3DRRB

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 106
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrB04
4Q8FA 2D3ZA 2I5JA 3MEDB 1RAJA 2RF2B 3RB0A 2I5JB 1WNEA 1JLBA 2R2RA 2OH2A 4EO6A 4RW8A 2FVRA 3NL0A 2B6AA 1S0OA 3OSNA 4J9MA 5F8NA 3ISND 2B6AB 3KLIB 4I2QA 4O44B 3N6LA 3NAIA 4EYHB 3SFUA 2R8GA 4IG0A 5KFPA 3OL8A 3IS9A 5KFOA 4IG0B 2QE5A 3M9MB 2W8LA 3I5BA 4KO0A 4KB7A 5DG7A 1SH0A 3LP2A 5KFYA 4KV8A 1S1UA 5F9NA 5KG6A 5EWGA 3V4IA 2FJWA 4KV8B 1C0TB 4TY9A 1S9GB 4DL5A 2CJQA 4WFZA 1SV5B 2ALZA 2GC8A 4ZP9A 1JXLA 2FLPA 1T03B 4JUZA 5KFSA 1RTDB 1S0MA 4F4ZA 2UVUA 5KG2A 3GIKA 2AU0A 4Q8EA 3KLFA 1LW0B 2HNYB 3UQSA 1REVA 3JSMB 5DQHA 1ZTTA 2E9RX 4O4GA 1REVB 3H5UA 4TQSA 3G86A 4O4GB 4ED2A 2ASJA 1IKVA 4K50A 1FKOA 1S1VB 4IG3A 2VG5A 5EWEA 1FKOB 3I0RA 5HLFA 3HVWA 1S6QB 4Q0BA 3BSAA 3BSCA 2WOMA 3I0RB 5HLFB 3E51A 2J6UA 3ICLA 4ECZA 4PUOB 3KK3A 1QE1B 2CKWA 1W25A 4QWEA 4IR9A 1IKXB 3KK3B 5L9XA 4FS1A 2V4RA 1RYRA 5DG8A 4NYZA 2IM3A 3MR6A 2J6SA 3CDUA 2XCAA 4ECVA 3OHAA 5KFEA 4QW8A 3PW0A 2AWZA 4RW4A 4IH5A 3UDLA 3Q8PB 4O3NA 4RW4B 1T05B 5F8HA 3OHBA 5KFBA 4B3OB 2AGQA 1RA6A 2AGOA 1QAJA 5KFJA 3GIIA 3BQ0A 4WYWA 2BRLA 4Y34A 1DTTA 2JC1A 1UWBB 3KK1A 4JV1A 2IAJA 2IC3A 1RTIA 2HWHA 3CDEA 4WFYA 2ASLA 1KLMB 5J2QA 4M95A 3GV5B 4NLVA 3MFHA 4I2PB 5C24A 5KG5A 5J2QB 4NCGA 3LP1A 1YVFA 3V6HA 2OPSB 1RT7B 4J9KA 4NCGB 5KFHA 4LQ3A 5C42A 3CJ0A 2R8HA 4K4VA 1RT5A 5C42B 1LWEA 4RW7A 4RNNA 4WE1B 3H5XA 2HWIA 1LWEB 1TV6A 5KFFA 2E9ZA 3CO9A 4ECUA 3KMQA 5KG3A 1D0EA 3I5AA 4KSEB 3QZ8A 1FKPB 1N4LA 2BQUA 4YP3A 5C5JA 2FJXA 2YNGA 3H98A 2UUTA 1N6QB 4QWBA 2YNGB 4PQUB 2WK4A 4KE5A 3KHRA 1LWFB 1S6PB 4ED6A 3IRXA 2D3UA 5KG1A 5KG0A 2UVVA 2YNFA 5HP1A 2VG7A 2ILZA 3PVXA 5HP1B 1S9EA 2R8IA 4O3SA 1DLOA 2VG7B 4IFVA 4ECYA 5DLFA 1S9EB 4YMEA 5J2MA 1DLOB 4IFVB 3DRSA 3FQLA 3VQSA 5J2MB 3QZ7A 3DRSB 2ZE2B 2R8KA 3V81A 1HNIA 1S4FA 4J9OA 1BQNB 3HVTA 4RW6A 4WXWA 5L1IA 3HVTB 4RW6B 2HMIB 3DM2A 3DI6A 3KLHA 1S1TA 4NLOA 3T5KA 5F8MA 2DPIA 3DI6B 3KLHB 3T1AA 1VRUA 3DLGA 2XI3A 5DQGA 2HAIA 1VRUB 3DLGB 2WTFA 2WONA 4R5PA 2WRMA 3QGHA 2W9BB 3QGIA 1JLFB 3PW7A 2D41A 4TLRA 2BANA 2WB4A 3GQCA 3KHHA 4ZHRB 3GYNA 1LWCB 4ZPAA 2W9CA 3BSOA 1S1XA 1C1CB 1VRTB 2VA3A 1KHWA 2FLNA 4RNMA 5EUHA 3MF5A 1N56A 3MEGA 1RT2B 4ED0A 2JLEA 1RT4B 3TQ1A 2IA6A 1S97A 4F50A 3MEDA 4O3PA 2C28A 4HYKA 4EBCA 2RF2A 4ZVFA 1TL1B 1C0UA 4ZVEA 2XCPA 3H5YA 4Q44A 2BQ3A 1C0UB 3PR5B 3KLVA 1RTHB 4R0EA 3G6YA 4KHRA 4LSNB 3UPFA 2EC0A 3M8PA 3LALA 1XR5A 3BQ1A 2IJFA 3M8PB 4ZVGA 3KLIA 4O44A 3PR4A 2XI2A 3EPGA 1RT6A 5KT5A 4NLQA 4ED3A 4YR2A 1RT6B 3MEEA 4ECQA 1IM4A 4MKAA 1TKXB 3MEEB 1JLGA 1NHVA 3JYTB 2FVSA 2IM2A 2XC9A 1JLGB 1JLEA 1C0TA 1HPZA 5J2NA 4Q43A 4KFBB 3KLEB 1JLEB 1HPZB 1S9GA 5J2NB 3EZUA 3OLAA 3I0SA 1ZETA 4DL7A 3I0SB 4QWCA 4K4YA 1SV5A 3RB3A 1S0NA 2OPRA 4LQ9A 3OL9A 3RBDA 2OPRB 1T03A 5F8IA 1RTDA 2GIRA 5KFLA 4ED7A 1HQUB 3C6UB 1R0AA 1DTQA 1LW0A 2HNYA 4MK8A 1R0AB 3FFIB 1IKWB 1DTQB 1MU2A 3DRPB 2YKMA 3MR5A 4ED1A 3JSMA 1J5OB 3RB4A 1MU2B 4NLGA 2YKMB 4K4ZA 4ED8A 5L1JA 5DGAA 1S1VA 2F8EX 4JV0A 4IDKA 1S6QA 1N5YA 3TVKA 3PW2A 2IM0A 4Y2AA 4IDKB 1SUQB 1N5YB 4FBUA 4PUOA 1S1WB 1QE1A 4NLDA 3H2LA 1IKXA 3KOAA 4J9QA 3CJ3A 3CVKA 4ZMMA 4WZQA 4KAIA 2O5DA 5T14A 3MECA 4K4WA 4X2BA 2XGPA 2ILYA 3PZPA 3MECB 3KJVB 4TY8B 2R8JA 2BRKA 5F8JA 1T05A 2HNDA 1Z4UA 4ZP6A 3ITHB 4B3OA 2HNDB 5K14A 3BJYA 3DOKA 5F8LA 3BR9A 4DL4A 2AQ4A 3DLKA 5K14B 2BQRA 3DOKB 4IR1A 3DLKB 1C1BB 3H40A 1UWBA 2B5JB 1S48A 4R8UB 1ZTWA 4XPEA 5J2PB 2YNIB 2WHOA 1KLMA 3T5HA 1BQMA 4I2PA 1HYSA 3NGDA 2VA2A 1BQMB 4IOBA 1U09A 3QLHA 2OPSA 2YNHA 3DMJB 1RT7A 2FJVA 1HYSB 5KT3A 3H4BA 3QLHB 1TVRB 2YNHB 5DQIA 3MR3A 4URSA 5KT4A 5EWFA 4K4XA 4OL8A 3CIZA 4ZVHA 4WE1A 1HNVB 1JKHA 4KKOA 2DPJA 2JEIA 4IFYB 1JKHB 4KKOB 3T19A 2WCXA 3RB6A 1FKPA 2IMWP 4URQU 1N48A 4TXSA 1N6QA 2FVQA 4DL2A 4PQUA 5KFWA 1TQLA 1K1QA 1LWFA 1S6PA 4Y2CA 1RTJB 3LAMA 1JLCA 3T5JA 4IQXA 4U7CA 5L1LA 2IM1A 1JLCB 2V4QA 3H5SA 4KBIA 5FDLB 