3DRRB

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 106
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB04
2JC1A 2OPQA 3JYTB 3H5SA 1S1XB 1VRUA 4ICLA 1JLEA 2ZD1A 3H59A 4URGA 2AQ4A 4M94A 2BANB 4O4GA 4RNMA 3LP1A 2I5JA 1RT7A 2B5JA 2YNHA 3T19A 2B43A 2XWYA 3FDSA 5KFSA 5KT2A 3Q8PB 3PW7A 4IR9A 5DGAA 4RW9A 3DRSA 1S97A 2HWHA 3GYNA 4O3QA 2XCAA 1REVA 1S0NA 1LW2A 2W7PA 4EO8A 4J9OA 2ZE2A 3KMSA 3MR6A 2W7OA 1TL3A 4B3OA 4K4VA 4NLXA 1Z4UA 4FS1A 2VG6A 4JV0A 5CYMA 1K1SA 4IFYB 5EWGA 3KLHB 1TKXA 4ED8A 2AU0A 5DQGA 1TV6B 4H4OB 3H40A 4MH8A 3CJ0A 3KK1A 4Y3CA 5KFCA 2VG7A 4YR0A 4MFBB 3H5UA 1S9EA 2YNFA 3LP2B 1S9GB 4U6PA 3MR2A 1YVFA 3HHKA 3G6YA 4IDKA 2AGQA 4IQXA 3KLGA 3KLFA 1S49A 5KFQA 3KJVB 4H4MA 3V6HA 4G3IA 1TVRA 3NL0A 5HP1A 5DQHA 5KFDA 5KFHA 2BQUA 1LWFA 2EC0A 2C22A 4J9RA 4KO0A 4KBIA 3QIPA 4ZVFA 1FK9B 5EUHA 3RB6A 3PR4A 2FVQA 3V6KA 3DRPA 2GC8A 4YR3A 4J9SA 5L1KA 5I42A 3HVTA 1JLGA 2AGOA 3RBDA 2FLNA 3DM2B 1S1WB 1T03A 4Y2CA 2OPQB 3CVKA 3V6JA 3H5XA 1VRUB 3V6DB 3TQ1A 1JLEB 2ZD1B 4MKAA 1J5OB 1SUQA 2JC0A 4NCGA 3TVKA 3LP1B 2I5JB 1IKXB 1RT7B 2YNHB 3RAQA 4RW7B 3EPIA 5FDLA 3Q8SB 2HMIA 3H4BA 4DG1B 2RF2A 1SH2A 1JLBB 5J2MB 5J2PB 3FQKA 3GV7B 4ZMMA 4TY8A 4DL5A 2HNDA 3E01A 2R8HA 4EBCA 5KG1A 4LSNA 5KFAA 5J2NB 2QV6A 3CDUA 4YP3A 3PVXA 4RW8A 3PJWA 2VG5A 3MEDA 3BQ0A 4QW8A 4B3OB 1TKTA 1QAIA 2WK4A 2OPSA 2HWIA 5C24A 5DLFA 1EP4B 4RNHA 2BQRA 1TKXB 5C42B 3DI6B 1RT6B 4ZVHA 3M9MB 1EETA 3KK1B 4R8UA 5KT7A 1JLAA 2VG7B 3M8PB 4MIBA 2J6UA 2YNFB 2QE5A 3IGNA 2IC3A 1S0MA 3JYTA 5C25A 3KLGB 1BQNB 2AX1A 5J1EB 1JIHA 4MIAA 1TVRB 2BANA 2R2RA 1S1UB 4PQUA 5HP1B 5KFRA 3LALA 5F9LA 2D7SA 3QYYA 4I2QA 1ZTTA 2HNYB 3BR9A 5KG7A 4QWAA 5KFZA 3BREA 2W9BB 4J9LA 4JV2A 3DRPB 4J9PA 4RUAA 5KFGA 5I42B 3HVTB 1JLGB 3CDWA 1HARA 1RT3A 1T03B 2WHOA 1T05B 3QGGA 4K4YA 3FSIA 5DQIA 2YKMB 3TAMB 2E9RX 4XO0A 4LSLA 2V0NA 1SUQB 3OL7A 4NCGB 1T94A 3OSPA 4IH7A 1QUVA 3PW5A 4K4SA 4H4OA 2HMIB 4ZVEA 5L1IA 1LWCA 3I5CA 2UVUA 4RW4B 2W9CB 3T1AA 4MFBA 4GC7A 1C1CA 4I2PA 5DLGA 3GV8B 2ZKUA 3E01B 5KFTA 3Q8RB 3CJ2A 3RB4A 1HNIA 3KJVA 4U7CA 3BQ1A 4LSNB 2HAIA 3QGHA 2BQ3A 4Y34A 4RW8B 4FBTA 2FJVA 1TP7A 1S10A 1RTDB 3IS9A 4EYIB 4PWDB 2ASLA 5DGBA 1TKTB 4JUZA 2OPSB 4TQSA 3C6UA 3DLKA 5C24B 4ED2A 3BSCA 3VQSA 4QWDA 4EO6A 4TN2A 4ED1A 5KG5A 4J9NA 3GIMA 3NBPB 5KT5A 5KFIA 1EETB 3HKWA 1JLAB 2W8KA 3MEGB 3DM2A 1S1WA 2IC3B 4PUOA 3CJ5A 5C25B 3KMQA 3V6DA 1DLOB 3LANA 4IR1A 2WTFA 4KSEB 3H5YA 4I7FA 1J5OA 5C5JA 5JXSA 4PQUB 4IG3B 1IKXA 5EWEA 2JEIA 4RW7A 3G6VA 4I2QB 1C2PA 4DG1A 3NMAA 3RB0A 3OL9A 1JLBA 5J2MA 5J2PA 4YMEA 3H4DA 1S1VB 2D3ZA 3OHAA 2IM2A 1N56A 4Q45A 5J2NA 5J2QA 1RT3B 1S4FA 2IM0A 1N4LA 3HVWA 1HYSA 1S0OA 4LSLB 4HYKA 1DTQB 2RDJA 1RYSA 1EP4A 1T3NA 5KG3A 2WB4A 5C42A 4RNNA 3DI6A 3FQLA 1RT6A 3BJYA 1QE1B 3DLGA 5KFPA 1LWCB 5KFNA 2XI3A 3KLIB 3M8PA 1R0AA 1C1CB 4K4XA 4I2PB 1RA6A 2BRLA 4QWBA 1BQNA 4RUCA 1HNIB 5J1EA 3CWJA 4ZHRB 1S1UA 2YNGB 3LAKA 4ZPCA 4TYBA 1RT1B 4WYLA 3MR5A 5L1LA 3IS9B 4WXOA 5L9XA 2WONB 3KLEA 1HPZA 2GIQA 4ECUA 5KFYA 3DMJB 5I3UB 2HNYA 2W9BA 2E9ZA 3C6UB 1RTHA 3DLKB 5JUMA 1SV5B 3M8QB 1D1UA 5KG6A 4H54A 2D3UA 3BSAA 2XGQA 4QWCA 2F8EX 4WXWA 3ISND 5KT6A 3I0RA 4MK9A 2ILZA 3D5MA 4K4ZA 2WRMA 5K14A 5HLFB 4HKQA 3T5KA 1T05A 4PUOB 1NHVA 2YKMA 3TAMA 2CKWA 4NLOA 2V9WA 3ISNC 4I7FB 2FVRA 3NAIA 4URSA 5F8MA 3H98A 4ZP8A 2CJQA 2O5DA 3KK2B 4OL8A 4URQU 5EWFA 4ZP9A 2JLEA 4RW4A 5F8IA 2W9CA 3KHHA 4ECVA 4IG0B 4ECRA 4O3RA 3PW2A 4ECZA 2C2RA 3JSMB 2C28A 2J6TA 1RT5B 3V4IB 1HNVB 2IAJB 5J2QB 4WZQA 1IKWB 4NLRA 2HNZB 1RTDA 1HYSB 2OH2A 4PWDA 1N6QA 2R8KA 1BQMB 1LWEB 3DYAA 3FRZA 2YNIA 5KFFA 1ZETA 1S6PB 4ZPDA 5KFMA 5KFWA 4ED7A 1S6QA 5F8NA 3NBPA 3DLGB 3T5LA 3D28A 3GIKA 1R0AB 3MEGA 1DLOA 5KFKA 2XGPA 5HBMA 2IBKA 4EEYA 3CIZA 1RDRA 3UR0A 3RB3A 5DG8A 4ZPBA 4IG3A 3OL6A 3HVAA 5L1JA 4RW6B 3KLEB 1HPZB 3PJXA 4IH6A 4GC6A 4DL3A 1RTHB 4EBEA 2I1RA 5KFUA 1HMVA 3BQ2A 4J9QA 2C2DA 3BGRA 1S1VA 2BRKA 4NRUA 1JKHA 3DRRA 3MFIA 3BSOA 3I0RB 3I5BA 3SFUA 3V81A 3GQCA 4R0EA 5K14B 4FBUA 2ASDA 3MR3A 4YR2A 3PHEA 1U09A 4NYZA 4IKAA 2BE2B 2FJXA 1DTQA 1RT2A 4KV8B 1N5YA 3IRXA 3QO9B 3C6TB 4ZPAA 3DDKA 1NHUA 3NKYA 1JX4A 1QE1A 1C0TB 3KK3B 1TKZB 4MKBA 3QZ8A 1NNDA 3OSNA 3RAXA 1QAJA 4IRKA 3KLIA 1W25A 2OPPB 4K4UA 3MTKA 4IRDA 1RTIA 2V4QA 4NLYA 4TLRA 3NAHA 5T14A 3E51A 3GIJA 1FKPA 3ITHA 4ZHRA 2YNGA 1RT1A 4EYHB 2WONA 1N6QB 4TXSA 3DYAB 3DMJA 5I3UA 1KHVA 1RAJA 2YNIB 3Q8QB 1SV5A 3M8QA 2R8GA 1IKYA 1HQEB 1S6QB 1TL1B 4KE5A 4ECTA 3OLAA 3LP0A 4KKOB 5KFXA 5F8GA 5HROB 4JV1A 3M9OB 5F8HA 1HQUB 3GV5B 2JEJA 5HLFA 1MMLA 4Q0BB 4R5PB 4DL2A 5F8JA 1VRTB 1I6JA 2R8IA 5HBMB 3M9NB 4WFZA 4KAIA 1OS5A 3PW4A 4EBDA 1ZTWA 4O44A 1S1TA 4ED3A 3DLEB 4F50A 4F4YA 4IH5A 3KK2A 5KG4A 4IOBA 1C0UB 3EZUA 5D3GB 4IG0A 1HMVB 4Q44A 4WZMA 2RDIA 3BGRB 3FFIB 3JSMA 1JKHB 3DRRB 3MECA 3OHBA 2UVRA 3OL8A 3DOLA 2D41A 1RA7A 3V81B 1RT5A 1FKOB 3I0SA 3V4IA 1HNVA 2IAJA 2YKNB 3LAMA 1IKWA 2C2EA 2WOMB 1RTJB 2HNZA 4O4RA 1BQMA 1LWEA 1S48A 2B6AA 4LQ3A 3IN5A 4O3SA 1WNEA 3KOAA 4NLUA 1RT2B 1GX6A 1N5YB 1S6PA 3IRXB 4MK8A 4TY9A 2ALZA 4MK7A 5KT4A 4F4XA 