2XZDB

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
CHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
total genus 18
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xzdB00
1I51B 2XZDB 2H5JB 1NMEB 1IBCB 1RHMB 2HBQB 1SC1B 3R7NB 1RHRB 1RWVB 4ZVRB 2H4WB 1RWPB 1RHJB 1RWKB 2CNNB 2H48B 2HBYB 4ZVOB 3GJSB 2QLBB 1RWXB 5IC6B 3D6MB 2XYGB 1F9EB 4ZVUB 2XYHB 3P4UB 3IBFB 1SC4B 3D6FB 2C1EB 1RHKB 4ZVSB 1BMQB 2QLJB 2QL7B 2HBZB 2C2KB 3QNWB 2C2OB 2CNLB 3R7SB 2Y1LB 3KJFB 3KJNB 3R7BB 4DCOB 1RHUB 1ICEB 1PYOB 2QL9B 3NS7B 2Y0BB 3R5JB 4DCPB 2C2ZB 3GJQB 4LSZB 2H54B 4DCJB 2QLFB 3R6LB 3D6HB 2FQQB 3SIPB 1I3OB 1RWMB 3GJTB 2CDRB 2HBRB 3GJRB 1SC3B 3IBCB 2H4YB 3KJQB 2QL5B 1GFWB 2H5IB 2H51B 4ZVTB 1RWOB 3RJMB 1RWWB 2CJYB 1QTNB 4ZVQB 1RE1B 2H65B 1RWNB 2XYPB 1PAUB 2CNKB 3EDQB 3P45B 2P2CB 2CNOB 1QDUB 2DKOB 5IC4B 2CJXB 2XZTB 4JB8B 4ZVPB 5K20B 3EDRB 3R6GB 1RHQB 2C2MB
chains in the Genus database with same CATH superfamily
1PJ7A 2HVDA 4WK1A 2XSJA 1XR7A 2UV8A 5D0HA 3C6TB 2ZH4A 1T7PA 4ZVEA 2HEKA 2HHPA 2D3O1 4LRBA 1J5EF 4IR1A 1VR6A 2W2QP 2MJNA 2NSCA 2V34A 4USJC 1QSLA 2IVMA 2CPDA 2HWHA 3HSZA 5KFZA 3UNGC 5CH7B 5LJ3Y 3MR5A 2DIUA 4YEAA 4DX6A 3OJSA 1SJFA 2ACMA 1S7IA 3AH6A 2OPPB 1J27A 4LF7F 2FHKA 3G4SS 4CNYA 4KFBA 2MZRA 1W2BR 5BJRA 1NK5A 3TAMB 1BE4A 3N28A 4H4KC 2KJWA 3TAQA 1S9FA 4C48A 3VGSA 2VIHA 4F02A 1TV6B 2HQ3A 5D0EA 2GZOA 5KFUA 4WPAA 2IRXA 4BWMA 1SL2A 4O3SA 2WB4A 1LQ9A 4CLKA 5FDLB 4Q43A 3NY0A 2YX1A 3HVAA 1K9MT 2R8JA 2E9RX 1UZDA 2R2RA 4GVLA 4B9VA 3DU5A 3FNNA 5ETTA 4F0HA 4MKYA 2V4JB 5CCMA 1FX2A 2DNOA 3VCDA 1NXIA 4D3GA 2W1BA 4H4MB 4FZVA 1JLEA 4ZPDA 2NR0A 1B4SA 1SH3A 4ITSA 3HHKA 3KLVA 2XMMA 2RRAA 4A48A 1IWGA 3BN7A 4Y2KA 1TVRB 2C2OB 1WNEA 4F4XA 3PRDA 4KGZB 2R3VA 2VA2A 4KTQA 4DLGA 3TW0A 3T1YJ 2ABYA 2XWYA 4G1QB 4N77A 3N6MA 5CZXA 3D1HA 2VOOA 1D9AA 2MPUA 3ILIA 4ZVHA 1QTMA 4ICLA 2B4OA 2OFGX 1PYOB 3Q8YA 5KG4A 1RA6A 2R7RA 4AXIA 3GSDA 3KUGA 3H20A 4TU7A 2K06A 1WC4A 1M5HA 1VHIA 1HQUA 3T19A 3AB2B 1SQGA 2B8PA 4FYDA 1BC6A 5J2NB 5HMZA 1HR0J 5DG7A 4PKDB 3TOQA 4ETZA 3C6UB 3EX7B 2IBKA 2YPYA 2BE2A 4OX9F 4PQAA 2DGUA 2J9EA 4TNOA 4FS2A 4DL3A 1FD8A 3EPIA 1NU4A 1X4GA 3OL9A 4JYAF 1QE1A 1A7GE 1RJJA 4EGLA 3ICLA 1YTYA 1WF2A 2PA3A 3KHLA 1RGVA 4WFYA 1HNWJ 4TY8A 4C6AA 2A0FB 1FDBA 4WZQA 2BQRA 2VASA 2YQ3A 4HACB 4ILLA 2CZVC 4B3MJ 2YKNB 1FRMA 4EO6A 4DV1J 4QWDA 2YWGA 2MGZB 1PJ6A 3Q8RB 5L1LA 3H25A 1KWMA 1RU1A 1IJEB 4B9UA 1IKXA 3K5OA 4OZJA 1D9FA 2M52A 2SXLA 3R27A 3RRKA 1U6BA 1RWNB 2EFQA 2PD1A 3BGOP 3E3XA 3QBCA 4XDCA 5CYQB 3UVJB 4DPUA 3T1HF 1FJGJ 1FE4A 4U7UD 4DR3F 1KLMA 3PYEA 4UTGA 2V2VA 3QAUA 4PUOA 3LAKA 3LO3A 4YFUA 2XSFA 5IQQA 2QFJA 4LF4J 3R2CJ 2LFVA 3K5NA 1F5AA 2J9DE 5DS7A 4KV8B 2R2UA 1M5SA 2YNGB 2EFNA 2KB2A 2XI2A 3E51A 4M5NA 2DO0A 2BVZA 1JNZB 3SXLA 3DC2A 3DDKA 2MHNA 3TA0A 3TJ9A 2E1PA 5H9EJ 4BS2A 4MIAA 1NKEA 4P52A 2QSWA 1FESA 4UF4A 1H72C 2U2FA 4LMZA 1QUVA 2PO4A 3A3OB 3EVWA 2GGPB 2DBBA 1RWKB 2BACA 2DISA 4OFZA 4WP8A 3S7RA 5DDQC 4OYAA 2E44A 3OT9A 4A8KA 4ZCLA 1CS4B 3K7RA 1N54B 3OFFA 3MECB 4G1PA 4USUA 5CHCB 5C2CA 2KXNB 2G2OA 1VGYA 3QWPA 4F4AA 3KLFB 2R2SA 4L73A 1R8PA 3FDSA 2L9WA 5G4DA 1V6HA 5LM7E 2LXUA 1SJRA 5F8LA 3GQCA 4DFJA 3RB0A 4DR7J 2R7TA 3WC2A 2CXEA 3H4BA 3G87A 2V50A 1HWIA 3SBMA 2CQ3A 5C42A 4BHQA 2M2BA 3MM7A 3QO9A 5HK4A 1HNWF 3TO8A 2HAFA 2V69A 2VZ9A 3IFEA 4I6WA 4WJBA 4C8NA 3PEHA 3I55S 1GQEA 3W8PA 2WB1D 4WKYA 1IVZA 4L3NA 3DKDA 1S99A 3H5YA 3IMQJ 4MH8A 3PY8A 2KXFA 1DURA 1JNRB 1FRIA 5ETSA 3P49B 4U8YA 4QIEA 1R0AB 2AT1B 4HHHA 1SUQA 4NWBA 2FGOA 2YNHA 4NLRA 4CM0A 4HT7A 4CNZA 3TAMA 5B0DA 4ELUA 5KFKA 1X9WA 1AFJA 2E5GA 1Q95G 1SIZA 2GMLA 4JV0A 3ISNC 4M5DB 4USHA 3UDLA 1RAHB 3EZOA 2DVIA 2A3JA 2KT3A 1RACB 4KB7A 1DARA 2NLWA 5KG1A 2E7XA 4DHVA 4R8UB 1MW7A 1UFKA 2PDAA 2EXUA 2X3GA 3ISZA 3AD8C 4MIWA 2PMZD 4ZLJA 3MR2A 5KFJA 1WWHA 3AA9A 5ETKA 5AT1B 2DNQA 2QMUB 2C2RA 1NHKL 2CPHA 2V8HA 1XMQF 3AY0A 4R5PA 4YHHF 4UY85 4L72B 4UZBA 1JIHA 1I94F 4QYZK 1BLUA 4ZPWR 2CYYA 3I31A 3I5BA 1LV5A 1RT1B 2ZD1A 4J5OA 4QYRA 3UE2A 4CT8A 1TL3A 4NCGA 4R0EA 1MG7A 3GJRB 3LQVA 3V2UC 4IRCA 3UFCX 5IT0A 5IV4A 2W8KA 2UXDJ 1TAUA 5A6WA 1MWYA 3ULHA 1O8BA 2XO7A 1U4BA 1C0UA 3OUYA 2E7WA 1NHUA 4M95A 4G1IA 1N6QA 4Q5VA 1G6BA 4TU8A 3MEEA 4OZNA 4XPCA 4KJIA 2AGOA 2JVRA 1R8BA 1JLFB 2BABA 4YDDB 5LXRA 3VALA 3P6YC 2P6TA 3QJPA 4USKA 3QRQA 4ATNA 3CJSA 3P5BP 4U67Q 1RTJA 2L9NA 3LALA 3R8YA 3H4DA 2PT0A 4C3LA 2C3OA 2QA1A 1L5UA 3DMJB 4OHWA 4CLZA 2CJXB 2I0XA 2XZTB 5C24A 1RT7B 3EDRB 2OIHA 1DZ5A 3K59A 1KLNA 1FEHA 2PI5A 4J91A 3C15B 1JLQB 5J1NA 5E3AA 5IWAJ 1UVMA 1JLFA 4OL8A 2V6AA 4FVMA 1GH8A 1IN0A 2P9EA 1N5SA 2HBQB 2HGLA 3R7NB 5IFMA 5B09A 2V4JA 3LWLA 4K4YA 4IOCQ 4N56A 1FDAA 3L09A 4JI3F 3PRVA 2N7YA 3UO0A 3LW5C 3Q8SB 4CLFA 2NYHA 4WFXA 4CT9A 2FHJD 4LF9F 3LPEA 1YK9A 5A8RB 3AAWB 2FUG9 4B3RF 2C2NA 1T02A 3K5MA 4K4ZA 3PACA 3MPYA 5IC6B 3SFGA 4I2PA 4DU8A 2DEIA 3MOZA 1TL1B 1GNKA 2XS5A 1BQMB 1RBAA 4TQRA 2BW2A 2DITA 3VGUA 2PFDA 2XYHB 2Z2MA 4JI1J 2F8EX 2KXHA 2COLA 3TJ8A 1VDHA 3T5HA 1KR4A 4L76A 4R25A 2CADA 2HSEB 6FD1A 5T14A 1F9FA 3HHLD 1MU2A 3SSSA 2EPIA 4ES2A 4O3QA 5LXYA 4UQGA 1S1UA 3PX6A 3FCWA 3KK1B 1UVJA 4NASA 4DR6F 4ED1A 1Q5YA 5CZVA 3KJVA 4DV4J 2Y8WA 3RBXA 2V67A 2H5EA 4Y6IA 4LFBJ 1WG4A 1XIQA 1TP7A 2FTRA 4JBCA 1NDPA 4GVBA 4HT5A 4NA3A 3W62A 1PILA 2QRRA 2VC0A 2BE2B 3DM2A 1N5VA 4IQXA 3C14A 3OTCA 4A4JA 1V5VA 1SKSA 4GO5X 4PAAA 2POKA 1FFSB 2BOAA 5ETLA 5CA5A 3HZEA 2W9AA 1AT1B 2GQCA 2CJAA 3DLEB 5L9NA 1WHWA 1R8HA 3EPGA 3N79A 1S49A 3BSAA 5HO4A 2AZ3A 3MD1A 3BGRB 3WC0A 4LF4F 2OEJA 4DZDA 3PKMA 3A3NB 2QA2A 3OR2B 2VG6A 3IWNC 1HFEL 4ICLB 4URSA 3GJQB 3IA0A 2ATCB 4NL5A 2NXCA 4JI4J 1VQLS 3KLIB 1JLAA 1M1GA 4PYAA 3QRPA 1RT4B 3IAS9 1XMOJ 3ZNUA 3GIJA 3D6HB 5ETRA 4JI8J 3FEYB 1R8CA 5A0YB 2J9CA 3SIPB 3H40A 2Z30B 4LBIA 1T3OA 2FJWA 1OMSA 1ULRA 1FK9B 3ZZ0A 3E2EA 2LQBA 1Q8BA 2VBZA 4IG0A 4RUAA 1NBEB 3W9HA 5KFEA 3WX8A 3CWJA 3QZ8A 3GG1A 3BGLA 1N48A 3ENQA 4O3NA 4F25A 2IA6A 4BWJA 1H7XA 3BQ1A 1E6VB 3LP2A 3MECA 3GU0A 1IQZA 2RU9A 4KKOA 3T5KA 2WSCC 3DOMB 2YWFA 5GAHI 2GMJA 1JJ2R 2FJVA 2H5IB 4ANEA 2JEGA 2IFXA 3AB4B 3DHXA 3ENAA 2ZWOA 3IGVA 1JLAB 1MWZA 4ZOSA 3U1LA 4QWEA 4ZIVA 2R8KA 1WTFA 3TUIC 1SKWA 1I1GA 3L9ZA 2B9YA 4DUYF 5ETOA 1S77D 4LQ3A 4YDXA 1Q16B 1DJ0A 2LLZA 3GLJA 3J7AN 4NLXA 3KG4A 3BGRA 4PZVA 5IV3A 4KFBB 2PFFB 1W7WA 2MKSA 2AYBA 3NLCA 5GMEA 2L3MA 4TY9A 2A2CA 3NNCA 2OI2A 2P6SA 2MQMA 3NGUA 3BZQA 1X5PA 1Y10A 2U1AA 4NA1A 3BPDA 4PWWA 4X2BA 1Y00A 4K2XA 4ZCMA 1LWFB 4GVBB 4ED5A 2FY1A 1DQ9A 2GJ2A 3IRXB 4Z7CA 2K3KA 1C2PA 2K7JA 2VKRA 1F1BB 1S1WB 1CJTA 2F5GA 2IM3A 2XSJB 3GSIA 4MJKA 3RAXA 4W98A 4JI4F 4RNHA 3CT9A 1RADB 2Z57B 2FZKB 2ASLA 3H2UB 4F26A 5KG0A 4LF5F 4OHZA 4ECWA 1HBMA 5HMWA 5F9NA 1PO6A 2OPRA 1UPPA 2CNNB 2W4PA 2ZC4A 3H5SA 5HP1B 4HDGA 4O3OA 4DSEA 2UUCF 1CLFA 1YBTA 3THVA 3MM5B 4N41A 4TY8B 1XMQJ 2KN4A 2J6SA 1H73A 4B17A 2HZCA 3L4BC 5L1IA 3D6MB 4ZJQA 3ZZTA 4ZN3A 4U7CA 1TL1A 2VDIA 3G6VA 3D28A 3I5AA 4NRUA 2YVSA 4DR1J 2HNDB 3H98A 2YNIB 2FJDB 1OIAA 1PSDA 2BRLA 3M9MB 4K59A 3K89A 2RDJA 2CQHA 5CXTA 4LR7A 1GXUA 1LOUA 2DT9A 4OYOA 2QEXS 2C3UA 4FYVB 3WDOA 5K8NA 3U1MA 4JV5F 1LW2A 3MEKA 4DL4A 1BMQB 3EXYA 2X7IA 2XO6A 4J90A 3M8WA 2VC1A 2HVHA 4JI0J 1HD0A 3BGFA 1GK8A 2CJ9A 2JC1A 3FCHA 4I6YA 1WSVA 4IKAA 3VQSA 3ZTPA 2R8IA 1FRHA 3QGHA 4DR4J 3CDAA 4LSNA 3FBBA 3NCQA 2YH0A 2KG0A 3T1YF 3VHQA 3V4IB 3GFYA 1KVKA 4NLQA 4CDIA 5C24B 5KOWA 2VQFJ 2KKHA 2CNLB 2V94A 3RR7A 3M30A 2ZJPQ 1UJ5A 2KT5A 1N36J 3CJ3A 4P2XA 2AW0A 4N7TA 4P74A 2BJ1A 4RW6A 4DG1B 3W8GA 1D1UA 3BDPA 4YB5A 1F2GA 5IXUA 1RTJB 2MKYA 1YLXA 2MHEA 2FZCB 3KTQA 1NEEA 2ZNZA 3IP0A 3SMZA 4ZMMA 2MKIA 4M8LA 3MR7A 4LSNB 1HBOA 1RT3B 3GP9A 3MPWA 3G9CA 1DTQB 2DY9A 5FIIA 4N8NA 2LU1A 1D8YA 4NCBA 3K17A 2MZSA 2AWZA 4EMDA 4OQJA 3RUBL 2IVYA 5K8MA 5MAOA 1HL6A 3GE9A 1PBAA 4NLPA 4Q2MA 4OYBA 3WZ0A 1YI2S 4EZ6A 2GX8A 2W7AA 5G0RA 3DLBA 2QYGA 4KPCA 3NAHA 4LRCA 1UWAA 2Z58B 5KT6A 5DDPC 1Z2ZA 2V8GA 1VC6A 2KTQA 1ZZNA 4X4UA 4U96A 1WJ9A 4I2QB 5KFSA 5KG2A 4XO0A 1KOOA 1Y5IB 2IA0A 2DGSA 4FXWA 3UN2A 1AW0A 3OFGA 4P9SA 3MDFA 1S10A 1KC8T 1SC3B 1JXVA 2Q3PA 5LMNF 2HQIA 1P6TA 2RAQA 3EE3A 4LR8A 1D0EA 1X8DA 3AJ2A 2EVZA 3KHRA 2DD8S 1URRA 2FPHX 4USMA 1UA0A 3DU6A 4CYUB 4DEZA 2J0SD 2DNYA 5K14A 5KFIA 5IM0B 1J5EJ 1IKYB 1S9EA 2MZTA 3RZAA 3ITHB 4IG3A 4JUZA 1JQGA 3DLGB 4ED7A 1SJ3P 2UUAF 3AJDA 2G2YA 3Q89A 2CJYB 2R7QA 4P10A 5ETNA 3AD9C 4YP3A 1UCNA 3SI8A 3C6TA 4QPTA 2H65B 3SEOA 1GAOA 1P1LA 2XYPB 5BR8J 1YIJS 1KP6A 3FQKA 1VIXA 2C3MA 3VGTA 4EK2A 4A8SA 4R8UA 4EO8A 1SJ4P 2IMOA 1CQMA 2CQIA 5E7OB 1AB8A 3P96A 5JXSA 3RBEA 3DLHA 3E01A 2P2CB 3PNIA 4LIWA 2KU7A 4I68A 3QGPA 3TX8A 4IFVA 3CJKA 3OLBA 3GV8B 2EC0A 2DNLA 2DKOB 3NGRA 5CD4A 2ZDOA 2F3JA 2JX2A 2ERRA 4DSJA 1VYAA 2QT7A 4YMEA 4YHHJ 5KT5A 1YHQS 4AFFA 1VHFA 5EUHA 4F8RA 2YH1A 3V81A 3K8WA 3Q86A 2G1HA 1REVB 3IAM9 3CD7A 2CPIA 4CO1A 2RUGA 1LWCB 1YBAA 4PWUA 3HSJA 5EX3A 3UVJA 4C2MA 6AT1B 2EKNA 1R31A 3MM8B 3NS6A 3CVKA 3N9UC 2RSQA 2AGQA 4LRFA 4K0KJ 4UZCA 3TYTA 4X62F 2QLBB 3CTRA 4M5HA 2ZZMA 1VISA 2IM1A 2YXLA 2RRNA 5D77A 3DLKA 3GFHA 1UA1A 2IRUA 1KOHA 3W2WB 2F9DA 3EM1A 3RB6A 3P3DA 2KVIA 2NXNA 4FBUA 4N76A 2DRBA 3CULA 3NP5A 3UN3A 1TKZA 3GCWP 4MFBB 1IBLF 2L41A 1RI7A 4KGXB 2OEKA 1LFWA 2ZC3A 3GFZA 3P4UB 3NWRA 5A0YA 4DR1F 1VBYA 1N33J 3CJQA 2PSZA 3IWXA 3ZTQA 1CJTB 1T03B 1TK5A 3RU0A 1JK9B 4USIA 2UVRA 3SSQA 1PAEX 1BQNB 4P7TA 4KHRA 1TK8A 4D3HA 2PI4A 2L9DA 3KMQA 4RUHA 3O6QA 1V9OA 3SV4A 3MMCB 2G1DA 3J80Y 1V3RA 3JTOA 2YKMB 2VG6B 3N4WA 2QL7B 3VR1A 4BC9A 3JSRA 1R89A 4ZCIA 2D3ZA 2WONB 1MMDA 4Q0BB 1RK8A 2E66A 2QTWA 1XNQJ 1CSJA 1RT5A 3DRPA 3G86A 5D0GA 1T3NA 4DWIA 5IQ6A 1FWKA 4ED2A 2DR5A 1UZHA 2YQ0A 2W9CB 3KJNB 2C22A 3FC9A 2E5HA 3MMCA 1HBUA 2HURA 4YB7A 4DV5J 1VQ7S 2R7UA 2GJIA 3FKBA 5ETMA 4X84A 4CO5A 3KOAA 3EVOA 1RDRA 2UZAA 1WEYA 1EIYB 4DS4A 2K7KA 4DCPB 1NNDA 1E6VA 4PR6A 1IJFB 4OYPA 1EQMA 1B7FA 2V4QA 1FVQA 2HHXA 3IO1A 1NK6A 2P9GA 2X1BA 3HMJG 4B9LA 2HG4A 1KSPA 4TQSA 3M32A 3WHIA 1GMUA 4KPYA 1AUSL 1I3OB 4WXOA 1JXLA 4NE9C 2RS2A 2BM0A 1VS3A 3B54A 3EZUA 2CKWA 2CDRB 3G8SA 1NK8A 3QLHA 3NOGA 2HBRB 4PQUA 2LVWA 3MM8A 3AXKA 4QU7A 3CPWR 1LFPA 3LTOA 2DGQA 2QYCA 3GZ7A 3IBCB 4RW4A 5CQGA 3VAMA 3FMBA 3OTEA 1S7HA 5F0WA 1GX6A 3MZIA 1EHWA 2GFFA 2GS8A 2HS3A 4QOTA 4DL7A 1FERA 1NHVA 2BKNA 2XCPA 1YJUA 5HANA 3B4MA 3QJLA 2J0XA 2YWEA 2ZE2B 5HI7A 2OD6A 1RWWB 1HNZJ 1F5CA 2ZE2A 4O23A 1IBLJ 3F0NA 1KNZA 3G8TA 3PYFA 4Y34A 3Q83A 3D54A 3I4PA 