1LXJA

X-ray structure of ybl001c northeast structural genomics (nesg) consortium target ytyst72
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 11.5KDA PROTEIN IN HTB2-NTH2 INTERGENIC REGION
publication title CRYSTAL STRUCTURES OF MTH1187 AND ITS YEAST ORTHOLOG YBL001C
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lxjA00
1LXJA 1S99A 2EPIA 1YQHA 1LXNA 2EKYA 1S7HA 1SBRA 2IBOA 1VK8A
chains in the Genus database with same CATH superfamily
2JFKA 4UQTA 1XTZA 4JI1J 1R43A 2CZ4A 4M5DA 2D9PA 3LPEA 4V19X 2ADCA 2R8JA 3SBMA 1WWHA 1KEKA 3SZ2A 2HIYA 4JI5J 2E5IA 3QZ8A 5B0DA 1YJWS 2D74B 1CVJA 1S79A 1IBMF 2DH9A 3BPDA 4OQJA 2H48B 4DL4A 2ILZA 1S6OA 5CD4A 1C1CA 4URGA 2Z4PA 5A8RB 4KPCA 2C2OB 4QCLA 1DTTA 2WOMA 3VTIA 4WE1A 3FGVA 1DURA 1IBCB 2MSTA 2DISA 2V4JA 3FMWA 2UUAF 2CQIA 1VR6A 5F8IA 2IFXA 1M5HA 3MR7A 2HIQA 2V5HG 3C16B 2X1FA 3QRRA 4NXNJ 1SPBP 1RT6A 2W24A 3S8SA 4HL9A 2XLKA 4JV0A 1M5SA 4CLFA 4LIRA 4IQMA 2HHWA 2KZZA 1P1LA 3PDNA 1C1BA 1IVZA 2MJNA 5B0FA 2LMIA 2F7VA 1VQOS 1ZM2A 2YX1A 2ZHAA 2ZBIA 6AT1B 1IKVB 2NLWA 4KH1B 2FJEB 2DNGA 1YJ9S 5ETKA 3EICA 3NGSA 2GMLA 3FUYA 3HSGA 3M9OB 4KSEB 1OO0B 5K8OA 1WG5A 4Q5VA 3QAUA 1BY9A 4DV5J 1JLBA 2JOQA 2LQ5A 3BBCA 3R97A 2WSCC 5KFTA 1LEOA 1YJNS 2JEFA 1HNWF 3TW0A 1T9XA 4ID5A 3T5KA 2ZDOA 2IM0A 2CPEA 5I42A 3GR1A 4CI0B 2BYCA 2RHQB 2XZTB 2ATCB 3BR9A 3R3TA 1CJUB 5B7WA 4DUZJ 1TL7A 5DM7Q 2LQJA 3BR8A 1RWMB 1SB6A 3GCXP 3SFUA 3MEEB 3NL0A 4KV8B 4MT1A 3R5GA 1PYSB 3OVAA 3FZBA 3KK2B 2BACA 4I6YA 4J9NA 3CCRS 3W2WB 1WOPA 2IC3A 2E5GA 2B5JB 1PKUA 1QE1A 3D6MB 1RYRA 2PSZA 4BWMA 3UDEA 4PXDA 3CVKA 3QWPA 3ZTPA 2I5JA 2BA9A 4LMZA 3L9ZA 2NPFA 4FYVB 2CKWA 2V6AA 2CNKB 4IQXA 1CLFA 1PJ7A 4ED4A 3DMJA 3NGRA 2PI4A 1C2PA 3MCOA 2B6AB 2ATLA 3OUYB 1J5OA 2QFJA 5FDLA 4OZ5A 1G7CB 3E01B 4GO5X 5D0RA 1Q95G 3QLHB 4O44B 5ETTA 5A8WA 1V5VA 3MPWA 3G82A 3CUNA 2XQCA 4FVCA 3JTPA 2WSEC 4QR2A 1J5EJ 3RRHA 5FD1A 2DYAA 1IJEB 4ZN3A 3MPUB 2Q6BA 3WQPA 2YTCA 1ZA2B 4JV2A 4KBIA 1RAEB 2CQ4A 3OFHA 2BRLA 5F41A 1SV5B 2RQCA 1RXOB 4OYZA 4J7CA 4LFBF 2H4WB 5HK4A 3NS7B 1VLOA 3D54A 2KYZA 2W9BB 4DOZA 2PMHA 4FNHA 2I0XA 2WVEA 2XSFA 2YNHA 4OYPA 4DPOA 1ZETA 1S1VB 3MM7A 3AD7C 2FQQB 2BBEA 4AFFA 1X8DA 2C2NA 3C6UA 4NWBA 1WEXA 2W2PP 5C42A 4M5GA 3D5MA 2ZWOA 3HSDA 2CQ3A 2E1AA 4DSLA 1VC5A 3G9CA 4C8ZA 5HANA 5DG7A 5C25A 2ALYB 1Q1KA 3NWGA 3AOBA 4DEZA 3OTCA 2DNKA 1JLCB 1HQ2A 3HFVA 3TAMA 4WF9Q 4ZJQA 1YBTA 4ZP6A 4AYBD 1RT2A 1PGZA 2GVDA 1QY7A 2ZUAA 2UXDF 1KC8T 5D0EA 2M8HA 5HP1B 4I68A 3H4BA 5F3TA 4IUFA 4ZPTR 1IJFB 2K3IA 1MWQA 2X7IA 3OTOF 2QL7B 2K7KA 4DPWA 4K4YA 3DDIA 2XB2D 2ASDA 4YHHF 4PQUA 2V8PA 4O0IA 1F60B 4B3SF 4DQQA 2Q1LA 4WPAA 4ETZA 3BDPA 4LFCF 4OLPA 1UVJA 1HBOB 2BANA 2HURA 3F41A 4MFBA 1TVRA 2AWZA 2GJ2A 2L48A 4C8LA 5KFFA 1RTHB 2N3LA 1RBLA 2MSSA 3J81U 5RUBA 2ZBQA 3EMTA 3HPOA 4LF4F 3IAM9 1K9MT 1MN7A 4M5KA 1JJ4A 2ZBCA 4ZKAA 2Y9HA 1S10A 1TP7A 2HQFA 4PABA 1FJ7A 1ZM3A 2MLYA 1F2GA 5KFOA 4DFJA 1Y5LB 4FF2A 2CG8A 1NSPA 5IS2A 2FVQA 3UI3A 1Y10A 3UDCA 4QIWD 3M8PB 4CLKA 5EN1A 1OYEA 1TAQA 2J7UA 3K8VA 2WVDA 3ILIA 1RABB 1ZPVA 4F0MA 1M1KT 2EK1A 1RT4B 3SCLE 4KR0B 3THVA 4I7FB 1N56A 3GV7B 2E7WA 4A8SA 3N01A 2EXUA 1TTHB 2XTJP 4GC7A 4A8OA 5L9XA 3D0IE 1BGXT 2MKIA 3MR6A 3AD8C 1EKSA 2GO8A 3AY0A 1CJKA 2CXEA 3ENAA 3QRQA 1OSDA 1N4LA 4YB1P 4CO2A 4MH8A 1QSSA 5LXRA 1M5PC 2M3DA 2BJ9A 2DO4A 2VZ9A 4CH1A 3A8IA 2BABA 1FD8A 3BQ1A 2M4MA 2R7WA 4DG1B 1NH8A 1LWCA 4NPOA 3PG9A 1CBKA 4DV4F 3PJXA 4X64J 1MMLA 4OI2A 3AXKA 3D3CJ 5LMNJ 3T5LA 3ZTRA 1A0OB 3Q0AA 1U7LA 2UUBF 4GRSA 4OI1A 1OPZA 3EVOA 5GAEU 2OIHA 2BM1A 4RNNA 2E5JA 5D3GA 3HHEA 3PM9A 3S6EA 1FXDA 2MTLA 4R8UB 3LUYA 2OPRA 3BO3A 3R1HA 2GHWA 3OL6A 5HVGA 4NLUA 3T5HA 2HPUA 1UFLA 2A1BA 4RJVA 3GP9A 1WSRA 2FTRA 1N32F 1OPIA 2BV3A 5GAEI 3VGTA 3R8YA 5E7OB 3DCAA 2LKZA 2E5HA 4NCGB 4IG0B 1PBAA 4DPUA 4I1TA 2CJQA 4DV7J 4NLYA 2YH0A 2RU9A 1NZAA 3RUBL 4FXVA 1X9WA 3T6BA 1TL1B 1HQEB 1RT7A 2H51B 2AQ4A 2RIJA 5DG8A 2NR0A 1F9HA 2FZGB 1QSYA 4PXEA 3D6TB 2VH7A 4X4PA 3DGPA 2QV6A 2HNDA 3GJSB 4A8KA 4ICLA 1AT1B 1FKOA 2RDDA 3I4PA 4YEAA 3DLGB 1CPZA 4Q8FA 3PXGa 2HQ3A 3ZZZA 1UKUA 3CF5Q 1HNVA 4ILMA 1IQZA 2KYXA 2RQMA 2BKOA 4P10A 4R0JA 4B17A 1WNEA 2XWXA 2YY3A 3KTQA 4ANDA 3LGHA 5GAHU 4RPFA 3FCHA 1S59A 1ZAXA 2GA7A 1WF0A 2R8IA 1ZAWA 4EZ9A 4FKYA 1HNIB 4LREA 3QT5A 4RW9B 1VQ7S 1WI8A 3TANA 2BJEA 3PZPA 4XDCA 3K57A 4ZK7M 3QIPB 5KFJA 1P27B 3I0SA 4X66F 2FDNA 3W61A 6FD1A 1AZSA 2O1PA 4RW7A 3VCDA 3X3UA 2JX2A 2BE9B 1ICEB 2KG1A 1RACB 1RT1B 2YKMA 3MTKA 5JJBA 2P8IA 3H5XA 1YTYA 2JEJA 3UVJB 2IMWP 1HARA 2NXNA 1GXUA 4CO3A 5A2QU 1HWIA 4WP3A 1A6LA 4OZ0A 3HKZD 4M5IA 5KFXA 3LANA 4A8MP 1VOMA 2VBYA 2M70A 4IRCA 1HD0A 4ZIVA 3W66A 2HNYA 5KG4A 2VG7B 1S1TB 1KQFB 3TQ1A 2AYGA 2GHVC 2MMYA 1R0AA 4L6V3 2XMJA 3GJRB 1FK9A 2KFYA 1EKRA 3G86A 5GAGU 3QGIA 3NCRA 4ZVQB 3T41A 2YNIA 3MM5B 4DR6J 1LNQA 4X84A 1IWAA 3AH6A 4ED1A 2E9RX 3PKMA 3IGVA 1U1PA 3LP2B 3BM7A 3NLCA 4I2PA 2DK2A 2XSJB 3UCGA 4PWWA 4ZS6A 4BCAA 2CDRB 1VQ9S 3EGZA 2A2CA 5GAGI 3IRWP 2XBPA 5F9LA 1CEZA 3D6FB 3H5YA 3NNCA 2G2YA 4L3NA 2HHSA 1EHWA 2K1RB 2V4QA 3PR4A 3MDFA 2HVIA 4X4SA 1HL6A 1IKYA 3F73A 3CDEA 