3WQPA

Crystal structure of rubisco t289d mutant from thermococcus kodakarensis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFDRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Mutation design of thermophilic Rubisco based on the three-dimensional structure enhances its activity at ambient temperature
rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
total genus 149
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3wqpA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3wqpA01
1UW9A 2QYGA 2ZVIA 1RLCL 2OEKA 3WQPA 3ZXWA 4NASA 5C2CA 1RUSA 1AUSL 1BWVA 2RUSA 2VDIA 5HJXA 1RCOB 1IR2A 1IWAA 1TELA 3AXMA 3RG6A 1AA1B 4HHHA 2V68A 1GEHA 1RXOB 1UPMB 5HATA 3KDOA 5HQMA 1UZHA 1RSCA 2OEMA 3KDNA 2V69A 1EJ7L 1SVDA 5HJYA 4F0HA 8RUCA 3QFWA 1UPPA 2D69A 2VDHA 1RBAA 3A12A 1RBLA 2CWXA 4MKVA 9RUBA 4LF1A 2V63A 3NWRA 1IR1A 1UWAA 5RUBA 2CXEA 1WDDA 1YKWA 4F0KA 2YBVA 5HAOA 1RBOB 3AXKA 1RCXB 3RUBL 4F0MA 2V6AA 4LF2A 1UZDA 5HK4A 3FK4A 5HANA 4RUBA 1GK8A 5HQLA 2OELA 1RLDA 1BXNA 2V67A 2OEJA 5C2GA 3A13A
chains in the Genus database with same CATH superfamily
1UW9A 1ME8A 1THFD 4GCXA 2EI5A 1NP0A 3R58A 2O9TA 3EX2A 3ABOA 1EO7A 3IV3A 3MMBB 3TSMA 2W25A 4NLDA 3UPWA 2DGUA 3UNTA 2Z4GA 2PI4A 3TA0A 3NQ6A 1B4EA 3KX6A 1FTCA 3BARA 1IGSA 3N29A 3BSOA 1VFMA 1TSIA 4UNIA 2BOAA 4A8WA 1CT5A 4TYBA 2DT1A 4Q8FA 3GFYA 4LQ9A 2F5GA 4ZITA 1ODZA 1S5MA 3APGA 3CMGA 5I07A 1O7AA 3U6WA 1RISA 3N0VA 4R7OA 5D4PA 3SY5A 4B3ZA 4YDDB 1L5UA 3BO9A 1F61A 3S1WA 1AW2A 1QO2A 4PWWA 1IBCB 1ZM2A 2NWRA 3GU2A 1CB2A 3OTEA 3UPBA 2XNRA 4CWBA 2DGOA 3MTJA 3EOOA 2X1RA 4UQEA 2KAUC 1YJ9S 1B4KA 1YPFA 1FFWB 2OZ0A 4WXZA 1SJRA 4MYAA 1PDYA 4MOZA 4A8FA 4U9RA 3E49A 4W98A 4ERGA 4OHZA 4J5NA 4QNEA 2CU0A 4B3OA 2HHUA 5E41A 4M94A 2X8RA 4YTTA 4JI1F 1KBRA 1CXLA 3TONA 3N4WA 1RY0A 3PRDA 2OH2A 2GMLA 1BRLA 4W90B 4HVXA 3NQMA 3CCUS 1MDLA 4MLJA 1E9LA 2EPKX 2PZNA 3DLEA 4ES1A 3GDRA 1GX5A 2E9ZA 5CAKA 4AZBA 1PZ0A 2PDUA 2A7NA 2V8GA 4HYRA 3CJ0A 2Z26A 4UMAA 2OSWA 3RITA 3EGVA 4B9TA 3GJTB 1BYBA 2Z28A 3D47A 5HWJA 4PTXA 3IMQJ 1FKOA 1R3NA 4LVNP 3I6TA 3GJRB 4IJBA 3PIPQ 2DT3A 3EXYA 5LKYA 4WYWA 3KUGA 4PCSA 4DL4A 4HMCA 1PEZA 4UFHA 3KOYA 1O94A 2O5DA 2VFDA 4NOHA 4DL3A 2J7BA 3I82A 4HNNA 1MUCA 3CZEA 2HHVA 4Z2XA 5D2VA 4EF8A 4NEZA 1E3ZA 4S3EA 1JG9A 2BOFX 5AYZA 1OVDA 3NGUA 4JHMA 1W8GA 4O8AA 3OYXA 3RPMA 2ZUAA 2NV2A 2VFSA 1MW0A 4X84A 1YWXA 2W2PP 4URIA 3T1GA 1WZMA 2XZDB 4ID8A 1S1WA 4DNHA 1RADB 2EF9A 2RU9A 1QK0A 3ENVA 2M7SA 4JI1J 2X3GA 4DR1F 1SC1B 4AD0A 3KRZA 2FTRA 3N9RA 1VBXA 4TLRA 1ONEA 1EJVC 4DQQA 4V2XA 2QJNA 2A5HA 4JTKA 5DMMA 2UVVA 3CASA 4KB7A 5D37A 3GD6A 3CCSS 5A0YB 3NQBA 3OODA 3OA5A 4MY9A 5A6SA 2F6XA 1HWKA 3ITHA 4PCQA 3PY2A 4IDKA 5ECVA 1IJFB 4YWIA 4UFJA 4UTWC 1WACA 3H59A 3JQMA 4FYWB 3W38A 1VAHA 2ZZ7A 3SADA 1MWYA 3VM5A 3NNAA 1Y5VA 1YJTA 3VDGA 3PANA 1H63A 1XH1A 4YB6A 2QF7A 4K3ZA 4KH2A 4DV7F 3U2CA 1S1XB 3T1HF 3S3GA 1P1LA 1TKTA 1R43A 2IQDA 1XIBA 3SGUA 2ZXAA 4HPHA 4OHQA 1LBMA 4I6YA 4Q44A 3MM5B 4MYTA 4A3YA 3KK3A 1KBKA 2C3MA 1G94A 5IM51 4TTUA 5LNRA 4N47A 2IMWP 2PTXA 5G2WA 2C3OA 2DNHA 4C65A 4PUDA 2HLUA 4YHEA 1C7TA 3E6EA 4K2XA 2ZBIA 4AH7A 1VIOA 3LHWA 5CPTA 4ES4A 1RABB 2J9ZA 1RYRA 4DR1J 3RM9A 3UYCA 2BKNA 1TMMA 1T05B 1Q7ZA 3IRWP 2PRHA 3EM1A 2KVIA 3LCLA 4GY7A 3GDMA 4CEXC 2YKAA 3CCRS 1RWKB 2H4YB 3OP2A 3DI6B 3OR2A 1BXCA 2VA3A 4O0QA 4PPZA 2ZUUA 1EP4B 1T11A 3B8TA 3C4UA 1XG4A 1RPKA 4FNHA 1LWJA 4C6BA 2P53A 5GVJA 1QAJA 4RX0A 1ZS6A 1Q8IA 3KHLA 1B3WA 4X4TA 4P8UA 1H7PA 2HS0A 3GILA 1W2BR 1H0IA 2EG2A 2VVNA 5FF4A 5H8MA 2B7PA 3T1HJ 1A0CA 1PTGA 1B54A 3VKBA 1FHDA 4Z37A 4WXOA 1A0OB 3KLGA 1XK8A 4ED7A 2VONA 3CZLA 1LCOA 1JI2A 2HPIA 1QTWA 3AFBA 2PBOA 3HZEA 2A2CA 4E4PA 1JQXA 3P0XA 4CO4A 4ZOSA 2AGQA 3QRPA 4ZLLA 3KLIA 3HVAA 2PE4A 3UNGC 5JUMA 1SJBA 3MTKA 5EFDA 4R25A 2QMKA 1OQ3A 2HFZA 3D4JA 1ZLPA 3LBMA 1D0EA 1JZ4A 3PY8A 2ZOFA 3QTPA 1H49A 2ON3A 2D7SA 3DZ1A 3O15A 4F2TA 3EXRA 4E3TA 5HSPA 2DVXA 5DANA 3NRBA 3NQVA 3UCQA 1CBGA 5M3WA 2KXFA 1W26A 1TV8A 4X2PA 2WK2A 1EUNA 1PIFA 2B4OA 5D2YA 3GHRA 3PHTA 2XM1A 1SC6A 3ITYA 5AHMA 1XFCA 3VGDA 3DHDA 4RNJA 2BM0A 2MANA 2HMIA 3W72A 5BXIA 5IT4A 1O1ZA 1S5VA 1TRIA 1RA6A 2R8KA 2MQNA 4DV2F 5IZHA 1C93A 4IKAA 2FZMA 4NRUA 1J5OB 3LOUA 2MGZA 2Y0FA 2C2MB 4WCEQ 4JI5F 3WC0A 2JL9A 3MP3A 4AW7A 3K5PA 1TV7A 2FC9A 5HBFA 4C0HA 1WC4A 3EWZA 1OPIA 1S38A 2ZVSA 3VGVA 3S7RA 1N5YA 1R0CB 1HJWA 3W1UA 1DXEA 3UE2A 5B0EA 1R87A 1U6ZA 1NM9A 4K5RA 1QI2A 2VEGA 1RDRA 3BGRB 3JSMA 4W5ZA 3HULA 2PDMA 1PJ5A 4KGXB 1DYSA 3NZGA 4BQ5A 2AV5A 2BJDA 4IMFA 2IW0A 3WIJA 1FCVA 4TX6A 1SKSA 2CFXA 4ZK7M 1K70A 4L9XA 1LWEA 1UA1A 3TUUA 2AYGA 1YIXA 3P5BP 3AYRA 1QJWA 1D2KA 3D1OA 4JN8A 3GSIA 3A3XA 1SH3A 1LOLA 3VOFA 1FO1A 5DMLA 4NLTA 3ELFA 3TXZA 1Y3KA 4B15A 4ED5A 1HL2A 4YUDA 1REQB 2QCFA 2XH7A 5LHFA 4U8YA 1Y0EA 3G6LA 4Z1YA 4DV2J 4NNAA 2DO4A 2LEBA 2J0XA 1I4NA 3GVVA 5DXXA 4R5EA 4KGJA 4UTLA 2XG8A 4JI5J 2QCMA 3WK3A 3KLVA 1UUMA 4WWSA 4GO8A 2ZZ6A 4RE4A 1L3TA 3LZ3A 4XV0A 2EFOA 4F40A 1IGWA 2FHCA 3BB5A 3JQJA 2D0HA 1FVPA 4AUBA 5CJ5A 2HDJA 4AAJA 4D6JA 1R3RA 4K1GA 1QE1B 4ZJLA 1RAGB 4WSJA 5C8BB 2P9GA 4O57A 1QPKA 3S6EA 