1LXJA

X-ray structure of ybl001c northeast structural genomics (nesg) consortium target ytyst72
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURES OF MTH1187 AND ITS YEAST ORTHOLOG YBL001C
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL 11.5KDA PROTEIN IN HTB2-NTH2 INTERGENIC REGION
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lxjA00
2IBOA 1S7HA 1S99A 1VK8A 2EPIA 1LXNA 1SBRA 1YQHA 1LXJA 2EKYA
chains in the Genus database with same CATH superfamily
2KT5A 2LEPA 1HWIA 1LWCA 4GKJJ 4B3OB 4PG5A 3NAIA 3PYEA 4DV2F 1NH8A 2MJUA 3DCAA 4I68A 1UL3A 4U9RA 4DV7J 1WSRA 3B4MA 1KC8T 5F8HA 2LKZA 4CH1A 4ED7A 3IS9A 2O66A 1ZZNA 4AYBD 3FBFA 2ILZA 3M2UB 2XS7A 3D28A 3HI9A 1T11A 4RBVA 4ZK7M 4WFBQ 5D0HA 2ASJA 7FD1A 2VL1A 2IM2A 3MHYA 4NX9A 3HD2A 1LOUA 1HARA 3EVMA 3GYGA 4QR1A 3NGKA 4RKUC 4LF4J 2F3JA 2OELA 3M2VA 3W1YC 4ANDA 3PIPQ 2WTFA 4F4XA 2C2DA 3Q8RB 2X1GA 3POTB 2QEXS 1PG5B 2K06A 5DLFA 4ZLJA 3GLJA 1WELA 4FF4A 1HBUB 3AOCA 3FJ2A 3F41A 3P8BB 2OH2A 2OP5A 4EEYA 3QRPA 2YX7A 4G1QB 1RLDA 5LOQA 4WYLA 5L9XA 2DPJA 2UV8G 2DRAA 2FC8A 5MLCV 1IUJA 4MKAA 5K8OA 4CZCA 2B7CB 2FB0A 2KO1A 5E0OA 3FK4A 1XMQJ 3DRPB 2ADCA 1C1BB 2YTCA 3ONQA 3C6TA 4DF8A 3TUIC 4DU7A 3O1LA 4FBTA 1YITS 4QPTA 4JI5F 3GYXB 4I67A 1B7FA 3DXBA 4KO0A 4PKDB 2ILYA 2KT3A 4DX6A 2Z8QA 2A0FB 4NXMF 4ITSA 2AYEA 4YHHF 2BBEA 4Z7CA 2MLZA 3KHLA 3MAAA 2VG6A 1KN6A 3CCJS 2HZCA 4N5SA 1UJ4A 1KVJA 4JV0A 2V2VA 1XR5A 2R8HA 2K3KA 3H4DA 3M6WA 4DG1A 4B3RF 2XULA 2V8GA 1O5JA 2E1CA 2E9TA 4M5IA 1QUVA 2YWGA 4CYUA 4LSLA 2QE5A 1W26A 5FD1A 3QZ8A 2F4VJ 3BM7A 1WG5A 5FIIA 3RAXA 3V4MA 1TFYA 3GILA 1GMUA 1VOMA 3M32A 3M8QB 4PWWA 2C2OB 2H5EA 1S7HA 3LW5C 4L75A 3QZ7A 1IKVB 1HL6A 4JV2A 4FDFA 1L3TA 2KYXA 2HHHJ 4UZCA 1JLBA 2OO4A 3L4BC 1P9QC 3OR2A 3MMBA 1M1HA 2GJIA 4MIWA 4QIFA 5KG6A 3OSPA 5ADZA 1AUDA 2UUCJ 3QSIA 2KFNA 3T6BA 2KT2A 2YKAA 1X31C 2OMLA 3EGVA 5F8MA 2K3IA 1DLOA 3PYDA 3I4PA 2HHQA 2RF2B 3EUNA 2VD3A 1HMVB 2VFVA 4O4GA 4PG4A 4I2QA 4W92B 2YWFA 2D3ZA 1RT6B 1FVQA 2R8JA 3C15A 4JI0F 1K9MT 2XLIA 1VK3A 4ZVQB 4TLRA 3CJ0A 2P9GA 1JNZB 1YJNS 4ED5A 1NDLA 3RG6A 5LXRA 1UEUA 4I4BA 3OUYB 2VOOA 3C6UA 1FFGB 4LFBJ 1FD8A 1R8AA 3AD8C 2XM3A 2XNRA 2PD1A 2LU2A 4RW6B 4TVAB 2QA4S 1NSAA 4YR0A 1L5UA 2XHWA 3AH6A 1TKZA 1O6XA 2CPIA 2IA0A 4JOUA 1NNDA 2KU7A 4MYTA 3ZNJ1 5IM0A 1T3NA 4DV6F 3K5MA 3CCMS 3NGRA 5B0AA 1PYTA 5CHCB 3L7OA 1FF2A 2ZKTA 5DDPC 3CCRS 2AGQA 2BRLA 2BJ7A 3LQVA 4UZBA 3PW5A 4F0MA 3MM7B 1DBDA 3GIIA 1WORA 2D69A 1KSPA 2HS3A 2IYIA 1V3SA 1XBWA 2KN4A 3QJPA 1RHMB 1XMQF 2YQ1A 4YFUA 1HBOB 2DXFA 3G2XA 1EQ0A 1M5PC 1N5YB 2GHWA 4DCOB 1V6HA 4IH7A 4IO1A 4IG3A 4TXSA 5T7LA 3K5OA 3US5A 4F36A 4DR5F 2D3O1 1KWMA 3MM9A 4Q7AA 4OYZA 1Z4UA 3BGOP 5J1NA 2Y0BB 5A8WA 1GXUA 1IBKJ 2FVPA 3I0RA 2XMJA 5KG4A 5DDQC 2DISA 2EFVA 4TQRA 3V6KA 3W64A 5HSPA 2RMLA 1X0PA 2B51A 4AL6A 1ZM4A 5K9FA 1FERA 2JZ5A 2G2ZA 2W2MP 2ZE2B 3ZZUA 2KG0A 2FJBB 2BJ9A 1BC6A 4IRDA 2HZAA 4USWA 4UW2A 1R0CB 3H5YA 2ZZMA 3EGZA 4J9VA 1NK5A 1HHTP 1CVJA 1NEEA 3B78A 5F8LA 3MWBA 4CM0A 2M8DB 2JFKA 2SXLA 3PO5A 3BGRA 4X65F 4OI2A 4PPDA 5D77A 4DBQA 4IH6A 1T05A 2HQFA 3W2VB 2IM3A 1S99A 3L7PA 5CYQB 4OJ3A 5K14A 4EYHB 4IO9Q 3GP9A 2MKHA 3DLLQ 2YX1A 1GT8A 4WYWA 3H25A 3JYTB 4A8KA 1KONA 1AYEA 3KG1A 5DGBA 1NK4A 1J2VA 2BYCA 4RW4B 2DGSA 2XY6A 3BO4A 2PIIA 3KMQA 4NA1A 4KE5A 4PWDA 3P4UB 4K5RA 2NSCA 2ZUGA 2O1PA 4DN9A 2GAHC 1B0TA 2XI3A 3AXMA 3DDNA 2E5GA 4A8XA 1BQXA 2MZJA 3VR1A 2YWHA 3DRPA 3NRBA 5KOXA 2KVQE 3DDIA 2DO0A 2VPYB 4DFJA 1G2EA 3LOUA 4C4WA 2HK3A 4TYBA 4WK1A 4FNHA 3QRQA 1FK9B 3KLIA 3DI6A 4CH7A 4OZJA 4CTAA 3OVAA 4F04B 3PHTA 2YNGB 3KLFB 1WHYA 1DTTB 1C4CA 2LFVA 3C66A 2HAFA 4TU9A 1E6YB 3SSQA 5SUHA 2NZ4A 3U02A 3MF5A 1IBCB 1WG4A 5IXUA 2VPWB 2FPHX 4YY3F 4DV4F 2VG6B 2V2ZA 4A8OA 2MZSA 1SKSA 4DPXA 2RKIB 1D9FA 4DWIA 1FFSB 2C2KB 2E5IA 5IOLA 2MQPA 1Q5YA 3P96A 4MAKA 4RW9B 5KFJA 4KHPJ 3LUYA 2PGCA 2PO4A 1KQFB 1IN0A 3QATA 4X84A 2VG7A 2BE7D 2FYXA 3PRBA 3TWZA 2RNEA 2NYHA 1KDNA 3MAAB 3KJNB 3J7A1 2MLYA 3MUTP 2QL9B 3FBCA 2RQ4A 3IRXB 4DV5J 3CCWA 1U1MA 2WSCC 4NLXA 4E98A 1VMBA 4LF1A 1NSPA 2G2OA 3SDEB 3CCUS 2HSEB 3UDEA 2FJDB 4P74A 4LR7A 4WK3A 3Q83A 4I7FB 1B64A 5C24B 2G1HA 3MEGB 2HFSA 4B3TF 3KTQA 1VIXA 2E7WA 3V4IB 3MMJA 4KJIA 2JEGA 3M32B 3HX9A 2NUHA 2KH9A 5JVGQ 2P6SA 1FDAA 1NPPA 2WONA 4M95A 2IRYA 3H5UA 4B08A 3M2VB 3GJTB 3OFFA 2N3OA 4FKXA 1YJWS 1Q0NA 2HFZA 1JMTA 4BLGA 1Y3KA 2CZ4A 2HWHA 1HWLA 1XIQA 2D3UA 3PR5B 2ZH4A 1S76D 1TKXA 4OX9J 1BE4A 2CQ4A 3TA1A 4JB8B 3VAJA 2IM1A 3TI0A 5CZVA 1PAUB 1HNVB 3CD7A 3U1NA 1X9MA 4U96A 4FYDA 4KO0B 2V6AA 3BBFA 3K2YA 2HWIA 5E3CA 4ZHRB 3CJ2A 4WFNQ 4P7TA 2VFSA 5KFPA 2V4RA 4J9MA 2QLXA 4QIEA 5IS2A 2W9CA 3K17A 1DARA 3CCLS 1SXLA 3AQPA 3D6MB 2AD9A 1RLCL 2M2BA 2V4QA 8AT1B 1LXNA 2EK6A 1Y9OA 2YVSA 1EX8A 5FDLB 2CQ3A 2QLFB 4W98A 1EQMA 1OO0B 2B9YA 3PNIA 2KJVA 4TNOA 5ETOA 3QIPA 3T1YF 3K89A 4DSLA 2IPOB 3WIVA 5GMKa 2IY5B 4ZCMA 1Q1KA 2AEMA 1YRXA 1KBRA 2QA2A 3AY0A 2FGOA 3N01A 4LFCJ 3G96A 2D1CA 4RR5A 1G4CA 4V19X 3NLCA 1SVDA 2JLFA 4DN0A 2N82B 3HP6A 1NSQA 4OX7A 3MPYA 2OSRA 3NXZA 4ED2A 2HNDB 3Q8PB 2Y8YA 3CF5Q 1NK0A 1TMMA 1IM6A 2J8SA 1ELOA 