4C3MA

Structure of wildtype pii from s. elongatus at medium resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
91
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 22
structure length 91
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c3mA00
3O8WA 2J9EA 4ZK7M 3AHPA 2XULA 3X3UA 4USJC 1NZAA 2E66A 3TA2A 1OSCA 4WK3A 2XZWA 1H3DA 3AA8A 3AA9A 1PILA 4YB5A 4YB7A 2CZ4A 3HLUA 4R25A 4CO3A 5D4PA 2ZOMA 5DRKA 4OZJA 3DFEA 5D4OA 1KR4A 4D3HA 4CO0A 1HWUA 1O51A 1J2VA 1O5JA 4C3MA 3BZQA 1NH7A 4CO1A 1XK8A 3CE8A 2J9DE 3AH6A 1V3SA 2GW8A 4IYQA 4D3GA 4NYPA 4CNZA 3NCRA 4CO4A 5D4LA 1GNKA 4RWWA 2PIIA 4NYOA 1VFJA 4Y65A 2O66A 1V3RA 4E98A 3GSDA 2NUUG 1NAQA 4CNYA 2O67A 3OPKA 4RLEA 2GX8A 2JJ4D 4RX6A 4YB6A 1QY7A 4C3LA 2EG2A 5D4NA 2J9CA 4RWXA 2NS1B 3N5BA 3LF0A 1Q1KA 2XG8A 4OZNA 2DCLA 1VHFA 2NUHA 2RD5C 3T9ZA 2EG1A 2XBPA 3M05A 4OZLA 3NCPA 4CO5A 4Y6IA 4AFFA 3NCQA 5DS7A 4WK1A 5L9NA 1V6HA 4USHA 1UFLA 3TA0A 1UL3A 1NH8A 1V9OA 3TA1A 4CO2A 3O5TB 2GNKA 1P1LA 1UKUA 1UMJA 4C3KA 3L7PA 4USIA 2ZFHA 3MHYA 2VD3A 2Z0GA 2V5HG 2J9DA
chains in the Genus database with same CATH superfamily
1IKYB 2B7BB 1T02A 4DPYA 5THWA 4DN0A 4LRCA 3W9JA 2XYGB 3MGJA 3QIDA 3ZTSA 5B7WA 1K0VA 4FKYA 4PXDA 3KOAA 2C3OA 1XN9A 5ETMA 3M6XA 2AWZA 2MKYA 4P2SA 1CC8A 2V2QA 5D0HA 3DCAA 2FHJA 1HNIA 1HLWA 3QAUA 1FTCA 1K8AT 2IA6A 3TAPA 1NPPA 3AOCA 5L46A 1NMEB 2BYCA 3G6ES 1REGX 2ASLA 4GKKJ 1HHSA 4NLVA 4YB1P 5KFVA 3W64A 3MM7B 2R7QA 1G6BA 2J9CA 1B0VA 2YNGB 2LQ9A 3KJQB 4X84A 4K0KF 3CCWA 3DGPB 4ZVQB 3UN2A 2UVRA 1VRTB 4C0HA 2V4JA 2DNGA 3SFUA 1RSCA 2W1BA 2LCWA 3ZTRA 1VQPS 3A1YG 2C2MB 1ZAVA 1T03B 2WSEC 2IDLA 4NMLA 4TLRA 3CB4A 2Z0GA 2YWKA 4A8SA 4G6VB 2XMKA 4OV1A 1HQEB 3ENAA 2BMBA 1GXTA 2DJWA 2CZ4A 3HKWA 1NKBA 4F8RA 5DRKA 1WF2A 4MK9A 1NJWA 3QFHA 3QRRA 1Y00A 4ZPVR 3LWMA 3LALA 3OFEA 3RBXA 2CDRB 3CGIA 1WTFA 4FDFA 4HH0A 3W62A 1EQMA 5KTQA 1TQLA 2OAUA 1KHWA 1SV5A 3KJFB 4I67A 3W2WA 4F3OA 1AXQA 4PZVA 1QAIA 2GX8A 4NRTA 4F4YA 4C3LA 4QYZK 4H54A 3HULA 2YXLA 1NUEA 2DR7A 1K47A 5B0EA 2FLNA 1RAGB 2OEKA 1S1VA 5J2QA 1TR0A 2Z58B 2PO4A 4O0IA 3R5GA 2HAFA 3PHTA 1NH8A 4ZCIA 1O0PA 1S1TB 4LT6A 5HLFB 1BQMB 3T1HF 2BJDA 3M1VA 4YQWA 4KC5A 3ZZRA 3EZUA 1ZM3A 2XS7A 3SCLE 1CJKB 2XZWA 2WW4A 1HNWJ 1OY8A 4NLQA 4DSKA 1NPRA 1PAUB 5EWGA 1S1XB 1MNEA 3NEKA 1ZH5A 1O51A 2E9ZA 1PJ6A 4KJIA 3H4BA 2CZ9A 1P27B 3MMBA 1MMNA 3TR5A 1DQAA 4TY8B 1S9GA 1X0PA 2KT5A 3OR2A 4CWBA 4B17A 1Q1KA 2ZH6A 1F60B 3I5BA 2B9XA 5ETVA 2GVZA 4ZS6A 2J5AA 3NKYA 4ETXA 5KFJA 3QQCD 1S0NA 3D3BJ 5LM7E 4ILLA 3K5LA 3ZTOA 3ZZOA 4B3OB 1WD6A 5T7LA 1NZAA 5DGBA 2DGOA 2DXDA 2PA3A 5JMNA 2DGWA 1DTTA 2EC2A 4A8FA 3IAM9 2NZ4A 3OSPA 1F5CA 2GGPA 3BZQA 2BE2B 3AD9C 4I0WA 3UDLA 1XNQJ 4M63A 1RB0A 2BRKA 4ECUA 5D77A 3DDIA 3ELHA 1FKPA 5D0RA 1FTRA 1SIZA 1HL6A 1MWQA 2NYHA 2XWYA 1D9FA 1TL3B 2YKMB 4PG4A 4KHMA 1ROFA 2PGCA 1OSDA 4HI2A 1HBNA 3K58A 1EKSA 5K9FA 2XTJP 3CD6S 2G2YA 5IC4B 1RBAA 1FFWB 1CJTA 4QW8A 4Y2CA 5LMUJ 2QZ8A 2BANB 2AGPA 2DBBA 3E8OA 2FJWA 2VPWB 4ZN3A 3P49B 1H7XA 4NMXA 4J9RA 2W9CB 2FY8A 1S49A 2E5JA 3NY0A 5HROA 2DIVA 4KGVB 3D1OA 2EFPA 4ZJQA 2GAGC 3AD7C 3I9V9 2PI4A 3KLHB 4QIFA 3TRGA 4ANEA 1TAQA 1DY3A 1YBAA 3BREA 4FBUA 4HL9A 4Z2XA 3P4UB 1U48A 2WVCA 2MYFA 4UUWA 3DXSX 4D3GA 3M9OB 3UI3A 3H4DA 4X4TA 2IFXA 4J9UE 4ZVTB 1RE1B 3BPSP 3CJKA 4CLYA 5GMEA 1D3WA 5AE2A 4HHUA 2RS2A 3IR7B 2QLWA 3L9ZA 5EDWA 2IJNA 3MM6A 3GR1A 1GFWB 2I38A 1WC0A 4X66J 4G1PA 3MAAB 2CQ2A 5EWEA 2CPDA 1QJHA 4AFFA 2QMUB 1C4CA 4NXMJ 3V6JA 1DFDA 4A8KA 1B3TA 6FD1A 2W7PA 4I1TA 1IN0A 2VU5A 2G2OA 3ZZTA 2LXFA 4J9KA 4RNHA 1FX4A 1T8EA 3ZO7A 4CIOA 4P74A 1SJRA 3DLJA 2M2BA 4IFVB 4DEZA 3FQKA 4KGKA 3ETOA 3R9LA 2F65A 1RDRA 3LQVA 2D74B 1NHKL 1RWOB 3G6VA 1HHTP 1XK8A 2X1AA 3D28A 2LA6A 1JJ2R 2Q1LA 1N54B 1AB8A 5KFIA 1S1WA 1ZM9A 4KYZA 2KVIA 1X5PA 3Q8UA 4G1QB 4FYDA 4X4NA 2R2RA 4DCPB 4WZMA 2Y1RI 5F8GA 2QLBB 2B5JB 1UFKA 3MM9A 4IDKB 1U2CA 3TUJC 2W9BB 1K1QA 1S6OA 3VWSA 2GNKA 5IQ6A 4WJBA 2M8DB 3DLHA 5E3RA 3TARA 2R7RA 1JLEA 4PWDB 4KGXB 4O44A 4J37A 3OJSA 5ETLA 4OYWA 2J6UA 4OMFG 1LKZA 2YKPA 4R8UB 4DL0C 2QMWA 4F26A 3Q23A 4H4KA 4HACA 3ZNUA 3MMCB 4P9SA 2CZVC 1S9FA 3N28A 1MROA 3I9ZA 3C19A 4LF7J 2UVUA 5GAEU 2XLKA 2PE8A 2FC8A 1V3RA 3QLHB 2KDOA 4K4UA 2FY1A 3IN5A 1LXNA 1U1RA 4P7TA 1N36J 1FWPA 2EG1A 2AYBA 1Z1ZA 1YK9A 3RBZA 1UVNA 5IT9U 5CCMA 4ZLNA 1JLAB 3EDQB 4A48A 1DRZA 2EEYA 1KONA 3I96A 2Y0BB 3LP0A 3EYZA 3EZ5A 1AUDA 4F0HA 5ETPA 4KSEB 1IVZA 4F4XA 3PW7A 2AF6A 3N9UC 4A46A 2MQQA 2KO1A 4M5NA 4DSEA 3C15B 3JAMU 3EDRB 1C1CA 2XI3A 2HQFA 3I4HX 4KV8B 2LA4A 5BJRA 4L3NA 1UEKA 1YLXA 2Z30B 4CLKA 3KKFA 3F56A 3NGDA 2RS8A 4DV3F 3NP5A 3WQPA 2CNNB 3CO9A 2EVZA 5L8RC 3H5SA 2ZH7A 5BXIA 1F6TA 1J5EJ 2G0CA 1TK5A 3BBFA 3ET6B 4MIWA 3T6BA 3DYAA 2IYIA 1YJTA 2GQQA 5FJ4A 2IBKA 3SYZA 3SDEA 2R7OA 1WEYA 1R43A 4O0NA 2UUWA 3BQ0A 2UVVA 4L3KA 5J2NA 1VQ8S 3BJYA 3RB0A 3NMAA 4DR3J 3CMAS 4NOHA 3LPYA 1X31C 3CDWA 2MZQA 1WC3A 5JVGQ 3TZXA 2LU1A 4P2FA 2BVZA 2DGTA 2B4UA 1RA6A 4S0MA 5HAOA 3BGLA 2BM0A 2DR9A 3GB0A 2C2KB 5B0FA 4F7VA 4JI4J 3RW6A 1VLYA 5KFMA 2XQCA 2BKOA 2YKQA 4LF1A 1XBWA 3BQ2A 2UXCF 2W7AA 2HVZA 1S12A 