3DRRB

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 106
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB04
3DOLB 4ZPBA 5KG3A 1VRUB 1IKVB 2WOMB 2IMWP 1IKYB 3I5CA 1S10A 4Y2CA 4EBEA 3MEGB 3MEDA 4RW8A 5KT3A 4YR0A 2C2EA 3JSMA 3BSNA 3TQ1A 5J2NB 3T5KA 1DTTA 4NYZA 2OPSB 3QZ7A 2DPJA 3DOLA 2FJWA 1TKTA 1S1VB 2AQ4A 4Y34A 4EO8A 3BREA 2B5JA 4EYHB 1T05A 1IKYA 5KFWA 1SV5B 1C2PA 2IM0A 1JXLA 3KK3B 2D3ZA 1K1QA 4TY9A 5KG4A 4I2QB 2GIRA 3KLVA 3QYYA 2FLPA 5KFXA 3LAKA 3BGRB 2R8HA 3DI6B 1S1VA 3GILA 4J9LA 5JXSA 3GYNA 2R8GA 4KO0A 1GX5A 2V4RA 4RNFA 1RYRA 3DYAB 4TLRA 2IM1A 5I3UA 5KG7A 4IOBA 4U6PA 2OPPB 3V6DB 3H98A 5KFRA 3HVTB 5CYQB 2E9ZA 5KFQA 3PJWA 2IM2A 2YNHB 4IH7A 3Q8PB 4O44A 3M9MB 3KLGA 3KK2B 4ECWA 3FFIB 3H5UA 3KMSA 4K4XA 1T03B 4IDKA 4Q0BA 3I0SB 4LQ9A 2IAJB 4DL3A 2FVCA 2VG5B 4MIAA 2EC0A 5F8NA 3RB0A 4NLTA 4IG0B 3IRXB 1GX6A 3KNAA 4WZMA 4TY8A 1HYSA 1MU2B 5J1EB 5J2NA 3C6TB 1RT1A 2RF2A 1WNEA 3G6YA 2ZE2A 3M8QB 2FVRA 3GIMA 4XPCA 4Q44A 1S6PB 4WFXA 1HPZA 3DRSA 3KLFA 3IRXA 2JEFA 3MR3A 1RT6A 1KLMB 1RT5A 3V4IA 1EETB 5HLFA 3CJ2A 3RBDA 3RB3A 1J5OB 3E01A 1QAJA 3SFGA 2HMIB 3HVAA 1S1WB 1RTDA 5HROB 3UQSA 4ED0A 4I7FA 1S1UA 2BQRA 1IKXA 1JLGB 1NNDA 4ECTA 1T05B 3PW5A 1S6PA 4O4GB 5KFPA 3JYTB 3I0RA 2HAIA 2WK4A 5KFIA 4QPXA 5EUHA 4TXSA 3OHBA 4J9QA 4MFBA 1N5YB 1J5OA 3CDEA 4FS1A 1EETA 1D0EA 2V9WA 4DL4A 3CWJA 4JV1A 2ASJA 2BE2A 1C1BA 1IKWA 5HROA 5L1IA 1I6JA 4ED3A 1ZETA 1EP4A 3CIZA 1TKXA 4DL7A 1TL1A 4XPEA 4URGA 4LSLA 4ECSA 4R5PA 1C1CB 3I0RB 4M95A 2AWZA 4NZ0A 4J9NA 1C0TB 2JLEA 2FJXA 1SUQA 4MK9A 2C28A 3N6NA 2BE2B 5CYQA 2D3UA 2JEIA 4TQSA 2JC0A 3MECA 5FDLB 5I42A 4JV2A 3MEEA 2AX0A 3IS9B 3FDSA 3DDKA 1HMVB 1TL1B 3QIDA 4NLSA 1KHVA 5KFDA 1EP4B 3KLGB 3QGHA 3QIPB 5KFBA 2OH2A 1C0UB 5DG8A 2VA2A 4ECYA 3E51A 1NHUA 2O5DA 4HKQA 3PW7A 4ZHRB 3T1AA 1JLCB 3KLIB 3MECB 2HNZA 3DLGB 5FDLA 1RAJA 1S97A 1S0MA 5EWGA 1LW0B 4IFVA 2BRKA 1BQNA 3NMAA 1S1WA 1RTDB 4ED2A 3BGRA 4DL2A 4ZVEA 2FJVA 5KFSA 2OPPA 3V6DA 2CJQA 5J2MA 3H5YA 3MR2A 1KLMA 1RT5B 3MEEB 1TV6A 2HNYB 3KLHA 4QWEA 4RNMA 5C25A 4LQ3A 2JEGA 3ITHA 2AX1A 5DG9A 5DLGA 2W7PA 5KT7A 4YMEA 2IC3B 3NAHA 2W8KA 5EWEA 1W25A 3MFHA 1SH0A 4RW7B 4ID5B 4QWBA 1FK9B 2IBKA 4KV8A 4RW9A 1JLFA 5J2PB 2HWHA 3OL7A 5DQGA 4Y3CA 2AGOA 4IR1A 4Y2AA 3GV8B 1S6QA 2C22A 3GIKA 1DLOB 3HKWA 4K4YA 4ED6A 1TL3A 2IJNA 2ZE2B 3M8QA 3PJXA 4ZP9A 5F9LA 1N48A 1TKXB 3IS9A 4KSEB 2B6AB 4X2BA 3MR6A 4O3PA 1LW2A 2YKNA 2ALZA 2HWIA 4RNHA 2UVWA 2V4QA 3KOAA 2ZD1A 4J9KA 3MTKA 4O3OA 3VQSA 4I2QA 5I42B 1S1TA 1LWFB 2RKIB 2BANB 3OSNA 4RNNA 3OSPA 3KJVB 3I5AA 3LP2A 1RT2B 4XO0A 4QWCA 1S48A 3BJYA 2HMIA 4GC6A 4B3OB 2WONA 3CJ3A 4ECVA 4IDKB 4Q0BB 1IKVA 4NLPA 2W9CB 4DEZA 1XR5A 2XI3A 1U09A 5KFFA 4TY8B 2J6SA 4F4WA 5C24A 3KLHB 2C2DA 1TKTB 1R0AB 3BSCA 1N6QA 1REVB 4IRCA 4DL6A 4K4SA 1VRTB 3KLEA 3UPFA 2D7SA 3KK3A 2ATLA 1TKZA 2FVSA 2ZKUA 3DLEB 1HQEB 1T94A 4ZP8A 4R8UB 1S6QB 2XI2A 3KHGA 2XC9A 4TN2A 5F8GA 3ICLA 3G86A 5DGAA 2WB4A 3NL0A 1XR7A 2I5JA 3G6XA 5KT5A 3KLFB 1REVA 4KO0B 4WXWA 3LANA 4ID5A 5KT2A 3Q8SB 2OPRA 3HVWA 1HQUB 1TKZB 3MEDB 3UDLA 5KG0A 2QE5A 3T5JA 2R8IA 5C24B 3EZUA 1RTHA 1S9GB 5J2QB 2CKWA 3V81B 4KFBB 4PWDB 2OPSA 3QO9A 5CYMA 3GV7B 1N6QB 3NGDA 4O44B 4NCGA 1S1UB 5KT6A 2YNHA 5T14A 4LSNA 1HQUA 2B5JB 1SH3A 2R8KA 4R5PB 2VA3A 3FSIA 4MIBA 2BQ3A 2VG7A 2RDIA 3BR9A 1QE1B 1HNIB 2R2UA 4KHRA 4URQU 4EBCA 3QO9B 4NLRA 4J9SA 1IKWB 4KFBA 1RT4A 1S4FA 4IH6A 5F9NA 3QZ8A 4PQUA 3LP2B 4O3SA 4MK7A 4TQRA 1XR6A 4NLYA 1C0UA 5KG2A 4K4VA 1HNIA 2R2SA 4RUCA 2W9CA 3PW0A 4MKBA 3N6LA 2IM3A 3M8PB 1D1UA 5KFLA 3HHKA 3BQ1A 4YP3A 5F8HA 1LW0A 3FFIA 3N6MA 1N56A 3OLBA 1OS5A 2VG7B 4ZP7A 3DOKA 3LP1B 4NLDA 2R8JA 3PHEA 3C6UA 4EEYA 1IM4A 1N4LA 3D28A 5KFCA 1ZTWA 2BANA 4R0EA 2HNYA 1UWBA 3H5XA 1DTTB 2BQUA 3V81A 3SFUA 3GQCA 4NRTA 5K14B 4ZVHA 1BQMB 3RAQA 1RT7A 4F4YA 1S1XA 2VG5A 4IFYA 4YQWA 2OPRB 2WHOA 5EDWA 4WFYA 1RT2A 3QGIA 5KFJA 3KHLA 1TV6B 1SUQB 4KV8B 4RW9B 5J2PA 2FVPA 4M94A 5F8LA 3QLHA 3ISND 3UR0A 5KFEA 2IA6A 4PWDA 3CDUA 1S0NA 4IRDA 4QWAA 1DLOA 1R0AA 5KFMA 4F4XA 2IC3A 3DMJB 4F4ZA 4NCGB 1VRTA 3KLEB 1JLAA 2E9RX 3H40A 3DYAA 4ZVGA 4ECQA 3PW2A 3CJ0A 3NBPB 4JUZA 4DG1A 4TYAA 4KB7A 4JV0A 3DM2B 2V0NA 2FLLA 2IJFA 2AU0A 2YNIB 1FKOB 1TL3B 4J9PA 1FKPA 4ZMMA 3KK1A 4KKOB 5KFAA 4WXOA 1JLGA 4QW9A 4EBDA 2YNFB 3GIJA 1JLEA 1DTQB 3IG1A 3V6KA 2R2TA 4O3QA 4NLXA 2ZD1B 5HBMA 4WYLA 5KT4A 4H54A 4WZQA 4YR3A 1C1BB 2J6TA 4FBUA 1S1TB 1FKPB 4NLQA 1Z4UA 3PW4A 5J2QA 2RF2B 5KFYA 1RT1B 3MFIA 4O3RA 4Q43A 3PVXA 3BSAA 2W9BB 2WONB 1LWEA 4RUAA 2YKMB 4QW8A 5HP1B 3GIIA 1JLFB 2XGPA 2FVQA 3DRPA 1JLCA 3KLIA 2WTFA 3PR5B 1RYSA 3QGGA 4KBIA 5DQHA 4OL8A 2OPQA 1BQNB 1RA7A 3CO9A 3SI8A 2VG6B 2JC1A 2D41A 4WYWA 2BRLA 3I5BA 4H4MB 4ZPDA 2ILYA 3MR5A 5I3UB 1JLQA 3DLKA 4MFBB 1N5YA 4DG1B 2QV6A 1JX4A 2RDJA 4F50A 2ASDA 4MK8A 2FLNA 1HARA 2GC8A 4ED7A 5EWFA 1CSJA 2I5JB 1LWFA 2RKIA 3V6HA 4GC7A 1RTIA 1C1CA 1FK9A 1T03A 3M9OB 4FBTA 1DTQA 3IG1B 4ZPCA 1LWCB 3DRRA 4IKAA 4IG0A 3PR4A 4ED8A 3ISNC 1HPZB 3DRSB 1TP7A 3KK1B 1JKHA 5C42B 3EPIA 3CJ4A 1S1XB 4G1QA 4RW7A 1JLEB 1HMVA 3H4DA 4RW4A 