGB 2ZVSA 1IQZA 3ZZTA 4IO9Q 1WHYA 4YDXA 4X2BA 1H73A 2GIFA 4B3SJ 3N5FA 4QIWD 4Y00A 2XSJB 4PXCA 2DGVA 2DHAA 2Z2LA 3SDEB 5IV4A 4ED6A 1C4AA 1Q1KA 3D3CJ 2BUNA 2CZ4A 3H20A 1KHVA 2R7RA 1UVMA 4QWEA 3U7JA 4ECYA 2XMVA 3THVA 3W3SA 3C19A 3BN7A 4C11B 1Y0HA 2J0WA 2AYMA 4XTTA 3GMGA 3N4WA 1VS3A 5T41A 1SH0A 2AYBA 2BACA 5D0RA 5DZ6A 1XJWB 1SL1A 3NP5A 1HWIA 1RLDA 4LRBA 5SUHA 3MEGA 2G13A 4OHZA 3AD9C 1SIWB 4NA3A 1BQXA 1YJWS 3T1HF 5C42B 2XS7A 3JAMU 1FJCA 1UCNA 2CQ2A 3W66A 1J5EJ 1WOPA 3ZZRA 4A8KA 1NPPA 1CJVB 2XS2A 3TAQA 4KPYA 4X65J 3KK1B 1CS4B 1WF2A 4WWSA 2QT7A 1KSPA 3BR9A 4HR2A 3W62A 2IM3A 5IV3A 3CDBA 2E9ZA 4NEYA 3RRHA 2AX1A 2O5DA 4J90A 1CJTA 2DNYA 2AJ2A 1HARA 1TQLA 4B08A 2J7WA 4OYBA 1XN9A 2LU1A 1TL1B 1NBEB 5A0YB 3T9NA 4OYIA 3U1NA 2J9EA 1TKDA 4NXMJ 3FFIA 2ZJRQ 4C8YA 2FZCB 3DYAA 3BKFA 4A8FA 2V94A 1SKWA 2DNPA 3ISNC 2PGCA 3UDEA 1R6YA 1J2VA 2VG5A 1S72S 4USHA 2HK3A 2RRNA 4ZPVR 3D0GE 4HTIA 4AT1B 5EN1A 4JI0J 4AUKA 1FWKA 3KHGA 5ETPA 3M8WA 2HZAA 4ZS6A 3OD2A 2ADBA 3I9ZA 2M52A 2EEYA 2VG6B 3KYLA 5F3ZA 3C6UA 1XIQA 3J81Y 4HLBA 4PPZA 3Q8PB 2DGQA 1RAIB 1W25A 1TV6B 1IR2A 3O8WA 3SXLA 3W61A 5IOLA 2ZOFA 4ZVUB 1VQLS 5HAOA 1DQ8A 1MMNA 1SL2A 4M5GA 3MPDA 2NZ4A 2ROEA 5D8HB 2YKQA 2YH0A 3H42A 3MCNA 2MLYA 2APOA 3MPUB 3EDQB 2DJWA 1TELA 4EFAC 2UVVA 4WYLA 4O4RA 4YMEA 2B3TB 4B3MJ 1X5SA 4FXWA 3M1VA 3OFGA 2XULA 3TNVA 1FNXH 5B0AA 3C6TA 2D1CA 4ERDA 3MEGB 3M30A 5M2PA 4JV5F 4UOCA 2IYIA 2ZWOA 1KNZA 4QWDA 1ZH5A 1SQGA 4U96A 1EB0A 2DRDA 3DDKA 4CLTA 2JEJA 1RE1B 4P72A 1FEHA 3Q8QB 5LJ5Y 1FRMA 1DJ0A 2KG1A 1U1KA 3EDRB 1ZA2B 1BWEA 3G87A 2DXFA 1RWVB 4IRKA 4DR5J 1CJTB 1YG0A 2L9DA 3NNAA 3ISZA 4L74A 4X84A 1RDRA 4IH5A 3P45B 3UQSA 2LQ9A 5M2RA 4NZ6A 1X9WA 4LSZB 3FFIB 3IGVA 1K44A 3LWLA 1KVIA 3M9MB 3EX7B 2LDIA 3OPKA 2DD8S 1U25A 1AZSA 2VG5B 1N33J 3OJUA 4WFYA 2IBKA 4FVMA 4X4VA 1DTTA 3W2VA 4NXNF 2V4RA 4H4OA 1HQUA 1JJCB 2W4CA 2PMZD 2J5AA 3L95X 4W92B 1FRXA 2YX1A 3FEYB 4ZVSB 3DLLQ 4WU3A 2EBGA 3C6UB 1VIXA 2QMUB 1CG2A 4F50A 4OJ1A 3SCJE 3RB4A 2CJ9A 2G0JA 1FWLA 1NDLA 1RBAA 3AQOA 4F3MA 5GMDA 3R9LA 5HSPA 2KHCA 3LH2S 3OLBA 5ETVA 2B4UA 3I0RA 4DR6F 3IWXA 5GAEU 3R5AA 1M1GA 4HI1A 1JKHA 1ZZFA 1UFLA 2QMXA 2AHOB 2UVRA 3WX8A 3GSIA 2ASYA 2L08A 1PKUA 4CO0A 4RWXA 3PX0A 4RW8A 4DPOA 4ZITA 4OYXA 4LF8J 2RUSA 3QIPA 4TXSA 1UJ4A 4DL4A 2HQCA 4DU8A 4O3NA 3M1VB 3MUTP 5KT6A 2RAQA 1R0CB 1VQMS 2DVIA 4LFCF 3C6TB 3NY0A 5HMXA 1RU2A 4JV1A 2CJXB 3M30B 1F9HA 4K4UA 4PRFA 4DOZA 1AYEA 4QQBA 2YNFA 2NYIA 2JZ5A 5DM7Q 1WC5A 4JP8A 3HHEA 1FVQA 5DG9A 2AU0A 4NMXA 4L6V3 1SJQA 5A6PA 5MAOA 2NXCA 5EHHA 3TEHB 4XAKA 4P2SA 2MHNA 4IRCA 2W8LA 4ZIVA 2ROPA 4ZVPB 3CXCR 5KFCA 1NSPA 1WG4A 1M1KT 2VZ9A 1M1HA 4DV7F 2R7VA 2UXBJ 4OZJA 2QSWA 1R43A 1WG5A 1XMQJ 3JXOA 3CDUA 4C8KA 4KHMA 2RVJA 3GCWP 4GMKA 3DRSA 5E5NA 4ATNA 5IC4B 4F8RA 1SKRA 3TR5A 1WKKA 2IBOA 4FF4A 2CDQA 2PFDA 2MLZA 2XMJA 2JEFA 4WXOA 4K50A 4PG4A 3PZPA 3KJVB 3HSZA 2G9OA 4UQTA 1AZSB 3QAEA 3QGHA 2MQ8A 2HHSA 3OV7A 1F9EB 3DM2A 4ZVRB 1DTTB 3W2VB 1T8EA 5D78A 1VI7A 3GJSB 3K57A 2IHR1 4H4OB 1QE1A 1HQUB 2MKCA 2BRKA 3M32A 1DURA 2V63A 4K2JA 3T1AA 4URGA 4NRTA 3TJ8A 3U02A 4V1Ak 1YDLA 4FS2A 3HULA 4OZ2A 1PAEX 3PJ9A 3CJ2A 5DDQC 2QA1A 2BQ3A 2B5JA 4PG5A 1HNXJ 1U09A 5JJBA 2MMYA 4J9SA 3I0RB 4TNOA 1V5IB 2LXFA 2XI2A 1JKHB 3JS9A 1MMDA 2HSEB 4YOEA 4ECRA 5DG8A 2XMTA 3KLEA 5DQIA 1WSVA 3CGIA 4FYXB 2N4CA 3DDIA 3D0HE 3ZC4A 1HI8A 1UP1A 2QJ3A 4RW8B 3CJKA 3OT9A 4BCAA 3VWSA 1H7XA 3MD3A 5AJ3F 4LVNP 2ACMA 1VK8A 3QIPB 4J9VA 1U6BA 4OJ3A 2V4JA 4NLQA 1VC6A 3W5YA 3ETMA 5KAKA 2JEGA 4WK3A 1MU2A 2VOPA 5DG7A 3AJ2A 1S0NA 3HLUA 1Q8IA 4EEYA 2NSCA 5HVHA 1FWPA 3KG1A 3M2RB 3RAQA 4NEZA 2U2FA 2DB1A 5KFLA 4DBQA 2OLWA 3L4BC 2YNFB 2GS8A 3GYXB 1T9WA 2LEPA 3ZTRA 2N3OA 4F2RA 2HBQB 4CLUA 2EG1A 3R8YA 4A8YA 4JI5J 3H2UB 2CJBA 3JQKA 2OIHA 5LM7E 1S6QA 3A13A 2F1FA 2W7OA 2F5GA 8AT1B 4ZJQA 4L3NA 3M6WA 3QNWB 4QR0A 2H51B 2E5JA 3VGVA 1EIYB 1NB7A 4F0KA 3DRSB 5HBMA 1TKTA 3K0JA 1O8BA 3GR1A 3GB0A 4DCOB 2DCLA 1TUVA 2LXIA 2JHEA 3QMQA 1TAQA 3TJAA 3PW4A 4B17A 1REVA 1WHWA 1Q86T 2XCPA 5HK4A 3CJQA 1TMMA 3RB6A 4ECVA 1JLEA 3EJMA 3CO0P 3DM2B 4Y34A 3K5MA 4I2PA 1VQYA 3C16A 4F4YA 3H98A 1QE1B 4YB6A 3VGUA 3MTJA 3M32B 3SFUA 3KOAA 2R7WA 3GIKA 2DISA 2AZ1A 2NZCA 3LF0A 1DRZA 4XPCA 4RNFA 4F4WA 1LOUA 4RLEA 1JK9B 3LW5C 2B5JB 1MWQA 2VUGA 2AYEA 2FDNA 1YBTA 2AKWB 1YTYA 2RF2A 1HBNA 1RAOA 2LQ8A 1IKXA 5I42A 5HMWA 3R3TA 3ILJA 3I32A 2WSEC 2GGPA 5KG4A 1I94F 3KLEB 2MKKA 2POKA 1S0OA 4PXDA 2J9CA 5BYSA 2LEBA 4JI4J 2Z8QA 3CJKB 1Q16B 2YPYA 2KYXA 3Q0AA 2HURA 3IMQJ 3MZIA 3SSQA 3US5A 2W25A 4URSA 2V4JB 4F0HA 3BKTA 1U0SA 3K5OA 5DETA 2V8DA 5FLXU 4DX5A 3T9ZA 2B9YA 3MPYA 1LK7A 1MU2B 3M6XA 3QZ7A 2HVZA 4L3KA 5IQQA 4LQ3A 5J1NA 5CYJA 1MWZA 2OEMA 1JX4A 3O5TB 3HK2A 3JSMA 4X4NA 2GO9A 2I6WA 4MMOA 2EFPA 4DL7A 1XQIA 1NK0A 1V6HA 3KUEA 2R8GA 2R7TA 2UUBJ 1B0PA 2GHWA 1S6QB 3UN5A 4UOHA 1ZTWA 1FTRA 1U49A 4X64J 3D66A 3K5PA 2GQ2A 2N3LA 5HBMB 4HACA 1TKTB 4NPOA 4YFUA 3QSIA 1XNQF 1KKHA 2FGOA 3EE3A 4CTAA 2Y0SD 4DZDA 4GVLA 1VIOA 1RAFB 1X7VA 1REVB 3I9V9 4Y2IA 1OQ6A 2J0QD 1F3FA 1DBDA 3D4JA 4LR9A 2NREA 3AJ1A 1AFIA 3CJ3A 4NLPA 3GU0A 1JLEB 4QJVA 3T19A 1RK8A 4F4XA 4MYTA 3H59A 2CPFA 4TLRA 3PV8A 1PC5A 4DQPA 4I2PB 1RT1A 2D74B 4O3OA 3C16B 2JFKA 3T41A 2XWXA 3MR5A 1X9MA 4KSEB 3GG0A 1VCTA 1EJ7L 4LBIA 4ZVGA 2EW9A 2RDJA 4ZA1A 3NNCA 3KTQA 1FO1A 4FZVA 4OX7A 4C8NA 1OWXA 4NCGA 2AIRB 1ZM4A 2VB6A 2K06A 3I5AA 4IRDA 1FXDA 3OFHA 1DY3A 4K7QA 3MMCA 2EC2A 1SH2A 4KY3A 4B02A 2RF2B 1SKUB 1RAJA 1HBNB 3VQSA 4PWUA 3G6XA 1IKXB 5I42B 1GMWA 2DHXA 5F8GA 2GGPB 1RT7A 4UTGA 1LEOA 4D3GA 4OX6A 1ZM2A 3RB3A 3KHHA 1KWMA 3D6MB 4JI3J 3VAGA 2X1GA 2QYCA 3W65A 3MUVP 4HVZA 2IA0A 2YX7A 2FVPA 4ED2A 1N0UA 1R8HA 2G4BA 4JI8J 1RT2A 3KG0A 3N28A 2LP4A 1WEYA 1PYSB 1XMOF 3GE9A 4X4TA 1VQ4S 2QX0A 1NB2A 1MN7A 1RQ0A 3C14A 4RUHA 4PUOA 4U7UD 4DV1F 4C3MA 3EZOA 2J0SD 2YWHA 1NLKL 2D3ZA 3JSMB 4DQIA 2ZHAA 3T1YJ 1KP6A 2HFSA 4C0OC 4FNHA 1WC1A 1KRPA 1NJXA 3JSBA 4OIXA 2IDEA 1C1CA 2DNRA 2GJFA 3KUHA 2KVQE 1JJ4A 4XPEA 5KFTA 3H40A 2QL5B 2PI4A 1RAGB 2BDPA 2VICA 4HACB 3KG4A 1QUPA 2Y0BB 2CPHA 4CTAB 3QO9A 4ED5A 4OI3A 2FPHX 5EX0A 1PILA 5IWAJ 3EPGA 2NYHA 3PW5A 1SJRA 2Z4PA 3CJRA 4YB7A 4RPFA 1X5PA 3HO1A 4NL5A 2O66A 4IG0A 2IJRA 4HHHA 1NZAA 4NZ0A 1RT1B 2VJVA 2V50A 3H4BA 1H2TZ 3C66A 3GSDA 2AMCB 4WZMA 1KVKA 3ZZUA 4KBIA 3EGNA 2JNJA 2WZ1A 5U47A 3K59A 1WC4A 5CXTA 2MQNA 3H25A 1WOOA 3IGNA 2OMLA 4ZVOB 4DV4F 4NCGB 3DFEA 2RQ4A 3OFEA 2J6SA 1RT3A 2CDRB 3UVJA 1M0SA 3B4MA 2I5JA 3MMCB 2MKJA 3ZTSA 1QLNA 3IXQA 4WP3A 1K9MT 1GTHA 4DWIA 3EVOA 2KXNB 4IUFA 1ROFA 3OSNA 4I6WA 1HNWJ 2NSBA 3SYZA 3HP6A 2R8HA 4RUBA 4GKJJ 4RBTA 1FA0A 1OPIA 1I6JA 5FIIA 3RR7A 2MKYA 2H5IB 1RT7B 1SB6A 3W9HA 2HQGA 3FEZA 4BS2A 3FDSA 1Z2LA 5L39A 1OO0B 3NOGA 1KQKA 1SJ4P 2IFXA 4CO2A 1VHIA 2OD4A 2VL1A 4YY3F 2AGPA 2W9BA 4JI1F 4DR1J 1M5PC 1KTVA 2CYYA 4Q7AA 2UU9F 3FJ2A 1I1GA 3UN2A 4I69A 1G6BA 4YN3B 4GKKF 1RT2B 4ZKAA 1HHQA 2B51A 1R27B 3RRKA 4OHVA 1L3VA 3TQEA 4DR2F 2A18A 1M5KC 3NGUA 2MZQA 4Z2XA 4J9UE 1REGX 3MWBA 1X4DA 1FCAA 2B4OA 5D4OA 2R2UA 3C14B 4B3TJ 4PUOB 3S6EA 2IJFA 4DV6F 3TP2A 4DUTA 1JJHA 2RD5C 2M70A 1FT8A 2VV5A 3O44A 3DLKA 4ILMA 2KT2A 2EWHA 3EYZA 3L7UA 5I3QA 1H2UX 2HNDA 1P6TA 4EWTA 2VBWA 1Y4ZB 1WSRA 5HJXA 1C1CB 5F41A 3H0PA 2HHHJ 3ENVA 1U1RA 1WJ9A 4C2MA 3UR3C 2YY3A 1F6TA 3T3FA 1YJ9S 1AW0A 3W2WA 4YR2A 2QZ8A 2F4VF 2FQQB 3QO9B 4ZPDA 1B0VA 4CLSA 1Y5IB 3JB9k 3QRRA 1RKJA 3H5UA 2DNZA 2C2MB 2A6MA 3P5BP 3A8KA 2CKWA 4X62J 2CPJA 4JV5J 4B3RF 3UCZP 1K1SA 2GJ2A 5JMNA 3CD5A 3SCKE 1QSSA 1FDDA 5AXLA 5B7WA 1AA1B 4IG0B 3ETOA 4I6AA 1U8SA 2RQMA 2WB4A 3BYRA 2ZH7A 3KK2B 2M4MA 3SBMA 5L1KA 5KFQA 1YJVA 2BA9A 5GVQA 2WAQD 1Y5NB 4F04B 1ZAXA 4PAAA 3NLCA 2LMIA 1RT3B 3UVJB 3QT7A 2I5JB 1NK7A 2M8HA 2R7QA 2VBZA 4DN9A 2HRUA 4NYPA 2IRYA 4I2QA 3GZ7A 4KQZA 3QBCA 4DS4A 3K7RA 5HQ8A 1EQ0A 2BXJA 2BZ2A 1YJNS 4ZLNA 1KQSR 2BV3A 3ZO7A 2BVZA 4CLPA 4P9SA 1ZPWX 4IH7A 4DSFA 5KFDA 2HFOA 2E1AA 3MR6A 2AJ4A 4JB8B 1D9DA 2G0IA 2WRMA 2YPZA 2VQEF 1HQEA 5A8RA 2W9BB 1TZ0A 4RUAA 5MLCV 4WKRA 1BY9A 1HPZA 2P6TA 2HWIA 2XZWA 4QOTA 4BWMA 2Y9HA 3NS6A 5KT5A 1IKVA 2OELA 7FD1A 4WTOB 1OS5A 2UXDJ 2FTRA 3TO8A 3KLHA 3I82A 3BQ2A 2QYGA 1NJYA 3RBDA 2H4WB 3OTOF 1WKLA 3QT5A 4DPTA 3PFOA 2C2DA 1XNRF 1Q82T 4J9QA 1JXVA 1S0VA 1VJWA 2CQ1A 1BD6A 3GIJA 1N5TA 2ASJA 4PXEA 3DLKB 1NJZA 4BDPA 1P1TA 5L46A 1B70B 5ETQA 2HNDB 4MIAA 1HD1A 5ETRA 3HDSA 4ENOA 1Q8KA 4PCQA 5LMNJ 2VFRA 1HBMA 3HVAA 5FLXY 2A0FB 5KFEA 3TJ9A 3KNGA 4RU9A 1UW4A 3MR3A 3KLFA 2DNQA 1WNEA 1EHWA 3QRPA 3W2WB 4DX6A 4RJVA 3FZ2A 1WC0A 4AYBD 2XLIA 5E3RA 4PWDA 5HJYA 2AJ0A 2V8PA 3AFGA 4L76A 5HP1A 1FRHA 1VRQC 2XHCA 2R8JA 2KI2A 2K1RA 5BJRA 2HAIA 2HHVA 1AB8A 2PFFB 3ILLA 3GPAA 4LRAA 2FVCA 4A48A 4DSIA 3P3DA 2QC3A 3CCTA 4USKA 2RMLA 1YX2A 2VF3A 3MF5A 2P2CB 4HHJA 2KXHA 3MUMP 5F8NA 1FEEA 1HW8A 2R8IA 1TK8A 2CQGA 3DRYA 4A8SA 3PG9A 1X4GA 5J2PA 2YBVA 3F73A 1TL5A 4F2SA 1SC6A 4DV0F 4ELUA 2ZD1A 3I4PA 3W60A 2DGOA 1X4CA 2NCKL 2BANA 2ILZA 2P9CA 2QG9B 3FK4A 4M94A 2AP6A 1GK8A 4I2QB 1Y3KA 3L7PA 1WD6A 1PGZA 3R5CA 2L9WA 4C4WA 4LF7F 3P8BB 1ZM3A 2HEKA 3PIOQ 3LGHA 3POTA 1SC3B 4QW9A 4XDDA 2CJKA 4M95A 4JI7F 