4AHQA 4NYZA 2A1YA 4P5UA 2DYAA 4FALA 3MEGA 4ZPBA 2JEGA 5DY3A 2F3JA 3KLEA 2OODA 3FDSA 3HV9A 5A8RB 2BZ2A 5AJ3F 3DH7A 4DQRA 1JLCA 3LCXA 3LUTA 2FQQB 2A10A 2OI2A 2VPZB 5D0HA 2QG9B 2ZQ0A 4IMAA 3CEUA 1TV6B 5HULA 1EP3A 1C1BA 3LLXA 4U8VA 2UXCF 2X1TA 2BABA 2RU3A 1XCXA 4JYDA 1FDNA 4XIMA 3BVJA 1US2A 3KTXA 2Z0GA 1OS5A 4RNIA 3GU9A 4KMQA 2W4XA 1JQGA 1W0MA 1HUVA 1AUDA 1ML1A 1NHUA 5I02A 3U3HA 2VBXA 3IJDA 4H01A 4RCXA 2MZSA 1YIJS 4WJ8A 1FK9B 2X42A 1MXSA 3LPFA 3QGVA 1XDMA 4IX0A 5I2UA 1HBOA 3MM8B 3TAKA 5C5JA 4CLZA 1VC0A 2ZHAA 4ZTYA 5H91A 3BCDA 4IPLA 3TARA 3K58A 1U5HA 3QHNA 5J1EB 3DCAA 4CM2A 3WUFA 4F4KA 3PO4A 3LI0A 3IV8A 2FIUA 2HE8A 1KN6A 4MB3A 1LJYA 2WVBA 5T7LA 3NAIA 3P14A 3GTXA 2QO3A 3UPMA 2JNJA 4N77A 4IR9A 4N76A 5H1WA 4FSAA 5DG8A 3HPFA 1G6CA 1O5KA 2BE9B 4CNZA 4KBIA 4DUYF 3CUHA 1R8LA 4B9YA 4ACZB 4DDFA 1F9EB 2ROEA 1QSSA 1WJ9A 3EKLA 2IDEA 1VRXA 3W1YC 2R7WA 2KKHA 2UXCJ 3R2GA 4MY1A 3R5JB 2YCLB 1JK9B 4A8NA 2V0NA 3CHFA 1SVDA 2Q09A 1DV7A 4IOAQ 3R7NB 5DM7Q 3Q67A 3TWZA 4O44A 2KYXA 4IH3A 1GVYA 1J11A 2ZH7A 1J0KA 2QCHA 3FVMA 4ICMA 3S6DA 1A5BA 3MZIA 4MDOA 3RW6A 2ZE2B 4J1OA 1W3LA 4BA0A 5C0QA 2Y7DA 2G8ZA 3GIKA 1XRSA 1IF2A 1YJWS 4DO5A 3X3UA 3SFKA 3GQCA 4S2CA 2Q3PA 2KFYA 1TZ7A 2OKTA 4RK8A 4JB8B 2ZIDA 1LRTA 4USUA 1C29A 4HT7A 4OJYA 4L6V3 1FRXA 1VHIA 2HS4A 5AHEA 3LGNA 2F4VF 2XULA 2D41A 3XIMA 2BFGA 1AROP 4J90A 1I3OB 2LVWA 2VICA 3MHYA 1RALA 1RK8A 3BL3A 2CQPA 2WNWA 3RRKA 3PEHA 3AWNA 3H4BA 4QLJA 2PEHA 3D68A 1AJ2A 1AD4A 3SYZA 2YQ3A 4DUYJ 3GVQA 2TODA 3CJ5A 2B6AB 4X4OA 3V4IA 3K4AA 4ZN1A 3Q8QB 4U7UD 1Q4NX 3GR0A 3KK2B 3V6KA 2H3EB 4C6IA 4DL0C 3MVIA 2XN0A 4DCJB 2OPPB 3QHMA 3C2VA 3VAHA 2ZRZA 5DQPA 3WJSA 2HRTA 2VOPA 1ZBVA 1R8BA 4M29A 4R27A 2DIUA 2WVEA 2DJLA 1KKRA 5F8JA 1KM1A 1RLCL 1QWKA 4QPTA 3PWGA 4CNYA 2PTDA 3DFPA 4DO7A 2FHKA 3KBJA 3W1QA 1XNRF 3VDHA 4ZE4A 3FEYB 4KAIA 2UY2A 4IUGA 5KFWA 3GW0A 5KINA 4GZ7A 1X9WA 3VFLA 4LJMA 3RG6A 3LHZA 4JEQA 2V68A 5G1YA 3SMZA 1PYOB 2WW5A 1YVFA 5EBUA 2OSQA 3LX9A 2F4VJ 3MPYA 1EZWA 3H0PA 4PMZA 4JKLA 4AQLA 1JDDA 2XN1A 4PCPA 5FIPA 4NQ1A 5DLCA 1TJ0A 2YZRA 5CKSA 3AJ1A 1F73A 3PNIA 1YBTA 3MPVA 2P8CA 1SQFA 2A3EA 1GCYA 4UTTA 2A21A 1NEYA 1KS2A 2BV3A 4UOCA 4EWND 4K8GA 2DP3A 3WEZA 1JLQB 3L3CA 1TWZA 3GUWA 3Q4DA 3BREA 4CNNA 1TK0A 4LIRA 3ZVIA 4A8IA 4CCHA 2ZJQQ 3PNZA 2I56A 1DY3A 2DO0A 3TX8A 2FGOA 1B7YB 3W7CA 1DFDA 4OQJA 2PCQA 3B4YA 3PWAA 2IKGA 5PTDA 3AICA 3IJ9A 4X4QA 1FCBA 1SH2A 3U0HA 5KG2A 4JQ4A 3CLWA 4IR1A 3M9NB 5CGMA 1KTNA 2G1HA 1I2QA 4H04A 3RN6A 3NLCA 3UG5A 3MI7X 3KLFA 3TEGA 3V16A 3WSUA 4WF7A 3U2ZA 1IKVB 4KSEB 5K3VA 1OFRA 3MGJA 4B3RF 2F9JA 2BG5A 2NX3A 1FD2A 1XNRJ 1TMQA 2ZZNA 5M5DA 4C1NA 4JOMA 3DHFA 2BASA 4D8ZA 4QR2A 3I3BA 4TU7A 1R85A 1SO4A 4ENOA 1PSDA 3KW3A 3PJ9A 2ZFHA 1HXJA 2NV1A 3TZXA 2IM0A 3CCMS 1BWLA 1NDWA 1W5PA 2WJDA 1EXBA 4U31A 4MT1A 2QLFB 2RDDA 3MC5A 4MB4A 2R1NA 3FJ4A 1G0CA 2OELA 3KBMA 4Y8FA 2ZA1A 4IHCA 3L4WA 1VQSA 3SSJA 4R0EA 2DKOB 2CLHA 1T5AA 4V15A 2MY7A 2X1FA 2MLYA 4UB9A 5GQBA 1IEXA 2XBPA 4CT9A 2ZDRA 4W4MA 1ZL1A 2ZH3A 2PDKA 4B3SF 1T99A 1Q7QA 4GIEA 3FA4A 3WX8A 3C56A 2HPUA 1X4GA 1DQ9A 4FBUA 4HA1A 4IRKA 2VFVA 5FJ4A 1DJNA 4AXKA 3EPMA 4YCOA 1SUQB 4GXWA 4FS1A 4PB5A 4EX4A 2YA1A 4Y6IA 5AXNA 1GOXA 2F8EX 4PMQA 3NY0A 3G6XA 4WIIA 3UT0A 1NBEB 4YJ5A 2YKOA 3D46A 4LBPA 1OPZA 2JEPA 4L1WA 3IS4A 1Y8BA 1VQ4S 4XSMA 5F0UA 3OVRA 1H60A 2ISWA 1Y00A 3T6BA 4USMA 2V69A 3WD4A 4PQUB 1TL1A 1DWGM 3H7HB 3NG8A 4HEA9 2R4FA 3TROA 2M3DA 3S9ZA 3B06A 4MYUA 3T5JA 3H5XA 2PU1A 5H8PA 1JLFA 2GIQA 1MU2B 2NXIA 3OJGA 5F4XA 1NRKA 1PYSB 1FWNA 1O4UA 5LIUX 4BCEA 2G0IA 4LS1A 1YPIA 4H9YA 3U5UA 1JRBA 2AL2B 1TV2A 3SN1A 1F0XA 3NDZA 4AEFA 3ZQ9A 3IS9A 1NFBA 3BE7A 1E6NA 1TJRA 3P61A 3A8IA 5CC7A 5CXTA 5EMKA 1BQGA 3ENWA 1KA9F 4GINA 3TYUA 2J47A 3PX4A 3EVMA 5I7GA 1VYAA 4DL7A 1QCWA 1G5AA 2DB1A 4FK9A 2RKIB 1ECQA 1QATA 2P3ZA 3E0WA 1XLAA 2GCFA 3TAMB 2XZ7A 1RU2A 3ZZZA 4Y3CA 1FT8A 4JI8F 4CYUB 3DLLQ 4DR2J 1E73M 4HK6A 5KFLA 1S1TB 3E1F1 5A8QA 1ZETA 4USJC 5E3RA 3OVPA 1QOXA 2OMLA 3PW2A 3HHLB 3LK6A 1X4EA 4DBEA 5L9XA 2ZM6F 5AN7A 2VKRA 5SUHA 3S9YA 4DR4J 4UOGA 1EC9A 1FFRA 4ID5A 2QGHA 3TTYA 4N42A 1A0EA 4IMGA 3MUTP 2HNYA 5M1TA 1ZPWX 4PRWA 4F2UA 4NL1A 1CULB 2G3NA 3H2VE 4DQIA 4JIPA 3DKLA 2WO5A 3PUEA 4W85A 3UCUP 3QRQA 4HSOA 4DLEA 1QW7A 1SB6A 2RHGA 1ZCCA 1KP6A 3LV5A 2HVHA 1WNEA 4J4KA 3W23A 1Z8AA 1DQWA 5AE1A 4HN4A 2E5GA 5HMYA 5E3PA 2VX5A 1K9TA 4LB4A 3C6UB 3PZUA 5T91A 3SEPA 1QUPA 1JYWA 1SXLA 3M8QB 5EGYA 4HACA 2FPVA 4J3UA 5FJPA 3IM8A 4E8GA 1LWCA 4IM4A 4MKBA 1SPQA 1X31C 3R11A 3S6OA 1NJYA 4AD3A 3QZ8A 5I0DA 2XY6A 2IIHA 1P0DA 2FDNA 3FMWA 4JI8J 4WIWA 3VX0A 3NGDA 3O05A 3VKAA 1NDKA 4JNYA 5BXSA 3I68A 3CDUA 3FJ6A 4K4ZA 3TJXA 2CQ3A 2DTJA 3HHKA 3JAMY 2EWHA 2FPHX 3SJNA 4PMOA 4LNCA 5A8GA 3H2FA 3G1HA 2ZM6J 1GYLA 1XGZA 3GWQA 1RWXB 4C11A 2R7RA 3R10A 3K5XA 3OFEA 4IG3A 1BRLB 4NE9C 1RQBA 3GYGA 3W76A 2G37A 4ZPTR 1HO4A 4W7WA 1P5BA 5GMEA 2VTFA 3EOUA 3L66A 4GH1A 3SI8A 3QZEA 3A3HA 4DVOA 1KRPA 1H3GA 5LA0A 1B7FA 3DOPA 3NJ3A 1SC3B 3MYPA 2CWNA 2O55A 5ECUA 3MV01 3NDOA 1YTKA 3FJNA 4JNMA 1AQ0A 1F6KA 1KVIA 2GK1A 2FJAB 1XS2A 4MKYA 3M5VA 2VRQA 4C1LA 5HP1A 1QTNB 