1LXJA

X-ray structure of ybl001c northeast structural genomics (nesg) consortium target ytyst72
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL 11.5KDA PROTEIN IN HTB2-NTH2 INTERGENIC REGION
publication title CRYSTAL STRUCTURES OF MTH1187 AND ITS YEAST ORTHOLOG YBL001C
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lxjA00
1LXNA 2EKYA 2IBOA 1S99A 1YQHA 1S7HA 2EPIA 1VK8A 1LXJA 1SBRA
chains in the Genus database with same CATH superfamily
3B82A 3Q8YA 1WC3A 1WSVA 1Z2ZA 3BSNA 1SL2A 1F5CA 5KFMA 2BE9B 2HHVA 5ETSA 4NCBA 2QLBB 1QTMA 3GV7B 4CO4A 2O5DA 2W4DA 4DX8H 4U6PA 3M7VA 5L8RC 3HLUA 2HRTA 1JLCB 4IG0A 1VQPS 1WKKA 1CC8A 1FD2A 4DR1F 3CULA 2QL5B 2QSFA 3VGSA 1F3VA 5B0AA 4FF2A 2ILZA 2HFSA 1ITPA 2FLLA 2AEMA 3N9UC 5H1SV 4C4WA 1NB2A 3Q8PB 3UVJB 3ZC4A 4DR6F 4I69A 3QRRA 3SCJE 2UU9J 4ZVUB 4AL7A 3VGVA 5BXIA 1UP1A 1RU1A 1Z1ZA 2V0NA 1GXUA 1EKRA 1ZOTA 4B3TJ 1OSCA 3G6YA 5CZVA 2RUGA 2E5LF 1EP4A 2E9TA 2HVIA 3NNHA 4ED7A 2C22A 2ZVIA 1FKAF 3MZIA 3ZTQA 1BLUA 3OTOF 1TVRB 1TUVA 1YJTA 3KK2B 1NJYA 2EFQA 3DRSB 4OHXA 1RUSA 2J0SD 5HQMA 2RS2A 3ENWA 3ZO7A 1U47A 4M95A 5K8PA 2B5JA 5KG6A 3DLKB 2EEYA 5KFBA 3GQCA 1VJQA 1D9FA 1MG7A 2IC3B 4EYHB 5L39A 3AOCA 4FN5A 4HLBA 2HFUA 2IDEA 1XTZA 4FYWB 1S9FA 5E7OB 2KKHA 1TL3B 3IXQA 2HVDA 3AJ2A 4EYIB 1Q81T 3IG1B 3T6JA 2MHEA 1MW7A 3GIKA 2ACYA 5CYJA 4KRWA 4ANCA 2W24A 2X1AA 3MD3A 4DU7A 1WORA 5LMNJ 3EICA 4OJ3A 3MOZA 3OXLA 5U47A 4JI5J 3FSYA 3OW2R 4ED0A 2XSJA 2YX1A 2H5EA 1W26A 4NMLA 1RKIA 5LXYA 4RL1A 4N8OA 2F7VA 2GJ2A 4TY8B 2JVRA 2OUGA 1S59A 1YQHA 4LRCA 2VKRA 2RRAA 4ER8A 4Y00A 2LXFA 3M2VB 5BR8J 3DMJA 3PYGA 2QA4G 2PD1A 4DF4A 1NKEA 1DTTA 5IM0A 3PX4A 2WW8A 2XB2D 3UN3A 2P8IA 1GFWB 4NCGA 5ETRA 2C1EB 3IO1A 1DTQA 2ZDPA 2DGSA 4ZITA 3I56S 4NX9A 4A8SA 4LF8F 2M8HA 1SJRA 2HGNA 4UT4A 4AT1B 4MKBA 3NS5A 1IBLF 2MGZA 3D0IE 5KTQA 1CULA 2KG1A 4MAKA 4WE1B 1S4FA 4DR1J 1A0OB 5KT4A 5GMEA 1ZM9A 2VJUA 1IBMF 1Q95G 2AX0A 2IRYA 2IMWP 3PHTA 4HDGA 2XZDB 2XO7A 2DNZA 4QYRA 5KAKA 4Y3CA 3KLEB 1UEVA 1RU2A 4DR6J 1EQMA 3CCZA 5KT7A 1TKTA 2QZ8A 1DJ0A 1X4HA 2LECA 3C19A 4ED1A 1NK9A 4W92B 3TX8A 1IVZA 4QYZJ 1D1UA 1HLWA 2AKWB 3BH6B 2CPFA 2E5LJ 1TUGB 2FC9A 4PWDA 4IRKA 3T1HF 1UFLA 1HNXJ 3CMQA 5BJRA 2VPZB 4KQZA 1R0BG 2KHCA 2GZOA 1S7HA 2AEJA 3WDOA 2D41A 5AXMA 5HROB 3OTOJ 5A8KA 4ZVRB 2RHQB 5ETLA 1FRXA 4KB7A 1G2EA 4WCEQ 5D3GB 1HQUA 4ZCIA 1RWKB 2MQ8A 3KKFA 3KLHB 1YLXA 4OV1A 4RX6A 5E3QA 5KFRA 4QIFA 3MMBB 1YJNS 4CYUB 1KFDA 3EYZA 4EBCA 3M9OB 5IS2A 4X4OA 4QWEA 4DPOA 5LSLA 2LDYA 1N88A 1TR0A 4GKJF 1O6XA 3PW0A 2CQ2A 1MMNA 1IKWB 2QO3A 3FC9A 1CJVB 3TUJC 4RKUC 5DJBA 3HHLD 3SYZA 2E5IA 1GMVA 4K59A 1R6YA 2HW3A 4KKOA 4ZPDA 3HCXA 2DJWA 3MM7A 3UN5A 1ZAXA 3GYGA 1QSLA 1LWCA 4GMKA 1RAFB 4UW2A 4UZBA 1PSDA 1QM9A 4NLOA 4WFAQ 4LVOP 4GO7X 2EPIA 5CXTA 1C0UA 3NRBA 3G96A 3TWZA 2KT3A 3KHLA 4A8MP 2V9WA 1RT5B 5GMDA 3AAWB 4FF4A 1D3WA 2H5JB 2XMMA 2EK1A 2J7UA 4P71A 1NSPA 3DU5A 4PEOA 2FQQB 3T3FA 4DR3F 3UDCA 2HAFA 2XI2A 1S6PA 2F9JA 3AA8A 2A1BA 3QGHA 4CTAA 4YP3A 4QW9A 2M3DA 1RHQB 3NAIA 1Y10A 3TAMB 2OTJS 2HRUA 2V68A 4IQXA 2L41A 3S7RA 4ES1A 1PC5A 1RYSA 5A0YB 4LF8J 3O44A 3MM5A 4X66F 2ZC3A 4K7QA 2BQRA 4ELUA 1S1VA 3R5DA 5MLCV 3M8SA 1O0PA 6FD1A 3MAHA 2HYIB 3KLIB 4DS4A 4KV8B 2CRLA 4KHPJ 3GSIA 1IBMJ 5EN1A 4HI1A 2BYCA 4URGA 4UUXA 4KSEB 1HBMA 1TELA 1RBOB 3PM9A 1NO8A 3J7ZT 3KMSA 2R2UA 2VG7B 3PKMA 1HBOB 1HWIA 1DY3A 1Y5IB 3C6TB 1J5EJ 3ILLA 2FC8A 3CO0P 4X62J 4OZLA 1HNIA 5KFNA 1S99A 4DSEA 1TL1A 1AUDA 2BKNA 3WBZA 3SQGA 4DX5A 3MGJA 1UW4A 3LGHA 2QSWA 2H48B 4PR6A 4AE5A 3RBZA 4JV0A 4KT0C 2DITA 1WELA 2KXHA 5GAHI 3ZZUA 3T6BA 2H4YB 3DLEA 5J2NB 2PGCA 2W2PP 2HIQA 4I6YA 3TI0A 5AE2A 1NHUA 3K57A 1TV6B 5JVHQ 3CCJS 5F0WA 1UFKA 3CO9A 3HHLA 3LH2S 4L3NA 1P27B 4M5MA 3HVRA 2XULA 5D78A 2JOQA 5EWEA 2V4JB 5B0DA 1X31C 1AFIA 5B7WA 3NBPA 3IBCB 5FDLB 3DRPB 3HHEA 4CNZA 3KG0A 2NREA 2ZOFA 1CG2A 2R7XA 1PYTA 4Y2AA 1U1OA 1FKPA 3AB2B 3JYTA 1NDCA 3KNAA 2XCPA 1ZM2A 2IVFB 3I5AA 4E8UA 3TVKA 3JS9A 2R8KA 4F4XA 2VONA 3I4HX 1L3KA 1U49A 3M8PA 2YWEA 3WC2A 5J1EA 4ZHRB 3BREA 5DQHA 1QJHA 2OFHX 3CJKA 3R6GB 4A47A 2WVEA 4LVNP 2B8QA 3F41A 4LF6F 4J9KA 1UWBB 1S0VA 1S10A 2YNGB 4B9TA 5G4DA 2W9BB 3CDUA 1SJ1A 4Y6IA 5A6PA 4JOUA 6AT1B 5D15A 4FBTA 2CJXB 2M52A 4IFYA 1SXLA 3CD7A 1Q16B 3QPIA 1B0PA 1SJFA 1Q8KA 1QE1B 2CUYA 4RW4A 2C2NA 2VFTA 1T9YA 1LK5A 3HT3A 1KP6A 2QGFB 2ATCB 2XM3A 1KDNA 1U25A 4O3SA 3IBWA 4C11B 2H1YA 2QA4S 4O3NA 1WHYA 2RVJA 2GC8A 1PJ6A 2CYYA 1VQ4S 3CJ8A 4Q2MA 1TK5A 1N4LA 2RD5C 1LQ9A 2KFYA 5IXUA 2JFDA 2F40A 2YWWA 3OSNA 5DG8A 3CCRS 4IH7A 5DM6Q 4P72A 3K89A 3MPYA 2Y1LB 5LMUF 2P9CA 1ZZNA 4ZP8A 1JJHA 2F65A 1FJGJ 4R5PA 1EQ0A 2NUUG 2BJ7A 4AQYF 1UVNA 2PFDA 2HLTA 3VF0B 2IIHA 1RTZA 1QAXA 2GVDB 5K14B 1VQNS 4RW9A 2LA4A 3M6XA 2VQFJ 1LK7A 4WZMA 2FHMA 1D9DA 1DARA 3AXKA 4JI6J 1RHMB 2PI5A 1TKXB 2DD8S 3CT9A 4L73A 4ZPWR 5E41A 2BJ1A 2UZAA 4WF9Q 1S6QA 2MKIA 2XMUA 2PFFB 3AQOA 4CDIA 2C3YA 4FF3A 4F4AA 1NPKA 4EFAC 2GMLA 2RQMA 4J37A 4Q0BB 4DV2F 2E5GA 2F4FA 1X8DA 2BRLA 5D6GA 4J9QA 4RWWA 1YJ7A 1O51A 2DCUB 5E33A 2J6TA 1YTYA 1SB6A 1AFJA 4N47A 1NU4A 2N4DA 1U2RA 2DNOA 3LQVA 2AGOA 4ANDA 