3WQPA

Crystal structure of rubisco t289d mutant from thermococcus kodakarensis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFDRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
publication title Mutation design of thermophilic Rubisco based on the three-dimensional structure enhances its activity at ambient temperature
rcsb
source organism Thermococcus kodakarensis
total genus 149
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3wqpA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3wqpA01
1RBLA 1GK8A 3AXKA 1UPPA 3KDNA 3A13A 1RBOB 2D69A 1AA1B 3RUBL 1RLDA 3KDOA 4F0MA 3QFWA 3ZXWA 4LF2A 4HHHA 1BWVA 1UWAA 2RUSA 3WQPA 1IR1A 1IR2A 2ZVIA 1TELA 1UW9A 5HJYA 3AXMA 3NWRA 1IWAA 1UZHA 2OEKA 5HQMA 2CXEA 2OEJA 2V67A 1SVDA 4LF1A 1UZDA 2QYGA 2V68A 2V69A 1EJ7L 5C2CA 5RUBA 3RG6A 2VDIA 4NASA 5HJXA 1AUSL 1RXOB 2OELA 2VDHA 5HQLA 4F0KA 5HK4A 1RSCA 2V6AA 1GEHA 1WDDA 3A12A 2V63A 1BXNA 2CWXA 5HAOA 4RUBA 8RUCA 5HATA 2YBVA 1UPMB 4F0HA 1YKWA 1RUSA 1RBAA 4MKVA 5HANA 1RCXB 2OEMA 3FK4A 9RUBA 1RCOB 5C2GA 1RLCL
chains in the Genus database with same CATH superfamily
3G71S 2CQHA 1NKCA 3ZZYA 3GVWA 1UVMA 2ZA3A 2WJFA 2M4MA 2IBOA 3TSDA 4X9SA 3CUGA 5LSLA 4U7UK 4O3PA 4Q2LA 5KFMA 1HL9A 3SV4A 3RLVA 3TYBA 1I94J 4YB1P 3SO7A 2AJ0A 2C1IA 2QV6A 4WHBA 1NK8A 2VVNA 1MMNA 5IFPA 2ZOGA 4EI2A 4F25A 1RT2A 1A5KC 4BY3A 1DIDA 3MHFA 3U7BA 4I8YA 1WKFA 2I0XA 1FWSA 3N34A 3CZGA 3R2DJ 3UESA 1P43A 2LXFA 3MM9B 5IM0A 1HBOB 5BXRA 2QT3A 4MZYA 4MAKA 4LF4J 1MFVA 2AHOB 5HDRA 2B0MA 1OT2A 3HF5A 4BWLA 1SUXA 4PUUA 1ITQA 1FDBA 1IGWA 2WONB 3UETA 2BXJA 5K8OA 1E9IA 1OYAA 3ZNUA 2Y1JA 4GC6A 1SC6A 1QBAA 1Y7VA 3V6HA 5MHBA 4MK7A 4LUYA 4X4PA 4FNHA 3RRXA 1ME8A 2GOKA 2DSWA 4NCGA 1WDSA 3W7BA 1T03B 4GO9A 4B9NA 1FF2A 1WG4A 4LF8F 1VEOA 5BU9A 3ID7A 3I6PA 3CV2A 1VKFA 3TV8A 2W25A 2VDHA 3SY1A 4D2JA 3PWIA 4JX5A 2M0GB 4TX6A 2AEFA 4TXEA 1U2YA 1Y4ZB 4MPQA 2JLEA 3F1QA 5EMKA 1EYWA 1DQAA 3W7EA 4G1IA 4AFYA 5GADI 4ZO9A 1FCVA 1V6HA 2E40A 1OFEA 4JIEA 2BJ3A 1SKRA 1U1UA 3WLIA 2AIRB 5IDIA 4F0HA 1MLAA 2XVGA 3QZAA 2Y85A 3BSHA 5F0UA 1PYTA 2QCDB 4YPJA 2DZVA 2OIHA 1ISVA 4L80A 4P8WA 3VKAA 3WQEA 1F3VA 3UR8A 4KFNA 1EIXA 1RWNB 2CPUA 2F6KA 4WYLA 3URQA 1REQB 3F4NA 3QXBA 3CDAA 4N42A 3EYZA 5F2LA 1RTDB 4D8ZA 2V2ZA 1YADA 3W71A 1HI1A 1E0UA 3MS8A 3PW4A 4X65F 3COTA 1P1MA 1B0PA 2FLOA 5L46A 4GVHA 4YHHF 3W6LA 4GKKJ 4OZLA 3SYZA 4GFSA 1B3TA 1Y0EA 4J28A 1BY9A 2XVLA 4D1IA 1K6WA 3R25A 4U31A 1JCXA 1EEPA 1GX6A 3MKKA 3P4UB 1LWEA 3TN3A 4HPHA 2MQNA 3MD1A 1S1VA 4RE0A 1R85A 3JVAA 1FTRA 3I96A 5E3AA 5GMEA 5H2ZA 3TW0A 3AY0A 4V19X 1KC7A 4LJMA 4IQJA 3W64A 4K4SA 1GYMA 4WKAA 3VZIA 4N7QA 5A8KA 3QJJA 1JFHA 4LYQA 2GUYA 3PB0A 1VI7A 1J10A 4QEEA 1UH3A 6CGTA 4JYAJ 2OR2A 4F0RA 1B31A 1UAWA 3KLHA 1CS4B 2VH7A 5A6PA 3GSMA 3EEZA 3UQNA 1TZ0A 3TA0A 3WZ0A 1CCWB 2CKSA 3G82B 3L7PA 1T11A 3MR7A 4FX8A 3BWWA 4DUYJ 3I3DA 3O44A 3I10A 2CJBA 3CHVA 2EQDA 2A1BA 1IQZA 2FPVA 3TJAA 4ZENA 1JCTA 4B5XA 4F9DA 4WKYA 5KFOA 2XO7A 2W5FA 1RT6A 1CGWA 2OELA 2BGNE 4DPQA 1QBBA 3EKGA 4LF7F 4QGCA 2QA4G 2Z1WA 1CNVA 4M8UA 3TEVA 3MVIA 4MHBA 4L61A 2DGWA 3NG8A 4USHA 1SFJA 1Z6KA 4RNOA 4U5IA 3IMQJ 3T5LA 4QR0A 2LFVA 4C8KA 4K5SA 3CMES 2Y5EA 5FF2A 3W82A 1C1CB 3A8IA 2VEGA 1TCDA 3W62A 5LXEA 1YK9A 2EG1A 1W1ZA 3CQJA 4XZBA 1R8CA 1JNRB 2PI6A 2OFHX 2I57A 2OI2A 3N14A 1QWGA 3EB3A 3FEQA 3HO8A 1YRUA 2EXOA 3A5VA 1M68A 1UD5A 3HPSA 5GVQA 3G8EA 5HO4A 5A76A 1XIHA 3AHVA 4C1KA 2WTFA 1H0IA 4DHVA 1G7CB 4FVCA 2OPJA 1H7NA 3B9DA 4Q7BA 4IOAQ 3MY9A 1S1WB 1ICEB 3I6EA 2IKIA 5BYWA 2QMWA 1IVZA 3DFPA 1F6YA 2DGOA 5JIPA 2WOMB 1K7XA 1I45A 3NOEA 1ZZNA 3GCXP 2Y1HA 1TP7A 4QAWA 1U2CA 2BNJA 4ECTA 4URGA 4W98A 4DR1F 3CJKA 2HHXA 3O06A 2QCMA 2BXVA 1EZZB 4A8RA 4HQVA 4MLJA 4M5MA 1GW9A 4Z1AA 1NWUA 4WSHA 2ZJPQ 1ZQ5A 1UBSA 3UA4A 1TR1A 5BR8J 3N13A 4S3EA 5KFXA 5GQBA 1PILA 4P2SA 1DEDA 1S0OA 4HKQA 2E1RA 2POZA 4DL2A 1E4IA 3E2QA 2DYAA 3IFEA 1NBEB 3MV11 2EPNA 3G1SA 5LXRA 2PGRA 1DWJM 3OFFA 1RCQA 2OJ3A 4ERAA 4N77A 4AWSA 4GJ1A 4WKFA 1EH9A 4D6DA 3VD7A 5HMXA 4UT4A 1IBKJ 4KERA 1S9EA 4H4KC 2AMCB 3GXPA 2ATSA 3DYOA 4LR7A 1H3DA 1KRMA 4M5DA 1XLJA 3NVDA 3FJLA 1W1A1 3TKFA 1YIXA 2PLMA 1QI5A 4MYXA 2BY0A 1Z2LA 1V3RA 1AUSL 1JUKA 3NGTA 3UCUP 4AD3A 1H62A 1QDSA 2CWKA 3VKJA 4AHOA 1RWWB 4DJDA 3XISA 4I9JA 4HN8A 3TYAA 4NI2B 3B8IA 2WKLA 2E1AA 5FI8A 4RPQA 5A94A 2DKOB 5C5YA 4L76A 2WJDA 5K9XA 1G7UA 3VCRA 1D8YA 2RS2A 2Z2ZA 4TU8A 2YBVA 5J1EB 4MIWA 3JSBA 3ZZRA 1M1BA 2PTYA 3S83A 2BUNA 5DXXA 4YEAA 2XH2A 3DFTA 1FK9B 5IBXA 3EICA 3IBFB 3RBEA 3CUZA 4O12A 1XR7A 3KUGA 3C3LA 3MD3A 3VFCA 5KT3A 4ALZA 2AZ1A 1WKKA 1X38A 4BS0A 4NX9A 4H7CA 4ZOSA 4AYBD 1MEHA 2PWFA 4JTLA 3B06A 3W3SA 3AWOA 2VV5A 1S6QB 1CGYA 4BWMA 2DK2A 2OU4A 3TDFA 1F73A 3TYTA 4AZGA 2I1RA 1DJWA 3DRPA 3ZZ0A 5D32A 3QR3A 3SGGA 2ZUWA 1D3WA 1NKEA 3Q8RB 1XC4A 3B97A 1VBUA 4FNQA 4XPEA 3B9OA 3QR1A 3HGOA 2VF3A 5CKSA 1DHPA 2CRLA 3C3UA 1B99A 2U1AA 4E0CA 1WBJA 5J04A 2NUXA 5LMNJ 3NNCA 4QYRA 1OYDA 4LBUA 4U2ZA 4MIMA 4X4NA 4YU1A 3F2DA 1FHUA 2PT0A 4JHZA 4W8BA 2GQQA 4PA8A 4TV5A 1V9OA 5DN1A 1XUUA 6REQB 2Q8XA 2AQ4A 1QMLA 4LALA 3Q8VA 1CC7A 3A24A 2EW9A 2F4VJ 