1SI9A 1DWFM 3LPGA 4DI8A 4Y2WA 2E8YA 2OP5A 4LQ1A 1GQNA 1ZM9A 5KT3A 4XZWA 3KL5A 3FBEA 3PEJA 3DLBA 2CAJA 3D3FA 4B3MF 2E9MA 4NA1A 2VD3A 4Q45A 4LVGA 2IC3A 5HA7A 1HNXF 1ZJHA 1V4YA 4XD4A 3OJUA 2VCBA 4N02A 2XS5A 3NQ7A 2VL4A 5HVFA 1IT7A 1JMTA 4ZXLA 3NKYA 4LF6F 3MOZA 1U1HA 5MLCV 2GUBA 4LBUA 1NSPA 2A6MA 4YB5A 1YXCA 5G4EA 4QX4A 2GVEA 1YJ7A 1TA3A 3UZWA 4XZHA 3M1VB 3WKZA 1KQGB 3G0SA 4HCHA 5E0FA 5DDQC 4O10A 4PL1A 5CPOA 4CNTA 4J3XA 4RDWA 2W61A 3M64A 4LIWA 4KPCA 5HJYA 1EX5A 4OX7A 4HU3A 3K8WA 1RHCA 4CD5A 1B4SA 1VFLA 2Z25A 3MD3A 3RAQA 1FP9A 3QPYA 4H6KA 1TK5A 4DO6A 1VRDA 1OC6A 1ONRA 1U8SA 3NCRA 3R5CA 5KFBA 2F9DA 3IGHX 1G69A 1U8WA 2N3LA 1NTHA 5BR8J 4Y2CA 3G24A 4OI3A 4C6DA 2GGIA 4HK7A 3CT7A 2AGOA 3NWRA 5IRPA 2QA4G 4KRZA 3SCQA 1ZQ5A 5JJBA 5A6MA 2AKZA 2YXOA 3URAA 1KTVA 4N0RA 1UQYA 3B03A 4X0VA 3IR5B 3A3WA 4KGLA 5EMMA 5CC6A 1JLAA 4I2PA 3SFGA 3VWSA 3OBIA 5CZ0A 1HNXJ 1RJPA 3GAYA 1DIKA 2DR7A 1VQ6S 1TAQA 4RKUC 3QVQA 4F50A 4IIDA 4LF6J 1WORA 4P2XA 3ZLGA 5CH9A 1ZBTA 5K8OA 2Z1VA 3TN4A 3KHJA 1E51A 4KIAA 2HQAA 4F3OA 1VD6A 1IKWB 1VF8A 3GDKA 3T7VA 3W01A 1D3GA 1CEOA 1TZ9A 2QF8A 4HT3A 4BZYA 4L4LA 1W9XA 4AD4A 4QYZK 4E2VA 3I4PA 3CMQA 1RWOB 3FQKA 1P1XA 2L3MA 4ZGYA 3AXXA 2PMZD 1FESA 2OZ3A 4IH5A 2DSKA 4O4WA 4AZ5A 3M6WA 3T81A 1QSLA 3TYAA 2HQGA 1LL4A 4PUKA 3T8LA 2HZAA 2QUUA 2AMXA 1K7FA 4O3SA 3TYEA 1NHKL 5F1UA 2F84A 3LH2S 4I69A 4RE2A 1YBQA 1KV5A 5BWAA 4BY3A 2HFOA 3I7RA 2EPLX 2EAWA 1IJEB 3KLGB 1AT1B 4AU0A 4I9JA 1Q6QA 3GYCA 4CH0S 2REQB 1Q63A 2WVCA 3CIXA 3B6BA 3L5LA 3MZ2A 3W7KA 3GLJA 5FAGA 5LHEA 1RT7B 3WMCA 3BR8A 1P6WA 3IUDA 3Q8UA 1U09A 1U5JA 3SSQA 3T1AA 2WHLA 5J2QB 5GAGU 2BWGA 1GXLA 1VFFA 4XO6A 4P8WA 1D3WA 2HGLA 3W73A 3WNLA 1HNWF 1WHXA 4AMAA 3QIPA 6ALDA 1EARA 4O4GA 4F67A 4B9NA 2KN4A 3J81U 4NX5A 5I3UA 1RTHA 1FRMA 1NDYA 2PWDA 4L76A 3QYQA 4NT0A 3TQ0A 1G6BA 5MKGA 1WV2A 2KT2A 1TWIA 5KT4A 2VB6A 5A6BA 3B8DA 2DRDA 5A8NA 4OZNA 3KRBA 2JQXA 1H7XA 1X4HA 1UKUA 2C2DA 1EKOA 2Z8QA 4YNGA 4EP8C 2PIIA 4TQRA 3EX1A 5A8WB 2UXBJ 2HK2A 4DV1J 1SGJA 1CJKB 1WKEA 1OINA 1UHVA 1XUUA 3QZ7A 1HMVA 3BCJA 4LVFA 1H73A 4ELUA 4DBSA 4OQVA 2Z2BA 2V4QA 1CXHA 2IKHA 4C8KA 2W6RA 1ZB5A 4WGXA 1XBXA 4G5DA 2UUBJ 5HNNA 4HB7A 4MWAA 1PE1A 1XRVA 3O3LA 4EANA 4M63A 2VGGA 3WNMA 5D2TA 3H42A 2CQ4A 2H9ZA 1FWJC 4WFYA 1HNWJ 2DITA 4LF5F 2CLPA 1VQPS 4ERAA 3DYAA 1KM5A 2NXHA 3CH9A 2XC9A 2ZC8A 3N3MA 5CBIA 2H90A 3GTFA 3GVGA 2ACMA 3GJQB 3LYEA 5HJXA 1YNQA 1HL6A 2QE5A 1W1TA 4DRSA 3QFEA 5B0CA 4DF8A 2QV5A 2CFFA 4AZ6A 4KFOA 5TF0A 1OFOA 4A8LA 3H26A 2L5HA 4M6QA 3P74A 2ZH8A 2W62A 5LOQA 3PVFA 2VWTA 3QO9A 4NLGA 2X3DA 5L6UA 2ZNZA 3IJIA 4MKAA 4C6PA 4PMUA 2XMVA 3TTSA 1XKYA 4WZQA 4BWJA 3K46A 3L23A 2HFNA 3PB0A 4QAIA 3IUHA 1NWSA 3TQKA 1OF6A 2Y9HA 4H8HA 2PO4A 4PG4A 4PUWA 2BXJA 1XLMA 3QJAA 3VDCA 2WHOA 2I9UA 3FFIA 4A35A 3VGGA 3ARRA 3TUJC 3MUMP 1F3VA 3IAPA 3ZJKA 4AVOA 1IBMF 4KJIA 1K9MT 4UZUA 5HINA 2OO4A 4YFUA 4N4PA 3AOFA 3I7QA 2R3VA 2VGIA 4LGXA 3W28A 5I3HA 1TCMA 3WN6A 3DESA 4Z2LA 5T9CE 4ECXA 2XZ9A 2VJUA 2HVMA 9XIMA 3TZYA 1YRUA 4MMOA 2GO8A 1GZJA 4ANEA 3DX5A 1XLIA 1EDTA 4LT9A 2G1DA 3O0FA 2XI3A 4ROQA 4TN2A 5HMZA 1YSJA 2XIOA 3MMWA 2DHAA 4LVOP 3PF3A 2CJBA 2ZRVA 2M8DB 2DNQA 3LGEA 1PWMA 3CDEA 1TPB1 2DU2A 4FVCA 1FOBA 1XWYA 1UUOA 2YZ5A 5M2FX 3ZR4A 4Q4MA 5JXQA 1N48A 1HYSA 2VG6A 2GSEA 2I17A 4OI0A 1TX0A 5CJMA 1W91A 2Y6ZA 4GGHA 5T8GA 3QMTA 3QKEA 2D1ZA 2C91A 1LW2B 4ICCX 4XTDA 3QMQA 5D4NA 4HH1A 4G1NA 1KM4A 3OTBA 3G96A 4AT1B 5GAEI 5AZ0A 1PKUA 5IQQA 4F0RA 4RZ6A 3WF4A 4GKJF 2PSNA 1XEZA 3ETMA 1UKTA 2XWXA 1AW5A 1SJ1A 4US6A 1SQGA 1IBMJ 3OR1A 1S9GA 1R3YA 4TXEA 4P7VA 2NQHA 3BSMA 4WTOB 4BDPA 2ABAA 1YJNS 2X7VA 4Z7YA 3WIVA 3MCOA 3N11A 2VC0A 2GUYA 4NNCA 3N04A 4DWSA 3T78A 4HKPA 2J13A 2BW2A 5EYWA 2H4WB 4C8LA 2IPJA 4Y65A 2X40A 2OFHX 5KFFA 1QR7A 4M6PA 5FDLA 3G8QA 2QCNA 2GIFA 2Z1WA 2QKFA 3L2MA 4LEQA 2V50A 4NI3A 4OUIA 4KTQA 2XO7A 3PZMA 4YOEA 5H9EJ 1IR0A 4UC5A 3JSBA 2QDGA 1IKXA 3WF3A 2YY3A 1Z42A 1X6NA 3TLLA 3IGSA 4OI4A 3I9V9 5M2RA 1R3WA 5A2QU 4BEUA 4EKJA 1UCNA 1F76A 3ATYA 5HMWA 2Y1IA 3LI1A 3FN9A 3PX0A 1RE1B 4DFKA 2CJ9A 3Q37A 4GYFA 3L65A 3I4EA 1W1A1 3RPTA 4X0NA 1VEPA 1FTXA 1UC5A 1KONA 1GW1A 3VGUA 3CPGA 1FWDC 1HBUA 3QF0A 1EOMA 3QGKC 3JS3A 1UR3M 2A0NA 3R0KA 2PAJA 1FWHC 1KCXA 1PYMA 4PB4A 5TNVA 1QPNA 4XWUA 1MNZA 1XTZA 3MFHA 4O14A 5AB3A 1V0NA 1JZ8A 4GUGA 1IWBA 1PYTA 3AXKA 1NB7A 1IN0A 1HT6A 1YDYA 2LA4A 1CX9A 4DYKA 2XZTB 2DVTA 3WDIA 3WH6A 2VUYA 4RX6A 2VHGA 1X98A 2HFUA 2VRKA 3C3NA 3DOLA 4HMDA 3MUCA 2ALZA 1RTDA 3WJXA 1JZ2A 2KFNA 3UXLA 3RB6A 3EX6A 4UCFA 3M7WA 3IP0A 4S3GA 1I2NA 3ZMRA 1VJWA 2CPEA 3AOBA 4FNRA 1OFQA 3TTQA 4AZGA 3ARXA 3VZZA 4YN3B 2VOMA 8AT1B 3RIKA 3L4BC 3HXMA 4IIGA 2HNDB 4F4RA 1MEHA 4AL5A 4BI5A 4AZCB 3B0VC 1VFOA 4ADUA 2G13A 4KEMA 2DR6A 2OPSB 4WY0A 5GNYA 3N6JA 3E0IA 1UVIA 2QCEA 4M19A 5JH1A 3DRSA 3R6GB 1QNQA 2FZDA 4EOUA 4ILMA 5T14A 4I5RA 3FSUA 1OY6A 1WG1A 4NZCA 2X05A 4AFFA 3UZJA 1S5ZA 1EQCA 2J7HA 2AYMA 1CGWA 4MVAA 4F2RA 1MEIA 1IIHA 1P27B 2XWYA 1V6WA 4MIBA 4N9CA 1RAAB 2ACUA 1H1ZA 1PPIA 2TMDA 2VEKA 2NQ5A 1N6QA 4B9SA 1QAYA 4DR5F 1UASA 4DJFA 4O4RA 4XKYA 1OC7A 4XO7A 4NVTA 1DLOB 4ECVA 2HRWA 