3Q8VA 3A3PB 5BR8F 4UY8T 1X5TA 3HT0A 4QCLA 2HHVA 1UWBA 2CNKB 2XI3A 1RYRA 4TLQA 3I96A 3ONQA 5KFYA 1WDTA 3BEGB 3J80U 1MMNA 1RAEB 1Q86T 1XK8A 5DG8A 1T94A 3R97A 4E8UA 1S4EA 2HIQA 1S57A 3VAGA 2E9TA 1Y5LB 4ANCA 4PEOA 4RNOA 2A6OA 4WTYA 1S1UB 4B02A 3MTJA 5AXNA 3N0VA 2BE9B 4C8KA 1SXLA 4CP5A 3P5TL 3HK2A 2FVQA 1X4CA 2H3EB 2Y8YA 2ZBIA 4LJMA 2NZ4A 3FZ2A 2B8QA 5I42B 5E0OA 4ZITA 1IKVA 4UW2A 3M4XA 3CCJS 1YQHA 1UW9A 4M5MA 4LBPA 4ANDA 1U8WA 4LF8J 1YJVA 2AHOB 1UW4A 3MCOA 1UFLA 4JI6J 1KVJA 1FTCA 1VJQA 2YNFB 3NG8A 3SQGB 2HK3A 2LYVA 3PYGA 5GAGI 3DRSB 2GA7A 2VA3A 5KT3A 4ED8A 3NMRA 4UUXA 2W01A 1S6UA 1U1OA 1LW0B 1U26A 2YNFA 1NJZA 1C0TB 5G0RB 4YY3J 5HBMB 4J9QA 4M5JA 3DXBA 2VG7B 4FKYA 4CI0B 4TU9A 1JB0C 3R5GA 2WBRA 5I42A 2FJBB 1VQKS 1Q8KA 1OSCA 1RA7A 3FFIB 1RAFB 2UUAJ 3DYAA 2D74B 1OQ6A 1RAOA 1SC4B 3BQ0A 4EBDA 2AV5A 2F8MA 2HS0A 2HFOA 5DRKA 4DV3J 2V2ZA 2VBYA 2CQ1A 2FC8A 3DHWC 3B6BA 2BOPA 1YX2A 1NH7A 2NCKL 2J8AA 2M0GB 4HTIA 2LDIA 4CRJA 3ET6B 4WE1B 5HROB 3PVXA 4ZPAA 3M30B 1W2IA 1NSPA 2BKPA 3HHLB 3PM9A 3QIPA 1W26A 2MLXA 3H42A 2JEIA 4F0KA 1S6QA 5M2PA 4YR0A 2R8HA 2VJVA 4C8YA 5KFRA 3PHEA 1Y7PA 4FN5A 4NEZA 2EI5A 2OPQB 4FP9A 2CZ9A 4LBHA 2GHPA 3MFHA 2XEXA 4K2JA 3Q8PB 2BJ7A 4AQYF 4DQIA 2OTJS 2FJAB 1WUUA 3GV5B 5F8IA 3FEXB 5B7WA 5J2PA 1OY9A 2VFVA 2E5JA 4QZVB 1JKHA 4Z7YA 1R0AA 3QJJA 1Q7YT 3LH2S 4RW4B 3TUJC 1TKTA 2VFTA 1VI7A 5J2MA 1GMWA 4E0DA 3R6LB 3CD6S 3CCSS 2XMAA 1VLOA 2EK1A 2NXUA 4LQ9A 1YJ7A 3TVKA 2ZJRQ 3RTVA 4GC6A 3G71S 1HWLA 1WOPA 4OYXA 3BN4A 1EJ7L 1VQYA 2WOMB 3I0SA 2CQGA 4NPOA 4A8YA 3LP0B 2BA9A 5K8OA 2ZEJA 4QIFA 2N4DA 2GV1A 4NEYA 5E33A 3FSIA 3LF0A 4K5RA 4PG8A 3E01B 1WEXA 1ZM3A 1VK8A 4X4PA 1PGZA 1N32J 5B08A 5MLCV 1Q0NA 1FT8A 4GO7X 1B99A 4KHMA 2H4YB 2OFHX 4MT1A 2UXDF 3KJQB 3PIOQ 4HL9A 2J0WA 2LMIA 3TUPA 1NJXA 1FNOA 1WEZA 2V63A 1R6VA 2MQLA 3SDEA 3OW2R 3CNQP 1F0XA 4LR9A 3ILLA 4ZPVR 1T95A 2B4PA 2ZVIA 3CUNA 1YG0A 2JLEA 3M8QA 1N5YA 2HVZA 3W63A 4IG3B 4A8OA 1UEUA 2XMVA 3MR6A 3G2XA 4JV2A 2JFKA 5F8GA 4RZRA 3OSNA 4DV2F 3T5JA 1PAUB 4X4NA 3HXMA 3ZZUA 4DUYJ 1K0TA 4CO3A 3AT1B 4EBCA 2HQGA 2HFUA 4ZPBA 2OPSB 4B3SJ 2GW8A 2UUCJ 4DJBA 1T8EA 4NZ6A 4WP9A 1A6LA 4U9RA 4YB1P 1LW0A 2F4VJ 3QYYA 2KG1A 3CO0P 2CVEA 5K9FA 3SCJE 2LEAA 4YR2A 3MEGB 3OVBA 3SFUA 1BQXA 2KT2A 3TZWA 3I0RA 1RHQB 4X4TA 1H38A 5F41A 1RTHB 2DHAA 3KUHA 2B7CB 4UOHA 1HBNB 5I3UA 4XK8C 3J7ZT 1T03A 1IKXB 3PG9A 3U1NA 1TL5A 2BJEA 2DR6A 2ILZA 1X4AA 4F3QA 1K1SA 1NPRA 1JLGB 3VF0B 3W1YC 4J9LA 2ADCA 3BSCA 3BO4A 4Z2XA 5LSOA 4C7QA 4JI8F 2DHHA 3U02A 3AODA 4PABA 3GJSB 3TQ1A 1OO0B 1ZS6A 5F3ZA 2Q6BA 3KLEB 2IYGA 2NZCA 2MEWA 4FF2A 2KYZA 2BE7D 4I7FA 4RW7B 1QAIA 1RT4A 3BKFA 3MPDA 4J9UE 1NZ8A 1PYTA 2PMHA 3KLIA 1RLDA 1TKTB 4PG5A 1RISA 5E3PA 2XYGB 5J2MB 1LK7A 4X65J 1MLAA 4FYXB 1TQLA 1UWBB 1ZAVA 3PJ9A 1FDNA 2NXJA 2RKIA 1REVA 3OV7A 4TN2A 1BUXA 1SBRA 1UFWA 2B7BB 3CC7S 1EKRA 2LA4A 4M94A 1YWXA 2IRYA 2DGVA 2KHCA 5KFMA 3FSXA 1S1VA 4FNHA 4IFVB 1L3SA 4GKKF 1OYEA 3C14B 2IJRA 3M8SA 2OLWA 3VZHA 4JI5J 3OR1B 4A8FA 4IH7A 5DETA 5ETQA 3QIPB 4L3KA 1IKWA 1UP1A 5F3TA 1ZM2A 5KFOA 1TL4A 3X1LB 1RZMA 3FBFA 4G1QA 3G6ES 2HWTA 3PR5B 4MK7A 4OV1A 4QQBA 2FC9A 2VODA 4ES1A 4KGMA 2MYFA 3HSDA 1OQ3A 2FGCA 5GVQA 2ZUGA 2IC3B 8ATCB 4OX8A 3CEDA 3MM5A 4DPTA 3EVMA 2ALZA 1KBRA 4B3TF 3QFHA 3MHYA 1P9YA 1R6YA 5BYRA 3M8PA 1QAYA 3ZC4A 4MKAA 2VHGA 3CJ0A 4NMXA 1FKPB 4ES3A 1X5OA 3R1HA 2B9EA 3CJ8A 1XC9A 1OS5A 2E7VA 2VG7A 3T6BA 1BQMA 4DCJB 4FXVA 2R9LA 3BPSP 4ZP6A 5HBMA 1Q81T 4M5KA 1RTHA 5I3UB 4XTTA 1S1WA 4F4ZA 3V6KA 2FQQB 2CQDA 3DLJA 4RUCA 3IRXA 4DI6A 3NNHA 1TUGB 5HVGA 1YITS 4Q8EA 1SJ1A 2Z2ZA 2WW8A 1RUSA 4CLSA 9ATCB 4JI5F 4LFBF 2AYEA 1HD1A 2V68A 1S5ZA 3TX0A 4BBYA 3M6WA 4C3MA 3QZ7A 3VAIA 3O44A 4FS1A 2J9DA 2G0IA 3J7Z5 4F3MA 2HHSA 3KK2B 2DJWA 2OPPA 1Q7LB 5HAOA 4UOGA 3I56S 2GQQA 4Q0BA 1EX8A 3J7A1 1HLWA 4J7CA 1FKAF 4DQPA 4ILMA 3MEDB 2MLZA 1LK5A 5EWFA 1N5YB 1YRUA 4JI1F 2Y9HA 1TELA 1IBMF 2DB1A 4FF4A 4C0OC 1RE1B 2YWHA 3BKUA 2CAJA 2O01C 3CDBA 3JQMA 2EG2A 5HN0A 5JUMA 4B9NA 2MJUA 2MDAA 2DTJA 2R7VA 1U1NA 1CEZA 2M3DA 3Q24A 4WIQA 3SZ2A 2W2MP 4P75A 2KFZA 4DR2J 2BX6A 1CJVB 4WK3A 2LP4A 1KTQA 2JSXA 5DM7Q 4TYBA 2W8LA 1UEKA 3NGKA 1FFWB 3PKYA 1ZM9A 2VQEF 3TARA 1S76D 1KRPA 1V3SA 2DK2A 5HLFA 5A6PA 3GYNA 1I51B 1NKBA 1EARA 1HNVB 4NMLA 1NMEB 2YX4A 1SL0A 3H0PA 3CCWA 2O5DA 1S48A 1UAWA 4DV3F 2CPZA 2DR7A 5J2QA 1RWVB 2LQ8A 1U0SA 4IRDA 3EYZA 2FHJA 3QLHB 5CABA 4LF6J 1TL3B 2H48B 1FE0A 3MUMP 5FD1A 4QW8A 1URNA 2R7SA 1DHMA 4OI6A 2Y1IA 5DGAA 4B3SF 1FJ7A 3JB9k 2HNZB 3BO2A 4RO0A 4F36A 2B43A 1WI6A 4MK8A 3D2WA 2ZH5A 2ZJQQ 2HIYA 5B0BA 3CJ2A 1AFIA 1D3WA 1TUVA 2I6WA 2UU9F 4NXMF 3TZXA 2NUHA 1O6XA 2V8DA 1S6QB 1KDNA 1BXNA 3OL6A 3MCSA 2Z8QA 3TVZA 4YS2A 1JJ4A 1IM6A 1F5BA 3UR0A 1X4BA 3DI6A 3GMGA 3IGNA 3EZ5A 3PEJA 4JV1A 1KQFB 1UJ6A 1H98A 2AJ0A 3PJXA 2QFIA 2QZ8A 2E5LF 2ZKTA 2DH7A 3K2YA 3KMSA 3Q8UA 4A46A 2KZZA 1H6KX 3CJ5A 4WU3A 1OJ4A 4HHUA 4DV0F 4O0NA 3FFIA 2XLKA 1NB7A 3G82A 5GADU 3KK3A 5EWGA 4HI2A 2ZWPA 1BHNA 1MROA 3IM9A 1ZOTA 4DLEA 4WKRA 5LT5A 2XGQA 5F8NA 4KYZA 3ENVA 5JJBA 3I82A 1WORA 1Q4RA 4DR3J 4O4GA 1T9XA 4RW8B 5DQIA 3KLGA 1N56A 3LGMA 2VH7A 4Q7AA 1ZBTA 5RUBA 2QIFA 3SQGA 1P27B 4ZK7M 4H4KA 5HQMA 2ZBCA 4K4TA 2QL9B 3KYLA 3MURP 2FB0A 3R5JB 4C97A 3TZZA 4FYWB 4DPXA 3Q22A 5AXMA 1IR1A 2I9SA 3MM6A 4XPEA 2H54B 2D41A 4I6AA 1Q79A 3ZTRA 2J6UA 2QLFB 5KTQA 3L3CA 4LF8F 3B78A 1S97A 4CTAB 1Y5NB 2QSFA 1X9MA 1K47A 2FYXA 4M5LA 4P2SA 3QSYB 3PX4A 5BYQA 1EAYC 4QWAA 1X0PA 1RTZA 2R7XA 2MY8A 2W24A 2B51A 3VVUA 2VICA 3R5BA 2DNGA 2FLOA 8RUCA 1LNQA 3UCUP 4JYAJ 4F4YA 3T1AA 1UVIA 5AE2A 3N6NA 1J2VA 3AQPA 4ZVGA 3GTYX 2CJQA 3I5CA 2WHOA 3JSYA 2AYGA 2D1CA 1WOSA 2B3TB 2AJQA 1RWOB 4G65A 3RJMB 3OTBA 2QGFB 1CC7A 1T9UA 3FSYA 3NKYA 2QA4G 3PW2A 1Q78A 4JP8A 1RLCL 2NQPA 2ZH3A 4K4WA 4QIGA 4ZVQB 4MKVA 3W9JA 3QSIA 3MAQA 1GMWD 5KFNA 1SQFA 5B0EA 2HLTA 1DBDA 4KH0B 4YY3F 3TAPA 1R8AA 3NCPA 4K4SA 1KLMB 2XY5A 2ZVSA 1B64A 2PE8A 4V1Ak 4DDFA 1VJWA 3DRYA 2WTFA 2HFVA 4NLUA 3W60A 4ECRA 4HR2A 5GAGU 1SL1A 3D5MA 3OL8A 3KJVB 4I7FB 4F50A 4OLPA 1QDUB 3Q2SC 4ERDA 5DJBA 4LFAF 2MKKA 2YQ1A 5K20B 3ITHA 1FKPA 2W4DA 4I56A 5AXKA 5K14B 1N5TA 1AXQA 2GAHC 3CC2S 1B0TA 2B4VA 4DV6J 1JLGA 3GYGA 4PPDA 4ENOA 1HYSA 3IR7B 3MD3A 5A76A 1T9YA 2RF2A 4OV6A 1OWXA 2Q66A 1K0VA 3FUYA 1WF1A 2M70A 3MCMA 1ROFA 1O51A 1S6PA 2WAQD 4OZLA 3QT5A 4YQWA 4KR0B 2NSBA 4C98A 1P8GA 2EWHA 2RRBA 3PIPQ 1LWFA 1FF2A 1RWXB 5A8RA 3MUVP 3HP6A 2VF3A 2OUGA 2WVCA 3T1HJ 4ED6A 1YZ6A 1GT8A 2UXBJ 1HQUB 5E5NA 3LWMA 1L3VA 1WC3A 3X3UA 4BCAA 4DV5F 2GIFA 3GWCA 3M2VB 5IZHA 3JSBA 4HH1A 8AT1B 1JLQA 1DTQA 4DSLA 2PC6A 4AT1B 2RKIB 1TU0B 3D6FB 1F9HA 3J81U 5DG9A 1ZAXA 2C1EB 2WSEC 3RB4A 4ELVA 1IM4A 2LEBA 1VBZA 3U27A 4DUZJ 2W2OP 2BKOA 1X31C 5L9XA 4ZS6A 4KT0C 4L74A 1KFDA 3HM9A 2GQ2A 1EETA 1S0OA 2HS4A 2DH8A 3DOMA 1H74A 2ZOMA 2WZ1A 3C66A 1AYEA 4HH0A 3LOUA 2NXEA 2V2QA 1WHXA 2QX0A 3A8JA 2UVWA 5AE1A 2HNYA 2J5AA 1KEKA 1WOOA 3UD5A 1Q5VA 4OHVA 2XB2D 2CG8A 2KVQE 3PX0A 2D3UA 3ZZOA 4KBIA 1H3DA 2IDLA 1NDKA 3TI0A 4ID5B 2W9BB 4J9KA 1RQ0A 4GMKA 4Y28C 4Q8FA 1X4FA 3BH7B 4GRSA 4PRFA 1XR6A 3AOAA 4X4VA 1ACMB 4BLGA 2Y0BB 1SIWB 5D3GB 3MEGA 6FDRA 2C2ZB 4X62J 4PPZA 1TL7B 3LGNA 5KFAA 3BF4A 1NLKL 2YWKA 4RWXA 3H7HB 3FGVA 4NZ0A 2J6TA 4KSEB 5B0AA 3KHHA 4I67A 1VK3A 3G82B 3KK3B 4DV6F 2ZOGA 5DDRC 5LMNJ 2GHVC 2B6AB 3DLEA 4P2FA 3HHLC 3N5BA 2I38A 1NK7A 2AEJA 4ECYA 5JVGQ 2HZAA 2BJDA 4PUOB 3RRHA 4FPIA 1U1MA 1TKXA 1UEVA 2D7SA 2G0CA 3HJVA 3W5YA 2X3DA 4YUDA 1KQSR 1SQEA 2Z56B 1ZM4A 2QC3A 2FIUA 4PG7A 3NOCA 4J9RA 2ASJA 1RT6A 2APOA 2OEMA 4HVZA 4LIRA 4ELTA 5HROA 2XY7A 3WQPA 1JXEA 1ZAWA 2GCFA 4IRKA 1N33F 4FVCA 2KM8B 1C4AA 3PO4A 1TAQA 3DLGA 1JMTA 2FLLA 4OMFG 4L75A 5CYMB 1MU2B 1WI8A 2BBEA 3T9ZA 2HGMA 3L95X 3N6LA 4M5DA 2WOMA 3IS9A 4YB6A 5BYSA 2OHDA 2RDDA 4RJVA 4ETXA 5L1JA 3N5FA 1R0BG 4URGA 2HW3A 1DFDA 1S72S 2CQ2A 4C4WA 4DR5J 2G2ZA 3CCQS 2V8PA 1FRKA 2W7PA 1Q82T 2DNKA 1UPMB 1MWQA 2YKAA 4CH0S 4H54A 5C5JA 5DQHA 3KWMA 3M8RA 2C28A 1U1LA 1RTIB 4K0KF 4ZVPB 3R6GB 3GR0A 5E2QA 3SSRA 4MIBA 3TA1A 1JLBA 2JH3A 4B9TA 1F6TA 3C6UA 2WSFC 1X60A 2DXEA 5J2NA 1YBUA 5SUHA 3KNGA 3BS9A 3PJWA 2F9JA 5C42B 4RX6A 4ZPCA 3CCUS 1SC1B 2MQOA 4QPXA 2DIVA 3GPAA 3CJRA 5A2QY 2NPFA 2C42A 3UD4P 4IG0B 2DRDA 3TWZA 5GMDA 4RL1A 5DZ6A 2V9WA 3OXFA 1LWXA 2D3OR 3B8HA 5D8HB 2DRAA 1L3KA 1Q8LA 2BMBA 1HMVA 1X0FA 3GG0A 3GONA 2AX0A 3DMJA 2RJZA 2VB6A 1HMVB 2C2DA 3GIRA 2AJFE 1ZZFA 2HAIA 2GO8A 2MLYA 4XAKA 1I5OB 1P9QC 1FVSA 3BR8A 4MYUA 1Z4UA 3SCKE 1S1XA 3D0GE 3HZGA 5CAAA 3I6PA 2PN6A 2FLNA 3H5UA 3QQCD 1U1RA 1IQTA 4NLDA 2M8HA 1VQNS 1VQMS 2AJ1A 1U7LA 3CCZA 2ZDPA 2VQFF 1SV5A 1WDDA 4DV0J 3BYPA 4ZVSB 2UXCF 4B3TJ 5C25B 1LW2B 2CUYA 2FJEB 2GVZA 4JI0F 5LMUJ 3C16B 1HPZB 2DXFA 1H2TZ 2X51A 2DHGA 2YY3A 4OHXA 2NPIA 3NCRA 1T0TV 3W66A 1NM2A 1HNXF 4Q2LA 3VTIA 4OZ5A 2JLFA 5AJ3F 2HNDA 4F0MA 5EHHA 1RSCA 2LCWA 4IDKA 3S6EA 2Y0SD 3M6XA 4HHJA 1XJWB 4PG6A 9RUBA 3RB3A 2G13A 1R3NA 3V6DA 1A0OB 1G2EA 2J76E 4LFCF 1HYSB 1NZAA 4DX8H 4QIWD 3BKTA 4NXNJ 3IS9B 3M8PB 2IMWP 5HP1A 5ITHA 2W7OA 2OPRB 1OY8A 1ITPA 3CSKA 4P73A 3D67A 3CD0A 4LSZB 4CO0A 2DGXA 4CLTA 3UI3A 2ADBA 3ENWA 2HMIA 5D4NA 3OVAA 3KNAA 3AHPA 4LF6F 1NO8A 4I2PB 1U1QA 4BDPA 1D9DA 1X7VA 4U95A 2IY5B 1GMVA 2XQCA 2DH9A 2ATLA 1Y4ZB 5LJ5Y 4HEA9 2BEFA 3IN5A 4C8ZA 3EWGA 4OZ0A 5D15A 4CWBA 1RWMB 1QVFR 3KXDA 5L39A 3W2VA 1HBUB 2DXDA 4NLSA 2HHHF 4FF1A 1QJHA 4LVNP 2MKHA 2ZH7A 2GMHA 1QY7A 2BQUA 1CC8A 2O3DA 1SV5B 3BV8A 2KHDA 2QO3A 2A6MA 2IAJA 4NLOA 5LSLA 1UVKA 4Y0FA 1H7WA 4ALZA 4CCHA 3DOKA 2AF6A 2JOQA 1UL3A 2DGWA 3BO3A 2FVSA 2BDPA 4RBVA 1UVNA 2HQFA 4ZDNA 1RBOB 3GB0A 2AU0A 1PJ5A 3LUYA 3MTKA 2VPYB 4P7VA 1SJQA 4F3OA 2N4CA 2CJBA 4LSLA 1QTNB 2I5JA 3MAAB 5A2QU 3PW7A 4C8MA 1JLCA 4I4BA 2VOPA 4IQMA 3MUTP 3BSOA 2O67A 3D68A 1YZ7A 2BANA 5CCLA 3RYLA 4J9PA 2GVDB 4EU0A 1CULB 3PFOA 4C0BA 4Z37A 4ID5A 4ZP7A 2W9BA 3CW2C 1HWJA 2HMIB 2J7KA 4PG4A 2AQ4A 2YWWA 3CJTA 1JLEB 2ZBQA 4OX6A 3NS5A 3W2WA 3ZNJ1 2LQ5A 4DPOA 3DLKB 3MEEB 4N47A 3KLFA 3MWBA 2XCAA 4IH6A 4TXSA 1VQSA 1VBKA 1WSRA 3OHAA 1N6QB 2FJXA 4V19J 1G1XA 2CQBA 2AGPA 4KHPJ 1HBNA 2BANB 2FDNA 2V9KA 2WBMA 3O3LA 3FQLA 3JYTA 1LKZA 3I87A 2XZDB 4NZ7A 4MMOA 3POTB 2XC9A 4LSLB 3UWTA 1RHMB 1NSQA 5A8WA 1U1PA 4GKJF 4RW8A 1PC4A 4W4MA 1TV6A 1LWCA 3UD3P 2MQ8A 2DHXA 1NSAA 3TR5A 1Q8IA 3OR2A 1RT2B 3PW5A 4OJGA 4O0IA 4OI4A 2LKZA 3BYRA 1XMOF 4LREA 2IAJB 2UXCJ 4USVA 2V2KA 2IVFB 2IM2A 4NI2B 4C11A 3CF5Q 1EQ0A 4S0MA 5H9FK 3RR8A 1IBKF 