3CJ5A 5C5JA 1IKXB 2AGQA 5DG7A 1YVFA 1RT4B 1QAIA 4WE1A 5L1LA 4K4ZA 3NAIA 3KJVA 4I7FB 4RW6A 1K1SA 1JLBA 2UUTA 2OPQB 1JIHA 5KFZA 1LWEB 2IAJA 2YNGB 1FKOA 2F8EX 3OLAA 3H2LA 3RB4A 5KG1A 2AGPA 3NBPA 5J1EA 3FRZA 2XCAA 5L1KA 3GV5B 3ITHB 3T5HA 4IRKA 4ECZA 1RTHB 1S9GA 2B43A 4RW6B 2UVVA 4IR9A 3DI6A 2UVRA 4NRUA 3LP0B 2XCPA 3PZPA 5L9XA 1S0OA 4LSLB 4H4MA 2YNGA 1RTIB 4KHMA 3BQ2A 1RT6B 1QE1A 3V4IB 3H4BA 4ZPAA 4ED1A 5DLFA 4H4OA 1LWCA 3DRRB 4WE1B 5HBMB 1TQLA 3IGNA 1HQEA 1SH2A 3IGVA 4MKAA 4TYBA 4EO6A 3OL8A 1TVRB 5KFKA 1RT7B 5DQIA 3LP0A 5K14A 3TVKA 2HNDA 1MMLA 4G1QB 5HP1A 4O4RA 3OL9A 4O4GA 5L1JA 2YKNB 1JLAB 4O3NA 2E9TA 3JSMB 2XWYA 4ZP6A 2W9BA 2XGQA 3G6VA 3KHHA 3TAMB 1HNVA 4PUOA 5C42A 1KHWA 4NLVA 1HYSB 5KFHA 2VG6A 4EYIB 3KK2A 4FS2A 5KG6A 4KE5A 1RTJB 1RDRA 3BSOA 3V6JA 3LAMA 5F8JA 1C0TA 3I0SA 3OL6A 3DOKB 2YNIA 3LP1A 1S9FA 3KMQA 4ECXA 1ZTTA 5HLFB 4ICLA 4ECRA 4YR2A 4PUOB 4IQXA 1MU2A 4Q8EA 1HNVB 3D5MA 4KKOA 5C25B 2GIQA 2WCXA 2C2RA 4J9OA 2J6UA 3QIPA 3T19A 5KFGA 1BQMA 5KFOA 2WRMA 3H59A 3LALA 3KHRA 1VRUA 4NLOA 3JYTA 4K4TA 2B6AA 4RZRA 4ICLB 3Q8QB 4ECUA 3T5LA 4RW8B 2ILZA 4KAIA 4R8UA 3MF5A 4G3IA 1QUVA 2HNZB 3DLGA 1T3NA 2W8LA 4Q45A 5KFVA 3NKYA 4NLUA 1NHVA 4Q8FA 3CVKA 4RU9A 2YKMA 4RW4B 3FQLA 3C6UB 4K50A 3CDWA 4URSA 3BQ0A 1JLQB 3DLKB 3DM2A 3C6TA 5KG5A 5CYMB 1UWBB 4RNOA 4IG3B 2JEJA 2R2RA 2HNDB 4J9RA 5JUMA 2YNFA 4I2PA 5D3GA 1SV5A 5F8MA 5DGBA 4ZVFA 4B3OA 4QWDA 4LSNB 3EPGA 1JLBB 4MH8A 3RBEA 3E01B 3Q8RB 1RT3B 3H5SA 2ASLA 5KFTA 4IG3A 3RAXA 4K4WA 3TAMA 2UUWA 1S9EB 4ZHRA 3HVTA 4IH5A 4NLGA 1S49A 4IFYB 4J9MA 1RA6A 3DMJA 4PQUB 2UVUA 1RTJA 2W7OA 4HYKA 1LW2B 2WOMA 3FQKA 4DL5A 5KFUA 3OHAA 2DPIA 3QLHB 3RB6A 1RT3A 2W9AA 4K4UA 2BR0A 5J2MB 1TVRA 3MEGA 5KFNA 1JKHB 3DLEA 4WFZA 3M8PA 1S9EA 4I2PB 4H4OB 3DRPB 5D3GB 2I1RA 4NLWA 4IFVB 5F8IA 4U7CA 3M9NB 3IN5A
chains in the Genus database with same CATH superfamily
2UUAF 2GO9A 1IKVB 2QC3A 2BEFA 2K7JA 1IKYB 5GADI 3I5CA 3CB4A 2V34A 1F9EB 3D66A 4Y2CA 4UY8T 3VZIA 4C9DA 2GVDA 1UA1A 3JQJA 2OUGA 2AYEA 3JSMA 3PO5A 2Y1RI 2VODA 1UCNA 3EGZA 3T5KA 3HJFA 1DTTA 1LEOA 2OPSB 3SSRA 2QSWA 1VHFA 3HHDA 1WOOA 3PO4A 4DPXA 1S1VB 2HEKA 2FGOA 2LP4A 2VBYA 3G82A 3L7OA 3M2VB 4P10A 4P2FA 4QOTA 2LXUA 4F26A 3AOBA 4AFFA 1IKYA 1ZZNA 2W2QP 2HVZA 3GJQB 3RBXA 2D3ZA 3PFOA 2DGUA 3BS9A 1KC8T 3A8EA 4TY9A 1WC0A 5HMWA 4X64F 4B3MJ 4DUTA 1FRHA 4DPTA 4ILLA 4I2QB 3KLVA 3BEGB 1F1BB 2EI5A 4G1IA 4HHJA 4USJC 5K5MA 5KFXA 3WIVA 1D9DA 3QBCA 2DISA 1S1VA 2VC1A 3M2VA 4L74A 5G4DA 4PXBA 2R8GA 4RNFA 3DYAB 1HR0F 1M5OC 4LF6J 3HO1A 3KFWX 2FIUA 4IOBA 4L75A 4U6PA 3PYEA 2OPPB 2IIHA 2K2PA 1WD6A 1TUWA 4P75A 1N36J 2E9ZA 3IWLA 2VBWA 2DNMA 2IM2A 4PCQA 2HRUA 1REGX 1OIAA 3Q8PB 3M9MB 1XMBA 2J8AA 3FFIB 3TZXA 4JI7J 4ZIWA 3H5UA 3HFKA 1T03B 4IDKA 2G0JA 1D8ZA 5E2QA 4ZPWR 1Y5IB 2FVCA 2W7AA 2HIQA 3PRVA 4MIAA 4DR2F 2QA4G 2EBEA 1BWEA 3IRXB 1GX6A 4N5SA 1BD6A 1VQ7S 1K0TA 3O6QA 1RHKB 3ZZZA 3W5ZA 1VLYA 5LXYA 2V5HG 4OHZA 2GJIA 3VGSA 5J2NA 4RJVA 2BKOA 1RT1A 3A13A 8AT1B 2DNZA 5F3ZA 3M2RA 1AUDA 3SBMA 2EFQA 2ZE2A 2HBYB 3TZWA 2LCWA 3V4MA 4Q44A 3D1OA 3MCSA 4WFXA 3DRSA 1SJ4P 4G1PA 3CJ2A 2CQPA 3LTOA 1EETB 2BKNA 4GMKA 4ANCA 1J5OB 2HSEB 3HPOA 3E01A 4DSEA 2CJXB 3ILLA 3SFGA 2X1FA 4A47A 2LYVA 3SEOA 1S1WB 2JOQA 3UQSA 5IC4B 2ZZMA 4K2JA 4QBUA 2KZMA 4FF3A 1VQPS 1S6PA 1SKRA 5KFIA 2WK4A 3O5TB 4QPXA 3KDNA 1N5YB 1J5OA 5BYRA 1IXKA 3FZ2A 1EETA 2IVYA 4P6QA 3OJSA 1C4AA 2A1BA 2FDNA 4P73A 4DL4A 2XYPB 3EYZA 3BB5A 2BE9B 3M8ZA 1C1BA 3Q2SC 3FGVA 2HGMA 1ZETA 2E44A 1EP4A 2IBOA 5HQLA 1X0FA 4FKYA 2IMOA 2V63A 4URGA 3A4TA 3HP6A 4R5PA 1HHSA 2K3KA 4M95A 2NPIA 1MMNA 2QMXA 1UW4A 1C0TB 2XMJA 4J9NA 1NK9A 4V19J 1WC1A 3GG1A 4MK9A 2DY9A 1SIZA 3R1HA 5CYQA 2LECA 3T1HF 4TQSA 2JEIA 1IBMJ 2V2VA 3MECA 4JV2A 3MEEA 4NLSA 3GE9A 5KFDA 3UCUP 1HMVB 1KHVA 1HWIA 2YPZA 2OH2A 2V67A 1C0UB 1IJFB 3M32A 3MMBA 4QIWD 5D4PA 3U7JA 3QSYB 2VA2A 4ECYA 4ZVQB 2NPFA 2JHEA 1DJ0A 2D9OA 1SL1A 1L3KA 1T7PA 3CJSA 3IO1A 1KQFB 3RBZA 2OFGX 1ZOTA 3MD3A 3W1YC 2HBQB 3FMBA 1RAJA 4FXVA 1GMUA 2Z2YB 1EKRA 3EDRB 1YK9A 2I2YA 3NMAA 2BRKA 1BQNA 4I6YA 4OI4A 4FPRA 4A48A 1RTDB 4PXEA 4EWTA 2RD5C 1KFSA 1B0PA 2B4PA 2FJVA 2J7KA 2NZCA 5AJ3J 2OPPA 2Q6BA 2Y0SD 3RU0A 1NJIT 4ZVSB 5DZ7A 2IRUA 5IWAF 4MAKA 1N33F 2W4PA 1YX2A 3QGPA 1RUSA 3RG6A 4LQ3A 1FDDA 4XDCA 2W7PA 2W8KA 5EWEA 3MFHA 5CQGA 4ID5B 4QWBA 1FK9B 2PC6A 5D78A 2BW7A 1NCLA 4UUXA 1T8EA 1VQLS 5ADZA 1R0BG 2UUCJ 3H42A 1FX4A 4Y2AA 3GLJA 3NXZA 4DPOA 2C22A 2PI5A 4OFZA 2EVZA 2HFUA 4X65F 1TL3A 3G82B 4WJBA 2AJ2A 2RNEA 2RRNA 4YB5A 4X2BA 1N54B 5AXKA 3W9IA 1LW2A 3SSSA 2HWIA 3WC2A 4OZLA 2UVWA 4DR1J 1N5VA 2NXEA 2RQ4A 3VCDA 3B4DA 4RU2A 4O3OA 3VQSA 4I2QA 2DNLA 5I42B 1AB8A 3GG0A 4DXLA 3LPYA 2ZH7A 1XNRF 3NOGA 3GMGA 1LWFB 2RKIB 4ES3A 3OSNA 1B4SA 3OSPA 1OYEA 3LP2A 4XO0A 3I5AA 1ZYQA 3EXCX 4CT8A 1Q79A 2L9DA 3OD2A 4CWBA 2AJQA 1IKVA 1RZMA 2AJ0A 3JTNA 4JBCA 2W9CB 2RRAA 4JI0F 1ACMB 2RIJA 2XI3A 3AQOA 3PACA 5T41A 1K8AT 1RTZA 2N7CA 4CH1A 1AA1B 3M30A 4TY8B 2HRTA 3BF4A 1FDAA 3KLHB 5DDPC 3MM8B 2C2DA 1HD1A 4NL5A 2ZZTA 5CABA 1FE4A 1UFLA 3BSCA 2XZTB 2DHGA 