1VC6A 2Y2WA 4M5DA 2YXGA 3SCRA 2YKMB 2DFAA 4H7CA 3C6TA 6XIMA 2PEBA 2QMXA 1A5CA 1GNXA 1JR1A 1UP3A 2BLEA 4TLQA 3HFYA 4YU1A 2PDHA 2ZWPA 4GCAA 4L72B 1NU5A 5AHLA 2MY8A 2VR5A 4JTIA 2PN6A 3W8GA 2SXLA 2CXEA 1B31A 3AIEA 3UG8A 3ZZ1A 3JSRA 3DM2A 2XFFA 5KETA 4A8XA 4GIYA 3NFUA 1H50A 3DI0A 4NYPA 3RAOA 3GSDA 4ZLPA 2P6TA 2OFGX 4IIHA 2DZBA 5L9FA 1N5QA 2V34A 5BJRA 4U6PA 3CJRA 2BXZA 1H6KX 3JAMU 4C97A 2Q8ZA 4YMZA 5KFHA 2Y8UA 4Z42C 3AALA 3ZFHA 3CO4A 4XD3A 4NZ1A 2YFNA 4QG8A 1JB0C 3LCIA 3R89A 3P67A 3RBEA 5AE3A 3SUWA 5M2PA 3D0CA 3RO8A 5KG3A 1A5NC 1YGYA 3ILJA 2EEXA 2QNEA 3NO3A 4J9RA 1U0HB 4DR5J 1EOKA 2OU4A 2DNLA 3DLGB 4WP8A 4TO8A 3NBPA 4AC1X 3KCJA 1XIGA 2VEMA 5HR6A 1WOAA 3MTWA 1N8RT 1JXKA 4MIMA 2CQDA 3CPUA 3QV7A 4JQ3A 1VLOA 4U3AA 1YX2A 3MAAB 4NA3A 2VRJA 5KFKA 5B08A 3GIMA 2WVSA 5FF3A 2FGLA 4LBHA 3L4XA 3L4YA 1EHWA 4X62J 1N4LA 1FJEB 5CLWA 1G4CA 2ASYA 4H54A 3BYPA 3DFTA 1LG1A 2GJFA 3TI0A 3M2RA 2C3UA 1VLWA 1MW3A 1X5PA 3TCSA 3MPUB 3CC4S 1U1MA 1MXDA 3W82A 5DQGA 1LF1A 3T05A 5HATA 4HNOA 2ASLA 4CVUA 2PFDA 4AY8A 2QUNA 3LCWA 1WD6A 1W9PA 3VGFA 2BE2B 4DSIA 5J1NA 4EBCA 4Y9NA 1HZYA 3LP0A 3CZKA 4JHZA 4LAMA 1D09B 2DH8A 3E5BA 2GAGC 1CS4A 2AX1A 4J91A 2IM2A 1DTUA 1SW3A 1IZCA 2VT0A 3H2EA 1W3KA 2G3JA 3VYLA 3AB4B 5HBMB 1SC4B 1BQNA 5I78A 2E7XA 3GY1A 4ZPWR 1SR0A 2AMCB 1VRTA 4H3DA 2W9CB 1IBKJ 4RW4A 3CD6S 3DN5A 3VNIA 2VEIA 4W8LA 3SAZA 2DR5A 5K2ZA 4RUHA 3AAWB 1D9AA 1UJ6A 4EPDC 4IQEA 2YNFA 3CHVA 3PW7A 3DMJA 4LH8A 3URNA 2ASDA 4XPEA 3DFNA 1VH7A 1U2FA 4EYIB 3TVAA 1GPWA 2X1GA 3UQSA 4A4JA 5A94A 1URRA 3PBVA 1NK5A 1R8HA 3IRXA 3TAQA 1X4AA 2WHJA 3M0YA 4Q32A 3VK5A 4CQBA 2R91A 3W1AA 3UWTA 2OLWA 2ZUTA 5KZDA 3WFAA 3B3DA 4V1XA 3ARUA 1JCLA 2NSOA 1TPUA 1U2RA 2NUHA 1M6JA 1FDJA 1A5OC 1VLIA 2NQZA 2VI0A 5HPCA 1H1NA 2I5QA 3EPGA 3R0DA 2ZITA 1BVZA 3AXHA 1U47A 3APTA 1AK5A 7CGTA 3SV4A 1GMWA 3M8PA 3MDWA 2AT1B 1LDCA 2OFJA 1U2YA 2AHOB 1HKIA 3TR5A 4N4QA 2OAUA 3KTCA 2ZOGA 4JTRA 1KQYA 2XU2A 2EG1A 3QAEA 4G56A 1X7FA 1L3VA 3QKZA 8XIMA 4JFVA 4IZGA 1MYRA 3W84A 4PA8A 4FB7A 2E1DA 3TN3A 4JQ1A 2P10A 2KXHA 4K4VA 5IDZA 1IUJA 3W5YA 3GR1A 3T40A 3NM3A 3MT1A 4C2MA 3ATZA 2YA2A 4IOTA 1JXJA 4FVMA 1SZNA 3WBAA 2B7NA 1XLBA 4S3BA 1AYEA 1FA2A 4AX7A 4M5LA 2OYKA 4M6UA 3WMLA 1FVQA 1J5TA 1U1OA 1C1CA 3GTYX 4O1EA 4M5PA 2HHHF 1ELOA 4QW9A 5IBXA 1YPXA 1KR0A 1AQHA 5KFUA 3CCVS 1K4GA 1S5TA 2A18A 5K5MA 3BO2A 1NQKA 1MUWA 1YDOA 4DJBA 2Z2LA 2MEWA 1VMBA 2WB4A 2R7QA 4HPXA 3KUHA 4PRTA 4FXDA 3VOGA 2IAJA 3BBFA 4RLEA 2B5JB 3HVTB 5D8HB 2CZVA 1FRKA 4CLLA 1AJ0A 1GUVA 1BSLA 1WXYA 2NX9A 5AZ1A 4V1YA 4MAKA 1FXRA 4P2SA 1XPGA 3TN6A 3BGAA 2FLIA 3VNMA 3F5JA 4GFSA 1F4AA 1GOWA 4ES3A 1RHJB 3UJEA 1SFSA 1KDNA 4KH0B 4PMNA 2F8MA 3SR7A 5K4XA 2NSCA 4PFMA 3HKWA 3NCOA 2AEMA 3UXKA 3KZPA 1WAWA 3EDDA 4XBKA 5JVHQ 4IMEA 1IKYB 3LXBA 1WC1A 2DNZA 3TA9A 2A7PA 4PUEA 2PGCA 1LK5A 3CQJA 4U67Q 3CL7A 4IWWA 2F2HA 4G1QB 1HBMA 2PDIA 1H11A 3MEDB 1N56A 4FI4A 2I8EA 4A48A 1KOOA 5E5NA 5CGQA 3MM6A 4DG1A 5A6PA 1K6WA 3DG3A 2HHHJ 4J9KA 3PZTA 3ONQA 2VO5A 2GDQA 3CU2A 4IFVA 1IXNA 5B0AA 2NVCA 1VDHA 1UA7A 3DOKB 2MQLA 2DK2A 5HP1B 3NA8A 5LGZA 4MK9A 1F5ZA 2O56A 1R6YA 2MKKA 3ARVA 4W8BA 2KG1A 4W92B 4DHGA 4UUIA 3A5FA 3WBEA 4OVXA 4IMDA 1S6PA 1L0PA 2JKEA 2DXDA 3PSWA 2J79A 1GVOA 3F03K 3EA2A 2O66A 4A3QA 3MZNA 3CPRA 1HNYA 2AEFA 4X64F 3MU7A 3A5VA 1AL8A 1J2VA 2GPTA 1IZJA 5C42B 4HTIA 3M2UB 3KHHA 2Q02A 2HVEA 3EPNA 1RT2A 1M1KT 4GKTA 4LRTA 5A6BD 4UQ9A 4NXNJ 3OLIA 2RDJA 3D3BJ 4AXNA 2IMOA 1XBYA 1X4FA 5DCEA 2M52A 1I8JA 4IH7A 3TZWA 1KBBA 4C6JA 1E6VA 4DPYA 3TP4A 4EVZA 4LPCA 3VAKA 5GADI 2CQCA 1W2VA 3PUDA 4GKKF 2JFEX 2BVYA 5CAAA 5EMLA 4Q7IA 3HK2A 4O15A 4RZ5A 3WDOA 3HPSA 3N2CA 5D09A 5CPMA 4I3GA 3E3XA 2QXWA 1RAKA 4I6KA 4MWAD 2DHHA 3C15A 2W7OA 4LFBF 3K8MA 2VBZA 1GYNA 3O5TB 3TJ8A 2QJIA 1SUXA 3T2PA 1A5LC 3BSAA 3EA3A 3GWCA 1E56A 4GQ0A 2ZVRA 4P71A 3PUGA 1YHQS 3FHAA 3HG4A 2LXIA 1TQXA 4U33A 2D0GA 4FX8A 4IIFA 2C1IA 5KG5A 4X64J 2AX0A 1R9XA 4I2PB 2M4MA 4F4ZA 2P5VA 3CGTA 2X1SA 1I45A 2P6SA 4I8YA 4E6MA 3AIVA 3RLHA 2H5JB 1S39A 5ETKA 4WFBQ 2OT0A 1J5SA 2DRBA 2V4JA 1S2VA 2PE8A 1KGWA 3CD0A 3WJZA 2PDGA 3QV6A 2ADCA 4EE9A 1ECEA 4JR5A 3WBWA 4DZHA 1J4EA 1PTDA 2GVYA 3N13A 5C2XA 4OWGA 2E9BA 2I1OA 2RF2B 2E29A 1ADDA 5IFMA 1QXLA 1KGUA 3KLHB 4TQTA 4C0BA 2BHZA 4GKKJ 3G1XA 2J7WA 4DSFA 2E7FA 5B0GA 1F05A 2DJWA 5B0BA 2E6AA 2DZAA 3N25A 2E28A 5F1VA 3JZEA 2NPIA 3EJMA 4WDWA 3LSCA 3DGRA 3VD4A 4J3VA 4FF1A 5ABTA 4H4OB 2Z2ZA 3PN8A 3M9MB 4K7YA 1KM6A 4WIQA 1E6ZA 3B54A 5LYRA 3P8JA 1I1GA 3OTDA 4LFBJ 2H54B 3WNPA 3N2MA 6TIMA 2R7OA 3TMLA 3CL6A 1YBQB 3KLKA 4JI2J 2PWVA 1C9WA 2OB3A 4EO8A 4Q8MA 4XTTA 3KDNA 3PTWA 3TEVA 4Z1DA 1Z7AA 2WC3A 1GJWA 4MWAE 1U1PA 1GKQA 3TV8A 4J5OA 1JDCA 4PUOB 4MUZA 1PG5B 1BF2A 2GJNA 5MF5A 4LYPA 2MXYA 3UCGA 2KL8A 2G9OA 1N5TA 3UO0A 1UL3A 3ULHA 3TXVA 1PBGA 3LOTA 3S6TA 3KS5A 1W2PA 3MMJA 2ZDSA 4W88A 4FNSA 4PEEA 4DCOB 3LM3A 2RNEA 3VE7A 4RZ4A 4P72A 3CT2A 4OIFA 3SRDA 1I1XA 1XLJA 1RU1A 3SI9A 5AKQA 4ZENA 7ENLA 4RW9A 3O8WA 3CHDA 2WCGA 3Q86A 2CYYA 2QPUA 3U8GA 2CQBA 1H7RA 4XBJA 1S6OA 3SCSA 3NQ8A 2BA9A 3C2PA 3UZZA 1QDUB 1T03B 4UOHA 2HEJA 1GXUA 3NCQA 1M41A 4PTVA 4I8DA 