4ZPAA 1CLFA 4C8KA 2H48B 1S1UB 1L3SA 1CC8A 2RHQB 3MEKA 1WEXA 4DUYF 1XR6A 2VKRA 1YSJA 1H98A 2OD6A 3AD9C 1Y10A 2DHSA 1Z1ZA 4F26A 3KMSA 4CLYA 3H40A 3H42A 1PJ6A 2WCXA 3DDKA 3UDCA 4CLSA 1I94J 1DRZA 2BJDA 2EC2A 2XMUA 3OPKA 3KJQB 3W2WB 4ATNA 2W7PA 1FXLA 2R7TA 1XMOJ 3OXGA 4Q2MA 3I5AA 1Q4RA 3UDLA 3DLGB 2HFUA 1X9WA 5ITHA 4WZQA 4JV5F 2FHJA 3N79A 2CDRB 2V68A 2A2DA 3LA0A 1U1PA 1U4BA 3KJVA 2VJVA 1GXLA 3DRYA 5F0WA 4LSNB 2FHKA 3IXQA 4URSA 5KT4A 1CJTA 1EETA 2W8LA 3PO4A 1NCLA 3MTKA 3HF5A 3TX8A 2FVQA 5L1IA 2FVCA 2OD4A 4P72A 2AX1A 3LANA 2WSEC 4USMA 5DLGA 3GR1A 4R5PA 3G8QA 4R8UA 4ENOA 1PILA 3VVTA 3GV8B 4XIUA 3ET6A 4IH5A 1VK8A 2JC0A 2YNHB 4WWSA 3W2VA 3G6VA 2AP6A 3AT1B 4K4TA 5EX0A 3J81U 4ECRA 4YB7A 3OLAA 3DLBA 2ZNYA 4C3KA 1YWXA 4ZVFA 4Y0FA 5AXNA 3MMCB 4G3IA 4P7VA 3K57A 3OLBA 4MTPA 2CPXA 3UCZP 1BWEA 4PYDA 3RJMB 2CJXB 3HHDA 1Q8BA 2E1PA 1XQIA 3FQLA 3QGPA 1P1LA 1FJGF 1RHKB 1Q8IA 4FS1A 3VALA 1DAXA 2DH7A 4M5JA 2HHVA 1VLYA 4KRWA 2HMIA 3I87A 2KZMA 2HRUA 1RGVA 3QIDA 3PFEA 1VQPS 2YQ0A 2ZD1B 3NGUA 4KFBB 3BZQA 2P9CA 2AF6A 1NK6A 2QZ8A 1C1CB 2AYMA 2BKOA 2U2FA 4LREA 4CM2A 5GADU 2HZVA 1FHTA 4OYOA 3CMAS 2BACA 1FDDA 1IQZA 2EK1A 3BN4A 4G1PA 3HSGA 1X4GA 4FXWA 2CNLB 3RR8A 4M5GA 2J6SA 3IBFB 4PXDA 1KHVA 4C9DA 1LV5A 1DJ0A 4M1KA 2CWKA 3W5XA 3VWSA 3OHAA 5GAEI 4DCJB 4NWBA 4J9QA 2W2NP 3D54A 4B3RJ 3OTBA 1MMNA 2R7OA 3H59A 4IR9A 2RJZA 2VBWA 2AJQA 2R7XA 2DJWA 3GFXA 3SQGB 4K50A 2UUAF 1FEEA 3MEGA 4LIRA 5CYJA 1S1WA 4ZVEA 1NK9A 5HMWA 3GPAA 1XMOF 2IBOA 2JEIA 2XLJA 2KJWA 1N34J 3BYRA 1VQSA 1GNKA 1RAJA 1RHUB 3MEDB 2ZJRQ 3TOQA 4O3RA 2VBZA 5A0YA 2MGZB 3C16A 2XZWA 3NCQA 3PJXA 3JTNA 1Q53A 5HBMA 2FJXA 5IT9Y 1PJ7A 1Y3JA 3CDEA 5DO2A 2WSFC 4L74A 1N48A 1KOHA 2IDLA 3BBCA 2FGCA 1S1VB 3T1AA 2WRMA 4TY8B 3W8GA 5BYQA 3CO0P 1CJVA 1G3OA 1V3ZA 3G82A 5FLXY 1L3KA 1QAYA 2WVCA 4DPUA 1KLMB 2UU9J 1SBRA 2NXJA 3AHPA 2CNNB 5G0RA 2CJ9A 5HROB 5D8HB 2A1BA 2IMWP 2XCAA 3ZTOA 2EXUA 1BLUA 5E7OB 5IQ6A 3CC7S 2BABA 4WP3A 4OZ1A 3P3DA 1SKRA 2FLPA 4H4KA 1J5OB 4I1TA 1NK7A 3OT9A 1R0AA 3X1LB 1HQ2A 1Q8KA 2CZ9A 2DGVA 5IWAJ 4UT4A 1HPZA 4DFMA 1HWKA 4ELTA 4M8LA 1HNWF 1N5YA 1FKPA 2DHAA 2RB7A 3PTWA 2HGNA 2JNJA 2DHXA 1XWLA 1EKRA 2QIFA 3MGJA 4JP8A 4KH0B 4OHVA 3SBMA 3HXMA 8RUCA 2JLGA 3S01A 2P2CB 4NLQA 2JFDA 1D1UA 3WC0A 5CCMA 5HROA 3O2IA 3MTJA 5HL7Q 1VQKS 4J37A 3DOLB 3HZEA 3EPIA 4NLUA 1CULB 2E44A 1JXVA 3QWUA 2DGTA 3RB3A 3G82B 3VAIA 1FFWB 1PBUA 1RA6A 1WD6A 3FBBA 4WXOA 2XO6A 3RYLA 1JX4A 4NE9C 2MB0B 1S9GA 3QT8A 2HVDA 4ZVUB 1X4EA 5HMYA 4Q43A 3HHLB 4Y2IA 2M7SA 1RAOA 3U7JA 4KGZB 4HH0A 4O0IA 3A13A 1E6VB 2CPJA 4LRDA 2C3PA 3H4BA 4DL0C 1VQ9S 1TQLA 1FI4A 4XTTA 3CCTA 3AA9A 1EZZB 1TFWA 3KDNA 2QA4G 3TANA 2I0XA 1BGXT 3GFZA 2BW2A 3ZZRA 3BPDA 3ENVA 4QWDA 1LKZA 3B4DA 2VC1A 3G4SS 4DFKA 5I42A 1X4DA 2YBVA 2PN6A 2YNFA 3V6HA 2MQMA 2OMOA 2VQEJ 2LDIA 4OI0A 1HFEL 1AA1B 1V9OA 3HJFA 1WC6A 1Y11A 3HFVA 3CC2S 3H20A 2V0NA 4DS4A 4DL4A 1HI0P 2GJFA 1F3VA 4KB7A 2I5JA 4QJVA 1JLEA 7AT1B 2F63A 2JC1A 3IO1A 4DG1B 1F6TA 1JJ4A 1RBAA 1I3OB 1VR6A 2DYAA 3MM9B 4DZDA 1VC6A 2HHSA 3LH2S 3S1TA 3G6YA 4AT1B 3S7RA 3FMWA 1RWVB 3D6FB 3JB9k 1BMQB 3B8HA 1TL7B 3CJKB 3QT6A 1VHIA 1KP6A 2CPYA 3PACA 2XQCA 3H8YA 2KVIA 3EVOA 2DPIA 2W7OA 4IRCA 2UXBF 4M5HA 4IG0B 3TO8A 1HBNB 4A47A 3K8VA 4ZP6A 4AQYF 1T8EA 3D4JA 2JH3A 3UN5A 3OTOF 1SPBP 3SSSA 2ZH5A 1T7PA 3J80U 2AJFE 3VZIA 1U2RA 2DGWA 4Z37A 5K5MA 4A8MP 4LF9F 3M7VA 3Q22A 4OIXA 5CYMB 1WKLA 1ZBTA 2G0CA 3NG8A 5IWAF 4W90B 3LF0A 4YEAA 3G6XA 1LK5A 3I9ZA 5CD4A 2F8HA 3EGNA 2GZOA 1S1UA 2JOQA 2ZOMA 3FEZA 4FNIA 4BDPA 2RRAA 2FJWA 3C2PA 2HNZB 3R8YA 5B0FA 1UPMB 3WX4A 1JNRB 4C6AA 3DC2A 1RDRA 4PYAA 3GIRA 4RW9A 2GV1A 3ENQA 1S1TA 1MU2B 5E3RA 2R8KA 3RUBL 4Q0BA 1HKAA 5KT5A 1RWMB 1YJ7A 1RJJA 3BREA 5KTQA 2DNHA 2XCPA 1MMLA 2LU1A 4ECZA 1VBYA 2O5DA 4IOCQ 2HGMA 1X5PA 3AAWB 3IN5A 4KC5A 3BS9A 3PM9A 4KHMA 5EDWA 2XHCA 2J0XA 3M8ZA 3CIZA 4CTAB 3OVSA 2QLJB 5ETRA 5GAGI 2HBZB 3F44A 2MEWA 1GTEA 1AW0A 1J5OA 1RAHB 4DX7A 2L9NA 4ZLNA 2UUBJ 5EWEA 4ED3A 2XGPA 2F7VA 4B3OA 2R8IA 1X5SA 3MCMA 5H9EK 3V4IA 4KGKA 3MI7X 4Q8FA 1H6KX 2GS8A 3VAHA 5L8RC 2I1RA 3MR5A 4C8LA 1S5ZA 3SCJE 2GQ2A 2VBYA 2ZHBA 2J6TA 4JI3J 2OLWA 3QO9A 1WHVA 2MQLA 1GK8A 4C8YA 2QFJA 3IRWP 4C0OC 3B54A 4CLZA 5BR8J 2V67A 5GAEU 2BEFA 3A8JA 5J2MB 1MSWD 2WAQD 2B0GA 2FVRA 3OV7A 1R27B 5CXTA 3H5SA 2J9CA 5FJ4A 2QC3A 4DR1J 3OW2R 4P52A 3MCNA 4GKKF 1YG0A 3C14A 3M8SA 3JXOA 4DQSA 4OZLA 2H65B 2E5LJ 4C8ZA 1SQGA 1O0PA 4ZITA 5D4OA 2IAJA 2Q1LA 2WB1D 5IFMA 3EZOA 3TVKA 3FQKA 1SB6A 4KIAA 3H5XA 1RU2A 2VIHA 5L46A 2AMCB 2YKNA 2NCKL 2N3LA 2C1EB 2ZH3A 1X4AA 2HLUA 2FVSA 2ACMA 3CEDA 3SDEA 3H90A 2N4CA 2QL7B 3GYNA 3D67A 3D3CJ 2MKYA 2RIJA 3GCWP 1R0AB 4ETXA 3ZZZA 2YKMA 1UJ5A 4LUBA 4FKYA 1U6BA 1R43A 3MMAB 2IRUA 1UKUA 1EHWA 2DD8S 5HATA 4DR3J 4MJKA 1JKHB 4KBIA 4V1Ak 3TX0A 5J2MA 1TK0A 2QO3A 3CDBA 2E9ZA 2GHPA 2A18A 3Q86A 1CJUB 3IWLA 4X4QA 1WSVA 2K7KA 3CJSA 4OYMA 3IC1A 2B9XA 2X3GA 3BR8A 4ID8A 1HMVA 2CVIA 4K2XA 4UUXA 1X4CA 4DV0F 2FZKB 4IUFA 4XDDA 1SKUB 2OKQA 4Y34A 4ZVGA 1OPIA 1WOOA 2GQQA 5A8KB 4J9KA 1SL1A 5L1JA 3G9CA 4X64J 5HQLA 5DGAA 2VODA 4UOHA 2Z58B 2EPIA 2KHDA 4CLFA 3V81A 