2ZH6A 2PGCA 4KQZA 1VRTB 1WEZA 4HACA 1NKEA 2NXUA 2X1AA 1TKZA 2Z30B 3HMJG 2NSCA 2ADCA 1UMJA 3VGUA 1X4HA 2M88A 4CH0S 1S6QB 2NYHA 3N01A 4LR7A 5FLXY 4F4AA 5F41A 1NKCA 3G6XA 5KT5A 3KLFB 3LANA 1HQUB 4FF1A 3MEDB 1WC4A 2QE5A 1UL3A 2H4WB 3KWMA 3T5JA 5C24B 2ROPA 3AT1B 5J2QB 4X4NA 4DUYF 5EN1A 4PWDB 3D1HA 1DAXA 1N6QB 3DN9A 5T7LB 4O0IA 1W2BR 4O44B 4J90A 4R25A 3KUHA 3IM8A 4AL7A 1ZM4A 2MQPA 4C8NA 2ZH3A 2R4FA 1SH3A 2XHCA 2W25A 1UZDA 3MM7B 4A4JA 3MAQA 1UPMB 2UXDF 4EBCA 3QT8A 2IRYA 4DCJB 4GKKF 3QO9B 4OZ1A 3R7NB 1T3OA 4OX6A 3FC9A 3TVYA 2XO7A 4B17A 5F9NA 2R42A 1Q8IA 2DGWA 2XZDB 1U2RA 1FESA 3CCUS 4LF8F 2YQ1A 2CPIA 1U1RA 3DKDA 1GMWA 4CO3A 1CS4A 3KKFA 3Q86A 1FO1A 3HD2A 1YBTA 3MM5A 2OFHX 4L72B 1P9QC 3HCXA 1HW9A 2IM3A 4M63A 4P7VA 3B54A 1D1UA 4Z37A 5KFLA 1D09B 4DV1J 1XNQJ 4KGKA 3SSQA 2D9PA 1X4CA 2BM0A 1YBAA 1S79A 2ACYA 1PAUB 1Z2LA 3KJFB 5F3TA 3TX8A 3OLBA 3Q8VA 1ZPVA 3MURP 1RABB 2HS3A 1YRXA 4UQTA 4DV0F 3L3CA 2R8JA 4WFAQ 1JJ4A 3C6UA 4OJ1A 4EEYA 3D28A 5KFCA 2UU9J 2ZUAA 3HD1A 3CMES 4PAAA 2PIIA 3KUEA 1HBOB 1QM9A 3AD7C 1G4CA 4DLGA 7FDRA 1PC5A 1X5SA 2RHSB 1BQMB 1VI7A 1RT7A 1EJ7L 1KWMA 2CPEA 1WSRA 3BBFA 2PSZA 3OTBA 2BM1A 3ETMA 4MKVA 1WF0A 2QX0A 4UTGA 3MM9B 3R8YA 4W92B 5EDWA 1EB0A 4WFYA 3QGIA 2QLFB 4WP3A 5KFJA 2LA6A 1TV6B 1JMTA 4NEZA 4OQJA 5J2PA 1Q8LA 3KG4A 2FVPA 3U1MA 3CCSS 3QLHA 1QD1A 3D1QA 3LOUA 3N5FA 4PWDA 4I64A 1LFPA 5HAOA 2IA6A 3OFHA 1HBUB 1OY6A 1S7HA 2NUHA 4FZVA 2IC3A 2IVFB 3OUYA 4F4XA 4F4ZA 1OJ4A 5HI7A 1RKJA 1VRTA 4PYDA 4NMLA 4ECQA 2QMWA 4ZVGA 4OI0A 3NBPB 4JUZA 1GXUA 4TYAA 4JV0A 1LOUA 2V0NA 3JXOA 2PMZD 2FLLA 2YNIB 3HZEA 3LQVA 4Z2XA 3BO4A 1T9TA 4ZMMA 2EW9A 3OTOJ 2LXIA 2FJDB 3I9V9 2Q1LA 9ATCB 4DFKA 2ZC4A 4FYWB 2U2FA 5DZ6A 3T1YF 3RR8A 3R9LA 5AE1A 2R2TA 2PO4A 4C11B 5JVHQ 4CCHA 4R0JA 4WK3A 1Y3JA 4LVNP 4DR6F 5KT4A 4H54A 2GO8A 4RUBA 4WZQA 5C2CA 2LDIA 5LT5A 4B9VA 2HHVA 1TK0A 2GAHC 2RDDA 2LQ8A 4PWWA 3SDEA 4LF9F 1SC1B 2OTLS 1YJ9S 3TJAA 1JK9B 4DSLA 1BUXA 2A3JA 1RU2A 1TUGB 3AY0A 4YDXA 3PRBA 4HACB 3U1NA 4I67A 3TJ8A 3C8YA 3DRPA 3KLIA 2HLTA 2CQ0A 3NS7B 3VAMA 4KBIA 2X1BA 3OR1A 3CD5A 4ID8A 3J7ZT 1Q16B 1CJUA 3AFGA 2JC1A 1WHWA 2BRLA 3I5BA 1X9SA 2NQPA 1UW9A 1U26A 3KXDA 1LNQA 1P9YA 3DLKA 7AT1B 1FF2A 1NSPA 4RL1A 2RDJA 2BVZA 4RBTA 2P9GA 1HARA 2HS0A 2KFZA 5D0RA 2XMAA 4CYUA 2WSEC 2ZVIA 4DPWA 1LWFA 2RKIA 2IVMA 3POTB 4LR9A 3V6HA 4BDPA 2Q66A 1C1CA 3GJTB 1FK9A 4P7TA 4FBTA 2MTLA 1R31A 3IR5B 1V5VA 3K89A 4PXCA 2XEXA 1CJTA 1WHYA 1X0PA 2CIMA 3AD9C 3L09A 4Y2IA 4IG0A 1YLXA 2MGZA 3PR4A 1HPZB 1MWYA 2K1RA 4ED8A 2DNRA 2R7OA 1JKHA 4Q2LA 1HQ2A 4UT4A 3A1YG 4OYZA 4YY3J 2MKHA 1TUVA 3M4XA 2BA9A 3Q2TC 1VLOA 2LA4A 1VQ9S 1SQEA 1N5TA 2WAQD 5C7PA 2DY1A 5IQ6A 4NASA 4JV5F 3I87A 3TUJC 1CJVB 3GCXP 5JJBA 1RWWB 2CNLB 1QLNA 4FXWA 3J7YI 1WDDA 2V9KA 3EUNA 3SV4A 1YVFA 5EHHA 1KQSR 4F25A 1QAIA 4DV4J 4BLGA 4CO4A 4WE1A 5RUBA 3C14A 3TW0A 2VDHA 4NCAA 2L08A 1JLBA 4ZPTR 2OPQB 1JIHA 3DRXA 4OHWA 4CLSA 1VBKA 3I9ZA 4E98A 2H5IB 5LMNF 2V4JA 1FKOA 1PILA 2RHQB 1HNXF 4KR0B 1FDNA 1FCAA 2MLZA 1M90T 5J1EA 3FRZA 4NEYA 3GV5B 4ECZA 1RTHB 5ETTA 1RSCA 2HZAA 2MY8A 4RW6B 3RZAA 4IR9A 4ZJLA 3DXBA 4M5DB 1B0TA 2ZBCA 5DM7Q 4FF2A 1LK5A 1V3ZA 2DNQA 1B7FA 3G8SA 2B7BB 1FDBA 1RHUB 1YJWS 3BQ2A 4ED1A 2IDEA 5DLFA 3EE3A 2EKNA 4H4OA 2CDQA 1I51B 3PDNA 1SH2A 1GXLA 3IGVA 2BJ1A 3K7RA 4UOHA 4LF5F 1TVRB 1NH7A 1HWUA 3AA9A 1GQEA 5MAOA 5DQIA 2FHKA 4FDFA 3MUTP 4G1QB 2P8IA 3P5BP 3SCKE 3VAJA 2QG9B 2YKNB 2CFXA 2DIVA 1UWAA 5A8WA 2XGQA 2QEXS 1UJ5A 3LGNA 3RAMA 3HT3A 2FC9A 5KAKA 1HNVA 2VU5A 3OTDA 4HT7A 1KHWA 4NLVA 1XMOF 2G13A 2FJBB 3J7AN 1U02A 3H20A 1WHXA 2KXHA 3PJ9A 5KG6A 1VISA 2MQOA 1VRQC 1FE0A 1E6YA 1R6YA 1U0HB 2Y8YA 1Q5YA 2DNOA 4DCPB 2XM3A 4Q5VA 3LP1A 4YFUA 3KMQA 3FCWA 4ECXA 3NMRA 3EGWB 4PQAA 1TKDA 4IQXA 2ZH4A 4C4WA 2MZTA 3HF5A 1NH8A 2H51B 3MZIA 3FZBA 3UNGC 2WCXA 5KOXA 5H9FJ 3K8WA 1K73T 1FX2A 4P2MA 3T19A 4LRFA 1QSLA 2DRDA 3IXQA 3O3LA 4KPCA 2E1PA 3TANA 1PCAA 3KHRA 5LMUF 4Y2KA 3JYTA 1H2VZ 2X3GA 4DR4F 1NMEB 2OGUA 2ZDOA 4L3NA 3D6TB 1RHRB 3Q8YA 3ZC4A 3T5LA 4CP5A 3ZXWA 5B0BA 4DF8A 4U95A 3MF5A 4DFMA 2YVSA 2HNZB 2W01A 4C48A 2FHOB 2W8LA 1MWQA 2W1BA 4Y65A 4CQ1A 1FNXH 3NKYA 4NLUA 3R5DA 2P9EA 2K7KA 3CPWR 3O8WA 3OR2A 1GXTA 1ROFA 2UXBF 3HHLC 5SZTA 2AD9A 2CPXA 1M5VC 2DHSA 1QAYA 4U9RA 4PG7A 4K50A 1YJ7A 2G0IA 3DLKB 3D6MB 1P1LA 3C6TA 2CPFA 5KG5A 2HHWA 3MM6B 2JEJA 2MMYA 1J2VA 2EBGA 4F3QA 2HNDB 1CJUB 3MAHA 4M5IA 4J9RA 3K0JA 3Q8UA 4KY3A 2YNFA 3DLHA 3GSIA 5F8MA 1RXOB 2KT2A 3M8RA 1WEXA 4ZVFA 5H9FK 4LSNB 3EJMA 2M0GB 2B3TB 2M2BA 1SKWA 2BJ8A 2GMHA 3SXLA 1MROA 2ASLA 5HQMA 2GS8A 2Z4PA 1GH8A 3MM6A 4K4WA 3TAMA 3LW5C 4ZHRA 3HVTA 4DV4F 2ABYA 3KG0A 1P8GA 1PYTA 4K2XA 4PQUB 2G1DA 1RTJA 4X4SA 1ZAVA 2KJVA 3Q24A 1AZSB 2XBPA 1LW2B 2AW0A 3FQKA 1H6KX 4ZA1A 4DL5A 2DPIA 1UEKA 1MROB 5HMXA 2GQQA 3GTYX 5BR8F 2KRRA 1SI9A 3FK4A 3N9UC 3K5NA 3OVBA 2HFSA 3DLEA 1WDTA 2KVIA 4OZ5A 4BWMA 1CVJA 2V69A 3DRPB 4NLWA 3FBFA 1CQNA 1Q53A 3VHQA 2AGPA 2RILA 2DNNA 2OO4A 1H2TZ 3T41A 2UXDJ 3JSYA 5KG3A 4DQRA 2MSSA 4HT5A 2WOMB 5D4OA 2V50A 2EXUA 4KIAA 1RLDA 1S10A 1UKUA 2CJBA 2CUYA 