3CJKB 2V5HG 4R5PB 2ZZNA 1WG1A 1RTDB 5CYMA 1S0VA 3ETOA 2KO1A 4B9MA 1LXJA 3M8QB 3DM2B 3R5DA 4ECUA 1F9EB 1HQEA 4A8WA 2VJUA 3DI6B 1FJCA 3G96A 3D1QA 1S6PB 3KFWX 2CPXA 3PHTA 2FY8A 2VD3A 5CYJA 5EWEA 3KK1A 4AD6A 1TKXB 2W4CA 1P1TA 3HD2A 3TEGA 4LVOP 4X66J 1UVLA 4QW9A 2YKNA 2F8HA 4EI2A 1FHTA 2C2KB 3NWGA 1R0CB 3MPVA 1TK0A 2ZKUA 3PDNA 3BQ2A 4ECSA 3NL0A 2M5YA 4DL2A 3IM8A 4X66F 5F0UA 2LQJA 1XNRF 5AJ3J 2HVEA 3DCAA 1RAAB 3VV2B 5HMXA 3HHDA 3F41A 1QE1B 3B4DA 3B82A 1TL7A 2E1RA 3HFKA 2RQMA 3ISND 4ZP8A 4OZ2A 4I2QA 4F04B 5J1EB 4Y2AA 2XTJP 1RHUB 1ICEB 2VFRA 4K4UA 3DDIA 4WCEQ 1HHQA 3I32A 2YPZA 1X4DA 1CVJA 3QFWA 4DV7J 4EUVA 1FO1A 2OGUA 2GVZB 3TJAA 3IWLA 2RDIA 3FZBA 2ZHBA 4ZPTR 2ILYA 3QT7A 3KUEA 4LF9J 3U7JA 4RUBA 2BW7A 1RBLA 4USTA 2KL8A 4WU2A 4GKKJ 2VQEJ 3C15A 5HJYA 3CJ4A 3AD7C 3HDSA 2HNYB 7FD1A 5HVFA 2IDEA 4F4KA 3ZFVA 1TR0A 5HJXA 3RGIA 2A10A 2AKWB 3GJTB 4MTPA 3JAMY 3EXCX 5KT4A 4WFBQ 1NJYA 2XM3A 2A1BA 1WELA 4RW6B 1SH2A 3L7UA 3IR6B 2EBGA 4ILRA 2NYIA 4LRDA 4ZJOA 2ZHAA 2KZMA 4Q44A 2F4VF 3VAJA 2JLGA 1I94J 1SH0A 2AMCB 3MEDA 2HVIA 2OH2A 5IT9U 4NXMJ 1K1QA 4ZN1A 4FNIA 5HL7Q 4CYUA 4CTAA 3R1LA 3OUYB 2YNGA 4DU7A 1T05B 2Z2YB 4KIAA 2ZH6A 1KVIA 5DZ7A 1HNIB 3MM6B 4DSFA 2HRTA 3UW1A 2KRRA 3A4TA 1VFJA 2VFSA 4HYKA 4I1TA 5BXIA 2BV3A 1KS2A 4NLTA 1VQ9S 1KQKA 2QMWA 3QATA 1QSYA 3RRGA 2X1FA 1JLBB 5GAHU 3HVRA 2DPJA 3DXSX 3BDEA 3L7OA 5FDLA 3K5PA 3MFIA 3CCRS 4C0HA 4EWTA 5CYQA 4O4GB 3KLGB 1RTIA 1WC1A 4HDHA 5KFTA 1VOMA 1CJUA 4ER8A 4NCGB 1Y3KA 1R7IA 4Y00A 2ZH1A 2RNEA 1U47A 1M5VC 3Q0AA 4EEYA 4WYLA 3W5XA 1N32F 2KYXA 2HHQA 2PMWA 3A1YG 5KG5A 2ASYA 2X1AA 1CJKB 3GIKA 3C3LA 2IM0A 2EBEA 1XTZA 1TKDA 4L6V3 5IWAF 4IFYA 2H5JB 1M5OC 1ZPWX 2CWKA 2VL1A 5HSPA 2IC3A 4K8RA 4WP3A 3ELHA 1C4CA 2R7OA 1FWPA 4ZVRB 1IWAA 3SQOP 1FFGB 4DS5A 1EP4A 3CIZA 4RBUA 2HFSA 2EW9A 2RQ4A 1C1CB 2CVIA 2WVEA 2R4FA 2ZOFA 3LA0A 1XBWA 4ZCKA 2CG4A 3UPFA 3KLHA 1KKHA 2OO4A 4DUZF 1IBMJ 1UJ4A 1HWUA 1FKOB 2YKPA 4E98A 1FXLA 2G4BA 4QWCA 2PEHA 4IYQA 1RTDA 2I2YA 5KFWA 1HQ2A 3DDNA 1S79A 1OSDA 2F65A 1QAXA 4X4SA 4JI7F 3D7SB 3GILA 2B6AA 1FJEB 5KFXA 2KDOA 5T7LA 1SI9A 3NRBA 4P72A 2MQPA 1CBKA 3CD5A 3OL7A 2Q43A 3W64A 3CMAS 3IBFB 2MXYA 4DL6A 2UXBF 2MMYA 1RT2A 1U49A 5K8PA 1SUQB 3A12A 1RP5A 3D6TB 2GHWA 4CO4A 2N82B 1N8RT 4WXWA 1B3TA 3RW6A 1D09B 1O5JA 1WTBA 2DGTA 3TNVA 1HW9A 2M7SA 2XMJA 5D3GA 1GX5A 1VRTA 3SCLE 2M88A 2AJ4A 2JFDA 3HD1A 3D3BJ 1XN9A 1TVRA 4ECXA 1IR2A 3JS9A 4OJ3A 3ZO7A 2ZBPA 3QNWB 1Y0HA 2HFNA 4QR1A 3VAFA 1VRQC 2DYAA 2Y1LB 4KGVB 4OYIA 3M32B 2M8DB 3K0JA 3MMAA 1TTHB 4FKXA 3R7BB 3GYXB 4FYYB 2MQQA 3SYZA 4WF9Q 2LXFA 3HVTB 2UUBJ 2R8GA 2RUSA 4LUBA 4OI3A 3QWUA 2H1YA 4LT6A 1WACA 1ZTWA 1FWLA 3EGVA 5LL6d 1WD6A 4AL7A 2GGPA 4DOZA 2XHWA 3NS7B 3GCXP 3NGDA 1YJ9S 3NMAA 2ZH8A 4N8OA 1VBXA 4AXJA 2AZ1A 3UN5A 5M2UA 2IPOB 2K1RA 3OJUA 4EYHB 4OYWA 4EBEA 2QMXA 3OFHA 4KE5A 3KG0A 4M5IA 4ZJLA 4PXCA 3DOKB 3FEZA 2BQ3A 1AZSB 4KV8A 3TUZC 1ZA2B 3M2VA 1UKUA 2LEPA 5E3QA 1RCXB 3V6JA 1S1TB 5F8HA 5I3QA 3M8ZA 1BWEA 1B0PA 2XG8A 4MK9A 3UQSA 4CM2A 3H8YA 1I6JA 2XMKA 3W2VB 2LXIA 4O3PA 2HYIB 3BBFA 5AE3A 1X4HA 4QYZJ 2DGOA 1TFYA 2QL5B 3SDEB 1GFWB 1H2VZ 4FPRA 3KLHB 2B9XA 1FI4A 4F2SA 3OFEA 4K4XA 1TMMA 1N0VC 2HK2A 3M1VA 3QAEA 2XLJA 1SKRA 3H2VE 3K5LA 3PV8A 4C9DA 3AOCA 5KG3A 5C7PA 4MFBA 1U1KA 2JC0A 3MGJA 4YOEA 5L38A 2CJKA 4QR2A 1YVFA 2HPUA 2JEJA 1RU2A 3I0SB 4LFAJ 1G3OA 1FK9A 3HJFA 2E29A 3G6YA 4JI3J 2QV6A 2F4FA 3DGPA 2EC2A 2HNZA 2F40A 4KQZA 3RG6A 2C2EA 5EX0A 1CPZA 1PBUA 3DGVA 4NA2A 3DFEA 1VC5A 5HMYA 1NAQA 1VRTB 1RKJA 4TLRA 3UCGA 5IC4B 2LU2A 1LXNA 1IKWB 2FVPA 3P8BB 2JNJA 2JZ5A 3R5CA 2MZ1A 3H90A 2G9OA 3OR1A 1H2UX 5EGYA 4IUFA 2E5IA 1EB0A 5HLFB 1RCOB 2ZHOA 5HQLA 2OMLA 3IC1A 4NOHA 4MAKA 1WHVA 3VVTA 4CH1A 3HT3A 1HNIA 3CC4S 4OX9J 4RW9A 2LQ9A 1EKSA 1KTVA 2DNNA 2OMOA 1U09A 2DHSA 1U0HB 3LGHA 3IRWP 4LFCJ 3ZTSA 3S1TA 2VV5A 3V6HA 4QIVA 3TRGA 4OZ3A 1BWVA 3O1LA 5KT2A 1FKOA 1HHTP 1WKLA 1VCTA 2BUNA 2N3LA 3KHGA 1T9WA 1QVGR 3UDEA 3MPUB 4NCAA 4RBTA 3ET6A 4WE1A 4WBFA 2MTLA 1M1HA 3MR3A 2XY6A 1X9SA 5I4MA 2CZ4A 2MSTA 3FBCA 5HVHA 3LP1B 3BGUA 1HNXJ 3MXHP 4B3OB 4WFAQ 2CPFA 4WFZA 5U47A 3G6XA 1Q1KA 3HF5A 4Y2IA 5FJ4A 3AJ1A 3EMTA 2KFYA 4RLEA 4JI7J 1XMBA 2GJFA 2NUUG 2DEJA 5KFVA 3BBCA 3M7VA 4B3MF 3CDWA 4ZHRB 4DN0A 1ZYQA 2N7CA 2XS2A 4PWDB 4YN3B 1WC0A 2VU5A 2OJ3A 2QLJB 2QG9B 3HKZD 2HHUA 5T41A 3T41A 4CLLA 4QR0A 4UOFA 3JXOA 2Q1LA 4DZ6A 3HX9A 2VPWB 2KH9A 1N88A 4OJHA 2BJ9A 3HO1A 3LPYA 1U45A 4Y2MA 3NNAA 1SPBP 1N0UA 2ZUAA 4ZLPA 2I8EA 5J1EA 1RAGB 3HFVA 1U6FA 1LEOA 4H4OB 3BB5A 1U48A 1QM9A 1IKVB 2IJNA 1HIYA 3M2UA 4B08A 1QD1A 4AQYJ 1N4LA 4FBTA 4PWDA 1OPZA 1V5IB 2VBXA 4ZHRA 3W9IA 2E5LJ 5JVHQ 3FVYA 3JSMB 1KD1T 4V19X 1ZH5A 2XHCA 2O66A 3AQOA 3R3TA 5KT7A 4W90B 3G8QA 4EFAC 1RT7A 4J9VA 4U6PA 4LF7J 3W65A 4CIOA 2KFNA 3LP1A 1YDLA 1F60B 3R2DJ 2DNMA 4XDDA 4CLPA 1KONA 4URQU 4AE5A 7AT1B 4ED3A 3DOLB 4I64A 4KY3A 3RW7A 1RT6B 2VBWA 1T11A 1BY9A 1NRKA 3R5AA 1DTTB 5DO2A 3VZIA 4GC7A 3T3FA 1VQ8S 1PYSB 4M63A 5ETPA 3M05A 2OTLS 1TFWA 3MF5A 1FA0A 2B5JA 3FK4A 1U2CA 2Y3YA 3LP0A 1HW8A 5IS2A 2CQ4A 4MYTA 3UDCA 2UUTA 5KFLA 4IOAQ 1RWUA 1S1VB 2CWXA 4NI2A 4C11B 1S9GA 1TMJA 2YBVA 1JJCB 1R43A 2OSRA 4C3KA 3A8KA 3BREA 4DR7F 5DLGA 2HKEA 2VFUA 3W7BA 1C0UB 2ROGA 1Z2LA 2YNHB 2VKZG 4UT4A 1FEEA 2HHTA 4WIIA 4ZVTB 1Y9OA 2JL9A 4F4WA 4F67A 2FZGB 2YNIA 5L8RC 3UDVA 2RMLA 2IHR1 4QU6A 2W25A 1GXTA 3POTA 2WVDA 1HNVA 1SKUB 2C3YA 2L48A 3AFGA 4JI6F 2DR8A 4QBUA 2PGCA 2R2TA 1WC6A 2OAUA 2BZ2A 1PCAA 3F73A 2Z2LA 1S4FA 1YKWA 2XWXA 3DGPB 4WYWA 2KRBA 2OPQA 3W5ZA 3EDQB 4DSKA 3P45B 4DV7F 3TQEA 5K5MA 3IR5B 1FTRA 1LWEB 3C46A 4G3IA 3TP2A 1HBMB 5C2GA 1MN9A 3T5LA 1U02A 1YJRA 4OIXA 4JB8B 3A8EA 1CS4A 4OI1A 1RABB 2JDJA 4IO1A 1EETB 3DRRB 3DOLA 2HWIA 2V8VA 3MAHA 2EKYA 2J7WA 1JLCB 3HLUA 3ZZYA 1K8AT 1REGX 2XS7A 2I5JB 2G0JA 3MAAA 4C8OA 2K3IA 1RKIA 3KDOA 3OTDA 4M1KA 4DX7A 2AJ2A 5A8KA 2RT3A 2F63A 3BSNA 5THWA 5HATA 3UNYA 2IYIA 4AL6A 1S1TA 4Y2CA 3OPKA 3UCZP 2HQDA 3AXMA 2ACYA 2ZZTA 4W92B 3KK2A 2WVBA 1S59A 2WONA 3OQ2A 4DPWA 2WRMA 2YTCA 2DR9A 3D0IE 1XNQF 1C0TA 1R27B 2AX1A 2ALYB 2K1RB 2O1PA 3EGNA 4USWA 3GIIA 1QLNA 2DCUB 4X65F 5A8WB 2VUGA 1F3VA 3MI7X 2L08A 5AXLA 4M5GA 3ZTOA 4HI1A 4K4VA 3GR1A 1HARA 2MQNA 2RQKA 4HLBA 5GADI 4X64J 1NK4A 3NBPA 3MM7B 3QO9B 1HI1A 3LP2B 1FX4A 5B0GA 5DLFA 1YSJA 1PIEA 4OLOA 4G6VB 3NXZA 4DFPA 4N5SA 4ZKAA 4NX9A 1WHYA 3V5RA 4DF4A 2A2DA 4C8LA 4PXEA 1PKUA 2K2PA 3HULA 2CFXA 1JX4A 1HR0F 3I4HX 4RU9A 2EEYA 5F9LA 1VQ5S 2UP1A 2P8IA 4E2FB 1NSKL 4J37A 4K7QA 2XMUA 3NEKA 3R7SB 2RQCA 1E6YA 4ECVA 2EG1A 3QGGA 3V6DB 2BR0A 2AP6A 2FLPA 3KJFB 2OD4A 3LAMA 4P2MA 3WX4A 4IDKB 4DCOB 4KHPF 5GMKa 4FDFA 3CIMA 1Y3JA 4ECTA 4I69A 3F56A 1VMBA 3VAKA 4O4RA 2FHOB 2RB7A 1JKHB 2RE1A 4DV4F 4A8QA 1NKCA 2CIMA 1FCAA 5J2PB 4RNNA 1YGYA 2KM8C 1N34J 4PXDA 5F8JA 5I3PA 2UV8G 3M9OB 1GXLA 1U0HA 3C16A 3W3SA 1KHVA 2R42A 5KFHA 1ZPVA 5FLXY 1S9GB 5L1KA 1OPIA 3ILJA 1U25A 2RVJA 1DY3A 3BH6B 5IOLA 2UUBF 5D78A 4WWSA 1GTEA 5B0FA 4DUTA 1YRXA 1ELOA 3CO9A 2VG5B 3O2IA 2X1GA 4Y65A 4YR3A 4K5SA 3J7YU 3CMQA 2XNRA 4K50A 1FRJA 2OSQA 3EJMA 1EP4B 3WIUA 2BJ3A 1X4EA 3UR3C 3T9NA 2ZFHA 3C8YA 3US5A 1NUEA 3KG1A 3ZZRA 5L46A 3KLEA 1M5PC 4OHYA 2XZWA 2Q79A 4Y3CA 2LA6A 1DQAA 3TA2A 5IM0A 2DY1A 2QLWA 2FD2A 1HI0P 4X4QA 3JSMA 3I9V9 4HACA 2HHHJ 1RXOB 2J0QD 1CJKA 1FXRA 2HGNA 2HRUA 4CLWA 4DR2F 4EZ9A 3DRXA 3J81Y 5KOXA 4OI0A 1UETA 2MKCA 3VGVA 4WTOB 3M6VA 1HI8A 3F44A 3PZPA 1OY6A 1EZZB 1CQNA 5E3RA 3S8SA 4DSIA 2CDQA 4NLVA 4ZIWA 4NLGA 2GNKA 1FNMA 3PR4A 1F2HA 5KFBA 2R7WA 3IG1B 2B56A 2EFOA 3FRYA 4CLYA 2QJ3A 2KJVA 1HPZA 1NK9A 3QRRA 2OPSA 2HLUA 3FJ2A 1XNRJ 2B0GA 4ZVFA 1HWKA 1RT5B 3DRPB 1L3UA 2BM1A 4JI2F 5E41A 3K58A 4NXNF 5D6GA 3PO5A 2JHEA 2J8SA 1S1XB 1IBCB 4RR5A 5ETVA 4CQ1A 3CDUA 2EK6A 2XBPA 1RHRB 2HRYA 3PFEA 5A8KB 2J7UA 1NB2A 1CG2A 1BQNA 2CPYA 4P71A 2XMWA 3HKWA 4PYDA 4CO2A 4DG1A 1RWPB 1U8SA 1RHJB 1FRLA 1VLYA 3ETMA 5IT4A 3D9BA 3GIMA 1MSWD 2HBYB 1DLOA 3PYDA 5EN1A 1RB0A 5EDWA 1K44A 3RAMA 3PW0A 1TKZB 2V0NA 4KRWA 3GV7B 2HQCA 2VG5A 4TVAB 5E3CA 5LSRA 3OVSA 1IBKJ 4DL0C 2JEFA 2ZM6F 1M5KC 3MMBB 2BYCA 2H9ZA 2LECA 1FRXA 4DQQA 1SVDA 3L7PA 2UVVA 4KGKA 3R9LA 1VQPS 5D0RA 2E9ZA 3MCNA 2MY7A 3D66A 1VRUB 2K8GA 1WKKA 2OKQA 4KH1B 2CPJA 2AEFA 3ZXWA 5GAEU 2MSSA 2DNZA 1M90T 3CCVS 2MZQA 1M0SA 1U24A 2OP5A 5B0CA 4PXBA 3SV3A 4PQUB 3OBIA 4IOBA 1WF0A 1U2FA 3D4JA 1VIOA 2AYMA 2HBZB 2EFPA 4ID8A 2JJ4D 3CE8A 4CLUA 5F8MA 1YJNS 1VRUA 3FMWA 3KKFA 4JOUA 5DM6Q 1RT1A 2UU9J 2UVUA 3N01A 5T7LB 2YKOA 2UUWA 3OHBA 4NYPA 1QSSA 4FF3A 2Z4PA 1SCJB 2JWNA 1XEZA 3JTNA 1C1BA 3D0HE 1U2RA 2B5JB 3AA8A 3MMBA 4NLWA 3ZZPA 5DGBA 3Q8QB 4UQTA 1HKAA 2ZBRA 4DQSA 2ZH9A 4LF2A 1UTAA 1IUJA 3BJYA 2ZM6J 3A8IA 3NBPB 1GTHA 4J9NA 1DLOB 1ZETA 5KFFA 4LF5J 1NK0A 1ZTTA 4NYZA 4B3RJ 1MN7A 2BXJA 2F1FA 2PA8D 3JQJA 3O8WA 3BM7A 4DN9A 1FDDA 1FD2A 3VAHA 3EGZA 2P5VA 2XULA 3OTOF 1IKYA 1RAJA 1S9EB 2BRKA 4IFYB 4NYOA 4DR4F 3CCES 1GEHA 2P9CA 3DYAB 4RWWA 2RHSB 2WK4A 2YKQA 2DO4A 1XWLA 3TEHB 1MNEA 4ZP9A 3TVYA 5DDOC 2W2NP 4OX7A 5M2RA 3HHEA 3W61A 4DFMA 4H4OA 1D8ZA 1HHSA 4IR9A 4JV5J 1U6ZA 4RNMA 1F3FA 5GAEI 2IIHA 4IO9Q 1RAIB 1APSA 3IG1A 2RS8A 2XLIA 2FVCA 3DRSA 5KAKA 3M6UA 1FNXH 1T9TA 4AUKA 3S01A 3JYTB 1S0NA 2WW4A 3DRRA 4LRAA 1W25A 1WG5A 3QT8A 2H51B 4KKOB 2HHWA 1VC0A 2XGPA 1H0HB 1NJIT 2XNQA 4OI2A 4X4RA 5JMNA 2RF2B 4UOCA 3HHNB 3EGWB 2VDHA 3PRBA 4U8VA 1KQGB 1S12A 2B4UA 2NS1B 2JRSA 3HFZB 5LOQA 1T05A 3C2PA 4O44A 2CRLA 3EUNA 5KFCA 1N34F 4DF8A 5KG6A 4DXLA 1HBOB 1RT3A 4TKTA 4DV2J 3MM9B 2MKJA 1JWWA 4NLYA 1CULA 1HA1A 3OXLA 1JJHA 3OXGA 2AD9A 1N36F 3JAMU 4P6QA 3QMQA 1VQ6S 1BGXT 3WIVA 2ZH2A 5H9EK 4KC5A 2C3PA 1FJGF 3CMES 5KFDA 3EICA 1J5OA 1AROP 3CB4A 2I1RA 2YX7A 1ZA1B 2FHMA 3ZZZA 3DNCA 4KO0A 1DRZA 3OSPA 5DQGA 2CQ0A 3CCLS 7FDRA 3DN9A 2WCXA 3THPA 4WFNQ 2QLXA 2RU3A 2CQCA 4J9OA 3V4IA 3PW4A 1HNZF 4GKJJ 2HZVA 3H5XA 4DPYA 1SB6A 2D9PA 1KFSA 2PIIA 3Q23A 4DV1F 5ADZA 3IXQA 1YRTA 3NAIA 4HKQA 4RW9B 3ADAC 5KG7A 2E1AA 2GIRA 2GIQA 2KI2A 2W2PP 1WKJA 2Y1RI 3IBWA 1N5QA 2BJ8A 2E1MC 2M4MA 2H4WB 3NGTA 3PTWA 2D9OA 4TYAA 5KFPA 1NJWA 4DX5A 3MOJB 2GC8A 3QIDA 4HTJA 3PXGa 4B3OA 2HFZA 2OELA 1NPPA 4ZVOB 2M9KA 4OYZA 3LANA 3PCOB 4KO0B 2PEBA 1KN6A 2XMTA 1C1CA 2AIRB 4CZCA 2DNPA 1G7CB 4RW7A 3OLAA 1DQ8A 1E6YB 2ROEA 3O5TB 1IXKA 3CDEA 2MGZA 1T9VA 3WBZA 4J9MA 2IJFA 3M2RB 4ZVUB 4A8XA 1QAJA 2FVRA 3MM9A 1S0MA 5D4OA 1KHWA 4O3RA 2E1CA 1TZ0A 2MZJA 4Q45A 4O44B 1AA1B 2GO9A 3C19A 3SCIE 1NDCA 3M2RA 4ECQA 4AL5A 1RHKB 2F7VA 4OZ1A 3M2UB 5FLXU 2VONA 1YJTA 3JTPA 2RD5C 1X5SA 2RILA 2RIJA 3BBBA 2RH3A 3HVWA 4LF1A 1CJUB 4WZMA 4OYMA 2AEMA 3I0RB 5HQ8A 4I0WA 4X4OA 4AYBD 3HI9A 3RBZA 3OTOJ 5LMUF 1VQOS 1BD6A 1HQEB 3JQKA 4DBQA 3CCTA 2NREA 4ZLLA 1G4CA 3E8OA 1WC5A 3THTA 3RAQA 3ILOA 4XIUA 2W9CA 4DFKA 2GAGC 1M1KT 5C25A 4F7VA 3M9NB 1MROB 1UMJA 2D69A 2EFGA 3J81j 4DQRA 2Y1JA 1YJWS 2N3OA 1AZSA 3FBEA 3HSGA 4QJVA 4DL5A 2RHQB 3K8VA 1XQIA 4QWBA 2YKMA 3M8YA 1TUWA 4MKBA 5J1PA 4RKUC 4CH7A 5H9FJ 1OYDA 1J5OB 3NGSA 1SC6A 2QA4S 3KDNA 2JVOA 4J9SA 2B9WA 4ZA1A 5KFGA 4KAIA 2DNHA 2ZITA 4DR6J 3CXCR 4IH5A 3QT6A 4A47A 1V3ZA 2DNRA 3GFXA 2A18A 3HVTA 4PCQA 1N52B 4ED4A 1IR0A 5CD4H 3RBDA 4RPFA 1XERA 3MMAB 4BC7A 1LWEA 1C1BB 1MMLA 2IBOA 3FCVA 2VPZB 4H4MA 2ZNYA 3H59A 2WVFA 1NPKA 1NH8A 2Q6CA 2GVDA 1S6OA 1XR5A 3CGIA 4NRTA 3TZYA 1PC5A 1B0VA 4OJ1A 3VQTA 4X64F 1VQ4S 2LDYA 1QUPA 3BR9A 2MB0B 2EFVA 2V4RA 1PG5B 3FRZA 3D1OA 3OD2A 4DR5F 2DCLA 3AOBA 5D4PA 3T6JA 5J2QB 3A13A 4RNFA 3TANA 1Q53A 4ECZA 5KFQA 1FXDA 4A8MP 5H1SV 4UUWA 2ASDA 1RYSA 1K73T 3CCMS 4B9SA 2ROPA 4F2RA 2QN6B 3V81B 1O0PA 2ZD1B 3DLLQ 2CPEA 1Z1ZA 3HPOA 4R0JA 3V4MA 3H2LA 4RU2A 2CA9A 2VPXB 4ZLNA 2Z0GA 1AUDA 4ED0A 2DPIA 4FXDA 3D3CJ 2CNOB 5SZTA 3K57A 4EYIB 1NDLA 5D4LA 1CJVA 1DAXA 1Y11A 2QE5A 3I9ZA 4JI2J 3MMJA 1A9NB 1L3TA 3QPIA 1B7YB 1NCLA 3QGIA 4DMZA 3J7YI 4U7UK 5IT9Y 2CQPA 1DTTA 3Q2TC 3M1VB 3HCXA 3VWSA 3HHLA 1B70B 2C2MB