3UFCX 4ZP8A 3RBXA 1RTDA 1S1XA 1VMBA 1HQEB 4ELTA 3ZFVA 5A8RB 3OVBA 1HPZB 1EAYC 1QSLA 2XNQA 2Z0GA 3RBZA 4CLFA 1IKVB 4Y3CA 3EMTA 2MZTA 4C8OA 4QPTA 3KLHB 2X51A 2ZDOA 4Y0FA 1LNQA 2MKSA 2VODA 4QPXA 4DV3J 3CD6S 4E98A 4DX7A 4OFZA 3CE8A 4Y6IA 1X4FA 5F0UA 2XQCA 2XMMA 3OTBA 4W4MA 2F65A 3K5NA 2N7YA 5KFVA 1AXQA 1HBMB 1X8DA 2HGMA 2K3KA 4KHPJ 4S0MA 1BUXA 1U6FA 2P9EA 4B9UA 4FVCA 4GC7A 3RJMB 2WOMA 5F9LA 2W2QP 3KLFB 1SBRA 4WTYA 3CTRA 3S8SA 2F9DA 4ID5A 5KT7A 1ZZNA 1WI6A 2DH7A 1W7WA 5HP1B 4DV5F 4DXLA 1IM4A 2K1RB 2WB1D 3UO0A 4Q43A 3O6QA 1ZYQA 1PYOB 2AJ1A 2L9NA 3V81A 4X4SA 1KN6A 1NEEA 3WIUA 2BKPA 3Q83A 5KFHA 2V8HA 4UF4A 2ZZMA 2VPXB 4RR5A 4DN0A 4Z37A 1MG7A 3RW7A 4A46A 3OBIA 2PSZA 5J2PB 1J27A 3AXMA 4M5MA 4DPYA 3N6MA 3A3PB 4H54A 2ZD1B 4J9LA 3FQKA 3SQOP 1S49A 1HMVA 4R8UA 3LPEA 2BANB 4ANCA 2BJ8A 4N41A 3HPOA 4F3OA 1CEZA 2Z2YB 4HHUA 5EWFA 1LWXA 4QU7A 4ANDA 3AD7C 1DLOA 4ELVA 1RYRA 1NRKA 5AE2A 4DSKA 2FYXA 1N54B 2DYAA 2VIHA 3POTB 2KKHA 3D5MA 4IO1A 4QWCA 2I9SA 4Q0BA 1LKZA 1RTDB 1S1XB 1CQMA 3CMAS 2HVIA 2WVFA 4ZVHA 1NSAA 4ZJLA 1Q78A 3LQVA 2A10A 3LWMA 5HVFA 4NA2A 3F44A 2MDAA 2ZZTA 2CQCA 1K0TA 1QVFR 4TYBA 2KT5A 5KOXA 3OXGA 4UUXA 2LEAA 2B8QA 4CZCA 2H9ZA 3Q8YA 1T9YA 2HS0A 4QBUA 3LUYA 2E1RA 1M5OC 4KFBA 1L5UA 2CQ0A 2JVRA 1L3UA 2Q66A 1NSKL 4P74A 1I94J 1RGVA 1TK0A 4M5JA 1V3RA 3DDNA 2FVQA 1VBYA 4RW6A 2DNKA 4YB5A 2MQPA 5L8RC 2CNLB 4WCEQ 3R5GA 2WOMB 4JI2J 1CJKA 5M2UA 1B4SA 3B8HA 2CZVC 4DQSA 8ATCB 4QYZJ 1PO6A 5A6WA 4IOBA 1XR5A 5LSOA 2ZKUA 4GO5X 1UFWA 3V6DA 2JC1A 3NEKA 5IFMA 4USUA 3H2VE 3PDNA 2ACYA 3CF5Q 3MM9A 2KM8C 1S6OA 3Q8UA 1IQTA 2UUCF 4Y2KA 4DFKA 4RKUC 4OYWA 3V81B 3LP1B 1FD8A 5ETLA 2BKOA 4U8VA 5LJ3Y 3ILOA 3VQTA 4B9TA 5L1IA 2Z58B 5J2QA 4EI2A 3W8PA 1T3OA 4X4UA 2CQIA 2BQUA 1KBRA 2H5EA 4BBYA 2RH3A 3H7HB 2YWFA 4LFAJ 4X4OA 4FKXA 2RU9A 4OYMA 1Q0NA 4MKAA 1FRLA 3ZZOA 3DRRA 5BYQA 1IBKF 1HMVB 4R8UB 1UA0A 2W2MP 2FZKB 3IC1A 3TZXA 4NASA 4JYAF 2XM3A 3ZTOA 4K0KJ 1XNQJ 3PO4A 5KFMA 4OQJA 1HLWA 2H54B 2YWGA 3HT3A 4OHWA 5F3TA 1S1TA 4OZ3A 3TAMA 2E9RX 2AEFA 3PY8A 2XLKA 2DXDA 3M2VA 1DLOB 3Q86A 1H3DA 3KHRA 4O0NA 2DPJA 2DGUA 3DI6A 5IC6B 3HHNB 4A8OA 4Q0BB 2KYZA 3MOJB 4ZHRA 4YEAA 2RRAA 4N7TA 5DM6Q 1QUVA 1ZBTA 2X1BA 1VRTA 1N8RT 1RADB 2DNMA 3BH7B 2O3DA 1U1OA 5DLGA 3PACA 3PTWA 4TY8A 4LF6J 3UD4P 1IR0A 3ZNUA 3W63A 2UUTA 5CYQA 1M5HA 1WI8A 1RP5A 4IH6A 1H98A 4TQRA 3EICA 4KGZB 3AD8C 2MEWA 1RKIA 3IAS9 2V68A 2VPWB 2YX4A 2MXYA 1QM9A 1OYDA 1IWAA 1S9EA 4KFBB 4KYZA 3NXZA 1JIHA 5J2NA 1KLMA 1VQSA 4O3SA 3SIPB 2MQQA 2MZ1A 2R3VA 3ZTPA 2IAJA 2OMOA 4DS5A 4RW6B 2MLXA 4X4PA 2KZZA 5SZTA 4FKYA 4P2XA 1P8GA 5DDPC 1CJKB 3C3LA 3F56A 1YIJS 3MGJA 3R6LB 5DS7A 1R31A 1NHUA 1T0TV 3DHWC 4NE9C 3V6DB 5HMZA 2EC0A 4GVBA 5D3GA 3MM9B 5A76A 2KVIA 3M8QA 3K17A 2OPSA 2X3GA 4USIA 1DTQA 5LSRA 1UJ5A 1A0OB 4OZ0A 2KDOA 4F7VA 2ZBIA 2QN6B 2XC9A 5HQLA 1I3OB 2PT0A 2VA2A 4C11A 2RDIA 4LVOP 5J2QB 1IBLJ 5HLFA 1YQHA 4I6YA 3SV3A 3MCOA 2QRRA 4J9PA 1H72C 3KLVA 3G6YA 2Y3YA 2IM1A 4B3SF 1UFKA 3R6GB 3E01A 4ZN1A 4LF4J 1CJUA 4ZVTB 1RXOB 4K4VA 3H4DA 2KU7A 3DRRB 2R7UA 4DFJA 4ICLA 5KFSA 3AH6A 2ZJQQ 3D54A 2IY5B 2C1EB 2PA8D 5KFAA 2FUG9 3CDAA 1D3WA 3KK3A 1S1TB 1T94A 3TAMB 3RB0A 4KH0B 1IBMJ 2ILYA 1BGXT 4XK8C 5B0GA 1HNZF 3M2VB 1U1NA 2AGOA 1VQ7S 4NLVA 3CULA 4EGLA 3DI6B 3AOCA 2D41A 1P9QC 4ZCIA 3V6KA 5LT5A 2V2VA 3DOMA 4CH0S 3LP0A 1J5EF 5A2QU 4Y2MA 4ZHRB 3AAWB 1UMJA 1UVKA 1CPZA 1S7IA 1VRTB 4X65F 4NZ7A 4EBEA 4ZPBA 2ALZA 1QAJA 3IR7B 3RR8A 4CLZA 3WX4A 3VGTA 1UETA 2FJBB 2XYGB 3TA1A 4FYVB 4C7QA 4TY8B 4DF8A 1HWUA 2CVIA 4DV4J 3D67A 2RILA 3C15A 5KOWA 5D4LA 4USTA 3GJQB 3D2WA 5CYQB 3N6LA 4DFPA 3WIVA 2LDYA 2VD3A 3PCOB 4IOAQ 1GEHA 2DNOA 1ZA1B 4LT6A 1ZS6A 1R0AA 2C2RA 2BJ9A 2UV8A 1S9EB 1U24A 2Q3PA 2WVDA 4J9NA 4OX8A 1YSJA 2B43A 2BMBA 2H48B 5J2NB 1DARA 1KLMB 4NXMF 5B08A 5K8MA 3MTKA 1S4EA 4K4TA 1Q8LA 2IAJB 3SQGA 3PO5A 5HN0A 4DV2J 5I3PA 1VC5A 4JI1J 4WP9A 4HTJA 3L3CA 4DL5A 2UU9J 2HGLA 4JI0F 3QWUA 5C2CA 4DR3J 1ULRA 2VC1A 1TFWA 3BSOA 4OX9J 1TUGB 3OL6A 3QGGA 1UZHA 3THPA 2AEJA 4AFFA 3M9NB 2VU5A 4GVBB 5D3GB 3NL0A 5A8WB 3C2PA 4LFBJ 2QO3A 3M8QB 1B0TA 2OPSB 3H8YA 1DTQB 4PKDB 3W7BA 1UVJA 4DV6J 1VRUA 1RT5A 1LXJA 2I2YA 1N88A 2DGWA 4P7VA 1NXIA 4XDCA 4L73A 3EXYA 5HLFB 1YRXA 5H9EK 2ATCB 2Q1LA 1QAIA 5CHCB 1OPZA 2EKNA 5D6GA 5D77A 2HIQA 4LSLA 4KJIA 3E01B 1FTCA 4LRFA 1CJUB 3NNHA 4HKQA 3QGPA 4V19J 4ZDNA 5EDWA 2L48A 2CFXA 1AROP 4Z7CA 4NYOA 2HKEA 2D9PA 1VQ6S 4D3HA 4ICLB 1VBZA 1EX8A 1U2FA 3PW7A 2F4VJ 2F3JA 4B3MF 4DLEA 4MK7A 2GZOA 3HVWA 2EI5A 5D4NA 2DR8A 4KKOB 1F0XA 3KK3B 5F0WA 1OYEA 5L9XA 2MQOA 4DU7A 3ELHA 1TVRA 2FC9A 2HFVA 3DU5A 2EFNA 2M88A 1MMLA 3FQLA 4ALZA 3DOMB 3LP0B 7AT1B 4LBPA 2VFVA 2DBBA 2HRTA 4XIUA 2FIUA 2GVZB 2FJWA 2CJYB 1JB0C 2OI2A 2BJ7A 3KJQB 2IMWP 1U0HA 4NLUA 2RS2A 1VBXA 4FF1A 2HHTA 2XB2D 5E33A 3ZXWA 3C15B 4ES3A 4X66J 4OZ1A 2R2RA 3DRXA 1R7IA 4DR5F 5EGYA 2GQQA 1R0AB 3Q23A 4DDFA 2NXEA 1LWCA 1RISA 3M8PA 5DDRC 3DMJB 1R0BG 1KEKA 1X31C 4IQMA 1SL0A 2ZBPA 1PBAA 3AOBA 1LFWA 1KVJA 1RZMA 3SQGB 4IYQA 2HHUA 1FDBA 2WSCC 4OI1A 2QLWA 3M9OB 1S9GA 2J9DE 3CJSA 3S1TA 1N33F 3VTIA 2V8GA 3JTPA 4K4WA 1N34J 2GC8A 3GIIA 2HQDA 4U8YA 2E5IA 1HQ2A 2MJNA 2G1DA 5BYRA 1OY9A 3GQCA 2E44A 3TVZA 3BGOP 8RUCA 3HM9A 2V0NA 3RU0A 2VBYA 2H5JB 1RT6A 3DLBA 3G82A 1EQMA 1Y9OA 3AXKA 4EYHB 1VRUB 1XNRJ 3TZZA 1RT5B 4ZCMA 3BSNA 3EXCX 3OSPA 4J37A 4EMDA 1A9NB 5F9NA 3FBEA 3K5LA 2DEIA 2KO1A 5C5JA 3OQ2A 3NGSA 4Q44A 5ETTA 4KT0C 2ZH6A 4KB7A 5ADZA 1N32J 4LSLB 4EBCA 1C4CA 2QLJB 3IM8A 4M5DB 1NJIT 1WHVA 3GV5B 5AE1A 2RIJA 3TI0A 4U9RA 3ENQA 3EVWA 3G86A 4AQYJ 2ZH8A 1GQEA 3UPFA 2E7XA 3NGTA 4KIAA 3HHDA 3F0NA 3MURP 1RCXB 3W1YC 3BGLA 4UT4A 3TYTA 1J5OA 1O51A 4F02A 4LF8F 1EKSA 1N52B 2EG2A 3THTA 3I4HX 2GVDB 4K4SA 1FRJA 3CSKA 1JNZB 2WBRA 3G9CA 4RZRA 3IBFB 4ILRA 2DNGA 2UVWA 1SC4B 1TVRB 2VFSA 1YLXA 4G6VB 1NK5A 3DOLA 2ZUGA 3EM1A 5F8JA 2ZJPQ 1FNMA 3KJNB 5G4DA 3TUZC 4NLDA 4LF9J 4C6AA 3VR1A 4K5SA 4B9MA 4A4JA 1F3VA 5KFNA 1BE4A 1S5ZA 1U48A 1U0HB 4YR0A 5K5MA 4DR4J 5KG2A 2GFFA 3I6PA 4DV0J 5AXMA 3CUNA 2UXBF 3KJVA 3ONQA 3HVTA 1ZAVA 2JEIA 1HNIA 2QLFB 1IKYA 1HI1A 1LWCB 3Q2TC 3M8PB 1QY7A 2OPPA 1OMSA 2NPIA 3I96A 5D0EA 3NAIA 3GYGA 2PEBA 2EBEA 2J6TA 3A8JA 3BKUA 1E6VA 2M5YA 3G4SS 4Q45A 1FDAA 1S9GB 2DRBA 2QIFA 3HFKA 1MSWD 3OL9A 1N36J 2YVSA 1BWVA 3E3XA 2HMIA 4ECQA 2OPQA 4OYZA 4N47A 3FBCA 2N4DA 1TR0A 2AF6A 2YH1A 1MNEA 1B64A 2UXCJ 2PMHA 4ECXA 2ZH5A 4RW9A 3TUIC 1RT6B 5CABA 2Z30B 3G82B 3GILA 3D68A 1FVSA 4W98A 2HYIB 2QA2A 2JDJA 4NCAA 4FBUA 3GFZA 3ULHA 2ERRA 1A7GE 2OHDA 1IVZA 5KG0A 2X1FA 1TKZA 4DX8H 2V2KA 2PEHA 4FDFA 3QWPA 1FE4A 5L1JA 3CB4A 3TQ1A 1KONA 9ATCB 1QAXA 4K2XA 3TARA 3GYNA 3QJLA 3BGRA 4DL3A 2G2ZA 2D3UA 2KRBA 1XWLA 3M2RA 1ZAWA 2DPIA 2PI5A 3X3UA 2VQFJ 1J5OB 2H3EB 3FKBA 1NNDA 3CO9A 2F40A 4PG6A 5CZXA 1DQAA 1GMVA 3D9BA 5B0BA 2OGUA 4LRCA 1U47A 4OZNA 4KGMA 4IDKA 2ZDPA 4XO0A 4HT5A 3K2YA 1YRUA 3DOLB 3UCGA 4TU8A 4IOCQ 2NQPA 2W8KA 2RUGA 4IFYA 4OV1A 3TX8A 3DXSX 2HZVA 3GJTB 1WG1A 5H9FK 5I4MA 2HFUA 2F7VA 3JYTA 4JI5F 2EFOA 2I0XA 3B78A 3EPIA 3PX6A 1V3ZA 1QAYA 3CCZA 3L9ZA 2ZBQA 3CDEA 3N79A 4NLSA 1K0VA 2W7AA 1K8AT 4WXWA 2RSQA 4LBHA 5KFBA 2Q6BA 1YGYA 4A47A 3HVTB 4AE5A 4LQ9A 1T02A 2YNGB 1HNIB 1CVJA 5A2QY 1IKYB 2AW0A 3CPWR 4H4MA 3DNCA 2KL8A 2XNRA 4LUBA 2OPPB 1S0MA 3Q8RB 3IR5B 3MR7A 3R7NB 4KPCA 1RCOB 3V5RA 1E6VB 4C8LA 2XMKA 3KMSA 2E66A 4P7TA 1JXLA 4DR7J 2BQRA 1YJTA 3BN4A 3PYDA 1JLQA 2ZM6J 2RNEA 1Y11A 4O44A 2AQ4A 2N7CA 2HMIB 2KJVA 3KUGA 2MKHA 3MXHP 4A8WA 4TQSA 3IG1A 2OPQB 2QA4G 1WF0A 1Y7PA 4I68A 5GMKa 3JQMA 3D6TB 3S7RA 1HR0F 1RWWB 4LSNA 4RW9B 4WF9Q 1LW0A 1BQNA 4LMZA 1EARA 4WIIA 3FCWA 1NJWA 2G2YA 4G1IA 5IS2A 3TUJC 2J7KA 1C0TA 2K8GA 3J7YI 5ITHA 2ASDA 2FJEB 2YQ1A 5GADU 4PEOA 4PZVA 5DDOC 4HL9A 4OLOA 1TKZB 2CQ4A 3TVKA 2D9OA 4DMZA 1T05A 1PSDA 4ZLJA 2GO8A 4TLQA 1U4BA 1Q79A 4Y28C 3BGRB 3G8TA 2C3OA 1GX5A 1FD2A 2ZH4A 1HBOA 3FRZA 1V5VA 3NAHA 1X5TA 4JI4F 2BW7A 3NGRA 1RTJA 5CD4A 1UEKA 3H90A 4KGVB 5E3QA 3KKFA 3RG6A 1LQ9A 2VC0A 4CIOA 4ES1A 2B7BB 3BSCA 1WEXA 2XMAA 4CO4A 2AZ3A 3HJFA 3W5XA 2J7UA 3J7A1 4DPUA 4P73A 4IDKB 1G1XA 2RE1A 1N6QA 2JLGA 4ZP9A 3BO3A 5LXRA 2R7SA 3SV4A 1VJQA 1ZM9A 4F67A 4IFYB 4RW4A 5LMUJ 3JAMY 2KFNA 3HSDA 3ILIA 3JYTB 1S12A 1Z4UA 2AGQA 4QIVA 5B0CA 2Q6CA 4U7CA 3IAM9 5EUHA 3N01A 1IBKJ 5LSLA 4TU9A 5KG5A 3P6YC 3HZGA 4UZBA 3OXLA 1NK8A 3MM5A 1NHVA 5JUMA 2GAGC 3D1QA 6FDRA 4QR1A 4H4MB 4ED8A 1UW9A 1GH8A 4ZPWR 4JUZA 3R5DA 1Z1ZA 3NOCA 1NUEA 5I3UA 3K8VA 2JVOA 3LAKA 3PIPQ 1NH8A 3IRXA 1YJUA 2DITA 2DY9A 3D3BJ 3CCSS 4UQGA 1TUWA 3HSGA 1JLQB 2UUWA 2HWHA 1TFYA 3NS5A 4O44B 3ZZYA 2DGXA 1ZOTA 2DR6A 3IG1B 1R89A 5LXYA 4FF3A 4B9SA 3BBCA 4MYUA 4ZVFA 3V4IA 3LA0A 4K8RA 4J5OA 4IFVA 3I55S 2CNKB 2VDHA 1SIZA 2Y1LB 4HH0A 4EUVA 4LSNB 3G96A 5KT4A 1LW0B 1HWKA 2ZNZA 1BQNB 1EETB 2HQ3A 2M3DA 3RZAA 4IQXA 1AUSL 2XO6A 4WFNQ 2ABYA 3PRDA 3PYGA 1C0TB 1FFGB 2QGFB 3MMAA 3QFWA 2DEJA 1F9FA 1U2RA 3QLHA 1D9FA 1Q5YA 4DUZF 1KOOA 2B56A 4NMLA 1LV5A 5CA5A 4K4ZA 4NI2A 4I7FA 1SUQA 1YWXA 1T05B 1U6ZA 1SQEA 1FX2A 4I4BA 3B6BA 1S1VA 1R6VA 4ED0A 2KN4A 2MZJA 2BJEA 1KFSA 1UVIA 2R2SA 2BE9B 1HBOB 1H74A 2DK2A 2DHSA 3MR2A 2C2NA 