4WFZA 1SC6A 3ZZ0A 4YR0A 3VGTA 1D9FA 2GCFA 3HLUA 3TEGA 3TQ1A 3W61A 4NYZA 4LF8J 2DPJA 2DB1A 3GU0A 1RJJA 4K7QA 1GEHA 1TKTA 2AQ4A 3CCRS 1H7XA 2X51A 4EO8A 3PRDA 5KFWA 2J9EA 3BPSP 1NUEA 2A10A 1EX8A 1YBUA 3QYYA 5DO2A 1G6BA 4QIFA 5L38A 3BGRB 2R8HA 3DI6B 4YDDB 4HEA9 2BZ2A 3GILA 5GAGI 5GAEI 3GYNA 4DWIA 3ZZRA 3K5OA 1OWXA 3BN4A 2WW4A 3P8BB 2BJ3A 1FWPA 5A8WB 1NEEA 1TELA 3H98A 2F65A 2CZ9A 5CYQB 3BZQA 4OYPA 5KFQA 3PJWA 3ILOA 4W90B 4IH7A 1TZ0A 5CXTA 4QYZK 4ECWA 5SUHA 2GV1A 2MSTA 2QIFA 1UVJA 2XMVA 3UD4P 3I4PA 3KMSA 4ZLPA 1WELA 3PYDA 4LQ9A 5D4NA 2MZQA 5L9NA 4DL3A 3IC1A 4HL9A 1T9VA 3ZZPA 4N77A 4DUYJ 4JI6J 4EK2A 2M3DA 1HYSA 1MU2B 1GFWB 5J1EB 1OY9A 3FJ2A 4NXMF 1UTAA 4X4QA 1LXJA 4DQQA 5DETA 3M8QB 1S57A 4XPCA 1S6PB 2FY8A 1UVKA 4DZDA 2JEFA 3IRXA 2Z57B 1KLMB 3KTQA 5HLFA 2PN6A 3E2EA 2R7XA 1IM6A 3ENAA 1S0VA 3DHXA 4F0HA 4A8SA 3CCMS 1MN7A 2ZM6F 1RCXB 2HMIB 2OTJS 1NSAA 3QAEA 2BQRA 4DQIA 1RWOB 2MLXA 1JLGB 3L95X 2C42A 3W60A 3C16A 2B7CB 1FRIA 3OHBA 5EUHA 4J9QA 4FS1A 3J81U 2RS2A 2A0FB 2BACA 3AOCA 3CWJA 4CLTA 2DCUB 3B78A 4A8WA 1WJ9A 2GA7A 3R7BB 1YHQS 5HROA 2NSBA 1I6JA 4DUZF 4DSKA 3CIZA 1TKXA 1C4CA 2H65B 1TL1A 4DL7A 4LSLA 4N8NA 1C1CB 3I0RB 2LU1A 3K17A 2A18A 1OY8A 4NZ0A 3P3DA 3ZTOA 2FHJA 4DV0J 1NKBA 1M5SA 4MTPA 2C28A 3N6NA 3CXCR 1SXLA 4C8KA 2BE2B 5MLCV 2CWXA 1GAOA 1HKAA 1KDNA 5FDLB 1Q8BA 5DG8A 2Y0BB 3GONA 4XTTA 2XSJB 2R9LA 3ENVA 2PEBA 2J0XA 3QIPB 2FLOA 1AZSA 1Q95G 1H72C 4NA1A 3MOJB 2IYGA 1NHUA 2ZHBA 2O5DA 4WFBQ 2VPZB 4ZHRB 2YH1A 3KLIB 2RAQA 3ZTRA 4ZVOB 2IJRA 1KTQA 5EWGA 1YKWA 2J9CA 4IFVA 2HVHA 4UOGA 4DL2A 4DR2J 4FP9A 1O8BA 2APOA 2CQ3A 5KFSA 3V6DA 4LF7J 5J2MA 4QYRA 3H5YA 1WC6A 5BYSA 2Q6CA 1RT5B 4USUA 2HQDA 2HNYB 3KLHA 4RNMA 1PG5B 2JEGA 3ITHA 5L46A 4PR6A 5KT7A 4YMEA 3NAHA 3TQEA 2VONA 1W25A 3TJ9A 2QL5B 2ERRA 2QJ3A 2L9NA 2AV5A 1G7CB 3F0NA 4EU0A 2HLUA 3TARA 2H5JB 4RW9A 2HWHA 2MJUA 4HDHA 2DGQA 1HA1A 4C0OC 4JI0J 2M5YA 2ZOFA 2IJNA 1BLUA 2W4CA 3PJXA 4QIGA 2NCKL 4ZP9A 2GNKA 5AT1B 5F9LA 1NK4A 1TKXB 2X1GA 1KVIA 4OZ2A 1SL2A 3NGTA 4O3PA 1YJVA 4A8OA 1U4BA 1O51A 1YG0A 2LVWA 3KOAA 5M2PA 4QR2A 1SCJB 1NJWA 4B08A 5B0FA 3MTKA 2NXCA 4F02A 5K9FA 1S1TA 3D2WA 3L9ZA 3KJVB 1X4AA 2K8GA 4J37A 4CLKA 4GC6A 1S48A 2HMIA 1NM2A 4DV7J 3W7BA 2VFUA 2GHVC 1XN9A 4PZVA 5E3AA 4Q0BB 1TR0A 4ECVA 4F2RA 3W3SA 2VIHA 2WB1D 1QAXA 9RUBA 1R43A 1SJFA 4OLOA 1NO8A 1WI8A 1F2HA 2XMWA 3CDAA 2XMMA 3TI0A 2N3OA 2CQDA 4FNHA 1URNA 4I69A 5HVFA 1SC4B 2JNJA 2QN6B 4IRCA 4JI8J 5IS2A 1X4DA 4DLEA 1U47A 2BXJA 3A8JA 3CE8A 2Z8QA 2HW3A 3KK3A 1HW8A 4MIWA 1VMBA 4OJGA 4Q2MA 5E3QA 4GKKJ 3OVAA 3KHGA 3ZO7A 1JB0C 1HBMA 4U96A 5DGAA 2W2NP 4MJKA 3G8TA 4B9MA 3AQPA 2VJVA 1Q7LB 3DDIA 4WXWA 4HYKA 4KO0B 4JI5J 3HVWA 2BV3A 4PWUA 1NDKA 3EGNA 2HVDA 3EZUA 1U45A 1RTHA 2PI4A 1GMVA 2G2YA 3QO9A 1ITPA 3FSYA 1TL7B 2VQFJ 1JWWA 4NCGA 3EZ5A 5KT6A 2KT3A 1VFJA 5FD1A 1HQUA 2B5JB 4HHHA 5LSOA 2R8KA 2J7UA 4R5PB 1T0TV 1YZ6A 3CJRA 3UE2A 2R7SA 3BYPA 4M5HA 1QE1B 2R2UA 1O6XA 1RB0A 3BBCA 1CS4B 1IBCB 2KN4A 2CRLA 4NLRA 4C3KA 1X4FA 4J91A 2BJ9A 2XHWA 3QZ8A 1U6BA 2BW2A 3OXFA 1ULRA 2GIFA 3M2RB 1J5EF 5A8RA 2OELA 3PX4A 2VFTA 3M6XA 2Q79A 4NLYA 1VBYA 5KG2A 2CQHA 3B8HA 2PE8A 2R2SA 4DPUA 5CD4A 1KOOA 3N6LA 3M8PB 1CC7A 3I56S 3HHKA 5E3RA 3OBIA 2WZ1A 1VYAA 3HULA 2W2MP 1BXNA 3M2UA 4YP3A 2GGPA 5F8HA 1LW0A 3FFIA 1MMDA 2AYGA 2E1CA 2HHSA 1OS5A 2VG7B 3CW2C 3VGVA 5IM0B 4ERDA 3D67A 1I1GA 2ATCB 4MYUA 2CNKB 1TK5A 4PG8A 5I3QA 2XTJP 5GAGU 5E7OB 5GAEU 4B3RJ 4LF6F 2HNYA 3G2XA 4L73A 2P6SA 3MUMP 2BQUA 2BJDA 2F63A 1XK8A 1JJCB 3BV8A 2QL7B 3JS9A 3DRYA 3MMCB 4M5JA 4NRTA 4ZJQA 4F4YA 4HR2A 4W4MA 1W2IA 3AB4B 4DX8H 1SJ3P 1EIYB 2WHOA 1HNZF 2MQLA 5I4MA 4DV2J 2KDOA 3KHLA 1SUQB 2CVEA 4RW9B 2FTRA 2I6WA 2HKEA 4M94A 5KFEA 3ISND 3CDUA 1Y9OA 2DO0A 1PJ5A 1ZAWA 1CLFA 4NYOA 4QWAA 2G1HA 1FTRA 1ZZFA 2AKWB 5KFMA 4HDGA 1XNQF 1S77D 3KLEB 1NK0A 1JLAA 3H40A 3DYAA 3D6FB 4KB7A 4ENOA 3MMAB 2KJWA 2IJFA 4PG6A 5F0WA 1K9MT 1KSPA 1TL3B 3BH7B 3KK1A 1DFDA 4KKOB 3PYGA 4WXOA 4QW9A 2LLZA 2WBMA 2YNFB 2JVRA 4A8YA 1B7YB 3GIJA 1FXLA 3DFEA 4CTAA 1SJQA 2CPZA 3CGIA 2EK1A 3IG1A 5LXRA 2HBZB 1U1LA 2I9SA 4FKXA 3EDQB 4NLXA 4L3KA 5HBMA 5CAAA 1N32J 1BGXT 3G4SS 3PY8A 4NPOA 4FBUA 4NLQA 4OZ0A 2EFPA 4X66F 3KJNB 1W26A 1VQKS 1Z4UA 1S7IA 2HHHF 2EFVA 2RF2B 1QY7A 4C8LA 3QFHA 3THPA 2VBZA 3SMZA 4CLLA 2OJ3A 2DRAA 3ONQA 3BR8A 1H73A 2D69A 3UO0A 4ZK7M 4Z7YA 3W5YA 5IM0A 4DDFA 4A8QA 1CJKB 2XGPA 3W2VA 3O2IA 1HNWJ 5D0EA 4OYOA 4DV1F 1RYSA 2R7QA 1FWLA 3KYLA 1FTCA 2CPHA 3QGGA 3UDEA 4WBFA 2VICA 3EM1A 2DCLA 1VQNS 4I4BA 1BQNB 2DGTA 2H48B 3VZHA 1TAQA 3LGHA 4IYQA 3SI8A 2RQMA 2D41A 4USTA 3MAAB 4H4MB 4ZPDA 5CCMA 4USHA 5LM7E 4CT9A 5I3UB 1JX4A 4DG1B 3ZZYA 4DN0A 4KJIA 3W64A 3EGVA 1BWVA 4YHHJ 4HH0A 4KGVB 3N79A 2ZEJA 1NU4A 1UJ6A 2GC8A 3VF0B 3QPIA 4C3MA 1CSJA 2I5JB 4B3RF 1WWHA 4ZN3A 1RTIA 1K47A 1HNXJ 1B99A 5BJRA 3M9OB 4O0NA 2ZJRQ 1DTQA 5IFMA 1IWGA 5LMNJ 5DJBA 3D9BA 1TL4A 1PBAA 2DNPA 2LU2A 4C97A 4FN5A 4YS2A 4QIVA 3R5AA 2I38A 2JX2A 2VB6A 5AXMA 3RUBL 1PYOB 3IP0A 4IO1A 4I6WA 3EPIA 3FCHA 4TNOA 4G1QA 4RW7A 3VAKA 1JLEB 1HMVA 2DEJA 2LQBA 3UR3C 