3TA1A 2W9AA 1RWKB 4MMOA 2PDPA 4DQIA 3NXZA 3ITHA 3V4BA 2NXJA 4KT2A 3Q94A 2NWRA 1DE5A 2HCVA 3MR5A 4N8OA 1LW2B 1KWGA 4GABA 1Q5VA 3QC3A 2ZYFA 1VLIA 5K20B 2WW4A 3WQ8A 2PWDA 3MW7A 2HQGA 1RY0A 1HNIB 4R7WA 3WNKA 5FF4A 1A5MC 5H9FK 1GMUA 4FLQA 4IG0A 4CCEA 3IK2A 3LV5A 4IMCA 5TD4A 2ROGA 4BWJA 5J2PA 2CG4A 1MMLA 2ERRA 3O2IA 2ZX9A 3HQPA 4F9JA 2VYOA 3CJ4A 1S2WA 2R6OA 1DPMA 2EJ1A 2YCJA 2OZ8A 4I2QB 2Z2UA 4GBUA 3WCZA 2ZH5A 2MZTA 3WUFA 5E0FA 2VGGA 1NK6A 5B0CA 4PWDA 4KGVB 2GSJA 4WJBA 2BABA 2VKZG 5I3PA 3IRWP 5C42B 2HZCA 1U1OA 2YLLA 3DYAB 3VCDA 1RAOA 1E9ZB 3GC2A 3E3XA 3NP5A 1LW0A 1SJBA 2D3ZA 3HCXA 5F3ZA 4WWSA 1LWFA 1OZMA 2WSRA 2FY8A 1OX4A 3HOJA 4OJ1A 2BGQA 1YJVA 3QIDA 3GIQA 1A53A 3HU7A 3PPFA 4AIOA 2IQDA 1KQGB 4OZNA 5C24A 3Q8PB 2AGOA 3BO4A 4IJBA 1H49A 2UUAF 5FKYA 3A4XA 4UQDA 1J2BA 2ACMA 2QPUA 2R42A 3W2VA 3V81B 3QFWA 1ISXA 2W9BB 4ZGYA 1UKUA 4P5UA 4B3TF 3NQ2A 1XR5A 3I5BA 2CVEA 1IHIA 3CW2C 2C71A 3DFQA 3TR2A 2DPEA 4LSBA 1DIOA 3ISIX 3X1LB 1GQEA 2VQFJ 5T91A 2WNWA 2V9DA 4YVXA 3EWYA 4EWTA 3LPYA 2NUUG 1DJXA 3MHGA 1CLXA 1O66A 1LT8A 1W1B1 4TX9A 2GS8A 4X64F 3DGBA 1UWSA 2NXCA 3CT9A 4HL9A 3FJ2A 4Z37A 1AJ2A 1N8RT 1AMKA 1O5RA 2P9GA 4ECZA 1ZHAA 4OOUA 2WB1D 5GNZA 2XMKA 2Z28A 1SGJA 3HJFA 2CQDA 2DNQA 1U1LA 3C14A 3ZIZA 2LMIA 4Q8VA 2GQ3A 1EX8A 3H5UA 4JS3A 1FEHA 4GH3A 3U4AA 1TFWA 5LZLA 1W91A 1VLYA 1OSEA 3QR0A 2IIHA 5A2BA 1FRKA 2X1GA 1S0NA 3M1VA 4B02A 4OYZA 3KK3A 3H12A 4MAVA 4Z2GA 3BSAA 3R6GB 1ZU8A 3MVTA 4IMGA 5K7JA 4M5NA 3HT3A 5IQQA 3MC5A 2HWGA 2XS7A 4YXGA 2IS7A 2G0WA 1UFWA 2FJEB 3N04A 4A8IA 3GYCA 2Z0IA 2TYSA 1RKJA 4DXLA 3NJ3A 2BXYA 4U28A 4M6PA 3SSRA 3R2GA 2YPZA 3Q83A 4TXSA 4WK3A 3TC3A 5LYRA 1T9VA 3D0HE 3PY2A 1UKTA 1Q53A 2FMOA 2VTFA 5AYZA 2R7QA 5I3UA 1I6JA 1ENUA 3B0UX 4RNHA 1SMAA 4MZ1A 1JLEB 2G96A 1JLAB 1N54B 3ILIA 1W5OA 1F4AA 3VGDA 4UR7A 1RADB 3U9IA 1P48A 4EPEC 2F1FA 4LVOP 4RL3A 4JL2A 4FX7A 3IACA 2PTWA 2AAMA 2GVZB 3N9RA 5LNVA 1F3XA 2UU9F 2GAHC 4LVNP 3SJNA 3LGGA 4ZOCA 4H9MA 4AXIA 2B7PA 2Y3YA 1FFWB 1DJHA 1DWIM 1MG7A 2OPPA 2WAQD 1TUXA 5E3PA 2ASHA 3L2IA 1UA0A 2CZEA 4EVZA 2IA6A 2REQB 1KM3A 1LK5A 4FO4A 3G9CA 3OQEA 1HW9A 3MECB 4PL1A 5EMMA 5HNNA 1Q0NA 2DCLA 2E77A 3KBMA 3PTKA 4HHHA 4H4IA 1L3TA 5REQB 3R97A 2R2SA 1V02A 1F2HA 4PH6A 2H4WB 2YVSA 2C3ZA 1HVXA 4ZSTA 2DNKA 3FCPA 3VI2A 2N4DA 2IMRA 1EF2A 1EZ2A 4J9PA 4IM4A 4K8EA 5EKYA 2ATMA 1CXLA 2B9WA 2QC3A 1LWHA 2MNRA 1W1PA 2FC8A 1BGAA 1DHMA 3VGUA 3SIPB 1S0MA 1WX0A 5KZEA 2D3LA 4Q43A 3LXAA 1TL1B 1OO0B 2E5GA 2XS5A 2HRTA 1HR0F 2GHWA 1EJSC 2ZHOA 3GIRA 2K7KA 3LRMA 4RKAA 3CD5A 2QKFA 4MGGA 2X41A 2FQQB 3BS9A 3OYZA 3ZZ1A 4WX2A 3B3DA 1N32F 3HPAA 5FEPA 4CO3A 4Z2HA 3TARA 3AMKA 3L67A 3GV8B 4F4XA 2OLWA 3W7MA 4PODA 1VRTB 1XDMA 5CZXA 1RV8A 4RNNA 4UTUA 2POTA 1UPMB 2IVYA 1JDFA 3W75A 2EI5A 1RQBA 1V3MA 2N3OA 1S49A 1U09A 1S46A 1KFKA 5PTDA 1HFBA 1Y8BA 5H1WA 4LS0A 3OHMB 5K14B 5DX7A 3BO3A 4NNCA 2F9JA 3VDHA 4AIBA 1QASA 4JFWA 1VIXA 2EG7A 6XIAA 1EX1A 5D0HA 5D0RA 1YXDA 4OZ1A 5CJ5A 2KTQA 2PC6A 5I23A 4LCRA 4QJ3B 1BF2A 3VILA 4DJED 3WLSA 5F0WA 4FF3A 2WW8A 2RDUA 4J37A 4JV2A 1NARA 1U2RA 3JSRA 1P0DA 3SCKE 1TUWA 1R46A 4JICA 5CBIA 4OYXA 1NSQA 1T3OA 4NLQA 3PBUA 1RTIB 4RW7A 4H9XA 1YJTA 4AEOA 1XIIA 4AXKA 1BMQB 1SXLA 4FPRA 3R8HA 3MV01 4M1RA 2A0FB 3BH4A 4KBIA 5I3GA 4U7UD 3HGRA 1B30A 4CNSA 1B54A 3UDEA 4ELVA 2FJXA 2C8NA 3NGKA 4HNOA 3OQ8A 1TYGA 3SQOP 3QBCA 2OQLA 3WJWA 5FCZA 2WM0A 4JI3F 2HQIA 4RCXA 4LUTB 2B4UA 4HNNA 1QPNA 1HBNB 2J6XA 3PWAA 4IMAA 5LIXX 4QYZJ 3D0GE 3LPOA 3TAMB 2E29A 2Y1LB 1ZJIA 3DIPA 3CIMA 1SYTA 1L2UA 5KZDA 2Y4SA 1IKYB 2V8PA 4WTYA 3AZSA 5H9EJ 4GIEA 5BOEA 2V69A 3LCIA 1TJ1A 4IFRA 5GPRA 2YNHB 4HK6A 1KS2A 4W90B 1P0EA 4CO2A 2ZFAA 2QHAA 4GD0A 3VX0A 4Z2IA 2KN4A 3DUGA 1GXLA 1XIEA 3TQPA 4I56A 3LU2A 2PBGA 4IPNB 2KFNA 4R25A 3URNA 3QGHA 2UXDJ 2C3MA 2XSJA 4DXXA 4W8LA 3HVRA 5EMUA 1KM5A 3MYOA 5I02A 1SCJB 2MSSA 4KMQA 1X8FA 1S79A 3EGZA 4NQ1A 5ABHA 4C3LA 4N47A 5IQ6A 2I2YA 3LA4A 4MPKA 2E5IA 1H72C 4HNTA 4C7FA 3SUUA 2YNIA 3G1RA 3UCCA 2R7OA 5A8RA 3TVZA 5M2RA 1XIGA 4TX8A 2IKHA 5D4YA 2EFPA 4DQSA 2YDRA 4B3SJ 2XDFA 4YHEA 2IM2A 2UUBF 3GPAA 4ROPA 1D2KA 2OQHA 5ETQA 4ZQNA 3OW2R 4DPXA 1JKHB 3M2UB 3GVQA 3I4KA 4UTJA 4JIPA 4JL1A 5LIYX 1WO2A 1WD6A 4Y9NA 3QY8A 4OI4A 4PULA 2VG7A 1IIHA 1HO1A 4A8FA 1HNXJ 1F2GA 3NOGA 3QPYA 3LI0A 2W2NP 2XLKA 5I06A 1RLDA 1WHXA 1SJRA 2EG8A 1E0TA 1S5MA 2DDXA 1GQNA 3AICA 3DLEB 4K4WA 4JV0A 2DT3A 1E4MM 3AOCA 1UWBB 2W7PA 4M63A 3S8HA 3Q4DA 3RAOA 1QW7A 4YN5A 3RR4A 3LBOA 1IE7C 2ZUNA 4WKHA 4YLWA 2ZVIA 3R0KA 1WWHA 5E93A 3VKKA 4CNOA 5L1KA 4XIUA 3LH2S 3AYRA 3OHIA 1H1NA 3I56S 1HFEL 3L4WA 5ETOA 3K5NA 4O3OA 1WAUA 4KBXA 1HGWA 4YCOA 3A3HA 2YWKA 4AXNA 4Y65A 5AECA 1NH6A 2CESA 3R8YA 2VPWB 2RQCA 4IOBA 4OVXA 3NNAA 3N73A 2XMVA 2VOPA 3US5A 2O92A 5J1NA 2DP3A 5D2VA 5HJXA 1OINA 1LOUA 3TR5A 5F7UA 4DCPB 3DU5A 3UDVA 1PL9A 2E1WA 3GJSB 4ICCX 4LNCA 4BF5A 2YTCA 1R89A 2FHMA 3QRQA 2C18A 1KN6A 3G1HA 3H59A 4PUJA 2AJQA 4I2PB 2E9BA 1ZPTA 4UBPC 2UXBJ 1B70B 4O53A 3CAWA 2C91A 4TU9A 4F79A 3GHRA 5HQEA 4DXVA 4MUZA 2R8IA 3LUYA 1V3KA 4O3QA 4AD0A 3VVGA 3EZOA 4JOUA 1XYLA 4PSRA 3I6TA 1REVB 3TI0A 3BAXA 2XTKA 3GUWA 1CXHA 4J4KA 