2XZDB

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
CHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xzdB00
1QDUB 4ZVTB 1RE1B 1RHRB 1RWXB 1RHKB 2C2ZB 2H65B 1RWPB 1F9EB 2CDRB 5K20B 4LSZB 1PAUB 3P45B 3EDQB 1RHQB 2CNNB 2CJXB 3IBCB 2XYGB 2QLJB 1NMEB 5IC6B 3RJMB 1SC4B 2C2KB 4DCPB 2XYHB 1I3OB 3IBFB 2CNOB 2XZDB 3GJTB 1I51B 2HBZB 2QL7B 1IBCB 4ZVQB 1GFWB 1RWKB 3D6MB 3R5JB 1QTNB 3KJQB 1PYOB 3SIPB 3R7SB 2H51B 4ZVSB 1BMQB 5IC4B 3GJSB 3EDRB 4JB8B 2H4YB 3GJRB 1ICEB 4DCOB 2P2CB 2CJYB 2QL5B 1RHJB 2H48B 3KJFB 2QL9B 2HBQB 3NS7B 1RWOB 3KJNB 3QNWB 2C2MB 2Y1LB 2C1EB 2XYPB 2H5IB 1RWNB 4ZVUB 1RWMB 2HBYB 3D6HB 3R7BB 1RHUB 4ZVOB 2H5JB 1RHMB 2QLBB 2DKOB 2FQQB 4DCJB 2CNLB 3P4UB 1SC1B 3R7NB 2HBRB 1RWVB 1RWWB 2QLFB 2H54B 2C2OB 3GJQB 2H4WB 4ZVPB 3D6FB 4ZVRB 3R6LB 2CNKB 1SC3B 2Y0BB 2XZTB 3R6GB
chains in the Genus database with same CATH superfamily
1VLYA 3O1LA 1NHVA 2R2RA 3A13A 1KLMA 2RUGA 3E8OA 3ZTPA 5KFCA 2G1HA 4NLPA 1XMOF 1FKAF 2RD5C 3T5JA 2BRLA 4KGZB 3EPGA 4DR3J 4UOHA 3KUGA 2RDIA 2BXJA 4G1QB 4NYPA 5DQGA 1N5QA 2NLWA 3AJ2A 1KN6A 4F4ZA 3HSDA 3TA2A 3GJRB 3AY0A 2QJ3A 3KNAA 1U2FA 1S10A 1EARA 2A3JA 2LQBA 2XI3A 3TUIC 4DV4F 1HBMB 2QSWA 4ALZA 3PFEA 4CI0B 2XYPB 1FDDA 2MHEA 3OQ2A 2AYEA 1PGZA 1DJ0A 2G9OA 4IDKB 3DRSA 1LW2B 4JI6J 1UEKA 2BJ8A 3M8PA 3IS9B 3IWNC 1CS4A 2KRRA 1IBKF 3G87A 2BYCA 4KPCA 2UP1A 1UTAA 2W2OP 2IJNA 5E3CA 4EZ9A 2O1PA 3AQPA 4BC9A 2EK6A 2KJWA 4ZJLA 3UNYA 2A6MA 1R8CA 1IQZA 1OSCA 1EAYC 2DNYA 2CNNB 4LF9J 2C28A 1CEZA 5F8MA 5C42A 2OEMA 1AYEA 2UVUA 2HHQA 1HNVB 3MMAB 4CH0S 3JQMA 3LP0A 3HJVA 4P10A 1KVJA 2V94A 1UEUA 2LQJA 4JV1A 1NDLA 3LANA 1UMJA 3AD7C 1XWLA 1Y4ZB 4P74A 1VK8A 3G82B 1M5OC 3GV8B 4OZ1A 5CD4A 3I9V9 4DFPA 2HNYB 1HNIA 2JEJA 4M5HA 4B3TF 3OD2A 1FD2A 2YKPA 2JLFA 2LKZA 2LEBA 4PYDA 5HJYA 4LBHA 3KMSA 3T19A 1UZDA 1RT1B 1RT7A 2CZVC 2FJWA 2UXDJ 1S1UB 3OTOF 1MN7A 2MMYA 2Z2ZA 2JLGA 2Y0BB 1Q16B 3FMWA 4OHVA 2FVCA 4KBIA 4E8UA 3HHKA 1SJ1A 4RWXA 3M1VB 4B3RF 3IO1A 4BLGA 3CDBA 4X62J 2C3MA 2V5HG 3RYLA 1O0PA 3EUNA 1H73A 4FYYB 5F8JA 2HPUA 2H5EA 2FJDB 2J7WA 4Z37A 2X1FA 3ELHA 3I96A 3Q0AA 1PO6A 1S9EA 2DBBA 3T1YF 5I3UB 1JNZB 3IWXA 3POTA 1GFWB 1U7LA 4KH1B 4KT0C 4IQXA 5D0HA 3H2LA 1IR1A 1F60B 2V8HA 2A18A 2J5AA 3QATA 4K4TA 2DXFA 4MKVA 3ETOA 5KTQA 3TEGA 2LQ9A 2RKIB 4B3MF 5K8NA 1TV6B 3QYYA 2WVCA 3BBCA 3BPSP 1NZ8A 3TA1A 3DOMA 1JLGA 2D3O1 2ZBCA 3CCWA 1CJUB 3UVJA 1ZA2B 4NA3A 4KHMA 3I4PA 5E2QA 1U8SA 1UVIA 2O5DA 2CPDA 3TVYA 4K5RA 4WYWA 3GFHA 3QRQA 2CPJA 3HO1A 3Q8YA 4NZ0A 3RW6A 2DNOA 4OV6A 4Y2AA 4I6WA 4L74A 1RWUA 1S1VB 1RAHB 3DHWC 1DQ8A 1EB0A 3R5AA 2D41A 3RR7A 2OKQA 1MMDA 1F9EB 2CQGA 2MB0B 4UZCA 3CT9A 3RAMA 4DR6F 2AJ0A 3CCUS 2V4JA 3DLBA 2PC6A 1RAFB 4UQGA 3DNCA 1S9GA 1TAQA 1WOOA 2GIRA 4OX9J 1RWKB 3R27A 4HH0A 4KO0B 4NA2A 3SMZA 4I0WA 2J6SA 3IWLA 4YB7A 4CLPA 2XZWA 4KIAA 5DGBA 3TZZA 4YN3B 2MEWA 1Q53A 4NLSA 2GVZB 2ZFHA 1WG5A 3KLFB 2J0XA 2EC0A 1B3TA 1CJVB 2NSCA 5KT6A 2JSXA 1QAYA 2XSFA 4DR1F 5FDLB 2FHOB 3IN5A 3MTJA 1MMLA 4FKXA 4XDCA 1N6QA 3GPAA 3GR1A 1YBAA 3NEKA 4J90A 1BQMA 1XR6A 2KVIA 3BEGB 2IFXA 4OV1A 3MECA 5F0UA 3TJ9A 3B4DA 3CCZA 4PWWA 3TZYA 2H65B 4ECRA 3F44A 3NS5A 4DF4A 2VUGA 2OUGA 5KOXA 2YNGA 4LF6F 2P9EA 2VC0A 3HPOA 3EMTA 3EM1A 3A8EA 4CH1A 2MJNA 3KG0A 1FI4A 3G86A 4QWAA 2B9EA 5J2QB 3IM8A 5IM0B 4FYXB 2DVIA 2DJWA 5ETPA 4NCGA 4X84A 3UR3C 3OL7A 3ZNUA 3H40A 3DDKA 5D4NA 2C3YA 3FZBA 3N0VA 1F9FA 3OR2A 3LQVA 4CQ1A 4ECWA 2W2MP 6FDRA 2F8EX 4C3MA 4LJMA 3M7VA 5CQGA 1G3OA 2DH9A 2HZCA 1PJ6A 5AXMA 3F56A 1SC1B 4URQU 3TUZC 3MM8B 3N5BA 2VF3A 1UVNA 1V6HA 2HZAA 2RF2B 3UN5A 4F0KA 1FRMA 3BDEA 1JXVA 4K4WA 1JWWA 2DK2A 1HARA 4ZJQA 3BQ2A 5GAHI 4ANEA 4KSEB 2ROEA 3P45B 2RU9A 1IR2A 2VDHA 2MSTA 4KKOB 2DR7A 1U8WA 2W4PA 3IBCB 3I0SA 4B9LA 3MEGB 3MR5A 5IC6B 1C1CA 3C14A 1HR0J 2O3DA 2FDNA 7FDRA 3KJQB 2EI5A 3K0JA 4ZVSB 4IO1A 1H7XA 2OD4A 5KFAA 3NMRA 4L3NA 2ZH4A 1SH0A 2Z56B 3QNWB 4AT1B 2WZ1A 4ZVGA 1RBLA 1TVRB 2E9TA 4RKUC 4ZIWA 4ECTA 2AU0A 1A0OB 4H4OA 2FC8A 1S1TB 3MM5B 1HD0A 2HVDA 5KFQA 1YGYA 4ZP9A 3CCQS 1EETA 3J80Y 1KONA 4L73A 2GHVC 1ELOA 1C0TA 2GJ2A 2N4DA 2OPPB 2CADA 1LW0A 2B56A 2DHXA 1GXUA 3M32A 2XSJB 2WTFA 3SEOA 4CO4A 2ASLA 4I2QA 3KLEA 3GLJA 1JQGA 2JNJA 3PACA 5CYQA 3NBPB 4DV7F 3M8RA 3RRKA 2VFUA 4USHA 1XNQF 1RU2A 4EWTA 4FYVB 2RU3A 4HVZA 2HVHA 2E5IA 2MKJA 4HDGA 5HMWA 1VC0A 3E01A 4JB8B 2IRUA 2HQFA 3DHXA 2BKPA 1JXLA 3CCRS 2CZ4A 1V5VA 3M05A 1K1SA 4MYTA 3H5XA 2IM1A 4LBPA 4OI1A 4CLWA 5HMZA 1VHFA 4QU6A 1NPRA 2KG0A 3FBCA 4NLDA 1D3WA 4LFCF 1SH2A 2FJVA 2DISA 1KVIA 1S7HA 1JLAB 3I55S 3C2PA 5IV4A 2V34A 2RRBA 3BREA 3M2VA 3IRXA 2JX2A 2XO6A 2LYVA 6FD1A 2WSEC 3R6GB 3DLHA 1QDUB 2KZZA 1GEHA 4OHWA 4AL5A 1FKOA 3KHLA 2R8HA 2VG7A 2IAJB 4DLGA 3L3CA 3RAXA 2CJXB 3OL6A 4YS2A 2HW3A 2WBRA 3RJMB 3HF5A 1HBNA 1RTDB 2OMOA 3D28A 4CTAA 2XNQA 4RU9A 4PG8A 5HVFA 3CEDA 1RTJA 3VGUA 5BXIA 1T9UA 3FFIB 4MKYA 3OXFA 5CCLA 3ENWA 1T03B 3QT5A 2OPRB 3KJNB 4PABA 2Q43A 1R8HA 2HNDB 4WBFA 4CCHA 2RSQA 3PRBA 2YWHA 3DCAA 2HAFA 2ZDPA 4LT6A 2DNQA 2FQQB 4OYIA 4JI8F 2QT7A 2JEFA 3PX6A 3LTOA 1B0VA 1NB2A 4FPRA 3SFGA 4TYBA 1X4DA 3L7OA 1H2TZ 2Z58B 4ZHRB 1U2CA 3CXCR 1UVLA 2EFGA 4GO7X 1FEEA 1WC0A 3KLIB 1OJ4A 2XCAA 2FZGB 3QJJA 3P5TL 1F6TA 5HN0A 4YB5A 2PT0A 1FO1A 4WXOA 2RILA 1GMVA 1GT8A 1WHYA 5T41A 2Y8WA 4QIGA 1FX2A 3R1LA 1T9VA 4DX5A 2BOAA 2ZH1A 3OSPA 2QFJA 1U09A 1JX4A 4B3OA 2XLKA 4G1IA 4QYZJ 2IVMA 3MR6A 3KK2B 4WFYA 1Y3KA 2PGCA 3IGVA 4CO0A 3Q2SC 1NHUA 4WYLA 3QAUA 1RT3B 1TKZB 4ZVUB 1NM2A 3G8QA 4RNOA 2DCUB 3GMGA 1FTRA 2FPHX 1HNZF 2P5VA 3BGLA 3AODA 4F3QA 2IRYA 3HVTA 1NB7A 3MWBA 2HS0A 4OZ3A 1OPIA 3BN4A 3M30B 3HSGA 4N76A 3NGTA 1IJEB 2YX1A 2D3ZA 1TL7B 3OUYB 2FVPA 1TELA 2JVOA 4DR3F 4EBEA 3MUMP 2YWWA 2IA6A 4IRKA 3D9BA 3PW2A 3D5MA 2HNZA 1IWGA 3G6YA 2IJFA 3KLGA 1N54B 3KLHA 8AT1B 4TQSA 3H5YA 2OSRA 2ZBQA 5F9NA 1P9QC 3DLGB 3AJ1A 4DCPB 2XYHB 5L9XA 5GMKa 4C8MA 4W90B 4G1PA 2DXDA 2KM8C 2DY1A 3LPYA 1T8EA 1B64A 4JI6F 3W2VB 2QL5B 2R42A 4K0KJ 4I69A 4UUWA 3MM7A 5K8PA 1TK0A 4B02A 4F7VA 5CYJA 1UEVA 2QMUB 4RW8B 3A3PB 4J9MA 4LF4J 2KKHA 3I9ZA 2WCXA 2CVIA 1RLCL 5KG0A 4DPXA 2WVFA 4WP8A 3NCPA 3WC2A 2H3EB 4F4AA 1TUVA 3SSQA 1U1QA 4DQRA 4J9NA 1VR6A 2HLUA 3PJXA 4TY8B 3QPIA 4DFMA 4LF9F 1VQ6S 2G0CA 4UF4A 4LF5J 1X7VA 3CJ3A 1NO8A 5ETRA 2UVWA 1JKHB 2VPYB 3GV5B 2UUCJ 2EFNA 1HW9A 1KRPA 2CFXA 1YSJA 2KXFA 3NCQA 2GAHC 3Q23A 1X9MA 4RW9A 5JVHQ 2NXUA 3HZEA 4KHPJ 2OMLA 4A8FA 2LVWA 3HZGA 4N56A 4ZDNA 5J2MB 3W66A 2EK1A 4GO5X 2AX0A 4J9RA 2DRAA 4FVCA 3WDOA 3DRPA 5BYQA 3OV7A 5DG8A 3CC4S 1IM4A 2UXDF 2EWHA 3W65A 1LWEB 2ZZNA 2ERRA 3WQPA 3OL9A 2JOQA 3BDPA 4MIBA 5CZXA 3CDWA 3B8HA 4N77A 4X62F 2AF6A 4M5IA 3K58A 2OLWA 4AQYJ 4OIXA 3THTA 2XMJA 1X8DA 1N5YA 2ADBA 3BO2A 2IIHA 5GAHU 3AB2B 3CJ4A 2DT9A 4B9UA 3IR7B 5EWEA 4YR2A 4EEYA 1PAUB 2W4DA 1TKTA 4ILRA 1QY7A 4O3QA 3RRHA 2ASYA 3W61A 1S97A 4ZCLA 2BX6A 2CNOB 2DHHA 1UW9A 4LR8A 4LVNP 5K5MA 2HHSA 5M2RA 4PEOA 2M8DB 3PEHA 1I6JA 2HGNA 3CSKA 1TL3A 4ER8A 2G4BA 2KT5A 1LWCB 3I4HX 3DRSB 2CQ2A 2GO8A 3O5TB 1HWJA 3QSYB 3TYTA 5LOQA 4TU8A 4JI7J 4R8UA 5IT9U 5IV3A 4J9KA 1K0TA 1SPBP 2Z2LA 3MUVP 1XC9A 1S1WA 4Y3CA 5KAKA 1E6VA 1J27A 1J5OA 1Q7YT 1F5AA 4UY85 1YBTA 3BV8A 4O23A 4WZMA 2EFQA 3PXGa 1VIXA 3H25A 2PD1A 1N8RT 2FVSA 4USKA 4OX9F 3MFIA 5C42B 3MTKA 3Q86A 1F3FA 1QUVA 1AUDA 2AHOB 4PXDA 1FK9A 3D7SB 4ZPCA 2YNHB 4I6YA 3CB4A 1HYSA 1RAIB 1RKIA 2Z2YB 5DO2A 1JXEA 4N5SA 4OI6A 3CWJA 5F8LA 3G6XA 2OH2A 2LCWA 2HK2A 2AJ4A 2I2YA 4KYZA 2X51A 1NDCA 4Y34A 1IJFB 1CBKA 4K2XA 1S0MA 3TUJC 5LSRA 1HMVA 2C2RA 2VA2A 2ILZA 4RX6A 3BBBA 2B4VA 4YHHJ 1UAWA 2P9GA 4C3KA 1C4AA 4HT7A 5B0AA 1R0AB 1UZHA 2F7VA 4FF4A 2R4FA 3PR4A 2GFFA 2E7WA 3OJUA 5IQ6A 3NGSA 2C2OB 2JZ5A 1HNWJ 2ZOGA 1TP7A 2LEAA 4BBYA 1X5OA 1U4BA 1H98A 2VBYA 1YK9A 1EHWA 2LXUA 4C2MA 4DQPA 4DR5J 5BJRA 4KV8A 1S9EB 2WW8A 1RISA 4F2RA 1SC6A 4NOHA 4ZPBA 5JJBA 1CC8A 3GJTB 4I1TA 2XY7A 5E3PA 4FXVA 2FLLA 4IUFA 4QU7A 3EDRB 4PWUA 5HVGA 3DN9A 1DZ5A 3UVJB 4XPEA 2WVDA 3FBFA 3HVWA 3TAMA 2BE2A 2AX1A 4NCBA 2EXUA 1X4GA 4DHVA 3ITHA 4HTIA 1WKLA 3DXBA 1R8AA 2YNIB 2LQ8A 2AKWB 2HVZA 3H5UA 3OR1A 2XMKA 4PAAA 3CO9A 4S0MA 2GCFA 2DO4A 1HR0F 2C2ZB 2IM3A 3DLJA 5HP1A 3V4IA 3DLKA 4RBUA 3C8YA 1S9GB 1RT4B 3KNGA 3WX4A 2IBOA 4C8KA 3AA8A 2JFDA 2QLJB 2FVQA 1TK8A 5J1NA 3NOCA 2W2NP 4FYWB 1S77D 2VASA 3CGIA 4O44A 3GU0A 2UXCJ 4MAKA 2G2ZA 3ZNJ1 1JIHA 3A4TA 2MSSA 1RK8A 2MQMA 5ETTA 1RU1A 2P2CB 4UZBA 4PUOB 4WP9A 3C15B 1VRTA 5K8MA 2KI2A 5CCMA 5LL6d 3DMJA 2DNMA 1N6QB 2M2BA 2RH3A 3T1HJ 1E6YB 4Y0FA 1BQMB 4ZP7A 1YQHA 4N41A 3R7NB 1XQIA 3I0RA 2H1YA 3MECB 4DN0A 2G2OA 1OWXA 2CPEA 1T9WA 3JQJA 1U45A 1LWFB 1RUSA 4Q43A 2YQ1A 5C24A 1WDDA 5FJ4A 2HHTA 2CPXA 2AD9A 4Q2MA 2CJKA 3MD1A 2N4CA 3BM7A 1B70B 1M1KT 1N5VA 2CG4A 1R0CB 1YBUA 2D1CA 2V50A 1RCOB 2LA6A 4ED0A 2M9KA 2AEJA 4TNOA 5K14A 2BABA 3JYTA 1I94J 2C2EA 1U26A 5C7PA 1WOSA 4CNYA 3W62A 4AL6A 1MN9A 1S4EA 2YVSA 2CA9A 4Y6IA 3KJVA 5B0BA 1X9WA 2EG2A 4PWDB 3JAMY 1Q78A 4Y2IA 2DHGA 4IOCQ 3CUNA 1FESA 2LDIA 3KK3A 1HD1A 2ZH6A 2WB4A 4ECQA 2ZD1B 2MZJA 1RAGB 1EQMA 3CCTA 1H72C 4F67A 1U1MA 2V63A 2MDAA 2ZH7A 4WFZA 1EZZB 1FVSA 1S9FA 3KHRA 1TKDA 3V6HA 4Y28C 4ZIVA 1RAOA 3I82A 3ZZOA 3SQOP 3I0SB 3SSSA 1C1CB 5H9EJ 3C14B 5LXYA 4ED6A 1F0XA 2MKIA 2BKNA 4ID5B 2IY5B 4DL0C 3QLHB 2HGMA 3WX8A 2R7XA 5A76A 2KTQA 2ZKUA 1Q81T 4NXMJ 2FGCA 2YWGA 2DGVA 4UTGA 3NL0A 3LA0A 2NCKL 2QLXA 4J9LA 2DIUA 2XGQA 2Q6CA 4IRDA 1S6PB 1YG0A 3CF5Q 4OI4A 3P96A 4FBUA 3D6HB 4H4OB 3PW4A 2G0IA 1O8BA 1SIWB 3NOGA 3TANA 1IKYA 5M2UA 1BQNA 2ZUGA 3RTVA 1T9XA 3PNIA 2AEMA 5C25A 3K5PA 2YKMA 4PCQA 2KM8B 4DSIA 1LW0B 1T9YA 3M32B 1JLEA 5LM7E 4X4PA 1LQ9A 1MWQA 2AYGA 3PHTA 3W60A 1IVZA 5CYQB 1R31A 1K1QA 1DLOB 3OVSA 4XK8C 5L9NA 2ZJRQ 1Z2ZA 5CD4H 3LP1A 2CPZA 1N5SA 5E41A 1S0NA 3N01A 2OFHX 1FE4A 4G65A 4OYBA 1Q79A 3T9NA 3UR0A 2D69A 4KPYA 1SIZA 2I9SA 4U8VA 2NXEA 2FHMA 2PFDA 5T7LA 1HWIA 3M2VB 3IRXB 2E1CA 2K1RA 2CNLB 1TFYA 1WEXA 4DSFA 1TUGB 4DF8A 3CIZA 3VAJA 2CPIA 3NY0A 4Z2XA 1FKOB 1MMNA 4GC7A 3RBXA 2KU7A 2VG7B 4DV6F 2E5GA 3G96A 3VAHA 2KJVA 3AXKA 2RVJA 5JUMA 1N5TA 4RUCA 1SC4B 3PW7A 4EYIB 2FC9A 4K0KF 3V6DA 2W2PP 3SQGB 2ZBIA 1KFSA 4LF4F 3A1YG 2L9WA 4LSNB 2QYCA 4DOZA 3BGRA 4IRCA 2XTJP 1PBAA 1S12A 2V4RA 3ZZPA 4M5JA 3T1AA 4LF5F 4QCLA 5ETOA 3CC2S 3HD2A 3TZXA 2V68A 2NXNA 4O3NA 3UI3A 1AROP 3PG9A 1VQ4S 2UUCF 2E29A 2HMIB 5LSOA 4RR5A 1TAUA 3P5BP 3Q89A 5H9FK 3NNCA 5J2NB 2VDIA 3DDIA 3ENQA 2MQQA 1B0TA 3S6EA 2RRAA 1KOHA 4KHPF 5FLXU 3W8PA 2ZM6J 2OPSA 