1RTJB 2WHOA 1F1BB 1RTHA 3MD1A 1N5YA 4JI3F 1VC0A 4PG8A 4G1PA 3DU6A 4JI8F 4NA1A 4KAIA 2DHGA 1CC8A 1RBLA 1N6QB 1GXTA 2CPZA 2G1HA 2OH2A 1RWUA 2ZE2A 1RWOB 3D6FB 2KXFA 4AD6A 3PVXA 3GP9A 4NLWA 1X4HA 3J7ZT 1RTZA 2PD1A 3K8WA 1H0HB 4RW4B 9RUBA 3T1YF 1NU4A 2FJXA 2EFGA 3PJWA 1UTAA 4WJBA 4RBVA 5KFUA 3MCMA 4DL2A 3OFFA 1VQ5S 3PXGa 1MWYA 3PEJA 4WP8A 3J81j 2IVYA 3GV7B 2CA9A 3DLGA 1TP7A 3MM5B 4I0WA 4CDIA 3HI9A 5AXNA 2ZC3A 3VF0B 2HIYA 1KOHA 1C1BA 5IT4A 1L3TA 1HNZJ 2E29A 4LF2A 4ZCLA 5I3UB 1T9XA 2HGNA 5IWAF 4WYWA 3VGSA 1HL6A 4CLWA 2AX0A 3IRXB 2UZAA 2JRSA 2QA4S 1T95A 2Q79A 1HBUA 3Q89A 2XSFA 1JLAA 3R2CJ 4JV0A 1FJGJ 2KHDA 3QZ8A 2ZHBA 4QIFA 3G6ES 3V4IB 1YI2S 5RUBA 2L41A 3TZWA 4A8XA 3VAKA 2ZNYA 3RGIA 1WTFA 4IFVB 2UUAJ 2HVEA 1S99A 2FVRA 2XLJA 3T6JA 2SXLA 1URRA 1BC6A 1B7YB 2C28A 3W9IA 4OL8A 2UV8G 3M05A 3D28A 1U1PA 5GAGI 2WONA 3MMAB 1UAWA 5KFKA 2C2EA 4USMA 1TTHB 3QLHB 1TAUA 4PPDA 2P6SA 4LJMA 4NI2B 4JOUA 4I7FB 1SUQB 3MMJA 1SJFA 2V9KA 5ETSA 1KTQA 1HNWF 3OW2R 3G6VA 3D6HB 2IIHA 2HQFA 1WUUA 4GKJF 4JI6J 2XGQA 5L1LA 1S1VB 1X4AA 3TANA 2M8DB 3N5BA 2E5LF 4P71A 4N8OA 3H2LA 4O3QA 3M6VA 1Y10A 1RTHB 4ZMMA 4DR1F 1N5YB 5F8LA 3CCRS 1JLCA 5ETMA 3MFIA 1CBKA 2V2ZA 1S48A 2W9CA 1VQKS 2HQIA 2IJNA 2OUGA 1WWHA 3UWTA 2DH8A 5B0DA 3KWMA 2XTJP 1NMEB 4FPRA 2ZE2B 5KTQA 4CLLA 5B0FA 3A3NB 3FSIA 5HL7Q 2Z2MA 4C9DA 4B3TF 4OMFG 4DL6A 1IM6A 3ICLA 1W26A 5HI7A 2FLPA 1NDCA 3OLAA 4OLPA 2HW3A 3BZQA 3PEHA 3GG1A 1GX6A 4W90B 2W2NP 1IWGA 2IA6A 3EGWB 3W5ZA 2X7IA 4URQU 1IR1A 1RU1A 1VQ8S 1YHQS 3T1HJ 4HDHA 2HHHF 2FB0A 3DLGB 1Y3JA 3PHEA 3OVAA 2W4DA 2IDLA 2MJUA 2WW8A 2J9DA 1R8AA 2FHJA 3BBBA 4FYYB 1S79A 2B0GA 3KK2A 4OI0A 1C1BB 2ZHOA 1VQOS 2FC8A 3BSAA 3F41A 4X62F 1LXNA 4N8NA 3QJJA 2GIQA 4ID8A 1HBUB 3CCLS 2HAFA 1U1MA 3H5SA 4FN5A 4G1QA 4FYWB 1JLAB 3WHIA 3PJXA 3QRQA 4EZ6A 2NR0A 3WBZA 4LRDA 2E5HA 3UDLA 4USJC 3R5BA 4FXDA 2U1AA 1WORA 2DXEA 4PABA 3MOZA 3GFHA 2BBEA 4X4RA 1YKWA 4P2MA 3FVYA 1HD0A 2OJ3A 2MB0B 4QIEA 2NUUG 3KHLA 2DGSA 5B09A 2B4VA 3M8ZA 2C42A 3AY0A 2KFZA 4DZ6A 5CCMA 2WONB 5DRKA 2V5HG 2EVZA 2HS3A 3IWNC 3CD0A 4EO6A 2AYGA 3CJ8A 4ZPTR 3BDPA 1X4BA 1XBWA 3R2DJ 3CCWA 4MH8A 3DYAB 1PYTA 1LK5A 4L72B 2CQ3A 1F5BA 4OZ5A 3NGKA 4CLKA 5FDLA 3T5KA 2IRUA 3MEKA 4OHYA 1PCAA 3BDEA 2ZBRA 2RU3A 1S7HA 5GMEA 2FY8A 2P8IA 2AD9A 4CH1A 3RAMA 3MPWA 1JLCB 1YJ7A 2W9CB 1WTBA 5K9FA 4Q5VA 2PN6A 1FJEB 2RQKA 5CD4H 1Q81T 3UCUP 2CVEA 4IG3A 3NWRA 2UXDF 3A4TA 1UJ6A 2RJZA 3FC9A 3WDOA 3CCJS 1SH3A 5KFRA 4M5IA 4FNIA 2DIVA 3Q22A 2C2OB 2HFNA 2HHPA 3BQ0A 1C0UA 1VR6A 4RBUA 1DZ5A 3G8SA 1QDUB 2OEKA 3A12A 4I64A 5J2MA 3J7Z5 5T14A 2YTCA 3MAQA 1L3SA 2Y1RI 3TEGA 5ETOA 5LMNF 4BHQA 1XC9A 2XMWA 1IJEB 2DNNA 2DR9A 1GMWD 2C2KB 3BEGB 2WVBA 4C8MA 4CRJA 3OVSA 3ENAA 2GHPA 5L38A 3DLHA 5CQGA 1Q4RA 3I87A 1VBKA 2QSFA 3P5TL 5KFGA 3VVTA 1D09B 3KDOA 2CADA 3RTVA 1VISA 1YVFA 2BM1A 4TYAA 4I1TA 1QSYA 3SMZA 3K58A 1CC7A 3IN5A 3QAUA 1VQNS 3SSSA 4C3KA 1GAOA 4NLRA
chains in the Genus database with same CATH topology
1LEOA 2DY9A 2ZUAA 1NSPA 3GPAA 1PAEX 1BHNA 3B54A 3PJ9A 4FKXA 3EVWA 1UCNA 3ZTRA 3ZTSA 1NSKL 3WX8A 3L7UA 3NGTA 3VGUA 4EK2A 1K44A 2VU5A 1S59A 1W7WA 3ELHA 3EVOA 3ZTQA 1LWXA 1S57A 4ANDA 1F3FA 3FCWA 1PKUA 3EICA 3FCVA 3VGTA 4DZ6A 2AZ1A 4DI6A 3FBFA 1WKLA 3BBCA 1VYAA 1U8WA 3VGSA 3EVMA 3DKDA 3PRVA 3ZTOA 2DYAA 2B8PA 1JXVA 3VVUA 4HR2A 1B4SA 1XIQA 3EMTA 4ANEA 1WKKA 2CWKA 4F4AA 3JS9A 1HLWA 3Q89A 3BBBA 1F6TA 1KDNA 4CP5A 3Q8VA 3ZTPA 3DDIA 3VGVA 1NHKL 3GP9A 1XQIA 5C7PA 2DXDA 3FBBA 3FKBA 1ZS6A 4ENOA 3Q86A 1NSQA 4F36A 3ENAA 4O0NA 2BEFA 4FKYA 3Q8UA 1NB2A 3EM1A 3Q83A 2NCKL 1MN7A 5IOLA 4WBFA 3VVTA 1NDPA 3FBCA 5CAAA 4KPCA 2HVEA 4C6AA 1B99A 1HHQA 4UOHA 1NLKL 3MPDA 5BXIA 1NDKA 1EHWA 3BH6B 3NGRA 1NDLA 1NCLA 1MN9A 1HIYA 4UOGA 1BE4A 2DXFA 3FBEA 2B8QA 1S5ZA 3NGUA 3ETMA 2BX6A 3Q8YA 3B6BA 3R9LA 5CABA 3G2XA 1NUEA 4UOFA 3BH7B 1NDCA 3NGSA 2DXEA 4W98A 2HVDA 1WKJA 4S0MA 3BBFA 1NPKA 1BUXA 3EE3A 2HURA 4ANCA 2AZ3A 3FC9A 3EJMA 4DUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LEO A;  2DY9 A;  2ZUA A;  1NSP A;  3GPA A;  1PAE X;  1BHN A;  3B54 A;  3PJ9 A;  4FKX A;  3EVW A;  1UCN A;  3ZTR A;  3ZTS A;  1NSK L;  3WX8 A;  3L7U A;  3NGT A;  3VGU A;  4EK2 A;  1K44 A;  2VU5 A;  1S59 A;  1W7W A;  3ELH A;  3EVO A;  3ZTQ A;  1LWX A;  1S57 A;  4AND A;  1F3F A;  3FCW A;  1PKU A;  3EIC A;  3FCV A;  3VGT A;  4DZ6 A;  2AZ1 A;  4DI6 A;  3FBF A;  1WKL A;  3BBC A;  1VYA A;  1U8W A;  3VGS A;  3EVM A;  3DKD A;  3PRV A;  3ZTO A;  2DYA A;  2B8P A;  1JXV A;  3VVU A;  4HR2 A;  1B4S A;  1XIQ A;  3EMT A;  4ANE A;  1WKK A;  2CWK A;  4F4A A;  3JS9 A;  1HLW A;  3Q89 A;  3BBB A;  1F6T A;  1KDN A;  4CP5 A;  3Q8V A;  3ZTP A;  3DDI A;  3VGV A;  1NHK L;  3GP9 A;  1XQI A;  5C7P A;  2DXD A;  3FBB A;  3FKB A;  1ZS6 A;  4ENO A;  3Q86 A;  1NSQ A;  4F36 A;  3ENA A;  4O0N A;  2BEF A;  4FKY A;  3Q8U A;  1NB2 A;  3EM1 A;  3Q83 A;  2NCK L;  1MN7 A;  5IOL A;  4WBF A;  3VVT A;  1NDP A;  3FBC A;  5CAA A;  4KPC A;  2HVE A;  4C6A A;  1B99 A;  1HHQ A;  4UOH A;  1NLK L;  3MPD A;  5BXI A;  1NDK A;  1EHW A;  3BH6 B;  3NGR A;  1NDL A;  1NCL A;  1MN9 A;  1HIY A;  4UOG A;  1BE4 A;  2DXF A;  3FBE A;  2B8Q A;  1S5Z A;  3NGU A;  3ETM A;  2BX6 A;  3Q8Y A;  3B6B A;  3R9L A;  5CAB A;  3G2X A;  1NUE A;  4UOF A;  3BH7 B;  1NDC A;  3NGS A;  2DXE A;  4W98 A;  2HVD A;  1WKJ A;  4S0M A;  3BBF A;  1NPK A;  1BUX A;  3EE3 A;  2HUR A;  4ANC A;  2AZ3 A;  3FC9 A;  3EJM A;  4DUT A; 
#chains in the Genus database with same CATH topology
 4G1Q B;  4WFB Q;  1RA6 A;  5IT9 U;  2H65 B;  2MY8 A;  3PHT A;  5IZH A;  3DCA A;  1Z2Z A;  3GIR A;  3O1L A;  3UDV A;  1UWA A;  2GMJ A;  1RA7 A;  1R3N A;  2DO4 A;  3DKD A;  2N82 B;  1D0E A;  1SV5 A;  3CVK A;  1AT1 B;  2MY7 A;  4WK1 A;  2DGT A;  4FYD A;  4MKB A;  2XYH B;  3QYY A;  2HFZ A;  5B0E A;  3QGI A;  2A1B A;  2F8H A;  1NHK L;  2FZG B;  4K4Y A;  5HRO A;  2HS4 A;  2V67 A;  4CYU A;  4NXN J;  2HVH A;  3M2U A;  4M5H A;  4KV8 A;  4LF5 F;  4U6P A;  2W2P P;  1HI0 P;  5THW A;  2ATL A;  2GNK A;  2W4P A;  1UWB A;  1VHF A;  2P9G A;  4ZVQ B;  4DUY F;  4CM0 A;  3HHL A;  2CRL A;  4A8Q A;  2GQC A;  1XTZ A;  5FDL B;  4DCP B;  2BW2 A;  3DXB A;  3CC4 S;  4TU7 A;  1RWM B;  4PR6 A;  1X60 A;  2HVD A;  2A6O A;  2BRL A;  1NPK A;  4QZV B;  3H5Y A;  1R8C A;  4E2F B;  2OFG X;  4WKY A;  1RAH B;  2OP5 A;  4M63 A;  4DR6 J;  2HNY A;  2XZT B;  1ZTT A;  3CNQ P;  4YDD B;  2MGZ A;  4USV A;  2FHJ D;  4IG3 B;  2Z57 B;  1VYA A;  2R7X A;  1E6Y A;  3BQ1 A;  3KFW X;  2BE2 A;  3FSX A;  3M7V A;  4DV3 F;  4DG1 A;  1X0P A;  3UD3 P;  1XMB A;  4CO1 A;  1C0U B;  4WZQ A;  2VA3 A;  2DIU A;  2PC6 A;  4NLT A;  2K7K A;  3UNG C;  2MTL A;  4F36 A;  5KG7 A;  5J2M B;  2JFD A;  2CG8 A;  4G3I A;  4NX9 A;  3CJ4 A;  4LFC J;  1IN0 A;  1C2P A;  4MTP A;  5HMY A;  4QWA A;  3NCQ A;  3KLG A;  2XYP B;  2KZM A;  3Q2S C;  2HWT A;  3HT0 A;  1ZET A;  4LR7 A;  5BXI A;  4KHP F;  4FP9 A;  1N4L A;  3P96 A;  1U2C A;  1UKU A;  3PFE A;  2BOP A;  4O0I A;  4MJK A;  3CCE S;  4C8Z A;  4ZP6 A;  1T9U A;  3HVR A;  2RDD A;  3DN9 A;  2FHK A;  2KTQ A;  4RNO A;  1SPB P;  3AQP A;  4MAK A;  1G4C A;  2FVS A;  4ES2 A;  3ZTQ A;  3QAT A;  4LIW A;  2QFI A;  4DV7 J;  4J9K A;  2XMU A;  2VON A;  2M7S A;  5E3C A;  1V3S A;  3OXF A;  2CPE A;  3UE2 A;  3BS9 A;  3W9J A;  2ADC A;  1T03 A;  2BR0 A;  4K5R A;  1FXR A;  4RW7 A;  1HHS A;  3FBB A;  2V9W A;  3OL7 A;  2EPI A;  4KH1 B;  1NSQ A;  1TL7 A;  3LAN A;  1EP4 A;  1SV5 B;  4HYK A;  1R8P A;  1NDK A;  4HEA 9;  1KD1 T;  1HIY A;  5KG1 A;  5HRO B;  5K20 B;  2KFY A;  3R7S B;  5K8N A;  4CYU B;  1FKP A;  2NUH A;  2I1R A;  3GLJ A;  3M2U B;  5K14 A;  2E1C A;  2MST A;  4KV8 B;  2GW8 A;  3CCU S;  3N0V A;  4UUW A;  4F26 A;  1NH7 A;  5CZV A;  2GAH C;  2OEJ A;  1NKB A;  1UPM B;  1UWB B;  4F25 A;  5DQG A;  1N5Q A;  3AA9 A;  2EK1 A;  3HHL B;  4N56 A;  1FF2 A;  2F9J A;  4QWB A;  3D7S B;  3NMA A;  4LIR A;  4O4G A;  3BRE A;  1RWK B;  5KG3 A;  2F63 A;  2EKY A;  3SCL E;  1JLB A;  3IM9 A;  2HNY B;  5LOQ A;  2VAS A;  1FKA F;  1KDN A;  4WU2 A;  2B6A A;  2MGZ B;  3AA8 A;  1ICE B;  4DSJ A;  2PE8 A;  1HR0 J;  1UEV A;  1E6Y B;  2BE2 B;  4DPW A;  2LQJ A;  4MKV A;  3CDW A;  4DG1 B;  4WFX A;  5AJ3 J;  1A6L A;  1TK5 A;  2JWN A;  1SJ3 P;  2BX6 A;  1JNR B;  1N5V A;  2HBY B;  3G2X A;  3ITH A;  2C2Z B;  3NCP A;  2W9A A;  3KLG B;  2VG7 A;  4TN2 A;  3U1M A;  2CIM A;  3FRY A;  2MQM A;  4CNY A;  2LYV A;  3OR1 A;  2HBR B;  2J76 E;  4JI2 F;  3LP1 A;  2XG8 A;  1UEU A;  1OSD A;  1B3T A;  1RJJ A;  3EVM A;  3AB4 B;  5GAH I;  2B8P A;  1MLA A;  4M1K A;  1RAC B;  4DLG A;  2YNH A;  1HW9 A;  1YK9 A;  5J1P A;  4KC5 A;  4CM2 A;  4N76 A;  1X4E A;  2DRA A;  3HCX A;  1N48 A;  3FUY A;  1U02 A;  5GAD I;  1TL4 A;  3HHL D;  4OI2 A;  3WC0 A;  3BV8 A;  1T03 B;  2W01 A;  4RNH A;  2W24 A;  2W2O P;  4RW7 B;  4OYP A;  5HAN A;  3BF4 A;  3J7Y U;  5D0H A;  4MK8 A;  4YHH F;  3CWJ A;  1VOM A;  2MHE A;  2JSX A;  2FHM A;  1TL7 B;  1EP4 B;  1SCJ B;  2LFV A;  1I5O B;  4OYA A;  4LFA F;  4AL6 A;  2Q43 A;  3QFH A;  2AEM A;  