chains in the Genus database with same CATH topology
1I51B 2XZDB 2H5JB 1NMEB 1IBCB 1RHMB 2HBQB 1SC1B 3R7NB 1RHRB 1RWVB 4ZVRB 2H4WB 1RWPB 1RHJB 1RWKB 2CNNB 2H48B 2HBYB 4ZVOB 3GJSB 2QLBB 1RWXB 5IC6B 3D6MB 2XYGB 1F9EB 4ZVUB 2XYHB 3P4UB 3IBFB 1SC4B 3D6FB 2C1EB 1RHKB 4ZVSB 1BMQB 2QLJB 2QL7B 2HBZB 2C2KB 3QNWB 2C2OB 2CNLB 3R7SB 2Y1LB 3KJFB 3KJNB 3R7BB 4DCOB 1RHUB 1ICEB 1PYOB 2QL9B 3NS7B 2Y0BB 3R5JB 4DCPB 2C2ZB 3GJQB 4LSZB 2H54B 4DCJB 2QLFB 3R6LB 3D6HB 2FQQB 3SIPB 1I3OB 1RWMB 3GJTB 2CDRB 2HBRB 3GJRB 1SC3B 3IBCB 2H4YB 3KJQB 2QL5B 1GFWB 2H5IB 2H51B 4ZVTB 1RWOB 3RJMB 1RWWB 2CJYB 1QTNB 4ZVQB 1RE1B 2H65B 1RWNB 2XYPB 1PAUB 2CNKB 3EDQB 3P45B 2P2CB 2CNOB 1QDUB 2DKOB 5IC4B 2CJXB 2XZTB 4JB8B 4ZVPB 5K20B 3EDRB 3R6GB 1RHQB 2C2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I51 B;  2XZD B;  2H5J B;  1NME B;  1IBC B;  1RHM B;  2HBQ B;  1SC1 B;  3R7N B;  1RHR B;  1RWV B;  4ZVR B;  2H4W B;  1RWP B;  1RHJ B;  1RWK B;  2CNN B;  2H48 B;  2HBY B;  4ZVO B;  3GJS B;  2QLB B;  1RWX B;  5IC6 B;  3D6M B;  2XYG B;  1F9E B;  4ZVU B;  2XYH B;  3P4U B;  3IBF B;  1SC4 B;  3D6F B;  2C1E B;  1RHK B;  4ZVS B;  1BMQ B;  2QLJ B;  2QL7 B;  2HBZ B;  2C2K B;  3QNW B;  2C2O B;  2CNL B;  3R7S B;  2Y1L B;  3KJF B;  3KJN B;  3R7B B;  4DCO B;  1RHU B;  1ICE B;  1PYO B;  2QL9 B;  3NS7 B;  2Y0B B;  3R5J B;  4DCP B;  2C2Z B;  3GJQ B;  4LSZ B;  2H54 B;  4DCJ B;  2QLF B;  3R6L B;  3D6H B;  2FQQ B;  3SIP B;  1I3O B;  1RWM B;  3GJT B;  2CDR B;  2HBR B;  3GJR B;  1SC3 B;  3IBC B;  2H4Y B;  3KJQ B;  2QL5 B;  1GFW B;  2H5I B;  2H51 B;  4ZVT B;  1RWO B;  3RJM B;  1RWW B;  2CJY B;  1QTN B;  4ZVQ B;  1RE1 B;  2H65 B;  1RWN B;  2XYP B;  1PAU B;  2CNK B;  3EDQ B;  3P45 B;  2P2C B;  2CNO B;  1QDU B;  2DKO B;  5IC4 B;  2CJX B;  2XZT B;  4JB8 B;  4ZVP B;  5K20 B;  3EDR B;  3R6G B;  1RHQ B;  2C2M B; 
#chains in the Genus database with same CATH topology
 1PJ7 A;  2HVD A;  4WK1 A;  2XSJ A;  1XR7 A;  2UV8 A;  5D0H A;  3C6T B;  2ZH4 A;  1T7P A;  4ZVE A;  2HEK A;  2HHP A;  2D3O 1;  4LRB A;  1J5E F;  4IR1 A;  1VR6 A;  2W2Q P;  2MJN A;  2NSC A;  2V34 A;  4USJ C;  1QSL A;  2IVM A;  2CPD A;  2HWH A;  3HSZ A;  5KFZ A;  3UNG C;  5CH7 B;  5LJ3 Y;  3MR5 A;  2DIU A;  4YEA A;  4DX6 A;  3OJS A;  1SJF A;  2ACM A;  1S7I A;  3AH6 A;  2OPP B;  1J27 A;  4LF7 F;  2FHK A;  3G4S S;  4CNY A;  4KFB A;  2MZR A;  1W2B R;  5BJR A;  1NK5 A;  3TAM B;  1BE4 A;  3N28 A;  4H4K C;  2KJW A;  3TAQ A;  1S9F A;  4C48 A;  3VGS A;  2VIH A;  4F02 A;  1TV6 B;  2HQ3 A;  5D0E A;  2GZO A;  5KFU A;  4WPA A;  2IRX A;  4BWM A;  1SL2 A;  4O3S A;  2WB4 A;  1LQ9 A;  4CLK A;  5FDL B;  4Q43 A;  3NY0 A;  2YX1 A;  3HVA A;  1K9M T;  2R8J A;  2E9R X;  1UZD A;  2R2R A;  4GVL A;  4B9V A;  3DU5 A;  3FNN A;  5ETT A;  4F0H A;  4MKY A;  2V4J B;  5CCM A;  1FX2 A;  2DNO A;  3VCD A;  1NXI A;  4D3G A;  2W1B A;  4H4M B;  4FZV A;  1JLE A;  4ZPD A;  2NR0 A;  1B4S A;  1SH3 A;  4ITS A;  3HHK A;  3KLV A;  2XMM A;  2RRA A;  4A48 A;  1IWG A;  3BN7 A;  4Y2K A;  1TVR B;  2C2O B;  1WNE A;  4F4X A;  3PRD A;  4KGZ B;  2R3V A;  2VA2 A;  4KTQ A;  4DLG A;  3TW0 A;  3T1Y J;  2ABY A;  2XWY A;  4G1Q B;  4N77 A;  3N6M A;  5CZX A;  3D1H A;  2VOO A;  1D9A A;  2MPU A;  3ILI A;  4ZVH A;  1QTM A;  4ICL A;  2B4O A;  2OFG X;  1PYO B;  3Q8Y A;  5KG4 A;  1RA6 A;  2R7R A;  4AXI A;  3GSD A;  3KUG A;  3H20 A;  4TU7 A;  2K06 A;  1WC4 A;  1M5H A;  1VHI A;  1HQU A;  3T19 A;  3AB2 B;  1SQG A;  2B8P A;  4FYD A;  1BC6 A;  5J2N B;  5HMZ A;  1HR0 J;  5DG7 A;  4PKD B;  3TOQ A;  4ETZ A;  3C6U B;  3EX7 B;  2IBK A;  2YPY A;  2BE2 A;  4OX9 F;  4PQA A;  2DGU A;  2J9E A;  4TNO A;  4FS2 A;  4DL3 A;  1FD8 A;  3EPI A;  1NU4 A;  1X4G A;  3OL9 A;  4JYA F;  1QE1 A;  1A7G E;  1RJJ A;  4EGL A;  3ICL A;  1YTY A;  1WF2 A;  2PA3 A;  3KHL A;  1RGV A;  4WFY A;  1HNW J;  4TY8 A;  4C6A A;  2A0F B;  1FDB A;  4WZQ A;  2BQR A;  2VAS A;  2YQ3 A;  4HAC B;  4ILL A;  2CZV C;  4B3M J;  2YKN B;  1FRM A;  4EO6 A;  4DV1 J;  4QWD A;  2YWG A;  2MGZ B;  1PJ6 A;  3Q8R B;  5L1L A;  3H25 A;  1KWM A;  1RU1 A;  1IJE B;  4B9U A;  1IKX A;  3K5O A;  4OZJ A;  1D9F A;  2M52 A;  2SXL A;  3R27 A;  3RRK A;  1U6B A;  1RWN B;  2EFQ A;  2PD1 A;  3BGO P;  3E3X A;  3QBC A;  4XDC A;  5CYQ B;  3UVJ B;  4DPU A;  3T1H F;  1FJG J;  1FE4 A;  4U7U D;  4DR3 F;  1KLM A;  3PYE A;  4UTG A;  2V2V A;  3QAU A;  4PUO A;  3LAK A;  3LO3 A;  4YFU A;  2XSF A;  5IQQ A;  2QFJ A;  4LF4 J;  3R2C J;  2LFV A;  3K5N A;  1F5A A;  2J9D E;  5DS7 A;  4KV8 B;  2R2U A;  1M5S A;  2YNG B;  2EFN A;  2KB2 A;  2XI2 A;  3E51 A;  4M5N A;  2DO0 A;  2BVZ A;  1JNZ B;  3SXL A;  3DC2 A;  3DDK A;  2MHN A;  3TA0 A;  3TJ9 A;  2E1P A;  5H9E J;  4BS2 A;  4MIA A;  1NKE A;  4P52 A;  2QSW A;  1FES A;  4UF4 A;  1H72 C;  2U2F A;  4LMZ A;  1QUV A;  2PO4 A;  3A3O B;  3EVW A;  2GGP B;  2DBB A;  1RWK B;  2BAC A;  2DIS A;  4OFZ A;  4WP8 A;  3S7R A;  5DDQ C;  4OYA A;  2E44 A;  3OT9 A;  4A8K A;  4ZCL A;  1CS4 B;  3K7R A;  1N54 B;  3OFF A;  3MEC B;  4G1P A;  4USU A;  5CHC B;  5C2C A;  2KXN B;  2G2O A;  1VGY A;  3QWP A;  4F4A A;  3KLF B;  2R2S A;  4L73 A;  1R8P A;  3FDS A;  2L9W A;  5G4D A;  1V6H A;  5LM7 E;  2LXU A;  1SJR A;  5F8L A;  3GQC A;  4DFJ A;  3RB0 A;  4DR7 J;  2R7T A;  3WC2 A;  2CXE A;  3H4B A;  3G87 A;  2V50 A;  1HWI A;  3SBM A;  2CQ3 A;  5C42 A;  4BHQ A;  2M2B A;  3MM7 A;  3QO9 A;  5HK4 A;  1HNW F;  3TO8 A;  2HAF A;  2V69 A;  2VZ9 A;  3IFE A;  4I6W A;  4WJB A;  4C8N A;  3PEH A;  3I55 S;  1GQE A;  3W8P A;  2WB1 D;  4WKY A;  1IVZ A;  4L3N A;  3DKD A;  1S99 A;  3H5Y A;  3IMQ J;  4MH8 A;  3PY8 A;  2KXF A;  1DUR A;  1JNR B;  1FRI A;  5ETS A;  3P49 B;  4U8Y A;  4QIE A;  1R0A B;  2AT1 B;  4HHH A;  1SUQ A;  4NWB A;  2FGO A;  2YNH A;  4NLR A;  4CM0 A;  4HT7 A;  4CNZ A;  3TAM A;  5B0D A;  4ELU A;  5KFK A;  1X9W A;  1AFJ A;  2E5G A;  1Q95 G;  1SIZ A;  2GML A;  4JV0 A;  3ISN C;  4M5D B;  4USH A;  3UDL A;  1RAH B;  3EZO A;  2DVI A;  2A3J A;  2KT3 A;  1RAC B;  4KB7 A;  1DAR A;  2NLW A;  5KG1 A;  2E7X A;  4DHV A;  4R8U B;  1MW7 A;  1UFK A;  2PDA A;  2EXU A;  2X3G A;  3ISZ A;  3AD8 C;  4MIW A;  2PMZ D;  4ZLJ A;  3MR2 A;  5KFJ A;  1WWH A;  3AA9 A;  5ETK A;  5AT1 B;  2DNQ A;  2QMU B;  2C2R A;  1NHK L;  2CPH A;  2V8H A;  1XMQ F;  3AY0 A;  4R5P A;  4YHH F;  4UY8 5;  4L72 B;  4UZB A;  1JIH A;  1I94 F;  4QYZ K;  1BLU A;  4ZPW R;  2CYY A;  3I31 A;  3I5B A;  1LV5 A;  1RT1 B;  2ZD1 A;  4J5O A;  4QYR A;  3UE2 A;  4CT8 A;  1TL3 A;  4NCG A;  4R0E A;  1MG7 A;  3GJR B;  3LQV A;  3V2U C;  4IRC A;  3UFC X;  5IT0 A;  5IV4 A;  2W8K A;  2UXD J;  1TAU A;  5A6W A;  1MWY A;  3ULH A;  1O8B A;  2XO7 A;  1U4B A;  1C0U A;  3OUY A;  2E7W A;  1NHU A;  4M95 A;  4G1I A;  1N6Q A;  4Q5V A;  1G6B A;  4TU8 A;  3MEE A;  4OZN A;  4XPC A;  4KJI A;  2AGO A;  2JVR A;  1R8B A;  1JLF B;  2BAB A;  4YDD B;  5LXR A;  3VAL A;  3P6Y C;  2P6T A;  3QJP A;  4USK A;  3QRQ A;  4ATN A;  3CJS A;  3P5B P;  4U67 Q;  1RTJ A;  2L9N A;  3LAL A;  3R8Y A;  3H4D A;  2PT0 A;  4C3L A;  2C3O A;  2QA1 A;  1L5U A;  3DMJ B;  4OHW A;  4CLZ A;  2CJX B;  2I0X A;  2XZT B;  5C24 A;  1RT7 B;  3EDR B;  2OIH A;  1DZ5 A;  3K59 A;  1KLN A;  1FEH A;  2PI5 A;  4J91 A;  3C15 B;  1JLQ B;  5J1N A;  5E3A A;  5IWA J;  1UVM A;  1JLF A;  4OL8 A;  2V6A A;  4FVM A;  1GH8 A;  1IN0 A;  2P9E A;  1N5S A;  2HBQ B;  2HGL A;  3R7N B;  5IFM A;  5B09 A;  2V4J A;  3LWL A;  4K4Y A;  4IOC Q;  4N56 A;  1FDA A;  3L09 A;  4JI3 F;  3PRV A;  2N7Y A;  3UO0 A;  3LW5 C;  3Q8S B;  4CLF A;  2NYH A;  4WFX A;  4CT9 A;  2FHJ D;  4LF9 F;  3LPE A;  1YK9 A;  5A8R B;  3AAW B;  2FUG 9;  4B3R F;  2C2N A;  1T02 A;  3K5M A;  4K4Z A;  3PAC A;  3MPY A;  5IC6 B;  3SFG A;  4I2P A;  4DU8 A;  2DEI A;  3MOZ A;  1TL1 B;  1GNK A;  2XS5 A;  1BQM B;  1RBA A;  4TQR A;  2BW2 A;  2DIT A;  3VGU A;  2PFD A;  2XYH B;  2Z2M A;  4JI1 J;  2F8E X;  2KXH A;  2COL A;  3TJ8 A;  1VDH A;  3T5H A;  1KR4 A;  4L76 A;  4R25 A;  2CAD A;  2HSE B;  6FD1 A;  5T14 A;  1F9F A;  3HHL D;  1MU2 A;  3SSS A;  2EPI A;  4ES2 A;  4O3Q A;  5LXY A;  4UQG A;  1S1U A;  3PX6 A;  3FCW A;  3KK1 B;  1UVJ A;  4NAS A;  4DR6 F;  4ED1 A;  1Q5Y A;  5CZV A;  3KJV A;  4DV4 J;  2Y8W A;  3RBX A;  2V67 A;  2H5E A;  4Y6I A;  4LFB J;  1WG4 A;  1XIQ A;  1TP7 A;  2FTR A;  4JBC A;  1NDP A;  4GVB A;  4HT5 A;  4NA3 A;  3W62 A;  1PIL A;  2QRR A;  2VC0 A;  2BE2 B;  3DM2 A;  1N5V A;  4IQX A;  3C14 A;  3OTC A;  4A4J A;  1V5V A;  1SKS A;  4GO5 X;  4PAA A;  2POK A;  1FFS B;  2BOA A;  5ETL A;  5CA5 A;  3HZE A;  2W9A A;  1AT1 B;  2GQC A;  2CJA A;  3DLE B;  5L9N A;  1WHW A;  1R8H A;  3EPG A;  3N79 A;  1S49 A;  3BSA A;  5HO4 A;  2AZ3 A;  3MD1 A;  3BGR B;  3WC0 A;  4LF4 F;  2OEJ A;  4DZD A;  3PKM A;  3A3N B;  2QA2 A;  3OR2 B;  2VG6 A;  3IWN C;  1HFE L;  4ICL B;  4URS A;  3GJQ B;  3IA0 A;  2ATC B;  4NL5 A;  2NXC A;  4JI4 J;  1VQL S;  3KLI B;  1JLA A;  1M1G