1RYRA 2VA2A 2AX0A 1SH3A 4ECSA 1RTIB 4K4WA 5KFJA 2XC9A 2R2TA 1S9FA 4J9MA 2IM3A 2W9AA 3CDEA 4G1QB 1FKPB 2OPRB 3ITHB 2FVPA 3H2LA 4F4ZA 4ED6A 3QLHB 1TQLA 4DL7A 4RW6A 2AWZA 3QIDA 3OLBA 2E9TA 5F9NA 4IFVA 2JEGA 1UWBA 1IKYB 1XR5A 5KFOA 4ECYA 3LP0B 1SH0A 5CYQA 4RNFA 4KFBB 4ID5B 3SI8A 4NLGA 3MF5A 4Q8EA 3GIIA 2BE2A 4TYAA 4ECXA 4KV8A 4YQWA 3QO9A 3C6TA 4O44B 1S1TB 4ECWA 2R8JA 1C0TA 1MU2A 1TKZA 3DOKB 3KK3A 4X2BA 4WFYA 3PR5B 2OPPA 4IRCA 1JLCA 4NZ0A 4RZRA 3MECB 1JLQB 2XI2A 3DOLB 4NLPA 3RBEA 2DPIA 2BR0A 4DL6A 3I0SB 5KFVA 1JXLA 4M95A 5DG7A 1CSJA 3N6NA 3UPFA 3UDLA 1DTTA 2B6AB 4NLDA 4NLSA 4ICLB 1XR6A 2ATLA 2RKIA 2W8LA 5KG0A 1HQEA 1TL1A 4O4GB 4RNOA 4NLVA 4KKOA 5HROA 2B5JB 1C1BA 2WCXA 4QW9A 5KFEA 1HQUA 4RW9B 2IJNA 4Q0BA 3DRSB 4R5PA 3PW0A 4F4WA 1LW0A 1VRTA 3UQSA 1IM4A 1XR7A 3IG1A 2FVCA 2UVVA 1REVB 4XPCA 1JLFA 2ILYA 3KNAA 1LW2B 3DLEA 4DL4A 1RT4A 1KLMA 1IKVA 2ZE2B 3EPGA 4WE1A 1K1QA 1C0UA 2IMWP 1TL3B 4IFVB 5D3GA 4K50A 1UWBB 3MEEA 2VG6B 3FFIA 2IM1A 5CYMB 4XPEA 3MFHA 1D0EA 4KB7A 1FKOA 5CYQB 3NGDA 2YKNA 3I5AA 4K4TA 2FLPA 2WOMA 1RTJA 2UUWA 4NLWA 5KFLA 1S9EB 4KHMA 3BSNA 2FJWA 2FVSA 4IDKB 4ZVGA 4FS2A 1S1XA 4WYWA 3KLFB 3QZ7A 2IJFA 2JEFA 2ASJA 4H4MB 3IGVA 5EDWA 3KLVA 2VA3A 4RU9A 1MU2B 3G6XA 2XCPA 3GILA 4QWEA 1LWFB 3T5HA 4Q8FA 4KO0B 3QIPB 4ECQA 1JLCB 4WFXA 5KT3A 4G1QA 2OPRA 3CJ4A 4ZP6A 3KHGA 3QLHA 2R2SA 1DTTB 4KHRA 4DEZA 2UUTA 2RKIB 4Y2AA 3N6LA 2V4RA 4IFYA 3KLHA 3CJ3A 4O3NA 4Q43A 1C1BB 2GIRA 1TV6A 5FDLB 4KFBA 4ID5A 3CO9A 2RF2B 2FLLA 1LW0B 3QGIA 3LP2A 1S9GA 1GX5A 4LQ9A 4TY8B 4ED0A 3T5JA 2HNDB 3IG1B 2AGPA 1N48A 2J6SA 1JLFB 2IA6A 4J9KA 3SFGA 1RT4B 1KLMB 1IKVB 3DOKA 1KHWA 4NRTA 4WE1B 5DG9A 2VG5B 3MEDB 2R2UA 5F8LA 3ICLA 4O3PA 4QPXA 3MEEB 2UVWA 1FK9A 4NLQA 5KFBA 3G86A 1JLQA 5KG2A 4TQRA 3KHLA 3PZPA 2DPJA 4R8UB 4O3OA 3N6MA 3KHRA 4ZP7A 4NLTA
chains in the Genus database with same CATH superfamily
4FYVB 4J90A 2V69A 4URGA 2QJ3A 4U7UK 1S97A 3R2DJ 1AA1B 3UI3A 4J9OA 5HSPA 1NK9A 5M2PA 2MGZA 3SXLA 2RAQA 1FJCA 4OX8A 3KLHB 2P5VA 4DV1F 2W4CA 1S49A 4KGVB 5SUHA 1UETA 1X5SA 2W4PA 2HZVA 1QAXA 4ZVFA 3DRPA 1H98A 1AB8A 2IRUA 3DCAA 1HR0F 1CJKB 1DQ9A 2RB7A 1JLBB 1EKRA 2KI2A 2WVBA 4TY8A 3CMAS 4DI6A 3PVXA 4F3QA 4WK1A 4B3OB 3CCZA 2BQRA 2B4UA 3DI6B 4ZVHA 1GXUA 3KK1B 2J6UA 1FJ7A 4OZ2A 2VPZB 4MKVA 1B7FA 1XK8A 4LF5F 5F9LA 5AJ3J 2HNYB 5LSOA 1GTHA 3CDWA 1HARA 1MN7A 3ZTRA 3R9LA 4DX7A 3POTA 3AODA 2ZDPA 2DNLA 1RWUA 1S79A 2QN6B 4LSNB 2BQ3A 1RAHB 3IS9A 4X4NA 3C6UA 1I94F 3ZZTA 1BXNA 4QPTA 3HFZB 2MLZA 4WPAA 3CCLS 5C5JA 3I96A 1QSLA 5EWEA 4ZDNA 4ZIVA 1GT8A 1Q86T 4B02A 2LEBA 3HVWA 1HYSA 1M5OC 4ENOA 8ATCB 4HYKA 3SBMA 1P9YA 4C3LA 1U49A 3M8PA 1C1CB 1BQNA 3PDNA 2WONB 1CJUA 1FEEA 3NWRA 1Q8BA 2V8VA 3FJ2A 4X65F 3TAMA 5LM7E 3EUNA 1RP5A 4NA1A 2A1BA 1XEZA 4OYXA 1ZS6A 3MCNA 3M6UA 3ILOA 2H54B 5H9EK 3NGUA 1RACB 4LBHA 1DBDA 3DLJA 1HNWJ 5F8NA 1FE0A 4C48A 2C3YA 2XGPA 3TQEA 4EEYA 4ZPBA 1RB0A 4RW6B 3PJXA 1UW9A 2HIQA 3BN4A 2QTWA 3I5BA 2RRAA 4W98A 4IKAA 2GMJA 3I55S 2A2CA 1NNDA 2YPYA 2PEBA 3SIPB 3DYAB 4EI2A 1N5SA 3M4XA 4KE5A 3DDIA 3J7ZT 3OLAA 2AJ2A 1FEHA 3C66A 1FJGJ 1VHIA 4ZK7M 1UL3A 1XC9A 4I68A 1Q82T 1AZSA 4DPUA 3JQKA 4LFBF 2VIHA 2DNRA 1RAEB 3KUGA 2DO0A 3IN5A 4UOCA 4OZLA 5KT4A 5BR8F 2XC9A 2BACA 3CDEA 5B7WA 1VQ5S 1TK8A 3P8BB 4DPWA 5DO2A 1TL4A 3V4MA 2W01A 4YDDB 1XNRF 2C3OA 3DGVA 2QSWA 2Q66A 5IQQA 1JLCA 4ZS6A 1SJ3P 4P2MA 1JXLA 1KWMA 2B6AB 4LRCA 5HMZA 1VOMA 2G0IA 3AOBA 3WBZA 2JH3A 3DRSB 4HHHA 1LXNA 4ZVSB 2ZE2B 2IMWP 2K1RA 4UOGA 4DCJB 2OTLS 4KHMA 2FJWA 2LXIA 2ASJA 1Y9OA 1YJTA 3CULA 5JJBA 2FB0A 4KGZB 1IBLF 4ECQA 4J9VA 1MMDA 1HNXJ 5A6WA 1AUDA 4DEZA 2UUTA 5H9FK 1VBYA 4NOHA 3D1OA 1GX5A 1T0TV 4HDHA 2V94A 4GRSA 4J9KA 2M52A 1HL6A 3GWCA 4DWIA 3MMBB 2E5IA 3KHLA 3WDOA 2KKHA 1GMVA 1WOOA 3H5SA 1AW0A 2YXLA 1RAFB 3AJDA 5C2GA 2HHHJ 2H48B 2FJDB 2OP5A 3P96A 5B0BA 4KC5A 1WJ9A 2XCAA 4LF6J 4DN9A 3KTQA 2OUGA 1M5VC 3H40A 2UXCF 2YNFA 1EARA 2E5JA 3KLGA 2J0QD 3IBCB 1J5EJ 3VGUA 2MQNA 1JXVA 5EUHA 2E1CA 2JFKA 1JLGA 3CVKA 1L5UA 5LMUJ 2HQCA 1O8BA 2I5JB 2PGCA 3PY8A 1YTYA 1FTCA 5HVHA 4L3KA 4B3SJ 2DRBA 2RRBA 2XLIA 4OHYA 2DNYA 1B99A 1RT6B 2CQ1A 4PG4A 2QE5A 3S01A 1CQMA 4RJVA 4JI8F 2BANA 1YKWA 4I2QA 4J9LA 3OUYA 1WF1A 4J9PA 5KFGA 3W9HA 4G6VB 2WHOA 1UVNA 2OLWA 3RU0A 3SSSA 1M5SA 2GGPA 3H8YA 4F0MA 2ZKUA 1ZPVA 4ILLA 2ZJQQ 3TARA 2OEMA 3N5FA 3K0JA 1NJZA 2W24A 4X66J 1N36F 2IC3B 3GFHA 3P4UB 1M5KC 2V8PA 3T6BA 4GKKJ 3IWLA 2EK1A 3I4PA 2DH8A 3M2RA 5J2MA 3MM5A 4DX5A 4ER8A 2W2OP 1CVJA 1A7GE 2IM0A 2N4CA 2RDJA 4RNNA 3U7JA 1RZMA 3KLIB 4LREA 4B9UA 1RA6A 5HK4A 1HNIB 1U1MA 2YNGB 3LAKA 5L9XA 3MAAA 5HJXA 2XGQA 3CCQS 2M0GB 3D5MA 2Q1LA 3S7RA 3MURP 2DH7A 3W62A 4NLOA 4LRFA 5U47A 1ZH5A 4ZP8A 3R27A 1PJ6A 1ZAXA 3PG9A 1O51A 1VIOA 1CEZA 4ZP9A 3KHHA 2W9CA 3PW2A 3D6MB 4Y2MA 4IYQA 2HGLA 5KFMA 2VFVA 1BWEA 2GJIA 2QSFA 4CLTA 4DCPB 3K8WA 2PC6A 4U8YA 4DSFA 3RB3A 4O23A 1UFLA 3KLEB 2LKZA 3NMRA 2P9GA 4ZN1A 3G82B 4HACA 5HI7A 4DV7F 3V81A 2ASDA 3JXOA 1GEHA 3I82A 4L3NA 3DRYA 2BE2B 1DTQA 4KV8B 1UEUA 9ATCB 4JI2F 4TXSA 2VFRA 4MYTA 3UCUP 1RCXB 1FDDA 2P6SA 