5KFZA 4DL6A 1JLAB 4NLRA 3Q8SB 2JC0A 4QPXA 4NZ0A 3KNAA 2ZE2A 4ZP7A 3LP0A 3LANA 4DEZA 5KFNA 4RNHA 4FS2A 3LP0B 5F8GA 1BQNA 1RT1A 2C2RA 2IBKA 4IH7A 1RT1B 3IGVA 3V6JA 1HMVB 2HMIA 4TYAA 1XR6A 3E01A 4TQRA 2JEFA 4NLSA 3E01B 1FK9A 1TKTB 2R2SA 4LSLB 4F4YA 1FK9B 4DL3A 2W8KA 2OPQA 2OPPA 2W9BA 3QYYA 1JLFA 4J9SA 2OPQB 2OPPB 4DG1B 4M94A 4O3OA 4ZHRA 4QWAA 1LWCA 5HBMA 5C25A 1C1CA 1VRTA 5HBMB 2W9AA 3QO9A 1CSJA 5C25B 4MKBA 4H4OB 4IH6A 3GV8B 1NHUA 3QO9B 1QAIA 3NBPA 4G1QA 1T3NA 1RT2A 4I7FB 1RT4A 2BE2B 3DRRA 3NBPB 4G1QB 1QUVA 3FDSA 5KT2A 5L1KA 2ATLA 3DRRB 1D1UA 3CJ5A 3BSNA 4K4UA 1TL1A 4XO0A 1RA7A 4EO8A 5HROB 1RTHA 4KHMA 5KFMA 3Q8RB 4LSNA 3FSIA 4IKAA 4NLWA 4EYIB 2FVCA 4RW9B 5KFKA 2UUWA 4O4RA 3D5MA 4EEYA 4ID5A 4WZMA 3NAHA 4ID5B 4YR0A 2AX0A 4J9PA 1KHVA 1TKXA 2I1RA 1NNDA 5CYQB 3H59A 3JYTA 5CYMA 3QGGA 3PHEA 3OL7A 1SH3A 2B43A 4J9NA 3DDKA 5CYMB 5F9LA 4G3IA 4KFBA 1RT3A 3KLEA 3NMAA 3OSPA 1RT3B 4IRDA 3IGNA 3ISNC 3V6DB 2V9WA 5KFIA 5KFUA 2BR0A 3MTKA 2XGQA 5KG4A 3NKYA 1XR7A 3DLEA 3DLEB 1HARA 1HQUA 3KHGA 3CWJA 3C6UA 4GC7A 1JLBB 3SI8A 4MFBA 3RBEA 5DG9A 4ECRA 4RW8B 3FFIA 4MFBB 1IKWA 3DRPA 2ASDA 2JEGA 3KK2A 3SFGA 4TYBA 1J5OA 3G6XA 3KK2B 4IRCA 3C6TA 5KFTA 1MMLA 1OS5A 4I2QB 5DLGA 3KLGA 4K4SA 3C6TB 2E9TA 3KLGB 3QIDA 4Q45A 1RYSA 3IS9B 2FLLA 2ZKUA 4KO0B 2VG6A 3D28A 3IG1A 3LP2B 1SUQA 4ECXA 1S1UB 1JIHA 3G6VA 2VG6B 1S1WA 3IG1B 3V4IB 3KHLA 2C2DA 2RKIA 3I5CA 5KFXA 2RKIB 4ZPDA 3CJ2A 4EBDA 2AX1A 3PW4A 4RUCA 3KJVA 3N6MA 4TY8A 5JXSA 3GIMA 4NLUA 2ZD1A 3ITHA 3KLFB 2ZD1B 1HQEA 4U6PA 3M9NB 3BQ2A 1HQEB 3Q8QB 5KT6A 5DGBA 2RDJA 1C1BA 4ECSA 2D7SA 3GILA 2B5JA 3QIPA 1IKVB 4R8UA 3QIPB 2VG5B 4IG3B 5J2PA 2YNIA 5JUMA 4YQWA 4Q0BB 4RU9A 3DYAA 2WOMB 4WFXA 5KG7A 3DYAB 3HKWA 4F4WA 5KFCA 3DMJA 4O3RA 1TVRA 2JEJA 4RNOA 4YR3A 1IKYA 3T5LA 2UVWA 1IKYB 1S10A 1RDRA 1HNVA 2C22A 4IFYA 4ECTA 4NRUA 4TN2A 1EP4A 4ZP8A 4PWDA 1EP4B 3M9OB 4FBTA 3IN5A 4QW9A 4PWDB 4NLXA 3KMSA 1DTTB 3FQKA 3LAKA 2J6TA 4ZPBA 1RTJA 3KK1B 2UVRA 2AGPA 4IRKA 2IAJB 2IC3B 5I42A 1RTIB 3HHKA 2R2UA 5I42B 1S49A 4H54A 4HKQA 1GX5A 2R2TA 4URGA 5FDLA 3RAQA 1JLAA 5C24B 2V0NA 2FVPA 3LP1B 4H4MA 5KFRA 2QV6A 4ZPCA 2HNZA 4H4MB 1TP7A 2HNZB 3PJWA 4WYLA 3EPIA 5KFAA 1RT5B 4RW7B 1TV6B 1HMVA 4GC6A 1LW2A 3HVAA 4QWDA 1LW2B 2C2EA 1TKTA 4J9LA 4LSLA 4MIAA 2XWYA 5KT7A 4Y3CA 4JV2A 2W7OA 3DOLA 4DG1A 3N6NA 4NLPA 3DOLB 3IRXB 5J1EA 2RDIA 5KFVA 4J9RA 1K1SA 3V6DA 5J1EB 2YNFB 1TL3A 4RNFA 2YKNA 4H4OA 4NLYA 3MFIA 3MR2A 1TL3B 3OL6A 2YKNB 5EDWA 4I7FA 2BE2A 2GIQA 3OLBA 3PJXA 3V6KA 4K4TA 4RUAA 4MIBA 5KFGA 2IJNA 4ECWA 3V81B 1HNIB 1SH2A 3RAXA 5HROA 3M8QA 3BREA 2W7PA 4ICLA 3M8QB 4WXOA 3CJ4A 5I3UA 3GV7B 4ICLB 4NLTA 3DM2B 3TAMA 5I3UB 1GX6A 1S1TB 3GIJA 4RW9A 3TAMB 1JLQA 4XPCA 1C2PA 1JLQB 3H4DA 4EBEA 3FRZA 3UR0A 2WONB 4R5PB 4MH8A 1S9FA 5CYQA 2BANB 3CDWA 3BGRA 1T94A 5KFQA 5D3GA 5KFDA 4NRTA 1JX4A 1EETA 3BGRB 2W9CB 5D3GB 4MK7A 1S1XB 4MK9A 3PW5A 1EETB 4RZRA 1TKZA 4O3QA 4F4XA 1I6JA 1TKZB 3MEGB
chains in the Genus database with same CATH superfamily
3D7SB 2RF2B 2F7VA 1XNRF 2L9DA 1KQGB 1P1TA 3ISND 4I2QA 3TA1A 4IG0A 3FEYB 3I5BA 1B7FA 1VQKS 3C46A 1FD8A 3QMQA 1SV5B 1FTCA 1S0MA 1T9XA 3DLBA 1YQHA 4ED4A 2CQ3A 3R7BB 1I5OB 1RYRA 3FBEA 2LKZA 2CJ9A 1SKRA 2BYCA 4NCAA 1T05B 3TARA 5HQLA 2CA9A 3RR8A 2CNLB 1NKCA 1SIZA 2KXHA 1OSDA 2IAJA 2ASLA 1KLMB 3N4WA 2GX8A 4RLEA 2QZ8A 2EW9A 3HF5A 2EFGA 1XEZA 3BO2A 1D0EA 2PI5A 1FKPB 4OYWA 4DL0C 2UUTA 2N7CA 3K89A 3MCMA 3CCTA 1DLOB 1RUSA 3Q89A 4N77A 3AA8A 2R8KA 1LEOA 1S4FA 1GAOA 2HMIB 5F8MA 2ZH4A 2DPIA 2WBRA 2EXUA 2W9BB 3KHHA 5G0RB 4DPTA 3B4DA 5C2GA 1N8RT 4LF8F 1RT4B 4F26A 4EBCA 2HQGA 2BQ3A 2R4FA 2KH9A 4P2FA 1OQ3A 4GVBA 2CJYB 5ETSA 4YR2A 4CRJA 2CQBA 3SSSA 4XDDA 1UVJA 1HPZB 1VJWA 3SEOA 2F63A 2EBGA 4MAKA 3I87A 1RTDA 2C3OA 3HP6A 1HQUB 1RQ0A 1T95A 1VIOA 1U49A 2B9XA 3RB4A 4X65J 1S1VA 3GJQB 2IM0A 1QE1A 3KYLA 3CJ3A 5GADI 2DR7A 2MKIA 2ZNYA 5H1SV 3UDCA 2M8HA 1PCAA 2QLFB 3GU0A 1ZTWA 3CIMA 3T6BA 3LF0A 