3WQPA

Crystal structure of rubisco t289d mutant from thermococcus kodakarensis
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFDRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation design of thermophilic Rubisco based on the three-dimensional structure enhances its activity at ambient temperature
rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 149
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3wqpA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3wqpA01
2OEKA 2V63A 5HAOA 2V6AA 5HJXA 1AUSL 2V69A 1RSCA 2QYGA 3A12A 1GK8A 3QFWA 4NASA 3WQPA 5HQLA 1SVDA 3RUBL 8RUCA 4F0MA 2OEJA 1UWAA 4HHHA 1RCXB 1BWVA 4RUBA 5HATA 1IR2A 1IR1A 3RG6A 1UW9A 2CXEA 3AXMA 4F0HA 5HQMA 3FK4A 5RUBA 4MKVA 1RLDA 1BXNA 1RLCL 1UPPA 1RCOB 2YBVA 1IWAA 1UZHA 2CWXA 3NWRA 5C2GA 1RXOB 2OEMA 4LF1A 3KDOA 5HK4A 1UZDA 2OELA 2V67A 1AA1B 1UPMB 2RUSA 2ZVIA 5HANA 1GEHA 2D69A 2V68A 3AXKA 3KDNA 3A13A 1TELA 2VDIA 1YKWA 4F0KA 5C2CA 9RUBA 1EJ7L 1RBOB 4LF2A 1RBLA 1RUSA 1WDDA 5HJYA 3ZXWA 1RBAA 2VDHA
chains in the Genus database with same CATH superfamily
4OV9A 2CVIA 3LI1A 2P9CA 4CZCA 3KEHA 4RXFA 3ZLHA 1E0WA 3GXDA 5HSPA 1L3SA 2NYHA 2FGZA 4EWTA 5F0UA 3FK4A 2BDQA 3EDFA 4MSSA 5IQ6A 2R7WA 3MYPA 4XK8C 1HYSB 2JOQA 3UGRA 4HZ8A 5EGYA 2ZTKA 3TN6A 4A3QA 1EEPA 2EF9A 1TIWA 3HKWA 3CZLA 1XIMA 4WJEA 2FHMA 1FWAC 2ZH7A 1SU5A 1UHVA 2IPFA 2IQTA 4EP8C 2OWWA 4Z2LA 4M5GA 1UP1A 1YJTA 2M52A 2A0FB 1J27A 1F9FA 1L5UA 1VJQA 3GHRA 4C8OA 2V5JA 4USHA 1HW9A 2OT1A 3H2OA 2JWNA 1WC6A 5FDLA 2PFHA 3CVKA 3HSJA 3ENLA 5G4WA 2PGCA 3P8JA 5FJ4A 3WUGA 1IVZA 1O60A 4FXWA 4F04B 3RMEA 3A23A 2BMBA 3DCAA 1YZ7A 1IXKA 2HBZB 2B8PA 2E6AA 2BBFA 2XSJA 2PDNA 1J11A 3NGJA 1O12A 1KKHA 2YL9A 2JLEA 3VNZA 2DEIA 1RWVB 2O55A 1QNPA 2P3EA 4N8OA 4FF1A 4W7UA 2XIJA 4LF9F 2CJYB 3M0HA 3OLGA 4NNAA 3A8IA 3NQ6A 3GJQB 1WOSA 4WKRA 1PDYA 1WDQA 1HQUA 1F4AA 4FS1A 3CGIA 1OY9A 1X5SA 3FS2A 1QBAA 1FJCA 2YLLA 3P5ZA 2EG8A 4DM1A 3PY8A 2QQ6A 5D32A 4ZOEA 1KCXA 5CC3A 1UEVA 3CDBA 4IP4A 4JTCA 1A53A 1W32A 1BPLB 3TAQA 4B9SA 4HEA9 3WUEA 3Q2SC 4KR0B 3WQEA 3GSDA 4RNNA 1Q6QA 4F02A 3KDOA 1JLCA 1W25A 1CB2A 3WC0A 3EZ5A 1OEPA 4J3SA 1IYXA 3R6LB 1EYWA 4ZTXA 2UY3A 4NAEA 1NK5A 4RDYA 5HMXA 4DV2J 4JI8J 6FD1A 3LPFA 3A3PB 3ARUA 1MSWD 2DISA 1U1NA 1YE4A 4DV4F 1P6BA 2PMQA 2O3DA 3E49A 3T3FA 2RFGA 4DZ6A 2IHR1 3N1AA 2ANUA 3VINA 1W56A 4AB4A 3BR8A 3IUHA 2D24A 1QHOA 5AOUA 2Z2YB 3PIOQ 1B2YA 1XQKA 2B3TB 2AX1A 2B7PA 3GU0A 4J9QA 1E0UA 3GIYA 1LNQA 4IIHA 3UNTA 1EJUC 1UA3A 2WZIA 3KHRA 4XD6A 2FPHX 2A3BA 2GVDB 4TN2A 2OJPA 1WYIA 4G6CA 3TCSA 2HRWA 3CLWA 1XH0A 3XINA 3ITVA 4IYQA 1H0HB 2BM1A 1E9ZB 5LNWA 1XIFA 2H9AA 3NXFA 4V1XA 4PUUA 1SIZA 5LSRA 1J01A 3VIHA 1W5QA 3R8RA 4H4OA 1XD0A 1OG6A 3M8WA 1D09B 1CIUA 1KLMB 2PLJA 1OPIA 3EBVA 3BO3A 1PTAA 3QR1A 5LIUX 3P3DA 1P1TA 3L67A 3UY7A 5JH2A 3FFIB 3NM1A 4A4AA 3GXPA 2AZ1A 4ZEPA 1REQB 1B3VA 4JTIA 1O0PA 2MQNA 5AXKA 2DR9A 3MP3A 2MKHA 3SCUA 4A3HA 1LW2A 3G82A 3A9IA 1T02A 2IJFA 3PZPA 4KKOA 2OPQB 4ZPDA 4Q7BA 1X97A 2WO5A 2YXGA 2LP4A 2JEGA 4LF8J 1WKFA 4L6DA 2G41A 2X0HA 3O6DA 3OXLA 5FF7A 5HJXA 1AYEA 4NZ6A 4N47A 1T3NA 1HHQA 4C1KA 1KRAC 4X4OA 1J0YA 2KKHA 4DPYA 3MS8A 1EP1A 1E9YB 4I7VA 1WWHA 3C2OA 3AS0A 2HMIA 1BWVA 2VQTA 3UWVA 2HZGA 4PUNA 5AC8A 1OFPA 3SCOA 5KFFA 3DLLQ 3T40A 5B7YA 4GMKA 1Y3JA 1S4FA 3I87A 4BWJA 4RDWA 3SSSA 2VA2A 4PAAA 1T7PA 3BC9A 5KZMA 3T5KA 3GE9A 4ZP9A 2Z25A 2ZUWA 3VFLA 2DZPA 1J6OA 4UWMA 1S9FA 3WIUA 3CHDA 2JVOA 4U2ZA 4JNZA 3W7PA 3U5YA 2CBUA 4NZ4A 1G5AA 5A8RA 1UIPA 1RA6A 5L1LA 1Q2RA 4X66F 5C9XA 3OL6A 1ZAJA 1UAWA 3OLIA 1VCVA 3QZAA 1C1BA 4KY3A 1PCAA 1U1KA 3T1YF 3GG1A 3EGZA 4DQQA 3ZTRA 4XAFA 1WKLA 1Y10A 1LUCA 2EPKX 5KFPA 4I9JA 3MR7A 2W27A 3UG5A 5EA9A 2OP5A 2JRSA 1TTPA 3FKBA 2WHJA 4QTGA 1A5AA 1ELSA 3HF5A 1TFWA 1EC7A 1KD1T 2L08A 3EPGA 3Q8RB 2WBKA 4QEEA 4Y0FA 1FH7A 4B5VA 4O8AA 3PP7A 4I68A 2M4MA 3FAXA 4XDCA 4Y2WA 1NP0A 2F9JA 2ZVIA 3W2KA 5KFXA 3KCJA 4IRDA 5MLCV 3CMAS 2PTWA 4G1KA 3IN5A 1QTNB 2O4MA 1OGBA 1AMYA 3N6JA 5D8HB 4GVHA 2ADBA 4JHZA 3FFIA 4CO3A 5JIWA 1PKNA 1PJ7A 2RILA 2BJ7A 3WUFA 4F8XA 1OFOA 3VZZA 3RR8A 3LA0A 4YMEA 3KBJA 1GTHA 5FSEC 2YBVA 3S0CA 3BH4A 2W2NP 2FLLA 2CPYA 3QPIA 2FB0A 4LY4A 4ZMGA 1CPZA 1MRAA 4AHQA 3JB9k 3NMAA 4V1YA 4UOFA 1RAGB 3DHPA 1MSSA 1LJYA 1VBHA 1U0HB 5I3UB 3TYBA 2FDNA 3S6OA 5I07A 4AD1A 4PXCA 1W1B1 1O94A 5T9CE 1AH4A 1EUNA 1XUZA 2XIQA 4WIQA 3BO4A 1P9QC 4B3OA 4CNPA 5ABEA 1ELOA 2IJNA 4ZVPB 3AMLA 1VQOS 4OYPA 4C4WA 2OTJS 2WJZA 2DIVA 2V3EA 1U5VA 1WELA 2KYXA 2HBRB 2G95A 9XIMA 4TO8A 4CLPA 3DG6A 2NT0A 1Q8KA 1D0EA 3VGUA 3Q8PB 4DEZA 2GCFA 4C0OC 2WVSA 4USUA 2LXIA 2JBMA 4U8VA 1ITXA 3PHTA 1QWKA 2CXEA 1MZHA 1QOXA 2KZMA 3ILOA 3WQDA 2C14A 3SUVA 1QE1B 1CW2A 1EJRC 3HHNB 4XKYA 2YKNB 1YLVA 5DEZA 3VIMA 4GY0A 2VFHA 3AIQA 3ZMRA 1RTHA 2HW3A 4B91A 2HG4A 4GCXA 2V69A 1JB0C 3HHLD 2BGNE 4Q44A 1EQPA 1RAEB 3EX4A 3W76A 2GFTA 4NEYA 1DIDA 3H4WA 2WONB 4J9UE 4JTGA 1EARA 3PRVA 1ME7A 3V2UC 1NHKL 2BRLA 1XKJA 2G0CA 3H70A 2PWFA 4CIOA 4ZOSA 4ZR8A 3R5BA 2CNCA 3OUYA 4GVLA 4LF5F 4BS0A 5CA5A 4RZBA 4NZ1A 4OI3A 1Z44A 2QL5B 3IM8A 3NQCA 3WLPA 4H3DA 3BZGA 1NDZA 4ZXOA 3RXZA 