3WQPA

Crystal structure of rubisco t289d mutant from thermococcus kodakarensis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFDRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation design of thermophilic Rubisco based on the three-dimensional structure enhances its activity at ambient temperature
rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 149
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3wqpA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3wqpA01
1RBOB 1RXOB 1WDDA 2QYGA 2OEKA 1GEHA 4LF1A 1RBAA 1UPPA 1IWAA 3KDNA 3KDOA 4RUBA 3WQPA 5C2GA 5HJXA 1UZDA 2CWXA 2VDHA 1RSCA 1BWVA 2VDIA 2V69A 3A13A 4LF2A 3ZXWA 2V67A 3A12A 8RUCA 1RBLA 1AA1B 1UW9A 2V63A 3FK4A 2V68A 1YKWA 2OELA 2D69A 4MKVA 1EJ7L 3RUBL 1TELA 2RUSA 5HAOA 1IR1A 4NASA 1IR2A 1UWAA 5HATA 9RUBA 4F0HA 3AXKA 1SVDA 5HJYA 4F0MA 5RUBA 3QFWA 1UPMB 5HQMA 1RLDA 5HQLA 1AUSL 1GK8A 2OEJA 2OEMA 2V6AA 2ZVIA 4HHHA 5HANA 5HK4A 4F0KA 1RLCL 3RG6A 2CXEA 1RCXB 1RCOB 3AXMA 1UZHA 2YBVA 1BXNA 5C2CA 1RUSA 3NWRA
chains in the Genus database with same CATH superfamily
5DO8A 1EHNA 3IIZA 2HNYA 4DI8A 3CCUS 2ZUUA 4WY0A 3OXGA 3BLOA 1RHMB 3TARA 4QEHA 2APOA 3AISA 4MFBB 1TCMA 2X40A 2ZM6F 1RJQA 2EFVA 3SQMA 2EPIA 4BC7A 3AIEA 1F6PA 1RY8A 1DLOB 4L6DA 4Y2AA 3CD7A 5SZTA 1EIXA 3CHEA 3PFOA 2KJVA 2KTQA 5E0FA 3K17A 2Y0FA 1GJPA 1R2RA 1M01A 3WKZA 4OZOA 2J0XA 3OP2A 1W37A 3K8MA 1NU4A 4PAAA 4X4UA 4F2SA 1SC4B 1GGOA 3W26A 3W2JA 1UH2A 1UG6A 2I1OA 1E1CB 5IDIA 1RK5A 2WQPA 4A8LA 2F1FA 2ZIDA 4QLKA 2WSKA 4OX7A 1UA3A 4QQ3A 3RYSA 4F0MA 5F8GA 1V5VA 3H2UB 3LW5C 1J0IA 5L8RC 1SJDA 1VS3A 1ADOA 1U45A 5J5DA 3J80U 4XAZA 2H3DA 4S3JA 5M1TA 1I3OB 3T44A 3ZZPA 3CAQA 2GOKA 1AQFA 3CDWA 2J7DA 1EL3A 5BOEA 1R7IA 2X7VA 4A46A 1NFPA 1E4MM 1EPXA 4A3RA 1WPCA 2EPOA 4X0NA 2K7KA 4Y2MA 1IM4A 2PI4A 2BQUA 4D72A 1X1NA 1GG1A 2YY3A 3HMJG 2QUVA 3WHIA 1VPXA 5J1PA 3GPAA 4Q45A 4Z7CA 2UZAA 2CKSA 4JS3A 3C3NA 3ZLHA 1H1NA 5E41A 2FJAB 3SI8A 4ZFMA 2E5DA 1K1SA 4UW2A 4MWAE 1KKRA 4HIBA 3C6UA 2XULA 2QGFB 3J81Y 3MECB 5K2ZA 3UERA 3ULHA 2VWTA 3CK5A 1TVNA 2JEJA 1EA9C 2GDQA 3M8RA 2XTKA 4H01A 2ZBRA 3G8TA 3KUEA 4JIRA 2PDPA 3W07A 6FD1A 1N32J 2Y1IA 3ET6A 3BBCA 4C11B 3E0WA 4K50A 2C1GA 2OI2A 4ERIA 3LHYA 5GNYA 3Q89A 2FJXA 2RRBA 3D66A 4MWAC 2HFOA 3PPHA 2JKEA 2CZ4A 5FJJA 3C0LA 3KTXA 4MY8A 4MJMA 3ERPA 3MFHA 3V5RA 1H2VZ 3JAMY 1HKMA 1SJAA 1XYFA 5K20B 3UW6A 4O1EA 3PM6A 2HYIB 1UC4A 2D1ZA 4FA3A 3N01A 2CQIA 1E6NA 3QHNA 3FYYA 1KP6A 3UR8A 4OX9J 4GFSA 1TKKA 1EQ0A 1R85A 1KR1A 3VIKA 2HK1A 4E3TA 3G5EA 3NDOA 3ELHA 4DM2A 3AH6A 4ZVGA 3ZTQA 4USTA 3ARVA 1Q63A 3VABA 1XR5A 2VFSA 4JI8J 2HAIA 3RBXA 1U22A 3R58A 2ESCA 1CVJA 2Y1LB 4KB7A 3AOAA 2QG9B 2W9AA 4JTUA 2DO0A 3N79A 4RW7A 3OVGA 4B3RJ 5BMWA 4TIMA 4LF6J 3MMCA 3R7SB 1KLZA 4FXRA 5G4EA 3MANA 4ZENA 2VX7A 3RCMA 2K1RB 1RAOA 3CDAA 1JIHA 4C6MA 2RFGA 2DUZA 3TAMA 4I90A 4PB5A 4AG0A 1Q8JA 3QYYA 3IS9A 2O9OA 1WE5A 3PG9A 2ZC1A 3AQUA 3GIMA 5DGBA 5HMXA 3C2PA 4CNUA 2BJ9A 4F4WA 1WF0A 4EBDA 1P6CA 4J9SA 2FZBA 4WP9A 1BEUA 1EO5A 1FRHA 4ZP9A 3D1OA 2OTDA 2CVIA 2JIWA 1F3XA 3TCSA 4WE1B 3PUOA 4BKNA 1PYSB 3VAIA 2LQBA 1UR0A 2DU2A 3T19A 4E38A 2VXNA 3J80Y 3M7WA 4LBIA 4Q43A 3HQOA 1QAXA 3H42A 3I32A 3I4HX 1TMJA 4F8XA 2XYGB 3MP3A 3OQ2A 4F50A 1JLQB 1YDYA 4KCTA 2FC8A 3TTSA 3VAHA 4DSLA 3ONCA 3CJ4A 3FGCA 4ZCIA 4HOXA 2ILZA 1B31A 3V1PA 1UUMA 1V0KA 3VCDA 2A3BA 1A5CA 1LBFA 2MSSA 3G8RA 3KOXA 3U0HA 1PAUB 1R8CA 2DZTA 3GNNA 2NV2A 4LXFA 2F2KA 2LMIA 1N7KA 1HUVA 5FAGA 2H65B 5CKSA 1BQMA 2HHUA 5BXTA 2O7SA 3MP4A 3LX9A 3S83A 5U4NA 4MAZA 4C0HA 2HWHA 1N5YA 5J2MA 4J9VA 3D47A 5B0GA 4GMEA 3C66A 5CSUA 3BOFA 5D32A 2CNNB 1ADSA 3FGCB 2WQDA 2XIIA 5FF4A 3U7VA 4PN2A 4BI6A 4PXDA 2O56A 1Q86T 2X2YA 3E0FA 4DO7A 1XCWA 1ZS2A 1E70M 1XYAA 5AYBA 2FHBA 3GJQB 4AB4A 4KV8A 5I5RA 1H51A 2UY3A 1NPKA 4ZE4A 2H3BA 3KLHB 1VBUA 4S3KA 3SQSA 5J1EB 2IDEA 2HPIA 2MEWA 2BUNA 4DIAA 2XMAA 3MJMA 3QW4B 1R9XA 2NV1A 1HJWA 3AZRA 5D2XA 3LV5A 2TRSA 1RALA 3A47A 3NL2A 2IC3B 3V6KA 1OYEA 1R43A 1HI1A 1NDCA 3MSGA 3KVLA 3R79A 4LSNB 2ZOGA 1XIIA 2WSQA 1UP3A 4GKKF 3M1VB 3PWIA 4QDPA 1YTDA 2NT0A 3CD5A 3R9LA 3EMCA 3O3RA 3MM9A 2G41A 1VZWA 5E93A 1RA5A 2QVHA 2W4XA 5T7LA 1Q5MA 3J7AN 3KL5A 3FSUA 1RT3B 2GMLA 3QT7A 3B4UA 1FWRA 3SM0A 1VFFA 1KRPA 1SO5A 4JI5F 3R1ZA 4YB1P 4JX4A 1JLQA 3T0DA 2E5CA 2VQFJ 5I4MA 3W1RA 1TL4A 4KKOB 3QV7A 1H63A 5KZDA 1S57A 4N41A 4IP5A 4JXCA 3NZPA 4FIRA 5CZVA 4ATNA 1VQ5S 4I5XA 3GAYA 1MWQA 2DZVA 3GDMA 3NTYA 3QKEA 2V30A 2ZWPA 4OYIA 1IXPA 1H7WA 5I79A 5E9AA 3TJLA 4PUDA 4RUCA 4DRSA 1VCFA 4D3HA 1JWWA 4CQCA 3BZJA 3V4IA 3PO5A 1JNEA 3MTJA 5G0RB 4LYQA 4OI0A 3ADAC 3P84A 3H24A 3OR2B 3H7VA 4JI8F 2ON3A 5BXSA 2CJKA 1E0UA 4DQQA 4YWSA 3PK7A 1QFEA 2BE2B 3KLHA 1AMKA 1H3DA 5LGZA 1XCFA 3LH2S 1TWDA 1EX1A 1G4TA 2AGOA 1QI2A 3TC6A 3VX0A 1PO6A 4H9YA 5D0RA 1KFCA 1E4NA 3PNUA 2VHGA 5K4XA 3H5SA 1MXSA 4X4QA 1VFUA 4UZSA 1Q81T 4WU3A 5JBDA 2VELA 4H41A 1U48A 2VFDA 1PJ5A 3EOOA 2ACRA 2QEXS 3OL9A 1SM9A 4FNUA 2OEKA 4DR1F 3ITTA 4CO5A 4CNPA 1RT4B 3KK3B 1E6ZA 2PWHA 5A94A 1FNMA 3K5OA 3K59A 2PD5A 3LQGA 3S1VA 3NOCA 4HMCA 4QSFA 4G1QA 2QFJA 3M44A 2QKFA 1E6PA 3PVFA 