4BK9A 4DFJA 2Z56B 2ZHBA 1VQNS 1S77D 4F04B 5GAEU 1Z6KA 2I6WA 2OYLA 2IVMA 5DDPC 4JL1A 4F9DA 1RZMA 3UWQA 1EA9C 2DUAA 4HSNA 2W8KA 4DWSD 2LA6A 2WMIB 4PH6A 3MV11 4HMNA 1XBZA 2V8VA 1UH2A 4DM1A 1XX1A 4O3OA 1S2UA 4IL2A 3R8GA 1FWLA 3GCXP 4LSLA 1JUKA 3PBYA 1SKUB 3CO0P 2MZQA 4X22A 3CS2A 4MZYA 3SIPB 4I2QA 4WVXA 2VEFA 3WUBA 2R82A 2FLNA 1PS9A 2G41A 1HIZA 4Z2JA 4LAKA 2BTMA 3AMCA 5KFVA 5E0KA 3OGSA 2WZ1A 3SCUA 4WKFA 4WK3A 4XAZA 3KZSA 1BG9A 3HF3A 4HPGA 1CJTA 4U2YA 2XO6A 2DH9A 2DGVA 2AD9A 1C92A 3HTWA 3M0HA 4R88A 1F60B 4C3MA 2LQ9A 1XDJA 4C3KA 1WZAA 1KXVA 3M4HA 4G7FA 5REQA 3TX9A 3RMJA 2J27A 1XC4A 1OFEA 4Y2AA 3W1XA 2IY5B 7TIMA 4NPOA 1JJ4A 3UP8A 1G4EA 2IJNA 3W64A 1DWAM 3MA8A 3B0YA 3AB2B 5CZJA 1RT4A 2NXJA 1X5TA 5I3PA 1F3TA 4FX7A 5EKYA 4JHOA 4B5NA 1UJ5A 2PMHA 3R79A 3GXNA 3C2RA 3KL0A 4PBFA 4A6GA 4LRDA 2WJEA 1DIDA 3BG5A 4NLQA 2NT1A 1HKWA 3FJLA 5LSMA 1YG0A 5I42B 4HA4A 3R8YA 2BY2A 4CD7A 2YKNA 1IIGA 5C9XA 1M5SA 1B64A 3GXMA 3U2EA 4ONVA 3RCMA 3VDAA 2L9WA 1VBRA 1FWCC 4EAMA 5BWFA 3KTQA 4NCAA 5B09A 1HQUB 3PTQA 1MN9A 4PG5A 4CD8A 3PULA 1SYTA 3OTOF 3UD4P 2CDRB 2KXNB 2OJ3A 2O4MA 2FGCA 1ZA2B 1R7IA 2NVAA 2HNHA 3FVDA 2J75A 4KCUA 4BI6A 3I31A 2VH7A 3WF1A 4REQB 4EK7A 4GNVA 1GQJA 2DIVA 3W02A 1UVJA 4EPBC 5M03A 2EPNA 1PHWA 2VGFA 4PGLA 1E4MM 3C2OA 4OHYA 2ZJPQ 1NJJA 2R8WA 4QR0A 1APSA 3TW0A 3GP9A 3W7DA 1GW9A 3KOWA 4Y34A 4CQ8A 1ZAWA 3WFZA 3KJFB 3S9IA 4F0LA 5HNTA 2RQMA 3EVOA 4JTQA 4KY3A 2QIIA 3LXCA 4OV9A 5B7WA 3T8QA 4LUSB 2JZ5A 2BVTA 1V6YA 3ISIX 3KAOA 3DC0A 2MLXA 5GJPA 3WDHA 2V30A 3N28A 3ZR6A 1E6YB 4CO0A 4LS0A 5BW6A 2VF3A 3QLHB 3OGRA 4AC7C 1D8ZA 2OGJA 4K50A 3ZZYA 4DJFD 3DHXA 4NJKA 5C9RA 3KWSA 4OV6A 1ELSA 1DJXA 1F6PA 4KETA 2PD5A 4E0CA 1UD4A 2AWZA 3VKDA 5L38A 4ZP6A 2LLEA 2DNNA 1OZQA 2BJ1A 2WLZA 5IC4B 1UIOA 5I5RA 3STCA 2VC5A 1NY1A 3V6HA 3PDNA 4M1RA 3U7BA 3MM7A 1GJPA 2DY3A 3H4DA 3NOGA 2E9LA 1HHSA 3HD1A 3UQNA 3BLPX 2KYZA 2XVLA 4JTAA 1WKFA 4O0NA 1UYQA 3T5LA 2RQ4A 1PO9A 1PILA 4IGMA 3RRGA 3ABSA 1DRZA 3B9NA 2Y62A 4MJ4A 1OT1A 4IFKA 1P9QC 4KEUA 2QJ3A 4LBIA 1RT6B 3UVJB 3M47A 4FPRA 2DZSA 1OX4A 1XSJA 2HQFA 2YL6A 1P6CA 1MWQA 4WKYA 2PI5A 2Z1SA 3EZ4A 1B1YA 4CI0B 1EGZA 2E09A 4CO2A 2GMJA 5KT7A 3GS6A 5CPNA 1OX6A 1VCGA 2B7QA 4F3MA 2TSYA 3EB4A 2DY1A 1R9YA 5DLFA 2J5AA 5AHFA 2DDXA 3BGLA 3V6DA 2YWGA 4RPQA 3NS6A 3AZSA 5HQ8A 2AJ0A 4J3WA 4D6GA 1QPQA 4AF0A 1FRLA 1RWNB 1KFLA 4C6EA 3BPSP 4DLMA 4FZVA 1YW1A 4UNKA 3IWPA 4JTGA 3W83A 2AKMA 5CAHA 1RP8A 1X0PA 1UR8A 3TIMA 2OWCA 3S01A 1OY9A 3PCOB 4O23A 2EKCA 4F26A 4A05A 3IIVA 2O7QA 3WDPP 2PT0A 3WDRA 1SQ7A 2MQ8A 3DOLB 2GDVA 5DX7A 3C8YA 2CIMA 1XWLA 2ZXBA 3T42A 2AKWB 3K5LA 2EEYA 2CADA 1I1WA 3OG3A 2HBQB 2V2QA 1Q8LA 5IS2A 3CB8A 1QBBA 4ZEPA 4IT1A 1ZSXA 2ZX9A 4ECYA 2PI6A 1C8YA 5EWEA 4KV8B 1NKEA 5C24B 2A3CA 2VFEA 3C8NA 4W7UA 3QGHA 3H40A 4OV1A 4OX9J 1RAEB 4JICA 3ITLA 5KOXA 2H9AA 2YDRA 1ZA1B 2Y61A 1OX5A 1PSCA 4TX9A 2A6OA 4M95A 3QATA 2R2TA 1H5VA 1TVRB 1WDWA 1LK7A 1LQ9A 1A4LA 4L4OA 2AEJA 1K4HA 3P5ZA 4X66F 3QRRA 1LL6A 1EWEA 1KEKA 3N2OA 3CMES 3AS2A 4X9SA 3ME3A 4GYPC 4TUFA 4LX4A 2WSKA 5AVHA 3CMJA 4MAVA 1H09A 5B80A 5I23A 1SJAA 3CUGA 3KJVB 2OPJA 5D9OA 1UR4A 1UUQA 4H00A 3IBFB 3MMBA 1BXBA 1UETA 1KLNA 3FC9A 3CJKA 1MFVA 4LR8A 1H2JA 1KGXA 2BJ8A 5E0OA 2YWHA 2KX9A 2YCEA 1GTEA 2I38A 3EMZA 2PDWA 3LPPA 2R2SA 2PDCA 2GJXB 5FEZA 3HP6A 2B8PA 4A8SA 4YVPA 4O54A 2WSYA 1GMWD 2VX4A 4XZLX 2KO1A 5LZLA 4QCEA 2CPYA 4G1PA 4B5VA 3IBCB 2ASHA 4OZ1A 4O17A 2ZWYA 2WMJA 4FPSA 3TAPA 2R7XA 4UQAA 2PWHA 1RVGA 3TC6A 2E1WA 4WFAQ 3L12A 1JPIA 3W6YA 4KCWA 1O68A 2WPBA 3G8SA 4JTDA 1AB8A 3NCPA 3O7UA 2EBGA 1T94A 1NXIA 5C7PA 3UR5A 4MK8A 3BXWA 4LRFA 2DH7A 2XEXA 5EX3A 2UXDJ 4FLOA 1PC5A 2EPHA 2YWKA 3NWGA 3UU0A 4J2PA 3L0NA 4C8YA 3VNZA 5AC6A 3L2IA 4ECRA 4GUIA 2XYGB 2W3ZA 5FJRA 2CC0A 4GZEA 4GBUA 2R2RA 4GVHA 2HQCA 3P60A 5ETPA 3AO0A 3VOHA 4J3ZA 2UY3A 3DUGA 1YJRA 3UR0A 3TRGA 4CCDA 4MZ8A 2D73A 1EC7A 3BGFA 2XVNA 3QFHA 5E2QA 1EDGA 2PWGA 3M2RB 2IJRA 2VR2A 5IV4A 2KH9A 1X39A 4ZQMA 3I32A 4E4FA 3QFWA 1V3RA 2V8PA 4CCCA 2PA8D 1RV8A 3BGGA 1O5XA 4USHA 4ZIWA 1K03A 3VNYA 4NXKA 1WEXA 3WUGA 1B3OA 4U95A 4OECA 4L80A 4WEVX 3BQ0A 3VQSA 2BANB 2QULA 1FA0A 3AYTA 4IIEA 1LBFA 2NCKL 4FP1A 4FNPA 4J9LA 3EDFA 1FBAA 4ETXA 1KVKA 3GH4A 3NL5A 4ZZ9A 1VRUB 1BHGA 4R85A 4HHLA 4DMZA 3A9BA 4IX2A 2HWTA 1Z3NA 2ZRWA 5BOOA 3LNMA 2O67A 4YMEA 1YTYA 1S97A 4NZJA 4L6OA 4NYUA 4ORIA 1RA7A 1JZ7A 5BU9A 2CZFA 5A0YA 5KFOA 2BDPA 5THWA 4QDPA 3VAIA 3W7QA 1JVNA 1JI1A 4H6EA 3NXLA 4XSLA 3CWHA 3TA1A 4B02A 4NXMF 3RB3A 2VELA 3UYIA 1KHVA 2VX6A 1VJSA 1FKPB 4XIUA 1XYZA 3GG7A 4L9YA 3TUIC 1PZ1A 3PJUA 1N54B 3IRXB 1IYXA 4AHPA 5LIXX 3IJLA 4DBQA 1S1XA 1T8XA 2YL5A 4EBEA 3VDBA 4LR7A 3F5KA 5JIPA 4USVA 2KZHA 4JV1A 3LDVA 3QBCA 3CYVA 2X09A 4NMXA 2HE5A 2G4JA 3AJXA 1UAWA 3MM5A 1ZGDA 3SRHA 3S46A 1E6XM 2F2KA 5H1SV 2P5NA 4OYBA 1KVJA 4ICLB 4Q2MA 3PYDA 3KBNA 2W4PA 1ZP3A 3QJJA 4GG9A 3PV8A 2ZUMA 3M8PB 5AECA 3C8FA 1KFWA 1UD2A 5KG7A 3CDAA 3W3SA 1GEHA 4PUMA 1TKZB 3G82B 3MKKA 3CJ8A 1T05A 4MFEA 4LVAA 1RTZA 2N3OA 1C8XA 1RTIB 1V6TA 1V7AA 1S9EA 3CAVA 3TU9A 1W17A 1VIZA 3DI6A 3B8VA 5E9AA 3S8SA 3HSDA 2ZWZA 4IGNA 1N8WA 2R94A 