3WQPA

Crystal structure of rubisco t289d mutant from thermococcus kodakarensis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
437
structure length
436
Chain Sequence
b'IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFDRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Mutation design of thermophilic Rubisco based on the three-dimensional structure enhances its activity at ambient temperature
rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
total genus 149
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3wqpA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3wqpA01
2OEKA 4F0MA 2OEMA 1IR2A 4HHHA 1TELA 2V67A 3ZXWA 3RG6A 3FK4A 1EJ7L 2VDIA 3NWRA 4MKVA 3A13A 2VDHA 3WQPA 1BWVA 1GK8A 4RUBA 1GEHA 5HANA 2YBVA 5HK4A 1WDDA 2V6AA 9RUBA 5HATA 1RLDA 3A12A 1UWAA 2OELA 3KDOA 4LF2A 4F0HA 8RUCA 5C2CA 2D69A 1RBOB 3KDNA 1UPPA 1IR1A 5HQMA 1BXNA 2OEJA 1RCOB 5HQLA 2ZVIA 5C2GA 1AA1B 4F0KA 4NASA 1RXOB 1RSCA 2V63A 5HAOA 2QYGA 1RCXB 4LF1A 1IWAA 3RUBL 5RUBA 1UZDA 2RUSA 1UW9A 2V68A 1AUSL 1RLCL 5HJYA 2V69A 3AXKA 1RBAA 1UZHA 1UPMB 2CXEA 1RUSA 1RBLA 1SVDA 2CWXA 3AXMA 1YKWA 5HJXA 3QFWA
chains in the Genus database with same CATH superfamily
3ZS4A 4NI8A 4PUWA 1QUVA 1EIYB 2OEMA 4N77A 3VZXA 4OWGA 3URBA 1V0MA 3UJ2A 1LJYA 4PWUA 4JTEA 5GMDA 4ECRA 1PAEX 1ACMB 4ZVUB 4MKAA 3WNPA 4ITSA 1VFFA 2ZH1A 2A0FB 1TA3A 4LF9J 3BYPA 1OY6A 3B4YA 4IYQA 2VFEA 2DNZA 2IVFB 1H1NA 4XZ9A 4Z37A 4I7FB 4GGHA 3IUDA 4QNWA 4IMAA 4GACA 1VP5A 2JX2A 4FB7A 1RD5A 4UNLA 1FK9B 4RW8B 4JFTA 2XS7A 4O4GB 3FSIA 2P53A 1WORA 4HNCA 1SXLA 2EPNA 4CVWA 4FXVA 3NMRA 2IA6A 1EP3A 5AECA 1UKSA 4RDVA 3A9IA 1MW7A 3JAMU 1K1SA 1LKZA 1VBJA 4F0HA 3DH7A 1DE5A 2EF9A 1LNQA 4QQBA 2RKIA 3G0UA 1KNZA 2E0PA 3MA8A 1TIMA 3EKZA 1RWOB 5IC6B 1HKJA 3C52A 3KRUA 1RWVB 3NZGA 3U2ZA 4LSBA 3W6YA 4JIRA 3MOJB 3MB9A 5CZKA 1B70B 2FLLA 1RCOB 3UNGC 1BTMA 1YGYA 4HK5A 3THQA 4EZ6A 1NM2A 3N9KA 3QLDA 3QTGA 4QXIA 4JEJA 2WSFC 4Z7YA 3G24A 4XBSA 1EF2A 4GGBA 2W4CA 4DSFA 4ES3A 2YDRA 3QRQA 1KXQA 3GVRA 4HU8A 1Q5VA 4DVOA 3BGUA 3KVMA 1T9WA 2N7YA 3UDEA 3MHUA 4IICA 3FBEA 2MQOA 3TAPA 2DIUA 3NL0A 4JI4J 4O3SA 3CCMS 2XMKA 5G5IA 3VKBA 1U24A 2X3DA 5D77A 3AWOA 1X9SA 4USHA 4Z0JA 5I42B 1I1GA 1SYTA 2ESCA 1S5ZA 3TJ9A 1LWFB 4Y28C 3KHRA 4M5IA 2O5DA 2B8PA 3MM6B 3KG1A 5HI7A 2GQ8A 3QN3A 3JTOA 1F7BA 3CUFA 3BH4A 2CQIA 2J9DE 4Q33A 2DZWA 1M5OC 1R9ZA 3BOFA 4DCPB 3SZ2A 2WBRA 3W1UA 3A24A 1ZBKA 4Q4MA 3S5ZA 5AYXA 1C0TA 4QJ5B 3VOHA 3NSNA 4PN2A 4JV0A 1YBQA 1UZ4A 3HPSA 4FAMA 4DL0C 3DRPA 4HNOA 4NXKA 3RILA 2QLBB 4JYFA 3WX8A 2QKFA 3LP0B 3IR6B 3PACA 1AD1A 1K77A 2X8RA 2WOQA 3B54A 3FQKA 3DFPA 4ZPWR 3C2YA 4C6LA 4EXQA 7XIMA 1N4LA 5EX0A 2J8AA 2OGYA 2YTCA 1XQKA 4Z2GA 1KM4A 1A5MC 4DUZF 5HLFA 1HL8A 4NZ6A 4HK6A 1T9YA 4IFYB 1JKHB 3R58A 2CXGA 4O0IA 4U2YA 3OFFA 4ZCMA 2FTPA 4ZE4A 1PS9A 4C5YA 2FZKB 1RHMB 1FP9A 3OLDA 3WF1A 4RE3A 3MMJA 1ITQA 1RJPA 4PSRA 2EKNA 4LUBA 4H2HA 4HNNA 4ED0A 3V5OA 4OE7A 4AH7A 2BE9B 4Y96A 1XBWA 5FAGA 1O0PA 3BBCA 1ONEA 3SQMA 3SN4A 4MWAA 3UQNA 5IXUA 1L2QA 5LXEA 1ADOA 3TJIA 1XIMA 1VQ5S 4DFPA 1ZNNA 1CGVA 4NCGA 1QHPA 3HK2A 3E0LA 2QC3A 2ISVA 3LERA 4QLKA 2OLWA 4X60A 4OYOA 2O7QA 2IS7A 1ZJAA 2UXBJ 4B4FA 4UNIA 3M6UA 2GGHA 3ITVA 4XG1A 1A3HA 2BHYA 2GVLA 3KLLA 1F3EA 4MWAD 4A35A 2XNQA 4GZJA 3BG5A 1A4MA 2VD9A 1ZAWA 3LXCA 2VEFA 1ENUA 3ITHA 4ROPA 3KCJA 2HNDA 2J7UA 5JVGQ 5CC5A 4JTTA 2W2MP 1XNRF 2HQFA 4B9NA 1DVJA 1RT4A 4EAMA 3VR1A 3LTPA 3QSYB 1C29A 4HZ8A 1T6MA 2YCJA 3N6NA 4QPTA 1TKXB 3Q22A 4WEVX 5GAHU 4UTIA 2J7KA 2WW4A 1PKLA 2PSNA 1OGGA 3G87A 5EA9A 4DR5F 5CLTA 3M5YA 2XFYA 2VFTA 3PUOA 3DFEA 4PTDA 5HJLA 1SJAA 3M0MA 1RT6A 4HYWA 1RY8A 4PMQA 1GNKA 1V6HA 1WNEA 1M1HA 2VC5A 4MK7A 1WD6A 3TN6A 3NBPA 4F2RA 1UVKA 3CJQA 1Y5VA 3WSUA 1JD9A 1DXEA 2BKOA 1SH2A 2OXNA 3CWNA 3P80A 5AFDA 4PMOA 3R5DA 2IQTA 1PYFA 3DFHA 3IRXA 2KFNA 1H51A 3IAM9 4WJBA 1APSA 2G3IA 4U3AA 1DQ9A 3NPUA 4LJMA 1SJRA 1QVBA 4H1ZA 4QPXA 3N12A 2J6SA 4JI2J 1NH6A 3AXHA 4I5UA 1W3JA 4FR6A 1QD1A 3UG5A 1ZUAX 1S1VB 3LPEA 3CTTA 4NLVA 1X60A 1V6UA 4LF4J 1O5JA 2DRDA 4ADTA 2CJAA 2ROPA 1Q6OA 3DMJA 3VIPA 5I23A 1GVYA 1EPXA 3O1NA 3WEOA 4DV3F 5IDIA 4HJFA 2J6XA 1P9YA 2ZQ0A 3IGHX 2MQMA 1V0KA 4ZB0A 1RZMA 4YB6A 1RWXB 4JQ2A 4OVXA 3H5XA 2D3NA 2QJHA 3ZTPA 3O8AA 1FX4A 3T0AA 2KFZA 1XLMA 3GHRA 5CZTA 4DX7A 2YCIX 1SL1A 4Q22A 1Q7YT 4NCAA 1WF0A 2PDFA 3PJTA 4JDYA 3BO9A 4EF8A 2X1RA 7REQA 3PO4A 5FKYA 3VDHA 4ZOAA 4KEMA 1G4TA 3DHWC 5KEZA 3HMCA 3V36A 3FIGA 4PMNA 1F8IA 4XO6A 1PZ3A 5LMUJ 2XVLA 3NS6A 3MUVP 1AW1A 1E9IA 1E4LA 4FVCA 4XBJA 2IQ0A 3VOFA 1XF0A 4F79A 4HTBA 4X0NA 4XTIA 1K0TA 4I7UA 5A5WA 3EOEA 3OQ8A 1BXBA 4QIEA 4YHEA 1P48A 1TJ2A 3VNJA 1GQNA 3VD7A 4Y2WA 1Q8LA 1UP3A 5CXPA 4FBTA 2I57A 2NSCA 3S1XA 3UWZA 1KTNA 2G0IA 3GG1A 3KS5A 1Q6GA 4I56A 1ECQA 1B4EA 2MLZA 3DDNA 4LV4A 4IDKA 1S1XA 3G6LA 3W01A 3I7RA 1H72C 2R82A 3W76A 4HYVA 1NHUA 4A8YA 2JEIA 4U10A 3EE3A 1A5OC 3V1HA 2WB4A 4MIBA 2I0XA 1V02E 5A8WB 1FKOB 1NJWA 3BVJA 4O14A 3N34A 3G82B 3HX9A 2HRUA 1YTKA 4QITA 3PIPQ 1XMQJ 1WDDA 1DY3A 4YVPA 1VS3A 1A50A 2XVGA 2PWUA 3DCPA 3M7VA 1T0OA 4JKMA 3O16A 4MUPA 2WAGA 2EFVA 3W9HA 1UKUA 5E09A 4DHGA 