4XDDA 4DZ6A 4A3UA 2CZVC 5LJ5Y 3SQGA 2ASDA 3L3CA 4RWXA 2VQEF 1THFD 3NDYA 2HS3A 5BRQA 3GC2A 4XZIA 3CC4S 4LFBJ 3M7SA 3HSJA 4G1IA 1H74A 4IFVA 3L2MA 4IR9A 4PMOA 3AAMA 5D4NA 1TRIA 7A3HA 3KLVA 3N9KA 3JSRA 4BWLC 2QLJB 1W0MA 4QJ1A 1HBNA 3TN3A 1JLFB 4FP1A 4UOZA 1FTCA 1KC8T 1AFSA 4FXVA 4PC8A 3CV6A 1L8PA 1RTDA 5KFQA 3MT1A 2W4CA 3VUPA 3ZNUA 3EGJA 2WMJA 1Z9AA 5HK4A 1CGUA 4C6LA 4S3DA 3UY7A 2J8AA 1U0HA 1WC6A 4O0IA 1US0A 3N6NA 1XQLA 3S6TA 1KM5A 4K38A 1E6YB 4OHZA 2A7NA 3VD5A 1URNA 2CLOA 1XBYA 3CW2C 3QJLA 2XFRA 1DWFM 3RMEA 2J78A 3V5FA 6AT1B 3T55A 1UW9A 4ES3A 1HHQA 1E71M 1JCMP 3N29A 4CQAA 2G3FA 4CM2A 1H1YA 2CESA 4IM4A 1W1TA 1XLAA 4DJDD 2PBOA 2GVZA 5IV3A 4RNMA 3SB0A 3A5VA 3AMCA 3E74A 4C6JA 4UY85 4YHHF 3Q83A 4PWWA 4R8UA 1RE1B 3O63A 2HQFA 3OLIA 3TH6A 2YCIX 3H2EA 2CKWA 2PIIA 2UXBJ 1AFIA 3BN4A 3NQFA 2WOMA 3Q8QB 2X1GA 4DR6J 3QGVA 2IVYA 4P75A 2A7RA 4O1FA 1PJ7A 4JY9A 1ZZMA 3WLIA 3W2UA 5HJYA 5HWJA 4BBYA 2VFEA 5IS2A 4F0RA 1E3XA 4J9LA 2YIHA 3KXDA 4HA4A 3J7HA 4H4MB 2QDEA 4CLMA 1RAGB 5KFYA 2IKGA 3GNOA 4H7CA 5I24A 4FX6M 2IPWA 1TL3B 2UUWA 3NGKA 4F48A 1SI9A 3QOKA 5A6BD 1TSIA 4TY8B 2HBRB 2BHYA 2QCGA 4S1FA 3D3BJ 4UOFA 1D9FA 4LF7J 3CVKA 2HHVA 4FS9A 3BANA 3GQCA 3SZ2A 1QY7A 2OLHA 3W01A 3W6MA 1CS4B 2DH8A 3N12A 4K4TA 2J24A 2QUNA 5D2WA 2KHDA 3TAOA 1E4IA 4AXJA 1JCNA 2NSOA 2BJ8A 5LA0A 5GAGU 2PDQA 3E3HA 2VVNA 4CLTA 1VEOA 2HVIA 2LA6A 4O8RA 2GWNA 4GUJA 2ACYA 4PYSA 1XIJA 3MVTA 3MECA 5FDLA 1Q45A 4AC7C 4GMKA 1Z2LA 3MBDA 2GHVC 3CJPA 1A53A 2BY2A 2HHPA 4B3SF 3AZSA 2P8IA 2C2EA 3SGUA 3I6EA 7PTDA 2DBBA 1GG0A 1FXDA 3VD4A 3CJQA 4DR3F 1S76D 4GINA 1HNWJ 2YKMA 2QULA 5F4XA 3ILOA 1QD1A 4AD6A 3UXLA 4CYUA 1Q7ZA 4CLSA 2R1LA 1V5XA 2G3NA 2BW7A 1H7NA 4FOJA 3QGGA 3B06A 2WCXA 3S5OA 4UQBA 3D3FA 2GC8A 1S2WA 2KZMA 5J2QA 2YBTA 3QRQA 1HNWF 2O55A 4ANCA 4GIAA 2FZNA 5IT9U 3HIJA 2MQNA 5HQLA 4JV1A 4W9TA 4PQAA 1S0MA 1BG4A 4AD1A 2DXDA 3PG8A 1XLEA 1RHKB 2BQ3A 4IPLA 2OO6A 5DS7A 4WKYA 3RZAA 2I2YA 3RO6A 1WDTA 3SUVA 2I5QA 1N36J 5CPTA 1X6UA 1M7XA 4OYWA 3OW2R 3HHLB 1QPQA 1J5SA 3PSVA 3BH7B 3HZ3A 2VC5A 4NA3A 1VRTB 1UA7A 6CGTA 4Q8QA 3BLKA 2M8HA 4CO2A 1SKRA 3WENA 3BG9A 4LC8A 4C5ZA 2X1IA 1QUVA 1BHNA 1OX5A 3C15B 5D03A 2G0JA 5AHFA 2QRRA 2ATMA 4CWBA 4DWIA 3DFPA 3TNBA 2QC3A 4GJ1A 2V9WA 1M41A 3BBBA 2FZDA 5ECUA 3P93A 4XKYA 5DDRC 3J7A1 3O6DA 1EJUC 4NLYA 2BVYA 4O53A 4DSFA 4YVXA 4F67A 2BJ1A 3AXKA 3UF9A 3R8GA 1TAQA 3NCPA 4F0KA 1SL0A 4DR7J 2IRYA 1FX6A 4B5TA 4Y90A 4XZ9A 3MW7A 2I8EA 3VALA 1U1RA 2DGTA 2O0TA 2N82B 3MEGB 3CCES 2V34A 2G50A 4GUIA 3WDJA 2WCSA 4DV7F 3TV8A 3FCPA 2R9RA 2HQGA 3KVMA 4M5PA 1YHTA 2VPWB 2YZRA 2XQCA 4UZUA 2Z4GA 1MQRA 1PAEX 3DXSX 4N6FA 4R5PA 4TLRA 4YDXA 1O66A 3IR7B 4M6UA 3MR5A 3GG1A 5BXRA 1RQ0A 3R7NB 3MM9B 2PWFA 5CZSA 4GZJA 1RT2A 1VLYA 3WDRA 2DP3A 1KVIA 1XLGA 3N2MA 5C7PA 5IT9Y 3GTYX 4V1XA 4Z1CA 1BQNB 4RCXA 2P9CA 4O15A 3NS5A 1BSLA 3REQA 1RWOB 3M9YA 2QGHA 2YXXA 3ZTSA 2DZXA 2IC3A 2JNJA 4Y8FA 3NGFA 4RZ5A 5KT7A 2FJEB 5HATA 4NZ3A 1UP2A 2VX5A 4PMZA 5DRKA 1RLDA 3B40A 3FSXA 3T6CA 2J0QD 3QZAA 1S72S 1Z48A 4TR9A 2YBVA 1FWWA 2RUGA 2HW3A 4REQA 3LTYA 1P0KA 1PBGA 4Q7BA 2J7HA 4IFKB 2I9UA 1KOOA 1H2JA 3LDVA 4RKUC 1HL9A 1T95A 2VQUA 4JEJA 4GGHA 3UWEA 2E7VA 4LIRA 5BW6A 5E5CA 3TMQA 5AE2A 1VMBA 2DGXA 1T5AA 4Q4OA 3W7NA 5KFJA 4U67Q 4O52A 1BKSA 3P8JA 3IEBA 3H4BA 1YRUA 3QBCA 1JLCA 4PTMA 2DH7A 4NUWA 1VBZA 1FRJA 2MZRA 2FLNA 2DNYA 3EOSA 4USVA 1R5YA 2YCEA 3VD3A 1NDKA 2MNRA 2PGWA 2WSCC 4KGJA 1IJFB 1J0JA 4NJHA 2WBGA 1KGWA 1TUGB 3LHVA 5G4HC 3QLHB 4LF4J 1CECA 4ECYA 4FYDA 4DXLA 3II1A 1FH8A 4DPTA 1V02A 3QRHA 3GDTA 3NIYA 2FMOA 4I7WA 5DLCA 3D6MB 4G7EB 5KFZA 1UOKA 4PRRA 2BY3A 3SFKA 5A8OA 4JL1A 2EVZA 3NQVA 2F4VF 4LJMA 1UD5A 3BPSP 5D02A 3AIRA 5I09A 3ZLFA 1OYCA 2CPYA 2ZVSA 2FDMA 4QJ3B 4AYGA 1HN1A 1C1CA 4GO9A 4YTSA 4ORIA 1Q6DA 3AMGA 3HTWA 2KL8A 1JIBA 1S2UA 1QI5A 4NLWA 3PANA 4DG1B 4GXWA 1RKIA 1X4HA 3U5UA 2PUZA 3B8UA 5XINA 4V2XA 2HHSA 2OWXA 1TL1B 2NXGA 3SR7A 3SADA 4GKJF 3WQ5A 1GZ1A 5KFRA 2G4BA 4NL1A 1RABB 2FMNA 3P80A 1YXYA 2JEIA 3CEPA 2UUBJ 3A22A 1Q6GA 3O2LA 3QSTA 1MROA 1U1JA 1Q6RA 3OZPA 3OG2A 2CZEA 1TPUA 4JI6J 2C16A 1PX8A 2DNQA 2Y8KA 2HZVA 1LEOA 1NKCA 3NPXA 1DTNA 2OHDA 4UQAA 4JI0F 2HIQA 4KGXB 4JFVA 2PTXA 2KO1A 3WLRA 2G37A 3TWZA 1A0OB 3U1LA 2ROGA 2H4WB 3POTA 3ARTA 1K9TA 4I69A 5JVLA 1TUXA 5DMNA 3T2OA 4L56A 1LCOA 4C8ZA 1VBJA 4OLPA 4QX4A 2WJZA 3G4SS 3C2YA 5LL6d 1KRCC 1RU1A 2GVLA 4FVMA 3BCJA 3ARRA 3BQ6A 2CQCA 3GRIA 1VPQA 1WKLA 4PMUA 3RDKA 4AE5A 4YFUA 2E1CA 4WBFA 4K8HA 1DY3A 4GBDA 1P1XA 2E1AA 1PKUA 4AVFA 1RT6A 3GFHA 4KGMA 4EUVA 2X09A 4KGKA 5CPQA 3SY8A 4AWEA 2Z1KA 2WYSA 3NOYA 3M8QB 3QT8A 2R7WA 7TAAA 3H90A 4N42A 1Q79A 4HT5A 2VUGA 2WBRA 2EGZA 4X64J 4LUBA 2ZRUA 2HBYB 1O8BA 4CN1A 4GC6A 2G97A 1E0VA 3PBYA 1NMEB 1KLNA 2OP5A 2P0IA 3W53A 1U1OA 1EJWC 3OR1B 1KBBA 5F2GA 1NQ6A 2ATLA 3TKFA 1X0FA 1W2BR 3AXHA 3SXLA 2O92A 5D05A 3EUNA 4MKYA 1E6RA 2CADA 2XU2A 4GIEA 3MKKA 4DJEA 1RAHB 1VHCA 2ZWOA 1K73T 2GS8A 2CQPA 2QMUB 5J5RA 5CZTA 4XPCA 3AD9C 1OQFA 4DYKA 3PKYA 3GV7B 3W25A 1HQUB 5CXTA 1KRAC 3C2VA 3TUIC 3KLEB 1HP5A 4JICA 2L3MA 3FSTA 3NQMA 4ZPVR 4UY8T 3I7RA 3IWPA 2PT0A 5HQ8A 5KFDA 