2XZDB

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
b'CHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 18
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xzdB00
2XYPB 2HBRB 3RJMB 5IC6B 2CNLB 2H48B 1PAUB 1SC1B 2QL7B 1QDUB 4ZVPB 2CNOB 5K20B 2H5IB 2QL9B 3NS7B 1IBCB 3QNWB 1RWXB 2FQQB 2QLBB 3D6MB 2H5JB 4ZVTB 2C2OB 3D6FB 2CDRB 3KJNB 4DCPB 3D6HB 2C2KB 2Y1LB 1RWKB 1NMEB 1RHRB 3IBCB 2QL5B 5IC4B 2H51B 2C2MB 1I51B 1RE1B 1RWPB 1SC4B 2CJXB 2DKOB 1F9EB 4ZVRB 4DCOB 3GJSB 1RWNB 3GJQB 1RHJB 1I3OB 1BMQB 4ZVOB 1RWVB 1SC3B 2HBYB 3R6LB 3IBFB 3KJFB 1RWMB 2XYGB 1QTNB 1ICEB 2XZDB 2HBQB 2XZTB 3GJTB 1GFWB 3R5JB 4JB8B 3R7BB 1RWOB 3EDQB 4ZVUB 3KJQB 2HBZB 1RWWB 3GJRB 2QLFB 4DCJB 2C1EB 3P4UB 4ZVQB 2Y0BB 3R7NB 2CJYB 3P45B 1RHQB 2P2CB 1PYOB 2H4YB 2H4WB 1RHUB 2H65B 2XYHB 3SIPB 3R7SB 4LSZB 2CNNB 1RHMB 4ZVSB 1RHKB 2CNKB 2H54B 3EDRB 2C2ZB 2QLJB 3R6GB
chains in the Genus database with same CATH superfamily
3WIUA 4X62F 4DR4F 2IPOB 1PIEA 3MXHP 1U02A 5HQ8A 2H5IB 3OTOJ 2W2PP 1NRKA 2DY9A 3UN3A 2IC3A 1Q7YT 2FQQB 4DUZF 4CLTA 3TP2A 2K7KA 3QT5A 1SL1A 3MCNA 7FD1A 1VMBA 2VL1A 4RO0A 2ZNZA 2XEXA 4DI6A 3G9CA 5D78A 1KRPA 2CG4A 1HI8A 3H2UB 4L75A 5IFMA 3GJQB 2QA1A 3HCXA 2KVIA 3M6VA 4H4OB 4X64J 2HPUA 1EP4A 2MTLA 2K1RB 1KVJA 2DNRA 1A9NB 2IAJA 3KHLA 3UN5A 3PCOB 3TUIC 2GIRA 1WTBA 4UUXA 2DNKA 1RDRA 1E6YA 4DG1A 4IRDA 4DL4A 1RYRA 1URNA 4KC5A 4UOFA 2DH8A 1OO0B 3SV3A 1WOOA 1B0TA 2VFSA 2GGPB 2R3VA 3HJFA 5DM7Q 2FLNA 5HN0A 4C8YA 1X4DA 3MFHA 1D9DA 4ZVTB 3ENVA 3MAAB 2L48A 1JJ4A 3RBDA 1YJVA 3PO5A 2F8MA 5ETPA 4ERDA 3UN2A 1OSDA 5DETA 1VQKS 2D3ZA 3BKTA 4QR2A 4J90A 1R31A 2CQ4A 4IR1A 3IN5A 3KLFA 5CZVA 2CIMA 2B56A 4HR2A 4AQYF 3T9ZA 3CNQP 2HHXA 1VRUB 4ANEA 2PFDA 1QUPA 5GADI 1NK4A 3FBCA 1SB6A 3I0RA 3M2VB 5ETVA 4K4UA 3IRXA 3CPWR 4BHQA 1KWMA 2WVDA 4XPCA 4HI1A 2HWIA 3DM2B 2CJAA 4NZ0A 1UJ5A 2BXJA 3KLGB 3GR1A 1YGYA 3PG9A 3FZBA 4I56A 4KKOB 1UETA 4NXMJ 2O66A 2ZZMA 2RVJA 4HVZA 5JVHQ 2M0GB 2HVZA 1HFEL 5T14A 3W5YA 4AXIA 1UJ6A 4DR1J 2R7VA 5C25B 4GRSA 2HAFA 2HGLA 3MEGA 2JRSA 2V2ZA 1Q78A 3OQ2A 1N88A 1FKAF 4TKTA 2R8IA 3HHLB 1VBKA 2M7SA 4E98A 3CCLS 3ZZZA 1M1HA 3V2UC 5DLFA 3TVYA 3EZUA 3T1YJ 1X5OA 1EZZB 2WB4A 2ZH1A 2PEHA 3Q2SC 3PYGA 2HQCA 3MM9A 4MMOA 3D1OA 1H2UX 3I55S 2P2CB 4QU6A 3G8SA 4FYWB 4GO7X 5IT9Y 2QC3A 4K4YA 2FJVA 5A6PA 4YFUA 3QGPA 2C3OA 1WG5A 4WK3A 4O3SA 1YSJA 5HROA 2R42A 2ZC3A 1SJ4P 2ZM6J 3UDVA 4XO0A 2MGZB 4Y2CA 4LFBF 4KHPJ 1WUUA 2UP1A 2M2BA 1Q95G 3BGLA 4ZITA 2ATCB 1G6BA 4QIEA 1RAFB 3C14B 5I42B 2ALZA 3BQ0A 3Q22A 3BR8A 3QJLA 3RYLA 5I3UA 3QFHA 4LFCF 3MR3A 4U7CA 2RS8A 1TZ0A 4B9NA 5L1KA 2JEIA 3O3LA 2EKYA 1NJWA 1OQ3A 3W61A 4QIVA 1KHWA 2UZAA 2RNEA 5BJRA 3QGIA 3BSAA 4ITSA 1RWOB 3ZZUA 1AB8A 3LA0A 4D3GA 1UA0A 2ILZA 5FJ4A 1NU4A 2KYZA 4EBEA 1KDNA 2W7PA 4DV2J 2LYVA 5C24A 3AB2B 4GC6A 2HK3A 2YKAA 3R7SB 2EKNA 1WKKA 4LSNA 1VIXA 4UY8T 5CH7B 2ZVIA 3OXLA 3RJMB 4DQRA 3WQPA 1KS2A 2XSJA 4BDPA 2FZKB 2BJ8A 3POTA 1IBCB 3KHGA 3FFIA 3RAXA 1NSKL 3BB5A 3G82B 2V0NA 2ASDA 3NOGA 3O8WA 1M5SA 2VPZB 5IQ6A 2PSZA 2E1CA 2COLA 2HIQA 5EX3A 4Q7AA 1K47A 4TU7A 4DUYJ 1QE1A 3HO1A 2N7YA 3KTQA 1P8GA 4DQQA 4Q43A 2FJWA 2DGVA 4JI3J 5KFJA 3G6ES 1T9UA 5F8GA 4JI4F 3BO2A 4R0EA 1RXOB 2IJFA 1CJKA 1WDTA 1YWXA 1NSAA 4P75A 3P4UB 4ER8A 2YPZA 1NHVA 2AJ0A 3NMAA 1D8YA 3DFEA 4B9VA 4YR3A 3RRKA 2NYIA 5LOQA 5RUBA 2B4OA 3O5TB 5K8PA 3B78A 3K7RA 2R7OA 1WHYA 2CQDA 5ETTA 2XZWA 2DHAA 2LDYA 3I4PA 5CZXA 4QOTA 2HS4A 4CO3A 2DJWA 2A6OA 3H25A 3IC1A 3IXQA 4H4KC 4OV1A 3HVAA 2LXFA 4ZCKA 1R89A 5T41A 3J80Y 1VOMA 4B9TA 5FIIA 3DDNA 1JLBB 3CJ4A 3M30B 2JZ5A 2CPYA 4K5RA 3MM5B 5IM0A 1IKVB 2OGUA 5AT1B 1SI9A 1U48A 3EGWB 4RLEA 4FYDA 4ED5A 3B8HA 4GVBB 3V6KA 3DLGB 2YNHA 2MQ8A 2QYCA 2HRUA 1YJRA 2V8PA 3OTEA 5ETOA 5HMWA 4CO4A 4DR2J 4CTAB 4K0KJ 3M8YA 1KBRA 1RHKB 1CJVB 3NL0A 4OYPA 3FSYA 3RBZA 3RB6A 3R1LA 1NJYA 5H9EK 1SH0A 2MZTA 4QIFA 3BSCA 2K2PA 1Y5IB 4YR0A 2XO7A 2HIYA 1JX4A 4JI2J 4OX8A 2H5JB 3CD7A 2B7CB 5LMUJ 4CCHA 3SEOA 4FF1A 4DLEA 3BV8A 2FGOA 2YH0A 4YB5A 4JI0F 4TLRA 1TKTA 1W2BR 1DTTA 2DRBA 3DRSB 1NXIA 3EE3A 4B9LA 3EPGA 2OKQA 1RT3B 3I31A 3QFWA 4LFAJ 4CDIA 4ZK7M 2ZBCA 1L3VA 1UMJA 2BQ3A 2JDJA 4P2MA 5J2MB 1U0SA 2LQBA 3GONA 4ZPCA 4KQZA 1C1BB 3NCPA 3BKFA 2VA2A 3IGNA 2GHWA 1FT8A 2PA3A 3G8TA 3N01A 3H42A 3OFFA 3OFGA 2I1RA 2CNNB 2NLWA 3P5TL 2VG5B 2DHSA 2V4JB 3CF5Q 2GJ2A 1HNZJ 2CQBA 4NLXA 2CJBA 1DARA 1IM6A 2RD5C 5E3QA 4G1QB 1B0PA 5K20B 1TKXB 2VJVA 4W92B 2M8DB 3R97A 1FI4A 1I94J 3EM1A 4OJ3A 2E5IA 2LA4A 2HG4A 4MIBA 1U2RA 3DXBA 2Y1LB 2ZVSA 4OYIA 3EVMA 3JSMB 2IDEA 3SZ2A 5FD1A 1D1UA 3K5NA 3E3XA 2D41A 1FKPB 5DG8A 2DNPA 2IM0A 1OQ6A 2QFJA 4AT1B 4ZVEA 2Y8YA 1V3ZA 2D3UA 3CJKB 3QGGA 2HHHF 2VUGA 3G8QA 3MZIA 3MPVA 2AYBA 2AT1B 2FVQA 4X66J 2KXNB 2LXUA 1T03A 3CD5A 4B3RF 4P7VA 2K7JA 2Z57B 2DGTA 4C3LA 3PHEA 1SV5B 4GVLA 1WELA 4WFZA 2P9EA 4MT1A 2JSXA 2A2CA 2C2RA 2JH3A 3MM6A 4L76A 2C3PA 1O5JA 1ZM3A 4HTJA 1XNRF 3M6UA 3W63A 4ED3A 3DOLA 4LQ9A 3H5YA 2Z2MA 3H5XA 3CEDA 5GMEA 2VBYA 5DGBA 4RW7B 4PR6A 2GMHA 3GFYA 2HHUA 3O1LA 1KHVA 3MUTP 2VQEF 4HH1A 4OJGA 4M5DA 3DLKA 1P1LA 5IWAF 2RQCA 2JFKA 1LWFB 2VFVA 4M5KA 4LSLB 3N5BA 2D7SA 2VJUA 1R0AB 2HHQA 1ZH5A 3ET6B 5EDWA 3C15A 1Z4UA 2NXUA 1CQNA 4X4OA 1QAYA 4F50A 4B9SA 2WVEA 4Y6IA 1X4AA 4FYYB 2FJBB 4U67Q 3D5MA 2J0QD 1W25A 4ZA1A 1OJ4A 3PJXA 3GIJA 3D67A 4I6YA 4CNYA 3HK2A 4RX6A 5K9FA 1QUVA 2V94A 2Z4PA 1QJHA 1ACMB 1K73T 2L3MA 3TVKA 3IM8A 4J9MA 1U09A 4TY9A 3V6HA 2V2QA 4HL9A 2EFOA 1EX8A 2ZWOA 3QAEA 4DSEA 2HWTA 4FPIA 2W4PA 1IUJA 4CLYA 4NLDA 2OPQB 3QYYA 2IA6A 3NWRA 1OY8A 4M5NA 5M2RA 3FBBA 3FRYA 2DHHA 1TK0A 1HBUB 3SCJE 1VCTA 4GKJJ 1QSLA 2X3DA 2W8KA 1PJ6A 2RAQA 3KXDA 3BYPA 1K8AT 2RIJA 4OYBA 1HW8A 3ZNUA 2E66A 2YTCA 5BYQA 4ZPTR 2EFQA 1GX5A 5A8KA 4IFYA 1V5IB 2VBWA 1Y0HA 3CO0P 4UQTA 2LA6A 3EGZA 1LQ9A 1WDDA 2U2FA 4U95A 2G0IA 2A6MA 3M05A 2L9DA 3HP6A 4RW6B 2AJ2A 3OV7A 2ZH5A 3PFEA 2UVRA 2WHOA 4B9MA 1VRTB 2G1DA 3K57A 2GJFA 1Z2ZA 4PPZA 4K59A 5HMZA 3HT3A 1MU2B 2R2UA 5I3QA 1RT2A 4WFXA 5KFHA 2UUTA 1RU2A 2IM3A 3AQPA 5HATA 1K9MT 4DLGA 2DGUA 4EBDA 5F8HA 2X51A 3AB4B 3HLUA 1U1LA 1AA1B 3D0HE 2BRKA 3CCRS 1F60B 4OHWA 3DRYA 3SXLA 2DY1A 5BR8F 4M95A 3GIKA 2ZH9A 4USMA 3IG1A 4N41A 2QMXA 1GTEA 2AMCB 3NS5A 4HT7A 3I5CA 4NMLA 1UWBB 1MW7A 2MQOA 2WOMB 4ZMMA 3PNIA 1LXNA 4NCBA 2DCLA 3A8KA 2KFZA 4JBCA 1QAXA 5HANA 2CQ0A 4DL0C 2VB6A 2QRRA 2NPFA 2JLEA 4A8QA 2AGQA 4OHZA 2J76E 1Q4RA 2YKMB 5H9EJ 3DDKA 3UVJB 1RT1B 4USTA 1YBAA 3EMTA 3ISNC 5LSLA 4X4QA 4CH7A 3Q8UA 3PYDA 4N77A 1F9HA 1S6QB 2AW0A 4K7QA 4P2FA 2DNYA 5FDLA 5KFSA 1F2HA 1RUSA 3JSBA 2GVDB 4DQPA 4KYZA 2ZH3A 2F9DA 1KTQA 4ELTA 2J0WA 1I3OB 1HR0J 4ANCA 4M5GA 3CVKA 2ZC4A 4WZMA 2G2ZA 1FF2A 1S1TA 1NCLA 4L3KA 5KFAA 5A8WA 3VGTA 5LMNJ 3S01A 2RHQB 4Y2AA 1YITS 4X4UA 2BE9B 1CLFA 2HGMA 2WZ1A 1GQEA 3IS9A 2IRUA 2MZ1A 1Q82T 2LKZA 1K0VA 3MFIA 2GV1A 1C4AA 2HVEA 2ZJRQ 2XB2D 1HQUB 3MMAB 2HVDA 3HFZB 3MPUB 1VK3A 2XGQA 3H20A 3KJNB 2WONA 1HI0P 2UXCJ 1C0UA 2F4VF 4Y65A 4YY3F 3Q86A 5EWFA 5GMDA 2DNHA 2CVIA 2QZ8A 1B70B 9ATCB 4DCOB 3M6WA 2MJUA 4M94A 2YNIB 4U9RA 4ELVA 1LNQA 1U47A 3Q8VA 3WBZA 4OMFG 2AJ4A 2NXCA 1E6VA 2HVHA 2CPFA 1X0PA 4KFBA 2C1EB 4N7TA 5KFYA 1U6ZA 1LFPA 4J9LA 2A18A 3OTCA 3MECA 1N48A 2W01A 3MCSA 1WC0A 3R3TA 4B02A 1M5HA 2CNLB 1UVNA 2J7WA 3K5OA 2J9DE 3DLBA 5A2QY 4ED8A 4JOUA 1LW2B 2FZGB 3D1HA 3FEXB 1APSA 2NPIA 5D4OA 5D3GB 3TZYA 4ZLLA 2G4BA 3S6EA 3OR1A 1IKYB 1ZAXA 2MQLA 2AWZA 1W7WA 3JXOA 4Y0FA 5HSPA 1N4LA 5K14B 1WACA 1FKOA 5HLFA 1U6BA 1K1QA 5G0RA 2R2SA 1R8PA 1FO1A 4YB7A 3V6JA 5KFIA 4XAKA 3IGVA 2QLXA 1P6TA 2KM8C 2OH2A 4LJMA 1H98A 4DPXA 2VASA 3LGHA 3MEEA 1CS4B 3QBCA 3DOKA 3BDEA 1X0FA 2AX1A 2PDAA 2CPIA 3ICLA 3UWTA 3ZTQA 3U27A 1S1VB 4X62J 4CLZA 4DR4J 2DO0A 3W9JA 3DRXA 3DNCA 5BYRA 1WI6A 4JI7F 3TZZA 1U2CA 2YWGA 1IWGA 2AGOA 3HM9A 3M32B 1HWJA 2E7WA 3MR5A 4LIRA 1NZ8A 4NCGB 1EKSA 2XMAA 3KLHA 2DGQA 2Y8WA 4ELUA 4DDFA 2C2OB 3M7VA 3ILJA 2RKIA 3D66A 2OPRB 4F4KA 1U1OA 3NGTA 1QSSA 4F4AA 3X1LB 2ZDOA 4WZQA 1FHTA 4M5JA 3C16A 4X2BA 5A0YA 2RJZA 1XR7A 3J7YI 2P6TA 4Z37A 4IG0A 3I0SB 3TEHB 2Q1LA 2HNYA 2JWNA 2YQ1A 1PO6A 1BLUA 4LMZA 2V67A 4JI1J 1M1GA 1CEZA 3PM9A 2A3JA 4QYZJ 1FFGB 4QWCA 3TQ1A 2K3IA 5HBMA 4LR9A 1JJ2R 3KK1A 4DZDA 3KK2B 1OPZA 4U8YA 5DO2A 1YJUA 2VDHA 1DURA 4QPTA 3MOJB 1J5EJ 4UY85 4OX7A 4B9UA 4HHUA 4B3OA 2KT2A 2FLLA 1K1SA 1T3NA 2L9WA 2WBMA 4ANDA 1S9EA 2P5VA 4YHHF 4P9SA 3CD0A 4U8VA 4KTQA 3OFHA 3UFCX 1TKZB 2UUCJ 1IN0A 4HHHA 3BN4A 4QYRA 4HDHA 4IYQA 1ITPA 3AJ2A 2VIHA 3QSYB 1XJWB 1WF2A 1S9FA 4JYAF 4USUA 3IR5B 2KT5A 1Q8LA 1UZHA 1SUQB 2VPXB 2B6AA 3FDSA 3WDOA 4ZN1A 4WCEQ 2V9WA 3JB9k 3V4IA 3SSSA 3VZIA 1IKXA 1VQPS 4Q0BA 4JB8B 4R8UB 1KONA 1JLGB 3CCWA 3MCMA 3KJQB 2UU9J 2QYGA 4M1KA 4OI3A 1S6PA 1F3VA 2AJ1A 3DGPA 3OT9A 1EARA 1N5VA 3ETOA 2VD3A 3CDEA 2MKIA 2BQUA 2HWHA 1TQLA 2XMWA 3KDNA 2HFSA 2PI5A 4HACA 1TL1A 2H3EB 4LF7J 4ZPDA 5DS7A 2K3KA 3I4HX 2W2OP 5GAEU 8AT1B 3CCSS 2AJFE 3DU6A 1HWLA 2G2OA 4ZVFA 3VHQA 1TVRB 4IG3B 4N8NA 1UEUA 1KQSR 4IQXA 3DMJA 3IFEA 1SQFA 4ALZA 4RNNA 1CJTA 3ZO7A 1VHIA 1N34J 3G87A 1RTDA 4QU7A 3JS9A 3THVA 2MLZA 3VTIA 2AQ4A 2IY5B 2O01C 5ETLA 2PI4A 4FN5A 5IOLA 3DOMB 5C42B 3ZC4A 2J8AA 1Q53A 2HSEB 3QIPA 4C11B 1UVMA 3W2VA 4DR6F 3M8QB 3FJ2A 3Q0AA 5J2NB 2EXUA 3D1QA 4EU0A 3G86A 2IM2A 2VC0A 3QQCD 1Q8KA 2HFVA 4LQ3A 3UW1A 3GIRA 2KXHA 3M2UA 3NCQA 3T1AA 2E1MC 1EQMA 2FVRA 2CNOB 5HMYA 3SYZA 1RWXB 2VA3A 3OR2B 2MY8A 4K4ZA 4JI5F 1KQKA 2PMWA 2J9EA 1WHWA 5HJYA 2I5JB 5KFXA 3AD9C 1LWCA 3CC7S 3W1YC 5K5MA 3OL7A 2KJWA 4I7FB 3KG1A 3VGVA 5C2GA 1UZDA 2KT3A 3GCXP 3M8ZA 2CPEA 5IQQA 4LIWA 5GAHU 2OSQA 3FQKA 3AJ1A 2VG6B 5ETNA 2FJAB 2EG1A 2KKHA 1GMVA 2CG8A 2Q6BA 2ROPA 4FYVB 1Y00A 3Q8RB 1VQ6S 5BXIA 3SCLE 4DV1J 3N28A 4LF9J 4DV7F 5F3ZA 1S6OA 2AGPA 3AD8C 5I3PA 3D0IE 4DSKA 3VQTA 3AT1B 4J5OA 3M8WA 4QWBA 2G0CA 3THPA 1WSVA 4CYUA 2YKQA 4EK2A 3FBEA 2DNGA 4MKAA 1RP5A 3OL8A 3DRPA 3IR6B 3LP1A 4LBIA 4PQUB 1AFJA 3SI8A 2D1CA 3L09A 3OUYA 4LF5J 1IQZA 4OLPA 3KUHA 4O4GB 2VODA 4TVAB 3ZTOA 4PG6A 4PWDA 1VR6A 2ZDPA 4OHXA 5KOXA 5HQMA 5K8MA 4DPYA 3LAMA 2OP5A 3M9MB 4TY8B 2BJ3A 2VBXA 3HJVA 2I8EA 1UEVA 4P52A 2MPUA 2LU1A 1C4CA 5KFKA 2NQPA 1T3OA 4O3OA 1S1UA 4KGMA 1TTHB 3T5LA 5CYJA 3JTPA 2E9ZA 3PY8A 2DB1A 3DI6B 1WI8A 2W2MP 2HQ3A 1R8CA 5DGAA 2GQCA 3MUVP 4C0OC 4IH6A 2H65B 1C1CB 2FB0A 2KG0A 3JYTB 3A1YG 2F8EX 3E8OA 1W2IA 3Q23A 4RW9A 4RU2A 4HTIA 4FKYA 4UT4A 2IC3B 4NLSA 4O44A 2QJ3A 4ZPAA 2GGPA 3MD3A 1GMWD 1VQOS 3F41A 4K50A 4C8LA 4ZLNA 1FERA 