A;  4PYA A;  3QRP A;  1RT4 B;  3IAS 9;  1XMO J;  3ZNU A;  3GIJ A;  3D6H B;  5ETR A;  4JI8 J;  3FEY B;  1R8C A;  5A0Y B;  2J9C A;  3SIP B;  3H40 A;  2Z30 B;  4LBI A;  1T3O A;  2FJW A;  1OMS A;  1ULR A;  1FK9 B;  3ZZ0 A;  3E2E A;  2LQB A;  1Q8B A;  2VBZ A;  4IG0 A;  4RUA A;  1NBE B;  3W9H A;  5KFE A;  3WX8 A;  3CWJ A;  3QZ8 A;  3GG1 A;  3BGL A;  1N48 A;  3ENQ A;  4O3N A;  4F25 A;  2IA6 A;  4BWJ A;  1H7X A;  3BQ1 A;  1E6V B;  3LP2 A;  3MEC A;  3GU0 A;  1IQZ A;  2RU9 A;  4KKO A;  3T5K A;  2WSC C;  3DOM B;  2YWF A;  5GAH I;  2GMJ A;  1JJ2 R;  2FJV A;  2H5I B;  4ANE A;  2JEG A;  2IFX A;  3AB4 B;  3DHX A;  3ENA A;  2ZWO A;  3IGV A;  1JLA B;  1MWZ A;  4ZOS A;  3U1L A;  4QWE A;  4ZIV A;  2R8K A;  1WTF A;  3TUI C;  1SKW A;  1I1G A;  3L9Z A;  2B9Y A;  4DUY F;  5ETO A;  1S77 D;  4LQ3 A;  4YDX A;  1Q16 B;  1DJ0 A;  2LLZ A;  3GLJ A;  3J7A N;  4NLX A;  3KG4 A;  3BGR A;  4PZV A;  5IV3 A;  4KFB B;  2PFF B;  1W7W A;  2MKS A;  2AYB A;  3NLC A;  5GME A;  2L3M A;  4TY9 A;  2A2C A;  3NNC A;  2OI2 A;  2P6S A;  2MQM A;  3NGU A;  3BZQ A;  1X5P A;  1Y10 A;  2U1A A;  4NA1 A;  3BPD A;  4PWW A;  4X2B A;  1Y00 A;  4K2X A;  4ZCM A;  1LWF B;  4GVB B;  4ED5 A;  2FY1 A;  1DQ9 A;  2GJ2 A;  3IRX B;  4Z7C A;  2K3K A;  1C2P A;  2K7J A;  2VKR A;  1F1B B;  1S1W B;  1CJT A;  2F5G A;  2IM3 A;  2XSJ B;  3GSI A;  4MJK A;  3RAX A;  4W98 A;  4JI4 F;  4RNH A;  3CT9 A;  1RAD B;  2Z57 B;  2FZK B;  2ASL A;  3H2U B;  4F26 A;  5KG0 A;  4LF5 F;  4OHZ A;  4ECW A;  1HBM A;  5HMW A;  5F9N A;  1PO6 A;  2OPR A;  1UPP A;  2CNN B;  2W4P A;  2ZC4 A;  3H5S A;  5HP1 B;  4HDG A;  4O3O A;  4DSE A;  2UUC F;  1CLF A;  1YBT A;  3THV A;  3MM5 B;  4N41 A;  4TY8 B;  1XMQ J;  2KN4 A;  2J6S A;  1H73 A;  4B17 A;  2HZC A;  3L4B C;  5L1I A;  3D6M B;  4ZJQ A;  3ZZT A;  4ZN3 A;  4U7C A;  1TL1 A;  2VDI A;  3G6V A;  3D28 A;  3I5A A;  4NRU A;  2YVS A;  4DR1 J;  2HND B;  3H98 A;  2YNI B;  2FJD B;  1OIA A;  1PSD A;  2BRL A;  3M9M B;  4K59 A;  3K89 A;  2RDJ A;  2CQH A;  5CXT A;  4LR7 A;  1GXU A;  1LOU A;  2DT9 A;  4OYO A;  2QEX S;  2C3U A;  4FYV B;  3WDO A;  5K8N A;  3U1M A;  4JV5 F;  1LW2 A;  3MEK A;  4DL4 A;  1BMQ B;  3EXY A;  2X7I A;  2XO6 A;  4J90 A;  3M8W A;  2VC1 A;  2HVH A;  4JI0 J;  1HD0 A;  3BGF A;  1GK8 A;  2CJ9 A;  2JC1 A;  3FCH A;  4I6Y A;  1WSV A;  4IKA A;  3VQS A;  3ZTP A;  2R8I A;  1FRH A;  3QGH A;  4DR4 J;  3CDA A;  4LSN A;  3FBB A;  3NCQ A;  2YH0 A;  2KG0 A;  3T1Y F;  3VHQ A;  3V4I B;  3GFY A;  1KVK A;  4NLQ A;  4CDI A;  5C24 B;  5KOW A;  2VQF J;  2KKH A;  2CNL B;  2V94 A;  3RR7 A;  3M30 A;  2ZJP Q;  1UJ5 A;  2KT5 A;  1N36 J;  3CJ3 A;  4P2X A;  2AW0 A;  4N7T A;  4P74 A;  2BJ1 A;  4RW6 A;  4DG1 B;  3W8G A;  1D1U A;  3BDP A;  4YB5 A;  1F2G A;  5IXU A;  1RTJ B;  2MKY A;  1YLX A;  2MHE A;  2FZC B;  3KTQ A;  1NEE A;  2ZNZ A;  3IP0 A;  3SMZ A;  4ZMM A;  2MKI A;  4M8L A;  3MR7 A;  4LSN B;  1HBO A;  1RT3 B;  3GP9 A;  3MPW A;  3G9C A;  1DTQ B;  2DY9 A;  5FII A;  4N8N A;  2LU1 A;  1D8Y A;  4NCB A;  3K17 A;  2MZS A;  2AWZ A;  4EMD A;  4OQJ A;  3RUB L;  2IVY A;  5K8M A;  5MAO A;  1HL6 A;  3GE9 A;  1PBA A;  4NLP A;  4Q2M A;  4OYB A;  3WZ0 A;  1YI2 S;  4EZ6 A;  2GX8 A;  2W7A A;  5G0R A;  3DLB A;  2QYG A;  4KPC A;  3NAH A;  4LRC A;  1UWA A;  2Z58 B;  5KT6 A;  5DDP C;  1Z2Z A;  2V8G A;  1VC6 A;  2KTQ A;  1ZZN A;  4X4U A;  4U96 A;  1WJ9 A;  4I2Q B;  5KFS A;  5KG2 A;  4XO0 A;  1KOO A;  1Y5I B;  2IA0 A;  2DGS A;  4FXW A;  3UN2 A;  1AW0 A;  3OFG A;  4P9S A;  3MDF A;  1S10 A;  1KC8 T;  1SC3 B;  1JXV A;  2Q3P A;  5LMN F;  2HQI A;  1P6T A;  2RAQ A;  3EE3 A;  4LR8 A;  1D0E A;  1X8D A;  3AJ2 A;  2EVZ A;  3KHR A;  2DD8 S;  1URR A;  2FPH X;  4USM A;  1UA0 A;  3DU6 A;  4CYU B;  4DEZ A;  2J0S D;  2DNY A;  5K14 A;  5KFI A;  5IM0 B;  1J5E J;  1IKY B;  1S9E A;  2MZT A;  3RZA A;  3ITH B;  4IG3 A;  4JUZ A;  1JQG A;  3DLG B;  4ED7 A;  1SJ3 P;  2UUA F;  3AJD A;  2G2Y A;  3Q89 A;  2CJY B;  2R7Q A;  4P10 A;  5ETN A;  3AD9 C;  4YP3 A;  1UCN A;  3SI8 A;  3C6T A;  4QPT A;  2H65 B;  3SEO A;  1GAO A;  1P1L A;  2XYP B;  5BR8 J;  1YIJ S;  1KP6 A;  3FQK A;  1VIX A;  2C3M A;  3VGT A;  4EK2 A;  4A8S A;  4R8U A;  4EO8 A;  1SJ4 P;  2IMO A;  1CQM A;  2CQI A;  5E7O B;  1AB8 A;  3P96 A;  5JXS A;  3RBE A;  3DLH A;  3E01 A;  2P2C B;  3PNI A;  4LIW A;  2KU7 A;  4I68 A;  3QGP A;  3TX8 A;  4IFV A;  3CJK A;  3OLB A;  3GV8 B;  2EC0 A;  2DNL A;  2DKO B;  3NGR A;  5CD4 A;  2ZDO A;  2F3J A;  2JX2 A;  2ERR A;  4DSJ A;  1VYA A;  2QT7 A;  4YME A;  4YHH J;  5KT5 A;  1YHQ S;  4AFF A;  1VHF A;  5EUH A;  4F8R A;  2YH1 A;  3V81 A;  3K8W A;  3Q86 A;  2G1H A;  1REV B;  3IAM 9;  3CD7 A;  2CPI A;  4CO1 A;  2RUG A;  1LWC B;  1YBA A;  4PWU A;  3HSJ A;  5EX3 A;  3UVJ A;  4C2M A;  6AT1 B;  2EKN A;  1R31 A;  3MM8 B;  3NS6 A;  3CVK A;  3N9U C;  2RSQ A;  2AGQ A;  4LRF A;  4K0K J;  4UZC A;  3TYT A;  4X62 F;  2QLB B;  3CTR A;  4M5H A;  2ZZM A;  1VIS A;  2IM1 A;  2YXL A;  2RRN A;  5D77 A;  3DLK A;  3GFH A;  1UA1 A;  2IRU A;  1KOH A;  3W2W B;  2F9D A;  3EM1 A;  3RB6 A;  3P3D A;  2KVI A;  2NXN A;  4FBU A;  4N76 A;  2DRB A;  3CUL A;  3NP5 A;  3UN3 A;  1TKZ A;  3GCW P;  4MFB B;  1IBL F;  2L41 A;  1RI7 A;  4KGX B;  2OEK A;  1LFW A;  2ZC3 A;  3GFZ A;  3P4U B;  3NWR A;  5A0Y A;  4DR1 F;  1VBY A;  1N33 J;  3CJQ A;  2PSZ A;  3IWX A;  3ZTQ A;  1CJT B;  1T03 B;  1TK5 A;  3RU0 A;  1JK9 B;  4USI A;  2UVR A;  3SSQ A;  1PAE X;  1BQN B;  4P7T A;  4KHR A;  1TK8 A;  4D3H A;  2PI4 A;  2L9D A;  3KMQ A;  4RUH A;  3O6Q A;  1V9O A;  3SV4 A;  3MMC B;  2G1D A;  3J80 Y;  1V3R A;  3JTO A;  2YKM B;  2VG6 B;  3N4W A;  2QL7 B;  3VR1 A;  4BC9 A;  3JSR A;  1R89 A;  4ZCI A;  2D3Z A;  2WON B;  1MMD A;  4Q0B B;  1RK8 A;  2E66 A;  2QTW A;  1XNQ J;  1CSJ A;  1RT5 A;  3DRP A;  3G86 A;  5D0G A;  1T3N A;  4DWI A;  5IQ6 A;  1FWK A;  4ED2 A;  2DR5 A;  1UZH A;  2YQ0 A;  2W9C B;  3KJN B;  2C22 A;  3FC9 A;  2E5H A;  3MMC A;  1HBU A;  2HUR A;  4YB7 A;  4DV5 J;  1VQ7 S;  2R7U A;  2GJI A;  3FKB A;  5ETM A;  4X84 A;  4CO5 A;  3KOA A;  3EVO A;  1RDR A;  2UZA A;  1WEY A;  1EIY B;  4DS4 A;  2K7K A;  4DCP B;  1NND A;  1E6V A;  4PR6 A;  1IJF B;  4OYP A;  1EQM A;  1B7F A;  2V4Q A;  1FVQ A;  2HHX A;  3IO1 A;  1NK6 A;  2P9G A;  2X1B A;  3HMJ G;  4B9L A;  2HG4 A;  1KSP A;  4TQS A;  3M32 A;  3WHI A;  1GMU A;  4KPY A;  1AUS L;  1I3O B;  4WXO A;  1JXL A;  4NE9 C;  2RS2 A;  2BM0 A;  1VS3 A;  3B54 A;  3EZU A;  2CKW A;  2CDR B;  3G8S A;  1NK8 A;  3QLH A;  3NOG A;  2HBR B;  4PQU A;  2LVW A;  3MM8 A;  3AXK A;  4QU7 A;  3CPW R;  1LFP A;  3LTO A;  2DGQ A;  2QYC A;  3GZ7 A;  3IBC B;  4RW4 A;  5CQG A;  3VAM A;  3FMB A;  3OTE A;  1S7H A;  5F0W A;  1GX6 A;  3MZI A;  1EHW A;  2GFF A;  2GS8 A;  2HS3 A;  4QOT A;  4DL7 A;  1FER A;  1NHV A;  2BKN A;  2XCP A;  1YJU A;  5HAN A;  3B4M A;  3QJL A;  2J0X A;  2YWE A;  2ZE2 B;  5HI7 A;  2OD6 A;  1RWW B;  1HNZ J;  1F5C A;  2ZE2 A;  4O23 A;  1IBL J;  3F0N A;  1KNZ A;  3G8T A;  3PYF A;  4Y34 A;  3Q83 A;  3D54 A;  3I4P A;  3Q8V A;  3A3P B;  5BR8 F;  4UY8 T;  1X5T A;  3HT0 A;  4QCL A;  2HHV A;  1UWB A;  2CNK B;  2XI3 A;  1RYR A;  4TLQ A;  3I96 A;  3ONQ A;  5KFY A;  1WDT A;  3BEG B;  3J80 U;  1MMN A;  1RAE B;  1Q86 T;  1XK8 A;  5DG8 A;  1T94 A;  3R97 A;  4E8U A;  1S4E A;  2HIQ A;  1S57 A;  3VAG A;  2E9T A;  1Y5L B;  4ANC A;  4PEO A;  4RNO A;  2A6O A;  4WTY A;  1S1U B;  4B02 A;  3MTJ A;  5AXN A;  3N0V A;  2BE9 B;  4C8K A;  1SXL A;  4CP5 A;  3P5T L;  3HK2 A;  2FVQ A;  1X4C A;  2H3E B;  2Y8Y A;  2ZBI A;  4LJM A;  2NZ4 A;  3FZ2 A;  2B8Q A;  5I42 B;  5E0O A;  4ZIT A;  1IKV A;  4UW2 A;  3M4X A;  3CCJ S;  1YQH A;  1UW9 A;  4M5M A;  4LBP A;  4AND A;  1U8W A;  4LF8 J;  1YJV A;  2AHO B;  1UW4 A;  3MCO A;  1UFL A;  4JI6 J;  1KVJ A;  1FTC A;  1VJQ A;  2YNF B;  3NG8 A;  3SQG B;  2HK3 A;  2LYV A;  3PYG A;  5GAG I;  3DRS B;  2GA7 A;  2VA3 A;  5KT3 A;  4ED8 A;  3NMR A;  4UUX A;  2W01 A;  1S6U A;  1U1O A;  1LW0 B;  1U26 A;  2YNF A;  1NJZ A;  1C0T B;  5G0R B;  4YY3 J;  5HBM B;  4J9Q A;  4M5J A;  3DXB A;  2VG7 B;  4FKY A;  4CI0 B;  4TU9 A;  1JB0 C;  3R5G A;  2WBR A;  5I42 A;  2FJB B;  1VQK S;  1Q8K A;  1OSC A;  1RA7 A;  3FFI B;  1RAF B;  2UUA J;  3DYA A;  2D74 B;  1OQ6 A;  1RAO A;  1SC4 B;  3BQ0 A;  4EBD A;  2AV5 A;  2F8M A;  2HS0 A;  2HFO A;  5DRK A;  4DV3 J;  2V2Z A;  2VBY A;  2CQ1 A;  2FC8 A;  3DHW C;  3B6B A;  2BOP A;  1YX2 A;  1NH7 A;  2NCK L;  2J8A A;  2M0G B;  4HTI A;  2LDI A;  4CRJ A;  3ET6 B;  4WE1 B;  5HRO B;  3PVX A;  4ZPA A;  3M30 B;  1W2I A;  1NSP A;  2BKP A;  3HHL B;  3PM9 A;  3QIP A;  1W26 A;  2MLX A;  3H42 A;  2JEI A;  4F0K A;  1S6Q A;  5M2P A;  4YR0 A;  2R8H A;  2VJV A;  4C8Y A;  5KFR A;  3PHE A;  1Y7P A;  4FN5 A;  4NEZ A;  2EI5 A;  2OPQ B;  4FP9 A;  2CZ9 A;  4LBH A;  2GHP A;  3MFH A;  2XEX A;  4K2J A;  3Q8P B;  2BJ7 A;  4AQY F;  4DQI A;  2OTJ S;  2FJA B;  1WUU A;  3GV5 B;  5F8I A;  3FEX B;  5B7W A;  5J2P A;  1OY9 A;  2VFV A;  2E5J A;  4QZV B;  1JKH A;  4Z7Y A;  1R0A A;  3QJJ A;  1Q7Y T;  3LH2 S;  4RW4 B;  3TUJ C;  1TKT A;  2VFT A;  1VI7 A;  5J2M A;  1GMW A;  4E0D A;  3R6L B;  3CD6 S;  3CCS S;  2XMA A;  1VLO A;  2EK1 A;  2NXU A;  4LQ9 A;  1YJ7 A;  3TVK A;  2ZJR Q;  3RTV A;  4GC6 A;  3G71 S;  1HWL A;  1WOP A;  4OYX A;  3BN4 A;  1EJ7 L;  1VQY A;  2WOM B;  3I0S A;  2CQG A;  4NPO A;  4A8Y A;  3LP0 B;  2BA9 A;  5K8O A;  2ZEJ A;  4QIF A;  2N4D A;  2GV1 A;  4NEY A;  5E33 A;  3FSI A;  3LF0 A;  4K5R A;  4PG8 A;  3E01 B;  1WEX A;  1ZM3 A;  1VK8 A;  4X4P A;  1PGZ A;  1N32 J;  5B08 A;  5MLC V;  1Q0N A;  1FT8 A;  4GO7 X;  1B99 A;  4KHM A;  2H4Y B;  2OFH X;  4MT1 A;  2UXD F;  3KJQ B;  3PIO Q;  4HL9 A;  2J0W A;  2LMI A;  3TUP A;  1NJX A;  1FNO A;  1WEZ A;  2V63 A;  1R6V A;  2MQL A;  3SDE A;  3OW2 R;  3CNQ P;  1F0X A;  4LR9 A;  3ILL A;  4ZPV R;  1T95 A;  2B4P A;  2ZVI A;  3CUN A;  1YG0 A;  2JLE A;  3M8Q A;  1N5Y A;  2HVZ A;  3W63 A;  4IG3 B;  4A8O A;  1UEU A;  2XMV A;  3MR6 A;  3G2X A;  4JV2 A;  2JFK A;  5F8G A;  4RZR A;  3OSN A;  4DV2 F;  3T5J A;  1PAU B;  4X4N A;  3HXM A;  3ZZU A;  4DUY J;  1K0T A;  4CO3 A;  3AT1 B;  4EBC A;  2HQG A;  2HFU A;  4ZPB A;  2OPS B;  4B3S J;  2GW8 A;  2UUC J;  4DJB A;  1T8E A;  4NZ6 A;  4WP9 A;  1A6L A;  4U9R A;  4YB1 P;  1LW0 A;  2F4V J;  3QYY A;  