4WFNQ 1ISVA 1RD5A 2PBGA 4JI4J 1XC4A 2XVGA 2UV8G 1C2PA 4YEAA 3DDIA 1T9VA 4HHPA 2Y7DA 3LNMA 3QN3A 3H26A 1GQKA 1GPWA 3KEHA 4J40A 2Y24A 3M0IA 1OIMA 3OO2A 4L7ZA 4NPOA 3NEHA 4HK5A 4W4QA 4CNNA 5A8NA 3OV7A 3B0PA 5AHMA 3CJSA 1R2TA 3S2MA 2K1RA 1FF2A 3BH4A 3AJDA 3VIFA 4QHRA 4U6PA 1K1QA 3S6OA 3UD5A 3KTQA 4FNIA 5JMNA 3T0AA 4E4FA 2F40A 4YHGA 3EXCX 1A6LA 3EEGA 5G2HA 2WB5A 3P14A 1SUQA 3QMQA 2XIBA 1QUMA 2F3JA 1OY9A 3OQ8A 3MR2A 5A6WA 3O2IA 2XGZA 2GW8A 1NCLA 4EWJA 5DY3A 2XY6A 3EAUA 4UOQA 4XSMA 3PC0A 3R25A 1KTQA 2PLCA 5HWNA 2VU5A 1JZ2A 1YNQA 3AHPA 2C3MA 5F3ZA 4X2RA 2XINA 3TVYA 1TFVA 5A8RB 2VF3A 4CN6A 5HMZA 1R6VA 1NK0A 4P72A 2OYLA 4DFPA 3TAPA 3TVKA 2FH6A 3FK4A 1XLJA 2YXLA 5GJNA 3WD3A 1XGZA 2BVDA 3BAWA 4DBWA 8CGTA 1XNQJ 4H6KA 2WO5A 2WW8A 4XTTA 3M2RB 4ILRA 4WVXA 4K6AA 3WSUA 2EXUA 3IFEA 4IISA 4CLYA 1NWRA 3F03K 1FVPA 1YJRA 4HNVA 2VJXA 1F2JA 2FJVA 4P8VA 1HWUA 4R34A 1K77A 2AKMA 1A0EA 3WLSA 1PYTA 3SJ3A 1I94J 3W37A 1TL7B 2LDIA 2AYBA 5C70A 5L1KA 3TZYA 4L9YA 1IKVA 4HN4A 5FJUA 1S10A 4I3GA 3BGFA 2HHHF 4N47A 4H7VA 1YDLA 3M6UA 4DHVA 4O1CA 3S6DA 1NQKA 2ACMA 1DJ0A 4H7ZA 4F3QA 3AHYA 4UTKA 4ZOEA 1UIOA 2QPSA 1W6TA 3GIJA 3VOGA 2ZD1B 4K5RA 4LEQA 3GYGA 4FHAA 3HKWA 4N5SA 2ZZ5A 4ZO7A 1W54A 3R89A 1M9HA 1E1FA 2ATSA 3ANUA 1KFJA 3T42A 3TVAA 3WBXA 3AIQA 1S3HA 4UOHA 2UUCF 1AROP 2YCLA 4OKDA 3GC5A 1JLBB 4KYZA 4UTMA 3ENAA 4D6HA 3U2EA 2W5FA 3DUGA 3H25A 5I3HA 4K2JA 4O8AA 3CGIA 1S59A 4WFAQ 1ZB5A 5GMDA 3TIMA 4JZ5A 1CEZA 3GV8B 1XK8A 5LSOA 2O7QA 1NHVA 1X8CA 4OZ2A 3W75A 2GWGA 2VR5A 4HOZA 1K02A 2V0TA 1L0PA 2XMJA 1KBIA 2VIHA 4PG5A 5EMUA 3VKBA 2FVCA 1SR9A 1SC3B 4TVUA 2B0GA 2K3IA 1S1TB 1BYDA 2EKCA 3EPGA 1B90A 1S5TA 4IIBA 2RKXA 3R1LA 1JF5A 3RPMA 5F8JA 1IXKA 1UJ5A 3OIHA 4I5UA 4L72B 1ZPTA 2YKKA 1DIOA 4WYWA 4HACA 2G95A 1LP6A 1HNIA 2XN1A 2RE1A 2ZQ0A 1R46A 2IKHA 3CQKA 4QISA 1UW4A 3MM7B 1K7FA 2FB3A 1DJYA 2C2DA 3LNPA 5L1IA 3LQVA 2CFXA 3TC7A 2X3DA 4ZB2A 2ALZA 3QF0A 1E1CA 4GO5X 5DDOC 1Z42A 1VC5A 2BB0A 2WKGA 1HXJA 1ICSA 3M2VA 4MJKA 1T3NA 3M2RA 3P5BP 4C7QA 4DM1A 1XW8A 1MSSA 3Q23A 4US5D 1QHOA 3N6QA 4B5VA 3OL8A 1DWGM 1XBXA 3CULA 3OEXA 1YQ2A 3P5TL 1BQNA 1QUPA 1FKOB 4XUGA 3RLUA 4LF1A 3NZGA 3FFSA 4BQ3A 4JDYA 1TPWA 4KBXA 2CPHA 2GMJA 4WDUA 4QYZJ 4NRRA 2ACQA 1B30A 1JLFA 1Q8LA 3FBEA 4K2XA 1V0LA 1B3YA 3W8PA 3QV8A 2F7VA 4DV4J 5K9FA 4I9AA 4DZ5A 2BVWA 4V27A 2H8XA 1BLIA 5BYWA 1K8ZA 1IEVA 1DL3A 3G8SA 4AEEA 3PKMA 3F1QA 3PZQA 3W1NA 4PQUA 3SQGB 3T3FA 1CQMA 1UP1A 3LA4A 4DJED 3QPIA 4O44B 1FNXH 4ATDA 3ISIX 3NXLA 4OBTA 2OODA 5DGAA 5FF2A 2JX2A 3TX9A 4H2CA 2E40A 3FAWA 4RUBA 3LF0A 1TK5A 5H8PA 2J77A 2CJ9A 4PMRA 4C97A 1UD4A 2VG7B 3B9AA 1G6BA 2G0IA 3H21A 3E49A 4RL3A 1XIQA 2W4PA 1U26A 3H2CA 4X3ZA 3SMZA 1XYZA 4B16A 3FGVA 3JW7A 1XD1A 3B3DA 3OUYB 1EZ2A 2OSXA 3MPGA 5J8LA 2ISSA 1S39A 5A5WA 4NCAA 3QYSA 4PCPA 4CQ9A 2PF0A 4Q4QA 3H5YA 2ZUVA 2EG1A 1S1TA 5C54A 2MZQA 4NLOA 3E0VA 2DXFA 3WLJA 3MCOA 2JLFA 2J7BA 4H4OA 3NM3A 4LF8J 1A80A 1G4EA 1KFLA 2QPUA 3ZJ6A 1ZBWA 4FNHA 3NCQA 3O3LA 2GJLA 3C8YA 4PTXA 1Q6LA 2ZC4A 1CDGA 4JP8A 3D5HA 7AT1B 4P7QA 5LIKX 2YFOA 3CCSS 5HR7A 2VI0A 4YMZA 2EG6A 1BRLA 1PUDA 1CCWB 5T14A 4URGA 1FXRA 3DI6A 2ZH4A 2WW4A 1OX4A 1WX0A 3DN5A 3QJJA 1VI7A 1OFBA 2Y7EA 3TANA 2A5HA 3PR4A 2KYZA 2B4GA 1Y9OA 1SJQA 3W1PA 3U1MA 3SUTA 1Y5IB 1RTHA 4FLSA 3PZIA 4EAMA 5M5DA 1HBMB 1CPZA 1GMUA 5AHIA 3R0DA 2BOAA 1X9MA 5E9XA 1DHKA 3MMCB 2C13A 3VE9A 4WF7A 1IKYA 3E5PA 3WNMA 4NJKA 1F6YA 1K9DA 1WG5A 4C0OC 4FF4A 1F05A 1ZGDA 2ZBTA 1KVJA 1OX4B 1JZ8A 1XINA 3S42A 3IS9B 3FRZA 1XLCA 4FNRA 1W25A 3H7HB 4OYPA 1UVLA 2KVIA 3H59A 2R8IA 4XUYA 1U4BA 2OEMA 3GYCA 1NO8A 2VFGA 5EBAA 2FC9A 1RQHA 1AVAA 1H0IA 5A2CA 3LGMA 4G1PA 2MMYA 1BXNA 1HWLA 2NXNA 4HKPA 2PEVA 1LK7A 1JK9B 3WLPA 3KOYA 1SC1B 2H90A 2R7OA 2NUHA 1WKEA 4DPXA 1POJA 4IG2A 2X1BA 3LGGA 5LIYX 1QVBA 2FTRA 4H2HA 5IC6B 1SJ4P 3INPA 4OOUA 2JEFA 1FKPB 1NY1A 1ZZFA 3FN9A 3CJ3A 3K8VA 2J9ZA 3PY8A 3NO1A 1A50A 1W2VA 3IVTA 4CNTA 2NX1A 4PG8A 3AJ2A 1EUAA 2BE7D 3OVSA 2A0NA 2AQ4A 1ZM4A 3MPVA 1IEWA 3QQWA 4J3XA 2TSYA 4WJ8A 3HHLA 3L4BC 2WOQA 2PFFB 3QMSA 3USBA 4P74A 4WKRA 4XO0A 2WNZA 2X7IA 3NL5A 1LFWA 2X1TA 1UZ4A 2GMHA 4NXSA 4QCFA 2XHCA 3WELA 3SRFA 5ABEA 3T8LA 1NFGA 2NUUG 4I8YA 2V5DA 1Q8KA 4LBPA 2Z6IA 5I23A 3UG5A 5ETMA 1E1EA 5AKQA 2ZUMA 3LXBA 5KT3A 4HNCA 5ETNA 3ES7A 2GX8A 4LVOP 4RDWA 1YNYA 1YG0A 3MR6A 3W1LA 3AA9A 1JYNA 4GUHA 3K8LA 1LWHA 3W73A 2JOQA 3MD3A 2RU3A 1YPXA 3LPPA 3RX3A 4FS1A 3HHEA 3KLIA 1OPIA 2WVBA 2VRJA 1K8CA 4ED0A 3GO2A 2Q02A 3B8DA 4FLQA 4KMQA 4CYUB 4AZGA 1KRBC 4I1TA 4L1WA 5BROA 1QNRA 3W7JA 1SW7A 2V69A 3QSIA 1TV6A 1XF0A 2DNKA 3GG0A 1TIMA 3P0WA 3ICLA 2UUAF 1W1PA 2YBUA 5A6LA 2PFHA 1LLZA 1W1A1 4NA2A 5HNUA 3IACA 4QU6A 3GG7A 4E2DA 1KM3A 1DTQA 1OWXA 2YDQA 4IIHA 5LMUJ 4HYVA 4UQEA 3TA0A 2J6UA 4R88A 1MW2A 3QY7A 3BKTA 3BLIA 3BM7A 2Q6ZA 4PUWA 3UCCA 3TZNA 3KM8A 5IT0A 4O14A 3TWBA 4KIAA 3GR1A 3A3WA 2IRUA 3W7QA 2ZZ6A 1XKJA 1RWPB 3SY5A 5M03A 3LWMA 1HHSA 3WMSA 4LBHA 1PZ0A 3ZZOA 4HU4A 3VDHA 3M43A 4REQB 3GKFA 2MKSA 4B3MF 1KBJA 4FX8A 3CB4A 4RZ6A 1E6QM 4D3GA 2HZGA 3EX1A 1WC5A 3TYCA 2HISA 2FPHX 1RT7A 3LLDA 3HSZA 3W7DA 4Y9NA 2JC0A 1S9EA 4A4AA 