1MMLA 4R5PB 5F8JA 4R25A 4DFJA 1SC4B 4IH5A 2GCFA 1S5ZA 1F5CA 2UVRA 1XNQJ 1HBOA 4JYAF 1Y11A 2P8IA 3IRXB 2XY5A 1RHRB 1RHMB 1U25A 3EX7B 4J9MA 3ZZZA 4PWUA 2AWZA 1S4EA 3W60A 4IFVA 2VFSA 3UWTA 3MCSA 4TYAA 2E7WA 3C6TA 2AT1B 4WFYA 3N79A 2XY7A 2X1GA 4C0OC 1CJTB 2J0SD 1KNZA 4F4AA 4B3RJ 4O0IA 4NLVA 1C1BA 4QW9A 1RABB 2DB1A 4WK3A 1NB7A 1VRTA 3AY0A 1VC0A 4OHXA 3KNAA 3PV8A 2OMOA 1U0HB 2HIYA 3R5AA 3A8KA 1Y3KA 4K2JA 2J8AA 4TU8A 2XZDB 2YWHA 1UP1A 3KWMA 4J5OA 5HJYA 1Z2LA 3OVBA 3T5HA 3X3UA 3J7A1 3RJMB 4OX9J 4NEYA 1O0PA 4WFNQ 2RKIB 3PX6A 1YWXA 2EW9A 2QLWA 1VFJA 1RBAA 2BJ8A 1NO8A 3SCLE 2PN6A 3TRGA 3MAHA 1Q7YT 2QL7B 3MMCA 3RBZA 3CIMA 1WWHA 2MQMA 4TLQA 3T19A 2KO1A 3FDSA 3CJ8A 1BD6A 2MKHA 1REVA 1IJFB 2NYHA 4ED8A 4PYDA 2QA2A 5KFCA 3EE3A 2GMLA 1S9EA 3H5UA 3KLFA 5E3CA 2CPXA 2FY8A 3NNCA 4J9RA 3AH6A 4D3GA 3PR4A 1CLFA 2DGQA 1SJFA 4L72B 1P1LA 3NG8A 4ELTA 3CF5Q 4IO1A 2YVSA 3PO4A 1TMMA 1SKRA 5C2CA 2MKYA 3OW2R 1B64A 4MJKA 3PJWA 1PCAA 2B51A 3QNWB 4CTAA 4A8YA 5ETMA 3CJTA 3S6EA 1P9QC 1VQNS 1EETA 3AOAA 1WACA 3TEGA 3GJRB 4M5GA 1ICEB 5B0FA 4A8SA 2F4VF 4ELUA 4KTQA 1GFWB 3MPUB 4XO0A 1HBNA 4U67Q 4DUTA 2QMWA 2UVUA 1TAUA 3T1AA 2CQ2A 4U7CA 4M5JA 1NSKL 3FBFA 4UT4A 3BSCA 2VDIA 5KG5A 2AZ1A 1SC6A 3A3NB 3KMQA 3V6DA 1DLOB 2BV3A 2KRBA 2XSJA 1M1GA 3QRRA 2Y8WA 4WKYA 1MWZA 2NUHA 3NMAA 3GJSB 4YMEA 2CNKB 2UV8A 1Q1KA 3SV3A 3CJSA 1N56A 4Q45A 2ZOMA 1Q0NA 2LEAA 4O0NA 4M5KA 4U95A 2ZVSA 4AFFA 5E0OA 4QWBA 2YWKA 4ECUA 3DMJB 2XBPA 4DHVA 4WXWA 2GQCA 4AL5A 3I0RA 1SL1A 3BYRA 4YB5A 1OMSA 2CKWA 1IWAA 4ZJOA 1MW7A 1S7IA 5L38A 4O3RA 2CVIA 4X4VA 3HVRA 1LK5A 2HNZB 3QWUA 1H6KX 2R8KA 1FD8A 3SQOP 4GKJF 2XMTA 2OKQA 3FRYA 1K8AT 2OGUA 1WKLA 3OL6A 3EM1A 4IH6A 4AQYF 2MQ8A 3MFIA 4MYUA 2LQ5A 1PJ7A 2B4VA 5GAHU 2HRTA 3R3TA 2GJ2A 2I6WA 4ZPAA 2ZH2A 4V19J 3QZ8A 1TUWA 3THPA 2V2QA 1G3OA 2YKQA 5ETNA 3GFZA 1C4CA 1AXQA 2GX8A 1URNA 1ZA2B 5F8GA 2M4MA 3M8ZA 4DL2A 1YHQS 2MEWA 4KAIA 1G2EA 2NZ4A 1HR0J 4DFMA 3OTBA 3PHTA 3TWZA 3TANA 1G7CB 2IDLA 4Q44A 3D66A 3DOLA 2F5GA 1RTJB 5A76A 5SZTA 3KOAA 2UU9F 1RT2B 1GX6A 1KVIA 3VQTA 2UXDJ 3W2VA 4F4XA 2AX0A 1SPBP 1JJHA 1PAEX 3IXQA 2DITA 4LF5J 2KHCA 2JFDA 2XMUA 1N8RT 2VC1A 3CO0P 4Q8EA 3MUMP 4OHZA 4O44B 1EAYC 4ZLNA 3WQPA 1TTHB 4NLDA 2ATLA 2OSQA 1B4SA 2W8LA 3QWPA 1I94J 2UUAF 2PMZD 2BMBA 4K8RA 3PRVA 2ILYA 1Q81T 3CDBA 4DPTA 4C8LA 4CLKA 5D77A 1C0UA 4DR4J 1C4AA 3W2WA 3BSNA 1MLAA 2WSEC 2VA3A 2OEJA 1AROP 3G2XA 2B7CB 5D0GA 2QC3A 3RRGA 2OPRA 4JV5F 2GHPA 4OJ1A 2R2SA 4DN0A 1DTTB 2MB0B 1NPKA 5FDLB 1FI4A 4ID5A 3H0PA 4JI6F 2FLLA 2ALYB 4M5NA 3HZGA 3T5JA 4LRAA 2C2MB 2AZ3A 1FK9A 2OFHX 3G86A 1X4GA 2PSZA 2D1CA 4HT5A 2GNKA 3CW2C 4CO5A 2DRDA 2ZD1A 3QSIA 3ZZYA 2YNHA 1VI7A 2OIHA 4CI0B 3GYNA 4O3QA 3LH2S 1FWLA 3IM8A 2ADCA 2E44A 3KG4A 4H4OB 4X64F 2AGQA 1GAOA 1FFWB 2NS1B 4KO0A 3RB6A 3V6KA 2LVWA 4DQQA 3OTDA 2JHEA 2CQ4A 1RHJB 3KYLA 1O6XA 2F40A 2MHEA 3AD8C 1MNEA 1J5OB 1KC8T 4OZJA 1OO0B 1PBAA 4CQ1A 4J9UE 2NXCA 3HX9A 4AUKA 2MPUA 3NS6A 4RW8A 3TJ9A 4QU6A 1NDCA 4F67A 2MQOA 4LFBJ 5KAKA 2N4DA 1VIXA 4KT0C 2KYZA 4DPOA 2AEMA 1KOHA 4DV0F 3DRPB 2QL5B 2CADA 1F9FA 4NI2A 3FSIA 3TVZA 2F8HA 5K8PA 2GVDA 1HNZF 2NSBA 2HAIA 3O1LA 1VC6A 1RTDB 4CRJA 4WP9A 1KQFB 1TL7A 3DLKA 1I1GA 1S72S 2FHKA 2EKNA 3AAWB 4LT6A 2KU7A 2J9DE 2MKSA 4PQAA 2WAQD 1QJHA 3BKFA 5ETOA 3G6VA 4UY85 4DG1A 4LVOP 2HFSA 2UXBF 1SXLA 1RWNB 1LOUA 3HT3A 1NDKA 2WZ1A 3W65A 1PJ5A 3ENVA 2XZTB 3BM7A 3WIUA 1PBUA 2YWWA 1TL5A 3IS9B 1VQ9S 5I3UB 2H51B 4CT9A 3C6UB 3BDPA 1H2VZ 2FGCA 2LU2A 4Z37A 2YX1A 2Z57B 1U8WA 4V19X 2BKOA 1HBUA 4IG0B 2VUGA 2FJAB 1M0SA 1HYSB 2D9PA 3FCWA 1S6PB 3NBPA 3C2PA 4OMFG 4E2FB 2E29A 3BGFA 1EZZB 3UR0A 1RKIA 2HHXA 1IR2A 2ZH4A 3C3LA 1URRA 1R43A 1RI7A 4P75A 3H90A 5CZXA 2XS7A 4EK2A 1MSWD 2XHWA 4P52A 4DUYF 3RR7A 1REGX 2Q6CA 4ZCKA 1CJVB 3Q8QB 4PABA 5KOWA 5AXMA 3W66A 2RU9A 3CCUS 1W2BR 4Q0BB 2DNOA 5CA5A 4ED3A 2XYPB 1HLWA 3N01A 3NCQA 4FYYB 1XTZA 3PACA 3OL8A 5IM0A 3I0SA 1NSPA 3MPVA 1IKWA 3I4HX 2FZGB 4JI0J 2AEFA 1WC6A 2ADBA 2HBQB 3FMBA 3N4WA 2CQ0A 3OPKA 4HT7A 5GAGU 4G1QB 3K89A 4ERDA 4JI8J 1K0TA 3S1TA 1K44A 2BEFA 2BKPA 2CQPA 4KFBB 1Z1ZA 3SI8A 4NLGA 1B0TA 2PFDA 2DNQA 2B56A 2RU3A 3UCZP 2CWXA 3TZZA 4YQWA 2MQLA 1HHQA 2F8MA 2ZC4A 2KZMA 2FIUA 1NDPA 4PXBA 2ZBIA 3UPFA 1UAWA 3HJFA 2DR9A 1YGYA 5E7OB 1L3UA 1BUXA 1T9WA 2KRRA 2GS8A 4JI1F 4XPCA 1LW2B 1UTAA 4RPFA 3DLEA 2FJEB 3EPGA 2OMLA 3BH7B 3FFIA 1FKOA 5F41A 4DPYA 4P2XA 4IDKB 4WYWA 2AYBA 1LWFB 3R5GA 1JLCB 3EGNA 3W5ZA 4OZ1A 4A8QA 2NR0A 3QLHA 2RS2A 1WG5A 5T7LA 1UA0A 2NXUA 2V4RA 3CJ3A 2CPFA 3GPAA 3OTEA 5D0HA 1JJCB 1KFSA 3K59A 2VG5B 3BH6B 2FHMA 1TUVA 2ZH9A 1U8SA 2ZH5A 2K1RB 3DGPA 1ZAWA 2CPIA 1NHKL 2RUSA 5D15A 1RT7A 2Y1LB 4RBVA 3M8RA 1DZ5A 1IUJA 3LO3A 4NYOA 1Q8LA 1WF0A 1KOOA 2J9EA 1ZM4A 2W7OA 1FJEB 3MM8B 4JV0A 2XSFA 5EWGA 1ZBTA 2MZRA 3LPEA 2C3UA 1QUPA 5LMNF 2CNLB 2EC0A 2WSCC 1F9HA 2FLNA 1T03A 4HHUA 3ETMA 4EWTA 2DGSA 3K17A 2B9WA 3HT0A 4P74A 4ZVPB 3CDUA 2WK4A 3PEHA 2Y0SD 1IM6A 2VPYB 1IQZA 1RBLA 3M9MB 2YNFB 1S0MA 2ZDOA 3KLGB 4MIAA 3CC7S 3D68A 4JYAJ 4ES1A 4PQUA 5KFRA 1Y5NB 2N7CA 1U1NA 1NH7A 2LDIA 1JLGB 