2BVZA 5C42B 4JV5J 3MEDA 3TVYA 3M1VA 4OYXA 3VQSA 2DR7A 4JI8J 1XTZA 4F2SA 4CLTA 1HLWA 4ZPWR 2HEKA 4DV7F 4J9NA 2PC6A 4K0KF 2XNQA 1FNMA 2GVZB 2B4UA 1OSDA 3GZ7A 2VB6A 3I9V9 3NOCA 4Y00A 3ZZTA 2LA4A 2BQUA 2OPSB 3ILOA 4ZPDA 1VFJA 3LWMA 2UUTA 1U49A 2HW3A 1R8CA 4PG8A 4X4RA 3MM6B 3KLGB 4M5DA 4NLDA 5EGYA 2CQ1A 1N34F 1F5BA 2MHNA 4DHVA 3QGHA 1JJCB 2J5AA 4X4PA 1Y5LB 4ED6A 1F3FA 4I2QB 1V5VA 1BWVA 2VFRA 5E3PA 1RWNB 4CO0A 1KHWA 1SC1B 2J7WA 2DXEA 3ULHA 3AXKA 4ZS6A 3T1HJ 1TK8A 1FJ7A 3QIPB 4GVLA 3G6ES 4C2MA 2CG4A 3LP2B 1C0TB 1CULA 1U1RA 5HP1A 2E5LF 2VFUA 2KHCA 3M8WA 3NKYA 1QUPA 3EJMA 4LQ9A 4LRFA 5EUHA 4QWEA 2OPRB 5A8RA 2HBYB 2ROPA 4USTA 4DV6J 3EGWB 1FT8A 3D1OA 4QWCA 2DNNA 2NLWA 2WOMA 3NGDA 2MQNA 1O51A 1H72C 2MDAA 1ZA2B 3NS5A 4HEA9 3M8PB 4OZ2A 5LXYA 1APSA 4YY3J 2KL8A 1SC6A 1CPZA 3R9LA 4DMZA 3LAKA 3N6LA 4LT6A 3HULA 4MFBA 3SZ2A 5KAKA 4DR5J 5DQIA 3DM2A 4QYRA 5GMDA 1HWUA 3HHLA 3ENAA 2HIYA 3K8WA 2JVOA 4I2PB 4E8UA 2EBEA 1UZDA 2ZJQQ 4YMEA 1WOPA 3DRSB 1Q7YT 2M88A 4MIBA 5DETA 5AJ3J 4NLYA 1VQMS 1YHQS 1S97A 4C11B 4NRTA 3RTVA 4DQRA 1Y00A 3MURP 2OEJA 1BQMB 4X4SA 1FX4A 4Z7YA 2ZOFA 5IZHA 3FC9A 5LMNF 1MWYA 5KFFA 4F02A 4O44B 1WEYA 2B9WA 2HRYA 2YWKA 4RZRA 2X51A 3MDFA 1UEKA 4I56A 3PYGA 4P75A 2Q6CA 3KYLA 3F73A 4GVBA 3CCES 3PJWA 1UWBB 4HKQA 1TUVA 3BSAA 2FJEB 1JLAB 2QFIA 1OY6A 5F3TA 1X4HA 3L95X 2YNGA 4DV2J 1G1XA 2BA9A 2R7UA 2JX2A 3NP5A 3CJ4A 2DRDA 5DZ6A 1B3TA 4MT1A 1TZ0A 2XYGB 2KM8C 5KOWA 1M5OC 3TJ8A 5E3AA 4HYKA 2C28A 3QRRA 5DRKA 1TKTB 4HHUA 3J7ZT 3UVJB 2GIRA 2LVWA 3QFWA 1ZA1B 3KUEA 4DSIA 1U0HA 2HLTA 3GR0A 1RAFB 5CH7B 5ETLA 3GIKA 1RT1B 1T05B 2EI5A 2E1RA 4ZA1A 2ATCB 2DNKA 5KFMA 2ATLA 1K47A 4C11A 1UPPA 3QO9B 3EXCX 4ECYA 2RS2A 1ZH5A 4LFAF 1KVKA 3RBDA 4LSNA 2DBBA 1UJ6A 2HS0A 3R5DA 4BWJA 4F25A 2C2ZB 1T9TA 4EO8A 2EFQA 4MK8A 4GKKJ 1RXOB 2H54B 2PSZA 1NDKA 3HO1A 3VAMA 2W9BB 3DLGA 4KFBA 3CULA 1S59A 1T94A 2ZWPA 5IT4A 1XK8A 4EO6A 4A8FA 1PCAA 2J7UA 3DHXA 4X66J 3KJFB 1R3NA 1FDBA 1AZSB 4U7CA 1NXIA 4CO4A 4WKRA 4X4NA 1CS4A 1PC4A 3WX8A 1IR0A 1T3OA 3BGFA 2F8MA 1EP4B 3SQGA 3W7BA 2K1RB 4QYZK 1REVB 1C1BA 4PUOB 1S4EA 3M2RA 4JI5J 2MY7A 4H4MA 3SCLE 3TR5A 3MR2A 3RBZA 4ZIWA 4MK9A 3BO3A 1QVFR 4G6VB 2FTRA 2KB2A 2IJRA 3L7UA 1TV6B 3NBPB 4ZCLA 2JEFA 1SC3B 3UR0A 2XSFA 1RTIA 3C14B 3IFEA 3MAQA 3T5LA 4RX6A 4LRBA 3KK2A 5ETQA 2DNRA 1FRMA 1TKXB 1IKWA 1UA0A 1Q78A 3CC4S 4QYZJ 3ZTPA 2YNIB 1HBUA 3CMQA 4P2MA 2AEJA 3IWXA 2V8PA 3W65A 1RHJB 1TL1B 3BPSP 1Y5NB 4F0KA 2LQJA 4L3NA 3SXLA 1IKXB 2GAGC 3M6UA 2VQEF 4H4KC 4U8VA 3FCHA 3G71S 5BXIA 1R89A 5JVHQ 1DQ8A 4EMDA 1Y5IB 4JYAJ 2HS4A 4OYPA 1UVJA 4RW8B 4FVMA 3GSIA 3MPUB 1QE1B 1SJ4P 1WWHA 2OPRA 4I7FA 5A8RB 2XS5A 2HVIA 3A12A 4B3MF 1HW9A 1JLQB 1HPZB 4YR3A 2UVUA 2PE8A 2JSXA 4DQIA 4M5MA 2IC3A 3CJ8A 4CP5A 4QQBA 5KFBA 4FS2A 4QBUA 3MZIA 3Q2TC 1PIEA 2DGXA 2KRBA 3Q89A 2LQ5A 4OX9F 4JI6F 3R97A 1HQUB 2O01C 5IQQA 2V8VA 4J91A 5D4LA 5F8IA 3KK3A 4Q2LA 1RKJA 2C3OA 1YI2S 2JEJA 2DGQA 1IXKA 2GMHA 1TP7A 2MZRA 3N5FA 4U8YA 4TLQA 4AQYJ 1RT4A 1PYSB 3GJQB 2H5JB 1TAUA 2Y1IA 1VDHA 5EX3A 4YDDB 1HNZF 4B9SA 2YKNB 2VFTA 1XEZA 1X5OA 2DB1A 2YNFB 4KKOA 3GV7B 1RYSA 1RK8A 2LQBA 4NLOA 2AQ4A 4EU0A 2Y9HA 2FLOA 1FXDA 3D9BA 4ERDA 3D1HA 3MPVA 1JLBB 1U8WA 4IYQA 4CYUB 5BYSA 3M9NB 2AGOA 4WF9Q 1Q16B 1HNVA 2EW9A 3CXCR 2R9LA 1DFDA 3K7RA 2HGLA 1S6PB 1VRUB 3TP2A 4K4UA 1NRKA 3NAHA 1U8SA 3DOKA 3OFGA 3MECB 1YTYA 1JLGA 2UVWA 1G6BA 3S6EA 3SMZA 4WTOB 4OYIA 5DG7A 1W2IA 4CI0B 3T5KA 2DNMA 1SV5A 3L9ZA 3O5TB 2VPXB 3TJ9A 2FIUA 4ANEA 3QT5A 2DTJA 3TAMB 5A76A 1VGYA 3MM8A 5AE2A 5H1SV 4B02A 1OJ4A 1RT1A 3FSIA 3ISNC 4KHPF 4DLEA 2LEBA 2EFPA 3MR6A 3BH6B 1WEZA 1PYOB 4F3QA 3DM2B 4DR3F 5U47A 4B9LA 1RI7A 2YPYA 5M2RA 1S6PA 1S6QA 1HBMB 3R1HA 1K0TA 1FKPB 4YS2A 4ES2A 1M5SA 4USVA 4ZCIA 4OV1A 2OFHX 4ZJLA 4ECUA 2DNOA 2LLZA 1CEZA 2ZH1A 1NHVA 5CQGA 3NOGA 2ZZNA 3Q23A 5F41A 1R31A 2DH8A 1CS4B 1YJUA 3T3FA 4NL5A 2BX6A 2Z2YB 3VTIA 4C0BA 4DQQA 3W61A 2G4BA 2BE2A 3JTPA 3PEHA 4KYZA 4UQTA 5DQHA 3NS6A 1C0TA 1Z2LA 2NYIA 4ECSA 1QAJA 4IR1A 4LBPA 3JSMB 1SKWA 5EN1A 3PY8A 1IWAA 1KOOA 3KLEA 4P9SA 3FRZA 4AE5A 3NY0A 1R8BA 2C2MB 2Q3PA 2CRLA 1KEKA 5CYQA 4DR6F 3I96A 3BQ2A 1S9FA 1OIAA 1UVMA 3VHQA 5BR8F 1Q7LB 2W1BA 4YR2A 4OZNA 1ZPWX 3LAMA 1RUSA 4PABA 3D1QA 5FDLA 5D3GA 4PG7A 2BW7A 4R0JA 1CJKB 2CQPA 2Q43A 1S1WB 2C42A 3BR9A 1JB0C 2AV5A 1AXQA 2IIHA 4ILRA 2PA8D 2QSWA 1TKTA 3D68A 3GIMA 4F8RA 3R3TA 1RHRB 1DTTA 1N54B 3BF4A 5DS7A 5HMXA 3THVA 2IHR1 4RUBA 2B4PA 3M9OB 1S10A 3CUNA 4PG6A 1HD0A 1MMDA 4XAKA 3EYZA 4DSEA 4FYVB 2HHUA 2ZBIA 3HMJG 3CT9A 3Q8VA 1FRKA 4TU7A 4WP9A 1ZM9A 2KFYA 1GQEA 5I3QA 3LGMA 3SFGA 3BDPA 4GVBB 4ZVSB 1UVIA 4HACA 4ZPCA 5GAHU 4QZVB 4PEOA 4QCLA 2WVBA 2BV3A 1HYSA 2R7SA 1S1XA 2AZ1A 3I55S 2HHTA 4H54A 3I6PA 2DGUA 3DYAA 2VQFJ 2WBRA 4OHYA 1QSSA 1TV6A 2CZVC 2GVDB 2WK4A 4WFXA 2OAUA 5D78A 1NZAA 3MR7A 4WP8A 1MWQA 1S48A 2DY9A 2GC8A 5B7WA 3PZPA 4BC9A 4OI3A 1QVGR 2X1FA 5IC4B 2Y1JA 3CO9A 1SUQB 2ROGA 3IR6B 2R8GA 2K1RA 4OYBA 1D3WA 2M70A 2HIQA 1DY3A 4DR4J 2KXFA 3KHRA 4DV0J 3SEOA 1QJHA 4OI4A 1VQOS 1FK9A 2RUSA 2BE2B 2GFFA 2GIQA 3KLIB 4ETZA 2A6OA 1N36J 3BN7A 1L3UA 4RJVA 4EZ9A 3R5JB 