2DIEA 3TOPA 5IC4B 4X3ZA 1FF2A 3AB4B 3QBCA 4H6RA 3NSNA 2LQ8A 1XWYA 5A8WA 5D8WA 4KQZA 3TTSA 1S72S 2R2UA 2UWFA 4S3AA 4PUEA 4PEOA 4F4XA 3GR1A 3Q22A 5D38A 3QWPA 4GO5X 1VRXA 2NQHA 4OQJA 5D03A 4MFBA 3IAM9 4QR6A 4DL7A 2J47A 3P7YA 2XY6A 5AECA 1TRDA 2Z28A 1V0LA 4ZKAA 3CCSS 2C2KB 3FCVA 4ZPVR 3BG3A 1SBRA 4DFMA 5IQQA 1F9HA 2IDEA 2GK1A 3R27A 3Q58A 2PTDA 4BQ5A 2WKJA 4DZAA 3Q8SB 3DCPA 2R9RA 3STCA 1NUEA 4K8EA 3GH4A 4ANCA 4P8WA 4DR2J 4CNOA 2PLCA 2BV3A 3WQOA 5D2XA 2GDUA 3CUIA 2CZ4A 4FF4A 2UP1A 4QJ5B 3RB0A 5C8BB 2ISWA 2CHRA 1HMVA 1TPB1 1GK8A 3OFEA 1RT5A 3CH9A 3PBMA 4X2BA 3WJYA 1HWJA 2CLMA 3PBVA 1K0TA 3U4AA 2N82B 1UKSA 5A8NA 3R79A 4E4PA 2BJ9A 4MK9A 1VJSA 5C7VA 4P2SA 3MDUA 1NKCA 2Y1IA 4NHVA 1YPFA 1GKPA 3K8KA 4C6MA 1VQSA 1FI4A 5HO4A 1Z2LA 2QMWA 4WRHA 3WBYA 4ZGYA 5K2ZA 3TW7A 2XC9A 5G2WA 3W22A 3WNPA 1H74A 5B7WA 2OMAA 4DV1F 3VO0A 1FK9B 4DJFA 1B0VA 3CU2A 5FF4A 1FDBA 1Q6GA 2G3MA 2ACMA 2RHSB 4F26A 3KFWX 2J9YA 2DGXA 2V3FA 4Y2CA 4ML4A 3ZTSA 3WK2A 4DSIA 3ARYA 4FXJA 2DZWA 3SIPB 1TR1A 1LLZA 3F5JA 4KEMA 5DO2A 2ZDSA 4O16A 5EUHA 1AQHA 2C71A 3R11A 4DI8A 1C8YA 1BF2A 4P8VA 1MN7A 1UBSA 2IDLA 4GNKB 4OX8A 4GYPC 1RJRA 1E6SM 1R0MA 2XSBA 1RA0A 1RAIB 3R58A 3MM5A 1A4MA 2R14A 1KNWA 3F56A 1W9UA 1ADSA 1A49A 3LP1B 3BXWA 2KN4A 1XSKA 4F8RA 1UR4A 4J2PA 5IBXA 1F5AA 3RLVA 4M7SA 4NYPA 5GQBA 3DG7A 1JXEA 4LFBJ 1MMDA 4PMYA 2WNNA 1NBEB 3PZNA 3W4RA 5D2YA 1CJKA 1XYZA 3QRHA 3D6MB 4BF7A 3EXCX 1GT8A 3HDSA 3F73A 3SYZA 1VBJA 1HL6A 3CCLS 1A80A 1ZBTA 3HXMA 2VQFF 1QTMA 1SW0A 4AD2A 2PE8A 4S0MA 1TMMA 5T9BG 3VD4A 1TL5A 4Q8TA 2VUYA 3L2LA 4X2PA 2YX0A 4MFDA 4L65A 3M8ZA 1BLIA 1HWIA 3I7SA 1QNOA 3C0SA 2Z1WA 3T19A 3BKTA 3COTA 1NPRA 2O67A 3RW7A 1EF3A 3CYVA 4NLXA 5KG7A 2RQMA 3VX0A 1I9CB 4PYAA 3NO5A 5B0DA 3H40A 3CJPA 1W9DM 3B8SA 3W73A 4RO0A 3GB6A 3O6AA 5HA7A 3KLKA 4C11A 5BYWA 1HT6A 1DJGA 3G6YA 5FJPA 3ZTPA 3E1F1 5E6YA 4WK9A 2QCGA 1RT5B 3VYLA 4JHOA 3MDFA 4JV5J 1P0KA 4ZDNA 3R5JB 4OI1A 3PNIA 2XIBA 4LCQA 3CJKB 3KMSA 3JR2A 2XSJB 3JAMU 1VFHA 1KOOA 3C2VA 3HHKA 5IBXC 3RBXA 4F25A 3FZBA 5DG7A 4IISA 4AY7A 4XUGA 2ZDPA 1D8WA 4J35A 1TPDA 2ZBPA 2RF2B 5K5MA 3KG0A 2J27A 2DNKA 3CJ5A 3QGIA 4U3CA 2QSFA 2BS9A 5A8KA 1CGUA 3G9CA 1QVBA 1QO5A 2DGUA 1RV8A 2CQBA 3DRRB 4WY0B 3SGUA 4JQ3A 4N76A 2A6LA 3N6NA 3ZFHA 4A2RA 3CH0A 4OBTA 4DBDA 4DR7J 2VFDA 3LWMA 1XR6A 4F0SA 1SL0A 1GX5A 1NELA 1UP3A 1X6NA 1UZHA 4QNEA 2VPYB 2OAUA 4FDFA 4DV6F 4U5KA 5D0HA 3E01A 2ATSA 3WDHA 3HFTA 2G8ZA 4B90A 1FTCA 8AT1B 3OYXA 4Y34A 3SY8A 4CQCA 3DU6A 3AXHA 3VAGA 3R5EA 4LEQA 5EL1A 4ZPAA 3J81j 4O3RA 3J7HA 2PA3A 1HYSA 1IZCA 2HXTA 5JUVA 1WBHA 5AKQA 4XISA 4H2HA 2VEFA 3EMCA 2Q01A 3MWAA 1UFWA 2ZC3A 1SW3A 4DJDD 4Y3CA 3VFCA 3VGDA 2EC2A 4XBJA 2G1DA 3K57A 2OFGX 2KO1A 3U2CA 5KFAA 4GMEA 3N01A 2EK6A 3PULA 3PUOA 4XQ6A 4GH1A 1VJWA 1V9OA 1CGYA 2CKRA 4NT0A 4UXDA 3WQVA 5D4OA 3FVDA 3MSDA 3CMGA 2VONA 4H9VA 4ELVA 4DS5A 1F8IA 3W71A 1OADA 4NF7A 3L4ZA 4AISA 3FN9A 2FJDB 1XSIA 2MMYA 2CCRA 4WFZA 3MMWA 4K3ZA 1I75A 1M7OA 3VAVA 4DUZF 1IR2A 2BHZA 2NCKL 4OKDA 2QYCA 4QXIA 2IUZA 1RHMB 3GV8B 2JF7A 5IFMA 4WKFA 3IJ8A 3G1XA 1Y4ZB 4BI7A 2Z0GA 4MYUA 6TIMA 3OQEA 4G56A 4IMGA 3CUNA 2GUBA 1JZ7A 3DESA 1BHGA 3P0WA 3BG9A 4O44A 3OVPA 4Y2KA 1E6ZA 1N4LA 2EJAA 1O5JA 4CQ9A 1REVB 3R8HA 3PFOA 4A8WA 3NKYA 3WX8A 3TJXA 3NQMA 2W0UA 3UN3A 4OX9F 1KFEA 4LC8A 2JIWA 3VD3A 3KUEA 3FUYA 4Z2KA 1FCQA 3I0SB 3IWLA 2ZRWA 1LLWA 4LGXA 1ZJAA 3Q89A 4NXMF 3PR4A 1RHUB 3NL3A 2N3OA 3H2NA 4OQVA 3SFWA 2QYGA 3BZQA 4UF4A 2G0WA 5DZ7A 1JUEA 2R8KA 5AYXA 3IC1A 3W1NA 1EOKA 3QQWA 4D8AA 2Q02A 4L6V3 1F6TA 3QGKC 2DGOA 4HH0A 4URQU 5F0WA 1J93A 4EE9A 2FLIA 1CULB 3G82B 1S77D 4CH0S 4ANEA 3DDIA 3OVAA 4UQDA 2MKCA 2QJNA 1TL3B 2OYMA 2HJPA 4DJBA 1FRBA 2Y0BB 1VFOA 3UZ5A 1KRMA 2GO8A 2Z58B 4LT6A 5A8MA 3N04A 3WNLA 2X41A 1NCLA 1HI0P 3VOJA 1TPWA 3MCNA 2QJ3A 4KGKA 4XAKA 5EMLA 1PDZA 1TQXA 1B54A 5A3HA 2GA7A 2BY0A 3MTJA 1TUXA 4X9SA 4AWTA 1RU2A 1GWJA 4O3OA 1R27B 3OP2A 1KC7A 2R6OA 4DV4J 1ZYQA 2QW5A 3STGA 2RDWA 1K4GA 1QO2A 4H9ZA 3BN4A 5CG7A 5MHBA 1O68A 3KK2A 2F6XA 2WNWA 5IRPA 5A8WB 1WHVA 1FRIA 3M0JA 2EAWA 2PO4A 3C8FA 3W28A 2XWDA 4DBUA 2P53A 5FIPA 4A3YA 4L76A 1RHQB 2XM3A 2J7BA 4EXBA 2P6TA 4CM2A 1C7SA 2YZ5A 1WF0A 3DI6A 2ZZ6A 1FHLA 2W4PA 1SUQB 1JVNA 2ACQA 2EPOA 1XRFA 3WF0A 2TODA 3GPAA 2JKPA 3UDCA 3ZS4A 1ICSA 2KFYA 4MNJA 3VIIA 4FX7A 1E6YA 2PSZA 1EP3A 4F67A 1JFXA 3ZWTA 4HHUA 1ZM2A 3TYAA 4A6GA 5FAGA 4F4RA 3R0DA 3LBOA 3TN5A 1KWKA 3J81Y 1H7RA 1QSSA 3MUMP 2BHYA 3EWYA 1H4PA 1UKPA 1NWRA 1JUKA 1IKYA 4JN6A 2OTLS 2OD6A 5E41A 4WDTA 4QE4A 1IEWA 1VISA 3EZUA 2WK4A 2MQLA 3E01B 3GR4A 3B0YA 2G3IA 3E2VA 5CAAA 5LJ3Y 3T2PA 4PN2A 3NSXA 1GOIA 1WJ9A 3IIPA 4XIAA 4EYIB 3QW3A 4JX4A 2GQ9A 2B7CB 5F3TA 5HNRA 1E6YB 1Q63A 3M0KA 1Q86T 3Q8YA 4JI5F 1GJPA 2YPYA 3LTSA 1JPHA 2RH9A 3HP6A 2GGIA 5IFPA 3SSJA 1FERA 1SQGA 1QXLA 3K7RA 3REQB 1C1BB 4JFTA 4H6EA 4J5NA 1KA9F 2WSKA 4DFKA 3HHEA 3S2JA 1ECEA 4PEEA 1U0HA 3RTVA 4FNIA 4M95A 1OF6A 1SC3B 3M0XA 4ZVSB 1TAUA 1BUXA 5KFKA 3P8IA 4GYFA 1UD3A 4GUGA 5KFZA 1UKTA 2FPYA 2DY1A 3LPPA 3W7GA 1UPPA 4RK8A 1DTQB 3YPIA 4X66J 1V3HA 4MOZA 1S1XB 3LERA 3FA3A 3H2EA 1UCWA 1S3HA 2FZ8A 2GMJA 1Q6OA 