2JFDA 4PG7A 3VF0B 1R8HA 1QY7A 1WC6A 3BF4A 3CIZA 1RHJB 5CYMA 4R5PA 4DV6J 4C3KA 4DR3J 2R8HA 1QD1A 1EP4B 3BN7A 2CQGA 4YOEA 1IBKJ 4FVMA 4C2MA 2IBOA 1E6YB 4DG1B 4ZHRA 3TYTA 3ZZPA 4Q5VA 4CLKA 3VVTA 1JLFA 2X7IA 2ZOMA 5IZHA 3Q8SB 3TAMA 5IV3A 1UWAA 4F02A 4CIOA 2DXEA 3QJJA 4OZ0A 4P6QA 4WPAA 5D6GA 3AY0A 5HVFA 3W65A 1S99A 4ED0A 3O6QA 4URQU 4DV4F 2Z2LA 1JKHA 5B7WA 1T9YA 1GMWA 2C2KB 2BRLA 3PHTA 4RU9A 2CPDA 1RTZA 3C2PA 2XLKA 3T5HA 3I87A 2V68A 4ED1A 5LXYA 1J5OA 1T11A 4A8SA 2ZKTA 1PG5B 3KLFB 4ECZA 2NZCA 4EYHB 2XY7A 1S48A 2Q43A 3RAMA 1LEOA 4ZVUB 3PEHA 4RUBA 1YIJS 3CT9A 5LT5A 3I0RB 4XDCA 3IRXB 4QPXA 5LSRA 3GV5B 5F0UA 3GIIA 3ZZ0A 1FRMA 4KH0B 2VF3A 2CZ4A 3O44A 1F9FA 1XR5A 1HLWA 1GXLA 3HULA 4Y2MA 4RBUA 4R25A 2HS0A 4UZCA 4O3NA 5IT9U 4QW9A 2KYXA 2KM8B 4DN0A 1VJWA 2DGOA 4K4TA 4C8ZA 2V8VA 3D6HB 3MI7X 2VOPA 3N6LA 1VQSA 1NK7A 3MEGB 3BBCA 3VZHA 5GAGI 1RAAB 5KT4A 4WKRA 5AXMA 1JXEA 4QIWD 2E9RX 2AD9A 3MMCA 4WU3A 2EEYA 4GMKA 2QT7A 5F8JA 2V69A 4MJKA 2M9KA 4HKQA 4EUVA 3QAUA 2LQ8A 1KC8T 4DQSA 3GJRB 3MM9B 3LP2A 2H4WB 3J81j 4Y34A 4BC7A 1REVA 2DH7A 1M1KT 2CFXA 3T5KA 3HVWA 1LWXA 4DX6A 2I9SA 3CXCR 2EBEA 2W8LA 4MIWA 5SZTA 2UV8G 1Q1KA 1NBEB 5HROB 3OPKA 3M4XA 4ZJQA 4M5HA 2MKYA 1IWAA 3BJYA 3E51A 1MN9A 2RRNA 3EGVA 4QWDA 1KKHA 5KAKA 2HHVA 4DPTA 4DR5J 3CUNA 1WJ9A 2VQEJ 3MOZA 2DEIA 4MH8A 4B3SF 1R6YA 1X4BA 3MMJA 5IWAJ 3DN9A 5EWGA 1PJ7A 3NKYA 4LUBA 3B4MA 3OSPA 5I3UB 3TJ8A 4CH1A 2B9WA 1VGYA 3FK4A 4C8NA 5H1SV 2UUAF 2M5YA 2KFNA 1V3SA 4NLQA 1UA1A 3ONQA 2ZUAA 4FXVA 2WVCA 5CAAA 3ULHA 1YZ6A 1JLCA 5LL6d 3HDSA 4BLGA 2MKKA 1LFWA 5L8RC 3PRVA 3ZTRA 3EX7B 1XNQF 4LSNB 2W9AA 4ZIVA 4NRTA 3BQ2A 1Y9OA 3H2LA 1UVLA 3NY0A 2BM0A 3CO9A 5HO4A 2XSJB 4C4WA 3I32A 4IRKA 2R4FA 4OI0A 2PMZD 3T3FA 3D9BA 3POTB 1NLKL 1G7CB 2POKA 3FFIB 2X1GA 1Y5NB 4LRDA 5EN1A 3ITHA 2LQ9A 3BZQA 1HIYA 2BQRA 3PX4A 2OEMA 2G2YA 5J2PA 5D15A 3OSNA 1RWPB 4M5MA 2OELA 4ECSA 2GC8A 1QE1B 5L38A 2GX8A 2HNZB 3DLHA 5FLXY 1HQEA 1PYSB 3PIOQ 3GB0A 3HPOA 3BBBA 3RAQA 4F8RA 3PR5B 4DFJA 3J80U 4FF3A 2WVFA 1X5TA 4KBIA 2BX6A 3OL9A 1D3WA 1CJKB 5KFBA 3MM5A 3Q89A 1TL3A 2AZ3A 5D4PA 4NZ6A 1FRKA 1YJTA 2MKCA 4JUZA 3C66A 2CJYB 1Y4ZB 1ULRA 3M8RA 2XMVA 5E41A 2CPJA 2ZBRA 2ZKUA 1SJ1A 4P2XA 2PT0A 4A47A 4F3OA 2DCUB 2FJDB 3KKFA 2MB0B 2RRBA 3UCUP 1SBRA 5KFMA 1VI7A 2QMWA 1XIQA 1N6QA 1X4EA 3KJVA 4NI2B 2I6WA 5DDPC 2Q6CA 3QO9A 1RTHA 4WWSA 4NZ7A 1SJQA 1NMEB 1UP1A 4ZVGA 5KFVA 3KMQA 1G2EA 1SC4B 1JLEA 2IVYA 2JJ4D 1F9EB 3N4WA 1RAOA 3TX0A 3MHYA 1EHWA 4F4ZA 1Y10A 5KOWA 5IM0B 5CCLA 3QWUA 4EFAC 1DHMA 5DG7A 4KT0C 2XMJA 2FVSA 3NNAA 1OWXA 1YRTA 2YNHB 1WG1A 2Y3YA 1RAIB 2R8KA 1YQHA 2KRBA 1UW4A 2YWWA 1LV5A 2GIQA 2XMKA 1HNXJ 3DLLQ 1RADB 3FEZA 1Q86T 1L3SA 5ETSA 1U8WA 4FS2A 4WXWA 5LM7E 3NNHA 3QGHA 1BQNA 4FPRA 4LF8F 2PFFB 4NMXA 2V6AA 2B9XA 1RB0A 3BPSP 1B99A 1GH8A 2B7BB 2JHEA 3CCUS 5KFDA 3T1HJ 3AOAA 1FFWB 1TKTB 2WSFC 4OZ5A 3BO4A 1DTTB 1DTQA 3KLIA 1NJXA 2VHGA 1YBUA 1WNEA 1T0TV 3T9NA 4NXMF 4KR0B 1VK8A 1HBNA 3JSMA 3K2YA 2ZHBA 4YB6A 5THWA 4P2SA 1RWMB 2BDPA 4NA3A 2DNQA 4OX9J 1FDBA 1BWVA 1HYSA 2IM1A 4GKKJ 1HPZA 4CLFA 2YNGA 5B09A 4Y00A 1SXLA 3CCVS 2PD1A 1N5QA 3T1YF 3AA8A 5JXSA 4RPFA 2D69A 2PMHA 1JK9B 2NUHA 5KT5A 2F4VJ 2JVOA 4EEYA 1RT7A 2PIIA 3H0PA 2C3UA 4YY3J 4A8MP 2D3OR 2XNRA 1NM2A 2RB7A 4CO0A 1HHSA 4YQWA 1T9WA 3MM8A 2GCFA 2HQFA 2HYIB 2W1BA 5KFLA 5DQIA 2B3TB 4OV6A 1HQ2A 3EPIA 4LR8A 4OZ3A 1X7VA 4X4VA 5HP1B 2ZM6F 4OZJA 2ASJA 3T41A 4USIA 4N56A 2XS5A 2BABA 2DNOA 2E44A 2DR5A 3H4BA 5JJBA 1RLDA 1X9WA 1S77D 4CLSA 1CC8A 1C0TA 1T03B 4A8KA 1R0AA 2D9OA 2LEBA 5KG2A 2R7SA 4F26A 2CXEA 1NAQA 1RHMB 4FDFA 3HF5A 2MZRA 4JV5F 1PGZA 4DFKA 3VCDA 4ECXA 4ETXA 3MM6B 5J1NA 4KRWA 5ETRA 1UW9A 4DSJA 3N0VA 3DOLB 1HWKA 3IP0A 2BANA 2F9JA 3QIDA 3QWPA 2B9YA 4NEYA 5A8RA 3B82A 1WD6A 3LANA 1JLAA 1HNIA 1TP7A 2Z8QA 3FRZA 1DAXA 2RDJA 4DSIA 4M5DB 1XC9A 3IO1A 2DHXA 2ZITA 3FGVA 3DLKB 2OO4A 4L72B 1RT6A 2H1YA 1FEHA 4DEZA 4RKUC 3NG8A 3FMBA 3C15B 4A4JA 4J9PA 2PO4A 3BBFA 4DS5A 4KIAA 3MTKA 2CKWA 5CCMA 5KFUA 3H4DA 1HL6A 1UEKA 4DUYF 2Y1RI 3T5JA 3A8IA 2W7OA 2ADBA 1SH3A 2CNKB 2F63A 2H54B 2FHJD 2R7RA 1S9GA 3M2RA 1OYDA 4JI3F 1FEEA 4OL8A 2H9ZA 4X65F 2R7WA 3DU5A 4LT6A 3RW7A 4DXLA 2CQIA 2FLOA 3N6MA 4O3PA 3WX4A 2W9BA 2M3DA 2E5LJ 1RTIA 2YVSA 3TEGA 5B0BA 2HLTA 1S12A 2XHWA 2XM3A 2BJ9A 4ZPBA 5CYQA 1ZTWA 1FK9A 2FD2A 4F0MA 4DOZA 4C3MA 3PX6A 3TA2A 2GAHC 4ZVRB 3AQOA 1IJFB 4F25A 1EKRA 3GCWP 3SQOP 4CT8A 3PTWA 3BGRA 1ZA1B 2ZOGA 2OMLA 4DV0J 3H7HB 1DY3A 4M8LA 4NOHA 3OD2A 3ZTPA 3AOBA 4NYPA 3VQSA 5E3AA 1U4BA 2BA9A 4YMEA 1SQEA 1KP6A 3F73A 4J9QA 5A8KB 1YDLA 4IFYB 2IDLA 2FHJA 3PRBA 4NLVA 3GSDA 3EDRB 4P10A 3CMES 1WF0A 4F2SA 4LF4J 5KFZA 1QM9A 2N4DA 2FJXA 2HFZA 4FZVA 4QWEA 1H7XA 2BE7D 1RBAA 1FWKA 3FUYA 2W9CA 2A2DA 4DR2F 2VZ9A 2ABYA 4K0KF 2ZOFA 5HAOA 2CZVC 1RT2B 3OHBA 4WTYA 5H9FJ 3U02A 5EGYA 2CJKA 5KT6A 3KG0A 1D09B 3LO3A 4HDGA 2UUBJ 4JI2F 1BWEA 1IM4A 3R6LB 5LMUF 5KFWA 5ETMA 3IG1B 3DKDA 5IS2A 3R1HA 2BBEA 5KT3A 3NRBA 4WK1A 4L73A 1R27B 2ZEJA 2JEFA 2ROEA 2C22A 3J7AN 5CQGA 3KYLA 1FXDA 1FFSB 2WW8A 4LFAF 4F67A 5GADU 2Z30B 2WVBA 1SCJB 3BSNA 4FXWA 4I68A 3HHEA 3TUJC 4CM0A 4CLUA 4NYOA 3TW0A 3MDFA 1RT4A 3IMQJ 1N56A 3W60A 1KOHA 2CADA 2XLJA 2IVMA 1M5VC 2VFRA 4RWWA 1RAEB 1HQUA 5KFGA 2DGWA 2YWKA 4A8OA 3A3OB 4I2PA 5FDLB 2EI5A 1HNZF 2SXLA 3CC2S 3DHWC 1Y7PA 3VAHA 1H0HB 4TLQA 1L3UA 3I5BA 1I94F 1FRLA 1N52B 2CQHA 1SJFA 1TL7A 2EFGA 2HBQB 3TAQA 4DPWA 1S1TB 5KG6A 4DV3F 3TA1A 4ZCIA 1RWWB 1S7IA 4UW2A 5A8WB 3TQEA 4DR6J 2F40A 2J7KA 2HFNA 2Z56B 1H7WA 4G1IA 3GYNA 3LPEA 2L9NA 5MLCV 4L3NA 2GA7A 2Q66A 2IMWP 4OI6A 3B4DA 5HVGA 3H59A 5J2QA 5F41A 3IS9B 3MTJA 2OTJS 3J81Y 3UDCA 5KG4A 2FLPA 3GYXB 3NMRA 3FKBA 4C0BA 4JI5J 1LWEA 1TV6A 3QZ8A 2DISA 3CIMA 4X66F 2GJIA 3HX9A 4P7TA 4DR7J 2WK4A 4Q2LA 4PWWA 4P71A 4WJBA 3V4MA 2J6TA 4LF1A 3HKZD 2WONB 1RWKB 4U7UD 1C0UB 1N33J 4KAIA 5A2QU 2ZHAA 4AL5A 2ASLA 2XGPA 2XHCA 4I4BA 1A6LA 1KNZA 3NGUA 4C8OA 4TU8A 1JIHA 3MURP 2CRLA 3R27A 4TXSA 1M0SA 2GNKA 2FJEB 4KPCA 1FESA 5K14A 2MZJA 2ADCA 5U47A 3T19A 3M8PA 1S4FA 1E6VB 1F5CA 1UL3A 3GSIA 3JTNA 4FF4A 2KI2A 4KFBB 3R7NB 2EFPA 2KO1A 3DGVA 2J9CA 3QLHB 2AKWB 2OEJA 2G0JA 1CSJA 1T9VA 4HYKA 1BQXA 3QMQA 2IBKA 2E7VA 2QGFB 1U6FA 1GAOA 3N5FA 2AF6A 1RCXB 4NCGA 1AT1B 2MJNA 3TZWA 4P73A 2LQ5A 2Z2ZA 1HMVA 1SJ3P 2NXNA 3TAPA 3PW2A 3ZXWA 1FKOB 5HLFB 4MK8A 5G0RB 5DLGA 2ACYA 1VRQC 2MZSA 3HZEA 2Y1IA 2CPZA 2DRAA 2XO6A 2OJ3A 2ZBPA 3CJ2A 3EDQB 3UE2A 5M2UA 3CCES 4Q8EA 3MEEB 2BR0A 3AXMA 3DOKB 4ETZA 3C46A 1Y11A 1FCAA 1OMSA 5DZ6A 3RB4A 2B4PA 3I5AA 2GQ2A 3I0SA 5T7LA 3VVUA 5A76A 3FMWA 5KG3A 1S0OA 2GS8A 3BS9A 4DPOA 1WC3A 4DUTA 3P8BB 4GKJF 3ENQA 2L41A 1YJWS 4UOCA 3D4JA 2OI2A 1NDKA 3QATA 3A13A 3CJQA 1NDLA 3I56S 3KLHB 3D6MB 3PR4A 4C8MA 4PKDB 3PFOA 2DNLA 1TU0B 2RKIB 2O3DA 4LRCA 3H5UA 1HNWF 1KLMA 4GC7A 1HHTP 4JI8F 5A6WA 2XULA 1G3OA 2HMIA 4CI0B 3S1TA 4DL2A 1BUXA 3KLEA 1CG2A 3C16B 5A0YB 3CC4S 3TJ9A 4M5IA 3K58A 1U1NA 4WP8A 1BXNA 4OJHA 3OJSA 4IG0B 3CJ5A 3GTYX 2AEFA 2DPIA 1GFWB 2HNYB 3BM7A 3RZAA 2B4UA 1IBMJ 3E01A 2VKZG 4C97A 1SIWB 2LCWA 3LALA 2XYHB 2YXLA 3GG0A 5HBMB 2OPPA 2LFVA 3KK1B 1RLCL 1YI2S 4ZKAA 5KT7A 1RZMA 2LDIA 5KFFA 2CJ9A 1XWLA 2DEJA 4DL6A 3TR5A 3OTDA 3KLVA 1A7GE 4RW4A 1T8EA 4KPYA 1CBKA 4B3OB 4IO9Q 5EWEA 1S9EB 4K4XA 3DXSX 4FNHA 3A8JA 5ADZA 3SCIE 3KMSA 2WW4A 2FHKA 1HNVB 2E1PA 3W9HA 1FXRA 5AJ3F 4X4RA 2DGXA 2W4DA 2FIUA 1Q5VA 1WF1A 3QRPA 1UAWA 1FRIA 2YKNA 2RT3A 4MYUA 2AX0A 2AYGA 2I38A 4DFPA 2B6AB 5HMXA 1KFSA 2LVWA 2MEWA 3S7RA 1IKXB 4PWUA 4Q0BB 3G2XA 2YQ0A 3PW4A 4RUAA 1U1KA 1WC5A 1MROA 3OXFA 3TUPA 3PO4A 1S6PB 4TYBA 3LH2S 1HR0F 4OI1A 2EG2A 3ISZA 1DQAA 1X9SA 3IWNC 4IQMA 5HQLA 3EVOA 2RU9A 4HACB 1TL1B 1FTCA 2MLYA 2OEKA 5EUHA 3QNWB 3KG4A 3RG6A 1U1PA 5CA5A 5LMNF 2UVVA 5L1JA 2FHOB 3KUEA 1SKWA 4RNMA 1D9FA 1OS5A 1S4EA 4ID5A 4WU2A 4J9KA 1RJJA 2GIFA 2DYAA 2C2NA 3PYEA 1DBDA 3R5GA 2CYYA 3UR3C 2MYFA 3DMJB 4F4WA 2DGSA 5D8HB 2A1BA 1UVJA 1RWVB 1CJTB 1K44A 1RTDB 4NCAA 1RCOB 2V8DA 1K0TA 1ZZFA 2OD4A 2ZH4A 3SQGA 3P3DA 2G1HA 4BWMA 3PJ9A 1HI1A 3BPDA 5K8NA 3LWMA 3SV4A 3OFEA 1IR2A 1RT5A 3QIPB 3NWGA 3RBEA 2DPJA 3UCZP 3W2VB 4Z7CA 1TAUA 3NGKA 4DSLA 1L3TA 5DG9A 2X1AA 2UVWA 1CULA 3M2UB 3ZZYA 2J0XA 2BJ1A 1HBMA 1YZ7A 1VFJA 4UTGA 2F7VA 2RQMA 3R2DJ 3FZ2A 2ZZTA 4NLRA 5E3CA 4F3QA 4UZBA 3NBPA 1RABB 4K2XA 3C6UA 1RGVA 1YRUA 1VQ4S 1VQMS 1FD8A 2CJXB 1LWCB 2QEXS 5AE2A 1Q79A 3SSRA 1FRHA 4P72A 3CJSA 3UR0A 5ETKA 1WHXA 2MKJA 4WE1B 5B08A 3MR6A 5JUMA 2OMOA 3JSYA 1F3FA 1ICEB 2XZTB 3D0GE 1FVQA 2N4CA 1RTJA 4PG8A 1FJCA 2V8HA 1NK0A 5HI7A 4DV5F 3GZ7A 2N3OA 3F56A 2DR8A 4FBTA 1XNQJ 5KFOA 5K8OA 2IMOA 1NUEA 1EJ7L 4UUWA 4NLOA 2R7QA 2Z58B 5F8IA 1AXQA 4CYUB 1NPKA 2OPSA 1C1CA 4EI2A 5L9NA 4ECUA 2HNDA 3QT6A 2Y0SD 2XMTA 4OI4A 4DL7A 3AFGA 2HQGA 2FZCB 2QE5A 3DRPB 3LP1B 2JLGA 2VQFJ 1WC1A 1VQ5S 4TN2A 5GVQA 1T05A 1HD0A 2F65A 3IBCB 4USKA 4CNZA 3QT7A 3OUYB 2EC2A 2BKNA 5IXUA 2BVZA 2IYGA 3DRRA 2DH9A 1U1QA 4PWDB 3K89A 2RRAA 5AXNA 1CC7A 2AZ1A 3OL6A 1VBYA 4QZVB 2GHPA 2WTFA 1KSPA 1ZPVA 4USJC 4KH1B 4ED4A 3T6JA 1BD6A 3D28A 3BKUA 1S1UB 3GE9A 1FDAA 1OY9A 5E3PA 5KG1A 1X4GA 4AUKA 2QO3A 1FX2A 2JC1A 3CDWA 2UXBJ 4YR2A 4DSFA 2EFNA 1XMQJ 3DYAA 4KV8A 4CP5A 2V9KA 3TZXA 3ZZTA 1WG4A 2WRMA 4I1TA 3SDEA 1QDUB 4JI1F 3IAS9 4DWIA 1DJ0A 4RW9B 2UVUA 4PXBA 2KB2A 2R2TA 3L7OA 4F4XA 3GR0A 3FCHA 4O44B 2C3MA 3AA9A 3WHIA 2VDIA 2ZH8A 1S10A 3MMBA 1IVZA 3R5BA 3MEDA 4B17A 3JAMY 3WC0A 2DKOB 3EXYA 3KFWX 2FTRA 1AZSA 2QSWA 4F0KA 3UO0A 5E7OB 2JC0A 2BE2B 1J5EF 1CJUA 2C42A 1EETA 1RWNB 5DRKA 3FVYA 1T02A 4ZPVR 5CYMB 2DR7A 4NLGA 4R5PB 4MAKA 3H98A 2P9CA 2UUCF 1ZYQA 3V6DA 1NH7A 1X4CA 1H74A 1YK9A 4ZN3A 6FDRA 3RBXA 1V9OA 2OTLS 2Y0BB 3BGOP 4ZHRB 4ZP8A 4IDKA 1JLFB 4LF8J 5DDQC 1VLOA 2XYPB 3LP0A 3TAMB 3N6NA 2YKPA 4U7UK 8ATCB 3ZFVA 3ILLA 3KHRA 2APOA 2UU9F 5D77A 1FJ7A 2BZ2A 1JKHB 1DRZA 1D8ZA 3GFXA 5DM6Q 2XCPA 4WFBQ 3W3SA 1EAYC 4NA1A 5DJBA 1GMUA 1W26A 1EIYB 5F3TA 4C6AA 1GTHA 2EWHA 2XQCA 1FWLA 1XK8A 4H54A 2IFXA 3W5ZA 1J5OB 2NR0A 3VR1A 4LF7F 4PXCA 1F5BA 4X4TA 1CPZA 2B43A 2XNQA 1S97A 3DLEB 2CQ1A 2HBZB 5D4NA 1XMOJ 4N5SA 2FHMA 3TA0A 3LGMA 3Q8YA 1VHFA 4LRAA 1C2PA 2XMMA 1KLNA 1VQYA 2FY8A 1NSQA 2ZH6A 1Z2LA 4FKXA 3HD2A 1N34F 2QLJB 2GMJA 3V81A 3G96A 2VPYB 5L39A 2ZE2A 2VFUA 3JQKA 2JL9A 2MHNA 2RF2A 3G6VA 3EYZA 3PW7A 3MAHA 2NS1B 2QL5B 2J8SA 1NKEA 4WIIA 2CQ2A 2DHGA 3QRQA 2FC8A 4KGXB 2HEKA 4KHRA 2MXYA 3HSGA 1H38A 4AYBD 4WP3A 2QA2A 3PKYA 2UV8A 1ROFA 3MMCB 1X60A 2D74B 2KHDA 3MM7A 