2ZFH A;  4PWW A;  3WC2 A;  2VPY B;  3I31 A;  2UP1 A;  3KJF B;  2LLZ A;  5IM0 A;  2M0G B;  2RHQ B;  1FKP B;  4FXV A;  4RWW A;  3VAH A;  5C2G A;  4K0K F;  6AT1 B;  4KTQ A;  5K14 B;  2IM0 A;  3BPD A;  3NRB A;  2VJU A;  3MPV A;  2EFV A;  3VAM A;  2HHX A;  4NCB A;  2CWX A;  5KG6 A;  3CIM A;  2MZR A;  2B4P A;  2CPY A;  4OJH A;  5FD1 A;  2KH9 A;  1FES A;  4O3P A;  1RHQ B;  4O4G B;  3H5X A;  4I56 A;  4AL5 A;  4K59 A;  2PDA A;  4Z7Y A;  1RB0 A;  1P27 B;  3HD2 A;  2OSQ A;  1FE0 A;  5C24 A;  1NDP A;  1JLB B;  4NLG A;  3QID A;  4TVA B;  4K4X A;  2VFT A;  2B6A B;  1Y5L B;  2HBZ B;  4DJB A;  3BM7 A;  2YXL A;  1KQF B;  4LF6 F;  1OIA A;  2YQ3 A;  3R7B B;  1U1Q A;  4BLG A;  3JSR A;  2JJ4 D;  2WVC A;  5KFI A;  3VAI A;  3CW2 C;  1PIE A;  2QFJ A;  2ZVI A;  5D15 A;  1HNV A;  5E41 A;  2HLT A;  4DUZ J;  5IQ6 A;  2D3O 1;  2CJA A;  2LVW A;  3ITH B;  2B9E A;  2RS8 A;  2VG7 B;  2V4Q A;  4I67 A;  1PC4 A;  2A3J A;  4ZPC A;  4U95 A;  4ANE A;  4CCH A;  4MK9 A;  3HKZ D;  4P2F A;  2C3P A;  5E0O A;  3PYF A;  4NRU A;  4BWJ A;  3OR1 B;  2HPU A;  4ZIW A;  1PJ5 A;  4E8U A;  3KLI A;  1APS A;  2C22 A;  4J9R A;  2O67 A;  4PG7 A;  3CIZ A;  4CNZ A;  1MRO A;  1JQG A;  4E0D A;  4DCJ B;  1SVD A;  5CAA A;  2YNH B;  1B99 A;  4H4K A;  3FCH A;  5JVG Q;  3PW2 A;  4RX6 A;  4C0B A;  3SCI E;  1MW7 A;  1WHX A;  2NLW A;  2NXN A;  1DFD A;  3EGV A;  4KRW A;  1OSC A;  3V4M A;  2BE7 D;  2A2C A;  3SZ2 A;  3FNN A;  4OYO A;  2IC3 A;  3AJD A;  2V2Q A;  3ET6 A;  3LO3 A;  2YWK A;  4BC7 A;  2G2O A;  3B54 A;  1EKR A;  1SKS A;  2KG0 A;  1IBL F;  4EK2 A;  3GWC A;  5KFP A;  2PO4 A;  2LQB A;  4R5P A;  1T9T A;  2A2D A;  2BKN A;  2CQD A;  4LF4 F;  2CNO B;  1OY6 A;  1RTI A;  2CWK A;  1TMJ A;  2CQH A;  1RAE B;  1UVN A;  5C25 A;  2AT1 B;  5IM0 B;  2FJA B;  4M5L A;  3Q8V A;  1WDD A;  5C7P A;  5IT9 Y;  1FFW B;  3TX0 A;  1WC3 A;  2UVU A;  1JMT A;  4CT9 A;  5HO4 A;  2AV5 A;  2GCF A;  3D1O A;  3IR6 B;  4ZN3 A;  1IBM F;  3EWG A;  1F5C A;  3GIM A;  2O01 C;  3RRG A;  4IR9 A;  2VPZ B;  5KFW A;  3LTO A;  2OKQ A;  1SJ1 A;  2J0X A;  3U27 A;  2F8E X;  3VZH A;  4WFA Q;  4UOF A;  3M6U A;  2ZH1 A;  2VH7 A;  3LP2 A;  4MKY A;  5C24 B;  4EZ9 A;  1KFD A;  1YBU A;  2Y1I A;  2IM2 A;  2BAB A;  4ILL A;  3IRW P;  1Q5V A;  2E7V A;  4N5S A;  2CPD A;  3PM9 A;  4O23 A;  4YB1 P;  1KQG B;  1Q95 G;  1NZ8 A;  1NKE A;  4AXI A;  2IVM A;  3RBE A;  1HNV B;  4ECW A;  2J6U A;  2YKO A;  1PBU A;  2IPO B;  5KFO A;  3O3L A;  4F4K A;  2QLB B;  5BR8 F;  3A3O B;  2KRR A;  4P52 A;  1T9V A;  3NKY A;  3GCX P;  1HYS A;  2HZC A;  4IKA A;  3JTN A;  3DOK A;  3FEX B;  2IYG A;  3DGV A;  4C98 A;  3AT1 B;  5A8W A;  1XMO J;  1OY8 A;  3HJV A;  2JH3 A;  2XY7 A;  2E5L J;  1IJF B;  1S4F A;  1FHT A;  5K8O A;  3OHA A;  4DV2 F;  2QL9 B;  3R27 A;  4DV1 J;  5EX3 A;  3OTD A;  5F8I A;  2LCW A;  3KLI B;  3HHK A;  3PX4 A;  3VV2 B;  2ZWP A;  4DR3 F;  1RSC A;  5L9N A;  1MRO B;  4OX9 F;  3FZB A;  4ETX A;  2KM8 B;  1S1W A;  3SSR A;  2LEC A;  2C3U A;  3TUP A;  3MI7 X;  3OJS A;  4OV6 A;  4ECU A;  2OFH X;  3IFE A;  3S01 A;  3T5L A;  4LFB F;  3D0I E;  4DSL A;  5CYM A;  4OHX A;  1W2B R;  1O5J A;  1NK4 A;  3FBF A;  5F8H A;  1LWF A;  2IC3 B;  2VKZ G;  2RB7 A;  3L09 A;  2B9X A;  4OJG A;  4Q8F A;  2VBX A;  3ET6 B;  1SC1 B;  4Y65 A;  4YQW A;  1XK8 A;  1YZ6 A;  5GAG U;  4DQQ A;  4KKO A;  1IUJ A;  2FJV A;  3GFY A;  1B7F A;  1HWJ A;  4R5P B;  5D0G A;  2O1P A;  2CAJ A;  2H1Y A;  4Q2M A;  3BPS P;  2CQP A;  3NG8 A;  1RTI B;  1ZPV A;  2DCU B;  2X1A A;  3BO2 A;  5C25 B;  5E3P A;  4YR3 A;  3QQC D;  2LA4 A;  2YKM A;  1NCL A;  4UOG A;  5D4P A;  1FNO A;  3M4X A;  2GVZ A;  2V69 A;  4PQA A;  4Q2L A;  1Q7L B;  2VDI A;  2QTW A;  1H6K X;  1K73 T;  3KDN A;  5A8K A;  2MZS A;  4RL1 A;  1TU0 B;  4ED1 A;  1RAB B;  1PAU B;  1JJ2 R;  5CCL A;  4OZL A;  3ENW A;  2EK6 A;  3TW0 A;  2K3I A;  1VLY A;  3LP2 B;  1XER A;  5J1E A;  3T5J A;  4CLY A;  2DTJ A;  3DMJ A;  1UL3 A;  1WEZ A;  4NOH A;  2L3M A;  4QR2 A;  1WEL A;  2R8K A;  3BO4 A;  2NS1 B;  5EWE A;  3ZNJ 1;  4O3R A;  2Y1J A;  3K89 A;  2OAU A;  3UDC A;  1GFW B;  3M8R A;  4X66 F;  2LQ5 A;  4ZP7 A;  1D9A A;  2XS5 A;  4YY3 J;  2OPR A;  1L3K A;  4RNN A;  5AT1 B;  1GXU A;  2R2T A;  5ETK A;  3BYP A;  2OTL S;  1HYS B;  1U45 A;  2XY6 A;  4UZC A;  3UI3 A;  4FS1 A;  2PA3 A;  4GKK J;  3DOK B;  2P5V A;  3HMJ G;  1RI7 A;  1HFE L;  5T7L A;  3IO1 A;  1BXN A;  3LAL A;  2COL A;  4DR2 J;  1HWL A;  1S97 A;  2ZH2 A;  3BBF A;  4FF2 A;  1OJ4 A;  2AJF E;  3DLJ A;  5IT0 A;  1VGY A;  3HHL C;  1WC6 A;  3LOU A;  1QJH A;  3NWG A;  3IA0 A;  2DT9 A;  1N34 F;  3RYL A;  2JC0 A;  4ECT A;  1N56 A;  3CJ5 A;  3EUN A;  1YBA A;  1SQF A;  4NYZ A;  4DI6 A;  4F4Z A;  1N0V C;  2C3M A;  4G65 A;  3CC2 S;  3V6H A;  1S1W B;  1U7L A;  1T11 A;  4MFB A;  3J80 U;  3FSY A;  3VVU A;  3BR8 A;  1EZZ B;  4EYI B;  2XI3 A;  3D1H A;  3CCM S;  2YKA A;  2YWW A;  1NKC A;  4QYR A;  2HK2 A;  2J8S A;  1P1L A;  4M5D A;  5CYM B;  1LWE A;  3JQJ A;  5KT3 A;  2LKZ A;  1CUL A;  3DC2 A;  1LWF B;  2RKI A;  2BEF A;  1S9F A;  2RQC A;  4CO3 A;  2R42 A;  5EWG A;  2FY1 A;  2GVD A;  1FJ7 A;  2FLL A;  2CG4 A;  2ZBC A;  1N32 F;  4B3R J;  5H9E J;  1F60 B;  3SFG A;  1M5S A;  3KMQ A;  5FJ4 A;  1S6U A;  4AQY F;  1DHM A;  2WBM A;  3LGN A;  4J7C A;  5G0R A;  2YKM B;  3LGM A;  2YQ0 A;  1S59 A;  2ZH9 A;  5DLF A;  1RHR B;  4KE5 A;  2DNL A;  1U8W A;  2DR5 A;  4P75 A;  4ITS A;  3ADA C;  5DGB A;  5JVH Q;  5A8K B;  4CQ1 A;  4B9N A;  1HHT P;  3NS7 B;  1S77 D;  4F4A A;  3E2E A;  2JLF A;  2JX2 A;  3GJR B;  5IXU A;  5GAE I;  3MAA A;  2E5G A;  3LPY A;  4J91 A;  5J1E B;  1IBC B;  2XY5 A;  2LXU A;  4LF9 F;  4AXJ A;  4CWB A;  4GO7 X;  1RBO B;  1XR6 A;  3W8G A;  2LA6 A;  1RUS A;  3BGF A;  3RUB L;  3MM8 A;  3M8Y A;  3TVY A;  4UW2 A;  2E1M C;  3PKM A;  4DR4 F;  1RT4 A;  2CQB A;  1S1U A;  1LW2 A;  3B4D A;  2V6A A;  3G8Q A;  2VQE J;  1K1Q A;  2GIR A;  1X5O A;  2OPR B;  3I5C A;  4CO5 A;  1SXL A;  5HAT A;  2YNI A;  4LF5 J;  3IS9 A;  3MM6 A;  3HFV A;  1KR4 A;  3QT6 A;  3DRP A;  1WF1 A;  1S6P A;  2XWY A;  2NXJ A;  4HT7 A;  5T7L B;  3E51 A;  4B9V A;  2G0C A;  4DUY J;  1FRK A;  1NO8 A;  3R1L A;  1RLC L;  3WZ0 A;  4PQU A;  3PR4 A;  2FD2 A;  3DLE A;  2V34 A;  2QMW A;  5ETN A;  3V6J A;  4DSE A;  4RU2 A;  3OTO J;  2MYF A;  4X4Q A;  4HI2 A;  1N36 F;  3QPI A;  2ZH3 A;  1KS2 A;  2ALY B;  1NM2 A;  1X9S A;  5H1S V;  3MED A;  4WPA A;  2MSS A;  2HNZ A;  1G7C B;  3NCR A;  4MFB B;  1F5A A;  1VFJ A;  4U7U K;  2UXC F;  5KFX A;  4ED7 A;  1IKW A;  2BJD A;  1YJR A;  3Q8S B;  1LWE B;  1RWX B;  1NK6 A;  1JLF A;  1H7W A;  1CUL B;  2RKI B;  3BGU A;  4C97 A;  2R4F A;  1LFP A;  1X0F A;  2AWZ A;  4ZOS A;  2ZOG A;  4QIG A;  1CQN A;  1RAA B;  1RWN B;  3SI8 A;  4ZK7 M;  1BQM A;  3GON A;  2DO0 A;  3L7O A;  1KHW A;  5G0R B;  3UW1 A;  2VQF F;  1H2V Z;  4PWD B;  2W7P A;  3OUY A;  3IWL A;  1OQ3 A;  4DL0 C;  1HA1 A;  5DJB A;  1D1U A;  3R97 A;  3MCS A;  4MT1 A;  3B82 A;  2OD6 A;  1T7P A;  3OL8 A;  3T5H A;  1W2I A;  5AXK A;  2CXE A;  3CME S;  3MEE A;  4MIB A;  1XMQ F;  1O6X A;  5KFF A;  1GT8 A;  3MAA B;  2WK4 A;  2WTF A;  3HKW A;  3TA2 A;  3P49 B;  4J9M A;  2YNG A;  1ELO A;  3I56 S;  2GML A;  4Q8E A;  2CNN B;  1S10 A;  2M9K A;  3MM8 B;  2FHO B;  1HKA A;  4LF7 J;  3TWZ A;  4DF4 A;  2K2P A;  1RT4 B;  1S1U B;  4R0E A;  1LW2 B;  2WSF C;  1FI4 A;  1URN A;  4JI7 J;  3FCV A;  2FGC A;  3HX9 A;  3N9U C;  2E7W A;  4R25 A;  3CC7 S;  2IVF B;  2R9L A;  2XGP A;  2YNI B;  2GHV C;  4NWB A;  4IR1 A;  2K7J A;  3IS9 B;  4TY9 A;  3I5B A;  2J8A A;  3MM6 B;  3SEO A;  2RRB A;  2VOO A;  2D69 A;  3ZZ0 A;  3MMB A;  3DRP B;  4UY8 T;  3DGP A;  1S6P B;  2OO4 A;  3VCD A;  4B9L A;  2RT3 A;  2YKN A;  3GV8 B;  2ZKT A;  2VFU A;  4PQU B;  3DLE B;  1YIT S;  3OTC A;  4PYD A;  4NLX A;  2FLO A;  3GTY X;  4DR7 F;  3CED A;  3R5J B;  2I8E A;  2ZM6 F;  3PYE A;  1XEZ A;  5DO2 A;  3BH6 B;  1CLF A;  3KXD A;  4EO8 A;  4OI4 A;  1HNX F;  3TRG A;  2IRX A;  1FK9 A;  3FMW A;  4Y2A A;  2HHW A;  4P10 A;  3MED B;  3J81 U;  2HNZ B;  3BJY A;  3HSJ A;  2IMO A;  4JBC A;  3VZI A;  5K8P A;  2Z56 B;  1UVL A;  1IKW B;  1RHU B;  1IXK A;  2JL9 A;  3NBP A;  4QYZ K;  4GRS A;  1BLU A;  1JLF B;  1QD1 A;  2D3O R;  2CZ9 A;  3EZU A;  2I38 A;  2DY1 A;  4ECS A;  2XBP A;  4FPI A;  4ZCK A;  4JV2 A;  5DGA A;  1WAC A;  1U26 A;  4NLY A;  1DQ9 A;  2B9W A;  4DV5 J;  1FX4 A;  2M2B A;  4C48 A;  3FMB A;  2XO7 A;  1FDN A;  3JTO A;  5F8M A;  5DZ7 A;  4ED3 A;  4USW A;  2XZD B;  1UA1 A;  2CPX A;  1ACM B;  3ISN D;  1BQM B;  3OHB A;  2ZOM A;  2DHH A;  3MM7 A;  5KT2 A;  2OSR A;  4J9O A;  2XCA A;  1RHK B;  4ID5 B;  2NPF A;  3OUY B;  3PR5 B;  4KO0 A;  3E8O A;  2VKR A;  3KNA A;  4M8L A;  3MFH A;  3AOD A;  5HQM A;  3M8S A;  2BM0 A;  3HFZ B;  5KFZ A;  2CUY A;  4H4K C;  2EFQ A;  5HVG A;  5E3A A;  3MAH A;  4ECZ A;  4CT8 A;  3NGD A;  3EZ5 A;  4AL7 A;  4KGX B;  4V19 X;  3MEE B;  4LF1 A;  1TKX A;  2RHS B;  3C8Y A;  2DR7 A;  3QT8 A;  3GR0 A;  1UPP A;  