2XZDB

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
CHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 18
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xzdB00
2CJXB 1RHQB 1SC3B 2CJYB 3GJTB 2QLBB 1PYOB 1IBCB 2H65B 3GJSB 4ZVSB 3RJMB 3EDRB 3P45B 3QNWB 4ZVPB 2HBZB 1RWOB 3IBCB 2XZTB 2XZDB 2QLJB 3GJQB 2H51B 2Y1LB 1RE1B 3SIPB 1RWXB 4DCJB 1RWMB 2CNNB 3R6GB 1NMEB 2H54B 3KJQB 3D6HB 2C2ZB 1BMQB 1RHKB 1I51B 1RHRB 1RWVB 2C1EB 4ZVTB 3IBFB 2C2OB 2XYGB 2QL7B 1RHUB 2P2CB 1RWNB 1RWPB 2HBRB 1QDUB 5K20B 2HBYB 4JB8B 2CNLB 3KJNB 1QTNB 3KJFB 1SC4B 2C2KB 2H4WB 2H5JB 1F9EB 1SC1B 2CDRB 4ZVRB 2QLFB 1RWKB 1RHMB 2C2MB 2CNKB 3EDQB 2XYPB 3R7BB 1PAUB 1ICEB 2H4YB 2QL5B 3R7SB 3GJRB 1RHJB 4ZVUB 2H48B 1RWWB 2QL9B 2CNOB 4ZVQB 3R6LB 3R5JB 1I3OB 4DCPB 3D6FB 5IC4B 3D6MB 5IC6B 2XYHB 3NS7B 3P4UB 2Y0BB 1GFWB 4ZVOB 2DKOB 4LSZB 4DCOB 2HBQB 3R7NB 2FQQB 2H5IB
chains in the Genus database with same CATH superfamily
1W25A 5D3GB 2YH0A 2D7SA 3LUYA 1QE1B 3UR3C 3Q8VA 4DLGA 2ADCA 4K59A 1U25A 3RB4A 3EXYA 2FVCA 2QLJB 1OIAA 2KFYA 2IDLA 1OJ4A 2VG6B 3IP0A 2RF2A 1TMJA 3LH2S 2DR5A 1TL3B 2R4FA 2L48A 2MSSA 5J2MB 2GMHA 1DLOA 2PGCA 4O3SA 1RABB 3HFZB 1FDAA 3V5RA 1AUSL 1MG7A 1NAQA 3DHWC 1R27B 2RKIA 2KXHA 4DPYA 2HVEA 1BQXA 1VRQC 1SUQB 3H20A 1V9OA 2VPZB 4DSEA 2DO4A 4RNOA 4N8OA 2HNZA 3CIZA 1KN6A 4O3RA 1NZ8A 2YPYA 1PAEX 3NNHA 2LFVA 1JQGA 2ROEA 4CNZA 2W9BA 2IM3A 3BN7A 2YQ0A 4I6AA 1PILA 3RBDA 4F3QA 5HBMB 2DNHA 2H5IB 2DHSA 5GMDA 2WK4A 3N5BA 3V6DA 3PR5B 4W90B 1NHUA 2K3IA 3ULHA 4DHVA 1UPMB 4PQUA 4DR2F 4KGKA 2WONB 2C3OA 2IRXA 1T7PA 4OZ0A 2YX1A 3KK3A 2HKEA 4WU2A 5IV3A 2FHJD 3MHYA 5C25B 1R0CB 1HNVB 4I69A 3PDNA 2HS0A 3TJAA 3MM7A 2XS7A 3PX6A 2E66A 1VJWA 3QGGA 5CYMB 4ECXA 3H2UB 2LU2A 4WFXA 3FJ2A 3OFGA 4M63A 1X4FA 3GLJA 1FCAA 4AQYF 4Q45A 2XMKA 1Q95G 1CG2A 2JZ5A 4ZHRA 4IO9Q 1T8EA 1VQ5S 2VFUA 4KY3A 3RB0A 3C46A 5KFPA 2XEXA 5GADI 4OX6A 1GMUA 4P2MA 2RS2A 1RT6B 3I9V9 3IM8A 1JNRB 2J0XA 2DGQA 5F41A 3MEKA 4DL2A 1CJUA 1DZ5A 4YP3A 2HAIA 2F9JA 2ZC4A 1LQ9A 5E3RA 2ZNYA 2CXEA 3LO3A 3DRRA 3K7RA 4QJVA 3TAPA 1VC6A 3OVBA 2VBWA 2E1CA 4DF4A 3DOLA 1HL6A 2J6UA 1UJ6A 2MQLA 2GJ2A 2HURA 1VLOA 3EDRB 2FZGB 2DITA 2M2BA 3RAXA 3TA0A 1S12A 1NHKL 4J9VA 2WAQD 1S1UB 1IKVA 4A8QA 1CC8A 2GO8A 1RHKB 1S1WB 2C2EA 1UPPA 2Q6BA 1U6ZA 4X64J 3M1VB 3THTA 4DWIA 1TR0A 2HS4A 1VBKA 5B0CA 2YWEA 2HFVA 3D67A 2AT1B 2Q6CA 2KT3A 2BDPA 3TQ1A 4G1QB 4RLEA 3CCTA 1U7LA 1E6VB 5ETSA 1BGXT 2OAUA 4MKBA 4TU9A 1NK8A 2WVDA 4HI2A 1O5JA 2WSEC 4WK1A 4NL5A 2UUTA 2EBGA 4FVCA 2V2ZA 1WF2A 4MIBA 1F2GA 1WEYA 3G9CA 1DTQA 5KTQA 1OY8A 2V6AA 2MZQA 1YJWS 2UUWA 2BUNA 1RWMB 2LDIA 4NASA 2ZZMA 5KG7A 1FWKA 2QX0A 3DLEA 2M52A 3K5LA 1GXUA 2UXCJ 2HMIA 5HLFA 3BQ2A 1Q0NA 4TQSA 2ZBPA 3TZYA 1SC4B 1V3RA 4K5SA 1NBEB 3OQ2A 2QYCA 5KG2A 2FJVA 2HQ3A 1LK5A 4OI3A 5ETPA 3AFGA 4OFZA 2JLFA 1S9EA 4IKAA 2VOOA 4ES3A 3A1YG 4LFBF 5BR8J 3D1QA 4EU0A 1ZTWA 4JI6J 1C1CB 3T41A 3BS9A 2Y1JA 1DY3A 3A8KA 4KHMA 2YH1A 2OIHA 3DDKA 3GJTB 5KT7A 1OY9A 4ZCLA 3MR3A 4ZVSB 1GXLA 2XCAA 2DNZA 2W7PA 4PABA 5E3PA 4FKYA 5THWA 2W01A 4DR5J 4K4XA 4K4VA 1NJIT 1RGVA 2YQ1A 5DDRC 5GMEA 1M5SA 3MMAB 3V4IA 2B4PA 3D0GE 1NEEA 1FK9A 3OPKA 4FDFA 3QFWA 2QRRA 2KH9A 3TEGA 1FFWB 3E3XA 3TAQA 5DQHA 3DRPB 3PYEA 3QYYA 4RU2A 1RBOB 2OPPB 1S7HA 4OHZA 1SL0A 3KDNA 1QTMA 2KHDA 4F50A 5HK4A 3H0PA 3MTKA 4OYZA 3NG8A 4KFBB 3NMRA 3KYLA 3MM5B 3R27A 1J5OA 1AT1B 5D4LA 4LSLB 3JQJA 4I2PA 1VK8A 1HR0F 2E29A 2DKOB 4JUZA 3CJ2A 1NCLA 1SI9A 2O66A 4ECSA 3FMWA 4NLUA 3RB6A 3S8SA 2EFOA 1L3VA 1V3SA 2HBZB 2DRDA 2VPWB 3IBCB 3CJKB 2R2RA 5J1PA 3KMQA 5F8HA 4RW4B 4A8KA 1TU0B 3NGKA 3FZ2A 3CJ3A 2I38A 4M8LA 2OTLS 2W24A 1R43A 1X4GA 4RBUA 2XLJA 4ZN1A 3I4PA 3ENAA 1CVJA 4HI1A 1YLXA 3DLGA 3CT9A 1EKSA 3CB4A 3NL0A 4MYTA 4DPWA 4ECWA 3KUEA 3M8PA 2DR7A 5E0OA 5KOWA 2UUBJ 2VICA 1B70B 4URGA 1RWKB 2M4MA 2XNQA 4QPTA 1JLAB 2UP1A 5L1IA 1ICEB 3CDUA 1S79A 5DG8A 3R7SB 2VBYA 4U7UD 1RLDA 1S0OA 5L38A 4OI4A 4RKUC 6FD1A 3LGMA 2MKHA 3A3NB 5KFNA 1Q82T 3FCVA 4EZ6A 3BN4A 1N56A 3OSNA 2PI4A 2CZ4A 5BYSA 2A2CA 3FRYA 2E5LJ 2UUAJ 3LP2B 4CO2A 2AJ4A 2YX4A 2YWKA 1VQ8S 1RUSA 3SSQA 1T05B 3QLHA 4ERDA 3POTB 2ZOFA 4OHXA 4LF1A 2B6AA 1HMVB 4HLBA 1RT4B 4M95A 1KLMB 1YKWA 1TV6B 3CMQA 2OD4A 1S59A 2CPHA 1LW2B 3R2DJ 3RBEA 2KXFA 1HWJA 3DMJA 3D6HB 3K5PA 2EXUA 2LLZA 4X4OA 2ZBQA 1S1XA 2YTCA 3MECB 4Q2LA 1JLBB 1H0HB 1BE4A 3DXBA 2ZE2A 4JV5F 1T03B 4CH0S 3H4BA 5CQGA 4R0EA 2NXCA 5KFKA 2DVIA 1UEKA 4LFCF 3P6YC 1YGYA 1FJCA 4JOUA 1PBUA 4FKXA 3N9UC 2B4VA 2R7XA 2QZ8A 4OLPA 4C6AA 1T94A 4QR1A 3OXGA 2MJNA 2IRYA 3F73A 3M2VB 5EX3A 5L1KA 1U2RA 2J8SA 4KRWA 2RQMA 4ID5A 2HNYA 3GG1A 1PCAA 1XMBA 4L3NA 1AFJA 2LP4A 2YBVA 2V9WA 2PEBA 2ZVIA 2J0WA 1U0HA 1OMSA 2UXDF 4YB1P 4KGVB 4OYIA 3P49B 2YNFA 4YB7A 3UI3A 3PY8A 5D0EA 1WTBA 4C8ZA 2I9SA 4J90A 2XGPA 2PSZA 1VRUB 5IS2A 3G86A 3R5CA 1ZBTA 3PG9A 1WHYA 2N82B 3B82A 5F8NA 1RWPB 2P9GA 2KVQE 5CHCB 5B0AA 2IBKA 2MJUA 2GO9A 3JSMB 3MFHA 2OHDA 3KHHA 2AX0A 4G6VB 5CYJA 3HVTA 3BGUA 3UR0A 4C8MA 3GMGA 4F25A 2CA9A 1CULA 2FTRA 3K89A 4TNOA 3MGJA 4JI4J 1IKXA 3KLVA 5G0RB 1FDDA 3DI6B 3LW5C 3QATA 1Y5IB 1JLGA 2HRTA 3QJLA 2EG2A 4UOFA 3MR5A 4P7VA 1LNQA 3Q8UA 4LRDA 3P4UB 4C8NA 2W7OA 4WKYA 2DB1A 5A0YA 1TK5A 1RT7A 1XMOJ 4LF9J 3I32A 2RJZA 2GNKA 2RUGA 4EBEA 2HGMA 3LAMA 4WWSA 4JV1A 3E01A 4JI3F 5FD1A 1J2VA 2BMBA 3C66A 4DF8A 1ACMB 2QGFB 2RUSA 3JTPA 3W2WB 1UJ5A 4L6V3 3K8VA 3C8YA 4ZJOA 4Y3CA 5ETVA 2DNGA 2M7SA 2C3PA 2YKAA 5KFMA 3RG6A 1U02A 1S1TA 4HH0A 4DR4J 2V0NA 1WOPA 3F44A 1RXOB 4PPZA 3HZGA 4OYWA 4HTJA 2ZH9A 2ZITA 1M1KT 5GAHI 4JB8B 4QR2A 1LFPA 3NBPB 4DL0C 1IM6A 1T9VA 3D0HE 4MKVA 2FGOA 2HWIA 4IRDA 4DBQA 1NJWA 3AXMA 3NGUA 4ZCKA 2R7OA 4DFPA 4R8UB 1SL2A 1T95A 3OTOJ 5L8RC 4NOHA 4RW8B 4CM2A 2M3DA 1SPBP 4LVOP 3KFWX 1C1BA 3EMTA 2AF6A 4I56A 5F3TA 5HROB 4ECRA 2R7QA 4N41A 1ELOA 2Z2ZA 4ZS6A 5JVGQ 3UW1A 4J9NA 2DH8A 3E51A 2GMJA 1SKUB 4NI2B 1RTDB 4CCHA 3DC2A 1JJHA 4TU8A 1RAHB 3MEEB 2B9WA 1XNQJ 3J7ZT 2HQGA 2DD8S 3I82A 4ZLPA 2ROGA 4YS2A 3T5JA 4LR9A 4Y2KA 1S48A 4ICLA 3TW0A 4LR7A 4U8VA 1WEXA 3MTJA 3WQPA 3UDCA 3UE2A 3F41A 2IC3A 1HQEB 5GVQA 2KN4A 3Q8RB 1AZSB 4ECYA 3HHLB 3DKDA 5C24A 4P2XA 1RADB 3BQ0A 3G82B 1V3ZA 1JIHA 1RYRA 4USMA 5DZ7A 1JLEA 2CVEA 2AW0A 4ZLLA 1HQUB 3HHDA 4DUZJ 4PXBA 3UFCX 2FY1A 1YZ7A 4KQZA 2YKMA 4MIAA 4ED0A 4A8FA 5K5MA 1X4CA 4CLPA 2Y8WA 1VQLS 3G8TA 2J7UA 1LXJA 5A8KB 1EARA 1WELA 2JEFA 4WPAA 4H54A 2BZ2A 4K0KJ 4M5JA 3BSOA 4JV0A 2B56A 4CLKA 1N5YB 4MK7A 1SQFA 1K9MT 1HNWJ 2PI5A 4ANEA 1Q8BA 4O4GB 1PBAA 4JI5J 3I0RA 3KJNB 5AJ3J 5D78A 2YXLA 4DPOA 3TUJC 2FD2A 3DOMA 4KH0B 3ZTQA 4F02A 1VQ4S 1KKHA 1IBLJ 4LVNP 3SDEB 4WFNQ 4J9LA 4B3MF 4IH6A 3CD5A 4O3OA 3S7RA 4WU3A 4ZLNA 2JX2A 4JP8A 2CQ0A 3VGTA 2FPHX 2VC1A 5AXKA 4Y6IA 3LALA 2YKPA 2QLBB 2G0JA 4ECTA 3IMQJ 1Y10A 3JXOA 2E5GA 2VJVA 3MAQA 1KFSA 4NE9C 4K4SA 3D2WA 3PR4A 4HEA9 4NEZA 2HQIA 5BYQA 1HPZA 1G1XA 2Z56B 3IR5B 2V4JA 1KBRA 4F0MA 1ZM9A 1N0UA 3H5SA 4ZCIA 1I51B 1JXLA 4V19J 3PFEA 4IDKB 2XLKA 2MEWA 2MQNA 5B0GA 1N33F 3LAKA 1SJFA 4BLGA 1YI2S 5B0BA 1RTJB 2H5EA 4CNYA 2XO6A 3HSJA 4NCGA 1HBUB 4GVLA 1GK8A 3BGOP 3BB5A 1IKYA 4FS2A 4ES1A 4UTGA 3RB3A 1ZM3A 3ELHA 4DPUA 2J76E 1OPIA 4ANDA 2XLIA 2BJ8A 4HVZA 3ICLA 2EKYA 1KHWA 4J91A 4M5NA 3SCIE 4B9NA 3NGDA 1HD1A 3OFHA 2CJXB 4M5GA 4DR2J 2YX7A 3OUYB 1UZDA 2VG7B 3CVKA 3OVSA 3AQPA 3FSXA 1TZ0A 5F8JA 4F2SA 4OZLA 1F2HA 4FYWB 2RVJA 3OXLA 3W63A 3HO1A 2VOPA 1R6VA 1WI8A 2RD5C 3U7JA 3LTOA 3CJ8A 4NLYA 5HP1B 1RT2B 2R2TA 3AD9C 1Y9OA 3DRXA 4OJGA 1FWPA 3V81B 2H4YB 4B3SF 5K8PA 4K4YA 2OPQB 2OPRA 3T1YF 4NEYA 3HSGA 1XK8A 4R5PA 3D6MB 2E1MC 4B17A 3CCQS 2BANB 3MR2A 2EK1A 2O5DA 1WC3A 2W2OP 3EGNA 3D5MA 2DYAA 1RT5A 2BKPA 4WE1A 1NB7A 2MKIA 3R2CJ 1KFDA 1RAGB 1RT3A 4DUTA 1HBOA 4IO1A 2XSJA 4IG0B 2XZTB 3M7VA 3PM9A 2JFKA 3FQLA 1WNEA 3EGVA 1W7WA 5G4DA 1CQNA 1C0TB 1K47A 3A8EA 2Q1LA 3UCGA 2ZEJA 2J9DA 4RW7A 4CO0A 1QSYA 4F4YA 3U02A 3GFXA 3KK1A 1F1BB 4ECQA 2Y0SD 3C6UA 4IOAQ 3JB9k 2H4WB 4DUYF 4MK8A 3ILJA 3CCES 1SJQA 3IGNA 2KFZA 1IM4A 3M8SA 1U1QA 1F6TA 3HJVA 4TXSA 3IG1B 4FBTA 1N34F 4FYVB 2YKQA 1LWEA 2C3UA 4DN0A 1MSWD 3AJ2A 4RR5A 2KVIA 4OZNA 1BQMA 4DCPB 2VQFF 4CYUA 4BC7A 1QUVA 1JLQA 2XCPA 4FF4A 2EPIA 4DFKA 1AW0A 1V5IB 3OFEA 3NS5A 2KXNB 2ALZA 2W25A 4J9PA 1CJTA 3QZ7A 4ID8A 2CRLA 2Y1RI 1APSA 5DQIA 3DM2B 4OYXA 2XWYA 1WACA 3QPIA 2NUHA 2ZBCA 1L3KA 1HHQA 2OEKA 5RUBA 2AJ0A 1RI7A 4F2RA 1UMJA 2QLXA 1VOMA 2BQUA 1X4EA 2BW7A 2BW2A 3OJSA 2X1BA 2ZDOA 4EWTA 1D9FA 3W65A 2HWHA 4P10A 4QZVB 1HWUA 2GVDB 4P74A 4Z7YA 4WFZA 2HGNA 4X65F 2JSXA 2JLGA 3MM9B 1TVRA 2EFGA 4LFBJ 3U27A 4CO5A 2DH7A 3EPGA 4ALZA 3P3DA 1VBXA 3IBWA 3D6FB 3IR6B 1AB8A 4PXCA 2HHSA 1TKZB 1FTCA 3SQOP 3CC4S 2ZZNA 2ASLA 4G65A 1X9WA 3RJMB 4I2QB 2Z2LA 1D9DA 1TL5A 3EVWA 2XMMA 4RBTA 3TNVA 2V8VA 4F04B 3G71S 4A8OA 5A8RB 1JXVA 2W2QP 2NPIA 2ZWPA 3G96A 4DQPA 2VBZA 4MYUA 1N5SA 3QWUA 3IS9A 3KNAA 4X4VA 2IJNA 3CXCR 2JNJA 4B9MA 4ZA1A 2GGPA 4X84A 1H3DA 3GIIA 3OHBA 2CNKB 2IAJB 3GYGA 5GMKa 2FYXA 1BD6A 3HI9A 1FE0A 2GAHC 3HK2A 3PZPA 4HR2A 3W60A 4I68A 4F4AA 3PYFA 1HR0J 2P9EA 3WBZA 2DR9A 4PKDB 1NJXA 1U4BA 3VAIA 1WJ9A 5F8GA 3M9OB 3R5BA 3EXCX 2FVPA 3DRYA 3PHTA 3CCMS 1UFWA 1DQAA 3OL8A 2EKNA 2AZ1A 4OJ1A 2ZUGA 4I7FA 3UD4P 2CJKA 3DDNA 4A8SA 3UPFA 4CLTA 2BJ1A 1FDNA 1RTHA 1HBMB 2MDAA 3KK2B 2HHQA 4CLFA 4KYZA 3VAFA 5KT6A 3N28A 4EYIB 1BWEA 2UUCF 4H4MB 1VHFA 3BSNA 1UEVA 2EWHA 5LJ5Y 2H54B 1YJNS 1L3SA 2DNLA 3AA8A 1JB0C 2DGOA 3HHLC 3A8JA 2CAJA 3IN5A 3DRSA 1FFGB 3SCLE 1Q8IA 2CUYA 2B3TB 1P9QC 3BQ1A 3GV5B 1ZS6A 2OFGX 3TZWA 1XWLA 3Q8SB 4OYBA 2XTJP 3OD2A 3PO5A 1J5EF 1F3VA 1TP7A 2VG5B 4PUOB 3DLKA 2ZH6A 2G2ZA 2BYCA 1NPKA 4CI0B 5HVHA 2HW3A 3KHLA 4C11A 2GVZB 5J2PA 1EQ0A 1SKRA 1F9HA 1R0AB 5MAOA 4IFYA 1W2BR 3BR9A 3S01A 1S57A 2E1AA 1QLNA 1YJVA 2BV3A 1R31A 3KLIB 3NWGA 1NK9A 3W3SA 1RP5A 1FKAF 3NMAA 3M32A 2ZHBA 4NLDA 3CF5Q 2EK6A 2DGVA 1N32F 2FB0A 1UKUA 4QIEA 4C3MA 4JI2F 4DR7F 3RR7A 1SV5B 2PD1A 4JV5J 4DN9A 2ZJPQ 5CZVA 5KFQA 1R8CA 4OI1A 1LKZA 5T14A 2W7AA 4RUCA 4GO7X 2RNEA 5KFOA 3GZ7A 1CQMA 3MFIA 1Y3KA 5ETNA 1F9EB 5D3GA 3N6MA 2KYZA 1MU2A 2BOAA 3HHLD 3KHGA 3C2PA 1LOUA 2A3JA 4UUWA 1FJGF 1S6OA 2PMHA 2DGUA 1Y5LB 2PMZD 2QL9B 1FA0A 2MKSA 2BA9A 2V4RA 3CDEA 2HIYA 1RAIB 2BE2B 5I3QA 4UZBA 1EZZB 1TL3A 3PKMA 2HBQB 2ZOMA 2UXDJ 2ZD1A 2DIVA 3X1LB 4DV4F 2B4UA 5A6WA 1G6BA 3GYXB 1FRHA 1SKSA 2ZDPA 1UWBB 2BJ7A 1SUQA 3MMBA 2HZVA 3OJUA 1B0VA 2X1GA 1XTZA 4PWDA 4FS1A 5J1EB 4A47A 2MY8A 1FXRA 2HK2A 1DHMA 5HSPA 3ZZRA 3ZFVA 