1HLWA 2HFOA 4QYZJ 1RCOB 1N54B 2R7XA 3DNCA 2WW8A 1U02A 5KFVA 5FLXY 5JUMA 1YI2S 4OI3A 5D4NA 4DL5A 4TQSA 4N7TA 2AP6A 3BPSP 3MZIA 4Q45A 3MHYA 1CQNA 3BGRA 2AV5A 3AAWB 2VU5A 1SKRA 1X4EA 1X60A 1GX6A 2D69A 3KNGA 4O3PA 1NK4A 3PVXA 1KBRA 3J80Y 2LVWA 4E8UA 1WKJA 3DOKB 3MM8A 5GVQA 3MCMA 1RTJB 4WIQA 3K7RA 4EWTA 2JC0A 1RBAA 3EGVA 3QT6A 4ENOA 3UD5A 4HKQA 3DXSX 2HZAA 2HVHA 2UU9F 1R89A 2OKQA 4AQYF 4DR5F 3MXHP 4KIAA 4UTGA 1TK0A 2BUNA 1XN9A 3WBZA 3SQOP 1CQMA 1RKJA 4B3TF 2CYYA 1N34F 4X4RA 2PC6A 1RYSA 5M2UA 4C97A 2AJ4A 2C2KB 5KFCA 1YBAA 4C48A 3CXCR 3BKUA 2DEIA 3NEKA 5EDWA 2AYEA 4DSFA 1RLCL 1JKHB 2HVZA 4WKYA 1BQMA 3IN5A 5A6PA 3IGNA 2HRTA 5T7LA 1WC0A 3SCIE 5K20B 3DLHA 1UMJA 2XYHB 2M8DB 3D3BJ 5AXNA 3W9IA 4EYIB 3H90A 4RR5A 3KK1A 5G0RB 1I51B 4WK1A 1EP4B 1GMVA 2UUCF 8AT1B 3GV8B 4DV6F 2QTWA 1YJVA 3M2UB 2DKOB 4LJMA 4KY3A 2BQRA 4Y00A 2R8GA 2D9OA 2DNYA 2E5LF 2DHSA 1QAYA 3H5SA 5KG5A 2VOPA 4Q2LA 4FXWA 1ZS6A 4RUAA 3NXZA 4USWA 5HJXA 1U0SA 4CYUA 2DNZA 3NNAA 5HROA 3V2UC 2IRXA 3SI8A 4Q8EA 5I3UB 2GJIA 3KLFB 2R7QA 2OPPB 1Y9OA 4G1PA 1K44A 5KFSA 4YS2A 3MPYA 5J2QB 3PKYA 3A8EA 3MPDA 2ZNZA 4P73A 2DR6A 2UUAJ 3OVSA 1DZ5A 2EBGA 1AROP 4MKVA 4USMA 1SC3B 2I6WA 2HWHA 3UD3P 4MJKA 3LF0A 4QW9A 2BOAA 3OLAA 5E3CA 4R5PA 5KG2A 3P6YC 4HTIA 4MK9A 4M5DB 4ZVHA 3H42A 1ZM4A 1REVA 2JVRA 5F0WA 2IVFB 4B3RF 1HFEL 3D0GE 3TYTA 3FCVA 1ROFA 2D1CA 5ETQA 1TFYA 1TKTB 3VWSA 2KU7A 2GZOA 5IWAF 1NBEB 4UF4A 2RQ4A 1T11A 1TUWA 4KHRA 1C1CB 1KP6A 1LXNA 4CRJA 1ZAVA 1DTTB 2WOMB 1T3OA 3POTA 4WE1B 2DGVA 2MHEA 3IRXA 2KTQA 2HW3A 4ECUA 2V4JB 1RISA 4AE5A 2WBRA 1PJ6A 3CD0A 1FWKA 5F8LA 1U6BA 2FLOA 4O23A 1KTQA 1M1HA 1HKAA 2HGNA 2XLJA 1SI9A 5KAKA 2XNRA 4EK2A 3UCUP 1CG2A 4QIGA 2ZEJA 4JV5F 2HS0A 5BYRA 4YR2A 1C1BB 2B9XA 1MROA 4RU9A 1WC1A 1WACA 3BQ2A 1YVFA 2LEPA 1N5VA 3TZZA 4ZCIA 4Q7AA 1U1QA 2IYGA 2MHNA 5T14A 4KO0A 2G0CA 3T9ZA 1AA1B 4PWUA 5L1LA 4C8OA 1VS3A 1UTAA 2VJUA 1JB0C 3F56A 4TXSA 2OEKA 1F3FA 4JI6F 3V81A 3F0NA 4ZPAA 3KHLA 1JLBB 4BWJA 1OIAA 1NHUA 1KOOA 2B7BB 3NMRA 3MWBA 4ID5B 4LR8A 5I42B 3KDOA 4KH0B 2HHTA 1BE4A 1TL7B 5HN0A 4CLTA 4PG6A 1VHIA 1SXLA 2WAQD 3N5BA 4RUBA 2EG1A 1DBDA 4UZBA 1WTBA 1LK5A 2J0XA 4OV1A 3TRGA 1HA1A 3OD2A 3JQKA 4P2MA 1GQEA 3FQLA 2IC3B 2MQLA 3BO4A 2R7OA 2HHUA 3FSIA 4J37A 2ALZA 1QE1B 3D67A 3HULA 4USVA 1HNZJ 3HVWA 2VIHA 3A13A 2HBQB 3FJ2A 4RNFA 3M6WA 3E51A 4C8MA 1VBKA 3CJ3A 1NJYA 2VC1A 2I5JB 4OZLA 4J9KA 4LFBJ 2VC0A 4KAIA 4DWIA 3H8YA 1VQLS 1JXEA 2R7TA 5L9NA 5ADZA 3DMJB 4BDPA 2ZH4A 2YKOA 1QSLA 2VL1A 5KG3A 4M8LA 4AD6A 5L1IA 3W63A 3K5MA 1LFWA 4NLQA 3K0JA 1J5OB 1D9FA 2MKKA 5IZHA 5FDLB 2DR7A 2L9NA 4JI0F 1U6ZA 3D28A 4RU2A 5A8WB 3FEXB 2N7YA 4DS5A 2GW8A 2O67A 3MD1A 3KHRA 3G82B 3H2VE 3HZGA 1XEZA 4ZCMA 1UWBA 2W2MP 2YPZA 5CQGA 2I1RA 4GMKA 1XIQA 2UXDJ 9ATCB 3PY8A 2ZH1A 4ZDNA 2U1AA 2GV1A 5KT5A 1NH7A 2EFNA 4Y65A 3OTOJ 3QGGA 4DX7A 3VAGA 1S48A 1VFJA 1KTVA 2UUTA 1IR1A 4U7UK 4JYAF 2JLEA 2F8HA 4RZRA 3T1HJ 2CQ2A 4DS4A 4NZ0A 4ECYA 2YNHB 4K4UA 4LFCJ 3MM7B 3UQSA 1FRLA 1RB0A 4K4ZA 2OLWA 3A3NB 5AE1A 3C6UB 1DQ9A 2YXLA 3C19A 2KHDA 3HI9A 3JAMY 5C42B 2OMLA 3QO9A 4LF9F 3GU0A 4ED2A 1OJ4A 5ETSA 2DNHA 3BSNA 3JYTA 4DL3A 3W65A 5B0EA 3QIDA 4LSNA 2FIUA 1OWXA 4DV0F 5C25B 2AF6A 5L8RC 1U25A 3M32A 2GJFA 1JLFA 3TAMB 4TNOA 4CO5A 1RT2B 2GVDB 1H74A 5KFWA 2DBBA 1BMQB 2VG6A 1CJTA 1HHQA 3W8PA 4P52A 4ECTA 2LXUA 1QJHA 1O0PA 3LTOA 3SXLA 4XPEA 5LSRA 5D4LA 2PFDA 4DR4J 4PQUB 2CNNB 3ADAC 2A10A 2W4PA 2DIVA 3CDWA 2BX6A 3M8QA 4OV6A 4IFYA 3O2IA 5HMZA 4NLSA 4CO0A 2BANB 1S77D 4GVBB 4MFBB 2AJQA 1TVRB 1X5TA 2XHCA 4P74A 3MOZA 1YSJA 3M9MB 1DQAA 3KMSA 1IM6A 2AX1A 4CLSA 5C5JA 4ITSA 4ZPDA 1FD2A 5KFMA 1R6YA 1JLEA 1JWWA 5KFLA 3IR7B 3IA0A 2IJFA 2AJ2A 2KL8A 4KE5A 1WC3A 2PN6A 3JSBA 2KDOA 4Y2IA 3HMJG 2EFGA 4HTJA 1SJQA 3ILLA 1FJGJ 3H5UA 1FFSB 1LW2A 1ZYQA 1FTRA 3M05A 3TJAA 2ZHBA 5CH7B 2RU3A 1ZZFA 2XEXA 3AHPA 2MQ8A 5F8NA 2RMLA 1IKWA 4TU7A 3PCOB 5DZ6A 4NXMJ 3PYFA 3FZ2A 4C0HA 1T03A 2FJAB 4OYXA 3DYAA 3DFEA 1NB7A 1FA0A 5SUHA 2AKWB 1WF1A 1O5JA 4KRWA 2WVCA 4ECRA 2QMWA 3G8SA 2CPFA 4DR7F 2FHMA 4FNIA 3FEZA 1YJUA 2VDIA 3IBCB 4BC9A 4J9QA 5J2NA 5BYSA 4OX6A 5IC6B 1Q8BA 1KHVA 2R42A 1CJKB 2OO4A 2EVZA 3TUIC 4S0MA 3HVRA 1QD1A 1M1GA 2RUGA 2DR9A 4YQWA 1NZ8A 5F8MA 3N6MA 4C11A 1FVQA 4A8QA 1IBLJ 2XC9A 1D09B 1HIYA 3MURP 2MEWA 5B08A 2JWNA 3QJLA 1LWCB 1N5TA 2ZC3A 3NG8A 3GFHA 4XDDA 1YHQS 2ZH2A 3HSZA 2AMCB 1VBZA 3CMQA 3QATA 2ZZMA 1IN0A 4EBEA 2XZDB 1Q5YA 3OBIA 4TYAA 3HHKA 3G4SS 1IUJA 2KHCA 3IWXA 2DH7A 5K8MA 3A8KA 2DGTA 5HVHA 2AHOB 1UA1A 4P75A 5D3GB 2RAQA 4TKTA 2FY1A 4AXIA 3R7SB 2XO6A 2BJ7A 3SIPB 2OPRB 4M63A 4LF8F 2CIMA 4IFVA 1Y0HA 1O8BA 1HQUA 3DLLQ 4HACA 5T41A 1N33F 1O51A 2W25A 4FKXA 4MAKA 2A18A 4M94A 4ZPVR 2Y1IA 1D8ZA 1T9WA 1S1UB 1G3OA 2WK4A 2IIHA 4ELTA 4O3QA 3ZO7A 2Y1LB 2IMOA 1IR2A 4MKYA 1EX8A 1LV5A 2FLPA 2WVBA 1WHWA 4MKAA 3ZC4A 2QA1A 1RT7B 4C6AA 1VMBA 2FJVA 4QIEA 5KT4A 5GMKa 4X66J 2QEXS 3GV5B 4ECSA 5EGYA 1RT3A 2CUYA 3E8OA 5J1EA 3DGPB 2DHAA 3Q86A 2HNDB 1TR0A 4ICLB 1R6VA 2CPHA 1FKOB 1PYOB 4PYAA 4DPXA 4NZ7A 4UT4A 4JI3F 1UEVA 1HNVB 1B4SA 4DR2F 3T19A 1GX5A 2E9ZA 1JLQA 4XO0A 2ZZTA 3CJ5A 4F36A 1HWKA 