3M0MA 4FB7A 1XSJA 1K9DA 2KH9A 4NXNJ 3R0UA 4PSPA 4AZ5A 4OX7A 3WDPP 3MI2A 4JN8A 4HPHA 4PMRA 3LQVA 3WD2A 4IMCA 1RTZA 3VDHA 1HBMB 3C0LA 3HG3A 1FXLA 4HSHA 2WCXA 4EU0A 3G1DA 4K1GA 4OV4A 3W2WA 2ISSA 2KI2A 1REVA 2Z1BA 1UA1A 2H90A 2MLYA 2EPMX 1SQFA 4LRDA 3LH2S 2C2RA 1JKHB 1U1HA 4M7TA 2BGQA 3FSYA 1FUYA 2J7DA 4ILRA 1Q7YT 2V0TA 3JSRA 3EWBX 1T11A 3AJ7A 1GQNA 3WBEA 5CLWA 4OMFG 5JVGQ 3CD0A 5FJOA 1F0XA 1ME8A 1XF0A 2P88A 1DWAM 3C52A 1HNYA 3AMCA 1BVWA 3DDKA 2DW6A 2FMNA 4MPKA 4IH5A 3PK7A 3QATA 5HANA 5KFBA 1H98A 2MZSA 3HV9A 3I6TA 2NXJA 4DWDA 3M9YA 2FVCA 2IMOA 2GO9A 2OX4A 3TARA 5K14A 4V19J 3AH6A 4FLRA 4XZMX 4L7ZA 1IKXB 1J2VA 3LQLA 3A4WA 2ZXQA 1H0IA 2UBPC 1JXJA 4OGZA 2YDRA 2JHEA 2ODOA 6ALDA 3HA1A 3DRYA 2D3NA 3P5YA 4J9JA 2Y7EA 1R8HA 1IWPA 3G1RA 3CL8A 2Z7GA 2HNDB 3UCQA 2W67A 4MYAA 2QVNA 3T07A 2EJ1A 4ECLA 4S3DA 4BWLC 4LB4A 2LYVA 1NO8A 4B3MJ 1VQ9S 1OY0A 2G5WA 3EVWA 3HFVA 4WUIA 2W25A 5KFHA 2VI0A 3AHXA 1JCTA 4UZUA 3QZ8A 2D0FA 3QLLA 1WOBA 4LAUA 3MCMA 1GYMA 1FX2A 4JPGA 2PU0A 1G6CA 3H2AA 2FGCA 1ZB5A 1NOFA 2R91A 2VJXA 3HFKA 4ECUA 2HHTA 1LW0B 1YE6A 5IT4A 2NQZA 2FJAB 3QGGA 4WU3A 4BC9A 5IXUA 4IJBA 2E8ZA 2E9ZA 3CCES 2ZRVA 1OZQA 4GQBA 3P82A 3PHEA 3QXBA 1BG9A 3AFGA 3W61A 1H09A 2FZCB 1XLDA 1GXUA 1U2RA 1OFAA 1TR9A 3DXSX 1ZM9A 2DGSA 4K7VA 1L3KA 4UC5A 3UYIA 1QUPA 5DX7A 3UY8A 3N17A 3IGNA 2VFGA 5KFSA 3W2WB 1WSVA 1EC9A 2OTDA 3ONCA 4RR4A 5D4LA 1GNKA 2JALA 1NJXA 1CT5A 1U1OA 2D41A 3UXLA 4HACA 2HHWA 2Y88A 2QUMA 5KFMA 4QBXA 1RK8A 2VGBA 1D3CA 4L61A 2PWGA 4ICLB 5G4HC 2E5BA 1JGIA 4QU7A 3KHDA 1TJ2A 2KAUC 2BY3A 2XYPB 3IS9A 1VOMA 4EBEA 1V6XA 3ZYZA 3KOXA 4DPXA 4JIQA 4JTLA 1DPMA 5IM51 4S3FA 4F79A 3AROA 3NZGA 1XRVA 2VNCA 4WF7A 3G6MA 3SUTA 4UTHA 1UA7A 4LSZB 2QF8A 4DCJB 3VE9A 1WXJA 2QLYA 4J7CA 4GJ1A 2PP0A 1NK0A 4TMCA 3QYQA 3KOYA 4IPJA 1XX1A 1GEQA 3HGRA 3W3OA 4HMDA 1ZBWA 3MHUA 2MQMA 3PW5A 3TAOA 4GUFA 4ES4A 2BVWA 1TR0A 2BHUA 5DMMA 1LL6A 2YW4A 1BWKA 4H9XA 3GYCA 3DN9A 2PDFA 1OCQA 2ACYA 2YCIX 2V4RA 3TZWA 3KRZA 4NYUA 3FJ6A 3EMQA 1HQ2A 1J8VA 2OLSA 1O6XA 1AJ2A 4JI1F 2OD4A 3LDVA 4BWLA 3IK4A 4E98A 1N8FA 3VWSA 3E2SA 3OODA 4X22A 1UZ1A 3KS5A 1EFZA 1NWTA 3A4AA 4FOJA 5TQLA 2IKIA 2XO6A 1QW8A 2R7XA 4URIA 5D4PA 2X7IA 3EMZA 2EBGA 3RHGA 4ED6A 3BW3A 2XNQA 2XMVA 4F50A 3ZJ8A 2E1CA 4QX4A 1PS9A 3TK7A 1I1GA 3IIZA 2Z6IA 5EY5A 4AEOA 2BDPA 3EA1A 4ZENA 2VPWB 3NP5A 2CPDA 2KRRA 4GGBA 2NQ5A 3OGSA 4PCNA 4WX2A 3TYZA 1W3KA 2VVSA 3G6ES 1OCJA 4Y00A 1T99A 2CBVA 3HPFA 2B51A 3OW1A 4M5DB 1K73T 4XZ9A 3QMSA 4AY1A 3LM3A 3L2MA 2MANA 3B06A 3A3NB 4JI7F 4NQ1A 3RRXA 1F3WA 3EOLA 3F44A 2PP1A 4W4MA 3EWXA 1DIEA 1HL8A 4W8LA 3SSRA 1VFMA 2ZZ4A 1GVEA 1R8AA 1TMHA 2CLLA 1JEZA 1JRBA 4IT1A 3E2EA 3W9JA 2H4YB 3M8QA 3RO8A 4HHPA 2WB1D 3ZFVA 2EG7A 2X42A 3BAXA 1RCOB 2M8DB 4LVBA 3D47A 4L3KA 1W1IE 4ZLNA 1UASA 3CDEA 3BL3A 1NAL1 1J0ZA 1EXPA 1BD6A 1VD6A 4AW7A 1EWEA 1X4EA 4ECQA 3RAQA 3W6LA 4O0KA 2Y9HA 2REQB 1VI7A 3AHYA 3WLOA 5HPOA 1J2BA 4DCOB 3FYPA 4LFYA 3PB2A 4PTMA 4ZB2A 4LALA 3NPXA 5FEZA 1JIHA 3A4XA 3OLDA 4HSOA 2JEPA 2Q6BA 3PF3A 3NGUA 5IFTA 2CZVA 1RD5A 1FNOA 2ZUAA 1RAKA 3GYEA 1RHCA 1MFUA 5I3FA 3CZEA 3H4GA 3IBWA 3L65A 3FC9A 5HI7A 1RWWB 4RR5A 2ZUSA 5GADI 2MPUA 2SFPA 3UW6A 3JTOA 1AQFA 3IRWP 5I79A 2CNOB 3A8EA 3KK1A 4DV3F 2HTMA 3IJIA 4KWVA 3K17A 3NAHA 3LGDA 4CCCA 2IJRA 3IV3A 1PJ9A 5JIPA 4B3OB 2Y5JA 2UY4A 2XVGA 1XLAA 1EGZA 1VQKS 3CIVA 3VABA 4BI6A 1IZKA 3NQFA 4ZFCA 2JEJA 3V3WA 4DNHA 3GBEA 3KJVB 1JLBA 1WZLA 2G2OA 2PTXA 3WQGA 3KMQA 4UMAA 4KBIA 3EUNA 2AQ4A 3G1SA 2OSXA 1LFWA 1L2UA 4DQIA 2VKZG 4GY7A 4JV5F 1S5TA 2R7OA 2ZICA 1M1GA 4OLPA 4UZCA 3SDEA 2Z6JA 3GVWA 1H7XA 1FNXH 4GUJA 3T4WA 1XNRF 1SFJA 3BBFA 4YP3A 3GAYA 4WTYA 2P50A 1LCOA 2WC7A 3K5NA 1S6UA 4J9VA 1O5XA 4ER8A 1RAFB 3PNUA 2MZ1A 3LTYA 2Z2LA 4XZHA 1XDMA 4D6JA 5JVLA 3I3DA 4QDMA 1IEXA 4UTWC 4OYIA 3H2MA 3BK0A 2HKEA 2DR5A 5CCZA 2I2YA 4YOEA 2FPTA 2PDPA 1RADB 2GDQA 2Z30B 2CWNA 2F61A 3EX2A 2Z8QA 3VTRA 2EGZA 3OR1B 3E2QA 1MW0A 2HE5A 4R3UA 2NSOA 4QIVA 3CCVS 1Q95G 3H55A 1SMAA 1W1YA 5F8IA 5BROA 5A94A 1YTEA 4K68A 1JD7A 2C2EA 4J5OA 4GXPA 3TTEA 1QUVA 5KOXA 1OF8A 2ZKTA 4F4WA 3CUHA 2BOEX 1S12A 2RJZA 1DJIA 4H9YA 3CB3A 3MY9A 3M9MB 4MADA 1V02A 4ZO9A 2QCFA 3MM5B 3FEZA 3TJ8A 5JMNA 1LWHA 1M68A 4RX0A 3C66A 2PTYA 5MKGA 4ZLLA 4O17A 3PNZA 3V5CA 3EAUA 4LV4A 4B3ZA 4IIBA 3APGA 5DXXA 5J1EB 2Q3PA 4LANA 3THDA 1NB2A 1GJUA 4O0QA 5DY3A 2UV8G 3UA3A 2X7VA 1T40A 3X1LB 3QGHA 2FLNA 2BOFX 3UXIA 4DWSB 4WXZA 2CJKA 4GI8A 4UQBA 2WSFC 1BRLB 4AC7C 1M1BA 1DZ5A 4H8VA 1CGWA 2ZM6J 3C5QA 4QWCA 3LCWA 1RT4A 3VDBA 3Q8VA 2Y8WA 1K1DA 2HXUA 3L23A 3CUXA 4US6A 2QJIA 3HM9A 4HK5A 2NXHA 3B4MA 2D1ZA 3B9OA 4QDPA 3K2GA 3BSHA 2PD9A 1VKFA 2NV9A 5AFDA 5KFIA 4BJHA 4W85A 1TFYA 1X31C 1MW3A 2POZA 1KGXA 4FKXA 3LV5A 1UMLA 3HG5A 4I5XA 3H8YA 3IFEA 5HR7A 4QJVA 5DZ6A 2BQRA 1QD1A 1ESWA 3P3BA 2AJ0A 3UR2A 5I7GA 2VG5B 1HVXA 3UP8A 4LBPA 5AHNA 1I60A 3ZR5A 3A8JA 3WJXA 1DFDA 3SCVA 3RBZA 4JNMA 1YSJA 1WZAA 4W7VA 4CCZA 2DB1A 3QO9A 4TYAA 4Q5VA 3CB8A 4NXKA 2HVDA 1D7KA 2RB7A 1S1WA 3SEOA 2C3OA 4QP0A 4GY1A 2BTMA 4LSBA 4C3MA 3QQCD 4JOMA 4CD4A 1DRZA 4W7WA 3DYAA 4DN9A 1BGXT 4NNBA 3E2RA 4KH2A 2XGIA 2VC6A 