4Y28C 5KMYA 2G8ZA 4I68A 1PIGA 1SMAA 1ME7A 2HS6A 5L9XA 2WJDA 1TPH1 1R6YA 3K58A 3RJXA 4B3OA 2HK2A 2D3NA 1DHMA 3SN0A 2RDTA 3BSCA 2DRBA 2ZRXA 1UD2A 1O1ZA 1Q6CA 4DV4F 3R5CA 1P1MA 4PXEA 1XIMA 1I9CB 1KXVA 3AYVA 4CD5A 2ROEA 3W5XA 3PXGa 1VHNA 1P9YA 1WKJA 3UPWA 3NSMA 1JI1A 3J7Z5 1HNXJ 4RJVA 4DZAA 5A8PA 5F41A 4QDWA 4BQ4A 5LT5A 5FF0A 4Y0FA 1JCTA 1FHLA 5KZ6A 3AD8C 2HXUA 2WVCA 4DLEA 2NZ4A 3LCFA 3DU5A 1LWFB 1HJUA 1MZRA 2ZA2A 1W5QA 3URBA 1HNXF 1UWTA 1GOQA 1TA3B 4D2JA 1SH0A 4RL1A 1EJSC 3F5KA 5IWAF 3BGRB 4B2DA 5F3TA 3TTYA 3W1XA 1WOSA 2HQDA 2G5WA 5ENLA 4F2TA 4MPKA 1E6SM 4MKSA 3K4AA 2X1UA 2QLWA 3WO8A 2FHCA 3T5LA 2FJUB 1QW9A 3QM3A 3QYQA 3WBZA 4JCMA 4RW3A 5BU9A 2B8PA 5D4OA 4DPYA 3AI0A 1N36F 4YTRA 4CEXC 2XNRA 1Y5LB 1S46A 2MQPA 2W66A 1TV3A 2C15A 2ZRVA 2VFUA 3VD7A 2Q09A 4ANEA 1RBAA 3HG4A 1OS5A 2BRLA 2RILA 1FE0A 3KFWX 5KFOA 3VGEA 1K47A 3W5YA 2LKZA 2Y88A 3EGNA 5F8NA 4DPOA 4U7CA 3JZUA 4LVDA 3WX4A 1TCDA 1XDMA 2KXHA 4J9KA 3G1VA 4DQSA 1L3TA 3LTSA 4F66A 3QSYB 2A0FB 3MI6A 4Q8PA 4B3TF 2W61A 4K0KJ 9XIAA 1R9YA 4S2BA 1ITXA 1UL3A 2PDUA 4CNSA 2CNLB 4YY3F 4S3AA 1WF1A 2OOFA 3MEKA 3AMKA 2UVRA 1XXXA 3FEQA 1HVXA 1BVZA 3IJ8A 1KQGB 1RVGA 1UKSA 5H8UA 5CG0A 4V28A 5I0DA 1X39A 3ZWSA 5CD4H 2ZE3A 1G6CA 4UTWA 4PL2A 2Q8ZA 2GL5A 4FEZA 2Z26A 4XAPA 4GO7X 1NDWA 3CC1A 4QOTA 2ZXAA 2V8ZA 2WMIA 1TKZA 2M9KA 5HP1A 1E9ZB 4FK9A 5GJPA 3O06A 5DLGA 1XSJA 3T0CA 3BK0A 4UNIA 1FWBC 2ZRYA 2ZE2B 3GU1A 2ZZ1A 1RZMA 4K4VA 3CCQS 3GZ3A 2DIEA 2Z1SA 4WY0B 4KCUA 1H7RA 4DJFA 1FH9A 2W01A 2ZNZA 3Q67A 2COLA 1GVQA 2ACSA 3MHYA 3SCKE 4IMGA 4MIWA 4HU3A 2YOCA 2R4FA 3O44A 1K3UA 3ZYZA 1N56A 1Q5YA 3KNAA 3CIXA 4HNTA 2PF8A 2PB1A 1TWIA 4IIGA 3WQVA 1WB0A 3PAJA 2IAJA 5D2YA 1WUFA 4OYXA 4HNLA 1CJTA 2V3DA 2Z30B 3CCRS 4O18A 4MAVA 4IOBA 4WLCA 4KFBB 3B9DA 1NWTA 4OZ1A 1MYRA 2RDIA 1KBRA 1NOUA 4ICCX 2C7FA 3VIPA 3LENA 3CJRA 1RK8A 2O9PA 2FVMA 3OG3A 3H54A 4DR1J 3BAYA 4WZMA 4DR2F 3L0NA 4LANA 4H1ZA 4WFZA 5CYJA 5G5IA 3NOGA 3SRKA 4DWSA 3QIPB 1ZENA 3TW0A 2P8CA 4LVAA 2B9YA 2YX7A 2Z6JA 4J3TA 4PSPA 1AW5A 1ME8A 3GXDA 5KFSA 3ID7A 3APTA 1YTKA 2XIOA 4KEZA 2BHUA 4LVGA 4EZ6A 2R7VA 2Z2YB 4K59A 5D3GA 1S12A 1TJPA 1PV8A 3THQA 4RDVA 3QGHA 4Y6IA 3R5DA 2IUZA 2GJRA 5I3IA 1ZAVA 3E3XA 1NEYA 2NLIA 3HO8A 4LV4A 3R7BB 2L9DA 3JTOA 3QRPA 1L2UA 1XHGA 2DSWA 4KWWA 5ETOA 4CTAA 2K06A 4AY1A 4TVAB 3UI3A 2AQVA 4OYBA 4X2BA 3TE9A 2Q8LA 5C24A 3FVMA 3BPWA 2MGZA 1RPXA 3TOPA 2KRRA 1NSAA 4X4NA 2Z2BA 5KFMA 3WZ0A 1HBOB 1FWLA 5DMLA 4I7FB 4ZS6A 2QW5A 1RTJA 2BXZA 5F1UA 3RB4A 3E2QA 2R8WA 2A6NA 4LRFA 4NQ1A 2A1YA 3P5YA 2PRMA 1RAIB 2OLWA 1V0MA 1C4AA 4Z37A 2J6TA 3GLCA 2MPUA 4AF0A 3LWLA 1TU0B 3A4TA 2Q66A 1ELOA 5GVQA 3R8RA 3PEJA 4RR5A 2QS8A 1ONXA 3CUXA 2C0HA 4XZMX 4GCAA 3FQLA 1ME9A 3WZ0E 3GIPA 1SGJA 2A3AA 4DUOA 3V75A 2YW3A 2HFVA 3HZGA 4KAIA 2HROA 3V6DA 3N13A 1FWJC 5FJTA 5EHHA 3AODA 4UFHA 2E8YA 3W7LA 4WF9Q 2V0NA 5DQPA 4A8YA 1NDYA 4DF4A 5AYYA 2OCZA 3NQAA 3OB8A 2QZ8A 4LS1A 4JFWA 1JULA 3RTVA 4KBIA 2Q8XA 2QUUA 4H00A 3IUDA 2OZ8A 2PS2A 4FR6A 1B57A 3TXZA 5JUVA 4EYIB 3E5BA 3UETA 2BJDA 1W7WA 2ZH5A 3R94A 1EWDA 3QHOA 4XKYB 3KLFB 5L1LA 5I07A 2BV3A 2DT0A 4OZ0A 1RK6A 4Y2KA 4FX7A 3JB9k 1QVFR 3TP2A 1JFXA 3UR2A 1PKMA 4IMDA 4DXXA 3NZQA 1TX0A 4XAFA 1M1HA 3U48A 1HMVA 5LJ3Y 3QAEA 4K4UA 2AHOB 1LL4A 4ICMA 1RYSA 5FL0A 2GJXB 4FI4A 4IPIA 1DWHM 1WKYA 4Q0BA 3LALA 3UCUP 2YLLA 2ZC8A 3QGAC 3MTKA 4XZWA 1UUOA 3PBWA 3LP1A 4USMA 4GHRA 3KLLA 4D9PA 3W7KA 1XERA 4IG0B 3J7ZT 5JIWA 3KLIB 3S8SA 4GIRA 4AIUA 1S5MA 1SU5A 2BV9A 1HJQA 3ZXWA 4C6AA 3M46A 4F36A 1N6QB 2XH4A 1VFMA 2CZFA 1K9MT 2R2TA 2WHJA 4TV6A 4ANDA 1G4PA 1QE1A 4ECSA 1JCJA 4ZTYA 4AZHA 1VJZA 2P6TA 4ES2A 1Y7VA 2HVHA 3OTOJ 1IT8A 1ML1A 2NR0A 1WZLA 3EXRA 3W0KA 2IVFB 4LSZB 3MMWA 3URQA 3A8EA 1WORA 4OX9F 3SZ8A 2AAAA 1KD0A 3RFAA 3H23A 4B15A 1W9PA 4A8RA 3KP0A 4F2RA 1VQ7S 3GBDA 2GAGC 3HJZA 2IM0A 3VILA 4OYZA 2V63A 5LSLA 2PU1A 1Z6KA 3DECA 3KP1A 3MEDB 1UVJA 1HFBA 3WL1A 1C93A 3VNLA 3M32B 1WOBA 2PA6A 1R3QA 3S2NA 1V6WA 4ZPWR 1KBKA 1S5VA 2BNJA 1VQ9S 4HI1A 3ZLGA 4M0XA 3A23A 2YH1A 1J0ZA 3A1YG 3QR3A 1IE7C 1TPEA 5C25A 1YBQB 5I42A 3UDVA 4J3ZA 4WFBQ 1IEQA 3FMBA 1UFLA 1ITUA 2FD2A 1D9AA 3BGOP 3BV7A 4Q7AA 1DPMA 1F5ZA 2D73A 2LXUA 5HN0A 4AWUA 2VOMA 4MK8A 3KUMA 2VEPA 5LNUA 2XI2A 4N8NA 3IXQA 1FHDA 4D6GA 2IJNA 1SQ7A 1RB0A 1RHRB 2Q6CA 3CO9A 5HPCA 1YRRA 3BYPA 1VRUB 3HPSA 3L4XA 1Y3KA 3SBMA 1NF0A 3HVAA 1S7HA 4NAFA 3TEVA 4X63A 2R1KA 3V35A 2R7SA 2YFNA 2X05A 2WZEA 5D30A 2PEBA 3TSMA 3I9ZA 1OWQA 2EK1A 5EX0A 5B0FA 1VC4A 3C15A 5AXKA 2NXUA 3E2RA 3MAAB 4JX5A 3CT9A 3B8WA 5F8LA 4MY1A 3T0BA 1FVSA 4XTDA 4B9TA 4PMVA 2DHAA 4TXSA 2JFEX 1WHYA 3EDJA 1ZL1A 3DG7A 4GKTA 2CJYB 1WV2A 3MI2A 2UV8A 1O5RA 3JSMA 1SZFA 1IXQA 1L6GA 3WDIA 1FH7A 4DCOB 1ZA2B 1PTGA 1OGBA 3F5JA 1LXJA 4YYCA 2EBEA 4DBDA 4FAMA 2W63A 2LDYA 2ZX6A 2WAQD 4YWIA 3TK7A 4Q2MA 3C6TB 4AT1B 1E56A 4M5MA 2FGOA 4RW4A 1YJNS 1JCLA 3OPSA 2EBGA 4B08A 1GKRA 5A6JA 4XIUA 1X96A 1OFRA 4L4OA 2X1SA 3O8AA 2YNFA 3G77A 1R7OA 1BYBA 3ZSTA 3PZPA 4XV0A 1HW6A 3GCWP 3OHMB 1IQZA 2J7UA 2OX4A 4WD0A 1WBJA 3EWXA 4C6PA 3BYRA 3HHDA 5F8HA 2ZE0A 1DQ9A 1H49A 4OV4A 4HNNA 4ICNA 4PRFA 1CXLA 3VZXA 2DIVA 