1QM9A 2FHKA 3GP9A 3F41A 1Q82T 2MZRA 4YDXA 1HQUB 1KVKA 8RUCA 2KHDA 3ZC4A 1QVGR 3DFEA 2ZHAA 3ISZA 3ZXWA 3H98A 3MMJA 3ZO7A 4K4ZA 3R7SB 4JV5J 3MM6A 4RW4B 4QOTA 4Q8FA 4KR0B 3TA0A 4FXDA 4KGKA 1T3OA 4WFBQ 4K2JA 1AW0A 4B3TJ 3HVTB 4AQYF 4DZ6A 1EJ7L 3DOLB 3BO3A 3RRGA 3R5BA 1N52B 4DX6A 4IKAA 2LXIA 1JNRB 2B7BB 3OFHA 3T5LA 4NLUA 5A8KB 3J7A1 3VAMA 4ZN1A 2QA2A 5C2CA 4NRUA 4A46A 1S1XA 2IM2A 1JLBB 2AJQA 5KFSA 3MHYA 3HD1A 4WE1A 7FD1A 3PM9A 3KLGB 3SCKE 3BPDA 5A6PA 1YRXA 5ETQA 5HMYA 2LLZA 2OPQA 4FP9A 3J81Y 4ECUA 2UUAJ 3DGVA 3PKYA 3A8JA 4FYDA 4MJKA 1VYAA 4DLEA 4DXLA 3EZUA 3C3LA 2FUG9 4JI7F 1P6TA 3MM7B 4QW8A 5KFUA 3A3OB 3M6UA 4N47A 4DJBA 1WWHA 3P6YC 2QEXS 2WSFC 4KE5A 1WDTA 4X2BA 3ET6B 1L3UA 4DPYA 5HROA 3NGDA 1XR5A 1H2VZ 4KFBA 4LSLB 5GVQA 3QO9A 4ED3A 3NGRA 3K5OA 5AE1A 4QIFA 3VAGA 5A8WA 1SV5A 1H74A 4P52A 2IDLA 3DLEA 2VG5A 2COLA 1CULA 1FHTA 2NS1B 4O4GA 2FD2A 1HI1A 4AD6A 1QAIA 5KG6A 2CWKA 1FRIA 3TARA 4DL6A 3DRYA 4ZCMA 2ATLA 1U6BA 3D3CJ 2ZZMA 4UOFA 2FZKB 4ED8A 3U7JA 3UCGA 4TN2A 3R5JB 3QGGA 1ZBTA 4YHHF 4QR1A 4C11A 5HBMB 4LQ9A 5D3GB 2CQ4A 1XJWB 3IAS9 4NRTA 4DMZA 3R5GA 1F2HA 1RWNB 3QIPA 1HNWF 3CC7S 4DR1J 4IG3B 4UQTA 1S0OA 4NXNJ 4HR2A 2Z8QA 2HBRB 2EFOA 4ZLNA 1OY8A 3BH6B 6AT1B 2NYIA 4DR5F 4B9VA 2DNRA 4NA1A 3MEDA 2WBMA 5LJ3Y 2DNGA 5KFGA 1SKWA 1IBMJ 1HLWA 3TW0A 1KC8T 4CLFA 4P72A 3C46A 1Y11A 4DR7J 3W5YA 1YDLA 1XR7A 2Q3PA 4AYBD 4JP8A 2AJ2A 1KBRA 1QAXA 4B08A 4IO9Q 5KFDA 1U1KA 3IBFB 1HQEB 4ZA1A 1N34J 3J80U 2BQUA 5HAOA 4L3KA 1N4LA 3EVWA 4N8OA 1KFDA 4LF7J 2R8GA 2BANA 4DQQA 2ZHBA 4OI0A 3PEJA 3ZZRA 2HQCA 3EPIA 1X4EA 3GIKA 2X7IA 3PYFA 1CC7A 3T5KA 1VDHA 4LRCA 2K3IA 4R8UB 5J1EA 4R0EA 2HG4A 3KYLA 3TQEA 4OI3A 1B7FA 4HHHA 1RHMB 3MAQA 3VQSA 4U6PA 1Q8KA 3NRBA 1BWVA 2VBZA 2MGZA 3C19A 3AH6A 2BR0A 2V2QA 4P2SA 1X5SA 3FK4A 1AB8A 3CJSA 3VVTA 5CYMA 3F0NA 2KXHA 1NZAA 1B4SA 2JJ4D 4ZK7M 3ILOA 4ETXA 5EHHA 2ZC3A 4MFBA 1HYSB 2UXCF 2QMXA 2ZEJA 4IH7A 1QJHA 2VFSA 1NHKL 3R9LA 3ISNC 3VZIA 2CPHA 2BM0A 2A2CA 3IXQA 2ZOFA 1I3OB 2P6SA 1SJ3P 2NZ4A 1EKSA 4LFAJ 5AE3A 1MG7A 2OAUA 1UFLA 2L9NA 3N6NA 4XPCA 2DGWA 3GSIA 3T1HF 3ISND 1RT5A 4I67A 1YZ7A 4FS2A 4C8OA 2E9ZA 1U48A 1YJ9S 2W9CB 2R7VA 2ZKTA 4RO0A 4JI2J 1LFPA 3EGVA 5KT3A 4I64A 3EJMA 1T05B 4ED2A 5DDRC 2OTLS 2AMCB 2B4PA 4PR6A 1JLFB 3NGKA 4I68A 2HAIA 5KFJA 3R2DJ 2CAJA 1IQTA 3BKUA 3EVMA 2F1FA 2DEIA 3VV2B 4M5DB 4EUVA 4PPDA 5EX0A 1C4CA 3DGPB 3CMQA 5A0YA 4P6QA 3SDEA 4KV8B 3QFHA 5KG4A 4OYZA 4ECYA 3HMJG 1I94F 3H7HB 1RXOB 2ROPA 3KFWX 1RDRA 4MK8A 3QZ8A 3PZPA 5SUHA 4X65J 3PX0A 3CCMS 5E5NA 1M5VC 2DNNA 4OZLA 3AD8C 2C42A 2VPZB 3W3SA 4ETZA 4HHUA 3W9HA 2NXCA 2B3TB 3TAMB 4UW2A 4PQUA 1REVB 2YKNB 3ITHB 3CNQP 2M70A 1NJWA 2FJAB 3FNNA 3D54A 1ZETA 2GJFA 3OTCA 1FRKA 1IKXA 1VGYA 3PCOB 4P71A 2QLBB 1GH8A 2F8MA 2FLNA 2KFYA 2IMWP 1VI7A 5K8OA 5F8HA 2H4WB 3FCVA 2R2UA 3MPWA 1NRKA 2GC8A 4TU7A 1NH7A 1FJ7A 4B3SJ 3HHNB 2MY7A 2LA4A 1KQFB 3G8TA 2XMUA 2N7YA 1DQ9A 4F4KA 3EZ5A 4NXMF 2I6WA 2XULA 4WCEQ 2HBZB 2B8PA 2CQ3A 1JB0C 1PJ5A 4RUAA 2KL8A 4D3GA 3MAAB 4DUZJ 2CRLA 3V6KA 1U1PA 2B0GA 4JI5J 3HX9A 1X60A 1MROA 4WTYA 1DTQA 4HACA 3TX0A 3CJKB 3NWGA 1RWMB 4OLPA 3HJFA 2BOPA 4HDHA 2PA8D 3I0RB 1D1UA 1EP4A 2KT2A 3DOKA 1D9DA 3ZTRA 3I56S 4HEA9 3FGVA 2V8DA 2UVVA 3P4UB 2HVIA 3SFUA 2R7TA 4LFBJ 1NLKL 1JLQA 4OQJA 3OTEA 2V9WA 2VOPA 4G3IA 5C24B 1IM6A 3FCWA 2QE5A 4ZVRB 2ZJQQ 5KFZA 2CNKB 1FKPA 3M8QA 3M9NB 3K5NA 2ZH9A 1YKWA 1OYEA 1O5JA 3UO0A 3S7RA 2MQOA 1U0HA 2ZE2A 1K8AT 2FY1A 4DI6A 1ITPA 3JYTB 3W7BA 4YP3A 4PQAA 2XZDB 1SUQA 3IM9A 1SCJB 3PKMA 2RAQA 1SKUB 4ZITA 4NLGA 1UFKA 4J9PA 5IS2A 5CABA 4ELVA 4TLRA 1RCXB 3CJ5A 1NXIA 3GJSB 4JI1J 2DIVA 2QTWA 1FD8A 3NXZA 2QL9B 3LPEA 1VBXA 4JV2A 4F25A 2DGUA 2VV5A 4RWWA 4QIVA 1LOUA 3CMAS 4G1QA 4U7UD 2XWXA 1BC6A 3CDUA 2GMHA 3TJAA 2YNFB 4CO3A 3DDNA 1RT2B 4L76A 4M63A 2ADCA 2CQ0A 3OT9A 1PJ7A 2B9XA 1OMSA 1QLNA 1HBMA 3VF0B 1NK8A 3GR0A 3AXMA 2LMIA 3I87A 1IBLJ 2KDOA 4YEAA 2DHSA 4IDKA 1P1LA 1LW2A 3OL8A 3IS9A 2EVZA 3QGIA 3ZTOA 3FSIA 4JUZA 1NDPA 2EBGA 9RUBA 4NLYA 2G2YA 2IC3B 1HNXJ 3IAM9 2JC0A 3N79A 1HI0P 4CO2A 1TTHB 2WW4A 2NPIA 2CYYA 1UPMB 1P8GA 2OD6A 3BSOA 4M5LA 3L95X 4KTQA 1AUSL 3OXLA 2R7UA 2R7OA 1HNVA 4FDFA 5DQIA 3MMAA 4OJ1A 1ZH5A 1BWEA 2DNHA 3MEKA 1QAJA 2YKMB 3C66A 5L1KA 5BYRA 2ZM6F 1JLEB 4XAKA 4A4JA 1KHVA 3GIRA 3KKFA 3G6ES 1RHRB 2EFPA 2GZOA 5DG9A 4PYAA 4A8XA 2BVZA 4ECXA 1F9HA 4GKJJ 4JV5F 3HXMA 3HT3A 1RT1A 1H2UX 1Z4UA 1FF2A 1S1UA 2CPYA 3AB4B 3GV7B 4A8OA 2DO0A 1ZS6A 2VA3A 1FDNA 3SIPB 5IFMA 3M1VA 1XMQJ 3TO8A 4DV0J 2BEFA 4ZVHA 3VGSA 5DETA 2MLYA 1FFSB 1F1BB 4HI1A 1K9MT 4DV1J 2BJEA 2PA3A 3IA0A 2OJ3A 2OHDA 2FLOA 2HHUA 3R7BB 1R0BG 2VH7A 1X0PA 3EVOA 2XM3A 4P2XA 5J2PB 3OLBA 2L48A 1BXNA 3TVKA 2XBPA 1L3SA 1L3VA 4DV2J 1Y5IB 4G6VB 1M1HA 4EI2A 4WZQA 3K5MA 1TV6A 3GSDA 1VMBA 3CMES 4B9TA 3BB5A 3ZTSA 2UV8A 5DM7Q 4O0IA 4ICLB 4N7TA 1YX2A 1CJUA 4FBTA 1YLXA 4TQRA 5B08A 4FNIA 3TUPA 1F2GA 4LRBA 3W1YC 4NL5A 2UUAF 1VQPS 4PKDB 2VB6A 1WORA 2PFFB 4Y2KA 1H3DA 1JJ2R 2XG8A 2HHXA 3Q8VA 3QJLA 3SI8A 4C8NA 2BW7A 3C6UB 1IKWB 2CJAA 4KJIA 3TR5A 1S1VA 4OYMA 3NG8A 1TQLA 3U1LA 4IG0B 5FLXY 2V69A 2X1AA 4K5SA 1VBKA 2K8GA 3OFFA 1D9AA 3PJ9A 1S72S 2AV5A 4IFYA 2ZVSA 3H4DA 2AJ1A 2XC9A 1RB0A 2YPYA 4MK9A 3SCLE 3ULHA 1W2BR 3DYAA 4M5NA 2FJXA 4OYOA 4USUA 4KO0A 3D0GE 5HANA 3N9UC 5ADZA 1GNKA 4DS4A 2VD3A 3CO0P 3PV8A 4F3OA 1U6FA 4Z7CA 4H4MB 3IP0A 5A6WA 3KMQA 4NLWA 4CT9A 1RHKB 4CNZA 3HSJA 3RG6A 4CT8A 3SZ2A 2QRRA 1PSDA 1NPKA 3WZ0A 3M2RA 2ZBRA 4KQZA 4H54A 1KSPA 1HPZA 3EGNA 5KT5A 3KUHA 5LT5A 1YZ6A 3CCLS 4M95A 2B9YA 4ECVA 3L09A 4WIIA 1RAJA 2GHPA 3H20A 2HIQA 2UVRA 4R5PB 1YJUA 2AP6A 2F65A 4DEZA 4NXNF 2F3JA 2HBQB 1P27B 4WF9Q 2XLJA 1S6OA 1CJKB 4I7FA 3MCMA 3UW1A 1VOMA 3G9CA 4PG4A 3K89A 3OW2R 3CCVS 1WOPA 1QE1A 1RTHB 2V8VA 2MXYA 1IBMF 1D9FA 4URSA 2RQCA 2K2PA 4V1Ak 2APOA 4O3RA 4DR7F 4CO1A 2J0WA 1LWXA 3NS6A 3UFCX 3I32A 1MWZA 4USIA 3C16B 4WE1B 1GTEA 4NYZA 4DS5A 2XMWA 2GV1A 2GIFA 4DFKA 1NK9A 1Q1KA 1WACA 3I31A 5G0RB 1N34F 4ZN3A 2XQCA 3PJWA 3Q22A 2W9BB 4LSZB 3V6JA 5F9LA 5D0EA 2OPQB 2VQEJ 3MM8A 3H59A 1JK9B 2DEJA 4LF7F 4OZNA 4OX7A 1UPPA 2MKKA 3PRDA 1K0VA 2RF2A 1M1GA 4H4KA 3C6TA 3HFKA 2NQPA 4GVBB 2I5JA 1NSQA 1YRUA 3LWMA 3FBBA 2DGTA 3BR9A 5GMDA 2F9JA 3SCJE 4OHYA 2E1PA 4KKOA 4X4UA 2DGQA 5HROB 3JSBA 3OBIA 3MEGA 2WOMA 3QO9B 2ABYA 3MR7A 2JWNA 2PE8A 2OFGX 1VK3A 3TX8A 3BN7A 2DKOB 2W2QP 5A8WB 4FZVA 2QFIA 3DM2B 4IR1A 5E3QA 2Y0SD 2XMMA 3CJ2A 1L3TA 1N56A 1CULB 1NSPA 4PPZA 2PSZA 1WF0A 2RDDA 2ZVIA 3QQCD 4DV3J 1ZPWX 2YH0A 3W5XA 2QX0A 3JAMU 4USJC 1SVDA 2C3PA 3BZQA 1YJ7A 1TMMA 1TVRA 3DI6B 4Z7YA 1XEZA 4UY8T 1KQKA 4U95A 4LFAF 4KAIA 4ENOA 1UWAA 4D3HA 3J7ZT 3FJ2A 1S1TA 1U1NA 3MM5A 3CTRA 1FJGJ 4ERDA 2JH3A 1CSJA 2NPFA 4RW7A 3UDEA 2B6AA 5A8RA 3LGNA 4JI2F 3RR8A 1Q0NA 2OPPA 2FIUA 3PDNA 2RE1A 4CWBA 3MPYA 3ZTQA 2ASDA 4OHZA 1WD6A 1YI2S 3EXYA 2BE9B 3BS9A 3FRZA 1PBUA 4DCJB 3MMCA 3MEDB 2M0GB 5HATA 2D3UA 2IMOA 5C5JA 1WC1A 2QSFA 3CCSS 3TQ1A 4ITSA 2JHEA 2VICA 2VIHA 1YITS 2GJIA 4X65F 1FDAA 4WU3A 3SSRA 1UA1A 3ILLA 3IGNA 2AGOA 3HM9A 1JLAA 1GAOA 3D1HA 2B43A 1CJTA 2FB0A 2WK4A 3FQKA 2C2KB 5CH7B 3WC0A 1D0EA 2I8EA 4R0JA 2BANB 2B8QA 3W9JA 2FY8A 1SJFA 3D6TB 3ETMA 2PDAA 3LP2B 3FSYA 2E66A 5DDOC 5E33A 4KH0B 4K59A 1IN0A 2CJYB 2DH7A 3RBEA 4UUXA 3GCWP 2G13A 2GO9A 2V2KA 4OLOA 2GMJA 2ROGA 2R9LA 1S59A 2MGZB 4YOEA 2CG8A 1RTDA 3Q8UA 1PAEX 3HFVA 5ETNA 4B3SF 2M88A 3VGTA 2HK3A 4JBCA 3EXCX 3FRYA 4KGMA 2QG9B 1UETA 5CAAA 2HFUA 1UWBA 4MFBB 4JI0J 3KOAA 2GS8A 1C0UA 3MURP 4M94A 1Y9OA 2W24A 2HRYA 1HBOA 5I42B 2DTJA 1JJCB 1RBOB 3EYZA 2XHWA 3IRWP 1CVJA 3HCXA 2MQNA 4DUZF 1MWYA 1FXRA 1DBDA 4JI5F 1VBZA 1U1RA 2E5HA 4UOCA 1RT5B 2OTJS 3U1NA 1Y3JA 1RQ0A 4F0MA 3RB4A 3KLIA 3SBMA 5BYSA 1TL1B 1WTBA 2KZMA 4JV0A 4KY3A 2HHHJ 4LFBF 2ASJA 2F9DA 3MUTP 1W26A 4I2PB 2N7CA 4MKBA 1NBEB 5M2PA 2AW0A 1SJRA 3QT8A 8ATCB 3QAEA 3M9OB 4QWBA 4PG7A 3J7YI 4ELUA 2OO4A 4MT1A 1MLAA 2POKA 3FKBA 4FVMA 4ZMMA 2ZUAA 4J91A 3KK2A 3MCSA 2UV8G 1YTYA 1FJCA 5EX3A 2Q79A 2VPWB 1RT3A 1TKZA 3PIPQ 4K4YA 2FGOA 2ZH8A 3MEEB 1KHWA 2HVEA 2F40A 5IT4A 2XB2D 2HEKA 1FNMA 1DARA 2FZCB 2MTLA 1WSRA 3X3UA 4JI1F 1HKAA 2ATCB 2C3UA 4IFVB 1IBCB 5U47A 5DLFA 2M4MA 2J9DE 2DRBA 2DITA 1FVQA 5ETKA 1HFEL 1TZ0A 2CQCA 1VQ5S 3U1MA 3KDOA 1IKXB 1UP1A 4F02A 5IXUA 1HW8A 3H2VE 3PX4A 3KK1B 1FE0A 1T11A 3OSNA 1TMJA 1N48A 2A10A 2M3DA 1AXQA 4ECSA 4K8RA 5EGYA 1Y10A 4OYXA 5AT1B 1A6LA 1T3NA 5K9FA 5EWGA 2R8IA 4J9VA 1IBLF 2IDEA 1RWWB 4NPOA 2QC3A 2L41A 2ACYA 1V5IB 3KXDA 3W2VA 1CQNA 2EBEA 4OZ0A 2HQ3A 4F4WA 1KTVA 4DV6J 2V67A 2DPJA 4RW8A 2QA4G 3K5LA 2JRSA 1HNXF 2VL1A 3M8YA 3P49B 1U0SA 2B5JA 1EQ0A 1KR4A 3CVKA 5L39A 3G8SA 3FEXB 4NLTA 3JTOA 4TY8A 4OMFG 2WAQD 3R5DA 5A2QY 3UCUP 1RABB 1MU2A 1TL4A 4HACB 2H4YB 1JKHA 3VAKA 4WXWA 2PO4A 4OZ5A 4WTOB 3JB9k 3X1LB 1HWLA 1GTHA 2AYMA 2BV3A 3DOKB 1BE4A 4RNFA 2XGPA 4AL7A 4BCAA 1ZTWA 1LNQA 5KFPA 1BUXA 3J81U 3NWRA 3K57A 3VALA 2CVEA 3M8QB 2LU1A 2YTCA 4GKJF 2HKEA 3HK2A 1T02A 4HL9A 1U0HB 4KC5A 2ZE2B 2QO3A 3BSAA 2GMLA 2VG6B 3R8YA 3KWMA 1RT6B 2NUHA 1XMQF 3LW5C 3HFZB 4DV0F 5KFLA 5ETVA 1LV5A 4DV1F 4PRFA 2J8AA 3GIJA 3HHLA 3CULA 1PYOB 1RKJA 5DRKA 2CJBA 3WHIA 1U6ZA 4ILMA 2GVDB 5D4PA 4IH5A 1S49A 3AAWB 1OSDA 4DV2F 4FF1A 2HFNA 4DBQA 1SKSA 2Z30B 3GQCA 1KLMB 2CQIA 2W8KA 3H2UB 1S7IA 3CD6S 1YRTA 1N33J 4DSEA 3BYRA 5KFNA 1H6KX 2UUBF 5JVGQ 5IOLA 3Q8QB 2W4CA 4NZ6A 2XZTB 3BBFA 1LWCA 4C98A 2NZCA 1TL5A 3OXGA 2Y1RI 4GRSA 2BJ7A 4K4VA 1RACB 1UFWA 3OVBA 1ZZNA 3K8WA 1NEEA 4RLEA 4YQWA 3FCHA 3DU5A 1X4CA 1ACMB 1NH8A 5GADI 4WJBA 1HHQA 1ZPVA 4EO6A 2E5JA 3M8PB 1QVFR 2H51B 2W7PA 2QA4S 1ZTTA 3BKTA 1CS4B 3FC9A 1F5BA 3VCDA 4HKQA 4U67Q 3O2IA 2LFVA 2FVRA 4USTA 2YNHA 4ZP8A 1W25A 3ENAA 1EX8A 1Q8LA 1U47A 3GFXA 1IWAA 3P3DA 1U1LA 2GQQA 2QLWA 1NNDA 2HS4A 5D0GA 4Q5VA 4O3SA 3NGUA 3TI0A 1GMUA 1X4AA 3M8ZA 3FZ2A 1N88A 3RB6A 4ZVPB 3J7Z5 3M6XA 2W9AA 2MLZA 2D3OR 3BYPA 3TEHB 3LP0B 3DKDA 1GMWA 5KOWA 2HFSA 2K7JA 3DXSX 3H42A 3HT0A 4FKYA 3CCJS 3MF5A 4HHJA 3HDSA 1M0SA 4TXSA 3ZFVA 1Y00A 1OO0B 1R0AA 5DZ7A 1HNIB 3R1HA 1S6QA 4QYZK 4USWA 3GYNA 2P9CA 1RSCA 4HT5A 5KFKA 1UJ4A 1YJTA 1FFGB 1RT7B 1LK5A 3DLLQ 2Y8YA 5MAOA 3KHHA 2V8GA 1AZSA 3JQKA 3RBZA 3K7RA 2BJDA 1AFJA 4RBTA 3G6VA 4ILLA 4J5OA 2Z4PA 4IQMA 3M2UA 1N32J 1DURA 3LALA 1N0UA 4NASA 4ZPWR 5B0EA 2H54B 4IOBA 1O6XA 5HQLA 5L1IA 3POTB 2VQEF 4CH7A 1RBAA 4LF2A 2R8KA 4LMZA 2J76E 2VKRA 3THPA 5D15A 1QTMA 1FA0A 4F4XA 2HQGA 4KGVB 3MMBA 4DPUA 3DC2A 2DR6A 2YNIA 2C22A 5DJBA 