5B08A 3CDAA 3NBPB 1HI8A 4JIIX 2W9MA 3UCGA 2OQLA 1TVNA 3TRGA 2QV5A 5DCEA 3UNGC 2I9UA 1EETB 3QW4B 5EMKA 5AYZA 4JEQA 1N52B 2Q71A 5EPDA 3LB0A 3TA0A 4Z0SA 2I5QA 3AXKA 4YN5A 3AZSA 1LDCA 3DHDA 2VO5A 4CVUA 1G9HA 7TAAA 2XWXA 4FP9A 4FPIA 3VGBA 1RT2A 1LORA 3HSGA 4G6VB 1OCBA 5F9LA 1IBMF 1HP5A 1QPNA 3DKJA 1SZNA 3FV9A 1ONRA 1UVMA 2DKOB 3THAA 3LV6A 4CD8A 1SJQA 4P10A 1K6WA 3C6CA 3LAMA 1G4TA 2FIUA 3GTFA 3J7Z5 1AT1B 1NKBA 3KDNA 4NWBA 4J27A 3BPDA 1NWUA 4CLLA 4YTTA 4J90A 4IMFA 3WELA 1KSPA 5H9FJ 1CGTA 3MTWA 4O28A 4R85A 5DRCA 3SBFA 4Y8FA 4ZL1A 3FSUA 1CULA 3UJRA 3S01A 1LL7A 3MC5A 3M5XA 4D2JA 3H4DA 1E6RA 1XH2A 2OKOA 1GMVA 4O3NA 1D1UA 1RAOA 1CXHA 2ZJPQ 5EFFA 4PUMA 1NF7A 4GFSA 1THFD 3DGVA 2YWGA 5CJ5A 3NGRA 3OBEA 4QQBA 1MLAA 5A1AA 2ZXAA 4RU9A 4D6EA 2Q09A 4A8YA 3MQTA 1M5KC 2QN6B 4X64F 4LAMA 2IRXA 4YY3F 4L4OA 1V03A 4OHZA 1JDFA 2IM0A 5E1QA 1NSJA 1YJ7A 3C56A 3ABOA 2X1FA 3VNMA 3R1LA 1CX9A 4XO0A 2X1RA 4O15A 2OKQA 5C54A 2UU9F 1KB3A 2ACUA 1SJRA 4XTDA 5E0OA 2FMOA 4ECYA 3J7AN 2MZRA 4WVXA 5IZHA 4HSNA 3NOYA 1FWFC 1TX0A 3UXKA 1US2A 1PZ3A 1Z42A 4KQNA 4ED2A 4H9TA 3ISZA 3NQDA 3KG4A 2VX6A 4DUWA 3N15A 1H3DA 2HAFA 1DJZA 4Q6JA 4JTEA 3W24A 2KVIA 2NV2A 2X1SA 3L09A 3GCWP 3D3CJ 1KFJA 3OUYB 1EQ0A 2LXUA 3CNYA 3WLRA 2XGBA 5D9PA 3KJNB 3SW6A 5C9WA 2YTCA 1LRNA 2R1KA 1QAPA 1BLUA 2INZA 2E77A 1W0MA 4YHHF 1YMYA 2A4AA 2INEA 4JTUA 4P61A 3MWBA 3UQSA 1JAEA 2W8KA 3KLFB 1KBBA 2PD5A 4WJBA 5EBUA 1WG4A 1XW8A 4CLKA 1X5TA 2ZC4A 5D0EA 4K59A 3T05A 3ZR6A 1O8BA 2VQEF 3WBAA 4YR3A 1TAQA 2E7FA 1UWSA 2RUSA 1LWEB 1CXLA 4WFNQ 4FR1A 1AFIA 3FCWA 1F73A 1CGVA 2PUZA 2ZVSA 2JF6A 3LGEA 3TJ4A 4ZK7M 4A21A 3MFIA 2J24A 2AZ3A 4ANDA 2PDYA 4IX2A 4C6PA 5GAGI 1K8CA 1SO5A 5ECUA 3PBYA 1XP3A 4MYXA 3FAWA 3IJ9A 2G50A 3HK2A 4AUBA 1ISXA 8A3HA 3TQPA 3GVGA 4U10A 4LUYA 4LRTA 1S1WB 3L12A 4ZVHA 4JQAA 3TA6A 2Q8XA 1KRCC 1MFVA 2F6KA 5DDPC 4Y6IA 1EO5A 2XMKA 4G9PA 3ARZA 1B9BA 1SSGA 4F3HA 3SR7A 4J7RA 3SCLE 3WNNA 3HVTB 5CYQA 3H4XA 2OPRB 4LBRA 5H8PA 5F1VA 3I56S 3TH6A 3I5BA 2QZRA 4WWSA 4RDVA 1O4UA 2Z2BA 3VGHA 4BHYA 2KM8C 1IKYB 3QPEA 2UVWA 3T09A 3GDMA 4QE5A 3GV5B 1BXCA 5D33A 2J6TA 4I3GA 4JD4A 5C7HA 1Q65A 1A5CA 5EWEA 1GZJA 3MCOA 5FF0A 1C0TB 5L8RC 1X9MA 1P4CA 3G22A 2Q8LA 4LJMA 1S9EA 5ETOA 4RJEA 4L1WA 2ZUGA 5EHHA 4A8NA 3KE0A 3PYDA 2OCZA 5C71A 4DSLA 1C29A 4JDBA 1M7XA 1RU1A 4R5PB 2J76E 2IRYA 3K0JA 2E09A 5DDQC 1EBHA 3UG3A 3EOSA 4ZXLA 1E5NA 3F2CA 4CO5A 1FVPA 1XYLA 2YXOA 3ETOA 3ZZTA 4ZN3A 2EC0A 3EWZA 3I6RA 1YQHA 2HHHJ 5KINA 4AZCA 3MPVA 3G1VA 3IUDA 3DOLA 1NDVA 1XM3A 5HMEA 1JCYA 2VICA 2YY3A 3HHLB 3DU0A 5KFQA 1ZSXA 2ZBIA 3DU5A 4H2CA 3UR3C 5F8NA 3P61A 3Q65A 4GC4A 4FF2A 3TNOA 3GXNA 4UOZA 1KR4A 3CC1A 1JULA 1YJ9S 1UMYA 3FGVA 3K8VA 5CPOA 3G24A 4E4UA 3BV4A 3NQGA 2V0NA 2WMKA 1KQFB 2HQIA 1VLYA 3L21A 2WMHA 3ENWA 1X98A 2C28A 3R2CJ 2LKZA 4LY8A 4ZQMA 2EPLX 2ZRZA 5MKGB 5LNUA 4IKAA 3GVQA 4UTJA 1X5OA 1N48A 3J7YI 2ZDRA 1SJAA 4RNJA 5K9XA 3RB3A 4PTDA 4AD4A 1DBDA 1WSRA 4M94A 1Q6LA 4ZOCA 5HNUA 5GAGU 4O0NA 3CZKA 6REQB 1P8GA 2PODA 1OCNA 1Q3NA 4DWSC 4NPOA 4I6AA 3MVIA 4O3QA 2GQ3A 1YBAA 2ZDOA 4C8YA 1TL7B 1NJJA 3O6CA 5CSYA 4DBWA 4JGDA 1HJQA 1L6WA 2E5DA 1U24A 1M9HA 4S2BA 5HBFA 2YXLA 3W1QA 3SIZA 3WKZA 1Y8BA 5HVGA 5D09A 1FD8A 3ZJ6A 3OHAA 1WV2A 3KK3A 1BY9A 2E1DA 3M64A 4BR1A 3NS6A 3WLTA 5LXEA 1J5OB 2HHVA 5LMNJ 1N34J 3EDJA 2BVZA 3CW2C 4LVFA 5AVHA 3WMSA 3A5VA 5ETPA 3UR5A 4GK8A 2FC8A 5D3GA 4DR1F 3W1TA 4Y6GA 4USVA 5E0KA 3AOFA 5C2CA 1FTRA 2BE7D 3CCRS 4OI2A 4LU0A 1GW1A 4W87A 2I57A 1KBLA 2OELA 1H11A 4GZEA 4HNUA 4H41A 3W72A 2WVEA 2CPHA 2CITA 3BCJA 3NPUA 1OYCA 1VYRA 1XCWA 2DZBA 2QZ8A 5CD4H 2QEXS 2JZ5A 2LU2A 5BRBA 2YL6A 1LFPA 2DXDA 3ZZPA 4FPRA 1DTNA 3ECQA 3TQ0A 5AE1A 1H5YA 4FSAA 5LMUJ 3K30A 2IKJA 2RRBA 1H2UX 2WSYA 1SGJA 4JFWA 3VA8A 1WHYA 2DNQA 5BMXA 2OLWA 1DBTA 4K36A 1YZ6A 2VEGA 1VEMA 5ECVA 5BMWA 1HUVA 4YB6A 1OWQA 3R4IA 4C60A 3BLLA 1ZBCA 3PO5A 3M8PB 5D0GA 4LQ9A 2OWXA 4IFOA 2ABBA 2W4DA 2IYIA 4A8KA 1VENA 3ET6B 2ZE3A 5FL1A 5I0DA 1J18A 4DV2F 3F5LA 3QPYA 5CC5A 1BYAA 3DDMA 4J3ZA 4UB9A 1UR8A 4BCEA 2DEJA 1U45A 4ZVQB 3NY0A 5CGMA 4E3TA 1VQ4S 4V15A 2ISFA 2DQXA 1Z7AA 4B3RJ 3LHYA 2VEKA 1QVGR 2IPWA 4K2XA 4M5MA 1TV3A 2YWHA 2ZOXA 2GVYA 4Z1YA 1B57A 2A2DA 3MEEB 1ZM4A 4CT8A 5J2QB 4PRFA 2CZVC 3JYTA 4C7DA 1ZY9A 4Z7CA 1SPQA 5DMNA 2QX0A 1XICA 2I16A 4FLSA 1CVJA 4X9YA 2BABA 4BKNA 5LZLA 1E4MM 5CPNA 1ZJHA 3FKRA 4KV8A 4OZ5A 3V1HA 3VDCA 4L74A 2GZXA 4AQLA 4DXKA 3LGHA 4ZCKA 1GEHA 1HNIA 1RPKA 2WQPA 1V7AA 3AD7C 3IS4A 2O7SA 3VI2A 3UZXA 3UWZA 1FO1A 1POKA 2XYHB 3ENVA 1XIEA 3LCIA 2WCSA 4QEHA 3OV7A 1Q6DA 1WX0A 3TWBA 3TO8A 1PVNA 1BWEA 1ZLPA 5LSMA 3BOFA 4X63A 2J9DA 2J9ZA 1TK8A 4O53A 2I9SA 3N12A 1A5OC 1KQGB 3THPA 3HB9A 2CLKA 3G0SA 1JZ4A 3S8HA 5C55A 4GKLA 3HG4A 3POTB 5G0RB 5J1NA 3HFZB 5K20B 4OJGA 3RGIA 5D3GB 1X9SA 4JS3A 4Z1DA 1H2JA 1CGXA 3OTDA 5DS7A 3HD1A 1PBUA 4FA3A 3S42A 4DPQA 1SZEA 3UG8A 4NI3A 3TSMA 2B9YA 3SRKA 1PKMA 3VNLA 2LA4A 4O4GA 3STFA 2DY9A 2QL7B 1WDPA 3SAZA 1XMOJ 1V3SA 1BYDA 3VKAA 2OGJA 2RDUA 4O0ZA 2ISVA 3IR5B 4ZVUB 4H1ZA 3NGDA 2GOUA 2NX1A 3TJLA 3BGFA 2XFWA 2BKNA 2EKGA 1U1QA 3UYCA 1TVRB 2YX1A 3N2TA 4ADSA 3UCZP 4ED8A 