4PPDA 2G96A 3AS2A 3Q24A 3OLDA 1A5UA 2VQTA 3IUHA 3M5VA 4XBJA 4CH1A 4ERGA 1H7OA 2FZKB 2ERRA 4FBTA 1BD6A 4OHVA 4K2SA 4AMAA 2OMLA 2XISA 1L6SA 3E38A 4XD3A 4QW8A 4WTOB 2D23A 1VC0A 2LXFA 4RPFA 2WZTA 2XUCA 3S2LA 4CVWA 2GHWA 4C60A 1OD8A 2FQIA 2GLKA 4W8AA 2WK2A 2KJWA 4FO4A 4AHPA 5LA2A 4YB7A 2IS7A 1MROB 3AO0A 1G1YA 1PTDA 4Q5VA 2X51A 2PP1A 3I4PA 4IDKA 4LF6F 4FPSA 1PHWA 2J9CA 1WA3A 2RAQA 1NJXA 3EXTA 3AFBA 2Y63A 3W7MA 2DNOA 2M8DB 4M24A 2MZSA 1DQUA 1MVYA 3T5JA 1J27A 3MI3A 2VQEJ 1LQ2A 4MB4A 3WMCA 3M9OB 1CT5A 4LFCJ 3HV9A 1XPGA 3DFYA 4W7VA 4NOHA 3OZYA 2JGQA 2C2NA 1CW2A 2FVKA 3CTTA 2WHKA 3KUGA 3H7UA 4ECWA 3FFIA 1TIWA 1WC1A 4GQGA 3CL6A 4I5RA 1JFHA 2YA0A 1F9EB 2OXNA 2RHGA 3RU6A 5K8PA 3HLUA 3MI7X 1UC5A 4UTTA 3TOYA 3WLTA 2E5HA 3I55S 3CAKA 2Q43A 4GYPA 1RU2A 4WJBA 3PY2A 5C8BB 2FJDB 2WKJA 3MPUB 1XMOF 4ZLJA 1IWPA 4D8AA 3XINA 4F2BA 1U2YA 4KH1B 1UZ1A 2WZIA 4NY2A 2DT2A 3C61A 3NRBA 3VF0B 4U33A 3DRSA 2J9EA 4ED3A 3EX4A 3VGDA 2F63A 2VG6A 4H4KA 1FFGB 2BQRA 4NXMJ 2NQLA 3WBYA 3VAFA 3MM5A 2DPJA 3THUA 3PB0A 1HLWA 1D3GA 4J7CA 4HJWA 4WZQA 4RUAA 1VQPS 4ICLA 4JQ4A 2NUYA 2J6XA 1QAJA 3LTOA 4Q8VA 3D3AA 3NMAA 1MDRA 1AH0A 3W1MA 1V6TA 1IKYB 2PTWA 1YE6A 5F1VA 3P62A 1AYEA 1HIZA 4EO8A 1CXHA 2BGNE 3MSDA 4ZQPA 5E3QA 1NJIT 1U5HA 2VX4A 3LTPA 3L4VA 4IGSA 1TVRA 3W1AA 1I2PA 2EFNA 3LBMA 3MO7A 5M3WA 4PRWA 4O4GB 3FNDA 1Y65A 4ZJLA 1H1ZA 1U33A 4XTIA 3FLUA 1AXQA 1EKSA 2N7YA 2ALDA 1LWEA 1G4SA 1I4NA 5FLXY 5GVJA 3TAMB 4AC1X 1KV8A 1BF2A 5C5JA 4P2XA 4E8UA 1UZDA 5T8GA 4UTWC 4DSJA 2GQ9A 4DBUA 4EXBA 1YXDA 5H9EK 4NYUA 4PR4A 2IIHA 1QOPA 4BWJA 4QROA 2XFFA 1UIPA 1ZOTA 1RWWB 4WP3A 3FYOA 4UTFA 1BQXA 1NB7A 2MANA 1TVLA 1SFSA 1EX8A 3CC2S 3SCVA 2R7TA 2BHZA 1WNEA 2VBXA 3ATZA 4J91A 3UNYA 1S3TC 1UYQA 5D04C 1F5BA 1BYAA 4O4VA 3ZO9A 1WEZA 4JTSA 3NEKA 3UE2A 4CM0A 2ZH2A 1WI8A 3VO0A 4MB1A 1SO3A 3MCMA 4IX2A 4ZE5A 4OI2A 3T9NA 4J35A 1B4KA 1KQSR 2YNHA 2GO8A 3LPYA 5A2QU 2GGGA 1JQXA 5KZMA 4PUOA 3ANYA 3QFWA 2JWNA 2BY0A 1ECQA 5EWFA 3H4WA 1F5AA 1RHJB 1NHKL 1EOMA 3VDGA 2XGIA 3W4RA 5FJPA 3I6TA 5ETSA 3TUZC 4A3YA 1JCXA 3CZJA 2P76A 2A3JA 2WM1A 2C2MB 1C8XA 3HDSA 1VQNS 1LWXA 1QWKA 3OFHA 1I2QA 1K1DA 4B4FA 2F6UA 3O1NA 3U4FA 3RYLA 4IH7A 1I6JA 1XNRF 1D9EA 1QAIA 1X97A 2VO5A 3DBPA 4DELA 4UBPC 2R6OA 3TTOA 2Z24A 3MUY1 4QJVA 1ZU8A 2ZH7A 1RD6A 4RW6B 1AW0A 3DN9A 4U96A 3EWCA 4ZB0A 3KL0A 1RBLA 2VD8A 2OZ3A 3LA0A 1IXOA 5CYMB 4WRHA 4K4SA 3R0UA 4PCFA 1TELA 4P5UA 3VVTA 3I6PA 4DUYJ 3O6YX 4BFAA 8A3HA 4AVNA 4A8WA 2XGBA 2B4PA 3T78A 3ARQA 4WGHA 1FWGC 2QV4A 3F2CA 3HOJA 3UDLA 3B78A 4IMEA 3QW3A 1RCXB 3PULA 4LS0A 4XO6A 1B3WA 3UDCA 3RAMA 1SH2A 5THWA 1XRTA 1JZ5A 1TRDA 5BRPA 1LK5A 2EBNA 1OMSA 3A13A 3WF3A 2DXEA 2R2SA 3KLGA 1GW1A 1F3FA 1TTIA 2J88A 5IZHA 3QR0A 2R3VA 2RHSB 4A8OA 1KTVA 3GB0A 2N3OA 1SZNA 1ISWA 3R5BA 3LMYA 3QBUA 4IG0A 1S0OA 2FZMA 2HMIA 2UU9F 2GCFA 2VEFA 1XLMA 4NCBA 4NZ0A 4PMDA 1XSIA 4UNKA 4XO7A 1S79A 1YQHA 2GQAA 1JRBA 3CZLA 2GJ2A 4FXFA 1T8XA 4OGZA 3IBWA 4P2SA 5T7LB 1ZP4A 1AG1O 3G1SA 9RUBA 4BR1A 1QDSA 3WQEA 3OJGA 2XGQA 4Q8TA 2A4AA 5I02A 2ISDA 2PC8A 4LCQA 1U30A 3VDAA 4F4XA 2WHLA 4ROPA 4C8LA 5J2PA 1XLBA 4MPQA 1CZ1A 2R42A 2GA7A 1A5OC 3UFCX 4CCDA 1QBAA 3SCOA 3N2BA 1M68A 2GQ8A 3SUSA 4LSLA 3V1HA 2LU2A 1CEOA 1W3KA 4YCOA 2BA9A 1N34J 4UUWA 4B3MJ 1J79A 1C9WA 4WCEQ 4NG3A 4GZ7A 4MIMA 4ZOBA 2JFKA 1HG3A 3D0IE 4C6DA 3MEDA 4IUGA 5ETQA 3SFGA 1UH3A 3KHHA 3HGJA 2FTWA 4ECLA 4KY3A 4X4VA 1DLOA 3IV3A 3WNNA 3H8YA 4H6QA 2HDJA 3UBPC 4GNVA 5IBXC 2ZADA 3WN6A 1ZTVA 1S6UA 1TTQA 4B3TJ 5ETKA 1OSDA 3A3HA 1V0NA 5HROA 3CQ0A 3W65A 4BLGA 1TE6A 4XK2A 1D3WA 2QDGA 4GVIA 4GYFA 1LNQA 4AYBD 3DLEA 2F84A 4KT0C 4HGXA 4S3EA 1C0TB 3C46A 1VRDA 1UEUA 2DRAA 3MEEB 1XWLA 2XWEA 4IH6A 1A4LA 4FLOA 2CZVA 4Q3MA 3QATA 3WC2A 1OSCA 4EFAC 3UJEA 3ZFHA 2J47A 4NKCA 1G5AA 5J2QB 5BYRA 2RJGA 3ENVA 3VOIA 3RU0A 8ATCB 4YXGA 1S2AA 4QNEA 3QR1A 1YJVA 4JTFA 4NP7A 1GMVA 3KBSA 2RDJA 1V6YA 1EQPA 2CJXB 3IM8A 3CJKA 2GIQA 2ZX5A 3CQIA 5AHNA 2Y70A 3WF2A 4QE5A 1A49A 4K68A 3ARZA 2C1EB 4DU7A 2U2FA 1YSJA 3BBFA 4ZXOA 4EVZA 3I5CA 1KKOA 2DSKA 1CJTB 1VC6A 4FF7A 2RD5C 4S3CA 3M6YA 1T9XA 2CQ4A 3VNDA 4OZ3A 3VFCA 1UASA 4F3HA 4HT7A 1NDZA 2ZDSA 4TU9A 1RVKA 1IKXA 4C8NA 2YNGA 4MK7A 2DDXA 2VGIA 2CJAA 1ELSA 1UWSA 3RK8A 2IFXA 1FOBA 5E3PA 1VBRA 3VMOA 1GYMA 3AOBA 1YIJS 4PA8A 4HTJA 2Y89A 3PYGA 1NNDA 4X60A 4Y96A 2B4VA 4J2PA 3AS3A 3L65A 2D3OR 2FHJA 3FY1A 1ITQA 1XI3A 1GX6A 4F3OA 4GKJJ 4DI6A 3BJSA 3MSYA 2AGQA 2DQXA 3ARSA 4EWTA 1UKUA 2X0SA 2BRKA 2YX1A 1TKXA 5B0CA 4RNNA 1RTHB 2PDYA 2MQLA 3NQDA 2VOTA 5AECA 2ZH9A 6TAAA 4ZN3A 2W2PP 1NSJA 4I2PA 2Y1RI 2C1IA 1UJ6A 3QJPA 4QE4A 1WNOA 1CTNA 3PW2A 5DBUA 3PUGA 4C8KA 1FTXA 1RT5A 1KFKA 3DYMA 2QCCA 1EIYB 1ZCCA 3A4WA 2FFCA 2V3GA 3P8IA 4FSAA 3T1HF 2PEHA 2IQTA 2HVOA 4V15A 5CGMA 2B7NA 2PMHA 3OTCA 3VIOA 1XBWA 2DV0A 2E1RA 5B7YA 3NS6A 3DFSA 4DQIA 2VOOA 4M29A 4I6YA 3L0GA 3BMXA 4EE9A 3KRBA 3HCXA 1FDAA 1EBGA 2W2OP 2HVNA 2ZZ2A 5C9WA 1NXIA 1I60A 2B9EA 2QE5A 4FYWB 1CQNA 3IJDA 5G2WA 2H54B 2OKQA 3PBGA 1W9DM 4BF5A 5EX3A 4HD5A 2EFGA 3GH7A 2U1AA 4PUNA 3W2VA 3STPA 2PA8D 1VENA 4PEEA 4NRTA 4NNAA 5ABFA 2DFAA 3DRRA 1VJSA 2ZZNA 1Z3NA 3D67A 