1U8SA 2WMFA 2YDQA 1C3FA 3UCDA 2WCSA 1JCLA 1G94A 3WEOA 2HNZB 3GWCA 1SUQB 3C15B 5H1SV 2YB4A 2A6OA 1Q2SA 5TF0A 3QFHA 3OVPA 2IYGA 2INFA 4DQQA 3FDKA 1RT1B 1ZPWX 3FA4A 3W7DA 2YX1A 3NQMA 1GXUA 4JTCA 3GR0A 1VHIA 4LFBJ 4J1OA 2I16A 3Q67A 4KIAA 2G2OA 4B5WA 3SADA 2VR5A 3M6WA 2DR8A 5FA5A 1RR2A 3NA8A 5XIMA 1E6VB 4IGHA 1Q65A 5TBOA 2V50A 4JEJA 2WB4A 4DN0A 1NK9A 3O0FA 1UTAA 2VEMA 2VZVA 2AEJA 3ABSA 1VFLA 1ZUAX 4PG6A 3M8PA 3U3HA 2X7IA 3EXSA 4DBQA 4B3OA 4OZ0A 3M5VA 5HLFB 4IXHA 1EUAA 2H3EB 2ZOXA 4JI0J 5F1UA 4XO6A 4U5KA 4KJIA 4NLVA 2W7OA 4EO6A 2P9CA 1OF6A 3RYSA 3PR2A 4IJRA 3VOFA 4DF0A 3I31A 1T0OA 3EJMA 2NT1A 2ZH6A 5KFKA 4MNKA 1BLUA 3L3CA 4LF9J 4HLBA 4DZIA 1OY8A 2RHSB 3W9JA 1VH7A 4ICNA 4C1NA 3G18A 3TE9A 3IVTA 4X2BA 2HWTA 2DVIA 1YYAA 4Q3MA 1ZS2A 2EKGA 3LDVA 4UQGA 5BYQA 2NXHA 2Y88A 2ABBA 1A6LA 1YBQB 2OOGA 1CBGA 3RZAA 1NDZA 2XM3A 1OX6A 3K8LA 4NE9C 1FP8A 3IGNA 2J7UA 3AOAA 4P8UA 1RH9A 1H38A 1RJRA 5LIWX 3NYZA 2LEBA 4XDDA 4OHYA 3W6YA 3A4TA 4LBPA 2BDQA 1N5YA 1H2UX 1QI0A 3UT0A 2OFGX 1S2UA 3QSIA 4USTA 4ZJLA 3UYCA 4GRSA 4B3LA 2JK2A 3WLOA 4RE2A 4U96A 1FJ7A 3KWSA 3FAXA 2IW0A 3UJFA 2G3JA 4R34A 1S9GA 2PRHA 1LUCB 1GQLA 4AY8A 2VEFA 5D2TA 4DU7A 3W7NA 5GJPA 4XUGA 1FWFC 3CO8A 3W01A 2X42A 3L5AA 4IIEA 3TQ0A 3FYYA 3BKTA 3IWPA 3R5EA 4QE1A 3WLQA 3BGJA 5KSWA 3TZYA 1E4NA 1V79A 3CEDA 5L38A 2A6MA 1JDEA 1D9FA 3VNDA 3EMTA 2JBMA 5JMUA 1EQCA 4IMFA 2A3LA 2Z1SA 3MDWA 4W89A 2O56A 3AH6A 4USWA 4HHPA 2F8MA 4A4JA 2HHHJ 1K9FA 1MWQA 4O23A 3OO2A 4M19A 4O4VA 5F8JA 1JPHA 1Q1KA 1RU1A 1B0IA 3L5MA 3QQCD 3HJVA 4RE4A 1VBZA 1S76D 2J7EA 1GEQA 2OSWA 1MW2A 4R9XA 2WC4A 3HXMA 2QW5A 3CD0A 5J2MA 3GFZA 3N11A 1V6WA 3GU9A 1WOPA 2WANA 5B09A 3DH7A 3ECQA 1IT7A 2NPFA 3CT2A 1HP4A 4DDFA 4QIFA 2MKCA 5G4DA 1R2TA 3O6QA 1WC3A 2VPXB 2JEIA 1R87A 2ZHBA 4ZHRB 1TKTB 4LRSA 3FUYA 3TVKA 3LTSA 3AIEA 5F4WA 3EXRA 3SDEB 1W3IA 2FQIA 1QCWA 2WO5A 4AZCA 1DHKA 1F7BA 2CPJA 4IFYA 2HKEA 4LVFA 1XNQF 1R0AA 3MZ2A 4GZ7A 4GY7A 5T26A 1RHMB 3RRKA 1AQFA 3LSBA 1W2IA 2ASJA 1SH0A 3EMZA 2C22A 2DSKA 2A3JA 3OA5A 1Q95G 1F74A 1PYFA 2E3ZA 4Z2XA 4X4SA 4K50A 4WVXA 4K4ZA 2RQMA 3BLLA 3MYPA 3UGVA 3MCNA 1TR9A 3R0DA 3HD1A 1HBUA 1P6CA 5M2UA 3DECA 4I5RA 2EPOA 4NVTA 2F61A 3P0XA 3UD3P 1MN9A 4ZN1A 4UQTA 5K8NA 3JQJA 2Y8VA 3AS3A 4JN7A 1EKRA 1VQ5S 1YQ2A 1DXIA 1O60A 2MY7A 4DV3J 1HKWA 2CYGA 2WBRA 3MTWA 1FNMA 1YKWA 2X0HA 1HIYA 3D5MA 1U45A 4HNLA 4XTDA 3USBA 1GJPA 2PE4A 3VNMA 4P7LA 2MZSA 4DLFA 1DJYA 8TIMA 1Q4RA 1LWJA 2DQWA 1HJVA 4JTDA 5EDWA 5DJBA 1KGXA 1A3WA 3SN0A 1MU2B 1FWDC 1R38A 3ONBA 2C7FA 4ZXLA 3H8YA 1YEYA 4K7VA 4LAOA 3H2NA 5KFLA 2VX6A 2CQGA 3PX0A 3KVLA 1RWUA 2B6AB 1U0HB 1QE1B 1XYAA 2HRWA 3WJZA 8CGTA 4O1CA 1BE4A 1OY9A 1QPOA 2VCBA 3B9AA 3DHUA 4WE1A 3OPKA 1YTDA 2DY3A 4C7QA 4LF6F 3SCRA 3KOYA 2WZ1A 3O07A 2PS2A 3T81A 3VGVA 1JNDA 1X4FA 3GDMA 4NJGA 4NEZA 4GO8A 1SH2A 3QKZA 3FXGA 1YRRA 1I51B 3HURA 1FJCA 3QWUA 3TA2A 2QV5A 3E3HA 4UFLA 4C5ZA 1M65A 2E1PA 2GK1B 1RZMA 3W86A 4P73A 3MUTP 5KFRA 1TELA 3DU0A 1QOPA 1HJXA 2QJGA 4DR2J 3FLUA 4L4PA 5HBFA 4L6OA 4H00A 1CXIA 2J0SD 4GCXA 4M5LA 3WY1A 3DI1A 4DR3F 1GMWD 2DNPA 1H2TZ 4F4AA 4A2SA 4HPJA 1XV8A 4L64A 4MJ2A 2ZE3A 3R11A 4TN2A 1EGMA 2UBPC 1DJQA 1EC9A 1U26A 4CH7A 1FNOA 4NLOA 4PWWA 3CULA 4LRFA 4DFMA 1NAL1 2W9MA 5JU6A 4GG9A 1B7YB 3BEGB 1WHWA 4MK8A 1IEQA 1F60B 1JPDX 3JS3A 5EWEA 1S1TA 2ZICA 3RFAA 1UOZA 1S3HA 4TO8A 1MVYA 3KTSA 2G1DA 4R33A 4DFPA 2ALDA 3CZJA 3SECA 3DKJA 4S3JA 1HKAA 3SCIE 1GYNA 4D9PA 2UUCJ 3CIXA 5B0FA 4UOGA 1YHQS 3EA1A 1XWYA 2GZOA 4RW8B 5AFDA 1RAHB 4QLJA 4PEEA 2OFJA 1SO6A 2MQOA 1DTTB 1JCMP 2H8XA 1HQUB 4I69A 2HGMA 3LCLA 1DJNA 4FIQA 3UZWA 2CQPA 5KG2A 3DRXA 3THTA 1XIDA 4I90A 4ES4A 2OHDA 3MEEA 3RLGA 1KWKA 3O2LA 1HQEA 3HN3A 4CEXC 4DR6J 5D77A 1XCXA 5TIMA 1S59A 4CP5A 4Y2MA 4O18A 1U6FA 2DRDA 3OVRA 4KE5A 4K38A 2EFOA 2XHCA 2BWGA 3W1QA 5KETA 4ZP9A 3FS2A 3ZVIA 1HMVA 4DN9A 2ZX8A 3VZHA 4XZHA 4P72A 2ZC4A 1HQTA 1SQEA 4MKAA 3C16B 2QUNA 2FJAB 1XYZA 1UQYA 1AZ1A 4OT7A 1NZAA 3FBCA 2V4JB 3PR5B 1XYBA 4Q0BA 1SJAA 1X6UA 3SFWA 4C0BA 5A2QU 3OP2A 4NI8A 2HFOA 4UF4A 2WZMA 1K44A 2ZD1A 3H98A 3OD2A 1TE6A 2UVWA 4CD4A 1FWJC 3BAWA 2R7WA 1EETA 1LOSA 1T40A 3IJDA 4L72B 2VG5A 3NSXA 4G1NA 1XGDA 1OC6A 4PFMA 2JE8A 4F2RA 4L65A 5I03A 4QDPA 3FFIA 3L4XA 3WNLA 1XQIA 1UC5A 4I3GA 4NA2A 4ES2A 8XIMA 2QF8A 1ODUA 1J5EJ 2VDIA 3C4UA 3PJXA 2COLA 4CLTA 3NGDA 4LF8J 4DV6J 1S39A 1A0EA 3BCDA 1JZ5A 3N2MA 1EZWA 1D7KA 2OSQA 4O52A 2VRKA 4V28A 2DISA 2V81A 1KFLA 4LVGA 4RBTA 3OG3A 1Z4UA 3VOHA 2PI5A 1IF2A 4GNVA 2ZUMA 4LFCJ 3SUTA 1W9DM 4A29A 2PPGA 4A8YA 4E4UA 3UD6A 4QEHA 5B0EA 3APGA 5CZJA 1AODA 4JQAA 5DRCA 5FL1A 5JBDA 1KVKA 3TX0A 2Z6IA 3BLKA 1CZ1A 1YLVA 2GJXA 3TLLA 2XLJA 3OV7A 1FCAA 5AB3A 3M30B 5SUHA 4QJ4B 4QYZK 1C9DA 1W0MA 2J24A 3T1YF 3W60A 5FSDC 3BN7A 5CXPA 6AT1B 1TWIA 3T2OA 1KA9F 2K3KA 5XIAA 1YJRA 2QZ8A 3CB4A 5A6TC 3GYNA 4IKAA 2VD9A 3W8PA 4KFBA 4UQAA 4L56A 1AD1A 3W87A 2CLLA 2NX9A 2WLYA 3IG1B 2P76A 3NTYA 5A0YB 4CM0A 3BO9A 1K8CA 3DFSA 4JNZA 1ZBKA 3MPUB 3KHLA 1KXHA 4KRWA 2YKMA 2UVVA 2AX0A 4H9TA 2I5IA 5DQGA 2DT1A 4AX6A 1TL4A 3GIIA 3SEPA 4FBTA 1GVIA 1NF7A 3D6HB 5EL1A 3C8YA 1RYRA 3MMDA 4YCPA 2J6UA 