1D8ZA 1FNXH 4UOHA 2J9DA 3ZXWA 2RRNA 4OLOA 4ZVEA 4I2PA 3C8YA 1FFSB 4UZBA 1ELOA 1RAOA 1VRQC 2BBEA 4F7VA 4RLEA 4E0DA 3CSKA 2H5JB 3A12A 4L75A 3IR6B 3OFEA 5JXSA 1IKXA 4CO1A 4I2QB 4USHA 2ZWOA 5E5NA 2HHUA 2XO6A 2IY5B 1N4LA 2DH9A 4NXNF 2CQ3A 2HVIA 2GGPB 5AJ3F 1DARA 1U1KA 4K4XA 3EGVA 3F56A 5CAAA 1TU0B 4NA2A 1NPRA 3M8QB 4XAKA 2MSTA 4MK9A 5HLFB 6AT1B 3KKFA 2Z56B 1IBCB 3M2RB 4URQU 3EXYA 4ECRA 3VTIA 1RT5B 3HI9A 2ZZTA 1N5VA 1TZ0A 4NLRA 4PWDA 1LWEB 1GXTA 2YNIA 5KFWA 5D0RA 3T5LA 2HBRB 2HG4A 4BS2A 3HZEA 3DXSX 3M32B 2DO4A 5DG8A 4A8KA 3MAAB 4GC6A 2D74B 5GAEU 1I5OB 4ID8A 3SFUA 3L7UA 2UUBF 4RUBA 1TK5A 2ZOFA 1RU2A 1QE1A 1TKZB 5FIIA 3JSRA 2M8HA 4NYPA 4ZCMA 1WOSA 3T3FA 2CXEA 3A8EA 1Q7LB 1UKUA 3TUJC 1HNWF 4CH0S 5D3GB 3JSMA 4HACB 3MECA 2VH7A 3V81B 5MLCV 1LNQA 2UV8G 4ZIWA 4GO5X 4TY9A 3RZAA 2DGOA 3IAS9 2R7WA 1T9VA 1S9FA 5AE2A 2FPHX 1OPIA 2W9AA 3A8JA 1NBEB 4IOAQ 3MM7B 4WBFA 4RNFA 3CTRA 2JSXA 2I9SA 3GFYA 2QLBB 2AJFE 5AXNA 4ECXA 4YN3B 5L9NA 4PR6A 3K8VA 5A0YA 1JMTA 2OPPA 3Q89A 1WG1A 4NLPA 3RBEA 5EHHA 2MY7A 1HBOB 4DQSA 1HQEA 2KB2A 4MKYA 1FRKA 2JL9A 3ONQA 2BJ7A 1WHXA 1BHNA 1D09B 1SQEA 1YJNS 4IFVB 4GVBB 2V2VA 3Q8YA 1MN9A 4KB7A 2HW3A 3DOMA 3KLVA 1R89A 4QIEA 1TR0A 3PJ9A 4N76A 1F3VA 2AYGA 3KHGA 1YG0A 4QIVA 3P6YC 3AD7C 1C1BB 4WU2A 4P7TA 1N33F 3D0GE 2AJ4A 2ZBQA 3CC2S 2X7IA 3MEDB 2R2UA 2L9WA 3GR0A 2CG8A 2A0FB 3QQCD 2DHHA 3L4BC 2OPQA 3VGTA 3Q8UA 3TA0A 1ZYQA 3OVSA 3W8PA 3PW7A 2FQQB 3PYDA 2W7PA 1T02A 1E6VB 4BWJA 4DS5A 4C8NA 1RAAB 4WFAQ 3CJ0A 4KGXB 3TYTA 1FX4A 2ASYA 3HHKA 1VYAA 2OFGX 1TVRA 3UFCX 3RGIA 3HHEA 2AKWB 3AA9A 3QIPA 1F2GA 3D9BA 4OYOA 3QAEA 1ULRA 3WZ0A 3V6JA 5HATA 1SUQA 7AT1B 1UZHA 3TVKA 3RAQA 1U45A 1PC5A 3OR2A 5J2PB 4FKYA 3P5BP 3E01A 2R8HA 2CNOB 2LYVA 1S77D 3TZYA 4DSIA 2EFVA 4QW8A 2HHHF 1N5TA 3HHLD 1JLAA 1FD2A 1SL2A 4LF6F 5ETKA 2XULA 5A6PA 3D0HE 3PX4A 3UDCA 2HHSA 2W9BB 1JQGA 4DMZA 2ZM6F 3SV4A 3HD2A 1YITS 3L9ZA 1X0PA 1H2UX 1X4AA 1J5EF 4P73A 1JWWA 3ZTOA 3NOCA 4MFBA 3CGIA 5DGBA 5LMUF 1UVKA 2D3O1 1WEYA 1RHKB 2W2QP 4K7QA 1EETB 2XMMA 5L39A 2W8KA 1N34J 1VGYA 3TZXA 5L8RC 2BE7D 4ETXA 2BXJA 1IR1A 2UUCF 3HM9A 2ABYA 3HHLA 2IM2A 2ROGA 4WIQA 1SIWB 1RWVB 5H9FJ 1HBNB 2KM8B 2DR6A 5C42A 5A8WB 2DK2A 1OY9A 4OJ3A 4QYRA 4RUCA 4XTTA 3HMJG 3W5XA 1RT1B 1HI0P 4C11B 1RTHA 1SV5B 4H54A 3BSAA 4QWCA 5EGYA 4K4ZA 4JV5J 3W1YC 2AIRB 2IMOA 1WC3A 4URSA 2VOOA 2SXLA 3HJVA 3BBFA 2EFNA 2ACYA 4ECZA 4X66F 5GMKa 4JI6J 1HNVB 1AFIA 3UE2A 1BQXA 3TNVA 3N0VA 4ED7A 4JI7F 3MEGA 2V67A 2BA9A 4C0HA 2L3MA 4N7TA 3FSXA 3K5LA 5KFUA 3DRRA 3I0RB 3MR7A 2FJBB 4FXWA 1U09A 2D69A 2QRRA 1TFYA 4X62J 2FJXA 1N5YA 1NB2A 4UQTA 4MKBA 4LUBA 2CZVC 1X31C 1ROFA 3A4TA 6FDRA 5LT5A 3ZTQA 2C42A 2BM1A 4X64J 2DR5A 3UN3A 1RXOB 1U1QA 2J7WA 4HLBA 3GSDA 1LWXA 4CNYA 3TJAA 4Y00A 3OTOJ 4DXLA 4R0JA 1LQ9A 1XMBA 1I51B 1PGZA 2XHCA 3GE9A 2OD4A 3AFGA 4ES3A 4CYUA 4F25A 3ZZRA 3ZZ0A 5B0GA 4A8WA 4QYZK 2C2EA 3B6BA 4WTYA 5E2QA 3AD9C 4ECSA 5F0UA 1IQTA 1LFPA 3ENAA 1CULA 2XEXA 3VAMA 2FVPA 3VHQA 3HFVA 3UN5A 3QIDA 4I6YA 1VCTA 4OHVA 2QFJA 2DJWA 5I4MA 2CQCA 3I6PA 1UW4A 5IZHA 1V9OA 2QYCA 1OQ6A 1W7WA 3US5A 4IO9Q 1JLQB 4CM0A 3DOLB 1HNZJ 1WOPA 4M5DA 5GADI 4F4KA 4KH0B 3CJQA 4L76A 2HK3A 3FZ2A 3W2VB 2OELA 1XNQF 2VICA 2ZC3A 2HQGA 4EU0A 4FPIA 1CS4A 1W26A 1U02A 5CYMB 5G4DA 3I5AA 5LXYA 2DNNA 4ZVGA 9RUBA 2POKA 5HQ8A 4OYAA 4QWEA 4NEZA 4OYPA 2KHDA 3G9CA 5G0RA 3C16A 4M5HA 2VASA 4BCAA 3EZOA 3LQVA 3TEHB 4B3RF 1FF2A 2RDDA 4PXCA 1N5QA 2BW7A 2CJXB 1YDLA 4ZP7A 3W2WB 1HWKA 5HQLA 3H59A 4O4GA 3GTYX 3HLUA 2LQBA 5KT2A 3Q8PB 4RW9A 3R6LB 2DIVA 4NASA 1B0VA 4I6AA 3KMSA 2QLJB 2Q43A 4K4VA 4DR3F 2BJEA 3CC4S 5E3RA 5DQHA 3HSJA 4KBIA 1FK9B 4DR7F 1VQ7S 2FVQA 1VMBA 2MLYA 3HVTA 2XLJA 3DM2B 1FTRA 2K7KA 4Y2CA 2JVOA 2ZD1B 1PYSB 1H7XA 2YNHB 1U48A 3FQKA 4YP3A 1EB0A 3D1HA 2CZ4A 2OPSA 3D4JA 3VGSA 3Q23A 5DLFA 1IWGA 3VZHA 4Z7YA 4R8UA 1VQPS 3PRDA 2OEKA 2HS3A 1UFKA 2AF6A 4DV2F 4QJVA 1RCOB 4MIWA 2GAHC 2Y8YA 2JX2A 5DQIA 3U02A 2M8DB 3NGSA 4FF2A 3HSDA 1T3OA 1T94A 1FVSA 2VDHA 4K4SA 2FC9A 5L1IA 5EX3A 1LWCA 1PAUB 4DR2F 3BQ1A 2W4DA 1FA0A 4RW8B 2NPFA 4I0WA 4M5LA 2W7AA 3GIMA 1SKWA 2X1FA 3GU0A 3LANA 2WTFA 1CJKA 3NP5A 1NLKL 1IN0A 1WC1A 2JEIA 4P2FA 1JLBA 3JTNA 2QA4S 2VJVA 2X51A 5J2QA 1ZOTA 1S0OA 4P72A 3DI6A 2XI3A 2GVDB 3QJPA 4OZ0A 3IFEA 2KT5A 1Y4ZB 4WYLA 2LU1A 2YX4A 5L1LA 3M8WA 2HNYA 1TL7B 4BHQA 3DLKB 2R7RA 1D1UA 3KFWX 3AOCA 1NU4A 3ISND 1RHQB 4A46A 2ACMA 2YKPA 3BB5A 3IBWA 3Q86A 1HHSA 4RWXA 1M5HA 3IBFB 2Z58B 4OL8A 3QT7A 1YQHA 1DJ0A 2M5YA 4KPCA 2OTJS 3SEOA 2C28A 4OIXA 2IAJB 2FD2A 2DGXA 3ZTPA 3FEZA 3GONA 1JNRB 1R0CB 2X3GA 2H3EB 2BX6A 4X4QA 1KEKA 2K3IA 1X9WA 5HBMA 5L1JA 1SC3B 3MM6A 1YJWS 1E6YA 2I1RA 3T1YJ 2ZZMA 2NXEA 4NYZA 4BWMA 3PIPQ 3KUHA 3RAXA 1HBUB 1QAJA 2FHOB 3EVWA 2ZH3A 3A13A 1UVMA 3KDOA 2K3KA 2WONA 2GVZB 2O66A 1TL1B 2YQ3A 4DF8A 5HROB 3ISZA 2M2BA 3DU5A 1HQUB 3C15A 2CQIA 3PEJA 1H72C 2EBEA 1L3TA 1X9SA 4WZMA 4A4JA 2WOMB 2MZJA 2JWNA 5LSLA 1R6VA 2VODA 4A8FA 5J1PA 1S99A 3D0IE 4PWWA 3W63A 1LV5A 3O6QA 4RW6A 3OR1A 4CDIA 3M7VA 4AYBD 3J80U 2RUGA 4DR6F 2HZCA 3R6GB 3OT9A 1X4BA 3G6ES 