3PHAA 3N5BA 3J81U 1YE4A 1W9BM 1SJ1A 3UZYA 4ZSUA 4JQ2A 5HWMA 1V3HA 3F4NA 3CCTA 3DI0A 4E6MA 2Y2WA 1FCBA 4D6IA 2X1RA 4Q6JA 1IJEB 1E0XA 3TJXA 3E1F1 2VHLA 2ZYFA 1JDEA 4KHRA 1VGAA 4GVBA 2XSBA 4N02A 1EF2A 2QCMA 3G1FA 1T9UA 2IPFA 4L1XA 1VQLS 1HNZJ 1LRTA 4LT6A 4QIVA 2WPGA 5KTQA 4HNOA 3UJFA 1GVRA 3NCRA 2XVLA 2VC7A 5KFFA 1HBMA 3HJEA 1VAHA 1WP6A 4GC3A 1X4DA 2VFHA 3GHUA 1JR1A 3EPIA 2FGZA 2Y3YA 3MUVP 4ELUA 1PCWA 5GPRA 1RISA 3R11A 4CCEA 3VINA 1CLVA 1KQYA 1G94A 1BPLB 4IUFA 1J8VA 1IBLJ 1DXFA 5FD0A 1UVKA 1UHVA 1K03A 2B9WA 3UZ5A 4ZIWA 1V3JA 3QWUA 1OYAA 2LP4A 5K3VA 1I0DA 1JXKA 5JXQA 2AL2A 4RJEA 4O12A 4W4MA 2Y0BB 4DF8A 1GTEA 3VZZA 2NXIA 1KKHA 2A18A 1XH0A 3T81A 2AQOA 1VQ4S 3WQPA 3OHIA 3WH7A 2VUNA 3QZ6A 4A48A 1MSWD 5LXXA 4PWDB 4FNQA 1TO3A 4IYQA 4HCDA 1RTDB 4U8VA 1YDVA 1AL8A 1H4PA 4DQWA 3DLBA 2HQAA 4WXWA 2GGHA 2Y0SD 1T0OA 4WK9A 1XMOJ 1QPOA 3CJ5A 2XS2A 3KHJA 4X66J 5A6SA 3QFHA 3N1AA 4KQNA 5HVFA 4IPNB 2AU0A 5HNTA 1UWIA 2G4JA 2PMZD 4GACA 1FKWA 1OABA 1KLMA 4M3PA 1REQB 1VDHA 3THVA 3IO1A 4P9SA 1LL7A 4YU1A 4LV9A 5JXSA 2VR4A 3CMFA 4HI2A 3QTGA 1I1GA 2ZEJA 4FLRA 5GNZA 3P6YC 4UTTC 3EOEA 3FA4A 3TYUA 1BYCA 3UCQA 2V50A 4G65A 1GFWB 2GJNA 1DORA 4NVTA 3TA9A 3PTKA 2IA6A 2OJ3A 2DHSA 4N77A 1DJHA 2EPHA 4V33A 3TROA 4Z2HA 1UPPA 3OLBA 4A3HA 2WW5A 5G4WA 1PBAA 5F0UA 4PFMA 4HNUA 4JTEA 4N9EA 1VIZA 1XIEA 1P27B 4ZJQA 4ZEPA 1R38A 1M5KC 2C2OB 4XQ6A 5DRCA 1WYIA 3AZTA 1DAXA 4HK7A 5U7SA 3VKDA 5C9UA 1K6AA 3FXGA 3VGSA 1GVYA 2R1NA 1KQKA 5D37A 2PWEA 1JPKA 1F7BA 5CZKA 1T9TA 2CQBA 3JQKA 2YKQA 4IJCA 3VA8A 1KOHA 3SV3A 3GZ7A 5KFGA 1S5NA 4JV0A 1OZQA 2B4UA 4TLQA 1D0EA 3PTQA 3EMQA 2N4DA 3ZQ9A 2PD9A 1EKRA 4R27A 5E1QA 3WY1A 1PL9A 3ECQA 2DZAA 3MEEA 3RB3A 1MFUA 1M5VC 1JYWA 1EYWA 1P4CA 1TV8A 5AC6A 2V8HA 6ENLA 1VK3A 3US5A 3TA2A 5AXNA 4LF7F 1FCVA 3HULA 5HO4A 5K7JA 2G13A 1E0TA 3I56S 3DCPA 2ZH6A 1FO1A 2WVSA 4M6QA 1RACB 3AALA 5F4SA 2W7PA 1ZTWA 4ATLA 1PILA 3BLEA 4LC6A 3HSDA 2ZRZA 1NIUA 1REGX 1XNRJ 1EJ7L 2RQ4A 3WUEA 4KEVA 4DUWA 2V2QA 1T05A 4S3BA 4ILMA 2KZHA 2VL1A 2RH3A 4OI3A 1Q2RA 1WTFA 5A8WB 3W85A 3M8WA 3TEGA 1C7TA 1DQXA 5JUMA 1U1LA 4JNZA 4R7OA 1LTDA 3I5BA 1LXNA 1N48A 2BP1A 1UP0A 5DMMA 5DBTA 3G1AA 4A35A 4OX8A 3NSXA 1NJZA 3HB9A 1DE5A 3MAAA 4ZMMA 5BXIA 3M6XA 3WUGA 1W3TA 2LFVA 3SN1A 1U7LA 3MPWA 2IHR1 4JIEA 4LR7A 1U1MA 2CQ0A 1XUZA 2L41A 2BASA 2YB1A 4N4PA 3L12A 3UWZA 3JQMA 1WTBA 5TAOA 4FXSA 3F0NA 1EP2A 1FDZA 4GABA 2FKPA 3GX9A 4GXPA 2NQ9A 1EJVC 3D46A 3HHLC 4K5SA 4O0NA 3MMAB 1AL7A 3MM7A 4Y65A 2K3KA 4AZCA 3CCZA 3ZVIA 2EW9A 1KA9F 2YLAA 3CJ0A 5HQMA 3QRRA 1GT8A 2LQJA 1NTHA 3HF5A 2VFFA 1Z69A 3TFXA 2V2HA 2WBMA 1X7IA 1VP5A 1I5OB 4J9QA 1V77A 2YL8A 1S97A 4ORMA 1QTMA 4JV5J 3QIPA 4FZVA 4P6QA 1ITCA 1DJZA 1TV5A 4DF1A 2YKAA 4JTRA 3W2NA 2CPEA 5HBMA 1GXUA 3TJ9A 1K7XA 3WG6A 2DH9A 2PDLA 1K6WA 5BRBA 1KCZA 4FF5A 4A22A 4OYMA 2YB4A 3UVJA 4Z0SA 1XV8A 3FC9A 4Z2KA 1WD6A 3W22A 2ZWYA 3BICA 3VUSA 1PVNA 4XG1A 3BOXA 1UR3M 4ZMGA 3LCLA 1FX4A 4DLFA 5DQHA 4DBSA 1Q4WA 4QYZK 4ML4A 2FJKA 5C42B 3G6MA 1RTZA 3LU2A 1EKOA 3KNGA 1TTPA 1WEXA 1VLOA 3WQ8A 3QZ7A 1FKPA 5E33A 3UCDA 3BL3A 4O10A 3EX3A 4MB3A 4NJIA 1OCJA 4QJ5B 1FCQA 9CGTA 1REVA 4PFHA 2E9RX 3G8QA 4ZODA 4J9NA 4I7UA 5EDWA 2VJVA 3SGGA 1BGAA 1DJQA 4QLJA 3EX2A 3NQ6A 4GX8A 3IBCB 1S1WA 5CABA 3QC3A 4W88A 4USUA 1HI8A 3AS1A 1URRA 3EWYA 3RHGA 3LCHA 3VM7A 2I38A 2BKOA 4OJ3A 1FDNA 2MLZA 4HPHA 3BC9A 4ZL1A 4RE3A 2ISFA 2Z0IA 4QIWD 5CGTA 4NLPA 2FVSA 3OZMA 4P2MA 1BFNA 4PUJA 4A47A 1IQTA 3WF4A 3BW4A 2ZUSA 2G0WA 4K4WA 4A21A 1Q1KA 3MUXA 4N0RA 3JQJA 1TMLA 1H7XA 3EMTA 2H6RA 4J9UE 3NURA 1UPMB 3GNDA 3LCIA 1CX9A 5KT2A 3TX0A 3C14B 4HEA9 4JFUA 3KZSA 1DHPA 3PZ9A 5E0KA 2ZITA 1O94A 3KL3A 3NL3A 3F73A 3ZT5A 4TYBA 2OGJA 1HBOA 8RUCA 2WLYA 1ICEB 2HFNA 1Q13A 3K57A 1SR0A 3N9SA 3ISNC 4BHQA 2QCDA 3CDBA 5FOOA 2E6AA 5C9XA 1E40A 3KWXA 1E6VA 1MZHA 2NQJA 3OFEA 4LFCF 3PNIA 2ZJPQ 4IOCQ 1FA0A 3PW5A 2AJQA 3DXIA 2DQWA 1X5PA 2OSYA 1JNRB 1RUSA 4OOZA 1QW7A 2V8DA 2N4CA 1J5EJ 1P43A 5T91A 3GVWA 1V6HA 2VFVA 1TKTB 4EK2A 1KR0A 2B43A 3BURA 4LBSA 1P0DA 1B0VA 1TMMA 2DNPA 4GUFA 2JIEA 5BMXA 4LSBA 1JQVA 3QIDA 1AH4A 4P71A 4GXMA 3PUDA 3BREA 3F44A 2JVOA 2DIJA 1R86A 3LPGA 2A10A 3W2VB 4CRJA 3N34A 2YWWA 1GORA 2XYPB 1IF2A 2VZSA 4LUYA 2WONB 4I4BA 4ZVPB 1BAGA 1EB3A 3PYFA 2W1BA 4ECUA 4IJRA 5D4LA 4N7QA 4AY7A 2V38A 4L5ZA 1H38A 1WXYA 1ZPWX 4U5KA 1YJTA 3IK4A 4CNYA 5HXMA 3RW6A 1C1CB 4JV5F 4Q8UA 1N88A 3N19B 2CJBA 3W1QA 2FLOA 1HO1A 3T1HJ 2EK6A 2E68A 2PDWA 4CTAB 5HINA 2RF2A 1JAEA 4JQAA 1FERA 3UZJA 2DRDA 4GYPC 2FYMA 2R24A 3PTMA 3KUHA 3E6EA 3LCXA 2PSZA 2QA4G 3N25A 1JGMA 3Q58A 5A8MA 3UVIA 1FHTA 4DUVA 2J5AA 5CZXA 4RW5A 7REQB 4DV0J 3CD6S 2Z29A 4L9ZA 5ETVA 2KAUC 5AVHA 2Q3PA 5BXPA 6FDRA 4Z08A 2FGLA 4W5ZA 3HK2A 1Q4NX 3TLLA 2LXIA 1WWHA 4PODA 2XTJP 1PAMA 3ABQA 1GAOA 2KKHA 2VEKA 2ZZTA 3OL7A 2ZFAA 2PTDA 4RX0A 2W79A 3MAQA 5I3PA 4HKQA 1A7GE 4AEOA 2E6FA 1WUUA 4NMXA 5F8MA 3B9EA 4HTBA 3USZA 3PM9A 3MURP 4LFYA 2B7CB 4AUBA 3T4WA 3WD1A 1VRUA 4KGLA 4KIEA 3AUJA 4H4OB 1G7UA 3NR0A 3SSRA 4MFBA 4DUZJ 5I03A 4DLMA 2DY1A 2R8KA 5C2XA 3SRHA 4MYUA 3U6WA 3WYZA 2F38A 4F0LA 2X3GA 3H2OA 3JTNA 4GH1A 3T2QA 1CS4A 