3UESA 3FVYA 4F9DA 2PI5A 2IXVA 3MBDA 3TLLA 3D54A 2FHKA 3BN7A 3GMGA 1U2FA 5LXXA 1J0JA 3OHMB 3KVLA 2O1PA 3NNHA 3CL7A 1VIXA 3ENAA 4NLDA 4UBPC 2G4JA 4MIMA 1OFQA 1RTJA 2HQGA 4IPIA 3MUAA 4GO9A 3WF3A 4PODA 4NXSA 2HDJA 1U5JA 3BV8A 4GLEA 1CJVA 5I3GA 4H6QA 3HGOA 2HWTA 3K1DA 4EYHB 4DYEA 3AJ2A 4Y8EA 3A3OB 3C8YA 3CO0P 3W38A 2F38A 1NH6A 2E1WA 2C1HA 1SUXA 2HFOA 1P1LA 4YR2A 4PBEA 2G3NA 2G2ZA 2LQJA 2UUTA 1V51A 3HF3A 4XAPA 4G65A 4WQ6A 5D8ZA 4XZNX 2XM2A 2V8PA 2WC3A 2MGZA 1W1TA 3CC4S 2D2HA 1G1YA 1JYNA 3MMUA 4RWWA 1SJ4P 3B8UA 1CB7B 4NX9A 2BE9B 1V08A 3CHVA 4OWGA 4MIAA 1TE1A 4MWAB 3S9IA 3C6TB 1EB3A 3G3DA 1QW9A 3OG3A 4C6NA 4AD6A 2RGLA 1J5EF 2PTZA 4ZS6A 3PN8A 4CO1A 2PU1A 1MN9A 3CJQA 3C61A 2X16A 1YHTA 3KHGA 3WDRA 2XIIA 4K4VA 4MF4A 4H54A 4NZ5A 3LZ3A 4YB5A 2PRLA 2AL2A 3ATYA 3PWAA 2FKPA 2LDYA 4DX8H 2CDQA 4Y2IA 3WMBA 3PEJA 4DL3A 4PSRA 1EJ7L 3WCZA 1VQ7S 3NOGA 4UR9A 3W87A 3AAWB 7ENLA 1N2VA 2FHJA 2C2MB 5C0QA 3DYOA 2HZAA 2ACSA 2VFRA 3ICLA 3U48A 1VC4A 2WMIA 2BNJA 2VD9A 1X39A 1PAMA 1W2PA 1TZZA 2BGSA 1NK4A 4BF9A 1OYBA 5HQMA 1CBKA 1TRIA 2Z56B 2W8LA 2GVJA 1KWMA 4KH0B 4CO2A 3REQA 3IWPA 1JXLA 4S3BA 1R30A 2PEBA 2DGQA 4O57A 4Q4QA 2G96A 3CT2A 4F2BA 2V9WA 5GNYA 1XYCA 1VPYA 3HU7A 4J1OA 4L56A 1MQRA 1AW1A 3RBEA 3N19B 5CCLA 1DJNA 4MH8A 4A8QA 4NYZA 2B5JB 2XBPA 3FGCA 1HNXF 4UR7A 4DLEA 3D3FA 2XVKA 3HOJA 1FRLA 1T9VA 4PABA 1NNDA 2HFZA 4CEUC 3AIWA 4ILSA 3LCXA 3ARPA 5LSLA 1EIYB 2OI2A 1WBJA 5HNTA 3DGPA 1EZWA 3R5CA 2GGPA 2JEFA 1G4PA 3SZ2A 1Z9AA 1DIOA 3E3HA 1YX2A 4CO0A 5GAEI 3QSTA 5FF3A 3VPLA 5I23A 4CO4A 4MMWA 2GHVC 1QPKA 1WNOA 2OOGA 4RZ5A 1XD1A 4OFZA 1CXFA 1FK9A 4JOUA 3UZZA 3IM9A 2PGFA 3RB6A 3ARWA 2A3JA 1L3UA 4GJJA 3OBIA 2Y8KA 2DY3A 4QPXA 4O10A 2NSBA 1R0AA 4M63A 1QSYA 5M1TA 2V30A 3IWXA 1LOSA 4H9MA 1JDEA 1RAJA 5AT1B 2XMAA 2PPGA 5D15A 4CH7A 3WD1A 4X84A 1BQMB 2ZX5A 1CPUA 5KEZA 4FI4A 3T08A 1RT1A 4OZNA 5IWAJ 4USTA 2HGLA 1Q4RA 2IRUA 2GX8A 1U49A 1JLAA 3PUEA 5J5DA 3U1NA 3GILA 5KOWA 1IN0A 2MNRA 3JZEA 3C4UA 1NEEA 3OSPA 5DRKA 5KFOA 2HS6A 3WDJA 4MWAA 3ITCA 1S9EB 5KG3A 1ZTVA 1FWJC 2UUAF 1BQNA 5SZTA 3T41A 1XNQJ 3QQ0A 1Z2ZA 5KT5A 3WQFA 5K8PA 2MQOA 2XQCA 4PC8A 1GVQA 3WFLA 2CLHA 4RUHA 1VK8A 2NXIA 3EXYA 4B3TF 2GJ2A 3O3LA 3WBZA 2HHUA 3ICJA 1LZOA 2ASYA 4LS2A 4QRNA 4QLLA 3NS7B 4ZJLA 3SV4A 4IJCA 3EA3A 4IG3B 4LRSA 4M5DA 1PX4A 4AL6A 3LLDA 4PUJA 4WKHA 4LF4J 3K4AA 5KMYA 3IG1A 5I3UA 1WOAA 1J9YA 2OWCA 3KTCA 3UPFA 3ABQA 1NKEA 2BXYA 3PZOA 4KBXA 4LB3A 2CJXB 2ZZMA 5CZKA 3FGCB 2O7QA 2CPFA 3KBWA 2GJXA 1VHCA 1JI1A 2R2RA 4Q2LA 3H2VE 1OD8A 2PA6A 2BY2A 2HFVA 1UA0A 1VFLA 2CU0A 4CDIA 3DIPA 3V16A 4FZVA 1R87A 2ZA2A 3V5OA 2QMUB 1UWIA 3CQ0A 1K77A 3L5AA 4C11B 4TU7A 4AWUA 1XLLA 3RM9A 5EYWA 1R8PA 5IS2A 5F7UA 3W07A 2Z2ZA 4H4KA 3UWQA 5I4MA 4CI0B 5F8HA 2NWRA 3MT1A 3R7NB 2QJHA 4L6OA 1C0TA 3L9ZA 4FNHA 3IAPA 4IFRA 2REQA 1Z8AA 1F7BA 1YX1A 1RA7A 1TVPA 3GYXB 3TZZA 4LVOP 1TFVA 3UGVA 3MEKA 1HR0F 4N6FA 3QZ7A 1K7XA 2XZ7A 3SN0A 3FX4A 2AQWA 1B0TA 1R0AB 4HCDA 4HLBA 4QOTA 4ZA0A 4PFMA 4LBIA 4CVWA 3PDNA 2X1GA 4C5ZA 2QGYA 5L9FA 3RGTA 3CC7S 5CJNA 1VQPS 3IGSA 3P74A 1YDNA 1HBOA 3E12A 2AW0A 3NXZA 3WX4A 6AT1B 2CNLB 3WK0A 4AXIA 1UBPC 1IWGA 4YYCA 3NZ1A 4CNZA 4LV9A 1Y5WA 1B7YB 1R0BG 2VHGA 1KDNA 1ZS6A 1M0SA 4RX6A 4J9KA 2YSWA 3K4WA 2EKCA 4X4TA 2HS0A 4HB7A 1FRHA 4U3AA 3W86A 4DF1A 4QHRA 1KBRA 4C7QA 3B4DA 2CLPA 2PFFB 1G0CA 3M8RA 2CPJA 4PBFA 4CQBA 2HNDA 1SQ7A 5A6BD 5DDOC 2EFNA 2JSXA 2XGPA 1K6AA 3ZXWA 4LH8A 2V6AA 5A6BA 4HK7A 1JUBA 4B9NA 2YBUA 3GVRA 4NVTA 2L9DA 3EPIA 2E68A 3IRDA 1JYVA 4DZHA 1KXHA 4RW5A 1E71M 4GA8A 2C2NA 2I5JB 3M05A 4H4KC 2BACA 2AJ4A 5TF0A 4E38A 3W1LA 3S5NA 3P93A 1RTJB 4MWAE 4TX8A 5THWA 4KE5A 3TW9A 2D9PA 3TP4A 1DAXA 1DIKA 1GQKA 1GGOA 4GG9A 4US5D 4NYYA 3UD5A 3MMTA 2QS8A 3PWGA 3VDAA 2DK2A 1EDTA 4F7VA 2GJPA 5A2AA 2Z1XA 5JBEA 3W65A 1Q8IA 1EP2A 3BLEA 3EE3A 3V5RA 1O7AA 3VHQA 3VAMA 4WJXA 3OIXA 5F9NA 1CENA 3BS9A 1WPCA 3M6DA 1RP5A 4NYOA 5LOQA 3QNWB 1RK6A 1OX6A 1P1MA 1IR0A 3UN5A 1Q4NX 2AF6A 4P7RA 5GAEU 4J9SA 3RNDA 3UR0A 5FEWA 3MANA 4PCTA 2HGNA 2HNHA 4ZO6A 2V5DA 4WCEQ 4ED1A 1GW9A 2TMDA 3SCSA 3M0ZA 5AVNA 4AG0A 4NUWA 3ARTA 4L6HA 3BF4A 3E9AA 1XLFA 1V02E 4IQLA 3WLNA 3NDYA 2J0XA 1Q1KA 2DT9A 4DZ5A 1RAHB 2K7JA 4Z2JA 1WC3A 1FDAA 4HTJA 1X6UA 2DRAA 1HKWA 3BMWA 4DO7A 3QSYB 1FT8A 3BB5A 4K8GA 2VC9A 2E28A 4HH1A 3MDWA 2HFSA 3F5KA 4O4RA 5J1EA 1OK4A 3HULA 2E44A 3VC5A 2X1IA 4YL2A 4G5DA 3IACA 5AYBA 1X1NA 4O1AA 1BF6A 4HZMA 4TU9A 2D20A 4DR5F 3EX1A 3AYSA 1E1FA 3O07A 2ZKUA 3M6WA 3JRKA 5KT2A 1CS4B 5HBMA 4RNOA 3QPZA 4LR7A 4LFAF 2R1MA 1S5VA 3D67A 1WZKA 2VX4A 3OR1A 1RPXA 4IDKA 1R5YA 3AOAA 4DBQA 1XIJA 2DUXA 4DR6F 2HWIA 1DVJA 1CSJA 3K5PA 3WLLA 1G67A 3A9BA 2OG9A 2HBXA 3HBLA 2D0HA 4C0BA 1B90A 3CV1A 4MJZA 2HURA 2PBOA 3CULA 1FNMA 1LG2A 1NY1A 4W90B 4LIRA 3P49B 1WUFA 2OEKA 3VD5A 3M8PA 2ZBCA 3KK3B 2C2DA 2NT1A 4EVZA 4JI6J 5LJ5Y 1PXGA 3T42A 3C0QA 1T9YA 1VPXA 4XBKA 2E9LA 4QJ1A 4RW8A 1X7VA 1EB0A 2HBQB 3Q2DA 4GRSA 1BSIA 2PI6A 5EWGA 2ATMA 2OMLA 4O1FA 3ZNUA 4LCSA 1G7UA 4QR2A 4TVAB 4QGCA 3R97A 1CLVA 3WF2A 1JJCB 2AIRB 3EJMA 3KJVA 1T8EA 1KBJA 1KFBA 4A47A 2PEVA 1PSCA 1AXQA 3MTKA 2IKGA 1C4CA 5GAHU 