2KG1 A;  3CO0 P;  2CVE A;  5K9F A;  3SCJ E;  2LEA A;  4YR2 A;  3MEG B;  3OVB A;  3SFU A;  1BQX A;  2KT2 A;  3TZW A;  3I0R A;  1RHQ B;  4X4T A;  1H38 A;  5F41 A;  1RTH B;  2DHA A;  3KUH A;  2B7C B;  4UOH A;  1HBN B;  5I3U A;  4XK8 C;  3J7Z T;  1T03 A;  1IKX B;  3PG9 A;  3U1N A;  1TL5 A;  2BJE A;  2DR6 A;  2ILZ A;  1X4A A;  4F3Q A;  1K1S A;  1NPR A;  1JLG B;  3VF0 B;  3W1Y C;  4J9L A;  2ADC A;  3BSC A;  3BO4 A;  4Z2X A;  5LSO A;  4C7Q A;  4JI8 F;  2DHH A;  3U02 A;  3AOD A;  4PAB A;  3GJS B;  3TQ1 A;  1OO0 B;  1ZS6 A;  5F3Z A;  2Q6B A;  3KLE B;  2IYG A;  2NZC A;  2MEW A;  4FF2 A;  2KYZ A;  2BE7 D;  4I7F A;  4RW7 B;  1QAI A;  1RT4 A;  3BKF A;  3MPD A;  4J9U E;  1NZ8 A;  1PYT A;  2PMH A;  3KLI A;  1RLD A;  1TKT B;  4PG5 A;  1RIS A;  5E3P A;  2XYG B;  5J2M B;  1LK7 A;  4X65 J;  1MLA A;  4FYX B;  1TQL A;  1UWB B;  1ZAV A;  3PJ9 A;  1FDN A;  2NXJ A;  2RKI A;  1REV A;  3OV7 A;  4TN2 A;  1BUX A;  1SBR A;  1UFW A;  2B7B B;  3CC7 S;  1EKR A;  2LA4 A;  4M94 A;  1YWX A;  2IRY A;  2DGV A;  2KHC A;  5KFM A;  3FSX A;  1S1V A;  4FNH A;  4IFV B;  1L3S A;  4GKK F;  1OYE A;  3C14 B;  2IJR A;  3M8S A;  2OLW A;  3VZH A;  4JI5 J;  3OR1 B;  4A8F A;  4IH7 A;  5DET A;  5ETQ A;  3QIP B;  4L3K A;  1IKW A;  1UP1 A;  5F3T A;  1ZM2 A;  5KFO A;  1TL4 A;  3X1L B;  1RZM A;  3FBF A;  4G1Q A;  3G6E S;  2HWT A;  3PR5 B;  4MK7 A;  4OV1 A;  4QQB A;  2FC9 A;  2VOD A;  4ES1 A;  4KGM A;  2MYF A;  3HSD A;  1OQ3 A;  2FGC A;  5GVQ A;  2ZUG A;  2IC3 B;  8ATC B;  4OX8 A;  3CED A;  3MM5 A;  4DPT A;  3EVM A;  2ALZ A;  1KBR A;  4B3T F;  3QFH A;  3MHY A;  1P9Y A;  1R6Y A;  5BYR A;  3M8P A;  1QAY A;  3ZC4 A;  4MKA A;  2VHG A;  3CJ0 A;  4NMX A;  1FKP B;  4ES3 A;  1X5O A;  3R1H A;  2B9E A;  3CJ8 A;  1XC9 A;  1OS5 A;  2E7V A;  2VG7 A;  3T6B A;  1BQM A;  4DCJ B;  4FXV A;  2R9L A;  3BPS P;  4ZP6 A;  5HBM A;  1Q81 T;  4M5K A;  1RTH A;  5I3U B;  4XTT A;  1S1W A;  4F4Z A;  3V6K A;  2FQQ B;  2CQD A;  3DLJ A;  4RUC A;  3IRX A;  4DI6 A;  3NNH A;  1TUG B;  5HVG A;  1YIT S;  4Q8E A;  1SJ1 A;  2Z2Z A;  2WW8 A;  1RUS A;  4CLS A;  9ATC B;  4JI5 F;  4LFB F;  2AYE A;  1HD1 A;  2V68 A;  1S5Z A;  3TX0 A;  4BBY A;  3M6W A;  4C3M A;  3QZ7 A;  3VAI A;  3O44 A;  4FS1 A;  2J9D A;  2G0I A;  3J7Z 5;  4F3M A;  2HHS A;  3KK2 B;  2DJW A;  2OPP A;  1Q7L B;  5HAO A;  4UOG A;  3I56 S;  2GQQ A;  4Q0B A;  1EX8 A;  3J7A 1;  1HLW A;  4J7C A;  1FKA F;  4DQP A;  4ILM A;  3MED B;  2MLZ A;  1LK5 A;  5EWF A;  1N5Y B;  1YRU A;  4JI1 F;  2Y9H A;  1TEL A;  1IBM F;  2DB1 A;  4FF4 A;  4C0O C;  1RE1 B;  2YWH A;  3BKU A;  2CAJ A;  2O01 C;  3CDB A;  3JQM A;  2EG2 A;  5HN0 A;  5JUM A;  4B9N A;  2MJU A;  2MDA A;  2DTJ A;  2R7V A;  1U1N A;  1CEZ A;  2M3D A;  3Q24 A;  4WIQ A;  3SZ2 A;  2W2M P;  4P75 A;  2KFZ A;  4DR2 J;  2BX6 A;  1CJV B;  4WK3 A;  2LP4 A;  1KTQ A;  2JSX A;  5DM7 Q;  4TYB A;  2W8L A;  1UEK A;  3NGK A;  1FFW B;  3PKY A;  1ZM9 A;  2VQE F;  3TAR A;  1S76 D;  1KRP A;  1V3S A;  2DK2 A;  5HLF A;  5A6P A;  3GYN A;  1I51 B;  1NKB A;  1EAR A;  1HNV B;  4NML A;  1NME B;  2YX4 A;  1SL0 A;  3H0P A;  3CCW A;  2O5D A;  1S48 A;  1UAW A;  4DV3 F;  2CPZ A;  2DR7 A;  5J2Q A;  1RWV B;  2LQ8 A;  1U0S A;  4IRD A;  3EYZ A;  2FHJ A;  3QLH B;  5CAB A;  4LF6 J;  1TL3 B;  2H48 B;  1FE0 A;  3MUM P;  5FD1 A;  4QW8 A;  1URN A;  2R7S A;  1DHM A;  4OI6 A;  2Y1I A;  5DGA A;  4B3S F;  1FJ7 A;  3JB9 k;  2HNZ B;  3BO2 A;  4RO0 A;  4F36 A;  2B43 A;  1WI6 A;  4MK8 A;  3D2W A;  2ZH5 A;  2ZJQ Q;  2HIY A;  5B0B A;  3CJ2 A;  1AFI A;  1D3W A;  1TUV A;  2I6W A;  2UU9 F;  4NXM F;  3TZX A;  2NUH A;  1O6X A;  2V8D A;  1S6Q B;  1KDN A;  1BXN A;  3OL6 A;  3MCS A;  2Z8Q A;  3TVZ A;  4YS2 A;  1JJ4 A;  1IM6 A;  1F5B A;  3UR0 A;  1X4B A;  3DI6 A;  3GMG A;  3IGN A;  3EZ5 A;  3PEJ A;  4JV1 A;  1KQF B;  1UJ6 A;  1H98 A;  2AJ0 A;  3PJX A;  2QFI A;  2QZ8 A;  2E5L F;  2ZKT A;  2DH7 A;  3K2Y A;  3KMS A;  3Q8U A;  4A46 A;  2KZZ A;  1H6K X;  3CJ5 A;  4WU3 A;  1OJ4 A;  4HHU A;  4DV0 F;  4O0N A;  3FFI A;  2XLK A;  1NB7 A;  3G82 A;  5GAD U;  3KK3 A;  5EWG A;  4HI2 A;  2ZWP A;  1BHN A;  1MRO A;  3IM9 A;  1ZOT A;  4DLE A;  4WKR A;  5LT5 A;  2XGQ A;  5F8N A;  4KYZ A;  3ENV A;  5JJB A;  3I82 A;  1WOR A;  1Q4R A;  4DR3 J;  4O4G A;  1T9X A;  4RW8 B;  5DQI A;  3KLG A;  1N56 A;  3LGM A;  2VH7 A;  4Q7A A;  1ZBT A;  5RUB A;  2QIF A;  3SQG A;  1P27 B;  4ZK7 M;  4H4K A;  5HQM A;  2ZBC A;  4K4T A;  2QL9 B;  3KYL A;  3MUR P;  2FB0 A;  3R5J B;  4C97 A;  3TZZ A;  4FYW B;  4DPX A;  3Q22 A;  5AXM A;  1IR1 A;  2I9S A;  3MM6 A;  4XPE A;  2H54 B;  2D41 A;  4I6A A;  1Q79 A;  3ZTR A;  2J6U A;  2QLF B;  5KTQ A;  3L3C A;  4LF8 F;  3B78 A;  1S97 A;  4CTA B;  1Y5N B;  2QSF A;  1X9M A;  1K47 A;  2FYX A;  4M5L A;  4P2S A;  3QSY B;  3PX4 A;  5BYQ A;  1EAY C;  4QWA A;  1X0P A;  1RTZ A;  2R7X A;  2MY8 A;  2W24 A;  2B51 A;  3VVU A;  2VIC A;  3R5B A;  2DNG A;  2FLO A;  8RUC A;  1LNQ A;  3UCU P;  4JYA J;  4F4Y A;  3T1A A;  1UVI A;  5AE2 A;  3N6N A;  1J2V A;  3AQP A;  4ZVG A;  3GTY X;  2CJQ A;  3I5C A;  2WHO A;  3JSY A;  2AYG A;  2D1C A;  1WOS A;  2B3T B;  2AJQ A;  1RWO B;  4G65 A;  3RJM B;  3OTB A;  2QGF B;  1CC7 A;  1T9U A;  3FSY A;  3NKY A;  2QA4 G;  3PW2 A;  1Q78 A;  4JP8 A;  1RLC L;  2NQP A;  2ZH3 A;  4K4W A;  4QIG A;  4ZVQ B;  4MKV A;  3W9J A;  3QSI A;  3MAQ A;  1GMW D;  5KFN A;  1SQF A;  5B0E A;  2HLT A;  1DBD A;  4KH0 B;  4YY3 F;  3TAP A;  1R8A A;  3NCP A;  4K4S A;  1KLM B;  2XY5 A;  2ZVS A;  1B64 A;  2PE8 A;  4V1A k;  4DDF A;  1VJW A;  3DRY A;  2WTF A;  2HFV A;  4NLU A;  3W60 A;  4ECR A;  4HR2 A;  5GAG U;  1SL1 A;  3D5M A;  3OL8 A;  3KJV B;  4I7F B;  4F50 A;  4OLP A;  1QDU B;  3Q2S C;  4ERD A;  5DJB A;  4LFA F;  2MKK A;  2YQ1 A;  5K20 B;  3ITH A;  1FKP A;  2W4D A;  4I56 A;  5AXK A;  5K14 B;  1N5T A;  1AXQ A;  2GAH C;  3CC2 S;  1B0T A;  2B4V A;  4DV6 J;  1JLG A;  3GYG A;  4PPD A;  4ENO A;  1HYS A;  3IR7 B;  3MD3 A;  5A76 A;  1T9Y A;  2RF2 A;  4OV6 A;  1OWX A;  2Q66 A;  1K0V A;  3FUY A;  1WF1 A;  2M70 A;  3MCM A;  1ROF A;  1O51 A;  1S6P A;  2WAQ D;  4OZL A;  3QT5 A;  4YQW A;  4KR0 B;  2NSB A;  4C98 A;  1P8G A;  2EWH A;  2RRB A;  3PIP Q;  1LWF A;  1FF2 A;  1RWX B;  5A8R A;  3MUV P;  3HP6 A;  2VF3 A;  2OUG A;  2WVC A;  3T1H J;  4ED6 A;  1YZ6 A;  1GT8 A;  2UXB J;  1HQU B;  5E5N A;  3LWM A;  1L3V A;  1WC3 A;  3X3U A;  4BCA A;  4DV5 F;  2GIF A;  3GWC A;  3M2V B;  5IZH A;  3JSB A;  4HH1 A;  8AT1 B;  1JLQ A;  1DTQ A;  4DSL A;  2PC6 A;  4AT1 B;  2RKI B;  1TU0 B;  3D6F B;  1F9H A;  3J81 U;  5DG9 A;  1ZAX A;  2C1E B;  2WSE C;  3RB4 A;  4ELV A;  1IM4 A;  2LEB A;  1VBZ A;  3U27 A;  4DUZ J;  2W2O P;  2BKO A;  1X31 C;  5L9X A;  4ZS6 A;  4KT0 C;  4L74 A;  1KFD A;  3HM9 A;  2GQ2 A;  1EET A;  1S0O A;  2HS4 A;  2DH8 A;  3DOM A;  1H74 A;  2ZOM A;  2WZ1 A;  3C66 A;  1AYE A;  4HH0 A;  3LOU A;  2NXE A;  2V2Q A;  1WHX A;  2QX0 A;  3A8J A;  2UVW A;  5AE1 A;  2HNY A;  2J5A A;  1KEK A;  1WOO A;  3UD5 A;  1Q5V A;  4OHV A;  2XB2 D;  2CG8 A;  2KVQ E;  3PX0 A;  2D3U A;  3ZZO A;  4KBI A;  1H3D A;  2IDL A;  1NDK A;  3TI0 A;  4ID5 B;  2W9B B;  4J9K A;  1RQ0 A;  4GMK A;  4Y28 C;  4Q8F A;  1X4F A;  3BH7 B;  4GRS A;  4PRF A;  1XR6 A;  3AOA A;  4X4V A;  1ACM B;  4BLG A;  2Y0B B;  1SIW B;  5D3G B;  3MEG A;  6FDR A;  2C2Z B;  4X62 J;  4PPZ A;  1TL7 B;  3LGN A;  5KFA A;  3BF4 A;  1NLK L;  2YWK A;  4RWX A;  3H7H B;  3FGV A;  4NZ0 A;  2J6T A;  4KSE B;  5B0A A;  3KHH A;  4I67 A;  1VK3 A;  3G82 B;  3KK3 B;  4DV6 F;  2ZOG A;  5DDR C;  5LMN J;  2GHV C;  2B6A B;  3DLE A;  4P2F A;  3HHL C;  3N5B A;  2I38 A;  1NK7 A;  2AEJ A;  4ECY A;  5JVG Q;  2HZA A;  2BJD A;  4PUO B;  3RRH A;  4FPI A;  1U1M A;  1TKX A;  1UEV A;  2D7S A;  2G0C A;  3HJV A;  3W5Y A;  2X3D A;  4YUD A;  1KQS R;  1SQE A;  2Z56 B;  1ZM4 A;  2QC3 A;  2FIU A;  4PG7 A;  3NOC A;  4J9R A;  2ASJ A;  1RT6 A;  2APO A;  2OEM A;  4HVZ A;  4LIR A;  4ELT A;  5HRO A;  2XY7 A;  3WQP A;  1JXE A;  1ZAW A;  2GCF A;  4IRK A;  1N33 F;  4FVC A;  2KM8 B;  1C4A A;  3PO4 A;  1TAQ A;  3DLG A;  1JMT A;  2FLL A;  4OMF G;  4L75 A;  5CYM B;  1MU2 B;  1WI8 A;  2BBE A;  3T9Z A;  2HGM A;  3L95 X;  3N6L A;  4M5D A;  2WOM A;  3IS9 A;  4YB6 A;  5BYS A;  2OHD A;  2RDD A;  4RJV A;  4ETX A;  5L1J A;  3N5F A;  1R0B G;  4URG A;  2HW3 A;  1DFD A;  1S72 S;  2CQ2 A;  4C4W A;  4DR5 J;  2G2Z A;  3CCQ S;  2V8P A;  1FRK A;  2W7P A;  1Q82 T;  2DNK A;  1UPM B;  1MWQ A;  2YKA A;  4CH0 S;  4H54 A;  5C5J A;  5DQH A;  3KWM A;  3M8R A;  2C28 A;  1U1L A;  1RTI B;  4K0K F;  4ZVP B;  3R6G B;  3GR0 A;  5E2Q A;  3SSR A;  4MIB A;  3TA1 A;  1JLB A;  2JH3 A;  4B9T A;  1F6T A;  3C6U A;  2WSF C;  1X60 A;  2DXE A;  5J2N A;  1YBU A;  5SUH A;  3KNG A;  3BS9 A;  3PJW A;  2F9J A;  5C42 B;  4RX6 A;  4ZPC A;  3CCU S;  1SC1 B;  2MQO A;  4QPX A;  2DIV A;  3GPA A;  3CJR A;  5A2Q Y;  2NPF A;  2C42 A;  3UD4 P;  4IG0 B;  2DRD A;  3TWZ A;  5GMD A;  4RL1 A;  5DZ6 A;  2V9W A;  3OXF A;  1LWX A;  2D3O R;  3B8H A;  5D8H B;  2DRA A;  1L3K A;  1Q8L A;  2BMB A;  1HMV A;  1X0F A;  3GG0 A;  3GON A;  2AX0 A;  3DMJ A;  2RJZ A;  2VB6 A;  1HMV B;  2C2D A;  3GIR A;  2AJF E;  1ZZF A;  2HAI A;  2GO8 A;  2MLY A;  4XAK A;  1I5O B;  1P9Q C;  1FVS A;  3BR8 A;  4MYU A;  1Z4U A;  3SCK E;  1S1X A;  3D0G E;  3HZG A;  5CAA A;  3I6P A;  2PN6 A;  2FLN A;  3H5U A;  3QQC D;  1U1R A;  1IQT A;  4NLD A;  2M8H A;  1VQN S;  1VQM S;  2AJ1 A;  1U7L A;  3CCZ A;  2ZDP A;  2VQF F;  1SV5 A;  1WDD A;  4DV0 J;  3BYP A;  4ZVS B;  2UXC F;  4B3T J;  5C25 B;  1LW2 B;  2CUY A;  2FJE B;  2GVZ A;  4JI0 F;  5LMU J;  3C16 B;  1HPZ B;  2DXF A;  1H2T Z;  2X51 A;  2DHG A;  2YY3 A;  4OHX A;  2NPI A;  3NCR A;  1T0T V;  3W66 A;  1NM2 A;  1HNX F;  4Q2L A;  3VTI A;  4OZ5 A;  2JLF A;  5AJ3 F;  2HND A;  4F0M A;  5EHH A;  1RSC A;  2LCW A;  4IDK A;  3S6E A;  2Y0S D;  3M6X A;  4HHJ A;  1XJW B;  4PG6 A;  9RUB A;  3RB3 A;  2G13 A;  1R3N A;  3V6D A;  1A0O B;  1G2E A;  2J76 E;  4LFC F;  1HYS B;  1NZA A;  4DX8 H;  4QIW D;  3BKT A;  4NXN J;  3IS9 B;  3M8P B;  2IMW P;  5HP1 A;  5ITH A;  2W7O A;  2OPR B;  1OY8 A;  1ITP A;  3CSK A;  4P73 A;  3D67 A;  3CD0 A;  4LSZ B;  4CO0 A;  2DGX A;  4CLT A;  3UI3 A;  2ADB A;  3ENW A;  2HMI A;  5D4N A;  3OVA A;  3KNA A;  3AHP A;  4LF6 F;  1NO8 A;  4I2P