1RB0A 1KNZA 2H3EB 4BCAA 3GCXP 3PFOA 3W9IA 4UUWA 3PKYA 4NLTA 4HI1A 4DL3A 2VC0A 1U25A 2JVRA 3AODA 4NCGB 2XMWA 4U95A 4WPAA 1R6VA 1Y4ZB 3CDWA 4ILMA 4LF7F 4K4XA 3R1LA 4K0KJ 2AZ3A 2IMOA 4B3SF 5I3UA 4CIOA 1SV5B 2CFXA 3GIJA 3OR1B 5KG7A 4PXEA 4HH1A 3GQCA 2Z0GA 2J9DA 2MKJA 4HHHA 4W4MA 3SCKE 2R7WA 2B43A 1R7IA 2B8PA 4LSZB 2UXBJ 1NUEA 4M5LA 2I9SA 4H4OB 1TUWA 3ITHB 3KOAA 2M9KA 4ZVHA 3VVUA 1MW7A 3KUHA 1FWKA 5LMUJ 1T03B 1HNZJ 5KFYA 4EI2A 3KNAA 2WB4A 3WZ0A 4LF6F 1SQFA 2K2PA 3DHWC 1ROFA 4URGA 3TAQA 4LF9J 1REVA 4PUOA 3D5MA 2UXDJ 1UFLA 3L3CA 1X4BA 4RLEA 4ZPVR 2F40A 2IVMA 3IR5B 4UQGA 1HI8A 3IM9A 1R0BG 4L3KA 2B7BB 3VGVA 1NH7A 1VS3A 5KFHA 2ZC4A 3QLHA 5DG9A 4D3HA 2UP1A 1M1GA 1ZTWA 4RL1A 4OHXA 2PDAA 4O3OA 4I2PA 1UVNA 2CQHA 2ZNZA 3OR1A 4J9LA 3BSCA 3FMBA 3LGHA 2J9DE 2VPZB 1RSCA 2E1MC 4BWMA 2DNZA 4JUZA 5A2QY 3CCSS 2XI2A 5H9FK 4DV1F 2CXEA 4UOFA 2EFOA 3IBCB 3MOJB 3H7HB 1GMWA 4A46A 1XJWB 2G0JA 5C25B 5J2NA 1RWUA 5HVHA 3TZYA 2OPQA 1KQKA 2PMZD 1WKKA 2BKPA 2VH7A 3CIMA 4MKVA 1N8RT 5F8NA 2Y0SD 3HSJA 2OPPB 3HVTB 3M6VA 4K4SA 3T41A 2UUAJ 2OTJS 1I94F 2DVIA 1PJ5A 4OX8A 2ZHAA 5A6PA 1PBAA 3A8IA 2F9JA 1NJIT 1F5CA 4ZCKA 4ED1A 4B9NA 2NS1B 1Q81T 4KPYA 2XB2D 2ADBA 2J0WA 3K5NA 5ETNA 2RQMA 3DLEB 5LSLA 2EG1A 2ZKUA 5KFZA 3BJYA 4ZP7A 4QWBA 3LALA 4NMXA 4DUZF 3K58A 3FZBA 4NCBA 1TAQA 1WI6A 1KS2A 2BUNA 3PXGa 1BQMA 2QMWA 1HHQA 3TNVA 4Y2AA 4CLWA 1KTQA 2DNYA 2RQKA 4O0NA 1FKOB 3H2VE 4QWAA 1HA1A 1GMVA 4I6YA 5ETTA 5ETPA 1U02A 4NXNJ 2ZZTA 4IOBA 1F9EB 2Z2ZA 3E3XA 4RNOA 1VBXA 3MECA 1JLFB 2ZBCA 2BANA 3UW1A 3E01A 2RS8A 3BEGB 4DL7A 1XNQF 5IV4A 2FY8A 1SQEA 3VCDA 2HQIA 1AUSL 1Q8LA 3CJTA 1UMJA 1VHFA 3PX4A 2LDYA 3V6DB 4WZMA 2DR9A 5ETSA 1TR0A 2MQQA 2BRKA 3PW7A 3PX6A 5KFUA 2E5HA 1LFWA 5L1LA 4MH8A 3OUYA 4X4OA 1GXTA 1FDNA 3TW0A 1YDLA 3OTDA 3R27A 1HD1A 1FRIA 3I5BA 3ZTRA 3Q8UA 3VGTA 1WC1A 3OTCA 4KHRA 1IBKF 3F56A 1P8GA 1U26A 2B4OA 2QRRA 4RW7B 2R2RA 2QSFA 4P2XA 4ES1A 1A7GE 2F5GA 3ZC4A 3AOAA 3P5BP 5CZXA 2VHGA 3AOBA 4WU3A 3SFUA 3CD6S 2ZFHA 2F4FA 2LQ9A 2XSJB 3MD3A 1NLKL 4G65A 4O3NA 5T41A 2YKQA 4ZKAA 1K44A 1R8PA 2DRBA 4C0HA 2G1DA 3CW2C 3CJ3A 2H1YA 4XO0A 5DZ7A 1U0SA 2DEJA 2CPFA 2L9DA 3DRRA 2PI4A 1F1BB 2R2TA 2GQCA 2LXFA 2BQ3A 1R8HA 5B0GA 4K7QA 3BGUA 1OSCA 4PQUA 2HVEA 1N5VA 1VISA 2YWEA 2ZE2A 4O44A 5H9EJ 2AX0A 5IT0A 2VDHA 2HVZA 3GG0A 4PCQA 1DHMA 2HNYB 4ED0A 4RW6A 4HT7A 1T02A 4KGXB 1A0OB 1VCTA 3DOMA 4N77A 3ET6B 3BSOA 4RPFA 3PW2A 4X4TA 2HG4A 4NYPA 2CNOB 1UA1A 1RAGB 1F9HA 2R4FA 4F3MA 3IM8A 1V3RA 2ZH9A 2WHOA 3VAKA 3KLVA 1M5KC 1K0VA 3N5BA 5HJXA 3SCIE 3PRDA 3OBIA 2LQ8A 1U0HB 5B0DA 4H4MB 1ACMB 3MPDA 3LGNA 1IJEB 4LRAA 3AFGA 1F9FA 2FC9A 4FP9A 2CQGA 4X62F 1OS5A 1M5VC 4YOEA 2H4YB 4CLLA 3IGNA 4ZJOA 4OX6A 1YVFA 2CJAA 2EEYA 4MYUA 2XZDB 4PR6A 4KT0C 1T03A 3HVTA 3A8EA 5IC6B 2GO9A 3I0RB 5C42A 1DTQB 2DNQA 2W9BA 3D6TB 4F4KA 2QN6B 2YNHA 1U6FA 3RB6A 1HW8A 1SUQA 3KK1B 1SH2A 2ALYB 3UQSA 1PC5A 2W25A 4S0MA 1EAYC 2Z2MA 3HSZA 2MYFA 1YJ9S 4ID5B 2MMYA 2EFGA 2VASA 5J2PB 4CQ1A 1Q82T 3EDQB 1WHWA 3GWCA 1K1QA 4FZVA 3V6JA 3J7AN 4L6V3 1SIWB 4LIWA 5AE3A 4JI7J 2IJFA 3OHBA 1B7YB 4HDGA 3NGSA 4MIAA 3QMQA 2UVVA 1D9AA 1S9GB 4FBUA 1CQNA 2DCUB 2QJ3A 3BSNA 1HWJA 1NMEB 4NZ0A 4OJHA 4LFCF 3UCGA 2E7VA 2DCLA 4KGMA 2OEKA 2RT3A 2ZD1A 4K4ZA 1S0NA 3UE2A 4FF1A 1NJWA 4LBIA 1MG7A 3N9UC 3UD3P 2ZDOA 4ZMMA 4WTYA 1NHKL 3EICA 1X8DA 4O3SA 1F2HA 2GW8A 1DQ9A 2DGOA 4IQXA 4DUYJ 5JXSA 2QGFB 1Q5VA 3M8QA 3MEEA 3M6XA 2W01A 2EG2A 3DMJB 3NS7B 5HVFA 4ELUA 2F4VF 2AHOB 3I0SB 1B4SA 2CG8A 1HHSA 2XMKA 2NPIA 4JI3F 3BQ1A 3IRXA 2WVEA 3T9ZA 3PRVA 3CDUA 4TY9A 1K73T 1S6OA 1S0VA 3R2CJ 2M4MA 1S7IA 2ERRA 1U6ZA 2M0GB 4RNMA 2CJBA 2ZITA 1FVSA 5B0EA 3MM8B 1BUXA 1NAQA 4OQJA 5A0YB 2IBKA 4NLRA 1ULRA 2MQ8A 4USHA 2BJ3A 4ED8A 3A8KA 2R7VA 1VJQA 2MZTA 4RUHA 5HO4A 5GADI 1VIOA 4WXWA 4OMFG 2CKWA 4HI2A 4NYOA 4FF3A 2BKNA 3SI8A 3FEXB 2OI2A 2NREA 2RH3A 4LF5F 1TTHB 3DLEA 4RNHA 2MTLA 4N8OA 2MXYA 3J81Y 2KXNB 4TN2A 2R2UA 1FCAA 3SYZA 4F4AA 3D3BJ 3OTOJ 1LW0A 4K59A 4YB1P 1OY8A 4RO0A 2XGQA 1JJ2R 2BJ1A 5LMUF 2NXUA 3A1YG 2AJ1A 4RWWA 1JLAA 4TKTA 3C8YA 1HI1A 3FEYB 5JJBA 1X4FA 4FVCA 3IWNC 5K8MA 3OFEA 5AE1A 1TL5A 4ZVPB 2J76E 3RW6A 4RW7A 3OJUA 4EBEA 2VA3A 2HNDA 2UUWA 4BC7A 3EPGA 1TMJA 4NZ7A 4DSFA 1TL4A 3TZXA 4M5NA 3K0JA 3QJJA 2QLWA 2RAQA 4USKA 3U1MA 3ILJA 3TEHB 2AW0A 2ZBRA 4A48A 3BB5A 3P49B 2LYVA 2VV5A 3LPEA 3MR3A 3QBCA 5HLFB 1AFIA 1KQSR 2GVZA 3CD5A 3M2UA 4MFBB 1B99A 3HZGA 3TEGA 4C48A 3KLFA 1X7VA 3ILIA 2XMTA 4O4RA 4EYIB 4DX8H 4WE1A 2L41A 2LCWA 2QX0A 1LW0B 2QT7A 3DRXA 2FLLA 1MROA 3QAEA 4IFVB 1UP1A 4DR4F 4N41A 1U1OA 4IG0A 4X65J 3ZZ0A 4B3SJ 2ZH2A 1KTVA 4FPIA 2QYCA 1EARA 4ECVA 1YK9A 3H0PA 3JQKA 4CLUA 4J7CA 3D0IE 1LK7A 3PG9A 1QD1A 3DYAB 2JHEA 4OZ0A 1B0VA 3CSKA 1T9XA 1RT5B 3FSYA 5GVQA 4F0HA 2RRBA 5KT7A 2HPUA 1XC9A 2DO4A 1NKEA 2XC9A 3KLHA 1S12A 5LT5A 4HACB 5KFNA 2OUGA 1YGYA 1YKWA 4DV3F 2B4VA 2OFGX 3HJVA 4J5OA 1FEHA 1S79A 3HT0A 4UOCA 1UW9A 1UZHA 4KV8B 3KK2B 3JTOA 5FLXU 1RISA 4L76A 4ECTA 1BQNA 1JLCA 2GA7A 3TAPA 3GFHA 3RAQA 5CYMA 2VONA 2NXNA 4ZDNA 1NU4A 4DR2J 3M8PA 4J90A 2M3DA 3OJSA 2JDJA 1A6LA 1QSYA 1I1GA 1K1SA 2XY7A 1GEHA 4A8QA 1RA7A 