2WWDA 1QWGA 2R2UA 3W2LA 2R42A 2XN2A 1EP4A 1PVNA 4GK8A 3QWUA 4J9UE 4LUYA 3FYPA 2R1MA 4KFPA 3VCRA 4NXMJ 1CVJA 1U5VA 1UPPA 4DF1A 2EJ1A 3PBUA 4FOKA 2ZHOA 3E0LA 2H51B 4B16A 1UKOA 1R27B 4I90A 3FUYA 2XG9A 2AGTA 3SSSA 3ZTOA 4DI9A 1HJXA 1FHVA 2X1IA 1QW9A 1AMKA 3EGZA 1HW8A 4LY8A 3NNTA 2JHEA 4XPCA 3OLGA 3KRSA 3S4TA 2ZUWA 1F9HA 1NHVA 4PYSA 3MAQA 3OFGA 3UEQA 1BF6A 1BQMA 3BJFA 5ABGA 1VHCA 3Q24A 2DJXA 4ERIA 5D4LA 3BO4A 3OZYA 2V5DA 2DGSA 1UZ1A 1Q1KA 3W2WB 1U1KA 1H41A 3RU8X 2R6OA 1AW0A 3VQTA 3BURA 4G3IA 4BWLA 2J6SA 4I7VA 4A3RA 1L3SA 1XLLA 1R46A 1IT8A 2HYIB 3RMEA 3BMVA 1V7YA 3D3AA 5FD0A 1JJCB 2XSAA 4F9JA 1ROFA 1HF6A 3CQHA 2HZCA 3RPDA 3MUIA 4BS2A 2D0FA 3RHGA 1QK2A 1HI0P 4I56A 2HQ3A 5M2UA 4LFCJ 4K0KJ 4PKDB 4DUOA 5K20B 4UTGA 3PTKA 2LMIA 3TP2A 3W62A 1EX1A 1TFYA 4QWCA 3N9SA 1IM4A 2ZTJA 1HJQA 5C2CA 3N9KA 2XZWA 4OZ2A 3GYNA 1PCKA 4ATWA 3VAJA 2ALYB 3PSVA 1UWSA 1HNZF 1K77A 3GC4A 4YTUA 3BQ5A 1NELA 1JNDA 1FWKA 5I09A 5I06A 2YNHB 3QYSA 4IFVB 5CBBA 1P7TB 4Z0JA 2JOQA 4DWSC 2OMOA 2VPXB 1VBZA 1BG4A 3TZZA 2VIHA 1RA5A 2PMQA 3TYZA 4XZIA 1J5OA 4ATDA 4Q0BB 4AZ7A 1XH0A 2G3FA 3IIOA 1XISA 3QSTA 1HHQA 2QMWA 4DPUA 1UZHA 2QS8A 1WKKA 1Q86T 4H6QA 3ITVA 4MNMA 5CPLA 4YHHF 2CZ5A 4GC3A 3P7YA 3DNCA 5D78A 4DELA 3IACA 1ISXA 1UKPA 4W8AA 5F8IA 4JIRA 4O1FA 5DJBA 4ML9A 3L21A 4DBUA 3I55S 4PYAA 1Y5NB 2B9XA 2EFNA 1TYGA 3OW2R 3H20A 2VD9A 1KNZA 2PBGA 4Z08A 3BOFA 4HSHA 2FGBA 3UPFA 1H61A 3NEVA 1Y10A 1E6VB 2C2KB 3SUUA 4ZLNA 2HMCA 1YMYA 3KWMA 5FKYA 1HNZJ 1B3ZA 3SCJE 3CUIA 2HVOA 1GVEA 3MR7A 2D22A 1EPVA 5G4WA 1SIWB 4CU7A 4F0MA 2QLXA 3DGPB 1REQA 4JX5A 3TMQA 1I75A 3O06A 2MPUA 4J9NA 3GNNA 4S3FA 3KVLA 4WKAA 5B7YA 3TC7A 9XIAA 2DORA 3GXTA 2EK6A 4HHPA 4XK2A 5HQLA 2VOTA 1JNZB 3VO0A 3A4WA 4ILSA 4IMCA 3WO8A 3MECB 1HTIA 1W3HA 2V82A 4NL5A 2WXDM 1G9HA 2O4QA 3MCSA 2G96A 3HIJA 2YH0A 3ZLHA 1EA0A 1QE1A 1KRMA 1X4CA 4DX5A 3GE7A 2FJKA 2W4DA 4L6DA 3V5OA 5B7ZA 3S1XA 4GUFA 3CSKA 2Z1BA 4D6IA 1O5RA 2O9RA 2FQIA 3M1ZA 4NMLA 3PC0A 2XWDA 4WSKA 2B8QA 3W61A 1H1YA 1OG0A 4OBTA 5A8RA 2CW6A 3UN2A 4ZOBA 3VMOA 4R8UB 1W1B1 2WKLA 3RR4A 2BNJA 1TV6A 1UVKA 4YWSA 5K8PA 2Z7GA 3OGVA 5LIWX 1TPVA 1LG2A 1VHFA 4C8ZA 2P88A 3R6IA 3G77A 6PTDA 1C8QA 4G6VB 3DC8A 3GZAA 3LRKA 3WD1A 5L1LA 1ZAJA 4QQUA 3EB2A 4RR5A 3SQGB 3KFTA 4JIIX 3EWXA 3AAMA 4LUTA 4FR1A 4DJFC 1H0GA 2HAIA 3EMTA 3FFSA 4JX6A 3UXDA 1NK8A 1XLEA 2G4FA 5I24A 3LBOA 2RHQB 3AIUA 1FK9A 2WK4A 5K9DA 1ZYQA 1J2WA 2RJHA 1N7KA 2Y4SA 1X60A 3MM8A 3O6CA 3ZZPA 2V5LA 4Q8OA 2D2JA 1O6IA 3F7JA 4GXMA 1C0TB 4NX9A 5J1EA 3MP4A 3AHTA 1OEPA 3CB3A 1N5SA 2VA2A 4KRTA 1FH9A 3PWIA 2QN6B 5LMUF 3VE9A 5I3IA 4PMXA 3ECQA 3DI1A 2P0OA 4DX8H 4TVUA 4MHBA 4EU0A 1JCTA 2YIHA 3DCPA 2PEVA 3DDIA 1BGGA 3W7IA 5M17A 4M0XA 3RLUA 3APYA 1HW9A 2FJEB 1UFWA 3MXHP 1Q16B 2VPWB 2DQWA 4GQRA 4YS1A 4RWWA 3T41A 4GD0A 1KCLA 2W2NP 2QLBB 4XISA 2UP1A 1GG1A 4ACZA 3D28A 3KS6A 4OYOA 2ZX8A 3PFRA 3C2EA 3TSDA 3ARYA 1F5AA 5BYSA 2FMNA 4B9UA 9CGTA 4DPXA 2LCWA 1ITQA 2GUUA 3G6MA 2DSWA 4IYQA 2ABBA 2P50A 1EJWC 1EX8A 1RWMB 1J93A 2WBRA 3QGIA 2KM8B 2LXFA 3ZSSA 2XHCA 4QW8A 1ZP4A 1EGMA 4IQMA 3RB0A 4JTEA 4PABA 1LEOA 5JH2A 2ZE2A 5E7OB 2FY1A 3W65A 3OLBA 3H21A 3B0UX 3PM9A 3W7GA 4ZP8A 2LECA 1NAL1 1IBLF 2DZPA 3OD2A 4P2MA 1TELA 2XFRA 4ZOCA 3TZFA 2R9LA 3RU0A 3MUY1 4HNTA 5LMUJ 4DSKA 3CZJA 4KWOA 4ICNA 2ACQA 2Q79A 5HJLA 2H3BA 3FCWA 3WLTA 2XDFA 4MJ2A 5ABHA 1FNMA 3L4TA 3BAYA 2J7UA 1QTMA 3WQGA 3TOYA 3MFIA 1HW6A 2E6DA 1VEMA 4GYKA 3L7PA 3BDKA 3NGTA 3Q83A 2RJZA 3ARQA 3UR8A 2P2CB 4LRBA 2Y8WA 3POCA 4HTJA 3M8YA 3OA3A 1WC5A 2VFHA 4A8MP 4KT2A 4RE3A 3RLGA 1QAIA 4PSPA 5JQ9A 2HBVA 3KK2A 1FDZA 4HVZA 2Z2UA 2FMOA 5REQB 4MMWA 3OUYB 5D9NA 4KF1A 3VFCA 2WB5A 4AMCA 1JFHA 4PTMA 4IPIA 3CEPA 2XVGA 2OPPA 4GVBB 1OY0A 1U30A 4RXGA 3UF9A 2XGQA 4CNPA 3QM3A 1WSVA 1WA3A 1TUGB 3QR3A 5C71A 2Y7FA 2BOGX 2V8HA 2JDJA 3L67A 4TVDA 4B3TF 1U1UA 4F3QA 3VPLA 1RB0A 2NT0A 4Q4OA 3BAXA 4ZO7A 2IHR1 2GGGA 4UTHA 3BG9A 1OWXA 4H6RA 2BB0A 3W9JA 2WVFA 1WTFA 1FVSA 4ZMGA 4LSZB 3VXGA 3H4XA 3A21A 2CERA 1MZRA 4PE8A 4DAIA 2W0UA 2BX6A 4AE5A 3CWNA 1Q6FA 3WQFA 1A3WA 3SCKE 3X1LB 4GVFA 5GAHU 1VPQA 3E2SA 5K4ZA 3TN5A 4L65A 3MUXA 1QFEA 1KFEA 1T9YA 5HMSA 1OFBA 1JLQA 5AY7A 1WP6A 1DIOA 1KBLA 4KHPF 1WQ5A 4S23A 3W2KA 3N79A 3LY0A 6FDRA 2OLHA 4GLEA 4ZVOB 4RR4A 4QNWA 2VOOA 5BXRA 4CLYA 4CTAB 3QT6A 3VOJA 1JYNA 4RWXA 1GOIA 1QNOA 2PTZA 1HJUA 3Q22A 1A6LA 3H53A 3LGGA 3RYLA 1FFGB 2FD2A 3H5SA 5KTLA 1XDLA 1VQ9S 3EWYA 1DBTA 3IEBA 3W22A 1PIEA 4B3TJ 2YLAA 2U1AA 1IKVA 4WBFA 2E5CA 2E9RX 2BS9A 2XNQA 2DNGA 2FVSA 4BCAA 2IPGA 3ZOAA 3KBWA 1UP0A 4QAWA 3COTA 4UR8A 2FDSA 4N9BA 1VQ5S 1XLFA 4JCLA 1C4CA 1S2WA 2YPYA 1MDRA 3HN3A 4QQ3A 2B3TB 5IBXC 1XIQA 4NP7A 3A1YG 5AVNA 3KTSA 1V79A 4HZ8A 3AUOA 3HD2A 1UMJA 4JI3F 1VFSA 3A12A 1JCXA 2B51A 1X9SA 1TKKA 2UUAF 1R3VA 1ZPTA 3WQ6A 1H2TZ 4NZ0A 2QHAA 5D0EA 3MVTA 1K9DA 1DEDA 3H7RA 1W25A 1LLZA 3QTGA 4FIQA 4N9EA 5E3CA 2J6UA 1QNVA 4V28A 4TU1A 1WI8A 3F0NA 4KHPJ 4BJHA 1AQMA 3RK8A 4J35A 4X4SA 2X1UA 4BC7A 2UVWA 2COLA 1PXGA 4TOQA 2QLJB 4JOUA 2VU5A 3CV7A 3WF0A 2DW7A 1PB0A 1WEZA 1WBJA 3ZM8A 2N82B 2HCVA 2XCPA 3L2LA 5FOOA 3K5OA 3UVAA 1V3HA 4IG0B 5DG7A 2J7GA 