2RUGA 2HBYB 2VA2A 2MHNA 2HVEA 2YQ1A 1S72S 3QLHB 1PBUA 4A48A 1FT8A 3W8GA 1CVJA 1FF2A 5LSOA 1Y9OA 4DL2A 2DNGA 3P45B 4ZJQA 4QPXA 3LANA 3TZYA 1YBUA 3R27A 4B9SA 4DQIA 3LOUA 2OPQA 4OV1A 3QT6A 1JLFA 3UD4P 4H4KC 4E0DA 2R3VA 3QO9B 2N4DA 2H1YA 3CJSA 1QUVA 2AGQA 1R0BG 3MUMP 1RA7A 4W90B 4NLWA 4CO1A 3A1YG 4P2MA 4DQSA 2EWHA 4CT8A 4ID5B 3FJ2A 2EPIA 5CYQB 3TOQA 3PHEA 3OL7A 1CQMA 1M5OC 5CYMB 4ETZA 2X7IA 4NYOA 1NU4A 1U02A 5IT0A 1HWLA 3KHGA 3C6UA 3MURP 1YSJA 4QOTA 1M5VC 1BWVA 5DLGA 3F41A 4ZLJA 5JVGQ 2VONA 1H2UX 2RKIA 3I5CA 4NZ6A 5IXUA 1VCTA 4TY8A 1NDCA 2VQEF 2G0JA 2VHGA 3PRVA 1C1BA 2UP1A 1EQMA 3T41A 2UXDF 3L7UA 2IVMA 5DS7A 4K59A 3C2PA 1V5VA 4ZP8A 4FXVA 3NGKA 3M9OB 4WP8A 5JVHQ 2VV5A 2HRTA 1HW9A 3MM9B 1RTIB 4HKQA 2HK2A 1O8BA 4BC9A 5B0EA 2AYBA 1JNZB 4RW7B 4DF8A 3D4JA 1H2TZ 2OMLA 4JV2A 1H7WA 2MEWA 5IQQA 3N6NA 2R7VA 3UI3A 2B9YA 1WKKA 1FJEB 2E66A 3B4MA 2B4PA 1XJWB 2QYGA 4BC7A 4X4OA 2PO4A 2AJFE 1SH2A 1OJ4A 5D4LA 2DR8A 3TAMA 5I3UB 5MLCV 2HSEB 4XPCA 2ZBRA 3TX8A 3UR0A 4ZCKA 5KFQA 4DV4F 2B0GA 2W9CB 1S4EA 3IR5B 3M6WA 4OX8A 3M05A 3IXQA 1WNEA 4WFAQ 2W01A 2E29A 3CDBA 1S0OA 1Y3JA 2B6AB 3NAIA 3SSRA 1TKDA 3ZNUA 4BHQA 2FJWA 4ZA1A 3O1LA 3SV4A 3QAUA 1IBKJ 1M1KT 1FERA 4I68A 2EFVA 5L39A 4Q8EA 5T41A 1CJTB 4ZK7M 2C1EB 1HW8A 1DJ0A 1NUEA 2DNOA 1X9MA 3MAAB 2Z2LA 3UE2A 1U8SA 4IOCQ 3TAQA 4A8FA 1QDUB 4A8SA 1RAHB 3HFVA 5D78A 4NI2A 4A8MP 1NB2A 3MPUB 3LUYA 4GO5X 3ONQA 3CCJS 3CJ0A 2QA4G 2HHXA 2KDOA 4UY8T 5I3PA 2BQUA 4YP3A 5C5JA 4XIUA 2C3YA 4GMKA 1LWFB 4YY3J 1Y4ZB 3SSQA 1ZBTA 1MN7A 4A8XA 1AZSB 3OXGA 3W5YA 4LFAJ 4ES1A 3KWMA 3DFEA 3KDOA 4L76A 4PEOA 2MKSA 2DNRA 4ZHRB 4DN9A 3HM9A 2ALYB 2JWNA 2CQGA 4LSNB 2KT2A 1LK7A 3TVZA 1SJRA 4NLQA 1YLXA 4JI7J 1YJ7A 2RDDA 4FNIA 3EZUA 4K4YA 1PIEA 3MMBB 1MU2A 1Q8BA 4PG7A 2W7AA 1J5OB 4NLGA 2HURA 3GB0A 3HHLC 2CJAA 2APOA 4FBUA 3GSIA 3G82B 1F2GA 4X4VA 3MECB 1GMWD 4Y6IA 1RACB 1NCLA 2FDNA 4D3GA 2VBXA 2B5JB 2DRBA 1S48A 2VDIA 3UN5A 1HYSA 3EVOA 3EZ5A 4HT5A 5DQIA 1IVZA 1F3VA 2FZKB 4DR7J 3DNCA 4DR5F 1UCNA 2AIRB 4KH1B 4TXSA 2KKHA 4LR9A 3BR8A 1QD1A 2MDAA 2GAHC 5K5MA 4DL6A 1UPPA 5ADZA 3BH7B 4DV1J 3S1TA 2XY5A 1NK8A 4OHVA 4LR7A 4NZ0A 1KVJA 2DY1A 3I9V9 3LP0B 2P8IA 4DJBA 1HMVB 4LFBF 3E01B 4DG1B 3EGNA 3W61A 2G2ZA 4G1QA 3POTA 2W4PA 4OV6A 1KTVA 1SQEA 5L9NA 2XZTB 4YHHJ 3CUNA 4JI2F 4L74A 2C3UA 1KHVA 4QZVB 1DQAA 2LU1A 4TYBA 1AROP 3CCMS 4K4SA 1MMLA 4P9SA 1I1GA 2VG6A 2KYZA 2VPXB 4ERDA 2AX1A 1S7HA 1HFEL 4UZBA 2QL9B 5LJ5Y 2IYIA 4I6WA 3JB9k 1IQTA 4B3MJ 1HNXJ 1YJTA 3QIPA 3HD2A 4DDFA 1EB0A 1F6TA 3KG1A 4AYBD 3BM7A 1KP6A 4FBTA 4PWDB 4KJIA 2MSSA 2EKYA 2BZ2A 2NS1B 2VODA 1S49A 4YFUA 2NPIA 2FZGB 4ITSA 3EPIA 2VFRA 3MD3A 1RT5B 1YJRA 4AFFA 5CHCB 3ET6B 2ATCB 4P2XA 2BEFA 4QR2A 3K8VA 2K06A 3GE9A 4IO1A 4F3QA 1TL3A 4CNZA 4AD6A 1L5UA 4X4SA 2ROGA 3PV8A 3AOAA 1H74A 2YWKA 3VCDA 2CZ4A 4HH0A 2RB7A 2PMZD 1M5PC 4MH8A 4A8YA 1S1XB 1HWIA 1S0VA 1EETB 1TKZA 1B70B 2M4MA 3LPYA 1EARA 2FJDB 2J0SD 3VAKA 1RAJA 4M5MA 2XM3A 2XLKA 1R27B 2OH2A 3SXLA 2OELA 3T9NA 2ZDPA 3AQOA 3W65A 2XMAA 4DPWA 3KLFA 2GQ2A 2HNYB 1RGVA 1TL5A 5B0AA 4NXNJ 3JSMB 4O4GB 1IKVA 3PHTA 4G65A 3IAS9 2V8PA 2XBPA 1W25A 2E1PA 1Y5NB 4LRAA 3NGSA 2VQFJ 2MZRA 5HMYA 1N52B 1U8WA 4KGKA 3W2WA 3G87A 2ZH2A 5DM6Q 3NCPA 3B54A 1N32F 3JSRA 5AXKA 3TUJC 4Y65A 4P7VA 3TUIC 5HANA 3H98A 4CM0A 3DGPB 1S6PB 5B08A 3RUBL 1Q5VA 3A8KA 5ETOA 1DLOA 2VG7B 4IFVB 3FQLA 2ZH7A 2FHJD 1IUJA 4ZPVR 1OQ6A 4UOCA 2LCWA 3FGVA 4NLOA 1E6YB 5DQGA 3OW2R 1FDBA 2WRMA 3EGZA 4P52A 5G0RA 3HHNB 3VGVA 1U47A 4OZ0A 2I6WA 2KZZA 4X4PA 3MEDA 3R3TA 1VK3A 3TJ9A 2KB2A 2RS2A 1C0UB 5BXIA 4LRCA 3BQ1A 1XK8A 4ZVGA 3GWCA 3EPGA 1KWMA 4USIA 1RT6B 2DY9A 3MEEB 4YN3B 2XC9A 1HPZA 2GFFA 3AHPA 4B3TF 4QWCA 5A8KB 4X4NA 3MCNA 4WIIA 4RBUA 2YKMB 1YJVA 3TVKA 4LF9J 4PUOA 2G2OA 3ELHA 2NR0A 1IKXA 3KOAA 1FRXA 2Q79A 1OSCA 2GGPB 2KG1A 3Q0AA 4OYXA 3I82A 4X62F 1UAWA 4OX6A 3W1YC 2DH9A 4IR1A 3DLKB 2G0IA 4DU8A 4LVNP 1X4AA 3CF5Q 3QLHA 1CJUB 1YJWS 4ZVUB 2WW8A 