3NCQA 1SJQA 4MKYA 1XNQF 3PJXA 2ALZA 2QYCA 1YJVA 3K0JA 5GAGU 1L3TA 2C3MA 1F5AA 4A8FA 2K2PA 3M6WA 1VC5A 4PPDA 1F9FA 3RBXA 4X4UA 4NASA 4DV6F 1RI7A 1VQLS 4OI2A 1RWWB 1DLOA 1S1WB 3G8TA 1P9QC 1ZH5A 2HNYB 3NGSA 3OR1A 5E2QA 1U6FA 1Q5VA 2DIUA 2CJAA 1YBUA 2QLXA 4LF6J 4UY85 3Q83A 2CWXA 5D0EA 2HMIA 3IP0A 1AZSA 1NH8A 5DETA 2G2YA 3CSKA 1K47A 5HBMB 4LJMA 1Y00A 4JYAJ 3IWXA 2H9ZA 4BBYA 4WP8A 2KVIA 1IXKA 1T8EA 2R7VA 1KQSR 2FJEB 4PG6A 1I51B 1XQIA 4P2FA 4PQUA 2CNKB 4NLDA 3KK3A 1SKSA 3DDIA 4MK9A 3G87A 1QDUB 2JWNA 3DYAB 1N33F 3BGLA 4WBFA 2UUAF 3CD0A 1IKYB 2DR5A 3GU0A 4IO9Q 3LP0A 1SKUB 2ADBA 3NKYA 4RU9A 5T7LA 2WOMA 4IQMA 3GFHA 2KRRA 5F0UA 1HYSB 2UXCF 3ZZTA 2GX8A 3TANA 1HARA 4YS2A 3W3SA 1KD1T 2FJAB 3M1VB 2VA3A 1JJCB 1X9MA 2LA6A 3QJPA 2WBRA 5LMUJ 4ETZA 1Q4RA 4YMEA 1Q0NA 2VG5A 3HHLC 4YR0A 2DGQA 1IQTA 1U1PA 3TUPA 5ETVA 5HSPA 4AQYJ 4ELVA 2D3O1 2DR8A 4IG0B 4MK8A 2ZH5A 3X3UA 1J2VA 1UCNA 3GIJA 2YX4A 1GNKA 2JDJA 2MQQA 2GQCA 1PAUB 1U0HA 1UEUA 4O4RA 2V6AA 5C2GA 4RBVA 4WFYA 2C3OA 4V1Ak 3RB4A 4NLWA 3PEHA 1K8AT 3AOBA 5F8LA 3J7YI 4I56A 3I87A 3CDAA 3CMAS 1HBUA 1K1QA 4LF7F 2LP4A 2JLFA 1CC7A 2EI5A 1X5PA 2XMWA 4C8NA 4DV2J 2ZWPA 1S9GA 2J8SA 3S1TA 5FIIA 3VAJA 1JX4A 1NJIT 3HHDA 3J7AN 4RNMA 4FYYB 4ZPVR 3G6VA 4I0WA 4DL4A 5KFVA 3IWNC 2F8HA 4CRJA 2PIIA 1LNQA 4DV7J 3Q8VA 3WIUA 1WWHA 3EGZA 4LF2A 4OQJA 2W01A 1IBKF 3LPEA 2D3ZA 2OP5A 4BC9A 2VDIA 2JEIA 4OX9F 1XNQJ 1QTNB 4U95A 3EZ5A 1YJWS 4K4TA 2UXDF 2I2YA 4AL5A 4LFCF 2CNNB 2YNFA 1F9HA 4DCPB 2B4OA 2BW2A 2PDAA 4F2SA 2E5HA 1VHIA 2ADCA 1V5VA 2B5JB 2VASA 1H98A 4ZCLA 4ZCKA 1IBCB 3AD7C 3CC7S 1B0TA 1MLAA 4DV0F 3AJ1A 1KWMA 1YI2S 3T41A 4DUTA 2J7KA 1MSWD 3N5BA 4DCJB 3QATA 2GHWA 3LANA 2NR0A 1M5KC 3DLHA 2HHXA 1GXLA 2DTJA 2MTLA 3CGIA 4DZ6A 3W62A 2UUCJ 3OTCA 2BJ3A 4I4BA 2WVBA 3GONA 2OPSA 1M1GA 2AJ1A 1S76D 2ZBCA 5D4OA 2BOAA 3DLJA 3M32A 1NSAA 4EZ9A 2H3EB 2WONA 3AB4B 2L9WA 2FHJD 2ILYA 5IT0A 1DBDA 2FGOA 5CD4H 3EE3A 1WC5A 1RQ0A 1BD6A 2DR6A 3G9CA 1N33J 1UZHA 2WVFA 2Q1LA 2XGPA 4ZCMA 2H5IB 5I4MA 4ECZA 1YBAA 5HVHA 2FZGB 3NAHA 3KHGA 4NEYA 3QIPA 2ATLA 4NLQA 2E1PA 4OHZA 1OYDA 3DMJB 2OHDA 3GCXP 2FB0A 4V19X 3HSZA 3L7OA 2H4WB 1DTTB 4RO0A 2NSBA 5IM0B 1S1XA 4JI8F 2HQDA 3P5BP 1G1XA 2MZQA 3PR5B 4DR2F 1HNZF 4NCGB 1DTQB 3B54A 5E0OA 1BQMA 4NLRA 4AUKA 2KN4A 4PXDA 4LF5F 2ZHAA 4F25A 1JLAA 2PE8A 4FKXA 3CDEA 2MGZB 3TEHB 1PC4A 3LGNA 1S12A 1RT1B 4DPYA 2G4BA 1CQMA 1Y11A 3B6BA 1KN6A 2ZEJA 4Z7YA 1LKZA 4G1QA 4ZN3A 3HVTA 3DCAA 4JV5F 3FRYA 5G0RA 3MM8A 1N0VC 5KG0A 3P3DA 1AXQA 1TKTB 3OFHA 1UVKA 3EVOA 4K4WA 2CA9A 2FJWA 1YZ7A 2EFPA 2ZBIA 4BC7A 3KHRA 1IN0A 4LF7J 5KFJA 4X65F 1OPZA 2DBBA 2VKZG 4C2MA 1RTHA 2KL8A 4YOEA 4PWDB 4ETXA 4IO1A 3MDFA 3K17A 5A6WA 4HR2A 1HNWJ 3O3LA 3NGUA 1VQYA 1JMTA 3SSSA 3PHEA 2KJWA 4RWXA 3O1LA 5J2MA 4OX9J 1BHNA 5A8KB 4RW8A 3W2WA 2I6WA 4RJVA 1VYAA 2BM1A 1HQUB 4JI4F 4B3SF 4Z37A 2Y0SD 1RABB 2HFNA 1XEZA 3CNQP 3AHPA 4OZNA 2HQ3A 2KXNB 2RILA 3ENQA 1ZM3A 2LLZA 3K5LA 4KYZA 4K4SA 4FVMA 1RK8A 2LQ8A 3VR1A 3CJ5A 4OI0A 2IPOB 4WFZA 3C15A 2XLKA 1VS3A 1RISA 3JAMY 4O44B 2ZH6A 4YY3F 3ADAC 2GAHC 1A7GE 4URQU 3EVMA 1RTJA 1S9EA 4URSA 2HQIA 5AXKA 1Q5YA 2DRAA 2FHJA 4K0KF 1KOOA 1GEHA 1X9SA 4OZ0A 4KKOB 2EC0A 3U27A 2FHKA 1OO0B 3MM7B 4JI0J 2ZH3A 2XGQA 1N32F 1LWCB 3R3TA 2FIUA 1OYEA 3CIZA 2ZZNA 1HA1A 5CA5A 2IM1A 2WSEC 2I1RA 3BGRA 2HK2A 2VF3A 5LOQA 1PAEX 1FRJA 1Q79A 1X4BA 3A8IA 1FRKA 2M88A 2ASYA 3BDEA 2YWKA 3VAHA 2DRBA 1YJUA 3VCDA 4NRUA 3PG9A 4Y2IA 1U1KA 1S6PB 4ZPCA 1TKZB 2DRDA 2Q6CA 2DGXA 4HHUA 4CTAB 2MKCA 2OMOA 3D1OA 3QZ8A 3T1AA 3G82A 3A8EA 4OJGA 4ITSA 4DSFA 4P73A 4DF8A 3GIMA 2CFXA 3W5XA 1N36J 5M2UA 4XDCA 5KOXA 1S1VB 4PG5A 1YSJA 1K0VA 4IH6A 1FD8A 1ZETA 1SL1A 2K8GA 4CI0B 3RAXA 1CJTA 3MI7X 3BQ1A 1K9MT 3LUYA 2VICA 3DOKA 3MPUB 4A8OA 3NGDA 3IM9A 3KK1A 1EX8A 5C5JA 3BB5A 2IFXA 3EXCX 4DLEA 3PY8A 1HBMB 4BWJA 5H9EK 2CWKA 2P6SA 1B99A 3MEGA 3TO8A 3V81A 2LU2A 1RAAB 3BO3A 3SDEA 2CZ4A 5F41A 5L1LA 4ZKAA 5ETKA 3KUEA 5LXRA 1U2FA 4X65J 1TK8A 1HNIB 1Q8LA 3OHAA 1WEXA 2GCFA 3B8HA 2PA8D 3M8YA 1TL1B 2M8DB 3C66A 3JTPA 3SQGB 4WK1A 3ZFVA 1TZ0A 4YB5A 5AJ3J 2G2ZA 2XO6A 3IR6B 2V8DA 9ATCB 5AT1B 3CJ0A 2C2DA 3P96A 3LWMA 5JUMA 2ASLA 4TLQA 1IUJA 4CH1A 4CM0A 4MFBA 4CLTA 3DLEB 1YGYA 4Y2KA 1GT8A 2VU5A 3G2XA 4ZP7A 3HKZD 1WG1A 2IVMA 2M70A 1T9WA 3G6ES 5GVQA 2XLIA 3HHLB 4M1KA 3R5JB 3W1YC 1M5PC 4ZLLA 1PJ5A 3RRGA 2O01C 1VBYA 5HMYA 4F3MA 2HZCA 2C2MB 2C2OB 1FWKA 2XYPB 4F36A 3NBPB 1RCXB 1L3UA 4Y2MA 2DNKA 4HVZA 1LWXA 1FKPB 2DH8A 4G1IA 1ZPVA 5T41A 4PABA 3JYTB 3O5TB 1N5YA 4ZDNA 3CVKA 1CS4A 3L95X 2P6TA 1JNRB 4XIUA 2V4RA 4OX7A 3CJRA 4UQTA 5F8HA 3QMQA 3JQMA 3ILJA 2D69A 3TAPA 3M8PB 4X4TA 5J1EB 5L1KA 4A4JA 2CADA 3VHQA 4QJVA 2YKOA 4CLKA 5DLGA 4KE5A 3C3LA 3Q8SB 4WFBQ 5GMKa 3HPOA 2D3UA 2HHPA 2FZCB 3L7UA 3PIOQ 1S4EA 4TU8A 1P8GA 1WG5A 1UJ5A 3DRXA 2DCLA 2POKA 2F8MA 4FDFA 4I1TA 4ZIWA 2ZKTA 1KNZA 1VIXA 1HR0F 4IFYB 3DRYA 3LOUA 4YN3B 3C16A 3A8KA 3GJRB 1IKVA 3HFZB 2QMWA 4RW4B 2R7RA 2W9AA 1ZBTA 4DFPA 2P9GA 1BY9A 1T02A 2DNQA 1PJ7A 4PG8A 5J2QB 3A3PB 1H2UX 2LMIA 1WC4A 2G1HA 4NYZA 1CLFA 4N5SA 3N79A 1U1LA 3NWGA 1DQAA 2DHSA 3O6QA 2BEFA 3DLBA 2M5YA 