4KB7A 3OTEA 3D68A 3KG1A 2PA3A 3W5ZA 2ZKTA 2CADA 5LSLA 1HWLA 2CA9A 5HMYA 3GYGA 1S7IA 2VBWA 4B9LA 4Y34A 4J5OA 3CJ2A 3JTNA 5H9FK 3M2RA 1B0VA 3RG6A 5F8JA 1U24A 5E3RA 1IQTA 4ECQA 1UZDA 4NRTA 3RBXA 4IOBA 2OFGX 2F4VJ 2GQQA 4I2QA 3I0SB 2NREA 3CC2S 1KD1T 2E66A 1RAIB 4LFAF 2QLWA 3RGIA 1AZSB 4RW7B 1U8SA 1FO1A 3LAMA 1DAXA 2LXFA 3AT1B 1URRA 1RT4A 3B82A 2QMXA 1S12A 1LOUA 3UN2A 2YKMB 4CLPA 1URNA 2VICA 2ROPA 4ILRA 1V3ZA 3OLBA 2NXJA 2M5YA 1HR0F 4ZVUB 4ED5A 3ZZUA 4DR3F 3SSQA 2LDIA 2FJWA 1FERA 4QIFA 2QG9B 2HSEB 4K7QA 2GAHC 3M8ZA 1XERA 5AJ3F 2YX7A 1Q86T 2HNYB 2DGWA 2FLLA 3DLBA 1X5SA 4HR2A 2D3O1 3UCZP 4CP5A 2VOOA 1Q5VA 3THTA 2LDYA 1R0AB 3MOJB 1Q81T 3I5CA 1FRXA 1FK9B 3KLIA 3VAMA 1N88A 1H38A 1H73A 5KT3A 2YNIB 3G6VA 2DD8S 4P72A 3MAHA 3CO9A 2CJXB 1TZ0A 2HZVA 3ZZYA 5KG0A 1KONA 4K4TA 1RCXB 1VK8A 4F25A 4I2PB 1WHVA 3M9NB 1FRHA 2V34A 1JLAA 1LXJA 2RVJA 4EI2A 1XBWA 1E6VA 2B4PA 3M8SA 2G0JA 4DCJB 2G0IA 4A8FA 4KGKA 5ETVA 3WC0A 1IKYB 2CQ0A 3T1YF 1ACMB 4B3TJ 4X4QA 4UY85 4EU0A 3HHDA 1PIEA 1N34J 1NK8A 1VIXA 2E1MC 3CC7S 2HQGA 4CZCA 1JIHA 5E0OA 2QYCA 1FKPA 4ECZA 2B8PA 3BH6B 5A0YA 1HBUA 3P5TL 1S99A 3LP0A 3MAAA 3BGRB 4OYMA 2CWXA 4Z2XA 3PIOQ 4PWDA 4CQ1A 2VB6A 3RR7A 4RBUA 4U8YA 3FEYB 3MM8B 4X65J 2UUCJ 3QAEA 3D4JA 3IBFB 3BQ0A 1BC6A 3F44A 5F9NA 3HK2A 4X4OA 3CD7A 2L9WA 1IKXA 3QFHA 4M5LA 1WHYA 1FFGB 3OPKA 4OMFG 1WD6A 4F3QA 1S0NA 4OJ3A 4DL0C 4JI4F 3EJMA 4D3HA 3D1OA 2DHXA 1F9EB 1LKZA 4DF4A 1SQEA 3DI6A 3J81j 3ZNUA 4UOCA 1HHSA 1YIJS 1KHWA 4WBFA 1BQMB 1AFJA 5T7LB 5ETOA 1DTQA 3IXQA 2ASYA 1F9FA 5HBMA 1Q16B 2YWFA 3Q8YA 4EYHB 3J7YU 2EFVA 4JI2F 3KK1B 1NSAA 3NKYA 1F6TA 1D3WA 1S1WA 2KKHA 4DCPB 3GCWP 4C3MA 5DQHA 4HDGA 3C14A 3HX9A 1MN9A 4A4JA 2FB0A 3KWMA 3J7YI 1M90T 1G1XA 2IBKA 4N41A 2QT7A 3KJQB 5LT5A 3DM2A 3K5LA 5HROB 4ZN1A 1PCAA 2ERRA 2W7AA 4F3OA 1NSQA 2XMWA 1AB8A 1NKCA 2VG7A 2MKSA 3C46A 1VBXA 1UZHA 2P9EA 3N79A 4N5SA 3DGVA 3I4HX 2ZKUA 4LF2A 4DV2J 4HHJA 3MR2A 2GMHA 1QTMA 3US5A 4FN5A 2LA6A 3OVBA 3PNIA 2IDEA 2K7JA 2HBYB 3VALA 2V9WA 4OJHA 3S7RA 1R31A 2V94A 4ZVEA 2K06A 4TYBA 1FRIA 4X2BA 1DJ0A 5L1JA 5A2QY 2PI5A 2XWYA 3VGUA 1JJ2R 4LQ9A 5C24A 1ZZNA 4OL8A 4DXLA 2W9CA 2AEFA 2KZMA 3RRGA 4F2RA 1RGVA 5ETRA 3Q8UA 1NXIA 1VQPS 2QJ3A 1RAFB 1FRKA 2YWGA 4DSKA 2WB1D 3N9UC 3LOUA 1REVB 1KQSR 1OQ6A 2FZKB 3H25A 1LWXA 1HI1A 4NLXA 2IYIA 1KQKA 4DLEA 2HAIA 2EFOA 3BS9A 3NWRA 1JXLA 2W2OP 3OXLA 2R7RA 3LGMA 1NPKA 3TQEA 4CLYA 3POTB 3MF5A 4CO4A 2DGUA 4HI2A 3IRXB 4P7TA 2XI3A 1UVNA 4BLGA 1MWYA 3SV3A 2YKQA 1JK9B 4LF5J 1PJ5A 5K14A 3WX8A 4J9RA 1R8BA 1D9AA 1ZA1B 5AT1B 1FE0A 4ZPBA 1I6JA 3JB9k 1KSPA 4F4WA 3E3XA 4HH1A 3HVAA 5LXYA 2UV8G 4A8XA 3Q23A 4DZ6A 1SQFA 3SDEA 2AU0A 3HF5A 4FPRA 1T02A 3J7Z5 3P45B 2HHXA 1RHQB 4YMEA 2NS1B 4KO0B 1HNXF 2GIQA 3O44A 3DRYA 1H2VZ 1RK8A 4A46A 1X4CA 3Q8QB 3V81B 2DRAA 3CJRA 1SJ3P 5D8HB 1FKAF 2DNQA 4WFNQ 4PR6A 4B3MJ 4DDFA 1WDTA 2MY8A 4NMLA 1Q82T 1FT8A 4EBCA 5D78A 3ONQA 1U49A 2ZM6F 1U1NA 2UXCF 1VJWA 3J7AN 1XK8A 2CJBA 1D8YA 3HFKA 1RI7A 2Y1JA 1XR7A 3PYGA 4YDDB 5F0UA 4C4WA 5DQGA 1F2HA 4PG7A 2YWEA 1NDPA 2CJYB 3LWMA 1KLNA 2MZTA 4NASA 4YOEA 2CG4A 2OMOA 2F1FA 3IWLA 2V0NA 3GILA 2QGFB 2IVMA 4FBTA 1Q7YT 2E1CA 2RSQA 1WDDA 3GSIA 7FDRA 1RTDA 2MGZA 2DNOA 3MECA 5AE2A 3ENWA 2CZVC 2HK2A 1S0OA 2C28A 2MKHA 1U4BA 2R4FA 3CCQS 4F26A 3GYXB 3H0PA 4P9SA 1ZTWA 3M4XA 2HHHF 2C22A 3CCTA 2WSFC 4FDFA 1B64A 1GMUA 2ZOMA 3G2XA 4NLVA 2BOPA 3OV7A 1N0UA 2R3VA 2VA2A 2AJ1A 3AB2B 4JI1F 3TVZA 4LF9J 4LBHA 3EDQB 2HRYA 3CCSS 2XCAA 2GMJA 1TFWA 3S01A 4DV0J 1X4BA 3SCKE 2HBRB 4TY9A 1Y4ZB 2U2FA 2GVZA 4ERDA 2G1DA 4JI5F 2R2UA 1UEUA 1UWBB 4XTTA 4Y2CA 2DIUA 1RWXB 3TA2A 1V3SA 1U1MA 4ZLJA 1UP1A 2HGMA 2JC1A 2N3OA 2C2ZB 4KHPJ 4TVAB 3W64A 1RWVB 4CIOA 2R7UA 1X4HA 4X4UA 3FRZA 1QM9A 3M8RA 4V1Ak 4MIBA 1YKWA 4ETXA 2Z2YB 2VFVA 1BHNA 4NXNF 1TKTA 5D4OA 4Y3CA 4EO6A 4DUYJ 3OTDA 1VC6A 3QO9B 4NI2A 3RB0A 3EPIA 3BSOA 3NY0A 3JYTB 5HATA 1S9EA 3MI7X 2DNPA 2KO1A 2RQKA 3D1HA 4LSNB 3IWNC 1T8EA 3Q22A 1T9TA 3UE2A 2DNRA 4UW2A 2AZ1A 3M32B 3N0VA 1KVJA 3HVTA 3V4MA 1JLFB 5CHCB 2QO3A 3O5TB 1S4FA 3TVKA 4FF1A 1OY8A 4NX9A 2VG6B 1CJTB 1RP5A 4IR1A 4FP9A 4QR1A 4PZVA 1U1RA 3HJVA 2OSQA 2FYXA 4ILLA 4EMDA 5U47A 4LRDA 4DFPA 3M8QB 3PW2A 4IFYB 3G96A 4U96A 4A8WA 3M6VA 4TY8A 4GKKF 1XWLA 3RW7A 3TWZA 2ILYA 4KFBA 4XK8C 3KG0A 1FEEA 4DR7J 2JLFA 4K8RA 3JQMA 4LUBA 1KN6A 3QJPA 1KWMA 1JLEB 1RSCA 1YRXA 2QSWA 5KG7A 4X4VA 1VQ6S 1TMJA 1UPMB 2NSCA 2DGXA 2FGCA 4U8VA 3B54A 3NMAA 2V50A 1LW2B 2RRAA 2XY5A 3GE9A 3R9LA 3R5JB 4RW4A 1YX2A 4FYWB 3QMQA 3QQCD 3CCLS 4J9UE 4NLGA 4J9VA 1IKWB 1TKXA 2KG0A 4ID8A 5IT0A 1NSKL 4WYWA 4ANEA 1T03B 4ZLPA 2EEYA 1N48A 3DYAB 3MPVA 1T94A 1TK8A 1SIZA 2LQ9A 4O3NA 5I4MA 4DHVA 2ZBRA 1VQ5S 4JP8A 3I0RA 1BWEA 4IOCQ 2V9KA 2PMZD 5J2NB 3TX0A 3D9BA 1UFKA 4WKRA 3GTYX 2UV8A 2DNLA 2OAUA 4HT7A 1R8AA 5F3ZA 1GNKA 3FSYA 3V4IB 4ATNA 3WX4A 4C11B 4OJGA 1WC6A 4LT6A 4ELVA 5HAOA 5E33A 4WP9A 2GHPA 4B08A 3AB4B 2H3EB 2A6MA 1YRTA 2ZOGA 1XR6A 4C8NA 1K8AT 2QYGA 4ZA1A 1TL5A 4PQAA 1FF2A 4OI6A 4ES2A 1UA0A 2PDAA 2Z2ZA 1X5OA 2V8VA 5LOQA 2CQBA 2ZZNA 1Z4UA 4WFAQ 1L3KA 2R2RA 1WOOA 2CPDA 2HZCA 4F3MA 5JMNA 4RKUC 3DHWC 