3TZY A;  1QTN B;  4RUC A;  2LU2 A;  2ROG A;  1DAX A;  3I0S A;  5LMU F;  4P6Q A;  4YHH J;  1P9Y A;  2KT3 A;  2HG4 A;  1SI9 A;  3PRV A;  2V8V A;  2FLN A;  5H9F J;  4GC6 A;  1F2G A;  4ETZ A;  1GNK A;  1T3N A;  4CI0 B;  2E1P A;  1K47 A;  3CJ0 A;  2GA7 A;  2JLE A;  1RWP B;  3N6N A;  4FBT A;  4F3Q A;  2HHQ A;  1G2E A;  5E2Q A;  3GFX A;  3MEC A;  3VAJ A;  3PW0 A;  3A1Y G;  4CH7 A;  1NK9 A;  2HRY A;  3OR2 A;  1Q7Y T;  4DHV A;  2BJ1 A;  3BB5 A;  3MMB B;  2PMW A;  3HZE A;  3DGP B;  1TL3 A;  4B3O A;  2ZC4 A;  1D8Y A;  5GAH U;  2YKN B;  3EGZ A;  3JSY A;  1RYS A;  1EET A;  4U67 Q;  2ZIT A;  2QEX S;  3LAM A;  3O2I A;  2WVE A;  4DEZ A;  5LL6 d;  2XEX A;  1Y00 A;  1CSJ A;  4C0H A;  2W1B A;  2B7C B;  5KFJ A;  2Z2Z A;  4PYA A;  1FK9 B;  3TOQ A;  2BYC A;  3T6B A;  6FD1 A;  2MPU A;  2PII A;  3NMR A;  2NXU A;  4MIW A;  1VDH A;  3NBP B;  4OI6 A;  4LR8 A;  4HH1 A;  4CP5 A;  3ZZP A;  3WQP A;  1FKO A;  3VAF A;  3CMQ A;  4C3L A;  2CJQ A;  2QLX A;  4BC9 A;  1VQP S;  2DNH A;  1GTE A;  1FER A;  5E7O B;  4YP3 A;  2UUC J;  4QW8 A;  4QCL A;  3J80 Y;  1VK3 A;  4WIQ A;  1XR7 A;  2OTJ S;  4WE1 A;  4ZPA A;  1WKJ A;  3PRB A;  3MM7 B;  1Q53 A;  2CPI A;  1VLO A;  2GJI A;  1JLG A;  4KO0 B;  2WCX A;  1D8Z A;  1KC8 T;  2F8M A;  3CD7 A;  1WDT A;  2GMH A;  5AE3 A;  2GX8 A;  2UUB F;  2XSJ A;  1R8B A;  3UNY A;  2QV6 A;  2FJD B;  3SDE A;  1YRT A;  4KHR A;  1TKX B;  2YKP A;  1V9O A;  1VQ9 S;  4EU0 A;  3X1L B;  4X64 F;  3CT9 A;  1KLN A;  4JYA J;  1PJ6 A;  3MHY A;  1AUD A;  3Q24 A;  3I0S B;  3ZZZ A;  3PKY A;  2R7O A;  1GXL A;  4M5N A;  2KB2 A;  2QL7 B;  1PJ7 A;  4A8M P;  1AFJ A;  3TAP A;  1M90 T;  3DHX A;  4ER8 A;  2JOQ A;  2Y8W A;  1O0P A;  3R1H A;  3HF5 A;  2D7S A;  1F2H A;  5C42 A;  2E9T A;  2YWE A;  4EBD A;  1FFS B;  1M5V C;  1G3O A;  1YZ7 A;  4QU6 A;  4PXB A;  3RAX A;  4DQR A;  4Y2C A;  7FDR A;  1JXE A;  4M5K A;  3TA0 A;  1CJV A;  1WOS A;  4R0J A;  4RNM A;  3IBC B;  4YS2 A;  3PNI A;  3MEC B;  1RHM B;  2KJW A;  3KK1 A;  1CS4 A;  3OR2 B;  2ASL A;  5CH7 B;  2EXU A;  3IBW A;  2H4Y B;  2ZUA A;  3OTE A;  4L75 A;  1TL3 B;  1BHN A;  1NAQ A;  4YUD A;  4B3O B;  5DQH A;  3CJT A;  4ZLP A;  3HXM A;  3V2U C;  2X3D A;  4DFM A;  5JXS A;  1FXL A;  3UN3 A;  2MQL A;  3FGV A;  2MKI A;  3CCV S;  4UY8 5;  4KR0 B;  3VAL A;  3HD1 A;  3C46 A;  4ZVE A;  1FJG F;  3IP0 A;  1NPR A;  2BOA A;  5KFY A;  1TL1 A;  5A0Y A;  3G71 S;  1JWW A;  2C3Y A;  3AB2 B;  1RHJ B;  2Y8Y A;  3UR0 A;  2UUA F;  3QJP A;  2BJ3 A;  2DH9 A;  3A8I A;  4HDG A;  3W64 A;  4WBF A;  2DKO B;  1I51 B;  2ZEJ A;  2HLU A;  1Q8B A;  3AOA A;  3A8E A;  2ZZN A;  5BR8 J;  4LRE A;  2WW4 A;  4N77 A;  1PG5 B;  1MN9 A;  1FKO B;  4ZLL A;  2F4F A;  2XHW A;  3VHQ A;  4ZJO A;  2QE5 A;  2GV1 A;  1U1L A;  1S76 D;  4TKT A;  4NLO A;  3QSY B;  2VG6 A;  1FRI A;  1N5S A;  3MDF A;  3CCQ S;  4WFZ A;  4JI6 F;  1BMQ B;  3U1L A;  1UZD A;  3J7A N;  3P4U B;  1GMU A;  3AHP A;  4DPX A;  1QTM A;  1S57 A;  1H38 A;  4WE1 B;  1TV6 A;  4KGK A;  2VHG A;  1ITP A;  3RW6 A;  4F0M A;  2AJQ A;  4ED4 A;  1QVG R;  3UD5 A;  4RO0 A;  1JLG B;  2ZVS A;  1IQZ A;  3ZZT A;  4IO9 Q;  1WHY A;  4YDX A;  4X2B A;  1H73 A;  2GIF A;  4B3S J;  3N5F A;  4QIW D;  4Y00 A;  2XSJ B;  4PXC A;  2DGV A;  2DHA A;  2Z2L A;  3SDE B;  5IV4 A;  4ED6 A;  1C4A A;  1Q1K A;  3D3C J;  2BUN A;  2CZ4 A;  3H20 A;  1KHV A;  2R7R A;  1UVM A;  4QWE A;  3U7J A;  4ECY A;  2XMV A;  3THV A;  3W3S A;  3C19 A;  3BN7 A;  4C11 B;  1Y0H A;  2J0W A;  2AYM A;  4XTT A;  3GMG A;  3N4W A;  1VS3 A;  5T41 A;  1SH0 A;  2AYB A;  2BAC A;  5D0R A;  5DZ6 A;  1XJW B;  1SL1 A;  3NP5 A;  1HWI A;  1RLD A;  4LRB A;  5SUH A;  3MEG A;  2G13 A;  4OHZ A;  3AD9 C;  1SIW B;  4NA3 A;  1BQX A;  1YJW S;  3T1H F;  5C42 B;  2XS7 A;  3JAM U;  1FJC A;  1UCN A;  2CQ2 A;  3W66 A;  1J5E J;  1WOP A;  3ZZR A;  4A8K A;  1NPP A;  1CJV B;  2XS2 A;  3TAQ A;  4KPY A;  4X65 J;  3KK1 B;  1CS4 B;  1WF2 A;  4WWS A;  2QT7 A;  1KSP A;  3BR9 A;  4HR2 A;  3W62 A;  2IM3 A;  5IV3 A;  3CDB A;  2E9Z A;  4NEY A;  3RRH A;  2AX1 A;  2O5D A;  4J90 A;  1CJT A;  2DNY A;  2AJ2 A;  1HAR A;  1TQL A;  4B08 A;  2J7W A;  4OYB A;  1XN9 A;  2LU1 A;  1TL1 B;  1NBE B;  5A0Y B;  3T9N A;  4OYI A;  3U1N A;  2J9E A;  1TKD A;  4NXM J;  3FFI A;  2ZJR Q;  4C8Y A;  2FZC B;  3DYA A;  3BKF A;  4A8F A;  2V94 A;  1SKW A;  2DNP A;  3ISN C;  2PGC A;  3UDE A;  1R6Y A;  1J2V A;  2VG5 A;  1S72 S;  4USH A;  2HK3 A;  2RRN A;  4ZPV R;  3D0G E;  4HTI A;  4AT1 B;  5EN1 A;  4JI0 J;  4AUK A;  1FWK A;  3KHG A;  5ETP A;  3M8W A;  2HZA A;  4ZS6 A;  3OD2 A;  2ADB A;  3I9Z A;  2M52 A;  2EEY A;  2VG6 B;  3KYL A;  5F3Z A;  3C6U A;  1XIQ A;  3J81 Y;  4HLB A;  4PPZ A;  3Q8P B;  2DGQ A;  1RAI B;  1W25 A;  1TV6 B;  1IR2 A;  3O8W A;  3SXL A;  3W61 A;  5IOL A;  2ZOF A;  4ZVU B;  1VQL S;  5HAO A;  1DQ8 A;  1MMN A;  1SL2 A;  4M5G A;  3MPD A;  2NZ4 A;  2ROE A;  5D8H B;  2YKQ A;  2YH0 A;  3H42 A;  3MCN A;  2MLY A;  2APO A;  3MPU B;  3EDQ B;  2DJW A;  1TEL A;  4EFA C;  2UVV A;  4WYL A;  4O4R A;  4YME A;  2B3T B;  4B3M J;  1X5S A;  4FXW A;  3M1V A;  3OFG A;  2XUL A;  3TNV A;  1FNX H;  5B0A A;  3C6T A;  2D1C A;  4ERD A;  3MEG B;  3M30 A;  5M2P A;  4JV5 F;  4UOC A;  2IYI A;  2ZWO A;  1KNZ A;  4QWD A;  1ZH5 A;  1SQG A;  4U96 A;  1EB0 A;  2DRD A;  3DDK A;  4CLT A;  2JEJ A;  1RE1 B;  4P72 A;  1FEH A;  3Q8Q B;  5LJ5 Y;  1FRM A;  1DJ0 A;  2KG1 A;  1U1K A;  3EDR B;  1ZA2 B;  1BWE A;  3G87 A;  2DXF A;  1RWV B;  4IRK A;  4DR5 J;  1CJT B;  1YG0 A;  2L9D A;  3NNA A;  3ISZ A;  4L74 A;  4X84 A;  1RDR A;  4IH5 A;  3P45 B;  3UQS A;  2LQ9 A;  5M2R A;  4NZ6 A;  1X9W A;  4LSZ B;  3FFI B;  3IGV A;  1K44 A;  3LWL A;  1KVI A;  3M9M B;  3EX7 B;  2LDI A;  3OPK A;  2DD8 S;  1U25 A;  1AZS A;  2VG5 B;  1N33 J;  3OJU A;  4WFY A;  2IBK A;  4FVM A;  4X4V A;  1DTT A;  3W2V A;  4NXN F;  2V4R A;  4H4O A;  1HQU A;  1JJC B;  2W4C A;  2PMZ D;  2J5A A;  3L95 X;  4W92 B;  1FRX A;  2YX1 A;  3FEY B;  4ZVS B;  3DLL Q;  4WU3 A;  2EBG A;  3C6U B;  1VIX A;  2QMU B;  1CG2 A;  4F50 A;  4OJ1 A;  3SCJ E;  3RB4 A;  2CJ9 A;  2G0J A;  1FWL A;  1NDL A;  1RBA A;  3AQO A;  4F3M A;  5GMD A;  3R9L A;  5HSP A;  2KHC A;  3LH2 S;  3OLB A;  5ETV A;  2B4U A;  3I0R A;  4DR6 F;  3IWX A;  5GAE U;  3R5A A;  1M1G A;  4HI1 A;  1JKH A;  1ZZF A;  1UFL A;  2QMX A;  2AHO B;  2UVR A;  3WX8 A;  3GSI A;  2ASY A;  2L08 A;  1PKU A;  4CO0 A;  4RWX A;  3PX0 A;  4RW8 A;  4DPO A;  4ZIT A;  4OYX A;  4LF8 J;  2RUS A;  3QIP A;  4TXS A;  1UJ4 A;  4DL4 A;  2HQC A;  4DU8 A;  4O3N A;  3M1V B;  3MUT P;  5KT6 A;  2RAQ A;  1R0C B;  1VQM S;  2DVI A;  4LFC F;  3C6T B;  3NY0 A;  5HMX A;  1RU2 A;  4JV1 A;  2CJX B;  3M30 B;  1F9H A;  4K4U A;  4PRF A;  4DOZ A;  1AYE A;  4QQB A;  2YNF A;  2NYI A;  2JZ5 A;  5DM7 Q;  1WC5 A;  4JP8 A;  3HHE A;  1FVQ A;  5DG9 A;  2AU0 A;  4NMX A;  4L6V 3;  1SJQ A;  5A6P A;  5MAO A;  2NXC A;  5EHH A;  3TEH B;  4XAK A;  4P2S A;  2MHN A;  4IRC A;  2W8L A;  4ZIV A;  2ROP A;  4ZVP B;  3CXC R;  5KFC A;  1NSP A;  1WG4 A;  1M1K T;  2VZ9 A;  1M1H A;  4DV7 F;  2R7V A;  2UXB J;  4OZJ A;  2QSW A;  1R43 A;  1WG5 A;  1XMQ J;  3JXO A;  3CDU A;  4C8K A;  4KHM A;  2RVJ A;  3GCW P;  4GMK A;  3DRS A;  5E5N A;  4ATN A;  5IC4 B;  4F8R A;  1SKR A;  3TR5 A;  1WKK A;  2IBO A;  4FF4 A;  2CDQ A;  2PFD A;  2MLZ A;  2XMJ A;  2JEF A;  4WXO A;  4K50 A;  4PG4 A;  3PZP A;  3KJV B;  3HSZ A;  2G9O A;  4UQT A;  1AZS B;  3QAE A;  3QGH A;  2MQ8 A;  2HHS A;  3OV7 A;  1F9E B;  3DM2 A;  4ZVR B;  1DTT B;  3W2V B;  1T8E A;  5D78 A;  1VI7 A;  3GJS B;  3K57 A;  2IHR 1;  4H4O B;  1QE1 A;  1HQU B;  2MKC A;  2BRK A;  3M32 A;  1DUR A;  2V63 A;  4K2J A;  3T1A A;  4URG A;  4NRT A;  3TJ8 A;  3U02 A;  4V1A k;  1YDL A;  4FS2 A;  3HUL A;  4OZ2 A;  1PAE X;  3PJ9 A;  3CJ2 A;  5DDQ C;  2QA1 A;  2BQ3 A;  2B5J A;  4PG5 A;  1HNX J;  1U09 A;  5JJB A;  2MMY A;  4J9S A;  3I0R B;  4TNO A;  1V5I B;  2LXF A;  2XI2 A;  1JKH B;  3JS9 A;  1MMD A;  2HSE B;  4YOE A;  4ECR A;  5DG8 A;  2XMT A;  3KLE A;  5DQI A;  1WSV A;  3CGI A;  4FYX B;  2N4C A;  3DDI A;  3D0H E;  3ZC4 A;  1HI8 A;  1UP1 A;  2QJ3 A;  4RW8 B;  3CJK A;  3OT9 A;  4BCA A;  3VWS A;  1H7X A;  3MD3 A;  5AJ3 F;  4LVN P;  2ACM A;  1VK8 A;  3QIP B;  4J9V A;  1U6B A;  4OJ3 A;  2V4J A;  4NLQ A;  1VC6 A;  3W5Y A;  3ETM A;  5KAK A;  2JEG A;  4WK3 A;  1MU2 A;  2VOP A;  5DG7 A;  3AJ2 A;  1S0N A;  3HLU A;  1Q8I A;  4EEY A;  2NSC A;  5HVH A;  1FWP A;  3KG1 A;  3M2R B;  3RAQ A;  4NEZ A;  2U2F A;  2DB1 A;  5KFL A;  4DBQ A;  2OLW A;  3L4B C;  2YNF B;  2GS8 A;  3GYX B;  1T9W A;  2LEP A;  3ZTR A;  2N3O A;  4F2R A;  2HBQ B;  4CLU A;  2EG1 A;  3R8Y A;  4A8Y A;  4JI5 J;  3H2U B;  2CJB A;  3JQK A;  2OIH A;  5LM7 E;  1S6Q A;  3A13 A;  2F1F A;  2W7O A;  2F5G A;  8AT1 B;  4ZJQ A;  4L3N A;  3M6W A;  3QNW B;  4QR0 A;  2H51 B;  2E5J A;  3VGV A;  1EIY B;  1NB7 A;  4F0K A;  3DRS B;  5HBM A;  1TKT A;  3K0J A;  1O8B A;  3GR1 A;  3GB0 A;  4DCO B;  2DCL A;  1TUV A;  2LXI A;  2JHE A;  