2RS8A 3DOKB 2I2YA 2V4JA 3LA0A 5IM0B 3I0SB 4FYDA 1IBKF 1R8BA 2HSEB 1NEEA 4ICLB 4CP5A 3T9NA 2B5JB 1BY9A 1SCJB 2IA0A 3G4SS 4JP8A 1RKJA 3O44A 3U27A 1YK9A 2DNKA 1OPZA 2GO8A 1TL3B 2DNZA 4K50A 1QAYA 1YJ9S 2UXDF 3MFHA 5LXRA 4HL9A 3NGDA 2EPIA 3R1LA 2CQGA 2FVSA 2DISA 3DFEA 1WUUA 5BYQA 4NXNJ 5ETRA 3ZC4A 1WDDA 3J80Y 1DQAA 2H1YA 2V8DA 3NS7B 2ROEA 2KXNB 1FNMA 4A48A 3B8HA 3SCIE 1KHWA 2CJAA 2XNQA 1XJWB 2ZBPA 4FZVA 2BUNA 3N6MA 4NLTA 4PYAA 3IAM9 4DFKA 5ETTA 2BJ1A 2MDAA 3LP1A 2B43A 5KFSA 4DR4F 2G1HA 3DRSA 1PG5B 1HWUA 3FSYA 1VQYA 2ZE2A 2J76E 3CCVS 5JVGQ 4FF4A 3I87A 2UUBJ 3B82A 1V3SA 1RQ0A 1D9FA 2LEPA 2HZAA 4HVZA 1P1TA 2EC2A 2N3LA 3H5XA 4MKAA 1RT7B 4YB1P 4IQMA 4ZVUB 3H4BA 5E3AA 4ZA1A 3IWXA 4UTGA 2PD1A 4WU3A 2CAJA 3MMBA 5AXKA 4K5RA 2Y1JA 1S7HA 1YRXA 2ZNZA 1S1UB 1Y10A 5AT1B 3MM9B 2XTJP 4QR0A 3F0NA 4S0MA 1RT3A 3QGGA 1T03B 2E9RX 2YKMB 4XK8C 4F2SA 4GC7A 3L7OA 3RRKA 4NE9C 4M63A 2FJVA 4C8ZA 2QO3A 4J9NA 3BGOP 2A6MA 4PQUB 1QD1A 3M6WA 3D3BJ 1C2PA 1V5VA 1S1VB 3QMQA 7FD1A 3NCRA 3MXHP 3OHAA 2IRYA 3SDEB 2ERRA 3G71S 1RT6A 1NK7A 4I2PB 1EQMA 5ADZA 3THTA 4ZHRB 4ZPCA 3MR5A 5IC6B 2WRMA 5ETQA 3DHWC 3AB4B 5IT0A 1NSQA 4G1IA 1KRPA 2CJQA 5F8IA 2FZKB 2B9XA 1CPZA 1N33J 2AP6A 2QMUB 5K5MA 1NDLA 4DLEA 1RWKB 1N6QA 1FE4A 1BQMB 4RUHA 4ZPDA 3G8SA 1CC8A 4NMXA 3GIKA 2HFOA 1M1KT 1RDRA 4YS2A 3R5BA 1L3VA 2V5HG 2QMXA 5LL6d 2ZJRQ 4F8RA 3J81U 2BABA 2EG2A 4FBUA 3MR3A 3ZZUA 2E5LJ 1UEKA 2ZUGA 4JBCA 3A8IA 5F3TA 3KLIA 4K4UA 3MTKA 1FXDA 2YNGA 4P2SA 1RTZA 2KL8A 2YNIB 3OXLA 4OI0A 3LP0A 2N82B 3GYGA 5F8HA 2JEJA 3RAMA 1ZPWX 3D1QA 2W2MP 5BYSA 4CH7A 2GFFA 2GJFA 3PFEA 1NUEA 3DLLQ 4QU7A 3CNQP 2YKNB 4O4RA 1U0SA 3OXFA 4ZOSA 1GH8A 1QSYA 4WP3A 1ZM3A 3R5DA 1SH3A 4BC9A 3BPDA 3M8YA 3EGWB 4DR5F 2JNJA 2V8GA 2CVEA 4KQZA 2LP4A 3KNGA 4KH1B 3J81Y 2CPDA 3G82A 2ZM6J 5CYQA 1SQGA 3CD7A 1B3TA 5B0CA 2BE2A 4Q7AA 4KV8A 3M2VB 3TA2A 2RE1A 3NS5A 3A3PB 4H4KA 2LDYA 1OYEA 3MECB 3MMAB 3MAQA 1L3KA 2MSSA 3ILJA 3N6NA 1S59A 2ZEJA 3VWSA 3NNAA 2WCXA 2K7JA 2HAFA 1YRUA 4A8MP 4R5PA 4ITSA 3CMQA 1HQ2A 1JLFA 5A8KB 4JI0F 1HW8A 4YB7A 1SJ4P 1NJXA 2HFVA 3LOUA 1SI9A 3MEEA 4ZJQA 2VG6B 2R3VA 2UUCJ 2W2PP 1O5JA 4NLWA 2H5IB 2P6TA 4KHPF 2E1MC 1S1XA 2HQ3A 3QT6A 3M2UA 2VPXB 3CCRS 2FZCB 4WFXA 1HI1A 4DZDA 3PXGa 4C8MA 4JI3J 3ET6B 3AQPA 3SZ2A 2QX0A 3U1NA 4LQ9A 4FN5A 1WEZA 2X3DA 2LQ9A 3O8WA 3BEGB 2CG4A 3DOMB 3TAQA 2A3JA 2VFTA 3OBIA 2DEJA 3J7AN 3JYTB 1VRUA 5CD4A 2AQ4A 4RNMA 4IR9A 3UR3C 2W1BA 3R97A 1FKAF 4JI7J 4B9NA 1U0HA 1F2HA 4OI2A 4M1KA 4G1PA 2QGFB 4NLXA 1VBZA 5LOQA 1KVJA 4YR0A 1TAQA 4UW2A 3KJVB 2M88A 2BQUA 3R5CA 2KM8C 4ZN3A 4YR3A 1FRHA 1VK8A 2EFOA 2OPQB 1UWAA 2Y1RI 1B7YB 3CE8A 2HMIA 3O5TB 2CPZA 2VU5A 2CA9A 2L48A 4HHJA 4DSEA 3HDSA 2M7SA 3NOGA 4B9TA 3MWBA 1TKTA 1W2IA 3GR1A 2HWIA 1EP4B 2JOQA 2M70A 2CFXA 1DRZA 3ENQA 3M1VB 2DXFA 2ROPA 2JZ5A 3LWLA 2L41A 1TVRB 2GHWA 4QIFA 3LALA 2KXHA 3BR9A 3UNYA 1FX2A 1KN6A 2V0NA 3FC9A 1SUQB 3OL7A 2A18A 2DNMA 4WKRA 4I69A 3P45B 1JJ2R 4LMZA 3OR2B 3TAPA 4RW4B 1KQKA 4PXDA 2PT0A 3GV8B 3E01B 4DSJA 1VBKA 3QGHA 2ASLA 4OX6A 3VQSA 4QWDA 2BJDA 1JJ4A 1JLAB 3CCMS 4I7FA 3IA0A 4F0HA 3RR8A 4NWBA 2ZVIA 2VBWA 3RBXA 3QFWA 3FBEA 4C9DA 1X5PA 2HFUA 3IO1A 1ZZFA 4W90B 2KTQA 2EWHA 4OV1A 2YWEA 2IYIA 5KG6A 4XDDA 2JJ4D 1VISA 2EKYA 4Z7CA 4F02A 4ELVA 4AL7A 4NXMJ 3E3XA 2FGOA 3M30A 2I38A 3V4IB 3DLHA 3J7YI 2KZZA 3L7PA 1X5TA 1DLOA 5KFKA 1TELA 2Z2YB 2A10A 3CIZA 2R7QA 1LFWA 3MD1A 2F1FA 3PIOQ 4DL3A 3FZBA 3ZZPA 1KP6A 1RTHB 5K8OA 3SCKE 1GMUA 4DU7A 1WHYA 1M90T 2ZH1A 2C2OB 5A8RB 1NHUA 1C0TB 3KK3B 5DETA 4DR3J 1F5BA 2RILA 1W25A 5CYJA 1RTIA 1NK8A 1XN9A 3C14A 5T14A 4CO4A 4C3KA 3DMJA 2RHQB 4TKTA 3PKMA 5KFXA 3VV2B 4DR7J 2WBRA 1EIYB 2VOPA 3BN7A 4L74A 4C2MA 1NK0A 3DRRB 4B3MF 2HNZA 2JDJA 4LQ3A 1S48A 1RISA 2YQ1A 4NLUA 1N5YB 1K73T 1N32J 4ED4A 1KQGB 2Z2ZA 2DCLA 4DL7A 3N28A 5F9NA 3UCGA 2DYAA 3BDEA 1J27A 4OYZA 4F04B 4DV2J 2RQMA 5D6GA 4WWSA 2F7VA 4DR2J 2MQPA 1SBRA 3HSZA 3NGKA 2VONA 3HCXA 3K58A 3GIRA 2J0XA 1H74A 1RU1A 1LW0A 2NXJA 5IC4B 2H5EA 2WW4A 3A1YG 3D3CJ 3VCDA 3WIVA 3GLJA 3OFHA 1RTJA 2JEFA 2C2ZB 2IJFA 4I67A 4H4MB 3LUYA 4ZITA 4RU9A 2LFVA 3G6XA 3RYLA 1QTMA 3UNGC 3EDRB 1H38A 3AXMA 3L3CA 3ILLA 3GCWP 3BKUA 5KTQA 4ZP6A 1ZM2A 4FNHA 2MMYA 2YWFA 4CZCA 3N6LA 4IFYA 4O3NA 4ZCLA 4Q43A 2RF2B 1S9GA 2HNDB 4AE5A 3F41A 2IBOA 4JOUA 1CS4B 2NXNA 4NRTA 1VS3A 3I32A 2OD6A 1YJ7A 4LF4J 4O3OA 1F6TA 3MMJA 1KR4A 2WVDA 3AT1B 2HWHA 3EZ5A 2ZZNA 3NNHA 3T6JA 1Y5LB 1U47A 4EZ6A 4PKDB 5GMDA 3CT9A 3C46A 4FS1A 1TKXA 5JVHQ 2YPZA 2VG7A 1XERA 4L73A 4NMLA 2NLWA 2RNEA 3K2YA 4GMKA 2PEHA 5HP1A 1A0OB 4JI5J 4NZ7A 1SQFA 4OZ3A 1S1WB 1JB0C 4CLSA 4C4WA 4UZCA 1VBXA 4RW7B 5FDLA 2IFXA 2VL1A 5F3ZA 1VDHA 1TMJA 3GV7B 3PYEA 4J37A 5KG1A 2K06A 5J2NB 2CDRB 1QAIA 1MMNA 3K5NA 2Y0BB 3QJLA 5J1EB 1ZM9A 4IUFA 2KYXA 3KXDA 3NY0A 4PPZA 2W25A 5IXUA 2FHJA 3HVTB 1T05B 1M5PC 4LSLA 2XS5A 5DZ7A 2P9EA 4H4OA 4DR6J 3KUEA 3EVOA 3FEXB 2XMKA 2QFIA 1K0VA 2Y9HA 3QFHA 5D4PA 3FCVA 1SIZA 1NJWA 2OPSB 4XDCA 1XMQJ 2B8PA 4WCEQ 4OI1A 3CJ5A 4IR1A 1IBKJ 1J5OA 5DDOC 1ZAVA 4IG3B 1WHWA 5D4LA 2EG1A 2H65B 2LCWA 3W9IA 3KJNB 3BPSP 