4YQWA 1U24A 4TQRA 1PC5A 1I6JA 5DO2A 1FVQA 3NWRA 3AHPA 4K7QA 1ZH5A 2DTJA 1X4AA 2WSFC 3RGIA 3VHQA 4ZVUB 1BQNB 2WONA 3HD1A 1NO8A 2R7SA 1VDHA 4NLGA 1YRUA 3EX7B 2XMWA 4O3PA 4XPCA 1B99A 2W4PA 1HFEL 4DPTA 2XC9A 2F63A 1HNVA 3CIMA 3QQCD 2W2MP 1EX8A 4DS5A 3J81Y 1VGYA 2HRYA 1TFWA 3MMCB 2LA4A 4OJ3A 3UN5A 2M8HA 2A1BA 2OD6A 1CEZA 1DTTB 4YUDA 3MMJA 2NUUG 2YNHB 1IWAA 1RT6A 1RWVB 1S1VB 2DNPA 2KM8B 4UY85 1S99A 2MTLA 1KONA 1FRKA 2XHWA 1FXLA 2V2QA 3CCJS 4ZVRB 2QLFB 3O44A 3M9NB 1HWKA 5KT5A 2YPZA 1VIXA 4QIGA 3TUPA 3EJMA 1U45A 2J0SD 4FF2A 2A6MA 1U6FA 4HHJA 1LW0B 1UETA 2MQPA 2XY7A 4CRJA 2EFPA 1S1WA 1S6UA 4ATNA 2QC3A 3GIRA 5T41A 3HVAA 3M1VA 2CQHA 2GC8A 1O8BA 4H4OA 5IT0A 1NH8A 2AYGA 2DY1A 3H5UA 2CJYB 2BR0A 2AGPA 3I56S 3H42A 4ZPDA 1MWQA 2CDQA 2YQ3A 4FXWA 5IFMA 1WC4A 4G1QA 1GH8A 3N4WA 1X4DA 1KQGB 2NQPA 1E6VA 2RKIB 1H2TZ 4DR3F 2KO1A 3MI7X 4Q43A 3SZ2A 2OP5A 2POKA 2Z2YB 2ZH5A 1LWXA 4A8WA 4PG8A 2XY5A 4UOCA 2HNZB 2N4DA 5KG3A 1RA6A 2ZH1A 1U48A 3SFGA 2VKZG 4DMZA 1XN9A 1TQLA 2W9BB 2ZH8A 3NGSA 2YNIA 4DL7A 2HFSA 1CJKA 3CJQA 2ZOGA 3CE8A 1JKHB 2HHXA 3KLHA 2VZ9A 2KJWA 3KDOA 3BEGB 3THVA 2FDNA 1KWMA 1YQHA 3UVJB 1JWWA 4J5OA 2V50A 3T5LA 2NXNA 2H1YA 2KB2A 5SZTA 4L3KA 2WW4A 2EFQA 4ZP6A 2YWFA 3BZQA 1TL1B 2QSFA 4USKA 2M8DB 2XI3A 3WDOA 5DM6Q 4AXIA 1B4SA 3MM7B 2DO0A 2LQBA 4JI7F 4WP3A 2MQMA 4ED4A 1YDLA 4PAAA 2DBBA 2OSQA 3KUGA 3K2YA 3SYZA 2JRSA 3OW2R 2WOMB 3MEGB 3CSKA 2F7VA 1QJHA 3ZTSA 3HJFA 1WOOA 1NUEA 2MPUA 4Z37A 1C1CA 2UXBF 4UOHA 2JVRA 4CIOA 5C7PA 2ZKTA 1YRXA 5IQQA 4B3MJ 2FJEB 5CAAA 2UV8G 2R8GA 5HMWA 1RQ0A 5K8MA 3QO9A 3Q24A 2BOPA 3M2RA 3M30B 3AODA 4M1KA 1Q8LA 2IA0A 3FBCA 1C4CA 2C2RA 2XI2A 4B9VA 4DOZA 3AOBA 4YFUA 2XULA 4WBFA 1EB0A 5JXSA 2YWGA 1JK9B 2MHNA 2XBPA 3RW7A 3CGIA 2E5JA 3PYDA 1RWOB 3PTWA 4FNHA 4P2FA 1RAEB 2H51B 2OPPA 2BM1A 3G6XA 5EDWA 3KHRA 5KFSA 1S4EA 1SL1A 1TKXB 4O44A 3TR5A 2HFZA 1NMEB 1N33J 1NZAA 2GIQA 3MM5A 4URSA 3C3LA 3QIDA 2MXYA 4LSLA 1EETA 1XBWA 4DX6A 3M8WA 4AD6A 1GT8A 1YJ7A 4LUBA 4G1PA 4C97A 2MKYA 2E5IA 1R6YA 3KUHA 1HHSA 1XNRF 5DDQC 3BBCA 3MM6B 4IH5A 1TKTB 1KHVA 2E1PA 1HNZF 1KD1T 4RW4A 3KWMA 3GWCA 4USUA 1DTQB 3L7PA 4DDFA 2J6TA 1M5HA 2DH9A 5K9FA 4U96A 5K8NA 3D66A 3BPSP 3JQMA 4KBIA 4BBYA 2OFHX 3DLEB 1UW4A 4M5LA 4ILRA 2HMIB 5KFDA 3D1OA 3A13A 4WFYA 5E3CA 1D9AA 3OFFA 4MKAA 1JLAA 1HI8A 1R7IA 1GX6A 3CTRA 1VQKS 1RHRB 3PEHA 4J9QA 2RQKA 3A4TA 1HHTP 4UT4A 1UTAA 4OYPA 3BJYA 2RMLA 4KKOB 4KGXB 4KE5A 4B3SJ 3LP2A 1U1RA 1FX4A 5DDPC 1T05A 3T1YJ 3POTA 4WTOB 3CPWR 1HMVA 4I4BA 1UCNA 4WZMA 2LMIA 1X0PA 2AX1A 3L7UA 1TV6A 3MR7A 3CCRS 1CJVB 2ABYA 1VCTA 4OX9F 3VAHA 2VBXA 4O3NA 1U26A 1K73T 4EK2A 2FQQB 2V4QA 1S77D 2EC0A 3MECA 3BREA 1UVLA 3BR8A 1JLBA 3U1LA 2ZHOA 2KG0A 3I96A 2AP6A 4NXNF 2M0GB 1HLWA 2I2YA 1U1PA 4EBDA 1U1LA 3QT6A 3QJPA 2JC1A 4RWXA 2ERRA 2D3UA 2DPIA 4QQBA 2WHOA 3D3CJ 1PC4A 1TMMA 4FZVA 6FDRA 1DARA 2QG9B 4DUYJ 2OPSB 5HAOA 2JJ4D 2RU3A 3ET6B 3BGRB 2N7YA 2G1DA 4M5MA 1O6XA 1N34J 3J7Z5 1QUPA 3PRDA 4NXMF 2O3DA 3OTBA 2B9EA 3T3FA 1HI0P 1PSDA 2VQFJ 5M2RA 3R5DA 8ATCB 1X0FA 4C2MA 4RNFA 1X5SA 2W2PP 3R6LB 1YSJA 3AQOA 4CLLA 1G3OA 1VRUA 2IYGA 4Y2AA 1FJ7A 3D7SB 3FCHA 3FRZA 4MTPA 1IBCB 3JSMA 2D3O1 3EICA 2IYIA 1N8RT 1Q7YT 4ZVPB 3DLGB 2A0FB 3C15B 1S0MA 5AXMA 4KPYA 3M8PB 3SIPB 4QCLA 2XHCA 1R89A 5ETOA 1GTEA 5G0RA 3DI6A 1NDLA 1T0TV 3V4MA 4TY9A 4AL7A 3CD7A 3KG1A 3VCDA 3L95X 3VALA 3Q86A 2O67A 4U95A 1RCOB 1P6TA 1B7YB 4Q8EA 3GU0A 4USTA 3HSDA 3N6LA 2YWWA 2W4CA 5HMXA 2HS3A 5GAEU 4ZPWR 1AROP 3ZZYA 3I6PA 1FESA 3W2WA 1B3TA 2DXEA 1QY7A 2COLA 3AJ1A 1SQEA 4RW9B 4GKKF 1HBNB 1J27A 1X60A 3IGVA 2PFFB 7AT1B 4K4WA 4M5HA 4PZVA 1WC6A 3DLJA 3CJ5A 2DXDA 7FDRA 1URRA 3K17A 3DXSX 4EGLA 4YR2A 2AGOA 1UVIA 2HVZA 5HANA 2MB0B 2HHHJ 1AA1B 2GMLA 4DX5A 2RRAA 5KFLA 2W8KA 4O23A 2X7IA 5JJBA 4C0HA 5B0FA 4ZN3A 4NYZA 4R8UA 4RW8A 1KQKA 2DIUA 1RWNB 4USJC 4FN5A 4H4KA 2JEJA 5HROA 1YJUA 5CCMA 2E7VA 2KRRA 3CDBA 2VFSA 3CJSA 4RX6A 5KFUA 2HEKA 3TVZA 4NI2A 3TP2A 1RTDA 4C9DA 2Q3PA 4OV6A 4OYOA 4OLOA 1G7CB 4NA2A 5LM7E 3MEEA 1QAYA 2ZM6F 4GO5X 3HHEA 2I5JA 3RRGA 5F3ZA 2QJ3A 3O1LA 1FX2A 3QGPA 2R2UA 2I8EA 2UUCJ 2P9CA 3K5MA 1HQEA 3BO2A 2C2DA 1ZA2B 3AY0A 3ZZUA 4LFAF 1VQOS 1H98A 1JJ4A 3TA2A 3G82A 3SSRA 5K14A 4L76A 3CC2S 1UWAA 3JYTB 2JEIA 4Q8FA 2IMOA 1HQUA 4E0DA 3QRQA 3VVUA 2KG1A 2WVEA 1J5EJ 3J80Y 2LKZA 1JLGB 2QYGA 2B4OA 1RTIB 5HI7A 1QM9A 1OQ3A 1VMBA 2BACA 4L74A 2RIJA 5KT2A 5A0YB 5A8KA 1FKPB 3PJ9A 5KG5A 4RNNA 4LQ9A 1RT7B 4FYXB 3PNIA 4K2XA 4CLSA 2HLUA 1RU1A 1H73A 3OR1B 2R8IA 3F56A 3ITHA 2DJWA 4K4UA 4LBIA 2VF3A 3TYTA 1U1OA 1N5YA 3ZXWA 3DGPB 1UVKA 1FI4A 3MEDB 4B3OB 1RBLA 4O4GA 2L9NA 1F0XA 1WI6A 1VQMS 2W9CB 3WC0A 2ALYB 4IQMA 4Q0BB 1M1GA 3SSSA 3IWXA 1N32J 1YBUA 3IAS9 1OO0B 5J2NB 4NZ6A 2C22A 1PJ7A 1REGX 4JI2J 2YNGB 1A9NB 1NSQA 3R1LA 3Q2SC 4ZP8A 4XDCA 2MSTA 3I0SB 2WTFA 1V6HA 4DV5J 2Z57B 1MWYA 3N79A 4AYBD 1NKCA 3K0JA 2MMYA 1UA0A 3NCRA 1T3OA 1FJGJ 1NM2A 2KRBA 1SXLA 5AE3A 1WF1A 4CLWA 1S49A 4O0IA 5H1SV 2OI2A 4FPIA 3I5BA 4FYYB 5DDOC 4E2FB 4CP5A 1RBAA 2MY7A 5C42B 4F67A 5A2QY 2GIRA 2MQ8A 5HQMA 3R3TA 4DV4J 4IDKA 3DOKA 3LWLA 2UV8A 1E6YB 4QWDA 3UO0A 1T9WA 2VA3A 4DV7F 3D0IE 4DU7A 2M88A 1U09A 4ES2A 3G4SS 3GIKA 3IWNC 5MLCV 2NPFA 2CZVC 3M05A 3AOAA 1HBUA 3BBBA 3MM8B 1WHVA 2HHTA 1FRLA 5KFHA 2IJRA 2FHOB 2K3KA 3G8QA 2W4DA 1D1UA 4U7CA 2VJUA 2AEFA 5C24B 2RT3A 3R5AA 3VGUA 5KFXA 5K20B 3MOZA 2KU7A 1TUWA 1YBAA 1X9SA 5E33A 1WTFA 4NPOA 2H5JB 1Y0HA 5J1NA 2IVYA 4OHYA 3OUYA 2YKMB 2VG7A 5KFTA 3VQSA 4P75A 3MCOA 4UQTA 1I5OB 1RHJB 1B64A 4ED1A 5KFVA 1N5QA 2OJ3A 4C8YA 2HWTA 5A8WA 2H9ZA 4NLOA 2CQ2A 2X3DA 3J81U 2R7TA 3OL7A 2PC6A 1Q53A 4KTQA 4B9LA 2R7RA 5CYQB 3I5AA 4NZ7A 1IJEB 3HULA 4BWJA 2JVOA 1HWIA 3Q22A 1RT2A 3VVTA 2RHQB 1TAUA 1KC8T 1WF0A 3ENVA 2WB1D 4C98A 5H9FJ 3S6EA 2OPQA 3VAKA 1Q8KA 1KVJA 2ZBRA 3AD7C 4IR1A 2JFDA 1VYAA 1R3NA 1WD6A 2VUGA 4Z7CA 4XO0A 3KLFB 2WCXA 2BANA 4RL1A 2BXJA 3QAEA 5I3UA 1H7XA 2DNYA 2NXEA 1FNMA 5KFBA 3IRXA 1H74A 3FZBA 5DZ6A 2JEGA 3H98A 4IG0A 4W98A 4DQIA 2NXJA 1UZHA 2D41A 1R8PA 2GQ2A 4UY8T 3N0VA 2XYHB 4X4TA 3CCUS 2AQ4A 2HQDA 3C6TB 3AJDA 1ITPA 5IV4A 4NMLA 1RCXB 1K1QA 3H2VE 3JAMY 2H65B 4LF5F 4GRSA 2LQ9A 4DR3J 1K0VA 4QWEA 2WW8A 4HTIA 2VB6A 3CNQP 4B3RF 4WP9A 3GG0A 1RWXB 3X3UA 3IG1A 4DQQA 3GSDA 2ZH4A 3LP0B 1IWGA 2QO3A 1URNA 5M2PA 3GFHA 1S76D 2A6OA 3W2VB 5ETKA 3TRGA 4ZCMA 1N6QA 3HX9A 4IQXA 3L9ZA 1FNOA 2BQ3A 2D9OA 4AXJA 2XM3A 4DFJA 5IM0B 5C5JA 2XYPB 3O5TB 1CLFA 3DFEA 4LRAA 2A10A 3HZEA 4TU7A 1FWLA 3PV8A 4XDDA 2FLLA 1A7GE 4XK8C 2CWXA 3K5OA 4GC7A 2GVDA 5CA5A 1Q1KA 4OX8A 3ZO7A 2Y1LB 2DRAA 2G2YA 3FFIA 1I94J 1SKWA 1SC6A 1HYSB 4M5DA 1FXDA 3MAAB 4WKRA 2UXBJ 3CD0A 2UUAF 3SFUA 2V34A 2CJ9A 5EWFA 1REVB 4LRBA 1TKZA 4IUFA 5AE1A 2O01C 2GIFA 4A46A 2BBEA 1NJZA 5J2QA 4ED2A 1JNZB 5KFFA 3DYAB 3PW4A 4PG4A 4I2QA 4UUXA 2R7VA 1RT5B 2JDJA 4TLRA 4YN3B 4A8XA 1XMQF 2AYBA 2CJQA 2CPYA 4QIVA 1NSAA 2GX8A 2IRUA 1RT3B 1UFKA 3SXLA 1ROFA 4ZKAA 5IT4A 1HQ2A 5A8RA 5IXUA 1S6QB 4N56A 1IR1A 2H3EB 2AZ3A 4HHHA 4WYWA 2CWKA 3SCJE 1BY9A 3KK1B 4KO0B 1YITS 2IAJA 3C6UB 2W9AA 4AE5A 2CPFA 1B0PA 3LGHA 2HNDB 4IOBA 1FRIA 2LXFA 1ZM4A 2P6SA 4W4MA 2K1RB 2KT5A 4KSEB 1LWEB 4FXVA 3ILOA 3B4DA 4X66F 1XNRJ 4U8YA 1U1MA 2C2KB 4MH8A 1BQMB 4WXWA 2FLPA 1HNZJ 1GMWA 1FEHA 4ZIVA 1HBMA 2GZOA 3KK2A 2VQEF 3UNYA 3TJ9A 1NRKA 3HT0A 1X5OA 3ETOA 5KFEA 4QWCA 5GAHU 4H4MA 1S0VA 3IWLA 3G6VA 2OMLA 2HG4A 3ONQA 3UDLA 2CQGA 1TTHB 1UW9A 3EGWB 3MZIA 4MIWA 5I42A 2DR8A 4R0JA 2B7BB 1CS4A 3MCMA 1S9GB 1RACB 4RNHA 1TK0A 4LBPA 3TEHB 3PHEA 1C0UB 3GR1A 4KV8B 3GP9A 5BYRA 4C0OC 3TUIC 3VV2B 1KTQA 4PUOA 5IWAF 2D74B 3NRBA 4CWBA 4P6QA 2KKHA 1XJWB 1OYDA 3OHAA 2MQQA 4DSIA 3JSRA 4LT6A 2GVZA 1VC0A 1OS5A 1LWFA 4KGZB 5EN1A 4DLEA 1R0AA 1KVIA 1RAAB 2CIMA 2GS8A 1IKWB 4P7TA 1X4BA 1NKEA 2HHPA 4C8KA 1RJJA 3KLIA 3RAMA 5CH7B 2WVFA 4OX9J 3QAUA 4QBUA 2GHPA 2E5HA 3M2UB 5AXNA 3V6JA 5B0EA 3HCXA 4HL9A 5KG4A 4JI8F 3FBBA 5D4PA 2LQJA 2IIHA 3R5JB 5IC4B 1Q4RA 1SV5A 2B5JB 1GFWB 4LSZB 4NXNJ 2J6SA 1MMLA 3MD3A 2HK3A 1P1LA 3BKFA 2Z58B 2DGXA 2F40A 4MFBA 2FC8A 4B08A 2XNRA 3ZC4A 1RA7A 1VFJA 5DLFA 4DQSA 1RT1B 3E8OA 4Q2MA 3GFZA 5EGYA 5F0WA 2FJDB 1N54B 2C3YA 4F7VA 2QMWA 4PCQA 1F3FA 2XYGB 4JBCA 4CLZA 1FRXA 2CPXA 3L7OA 3FBEA 1JLFB 2AEMA 2QMUB 2F1FA 3CJRA 4WP8A 3PIOQ 1D3WA 4OZ5A 2CDRB 1TUVA 1PG5B 2KT2A 3ETMA 3PIPQ 4QU7A 3PRBA 3HVRA 4RBVA 1ZAWA 5AXLA 3VGVA 4F3MA 1A0OB 4I7FB 3W7BA 4ED8A 4PG6A 4OYMA 1FE4A 1RTHB 2BE7D 2FIUA 3IAM9 4LF6F 3TX0A 4JYAF 3FCWA 1S6PA 2L9DA 1RKJA 2I1RA 3L4BC 1M90T 1KR4A 5B08A 1SBRA 3IFEA 2HRUA 1Z1ZA 2N7CA 1BWVA 1Y5NB 3P45B 3TQEA 1RYSA 4DR6F 3S1TA 4ED3A 3TAMB 2DGWA 2WVCA 8AT1B 1O51A 2ZKUA 4EFAC 4QYZJ 3C19A 5LOQA 1GNKA 1BQNA 4UQGA 5KAKA 3EGZA 4FP9A 5L46A 4YY3F 3SQGB 3RRHA 4K8RA 5FDLA 2U2FA 3M8RA 4LQ3A 1F9FA 4K4ZA 4XAKA 5HMZA 2B7CB 5J2PB 1SC1B 5B0DA 1HNXF 1WORA 3C16B 4L72B 2AJFE 2WRMA 4JV2A 2ASYA 4ZITA 3TI0A 1X31C 1VQYA 3PJWA 4DFMA 3MMCA 4GKKJ 3PW0A 1DQ9A 3AB4B 4X4NA 2V8HA 3MURP 2HFNA 4LR8A 2DGSA 2XY6A 2YNHA 1W26A 3VTIA 1S1VA 3TJ8A 4ZDNA 1U0SA 2PN6A 2RAQA 5LXYA 4KHPF 1EQMA 3CO9A 3TA1A 4AUKA 2NSCA 4EO6A 1VR6A 1D8ZA 1WEZA 2FVSA 9RUBA 3B78A 4FYDA 1YBTA 2NLWA 2QIFA 4NRTA 5E3AA 2CZ9A 4ANCA 2EC2A 4AFFA 3K5NA 1MU2B 2BABA 2NYHA 3L09A 2RRBA 4YDXA 1U1NA 3W64A 1LW0A 2LEPA 3H25A 3GIJA 4KIAA 2YVSA 1R0BG 2JLEA 2D1CA 1KQFB 1EHWA 3TUZC 3CD6S 5HJYA 5CXTA 4RZRA 3EPIA 4O0NA 5GAEI 4PR6A 4CH1A 2VDIA 2HHVA 3MWBA 3UD3P 2FHJA 2ZM6J 2ZD1B 3VAMA 9ATCB 2QA4S 3PKYA 3JTNA 3FEZA 3PACA 5KFIA 3MPDA 3U1NA 1FKOA 1I3OB 5E5NA 2YY3A 3MMBB 3I4HX 1VBYA 4P72A 1TKDA 5DG9A 2DEJA 5F0UA 2V8DA 4PWDB 4LFAJ 4Y0FA 1XQIA 3FGVA 3TARA 5GAGU 1I1GA 3UNGC 3DLHA 2CJAA 3T9NA 5K8OA 1T11A 1JKHA 1WUUA 1VJQA 4P2SA 3DNCA 1IVZA 4KJIA 1UFLA 2C2ZB 4IG3A 3RR8A 1RWUA 3I55S 2EI5A 3J80U 2AJQA 2FHMA 1WDDA 3PFOA 3SMZA 1U49A 3NAHA 1OWXA 2BEFA 3QMQA 3UVJA 1FHTA 1KLNA 3ILLA 2XGQA 1WWHA 4YB5A 3MOJB 2XB2D 4TY8B 3LWMA 2Y3YA 4K5RA 4TLQA 1IQTA 1TL1A 3BKUA 3OXFA 4N5SA 2PDAA 3I87A 4X62F 5ETMA 3HT3A 1LEOA 3HLUA 2E1RA 4MMOA 4I67A 3BYRA 2WOMA 3H5YA 3MEGA 3H40A 4NRUA 1BUXA 1NKBA 1YHQS 3M8QA 4USWA 2EG1A 4ZMMA 3Q23A 3UCUP 3ZNJ1 2AWZA 1N36F 3MPUB 4C3LA 2DT9A 2HAFA 1Y4ZB 5DETA 1DFDA 1KVKA 4AQYJ 2YKNB 4WZQA 1OPZA 4LREA 1GXTA 1HARA 3FKBA 1NDCA 3BKTA 4HACB 2LXUA 2IM0A 3M30A 3JSYA 3W66A 1KOOA 2KTQA 4RW6A 4YHHF 1GEHA 2R2SA 5KT3A 3RBZA 2XO7A 1RAOA 4H4OB 4TKTA 2V67A 5EWGA 3P96A 1VQSA 2VA2A 2NZ4A 2MZRA 5A2QU 1W2IA 4RUBA 3EVOA 3KOAA 2VH7A 1TKXA 2J7KA 3TOQA 