1OMSA 1P27B 2D2OA 2E8ZA 5DF0A 2JLEA 5REQB 1GOIA 3KDNA 3W1TA 5FEZA 2ZOXA 2HRYA 3DLGB 1FTRA 1E9YB 4NI3A 1IXOA 3R89A 1GOWA 4OLPA 3W4RA 2GHVC 5SUHA 4ZPVR 4KQZA 2WKLA 4K7YA 5H1WA 4LC8A 4X4TA 1SM9A 2XFWA 4JXCA 3C15B 1HJUA 1W0MA 3T1GA 3ZC4A 4E8GA 3R8HA 4QBUA 2FB2A 2GJIA 2GVDB 5CAKA 3VX1A 2HFNA 1WX0A 4GWEA 3AB2B 1QRQA 1AZ1A 3E01B 2YA0A 1X97A 2GIRA 3UN2A 4OZ5A 3VIGA 1XH1A 6CGTA 1FKPB 5F8HA 4G1NA 4OT7A 1JLEA 1FJCA 2ADBA 5KFOA 3CV7A 3G1XA 3WNLA 2EO7A 2RNEA 1BLIA 4GYFA 4OI6A 5FOOA 2MEWA 1N33J 4M5NA 5EX3A 3V5RA 3AIEA 4XZNX 1MW2A 4FLOA 3K5MA 3W60A 2YNGA 1TTJA 2J78A 4B5TA 2J7EA 4YY3F 2GNKA 1M01A 1I2PA 4DSIA 2OTLS 2YOCA 8CGTA 1QNQA 3W37A 5K8OA 5I3HA 2CKRA 3MUCA 2KYZA 1XLDA 3D3AA 1KGUA 1JJCB 1M1GA 2V3GA 4DV1F 4C6PA 3M30B 3GU1A 3MEGB 1OC5A 1H09A 3ZXWA 3VAMA 4MAVA 5G2WA 3O5TB 2NSOA 2CZVC 1RY0A 4MHBA 4LTSA 2AJ4A 4IMCA 3OL7A 1ZJIA 3GPAA 4W93A 1NHVA 2VG5B 3TCEA 2PD9A 3P5YA 5GADU 1S1UB 4RLEA 3QEZA 2ZVRA 2HAFA 3GO2A 2RJZA 3LNMA 2DY3A 1QHOA 4IIFA 2KB2A 1O60A 4DR3J 3NGSA 2NS1B 4I9JA 3CQ0A 8AT1B 1T11A 4JV1A 1UUOA 4I9AA 3VD4A 3THPA 4Y6IA 1YJRA 3Q24A 1FWPA 1OT2A 3PPFA 5H8UA 2K3IA 2HS8A 1RTIB 3WLPA 3W1LA 4CN6A 1YJ9S 1MEHA 3NGUA 4LF2A 1GONA 1MQRA 3N6HA 4GX9A 1ZCOA 1DJXA 5ETOA 5IFTA 4IG3A 3O3RA 2VFVA 3W29A 3W9IA 3NZRA 4NZCA 3IARA 2IMWP 4PUJA 3BICA 5HMXA 3CPWR 1UHVA 1TJPA 4DBEA 2AOSA 3M6YA 1IZJA 3IANA 4PUEA 4MTPA 4S2BA 3GW3A 2V94A 1TKDA 1OGBA 3BO4A 2ALDA 2NWRA 3M6DA 1YJ7A 4D6HA 4B3KA 3MAQA 3F5JA 4GI8A 3KAOA 3G6ES 1YDVA 1NVMA 1KQZA 3SCJE 3G5EA 3S9YA 3HQPA 1UR3M 2SFPA 4Y2IA 3NFUA 3NAVA 5HWMA 4RZ5A 2QUMA 2CZ4A 3IP0A 3GIYA 5KG7A 4U8YA 4CH7A 5DDPC 4C11A 4O28A 3PX4A 4DO7A 1PIEA 2CQ2A 3HGOA 2L48A 1CNVA 1IGSA 4IPJA 3EEGA 3SGUA 1JR1A 4BWLC 2GV1A 1T96A 1U83A 3VD9A 1U5VA 5AYYA 1Q5YA 1NFGA 4JI5F 3AROA 2W25A 4LF8F 1ZTWA 5KT7A 1QI4A 5FEPA 3RDKA 2J7FA 2OZ3A 1W1B1 2PDNA 1VQKS 2YNIB 3PAJA 3UNDA 3TYAA 1AUDA 3KP1A 4I64A 5HP1B 1HJQA 3O8WA 1VIWA 2NUHA 4H6RA 2CPDA 3W7RA 1SSDA 1VMBA 4AEOA 4YN3B 1FOBA 1MMNA 2CPYA 4B3OB 1W2VA 3G1AA 1JMTA 3CQJA 3GZ3A 5KFGA 5ADZA 2FVRA 1U1MA 2ZZMA 4DLGA 3UW1A 2HLUA 4P2FA 5LA2A 1ZPVA 1UCNA 5AYIA 2VVSA 2KM8B 1DL3A 4AY8A 4D8ZA 5BXSA 4GIRA 3KFTA 1W9DM 3QXBA 3V6JA 2C91A 1T8XA 1SFJA 4GVIA 3FLUA 2D24A 2MQLA 1H11A 5FJTA 1VFSA 1OZMA 4ANCA 1YX1A 4OMFG 1V5IB 1FY6A 4P2XA 1ML1A 3VGGA 2W4PA 1KRCC 2WK4A 1RTHB 3QH2A 3CCZA 3BJYA 1A0OB 5EWFA 4ZVGA 1ULRA 4AWEA 1AXQA 4EI2A 3C46A 3OUYB 1GVEA 1JL8A 2CNKB 3T55A 4X65F 1FWGC 4LF6F 1YXDA 1XLGA 3L68A 3FN9A 3W22A 4DO6A 5GJMA 1UEVA 1VRDA 4IGNA 1TX0A 4LUIA 3SQSA 4IH7A 3ETMA 2PGFA 3DN9A 3Q4DA 2C1GA 1JUKA 2GGIA 2EC2A 3W7OA 4IMFA 4H6EA 4PEEA 4UOZA 4OHQA 2PN6A 2OO4A 1DRZA 1JDDA 3HFVA 2UUTA 5GJNA 4JTSA 5HPOA 5DDQC 4Z2XA 1TA3B 4JAWA 3DUGA 4O1FA 4AWTA 2WCXA 2DVUA 3WH7A 1X31C 3ID7A 1KRBC 4AU0A 2CW6A 4ZA0A 1C1BA 4IRKA 3E8OA 1EA9C 4NZFA 3CB8A 1TUWA 1SL2A 3CL8A 3EZ5A 3K59A 1Q8JA 4RJEA 2YJQA 3BPDA 2X7VA 3RB6A 3R0DA 1FWDC 3TI0A 3KOZA 4AQYJ 2AKWB 4M82A 2VPXB 3CDUA 4ES4A 1D9AA 2HAIA 3TVYA 1HBUA 2G5WA 1RQBA 4PB4A 3SY8A 4CD5A 2N3LA 2NVDA 3QKZA 2A4AA 3PWGA 5GNXA 2WNQA 4M3PA 4FIQA 2C1HA 4OI3A 1JCMP 1OYDA 5A3HA 3M5VA 3T4CA 2EPMX 2PDWA 1WXZA 1ONRA 3GNXA 1XYLA 4XVEA 3CCWA 5AXMA 1SW7A 3LX9A 5DT7A 4WK1A 3D68A 4G1IA 4MVAA 1OEPA 1S10A 4P7RA 1H50A 2QV6A 1HGYA 2YKPA 3VALA 3H2MA 3SCSA 3LEPA 4WFYA 1K47A 2ATSA 4PFHA 1I94J 1BEUA 1AW2A 3ARTA 4MF4A 4RZ4A 1JXJA 4D71A 1U09A 2OR2A 3NVTA 2PTYA 2XN2A 2P5VA 4E2VA 5E0CA 3V16A 4RX6A 3CIXA 5F8LA 1EX1A 4MDOA 3BMXA 3KLHB 1GKQA 4AZHA 1JLGA 3UT0A 5IRPA 3EOOA 1VGAA 1H7NA 3QGAC 3U9IA 2BQ3A 3MPUB 2DP3A 3U8GA 4JYAJ 5CEWA 4JHOA 2QA1A 4H7ZA 4PG8A 4TQTA 4YEAA 4NYUA 4FKXA 4NJKA 3GJQB 4QCEA 1AODA 2K8GA 3OL8A 4H4IA 3AYTA 4RW6B 4ZIWA 3UJRA 3SCPA 1MDLA 1Q6DA 4FR1A 4OLOA 1BF6A 1GVOA 4IQEA 1WP6A 2YKOA 2R1PA 3WZ0E 2VFGA 4RCXA 4IQDA 3CNYA 5BOFA 4Q6XA 3WDPP 4X0VA 4ZOCA 4WCEQ 4KHPF 4FXSA 1EJUC 2PMHA 3H7HB 3CCSS 1UJ6A 2CZEA 1C0UA 1OHLA 4DXKA 5KFXA 2VFUA 1TQLA 4YS1A 3RBEA 3S1VA 1T3OA 4E8UA 2UWFA 4KPLA 3RCNA 1JZ2A 1H5YA 1KHWA 3LXAA 4J27A 3H90A 2R7VA 2O56A 1PTDA 4HPHA 4KV8A 2J9YA 4GBDA 2QUNA 1TWSA 3P8JA 2GCFA 2DT1A 1HNZJ 2XMWA 3P5TL 4NCBA 3SQOP 2HWGA 3QHMA 2HHXA 3TK7A 1KQFB 2AL1A 2XVPA 4LX4A 4NJHA 1FFGB 1CJKB 2DGXA 1P0BA 5H8PA 4ZQRA 2NT0A 3WQ6A 4AZBA 3ABOA 2GMHA 3EKGA 3W61A 1A5CA 1CJUB 2PS2A 8ATCB 4BF5A 3NGDA 4F36A 3WF2A 4CN1A 4DFJA 4J2PA 2CZVA 5E9XA 3Q8YA 1H61A 3CLMA 3S4TA 3N3TA 2OSYA 2ZFHA 4HHLA 3SBFA 2CPZA 2BMBA 1EKRA 2EFQA 4YP3A 2CFFA 1AT1B 1H1YA 4P72A 4I1TA 1D3GA 1YADA 1DURA 1MQQA 5EWEA 1MEIA 1V93A 2ZE3A 2H9ZA 5AE1A 5HATA 4EPDC 4PUKA 2QDHA 2MKSA 3KDOA 4LBUA 1E15A 1X4DA 3UCZP 2IJNA 3E49A 2HQCA 1PAMA 4KGMA 1S6OA 4F26A 1IZCA 2W8LA 2VFIA 4AC7C 4EFAC 4B15A 3VAJA 3KLFB 2J66A 2HXTA 3W1XA 4DV7J 1LG2A 4IIBA 3W7CA 3QGHA 2XN1A 3XIMA 4JP8A 5DXXA 3DHXA 5KFVA 3TUZC 2Y85A 1VJQA 1E6YA 3ZVHB 5A2CA 2WSRA 2QMXA 4WIIA 3DHPA 3ITHB 4K8GA 2BY1A 5TBOA 3RR8A 3BLLA 4F40A 3ILIA 2ZH8A 4QGCA 5BWFA 1Z48A 1OX5A 3WK3A 4F3OA 2CQ1A 3HGRA 3RYSA 1SUQA 3CHCA 2C2NA 2Y1HA 1YXYA 2QL7B 1UWSA 5GJPA 3SDOA 3CCLS 1B64A 1XJBA 4U2ZA 2DFAA 6ENLA 3A4WA 3MM8A 4DBQA 2AQ4A 1N52B 1FWAC 4C6QA 2G2OA 