3GG0A 3M0IA 4UIOA 3VMNA 2P3ZA 2WNZA 5A76A 2PRHA 1HA1A 3KZSA 2AMXA 3QLDA 2YWWA 1YBUA 2KXFA 1EHAA 2F5GA 5EB8A 4CP5A 1VFUA 2ZNYA 1WDWA 3TUUA 4UOHA 4KESA 3TSDA 1UMJA 1ZU8A 3OSNA 1Q8JA 1ZZNA 2RDDA 5DLFA 3QT6A 4HA3A 1C3FA 4HU4A 1UETA 1OIMA 3D1HA 3UVJA 1WB0A 1FFSB 4MNMA 2W62A 2XI3A 3D5MA 5EDWA 1OJ4A 4JTDA 1B4EA 1RCXB 2UZAA 1TV6B 3ATZA 3UJFA 2CQ3A 3OZOA 4XO7A 1YRTA 3ORWA 4J3XA 4E0DA 4Z1BA 4RW4B 4IR1A 3L0KA 1X8DA 2WB5A 3DFOA 1FHVA 3TTOA 1WG5A 1H41A 3GNDA 3PAJA 2CG8A 3VAIA 4KKOB 2P6SA 5BJRA 4FHAA 2B0GA 2LEPA 3HJZA 4NEZA 2VC0A 3B4YA 4JN7A 1L6YA 1TVRA 1IF2A 4JP8A 4NZCA 2F40A 3EWUA 4O8RA 4LSNA 4ZITA 2CPIA 2VOPA 2GJLA 3V5FA 3BREA 3M2VB 2OFHX 2YCEA 4HOXA 4W88A 2IVFB 1MEWA 4IZGA 4CNTA 3PEHA 4UQCA 2FFCA 3DDNA 2ICSA 2AL2B 2GVZB 5JVHQ 4IQJA 2B56A 4A8XA 3DI6B 1MQQA 4LSLA 5FCZA 1OT1A 1FFRA 5I2UA 4YWSA 1QVFR 5D6GA 2PDQA 1W2IA 3HPOA 5CGTA 3VIFA 1GONA 1M1KT 1OIAA 3W5YA 1H1YA 2Y1HA 3EPNA 4QYZJ 4KERA 2F2HA 5ETMA 3OVRA 2J88A 3DBPA 4E2VA 1RTDA 2X8RA 4QAWA 1OT2A 3CE8A 1VK3A 1TPC1 3GS6A 2BZNA 2VG7B 2A7RA 2MJUA 3GTYX 1OC6A 3NG8A 1VFJA 1TTQA 2R7SA 1K8AT 1L3TA 2CLFA 2FIQA 4ZP6A 1RVKA 4ICCX 4LUSA 1IGWA 2TPSA 4AVFA 2H5JB 3LMZA 4QROA 1TU0B 4OOZA 2XWYA 1RY0A 1HBOB 4N2YA 3RUBL 1A0DA 3P81A 4W98A 3GDRA 4TUFA 1EPVA 2VC7A 2QLFB 3IEBA 4H19A 3BGLA 5KZDA 1R3WA 1OFDA 4YS2A 4OVXA 1VPQA 2FUG9 2ABAA 1UWTA 5I24A 1CC7A 4PCFA 3V4MA 3EVOA 2ATLA 1JPDX 2J4GA 4AD3A 3ET6A 4AQYF 2Q3OA 5AYYA 2LA6A 4ES1A 4YEAA 2QIFA 4DJED 1A47A 2NZCA 3M32B 2QFJA 1FKOB 1W2VA 4JI2J 2GQ2A 2ROGA 5HBMB 1RCQA 3GSIA 3GB0A 3VDGA 3IIXA 3NVTA 3OHBA 1XG3A 3AZRA 3LAKA 1ZL1A 3DHUA 4TU1A 5GVQA 1S76D 1MXDA 1C8QA 1WAUA 3LYEA 5HMSA 1K4HA 2GSHA 1UROA 5T7LB 3UWUA 5BRPA 4FXRA 1B64A 4AD0A 1RQ0A 1DTQA 4CWBA 1WA3A 4P7OA 2NVDA 1FTXA 2E5LF 5EN1A 3PBUA 1NOWA 4C3LA 3JTPA 4LYQA 1OO0B 2JE8A 2VR2A 3L95X 2PS2A 4RUBA 2CQCA 4K37A 5LA0A 1IEQA 4DHGA 3TC7A 1NK7A 3I5CA 2I1OA 1XLGA 4UTUA 3E5PA 4K4ZA 1V3MA 4V19X 1DXEA 1LXJA 1T95A 2WSPA 3LALA 1FJ7A 3C46A 2NXEA 1D8YA 2E40A 2JKAA 1VRTB 3WIJA 4BEUA 3W1XA 3BYRA 1KP6A 4ASTA 1TWWA 4RE4A 3GONA 1B3TA 1S49A 3PJWA 2DH8A 4G1IA 3WQPA 2XI2A 2V8DA 2J7WA 1XIBA 1FKWA 1NZAA 4K4SA 2WVTA 1PEZA 4NLTA 3LTPA 3P67A 3L7RA 1GMWA 2FLPA 3TCEA 1SSDA 2FVKA 1TUGB 5BNKA 4JYFA 4L4MA 3GC4A 3WLIA 4P7QA 4PR4A 2YX7A 2ZJQQ 4EPBC 2RAQA 1QATA 1NXIA 4KTQA 3W3SA 4Q7AA 3AT1B 1BVNP 1CQNA 4WTOB 3KLFA 2DGTA 2VEMA 5FA5A 3EDKA 4O4GB 2DJXA 1KNZA 3R8YA 1IXPA 3KL5A 3FMBA 1FDDA 1QTWA 1B31A 1KLZA 3BMXA 3IJDA 4BF5A 1JLEA 4Z08A 3MURP 3VGSA 1M04A 3F7JA 2NSXA 3SADA 1J6PA 2ALRA 3FJ2A 3J7A1 1UEUA 3JAMY 3IXQA 1H1NA 3W82A 1BRLA 3JU2A 3GC5A 2NVCA 3E3XA 1DTTA 2DRBA 2VZTA 2V5KA 1EXBA 1TA3B 3AHVA 4PQUA 3V18A 2Y5SA 4F0LA 2X1BA 4DQPA 5RUBA 1XBWA 2XMJA 1S59A 3F03K 2Y2WA 3Q86A 1EX1A 4J4KA 1N33J 1PBAA 4HGXA 2I9EA 4TXSA 4PWUA 3O16A 2NLWA 4GPNA 3JSMB 4JI0J 1JZ2A 4G8TA 2QAFA 3NNAA 4MY9A 1S9GB 3KK2B 3WH9A 5KFDA 2ZA3A 2ILYA 3IG1B 2MQQA 4D71A 5I09A 4C8LA 2DIJA 4JYDA 4Q8QA 2E5JA 4OFCA 3NUKA 2UY2A 4P2XA 1XGEA 2PC4A 2GWNA 4JV0A 4M8LA 4WP9A 4NKCA 4UFMA 5BXSA 4F9JA 4I2PA 3INPA 3RAMA 4IQEA 3BLIA 3WJZA 1N54B 3AHZA 5ENLA 1JDDA 1DWHM 3AJXA 4LMZA 1RWXB 3FKKA 4ZOBA 1HMVB 4MB5A 1LT7A 1OX4A 3DHWC 3IVTA 3PX4A 3QTGA 4Y9MA 4AL7A 4KC5A 3S2MA 2FYMA 2G3JA 4I64A 3HPSA 5KITA 1GQIA 3N4AA 1KRPA 4AC1X 4C91A 1DKWA 1B3WA 1K3UA 4PR6A 3ENQA 1R38A 4QSHA 2D69A 1FQ0A 3KFTA 3BAJA 3W7NA 3QSRA 4GD0A 1E6PA 2VYOA 3WLKX 1K47A 1HFEL 3OFHA 1TKKA 3W6YA 1RWUA 1GQLA 4HI1A 4ECVA 5E3CA 1DYSA 1FHUA 3PVFA 4ERGA 5F41A 4L73A 2HWGA 1FRKA 3TZYA 4K4YA 4YTSA 4C6IA 4MVAA 3S6DA 4PMUA 5F1UA 3OG2A 2EPNA 1GHSA 2AP6A 4ZOAA 3QYYA 4AZIA 1ICPA 2WHOA 2DNOA 2HIYA 4KGZB 1MWYA 4JFUA 3C8NA 5IWAF 3K1GA 2R9LA 3NNCA 1TYGA 2ZH9A 4L4LA 3RX3A 4ZVJA 2PT0A 1XLJA 2X05A 5CYQB 2PLMA 2YOCA 3BPSP 4IPPA 1H7PA 3U8GA 1W37A 3WX7A 3EDDA 4U9RA 4IFYB 2PMHA 3LBMA 3W8GA 4JIRA 1XNQF 4LQ1A 1DWFM 1IE7C 2OB3A 4S3CA 2GK1B 1NWSA 3EPMA 3L0GA 4K4UA 4DM2A 5BXPA 1AMKA 2RKXA 4JIEA 4GXMA 1QDUB 1ECQA 2WCAA 4AH7A 1QM9A 2ESCA 1LF1A 1ZP4A 2WVDA 1UW4A 2O66A 4MT1A 3GU9A 3WF1A 3WBWA 2PCEA 3ONQA 4X4NA 1MROB 2K1RB 2PWDA 1JJKA 1H38A 3DYPA 1PTGA 4XZWA 4OI6A 5FLXY 4C6EA 5A2QU 5G5IA 3W75A 1WEYA 3GRIA 2EKYA 4QITA 3SO7A 2IPJA 4IG2B 3B0VC 1RA5A 4BDPA 2KZZA 2MYFA 1S2TA 3UBPC 4QS6A 9ATCB 2V8ZA 2K2PA 4Z0JA 1BQMA 2G2YA 3O06A 4LF2A 2QLXA 1E9LA 4UUIA 5IHRA 1D9FA 4HYRA 4Q8MA 1AL7A 4CGTA 4RWXA 1EPXA 3I96A 3ALFA 2VT0A 2JFKA 2QCCA 1F5BA 3KLLA 2B4PA 2NQLA 3N2MA 5E0CA 1LW0A 1POJA 4JAWA 4DLGA 3SDEB 3A64A 3IARA 2H1YA 4NMLA 1NJWA 4I9AA 4I6YA 2GQ8A 1NDPA 2VASA 2QJGA 1B4SA 3LHTA 1EETA 2LCWA 3RIKA 4UY85 2IMRA 9XIAA 3RRAA 3KJFB 1VZWA 2F4VJ 4GKKF 3V7PA 5FJUA 2XYLA 4F4KA 5E3QA 3UPBA 4V2XA 4RUCA 2E29A 3LP2B 4I0WA 3SJ3A 3N2BA 5D04C 4JBCA 4UCFA 1GOXA 3E96A 2H9ZA 2GQCA 3T6BA 2KJVA 1W3JA 5AN7A 3I9V9 3H20A 4NI2A 3OL8A 2DCLA 1Q8BA 3MPWA 2O4QA 3DI0A 3SCKE 4IM4A 4IMDA 3GXMA 1FFGB 1U4BA 1NIUA 5IXEA 1V6WA 2Z2UA 1SFSA 2DO0A 1YK9A 3S5ZA 2XMTA 2HVMA 3R2DJ 2VZ9A 2J77A 3Q8QB 2D2GA 3LCGA 4FPSA 3UE2A 3VOFA 2ZKMX 1TP7A 3BGGA 1ZETA 1EX5A 3Q37A 1Y9OA 2QDDA 4ZE5A 3JUGA 3VKKA 3KHHA 5L1JA 2J78A 4YYFA 5D4YA 3I7RA 