3ETOA 1SUQA 1TQLA 3R9LA 1BMQB 4D3GA 1V5IB 4UOFA 4EBEA 1U7LA 2ZJPQ 4JV2A 3Q86A 2CQ1A 4YUDA 3QJJA 1H3DA 2AZ1A 3UNGC 3IAS9 2BX6A 3RGIA 4AL6A 2J0WA 2IHR1 2CJBA 5K8OA 1S6OA 3PW2A 4C0HA 4RW9B 4QWBA 3TA2A 2DNGA 1VOMA 3M05A 4CO2A 1BWVA 1J27A 4Q8FA 2XI3A 4OL8A 1H73A 4U96A 1NEEA 1FI4A 1FERA 4NLXA 2MZJA 4EI2A 4NZ0A 3PX6A 5CYMA 4O0IA 3BSCA 2OTLS 1S6QB 3K2YA 1WDDA 1ZAWA 5BYQA 3PNIA 3IN5A 3OUYA 4DV4F 4RW6A 5B08A 3V6HA 5RUBA 3FQKA 3H20A 3CJ3A 1PGZA 3VVTA 4LFBJ 3KLGA 3N6LA 4FP9A 1JLEA 4ECXA 2VC0A 1PCAA 4HHHA 1ROFA 4M5KA 2G2OA 3LALA 2KFZA 2R7WA 2CJ9A 3ZNJ1 1JIHA 4WYLA 4IFVA 1FVSA 3BDPA 3KLVA 5D4LA 4DSJA 2CAJA 4RZRA 2AJ2A 1C2PA 2CPDA 1Y3JA 2ZOMA 4P6QA 3N28A 3ZZRA 1VQ7S 2ZE2A 2R2TA 4P9SA 4ED2A 1DLOB 3CCES 3KG4A 1RWOB 1WHXA 1E6VA 4N41A 1LWEA 4OX8A 3OR1B 3QBCA 3DRRA 4M5LA 1X0FA 4C8OA 4DQQA 4DUYJ 1T3NA 4YR3A 3MTKA 4KH0B 7AT1B 2V8HA 3HDSA 2HMIB 1OQ3A 1AZSB 4QWAA 1HPZB 3TQ1A 1U45A 3JAMU 4NXMF 5DRKA 2JLEA 2RNEA 3CEDA 2ZH9A 4WPAA 3P8BB 1NMEB 1RAIB 3LP2B 1RHUB 1EHWA 2GHVC 5FJ4A 2HVEA 3GYNA 1S0NA 4PQUB 1RWNB 4FS1A 3MWBA 3KJFB 3KK3B 2WB4A 1QAJA 2F3JA 4KGXB 4WKYA 1T03A 1WOSA 1LEOA 2DHAA 3LP0B 2NQPA 3DI6A 3IR7B 4FXDA 5T7LB 1F5BA 3PO5A 2WOMB 2YPZA 1NJZA 4LR9A 3RW6A 2NZCA 3CJ4A 1HMVB 5F8IA 4F8RA 1B64A 4XK8C 3V6KA 3K5NA 5D77A 2EC2A 3BGFA 3PYDA 4Q44A 2OFGX 4M5DA 3DOLA 5LJ3Y 2VG5B 1Y3KA 1XBWA 2QJ3A 4J9MA 4QU7A 4QWDA 4ED3A 5KFZA 2X1GA 4DPTA 5KFFA 1RT2B 1S57A 3CCTA 2HAIA 4KPCA 2SXLA 1BGXT 3EGWB 4C8LA 4ZVTB 2AJ0A 3W66A 2HWIA 5CQGA 1FWLA 1VQ9S 1FX4A 1FFWB 2BVZA 2B8PA 3S8SA 3U1NA 1UJ6A 3T1YF 1U0HB 1TFWA 1BQNA 2RDIA 2VFRA 3BM7A 4YHHJ 2DNMA 2ZC4A 3EZOA 3Q2SC 3TUIC 2IJRA 1S72S 4LF1A 4DR7F 4K50A 2HWTA 4M5HA 5C24A 1IWGA 1HBUB 4UUWA 4R25A 2LVWA 3MURP 4ID5A 2QE5A 1S9GB 3KYLA 2ZBQA 4OZ5A 2BV3A 2QYGA 4ECSA 5D8HB 3KJVA 4HTIA 5KFYA 2O1PA 2AJ4A 3FBCA 3K7RA 1RE1B 1GTEA 3FNNA 3MCOA 4C3MA 3D0HE 1CVJA 3ITHA 4JP8A 2BQUA 3DFEA 4U8VA 2B9EA 1RLDA 2KT2A 2YKMA 1PILA 3NMAA 2EW9A 1YG0A 2YNFB 4HACA 2CQGA 3UQSA 4OYPA 1UJ4A 3HI9A 1V9OA 5KT6A 3GLJA 1K44A 2V9KA 3PRBA 2D9PA 3BQ2A 1OY6A 1FE0A 5EWFA 4KO0A 5HJYA 1YIJS 2KU7A 2BW7A 3RG6A 2EBGA 2W9CA 4Q8EA 3J7YU 2BXJA 1REVA 4NA2A 3PYFA 1Y5LB 4WTOB 1S97A 3G8SA 3TYTA 4Z7CA 3HFKA 3HT0A 2NSCA 4H4KA 1RKJA 4QR1A 2E7WA 3F44A 4WIIA 1VK3A 3PW5A 2M4MA 3H2VE 2NPIA 2WHOA 5F9LA 3LPYA 4QR0A 1JLGA 3M32B 2WONB 2F9DA 5IWAJ 2VOOA 2AWZA 5F8NA 2JLGA 2QLJB 4ECRA 4J9RA 3CF5Q 3MPWA 2W7AA 2NPFA 1I94J 1EJ7L 2BABA 4EEYA 2R7QA 1JQGA 1CJKB 3OPKA 3D54A 3QIPB 4DLGA 1SBRA 5KG7A 2HNDA 3D67A 2C2KB 2G13A 3V4IA 3QT6A 2CPZA 4USVA 1RAOA 1QAYA 3ET6B 3DC2A 2XBPA 1S1XB 4OI3A 4ICLA 5GAGI 4OI6A 5C42A 4DFJA 4EMDA 4IH5A 1R27B 4DG1A 3T5JA 1JLAB 2IRXA 1E6YB 2V5HG 2MEWA 2HHWA 3V6JA 4UTGA 1S0MA 4Q43A 2UVVA 4YQWA 4QOTA 2J9DE 5DDOC 4G1QB 3CD6S 3HVTB 2YNHA 5G0RB 2B9YA 4B3TF 2W2NP 3MM8B 3EVWA 3HVAA 4ZVEA 8RUCA 3T5KA 3GZ7A 3CMES 3K8WA 2EK6A 4YB1P 4DV3F 1YVFA 1T94A 3FUYA 1RTHB 1NKBA 2KYZA 2FVRA 4LRBA 4ZA1A 3FKBA 3GB0A 4M5GA 3PW7A 2XNRA 4UY8T 4CT9A 4X64J 3H2UB 5J2MB 4N76A 2RQ4A 3A12A 4RW8B 2KG0A 3CCLS 4GVBA 1VQ6S 3W2WB 3OTBA 5J1NA 2WW4A 3TX0A 4G6VB 1W2IA 3TJ8A 1KTVA 4NYPA 1DRZA 4ZPAA 1UPMB 3CDBA 3KG1A 2Z2YB 3EGVA 3ILOA 3GIRA 3DLGA 3NG8A 4OZ1A 5LL6d 2XMVA 4X4QA 4B3MF 3UD4P 4H4OA 4O3RA 3JSRA 1DURA 3C15B 3UDVA 2DEIA 4KY3A 1EKSA 4OYOA 4XTTA 2L9DA 5B0CA 1P9YA 2XYHB 2ZHOA 1RTJB 2ZWOA 1S9EB 3MMAA 3NL0A 1T9VA 1FFSB 4DX7A 4CH7A 3SEOA 2W1BA 2V2KA 2CG8A 3KWMA 1T0TV 2K3IA 2G0CA 4JI5F 3UDEA 3H0PA 3UI3A 3US5A 3PVXA 3H7HB 3FFIA 1YK9A 1N56A 1LV5A 1H2VZ 2VG6B 2MQOA 1NK7A 3Q8QB 3DM2A 3UCUP 4ENOA 2WSCC 2XZWA 3BGRB 1JLBB 1FK9A 4ED4A 3FMWA 5BR8F 5DDQC 1G4CA 3IGVA 2JHEA 3PR4A 2CQ4A 3N01A 1BXNA 2HLUA 3KJNB 4F0MA 4GC7A 1R43A 1RTIA 2DXDA 2CPXA 1LW2A 1YX2A 1UVLA 1VC0A 2VBXA 3G82B 2YQ0A 4B3OB 1SQFA 1HBNB 2ZOGA 4QZVB 2PO4A 4F4WA 4C48A 4LSLB 5HQLA 4P2XA 3D0GE 1FTRA 2GIRA 4L74A 2FUG9 4C3LA 2HHTA 4U8YA 3NNAA 4I2QA 3C6UB 2DGVA 3S6EA 1CJTB 2CDQA 3BF4A 4G65A 3DOKB 2I5JA 3OTEA 8ATCB 1I5OB 2YTCA 5AE1A 3KK1B 4O3PA 2FVCA 3B4DA 4YB7A 1NAQA 3LP1A 4OHWA 1QVFR 2DGTA 3M2UA 5KT3A 1NKCA 2V50A 2CNLB 4LMZA 5KG2A 5L1JA 4NL5A 3MEGB 3V81B 1FESA 2YQ3A 4O3QA 1RACB 3SDEB 5DDRC 1YJRA 3T9NA 1HNXF 4DV3J 2DR9A 4BWMA 2MHNA 4C9DA 1MN7A 2V2VA 3PYEA 5KFLA 1IJEB 5FLXY 3UR3C 3DLKA 2RF2A 4BCAA 3QT8A 4FPRA 1JJ2R 2RU9A 4DSKA 3D9BA 5LSRA 4DQSA 4IDKB 1PKUA 1K73T 2HK3A 3N0VA 3OLBA 5LSOA 4BLGA 1UKUA 4WYWA 2OPRA 4CT8A 5SZTA 4H4KC 3OVSA 4HEA9 4MFBB 2FGCA 5KG5A 3IAM9 2GIFA 5I42A 3IG1A 4OHYA 3KHHA 5DLFA 2CJYB 4LRDA 1RAHB 2DYAA 4DR5J 4ZVGA 3RR7A 2N7YA 3DOMA 4WK3A 4B3MJ 4OYMA 3MMJA 3MM6A 1D09B 2MY8A 1R8AA 4K5SA 3G71S 2MKKA 4N8NA 5DO2A 4PXEA 2E1CA 5KFXA 1ACMB 4L6V3 4WKRA 2PMHA 1KHWA 2V63A 3F56A 1N5YB 2AYBA 4Q2LA 3M2VA 2ZZMA 3MCNA 5EX3A 1CS4B 4MK7A 3VAKA 1UVIA 1GTHA 4K8RA 2CZ9A 1EB0A 1I1GA 5HMWA 3GMGA 4DWIA 3WX8A 3DXSX 2KZMA 3TUZC 3RB6A 4EU0A 4R8UA 2DISA 2MLYA 5M2PA 4Z2XA 2MKSA 2KXFA 4ECVA 5ETMA 4HT5A 2HG4A 3R5BA 4P75A 2BUNA 1EIYB 3GFYA 2B7BB 3K8VA 3KMQA 5L1IA 3FGVA 2ZJQQ 2LQ9A 2ZNZA 3SIPB 2HRYA 2V2QA 1Q86T 3C16B 3M8ZA 4AXIA 5DG7A 2IYIA 1IKVB 3GG0A 2QA1A 2J0XA 1X4EA 