3W2VB 3WFAA 3MM5B 1FBAA 4WY0A 2RQCA 3TWAA 4C8ZA 1LBFA 3W7JA 4R5PA 5CC7A 3AAMA 2NVAA 3DOLB 4IFVB 4ZIVA 2CWXA 1C3FA 3DI6B 4QG9A 4RJVA 1VPYA 4BWLA 1QOXA 1CT5A 4NJIA 5D2WA 2VOMA 1W1A1 3AS3A 4H8UA 4XSMA 1E6ZA 4M1RA 4R8UA 1YMYA 5KFSA 4CNOA 5JJBA 5M17A 1T05B 2O66A 2ZBTA 3IRXB 5HNTA 4LU0A 2BQUA 1HBOA 2YWKA 4Q45A 3CSKA 1K7XA 1GJWA 5E6ZA 2BEFA 4GO8A 1EO7A 2X41A 2FHMA 1PL9A 2VONA 5F4WA 3TAOA 3LLXA 3E0WA 3M0YA 2PDXA 2IM1A 2IM0A 2CQDA 4IPNB 3R8YA 4OV4A 3H6OA 1WDPA 3BSCA 1NK8A 1B3YA 2PCEA 3SUVA 1QSYA 1HNXJ 4QLJA 3GYCA 3OLIA 3HZ3A 4M5HA 1UB3A 3K46A 1OX4B 4MFEA 4ZP8A 3G22A 5BW6A 3LMZA 3M4HA 4RW7B 2V4JA 4YB5A 4MTVA 3H7VA 4KIRA 1X5SA 2AZ3A 5EYWA 4DSJA 4I67A 4B3SF 3PFRA 2XLJA 1ONWA 3UWQA 4NLGA 5B7YA 3A6OA 1IXPA 1NU4A 1IXNA 3IVUA 7REQB 5AKQA 3DYPA 4DO5A 2DR7A 5HNNA 1L6SA 2YZRA 2PU0A 4TY8B 3IC1A 3C16B 5BU6A 1JCJA 2QPUA 4O0QA 3FV9A 3OG3A 2D9OA 4DMZA 1WC4A 4IGMA 1FWNA 3Q8SB 2VEGA 4WSKA 3KWMA 1OQFA 4R34A 4YN5A 4H9MA 1PSCA 1RT1B 1DJWA 1ZBTA 2OO0A 2ZE2B 3AIBA 3OQEA 2BANB 2XYGB 3ONCA 4LS0A 2WMJA 4MKNA 4OUIA 5KG6A 2Q43A 2EJ1A 1OFRA 4OUEA 4Z42C 1G5AA 4IQJA 4BBYA 5FJPA 3KK1A 2D2GA 4ER8A 5FF4A 4NQ1A 1YRRA 3WNOA 3ZZUA 4FX6M 3HHNB 1R7AA 5A6SA 4DUVA 3B8UA 5KFRA 1DJQA 3DFYA 1WPCA 5C9WA 2R7SA 2QAFA 1NZAA 4WGXA 1IWBA 1WWHA 1KB3A 6FDRA 3IPWA 3MHYA 4PRRA 2CIPA 3I6RA 2FUG9 3I5CA 3KFWX 3UI3A 1I1WA 4EWJA 2V50A 3ZZ1A 3QY6A 4N76A 3CCJS 2C2EA 4TKTA 1E51A 3CC2S 5A8KA 5KMYA 3IJLA 1XN9A 5LIWX 4Z2LA 3K5PA 4JTHA 3VOJA 4K1GA 3AIVA 2BBFA 3IV3A 3M64A 4NX5A 2BODX 4UTTC 4KS0A 1XJWB 2DJXA 4B90A 1DLOA 1TRDA 3DOMB 3SEPA 3UR2A 1ZFJA 5D2XA 2MKIA 2O9RA 1BVWA 4C7DA 4B3TF 2J5AA 4PZVA 2V9DA 1OFOA 1W7WA 2FHCA 2VTFA 2P76A 1ROFA 2DH9A 2VRKA 3HB9A 1ADDA 6FD1A 3J7YU 1E0UA 3BARA 4ZPTR 3PKYA 2DZPA 3ZT5A 3CD0A 1QNOA 2RRAA 2L9DA 1YDOA 2E7WA 2IAJA 4Q44A 1TJRA 3PCOB 4I9TA 3ILOA 2G1DA 4U3CA 4LUSA 1HWLA 4MADA 1WOOA 2CQPA 1PCAA 4YS2A 1TPDA 3MM9A 1T03B 4RZ6A 4ZPDA 1QNRA 2XU2A 2F8EX 3ARVA 3MWBA 4O12A 4GVLA 4NXSA 4LRTA 1TL7A 2YNGB 3D0HE 3G86A 3N04A 3JAMY 2LQBA 2Y0FA 2FZ9A 1V3LA 1A0CA 3WBEA 5JUVA 2YFOA 1WHXA 1UBPC 3BDEA 3S9IA 1YX2A 2DNPA 3HGSA 3WMLA 2AGOA 1VEPA 2DSWA 3U02A 3V6DA 4NYZA 6REQB 3P67A 1RAAB 3ZLHA 4IMDA 2MTLA 4DB7A 3GQCA 2XMJA 1QPOA 2PPGA 3K5NA 1WZKA 3PZUA 3QFHA 4DL5A 3RK8A 2JC0A 2V69A 1O95A 3FSUA 1C2PA 3VGSA 4IF2A 3M9NB 2XM3A 4QTGA 1LRNA 3UCGA 1BMQB 2PURA 3ATZA 1OX6A 5E3CA 3H0PA 3NSXA 2ROEA 1QAIA 4LAUA 2H4YB 1VHIA 5DMYA 3RR7A 1OF6A 1KWGA 4KRTA 1OY8A 3IM9A 3HF3A 3PZQA 4KIEA 1BD0A 1M03A 4PCSA 4N42A 1AROP 1Z69A 2PP0A 2VI0A 3DBPA 1IBMJ 3S01A 3UG4A 5K7JA 3ADAC 3NVDA 2RJGA 4O44B 2FMNA 3DFQA 1Q78A 3TC6A 1EZWA 3TQPA 2AX1A 1Q3NA 3QIPB 2PA3A 1V3ZA 4F2SA 4J9MA 3BCDA 4DQSA 5EDWA 1RABB 4PTMA 2OVLA 2CWNA 5IOBA 4LR7A 2IXUA 1E6SM 4DSKA 3KK3B 3DENA 1RV8A 5HQ8A 4O1BA 4F4ZA 4AC1X 2IMRA 4PRWA 3ZFHA 4Y8FA 3WN6A 1K8YA 4PMYA 1F9EB 1S2UA 1O51A 1U5JA 2E6FA 3HIJA 4Q8PA 1CCWB 5C9RA 4BC7A 1ZGDA 1RAEB 4FN5A 2UXDF 2BDPA 3CC1A 4I4BA 1BHNA 3M43A 1Q6RA 3LHUA 1A5LC 1PVNA 1JCTA 5DRIA 1T8EA 3D67A 5MF5A 3GNOA 3EPOA 2DTJA 3GG8A 3CO0P 2PWEA 4C11B 3ZTQA 2OEJA 3ONQA 4BQ4A 2CA9A 3GR1A 4ECUA 3AMKA 1BG4A 4F0RA 4OX8A 2ZJPQ 2D2HA 3F5LA 1BKHA 3SCWA 3WH8A 2RFGA 3MMUA 4CDIA 2QJMA 4UUWA 4J9OA 4LF7F 3BAJA 2V2KA 4WF9Q 1OCNA 2E09A 1RCXB 4OV6A 1XFCA 1PBUA 2VGBA 1K8XA 3WLOA 2Z4GA 2QMWA 3CYVA 2BACA 2ZZ3A 3BLOA 5D37A 3N0VA 3VGHA 3PW4A 4TYAA 3IIVA 4E6MA 3HJFA 1SJFA 4HA3A 1IBCB 2E9RX 4X61A 3DZ1A 4TVUA 1I45A 4BQ3A 3TTEA 1GUVA 1JLCB 1XQIA 1HIYA 1W31A 3QKEA 5A8RB 1VLWA 3SGGA 1N55A 2CPUA 4C6BA 2QFIA 2EG7A 4CYUB 3T9ZA 4ZDNA 5IT4A 1W26A 2PC4A 1QW9A 4PCTA 4X66F 5G2IA 5A0YB 1YKWA 4FPSA 3CO9A 3W6LA 4TTGA 1HBNA 2C2RA 4NNBA 5HQEA 4GY0A 4S39A 1XR7A 1SSGA 2I9EA 4LR8A 1W2IA 1KS2A 2I1RA 4S0MA 2QR6A 3GH7A 3MI2A 4GFIA 1ZS2A 3CPUA 1EEPA 2PLCA 3W65A 1KA9F 4XSLA 3V4BA 2UY5A 2ZNYA 3M2UB 2MJUA 4UFJA 3DKJA 3WX7A 1OGSA 4EACA 5KAKA 4XD5A 4KERA 2V5DA 1ISYA 1RAHB 3IMQJ 3K8VA 3D6NA 2A1BA 4ZHRB 1VQTA 1S48A 4X4VA 2X40A 3SSZA 2PDCA 5JBDA 2VR2A 5GMEA 4F50A 5H9EJ 3WHIA 3RB0A 4F9DA 3QR0A 2QHAA 2MQNA 5J2NB 3N4AA 3GVVA 3M8YA 2PLKA 1XINA 2P0IA 2R91A 1RP9A 4CZCA 1UA7A 2HIQA 3ENVA 2GQCA 4HHUA 1LCOA 3N25A 4HACB 3MQTA 1L3UA 4R88A 4FXWA 1C4CA 2XDFA 4PBGA 2UUCF 2RGLA 5B08A 3K2YA 5KG1A 2QCEA 4B3LA 4CO0A 4NRTA 5DANA 4EK7A 1GORA 4PMZA 2W67A 4QROA 4HYKA 5AHIA 2C7FA 2KVQE 2AQWA 2W27A 3SI8A 1MRQA 3IIZA 1R8CA 3OYXA 2L9NA 3H2NA 1ICPA 1HQUA 1KVKA 1AD4A 4W4MA 4DQRA 2KXFA 3ETOA 3ITGA 5HR7A 2HXUA 1J96A 3EB3A 2IQDA 1E6PA 3ZNJ1 2G95A 3SCRA 4WYLA 5BU9A 2ZKTA 1I0DA 3PRVA 1ZAIA 2ZD1B 1GOKA 1C9WA 4DX6A 2Q09A 1P4CA 5B0BA 5CHCB 1U0HB 3UCUP 4B9TA 4A8FA 1ZP3A 3VM5A 4N6FA 1HBUB 3MUXA 4KCUA 3D6MB 3N5BA 4D6DA 1BSLA 4TY9A 3RM4A 5DG7A 1S3HA 1OPZA 3F2DA 4WE1A 1NU5A 1UMLA 5JMNA 2AGPA 4BC9A 1NJZA 1OIFA 4Q8VA 2ZUAA 1IJEB 2HQDA 1LZOA 1HWJA 1J2BA 3ZWTA 3L3CA 4ZOEA 2XG8A 2I38A 2PI6A 4UY8T 3KTCA 1XLHA 1L2UA 1UMJA 2XGPA 4DUTA 4PQUB 4WZHA 1NH8A 5I78A 1OC6A 3UWWA 4DL2A 2W66A 1N82A 2QCFA 4Y2KA 1XLFA 1JK9B 3QTPA 1OWXA 3P0XA 1RPKA 3FFIA 4HD5A 1FI4A 4DQPA 1JDEA 2ZUGA 4HT5A 2RS2A 4ZVTB 4HN8A 3WIJA 2CJQA 5DZ6A 3NCOA 3MVIA 3GC2A 1SO3A 1D3CA 