3P3DA 4WK3A 2UY4A 3EDFA 3G82A 4P7OA 1OX6A 3N18A 4K4ZA 1V6UA 2Z57B 3WQDA 4BDPA 2GOUA 4H04A 2X7WA 4B3SJ 5LA1A 2NPIA 3M6DA 1NJJA 2J9DA 1LBMA 3V6HA 2ZRWA 3PX0A 3FAXA 3L68A 2VB6A 4O1BA 4TOQA 4KH0B 4HYWA 2UU9J 4Q6XA 3E2VA 2QN6B 3O7UA 2B51A 4PG4A 1SJCA 3MZIA 3DBNA 1H41A 2WC7A 2YKNA 1A3XA 5E09A 2BSLA 4KT2A 2Q01A 3OFGA 2W8LA 2CPFA 3IA0A 1YMYA 2PDHA 2OIHA 2J8SA 1HL8A 2ZXQA 3ARWA 3MPDA 3CB8A 1P5BA 2WBKA 3SCRA 3W70A 1JKHA 3EYZA 5D8HB 2X42A 4MYTA 3WNPA 4R8UB 4LNYA 3A8KA 2VC1A 4DO4A 5ETTA 2AZ1A 3GDRA 3NVDA 7ODCA 1AJZA 3SV4A 2CIMA 2UXDF 4L4PA 3VOFA 5J2NA 3O0KA 6XIMA 1TB3A 3ZZUA 2GGPB 4C6KA 1ULRA 3W83A 2DR8A 3RIKA 1SJFA 5HA7A 4G3IA 2ZFHA 3IC1A 4Z1YA 3KK2B 5CJNA 4GQRA 4URQU 1KWKA 3O16A 3N11A 3C5QA 4EMDA 4D1JA 2HVDA 3NL0A 3QVQA 3UNDA 2EO7A 2C79A 2PDGA 2LEPA 3T2PA 1UFKA 3P60A 5H6HA 2HPUA 4ROQA 3WQGA 3ME3A 4JR5A 5IRPA 2YNIA 1GHSA 4X66F 2W6RA 1HL2A 1SCJB 1FUYA 3MOZA 3SIPB 4ER8A 3MXHP 3H70A 4HT3A 3R3TA 3APYA 4R85A 1YWXA 4A2SA 2IDLA 4J5OA 3BLFA 2E7WA 1U1UA 2Y9HA 1B7FA 4TX8A 5DDQC 4DAIA 3S5YA 2YVSA 3VQTA 3J7YI 4KGZB 4S39A 2PLKA 4IIFA 1VCGA 5ABHA 2DGVA 1EXBA 2LU1A 3VOHA 5T41A 2NSBA 1QATA 2DVIA 1RR2A 3DC0A 4ZOCA 2V5JA 3DYPA 4J3UA 2BXYA 4LTSA 2I6WA 4Q8NA 4HU8A 1ISYA 3MKVA 2XVPA 3KRSA 1N54B 3NNAA 1O5KA 4ZCMA 1F3EA 3FJ6A 3MMBA 2EWHA 2GVJA 2WM0A 1TZZA 1ZHAA 4P2VA 4NI2A 4C6EA 5KTLA 3FVYA 5D77A 4F8RA 2NZLA 3PHTA 1L5UA 2DGOA 1CGWA 3WD0A 4NYOA 4WGXA 4LU0A 1X6NA 1EDTA 3ELFA 3COTA 2RVJA 1D7FA 1FWTA 3AJ7A 3DOPA 1MW1A 1RAEB 4RNHA 1FFQA 5CYQA 3B4YA 3K5NA 1VS1A 4OT7A 4ID5B 1M5PC 4UIOA 2JBMA 1V3MA 2OVLA 2NCKL 2DT3A 2RQCA 3CYVA 1Y10A 1IKVB 3H4DA 2G0CA 1ZA1B 2V4QA 2INZA 3OTRA 1HL6A 1VPYA 4W84A 2MQOA 1LQ9A 3D54A 2JKAA 3HVTA 3NBPB 5HSPA 3CWHA 2EKYA 1M5SA 2ISVA 4WYLA 2OMOA 4HH1A 4ECRA 2GVDB 3OGVA 2QL9B 1GKQA 2NVAA 2EPKX 2J74A 2DZSA 5AOUA 1ZBKA 3UXAA 3NP5A 2J6SA 4O19A 1VIWA 2JZ5A 5AJ3J 2BZNA 4DPUA 1RBOB 4HLBA 2QMWA 2IPGA 6ALDA 1L6FA 3KHGA 4DU8A 5HJXA 1XC9A 2QF8A 1S5WA 4MVAA 1I1WA 3LGNA 4CKQA 4XZLX 3VD9A 1K9EA 2DISA 3R97A 4CQDA 2WJEA 2YPYA 4A4JA 1XD0A 2BKPA 4NLSA 4EU0A 4UOGA 3NNHA 1J01A 4C6NA 1JJ2R 3PPGA 4MAKA 1TYGA 1KD1T 2XH0A 2GIFA 1GNXA 4WFXA 2QF7A 2PZ0A 5DCDA 4N9CA 1HQ2A 2Q6BA 4GBUA 4L4LA 2AJ0A 1BF6A 3N6HA 2CQ2A 2VG6B 4WWSA 3U5YA 1FNOA 3QLLA 4C6OA 2BX6A 3W7EA 4S3FA 5KFUA 3MUTP 4TU7A 3M8PB 1ZNNA 1Z89A 4C6IA 3P8BB 3OVBA 1U1PA 1MUWA 4KKOA 3H55A 3OFFA 5K8NA 2YSWA 1MQQA 5MF5A 3EDQB 3PZTA 4ZA0A 4OE7A 2KU7A 2VBYA 4QW9A 1RWKB 3QO9B 3R4IA 3BCDA 1M90T 5I3GA 3UA3A 4LR9A 9ATCB 3UJRA 1ZAWA 2QIIA 3CUHA 3AYSA 5JBEA 4RU2A 2VODA 1T9WA 4HQVA 2OYKA 5GJMA 4DR4J 4PEKA 2GK1B 3HMCA 1BE4A 5A6PA 1GOKA 3IWNC 2QT3A 5I3DA 5E0CA 4WCJA 4RXGA 2YNHB 3UJ2A 3M0YA 3MV01 8AT1B 1JPIA 3KCOA 7REQA 4KPLA 2VGBA 4YOEA 5JH1A 4IFRA 1T0TV 3UN5A 1RH9A 3T1AA 4RDZA 1IWGA 2QJNA 4PMQA 4LRBA 2XPKA 3IV8A 2AEJA 3CM4A 3EA2A 2DZBA 3NPUA 5L38A 1Q8IA 4HOWA 4AZ5A 1CXFA 1WQ5A 3D3CJ 2KFZA 4MKBA 1GVIA 5KFVA 1BKHA 2D2OA 5AFDA 6TIMA 4PG7A 5HI7A 4I7VA 4P2FA 4ED6A 3EPNA 1X4FA 1NDPA 5CD4A 3ISZA 5CCMA 1VBGA 3VK5A 3Q45A 2A1BA 4NAFB 1NB2A 2CLLA 3GWCA 4F9DA 4UB9A 5E6ZA 1JUBA 1S1VB 1NHUA 1E51A 3VNIA 1RT4A 2B8QA 1KRMA 3CMJA 3DM2A 4OBSA 4TMCA 3V4IB 4IQLA 1RGVA 2INEA 1V9OA 5D9NA 3F56A 1KM0A 3HF3A 4JTHA 1S48A 1X1ZA 2GZOA 1UVMA 3S8HA 1EH9A 3OUYA 3UGRA 3GP9A 4U7UK 2IMRA 4IF2A 5F2MA 1UCWA 3VMNA 1T40A 3AIUA 3AQOA 5E2QA 1NSKL 1UEVA 4LF9J 3FHAA 3ABZA 2P5NA 1ZY9A 1E3ZA 1XH2A 2OPJA 1OJ4A 3GVGA 3UXIA 4JY8A 5ETRA 4PCNA 1KFEA 3CYJA 5DQIA 1REQA 4M81A 3HXMA 5DY2A 3TAQA 1QO5A 4Q4KA 2VJUA 1N8FA 5AN7A 3UPBA 3TYBA 3T9PA 1TV6B 2P9EA 3GU0A 2RSQA 1KFWA 1YW1A 5KFEA 1D8CA 1KVKA 5L9FA 3VNYA 2Z1VA 1KQFB 4GY1A 1FJ7A 5F9NA 3TUPA 4DV7J 1JLGB 3ABRA 5L6UA 1MW3A 4AL7A 1OSEA 2AMXA 2XYLA 3VV2B 4EBEA 4GISA 3PPCA 4DDFA 4BY3A 4OZ5A 3TZWA 3VTIA 3W6LA 3WMBA 1RWMB 2IAJB 1FXQA 1RPKA 3P6LA 3VGGA 3G82B 2CUYA 1XTZA 3JAMU 2J8TA 4IOAQ 4RW4B 4USKA 5IDZA 2GO9A 4PE8A 3A3PB 4U31A 4LF8F 4HCHA 1T7PA 4DUTA 2AKZA 3UG4A 3FCVA 2PAJA 4AXIA 3GLJA 4QG9A 2ADCA 5DCBA 3PIPQ 1FP9A 4R9XA 4JKMA 3VAVA 3DGPB 4BQ2A 3HQ1A 2FIUA 3C16A 2YR1A 2MQ8A 5AB3A 2DJLA 2AYGA 5K9CA 1IYXA 5EN1A 3OLAA 2PP3A 3K46A 4DZHA 2VRQA 3EWDA 2EKNA 2H5JB 3IIPA 4ZOAA 1L3KA 4XVDA 5I3QA 2J7EA 3RN6A 1HKAA 4DWSD 2H9AB 5LIWX 4XDCA 4NEZA 4X62J 1U1NA 5J2NB 2W0UA 2QCEA 3QOMA 1UROA 4YR3A 1T9YA 2IM1A 1EOKA 3A9BA 4M5HA 5IXEA 1Z4UA 1U47A 4NXMF 1L3UA 1XUUA 3CS2A 3RAQA 4MOZA 4Q8WA 4B9VA 2V2DA 5A8WA 3W7BA 3CHCA 3CQJA 3GR8A 4UMAA 4FKYA 4CNOA 2CBVA 4GI6A 3JXOA 1PXGA 3HPFA 3CO0P 2B0MA 4DO5A 4H9XA 2VDGA 1J93A 3GIYA 5REQB 2HWIA 3QQ1A 1ZUAX 4ILLA 5M2UA 4HL9A 3TJ8A 1RLCL 3OR1A 1NK9A 4JI3J 3PF3A 1O6XA 1E43A 3G0UA 5A2QY 5IQ6A 2BVZA 1Q7LB 2DNZA 1R0BG 3B0YA 3UG3A 3CL7A 3QPYA 2KB2A 2DHXA 4AFFA 1JLGA 4CLKA 3GONA 4I6AA 1TP7A 3IIXA 2LQ9A 1MEHA 4M6VA 3Q94A 1XFBA 3W7OA 2P10A 2ZZ4A 3ZIZA 3EDRB 1M5HA 4Q8EA 3PRVA 1KCXA 3GXPA 3P3BA 2H51B 1W1YA 4MWAA 3SEOA 2VM8A 4JX6A 2DVUA 3D28A 4V1Ak 3N4AA 3K1DA 3W2WA 4YMEA 5LMUF 1DE6A 3GR4A 2AEFA 3H2LA 5DZ7A 2Y8WA 1ZH5A 1ZJIA 3E9AA 5BR8J 1TL3A 3ABOA 4KIRA 4M94A 1DKWA 3UZXA 1H61A 1XYLA 1FWHC 2D3LA 1GWJA 2QAFA 4C7GA 2DORA 4EIVA 