4DPXA 1VRTA 4KGMA 4WJBA 1L5UA 4KHPF 3JSBA 2LXUA 4WIQA 1YZ6A 4F50A 2JH3A 1SQEA 1NK4A 3I82A 2XLJA 1LWFA 3TA1A 1FO1A 3R1HA 5DG9A 1NJXA 1U2CA 3HM9A 2FLNA 4HH0A 1X9WA 1VISA 4JV1A 2R2RA 1AT1B 2J9CA 2WZ1A 1DFDA 4KAIA 2PI4A 1SUQB 4X4NA 3GE9A 1J5EF 3SXLA 1DZ5A 4OIXA 4X62F 5F8MA 2M0GB 3U1MA 2MQPA 1R6VA 3OHBA 1VQOS 1WEYA 2QC3A 3KLHA 3W8PA 3NCPA 3VAFA 3HSJA 1UVJA 1RWXB 1HWKA 3PRVA 1ZA2B 3C46A 1C4CA 2MKHA 1AB8A 1TAQA 5IT4A 4JUZA 3OVBA 1LFPA 4J9UE 1UL3A 3MUMP 3H4DA 4F3QA 1S1UA 5B0EA 3A8JA 2X51A 2RJZA 2HS4A 2GVZA 1QLNA 2DGUA 2HQCA 3T19A 2J0QD 4C0BA 2V8PA 4TQSA 3HO1A 1FT8A 4RNOA 3HK2A 3OUYB 4RW6B 2AU0A 3M6UA 2C3UA 4ERDA 3FCVA 5L46A 3D6FB 3ZZ0A 3MUVP 2LDIA 4WP9A 3FCWA 3KLGB 3PO4A 3FVYA 3UCZP 1RSCA 2VPYB 1JLEB 3ULHA 4YB6A 3D1HA 1KEKA 2E44A 4IFVB 4IG3B 5CCLA 2JJ4D 5H9EJ 4YDDB 3UE2A 3H8YA 2QX0A 4J9VA 5HQ8A 5F3TA 4NLSA 3TARA 4C7QA 3J81U 1RHKB 9RUBA 2ZE2B 3TAMA 1QD1A 1FXDA 4RUCA 2OLWA 4IRCA 1E6VB 5I3UA 2I38A 3BS9A 1LWEB 2WBMA 2VV5A 1WC0A 3MR7A 3DRRB 2OO4A 1D9AA 3MOJB 4NI2B 5KFOA 2RQKA 3PDNA 2V34A 4B9VA 2GQQA 1B0VA 1U24A 3BR9A 1HD1A 2GJIA 3K5MA 2KT5A 2BMBA 5E3PA 4B17A 2UXBF 4OYZA 4YR2A 3KFWX 2X1BA 5DS7A 3UNYA 1XWLA 5AXLA 3CIMA 3OXFA 4NZ6A 1S79A 5F8GA 4B9NA 3Q2TC 2CJQA 2DH7A 3J80Y 3KUGA 1IKXA 3BYPA 2HSEB 2VUGA 5D0HA 1PG5B 4WU2A 4ZJOA 4O0NA 2OAUA 1T03B 2CNOB 3DU6A 1XMOJ 1SH2A 3R8YA 4PKDB 1T3OA 1XJWB 1R8HA 2DT9A 3BPDA 3DI6B 4DU8A 2AD9A 1NDLA 5F9NA 3D4JA 1HHSA 3C14A 4TXSA 2IY5B 2DR7A 3FEYB 3TAQA 2Z4PA 2I9SA 4WZQA 1JLQA 1I3OB 3OVAA 4K2JA 4J5OA 2IBOA 1FJGF 4QIGA 2LQJA 5JJBA 4LFAF 1KOHA 4A48A 2EG2A 2W25A 3NNCA 4M5DB 2W2QP 1H72C 2PMWA 2VQFF 2U2FA 4TN2A 3NGTA 3WIVA 4J91A 2DO4A 5HMXA 2CXEA 2CKWA 4Q45A 4JI6F 2E9RX 1JXVA 2IVYA 2ZFHA 4H54A 2QG9B 2HHQA 4CLZA 1HNVB 1RT6A 3HXMA 3PFOA 2GW8A 3X1LB 2AP6A 1BQNB 3OJUA 3GV8B 4DCOB 1YWXA 2MPUA 2E7XA 3I31A 1OS5A 3M6VA 4B3RF 3SCKE 4CLUA 2KJVA 1U8SA 2D3OR 4B9SA 1RT4A 2B56A 5C24B 4QWCA 4IRDA 1VR6A 3W64A 2ROPA 4ID5B 2PA3A 5HLFA 4ZHRA 4RUBA 1FXLA 5IC4B 4CWBA 1Q78A 3KJVB 3U02A 5CYQA 4I2PA 3MEDA 1FEEA 3ITHB 5FLXU 4N7TA 2YNGA 3R7BB 2YKMB 4DL6A 3BBBA 1Q8BA 2GHPA 4O4GB 3S01A 2AQ4A 4E2FB 2KDOA 1WI6A 2YH0A 3VZIA 3OBIA 5KFAA 4WP3A 5KFWA 2CJKA 5KT5A 3KXDA 2HHHF 1QE1A 2HS0A 3CCVS 4GKKJ 3E8OA 3SV4A 2YX7A 4RUAA 4KO0B 3TZWA 4JYAF 2L08A 3I32A 1X4AA 1KC8T 3AXMA 2VPWB 2W9CB 3D2WA 1L3SA 1REVB 1YRTA 1KVKA 4RUHA 4DI6A 1UMJA 2UXBJ 1NBEB 4NEZA 2NXEA 4PCQA 1WI8A 2B0GA 1M5SA 3KOAA 2EFGA 1YITS 1JLGB 2OGUA 4QIEA 1S49A 4C8MA 1JK9B 3B4MA 3QAUA 3BV8A 2J9DA 1HW8A 4PG7A 1NPPA 5J2PB 4G3IA 2DK2A 3RAMA 2V67A 5C25A 1SVDA 3V4IB 3GCWP 2NZ4A 1MROA 1Y7PA 2IM2A 2KTQA 5KG1A 4I67A 3AY0A 1TFYA 4LFAJ 2J6SA 2CPIA 1F60B 4KIAA 1MMDA 4ICLB 2VIHA 2R7OA 2MXYA 2N3LA 1FWPA 2CQ3A 4OZ2A 3G6XA 4DUZJ 3O2IA 4ED5A 3QWPA 5C42B 2GGPA 5E5NA 4X4VA 2DH9A 4LRFA 2GS8A 5HMZA 4DG1B 2OEKA 3DXBA 1VQMS 3IRXA 1U02A 3QGPA 1IR2A 1VBKA 5ETPA 1ULRA 4DZDA 3JSMA 1J5OA 1TL7B 3NMRA 1URNA 3LA0A 2FY1A 3LWLA 2LFVA 1VBXA 2YNHB 2NCKL 3PJWA 4B3RJ 2R7UA 5A8WB 2ZZTA 1Q1KA 2Z0GA 3AQPA 5D0RA 5KT2A 3R5GA 3SCIE 1V6HA 1FVQA 5EWGA 2Y1RI 4LR8A 3GYXB 1RCOB 4E98A 1KQKA 1RT7A 4UQGA 4DV7F 3CCUS 3W7BA 2MZ1A 2J7WA 2A0FB 3BBCA 4LF9J 2JL9A 2OSRA 4DJBA 5GADU 4XAKA 3ZZPA 4EO8A 1H38A 2RT3A 3R2DJ 3L3CA 4K4UA 2UUBJ 3MF5A 4LF4F 3D6HB 5HBMA 3I4PA 3Q8RB 1C1BA 4ZPBA 4DV5F 4U67Q 2WVDA 4RU2A 1TK0A 4UZCA 1WNEA 1F0XA 1F2GA 3N4WA 2K7JA 4OYIA 3VTIA 3V4MA 1TL4A 2ZHBA 2HHHJ 3GSDA 1FRIA 3RJMB 1OMSA 4H4OB 2E1MC 4IR9A 3AD8C 4M5NA 2LEAA 2ZH7A 1P6TA 1FF2A 2XMAA 2UUCF 2GFFA 3NEKA 2F4VJ 3CJSA 2COLA 3MMAB 2UVWA 5ETOA 2VODA 4YDXA 1RDRA 4YFUA 5HVGA 3M4XA 3CCWA 3SBMA 4RNNA 4ZVSB 4ED6A 3PXGa 2ZBRA 3M1VA 3FFIB 3NWRA 1HHQA 2R7TA 2FVPA 4JI3J 3DM2B 3FJ2A 2PEHA 1VHFA 4CH0S 1R8PA 2OH2A 1LOUA 5BYRA 1GXTA 2FVSA 1FJCA 5CZXA 4OYXA 3GV5B 1FK9B 3D66A 4O23A 2IJFA 3W2VA 1R89A 2D74B 2AZ3A 4XPEA 3M30A 2BJDA 5B0GA 2GAGC 2DNYA 4FNIA 2DPJA 1UPPA 2W8KA 4ZJQA 4S0MA 2VC1A 2R4FA 4ECQA 1RTIB 4UOHA 4I64A 3R97A 1XNRF 1WHWA 1RB0A 4RBUA 2HFZA 2MDAA 3OR2A 3ZTPA 1LW2B 2BJ9A 3D5MA 3QQCD 2WSFC 4USJC 4Y0FA 1OSDA 2XNQA 3CJQA 5T14A 1MN9A 2MZRA 2AYMA 1G6BA 3PRDA 2FJDB 2RKIA 5D4NA 1WKJA 2EG1A 2HZVA 3R2CJ 4I2QB 1ZTWA 5HN0A 3PEJA 4A8WA 3J80U 4GRSA 2GNKA 1SJ4P 3QSYB 2O66A 2I5JB 2HBYB 1N6QA 3SI8A 2UP1A 2YKAA 2JZ5A 1NCLA 1KONA 3MECA 3BH7B 2GO8A 3LP1B 6FDRA 5HK4A 2IRUA 3M2UB 4LT6A 2XC9A 5A76A 4PYDA 2YNIA 2O3DA 4NZ7A 1FX2A 1S7IA 5GAEU 1RP5A 3DGPA 5K20B 1NZAA 3HHKA 3K58A 2RH3A 3V5RA 1HQ2A 1EP4B 3CDWA 4USIA 4DN9A 4QBUA 2XS2A 1LW0A 1HNWF 2DNLA 2WK4A 1K0TA 1R0AA 2AJQA 2RF2B 3RB0A 4RBTA 2HPUA 3BKUA 3LO3A 2R9LA 3BYRA 3EGNA 4WFNQ 2C2EA 2YKNA 4HL9A 4UOGA 4LRAA 1VGYA 5FD1A 4E0DA 3THTA 2OPRB 4LF4J 4DV5J 1XIQA 1FTCA 3JQJA 1TTHB 3BZQA 3N6MA 5DQIA 5HJXA 1NB7A 5HO4A 5I42B 3PW4A 3VGUA 2QT7A 1CJUA 3ENVA 3HZEA 2MQLA 4ANEA 3DOMB 1TUWA 1KTQA 3QRPA 3MM6B 1OY8A 4H4MA 3RZAA 2HHSA 3PIPQ 3W8GA 1VRQC 3PV8A 4TVAB 4JI0F 5DM7Q 4UF4A 3FQLA 2OD6A 1NJWA 1O5JA 4MH8A 2EFNA 3F0NA 3NGRA 5IZHA 3QO9A 3V6DA 2RAQA 4OJ1A 5E3AA 3LAMA 4M63A 2XSJB 3ZZYA 2K7KA 4R8UB 2CDRB 3UPFA 2NLWA 4FYDA 3W61A 4RNFA 5KFCA 4EWTA 1LFWA 3A1YG 