3BM7A 3KLGA 1PO6A 4DV7J 1UA1A 1NXIA 5LL6d 3THPA 4DCOB 4DV2F 5U47A 4E8UA 3EWGA 3DLLQ 1SC3B 4C8LA 3UDEA 4DV3F 1ZZFA 4RJVA 4ZVGA 2IHR1 3DHXA 5HO4A 2VONA 1ZPVA 1NNDA 3ADAC 2Z30B 1WKKA 2UVUA 2E9TA 2ATLA 3ENQA 3JS9A 3MM6A 2RQCA 1TKTA 3LP1B 3KKFA 2YNIB 4F8RA 1YIJS 2EW9A 1CJKB 3NY0A 3KLHB 4D3GA 1QDUB 2CQCA 1EP4B 2L9WA 3OR2B 2VFTA 2F4VF 2FHKA 1IBMF 4U67Q 5H9FK 3PO4A 2IVMA 1LFWA 4O3QA 2Y1IA 3BYPA 2Y8YA 4OHWA 3KTQA 1NDKA 4HT7A 4P52A 4IH7A 4MAKA 2CYYA 4HDGA 2D3ZA 4DXLA 3MCNA 5CD4H 2B9YA 4CO1A 3FSYA 3R97A 4CTAB 3HF5A 4CO3A 2K7JA 1UP1A 4B9TA 3A12A 3HDSA 2PIIA 2ATCB 3FK4A 1VQ9S 1PJ5A 2EBEA 4HT5A 4KKOA 1NU4A 2QA2A 2R8JA 5ETTA 3VR1A 2NR0A 3G6YA 4DJBA 2RILA 2DHHA 4F0KA 1CJVA 2ZC3A 4J37A 4G3IA 3Q83A 4DSFA 3MPYA 3SEOA 3TVYA 1D8YA 3QJJA 2HYIB 2CNLB 4AT1B 3QO9B 4QIFA 4ETXA 2K8GA 3M2RB 1FEEA 2OTJS 3NLCA 3MXHP 3VZHA 1H7WA 3D9BA 5L1JA 4GVBA 2ADBA 2G0CA 5KFCA 2NYIA 2X1FA 2QEXS 3QBCA 4PRFA 2WZ1A 3ISZA 1DBDA 5KG0A 3QGIA 4M5IA 3BSAA 3O3LA 4NZ0A 4LF5J 3R9LA 1ZPWX 3NEKA 3JAMU 4O44B 2OPSA 3K59A 1JJ2R 3ET6A 4IFVB 4B3RJ 3BGRA 1FF2A 3U1MA 1EETB 2OH2A 2MKJA 1JLCA 3KMSA 1DJ0A 2IY5B 5KFZA 3N5FA 1S0NA 3QRRA 2C3MA 1VRTA 2PO4A 4UZCA 5T7LA 1QVGR 3TZXA 1M1HA 3MAHA 4DL5A 1MMNA 1P9YA 5B09A 3OBIA 5LMNF 3T5KA 1SJ1A 1HWLA 1H38A 3T19A 3OT9A 3LQVA 2ZH2A 3DDIA 3WC2A 4KC5A 4D3HA 3ZZ0A 3D4JA 2CQ3A 4OJHA 3C15A 2MGZA 2B8PA 5ETQA 3GQCA 2CQDA 4N77A 4HYKA 2FY8A 2DGTA 2F8MA 1H2VZ 1CPZA 1MMDA 1LXNA 3H8YA 2RB7A 3DU5A 2B8QA 3DLBA 3FC9A 5FLXU 4ZOSA 2BKNA 4WYLA 1L3TA 1HW8A 4ZIWA 3Q0AA 4ECZA 2HSEB 3NOCA 4C7QA 1N48A 1Q79A 1TL7A 2IFXA 3IA0A 3CEDA 1MROB 2CG8A 2XSFA 1KSPA 5IT9U 1D0EA 1B0TA 4OMFG 1QAIA 1LWCB 1RAFB 2C2OB 2GFFA 2PE8A 1O0PA 3CJ4A 4RW9A 4BWMA 1HBNA 1Q78A 3O8WA 3CJTA 3B8HA 3DGVA 1FNXH 1VK3A 1XMQJ 4EUVA 5KOXA 1CSJA 2AJ2A 3D3BJ 4FNIA 1B7FA 5HVFA 3JQKA 3QIPB 3QSIA 3BGLA 2KL8A 3GJRB 1YG0A 5L9XA 3PEJA 4DG1B 3RBXA 3V2UC 2CKWA 2MLXA 2QE5A 1X5TA 1WG1A 4PWWA 3BV8A 3R1HA 2FGCA 2FUG9 1RSCA 4J9UE 4B3TF 3UWTA 4ED6A 3GCWP 3ISNC 2LCWA 4P9SA 4JI1F 2UZAA 2XMAA 4ECUA 2ZJRQ 3N01A 5KFGA 4J7CA 1QAXA 2XMVA 4USVA 5DRKA 2CPIA 2L41A 2IJFA 4LFCJ 2QSWA 2QA1A 1RTZA 2NCKL 5EUHA 5D4OA 4F4WA 3KJVB 3UQSA 2EFVA 3NGRA 1ZA1B 2DXFA 3KJQB 4ELUA 1TELA 4NLVA 1C2PA 1QE1A 4X66J 2CQPA 3R5GA 3G6ES 2DCLA 4J9MA 2X3GA 2VQEJ 4B9SA 2VG6A 3KG0A 2Z0GA 1YX2A 2C28A 4Q5VA 4F0HA 4YEAA 4F3OA 5J2MA 2OO4A 2G1HA 2I6WA 5DJBA 1NPPA 3IRWP 4FBUA 4DV6F 4AL6A 2EFNA 2AV5A 1MN7A 2FVRA 4RUAA 5F8MA 3RW6A 3JYTA 1GAOA 3M8YA 3VGSA 5KFWA 2K2PA 3LPEA 5IOLA 1G2EA 1IXKA 3HKZD 2UU9F 3RU0A 4ZPTR 4N8NA 1RTIA 5IWAJ 4NWBA 1IBKF 3KLEB 3ISND 2CPZA 2RRNA 2KZZA 2MLYA 1FKPA 4DL4A 4OI0A 1LV5A 2R9LA 5HBMA 4HDHA 4PEOA 2P6TA 1T9UA 1NH7A 3C14B 3OR1A 3HVWA 5LSOA 4DL6A 1MN9A 4G1IA 1SH0A 1HNIB 2N4CA 4DL3A 3IBFB 3HPOA 2B9XA 3DGPA 3BSCA 3MEDA 1YJTA 4B3OA 2HVHA 3FNNA 5E41A 2W9CA 4Q0BA 4JI8J 1BHNA 4JI3J 2MZSA 3P8BB 5J2NA 5C25A 2DPJA 1ZAXA 2CQ4A 1VS3A 2YNGA 4Y34A 3AOCA 3GYNA 4LF7F 1VC5A 5CYMA 4ZVQB 4USIA 4URQU 5C2GA 4JI0F 1X9MA 2D9PA 3I0SA 2W2NP 4X4PA 2WSCC 2KDOA 1T3NA 1HD0A 4BS2A 2DNOA 5I4MA 4ECVA 2PA8D 4NLPA 1K8AT 4LSNB 2V8GA 1N5TA 2IPOB 3EYZA 3J81j 2LXIA 3NOGA 2F3JA 5KFAA 2HFUA 3BPDA 1S7IA 5JMNA 1GQEA 5LSLA 4WK3A 5C42A 2J9EA 4RU9A 3EZ5A 2BJEA 2EEYA 3ZZZA 4XIUA 4IR9A 2PEHA 1E6YA 4QOTA 1N52B 1S1UA 4F4XA 3UN3A 4F4ZA 3UDVA 1U2FA 4L73A 4ZJQA 4QYZK 2I5JB 5IZHA 4LF6J 2FC9A 5LJ3Y 4UF4A 3W8GA 2RF2B 3ZTRA 3MM8A 4JYAJ 1RWWB 3ZNUA 2K06A 4F36A 4LF2A 1DLOB 2J9DE 1M0SA 5HQ8A 3O6QA 4ZP7A 5KT4A 3ENWA 3GB0A 2JWNA 3GE9A 1P8GA 1U8SA 4YOEA 2GQCA 5K14B 2W8LA 4PYAA 4DR6J 2DISA 3J7YU 4ILMA 5CD4A 5ETRA 2J0QD 2DNKA 1FVSA 1UVNA 1EIYB 1YRTA 3HHKA 5LSRA 4V19X 4YY3J 2FJBB 2V69A 4B9UA 3EUNA 2G0IA 4KGMA 2HZCA 1VLYA 1WC0A 3TVKA 4RO0A 1HNXJ 1RAJA 4A8MP 3ITHB 3QSYB 2RS8A 5L1LA 1EKRA 3V6DB 2JHEA 3GCXP 5CYQA 1WHWA 3LGNA 4PQUB 5JUMA 4A48A 3EDQB 2ZFHA 4OZ2A 4J9OA 3KK3B 1T02A 1BLUA 1MW7A 1ZAVA 4KHPJ 2FLOA 4NLQA 5ETLA 3KLFA 1ZOTA 3OL6A 4KPCA 1XR6A 3FSIA 3VF0B 5KFJA 2RDIA 2E9RX 1JMTA 1DQ8A 2DCUB 3WIVA 3W9JA 3GJSB 2BQRA 4ZHRB 2ZZTA 1QSLA 2MKKA 4LF8F 3H5XA 1IJFB 3TZZA 2MKCA 5HVGA 1UAWA 1U1KA 4BHQA 3E2EA 1CJUB 5LMUF 5HN0A 3NCPA 3L3CA 3UCZP 2Q43A 3DRRB 3Q8QB 4WXOA 2OKQA 4J9RA 2KI2A 2ASDA 2VL1A 3C6TA 3DOLB 1WOSA 3QT5A 4DSKA 4J9KA 2VFVA 4ZVFA 3MMAA 5DGAA 3RZAA 2AD9A 1GX5A 3DOKB 2VPXB 4ZK7M 2V2KA 2A18A 1EJ7L 1KQSR 1IKVB 1MWZA 4ILLA 4TN2A 3AA9A 3HHNB 3HSZA 1H6KX 3LP0A 3EZUA 3DRPA 1Y11A 2FJXA 3D68A 2VASA 3W2VA 1S72S 2GA7A 4X4UA 1UVMA 5KG1A 5LT5A 3CCZA 2DNMA 4Q44A 1M5KC 3R8YA 4MK9A 2AHOB 4Y65A 1VIOA 3H4DA 1XR7A 4KFBA 1NDPA 3B4MA 5M2UA 3FEYB 1VQ7S 5IM0A 5DG7A 4DEZA 3AB2B 3RAQA 3Q89A 5L39A 4EMDA 2GJIA 5H9EJ 4CM0A 2XQCA 1SB6A 4OZ1A 1A6LA 3MCSA 4ZPAA 4K50A 1JX4A 4OI2A 1RHUB 4L75A 3CJKA 2AJ1A 2QV6A 1N88A 2DR6A 5A8WB 4X62J 4QU6A 2Z4PA 2E44A 4GKJF 2XMUA 4KR0B 2JOQA 3F0NA 3PW7A 1U6BA 1KRPA 4YDDB 2J5AA 2LYVA 1HYSA 4OZ3A 4WTYA 2MYFA 5HLFB 3IR7B 3MAAA 1VHIA 4LJMA 1N36J 3NNAA 1SJ3P 1REVA 5GAGI 3LF0A 1PYOB 1JJCB 4DPXA 1KOHA 5HMYA 2R42A 3CCSS 2R8KA 3DYAA 1S9EB 3BH7B 8RUCA 3T1HF 4ELTA 5I3UB 2VDHA 2D3OR 2ILZA 4OV1A 3IRXB 5F8LA 4I6YA 3JTOA 2FJWA 4YHHJ 3HD2A 3B6BA 3P5TL 4PYDA 2NREA 1RT4A 1KLMA 2NSBA 2GAGC 2LQ8A 1S6QA 2DNQA 1LW2A 2GCFA 1SH2A 4UOGA 1U47A 2FJAB 1R8HA 2XS2A 2M70A 1Q16B 2V9KA 5EX0A 5AE2A 3BO3A 1PAUB 3TX8A 4LBHA 1DRZA 2L3MA 1X5PA 2BVZA 2LQ5A 4P71A 2XS5A 4N7TA 4KO0A 3V4IB 4USHA 4DSJA 4DV2J 2JL9A 3FBFA 1T03A 2HNDA 1FK9B 3GFYA 2G2OA 4DV3J 1V5VA 3FDSA 3PX4A 3NNCA 2HLTA 3R7NB 2K1RA 1NK0A 2V63A 4NA3A 4I6WA 4ED7A 1Q5VA 1HA1A 3K58A 2RSQA 3M2VA 3VAGA 4DV1F 3NP5A 3NKYA 1N6QB 2DNRA 3OVAA 3K8WA 2ZUAA 1FRMA 1UEUA 1RLCL 1J5OB 4RWWA 2AIRB 3R6GB 3HKWA 2MQOA 1BMQB 4I2PB 4HHUA 3EE3A 2OMOA 2F4VJ 2Z2MA 4PG7A 4X4RA 3T6BA 3WX8A 1IBMJ 2ZH3A 2E7XA 4EZ9A 2HBRB 3ZZTA 4E98A 1Z2LA 4QPXA 2RH3A 3PYGA 3VZIA 2E7WA 1S9GA 2X51A 2RQ4A 2HIQA 4LF4F 2HQCA 1C0UA 1OSCA 3BH6B 4KV8A 3RRKA 1OY6A 3TWZA 3LOUA 1AXQA 2OUGA 2C42A 3G8SA 3FFIB 4I1TA 2F8EX 2WBMA 1IKWA 4M5DB 4NCBA 1IR2A 4LMZA 3AH6A 4NLWA 4ETZA 4ZJLA 1L3UA 3QNWB 1PJ6A 2CQBA 1FD8A 2V68A 4X65J 1HIYA 1IUJA 1WC5A 3M2UA 2ACYA 1U2CA 5J2QB 2HGLA 4ER8A 2K7KA 1XEZA 2C1EB 3W62A 4ED5A 4CLYA 3NCQA 3V6KA 3PXGa 5HL7Q 2B5JA 4DV0F 3QLHB 3GR0A 2DHXA 2B6AB 1MLAA 1WHXA 1KDNA 2HHHF 3FMBA 2OEJA 1QSSA 3GPAA 4K4TA 4DR1F 3BO4A 1SCJB 4EI2A 3UD5A 3DMJB 2KYXA 3T6JA 4K2JA 3SCKE 3OV7A 2V5HG 1RT1A 1S1XB 1KEKA 3NBPA 4OQJA 1RK8A 1WC1A 4N47A 2AKWB 4ZVOB 2HQFA 5A76A 4H4KC 4NCAA 2ZE2B 2YWHA 4DQRA 4YB6A 1JLFA 4XPEA 1X4HA 4QWBA 1K1SA 2JC0A 2KJVA 1YJ9S 1K0TA 1JXEA 3LANA 4LRFA 2XG8A 1QAJA 2OEMA 3W8PA 3OSPA 1SJRA 5LMNJ 3SV4A 2IM1A 1YK9A 3PX0A 1Q81T 5DM7Q 5FIIA 4ID5B 1XERA 4ZVEA 2HNYB 3KJFB 3V6HA 1IR0A 2V2VA 1P27B 5F9NA 1U0HB 4OX7A 5EWEA 1F60B 4FXDA 5DGBA 2YNFB 2VIHA 2QL5B 5ITHA 5I42B 3OLAA 3TAMA 1CS4B 2H48B 5GADU 2F8HA 3ZTPA 1RISA 4F26A 4FF1A 2IDEA 2L08A 3D54A 1R8BA 3H90A 5IC6B 5C2CA 2QLWA 1FTRA 3SQGA 1AZSA 4KB7A 3HHLA 3MF5A 5JVHQ 5E7OB 4MJKA 3SV3A 3PVXA 1F5CA 3HVTB 2HPUA 1FRJA 4WFBQ 1LWFB 2FVQA 2J9CA 1CULB 3G2XA 3AXKA 3C16A 1C4AA 1SVDA 1IKXB 3I9ZA 1RB0A 3T1AA 1RU2A 4FPRA 4IRCA 4WF9Q 3AT1B 1HW9A 1EAYC 4IRKA 3B54A 1U8WA 5BJRA 2AYMA 2P2CB 2OGUA 3E01B 4ZLJA 2AGQA 2QTWA 3H59A 1SIWB 1TAQA 3A3PB 1S97A 3WX4A 1WDTA 1WSRA 2GW8A 3WZ0A 1FD2A 4MFBB 2DNNA 3JSBA 2DEIA 1FT8A 4B3TJ 4LRCA 1S1TB 3ZTOA 4OZJA 1XR5A 2RHSB 4DV5F 4JI1J 2XMJA 7FD1A 3PW5A 2N3LA 2RDJA 4C4WA 4DR7J 4ZPVR 1Z2ZA 5BXIA 5B7WA 3M6UA 1WKLA 1OSDA 3US5A 3SDEA 2M9KA 2V94A 1TUGB 1VQPS 4OI6A 4OHVA 1IN0A 3CMAS 3BGFA 5KFYA 1OYEA 3KG4A 2J8AA 4M94A 4EBCA 1WG5A 1P1TA 3QT8A 4PXDA 3H7HB 3FUYA 1C1BB 3BBFA 4U6PA 2AEJA 4LIRA 3W5XA 2CQIA 5F8IA 4YR0A 3EM1A 2BJ3A 3QT7A 2HVDA 4X64F 3M4XA 3HFVA 1PYSB 2BJDA 2OELA 3DCAA 2F65A 4DV6J 4NLRA 3MD1A 1S6PB 3R7BB 3CDWA 1UL3A 5AT1B 4ICLB 1RTJA 3ILIA 1PGZA 2J7WA 2CG4A 2UU9J 3J7AN 5D0HA 1VQ6S 2IC3B 4PG5A 3UN2A 1IBKJ 4Y2MA 2LA6A 2VODA 3GSIA 4TYBA 4CLUA 2LECA 4C0BA 4CDIA 3OL9A 5FDLB 1NK7A 2G9OA 3CDAA 4IOCQ 3PW2A 3BDPA 4ZP9A 2DY9A 2XZDB 3AD8C 2M5YA 4TY8A 1JLEB 3IXQA 2CVIA 2GHWA 5E2QA 4Y2IA 4CH7A 1CC7A 2UXCF 1H2UX 4BC9A 2I0XA 1CBKA 4LF7J 1FDBA 4P73A 3QZ8A 1KNZA 4JI0J 2KZMA 4X4QA 1F5BA 2MLZA 3M8ZA 4NYOA 4QWAA 3DN9A 2A2DA 5HP1A 2YKNA 4MKYA 2CNOB 2Z8QA 2RE1A 4HACA 3CCVS 3I0RB 3A8IA 2QFJA 2HZAA 2Y0BB 4PXEA 3V81A 5BR8F 1NSPA 2PA3A 2WBRA 4JI6F 1NK4A 4PQAA 3DOMB 2WB4A 2LU1A 1KTVA 3PCOB 1S5ZA 3Q2TC 2OLWA 4LIWA 3QFHA 2FZKB 1YJRA 4WIIA 4Y00A 4AL5A 4DR5F 2W1BA 1SJ4P 3I31A 1PKUA 3KNGA 4TVAB 1QTNB 3QGHA 4CT9A 1FKOB 2Y9HA 4QYRA 3OTEA 4ZPCA 5IQ6A 4BDPA 1C0TA 5A6PA 3MUMP 1WSVA 2B43A 1HPZB 2VU5A 1Y00A 2V4JB 2NZCA 2ROPA 5F9LA 1RKIA 2XMTA 1N0VC 2Q66A 3LP1A 2G13A 1K44A 4CO4A 3KXDA 3VWSA 3GTYX 1SIZA 1AFIA 2HFOA 1T9TA 2CADA 4DX7A 2CFXA 5HJXA 1EP4A 2R8HA 4IG3B 4NCGB 3N6NA 3Q8PB 2B51A 2OSRA 4C8OA 3OR2A 2GV1A 1IKYB 2U1AA 2N3OA 2QN6B 2DHAA 1T9XA 4NYPA 2BRLA 4F4KA 2VHGA 3CCLS 1HKAA 2NXUA 2VC0A 4U9RA 5LXRA 4QW9A 1M5VC 2ZWOA 1TL4A 4ELVA 5CZXA 3W61A 2HVIA 1QD1A 4IYQA 2R7UA 5D6GA 2ILYA 1GMVA 1WKJA 3DM2A 4CTAA 2RU9A 1ZZNA 3CCWA 3GV8B 3HXMA 1KP6A 1I94F 2C2MB 2UVWA 1Y7PA 1L5UA 1ZYQA 1VISA 3M8QB 5CCLA 2UUBF 1H72C 3PJXA 4PPDA 4JI7J 2APOA 1SQGA 5FLXY 3Q8YA 1YWXA 2D69A 4Y2CA 3MM9A 3HP6A 1VI7A 3MDFA 5D0GA 3M6VA 4M5KA 3CUNA 1NK5A 3J7YI 4X2BA 5EHHA 4LF8J 4RNMA 4FF3A 3W9HA 4A4JA 5D0RA 1RDRA 2IVFB 5KG6A 2E5LF 5IT9Y 2OPRB 5LMUJ 4RW6B 2ZNZA 4ENOA 1PYTA 4DCJB 1VQNS 1M5PC 4R5PB 3NXZA 2F4FA 4DZ6A 1FO1A 4HH1A 4ZVTB 2CQ1A 3CMES 1XIQA 1T9YA 2QL7B 1YZ6A 2MHEA 4QR0A 4WE1B 2BX6A 5SUHA 4ZVHA 2MZTA 1HBOB 3KLGB 4HKQA 2XSJB 5D15A 3M9MB 4IFVA 4UW2A 4N76A 6AT1B 3QRPA 3RTVA 5H9EK 2B0GA 2ZH7A 3M6XA 1IQZA 3FEXB 2P5VA 1PIEA 4EO8A 4WJBA 5DS7A 4RW7B 3MUTP 3WHIA 4I64A 1N5VA 4V1Ak 1NJYA 3J7A1 1RHQB 3TANA 4ITSA 2G4BA 2HHWA 4DU8A 2JH3A 1N4LA 4O4RA 1YVFA 1TFYA 3M6WA 3NAIA 4DI6A 1FJEB 2UVVA 4NLXA 1ZM2A 1Q7LB 1S9FA 1UJ4A 2IM2A 1DURA 2XZWA 4CYUB 3W9IA 2VV5A 5HQLA 3SI8A 1JLQB 1BC6A 1Q5YA 3MPWA 1FERA 3IC1A 3MUVP 4GKJJ 1Z4UA 4U7UK 4XTTA 2GHVC 2O1PA 1NB2A 1CJTB 3VQTA 3A3OB 5I3PA 3IM9A 2HHUA 2AMCB 2X1AA 3I5CA 1Y3JA 1RZMA 1MROA 4YMEA 4JI4F 2NS1B 1LWCA 1TK8A 2VG5A 3K57A 4B02A 3GILA 4Y28C 4EYHB 1KS2A 3G87A 2CPDA 2VFRA 2R3VA 4PWUA 2LDYA 1TVRB 3GONA 3T1HJ 3CC7S 2BJ9A 3W1YC 3QWPA 3CULA 1XMOF 4LF9F 1XC9A 3EVMA 4QIWD 3GJQB 2F5GA 3QIPA 3D1HA 3P5BP 2EVZA 3CJ0A 3MPVA 4GMKA 2MZ1A 4EEYA 1GMWD 4DG1A 4DSLA 2IBOA 4RPFA 2GQQA 4YR3A 2SXLA 2F9DA 4DZDA 5ADZA 3BDEA 4NA1A 1AYEA 2ACMA 4GVBB 2PMWA 4FVMA 4DR4F 3D28A 3IO1A 3W5ZA 3LPYA 1QVFR 2C2NA 4CQ1A 1OQ6A 3ZZOA 1ZTTA 1X8DA 4NMXA 3TO8A 2VD3A 4QW8A 1MNEA 4Q7AA 3HM9A 2QMXA 2IA6A 3KJVA 1NHVA 2CPJA 5KFRA 1JLCB 4W92B 2CJBA 1X7VA 4OYAA 2BE9B 3IS9B 2VKRA 3OTOF 2UVRA 3ZZPA 1M5OC 1VRTB 5T7LB 4DV1J 1NK6A 2QA4G 2R7WA 1R8AA 1S4FA 2GGPB 3WIUA 5CABA 4CT8A 2ZBIA 2DRBA 2KFNA 4S0MA 2V8PA 3CWJA 3OLBA 4WIQA 2BE2A 1ZETA 3W5YA 5D4NA 1ULRA 1SH3A 4NXMJ 1GTHA 2DHGA 2MZJA 2ZHAA 4C3KA 5FJ4A 2YKOA 3CW2C 3HFKA 3SBMA 1D09B 5HATA 4Z2XA 2ZJQQ 4J9SA 1XNQF 1NSKL 4TYAA 2PT0A 2MGZB 1UWBA 2HBYB 2P8IA 2CPEA 3GV7B 5DQGA 4C48A 3NS6A 4LF4J 2AU0A 5J1EA 2PFDA 4I0WA 2LEBA 4KT0C 2ASJA 2Q79A 3KLEA 1HI1A 4RUHA 3GIMA 2IMWP 1F5AA 4WCEQ 2WVBA 1G4CA 2KHCA 1NPRA 4A8YA 3VAJA 1Q86T 5D77A 5DLGA 3C14A 4X4SA 4WFAQ 2LVWA 3DRSB 1TL7B 3EZOA 1HNIA 4NX9A 3T5HA 4DUZF 4NLSA 4ZPBA 3RYLA 3AAWB 3DLKB 2BM0A 2LEAA 5L9NA 5E3QA 1RE1B 3FVYA 4BCAA 1UVJA 4C11B 4DX8H 1DAXA 3BF4A 4OIXA 2CNNB 2VPYB 1NLKL 4K0KF 2BKOA 2DK2A 1VBZA 4DV0J 4IFYB 3H2LA 2XWXA 4R25A 2KM8C 3OTCA 3RUBL 4KH1B 4KAIA 1LK7A 2GJFA 1BXNA 4CZCA 3LA0A 2FLNA 3FQKA 1DTTA 1FFSB 3D6TB 1AUDA 1HNWF 3O2IA 2FZCB 4DR1J 4JI5F 4NLTA 2BRKA 3M32B 4MT1A 1RHMB 3HMJG 5AJ3F 2QT7A 4OL8A 4DS4A 2RDDA 4LSNA 3MR6A 3OTDA 3CO0P 4GC6A 1S10A 1YTYA 3NGTA 1IBLF 2QFIA 3NS7B 1WG4A 4KHRA 2AYEA 2ZVSA 3PRVA 3DU6A 3T9ZA 5D8HB 2E9ZA