5A8KB 3R5JB 4Q8EA 4RW4A 2CQIA 3A12A 3CJ5A 1R27B 4OI2A 2QRRA 3D0GE 2MB0B 2R7UA 3TA2A 2F5GA 2CPDA 3TNVA 2ZHAA 2UU9F 2YKPA 2POKA 4ZN1A 1R8CA 4M5LA 1ZM3A 2N7YA 1IUJA 2GJFA 2ZUGA 5G0RB 1WUUA 4K4ZA 1HI8A 4JYAF 4NYPA 4M5DA 3NAIA 1K1SA 5F8LA 4RW6A 3UFCX 2XYHB 4GVBA 3W63A 2KXFA 1LWEB 2ZWPA 2DR9A 1OQ3A 4C8YA 2F8EX 3OLAA 3AAWB 4F8RA 3IBCB 4C8ZA 2DTJA 2KKHA 3W2VB 4CO0A 1XMOJ 2UV8G 1FJ7A 4DF4A 3TAPA 2LQ5A 4WTYA 5JVGQ 2DR7A 3QT7A 2V8DA 2NREA 3DI6A 4NRUA 1M0SA 2C2KB 2DNGA 3PV8A 3DGPB 1FEEA 4K59A 4NOHA 1S0OA 2QSFA 4H4MA 4OMFG 1RTIB 4LF2A 1QDUB 1DQAA 2WVBA 1U8SA 3AJ2A 3GJRB 3GWCA 4DV5J 2P9CA 4X4PA 4DSJA 1DARA 1KFDA 3IAM9 4WE1B 5HBMB 1TQLA 1S0NA 2FLNA 4UY85 2IFXA 4OI3A 4KRWA 3OL8A 2HK3A 4WP9A 3JQMA 3MPUB 5KFKA 1M1GA 5LMUJ 5K14A 3PIPQ 4KHPF 3LWLA 1I3OB 1VC6A 1AFIA 3AODA 2QZ8A 4O4RA 3OL9A 4PKDB 5CD4H 4DR7F 2ZNZA 2CG4A 2LEPA 4A46A 3GJSB 1S6OA 2QO3A 2KYZA 1CJTB 1H7WA 4P71A 3KHHA 2J9DA 3TAMB 1RAEB 3R2CJ 4PUOA 2MYFA 3GFXA 2VHGA 2J6UA 1SJ1A 2QLJB 4M5KA 4E2FB 1T9YA 1RTJB 4QPTA 3WX8A 2NUUG 2F9DA 3LAMA 3OR1B 2UUAJ 4OJHA 4NCBA 5F8JA 3I0SA 2HHQA 2AP6A 3OL6A 3DOKB 1IN0A 3MMAA 5DDRC 4AT1B 4ICLA 4DJBA 4FYVB 4ECRA 4PUOB 4P74A 4CYUB 1U2FA 1RCOB 3PCOB 4WIIA 3TRGA 5B0CA 4KKOA 2GIQA 2XLJA 1IBLJ 2OSRA 2BDPA 3I6PA 3VVTA 2XLKA 1Q82T 4NLOA 2AT1B 4B3MF 4RZRA 3Q8QB 4ICLB 2VQEF 4OYWA 3SQOP 2I8EA 4ELVA 1IQTA 1HLWA 2BYCA 2C2MB 4X64J 2MQ8A 4R8UA 4CM2A 2KYXA 1QUVA 4C0BA 2Y1LB 1T3NA 1H0HB 4D3GA 3NNCA 4RKUC 2O1PA 5KFVA 2QLBB 3NWRA 1NK6A 4NXNF 2JRSA 3CVKA 3RRKA 1VQ4S 5HO4A 2DXEA 4E8UA 2JLFA 3QWUA 4OZNA 3M1VA 2XO6A 3BQ0A 3IBWA 1SB6A 1JLQB 4DFPA 2B4VA 3L7UA 5B0EA 1QTNB 5CYMB 2VKZG 3W9JA 4ZVRB 4IG3B 2C3UA 3HHLA 4RNOA 2HQFA 1J5EJ 4CNZA 4DZ6A 3EXYA 1VQYA 5JUMA 4ED4A 2EPIA 1VC5A 2XS7A 5D3GA 3BDEA 5DGBA 2E7VA 2NXNA 2HZVA 4LF7F 1DURA 1LV5A 4GVBB 4MH8A 3R27A 2HYIB 5HJYA 3KJQB 4YOEA 3CJ8A 3E8OA 4WWSA 1R8HA 2FQQB 3RAXA 5AXNA 2VQEJ 3PIOQ 3B82A 2VPXB 2UUWA 4NLGA 3DGPA 1S49A 2HPUA 1RA6A 2J5AA 4LR8A 1E6YB 1U0HA 1XEZA 2A6MA 2DNHA 3PM9A 2P5VA 1KD1T 2YXLA 3NP5A 3RW7A 2UVUA 2RB7A 2LXFA 2EKYA 4B02A 4KPYA 4KYZA 1I94J 5KFUA 3NNAA 3QJJA 3QLHB 4K0KJ 1RT3A 3LA0A 2J8SA 1KR4A 4DR7J 1X4GA 2DH8A 1TVRA 3MEGA 4CRJA 1Q7YT 1WKKA 3W65A 4V19X 3M8YA 1DQ8A 3M8PA 1S9EA 2NYIA 3DOMB 3M6WA 4I2PB 4H4OB 2H9ZA 1ICEB 1TMMA 2E1MC 2ROGA 2YQ0A 4P9SA 3FNNA 3DOLB 4ZPBA 1RWNB 5ETLA 1NJZA 3PTWA 3TWZA 2ZBPA 1KN6A 4X84A 2GMJA 5DM6Q 4EBEA 2HRYA 2F7VA 5HANA 4RW8A 5KT3A 4B9SA 4LFAF 4ZPCA 3U1LA 3IFEA 2DHAA 3MHYA 4FYXB 4Y28C 4DUZJ 5GMKa 2YQ3A 4IUFA 4CLWA 2VOPA 5AXLA 2FJEB 3BO3A 5KOWA 2C3YA 2IA0A 2Y8WA 1NPPA 2QT7A 3FBBA 5JMNA 3HI9A 3RGIA 3TZYA 2BABA 4RWXA 5HK4A 1S99A 2B8PA 4L6V3 2V4JB 2B51A 3K5PA 5CHCB 5D0GA 3UCGA 2B5JA 2ZH1A 4EYHB 4F4KA 1SV5B 1C2PA 2BE7D 2IM0A 4PG4A 3KK3B 1VBZA 1JXLA 1MSWD 4LRBA 5IQQA 1U1NA 2E5HA 1IBMF 1FRXA 1A9NB 2CQGA 4ZLNA 4U67Q 2CJAA 1HBMB 2HFOA 5GMEA 2KH9A 3CC2S 1H38A 2FLPA 4B3SJ 2MKSA 3UD3P 2RQCA 1CULB 2E5JA 2GAGC 2ZZNA 4J9LA 2ZC3A 5JXSA 2ZITA 1RAOA 5L39A 2BOPA 2M52A 4KO0A 1GX5A 2YPYA 1QVGR 3VAGA 1SJRA 2LDYA 4GO5X 4ETXA 2KG0A 4OYBA 5I3UA 4QIEA 2FPHX 5KG7A 1KS2A 4OIXA 1LWXA 1NK5A 4XAKA 1M1HA 2DK2A 3NCRA 2UXCJ 1RBLA 5KFRA 3VR1A 3HXMA 4XDDA 4DMZA 4EMDA 2C3MA 4O44A 1GMWD 3KLGA 3C14B 4ATNA 3IBFB 3R5GA 3VTIA 5A2QY 4B3TF 4ES2A 1IJEB 1OSCA 3Q0AA 4Q0BA 1WTBA 2CG8A 2EG2A 2QFIA 3MM7A 2AZ1A 1Q8KA 2XMUA 3I31A 5GAHI 3IWNC 2EC0A 5F8NA 1HBNB 2RE1A 2PMHA 4IG0B 4NLTA 2MGZB 1EQMA 4JI3F 1NHKL 1MWZA 2VPYB 3M7VA 4OLPA 3CCZA 2ROEA 1RAAB 1RQ0A 3HFVA 2RF2A 2YKQA 3T6BA 4DSFA 2OD4A 1WNEA 4P2SA 3GIMA 2CJYB 3THTA 4PRFA 4UQGA 2MDAA 1U24A 1XWLA 1R8PA 2DIUA 3QFWA 1WC5A 1HPZA 3T9ZA 3KLFA 2MKKA 3T1HJ 1VQ6S 1AT1B 4IOCQ 1RT6A 1RT5A 3V4IA 2DBBA 2XMKA 3HKZD 4EI2A 3P6YC 1LK7A 1WEYA 4CO1A 2EFGA 3O44A 1ZA2B 4PXDA 1QAJA 1XJWB 4GO7X 1A7GE 1RKIA 2Z58B 5ETSA 1X4EA 2RUGA 3DXSX 3HVAA 4X65J 3BGUA 3CF5Q 4ED0A 1S1UA 2OEMA 2XY5A 3CCJS 1NNDA 3PW5A 4O4GB 2HAIA 3CSKA 1YITS 1B0VA 4NWBA 2KFYA 1FNMA 1Y5NB 2QLWA 1NSQA 2PEHA 1ZPWX 3I4HX 1F6TA 2DH9A 2V9WA 4JV1A 3MPWA 4S0MA 1XMQJ 4CM0A 1IKWA 3NGSA 1YQHA 4ED3A 1WI6A 2DEIA 2DXDA 5IT4A 4UZBA 3P49B 3CCES 2AEJA 2XNQA 4C11A 5B7WA 3SV3A 4ECSA 1CEZA 3G71S 2JLEA 1F2GA 2HVEA 2FJXA 1SUQA 1Z2ZA 2MY7A 2JVOA 3CO0P 1MG7A 4DV6J 1N34J 2D3UA 1JXVA 2JC0A 5I42A 1RI7A 2AX0A 5CYJA 3MR3A 3FDSA 1FFWB 1N5QA 1TL1B 2FZGB 3GIIA 3GFYA 3QMQA 4RPFA 3KLGB 3QGHA 2PT0A 3CNQP 2F40A 1H74A 1UVLA 3D4JA 1AXQA 2R7TA 1ZM9A 5HN0A 3E51A 2NS1B 2PMWA 4ER8A 3DLBA 1LFWA 3GPAA 2F4FA 4HKQA 4AQYJ 1OSDA 1JLCB 2MXYA 5FDLA 2HNZA 3AJDA 3BGLA 4DV5F 1WC3A 1S0MA 2DGSA 1LW0B 4I0WA 3DU5A 2BOAA 2PD1A 4OYMA 1T9WA 4UF4A 1NPKA 2KHCA 4CLPA 4C8OA 2UUBJ 3OTEA 2MKJA 1KLMA 3UN2A 4B9TA 1TV6A 5D6GA 4ILMA 4QWEA 4HI2A 4Y6IA 4ZCIA 5A8RB 1WSVA 2AX1A 3CCTA 3MMBB 5DG9A 1VQOS 1B3TA 3BDPA 2IC3B 3QQCD 4USMA 3OUYB 1PGZA 1HBUA 2DNKA 2VASA 1NB7A 1SH0A 2MJNA 2KRBA 3JTOA 3ZZTA 3HSJA 4F7VA 2IBKA 2FC8A 4DL0C 2RMLA 3WZ0A 3MXHP 3HSGA 2V2KA 4ANEA 5J2PB 3RRGA 1JLFA 2OEJA 3UWTA 3OL7A 4IR1A 4Y3CA 3W8PA 1X9WA 1P6TA 4OX9J 3GIKA 2HG4A 4K4YA 1N48A 4ED6A 1TK8A 