2GJFA 3FSXA 4DFKA 4Y34A 3GR0A 3R1LA 4OX6A 4OI1A 3CWJA 2CPEA 1X4CA 4AYBD 3BO4A 1WC6A 2ZH2A 2QL9B 3RU0A 3HF5A 1RT1A 1RWPB 1KLNA 2VDHA 1XNRJ 2DIVA 4C8YA 1WEZA 4J9PA 4NA1A 5HAOA 2JEGA 1WDTA 3POTA 1N36F 2ZD1A 1Z2LA 3PKYA 1KVIA 3THPA 4A46A 3GFZA 2RMLA 3Q24A 1S1TA 2MLZA 1X4FA 2EFOA 1CULB 1QSYA 1VRTB 2DNHA 2Q43A 2BE7D 2X7IA 2BDPA 2DKOB 4OLOA 4DL0C 2JRSA 1HW9A 3R6LB 1FDNA 1LWFB 1YKWA 1FRLA 3TZXA 2DGWA 3IA0A 4JB8B 3TR5A 3RBDA 2ROGA 3AFGA 4MIAA 4DQRA 1N48A 4ZVPB 4GVLA 2VFVA 1WKLA 1WOPA 2FYXA 3H2LA 1YDLA 2Y1JA 2XYGB 2B6AA 1WG4A 2AYEA 2Y9HA 2YBVA 2V4QA 4DEZA 2HFVA 3FSIA 1Q7LB 2A3JA 4ILLA 4CP5A 2HFOA 5AJ3F 3CCSS 1ZS6A 1GMUA 2HIYA 1KFSA 1UA0A 1X5TA 2ASJA 4ZPTR 4JI7F 1S6UA 2ALYB 2E9ZA 4O44A 2NYIA 1Z4UA 4WWSA 2HBZB 1IM6A 1X4GA 1S1UB 4I7FA 2QRRA 2LCWA 2GVZB 3OQ2A 3BKFA 2XHWA 3W65A 2G0JA 3RYLA 4ZMMA 3I9V9 4DQIA 3I5CA 4QQBA 1KHVA 4IOAQ 3HD1A 3HKWA 2LYVA 2HZAA 1U6BA 1RLCL 4DL3A 4NXNF 2XMTA 2R42A 4OYAA 1SC1B 4UOCA 2FTRA 2DVIA 1C4AA 2EBEA 5HL7Q 1Y4ZB 2W8LA 3EDRB 3M9MB 3LAKA 2Z2MA 2KM8C 4IYQA 1QAIA 4F0KA 1WF2A 2UUWA 1TKZA 2ZH8A 1C0UB 4ZVQB 3ETMA 3PCOB 2AT1B 3EJMA 5KFDA 1KRPA 1P1LA 4NLPA 4CLLA 5DZ6A 2RS8A 5E3CA 5I3UB 2MLXA 1WACA 4KH1B 1W7WA 2QA2A 4KGKA 3FRZA 1B3TA 4F4YA 3VGTA 3FBFA 3D1QA 4PZVA 4J9OA 2KB2A 4CLWA 3MAAA 1IBLJ 1SCJB 1AW0A 2Y0BB 1RXOB 1N0UA 2XEXA 2MJUA 4FZVA 2V69A 2CQ0A 3BPSP 4XDDA 3KTQA 1DQ9A 3BN7A 4PG4A 4M5JA 3MM5B 1YRXA 4FYVB 1NXIA 2CQHA 1UW9A 1V3ZA 3CCQS 2RHSB 2DB1A 1IKXB 2RDJA 2VZ9A 4USUA 1RHRB 5L38A 4CM2A 4ES2A 1UEKA 3I5BA 5H9FJ 3QJLA 4DV1F 1FHTA 2E1RA 3AD9C 2HKEA 2G1DA 3BR8A 3ICLA 3T1HJ 3D6TB 4NLGA 4KFBA 3RRHA 2AYGA 2CVEA 4B9MA 3ZZZA 3C14B 1NZ8A 1RYRA 2UVUA 1XK8A 1GQEA 3H5YA 2QEXS 2HNZA 2DNRA 2JX2A 1T7PA 1JLQB 2X1FA 5EX0A 1KR4A 1HHTP 2KZZA 1U09A 1GAOA 3H42A 1U26A 1KQGB 4KJIA 2P2CB 4LQ3A 4F04B 3ZTRA 4DFMA 1JB0C 3OL7A 3MFHA 3IS9A 1FDBA 1VQKS 1F9EB 2VBYA 4MIWA 4USMA 2E7VA 4P74A 1XMQF 4K2XA 1UVMA 2OSQA 1M90T 2R8IA 2J6UA 5BYSA 3BO2A 4DR4F 3W5YA 3A4TA 3BN4A 4QPTA 1IR1A 3MM9A 1HL6A 1RT3A 4JI7J 2YXLA 1Q8IA 1EARA 3OL8A 4GKJJ 3MEKA 3RUBL 1RT6B 2NXNA 3ZTSA 2VB6A 2GMHA 5B0BA 4CO0A 3ZZOA 1A9NB 5LT5A 2WB1D 3AH6A 1RT4B 1EETA 2XWYA 3QGGA 4LFBF 5LM7E 5K8MA 2XY6A 3NS6A 1X0PA 3D7SB 5KFIA 1F3FA 3IM8A 3L9ZA 4TQRA 4DL2A 4NXNJ 1MNEA 1BE4A 5HLFB 3QAEA 5CYQB 1B70B 2JEJA 4TU7A 4I2PB 3IGNA 5IV4A 3MEDB 2BACA 1V3RA 2XS7A 1D8ZA 1VCTA 1U6ZA 1C0TA 2A18A 2VFUA 2U1AA 4DR3J 5M2RA 1BQXA 2LEPA 2CPYA 4BHQA 1SC4B 3SFUA 1JKHA 3PX0A 2AIRB 4DDFA 1QUVA 2QIFA 1IM4A 1SKWA 2FPHX 4KC5A 2NYHA 2DHXA 3CJKB 2APOA 2QMUB 1S5ZA 1H6KX 4DUYF 4R0EA 1CEZA 1FNXH 1SH0A 1REGX 2IM3A 3P6YC 2UV8G 5J2QA 4X66J 3THVA 5DGBA 2VHGA 2XSFA 2K1RA 4DSIA 4PYAA 1SIZA 4C98A 2ZNYA 1T95A 2BA9A 3A3OB 1KS2A 2CQBA 2W2MP 1VMBA 3CB4A 1DHMA 1T05A 4CLFA 5ADZA 1UETA 3DDKA 1CBKA 4I6WA 2IJNA 4C8ZA 2KO1A 4CO1A 4DL7A 4DV1J 3HP6A 2ZVSA 1GX6A 4RW7A 2DNPA 3FBBA 4U7CA 1DQ8A 4QIVA 4HYKA 1FNMA 3SQOP 3D28A 3VQSA 3JQKA 1PIEA 3OTDA 3SMZA 3JSYA 3QT7A 5C25B 1TKDA 4ZN1A 1MROB 4R5PB 1GH8A 4ILMA 3I9ZA 1N5SA 3BSOA 2AF6A 4LQ9A 3E51A 2OELA 3E2EA 2J76E 3VAIA 4MIBA 2GGPB 4NOHA 2CG4A 1XMQJ 1MMLA 1VC6A 1WTFA 4DR4J 3FZBA 3IRXB 4FBUA 2Q6BA 4YHHF 3DNCA 5F3ZA 1KLMA 1C1CA 4TLRA 3JSMB 1J5OB 1W2BR 2PC6A 2ZJRQ 3ILIA 1RGVA 3MMCA 3A13A 2KH9A 2F63A 1T9XA 4ZVOB 3TRGA 2GIQA 3JB9k 3EM1A 4P7TA 5I3QA 3RRKA 3HZGA 3BGOP 4DHVA 1H0HB 2Z56B 1XR5A 3NCRA 3FCHA 3WX4A 2MQMA 1RT7B 2MQNA 3MR3A 3LW5C 2F5GA 2R3VA 5KFEA 2N7CA 2FVQA 3P4UB 3HVWA 3JTOA 1AUSL 4KGZB 2AEFA 1Q82T 4Y2CA 1HPZA 1UFWA 3I0SA 5HVFA 3I0RA 1C1BB 4WXOA 1B7YB 3QLHA 3Q8UA 2CQDA 5E3RA 3BGUA 2OI2A 4C0OC 5IQ6A 3MXHP 1NRKA 5HP1A 3EX7B 3LP2A 4L76A 2BR0A 4L75A 1U4BA 4AXJA 3TNVA 3TEGA 3HJFA 4U9RA 4ZVHA 3AOAA 4RR5A 1JNZB 1NUEA 1U48A 3GJSB 3P5TL 2A6OA 4WFXA 1NK5A 3H5SA 1TMJA 4PUOA 2EFVA 4ALZA 1JXLA 1WSRA 3K59A 4K5RA 5MAOA 3KDOA 2CZVC 3OL9A 2CQCA 2FLPA 5IWAF 4V19J 1HMVA 2HHUA 3BKTA 2B3TB 2A2CA 1IR0A 1UA1A 3E3XA 4ID8A 1I94F 2EVZA 2BJ8A 2OJ3A 5ITHA 3GJTB 2YPYA 2OKQA 3Q23A 2ZBPA 5EDWA 1S0OA 2IA0A 2RB7A 5EGYA 1RT2A 3QWUA 3NXZA 3TJ9A 5KFGA 3W2VB 1RBLA 1FJ7A 1VK8A 3TZYA 3N6NA 3M30B 3IC1A 3ONQA 1N34F 1OWXA 4LIWA 2OD4A 4TU9A 2KM8B 5KFPA 4XPCA 2YQ1A 1BC6A 2HWHA 4ES3A 3UR0A 2HURA 5HANA 1RAEB 3UD3P 3OR2B 4TY9A 3GILA 1Q53A 1FRHA 3DKDA 2HQGA 1OJ4A 1L3VA 1N5TA 4FVCA 5K8NA 3MEEA 1CQNA 1P1TA 2RKIB 4ZLNA 3O8WA 4C8KA 1XERA 2NXJA 2FJBB 3W60A 4IKAA 3BJYA 3HHNB 2OPPA 5K5MA 5HATA 1JJ4A 1OIAA 2NXUA 3CPWR 1WF0A 1N6QB 1WOOA 1YRUA 4K4YA 2GA7A 5L9NA 3MECB 4MMOA 3CE8A 2W2OP 3SSRA 2YNIB 1FDDA 3UFCX 3FDSA 2N4CA 2L3MA 1Y5NB 1RBAA 4LSNA 4ZIVA 3DGPB 2QLWA 2XWXA 2QMXA 4DSLA 3TOQA 2IYGA 3MUTP 5A2QY 4RLEA 4P2SA 4NLYA 1LW0B 4DV6J 1X60A 1QUPA 1MWQA 2ZITA 4LR7A 2N82B 1R0AB 4X64F 4AFFA 4DX6A 1NDPA 4JI2F 1SH3A 3E01A 3LGMA 2DXFA 4PPZA 3SZ2A 4FYXB 5IFMA 3OSPA 1UWAA 2B4VA 4A8KA 2FJXA 3KNGA 2Y8WA 3EUNA 2DHHA 1B4SA 1SQGA 3UWTA 2YWFA 4F26A 4BS2A 3TVYA 4ECTA 4CLYA 2YKNB 1CSJA 4ECYA 4JI1F 5DGAA 5JMNA 1G7CB 2JNJA 1NSKL 5IC6B 1U1MA 4DBQA 3R5AA 2IAJA 4WU3A 4HTJA 4KHRA 3VVUA 1WUUA 3IFEA 3P49B 3BBFA 2ZM6F 3HMJG 1CJUB 1SPBP 2BJEA 1NHKL 2X3DA 1RTDA 2R2SA 3MCMA 