3DFYA 3D4JA 2IHR1 5KG7A 1Y5WA 2DZTA 4DM1A 3GD6A 2B43A 5U4NA 1OFQA 2M3DA 2CIMA 4DQWA 3MUIA 3IIXA 1JFXA 1AW5A 1SFTA 4HCHA 1P1XA 2DVTA 2PTZA 2J6VA 5HNTA 3QATA 4NYOA 4FKYA 4R27A 3OL6A 3RB3A 1NELA 2QMUB 2R1MA 1GJWA 1XLEA 3K5MA 2PLJA 4NZ5A 3E0FA 2AYBA 4NCGB 1WV2A 1X0FA 1XLFA 2VCAA 4QCFA 2F3JA 3ERPA 3KG0A 5MLCV 3GE7A 1TPUA 4FXRA 2A85A 4ZEPA 3VQTA 2WMIB 4ZQMA 4F4KA 2YXGA 3IRDA 1JK9B 4LT6A 2NS1B 2NLWA 3CO0P 4HTBA 1JG9A 4YS2A 2VC7A 3R7MA 1XEZA 2ZRUA 4W92B 1PYMA 4ICLA 4KH0B 1KNZA 3MM5B 2NSBA 3LPEA 4PUKA 1B3YA 3R13A 2J9YA 5AN7A 5IRPA 1NDLA 2QTWA 4I5XA 1ULRA 1HJQA 3V75A 3AAWB 1CJUA 3ZO9A 1LJYA 4Y9AA 4IPPA 1HI8A 4KV8B 4UZSA 3O7UA 4IT1A 3VKBA 4CVUA 4X62J 3H25A 1JCJA 4HOZA 4AL6A 4DYEA 3W1XA 3FSIA 4HHLA 3AJ7A 5C7VA 4IG3B 2DJWA 2G41A 3BARA 5LNSA 5M2FX 3LTOA 2RIJA 2C2DA 4LSZB 3KM8A 3N4WA 4MJ4A 2WM1A 3QJAA 1W56A 3Q45A 4NYUA 5AC5A 4PTXA 4PG5A 2Q6BA 4DR1J 2XUCA 4Z2KA 4UMCA 1VJSA 1GQIA 1FX4A 4ZPBA 4J9LA 1VQNS 3SV3A 1OGSA 4DPYA 2RB7A 4WP9A 1LWEB 4WFZA 1RAGB 5CZ0A 4CH0S 3KLIB 3VGTA 2IC3A 4F04B 5B08A 4JI5F 5BOOA 2D22A 3T44A 1J2VA 3W02A 4HU3A 3NDOA 1VISA 1WOSA 2DW6A 1IIGA 2BKPA 4EYHB 3R1HA 2JNJA 2BRKA 5E7OB 2VX4A 4MZ8A 4ID5B 1UH2A 2CNLB 4PN2A 4Z1CA 3WD4A 1V3HA 1UW9A 4NPOA 2BSLA 3SCLE 1FI4A 2NYIA 4TY8B 3RX2A 2J88A 3W5ZA 1E1CA 5ECUA 4P2FA 2CJAA 2RMLA 4X4OA 3CPWR 3MI2A 3OYXA 2LEAA 4DJEA 4F8XA 3K57A 2KL8A 4H9ZA 2DH8A 4WIQA 4GBDA 3MO4A 1UUOA 2FVMA 5GAEI 1ADOA 2D7SA 1RT6B 1QI3A 3FFSA 1OWQA 1M7XA 2UY2A 3S4TA 3VNLA 2GDQA 4OECA 5JMNA 1JXEA 2EPMX 2CUYA 1EHNA 2VM8A 2E9RX 1WEXA 5HK4A 5I7GA 4JX6A 4HIBA 3C0LA 2G2ZA 1S1XB 2HS8A 5KOXA 4NXKA 1XYMA 2A3CA 3GTFA 4OI0A 2HQDA 2ZTJA 3RK8A 4EKJA 4DUOA 1JAEA 3FJ6A 1TL7A 3MM8A 2XVNA 1W3TA 4I7VA 4PMVA 5JXSA 2ZDSA 3RN6A 3BGRB 4IX0A 2X1FA 4DF8A 4KRZA 4PB5A 3RXZA 5ADZA 3ZZTA 3IS4A 2PDJA 2H90A 4PFHA 1GOIA 1EA0A 2J7HA 1P27B 3MZIA 3FBEA 1NDVA 4ETXA 1FWLA 1JQVA 1V7YA 4G9PA 3NZQA 1Y65A 4R5EA 4ZTXA 3CJ2A 2CPIA 1X31C 4GY0A 5D9PA 1CECA 1HNVB 1UPPA 4FS9A 3W66A 3N4AA 2QJMA 2HE8A 5CC7A 3H55A 4QLKA 2JFDA 1WOAA 2YJQA 1KHWA 2CQ4A 3CJKB 3BPDA 1HPZB 1VQKS 1SSGA 2J5AA 2F38A 2B51A 1FCQA 3N9SA 3NKYA 2AOSA 1RT7A 2ZJQQ 5CG0A 4CLMA 1VRUA 2XIMA 1BQMA 4UMAA 1G01A 2XHWA 3ELFA 3DBNA 5CQGA 1HZYA 3MTJA 3VC5A 1TQJA 3G6ES 1CLKA 2F9RA 2CC0A 2MGZB 3D3BJ 3EGNA 2J6TA 2YCLA 1JJ4A 2XH7A 4W84A 4O50A 3GC4A 4DZHA 3OJSA 2IAJA 3DESA 1C90A 1QR7A 4QW9A 3C56A 4RK8A 1FE0A 5FJPA 3C6TA 1H0GA 2V9KA 3W28A 3ILJA 1E5NA 1PDZA 4DL7A 3B40A 2NV2A 3LWMA 4NZ7A 2GWNA 1WJ9A 4O1DA 2OTLS 3ALGA 4NLGA 2DSZA 4NLWA 4NJIA 4K2SA 3W2LA 1C8QA 4MJMA 1RTJA 2A2IA 1T9WA 1WF0A 3DKDA 5ITHA 3PRDA 2BKOA 2HBZB 1LWCB 5AJ3F 3TTOA 5BWAA 3OL9A 4TYAA 1GW1A 2PU0A 2XTJP 4DSEA 1B7FA 3BLEA 1T94A 3OLDA 4YOEA 3CQKA 1BWKA 3VAHA 3RF9A 2PEVA 3VC6A 1RVKA 3W7RA 1XMOF 1RGVA 4P7NA 1L0PA 3E6EA 3H2AA 3PZOA 3LQVA 2HNEA 3I3BA 4P6QA 1ZZMA 4J3SA 4IJCA 4MK9A 1A4MA 3BE7A 2ADAA 4PRRA 4ZZ9A 1I2QA 3OSNA 1SZRA 3B9NA 1KGWA 1QXLA 3T05A 4XVDA 4L9ZA 3CLWA 3N2CA 4AL7A 2WCAA 3SW6A 4LXFA 2EC2A 5GJNA 2HGLA 4DV7F 3PW5A 1UEKA 1CW2A 4L75A 3LWLA 5J5DA 4IPLA 3AWNA 5ABFB 4LMZA 2HFZA 2PEHA 2FHBA 1IT0A 1N8FA 1HKKA 2FZNA 3MM9A 4GI6A 2QCHA 3QFEA 1HBOA 5BYSA 1YTEA 4WYWA 2Y0SD 1AYEA 2NVAA 3N1AA 4XBKA 3HX9A 4IOTA 4ZJOA 3I5AA 1S5TA 2Y63A 1VB9A 3WLNA 3BLFA 2WONA 1VQTA 1FHLA 4PTWA 1GMVA 4B9TA 2OTDA 2HZGA 1U0SA 3W1YC 1C7SA 4YY3F 4B3TJ 5CAHA 1NLKL 1R7OA 2HFSA 3K2YA 2VPYB 2OAUA 3QW3A 2Y0BB 3UN2A 5J1PA 3OL7A 2VXNA 1T03A 5HI7A 3JAMU 1XR6A 4QG8A 2YKAA 3CASA 1CTNA 2AKZA 1L2QA 4ZO7A 5K8PA 4X64J 3SQLA 4UQ9A 7PTDA 3AI0A 4Q44A 3WLTA 2G2YA 1WDWA 1NH7A 1XJWB 3AS2A 1Y3KA 1FHTA 1TL3A 3IUHA 3LCWA 1TPDA 2BOAA 3GLJA 1X5OA 3CS2A 2B9YA 1NK4A 4KHRA 2ASYA 2OX1A 2NWSA 3ARRA 2WMHA 4O0ZA 3SFKA 1XIBA 1X6NA 1O12A 3OGVA 3O1LA 2ZWYA 3S5YA 3FKKA 3JZUA 2QUVA 4WSJA 1EB0A 3GZ3A 2CJXB 3EVMA 3OBKA 4JDYA 4HP5A 1UJ6A 3KE0A 4FP1A 1YGYA 2E25A 3KLKA 2Y62A 2Y61A 4PTDA 4C6DA 1LV5A 5F8HA 1RTDA 2VC0A 2XLIA 1OFPA 1A80A 3CJ5A 1DQ8A 1P6WA 1RT4B 4EOUA 5D4PA 2VGBA 4PMYA 1XRSA 3H90A 3QGKC 2BX6A 3LP2B 3QGPA 3FJNA 3FVMA 4AWEA 1K1SA 4KQNA 1FKWA 3F0NA 3LHVA 1I94F 3CL8A 1XC6A 2HHWA 3AMGA 1LW0B 5EBAA 3S1VA 2A18A 2V38A 2PLCA 1LWFB 3OQ2A 2CERA 4Y6GA 4ZPTR 1UMYA 2I1OA 1HL6A 5E0KA 3PS7A 3BQ1A 4O44B 4JTSA 3L95X 2ASLA 4USVA 1Q13A 2FB2A 3P8BB 4LF4F 3L0NA 1SJDA 1TL5A 1YX1A 4J2MA 3A64A 2KHCA 3HZGA 1YZ6A 1UG6A 4RXFA 4Y96A 2ZH2A 1Q4WA 4FOUA 1AA1B 1CS4A 1SQFA 2XI3A 3PIPQ 3BAIA 4DN1A 5DFAA 1HG3A 2OLHA 1HJSA 1KQFB 3T5HA 1F2JA 2GL5A 2A3AA 5G4WA 4XUYA 3ZXWA 1RQEA 3PG9A 1EXBA 1JF6A 3ADAC 3G82A 3I82A 2ZRXA 4ZLNA 1NDYA 1R3TA 1ZENA 5ABGA 1PXGA 2V34A 3LANA 3J7HA 4HCLA 4EXQA 2ZTKA 3DXSX 3H24A 1OEPA 5DZ7A 1Z32X 4KPCA 4PXEA 4QTGA 3F56A 3AXMA 5DEZA 1NDWA 1H7PA 4KWWA 2PWEA 2HNYB 3EPGA 4JI7J 3MR3A 2PEBA 1VBHA 3TQ1A 3LMZA 1E6QM 5F4XA 1JLFA 2EFNA 4ZMGA 2B5JB 3L0KA 1TMHA 3WNMA 2ZZ5A 2VFGA 3L4ZA 1W5MA 1C1CA 5C2CA 4Z08A 1NEYA 5DG7A 2HK3A 2CZVC 1DXFA 3C6UA 1BRLA 2E5DA 4QDWA 4HHUA 1T6MA 4UTGA 5KFPA 1D9DA 4JN6A 1SKWA 1WB0A 3W00A 2KU7A 3OXLA 4M8LA 2V5JA 4J2PA 4UOJA 3M1VB 4C9DA 1N32J 1JLGA 4TQTA 3E2RA 1KKOA 1TK5A 1VQSA 3BBFA 3WEZA 2V2VA 4U7CA 