4NXNF 1NPKA 1SIZA 4R0EA 1FRXA 3M8YA 1RTDA 1JIHA 4DPOA 1IKYA 1U7LA 2GHVC 1DTQA 2PT0A 4IFVA 4AUKA 2KRRA 4C97A 4F4ZA 2CADA 2BJ8A 2W8KA 1N0UA 2GIFA 2XY5A 3ZZYA 5KFEA 4C8OA 1TL7A 2FHMA 3QFHA 3JAMY 4ZN3A 4DSKA 2C2NA 3RBXA 2IJNA 1F0XA 4HVZA 2MHEA 3LP0A 1FE0A 1HBNA 3FNNA 4LVOP 3W60A 5LSOA 2W9AA 1JXLA 4USUA 5D15A 3HDSA 1LW2B 4KQZA 2RILA 3IAS9 3MMAA 5K14B 4ZLPA 2MLXA 1WOSA 3GV5B 5DM7Q 4TU8A 3M30B 1RT4B 3R5GA 2I6WA 1RT7B 3RW7A 2BQRA 3A3NB 1LWEA 2AIRB 3KG4A 2KYZA 3Q8YA 3FFIB 1CJUA 1GX6A 1NJYA 4LF2A 3W9JA 5KG1A 2XTJP 4AD6A 1HQEB 1HQUA 2ROEA 3DNCA 3GB0A 4G1IA 4WFYA 3X3UA 3KK3B 1CQMA 4NCGA 5LMNJ 2HMIB 5I4MA 3C6TB 2HQ3A 5L9NA 1D9DA 5B0BA 4ECXA 1TVRB 4DV1J 2RSQA 3TYTA 2O3DA 3SSRA 3KWMA 1LXJA 2LEAA 3QYYA 2RUGA 3HLUA 1LWXA 1H7XA 1UAWA 5AXKA 5T14A 2R2SA 2ZJPQ 4B9UA 5A6WA 5DJBA 1PKUA 2QMXA 3PR4A 1C0UB 2W4DA 4DV5F 4C3LA 2DITA 5KT2A 1HIYA 1VJWA 1FNOA 2MKCA 5JMNA 5F9NA 4LQ3A 4Y3CA 3CDAA 4WJBA 4B3TJ 4DR6J 2XG8A 3TJAA 3R7NB 1MNEA 1S1VA 3D6HB 3O44A 2CPDA 2ZH6A 4QOTA 2WW4A 2CWXA 5DG8A 3HD1A 5F3ZA 3KK1A 3BDEA 1YBUA 3CB4A 4JI6J 1RT2B 2FDNA 1C1CA 2IC3B 3QGIA 4ZVOB 3U27A 3VV2B 1VQNS 5I3UB 1N6QB 4IFYB 1N88A 4DCPB 3OR2B 4ZVTB 5KFVA 1PO6A 3GG1A 4OL8A 2AYBA 2BXJA 3UN2A 1RBOB 2J0QD 4FYYB 1XNRJ 2BMBA 4XDCA 3DLJA 4YP3A 4I64A 1OMSA 3W9HA 2BJEA 3C6UB 4DV4J 5SZTA 2OIHA 4NZ6A 3QJLA 2HHXA 2FHJD 3OXFA 3UWTA 3B82A 4B17A 3ETOA 4LF4F 3DLHA 3C15B 3H98A 4DI6A 2CNKB 3J7YI 3HPOA 2J9EA 2KDOA 1NB7A 1YZ6A 5DM6Q 1FD2A 3JQMA 3RGIA 1P6TA 1VC5A 5E3QA 4FN5A 1H7WA 3CE8A 3QGGA 2XZTB 3I5CA 4Y2CA 3D0GE 2L3MA 1UFKA 1FWLA 4ZJQA 4ES3A 5CA5A 3OVBA 4JI1F 2HFNA 2AWZA 1KRPA 3OL7A 1LFPA 4CLPA 3BH7B 4J9RA 3GFYA 3UD4P 1F2GA 2H4WB 2V8HA 3J7YU 2D74B 2FJAB 3LP1A 3N6MA 4CT9A 4J9OA 2UZAA 5IV3A 1U2CA 4AL7A 1S49A 5J1EB 5I3PA 2V50A 2W9CB 2ZOGA 4PWUA 4UTGA 4ZN1A 1Q86T 2HHHF 3GSDA 3W3SA 5GAGU 4JI8F 3DXSX 5B09A 1TELA 1QSLA 1O8BA 4MKYA 4FXDA 1Q95G 2CQBA 3EZUA 4N47A 5IM0B 2ZM6J 1IM4A 2H5IB 5HP1B 1IBLF 4NMLA 1SL0A 1K8AT 3TZWA 5B08A 2EBGA 1PGZA 2YWWA 4ZVRB 2ZBQA 2BANB 3J81j 5KFWA 1FWPA 1BHNA 1SH0A 2Z57B 4YB6A 1UVLA 1M1KT 3P45B 3ZTSA 3LP1B 3KLHB 1WF0A 4R5PB 5L38A 4Q45A 3DGPA 1FE4A 4KAIA 5ETKA 1CG2A 1MU2A 4JI0J 1VI7A 2B5JA 3R7SB 2F9DA 1VQ7S 4PAAA 3CGIA 3A3OB 3RAMA 1MN9A 2HYIB 2O67A 1EETB 3M30A 3BO2A 2FY1A 5IT9U 3CCQS 3NNAA 1H74A 1UTAA 1TL3B 2H9ZA 2RF2A 2OPSA 4WBFA 4HR2A 1I5OB 3T1HF 3MUMP 3O6QA 4DSJA 2KM8B 3DOKB 3TZZA 1YX2A 2CPHA 4ZIVA 1JLEB 4QR2A 1SI9A 4K4VA 3KG0A 3MM5B 4CH0S 3PX0A 3TA2A 4ICLA 4A8YA 1RTHA 2RHSB 1XNRF 4LVNP 2NXCA 3PHEA 3V2UC 3WBZA 2FD2A 1HR0F 2MZ1A 3BGLA 4J9PA 2ACYA 1YIJS 1FXRA 2U1AA 2W2QP 2CPZA 3MOZA 5M2PA 1CJKA 3WC2A 4E0DA 5H9FJ 4F2RA 3LO3A 5E2QA 4Q0BB 4CO5A 1QY7A 4RW4A 3ZTQA 1REGX 2HFVA 2G0IA 1LEOA 1LNQA 1TU0B 1J5EF 1U09A 1RT7A 2E7XA 1HNXJ 3NWRA 5F0UA 1H38A 1FJGJ 4IKAA 3UPFA 3N6NA 2DXDA 3CNQP 1SH3A 1VRTB 3UVJA 4F3OA 2V69A 3VGSA 3UI3A 1E6YA 2BOAA 2H51B 1RWKB 4DFPA 1S77D 2AKWB 4LF8F 2CQCA 2HNYA 4DLGA 3T19A 2WBMA 4GC7A 1ZAWA 1UWAA 3DI6B 1RP5A 2PEBA 4NI2B 1JLQA 2CYYA 3JQJA 2HBQB 2MZQA 3D2WA 4JYAF 5M2UA 4QU6A 2J0SD 2IVYA 1EP4A 2ZUAA 3PJ9A 3QQCD 4A4JA 4ALZA 3NEKA 5KFDA 1EKSA 1H3DA 4OZ3A 3TUZC 3T5JA 3E2EA 3ZFVA 2LECA 2YX4A 4DL5A 1VYAA 2DIVA 4HT5A 4L73A 4LBHA 2M8HA 5L39A 6FDRA 1RCXB 2DR5A 1IJFB 3RRGA 4P6QA 4WU2A 4BS2A 3AJDA 2ZC3A 2B5JB 3WDOA 4K8RA 1IBLJ 1S9EB 3CCZA 1WUUA 4NLPA 2I2YA 4M5KA 2LXIA 1JKHA 4O23A 2UU9F 2XMVA 1MN7A 4IQMA 2DR6A 2YNIA 5LL6d 1TL3A 5F9LA 2C3MA 1BXNA 2Y3YA 4I0WA 1U45A 4RBTA 2GMJA 4DOZA 3TVZA 1Y7PA 1VQ4S 3HHNB 2B3TB 2ZH8A 3T5HA 2HRTA 2DR8A 5JUMA 2G13A 3B6BA 4NEYA 1RTIB 4CDIA 1IVZA 3RB0A 2C3YA 1CJVB 3QPIA 2QL5B 1XNQJ 4LFBF 2W4CA 2HQDA 4RWXA 1U1QA 4DX5A 3P5TL 1N52B 2B56A 2D9PA 2HQGA 1AROP 2LXUA 3M2RB 1IKYB 3A4TA 4NA2A 5B0CA 1XR7A 3V5RA 5AT1B 5GAHI 3PYFA 1S0OA 2X7IA 2X1BA 4BHQA 3IS9B 4PZVA 1M90T 3PVXA 2RVJA 3R2DJ 2DNPA 3H2UB 2GJ2A 3TRGA 1N5TA 3ZO7A 3IG1B 3OL6A 2XBPA 3ZZPA 2CJYB 5KFAA 4LF5J 1URRA 2W7AA 2NXEA 3ISZA 3Q2SC 4CNZA 4YN3B 3WQPA 4J9UE 2UV8A 1VRQC 3VAGA 2IA6A 2B9EA 3MFIA 3T1YJ 3KHHA 1RU1A 4N8NA 7FDRA 3HFKA 1D09B 2W2OP 4EZ6A 3CJKA 2P5VA 3BKFA 3ETMA 2VF3A 3HVAA 1AT1B 1IKXA 3FBEA 3OFHA 4FF2A 3FFIA 4PXCA 5A2QU 4HLBA 2GO8A 5BJRA 1X9SA 3EVWA 1ZAVA 3DGPB 2R42A 5MAOA 2ASDA 4NLVA 4QU7A 2QLBB 3C19A 3MM7A 3R7BB 1U2FA 2J8AA 2PEHA 2VBXA 1MWZA 4P10A 4LF8J 2YKMB 3RB4A 1KFSA 3N28A 2VA2A 2MJNA 3ISND 5EWFA 2E66A 2B8QA 4ECWA 1FJCA 2PFFB 4AFFA 1N32J 4WKYA 1S57A 5RUBA 5E33A 1X60A 2ZH7A 1ITPA 1UFWA 1W7WA 1JJHA 2HFOA 2OPPA 2HURA 3E01B 3HHKA 3TA0A 1NJXA 2NSBA 4RU2A 2CAJA 1V5IB 1WC3A 2ABYA 4KKOB 2ZVIA 5D0GA 3K5LA 5HQMA 4OYWA 5J2QA 4R8UB 1YZ7A 4V19J 2RQCA 4KTQA 2X1AA 4EK2A 3NCRA 3RBEA 2D3OR 3T9NA 2Y1LB 3ITHA 4OFZA 4P2FA 3TAMA 2V34A 3W62A 2C2RA 3O3LA 4WIQA 3OL8A 1U24A 1RKIA 5LSRA 3HKWA 2RU9A 1J27A 4WFZA 1QLNA 1WC5A 5HLFA 2CQDA 1S72S 1FTCA 1ZM2A 4NLSA 1OY9A 1ICEB 4PPZA 2DK2A 2V5HG 2PFDA 4O3QA 2Z30B 3UR3C 1T9UA 4NOHA 4F7VA 3MUVP 1XMBA 4X62J 2DIUA 3IG1A 2VG5B 1R6YA 2HNZA 1FNXH 3DMJA 4NEZA 1IBMF 1OYDA 4DR7J 2XYPB 2CUYA 3E8OA 3UN3A 3Q0AA 4URQU 4C98A 5CCLA 4LF6J 3GTYX 3W66A 5I42B 4TQSA 3KFWX 3QWPA 