4KYZA 4J9PA 4FZVA 2KFZA 4RBVA 5D4PA 1HBNA 1FDAA 2HLUA 3R27A 5DQIA 1R8PA 3MMAA 4OHYA 4X4NA 2R2SA 1JJHA 4NZ6A 4NLRA 2FUG9 2EKYA 4IFVB 3BH7B 3VZHA 1N36J 3FFIA 4WZQA 1HQUB 1H72C 2R9LA 4I56A 3BGLA 2COLA 4HACB 3L3CA 2OSRA 3D0HE 5F8GA 5MLCV 4U7CA 2LLZA 3ZTQA 2BQ3A 2ZE2A 2ASLA 4EBDA 2DRBA 3D66A 3FSXA 4CH0S 1FE4A 3KYLA 2QE5A 3HO1A 4CDIA 2K8GA 2V68A 3IS9A 3NRBA 3K8WA 4PUOA 4LVOP 3W7BA 3CULA 4CNZA 2AD9A 1XNQF 1RT3B 2W01A 3IR6B 2BEFA 3CJKA 3LAKA 3UR0A 5J1EB 2VFRA 2BZ2A 1CULA 2M9KA 2XY6A 1TL4A 2GGPA 1PAEX 3NBPA 2BJ3A 4L72B 4DSIA 2DPJA 4LSZB 2P9CA 1P1TA 4CLZA 5F8HA 2D3UA 2MZQA 2H9ZA 2J9EA 4GVBA 4DLGA 1XMQF 2QIFA 5MAOA 4ZVPB 4LQ3A 3OJUA 1JLQB 2OTJS 1YBUA 4DFMA 1HR0J 3HD2A 2QZ8A 4WP8A 1PC5A 2KN4A 4P2XA 4WTOB 2D3OR 2H4YB 2Z8QA 4RUCA 4DJBA 3M6XA 3IAS9 4OX9J 5FLXU 3H2UB 3D7SB 4F02A 3Q24A 2M52A 2WB4A 1WEZA 4DL7A 3M2RB 2VUGA 4QW8A 1FEHA 3OSNA 1B70B 2IRUA 2EWHA 5KOXA 5GADU 2X1AA 3C2PA 1RHMB 2VDHA 1LWEA 4I2QB 5H9EJ 5HO4A 3CCZA 1XJWB 2EI5A 5J2PA 1GFWB 4ZMMA 3J80U 1B0PA 2LP4A 1KQGB 4EO8A 4GKJF 4WXOA 3PJWA 1T95A 5CYQA 3I55S 3IR5B 3DKDA 1RWKB 3CJ8A 4I64A 4OI0A 3OW2R 4OFZA 3KLHA 1OS5A 4JI7F 4X64F 1GH8A 2XNQA 2VKZG 4EGLA 4E98A 4ES3A 4F50A 3CNQP 4DSJA 2FJXA 3SQGA 5E5NA 1DRZA 2NYHA 3K17A 4YB7A 2B56A 1WKLA 4PRFA 2JL9A 1EB0A 4NLTA 3BBFA 2RB7A 3T1YJ 1X4DA 2MZSA 3TARA 1NPPA 1KNZA 4JV1A 2QRRA 3ILOA 2FVPA 1FTCA 3W3SA 3GLJA 1VDHA 3U1LA 4MK8A 2AJFE 3KJFB 1BWVA 1RTIA 2J9DA 5IM0A 2FC9A 3KLIB 4K50A 3MFIA 3N4WA 3DLEA 3WIUA 1VLYA 3LPYA 4C0OC 2OTLS 2HVEA 1RHJB 4LF6F 2VFSA 3ZNJ1 3THPA 4Y28C 2KXHA 3MGJA 4Q44A 4ED6A 2IM2A 3QBCA 2CPXA 2G1HA 5G4DA 2ZC4A 4NA1A 1G6BA 4TU8A 2BKPA 1SUQA 2PD1A 3PO5A 3TAQA 4J9SA 1YQHA 1JLAB 4DV7F 4C9DA 5KFHA 1VYAA 1K73T 1K1QA 4PEOA 1VISA 5K9FA 1E6VB 5BXIA 2XGPA 3B4DA 3BGFA 3JSMA 4XPCA 4N8NA 3NGUA 4TLQA 1VQYA 4BHQA 2MZ1A 3GWCA 5BR8J 3G8TA 3O3LA 4N8OA 3RB3A 1S1UA 1A7GE 2PGCA 2KVQE 3U1NA 2ROEA 2C42A 1HW8A 1QVFR 2DHHA 1H3DA 3JTOA 4OYAA 4ZCLA 1VHFA 4ZVSB 1FKPB 1FXRA 1AYEA 3GIMA 4KC5A 5A0YB 3UO0A 1L3VA 2HQIA 1HBUB 3LQVA 3LP0B 3MAAB 1C0TB 4QR0A 2G9OA 4QWDA 1EJ7L 2J7KA 1M5OC 1U1LA 3W1YC 2HEKA 4QPXA 4PWDB 2O3DA 1UW4A 3PV8A 4L76A 1X4AA 1TL3A 3I9V9 3LALA 2BDPA 3WIVA 3MMBA 2ZH3A 3VGVA 1AUSL 2NUUG 3NOCA 1G2EA 3ETOA 1TKZA 2EG2A 2B9WA 1C0UA 1NO8A 1RZMA 4RWWA 1IKXB 5CXTA 1F5CA 2HLTA 1V9OA 5L46A 5LL6d 1RADB 2C2DA 4K2JA 1B7YB 2FZCB 2HYIB 1H0HB 4USTA 5DS7A 3EYZA 2ROGA 3DI6B 2VD3A 1BQXA 4U6PA 4DU8A 4L74A 4DV3J 2ZH8A 2ZD1A 2F40A 2MZRA 2HFNA 4UUWA 4WYLA 5DRKA 1DTQB 1RAGB 1UETA 1Y5NB 5HBMB 3D6HB 1K0TA 5GAHI 4PG8A 1RA6A 5IQQA 2IBOA 1IWGA 1FDNA 4DN9A 4HHHA 4UZCA 1S1WB 1T9UA 1W2BR 1U2FA 1YZ7A 1X9MA 2PO4A 2CWKA 5B0CA 1N6QA 3TEGA 4F4KA 2J6UA 1QVGR 5KFQA 3C14B 3BN4A 5LJ3Y 2ZH7A 2QC3A 5CCLA 2LFVA 1Y00A 1I5OB 2OI2A 5IT9Y 3R2DJ 4IG3A 2J0QD 2J6TA 3HKWA 2P6SA 5ETLA 4DR6F 3DM2B 5DDRC 2P6TA 1W26A 5KOWA 2C3OA 4DR1J 3CEDA 3OR1A 3VVTA 3BBBA 3G6YA 3DRRA 1OMSA 1VCTA 2EC0A 2PEBA 4UOGA 2BE7D 3A4TA 2JEIA 3OL7A 2UP1A 3EPGA 4E2FB 1MNEA 3K59A 3DLJA 5C24B 2DH8A 2W9CB 2OGUA 1SC6A 2CFXA 2B9EA 2DGSA 3KLVA 1T05A 2RDJA 3HHLD 3KHGA 4F4XA 1RDRA 4EEYA 4FYXB 4ZJLA 4MK7A 3HDSA 3A3PB 3EVWA 3KKFA 3GG1A 2K3KA 3MCNA 1XNRJ 1JLGA 3N6NA 3LO3A 1K47A 3TA0A 4W98A 3OL8A 2RHSB 1FX4A 1REGX 2GQCA 3V6DA 1YDLA 2F8EX 3QJJA 4JOUA 3FBBA 4YFUA 4NYPA 2PA8D 3T9NA 3BB5A 4F4YA 5K14B 3JS9A 2PIIA 4ZVTB 2BE2A 3MM9B 5C2GA 2ZBPA 3MFHA 4ECXA 2F4FA 4FS1A 1RBOB 5ITHA 2YBVA 2ZVIA 3GG0A 2CVEA 3QNWB 2HFSA 3LWLA 3CIZA 2V2KA 1TU0B 1RA7A 3SDEB 1QTNB 3OFGA 4KTQA 1VQSA 1EQMA 2I38A 1VRTA 1NK7A 3BGUA 1RWWB 3W62A 4K5RA 2Q79A 2C3PA 1GT8A 2E1RA 4IKAA 5C7PA 3WHIA 3MMJA 1P9QC 5DM6Q 4Q43A 2HWTA 2HHHJ 3TUPA 5KT7A 4NLOA 2CJKA 2XO7A 3JAMU 4AL5A 5HLFB 5LMUJ 5HQLA 3MD3A 1J27A 1VQMS 1KKHA 2V2QA 3GFXA 3UFCX 2W9AA 2HQCA 4IO1A 4C8YA 2G2ZA 3DOLA 2CQCA 3BEGB 2Y8YA 1LW0A 3FKBA 4G6VB 2HFUA 1R27B 3M30A 3W5YA 4DMZA 5A76A 1BQNA 3O1LA 4DCOB 1WI6A 4WCEQ 1SH0A 4YR0A 1PC4A 2ADBA 2HNZA 4F4AA 2F9JA 5H9EK 4NOHA 4WIIA 2VV5A 5DETA 3ZXWA 3HT3A 1RAJA 4ELUA 1RTDB 5B09A 2MGZB 3MECB 4AT1B 1O6XA 2ACYA 3I5BA 2RKIA 4OYWA 3WZ0A 5GMDA 4ZOSA 4LRBA 1U2CA 3EUNA 5HVFA 5IFMA 2FHJD 5CYJA 1IBMJ 4NCBA 2LU1A 4B9SA 2RS8A 3TI0A 4IDKA 1VBYA 3W8GA 2VONA 3DXBA 4USJC 4AXJA 1HPZA 3OT9A 1AUDA 4PXBA 4KKOA 1U2RA 3PYDA 7FD1A 2GVZB 4ZPCA 2N82B 3KJVA 2HHQA 3QSYB 3GJTB 1FWLA 4HLBA 1RKIA 4M5NA 2QX0A 1QAXA 1GAOA 1NJZA 2LU2A 1JJCB 3DDNA 1S0VA 2LQBA 2HWIA 2J6SA 3EXCX 4RWXA 1HD1A 1F5AA 4NLWA 3VGSA 3BO2A 3IC1A 5J1PA 3PHEA 5DJBA 3CDAA 1N5SA 1QUPA 3CSKA 3FK4A 1HW9A 2AT1B 3DU5A 1NK5A 3LA0A 3DHXA 4GKKJ 3PFEA 1AFIA 3IP0A 1S49A 4MMOA 2V2VA 2B0GA 1X4FA 4F4ZA 1FWPA 1NEEA 3GB0A 5A8KA 3W9HA 2MQNA 2QN6B 3PJ9A 4BBYA 4NI2B 1R0BG 3FBEA 1HNWJ 1M0SA 1S9EB 1CJVA 3CIMA 4Z7CA 4WFZA 1PSDA 4DPTA 1DY3A 3HVTB 5CYMA 4ZPWR 1S6UA 5H1SV 3TO8A 2L3MA 3I31A 2XMUA 3KUEA 2A2DA 3AA9A 4X62F 1PILA 2MJUA 1U6FA 1FXLA 3KJNB 1RHRB 4C3LA 2YX4A 2OPSA 1S5ZA 3AODA 4CM0A 3LH2S 2ZDPA 3KXDA 4TY8B 4KFBB 1PG5B 1XMOF 4PXCA 4A48A 4WZMA 4J9LA 5KFNA 1FHTA 1E6YA 4I4BA 4ZHRA 5KFKA 2R7VA 3CDUA 1U48A 1GXTA 3ZZPA 3P49B 2BXJA 1AW0A 5HSPA 4FBUA 5H9FJ 3GYNA 