3WDIA 1V03A 3OVQA 3MQTA 1M0SA 2W4CA 1S1WA 3R7NB 2C14A 2EC0A 2UVUA 4GX8A 3LQLA 4R88A 4HDGA 4HOXA 4KYZA 2HBVA 4N41A 4MYUA 1PX8A 3VMPA 4GKKF 1YJ7A 3LLDA 1JYWA 1QW9A 3T6BA 1GTEA 2PB1A 3GR8A 4JUZA 2F63A 4A8MP 3ARUA 3BSGA 3NMRA 1QJWA 3S9ZA 3WQ5A 1FERA 2LXUA 5L9FA 3GSDA 1N88A 4LAMA 1D8CA 1NOUA 3N4EA 2PMWA 1IZKA 3IR5B 4O1FA 1HO4A 1MW0A 3E5BA 3VDBA 1E6SM 3CCTA 3DN5A 1JXJA 5LSRA 5IXUA 2V5HG 1WYIA 1YZ7A 1WZMA 2HBXA 1JZ3A 4CRJA 4JYAF 2WHMA 5IDZA 3K4WA 4FSAA 1IR0A 2WVEA 2WSQA 1ZAHA 1JRBA 2ZRZA 2P8IA 1FY6A 3U6WA 4ECWA 3TFXA 2ALZA 2DNMA 2HVDA 2FZ8A 1W3JA 4DEZA 3MM6B 1PTDA 1UCWA 4DUYF 1KO0A 3BSCA 3TLQA 1RHKB 1Q85A 4HU0A 4XZIA 5CD4A 2ACSA 2ZA2A 2XY5A 4KESA 3EGWB 1FX6A 3ARWA 3GYGA 2HMIB 4F26A 2FC9A 3POTB 3S1UA 3W38A 4LY4A 2RUGA 5HVFA 1VIWA 2IFXA 5DS7A 4ZDNA 1PBGA 5F4SA 1JXKA 3N3MA 1UMJA 2LYVA 3HG3A 4O54A 4NI2A 1NDCA 4M0XA 4LVAA 2VFIA 4JCMA 1F3EA 3QQ0A 3GK0A 2V68A 2C3YA 3PZIA 5J1EA 4FYXB 4BWLC 1FH7A 1HJWA 2XPKA 3RJYA 4DQPA 2PF0A 3M5YA 1OB0A 7TAAA 1WNEA 4BR1A 2INZA 2GW8A 4I7WA 3H6OA 4W7UA 2ADCA 3LAKA 4P7RA 3GTIA 1DAXA 3LPFA 8XIAA 1N36J 3GVGA 3IV8A 1WDQA 2LDIA 1UR1A 4QRNA 1FDZA 4B4FA 4X3ZA 4E6MA 5F8IA 5KT6A 1N6QA 1KTBA 1NFBA 1S6QA 4M5PA 3PW7A 7AT1B 1DARA 2JWNA 2Q79A 4RX0A 3AJXA 4CN1A 2J76E 5L1JA 3T5KA 3C0JA 5SZTA 1VP5A 5G1MA 3NCQA 4QWDA 1QNVA 2VEPA 2UUBJ 4LUSA 1CGTA 1GVQA 1RQHA 1QO5A 2I56A 3BG9A 4ZCWA 3UPMA 3WQCA 3E2VA 5BR8F 3SURA 3GLCA 4B5VA 2QQ6A 4HA1A 4OBTA 2VELA 3DENA 4LS2A 1TTHB 4DX6A 4AVOA 2GMLA 2GNKA 3U1LA 4KTQA 3S6OA 4RW7B 3ARZA 4ZQCA 2H48B 3NL6A 3UCQA 5A6SA 3K46A 2FVQA 2BOEX 4ES1A 5FJJA 2ZBIA 3EWZA 1IBKF 4DWDA 4I6AA 4ED5A 4WDWA 1H60A 4PMDA 1HHQA 3D3FA 4XKYB 2D3OR 3LBMA 2CADA 4FDFA 3NDYA 3M9OB 3P61A 1UP3A 2PF8A 4X4TA 3NQGA 4B91A 3PNUA 2OT0A 4KWVA 2JEPA 2W27A 3TONA 1BVZA 3UQSA 3CDWA 5DLCA 3S1WA 4UUXA 3M6XA 3M0MA 2XG8A 5XINA 2XIIA 3TNOA 2PURA 3I7RA 1O1HA 2FYXA 2GGHA 1HNYA 3STCA 4NAFB 1EFZA 2ZZNA 1KM1A 5U7SA 1UJQA 3UXKA 3NS6A 1IKWA 1T9UA 2HRYA 3ANVA 2A3BA 5A6BD 3UR5A 5CCMA 4I2QA 1L8PA 3UJSA 5D04C 4HTJA 2NXUA 1F5ZA 4CUCA 1XBXA 3TH6A 3WBYA 1KCXA 1R2SA 4UTTA 4QDMA 1XFBA 1O6XA 2CQ2A 2QLWA 3MSDA 4CQCA 2WVFA 4TMBA 4N5SA 2AEMA 1LQ2A 1C8YA 5FJUA 3NY0A 5IV3A 3AO0A 3KRSA 4CI0B 4NX5A 2R2TA 4M7SA 1HTIA 2DIKA 3WJSA 1CSJA 4FF5A 4KWOA 3P96A 5M3WA 5KFDA 3ZR5A 4DYKA 2WW5A 4Q4SA 2UY5A 3WDPP 2D0FA 5K3VA 5LGXA 1M41A 1OJ4A 2J0QD 2YNIB 1JDDA 1I2RA 2ZX5A 2Z1KA 2MANA 2J9CA 2QZRA 3CV6A 2V3GA 1WDTA 3K1DA 4US5D 2FLIA 2FPYA 3H22A 2QIWA 3HO1A 1KD1T 3AU2A 5E0CA 1XD0A 4MTPA 3VALA 4CLSA 3PTQA 4JFVA 3CSKA 2XSFA 3V81A 1F9CA 1ROFA 2BQRA 3D54A 2PA3A 3IN5A 5LMNF 1DWFM 2UWFA 3EPIA 2J4GA 2UZ9A 2ABYA 2VG7B 3KCJA 2Q6CA 3W76A 4J9NA 2B7BB 3NCOA 1OADA 2UP1A 3FYOA 1G6CA 1OS5A 5CCLA 2W62A 3V16A 1TWWA 3BG5A 1RBOB 4G7FA 4PXDA 2R7XA 3WIVA 1XUZA 4UTFA 1LBLA 3G3DA 3VIPA 3GU1A 3LOTA 1Y7PA 1NB7A 1KTNA 3FJ4A 4QE5A 5LNUA 5AHLA 1SJCA 1EP1A 4RW4B 3TU9A 3TYUA 4P8XA 4Q7NA 3FSXA 4A2RA 3PIOQ 1M5OC 1TTIA 3K13A 4GISA 1SL0A 3IIOA 1OGBA 3QZ8A 2DRBA 1GPFA 3DDKA 4DV2F 3EGVA 4EUVA 3J7A1 4AY1A 3U4FA 3LNMA 4J5OA 3SCJE 4F7VA 3MUZ1 3TW9A 4Q4QA 2O9TA 1S2CA 3H21A 3CO4A 4KETA 3M8SA 3B4UA 3P45B 2HWIA 4PL2A 2VX5A 3KRBA 4QNEA 2BZNA 5D4OA 3FDSA 4HPGA 2CLHA 2E5CA 1YWXA 2V0NA 4E2FB 3W83A 3S01A 3OHAA 1P6BA 3BN4A 4K4YA 1EQMA 1SH3A 2X3DA 4EF8A 4JNMA 4LT9A 2FPTA 4W93A 2KG0A 3UZYA 5EMYA 1FXQA 4M80A 1P1LA 2G3NA 4OHWA 3PPHA 1M7PA 3QJPA 1F1BB 3B8HA 1WBHA 2WYSA 1GVRA 4HBKA 1JLEA 1JLAA 4JIHA 3ILOA 3ICJA 4IGNA 1W9UA 1HWUA 2Z57B 4WR3A 4Y8FA 1YBTA 4KWSA 4Z0SA 4ZVHA 1FESA 3UNGC 2GVZA 2AAAA 3L4VA 4KGXB 4KAIA 2JVOA 4A47A 3W53A 1BVWA 3G1YA 3QBUA 2HBRB 3G0UA 3KCLA 2NQPA 1EX5A 3PR4A 1RACB 1RCXB 2D74B 2J9EA 4JPGA 1GZ1A 2ASDA 2Z29A 2G9OA 2BMBA 3TTQA 3W9HA 4IR9A 1Y5IB 1WORA 3L21A 1QLNA 4UFKA 5DCDA 3MECA 1M5PC 2FHOB 3DFHA 3W24A 4DB7A 2IA0A 2D0HA 2VQFF 5D03A 5REQA 5DM6Q 4BQ5A 4MKNA 5HUPA 2PP1A 3KLVA 1VQPS 1W1VA 4NXNF 2GZXA 4LFAF 3NBPB 4LAKA 1T8EA 4M6QA 4UFJA 1ONRA 5FDLB 2C2EA 3M8PB 4MKYA 2PAJA 3E2EA 2DEIA 5CPOA 5D0GA 4B3OB 2PCQA 3W1NA 3OFHA 3LA0A 1R3SA 1QAXA 2GMJA 3VTRA 1DWAM 1OCQA 2MHNA 5HVGA 4OX9J 1K77A 4ZVUB 5H8PA 4WFYA 4ZCIA 2HSAA 1FDJA 3CDUA 2R7RA 3G8RA 3Q2SC 2ZZ6A 5L39A 2QMJA 3EDFA 2XMMA 1PO9A 3CUXA 2V5DA 2B8PA 2ZNYA 3T1HJ 1S2AA 1EC8A 3T19A 2OMAA 3WH5A 3J7YU 1YLXA 1DL3A 2KXHA 1U1QA 1KFCA 4HHMA 3AODA 3QRPA 1RT3A 4NYYA 4GIAA 2VNCA 1WF1A 3BDKA 1P8GA 1V8EA 1XRVA 3VE9A 3EXCX 3TP2A 3RB0A 4DO4A 2YZ5A 3VGSA 2B4VA 5BYRA 4PTMA 1XGZA 5E3CA 1LG2A 2ZOFA 2DZAA 5K14A 2CWNA 4BS2A 2PD9A 2VZUA 3HG4A 1H11A 4F0KA 1N5YB 3M0XA 3LHUA 2GC8A 1BD0A 1GEHA 1PCWA 3P0WA 1BXCA 1FDDA 1XN9A 4TYBA 5DZ6A 3NEHA 3CT7A 5F8LA 1KRBC 1VENA 1W2VA 3HM9A 1S9FA 4FZIA 4S39A 1NU5A 2EXUA 5DDPC 3KWXA 4MKVA 1CT5A 3EX6A 2Z8QA 4GUHA 4L4MA 4WOQA 3DZ1A 3VCNA 1RTIA 5HP1B 2B31A 5D38A 2MQ8A 3EB4A 1YJNS 3CCMS 3DGRA 5GVJA 3EWUA 3WQWA 1XNRJ 4ZJQA 1YPIA 1ZLPA 1H7WA 3FRYA 5I78A 3B9EA 3WQVA 2LQBA 2FJBB 4LUTA 4LJ3A 1HBNA 2BGSA 4TU1A 2FKPA 5T14A 3H5YA 4LF6J 2XEXA 3FMWA 1BYAA 3L4TA 4UZCA 4HOWA 1PKUA 1LXJA 2PWVA 1LDCA 5B7WA 4X4UA 5I3HA 4DI8A 3FN9A 5J2MB 4WJXA 1Z44A 2F8QA 3UXLA 3BG3A 4UWMA 2J74A 1XH1A 