2R3VA 3FCVA 3V6DA 3DKDA 4ZHRA 3OL9A 3FRYA 2PMWA 4PWDB 3MM5A 5KFIA 2GNKA 2BM1A 4OJGA 2CQ0A 1B0PA 1RWXB 1N0VC 2XWYA 3FUYA 3W8PA 2KXHA 3DRSA 3GE9A 1RAAB 5A8WB 3HM9A 3TQ1A 2MSTA 4CWBA 1U1KA 5J2NB 5C25A 3WHIA 1AB8A 1I6JA 1X0FA 4NLGA 2EKYA 1WNEA 1RABB 3WIUA 5EWGA 3RZAA 4XPEA 2VQFF 3OTEA 1RT5A 3UNYA 2QTWA 4BBYA 2Q6BA 1YRTA 1HNIB 1S1XB 2QMUB 2MKKA 2GCFA 2KG1A 2XLKA 5THWA 3CD0A 1EJ7L 4RBUA 4ZOSA 5HAOA 2V94A 4MK7A 3KXDA 5KG3A 3VF0B 2LMIA 2PI5A 2XS2A 4OLOA 3DU6A 3MCSA 1RWOB 1YJVA 3AJ2A 3ICLA 2NUUG 3R6LB 5KFCA 4P2SA 1JWWA 1LWFB 1M5HA 1WACA 1WTBA 5E41A 4B9VA 4PQUB 2AEFA 4HL9A 2IDEA 4K5SA 3Q8SB 2QYGA 4YUDA 2ASLA 1QAXA 1VRTA 2I38A 1YBAA 2QG9B 3ZNUA 1Q79A 3C46A 4Q8EA 2A2CA 4IG3B 2UUCF 4B9TA 4X2BA 4QW9A 2ZM6F 3CJQA 3EM1A 1F60B 6AT1B 1N32F 5CAAA 3EWGA 4ID5A 5J2PA 2BM0A 1SJFA 2ALZA 2RE1A 1LW2A 4ANCA 2GX8A 4B9MA 2CVEA 4ZP8A 5T7LB 1QTNB 4K4WA 3GONA 2R7QA 2ASYA 4JI2F 1WF1A 3HHLC 1IBMJ 2UVRA 4OI6A 3JSMA 1WHXA 2D41A 3J80Y 3I56S 3DOLA 2I8EA 3R5AA 3JAMU 4Q44A 2EVZA 3VGUA 4ECQA 4HDHA 4DS5A 3KDOA 3BKTA 3FSXA 1PAEX 1FO1A 3MEEB 2UXCF 4DEZA 4RW8A 5KFQA 1RAEB 1KFDA 1RT3B 4KPCA 4NYZA 1RTJB 1RWWB 4Z2XA 4DR7F 4QIGA 1N6QA 2IAJB 3DGVA 2UXDF 4FPRA 4OJ1A 1AZSA 2A3JA 4U7UK 3ILLA 3CJRA 3K59A 2FHOB 1TK5A 2PMHA 1FRLA 2XSJA 4N7TA 4JI1J 4CRJA 3V81B 4KR0B 3OSNA 4KV8A 4QR0A 3JYTA 3PEJA 2ZWOA 5AXLA 4IDKA 1HR0J 2N4DA 2P8IA 1URNA 3EXYA 1GH8A 2MSSA 3HKZD 2G2YA 3UDVA 2AJ0A 2JWNA 2Q66A 3OD2A 4RU9A 1KLMA 4QIVA 2NZCA 3Q24A 2IRXA 1KKHA 2OSQA 2YXLA 4OLPA 1TKDA 4B3MJ 2FLNA 5CD4H 4AXJA 2WVFA 1QE1A 4OV6A 3TQEA 1JLGB 2YH0A 5K8PA 4ILLA 2XEXA 3DOMB 5J1EA 4WFAQ 1N5QA 4LR8A 2Z2LA 3UFCX 1CSJA 1H2VZ 1T95A 2BOPA 3IR7B 1RADB 3RU0A 1N36F 1SL2A 4F50A 1RTZA 2BZ2A 4JV1A 2HHWA 1U1NA 2MKIA 3QSYB 2AYGA 1B70B 5ETVA 1TVRA 4OHZA 3HCXA 1RT2A 1WF2A 2EWHA 4F4YA 4K4YA 2KI2A 3HVRA 3FDSA 3HSDA 1QTMA 2VG7B 1HQEA 1H2UX 2X3DA 3KHGA 1OYEA 3ADAC 3K5PA 3LTOA 2DT9A 4DV3J 5KFGA 3NMAA 4NA3A 1H2TZ 1YBTA 2LP4A 3I31A 4K2JA 1D8ZA 2RKIA 3AB2B 5LM7E 3I0SA 3MPWA 3NNHA 2V4JA 4TYAA 4WIIA 2F8EX 5KG0A 3ENWA 3KJVB 1KVIA 4EGLA 5HVGA 2VUGA 1NSKL 4DPWA 5J2QB 4ZLLA 4GC6A 4AXIA 2YPZA 3D0HE 1U48A 2RD5C 5C24A 4I69A 4ED4A 4NLWA 3SV3A 1L3VA 3TUPA 1F5AA 2OEMA 5BYRA 4ICLB 3DN9A 2J6UA 2F65A 3IGVA 1UETA 3AJ1A 4DF4A 3DU5A 1T9VA 6FD1A 2OGUA 3JSRA 3TARA 2OPQB 1N56A 3BBBA 4CLKA 1J5EJ 4YQWA 4UF4A 3M8RA 2NQPA 4P71A 1H73A 2K8GA 8ATCB 2V2KA 3M9MB 1VQ5S 4OYAA 3MMCA 1RCOB 4YB5A 1ZETA 3G86A 2DNGA 1IR2A 2RRNA 4CT8A 3EDRB 2V9KA 4MKBA 1RT6A 2CA9A 5KT3A 2RU3A 4M63A 4M5DB 5KFXA 1IQTA 3VAFA 5KFKA 2OTLS 1WI8A 4PXBA 4J9SA 4IRKA 4NXMJ 4ZPBA 4GKJF 3E51A 4DDFA 1VRUA 3EE3A 1HNXF 2HAIA 2MY8A 2Z56B 2EFNA 1FESA 2VJUA 5KT6A 1FA0A 3KLGA 1TKZB 2CDQA 1OQ3A 1VQ6S 1NPRA 1FKAF 1VQ8S 4USJC 5AJ3F 5F8JA 1XN9A 2B6AB 2L48A 3HFZB 4D3GA 2E9RX 2WVDA 2BE9B 5KFSA 2UUBF 3VZHA 5D0EA 1X5TA 1W25A 2HVHA 4C3MA 1MROB 1SJQA 2FQQB 3HHEA 4U7UD 1OPZA 5G4DA 2Q79A 3CPWR 1RTHB 2HQCA 3LP2A 3ELHA 3IMQJ 5E5NA 3PW0A 3N4WA 2VKZG 1RYRA 2KFZA 1HBMA 2MPUA 5F8GA 2JLEA 1BD6A 5C7PA 2NR0A 1NHUA 1JLFA 1WDDA 5CABA 3S8SA 4PRFA 1CBKA 1DLOB 2W2PP 4KGVB 3VQTA 3KKFA 3MFHA 2A6MA 3M05A 4Y65A 3NMRA 4DU8A 4DZ6A 1S6UA 3AQOA 5K8NA 2C2EA 3IA0A 3L09A 4YDXA 4EBDA 4CO1A 1C2PA 2I5JB 2YKOA 2BDPA 4LF7J 4C8MA 4MMOA 2L9WA 1P27B 3KNGA 3QNWB 5HMZA 3MAHA 3CMES 3BYPA 5AXMA 1NO8A 5HI7A 1FTRA 5EHHA 1VBZA 2IM0A 2POKA 2MKSA 1CC7A 4JI2J 1NB2A 2FZCB 1M0SA 1IR1A 2V2QA 1C4AA 5HQ8A 1WG1A 2K7JA 2JJ4D 2E1AA 2VZ9A 4U6PA 3LWLA 2M5YA 2YKPA 3OXLA 4LFAJ 5D4PA 5LJ3Y 1HNWJ 3PKMA 2UXCJ 1N33F 4XPCA 1AFJA 4ELVA 2CPEA 1N4LA 1WKJA 1NDPA 4YHHJ 1BQNB 1JLCB 1KR4A 4F67A 2E29A 5KFRA 1TL1A 1VQLS 1DZ5A 3FCWA 2CJKA 4UY8T 4HTJA 3DRRB 4KY3A 9ATCB 1GMWD 3PDNA 4IOAQ 5A8KA 2ZHOA 2YY3A 4F4WA 1IKWB 1GTHA 3CVKA 1YQHA 4NI2A 2GVDA 2JL9A 1S1TB 1HNIA 2AGPA 1WDTA 5GMEA 3EZ5A 1KD1T 4DUTA 3R5BA 1RAIB 3NBPA 2C22A 2N7CA 2DEIA 2C3UA 2WONB 1TUGB 4Y6IA 4A8SA 2WZ1A 1SJ1A 3NWGA 2XO7A 3T6JA 2HKEA 2IVFB 1T9WA 2ZVSA 4IDKB 4UOGA 3LP0B 5KFLA 4EUVA 4OHWA 1ZAXA 1D0EA 2MGZA 2W24A 5DDOC 2AJ2A 3I32A 4RUAA 3RRHA 3AB4B 2KZZA 3LPYA 1WJ9A 3W5ZA 5KFOA 3PIOQ 1RHQB 2RDJA 1U47A 1NK8A 2RDIA 2FZGB 1NJZA 4I6AA 5DQGA 1LWCB 4FYWB 5HK4A 1QM9A 4C7QA 2GGPA 3PW4A 5DDRC 4G1QA 2VU5A 2XMAA 5KG5A 3EMTA 4DL6A 3C3LA 1QAIA 3O8WA 1S0MA 9RUBA 1H0HB 4GRSA 2V9WA 1FRHA 2DHGA 5G0RB 1A9NB 1N5SA 3THTA 3CCVS 4N76A 2ZDPA 1PSDA 4EBCA 3UD5A 2RDDA 2V63A 4R25A 3SV4A 3DLKA 3G8TA 3KUGA 1NDCA 3GJSB 4LJMA 4ZPTR 4OI1A 5KG2A 4NCAA 1G7CB 2AT1B 1VQYA 1VBKA 1EB0A 2AU0A 2XMMA 2V4JB 1ZTTA 3RR7A 1NM2A 2L08A 2AJ4A 3N0VA 1FX2A 3HVWA 1P1TA 4CNYA 5LJ5Y 3I4HX 4P73A 3THPA 3BKUA 1YJTA 3MMBB 4DPTA 3MM6A 5HN0A 2ZEJA 2QV6A 4AL5A 1YLXA 4OZ5A 4GO5X 5D4NA 2OHDA 2W4PA 4Y2KA 4CO3A 4JI4F 1LQ9A 1UEVA 3JSYA 4PQAA 2APOA 3C16B 2B6AA 3SQOP 3RRKA 3AA8A 3W63A 5HBMB 4GMKA 2MQOA 1UW4A 2CQIA 2HHPA 2Y8WA 3M1VB 1SJ3P 2N7YA 4LSLB 2EC0A 3UO0A 1N33J 5D6GA 5C2CA 1NKCA 2G9OA 2YH1A 2FJVA 4HTIA 1S6QB 2CIMA 2NPFA 4N56A 4QIWD 5D0RA 4DPYA 4DL2A 2DHHA 4ER8A 1EIYB 5K20B 1VLOA 1XERA 1RQ0A 1WC0A 4Y28C 5D3GB 4JI7F 3DFEA 3POTA 3SIPB 3W5YA 1FKOA 1NZ8A 4DJBA 4X4UA 3OQ2A 2DY1A 3PCOB 