1NRKA 4ZP9A 1HNZF 3TAPA 2XS2A 2QL5B 3MR5A 2YPYA 3TZYA 1VJQA 4OYOA 2YWKA 4RW4B 1KR4A 5KT6A 2GQ2A 3SV4A 4C3KA 1TKXB 3V6HA 4QJVA 2P5VA 3DRSA 4JBCA 2YQ0A 3SFGA 4J9MA 1SJ1A 1ZH5A 3PEJA 1NLKL 2EW9A 3R6LB 3AQPA 3BF4A 2F5GA 2YQ3A 1NU4A 1RHKB 2FGOA 4OHVA 3SYZA 3I0RB 2ZITA 1OSCA 2H5JB 4OZNA 2C3YA 4H4OA 4UQGA 3C3LA 1FNOA 1NKBA 3PR5B 3I56S 1RQ0A 4K2XA 4JUZA 4LRCA 2AEJA 3MEGA 4K4WA 1EZZB 3IM9A 2JLGA 4ZLNA 4QU6A 4LVNP 4HH0A 1RU2A 3UNGC 1GK8A 4LRFA 2AW0A 4DZDA 4LSLA 2QSFA 2RUSA 2VFUA 3L09A 2YKNA 3QZ7A 4TN2A 1X4GA 4MIAA 2EFPA 1IBKF 3PIPQ 3T1HF 2XS5A 3NP5A 2OELA 5DGBA 2VPZB 1YITS 2KXNB 2X3GA 4QU7A 2VPWB 4FF3A 1WF2A 5JVHQ 3C6TA 5HL7Q 1Q8IA 2MKJA 1RWPB 3VAHA 2Z2LA 3RAMA 1EQ0A 1U1OA 1RAOA 4QIVA 5D77A 1XNQJ 2VODA 4YHHJ 4OHZA 5K5MA 3T5JA 1T0TV 2EKNA 2CDQA 3ISZA 2VQEF 1HBNB 4B3SJ 4MIWA 3OR2A 5FJ4A 3MMAB 4KT0C 2DRDA 1XMQJ 5KG6A 1RE1B 3B78A 3TJ9A 2WVFA 1ZBTA 3FFIB 2UUWA 5ETPA 2BW2A 3TNVA 4F8RA 4I0WA 2YH1A 4LF4J 3G6ES 1S4EA 4FYDA 2O01C 4DR4F 2W4CA 2CAJA 2ZE2B 4C0BA 2XI2A 4YN3B 2HAFA 1M5VC 2FHOB 4HVZA 5E3AA 3TVYA 1TMMA 3PFOA 4ZIWA 4ZVGA 2EK6A 3IS9B 2HHPA 2LQ8A 3HHLC 4PUOB 2RRNA 5KFUA 2WTFA 3CJKB 1JMTA 3L95X 1CULB 4GKJJ 5EHHA 1HI8A 2B7CB 4N77A 2GGPB 3NBPB 1Q8KA 3O8WA 2JJ4D 3A8JA 3MEDA 2HKEA 1FJGF 4RNMA 1NK6A 1QLNA 1S1XA 1FJEB 3HT0A 3JQJA 1ELOA 3BJYA 5EX3A 4JB8B 2H65B 4JI7J 2OHDA 1Y3KA 4Z37A 2P9GA 3JSRA 3GJQB 4O4GA 4B02A 1SH3A 4H54A 4NXMF 4ED3A 3R1LA 2GIFA 1LWFA 4CM2A 1RU1A 3CCMS 2B43A 4G1QA 3FQKA 3OL9A 1SKWA 3RR8A 3IFEA 1P6TA 4FPIA 2RJZA 2V8GA 2MZJA 3CJ0A 3RBEA 4YY3F 4MKBA 4DV4J 2BJDA 1LWEB 3FCWA 3ZZ0A 3H59A 2HS3A 4BC7A 2M0GB 4ZITA 2YNGA 5KFPA 4U67Q 5J2PB 2PT0A 1DLOB 4LF6J 2HFVA 3GMGA 1T3NA 1ITPA 4NEZA 1IBLF 5CYQB 2UUBJ 4KGXB 4OHXA 1UJ5A 3R5CA 1UAWA 4K59A 3ITHA 3KLHB 1TUVA 3MMCA 2Q43A 3QFWA 3OHBA 3GPAA 3NCQA 2E1PA 1K0VA 2AZ3A 2MDAA 4OYBA 4AL6A 3SQGB 4CH7A 1SH2A 4LBIA 3I96A 1H98A 3NAHA 3CJ4A 1S7HA 4CT8A 3CPWR 1U45A 3V4IA 1BXNA 2VQFF 3FVYA 1HBMA 4P71A 4QWEA 1N32J 5J2MA 3QT8A 3MR3A 1J2VA 2Y3YA 4O3RA 4YB5A 3BSAA 4KGMA 1RTIB 1S9GA 4CWBA 5IM0B 3JXOA 2POKA 3M8WA 3DLEB 3CD6S 4WTYA 3UR3C 4TQRA 2M7SA 2A3JA 1T9YA 4ALZA 5EWEA 3ETMA 2I2YA 2HS4A 4W90B 3PRVA 4UY8T 1RTZA 1IXKA 3GR0A 1MMNA 4F0HA 1SUQB 3HZEA 1S57A 4RW6A 3ET6A 2XMVA 3D1QA 4P2SA 3UNYA 3CCJS 2AYBA 3IG1A 2V69A 4B3OA 1DFDA 1TKDA 1F3VA 1WKKA 1FDDA 4NLDA 3JSMB 2PFFB 6FDRA 3M8YA 3FBFA 1RWOB 1F0XA 5EUHA 1PBUA 5I3PA 1HMVA 2VPYB 3CMES 2JZ5A 2WHOA 4OLOA 2RRBA 1BD6A 3L7PA 2E7VA 5M2PA 2LEAA 2XY7A 1CC7A 1RT5A 2Z56B 2YWWA 2FVCA 2JFDA 1OY9A 2HGLA 1X9SA 4CLUA 1VC0A 1UPPA 1W2IA 2I8EA 3U1MA 4CO1A 1RJJA 3SMZA 4PKDB 1S6QA 1MWZA 3ICLA 3MUMP 1FDBA 2CPZA 3Q8SB 3VQSA 4X4TA 1TL3B 5CZXA 1DARA 3MMBB 3KOAA 2XHWA 5KT2A 2G2OA 2BR0A 1YJRA 4DL6A 3T6JA 1TKZB 3VZIA 3UN3A 1WOSA 4MTPA 3I32A 1C0UB 2YNFA 2JRSA 2OFHX 1VK3A 5KTQA 1SBRA 1XR5A 2F4VF 1WTFA 5ETMA 4I69A 1U26A 2CQGA 2W4DA 1ZOTA 3BYRA 2J8AA 2DITA 4W92B 1V3RA 3N6LA 2W7OA 2ZHOA 2IPOB 3BV8A 3RZAA 1VIOA 1V6HA 2KM8C 1R0CB 3CCUS 3PX0A 2JEGA 2ZD1B 1VRQC 2J9DE 4IH5A 2OPQA 2MKCA 5B0AA 1HHTP 2CZ9A 2MKYA 1H2UX 4N76A 3OFFA 3WC2A 2A0FB 5FIIA 4DX6A 4DQIA 3R5DA 4RX6A 2YKAA 2CNOB 2EBEA 2VJVA 3J81Y 2LECA 3DLKA 4BS2A 4CTAA 1N6QB 5LM7E 3M1VA 1JQGA 4GVLA 2KJWA 1B0TA 4F7VA 4DL2A 4L75A 3RU0A 4K0KF 4IG3B 4NLPA 2Y0BB 1NMEB 2NXUA 3K5NA 2IAJA 2C3UA 1UVLA 4CLLA 3FRYA 3Q2SC 4Y6IA 3P96A 2ZFHA 3RB4A 2MXYA 4YB6A 2IM1A 3AJ1A 2NCKL 3NCPA 3OR1B 1MG7A 3C8YA 1APSA 3IMQJ 3DRRB 2WRMA 3VHQA 1N5YA 3H7HB 4Y2KA 3FC9A 2VF3A 2CPIA 3KLGA 2N4DA 3ZFVA 1DHMA 4F0KA 2H1YA 1GTHA 1LFPA 3N5FA 1RAHB 4Q0BA 2RT3A 3TR5A 3L7OA 2DO0A 2Z30B 5D0HA 3HHLA 1JXVA 1T05B 4DSEA 3P5BP 1S97A 2GFFA 1SL1A 3R2CJ 4O4RA 3DOMA 1VGYA 1KOHA 1UVMA 1JLGB 1L3TA 1Y5IB 2F65A 4LR7A 2LA4A 2UU9J 2DY9A 3B4MA 2XMMA 5D0GA 2AGOA 3C66A 4AQYJ 4U95A 4DR5J 3L4BC 5THWA 3CO0P 3V6DB 5J1NA 2IM3A 3J7ZT 1UEKA 3OFEA 5KG1A 3KMQA 3ZZTA 5KFZA 3HFZB 1Q79A 4X65F 3GIKA 2AX0A 2FVRA 1RWNB 4USHA 4M5MA 3RRKA 3MUTP 3AD9C 9RUBA 2BE2B 1C0TA 1CS4A 3C15A 2B3TB 2CQHA 1WSVA 3GIJA 2F8MA 1CC8A 2J7WA 4F04B 1Y3JA 3U02A 2UVVA 2B4OA 4R0EA 1SJ4P 2LCWA 2XYPB 3PW5A 2G13A 5CABA 3FDSA 2QFIA 1WC4A 1R3NA 2AGPA 1S72S 4LRAA 4RW8A 5KFEA 4Z7YA 3I82A 4DV6J 2MQMA 1VRTB 3KK3A 3I9ZA 2K2PA 4J9OA 4CCHA 1S9FA 2R7SA 3W60A 3PX6A 2E5LJ 3G87A 1U0HA 1TV6A 2L41A 4B9VA 3TUJC 4DBQA 2KRRA 1YLXA 2Y1RI 2CNLB 4PCQA 1AXQA 3KHHA 1MLAA 4IRKA 4B9NA 2RD5C 2DGOA 1KVIA 3TEHB 1FX2A 3DRPA 2DNNA 2XGQA 2UXBF 3KLEA 1Z1ZA 3UWTA 3K5OA 3BYPA 3DOLB 3ELHA 3HM9A 2Q6CA 1LW0B 5ETNA 2WBMA 1OYDA 3AXMA 4I67A 2DXDA 3M30B 1YJ7A 2B8QA 1BQNB 4ZP7A 3SEOA 3HSJA 5CAAA 4D3GA 1X5PA 3GZ7A 4E0DA 2HNZB 1FNXH 2F63A 2VPXB 2AYMA 3WDOA 3Q83A 3AJ2A 4KGZB 5HQ8A 4YUDA 2EC2A 3Q8PB 2V8DA 4EUVA 3NGTA 4DV2F 4ER8A 2GAGC 1I94F 2RKIB 2ZJQQ 2CQPA 5JXSA 3QRPA 2X1BA 4OIXA 4B3RJ 8ATCB 3EGWB 4QWAA 2FHJA 2X3DA 4J90A 2ZH5A 1MU2A 4P7VA 5L39A 1VRUA 2WZ1A 1RT6B 2L08A 2FD2A 5K8NA 1D1UA 3HJFA 5IWAJ 4IDKB 2OD6A 2DNMA 3UW1A 2C1EB 3ILJA 1YWXA 5L38A 3MM6A 5EWFA 1NJWA 1HPZB 4ES1A 2UVWA 4KKOB 3CMAS 3RBZA 1KDNA 2ZH9A 4H4MA 5AXKA 2DCLA 3KJVB 2GCFA 1EARA 2WCXA 3OTBA 1Z2ZA 2OP5A 1GMWD 2RILA 