chains in the Genus database with same CATH topology
2CJXB 1RHQB 1SC3B 2CJYB 3GJTB 2QLBB 1PYOB 1IBCB 2H65B 3GJSB 4ZVSB 3RJMB 3EDRB 3P45B 3QNWB 4ZVPB 2HBZB 1RWOB 3IBCB 2XZTB 2XZDB 2QLJB 3GJQB 2H51B 2Y1LB 1RE1B 3SIPB 1RWXB 4DCJB 1RWMB 2CNNB 3R6GB 1NMEB 2H54B 3KJQB 3D6HB 2C2ZB 1BMQB 1RHKB 1I51B 1RHRB 1RWVB 2C1EB 4ZVTB 3IBFB 2C2OB 2XYGB 2QL7B 1RHUB 2P2CB 1RWNB 1RWPB 2HBRB 1QDUB 5K20B 2HBYB 4JB8B 2CNLB 3KJNB 1QTNB 3KJFB 1SC4B 2C2KB 2H4WB 2H5JB 1F9EB 1SC1B 2CDRB 4ZVRB 2QLFB 1RWKB 1RHMB 2C2MB 2CNKB 3EDQB 2XYPB 3R7BB 1PAUB 1ICEB 2H4YB 2QL5B 3R7SB 3GJRB 1RHJB 4ZVUB 2H48B 1RWWB 2QL9B 2CNOB 4ZVQB 3R6LB 3R5JB 1I3OB 4DCPB 3D6FB 5IC4B 3D6MB 5IC6B 2XYHB 3NS7B 3P4UB 2Y0BB 1GFWB 4ZVOB 2DKOB 4LSZB 4DCOB 2HBQB 3R7NB 2FQQB 2H5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  1RHQ B;  1SC3 B;  2CJY B;  3GJT B;  2QLB B;  1PYO B;  1IBC B;  2H65 B;  3GJS B;  4ZVS B;  3RJM B;  3EDR B;  3P45 B;  3QNW B;  4ZVP B;  2HBZ B;  1RWO B;  3IBC B;  2XZT B;  2XZD B;  2QLJ B;  3GJQ B;  2H51 B;  2Y1L B;  1RE1 B;  3SIP B;  1RWX B;  4DCJ B;  1RWM B;  2CNN B;  3R6G B;  1NME B;  2H54 B;  3KJQ B;  3D6H B;  2C2Z B;  1BMQ B;  1RHK B;  1I51 B;  1RHR B;  1RWV B;  2C1E B;  4ZVT B;  3IBF B;  2C2O B;  2XYG B;  2QL7 B;  1RHU B;  2P2C B;  1RWN B;  1RWP B;  2HBR B;  1QDU B;  5K20 B;  2HBY B;  4JB8 B;  2CNL B;  3KJN B;  1QTN B;  3KJF B;  1SC4 B;  2C2K B;  2H4W B;  2H5J B;  1F9E B;  1SC1 B;  2CDR B;  4ZVR B;  2QLF B;  1RWK B;  1RHM B;  2C2M B;  2CNK B;  3EDQ B;  2XYP B;  3R7B B;  1PAU B;  1ICE B;  2H4Y B;  2QL5 B;  3R7S B;  3GJR B;  1RHJ B;  4ZVU B;  2H48 B;  1RWW B;  2QL9 B;  2CNO B;  4ZVQ B;  3R6L B;  3R5J B;  1I3O B;  4DCP B;  3D6F B;  5IC4 B;  3D6M B;  5IC6 B;  2XYH B;  3NS7 B;  3P4U B;  2Y0B B;  1GFW B;  4ZVO B;  2DKO B;  4LSZ B;  4DCO B;  2HBQ B;  3R7N B;  2FQQ B;  2H5I B; 
#chains in the Genus database with same CATH topology
 1W25 A;  5D3G B;  2YH0 A;  2D7S A;  3LUY A;  1QE1 B;  3UR3 C;  3Q8V A;  4DLG A;  2ADC A;  4K59 A;  1U25 A;  3RB4 A;  3EXY A;  2FVC A;  2QLJ B;  1OIA A;  2KFY A;  2IDL A;  1OJ4 A;  2VG6 B;  3IP0 A;  2RF2 A;  1TMJ A;  3LH2 S;  2DR5 A;  1TL3 B;  2R4F A;  2L48 A;  2MSS A;  5J2M B;  2GMH A;  1DLO A;  2PGC A;  4O3S A;  1RAB B;  3HFZ B;  1FDA A;  3V5R A;  1AUS L;  1MG7 A;  1NAQ A;  3DHW C;  1R27 B;  2RKI A;  2KXH A;  4DPY A;  2HVE A;  1BQX A;  1VRQ C;  1SUQ B;  3H20 A;  1V9O A;  2VPZ B;  4DSE A;  2DO4 A;  4RNO A;  4N8O A;  2HNZ A;  3CIZ A;  1KN6 A;  4O3R A;  1NZ8 A;  2YPY A;  1PAE X;  3NNH A;  2LFV A;  1JQG A;  2ROE A;  4CNZ A;  2W9B A;  2IM3 A;  3BN7 A;  2YQ0 A;  4I6A A;  1PIL A;  3RBD A;  4F3Q A;  5HBM B;  2DNH A;  2H5I B;  2DHS A;  5GMD A;  2WK4 A;  3N5B A;  3V6D A;  3PR5 B;  4W90 B;  1NHU A;  2K3I A;  3ULH A;  4DHV A;  1UPM B;  4PQU A;  4DR2 F;  4KGK A;  2WON B;  2C3O A;  2IRX A;  1T7P A;  4OZ0 A;  2YX1 A;  3KK3 A;  2HKE A;  4WU2 A;  5IV3 A;  2FHJ D;  3MHY A;  5C25 B;  1R0C B;  1HNV B;  4I69 A;  3PDN A;  2HS0 A;  3TJA A;  3MM7 A;  2XS7 A;  3PX6 A;  2E66 A;  1VJW A;  3QGG A;  5CYM B;  4ECX A;  3H2U B;  2LU2 A;  4WFX A;  3FJ2 A;  3OFG A;  4M63 A;  1X4F A;  3GLJ A;  1FCA A;  4AQY F;  4Q45 A;  2XMK A;  1Q95 G;  1CG2 A;  2JZ5 A;  4ZHR A;  4IO9 Q;  1T8E A;  1VQ5 S;  2VFU A;  4KY3 A;  3RB0 A;  3C46 A;  5KFP A;  2XEX A;  5GAD I;  4OX6 A;  1GMU A;  4P2M A;  2RS2 A;  1RT6 B;  3I9V 9;  3IM8 A;  1JNR B;  2J0X A;  2DGQ A;  5F41 A;  3MEK A;  4DL2 A;  1CJU A;  1DZ5 A;  4YP3 A;  2HAI A;  2F9J A;  2ZC4 A;  1LQ9 A;  5E3R A;  2ZNY A;  2CXE A;  3LO3 A;  3DRR A;  3K7R A;  4QJV A;  3TAP A;  1VC6 A;  3OVB A;  2VBW A;  2E1C A;  4DF4 A;  3DOL A;  1HL6 A;  2J6U A;  1UJ6 A;  2MQL A;  2GJ2 A;  2HUR A;  1VLO A;  3EDR B;  2FZG B;  2DIT A;  2M2B A;  3RAX A;  3TA0 A;  1S12 A;  1NHK L;  4J9V A;  2WAQ D;  1S1U B;  1IKV A;  4A8Q A;  1CC8 A;  2GO8 A;  1RHK B;  1S1W B;  2C2E A;  1UPP A;  2Q6B A;  1U6Z A;  4X64 J;  3M1V B;  3THT A;  4DWI A;  1TR0 A;  2HS4 A;  1VBK A;  5B0C A;  2YWE A;  2HFV A;  3D67 A;  2AT1 B;  2Q6C A;  2KT3 A;  2BDP A;  3TQ1 A;  4G1Q B;  4RLE A;  3CCT A;  1U7L A;  1E6V B;  5ETS A;  1BGX T;  2OAU A;  4MKB A;  4TU9 A;  1NK8 A;  2WVD A;  4HI2 A;  1O5J A;  2WSE C;  4WK1 A;  4NL5 A;  2UUT A;  2EBG A;  4FVC A;  2V2Z A;  1WF2 A;  4MIB A;  1F2G A;  1WEY A;  3G9C A;  1DTQ A;  5KTQ A;  1OY8 A;  2V6A A;  2MZQ A;  1YJW S;  2UUW A;  2BUN A;  1RWM B;  2LDI A;  4NAS A;  2ZZM A;  5KG7 A;  1FWK A;  2QX0 A;  3DLE A;  2M52 A;  3K5L A;  1GXU A;  2UXC J;  2HMI A;  5HLF A;  3BQ2 A;  1Q0N A;  4TQS A;  2ZBP A;  3TZY A;  1SC4 B;  1V3R A;  4K5S A;  1NBE B;  3OQ2 A;  2QYC A;  5KG2 A;  2FJV A;  2HQ3 A;  1LK5 A;  4OI3 A;  5ETP A;  3AFG A;  4OFZ A;  2JLF A;  1S9E A;  4IKA A;  2VOO A;  4ES3 A;  3A1Y G;  4LFB F;  5BR8 J;  3D1Q A;  4EU0 A;  1ZTW A;  4JI6 J;  1C1C B;  3T41 A;  3BS9 A;  2Y1J A;  1DY3 A;  3A8K A;  4KHM A;  2YH1 A;  2OIH A;  3DDK A;  3GJT B;  5KT7 A;  1OY9 A;  4ZCL A;  3MR3 A;  4ZVS B;  1GXL A;  2XCA A;  2DNZ A;  2W7P A;  4PAB A;  5E3P A;  4FKY A;  5THW A;  2W01 A;  4DR5 J;  4K4X A;  4K4V A;  1NJI T;  1RGV A;  2YQ1 A;  5DDR C;  5GME A;  1M5S A;  3MMA B;  3V4I A;  2B4P A;  3D0G E;  1NEE A;  1FK9 A;  3OPK A;  4FDF A;  3QFW A;  2QRR A;  2KH9 A;  3TEG A;  1FFW B;  3E3X A;  3TAQ A;  5DQH A;  3DRP B;  3PYE A;  3QYY A;  4RU2 A;  1RBO B;  2OPP B;  1S7H A;  4OHZ A;  1SL0 A;  3KDN A;  1QTM A;  2KHD A;  4F50 A;  5HK4 A;  3H0P A;  3MTK A;  4OYZ A;  3NG8 A;  4KFB B;  3NMR A;  3KYL A;  3MM5 B;  3R27 A;  1J5O A;  1AT1 B;  5D4L A;  4LSL B;  3JQJ A;  4I2P A;  1VK8 A;  1HR0 F;  2E29 A;  2DKO B;  4JUZ A;  3CJ2 A;  1NCL A;  1SI9 A;  2O66 A;  4ECS A;  3FMW A;  4NLU A;  3RB6 A;  3S8S A;  2EFO A;  1L3V A;  1V3S A;  2HBZ B;  2DRD A;  2VPW B;  3IBC B;  3CJK B;  2R2R A;  5J1P A;  3KMQ A;  5F8H A;  4RW4 B;  4A8K A;  1TU0 B;  3NGK A;  3FZ2 A;  3CJ3 A;  2I38 A;  4M8L A;  2OTL S;  2W24 A;  1R43 A;  1X4G A;  4RBU A;  2XLJ A;  4ZN1 A;  3I4P A;  3ENA A;  1CVJ A;  4HI1 A;  1YLX A;  3DLG A;  3CT9 A;  1EKS A;  3CB4 A;  3NL0 A;  4MYT A;  4DPW A;  4ECW A;  3KUE A;  3M8P A;  2DR7 A;  5E0O A;  5KOW A;  2UUB J;  2VIC A;  1B70 B;  4URG A;  1RWK B;  2M4M A;  2XNQ A;  4QPT A;  1JLA B;  2UP1 A;  5L1I A;  1ICE B;  3CDU A;  1S79 A;  5DG8 A;  3R7S B;  2VBY A;  4U7U D;  1RLD A;  1S0O A;  5L38 A;  4OI4 A;  4RKU C;  6FD1 A;  3LGM A;  2MKH A;  3A3N B;  5KFN A;  1Q82 T;  3FCV A;  4EZ6 A;  3BN4 A;  1N56 A;  3OSN A;  2PI4 A;  2CZ4 A;  5BYS A;  2A2C A;  3FRY A;  2E5L J;  2UUA J;  3LP2 B;  4CO2 A;  2AJ4 A;  2YX4 A;  2YWK A;  1VQ8 S;  1RUS A;  3SSQ A;  1T05 B;  3QLH A;  4ERD A;  3POT B;  2ZOF A;  4OHX A;  4LF1 A;  2B6A A;  1HMV B;  4HLB A;  1RT4 B;  4M95 A;  1KLM B;  1YKW A;  1TV6 B;  3CMQ A;  2OD4 A;  1S59 A;  2CPH A;  1LW2 B;  3R2D J;  3RBE A;  2KXF A;  1HWJ A;  3DMJ A;  3D6H B;  3K5P A;  2EXU A;  2LLZ A;  4X4O A;  2ZBQ A;  1S1X A;  2YTC A;  3MEC B;  4Q2L A;  1JLB B;  1H0H B;  1BE4 A;  3DXB A;  2ZE2 A;  4JV5 F;  1T03 B;  4CH0 S;  3H4B A;  5CQG A;  4R0E A;  2NXC A;  5KFK A;  2DVI A;  1UEK A;  4LFC F;  3P6Y C;  1YGY A;  1FJC A;  4JOU A;  1PBU A;  4FKX A;  3N9U C;  2B4V A;  2R7X A;  2QZ8 A;  4OLP A;  4C6A A;  1T94 A;  4QR1 A;  3OXG A;  2MJN A;  2IRY A;  3F73 A;  3M2V B;  5EX3 A;  5L1K A;  1U2R A;  2J8S A;  4KRW A;  2RQM A;  4ID5 A;  2HNY A;  3GG1 A;  1PCA A;  1XMB A;  4L3N A;  1AFJ A;  2LP4 A;  2YBV A;  2V9W A;  2PEB A;  2ZVI A;  2J0W A;  1U0H A;  1OMS A;  2UXD F;  4YB1 P;  4KGV B;  4OYI A;  3P49 B;  2YNF A;  4YB7 A;  3UI3 A;  3PY8 A;  5D0E A;  1WTB A;  4C8Z A;  2I9S A;  4J90 A;  2XGP A;  2PSZ A;  1VRU B;  5IS2 A;  3G86 A;  3R5C A;  1ZBT A;  3PG9 A;  1WHY A;  2N82 B;  3B82 A;  5F8N A;  1RWP B;  2P9G A;  2KVQ E;  5CHC B;  5B0A A;  2IBK A;  2MJU A;  2GO9 A;  3JSM B;  3MFH A;  2OHD A;  3KHH A;  2AX0 A;  4G6V B;  5CYJ A;  3HVT A;  3BGU A;  3UR0 A;  4C8M A;  3GMG A;  4F25 A;  2CA9 A;  1CUL A;  2FTR A;  3K89 A;  4TNO A;  3MGJ A;  4JI4 J;  1IKX A;  3KLV A;  5G0R B;  1FDD A;  3DI6 B;  3LW5 C;  3QAT A;  1Y5I B;  1JLG A;  2HRT A;  3QJL A;  2EG2 A;  4UOF A;  3MR5 A;  4P7V A;  1LNQ A;  3Q8U A;  4LRD A;  3P4U B;  4C8N A;  2W7O A;  4WKY A;  2DB1 A;  5A0Y A;  1TK5 A;  1RT7 A;  1XMO J;  4LF9 J;  3I32 A;  2RJZ A;  2GNK A;  2RUG A;  4EBE A;  2HGM A;  3LAM A;  4WWS A;  4JV1 A;  3E01 A;  4JI3 F;  5FD1 A;  1J2V A;  2BMB A;  3C66 A;  4DF8 A;  1ACM B;  2QGF B;  2RUS A;  3JTP A;  3W2W B;  1UJ5 A;  4L6V 3;  3K8V A;  3C8Y A;  4ZJO A;  4Y3C A;  5ETV A;  2DNG A;  2M7S A;  2C3P A;  2YKA A;  5KFM A;  3RG6 A;  1U02 A;  1S1T A;  4HH0 A;  4DR4 J;  2V0N A;  1WOP A;  3F44 A;  1RXO B;  4PPZ A;  3HZG A;  4OYW A;  4HTJ A;  2ZH9 A;  2ZIT A;  1M1K T;  5GAH I;  4JB8 B;  4QR2 A;  1LFP A;  3NBP B;  4DL0 C;  1IM6 A;  1T9V A;  3D0H E;  4MKV A;  2FGO A;  2HWI A;  4IRD A;  4DBQ A;  1NJW A;  3AXM A;  3NGU A;  4ZCK A;  2R7O A;  4DFP A;  4R8U