1KVKA 1LK5A 2C3YA 4J91A 2YNFA 2B5JA 1F6TA 4CT9A 2VKRA 4DUZJ 3EZOA 4EWTA 2RE1A 4JV5J 4I2QA 3LP2B 1RHQB 2DBBA 4W4MA 4IRCA 1REVB 1BY9A 4OZLA 2MQMA 4C48A 3ADAC 3OHAA 2QFIA 2ILYA 4NXNF 2J9DA 1FRJA 4BS2A 1S79A 4YN3B 3BSOA 1R8AA 4DV1F 3C6TA 4LF9F 2KZZA 1HARA 4YDDB 3KK3A 2ZD1B 1VQLS 4JV1A 4KO0A 5KFNA 1HWIA 1YVFA 3I9V9 3AD7C 1QVFR 2RH3A 2R8JA 4ZVOB 2VU5A 1H3DA 1NK6A 3KJFB 2NCKL 3PRDA 4EZ6A 1ZA2B 1WSRA 4QR1A 1LOUA 1SH2A 3GMGA 5E2QA 4LF5F 2HNZA 3PX0A 3UD5A 1UPMB 2KTQA 4TYAA 5FLXU 1JLCB 1N5YA 1TK5A 3HXMA 4X65J 1RBLA 1WHVA 4YDXA 3W2WA 4PUOA 2ZHOA 2C2ZB 1JLQA 1HBOA 1YG0A 4TQSA 3GIMA 1NDCA 4KY3A 4HEA9 1UFKA 1QLNA 1AFIA 3SFGA 2FVCA 1XEZA 1M5PC 2PC6A 3W8GA 4IKAA 2NZ4A 3W9IA 1ZZNA 4AQYJ 2CDRB 4YP3A 4IOCQ 1OSCA 3BR9A 2BUNA 4U96A 3ITHB 2MQPA 2D3O1 4O0IA 5J2PB 4ECTA 4PCQA 2GZOA 3NGRA 4WKYA 1BQMA 4NI2A 4I69A 4ENOA 2AU0A 2HKEA 3BH6B 3TARA 1UPPA 1J27A 4K2JA 2FUG9 1S1XA 1JNZB 1HQEB 3A12A 2VG7A 4WP9A 1SPBP 2P9GA 3GWCA 4RBTA 1U0HA 5J1EA 2EW9A 3MWBA 3R5AA 3PACA 1TL3B 4H4MA 3J7YU 4OIXA 5HL7Q 2E5JA 5IV4A 2XSFA 3GFHA 2CPHA 4DV6F 4LREA 2FVPA 2M8HA 2V34A 4DR3F 1UFLA 1SC6A 3RW6A 5CD4A 1RA6A 2BMBA 3F44A 3MAQA 4ZIWA 1NK8A 3L7UA 1WC4A 1IBKF 2DXDA 4X4SA 2GO8A 2OD6A 3M6XA 1OY6A 3MF5A 1BHNA 4HT5A 1N6QB 3KJVB 2XCAA 3IR7B 1EB0A 1H2VZ 4MFBA 3QO9B 1KOOA 1RTHB 3OXGA 4F3MA 3J7A1 7AT1B 3A3NB 1N5TA 3QZ7A 1Y3JA 2DR9A 1O8BA 6AT1B 1CVJA 2IJRA 5ITHA 4I64A 4QIGA 1JLEB 1X8DA 3PJWA 2MZQA 1DQ8A 4CO1A 1SKRA 3HVTA 3MPDA 1IKWA 1YBTA 4RW8A 1MWQA 2CJQA 5IT0A 3KOAA 2HBYB 4E2FB 1UFWA 5GMKa 3NOCA 4DX8H 4WYLA 4XDDA 2BKPA 1PJ5A 2QN6B 2W2NP 3R7BB 1RQ0A 4KGVB 2NSCA 1F5AA 2MQNA 4LFBJ 4CWBA 1ZAWA 1FJEB 4LSZB 2W4CA 1F0XA 2A10A 1WKJA 4DN9A 2OHDA 2C28A 4ZOSA 3HHKA 3AXKA 1PAUB 4LFCJ 4ZLPA 3D7SB 1M90T 2XY6A 1S1WB 1BQNB 1DLOA 2BM1A 3K5PA 1Q8BA 4BBYA 3P49B 4URSA 4DHVA 1GX6A 3M1VA 2JOQA 3NEKA 3B6BA 4IFVB 2HQIA 4ILRA 3IRWP 4KGKA 4IH5A 1RKJA 3HSJA 4HLBA 4LVNP 3MPYA 2HGNA 1LW0A 3LAKA 3DHXA 3ENAA 1H73A 3QRRA 1N5SA 1DTQB 2YY3A 3KLIB 4BCAA 2GVZA 4K8RA 4O3QA 1T7PA 2HRYA 3JTOA 4DV3J 4NPOA 1HBNB 2W24A 2ASYA 3KNAA 1O51A 1ZS6A 1UVIA 4QJVA 2IRXA 2V2KA 4OYAA 1MLAA 2KRRA 4QR0A 3L7PA 1VBXA 3DLJA 4FYXB 4ICLA 5HP1A 1HYSB 3TJAA 1HPZB 3CTRA 3H5SA 3R8YA 2YNGB 3HSZA 4Q2MA 5KFRA 5KFEA 1B4SA 4XK8C 4B3TF 5F9NA 4DPUA 1P1TA 5D0RA 1BGXT 2WSCC 5F8LA 3K8WA 2JEGA 1ZBTA 3UNYA 1PC4A 3TUZC 4IR9A 1RT7B 2N82B 4K4SA 1YX2A 4JI4J 2XY5A 4F0HA 3OBIA 3MM8B 2OLWA 1X5SA 2J7UA 3ZZOA 4MKBA 3AH6A 4A8FA 4H4OA 4E8UA 2XTJP 4AXJA 4USVA 5CXTA 1MSWD 1TUWA 1RWUA 2K1RA 4DR5F 2YX7A 3OLBA 1U1RA 3HHDA 3QJPA 2NYHA 3I96A 3G6YA 1NHKL 1VC0A 2V8GA 2B51A 1FE0A 4FF2A 1KD1T 1YRXA 1C0TB 1Z1ZA 5DZ7A 1HHQA 3GU0A 1SL2A 2YH1A 3BH7B 5IC6B 2R7XA 1NJIT 3TANA 4ECQA 3IWLA 4ATNA 4Z7YA 3MAAA 1XBWA 1RKIA 1JJCB 2BANB 3CCQS 3RB0A 3MPWA 1S76D 5A8RB 4Y28C 3RGIA 4RNFA 1JLAB 1HNIB 1WORA 3AJDA 4PAAA 2XLIA 1P9YA 2IAJB 4Q45A 3NP5A 3HHLD 4BWJA 4LF6F 4CRJA 1S59A 3DCAA 2MSTA 3FNNA 1HW9A 1MMDA 2VFTA 1RT6B 1URRA 3LTOA 2OSRA 1VRUA 3OLAA 1IR0A 2DO4A 3GFZA 4OLOA 3JQMA 3M2VA 4YEAA 5IT4A 2UXDF 2NXEA 2E5HA 1WEZA 2XS2A 1L5UA 1RAHB 2JEJA 1N54B 1NPRA 1YHQS 3DM2A 1UKUA 2KG1A 4JI0J 3US5A 1RISA 2VONA 1S9GB 3M2RB 4RUCA 3KLGA 3W64A 1OYEA 3VGSA 2HBRB 5D4LA 4KKOA 3LPYA 2MKHA 2QL7B 4MTPA 4QYZK 2HHSA 2M70A 2W9BB 1U26A 3LF0A 2V2VA 2PA8D 3PXGa 1RTIB 2X1BA 2HW3A 5B0AA 2AJQA 1TL4A 1HNWJ 3RRGA 4JI8J 5C25A 3NGSA 5CYQB 1T95A 2CWKA 2H51B 4NLPA 1Q16B 1FK9B 1HD1A 4JI6F 3HHLA 4ED2A 4L6V3 2KFYA 2XG8A 4I0WA 1F2GA 2ACMA 4NWBA 1IBLF 2EVZA 2E1RA 2G9OA 3ETMA 1ELOA 1PBUA 1S0MA 2X1FA 5B0DA 2QIFA 2YQ3A 3BGRB 2V50A 9RUBA 1Q7LB 2HURA 4ZCMA 2RHSB 1UVKA 3P96A 2KN4A 3RRHA 3MCOA 1PBAA 1FJGF 1V3RA 4FBUA 2PE8A 1I1GA 3TVZA 4YUDA 1N36F 3OW2R 1FDNA 4EGLA 3C8YA 1B0VA 4RUHA 1U25A 1ZTTA 2QL9B 5AJ3J 2HVIA 3H40A 2MGZA 3L95X 3D54A 1B7YB 2HHHJ 2W9CB 5DQGA 3PKMA 2K8GA 4WFNQ 1NDPA 2E7XA 3C14A 1X4FA 5I42A 1HNXF 2B0GA 2XS7A 4N76A 2RDIA 3BREA 4B3RJ 1R7IA 3Q8PB 3U1LA 4LRBA 1XMBA 2DTJA 2HHWA 2CVEA 3H2VE 2I2YA 2HQDA 1TFYA 5DDRC 2MQQA 5J1PA 1AW0A 1PKUA 1FNMA 1XNRJ 3T1HF 3GPAA 3CCJS 2RQ4A 1MG7A 2ZH7A 4B3MF 4K4WA 1NJZA 4RR5A 1U24A 4G1PA 3SIPB 1XTZA 1U8SA 3CCTA 4J9RA 4E0DA 3NLCA 2FPHX 1DQ9A 5HVHA 2Y9HA 4O23A 1JJHA 1YJ9S 3HHNB 2ALYB 2RILA 3CULA 4OX9F 1N32F 4ECYA 2HFUA 1ZAVA 1H2TZ 4PRFA 4GKKF 2WBRA 4PXDA 1RT4B 2XBPA 1GK8A 4CO5A 3G82A 4OYOA 4G3IA 2W2QP 1BE4A 5EX0A 1TELA 4Y2IA 2MHEA 2RU3A 1NZAA 3J81U 4WF9Q 3HD1A 2F4FA 4I2PB 2GW8A 4KSEB 1KEKA 1MWZA 1ZPWX 1DFDA 4EO6A 5KFTA 5C24B 1KFDA 1QTNB 2IRYA 2HFOA 1TL7B 4OI2A 2KL8A 2RUSA 1PILA 2B8QA 4TU9A 4RJVA 1WKLA 5GAGU 1S6UA 1X31C 5B0CA 1NHUA 2WCXA 3D3CJ 1PSDA 4F04B 2BACA 1YJ7A 2NXJA 4IH7A 2NUUG 3NS6A 2OFGX 4QW8A 4Q44A 3SCKE 5J2QB 4ZVHA 2NSBA 1FNOA 3HFKA 1LWEB 1LKZA 1RYSA 1TAQA 1TV6B 2O1PA 2BW7A 3CWJA 3QLHA 2XWXA 3Q2TC 2HZCA 3OTOF 1SKSA 3I82A 3LGNA 1ZM2A 4NL5A 2YBVA 1VLYA 3RTVA 1ZM9A 2RS2A 1NKCA 4KJIA 1JLBA 3W66A 3M30A 4V19X 4KB7A 3RUBL 1IKVA 2ZUGA 4KGZB 2LXIA 3CB4A 3HMJG 4ZCLA 5G4DA 3UD4P 1X4HA 4DZ6A 4N8OA 4ZJLA 2R7UA 4DV5J 3R5JB 4GVBA 1UCNA 3NAIA 3DLGA 3GLJA 2CQCA 2P8IA 2M88A 2JVRA 4DU7A 4X64F 3M8PB 4G6VB 3HT0A 2V4QA 2VC1A 4JP8A 1MNEA 1JXVA 1NK9A 1FD2A 4CTAA 2XI2A 2WB1D 4OJ1A 1CJVA 3VWSA 1R3NA 1VS3A 1TUGB 4PEOA 4J9OA 1WOPA 4OYXA 4J9NA 4RL1A 4ZPWR 3V5RA 3TX8A 5BR8J 3L3CA 4C0HA 2HRTA 3FCWA 2VPWB 4OYMA 3UDLA 4W98A 2Q79A 3IWXA 1R8BA 2WSEC 4OZNA 4NE9C 3NCRA 1I51B 1T94A 3UDEA 4ILLA 4I6AA 3DDIA 4R0JA 4F7VA 1HMVB 3DRSA 3UD3P 4ES2A 3LWLA 2ATLA 1SJRA 2R2RA 1AROP 1RT3A 4LBHA 3A3PB 4V19J 2E5LF 3CJ8A 1NK5A 5CABA 3VALA 5J2MA 2C2EA 2Q3PA 2AIRB 3FQLA 5C7PA 1C1BA 1FTRA 2YWFA 4CLWA 3EWGA 1S0VA 4N47A 5LJ5Y 3CMAS 1JQGA 1L3KA 4DCJB 3L9ZA 2P6SA 3CCZA 2MLXA 5T7LB 3BYRA 4FVCA 2XWYA 5B0GA 2OFHX 3K17A 2VG5A 2V4JA 5GAEI 1HKAA 5LSOA 3PIPQ 3ILIA 2ZJQQ 3BGFA 3J7ZT 4DV0F 4G1QA 1TKXA 3PYFA 4C9DA 1N0VC 2IIHA 1YJNS 2KXFA 3LUYA 2OAUA 3NS7B 4I6WA 2VOOA 1VBZA 1FVSA 3EUNA 1VIOA 3GV7B 1BC6A 2AV5A 3BGUA 4EZ9A 4B08A 1RU1A 2MMYA 4OFZA 4QWAA 3K8VA 1R0CB 3EGNA 1PYTA 1FKPA 4XTTA 1KLMB 4LF4F 4DR1F 1HNVA 2HMIB 1NB2A 3KLEB 4TQRA 3FBFA 3HSDA 1FRXA 3CJKA 3A4TA 4WYWA 1SC3B 1RACB 4X4PA 3GG1A 2KU7A 4WFYA 3GJTB 3CJ3A 4WBFA 2BJEA 3E01B 4ZLJA 1OIAA 2FYXA 1SV5A 3HKWA 1ZOTA 3RR8A 3CJ0A 2OPPB 2UUBF 5ETQA 3QT8A 2GMLA 3CW2C 1SC1B 3I6PA 1H6KX 2BOPA 4RW4B 5KFQA 1V6HA 4RWXA 2FGCA 4RW7A 5GAHI 2EC0A 1HWUA 1O6XA 5E3RA 1RE1B 1KQGB 1R0BG 4KHPF 1JB0C 1MMLA 1RI7A 3CE8A 3AODA 4OQJA 1LWFA 1IJEB 2B4VA 2YKNB 2LEAA 1YLXA 1PAEX 4LSLA 2QA4G 3TOQA 1FE4A 3TI0A 4DX5A 1S5ZA 3OVAA 3ET6A 4JV0A 4AE5A 1WEXA 2DK2A 3L4BC 3CDAA 2AHOB 2EK6A 1P27B 2YX4A 1FNXH 2D9PA 1XERA 2HZVA 3M9NB 1MROB 3P45B 2H4YB 4CQ1A 2E5GA 1I6JA 3TNVA 4DV2F 4EBCA 3PV8A 3PZPA 2IVFB 2DRDA 1XN9A 1IXKA 4A46A 3U7JA 2RUGA 3EXCX 3ILOA 2ZNYA 4ZP6A 3T6BA 8RUCA 4W90B 4Z2XA 5F9LA 1VJQA 1RHRB 4YS2A 4ID5B 2OPQA 4DBQA 4DF8A 2AYEA 4NLYA 2HAIA 1HBUA 2YKOA 4BC9A 1VC6A 1TUVA 2DNNA 4JI7J 3UCGA 4RNHA 1R6VA 2E1AA 4GO5X 4DR7F 4XPEA 1U49A 3W5XA 2DVIA 1SVDA 3SQGB 4FXDA 4WTOB 1N33F 2AYMA 2HS3A 4JV2A 4WE1A 3G71S 4MKVA 1NSPA 1VQ7S 3PEJA 3PW0A 4HH0A 4NYZA 2W7AA 1RT5B 5E33A 3SBMA 4DQIA 4NXNJ 4NEZA 2LEPA 2R7TA 2CQ3A 3R6GB 4F2RA 2PN6A 3UNGC 4ZP9A 4RW6A 1CULB 5CD4H 4PG4A 2J6SA 3OVBA 4A8XA 1HBMB 1VRTA 2QX0A 5DDOC 1WTFA 3DC2A 3OTBA 1MU2A 1TL5A 2OIHA 1R43A 3D2WA 1QAIA 3NBPB 1S49A 3C6UB 2BJ7A 2MDAA 1RAJA 5KFCA 3R2CJ 4Y3CA 2M52A 4RZRA 3FSXA 4PXEA 2LLZA 3SFUA 3ZTSA 2MSSA 2LECA 1JMTA 3B54A 4WIQA 2Z0GA 4Q8FA 6FD1A 2XYGB 2KH9A 3WIVA 3QPIA 3H90A 4NX9A 1FDDA 4OHYA 2QA4S 5I4MA 1X5PA 4OYZA 4LVOP 1VISA 3WC2A 1QSYA 1UWBA 1NEEA 1RTJB 4FS1A 2WOMA 2CQPA 4A8YA 3VAFA 4YHHJ 2Z2YB 4Y2KA 2EPIA 5KTQA 2RSQA 3QSIA 1RA7A 4X84A 1VDHA 2B9EA 3AOCA 3RR7A 2L08A 5JVGQ 2R8GA 4CH0S 3UPFA 2YKMA 2ZZNA 2BJDA 4JYAJ 4MKYA 3Q24A 3UVJA 1RT1A 4YB1P 2OPSB 2HNDB 5LJ3Y 1T9XA 2YX1A 1VC5A 3MEKA 3KUGA 1S6QA 4G65A 2M4MA 1T05B 5IC4B 4O4RA 5F8MA 1VYAA 2GVDA 3UQSA 2X3GA 3FSIA 1TMJA 3OJUA 1KVIA 4J37A 3K59A 3DRRB 5AE3A 3JSRA 2YWHA 4C8KA 2QTWA 3FEYB 1S57A 3IBWA 3VV2B 3IBFB 2J0SD 3JAMU 3MD1A 4CZCA 4WFAQ 2KDOA 3SMZA 2BE2A 2UUWA 4ILMA 1MWYA 4OX6A 4UF4A 4DF4A 5L9XA 4DS4A 4ED6A 1GXUA 4DL3A 3AAWB 3MUMP 5E0OA 4ID8A 3JQJA 4ES3A 2AP6A 1UJ4A 3LW5C 3AHPA 2XC9A 3DYAB 3MR2A 2F8HA 4KV8B 3HVRA 2PGCA 4IOBA 4J7CA 5DQHA 3KDOA 2ZJPQ 3SDEB 3MMAA 3TRGA 2HZAA 4IOAQ 1IBMF 4USWA 3M9OB 2QLBB 4ECRA 2V5HG 4CLPA 2LQJA 5AE1A 5SUHA 3CCMS 3MMBB 3K5MA 3MEDB 3IAM9 1AZSB 4QBUA 1CJUB 1EETB 4K4VA 2PEBA 1HA1A 1WEYA 5MAOA 2DITA 2YNIA 5L46A 1SQGA 3PDNA 3RU0A 2EBGA 2VBZA 4DL5A 2YWEA 4PZVA 2DD8S 5CHCB 3M8SA 3V6DB 1Q8IA 1DZ5A 1TR0A 2QLWA 4D3HA 5KFPA 2JNJA 5KG7A 4MK9A 5E5NA 1RHUB 4H4KA 4ECWA 4O3RA 3THTA 3EICA 4LR7A 1EQ0A 3SSQA 2CA9A 4IDKB 3DLEA 3U1MA 2HHPA 1G4CA 3VAGA 3LP0B 3CSKA 3HFVA 1LW2A 3O2IA 4HI2A 2FY1A 2VV5A 2CAJA 3BEGB 4QQBA 4ECVA 4MK7A 2CUYA 1QVGR 4A8WA 2GAGC 2CDQA 4OHVA 4S0MA 1RSCA 5D3GA 2YPYA 3NXZA 3ZNJ1 1Y3KA 1IKYA 4DU8A 2EFVA 1IQTA 1KN6A 2A0FB 3MGJA 2JX2A 4PYDA 1JNRB 2O5DA 4DV7J 4X4NA 2BEFA 3VGUA 2FDNA 4LRFA 4ZP7A 2K06A 1MN7A 2VICA 5B0FA 5B0EA 3R9LA 3IA0A 2XZDB 1GEHA 2DIVA 4EMDA 1CS4A 3MECB 2Y1JA 1UTAA 1U2FA 3GYGA 2CWXA 3X3UA 3BQ1A 1QTMA 3IM9A 1S1VA 4B3TJ 3HHLC 1FXLA 2LMIA 5KT2A 3EZ5A 4ZJOA 2IHR1 2N3LA 5JMNA 3V81B 4ZS6A 3M32A 3GQCA 1T9TA 3K5LA 3E2EA 1S7HA 3OR1B 2MKSA 3TWZA 4ZVPB 1NNDA 4DX7A 2DNZA 4C98A 2BKOA 4PPDA 3A8EA 2ZE2B 3CJTA 2CZ9A 4M63A 2EK1A 2RF2B 3PW5A 2OPRA 3MR7A 4OZ2A 2MY7A 5L1IA 4TNOA 1J2VA 1FX4A 4RNOA 4J9SA 3N79A 5AXLA 4UQGA 4AL7A 1AUSL 3NAHA 1VQ9S 2KJVA 1B64A 2ZD1A 1REGX 2ZBIA 1Q5YA 5EHHA 2DIUA 2E29A 3OVSA 3MM7B 1KQFB 1X9MA 4A48A 3WX8A 4PQAA 2YNFB 5KG0A 2B5JB 1TK8A 3FCVA 2GO9A 4NRUA 1CQMA 4ZVQB 3PVXA 1NO8A 1PYOB 4MYTA 4I2QB 3KK2A 1FA0A 2BW2A 2ERRA 1N0UA 3GP9A 1KR4A 4QCLA 3GILA 4URGA 1F1BB 3GV8B 2AEMA 1VQ8S 3HI9A 1OPIA 3KHHA 1LK7A 1TKZA 3C6TB 3G6XA 2RDDA 2QSFA 4USHA 3HZGA 7FDRA 1NB7A 4LF2A 5C2CA 1U45A 3KK3B 3W7BA 3Q83A 2F3JA 2C2MB 1U1MA 4LF6J 2XI3A 2ZWPA 4KO0B 1Y5LB 2C2DA 1Q0NA 1JWWA 3GJSB 2O67A 2RMLA 3BO3A 1SUQA 1BMQB 4L74A 4O0NA 4J9VA 1PC5A 1M5OC 2UXDJ 2VQFF 2BOAA 2R9LA 4R8UA 4EYIB 1JLGA 1S0NA 3F0NA 2BV3A 4DV4J 3VAIA 2I0XA 2QLFB 3LOUA 1SKUB 1WWHA 1I5OB 2CPXA 2GFFA 1GT8A 2E9TA 1N5YB 2DNMA 1PCAA 3D68A 3KNGA 4ZVSB 3W2WB 3LQVA 4PUOB 1KTVA 3D6TB 1JLQB 1HBOB 2J5AA 5KG5A 1XQIA 4J9UE 1RBOB 2H48B 3CMQA 2U1AA 3VAMA 3NGDA 4XIUA 4AFFA 1VQNS 3TO8A 1D9AA 4NASA 2IA0A 2ZH2A 2UXBF 1XMQF 4JI6J 4OZ1A 4PABA 1B3TA 2QMUB 1A0OB 5C5JA 1G1XA 3V4IB 1IBLJ 1AUDA 1TVRA 4IG3A 2GHVC 3C19A 4M5LA 1BQMB 4P74A 4NLWA 2GQQA 3R5CA 1D0EA 5F0WA 3D3BJ 2B8PA 1S72S 2ZBQA 3G4SS 3EVWA 2ZFHA 1S1XB 1AYEA 3DGPB 2QG9B 1ZETA 5H9FK 3P6YC 2VG7B 4IUFA 3K0JA 3NNCA 4F4YA 1WOSA 1FJGJ 3DOMA 5C42A 1U0HB 5J1EB 2WAQD 4C11A 3EJMA 4H4MB 2IYIA 1N36J 5D0HA 3M8QA 1NKBA 5J2NA 2N7CA 5M2PA 1FWPA 2XMUA 5L1LA 2HK2A 2DR6A 3N9UC 5BYSA 3H8YA 4DMZA 5D0EA 2KHCA 3P5BP 4OYWA 1QAJA 3OR2A 2F1FA 1RK8A 1O0PA 4CLLA 3BDPA 2IJNA 2JLFA 4DCPB 3CDUA 1IR1A 2I5JA 2NREA 4MFBB 4I67A 2HHTA 1S1WA 4MIAA 1XR6A 2UXCF 1N8RT 1YTYA 2DT9A 4I7FA 3ELHA 4CM2A 4KHMA 4UOHA 4LBPA 1SL0A 4HHJA 4IFVA 2VG6A 3HVTB 1IKWB 4RW8B 2F5GA 1TKDA 2V63A 5LXRA 1JXLA 1GXTA 4PG5A 4B3MJ 3ENWA 1LXJA 2LU2A 2G13A 4F36A 5HK4A 2FC9A 3UI3A 4AL6A 5D0GA 4ZDNA 1U7LA 3ISND 4NLUA 3RB3A 2AEJA 2OUGA 3U1NA 2V4RA 4IO1A 4B3SJ 1TFWA 1N32J 3VAJA 1Q81T 4FNIA 1NPPA 4K5SA 2H5EA 3I9ZA 3J7Z5 1GNKA 1XMOF 1NH8A 3R5DA 4NA2A 2DXFA 1DLOB 2BYCA 4PQUA 1ZM4A 3D6FB 2J6UA 5HJXA 4ED7A 2HLUA 3M1VB 2UUAJ 4RBVA 4WXOA 1V5VA 2LP4A 4O4GA 3S8SA 3VAKA 1LW0B 3CGIA 1M5KC 4CO2A 4EO8A 4TY8A 1MMNA 3Q8QB 1YKWA 2GVZB 3WZ0A 2RQKA 4AD6A 4U6PA 4DFMA 4V1Ak 1TMMA 3W62A 4FP9A 3CJRA 3CD6S 4C7QA 4DJBA 3W8PA 3DI6A 3C3LA 1SIZA 5AXKA 2QV6A 4ICLB 4PYAA 2KVQE 3CDBA 2VH7A 1H72C 4NLTA 2KZMA 2W25A 4KE5A 3FC9A 1B7FA 3KWMA 3JYTA 4UOGA 5F8NA 1RAGB 1P9QC 4ES1A 3ZZRA 2ROGA