1QSYA 3M8QA 2DITA 3PKYA 1NB2A 1EZZB 3LF0A 2HHUA 2ZH8A 3GFZA 3P96A 3ZNJ1 5IC6B 2YKNA 4CO2A 2AHOB 5FLXU 3AOAA 2YY3A 2V4QA 2ZD1A 4DS4A 1TU0B 1X5TA 4F0KA 4F36A 1S4EA 3QSIA 1VCTA 2BANB 3X3UA 4C0HA 2B9WA 3OVSA 3OV7A 3F41A 2JLGA 1Z1ZA 3BJYA 1RT2B 4B3OB 2WONA 4EUVA 1IQZA 3CJ3A 2Y9HA 2HURA 2XG8A 4M5GA 4NLPA 4OYAA 2GFFA 5EGYA 3PHTA 3CCLS 4DEZA 1XR5A 2HIYA 3EZOA 1U09A 5KFFA 1HWKA 4YHHF 4OHVA 4G65A 2BJEA 2O01C 4J5OA 4F4WA 5C24A 1F5BA 3J7A1 3UI3A 3R7SB 1TKTB 5HMZA 3IMQJ 2CQ2A 5D77A 1HWLA 2ZBRA 3ZTPA 1N6QA 1Q81T 1WTFA 4B3TJ 2KB2A 4DL6A 2VFRA 2ZHOA 2EFNA 4CZCA 4Y00A 4G6VB 1MW7A 2H4YB 2ATLA 5K8PA 2ZKUA 1HQEB 1IR1A 1T94A 2YH0A 4USWA 4ZP8A 5ETPA 4D3HA 1H2UX 4TN2A 4N8OA 1BE4A 3G86A 2OP5A 5F8GA 3NL0A 2W24A 2W2PP 3UNYA 4DFJA 2I5JA 2YX7A 1RHJB 4NZ7A 3Q8SB 1U49A 2IY5B 2OPRA 1UPPA 2AIRB 1TKZB 5L8RC 3UDLA 3A8IA 3M1VB 5LSLA 3OTOF 2R8IA 2WSFC 3NGKA 1WORA 1N88A 3V81B 3ZTSA 4KFBB 3HHLB 3AA8A 5CYMA 3GV7B 3GR1A 3NGDA 3DC2A 1NZ8A 1U0SA 2B4UA 5E5NA 5T14A 3H0PA 1H98A 2DR6A 2UUCF 2VA3A 4MIBA 4U7UK 2BQ3A 2RDIA 2L9WA 4KHRA 3TYTA 1HNIB 3LO3A 5E3PA 2M4MA 3AHPA 4J9SA 4YUDA 2L3MA 4LFCF 1S4FA 5C2GA 5AE2A 1AFJA 5H9EK 2VH7A 2C2OB 4PQUA 4LJMA 2VUGA 3LP2B 4O3SA 4TQRA 1FRMA 4LBPA 3TP2A 4EFAC 2FY1A 3IA0A 2NR0A 2U1AA 3UW1A 1R7IA 1GK8A 2DXFA 2G2OA 4LBHA 5HQ8A 1S59A 1JJHA 3HDSA 3HFZB 4K4VA 4OHYA 1M5PC 2W9CA 2F3JA 2JH3A 2V94A 3M8SA 3PW0A 4LF4J 3R3TA 4ZIVA 1Y5LB 1KQGB 2DR8A 3BQ1A 2CA9A 4DQPA 2HZCA 3AH6A 3D3CJ 5K20B 4ZS6A 3N6MA 2QA2A 1DRZA 1U8WA 3QRPA 3DOKA 4IQMA 3THVA 3A3NB 4NLDA 4GKJJ 2J0SD 2KHDA 2CQBA 2WVCA 3RYLA 5J1PA 1XNRJ 1HHQA 1ZTWA 3CC4S 3S7RA 1U48A 2PA8D 3OT9A 2ZBQA 5CCLA 1DTTB 1UJ4A 3V81A 3SFUA 1FVQA 5CA5A 3N28A 3WBZA 2N3LA 5K14B 4YEAA 4ZVHA 3I55S 1RP5A 3Q89A 2HBRB 5B0AA 1S1XA 2VG5A 4IFYA 2V6AA 3GCWP 5BYQA 1ZH5A 2OPRB 2XS2A 2L41A 5LSRA 2KO1A 2PDAA 1UAWA 2V8VA 1G1XA 3SQGB 2MHEA 3V2UC 2ZJQQ 3CC7S 4AQYF 3US5A 4IRDA 4CLYA 2W4DA 1V5IB 2HQCA 1DLOA 1R0AA 2D3O1 4N41A 1X8DA 2LFVA 4QZVB 3LWMA 2VC0A 1Y7PA 1L3TA 3QT6A 4NXMJ 4DI6A 4C6AA 4NI2B 1WHVA 2I0XA 1N5SA 2L48A 4JI6F 4CI0B 1PO6A 1TL5A 4TU7A 3CJTA 1U6FA 4DU8A 5FIIA 3J80Y 3GB0A 4J9PA 4WKYA 1OPIA 4QU6A 4LIWA 2QGFB 5KFAA 1JLGA 4WU3A 5M2RA 4DV3J 4F3MA 1WKJA 2Z2MA 1I94F 1JLEA 2JFDA 2ZM6J 3F73A 3V6KA 5BXIA 1VBXA 4J7CA 4KC5A 1BQXA 2JZ5A 4O3QA 5B09A 2YX4A 1U6ZA 4B9UA 1F5AA 1VDHA 1WF2A 1WOPA 4P52A 1FJGJ 1VC0A 4DN9A 2YX1A 5HATA 4MT1A 4YR3A 1C1BB 4HI1A 2J6TA 5HJXA 1FKPB 1Q0NA 3PW4A 1OMSA 1FRLA 3A3OB 4XK8C 4TU9A 2ZKTA 3U02A 3K59A 3MFIA 5D8HB 1T95A 3HZGA 4C98A 4Q43A 1YDLA 2RS8A 3BSAA 2WONB 1FVSA 1R8AA 1LWEA 3GR0A 3IM9A 4ILRA 2YKMB 3Q23A 1NK7A 4CDIA 3NOCA 2P2CB 2E1RA 2QLXA 3H2UB 1XERA 2WTFA 1CQMA 1RWMB 3NEKA 2OPQA 2GW8A 2M9KA 2MPUA 4I6AA 3TVZA 1G3OA 1D3WA 1RA7A 1TMJA 2VG6B 4HLBA 3FKBA 3S01A 1NBEB 5ETVA 5A8KA 2ILYA 5KTQA 3MR5A 3NGRA 3ILJA 2NZ4A 1APSA 1N5YA 1CJKA 3ILIA 1HI1A 5ETOA 5B08A 2PFDA 3UD5A 1CJVA 2HK2A 4YB6A 2ASDA 3UDVA 4BC7A 3FVYA 5EWFA 4Z7CA 4QR0A 1K0VA 2DH7A 1O5JA 3UN3A 3KG1A 5HSPA 1OYDA 2JJ4D 3P5TL 1DQ9A 4GC7A 1Q86T 1U2CA 4JI2J 1T03A 4LRAA 4CLZA 1S72S 3W9HA 1D8YA 2E29A 2LMIA 2CJ9A 1LWCB 3BN7A 4IKAA 3DRSB 1TP7A 4LF4F 2LQ9A 3DHWC 5B0DA 4X62F 2RSQA 2DO4A 4AXIA 3MTJA 1KLNA 2C2ZB 1S1XB 2DGOA 4QJVA 5A6WA 2F4VF 4Y2MA 1YJNS 3PXGa 4CTAB 1GNKA 3ENQA 3GZ7A 4XIUA 3N5BA 3NRBA 1N33J 5C5JA 1IKXB 2G0CA 2XZWA 5LJ5Y 1CPZA 2GHWA 2AJFE 3PEJA 1L3UA 2FZKB 2VJUA 1IR2A 1RGVA 1RT4B 4X62J 1EKSA 1YWXA 2QA4S 4OX7A 3POTA 2H1YA 2R7WA 3KJVA 4I7FB 3PEHA 1QSSA 2UUTA 3VALA 5IT0A 2IAJA 2IHR1 2MZJA 4I56A 1IVZA 3BYRA 4TU8A 5K8NA 1PKUA 1R6VA 3H2LA 1FRKA 1HFEL 1YRUA 4PG5A 1EAYC 1X60A 3NLCA 1RBAA 1RK8A 2OI2A 3HSZA 4JB8B 4X66J 2ZOGA 3ITHB 1FFSB 5L1KA 4B9LA 1S9GA 2B43A 4TKTA 4YY3F 4IRKA 4UOFA 2UVVA 2F4VJ 2KFNA 2H3EB 3M6VA 4LF9J 2A2CA 3MMCA 4KGMA 3LP0B 2HQIA 3D68A 1RWUA 3PZPA 2ZFHA 2BBEA 3OR2B 2YNGA 3TZZA 2V8PA 4HVZA 2VBXA 4HHUA 4QQBA 1D9AA 1RAIB 4GVLA 4ZPAA 5IZHA 3H4BA 1FKAF 3DRRB 3DGVA 4TYBA 2Y3YA 1VK3A 2B4OA 1NPRA 1RWKB 3IGNA 2YWWA 3AXKA 1MNEA 2AZ3A 2O3DA 5H1SV 2V2QA 2VZ9A 2XY7A 1PJ6A 3LP0A 1FERA 5CZVA 4ZKAA 2HNDA 4BS2A 1MMLA 4K0KF 5CH7B 1V9OA 4O4GA 5L1JA 4C3LA 1JLAB 2Z56B 1K44A 2YKAA 2CQCA 3JSMB 4M5NA 2FB0A 4O3NA 2KU7A 1FJEB 4RR5A 1SC3B 3G6VA 2XB2D 2OEKA 3PYFA 2W2OP 2HFNA 5C42A 1EARA 4EYIB 4JI4J 3KK2A 4KE5A 1RDRA 3K8VA 3BSOA 1RBOB 1ZAXA 2AEFA 2GVZB 4DR3F 3V6JA 3A3PB 3FUYA 3PKMA 3R1LA 1S9FA 2YNIA 1FI4A 2AEMA 4MMOA 4DBQA 2Q43A 1ZTTA 4F3OA 3MPVA 3GIRA 4YR2A 1SPBP 2R3VA 2YWFA 3C2PA 4P72A 1HNVB 3D5MA 1HNWF 3W2WB 3EX7B 2CDRB 6AT1B 3DU6A 3QIPA 1PBUA 1URRA 2B56A 2CADA 1BQMA 5KFGA 2WRMA 5HVGA 4LF5J 2YWEA 2LKZA 1NZAA 4OZ3A 3LALA 3M8WA 1VRUA 1T9UA 3Q22A 4LBIA 4K4TA 2B6AA 1KBRA 1HIYA 3C16B 1F3FA 3SCLE 2QTWA 4CLUA 1WACA 1RWPB 5M2UA 1N0VC 2R7RA 4DV7F 1X9MA 1U1QA 3BBBA 4G3IA 3NCQA 1R3NA 1VGYA 3S8SA 2CYYA 1T11A 1FJGF 1V3SA 1NHVA 3NS6A 5ITHA 1ZS6A 1IWAA 2OSQA 3VAIA 4TLQA 1UEUA 2ACMA 4YB1P 3RTVA 2RVJA 3ET6B 3C6UB 3FQLA 4V1Ak 3CDWA 1N36F 3DM2A 1E6VA 3HHEA 1VIXA 3OTCA 3CCQS 2VKRA 3DDNA 2VDIA 1PC4A 3C15B 5A0YB 4FYDA 3I32A 4WKRA 3MMJA 