B;  1SL2 A;  1T95 A;  3OTO J;  5L8R C;  4NOH A;  4RW8 B;  4CM2 A;  2M3D A;  1SPB P;  4LVO P;  3KFW X;  1C1B A;  3EMT A;  2AF6 A;  4I56 A;  5F3T A;  5HRO B;  4ECR A;  2R7Q A;  4N41 A;  1ELO A;  2Z2Z A;  4ZS6 A;  5JVG Q;  3UW1 A;  4J9N A;  2DH8 A;  3E51 A;  2GMJ A;  1SKU B;  4NI2 B;  1RTD B;  4CCH A;  3DC2 A;  1JJH A;  4TU8 A;  1RAH B;  3MEE B;  2B9W A;  1XNQ J;  3J7Z T;  2HQG A;  2DD8 S;  3I82 A;  4ZLP A;  2ROG A;  4YS2 A;  3T5J A;  4LR9 A;  4Y2K A;  1S48 A;  4ICL A;  3TW0 A;  4LR7 A;  4U8V A;  1WEX A;  3MTJ A;  3WQP A;  3UDC A;  3UE2 A;  3F41 A;  2IC3 A;  1HQE B;  5GVQ A;  2KN4 A;  3Q8R B;  1AZS B;  4ECY A;  3HHL B;  3DKD A;  5C24 A;  4P2X A;  1RAD B;  3BQ0 A;  3G82 B;  1V3Z A;  1JIH A;  1RYR A;  4USM A;  5DZ7 A;  1JLE A;  2CVE A;  2AW0 A;  4ZLL A;  1HQU B;  3HHD A;  4DUZ J;  4PXB A;  3UFC X;  2FY1 A;  1YZ7 A;  4KQZ A;  2YKM A;  4MIA A;  4ED0 A;  4A8F A;  5K5M A;  1X4C A;  4CLP A;  2Y8W A;  1VQL S;  3G8T A;  2J7U A;  1LXJ A;  5A8K B;  1EAR A;  1WEL A;  2JEF A;  4WPA A;  4H54 A;  2BZ2 A;  4K0K J;  4M5J A;  3BSO A;  4JV0 A;  2B56 A;  4CLK A;  1N5Y B;  4MK7 A;  1SQF A;  1K9M T;  1HNW J;  2PI5 A;  4ANE A;  1Q8B A;  4O4G B;  1PBA A;  4JI5 J;  3I0R A;  3KJN B;  5AJ3 J;  5D78 A;  2YXL A;  4DPO A;  3TUJ C;  2FD2 A;  3DOM A;  4KH0 B;  3ZTQ A;  4F02 A;  1VQ4 S;  1KKH A;  1IBL J;  4LVN P;  3SDE B;  4WFN Q;  4J9L A;  4B3M F;  4IH6 A;  3CD5 A;  4O3O A;  3S7R A;  4WU3 A;  4ZLN A;  2JX2 A;  4JP8 A;  2CQ0 A;  3VGT A;  2FPH X;  2VC1 A;  5AXK A;  4Y6I A;  3LAL A;  2YKP A;  2QLB B;  2G0J A;  4ECT A;  3IMQ J;  1Y10 A;  3JXO A;  2E5G A;  2VJV A;  3MAQ A;  1KFS A;  4NE9 C;  4K4S A;  3D2W A;  3PR4 A;  4HEA 9;  4NEZ A;  2HQI A;  5BYQ A;  1HPZ A;  1G1X A;  2Z56 B;  3IR5 B;  2V4J A;  1KBR A;  4F0M A;  1ZM9 A;  1N0U A;  3H5S A;  4ZCI A;  1I51 B;  1JXL A;  4V19 J;  3PFE A;  4IDK B;  2XLK A;  2MEW A;  2MQN A;  5B0G A;  1N33 F;  3LAK A;  1SJF A;  4BLG A;  1YI2 S;  5B0B A;  1RTJ B;  2H5E A;  4CNY A;  2XO6 A;  3HSJ A;  4NCG A;  1HBU B;  4GVL A;  1GK8 A;  3BGO P;  3BB5 A;  1IKY A;  4FS2 A;  4ES1 A;  4UTG A;  3RB3 A;  1ZM3 A;  3ELH A;  4DPU A;  2J76 E;  1OPI A;  4AND A;  2XLI A;  2BJ8 A;  4HVZ A;  3ICL A;  2EKY A;  1KHW A;  4J91 A;  4M5N A;  3SCI E;  4B9N A;  3NGD A;  1HD1 A;  3OFH A;  2CJX B;  4M5G A;  4DR2 J;  2YX7 A;  3OUY B;  1UZD A;  2VG7 B;  3CVK A;  3OVS A;  3AQP A;  3FSX A;  1TZ0 A;  5F8J A;  4F2S A;  4OZL A;  1F2H A;  4FYW B;  2RVJ A;  3OXL A;  3W63 A;  3HO1 A;  2VOP A;  1R6V A;  1WI8 A;  2RD5 C;  3U7J A;  3LTO A;  3CJ8 A;  4NLY A;  5HP1 B;  1RT2 B;  2R2T A;  3AD9 C;  1Y9O A;  3DRX A;  4OJG A;  1FWP A;  3V81 B;  2H4Y B;  4B3S F;  5K8P A;  4K4Y A;  2OPQ B;  2OPR A;  3T1Y F;  4NEY A;  3HSG A;  1XK8 A;  4R5P A;  3D6M B;  2E1M C;  4B17 A;  3CCQ S;  2BAN B;  3MR2 A;  2EK1 A;  2O5D A;  1WC3 A;  2W2O P;  3EGN A;  3D5M A;  2DYA A;  1RT5 A;  2BKP A;  4WE1 A;  1NB7 A;  2MKI A;  3R2C J;  1KFD A;  1RAG B;  1RT3 A;  4DUT A;  1HBO A;  4IO1 A;  2XSJ A;  4IG0 B;  2XZT B;  3M7V A;  3PM9 A;  2JFK A;  3FQL A;  1WNE A;  3EGV A;  1W7W A;  5G4D A;  1CQN A;  1C0T B;  1K47 A;  3A8E A;  2Q1L A;  3UCG A;  2ZEJ A;  2J9D A;  4RW7 A;  4CO0 A;  1QSY A;  4F4Y A;  3U02 A;  3GFX A;  3KK1 A;  1F1B B;  4ECQ A;  2Y0S D;  3C6U A;  4IOA Q;  3JB9 k;  2H4W B;  4DUY F;  4MK8 A;  3ILJ A;  3CCE S;  1SJQ A;  3IGN A;  2KFZ A;  1IM4 A;  3M8S A;  1U1Q A;  1F6T A;  3HJV A;  4TXS A;  3IG1 B;  4FBT A;  1N34 F;  4FYV B;  2YKQ A;  1LWE A;  2C3U A;  4DN0 A;  1MSW D;  3AJ2 A;  4RR5 A;  2KVI A;  4OZN A;  1BQM A;  4DCP B;  2VQF F;  4CYU A;  4BC7 A;  1QUV A;  1JLQ A;  2XCP A;  4FF4 A;  2EPI A;  4DFK A;  1AW0 A;  1V5I B;  3OFE A;  3NS5 A;  2KXN B;  2ALZ A;  2W25 A;  4J9P A;  1CJT A;  3QZ7 A;  4ID8 A;  2CRL A;  2Y1R I;  1APS A;  5DQI A;  3DM2 B;  4OYX A;  2XWY A;  1WAC A;  3QPI A;  2NUH A;  2ZBC A;  1L3K A;  1HHQ A;  2OEK A;  5RUB A;  2AJ0 A;  1RI7 A;  4F2R A;  1UMJ A;  2QLX A;  1VOM A;  2BQU A;  1X4E A;  2BW7 A;  2BW2 A;  3OJS A;  2X1B A;  2ZDO A;  4EWT A;  1D9F A;  3W65 A;  2HWH A;  4P10 A;  4QZV B;  1HWU A;  2GVD B;  4P74 A;  4Z7Y A;  4WFZ A;  2HGN A;  4X65 F;  2JSX A;  2JLG A;  3MM9 B;  1TVR A;  2EFG A;  4LFB J;  3U27 A;  4CO5 A;  2DH7 A;  3EPG A;  4ALZ A;  3P3D A;  1VBX A;  3IBW A;  3D6F B;  3IR6 B;  1AB8 A;  4PXC A;  2HHS A;  1TKZ B;  1FTC A;  3SQO P;  3CC4 S;  2ZZN A;  2ASL A;  4G65 A;  1X9W A;  3RJM B;  4I2Q B;  2Z2L A;  1D9D A;  1TL5 A;  3EVW A;  2XMM A;  4RBT A;  3TNV A;  2V8V A;  4F04 B;  3G71 S;  4A8O A;  5A8R B;  1JXV A;  2W2Q P;  2NPI A;  2ZWP A;  3G96 A;  4DQP A;  2VBZ A;  4MYU A;  1N5S A;  3QWU A;  3IS9 A;  3KNA A;  4X4V A;  2IJN A;  3CXC R;  2JNJ A;  4B9M A;  4ZA1 A;  2GGP A;  4X84 A;  1H3D A;  3GII A;  3OHB A;  2CNK B;  2IAJ B;  3GYG A;  5GMK a;  2FYX A;  1BD6 A;  3HI9 A;  1FE0 A;  2GAH C;  3HK2 A;  3PZP A;  4HR2 A;  3W60 A;  4I68 A;  4F4A A;  3PYF A;  1HR0 J;  2P9E A;  3WBZ A;  2DR9 A;  4PKD B;  1NJX A;  1U4B A;  3VAI A;  1WJ9 A;  5F8G A;  3M9O B;  3R5B A;  3EXC X;  2FVP A;  3DRY A;  3PHT A;  3CCM S;  1UFW A;  1DQA A;  3OL8 A;  2EKN A;  2AZ1 A;  4OJ1 A;  2ZUG A;  4I7F A;  3UD4 P;  2CJK A;  3DDN A;  4A8S A;  3UPF A;  4CLT A;  2BJ1 A;  1FDN A;  1RTH A;  1HBM B;  2MDA A;  3KK2 B;  2HHQ A;  4CLF A;  4KYZ A;  3VAF A;  5KT6 A;  3N28 A;  4EYI B;  1BWE A;  2UUC F;  4H4M B;  1VHF A;  3BSN A;  1UEV A;  2EWH A;  5LJ5 Y;  2H54 B;  1YJN S;  1L3S A;  2DNL A;  3AA8 A;  1JB0 C;  2DGO A;  3HHL C;  3A8J A;  2CAJ A;  3IN5 A;  3DRS A;  1FFG B;  3SCL E;  1Q8I A;  2CUY A;  2B3T B;  1P9Q C;  3BQ1 A;  3GV5 B;  1ZS6 A;  2OFG X;  3TZW A;  1XWL A;  3Q8S B;  4OYB A;  2XTJ P;  3OD2 A;  3PO5 A;  1J5E F;  1F3V A;  1TP7 A;  2VG5 B;  4PUO B;  3DLK A;  2ZH6 A;  2G2Z A;  2BYC A;  1NPK A;  4CI0 B;  5HVH A;  2HW3 A;  3KHL A;  4C11 A;  2GVZ B;  5J2P A;  1EQ0 A;  1SKR A;  1F9H A;  1R0A B;  5MAO A;  4IFY A;  1W2B R;  3BR9 A;  3S01 A;  1S57 A;  2E1A A;  1QLN A;  1YJV A;  2BV3 A;  1R31 A;  3KLI B;  3NWG A;  1NK9 A;  3W3S A;  1RP5 A;  1FKA F;  3NMA A;  3M32 A;  2ZHB A;  4NLD A;  3CF5 Q;  2EK6 A;  2DGV A;  1N32 F;  2FB0 A;  1UKU A;  4QIE A;  4C3M A;  4JI2 F;  4DR7 F;  3RR7 A;  1SV5 B;  2PD1 A;  4JV5 J;  4DN9 A;  2ZJP Q;  5CZV A;  5KFQ A;  1R8C A;  4OI1 A;  1LKZ A;  5T14 A;  2W7A A;  4RUC A;  4GO7 X;  2RNE A;  5KFO A;  3GZ7 A;  1CQM A;  3MFI A;  1Y3K A;  5ETN A;  1F9E B;  5D3G A;  3N6M A;  2KYZ A;  1MU2 A;  2BOA A;  3HHL D;  3KHG A;  3C2P A;  1LOU A;  2A3J A;  4UUW A;  1FJG F;  1S6O A;  2PMH A;  2DGU A;  1Y5L B;  2PMZ D;  2QL9 B;  1FA0 A;  2MKS A;  2BA9 A;  2V4R A;  3CDE A;  2HIY A;  1RAI B;  2BE2 B;  5I3Q A;  4UZB A;  1EZZ B;  1TL3 A;  3PKM A;  2HBQ B;  2ZOM A;  2UXD J;  2ZD1 A;  2DIV A;  3X1L B;  4DV4 F;  2B4U A;  5A6W A;  1G6B A;  3GYX B;  1FRH A;  1SKS A;  2ZDP A;  1UWB B;  2BJ7 A;  1SUQ A;  3MMB A;  2HZV A;  3OJU A;  1B0V A;  2X1G A;  1XTZ A;  4PWD A;  4FS1 A;  5J1E B;  4A47 A;  2MY8 A;  1FXR A;  2HK2 A;  1DHM A;  5HSP A;  3ZZR A;  3ZFV A;  4YQW A;  1U24 A;  4TQR A;  1PC5 A;  1I6J A;  5DO2 A;  1FVQ A;  3NWR A;  3AHP A;  4K7Q A;  1ZH5 A;  2DTJ A;  1X4A A;  2WSF C;  3RGI A;  3VHQ A;  4ZVU B;  1BQN B;  2WON A;  3HD1 A;  1NO8 A;  2R7S A;  1VDH A;  4NLG A;  1YRU A;  3EX7 B;  2XMW A;  4O3P A;  4XPC A;  1B99 A;  2W4P A;  1HFE L;  4DPT A;  2XC9 A;  2F63 A;  1HNV A;  3CIM A;  3QQC D;  2W2M P;  1EX8 A;  4DS5 A;  3J81 Y;  1VGY A;  2HRY A;  1TFW A;  3MMC B;  2LA4 A;  4OJ3 A;  3UN5 A;  2M8H A;  2A1B A;  2OD6 A;  1CEZ A;  1DTT B;  4YUD A;  3MMJ A;  2NUU G;  2YNH B;  1IWA A;  1RT6 A;  1RWV B;  1S1V B;  2DNP A;  2KM8 B;  4UY8 5;  1S99 A;  2MTL A;  1KON A;  1FRK A;  2XHW A;  1FXL A;  2V2Q A;  3CCJ S;  4ZVR B;  2QLF B;  3O44 A;  3M9N B;  1HWK A;  5KT5 A;  2YPZ A;  1VIX A;  4QIG A;  3TUP A;  3EJM A;  1U45 A;  2J0S D;  4FF2 A;  2A6M A;  1U6F A;  4HHJ A;  1LW0 B;  1UET A;  2MQP A;  2XY7 A;  4CRJ A;  2EFP A;  1S1W A;  1S6U A;  4ATN A;  2QC3 A;  3GIR A;  5T41 A;  3HVA A;  3M1V A;  2CQH A;  2GC8 A;  1O8B A;  4H4O A;  5IT0 A;  1NH8 A;  2AYG A;  2DY1 A;  3H5U A;  2CJY B;  2BR0 A;  2AGP A;  3I56 S;  3H42 A;  4ZPD A;  1MWQ A;  2CDQ A;  2YQ3 A;  4FXW A;  5IFM A;  1WC4 A;  4G1Q A;  1GH8 A;  3N4W A;  1X4D A;  1KQG B;  2NQP A;  1E6V A;  2RKI B;  1H2T Z;  4DR3 F;  2KO1 A;  3MI7 X;  4Q43 A;  3SZ2 A;  2OP5 A;  2POK A;  2Z2Y B;  2ZH5 A;  1LWX A;  4A8W A;  4PG8 A;  2XY5 A;  4UOC A;  2HNZ B;  2N4D A;  5KG3 A;  1RA6 A;  2ZH1 A;  1U48 A;  3SFG A;  2VKZ G;  4DMZ A;  1XN9 A;  1TQL A;  2W9B B;  2ZH8 A;  3NGS A;  2YNI A;  4DL7 A;  2HFS A;  1CJK A;  3CJQ A;  2ZOG A;  3CE8 A;  1JKH B;  2HHX A;  3KLH A;  2VZ9 A;  2KJW A;  3KDO A;  3BEG B;  3THV A;  2FDN A;  1KWM A;  1YQH A;  3UVJ B;  1JWW A;  4J5O A;  2V50 A;  3T5L A;  2NXN A;  2H1Y A;  2KB2 A;  5SZT A;  4L3K A;  2WW4 A;  2EFQ A;  4ZP6 A;  2YWF A;  3BZQ A;  1TL1 B;  2QSF A;  4USK A;  2M8D B;  2XI3 A;  3WDO A;  5DM6 Q;  4AXI A;  1B4S A;  3MM7 B;  2DO0 A;  2LQB A;  4JI7 F;  4WP3 A;  2MQM A;  4ED4 A;  1YDL A;  4PAA A;  2DBB A;  2OSQ A;  3KUG A;  3K2Y A;  3SYZ A;  2JRS A;  3OW2 R;  2WOM B;  3MEG B;  3CSK A;  2F7V A;  1QJH A;  3ZTS A;  3HJF A;  1WOO A;  1NUE A;  2MPU A;  4Z37 A;  1C1C A;  2UXB F;  4UOH A;  2JVR A;  4CIO A;  5C7P A;  2ZKT A;  1YRX A;  5IQQ A;  4B3M J;  2FJE B;  5CAA A;  2UV8 G;  2R8G A;  5HMW A;  1RQ0 A;  5K8M A;  3QO9 A;  3Q24 A;  2BOP A;  3M2R A;  3M30 B;  3AOD A;  4M1K A;  1Q8L A;  2IA0 A;  3FBC A;  1C4C A;  2C2R A;  2XI2 A;  4B9V A;  4DOZ A;  3AOB A;  4YFU A;  2XUL A;  4WBF A;  1EB0 A;  5JXS A;  2YWG A;  1JK9 B;  2MHN A;  2XBP A;  3RW7 A;  3CGI A;  2E5J A;  3PYD A;  1RWO B;  3PTW A;  4FNH A;  4P2F A;  1RAE B;  2H51 B;  2OPP A;  2BM1 A;  3G6X A;  5EDW A;  3KHR A;  5KFS A;  1S4E A;  1SL1 A;  1TKX B;  4O44 A;  3TR5 A;  2HFZ A;  1NME B;  1N33 J;  1NZA A;  2GIQ A;  3MM5 A;  4URS A;  3C3L A;  3QID A;  2MXY A;  4LSL A;  1EET A;  1XBW A;  4DX6 A;  3M8W A;  4AD6 A;  1GT8 A;  1YJ7 A;  4LUB A;  4G1P A;  4C97 A;  2MKY A;  2E5I A;  1R6Y A;  3KUH A;  1HHS A;  1XNR F;  5DDQ C;  3BBC A;  3MM6 B;  4IH5 A;  1TKT B;  1KHV A;  2E1P A;  1HNZ F;  1KD1 T;  4RW4 A;  3KWM A;  3GWC A;  4USU A;  1DTQ B;  3L7P A;  4DDF A;  2J6T A;  1M5H A;  2DH9 A;  5K9F A;  4U96 A;  5K8N A;  3D66 