chains in the Genus database with same CATH topology
2XYPB 2HBRB 3RJMB 5IC6B 2CNLB 2H48B 1PAUB 1SC1B 2QL7B 1QDUB 4ZVPB 2CNOB 5K20B 2H5IB 2QL9B 3NS7B 1IBCB 3QNWB 1RWXB 2FQQB 2QLBB 3D6MB 2H5JB 4ZVTB 2C2OB 3D6FB 2CDRB 3KJNB 4DCPB 3D6HB 2C2KB 2Y1LB 1RWKB 1NMEB 1RHRB 3IBCB 2QL5B 5IC4B 2H51B 2C2MB 1I51B 1RE1B 1RWPB 1SC4B 2CJXB 2DKOB 1F9EB 4ZVRB 4DCOB 3GJSB 1RWNB 3GJQB 1RHJB 1I3OB 1BMQB 4ZVOB 1RWVB 1SC3B 2HBYB 3R6LB 3IBFB 3KJFB 1RWMB 2XYGB 1QTNB 1ICEB 2XZDB 2HBQB 2XZTB 3GJTB 1GFWB 3R5JB 4JB8B 3R7BB 1RWOB 3EDQB 4ZVUB 3KJQB 2HBZB 1RWWB 3GJRB 2QLFB 4DCJB 2C1EB 3P4UB 4ZVQB 2Y0BB 3R7NB 2CJYB 3P45B 1RHQB 2P2CB 1PYOB 2H4YB 2H4WB 1RHUB 2H65B 2XYHB 3SIPB 3R7SB 4LSZB 2CNNB 1RHMB 4ZVSB 1RHKB 2CNKB 2H54B 3EDRB 2C2ZB 2QLJB 3R6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYP B;  2HBR B;  3RJM B;  5IC6 B;  2CNL B;  2H48 B;  1PAU B;  1SC1 B;  2QL7 B;  1QDU B;  4ZVP B;  2CNO B;  5K20 B;  2H5I B;  2QL9 B;  3NS7 B;  1IBC B;  3QNW B;  1RWX B;  2FQQ B;  2QLB B;  3D6M B;  2H5J B;  4ZVT B;  2C2O B;  3D6F B;  2CDR B;  3KJN B;  4DCP B;  3D6H B;  2C2K B;  2Y1L B;  1RWK B;  1NME B;  1RHR B;  3IBC B;  2QL5 B;  5IC4 B;  2H51 B;  2C2M B;  1I51 B;  1RE1 B;  1RWP B;  1SC4 B;  2CJX B;  2DKO B;  1F9E B;  4ZVR B;  4DCO B;  3GJS B;  1RWN B;  3GJQ B;  1RHJ B;  1I3O B;  1BMQ B;  4ZVO B;  1RWV B;  1SC3 B;  2HBY B;  3R6L B;  3IBF B;  3KJF B;  1RWM B;  2XYG B;  1QTN B;  1ICE B;  2XZD B;  2HBQ B;  2XZT B;  3GJT B;  1GFW B;  3R5J B;  4JB8 B;  3R7B B;  1RWO B;  3EDQ B;  4ZVU B;  3KJQ B;  2HBZ B;  1RWW B;  3GJR B;  2QLF B;  4DCJ B;  2C1E B;  3P4U B;  4ZVQ B;  2Y0B B;  3R7N B;  2CJY B;  3P45 B;  1RHQ B;  2P2C B;  1PYO B;  2H4Y B;  2H4W B;  1RHU B;  2H65 B;  2XYH B;  3SIP B;  3R7S B;  4LSZ B;  2CNN B;  1RHM B;  4ZVS B;  1RHK B;  2CNK B;  2H54 B;  3EDR B;  2C2Z B;  2QLJ B;  3R6G B; 
#chains in the Genus database with same CATH topology
 3WIU A;  4X62 F;  4DR4 F;  2IPO B;  1PIE A;  3MXH P;  1U02 A;  5HQ8 A;  2H5I B;  3OTO J;  2W2P P;  1NRK A;  2DY9 A;  3UN3 A;  2IC3 A;  1Q7Y T;  2FQQ B;  4DUZ F;  4CLT A;  3TP2 A;  2K7K A;  3QT5 A;  1SL1 A;  3MCN A;  7FD1 A;  1VMB A;  2VL1 A;  4RO0 A;  2ZNZ A;  2XEX A;  4DI6 A;  3G9C A;  5D78 A;  1KRP A;  2CG4 A;  1HI8 A;  3H2U B;  4L75 A;  5IFM A;  3GJQ B;  2QA1 A;  3HCX A;  2KVI A;  3M6V A;  4H4O B;  4X64 J;  2HPU A;  1EP4 A;  2MTL A;  2K1R B;  1KVJ A;  2DNR A;  1A9N B;  2IAJ A;  3KHL A;  3UN5 A;  3PCO B;  3TUI C;  2GIR A;  1WTB A;  4UUX A;  2DNK A;  1RDR A;  1E6Y A;  4DG1 A;  4IRD A;  4DL4 A;  1RYR A;  1URN A;  4KC5 A;  4UOF A;  2DH8 A;  1OO0 B;  3SV3 A;  1WOO A;  1B0T A;  2VFS A;  2GGP B;  2R3V A;  3HJF A;  5DM7 Q;  2FLN A;  5HN0 A;  4C8Y A;  1X4D A;  3MFH A;  1D9D A;  4ZVT B;  3ENV A;  3MAA B;  2L48 A;  1JJ4 A;  3RBD A;  1YJV A;  3PO5 A;  2F8M A;  5ETP A;  4ERD A;  3UN2 A;  1OSD A;  5DET A;  1VQK S;  2D3Z A;  3BKT A;  4QR2 A;  4J90 A;  1R31 A;  2CQ4 A;  4IR1 A;  3IN5 A;  3KLF A;  5CZV A;  2CIM A;  2B56 A;  4HR2 A;  4AQY F;  3T9Z A;  3CNQ P;  2HHX A;  1VRU B;  4ANE A;  2PFD A;  1QUP A;  5GAD I;  1NK4 A;  3FBC A;  1SB6 A;  3I0R A;  3M2V B;  5ETV A;  4K4U A;  3IRX A;  3CPW R;  4BHQ A;  1KWM A;  2WVD A;  4XPC A;  4HI1 A;  2HWI A;  3DM2 B;  2CJA A;  4NZ0 A;  1UJ5 A;  2BXJ A;  3KLG B;  3GR1 A;  1YGY A;  3PG9 A;  3FZB A;  4I56 A;  4KKO B;  1UET A;  4NXM J;  2O66 A;  2ZZM A;  2RVJ A;  4HVZ A;  5JVH Q;  2M0G B;  2HVZ A;  1HFE L;  5T14 A;  3W5Y A;  4AXI A;  1UJ6 A;  4DR1 J;  2R7V A;  5C25 B;  4GRS A;  2HAF A;  2HGL A;  3MEG A;  2JRS A;  2V2Z A;  1Q78 A;  3OQ2 A;  1N88 A;  1FKA F;  4TKT A;  2R8I A;  3HHL B;  1VBK A;  2M7S A;  4E98 A;  3CCL S;  3ZZZ A;  1M1H A;  3V2U C;  5DLF A;  3TVY A;  3EZU A;  3T1Y J;  1X5O A;  1EZZ B;  2WB4 A;  2ZH1 A;  2PEH A;  3Q2S C;  3PYG A;  2HQC A;  3MM9 A;  4MMO A;  3D1O A;  1H2U X;  3I55 S;  2P2C B;  4QU6 A;  3G8S A;  4FYW B;  4GO7 X;  5IT9 Y;  2QC3 A;  4K4Y A;  2FJV A;  5A6P A;  4YFU A;  3QGP A;  2C3O A;  1WG5 A;  4WK3 A;  4O3S A;  1YSJ A;  5HRO A;  2R42 A;  2ZC3 A;  1SJ4 P;  2ZM6 J;  3UDV A;  4XO0 A;  2MGZ B;  4Y2C A;  4LFB F;  4KHP J;  1WUU A;  2UP1 A;  2M2B A;  1Q95 G;  3BGL A;  4ZIT A;  2ATC B;  1G6B A;  4QIE A;  1RAF B;  3C14 B;  5I42 B;  2ALZ A;  3BQ0 A;  3Q22 A;  3BR8 A;  3QJL A;  3RYL A;  5I3U A;  3QFH A;  4LFC F;  3MR3 A;  4U7C A;  2RS8 A;  1TZ0 A;  4B9N A;  5L1K A;  2JEI A;  3O3L A;  2EKY A;  1NJW A;  1OQ3 A;  3W61 A;  4QIV A;  1KHW A;  2UZA A;  2RNE A;  5BJR A;  3QGI A;  3BSA A;  4ITS A;  1RWO B;  3ZZU A;  1AB8 A;  3LA0 A;  4D3G A;  1UA0 A;  2ILZ A;  5FJ4 A;  1NU4 A;  2KYZ A;  4EBE A;  1KDN A;  2W7P A;  4DV2 J;  2LYV A;  5C24 A;  3AB2 B;  4GC6 A;  2HK3 A;  2YKA A;  3R7S B;  2EKN A;  1WKK A;  4LSN A;  1VIX A;  4UY8 T;  5CH7 B;  2ZVI A;  3OXL A;  3RJM B;  4DQR A;  3WQP A;  1KS2 A;  2XSJ A;  4BDP A;  2FZK B;  2BJ8 A;  3POT A;  1IBC B;  3KHG A;  3FFI A;  3RAX A;  1NSK L;  3BB5 A;  3G82 B;  2V0N A;  2ASD A;  3NOG A;  3O8W A;  1M5S A;  2VPZ B;  5IQ6 A;  2PSZ A;  2E1C A;  2COL A;  2HIQ A;  5EX3 A;  4Q7A A;  1K47 A;  4TU7 A;  4DUY J;  1QE1 A;  3HO1 A;  2N7Y A;  3KTQ A;  1P8G A;  4DQQ A;  4Q43 A;  2FJW A;  2DGV A;  4JI3 J;  5KFJ A;  3G6E S;  1T9U A;  5F8G A;  4JI4 F;  3BO2 A;  4R0E A;  1RXO B;  2IJF A;  1CJK A;  1WDT A;  1YWX A;  1NSA A;  4P75 A;  3P4U B;  4ER8 A;  2YPZ A;  1NHV A;  2AJ0 A;  3NMA A;  1D8Y A;  3DFE A;  4B9V A;  4YR3 A;  3RRK A;  2NYI A;  5LOQ A;  5RUB A;  2B4O A;  3O5T B;  5K8P A;  3B78 A;  3K7R A;  2R7O A;  1WHY A;  2CQD A;  5ETT A;  2XZW A;  2DHA A;  2LDY A;  3I4P A;  5CZX A;  4QOT A;  2HS4 A;  4CO3 A;  2DJW A;  2A6O A;  3H25 A;  3IC1 A;  3IXQ A;  4H4K C;  4OV1 A;  3HVA A;  2LXF A;  4ZCK A;  1R89 A;  5T41 A;  3J80 Y;  1VOM A;  4B9T A;  5FII A;  3DDN A;  1JLB B;  3CJ4 A;  3M30 B;  2JZ5 A;  2CPY A;  4K5R A;  3MM5 B;  5IM0 A;  1IKV B;  2OGU A;  5AT1 B;  1SI9 A;  1U48 A;  3EGW B;  4RLE A;  4FYD A;  4ED5 A;  3B8H A;  4GVB B;  3V6K A;  3DLG B;  2YNH A;  2MQ8 A;  2QYC A;  2HRU A;  1YJR A;  2V8P A;  3OTE A;  5ETO A;  5HMW A;  4CO4 A;  4DR2 J;  4CTA B;  4K0K J;  3M8Y A;  1KBR A;  1RHK B;  1CJV B;  3NL0 A;  4OYP A;  3FSY A;  3RBZ A;  3RB6 A;  3R1L A;  1NJY A;  5H9E K;  1SH0 A;  2MZT A;  4QIF A;  3BSC A;  2K2P A;  1Y5I B;  4YR0 A;  2XO7 A;  2HIY A;  1JX4 A;  4JI2 J;  4OX8 A;  2H5J B;  3CD7 A;  2B7C B;  5LMU J;  4CCH A;  3SEO A;  4FF1 A;  4DLE A;  3BV8 A;  2FGO A;  2YH0 A;  4YB5 A;  4JI0 F;  4TLR A;  1TKT A;  1W2B R;  1DTT A;  2DRB A;  3DRS B;  1NXI A;  3EE3 A;  4B9L A;  3EPG A;  2OKQ A;  1RT3 B;  3I31 A;  3QFW A;  4LFA J;  4CDI A;  4ZK7 M;  2ZBC A;  1L3V A;  1UMJ A;  2BQ3 A;  2JDJ A;  4P2M A;  5J2M B;  1U0S A;  2LQB A;  3GON A;  4ZPC A;  4KQZ A;  1C1B B;  3NCP A;  3BKF A;  2VA2 A;  3IGN A;  2GHW A;  1FT8 A;  2PA3 A;  3G8T A;  3N01 A;  3H42 A;  3OFF A;  3OFG A;  2I1R A;  2CNN B;  2NLW A;  3P5T L;  2VG5 B;  2DHS A;  2V4J B;  3CF5 Q;  2GJ2 A;  1HNZ J;  2CQB A;  4NLX A;  2CJB A;  1DAR A;  1IM6 A;  2RD5 C;  5E3Q A;  4G1Q B;  1B0P A;  5K20 B;  1TKX B;  2VJV A;  4W92 B;  2M8D B;  3R97 A;  1FI4 A;  1I94 J;  3EM1 A;  4OJ3 A;  2E5I A;  2LA4 A;  2HG4 A;  4MIB A;  1U2R A;  3DXB A;  2Y1L B;  2ZVS A;  4OYI A;  3EVM A;  3JSM B;  2IDE A;  3SZ2 A;  5FD1 A;  1D1U A;  3K5N A;  3E3X A;  2D41 A;  1FKP B;  5DG8 A;  2DNP A;  2IM0 A;  1OQ6 A;  2QFJ A;  4AT1 B;  4ZVE A;  2Y8Y A;  1V3Z A;  2D3U A;  3CJK B;  3QGG A;  2HHH F;  2VUG A;  3G8Q A;  3MZI A;  3MPV A;  2AYB A;  2AT1 B;  2FVQ A;  4X66 J;  2KXN B;  2LXU A;  1T03 A;  3CD5 A;  4B3R F;  4P7V A;  2K7J A;  2Z57 B;  2DGT A;  4C3L A;  3PHE A;  1SV5 B;  4GVL A;  1WEL A;  4WFZ A;  2P9E A;  4MT1 A;  2JSX A;  2A2C A;  2C2R A;  2JH3 A;  3MM6 A;  4L76 A;  2C3P A;  1O5J A;  1ZM3 A;  4HTJ A;  1XNR F;  3M6U A;  3W63 A;  4ED3 A;  3DOL A;  4LQ9 A;  3H5Y A;  2Z2M A;  3H5X A;  3CED A;  5GME A;  2VBY A;  5DGB A;  4RW7 B;  4PR6 A;  2GMH A;  3GFY A;  2HHU A;  3O1L A;  1KHV A;  3MUT P;  2VQE F;  4HH1 A;  4OJG A;  4M5D A;  3DLK A;  1P1L A;  5IWA F;  2RQC A;  2JFK A;  1LWF B;  2VFV A;  4M5K A;  4LSL B;  3N5B A;  2D7S A;  2VJU A;  1R0A B;  2HHQ A;  1ZH5 A;  3ET6 B;  5EDW A;  3C15 A;  1Z4U A;  2NXU A;  1CQN A;  4X4O A;  1QAY A;  4F50 A;  4B9S A;  2WVE A;  4Y6I A;  1X4A A;  4FYY B;  2FJB B;  4U67 Q;  3D5M A;  2J0Q D;  1W25 A;  4ZA1 A;  1OJ4 A;  3PJX A;  3GIJ A;  3D67 A;  4I6Y A;  4CNY A;  3HK2 A;  4RX6 A;  5K9F A;  1QUV A;  2V94 A;  2Z4P A;  1QJH A;  1ACM B;  1K73 T;  2L3M A;  3TVK A;  3IM8 A;  4J9M A;  1U09 A;  4TY9 A;  3V6H A;  2V2Q A;  4HL9 A;  2EFO A;  1EX8 A;  2ZWO A;  3QAE A;  4DSE A;  2HWT A;  4FPI A;  2W4P A;  1IUJ A;  4CLY A;  4NLD A;  2OPQ B;  3QYY A;  2IA6 A;  3NWR A;  1OY8 A;  4M5N A;  5M2R A;  3FBB A;  3FRY A;  2DHH A;  1TK0 A;  1HBU B;  3SCJ E;  1VCT A;  4GKJ J;  1QSL A;  2X3D A;  2W8K A;  1PJ6 A;  2RAQ A;  3KXD A;  3BYP A;  1K8A T;  2RIJ A;  