3CCQS 4Y2IA 2C2ZB 5FD1A 4EWTA 1RT4B 2OH2A 3ZFVA 4DU7A 4PG5A 4MIBA 3G96A 4FF4A 2DT9A 3EWGA 2QA2A 3VGSA 1X9MA 2OEMA 4YEAA 1EARA 4LF9J 2RNEA 2BE7D 4ZJOA 4JI8J 4CCHA 3Q8PB 2ZH1A 1D9AA 2ILZA 3OTCA 1SL0A 2KXFA 1MU2B 4KH0B 3I6PA 1LEOA 3D1HA 4FP9A 2JLFA 3BBBA 3UN3A 1ZZNA 4U7UK 4AUKA 4MFBA 3V4IB 2Y1JA 3QIPA 2MPUA 2DKOB 2WVEA 2QYCA 2HQCA 3I0RB 4LSZB 4A8OA 1WC6A 1RT1B 5KFPA 4CO0A 3TO8A 3TWZA 2X7IA 3CE8A 1N33J 3CWJA 4OX9F 2Y8WA 2XY5A 5G0RB 3FMBA 3C3LA 3X1LB 1KP6A 4LUBA 4LSNA 3D66A 4OI2A 3W3SA 1KVIA 3OUYB 4RWXA 2ASDA 1T11A 3M8QA 3KLVA 1HPZB 5ETNA 1Q8BA 4JV0A 3I32A 1YJUA 4R5PA 2GJ2A 4DR7J 2KYXA 4R0JA 1V9OA 3GSIA 4USIA 4ANDA 1PYOB 5IFMA 3ZZYA 3Q8QB 3POTA 2IMWP 4LRBA 3KHGA 3NOGA 4EBDA 2F9JA 3TA2A 4K4VA 1TVRA 5EX0A 2APOA 1X9WA 2OPRB 2Y0SD 4B9UA 2CPJA 1RK8A 3HSJA 2OFGX 2YWFA 3FZ2A 5IC6B 1V5IB 2VQEF 3RJMB 1EIYB 2UXDJ 1FXDA 3W5ZA 3FK4A 4ZVOB 1H2VZ 3UWTA 5KFZA 1S57A 3D0GE 4WYWA 4LSLB 2F3JA 4IOBA 4CLZA 4FYVB 3U7JA 4JI2F 2QRRA 4IRCA 4TVAB 1NSQA 1FDAA 2VPXB 3BH7B 2V8DA 4IQXA 4E98A 4BWJA 2BJ7A 2BW2A 5KFLA 2W01A 3MPYA 4RUAA 4UZBA 2D1CA 4DSFA 3TUIC 2VFTA 5KFAA 3ULHA 2VONA 4LR8A 2OD4A 4QWEA 3IG1B 1S10A 1FJGJ 1FK9B 2L9NA 1NXIA 2BEFA 5E3QA 1JLCA 4F3QA 4DUZJ 5K20B 2WBRA 2CJ9A 1JXLA 4FS2A 3LPEA 3MEGB 4Q0BB 3CC7S 3DLEB 2GVDA 4CT9A 4JB8B 2BABA 5D15A 2W2OP 2E5IA 4RNFA 3FEZA 2JFKA 2KH9A 4FXVA 4CYUB 5A8KB 1S6PB 2XMWA 3MM8B 3K5MA 5K5MA 5KOXA 5LSRA 4YR3A 3K0JA 4ZA1A 3FBBA 1QSSA 3RB3A 4Y2MA 3V5RA 3V6HA 1W25A 1WUUA 1HKAA 1BWVA 3UW1A 2JEJA 5DDRC 3QWUA 2PSZA 1WDDA 2ZOFA 3G86A 2JH3A 3PJ9A 5J2MA 1N88A 3VAIA 3RGIA 2R3VA 1VC0A 2RAQA 2HRYA 4DS4A 4NLXA 1R0BG 1RAAB 4JI6F 2D9PA 1K1SA 4ICLA 3W63A 3GR0A 3Q2SC 4I2QA 3NNCA 4OLOA 3J7YU 4OI0A 2BV3A 2K2PA 4OI4A 3S7RA 2XMUA 3OD2A 3TNVA 3H8YA 4RNMA 3U27A 2D3UA 2JEGA 3DM2B 2YWHA 1GEHA 3TYTA 2V34A 3RBEA 3HVTB 2JZ5A 1T9UA 2K1RB 3AY0A 2D69A 5D4LA 1Q79A 3JSMB 4U95A 3GV8B 3RB4A 1HHQA 1SCJB 3MM5A 2EFVA 2NUUG 2KFNA 1LK7A 3PV8A 2H65B 1JKHA 2YTCA 1UWAA 3ILIA 2FD2A 4KH1B 3GV5B 2HGLA 4JI5F 4DV2J 4LRFA 1QVGR 4TXSA 4XDDA 1WI6A 4L74A 3D68A 4DSIA 4IR1A 2J9DA 2I2YA 2A1BA 3UNYA 1JQGA 4GC7A 1YJNS 4IO9Q 3EUNA 2UXBF 2KN4A 5IZHA 1FNOA 3IO1A 1GAOA 2VIHA 4RBVA 4F4AA 5IT0A 1IKYA 5DLFA 3NWRA 2CQ3A 1AZSB 5M2UA 4RW7B 4NE9C 1FFGB 2ATLA 1RLCL 1NK9A 1FEHA 2JVOA 4DR1J 1N34F 3QGPA 3CCES 4CI0B 2V94A 5B09A 3G87A 1VYAA 2YKAA 4AT1B 1KTQA 2FZGB 3D9BA 3I56S 4EYHB 2AU0A 4F4WA 3DRRB 3UR3C 1KN6A 4LRDA 2E7WA 3IRXB 4X4UA 3OL8A 4M8LA 1HNIB 1GT8A 3KUGA 3QMQA 1EZZB 4QPTA 2XYPB 3MM7A 4URQU 2GJFA 1X4HA 4C8LA 4KTQA 1MWZA 3PW4A 3D0HE 3QBCA 1VI7A 4ALZA 2HGMA 4TLQA 1OMSA 3DGPA 3EPGA 3QGGA 1S9EA 1VRTA 3FCWA 4ZCMA 2F1FA 3GWCA 2HW3A 3ISND 1IBCB 3HLUA 1T03A 3QJJA 1K0TA 4Q45A 3HSDA 4U9RA 1FERA 1KOOA 3GTYX 3WX4A 3BV8A 3R5CA 2MJUA 3BGOP 1NH7A 1HQEA 1LK5A 4ZIWA 3AFGA 2OIHA 2NPIA 1X5TA 3NCRA 5A8WB 2QSWA 4PG7A 4LQ9A 5KG3A 1N0UA 4QR2A 4QR1A 2MKSA 2ZNYA 4OYBA 1NO8A 2OI2A 5KT4A 3N4WA 2DK2A 2U2FA 1TKTB 3NCQA 3OLAA 5HQLA 3ICLA 1R6YA 3HP6A 1SH0A 1UL3A 4DCOB 3BDEA 4IFYB 1RWXB 3L7OA 1TP7A 1AUSL 2KZZA 1FHTA 2VJUA 3W1YC 2Z4PA 4JI0J 3Q8YA 1EX8A 2OELA 4KHPF 3IMQJ 3ENWA 2OPQB 2HQDA 2XGQA 4OHVA 3TVKA 1IR2A 2AIRB 1S1TA 1S1VB 4WFNQ 4OZJA 5J2QB 5D4OA 3GE9A 1BQMA 2HEKA 3WC0A 1NM2A 1N52B 2QYGA 3QPIA 2XMVA 4K4YA 4DWIA 2DPIA 2DR8A 2BE9B 1XMQF 1DBDA 1Q7LB 2ASJA 2CG8A 1TKZB 4X62J 4IH5A 4OZNA 3GV7B 4X65F 2W9AA 1CS4B 4TY8A 4C6AA 4CM0A 2R2UA 2DNNA 3CJ8A 3EVOA 1IWGA 4I6WA 3MMBB 4J7CA 1OO0B 3GIJA 3LP2B 1SPBP 3N6LA 4WF9Q 2ZBIA 2BBEA 1XMOF 1RQ0A 3T3FA 4JI7J 2X1BA 1FRKA 1B7FA 3MPWA 2ERRA 3A8KA 1RLDA 1LNQA 2BJ3A 1UW4A 3GU0A 2IVYA 2FGOA 1LWCA 2RQ4A 4WCEQ 2CJAA 5IV4A 1NDCA 1PC4A 4XK8C 4B3OA 3AOBA 1U02A 3RAMA 3VAGA 2XWXA 4DUYJ 3DLLQ 1F5BA 4DR6J 3HVAA 4DV1F 1NAQA 3AQOA 2QV6A 3I82A 3VGVA 2BE2A 5HJXA 4DDFA 3GLJA 3L3CA 2ZD1B 4RU2A 5GADU 2MQMA 3LOUA 3ZTQA 2VICA 2RJZA 1X8DA 4B3TF 1TL3A 2YKMA 5KFQA 1XJWB 2CYYA 2HNZA 3TA1A 2JFDA 3D6FB 3DLKB 5J1PA 1FJCA 4TNOA 1L3KA 4QU6A 2RKIA 4FZVA 2KFYA 4OYXA 4YDXA 2QE5A 4P71A 4RR5A 5HQMA 2BANA 3MAHA 1H6KX 4MKAA 1M1KT 2RDDA 2ZWPA 2GJIA 1Q7YT 3AXKA 2W9CA 1KR4A 1U2RA 4NYZA 3DLGA 5BR8F 4DV6F 1EP4B 4ATNA 2I5JA 1DHMA 2Y8YA 1WC1A 4CNZA 3HJVA 2QFIA 5HROB 2MZTA 4YUDA 3Q83A 2DO4A 4V19J 3H7HB 2DNZA 3QO9B 4E8UA 2KFZA 2XG8A 3DU5A 2VH7A 3PX6A 3FJ2A 4ZVHA 4HYKA 2WBMA 2HS4A 3CCZA 4LQ3A 1BE4A 2GMLA 4JI1J 3JB9k 2XCAA 2ZKTA 3ITHB 3M2UA 2LEAA 2PN6A 1KFSA 2ZM6J 2KB2A 5J1EB 2UV8G 2YWEA 1WTBA 2KZMA 2R7VA 2VFUA 1HNVB 1M5SA 4C3KA 1YGYA 1ZM2A 2CNKB 2ZZNA 5KFNA 1F0XA 4FN5A 2MY7A 2H1YA 2MGZB 1VR6A 3MDFA 2F63A 5LSOA 4KGZB 1RWVB 5I42B 5L1KA 1BXNA 2DISA 2GMJA 2XSJB 2KYZA 4EFAC 4ITSA 2J0SD 3JTNA 3NOCA 1PYTA 1OPZA 1URRA 3J7AN 1PO6A 1CBKA 1HWKA 3T5LA 3HMJG 2JEIA 3OR1A 4FNHA 4WP9A 4X4PA 3QSYB 1OY9A 1WC5A 4UUXA 1LFPA 4DV7F 3SCJE 2W4PA 2WTFA 2MB0B 4IG3A 4F2SA 3MUMP 1T9XA 3O44A 2ZZMA 2P9EA 3MEDB 1M5HA 2RSQA 2BM1A 1SH2A 1YITS 1TELA 1VBYA 1S59A 5A2QY 4UOHA 1KTVA 1A7GE 2GO9A 2OMOA 1S4FA 3BR9A 5G4DA 3UDVA 3M2VA 3L95X 4LFBJ 3KNGA 1S1WB 2KRBA 2V2ZA 2HSEB 4XIUA 3KLFB 2LKZA 2B5JA 3KK3B 3CEDA 2HHHJ 4IDKA 2VKRA 3MFHA 3GG1A 