4YTRA 5CD4A 4P9SA 1K9TA 4KRUA 5LNVA 1YJVA 1QJHA 2C1GA 4RCXA 1W5NA 2JNJA 4RW4A 4ERAA 4AXKA 4N42A 1WG1A 4AFYA 2B4UA 4IG2A 3V0TA 4CRJA 5F2GA 3UWEA 4CYUA 1RACB 3FBFA 1PWLA 4FOUA 2NUYA 2F7FA 2D2JA 4O18A 3P45B 3A3HA 2MXYA 4C90A 4DWIA 4OBRA 2BJ3A 2VZUA 4U95A 3MPGA 3AIBA 3BLOA 2C3YA 2GJXB 2BKPA 2HROA 3T1AA 4HVZA 3W7BA 4KF1A 4DRSA 2V5HG 4UTIA 4LREA 3U7BA 4GINA 2KHDA 2O9TA 2BXJA 3T6CA 5EGRA 3B97A 4M1BA 3ABXA 5DCDA 3VIOA 2GV1A 1T03B 2WWCA 1HKAA 1R3NA 4LFCF 4IH7A 1H50A 1UD2A 3IUIA 3R0KA 2Y1RI 1D8ZA 1U1LA 5LXYA 1F2JA 5L39A 2ZIDA 3VVTA 1RAAB 3W7CA 2XG8A 4MIWA 3TW0A 1XNRJ 2V63A 2GIFA 3BDEA 3U1LA 3OVSA 5HL7Q 4B4HA 1P5BA 5LKYA 4W84A 4DXXA 2E1AA 1S0MA 1T94A 3PZIA 4S39A 4TX9A 3H59A 1H1ZA 4TY8B 1KKOA 3V6JA 2UVRA 3LP2A 4ORIA 1W91A 3MVTA 3NGKA 3W9IA 4M5HA 4P2FA 1ROFA 1QFEA 5KZ6A 2HBYB 2LXFA 5G2HA 4OZ1A 3AC0A 3F4CA 4D6DA 1FXQA 1TKTB 3BGOP 4I7FB 1JCXA 2RQ4A 2PWHA 2CJQA 4MB1A 2LU1A 3DC2A 4USMA 5KT7A 1B3OA 1B5TA 3DOMB 5MF5A 1JNRB 1FCUA 3PBGA 3LGMA 2HHQA 3OIHA 1ITCA 1FWKA 2FJKA 1E73M 2QL9B 4LFBF 4W8AA 3EMTA 3KOAA 4LF1A 3STEA 4YVVA 4LF7F 3WK1A 1YXYA 2VG6A 2C0AA 3GC2A 4AL5A 1RT4B 2WHMA 2ZZ3A 3D1QA 3QRPA 3M32A 4FALA 4BEQA 3HVAA 3D9BA 3J80Y 1S2CA 5LA2A 4DO4A 3MPUB 1LG1A 5BW6A 3M46A 3U6WA 5E70A 3E6EA 4X62J 3CMES 1VQ8S 2HVOA 3QT8A 4U96A 2O56A 1EIXA 3VNDA 2BW7A 1PCKA 2E7WA 2ZRYA 3PG8A 3PSVA 3EX6A 1RK5A 4K5RA 1TK0A 2E3ZA 4IG3A 2GAGC 1ZPVA 3BSAA 1GKRA 2DSVA 4P71A 1DARA 2Y4SA 2QCEA 3HG2A 3T0AA 3AIVA 1XR5A 1RWOB 2AMCB 2Y3YA 1C91A 2H3DA 1WKJA 2D3UA 3EXRA 3IIOA 1QPQA 4F0MA 1TKDA 2AAMA 3MM9B 4EZ6A 4USIA 4WXYA 2VWTA 1JFHA 3LHWA 5BOFA 3RF9A 2WBMA 1NAQA 2DNPA 4OYWA 2RVJA 1T41A 2A3HA 2YPZA 3QY7A 1HNIB 3MEEA 3DH7A 3SBMA 3EB2A 4TYBA 3OW2R 2QMJA 2YDQA 3P5BP 4QAIA 3VC6A 4Q2MA 4L9YA 4OHYA 8RUCA 2ZZTA 3LXCA 4WOZA 4F2TA 1LT8A 2G97A 5A8PA 3AQUA 4ZODA 3TVAA 1F5CA 2K8GA 3O2LA 1LWIA 1FVSA 2DORA 4DPOA 4TQRA 3VIKA 4WGXA 1ZALA 1BFNA 5ITHA 3S1TA 3PUDA 3HHLC 2I7GA 2GJNA 2HS8A 1KR1A 4O11A 2OT0A 1B7FA 4HKQA 4AIOA 5I3KA 3ZZZA 3BLKA 1WHWA 2QV4A 4JI4F 4KPCA 1NJIT 5M17A 4MKYA 2J5AA 4LR8A 2W9AA 1GVFA 5A8QA 4LUTB 4LBSA 1WE5A 4MWAD 1H49A 2XSAA 3CJRA 2B9WA 4F4ZA 2WMGA 3W7IA 1NFPA 2KX9A 1W3LA 4IMAA 2OSWA 2N4CA 2VFVA 3EGNA 4B9VA 2UUBJ 1R6YA 1VIZA 3G86A 2LQBA 1RTDB 3WL1A 4Q32A 1A7GE 2DGVA 1AZSB 3POTA 2XCAA 1TV5A 3TJAA 4PQUB 2RH3A 1U48A 3KRBA 3NCPA 2NUHA 1JLBB 3UXDA 5E3AA 4LF6F 3FSTA 2DU2A 3B04A 1HI1A 1IUJA 5I06A 2WTFA 3QFHA 4D3GA 3M6YA 3VAHA 1TMLA 1U7LA 2PD1A 1S9GA 2ADAA 1C0UA 2MDAA 1AQ0A 1L8NA 4MIBA 4KV8B 4HYVA 5CBJA 1ZNNA 3GXIA 2MTLA 1QJWA 3LTOA 4QCFA 5AZ1A 4OHWA 4IUFA 1BQGA 4UOJA 3GU1A 3G4SS 3AS2A 4AD5A 3GQCA 4QPTA 2QXWA 2LLZA 1FWTA 1SH3A 5C9RA 4BQ3A 2BOAA 1S1RA 1WQ5A 2VA3A 3H2FA 1W9PA 1B3ZA 2EO7A 4HPGA 1A5MC 3DECA 4F4YA 1KFKA 3OTOF 2R2TA 5KFTA 3GIMA 2JGQA 2HZVA 4I67A 4B3SJ 3BARA 2GIRA 1JWWA 2GUYA 1IM6A 3MW7A 3W1RA 4Z2IA 3CTLA 5GMKa 4C65A 3RCYA 4DV0F 3TC3A 3GV7B 2RRNA 3G87A 1XH1A 4JTAA 2TSYA 4NRTA 1AZ1A 4X61A 5DM7Q 4NXMJ 3T1HF 3GDKA 4X64J 4XSLA 4HD5A 4OYAA 3WZ0E 1JLEB 3KBMA 1QNSA 4P74A 3GE7A 3ZM8A 4IFVA 2RNEA 1R3TA 4KFNA 3OZMA 4PG7A 4OZ3A 1PYOB 4RE0A 1EKSA 1NMEB 3LW5C 3GIIA 1BYBA 4O1DA 2HQ3A 3TEGA 3MBFA 4O14A 2WOMA 1ZTTA 3NVDA 3QO9B 4I1TA 3EICA 4CN4A 4A48A 1SVDA 4JFSA 3M1ZA 1F5ZA 4NA2A 2J8TA 1Q7LB 4GNVA 3T44A 2WLZA 1X1ZA 2J8SA 2HLTA 4OHQA 2XPKA 2O92A 1Q8LA 4YMZA 1N36F 4HR2A 1F3TA 2H54B 3SN1A 3DC8A 4N6EA 1MI3A 3THQA 2Y7FA 1AW2A 1XIDA 3DFPA 4K8HA 3JSMA 3B8VA 5A0YA 4LVDA 4DXLA 1QNQA 2N4DA 1XFBA 3QTPA 3VKCA 1BKSA 4IIDA 2BXZA 3NQAA 5HATA 3RRKA 4E6MA 1US3A 5GJNA 1HWKA 2MHNA 3MR2A 1H62A 2WVVB 1ACMB 3EZOA 2OGYA 1E55A 4JDYA 3OFGA 1I2QA 1BGAA 4WFAQ 4JUZA 4PMZA 3WMLA 1VYAA 1M41A 5KG2A 3BQ6A 1XN9A 4GKJF 1PUDA 2J7GA 2HRYA 1F4HA 2V2KA 1GMUA 1V6VA 1XKYA 4DUYJ 1L0PA 2DHHA 4ID5A 4L80A 2Z2AA 2ZFAA 1YBQA 2KJWA 3GJTB 1E4NA 4BC7A 3C6TA 1UEKA 1RT7B 4YU1A 4C6BA 3PJUA 2FPVA 1VQ6S 3BM7A 5A8OA 3VILA 3SI8A 3WLHA 1W3HA 5K8MA 1YEYA 1XCFA 1KFCA 2W2OP 4IWWA 2ZCGA 3VX1A 3E8OA 2WANA 3WH6A 2NUXA 1U1PA 2FJXA 2AKZA 1AUDA 5C2GA 3CAKA 3LO3A 3ULHA 4HU8A 4WGHA 4J9RA 2R8IA 4Z2XA 3QQ1A 2A3EA 2X1UA 1YDLA 4WFXA 1GCYA 2C13A 2NUWA 4YCPA 1N33F 3ANYA 4NP7A 2WM1A 3CEUA 2AEMA 2FZBA 5CZTA 2INFA 3DI1A 1E6XM 1YTKA 1BQNB 1KXTA 3QFEA 4GQGA 3OXFA 4RKAA 1HJXA 3RM4A 5H1WA 4QIEA 4DLMA 1RT1B 1PWMA 1G01A 3KX6A 4JL1A 3UZWA 3S6EA 2DW7A 1KRBC 3I55S 7PTDA 3MWCA 3ZLGA 3WYZA 4HA4A 5HMDA 4BK9A 1N32J 1Q85A 1R85A 3LY0A 2V5BA 4PL1A 3HD2A 3CD6S 2WBRA 1WDDA 1G94A 4FXFA 1Y00A 4TNOA 3ITLA 5FACA 1JLFA 1RH9A 3K59A 3NLCA 5HVHA 3QT7A 3LHZA 3N3MA 3M4HA 2K1RA 2NSCA 3DLJA 1MZRA 4IOBA 2Y6ZA 2HS4A 3N2OA 2YKOA 2F9DA 2NS1B 4C8MA 2HYIB 4XVDA 1VGYA 1EJXC 2YBTA 4PMOA 1UJ5A 4FNTA 3R5AA 1F2HA 2EBNA 1B3XA 5K7JA 3IGXA 1O6IA 4R0JA 4A2SA 4FYXB 3KG1A 1KGUA 4IPNB 1IKXA 2R7RA 2VKRA 3IGHX 3PSWA 3NEKA 4NI8A 3N9UC 3MKVA 1W9BM 4Z7YA 5G4DA 2EBEA 3A3XA 1Z89A 1HF6A 3W7KA 1EKRA 2YDAA 4AMAA 4R25A 3GKAA 2GPTA 5F4WA 4DQRA 1UWQA 3STPA 4F0HA 3HN3A 3VIPA 3VAJA 4L4PA 4CNSA 2ZH2A 1XTZA 3PUGA 3MP5A 1C8XA 1OSEA 1UVLA 4B3KA 3JQKA 4PBGA 2DVTA 1RYSA 4WSJA 3UFYA 4ZVGA 4H7VA 1DWJM 4R9OA 5E3RA 1KVKA 3HHLA 