A;  3BPS P;  3JQM A;  4KBI A;  4BBY A;  2OFH X;  3DLE B;  1UW4 A;  4M5L A;  4ILR A;  2HMI B;  5KFD A;  3D1O A;  3A13 A;  4WFY A;  5E3C A;  1D9A A;  3OFF A;  4MKA A;  1JLA A;  1HI8 A;  1R7I A;  1GX6 A;  3CTR A;  1VQK S;  1RHR B;  3PEH A;  4J9Q A;  2RQK A;  3A4T A;  1HHT P;  4UT4 A;  1UTA A;  4OYP A;  3BJY A;  2RML A;  4KKO B;  4KGX B;  4KE5 A;  4B3S J;  3LP2 A;  1U1R A;  1FX4 A;  5DDP C;  1T05 A;  3T1Y J;  3POT A;  4WTO B;  3CPW R;  1HMV A;  4I4B A;  1UCN A;  4WZM A;  2LMI A;  1X0P A;  2AX1 A;  3L7U A;  1TV6 A;  3MR7 A;  3CCR S;  1CJV B;  2ABY A;  1VCT A;  4OX9 F;  3VAH A;  2VBX A;  4O3N A;  1U26 A;  1K73 T;  4EK2 A;  2FQQ B;  2V4Q A;  1S77 D;  2EC0 A;  3MEC A;  3BRE A;  1UVL A;  3BR8 A;  1JLB A;  3U1L A;  2ZHO A;  2KG0 A;  3I96 A;  2AP6 A;  4NXN F;  2M0G B;  1HLW A;  2I2Y A;  1U1P A;  4EBD A;  1U1L A;  3QT6 A;  3QJP A;  2JC1 A;  4RWX A;  2ERR A;  2D3U A;  2DPI A;  4QQB A;  2WHO A;  3D3C J;  1PC4 A;  1TMM A;  4FZV A;  6FDR A;  1DAR A;  2QG9 B;  4DUY J;  2OPS B;  5HAO A;  2JJ4 D;  2RU3 A;  3ET6 B;  3BGR B;  2N7Y A;  2G1D A;  4M5M A;  1O6X A;  1N34 J;  3J7Z 5;  1QUP A;  3PRD A;  4NXM F;  2O3D A;  3OTB A;  2B9E A;  3T3F A;  1HI0 P;  1PSD A;  2VQF J;  5M2R A;  3R5D A;  8ATC B;  1X0F A;  4C2M A;  4RNF A;  1X5S A;  2W2P P;  3R6L B;  1YSJ A;  3AQO A;  4CLL A;  1G3O A;  1VRU A;  2IYG A;  4Y2A A;  1FJ7 A;  3D7S B;  3FCH A;  3FRZ A;  4MTP A;  1IBC B;  3JSM A;  2D3O 1;  3EIC A;  2IYI A;  1N8R T;  1Q7Y T;  4ZVP B;  3DLG B;  2A0F B;  3C15 B;  1S0M A;  5AXM A;  4KPY A;  3M8P B;  3SIP B;  4QCL A;  2XHC A;  1R89 A;  5ETO A;  1GTE A;  5G0R A;  3DI6 A;  1NDL A;  1T0T V;  3V4M A;  4TY9 A;  4AL7 A;  3CD7 A;  3KG1 A;  3VCD A;  3L95 X;  3VAL A;  3Q86 A;  2O67 A;  4U95 A;  1RCO B;  1P6T A;  1B7Y B;  4Q8E A;  3GU0 A;  4UST A;  3HSD A;  3N6L A;  2YWW A;  2W4C A;  5HMX A;  2HS3 A;  5GAE U;  4ZPW R;  1ARO P;  3ZZY A;  3I6P A;  1FES A;  3W2W A;  1B3T A;  2DXE A;  1QY7 A;  2COL A;  3AJ1 A;  1SQE A;  4RW9 B;  4GKK F;  1HBN B;  1J27 A;  1X60 A;  3IGV A;  2PFF B;  7AT1 B;  4K4W A;  4M5H A;  4PZV A;  1WC6 A;  3DLJ A;  3CJ5 A;  2DXD A;  7FDR A;  1URR A;  3K17 A;  3DXS X;  4EGL A;  4YR2 A;  2AGO A;  1UVI A;  2HVZ A;  5HAN A;  2MB0 B;  2HHH J;  1AA1 B;  2GML A;  4DX5 A;  2RRA A;  5KFL A;  2W8K A;  4O23 A;  2X7I A;  5JJB A;  4C0H A;  5B0F A;  4ZN3 A;  4NYZ A;  4R8U A;  4RW8 A;  1KQK A;  2DIU A;  1RWN B;  4USJ C;  4FN5 A;  4H4K A;  2JEJ A;  5HRO A;  1YJU A;  5CCM A;  2E7V A;  2KRR A;  3CDB A;  2VFS A;  3CJS A;  4RX6 A;  5KFU A;  2HEK A;  3TVZ A;  4NI2 A;  3TP2 A;  1RTD A;  4C9D A;  2Q3P A;  4OV6 A;  4OYO A;  4OLO A;  1G7C B;  4NA2 A;  5LM7 E;  3MEE A;  1QAY A;  2ZM6 F;  4GO5 X;  3HHE A;  2I5J A;  3RRG A;  5F3Z A;  2QJ3 A;  3O1L A;  1FX2 A;  3QGP A;  2R2U A;  2I8E A;  2UUC J;  2P9C A;  3K5M A;  1HQE A;  3BO2 A;  2C2D A;  1ZA2 B;  3AY0 A;  3ZZU A;  4LFA F;  1VQO S;  1H98 A;  1JJ4 A;  3TA2 A;  3G82 A;  3SSR A;  5K14 A;  4L76 A;  3CC2 S;  1UWA A;  3JYT B;  2JEI A;  4Q8F A;  2IMO A;  1HQU A;  4E0D A;  3QRQ A;  3VVU A;  2KG1 A;  2WVE A;  1J5E J;  3J80 Y;  2LKZ A;  1JLG B;  2QYG A;  2B4O A;  1RTI B;  5HI7 A;  1QM9 A;  1OQ3 A;  1VMB A;  2BAC A;  4L74 A;  2RIJ A;  5KT2 A;  5A0Y B;  5A8K A;  1FKP B;  3PJ9 A;  5KG5 A;  4RNN A;  4LQ9 A;  1RT7 B;  4FYX B;  3PNI A;  4K2X A;  4CLS A;  2HLU A;  1RU1 A;  1H73 A;  3OR1 B;  2R8I A;  3F56 A;  3ITH A;  2DJW A;  4K4U A;  4LBI A;  2VF3 A;  3TYT A;  1U1O A;  1N5Y A;  3ZXW A;  3DGP B;  1UVK A;  1FI4 A;  3MED B;  4B3O B;  1RBL A;  4O4G A;  2L9N A;  1F0X A;  1WI6 A;  1VQM S;  2W9C B;  3WC0 A;  2ALY B;  4IQM A;  4Q0B B;  1M1G A;  3SSS A;  3IWX A;  1N32 J;  1YBU A;  3IAS 9;  1OO0 B;  5J2N B;  4NZ6 A;  2C22 A;  1PJ7 A;  1REG X;  4JI2 J;  2YNG B;  1A9N B;  1NSQ A;  3R1L A;  3Q2S C;  4ZP8 A;  4XDC A;  2MST A;  3I0S B;  2WTF A;  1V6H A;  4DV5 J;  2Z57 B;  1MWY A;  3N79 A;  4AYB D;  1NKC A;  3K0J A;  2MMY A;  1UA0 A;  3NCR A;  1T3O A;  1FJG J;  1NM2 A;  2KRB A;  1SXL A;  5AE3 A;  1WF1 A;  4CLW A;  1S49 A;  4O0I A;  5H1S V;  2OI2 A;  4FPI A;  3I5B A;  4FYY B;  5DDO C;  4E2F B;  4CP5 A;  1RBA A;  2MY7 A;  5C42 B;  4F67 A;  5A2Q Y;  2GIR A;  2MQ8 A;  5HQM A;  3R3T A;  4DV4 J;  4IDK A;  3DOK A;  3LWL A;  2UV8 A;  1E6Y B;  4QWD A;  3UO0 A;  1T9W A;  2VA3 A;  4DV7 F;  3D0I E;  4DU7 A;  2M88 A;  1U09 A;  4ES2 A;  3G4S S;  3GIK A;  3IWN C;  5MLC V;  2NPF A;  2CZV C;  3M05 A;  3AOA A;  1HBU A;  3BBB A;  3MM8 B;  1WHV A;  2HHT A;  1FRL A;  5KFH A;  2IJR A;  2FHO B;  2K3K A;  3G8Q A;  2W4D A;  1D1U A;  4U7C A;  2VJU A;  2AEF A;  5C24 B;  2RT3 A;  3R5A A;  3VGU A;  5KFX A;  5K20 B;  3MOZ A;  2KU7 A;  1TUW A;  1YBA A;  1X9S A;  5E33 A;  1WTF A;  4NPO A;  2H5J B;  1Y0H A;  5J1N A;  2IVY A;  4OHY A;  3OUY A;  2YKM B;  2VG7 A;  5KFT A;  3VQS A;  4P75 A;  3MCO A;  4UQT A;  1I5O B;  1RHJ B;  1B64 A;  4ED1 A;  5KFV A;  1N5Q A;  2OJ3 A;  4C8Y A;  2HWT A;  5A8W A;  2H9Z A;  4NLO A;  2CQ2 A;  2X3D A;  3J81 U;  2R7T A;  3OL7 A;  2PC6 A;  1Q53 A;  4KTQ A;  4B9L A;  2R7R A;  5CYQ B;  3I5A A;  4NZ7 A;  1IJE B;  3HUL A;  4BWJ A;  2JVO A;  1HWI A;  3Q22 A;  1RT2 A;  3VVT A;  2RHQ B;  1TAU A;  1KC8 T;  1WF0 A;  3ENV A;  2WB1 D;  4C98 A;  5H9F J;  3S6E A;  2OPQ A;  3VAK A;  1Q8K A;  1KVJ A;  2ZBR A;  3AD7 C;  4IR1 A;  2JFD A;  1VYA A;  1R3N A;  1WD6 A;  2VUG A;  4Z7C A;  4XO0 A;  3KLF B;  2WCX A;  2BAN A;  4RL1 A;  2BXJ A;  3QAE A;  5I3U A;  1H7X A;  2DNY A;  2NXE A;  1FNM A;  5KFB A;  3IRX A;  1H74 A;  3FZB A;  5DZ6 A;  2JEG A;  3H98 A;  4IG0 A;  4W98 A;  4DQI A;  2NXJ A;  1UZH A;  2D41 A;  1R8P A;  2GQ2 A;  4UY8 T;  3N0V A;  2XYH B;  4X4T A;  3CCU S;  2AQ4 A;  2HQD A;  3C6T B;  3AJD A;  1ITP A;  5IV4 A;  4NML A;  1RCX B;  1K1Q A;  3H2V E;  3JAM Y;  2H65 B;  4LF5 F;  4GRS A;  2LQ9 A;  4DR3 J;  1K0V A;  4QWE A;  2WW8 A;  4HTI A;  2VB6 A;  3CNQ P;  4B3R F;  4WP9 A;  3GG0 A;  1RWX B;  3X3U A;  3IG1 A;  4DQQ A;  3GSD A;  2ZH4 A;  3LP0 B;  1IWG A;  2QO3 A;  1URN A;  5M2P A;  3GFH A;  1S76 D;  2A6O A;  3W2V B;  5ETK A;  3TRG A;  4ZCM A;  1N6Q A;  3HX9 A;  4IQX A;  3L9Z A;  1FNO A;  2BQ3 A;  2D9O A;  4AXJ A;  2XM3 A;  4DFJ A;  5IM0 B;  5C5J A;  2XYP B;  3O5T B;  1CLF A;  3DFE A;  4LRA A;  2A10 A;  3HZE A;  4TU7 A;  1FWL A;  3PV8 A;  4XDD A;  2FLL A;  1A7G E;  4XK8 C;  2CWX A;  3K5O A;  4GC7 A;  2GVD A;  5CA5 A;  1Q1K A;  4OX8 A;  3ZO7 A;  2Y1L B;  2DRA A;  2G2Y A;  3FFI A;  1I94 J;  1SKW A;  1SC6 A;  1HYS B;  4M5D A;  1FXD A;  3MAA B;  4WKR A;  2UXB J;  3CD0 A;  2UUA F;  3SFU A;  2V34 A;  2CJ9 A;  5EWF A;  1REV B;  4LRB A;  1TKZ A;  4IUF A;  5AE1 A;  2O01 C;  2GIF A;  4A46 A;  2BBE A;  1NJZ A;  5J2Q A;  4ED2 A;  1JNZ B;  5KFF A;  3DYA B;  3PW4 A;  4PG4 A;  4I2Q A;  4UUX A;  2R7V A;  1RT5 B;  2JDJ A;  4TLR A;  4YN3 B;  4A8X A;  1XMQ F;  2AYB A;  2CJQ A;  2CPY A;  4QIV A;  1NSA A;  2GX8 A;  2IRU A;  1RT3 B;  1UFK A;  3SXL A;  1ROF A;  4ZKA A;  5IT4 A;  1HQ2 A;  5A8R A;  5IXU A;  1S6Q B;  4N56 A;  1IR1 A;  2H3E B;  2AZ3 A;  4HHH A;  4WYW A;  2CWK A;  3SCJ E;  1BY9 A;  3KK1 B;  4KO0 B;  1YIT S;  2IAJ A;  3C6U B;  2W9A A;  4AE5 A;  2CPF A;  1B0P A;  3LGH A;  2HND B;  4IOB A;  1FRI A;  2LXF A;  1ZM4 A;  2P6S A;  4W4M A;  2K1R B;  2KT5 A;  4KSE B;  1LWE B;  4FXV A;  3ILO A;  3B4D A;  4X66 F;  1XNR J;  4U8Y A;  1U1M A;  2C2K B;  4MH8 A;  1BQM B;  4WXW A;  2FLP A;  1HNZ J;  1GMW A;  1FEH A;  4ZIV A;  1HBM A;  2GZO A;  3KK2 A;  2VQE F;  3UNY A;  3TJ9 A;  1NRK A;  3HT0 A;  1X5O A;  3ETO A;  5KFE A;  4QWC A;  5GAH U;  4H4M A;  1S0V A;  3IWL A;  3G6V A;  2OML A;  2HG4 A;  3ONQ A;  3UDL A;  2CQG A;  1TTH B;  1UW9 A;  3EGW B;  3MZI A;  4MIW A;  5I42 A;  2DR8 A;  4R0J A;  2B7B B;  1CS4 A;  3MCM A;  1S9G B;  1RAC B;  4RNH A;  1TK0 A;  4LBP A;  3TEH B;  3PHE A;  1C0U B;  3GR1 A;  4KV8 B;  3GP9 A;  5BYR A;  4C0O C;  3TUI C;  3VV2 B;  1KTQ A;  4PUO A;  5IWA F;  2D74 B;  3NRB A;  4CWB A;  4P6Q A;  2KKH A;  1XJW B;  1OYD A;  3OHA A;  2MQQ A;  4DSI A;  3JSR A;  4LT6 A;  2GVZ A;  1VC0 A;  1OS5 A;  1LWF A;  4KGZ B;  5EN1 A;  4DLE A;  1R0A A;  1KVI A;  1RAA B;  2CIM A;  2GS8 A;  1IKW B;  4P7T A;  1X4B A;  1NKE A;  2HHP A;  4C8K A;  1RJJ A;  3KLI A;  3RAM A;  5CH7 B;  2WVF A;  4OX9 J;  3QAU A;  4QBU A;  2GHP A;  2E5H A;  3M2U B;  5AXN A;  3V6J A;  5B0E A;  3HCX A;  4HL9 A;  5KG4 A;  4JI8 F;  3FBB A;  5D4P A;  2LQJ A;  2IIH A;  3R5J B;  5IC4 B;  1Q4R A;  1SV5 A;  2B5J B;  1GFW B;  4LSZ B;  4NXN J;  2J6S A;  1MML A;  3MD3 A;  2HK3 A;  1P1L A;  3BKF A;  2Z58 B;  2DGX A;  2F40 A;  4MFB A;  2FC8 A;  4B08 A;  2XNR A;  3ZC4 A;  1RA7 A;  1VFJ A;  5DLF A;  4DQS A;  1RT1 B;  3E8O A;  4Q2M A;  3GFZ A;  5EGY A;  5F0W A;  2FJD B;  1N54 B;  2C3Y A;  4F7V A;  2QMW A;  4PCQ A;  1F3F A;  2XYG B;  4JBC A;  4CLZ A;  1FRX A;  2CPX A;  3L7O A;  3FBE A;  1JLF B;  2AEM A;  2QMU B;  2F1F A;  3CJR A;  4WP8 A;  3PIO Q;  1D3W A;  4OZ5 A;  2CDR B;  1TUV A;  1PG5 B;  2KT2 A;  3ETM A;  3PIP Q;  4QU7 A;  3PRB A;  3HVR A;  4RBV A;  1ZAW A;  5AXL A;  3VGV A;  4F3M A;  1A0O B;  4I7F B;  3W7B A;  4ED8 A;  4PG6 A;  4OYM A;  1FE4 A;  1RTH B;  2BE7 D;  2FIU A;  3IAM 9;  4LF6 F;  3TX0 A;  4JYA F;  3FCW A;  1S6P A;  2L9D A;  1RKJ A;  2I1R A;  3L4B C;  1M90 T;  1KR4 A;  5B08 A;  1SBR A;  3IFE A;  2HRU A;  1Z1Z A;  2N7C A;  1BWV A;  1Y5N B;  3P45 B;  3TQE A;  1RYS A;  4DR6 F;  3S1T A;  4ED3 A;  3TAM B;  2DGW A;  2WVC A;  8AT1 B;  1O51 A;  2ZKU A;  4EFA C;  4QYZ J;  3C19 A;  5LOQ A;  1GNK A;  1BQN A;  4UQG A;  5KAK A;  3EGZ A;  4FP9 A;  5L46 A;  4YY3 F;  3SQG B;  3RRH A;  4K8R A;  5FDL A;  2U2F A;  3M8R A;  4LQ3 A;  1F9F A;  4K4Z A;  4XAK A;  5HMZ A;  2B7C B;  5J2P B;  1SC1 B;  5B0D A;  1HNX F;  1WOR A;  3C16 B;  4L72 B;  2AJF E;  2WRM A;  4JV2 A;  2ASY A;  4ZIT A;  3TI0 A;  1X31 C;  1VQY A;  3PJW A;  4DFM A;  3MMC A;  4GKK J;  3PW0 A;  1DQ9 A;  3AB4 B;  4X4N A;  2V8H A;  3MUR P;  2HFN A;  4LR8 A;  2DGS A;  2XY6 A;  2YNH A;  1W26 A;  3VTI A;  1S1V A;  3TJ8 A;  4ZDN A;  1U0S A;  2PN6 A;  2RAQ A;  5LXY A;  4KHP F;  1EQM A;  3CO9 A;  3TA1 A;  4AUK A;  2NSC A;  4EO6 A;  1VR6 A;  1D8Z A;  1WEZ A;  2FVS A;  9RUB A;  3B78 A;  4FYD A;  1YBT A;  2NLW A;  2QIF A;  4NRT A;  5E3A A;  2CZ9 A;  4ANC A;  2EC2 A;  