3K8WA 4ZMMA 4PUOA 2ZH5A 1YG0A 4DPXA 1FFSB 4GKKF 1Y0HA 2F4VJ 3MM9B 1W7WA 4N56A 3SZ2A 2B0GA 1RWUA 1NSPA 1JJCB 4M5GA 4QWBA 2MLXA 3EE3A 2Z2LA 2BQRA 2DIUA 4ZKAA 4PWDA 2HZCA 4ZN1A 2MZJA 4USUA 2BQ3A 5MLCV 5CYMB 3N79A 2J7UA 4DX6A 3VAFA 4PQAA 2GHPA 3W7BA 3LP1B 4O44B 3FBCA 4J5OA 4DOZA 4I68A 3QNWB 2NXJA 1UPPA 4FS1A 3MMCA 3OL7A 2WVFA 1VC6A 2RQMA 3WX8A 2A2DA 3M05A 4J91A 3IS9B 1FRMA 3ONQA 1FXLA 1VJQA 8AT1B 2R42A 3OLBA 1T9YA 3QLHA 2CQCA 4J9LA 1H74A 2DNOA 2HHUA 2W8KA 4ECRA 4DV5J 3TZWA 1VS3A 1U6BA 2NZCA 3FKBA 1JLAA 5D8HB 2QC3A 4WFBQ 4LF4J 1Y11A 3VQSA 4AQYJ 5CH7B 5LSLA 5KG4A 4I56A 2VC0A 3C15A 4CZCA 2MZRA 2QL7B 3TUPA 4KV8A 4RW6B 4HHJA 3HO1A 4EYIB 1U4BA 3B6BA 1XQIA 3CMQA 2B7CB 4QQBA 3VGUA 3L4BC 2JSXA 3T1HJ 1NK6A 3W8GA 1VHFA 2FQQB 4DX7A 2XI2A 1X4GA 4ZLLA 2AQ4A 1YJ9S 1IUJA 3MECB 1YZ7A 5IWAJ 2ZHOA 3NBPA 4O23A 4O3QA 3DMJB 1HNZJ 3X3UA 3W60A 1R7IA 3B8HA 1TTHB 2ZC4A 2M3DA 2A6OA 1U26A 2ZH8A 1QAYA 1KC8T 3KLGB 2V8HA 2L3MA 2CA9A 5GAEI 3H20A 1H98A 1F2GA 4WU3A 4V19X 4OJ3A 2EK6A 4NYOA 2QSFA 1U7LA 2BA9A 3KJVB 1U1NA 2QA4G 1RYRA 1XWLA 1PG5B 2XEXA 5H9FJ 1RT4A 1U24A 2HWIA 3L7UA 1PGZA 2OLWA 1SJ1A 5GAHU 4IRKA 1TAUA 2Z57B 1PJ7A 2HHWA 4QR0A 3N5FA 2B9WA 2V9WA 4GC6A 3CT9A 3MTKA 4ES1A 2D3O1 1XNQF 5EX3A 2OSRA 4FF3A 1UJ6A 2HK2A 5T14A 4YB7A 3IRWP 1MU2A 1R3NA 2C2OB 3QJPA 2H5IB 3EGZA 4KY3A 1B0TA 2NLWA 4QPXA 3MUTP 2FJAB 5D0EA 3IC1A 2CPEA 3V4IA 5L1JA 1M5OC 4FYYB 2J0QD 4O3OA 1SUQB 4Q8FA 2RUSA 4U96A 5LMUF 3QYYA 3ENQA 1Q53A 3I0RA 3T41A 4OZ5A 3RW7A 4QIEA 4NLPA 2RE1A 2JL9A 2FJBB 4C8KA 2PEHA 1D1UA 4K8RA 2MQOA 1J5OB 5DGAA 3C14A 3MCNA 1ZZFA 1UJ5A 2GV1A 4DG1B 2ZHAA 5B08A 3MPUB 1RT6B 2IY5B 1B4SA 4XPEA 2ZH3A 2RH3A 2X51A 2LEPA 2VFVA 3TX0A 2V50A 3ADAC 1KQKA 1T9TA 4RBTA 2DYAA 5GMKa 3OVBA 2VUGA 4HTJA 3M8RA 3G6YA 4P2MA 3E3XA 1BUXA 3M8PB 2OHDA 2AEJA 1KNZA 3JQKA 3CIMA 4D3HA 1ZOTA 3B4DA 4R5PB 2C2EA 4HT5A 3MR3A 2Q43A 4X66F 3J81j 1RP5A 2OPRA 4NXMF 1S99A 2P6TA 1RXOB 1SJFA 1TVRB 2AJ0A 1RISA 4B3RF 1P9YA 1F3FA 1VIOA 1X4AA 4J90A 3R5AA 2HFNA 4IOAQ 1FCAA 2L9DA 2BJ1A 3A12A 2ZZTA 3DOMA 4P73A 2HVIA 2CFXA 2DNRA 2ZC3A 2J9EA 2C28A 4RBUA 2GA7A 3IG1A 3VGTA 2CPFA 3ZTPA 1FK9A 4DJBA 2BW7A 2KHDA 4USTA 2NYIA 3JYTB 4TYBA 3BKTA 5LT5A 4OYAA 3HK2A 3IA0A 2CQBA 1Y4ZB 2GHVC 1U25A 3OTBA 3K5OA 3HSGA 1X4EA 3MEGA 4AL7A 1X4BA 1JLCB 4ILRA 3DLEA 3RYLA 4RZRA 3Q8RB 3LH2S 2UUAJ 5A0YA 4QIVA 3AJ1A 3CO0P 4RW4A 2V69A 3N01A 2CPZA 3JQJA 2K8GA 4MK8A 4ELTA 5KFWA 4Q44A 1KKHA 5A8KA 2LQJA 4MMOA 4Z37A 1T0TV 1S6PA 3MM8A 4I6AA 6FDRA 1U47A 1CSJA 2IRXA 4P52A 2RDIA 5CQGA 1UFWA 4C8MA 3HKZD 4FPIA 3OQ2A 4PXCA 2WW8A 2IMOA 3PFEA 2HRTA 4OZLA 2AHOB 2V4RA 2F4FA 3KNAA 4Y6IA 1HBMB 1RAOA 1LXJA 3HFVA 3HD2A 1TMJA 2WK4A 1GMUA 3TQ1A 2F9DA 1HBOB 3PRDA 3MPVA 2P2CB 2ZFHA 4N76A 2IYGA 2HWTA 3V6DB 2X1FA 4I7FB 2ZH4A 4ED7A 1RT2A 1H3DA 4LF8F 4GVLA 5DLGA 4L73A 2UVWA 1HARA 3ENVA 4TKTA 5HI7A 5J2MB 2FLOA 2FJVA 3FNNA 2HHQA 4HDGA 2UUCJ 2KJVA 4OYIA 1BQNA 1R8CA 1D0EA 4WKRA 1T3NA 1YBTA 2CPIA 1ZM4A 3DDKA 3I0SB 4KO0B 3OTOJ 4GMKA 4RX6A 3IGNA 3HVWA 2KKHA 1HMVB 5K8OA 1AROP 3AJ2A 4YOEA 1PBUA 2K1RA 3BN4A 2B4VA 2XBPA 2VL1A 3MMAA 4WTYA 3UCZP 1HI1A 2IPOB 4DV3J 5JVHQ 4YR2A 2A0FB 4G1IA 1YRUA 3AJDA 5KFXA 4R0EA 3FFIB 4C48A 5CYQB 2VD3A 1J5EF 3GFZA 2DHXA 1RT3B 1KQFB 1V3ZA 1JKHB 3O1LA 1U0HB 3FVYA 1Y5IB 2HAIA 2FPHX 1DQ9A 4NZ7A 1HFEL 3FC9A 3QZ8A 2QTWA 3MR7A 2W24A 3DI6B 4LIRA 4MKVA 2E1AA 3GIRA 4P2XA 3HHKA 4MKBA 2DHHA 2VFSA 4WBFA 4IG0A 4DR3F 1APSA 2HFUA 5C25A 3GILA 2ACYA 3CDAA 3I4PA 5E3PA 1RWPB 3NS6A 2ZEJA 1OYDA 2J8AA 5KFRA 2J7KA 4LFAJ 1AZSA 2WVBA 4RW7A 1AW0A 3DRSA 3VAMA 4JYAF 3J81Y 4ZVRB 1FRJA 2MY8A 1ZA2B 2HBQB 1U6ZA 4JI4F 1Q95G 1JLFA 1RTJA 2ASYA 1S0VA 3LAKA 3J7YI 1FKOB 2VKZG 3ETMA 3DRRA 1ZAWA 2FVRA 3IRXA 4ZVPB 1RA7A 3QGIA 3HHLD 5LOQA 1WG5A 3E2EA 4I69A 3AA9A 1C0TB 3CCVS 2DRDA 2XO7A 3UD4P 3BKUA 5D4PA 2YQ0A 1RT5B 5ETSA 5H9EJ 3EGNA 4QCLA 3ZZUA 3CCTA 4LF9F 1RGVA 3CCMS 3K89A 3G8SA 2VG7B 1S9EB 1U1LA 4NLDA 3O2IA 3DXBA 1RWKB 2C22A 1PIEA 1GTEA 3CULA 2DNHA 2YNHB 1FT8A 2W4DA 5F8MA 4TQRA 3DKDA 3PNIA 1NDPA 4LBPA 3PFOA 3KTQA 5A8WA 1FI4A 1OWXA 2IDEA 3IAS9 1KD1T 1SB6A 4ED2A 4A8MP 2HHPA 3FMWA 4OHXA 4ECTA 2A2CA 4YHHJ 2ZBRA 2R2TA 1HD1A 1FRIA 2FGCA 1SXLA 5A2QU 2MTLA 1TKTA 3VZIA 2KXHA 1N33F 3ILLA 2QN6B 2W7OA 4TQSA 3CVKA 4Z7YA 4X2BA 3BDPA 2LYVA 3J7Z5 1Y5NB 3BGFA 3MOZA 2EFGA 5KG5A 4IFYA 3QFWA 1G1XA 2WRMA 3BPDA 2ZKUA 4CDIA 4KKOB 5DDOC 4KPCA 4CO4A 4A47A 2OPQA 3NMRA 4LVNP 2VA2A 1RUSA 3DN9A 4B02A 4YMEA 2GIRA 4I64A 4UQTA 2C3PA 3GP9A 3O6QA 4ZVGA 4DQQA 1JXEA 3GONA 2PT0A 2MJNA 2E5LJ 5LMNJ 1Q5VA 1SVDA 4CLTA 3NNHA 3WC2A 4X4RA 3TUZC 2K3KA 1FD8A 1UFLA 2CJYB 4Y00A 4ZPDA 2VQEJ 5C2GA 3U1LA 2VV5A 1TKZA 4O3SA 4FXDA 5DZ7A 1NKCA 4ILMA 2N4CA 1WNEA 1CS4A 1IKWB 5CZVA 4DLGA 3H2UB 4BLGA 3LTOA 1Q4RA 5AJ3F 3OT9A 2Z56B 2GS8A 1GK8A 4EUVA 3LP2A 4QOTA 2QEXS 3W8PA 4DR2J 4WE1B 3SSSA 3H5UA 2CIMA 4LFCF 3TW0A 5E3AA 4N77A 5J2PA 3LANA 4PPZA 3GIIA 2HWHA 3TEGA 4WP3A 3C6UB 4DUZF 3R3TA 1J27A 1S0MA 4NCGB 2QLXA 1VHIA 5LJ5Y 2OUGA 3PYFA 2VDHA 1PJ5A 1H0HB 2FVQA 1LWCB 4K50A 1UVLA 1HIYA 3HHLA 2YQ3A 4OFZA 5DS7A 3D2WA 3IBWA 2BRLA 3J7A1 2BOPA 5CXTA 4NLUA 2F8HA 2IIHA 3R2CJ 1RHQB 3CCRS 4CRJA 2ZJRQ 2ZD1A 3QJLA 1QE1A 2J0WA 1Q78A 4KFBB 1CQNA 5AE1A 1WI8A 1FWKA 2MKCA 4B9TA 4YB5A 2LVWA 4LBHA 4LIWA 2AJ4A 3DLKA 2MEWA 1WHXA 3HJFA 4B08A 2LFVA 4PABA 4DI6A 1L3TA 2HNZB 2VQFF 1YWXA 2C2DA 1PSDA 3MF5A 4IYQA 2ADBA 1NLKL 4ZJLA 3KHRA 1P8GA 3B78A 1KRPA 3DC2A 2RKIB 4J9PA 4O3NA 3C46A 2HNYA 1KHVA 1YI2S 3KUHA 3I55S 1JX4A 1QTMA 2R2SA 4DXLA 1EP4A 3PJXA 2OTJS 2VDIA 3PCOB 3DLGB 2AYGA 1SJ3P 2N4DA 3PJWA 3R8YA 3IWNC 5HP1B 1IJFB 2I5JB 3SXLA 2C2NA 1TL5A 3HHLC 4AL5A 3QO9A 4PWWA 2KJWA 1RADB 4AE5A 1M1HA 4FYWB 2HFSA 1PKUA 4IOCQ 3ITHA 4K59A 4F2RA 4B9NA 2IVFB 1SBRA 5J1EA 4M5IA 1SJ4P 2K7JA 2ACMA 4Y28C 3M2UB 1HNVA 4J9SA 5DQHA 2XS5A 1C1BB 3C6TB 3PIOQ 1HW8A 1JLQB 1JB0C 1H2UX 2MGZA 3R1LA 1GX6A 4KGMA 2CQPA 5I42A 5DETA 1GTHA 4DV2F 2XSJA 2DNMA 3LWLA 4DU8A 3AB4B 2B4PA 5GADI 3RAXA 2VPZB 4ZPCA 1NPKA 5D4NA 1RACB 4WZQA 2BUNA 2DCUB 4QW9A 2YX4A 2RU9A 2IAJB 2O5DA 4NLWA 1IBLF 4P72A 3M6VA 2ILYA 4UF4A 2JX2A 3OR1B 2ADCA 4TU9A 1YKWA 3TAQA 5CCLA 2DVIA 3MEDA 2XLIA 3OL6A 3D0IE 4WYLA 4W92B 4IG3B 1T94A 4I4BA 2YH1A 1FJEB 4NCBA 2UP1A 4NA3A 3M8ZA 2IVMA 1NKEA 2EXUA 3QT6A 1YJ7A 1UW9A 3C16B 1U1KA 3DOLB 3MFIA 3SV3A 1S77D 3KLFA 2M9KA 2A3JA 3T1YF 3M2VB 3KK3A 3M7VA 4ECQA 1HQUA 1U8SA 1A9NB 4HEA9 4NYPA 5HVFA 1VRUA 4RUCA 4OLPA 3D67A 4OX6A 1UA0A 4ERDA 5KAKA 3M32B 1NK8A 2YX1A 4PUOB 1CVJA 3K17A 3M30A 2H5JB 4NWBA 2WONB 5A8RB 4C8YA 3MURP 5D3GB 5CYMA 1Y3KA 5E5NA 4XPCA 3UE2A 3LP1A 4DFKA 5I3UA 3KK2B 2J6SA 3EICA 4NXNJ 3PACA 2IRUA 4ELUA 4WFAQ 2AP6A 3TANA 2DGQA 3MHYA 2N7CA 2FUG9 1WEXA 4ZITA 4XAKA 4ZK7M 1ZPWX 3IS9A 2EFQA 1FNXH 1R6VA 3QT5A 3NWGA 2DH8A 2CAJA 2BXJA 1FNMA 5KT6A 3ILJA 5B0AA 1YJWS 5B0CA 2U1AA 1ICEB 5KT2A 2IM3A 4ANCA 1RTIB 3HZEA 2GC8A 4LF5J 2E1CA 4CM2A 4H4MB 3TJ8A 4PYDA 2MDAA 2UU9F 2DEJA 3NGUA 4K2JA 3GFHA 2KU7A 3B4MA 3FZBA 4F02A 3R5JB 3IR5B 4DR5J 1X0FA 1VRQC 1Z4UA 2JJ4D 1RCXB 1H72C 2RT3A 2G9OA 4OYMA 3PXGa 1TUGB 2JRSA 1TFWA 4Y34A 4BC7A 4RW6A 4FF1A 4GRSA 4JI0F 3CJ0A 1NU4A 1GX5A 2HHXA 4DV4F 1TL1B 2ZOGA 2QJ3A 4MIAA 2FZCB 1WC4A 2G13A 2M5YA 4DFMA 2E5GA 3W9HA 4LR9A 3HSZA 5CAAA 3CJ5A 1BLUA 1SH3A 3Q2TC 2KM8C 2IM2A 3TZZA 1U45A 5IQQA 1U2FA 4B9VA 4WK3A 2CXEA 3RRGA 1SL1A 4ZHRA 2M7SA 4M5DB 2HK3A 4X65J 1RT7B 3MECA 2R8IA 4MH8A 1XNRJ 1V5VA 4M5LA 4X62F 2CPYA 3HI9A 3DMJA 3R5DA 2RQKA 4C97A 3NBPB 2D3ZA 4ID5A 2CVIA 1IM6A 3VTIA 4DPOA 4DUTA 1LW0B 3OTDA 1VDHA 3KLGA 1QD1A 1X5OA 1JNRB 3GCWP 2NXNA 4C11B 4C2MA 3UCUP 2OEJA 3MUVP 2CWKA 3RBDA 2SXLA 1Q86T 2KG1A 3KG0A 1UETA 4KQZA 3KJVA 1YRTA 3MR6A 5IOLA 3L7PA 2I1RA 1WWHA 5KOWA 1VK8A 3SBMA 1DZ5A 4DV1J 1ELOA 2EWHA 4HT7A 4DR6F 1OJ4A 2QX0A 2W2MP 3TZYA 4OL8A 3K2YA 2J9DE 2VZ9A 3MI7X 1P9QC 4B3TJ 1VQ7S 2G1DA 3EMTA 1WEZA 3KHHA 4ED4A 1M90T 1JLGB 1I3OB 1CJUB 3PDNA 4UT4A 4OV6A 1AA1B 1EJ7L 1D8ZA 1SUQA 3PY8A 2CG4A 3CIZA 3HZGA 1OY6A 3ZZPA 4Y3CA 3FSIA 2LLZA 2VB6A 2G0JA 1URNA 5CA5A 1DAXA 3H59A 3T9NA 2KI2A 4TY9A 2W2PP 4QYZJ 1J5OA 3A3NB 3Q0AA 2CQDA 3QRPA 3J81U 2D3OR 1BGXT 2HVDA 3RB6A 2HURA 4DG1A 4ZPBA 2C3MA 1RT6A 4OYZA 3C14B 4Q43A 4C8OA 3FBEA 3TJAA 2COLA 4DSJA 4EZ9A 1XR6A 4JV1A 3G4SS 3BGRB 3EM1A 1IKVB 3PM9A 2LU2A 5HBMB 1VQOS 2DGVA 2V8VA 1ZTTA 2CJQA 4ENOA 4JI1F 1XTZA 2F8EX 3M8PA 1AT1B 1EAYC 4NLTA 2O66A 3CDUA 2B3TB 5EN1A 2Z2ZA 5BYSA 5GAHI 2GMHA 1RAHB 3UD3P 2P8IA 4WP8A 3NCPA 3IBFB 1YTYA 1WJ9A 3KMQA 2RF2B 2MKJA 5C7PA 4USHA 2WHOA 2FHMA 2FJEB 2XSFA 3MWBA 1FJ7A 4YDDB 2A6MA 2GHWA 2MQPA 3VCDA 1VQLS 3PYGA 2BX6A 3Q89A 3T19A 3OHAA 2HGNA 5ETRA 2CNOB 4NRUA 3VHQA 5GAGU 1F5AA 1JK9B 2FVSA 4LMZA 2H4YB 5ETOA 1IBMF 1YX2A 3QWPA 1M0SA 4RU9A 1TZ0A 3DOMB 1U49A 4PWUA 4JI3F 1MW7A 3P96A 1ZAXA 3CJ3A 3NRBA 3JYTA 3CC4S 4EGLA 3FEYB 3K5NA 2ZDOA 4C0OC 1HYSA 1TKXB 1MN9A 2W2QP 3EJMA 4C8ZA 4LFBF 1QTNB 2DNPA 4RUHA 2HHHF 2A18A 1AFIA 3H5YA 3OFFA 4XTTA 5A0YB 1U09A 1WHVA 2UUBJ 4RW4B 2F4VF 1DURA 1WOSA 1IR0A 1E6YB 1IJEB 4KRWA 4LF6J 3DU6A 2XY7A 5DJBA 5AT1B 3PYDA 1HBMA 2H54B 3IGVA 1YDLA 1RAEB 1UPMB 2HHTA 3D6TB 2NCKL 1FWLA 1HBOA 3AODA 1IM4A 2YNIB 2LXUA 4P75A 3H42A 3V6DA 4I7FA 1VQSA 3BM7A 4L76A 3MCOA 4YN3B 2M0GB 4X4SA 4EU0A 1S48A 4WU2A 4KPYA 5DG7A 1KVJA 3G82A 9RUBA 3THTA 2GQCA 1RT2B 1TV6A 5I4MA 3CD5A 1YJRA 3FRZA 1RHMB 1B0PA 2PI5A 4OX8A 2BJ9A 3CD0A 4DV5F 4B9LA 1U1MA 4RNNA 4E2FB 3I0SA 4KO0A 1BQNB 4LF4F 5F0WA 3WIVA 3NNAA 4AQYF 1CPZA 2XGPA 3QZ7A 1RI7A 1VQKS 1HMVA 2QG9B 3FRYA 3RZAA 3ZZ0A 1Y10A 1RTHB 2VG5B 4F67A 2QA4S 2E44A 2EC0A 3QAEA 1I51B 5HMWA 3OFHA 2DNYA 1I5OB 4U8VA 3S01A 2ZITA 4Y0FA 1LWFA 2Q6CA 1Q8LA 4NA1A 2G4BA 3FDSA 3H2LA 2EFOA 3S6EA 3HVRA 3MMAB 4ZVEA 2HFVA 2YPZA 4IQMA 3TAMB 3TP2A 1T05B 4PEOA 1IQZA 3FFIA 5CYQA 3AXMA 3HHEA 2VC1A 1N8RT 1RT3A 2R4FA 1R8PA 3IFEA 2XHWA 5I3QA 2GW8A 1KLNA 1U0HA 4F50A 1RZMA 3OXGA 3GSDA 4DX5A 4B3SJ 3BSOA 4CH0S 1RTDB 3DI6A 4IR9A 5B0DA 5IWAF 1P1TA 2ZWOA 1HNZF 5E3CA 4OYPA 3OW2R 2N7YA 1FO1A 2H48B 2Q79A 4IG0B 1K9MT 5ETKA 5C25B 4ZDNA 3B82A 3M4XA 4K4SA 2QFJA 1HR0J 3UN5A 2AD9A 4WXOA 1CJVA 1NB7A 3BB5A 3GG0A 2MSSA 4B3MF 1OSCA 2R8KA 4NL5A 3DRSB 1MMDA 2Z2MA 2XB2D 2VBWA 1FKOA 3AQPA 2ZH2A 1K44A 2EI5A 1N48A 4LREA 2AEFA 1HWUA 1JLFB 1S79A 1RTJB 4O4GB 2JLGA 5AE3A 