2CZDA 1R3YA 2YA0A 3LPOA 1G7CB 4JI3J 1CLFA 3JYTB 1PO9A 4RW7B 4LRBA 4OYMA 4X4PA 3QJPA 3EPOA 1M5OC 2FZ9A 4CCDA 4IQDA 2M3DA 3WH8A 1QUMA 4W8BA 4LUTA 4DSKA 3WBXA 5HJYA 1I0BA 2RU9A 4OOUA 1SR9A 2QA4S 4FLQA 3TQVA 2VODA 3N34A 2ZZ7A 1KHWA 3UCCA 3A12A 3BTNA 1HWUA 1MQPA 4CQAA 1GH8A 3I7QA 1MU2B 2GW8A 3QYSA 3QMTA 2HQAA 2RDXA 1HBUA 2WRMA 4IGMA 3SQGA 2BKOA 2UUCF 1ZUAX 2NXCA 3UDVA 4EEYA 1VH7A 4UTTA 2ZX7A 2HGMA 3UD3P 1Q7QA 3BJYA 2HVZA 2BBEA 3LRLA 3U02A 4EAYA 5I3QA 3W5ZA 1TWDA 1SH2A 2V50A 4X65F 1V3KA 3H21A 2C15A 3R6GB 1RSCA 4EBCA 1TJ1A 2VR5A 3TR5A 3PS7A 4LUIA 3NWGA 1C0UB 1VLWA 1VBRA 5DBUA 3SN4A 2GGPB 1JYWA 1QR7A 5CQGA 5HQ8A 3KK1B 3V6HA 1XRSA 4BQ2A 1RTIB 3MUTP 2YNGA 2KZHA 4MNLA 5B80A 2YWKA 1Z1ZA 1LWFB 5FEXA 5M5DA 4ENOA 4QIUA 1R9XA 3VKBA 5LMUF 2EWHA 2AEFA 2RD5C 4MZYA 3N4FA 3TVZA 1LV5A 3TUIC 1PE1A 2JVRA 1KM6A 1Y5NB 3QR3A 2C91A 4HA0A 5CZXA 4IFYA 4DWSD 2DT2A 1OBAA 3VZHA 2G1HA 1NSPA 3D6TB 2X3GA 4MPQA 1DEDA 3EVMA 2HRTA 5C42A 4NL1A 3UWYA 4TTUA 4CLZA 1MNEA 4DUXA 1N5QA 1PTDA 1S2WA 4M8UA 4PEKA 4BI5A 2P9EA 2VMFA 1XMBA 2HAIA 4QWAA 1RYRA 3URBA 1U8SA 2W5FA 4GKKJ 3CT7A 1X9WA 4ZSUA 1PKYA 3HMCA 1PZ0A 3OO2A 3B8IA 2DP3A 2VFIA 4K6AA 8TIMA 1NK9A 4DJDA 4U67Q 3PWIA 4B3RF 1VJZA 2PSNA 2RAGA 2QCNA 1E0TA 4MLRA 2HNYB 3AJDA 4WE1A 3CCJS 2MUCA 4WF9Q 4GBUA 4Y9AA 1X4BA 3WD4A 5I5RA 4YNGA 2VFSA 3SQSA 2PDCA 2XLJA 4DLFA 2B7BB 3KNAA 1F74A 1PB0A 2FTYA 3G3MA 1OYEA 1RT2B 1XBVA 2I17A 1T05B 4MJ4A 3P96A 1VEOA 1TV8A 3TLQA 1R2TA 5HXMA 2TAAA 4NMXA 1M5WA 4HNNA 1I1XA 2J25A 5A8KB 1Q5VA 2CPEA 3VAFA 2GIQA 3DRRA 4ZPCA 1OYAA 3VAKA 3S4TA 2EG2A 2WB4A 2ZWYA 5EBAA 4HNOA 5GJMA 2HEJA 1VHNA 1SJBA 2DR6A 1E6VA 4DL6A 4FP1A 3ONBA 1UUQA 2X0SA 3QAEA 1HW8A 4MMOA 4LRCA 3MP4A 3VZXA 4NLQA 3BGJA 5EMMA 5EX3A 2NVAA 2QULA 2BG5A 3UJEA 5I3JA 2OO4A 1YYAA 2XCPA 2N3LA 3VGGA 2C3ZA 1X0PA 1I8JA 4AZBA 1TL4A 3C2PA 1E40A 2PURA 1S0NA 4DG1A 4J9MA 1FWIC 1KM5A 3PX6A 1UD4A 5KFRA 1A5SA 5LYRA 4G3IA 4Y9NA 4KEZA 5EWFA 1VBGA 5JUMA 1XMOF 1M65A 2OJ3A 4AHPA 2VDIA 1EEXA 2W2PP 1U1RA 1RQBA 2ZUVA 3TZFA 1SMDA 2V38A 4QR1A 4XZBA 2ZZ1A 3KCLA 2I38A 4QYRA 2HVIA 1IGSA 2ZA1A 3R7BB 2DYAA 1AJZA 5DO8A 2FJUB 4RW8B 1KLMA 2VBYA 4DL0C 1KQKA 4U33A 4L1GA 4KCVA 3MUVP 1GYLA 3H2LA 1FHDA 4IG0B 2PDGA 2Q1LA 2MGZB 1MNZA 2AJ2A 2U1AA 3DNCA 2J79A 2KTQA 1W26A 1J0IA 2BWGA 4RBTA 1O66A 1HL2A 2VUNA 4LVGA 3IGUA 4MKSA 1J5TA 5F8GA 2VP8A 3QY8A 3ILLA 4KFPA 2R8WA 1MWOA 1IBLF 2VVNA 5HJLA 2QCLA 3SFGA 3FBBA 4OV6A 4E2BA 3E38A 4CNNA 3MOZA 1XYBA 1E5JA 1OC5A 3EOEA 1FEEA 1E72M 2V8HA 3W70A 2Y8VA 3SSQA 1I94J 2VEIA 1LL4A 1OQFA 4DR3J 3N18A 4C9DA 4LF7J 1D3GA 1CEZA 2QRRA 5HQEA 1OHLA 4DSEA 3LMYA 3PZQA 4A4JA 1M5SA 1Z41A 2BB0A 3NBPA 3KLIA 4INFA 1RT7A 1KTNA 4GABA 1QASA 1S3TC 4BFAA 5IT9Y 4G1NA 5C9ZA 3UJSA 4ACZB 1JLAB 2IM2A 5DDRC 3C16A 3N73A 2B7NA 4H83A 4DO5A 1QMLA 5CPQA 2GVZA 2OLAA 2D73A 4DL5A 4TIMA 2G0IA 4WDUA 1ZP3A 4UTLA 2P10A 4R0EA 1XYAA 3N14A 1HL9A 1LKZA 1A0CA 4AWSA 1TTJA 4OV1A 3LWLA 3U2ZA 4LSNB 1DHMA 4AT1B 1MROA 1N88A 3H2UB 1ZJIA 5AYIA 3MM7A 3POHA 4EO8A 3KJQB 2KYZA 1PZ2A 2XWEA 3NG3A 4M6UA 3ZR4A 3H12A 1VR6A 4B5UA 2D1CA 4UUXA 1T9XA 2ZUMA 3PFRA 1YNQA 3A13A 4HHJA 2XO7A 4D8LA 1Y5LB 1HGYA 1MO0A 4LR9A 3O63A 3GIPA 4M0XA 4UTMA 4Q6XA 3EDEA 5AE2A 2VG5A 1LK7A 2HCVA 2YH1A 3GIQA 1PGZA 4HNTA 1OB0A 1BWLA 3NOCA 1VHIA 4Q8FA 4I9MA 2QF7A 3RYLA 2A3CA 3RM8A 1NRKA 4AYGA 3ELHA 5CBIA 3AQOA 4GUHA 4HHMA 4MY1A 4RW7A 3LGNA 2YKAA 3JQMA 3G8SA 2FHCA 4A29A 1GXLA 2H65B 2VG7A 5KG4A 4KMQA 4GXWA 3L7OA 1TV6A 5CZSA 2QCHA 3T1YJ 2E1RA 2DZAA 4GE8A 2L9NA 4AEFA 3ALGA 4AMCA 4DX5A 4IGNA 2BJ1A 4S3EA 2W9CA 3DYAB 3AO0A 5E6ZA 1WHXA 2W7OA 4O19A 1JZ3A 2B31A 4YB1P 3FFSA 4I2PB 3TJIA 4AHOA 3RYSA 3QWUA 4NLRA 1K02A 2EK1A 2HSEB 4JI4J 4AX7A 4C6KA 1O95A 4IG0A 5DLCA 2B6AA 1OJXA 1IHIA 4JTTA 2GHPA 3V4BA 2B5JA 5D37A 4MKNA 1R7OA 1JR1A 4DELA 1A3HA 3QFWA 5BXRA 3OL7A 4K4WA 4XZIA 1WF1A 3ARVA 4EX4A 3ZZRA 4GX8A 4FNRA 1VIWA 1H2VZ 3MGJA 4EACA 3K8MA 1HG3A 3IAQA 4ZCMA 1FOBA 1MW2A 2E7VA 4LF6J 1V3IA 2FC9A 2WZEA 2ZH3A 2XN1A 3SRDA 4PRWA 3BGUA 2BA9A 2V5CA 4RW6B 2RDIA 3F1QA 3UWWA 5BCAA 1FJGJ 4IOAQ 1JNEA 1JCMP 1R3SA 1BKHA 2L3MA 1YPIA 1NLKL 3GNXA 2PE4A 1OZMA 6A3HA 3HMJG 1AFSA 4ROPA 1OFRA 3H8AA 3C6UA 3C16B 3TFXA 3W7JA 1I6NA 2BYCA 2DD8S 2VBWA 3IBFB 4B3TJ 2IY5B 2V3GA 3TOQA 3W1MA 3GR8A 4ZLJA 2B4GA 3D0CA 5BXTA 5T41A 3CSKA 4ED4A 3AS3A 3KOZA 4DU8A 3WSUA 1CWYA 4XPCA 3TYUA 3FEQA 3TWZA 1QI3A 2QG9B 3MM8A 2Z1KA 3KYLA 3EM1A 5FF2A 1IV8A 3VCCA 3NQ8A 1YJUA 3G18A 2ZRUA 3ZWSA 4Z2HA 4CD5A 2ZUTA 2OPSB 4Q0BB 3M6UA 2CETA 4HQVA 2OZTA 2XMWA 1WXYA 1YDOA 2J6SA 1HKJA 1SZRA 2Y7GA 5C70A 3MCSA 3KLHB 4IIGA 1RTIA 3P62A 3W63A 2OYKA 3TIMA 2CJAA 2BUNA 4D1IA 1ONXA 3CL6A 3KOFA 2KXNB 1TIMA 1SC1B 2WJFA 2XS7A 1MVYA 4DF8A 2X7WA 4UUWA 2QCDB 4YIWA 4D6HA 2Y1LB 1U6FA 1UVKA 2PZNA 5CXPA 4F66A 1JLQB 3TXVA 4GI9A 1XQIA 3N29A 3UWTA 4ZVRB 1X4HA 1HR0J 4UOGA 4XVEA 2AMGA 1QK2A 3D2WA 5KT4A 3N4WA 1XYFA 3OZYA 2WMJA 1JZ6A 4B5SA 1XLBA 2HNZA 2H51B 1TPFA 1XLCA 1GXTA 3MPDA 3ZNJ1 4WFYA 2QPSA 4HYWA 4H9UA 3ARXA 3W88A 1CC8A 4QWDA 1SKSA 2BANA 2ASHA 4PMNA 2CADA 3HX9A 5DBTA 3EGVA 2VU5A 1TREA 3TANA 2N7CA 3JTNA 4LRAA 3KW3A 4QDWA 3J7ZT 1N56