3R5BA 1JKHB 2BJ1A 4K5RA 3IWXA 4PR6A 2UU9J 1DAXA 4P10A 4NLRA 3GCWP 6FD1A 2CPEA 1X5OA 2N3OA 4LSLB 2FPHX 1HNWF 3BO4A 3AAWB 1L3KA 2UV8G 3OVSA 3QO9A 4MKBA 1R8HA 2DGQA 2JVRA 4DX6A 4K0KF 2QLXA 3MUTP 2DGSA 3W9HA 2XY7A 4LF7J 4D3HA 4RW9B 4ID5A 3OFFA 2DXEA 5IT9U 2J7WA 2Z57B 2MZQA 1NNDA 5CYMA 1BC6A 4MMOA 4QU6A 5LMNJ 1IBMF 3V6DB 3MTKA 4HHHA 2KL8A 3SFGA 1S6UA 4TU7A 4OI1A 3C6TB 2FQQB 3AOBA 3D67A 3HK2A 2OKQA 4ECXA 3AOCA 5KFXA 3ZZ0A 1FXLA 2ERRA 1K0TA 2DNNA 2H3EB 4WKYA 2ZM6J 5FLXY 2HHHJ 2ZD1B 3BQ2A 2UXCJ 3X1LB 1GMWA 1FDDA 4MT1A 2YNIA 4DSJA 1I94F 3PCOB 1TVRA 2JEJA 2LDYA 1IKYB 2ZBQA 1S10A 2CQIA 1VQPS 2RAQA 3PRBA 1SQFA 1UL3A 4L3NA 5HL7Q 4ZPBA 3T1HF 2Z56B 1FVQA 5I42B 4KGZB 2OJ3A 5A0YB 1QSLA 2V0NA 3EJMA 3EYZA 2FHOB 3C16B 4GC6A 1ROFA 4JB8B 2ZOMA 4H4OA 1N5QA 5DRKA 4ZS6A 2GVZA 2Z2YB 5M2UA 2W7PA 5I3UA 4F36A 1GX6A 2GHPA 1N5TA 1X9WA 1HR0F 4EBEA 2XG8A 1S9FA 2YWFA 1L3SA 2DCLA 2EG1A 3M32B 4MK7A 4CLSA 3JS9A 3WQPA 2ZOGA 1HKAA 4CYUB 2W4CA 3PX4A 2B6AA 2KVQE 5IM0A 1MMNA 2R8GA 4FZVA 3MMCB 4KV8B 4ZP9A 3N28A 1AA1B 3OT9A 1RADB 3AY0A 2OFHX 4AT1B 3HHLB 2QFJA 3CD6S 5AJ3F 3P5TL 5E3AA 3T9ZA 3I0RB 1U1PA 2IY5B 2AD9A 4IR9A 1AT1B 3PRDA 4HACB 1XC9A 1V6HA 2LXIA 4QCLA 1HWKA 2GVDA 3WX4A 4DSEA 4WYWA 4CH1A 4JI6F 4LUBA 4DR2J 1D9FA 1KDNA 2DNHA 1WELA 4DV3F 5KFHA 3DHXA 4RNNA 3AFGA 4KSEB 1IBLJ 3H0PA 1UP1A 3KJFB 3PEHA 2KM8C 1FWKA 2UVVA 1AZSA 4NOHA 2ZE2B 4DV7F 1VQ4S 2XO7A 4G6VB 3QFWA 4HVZA 2NZ4A 3VZIA 1N0VC 2WTFA 3QGHA 3QGIA 2B9EA 4ZITA 4USHA 3MPWA 1VQ9S 1H3DA 4HHUA 2CPIA 1PJ6A 4R0EA 4U67Q 2KFYA 3KLIA 2XI2A 4ED3A 9ATCB 3JYTB 3M8SA 2FVSA 8ATCB 3VAMA 2MPUA 1UJ4A 3R5CA 2M5YA 2MZ1A 2OPRB 1T03A 5CD4A 2J0XA 4CLYA 5KFLA 1D8ZA 1IR2A 1R0AB 4YB7A 1YX2A 2CVIA 3I31A 1S6QA 2K3IA 3NOGA 3HFZB 1VQOS 3MECA 2ILYA 2R8JA 1APSA 2JNJA 5E0OA 2HNDB 5L8RC 3DOKB 1BUXA 4IUFA 2OD4A 2FTRA 4R8UB 4O23A 3QSYB 4DR4J 3FVYA 2UUAJ 3SQOP 4IOBA 2OPSA 2OEKA 4OHXA 4MKVA 2QX0A 1X5TA 3BYPA 2NXEA 5ETVA 1HNVB 3KFWX 4KKOB 3QSIA 4ZLPA 1UTAA 2FZCB 3LAMA 4EK2A 5F0WA 1XMQJ 4WK3A 3EVWA 2OIHA 3QBCA 5BR8J 2ZVSA 3LP0A 4RNHA 2C2RA 4LBHA 3V6JA 1XR6A 3E01A 1RBAA 2JEFA 2FHJA 1SC3B 3EE3A 3UN2A 3O2IA 4RPFA 4U96A 3QWPA 4CLWA 3ULHA 1NHUA 5IC4B 1YWXA 4F4AA 4JI4J 1RJJA 3G2XA 4EO8A 5LMUJ 3CE8A 3J80U 1PO6A 4YR0A 2Q6CA 4DV6J 3BS9A 3JAMY 2JSXA 2JFDA 2ZOFA 4ILRA 1XR7A 2VFSA 1WWHA 2E9TA 2KJWA 3QIDA 2FLLA 3KDNA 1SUQA 4PG8A 4AQYJ 1Z2LA 3A8JA 2ZBIA 2W2MP 5IWAJ 4PXDA 2BW7A 1VR6A 3CTRA 3FCVA 1VQ7S 1X9SA 1UA1A 1IJEB 5DGBA 3WX8A 4JBCA 1S6OA 5D0RA 3JQJA 2LQJA 2AZ3A 4FDFA 2ZITA 3OUYB 4N47A 4F0MA 3OR1B 2ACMA 4A8QA 2MHEA 4PWDA 3FQKA 3LAKA 1J5EJ 1VBKA 1GX5A 1ZOTA 2E5JA 4U7UD 2QV6A 3GP9A 1R3NA 3ET6A 1TV6B 2JRSA 2GS8A 3D9BA 4JI5F 2ZBCA 4Y3CA 3SIPB 2E7WA 5GAGU 2O1PA 2WSFC 3OJUA 3P6YC 4RUAA 1DARA 1T0TV 1WTFA 4I4BA 1S7IA 2K3KA 3VAHA 2LQBA 4JI7F 3LPEA 4ICLB 2HHSA 1TELA 4OX9J 2BKOA 3H4DA 5KFDA 1EETA 1HBUB 2Z2ZA 4CLKA 4LREA 1RTZA 4DSKA 1X5PA 1JLBA 1RSCA 4RW8A 3HCXA 3FSXA 3D3BJ 2QA2A 2ZH6A 3LP2A 1RI7A 2MKHA 2HGNA 3FRYA 4WFZA 2RQMA 4OI6A 5KFSA 2BOAA 2L9WA 4O4GA 2BE9B 3GG1A 1XNRJ 3H5UA 1YJ9S 2KFNA 1SKSA 1FNXH 2KVIA 2CKWA 3D0GE 3FKBA 1CS4A 2HRUA 1V3RA 5F3ZA 3MI7X 2YPYA 1QAJA 3BQ0A 4DV1F 3HXMA 3ZNJ1 4B02A 2ROPA 3O6QA 4NLVA 4WU2A 3RBZA 1X4EA 1UVKA 4WE1B 1NZ8A 3L9ZA 3KJNB 2HWIA 2HQIA 2MQLA 5KG3A 1S59A 2DT9A 3CMES 4ZIVA 2IRXA 4A8KA 3GONA 4QWBA 3KHRA 2ZJPQ 5KG0A 1ZM4A 3CCLS 1QTMA 5IOLA 2VG7A 2LDIA 2R8IA 4IFVA 5K8MA 1RAFB 4YHHF 3WC2A 1P27B 4RW6B 1S1TA 1WC4A 4Q2MA 2KFZA 1Y10A 2QEXS 2XI3A 2FJBB 2I9SA 1OYEA 3K57A 3DRYA 4RNMA 2JLEA 4CTAA 2YWHA 1C0UA 2LA4A 1U2CA 1RT6A 3MEEA 1NHVA 2CRLA 3PIOQ 5J2NB 5A8KA 4UUWA 4AL7A 1WC5A 1HNXF 1BE4A 3DC2A 1KQFB 3BEGB 4LF8J 3BYRA 4MK8A 3I56S 2DK2A 2YKMA 2LECA 3O44A 3WZ0A 4DPUA 4Y2AA 3Q24A 2MLYA 3IMQJ 5B0CA 2GGPA 4IQMA 1BXNA 2XGPA 3UN3A 1S5ZA 1NK6A 3DLKA 2NREA 2PA3A 5U47A 4DI6A 5IFMA 4NA1A 5B0GA 1WHXA 1F60B 1UEUA 1VYAA 2MQ8A 3MM6B 3TWZA 1BQMB 1FA0A 1GMVA 3GJTB 2D3O1 3AB4B 1MMDA 