4QYRA 3M2VA 1A9NB 4NL5A 2KVIA 4OZ3A 3UN5A 4K4SA 2VG5A 3ENVA 5DDQC 4X62J 4B9MA 4JV5J 1S6PA 3CJSA 4KQZA 1NNDA 1ZM9A 2QLJB 2WONA 2IRYA 2XYGB 1YK9A 3LP1A 2HHVA 4KHMA 3QSIA 2XM3A 4LF5F 2UZAA 3CJQA 4LF7F 1MMDA 2DY1A 1D0EA 1XMOJ 3K2YA 4N56A 4QQBA 4ZVRB 4ZLLA 1JNRB 2LXIA 5A8KB 4JI6J 1FFWB 5HMWA 4ED7A 3H98A 2DVIA 3BGOP 2QMUB 3LW5C 3NGKA 2FY8A 2XULA 1CJVB 3L7UA 3ISND 2Z2MA 2V2ZA 3W2VA 1BLUA 3I6PA 2ZOFA 2AGQA 4URQU 5CYMB 3H20A 2DCUB 4O0NA 3MM9A 5BYQA 1KLMA 5IOLA 4H4KC 1ZTTA 3KG4A 4QBUA 4DU7A 3AOCA 2HMIA 3A12A 3GONA 3TX8A 4PG4A 3KFWX 3P8BB 4B3MF 3UDLA 2IHR1 3CCVS 2KI2A 5IQ6A 2CQ1A 2OPSB 5EX0A 4NYOA 3CCWA 3EWGA 1BUXA 1ZPWX 2ZWPA 2JSXA 3I5AA 2RF2A 3ZZOA 2CVIA 3SSSA 4OZ2A 1EETA 1L5UA 3H2LA 2Z57B 1E6YB 1RLDA 4USKA 5KFGA 1I3OB 5HLFA 4JI8F 4ZHRB 1HYSA 1X7VA 2Z58B 4RBTA 1SQGA 1MW7A 3EM1A 1W7WA 3NGDA 2RH3A 1SIWB 5JVGQ 2FPHX 1RHUB 4USIA 4OX7A 4JI0J 2IA0A 3SCJE 2WW4A 4PG5A 2X51A 3Q8RB 1QAJA 4IR9A 2W2QP 1S76D 1IBKJ 1Z2LA 4K5SA 1EAYC 2JHEA 4O3OA 1TK5A 3CD5A 4FYYB 1U8WA 1YJTA 3EVMA 4OHWA 4PPZA 3NOGA 2IA6A 1UVKA 3DRSB 4ZCKA 4EZ6A 5A8RA 4YDXA 4DV1F 5LSOA 1R8CA 4GO7X 3PACA 1NUEA 3MTJA 3O6QA 1SC4B 4QYZK 4C8KA 2QLXA 2MPUA 1OY6A 2VQEJ 4U9RA 2VFTA 4JYAJ 1U09A 2KFNA 4HYKA 1EIYB 4H4OB 3IM8A 3C16A 2DJWA 2N7CA 2HG4A 4QOTA 1WORA 1UWAA 2C2RA 4NA3A 5C2CA 1SKUB 2NZ4A 3MEGB 2GO9A 4CLWA 5CCMA 4KHPF 3RYLA 2DHGA 3W5XA 1CSJA 3ZTSA 4QWCA 3CDBA 2HFZA 1UJ4A 4LSLB 2YKNB 1N52B 1NJIT 1IKVA 3EXYA 3CC4S 4M95A 3VVUA 1F5BA 3NAIA 4DN0A 3QT7A 1F1BB 4PAAA 5A6WA 4G65A 3TA1A 3R5AA 4DUYF 4G3IA 2OEJA 1P9YA 2PEHA 3C6TB 4YR3A 2LEBA 5HJYA 2NSBA 3QGHA 1IR0A 1V5IB 4C2MA 3V6JA 4WFXA 3PO4A 1PYTA 1CJUA 5DO2A 4DF8A 2UVRA 5DDPC 3TJ8A 2BM0A 1NM2A 3OR2B 2D7SA 1N5QA 2XCPA 3MEEA 4KV8A 3AA8A 5B0GA 5BJRA 5EWGA 2J5AA 2BJ1A 4RO0A 3KK2A 3HXMA 1R7IA 1SL0A 1JX4A 3W2WA 4DX5A 4I6WA 2B5JA 2J8SA 4Y0FA 2FC8A 3QWUA 3BZQA 1X31C 3D2WA 1UL3A 2MQOA 3IBWA 4K4XA 1VQ4S 1FESA 4LBPA 3GIRA 2P2CB 1Y11A 1X0PA 4YY3J 3PX4A 4DV5F 2J0WA 4ED8A 2XMAA 2NZCA 2VKRA 3CWJA 2DB1A 5AXLA 3EZUA 3P3DA 2B6AA 1UW9A 3K5PA 3AOAA 5CZVA 3OXGA 5DZ7A 3OUYA 2FJBB 5HI7A 1T7PA 1GEHA 3B6BA 4DUZF 4IRDA 3E01A 3MEDB 2G4BA 3TZXA 1S1XB 1QUVA 3VAIA 3QLHA 4O44A 1FVSA 4HI1A 1WEYA 4IO9Q 4OZ1A 3CTRA 3EX7B 2QLBB 4OYIA 1H7XA 5IC4B 2W8LA 3GIIA 3DDKA 4HDHA 4O4GB 2ZUGA 1C4AA 1N8RT 2KJVA 4DQRA 2N4CA 4FS2A 3QYYA 1LWFB 3DN9A 2VQFJ 2H5IB 4G1QB 3TOQA 1X0FA 1H2TZ 3R5BA 4A47A 1SV5A 3DRXA 2V63A 3QPIA 4URSA 1VQ8S 4GC6A 4AL7A 3H40A 2W9BA 2BQUA 1SKSA 5D15A 3VF0B 1S1VA 4LIWA 1YZ6A 2YNGB 2MB0B 3Q89A 2YWHA 3RTVA 2QA4G 2VA3A 3RB6A 2B4UA 4IYQA 3VQTA 5B0BA 3SSRA 3OHAA 5DLFA 2ABYA 4WU3A 1Q78A 3ITHB 3U27A 3MMCB 1PO6A 3TP2A 1N0VC 1JLCA 4LF8J 1HWUA 2QL9B 3AJDA 1J5EF 1SJRA 2FHKA 4OX8A 1Q7LB 2R2TA 1NDLA 2W2NP 2LYVA 5HP1A 2IJRA 4NEYA 2XLIA 1HBMB 4OI4A 1L3SA 4FXDA 2C2MB 5J2MB 1N33J 3VR1A 1XC9A 4ZVFA 5AXMA 2KT3A 4ZP8A 2R8HA 1TAUA 1S9GB 5L1KA 4W4MA 3HCXA 1HBOA 3OQ2A 1NDCA 1U47A 3VAFA 1N36F 4LF1A 2GS8A 4H4KA 1RTHA 1FNMA 2OD4A 2DT9A 2AJ0A 3BN7A 1WG1A 1C4CA 4WU2A 3ULHA 3J7A1 2DGQA 5LJ5Y 4B9TA 3Q2TC 4RW6B 4G1IA 3ET6B 3VV2B 5AE3A 4MYUA 3EZOA 4A8YA 5IT9U 3IG1B 4B3OB 4R25A 3UD4P 1KFSA 4JI3J 4RLEA 2OUGA 3NS5A 2Q3PA 2IJNA 1FI4A 4DR2J 4U7UD 1OQ3A 2F9DA 5KFBA 4NE9C 4WJBA 1QAIA 2I9SA 1HMVB 4DQPA 3M8PA 3HLUA 3FNNA 3JSYA 2BKNA 2A6OA 1UCNA 1NHKL 4QPTA 3NNHA 4Y2AA 1SJFA 2JVOA 1RT5B 3P4UB 4NCAA 1FJCA 2QA2A 4KGVB 1NKEA 1FRMA 4I7FA 5HMXA 2B4VA 4F67A 5IT4A 2Y0SD 3MUVP 1S6QB 3FMBA 4LFAJ 2J76E 4PPDA 3RW6A 3PW0A 1L3UA 4C7QA 4UOFA 4OX9F 4KJIA 1NJXA 4OZJA 2PE8A 2VHGA 4M5HA 2XG8A 3H4DA 2Z0GA 1DQ8A 4DG1A 3PHTA 3HD1A 1H7WA 4J91A 2DPIA 4TLRA 3M6UA 5CA5A 4K0KJ 2YNFB 2APOA 2DXEA 2E7XA 3KUGA 3AQOA 4HEA9 1FRJA 4DR3J 5KFYA 4L73A 2W7PA 1RWUA 3ISNC 1SVDA 5AJ3J 1B3TA 1PAUB 2FVSA 1TUGB 3MAQA 4CT9A 2VASA 2V4RA 3B8HA 2QLFB 4L3KA 2OH2A 2OPQB 2FJDB 1YG0A 1S0MA 2MY7A 1NDKA 1NAQA 4WFBQ 4MYTA 2DR8A 5HQMA 4R8UA 2H54B 1TQLA 2C3MA 5KFRA 4NYZA 5M2RA 2XMTA 2MQQA 1DLOA 3EE3A 1WG4A 5DG9A 2DXFA 1HWJA 4LR9A 2CJ9A 3DLKB 3NS6A 4CTAB 3M1VB 1WHXA 1MSWD 4ZJOA 4NCGA 2RS2A 3T3FA 1VQNS 5GADI 2E9TA 4IG0A 1G4CA 2Q66A 4UUXA 1IM4A 3UPFA 4DI6A 5E3PA 5IXUA 2XZWA 2M88A 1RAAB 2GNKA 2IAJB 2XMKA 1TL1A 5GMEA 1HQEA 3PEHA 5LMNF 1RUSA 3BKTA 1LK7A 5IV3A 3ENQA 2IVYA 1P8GA 3MCSA 2ASJA 3ZTOA 2ZVSA 4KPYA 4WFYA 4NRUA 2W8KA 1N5YB 3QGPA 2ACMA 1UVIA 3KLGB 3DLGA 4I6AA 4NMXA 1WC5A 2SXLA 4ED0A 3ZZRA 2BJ8A 2EPIA 4DQSA 2JDJA 4Q0BB 1NK0A 5KFDA 3GSDA 2ZH6A 5BR8F 2NXEA 3RJMB 3HHLB 5CD4H 2W1BA 1I1GA 2KXFA 5SZTA 8RUCA 2X1GA 1HNIA 4QZVB 3DOMB 1YGYA 4YP3A 4RW9A 1B99A 2J9CA 5IV4A 4TU9A 2KT5A 3PW4A 3QIPA 2JH3A 1UJ6A 3W9JA 1KFDA 4JI4J 2V8HA 3IO1A 3DC2A 2CPJA 2UXBJ 1WUUA 1RT1A 1B7FA 1XQIA 2OJ3A 3X1LB 2DTJA 1XMBA 3BDEA 3VAJA 4RUHA 3M7VA 2ZJRQ 5E3QA 3OXFA 1CS4B 3C15B 3UVJA 2B51A 2HK3A 3EDRB 4ECVA 2R8KA 2KB2A 4WXWA 4N47A 4CYUB 3VAKA 3A1YG 2MYFA 4JI2J 5E41A 1KVKA 1GXLA 4PYDA 2KH9A 1U1KA 4RW8B 1S1TA 3GFZA 2GIRA 4DV3F 3K89A 3KK3B 3UDVA 2MQPA 7AT1B 4ANCA 3CGIA 1I94J 1WJ9A 3PTWA 1KRPA 4UOHA 1U0HB 1TV6B 1VI7A 2AEMA 2IDLA 5E2QA 3MM5A 4EFAC 2RE1A 2YKPA 2H5EA 4XAKA 5DLGA 1W25A 3HP6A 2MLZA 