4OYB A;  1HW8 A;  3ZNU A;  2E66 A;  2YTC A;  5BYQ A;  4ZPT R;  2EFQ A;  1GX5 A;  5A8K A;  4IFY A;  1V5I B;  2VBW A;  1Y0H A;  3CO0 P;  4UQT A;  2LA6 A;  3EGZ A;  1LQ9 A;  1WDD A;  2U2F A;  4U95 A;  2G0I A;  2A6M A;  3M05 A;  2L9D A;  3HP6 A;  4RW6 B;  2AJ2 A;  3OV7 A;  2ZH5 A;  3PFE A;  2UVR A;  2WHO A;  4B9M A;  1VRT B;  2G1D A;  3K57 A;  2GJF A;  1Z2Z A;  4PPZ A;  4K59 A;  5HMZ A;  3HT3 A;  1MU2 B;  2R2U A;  5I3Q A;  1RT2 A;  4WFX A;  5KFH A;  2UUT A;  1RU2 A;  2IM3 A;  3AQP A;  5HAT A;  1K9M T;  4DLG A;  2DGU A;  4EBD A;  5F8H A;  2X51 A;  3AB4 B;  3HLU A;  1U1L A;  1AA1 B;  3D0H E;  2BRK A;  3CCR S;  1F60 B;  4OHW A;  3DRY A;  3SXL A;  2DY1 A;  5BR8 F;  4M95 A;  3GIK A;  2ZH9 A;  4USM A;  3IG1 A;  4N41 A;  2QMX A;  1GTE A;  2AMC B;  3NS5 A;  4HT7 A;  3I5C A;  4NML A;  1UWB B;  1MW7 A;  2MQO A;  2WOM B;  4ZMM A;  3PNI A;  1LXN A;  4NCB A;  2DCL A;  3A8K A;  2KFZ A;  4JBC A;  1QAX A;  5HAN A;  2CQ0 A;  4DL0 C;  2VB6 A;  2QRR A;  2NPF A;  2JLE A;  4A8Q A;  2AGQ A;  4OHZ A;  2J76 E;  1Q4R A;  2YKM B;  5H9E J;  3DDK A;  3UVJ B;  1RT1 B;  4UST A;  1YBA A;  3EMT A;  3ISN C;  5LSL A;  4X4Q A;  4CH7 A;  3Q8U A;  3PYD A;  4N77 A;  1F9H A;  1S6Q B;  2AW0 A;  4K7Q A;  4P2F A;  2DNY A;  5FDL A;  5KFS A;  1F2H A;  1RUS A;  3JSB A;  2GVD B;  4DQP A;  4KYZ A;  2ZH3 A;  2F9D A;  1KTQ A;  4ELT A;  2J0W A;  1I3O B;  1HR0 J;  4ANC A;  4M5G A;  3CVK A;  2ZC4 A;  4WZM A;  2G2Z A;  1FF2 A;  1S1T A;  1NCL A;  4L3K A;  5KFA A;  5A8W A;  3VGT A;  5LMN J;  3S01 A;  2RHQ B;  4Y2A A;  1YIT S;  4X4U A;  2BE9 B;  1CLF A;  2HGM A;  2WZ1 A;  1GQE A;  3IS9 A;  2IRU A;  2MZ1 A;  1Q82 T;  2LKZ A;  1K0V A;  3MFI A;  2GV1 A;  1C4A A;  2HVE A;  2ZJR Q;  2XB2 D;  1HQU B;  3MMA B;  2HVD A;  3HFZ B;  3MPU B;  1VK3 A;  2XGQ A;  3H20 A;  3KJN B;  2WON A;  1HI0 P;  2UXC J;  1C0U A;  2F4V F;  4Y65 A;  4YY3 F;  3Q86 A;  5EWF A;  5GMD A;  2DNH A;  2CVI A;  2QZ8 A;  1B70 B;  9ATC B;  4DCO B;  3M6W A;  2MJU A;  4M94 A;  2YNI B;  4U9R A;  4ELV A;  1LNQ A;  1U47 A;  3Q8V A;  3WBZ A;  4OMF G;  2AJ4 A;  2NXC A;  1E6V A;  2HVH A;  2CPF A;  1X0P A;  4KFB A;  2C1E B;  4N7T A;  5KFY A;  1U6Z A;  1LFP A;  4J9L A;  2A18 A;  3OTC A;  3MEC A;  1N48 A;  2W01 A;  3MCS A;  1WC0 A;  3R3T A;  4B02 A;  1M5H A;  2CNL B;  1UVN A;  2J7W A;  3K5O A;  2J9D E;  3DLB A;  5A2Q Y;  4ED8 A;  4JOU A;  1LW2 B;  2FZG B;  3D1H A;  3FEX B;  1APS A;  2NPI A;  5D4O A;  5D3G B;  3TZY A;  4ZLL A;  2G4B A;  3S6E A;  3OR1 A;  1IKY B;  1ZAX A;  2MQL A;  2AWZ A;  1W7W A;  3JXO A;  4Y0F A;  5HSP A;  1N4L A;  5K14 B;  1WAC A;  1FKO A;  5HLF A;  1U6B A;  1K1Q A;  5G0R A;  2R2S A;  1R8P A;  1FO1 A;  4YB7 A;  3V6J A;  5KFI A;  4XAK A;  3IGV A;  2QLX A;  1P6T A;  2KM8 C;  2OH2 A;  4LJM A;  1H98 A;  4DPX A;  2VAS A;  3LGH A;  3MEE A;  1CS4 B;  3QBC A;  3DOK A;  3BDE A;  1X0F A;  2AX1 A;  2PDA A;  2CPI A;  3ICL A;  3UWT A;  3ZTQ A;  3U27 A;  1S1V B;  4X62 J;  4CLZ A;  4DR4 J;  2DO0 A;  3W9J A;  3DRX A;  3DNC A;  5BYR A;  1WI6 A;  4JI7 F;  3TZZ A;  1U2C A;  2YWG A;  1IWG A;  2AGO A;  3HM9 A;  3M32 B;  1HWJ A;  2E7W A;  3MR5 A;  4LIR A;  1NZ8 A;  4NCG B;  1EKS A;  2XMA A;  3KLH A;  2DGQ A;  2Y8W A;  4ELU A;  4DDF A;  2C2O B;  3M7V A;  3ILJ A;  2RKI A;  3D66 A;  2OPR B;  4F4K A;  1U1O A;  3NGT A;  1QSS A;  4F4A A;  3X1L B;  2ZDO A;  4WZQ A;  1FHT A;  4M5J A;  3C16 A;  4X2B A;  5A0Y A;  2RJZ A;  1XR7 A;  3J7Y I;  2P6T A;  4Z37 A;  4IG0 A;  3I0S B;  3TEH B;  2Q1L A;  2HNY A;  2JWN A;  2YQ1 A;  1PO6 A;  1BLU A;  4LMZ A;  2V67 A;  4JI1 J;  1M1G A;  1CEZ A;  3PM9 A;  2A3J A;  4QYZ J;  1FFG B;  4QWC A;  3TQ1 A;  2K3I A;  5HBM A;  4LR9 A;  1JJ2 R;  3KK1 A;  4DZD A;  3KK2 B;  1OPZ A;  4U8Y A;  5DO2 A;  1YJU A;  2VDH A;  1DUR A;  4QPT A;  3MOJ B;  1J5E J;  4UY8 5;  4OX7 A;  4B9U A;  4HHU A;  4B3O A;  2KT2 A;  2FLL A;  1K1S A;  1T3N A;  2L9W A;  2WBM A;  4AND A;  1S9E A;  2P5V A;  4YHH F;  4P9S A;  3CD0 A;  4U8V A;  4KTQ A;  3OFH A;  3UFC X;  1TKZ B;  2UUC J;  1IN0 A;  4HHH A;  3BN4 A;  4QYR A;  4HDH A;  4IYQ A;  1ITP A;  3AJ2 A;  2VIH A;  3QSY B;  1XJW B;  1WF2 A;  1S9F A;  4JYA F;  4USU A;  3IR5 B;  2KT5 A;  1Q8L A;  1UZH A;  1SUQ B;  2VPX B;  2B6A A;  3FDS A;  3WDO A;  4ZN1 A;  4WCE Q;  2V9W A;  3JB9 k;  3V4I A;  3SSS A;  3VZI A;  1IKX A;  1VQP S;  4Q0B A;  4JB8 B;  4R8U B;  1KON A;  1JLG B;  3CCW A;  3MCM A;  3KJQ B;  2UU9 J;  2QYG A;  4M1K A;  4OI3 A;  1S6P A;  1F3V A;  2AJ1 A;  3DGP A;  3OT9 A;  1EAR A;  1N5V A;  3ETO A;  2VD3 A;  3CDE A;  2MKI A;  2BQU A;  2HWH A;  1TQL A;  2XMW A;  3KDN A;  2HFS A;  2PI5 A;  4HAC A;  1TL1 A;  2H3E B;  4LF7 J;  4ZPD A;  5DS7 A;  2K3K A;  3I4H X;  2W2O P;  5GAE U;  8AT1 B;  3CCS S;  2AJF E;  3DU6 A;  1HWL A;  2G2O A;  4ZVF A;  3VHQ A;  1TVR B;  4IG3 B;  4N8N A;  1UEU A;  1KQS R;  4IQX A;  3DMJ A;  3IFE A;  1SQF A;  4ALZ A;  4RNN A;  1CJT A;  3ZO7 A;  1VHI A;  1N34 J;  3G87 A;  1RTD A;  4QU7 A;  3JS9 A;  3THV A;  2MLZ A;  3VTI A;  2AQ4 A;  2IY5 B;  2O01 C;  5ETL A;  2PI4 A;  4FN5 A;  5IOL A;  3DOM B;  5C42 B;  3ZC4 A;  2J8A A;  1Q53 A;  2HSE B;  3QIP A;  4C11 B;  1UVM A;  3W2V A;  4DR6 F;  3M8Q B;  3FJ2 A;  3Q0A A;  5J2N B;  2EXU A;  3D1Q A;  4EU0 A;  3G86 A;  2IM2 A;  2VC0 A;  3QQC D;  1Q8K A;  2HFV A;  4LQ3 A;  3UW1 A;  3GIR A;  2KXH A;  3M2U A;  3NCQ A;  3T1A A;  2E1M C;  1EQM A;  2FVR A;  2CNO B;  5HMY A;  3SYZ A;  1RWX B;  2VA3 A;  3OR2 B;  2MY8 A;  4K4Z A;  4JI5 F;  1KQK A;  2PMW A;  2J9E A;  1WHW A;  5HJY A;  2I5J B;  5KFX A;  3AD9 C;  1LWC A;  3CC7 S;  3W1Y C;  5K5M A;  3OL7 A;  2KJW A;  4I7F B;  3KG1 A;  3VGV A;  5C2G A;  1UZD A;  2KT3 A;  3GCX P;  3M8Z A;  2CPE A;  5IQQ A;  4LIW A;  5GAH U;  2OSQ A;  3FQK A;  3AJ1 A;  2VG6 B;  5ETN A;  2FJA B;  2EG1 A;  2KKH A;  1GMV A;  2CG8 A;  2Q6B A;  2ROP A;  4FYV B;  1Y00 A;  3Q8R B;  1VQ6 S;  5BXI A;  3SCL E;  4DV1 J;  3N28 A;  4LF9 J;  4DV7 F;  5F3Z A;  1S6O A;  2AGP A;  3AD8 C;  5I3P A;  3D0I E;  4DSK A;  3VQT A;  3AT1 B;  4J5O A;  3M8W A;  4QWB A;  2G0C A;  3THP A;  1WSV A;  4CYU A;  2YKQ A;  4EK2 A;  3FBE A;  2DNG A;  4MKA A;  1RP5 A;  3OL8 A;  3DRP A;  3IR6 B;  3LP1 A;  4LBI A;  4PQU B;  1AFJ A;  3SI8 A;  2D1C A;  3L09 A;  3OUY A;  4LF5 J;  1IQZ A;  4OLP A;  3KUH A;  4O4G B;  2VOD A;  4TVA B;  3ZTO A;  4PG6 A;  4PWD A;  1VR6 A;  2ZDP A;  4OHX A;  5KOX A;  5HQM A;  5K8M A;  4DPY A;  3LAM A;  2OP5 A;  3M9M B;  4TY8 B;  2BJ3 A;  2VBX A;  3HJV A;  2I8E A;  1UEV A;  4P52 A;  2MPU A;  2LU1 A;  1C4C A;  5KFK A;  2NQP A;  1T3O A;  4O3O A;  1S1U A;  4KGM A;  1TTH B;  3T5L A;  5CYJ A;  3JTP A;  2E9Z A;  3PY8 A;  2DB1 A;  3DI6 B;  1WI8 A;  2W2M P;  2HQ3 A;  1R8C A;  5DGA A;  2GQC A;  3MUV P;  4C0O C;  4IH6 A;  2H65 B;  1C1C B;  2FB0 A;  2KG0 A;  3JYT B;  3A1Y G;  2F8E X;  3E8O A;  1W2I A;  3Q23 A;  4RW9 A;  4RU2 A;  4HTI A;  4FKY A;  4UT4 A;  2IC3 B;  4NLS A;  4O44 A;  2QJ3 A;  4ZPA A;  2GGP A;  3MD3 A;  1GMW D;  1VQO S;  3F41 A;  4K50 A;  4C8L A;  4ZLN A;  1FER A;  2JFD A;  4PG7 A;  3VF0 B;  1R8H A;  1QY7 A;  1WC6 A;  3BF4 A;  3CIZ A;  1RHJ B;  5CYM A;  4R5P A;  4DV6 J;  4C3K A;  4DR3 J;  2R8H A;  1QD1 A;  1EP4 B;  3BN7 A;  2CQG A;  4YOE A;  1IBK J;  4FVM A;  4C2M A;  2IBO A;  1E6Y B;  4DG1 B;  4ZHR A;  3TYT A;  3ZZP A;  4Q5V A;  4CLK A;  3VVT A;  1JLF A;  2X7I A;  2ZOM A;  5IZH A;  3Q8S B;  3TAM A;  5IV3 A;  1UWA A;  4F02 A;  4CIO A;  2DXE A;  3QJJ A;  4OZ0 A;  4P6Q A;  4WPA A;  5D6G A;  3AY0 A;  5HVF A;  3W65 A;  1S99 A;  4ED0 A;  3O6Q A;  4URQ U;  4DV4 F;  2Z2L A;  1JKH A;  5B7W A;  1T9Y A;  1GMW A;  2C2K B;  2BRL A;  3PHT A;  4RU9 A;  2CPD A;  1RTZ A;  3C2P A;  2XLK A;  3T5H A;  3I87 A;  2V68 A;  4ED1 A;  5LXY A;  1J5O A;  1T11 A;  4A8S A;  2ZKT A;  1PG5 B;  3KLF B;  4ECZ A;  2NZC A;  4EYH B;  2XY7 A;  1S48 A;  2Q43 A;  3RAM A;  1LEO A;  4ZVU B;  3PEH A;  4RUB A;  1YIJ S;  3CT9 A;  5LT5 A;  3I0R B;  4XDC A;  3IRX B;  4QPX A;  5LSR A;  3GV5 B;  5F0U A;  3GII A;  3ZZ0 A;  1FRM A;  4KH0 B;  2VF3 A;  2CZ4 A;  3O44 A;  1F9F A;  1XR5 A;  1HLW A;  1GXL A;  3HUL A;  4Y2M A;  4RBU A;  4R25 A;  2HS0 A;  4UZC A;  4O3N A;  5IT9 U;  4QW9 A;  2KYX A;  2KM8 B;  4DN0 A;  1VJW A;  2DGO A;  4K4T A;  4C8Z A;  2V8V A;  3D6H B;  3MI7 X;  2VOP A;  3N6L A;  1VQS A;  1NK7 A;  3MEG B;  3BBC A;  3VZH A;  5GAG I;  1RAA B;  5KT4 A;  4WKR A;  5AXM A;  1JXE A;  4QIW D;  2E9R X;  2AD9 A;  3MMC A;  4WU3 A;  2EEY A;  4GMK A;  2QT7 A;  5F8J A;  2V69 A;  4MJK A;  2M9K A;  4HKQ A;  4EUV A;  3QAU A;  2LQ8 A;  1KC8 T;  4DQS A;  3GJR B;  3MM9 B;  3LP2 A;  2H4W B;  3J81 j;  4Y34 A;  4BC7 A;  1REV A;  2DH7 A;  1M1K T;  2CFX A;  3T5K A;  3HVW A;  1LWX A;  4DX6 A;  2I9S A;  3CXC R;  2EBE A;  2W8L A;  4MIW A;  5SZT A;  2UV8 G;  1Q1K A;  1NBE B;  5HRO B;  3OPK A;  3M4X A;  4ZJQ A;  4M5H A;  2MKY A;  1IWA A;  3BJY A;  3E51 A;  1MN9 A;  2RRN A;  3EGV A;  4QWD A;  1KKH A;  5KAK A;  2HHV A;  4DPT A;  4DR5 J;  3CUN A;  1WJ9 A;  2VQE J;  3MOZ A;  2DEI A;  4MH8 A;  4B3S F;  1R6Y A;  1X4B A;  3MMJ A;  5IWA J;  3DN9 A;  5EWG A;  1PJ7 A;  3NKY A;  4LUB A;  3B4M A;  3OSP A;  5I3U B;  3TJ8 A;  4CH1 A;  2B9W A;  1VGY A;  3FK4 A;  4C8N A;  5H1S V;  2UUA F;  2M5Y A;  2KFN A;  1V3S A;  4NLQ A;  1UA1 A;  3ONQ A;  2ZUA A;  4FXV A;  2WVC A;  5CAA A;  3ULH A;  1YZ6 A;  1JLC A;  5LL6 d;  3HDS A;  4BLG A;  2MKK A;  1LFW A;  5L8R C;  3PRV A;  3ZTR A;  3EX7 B;  1XNQ F;  4LSN B;  2W9A A;  4ZIV A;  4NRT A;  3BQ2 A;  1Y9O A;  3H2L A;  1UVL A;  3NY0 A;  2BM0 A;  3CO9 A;  5HO4 A;  2XSJ B;  4C4W A;  3I32 A;  4IRK A;  2R4F A;  4OI0 A;  2PMZ D;  3T3F A;  3D9B A;  3POT B;  1NLK L;  1G7C B;  2POK A;  3FFI B;  2X1G A;  1Y5N B;  4LRD A;  5EN1 A;  3ITH A;  2LQ9 A;  3BZQ A;  1HIY A;  2BQR A;  3PX4 A;  2OEM A;  2G2Y A;  5J2P A;  5D15 A;  3OSN A;  1RWP B;  4M5M A;  2OEL A;  4ECS A;  2GC8 A;  1QE1 B;  5L38 A;  2GX8 A;  2HNZ B;  3DLH A;  5FLX Y;  1HQE A;  1PYS B;  3PIO Q;  3GB0 A;  3HPO A;  3BBB A;  3RAQ A;  4F8R A;  3PR5 B;  4DFJ A;  3J80 U;  4FF3 A;  2WVF A;  1X5T A;  4KBI A;  2BX6 A;  3OL9 A;  1D3W A;  1CJK B;  5KFB A;  3MM5 A;  3Q89 A;  1TL3 A;  2AZ3 A;  5D4P A;  4NZ6 A;  1FRK A;  1YJT A;  2MKC A;  4JUZ A;  3C66 A;  2CJY B;  1Y4Z B;  1ULR A;  3M8R A;  2XMV A;  5E41 A;  2CPJ A;  2ZBR A;  2ZKU A;  1SJ1 A;  4P2X A;  2PT0 A;  4A47 A;  4F3O A;  2DCU B;  2FJD B;  3KKF A;  2MB0 B;  2RRB A;  3UCU P;  1SBR A;  5KFM A;  1VI7 A;  2QMW A;  1XIQ A;  1N6Q A;  1X4E A;  3KJV A;  4NI2 B;  2I6W A;  5DDP C;  2Q6C A;  3QO9 A;  1RTH A;  4WWS A;  4NZ7 A;  1SJQ A;  1NME B;  1UP1 A;  4ZVG A;  5KFV A;  3KMQ A;  1G2E A;  1SC4 B;  1JLE A;  2IVY A;  2JJ4 D;  1F9E B;  3N4W A;  1RAO A;  3TX0 A;  3MHY A;  1EHW A;  4F4Z A;  1Y10 A;  5KOW A;  5IM0 B;  5CCL A;  3QWU A;  4EFA C;  1DHM A;  5DG7 A;  4KT0 C;  2XMJ A;  2FVS A;  3NNA A;  1OWX A;  1YRT A;  2YNH B;  1WG1 A;  2Y3Y A;  1RAI B;  2R8K A;  1YQH A;  2KRB A;  1UW4 A;  2YWW A;  1LV5 A;  2GIQ A;  2XMK A;  1HNX J;  3DLL Q;  1RAD B;  3FEZ A;  1Q86 T;  1L3S A;  5ETS A;  1U8W A;  4FS2 A;  4WXW A;  5LM7 E;  3NNH A;  3QGH A;  1BQN A;  4FPR A;  4LF8 F;  2PFF B;  4NMX A;  2V6A A;  2B9X A;  1RB0 A;  3BPS P;  1B99 A;  1GH8 A;  2B7B B;  2JHE A;  3CCU S;  5KFD A;  3T1H J;  3AOA A;  1FFW B;  1TKT B;  2WSF C;  4OZ5 A;  3BO4 A;  1DTT B;  1DTQ A;  3KLI A;  1NJX A;  2VHG A;  1YBU A;  1WNE A;  1T0T V;  3T9N A;  4NXM F;  4KR0 B;  1VK8 A;  1HBN A;  3JSM A;  3K2Y A;  2ZHB A;  4YB6 A;  5THW A;  4P2S A;  1RWM B;  2BDP A;  4NA3 A;  2DNQ A;  4OX9 J;  1FDB A;  1BWV A;  1HYS A;  2IM1 A;  4GKK J;  1HPZ A;  4CLF A;  2YNG A;  5B09 A;  4Y00 A;  1SXL A;  3CCV S;  2PD1 A;  1N5Q A;  3T1Y F;  3AA8 A;  5JXS A;  4RPF A;  2D69 A;  2PMH A;  1JK9 B;  2NUH A;  5KT5 A;  2F4V J;  2JVO A;  4EEY A;  1RT7 A;  2PII A;  3H0P A;  2C3U A;  4YY3 J;  4A8M P;  2D3O R;  2XNR A;  1NM2 A;  2RB7 A;  4CO0 A;  1HHS A;  4YQW A;  1T9W A;  3MM8 A;  2GCF A;  2HQF A;  2HYI B;  2W1B A;  5KFL A;  5DQI A;  2B3T B;  4OV6 A;  1HQ2 A;  3EPI A;  4LR8 A;  4OZ3 A;  1X7V A;  4X4V A;  5HP1 B;  2ZM6 F;  4OZJ A;  2ASJ A;  3T41 A;  4USI A;  4N56 A;  2XS5 A;  2BAB A;  2DNO A;  2E44 A;  2DR5 A;  3H4B A;  5JJB A;  1RLD A;  1X9W A;  1S77 D;  4CLS A;  1CC8 A;  1C0T A;  1T03 B;  4A8K A;  1R0A A;  2D9O A;  2LEB A;  5KG2 A;  2R7S A;  4F26 A;  2CXE A;  1NAQ A;  1RHM B;  4FDF A;  3HF5 A;  2MZR A;  4JV5 F;  1PGZ A;  4DFK A;  3VCD A;  4ECX A;  4ETX A;  3MM6 B;  5J1N A;  4KRW A;  5ETR A;  1UW9 A;  4DSJ A;  3N0V A;  3DOL B;  1HWK A;  3IP0 A;  2BAN A;  2F9J A;  3QID A;  3QWP A;  2B9Y A;  4NEY A;  5A8R A;  3B82 A;  1WD6 A;  3LAN A;  1JLA A;  1HNI A;  1TP7 A;  2Z8Q A;  3FRZ A;  1DAX A;  2RDJ A;  4DSI A;  4M5D B;  1XC9 A;  3IO1 A;  2DHX A;  2ZIT A;  3FGV A;  3DLK B;  2OO4 A;  4L72 B;  1RT6 A;  2H1Y A;  1FEH A;  4DEZ A;  4RKU C;  3NG8 A;  3FMB A;  3C15 B;  4A4J A;  4J9P A;  2PO4 A;  3BBF A;  4DS5 A;  4KIA A;  3MTK A;  2CKW A;  5CCM A;  5KFU A;  3H4D A;  1HL6 A;  1UEK A;  4DUY F;  2Y1R I;  3T5J A;  3A8I A;  2W7O A;  2ADB A;  1SH3 A;  2CNK B;  2F63 A;  2H54 B;  2FHJ D;  2R7R A;  1S9G A;  3M2R A;  1OYD A;  4JI3 F;  1FEE A;  4OL8 A;  2H9Z A;  4X65 F;  2R7W A;  3DU5 A;  4LT6 A;  3RW7 A;  4DXL A;  2CQI A;  2FLO A;  3N6M A;  4O3P A;  3WX4 A;  2W9B A;  2M3D A;  2E5L J;  1RTI A;  2YVS A;  3TEG A;  5B0B A;  2HLT A;  1S12 A;  2XHW A;  2XM3 A;  2BJ9 A;  4ZPB A;  5CYQ A;  1ZTW A;  1FK9 A;  2FD2 A;  4F0M A;  4DOZ A;  4C3M A;  3PX6 A;  3TA2 A;  2GAH C;  4ZVR B;  3AQO A;  1IJF B;  4F25 A;  1EKR A;  3GCW P;  3SQO P;  4CT8 A;  3PTW A;  3BGR A;  1ZA1 B;  2ZOG A;  2OML A;  4DV0 J;  3H7H B;  1DY3 A;  4M8L A;  4NOH A;  3OD2 A;  3ZTP A;  3AOB A;  4NYP A;  3VQS A;  5E3A A;  1U4B A;  2BA9 A;  4YME A;  1SQE A;  1KP6 A;  3F73 A;  4J9Q A;  5A8K B;  1YDL A;  4IFY B;  2IDL A;  2FHJ A;  3PRB A;  4NLV A;  3GSD A;  3EDR B;  4P10 A;  3CME S;  1WF0 A;  4F2S A;  4LF4 J;  5KFZ A;  1QM9 A;  2N4D A;  2FJX A;  2HFZ A;  4FZV A;  4QWE A;  1H7X A;  2BE7 D;  1RBA A;  1FWK A;  3FUY A;  2W9C A;  2A2D A;  4DR2 F;  2VZ9 A;  2ABY A;  4K0K F;  2ZOF A;  5HAO A;  2CZV C;  1RT2 B;  3OHB A;  4WTY A;  5H9F J;  3U02 A;  5EGY A;  2CJK A;  5KT6 A;  3KG0 A;  1D09 B;  3LO3 A;  4HDG A;  2UUB J;  4JI2 F;  1BWE A;  1IM4 A;  3R6L B;  5LMU F;  5KFW A;  5ETM A;  3IG1 B;  3DKD A;  5IS2 A;  3R1H A;  2BBE A;  5KT3 A;  3NRB A;  4WK1 A;  4L73 A;  1R27 B;  2ZEJ A;  2JEF A;  2ROE A;  2C22 A;  3J7A N;  5CQG A;  3KYL A;  1FXD A;  1FFS B;  2WW8 A;  4LFA F;  4F67 A;  5GAD U;  2Z30 B;  2WVB A;  1SCJ B;  3BSN A;  4FXW A;  4I68 A;  3HHE A;  3TUJ C;  4CM0 A;  4CLU A;  4NYO A;  3TW0 A;  3MDF A;  1RT4 A;  3IMQ J;  1N56 A;  3W60 A;  1KOH A;  2CAD A;  2XLJ A;  2IVM A;  1M5V C;  2VFR A;  4RWW A;  1RAE B;  1HQU A;  5KFG A;  2DGW A;  2YWK A;  4A8O A;  3A3O B;  4I2P A;  5FDL B;  2EI5 A;  1HNZ F;  2SXL A;  3CC2 S;  3DHW C;  1Y7P A;  3VAH A;  1H0H B;  4TLQ A;  1L3U A;  3I5B A;  1I94 F;  1FRL A;  1N52 B;  2CQH A;  1SJF A;  1TL7 A;  2EFG A;  2HBQ B;  3TAQ A;  4DPW A;  1S1T B;  5KG6 A;  4DV3 F;  3TA1 A;  4ZCI A;  1RWW B;  1S7I A;  4UW2 A;  5A8W B;  3TQE A;  4DR6 J;  2F40 A;  2J7K A;  2HFN A;  2Z56 B;  1H7W A;  4G1I A;  3GYN A;  3LPE A;  2L9N A;  5MLC V;  4L3N A;  2GA7 A;  2Q66 A;  2IMW P;  4OI6 A;  3B4D A;  5HVG A;  3H59 A;  5J2Q A;  5F41 A;  3IS9 B;  3MTJ A;  2OTJ S;  3J81 Y;  3UDC A;  5KG4 A;  2FLP A;  3GYX B;  3NMR A;  3FKB A;  4C0B A;  4JI5 J;  1LWE A;  1TV6 A;  3QZ8 A;  2DIS A;  3CIM A;  4X66 F;  2GJI A;  3HX9 A;  4P7T A;  4DR7 J;  2WK4 A;  4Q2L A;  4PWW A;  4P71 A;  4WJB A;  3V4M A;  2J6T A;  4LF1 A;  3HKZ D;  2WON B;  1RWK B;  4U7U D;  1C0U B;  1N33 J;  4KAI A;  5A2Q U;  2ZHA A;  4AL5 A;  2ASL A;  2XGP A;  2XHC A;  4I4B A;  1A6L A;  1KNZ A;  3NGU A;  4C8O A;  4TU8 A;  1JIH A;  3MUR P;  2CRL A;  3R27 A;  4TXS A;  1M0S A;  2GNK A;  2FJE B;  4KPC A;  1FES A;  5K14 A;  2MZJ A;  2ADC A;  5U47 A;  3T19 A;  3M8P A;  1S4F A;  1E6V B;  1F5C A;  1UL3 A;  3GSI A;  3JTN A;  4FF4 A;  2KI2 A;  4KFB B;  3R7N B;  2EFP A;  2KO1 A;  3DGV A;  2J9C A;  3QLH B;  2AKW B;  2OEJ A;  2G0J A;  1CSJ A;  1T9V A;  4HYK A;  1BQX A;  3QMQ A;  2IBK A;  2E7V A;  2QGF B;  1U6F A;  1GAO A;  3N5F A;  2AF6 A;  1RCX B;  4NCG A;  1AT1 B;  2MJN A;  3TZW A;  4P73 A;  2LQ5 A;  2Z2Z A;  1HMV A;  1SJ3 P;  2NXN A;  3TAP A;  3PW2 A;  3ZXW A;  1FKO B;  5HLF B;  4MK8 A;  5G0R B;  5DLG A;  2ACY A;  1VRQ C;  2MZS A;  3HZE A;  2Y1I A;  2CPZ A;  2DRA A;  2XO6 A;  2OJ3 A;  2ZBP A;  3CJ2 A;  3EDQ B;  3UE2 A;  5M2U A;  3CCE S;  4Q8E A;  3MEE B;  2BR0 A;  3AXM A;  3DOK B;  4ETZ A;  3C46 A;  1Y11 A;  1FCA A;  1OMS A;  5DZ6 A;  3RB4 A;  2B4P A;  3I5A A;  2GQ2 A;  3I0S A;  5T7L A;  3VVU A;  5A76 A;  3FMW A;  5KG3 A;  1S0O A;  2GS8 A;  3BS9 A;  4DPO A;  1WC3 A;  4DUT A;  3P8B B;  4GKJ F;  3ENQ A;  2L41 A;  1YJW S;  4UOC A;  3D4J A;  2OI2 A;  1NDK A;  3QAT A;  3A13 A;  3CJQ A;  1NDL A;  3I56 S;  3KLH B;  3D6M B;  3PR4 A;  4C8M A;  4PKD B;  3PFO A;  2DNL A;  1TU0 B;  2RKI B;  2O3D A;  4LRC A;  3H5U A;  1HNW F;  1KLM A;  4GC7 A;  1HHT P;  4JI8 F;  5A6W A;  2XUL A;  1G3O A;  2HMI A;  4CI0 B;  3S1T A;  4DL2 A;  1BUX A;  3KLE A;  1CG2 A;  3C16 B;  5A0Y B;  3CC4 S;  3TJ9 A;  4M5I A;  3K58 A;  1U1N A;  4WP8 A;  1BXN A;  4OJH A;  3OJS A;  4IG0 B;  3CJ5 A;  3GTY X;  2AEF A;  2DPI A;  1GFW B;  2HNY B;  3BM7 A;  3RZA A;  2B4U A;  1IBM J;  3E01 A;  2VKZ G;  4C97 A;  1SIW B;  2LCW A;  3LAL A;  2XYH B;  2YXL A;  3GG0 A;  5HBM B;  2OPP A;  2LFV A;  3KK1 B;  1RLC L;  1YI2 S;  4ZKA A;  5KT7 A;  1RZM A;  2LDI A;  5KFF A;  2CJ9 A;  1XWL A;  2DEJ A;  4DL6 A;  3TR5 A;  3OTD A;  3KLV A;  1A7G E;  4RW4 A;  1T8E A;  4KPY A;  1CBK A;  4B3O B;  4IO9 Q;  5EWE A;  1S9E B;  4K4X A;  3DXS X;  4FNH A;  3A8J A;  5ADZ A;  3SCI E;  3KMS A;  2WW4 A;  2FHK A;  1HNV B;  2E1P A;  3W9H A;  1FXR A;  5AJ3 F;  4X4R A;  2DGX A;  2W4D A;  2FIU A;  1Q5V A;  1WF1 A;  3QRP A;  1UAW A;  1FRI A;  2YKN A;  2RT3 A;  4MYU A;  2AX0 A;  2AYG A;  2I38 A;  4DFP A;  2B6A B;  5HMX A;  1KFS A;  2LVW A;  2MEW A;  3S7R A;  1IKX B;  4PWU A;  4Q0B B;  3G2X A;  2YQ0 A;  3PW4 A;  4RUA A;  1U1K A;  1WC5 A;  1MRO A;  3OXF A;  3TUP A;  3PO4 A;  1S6P B;  4TYB A;  3LH2 S;  1HR0 F;  4OI1 A;  2EG2 A;  3ISZ A;  1DQA A;  1X9S A;  3IWN C;  4IQM A;  5HQL A;  3EVO A;  2RU9 A;  4HAC B;  1TL1 B;  1FTC A;  2MLY A;  2OEK A;  5EUH A;  3QNW B;  3KG4 A;  3RG6 A;  1U1P A;  5CA5 A;  5LMN F;  2UVV A;  5L1J A;  2FHO B;  3KUE A;  1SKW A;  4RNM A;  1D9F A;  1OS5 A;  1S4E A;  4ID5 A;  4WU2 A;  4J9K A;  1RJJ A;  2GIF A;  2DYA A;  2C2N A;  3PYE A;  1DBD A;  3R5G A;  2CYY A;  3UR3 C;  2MYF A;  3DMJ B;  4F4W A;  2DGS A;  5D8H B;  2A1B A;  1UVJ A;  1RWV B;  1CJT B;  1K44 A;  1RTD B;  4NCA A;  1RCO B;  2V8D A;  1K0T A;  1ZZF A;  2OD4 A;  2ZH4 A;  3SQG A;  3P3D A;  2G1H A;  4BWM A;  3PJ9 A;  1HI1 A;  3BPD A;  5K8N A;  3LWM A;  3SV4 A;  3OFE A;  1IR2 A;  1RT5 A;  3QIP B;  3NWG A;  3RBE A;  2DPJ A;  3UCZ P;  3W2V B;  4Z7C A;  1TAU A;  3NGK A;  4DSL A;  1L3T A;  5DG9 A;  2X1A A;  2UVW A;  1CUL A;  3M2U B;  3ZZY A;  2J0X A;  2BJ1 A;  1HBM A;  1YZ7 A;  1VFJ A;  4UTG A;  2F7V A;  2RQM A;  3R2D J;  3FZ2 A;  2ZZT A;  4NLR A;  5E3C A;  4F3Q A;  4UZB A;  3NBP A;  1RAB B;  4K2X A;  3C6U A;  1RGV A;  1YRU A;  1VQ4 S;  1VQM S;  1FD8 A;  2CJX B;  1LWC B;  2QEX S;  5AE2 A;  1Q79 A;  3SSR A;  1FRH A;  4P72 A;  3CJS A;  3UR0 A;  5ETK A;  1WHX A;  2MKJ A;  4WE1 B;  5B08 A;  3MR6 A;  5JUM A;  2OMO A;  3JSY A;  1F3F A;  1ICE B;  2XZT B;  3D0G E;  1FVQ A;  2N4C A;  1RTJ A;  4PG8 A;  1FJC A;  2V8H A;  1NK0 A;  5HI7 A;  4DV5 F;  3GZ7 A;  2N3O A;  3F56 A;  2DR8 A;  4FBT A;  1XNQ J;  5KFO A;  5K8O A;  2IMO A;  1NUE A;  1EJ7 L;  4UUW A;  4NLO A;  2R7Q A;  2Z58 B;  5F8I A;  1AXQ A;  4CYU B;  1NPK A;  2OPS A;  1C1C A;  4EI2 A;  5L9N A;  4ECU A;  2HND A;  3QT6 A;  2Y0S D;  2XMT A;  4OI4 A;  4DL7 A;  3AFG A;  2HQG A;  2FZC B;  2QE5 A;  3DRP B;  3LP1 B;  2JLG A;  2VQF J;  1WC1 A;  1VQ5 S;  4TN2 A;  5GVQ A;  1T05 A;  1HD0 A;  2F65 A;  3IBC B;  4USK A;  4CNZ A;  3QT7 A;  3OUY B;  2EC2 A;  2BKN A;  5IXU A;  2BVZ A;  2IYG A;  3DRR A;  2DH9 A;  1U1Q A;  4PWD B;  3K89 A;  2RRA A;  5AXN A;  1CC7 A;  2AZ1 A;  3OL6 A;  1VBY A;  4QZV B;  2GHP A;  2WTF A;  1KSP A;  1ZPV A;  4USJ C;  4KH1 B;  4ED4 A;  3T6J A;  1BD6 A;  3D28 A;  3BKU A;  1S1U B;  3GE9 A;  1FDA A;  1OY9 A;  5E3P A;  5KG1 A;  1X4G A;  4AUK A;  2QO3 A;  1FX2 A;  2JC1 A;  3CDW A;  2UXB J;  4YR2 A;  4DSF A;  2EFN A;  1XMQ J;  3DYA A;  4KV8 A;  