4AFF A;  3K5N A;  1MU2 B;  2BAB A;  2NYH A;  3L09 A;  2RRB A;  4YDX A;  1U1N A;  3W64 A;  1LW0 A;  2LEP A;  3H25 A;  3GIJ A;  4KIA A;  2YVS A;  1R0B G;  2JLE A;  2D1C A;  1KQF B;  1EHW A;  3TUZ C;  3CD6 S;  5HJY A;  5CXT A;  4RZR A;  3EPI A;  4O0N A;  5GAE I;  4PR6 A;  4CH1 A;  2VDI A;  2HHV A;  3MWB A;  3UD3 P;  2FHJ A;  2ZM6 J;  2ZD1 B;  3VAM A;  9ATC B;  2QA4 S;  3PKY A;  3JTN A;  3FEZ A;  3PAC A;  5KFI A;  3MPD A;  3U1N A;  1FKO A;  1I3O B;  5E5N A;  2YY3 A;  3MMB B;  3I4H X;  1VBY A;  4P72 A;  1TKD A;  5DG9 A;  2DEJ A;  5F0U A;  2V8D A;  4PWD B;  4LFA J;  4Y0F A;  1XQI A;  3FGV A;  3TAR A;  5GAG U;  1I1G A;  3UNG C;  3DLH A;  2CJA A;  3T9N A;  5K8O A;  1T11 A;  1JKH A;  1WUU A;  1VJQ A;  4P2S A;  3DNC A;  1IVZ A;  4KJI A;  1UFL A;  2C2Z B;  4IG3 A;  3RR8 A;  1RWU A;  3I55 S;  2EI5 A;  3J80 U;  2AJQ A;  2FHM A;  1WDD A;  3PFO A;  3SMZ A;  1U49 A;  3NAH A;  1OWX A;  2BEF A;  3QMQ A;  3UVJ A;  1FHT A;  1KLN A;  3ILL A;  2XGQ A;  1WWH A;  4YB5 A;  3MOJ B;  2XB2 D;  4TY8 B;  3LWM A;  2Y3Y A;  4K5R A;  4TLQ A;  1IQT A;  1TL1 A;  3BKU A;  3OXF A;  4N5S A;  2PDA A;  3I87 A;  4X62 F;  5ETM A;  3HT3 A;  1LEO A;  3HLU A;  2E1R A;  4MMO A;  4I67 A;  3BYR A;  2WOM A;  3H5Y A;  3MEG A;  3H40 A;  4NRU A;  1BUX A;  1NKB A;  1YHQ S;  3M8Q A;  4USW A;  2EG1 A;  4ZMM A;  3Q23 A;  3UCU P;  3ZNJ 1;  2AWZ A;  1N36 F;  3MPU B;  4C3L A;  2DT9 A;  2HAF A;  1Y4Z B;  5DET A;  1DFD A;  1KVK A;  4AQY J;  2YKN B;  4WZQ A;  1OPZ A;  4LRE A;  1GXT A;  1HAR A;  3FKB A;  1NDC A;  3BKT A;  4HAC B;  2LXU A;  2IM0 A;  3M30 A;  3JSY A;  3W66 A;  1KOO A;  2KTQ A;  4RW6 A;  4YHH F;  1GEH A;  2R2S A;  5KT3 A;  3RBZ A;  2XO7 A;  1RAO A;  4H4O B;  4TKT A;  2V67 A;  5EWG A;  3P96 A;  1VQS A;  2VA2 A;  2NZ4 A;  2MZR A;  5A2Q U;  1W2I A;  4RUB A;  3EVO A;  3KOA A;  2VH7 A;  1TKX A;  2J7K A;  3TOQ A;  3BM7 A;  3KLG A;  1PO6 A;  4DV7 J;  1UA1 A;  1NXI A;  5LL6 d;  3THP A;  4DCO B;  4DV2 F;  5U47 A;  4E8U A;  3EWG A;  3DLL Q;  1SC3 B;  4C8L A;  3UDE A;  4DV3 F;  1ZZF A;  4RJV A;  4ZVG A;  2IHR 1;  3DHX A;  5HO4 A;  2VON A;  1ZPV A;  1NND A;  3ADA C;  2Z30 B;  1WKK A;  2UVU A;  2E9T A;  2ATL A;  3ENQ A;  3JS9 A;  3MM6 A;  2RQC A;  1TKT A;  3LP1 B;  3KKF A;  2YNI B;  4F8R A;  1YIJ S;  2EW9 A;  1CJK B;  3NY0 A;  3KLH B;  4D3G A;  1QDU B;  2CQC A;  1EP4 B;  2L9W A;  3OR2 B;  2VFT A;  2F4V F;  2FHK A;  1IBM F;  4U67 Q;  5H9F K;  3PO4 A;  2IVM A;  1LFW A;  4O3Q A;  2Y1I A;  3BYP A;  2Y8Y A;  4OHW A;  3KTQ A;  1NDK A;  4HT7 A;  4P52 A;  4IH7 A;  4MAK A;  2CYY A;  4HDG A;  2D3Z A;  4DXL A;  3MCN A;  5CD4 H;  2B9Y A;  4CO1 A;  3FSY A;  3R97 A;  4CTA B;  3HF5 A;  4CO3 A;  2K7J A;  1UP1 A;  4B9T A;  3A12 A;  3HDS A;  2PII A;  2ATC B;  3FK4 A;  1VQ9 S;  1PJ5 A;  2EBE A;  4HT5 A;  4KKO A;  1NU4 A;  2QA2 A;  2R8J A;  5ETT A;  3VR1 A;  2NR0 A;  3G6Y A;  4DJB A;  2RIL A;  2DHH A;  4F0K A;  1CJV A;  2ZC3 A;  4J37 A;  4G3I A;  3Q83 A;  4DSF A;  3MPY A;  3SEO A;  3TVY A;  1D8Y A;  3QJJ A;  2HYI B;  2CNL B;  4AT1 B;  3QO9 B;  4QIF A;  4ETX A;  2K8G A;  3M2R B;  1FEE A;  2OTJ S;  3NLC A;  3MXH P;  3VZH A;  1H7W A;  3D9B A;  5L1J A;  4GVB A;  2ADB A;  2G0C A;  5KFC A;  2NYI A;  2X1F A;  2QEX S;  3QBC A;  4PRF A;  2WZ1 A;  3ISZ A;  1DBD A;  5KG0 A;  3QGI A;  4M5I A;  3BSA A;  3O3L A;  4NZ0 A;  4LF5 J;  3R9L A;  1ZPW X;  3NEK A;  3JAM U;  4O44 B;  2OPS A;  3K59 A;  1JJ2 R;  3ET6 A;  4IFV B;  4B3R J;  3BGR A;  1FF2 A;  3U1M A;  1EET B;  2OH2 A;  2MKJ A;  1JLC A;  3KMS A;  1DJ0 A;  2IY5 B;  5KFZ A;  3N5F A;  1S0N A;  3QRR A;  2C3M A;  1VRT A;  2PO4 A;  4UZC A;  5T7L A;  1QVG R;  3TZX A;  1M1H A;  3MAH A;  4DL5 A;  1MMN A;  1P9Y A;  5B09 A;  3OBI A;  5LMN F;  3T5K A;  1SJ1 A;  1HWL A;  1H38 A;  3T19 A;  3OT9 A;  3LQV A;  2ZH2 A;  3DDI A;  3WC2 A;  4KC5 A;  4D3H A;  3ZZ0 A;  3D4J A;  2CQ3 A;  4OJH A;  3C15 A;  2MGZ A;  2B8P A;  5ETQ A;  3GQC A;  2CQD A;  4N77 A;  4HYK A;  2FY8 A;  2DGT A;  2F8M A;  1H2V Z;  1CPZ A;  1MMD A;  1LXN A;  3H8Y A;  2RB7 A;  3DU5 A;  2B8Q A;  3DLB A;  3FC9 A;  5FLX U;  4ZOS A;  2BKN A;  4WYL A;  1L3T A;  1HW8 A;  4ZIW A;  3Q0A A;  4ECZ A;  2HSE B;  3NOC A;  4C7Q A;  1N48 A;  1Q79 A;  1TL7 A;  2IFX A;  3IA0 A;  3CED A;  1MRO B;  2CG8 A;  2XSF A;  1KSP A;  5IT9 U;  1D0E A;  1B0T A;  4OMF G;  1QAI A;  1LWC B;  1RAF B;  2C2O B;  2GFF A;  2PE8 A;  1O0P A;  3CJ4 A;  4RW9 A;  4BWM A;  1HBN A;  1Q78 A;  3O8W A;  3CJT A;  3B8H A;  3DGV A;  1FNX H;  1VK3 A;  1XMQ J;  4EUV A;  5KOX A;  1CSJ A;  2AJ2 A;  3D3B J;  4FNI A;  1B7F A;  5HVF A;  3JQK A;  3QIP B;  3QSI A;  3BGL A;  2KL8 A;  3GJR B;  1YG0 A;  5L9X A;  3PEJ A;  4DG1 B;  3RBX A;  3V2U C;  2CKW A;  2MLX A;  2QE5 A;  1X5T A;  1WG1 A;  4PWW A;  3BV8 A;  3R1H A;  2FGC A;  2FUG 9;  1RSC A;  4J9U E;  4B3T F;  3UWT A;  4ED6 A;  3GCW P;  3ISN C;  2LCW A;  4P9S A;  4JI1 F;  2UZA A;  2XMA A;  4ECU A;  2ZJR Q;  3N01 A;  5KFG A;  4J7C A;  1QAX A;  2XMV A;  4USV A;  5DRK A;  2CPI A;  2L41 A;  2IJF A;  4LFC J;  2QSW A;  2QA1 A;  1RTZ A;  2NCK L;  5EUH A;  5D4O A;  4F4W A;  3KJV B;  3UQS A;  2EFV A;  3NGR A;  1ZA1 B;  2DXF A;  3KJQ B;  4ELU A;  1TEL A;  4NLV A;  1C2P A;  1QE1 A;  4X66 J;  2CQP A;  3R5G A;  3G6E S;  2DCL A;  4J9M A;  2X3G A;  2VQE J;  4B9S A;  2VG6 A;  3KG0 A;  2Z0G A;  1YX2 A;  2C28 A;  4Q5V A;  4F0H A;  4YEA A;  4F3O A;  5J2M A;  2OO4 A;  2G1H A;  2I6W A;  5DJB A;  1NPP A;  3IRW P;  4FBU A;  4DV6 F;  4AL6 A;  2EFN A;  2AV5 A;  1MN7 A;  2FVR A;  4RUA A;  5F8M A;  3RW6 A;  3JYT A;  1GAO A;  3M8Y A;  3VGS A;  5KFW A;  2K2P A;  3LPE A;  5IOL A;  1G2E A;  1IXK A;  3HKZ D;  2UU9 F;  3RU0 A;  4ZPT R;  4N8N A;  1RTI A;  5IWA J;  4NWB A;  1IBK F;  3KLE B;  3ISN D;  2CPZ A;  2RRN A;  2KZZ A;  2MLY A;  1FKP A;  4DL4 A;  4OI0 A;  1LV5 A;  2R9L A;  5HBM A;  4HDH A;  4PEO A;  2P6T A;  1T9U A;  1NH7 A;  3C14 B;  3OR1 A;  3HVW A;  5LSO A;  4DL6 A;  1MN9 A;  4G1I A;  1SH0 A;  1HNI B;  2N4C A;  4DL3 A;  3IBF B;  3HPO A;  2B9X A;  3DGP A;  3BSC A;  3MED A;  1YJT A;  4B3O A;  2HVH A;  3FNN A;  5E41 A;  2W9C A;  4Q0B A;  4JI8 J;  1BHN A;  4JI3 J;  2MZS A;  3P8B B;  5J2N A;  5C25 A;  2DPJ A;  1ZAX A;  2CQ4 A;  1VS3 A;  2YNG A;  4Y34 A;  3AOC A;  3GYN A;  4LF7 F;  1VC5 A;  5CYM A;  4ZVQ B;  4USI A;  4URQ U;  5C2G A;  4JI0 F;  1X9M A;  2D9P A;  3I0S A;  2W2N P;  4X4P A;  2WSC C;  2KDO A;  1T3N A;  1HD0 A;  4BS2 A;  2DNO A;  5I4M A;  4ECV A;  2PA8 D;  4NLP A;  1K8A T;  4LSN B;  2V8G A;  1N5T A;  2IPO B;  3EYZ A;  3J81 j;  2LXI A;  3NOG A;  2F3J A;  5KFA A;  2HFU A;  3BPD A;  1S7I A;  5JMN A;  1GQE A;  5LSL A;  4WK3 A;  5C42 A;  2J9E A;  4RU9 A;  3EZ5 A;  2BJE A;  2EEY A;  3ZZZ A;  4XIU A;  4IR9 A;  2PEH A;  1E6Y A;  4QOT A;  1N52 B;  1S1U A;  4F4X A;  3UN3 A;  4F4Z A;  3UDV A;  1U2F A;  4L73 A;  4ZJQ A;  4QYZ K;  2I5J B;  5IZH A;  4LF6 J;  2FC9 A;  5LJ3 Y;  4UF4 A;  3W8G A;  2RF2 B;  3ZTR A;  3MM8 A;  4JYA J;  1RWW B;  3ZNU A;  2K06 A;  4F36 A;  4LF2 A;  1DLO B;  2J9D E;  1M0S A;  5HQ8 A;  3O6Q A;  4ZP7 A;  5KT4 A;  3ENW A;  3GB0 A;  2JWN A;  3GE9 A;  1P8G A;  1U8S A;  4YOE A;  2GQC A;  5K14 B;  2W8L A;  4PYA A;  4DR6 J;  2DIS A;  3J7Y U;  4ILM A;  5CD4 A;  5ETR A;  2J0Q D;  2DNK A;  1FVS A;  1UVN A;  1EIY B;  1YRT A;  3HHK A;  5LSR A;  4V19 X;  4YY3 J;  2FJB B;  2V69 A;  4B9U A;  3EUN A;  2G0I A;  4KGM A;  2HZC A;  1VLY A;  1WC0 A;  3TVK A;  4RO0 A;  1HNX J;  1RAJ A;  4A8M P;  3ITH B;  3QSY B;  2RS8 A;  5L1L A;  1EKR A;  3V6D B;  2JHE A;  3GCX P;  5CYQ A;  1WHW A;  3LGN A;  4PQU B;  5JUM A;  4A48 A;  3EDQ B;  2ZFH A;  4OZ2 A;  4J9O A;  3KK3 B;  1T02 A;  1BLU A;  1MW7 A;  1ZAV A;  4KHP J;  2FLO A;  4NLQ A;  5ETL A;  3KLF A;  1ZOT A;  3OL6 A;  4KPC A;  1XR6 A;  3FSI A;  3VF0 B;  5KFJ A;  2RDI A;  2E9R X;  1JMT A;  1DQ8 A;  2DCU B;  3WIV A;  3W9J A;  3GJS B;  2BQR A;  4ZHR B;  2ZZT A;  1QSL A;  2MKK A;  4LF8 F;  3H5X A;  1IJF B;  3TZZ A;  2MKC A;  5HVG A;  1UAW A;  1U1K A;  4BHQ A;  3E2E A;  1CJU B;  5LMU F;  5HN0 A;  3NCP A;  3L3C A;  3UCZ P;  2Q43 A;  3DRR B;  3Q8Q B;  4WXO A;  2OKQ A;  4J9R A;  2KI2 A;  2ASD A;  2VL1 A;  3C6T A;  3DOL B;  1WOS A;  3QT5 A;  4DSK A;  4J9K A;  2VFV A;  4ZVF A;  3MMA A;  5DGA A;  3RZA A;  2AD9 A;  1GX5 A;  3DOK B;  2VPX B;  4ZK7 M;  2V2K A;  2A18 A;  1EJ7 L;  1KQS R;  1IKV B;  1MWZ A;  4ILL A;  4TN2 A;  3AA9 A;  3HHN B;  3HSZ A;  1H6K X;  3LP0 A;  3EZU A;  3DRP A;  1Y11 A;  2FJX A;  3D68 A;  2VAS A;  3W2V A;  1S72 S;  2GA7 A;  4X4U A;  1UVM A;  5KG1 A;  5LT5 A;  3CCZ A;  2DNM A;  4Q44 A;  1M5K C;  3R8Y A;  4MK9 A;  2AHO B;  4Y65 A;  1VIO A;  3H4D A;  1XR7 A;  4KFB A;  1NDP A;  3B4M A;  5M2U A;  3FEY B;  1VQ7 S;  5IM0 A;  5DG7 A;  4DEZ A;  3AB2 B;  3RAQ A;  3Q89 A;  5L39 A;  4EMD A;  2GJI A;  5H9E J;  4CM0 A;  2XQC A;  1SB6 A;  4OZ1 A;  1A6L A;  3MCS A;  4ZPA A;  4K50 A;  1JX4 A;  4OI2 A;  1RHU B;  4L75 A;  3CJK A;  2AJ1 A;  2QV6 A;  1N88 A;  2DR6 A;  5A8W B;  4X62 J;  4QU6 A;  2Z4P A;  2E44 A;  4GKJ F;  2XMU A;  4KR0 B;  2JOQ A;  3F0N A;  3PW7 A;  1U6B A;  1KRP A;  4YDD B;  2J5A A;  2LYV A;  1HYS A;  4OZ3 A;  4WTY A;  2MYF A;  5HLF B;  3IR7 B;  3MAA A;  1VHI A;  4LJM A;  1N36 J;  3NNA A;  1SJ3 P;  1REV A;  5GAG I;  3LF0 A;  1PYO B;  1JJC B;  4DPX A;  1KOH A;  5HMY A;  2R42 A;  3CCS S;  2R8K A;  3DYA A;  1S9E B;  3BH7 B;  8RUC A;  3T1H F;  4ELT A;  5I3U B;  2VDH A;  2D3O R;  2ILZ A;  4OV1 A;  3IRX B;  5F8L A;  4I6Y A;  3JTO A;  2FJW A;  4YHH J;  3HD2 A;  3B6B A;  3P5T L;  4PYD A;  2NRE A;  1RT4 A;  1KLM A;  2NSB A;  2GAG C;  2LQ8 A;  1S6Q A;  2DNQ A;  1LW2 A;  2GCF A;  1SH2 A;  4UOG A;  1U47 A;  2FJA B;  1R8H A;  2XS2 A;  2M70 A;  1Q16 B;  2V9K A;  5EX0 A;  5AE2 A;  3BO3 A;  1PAU B;  3TX8 A;  4LBH A;  1DRZ A;  2L3M A;  1X5P A;  2BVZ A;  2LQ5 A;  4P71 A;  2XS5 A;  4N7T A;  4KO0 A;  3V4I B;  4USH A;  4DSJ A;  4DV2 J;  2JL9 A;  3FBF A;  1T03 A;  2HND A;  1FK9 B;  3GFY A;  2G2O A;  4DV3 J;  1V5V A;  3FDS A;  3PX4 A;  3NNC A;  2HLT A;  3R7N B;  2K1R A;  1NK0 A;  2V63 A;  4NA3 A;  4I6W A;  4ED7 A;  1Q5V A;  1HA1 A;  3K58 A;  2RSQ A;  3M2V A;  3VAG A;  4DV1 F;  3NP5 A;  3NKY A;  1N6Q B;  2DNR A;  3OVA A;  3K8W A;  2ZUA A;  1FRM A;  1UEU A;  1RLC L;  1J5O B;  4RWW A;  2AIR