3DRPB 3R7NB 3KLEB 5KFIA 2FLNA 3PRBA 3KUHA 3LP2A 4USUA 4R5PB 1Y7PA 4DX8H 2XSJA 3RAXA 3RBDA 4DUTA 3KNAA 1NPRA 2JNJA 3BKFA 3CJTA 4HT5A 2GX8A 5K8PA 2RNEA 2VBXA 4OJ1A 4IH7A 2K1RA 4C98A 2J0SD 3PYEA 2HBZB 2V67A 2D3ZA 3GFYA 2L9DA 1KS2A 3EZ5A 4M1KA 4V19J 3Q8VA 2ZNYA 2E29A 4P2FA 4DR1F 2NPIA 3OJSA 2HVDA 2HQDA 2OEMA 4M5JA 3TZWA 4ZVOB 1LQ9A 4F2SA 1NHVA 2DEJA 4XIUA 1SCJB 2QA4S 4CNYA 2MLXA 3TUZC 4LF7J 1HI0P 2XS7A 1ULRA 2CRLA 4P6QA 1MU2B 1H6KX 3K58A 1VRUB 2CPYA 2NQPA 1GTEA 3OSPA 1T9VA 3CW2C 1Q53A 3LGNA 3DOKA 2C2EA 3MM6B 1MROB 4ECWA 1JNZB 1Q0NA 1YRUA 1RTJA 4FVMA 4HHUA 4AUKA 1XNRF 4H4MB 3G71S 1SC1B 1D9DA 2EFQA 3R6GB 1GMWA 4K4VA 1Q8LA 3CE8A 3M2VB 4RL1A 2YQ1A 1WELA 2RDIA 1FCAA 3R7BB 2VG5B 2AIRB 4WWSA 4WK3A 2CQDA 3S1TA 3GQCA 3V6KA 2M2BA 2O66A 1S6PB 3KDNA 1NCLA 2F3JA 2WONB 3LP1B 1TELA 1Q4RA 2ZJPQ 3FBCA 2UVUA 1JKHA 4O3SA 1HNXJ 2YVSA 4IOAQ 1VQKS 3CCES 3I87A 1R8HA 4Y2MA 2NYIA 5G0RA 3EGNA 4JI8J 5D6GA 3CB4A 4DFKA 1EP4A 5I3QA 5DDOC 2KT2A 2D41A 5KFAA 3V5RA 4RNOA 2PMWA 3W2VB 3M2UA 3U7JA 2ZM6J 2UXCJ 2KM8B 2GC8A 1K1SA 2Y8WA 3RAQA 2NUHA 1KLMB 2HRUA 3T1AA 1NK9A 1QDUB 3BREA 3DU6A 4B9UA 4NA2A 4DPYA 2HMIB 5I3UA 1UFWA 3KLFA 1M5KC 2DR5A 4QWBA 2NXCA 2OPPA 4IH6A 5LMUF 3CT9A 2IY5B 3PRDA 5J2QA 4FF4A 4DV1J 3HHNB 3E2EA 2CJAA 3G8QA 3MEKA 4Q2MA 5DGAA 2RF2B 2O5DA 3G6XA 3PW7A 2BW7A 1EETB 2BRKA 2BVZA 3N28A 2VBZA 2E44A 3A3OB 3BSCA 4RNHA 1HYSB 2B9YA 1SL2A 1NB2A 2BMBA 2KRBA 3AFGA
chains in the Genus database with same CATH topology
2JFKA 2W4PA 2DIVA 3CDWA 1OS5A 4JI7F 3M8QA 4UQTA 4IFYA 4X64F 1GH8A 5THWA 3V6DB 1XTZA 1R43A 3O2IA 2XNQA 2VKZG 4EGLA 5HMZA 5J1NA 2IM3A 4NLSA 4E98A 2CZ4A 4ES3A 4F50A 3J7ZT 4DSJA 3OFEA 4M5DA 2D9PA 2FJXA 3SQGA 4CO0A 5E5NA 2BANB 1DRZA 5KG1A 4V19X 1S77D 4MFBB 4YB7A 2AJQA 3KMQA 1TVRB 1X5TA 2B56A 3ZZTA 4PRFA 2ADCA 2R8JA 2JL9A 5KFZA 1Q79A 3MOZA 1WWHA 4NLTA 1KEKA 4X65F 3SZ2A 1YSJA 3M9MB 3GIKA 2AX0A 2RB7A 2FVRA 1DQAA 1X4DA 4USHA 2MZSA 3RRKA 3TARA 3KMSA 2AX1A 3MUTP 1KNZA 2E5IA 2QRRA 5C5JA 3QZ8A 2FVPA 5B0DA 1YJWS 4ITSA 1FTCA 4ZPDA 2D74B 1FD2A 1CVJA 5KFMA 1R6YA 1JLEA 1S79A 1IBMF 3W3SA 2BE2B 1C0TA 2DH9A 3U1LA 1JWWA 5KFLA 4MK8A 2AJFE 2B3TB 3IR7B 4OQJA 3IA0A 2CQHA 2IJFA 4DL4A 3GIJA 1RTIA 2ILZA 4KE5A 2F8MA 2J9DA 2PN6A 1CC8A 2J7WA 5IM0A 3JSBA 1Y3JA 2FC9A 3KLIB 1S6OA 2KDOA 4Y2IA 3U02A 4K50A 3MFIA 2B4OA 2UVVA 3N4WA 1C1CA 3DLEA 3HMJG 4URGA 2Z4PA 5A8RB 2EFGA 4HTJA 1SJQA 4R0EA 1SJ4P 1DTTA 1VLYA 2LCWA 2WOMA 4QCLA 3LPYA 4C0OC 3VTIA 4WE1A 3H5UA 3FGVA 1DURA 2G13A 1LW2A 3PW5A 2OTLS 3FDSA 2MSTA 2DISA 2V4JA 3FMWA 1R3NA 4LF6F 2AGPA 1S72S 2VFSA 1ZYQA 1FTRA 3THPA 4RW8A 3M05A 4Y28C 2KXHA 5KFEA 2ZHBA 5CH7B 2UUAF 2CQIA 3MGJA 4Q44A 4ED6A 2RU3A 3I82A 2IM2A 5F8IA 1ZZFA 1VRTB 2MQMA 2XEXA 2CPXA 2IFXA 3AHPA 5G4DA 2ZC4A 4NA1A 1M5HA 3KK3A 1G6BA 3I9ZA 4TU8A 2K2PA 2HIQA 2V5HG 4J9OA 2X1FA 1SUQA 5F8NA 2RMLA 1IKWA 4TU7A 4CCHA 1RT6A 2PD1A 1S9FA 2W24A 3S8SA 3TAQA 4HL9A 3PX6A 3PO5A 2XLKA 2R7SA 4J9SA 1TV6A 2L41A 1YQHA 1JLAB 4DV7F 4JV0A 4C9DA 1M5SA 3FZ2A 4C0HA 5KFHA 4B9VA 1K73T 1K1QA 1T03A 4LIRA 5K9FA 4IQMA 1E6VB 3TUJC 4DBQA 2DPIA 2FJAB 2XGPA 3DYAA 2KRRA 2HHWA 2KZZA 2Y1RI 3DFEA 1NB7A 1FA0A 5SUHA 1P1LA 1WF1A 3PDNA 1O5JA 3B4DA 1C1BA 3BGFA 3JSMA 4PCQA 1AXQA 4XPCA 2MJNA 5B0FA 2LMIA 2F7VA 3KHHA 1VQOS 1ZM2A 4N8NA 4B9NA 4IRKA 4KRWA 2YX1A 2ZHAA 4ECRA 2QMWA 2DGOA 2RD5C 1KVIA 4TLQA 3G8SA 1VQYA 4BHQA 3DRPA 2CPFA 2DNNA 2MZ1A 2XGQA 4DR7F 3KLEA 2FHMA 2UXBF 4FNIA 2ZBIA 3GWCA 3FEZA 1Z1ZA 1YJUA 1IKVB 2NLWA 4BC9A 2FJEB 2DNGA 3G8TA 4J9QA 1YJ9S 3UWTA 3K5OA 5J2NA 3O3LA 5BYSA 4OX6A 2GMLA 1Q8BA 1KHVA 3DOLB 4N8OA 3M9OB 2OO4A 3RB3A 3HM9A 1S1UA 2Q6CA 1A7GE 2EVZA 4KSEB 3TUIC 2PGCA 1LW0B 3HVRA 1OO0B 2RUGA 5K8OA 2WBMA 2DR9A 1WG5A 4Q5VA 4YQWA 3U1NA 4I67A 5F8MA 3N6MA 1BY9A 2ROEA 1JLBA 3M30B 3QAUA 1FVQA 2C42A 1HW8A 2JOQA 4C11A 4A8QA 1QVFR 1H3DA 3JTOA 2LQ5A 4ZCLA 1VHFA 1FKPB 1BQNB 1FXRA 5KFTA 2WSCC 4ZP7A 3GIMA 4KC5A 3SEOA 5A0YB 4D3GA 1X5PA 3GZ7A 2XC9A 2HQIA 1YJNS 1L3VA 4E0DA 2JEFA 1HNWF 1HBUB 3MURP 3TW0A 3LQVA 2HNZB 3LP0B 1FNXH 4ID5A 5B08A 2JWNA 1C0TB 3T5KA 2ZDOA 3QJLA 4QR0A 2VPXB 1LWCB 2AYMA 2G9OA 2CPEA 2IM0A 4QWDA 5I42A 3GR1A 4CI0B 2BYCA 1N5TA 3WDOA 2J7KA 2ZC3A 3AJ2A 3BR9A 3R3TA 5HQ8A 4YUDA 3NG8A 1M5OC 5B7WA 1U1LA 5DM7Q 4QPXA 3Q8PB 3GFHA 2LQJA 2O3DA 1UW4A 3BR8A 4XDDA 3PV8A 2ZH2A 1YHQS 1X4AA 1SB6A 2V8DA 1TL3A 3I9V9 3LALA 4EUVA 2BDPA 3SFUA 4DV2F 3MEEB 3NL0A 4KV8B 1VBZA 3MMBA 1I94F 2RKIB 2ZZMA 1IN0A 2ZJQQ 2ZH3A 4EBEA 2CQPA 2NUUG 5JXSA 3OBIA 4TYAA 3HHKA 1G2EA 2X1BA 4OIXA 3ETOA 3OVAA 3EGWB 3G4SS 1TKZA 3FZBA 1IUJA 3KK2B 2KHCA 2BACA 4QWAA 3IWXA 2DH7A 2FHJA 4I6YA 5K8MA 2ZH5A 2EG2A 4J9NA 1MU2A 4P7VA 3CCRS 2DGTA 5L39A 3W2WB 1VRUA 2IC3A 2E5GA 1UA1A 1RT6B 2L08A 2FD2A 2B9WA 1C0UA 1NO8A 5K8NA 5D3GB 1D1UA 3HJFA 2B5JB 4TKTA 4RWWA 2FY1A 1IKXB 4AXIA 5CXTA 1QE1A 1F5CA 4IDKB 2OD6A 2HLTA 2DNMA 1V9OA 1RYRA 5LL6d 2C2DA 3UW1A 2PSZA 1YWXA 4BWMA 2OPRB 4M63A 5L38A 4LF8F 2CIMA 3MM6A 4PXDA 5EWFA 1NJWA 4IFVA 3CVKA 1HPZB 3QWPA 4ES1A 1Y0HA 2HYIB 2UVWA 1H0HB 1O8BA 1HQUA 4KKOB 5DS7A 2ROGA 3EYZA 2I5JA 3DI6B 3DLLQ 2BA9A 4LMZA 2VD3A 3CMAS 2NPFA 2CKWA 2ZH9A 