4NEYA 2YNHA 3UPFA 2W2PP 1ZS6A 4ES3A 1CULB 2KZMA 4Q45A 1J12A 2E5LJ 3K5PA 2VZTA 2HPIA 2Y8KA 1FVPA 5HJYA 2W2QP 5E70A 1H4PA 2VOTA 4H8HA 1CI1A 4AD6A 1W3HA 3GG8A 3CEUA 4JTKA 2VC5A 1CJVB 3DMJA 5L9XA 4TNOA 5ECVA 1A3HA 3PZ9A 2Z4GA 3T0CA 4BI7A 1LXNA 2NVDA 3WK1A 1K70A 3W23A 1QOQA 3RU6A 3BW3A 3R79A 4LGXA 3RU0A 4CN4A 1MDRA 3P6LA 2BKNA 2YH0A 4EZ9A 4RPFA 3TC6A 1OWXA 2D3NA 2O4MA 4HK5A 2QJHA 1RTHB 3WQ4A 1G2EA 1BWEA 3SI9A 1EOMA 1HNZF 1TG7A 3WC0A 2GIQA 5LJ5Y 2JFEX 2DGAA 1H7XA 1U25A 4HA0A 3HHEA 5DMYA 2WXDM 1SR9A 4QR6A 3M2UA 3I6RA 4KH2A 4YB7A 4PUWA 1KSPA 2AD9A 1OIMA 3BW4A 2V5CA 2JALA 4FZVA 4V27A 1MUCA 3ES8A 1F61A 2RDWA 3TCSA 2JSXA 2E8ZA 2Q3RA 3ARVA 5L6UA 3NGSA 2Y2WA 3VNIA 3DLEA 2DUXA 1UW4A 4KPYA 2WNQA 1XX1A 4GLEA 3MWAA 3H53A 2XSBA 2O9PA 4ONVA 4DWIA 1H3GA 3TZFA 3KEHA 2L5HA 4PUOB 4XAFA 2ACYA 2MKIA 2XIQA 1FRLA 2M8HA 1JD7A 1HKIA 3RUBL 5LA0A 2G50A 1MMDA 5BW6A 2VQUA 1R6VA 2CHRA 3PW2A 2Z6JA 4HZMA 2J66A 1TRIA 4D6GA 4XG1A 1RHCA 3KJNB 4LF2A 5GAHU 3KBSA 2Y1IA 1SW7A 1E70M 1C0UB 3MUMP 1KM4A 1OT1A 4J3TA 4RZ5A 3WH6A 1D9AA 4JI1J 3AIBA 2HIYA 2JF6A 1A5UA 2HK2A 3SQGA 3SCWA 3RAXA 2P1FA 3CDEA 2ACUA 4DSJA 2ZXBA 3HFKA 3ATYA 3SQMA 4JQ1A 1BPLB 1Z41A 1BQNB 4I2PA 5CLWA 2INEA 1WI8A 7CGTA 2IMWP 2VDGA 9XIAA 1Q6QA 1P0BA 3DHFA 2VZ9A 4L5ZA 1WOOA 3STEA 3TP4A 3IPWA 4HSOA 3CJ0A 3UEQA 3KK2B 4H6KA 4F0LA 1JNEA 3GG7A 1XLAA 4UCGA 2DVXA 1E43A 1FWGC 4A22A 2JEFA 2DXDA 3HFYA 1REVA 3W72A 3ATZA 2YXLA 1CXKA 2ZWPA 4QIWD 1S1TB 3LZ3A 1YG0A 1UR2A 1B0TA 4UC5A 4S23A 3OUYB 5BRPA 4RR5A 1PCKA 3R89A 2GVDB 3HHDA 3S5OA 1VFMA 2HNZA 4B3SF 3CMQA 4P7TA 4JZ5A 1SUQA 3C15A 5FJOA 2UY3A 2WBGA 3N17A 4IPIA 1K47A 5EA9A 3GVRA 3MUAA 2J0WA 5D6GA 3TZZA 1RT1A 1EGZA 3MP4A 2QLFB 1HN1A 2PDAA 4I4BA 4WXWA 3M2RA 4KCUA 3PZPA 1HBMA 3C2EA 1L6YA 3DLBA 3KOZA 4RU9A 3FGCB 4H6QA 1E9LA 4C6IA 1E6VA 3HFVA 2FTPA 1E6NA 5A95A 5BNKA 2QN6B 1UQZA 1HQEB 1DQ9A 2GGEA 3RPTA 2J7GA 3OFEA 4AEFA 2PBOA 5KITA 2V8VA 3ES7A 2XSAA 3T1YJ 1A0DA 2DV0A 2ZH3A 3IJIA 2XVPA 2D3UA 3EWXA 1HQ2A 4NILA 4LR9A 4HJFA 2ZUTA 3V2UC 1YHTA 5FF7A 4AZIA 4ZVGA 2Y8WA 4P2VA 2BM0A 2QEZA 3J81Y 2K3IA 3ITXA 4J9KA 3QMRA 5AKQA 3MI7X 1W5QA 3A13A 4O13A 4OI1A 1DV7A 4JI6F 3B0XA 3PVFA 3VMNA 1C92A 3CZLA 3QAEA 2FGZA 2O4QA 4LANA 5FLXY 3B8WA 1SM9A 2CPZA 2D69A 3M0ZA 3R43A 3QHOA 1MQPA 1UA3A 4CO1A 2KT2A 4Q0BB 2W61A 1W6TA 2X2YA 4C6MA 2HSEB 4P52A 4FAMA 3LP0B 3UZ5A 1QDUB 3GDLA 2KYZA 4TOQA 2ZDRA 4BI5A 2ZD1B 5CJNA 5KZMA 1JDAA 1UR0A 3JU2A 4H4OB 5T41A 3W5YA 2FHCA 1R9ZA 2P5NA 4PMZA 2PA8D 3OJUA 3LPGA 2EG2A 5HPCA 4R8UA 3UZXA 3QQ1A 3W3OA 1KGUA 5B0DA 4DHGA 2XU2A 3C8NA 4QWBA 3TA6A 4OYWA 3OTCA 1FWPA 1NKBA 2FJWA 1DQXA 2H3DA 2OLAA 4GVLA 2VG5B 1RK6A 2UVRA 5L1LA 1FDYA 1EIYB 3DOKB 2UXBF 3T9ZA 3FFIB 3CVKA 4RDYA 2BJ1A 3DN9A 4BKNA 3GIKA 3F7JA 2E6AA 4JYFA 4FXSA 2DH7A 1CBKA 3VZZA 2DORA 2C19A 3OEXA 1LCOA 3JTOA 1ZM3A 4NX0A 3FDGA 5A8NA 2AYGA 4LW7A 4B3RF 3UGRA 4CNUA 3U2CA 4KGZB 3I5CA 2E7WA 3WX4A 1UVJA 4H83A 3QGAC 3BV7A 2WNNA 4AVFA 3HLUA 1KBKA 5HMWA 1X4HA 4LRAA 2OWWA 3T7VA 1VIOA 3PHEA 3KOFA 3PBYA 4Q8NA 1JZ7A 2FLPA 4LFBF 3PACA 3UWYA 3GFXA 3IRSA 1FRXA 2XMTA 3W8GA 2Y7GA 4PEOA 2JEGA 3VD3A 1WQ5A 4GKLA 3W7CA 2V8ZA 4MWAE 2H5JB 3I9ZA 4ZBCA 3M07A 4HPNA 4PB4A 1JYXA 2VR2A 2HFUA 2FZCB 3M8ZA 2ANUA 1WXZA 2GJRA 2PDNA 5K9CA 1X7VA 2FIQA 4JKKA 1C0TB 3JQMA 2YA2A 4DBWA 4OZJA 1TZZA 4JI0F 2PD1A 2AQWA 3SFUA 1TVLA 3MM7A 3VHQA 1J11A 4UR9A 3ZLGA 3HPXA 4A8LA 3IS9A 3MXHP 2IQ0A 1CB7B 3SRHA 1J0ZA 3TJLA 4KFBB 2ZH9A 4PCQA 1FFQA 3VO0A 4BBYA 3TYCA 1L3KA 4WTOB 4E8DA 1Q45A 4UOHA 2BB0A 1KLMB 2DGTA 3UVJB 4LF9F 2POKA 4HYVA 3CUHA 4DBSA 3HHLA 1S38A 1NJYA 1KEKA 1OD8A 3OBIA 2J8SA 1H7OA 4V1Ak 2AWZA 1GKQA 2YKMB 1I2OA 3ZLHA 4WFBQ 1VPQA 3WDJA 2LLEA 4LOCA 2P8BA 1TQXA 4O11A 4XBJA 3A5FA 5GMDA 4DOZA 2KM8B 1HX0A 2LCWA 1QTMA 2HZVA 3VXGA 1Q8JA 3DBPA 3AD7C 4B9SA 4FKXA 4OLPA 5JVLA 4C6CA 4MKSA 3PYFA 2J78A 3E0WA 4DG1B 4Y2WA 1JB0C 5AZ0A 4H4MB 4LPCA 1G67A 2IRXA 4Q8OA 2I6WA 3C19A 4PMXA 4JYDA 4GI9A 4N6FA 2BLEA 7TIMA 4NG3A 2FGCA 3JS9A 2DRAA 4IH5A 2FD2A 4UY85 5BZAA 2Z2YB 2MQPA 2GFTA 4Z42C 5EHHA 4HVXA 2RS8A 3FYPA 1PC4A 3DC0A 3EA2A 3PHTA 3TRGA 2AMXA 1GHSA 4B2DD 3ICLA 1TVNA 4S3AA 4DPOA 1H51A 3GRIA 1KTQA 1E9YB 3E9AA 4F2UA 4ICLB 2BACA 2CJ9A 1MRAA 1US0A 3QKEA 4PCFA 1GNKA 4HD5A 4A21A 3N2BA 4QIEA 3K89A 4J9SA 1MU2A 4J3XA 2CNOB 4J9QA 1WC0A 3THQA 3EWCA 2RJHA 3TUZC 4CN6A 4NA1A 1T05A 3BOXA 1WTFA 3F4DA 5A8PA 2B6AA 1U0HA 2K2PA 1OGGA 3MOZA 1C4AA 4UY8T 1NWTA 4KF1A 4TIMA 3MPYA 3BJYA 1V6YA 3D28A 2ATCB 2R9RA 1FXRA 2FYMA 1W32A 5LM7E 5D9OA 4UTWC 4ZCKA 2QDEA 2FB0A 4F8RA 2WZEA 3B82A 4DR4F 3AUOA 3H5XA 3A3PB 3OT9A 4LQ1A 1D9EA 5AC4A 5B0BA 1NSJA 4XD4A 1FEEA 1AH4A 1S5VA 3J80U 1ELOA 4G1QB 4K7QA 1CXEA 2RKXA 1MDLA 3CZEA 3B8TA 3BV4A 2D0GA 5LJ3Y 5KINA 1LBMA 2X1UA 1SQGA 3NGUA 2C0HA 4MH8A 2D2JA 4UXDA 1H5VA 4QE4A 5LOQA 3GYEA 4CNTA 1TA3B 1PBAA 1WG5A 4QCLA 3IUDA 1EWDA 2F5GA 1SFLA 4AY7A 5D02A 4MT1A 5I6SA 3KOAA 5LIKX 1EBHA 4V2XA 1BYCA 4F50A 5ETTA 2B7OA 2F6XA 5D78A 1IWAA 3A6OA 1POJA 5KTLA 3TFCA 1A7GE 3AFBA 1E1CB 1VOMA 2M5YA 4IUFA 1F8MA 4EF9A 1KFWA 1UZ4A 1ISZA 4OMFG 4DO5A 1SPQA 1UZDA 1KLZA 5CYMA 2K1RB 3CNYA 3PJ9A 4B5TA 4HH1A 