3TVKA 3AOCA 2YFOA 2PC8A 2CG4A 2BKOA 1JNEA 1N0VC 4X4PA 2OX4A 3MSRA 4FMVA 3JU2A 5CD4H 1ITUA 4PQUA 2OO0A 3MUZ1 3LLFA 4JIQA 1P1TA 5H9FJ 4H4KA 5HNUA 3B4DA 5DFAA 1TCDA 4IIBA 4OI2A 3WD0A 4ZLJA 4FYVB 1VENA 4GGBA 3R5DA 4JI3J 2WYSA 4NHVA 3VD5A 3ONCA 2QA2A 3UD3P 2UUAJ 1P6BA 1JF5A 3M30B 3WDQA 4EEYA 3HQ1A 1S6QB 4FA3A 1KLZA 1CZ1A 5E3AA 1E4NA 3CCES 2VQEJ 2HEKA 1OD8A 1P4CA 5AXKA 2AL2A 4MB1A 3SFUA 2N7YA 1SFLA 2I1RA 3AA9A 1NIUA 2AJ2A 3UFCX 3RB4A 1DWJM 4LTSA 3J7HA 2AF6A 3EBVA 4TR9A 2CHNA 5HWMA 2ZTKA 2D9PA 4C7GA 4HBKA 3PHAA 3DC2A 1SQEA 2J24A 3B82A 3RO6A 2XGBA 3HZGA 4QJ1A 1JAKA 5FI8A 4YS2A 4Z1BA 4H7ZA 2ILZA 1UJQA 1TL4A 5AYBA 2ZWOA 1OGBA 4NSBA 1JXVA 4H41A 4ED0A 4CYUA 1SZEA 4E98A 3GAKA 4Y2MA 4ZJQA 1DJQA 3GSMA 3F4WA 3LSBA 1S1TA 1ONWA 3POTB 1DJIA 1WOSA 4CO5A 1EB3A 2ZX5A 7TAAA 3GXPA 1Q65A 2LQ8A 3EWWA 1U48A 1RAOA 5HROB 2FLLA 3ZNJ1 3RW7A 4L64A 2V2CA 4NAEB 3TK7A 2GLKA 5AYIA 1WI6A 5L46A 3IIXA 1CULA 5IOLA 9ATCB 4JY9A 5DRIA 3BMXA 2JF7A 3D0HE 2PUZA 4NYOA 4CN4A 1WKDA 3N12A 1HWUA 2XS7A 4GI6A 4E8UA 2WOQA 3W7JA 4YLWA 3N6MA 3CUNA 3V18A 1Q78A 2IPFA 3JTNA 1E5NA 3C6UA 3CJKB 4NX0A 2JIEA 3TUZC 3U4AA 4H8VA 3M8QA 2QCDB 1H2UX 1ZENA 4B2DA 4H2HA 2OG9A 5EN1A 1AH0A 2BV9A 3EDRB 2C3YA 2KI2A 3ZTSA 3PFEA 4ECWA 2TAAA 3A47A 4S39A 3GIQA 2V5CA 1F74A 5A76A 1KWKA 6XIAA 3HKZD 2YNIB 3R9LA 3NM1A 1KOHA 5KFAA 3OLDA 1WDTA 3WQPA 4O0KA 3TYDA 3AFGA 1FXQA 2C18A 4NJGA 1TPFA 2Y1HA 3FYYA 3EB3A 2AQOA 3CAQA 1N8FA 4K38A 2EBEA 3EGNA 2DW6A 2WHKA 2DSUA 3HLUA 5FD1A 2Q8LA 1DPMA 3UGRA 3L7OA 2DR8A 4CCZA 3V4BA 2QLYA 1U22A 1NNDA 2Y1LB 2OSXA 4DZ6A 1P8GA 4P7LA 1NVMA 5C54A 4FXWA 2YWWA 2XGZA 3FAXA 5KFPA 2WMHA 1GOOA 3WYZA 4IOCQ 2AU0A 1JF6A 3KUMA 4DYEA 1JYXA 1QU4A 3NUKA 1R0BG 3BSNA 3I10A 1ZAIA 5CEWA 1SSDA 1CG2A 2M0GB 3QV9A 5I6SA 1J6PA 1XQLA 2NPFA 3BDPA 2FJWA 3HURA 5J04A 1RI7A 3BZQA 5LJ5Y 1ZJAA 1PO6A 1E3XA 1NWRA 4LF8F 3GM8A 5G1MA 4DJDA 1B70B 3MHFA 1UD3A 2GJRA 1K6AA 4DM2A 2CJYB 2E1MC 4O3PA 5F2LA 1JZ5A 2D1CA 4NI2B 1T3NA 4UTWA 3B0XA 1BEUA 3N1AA 3RBDA 3HA1A 4W7VA 2WV8A 4I5UA 3GH5A 3NZPA 1JJ2R 3LF0A 3C66A 2ALRA 2C19A 1XYCA 2EXUA 4I6AA 3EEZA 2YW3A 4C1KA 1R8CA 5IHRA 1JLBB 4EXBA 1S0OA 4IQDA 3IRSA 4NLXA 1H2VZ 1F6YA 4AHOA 2XFYA 2IM1A 4C91A 2R1LA 5KG0A 3D6NA 3MEEB 3TEHB 4DXXA 2ZBRA 4PMJA 5AXLA 4XAPA 3KKFA 4X60A 2XMAA 3LMYA 4D8AA 2JFDA 4PWDA 3QQCD 1MMFA 5LIKX 3M1VA 2FKPA 4QE1A 3CCTA 2YDQA 3CC2S 4P73A 4RL3A 2LXUA 1ZRQA 4LF4F 1XF0A 2V67A 4ROPA 4F4XA 3OHIA 4K4YA 5DG9A 2XMTA 3VGBA 1U0SA 2DQXA 2V5KA 3IO1A 1IZKA 4ZDNA 3BJSA 3F4DA 2PP3A 3EOSA 2R7SA 4QSFA 3RX4A 4UTFA 4LF8J 4RW8B 3LU2A 3GBEA 4KR0B 3MI6A 3MPGA 4B90A 3WX4A 4KS0A 3T0DA 3T07A 3D0IE 3P5YA 1RAIB 2ZZ5A 4NJHA 2KRRA 3I9ZA 4MIWA 1AFSA 3W37A 4HHHA 4WK9A 2YQ0A 3FKRA 5BMWA 2CRLA 4QWEA 3KHRA 4XTIA 1LNQA 3GRIA 3W2VB 4HCLA 2OD6A 4H9ZA 1T9TA 4LQ3A 1V0LA 4GA8A 1KW1A 2VFFA 1A5AA 3ZS4A 2WANA 1YNYA 2QCLA 2D24A 4I9AA 2AJQA 1IKWA 2EFPA 4CCEA 4Z17A 2YKQA 3O8AA 4B3KA 3AZTA 3V1HA 3AIWA 1S9EB 4M1BA 5CA5A 2M8HA 3STGA 2E5DA 5LXRA 3CQIA 4LF4J 1TTJA 2YCJA 4JQAA 1JZ6A 2IFXA 3KCOA 5U7SA 5D33A 3D6MB 2BVWA 3EDEA 3ITOA 3LQGA 2ACSA 4GI8A 3KBSA 1CTNA 4DX6A 3C46A 1DHKA 1MO0A 3MUAA 3O9NA 2I0XA 3AXIA 1GG0A 4IGSA 1YNPA 2DUZA 3IARA 1RACB 3S1VA 1GOQA 1VQOS 2CQ1A 2UV8A 4ED6A 1ULRA 5D3GB 3TR9A 4DV7J 4Q8QA 3ID7A 4F4YA 3TA2A 3W07A 1RT1B 1QAPA 4M51A 3SN4A 4JTCA 1KB3A 5A3HA 2CA9A 3MMDA 1BQMB 3CGIA 5ETTA 4BQ2A 1URNA 1LWFB 2REQA 1R5YA 1XN9A 1RT7A 1XHGA 3MJMA 1M1GA 3O16A 3OHBA 3D5HA 3CTRA 3ET6A 1NUEA 5J2QA 5CSYA 1BWKA 3ES7A 2K3IA 1RK6A 4BWMA 1NJXA 1GEQA 5KMYA 3GVRA 4I0WA 4UOQA 3QV8A 1KRCC 1R8AA 2ZXQA 2G97A 3SCLE 4WXWA 4JDBA 1JLEB 4DFMA 2FVLA 1CXFA 2XIQA 3L7UA 4YR2A 2VYOA 5DGBA 4HZ7A 4UFLA 4OYPA 5JIWA 3PKMA 4ZQOA 1XLCA 4AIOA 4DX7A 5F9NA 3S1UA 5JUVA 4F48A 5C7VA 2AJ1A 2FB0A 1NZAA 4TYAA 1W1PA 4ZFMA 4DUTA 1BYCA 3THUA 5CG0A 1CXIA 2DISA 5L1KA 2XH4A 4XIAA 5I3FA 4CO1A 3U7JA 3HHDA 4ER8A 2Z0IA 4ZCKA 5AOUA 5A8WA 1FCAA 4IRDA 4RV8A 3CUXA 1XQIA 3Q2DA 1CJKA 1GVQA 2INZA 2GNKA 1ZBCA 2ZKTA 2OTLS 2HBRB 1UWUA 3FZBA 2IDLA 2CLOA 2EFVA 5EX0A 1XIMA 1WX0A 3N9UC 4E8CA 1TUWA 2QAPA 4LMZA 2OSYA 2PLJA 3IWXA 3LN3A 3PIOQ 1ZH5A 1W5NA 2I14A 5J5DA 4TMCA 2DGTA 2W1BA 5HVHA 4ITSA 4YTQA 2J7EA 1UWAA 4HH0A 1AXQA 3PACA 2Z00A 5ABEA 1LUCB 1SMDA 5D6GA 4LYKA 4AWTA 2HNZB 4O0ZA 4TY8B 4UNLA 5GNXA 1RHQB 1XR5A 2W8LA 2RRNA 5ETVA 4FIRA 1JNRB 1PYFA 3R8RA 2FJDB 4A4AA 5HUOA 1F8MA 3THPA 5J5RA 1I2OA 1TG7A 4W86A 1VKFA 5LNWA 2QL9B 3D0GE 3FJ2A 2V5JA 2BE7D 3QMRA 2RKXA 3R43A 5DRCA 4FR6A 2W2OP 4TMBA 4B4FA 3ZZTA 2FTPA 5C25A 5KFYA 4EPKA 3QHOA 2CZ4A 3W9ZA 3UI3A 1H7NA 3ZJ8A 2OPQB 2I2YA 1FRBA 2E4TA 4Q33A 3BDEA 3A64A 2E5LF 4KGZB 3ZSTA 1EJTC 4DR7F 1ICEB 1W9UA 4O11A 1UWRA 3PZNA 1ZU8A 4ELVA 5TAOA 4NASA 4JI6F 4C7FA 1D8CA 2B7CB 3TFXA 4XAKA 4HR2A 4DY1A 3SEOA 4JTLA 2HXUA 3D1HA 3WLNA 4NEYA 4P7OA 3LO3A 4ANCA 5L1JA 3HPZA 4U5KA 4YVXA 2CXGA 3IXQA 1M68A 4MTPA 4Y90A 1S1UA 3SBFA 1WOBA 5K9CA 3A4XA 4AVNA 1V5XA 4DF0A 2HRUA 2I57A 3OVQA 4KGVB 2VXNA 3CJQA 4UMCA 1TR0A 1Q2SA 4QCFA 2XSJA 2WOMB 3DFHA 3DRRB 3R2CJ 2Y63A 1I6JA 3R12A 1L6GA 3ISND 5A6TC 5K9XA 1W5MA 3L9CA 3D6HB 2I16A 5KG1A 5G4DA 2ZE0A 4MK7A 3FGCA 