1BQXA 4H4MA 5AXKA 4U6PA 2DCLA 5T41A 3KJVB 2GCFA 4IQXA 1N33F 1O51A 2W25A 1CLFA 4MAKA 2ZH8A 2ZD1A 2A18A 2WCXA 3OTBA 4M94A 1Z2ZA 2F40A 2MZRA 3DMJA 4ZPVR 2HFNA 4UUWA 2Y1IA 1D8ZA 2PI4A 2OP5A 4WYLA 2RILA 4QYRA 1C2PA 1S1UB 5DRKA 1G3OA 2WK4A 4ELTA 3M2VA 1DTQB 1A9NB 4NL5A 4O3QA 2B6AB 2KVIA 2IMOA 4K4SA 1UETA 4MKYA 1Y5NB 2ATLA 2VG5A 3OUYB 5HBMB 1J5OA 3ENVA 5DDQC 1LV5A 2QFJA 1K0TA 5GAHI 4PG8A 1RA6A 5IQQA 2IBOA 4B9MA 1S6PA 5FDLA 4OZ5A 1G7CB 2FLPA 3E01B 1FDNA 1WHWA 4KQZA 4DN9A 1NNDA 1ZM9A 2WONA 4MKAA 4GO5X 3ZC4A 3QLHB 2QA1A 2IRYA 4O44B 5A8WA 3LP1A 1S1WB 2HHVA 1RT7B 1W2BR 1U2FA 1X9MA 2PO4A 4KHMA 1VMBA 3MPWA 5B0CA 2FJVA 4LF5F 1N6QA 2UZAA 3CUNA 4QIEA 5KT4A 4LF7F 5GMKa 4FVCA 4F4KA 3JTPA 2WSEC 4QR2A 2QEXS 2J6UA 3GV5B 1QVGR 5KFQA 4ECSA 5EGYA 3RRHA 1RT3A 1MMDA 3BN4A 5FD1A 5LJ3Y 2ZH7A 1IJEB 1D0EA 2Q6BA 5CCLA 1Y00A 3E8OA 3K2YA 5J1EA 5IT9Y 2DHAA 2YTCA 4N56A 4QQBA 4IG3A 2HNDB 1JNRB 4JV2A 2LXIA 5A8KB 2J0QD 4KBIA 1TR0A 2J6TA 5HMWA 3HKWA 2P6SA 4ICLB 4ED7A 2CPHA 1FKOB 2CQ4A 3OFHA 3H98A 2DVIA 4DR6F 2BRLA 3DM2B 4NZ7A 5F41A 5DDRC 3LW5C 3NGKA 4JI3F 2P6TA 1UEVA 2XULA 1SV5B 2RQCA 1HNVB 4DR2F 4LFBF 3T19A 1GX5A 3ISND 2Z2MA 3W2VA 3D54A 2KYZA 1BLUA 1JLQA 5KOWA 2E9ZA 3I6PA 2C3OA 4XO0A 2W9BB 4DOZA 2PMHA 3CJ5A 2ZOFA 3CEDA 1HWKA 4FNHA 2I0XA 4KB7A 2AGQA 2XSFA 2YNHA 4URQU 3OR1A 4DPOA 3OTEA 1S1VB 3MM7A 1ZETA 5CYMB 3H20A 3G6YA 2DCUB 3KG1A 2PA3A 3DRRA 2BBEA 2ZKTA 4AFFA 3MM9A 5BYQA 1KLMA 5LSLA 1HWLA 4H4KC 1X8DA 5HMYA 2EC0A 3C6UA 1ZTTA 4NWBA 3KG4A 4QBUA 1WEXA 5C42A 3D5MA 2VBWA 4B9LA 2CQ3A 4Y34A 4J5OA 2HMIA 2E1AA 2JEIA 3CJ2A 3JTNA 3M2RA 3TX8A 1B0VA 4PG4A 4DSLA 3KFWX 3OL7A 1VC5A 2UP1A 4B3MF 5F8JA 3UDLA 1U24A 3EPGA 3G9CA 2IHR1 5E3RA 3CCVS 4C8ZA 1IQTA 1MNEA 4ECQA 3K59A 3DLJA 2KI2A 5IQ6A 5DG7A 4NRTA 5C25A 5C24B 2CQ1A 1Q1KA 3NWGA 4IOBA 2OFGX 2GQQA 2DH8A 4I2QA 2OPSB 4DEZA 5EX0A 2W9CB 3OTCA 1SC6A 2CFXA 2DNKA 1JLCB 3I0SB 4NYOA 2DGSA 3CCWA 3TAMA 3KLVA 1T05A 2NREA 2RDJA 4WF9Q 3HHLD 3CC2S 1ZPWX 2E66A 3KHGA 4F4XA 4ZP6A 1KD1T 1RDRA 4AYBD 4LFAF 4EEYA 2JSXA 3I5AA 1RT2A 1PGZA 2QLWA 4MK7A 1QY7A 2UXDF 2RF2A 4RW7B 3ZZOA 1U8SA 3HDSA 1FO1A 3LAMA 1DAXA 2LXFA 1KC8T 1URRA 2CVIA 1RT4A 3B82A 2M8HA 3KKFA 2QMXA 3SSSA 5HP1B 1EETA 3GG1A 2K3KA 4I68A 5F3TA 3H4BA 1L5UA 1LOUA 3H2LA 4IUFA 1JLGA 1E6YB 1IJFB 2K3IA 4ZPTR 3OTOF 5KFGA 2YKMB 2K7KA 4JI8F 4ZHRB 5HLFA 1HYSA 3N6NA 1X7VA 4K4YA 4RBTA 1URNA 2XB2D 3LO3A 2ASDA 4YHHF 2ROPA 4PQUA 3TA0A 1MW7A 4O0IA 1F60B 3OL8A 4ILRA 1V3ZA 3OLBA 2GQCA 3NGDA 3V6DA 4B3SF 2RH3A 4DQQA 1SIWB 2Q1LA 2M5YA 5JVGQ 2F8EX 2FPHX 1HR0F 3QJJA 4ED5A 4ETZA 3ZZUA 4JOUA 4DR3F 3BDPA 4LFCF 3SSQA 4USIA 4OLPA 2LDIA 1UVJA 2FJWA 1HBOB 1FERA 2BANA 3F41A 4QIFA 4OX7A 4MFBA 2IA0A 1TVRA 3SCJE 2AWZA 1XERA 5AJ3F 2GJ2A 2L48A 4YFUA 4C8LA 4NYPA 5KFFA 2YX7A 1RTHB 2PA8D 2X51A 4PG5A 3T9NA 1Q86T 3Q8RB 1QAJA 2N3LA 4IR9A 2HNYB 3BB5A 2DGWA 4F4YA 2FLLA 5K14B 3DLBA 1X5SA 1S76D 2MSSA 1Z2LA 3HPOA 4K5SA 4LF4F 3IAM9 3UCZP 1K9MT 2PIIA 2JHEA 2VOOA 4O3OA 1TK5A 3THTA 2BE2A 2LDYA 3CD5A 1R0AB 1JJ4A 3MOJB 2ZBCA 4ZKAA 1S10A 1YJTA 1Q81T 1TP7A 4OHWA 3MM9B 3I5CA 4PPZA 2IA6A 1UVKA 3MFHA 4ECXA 1FRXA 3DRSB 4FS1A 1FK9B 3KLIA 5ITHA 4ZCKA 3VAMA 4EZ6A 1N88A 1H38A 5A8RA 1FJ7A 4YDXA 4DV1F 5LSOA 3GG0A 2CVEA 5KT3A 1R8CA 2YNIB 3G6VA 1ZM3A 3LWLA 3CIZA 4GO7X 1F2GA 2DD8S 2V2KA 5KFOA 3PACA 4DFJA 1RA7A 3MTJA 3SDEB 1Y5LB 4FF2A 3O6QA 4C8KA 2QLXA 3OFGA 5IS2A 2MPUA 3MAHA 3CO9A 1TZ0A 4KTQA 2FVQA 3UI3A 4U9RA 1VQSA 2VFTA 2I38A 3ZZYA 1U09A 5KG0A 1VRTA 1NK7A 3UDCA 1KONA 4K4TA 2KFNA 1VK8A 4HYKA 4F25A 4H4OB 4I2PB 3BGUA 4K5RA 1WHVA 4QIWD 2DJWA 3M8PB 2N7CA 2HG4A 4QOTA 5EN1A 1TAQA 3M9NB 2Q79A 2J7UA 2C3PA 2C2RA 1FRHA 1GT8A 3K8VA 4NA3A 1JLAA 1LXJA 2E1RA 4IKAA 2RVJA 2NZ4A 1ZPVA 1M1KT 3MEGB 1XBWA 1E6VA 2B4PA 2GO9A 3MMJA 2EK1A 1P9QC 1RT4B 5DM6Q 3M8SA 4Q43A 2HWTA 3SCLE 5KT7A 5CCMA 4NLOA 4KR0B 2CJKA 2XO7A 4A8FA 4KGKA 4KHPF 3RYLA 4AL5A 5HLFB 2DHGA 3THVA 1CSJA 4QWCA 3WC0A 4I7FB 1N56A 3GV7B 3CDBA 2HFZA 1UJ4A 2E7WA 4LSLB 4A8SA 1IKYB 3N01A 2CQ0A 2YKNB 1N52B 1NJIT 1IKVA 3T1YF 3EXYA 3MD3A 4GC7A 4A8OA 5L9XA 3D0IE 3CC4S 4M95A 1VQMS 1BGXT 3GFXA 3UFCX 2W9AA 2MKIA 4X4QA 4IO1A 3MR6A 4EU0A 1F5BA 3NAIA 4UY85 2GO8A 4DN0A 4C8YA 3AY0A 3HHDA 3DOLA 2CQCA 3BEGB 1OSDA 1N4LA 4YB1P 1NK8A 1LW0A 5A6WA 1VIXA 3TA1A 2E1MC 3CC7S 3R5AA 4DUYF 4G3IA 4CO2A 4G6VB 4MH8A 1R27B 1QSSA 5LXRA 1M5PC 2PEHA 3M30A 4CZCA 3C6TB 1JIHA 4YR3A 2LEBA 2M3DA 4PWDB 2NSBA 5E0OA 2QYCA 4DMZA 1FKPA 1BQNA 2DO4A 2VZ9A 4ECZA 4CH1A 3O1LA 1WI6A 3QGHA 5A0YA 2BABA 4WCEQ 1SH0A 1IR0A 1FD8A 1HBUA 4YR0A 3P5TL 3BQ1A 2M4MA 1PC4A 2ADBA 1S99A 2HNZA 3LP0A 2F9JA 4DG1B 4C2MA 4NOHA 2R7WA 3V6JA 1NH8A 4WIIA 4WFXA 1LWCA 3BGRB 3PO4A 4NPOA 2VV5A 5DETA 4DV4F 3PJXA 5DO2A 4DF8A 2UVRA 3HT3A 1MMLA 4OI2A 5DDPC 4Z2XA 3PIOQ 1RAJA 4PWDA 2BM0A 4CQ1A 4ELUA 1RTDB 3OR2B 2VB6A 2D7SA 3MECB 5B09A 2MGZB 1N5QA 2XCPA 3RR7A 2ACYA 3MEEA 3I5BA 4RBUA 4KV8A 2RKIA 3AA8A 5B0GA 5BJRA 3FEYB 3MM8B 3WZ0A 5EWGA 2J5AA 3T5LA 4ZOSA 3QAEA 3EUNA 3KK2A 3HXMA 3Q0AA 1R7IA 1U7LA 3BQ0A 1SL0A 2UUBF 4OI1A 1BC6A 1JX4A 1OPZA 2FHJD 5IFMA 3W2WA 5CYJA 3F44A 5GAEU 5F9NA 2OIHA 4X4OA 3HK2A