1W9UA 4A3RA 2XIJA 3ZO7A 4KHRA 5EBUA 1OS5A 3OXGA 1TZZA 2B7BB 3M0JA 4A46A 4CQCA 4L9XA 1QY7A 2A18A 4UTTA 4IOAQ 4LF9F 5GAEU 2POTA 4CT8A 1CECA 2NPIA 2DUXA 3JSYA 1DXIA 5D9MA 1V79A 3OVGA 3AY0A 3KBJA 2DPJA 3BAIA 3DYAB 5DG9A 4X2BA 3L9CA 2XIMA 1ZU8A 3IV8A 4QM1A 3SN0A 2HVNA 4KGKA 1WEXA 2VCAA 1FXLA 4HPJA 1SQFA 1JB0C 3LCFA 2WYSA 3BAYA 4MPKA 1EAYC 4S3KA 2VC7A 3CIZA 1GTHA 4AD6A 4DBWA 1NBEB 1R5YA 2QULA 4IP5A 2Y61A 4ZSTA 4AZIA 9CGTA 2JEFA 1IKXB 3SRFA 4KFBB 4QIGA 4OZJA 1R38A 3LZ3A 3N4WA 2YA1A 5DX7A 5HAOA 1L5UA 3EDRB 4UC5A 5BYRA 3T41A 2DV0A 3POCA 4OTKA 3WUBA 2ZNZA 2HHVA 4HGXA 4Q8UA 4LY4A 2EBEA 1W32A 2DPEA 3ARXA 4G1QB 2Z30B 1WUUA 3G1SA 1CB7B 4LFAJ 4E38A 1EKSA 4FPIA 2GYIA 1R2TA 5DEZA 5HL7Q 4P2MA 1XUUA 4CU8A 5EPDA 1LK5A 3A8KA 1HT6A 4MIAA 5AHNA 2HPMA 2JFKA 5I3IA 3WQDA 2WCGA 3MI6A 3GDKA 4D6FA 3KHJA 4GFSA 4XWUA 3AOCA 3K8LA 3AYRA 1RVKA 4GK8A 2J4GA 3B8VA 4AD5A 1HKWA 3CUXA 3MP3A 4HZ6A 1E70M 1UWQA 2PDQA 4JTGA 1QWKA 4G7EB 2FJXA 3IM8A 4AIBA 1BY9A 3FDGA 3GXIA 2XFRA 2FGLA 4ICCX 4BF9A 2VQEF 1AQFA 1A53A 1NOUA 3JSBA 3B8SA 3KRBA 2REQB 3B0VC 3LMYA 1YEYA 3BCJA 2AEJA 2A3CA 1TX2A 2HBZB 4AWSA 1S9GA 2ZRWA 1C92A 5A8QA 1R3SA 5E3PA 3EDQB 1MZHA 1XYFA 2Q8XA 2F3JA 2DW7A 4QHRA 5T9CE 1HJVA 3PP7A 1NPRA 4IX2A 1LBLA 3STEA 2I1OA 4ZOSA 3M5XA 1E6YB 4DPUA 3MS8A 2XIBA 2CETA 4UQGA 4UTLA 3PG9A 3RPMA 1I51B 3TVAA 4QX4A 1P1TA 1JQVA 2DCUB 4V19X 4JCLA 1FRIA 4M6UA 5FIPA 3KJVA 1FFQA 3K4AA 3NY0A 3M0LA 1I2RA 2E5HA 3IXQA 1SCJB 4JL2A 4ICLB 5EUHA 3H98A 3C6TB 1SUQB 3LD5A 2HMIB 1W1PA 3AIRA 1BLUA 1AH0A 2ACMA 1I2OA 2VR4A 5CC6A 1BWKA 1XX1A 3GHSA 1RHUB 3PZOA 1RTDB 1GHSA 1OSEA 4LWWA 2BRKA 1CW2A 4AIUA 3ONBA 4WXWA 4R5PB 3E9AA 1A0DA 2QNEA 1NWRA 2CUYA 1K1DA 4DXVA 2YDSA 2DU2A 3GK0A 2PBGA 5H9FJ 3BLKA 2HRTA 2BA9A 1PCKA 1QBBA 1TUFA 4CNZA 3WJZA 2WMFA 5H91A 2OPQA 4URQU 4CLKA 4K37A 1D3WA 1K6AA 4W5UA 1WEZA 3V7PA 2YL5A 4CEXC 4V28A 5D2VA 1RK8A 2IIHA 2OJ3A 5AB3A 3WLSA 1XFBA 4WWSA 3NDYA 2VEKA 5U4NA 1B7FA 5FJIA 3UR7A 2W9BA 4PXBA 1SZFA 2VFFA 5D3GB 3WFZA 3TEGA 4ED4A 3MT1A 4LV9A 5A6JA 1E1CA 3THDA 2QF8A 4P7QA 3FZBA 1RT2A 3APYA 3KW3A 3SJNA 5H1SV 2V2DA 2LA6A 4LQ3A 3WG6A 3T0CA 4USKA 4NI2B 1H98A 1U4BA 3SZ8A 3KUEA 1VIXA 3ARZA 1F5CA 1TV6B 1S39A 3D0IE 1DARA 1JJHA 4ID5B 1WBJA 4DM1A 4CO2A 2NW0A 1N6QA 2WQPA 4RKAA 5M03A 4QAIA 1FX6A 2YWGA 4HU4A 3U7BA 3TTOA 4BKNA 4D9PA 1RTJB 4ZMMA 2WJDA 5I3DA 1DXFA 4OYWA 1HO4A 5C9XA 1CULA 2A3HA 4POCA 4IOTA 5JQ9A 3TYUA 4YTRA 2OWCA 5C25B 2J25A 3A4XA 6ALDA 5IT9Y 1CLFA 1NY1A 4NYYA 1RK6A 3SCVA 3ENAA 4DR4J 1E71M 2WOMB 2FYXA 2CQHA 5I3UB 1D7FA 1WQ5A 2JE8A 4AD2A 2QGHA 3E1F1 4I8DA 3O05A 1M53A 1LL6A 2J0XA 2O67A 2QUVA 4HH1A 5KOWA 4MJ2A 2ZJRQ 1SH0A 2EGZA 4HPXA 2QPSA 4A4JA 2BQRA 4UFLA 4HDHA 1AA1B 4ATDA 1I2NA 4CTAA 1JPIA 1V6WA 2XYHB 5E0FA 2YIHA 4RW4A 4ZP9A 1OYBA 2BTMA 2F9DA 1RHRB 3X3UA 1XYMA 1M7PA 4WKHA 3VIHA 4PXDA 3MXHP 2HISA 3GNPA 1FCBA 2W8KA 2O55A 3N2BA 1CS4B 2P9EA 4CUCA 4OI2A 4UOHA 1OD8A 2PA6A 4GUJA 5C55A 4S23A 1VQ7S 4ZQNA 2X51A 2XMUA 4NZ1A 5CSYA 1TE1A 3OVAA 4HQVA 3PV8A 4Q0BB 2IFXA 3UVJB 2NLWA 3W5ZA 1AUSL 4J5OA 3MCSA 1N0VC 2EQDA 1V0NA 3LCHA 4UOGA 4YJ5A 4RPFA 3NPXA 1WV2A 2BRLA 2J7HA 3THTA 3HKZD 4YFUA 1KLMB 4DJDC 3R43A 2MKHA 1TZ7A 3TW0A 2Z0IA 1LQAA 4CQ9A 2PRLA 1T9XA 3CIWA 2V82A 4ECXA 2KXHA 3L0GA 2VA2A 4NHVA 1DJIA 5HN0A 1LXJA 2RF2A 1E4IA 2WSPA 3RR4A 2GVZA 4M24A 4FZIA 3ABZA 3W81A 3CQIA 5I3PA 1KCZA 1CJVB 1WUFA 3P5ZA 3MC5A 2X30A 1DORA 3VKKA 1GXUA 5CGQA 2JK2A 1XQLA 2BOAA 3KTXA 5FSDC 5C5JA 5LMUF 5BRBA 3FAWA 1VFOA 1VFMA 3H25A 1FX2A 2PP3A 2VR5A 3HOJA 3FVDA 4TMCA 4CCEA 4JI7F 3EYPA 1LF1A 4UWMA 5GNYA 1MFVA 1UEKA 2YKAA 4LFBF 4OZ3A 3OVSA 3H21A 3GSMA 1U22A 4LYKA 3U0HA 3BZGA 5TAOA 3MPGA 3KJFB 4Y3CA 4RE0A 2YNFA 3EX6A 1JLAA 1TL7B 1K6WA 2JVRA 2FZDA 3VPLA 4LREA 3VFCA 3LBOA 3OTDA 3BO3A 5HULA 1F3WA 3TZNA 5F9NA 3CC4S 1RHJB 1JPHA 1S9EB 2HNYA 4D6IA 1JEZA 5ABFA 3M6VA 3IK4A 1J18A 4NT0A 1R6WA 2VQUA 3QRHA 1NJJA 3CZ8A 4M5PA 3UWTA 3JR2A 2VPWB 1I2QA 3FGCA 3MANA 1TV2A 4Q5VA 1JPKA 2GZXA 2J79A 4B2DA 3H2EA 1UWRA 1U6BA 3H24A 3UZYA 1RWMB 2VG7A 2HW3A 1CGWA 3FAXA 4EBDA 1OFBA 1UMYA 1TU0B 3C8NA 4R3UA 1PIFA 4BF7A 3LQLA 3MSDA 4GXMA 2BGSA 3V4IB 5C9ZA 2V8VA 3B6BA 3KKFA 1IT0A 3NQ7A 5FJOA 3W27A 2DH3A 5EL1A 3GSDA 5CA5A 1Z2ZA 2YCLA 1JX4A 2VEIA 3R1LA 1XDLA 2XIOA 3N2TA 3MDUA 1ALDA 3TO8A 2Y1IA 1N5VA 1JXKA 3KM8A 1W2BR 2GGEA 3PEJA 4L1WA 3PX6A 4FYWB 3QRRA 3KK2B 1JZ7A 4B2DD 1DJHA 3EXCX 3HXMA 1S79A 2PC6A 4F2UA 3M9OB 5G4HC 4S3JA 1LW0A 3OHMB 2F6UA 4DWSB 3AQOA 1NP2A 4O3QA 1V3IA 3NO1A 1JRCA 5IBXC 1D8YA 3G1YA 4C6DA 2DXEA 1YSJA 3RZAA 4H4OB 5ETPA 1HP4A 3FFSA 1H49A 3HHLC 2D1ZA 2JOQA 2WVVB 4U95A 2GMLA 3MEEB 5D09A 2EPOA 4OBSA 2VL4A 4QE1A 5CYJA 1Q13A 1B30A 4AYBD 1FCQA 3GH4A 4ERDA 1Q65A 2FVLA 3JB9k 1VRUA 4OYBA 2QLWA 4ZSUA 1FRLA 4JX6A 5C24A 5A76A 2KJVA 3S5SA 3JQJA 5AZ1A 2Z8QA 1QNVA 4ILRA 3BV4A 4ECQA 2G4FA 2MY7A 4KW2A 3RCMA 3U57A 1NOWA 1LK7A 3FBCA 3A5FA 1S76D 3D47A 5D0EA 2W2QP 3TEVA 2J9DA 2A6NA 1XLKA 3SCIE 1XNRJ 1J5OA 4IJCA 5HQMA 3HGJA 3Q0AA 2C8NA 1JXEA 4GVBB 2DB1A 3Q8VA 3D0CA 4DR3F 4GKLA 3EDDA 1HF6A 1HGWA 1S6QA 4C6OA 5CPSA 2EKYA 1NIUA 4KWOA 3MMBB 3UDLA 3UEQA 2GDUA 2HROA 4AE5A 2FVPA 4DR5J 