5HSPA 2YNFB 4CTAB 5LJ3Y 1C0TA 1UZHA 1XR5A 3NAIA 2WB1D 2PIIA 3K59A 2HMIA 4ZCLA 1QLNA 2DITA 2V2VA 3KHLA 4ZPAA 5AXLA 1RT5A 1C4AA 2P6SA 4WPAA 2DGXA 3VF0B 1N32J 3CPWR 2CQHA 1D09B 1CC7A 3JS9A 1S76D 4HVZA 1X4FA 2OJ3A 1WELA 4CO5A 5M2PA 2VG7A 3HXMA 3KLIA 5HK4A 3M2RB 1N5QA 2DY1A 1KEKA 2XMTA 5L38A 2YNHA 1UAWA 2J6TA 4JUZA 1UMJA 1GMVA 1RKJA 5I3PA 2JOQA 4OZ2A 2VHGA 1VQYA 3DRYA 4DLEA 4DPWA 1N5YA 4J9VA 3O8WA 5ADZA 1LQ9A 3JTPA 5D78A 1HQ2A 2E5HA 1NZ8A 1NHVA 1IBKJ 3VAKA 4IO1A 4ECYA 3EX7B 4N5SA 2ZOMA 3PX4A 2DNLA 9ATCB 1TFYA 4YY3J 4A4JA 5L9XA 3M8YA 1ZTWA 5F0UA 2OGUA 3M6UA 3A13A 2ZUAA 5FIIA 2FDNA 3F0NA 3A8IA 4CLPA 3U1MA 1UVIA 1LWEB 3W5YA 3VQTA 2CQ0A 7AT1B 2Y1IA 4HDHA 4CNYA 3RUBL 3OPKA 3CJTA 2PMWA 3AB2B 1NJZA 5D6GA 1TL4A 5L39A 4PYAA 4CLSA 3AOAA 3G9CA 4KKOA 1UWBB 2CQ4A 3MEEB 1FD2A 4CQ1A 3NLCA 4L75A 1TK0A 4BDPA 4HH1A 4ZPWR 2OP5A 4DZDA 2LP4A 5F8NA 1VQ9S 2KL8A 3W2VB 1S7IA 1WORA 2B6AB 1QAXA 2R9LA 4RPFA 5DM7Q 2CADA 3PW0A 3BQ1A 4JV5J 5IT4A 1SKWA 3ZC4A 1WG4A 3E01A 2LXIA 2BZ2A 1B70B 1I94F 2L41A 1NDKA 2JWNA 4B3RJ 1FEEA 2KG0A 1SL2A 1T9WA 3KK1B 1F3VA 1HW9A 1JLBA 1XC9A 4BC9A 1CQMA 1N6QB 3SIPB 4N41A 3D4JA 3S1TA 4M5MA 2OMLA 1IKWA 4ZVSB 1RAFB 3KLEA 2P9GA 1XIQA 1EETB 2E1RA 4NI2B 3S8SA 3PRBA 1JWWA 1FRLA 2LQ5A 1WOOA 2HYIB 1TL7A 1SQFA 2FIUA 3NAHA 4WE1A 3UNGC 3P45B 2XCPA 3CDBA 2I6WA 1NJIT 1T95A 4YS2A 5FDLB 2DCLA 5HVHA 2GZOA 4F04B 1RHKB 3C6UA 2DRBA 2F7VA 5J2PB 4BWMA 4X64J 5F8LA 5HO4A 4NCGA 4LJMA 3O5TB 5KT5A 3EGWB 2UUAF 2WSCC 4PCQA 2V5HG 3SMZA 2DH9A 4U8YA 2C42A 4DR4F 1H73A 2KT2A 4MTPA 3QRQA 4ED0A 3IM8A 2ATCB 3HHLB 4AYBD 2JNJA 4CO3A 2VPYB 2VASA 4USVA 4A8XA 4GKJJ 4NLOA 3GPAA 2AGQA 4KFBA 2VJVA 4W98A 2GIQA 2JLEA 3BSCA 1S0OA 2E1MC 1QE1B 2W8LA 1JMTA 1M5KC 3PG9A 3A3OB 1VOMA 4CLUA 3DRPB 3KUEA 4ID8A 2LMIA 1HNXJ 1S1UB 2YKNA 3EVWA 5K14B 3SQOP 2BDPA 4OI6A 3QT7A 5EGYA 3IP0A 4LF8J 3RAQA 1TU0B 2QL5B 4NLGA 1FDNA 5F9LA 5T41A 4OI1A 2RU3A 5K8NA 1XR7A 4MKYA 2Y9HA 2HNYB 2HIQA 4OQJA 2UUCF 2XO6A 4Q8EA 4QJVA 2FVPA 1N5SA 2I0XA 2D7SA 5RUBA 4FYXB 3CSKA 2POKA 2KVQE 5HP1A 4DV0F 3QATA 2ZNZA 3OTOF 3FSYA 2K7KA 1BY9A 5SZTA 4J9NA 4PQUB 2ZVSA 2Q3PA 1CULA 2DPJA 3AAWB 1RWWB 1T9VA 2B43A 3OL9A 5HQ8A 2JC1A 5C2CA 3T6JA 2DXFA 1S6QB 4DL7A 1KLMA 4DZ6A 3D54A 2ZHBA 3NS7B 4WTOB 3FCHA 1R27B 3BO2A 1KQSR 4EMDA 1N4LA 5IXUA 1SC1B 2PEBA 1C1BA 2OO4A 3C6TA 2QLFB 1REVB 3EXCX 2MSTA 2IM0A 1JLQA 1SI9A 4H4KC 1GMWD 2JDJA 3EPIA 1S97A 1UP1A 3CCSS 3W61A 3HPOA 3G6XA 4RKUC 5CABA 2AJQA 1GQEA 4HI1A 3RTVA 1DTQA 2EBEA 4CO2A 2HS0A 4USKA 4WFZA 2IAJA 4ZP9A 5GVQA 1F1BB 4BHQA 3VR1A 4TU8A 1MMLA 4OIXA 2NREA 2EBGA 1JJHA 1VGYA 4YP3A 2K06A 1SQEA 3JSRA 3TVYA 1RHRB 2QGFB 4MK7A 2CQIA 3GZ7A 1X9SA 3OVAA 4JYAJ 2DNKA 4LFAF 4MYUA 2IC3A 3P5TL 4ZP6A 3PO5A 3HFZB 4Q2MA 2B4OA 3LGNA 5HMXA 4ECWA 3OHBA 4LBIA 2WVDA 2RUGA 3K8VA 3M6WA 4K4WA 1HBUB 3C16A 3DOLA 5KFFA 5DQIA 1SKSA 5JXSA 3TOQA 1IWAA 2OFHX 2NS1B 4DSLA 2G0IA 3PW5A 1L5UA 3BS9A 2RIJA 4GVBB 3UDEA 3N6NA 2V63A 3M32A 3R97A 1HQUB 2MQ8A 3MD1A 1IKXB 1VRUB 1QAJA 5KG2A 2WONA 5A8RA 3P5BP 2MKHA 4L6V3 2RHSB 3GJSB 5D3GA 3R7NB 4K0KJ 3IR6B 2PFFB 1Q82T 3VAJA 2ZJQQ 3M30B 3SQGB 1VJWA 5EHHA 1SJQA 3KK2A 1F9FA 5F3ZA 3F44A 4DFJA 5DO2A 4DN9A 2AEMA 2RVJA 4EK2A 5I3UB 4UY8T 1RWMB 2WAQD 3NL0A 1WHWA 2YX7A 4WWSA 2K3IA 1OYEA 3H25A 1Y3JA 2KM8B 2IJFA 1LWXA 3LW5C 1X4DA 3OV7A 2R7TA 4UW2A 2KT3A 1FKAF 4ZLJA 4F4ZA 4DL2A 5F8JA 3UVJB 3ZNJ1 3KG4A 1LW2B 2XZDB 1RTIA 4Q5VA 3CJRA 2WOMB 4H4MA 3JTOA 4YHHF 1VQ6S 4OJGA 4X4QA 3ZXWA 4JV2A 3WIUA 1DQ8A 3OJUA 3CDEA 2CDQA 5DDPC 2FHKA 2PD1A 2J76E 2H51B 3VV2B 1S5ZA 1YVFA 2EFNA 2HFOA 2VG6B 1E6VB 4N8OA 1VCTA 3WBZA 1TL1A 4OHZA 2DXEA 2L48A 1BHNA 2IRYA 1QSYA 1EKRA 3BKFA 5HMYA 2JC0A 2NXEA 3DFEA 3UCGA 4W90B 2DD8S 5A76A 2AV5A 2E5LF 1GMWA 5LMNF 3HT3A 4M5HA 1UA1A 1I6JA 4ZIVA 3AH6A 4XO0A 1R0AB 3SFGA 5LXYA 1GNKA 3AT1B 1VFJA 1Q81T 3C8YA 2B8PA 1FE4A 1FA0A 4P7VA 4M5DA 4HLBA 3CJ4A 2VOPA 5IM0A 1HNWF 1RT7A 2ZVIA 2ROEA 1ITPA 2HQGA 2EG2A 2B56A 3US5A 1WOPA 4H4OB 4ZHRB 1P6TA 3GQCA 2GFFA 2FYXA 2RMLA 3BEGB 5AJ3J 1SC6A 4KBIA 4DL5A 4PXEA 5C24A 1LW0A 3MCMA 4RW9B 4L72B 4ID5B 1HD0A 4LFCJ 4DR2F 4C11A 2NQPA 2V2KA 3FEXB 3KDNA 4K2XA 1RKIA 2PA8D 1R8HA 3WZ0A 5AXNA 2XNRA 2AZ1A 5FLXY 3G8TA 2B51A 4CLWA 3CCUS 3Q8SB 2V67A 2DH7A 1TK8A 1W2BR 3PEHA 3TI0A 1K73T 2DRAA 5DM6Q 2RRAA 1Z2LA 1RBOB 1YSJA 3R7SB 1LV5A 4OJ1A 3DRXA 3DLBA 2X3GA 2G2ZA 2ZUGA 2YWWA 1ZA1B 4RW8A 2HNDB 4QZVB 1WKLA 4BS2A 1L3SA 3SCKE 4ZVFA 4USWA 1M1GA 3CMES 3K5PA 4AD6A 1U1PA 2MZ1A 2XC9A 3O3LA 1RABB 1XEZA 4ECVA 2B8QA 3PR5B 1C0UB 2PMZD 4WFXA 1LOUA 1JLGA 5KFCA 4PR6A 2MHEA 2QL9B 1CJUA 4Z7CA 2J0XA 2VQFJ 3T1AA 1LFWA 4KR0B 1KQGB 2F40A 2CVEA 3BH6B 2BR0A 2OSQA 4DBQA 5KFBA 2M70A 1ZPVA 3WHIA 3D6HB 2O1PA 1B99A 3PKMA 7FD1A 2HRUA 3GIMA 2XMMA 4KB7A 1DLOA 3NGTA 2MKIA 4DFPA 3DOKB 2MXYA 3NGKA 5KT3A 3MEKA 4KAIA 1GXUA 4ECZA 2HQ3A 2W4CA 1MWYA 4TYAA 2RDJA 3BGRA 3G71S 3GYGA 3N6MA 1IKVA 2OPSA 1Y9OA 1Q8KA 5HBMA 4DS5A 4WIQA 2LECA 4K4TA 1CEZA 4ED8A 3R1HA 3VAHA 4I2PA 3DHWC 3IXQA 3J80Y 2GIFA 4CLLA 3GMGA 2P9CA 3SSRA 2R8GA 3CD7A 1EQ0A 1P1LA 4O3PA 1W26A 2YQ1A 3V81A 3BBCA 1NK4A 4RO0A 1BWEA 2RF2A 2OPPB 