3DOMB 1JLGB 1A9NB 1ZM3A 1VQ9S 4XTTA 2RNEA 1J5EJ 4EBCA 3R3TA 3MOZA 2RHSB 3AA9A 4O3OA 5CXTA 4QIWD 4WFXA 4I6AA 2YWFA 3ILIA 1TR0A 1FTCA 5AXKA 1BMQB 1W7WA 2BQ3A 1SL1A 1X4BA 5KFTA 3ZZYA 3JS9A 3M6VA 3RB0A 1SL2A 4IFYB 2MKSA 4F8RA 3MR3A 1RT4A 4KGXB 3MM9A 3Q2TC 1WEYA 4CZCA 2D9PA 1FX4A 3DYAB 5H1SV 2IJRA 2YKAA 2LU2A 3W63A 4DV3F 5DS7A 3HHLC 3B54A 2RB7A 1C1BA 4V19X 4BDPA 1M5HA 2F4VJ 3J7YU 2VFVA 3V81A 2JDJA 2V4JB 1F3VA 2C2NA 4ES3A 4PUOA 3U27A 4DSKA 1R43A 3HHLD 3C15A 1WC6A 4MH8A 1WC5A 3GFZA 1FJGF 1M5PC 5KG2A 4DU7A 3M2RB 1CPZA 4DL7A 1E6YA 3R2CJ 4C8YA 4C9DA 1FEHA 1HPZB 4K4SA 3EE3A 3B78A 3JTPA 4EFAC 1LWFA 2KVQE 4DPWA 4QZVB 4LF1A 2FHJA 2MY8A 2YY3A 3UD4P 4I7FB 2MKYA 4OYWA 1QE1B 2V4QA 3R5CA 3MPUB 1W2IA 3CJ0A 1DQAA 1NCLA 1SI9A 2QV6A 3Q8PB 2AZ1A 4RW6A 2ZZTA 1M90T 3Q24A 4FS1A 1VRUA 2XWYA 1GX6A 4C8LA 3HHEA 2KFZA 2WHOA 4NI2A 4WWSA 3OLAA 2YNGB 1XN9A 5B0DA 3I5BA 5HLFA 4PWDA 1ZAWA 2HIYA 4QWCA 3RGIA 2XMTA 4Q45A 2UXBJ 4LF8J 2DNPA 4DDFA 4ECZA 3BH7B 2I1RA 3B82A 2DR9A 4V19J 3DU6A 4W92B 3SXLA 3DRRA 2HQIA 4NCGB 3MD3A 2ZD1A 2J8SA 2R7RA 1VFJA 5KFIA 3C6TB 2BW2A 1LK7A 1ZA1B 2PI5A 2XS5A 3OR2B 3H4BA 1I5OB 2JLEA 2I5JB 4DN9A 1VIOA 4USVA 3M4XA 1RTIA 2JC1A 1FXLA 1XK8A 4NLQA 2ZWOA 3LH2S 4RUBA 2HFOA 2WOMB 2J9CA 2HGLA 1GMWD 4ID5A 1G2EA 1HBUA 3QLHA 3EICA 4DFJA 1T94A 3D2WA 3QIDA 5F3ZA 4LRFA 1R7IA 4JI0F 2JVRA 2W1BA 1K44A 3PR5B 4A8KA 2CQDA 5L1JA 4TY9A 3FMBA 1VQYA 2PIIA 4LR7A 1RJJA 3Q83A 3ZZTA 2AGQA 4MKAA 2E5LJ 3AJDA 4B9MA 4J7CA 2VJUA 1S6PA 1QUPA 4ED7A 5DQHA 2HHPA 5B0GA 2HQDA 4A8YA 1YIJS 3UDVA 2CUYA 3MFHA 4M5MA 4LBIA 1Q5YA 3AQOA 3A3NB 4GKKJ 1U25A 4ZJOA 3QWUA 4K7QA 4ZPAA 1SH3A 4RW7B 4MIWA 1X5PA 2B6AB 5A8RB 1L3KA 2RQMA 3A8IA 2YQ0A 1UKUA 2K06A 2GHWA 4DV5J 2Z0GA 3TAPA 2HHHF 5GAEI 2RRNA 3VGVA 2MKCA 1KDNA 3ILJA 2UU9J 1MSWD 2I0XA 4USMA 2CIMA 1EETB 3NS7B 4KRWA 2YWKA 3OVAA 1DLOA 4YB6A 1CLFA 5CA5A 1IUJA 2H5IB 1C0TB 2ZHOA 2F63A 3MMCB 2N82B 4NE9C 1RHUB 4NWBA 3UE2A 1T9TA 3KUEA 2KO1A 5FIIA 5CHCB 3VHQA 3KTQA 1VISA 3GTYX 2QZ8A 2JEGA 4I2QB 3KLEB 5KT4A 4ED1A 1OY9A 2MJUA 2I38A 4X4SA 3V5RA 1WELA 2XHCA 2BZ2A 3NNAA 1HA1A 4RBVA 1M5KC 4L72B 4ID8A 1UJ5A 4LUBA 3JXOA 2DD8S 3E01B 1YJRA 2DNLA 1DHMA 1CJTB 2DH8A 1URRA 1TKXA 1WHXA 1Q8IA 3H5SA 4DU8A 5GADU 5HJXA 4I4BA 2MHNA 4LQ3A 3RU0A 3CD0A 4U96A 1D09B 1Z2LA 3B6BA 5ETMA 1BHNA 4WU2A 2MZSA 3NAHA 2V2VA 3TP2A 3NKYA 2FTRA 2IBKA 5GAGI 4RU2A 4NLXA 4CO5A 3OFEA 4WKYA 4OHXA 4YY3J 5E7OB 2OP5A 1O51A 4UOGA 4A8WA 3CDAA 3SQGA 5EN1A 4OI2A 2YQ3A 4FN5A 5F3TA 4RJVA 1VQLS 1QSSA 4LSNA 1UWBB 2MQLA 5RUBA 1HBNB 3QMQA 1C0UB 2WONA 2R8JA 4CTAB 1HBOB 4GMKA 2FHJD 2XMAA 1RTJB 1Q5VA 1WSVA 2C2DA 1WC4A 4AUKA 3W2WA 4U8YA 2JFKA 1WEZA 2HMIA 4CLZA 5J2NA 4WK3A 4HH1A 4DL5A 1WHVA 1U2RA 3BGOP 3D6MB 3TOQA 3W64A 1H38A 1WI6A 3ADAC 1Q7LB 1DFDA 2RT3A 1P1TA 2ILYA 4ZPTR 1VQNS 5LXRA 1RYSA 3HULA 1XNRJ 3QZ7A 1HQUA 4JI4J 3B4MA 2YH1A 2VQFJ 2E7XA 3FQLA 2VHGA 5HI7A 4MK7A 1RAAB 1JMTA 3GZ7A 4IH6A 4RW4A 1DTTA 5HQMA 1NDKA 4YFUA 4I56A 1WF1A 3BSNA 4K50A 4DL3A 2WRMA 2YKQA 4DPOA 4CLSA 5F8GA 1UL3A 2IYIA 3DOLA 1BGXT 2B51A 4B3OB 2Q1LA 3D66A 4BC7A 2KG1A 3BGUA 4WFAQ 4JYAJ 2PN6A 4XO0A 5A8KA 1FCAA 4DWIA 4LRDA 1YJVA 4QJVA 2X3GA 3TJ8A 1R6VA 1JLBA 4C97A 1FRLA 1N36J 1KTQA 3HVAA 2PMWA 2CPFA 1WI8A 4DX8H 3IG1A 5F0WA 5DDQC 1N33F 2C2MB 4CYUA 2BJ1A 3I5CA 4ZVOB 2DGSA 3QFWA 2GGPA 1AA1B 2HNZB 2ZH3A 3PYEA 4DSJA 4CLKA 5HL7Q 1U24A 3KLHB 4Q8EA 4C6AA 3N4WA 3P8BB 5H9EK 1HHTP 4OJGA 3PY8A 2RHQB 3ET6A 4JI3J 4Y65A 2B5JB 4LSLA 3D1OA 5L46A 4NEZA 3GCXP 1LEOA 3OTDA 2ZC4A 1URNA 4ES1A 2XY6A 3EZOA 2KHCA 3BR8A 1MU2B 3LGHA 2EG1A 1BLUA 4X4QA 1NJYA 4ZVFA 2J0QD 4CIOA 1GXLA 1FWPA 1ICEB 1QD1A 4CLTA 3UD3P 4OFZA 5LSLA 3MDFA 3H90A 3IBWA 3BJYA 1TUWA 3M8WA 2OI2A 4DG1A 1U1OA 2C1EB 1RADB 4CM2A 3K59A 2HBYB 2VKZG 2J9DA 4IYQA 2R2TA 1NSAA 2DR8A 3SYZA 1WG4A 2MPUA 1YJNS 1EIYB 5HK4A 5HBMA 4RW9B 3D6FB 4BWJA 5JXSA 4P73A 5D3GA 2YKOA 3QRRA 1S5ZA 2JL9A 3T41A 4LREA 1PCAA 4P2MA 1L5UA 4YR0A 2E7VA 4IG3A 5LJ5Y 3TRGA 3G4SS 3DRPB 1V3SA 1KLNA 1VQMS 4W4MA 5KT7A 4OYPA 4DUYJ 3HHLB 2NREA 4Q44A 2Y1IA 4BWMA 5J1PA 2Y9HA 4QPXA 5SZTA 1VC5A 2AT1B 4TYAA 5IQQA 3CJRA 1RHJB 1N32F 2PMZD 3L7PA 2PI4A 1N5YB 1FWKA 1P9YA 4U9RA 4C3LA 2VBXA 1HQEA 4Q0BA 2HFZA 4P75A 2N3OA 2QN6B 2XEXA 3US5A 3CIMA 3PW0A 4F04B 3D67A 4PG5A 4EZ6A 1TKTB 2XS2A 1CQMA 1RWVB 2RIJA 2J6UA 2FYXA 5E3RA 1SKRA 3OJSA 2NSBA 5DLGA 4QR2A 3K2YA 4B17A 3E2EA 1J5EF 1JLCA 2LEPA 3FEZA 5KFMA 2DGOA 1REGX 2CDRB 1TL3B 1RHQB 4DR2J 3CPWR 2BM1A 2HWTA 2A0FB 1NSKL 4X64J 1PKUA 4ANCA 5BR8J 3GILA 4FXWA 2OIHA 5GAEU 3PW5A 5DGAA 1S4FA 3I5AA 5E0OA 3GWCA 4LR9A 3HP6A 1YJWS 2CKWA 1S1WB 1E6VB 2HFVA 2F4VF 3T9ZA 1J5OB 4Y2CA 3ZZUA 4DX7A 3IFEA 3Q8RB 2G0JA 5DZ6A 4OJ3A 2W25A 4TKTA 2X3DA 1FK9B 1NKBA 4DL2A 3CCES 1Y5NB 2L9DA 2IPOB 1OQ3A 3BF4A 3N5FA 1LXNA 2ZWPA 3M8SA 5DG7A 5HMXA 2W9CA 1R8PA 3MI7X 4O4RA 3NCRA 1T05A 3E3XA 5C2GA 4RPFA 4AFFA 4CP5A 2KFNA 2MQ8A 1S6QB 1JLFA 1GQEA 4ES2A 3AD9C 3LOUA 2BJ3A 1HMVB 3MCNA 3D1QA 2E1MC 1NK0A 1NMEB 2F4FA 3LGMA 2B4UA 4M5DA 4O0NA 3DGPA 3S1TA 5LMNJ 3RZAA 2IM0A 2R7WA 2OSQA 1AZSB 2VOOA 1R27B 5GAGU 3WBZA 3N6LA 1SB6A 4N8NA 5EUHA 2MZTA 3AOCA 2IA0A 2Q66A 2SXLA 3M2UB 1OPZA 7AT1B 1H7WA 2CQHA 5KFXA 1HWKA 5D78A 3GFYA 3PIOQ 2ZJPQ 1NAQA 2UXBF 4Y2MA 4LF8F 1HL6A 3MOJB 4ZKAA 4WP3A 1REVA 2YKNA 1WNEA 2DGXA 1OYDA 2FJEB 1ROFA 4RNHA 3O6QA 3MMBB 1K47A 1KQSR 2HZVA 3UWTA 4C8ZA 1G6BA 2BJ9A 2BBEA 3FSXA 1ZM4A 1YWXA 5FD1A 2BE2B 4BS2A 4RL1A 1MW7A 3LAMA 4AXIA 2UUWA 3IR6B 3OR1B 3MM9B 4OX6A 1G7CB 4DCOB 2GIQA 2H48B 2ALYB 3CJ8A 1VBYA 5D4OA 1FFWB 5IWAJ 1C1BB 1RZMA 4QBUA 1UVMA 4OZJA 3V81B 5HP1B 3V4IB 2E5LF 3PYGA 4ZPDA 3DLKB 1KS2A 1UA0A 1SBRA 2JEIA 2AYBA 2U1AA 2HLTA 3MAAA 2QLFB 5IZHA 3THVA 5KG5A 4GKKF 3TVZA 2A6OA 1AT1B 3CJKA 4O44B 3O44A 4DV5F 2MLXA 2D9OA 3SV3A 1ZZFA 5K20B 1LFWA 3ZZZA 1X0FA 1SQFA 1IKVA 2UU9F 5H9FJ 3BQ1A 4DR4J 1VRTB 2HS3A 2V8PA 1RLDA 2CXEA 2IYGA 5HSPA 3DMJB 3JSMA 2GAGC 3ZZ0A 2HSEB 3GB0A 4OJHA 5IC4B 1SQGA 1VJQA 3DRXA 4WFNQ 2CJQA 1MNEA 2RS2A 4P7TA 2ZNZA 4RW6B 3VTIA 5AJ3J 5JMNA 1PC5A 2FJBB 1VRUB 3GG0A 2VODA 2QMWA 2QYGA 1KEKA 4F50A 2EEYA 2KXNB 4NI2B 3M9MB 5A2QU 2X1BA 5HLFB 1Q8BA 5B0CA 2QIFA 2RDJA 1WHWA 2EPIA 4NLVA 5K14B 3J7AN 2EKYA 2OEKA 3W9IA 3AT1B 2MZ1A 1NK5A 1I1GA 5EWFA 1F5CA 1RE1B 3DRRB 1NKEA 1ULRA 2MQPA 1FNOA 4L75A 3CW2C 4A8MP 3KJVB 3IR5B 4LIWA 2YNFA 4X66J 1NPPA 1UVKA 1RT2A 1NK6A 1N0VC 1RTIB 4Y00A 4WK1A 3NAIA 5KG1A 5F8NA 2DNZA 3E51A 3NNHA 3KK3B 1U02A 2H9ZA 2HYIB 1VLOA 3KG1A 4YY3F 4RUHA 3G71S 1SQEA 2VONA 3JSRA 1HBUB 1SJ4P 3UN3A 3KLVA 3AOAA 1NU4A 3KJFB 3A12A 2HRUA 3EX7B 3GIMA 1PYSB 3D0HE 4F2SA 1RP5A 2P8IA 3S8SA 1VQOS 1Z1ZA 3JSYA 3NMAA 2A2DA 4XDDA 2IC3A 5HVHA 2V0NA 4PXBA 2CQPA 3FEYB 2XO7A 2M8HA 3HKZD 1BY9A 1ZOTA 3QT7A 2M5YA 2RS8A 3UDLA 4OX8A 2WVBA 5KFHA 5KFEA 2BA9A 5L1LA 1PILA 4HYKA 4C4WA 1TU0B 2QGFB 4DPTA 1KQGB 1VQSA 1XNRF 4KHRA 1S79A 3J81j 4K4XA 1IKYB 1QTNB 1YVFA 3BGFA 4JI4F 1RTZA 1BQNB 4K4UA 3NLCA 2VQFF 4KB7A 2LXFA 1H0HB 2FLPA 2E9RX 5C25B 2XNRA 1RWOB 2EC2A 1VQKS 1UVJA 3ENVA 2X1GA 5T14A 3G82A 4GC6A 3ICLA 1HIYA 1ZAXA 5KFBA 3MPVA 2HNYA 4J9SA 2PMHA 4NLRA 4E2FB 4OZ2A 1SL0A 2O67A 2Z2MA 4EYHB 2A1BA 4J9UE 3KG4A 1T0TV 3LP1B 5LMUJ 2BE7D 4JYAF 2DRDA 2VZ9A 2EFVA 1D8YA 2IHR1 1TKXB 1NJZA 4BHQA 1V3RA 2LDYA 3U02A 1N36F 5J2PA 1RWPB 2E1AA 4U7UK 1VCTA 1FDBA 2B4OA 2KH9A 4XIUA 4P7VA 2YX7A 5CZVA 2M7SA 4CRJA 4AE5A 3QGHA 5T7LB 5KFYA 3HLUA 4ICLA 2K1RB 4WIQA 1XMOJ 1VRQC 3FVYA 2ZH2A 5I3UA 1S6UA 2J9EA 2BMBA 2AEFA 3TZWA 2KRBA 2XI2A 2D74B 2V2ZA 1Y5LB 4TU9A 4ZCIA 2HHWA 3CE8A 2L08A 2RKIA 4J9OA 2VBWA 3LF0A 3RW7A 1S57A 4F26A 4ZOSA 3C6UA 1IKWA 5EDWA 2V9KA 3OPKA 4EK2A 2HWIA 4Q7AA 1VC6A 3TAQA 5ETSA 3WIUA 4DV4J 2F5GA 4R25A 5B09A 3L4BC 2WONB 4IG0A 3LUYA 5B0FA 4JI3F 2UUBJ 1HI8A 1SXLA 4YR3A 1NJIT 5F8IA 3V6DB 3L9ZA 2AJFE 3W5ZA 1IBKJ 2N3LA 3UQSA 3W2WB 1WJ9A 2J7KA 1VQ7S 4RNNA 5L8RC 2P6TA 5HO4A 4UT4A 3BGRB 1FNXH 1KNZA 4QYRA 4ZP6A 5I4MA 3RB3A 3IC1A 4NYOA 1DAXA 4H4MA 2UUTA 4ZVQB 2WSCC 3MCOA 2ZH5A 1ZYQA 1RGVA 1WC3A 1QSLA 4M8LA 1WTFA 4X4NA 3T5HA 1RA6A 2DY9A 5D4LA 1J2VA 5AE2A 3UD5A 4EU0A 1G4CA 2OEJA 2IVYA 1DTTB 2QA1A 3QT6A 3T3FA 2GVZA 3LO3A 3OFGA 3SCIE 2OPSB 3KLFA 2WB1D 2ZBPA 1CJVA 3OHBA 2AQ4A 4MTPA 4R5PA 2NXJA 3OHAA 3GJQB 5FDLA 1WKKA 2VFTA 2DXEA 1ZM9A 1HWUA 4YB1P 3FUYA 5KFWA 1CJKA 4DUYF 2HHVA 5ETLA 2EW9A 4GVLA 4L6V3 3MM6B 3QBCA 3T6JA 4NEYA 3O8WA 3RUBL 2VJVA 2CQBA 1Q86T 1RTHA 3OTOJ 3KDNA 1FWLA 2B9WA 3Q8SB 4B3RJ 3C16A 3N28A 1X9SA 5I3PA 2DB1A 4F4YA 3IG1B 1LKZA 2VC1A 1NKCA 4FF3A 2HURA 5G0RA 2YPZA 4TVAB 3WIVA 4CYUB 2W9BA 3T1YJ 4IR9A 5J2QA 1S1XB 4TLQA 5IM0A 5D77A 3CDEA 2GGPB 3O3LA 2E1RA 3CJQA 3VQTA 3UDCA 4QQBA 3JTNA 4FNHA 1PG5B 1Y7PA 4GVBA 4B3MJ 2W7OA 3A8KA 1VHIA 3UPFA 4YDDB 1B0PA 2W01A 4C0HA 1S48A 4FF2A 2EKNA 2BKOA 4QR0A 4DR2F 2V6AA 3MAHA 4MIAA 2GQ2A 1FXDA 2CQ1A 4X64F 2G1DA 1C2PA 5E3AA 2AIRB 5BR8F 2ZNYA 3DM2A 3EDQB 1WF2A 1UJ6A 1R89A 5D0RA 1TFWA 2DHAA 4DZDA 1SJQA 1X5TA 3EGZA 2Z57B 4KFBB 2BQRA 1BD6A 4ZCKA 1KKHA 1XIQA 1S76D 3CD7A 3DI6A 3CJTA 4DR6J 2YBVA 1GK8A 2RMLA 4DG1B 1SV5B 2GNKA 3HSZA 3DLEB 2VG5B 3VAFA 3PFOA 3F73A 4O4GB 2LP4A 3MGJA 2LQ5A 3RAQA 2XS7A 5DM6Q 3T6BA 4DQSA 2DNKA 1WG1A 1U49A 2RJZA 1CG2A 1JJHA 1JJ4A 5L38A 3UNGC 2GW8A 3R6LB 3GYXB 4X4TA 2VU5A 1FRHA 5AXNA 4CLYA 1RWXB 1FRJA 2CWXA 4C11B 3PHEA 4ZVEA 4ED4A 5LMNF 2IVFB 4QWDA 4ATNA 1S0VA 1NK4A 3PYDA 2XSJA 2D7SA 3PO4A 3QIPB 4A8QA 3QSIA 1HQ2A 1GX5A 3MPDA 5IT9Y 3NBPA 4OL8A 2KYZA 1FJEB 3VWSA 4NMLA 3QRPA 2NR0A 4HTJA 4ELTA 4A8SA 4LF6J 3M6WA 1Y0HA 3D4JA 4Q0BB 1VS3A 2ZOMA 3S01A 2Y1LB 1WKJA 5D6GA 3D3BJ 2XMVA 3PRVA 5ITHA 4EGLA 4NCAA 3LP2A 5KFFA 1KOOA 2CZ9A 1APSA 3HKWA 4QIEA 2MZQA 4P2FA 1JLCB 1R8BA 1Q95G 4C7QA 3GE9A 4NMXA 4DQIA 2KT3A 1B7YB 4A48A 1ZM2A 2C3OA 4LVOP 3VVUA 3GG1A 2NUUG 5F41A 4M1KA 1RAEB 1X4FA 2PEHA 1QSYA 3I6PA 5KG3A 2NYHA 1EKRA 1UW4A 1XMBA 1BQXA 5MLCV 1IXKA 4HLBA 3UCZP 1LXJA 4Q2LA 4QPTA 2UZAA 4RNMA 5G4DA 3G2XA 3D0IE 2BDPA 3H8YA 5J1EB 4O3PA 2IAJA 3PTWA 1B99A 4CDIA 4ZLLA 1NK7A 5IWAF 2KB2A 2XCPA 3H0PA 4PZVA 2R7QA 2AZ3A 1OY6A 1YHQS 1ZAVA 5I42A 4W98A 4PXEA 3ONQA 3SV4A 4OYAA 5CYMB 1KP6A 4NLOA 3FFIA 1FT8A 3VZHA 2U2FA 2RQKA 5GMEA 2J0SD 1RI7A 4ZLJA 4EO8A 1T03A 2H5JB 2GA7A 2PEBA 2OPRA 5DDPC 3TNVA 1A7GE 3OTBA 1T95A 4C0BA 1KD1T 3QJPA 2HNDA 2VPXB 4E0DA 3VAIA 1TL1A 2W7AA 3EWGA 2YWEA 4HI2A 2HRTA 1SC3B 2K7KA 3KHGA 1V3ZA 4DR4F 3N6MA 4URGA 3GYGA 2ACMA 4I2PA 3R97A 4ZHRA 2J6TA 3BSCA 1HHSA 3K8VA 2GQCA 2O01C 1V9OA 4YMEA 1OIAA 2OGUA 3HHDA 1S99A 5AXLA 1RYRA 4CLUA 2F8HA 4X4RA 3UN2A 3BO4A 1R3NA 4X4VA 4ZLPA 1FRXA 4H4KC 4U7CA 5AJ3F 3MEEA 3PO5A 4E98A 4C0OC 2M52A 5KFRA 3V4MA 3MZIA 4J37A 4DV7J 1PC4A 4M5GA 1XNQJ 1DRZA 4MMOA 2R2SA 2ALZA 1XBWA 1K73T 5A0YB 3SDEB 4LIRA 2KYXA 3W8GA 5KFVA 4IFVA 2VFRA 4JOUA 2Y1JA 1NJXA 3VR1A 4ZPVR 3MR2A 5KT2A 2RQ4A 1M5SA 3M30A 4LFCJ 4PXCA 5THWA 4X66F 4CM0A 3FBEA 2YXLA 3AFGA 3KK1A 1FERA 4IOAQ 1TL7A 5D8HB 3OUYA 4WPAA 1WUUA 4DUTA 4ANDA 2CDQA 4PQUB 4B9NA 4M5KA 4ZS6A 5KFOA 2ZDOA 4AXJA 4X4OA 2GX8A 4QWEA 2MYFA 3CD5A 2DR5A 2XYGB 2RUSA 1RA7A 2DPIA 2W8LA 4FPIA 4PG6A 5B7WA 9ATCB 4DL4A 3DLGA 4NZ7A 1GXTA 1PYTA 1KWMA 5KG7A 3QWPA 2IRXA 4EMDA 2ZITA 5IT0A 2R7SA 2DCLA 4J9QA 3AHPA 2R3VA 1VJWA 2Q6BA 1XTZA 4WKRA 3BKFA 4YUDA 1X31C 2BUNA 4B9SA 4F0HA 2WVEA 5HQ8A 4F36A 1TK5A 4P9SA 2LECA 2AGPA 1Q4RA 1IR0A 1D8ZA 3NP5A 4CLLA 5I3QA 2CJ9A 2OELA 4ZVTB 4JI8J 3PVXA 3HVRA 2L3MA 1IKVB 3HI9A 1XERA 2AWZA 3IMQJ 2E44A 1MROB 4NX9A 2DYAA 3JSMB 1DTQB 2HWHA 2O66A 2KN4A 1PIEA 2XLIA 3LWLA 2YX4A 4QW9A 1I51B 2QL7B 1VQ8S 1EP4B 3GONA 1R6YA 3BQ0A 1DY3A 4EBDA 4F3MA 2K3KA 1NUEA 1JLQB 4ED5A 2VG6A 4MYUA 4C48A 1OS5A 1RT6A 3MXHP 3D68A 2MKHA 5J2MA 3QGPA 1FKPB 1AFIA 3AOBA 3FDSA 1G1XA 4DSLA 3EGWB 1OQ6A 4RZRA 5LMUF 2Y3YA 2XY5A 4A47A 3V2UC 1T7PA 3L7UA 2J7UA 1LWEA 3LAKA 3GIIA 4LRAA 1X4HA 1UCNA 3TWZA 2BRKA 3K17A 3RBDA 2GVDA 2B7CB 1HNZJ 1SUQB 2BACA