1VHFA 1CJUA 1T8EA 1JKHA 1IM6A 2Z58B 4F7VA 2PFFB 3ETOA 1N6QA 1RWKB 4C8KA 3QRRA 5KFZA 4KR0B 3MCOA 3Q8SB 4TNOA 3M8YA 2VFVA 3TJ8A 1HI1A 2IBKA 1RT1B 2K7KA 2K8GA 2F4VF 2CQCA 2JOQA 5SZTA 2E7XA 1DRZA 2IBOA 1FRIA 1UFKA 5KT2A 2CQPA 3US5A 2AEFA 4F4KA 4WBFA 4IKAA 2X51A 1O5JA 2I1RA 3CO0P 5F9LA 2G1HA 3NMAA 4Y28C 5HSPA 2BA9A 2DO0A 4C8OA 1YBTA 1RHQB 4N41A 1CPZA 3C6TA 4I2QB 4UUXA 2VQFF 4DLEA 1R6VA 2LEAA 1P9QC 2BXJA 3IBCB 1WF2A 3LWMA 2V68A 2MKKA 4XAKA 3CULA 5EX3A 4NLUA 2GZOA 2ZD1A 1UVLA 4U6PA 1HQEB 2G2YA 3CJTA 2VC1A 3J7YI 4PCQA 4N76A 2NPFA 1BQXA 4GO7X 1ULRA 2Z30B 5CQGA 3OV7A 5DZ7A 4YR3A 1IKYA 2C22A 3K17A 3CDAA 2F5GA 4Y2IA 4F8RA 4USMA 5G4DA 2IAJB 5I42A 4DX7A 2VQEJ 5A0YA 3LW5C 3I32A 1JLAA 4ZPCA 5BYRA 2HFVA 3C16A 1Q7LB 2JX2A 1PYOB 3R7NB 2KM8B 2MMYA 2XWYA 4QIGA 2W7OA 1U24A 2VOOA 1KFSA 3W66A 3DN9A 1FX4A 1H6KX 5A6WA 4X66J 2BE2A 1WOOA 3V6KA 2XMMA 2IJNA 1TK0A 2QTWA 2IRUA 3M30B 2Y0BB 1JJ2R 2XS7A 3A3PB 2BKNA 3CDWA 3M32A 4C98A 4F02A 1FFWB 3HJVA 2RQ4A 5D15A 3EMTA 2XMUA 4CYUA 2I5JB 2GA7A 2R2RA 4FKXA 4PWUA 2EEYA 3EDRB 1YKWA 4BCAA 3C15A 4KO0A 4KV8A 2AYMA 1F5BA 2Q6BA 2ZFHA 4Y00A 3MDFA 1OPZA 1RTDB 3B78A 3FCHA 1F5CA 3GFHA 4PQAA 1S1VB 3W5ZA 3I0RA 5HQ8A 2AYGA 4B08A 3IR6B 1QE1B 5DG8A 4HACA 1KFDA 2MZTA 4RW4B 3M2VA 2UU9F 3V4MA 2ZHAA 2G0CA 2JC1A 3BB5A 3UCGA 3PEJA 3W9IA 3V6HA 1Q1KA 3THPA 1A6LA 2ZC4A 3DXSX 3OTDA 4OLPA 2GO9A 4DWIA 3QZ8A 3BO3A 4I56A 3JTPA 3THVA 3FSYA 3TQEA 4Z2XA 4O3SA 1QM9A 5DLFA 2HZVA 2YQ3A 1ZM3A 2I2YA 2AJ2A 1LXJA 1U1OA 2RRNA 4ZPWR 3AXMA 5GMDA 3CD0A 1IQZA 2M52A 1VRUB 4OZ1A 2PN6A 1JLFB 4HDHA 2BANA 3GQCA 3PG9A 5RUBA 4QIWD 4UTGA 3MEGA 4ED0A 1H38A 1OYDA 4ZVEA 4NCBA 2MZJA 4W98A 3TA0A 3UPFA 2HFZA 3EX7B 2RMLA 2B8QA 4LMZA 1C0TA 2RU3A 3R5GA 4F04B 2OPRA 2UUCJ 3RBDA 2VZ9A 3TUPA 3C6UB 1R0AA 5HMWA 2WSCC 4B9NA 2D1CA 2J9DA 2XMKA 1RAOA 2WVDA 5DO2A 4ZMMA 4BBYA 4TY8B 2HNDA 4LF4J 2ZWPA 3MHYA 3DOKA 3RAMA 2BABA 2I8EA 1C1BB 2RT3A 2Z8QA 3RW6A 4XPEA 2WHOA 2MY7A 1NDKA 1B0VA 3OPKA 3GTYX 1U09A 4YOEA 4URSA 3NMRA 2R7WA 1NSPA 4KKOA 3T19A 4NMLA 2LP4A 2IMWP 1RISA 2GJFA 5KFWA 4KHPJ 4Y2CA 3T5JA 5L1LA 2V4QA 2XMVA 3JTOA 1Y7PA 5ETKA 2M9KA 3KG4A 3KNAA 1TL7A 1VBYA 3DU6A 2HYIB 1SB6A 2ZUGA 2FIUA 1FK9B 4WK1A 2W8KA 2YWEA 2VJUA 2CQDA 3UNYA 1RHKB 1C1CA 1VBXA 4NEYA 1TL1A 1N5VA 1F1BB 2JH3A 1RTHA 4P73A 2RIJA 2MQQA 5KFKA 2UUWA 2EBEA 3RZAA 2CNKB 4KIAA 2VPZB 3K5PA 2R7TA 2IRYA 2HVZA 2DJWA 4IRDA 1QVFR 4DSFA 2G4BA 1F9EB 1QUPA 1GH8A 3S01A 1JMTA 4DPXA 3FFIA 1IKWA 1FRJA 5F41A 5DDPC 1JIHA 3KHLA 3TA2A 1CJVB 2HQ3A 2VKZG 2MKYA 2QMUB 5JXSA 3R8YA 1C4CA 4DR2F 4DQRA 1BGXT 4ECSA 4ZDNA 5J2PA 4YQWA 3DYAB 1AYEA 1WD6A 3OUYA 1T9TA 4ZVSB 4ZJOA 3EM1A 1O51A 1EP4B 4BWMA 2P6SA 2F40A 4TU8A 1RTJA 4URGA 4NI2B 1GQEA 1P9YA 3BKFA 4JYAJ 1AXQA 2W1BA 1TUVA 3M8RA 3L4BC 4J9VA 4JP8A 4QWDA 3AH6A 3HZGA 1MWYA 2RDIA 2YKQA 3OL6A 2YKNB 5HN0A 2C2KB 3OJSA 2GHWA 2DHSA 2V6AA 1FJ7A 4WIQA 4ICLA 5ETPA 4RUHA 1KOOA 2F1FA 2AW0A 1Y11A 2RQKA 1HBUA 1T94A 2FHMA 4RZRA 4DR6J 1I6JA 1Z1ZA 4RWXA 4WTOB 2OEMA 4C6AA 3R5DA 2A2DA 4DCPB 5HJYA 3FCWA 3R6GB 2LA6A 4G1PA 3NCQA 4JOUA 4ZLNA 2MLZA 1JQGA 1G1XA 2PMHA 2QE5A 3TZWA 1MG7A 4Y2MA 1VQMS 1V3SA 4OZJA 5KTQA 1REGX 2UVUA 4PRFA 2DITA 3Q2TC 5AXNA 1RK8A 1NK9A 3CD7A 1RHMB 2E9RX 3VV2B 3HVRA 3GMGA 2HHTA 3E51A 2J6UA 1OY6A 3D66A 1FESA 3ZC4A 3KK3B 4FS1A 2V4RA 4NYZA 3MR6A 3J7ZT 4LSZB 2CJKA 3OTOF 1HHSA 5F8HA 1RA6A 1XMQF 2DTJA 1S12A 3G96A 4WFBQ 3IAM9 1GEHA 2DO4A 2OUGA 5C24A 4YEAA 4FYWB 1KRPA 2OTJS 3W8PA 2E1CA 2DNZA 2B3TB 3IR7B 1YZ6A 4C3LA 2VC0A 5KOXA 4JI4F 4ED6A 3CMQA 5LMUF 2CAJA 3VQSA 3VGTA 1KN6A 3A3NB 1N32J 4RW6A 5L1IA 4YDDB 4YB1P 4P2SA 3BGOP 3GZ7A 1M0SA 2W2QP 4M5JA 4PKDB 2L9NA 1B7YB 4HYKA 2D9OA 1UFLA 3DXBA 3FK4A 2NUHA 1YJUA 4AQYF 2IJFA 3M8PB 4OYAA 5IWAF 3PKMA 2DR9A 5J2NA 4Q43A 4L6V3 2DH8A 5ETMA 3SCKE 1HD0A 1VC5A 2MKJA 2XZDB 4C97A 1WHVA 1TR0A 5BJRA 3H42A 4K4WA 4JI3F 2BRKA 5F8JA 4N7TA 1KD1T 1B0PA 4B3TJ 1LKZA 2FUG9 2BQRA 2RU9A 2AEMA 1UWBA 1WC3A 4RU2A 