B;  1U1Q A;  4BDP A;  1D9D A;  1X7V A;  4U95 A;  2IY5 B;  1GMV A;  2XQC A;  2DH9 A;  2ATL A;  1Y4Z B;  5LJ5 Y;  4HEA 9;  2BEF A;  3IN5 A;  4C8Z A;  3EWG A;  4OZ0 A;  5D15 A;  4CWB A;  1RWM B;  1QVF R;  3KXD A;  5L39 A;  3W2V A;  1HBU B;  2DXD A;  4NLS A;  2HHH F;  4FF1 A;  1QJH A;  4LVN P;  2MKH A;  2ZH7 A;  2GMH A;  1QY7 A;  2BQU A;  1CC8 A;  2O3D A;  1SV5 B;  3BV8 A;  2KHD A;  2QO3 A;  2A6M A;  2IAJ A;  4NLO A;  5LSL A;  1UVK A;  4Y0F A;  1H7W A;  4ALZ A;  4CCH A;  3DOK A;  2AF6 A;  2JOQ A;  1UL3 A;  2DGW A;  3BO3 A;  2FVS A;  2BDP A;  4RBV A;  1UVN A;  2HQF A;  4ZDN A;  1RBO B;  3GB0 A;  2AU0 A;  1PJ5 A;  3LUY A;  3MTK A;  2VPY B;  4P7V A;  1SJQ A;  4F3O A;  2N4C A;  2CJB A;  4LSL A;  1QTN B;  2I5J A;  3MAA B;  5A2Q U;  3PW7 A;  4C8M A;  1JLC A;  4I4B A;  2VOP A;  4IQM A;  3MUT P;  3BSO A;  2O67 A;  3D68 A;  1YZ7 A;  2BAN A;  5CCL A;  3RYL A;  4J9P A;  2GVD B;  4EU0 A;  1CUL B;  3PFO A;  4C0B A;  4Z37 A;  4ID5 A;  4ZP7 A;  2W9B A;  3CW2 C;  1HWJ A;  2HMI B;  2J7K A;  4PG4 A;  2AQ4 A;  2YWW A;  3CJT A;  1JLE B;  2ZBQ A;  4OX6 A;  3NS5 A;  3W2W A;  3ZNJ 1;  2LQ5 A;  4DPO A;  3DLK B;  3MEE B;  4N47 A;  3KLF A;  3MWB A;  2XCA A;  4IH6 A;  4TXS A;  1VQS A;  1VBK A;  1WSR A;  3OHA A;  1N6Q B;  2FJX A;  4V19 J;  1G1X A;  2CQB A;  2AGP A;  4KHP J;  1HBN A;  2BAN B;  2FDN A;  2V9K A;  2WBM A;  3O3L A;  3FQL A;  3JYT A;  1LKZ A;  3I87 A;  2XZD B;  4NZ7 A;  4MMO A;  3POT B;  2XC9 A;  4LSL B;  3UWT A;  1RHM B;  1NSQ A;  5A8W A;  1U1P A;  4GKJ F;  4RW8 A;  1PC4 A;  4W4M A;  1TV6 A;  1LWC A;  3UD3 P;  2MQ8 A;  2DHX A;  1NSA A;  3TR5 A;  1Q8I A;  3OR2 A;  1RT2 B;  3PW5 A;  4OJG A;  4O0I A;  4OI4 A;  2LKZ A;  3BYR A;  1XMO F;  4LRE A;  2IAJ B;  2UXC J;  4USV A;  2V2K A;  2IVF B;  2IM2 A;  4NI2 B;  4C11 A;  3CF5 Q;  1EQ0 A;  4S0M A;  5H9F K;  3RR8 A;  1IBK F;  3CJK B;  2V5H G;  4R5P B;  2ZZN A;  1WG1 A;  1RTD B;  5CYM A;  1S0V A;  3ETO A;  2KO1 A;  4B9M A;  1LXJ A;  3M8Q B;  3DM2 B;  3R5D A;  4ECU A;  1F9E B;  1HQE A;  4A8W A;  2VJU A;  3DI6 B;  1FJC A;  3G96 A;  3D1Q A;  1S6P B;  3KFW X;  2CPX A;  3PHT A;  2FY8 A;  2VD3 A;  5CYJ A;  5EWE A;  3KK1 A;  4AD6 A;  1TKX B;  2W4C A;  1P1T A;  3HD2 A;  3TEG A;  4LVO P;  4X66 J;  1UVL A;  4QW9 A;  2YKN A;  2F8H A;  4EI2 A;  1FHT A;  2C2K B;  3NWG A;  1R0C B;  3MPV A;  1TK0 A;  2ZKU A;  3PDN A;  3BQ2 A;  4ECS A;  3NL0 A;  2M5Y A;  4DL2 A;  3IM8 A;  4X66 F;  5F0U A;  2LQJ A;  1XNR F;  5AJ3 J;  2HVE A;  3DCA A;  1RAA B;  3VV2 B;  5HMX A;  3HHD A;  3F41 A;  1QE1 B;  3B4D A;  3B82 A;  1TL7 A;  2E1R A;  3HFK A;  2RQM A;  3ISN D;  4ZP8 A;  4OZ2 A;  4I2Q A;  4F04 B;  5J1E B;  4Y2A A;  2XTJ P;  1RHU B;  1ICE B;  2VFR A;  4K4U A;  3DDI A;  4WCE Q;  1HHQ A;  3I32 A;  2YPZ A;  1X4D A;  1CVJ A;  3QFW A;  4DV7 J;  4EUV A;  1FO1 A;  2OGU A;  2GVZ B;  3TJA A;  3IWL A;  2RDI A;  3FZB A;  2ZHB A;  4ZPT R;  2ILY A;  3QT7 A;  3KUE A;  4LF9 J;  3U7J A;  4RUB A;  2BW7 A;  1RBL A;  4UST A;  2KL8 A;  4WU2 A;  4GKK J;  2VQE J;  3C15 A;  5HJY A;  3CJ4 A;  3AD7 C;  3HDS A;  2HNY B;  7FD1 A;  5HVF A;  2IDE A;  4F4K A;  3ZFV A;  1TR0 A;  5HJX A;  3RGI A;  2A10 A;  2AKW B;  3GJT B;  4MTP A;  3JAM Y;  3EXC X;  5KT4 A;  4WFB Q;  1NJY A;  2XM3 A;  2A1B A;  1WEL A;  4RW6 B;  1SH2 A;  3L7U A;  3IR6 B;  2EBG A;  4ILR A;  2NYI A;  4LRD A;  4ZJO A;  2ZHA A;  2KZM A;  4Q44 A;  2F4V F;  3VAJ A;  2JLG A;  1I94 J;  1SH0 A;  2AMC B;  3MED A;  2HVI A;  2OH2 A;  5IT9 U;  4NXM J;  1K1Q A;  4ZN1 A;  4FNI A;  5HL7 Q;  4CYU A;  4CTA A;  3R1L A;  3OUY B;  2YNG A;  4DU7 A;  1T05 B;  2Z2Y B;  4KIA A;  2ZH6 A;  1KVI A;  5DZ7 A;  1HNI B;  3MM6 B;  4DSF A;  2HRT A;  3UW1 A;  2KRR A;  3A4T A;  1VFJ A;  2VFS A;  4HYK A;  4I1T A;  5BXI A;  2BV3 A;  1KS2 A;  4NLT A;  1VQ9 S;  1KQK A;  2QMW A;  3QAT A;  1QSY A;  3RRG A;  2X1F A;  1JLB B;  5GAH U;  3HVR A;  2DPJ A;  3DXS X;  3BDE A;  3L7O A;  5FDL A;  3K5P A;  3MFI A;  3CCR S;  4C0H A;  4EWT A;  5CYQ A;  4O4G B;  3KLG B;  1RTI A;  1WC1 A;  4HDH A;  5KFT A;  1VOM A;  1CJU A;  4ER8 A;  4NCG B;  1Y3K A;  1R7I A;  4Y00 A;  2ZH1 A;  2RNE A;  1U47 A;  1M5V C;  3Q0A A;  4EEY A;  4WYL A;  3W5X A;  1N32 F;  2KYX A;  2HHQ A;  2PMW A;  3A1Y G;  5KG5 A;  2ASY A;  2X1A A;  1CJK B;  3GIK A;  3C3L A;  2IM0 A;  2EBE A;  1XTZ A;  1TKD A;  4L6V 3;  5IWA F;  4IFY A;  2H5J B;  1M5O C;  1ZPW X;  2CWK A;  2VL1 A;  5HSP A;  2IC3 A;  4K8R A;  4WP3 A;  3ELH A;  1C4C A;  2R7O A;  1FWP A;  4ZVR B;  1IWA A;  3SQO P;  1FFG B;  4DS5 A;  1EP4 A;  3CIZ A;  4RBU A;  2HFS A;  2EW9 A;  2RQ4 A;  1C1C B;  2CVI A;  2WVE A;  2R4F A;  2ZOF A;  3LA0 A;  1XBW A;  4ZCK A;  2CG4 A;  3UPF A;  3KLH A;  1KKH A;  2OO4 A;  4DUZ F;  1IBM J;  1UJ4 A;  1HWU A;  1FKO B;  2YKP A;  4E98 A;  1FXL A;  2G4B A;  4QWC A;  2PEH A;  4IYQ A;  1RTD A;  2I2Y A;  5KFW A;  1HQ2 A;  3DDN A;  1S79 A;  1OSD A;  2F65 A;  1QAX A;  4X4S A;  4JI7 F;  3D7S B;  3GIL A;  2B6A A;  1FJE B;  5KFX A;  2KDO A;  5T7L A;  1SI9 A;  3NRB A;  4P72 A;  2MQP A;  1CBK A;  3CD5 A;  3OL7 A;  2Q43 A;  3W64 A;  3CMA S;  3IBF B;  2MXY A;  4DL6 A;  2UXB F;  2MMY A;  1RT2 A;  1U49 A;  5K8P A;  1SUQ B;  3A12 A;  1RP5 A;  3D6T B;  2GHW A;  4CO4 A;  2N82 B;  1N8R T;  4WXW A;  1B3T A;  3RW6 A;  1D09 B;  1O5J A;  1WTB A;  2DGT A;  3TNV A;  1HW9 A;  2M7S A;  2XMJ A;  5D3G A;  1GX5 A;  1VRT A;  3SCL E;  2M88 A;  2AJ4 A;  2JFD A;  3HD1 A;  3D3B J;  1XN9 A;  1TVR A;  4ECX A;  1IR2 A;  3JS9 A;  4OJ3 A;  3ZO7 A;  2ZBP A;  3QNW B;  1Y0H A;  2HFN A;  4QR1 A;  3VAF A;  1VRQ C;  2DYA A;  2Y1L B;  4KGV B;  4OYI A;  3M32 B;  2M8D B;  3K0J A;  3MMA A;  1TTH B;  4FKX A;  3R7B B;  3GYX B;  4FYY B;  2MQQ A;  3SYZ A;  4WF9 Q;  2LXF A;  3HVT B;  2UUB J;  2R8G A;  2RUS A;  4LUB A;  4OI3 A;  3QWU A;  2H1Y A;  4LT6 A;  1WAC A;  1ZTW A;  1FWL A;  3EGV A;  5LL6 d;  1WD6 A;  4AL7 A;  2GGP A;  4DOZ A;  2XHW A;  3NS7 B;  3GCX P;  3NGD A;  1YJ9 S;  3NMA A;  2ZH8 A;  4N8O A;  1VBX A;  4AXJ A;  2AZ1 A;  3UN5 A;  5M2U A;  2IPO B;  2K1R A;  3OJU A;  4EYH B;  4OYW A;  4EBE A;  2QMX A;  3OFH A;  4KE5 A;  3KG0 A;  4M5I A;  4ZJL A;  4PXC A;  3DOK B;  3FEZ A;  2BQ3 A;  1AZS B;  4KV8 A;  3TUZ C;  1ZA2 B;  3M2V A;  1UKU A;  2LEP A;  5E3Q A;  1RCX B;  3V6J A;  1S1T B;  5F8H A;  5I3Q A;  3M8Z A;  1BWE A;  1B0P A;  2XG8 A;  4MK9 A;  3UQS A;  4CM2 A;  3H8Y A;  1I6J A;  2XMK A;  3W2V B;  2LXI A;  4O3P A;  2HYI B;  3BBF A;  5AE3 A;  1X4H A;  4QYZ J;  2DGO A;  1TFY A;  2QL5 B;  3SDE B;  1GFW B;  1H2V Z;  4FPR A;  3KLH B;  2B9X A;  1FI4 A;  4F2S A;  3OFE A;  4K4X A;  1TMM A;  1N0V C;  2HK2 A;  3M1V A;  3QAE A;  2XLJ A;  1SKR A;  3H2V E;  3K5L A;  3PV8 A;  4C9D A;  3AOC A;  5KG3 A;  5C7P A;  4MFB A;  1U1K A;  2JC0 A;  3MGJ A;  4YOE A;  5L38 A;  2CJK A;  4QR2 A;  1YVF A;  2HPU A;  2JEJ A;  1RU2 A;  3I0S B;  4LFA J;  1G3O A;  1FK9 A;  3HJF A;  2E29 A;  3G6Y A;  4JI3 J;  2QV6 A;  2F4F A;  3DGP A;  2EC2 A;  2HNZ A;  2F40 A;  4KQZ A;  3RG6 A;  2C2E A;  5EX0 A;  1CPZ A;  1PBU A;  3DGV A;  4NA2 A;  3DFE A;  1VC5 A;  5HMY A;  1NAQ A;  1VRT B;  1RKJ A;  4TLR A;  3UCG A;  5IC4 B;  2LU2 A;  1LXN A;  1IKW B;  2FVP A;  3P8B B;  2JNJ A;  2JZ5 A;  3R5C A;  2MZ1 A;  3H90 A;  2G9O A;  3OR1 A;  1H2U X;  5EGY A;  4IUF A;  2E5I A;  1EB0 A;  5HLF B;  1RCO B;  2ZHO A;  5HQL A;  2OML A;  3IC1 A;  4NOH A;  4MAK A;  1WHV A;  3VVT A;  4CH1 A;  3HT3 A;  1HNI A;  3CC4 S;  4OX9 J;  4RW9 A;  2LQ9 A;  1EKS A;  1KTV A;  2DNN A;  2OMO A;  1U09 A;  2DHS A;  1U0H B;  3LGH A;  3IRW P;  4LFC J;  3ZTS A;  3S1T A;  2VV5 A;  3V6H A;  4QIV A;  3TRG A;  4OZ3 A;  1BWV A;  3O1L A;  5KT2 A;  1FKO A;  1HHT P;  1WKL A;  1VCT A;  2BUN A;  2N3L A;  3KHG A;  1T9W A;  1QVG R;  3UDE A;  3MPU B;  4NCA A;  4RBT A;  3ET6 A;  4WE1 A;  4WBF A;  2MTL A;  1M1H A;  3MR3 A;  2XY6 A;  1X9S A;  5I4M A;  2CZ4 A;  2MST A;  3FBC A;  5HVH A;  3LP1 B;  3BGU A;  1HNX J;  3MXH P;  4B3O B;  4WFA Q;  2CPF A;  4WFZ A;  5U47 A;  3G6X A;  1Q1K A;  3HF5 A;  4Y2I A;  5FJ4 A;  3AJ1 A;  3EMT A;  2KFY A;  4RLE A;  4JI7 J;  1XMB A;  2GJF A;  2NUU G;  2DEJ A;  5KFV A;  3BBC A;  3M7V A;  4B3M F;  3CDW A;  4ZHR B;  4DN0 A;  1ZYQ A;  2N7C A;  2XS2 A;  4PWD B;  4YN3 B;  1WC0 A;  2VU5 A;  2OJ3 A;  2QLJ B;  2QG9 B;  3HKZ D;  2HHU A;  5T41 A;  3T41 A;  4CLL A;  4QR0 A;  4UOF A;  3JXO A;  2Q1L A;  4DZ6 A;  3HX9 A;  2VPW B;  2KH9 A;  1N88 A;  4OJH A;  2BJ9 A;  3HO1 A;  3LPY A;  1U45 A;  4Y2M A;  3NNA A;  1SPB P;  1N0U A;  2ZUA A;  4ZLP A;  2I8E A;  5J1E A;  1RAG B;  3HFV A;  1U6F A;  1LEO A;  4H4O B;  3BB5 A;  1U48 A;  1QM9 A;  1IKV B;  2IJN A;  1HIY A;  3M2U A;  4B08 A;  1QD1 A;  4AQY J;  1N4L A;  4FBT A;  4PWD A;  1OPZ A;  1V5I B;  2VBX A;  4ZHR A;  3W9I A;  2E5L J;  5JVH Q;  3FVY A;  3JSM B;  1KD1 T;  4V19 X;  1ZH5 A;  2XHC A;  2O66 A;  3AQO A;  3R3T A;  5KT7 A;  4W90 B;  3G8Q A;  4EFA C;  1RT7 A;  4J9V A;  4U6P A;  4LF7 J;  3W65 A;  4CIO A;  2KFN A;  3LP1 A;  1YDL A;  1F60 B;  3R2D J;  2DNM A;  4XDD A;  4CLP A;  1KON A;  4URQ U;  4AE5 A;  7AT1 B;  4ED3 A;  3DOL B;  4I64 A;  4KY3 A;  3RW7 A;  1RT6 B;  2VBW A;  1T11 A;  1BY9 A;  1NRK A;  3R5A A;  1DTT B;  5DO2 A;  3VZI A;  4GC7 A;  3T3F A;  1VQ8 S;  1PYS B;  4M63 A;  5ETP A;  3M05 A;  2OTL S;  1TFW A;  3MF5 A;  1FA0 A;  2B5J A;  3FK4 A;  1U2C A;  2Y3Y A;  3LP0 A;  1HW8 A;  5IS2 A;  2CQ4 A;  4MYT A;  3UDC A;  2UUT A;  5KFL A;  4IOA Q;  1RWU A;  1S1V B;  2CWX A;  4NI2 A;  4C11 B;  1S9G A;  1TMJ A;  2YBV A;  1JJC B;  1R43 A;  2OSR A;  4C3K A;  3A8K A;  3BRE A;  4DR7 F;  5DLG A;  2HKE A;  2VFU A;  3W7B A;  1C0U B;  2ROG A;  1Z2L A;  2YNH B;  2VKZ G;  4UT4 A;  1FEE A;  2HHT A;  4WII A;  4ZVT B;  1Y9O A;  2JL9 A;  4F4W A;  4F67 A;  2FZG B;  2YNI A;  5L8R C;  3UDV A;  2RML A;  2IHR 1;  4QU6 A;  2W25 A;  1GXT A;  3POT A;  2WVD A;  1HNV A;  1SKU B;  2C3Y A;  2L48 A;  3AFG A;  4JI6 F;  2DR8 A;  4QBU A;  2PGC A;  2R2T A;  1WC6 A;  2OAU A;  2BZ2 A;  1PCA A;  3F73 A;  2Z2L A;  1S4F A;  1YKW A;  2XWX A;  3DGP B;  4WYW A;  2KRB A;  2OPQ A;  3W5Z A;  3EDQ B;  4DSK A;  3P45 B;  4DV7 F;  3TQE A;  5K5M A;  3IR5 B;  1FTR A;  1LWE B;  3C46 A;  4G3I A;  3TP2 A;  1HBM B;  5C2G A;  1MN9 A;  3T5L A;  1U02 A;  1YJR A;  4OIX A;  4JB8 B;  3A8E A;  1CS4 A;  4OI1 A;  