3CD7A 1LKZA 2DR5A 1SV5A 1HL6A 4DX7A 3EPGA 4B3OA 3R5BA 1JLBB 1JQGA 3RBEA 2FZCB 3QNWB 3SZ2A 4DX6A 1AW0A 2NXJA 3H5SA 1LQ9A 5KFTA 3LUYA 2LQJA 2OKQA 3CEDA 3GFHA 1S9EB 2DKOB 1FWKA 1Y00A 2FD2A 3TA1A 2VFSA 3K57A 3R6GB 3DMJA 2PA3A 3MI7X 2W7OA 2FHJD 4AL6A 1F0XA 2HHTA 1NSKL 1RWXB 4KHPJ 4OYXA 2WBRA 4LT6A 4C2MA 3RB6A 1E6VB 1N34F 1HD0A 1VQ8S 2BR0A 1TTHB 4UOCA 4I68A 3WIUA 1T02A 3JTPA 5E3CA 1XC9A 5KFNA 3T3FA 1JKHB 3W2WA 1HNZJ 3L7PA 4N56A 2E1AA 2OIHA 4WU2A 2DRBA 2I1RA 3OFEA 3MPDA 4ZDNA 3M9NB 1UVMA 4O23A 4A8FA 3CMQA 1VRUB 1Q5VA 1HHTP 2IMWP 2JL9A 3T9NA 4H4KC 5D4LA 1KKHA 3MEGB 4Y0FA 3MEDA 1HR0J 2C2EA 2E7WA 3BSNA 3TUIC 5J2NB 4X4TA 4EZ6A 2Y1IA 3OJUA 3QZ7A 4ZITA 4A8XA 3DOLA 3TR5A 1YRTA 2FJWA 3CT9A 3I96A 4ALZA 2KT5A 1FXRA 2EG1A 2MQMA 3BREA 1T05A 4DU7A 4RUHA 2HGNA 4N7TA 4PABA 5GVQA 2P6TA 1K1QA 3SQGA 1SIWB 1YI2S 5KG4A 3JAMU 2GIRA 2IYIA 3RW6A 3PG9A 3LAKA 2DHXA 2HQGA 2MHNA 3L4BC 4X4VA 3G9CA 3HK2A 2QYCA 2F8HA 2MQQA 3QAUA 2ZVSA 2V4RA 4K5RA 1RYRA 4HTJA 1FFGB 3IR6B 2IM1A 4TLRA 2DYAA 2YTCA 2XYGB 3V6DB 4LFBF 3HVTB 3M30B 4LFAJ 4KH1B 4ANDA 3RR7A 2YNHB 2LEAA 3R6LB 5AJ3F 3KK2B 2RQKA 2E5LF 2XSJA 3U27A 4CH7A 4K4XA 3ULHA 2H54B 2C3PA 1NLKL 3I0SB 1MLAA 2OD6A 2IAJB 4M8LA 4NA2A 2VG5B 1CC8A 1J27A 4UUWA 2LEBA 3RB0A 1SL0A 2HHXA 4WZMA 3KNAA 4DX5A 4TY8A 1VK8A 2MZSA 3B4MA 3GYGA 5IOLA 1XMQF 5DRKA 3C6TB 4NX9A 3SDEB 3UVJA 1ELOA 2GQCA 3W8GA 3ENWA 3G6YA 4B3SF 2FVRA 4ES1A 2K3IA 3N0VA 4CO5A 4WCEQ 1UVIA 2X7IA 2MKCA 1UFWA 3EVMA 1FT8A 4ZVPB 3O1LA 1HBNA 4KT0C 3SIPB 3RB3A 4BWJA 3A8KA 3RBDA 4ZOSA 4LUBA 2AYMA 4A8MP 3LH2S 1VJQA 2MZ1A 1I5OB 3J80U 4OZJA 3SYZA 3QATA 1RTDA 5HROB 5E41A 4I7FA 3G8QA 1IKXA 1T9XA 2CWKA 2ZDPA 4ECTA 1T05B 1UETA 4DR1F 4WP8A 4FF4A 5ETRA 3JYTB 3I0RA 5KFPA 3QRQA 2QYGA 4USVA 1OO0B 4TXSA 4MFBA 2MLYA 3CDEA 2UV8A 1D0EA 3CCVS 1ZA1B 1F5CA 2ASJA 4ELUA 3BGFA 1KOHA 3P45B 2BE2A 2KL8A 5L1IA 2CQ1A 1CULA 1S76D 2EK6A 2KZZA 3OPKA 3ELHA 4XPEA 4OHXA 2AWZA 2YKOA 4JI1F 1VR6A 2XY6A 2JDJA 1L3SA 2KVQE 5ETMA 1XQIA 4AD6A 4DR5J 2JWNA 1YIJS 1RAGB 3PX6A 4JYAJ 5U47A 1WOSA 4ZVUB 1FD8A 2CZ4A 1RISA 2VQFF 3QJLA 3IS9B 1FHTA 3DDKA 3QIDA 5IT9U 1KQKA 1EP4B 2KI2A 2RT3A 4H4KA 8ATCB 5KFBA 1NXIA 2JSXA 5I3PA 4RBVA 5K8MA 4FPIA 1BY9A 5DDOC 4DHVA 3HHNB 2UP1A 2E5IA 2UUBF 3PW7A 4B9NA 3NY0A 3T1AA 3S1TA 4OX9F 4MYTA 1NDPA 3MECB 3DLGB 3E3XA 4JI2F 3SCJE 2PFFB 1SVDA 8RUCA 4K5SA 1L5UA 3FBCA 3HX9A 1KTVA 4ITSA 1S1WA 1N0UA 3GSDA 3BGRA 3J81Y 4ED2A 5H9EJ 4ZVEA 4JI1J 3FCVA 3D0HE 4C8MA 2BUNA 2CJQA 3FRYA 4J9UE 5EX0A 2CJKA 1R8BA 3MR2A 3MEEB 3AD8C 2FGCA 2J7WA 5C25A 2M8HA 1YZ7A 1LXNA 1A0OB 5DLGA 3JAMY 3PNIA 3MCOA 4U8YA 4F2SA 2C1EB 2KXNB 1EHWA 3BPDA 4RW7B 2MKYA 1WG1A 2M8DB 1F9FA 3P4UB 4DS5A 4DR3J 4CNYA 1VQMS 3CD6S 4KV8A 5DQGA 2AGOA 3GV8B 1S6QA 1VS3A 2XLIA 1DLOB 1OPZA 3HKWA 2WVDA 3V5RA 1MN9A 2ZE2B 2C2NA 3ZZUA 2OAUA 5T7LA 3G87A 3IS9A 4KSEB 2B6AB 2BX6A 2N4DA 2ZWOA 3MAAA 3MCMA 4NI2A 1X4BA 4NMXA 5J1NA 4DCOB 3MR6A 5LL6d 2FHMA 2GZOA 2ALZA 1N52B 4RNHA 1BC6A 1IBLF 2CNOB 1QTMA 1VJWA 1KVJA 4M5MA 4ETZA 4J9KA 2IRXA 3FEYB 3FMWA 4UW2A 1X5PA 4RNNA 1S97A 3DNCA 4GKJF 2HGLA 4QWCA 3PFEA 3MR7A 3CUNA 2AYBA 3W62A 3MPYA 2ZBIA 4IDKB 2IDLA 2D74B 1FA0A 4FYYB 2M7SA 2CQ4A 2J6SA 4KGZB 4ZPVR 3B6BA 4ED5A 2V68A 2RUSA 3J7YU 3G6ES 3KNGA 1R0AB 2COLA 7FD1A 1REVB 2Z2ZA 4QYZJ 1VHIA 4CIOA 1UVNA 2B8QA 1YTYA 4K4SA 3KLEA 4AL5A 3MOZA 3UPFA 2D7SA 2B9YA 2FVSA 1WG5A 4RLEA 3DLLQ 3DLEB 1TFYA 4R8UB 1BHNA 1X7VA 2XI2A 3GYXB 3HSDA 2XC9A 2EFOA 1S6UA 2OMOA 3ICLA 2RU9A 2WB4A 4OV1A 1XR7A 1UEVA 4PPDA 4AE5A 2ZH9A 2CPJA 1EQ0A 3F56A 3ZTQA 5KT2A 1REVA 4ID5A 3NNHA 2E66A 2GVDB 1M5HA 1NDLA 5KG0A 2VPWB 1IBKF 3LGMA 5F0UA 1S9GB 2CKWA 3VAFA 1QUPA 1VQSA 1B64A 2OPSA 3OXGA 4A8KA 2BJ7A 3HT0A 5GMDA 3NGUA 1SBRA 4N76A 1S1UB 2YNHA 4LF1A 3TOQA 1FNOA 3LPEA 5A6PA 1NJXA 4LSNA 4FVMA 4N47A 3VVUA 3H7HB 3FSIA 2E5GA 3KUGA 2VG7A 1Q78A 3BR9A 4URQU 1W7WA 1VQ5S 2F9JA 2GHPA 4JI8F 1U25A 3MCNA 4YN3B 1RE1B 1IKWB 4KFBA 1RT4A 2DGXA 3IAS9 1P27B 4IH6A 4U8VA 3ADAC 3UDCA 5B0GA 5GAHU 1PAEX 4MK7A 1S12A 4E0DA 5HMYA 1M5KC 1XR6A 4W98A 4M1KA 2DGVA 4ZCMA 1PSDA 2VF3A 1C0UA 2MEWA 3C66A 3M32B 4BBYA 5ETKA 3QWPA 1HNIA 1RU1A 4RUCA 1P1TA 4F67A 4JI5F 2SXLA 4USKA 4MKBA 1FXDA 2CZVC 2HQ3A 5K8OA 2G2ZA 2VL1A 2WVEA 2R7VA 2ZH2A 2YWKA 1N56A 3CIMA 4ZP7A 1Q1KA 3LP1B 1O0PA 2A6OA 4QR1A 3CJKA 2VOOA 1V3RA 2QA1A 3MM9A 4F04B 2RU3A 2VD3A 3PHEA 4RO0A 4L76A 2J0QD 1XBWA 1IM4A 1N4LA 4PPZA 5LJ3Y 4Q7AA 2BANA 4DPYA 1SKUB 4R0EA 1UWBA 3H5XA 4LVOP 3EVOA 1JNZB 3GQCA 2GGPB 4F0MA 3RAQA 1VOMA 3WHIA 4LFCJ 1KNZA 1YJRA 1PJ7A 1YJUA 1RLCL 4WIQA 4C7QA 4YQWA 3X1LB 2EEYA 2DD8S 3JSRA 1RT2A 4JI7F 1YJTA 2VV5A 2WW8A 4KV8B 3HHLD 5G0RA 3HM9A 2UXBJ 3UR0A 1N8RT 3TX0A 4ZJOA 2KM8B 3OFFA 1TAUA 5GADU 3WQPA 3IRWP 3DMJB 2DVIA 4K8RA 4NCGB 3W5XA 4LSZB 2E9RX 4NZ6A 3PW2A 2AJ4A 3CJ0A 4DG1A 3NWGA 3DM2B 3QT5A 4FVCA 2AU0A 5IWAJ 1FKOB 2E7XA 4AYBD 2N82B 1F9HA 4QCLA 1FKPA 4JOUA 2B9XA 4LREA 2CXEA 2ZH5A 4EBDA 4DQSA 3RJMB 4USIA 3T6JA 3MD1A 2O67A 1QVFR 3GP9A 1AUSL 1DTQB 1FRJA 1DZ5A 5ETQA 1R0CB 2ZJPQ 1U1OA 3BM7A 2UZAA 2ZD1B 4WYLA 2D3OR 4FXDA 2V8GA 5IT9Y 3M6UA 