3VZHA 2HGLA 4ELTA 2ZH1A 4H4MB 4M94A 1D8YA 4FPIA 3BEGB 2UUAJ 5IQQA 3MR2A 1VRUA 1NK0A 4D3HA 4O3OA 2OPQA 1A6LA 2PT0A 2OPSB 1CJKA 5ETQA 2PMZD 3SV3A 1RWMB 3QO9B 1Y0HA 3V6DB 4YEAA 1XC9A 2UXCJ 2A10A 2B4UA 3T5LA 2H65B 3HJVA 4EGLA 3UD5A 3ET6A 3QGIA 4CLPA 3PACA 4MKAA 1X5OA 4TNOA 5THWA 2MZSA 4DQPA 1E6YA 5KFQA 2QFJA 4N56A 1H2TZ 2B9XA 4ECUA 1N34J 3T9ZA 4A8XA 2ROEA 2VD3A 5LJ5Y 5GADI 4GC6A 1FNOA 4F4KA 4KHMA 1MU2A 1BQMB 1JWWA 2BOPA 3POTB 2VJVA 4NYOA 1HI8A 2ZD1B 1FRMA 1HI0P 3OFFA 1S1TB 3GTYX 3WZ0A 1RZMA 1JLFA 1VFJA 2QL7B 3DLLQ 2BANA 3M2RA 3K5OA 3J81j 1YBTA 1EAYC 3IR5B 1FKOA 2XY5A 2C3PA 5JVGQ 1XN9A 1URRA 3OJSA 1N5VA 2NS1B 4NLUA 2IDLA 2C28A 2Z8QA 4PWUA 5CH7B 1HWJA 3RAQA 3G86A 3ISZA 5A8RA 1IBKJ 3RR8A 2RU3A 1NHVA 5DZ7A 4QU6A 4RNHA 2B6AB 2W7PA 3HFVA 3DHWC 2QTWA 5C7PA 2UXDJ 4LFCJ 1IWAA 3OL6A 2EWHA 5KFSA 4K4VA 2V8GA 2VL1A 4MYTA 4OYWA 2CIMA 2BE2A 3OV7A 4X4SA 5IV3A 3GPAA 1GK8A 3QFHA 2H54B 3QFWA 4ZOSA 4AD6A 4CQ1A 3M8RA 4DS5A 5IOLA 4OHVA 2AGQA 3J81Y 4JI2J 2BBEA 2WVCA 2Z2ZA 4DV0J 2YVSA 3D68A 2K3KA 4C6AA 2ACMA 4DOZA 4HI2A 3KLFA 1VJWA 4IOCQ 5KOWA 4JI1J 1LXNA 4I7FB 2RIJA 4WXWA 1XMBA 4DR5F 1SV5A 3JTNA 3MAQA 2ZM6J 4QYZK 3M8QA 3TJAA 4FKYA 2MJNA 2KHDA 5ETNA 4FXWA 2VG6A 2YKPA 4QIWD 2FZKB 2O67A 3VV2B 4B02A 3D3CJ 4CO3A 2ZUAA 3W9IA 1JLBA 4C97A 2LKZA 1HQEA 2VPXB 2FLOA 3CC2S 4FXVA 5D4PA 1X4DA 2D1CA 1HD0A 4TKTA 4ZVFA 2I8EA 2LQ5A 2MMYA 3H5XA 1RA7A 4HHJA 2DPIA 3VWSA 1Y9OA 1TAUA 4JI8J 2ZH4A 5GAEI 4X4RA 4EBDA 5EUHA 1FFGB 2VA2A 1JLCA 4B08A 3OLAA 4PAAA 4DR2J 1HNZJ 3QT5A 4B3OA 3MR5A 3L4BC 1O8BA 1HBNA 1BUXA 1GMWD 4LSLA 2MYFA 2VFSA 5CAAA 4LF5J 1D0EA 2VBZA 1RWUA 3HULA 4DPUA 1R8CA 2MSTA 1CPZA 3MAAB 1N5QA 3M9NB 3C6UA 3QRQA 2R7SA 3TA0A 4FS2A 3C2PA 3RW7A 2Y8YA 3CTRA 3UVJA 2L9NA 4KR0B 1FA0A 2JFKA 1HFEL 3TW0A 2VQEF 1NPRA 3AODA 2FDNA 4B9UA 4JV5J 3K5PA 1VQSA 1AROP 3BQ0A 2W4PA 3WHIA 1G3OA 4Q7AA 1SC3B 3H5UA 2CVIA 1N54B 1SI9A 2XZTB 2DNNA 4LBHA 4X84A 3ISND 5EHHA 3J7Z5 1VIOA 4KFBB 1TVRA 2ABYA 1WD6A 4EO6A 4M8LA 4IDKA 3KK2A 4L3KA 3GFXA 4MT1A 1RWVB 3TQEA 1NSQA 4U7UD 3DRSA 3HSGA 2HNZB 2RRBA 4GO5X 4LUBA 4L72B 4KTQA 3NOCA 1OQ6A 4USWA 2RE1A 2NXCA 5KFUA 1VLYA 4JI4J 4B3SJ 3IS9B 2IC3A 3MFIA 4QCLA 1FJEB 4P7VA 2IMOA 1HI1A 5IT9Y 1TL3A 3MM9B 1KBRA 1RT3B 2LQBA 3PZPA 2V2ZA 3KUHA 4F2RA 3ELHA 4MJKA 4YY3J 3OXGA 1ZAVA 3N5FA 4K0KJ 2ZKUA 1VQ5S 3SFGA 3VAGA 4QR2A 1WJ9A 3NP5A 4R0JA 1EETB 3RTVA 2MKJA 2F1FA 1N32J 3VQTA 5J1PA 4P2MA 1WC1A 3LF0A 1FXRA 2MKYA 5H9FK 2DGOA 2MY7A 1SL0A 1PYSB 4I6AA 4TY8A 3H25A 1M5HA 3NY0A 4PQAA 5A2QU 5GAHU 3EZUA 2IA6A 4OYBA 3CD5A 3EMTA 2BKPA 4CZCA 2JC0A 2PSZA 1DAXA 1C0TB 4I68A 3Q89A 1IJFB 1M1HA 1ICEB 2FHOB 1GMWA 2B43A 2AMCB 1JKHB 2BKOA 2BM0A 1RA6A 2ZUGA 2CPHA 1ZPWX 4CIOA 3CXCR 3CC4S 1M1KT 2J8AA 3C8YA 2C2RA 1Q7YT 4QW8A 1MWYA 3MTJA 4ATNA 4F7VA 4USTA 4TYAA 4MKVA 3FMBA 3A3NB 4PRFA 4NWBA 1B7FA 1H7XA 2QV6A 3UO0A 1ZZFA 4FNHA 4LIRA 1FDAA 2GQ2A 4WE1A 3CJTA 1ZYQA 4F02A 1I6JA 2K1RB 4USHA 2QN6B 1IQZA 2CPJA 4XO0A 3KLEA 5DDPC 3GJQB 1M0SA 2UVRA 2VQEJ 3UDLA 3RBEA 4Y28C 2FJVA 2E1AA 1T05B 2AW0A 1XMOF 4DXLA 1MWZA 2PEBA 5C2CA 5DQGA 2LU1A 1NNDA 3IBFB 2JSXA 1PO6A 3L09A 4DL5A 4RW7B 3QZ7A 5HROA 3AT1B 2R8HA 1UZDA 3H40A 5D3GA 2HBQB 2UV8A 4NPOA 3R5CA 2BRKA 3LTOA 1RJJA 3H90A 4ZK7M 3WC0A 5K9FA 2I0XA 3IRWP 3MMBA 3B78A 4CYUA 4ZLPA 1U1RA 3I55S 3W5ZA 4KPYA 1TP7A 3ZNUA 3V2UC 3T5HA 1YJ9S 1KQFB 2X3GA 4ZP9A 3I96A 1IKWA 1CJVA 2OEMA 3MD1A 4JBCA 1NM2A 2MB0B 1HWUA 1KLMB 1C1CB 2D7SA 2HBRB 2HVZA 1TMMA 5CYMB 2M9KA 1V3SA 2Z58B 1PBUA 4IG3A 3MMCB 3BSAA 4PWWA 3MHYA 5ETTA 4OFZA 2RSQA 3UN2A 2KVQE 2Y1IA 1T9UA 1OPIA 4W98A 3D3BJ 4WTYA 1RT5A 2ASDA 2HVHA 2B9WA 2LEBA 2EKYA 4IR1A 1R3NA 2RDDA 2WCXA 2W4CA 2YY3A 3J7A1 4ZJLA 3EPIA 2EXUA 2XTJP 3DGVA 3AJDA 2IBKA 4NI2A 4NE9C 5AE3A 3OFEA 4F0HA 1S48A 2KRBA 2D9OA 2L48A 3I0SB 4M5IA 3I0RB 2DEJA 1YHQS 3IWLA 3QLHB 4CLSA 2V8VA 2LXIA 4GKKF 1HR0J 3TVZA 5A0YA 2YWGA 5HP1B 1LXJA 3TZZA 2VH7A 1FEHA 1HWLA 3DHXA 2DHGA 3KLIA 4IOBA 2M2BA 4KV8A 1RAGB 1KKHA 1R0CB 4W4MA 4OLPA 2AGPA 3IMQJ 4PUOB 3G4SS 3CW2C 2DY9A 3FK4A 1PYOB 2VG7A 1HBOA 5KFHA 3C6TA 2RRNA 1WF1A 3Q22A 3UW1A 1ZTTA 2N3OA 2A2DA 1VDHA 3MR6A 1VI7A 3DDNA 3OFGA 3NLCA 2CQPA 2XS5A 2AV5A 5B0FA 3HD2A 2JC1A 1H7WA 1UTAA 1R7IA 4J7CA 3ZXWA 2RUSA 2XY7A 5B09A 2JEFA 4G1PA 3GWCA 1N52B 1K1SA 1VLOA 4LBPA 1HIYA 4LBIA 2QLFB 1KSPA 5J2NA 1F1BB 1HNVA 1R31A 2F8EX 1APSA 2ZDOA 2GO9A 3DOLB 4DUZF 1TV6A 3U1LA 4LREA 4OMFG 2GMJA 2ERRA 4CCHA 4NLVA 1U0SA 2P5VA 2V4JA 3TP2A 3MEEB 2C2ZB 5CD4A 4DV4J 3MPDA 4J9SA 2E5JA 3KJQB 5FDLA 4CO5A 4ZP6A 3DRPA 4HKQA 2XHCA 2OPPB 2OEJA 2WRMA 1OY9A 4KGVB 1WHVA 2NUHA 2R8GA 1ZA1B 1SKRA 4ZLJA 2DY1A 2QFIA 3QYYA 3H98A 4LSNB 4N77A 2P9EA 3DN9A 2B51A 1M5VC 3RB3A 4O4GA 1FE4A 5F8JA 4NA3A 4Q5VA 2AX1A 2E66A 5SUHA 4LF9F 1U1NA 4FF1A 3NOGA 1UWBA 1RADB 3VALA 3GG1A 4NRTA 4HDHA 3GIIA 2W9BA 2CQIA 3E01B 4ECWA 2UUBF 2PN6A 2Q66A 4OZJA 3WQPA 2HS3A 4HACB 5IT9U 2J5AA 2G9OA 4RPFA 1GX5A 4OV6A 3P45B 4MYUA 3VAMA 4NXMJ 1TU0B 1UAWA 3M8WA 3GR1A 1QSSA 4CNYA 1X7VA 2Z57B 3ISNC 2Z2LA 2IAJB 1U1QA 4DN0A 3FBEA 3EWGA 4A8QA 4C11A 2YKQA 3W63A 4X2BA 1RTDB 2F4VF 4C3KA 3NGKA 2XCAA 2R8JA 3Q0AA 3CJ2A 