1HBOA 4I6WA 1D8YA 4RNNA 3IBWA 3BQ0A 1KLNA 1P9YA 2HK2A 3IP0A 4X64F 3FZ2A 4A8WA 4XK8C 3AD7C 2WOMB 4USIA 2CJQA 1NKBA 2GGPB 2VICA 1S4FA 1Z2ZA 2ZBPA 3QLHB 1DURA 2IYGA 3I82A 5KFTA 3KLEB 3PV8A 2VOPA 1MLAA 2COLA 3NNCA 4X4VA 2CQ2A 2HBRB 1GAOA 4WE1B 4LRCA 4C8NA 4NRUA 2J7KA 3GJRB 2F1FA 4H4OA 3GMGA 1IKVA 2DNLA 2P6TA 1IWGA 3U1LA 1ZYQA 4ZP9A 4WCEQ 5HANA 2GMLA 2VDIA 4LR9A 3MXHP 3G87A 3UCUP 4M94A 1RWPB 3NCPA 1Y0HA 1ZZFA 3FVYA 3CJ5A 4NPOA 2KKHA 1QDUB 2XWXA 1YJRA 3JS9A 3GU0A 4FXVA 1GX5A 4O3PA 4DQPA 4IFYA 4EFAC 3QAUA 3CTRA 3HHLD 3HT3A 3CWJA 1SC4B 1E6VA 3NL0A 3FGVA 4DR1F 4DUZJ 1FJEB 4Q5VA 1U1LA 3Q8QB 1JXEA 2P9EA 3ZXWA 1BY9A 2PA3A 4U67Q 1UCNA 4HHJA 2LA6A 4JBCA 2EKNA 4DR2F 4CCHA 2IFXA 1LWFA 3P6YC 3HK2A 1CJTB 1RZMA 2Y1RI 1NBEB 1JQGA 5C5JA 5ETMA 4NASA 5J1PA 3EX7B 4L72B 2D9OA 4DXLA 3MD1A 3NGTA 2QA1A 1UWBA 1T9YA 1RT3A 4FYXB 4X66F 1HYSB 3M4XA 1RACB 1SCJB 4E2FB 2WW8A 4JI4J 4EWTA 1KQGB 2JRSA 2FUG9 1DQAA 2VG5A 2V8DA 2YQ3A 3D66A 2DH9A 3W2WA 2R7RA 3JSBA 3G8SA 3H2LA 5C2GA 1YRUA 3F0NA 1LWEB 4KSEB 2KTQA 4RNFA 4O4GB 1OWXA 1RBLA 1SJRA 3BV8A 3R6GB 3FKBA 3QT7A 4QW8A 4QPXA 4LMZA 2M52A 3IAM9 2A10A 2D7SA 2BR0A 3TUJC 3J7Z5 3DLKB 4KH1B 1GFWB 1S9EA 2HWTA 2DKOB 1ZOTA 3R5CA 2OJ3A 1FRJA 5L1KA 3D7SB 1OQ6A 1T0TV 3BGRB 4GO7X 2XYHB 1VC0A 1W2BR 1JK9B 1RE1B 1ZS6A 4CO2A 1ZPVA 3A3PB 3MCOA 4TY8A 2Z4PA 2E5JA 3UNGC 4Y2MA 3ZZOA 4RUCA 1WC4A 5HJYA 1I51B 1RTJA 1WTFA 1UVKA 1ZM3A 1RTDB 4UY85 1C0UA
chains in the Genus database with same CATH topology
2KT5A 2LEPA 1HWIA 1LWCA 4B3OB 4PG5A 3NAIA 4DV2F 1NH8A 2MJUA 3DCAA 4I68A 1UL3A 3B4MA 1KC8T 5F8HA 2LKZA 4CH1A 4ED7A 3IS9A 2O66A 1ZZNA 4AYBD 2ILZA 3M2UB 2XS7A 3D28A 3HI9A 4RBVA 4WFBQ 4ZK7M 2ASJA 7FD1A 2VL1A 2IM2A 3MHYA 4NX9A 1LOUA 1HARA 4RKUC 4QR1A 3NGKA 2F3JA 4F4XA 3M2VA 3PIPQ 2WTFA 2C2DA 3Q8RB 2X1GA 3POTB 2QEXS 5DLFA 1WELA 4FF4A 1HBUB 3FJ2A 2OH2A 3F41A 2OP5A 4EEYA 2YX7A 4G1QB 2DPJA 4WYLA 5L9XA 2UV8G 2DRAA 2FC8A 5MLCV 1IUJA 4MKAA 5K8OA 4CZCA 2B7CB 2FB0A 2KO1A 5E0OA 3DRPB 2ADCA 1C1BB 2YTCA 3ONQA 3C6TA 4DF8A 3TUIC 3O1LA 4FBTA 1YITS 4QPTA 4JI5F 3GYXB 4I67A 1B7FA 3DXBA 4KO0A 4PKDB 2ILYA 2KT3A 2Z8QA 4NXMF 4ITSA 2AYEA 4YHHF 2BBEA 3KHLA 2VG6A 1KN6A 3CCJS 2HZCA 4N5SA 1UJ4A 1KVJA 4JV0A 1XR5A 2R8HA 2K3KA 3H4DA 3M6WA 4DG1A 4B3RF 2XULA 2V8GA 1O5JA 2E1CA 2E9TA 1QUVA 2YWGA 4LSLA 2QE5A 5FD1A 3QZ8A 3BM7A 1WG5A 5FIIA 3RAXA 3V4MA 3GILA 1VOMA 3M32A 3M8QB 2H5EA 1S7HA 3LW5C 3QZ7A 1IKVB 1HL6A 4JV2A 1L3TA 2KYXA 1JLBA 2OO4A 1P9QC 3OR2A 3MMBA 2GJIA 4MIWA 5KG6A 3OSPA 5ADZA 1AUDA 2KFNA 3T6BA 2KT2A 2YKAA 2OMLA 5F8MA 2K3IA 1DLOA 3I4PA 2HHQA 2RF2B 3EUNA 2VD3A 1HMVB 2VFVA 4O4GA 4PG4A 4I2QA 4W92B 2YWFA 2D3ZA 1RT6B 1FVQA 2R8JA 4JI0F 1K9MT 2XLIA 1VK3A 4TLRA 3CJ0A 2P9GA 1JNZB 1YJNS 4ED5A 3OUYB 2VOOA 5LXRA 1UEUA 4I4BA 3C6UA 1FD8A 1R8AA 2XNRA 2PD1A 2LU2A 4RW6B 2QA4S 4YR0A 1L5UA 2XHWA 3AH6A 1TKZA 2IA0A 2CPIA 4JOUA 4MYTA 1NNDA 2KU7A 5IM0A 1T3NA 3EGZA 4DV6F 3K5MA 3CCMS 5B0AA 5CHCB 3L7OA 1FF2A 2ZKTA 5DDPC 3CCRS 2AGQA 2BRLA 3LQVA 3PW5A 1KSPA 3MM7B 1DBDA 3GIIA 2HS3A 2IYIA 1V3SA 1XBWA 2KN4A 3QJPA 1XMQF 4YFUA 1HBOB 1M5PC 1N5YB 2GHWA 1V6HA 4IH7A 4IO1A 4IG3A 4TXSA 5T7LA 3K5OA 3US5A 4DR5F 3MM9A 4Q7AA 1Z4UA 5J1NA 5A8WA 1GXUA 3I0RA 2XMJA 5KG4A 5DDQC 2DISA 2EFVA 4TQRA 3V6KA 2RMLA 1X0PA 2B51A 4AL6A 1ZM4A 5K9FA 1FERA 2JZ5A 2ZE2B 3ZZUA 2KG0A 2FJBB 1BC6A 4IRDA 4UW2A 2ZZMA 3H5YA 1NK5A 1HHTP 1CVJA 1NEEA 3B78A 5F8LA 3MWBA 2M8DB 2JFKA 2SXLA 3PO5A 3BGRA 4X65F 4OI2A 4PPDA 5D77A 4DBQA 4IH6A 1T05A 3W2VB 2IM3A 1S99A 3L7PA 5CYQB 4OJ3A 5K14A 4EYHB 4IO9Q 2MKHA 3DLLQ 2YX1A 1GT8A 4WYWA 3H25A 3JYTB 1KONA 3KG1A 5DGBA 1NK4A 1J2VA 2BYCA 4RW4B 2DGSA 2XY6A 3BO4A 2PIIA 3KMQA 4NA1A 4KE5A 4PWDA 4K5RA 2NSCA 2ZUGA 2O1PA 4DN9A 1B0TA 2XI3A 3DDNA 4A8XA 2E5GA 1BQXA 2MZJA 3VR1A 2YWHA 3DRPA 3NRBA 5KOXA 1G2EA 2DO0A 2VPYB 4DFJA 3LOUA 4C4WA 4TYBA 4WK1A 4FNHA 1FK9B 3KLIA 3DI6A 4CH7A 4OZJA 4CTAA 3OVAA 2YNGB 3KLFB 1WHYA 1DTTB 1C4CA 3C66A 4TU9A 1E6YB 3SSQA 5SUHA 2NZ4A 3U02A 3MF5A 5IXUA 1WG4A 2VPWB 2FPHX 4YY3F 4DV4F 2VG6B 4A8OA 2MZSA 1SKSA 1D9FA 2RKIB 4DWIA 2E5IA 2MQPA 4MAKA 3P96A 4RW9B 5KFJA 3LUYA 2PGCA 2PO4A 1KQFB 1IN0A 4X84A 2VG7A 3PRBA 2RNEA 3J7A1 3MUTP 3IRXB 2RQ4A 1U1MA 3CCWA 2WSCC 4NLXA 4E98A 1VMBA 3CCUS 3SDEB 2FJDB 4WK3A 1B64A 4I7FB 5C24B 3MEGB 4B3TF 3KTQA 1VIXA 2E7WA 3V4IB 3MMJA 4KJIA 2JEGA 3M32B 3HX9A 2NUHA 2KH9A 5JVGQ 2P6SA 1FDAA 2WONA 4M95A 2IRYA 3H5UA 4B08A 3M2VB 3OFFA 2N3OA 1YJWS 2HFZA 1JMTA 1Y3KA 2CZ4A 2HWHA 1HWLA 3PR5B 2D3UA 2ZH4A 1S76D 1TKXA 2CQ4A 3TA1A 3VAJA 2IM1A 3TI0A 5CZVA 1X9MA 1HNVB 3CD7A 3U1NA 4FYDA 4KO0B 3K2YA 2HWIA 5E3CA 4ZHRB 3CJ2A 4WFNQ 4P7TA 2VFSA 5KFPA 2V4RA 4J9MA 2QLXA 4QIEA 5IS2A 2W9CA 3CCLS 1DARA 1SXLA 3AQPA 2AD9A 2M2BA 2V4QA 1LXNA 2EK6A 1Y9OA 2YVSA 5FDLB 2CQ3A 1OO0B 2B9YA 3PNIA 2KJVA 4TNOA 3QIPA 3T1YF 4DSLA 5GMKa 4ZCMA 1Q1KA 3AY0A 1YRXA 2QA2A 2FGOA 3N01A 3G96A 2D1CA 4V19X 3NLCA 3HP6A 2JLFA 4DN0A 2N82B 4OX7A 3MPYA 2OSRA 4ED2A 2HNDB 3Q8PB 3CF5Q 1NK0A 4ZPAA 1ELOA 1CLFA 4C8KA 1S1UB 1L3SA 1CC8A 3MEKA 4DUYF 1WEXA 1HYSA 1XR6A 2VKRA 1YSJA 1H98A 2OD6A 4F26A 3KMSA 2DHSA 1Z1ZA 3H40A 2WCXA 3DDKA 3UDCA 