B;  3R6G B;  3HKW A;  2MQO A;  1BMQ B;  4I2P B;  4HHU A;  3EE3 A;  2OMO A;  2F4V J;  2Z2M A;  4PG7 A;  4X4R A;  3T6B A;  3WX8 A;  1IBM J;  2ZH3 A;  2E7X A;  4EZ9 A;  2HBR B;  3ZZT A;  4E98 A;  1Z2L A;  4QPX A;  2RH3 A;  3PYG A;  3VZI A;  2E7W A;  1S9G A;  2X51 A;  2RQ4 A;  2HIQ A;  4LF4 F;  2HQC A;  1C0U A;  1OSC A;  3BH6 B;  4KV8 A;  3RRK A;  1OY6 A;  3TWZ A;  3LOU A;  1AXQ A;  2OUG A;  2C42 A;  3G8S A;  3FFI B;  4I1T A;  2F8E X;  2WBM A;  1IKW A;  4M5D B;  4NCB A;  1IR2 A;  4LMZ A;  3AH6 A;  4NLW A;  4ETZ A;  4ZJL A;  1L3U A;  3QNW B;  1PJ6 A;  2CQB A;  1FD8 A;  2V68 A;  4X65 J;  1HIY A;  1IUJ A;  1WC5 A;  3M2U A;  2ACY A;  1U2C A;  5J2Q B;  2HGL A;  4ER8 A;  2K7K A;  1XEZ A;  2C1E B;  3W62 A;  4ED5 A;  4CLY A;  3NCQ A;  3V6K A;  3PXG a;  5HL7 Q;  2B5J A;  4DV0 F;  3QLH B;  3GR0 A;  2DHX A;  2B6A B;  1MLA A;  1WHX A;  1KDN A;  2HHH F;  3FMB A;  2OEJ A;  1QSS A;  3GPA A;  4K4T A;  4DR1 F;  3BO4 A;  1SCJ B;  4EI2 A;  3UD5 A;  3DMJ B;  2KYX A;  3T6J A;  4K2J A;  3SCK E;  3OV7 A;  2V5H G;  1RT1 A;  1S1X B;  1KEK A;  3NBP A;  4OQJ A;  1RK8 A;  1WC1 A;  4N47 A;  2AKW B;  4ZVO B;  2HQF A;  5A76 A;  4H4K C;  4NCA A;  2ZE2 B;  2YWH A;  4DQR A;  4YB6 A;  1JLF A;  4XPE A;  1X4H A;  4QWB A;  1K1S A;  2JC0 A;  2KJV A;  1YJ9 S;  1K0T A;  1JXE A;  3LAN A;  4LRF A;  2XG8 A;  1QAJ A;  2OEM A;  3W8P A;  3OSP A;  1SJR A;  5LMN J;  3SV4 A;  2IM1 A;  1YK9 A;  3PX0 A;  1Q81 T;  5DM7 Q;  5FII A;  4ID5 B;  1XER A;  4ZVE A;  2HNY B;  3KJF B;  3V6H A;  1IR0 A;  2V2V A;  1P27 B;  5F9N A;  1U0H B;  4OX7 A;  5EWE A;  1F60 B;  4FXD A;  5DGB A;  2YNF B;  2VIH A;  2QL5 B;  5ITH A;  5I42 B;  3OLA A;  3TAM A;  1CS4 B;  2H48 B;  5GAD U;  2F8H A;  3ZTP A;  1RIS A;  4F26 A;  4FF1 A;  2IDE A;  2L08 A;  3D54 A;  1R8B A;  3H90 A;  5IC6 B;  5C2C A;  2QLW A;  1FTR A;  3SQG A;  1AZS A;  4KB7 A;  3HHL A;  3MF5 A;  5JVH Q;  5E7O B;  4MJK A;  3SV3 A;  3PVX A;  1F5C A;  3HVT B;  2HPU A;  1FRJ A;  4WFB Q;  1LWF B;  2FVQ A;  2J9C A;  1CUL B;  3G2X A;  3AXK A;  3C16 A;  1C4A A;  1SVD A;  1IKX B;  3I9Z A;  1RB0 A;  3T1A A;  1RU2 A;  4FPR A;  4IRC A;  4WF9 Q;  3AT1 B;  1HW9 A;  1EAY C;  4IRK A;  3B54 A;  1U8W A;  5BJR A;  2AYM A;  2P2C B;  2OGU A;  3E01 B;  4ZLJ A;  2AGQ A;  2QTW A;  3H59 A;  1SIW B;  1TAQ A;  3A3P B;  1S97 A;  3WX4 A;  1WDT A;  1WSR A;  2GW8 A;  3WZ0 A;  1FD2 A;  4MFB B;  2DNN A;  3JSB A;  2DEI A;  1FT8 A;  4B3T J;  4LRC A;  1S1T B;  3ZTO A;  4OZJ A;  1XR5 A;  2RHS B;  4DV5 F;  4JI1 J;  2XMJ A;  7FD1 A;  3PW5 A;  2N3L A;  2RDJ A;  4C4W A;  4DR7 J;  4ZPV R;  1Z2Z A;  5BXI A;  5B7W A;  3M6U A;  1WKL A;  1OSD A;  3US5 A;  3SDE A;  2M9K A;  2V94 A;  1TUG B;  1VQP S;  4OI6 A;  4OHV A;  1IN0 A;  3CMA S;  3BGF A;  5KFY A;  1OYE A;  3KG4 A;  2J8A A;  4M94 A;  4EBC A;  1WG5 A;  1P1T A;  3QT8 A;  4PXD A;  3H7H B;  3FUY A;  1C1B B;  3BBF A;  4U6P A;  2AEJ A;  4LIR A;  3W5X A;  2CQI A;  5F8I A;  4YR0 A;  3EM1 A;  2BJ3 A;  3QT7 A;  2HVD A;  4X64 F;  3M4X A;  3HFV A;  1PYS B;  2BJD A;  2OEL A;  3DCA A;  2F65 A;  4DV6 J;  4NLR A;  3MD1 A;  1S6P B;  3R7B B;  3CDW A;  1UL3 A;  5AT1 B;  4ICL B;  1RTJ A;  3ILI A;  1PGZ A;  2J7W A;  2CG4 A;  2UU9 J;  3J7A N;  5D0H A;  1VQ6 S;  2IC3 B;  4PG5 A;  3UN2 A;  1IBK J;  4Y2M A;  2LA6 A;  2VOD A;  3GSI A;  4TYB A;  4CLU A;  2LEC A;  4C0B A;  4CDI A;  3OL9 A;  5FDL B;  1NK7 A;  2G9O A;  3CDA A;  4IOC Q;  3PW2 A;  3BDP A;  4ZP9 A;  2DY9 A;  2XZD B;  3AD8 C;  2M5Y A;  4TY8 A;  1JLE B;  3IXQ A;  2CVI A;  2GHW A;  5E2Q A;  4Y2I A;  4CH7 A;  1CC7 A;  2UXC F;  1H2U X;  4BC9 A;  2I0X A;  1CBK A;  4LF7 J;  1FDB A;  4P73 A;  3QZ8 A;  1KNZ A;  4JI0 J;  2KZM A;  4X4Q A;  1F5B A;  2MLZ A;  3M8Z A;  4NYO A;  4QWA A;  3DN9 A;  2A2D A;  5HP1 A;  2YKN A;  4MKY A;  2CNO B;  2Z8Q A;  2RE1 A;  4HAC A;  3CCV S;  3I0R B;  3A8I A;  2QFJ A;  2HZA A;  2Y0B B;  4PXE A;  3V81 A;  5BR8 F;  1NSP A;  2PA3 A;  2WBR A;  4JI6 F;  1NK4 A;  4PQA A;  3DOM B;  2WB4 A;  2LU1 A;  1KTV A;  3PCO B;  1S5Z A;  3Q2T C;  2OLW A;  4LIW A;  3QFH A;  2FZK B;  1YJR A;  4WII A;  4Y00 A;  4AL5 A;  4DR5 F;  2W1B A;  1SJ4 P;  3I31 A;  1PKU A;  3KNG A;  4TVA B;  1QTN B;  3QGH A;  4CT9 A;  1FKO B;  2Y9H A;  4QYR A;  3OTE A;  4ZPC A;  5IQ6 A;  4BDP A;  1C0T A;  5A6P A;  3MUM P;  1WSV A;  2B43 A;  1HPZ B;  2VU5 A;  1Y00 A;  2V4J B;  2NZC A;  2ROP A;  5F9L A;  1RKI A;  2XMT A;  1N0V C;  2Q66 A;  3LP1 A;  2G13 A;  1K44 A;  4CO4 A;  3KXD A;  3VWS A;  3GTY X;  1SIZ A;  1AFI A;  2HFO A;  1T9T A;  2CAD A;  4DX7 A;  2CFX A;  5HJX A;  1EP4 A;  2R8H A;  4IG3 B;  4NCG B;  3N6N A;  3Q8P B;  2B51 A;  2OSR A;  4C8O A;  3OR2 A;  2GV1 A;  1IKY B;  2U1A A;  2N3O A;  2QN6 B;  2DHA A;  1T9X A;  4NYP A;  2BRL A;  4F4K A;  2VHG A;  3CCL S;  1HKA A;  2NXU A;  2VC0 A;  4U9R A;  5LXR A;  4QW9 A;  1M5V C;  2ZWO A;  1TL4 A;  4ELV A;  5CZX A;  3W61 A;  2HVI A;  1QD1 A;  4IYQ A;  2R7U A;  5D6G A;  2ILY A;  1GMV A;  1WKJ A;  3DM2 A;  4CTA A;  2RU9 A;  1ZZN A;  3CCW A;  3GV8 B;  3HXM A;  1KP6 A;  1I94 F;  2C2M B;  2UVW A;  1Y7P A;  1L5U A;  1ZYQ A;  1VIS A;  3M8Q B;  5CCL A;  2UUB F;  1H72 C;  3PJX A;  4PPD A;  4JI7 J;  2APO A;  1SQG A;  5FLX Y;  3Q8Y A;  1YWX A;  2D69 A;  4Y2C A;  3MM9 A;  3HP6 A;  1VI7 A;  3MDF A;  5D0G A;  3M6V A;  4M5K A;  3CUN A;  1NK5 A;  3J7Y I;  4X2B A;  5EHH A;  4LF8 J;  4RNM A;  4FF3 A;  3W9H A;  4A4J A;  5D0R A;  1RDR A;  2IVF B;  5KG6 A;  2E5L F;  5IT9 Y;  2OPR B;  5LMU J;  4RW6 B;  2ZNZ A;  4ENO A;  1PYT A;  4DCJ B;  1VQN S;  1M5P C;  4R5P B;  3NXZ A;  2F4F A;  4DZ6 A;  1FO1 A;  4HH1 A;  4ZVT B;  2CQ1 A;  3CME S;  1XIQ A;  1T9Y A;  2QL7 B;  1YZ6 A;  2MHE A;  4QR0 A;  4WE1 B;  2BX6 A;  5SUH A;  4ZVH A;  2MZT A;  1HBO B;  3KLG B;  4HKQ A;  2XSJ B;  5D15 A;  3M9M B;  4IFV A;  4UW2 A;  4N76 A;  6AT1 B;  3QRP A;  3RTV A;  5H9E K;  2B0G A;  2ZH7 A;  3M6X A;  1IQZ A;  3FEX B;  2P5V A;  1PIE A;  4EO8 A;  4WJB A;  5DS7 A;  4RW7 B;  3MUT P;  3WHI A;  4I64 A;  1N5V A;  4V1A k;  1NJY A;  3J7A 1;  1RHQ B;  3TAN A;  4ITS A;  2G4B A;  2HHW A;  4DU8 A;  2JH3 A;  1N4L A;  4O4R A;  1YVF A;  1TFY A;  3M6W A;  3NAI A;  4DI6 A;  1FJE B;  2UVV A;  4NLX A;  1ZM2 A;  1Q7L B;  1S9F A;  1UJ4 A;  2IM2 A;  1DUR A;  2XZW A;  4CYU B;  3W9I A;  2VV5 A;  5HQL A;  3SI8 A;  1JLQ B;  1BC6 A;  1Q5Y A;  3MPW A;  1FER A;  3IC1 A;  3MUV P;  4GKJ J;  1Z4U A;  4U7U K;  4XTT A;  2GHV C;  2O1P A;  1NB2 A;  1CJT B;  3VQT A;  3A3O B;  5I3P A;  3IM9 A;  2HHU A;  2AMC B;  2X1A A;  3I5C A;  1Y3J A;  1RZM A;  1MRO A;  4YME A;  4JI4 F;  2NS1 B;  1LWC A;  1TK8 A;  2VG5 A;  3K57 A;  4B02 A;  3GIL A;  4Y28 C;  4EYH B;  1KS2 A;  3G87 A;  2CPD A;  2VFR A;  2R3V A;  4PWU A;  2LDY A;  1TVR B;  3GON A;  3T1H J;  3CC7 S;  2BJ9 A;  3W1Y C;  3QWP A;  3CUL A;  1XMO F;  4LF9 F;  1XC9 A;  3EVM A;  4QIW D;  3GJQ B;  2F5G A;  3QIP A;  3D1H A;  3P5B P;  2EVZ A;  3CJ0 A;  3MPV A;  4GMK A;  2MZ1 A;  4EEY A;  1GMW D;  4DG1 A;  4DSL A;  2IBO A;  4RPF A;  2GQQ A;  4YR3 A;  2SXL A;  2F9D A;  4DZD A;  5ADZ A;  3BDE A;  4NA1 A;  1AYE A;  2ACM A;  4GVB B;  2PMW A;  4FVM A;  4DR4 F;  3D28 A;  3IO1 A;  3W5Z A;  3LPY A;  1QVF R;  2C2N A;  4CQ1 A;  1OQ6 A;  3ZZO A;  1ZTT A;  1X8D A;  4NMX A;  3TO8 A;  2VD3 A;  4QW8 A;  1MNE A;  4Q7A A;  3HM9 A;  2QMX A;  2IA6 A;  3KJV A;  1NHV A;  2CPJ A;  5KFR A;  1JLC B;  4W92 B;  2CJB A;  1X7V A;  4OYA A;  2BE9 B;  3IS9 B;  2VKR A;  3OTO F;  2UVR A;  3ZZP A;  1M5O C;  1VRT B;  5T7L B;  4DV1 J;  1NK6 A;  2QA4 G;  2R7W A;  1R8A A;  1S4F A;  2GGP B;  3WIU A;  5CAB A;  4CT8 A;  2ZBI A;  2DRB A;  2KFN A;  4S0M A;  2V8P A;  3CWJ A;  3OLB A;  4WIQ A;  2BE2 A;  1ZET A;  3W5Y A;  5D4N A;  1ULR A;  1SH3 A;  4NXM J;  1GTH A;  2DHG A;  2MZJ A;  2ZHA A;  4C3K A;  5FJ4 A;  2YKO A;  3CW2 C;  3HFK A;  3SBM A;  1D09 B;  5HAT A;  4Z2X A;  2ZJQ Q;  4J9S A;  1XNQ F;  1NSK L;  4TYA A;  2PT0 A;  2MGZ B;  1UWB A;  2HBY B;  2P8I A;  2CPE A;  3GV7 B;  5DQG A;  4C48 A;  3NS6 A;  4LF4 J;  2AU0 A;  5J1E A;  2PFD A;  4I0W A;  2LEB A;  4KT0 C;  2ASJ A;  2Q79 A;  3KLE A;  1HI1 A;  4RUH A;  3GIM A;  2IMW P;  1F5A A;  4WCE Q;  2WVB A;  1G4C A;  2KHC A;  1NPR A;  4A8Y A;  3VAJ A;  1Q86 T;  5D77 A;  5DLG A;  3C14 A;  4X4S A;  4WFA Q;  2LVW A;  3DRS B;  1TL7 B;  3EZO A;  1HNI A;  4NX9 A;  3T5H A;  4DUZ F;  4NLS A;  4ZPB A;  3RYL A;  3AAW B;  3DLK B;  2BM0 A;  2LEA A;  5L9N A;  5E3Q A;  1RE1 B;  3FVY A;  4BCA A;  1UVJ A;  4C11 B;  4DX8 H;  1DAX A;  3BF4 A;  4OIX A;  2CNN B;  2VPY B;  1NLK L;  4K0K F;  2BKO A;  2DK2 A;  1VBZ A;  4DV0 J;  4IFY B;  3H2L A;  2XWX A;  4R25 A;  2KM8 C;  3OTC A;  3RUB L;  4KH1 B;  4KAI A;  1LK7 A;  2GJF A;  1BXN A;  4CZC A;  3LA0 A;  2FLN A;  3FQK A;  1DTT A;  1FFS B;  3D6T B;  1AUD A;  1HNW F;  3O2I A;  2FZC B;  4DR1 J;  4JI5 F;  4NLT A;  2BRK A;  3M32 B;  4MT1 A;  1RHM B;  3HMJ G;  5AJ3 F;  2QT7 A;  4OL8 A;  4DS4 A;  2RDD A;  4LSN A;  3MR6 A;  3OTD A;  3CO0 P;  4GC6 A;  1S10 A;  1YTY A;  3NGT A;  1IBL F;  2QFI A;  3NS7 B;  1WG4 A;  4KHR A;  2AYE A;  2ZVS A;  3PRV A;  3DU6 A;  3T9Z A;  5D8H B;  2E9Z A; 
#chains in the Genus database with same CATH homology
 2CJX B;  1RHQ B;  1SC3 B;  2CJY B;  3GJT B;  2QLB B;  1PYO B;  1IBC B;  2H65 B;  3GJS B;  4ZVS B;  3RJM B;  3EDR B;  3P45 B;  3QNW B;  4ZVP B;  2HBZ B;  1RWO B;  3IBC B;  2XZT B;  2XZD B;  2QLJ B;  3GJQ B;  2H51 B;  2Y1L B;  1RE1 B;  3SIP B;  1RWX B;  4DCJ B;  1RWM B;  2CNN B;  3R6G B;  1NME B;  2H54 B;  3KJQ B;  3D6H B;  2C2Z B;  1BMQ B;  1RHK B;  1I51 B;  1RHR B;  1RWV B;  2C1E B;  4ZVT B;  3IBF B;  2C2O B;  2XYG B;  2QL7 B;  1RHU B;  2P2C B;  1RWN B;  1RWP B;  2HBR B;  1QDU B;  5K20 B;  2HBY B;  4JB8 B;  2CNL B;  3KJN B;  1QTN B;  3KJF B;  1SC4 B;  2C2K B;  2H4W B;  2H5J B;  1F9E B;  1SC1 B;  2CDR B;  4ZVR B;  2QLF B;  1RWK B;  1RHM B;  2C2M B;  2CNK B;  3EDQ B;  2XYP B;  3R7B B;  1PAU B;  1ICE B;  2H4Y B;  2QL5 B;  3R7S B;  3GJR B;  1RHJ B;  4ZVU B;  2H48 B;  1RWW B;  2QL9 B;  2CNO B;  4ZVQ B;  3R6L B;  3R5J B;  1I3O B;  4DCP B;  3D6F B;  5IC4 B;  3D6M B;  5IC6 B;  2XYH B;  3NS7 B;  3P4U B;  2Y0B B;  1GFW B;  4ZVO B;  2DKO B;  4LSZ B;  4DCO B;  2HBQ B;  3R7N B;  2FQQ B;  2H5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...