chains in the Genus database with same CATH topology
1QDUB 4ZVTB 1RE1B 1RHRB 1RWXB 1RHKB 2C2ZB 2H65B 1RWPB 1F9EB 2CDRB 5K20B 4LSZB 1PAUB 3P45B 3EDQB 1RHQB 2CNNB 2CJXB 3IBCB 2XYGB 2QLJB 1NMEB 5IC6B 3RJMB 1SC4B 2C2KB 4DCPB 2XYHB 1I3OB 3IBFB 2CNOB 2XZDB 3GJTB 1I51B 2HBZB 2QL7B 1IBCB 4ZVQB 1GFWB 1RWKB 3D6MB 3R5JB 1QTNB 3KJQB 1PYOB 3SIPB 3R7SB 2H51B 4ZVSB 1BMQB 5IC4B 3GJSB 3EDRB 4JB8B 2H4YB 3GJRB 1ICEB 4DCOB 2P2CB 2CJYB 2QL5B 1RHJB 2H48B 3KJFB 2QL9B 2HBQB 3NS7B 1RWOB 3KJNB 3QNWB 2C2MB 2Y1LB 2C1EB 2XYPB 2H5IB 1RWNB 4ZVUB 1RWMB 2HBYB 3D6HB 3R7BB 1RHUB 4ZVOB 2H5JB 1RHMB 2QLBB 2DKOB 2FQQB 4DCJB 2CNLB 3P4UB 1SC1B 3R7NB 2HBRB 1RWVB 1RWWB 2QLFB 2H54B 2C2OB 3GJQB 2H4WB 4ZVPB 3D6FB 4ZVRB 3R6LB 2CNKB 1SC3B 2Y0BB 2XZTB 3R6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QDU B;  4ZVT B;  1RE1 B;  1RHR B;  1RWX B;  1RHK B;  2C2Z B;  2H65 B;  1RWP B;  1F9E B;  2CDR B;  5K20 B;  4LSZ B;  1PAU B;  3P45 B;  3EDQ B;  1RHQ B;  2CNN B;  2CJX B;  3IBC B;  2XYG B;  2QLJ B;  1NME B;  5IC6 B;  3RJM B;  1SC4 B;  2C2K B;  4DCP B;  2XYH B;  1I3O B;  3IBF B;  2CNO B;  2XZD B;  3GJT B;  1I51 B;  2HBZ B;  2QL7 B;  1IBC B;  4ZVQ B;  1GFW B;  1RWK B;  3D6M B;  3R5J B;  1QTN B;  3KJQ B;  1PYO B;  3SIP B;  3R7S B;  2H51 B;  4ZVS B;  1BMQ B;  5IC4 B;  3GJS B;  3EDR B;  4JB8 B;  2H4Y B;  3GJR B;  1ICE B;  4DCO B;  2P2C B;  2CJY B;  2QL5 B;  1RHJ B;  2H48 B;  3KJF B;  2QL9 B;  2HBQ B;  3NS7 B;  1RWO B;  3KJN B;  3QNW B;  2C2M B;  2Y1L B;  2C1E B;  2XYP B;  2H5I B;  1RWN B;  4ZVU B;  1RWM B;  2HBY B;  3D6H B;  3R7B B;  1RHU B;  4ZVO B;  2H5J B;  1RHM B;  2QLB B;  2DKO B;  2FQQ B;  4DCJ B;  2CNL B;  3P4U B;  1SC1 B;  3R7N B;  2HBR B;  1RWV B;  1RWW B;  2QLF B;  2H54 B;  2C2O B;  3GJQ B;  2H4W B;  4ZVP B;  3D6F B;  4ZVR B;  3R6L B;  2CNK B;  1SC3 B;  2Y0B B;  2XZT B;  3R6G B; 
#chains in the Genus database with same CATH topology
 1VLY A;  3O1L A;  1NHV A;  2R2R A;  3A13 A;  1KLM A;  2RUG A;  3E8O A;  3ZTP A;  5KFC A;  2G1H A;  4NLP A;  1XMO F;  1FKA F;  2RD5 C;  3T5J A;  2BRL A;  4KGZ B;  3EPG A;  4DR3 J;  4UOH A;  3KUG A;  2RDI A;  2BXJ A;  4G1Q B;  4NYP A;  5DQG A;  1N5Q A;  2NLW A;  3AJ2 A;  1KN6 A;  4F4Z A;  3HSD A;  3TA2 A;  3GJR B;  3AY0 A;  2QJ3 A;  3KNA A;  1U2F A;  1S10 A;  1EAR A;  2A3J A;  2LQB A;  2XI3 A;  3TUI C;  4DV4 F;  1HBM B;  2QSW A;  4ALZ A;  3PFE A;  4CI0 B;  2XYP B;  1FDD A;  2MHE A;  3OQ2 A;  2AYE A;  1PGZ A;  1DJ0 A;  2G9O A;  4IDK B;  3DRS A;  1LW2 B;  4JI6 J;  1UEK A;  2BJ8 A;  3M8P A;  3IS9 B;  3IWN C;  1CS4 A;  2KRR A;  1IBK F;  3G87 A;  2BYC A;  4KPC A;  2UP1 A;  1UTA A;  2W2O P;  2IJN A;  5E3C A;  4EZ9 A;  2O1P A;  3AQP A;  4BC9 A;  2EK6 A;  2KJW A;  4ZJL A;  3UNY A;  2A6M A;  1R8C A;  1IQZ A;  1OSC A;  1EAY C;  2DNY A;  2CNN B;  4LF9 J;  2C28 A;  1CEZ A;  5F8M A;  5C42 A;  2OEM A;  1AYE A;  2UVU A;  2HHQ A;  1HNV B;  3MMA B;  4CH0 S;  3JQM A;  3LP0 A;  3HJV A;  4P10 A;  1KVJ A;  2V94 A;  1UEU A;  2LQJ A;  4JV1 A;  1NDL A;  3LAN A;  1UMJ A;  3AD7 C;  1XWL A;  1Y4Z B;  4P74 A;  1VK8 A;  3G82 B;  1M5O C;  3GV8 B;  4OZ1 A;  5CD4 A;  3I9V 9;  4DFP A;  2HNY B;  1HNI A;  2JEJ A;  4M5H A;  4B3T F;  3OD2 A;  1FD2 A;  2YKP A;  2JLF A;  2LKZ A;  2LEB A;  4PYD A;  5HJY A;  4LBH A;  3KMS A;  3T19 A;  1UZD A;  1RT1 B;  1RT7 A;  2CZV C;  2FJW A;  2UXD J;  1S1U B;  3OTO F;  1MN7 A;  2MMY A;  2Z2Z A;  2JLG A;  2Y0B B;  1Q16 B;  3FMW A;  4OHV A;  2FVC A;  4KBI A;  4E8U A;  3HHK A;  1SJ1 A;  4RWX A;  3M1V B;  4B3R F;  3IO1 A;  4BLG A;  3CDB A;  4X62 J;  2C3M A;  2V5H G;  3RYL A;  1O0P A;  3EUN A;  1H73 A;  4FYY B;  5F8J A;  2HPU A;  2H5E A;  2FJD B;  2J7W A;  4Z37 A;  2X1F A;  3ELH A;  3I96 A;  3Q0A A;  1PO6 A;  1S9E A;  2DBB A;  3T1Y F;  5I3U B;  1JNZ B;  3IWX A;  3POT A;  1GFW B;  1U7L A;  4KH1 B;  4KT0 C;  4IQX A;  5D0H A;  3H2L A;  1IR1 A;  1F60 B;  2V8H A;  2A18 A;  2J5A A;  3QAT A;  4K4T A;  2DXF A;  4MKV A;  3ETO A;  5KTQ A;  3TEG A;  2LQ9 A;  2RKI B;  4B3M F;  5K8N A;  1TV6 B;  3QYY A;  2WVC A;  3BBC A;  3BPS P;  1NZ8 A;  3TA1 A;  3DOM A;  1JLG A;  2D3O 1;  2ZBC A;  3CCW A;  1CJU B;  3UVJ A;  1ZA2 B;  4NA3 A;  4KHM A;  3I4P A;  5E2Q A;  1U8S A;  1UVI A;  2O5D A;  2CPD A;  3TVY A;  4K5R A;  4WYW A;  3GFH A;  3QRQ A;  2CPJ A;  3HO1 A;  3Q8Y A;  4NZ0 A;  3RW6 A;  2DNO A;  4OV6 A;  4Y2A A;  4I6W A;  4L74 A;  1RWU A;  1S1V B;  1RAH B;  3DHW C;  1DQ8 A;  1EB0 A;  3R5A A;  2D41 A;  3RR7 A;  2OKQ A;  1MMD A;  1F9E B;  2CQG A;  2MB0 B;  4UZC A;  3CT9 A;  3RAM A;  4DR6 F;  2AJ0 A;  3CCU S;  2V4J A;  3DLB A;  2PC6 A;  1RAF B;  4UQG A;  3DNC A;  1S9G A;  1TAQ A;  1WOO A;  2GIR A;  4OX9 J;  1RWK B;  3R27 A;  4HH0 A;  4KO0 B;  4NA2 A;  3SMZ A;  4I0W A;  2J6S A;  3IWL A;  4YB7 A;  4CLP A;  2XZW A;  4KIA A;  5DGB A;  3TZZ A;  4YN3 B;  2MEW A;  1Q53 A;  4NLS A;  2GVZ B;  2ZFH A;  1WG5 A;  3KLF B;  2J0X A;  2EC0 A;  1B3T A;  1CJV B;  2NSC A;  5KT6 A;  2JSX A;  1QAY A;  2XSF A;  4DR1 F;  5FDL B;  2FHO B;  3IN5 A;  3MTJ A;  1MML A;  4FKX A;  4XDC A;  1N6Q A;  3GPA A;  3GR1 A;  1YBA A;  3NEK A;  4J90 A;  1BQM A;  1XR6 A;  2KVI A;  3BEG B;  2IFX A;  4OV1 A;  3MEC A;  5F0U A;  3TJ9 A;  3B4D A;  3CCZ A;  4PWW A;  3TZY A;  2H65 B;  4ECR A;  3F44 A;  3NS5 A;  4DF4 A;  2VUG A;  2OUG A;  5KOX A;  2YNG A;  4LF6 F;  2P9E A;  2VC0 A;  3HPO A;  3EMT A;  3EM1 A;  3A8E A;  4CH1 A;  2MJN A;  3KG0 A;  1FI4 A;  3G86 A;  4QWA A;  2B9E A;  5J2Q B;  3IM8 A;  5IM0 B;  4FYX B;  2DVI A;  2DJW A;  5ETP A;  4NCG A;  4X84 A;  3UR3 C;  3OL7 A;  3ZNU A;  3H40 A;  3DDK A;  5D4N A;  2C3Y A;  3FZB A;  3N0V A;  1F9F A;  3OR2 A;  3LQV A;  4CQ1 A;  4ECW A;  2W2M P;  6FDR A;  2F8E X;  4C3M A;  4LJM A;  3M7V A;  5CQG A;  1G3O A;  2DH9 A;  2HZC A;  1PJ6 A;  5AXM A;  3F56 A;  1SC1 B;  4URQ U;  3TUZ C;  3MM8 B;  3N5B A;  2VF3 A;  1UVN A;  1V6H A;  2HZA A;  2RF2 B;  3UN5 A;  4F0K A;  1FRM A;  3BDE A;  1JXV A;  4K4W A;  1JWW A;  2DK2 A;  1HAR A;  4ZJQ A;  3BQ2 A;  5GAH I;  4ANE A;  4KSE B;  2ROE A;  3P45 B;  2RU9 A;  1IR2 A;  2VDH A;  2MST A;  4KKO B;  2DR7 A;  1U8W A;  2W4P A;  3IBC B;  3I0S A;  4B9L A;  3MEG B;  3MR5 A;  5IC6 B;  1C1C A;  3C14 A;  1HR0 J;  2O3D A;  2FDN A;  7FDR A;  3KJQ B;  2EI5 A;  3K0J A;  4ZVS B;  4IO1 A;  1H7X A;  2OD4 A;  5KFA A;  3NMR A;  4L3N A;  2ZH4 A;  1SH0 A;  2Z56 B;  3QNW B;  4AT1 B;  2WZ1 A;  4ZVG A;  1RBL A;  1TVR B;  2E9T A;  4RKU C;  4ZIW A;  4ECT A;  2AU0 A;  1A0O B;  4H4O A;  2FC8 A;  1S1T B;  3MM5 B;  1HD0 A;  2HVD A;  5KFQ A;  1YGY A;  4ZP9 A;  3CCQ S;  1EET A;  3J80 Y;  1KON A;  4L73 A;  2GHV C;  1ELO A;  1C0T A;  2GJ2 A;  2N4D A;  2OPP B;  2CAD A;  1LW0 A;  2B56 A;  2DHX A;  1GXU A;  3M32 A;  2XSJ B;  2WTF A;  3SEO A;  4CO4 A;  2ASL A;  4I2Q A;  3KLE A;  3GLJ A;  1JQG A;  2JNJ A;  3PAC A;  5CYQ A;  3NBP B;  4DV7 F;  3M8R A;  3RRK A;  2VFU A;  4USH A;  1XNQ F;  1RU2 A;  4EWT A;  4FYV B;  2RU3 A;  4HVZ A;  2HVH A;  2E5I A;  2MKJ A;  4HDG A;  5HMW A;  1VC0 A;  3E01 A;  4JB8 B;  2IRU A;  2HQF A;  3DHX A;  2BKP A;  1JXL A;  3CCR S;  2CZ4 A;  1V5V A;  3M05 A;  1K1S A;  4MYT A;  3H5X A;  2IM1 A;  4LBP A;  4OI1 A;  4CLW A;  5HMZ A;  1VHF A;  4QU6 A;  1NPR A;  2KG0 A;  3FBC A;  4NLD A;  1D3W A;  4LFC F;  1SH2 A;  2FJV A;  2DIS A;  1KVI A;  1S7H A;  1JLA B;  3I55 S;  3C2P A;  5IV4 A;  2V34 A;  2RRB A;  3BRE A;  3M2V A;  3IRX A;  2JX2 A;  2XO6 A;  2LYV A;  6FD1 A;  2WSE C;  3R6G B;  3DLH A;  1QDU B;  2KZZ A;  1GEH A;  4OHW A;  4AL5 A;  1FKO A;  3KHL A;  2R8H A;  2VG7 A;  2IAJ B;  4DLG A;  3L3C A;  3RAX A;  2CJX B;  3OL6 A;  4YS2 A;  2HW3 A;  2WBR A;  3RJM B;  3HF5 A;  1HBN A;  1RTD B;  2OMO A;  3D28 A;  4CTA A;  2XNQ A;  4RU9 A;  4PG8 A;  5HVF A;  3CED A;  1RTJ A;  3VGU A;  5BXI A;  1T9U A;  3FFI B;  4MKY A;  3OXF A;  5CCL A;  3ENW A;  1T03 B;  3QT5 A;  2OPR B;  3KJN B;  4PAB A;  2Q43 A;  1R8H A;  2HND B;  4WBF A;  4CCH A;  2RSQ A;  3PRB A;  2YWH A;  3DCA A;  2HAF A;  2ZDP A;  4LT6 A;  2DNQ A;  2FQQ B;  4OYI A;  4JI8 F;  2QT7 A;  2JEF A;  3PX6 A;  3LTO A;  1B0V A;  1NB2 A;  4FPR A;  3SFG A;  4TYB A;  1X4D A;  3L7O A;  1H2T Z;  2Z58 B;  4ZHR B;  1U2C A;  3CXC R;  1UVL A;  2EFG A;  4GO7 X;  1FEE A;  1WC0 A;  3KLI B;  1OJ4 A;  2XCA A;  2FZG B;  3QJJ A;  3P5T L;  1F6T A;  5HN0 A;  4YB5 A;  2PT0 A;  1FO1 A;  4WXO A;  2RIL A;  1GMV A;  1GT8 A;  1WHY A;  5T41 A;  2Y8W A;  4QIG A;  1FX2 A;  3R1L A;  1T9V A;  4DX5 A;  2BOA A;  2ZH1 A;  3OSP A;  2QFJ A;  1U09 A;  1JX4 A;  4B3O A;  2XLK A;  4G1I A;  4QYZ J;  2IVM A;  3MR6 A;  3KK2 B;  4WFY A;  1Y3K A;  2PGC A;  3IGV A;  4CO0 A;  3Q2S C;  1NHU A;  4WYL A;  3QAU A;  1RT3 B;  1TKZ B;  4ZVU B;  1NM2 A;  3G8Q A;  4RNO A;  2DCU B;  3GMG A;  1FTR A;  2FPH X;  1HNZ F;  2P5V A;  3BGL A;  3AOD A;  4F3Q A;  2IRY A;  3HVT A;  1NB7 A;  3MWB A;  2HS0 A;  4OZ3 A;  1OPI A;  3BN4 A;  3M30 B;  3HSG A;  4N76 A;  3NGT A;  1IJE B;  