4EO8A 1PO9A 3N2MA 1BUXA 3MVTA 3RNDA 2QYGA 3RM8A 1R0CB 4OX9F 3SDEB 1S1WA 5AC8A 3BLPX 5J2MB 3GFZA 1QJHA 3VIFA 1MW0A 4M63A 4KH1B 2QO3A 1BWEA 3VQSA 1BQMB 1QR7A 4IG2A 2OD4A 3C56A 1I6NA 3RRAA 3B82A 4PWDB 3ARQA 4WIWA 4H4KC 3OZOA 3PZ9A 3NEVA 4H9YA 3H8AA 1VISA 3B97A 4G1KA 1H5VA 2XZDB 2BM1A 4J90A 1PDYA 1XISA 5I77A 3HZGA 1BYCA 5KG4A 3PJXA 1Z41A 3T6CA 3K8KA 1NOFA 4ZB5A 2OGJA 3GMGA 1XLBA 1ZAVA 5AVNA 1RT3B 3EVMA 4LVOP 5D2YA 2OEKA 2ZA3A 4LBRA 3T42A 1ZTVA 1NDYA 1X7FA 5K2ZA 2C28A 2EWHA 4ZVQB 4DV3J 4DSLA 1KV5A 2ZXAA 3PBVA 2ZOMA 5L39A 5MHBA 4A8NA 2CKSA 3FK4A 2E4TA 4N9DA 1Z6KA 3PRDA 2UV8G 4JBCA 5B7ZA 1XMOJ 2RH9A 2ZXBA 2A7NA 2VWSA 5DBTA 2GUBA 4CLFA 5DCBA 2FGBA 3NQGA 3BREA 3CCQS 4EAYA 3M6XA 4WDXA 3S2NA 1U26A 1WG5A 4DX5A 3HZEA 4IR9A 3K5LA 1R2SA 4LFYA 3RRXA 3V75A 1G1XA 2OPRA 4K4TA 3V81A 3SN1A 1SV5A 2HIYA 1KDNA 2ASYA 5E3QA 1XD1A 1EKOA 1VRTB 2BDQA 2Q3PA 4RV3A 1OFDA 3T2OA 4URIA 3MMAA 3D0GE 3UETA 3L0NA 2Z2ZA 2WNNA 3C2PA 4N41A 4NLSA 3PZGA 3OBKA 3EAUA 1Y11A 4ZVJA 4C3LA 3BS9A 3WNNA 3D6TB 1JLFB 2YPYA 3OJSA 3JQMA 2QL5B 3LP1A 5HWNA 1OIAA 4U67Q 1XRFA 2OX1A 4BLGA 1N7KA 4C6IA 2VQTA 3WD3A 2PSZA 2PLMA 2R8GA 5F2GA 2AT1B 2Q02A 4C48A 4K50A 3PYEA 2EKGA 3RBZA 3HSJA 4R7OA 3OU8A 3TW7A 3WL1A 3P3BA 2CESA 4OFZA 2GQ2A 2R2TA 3WLLA 3WK2A 4O18A 1ITCA 2BM0A 3TNBA 2FZNA 4DYKA 4WRHA 1ZBCA 3LM7A 4ZFMA 3Q23A 3WUGA 2DIEA 1ZSXA 5KSWA 2KG1A 4DPWA 3HHKA 1NJIT 1H2JA 4CQ8A 3D2WA 1U47A 2FPHX 3WO8A 1RBLA 3SFUA 1B54A 1LT7A 1O7AA 4WKYA 3MU7A 2J88A 3TN3A 4P7VA 3A3OB 1TPB1 2Y88A 5A95A 4UTWC 4I7WA 3BDPA 4DJDA 4C8OA 3GWQA 3LHYA 1VFJA 1CPUA 1QU4A 3GLCA 4QWDA 1Q6QA 2PGEA 3WIUA 3W7QA 2QA4G 4QDPA 2Y6ZA 1N54B 4C6CA 1V7YA 5G0RB 2NUYA 4Z17A 2RD5C 3SADA 3WQOA 3PANA 2X1BA 4Q4OA 4AL5A 1QK0A 3QPIA 1OSCA 1SIZA 3UJSA 1A5AA 5JIPA 4EPBC 1LWXA 4KGXB 3IGUA 1Q7LB 2YVSA 2ALRA 3R7NB 2VD8A 1IBLF 5BRQA 2DT3A 4DWDA 3I0RB 4AQYF 4JI6J 3D1QA 2KFYA 4QYRA 2ROGA 2QCGA 4M56A 2X42A 5E7OB 3LCGA 2XZ9A 4ZQPA 5GQBA 3MZNA 3FJLA 3C14B 3EWCA 2ZITA 5D8WA 4JTFA 1W3HA 3NRBA 1EWDA 1QJWA 1TVRB 4OHWA 2IMOA 2PE4A 2PZ0A 3PAOA 3FNNA 2PAJA 3LV6A 3WD2A 4HL9A 1JJ4A 2GFFA 4J9KA 3RJYA 5DRCA 3TW6A 3DC8A 4Q4RA 3HG5A 3CO8A 3EOLA 3QPYA 3MCMA 4UNKA 1YK9A 3AUOA 3M9MB 3QNWB 4O3RA 4IFKB 2XGZA 3QAEA 1RT7B 3V0SA 1CLKA 3W1RA 2BBEA 1W1VA 2YBUA 4H8NA 1YZ7A 3QLHA 2GW8A 3UXAA 4LB4A 1B90A 3EBVA 1F61A 2FHJD 2Z2BA 4TNOA 1SFTA 4ES1A 3VFLA 4JYAF 1KFSA 2EFPA 2ZBIA 2P8BA 4U33A 1B4KA 2VOPA 4YWSA 2VZSA 2MQ8A 1RHKB 5LJ5Y 4AEEA 4W90B 3WQGA 1S9GB 3AMDA 3NIYA 5DDOC 1NDKA 2F8HA 1R0AB 2VB6A 2NZCA 1QE1A 4WFNQ 2GK1B 1B2YA 3VCDA 1NK5A 3KLVA 3JYTB 4FNRA 3M8PA 4IHCA 1KKOA 2ZE0A 5EMJA 2B6AB 2GQ3A 2XFFA 3BPSP 3O0FA 3HULA 3H4BA 4CP5A 1NQKA 2PGRA 2LP4A 1FTXA 3M05A 2FJVA 4CI0B 3T4WA 3WQFA 3Q37A 1J0KA 3LBMA 3GAYA 5IBXA 1OYAA 2GHPA 3I0SA 1E6NA 1Q0NA 1B1YA 1P6CA 4XK2A 3GXPA 5EBAA 2Z6JA 3DRRB 2D41A 2R2SA 1FWKA 3E51A 3OD2A 1U49A 4O52A 3T5HA 3TDFA 2VCBA 5BR8F 1M3UA 5F4XA 3HHLA 4KKXA 3RM9A 3PYGA 2AKZA 1HNZF 5HWJA 1QCWA 2XH4A 2WONA 4TLQA 1UA0A 1GFWB 1L9WA 3UU0A 1LLOA 1UOZA 1XYCA 2A7PA 2DHHA 5GNZA 1YNPA 1Y65A 4LYQA 1TKTB 1GQLA 5C42B 5BMXA 2WB1D 3MTKA 4I90A 2V2CA 4ANEA 1BQNA 1W5QA 1FDNA 1TR0A 4C97A 4JI5J 4KCWA 2NUWA 2QLYA 3KHLA 2O9OA 3CWHA 2LA4A 2VX4A 2DCLA 2MSSA 5THWA 5LNWA 3AHZA 3FOKA 2RHGA 3P8BB 1XH0A 4U7UK 4Q3MA 3N11A 4ZOBA 2OPQB 2JF7A 3L2IA 4WTYA 1XV8A 4P7TA 4EPKA 4EZ9A 4KFNA 3AZRA 3WEMA 1LWEB 4YR2A 3UY7A 2F2KA 4P7OA 3VCRA 2K06A 5KFUA 2WZ1A 2JJ4D 3AQPA 3STCA 4C8MA 2OCZA 3IWXA 2XSFA 1GYNA 1W1IE 5E9AA 4BI6A 1X4CA 5AOUA 3GILA 2HHPA 2XSAA 1U2YA 3UZXA 4ZN3A 2RDXA 3R9LA 1HPZB 1TK0A 1K9MT 1OK4A 2O9PA 3USBA 3N18A 4W89A 1KLYA 4IIEA 4D72A 4CN4A 2JLFA 1NK0A 3QPZA 4DN1A 2YR1A 4NRRA 3HSDA 3MFIA 1XMBA 4GXWA 3B04A 5DMNA 4DV7F 1GQEA 4K5RA 1EB0A 4A3QA 2O1PA 1ZY9A 3B05A 3HFTA 3W2NA 4C65A 3R5CA 2I6WA 1S0NA 2G1HA 3H7UA 3JW7A 4Q8WA 4N0RA 1WXJA 1H2VZ 4XAFA 3AD8C 3MM7A 4QYZK 6TIMA 4X4PA 3CUJA 2D3OR 1FVSA 2ZOGA 2VG6B 3R3TA 1KOHA 4H4KA 3N6MA 3QPEA 4WJEA 3TTQA 1Q45A 4KPYA 3AIUA 1AMKA 2Z2MA 3UDCA 3QZ7A 2INEA 1GCYA 2HVHA 2ZA2A 4X65J 2PWFA 5JIWA 2QIFA 2C2ZB 2VH7A 1DWAM 3F4VA 4H01A 4H2CA 1ZOTA 3CGIA 2W9MA 3QGIA 2A3AA 3EDEA 2OQYA 3M6WA 2NV9A 2W4XA 4XIMA 5E5NA 3CL7A 1T9VA 2PA8D 1F2HA 3I7QA 1TUVA 1A80A 1P1MA 2XI3A 3GYGA 2ZTJA 1XC6A 2WZIA 2RJHA 5JXQA 1YITS 3INPA 2QV5A 3L09A 4HBKA 2QV4A 2V6AA 2UVVA 4DPXA 3PFEA 2ODOA 1OM0A 4K39A 3CH0A 4OI4A 4GVHA 4DQQA 2DSUA 3BYRA 3GV7B 3GWCA 3HM9A 4LSNB 3PIOQ 1KCKA 2A3BA 1TKKA 5J2PB 3DM2A 1W5PA 1RAIB 2DZTA 2WVBA 3TYBA 5LOQA 3IGVA 3ELHA 4KO0B 1O6XA 4DI8A 1Y5LB 3OIHA 2DNOA 3H2VE 3TYTA 3RXZA 3X1LB 3QOMA 7FD1A 1L3SA 2QDDA 4PEOA 1VQSA 1EPVA 3KBSA 1N8FA 3VILA 2FFIA 2RU3A 2ERRA 3P6YC 5D0HA 3HO8A 3I68A 3VCCA 4QAWA 4QJ3B 2H90A 2NQLA 2DHXA 3VKAA 2ZUUA 2VENA 2M8HA 4GZIA 4ZS6A 4FNUA 1LBMA 3TJXA 1Q8IA 3TV8A 1ZP4A 4M8UA 3W9JA 4NOHA 5LXRA 3DRXA 5HJYA 5I24A 3SI9A 4PRFA 2R7XA 3T5JA 4L74A 3BSMA 2VZUA 1XIQA 4F8XA 1ZL1A 2PEBA 2FJEB 3OFGA 4Y6GA 3PVXA 5EFFA 1Q79A 1EGZA 2JIWA 5J2QA 5MKGA 4Z1YA 2X2GA 1IBKF 1WI8A 3N79A 2YNFB 2NXNA 5LJ3Y 1XPGA 3M0HA 4HOZA 4PPZA 1RPXA 4QEHA 3ISNC 1N2VA 1J2WA 5DZ7A 4F7VA 2GSEA 1NB2A 1KRAC 