3VAJA 2ZBRA 5AE1A 1QSSA 1LWCB 2DR8A 1R0AA 1KDNA 3W61A 4HH0A 2XQCA 2E9ZA 3IM9A 3KJFB 1JXEA 1R8AA 2QIFA 2ILZA 3QAUA 3I31A 5A2QU 4HKQA 2B9YA 2J0WA 1NHVA 2IJRA 4ED5A 1BLUA 1A6LA 2IIHA 5F8MA 1VQOS 3KK2B 2JVRA 3OFFA 1BWVA 2VBZA 2JLEA 2PE8A 4FYWB 4BBYA 3TW0A 5J2QB 2NPIA 1RTDA 1QTNB 2GV1A 1N34F 1ZETA 2R7XA 2Q3PA 2EEYA 2KJWA 3LGHA 1U2RA 3PYFA 2Y3YA 2ZBCA 3AA8A 5DDPC 1U6BA 4Y2KA 4QR1A 1HMVA 3BQ2A 4J9QA 1U4BA 5KOXA 3QO9B 3GSIA 1X4DA 3DDKA 1JX4A 2QLXA 1R31A 2B3TB 4HH1A 4OFZA 3LGNA 1XWLA 4YDXA 3M6VA 5I3UA 3W8GA 4K5SA 4FF1A 5B0EA 2R8GA 4ECTA 4KKOB 4N41A 3M9OB 2V50A 3GV5B 1YZ7A 5A2QY 2R8IA 5HBMB 1OS5A 4E8UA 4EBDA 1Y5IB 3E2EA 3MM6B 1E6YB 4LR9A 4IG0A 2HFZA 4C7QA 5HMYA 3MOJB 1RA7A 2VC0A 3BV8A 2DHXA 1WNEA 2U1AA 3OQ2A 1S6PA 2ALZA 1SJRA 5AE3A 3VZIA 4KY3A 2E7XA 3H2LA 3D2WA 2G2OA 3ZZOA 5IS2A 4X62F 1UWBA 1D3WA 4PG5A 4ECYA 5ETPA 3GMGA 1SKUB 4FNIA 3C15B 1PILA 3H42A 3MF5A 3GIIA 2ZJPQ 2ZUAA 4DV5F 3FNNA 3OTOF 2CQBA 3H20A 2DPIA 2PIIA 1CJVA 1CSJA 4KGKA 1RLDA 5KG0A 1YJUA 4QBUA 6FD1A 5KFEA 1QM9A 4Q0BA 4DL4A 1RT4A 3CCES 1IKVA 2MGZB 2HQDA 3OR1B 1K1QA 2JLFA 2PMWA 4CT8A 3T1HJ 1X4FA 2UUWA 2W2NP 3Q2SC 2QG9B 1VC5A 2NCKL 2Z8QA 1HKAA 2V4JB 4ZVQB 4LRBA 4G1QA 2DD8S 3HF5A 1UVIA 1F0XA 2ZNYA 5HQMA 3SQGA 2ZWPA 3BKTA 3NEKA 1Q8KA 5DRKA 1NPPA 1TV6A 1RBOB 3FEYB 4KFBA 3OJUA 1Q4RA 1N0UA 2DGVA 4Q2LA 4TY8B 4DCOB 2J6SA 4B08A 3CD0A 2HGMA 3H2UB 3SFGA 5DG9A 4CLFA 5F0WA 4K2XA 5CABA 3IWNC 1YIJS 4TNOA 3PZPA 4KR0B 2JC1A 3DC2A 4X84A 1UVLA 1Z2ZA 2HEKA 1NJYA 2MKKA 4ZVRB 2DNPA 1MROA 3LGMA 2FLOA 1GK8A 1DFDA 1S0NA 4PG6A 1LW2A 3I9ZA 2O3DA 1FXLA 4GO7X 4A8XA 3POTB 3D67A 5DQGA 4C8YA 1A9NB 4F2RA 3MOZA 4FXDA 4IDKA 3AHPA 1FVQA 3S8SA 1LWFA 5DDRC 4QYZJ 2WB1D 3L09A 2EFPA 5L1KA 2AGOA 4Y28C 4NCGA 3LP1B 2MYFA 1FT8A 5D4NA 1N54B 1UMJA 2QV6A 4FKXA 1HD0A 2VG5A 4M5MA 1G4CA 3N5BA 2RQKA 4I4BA 5BYRA 1VQLS 5ETSA 3M8PB 4K0KF 1SB6A 5C25A 1BQNB 1Q95G 3CUNA 1ACMB 1DURA 1CJUB 4QWAA 4EFAC 3JS9A 2WSFC 1KQSR 5IOLA 4LJMA 4DR5J 3ADAC 3TAMB 3AJ1A 2DXEA 2G9OA 3JAMU 3MM8A 2VV5A 2CJ9A 4IH7A 1EHWA 2MHNA 2QEXS 4NCAA 3CJ2A 1FRMA 1SJ1A 3VAFA 4EYIB 4DV3J 1VLOA 4TQSA 4ED2A 3AJ2A 4LF8J 1H0HB 1UJ6A 4G65A 4A8OA 3NCPA 4OYIA 2AEJA 3BR8A 1KKHA 1NKEA 4KSEB 3W7BA 4N77A 1WTFA 1T9UA 4P71A 3GG0A 1F60B 3GB0A 5HVFA 1GTEA 1RT3B 4B9LA 4Y0FA 1RYSA 3DU6A 2B0GA 2PO4A 3FGVA 3MZIA 4CIOA 3KG1A 2Q79A 4BDPA 1X7VA 2LA6A 4DR1F 4KHPJ 4P9SA 1HPZA 4C0BA 3E8OA 4LBPA 1LXJA 5DZ6A 1NM2A 5K14A 2BVZA 3JAMY 3ELHA 2ATCB 1AZSB 5MAOA 2J6TA 1KBRA 2KFYA 4WZQA 2OH2A 1LKZA 3FRZA 2BOPA 1S6QA 3D28A 2XG8A 3UD5A 1NK6A 1BC6A 1YRTA 3BO3A 2LQJA 3A3OB 2BRKA 4ZVTB 3GQCA 3ZTSA 2G4BA 1DHMA 4R0EA 5K8NA 2LMIA 3D6TB 2ZHAA 1Y3JA 1HW9A 3NKYA 4CWBA 3SYZA 3OSNA 5E33A 2MQQA 1V5IB 3OD2A 3O3LA 1GXLA 4J91A 2CIMA 1FKPA 2QYGA 1N6QB 2IYGA 2O67A 3M8QA 2XMVA 4C8KA 2G2ZA 5HLFA 1OQ3A 2Y1IA 2VQFF 4UUWA 2YH1A 1S1TA 3VGVA 3AB2B 2KH9A 3ZFVA 2RDIA 5BXIA 3VAKA 1RT5A 5CXTA 4DV6F 4C3MA 1LWEA 2OI2A 4KRWA 3WX8A 2R7UA 3MEKA 1YSJA 3T1YF 3M32A 3M8SA 2GA7A 1IBMF 3LP0B 3UN2A 1SH0A 4LR8A 1WELA 3HKZD 4NCBA 4ECWA 2HLUA 4N8OA 1MU2A 1TKZA 1S76D 1WHVA 2E5GA 3KDNA 4NZ0A 2XLKA 4LF2A 1RADB 2XI2A 3BS9A 4DL6A 4HTIA 5KFVA 2MXYA 3PX0A 1YLXA 4YB6A 3HFKA 1YBUA 3PW0A 4LF9F 4HR2A 4WE1A 5LJ3Y 5D3GA 1FO1A 2FUG9 5CYQB 4K4TA 1X9MA 4CNZA 5CZVA 3U1MA 3GILA 5K8MA 3WC0A 3UW1A 3TA1A 3Q24A 2E5HA 2GW8A 3MM7A 4HDGA 2HGNA 2HFNA 4Y2AA 3LPYA 2XY6A 1FDBA 3GCXP 3LP2A 1N48A 3B78A 3EDQB 1JLFB 2IA6A 3EJMA 2I0XA 4QPXA 4MMOA 4Q2MA 5B08A 3MEEB 1UJ4A 3PTWA 2Z30B 2VQEF 1TFWA 4UOFA 3CD5A 2V8HA 4FVCA 3B54A 1S1XB 2XYHB 3UD4P 1FRIA 2BANB 3M2UB 5B0AA 1K9MT 1U6ZA 1UCNA 3DNCA 3OUYB 2H4YB 4DPXA 3CCSS 4EO8A 4N56A 4ANEA 3MR6A 4M8LA 4GVBA 2J8SA 1S12A 2HVDA 4MH8A 4IQXA 2C2KB 4YHHF 1BGXT 4OYWA 4AL6A 2RHSB 4MAKA 3R7SB 4LF1A 3VAHA 1VRUB 4CO0A 2F65A 3JTOA 2ZHOA 1F5AA 3Q8SB 1SH2A 5J2MB 3MM5B 3CJKA 1OY6A 5KFAA 2MZTA 3TUZC 4B3TF 4MT1A 3W9JA 3MEDA 3BQ0A 2AD9A 5C24A 1KVKA 4B3MJ 3QPIA 4ANDA 2KFZA 3HHLC 2R2RA 4OV6A 4JV2A 2H4WB 3RG6A 2A6OA 1YI2S 1E6VA 5E3PA 1RSCA 3PW5A 2HMIB 2MZSA 2W9CB 3OTCA 4YY3J 5DLGA 1X5OA 3RB4A 3T41A 3TO8A 2ZH8A 1S10A 4C98A 2NZCA 3DXBA 3DRXA 1TKTB 2GZOA 4TN2A 4EO6A 4ED1A 5KFIA 2XMJA 2BZ2A 4PUOA 1OSDA 3CDAA 2FDNA 2HK2A 3H5YA 4USKA 2R7OA 5J2PA 4D3HA 4I6WA 1R27B 1B70B 2YX7A 3NGTA 2MTLA 4BC7A 1NSAA 3G8QA 4Y65A 1DTQB 4QQBA 3GJTB 5E3QA 3TUPA 5KFPA 4PXEA 2F9JA 2M9KA 2UP1A 2HKEA 2W9BA 2CJYB 2CWKA 1U2CA 4AT1B 5KT6A 4DV4J 2BKNA 4USJC 3G87A 3T5KA 2CPYA 3PFOA 5IWAF 4I7FB 1NZAA 2HS0A 4FVMA 1HHTP 5EWFA 4DF4A 4PG8A 4NX9A 4E98A 4FDFA 3KG0A 2IVFB 3IRWP 1RWMB 1NAQA 3JB9k 2HVHA 3J7Z5 2CDQA 2N3OA 2DNHA 1JKHA 1APSA 1R8HA 2B4PA 3UO0A 3TJ8A 4C6AA 2HRYA 3C6TB 5A8WA 2OO4A 4IRKA 3M30B 2J7UA 2DVIA 3ITHA 3TZWA 2KVQE 1RT1A 4C11A 1RAJA 2NYIA 1SV5A 2V63A 4PG7A 5THWA 1RK8A 2YQ0A 1VRTB 3VAGA 3M9NB 4WFZA 1ZTWA 2GQ2A 4F50A 3Q8VA 4W92B 3OHBA 3QRQA 1HNVA 4DUZJ 4RR5A 3FVYA 1U1RA 2KT3A 1VQ4S 1VQ6S 3PRBA 1RTIB 3C14B 1U26A 2E5LF 7FDRA 1HA1A 2M3DA 2E9TA 3EXCX 1XR5A 3UVJA 1WKJA 4TU7A 3WX4A 1KSPA 2HVEA 1VLYA 5JMNA 5CQGA 3D6HB 3MMCB 1YJRA 5DG7A 3UDLA 