2YX1 A;  2D3Z A;  1TL7 B;  3OUY B;  2FVP A;  1TEL A;  2JVO A;  4DR3 F;  4EBE A;  3MUM P;  2YWW A;  2IA6 A;  4IRK A;  3D9B A;  3PW2 A;  3D5M A;  2HNZ A;  1IWG A;  3G6Y A;  2IJF A;  3KLG A;  1N54 B;  3KLH A;  8AT1 B;  4TQS A;  3H5Y A;  2OSR A;  2ZBQ A;  5F9N A;  1P9Q C;  3DLG B;  3AJ1 A;  4DCP B;  2XYH B;  5L9X A;  5GMK a;  4C8M A;  4W90 B;  4G1P A;  2DXD A;  2KM8 C;  2DY1 A;  3LPY A;  1T8E A;  1B64 A;  4JI6 F;  3W2V B;  2QL5 B;  2R42 A;  4K0K J;  4I69 A;  4UUW A;  3MM7 A;  5K8P A;  1TK0 A;  4B02 A;  4F7V A;  5CYJ A;  1UEV A;  2QMU B;  4RW8 B;  3A3P B;  4J9M A;  4LF4 J;  2KKH A;  3I9Z A;  2WCX A;  2CVI A;  1RLC L;  5KG0 A;  4DPX A;  2WVF A;  4WP8 A;  3NCP A;  3WC2 A;  2H3E B;  4F4A A;  1TUV A;  3SSQ A;  1U1Q A;  4DQR A;  4J9N A;  1VR6 A;  2HLU A;  3PJX A;  4TY8 B;  3QPI A;  4DFM A;  4LF9 F;  1VQ6 S;  2G0C A;  4UF4 A;  4LF5 J;  1X7V A;  3CJ3 A;  1NO8 A;  5ETR A;  2UVW A;  1JKH B;  2VPY B;  3GV5 B;  2UUC J;  2EFN A;  1HW9 A;  1KRP A;  2CFX A;  1YSJ A;  2KXF A;  3NCQ A;  2GAH C;  3Q23 A;  1X9M A;  4RW9 A;  5JVH Q;  2NXU A;  3HZE A;  4KHP J;  2OML A;  4A8F A;  2LVW A;  3HZG A;  4N56 A;  4ZDN A;  5J2M B;  3W66 A;  2EK1 A;  4GO5 X;  2AX0 A;  4J9R A;  2DRA A;  4FVC A;  3WDO A;  3DRP A;  5BYQ A;  3OV7 A;  5DG8 A;  3CC4 S;  1IM4 A;  2UXD F;  2EWH A;  3W65 A;  1LWE B;  2ZZN A;  2ERR A;  3WQP A;  3OL9 A;  2JOQ A;  3BDP A;  4MIB A;  5CZX A;  3CDW A;  3B8H A;  4N77 A;  4X62 F;  2AF6 A;  4M5I A;  3K58 A;  2OLW A;  4AQY J;  4OIX A;  3THT A;  2XMJ A;  1X8D A;  1N5Y A;  2ADB A;  3BO2 A;  2IIH A;  5GAH U;  3AB2 B;  3CJ4 A;  2DT9 A;  4B9U A;  3IR7 B;  5EWE A;  4YR2 A;  4EEY A;  1PAU B;  2W4D A;  1TKT A;  4ILR A;  1QY7 A;  4O3Q A;  3RRH A;  2ASY A;  3W61 A;  1S97 A;  4ZCL A;  2BX6 A;  2CNO B;  2DHH A;  1UW9 A;  4LR8 A;  4LVN P;  5K5M A;  2HHS A;  5M2R A;  4PEO A;  2M8D B;  3PEH A;  1I6J A;  2HGN A;  3CSK A;  1TL3 A;  4ER8 A;  2G4B A;  2KT5 A;  1LWC B;  3I4H X;  3DRS B;  2CQ2 A;  2GO8 A;  3O5T B;  1HWJ A;  3QSY B;  3TYT A;  5LOQ A;  4TU8 A;  4JI7 J;  4R8U A;  5IT9 U;  5IV3 A;  4J9K A;  1K0T A;  1SPB P;  2Z2L A;  3MUV P;  1XC9 A;  1S1W A;  4Y3C A;  5KAK A;  1E6V A;  1J27 A;  1J5O A;  1Q7Y T;  1F5A A;  4UY8 5;  1YBT A;  3BV8 A;  4O23 A;  4WZM A;  2EFQ A;  3PXG a;  1VIX A;  3H25 A;  2PD1 A;  1N8R T;  2FVS A;  4USK A;  4OX9 F;  3MFI A;  5C42 B;  3MTK A;  3Q86 A;  1F3F A;  1QUV A;  1AUD A;  2AHO B;  4PXD A;  1FK9 A;  3D7S B;  4ZPC A;  2YNH B;  4I6Y A;  3CB4 A;  1HYS A;  1RAI B;  1RKI A;  2Z2Y B;  5DO2 A;  1JXE A;  4N5S A;  4OI6 A;  3CWJ A;  5F8L A;  3G6X A;  2OH2 A;  2LCW A;  2HK2 A;  2AJ4 A;  2I2Y A;  4KYZ A;  2X51 A;  1NDC A;  4Y34 A;  1IJF B;  1CBK A;  4K2X A;  1S0M A;  3TUJ C;  5LSR A;  1HMV A;  2C2R A;  2VA2 A;  2ILZ A;  4RX6 A;  3BBB A;  2B4V A;  4YHH J;  1UAW A;  2P9G A;  4C3K A;  1C4A A;  4HT7 A;  5B0A A;  1R0A B;  1UZH A;  2F7V A;  4FF4 A;  2R4F A;  3PR4 A;  2GFF A;  2E7W A;  3OJU A;  5IQ6 A;  3NGS A;  2C2O B;  2JZ5 A;  1HNW J;  2ZOG A;  1TP7 A;  2LEA A;  4BBY A;  1X5O A;  1U4B A;  1H98 A;  2VBY A;  1YK9 A;  1EHW A;  2LXU A;  4C2M A;  4DQP A;  4DR5 J;  5BJR A;  4KV8 A;  1S9E B;  2WW8 A;  1RIS A;  4F2R A;  1SC6 A;  4NOH A;  4ZPB A;  5JJB A;  1CC8 A;  3GJT B;  4I1T A;  2XY7 A;  5E3P A;  4FXV A;  2FLL A;  4IUF A;  4QU7 A;  3EDR B;  4PWU A;  5HVG A;  3DN9 A;  1DZ5 A;  3UVJ B;  4XPE A;  2WVD A;  3FBF A;  3HVW A;  3TAM A;  2BE2 A;  2AX1 A;  4NCB A;  2EXU A;  1X4G A;  4DHV A;  3ITH A;  4HTI A;  1WKL A;  3DXB A;  1R8A A;  2YNI B;  2LQ8 A;  2AKW B;  2HVZ A;  3H5U A;  3OR1 A;  2XMK A;  4PAA A;  3CO9 A;  4S0M A;  2GCF A;  2DO4 A;  1HR0 F;  2C2Z B;  2IM3 A;  3DLJ A;  5HP1 A;  3V4I A;  3DLK A;  4RBU A;  3C8Y A;  1S9G B;  1RT4 B;  3KNG A;  3WX4 A;  2IBO A;  4C8K A;  3AA8 A;  2JFD A;  2QLJ B;  2FVQ A;  1TK8 A;  5J1N A;  3NOC A;  2W2N P;  4FYW B;  1S77 D;  2VAS A;  3CGI A;  4O44 A;  3GU0 A;  2UXC J;  4MAK A;  2G2Z A;  3ZNJ 1;  1JIH A;  3A4T A;  2MSS A;  1RK8 A;  2MQM A;  5ETT A;  1RU1 A;  2P2C B;  4UZB A;  4PUO B;  4WP9 A;  3C15 B;  1VRT A;  5K8M A;  2KI2 A;  5CCM A;  5LL6 d;  3DMJ A;  2DNM A;  1N6Q B;  2M2B A;  2RH3 A;  3T1H J;  1E6Y B;  4Y0F A;  1BQM B;  4ZP7 A;  1YQH A;  4N41 A;  3R7N B;  1XQI A;  3I0R A;  2H1Y A;  3MEC B;  4DN0 A;  2G2O A;  1OWX A;  2CPE A;  1T9W A;  3JQJ A;  1U45 A;  1LWF B;  1RUS A;  4Q43 A;  2YQ1 A;  5C24 A;  1WDD A;  5FJ4 A;  2HHT A;  2CPX A;  2AD9 A;  4Q2M A;  2CJK A;  3MD1 A;  2N4C A;  3BM7 A;  1B70 B;  1M1K T;  1N5V A;  2CG4 A;  1R0C B;  1YBU A;  2D1C A;  2V50 A;  1RCO B;  2LA6 A;  4ED0 A;  2M9K A;  2AEJ A;  4TNO A;  5K14 A;  2BAB A;  3JYT A;  1I94 J;  2C2E A;  1U26 A;  5C7P A;  1WOS A;  4CNY A;  3W62 A;  4AL6 A;  1MN9 A;  1S4E A;  2YVS A;  2CA9 A;  4Y6I A;  3KJV A;  5B0B A;  1X9W A;  2EG2 A;  4PWD B;  3JAM Y;  1Q78 A;  4Y2I A;  2DHG A;  4IOC Q;  3CUN A;  1FES A;  2LDI A;  3KK3 A;  1HD1 A;  2ZH6 A;  2WB4 A;  4ECQ A;  2ZD1 B;  2MZJ A;  1RAG B;  1EQM A;  3CCT A;  1H72 C;  4F67 A;  1U1M A;  2V63 A;  2MDA A;  2ZH7 A;  4WFZ A;  1EZZ B;  1FVS A;  1S9F A;  3KHR A;  1TKD A;  3V6H A;  4Y28 C;  4ZIV A;  1RAO A;  3I82 A;  3ZZO A;  3SQO P;  3I0S B;  3SSS A;  1C1C B;  5H9E J;  3C14 B;  5LXY A;  4ED6 A;  1F0X A;  2MKI A;  2BKN A;  4ID5 B;  2IY5 B;  4DL0 C;  3QLH B;  2HGM A;  3WX8 A;  2R7X A;  5A76 A;  2KTQ A;  2ZKU A;  1Q81 T;  4NXM J;  2FGC A;  2YWG A;  2DGV A;  4UTG A;  3NL0 A;  3LA0 A;  2NCK L;  2QLX A;  4J9L A;  2DIU A;  2XGQ A;  2Q6C A;  4IRD A;  1S6P B;  1YG0 A;  3CF5 Q;  4OI4 A;  3P96 A;  4FBU A;  3D6H B;  4H4O B;  3PW4 A;  2G0I A;  1O8B A;  1SIW B;  3NOG A;  3TAN A;  1IKY A;  5M2U A;  1BQN A;  2ZUG A;  3RTV A;  1T9X A;  3PNI A;  2AEM A;  5C25 A;  3K5P A;  2YKM A;  4PCQ A;  2KM8 B;  4DSI A;  1LW0 B;  1T9Y A;  3M32 B;  1JLE A;  5LM7 E;  4X4P A;  1LQ9 A;  1MWQ A;  2AYG A;  3PHT A;  3W60 A;  1IVZ A;  5CYQ B;  1R31 A;  1K1Q A;  1DLO B;  3OVS A;  4XK8 C;  5L9N A;  2ZJR Q;  1Z2Z A;  5CD4 H;  3LP1 A;  2CPZ A;  1N5S A;  5E41 A;  1S0N A;  3N01 A;  2OFH X;  1FE4 A;  4G65 A;  4OYB A;  1Q79 A;  3T9N A;  3UR0 A;  2D69 A;  4KPY A;  1SIZ A;  2I9S A;  4U8V A;  2NXE A;  2FHM A;  2PFD A;  5T7L A;  1HWI A;  3M2V B;  3IRX B;  2E1C A;  2K1R A;  2CNL B;  1TFY A;  1WEX A;  4DSF A;  1TUG B;  4DF8 A;  3CIZ A;  3VAJ A;  2CPI A;  3NY0 A;  4Z2X A;  1FKO B;  1MMN A;  4GC7 A;  3RBX A;  2KU7 A;  2VG7 B;  4DV6 F;  2E5G A;  3G96 A;  3VAH A;  2KJV A;  3AXK A;  2RVJ A;  5JUM A;  1N5T A;  4RUC A;  1SC4 B;  3PW7 A;  4EYI B;  2FC9 A;  4K0K F;  3V6D A;  2W2P P;  3SQG B;  2ZBI A;  1KFS A;  4LF4 F;  3A1Y G;  2L9W A;  4LSN B;  2QYC A;  4DOZ A;  3BGR A;  4IRC A;  2XTJ P;  1PBA A;  1S12 A;  2V4R A;  3ZZP A;  4M5J A;  3T1A A;  4LF5 F;  4QCL A;  5ETO A;  3CC2 S;  3HD2 A;  3TZX A;  2V68 A;  2NXN A;  4O3N A;  3UI3 A;  1ARO P;  3PG9 A;  1VQ4 S;  2UUC F;  2E29 A;  2HMI B;  5LSO A;  4RR5 A;  1TAU A;  3P5B P;  3Q89 A;  5H9F K;  3NNC A;  5J2N B;  2VDI A;  3DDI A;  3ENQ A;  2MQQ A;  1B0T A;  3S6E A;  2RRA A;  1KOH A;  4KHP F;  5FLX U;  3W8P A;  2ZM6 J;  2OPS A;  1QM9 A;  2FHK A;  3GP9 A;  3F41 A;  1Q82 T;  2MZR A;  4YDX A;  1HQU B;  1KVK A;  8RUC A;  2KHD A;  3ZC4 A;  1QVG R;  3DFE A;  2ZHA A;  3ISZ A;  3ZXW A;  3H98 A;  3MMJ A;  3ZO7 A;  4K4Z A;  3R7S B;  4JV5 J;  3MM6 A;  4RW4 B;  4QOT A;  4Q8F A;  4KR0 B;  3TA0 A;  4FXD A;  4KGK A;  1T3O A;  4WFB Q;  4K2J A;  1AW0 A;  4B3T J;  3HVT B;  4AQY F;  4DZ6 A;  1EJ7 L;  3DOL B;  3BO3 A;  3RRG A;  3R5B A;  1N52 B;  4DX6 A;  4IKA A;  2LXI A;  1JNR B;  2B7B B;  3OFH A;  3T5L A;  4NLU A;  5A8K B;  3J7A 1;  3VAM A;  4ZN1 A;  2QA2 A;  5C2C A;  4NRU A;  4A46 A;  1S1X A;  2IM2 A;  1JLB B;  2AJQ A;  5KFS A;  3MHY A;  3HD1 A;  4WE1 A;  7FD1 A;  3PM9 A;  3KLG B;  3SCK E;  3BPD A;  5A6P A;  1YRX A;  5ETQ A;  5HMY A;  2LLZ A;  2OPQ A;  4FP9 A;  3J81 Y;  4ECU A;  2UUA J;  3DGV A;  3PKY A;  3A8J A;  4FYD A;  4MJK A;  1VYA A;  4DLE A;  4DXL A;  3EZU A;  3C3L A;  2FUG 9;  4JI7 F;  1P6T A;  3MM7 B;  4QW8 A;  5KFU A;  3A3O B;  3M6U A;  4N47 A;  4DJB A;  1WWH A;  3P6Y C;  2QEX S;  2WSF C;  4KE5 A;  1WDT A;  4X2B A;  3ET6 B;  1L3U A;  4DPY A;  5HRO A;  3NGD A;  1XR5 A;  1H2V Z;  4KFB A;  4LSL B;  5GVQ A;  3QO9 A;  4ED3 A;  3NGR A;  3K5O A;  5AE1 A;  4QIF A;  3VAG A;  5A8W A;  1SV5 A;  1H74 A;  4P52 A;  2IDL A;  3DLE A;  2VG5 A;  2COL A;  1CUL A;  1FHT A;  2NS1 B;  4O4G A;  2FD2 A;  1HI1 A;  4AD6 A;  1QAI A;  5KG6 A;  2CWK A;  1FRI A;  3TAR A;  4DL6 A;  3DRY A;  4ZCM A;  2ATL A;  1U6B A;  3D3C J;  2ZZM A;  4UOF A;  2FZK B;  4ED8 A;  3U7J A;  3UCG A;  4TN2 A;  3R5J B;  3QGG A;  1ZBT A;  4YHH F;  4QR1 A;  4C11 A;  5HBM B;  4LQ9 A;  5D3G B;  2CQ4 A;  1XJW B;  3IAS 9;  4NRT A;  4DMZ A;  3R5G A;  1F2H A;  1RWN B;  3QIP A;  1HNW F;  3CC7 S;  4DR1 J;  4IG3 B;  4UQT A;  1S0O A;  4NXN J;  4HR2 A;  2Z8Q A;  2HBR B;  2EFO A;  4ZLN A;  1OY8 A;  3BH6 B;  6AT1 B;  2NYI A;  4DR5 F;  4B9V A;  2DNR A;  4NA1 A;  3MED A;  2WBM A;  5LJ3 Y;  2DNG A;  5KFG A;  1SKW A;  1IBM J;  1HLW A;  3TW0 A;  1KC8 T;  4CLF A;  4P72 A;  3C46 A;  1Y11 A;  4DR7 J;  3W5Y A;  1YDL A;  1XR7 A;  2Q3P A;  4AYB D;  4JP8 A;  2AJ2 A;  1KBR A;  1QAX A;  4B08 A;  4IO9 Q;  5KFD A;  1U1K A;  3IBF B;  1HQE B;  4ZA1 A;  1N34 J;  3J80 U;  2BQU A;  5HAO A;  4L3K A;  1N4L A;  3EVW A;  4N8O A;  1KFD A;  4LF7 J;  2R8G A;  2BAN A;  4DQQ A;  2ZHB A;  4OI0 A;  3PEJ A;  3ZZR A;  2HQC A;  3EPI A;  1X4E A;  3GIK A;  2X7I A;  3PYF A;  1CC7 A;  3T5K A;  1VDH A;  4LRC A;  2K3I A;  4R8U B;  5J1E A;  4R0E A;  2HG4 A;  3KYL A;  3TQE A;  4OI3 A;  1B7F A;  4HHH A;  1RHM B;  3MAQ A;  3VQS A;  4U6P A;  1Q8K A;  3NRB A;  1BWV A;  2VBZ A;  2MGZ A;  3C19 A;  3AH6 A;  2BR0 A;  2V2Q A;  4P2S A;  1X5S A;  3FK4 A;  1AB8 A;  3CJS A;  3VVT A;  5CYM A;  3F0N A;  2KXH A;  1NZA A;  1B4S A;  2JJ4 D;  4ZK7 M;  3ILO A;  4ETX A;  5EHH A;  2ZC3 A;  4MFB A;  1HYS B;  2UXC F;  2QMX A;  2ZEJ A;  4IH7 A;  1QJH A;  2VFS A;  1NHK L;  3R9L A;  3ISN C;  3VZI A;  2CPH A;  2BM0 A;  2A2C A;  3IXQ A;  2ZOF A;  1I3O B;  2P6S A;  1SJ3 P;  2NZ4 A;  1EKS A;  4LFA J;  5AE3 A;  1MG7 A;  2OAU A;  1UFL A;  2L9N A;  3N6N A;  4XPC A;  2DGW A;  3GSI A;  3T1H F;  3ISN D;  1RT5 A;  4I67 A;  1YZ7 A;  4FS2 A;  4C8O A;  2E9Z A;  