3QNWB 8AT1B 1T9TA 2OMLA 4X4PA 4ED8A 4K4ZA 3OT9A 1F2HA 5AXNA 2VOPA 3L7PA 1VRUB 3SCLE 1W25A 4OJHA 1NK8A 2OPQB 1NH7A 1AA1B 3F73A 2OIHA 2IM0A 1M5OC 5D0GA 2UUTA 3FEZA 5J2PA 2WAQD 4J90A 4A8YA 4JI3F 5CABA 4OZ3A 3GP9A 4IUFA 3EDQB 1QVGR 4EZ6A 3H59A 1TL5A 1XR6A 2DO0A 1HKAA 4F3OA 2GVDA 2XMKA 2FY8A 5K14A 2Q3PA 4ZS6A 2VBWA 3U7JA 4TYBA 2HNDB 5KG3A 3OD2A 1TKXA 2HGMA 3QSIA 3FEXB 5HI7A 2J9EA 2UU9F 3T1YJ 1ELOA 1TL7A 1MU2B 4OI4A 3R7SB 3MCSA 3HX9A 5KFTA 5A8WA 4PXBA 4Q0BA 4B9LA 4DR7J 2A6MA 2Y3YA 1JLFB 7FD1A 3D6MB 3G8QA 3PTWA 2BANB 3M2RB 4F67A 3ZTOA 2HEKA 3CUNA 1H74A 4HH1A 2H51B 3EXYA 5KG4A 1SIWB 5I3PA 4F4ZA 1FKOB 4NCAA 2YWHA 2B7CB 2XMJA 1X5SA 1AYEA 5KFKA 2YH1A 1VQ8S 2FD2A 2GV1A 4DMZA 1PBAA 3FZ2A 3PJ9A 4EUVA 1NLKL 1WTBA 4QPXA 3MPVA 2KYXA 2V94A 5A8RB 5L9XA 4J9LA 5JXSA 4HT7A 1S1WA 2KFNA 3EPGA 2DXEA 4NLTA 2XQCA 3HSDA 3R27A 2M7SA 2HNYA 2BZ2A 2Q79A 3W9JA 1ZM4A 4PXCA 3UCGA 2BE2B 1R8BA 4BDPA 4P10A 3PFEA 1NK6A 4J9NA 1T11A 4EK2A 2G0IA 2HQFA 1S77D 7FDRA 1KVJA 4P52A 2KI2A 4K4XA 1N8RT 4LSZB 3SSQA 4GVBB 2WTFA 3R7NB 3QIDA 1SJ3P 2E29A 3KLFB 4USKA 4W90B 4MTPA 1RHJB 1BWEA 3H4BA 2K06A 3I6PA 1EZZB 1RAJA 1SV5B 3DLGB 5LMNF 2B4PA 1JXEA 1FCAA 2XG8A 4U7UK 2JVOA 2MZTA 2AHOB 3M8QB 1VBZA 3DYAA 4ILRA 1IKYA 2Z30B 1QY7A 2AJFE 3AA9A 1XR7A 3KDNA 1NDKA 1U8WA 3NS7B 5CHCB 4Y65A 1SC6A 3JXOA 3CCMS 3ENAA 1F6TA 3W9HA 2EKNA 5CCMA 2RQCA 2BQ3A 2W7OA 4DPWA 2C42A 1HQEB 2MSSA 4NMXA 1HYSA 4KBIA
chains in the Genus database with same CATH topology
3K5MA 4ZPCA 1TKZB 3B82A 4K5RA 5MAOA 2Q6CA 2DGXA 1Z2ZA 3BSNA 2KT5A 4CTAB 5E3PA 1SL2A 1F5CA 5KFMA 2MKCA 2OMOA 4B17A 3D1OA 2UXBF 2HHVA 2CZVC 3OL9A 4NCBA 4YR2A 2CQCA 2FLPA 3KFWX 2X1BA 5DS7A 5IWAF 4V19J 1HMVA 1XWLA 3QZ8A 5AXLA 3CIMA 3OXFA 4NZ6A 2HHUA 1QTMA 3T1AA 3GV7B 4CO4A 3A8EA 2B3TB 2O5DA 2W4DA 1S79A 2A2CA 1IR0A 4OJGA 4ITSA 1UA1A 4DSFA 5F8GA 4B9NA 3Q2TC 2CJQA 4DX8H 4U6PA 3E3XA 4ID8A 4DF8A 1I94F 2EVZA 5L8RC 2DH7A 3J80Y 1IKXA 3HLUA 3GIMA 2OJ3A 5ITHA 2CFXA 2VUGA 1JLCB 5M2UA 4XDCA 2OKQA 4IG0A 5KOXA 4WU2A 3Q23A 1S1VB 1T03B 2OAUA 5EDWA 1VQPS 4PG5A 1S0OA 2IA0A 1YSJA 1K0VA 2RB7A 3DU6A 4IH6A 1FD8A 1ZETA 1SL1A 2K8GA 4CI0B 3RAXA 1SH2A 5EGYA 1RT2A 3QWUA 4PKDB 1T3OA 3MI7X 3BQ1A 1K9MT 1CC8A 1FD2A 3LUYA 1R8HA 3DOKA 4DR1F 5KFGA 4A8OA 3W2VB 3NGDA 3CULA 2DT9A 3DI6B 2QSFA 1FJ7A 1VK8A 2AD9A 3N6NA 5B0AA 3KK1A 4FF2A 5F9NA 2ILZA 3M30B 3IC1A 5C5JA 3ONQA 3BB5A 2IFXA 3EXCX 2FLLA 1HHSA 1N34F 1OWXA 4TXSA 4LIWA 4DLEA 3PY8A 3N9UC 2DR7A 2OD4A 5H1SV 3FEYB 4C4WA 3TAQA 2Z4PA 4TU9A 2I9SA 3Q8PB 2KM8B 3ZC4A 1HBMB 4BWJA 4DR6F 5KFPA 4I69A 4WZQA 2P6SA 1JLQA 4XPCA 3SCJE 3OVAA 1BC6A 2HWHA 4J5OA 2IBOA 1FJGF 4ES3A 4QIGA 4AL7A 3UR0A 3MEGA 2LQJA 3TO8A 5JJBA 3V81A 2LU2A 1KOHA 4LFAF 1UP1A 3BO3A 4A48A 3UD3P 1Z1ZA 2EG2A 3OR2B 3SDEA 2W25A 4TY9A 3GILA 2CZ4A 3NNCA 5F41A 1Q53A 1FRHA 2V0NA 4M5DB 5L1LA 1GXUA 1ZOTA 4ZKAA 1OSCA 3G6YA 1L3VA 1N5TA 1U2FA 5LXRA 2VQFF 4FVCA 5K8NA 3MEEA 1TK8A 5CZVA 1P1TA 1CQNA 1HNIB 2RUGA 2E5LF 2U2FA 4TN2A 1Q8LA 3OHAA 1WEXA 2DO4A 2GCFA 5HMXA 1EP4A 2RKIB 3B8HA 2CKWA 4Q45A 4JI6F 3O8WA 4C8KA 1XERA 2PA8D 2FJBB 2E9TA 4IKAA 3BJYA 3HHNB 1TL1B 2E9RX 2HVIA 2M8DB 3C66A 3NNHA 3JTPA 2IVYA 3SQGB 4WK1A 4ED7A 3ZFVA 2C22A 2OPPA 5K5MA 1TZ0A 2ZFHA 4H54A 1JJ4A 2HHQA 4YB5A 1OIAA 2NXUA 3CPWR 1FKAF 1WF0A 1N6QB 1HNVB 3MZIA 1RT6A 3HXMA 3IR6B 1BLUA 1YRUA 2V8DA 4K4YA 3PFOA 2GW8A 3X1LB 3CJ0A 2C2DA 3OTOF 3P96A 2GA7A 1TVRB 1BQNB 2AP6A 5L9NA 3OJUA 5JUMA 3MECB 1TUVA 1YJTA 4TLQA 4MMOA 3LWMA 1IUJA 2ASLA 3KK2B 3CE8A 1YWXA 4CH1A 2MPUA 2E7XA 4MFBA 1NJYA 3DLEB 2EFQA 3I31A 1OS5A 3DRSB 3M6VA 4B3RF 1YGYA 4OHXA 3SSRA 2J0SD 2YNIB 4Y2KA 3SCKE 1FDDA 2KJVA 1GT8A 3UFCX 2RS2A 3FDSA 2N4CA 2L3MA 1Y5NB 4LSNA 1U8SA 3ENWA 2D3OR 4ZP7A 4B9SA 2QLWA 1RT4A 2B56A 3HKZD 1WG1A 2IVMA 2M70A 5C24B 2XWXA 4QWCA 3G6ES 4IRDA 1U47A 2QMXA 4DSLA 4M95A 5GVQA 5K8PA 2XLIA 3HHLB 2B5JA 3TOQA 4M1KA 5KG6A 2IYGA 3DLKB 5KFBA 3GQCA 3MUTP 1D9FA 5A2QY 2ROPA 1M5PC 4RLEA 4P2SA 4NLYA 1LW0B 2IC3B 4ID5B 1QUPA 3RRGA 2O01C 1VBYA 2PA3A 4EYHB 5L39A 2ZITA 5HLFA 5HMYA 4F3MA 2HZCA 4ZHRA 1FXLA 2N82B 1R0AB 4FN5A 1Q78A 4HLBA 3KJVB 4X64F 3NBPB 4AFFA 4JI2F 3U02A 1XTZA 1SH3A 3E01A 5CYQA 1S9FA 3LGMA 5E7OB 4PPZA 3SZ2A 5IFMA 2KKHA 4I2PA 1TL3B 3OSPA 3IXQA 2B4VA 1L3UA 4Y2MA 3MEDA 4A8KA 2FJXA 3KNGA 2DNKA 1FEEA 4HVZA 3ITHB 3EUNA 3UWTA 2YWFA 2YNGA 3AJ2A 4F26A 4BS2A 3TVYA 1FKPB 2DH8A 4G1IA 1ZPVA 5T41A 4ECTA 2YKNB 3JYTB 1CSJA 4ECYA 4JI1F 3O5TB 5DGAA 1N5YA 4EYIB 1Q81T 3IG1B 4ZDNA 2YKMB 3CVKA 3T6JA 4DL6A 3L95X 2MHEA 1MW7A 1G7CB 2P6TA 1JNRB 1Q8BA 3GIKA 1U1MA 2GHPA 4XIUA 4O4GB 2V4RA 3S01A 3R5AA 4DBQA 2AQ4A 2ACYA 5CYJA 4OX7A 2KDOA 4UQTA 1WI6A 4KRWA 2W24A 2X1AA 2YH0A 3MD3A 3VZIA 3OBIA 5F8HA 3QMQA 2IAJA 4WU3A 4HTJA 4KHRA 5KFAA 5KFWA 2CJKA 3IFEA 3P49B 3TAPA 3M8PB 4OJ3A 2ZM6F 3MOZA 3OXLA 5KT5A 5U47A 3HMJG 4X4TA 3FSYA 3OW2R 5J1EB 4ED0A 2HHHF 1QE1A 2HS0A 5L1KA 2XSJA 4A4JA 2BJEA 3CCVS 1RTDA 2YX1A 2R2SA 2H5EA 3VZHA 4NMLA 1RKIA 5LXYA 4QJVA 2YKOA 3E8OA 5DLGA 4N8OA 3SV4A 2YX7A 2HGLA 4ELTA 4KE5A 2F7VA 4RUAA 4KO0B 2ZH1A 4H4MB 3C3LA 2GJ2A 3Q8SB 4TY8B 4M94A 2JVRA 1D8YA 4JYAF 2L08A 3I32A 4WFBQ 