2UZAA 3MM6A 1BQMA 1KS2A 2FJVA 5KT3A 4OYIA 3W2VA 3CIZA 2JFKA 2DRAA 3QNWB 3F56A 3QT8A 1PC5A 4X62J 2OEJA 2DNLA 3WIVA 3M4XA 3PO5A 4JV5J 4ZP7A 4OX9F 2ZJRQ 4ANDA 5DETA 1RT1A 2C3PA 1GT8A 3TZZA 4IH7A 2BJ9A 1M1HA 1HBNB 3HMJG 4E8UA 2RQCA 1KBRA 3VALA 3D6HB 2IJRA 2XLJA 3UD3P 1WI6A 4L73A 2ZH8A 3DRRB 1IBCB 5E7OB 2QGFB 2O67A 3EXYA 2B4UA 2LEBA 2Z4PA 3H59A 5HAOA 4CP5A 1HNWJ 1TUGB 3IGNA 5KFIA 2DXFA 1GTHA 4KPYA 4P71A 3SI8A 4PZVA 4ECRA 4K0KJ 1IR0A 3NNHA 3KLGB 3HULA 3W62A 2A6MA 3I6PA 3ADAC 3IG1B 3GFYA 4OJHA 4PPDA 4QYZJ 1CULB 5C2CA 3ZTPA 4QR1A 2NSBA 4U95A 4RUCA 3GIMA 1XQIA 1WG5A 1R89A 1IBMJ 3KLFB 1HQEA 4FP9A 3F0NA 4FF3A 3GILA 1IKVB 3PYDA 4WWSA 1U6BA 4EFAC 3FEZA 4WFXA 3CC2S 3MAQA 3P8BB 3T5LA 1M5SA 1Y00A 3W2WB 1K73T 2YWGA 5LOQA 2PGCA 2E1RA 2FVPA 3C8YA 2CPXA 1GXUA 4WYLA 3BDPA 1I94J 3MPVA 3MD1A 1LW2B 4J9LA 3AQPA 1NPKA 3N0VA 1A7GE 3MR2A 5EDWA 1B3TA 3T1HJ 4C48A 2LFVA 5B7WA 3M30A 3W5XA 2AKWB 5H9EK 2OO4A 1CLFA 4YUDA 3A8IA 3RG6A 4C0OC 2YX7A 3TZXA 4DF4A 2I5JA 3MEDB 5HO4A 4ZN1A 2MTLA 3AJ2A 5DDQC 2BE7D 1UJ5A 5KFPA 1NJIT 2W8LA 5DG7A 4C7QA 1S1UA 1HR0J 3V4IA 5A8WA 5K9FA 5MAOA 2DXDA 2GC8A 4EZ9A 1IN0A 3PX6A 1VC6A 2DR5A 4DFJA 2OMOA 4TQSA 2RSQA 4ZCMA 3IM9A 1FKOB 2YKAA 2WOMA 3OTCA 4PUOB 3TR5A 1IKXB 5HQMA 2QL5B 5EX0A 1NK0A 4ECVA 4QW8A 1PGZA 4RW4A 2P5VA 5KFJA 4LVOP 4Z37A 1KTQA 2DNKA 1WSVA 3KK1A 3A3OB 5AJ3J 5GAHU 4RX6A 2J7KA 4USJC 3FEXB 1EKSA 2W2PP 3G8SA 2ZZTA 3BGUA 1RCOB 3IRXA 2SXLA 3PVXA 2RS8A 1HA1A 4JI6J 2RNEA 3DRSB 5J1PA 1P1LA 4LF5F 1HNIA 4USTA 4WXWA 2XYPB 4DV3J 2ZZMA 1KVKA 3F44A 1VRUA 4QYRA 3NCRA 2VU5A 3PW7A 1FE0A 2HBZB 1U1LA 4C3KA 4DV7J 3J7YU 4O44A 3GYXB 1R8AA 4AXJA 4CO0A 1PSDA 1IWAA 1U45A 3L95X 3GFXA 1SJ1A 4LQ9A 2YX4A 1RWOB 4C8LA 3NP5A 2MQNA 4ZCIA 5L1JA 4ZKAA 4IDKB 3JQKA 2YKOA 5I3QA 3BPSP 1PKUA 3PZPA 1EIYB 3PFOA 5CAAA 2HK3A 2JLFA 2E5LF 3BJYA 2AQ4A 5K14B 1RAAB 3W9JA 3WIUA 2YNIB 2CDQA 4LT6A 1B0TA 4LF1A 3BDEA 1GNKA 1RT7A 1TVRB 3UW1A 1D9AA 2ZH3A 5EWFA 5B0FA 4OL8A 3P3DA 2DPJA 5H9FJ 2F9JA 3ZTSA 4X66F 3ZTQA 1VJQA 1X4CA 2IM1A 2VDHA 2LVWA 3H5SA 2M88A 5LL6d 3NGTA 1TL4A 3LGMA 2GMJA 3N9UC 4EU0A 1FK9A 2R2SA 1NJWA 2HLTA 3H90A 3IA0A 3ILLA 5JJBA 4H4OB 5BYQA 1QAIA 1TAQA 2GVZB 2QG9B 5KFMA 5EGYA 3CXCR 1LQ9A 1SKWA 1H98A 4C8MA 1WC1A 1EQ0A 3QGGA 3KLEA 2V9WA 1TMMA 2WVFA 2XGQA 7AT1B 5DM7Q 4MFBB 4IRCA 5KFTA 3FNNA 3IBFB 5IM0B 4ID8A 3D6FB 3MEKA 3H7HB 1F9HA 3D28A 5AE3A 3G6VA 2EG2A 1CJVA 2BUNA 5IV4A 4OYBA 1FXRA 4CLTA 3ITHA 4C9DA 3U1LA 5ETTA 1WI8A 2HVHA 2EC2A 2RDJA 4S0MA 5JUMA 4XK8C 4RU9A 3DYAA 2R7OA 3HKWA 2RJZA 2FHKA 3RW7A 1T9VA 4LBPA 1EP4A 2XEXA 2GVDB 4ZVRB 4CLZA 5C7PA 4HT7A 1SJQA 1WACA 1FXDA 4CLLA 4OI3A 2CQ0A 5FDLA 1KLNA 2DNQA 2CPZA 4ZVPB 4A8OA 3CJKA 2OGUA 2HIYA 2VFTA 2MGZA 4NXMJ 1TKTA 4ZCLA 1K9MT 5KT7A 3MOJB 3GR1A 3BGFA 2EKNA 3M7VA 2YKNA 1RWVB 5KFGA 2Y8YA 2HBRB 2JDJA 2F65A 5GMKa 3CJ4A 2X1AA 3GV7B 3IO1A 4QJVA 2UUCF 2DNYA 4JI5J 2LLZA 5ITHA 3EICA 1SC1B 2WBMA 1ZM2A 3LTOA 2AHOB 1X0FA 3QJPA 3G6ES 4MKYA 2MSTA 4X64J 1N88A 1FE4A 1JXEA 3KLIB 3CPWR 3NNAA 2GO8A 3SFUA 2DHHA 1HBMB 5KFYA 1R0CB 4CO3A 5GAGI 2QYCA 4C11B 4LF4F 4DL5A 4B3RJ 4FKYA 1T03B 4UOFA 2M0GB 4OIXA 4C8ZA 2FYXA 5IS2A 1V3ZA 4OZLA 1REVB 1IR1A 3UNGC 3R2DJ 1HLWA 3K5MA 4A4JA 4X4QA 1S6QB 3KK3A 3D3CJ 3HSGA 2YH1A 2DYAA 4KHPF 2P9CA 4P72A 4J90A 3SDEA 1OWXA 4KRWA 3R5AA 2CPHA 4RO0A 4WTYA 4DR1J 2F4FA 3NWGA 5J2QB 2OPSB 4PG5A 1K8AT 1DURA 2NYIA 1SJ4P 3GPAA 4KE5A 4MYUA 1VOMA 4DCOB 3G4SS 5AE1A 3NRBA 2Y1RI 1RWMB 1U1QA 5A2QY 4QBUA 2K1RB 2RVJA 3T5KA 3HT0A 2QSFA 2EVZA 3DLGB 4R5PA 5FIIA 1UPMB 2QSWA 1DY3A 3MAHA 3FZ2A 3H5YA 1RXOB 4CO4A 1WUUA 5HI7A 3WHIA 4CLFA 4I0WA 4AL6A 1HD1A 3M8PA 3AJ1A 2BW2A 2OI2A 5CABA 3MR7A 4IO9Q 3OXFA 3VF0B 2FJEB 2GIRA 2R7SA 1LW0A 2CPJA 2QLBB 4K4ZA 1SL2A 2M8DB 1SUQB 2OFGX 2V50A 3S7RA 3PXGa 5DZ6A 4OHYA 2E5IA 4Z7YA 3SZ2A 4TLQA 1LFWA 4F3MA 2Q66A 3TJAA 5CYJA 4BS2A 4JYAF 5K8NA 1TZ0A 3T6JA 3NGDA 4LR8A 4OX7A 3H4BA 1VLYA 2R7RA 4PXCA 4URQU 2R7XA 1N48A 2CVEA 4PQUA 1QSYA 