3DU0A 5BRPA 4OBRA 2VDHA 1ZZFA 2K7KA 5DZ7A 1XRFA 2PU0A 1B0TA 5JU6A 3NO1A 1LW2A 2C3PA 3UG4A 2D9OA 2RRAA 5D04C 3Q23A 1PIGA 3HSZA 3UJFA 2RS8A 4ZPDA 1FWTA 3OBEA 2E5LJ 2PGFA 4NRSA 5CYQB 3GC5A 1KFJA 4LUTB 3RAXA 3BF4A 5KSWA 2W91A 4JI6J 4QJ4B 3MO7A 3QT5A 1J0HA 1R6WA 1VQ8S 3PNUA 2DNPA 3G2GA 2HJPA 3HGOA 3K4DA 2CZ9A 1RJJA 4C90A 4HHJA 4BQ3A 4DCPB 4OJHA 4QP0A 2NYIA 3CNYA 1V02A 2JK2A 3LM7A 5BRQA 1SSGA 3GFXA 2R7VA 1Q5MA 4ZQNA 2PC4A 3DHPA 1K1DA 1LROA 1AVAA 4ZVRB 4RUBA 4ERDA 1VBHA 1AH4A 4OOZA 3GXIA 5T9BG 4AYGA 1FKWA 1G7UA 1LOSA 3ZVHB 3CT9A 2PODA 3J81Y 5AJ3J 4J28A 4BLGA 5C2GA 2ZC4A 3ABZA 4DU8A 4YQWA 1FJGF 1KC8T 1X7IA 1N52B 1XLHA 5D0RA 3PR2A 3BH7B 3WJWA 1KQFB 3E74A 1HA1A 2HHSA 5ENLA 3LTOA 1BLUA 3AHYA 2Z1KA 4EACA 2J77A 1JGMA 1ZZMA 3GIPA 1MW7A 3UNYA 1P6TA 1Z9AA 4O8RA 4O1DA 1J96A 1FWPA 3KCLA 1XCWA 2Y0BB 2PZ0A 5KFNA 1CGTA 2V81A 4FNIA 4OHVA 2QMUB 2OOGA 1FE4A 3SY8A 2GHPA 2HHQA 3FOKA 1S12A 2XLJA 1I94F 3PZGA 3C16B 1CLKA 4RUAA 2GFTA 3GG1A 1QRQA 2IXVA 2Y8VA 2PURA 2CBUA 3NAHA 3I4KA 3QJPA 3TQVA 1FF2A 4PUUA 4PQAA 4ZB0A 2JSXA 5IT0A 1RPXA 3I87A 2J76E 5E09A 4IQJA 1O12A 1DVJA 2AYBA 1GFWB 2Z7KA 3PPFA 4GIAA 2QPXA 2HZVA 3ILOA 1CIUA 3W70A 3WK2A 1LV5A 1Y4ZB 3LTPA 3HGSA 3M32A 3M6VA 2EBNA 5D8ZA 4MFDA 4XD6A 2V8DA 3GMGA 3SQOP 1V0KA 2ZEJA 3W5ZA 1YJUA 1FJGJ 3W66A 2VFTA 4QSHA 1YTEA 1CSJA 4QE4A 1DIEA 3TYTA 3AS1A 2HNDA 5HLFB 3SCOA 3G8EA 4GUHA 3RF9A 4AZCA 3BWWA 1G4TA 3QQ1A 3FCHA 1PKMA 2OPSA 2CLFA 3IA0A 1AD1A 1OIAA 2IS7A 3REQB 1PKYA 4KBXA 1LYXA 1LZOA 1BQXA 4JTSA 4H9UA 3LALA 5J2PB 2VMFA 1Y5IB 2GA7A 4LSNB 1Z1ZA 3Q89A 3BBCA 1HPZB 3UESA 4KKOB 4OHWA 3CW2C 4FNTA 4LF2A 4MPQA 3MBFA 4PYDA 3UR2A 3QSYB 2WNZA 2J0QD 1FJ7A 1AZSB 3AHZA 2XY7A 1I94J 3NDYA 5D9MA 2XTKA 5J2NB 4AEOA 2BGSA 5IXUA 3E0VA 3LHYA 4G9PA 3CCJS 3HG2A 4Q2LA 3DRYA 4WX2A 3OFFA 4H4MB 2MKHA 4WF9Q 4FS2A 4H9MA 3GXDA 4MUPA 3TDFA 2C42A 2OVLA 2GQCA 3NGSA 1DLOA 4BR1A 1KFSA 4CUCA 2D2OA 3IM9A 2YKMA 2DGQA 3GYXB 8CGTA 3MDFA 1E1CB 1Z4UA 4TIMA 2NXCA 2C2OB 3C3UA 6CGTA 4N7TA 2VDIA 3PRVA 5FAJA 1CJUB 2H8ZA 3ONBA 2Y3YA 4NCBA 2GGPB 2QV4A 4QR6A 4GACA 1R6VA 2IYGA 2JF6A 3W9IA 4FNQA 2RQCA 4Q4QA 3G1SA 2UZAA 4INFA 4L9ZA 3HHLD 1VQYA 3FGVA 1H5YA 3UJ2A 2CBJA 4CLTA 3OSPA 3II1A 4UTMA 2OPRB 1VIWA 2P0IA 4ZPVR 1PX8A 2IKJA 3S2LA 1KD1T 1LBLA 2CQIA 1NOFA 1MLAA 4GC6A 3NURA 3HPOA 1NK6A 4ECSA 3W7BA 4AB4A 1MUMA 5H6HA 3A3PB 5CPSA 4EAYA 4EFAC 2FJXA 1MWOA 4YVVA 2NXNA 3SW6A 2C71A 1R0AB 4YY3F 1FWEC 3P0WA 1SZFA 3U2OA 1Q66A 1U0HA 1YRXA 1FDAA 3W2NA 4AD5A 2EK1A 1MZHA 2HSEB 3DLGA 3QMSA 3CMAS 2Y89A 3O1NA 1RHUB 2YL8A 1M5PC 2WCAA 5DY2A 4B2DD 1ISZA 3MAAA 1C7SA 1XI3A 4J40A 4XZNX 1DARA 3CCZA 1KM2A 4R0JA 2V3GA 3ILLA 4IPNB 1HVXA 1PUDA 2OSRA 3IR7B 4BHQA 5CZTA 2OJPA 1JAEA 1LP6A 2EKYA 4HOWA 1Q2RA 1Q95G 3CCWA 2FZ8A 4H4IA 2P8BA 1X38A 3M6YA 2ICSA 2XMJA 3TJ4A 4BWLC 2CPFA 5CCLA 4AL7A 4Y00A 3K8LA 3O07A 4MZ1A 2E68A 1LTDA 1R3SA 1M5WA 4M80A 5A2QY 2XQCA 4JX4A 2BE2A 2GQ2A 2ZUSA 5HUPA 1UFKA 2GX8A 2FVQA 5BYQA 3LAMA 1T0OA 1O1HA 2HGNA 2ABYA 4NU7A 3EXTA 1HKMA 1W3TA 4B3RJ 4O3QA 3V36A 6AT1B 2QW5A 1Q8JA 1KLMB 4UT4A 2QT3A 2BOPA 4JTHA 3EKZA 5A6AA 1M04A 5HBMA 3KOFA 4YY3J 2G3IA 4NLUA 4N8OA 2PP1A 4AZHA 2Y1RI 2W9CA 1EETB 1J27A 1NLKL 3G0UA 3US5A 3VIOA 1IQTA 3CAWA 4MNLA 4WFXA 1OQ6A 1RXOB 3NSXA 4LC8A 3TOPA 4DJDD 2F6UA 2BVZA 4OYXA 3N14A 3DLJA 5J1PA 4K37A 4WDTA 3GUGA 2VV5A 2MB0B 1JGIA 4XG1A 2PF8A 2PDQA 1SL2A 3V5FA 1EC8A 2F8QA 2DCUB 3QR0A 2BR0A 3HFVA 2WZHA 3HX9A 4B3SJ 1UKSA 5FEPA 2P76A 2HV5A 2Z6IA 1KRBC 4FZIA 3GV8B 3KP1A 4B9VA 4QJ5B 2QV6A 1XXXA 2NW0A 4B5UA 3OSNA 2D69A 4CNSA 4MF4A 1YLXA 3HHNB 4QU7A 4HMEA 3HDSA 3E12A 3HCXA 5JBFA 2NLYA 4BHYA 4HOZA 3Q8VA 3TTEA 2DVIA 1F6TA 2LKZA 2LEAA 5F2MA 4M5KA 2K2PA 4F7VA 1D9FA 3BZJA 1H98A 4J9MA 1XCFA 1TKXB 2NWSA 3UDVA 3L0GA 4QPXA 5I3DA 2OX1A 5FJJA 3E01B 4DXLA 1SJ4P 4JV5F 2VC1A 4O3NA 1VK8A 1DWHM 4F02A 4WP3A 3DDMA 2CPIA 2QMJA 2C0HA 5IT9U 3P6LA 2VNCA 4N41A 3L7RA 2BJ9A 2WCXA 3EGWB 2QCGA 1EGVA 4GFIA 5DZ6A 1BVNP 4ZHRB 4K8HA 2X41A 2V3DA 4FXFA 4LCRA 5BOFA 1VOMA 5F2IA 2VC9A 3KOZA 1B57A 4P7NA 2V9DA 2WWCA 1MQQA 3J80U 4HZ6A 3O6QA 1QASA 3R8HA 2VASA 3OQ8A 1S0VA 4ES2A 3CJSA 2CLLA 3UY7A 1H3DA 2C1HA 2EKGA 4WU2A 1HLWA 3SCIE 1FWIC 1P0NA 1QW8A 1XMBA 2PSZA 4FF7A 1S59A 4LOCA 5LXYA 4U4MA 2PD1A 2Q3OA 4DO4A 4CVWA 2ZC3A 1F2GA 3KBVA 3R5AA 3UA3A 2B5JA 3HVTA 1K8ZA 2FVCA 3IGVA 4IPJA 2IYIA 2E6YA 4AQYF 1HBNB 3VC5A 1S1VB 2E66A 3BCFA 2CNLB 1ZTTA 3LV6A 3MWAA 5ETMA 1DAXA 5BXTA 3GNPA 2GQQA 3QAUA 4WE1A 2DD8S 2G50A 2J9YA 4MNKA 5E6YA 1NO8A 3QPZA 2LEPA 2VG7B 3V6JA 2E5BA 1RA0A 4IICA 3QY6A 2QC3A 3GR8A 1HR0F 5K8MA 5A2AA 2XMKA 3UA4A 3Q94A 4FXSA 5BU6A 1UW4A 4NYYA 1B5TA 4XAYA 1IKYA 3H6OA 3K30A 1NSQA 4JD4A 2O01C 4RBVA 1CJVB 1XQKA 3NQFA 5F9LA 3CUJA 3CCQS 2A3AA 1K9FA 2DHGA 2WB1D 4CDIA 2GDUA 3DERA 3GG0A 4G1QA 2ZOXA 1JXEA 4KW2A 3MEDA 5D2XA 1EEXA 3GH7A 3XINA 3BLFA 4CLKA 1S10A 3NOYA 3QYYA 1FJCA 1TMHA 4XO0A 5FA5A 1XD0A 3I65A 1K47A 4L73A 2Z24A 2BQRA 1NFGA 2V94A 3EXCX 3DOKA 2VZSA 4WZMA 3G1YA 2ZBTA 1X1ZA 2WQPA 4LAZA 4AQYJ 3OEXA 3BSGA 3ALFA 4JQ2A 1LLOA 1K7EA 3ZLFA 4K6AA 2IKIA 3STEA 3L9ZA 3URQA 1Z41A 3BN7A 1H74A 3CJ3A 3GHTA 2ZNYA 1E43A