1RAB B;  2JDJ A;  4IO1 A;  1EET B;  3DRR B;  3DOL A;  2HWI A;  2V8V A;  3MAH A;  2EKY A;  2J7W A;  1JLC B;  3HLU A;  3ZZY A;  1K8A T;  1REG X;  2XS7 A;  2I5J B;  2G0J A;  3MAA A;  4C8O A;  2K3I A;  1RKI A;  3KDO A;  3OTD A;  4M1K A;  4DX7 A;  2AJ2 A;  5A8K A;  2RT3 A;  2F63 A;  3BSN A;  5THW A;  5HAT A;  3UNY A;  2IYI A;  4AL6 A;  1S1T A;  4Y2C A;  3OPK A;  3UCZ P;  2HQD A;  3AXM A;  2ACY A;  2ZZT A;  4W92 B;  3KK2 A;  2WVB A;  1S59 A;  2WON A;  3OQ2 A;  4DPW A;  2WRM A;  2YTC A;  2DR9 A;  3D0I E;  1XNQ F;  1C0T A;  1R27 B;  2AX1 A;  2ALY B;  2K1R B;  2O1P A;  3EGN A;  4USW A;  3GII A;  1QLN A;  2DCU B;  4X65 F;  5A8W B;  2VUG A;  1F3V A;  3MI7 X;  2L08 A;  5AXL A;  4M5G A;  3ZTO A;  4HI1 A;  4K4V A;  3GR1 A;  1HAR A;  2MQN A;  2RQK A;  4HLB A;  5GAD I;  4X64 J;  1NK4 A;  3NBP A;  3MM7 B;  3QO9 B;  1HI1 A;  3LP2 B;  1FX4 A;  5B0G A;  5DLF A;  1YSJ A;  1PIE A;  4OLO A;  4G6V B;  3NXZ A;  4DFP A;  4N5S A;  4ZKA A;  4NX9 A;  1WHY A;  3V5R A;  4DF4 A;  2A2D A;  4C8L A;  4PXE A;  1PKU A;  2K2P A;  3HUL A;  2CFX A;  1JX4 A;  1HR0 F;  3I4H X;  4RU9 A;  2EEY A;  5F9L A;  1VQ5 S;  2UP1 A;  2P8I A;  4E2F B;  1NSK L;  4J37 A;  4K7Q A;  2XMU A;  3NEK A;  3R7S B;  2RQC A;  1E6Y A;  4ECV A;  2EG1 A;  3QGG A;  3V6D B;  2BR0 A;  2AP6 A;  2FLP A;  3KJF B;  2OD4 A;  3LAM A;  4P2M A;  3WX4 A;  4IDK B;  4DCO B;  4KHP F;  5GMK a;  4FDF A;  3CIM A;  1Y3J A;  4ECT A;  4I69 A;  3F56 A;  1VMB A;  3VAK A;  4O4R A;  2FHO B;  2RB7 A;  1JKH B;  2RE1 A;  4DV4 F;  4A8Q A;  1NKC A;  2CIM A;  1FCA A;  5J2P B;  4RNN A;  1YGY A;  2KM8 C;  1N34 J;  4PXD A;  5F8J A;  5I3P A;  2UV8 G;  3M9O B;  1GXL A;  1U0H A;  3C16 A;  3W3S A;  1KHV A;  2R42 A;  5KFH A;  1ZPV A;  5FLX Y;  1S9G B;  5L1K A;  1OPI A;  3ILJ A;  1U25 A;  2RVJ A;  1DY3 A;  3BH6 B;  5IOL A;  2UUB F;  5D78 A;  4WWS A;  1GTE A;  5B0F A;  4DUT A;  1YRX A;  1ELO A;  3CO9 A;  2VG5 B;  3O2I A;  2X1G A;  4Y65 A;  4YR3 A;  4K5S A;  3J7Y U;  3CMQ A;  2XNR A;  4K50 A;  1FRJ A;  2OSQ A;  3EJM A;  1EP4 B;  3WIU A;  2BJ3 A;  1X4E A;  3UR3 C;  3T9N A;  2ZFH A;  3C8Y A;  3US5 A;  1NUE A;  3KG1 A;  3ZZR A;  5L46 A;  3KLE A;  1M5P C;  4OHY A;  2XZW A;  2Q79 A;  4Y3C A;  2LA6 A;  1DQA A;  3TA2 A;  5IM0 A;  2DY1 A;  2QLW A;  2FD2 A;  1HI0 P;  4X4Q A;  3JSM A;  3I9V 9;  4HAC A;  2HHH J;  1RXO B;  2J0Q D;  1CJK A;  1FXR A;  2HGN A;  2HRU A;  4CLW A;  4DR2 F;  4EZ9 A;  3DRX A;  3J81 Y;  5KOX A;  4OI0 A;  1UET A;  2MKC A;  3VGV A;  4WTO B;  3M6V A;  1HI8 A;  3F44 A;  3PZP A;  1OY6 A;  1EZZ B;  1CQN A;  5E3R A;  3S8S A;  4DSI A;  2CDQ A;  4NLV A;  4ZIW A;  4NLG A;  2GNK A;  1FNM A;  3PR4 A;  1F2H A;  5KFB A;  2R7W A;  3IG1 B;  2B56 A;  2EFO A;  3FRY A;  4CLY A;  2QJ3 A;  2KJV A;  1HPZ A;  1NK9 A;  3QRR A;  2OPS A;  2HLU A;  3FJ2 A;  1XNR J;  2B0G A;  4ZVF A;  1HWK A;  1RT5 B;  3DRP B;  1L3U A;  2BM1 A;  4JI2 F;  5E41 A;  3K58 A;  4NXN F;  5D6G A;  3PO5 A;  2JHE A;  2J8S A;  1S1X B;  1IBC B;  4RR5 A;  5ETV A;  4CQ1 A;  3CDU A;  2EK6 A;  2XBP A;  1RHR B;  2HRY A;  3PFE A;  5A8K B;  2J7U A;  1NB2 A;  1CG2 A;  1BQN A;  2CPY A;  4P71 A;  2XMW A;  3HKW A;  4PYD A;  4CO2 A;  4DG1 A;  1RWP B;  1U8S A;  1RHJ B;  1FRL A;  1VLY A;  3ETM A;  5IT4 A;  3D9B A;  3GIM A;  1MSW D;  2HBY B;  1DLO A;  3PYD A;  5EN1 A;  1RB0 A;  5EDW A;  1K44 A;  3RAM A;  3PW0 A;  1TKZ B;  2V0N A;  4KRW A;  3GV7 B;  2HQC A;  2VG5 A;  4TVA B;  5E3C A;  5LSR A;  3OVS A;  1IBK J;  4DL0 C;  2JEF A;  2ZM6 F;  1M5K C;  3MMB B;  2BYC A;  2H9Z A;  2LEC A;  1FRX A;  4DQQ A;  1SVD A;  3L7P A;  2UVV A;  4KGK A;  3R9L A;  1VQP S;  5D0R A;  2E9Z A;  3MCN A;  2MY7 A;  3D66 A;  1VRU B;  2K8G A;  1WKK A;  2OKQ A;  4KH1 B;  2CPJ A;  2AEF A;  3ZXW A;  5GAE U;  2MSS A;  2DNZ A;  1M90 T;  3CCV S;  2MZQ A;  1M0S A;  1U24 A;  2OP5 A;  5B0C A;  4PXB A;  3SV3 A;  4PQU B;  3OBI A;  4IOB A;  1WF0 A;  1U2F A;  3D4J A;  1VIO A;  2AYM A;  2HBZ B;  2EFP A;  4ID8 A;  2JJ4 D;  3CE8 A;  4CLU A;  5F8M A;  1YJN S;  1VRU A;  3FMW A;  3KKF A;  4JOU A;  5DM6 Q;  1RT1 A;  2UU9 J;  2UVU A;  3N01 A;  5T7L B;  2YKO A;  2UUW A;  3OHB A;  4NYP A;  1QSS A;  4FF3 A;  2Z4P A;  1SCJ B;  2JWN A;  1XEZ A;  3JTN A;  1C1B A;  3D0H E;  1U2R A;  2B5J B;  3AA8 A;  3MMB A;  4NLW A;  3ZZP A;  5DGB A;  3Q8Q B;  4UQT A;  1HKA A;  2ZBR A;  4DQS A;  2ZH9 A;  4LF2 A;  1UTA A;  1IUJ A;  3BJY A;  2ZM6 J;  3A8I A;  3NBP B;  1GTH A;  4J9N A;  1DLO B;  1ZET A;  5KFF A;  4LF5 J;  1NK0 A;  1ZTT A;  4NYZ A;  4B3R J;  1MN7 A;  2BXJ A;  2F1F A;  2PA8 D;  3JQJ A;  3O8W A;  3BM7 A;  4DN9 A;  1FDD A;  1FD2 A;  3VAH A;  3EGZ A;  2P5V A;  2XUL A;  3OTO F;  1IKY A;  1RAJ A;  1S9E B;  2BRK A;  4IFY B;  4NYO A;  4DR4 F;  3CCE S;  1GEH A;  2P9C A;  3DYA B;  4RWW A;  2RHS B;  2WK4 A;  2YKQ A;  2DO4 A;  1XWL A;  3TEH B;  1MNE A;  4ZP9 A;  3TVY A;  5DDO C;  2W2N P;  4OX7 A;  5M2R A;  3HHE A;  3W61 A;  4DFM A;  4H4O A;  1D8Z A;  1HHS A;  4IR9 A;  4JV5 J;  1U6Z A;  4RNM A;  1F3F A;  5GAE I;  2IIH A;  4IO9 Q;  1RAI B;  1APS A;  3IG1 A;  2RS8 A;  2XLI A;  2FVC A;  3DRS A;  5KAK A;  3M6U A;  1FNX H;  1T9T A;  4AUK A;  3S01 A;  3JYT B;  1S0N A;  2WW4 A;  3DRR A;  4LRA A;  1W25 A;  1WG5 A;  3QT8 A;  2H51 B;  4KKO B;  2HHW A;  1VC0 A;  2XGP A;  1H0H B;  1NJI T;  2XNQ A;  4OI2 A;  4X4R A;  5JMN A;  2RF2 B;  4UOC A;  3HHN B;  3EGW B;  2VDH A;  3PRB A;  4U8V A;  1KQG B;  1S12 A;  2B4U A;  2NS1 B;  2JRS A;  3HFZ B;  5LOQ A;  1T05 A;  3C2P A;  4O44 A;  2CRL A;  3EUN A;  5KFC A;  1N34 F;  4DF8 A;  5KG6 A;  4DXL A;  1HBO B;  1RT3 A;  4TKT A;  4DV2 J;  3MM9 B;  2MKJ A;  1JWW A;  4NLY A;  1CUL A;  1HA1 A;  3OXL A;  1JJH A;  3OXG A;  2AD9 A;  1N36 F;  3JAM U;  4P6Q A;  3QMQ A;  1VQ6 S;  1BGX T;  3WIV A;  2ZH2 A;  5H9E K;  4KC5 A;  2C3P A;  1FJG F;  3CME S;  5KFD A;  3EIC A;  1J5O A;  1ARO P;  3CB4 A;  2I1R A;  2YX7 A;  1ZA1 B;  2FHM A;  3ZZZ A;  3DNC A;  4KO0 A;  1DRZ A;  3OSP A;  5DQG A;  2CQ0 A;  3CCL S;  7FDR A;  3DN9 A;  2WCX A;  3THP A;  4WFN Q;  2QLX A;  2RU3 A;  2CQC A;  4J9O A;  3V4I A;  3PW4 A;  1HNZ F;  4GKJ J;  2HZV A;  3H5X A;  4DPY A;  1SB6 A;  2D9P A;  1KFS A;  2PII A;  3Q23 A;  4DV1 F;  5ADZ A;  3IXQ A;  1YRT A;  3NAI A;  4HKQ A;  4RW9 B;  3ADA C;  5KG7 A;  2E1A A;  2GIR A;  2GIQ A;  2KI2 A;  2W2P P;  1WKJ A;  2Y1R I;  3IBW A;  1N5Q A;  2BJ8 A;  2E1M C;  2M4M A;  2H4W B;  3NGT A;  3PTW A;  2D9O A;  4TYA A;  5KFP A;  1NJW A;  4DX5 A;  3MOJ B;  2GC8 A;  3QID A;  4HTJ A;  3PXG a;  4B3O A;  2HFZ A;  2OEL A;  1NPP A;  4ZVO B;  2M9K A;  4OYZ A;  3LAN A;  3PCO B;  4KO0 B;  2PEB A;  1KN6 A;  2XMT A;  1C1C A;  2AIR B;  4CZC A;  2DNP A;  1G7C B;  4RW7 A;  3OLA A;  1DQ8 A;  1E6Y B;  2ROE A;  3O5T B;  1IXK A;  3CDE A;  2MGZ A;  1T9V A;  3WBZ A;  4J9M A;  2IJF A;  3M2R B;  4ZVU B;  4A8X A;  1QAJ A;  2FVR A;  3MM9 A;  1S0M A;  5D4O A;  1KHW A;  4O3R A;  2E1C A;  1TZ0 A;  2MZJ A;  4Q45 A;  4O44 B;  1AA1 B;  2GO9 A;  3C19 A;  3SCI E;  1NDC A;  3M2R A;  4ECQ A;  4AL5 A;  1RHK B;  2F7V A;  4OZ1 A;  3M2U B;  5FLX U;  2VON A;  1YJT A;  3JTP A;  2RD5 C;  1X5S A;  2RIL A;  2RIJ A;  3BBB A;  2RH3 A;  3HVW A;  4LF1 A;  1CJU B;  4WZM A;  4OYM A;  2AEM A;  3I0R B;  5HQ8 A;  4I0W A;  4X4O A;  4AYB D;  3HI9 A;  3RBZ A;  3OTO J;  5LMU F;  1VQO S;  1BD6 A;  1HQE B;  3JQK A;  4DBQ A;  3CCT A;  2NRE A;  4ZLL A;  1G4C A;  3E8O A;  1WC5 A;  3THT A;  3RAQ A;  3ILO A;  4XIU A;  2W9C A;  4DFK A;  2GAG C;  1M1K T;  5C25 A;  4F7V A;  3M9N B;  1MRO B;  1UMJ A;  2D69 A;  2EFG A;  3J81 j;  4DQR A;  2Y1J A;  1YJW S;  2N3O A;  1AZS A;  3FBE A;  3HSG A;  4QJV A;  4DL5 A;  2RHQ B;  3K8V A;  1XQI A;  4QWB A;  2YKM A;  3M8Y A;  1TUW A;  4MKB A;  5J1P A;  4RKU C;  4CH7 A;  5H9F J;  1OYD A;  1J5O B;  3NGS A;  1SC6 A;  2QA4 S;  3KDN A;  2JVO A;  4J9S A;  2B9W A;  4ZA1 A;  5KFG A;  4KAI A;  2DNH A;  2ZIT A;  4DR6 J;  3CXC R;  4IH5 A;  3QT6 A;  4A47 A;  1V3Z A;  2DNR A;  3GFX A;  2A18 A;  3HVT A;  4PCQ A;  1N52 B;  4ED4 A;  1IR0 A;  5CD4 H;  3RBD A;  4RPF A;  1XER A;  3MMA B;  4BC7 A;  1LWE A;  1C1B B;  1MML A;  2IBO A;  3FCV A;  2VPZ B;  4H4M A;  2ZNY A;  3H59 A;  2WVF A;  1NPK A;  1NH8 A;  2Q6C A;  2GVD A;  1S6O A;  1XR5 A;  3CGI A;  4NRT A;  3TZY A;  1PC5 A;  1B0V A;  4OJ1 A;  3VQT A;  4X64 F;  1VQ4 S;  2LDY A;  1QUP A;  3BR9 A;  2MB0 B;  2EFV A;  2V4R A;  1PG5 B;  3FRZ A;  3D1O A;  3OD2 A;  4DR5 F;  2DCL A;  3AOB A;  5D4P A;  3T6J A;  5J2Q B;  3A13 A;  4RNF A;  3TAN A;  1Q53 A;  4ECZ A;  5KFQ A;  1FXD A;  4A8M P;  5H1S V;  4UUW A;  2ASD A;  1RYS A;  1K73 T;  3CCM S;  4B9S A;  2ROP A;  4F2R A;  2QN6 B;  3V81 B;  1O0P A;  2ZD1 B;  3DLL Q;  2CPE A;  1Z1Z A;  3HPO A;  4R0J A;  3V4M A;  3H2L A;  4RU2 A;  2CA9 A;  2VPX B;  4ZLN A;  2Z0G A;  1AUD A;  4ED0 A;  2DPI A;  4FXD A;  3D3C J;  2CNO B;  5SZT A;  3K57 A;  4EYI B;  1NDL A;  5D4L A;  1CJV A;  1DAX A;  1Y11 A;  2QE5 A;  3I9Z A;  4JI2 J;  3MMJ A;  1A9N B;  1L3T A;  3QPI A;  1B7Y B;  1NCL A;  3QGI A;  4DMZ A;  3J7Y I;  4U7U K;  5IT9 Y;  2CQP A;  1DTT A;  3Q2T C;  3M1V B;  3HCX A;  3VWS A;  3HHL A;  1B70 B;  2C2M B; 
#chains in the Genus database with same CATH homology
 1I51 B;  2XZD B;  2H5J B;  1NME B;  1IBC B;  1RHM B;  2HBQ B;  1SC1 B;  3R7N B;  1RHR B;  1RWV B;  4ZVR B;  2H4W B;  1RWP B;  1RHJ B;  1RWK B;  2CNN B;  2H48 B;  2HBY B;  4ZVO B;  3GJS B;  2QLB B;  1RWX B;  5IC6 B;  3D6M B;  2XYG B;  1F9E B;  4ZVU B;  2XYH B;  3P4U B;  3IBF B;  1SC4 B;  3D6F B;  2C1E B;  1RHK B;  4ZVS B;  1BMQ B;  2QLJ B;  2QL7 B;  2HBZ B;  2C2K B;  3QNW B;  2C2O B;  2CNL B;  3R7S B;  2Y1L B;  3KJF B;  3KJN B;  3R7B B;  4DCO B;  1RHU B;  1ICE B;  1PYO B;  2QL9 B;  3NS7 B;  2Y0B B;  3R5J B;  4DCP B;  2C2Z B;  3GJQ B;  4LSZ B;  2H54 B;  4DCJ B;  2QLF B;  3R6L B;  3D6H B;  2FQQ B;  3SIP B;  1I3O B;  1RWM B;  3GJT B;  2CDR B;  2HBR B;  3GJR B;  1SC3 B;  3IBC B;  2H4Y B;  3KJQ B;  2QL5 B;  1GFW B;  2H5I B;  2H51 B;  4ZVT B;  1RWO B;  3RJM B;  1RWW B;  2CJY B;  1QTN B;  4ZVQ B;  1RE1 B;  2H65 B;  1RWN B;  2XYP B;  1PAU B;  2CNK B;  3EDQ B;  3P45 B;  2P2C B;  2CNO B;  1QDU B;  2DKO B;  5IC4 B;  2CJX B;  2XZT B;  4JB8 B;  4ZVP B;  5K20 B;  3EDR B;  3R6G B;  1RHQ B;  2C2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...