2GQ2A 4UOCA 4LVOP 3E51A 1Y5LB 5M2RA 2BJEA 4WKYA 4R25A 2PC6A 5C42A 1BQXA 1C2PA 1KS2A 3LGMA 4NZ6A 2IA0A 3SSQA 3P6YC 1U6FA 4I6YA 2MZSA 1HWJA 4CLFA 2HG4A 4FVMA 3D5MA 3FCVA 1IBLJ 2ZE2B 2LEBA 3PHEA 4X4OA 2NXCA 2ALZA 1RHJB 1WF0A 5LXRA 3THPA 4U67Q 5KFHA 4PPDA 4ZVUB 2V0NA 2WB4A 5ETQA 2O67A 3VVTA 4K4XA 3HFKA 3BYRA 3GYXB 2RRNA 1VISA 2O01C 3GIKA 4F0KA 4NLRA 4U7UD 1QUVA 3A8JA 2QT7A 3KJNB 4MJKA 5E33A 2V4QA 5E41A 1U1QA 1UTAA 3BR8A 3D1QA 2DB1A 2VODA 1TKXA 1KOHA 2PFDA 1JJ4A 4URSA 3T5JA 1RU1A 3T1YJ 1HYSB 3GFYA 4ES2A 2NPFA 2QIFA 1QUPA 5AXMA 5CYJA 3C2PA 3R2DJ 3EGVA 1E6YA 2Y1LB 4BBYA 2YNGA 1IR1A 1OPIA 2Q6BA 1IQTA 3MD3A 1RHUB 5IV3A 1WHYA 2PDAA 3JSYA 4DF8A 3A3PB 1B64A 4AL6A 5H9FK 5EWFA 2VFRA 4P6QA 3RR7A 1X4CA 2V4JB 1MG7A 4RWWA 3H40A 3FQLA 4NXNF 2YNIA 3EVMA 1FDBA 2WSFC 4N8NA 5MAOA 2ABYA 3KXDA 2XY6A 2IM1A 2FJXA 2CKWA 2AMCB 2IBOA 2EKNA 2EW9A 3CJQA 1GXLA 1VMBA 2PMHA 1O6XA 3OXFA 1RYSA 3H0PA 4LF7F 4J9MA 1KDNA 3I31A 1IXKA 4Q2LA 3G82B 2DHAA 4A8YA 4LF5F 2UU9J 2KRRA 1TV6B 5GAGI 2XULA 3T5KA 4EZ6A 1N36F 3BO3A 2ZBPA 1VQMS 2A10A 4DR5F 1SV5B 4URGA 2XMAA 3KG1A 1VC5A 3W2WB 3M9MB 1RTHA 2VG5A 3UPFA 4C0BA 3CNQP 2AYEA 3D6MB 4TU7A 3IWXA 2O3DA 1OIAA 1WG1A 4C3MA 1X60A 1BMQB 4DV4J 1KFDA 1V3SA 1MLAA 1G7CB 2AYMA 2B9EA 5H1SV 2W25A 4Y65A 3PIPQ 2CQGA 1WKJA 1ZYQA 1LWFB 5HLFA 2HPUA 3TAMA 2EKYA 1T05A 2CRLA 4IKAA 2D9OA 3DGVA 3OFGA 1CJKA 1O8BA 5CZXA 4AXJA 2H5EA 3GFXA 3BN7A 3M1VB 2I8EA 1YQHA 1Q16B 4ZLPA 2X1GA 3H2VE 1S1XA 1Y7PA 3NGRA 1RTDA 1EB0A 3W9IA 3KFWX 4QYRA 2YWGA 1XNRF 5JJBA 1X5SA 3P3DA 4NEZA 1S7HA 1KWMA 4UOGA 4FXWA 4DF4A 3C66A 3R27A 2CWXA 1PBAA 3PR4A 1FRHA 3J7ZT 3T5HA 2OD6A 3VALA 4C8NA 4PKDB 3TJ9A 5KG7A 4YFUA 1S9GB 4OI3A 4V1Ak 3OBIA 3OR2B 3V4MA 4PAAA 4MT1A 3PO4A 3LAMA 2YKOA 3RU0A 2Q66A 2V68A 2GVZB 3R6LB 4C7QA 1FE0A 2VA3A 4K5SA 1CJVB 2HVEA 3U02A 1U1OA 1H7WA 1NSKL 2E1PA 2LDIA 2AX0A 2VF3A 3TQEA 4O4GA 2UXCJ 1ZETA 5K8MA 1VBXA 3H5XA 1VLOA 2YNFA 4CTAA 1RCOB 4K4ZA 4FBTA 5F8IA 4IUFA 4QIGA 5T7LB 2FB0A 2N3LA 4ED5A 4GO7X 1CG2A 3CUNA 4BCAA 3R6GB 1R8BA 1DTTB 4ZOSA 2GO8A 2HMIB 1NDLA 1NK7A 1VIXA 1TKDA 3AHPA 4O4RA 4C98A 2GGPB 3PZPA 4UZCA 2GCFA 4USJC 4N7TA 5E2QA 3M2RA 3UQSA 4JP8A 1FKPB 1F2HA 2VOOA 2JVRA 3KLIB 4JI8F 4Y2AA 3UD5A 4LF2A 1PYSB 3KYLA 2MQNA 1OS5A 4LR7A 1HBNB 3M9NB 4AXIA 1SC3B 1N5YB 2YVSA 4B9MA 1CJTB 1YHQS 3TX8A 2LQBA 1QVFR 4LRAA 4P10A 1PAEX 2CJXB 2HZAA 1M5PC 2E7VA 1DJ0A 2NUHA 1TMMA 5KFTA 2FLLA 2AJFE 3HX9A 1NSAA 5IS2A 1LWEA 3KLHA 4OX9J 1FXRA 4KT0C 3TA0A 2RQCA 4J9OA 1UWBA 4O3RA 3MEEA 2AJ2A 3UDCA 2ROGA 4J9QA 2FC9A 1B7YB 3GYNA 2E66A 1PILA 3W2VA 3CC2S 1BC6A 3CJKB 2B6AA 4M94A 3ISNC 3MAAA 4ZP7A 1NB2A 1MN7A 4DR7F 1HI8A 3MM6B 3MMJA 4DL4A 3M8SA 3GCXP 3MPDA 4OJHA 2Y3YA 1R0CB 3KK1A 1SKRA 3LGHA 4WFYA 4CT8A 3E01B 1G3OA 3V6KA 2R7WA 4N47A 1N6QA 2E9TA 1QY7A 2FHOB 1N5VA 1EETA 1JLBB 1HA1A 2RD5C 2EPIA 2UXDF 4NI2A 5KFEA 4IFVA 2FJDB 4JI2J 3KLEB 2EK1A 3UR0A 3SV4A 1X7VA 2HS3A 1IBMJ 3RRHA 1NHUA 1ZS6A 3D3CJ 4USMA 1UCNA 2OTLS 5FDLA 3OTEA 1TL7B 4JI3J 4DMZA 2J7WA 1U0SA 3Q86A 3NS5A 1T7PA 1WF1A 4EI2A 2QLJB 3NXZA 1JNZB 1R89A 4M5JA 1AYEA 4NZ0A 4DCJB 2WZ1A 2RRBA 2BQUA 4G1QA 5JUMA 2HLTA 1WDTA 3OVSA 1FJGF 3D7SB 4KHRA 1T3OA 4UQGA 3Q24A 2YH0A 2RILA 5D0GA 1N0VC 2XNQA 5CD4H 4M5KA 1I1GA 2V8PA 4K5RA 2W9BA 1Q8IA 2MMYA 4QWDA 4A8WA 4G65A 1SIWB 2C3UA 1D8YA 1SC4B 2UUBF 4PG6A 3HHNB 2R7XA 4OHWA 1BD6A 1YBUA 5BYRA 4DL3A 3LA0A 1UVJA 4LF6F 3AD8C 2HVHA 1JLEB 4F3MA 3GJTB 1RAIB 4R8UA 4IH7A 1TUVA 3K57A 2BOAA 2MLZA 3DRPA 1XERA 4QIWD 3EXYA 1S1UA 3OSNA 5K14A 4ETZA 1PCAA 5H9EK 1MSWD 3IWLA 3W66A 4HACB 4RJVA 1F9EB 4CH1A 5KT7A 2YKNB 5E0OA 5L1LA 1L3UA 2X3DA 1MROB 3AA8A 1NJYA 5F41A 2BKPA 3F41A 2MKKA 3HHDA 3ZZZA 2NR0A 4JI6J 4M95A 3DNCA 1HI0P 5HATA 4DQSA 3MAQA 4MYTA 8ATCB 3RRKA 4RNOA 3BO4A 5FLXU 2N82B 2RHQB 2DGSA 1U8WA 4B9SA 4PQUA 1WSVA 2NSBA 4RLEA 3LP0B 1D9DA 3PW2A 3W65A 1SKUB 2M52A 1NK0A 5HN0A 4DL6A 1S6QA 4MAKA 1CULB 2BACA 2MHNA 1YZ6A 5J1NA 1C1CB 4FVCA 4CP5A 3DHXA 1KLMB 2H3EB 3GJQB 2C3YA 3CCJS 2Z8QA 1REVA 1Z2ZA 2HQIA 4RUBA 2J8SA 1NJXA 2CPHA 5KFSA 4NCAA 4EBEA 3ET6A 2E9RX 1JXVA 2KXNB 3HCXA 3PVXA 4PRFA 2FLPA 5B0GA 3CJ2A 2B9YA 2FVCA 4JI5J 2HHVA 1YRXA 3MZIA 3DYAB 3IM9A 3G8QA 4B3SF 2H4WB 3SDEB 5HVGA 3JXOA 4HR2A 3PKYA 3A8EA 1A0OB 1DTQB 4X4VA 2AZ3A 2JHEA 4ED1A 3FUYA 5J2NB 3BGUA 3ISZA 1H2TZ 1VK3A 1NK5A 4OX7A 4OYOA 5BYQA 2UXBJ 1Q5YA 1RWNB 2R7SA 3RG6A 5KFKA 2HKEA 4UY85 2XM3A 5L1IA 3CCLS 2VBZA 5CHCB 1AFJA 2G1HA 3JSBA 1HR0F 1W2IA 3CW2C 4JOUA 1FDDA 1QDUB 4B3MJ 4OHYA 2V6AA 3PYEA 4HTIA 2HIYA 1NEEA 3L09A 2IC3B 1V6HA 2QA1A 1N34J 3GJRB 1WSRA 1NCLA 3U1NA 1HBUA 1VBKA 4F4KA 2AKWB 4PG8A 3M8WA 4DR1F 5ITHA 3THVA 1JIHA 4GVBA 4DHVA 3J80U 3G2XA 4IH6A 3I87A 1IKXA 5KFGA 2C2RA 4M1KA 3SEOA 3NG8A 2JEFA 2AT1B 3VZHA 2E7XA 1J2VA 2XS2A 1N32F 5GMDA 2MLYA 1S4EA 3H98A 2CUYA 3SQGA 2C1EB 5DDQC 1YJVA 1G4CA 4KIAA 3FBFA 1RBLA 2AX1A 4NLSA 3MOJB 1ACMB 2HBRB 3HF5A 3LF0A 3KDOA 1OQ3A 2CJKA 5HMZA 1HWLA 2AJ1A 2XZTB 4ELVA 1QM9A 1FRXA 2RB7A 2YY3A 3LUYA 4MFBB 3NGSA 3QIPB 1G2EA 2OKQA 2KTQA 1IBKF 3UVJA 1S6UA 1LW2A 4F36A 2UV8A 1RT1A 2I9SA 2WOMA 4K7QA 2D41A 5DQGA 2V9KA 4YY3F 4DPUA 