3QMQ A;  1TAQ A;  3TJA A;  3PW4 A;  4B17 A;  1REV A;  1WHW A;  1Q86 T;  2XCP A;  5HK4 A;  3CJQ A;  1TMM A;  3RB6 A;  4ECV A;  1JLE A;  3EJM A;  3CO0 P;  3DM2 B;  4Y34 A;  3K5M A;  4I2P A;  1VQY A;  3C16 A;  4F4Y A;  3H98 A;  1QE1 B;  4YB6 A;  3VGU A;  3MTJ A;  3M32 B;  3SFU A;  3KOA A;  2R7W A;  3GIK A;  2DIS A;  2AZ1 A;  2NZC A;  3LF0 A;  1DRZ A;  4XPC A;  4RNF A;  4F4W A;  1LOU A;  4RLE A;  1JK9 B;  3LW5 C;  2B5J B;  1MWQ A;  2VUG A;  2AYE A;  2FDN A;  1YBT A;  2AKW B;  1YTY A;  2RF2 A;  1HBN A;  1RAO A;  2LQ8 A;  1IKX A;  5I42 A;  5HMW A;  3R3T A;  3ILJ A;  3I32 A;  2WSE C;  2GGP A;  5KG4 A;  1I94 F;  3KLE B;  2MKK A;  2POK A;  1S0O A;  4PXD A;  2J9C A;  5BYS A;  2LEB A;  4JI4 J;  2Z8Q A;  3CJK B;  1Q16 B;  2YPY A;  2KYX A;  3Q0A A;  2HUR A;  3IMQ J;  3MZI A;  3SSQ A;  3US5 A;  2W25 A;  4URS A;  2V4J B;  4F0H A;  3BKT A;  1U0S A;  3K5O A;  5DET A;  2V8D A;  5FLX U;  4DX5 A;  3T9Z A;  2B9Y A;  3MPY A;  1LK7 A;  1MU2 B;  3M6X A;  3QZ7 A;  2HVZ A;  4L3K A;  5IQQ A;  4LQ3 A;  5J1N A;  5CYJ A;  1MWZ A;  2OEM A;  1JX4 A;  3O5T B;  3HK2 A;  3JSM A;  4X4N A;  2GO9 A;  2I6W A;  4MMO A;  2EFP A;  4DL7 A;  1XQI A;  1NK0 A;  1V6H A;  3KUE A;  2R8G A;  2R7T A;  2UUB J;  1B0P A;  2GHW A;  1S6Q B;  3UN5 A;  4UOH A;  1ZTW A;  1FTR A;  1U49 A;  4X64 J;  3D66 A;  3K5P A;  2GQ2 A;  2N3L A;  5HBM B;  4HAC A;  1TKT B;  4NPO A;  4YFU A;  3QSI A;  1XNQ F;  1KKH A;  2FGO A;  3EE3 A;  4CTA A;  2Y0S D;  4DZD A;  4GVL A;  1VIO A;  1RAF B;  1X7V A;  1REV B;  3I9V 9;  4Y2I A;  1OQ6 A;  2J0Q D;  1F3F A;  1DBD A;  3D4J A;  4LR9 A;  2NRE A;  3AJ1 A;  1AFI A;  3CJ3 A;  4NLP A;  3GU0 A;  1JLE B;  4QJV A;  3T19 A;  1RK8 A;  4F4X A;  4MYT A;  3H59 A;  2CPF A;  4TLR A;  3PV8 A;  1PC5 A;  4DQP A;  4I2P B;  1RT1 A;  2D74 B;  4O3O A;  3C16 B;  2JFK A;  3T41 A;  2XWX A;  3MR5 A;  1X9M A;  4KSE B;  3GG0 A;  1VCT A;  1EJ7 L;  4LBI A;  4ZVG A;  2EW9 A;  2RDJ A;  4ZA1 A;  3NNC A;  3KTQ A;  1FO1 A;  4FZV A;  4OX7 A;  4C8N A;  1OWX A;  4NCG A;  2AIR B;  1ZM4 A;  2VB6 A;  2K06 A;  3I5A A;  4IRD A;  1FXD A;  3OFH A;  1DY3 A;  4K7Q A;  3MMC A;  2EC2 A;  1SH2 A;  4KY3 A;  4B02 A;  2RF2 B;  1SKU B;  1RAJ A;  1HBN B;  3VQS A;  4PWU A;  3G6X A;  1IKX B;  5I42 B;  1GMW A;  2DHX A;  5F8G A;  2GGP B;  1RT7 A;  4UTG A;  1LEO A;  4D3G A;  4OX6 A;  1ZM2 A;  3RB3 A;  3KHH A;  1KWM A;  3D6M B;  4JI3 J;  3VAG A;  2X1G A;  2QYC A;  3W65 A;  3MUV P;  4HVZ A;  2IA0 A;  2YX7 A;  2FVP A;  4ED2 A;  1N0U A;  1R8H A;  2G4B A;  4JI8 J;  1RT2 A;  3KG0 A;  3N28 A;  2LP4 A;  1WEY A;  1PYS B;  1XMO F;  3GE9 A;  4X4T A;  1VQ4 S;  2QX0 A;  1NB2 A;  1MN7 A;  1RQ0 A;  3C14 A;  4RUH A;  4PUO A;  4U7U D;  4DV1 F;  4C3M A;  3EZO A;  2J0S D;  2YWH A;  1NLK L;  2D3Z A;  3JSM B;  4DQI A;  2ZHA A;  3T1Y J;  1KP6 A;  2HFS A;  4C0O C;  4FNH A;  1WC1 A;  1KRP A;  1NJX A;  3JSB A;  4OIX A;  2IDE A;  1C1C A;  2DNR A;  2GJF A;  3KUH A;  2KVQ E;  1JJ4 A;  4XPE A;  5KFT A;  3H40 A;  2QL5 B;  2PI4 A;  1RAG B;  2BDP A;  2VIC A;  4HAC B;  3KG4 A;  1QUP A;  2Y0B B;  2CPH A;  4CTA B;  3QO9 A;  4ED5 A;  4OI3 A;  2FPH X;  5EX0 A;  1PIL A;  5IWA J;  3EPG A;  2NYH A;  3PW5 A;  1SJR A;  2Z4P A;  3CJR A;  4YB7 A;  4RPF A;  1X5P A;  3HO1 A;  4NL5 A;  2O66 A;  4IG0 A;  2IJR A;  4HHH A;  1NZA A;  4NZ0 A;  1RT1 B;  2VJV A;  2V50 A;  3H4B A;  1H2T Z;  3C66 A;  3GSD A;  2AMC B;  4WZM A;  1KVK A;  3ZZU A;  4KBI A;  3EGN A;  2JNJ A;  2WZ1 A;  5U47 A;  3K59 A;  1WC4 A;  5CXT A;  2MQN A;  3H25 A;  1WOO A;  3IGN A;  2OML A;  4ZVO B;  4DV4 F;  4NCG B;  3DFE A;  2RQ4 A;  3OFE A;  2J6S A;  1RT3 A;  2CDR B;  3UVJ A;  1M0S A;  3B4M A;  2I5J A;  3MMC B;  2MKJ A;  3ZTS A;  1QLN A;  3IXQ A;  4WP3 A;  1K9M T;  1GTH A;  4DWI A;  3EVO A;  2KXN B;  4IUF A;  1ROF A;  3OSN A;  4I6W A;  1HNW J;  2NSB A;  3SYZ A;  3HP6 A;  2R8H A;  4RUB A;  4GKJ J;  4RBT A;  1FA0 A;  1OPI A;  1I6J A;  5FII A;  3RR7 A;  2MKY A;  2H5I B;  1RT7 B;  1SB6 A;  3W9H A;  2HQG A;  3FEZ A;  4BS2 A;  3FDS A;  1Z2L A;  5L39 A;  1OO0 B;  3NOG A;  1KQK A;  1SJ4 P;  2IFX A;  4CO2 A;  1VHI A;  2OD4 A;  2VL1 A;  4YY3 F;  2AGP A;  2W9B A;  4JI1 F;  4DR1 J;  1M5P C;  1KTV A;  2CYY A;  4Q7A A;  2UU9 F;  3FJ2 A;  1I1G A;  3UN2 A;  4I69 A;  1G6B A;  4YN3 B;  4GKK F;  1RT2 B;  4ZKA A;  1HHQ A;  2B51 A;  1R27 B;  3RRK A;  4OHV A;  1L3V A;  3TQE A;  4DR2 F;  2A18 A;  1M5K C;  3NGU A;  2MZQ A;  4Z2X A;  4J9U E;  1REG X;  3MWB A;  1X4D A;  1FCA A;  2B4O A;  5D4O A;  2R2U A;  3C14 B;  4B3T J;  4PUO B;  3S6E A;  2IJF A;  4DV6 F;  3TP2 A;  4DUT A;  1JJH A;  2RD5 C;  2M70 A;  1FT8 A;  2VV5 A;  3O44 A;  3DLK A;  4ILM A;  2KT2 A;  2EWH A;  3EYZ A;  3L7U A;  5I3Q A;  1H2U X;  2HND A;  1P6T A;  4EWT A;  2VBW A;  1Y4Z B;  1WSR A;  5HJX A;  1C1C B;  5F41 A;  3H0P A;  2HHH J;  3ENV A;  1U1R A;  1WJ9 A;  4C2M A;  3UR3 C;  2YY3 A;  1F6T A;  3T3F A;  1YJ9 S;  1AW0 A;  3W2W A;  4YR2 A;  2QZ8 A;  2F4V F;  2FQQ B;  3QO9 B;  4ZPD A;  1B0V A;  4CLS A;  1Y5I B;  3JB9 k;  3QRR A;  1RKJ A;  3H5U A;  2DNZ A;  2C2M B;  2A6M A;  3P5B P;  3A8K A;  2CKW A;  4X62 J;  2CPJ A;  4JV5 J;  4B3R F;  3UCZ P;  1K1S A;  2GJ2 A;  5JMN A;  3CD5 A;  3SCK E;  1QSS A;  1FDD A;  5AXL A;  5B7W A;  1AA1 B;  4IG0 B;  3ETO A;  4I6A A;  1U8S A;  2RQM A;  2WB4 A;  3BYR A;  2ZH7 A;  3KK2 B;  2M4M A;  3SBM A;  5L1K A;  5KFQ A;  1YJV A;  2BA9 A;  5GVQ A;  2WAQ D;  1Y5N B;  4F04 B;  1ZAX A;  4PAA A;  3NLC A;  2LMI A;  1RT3 B;  3UVJ B;  3QT7 A;  2I5J B;  1NK7 A;  2M8H A;  2R7Q A;  2VBZ A;  4DN9 A;  2HRU A;  4NYP A;  2IRY A;  4I2Q A;  3GZ7 A;  4KQZ A;  3QBC A;  4DS4 A;  3K7R A;  5HQ8 A;  1EQ0 A;  2BXJ A;  2BZ2 A;  1YJN S;  4ZLN A;  1KQS R;  2BV3 A;  3ZO7 A;  2BVZ A;  4CLP A;  4P9S A;  1ZPW X;  4IH7 A;  4DSF A;  5KFD A;  2HFO A;  2E1A A;  3MR6 A;  2AJ4 A;  4JB8 B;  1D9D A;  2G0I A;  2WRM A;  2YPZ A;  2VQE F;  1HQE A;  5A8R A;  2W9B B;  1TZ0 A;  4RUA A;  5MLC V;  4WKR A;  1BY9 A;  1HPZ A;  2P6T A;  2HWI A;  2XZW A;  4QOT A;  4BWM A;  2Y9H A;  3NS6 A;  5KT5 A;  1IKV A;  2OEL A;  7FD1 A;  4WTO B;  1OS5 A;  2UXD J;  2FTR A;  3TO8 A;  3KLH A;  3I82 A;  3BQ2 A;  2QYG A;  1NJY A;  3RBD A;  2H4W B;  3OTO F;  1WKL A;  3QT5 A;  4DPT A;  3PFO A;  2C2D A;  1XNR F;  1Q82 T;  4J9Q A;  1JXV A;  1S0V A;  1VJW A;  2CQ1 A;  1BD6 A;  3GIJ A;  1N5T A;  2ASJ A;  4PXE A;  3DLK B;  1NJZ A;  4BDP A;  1P1T A;  5L46 A;  1B70 B;  5ETQ A;  2HND B;  4MIA A;  1HD1 A;  5ETR A;  3HDS A;  4ENO A;  1Q8K A;  4PCQ A;  5LMN J;  2VFR A;  1HBM A;  3HVA A;  5FLX Y;  2A0F B;  5KFE A;  3TJ9 A;  3KNG A;  4RU9 A;  1UW4 A;  3MR3 A;  3KLF A;  2DNQ A;  1WNE A;  1EHW A;  3QRP A;  3W2W B;  4DX6 A;  4RJV A;  3FZ2 A;  1WC0 A;  4AYB D;  2XLI A;  5E3R A;  4PWD A;  5HJY A;  2AJ0 A;  2V8P A;  3AFG A;  4L76 A;  5HP1 A;  1FRH A;  1VRQ C;  2XHC A;  2R8J A;  2KI2 A;  2K1R A;  5BJR A;  2HAI A;  2HHV A;  1AB8 A;  2PFF B;  3ILL A;  3GPA A;  4LRA A;  2FVC A;  4A48 A;  4DSI A;  3P3D A;  2QC3 A;  3CCT A;  4USK A;  2RML A;  1YX2 A;  2VF3 A;  3MF5 A;  2P2C B;  4HHJ A;  2KXH A;  3MUM P;  5F8N A;  1FEE A;  1HW8 A;  2R8I A;  1TK8 A;  2CQG A;  3DRY A;  4A8S A;  3PG9 A;  1X4G A;  5J2P A;  2YBV A;  3F73 A;  1TL5 A;  4F2S A;  1SC6 A;  4DV0 F;  4ELU A;  2ZD1 A;  3I4P A;  3W60 A;  2DGO A;  1X4C A;  2NCK L;  2BAN A;  2ILZ A;  2P9C A;  2QG9 B;  3FK4 A;  4M94 A;  2AP6 A;  1GK8 A;  4I2Q B;  1Y3K A;  3L7P A;  1WD6 A;  1PGZ A;  3R5C A;  2L9W A;  4C4W A;  4LF7 F;  3P8B B;  1ZM3 A;  2HEK A;  3PIO Q;  3LGH A;  3POT A;  1SC3 B;  4QW9 A;  4XDD A;  2CJK A;  4M95 A;  4JI7 F;  3UFC X;  4ZP8 A;  3RBX A;  1RTD A;  1S1X A;  1VMB A;  1HQE B;  4ELT A;  3ZFV A;  5A8R B;  3OVB A;  1HPZ B;  1EAY C;  1QSL A;  2XNQ A;  2Z0G A;  3RBZ A;  4CLF A;  1IKV B;  4Y3C A;  3EMT A;  2MZT A;  4C8O A;  4QPT A;  3KLH B;  2X51 A;  2ZDO A;  4Y0F A;  1LNQ A;  2MKS A;  2VOD A;  4QPX A;  4DV3 J;  3CD6 S;  4E98 A;  4DX7 A;  4OFZ A;  3CE8 A;  4Y6I A;  1X4F A;  5F0U A;  2XQC A;  2XMM A;  3OTB A;  4W4M A;  2F65 A;  3K5N A;  2N7Y A;  5KFV A;  1AXQ A;  1HBM B;  1X8D A;  2HGM A;  2K3K A;  4KHP J;  4S0M A;  1BUX A;  1U6F A;  2P9E A;  4B9U A;  4FVC A;  4GC7 A;  3RJM B;  2WOM A;  5F9L A;  2W2Q P;  3KLF B;  1SBR A;  4WTY A;  3CTR A;  3S8S A;  2F9D A;  4ID5 A;  5KT7 A;  1ZZN A;  1WI6 A;  2DH7 A;  1W7W A;  5HP1 B;  4DV5 F;  4DXL A;  1IM4 A;  2K1R B;  2WB1 D;  3UO0 A;  4Q43 A;  3O6Q A;  1ZYQ A;  1PYO B;  2AJ1 A;  2L9N A;  3V81 A;  4X4S A;  1KN6 A;  1NEE A;  3WIU A;  2BKP A;  3Q83 A;  5KFH A;  2V8H A;  4UF4 A;  2ZZM A;  2VPX B;  4RR5 A;  4DN0 A;  4Z37 A;  1MG7 A;  3RW7 A;  4A46 A;  3OBI A;  2PSZ A;  5J2P B;  1J27 A;  3AXM A;  4M5M A;  4DPY A;  3N6M A;  3A3P B;  4H54 A;  2ZD1 B;  4J9L A;  3FQK A;  3SQO P;  1S49 A;  1HMV A;  4R8U A;  3LPE A;  2BAN B;  4ANC A;  2BJ8 A;  4N41 A;  3HPO A;  4F3O A;  1CEZ A;  2Z2Y B;  4HHU A;  5EWF A;  1LWX A;  4QU7 A;  4AND A;  3AD7 C;  1DLO A;  4ELV A;  1RYR A;  1NRK A;  5AE2 A;  4DSK A;  2FYX A;  