1U48 A;  1YJ9 S;  2W9C B;  2R7V A;  2ZKT A;  4RO0 A;  4JI2 J;  1LFP A;  3EGV A;  5KT3 A;  4I64 A;  3EJM A;  1T05 B;  4ED2 A;  5DDR C;  2OTL S;  2AMC B;  2B4P A;  4PR6 A;  1JLF B;  3NGK A;  4I68 A;  2HAI A;  5KFJ A;  3R2D J;  2CAJ A;  1IQT A;  3BKU A;  3EVM A;  2F1F A;  2DEI A;  3VV2 B;  4M5D B;  4EUV A;  4PPD A;  5EX0 A;  1C4C A;  3DGP B;  3CMQ A;  5A0Y A;  4P6Q A;  3SDE A;  4KV8 B;  3QFH A;  5KG4 A;  4OYZ A;  4ECY A;  3HMJ G;  1I94 F;  3H7H B;  1RXO B;  2ROP A;  3KFW X;  1RDR A;  4MK8 A;  3QZ8 A;  3PZP A;  5SUH A;  4X65 J;  3PX0 A;  3CCM S;  5E5N A;  1M5V C;  2DNN A;  4OZL A;  3AD8 C;  2C42 A;  2VPZ B;  3W3S A;  4ETZ A;  4HHU A;  3W9H A;  2NXC A;  2B3T B;  3TAM B;  4UW2 A;  4PQU A;  1REV B;  2YKN B;  3ITH B;  3CNQ P;  2M70 A;  1NJW A;  2FJA B;  3FNN A;  3D54 A;  1ZET A;  2GJF A;  3OTC A;  1FRK A;  1IKX A;  1VGY A;  3PCO B;  4P71 A;  2QLB B;  1GH8 A;  2F8M A;  2FLN A;  2KFY A;  2IMW P;  1VI7 A;  5K8O A;  5F8H A;  2H4W B;  3FCV A;  2R2U A;  3MPW A;  1NRK A;  2GC8 A;  4TU7 A;  1NH7 A;  1FJ7 A;  4B3S J;  3HHN B;  2MY7 A;  2LA4 A;  1KQF B;  3G8T A;  2XMU A;  2N7Y A;  1DQ9 A;  4F4K A;  3EZ5 A;  4NXM F;  2I6W A;  2XUL A;  4WCE Q;  2HBZ B;  2B8P A;  2CQ3 A;  1JB0 C;  1PJ5 A;  4RUA A;  2KL8 A;  4D3G A;  3MAA B;  4DUZ J;  2CRL A;  3V6K A;  1U1P A;  2B0G A;  4JI5 J;  3HX9 A;  1X60 A;  1MRO A;  4WTY A;  1DTQ A;  4HAC A;  3TX0 A;  3CJK B;  3NWG A;  1RWM B;  4OLP A;  3HJF A;  2BOP A;  4HDH A;  2PA8 D;  3I0R B;  1D1U A;  1EP4 A;  2KT2 A;  3DOK A;  1D9D A;  3ZTR A;  3I56 S;  4HEA 9;  3FGV A;  2V8D A;  2UVV A;  3P4U B;  2HVI A;  3SFU A;  2R7T A;  4LFB J;  1NLK L;  1JLQ A;  4OQJ A;  3OTE A;  2V9W A;  2VOP A;  4G3I A;  5C24 B;  1IM6 A;  3FCW A;  2QE5 A;  4ZVR B;  2ZJQ Q;  5KFZ A;  2CNK B;  1FKP A;  3M8Q A;  3M9N B;  3K5N A;  2ZH9 A;  1YKW A;  1OYE A;  1O5J A;  3UO0 A;  3S7R A;  2MQO A;  1U0H A;  2ZE2 A;  1K8A T;  2FY1 A;  4DI6 A;  1ITP A;  3JYT B;  3W7B A;  4YP3 A;  4PQA A;  2XZD B;  1SUQ A;  3IM9 A;  1SCJ B;  3PKM A;  2RAQ A;  1SKU B;  4ZIT A;  4NLG A;  1UFK A;  4J9P A;  5IS2 A;  5CAB A;  4ELV A;  4TLR A;  1RCX B;  3CJ5 A;  1NXI A;  3GJS B;  4JI1 J;  2DIV A;  2QTW A;  1FD8 A;  3NXZ A;  2QL9 B;  3LPE A;  1VBX A;  4JV2 A;  4F25 A;  2DGU A;  2VV5 A;  4RWW A;  4QIV A;  1LOU A;  3CMA S;  4G1Q A;  4U7U D;  2XWX A;  1BC6 A;  3CDU A;  2GMH A;  3TJA A;  2YNF B;  4CO3 A;  3DDN A;  1RT2 B;  4L76 A;  4M63 A;  2ADC A;  2CQ0 A;  3OT9 A;  1PJ7 A;  2B9X A;  1OMS A;  1QLN A;  1HBM A;  3VF0 B;  1NK8 A;  3GR0 A;  3AXM A;  2LMI A;  3I87 A;  1IBL J;  2KDO A;  4YEA A;  2DHS A;  4IDK A;  1P1L A;  1LW2 A;  3OL8 A;  3IS9 A;  2EVZ A;  3QGI A;  3ZTO A;  3FSI A;  4JUZ A;  1NDP A;  2EBG A;  9RUB A;  4NLY A;  2G2Y A;  2IC3 B;  1HNX J;  3IAM 9;  2JC0 A;  3N79 A;  1HI0 P;  4CO2 A;  1TTH B;  2WW4 A;  2NPI A;  2CYY A;  1UPM B;  1P8G A;  2OD6 A;  3BSO A;  4M5L A;  3L95 X;  4KTQ A;  1AUS L;  3OXL A;  2R7U A;  2R7O A;  1HNV A;  4FDF A;  5DQI A;  3MMA A;  4OJ1 A;  1ZH5 A;  1BWE A;  2DNH A;  3MEK A;  1QAJ A;  2YKM B;  3C66 A;  5L1K A;  5BYR A;  2ZM6 F;  1JLE B;  4XAK A;  4A4J A;  1KHV A;  3GIR A;  3KKF A;  3G6E S;  1RHR B;  2EFP A;  2GZO A;  5DG9 A;  4PYA A;  4A8X A;  2BVZ A;  4ECX A;  1F9H A;  4GKJ J;  4JV5 F;  3HXM A;  3HT3 A;  1RT1 A;  1H2U X;  1Z4U A;  1FF2 A;  1S1U A;  2CPY A;  3AB4 B;  3GV7 B;  4A8O A;  2DO0 A;  1ZS6 A;  2VA3 A;  1FDN A;  3SIP B;  5IFM A;  3M1V A;  1XMQ J;  3TO8 A;  4DV0 J;  2BEF A;  4ZVH A;  3VGS A;  5DET A;  2MLY A;  1FFS B;  1F1B B;  4HI1 A;  1K9M T;  4DV1 J;  2BJE A;  2PA3 A;  3IA0 A;  2OJ3 A;  2OHD A;  2FLO A;  2HHU A;  3R7B B;  1R0B G;  2VH7 A;  1X0P A;  3EVO A;  2XM3 A;  4P2X A;  5J2P B;  3OLB A;  2L48 A;  1BXN A;  3TVK A;  2XBP A;  1L3S A;  1L3V A;  4DV2 J;  1Y5I B;  4G6V B;  1M1H A;  4EI2 A;  4WZQ A;  3K5M A;  1TV6 A;  3GSD A;  1VMB A;  3CME S;  4B9T A;  3BB5 A;  3ZTS A;  2UV8 A;  5DM7 Q;  4O0I A;  4ICL B;  4N7T A;  1YX2 A;  1CJU A;  4FBT A;  1YLX A;  4TQR A;  5B08 A;  4FNI A;  3TUP A;  1F2G A;  4LRB A;  3W1Y C;  4NL5 A;  2UUA F;  1VQP S;  4PKD B;  2VB6 A;  1WOR A;  2PFF B;  4Y2K A;  1H3D A;  1JJ2 R;  2XG8 A;  2HHX A;  3Q8V A;  3QJL A;  3SI8 A;  4C8N A;  2BW7 A;  3C6U B;  1IKW B;  2CJA A;  4KJI A;  3TR5 A;  1S1V A;  4OYM A;  3NG8 A;  1TQL A;  3U1L A;  4IG0 B;  5FLX Y;  2V69 A;  2X1A A;  4K5S A;  1VBK A;  2K8G A;  3OFF A;  1D9A A;  3PJ9 A;  1S72 S;  2AV5 A;  4IFY A;  2ZVS A;  3H4D A;  2AJ1 A;  2XC9 A;  1RB0 A;  2YPY A;  4MK9 A;  3SCL E;  3ULH A;  1W2B R;  3DYA A;  4M5N A;  2FJX A;  4OYO A;  4USU A;  4KO0 A;  3D0G E;  5HAN A;  3N9U C;  5ADZ A;  1GNK A;  4DS4 A;  2VD3 A;  3CO0 P;  3PV8 A;  4F3O A;  1U6F A;  4Z7C A;  4H4M B;  3IP0 A;  5A6W A;  3KMQ A;  4NLW A;  4CT9 A;  1RHK B;  4CNZ A;  3HSJ A;  3RG6 A;  4CT8 A;  3SZ2 A;  2QRR A;  1PSD A;  1NPK A;  3WZ0 A;  3M2R A;  2ZBR A;  4KQZ A;  4H54 A;  1KSP A;  1HPZ A;  3EGN A;  5KT5 A;  3KUH A;  5LT5 A;  1YZ6 A;  3CCL S;  4M95 A;  2B9Y A;  4ECV A;  3L09 A;  4WII A;  1RAJ A;  2GHP A;  3H20 A;  2HIQ A;  2UVR A;  4R5P B;  1YJU A;  2AP6 A;  2F65 A;  4DEZ A;  4NXN F;  2F3J A;  2HBQ B;  1P27 B;  4WF9 Q;  2XLJ A;  1S6O A;  1CJK B;  4I7F A;  3MCM A;  3UW1 A;  1VOM A;  3G9C A;  4PG4 A;  3K89 A;  3OW2 R;  3CCV S;  1WOP A;  1QE1 A;  1RTH B;  2V8V A;  2MXY A;  1IBM F;  1D9F A;  4URS A;  2RQC A;  2K2P A;  4V1A k;  2APO A;  4O3R A;  4DR7 F;  4CO1 A;  2J0W A;  1LWX A;  3NS6 A;  3UFC X;  3I32 A;  1MWZ A;  4USI A;  3C16 B;  4WE1 B;  1GTE A;  4NYZ A;  4DS5 A;  2XMW A;  2GV1 A;  2GIF A;  4DFK A;  1NK9 A;  1Q1K A;  1WAC A;  3I31 A;  5G0R B;  1N34 F;  4ZN3 A;  2XQC A;  3PJW A;  3Q22 A;  2W9B B;  4LSZ B;  3V6J A;  5F9L A;  5D0E A;  2OPQ B;  2VQE J;  3MM8 A;  3H59 A;  1JK9 B;  2DEJ A;  4LF7 F;  4OZN A;  4OX7 A;  1UPP A;  2MKK A;  3PRD A;  1K0V A;  2RF2 A;  1M1G A;  4H4K A;  3C6T A;  3HFK A;  2NQP A;  4GVB B;  2I5J A;  1NSQ A;  1YRU A;  3LWM A;  3FBB A;  2DGT A;  3BR9 A;  5GMD A;  2F9J A;  3SCJ E;  4OHY A;  2E1P A;  4KKO A;  4X4U A;  2DGQ A;  5HRO B;  3JSB A;  3OBI A;  3MEG A;  2WOM A;  3QO9 B;  2ABY A;  3MR7 A;  2JWN A;  2PE8 A;  2OFG X;  1VK3 A;  3TX8 A;  3BN7 A;  2DKO B;  2W2Q P;  5A8W B;  4FZV A;  2QFI A;  3DM2 B;  4IR1 A;  5E3Q A;  2Y0S D;  2XMM A;  3CJ2 A;  1L3T A;  1N56 A;  1CUL B;  1NSP A;  4PPZ A;  2PSZ A;  1WF0 A;  2RDD A;  2ZVI A;  3QQC D;  4DV3 J;  1ZPW X;  2YH0 A;  3W5X A;  2QX0 A;  3JAM U;  4USJ C;  1SVD A;  2C3P A;  3BZQ A;  1YJ7 A;  1TMM A;  1TVR A;  3DI6 B;  4Z7Y A;  1XEZ A;  4UY8 T;  1KQK A;  4U95 A;  4LFA F;  4KAI A;  4ENO A;  1UWA A;  4D3H A;  3J7Z T;  3FJ2 A;  1S1T A;  1U1N A;  3MM5 A;  3CTR A;  1FJG J;  4ERD A;  2JH3 A;  1CSJ A;  2NPF A;  4RW7 A;  3UDE A;  2B6A A;  5A8R A;  3LGN A;  4JI2 F;  3RR8 A;  1Q0N A;  2OPP A;  2FIU A;  3PDN A;  2RE1 A;  4CWB A;  3MPY A;  3ZTQ A;  2ASD A;  4OHZ A;  1WD6 A;  1YI2 S;  3EXY A;  2BE9 B;  3BS9 A;  3FRZ A;  1PBU A;  4DCJ B;  3MMC A;  3MED B;  2M0G B;  5HAT A;  2D3U A;  2IMO A;  5C5J A;  1WC1 A;  2QSF A;  3CCS S;  3TQ1 A;  4ITS A;  2JHE A;  2VIC A;  2VIH A;  1YIT S;  2GJI A;  4X65 F;  1FDA A;  4WU3 A;  3SSR A;  1UA1 A;  3ILL A;  3IGN A;  2AGO A;  3HM9 A;  1JLA A;  1GAO A;  3D1H A;  2B43 A;  1CJT A;  2FB0 A;  2WK4 A;  3FQK A;  2C2K B;  5CH7 B;  3WC0 A;  1D0E A;  2I8E A;  4R0J A;  2BAN B;  2B8Q A;  3W9J A;  2FY8 A;  1SJF A;  3D6T B;  3ETM A;  2PDA A;  3LP2 B;  3FSY A;  2E66 A;  5DDO C;  5E33 A;  4KH0 B;  4K59 A;  1IN0 A;  2CJY B;  2DH7 A;  3RBE A;  4UUX A;  3GCW P;  2G13 A;  2GO9 A;  2V2K A;  4OLO A;  2GMJ A;  2ROG A;  2R9L A;  1S59 A;  2MGZ B;  4YOE A;  2CG8 A;  1RTD A;  3Q8U A;  1PAE X;  3HFV A;  5ETN A;  4B3S F;  2M88 A;  3VGT A;  2HK3 A;  4JBC A;  3EXC X;  3FRY A;  4KGM A;  2QG9 B;  1UET A;  5CAA A;  2HFU A;  1UWB A;  4MFB B;  4JI0 J;  3KOA A;  2GS8 A;  1C0U A;  3MUR P;  4M94 A;  1Y9O A;  2W24 A;  2HRY A;  1HBO A;  5I42 B;  2DTJ A;  1JJC B;  1RBO B;  3EYZ A;  2XHW A;  3IRW P;  1CVJ A;  3HCX A;  2MQN A;  4DUZ F;  1MWY A;  1FXR A;  1DBD A;  4JI5 F;  1VBZ A;  1U1R A;  2E5H A;  4UOC A;  1RT5 B;  2OTJ S;  3U1N A;  1Y3J A;  1RQ0 A;  4F0M A;  3RB4 A;  3KLI A;  3SBM A;  5BYS A;  1TL1 B;  1WTB A;  2KZM A;  4JV0 A;  4KY3 A;  2HHH J;  4LFB F;  2ASJ A;  2F9D A;  3MUT P;  1W26 A;  4I2P B;  2N7C A;  4MKB A;  1NBE B;  5M2P A;  2AW0 A;  1SJR A;  3QT8 A;  8ATC B;  3QAE A;  3M9O B;  4QWB A;  4PG7 A;  3J7Y I;  4ELU A;  2OO4 A;  4MT1 A;  1MLA A;  2POK A;  3FKB A;  4FVM A;  4ZMM A;  2ZUA A;  4J91 A;  3KK2 A;  3MCS A;  2UV8 G;  1YTY A;  1FJC A;  5EX3 A;  2Q79 A;  2VPW B;  1RT3 A;  1TKZ A;  3PIP Q;  4K4Y A;  2FGO A;  2ZH8 A;  3MEE B;  1KHW A;  2HVE A;  2F40 A;  5IT4 A;  2XB2 D;  2HEK A;  1FNM A;  1DAR A;  2FZC B;  2MTL A;  1WSR A;  3X3U A;  4JI1 F;  1HKA A;  2ATC B;  2C3U A;  4IFV B;  1IBC B;  5U47 A;  5DLF A;  2M4M A;  2J9D E;  2DRB A;  2DIT A;  1FVQ A;  5ETK A;  1HFE L;  1TZ0 A;  2CQC A;  1VQ5 S;  3U1M A;  3KDO A;  1IKX B;  1UP1 A;  4F02 A;  5IXU A;  1HW8 A;  3H2V E;  3PX4 A;  3KK1 B;  1FE0 A;  1T11 A;  3OSN A;  1TMJ A;  1N48 A;  2A10 A;  2M3D A;  1AXQ A;  4ECS A;  4K8R A;  5EGY A;  1Y10 A;  4OYX A;  5AT1 B;  1A6L A;  1T3N A;  5K9F A;  5EWG A;  2R8I A;  4J9V A;  1IBL F;  2IDE A;  1RWW B;  4NPO A;  2QC3 A;  2L41 A;  2ACY A;  1V5I B;  3KXD A;  3W2V A;  1CQN A;  2EBE A;  4OZ0 A;  2HQ3 A;  4F4W A;  1KTV A;  4DV6 J;  2V67 A;  2DPJ A;  4RW8 A;  2QA4 G;  3K5L A;  2JRS A;  1HNX F;  2VL1 A;  3M8Y A;  3P49 B;  1U0S A;  2B5J A;  1EQ0 A;  1KR4 A;  3CVK A;  5L39 A;  3G8S A;  3FEX B;  4NLT A;  3JTO A;  4TY8 A;  4OMF G;  2WAQ D;  3R5D A;  5A2Q Y;  3UCU P;  1RAB B;  1MU2 A;  1TL4 A;  4HAC B;  2H4Y B;  1JKH A;  3VAK A;  4WXW A;  2PO4 A;  4OZ5 A;  4WTO B;  3JB9 k;  3X1L B;  1HWL A;  1GTH A;  2AYM A;  2BV3 A;  3DOK B;  1BE4 A;  4RNF A;  2XGP A;  4AL7 A;  4BCA A;  1ZTW A;  1LNQ A;  5KFP A;  1BUX A;  3J81 U;  3NWR A;  3K57 A;  3VAL A;  2CVE A;  3M8Q B;  2LU1 A;  2YTC A;  4GKJ F;  2HKE A;  3HK2 A;  1T02 A;  4HL9 A;  1U0H B;  4KC5 A;  2ZE2 B;  2QO3 A;  3BSA A;  2GML A;  2VG6 B;  3R8Y A;  3KWM A;  1RT6 B;  2NUH A;  1XMQ F;  3LW5 C;  3HFZ B;  4DV0 F;  5KFL A;  5ETV A;  1LV5 A;  4DV1 F;  4PRF A;  2J8A A;  3GIJ A;  3HHL A;  3CUL A;  1PYO B;  1RKJ A;  5DRK A;  2CJB