4CP5 A;  2V9K A;  3TZX A;  3ZZT A;  1WG4 A;  2WRM A;  4I1T A;  3SDE A;  1QDU B;  4JI1 F;  3IAS 9;  4DWI A;  1DJ0 A;  4RW9 B;  2UVU A;  4PXB A;  2KB2 A;  2R2T A;  3L7O A;  4F4X A;  3GR0 A;  3FCH A;  4O44 B;  2C3M A;  3AA9 A;  3WHI A;  2VDI A;  2ZH8 A;  1S10 A;  3MMB A;  1IVZ A;  3R5B A;  3MED A;  4B17 A;  3JAM Y;  3WC0 A;  2DKO B;  3EXY A;  3KFW X;  2FTR A;  1AZS A;  2QSW A;  4F0K A;  3UO0 A;  5E7O B;  2JC0 A;  2BE2 B;  1J5E F;  1CJU A;  2C42 A;  1EET A;  1RWN B;  5DRK A;  3FVY A;  1T02 A;  4ZPV R;  5CYM B;  2DR7 A;  4NLG A;  4R5P B;  4MAK A;  3H98 A;  2P9C A;  2UUC F;  1ZYQ A;  3V6D A;  1NH7 A;  1X4C A;  1H74 A;  1YK9 A;  4ZN3 A;  6FDR A;  3RBX A;  1V9O A;  2OTL S;  2Y0B B;  3BGO P;  4ZHR B;  4ZP8 A;  4IDK A;  1JLF B;  4LF8 J;  5DDQ C;  1VLO A;  2XYP B;  3LP0 A;  3TAM B;  3N6N A;  2YKP A;  4U7U K;  8ATC B;  3ZFV A;  3ILL A;  3KHR A;  2APO A;  2UU9 F;  5D77 A;  1FJ7 A;  2BZ2 A;  1JKH B;  1DRZ A;  1D8Z A;  3GFX A;  5DM6 Q;  2XCP A;  4WFB Q;  3W3S A;  1EAY C;  4NA1 A;  5DJB A;  1GMU A;  1W26 A;  1EIY B;  5F3T A;  4C6A A;  1GTH A;  2EWH A;  2XQC A;  1FWL A;  1XK8 A;  4H54 A;  2IFX A;  3W5Z A;  1J5O B;  2NR0 A;  3VR1 A;  4LF7 F;  4PXC A;  1F5B A;  4X4T A;  1CPZ A;  2B43 A;  2XNQ A;  1S97 A;  3DLE B;  2CQ1 A;  2HBZ B;  5D4N A;  1XMO J;  4N5S A;  2FHM A;  3TA0 A;  3LGM A;  3Q8Y A;  1VHF A;  4LRA A;  1C2P A;  2XMM A;  1KLN A;  1VQY A;  2FY8 A;  1NSQ A;  2ZH6 A;  1Z2L A;  4FKX A;  3HD2 A;  1N34 F;  2QLJ B;  2GMJ A;  3V81 A;  3G96 A;  2VPY B;  5L39 A;  2ZE2 A;  2VFU A;  3JQK A;  2JL9 A;  2MHN A;  2RF2 A;  3G6V A;  3EYZ A;  3PW7 A;  3MAH A;  2NS1 B;  2QL5 B;  2J8S A;  1NKE A;  4WII A;  2CQ2 A;  2DHG A;  3QRQ A;  2FC8 A;  4KGX B;  2HEK A;  4KHR A;  2MXY A;  3HSG A;  1H38 A;  4AYB D;  4WP3 A;  2QA2 A;  3PKY A;  2UV8 A;  1ROF A;  3MMC B;  1X60 A;  2D74 B;  2KHD A;  3MM7 A;  1KVK A;  1LK5 A;  2C3Y A;  4J91 A;  2YNF A;  2B5J A;  1F6T A;  4CT9 A;  2VKR A;  4DUZ J;  3EZO A;  4EWT A;  2RE1 A;  4JV5 J;  4I2Q A;  3LP2 B;  1RHQ B;  2DBB A;  4W4M A;  4IRC A;  1REV B;  1BY9 A;  4OZL A;  2MQM A;  4C48 A;  3ADA C;  3OHA A;  2QFI A;  2ILY A;  4NXN F;  2J9D A;  1FRJ A;  4BS2 A;  1S79 A;  4YN3 B;  3BSO A;  1R8A A;  4DV1 F;  3C6T A;  4LF9 F;  2KZZ A;  1HAR A;  4YDD B;  3KK3 A;  2ZD1 B;  1VQL S;  4JV1 A;  4KO0 A;  5KFN A;  1HWI A;  1YVF A;  3I9V 9;  3AD7 C;  1QVF R;  2RH3 A;  2R8J A;  4ZVO B;  2VU5 A;  1H3D A;  1NK6 A;  3KJF B;  2NCK L;  3PRD A;  4EZ6 A;  1ZA2 B;  1WSR A;  4QR1 A;  1LOU A;  1SH2 A;  3GMG A;  5E2Q A;  4LF5 F;  2HNZ A;  3PX0 A;  3UD5 A;  1UPM B;  2KTQ A;  4TYA A;  5FLX U;  1JLC B;  1N5Y A;  1TK5 A;  3HXM A;  4X65 J;  1RBL A;  1WHV A;  4YDX A;  3W2W A;  4PUO A;  2ZHO A;  2C2Z B;  1JLQ A;  1HBO A;  1YG0 A;  4TQS A;  3GIM A;  1NDC A;  4KY3 A;  4HEA 9;  1UFK A;  1QLN A;  1AFI A;  3SFG A;  2FVC A;  1XEZ A;  1M5P C;  2PC6 A;  3W8G A;  4IKA A;  2NZ4 A;  3W9I A;  1ZZN A;  4AQY J;  2CDR B;  4YP3 A;  4IOC Q;  1OSC A;  3BR9 A;  2BUN A;  4U96 A;  3ITH B;  2MQP A;  2D3O 1;  4O0I A;  5J2P B;  4ECT A;  4PCQ A;  2GZO A;  3NGR A;  4WKY A;  1BQM A;  4NI2 A;  4I69 A;  4ENO A;  2AU0 A;  2HKE A;  3BH6 B;  3TAR A;  1UPP A;  1J27 A;  4K2J A;  2FUG 9;  1S1X A;  1JNZ B;  1HQE B;  3A12 A;  2VG7 A;  4WP9 A;  1SPB P;  2P9G A;  3GWC A;  4RBT A;  1U0H A;  5J1E A;  2EW9 A;  3MWB A;  3R5A A;  3PAC A;  1TL3 B;  4H4M A;  3J7Y U;  4OIX A;  5HL7 Q;  2E5J A;  5IV4 A;  2XSF A;  3GFH A;  2CPH A;  4DV6 F;  4LRE A;  2FVP A;  2M8H A;  2V34 A;  4DR3 F;  1UFL A;  1SC6 A;  3RW6 A;  5CD4 A;  1RA6 A;  2BMB A;  3F44 A;  3MAQ A;  4ZIW A;  1NK8 A;  3L7U A;  1WC4 A;  1IBK F;  2DXD A;  4X4S A;  2GO8 A;  2OD6 A;  3M6X A;  1OY6 A;  3MF5 A;  1BHN A;  4HT5 A;  1N6Q B;  3KJV B;  2XCA A;  3IR7 B;  1EB0 A;  1H2V Z;  4MFB A;  3QO9 B;  1KOO A;  1RTH B;  3OXG A;  4F3M A;  3J7A 1;  7AT1 B;  3A3N B;  1N5T A;  3QZ7 A;  1Y3J A;  2DR9 A;  1O8B A;  6AT1 B;  1CVJ A;  2IJR A;  5ITH A;  4I64 A;  4QIG A;  1JLE B;  1X8D A;  3PJW A;  2MZQ A;  1DQ8 A;  4CO1 A;  1SKR A;  3HVT A;  3MPD A;  1IKW A;  1YBT A;  4RW8 A;  1MWQ A;  2CJQ A;  5IT0 A;  3KOA A;  2HBY B;  4E2F B;  1UFW A;  5GMK a;  3NOC A;  4DX8 H;  4WYL A;  4XDD A;  2BKP A;  1PJ5 A;  2QN6 B;  2W2N P;  3R7B B;  1RQ0 A;  4KGV B;  2NSC A;  1F5A A;  2MQN A;  4LFB J;  4CWB A;  1ZAW A;  1FJE B;  4LSZ B;  2W4C A;  1F0X A;  2A10 A;  1WKJ A;  4DN9 A;  2OHD A;  2C28 A;  4ZOS A;  3HHK A;  3AXK A;  1PAU B;  4LFC J;  4ZLP A;  3D7S B;  1M90 T;  2XY6 A;  1S1W B;  1BQN B;  1DLO A;  2BM1 A;  3K5P A;  1Q8B A;  4BBY A;  3P49 B;  4URS A;  4DHV A;  1GX6 A;  3M1V A;  2JOQ A;  3NEK A;  3B6B A;  4IFV B;  2HQI A;  4ILR A;  3IRW P;  4KGK A;  4IH5 A;  1RKJ A;  3HSJ A;  4HLB A;  4LVN P;  3MPY A;  2HGN A;  1LW0 A;  3LAK A;  3DHX A;  3ENA A;  1H73 A;  3QRR A;  1N5S A;  1DTQ B;  2YY3 A;  3KLI B;  4BCA A;  2GVZ A;  4K8R A;  4O3Q A;  1T7P A;  2HRY A;  3JTO A;  4DV3 J;  4NPO A;  1HBN B;  2W24 A;  2ASY A;  3KNA A;  1O51 A;  1ZS6 A;  1UVI A;  4QJV A;  2IRX A;  2V2K A;  4OYA A;  1MLA A;  2KRR A;  4QR0 A;  3L7P A;  1VBX A;  3DLJ A;  4FYX B;  4ICL A;  5HP1 A;  1HYS B;  3TJA A;  1HPZ B;  3CTR A;  3H5S A;  3R8Y A;  2YNG B;  3HSZ A;  4Q2M A;  5KFR A;  5KFE A;  1B4S A;  4XK8 C;  4B3T F;  5F9N A;  4DPU A;  1P1T A;  5D0R A;  1BGX T;  2WSC C;  5F8L A;  3K8W A;  2JEG A;  1ZBT A;  3UNY A;  1PC4 A;  3TUZ C;  4IR9 A;  1RT7 B;  2N82 B;  4K4S A;  1YX2 A;  4JI4 J;  2XY5 A;  4F0H A;  3OBI A;  3MM8 B;  2OLW A;  1X5S A;  2J7U A;  3ZZO A;  4MKB A;  3AH6 A;  4A8F A;  4H4O A;  4E8U A;  2XTJ P;  4AXJ A;  4USV A;  5CXT A;  1MSW D;  1TUW A;  1RWU A;  2K1R A;  4DR5 F;  2YX7 A;  3OLB A;  1U1R A;  3HHD A;  3QJP A;  2NYH A;  3I96 A;  3G6Y A;  1NHK L;  1VC0 A;  2V8G A;  2B51 A;  1FE0 A;  4FF2 A;  1KD1 T;  1YRX A;  1C0T B;  1Z1Z A;  5DZ7 A;  1HHQ A;  3GU0 A;  1SL2 A;  2YH1 A;  3BH7 B;  5IC6 B;  2R7X A;  1NJI T;  3TAN A;  4ECQ A;  3IWL A;  4ATN A;  4Z7Y A;  3MAA A;  1XBW A;  1RKI A;  1JJC B;  2BAN B;  3CCQ S;  3RB0 A;  3MPW A;  1S76 D;  5A8R B;  4Y28 C;  3RGI A;  4RNF A;  1JLA B;  1HNI B;  1WOR A;  3AJD A;  4PAA A;  2XLI A;  1P9Y A;  2IAJ B;  4Q45 A;  3NP5 A;  3HHL D;  4BWJ A;  4LF6 F;  4CRJ A;  1S59 A;  3DCA A;  2MST A;  3FNN A;  1HW9 A;  1MMD A;  2VFT A;  1RT6 B;  1URR A;  3LTO A;  2OSR A;  1VRU A;  3OLA A;  1IR0 A;  2DO4 A;  3GFZ A;  4OLO A;  3JQM A;  3M2V A;  4YEA A;  5IT4 A;  2UXD F;  2NXE A;  2E5H A;  1WEZ A;  2XS2 A;  1L5U A;  1RAH B;  2JEJ A;  1N54 B;  1NPR A;  1YHQ S;  3DM2 A;  1UKU A;  2KG1 A;  4JI0 J;  3US5 A;  1RIS A;  2VON A;  1S9G B;  3M2R B;  4RUC A;  3KLG A;  3W64 A;  1OYE A;  3VGS A;  2HBR B;  5D4L A;  4KKO A;  3LPY A;  2MKH A;  2QL7 B;  4MTP A;  4QYZ K;  2HHS A;  2M70 A;  2W9B B;  1U26 A;  3LF0 A;  2V2V A;  2PA8 D;  3PXG a;  1RTI B;  2X1B A;  2HW3 A;  5B0A A;  2AJQ A;  1TL4 A;  1HNW J;  3RRG A;  4JI8 J;  5C25 A;  3NGS A;  5CYQ B;  1T95 A;  2CWK A;  2H51 B;  4NLP A;  1Q16 B;  1FK9 B;  1HD1 A;  4JI6 F;  3HHL A;  4ED2 A;  4L6V 3;  2KFY A;  2XG8 A;  4I0W A;  1F2G A;  2ACM A;  4NWB A;  1IBL F;  2EVZ A;  2E1R A;  2G9O A;  3ETM A;  1ELO A;  1PBU A;  1S0M A;  2X1F A;  5B0D A;  2QIF A;  2YQ3 A;  3BGR B;  2V50 A;  9RUB A;  1Q7L B;  2HUR A;  4ZCM A;  2RHS B;  1UVK A;  3P96 A;  2KN4 A;  3RRH A;  3MCO A;  1PBA A;  1FJG F;  1V3R A;  4FBU A;  2PE8 A;  1I1G A;  3TVZ A;  4YUD A;  1N36 F;  3OW2 R;  1FDN A;  4EGL A;  3C8Y A;  1B0V A;  4RUH A;  1U25 A;  1ZTT A;  2QL9 B;  5AJ3 J;  2HVI A;  3H40 A;  2MGZ A;  3L95 X;  3D54 A;  1B7Y B;  2HHH J;  2W9C B;  5DQG A;  3PKM A;  2K8G A;  4WFN Q;  1NDP A;  2E7X A;  3C14 A;  1X4F A;  5I42 A;  1HNX F;  2B0G A;  2XS7 A;  4N76 A;  2RDI A;  3BRE A;  4B3R J;  1R7I A;  3Q8P B;  3U1L A;  4LRB A;  1XMB A;  2DTJ A;  2HHW A;  2CVE A;  3H2V E;  2I2Y A;  2HQD A;  1TFY A;  5DDR C;  2MQQ A;  5J1P A;  1AW0 A;  1PKU A;  1FNM A;  1XNR J;  3T1H F;  3GPA A;  3CCJ S;  2RQ4 A;  1MG7 A;  2ZH7 A;  4B3M F;  4K4W A;  1NJZ A;  4RR5 A;  1U24 A;  4G1P A;  3SIP B;  1XTZ A;  1U8S A;  3CCT A;  4J9R A;  4E0D A;  3NLC A;  2FPH X;  1DQ9 A;  5HVH A;  2Y9H A;  4O23 A;  1JJH A;  1YJ9 S;  3HHN B;  2ALY B;  2RIL A;  3CUL A;  4OX9 F;  1N32 F;  4ECY A;  2HFU A;  1ZAV A;  1H2T Z;  4PRF A;  4GKK F;  2WBR A;  4PXD A;  1RT4 B;  2XBP A;  1GK8 A;  4CO5 A;  3G82 A;  4OYO A;  4G3I A;  2W2Q P;  1BE4 A;  5EX0 A;  1TEL A;  4Y2I A;  2MHE A;  2RU3 A;  1NZA A;  3J81 U;  4WF9 Q;  3HD1 A;  2F4F A;  4I2P B;  2GW8 A;  4KSE B;  1KEK A;  1MWZ A;  1ZPW X;  1DFD A;  4EO6 A;  5KFT A;  5C24 B;  1KFD A;  1QTN B;  2IRY A;  2HFO A;  1TL7 B;  4OI2 A;  2KL8 A;  2RUS A;  1PIL A;  2B8Q A;  4TU9 A;  4RJV A;  1WKL A;  5GAG U;  1S6U A;  1X31 C;  5B0C A;  1NHU A;  2WCX A;  3D3C J;  1PSD A;  4F04 B;  2BAC A;  1YJ7 A;  2NXJ A;  4IH7 A;  2NUU G;  3NS6 A;  2OFG X;  4QW8 A;  4Q44 A;  3SCK E;  5J2Q B;  4ZVH A;  2NSB A;  1FNO A;  3HFK A;  1LWE B;  1LKZ A;  1RYS A;  1TAQ A;  1TV6 B;  2O1P A;  2BW7 A;  3CWJ A;  3QLH A;  2XWX A;  3Q2T C;  2HZC A;  3OTO F;  1SKS A;  3I82 A;  3LGN A;  1ZM2 A;  4NL5 A;  2YBV A;  1VLY A;  3RTV A;  1ZM9 A;  2RS2 A;  1NKC A;  4KJI A;  1JLB A;  3W66 A;  3M30 A;  4V19 X;  4KB7 A;  3RUB L;  1IKV A;  2ZUG A;  4KGZ B;  2LXI A;  3CB4 A;  3HMJ G;  4ZCL A;  5G4D A;  3UD4 P;  1X4H A;  4DZ6 A;  4N8O A;  4ZJL A;  2R7U A;  4DV5 J;  3R5J B;  4GVB A;  1UCN A;  3NAI A;  3DLG A;  3GLJ A;  2CQC A;  2P8I A;  2M88 A;  2JVR A;  4DU7 A;  4X64 F;  3M8P B;  4G6V B;  3HT0 A;  2V4Q A;  2VC1 A;  4JP8 A;  1MNE A;  1JXV A;  1NK9 A;  1FD2 A;  4CTA A;  2XI2 A;  2WB1 D;  4OJ1 A;  1CJV A;  3VWS A;  1R3N A;  1VS3 A;  1TUG B;  4PEO A;  4J9O A;  1WOP A;  4OYX A;  4J9N A;  4RL1 A;  4ZPW R;  3V5R A;  3TX8 A;  5BR8 J;  3L3C A;  4C0H A;  2HRT A;  3FCW A;  2VPW B;  4OYM A;  3UDL A;  4W98 A;  2Q79 A;  3IWX A;  1R8B A;  2WSE C;  4OZN A;  4NE9 C;  3NCR A;  1I51 B;  1T94 A;  3UDE A;  4ILL A;  4I6A A;  3DDI A;  4R0J A;  4F7V A;  1HMV B;  3DRS A;  3UD3 P;  4ES2 A;  3LWL A;  2ATL A;  1SJR A;  2R2R A;  1ARO P;  1RT3 A;  4LBH A;  3A3P B;  4V19 J;  2E5L F;  3CJ8 A;  1NK5 A;  5CAB A;  3VAL A;  5J2M A;  2C2E A;  2Q3P A;  2AIR B;  3FQL A;  5C7P A;  1C1B A;  1FTR A;  2YWF A;  4CLW A;  3EWG A;  1S0V A;  4N47 A;  5LJ5 Y;  3CMA S;  1JQG A;  1L3K A;  