1N54 B;  2DYA A;  2VIH A;  3POT B;  2KKH A;  3D5M A;  4IO1 A;  4QWC A;  2I9S A;  4Q0B A;  1LKZ A;  1RTD B;  1S1X B;  1CQM A;  3CMA S;  2HVI A;  2WVF A;  4ZVH A;  1NSA A;  4ZJL A;  1Q78 A;  3LQV A;  2A10 A;  3LWM A;  5HVF A;  4NA2 A;  3F44 A;  2MDA A;  2ZZT A;  2CQC A;  1K0T A;  1QVF R;  4TYB A;  2KT5 A;  5KOX A;  3OXG A;  4UUX A;  2LEA A;  2B8Q A;  4CZC A;  2H9Z A;  3Q8Y A;  1T9Y A;  2HS0 A;  4QBU A;  3LUY A;  2E1R A;  1M5O C;  4KFB A;  1L5U A;  2CQ0 A;  2JVR A;  1L3U A;  2Q66 A;  1NSK L;  4P74 A;  1I94 J;  1RGV A;  1TK0 A;  4M5J A;  1V3R A;  3DDN A;  2FVQ A;  1VBY A;  4RW6 A;  2DNK A;  4YB5 A;  2MQP A;  5L8R C;  2CNL B;  4WCE Q;  3R5G A;  2WOM B;  4JI2 J;  1CJK A;  5M2U A;  1B4S A;  3B8H A;  2CZV C;  4DQS A;  8ATC B;  4QYZ J;  1PO6 A;  5A6W A;  4IOB A;  1XR5 A;  5LSO A;  2ZKU A;  4GO5 X;  1UFW A;  3V6D A;  2JC1 A;  3NEK A;  5IFM A;  4USU A;  3H2V E;  3PDN A;  2ACY A;  3CF5 Q;  3MM9 A;  2KM8 C;  1S6O A;  3Q8U A;  1IQT A;  2UUC F;  4Y2K A;  4DFK A;  4RKU C;  4OYW A;  3V81 B;  3LP1 B;  1FD8 A;  5ETL A;  2BKO A;  4U8V A;  5LJ3 Y;  3ILO A;  3VQT A;  4B9T A;  5L1I A;  2Z58 B;  5J2Q A;  4EI2 A;  3W8P A;  1T3O A;  4X4U A;  2CQI A;  2BQU A;  1KBR A;  2H5E A;  4BBY A;  2RH3 A;  3H7H B;  2YWF A;  4LFA J;  4X4O A;  4FKX A;  2RU9 A;  4OYM A;  1Q0N A;  4MKA A;  1FRL A;  3ZZO A;  3DRR A;  5BYQ A;  1IBK F;  1HMV B;  4R8U B;  1UA0 A;  2W2M P;  2FZK B;  3IC1 A;  3TZX A;  4NAS A;  4JYA F;  2XM3 A;  3ZTO A;  4K0K J;  1XNQ J;  3PO4 A;  5KFM A;  4OQJ A;  1HLW A;  2H54 B;  2YWG A;  3HT3 A;  4OHW A;  5F3T A;  1S1T A;  4OZ3 A;  3TAM A;  2E9R X;  2AEF A;  3PY8 A;  2XLK A;  2DXD A;  3M2V A;  1DLO B;  3Q86 A;  1H3D A;  3KHR A;  4O0N A;  2DPJ A;  2DGU A;  3DI6 A;  5IC6 B;  3HHN B;  4A8O A;  4Q0B B;  2KYZ A;  3MOJ B;  4ZHR A;  4YEA A;  2RRA A;  4N7T A;  5DM6 Q;  1QUV A;  1ZBT A;  2X1B A;  1VRT A;  1N8R T;  1RAD B;  2DNM A;  3BH7 B;  2O3D A;  1U1O A;  5DLG A;  3PAC A;  3PTW A;  4TY8 A;  4LF6 J;  3UD4 P;  1IR0 A;  3ZNU A;  3W63 A;  2UUT A;  5CYQ A;  1M5H A;  1WI8 A;  1RP5 A;  4IH6 A;  1H98 A;  4TQR A;  3EIC A;  4KGZ B;  3AD8 C;  2MEW A;  1RKI A;  3IAS 9;  2V68 A;  2VPW B;  2YX4 A;  2MXY A;  1QM9 A;  1OYD A;  1IWA A;  1S9E A;  4KFB B;  4KYZ A;  3NXZ A;  1JIH A;  5J2N A;  1KLM A;  1VQS A;  4O3S A;  3SIP B;  2MQQ A;  2MZ1 A;  2R3V A;  3ZTP A;  2IAJ A;  2OMO A;  4DS5 A;  4RW6 B;  2MLX A;  4X4P A;  2KZZ A;  5SZT A;  4FKY A;  4P2X A;  1P8G A;  5DDP C;  1CJK B;  3C3L A;  3F56 A;  1YIJ S;  3MGJ A;  3R6L B;  5DS7 A;  1R31 A;  1NHU A;  1T0T V;  3DHW C;  4NE9 C;  3V6D B;  5HMZ A;  2EC0 A;  4GVB A;  5D3G A;  3MM9 B;  5A76 A;  2KVI A;  3M8Q A;  3K17 A;  2OPS A;  2X3G A;  4USI A;  1DTQ A;  5LSR A;  1UJ5 A;  1A0O B;  4OZ0 A;  2KDO A;  4F7V A;  2ZBI A;  2QN6 B;  2XC9 A;  5HQL A;  1I3O B;  2PT0 A;  2VA2 A;  4C11 A;  2RDI A;  4LVO P;  5J2Q B;  1IBL J;  5HLF A;  1YQH A;  4I6Y A;  3SV3 A;  3MCO A;  2QRR A;  4J9P A;  1H72 C;  3KLV A;  3G6Y A;  2Y3Y A;  2IM1 A;  4B3S F;  1UFK A;  3R6G B;  3E01 A;  4ZN1 A;  4LF4 J;  1CJU A;  4ZVT B;  1RXO B;  4K4V A;  3H4D A;  2KU7 A;  3DRR B;  2R7U A;  4DFJ A;  4ICL A;  5KFS A;  3AH6 A;  2ZJQ Q;  3D54 A;  2IY5 B;  2C1E B;  2PA8 D;  5KFA A;  2FUG 9;  3CDA A;  1D3W A;  3KK3 A;  1S1T B;  1T94 A;  3TAM B;  3RB0 A;  4KH0 B;  1IBM J;  2ILY A;  1BGX T;  4XK8 C;  5B0G A;  1HNZ F;  3M2V B;  1U1N A;  2AGO A;  1VQ7 S;  4NLV A;  3CUL A;  4EGL A;  3DI6 B;  3AOC A;  2D41 A;  1P9Q C;  4ZCI A;  3V6K A;  5LT5 A;  2V2V A;  3DOM A;  4CH0 S;  3LP0 A;  1J5E F;  5A2Q U;  4Y2M A;  4ZHR B;  3AAW B;  1UMJ A;  1UVK A;  1CPZ A;  1S7I A;  1VRT B;  4X65 F;  4NZ7 A;  4EBE A;  4ZPB A;  2ALZ A;  1QAJ A;  3IR7 B;  3RR8 A;  4CLZ A;  3WX4 A;  3VGT A;  1UET A;  2FJB B;  2XYG B;  3TA1 A;  4FYV B;  4C7Q A;  4TY8 B;  4DF8 A;  1HWU A;  2CVI A;  4DV4 J;  3D67 A;  2RIL A;  3C15 A;  5KOW A;  5D4L A;  4UST A;  3GJQ B;  3D2W A;  5CYQ B;  3N6L A;  4DFP A;  3WIV A;  2LDY A;  2VD3 A;  3PCO B;  4IOA Q;  1GEH A;  2DNO A;  1ZA1 B;  4LT6 A;  1ZS6 A;  1R0A A;  2C2R A;  2BJ9 A;  2UV8 A;  1S9E B;  1U24 A;  2Q3P A;  2WVD A;  4J9N A;  4OX8 A;  1YSJ A;  2B43 A;  2BMB A;  2H48 B;  5J2N B;  1DAR A;  1KLM B;  4NXM F;  5B08 A;  5K8M A;  3MTK A;  1S4E A;  4K4T A;  1Q8L A;  2IAJ B;  3SQG A;  3PO5 A;  5HN0 A;  4DV2 J;  5I3P A;  1VC5 A;  4JI1 J;  4WP9 A;  4HTJ A;  3L3C A;  4DL5 A;  2UU9 J;  2HGL A;  4JI0 F;  3QWU A;  5C2C A;  4DR3 J;  1ULR A;  2VC1 A;  1TFW A;  3BSO A;  4OX9 J;  1TUG B;  3OL6 A;  3QGG A;  1UZH A;  3THP A;  2AEJ A;  4AFF A;  3M9N B;  2VU5 A;  4GVB B;  5D3G B;  3NL0 A;  5A8W B;  3C2P A;  4LFB J;  2QO3 A;  3M8Q B;  1B0T A;  2OPS B;  3H8Y A;  1DTQ B;  4PKD B;  3W7B A;  1UVJ A;  4DV6 J;  1VRU A;  1RT5 A;  1LXJ A;  2I2Y A;  1N88 A;  2DGW A;  4P7V A;  1NXI A;  4XDC A;  4L73 A;  3EXY A;  5HLF B;  1YRX A;  5H9E K;  2ATC B;  2Q1L A;  1QAI A;  5CHC B;  1OPZ A;  2EKN A;  5D6G A;  5D77 A;  2HIQ A;  4LSL A;  4KJI A;  3E01 B;  1FTC A;  4LRF A;  1CJU B;  3NNH A;  4HKQ A;  3QGP A;  4V19 J;  4ZDN A;  5EDW A;  2L48 A;  2CFX A;  1ARO P;  4Z7C A;  4NYO A;  2HKE A;  2D9P A;  1VQ6 S;  4D3H A;  4ICL B;  1VBZ A;  1EX8 A;  1U2F A;  3PW7 A;  2F4V J;  2F3J A;  4B3M F;  4DLE A;  4MK7 A;  2GZO A;  3HVW A;  2EI5 A;  5D4N A;  2DR8 A;  4KKO B;  1F0X A;  3KK3 B;  5F0W A;  1OYE A;  5L9X A;  2MQO A;  4DU7 A;  3ELH A;  1TVR A;  2FC9 A;  2HFV A;  3DU5 A;  2EFN A;  2M88 A;  1MML A;  3FQL A;  4ALZ A;  3DOM B;  3LP0 B;  7AT1 B;  4LBP A;  2VFV A;  2DBB A;  2HRT A;  4XIU A;  2FIU A;  2GVZ B;  2FJW A;  2CJY B;  1JB0 C;  2OI2 A;  2BJ7 A;  3KJQ B;  2IMW P;  1U0H A;  4NLU A;  2RS2 A;  1VBX A;  4FF1 A;  2HHT A;  2XB2 D;  5E33 A;  3ZXW A;  3C15 B;  4ES3 A;  4X66 J;  4OZ1 A;  2R2R A;  3DRX A;  1R7I A;  4DR5 F;  5EGY A;  2GQQ A;  1R0A B;  3Q23 A;  4DDF A;  2NXE A;  1LWC A;  1RIS A;  3M8P A;  5DDR C;  3DMJ B;  1R0B G;  1KEK A;  1X31 C;  4IQM A;  1SL0 A;  2ZBP A;  1PBA A;  3AOB A;  1LFW A;  1KVJ A;  1RZM A;  3SQG B;  4IYQ A;  2HHU A;  1FDB A;  2WSC C;  4OI1 A;  2QLW A;  3M9O B;  1S9G A;  2J9D E;  3CJS A;  3S1T A;  1N33 F;  3VTI A;  2V8G A;  3JTP A;  4K4W A;  1N34 J;  2GC8 A;  3GII A;  2HQD A;  4U8Y A;  2E5I A;  1HQ2 A;  2MJN A;  2G1D A;  5BYR A;  1OY9 A;  3GQC A;  2E44 A;  3TVZ A;  3BGO P;  8RUC A;  3HM9 A;  2V0N A;  3RU0 A;  2VBY A;  2H5J B;  1RT6 A;  3DLB A;  3G82 A;  1EQM A;  1Y9O A;  3AXK A;  4EYH B;  1VRU B;  1XNR J;  3TZZ A;  1RT5 B;  4ZCM A;  3BSN A;  3EXC X;  3OSP A;  4J37 A;  4EMD A;  1A9N B;  5F9N A;  3FBE A;  3K5L A;  2DEI A;  2KO1 A;  5C5J A;  3OQ2 A;  3NGS A;  4Q44 A;  5ETT A;  4KT0 C;  2ZH6 A;  4KB7 A;  5ADZ A;  1N32 J;  4LSL B;  4EBC A;  1C4C A;  2QLJ B;  3IM8 A;  4M5D B;  1NJI T;  1WHV A;  3GV5 B;  5AE1 A;  2RIJ A;  3TI0 A;  4U9R A;  3ENQ A;  3EVW A;  3G86 A;  4AQY J;  2ZH8 A;  1GQE A;  3UPF A;  2E7X A;  3NGT A;  4KIA A;  3HHD A;  3F0N A;  3MUR P;  1RCX B;  3W1Y C;  3BGL A;  4UT4 A;  3TYT A;  1J5O A;  1O51 A;  4F02 A;  4LF8 F;  1EKS A;  1N52 B;  2EG2 A;  3THT A;  3I4H X;  2GVD B;  4K4S A;  1FRJ A;  3CSK A;  1JNZ B;  2WBR A;  3G9C A;  4RZR A;  3IBF B;  4ILR A;  2DNG A;  2UVW A;  1SC4 B;  1TVR B;  2VFS A;  1YLX A;  4G6V B;  1NK5 A;  3DOL A;  2ZUG A;  3EM1 A;  5F8J A;  2ZJP Q;  1FNM A;  3KJN B;  5G4D A;  3TUZ C;  4NLD A;  4LF9 J;  4C6A A;  3VR1 A;  4K5S A;  4B9M A;  4A4J A;  1F3V A;  5KFN A;  1BE4 A;  1S5Z A;  1U48 A;  1U0H B;  4YR0 A;  5K5M A;  4DR4 J;  5KG2 A;  2GFF A;  3I6P A;  4DV0 J;  5AXM A;  3CUN A;  2UXB F;  3KJV A;  3ONQ A;  3HVT A;  1ZAV A;  2JEI A;  1HNI A;  2QLF B;  1IKY A;  1HI1 A;  1LWC B;  3Q2T C;  3M8P B;  1QY7 A;  2OPP A;  1OMS A;  2NPI A;  3I96 A;  5D0E A;  3NAI A;  3GYG A;  2PEB A;  2EBE A;  2J6T A;  3A8J A;  3BKU A;  1E6V A;  2M5Y A;  3G4S S;  4Q45 A;  1FDA A;  1S9G B;  2DRB A;  2QIF A;  3HFK A;  1MSW D;  3OL9 A;  1N36 J;  2YVS A;  1BWV A;  3E3X A;  2HMI A;  4ECQ A;  2OPQ A;  4OYZ A;  4N47 A;  3FBC A;  2N4D A;  1TR0 A;  2AF6 A;  2YH1 A;  1MNE A;  1B64 A;  2UXC J;  2PMH A;  4ECX A;  2ZH5 A;  4RW9 A;  3TUI C;  1RT6 B;  5CAB A;  2Z30 B;  3G82 B;  3GIL A;  3D68 A;  1FVS A;  4W98 A;  2HYI B;  2QA2 A;  2JDJ A;  4NCA A;  4FBU A;  3GFZ A;  3ULH A;  2ERR A;  1A7G E;  2OHD A;  1IVZ A;  5KG0 A;  2X1F A;  1TKZ A;  4DX8 H;  2V2K A;  2PEH A;  4FDF A;  3QWP A;  1FE4 A;  5L1J A;  3CB4 A;  3TQ1 A;  1KON A;  9ATC B;  1QAX A;  4K2X A;  3TAR A;  3GYN A;  3QJL A;  3BGR A;  4DL3 A;  2G2Z A;  2D3U A;  2KRB A;  1XWL A;  3M2R A;  1ZAW A;  2DPI A;  2PI5 A;  3X3U A;  2VQF J;  1J5O B;  2H3E B;  3FKB A;  1NND A;  3CO9 A;  2F40 A;  4PG6 A;  5CZX A;  1DQA A;  1GMV A;  3D9B A;  5B0B A;  2OGU A;  4LRC A;  1U47 A;  4OZN A;  4KGM A;  4IDK A;  2ZDP A;  4XO0 A;  4HT5 A;  3K2Y A;  1YRU A;  3DOL B;  3UCG A;  4TU8 A;  4IOC Q;  2NQP A;  2W8K A;  2RUG A;  4IFY A;  4OV1 A;  3TX8 A;  3DXS X;  2HZV A;  3GJT B;  1WG1 A;  5H9F K;  5I4M A;  2HFU A;  2F7V A;  3JYT A;  4JI5 F;  2EFO A;  2I0X A;  3B78 