1X4AA 3BEGB 1YQHA 1KC8T 5GMKa 3HPOA 2VPWB 2W9CB 2D3UA 5IQQA 2VKRA 2HHPA 2RRAA 3MR2A 3D2WA 1L3SA 1VRUA 4Y00A 2LXFA 3PIOQ 1NK0A 3M2VB 1REVB 4TU8A 1P8GA 4D3HA 4O3OA 3DMJA 1YRTA 2OPQA 2QA4G 1WG5A 1UJ5A 2PD1A 2PT0A 1A6LA 2DCLA 2OPSB 2POKA 2F8MA 3DRXA 4DF4A 4I1TA 4RUHA 1NKEA 1DTTA 2PMZD 1UMJA 2ZKTA 1KNZA 5IM0A 1VIXA 3SV3A 4IFYB 1HR0F 3PX4A 3QO9B 1Y0HA 3DRYA 3V6DB 4YEAA 2WW8A 2XB2D 1XC9A 3LOUA 2A10A 2B4UA 4PCQA 3T5LA 1WI8A 2B0GA 1M5SA 4EGLA 3KOAA 4NCGA 3IO1A 1DTQA 1IKVA 2ZDPA 2EFGA 2QMWA 3QGIA 4RW4B 1YITS 2DGSA 1JLGB 2R7RA 2W9AA 3I56S 3PACA 4NX9A 4A8SA 1ZBTA 4LF8F 4DFPA 2P9GA 2M8HA 1BY9A 4MKAA 1T02A 1SJRA 2DNQA 4QIEA 1S49A 2HGNA 4PG8A 5J2QB 4MKBA 3NS5A 1IBLF 1X5OA 1H2UX 4C8MA 2MGZA 3D0IE 1JK9B 2LMIA 3B4MA 4TNOA 5KTQA 3QAUA 4NYZA 5THWA 4MAKA 2KG1A 4WE1B 1CLFA 1S4FA 2MZSA 4N5SA 3N79A 5KT4A 1ZM9A 4DQPA 1IBMF 1E6YA 1U1LA 3NWGA 1DQAA 2J9DA 1HW8A 2AX0A 2IRYA 5KFQA 2QFJA 4N56A 1H2TZ 4PG7A 2B9XA 2IMWP 2DHSA 4ECUA 5J2PB 3O6QA 4HDGA 4G3IA 3DLBA 2XO7A 2M5YA 2DNZA 3T9ZA 4QYRA 4A8XA 5KAKA 2ROEA 3ETOA 2VD3A 4Y3CA 1SUQA 1TQLA 2DK2A 5LJ5Y 3RAMA 5C25A 5GADI 3KLEB 1UEVA 3V4IB 4GC6A 2NZ4A 1FNOA 1MROA 1Y7PA 4F4KA 2IM2A 2KTQA 3CCZA 5KG1A 4I67A 5KT7A 1TKTA 2QZ8A 3AY0A 4KHMA 1MU2A 1TFYA 1BQMB 2J6SA 4D3GA 1JWWA 2CPIA 1F60B 1DJ0A 4KIAA 1MMDA 2BOPA 1X4HA 4ICLB 4EBEA 2LECA 1U7LA 3POTB 2ZJPQ 4ED1A 4JV2A 1NK9A 4NYOA 4W92B 1HI8A 2R7OA 1FRMA 2ZD1B 3TX8A 2N3LA 2CQ3A 2MXYA 2CQ1A 4QYZJ 3K59A 4YUDA 3QJJA 1H3DA 3G6XA 3OFFA 3UNGC 3O2IA 1HI0P 1D1UA 1S1TB 4ED5A 3QWPA 5C42B 2GGPA 3WZ0A 5E5NA 2CPFA 3IAS9 1JLFA 3GV8B 1VFJA 4X4VA 2DH9A 3DLLQ 2FC9A 2BANA 5HMZA 3M2RA 3K5OA 4PWDA 4IRKA 4AL6A 3T1HF 4DG1B 2J0WA 2IHR1 1UFLA 2CJBA 5K8OA 1S6OA 3PW2A 3DXBA 1VQMS 3IRXA 3QGPA 5BJRA 3IR5B 4C0HA 1FKOA 4RW9B 2VPZB 4KQZA 4QWBA 2XY5A 3TA2A 2DNGA 1ULRA 2KHCA 2C3PA 5JVGQ 1XN9A 1VOMA 3M05A 4CO2A 1S7HA 3WDOA 4Q8FA 2XI3A 3JSMA 2D41A 1URRA 5AXMA 1J5OA 3OJSA 1N5VA 5HROB 2NS1B 4NLUA 4OL8A 5A8KA 1FRXA 3NMRA 1URNA 4KB7A 2C28A 1NEEA 2Z8QA 4WCEQ 4PWUA 1G2EA 5D3GB 5CH7B 1HWJA 3RAQA 2FY1A 3LWLA 1FERA 1VBXA 3G86A 1HQUA 2YNHB 3ISZA 2MZJA 4NLXA 5A8RA 4ZCIA 3PJWA 3RR8A 2RU3A 2R7UA 1NHVA 4NZ0A 5A8WB 1Q1KA 2Z0GA 3PX6A 3AQPA 5CYMA 3KKFA 4O0IA 3KLHB 3BSCA 2OTLS 4QU6A 4RNHA 1S6QB 2B6AB 2W7PA 3K2YA 4OV1A 1ZAWA 3DHWC 5BYQA 3PNIA 5KT2A 4RX6A 3IN5A 5E3QA 5KFRA 4QIFA 3OL6A 4RW6A 3OUYA 2EWHA 4DV4F 5KFSA 5B08A 3MMBB 1YJNS 4K4VA 1KFDA 2V8GA 3EYZA 4EBCA 3M9OB 3SCIE 3V6HA 1V6HA 1FVQA 5IS2A 5EWGA 4X4OA 2VL1A 2Y1RI 4QWEA 4MYTA 4DPOA 2CIMA 3FQKA 3GYXB 3H20A 4E98A 2BE2A 5LSLA 3CJ3A 3OV7A 1PGZA 2LDYA 1KQKA 1RT7A 4UQGA 4X4SA 3CCUS 4DV7F 3W7BA 3KLGA 1N88A 1TR0A 3N6LA 4GKJF 4ZOSA 2MZ1A 4CQ1A 3M8RA 3PW0A 4DS5A 4FP9A 2J7WA 2CQ2A 1JLEA 4OHVA 1MMNA 4ECXA 2VC0A 1IKWB 2QO3A 3J81Y 2AGQA 1ROFA 2BBEA 3LALA 2KFZA 3TUJC 4RKUC 2R7WA 5DJBA 2CJ9A 2JL9A 2OSRA 2YVSA 3HHLD 4DJBA 1JIHA 5GADU 3SYZA 2E5IA 4WYLA 4IFVA 4XAKA 3ZZPA 1FVSA 2K3KA 3BDPA 4EO8A 4K59A 1R6YA 3KLVA 2HW3A 4KKOA 4DOZA 1H38A 5D4LA 4HI2A 4ZPDA 4DSJA 3KLFA 2RT3A 4RZRA 1VJWA 4IOCQ 3L3CA 2DJWA 5KOWA 3MM7A 4K4UA 3MF5A 1LXNA 1ZAXA 4LF4F 4I7FB 2RIJA 5HBMA 3I4PA 3Q8RB 1C1BA 4ZPBA 4WXWA 4DV5F 1C2PA 2CPDA 1QSLA 1LWCA 4GMKA 4U67Q 1Y3JA 4UW2A 1XMBA 4RU2A 2ZOMA 4P6QA 4DR5F 3N28A 1PSDA 1QM9A 4NLOA 3ZZRA 1SV5A 4WFAQ 1TK0A 1VQ7S 4LVOP 2ZE2A 2EPIA 4GO7X 3JTNA 2R2TA 4ED2A 5CXTA 1WNEA 1F0XA 1C0UA 3NRBA 3G96A 1F2GA 1DLOB 3CCES 3KG4A 3MAQA 3N4WA 1WHXA 2KT3A 3M8QA 3KHLA 2K7JA 1E6VA 4A8MP 2V9WA 1RT5B 3VTIA 4N41A 1LWEA 2MJNA 3V4MA 1TL4A 2KHDA 4OX8A 3AAWB 2ZHBA 1D3WA 4FF4A 3GSDA 4FXWA 1FRIA 3OR1B 2VG6A 2YKPA 2XMMA 4QIWD 3DRRA 4H4OB 2O67A 2EK1A 2E1MC 4B02A 1X0FA 4IR9A 4C8OA 4DQQA 4CO3A 1T3NA 4YR3A 3MTKA 2J7UA 2LEAA 3DU5A 2ZH7A 3T3FA 2V8HA 3HDSA 1P6TA 1FF2A 1JLBA 2LKZA 4C97A 2HMIB 4DR3F 2UUCF 3UDCA 1HQEA 2GFFA 1OQ3A 2COLA 2XI2A 4QWAA 1S6PA 2VPXB 2F9JA 1HPZB 3MMAB 3TQ1A 3AA8A 2UVWA 2A1BA 1U45A 2FLOA 2VODA 3CC2S 4NXMF 4YDXA 5DRKA 1RDRA 2JLEA 2RNEA 3CEDA 3QGHA 4CTAA 4YP3A 2ZH9A 4QW9A 2M3DA 4FXVA 4YFUA 3M4XA 3NAIA 5D4PA 1X4DA 2D1CA 3CCWA 1HD0A 3TAMB 4TKTA 4RNNA 2OTJS 4ZVFA 2I8EA 2LQ5A 3PXGa 4ED6A 2HRUA 2MMYA 3H5XA 3LP2B 1RA7A 4HHJA 4IQXA 3M1VA 2L41A 2GHVC 2DPIA 3VWSA 1Y9OA 3S7RA 4ES1A 1TAUA 5FJ4A 3FFIB 4PQUB 3GYNA 1S0NA 1PC5A 1RYSA 4FS1A 3MWBA 2R7TA 2ZH4A 5GAEI 4X4RA 2FVPA 4EBDA 5EUHA 2WB4A 3KK3B 1QAJA 3DM2B 2F3JA 2VA2A 5A0YB 3FJ2A 3O44A 3MM5A 4X66F 1JLCA 2PEHA 1VHFA 2ZC3A 4B08A 4CH0S 3OLAA 2BQRA 1R8PA 2OH2A 4ELUA 1S1VA 4WKYA 1T03A 1LOUA 3R5DA 4B3OA 5BYRA 3MR5A 5MLCV 3M8SA 1O8BA 1GXTA 1HBNA 1O0PA 6FD1A 3MAHA 2FVSA 5CZXA 1FJCA 3GV5B 2HYIB 1FK9B 2DHAA 4O23A 4LSLA 2MYFA 3LP0B 3KLIB 4DS4A 4KV8B 2IJFA 2VFSA 3W2VA 1R89A 2NQPA 3DI6A 2CRLA 3IR7B 2D74B 1D0EA 4FXDA 2VBZA 1RWUA 1F5BA 5T7LB 1CPZA 1R8CA 2MSTA 3PO5A 2WOMB 1N5QA 4XPEA 3M9NB 3C6UA 3M30A 5EN1A 2BJDA 5B0GA 2DNYA 4FNIA 2R7SA 1NJZA 2DPJA 4HI1A 3TA0A 4FS2A 3C2PA 2BYCA 3RW7A 2W8KA 4URGA 4UUXA 3CTRA 4KSEB 3RW6A 2L9NA 2VC1A 1HBMA 1HMVB 2R4FA 3CJ4A 4KR0B 5F8IA 4ECQA 4F8RA 1RTIB 3PM9A 4I64A 1FA0A 2JFKA 1B64A 1NO8A 4XK8C 1XNRF 1WHWA 1HFEL 3J7ZT 4RBUA 3V6KA