1FEHA 3FEXB 1S1TB 1KEKA 4UZCA 4JI4F 4IOAQ 3KDOA 4GRSA 5J2QA 4OX8A 2UXCF 1Y11A 5KFYA 1RT1B 4O3RA 2HFZA 5DDQC 1CBKA 3PVXA 2W9BB 2AJ1A 1Y4ZB 3CMAS 4RUAA 4WF9Q 3CJKB 2XQCA 1AYEA 4NE9C 5HP1B 1CG2A 4QW8A 1JLFB 3VV2B 3SCIE 3TEHB 2FVQA 3UCZP 1WKLA 1JLCA 1DHMA 2Y1JA 3PR5B 2JFKA 4DV6F 3C46A 1NRKA 5DQHA 4OL8A 1PIEA 1UP1A 4IO9Q 2E5LJ 2DHHA 2DJWA 4JV5J 2B0GA 1BMQB 3CO9A 4AXJA 4WYWA 2GX8A 2OLWA 1RHMB 2HS4A 1U1MA 4P2XA 3IR7B 1ZBTA 2DNYA 1GTEA 1JLQA 1NDCA 4MFBB 1KP6A 1Q4RA 2QV6A 2GMLA 3CJQA 4KGXB 1GT8A 4WPAA 3TA0A 4F50A 3CD0A 5FJ4A 3BKUA 4MK8A 2K1RB 3K2YA 4ZLLA 4ED7A 1U1KA 1HI0P 4NA3A 1JNRB 1GTHA 2XMTA 2FUG9 4I1TA 4DSIA 2MZRA 1OQ6A 3S6EA 2A2DA 6FD1A 3AXMA 3H25A 4EZ9A 1F3VA 3IG1B 2QL9B 1VIOA 5DS7A 1H3DA 1Y10A 3DRRA 3R97A 2K06A 4DOZA 4RWWA 2C3OA 3ISNC 3KK1B 2RH3A 2VFVA 1FD2A 5C42B 1KVKA 1ZM2A 2G4BA 3CJ4A 4BCAA 2WSCC 1PYSB 2ZOMA 2J0WA 3UVJB 2ZNYA 3K5LA 1UFKA 3ZNUA 4PYAA 4OI1A 3H4DA 3CDBA 2EC2A 1DY3A 5HL7Q 1AROP 1A6LA 1JJ2R 2AGQA 5DG7A 3TUZC 3QRRA 3HJVA 3R5CA 3TAQA 4X4OA 3VAHA 2KTQA 2YWHA 2O66A 3G96A 2XS5A 1B70B 2N4CA 3FSXA 1YGYA 4DV3F 5L1LA 1S5ZA 2AMCB 3M2UB 5KFZA 3UN5A 5HVHA 4BHQA 4NXNJ 1FJCA 2GJ2A 1KONA 3D6HB 4WK1A 4X4RA 2YNGB 2CAJA 4DV2F 3RB4A 1HWJA 2MQNA 2Z2LA 5KG1A 3TO8A 4CLFA 3NBPA 3VWSA 2XCAA 2Z0GA 4YB7A 1M1KT 2XSFA 3T5HA 2HHHJ 3NCPA 3CULA 5IV3A 2HVIA 2UVRA 5D0HA 2HWTA 3DCAA 1WF1A 2XCPA 2J76E 5L9XA 3R2DJ 4ZCLA 4LSLB 2GQ2A 2RJZA 4OJ3A 4KHMA 3BO2A 1RT6B 1QE1A 3V4IB 2CNNB 4LIRA 1UZHA 2XNRA 1LWCA 1QJHA 3OFGA 1HQEA 4MKAA 4EO6A 2Q3PA 2QMUB 5LOQA 1RT7B 1RAHB 3JSBA 3TVKA 4U7UD 1F60B 3I82A 4HTIA 1KRPA 5ETNA 5HP1A 2KM8C 1RAFB 2CPYA 4HH1A 2E9TA 3BGOP 5A2QU 2X3DA 2XWYA 4ZP6A 2W9BA 1NAQA 4DR6J 3M05A 3MGJA 5E33A 3MM5B 3JB9k 1V6HA 6FDRA 3AJ1A 4WFNQ 1XTZA 2IPOB 2ADBA 4PEOA 3D3BJ 5KFHA 1HYSB 2ALYB 2VG6A 2RRBA 3CCWA 3H90A 3OXLA 4FS2A 3PX0A 1UA0A 3C19A 4EGLA 3NG8A 5AE3A 2BMBA 1C0TA 2OHDA 1DBDA 5CZXA 1YSJA 2NLWA 2V8HA 3ETOA 3NS5A 1N32F 5HLFB 2XULA 1TL7A 1X5OA 1MU2A 4JP8A 1SKSA 1HBOA 5C25B 4LRCA 1IBKJ 2C2RA 4J9OA 3ISZA 3ZFVA 1NJYA 3MEKA 1IR0A 1U7LA 5KFOA 2D1CA 3H59A 3HVRA 3C15A 5A0YA 3F44A 4ZLJA 5IV4A 4ELTA 3QJPA 1G2EA 1X31C 2EWHA 1XIQA 4FNIA 3K58A 3D54A 4ECUA 2FJAB 1WG4A 3EVWA 4RX6A 4DR5F 4RW8B 1RADB 1TFWA 3ET6A 2ILZA 3DOMA 4KAIA 3WDOA 3TUPA 4BC9A 4ZCKA 3DLGA 3BKFA 4WTOB 3WX4A 4AUKA 2J9DE 4Q45A 1JXEA 1Y0HA 3IWXA 3EWGA 4Q8FA 2YBVA 4OI6A 2AF6A 1R89A 3DLJA 2YKMA 3H2VE 4Y34A 5BR8J 4RU9A 3T1YJ 4KTQA 4LFBJ 2MKIA 4RW4B 3EICA 1SQFA 3EMTA 4URSA 1RACB 5EX3A 3WC0A 3MWBA 1UWBB 4KH0B 2YWGA 2G9OA 2H5EA 2R2RA 2DT9A 2WVFA 5THWA 4MKYA 2HHPA 4LMZA 3CTRA 5IXUA 4J9VA 1RHQB 2QFJA 4I2PA 2B9EA 2BKPA 2F1FA 3D0IE 3MM8A 3MUVP 1L3VA 4QWDA 1Y3KA 2ASYA 2HFVA 4JI3J 4X4UA 3E01B 4OV6A 3BH6B 3Q8RB 4ZVTB 3K5MA 3RRHA 1SQGA 1RT3B 4DR4J 5A76A 4IG3A 3Q83A 2FYXA 2CVIA 4IH5A 4TVAB 4IFYB 4J9MA 2V2ZA 5D15A 2GVZA 3D7SB 3FBEA 3OW2R 4QU7A 2XWXA 4OYIA 2WOMA 3H8YA 3OQ2A 3VQTA 3OHAA 1U1PA 1RWVB 5E0OA 3ZZOA 2F8MA 2W9AA 4K4UA 2OMLA 3MDFA 5J2MB 4LRDA 3J81j 3N4WA 3C3LA 4RBUA 3J7Z5 3FEZA 3W66A 2HAFA 1NK8A 5D3GB 3JQKA 2KG1A 3BKTA 4IFVB 5F8IA 4U7CA 3AB2B 2M70A 3IN5A
chains in the Genus database with same CATH topology
2UUAF 2GO9A 1IKVB 2K7JA 1IKYB 5GADI 3I5CA 3CB4A 4Y2CA 4UY8T 4C9DA 3VZIA 1UA1A 2VODA 2AYEA 3JSMA 3PO5A 2Y1RI 3EGZA 3T5KA 3HJFA 1DTTA 2OPSB 3SSRA 2QSWA 1VHFA 3HHDA 3PO4A 1S1VB 2VBYA 2FGOA 3L7OA 3M2VB 4Y34A 1YJWS 4QOTA 2LXUA 4F26A 1ZZNA 4AFFA 1IKYA 2HVZA 2D3ZA 3PFOA 2DGUA 3BS9A 1KC8T 3A8EA 4TY9A 5HMWA 4X64F 1FRHA 4ILLA 4I2QB 3KLVA 3BEGB 4G1IA 2EI5A 4HHJA 4USJC 5K5MA 5KFXA 1D9DA 4B9TA 2DISA 1S1VA 2VC1A 3M2VA 5G4DA 4PXBA 2R8GA 4RNFA 3DYAB 1HR0F 1M5OC 3HO1A 3KFWX 2FIUA 4IOBA 4U6PA 2OPPB 2K2PA 1WD6A 2E9ZA 3IWLA 2VBWA 2DNMA 2IM2A 4PCQA 2HRUA 3Q8PB 1OIAA 3M9MB 1XMBA 2J8AA 3FFIB 3H5UA 3HFKA 1T03B 4IDKA 1D8ZA 5E2QA 4ZPWR 1Y5IB 2FVCA 2W7AA 2HIQA 4MIAA 1BWEA 2QA4G 2EBEA 3IRXB 1GX6A 4N5SA 1BD6A 1VQ7S 1K0TA 3O6QA 3ZZZA 1VLYA 5LXYA 2V5HG 4OHZA 2GJIA 5J2NA 1RT1A 5F3ZA 2DNZA 3M2RA 1AUDA 3V4MA 2EFQA 2ZE2A 2LCWA 4Q44A 3D1OA 3MCSA 4WFXA 3DRSA 4G1PA 3CJ2A 2CQPA 4GMKA 1EETB 3HPOA 1J5OB 4DSEA 3E01A 3SFGA 2X1FA 4A47A 2LYVA 3SEOA 1S1WB 2JOQA 3UQSA 2ZZMA 4QBUA 2KZMA 1VQPS 1S6PA 1SKRA 5KFIA 2WK4A 3O5TB 4QPXA 1N5YB 1J5OA 5BYRA 1IXKA 3FZ2A 1EETA 2IVYA 4P6QA 3OJSA 1C4AA 2A1BA 2FDNA 4DL4A 3EYZA 3BB5A 1C1BA 3Q2SC 3FGVA 2HGMA 1ZETA 2E44A 1EP4A 2IBOA 1X0FA 2IMOA 4URGA 3HP6A 2E5LF 4R5PA 1HHSA 2K3KA 4M95A 2NPIA 1MMNA 2QMXA 1UW4A 1C0TB 2XMJA 4J9NA 1NK9A 4V19J 3GG1A 4MK9A 1SIZA 3R1HA 5CYQA 2LECA 3T1HF 4TQSA 2JEIA 4JV2A 3MECA 3MEEA 4NLSA 3GE9A 5KFDA 3UCUP 1HMVB 1KHVA 1HWIA 2OH2A 3MMBA 1C0UB 1IJFB 3M32A 4QIWD 5D4PA 3U7JA 2VA2A 4ECYA 2NPFA 2JHEA 1DJ0A 2D9OA 1SL1A 1L3KA 1T7PA 3IO1A 1KQFB 2OFGX 1ZOTA 3MD3A 1S97A 3FMBA 4FXVA 1RAJA 2I2YA 3NMAA 2BRKA 1BQNA 4I6YA 4OI4A 4FPRA 4A48A 1RTDB 4PXEA 4EWTA 2RD5C 1KFSA 1B0PA 2B4PA 2FJVA 2J7KA 2OPPA 2Q6BA 2Y0SD 3RU0A 1NJIT 5IWAF 2IRUA 4MAKA 1N33F 2W4PA 4LQ3A 3QGPA 1FDDA 4XDCA 2W7PA 2W8KA 5EWEA 3MFHA 5CQGA 4ID5B 4QWBA 1FK9B 2PC6A 5D78A 1VQLS 4UUXA 1T8