A;  3EPI A;  3PX6 A;  1V3Z A;  1QAY A;  3CCZ A;  3L9Z A;  2ZBQ A;  3CDE A;  3N79 A;  4NLS A;  1K0V A;  2W7A A;  1K8A T;  4WXW A;  2RSQ A;  4LBH A;  5KFB A;  2Q6B A;  1YGY A;  4A47 A;  3HVT B;  4AE5 A;  4LQ9 A;  1T02 A;  2YNG B;  1HNI B;  1CVJ A;  5A2Q Y;  1IKY B;  2AW0 A;  3CPW R;  4H4M A;  3DNC A;  2KL8 A;  2XNR A;  4LUB A;  2OPP B;  1S0M A;  3Q8R B;  3IR5 B;  3MR7 A;  3R7N B;  4KPC A;  1RCO B;  3V5R A;  1E6V B;  4C8L A;  2XMK A;  3KMS A;  2E66 A;  4P7T A;  1JXL A;  4DR7 J;  2BQR A;  1YJT A;  3BN4 A;  3PYD A;  1JLQ A;  2ZM6 J;  2RNE A;  1Y11 A;  4O44 A;  2AQ4 A;  2N7C A;  2HMI B;  2KJV A;  3KUG A;  2MKH A;  3MXH P;  4A8W A;  4TQS A;  3IG1 A;  2OPQ B;  2QA4 G;  1WF0 A;  1Y7P A;  4I68 A;  5GMK a;  3JQM A;  3D6T B;  3S7R A;  1HR0 F;  1RWW B;  4LSN A;  4RW9 B;  4WF9 Q;  1LW0 A;  1BQN A;  4LMZ A;  1EAR A;  4WII A;  3FCW A;  1NJW A;  2G2Y A;  4G1I A;  5IS2 A;  3TUJ C;  2J7K A;  1C0T A;  2K8G A;  3J7Y I;  5ITH A;  2ASD A;  2FJE B;  2YQ1 A;  5GAD U;  4PEO A;  4PZV A;  5DDO C;  4HL9 A;  4OLO A;  1TKZ B;  2CQ4 A;  3TVK A;  2D9O A;  4DMZ A;  1T05 A;  1PSD A;  4ZLJ A;  2GO8 A;  4TLQ A;  1U4B A;  1Q79 A;  4Y28 C;  3BGR B;  3G8T A;  2C3O A;  1GX5 A;  1FD2 A;  2ZH4 A;  1HBO A;  3FRZ A;  1V5V A;  3NAH A;  1X5T A;  4JI4 F;  2BW7 A;  3NGR A;  1RTJ A;  5CD4 A;  1UEK A;  3H90 A;  4KGV B;  5E3Q A;  3KKF A;  3RG6 A;  1LQ9 A;  2VC0 A;  4CIO A;  4ES1 A;  2B7B B;  3BSC A;  1WEX A;  2XMA A;  4CO4 A;  2AZ3 A;  3HJF A;  3W5X A;  2J7U A;  3J7A 1;  4DPU A;  4P73 A;  4IDK B;  1G1X A;  2RE1 A;  1N6Q A;  2JLG A;  4ZP9 A;  3BO3 A;  5LXR A;  2R7S A;  3SV4 A;  1VJQ A;  1ZM9 A;  4F67 A;  4IFY B;  4RW4 A;  5LMU J;  3JAM Y;  2KFN A;  3HSD A;  3ILI A;  3JYT B;  1S12 A;  1Z4U A;  2AGQ A;  4QIV A;  5B0C A;  2Q6C A;  4U7C A;  3IAM 9;  5EUH A;  3N01 A;  1IBK J;  5LSL A;  4TU9 A;  5KG5 A;  3P6Y C;  3HZG A;  4UZB A;  3OXL A;  1NK8 A;  3MM5 A;  1NHV A;  5JUM A;  2GAG C;  3D1Q A;  6FDR A;  4QR1 A;  4H4M B;  4ED8 A;  1UW9 A;  1GH8 A;  4ZPW R;  4JUZ A;  3R5D A;  1Z1Z A;  3NOC A;  1NUE A;  5I3U A;  3K8V A;  2JVO A;  3LAK A;  3PIP Q;  1NH8 A;  3IRX A;  1YJU A;  2DIT A;  2DY9 A;  3D3B J;  3CCS S;  4UQG A;  1TUW A;  3HSG A;  1JLQ B;  2UUW A;  2HWH A;  1TFY A;  3NS5 A;  4O44 B;  3ZZY A;  2DGX A;  1ZOT A;  2DR6 A;  3IG1 B;  1R89 A;  5LXY A;  4FF3 A;  4B9S A;  3BBC A;  4MYU A;  4ZVF A;  3V4I A;  3LA0 A;  4K8R A;  4J5O A;  4IFV A;  3I55 S;  2CNK B;  2VDH A;  1SIZ A;  2Y1L B;  4HH0 A;  4EUV A;  4LSN B;  3G96 A;  5KT4 A;  1LW0 B;  1HWK A;  2ZNZ A;  1BQN B;  1EET B;  2HQ3 A;  2M3D A;  3RZA A;  4IQX A;  1AUS L;  2XO6 A;  4WFN Q;  2ABY A;  3PRD A;  3PYG A;  1C0T B;  1FFG B;  2QGF B;  3MMA A;  3QFW A;  2DEJ A;  1F9F A;  1U2R A;  3QLH A;  1D9F A;  1Q5Y A;  4DUZ F;  1KOO A;  2B56 A;  4NML A;  1LV5 A;  5CA5 A;  4K4Z A;  4NI2 A;  4I7F A;  1SUQ A;  1YWX A;  1T05 B;  1U6Z A;  1SQE A;  1FX2 A;  4I4B A;  3B6B A;  1S1V A;  1R6V A;  4ED0 A;  2KN4 A;  2MZJ A;  2BJE A;  1KFS A;  1UVI A;  2R2S A;  2BE9 B;  1HBO B;  1H74 A;  2DK2 A;  2DHS A;  3MR2 A;  2C2N A;  1RTJ B;  2WHO A;  1F1B B;  1RTH A;  3MD1 A;  1N5Y A;  4JI3 F;  1VC0 A;  4PG8 A;  4G1P A;  3DU6 A;  4JI8 F;  4NA1 A;  4KAI A;  2DHG A;  1CC8 A;  1RBL A;  1N6Q B;  1GXT A;  2CPZ A;  2G1H A;  2OH2 A;  1RWU A;  2ZE2 A;  1RWO B;  3D6F B;  2KXF A;  4AD6 A;  3PVX A;  3GP9 A;  4NLW A;  1X4H A;  3J7Z T;  1RTZ A;  2PD1 A;  3K8W A;  1H0H B;  4RW4 B;  9RUB A;  3T1Y F;  1NU4 A;  2FJX A;  2EFG A;  3PJW A;  1UTA A;  4WJB A;  4RBV A;  5KFU A;  3MCM A;  4DL2 A;  3OFF A;  1VQ5 S;  3PXG a;  1MWY A;  3PEJ A;  4WP8 A;  3J81 j;  2IVY A;  3GV7 B;  2CA9 A;  3DLG A;  1TP7 A;  3MM5 B;  4I0W A;  4CDI A;  3HI9 A;  5AXN A;  2ZC3 A;  3VF0 B;  2HIY A;  1KOH A;  1C1B A;  5IT4 A;  1L3T A;  1HNZ J;  2E29 A;  4LF2 A;  4ZCL A;  5I3U B;  1T9X A;  2HGN A;  5IWA F;  4WYW A;  3VGS A;  1HL6 A;  4CLW A;  2AX0 A;  3IRX B;  2UZA A;  2JRS A;  2QA4 S;  1T95 A;  2Q79 A;  1HBU A;  3Q89 A;  2XSF A;  1JLA A;  3R2C J;  4JV0 A;  1FJG J;  2KHD A;  3QZ8 A;  2ZHB A;  4QIF A;  3G6E S;  3V4I B;  1YI2 S;  5RUB A;  2L41 A;  3TZW A;  4A8X A;  3VAK A;  2ZNY A;  3RGI A;  1WTF A;  4IFV B;  2UUA J;  2HVE A;  1S99 A;  2FVR A;  2XLJ A;  3T6J A;  2SXL A;  1URR A;  1BC6 A;  1B7Y B;  2C28 A;  3W9I A;  4OL8 A;  2UV8 G;  3M05 A;  3D28 A;  1U1P A;  5GAG I;  2WON A;  3MMA B;  1UAW A;  5KFK A;  2C2E A;  4USM A;  1TTH B;  3QLH B;  1TAU A;  4PPD A;  2P6S A;  4LJM A;  4NI2 B;  4JOU A;  4I7F B;  1SUQ B;  3MMJ A;  1SJF A;  2V9K A;  5ETS A;  1KTQ A;  1HNW F;  3OW2 R;  3G6V A;  3D6H B;  2IIH A;  2HQF A;  1WUU A;  4GKJ F;  4JI6 J;  2XGQ A;  5L1L A;  1S1V B;  1X4A A;  3TAN A;  2M8D B;  3N5B A;  2E5L F;  4P71 A;  4N8O A;  3H2L A;  4O3Q A;  3M6V A;  1Y10 A;  1RTH B;  4ZMM A;  4DR1 F;  1N5Y B;  5F8L A;  3CCR S;  1JLC A;  5ETM A;  3MFI A;  1CBK A;  2V2Z A;  1S48 A;  2W9C A;  1VQK S;  2HQI A;  2IJN A;  2OUG A;  1WWH A;  3UWT A;  2DH8 A;  5B0D A;  3KWM A;  2XTJ P;  1NME B;  4FPR A;  2ZE2 B;  5KTQ A;  4CLL A;  5B0F A;  3A3N B;  3FSI A;  5HL7 Q;  2Z2M A;  4C9D A;  4B3T F;  4OMF G;  4DL6 A;  1IM6 A;  3ICL A;  1W26 A;  5HI7 A;  2FLP A;  1NDC A;  3OLA A;  4OLP A;  2HW3 A;  3BZQ A;  3PEH A;  3GG1 A;  1GX6 A;  4W90 B;  2W2N P;  1IWG A;  2IA6 A;  3EGW B;  3W5Z A;  2X7I A;  4URQ U;  1IR1 A;  1RU1 A;  1VQ8 S;  1YHQ S;  3T1H J;  4HDH A;  2HHH F;  2FB0 A;  3DLG B;  1Y3J A;  3PHE A;  3OVA A;  2W4D A;  2IDL A;  2MJU A;  2WW8 A;  2J9D A;  1R8A A;  2FHJ A;  3BBB A;  4FYY B;  1S79 A;  2B0G A;  3KK2 A;  4OI0 A;  1C1B B;  2ZHO A;  1VQO S;  2FC8 A;  3BSA A;  3F41 A;  4X62 F;  1LXN A;  4N8N A;  3QJJ A;  2GIQ A;  4ID8 A;  1HBU B;  3CCL S;  2HAF A;  1U1M A;  3H5S A;  4FN5 A;  4G1Q A;  4FYW B;  1JLA B;  3WHI A;  3PJX A;  3QRQ A;  4EZ6 A;  2NR0 A;  3WBZ A;  4LRD A;  2E5H A;  3UDL A;  4USJ C;  3R5B A;  4FXD A;  2U1A A;  1WOR A;  2DXE A;  4PAB A;  3MOZ A;  3GFH A;  2BBE A;  4X4R A;  1YKW A;  4P2M A;  3FVY A;  1HD0 A;  2OJ3 A;  2MB0 B;  4QIE A;  2NUU G;  3KHL A;  2DGS A;  5B09 A;  2B4V A;  3M8Z A;  2C42 A;  3AY0 A;  2KFZ A;  4DZ6 A;  5CCM A;  2WON B;  5DRK A;  2V5H G;  2EVZ A;  2HS3 A;  3IWN C;  3CD0 A;  4EO6 A;  2AYG A;  3CJ8 A;  4ZPT R;  3BDP A;  1X4B A;  1XBW A;  3R2D J;  3CCW A;  4MH8 A;  3DYA B;  1PYT A;  1LK5 A;  4L72 B;  2CQ3 A;  1F5B A;  4OZ5 A;  3NGK A;  4CLK A;  5FDL A;  3T5K A;  2IRU A;  3MEK A;  4OHY A;  1PCA A;  3BDE A;  2ZBR A;  2RU3 A;  1S7H A;  5GME A;  2FY8 A;  2P8I A;  2AD9 A;  4CH1 A;  3RAM A;  3MPW A;  1JLC B;  1YJ7 A;  2W9C B;  1WTB A;  5K9F A;  4Q5V A;  2PN6 A;  1FJE B;  2RQK A;  5CD4 H;  1Q81 T;  3UCU P;  2CVE A;  4IG3 A;  3NWR A;  2UXD F;  3A4T A;  1UJ6 A;  2RJZ A;  3FC9 A;  3WDO A;  3CCJ S;  1SH3 A;  5KFR A;  4M5I A;  4FNI A;  2DIV A;  3Q22 A;  2C2O B;  2HFN A;  2HHP A;  3BQ0 A;  1C0U A;  1VR6 A;  4RBU A;  1DZ5 A;  3G8S A;  1QDU B;  2OEK A;  3A12 A;  4I64 A;  5J2M A;  3J7Z 5;  5T14 A;  2YTC A;  3MAQ A;  1L3S A;  2Y1R I;  3TEG A;  5ETO A;  5LMN F;  4BHQ A;  1XC9 A;  2XMW A;  1IJE B;  2DNN A;  2DR9 A;  1GMW D;  2C2K B;  3BEG B;  2WVB A;  4C8M A;  4CRJ A;  3OVS A;  3ENA A;  2GHP A;  5L38 A;  3DLH A;  5CQG A;  1Q4R A;  3I87 A;  1VBK A;  2QSF A;  3P5T L;  5KFG A;  3VVT A;  1D09 B;  3KDO A;  2CAD A;  3RTV A;  1VIS A;  1YVF A;  2BM1 A;  4TYA A;  4I1T A;  1QSY A;  3SMZ A;  3K58 A;  1CC7 A;  3IN5 A;  3QAU A;  1VQN S;  3SSS A;  4C3K A;  1GAO A;  4NLR A; 
#chains in the Genus database with same CATH homology
 1LEO A;  2DY9 A;  2ZUA A;  1NSP A;  3GPA A;  1PAE X;  1BHN A;  3B54 A;  3PJ9 A;  4FKX A;  3EVW A;  1UCN A;  3ZTR A;  3ZTS A;  1NSK L;  3WX8 A;  3L7U A;  3NGT A;  3VGU A;  4EK2 A;  1K44 A;  2VU5 A;  1S59 A;  1W7W A;  3ELH A;  3EVO A;  3ZTQ A;  1LWX A;  1S57 A;  4AND A;  1F3F A;  3FCW A;  1PKU A;  3EIC A;  3FCV A;  3VGT A;  4DZ6 A;  2AZ1 A;  4DI6 A;  3FBF A;  1WKL A;  3BBC A;  1VYA A;  1U8W A;  3VGS A;  3EVM A;  3DKD A;  3PRV A;  3ZTO A;  2DYA A;  2B8P A;  1JXV A;  3VVU A;  4HR2 A;  1B4S A;  1XIQ A;  3EMT A;  4ANE A;  1WKK A;  2CWK A;  4F4A A;  3JS9 A;  1HLW A;  3Q89 A;  3BBB A;  1F6T A;  1KDN A;  4CP5 A;  3Q8V A;  3ZTP A;  3DDI A;  3VGV A;  1NHK L;  3GP9 A;  1XQI A;  5C7P A;  2DXD A;  3FBB A;  3FKB A;  1ZS6 A;  4ENO A;  3Q86 A;  1NSQ A;  4F36 A;  3ENA A;  4O0N A;  2BEF A;  4FKY A;  3Q8U A;  1NB2 A;  3EM1 A;  3Q83 A;  2NCK L;  1MN7 A;  5IOL A;  4WBF A;  3VVT A;  1NDP A;  3FBC A;  5CAA A;  4KPC A;  2HVE A;  4C6A A;  1B99 A;  1HHQ A;  4UOH A;  1NLK L;  3MPD A;  5BXI A;  1NDK A;  1EHW A;  3BH6 B;  3NGR A;  1NDL A;  1NCL A;  1MN9 A;  1HIY A;  4UOG A;  1BE4 A;  2DXF A;  3FBE A;  2B8Q A;  1S5Z A;  3NGU A;  3ETM A;  2BX6 A;  3Q8Y A;  3B6B A;  3R9L A;  5CAB A;  3G2X A;  1NUE A;  4UOF A;  3BH7 B;  1NDC A;  3NGS A;  2DXE A;  4W98 A;  2HVD A;  1WKJ A;  4S0M A;  3BBF A;  1NPK A;  1BUX A;  3EE3 A;  2HUR A;  4ANC A;  2AZ3 A;  3FC9 A;  3EJM A;  4DUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...