5LJ5Y 3GJQB 1NZ8A 4FXVA 3MDFA 1Y0HA 4DSKA 2DNGA 1T9TA 2ZFHA 3VR1A 1UPMB 2FVCA 2X1BA 1REVB 1KLMA 2IM1A 2AJ0A 1U1PA 3BGLA 1S9EB 8AT1B 4QOTA 4FS2A 2EFGA 3KLFB 2CYYA 4KPYA 4X4SA 1RJJA 2YWGA 2AV5A 5CD4H 3RW6A 4DV1J 3BYPA 3RUBL 4ILRA 4DS4A 1FNOA 2VD3A 3HXMA 4KHRA 1RGVA 4ZLJA 1SVDA 2AYMA 3MHYA 1LW0B 1R7IA 2LXFA 1D9DA 4MTPA 2R7TA 4J7CA 4CTAB 3ICLA 4U8VA 5GADU 2UVWA 1JLQA 4TQRA 3D54A 1FWPA 5GVQA 5DDQC 5CH7B 1JLEA 5LSRA 1WC5A 5DJBA 2AJ1A 4DFPA 3QRPA 5CYMA 4IFYB 1WTBA 2AU0A 4DX6A 4Y3CA 1S9GB 3VALA 3Q22A 4JI3F 3NL0A 4KIAA 4YUDA 3TOQA 2GAGC 2GC8A 3P3DA 3I56S 4J9SA 5I42A 2HHTA 3C19A 4RBUA 3V6DB 5I3PA 1WDTA 2XSJB 4ATNA 4CLPA 3EMTA 2WBMA 5T41A 3R2CJ 4CLUA 4RNHA 1TKXB 3UD3P 1N52B 2VG7B 2BE9B 3BBCA 1DY3A 3DDNA 1JIHA 2KFNA 5HP1B 3U1LA 3QYYA 1U7LA 2R4FA 3W3SA 4RUAA 3FMWA 1FESA 2KXFA 2P2CB 2C1EB 1EKSA 1M1HA 1Q79A 1R8PA 1QUVA 3SSQA 2VBXA 4X65J 3IMQJ 4Z2XA 1RAGB 1VQ8S 3IC1A 5EN1A 4DV5J 2PI4A 4QCLA 1S57A 3HKWA 4I56A 3DM2A 1U24A 3IR7B 4LR7A 2MJUA 4LF7F 1OIAA 2BW2A 2DKOB 1Q5VA 2GQQA 4LSLB 1XMOF 4OZNA 2WB4A 3M6XA 5GAHI 3FQLA 3BJYA 3DLGA 2EI5A 3D7SB 2RQCA 1YZ6A 1OYDA 3TI0A 4TYBA 1UZDA 1HBMA 5IV3A 2F8EX 1X60A 2J9CA 3ISNC 1SL0A 2QT7A 3FBCA 4HTJA 5D0EA 2ZITA 2HS4A 4DX8H 1R0AB 5IQ6A 2CNNB 4JI4F 3HK2A 3RW7A 3HPOA 2VBYA 1YX2A 2CQHA 2HRUA 3BGRA 2U2FA 5D78A 4DDFA 5BR8J 2EFQA 5CHCB 3NGRA 1FRJA 2EVZA 1KONA 4AXIA 4IRDA 3RTVA 4X4RA 3E51A 1XNRJ 1AYEA 4EYHB 4CM2A 4OJHA 4NXMF 1IKYA 2CPEA 4TVAB 1I6JA 2RSQA 1SC1B 4F4YA 2Z2MA 4IOBA 1C0UB 1HMVB 2C3PA 2CZ9A 2IAJA 4F3MA 2HPUA 1PSDA 4MK8A 1UJ5A 1FRLA 2QL9B 2V2ZA 2GO9A 1T8EA 2VA2A 1VK3A 4OQJA 5L46A 1FWKA 8RUCA 2HURA 4QIWD 3R5JB 4K0KJ 2OPRB 4ES2A 2R9LA 1Q53A 1IBLJ 4ZJLA 4ID5B 2Z4PA 5IT9U 5BJRA 3K7RA 1S0VA 3MGJA 4EMDA 2NQPA 1N88A 1AUSL 4RZRA 1X4EA 2VF3A 2N7YA 1XR6A 2GVZA 2KVIA 1QDUB 1TL1A 4RNOA 5HROA 1HFEL 2DGTA 1HQUA 3GZ7A 3DHXA 1B0PA 2RVJA 3UQSA 3IG1A 3R8YA 1VQKS 4B9VA 1Y00A 2WVEA 4I64A 1UWBB 4LVNP 4LIRA 2AW0A 1WEXA 1DQ8A 1N32F 4C97A 2FLPA 2WOMA 1XQIA 4U7UD 3IGVA 2MKIA 5HANA 1UVJA 4OJGA 2V9KA 4KO0B 2XB2D 2UXCJ 2PMHA 1Q16B 3V5RA 4DR1J 3T9ZA 4LFAF 3KLHA 4GVLA 1CBKA 3EICA 5IT9Y 1D8YA 1UFWA 3QGIA 4WF9Q 2AGPA 1WD6A 1RT4B 2AJQA 1IKVB 3DOKA 2IRXA 4F3OA 4F26A 5F8LA 1VJQA 2HHWA 2WVCA 4NLQA 5KFBA 4RU2A 1VQMS 3ULHA 1G1XA 2E1RA 4DQIA 4ICLA 4LBIA 4M94A 2COLA 4X4PA 2B5JA 3BO4A 2MJNA 3V2UC 1NMEB 3L95X 1QY7A 4NI2B 1OWXA 5HL7Q 4RO0A 1TK0A 1TL3A 4B3OA 1VQSA 3FCHA 3SQGB 4UF4A 2WW8A 1TV6B 2K2PA 2RT3A 3KK1A 1KTQA 4U6PA 1YVFA 2DCUB 5KFQA 4G3IA 2BM0A 1XBWA 4B17A 1PYOB 2KDOA 2FYXA 5ETLA 4WP8A 1WSVA 3RBDA 2WVFA 3TQ1A 3ILIA 4A47A 3JQJA 3F73A 2DT9A 1MROB 4DG1B 3THVA 3MUTP 5EX0A 1N36J 2MLXA 4LF4F 3KJQB 4EBCA 2VQFJ 4LSNA 2IVMA 2C2NA 2DY1A 1ZA1B 3TX8A 4K59A 5C7PA 3OJSA 4MIBA 5GMEA 4DOZA 4DV6J 3CB4A 3BO2A 1EJ7L 2MKJA 4TU9A 5KG7A 3BREA 1NCLA 4ETZA 2BOAA 5E41A 2EBGA 4NCGB 1VJWA 1IBMJ 1IXKA 4ZPVR 4JI5F 1NKCA 1C1CA 3Q8RB 3K57A 2LA4A 3H2VE 4USIA 3NBPB 4DLGA 3LTOA 1N0VC 3IR5B 4OI3A 3MPDA 5C25B 4PEOA 1RWXB 1R8CA 1U6FA 4YEAA 3TX0A 3OL9A 3HHDA 3H4DA 2D3ZA 4OLPA 2MZQA 4OHWA 4LF9J 4X4OA 1S4FA 1PKUA 4CLYA 1T3NA 5KG3A 1Q5YA 2GIFA 5KFNA 2F63A 4DV7J 4N8NA 3EWGA 5ETVA 3CWJA 1S1UA 2VKZG 2L9NA 3MM9A 5JUMA 3PO5A 2D3UA 1CG2A 2ZH6A 2JLGA 2YKMA 1UPPA 3CXCR 5CCLA 4JI2J 2V9WA 4OZ5A 2FVRA 4DZ6A 2F3JA 1XMQF 1R3NA 2PDAA 3LWMA 4LFCF 3UDEA 1IKWB 3DYAA 2B9EA 2ZKTA 5KFFA 1RWPB 4I1TA 2VQEJ 2HLTA 3QGPA 3HVAA 1HPZB 3IP0A 5GAGI 1S1VA 4NRUA 4FYXB 3BSOA 3MPWA 5K14B 5FJ4A 4YR2A 3FUYA 3SDEA 1VR6A 1CQNA 4CCHA 2O01C 3FKBA 3GIJA 1EQ0A 4L6V3 4YFUA 2B4OA 4ZHRA 3AXKA 1PYTA 5DM6Q 2XMWA 4YHHJ 1S6QB 1OSCA 1NH8A 3I9V9 4H4KC 1WC0A 3DLEB 5KG4A 3EZUA 3FFIB 1FKOB 4PZVA 3OFGA 2IPOB 1BQMA 2B6AA 4B3TJ 3LW5C 1FHTA 3VVUA 5KFJA 1RE1B 1HI8A 1WKKA 2R2TA 1QLNA 1FKPB 4B9SA 3QLHB 1TKDA 5T7LB 3F44A 3OLBA 2JEGA 1P8GA 3ZO7A 1Y7PA 4OYMA 3VF0B 1KS2A 2DBBA 1S1TB 1R6YA 2G0JA 4Y2IA 3FBBA 3PR5B 2RD5C 4LSZB 1PO6A 2HBZB 5IV4A 3QSYB 2C3MA 3DGPB 3HP6A 2BR0A 1IR0A 4DU8A 2RJZA 4OI4A 1WI8A 3NRBA 3TR5A 3GFXA 5FLXU 4IOCQ 1SKSA 1NXIA 4F4WA 1XR7A 2GMHA 4ZLPA 4P7VA 1RWWB 3B4MA 4XPEA 2YKNA 4U9RA 3DLBA 5KFLA 3CCWA 5FD1A 3JSYA 5EDWA 2RIJA 4FPRA 3CMES 1MU2B 2XCPA 5K9FA 4ZVOB 2RQ4A 3CJ4A 1YJVA 2NUUG 5HMXA 2XYGB 3Q2TC 3HD1A 4HEA9 3PYGA 3CO9A 3MPYA 3M2VA 4CO2A 5IWAJ 4WE1B 3BZQA 4O3PA 1NK4A 5KG2A 2YKOA 3MMAA 2XM3A 2CUYA 2DPJA 3ZNUA 3KHRA 1S6OA 1WI6A 2I5JA 2B8QA 2XWYA 5FLXY 1YBAA 3N9UC 2QLFB 5DGAA 1H3DA 2DHSA 2YBVA 3T1HF 1P27B 5A8KA 2E7VA 2LECA 1Z4UA 2VG6A 2F4VJ 2BDPA 4USMA 5M2UA 3LP2B 3MR2A 3G6YA 2V34A 4USWA 1WG4A 2QA1A 5KFDA 3OVAA 1HD1A 2C22A 4EGLA 2MZ1A 2IHR1 4P10A 1FJGF 2EXUA 1RWOB 2JRSA 2AHOB 2LXUA 1D9AA 3ET6A 4RL1A 2JC0A 1IKXB 3PM9A 3EPIA 3VAIA 2ZH7A 2VFUA 2D9OA 4ZMMA 4CLLA 4UUXA 4DL5A 4ZLLA 4JB8B 3CJRA 1F3FA 3JQMA 3MUVP 1ITPA 2Z2LA 2A2DA 2FY1A 5KT7A 5DS7A 4DJBA 3IGNA 2IC3A 3K5PA 3JYTA 4CLZA 2AX1A 4CH1A 4CO3A 4ZKAA 1U1OA 1ZTTA 2O1PA 2IVYA 5KFZA 5H9EJ 5RUBA 2MY8A 5HAOA 1FERA 3WC2A 2KJVA 4K4YA 1AFJA 3NXZA 3OSPA 4RKUC 2ZHBA 3I5CA 1T9XA 3CJKB 1NJIT 1HNIA 3KJVA 2F4FA 2LQ8A 4Y34A 2FTRA 1TP7A 