4URSA 1T9XA 4NJKA 3KVKA 2QO3A 3ITTA 4OX7A 1XLDA 1XQLA 2EKCA 5AZ1A 2NREA 3WLMA 1M5VC 5FL0A 2ZWZA 4P61A 4AH7A 1DTTA 2RRAA 4HZ6A 1HQUA 1SBRA 4RBVA 2P6SA 2W2MP 3RU8X 1ZM2A 3BREA 2QUTA 2TPSA 1O95A 2QLBB 1TV3A 3WO8A 1L5UA 3W7PA 5GAGI 4PMUA 1G1YA 1XMOJ 2CLFA 1R47A 1OABA 1P9QC 3UN3A 4XAKA 1PZ2A 8RUCA 3MOJB 2OP5A 3TCEA 4GFIA 2EBNA 1LFWA 1NOWA 1TL7B 5ENLA 2RKIA 3QMTA 5T7LA 3P80A 3O9NA 3MP3A 2EPKX 2BS9A 1S5ZA 4J5NA 2DHGA 3HPFA 3LGHA 2OT1A 4XD6A 3K5XA 3C16A 3CCJS 3CAVA 5JVGQ 1KQYA 3PSWA 2V4JA 4US6A 1TR0A 1WEYA 1N55A 5FEXA 3EPOA 2JIWA 1ESWA 4MDOA 2QL7B 1RD6A 3DXIA 3QQWA 4R7OA 5F3TA 3L2LA 4XD5A 2VX7A 1KFSA 3NURA 2R1PA 3VOGA 3M32B 3S9YA 2ZITA 2R24A 5FEZA 4QU7A 1XPGA 2NVCA 3EEGA 4MVAA 1LQ0A 2I14A 5HINA 3RW7A 4DV5J 4ED6A 2JHEA 1N4LA 1G6BA 2VOMA 1QO2A 3N0VA 4HN4A 2F40A 1GVOA 4JD4A 4JTUA 4YY3J 1SL1A 2A0NA 3GTXA 1SFSA 1Q8IA 2DGUA 1BQMB 1W31A 3EUNA 3KLGB 3BW2A 5F8NA 1TV5A 1TRDA 4YFUA 1VF8A 2HK1A 4HACB 2D24A 4KHPF 1V3JA 2VO5A 3WUEA 1I1WA 2GJ2A 1XIJA 5AC7A 5LA2A 1U2FA 2Z27A 2WK2A 2YCLB 2W92A 5EB8A 2IBKA 2PGEA 1PEZA 4NAEB 3HD2A 1XD1A 3T78A 2IAJB 3R5GA 3EDRB 1IWBA 5HMFA 5EMJA 2YZRA 4JTIA 4FMVA 3R7SB 2VFDA 3C6TB 1V5VA 2R14A 3U2ZA 1JLQB 4RX6A 2Z2AA 2Z4PA 3M8WA 4WD0A 4A48A 1E3XA 4EP8C 1VIZA 4NZ4A 1OFOA 1F4HA 1TUGB 4IQLA 1RTJB 3WLRA 4DYJA 2L08A 1A5SA 1UVKA 1W9BM 1X5SA 1FKXA 3WLHA 1VYSX 4WZQA 2X51A 1C7TA 1AW2A 5HPOA 4DR6F 4WP3A 5D15A 2HVIA 5KFJA 3VIHA 2V63A 1XM3A 2DR6A 3QZ7A 4E98A 4JIIX 1B4EA 3W61A 3CCUS 1K7EA 1POKA 3NQEA 3QSRA 2VURA 3ZSSA 3PZNA 3REQA 1K8AT 4WF9Q 4AMCA 4AWTA 4ZITA 4O8AA 2VZOA 4DXKA 3E01B 3IG1A 3D0IE 5A0YA 3BZJA 1JPKA 5HMEA 4PQAA 1ZM4A 3E2SA 3G86A 2OEMA 2PD5A 2BEFA 3CCSS 2E28A 4X66J 3LGDA 1R8BA 2IDEA 1PIEA 3K8WA 5CSSA 3MEDB 1AFIA 3NO5A 3FVDA 1VBJA 3BICA 4QITA 4DX3A 2DIJA 3SSJA 3AIVA 1TVRB 3NEKA 2XMJA 4QLLA 4EWND 4FNIA 5KMYA 5KZ6A 3Q89A 4B08A 2CLKA 4UFHA 1ZTVA 4OZ5A 5ETLA 1FKOB 4AWUA 2X3GA 3QGGA 2JKPA 1JGMA 3MMCB 2R9LA 3VIOA 4USJC 5EN1A 5KFHA 2IJNA 2DJXA 4AD1A 3G6MA 2P88A 4DLGA 3FEMA 3NEVA 3ZWTA 4IQEA 2VC1A 3N6NA 2OKTA 5K9FA 1DRZA 2PFFB 2AKMA 4OIFA 2PRLA 3TXVA 5CH7B 2ZZMA 3HMCA 1ZJHA 4PCPA 5CYQB 4WUIA 1J5EF 4Q5VA 4DV6F 1TCMA 5HL7Q 1S2TA 1CGVA 4Q8UA 4GZIA 5G2WA 3QO9A 2CFXA 1S57A 1H5YA 2WMIA 3B8VA 2DT0A 1CJKB 1TMQA 3NWRA 3BTNA 1VR6A 2J27A 2XI2A 1PB0A 2CQCA 3ENVA 3PYGA 4DL0C 4LFCF 1T9TA 1GJUA 2HNHA 1TL3B 3AB4B 2VVSA 3MM5A 3DHXA 4BF7A 1UC4A 1C1BB 3T2PA 3W7LA 3W1TA 1Z3NA 5EUHA 2OZ3A 3W2WA 3UU0A 4KRTA 2J7DA 5C8BB 5F9NA 3Q2TC 3PY8A 4KV8A 1LYXA 1X6LA 3PB2A 3RJMB 1D0EA 4CQBA 1GPWA 4OYMA 4TLRA 3UCZP 3W9IA 3ITOA 2WCXA 4EACA 3CHEA 3DOMA 4MY9A 4S3BA 3THAA 3BQ0A 3E74A 4IG3A 4ZA1A 1RPXA 1C2PA 4RNJA 1UWIA 2J8GA 4UCFA 3T1AA 1KFJA 1PZ0A 5I2UA 3AJ2A 3FY1A 3OTBA 2DEJA 3G2GA 4OJ3A 1TX2A 3OTOJ 4L3NA 3GTHA 2YBTA 4OYBA 3D5HA 1W8GA 1GQJA 1EQPA 1PHWA 1WZLA 2DH3A 2WVUA 2NYHA 2ADBA 2RU3A 3KLIA 1RLCL 3T55A 3O6CA 1OIFA 1TZ9A 3W2KA 4OZ3A 1JCYA 4AZ5A 5C9UA 1FUYA 3IJ7A 2BJEA 4J9VA 4M5JA 2XN2A 4S38A 1UR3M 4ID5A 2V2KA 2PMHA 2VIHA 2Y6ZA 1O8BA 3WBEA 3WELA 3N3TA 2WBKA 3TUIC 4BEQA 4TY8A 2HS3A 1NVMA 2F4FA 8AT1B 3V4IA 2JFKA 3ZZPA 3DLKA 3GTYX 2IJRA 4NLUA 1GOMA 1DTQB 5KFTA 3D0CA 4PR4A 2CPYA 2OKQA 1TWSA 1XR2A 3WSUA 1WC1A 3I3EA 4NLDA 3UP8A 4GC3A 3NPVA 1VFFA 1J8VA 3VIGA 2H3BA 6FD1A 5KFQA 3GZ7A 1QNOA 3WD3A 2NQJA 1PYSB 3CJPA 3S7RA 4E8UA 4G5DA 2P2CB 4AISA 5C71A 3PFMA 3EBVA 1A5OC 1M04A 1JLFB 2VQEF 3ZTQA 4TQRA 2XNRA 1Q8LA 4LUJA 3UJRA 3R58A 1V3SA 2CXEA 3VWSA 5DBUA 1DWHM 1S1XA 4PC8A 3GG1A 2ZX6A 3TO8A 2H9AB 4NZCA 2VHLA 4LYRA 3V6KA 3C6UB 2ZRWA 3KKFA 1BRLB 1PWLA 3LCGA 2GQ8A 4YYCA 5A3HA 4USKA 4NRRA 1K4GA 4WZHA 5B7ZA 1VFHA 3LGNA 4I7FB 2WSCC 4BCAA 4MLRA 3WNNA 3BGRA 2CLPA 1JLGB 4D8AA 3LV6A 4X62F 1RABB 4ACZB 2QAPA 1V0LA 4CEUC 4O0KA 2EVZA 3LRLA 5AE2A 2ZE2B 3OR2B 2QJIA 2YH1A 5HAOA 2Y0FA 1BTMA 3C86A 2EGZA 2Q1LA 4ZOEA 1B90A 2A6LA 3IGSA 4JR5A 2M2BA 3W6MA 3LOUA 1TFYA 1TZ7A 4W9TA 4GVBA 4Q22A 1HNVA 1PJ7A 2J7WA 3QN3A 3QEZA 1N8WA 3W5XA 2DGSA 2BQUA 3RM9A 4ZB2A 4DLMA 3TEHB 4DFJA 1HPZA 4R85A 3NL5A 3QPEA 2Z24A 3ARQA 4J7RA 4P7VA 3TAOA 1UD8A 1IT8A 1ODZA 1VQ7S 2FMNA 1K8XA 6ENLA 1OPIA 4L3KA 1FTXA 5BWFA 1M1HA 5LSOA 3WJYA 3R5JB 5DY3A 1TPFA 4LREA 3S5NA 1PKYA 4OJHA 2FVPA 3HHNB 4UR8A 3QAUA 1LQ9A 3UJEA 1ALDA 2ESCA 2DD8S 2MGZA 3BL3A 4GY1A 2C3UA 1Q16B 5M1TA 2OOFA 4LRDA 3URBA 2W2OP 4YJ5A 5FJRA 5H6HA 3LQGA 4ZVFA 5KG4A 1U1RA 1IM6A 3CJTA 2QFJA 1LWXA 1TK8A 3R4IA 1KWMA 3GIJA 3TMQA 4W5UA 2CZ5A 2AGPA 3OA3A 1GVEA 3U57A 1M9HA 4ZVQB 1Q7LB 1LWCA 2CZFA 2UY4A 3VD5A 3JR2A 3CJ3A 1FWKA 1UR4A 4LB3A 4Y9OA 5K2ZA 5AYXA 1FD8A 2KKHA 2KM8C 3M44A 1S97A 3H2CA 5H91A 1OQFA 1YJUA 3IAPA 4Y9PA 4WFAQ 2MQQA 5A6WA 1HKVA 2VHGA 5GMKa 2PTDA 5DQIA 3LY0A 3OW1A 4DEFA 2EKYA 3R5AA 4IRCA 5DCBA 4Z17A 4GOAA 2ZDOA 5L9NA 4K3ZA 4ZQRA 1RJJA 2EBEA 3LBCA 3R10A 1Q6OA 4I5UA 1I3OB 1VBYA 2Y24A 3A3OB 4C0OC 4ZPWR 1N6QB 1ADSA 5ABFA 3NO3A 4OQVA 3OLBA 5CSUA 1URRA 1B64A 2HAFA 2DZSA 4ERDA 3H4WA 2QE5A 4WFXA 1VMBA 2FGOA 2F6UA 4RV3A 5J2NB 2CW6A 4A8QA 2EBGA 3ZT5A 4GVFA 2GVEA 4LUSB 2MZRA 4M5GA 2QCNA 1Q5MA 3AXIA 3V18A 1D8ZA 1XCFA 4PBGA 3KJVA 2PWUA 2QCGA 4NXMJ 1VC6A 3LENA 4DCOB 4KIEA 