A;  3WHI A;  1U6Z A;  4ILM A;  2GVD B;  5D4P A;  4IH5 A;  1S49 A;  3AAW B;  1OSD A;  4DV2 F;  4FF1 A;  2HFN A;  4DBQ A;  1SKS A;  2Z30 B;  3GQC A;  1KLM B;  2CQI A;  2W8K A;  3H2U B;  1S7I A;  3CD6 S;  1YRT A;  1N33 J;  4DSE A;  3BYR A;  5KFN A;  1H6K X;  2UUB F;  5JVG Q;  5IOL A;  3Q8Q B;  2W4C A;  4NZ6 A;  2XZT B;  3BBF A;  1LWC A;  4C98 A;  2NZC A;  1TL5 A;  3OXG A;  2Y1R I;  4GRS A;  2BJ7 A;  4K4V A;  1RAC B;  1UFW A;  3OVB A;  1ZZN A;  3K8W A;  1NEE A;  4RLE A;  4YQW A;  3FCH A;  3DU5 A;  1X4C A;  1ACM B;  1NH8 A;  5GAD I;  4WJB A;  1HHQ A;  1ZPV A;  4EO6 A;  2E5J A;  3M8P B;  1QVF R;  2H51 B;  2W7P A;  2QA4 S;  1ZTT A;  3BKT A;  1CS4 B;  3FC9 A;  1F5B A;  3VCD A;  4HKQ A;  4U67 Q;  3O2I A;  2LFV A;  2FVR A;  4UST A;  2YNH A;  4ZP8 A;  1W25 A;  3ENA A;  1EX8 A;  1Q8L A;  1U47 A;  3GFX A;  1IWA A;  3P3D A;  1U1L A;  2GQQ A;  2QLW A;  1NND A;  2HS4 A;  5D0G A;  4Q5V A;  4O3S A;  3NGU A;  3TI0 A;  1GMU A;  1X4A A;  3M8Z A;  3FZ2 A;  1N88 A;  3RB6 A;  4ZVP B;  3J7Z 5;  3M6X A;  2W9A A;  2MLZ A;  2D3O R;  3BYP A;  3TEH B;  3LP0 B;  3DKD A;  1GMW A;  5KOW A;  2HFS A;  2K7J A;  3DXS X;  3H42 A;  3HT0 A;  4FKY A;  3CCJ S;  3MF5 A;  4HHJ A;  3HDS A;  1M0S A;  4TXS A;  3ZFV A;  1Y00 A;  1OO0 B;  1R0A A;  5DZ7 A;  1HNI B;  3R1H A;  1S6Q A;  4QYZ K;  4USW A;  3GYN A;  2P9C A;  1RSC A;  4HT5 A;  5KFK A;  1UJ4 A;  1YJT A;  1FFG B;  1RT7 B;  1LK5 A;  3DLL Q;  2Y8Y A;  5MAO A;  3KHH A;  2V8G A;  1AZS A;  3JQK A;  3RBZ A;  3K7R A;  2BJD A;  1AFJ A;  4RBT A;  3G6V A;  4ILL A;  4J5O A;  2Z4P A;  4IQM A;  3M2U A;  1N32 J;  1DUR A;  3LAL A;  1N0U A;  4NAS A;  4ZPW R;  5B0E A;  2H54 B;  4IOB A;  1O6X A;  5HQL A;  5L1I A;  3POT B;  2VQE F;  4CH7 A;  1RBA A;  4LF2 A;  2R8K A;  4LMZ A;  2J76 E;  2VKR A;  3THP A;  5D15 A;  1QTM A;  1FA0 A;  4F4X A;  2HQG A;  4KGV B;  3MMB A;  4DPU A;  3DC2 A;  2DR6 A;  2YNI A;  2C22 A;  5DJB A;  3DOM B;  1JLG B;  1A9N B;  1ZM3 A;  1VQ9 S;  4XTT A;  2RNE A;  1J5E J;  4EBC A;  3R3T A;  3MOZ A;  2RHS B;  3AA9 A;  4O3O A;  5CXT A;  4QIW D;  4WFX A;  4I6A A;  2YWF A;  3ILI A;  1TR0 A;  1FTC A;  5AXK A;  1BMQ B;  1W7W A;  2BQ3 A;  1SL1 A;  1X4B A;  5KFT A;  3ZZY A;  3JS9 A;  3M6V A;  3RB0 A;  1SL2 A;  4IFY B;  2MKS A;  4F8R A;  3MR3 A;  1RT4 A;  4KGX B;  3MM9 A;  3Q2T C;  1WEY A;  4CZC A;  2D9P A;  1FX4 A;  3DYA B;  5H1S V;  2IJR A;  2YKA A;  2LU2 A;  3W63 A;  4DV3 F;  5DS7 A;  3HHL C;  3B54 A;  2RB7 A;  1C1B A;  4V19 X;  4BDP A;  1M5H A;  2F4V J;  3J7Y U;  2VFV A;  3V81 A;  2JDJ A;  2V4J B;  1F3V A;  2C2N A;  4ES3 A;  4PUO A;  3U27 A;  4DSK A;  1R43 A;  3HHL D;  3C15 A;  1WC6 A;  4MH8 A;  1WC5 A;  3GFZ A;  1FJG F;  1M5P C;  5KG2 A;  4DU7 A;  3M2R B;  1CPZ A;  4DL7 A;  1E6Y A;  3R2C J;  4C8Y A;  4C9D A;  1FEH A;  1HPZ B;  4K4S A;  3EE3 A;  3B78 A;  3JTP A;  4EFA C;  1LWF A;  2KVQ E;  4DPW A;  4QZV B;  4LF1 A;  2FHJ A;  2MY8 A;  2YY3 A;  3UD4 P;  4I7F B;  2MKY A;  4OYW A;  1QE1 B;  2V4Q A;  3R5C A;  3MPU B;  1W2I A;  3CJ0 A;  1DQA A;  1NCL A;  1SI9 A;  2QV6 A;  3Q8P B;  2AZ1 A;  4RW6 A;  2ZZT A;  1M90 T;  3Q24 A;  4FS1 A;  1VRU A;  2XWY A;  1GX6 A;  4C8L A;  3HHE A;  2KFZ A;  2WHO A;  4NI2 A;  4WWS A;  3OLA A;  2YNG B;  1XN9 A;  5B0D A;  3I5B A;  5HLF A;  4PWD A;  1ZAW A;  2HIY A;  4QWC A;  3RGI A;  2XMT A;  4Q45 A;  2UXB J;  4LF8 J;  2DNP A;  4DDF A;  4ECZ A;  3BH7 B;  2I1R A;  3B82 A;  2DR9 A;  4V19 J;  3DU6 A;  4W92 B;  3SXL A;  3DRR A;  2HQI A;  4NCG B;  3MD3 A;  2ZD1 A;  2J8S A;  2R7R A;  1VFJ A;  5KFI A;  3C6T B;  2BW2 A;  1LK7 A;  1ZA1 B;  2PI5 A;  2XS5 A;  3OR2 B;  3H4B A;  1I5O B;  2JLE A;  2I5J B;  4DN9 A;  1VIO A;  4USV A;  3M4X A;  1RTI A;  2JC1 A;  1FXL A;  1XK8 A;  4NLQ A;  2ZWO A;  3LH2 S;  4RUB A;  2HFO A;  2WOM B;  2J9C A;  2HGL A;  1GMW D;  4ID5 A;  1G2E A;  1HBU A;  3QLH A;  3EIC A;  4DFJ A;  1T94 A;  3D2W A;  3QID A;  5F3Z A;  4LRF A;  1R7I A;  4JI0 F;  2JVR A;  2W1B A;  1K44 A;  3PR5 B;  4A8K A;  2CQD A;  5L1J A;  4TY9 A;  3FMB A;  1VQY A;  2PII A;  4LR7 A;  1RJJ A;  3Q83 A;  3ZZT A;  2AGQ A;  4MKA A;  2E5L J;  3AJD A;  4B9M A;  4J7C A;  2VJU A;  1S6P A;  1QUP A;  4ED7 A;  5DQH A;  2HHP A;  5B0G A;  2HQD A;  4A8Y A;  1YIJ S;  3UDV A;  2CUY A;  3MFH A;  4M5M A;  4LBI A;  1Q5Y A;  3AQO A;  3A3N B;  4GKK J;  1U25 A;  4ZJO A;  3QWU A;  4K7Q A;  4ZPA A;  1SH3 A;  4RW7 B;  4MIW A;  1X5P A;  2B6A B;  5A8R B;  1L3K A;  2RQM A;  3A8I A;  2YQ0 A;  1UKU A;  2K06 A;  2GHW A;  4DV5 J;  2Z0G A;  3TAP A;  2HHH F;  5GAE I;  2RRN A;  3VGV A;  2MKC A;  1KDN A;  3ILJ A;  2UU9 J;  1MSW D;  2I0X A;  4USM A;  2CIM A;  1EET B;  3NS7 B;  4KRW A;  2YWK A;  3OVA A;  1DLO A;  4YB6 A;  1CLF A;  5CA5 A;  1IUJ A;  2H5I B;  1C0T B;  2ZHO A;  2F63 A;  3MMC B;  2N82 B;  4NE9 C;  1RHU B;  4NWB A;  3UE2 A;  1T9T A;  3KUE A;  2KO1 A;  5FII A;  5CHC B;  3VHQ A;  3KTQ A;  1VIS A;  3GTY X;  2QZ8 A;  2JEG A;  4I2Q B;  3KLE B;  5KT4 A;  4ED1 A;  1OY9 A;  2MJU A;  2I38 A;  4X4S A;  3V5R A;  1WEL A;  2XHC A;  2BZ2 A;  3NNA A;  1HA1 A;  4RBV A;  1M5K C;  4L72 B;  4ID8 A;  1UJ5 A;  4LUB A;  3JXO A;  2DD8 S;  3E01 B;  1YJR A;  2DNL A;  1DHM A;  1CJT B;  2DH8 A;  1URR A;  1TKX A;  1WHX A;  1Q8I A;  3H5S A;  4DU8 A;  5GAD U;  5HJX A;  4I4B A;  2MHN A;  4LQ3 A;  3RU0 A;  3CD0 A;  4U96 A;  1D09 B;  1Z2L A;  3B6B A;  5ETM A;  1BHN A;  4WU2 A;  2MZS A;  3NAH A;  2V2V A;  3TP2 A;  3NKY A;  2FTR A;  2IBK A;  5GAG I;  4RU2 A;  4NLX A;  4CO5 A;  3OFE A;  4WKY A;  4OHX A;  4YY3 J;  5E7O B;  2OP5 A;  1O51 A;  4UOG A;  4A8W A;  3CDA A;  3SQG A;  5EN1 A;  4OI2 A;  2YQ3 A;  4FN5 A;  5F3T A;  4RJV A;  1VQL S;  1QSS A;  4LSN A;  1UWB B;  2MQL A;  5RUB A;  1HBN B;  3QMQ A;  1C0U B;  2WON A;  2R8J A;  4CTA B;  1HBO B;  4GMK A;  2FHJ D;  2XMA A;  1RTJ B;  1Q5V A;  1WSV A;  2C2D A;  1WC4 A;  4AUK A;  3W2W A;  4U8Y A;  2JFK A;  1WEZ A;  2HMI A;  4CLZ A;  5J2N A;  4WK3 A;  4HH1 A;  4DL5 A;  1WHV A;  1U2R A;  3BGO P;  3D6M B;  3TOQ A;  3W64 A;  1H38 A;  1WI6 A;  3ADA C;  1Q7L B;  1DFD A;  2RT3 A;  1P1T A;  2ILY A;  4ZPT R;  1VQN S;  5LXR A;  1RYS A;  3HUL A;  1XNR J;  3QZ7 A;  1HQU A;  4JI4 J;  3B4M A;  2YH1 A;  2VQF J;  2E7X A;  3FQL A;  2VHG A;  5HI7 A;  4MK7 A;  1RAA B;  1JMT A;  3GZ7 A;  4IH6 A;  4RW4 A;  1DTT A;  5HQM A;  1NDK A;  4YFU A;  4I56 A;  1WF1 A;  3BSN A;  4K50 A;  4DL3 A;  2WRM A;  2YKQ A;  4DPO A;  4CLS A;  5F8G A;  1UL3 A;  2IYI A;  3DOL A;  1BGX T;  2B51 A;  4B3O B;  2Q1L A;  3D66 A;  4BC7 A;  2KG1 A;  3BGU A;  4WFA Q;  4JYA J;  2PN6 A;  4XO0 A;  5A8K A;  1FCA A;  4DWI A;  4LRD A;  1YJV A;  4QJV A;  2X3G A;  3TJ8 A;  1R6V A;  1JLB A;  4C97 A;  1FRL A;  1N36 J;  1KTQ A;  3HVA A;  2PMW A;  2CPF A;  1WI8 A;  4DX8 H;  3IG1 A;  5F0W A;  5DDQ C;  1N33 F;  2C2M B;  4CYU A;  2BJ1 A;  3I5C A;  4ZVO B;  2DGS A;  3QFW A;  2GGP A;  1AA1 B;  2HNZ B;  2ZH3 A;  3PYE A;  4DSJ A;  4CLK A;  5HL7 Q;  1U24 A;  3KLH B;  4Q8E A;  4C6A A;  3N4W A;  3P8B B;  5H9E K;  1HHT P;  4OJG A;  3PY8 A;  2RHQ B;  3ET6 A;  4JI3 J;  4Y65 A;  2B5J B;  4LSL A;  3D1O A;  5L46 A;  4NEZ A;  3GCX P;  1LEO A;  3OTD A;  2ZC4 A;  1URN A;  4ES1 A;  2XY6 A;  3EZO A;  2KHC A;  3BR8 A;  1MU2 B;  3LGH A;  2EG1 A;  1BLU A;  4X4Q A;  1NJY A;  4ZVF A;  2J0Q D;  4CIO A;  1GXL A;  1FWP A;  1ICE B;  1QD1 A;  4CLT A;  3UD3 P;  4OFZ A;  5LSL A;  3MDF A;  3H90 A;  3IBW A;  3BJY A;  1TUW A;  3M8W A;  2OI2 A;  4DG1 A;  1U1O A;  2C1E B;  1RAD B;  4CM2 A;  3K59 A;  2HBY B;  2VKZ G;  2J9D A;  4IYQ A;  2R2T A;  1NSA A;  2DR8 A;  3SYZ A;  1WG4 A;  2MPU A;  1YJN S;  1EIY B;  5HK4 A;  5HBM A;  4RW9 B;  3D6F B;  4BWJ A;  5JXS A;  4P73 A;  5D3G A;  2YKO A;  3QRR A;  1S5Z A;  2JL9 A;  3T41 A;  4LRE A;  1PCA A;  4P2M A;  1L5U A;  4YR0 A;  2E7V A;  4IG3 A;  5LJ5 Y;  3TRG A;  3G4S S;  3DRP B;  1V3S A;  1KLN A;  1VQM S;  4W4M A;  5KT7 A;  4OYP A;  4DUY J;  3HHL B;  2NRE A;  4Q44 A;  2Y1I A;  4BWM A;  5J1P A;  2Y9H A;  4QPX A;  5SZT A;  1VC5 A;  2AT1 B;  4TYA A;  5IQQ A;  3CJR A;  1RHJ B;  1N32 F;  2PMZ D;  3L7P A;  2PI4 A;  1N5Y B;  1FWK A;  1P9Y A;  4U9R A;  4C3L A;  2VBX A;  1HQE A;  4Q0B A;  2HFZ A;  4P75 A;  2N3O A;  2QN6 B;  2XEX A;  3US5 A;  3CIM A;  3PW0 A;  4F04 B;  3D67 A;  4PG5 A;  4EZ6 A;  1TKT B;  2XS2 A;  1CQM A;  1RWV B;  2RIJ A;  2J6U A;  2FYX A;  5E3R A;  1SKR A;  3OJS A;  2NSB A;  5DLG A;  4QR2 A;  3K2Y A;  4B17 A;  3E2E A;  1J5E F;  1JLC A;  2LEP A;  3FEZ A;  5KFM A;  2DGO A;  1REG X;  2CDR B;  1TL3 B;  1RHQ B;  4DR2 J;  3CPW R;  2BM1 A;  2HWT A;  2A0F B;  1NSK L;  4X64 J;  1PKU A;  4ANC A;  5BR8 J;  3GIL A;  4FXW A;  2OIH A;  5GAE U;  3PW5 A;  5DGA A;  1S4F A;  3I5A A;  5E0O A;  3GWC A;  4LR9 A;  3HP6 A;  1YJW S;  2CKW A;  1S1W B;  1E6V B;  2HFV A;  2F4V F;  3T9Z A;  1J5O B;  4Y2C A;  3ZZU A;  4DX7 A;  3IFE A;  3Q8R B;  2G0J A;  5DZ6 A;  4OJ3 A;  2W25 A;  4TKT A;  2X3D A;  1FK9 B;  1NKB A;  4DL2 A;  3CCE S;  1Y5N B;  2L9D A;  2IPO B;  1OQ3 A;  3BF4 A;  3N5F A;  1LXN A;  2ZWP A;  3M8S A;  5DG7 A;  5HMX A;  2W9C A;  1R8P A;  3MI7 X;  4O4R A;  3NCR A;  1T05 A;  3E3X A;  5C2G A;  4RPF A;  4AFF A;  4CP5 A;  2KFN A;  2MQ8 A;  1S6Q B;  1JLF A;  1GQE A;  4ES2 A;  3AD9 C;  3LOU A;  2BJ3 A;  1HMV B;  3MCN A;  3D1Q A;  2E1M C;  1NK0 A;  1NME B;  2F4F A;  3LGM A;  2B4U A;  4M5D A;  4O0N A;  3DGP A;  3S1T A;  5LMN J;  3RZA A;  2IM0 A;  2R7W A;  2OSQ A;  1AZS B;  2VOO A;  1R27 B;  5GAG U;  3WBZ A;  3N6L A;  1SB6 A;  4N8N A;  5EUH A;  2MZT A;  3AOC A;  2IA0 A;  2Q66 A;  2SXL A;  3M2U B;  1OPZ A;  7AT1 B;  1H7W A;  2CQH A;  5KFX A;  1HWK A;  5D78 A;  3GFY A;  3PIO Q;  2ZJP Q;  1NAQ A;  2UXB F;  4Y2M A;  4LF8 F;  1HL6 A;  3MOJ B;  4ZKA A;  4WP3 A;  1REV A;  2YKN A;  1WNE A;  2DGX A;  1OYD A;  2FJE B;  1ROF A;  4RNH A;  3O6Q A;  3MMB B;  1K47 A;  1KQS R;  2HZV A;  3UWT A;  4C8Z A;  1G6B A;  2BJ9 A;  2BBE A;  3FSX A;  1ZM4 A;  1YWX A;  5FD1 A;  2BE2 B;  4BS2 A;  4RL1 A;  1MW7 A;  3LAM A;  4AXI A;  2UUW A;  3IR6 B;  3OR1 B;  3MM9 B;  4OX6 A;  1G7C B;  4DCO B;  2GIQ A;  2H48 B;  2ALY B;  3CJ8 A;  1VBY A;  5D4O A;  1FFW B;  5IWA J;  1C1B B;  1RZM A;  4QBU A;  1UVM A;  4OZJ A;  3V81 B;  5HP1 B;  3V4I B;  2E5L F;  3PYG A;  4ZPD A;  3DLK B;  1KS2 A;  1UA0 A;  1SBR A;  