3TXZA 2NLYA 5DMLA 2YXLA 3RIKA 4UTUA 5E6YA 4UTWA 4RUBA 4QBXA 5CC3A 2AJ2A 1SW0A 2QA4S 5U47A 4FS2A 5DLFA 1SC1B 4IJBA 3M46A 1X96A 1KC7A 4O0ZA 1K9TA 4RNJA 2C71A 3UYIA 1MVYA 1HQ2A 3LP2A 1FH7A 1Y0EA 3GHTA 4MZYA 5AHFA 4FF2A 2BY2A 4LBIA 2ZRUA 4L6HA 1YJUA 4AX7A 2XI2A 1EXPA 1EP4A 2FC9A 1D9EA 4L4OA 2ZDPA 3MD1A 2MKCA 3K0JA 2WVSA 2F4FA 1YTDA 1PWMA 4LVGA 1Y7VA 4ZVHA 4CD7A 2ZEJA 1L3TA 2CZDA 4KT0C 4DU8A 1WDRA 2X7IA 1LP6A 3AYVA 4EE9A 4HA0A 4RNFA 2WLYA 1VQYA 4PMJA 1EYEA 4HNLA 5HMZA 5FJUA 1MMFA 2J6UA 1LFWA 3LENA 3C8YA 4UQTA 5C6MA 2OQHA 2ZC3A 1VR6A 2W9CB 2G2ZA 4CQDA 4ADSA 3A21A 2MHNA 5C5YA 3DLHA 4A2RA 1UZDA 1E6VB 2DVIA 1ZZMA 2ISDA 2RQMA 3QAUA 3ABQA 3UZJA 2V8PA 3L0KA 3P7YA 1ZTTA 3CMQA 3ABXA 4KH0B 2BE2B 4HZ7A 4KKOA 2MKYA 3BGRB 3PTQA 1A5NC 1S57A 2RHQB 1FP8A 1VCGA 3EWZA 4E98A 3PHEA 5D4NA 4E2FB 4B08A 2O9TA 3L65A 2XSJB 4TYBA 4GINA 4EBEA 2VJXA 4KEZA 3DFNA 4J40A 1FQ0A 3LG3A 4OZ0A 1N32F 1U1LA 5G1MA 1U1RA 3CPGA 3OL9A 4U28A 1FCAA 4CU6A 1V3HA 1LQ0A 2E5JA 5D78A 1EC8A 3NKYA 4K4ZA 3SGZA 4I6VA 5DLCA 2IHR1 1NKCA 3SYZA 1OJXA 3EDKA 4OV9A 4PQAA 2E66A 3OW1A 1HNIB 4IP4A 3ICLA 3FSYA 4YHHJ 1VBUA 3FVYA 1MW3A 4NILA 2W2PP 1EYWA 3S9ZA 1HBMB 5CBJA 3BZQA 3RW6A 2XSXA 4O53A 3NSMA 4RWWA 1P7TA 2HHHF 3IR7B 2C19A 1REQA 3OGVA 1JLBA 3QJJA 1FA0A 2HGNA 1SW3A 2D0FA 4NAEA 2BOEX 2KL8A 2NPFA 2QA2A 2NLIA 4C91A 1IBMF 3VAVA 3NL5A 2CPHA 2KG0A 3ERPA 4V15A 1WELA 1XUZA 4C7QA 4ROQA 2FVCA 4FX7A 4MMOA 3H2OA 4HCDA 5IM0A 5KG5A 5CPQA 3W88A 5GADI 1DIEA 2F84A 1QUMA 4GKJF 3CEDA 5LIUX 2G2YA 2L08A 1ITPA 1TUGB 2HLTA 2DQWA 1FCUA 3UZ5A 2G3JA 3KLIA 4I68A 4LSLB 3BLDA 1SO6A 3D28A 1S12A 4L3KA 2GA7A 4L9YA 2ZBPA 3LAMA 1WG4A 4EX4A 1G1YA 2VX5A 2YDQA 2R7TA 3WLMA 4G5DA 3WMCA 1QTWA 3Q58A 2DY9A 1WNOA 1OSDA 2A2CA 2PRHA 3RBDA 5FJJA 2V4QA 1FCVA 4PBEA 3UWEA 4CWBA 2B7QA 1RP5A 2ZRZA 1JD7A 5IFMA 3K2GA 2R14A 1ZPTA 1JAKA 3AHPA 1I60A 4OHYA 2BW2A 4MH8A 1H7RA 2P9CA 3SCQA 4DU7A 2IKIA 2RIJA 1TMLA 2P6TA 3TCSA 3GU0A 3F4CA 3FMBA 5AC6A 3KUGA 2B56A 3L7UA 2QF7A 3DERA 1XXXA 2ZX9A 3N4FA 3TYDA 3VNIA 2CQBA 2K2PA 4XKYA 5K14A 3BF4A 3ZTSA 1Q8KA 2W91A 2I17A 3OYZA 1PX8A 4Z08A 3V18A 4XVDA 2K1RB 4AAJA 4RK8A 3DG6A 3HVAA 1X4AA 5KFTA 1X5OA 2KKHA 4ZVRB 5XIAA 2W7AA 3GR0A 1AFSA 4ZKAA 5K8PA 2NQHA 3CASA 1W9PA 5C8BB 1A9NB 1GGOA 1TL1A 3KOYA 2J75A 3UERA 1S6PB 3CZEA 1SJCA 1RAJA 1RI7A 3TXVA 3CAQA 1SV5B 1EOKA 3NQ2A 5HO4A 3P5BP 1Z32X 2NUXA 3DX5A 2LEPA 1LDCA 1REVB 3O06A 2H9AA 4TQSA 4WX2A 1UVMA 4RPQA 4YB1P 1WUEA 4KFPA 1PYTA 5EMUA 2YX1A 1TK8A 3H4WA 2XCAA 3VIMA 4AZ5A 1MMDA 2H3BA 1YWXA 2E6YA 1JNEA 4MWAE 4K7VA 4AY7A 1XWYA 1S4FA 1C1CA 2BY3A 4IIGA 5CQGA 3JTNA 3MAAA 4FNPA 3GFYA 4IPLA 4FIRA 2Y7EA 3B0UX 1W56A 4DAFA 3IEBA 3PSWA 4LT9A 3EOSA 4QU7A 2HZVA 3H53A 1HYSA 2WM0A 1M1KT 2GVJA 4MUZA 1FWBC 3LPFA 2BXZA 1LRTA 4YR3A 5B09A 4FYXB 2BKNA 4I6WA 3A22A 1FWRA 2GUUA 3WYZA 3TAQA 4ZBCA 4JUZA 2IA0A 4K2JA 3M8QB 1YIJS 1CGYA 5I7GA 1DWIM 4KETA 4YIWA 1E1EA 1FRBA 2GJFA 3BR8A 3FDSA 3UYCA 2FQIA 5T7LA 4X63A 1OY0A 3NLCA 5L6UA 3STPA 1VLOA 1FEHA 3OZPA 1YTYA 1RP8A 2J6TA 2CZFA 3OGSA 1GVQA 2EHHA 3LQVA 1JXLA 4B3TJ 3DRSA 3EICA 3R6LB 5TF0A 2A85A 2ZDRA 1M04A 3DU5A 3I96A 1BC6A 2XMTA 1HW9A 3KHHA 2OSRA 4H8HA 4RNHA 5KTLA 2FTRA 2GGPA 1BD6A 3KBNA 2CBIA 1LTDA 3J7ZT 1UPMB 2G13A 2OIHA 2G3FA 4QE5A 3GXFA 3HJZA 3W82A 3GTYX 2A7RA 2NR0A 3Q94A 5LNRA 1FF2A 2ZHAA 4AYSA 1Y7PA 4GLEA 4ZE5A 3CCUS 2HNEA 1IR0A 1J12A 2I2YA 2QT7A 1FE0A 4F4AA 3ANVA 3G96A 1UR1A 4XD4A 1UL3A 1WTFA 3K1DA 1H62A 3WBZA 1NSPA 5KITA 1B0VA 4J9QA 3MPWA 4O10A 2HSAA 4ECZA 4KPCA 4CQBA 2B4OA 3PULA 2I9SA 1UD5A 4A8WA 3PJ9A 2ZDSA 4KFOA 3AHYA 3VUPA 3A4TA 3F44A 3OVBA 4K4YA 2DEIA 2MANA 4K59A 3K1GA 3BB5A 3N4EA 3TA2A 3LU2A 3UPWA 4IX0A 3VMNA 1ME8A 4JX5A 4CO4A 2D0GA 3TR9A 5FL0A 5A69A 4W84A 1Q82T 3VZHA 4U4MA 4DR6F 3LM3A 1KFJA 3T40A 2ZUVA 2YXOA 5FJ4A 3W2MA 3HBLA 1WYIA 4QNEA 3W7IA 2DHAA 4UZCA 2J0QD 1BQGA 2DSZA 4MY1A 3CO4A 3BN4A 1H63A 2MZJA 5IZHA 2V3FA 2CLEA 1V3KA 1FH9A 4BEQA 2G8ZA 3KXQA 2KZMA 2XMMA 3D6HB 5KG3A 5F3TA 1P9QC 5CZJA 1A4LA 4DUWA 3BM7A 5HNUA 1EF3A 4QDWA 1CB2A 3ZNUA 1TFWA 4GI4A 2WRMA 1X5TA 4KEUA 3W2JA 3NO3A 4Z1CA 1IKVB 1H7WA 3PZTA 1UH3A 3Q89A 2UY2A 3KVJA 1RR2A 3A3HA 4N56A 2BLEA 1L6GA 2AGKA 2PLJA 1ODUA 2UXDJ 1JULA 2E67A 4HKPA 1J11A 2VOOA 4Z2KA 2PWHA 2HFOA 1M5SA 2IC3A 3FX4A 2DT9A 3M2RB 4NZJA 1EWEA 3B4UA 1F2JA 3DOKA 3W2UA 2WHLA 3SCOA 3VZYA 4DZ5A 3MEDB 2R3VA 4PSPA 3VMOA 2V67A 4LFAF 4LF7J 3AC0A 2NX9A 2WJFA 4X64F 3SQGB 4X4RA 2QUUA 1EJRC 1TRIA 2P50A 2IKJA 4WP8A 4FLQA 1KV8A 3R12A 2HQAA 5FCZA 1BYAA 3GONA 2GWGA 2V30A 4DNMA 3DLKA 1QI5A 3WQEA 1S3TC 4ED6A 1JLQB 2P8CA 1F0XA 3FEXB 2PZNA 1KGWA 3AO0A 2JGQA 2P6SA 2UVUA 1VYPX 2LQ9A 4ACZB 2ANUA 1UYQA 3GJTB 3GKFA 5A6AA 4DSEA 3US5A 3SV3A 4ZLNA 3LBCA 1HTIA 2H4WB 3GM8A 3TSDA 2AU0A 3MURP 2PMZD 3ZJ7A 1UR9A 4CEUC 4PWWA 1Y5IB 2AEFA 1RB0A 4X66J 1JF6A 5FDLA 2HNZB 2DNHA 2FPYA 2J76E 2R2UA 3HURA 4AL7A 4WU2A 3GDMA 3GNDA 3OSPA 4NXNF 2XIQA 4V33A 5A2QU 3MSGA 4IXHA 4ETXA 4B5WA 2FYMA 1VRXA 3POHA 1ZYQA 5BYWA 3TUJC 2Y8WA 1TFVA 1ISXA 1J8VA 4WP3A 3UN5A 4IGSA 2RRBA 2RB7A 3QOKA 5FF0A 1X4BA 5SZTA 3RYLA 3IJIA 2V5CA 4YWIA 5KFLA 2EEXA 3PF3A 4IGHA 1TIWA 4JFWA 5CD4A 1VQPS 