3GS6A 1KBBA 3EDJA 3ZR4A 5J2QA 7ODCA 4IP5A 4U8YA 4ZE4A 2PZNA 3OR1B 3R27A 1ZM9A 4KEVA 3AS1A 1CXFA 1YTKA 3UR3C 2GSEA 3EB2A 3W26A 5LXYA 3MPWA 1M7OA 3MU7A 3SUWA 3LCXA 3LF0A 1CIUA 2RE1A 2WVTA 3LD5A 1TMJA 1TJ2A 1CQMA 4UUWA 4TR9A 3HVAA 4NU7A 2WJEA 3UPWA 2CEQA 2G4FA 1WE5A 3HQNA 3EDQB 2DB1A 6FDRA 2EHHA 2CBIA 1SI9A 1R86A 2MQMA 5KFFA 1J79A 3CE8A 3DFOA 5HMDA 5E2QA 4D6EA 2PGWA 4DV2J 2CQ0A 1SW0A 5BXIA 5I77A 2FH6A 4ECUA 4ANEA 5EMLA 2HISA 3KRUA 2JDJA 1EF3A 3S9IA 4LBIA 4RLIA 1K02A 1UCNA 4K4VA 2F2HA 3SQSA 4F66A 4PXCA 1S6UA 3PUGA 2HHVA 2J75A 4LF1A 1IKWB 4PR6A 3T41A 3DC2A 2Z7GA 2BVZA 1KXVA 3P7YA 3KK1B 4MNJA 2IKJA 4GX9A 1DOSA 3GHUA 4A35A 1RT4A 3WF0A 4WKRA 5K8MA 3NPXA 3LP2A 1MZHA 5EY5A 4J3VA 3K0JA 4IUOA 4UMBA 1FWCC 4BDPA 2V6AA 3LCHA 1VJIA 4HZ8A 4UIOA 4DJEC 1RISA 2MLZA 3C2VA 4DSFA 3S6DA 5DMMA 3R12A 4O44A 3JAMY 1UKOA 4ZLLA 2C1GA 1NSPA 2B4GA 4MMWA 3AXHA 3N79A 2NUYA 1HWJA 4RUAA 1FNXH 1GG1A 4HKPA 3LB0A 1M5WA 1WKLA 4JIRA 4ZVSB 2X8RA 4XVEA 4O8RA 4ZQOA 1TV6B 3HJEA 3EXYA 2QCLA 5D2YA 1HARA 3PKYA 1LL4A 3O6DA 3IWXA 3HA1A 4A8NA 2VT0A 3QSYB 3M0IA 3EOSA 4PMQA 2VJVA 2YSWA 3AAMA 1WPCA 2BHYA 3PULA 4L9YA 3PP7A 1VFUA 5FD0A 3DCAA 4FYYB 3VTIA 3BKFA 3M9YA 4AMAA 1X9SA 3A8JA 1FCUA 1R8PA 5A5WA 2FHKA 1CQNA 3SZ2A 4NXNJ 4LFAJ 3K1GA 3W70A 1IZJA 1TTPA 3PX6A 1L3UA 3TN5A 1KKHA 2J47A 3W1RA 2HNYA 4C7DA 3MEGB 1MSWD 5MKGA 1PVNA 1PX4A 1C93A 3R1LA 3QYSA 1FFSB 3BLIA 4JFUA 4GNJA 4DBUA 2B5JA 3DGVA 4OI6A 4MM1A 3RGIA 1MROB 3NL2A 4WJ8A 2Q3PA 3T42A 1TTQA 1UIPA 1GCYA 2RQ4A 1W3LA 1XIFA 1PSDA 4C4WA 3T09A 2Z58B 1BYBA 1J6OA 1K9DA 1ZFJA 3O63A 1FWRA 1KB3A 1US3A 1GGOA 4OZ2A 2HHQA 3B54A 4UTIA 3L4YA 1MWZA 1R3NA 2WRMA 3HT0A 3VAVA 3V6DB 1ZCOA 4V1XA 4ADUA 1P6TA 5HROB 2J79A 4RUCA 1WOBA 2QYGA 2YL9A 4RJEA 4YUDA 1OY0A 1NWRA 1FWWA 2J7BA 1UKSA 3FSUA 2Y7EA 4AYGA 4J40A 1N7KA 4IL0A 3JRKA 5EU9A 1XRTA 3CXCR 1JJHA 4DNHA 1ZTTA 1IXQA 3RM4A 1TKKA 4AX7A 1FQ0A 1TPC1 2XFWA 3ZVHB 1VQLS 3NCRA 2KVIA 1EEXA 1I1XA 2J7FA 3K4AA 3MAHA 4CO4A 4CNPA 1N34F 4MY8A 3VOJA 3TTYA 1UJ4A 4QZVB 2WMJA 5ETVA 3AHPA 4A8WA 3T9NA 2XWDA 1YITS 2NV1A 3Q8QB 5CBJA 3OVBA 1K73T 4WCJA 3B0PA 3DHWC 1XS2A 1CYGA 3MMBB 3TNBA 1EP3A 2F7VA 4Y2IA 3PAOA 5H8UA 2Q02A 3PK7A 3NSNA 2JLGA 5HANA 3H26A 2FJKA 1QY7A 4J9UE 1W2PA 2PGFA 3MI3A 2O7QA 1PHQA 3QHMA 5KFYA 4GHRA 2DFAA 3F5LA 1RHQB 3VK5A 1MQRA 2F9DA 1SSDA 3UXIA 2R8KA 5D8ZA 1V3LA 3MM6A 2ZOMA 3ITYA 4ECYA 1S0VA 1VLWA 1WZAA 2CYYA 3CL6A 4D6HA 2YL5A 3HM7A 4B2DA 5ETKA 1CB2A 3L9ZA 1F8IA 3N9KA 3MAQA 4QW8A 4KS0A 2HMIA 2RFGA 3POTA 4CM2A 1I8JA 1G0CA 1GOQA 1Q66A 4NLYA 1TX0A 4JI7F 2JC0A 4OZOA 1H41A 1JF5A 3ZR6A 2EK1A 3OTDA 3KMQA 4LIRA 1AD4A 1F3TA 2V5KA 4H6EA 4W5ZA 1VQOS 2GQ2A 5AXKA 4ECRA 1UBPC 2VFHA 2YOCA 3S6EA 1GOXA 2FVRA 1FXLA 3MI6A 1FVQA 3L66A 1BUXA 3UCGA 1H61A 5F8GA 1LORA 4DVOA 3RB6A 5AXNA 4QIUA 4KT0C 2VL1A 1MUWA 3RRHA 5KT5A 1E51A 1B57A 2FHJA 1EA9C 2QMKA 4C6AA 5C5JA 2F2KA 1ML1A 5IHRA 1Q63A 2GHVC 3NWGA 1LP6A 2ZZ4A 2FB3A 1RT3B 4WEVX 2FH8A 3KTXA 4HU8A 3VDGA 1DWGM 3P8JA 5CSRA 2ZBQA 3RG6A 2PRMA 3MPDA 1QOXA 2QXWA 3UF9A 4V1YA 4U9RA 2NSOA 3VAJA 4QQUA 3QOKA 5KFSA 3SUVA 4NZ3A 4FNRA 3ZJ7A 1N5QA 3STFA 5HQLA 2P9EA 2D20A 4JHOA 1WUFA 1YNPA 3ZJKA 1HNZJ 2ZC8A 5SWUA 4A46A 1IYXA 1NJJA 1QT1A 1PIGA 5TAOA 3JXOA 2CWXA 3O1NA 3R5DA 3EVOA 2HVHA 4GE8A 1TK0A 3DOLA 4CD7A 2XC9A 4ATWA 4DUXA 3F4WA 1CGUA 4JQ2A 4GQ0A 1YTYA 3LRKA 1NB2A 1UFLA 4KCVA 2DNZA 3H0PA 5GADU 1CX9A 4QQBA 3ULHA 1A3XA 3ZTPA 5IT9Y 4CGTA 4IO9Q 4IGMA 3U1MA 1K8YA 4X61A 4HYRA 1T8QA 1ICSA 2DNGA 2HFNA 4HCDA 2R8WA 1JQXA 4XKYA 1VCFA 1X4GA 2M9KA 2X7WA 1RHJB 3JUGA 1GK8A 4EXBA 4F2TA 2HEKA 2QCFA 4DF4A 4FNPA 2IUZA 2AP6A 3UBPC 1SJ3P 3IAS9 2PDQA 4M6VA 4KHMA 1PZ1A 2HK0A 1FXPA 1NPKA 4ZOAA 1U1MA 3AQPA 2FHFA 2NXGA 3PDNA 1V0KA 3L7RA 4A3QA 5M03A 3MUY1 3BOFA 4NAFA 3PEHA 4K1GA 8ATCB 2AL2A 2ZZ1A 1S4FA 5LHFA 2OJPA 1ONWA 4WCEQ 1EP4A 4RNFA 1N56A 3ARPA 3CBWA 1ITPA 3IO1A 4GC7A 1UEUA 3BBBA 4MWAA 2CXGA 4KGMA 4GIRA 1R27B 3FCWA 5JIWA 3GNXA 3UD4P 2DGVA 3DMJB 4WK1A 1U1KA 1N36F 1VFOA 1Q8KA 4IGSA 3GG0A 1JI1A 3GO2A 4AAJA 5AHNA 4W4MA 5CD4H 5E5CA 2PGCA 3THUA 1ZJAA 3VKDA 5FF0A 1WNOA 2V2CA 3N12A 1GT8A 2XZ9A 5I3DA 3RCYA 2I8EA 3I32A 2V3EA 2VR4A 4ZVJA 3T40A 3SCPA 5B0GA 1WDRA 3HVWA 3GC5A 1QAYA 3S6TA 1YSJA 1CLVA 1KR1A 3EX4A 1UWRA 4HA3A 1F6KA 1D7FA 1C8VA 4FPSA 2HJPA 1GVFA 4N02A 1J5TA 1XGEA 1YDVA 3WNOA 3O05A 1Y0HA 2WK4A 3ONQA 2AU0A 2E7FA 4CNYA 2V8GA 2HQAA 1E6YB 6TAAA 1VPXA 3AOFA 5KFVA 3SIMA 4DL4A 2QL9B 1SO5A 1J93A 2ZUGA 1ITUA 2BASA 3C2OA 1QHPA 1T95A 2G97A 3NXLA 4Q8MA 4D6FA 3T0AA 4UOQA 1ZOTA 4W7VA 3SGUA 3WK2A 3M41A 4XAYA 3PBWA 2AMGA 4TMCA 4DX5A 1EC7A 5JVHQ 2CQBA 2YY3A 3BGLA 4RW4A 4LY8A 4NMLA 3ZTSA 4D6CA 3V5RA 3FOKA 4MFBA 2C3PA 4HB7A 4UOCA 2E1MC 3LZ5A 3S1GA 1M53A 2YX0A 4PZVA 4JI6J 1V7AA 1W1TA 4TY9A 4LWWA 2C2ZB 2DR7A 1IXOA 5CAKA 4F67A 4B92A 2C15A 2EWHA 3I0RA 3H4BA 2YCIX 1FH8A 3RLUA 2C1HA 2H6RA 1VCTA 2GHPA 2PDIA 4RNIA 2HEJA 1XMQJ 1J4EA 3CU2A 1H50A 1DIKA 2ZVSA 4MFEA 3PC0A 2B7CB 3ZS4A 4FR6A 1AXQA 3K2GA 4GQRA 3FSTA 4J35A 3MJYA 3NPWA 3SQGB 5DETA 1S2VA 3NQ6A 4Y6IA 1XDJA 2ZRYA 2WVVB 5DCEA 1D09B 1NSKL 3S2MA 3QPIA 1M90T 4M29A 1L3SA 3KBVA 4ROQA 3ABRA 1KQZA