1Q16B 4FYXB 4M5LA 1PBAA 1QAYA 4KBIA 1ICEB 2H4YB 4M5NA 5F8GA 3PKYA 2GHVC 1HBNA 4B9VA 3BKTA 4DR6F 3DDIA 1FFGB 3Q86A 5D0EA 1VRTA 5HBMB 2J9DE 5C25B 4TVAB 5IV3A 4FXDA 3DRRA 3FDSA 3D1OA 4ETXA 5L1KA 2VB6A 2QJ3A 4B9MA 4XO0A 3W3SA 3D6TB 5K20B 2A6OA 3RTVA 4WZMA 2AJ4A 2J0QD 4USVA 2VOPA 2MB0B 2F4VJ 4PXBA 5E2QA 2BR0A 4QQBA 4KGXB 1NB7A 3PACA 3K5OA 1JLBB 4RW8B 4FF4A 1G3OA 3K5NA 3T1YF 4WJBA 3KLGA 2PIIA 2UXBF 4Q45A 4EZ6A 5LT5A 2LXUA 3IG1A 3LP2B 5K8OA 1CULA 3BKUA 1V9OA 2VPWB 4EBDA 2YXLA 3WDOA 4EWTA 1TTHB 3TNVA 1UETA 3FZBA 2N4CA 4DQQA 4WP9A 5KFCA 1IXKA 1CS4B 2DGXA 1IWGA 1YGYA 1HL6A 1U1NA 2DGOA 2A10A 4IRKA 2QLJB 3SQGA 2M70A 4LIRA 2M2BA 4RL1A 5D4NA 5KFAA 4UW2A 2QA1A 3Q2SC 5CCMA 1LW2A 1U48A 4EI2A 1Q53A 3C14A 5B09A 4DV5F 5F3TA 1VK8A 2PE8A 3OLBA 3O5TB 4OQJA 2QIFA 2DBBA 4IYQA 4ENOA 1S1TB 1C2PA 2ROEA 3HHDA 2XS5A 5HVFA 5LXRA 4X4TA 4P6QA 4Q8FA 4CTAB 1VDHA 4FXWA 3DKDA 4AUKA 2FVRA 4EYHB 2V8HA 2BJ3A 3I4HX 2JZ5A 1SI9A 2ALZA 4JUZA 1WDTA 3UQSA 5DQHA 2PT0A 2HZCA 4ED2A 2MYFA 1FKOA 4IG3A 1CG2A 5EWEA 4Q0BA 2ZKTA 3PM9A 4LJMA 4RR5A 1MNEA 1FEEA 3MPYA 1FX2A 4R0JA 2E5HA 4QYZK 7FDRA 3PW0A 2VASA 4OZ3A 3CB4A 2BJEA 1UW4A 3NS6A 3BPDA 3PY8A 4ELVA 2BRLA 4JV5F 3HSJA 1DTTA 1VHIA 2ABYA 2KTQA 1X4GA 4BLGA 2IC3A 1P6TA 2HWHA 4Z7CA 1XMOF 4KH0B 2YWWA 3U02A 4K4VA 4I64A 2V8VA 1LWEB 5KFFA 3OFEA 2FJXA 5HJXA 1N6QB 3TI0A 4KY3A 4CIOA 2VICA 2H65B 2HS3A 2YNFA 1S76D 2IVFB 5E33A 3VVTA 4OJ3A 3DRSA 2NUUG 4C0HA 2QC3A 3ZZUA 3DM2A 1UVMA 4NPOA 2WB4A 3QWUA 1DBDA 4ZPAA 3BSOA 3NXZA 2BKPA 3TQ1A 4WPAA 4FPIA 4F3OA 2DISA 1JLGB 4GKKJ 1X31C 3M2UB 2MXYA 1S9GA 3I0SB 3H2VE 2XHWA 3ENQA 1F5AA 2GW8A 4ED8A 2E1AA 2I38A 1I51B 1Q81T 3JAMU 4IDKA 3AXKA 2EFPA 3BN4A 1DHMA 3PX0A 3N5BA 9RUBA 5T14A 2COLA 5DDOC 1D9DA 3K8WA 2ZC3A 4B3OA 5K14A 2MQMA 3M6UA 5ETRA 1NM2A 2J9EA 2CXEA 3AA9A 4OFZA 4W4MA 2YVSA 5E3QA 5KT4A 4CLUA 3ZZPA 3CJQA 3T3FA 4USUA 3PDNA 3D68A 5B0DA 4IQXA 3Q8VA 1XNQF 1JLCB 4B9TA 1JLAB 3CCRS 4CZCA 3ILOA 1H7XA 3IGVA 8RUCA 2XWXA 2ADCA 4NA2A 2DGUA 4F4YA 3NS5A 1VQ5S 2OPPB 3I55S 1LWCA 3BF4A 1CSJA 2W9AA 3J7A1 2F8HA 4IH6A 2HG4A 1W2IA 1RT2A 2BE2B 2ATLA 8AT1B 3DRXA 3CJ5A 3V5RA 3MMJA 2AYEA 1PYSB 1JJHA 3H25A 2F3JA 4EYIB 2YQ0A 2CWKA 3MWBA 1TKXA 2DEIA 2VD3A 1XERA 3BZQA 3FBCA 5HK4A 1FFSB 1Q0NA 3CSKA 1SJFA 4GC7A 3ZZRA 4MFBA 2E1MC 3KNGA 3C15B 4KO0B 1FVSA 2XMWA 1NSAA 3KUHA 3MM5A 2XQCA 4DX8H 3Q8QB 1X4FA 2WSEC 2CQ4A 1WF1A 2CNNB 4KYZA 3DMJA 5IZHA 4C4WA 4OLOA 5LJ3Y 4ECTA 3IC1A 3M2VB 4RJVA 2DB1A 1FDNA 2UVRA 3KKFA 3HHKA 1VQNS 4OHZA 3TP2A 4N56A 1XMBA 3R7SB 2B8PA 2YTCA 2QA4S 1M5KC 5H9FK 3K5LA 2XSFA 3OQ2A 3LA0A 2AP6A 3X3UA 4RNFA 5L38A 4I7FA 5HROA 4WU3A 3L3CA 1VLOA 1Q5YA 4V19X 4ZJLA 1JLQB 3FRZA 4OZ5A 4DPYA 2BANB 1AUSL 4ILLA 1TAUA 1WTBA 3ZXWA 3MEGB 2D3ZA 2XNQA 4NL5A 4Q7AA 2X1BA 1HI8A 1RU2A 2J8SA 3DCAA 2JEIA 1HBMA 3M9MB 1C0TB 4C11A 4TY9A 2GMHA 2W24A 4L75A 1RCXB 4HHJA 4CH0S 3MMAA 2L3MA 3KUGA 1CJKB 1UVIA 4F4ZA 5KG2A 4DS4A 1MROB 3HT3A 1REVA 2RUSA 4NASA 2CPYA 2VG5A 2IDLA 3OTBA 1WEYA 4CH7A 1G2EA 3CDUA 2XCAA 1MLAA 3HSZA 4DXLA 1WOSA 4FYDA 2PFDA 1MW7A 3OHBA 2HLUA 4ANEA 2MY8A 4ZVOB 6AT1B 3R2CJ 3I4PA 2PEBA 3N79A 2VBYA 4WFYA 3ZZOA 5J2QA 5KG5A 3LP1A 1FRLA 2ZWOA 2V8DA 2LQ5A 3RU0A 1X8DA 2NSCA 1YDLA 2R8HA 5C42B 2H4WB 3H5XA 1VS3A 2ZBPA 1N34F 3I5AA 1UKUA 1PG5B 3OTOJ 3QJJA 2POKA 3VWSA 2BX6A 1H73A 4NYPA 1PAEX 3AD7C 1TL7B 3V81A 2UUBJ 4HR2A 2IIHA 1VFJA 2K1RA 2YX1A 2VBZA 3KLHB 2GIFA 3T1AA 1C4AA 3DLGA 4N8OA 2V63A 2IMOA 3NOCA 1C1CB 5HMXA 1N56A 1S97A 1RHUB 5D0GA 4KPCA 4F50A 1TL1B 1QLNA 2XCPA 1RTHB 2LXFA 4WFNQ 3PR4A 2BJ7A 1PJ5A 4IOAQ 2HVDA 3EGVA 1IM4A 4MKAA 3PFEA 1DFDA 1UZDA 1NKBA 3WBZA 2HGLA 1N33J 1R31A 4M63A 3FFIB 1IKWB 4ED1A 3GLJA 4J37A 4OJ1A 1NSQA 3TEHB 4HI1A 2XYGB 2PC6A 1N5YB 4MTPA 3H2LA 2EK6A 4KAIA 1JXVA 3U1MA 1U1RA 4OYOA 3JSBA 3EGWB 3MM8B 5E3RA 3H40A 2V2VA 5J2PB 3TRGA 4I2PA 4NXMF 4QIVA 2YNHB 3MR3A 3R5JB 4K4XA 1NO8A 1YG0A 3VVUA 3MPDA 1G4CA 1NH7A 1K47A 4JI3J 2AJ0A 1TQLA 1RTJB 4U7CA 