2CQ1A 4IRDA 5G0RA 4WXWA 2IHR1 1UEVA 3RR8A 3BSNA 1KVKA 4F25A 2P5VA 4NX9A 3OUYA 4OZ0A 4FKXA 3I5CA 3Q8VA 4Y2KA 4LSNB 3SI8A 3B54A 4HHHA 2M4MA 3FSXA 2XYHB 2LDYA 1HPZA 2VG6A 1E6VA 1O5JA 1A6LA 2F8MA 3EZOA 4CH7A 3MCSA 3M8QB 5EUHA 4QWAA 4ECXA 1N5TA 5U47A 4KHPJ 7FDRA 3FGVA 4ZPTR 4UOFA 2NXUA 3KMSA 4PXBA 4YB6A 1TUWA 1ULRA 1YIJS 1RJJA 2CPXA 1VBZA 5KG0A 2IJRA 4C4WA 2DGUA 4ZCKA 5A6PA 1I94J 4JV5F 1R0AA 4RL1A 3SCIE 1R31A 3POTB 3LO3A 2VBXA 3R7BB 4HKQA 5C5JA 5DG9A 1XMQJ 2HBYB 5CD4A 4G3IA 3N0VA 2DY9A 4LSLA 4H4OA 1VQNS 1L3VA 2W2NP 4U6PA 5IM0B 1ZBTA 2NSCA 3WDOA 5K8PA 2HHSA 4ER8A 3UO0A 2LQ8A 2ZBCA 2DNQA 1UEUA 4GO5X 4E0DA 4RW9A 1KBRA 3HD1A 4QU7A 5C24B 2BKNA 5KFYA 3VVUA 4ECSA 4Q7AA 2FTRA 2FZKB 2DEIA 5B0BA 4EBCA 1XMOJ 2ZH9A 3A4TA 4CO1A 2XLJA 1HWIA 4OZ1A 2BJ8A 4JI7F 5SUHA 1WKKA 5IT9Y 5E7OB 3BF4A 4X64F 4NEYA 3Q22A 2M8HA 4Q0BA 3HM9A 2N3OA 3CXCR 2DHGA 2FHJD 5HJYA 4DR4J 1CLFA 2QMXA 2KHCA 2CJBA 2GVDB 2HZVA 1FVQA 4CYUA 2HNDA 3K7RA 3JAMY 4WK1A 2GAHC 5L9NA 1FVSA 2L9WA 5HL7Q 1XMBA 4A8QA 4RW8B 4DUYF 3JQMA 3TVZA 4FF2A 3I5AA 4DQRA 6AT1B 1RU2A 4GKJF 1UKUA 2ROPA 1GH8A 5KFUA 1PC5A 4YR0A 4JBCA 5F3TA 5HANA 2E29A 1H38A 3HT0A 3BYPA 5F8HA 1M5VC 1NRKA 1C0UA 4FPRA 3CJSA 3H90A 2R8HA 3IBCB 5AXKA 5KFOA 4EEYA 1DARA 1UZDA 1HNXF 4UTGA 5KFDA 1R8AA 4ES3A 2DR6A 2ALYB 5ETTA 5KG1A 2UUTA 4WIIA 2ZBQA 5KG6A 1UVMA 1NBEB 2R7UA 1Q0NA 3UFCX 3PRVA 2AGOA 4EO6A 3CF5Q 2AW0A 4DQPA 2HLUA 2M88A 2R8JA 4OZ3A 4DQIA 4QBUA 4C9DA 5BR8J 4DV6J 2DO0A 1QSLA 4ICLB 3MR2A 3T9ZA 4DV0J 8RUCA 3R5BA 4F0MA 3DOKA 4I2QB 3MXHP 3PTWA 3QT8A 2L08A 3KWMA 2XHCA 1NNDA 1DLOB 2CNLB 2ZDPA 2HFZA 4EO8A 3MR5A 5F9NA 1F9HA 3DM2A 1RAJA 2ZJPQ 3P8BB 1KSPA 3HVTA 2DR5A 4QWCA 4DX8H 4U7CA 1EHWA 3JSMA 2OPSB 3DDNA 5A6WA 3HDSA 2QO3A 3QGHA 2VBYA 4TN2A 1FESA 1VQ4S 3BSAA 2MQLA 5LL6d 2DHSA 4NPOA 3MM5B 4ED3A 4I2PB 2ZM6F 2UZAA 2HBZB 1N56A 4W4MA 2H9ZA 2OPPA 4NLYA 4NA2A 2XMJA 3CTRA 3PX0A 3W5XA 3V81B 2Z2YB 5DG8A 5DZ6A 1UVKA 4ED6A 2DTJA 1UJ4A 2V8GA 1RTZA 1SQGA 3MTJA 2YPYA 5C42B 3N5BA 2ZE2A 4DPTA 1FX2A 3QSIA 3OXLA 4ZP8A 4NASA 3V2UC 3ILOA 2F5GA 3TEHB 4DV7J 1VQ5S 4KE5A 1FF2A 3F73A 2YBVA 1S72S 4XDCA 2WCXA 4FNIA 3PEJA 1WACA 1OQ6A
chains in the Genus database with same CATH topology
2PA8D 1XMOF 1IKYB 1RQ0A 1T94A 3T3FA 1R8HA 2B7BB 2X1BA 1T02A 4I4BA 2YH1A 5THWA 3WZ0A 4DN0A 1FJEB 4NCBA 1FRKA 5AXNA 1B7FA 2UP1A 3MPWA 2XNRA 2ERRA 3MGJA 3QIDA 4NA3A 5B7WA 1K0VA 5FLXY 3G8TA 2B51A 4PXDA 2IVMA 1NKEA 3KOAA 3CCUS 2C3OA 3Q8SB 1UW4A 1XN9A 2DH7A 3M6XA 2IVYA 1TK8A 1W2BR 3PEHA 2FGOA 3TI0A 2AWZA 4P2SA 1K73T 1LWCA 2RQ4A 4WCEQ 2DRAA 1CC8A 5DM6Q 1U1KA 2RRAA 3DOLB 1Z2LA 3DCAA 3MFIA 2CJAA 2FHJA 3SV3A 1S77D 1YSJA 1HNIA 3KLFA 1LV5A 3QAUA 1FTCA 4OJ1A 2M9KA 2A3JA 3DRXA 3T1YF 1K8AT 1PC4A 3M2VB 2X3GA 4XK8C 3KK3A 3DLBA 4B3OA 2IA6A 2ZUGA 4ECQA 3TAPA 1HQUA 1U8SA 1A9NB 4HEA9 4NYPA 4RW8A 3RAMA 1VRUA 2HNDB 3VAGA 4RUCA 2XWXA 4QZVB 3DLLQ 4OLPA 4OX6A 1F5BA 2BYCA 3G6ES 1UA0A 4BS2A 2ASLA 3HVAA 4ERDA 5KAKA 3M32B 1HHSA 4NLVA 1L3SA 4YB1P 4DV1F 5KFVA 1NK8A 1NAQA 3AQOA 3SCKE 2YX1A 4ZVFA 2QV6A 3MM7B 3I82A 4PUOB 1CVJA 2R7QA 1G6BA 3M30A 4NWBA 2J9CA 2WONB 5A8RB 1B0VA 2YNGB 2LQ9A 2BE2A 4X84A 3CMES 4DDFA 4C8YA 3K5PA 4K0KF 3L3CA 3MURP 1U1PA 2ZD1B 5D3GB 2MZ1A 4RU2A 3CCWA 5CYMA 5GADU 1Y3KA 2MQMA 2XC9A 2UVRA 3LOUA 1VRTB 5E5NA 4C0HA 3O3LA 4XPCA 2V4JA 3UE2A 2RJZA 3LP1A 4DFKA 1XEZA 4ECVA 5I3UA 2DNGA 3SFUA 1X8DA 3KK2B 4B3TF 2LCWA 3PR5B 2J6SA 1C0UB 2PMZD 1VQPS 1TL3A 2YKMA 4WFXA 3PACA 2IRUA 3A1YG 1ZAVA 1LOUA 5KFQA 1JLGA 5KFCA 4ELUA 1T03B 2WSEC 4PR6A 2CYYA 2HNZA 2MHEA 3TA1A 4WFAQ 2JFDA 4NMLA 2AP6A 3DLKB 5J1PA 3TANA 1FJCA 2J0XA 2DGQA 4TNOA 3CB4A 4TLRA 3MHYA 1L3KA 2Z0GA 2N7CA 2FUG9 2YWKA 1WEXA 4A8SA 4XAKA 3T1AA 4QU6A 2RKIA 4G6VB 4FZVA 4ZK7M 1ZPWX 1LFWA 2XMKA 3IS9A 4KR0B 4OV1A 2EFQA 1FNXH 1KQGB 2F40A 2KFYA 3NWGA 2DH8A 4YDXA 1HQEB 2BXJA 2CVEA 1FNMA 2QE5A 5KT6A 5B0AA 1YJWS 2BR0A 2BANA 3MAHA 1H6KX 2OSQA 4MKAA 4DBQA 1M1KT 5KFBA 1GXTA 2DJWA 5B0CA 2M70A 2CZ4A 3HKWA 1ZPVA 1NKBA 4F8RA 5DRKA 1WF2A 2GJIA 2U1AA 5KT2A 2O1PA 2IM3A 1Q7YT 3PKMA 4MK9A 1RTIB 1NJWA 3HZEA 2W9CA 1KR4A 1Y00A 7FD1A 1U2RA 2GC8A 2HRUA 4NYZA 2E1CA 3DLGA 4ZPVR 4H4MB 3LWMA 5BR8F 3LALA 3OFEA 3GIMA 2XMMA 2MDAA 4DV6F 3CGIA 1WTFA 2UU9F 1EP4B 4ATNA 2I5JA 4HH0A 4KB7A 1DHMA 1DLOA 3GFHA 2KU7A 5KTQA 2MKIA 4DFPA 3B4MA 1TQLA 2OAUA 3DOKB 3FZBA 4CNZA 4F02A 2MXYA 3NGKA 5KT3A 1KHWA 3MEKA 1SV5A 4KAIA 1GXUA 4ECZA 4I67A 3W2WA 5HROB 3IR5B 1X0FA 4F3OA 2HQ3A 2MZTA 2W4CA 1MWYA 4TYAA 4YUDA 1AXQA 1Z4UA 3BGRA 2RDJA 1QAIA 2GX8A 2JJ4D 2DO4A 3G71S 4NRTA 3N6MA 4V19J 1IKVA 4F4YA 2DNZA 3QO9B 2OPSA 4C3LA 4E8UA 1Y9OA 2RT3A 2KFZA 2G9OA 2XG8A 5HBMA 3PXGa 4DS5A 4H54A 3DU5A 2JRSA 2VH7A 1TFWA 3PX6A 3FJ2A 2LECA 4Y34A 4ZVHA 4BC7A 4RW6A 4HYKA 2DR7A 4FF1A 5B0EA 2WBMA 4K4TA 1CEZA 2HS4A 3CCZA 2FLNA 4LQ3A 3JB9k 2GMLA 4ED8A 4JI0F 2XCAA 2ZKTA 3CJ0A 3ITHB 3VAHA 3R1HA 1NU4A 1S1VA 1GX5A 3M2UA 5J2QA 4I2PA 1TR0A 3DHWC 3IXQA 4DV4F 2LEAA 2HHXA 2PN6A 1TL1B 3J80Y 2PO4A 2ZOGA 1KFSA 4O0IA 4MIAA 2KB2A 5J1EB 2UV8G 2YWEA 2G13A 1NH8A 4ZCIA 2M5YA 1O0PA 4DFMA 1WTBA 2KZMA 2E5GA 1S1TB 2P9CA 3GMGA 3SSRA 