4JEQA 4TIMA 2AEMA 1K8AT 3OG2A 2W3ZA 1QSSA 1WJ9A 3B9AA 3GVWA 1UD3A 5KT2A 2ZHBA 6A3HA 1XYBA 2DH2A 5L9NA 2PDLA 5KFZA 2Y1RI 3O9NA 4DCOB 4L80A 3LQGA 2PD1A 2FC8A 3KBMA 3FEZA 5EMMA 1OJ4A 2E5LF 2DVXA 1IT7A 5ETSA 1JZ6A 1WI6A 3TU9A 3PK7A 2DZUA 4P8XA 3SUSA 2LCWA 1IE7C 1AW5A 3F5KA 2J7WA 3RMEA 2UUCJ 3BZJA 2E3ZA 3PFMA 3W70A 2JLGA 4U7UD 3E0FA 3PUGA 1D09B 4XDCA 3IBWA 4W7UA 2Z7GA 4LVBA 3OPSA 3DAQA 4JOMA 1FDZA 2ACSA 2B7PA 1H3GA 1CJTA 3LPYA 3HHDA 2OZ0A 5EHHA 3EWBX 1U45A 4WYWA 2F4VJ 2Z24A 4DHVA 1HL2A 4CM2A 3RG6A 2Q8ZA 3TAKA 2OFGX 3EX1A 4BDPA 3SAZA 1WC1A 2Q66A 3L4BC 2MB0B 3UJFA 4LGXA 3SUTA 4EXAA 2ASLA 3PBYA 4DNHA 1G7UA 2G3NA 2WBKA 1BYBA 1EHNA 2VXNA 3BH6B 1DIOA 7PTDA 4TLRA 1TWWA 4FOUA 4X4QA 1X8DA 3E5BA 3CU2A 3MUIA 1FEEA 4C1NB 5GPRA 1TL3B 3SSQA 4LQ1A 4KSEB 2OWXA 3CHEA 1SMAA 3W5XA 1EUAA 3OVPA 3TROA 1DTQA 2RRNA 1H0GA 2JIEA 2VHLA 3S5OA 4O4RA 1DHPA 4ECVA 3JXOA 4TTUA 2VZ9A 1GZGA 4Q4KA 2YNHB 3KEHA 4B4HA 2QIIA 4GIYA 2VQFJ 3TX0A 4GJJA 2EPLX 1FRJA 3WIVA 3SIPB 1JCLA 4A6GA 3L7PA 3W86A 3R27A 3Q8PB 2DEPA 3QMQA 1G7VA 1W3TA 4LRAA 3WQ4A 1LM1A 3UGRA 2XB2D 3L4VA 2GWNA 3MBFA 1JGMA 5KFDA 3UXKA 1KBIA 2ZUSA 3PZVA 4DR4F 1BWLA 4LVNP 2HVEA 4PYDA 1ESWA 3HJEA 3P74A 1LFPA 3BC9A 2H6RA 2R7OA 2FLPA 4FF7A 1AQHA 1V9OA 3HQNA 5ETQA 1UIOA 5DO8A 5CG0A 3RJMB 3TA1A 4US5A 2JFEX 1FWFC 1HIZA 4HDGA 2C3ZA 3ZT7A 1F3XA 2R42A 2W92A 3TFCA 3SRDA 1SJ1A 2PDBA 1DWFM 7ODCA 2MZTA 3RITA 2RILA 4PEKA 2LXFA 3UNTA 3H2LA 1VHFA 2WZMA 4Q8OA 1M9HA 1ZALA 3GUGA 2PP1A 3T0TA 4YLWA 1TV7A 2E1RA 4XISA 4XV0A 2QCLA 3CD5A 5B0GA 4Q8EA 3WLRA 2B4GA 2K7JA 3G9CA 4IOCQ 3NYZA 2E1AA 3P6LA 1VQ4S 1AJ2A 4BEUA 4AB4A 3EA3A 2QUTA 3I56S 2VMFA 5GVJA 2ZWYA 2Z25A 1UWTA 2X16A 5A94A 3T44A 2GVYA 4O19A 2MGZB 3ISIX 3IA0A 5AY7A 3U6WA 3KTQA 3S6OA 2Y5EA 3C2FA 4JNMA 4AUBA 4S3CA 1D8ZA 1ZENA 1G4CA 3NUKA 3KHDA 2XNRA 3E3HA 4MY9A 3ICJA 4GUGA 3MW7A 4HYRA 3USZA 3ARSA 2FH8A 4REQB 1FVPA 2HFUA 1IEVA 4XAPA 1MW1A 2BKPA 1VZWA 4GNJA 4P73A 1TYGA 1EQCA 4NYOA 1LOLA 2YKNA 2WSEC 2GGJA 4PCPA 1X7VA 2DR9A 4ZQOA 2KZZA 4HPGA 3TQ1A 5ENLA 4LR9A 2Y8YA 3CVKA 2FKPA 4F4WA 2YSWA 1F8MA 2D1CA 2W4DA 4C8YA 1CXIA 1IZKA 2G50A 3EWYA 4W88A 4IQMA 2NXJA 1FKWA 3EZUA 1NTHA 2X1IA 3OR1A 3TJAA 2GFTA 3RRHA 4QQUA 2BZ2A 4O17A 3UA3A 2VQEJ 3GD6A 1OF8A 4GABA 5L1KA 4E3VA 4S3FA 5EN1A 1IKWA 4TQRA 3TYCA 2HBQB 2NZLA 1HNVB 2HNHA 2MNRA 4A48A 4FALA 4AXKA 4G3IA 4S3EA 2QCDA 1S38A 1U8SA 2XHCA 3T0DA 1XRVA 2VO5A 1F5AA 2KJWA 3U27A 2AWZA 2PTDA 4L4PA 1ZHAA 3GKAA 1MUMA 3S5YA 3TANA 1LV5A 4RX0A 3R5GA 5JH2A 1RA5A 4N7QA 4C8NA 2J7DA 1RJJA 3CF5Q 1FRXA 2WZHA 5D8ZA 1QWGA 2XTKA 2BJDA 1YDNA 3SSRA 3TOQA 2M5YA 4M5GA 1OO0B 2PI4A 1MLAA 4OJ3A 1XK8A 1O4UA 3N6QA 2VASA 2OPPB 1WAWA 1UC5A 4OKDA 1HKIA 4YUDA 2ZJQQ 4HMDA 3WLIA 4P9SA 1SVDA 3QO9A 4W9TA 3WCZA 2F7FA 2Z00A 4DF0A 1XD0A 4JKLA 1ZBVA 3SURA 1XH2A 1BXCA 4FO4A 3PKMA 5PTDA 1WKYA 4B5SA 3W0KA 2LQ5A 2GHWA 1JCNA 2P1FA 1U0SA 3SUUA 2X09A 3S42A 4DELA 4HT7A 5IWAF 1F5BA 2BJEA 2HBVA 2L9WA 2ZRVA 4WBFA 4R0EA 2PD5A 1PJ5A 2WW5A 3BV7A 4NLRA 4DPQA 4IR1A 3MD3A 4WKFA 4CNSA 5J1EA 3AD9C 2WKGA 2R7WA 2Y7GA 3APGA 2EJAA 3WKZA 2V9WA 4GIEA 1CSJA 5K5MA 3NWGA 1NAQA 2HZAA 3S1TA 5CSUA 2DD8S 2ZWPA 4GNVA 1RHQB 1U8WA 3SSJA 3SEOA 1S0OA 3N9RA 4IL2A 2YKKA 2VDGA 3ZTOA 4J2MA 3WBYA 4GQBA 4H9XA 3VDGA 1VCTA 3UR0A 2HFSA 1R0MA 3DLBA 2FMOA 2Z27A 2D73A 1V3JA 5BOOA 2DZSA 2ZZ2A 3PBUA 2MKKA 1RBOB 3HG3A 2P2CB 4ECWA 2K7KA 3NMAA 3LGMA 2B0GA 4M5DA 5E93A 4ED8A 3RU0A 3KTSA 4CLMA 2VRJA 3G6YA 4TVCA 4U96A 5D03A 4Y00A 4RW3A 2OYMA 1E1FA 2OPSB 2QZRA 4L75A 3M5ZA 1RSCA 3A5VA 4RL3A 1D0EA 1GH8A 2WMIA 3TQKA 1FD2A 2XBPA 2E1MC 1J9YA 3W5YA 2C3YA 5ETNA 3HV9A 1MN9A 4NJJA 2Y8UA 2C3UA 1XR2A 5F7UA 3GFXA 1Z4UA 1OK6A 3DGPA 3RHGA 4WQ6A 4PUUA 3QM3A 5CZVA 5DM6Q 4RZRA 4WOQA 3ZR6A 3C86A 1R3VA 5D0RA 2JQXA 2E5IA 1FWIC 3IG1B 3NZPA 2DKOB 2I5JA 1W1TA 3WD1A 2LMIA 2AGQA 4ZITA 1FHLA 2JL9A 4MAZA 2YL8A 3FHAA 3UO0A 2MZSA 4TX8A 4O3NA 1MXSA 1IEQA 2A21A 3J81Y 4PCQA 1R3WA 2I5IA 4PH6A 2ZRXA 2WVEA 1HXJA 3M0XA 2R7QA 2WKJA 3IWNC 3EX3A 1LQ2A 1UETA 2WVDA 1AH3A 3PPCA 4RPPA 5BXPA 3M8ZA 3AWNA 3A3PB 4AZCB 3PBWA 5HBMB 2Y24A 4R9OA 2DNKA 1PZ1A 1UJQA 5AHEA 2CIMA 2DGOA 1AK5A 5BMWA 2EXUA 1PBGA 5KG2A 2NREA 3S6TA 3EGNA 2HPIA 4ILMA 4MGGA 3KVLA 1CBGA 2HWIA 4RDWA 3RF9A 3GW0A 2HURA 4HHMA 3P61A 3PZPA 4FS9A 1KTCA 1Z8AA 4XX6A 3QGPA 1DTNA 3IAQA 3VNLA 1LW2A 1L8NA 2Z56B 1WTBA 1VQLS 4K4SA 2QTWA 2BVZA 4WFBQ 2CZ5A 5F0UA 4GHRA 3H2FA 4EKJA 3MOZA 1TKZA 3U7JA 3RGTA 3DHFA 1ZJHA 3NXLA 3GYEA 1SZGA 3AZSA 4WJXA 4WD0A 2BVWA 4J3XA 1A3XA 5CABA 1XMOF 5ABEA 4C0HA 5M2UA 1NSKL 3CAWA 3GX9A 2AJFE 5DQPA 3P60A 1WHVA 3PRBA 2CJKA 3A3WA 4OYAA 5L9FA 9XIMA 4M1BA 3OJGA 3CZLA 3FMWA 3VGVA 1J27A 1HQEA 3FQLA 3DLEA 3QATA 1XBVA 1WDTA 1YVFA 3W2WA 2HVZA 4PR6A 3O6QA 3FNDA 4K8EA 4TN2A 3VVGA 4BHYA 4A8LA 3KLGA 3HFZB 4JI7J 2PTZA 3QQWA 1EETA 2Z58B 1BRLA 2E1CA 1C90A 4LFBJ 1M68A 1V0LA 3PFOA 3T9PA 4AEFA 2MYFA 2YKMA 2DH7A 3T19A 2D74B 1KLZA 2P9GA 3RCYA 4K8RA 4CLZA 3KL3A 1HHQA 4V1Ak 3DKDA 3BJSA 3E5PA 4NAFA 2V5BA 1TB3A 1VK8A 1H41A 2AL2B 2EFGA 3CXCR 3CL6A 4FYYB 3UCCA 2EVZA 4LMZA 1LUCB 2ZKMX 3NR0A 4A3UA 3MR2A 4UCGA 3P0WA 1QMLA 4GMEA 4GQQA 2JFDA 3S46A 4ZJOA 1DTTA 