2JEFA 1DRZA 2BJDA 2XMUA 3OPKA 3W2WB 4ATNA 2W7PA 2R7TA 1FXLA 3OXGA 4Q2MA 3I5AA 1Q4RA 3UDLA 3DLGB 1X9WA 5ITHA 4WZQA 4JV5F 2FHJA 3N79A 1U1PA 1U4BA 2A2DA 3KJVA 1GXLA 3DRYA 5F0WA 4LSNB 2FHKA 3IXQA 4URSA 5KT4A 1EETA 2W8LA 3PO4A 3MTKA 3HF5A 3TX8A 2FVQA 5L1IA 2FVCA 2OD4A 2AX1A 3LANA 2WSEC 5DLGA 4R5PA 3GR1A 3G8QA 4R8UA 1PILA 3GV8B 4XIUA 3G6VA 4IH5A 1VK8A 2JC0A 2YNHB 3W2VA 1IBMF 1UVLA 2AP6A 4ECRA 4K4TA 5EX0A 4YB7A 3OLAA 2ZNYA 4C3KA 1YWXA 4ZVFA 4Y0FA 5AXNA 3MMCB 4G3IA 4P7VA 3K57A 3OLBA 4MTPA 2CPXA 3UCZP 1BWEA 3HHDA 1Q8BA 3QGPA 3FQLA 1P1LA 1FJGF 1Q8IA 4FS1A 3VALA 1DAXA 2DH7A 1VLYA 4KRWA 2HMIA 3I87A 2KZMA 2HRUA 1RGVA 3QIDA 3PFEA 1VQPS 2ZD1B 4KFBB 3BZQA 2P9CA 2AF6A 1NK6A 2QZ8A 1C1CB 2AYMA 2U2FA 1FHTA 5GADU 3CMAS 3BN4A 2BACA 1FDDA 1IQZA 2EK1A 4G1PA 1X4GA 4FXWA 3RR8A 2J6SA 4PXDA 1KHVA 4C9DA 1LV5A 1DJ0A 4M1KA 3VWSA 3OHAA 5GAEI 4J9QA 4NWBA 3D54A 3OTBA 2R7OA 1MMNA 3H59A 4IR9A 2RJZA 2VBWA 2AJQA 2R7XA 2DJWA 3GFXA 3SQGB 4K50A 2UUAF 1FEEA 3MEGA 4LIRA 5CYJA 1S1WA 4ZVEA 1NK9A 5HMWA 1XMOF 2IBOA 2JEIA 2XLJA 2KJWA 1VQSA 1GNKA 1RAJA 3MEDB 2ZJRQ 3TOQA 4O3RA 2VBZA 5A0YA 2MGZB 5HBMA 2XZWA 3NCQA 3PJXA 3JTNA 1Q53A 5IT9Y 1Y3JA 3CDEA 5DO2A 2WSFC 1N48A 1KOHA 2FGCA 1S1VB 3T1AA 2WRMA 4TY8B 5BYQA 1G3OA 1V3ZA 5FLXY 1L3KA 1QAYA 1KLMB 1SBRA 3AHPA 5G0RA 2CJ9A 5HROB 5D8HB 2A1BA 2XCAA 5E7OB 1BLUA 5IQ6A 3CC7S 2BABA 4OZ1A 3P3DA 1SKRA 2FLPA 4H4KA 1J5OB 4I1TA 1NK7A 1R0AA 3X1LB 4ELTA 2DGVA 1HPZA 4DFMA 1HWKA 1HNWF 4M8LA 1FKPA 2DHAA 2RB7A 2HGNA 2DHXA 1XWLA 2QIFA 3MGJA 2JLGA 4OHVA 2HHVA 3HXMA 3S01A 4NLQA 2JFDA 1D1UA 3WC0A 5CCMA 5HROA 3O2IA 3MTJA 5HL7Q 1VQKS 4J37A 3DOLB 3HZEA 3EPIA 4NLUA 2E44A 3QWUA 2DGTA 3RB3A 3VAIA 1WD6A 1RA6A 4WXOA 2MB0B 3RYLA 1JX4A 1S9GA 1X4EA 5HMYA 4Q43A 3HHLB 4Y2IA 2M7SA 3U7JA 4HH0A 4O0IA 3H4BA 1E6VB 2CPJA 2C3PA 1VQ9S 4DL0C 1TQLA 3CCTA 3AA9A 1TFWA 2QA4G 3TANA 2I0XA 1BGXT 3GFZA 2BW2A 3ZZRA 3ENVA 4QWDA 1LKZA 3B4DA 2VC1A 3G4SS 4DFKA 5I42A 1X4DA 2PN6A 2YNFA 3V6HA 2MQMA 2OMOA 2LDIA 4OI0A 1HFEL 1V9OA 3HJFA 4DS4A 3CC2S 3H20A 2V0NA 4DL4A 1HI0P 4KB7A 2I5JA 4QJVA 1JLEA 2JC1A 3IO1A 4DG1B 1JJ4A 1VC6A 2HHSA 3MM9B 3LH2S 3S1TA 3G6YA 3S7RA 3FMWA 3JB9k 3B8HA 3CJKB 3PACA 2CPYA 3H8YA 2KVIA 2DPIA 4IRCA 2W7OA 2UXBF 4IG0B 3TO8A 1HBNB 4A47A 3K8VA 4ZP6A 4AQYF 1T8EA 3OTOF 2JH3A 2ZH5A 3SSSA 1T7PA 2AJFE 3VZIA 1U2RA 2DGWA 4Z37A 5K5MA 4A8MP 4LF9F 3Q22A 4OIXA 5CYMB 1ZBTA 5IWAF 2G0CA 3NG8A 4W90B 3LF0A 4YEAA 3G6XA 1LK5A 3I9ZA 2F8HA 3EGNA 4FNIA 1S1UA 2JOQA 2ZOMA 3FEZA 4BDPA 2RRAA 2FJWA 3C2PA 2HNZB 5B0FA 3WX4A 1JNRB 3DC2A 1RDRA 4RW9A 2GV1A 3ENQA 1S1TA 1MU2B 5E3RA 2R8KA 4Q0BA 5KT5A 5KTQA 1RJJA 3BREA 2DNHA 2XCPA 1MMLA 2LU1A 4ECZA 1VBYA 2O5DA 4IOCQ 2HGMA 1X5PA 3AAWB 3IN5A 4KC5A 3BS9A 3PM9A 4KHMA 5EDWA 2J0XA 3CIZA 4CTAB 3OVSA 5GAGI 3F44A 1GTEA 1AW0A 1J5OA 4B3OA 2L9NA 5EWEA 4ED3A 2XGPA 2F7VA 2R8IA 1X5SA 3V4IA 4KGKA 3MI7X 4Q8FA 1H6KX 3VAHA 5L8RC 2I1RA 3MR5A 4C8LA 3SCJE 2GQ2A 2VBYA 2ZHBA 2J6TA 2OLWA 3QO9A 1WHVA 2MQLA 4C8YA 2QFJA 3IRWP 4C0OC 5GAEU 1MSWD 5J2MB 2WAQD 2B0GA 2FVRA 3OV7A 1R27B 5CXTA 3H5SA 2J9CA 5FJ4A 3OW2R 4GKKF 1YG0A 3M8SA 4DQSA 4OZLA 4C8ZA 1O0PA 5D4OA 2IAJA 2Q1LA 2WB1D 5IFMA 3TVKA 3FQKA 1SB6A 4KIAA 3H5XA 2YKNA 2N3LA 2ZH3A 1X4AA 2HLUA 2FVSA 3CEDA 3SDEA 2N4CA 3GYNA 2RIJA 1R0AB 4ETXA 3ZZZA 2YKMA 1UJ5A 4LUBA 1U6BA 1R43A 3MMAB 2IRUA 1UKUA 2DD8S 4MJKA 1JKHB 4KBIA 5J2MA 2E9ZA 1TK0A 2QO3A 3CDBA 2GHPA 2A18A 3IWLA 4X4QA 2K7KA 3IC1A 2B9XA 2X3GA 3BR8A 4ID8A 1HMVA 2CVIA 4K2XA 4UUXA 1X4CA 4DV0F 4IUFA 2R7VA 4XDDA 4Y34A 2OKQA 5A8KB 4ZVGA 1OPIA 2GQQA 4J9KA 1SL1A 3G9CA 5L1JA 2VODA 5DGAA 2EPIA 2KHDA 3V81A 2BVZA 5C42B 3MEDA 3TVYA 3M1VA 2DR7A 3VQSA 1XTZA 4F2SA 4ZPWR 4DV7F 4J9NA 2PC6A 4K0KF 2XNQA 1FNMA 3GZ7A 2B4UA 1OSDA 3I9V9 2VB6A 2BQUA 4Y00A 2FVPA 3ZZTA 2LA4A 1AFIA 2OPSB 3LWMA 4ZPDA 1VFJA 2HW3A 2UUTA 1U49A 1R8CA 4PG8A 4X4RA 3MM6B 3KLGB 4M5DA 4NLDA 5EGYA 2CQ1A 1N34F 1F5BA 2MHNA 4DHVA 3QGHA 2J5AA 4X4PA 1Y5LB 4ED6A 4I2QB 2VFRA 5E3PA 4CO0A 1KHWA 2J7WA 3ULHA 4ZS6A 1TK8A 1FJ7A 3QIPB 3G6ES 4C2MA 2CG4A 3LP2B 1C0TB 1U1RA 5HP1A 2E5LF 2VFUA 2KHCA 3NKYA 1QUPA 4LQ9A 5EUHA 4QWEA 2OPRB 5A8RA 2ROPA 3EGWB 1FT8A 3D1OA 4QWCA 2DNNA 2NLWA 2WOMA 3NGDA 2MQNA 1O51A 2MDAA 3NS5A 4HEA9 3M8PB 5LXYA 1APSA 1SC6A 1CPZA 4DMZA 3LAKA 3N6LA 4LT6A 4MFBA 3SZ2A 5KAKA 5DQIA 3DM2A 4QYRA 1HWUA 3HHLA 4I2PB 3K8WA 4E8UA 2JVOA 2ZJQQ 1Q7YT 2EBEA 4YMEA 3DRSB 2M88A 4MIBA 5DETA 1VQMS 4NLYA 1YHQS 1S97A 2IMWP 4C11B 4NRTA 3RTVA 4DQRA 1Y00A 3MURP 1BQMB 4X4SA 5LMNF 5IZHA 2ZOFA 1MWYA 5KFFA 4F02A 4O44B 1WEYA 2B9WA 2HRYA 2YWKA 4RZRA 2X51A 3MDFA 4I56A 3KYLA 2Q6CA 3F73A 3CCES 3PJWA 1UWBB 4HKQA 1TUVA 3BSAA 2FJEB 1JLAB 5F3TA 2R7UA 1G1XA 1X4HA 3L95X 2YNGA 2BA9A 2JX2A 3NP5A 3CJ4A 1TZ0A 2KM8C 5KOWA 1M5OC 5E3AA 4HYKA 2C28A 5DRKA 1TKTB 3J7ZT 2GIRA 2LVWA 4DSIA 2HLTA 3GR0A 5CH7B 1T05B 3GIKA 1RT1B 2EI5A 2E1RA 4ZA1A 5KFMA 2DNKA 2ATLA 4C11A 3QO9B 3EXCX 4ECYA 2RS2A 1ZH5A 4LFAF 3RBDA 4LSNA 2DBBA 1UJ6A 2HS0A 3R5DA 4BWJA 4F25A 4EO8A 2EFQA 4MK8A 3HO1A 2PSZA 3VAMA 2W9BB 3DLGA 4KFBA 3CULA 5IT4A 1T94A 1XK8A 4EO6A 4A8FA 2J7UA 3DHXA 4X4NA 1R3NA 1FDBA 4U7CA 4WKRA 4CO4A 1PC4A