2R8GA 2R7VA 2VFUA 3CD7A 4LT6A 1P1LA 1HNVB 1M5SA 4O3PA 4C3KA 3CJ5A 5HLFB 1BLUA 1YGYA 1ZM2A 1BQMB 2ZZNA 5KFNA 1F0XA 1SH3A 3T1HF 4FN5A 3Q2TC 2BJDA 3V81A 2MY7A 2KM8C 3M1VA 1NK4A 1BWEA 4YQWA 2IM2A 2MGZB 4KC5A 1U45A 5IQQA 2RF2A 2OPPB 2GQ2A 1U2FA 4UOCA 3ZZRA 3EZUA 4LVOP 1ZM3A 4B9VA 2XS7A 3E51A 3MDFA 4WK3A 3SCLE 1Y5LB 2XZWA 5M2RA 5LSOA 2BJEA 5I42B 5L1KA 4WKYA 2DISA 3RRGA 1SL1A 2GMJA 4R25A 2PC6A 5C42A 4NLQA 1BQXA 2XSJB 1C2PA 1KS2A 4ZHRA 3LGMA 2M7SA 4DSKA 4NZ6A 4M5DB 2IA0A 3SSQA 3P6YC 1U6FA 2KYZA 4I6YA 5EWGA 2MZSA 1HWJA 1RT7B 3MECA 2R8IA 4MH8A 4ITSA 4EFAC 2J0SD 1S1XB 1MNEA 2HG4A 4FVMA 1ZH5A 3JTNA 3D5MA 4X62F 1OPZA 1O51A 1URRA 2CPYA 2E9ZA 3HI9A 2ZE2B 4KJIA 2LEBA 3DMJA 1PO6A 1HWKA 3T5LA 3H4BA 3HMJG 2JEIA 3OR1A 1P27B 3R5DA 4FNHA 3PHEA 3MMBA 4X4OA 2ALZA 1MMNA 3TR5A 1DQAA 1WF0A 2RQKA 4C97A 3NBPB 2D3ZA 4ID5A 4X4PA 4TY8B 5LXRA 2CVIA 4UUXA 3THPA 4U67Q 1LFPA 3VTIA 1S9GA 4DV7F 4DPOA 5KFHA 1LW0B 3OTDA 1X0PA 4PPDA 2KT5A 3SCJE 2V0NA 2WB4A 3KLGA 2O67A 2W4PA 2WTFA 2MB0B 4IG3A 1X5OA 4F2SA 4K4XA 3MUMP 3HFKA 1JNRB 3OR2A 3O44A 3GYXB 4B17A 2RRNA 4C11B 4C2MA 2P9EA 2O01C 2ZZMA 1Q1KA 3GIKA 4NLRA 3MEDB 3UCUP 1QUVA 2RSQA 1M5HA 1F60B 2BM1A 3I5BA 1SH2A 2ZH6A 2B9XA 2QT7A 4MJKA 5E33A 1YITS 1VBYA 5A2QY 3MUVP 2V4QA 5E41A 1U1QA 3BR8A 4ZS6A 3RBDA 2SXLA 3D1QA 1Q86T 2KG1A 2J5AA 3NKYA 2DB1A 1KTVA 3KG0A 4ETXA 1UETA 1A7GE 2GO9A 4KQZA 5KFJA 2OMOA 1S4FA 2VODA 3KJVA 1TKXA 3BR9A 1KOHA 1S0NA 5G4DA 1YRTA 1JJ4A 4URSA 3MR6A 3M2VA 4ILLA 3L95X 3T5JA 3K5LA 3L7PA 3KNGA 1S1WB 1HYSB 2I1RA 2KRBA 1WWHA 5KOWA 4XIUA 3KLFB 3GFYA 4ES2A 1VK8A 2LKZA 3ZZOA 2B5JA 2NPFA 3KK3B 4B3OB 2QIFA 3CEDA 1QUPA 5AXMA 1WD6A 4IDKA 5T7LA 1NZAA 5DGBA 2VKRA 5CYJA 3MFHA 1DZ5A 3GG1A 2DGOA 1ELOA 3K8WA 2EWHA 4ZMMA 3C2PA 4PUOA 4HT7A 2ZH5A 1YG0A 4DR6F 1E6YA 4GKKF 1Y0HA 2PA3A 4BBYA 2DGWA 1DTTA 2YNGA 3MM9B 1OPIA 4N56A 2Q6BA 3SZ2A 2B0GA 1IQTA 1RWUA 3MD3A 4A8FA 1WHYA 4QWBA 3IAM9 2PDAA 2Z2LA 2BQRA 3JSYA 2DIUA 2NZ4A 4ZKAA 4DF8A 3OSPA 4PWDA 1F5CA 2GGPA 1B64A 2HZCA 3BZQA 2BE2B 4AL6A 4I0WA 3UDLA 4OL8A 4M63A 5EWFA 3K2YA 2J9DE 2MZJA 2VFRA 2VZ9A 2BQ3A 4P6QA 3MI7X 1P9QC 3RR7A 1X4CA 5MLCV 5CYMB 2BRKA 4ECUA 5D77A 3N79A 2J7UA 3VAFA 1VQ7S 1FKPA 2GHPA 1FTRA 4PQAA 2V4JB 3W7BA 4LFCF 2G1DA 3LP1B 4RWWA 3H40A 1SIZA 4O44B 3FQLA 4J5OA 1HL6A 4NXNF 2YNIA 4DOZA 1WEZA 3KHHA 2XWYA 1D9FA 1FDBA 1TL3B 2WSFC 2YKMB 4I68A 4N8NA 4PG4A 1M90T 4KHMA 5MAOA 1JLGB 2ABYA 1ROFA 2PGCA 4FS1A 1OSDA 3MMCA 3OL7A 3PDNA 4HI2A 2XY6A 1VC6A 2IM1A 2FJXA 2RQMA 1HBNA 3K58A 2A2DA 2CKWA 3M05A 5K9FA 3IS9B 3CD6S 1D8ZA 2IBOA 1FRMA 3ONQA 1SUQA 2EW9A 1GXLA 1FXLA 3PY8A 1VMBA 2PMHA 3OLBA 3OXFA 1RYSA 4QW8A 4Y2CA 2CG4A 3QLHA 2QZ8A 3CIZA 3HZGA 2CQCA 2BANB 2AGPA 2DBBA 4LF7F 4J9MA 3E8OA 3ZZPA 2FJWA 4Y3CA 3FSIA 3I31A 2LLZA 2VPWB 2VB6A 4J9LA 1URNA 1IXKA 4Q2LA 5CA5A 1DAXA 3H59A 3P49B 3T9NA 2DHAA 4A8YA 2DNOA 1H7XA 2HHUA 2KI2A 4TY9A 4LF5F 2KRRA 1TV6B 2W8KA 4ECRA 4J9RA 5GAGI 2W9CB 4QYZJ 1J5OA 3Q0AA 1VS3A 2CQDA 2D3OR 2XULA 1BGXT 1S49A 3T5KA 3RB6A 1U6BA 1JLAA 2E5JA 5HROA 5D8HB 4EZ6A 1N36F 4DG1A 2DIVA 4ZPBA 4WFBQ 3BO3A 3VQSA 3D1OA 2C3MA 1RT6A 1VQMS 2A10A 4Q43A 4C8OA 2EFPA 4DR5F 5CH7B 1SV5B 4URGA 3KG1A 1VC5A 3I9V9 3W2WB 5LSLA 2COLA 3M9MB 2PI4A 4DSJA 3KLHB 5KG4A 4EZ9A 4QIFA 3TRGA 1XR6A 1RTHA 2VG5A 4JV1A 3UPFA 1TAQA 3BGRB 3G4SS 4I56A 4C0BA 1YBAA 3BREA 4FBUA 2AYEA 1IKVB 4HL9A 4Z2XA 2VC0A 4TU7A 3IWXA 3PM9A 2LU2A 2O3DA 1U48A 4CZCA 2MZRA 1OIAA 1WG1A 4C3MA 5HBMB 1VQOS 2MYFA 1KFDA 2DGVA 2V8VA 4KV8A 1V3SA 4UUWA 1ZTTA 3DXSX 4D3GA 3M9OB 2CJQA 4RW6B 3UI3A 4HHJA 3H4DA 4JI1F 1XTZA 3HO1A 4X4TA 2F8EX 2IFXA 4EYIB 1U4BA 1G7CB 2AYMA 3M8PA 5H1SV 2W25A 3CJKA 4NLTA 4Y65A 3PIPQ 2O66A 2CQGA 1ZYQA 1LWFB 5HLFA 2B7CB 2HPUA 4QQBA 3TAMA 1D3WA 2EKYA 1T05A 5AE2A 2CRLA 3CDUA 2B3TB 2RS2A 3IR7B 2JSXA 2QLWA 5EDWA 1NK6A 2IJNA 4IKAA 3MM6A 3GR1A 5EN1A 2D9OA 2I38A 3OFGA 5BYSA 5GAHI 2GMHA 1VHFA 1O8BA 5CZXA 4G1PA 4AXJA 2H5EA 3GFXA 3UD3P 3NCPA 2CQ2A 3BN7A 5EWEA 3M1VB 2I8EA 1YQHA 1YTYA 3KMQA 2CPDA 1QJHA 4AFFA 1Q16B 1C4CA 4ZLPA 2RF2B 2MKJA 3V6JA 1DFDA 2X1GA 4USHA 2WHOA 2FHMA 2FJEB 2XSFA 3H2VE 3MWBA 1S1XA 2XI2A 1Y7PA 1X4GA 4YDDB 1FJ7A 2AQ4A 1RTDA 4A8KA 6FD1A 2W7PA 3KFWX 4I1TA 4QYRA 2YWGA 1IN0A 2GHWA 2MQPA 1IUJA 1YJ9S 1XNRF 3VCDA 1VQLS 5JJBA 1X5SA 3ZZTA 2LXFA 3MECB 3P3DA 1S7HA 2ZHOA 3NBPA 4O23A 4J9KA 4FXWA 4DF4A 3C66A 4RNHA 3R27A 3T19A 4O3QA 3DMJB 3X3UA 3OHAA 2HGNA 1T8EA 3PR4A 4CIOA 1FRHA 3J7ZT 4NRUA 1R7IA 3B8HA 3T5HA 2ZC4A 2M3DA 2OD6A 5GAGU 1SJRA 1F5AA 3VALA 4C8NA 4PKDB 1JK9B 1U26A 2M2BA 3DLJA 4IFVB 4DEZA 5KG7A 4YFUA 2FVSA 4LMZA 1S9GB 2ZH8A 1QAYA 1KC8T 3KLGB 2V8HA 3FQKA 2L3MA 4KGKA 4OI3A 3ETOA 1IBMF 3QWPA 5GAEI 1RDRA 1M0SA 3LQVA 3OBIA 2D74B 3OR2B 3V4MA 4RU9A 1TZ0A 3H20A 1H98A 1U49A 3PO4A 1F2GA 3LAMA 4PWUA 3G6VA 4JI3F 2YKOA 1HHTP 1MW7A 1XK8A 3RU0A 2X1AA 3P96A 4WU3A 1ZAXA 2Q66A 3D28A 3CJ3A 4V19X 3NRBA 4OJ3A 3JYTA 2LA6A 1JJ2R 3CC4S 2Q1LA 4EGLA 4C7QA 1FE0A 2EK6A 4NYOA 2VA3A 1N54B 3FEYB 2QSFA 4K5SA 3K5NA 1U7LA 2ZDOA 5KFIA 2BA9A 3U02A 4C0OC 1S1WA 1U1OA 1ZM9A 1HYSA 1H7WA 3KJVB 1TKXB 2KVIA 1X5PA 1U1NA 4G1QB 2QA4G 4C8ZA 4LFBF