2JEI A;  2AYB A;  2U1A A;  2HLT A;  3MAA A;  2QLF B;  5IZH A;  3THV A;  5KG5 A;  4GKK F;  3TVZ A;  2A6O A;  1AT1 B;  3CJK A;  4O44 B;  3O44 A;  4DV5 F;  2MLX A;  2D9O A;  3SV3 A;  1ZZF A;  5K20 B;  1LFW A;  3ZZZ A;  1X0F A;  1SQF A;  1IKV A;  2UU9 F;  5H9F J;  3BQ1 A;  4DR4 J;  1VRT B;  2HS3 A;  2V8P A;  1RLD A;  2CXE A;  2IYG A;  5HSP A;  3DMJ B;  3JSM A;  2GAG C;  3ZZ0 A;  2HSE B;  3GB0 A;  4OJH A;  5IC4 B;  1SQG A;  1VJQ A;  3DRX A;  4WFN Q;  2CJQ A;  1MNE A;  2RS2 A;  4P7T A;  2ZNZ A;  4RW6 B;  3VTI A;  5AJ3 J;  5JMN A;  1PC5 A;  2FJB B;  1VRU B;  3GG0 A;  2VOD A;  2QMW A;  2QYG A;  1KEK A;  4F50 A;  2EEY A;  2KXN B;  4NI2 B;  3M9M B;  5A2Q U;  2X1B A;  5HLF B;  1Q8B A;  5B0C A;  2QIF A;  2RDJ A;  1WHW A;  2EPI A;  4NLV A;  5K14 B;  3J7A N;  2EKY A;  2OEK A;  3W9I A;  3AT1 B;  2MZ1 A;  1NK5 A;  1I1G A;  5EWF A;  1F5C A;  1RE1 B;  3DRR B;  1NKE A;  1ULR A;  2MQP A;  1FNO A;  4L75 A;  3CW2 C;  4A8M P;  3KJV B;  3IR5 B;  4LIW A;  2YNF A;  4X66 J;  1NPP A;  1UVK A;  1RT2 A;  1NK6 A;  1N0V C;  1RTI B;  4Y00 A;  4WK1 A;  3NAI A;  5KG1 A;  5F8N A;  2DNZ A;  3E51 A;  3NNH A;  3KK3 B;  1U02 A;  2H9Z A;  2HYI B;  1VLO A;  3KG1 A;  4YY3 F;  4RUH A;  3G71 S;  1SQE A;  2VON A;  3JSR A;  1HBU B;  1SJ4 P;  3UN3 A;  3KLV A;  3AOA A;  1NU4 A;  3KJF B;  3A12 A;  2HRU A;  3EX7 B;  3GIM A;  1PYS B;  3D0H E;  4F2S A;  1RP5 A;  2P8I A;  3S8S A;  1VQO S;  1Z1Z A;  3JSY A;  3NMA A;  2A2D A;  4XDD A;  2IC3 A;  5HVH A;  2V0N A;  4PXB A;  2CQP A;  3FEY B;  2XO7 A;  2M8H A;  3HKZ D;  1BY9 A;  1ZOT A;  3QT7 A;  2M5Y A;  2RS8 A;  3UDL A;  4OX8 A;  2WVB A;  5KFH A;  5KFE A;  2BA9 A;  5L1L A;  1PIL A;  4HYK A;  4C4W A;  1TU0 B;  2QGF B;  4DPT A;  1KQG B;  1VQS A;  1XNR F;  4KHR A;  1S79 A;  3J81 j;  4K4X A;  1IKY B;  1QTN B;  1YVF A;  3BGF A;  4JI4 F;  1RTZ A;  1BQN B;  4K4U A;  3NLC A;  2VQF F;  4KB7 A;  2LXF A;  1H0H B;  2FLP A;  2E9R X;  5C25 B;  2XNR A;  1RWO B;  2EC2 A;  1VQK S;  1UVJ A;  3ENV A;  2X1G A;  5T14 A;  3G82 A;  4GC6 A;  3ICL A;  1HIY A;  1ZAX A;  5KFB A;  3MPV A;  2HNY A;  4J9S A;  2PMH A;  4NLR A;  4E2F B;  4OZ2 A;  1SL0 A;  2O67 A;  2Z2M A;  4EYH B;  2A1B A;  4J9U E;  3KG4 A;  1T0T V;  3LP1 B;  5LMU J;  2BE7 D;  4JYA F;  2DRD A;  2VZ9 A;  2EFV A;  1D8Y A;  2IHR 1;  1TKX B;  1NJZ A;  4BHQ A;  1V3R A;  2LDY A;  3U02 A;  1N36 F;  5J2P A;  1RWP B;  2E1A A;  4U7U K;  1VCT A;  1FDB A;  2B4O A;  2KH9 A;  4XIU A;  4P7V A;  2YX7 A;  5CZV A;  2M7S A;  4CRJ A;  4AE5 A;  3QGH A;  5T7L B;  5KFY A;  3HLU A;  4ICL A;  2K1R B;  4WIQ A;  1XMO J;  1VRQ C;  3FVY A;  2ZH2 A;  5I3U A;  1S6U A;  2J9E A;  2BMB A;  2AEF A;  3TZW A;  2KRB A;  2XI2 A;  2D74 B;  2V2Z A;  1Y5L B;  4TU9 A;  4ZCI A;  2HHW A;  3CE8 A;  2L08 A;  2RKI A;  4J9O A;  2VBW A;  3LF0 A;  3RW7 A;  1S57 A;  4F26 A;  4ZOS A;  3C6U A;  1IKW A;  5EDW A;  2V9K A;  3OPK A;  4EK2 A;  2HWI A;  4Q7A A;  1VC6 A;  3TAQ A;  5ETS A;  3WIU A;  4DV4 J;  2F5G A;  4R25 A;  5B09 A;  3L4B C;  2WON B;  4IG0 A;  3LUY A;  5B0F A;  4JI3 F;  2UUB J;  1HI8 A;  1SXL A;  4YR3 A;  1NJI T;  5F8I A;  3V6D B;  3L9Z A;  2AJF E;  3W5Z A;  1IBK J;  2N3L A;  3UQS A;  3W2W B;  1WJ9 A;  2J7K A;  1VQ7 S;  4RNN A;  5L8R C;  2P6T A;  5HO4 A;  4UT4 A;  3BGR B;  1FNX H;  1KNZ A;  4QYR A;  4ZP6 A;  5I4M A;  3RB3 A;  3IC1 A;  4NYO A;  1DAX A;  4H4M A;  2UUT A;  4ZVQ B;  2WSC C;  3MCO A;  2ZH5 A;  1ZYQ A;  1RGV A;  1WC3 A;  1QSL A;  4M8L A;  1WTF A;  4X4N A;  3T5H A;  1RA6 A;  2DY9 A;  5D4L A;  1J2V A;  5AE2 A;  3UD5 A;  4EU0 A;  1G4C A;  2OEJ A;  2IVY A;  1DTT B;  2QA1 A;  3QT6 A;  3T3F A;  2GVZ A;  3LO3 A;  3OFG A;  3SCI E;  2OPS B;  3KLF A;  2WB1 D;  2ZBP A;  1CJV A;  3OHB A;  2AQ4 A;  4MTP A;  4R5P A;  2NXJ A;  3OHA A;  3GJQ B;  5FDL A;  1WKK A;  2VFT A;  2DXE A;  1ZM9 A;  1HWU A;  4YB1 P;  3FUY A;  5KFW A;  1CJK A;  4DUY F;  2HHV A;  5ETL A;  2EW9 A;  4GVL A;  4L6V 3;  3MM6 B;  3QBC A;  3T6J A;  4NEY A;  3O8W A;  3RUB L;  2VJV A;  2CQB A;  1Q86 T;  1RTH A;  3OTO J;  3KDN A;  1FWL A;  2B9W A;  3Q8S B;  4B3R J;  3C16 A;  3N28 A;  1X9S A;  5I3P A;  2DB1 A;  4F4Y A;  3IG1 B;  1LKZ A;  2VC1 A;  1NKC A;  4FF3 A;  2HUR A;  5G0R A;  2YPZ A;  4TVA B;  3WIV A;  4CYU B;  2W9B A;  3T1Y J;  4IR9 A;  5J2Q A;  1S1X B;  4TLQ A;  5IM0 A;  5D77 A;  3CDE A;  2GGP B;  3O3L A;  2E1R A;  3CJQ A;  3VQT A;  3UDC A;  4QQB A;  3JTN A;  4FNH A;  1PG5 B;  1Y7P A;  4GVB A;  4B3M J;  2W7O A;  3A8K A;  1VHI A;  3UPF A;  4YDD B;  1B0P A;  2W01 A;  4C0H A;  1S48 A;  4FF2 A;  2EKN A;  2BKO A;  4QR0 A;  4DR2 F;  2V6A A;  3MAH A;  4MIA A;  2GQ2 A;  1FXD A;  2CQ1 A;  4X64 F;  2G1D A;  1C2P A;  5E3A A;  2AIR B;  5BR8 F;  2ZNY A;  3DM2 A;  3EDQ B;  1WF2 A;  1UJ6 A;  1R89 A;  5D0R A;  1TFW A;  2DHA A;  4DZD A;  1SJQ A;  1X5T A;  3EGZ A;  2Z57 B;  4KFB B;  2BQR A;  1BD6 A;  4ZCK A;  1KKH A;  1XIQ A;  1S76 D;  3CD7 A;  3DI6 A;  3CJT A;  4DR6 J;  2YBV A;  1GK8 A;  2RML A;  4DG1 B;  1SV5 B;  2GNK A;  3HSZ A;  3DLE B;  2VG5 B;  3VAF A;  3PFO A;  3F73 A;  4O4G B;  2LP4 A;  3MGJ A;  2LQ5 A;  3RAQ A;  2XS7 A;  5DM6 Q;  3T6B A;  4DQS A;  2DNK A;  1WG1 A;  1U49 A;  2RJZ A;  1CG2 A;  1JJH A;  1JJ4 A;  5L38 A;  3UNG C;  2GW8 A;  3R6L B;  3GYX B;  4X4T A;  2VU5 A;  1FRH A;  5AXN A;  4CLY A;  1RWX B;  1FRJ A;  2CWX A;  4C11 B;  3PHE A;  4ZVE A;  4ED4 A;  5LMN F;  2IVF B;  4QWD A;  4ATN A;  1S0V A;  1NK4 A;  3PYD A;  2XSJ A;  2D7S A;  3PO4 A;  3QIP B;  4A8Q A;  3QSI A;  1HQ2 A;  1GX5 A;  3MPD A;  5IT9 Y;  3NBP A;  4OL8 A;  2KYZ A;  1FJE B;  3VWS A;  4NML A;  3QRP A;  2NR0 A;  4HTJ A;  4ELT A;  4A8S A;  4LF6 J;  3M6W A;  1Y0H A;  3D4J A;  4Q0B B;  1VS3 A;  2ZOM A;  3S01 A;  2Y1L B;  1WKJ A;  5D6G A;  3D3B J;  2XMV A;  3PRV A;  5ITH A;  4EGL A;  4NCA A;  3LP2 A;  5KFF A;  1KOO A;  2CZ9 A;  1APS A;  3HKW A;  4QIE A;  2MZQ A;  4P2F A;  1JLC B;  1R8B A;  1Q95 G;  4C7Q A;  3GE9 A;  4NMX A;  4DQI A;  2KT3 A;  1B7Y B;  4A48 A;  1ZM2 A;  2C3O A;  4LVO P;  3VVU A;  3GG1 A;  2NUU G;  5F41 A;  4M1K A;  1RAE B;  1X4F A;  2PEH A;  1QSY A;  3I6P A;  5KG3 A;  2NYH A;  1EKR A;  1UW4 A;  1XMB A;  1BQX A;  5MLC V;  1IXK A;  4HLB A;  3UCZ P;  1LXJ A;  4Q2L A;  4QPT A;  2UZA A;  4RNM A;  5G4D A;  3G2X A;  3D0I E;  2BDP A;  3H8Y A;  5J1E B;  4O3P A;  2IAJ A;  3PTW A;  1B99 A;  4CDI A;  4ZLL A;  1NK7 A;  5IWA F;  2KB2 A;  2XCP A;  3H0P A;  4PZV A;  2R7Q A;  2AZ3 A;  1OY6 A;  1YHQ S;  1ZAV A;  5I42 A;  4W98 A;  4PXE A;  3ONQ A;  3SV4 A;  4OYA A;  5CYM B;  1KP6 A;  4NLO A;  3FFI A;  1FT8 A;  3VZH A;  2U2F A;  2RQK A;  5GME A;  2J0S D;  1RI7 A;  4ZLJ A;  4EO8 A;  1T03 A;  2H5J B;  2GA7 A;  2PEB A;  2OPR A;  5DDP C;  3TNV A;  1A7G E;  3OTB A;  1T95 A;  4C0B A;  1KD1 T;  3QJP A;  2HND A;  2VPX B;  4E0D A;  3VAI A;  1TL1 A;  2W7A A;  3EWG A;  2YWE A;  4HI2 A;  2HRT A;  1SC3 B;  2K7K A;  3KHG A;  1V3Z A;  4DR4 F;  3N6M A;  4URG A;  3GYG A;  2ACM A;  4I2P A;  3R97 A;  4ZHR A;  2J6T A;  3BSC A;  1HHS A;  3K8V A;  2GQC A;  2O01 C;  1V9O A;  4YME A;  1OIA A;  2OGU A;  3HHD A;  1S99 A;  5AXL A;  1RYR A;  4CLU A;  2F8H A;  4X4R A;  3UN2 A;  3BO4 A;  1R3N A;  4X4V A;  4ZLP A;  1FRX A;  4H4K C;  4U7C A;  5AJ3 F;  3MEE A;  3PO5 A;  4E98 A;  4C0O C;  2M52 A;  5KFR A;  3V4M A;  3MZI A;  4J37 A;  4DV7 J;  1PC4 A;  4M5G A;  1XNQ J;  1DRZ A;  4MMO A;  2R2S A;  2ALZ A;  1XBW A;  1K73 T;  5A0Y B;  3SDE B;  4LIR A;  2KYX A;  3W8G A;  5KFV A;  4IFV A;  2VFR A;  4JOU A;  2Y1J A;  1NJX A;  3VR1 A;  4ZPV R;  3MR2 A;  5KT2 A;  2RQ4 A;  1M5S A;  3M30 A;  4LFC J;  4PXC A;  5THW A;  4X66 F;  4CM0 A;  3FBE A;  2YXL A;  3AFG A;  3KK1 A;  1FER A;  4IOA Q;  1TL7 A;  5D8H B;  3OUY A;  4WPA A;  1WUU A;  4DUT A;  4AND A;  2CDQ A;  4PQU B;  4B9N A;  4M5K A;  4ZS6 A;  5KFO A;  2ZDO A;  4AXJ A;  4X4O A;  2GX8 A;  4QWE A;  2MYF A;  3CD5 A;  2DR5 A;  2XYG B;  2RUS A;  1RA7 A;  2DPI A;  2W8L A;  4FPI A;  4PG6 A;  5B7W A;  9ATC B;  4DL4 A;  3DLG A;  4NZ7 A;  1GXT A;  1PYT A;  1KWM A;  5KG7 A;  3QWP A;  2IRX A;  4EMD A;  2ZIT A;  5IT0 A;  2R7S A;  2DCL A;  4J9Q A;  3AHP A;  2R3V A;  1VJW A;  2Q6B A;  1XTZ A;  4WKR A;  3BKF A;  4YUD A;  1X31 C;  2BUN A;  4B9S A;  4F0H A;  2WVE A;  5HQ8 A;  4F36 A;  1TK5 A;  4P9S A;  2LEC A;  2AGP A;  1Q4R A;  1IR0 A;  1D8Z A;  3NP5 A;  4CLL A;  5I3Q A;  2CJ9 A;  2OEL A;  4ZVT B;  4JI8 J;  3PVX A;  3HVR A;  2L3M A;  1IKV B;  3HI9 A;  1XER A;  2AWZ A;  3IMQ J;  2E44 A;  1MRO B;  4NX9 A;  2DYA A;  3JSM B;  1DTQ B;  2HWH A;  2O66 A;  2KN4 A;  1PIE A;  2XLI A;  3LWL A;  2YX4 A;  4QW9 A;  1I51 B;  2QL7 B;  1VQ8 S;  1EP4 B;  3GON A;  1R6Y A;  3BQ0 A;  1DY3 A;  4EBD A;  4F3M A;  2K3K A;  1NUE A;  1JLQ B;  4ED5 A;  2VG6 A;  4MYU A;  4C48 A;  1OS5 A;  1RT6 A;  3MXH P;  3D68 A;  2MKH A;  5J2M A;  3QGP A;  1FKP B;  1AFI A;  3AOB A;  3FDS A;  1G1X A;  4DSL A;  3EGW B;  1OQ6 A;  4RZR A;  5LMU F;  2Y3Y A;  2XY5 A;  4A47 A;  3V2U C;  1T7P A;  3L7U A;  2J7U A;  1LWE A;  3LAK A;  3GII A;  4LRA A;  1X4H A;  1UCN A;  3TWZ A;  2BRK A;  3K17 A;  3RBD A;  2GVD A;  2B7C B;  1HNZ J;  1SUQ B;  2BAC A; 
#chains in the Genus database with same CATH homology
 1QDU B;  4ZVT B;  1RE1 B;  1RHR B;  1RWX B;  1RHK B;  2C2Z B;  2H65 B;  1RWP B;  1F9E B;  2CDR B;  5K20 B;  4LSZ B;  1PAU B;  3P45 B;  3EDQ B;  1RHQ B;  2CNN B;  2CJX B;  3IBC B;  2XYG B;  2QLJ B;  1NME B;  5IC6 B;  3RJM B;  1SC4 B;  2C2K B;  4DCP B;  2XYH B;  1I3O B;  3IBF B;  2CNO B;  2XZD B;  3GJT B;  1I51 B;  2HBZ B;  2QL7 B;  1IBC B;  4ZVQ B;  1GFW B;  1RWK B;  3D6M B;  3R5J B;  1QTN B;  3KJQ B;  1PYO B;  3SIP B;  3R7S B;  2H51 B;  4ZVS B;  1BMQ B;  5IC4 B;  3GJS B;  3EDR B;  4JB8 B;  2H4Y B;  3GJR B;  1ICE B;  4DCO B;  2P2C B;  2CJY B;  2QL5 B;  1RHJ B;  2H48 B;  3KJF B;  2QL9 B;  2HBQ B;  3NS7 B;  1RWO B;  3KJN B;  3QNW B;  2C2M B;  2Y1L B;  2C1E B;  2XYP B;  2H5I B;  1RWN B;  4ZVU B;  1RWM B;  2HBY B;  3D6H B;  3R7B B;  1RHU B;  4ZVO B;  2H5J B;  1RHM B;  2QLB B;  2DKO B;  2FQQ B;  4DCJ B;  2CNL B;  3P4U B;  1SC1 B;  3R7N B;  2HBR B;  1RWV B;  1RWW B;  2QLF B;  2H54 B;  2C2O B;  3GJQ B;  2H4W B;  4ZVP B;  3D6F B;  4ZVR B;  3R6L B;  2CNK B;  1SC3 B;  2Y0B B;  2XZT B;  3R6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...