2XNRA 4PWDB 1WF2A 5C24B 3WHIA 1RHUB 3Q83A 1TUGB 2VPWB 5KT5A 5AXLA 4DQPA 1KTVA 4X4UA 4GKJJ 3RB0A 3JTPA 2XO7A 2P9CA 4WIIA 3SSRA 5GAEI 1FDNA 3CPWR 4AQYJ 1EP4A 3G8TA 1QE1B 3M1VA 2XMAA 1V3RA 2FC8A 1HNXF 3TVYA 2QA4G 4WXOA 3KLEA 1H7WA 2GIQA 4QZVB 1KD1T 3VVTA 4WFBQ 3LF0A 4PUOB 1H2TZ 1K47A 1RUSA 3UDVA 2G2YA 4DV3F 2PA3A 3MTJA 2O5DA 2HYIB 2G0CA 2HHQA 4X4TA 2HHVA 4RW4A 4LF8F 4ECVA 2C2RA 3JSMB 4DL0C 3P5TL 2ZOGA 2DHAA 3MCMA 2OAUA 1GQEA 3OXGA 1MWYA 3W5YA 4C8OA 4BLGA 2G13A 2UU9J 4WTOB 2OJ3A 2DHGA 4RWWA 3NLCA 2C2DA 1BE4A 2HQFA 2CJKA 3QT8A 3IRXA 1P6TA 2OHDA 2J5AA 2KN4A 5A0YB 2OPPB 4NLYA 5IFMA 4TLRA 3NAHA 1JNZB 1MG7A 3JSBA 2X1AA 1HQEB 2R7SA 2H9ZA 4B3SF 2YY3A 3RRHA 4NA3A 4PRFA 2UUAJ 4V1Ak 3J7YU 1JKHB 2V68A 2D41A 3V4IA 3LAMA 1CJTA 1T11A 3EGZA 3CCTA 2XZWA 3W64A 4KGMA 1X0FA 3GG1A 4K4WA 4F4ZA 3ITHB 3PNIA 3QATA 4DBQA 2F9DA 3G96A 3BBBA 5K20B 2RH3A 4XIUA 5A8RA 2HVZA 1C0TA 3KK3A 5B0DA 4USTA 1JK9B 2KG1A 1CC7A 4HI1A 1T7PA 2APOA 4GKKF 4NLSA 3M05A 3MI7X 2RKIA 4ZPTR 1QVFR 2R42A 1RAIB 4KJIA 2IJNA 4N5SA 1OY8A 4ILMA 1IM4A 2RMLA 2UVVA 1IJEB 2EK6A 1QVGR 2NREA 2BYCA 2DIUA 2OSRA 4LIWA 2L9DA 3UVJB 1Q78A 1D0EA 4LF7J 3DN9A 1FCAA 3SCJE 5HVGA 1GMWD 2VHGA 1EX8A 3K5OA 1XMOJ 4Q8FA 3QIPB 5KT3A 4B9MA 3MD3A 2YTCA 3FK4A 1ZZNA 2DGUA 1X4CA 1G6BA 3PKYA 4CLWA 2XS2A 1KLMB 2J7KA 3H25A 5H1SV 4ANCA 3HO1A 4ED0A 2HBYB 3EYZA 4NL5A 2VJUA 5HMWA 3QT5A 2V6AA 1YBTA 2KT2A 3NWGA 4PCQA 3AQOA 4JI4J 1GMWA 4WJBA 1K1SA 3MCOA 4DV0J 5IT4A 4MFBB 4QIGA 3OV7A 4RBTA 4H4MA 3V6HA 5KFHA 1KFDA 1GNKA 2VZ9A 5B09A 1NKBA 2B7BB 3TUIC 4AD6A 2PA8D 2K8GA 4UY8T 1JLEB 1X4HA 2RF2A 1H73A 2HNDA 2V2KA 3ENWA 3HHLB 4DSLA 2HWTA 1AT1B 5C42B 2UXBJ 5DM7Q 4Q5VA 4UQGA 4QR2A 2HQIA 2MKCA 1DAXA 2D7SA 1WORA 4OI6A 5D4OA 5I42B 1FFGB 2DGWA 3H7HB 1HWJA 4EUVA 2PI5A 4W4MA 5KFTA 4FBTA 2DR7A 4JUZA 3SMZA 1WSRA 3MEGB 2DY9A 1S1WA 3HULA 4ZCIA 4P6QA 4AXJA 3GP9A 4RW7A 2CPJA 2YKAA 1V3ZA 1L3SA 2AMCB 2CJBA 5J2NA 2Q6BA 3BGUA 1HIYA 4OX9F 2CQDA 2I8EA 2BRLA 1VHFA 5J1EA 2GHVC 1FRXA 5KFYA 1PIEA 4DQRA 4DUYJ 4FP9A 2YH0A 4YY3F 1T05A 3NAIA 3K5MA 3H98A 4CYUB 4LFAJ 2G1DA 3R7BB 4USUA 2PFFB 1LEOA 1KLNA 2IDEA 1UEVA 3BF4A 2CPHA 3ETOA 1XIQA 3DLGB 3CD6S 3D6FB 4NZ6A 2IBKA 1CULB 3TP2A 4IG3A 4EZ9A 1HBMB 2XWXA 4EBEA 3QJJA 3PHEA 3P49B 1RT2A 1HWLA 1F9EB 2UZAA 2E1PA 2QZ8A 2V4QA 4DV4F 4YOEA 1V6HA 2DEIA 3CEDA 4KYZA 3J81j 4M5DB 1KHVA 3PCOB 1HWIA 4LRDA 1Q8IA 1UA1A 4JV1A 2E66A 1NK5A 4N47A 2NSCA 3CCJS 1F1BB 3PW4A 4O44A 2R7VA 3KK2A 1WC4A 2DTJA 3BGRB 1IVZA 1OJ4A 4JI1J 4ALZA 1S6UA 4NPOA 4O3SA 5ITHA 5HN0A 4MK7A 1FDAA 1RYRA 1NRKA 3EVMA 2IM3A 5M2RA 4ED6A 2VKRA 2KG0A 1TQLA 5HO4A 1U1LA 2LLZA 1FXRA 5CCMA 1IKYB 5KFOA 5J1NA 5G0RB 2FHJD 2AYEA 4HI2A 2L08A 3C16B 1MWQA 3ZNJ1 1SJQA 4PPDA 1J2VA 3Q0AA 3QO9A 2R8JA 1RLCL 4X2BA 5I3QA 4IRCA 4OYBA 2Z0GA 3DKDA 1LK7A 4M95A 2DRAA 1DTTA 4FF3A 3B4DA 3R7NB 4O4GB 1X8DA 4KKOA 2BJ9A 3HSGA 4RW9B 3R1HA 1T95A 4DUZF 2VB6A 1T9YA 1R0BG 2DXDA 4M5IA 3GYXB 5D8HB 1BMQB 3QBCA 2BJ3A 2CRLA 1I3OB 3QZ7A 4OX7A 4F0KA 4F36A 4U96A 5LMNJ 4PAAA 2E1AA 2GIRA 2HHPA 3IG1B 1U2FA 2D3OR 3O2IA 4ZPWR 4USVA 1PC4A 4RX6A 3X1LB 3HHNB 4LFCJ 4R8UB 4Y6IA
chains in the Genus database with same CATH topology
3JYTB 1VRUA 1JLEA 5LSRA 4URGA 2AQ4A 4RNMA 1RT7A 4IR9A 4RBVA 3UR3C 3M8RA 1FKAF 5DJBA 2AJ1A 1DZ5A 4U7UK 1IUJA 3LO3A 1S97A 4NYOA 4DFPA 4B9NA 1Q8LA 3UI3A 1WF0A 4J9OA 1KOOA 2J9EA 1NK9A 4OI2A 4M1KA 5M2PA 2MGZA 1ZM4A 3SXLA 4G1PA 2W7OA 1FJCA 1FJEB 3MM8B 4NLXA 1VBZA 4JV0A 5CYMA 2XSFA 4IFYB 4OX8A 3KLHB 5EWGA 1WTBA 2AU0A 2P5VA 1ZBTA 4Y3CA 1KVJA 2MZRA 4DV1F 4YR0A 1S9GB 2C3UA 2W4CA 1TAQA 3VALA 4UW2A 1QUPA 3Q22A 1S49A 5LMNF 3KJVB 2M88A 4JI3F 5SUHA 1UETA 1X5SA 2W4PA 3NL0A 4KIAA 1QAXA 4YUDA 2BQUA 2EC0A 3R5CA 4ZVFA 2WSCC 3TOQA 2KM8C 3DRPA 2GC8A 3P3DA 3I56S 1H98A 1FRHA 1VK8A 4YR3A 4J9SA 2IRUA 5I42A 2HHTA 2FLNA 2EFOA 1T03A 3DCAA 2OPQB 4RBUA 3V6DB 2Y1RI 4EWTA 5I3PA 1HR0F 3CE8A 2XSJB 2DGSA 1DQ9A 2RB7A 2HMIA 4ATNA 3O5TB 2CPZA 1JLBB 2B9WA 2KI2A 2L48A 4HHJA 4TY8A 3CMAS 4DSEA 2WBMA 3CDUA 3HDSA 3PVXA 2M7SA 4B9TA 3MWBA 5T41A 4WK1A 4F3QA 4B3OB 1TKTA 1W2IA 2WK4A 3GR1A 2HWIA 3PEHA 2Y0SD 1EP4B 2JOQA 2M70A 1TKXB 2B4UA 3CCZA 4RNHA 2CFXA 3UD3P 2BQRA 3DI6B 1DRZA 2VPYB 1IQZA 4ZVHA 3ENQA 3M9MB 1GXUA 3M1VB 1N52B 3KK1B 2ROPA 2VG7B 2JZ5A 2J6UA 1FJ7A 2YNFB 3LWLA 1S0MA 2ZDOA 3KLGB 3DDNA 2L41A 2VPZB 1JIHA 4MIAA 3CC7S 1TVRB 4ES1A 2GHWA 2KFNA 4PQUA 5HP1B 4QIFA 3LALA 1XK8A 5KFRA 3U1LA 2KXHA 5F9LA 4LF5F 3QYYA 3BR9A 2HNYB 1Y5NB 2N7CA 1U7LA 2R4FA 5LSOA 1U1NA 4RUAA 3W3SA 1GTHA 1NH7A 2LDIA 1KN6A 1JLGB 1D8ZA 1FNXH 2J9DA 3FMWA 3CDWA 1HARA 2RRNA 1FESA 2KXFA 2V0NA 1SUQB 3OL7A 2A18A 4OLOA 2DNMA 1Q79A 3POTA 4WKRA 1R8PA 4I69A 1QUVA 3SSQA 4ZVEA 2ZDPA 2VBXA 1JJ2R 4LMZA 3OR2B 3TAPA 4RW4B 4Z2XA 2DNLA 4I2PA 1KQKA 4PXDA 2PT0A 3C8YA 3E01B 1RWUA 3GV8B 1VQ8S 1S79A 4DSJA 4LSNB 3QGHA 2BQ3A 3IC1A 1ELOA 5EN1A 3IS9A 2ASLA 2BBEA 4OX6A 2PI4A 4X4NA 4QCLA 3C6UA 1I94F 3VQSA 3ZZTA 4QWDA 2BJDA 4RLEA 4E0DA 3CSKA 1JJ4A 3HKWA 1JLAB 4I56A 3DM2A 1U24A 3IR7B 4QPTA 3CCMS 4I7FA 3CCLS 3IR6B 5C5JA 3I96A 3OFEA 5JXSA 1QSLA 1IKXA