1JVNA 4I2PA 1K0VA 2E68A 3ES8A 3BQ6A 4ETZA 1RALA 2UVWA 4LUTA 3MMCA 2H5EA 1GHRA 3CMJA 3AU6A 1DJYA 1PTAA 3PZIA 4MKVA 3L7OA 2VWTA 2RU9A 1YBUA 4JIIX 2J62A 3FJ4A 1W54A 3CB3A 2VNCA 3BG9A 4ALZA 3GC4A 3CUGA 4ZTYA 3DHUA 1G0CA 2FH6A 2C22A 3POTA 1MU2A 1R8LA 1NEYA 1ISZA 4NSBA 3NOGA 4KWVA 2YWWA 1E3ZA 3B0PA 2W01A 5IT0A 3GQYA 1DV7A 5IV4A 3LA4A 4PRTA 1WHYA 1XSKA 2LFVA 1GMWA 1RU1A 1HL9A 1UWBB 4E8DA 2PWDA 3VAIA 4FNQA 1LWCA 2LEAA 4XAGA 2LVWA 4WTOB 4UTFA 3M2VA 4OQJA 5BCAA 3E2QA 4I2QA 4O0NA 4OJHA 1JDAA 4QE4A 1JUEA 1GNXA 1UC4A 4QQ3A 3TFXA 1E9ZB 3EB2A 2Z1KA 3QSRA 3WNMA 3ITOA 2FHBA 4ML9A 5IQQA 4S1FA 1HKVA 4K4WA 2XGQA 1XNQJ 2APOA 4JI6F 1QOQA 2IDEA 1VFUA 3C6UB 3FXGA 1U33A 2ZUNA 3JSRA 4ED1A 4LCRA 1VQNS 1KFDA 1F9FA 2ZX7A 1GMWD 1T9TA 3ET6A 2CQ4A 2EPIA 1SFSA 2XJ7A 1JNDA 2KAUC 2ZH5A 2J9CA 2VFHA 3DOKB 2ZYFA 4DIAA 4JS3A 5JU6A 3HQOA 1J0JA 3OODA 3UWYA 3R1ZA 5CYQA 4R25A 3ZMRA 3HVTB 4D6EA 2DO4A 3HU7A 4JI3J 2E9LA 3HI9A 2JZ5A 1I0BA 5A8NA 3CPRA 1FWWA 3N2XA 3RB3A 2O7SA 5HVFA 3JZEA 1KBLA 3ZR4A 3OR2A 4Q7AA 4F3QA 5CYMA 3RX3A 1FFWB 1ZM3A 4FF1A 3RAXA 5KT5A 5BZAA 4DV4J 4AFYA 2I5QA 3WQCA 1H2UX 4F02A 2AQVA 5IV3A 4L73A 2WSYA 2JGYA 4Q8QA 1LOSA 2CLIA 3G3DA 3KX6A 2HEKA 3E3XA 3AJ7A 2B0MA 1ODZA 2VC9A 4J3SA 2NV2A 3I4KA 5CH7B 1FHUA 3WNKA 2IXVA 4OX9J 1VYRA 2ZCGA 3EWXA 5HINA 3RB4A 4IG0B 3K5XA 5C70A 2RH3A 1SO5A 2PDGA 1MROB 3HD2A 3N17A 4Q4SA 1TMQA 2MUCA 3CJ5A 1R8PA 2Z1SA 4FYVB 4CLYA 1A5KC 2EG2A 2F5GA 3G4SS 1N48A 3JZUA 3BW3A 4L61A 4H7CA 2X05A 5D04C 4ORMA 4H7VA 3UPBA 4ASTA 1B0TA 2MLXA 3F2BA 5HOSA 4ZCLA 3AS0A 4YTQA 2EFNA 5A6BA 5DQHA 4S3GA 2VX6A 3KYLA 4PFMA 1NPKA 4EUVA 3KE0A 4P61A 2PCQA 3WJYA 4MFBB 3QZAA 3WENA 3TUPA 1DQ8A 1TE6A 4GRSA 1WG1A 3IGNA 3J7HA 2MQQA 1DBDA 2VURA 3B3DA 2Z2UA 4D6CA 1FXQA 3N73A 2HYIB 3CW2C 1FO1A 3UVAA 1SJ4P 2E5DA 4PUNA 4L6DA 4DOZA 4DLFA 1WDSA 4UMBA 4NE9C 5A2BA 3OPKA 4HCHA 4I7FA 1K7FA 2PDYA 4PC8A 2DVTA 2FZGB 5IT9U 4OIFA 2YGYA 4BR1A 1CZ1A 3OLEA 4U6PA 3TN4A 1FK9A 4RW8A 3IO1A 5JMUA 4O4GA 1B0PA 2CCRA 1KW1A 1VAHA 5ECVA 3PZMA 3BSHA 1ELSA 8XIAA 3KJQB 1FJ7A 1A3WA 3BG3A 5J1NA 4TU1A 3VIKA 3NGKA 4UMAA 3NURA 2G41A 1C9DA 2Y62A 1CVJA 3NG3A 2AV5A 1VJWA 3BGOP 1Z9AA 1HX0A 3S2CA 1DHKA 1WKJA 4F0MA 4UIOA 1AL7A 4FXJA 4ZVFA 1SL0A 1FFRA 5LMNJ 2AKMA 3S2LA 2GJRA 2OGUA 2R7RA 3CJKB 4JN7A 4C6NA 1EJ7L 3KL5A 4ID8A 3CQHA 3NWRA 1TMMA 1X98A 1UAWA 4LNYA 4USVA 1XRSA 4E5TA 5CAAA 1GEHA 3IVTA 1E40A 5L1IA 2OP5A 2VUGA 1SGJA 1LROA 1JI1A 1FDJA 3IS9A 2NWSA 5J5RA 3EA1A 2E1WA 2FIQA 3LPPA 4MJ4A 3SCUA 3ZSTA 4QR0A 2VVNA 3OL6A 2X0YA 3WLNA 2YY3A 1DYSA 1DQAA 1C8XA 4FOKA 4XUGA 1VIOA 2ZZ7A 4O4VA 1CC7A 1GZ1A 2R24A 1RAFB 4M5JA 5HPCA 3D9BA 4LEQA 5I42A 2NV1A 5D4YA 1LWFA 5DBUA 2YCKX 1IQZA 3MM6A 3RTVA 1LWHA 4ZGYA 3D66A 3UCQA 2R8WA 3SV4A 3H4XA 3AXIA 2GJ2A 5C7PA 2VZVA 2IUZA 2JC1A 2YL6A 1H38A 2BJ3A 3A8JA 1XW8A 4GUIA 3DU0A 4FK9A 3STFA 3BTNA 3N14A 3LTSA 3M0VA 2OMLA 3H12A 4IMEA 1XIGA 2A6LA 1VBXA 2G0CA 4KGJA 2PB1A 3UD5A 3RN6A 3H4DA 3TR5A 1S5MA 3GP9A 1JQGA 2MY8A 4L7ZA 1IBLJ 1R6YA 3LP0A 5CZXA 3VOGA 3VDAA 4AVNA 4ZFCA 9ATCB 3GB0A 2HK2A 1S46A 2F8QA 5E33A 1X4FA 2B9YA 5M1TA 1GX6A 1F1BB 4NZ3A 1PILA 3CJRA 2RKIB 1SQGA 3MZ2A 1XSIA 3DXIA 1PKUA 1XEZA 2DGSA 1XCXA 1JKHA 1Y9OA 3H22A 1TWZA 3RRGA 4WKAA 1GT8A 2YW3A 2YKQA 4U9RA 4GY1A 3G8TA 4QISA 3D3FA 3RJXA 4Z2JA 3FCPA 5FACA 2YXXA 3H42A 3MCOA 4B92A 3O6AA 2CKWA 2PRMA 4ZP6A 1NCLA 2QLFB 3F41A 1XLLA 2PC8A 4ELVA 5XINA 3D3BJ 3W2LA 4UY85 3LHZA 1RGVA 3PR4A 4MJZA 1KM1A 2RKXA 2TPSA 3CUIA 5B0CA 2A2DA 1J5EJ 4UT4A 2NXIA 3WQ8A 1YQHA 4FP1A 3D1HA 3BAKA 2RGMA 1ITUA 1DEDA 1RKIA 4S3BA 3ILJA 3R94A 4WZMA 1H73A 2WANA 4AL6A 1PYSB 2NQPA 1IHIA 3S6DA 1RH9A 1V08A 1HWIA 1D7KA 1XIDA 1TTHB 3LS9A 1T8QA 4FX8A 1O5XA 1O68A 3NCPA 5CZ0A 4TOQA 3W1QA 3W7HA 4DYEA 2V5HG 3GSIA 1YYAA 1CGUA 3H70A 1VJZA 5FEWA 1AVAA 1C0TB 5K9XA 5D0GA 3BMWA 1QAYA 1E6XM 5B0DA 1RDRA 3TZZA 1MXGA 3M47A 2XH0A 4MPQA 5E1QA 2AYEA 1YBQB 4DLMA 4C60A 1MO0A 3O6CA 2WC4A 2M2BA 3ZTRA 3URAA 4GVGA 3DRPB 4YQWA 1LOQA 1HFEL 4NLWA 1TKXA 4GI6A 2VODA 2KM8C 1MI3A 4XQ6A 4DZ6A 5CKSA 1J93A 1R31A 5BR8J 1NDZA 3DU6A 5DY2A 1HFBA 2XN0A 3OFHA 2WVFA 4CD4A 1QVFR 4RBUA 4XIAA 2CEQA 1HO1A 1TTIA 2VCCA 5HLFB 3OW2R 5IHSA 3NPWA 4H54A 3KZSA 3THUA 1KTQA 2VGFA 3P96A 3GIPA 5D15A 3S2MA 2AGTA 2B9EA 2H3EB 3WQWA 2DNGA 1FWLA 3WX4A 5M2FX 4FKYA 5F2LA 3I7SA 5J1EB 1XS2A 2HS4A 5CAHA 2POZA 2DIJA 5LHEA 2R4FA 4LS2A 1S1VA 2E9TA 1RAOA 4I8YA 3OXFA 2XEXA 3N2OA 2FHOB 4KBIA 2E77A 4MWAB 3SW6A 1T41A 2QZ8A 3UPFA 1TSIA 5DGAA 4MM1A 3CIMA 1S97A 1L6WA 4JTUA 3NL2A 1E4MM 5D4OA 3ZZTA 4KCVA 4NCGB 5DELA 3BQ2A 1SFLA 4LF5J 4ML4A 3U5YA 3MYPA 1N8RT 3U1MA 2OZ8A 3BGLA 3TWZA 1J0HA 3GVQA 1V3RA 3TN5A 3MKKA 4OI0A 4PUMA 3VKCA 4UZUA 1PHQA 1X4GA 3U7VA 1P6BA 2E1DA 4P8VA 4ATNA 1EH9A 4G2DA 3W64A 4DV5J 3NO5A 2KVIA 3GU9A 2B4UA 2LXIA 1HJXA 4P5UA 4XPCA 3SB0A 4AG0A 3R8RA 3PPHA 4YHHF 3ARPA 3OHAA 2HNDB 2OT0A 3CHFA 2FZMA 3VIJA 1KM6A 2DGTA 2TAAA 3EEZA 3IS4A 4UFMA 5KG0A 1X0FA 3BV8A 2XO6A 3T7VA 3K58A 4HP5A 1RT4B 4Q7NA 2WC7A 1FE4A 4UR8A 3CM4A 4KGLA 1SKRA 1B9BA 3WDRA 3C0JA 2JRSA 4HEA9 4RUAA 3OHIA 2C14A 2J9EA 5I00A 3CUNA 3HSGA 3BOLA 2A6MA 3DIPA 4H8VA 1MN7A 1REGX 3L5MA 3URQA