3DMJB 3PTWA 5E3AA 3R8YA 4JI1F 1OG0A 3CSKA 1AQ0A 4AUKA 5GNXA 2JHEA 4DJDA 4LYKA 1T41A 4O4GA 3L4ZA 4Y2IA 3U27A 2I7GA 4G2DA 3CJTA 3U02A 3KRUA 1UWQA 1W3LA 4ICLB 3R8HA 3EZ4A 2XSJA 2VV5A 4HYRA 5KFBA 3I3EA 3L0KA 5GAEU 1XWYA 4MK9A 4GO8A 1QK2A 2GJXA 2NXHA 3GHRA 3VKCA 3B0VC 1UFWA 4YQWA 4GI4A 1T03B 3AT1B 1PDZA 4O0ZA 2INFA 2PI5A 3ABSA 5GMEA 1ALDA 5K4ZA 1LBLA 3B0UX 1OGGA 3OSPA 4RW7B 5EMKA 5JVHQ 1LORA 2LLEA 1IIGA 2VASA 4N76A 2HMCA 3EPOA 4DYJA 5DELA 4QITA 1WDRA 3JRKA 3BV4A 4OLOA 3O5TB 1MEWA 3SIZA 3TQVA 3NG8A 1D3CA 2R8HA 3PAOA 3PTDA 4DHGA 3BSOA 3E01A 4E2FB 3CUGA 2XWXA 1TKXB 4DV2J 2AV5A 1YXCA 3AA8A 2QCDB 4WR3A 3OT9A 3TO8A 4E8CA 3A24A 4WFYA 4AFYA 2H1YA 3P4UB 2OZTA 4M82A 1ISXA 2KVQE 2IQ0A 3CXOA 1W26A 3VVGA 2V2VA 2ASJA 4MHBA 3TYDA 3D0GE 2V3EA 3JS3A 4JTJA 4O13A 4PXCA 3SCLE 1DWAM 1XYCA 3VDBA 5DO2A 1FFWB 4F4AA 2FYXA 5E6YA 4K0KF 2UXDJ 3FSYA 4D8LA 3T41A 4L73A 2RNEA 1NZ8A 1G01A 5AXLA 1A3WA 2M2BA 2J7GA 1SMDA 1OZMA 4GLEA 2KT5A 1XJWB 2Y1HA 2HNHA 1DTTB 4U4MA 1M03A 2AMGA 2HNZA 1G3OA 6XIAA 1JEZA 1O0PA 1B4SA 1TWWA 3F7JA 2UXCF 2ZX7A 3GW3A 3NYDA 5CCZA 3GJTB 3N4EA 3GCXP 4MIAA 4HPNA 4D6EA 3K8WA 1U1KA 4JI3F 1HNVB 2VEIA 1JLBA 3XIMA 3GBEA 1RADB 2GVDA 4UF4A 4C8OA 5H1SV 3B97A 2D20A 1ZAXA 3CUFA 4I64A 4QIFA 4F3MA 3GM8A 2C3ZA 3GVRA 5T9BG 5B08A 4M6PA 1ZRQA 3QEZA 4ZXLA 3JR2A 4F40A 2MZJA 4U3AA 2RGMA 1OB0A 4E8GA 3UEQA 4W86A 2XIJA 4AQYJ 2E1PA 2ABYA 1FCUA 2Z4PA 3TA1A 5KT6A 3D6NA 5CH7B 2Q71A 4IP4A 4NIRA 1KN6A 1IT0A 2ZDPA 1N33F 6REQA 3S7RA 6PTDA 5AYZA 1BSIA 4OV6A 4MNKA 1FD2A 1PBUA 3K13A 2BANB 1AZSA 2ZA3A 5EFFA 3WQFA 2K7JA 5A1AA 5M2PA 1PZ1A 2XN0A 5D8ZA 1B2YA 4ADSA 3N9UC 5SUHA 3WNOA 4O17A 4YHEA 3LG3A 5EGRA 1F9CA 2FLPA 1VQSA 4EPEC 4MG4A 4LAMA 2XLJA 3KJFB 5DN1A 3KJVA 3DKJA 2CDRB 3CWOX 2Y5JA 3G96A 3ONBA 4Z0JA 2OD4A 1HBNB 4KKXA 4AAJA 2D69A 2DIUA 3M8PA 2CPXA 4UUIA 1RQEA 2POKA 2IMWP 2J79A 2NSCA 2AMCB 4ZPTR 4UWMA 3H2MA 2QL5B 4GZEA 1O95A 3WLQA 1ZAJA 3LGEA 2YJQA 4LY8A 1U83A 3KLFA 1HJSA 3OTBA 1R0AA 1C8VA 3T07A 4DV6F 3WBEA 3Q2DA 2HMIB 1EXPA 4IFOA 1JJ4A 1TV4A 1E6XM 1B3VA 1TL1A 1KWMA 4NX9A 1HW8A 1GJWA 2OFJA 3LY0A 3SQLA 3DAQA 5BOOA 3HPOA 3AU2A 4LCRA 3SO7A 2A6MA 3HSGA 2EC0A 1GCYA 2BWGA 2ZZ7A 3I31A 1TVPA 3HI9A 2VMFA 5GMKa 1Z32X 1JJCB 2D3UA 1MNZA 3TQEA 3T6BA 1YTYA 5IT4A 4K36A 2N3LA 2FZGB 1G67A 1RHCA 3E2SA 1NOFA 4HZ6A 2Y8UA 3SI9A 2KG0A 2AP6A 2UUCJ 3DYOA 1YBUA 5KSWA 4ES1A 5A6BA 1MMFA 4POCA 1CGTA 1J5TA 1FRLA 3BO9A 1UR1A 1TAUA 2OKOA 4QPXA 3L7RA 3SCJE 3W2KA 1U0HB 1EC9A 2WVVA 2JE8A 3FKBA 2GGIA 3I9V9 4H6RA 1F07A 2OQHA 2YXOA 3PO4A 1XLHA 3CBWA 3CV7A 3M16A 3K30A 2ZUGA 3EWGA 4HPJA 1ECEA 4KWSA 3FOKA 4B3LA 4EYHB 2MKYA 3BGAA 1NH6A 3LUTA 2RDXA 2AL1A 1UR8A 4PL1A 4UC5A 1NVMA 2JFDA 2GSJA 2PDBA 4LMZA 3CPWR 1EHWA 4K7YA 3GFYA 1SO4A 1RTIA 1GMWA 2PGCA 2R91A 4ZK7M 4MTPA 3E96A 4RV3A 4K7VA 2BANA 4I9JA 2D41A 4PTNA 1F8IA 2BBFA 4JCLA 5A0YA 1H09A 2CLEA 3RITA 4AIEA 1LOUA 2F8MA 3UJSA 4FF1A 4RBUA 3CT2A 2KFYA 1SKUB 1LG1A 1B5TA 2VG7A 3MM6B 2TODA 1S9GB 2B6AA 5EFDA 3N2TA 1R31A 1TA3A 4BJHA 2GQCA 4P7NA 2CNOB 3DERA 1W9UA 2G4FA 5EWEA 5D33A 3ZNJ1 4NLVA 2GNKA 4N8OA 1JD7A 1FFSB 2KH9A 3RNDA 4MWAB 2OAUA 1X5TA 5B7WA 1A5LC 2B7BB 2P50A 3VMPA 2QEZA 2FDNA 4F4RA 1EGZA 2VEMA 3RJYA 3MM5B 2J7CA 4HU0A 3ARXA 4LUJA 4US5A 2PDXA 1VGYA 2B6AB 3MD1A 4M1KA 2V8GA 4C48A 5A8KB 3MUMP 1M7OA 4JV2A 1GX5A 2Z28A 1MW7A 3MDFA 1TR1A 3WK2A 2PZNA 1GQLA 1VFTA 3FA5A 1S7IA 2ZICA 3NGDA 4ECVA 3T7VA 4D6DA 3AB4B 3NQGA 1IGSA 4A05A 5M17A 1LJYA 3N2CA 4LQ1A 3KMQA 5KG4A 1FXPA 3CB3A 1TFYA 2MLYA 3KBVA 1HKWA 4WXOA 2VZ9A 2AEMA 1OVDA 3B9NA 4Q8OA 3BSGA 1XISA 1GVFA 3BZGA 3GD6A 5HPOA 5GAHI 2E3ZA 3QV6A 4RUHA 4J9JA 2R14A 2Y8YA 2HNEA 5A3HA 3M0ZA 4ZO6A 1G0CA 1V3LA 2AX1A 3MR7A 4K4XA 1LOSA 2FTPA 3GTXA 3BF4A 3UXKA 2GQ3A 4AZIA 3KWMA 3OVPA 4NA1A 3CT7A 4LJ3A 3OXLA 3DFOA 4JFTA 3K89A 5CJMA 1NUEA 1RT5B 2YTCA 1MUMA 2E29A 5IHSA 3U9IA 2XMWA 4CCHA 1O60A 4B02A 1WO2A 2D2HA 3IAQA 2O5DA 1QOQA 3DHFA 4U95A 4UFMA 4DL4A 3MV11 1CJVB 1LWJA 4YVPA 2E7XA 4BI5A 2IVMA 4WIIA 2PO4A 2OTJS 2NQHA 3LP2B 4DS5A 3C6UB 1UMLA 1XEZA 3RM4A 3GFZA 1T03A 3G1YA 3TW9A 2X30A 3HBLA 4AU0A 4KS0A 5REQA 1X7VA 1CLKA 4M5IA 1WC3A 3G6LA 3P81A 3LERA 2V94A 5LGXA 1IR0A 1CYGA 1F5CA 3SCWA 2HHWA 4GI9A 4OYAA 4C7DA 2UXBF 1OFPA 3MC5A 4WE1A 3EX6A 3THPA 3W8GA 3TU9A 1GJUA 3FS2A 3PZNA 1W1VA 3C14A 5AXMA 1H0GA 1ZJAA 3BAJA 2IA0A 3KCJA 2VICA 4LRTA 5EMMA 2XSXA 1KS2A 2JL9A 3UD6A 3GJRB 2ACUA 1BWEA 5F7UA 1XRFA 2CXGA 3OLEA 2FY1A 3LM7A 4PGLA 3WLKX 3W64A 3DENA 1VRXA 2CYGA 2ATCB 4TYAA 1OT2A 1EC7A 4DN0A 5FEPA 1VIOA 1WHXA 4DX3A 2E5BA 3DOKB 2E5IA 2ADAA 3VFLA 3DRYA 3Q86A 4JNYA 2OPQB 5HMEA 3G18A 2R1MA 4Z2JA 4USJC 1QNVA 1VQTA 3W2MA 4EANA 4NRUA 4ED8A 2BR0A 3EPMA 3GTNA 1UKOA 4YL2A 2A6OA 3F4DA 5FKYA 1EETB 1CJUA 4JI6F 2C8NA 1OHLA 4O16A 3LS9A 5A6AA 3TNVA 3TQ0A 3CZ8A 1VLIA 3MB9A 1S4FA 2VKRA 4KFPA 3IUIA 4CEUC 4Y00A 5DRIA 2ABAA 3V2UC 7TIMA 4X4OA 1IWBA 3KVJA 3AJ1A 4YY3J 5A76A 2QCNA 4WJXA 2HEJA 2NXJA 1DXEA 4IGMA 1SV5B 2E1MC 2E4TA 3NL6A 2V2ZA 3I0RA 1VRTA 1KQZA 1VOMA 5K5MA 2HK3A 1YADA 3V6DB 2VZVA 1WF2A 4A6GA 1O7AA 2XZTB 1FI4A 4XAKA 5ABGA 1S1PA 5DM7Q 2HNZB 2QPXA 1YBAA 5HVHA 1Q7YT 4GVL