4DCJ B;  3L9Z A;  2P6S A;  3CCZ A;  2MLX A;  5T7L B;  3BYR A;  4FVC A;  2XWY A;  5B0G A;  2OFH X;  3K17 A;  2VG5 A;  2V4J A;  5GAE I;  1HKA A;  5LSO A;  3PIP Q;  3ILI A;  2ZJQ Q;  3BGF A;  3J7Z T;  4DV0 F;  4G1Q A;  1TKX A;  3PYF A;  4C9D A;  1N0V C;  2IIH A;  1YJN S;  2KXF A;  3LUY A;  2OAU A;  3NS7 B;  4I6W A;  2VOO A;  1VBZ A;  1FVS A;  3EUN A;  1VIO A;  3GV7 B;  1BC6 A;  2AV5 A;  3BGU A;  4EZ9 A;  4B08 A;  1RU1 A;  2MMY A;  4OFZ A;  4QWA A;  3K8V A;  1R0C B;  3EGN A;  1PYT A;  1FKP A;  4XTT A;  1KLM B;  4LF4 F;  4DR1 F;  1HNV A;  2HMI B;  1NB2 A;  3KLE B;  4TQR A;  3FBF A;  3HSD A;  1FRX A;  3CJK A;  3A4T A;  4WYW A;  1SC3 B;  1RAC B;  4X4P A;  3GG1 A;  2KU7 A;  4WFY A;  3GJT B;  3CJ3 A;  4WBF A;  2BJE A;  3E01 B;  4ZLJ A;  1OIA A;  2FYX A;  1SV5 A;  3HKW A;  1ZOT A;  3RR8 A;  3CJ0 A;  2OPP B;  2UUB F;  5ETQ A;  3QT8 A;  2GML A;  3CW2 C;  1SC1 B;  3I6P A;  1H6K X;  2BOP A;  4RW4 B;  5KFQ A;  1V6H A;  4RWX A;  2FGC A;  4RW7 A;  5GAH I;  2EC0 A;  1HWU A;  1O6X A;  5E3R A;  1RE1 B;  1KQG B;  1R0B G;  4KHP F;  1JB0 C;  1MML A;  1RI7 A;  3CE8 A;  3AOD A;  4OQJ A;  1LWF A;  1IJE B;  2B4V A;  2YKN B;  2LEA A;  1YLX A;  1PAE X;  4LSL A;  2QA4 G;  3TOQ A;  1FE4 A;  3TI0 A;  4DX5 A;  1S5Z A;  3OVA A;  3ET6 A;  4JV0 A;  4AE5 A;  1WEX A;  2DK2 A;  3L4B C;  3CDA A;  2AHO B;  2EK6 A;  1P27 B;  2YX4 A;  1FNX H;  2D9P A;  1XER A;  2HZV A;  3M9N B;  1MRO B;  3P45 B;  2H4Y B;  4CQ1 A;  2E5G A;  1I6J A;  3TNV A;  4DV2 F;  4EBC A;  3PV8 A;  3PZP A;  2IVF B;  2DRD A;  1XN9 A;  1IXK A;  4A46 A;  3U7J A;  2RUG A;  3EXC X;  3ILO A;  2ZNY A;  4ZP6 A;  3T6B A;  8RUC A;  4W90 B;  4Z2X A;  5F9L A;  1VJQ A;  1RHR B;  4YS2 A;  4ID5 B;  2OPQ A;  4DBQ A;  4DF8 A;  2AYE A;  4NLY A;  2HAI A;  1HBU A;  2YKO A;  4BC9 A;  1VC6 A;  1TUV A;  2DNN A;  4JI7 J;  3UCG A;  4RNH A;  1R6V A;  2E1A A;  4GO5 X;  4DR7 F;  4XPE A;  1U49 A;  3W5X A;  2DVI A;  1SVD A;  3SQG B;  4FXD A;  4WTO B;  1N33 F;  2AYM A;  2HS3 A;  4JV2 A;  4WE1 A;  3G71 S;  4MKV A;  1NSP A;  1VQ7 S;  3PEJ A;  3PW0 A;  4HH0 A;  4NYZ A;  2W7A A;  1RT5 B;  5E33 A;  3SBM A;  4DQI A;  4NXN J;  4NEZ A;  2LEP A;  2R7T A;  2CQ3 A;  3R6G B;  4F2R A;  2PN6 A;  3UNG C;  4ZP9 A;  4RW6 A;  1CUL B;  5CD4 H;  4PG4 A;  2J6S A;  3OVB A;  4A8X A;  1HBM B;  1VRT A;  2QX0 A;  5DDO C;  1WTF A;  3DC2 A;  3OTB A;  1MU2 A;  1TL5 A;  2OIH A;  1R43 A;  3D2W A;  1QAI A;  3NBP B;  1S49 A;  3C6U B;  2BJ7 A;  2MDA A;  1RAJ A;  5KFC A;  3R2C J;  4Y3C A;  2M52 A;  4RZR A;  3FSX A;  4PXE A;  2LLZ A;  3SFU A;  3ZTS A;  2MSS A;  2LEC A;  1JMT A;  3B54 A;  4WIQ A;  2Z0G A;  4Q8F A;  6FD1 A;  2XYG B;  2KH9 A;  3WIV A;  3QPI A;  3H90 A;  4NX9 A;  1FDD A;  4OHY A;  2QA4 S;  5I4M A;  1X5P A;  4OYZ A;  4LVO P;  1VIS A;  3WC2 A;  1QSY A;  1UWB A;  1NEE A;  1RTJ B;  4FS1 A;  2WOM A;  2CQP A;  4A8Y A;  3VAF A;  4YHH J;  2Z2Y B;  4Y2K A;  2EPI A;  5KTQ A;  2RSQ A;  3QSI A;  1RA7 A;  4X84 A;  1VDH A;  2B9E A;  3AOC A;  3RR7 A;  2L08 A;  5JVG Q;  2R8G A;  4CH0 S;  3UPF A;  2YKM A;  2ZZN A;  2BJD A;  4JYA J;  4MKY A;  3Q24 A;  3UVJ A;  1RT1 A;  4YB1 P;  2OPS B;  2HND B;  5LJ3 Y;  1T9X A;  2YX1 A;  1VC5 A;  3MEK A;  3KUG A;  1S6Q A;  4G65 A;  2M4M A;  1T05 B;  5IC4 B;  4O4R A;  5F8M A;  1VYA A;  2GVD A;  3UQS A;  2X3G A;  3FSI A;  1TMJ A;  3OJU A;  1KVI A;  4J37 A;  3K59 A;  3DRR B;  5AE3 A;  3JSR A;  2YWH A;  4C8K A;  2QTW A;  3FEY B;  1S57 A;  3IBW A;  3VV2 B;  3IBF B;  2J0S D;  3JAM U;  3MD1 A;  4CZC A;  4WFA Q;  2KDO A;  3SMZ A;  2BE2 A;  2UUW A;  4ILM A;  1MWY A;  4OX6 A;  4UF4 A;  4DF4 A;  5L9X A;  4DS4 A;  4ED6 A;  1GXU A;  4DL3 A;  3AAW B;  3MUM P;  5E0O A;  4ID8 A;  3JQJ A;  4ES3 A;  2AP6 A;  1UJ4 A;  3LW5 C;  3AHP A;  2XC9 A;  3DYA B;  3MR2 A;  2F8H A;  4KV8 B;  3HVR A;  2PGC A;  4IOB A;  4J7C A;  5DQH A;  3KDO A;  2ZJP Q;  3SDE B;  3MMA A;  3TRG A;  2HZA A;  4IOA Q;  1IBM F;  4USW A;  3M9O B;  2QLB B;  4ECR A;  2V5H G;  4CLP A;  2LQJ A;  5AE1 A;  5SUH A;  3CCM S;  3MMB B;  3K5M A;  3MED B;  3IAM 9;  1AZS B;  4QBU A;  1CJU B;  1EET B;  4K4V A;  2PEB A;  1HA1 A;  1WEY A;  5MAO A;  2DIT A;  2YNI A;  5L46 A;  1SQG A;  3PDN A;  3RU0 A;  2EBG A;  2VBZ A;  4DL5 A;  2YWE A;  4PZV A;  2DD8 S;  5CHC B;  3M8S A;  3V6D B;  1Q8I A;  1DZ5 A;  1TR0 A;  2QLW A;  4D3H A;  5KFP A;  2JNJ A;  5KG7 A;  4MK9 A;  5E5N A;  1RHU B;  4H4K A;  4ECW A;  4O3R A;  3THT A;  3EIC A;  4LR7 A;  1EQ0 A;  3SSQ A;  2CA9 A;  4IDK B;  3DLE A;  3U1M A;  2HHP A;  1G4C A;  3VAG A;  3LP0 B;  3CSK A;  3HFV A;  1LW2 A;  3O2I A;  4HI2 A;  2FY1 A;  2VV5 A;  2CAJ A;  3BEG B;  4QQB A;  4ECV A;  4MK7 A;  2CUY A;  1QVG R;  4A8W A;  2GAG C;  2CDQ A;  4OHV A;  4S0M A;  1RSC A;  5D3G A;  2YPY A;  3NXZ A;  3ZNJ 1;  1Y3K A;  1IKY A;  4DU8 A;  2EFV A;  1IQT A;  1KN6 A;  2A0F B;  3MGJ A;  2JX2 A;  4PYD A;  1JNR B;  2O5D A;  4DV7 J;  4X4N A;  2BEF A;  3VGU A;  2FDN A;  4LRF A;  4ZP7 A;  2K06 A;  1MN7 A;  2VIC A;  5B0F A;  5B0E A;  3R9L A;  3IA0 A;  2XZD B;  1GEH A;  2DIV A;  4EMD A;  1CS4 A;  3MEC B;  2Y1J A;  1UTA A;  1U2F A;  3GYG A;  2CWX A;  3X3U A;  3BQ1 A;  1QTM A;  3IM9 A;  1S1V A;  4B3T J;  3HHL C;  1FXL A;  2LMI A;  5KT2 A;  3EZ5 A;  4ZJO A;  2IHR 1;  2N3L A;  5JMN A;  3V81 B;  4ZS6 A;  3M32 A;  3GQC A;  1T9T A;  3K5L A;  3E2E A;  1S7H A;  3OR1 B;  2MKS A;  3TWZ A;  4ZVP B;  1NND A;  4DX7 A;  2DNZ A;  4C98 A;  2BKO A;  4PPD A;  3A8E A;  2ZE2 B;  3CJT A;  2CZ9 A;  4M63 A;  2EK1 A;  2RF2 B;  3PW5 A;  2OPR A;  3MR7 A;  4OZ2 A;  2MY7 A;  5L1I A;  4TNO A;  1J2V A;  1FX4 A;  4RNO A;  4J9S A;  3N79 A;  5AXL A;  4UQG A;  4AL7 A;  1AUS L;  3NAH A;  1VQ9 S;  2KJV A;  1B64 A;  2ZD1 A;  1REG X;  2ZBI A;  1Q5Y A;  5EHH A;  2DIU A;  2E29 A;  3OVS A;  3MM7 B;  1KQF B;  1X9M A;  4A48 A;  3WX8 A;  4PQA A;  2YNF B;  5KG0 A;  2B5J B;  1TK8 A;  3FCV A;  2GO9 A;  4NRU A;  1CQM A;  4ZVQ B;  3PVX A;  1NO8 A;  1PYO B;  4MYT A;  4I2Q B;  3KK2 A;  1FA0 A;  2BW2 A;  2ERR A;  1N0U A;  3GP9 A;  1KR4 A;  4QCL A;  3GIL A;  4URG A;  1F1B B;  3GV8 B;  2AEM A;  1VQ8 S;  3HI9 A;  1OPI A;  3KHH A;  1LK7 A;  1TKZ A;  3C6T B;  3G6X A;  2RDD A;  2QSF A;  4USH A;  3HZG A;  7FDR A;  1NB7 A;  4LF2 A;  5C2C A;  1U45 A;  3KK3 B;  3W7B A;  3Q83 A;  2F3J A;  2C2M B;  1U1M A;  4LF6 J;  2XI3 A;  2ZWP A;  4KO0 B;  1Y5L B;  2C2D A;  1Q0N A;  1JWW A;  3GJS B;  2O67 A;  2RML A;  3BO3 A;  1SUQ A;  1BMQ B;  4L74 A;  4O0N A;  4J9V A;  1PC5 A;  1M5O C;  2UXD J;  2VQF F;  2BOA A;  2R9L A;  4R8U A;  4EYI B;  1JLG A;  1S0N A;  3F0N A;  2BV3 A;  4DV4 J;  3VAI A;  2I0X A;  2QLF B;  3LOU A;  1SKU B;  1WWH A;  1I5O B;  2CPX A;  2GFF A;  1GT8 A;  2E9T A;  1N5Y B;  2DNM A;  1PCA A;  3D68 A;  3KNG A;  4ZVS B;  3W2W B;  3LQV A;  4PUO B;  1KTV A;  3D6T B;  1JLQ B;  1HBO B;  2J5A A;  5KG5 A;  1XQI A;  4J9U E;  1RBO B;  2H48 B;  3CMQ A;  2U1A A;  3VAM A;  3NGD A;  4XIU A;  4AFF A;  1VQN S;  3TO8 A;  1D9A A;  4NAS A;  2IA0 A;  2ZH2 A;  2UXB F;  1XMQ F;  4JI6 J;  4OZ1 A;  4PAB A;  1B3T A;  2QMU B;  1A0O B;  5C5J A;  1G1X A;  3V4I B;  1IBL J;  1AUD A;  1TVR A;  4IG3 A;  2GHV C;  3C19 A;  4M5L A;  1BQM B;  4P74 A;  4NLW A;  2GQQ A;  3R5C A;  1D0E A;  5F0W A;  3D3B J;  2B8P A;  1S72 S;  2ZBQ A;  3G4S S;  3EVW A;  2ZFH A;  1S1X B;  1AYE A;  3DGP B;  2QG9 B;  1ZET A;  5H9F K;  3P6Y C;  2VG7 B;  4IUF A;  3K0J A;  3NNC A;  4F4Y A;  1WOS A;  1FJG J;  3DOM A;  5C42 A;  1U0H B;  5J1E B;  2WAQ D;  4C11 A;  3EJM A;  4H4M B;  2IYI A;  1N36 J;  5D0H A;  3M8Q A;  1NKB A;  5J2N A;  2N7C A;  5M2P A;  1FWP A;  2XMU A;  5L1L A;  2HK2 A;  2DR6 A;  3N9U C;  5BYS A;  3H8Y A;  4DMZ A;  5D0E A;  2KHC A;  3P5B P;  4OYW A;  1QAJ A;  3OR2 A;  2F1F A;  1RK8 A;  1O0P A;  4CLL A;  3BDP A;  2IJN A;  2JLF A;  4DCP B;  3CDU A;  1IR1 A;  2I5J A;  2NRE A;  4MFB B;  4I67 A;  2HHT A;  1S1W A;  4MIA A;  1XR6 A;  2UXC F;  1N8R T;  1YTY A;  2DT9 A;  4I7F A;  3ELH A;  4CM2 A;  4KHM A;  4UOH A;  4LBP A;  1SL0 A;  4HHJ A;  4IFV A;  2VG6 A;  3HVT B;  1IKW B;  4RW8 B;  2F5G A;  1TKD A;  2V63 A;  5LXR A;  1JXL A;  1GXT A;  4PG5 A;  4B3M J;  3ENW A;  1LXJ A;  2LU2 A;  2G13 A;  4F36 A;  5HK4 A;  2FC9 A;  3UI3 A;  4AL6 A;  5D0G A;  4ZDN A;  1U7L A;  3ISN D;  4NLU A;  3RB3 A;  2AEJ A;  2OUG A;  3U1N A;  2V4R A;  4IO1 A;  4B3S J;  1TFW A;  1N32 J;  3VAJ A;  1Q81 T;  4FNI A;  1NPP A;  4K5S A;  2H5E A;  3I9Z A;  3J7Z 5;  1GNK A;  1XMO F;  1NH8 A;  3R5D A;  4NA2 A;  2DXF A;  1DLO B;  2BYC A;  4PQU A;  1ZM4 A;  3D6F B;  2J6U A;  5HJX A;  4ED7 A;  2HLU A;  3M1V B;  2UUA J;  4RBV A;  4WXO A;  1V5V A;  2LP4 A;  4O4G A;  3S8S A;  3VAK A;  1LW0 B;  3CGI A;  1M5K C;  4CO2 A;  4EO8 A;  4TY8 A;  1MMN A;  3Q8Q B;  1YKW A;  2GVZ B;  3WZ0 A;  2RQK A;  4AD6 A;  4U6P A;  4DFM A;  4V1A k;  1TMM A;  3W62 A;  4FP9 A;  3CJR A;  3CD6 S;  4C7Q A;  4DJB A;  3W8P A;  3DI6 A;  3C3L A;  1SIZ A;  5AXK A;  2QV6 A;  4ICL B;  4PYA A;  2KVQ E;  3CDB A;  2VH7 A;  1H72 C;  4NLT A;  2KZM A;  2W25 A;  4KE5 A;  3FC9 A;  1B7F A;  3KWM A;  3JYT A;  4UOG A;  5F8N A;  1RAG B;  1P9Q C;  4ES1 A;  3ZZR A;  2ROG A; 
#chains in the Genus database with same CATH homology
 2XYP B;  2HBR B;  3RJM B;  5IC6 B;  2CNL B;  2H48 B;  1PAU B;  1SC1 B;  2QL7 B;  1QDU B;  4ZVP B;  2CNO B;  5K20 B;  2H5I B;  2QL9 B;  3NS7 B;  1IBC B;  3QNW B;  1RWX B;  2FQQ B;  2QLB B;  3D6M B;  2H5J B;  4ZVT B;  2C2O B;  3D6F B;  2CDR B;  3KJN B;  4DCP B;  3D6H B;  2C2K B;  2Y1L B;  1RWK B;  1NME B;  1RHR B;  3IBC B;  2QL5 B;  5IC4 B;  2H51 B;  2C2M B;  1I51 B;  1RE1 B;  1RWP B;  1SC4 B;  2CJX B;  2DKO B;  1F9E B;  4ZVR B;  4DCO B;  3GJS B;  1RWN B;  3GJQ B;  1RHJ B;  1I3O B;  1BMQ B;  4ZVO B;  1RWV B;  1SC3 B;  2HBY B;  3R6L B;  3IBF B;  3KJF B;  1RWM B;  2XYG B;  1QTN B;  1ICE B;  2XZD B;  2HBQ B;  2XZT B;  3GJT B;  1GFW B;  3R5J B;  4JB8 B;  3R7B B;  1RWO B;  3EDQ B;  4ZVU B;  3KJQ B;  2HBZ B;  1RWW B;  3GJR B;  2QLF B;  4DCJ B;  2C1E B;  3P4U B;  4ZVQ B;  2Y0B B;  3R7N B;  2CJY B;  3P45 B;  1RHQ B;  2P2C B;  1PYO B;  2H4Y B;  2H4W B;  1RHU B;  2H65 B;  2XYH B;  3SIP B;  3R7S B;  4LSZ B;  2CNN B;  1RHM B;  4ZVS B;  1RHK B;  2CNK B;  2H54 B;  3EDR B;  2C2Z B;  2QLJ B;  3R6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...