1RHJB 3VAGA 2ZEJA 1Q82T 2FGOA 2FJAB 2RHQB 1WKJA 3MCSA 1BQNA 1BLUA 1U25A 1QSSA 2HFOA 1ZPVA 4NLSA 2EFQA 4ANCA 4K2XA 3WC0A 4F0KA 3ZTRA 2H9ZA 5HBMA 1OO0B 5C25A 3GV8B 3CT9A 1T3NA 4X64F 3NBPB 1I3OB 4K4UA 1ACMB 1RWUA 2OSQA 3J81U 3W64A 2O66A 4O4RA 3D5MA 3NAHA 2LU2A 4B3RF 3VHQA 2B43A 4KFBA 3BGLA 4LRBA 4NMXA 3HFKA 2A0FB 1RBOB 2GJ2A 1NAQA 4DUZJ 1SIWB 2DGTA 4L72B 3DRPA 3I96A 2ASDA 3TUZC 1TFWA 4HDGA 3H8YA 1WG4A 3IRWP 3S6EA 1S1WA 3GFZA 2KI2A 4DR3F 3GR0A 5LXYA 3KJVA 3HI9A 2ZVIA 4E98A 4DR1F 1O0PA 4C2MA 1UEVA 1CC8A 3AJDA 2DGWA 4F4WA 2VF3A 2MKCA 2V2KA 4O3RA 3OFGA 3O8WA 4DFPA 4IFYA 1XN9A 1M1GA 2HKEA 5CXTA 4ELTA 4GRSA 1HI0P 2AMCB 3P96A 4RUBA 5C24B 4NZ7A 4H4MB 1TP7A 3TO8A 2RD5C 3QFHA 4PABA 3W63A 1J27A 3A12A 3MFIA 3EZOA 4PAAA 2RE1A 4YB5A 4DZDA 3M8QB 3PIPQ 4PG4A 4LF6F 1LOUA 3W7BA 1DZ5A 4LF2A 1VGYA 3KUEA 3A4TA 2AJ1A 5D3GB 5T7LB 3PW5A 2L41A 4X4UA 4R25A 3RB0A 1L3TA 3OVAA 2V4JA 4FNHA 1KEKA 2C2NA 4FN5A 2C2MB 4J9MA 1ITPA 3N6LA 1FJGF 2AZ1A 3IS9A 3ENVA 3ETMA 5AXMA 4KB7A 4UY85 5EWGA 1SC4B 2NZCA 4M1KA 3KG0A 4NE9C 2J5AA 3R1HA 3THTA 4OYPA 2BMBA 1VQ6S 1UZHA 1QVGR 2NLWA 4B3SJ 3UD5A 1UVNA 1HIYA 1ZTTA 2DHGA 2KT3A 3HPOA 2UV8A 1W7WA 3UR3C 3BSAA 5HLFB 3ICLA 2XNRA 2IM3A 4PYDA 4DQPA 3OHAA 1NPPA 3UDLA 1UWAA 2A3JA 4YS2A 3GIIA 5IT4A 2BOPA 3H20A 2HEKA 1UWBB 4JV1A 3CDEA 2ZHBA 4FF2A 1MN9A 5CD4H 3GV5B 1YVFA 5J1NA 1EKRA 3QT5A 2YY3A 3W2VB 4C3MA 3R9LA 1LWEA 2A2CA 5GAEI 1FNMA 2CG8A 1A0OB 1FHTA 2KN4A 3D0IE 2FY1A 3M2RA 3HX9A 2P9GA 3K59A 3L7OA 5J2MB 1X5SA 5H9EJ 1RAEB 4UQTA 3DI6B 2HAIA 3LGHA 2WONA 4TLRA 5M2PA 3GYNA 2VA3A 2Y8WA 2HWTA 2OAUA 4O3PA 2C28A 1NK7A 2RF2A 4ZVFA 3P49B 5GAHI 4UQGA 3LQVA 2OHDA 5LSRA 4KHRA 4HL9A 3DOMB 4LF5J 3IWLA 4FVCA 4C0BA 4ECQA 2LQ8A 1RU1A 2W4DA 3CCSS 4K5SA 1JLGA 4E2FB 2IM2A 3M2UA 3FBBA 3I0SA 1NZAA 1SV5A 4KTQA 2IVYA 3AODA 3FMBA 2C2ZB 3SCLE 5DGAA 1MWZA 3AB2B 3GJRB 4LRFA 1TMJA 2BV3A 3CC7S 4WZQA 2O5DA 4G1IA 2D9PA 4OHWA 2ZH1A 1T05A 3R97A 2X3GA 1R8CA 5F8LA 3BR9A 1PJ7A 3K7RA 4DUYJ 1NEEA 1NHKL 1KLMA 1RBLA 1D8YA 3HDSA 2XYHB 2HHQA 5JMNA 3U7JA 4JI1J 4ZVHA 1FKPA 1Y5IB 4J7CA 3QPIA 1JLCA 2E5LJ 2E5GA 2MJUA 3D2WA 1RWPB 4DV2J 1N36F 1TK8A 5KFNA 4NEZA 2VJVA 3RGIA 2HMIA 4EUVA 2L48A 1OMSA 2JL9A 1YTYA 1X7VA 5FJ4A 2OPPA 2W9BA 1BHNA 4J9SA 2HIQA 2AEJA 1B4SA 2W2OP 3RRHA 1VQYA 3UO0A 1YJNS 1RT4A 1FRMA 4HTIA 1URNA 3Q8RB 1SBRA 2GV1A 2KRBA 4DS5A 4USKA 1Z2ZA 2P9EA 3ILJA 3NY0A 3Q83A 5AT1B 2DH7A 4ZOSA 2JHEA 4QIEA 3VAFA 1HQUA 3D1QA 1YRUA 3G6XA 3KK2B 2DR6A 1F0XA 3BBFA 3OD2A 4UT4A 3UFCX 3LO3A 3J7AN 1RLDA 4GKJF 1S1UB 1R43A 2IDEA 4UOHA 5CH7B 3V4IB 5A8WB 4ZPDA 2AV5A 1FRKA 3N6MA 3RJMB 4JI0J 4TKTA 2KJVA 2WB1D 5KT6A 4OJGA 3U1NA 2WOMB 4EGLA 4RNOA 5D4PA 1RDRA 5E3PA 4NRUA 2O3DA 3Q8YA 3RYLA 2MJNA 3KK1B 3I9ZA 5L46A 5CZXA 1OIAA 3MXHP 4NX9A 1N54B 3SCJE 1NLKL 2MQOA 3EVMA 4J9UE 4J91A 3PJ9A 3HO1A 4MIWA 3DOLB 3IRXB 5E41A 2QLWA 1HNZJ 3HJFA 3BBCA 3AT1B 4NLYA 2DVIA 3PJXA 1YK9A 4KC5A 2JVOA 1HNIB 1ZZFA 4BWJA 2ZZNA 4GKKF 1FEHA 1JLQA 3EUNA 5CYQA 2NCKL 4NRTA 1NJYA 1HHTP 4MK9A 5IQ6A 3Q8UA 2DD8S 1KKHA 3OSNA 4O44B 2EI5A 5ETNA 5D6GA 2HGMA 3HZEA 3JQMA 3W60A 4P7TA 2CJQA 1CJKA 1Q86T 2J9CA 1MROA 2VIHA 2ZDOA 2DHAA 2BACA 2FB0A 3G86A 3MTJA 1HHQA 4JI8J 3L09A 3TW0A 1E6VB 2HFUA 4ECZA 2DRDA 2DNMA 3CCQS 1FJCA 1N0UA 1WOPA 4K2JA 5KFEA 1RAIB 1RWXB 4ATNA 2AGOA 3M8WA 1LNQA 2J8AA 4Y34A 4PWWA 4RWWA 3MM9A 1RTIA 4M95A 1T7PA 1RT7B 4J9KA 4NCGB 1UJ6A 4LQ3A 1CEZA 5C42A 2CJXB 4RW7A 3RR7A 1N4LA 2U1AA 1UMJA 3IM8A 2CQ1A 5AE2A 1KQSR 1S9EB 4DN0A 3PYGA 3NWRA 4J9OA 3HVTB 1IJFB 1KNZA 3KLHA 1JNRB 1ZAWA 3F73A 4LFCJ 1AB8A 4KT0C 4DUTA 1TUWA 2W9CA 1KHWA 1SC6A 2KHDA 3ZFVA 5GADU 4X65F 1NDLA 3KLVA 1O6XA 3G6YA 2EFOA 4DFMA 2EC0A 3LALA 3QGPA 4L3KA 1ZH5A 5KT5A 2DGVA 4UF4A 4RBVA 2KO1A 1SJ3P 3KLEB 1JLEB 1ZETA 1YHQS 3RB3A 2Q1LA 3OL9A 1R8PA 1QAXA 2XSJB 4ZIWA 4ED7A 5A8RB 4F25A 2RHSB 2RH3A 1DTQB 3QATA 1CJTA 1OPIA 2F8EX 1URRA 1N5YA 3PW2A 4X4RA 3OFHA 3KXDA 3IFEA 1KOHA 4FF1A 3MAAA 4X2BA 1WHWA 3MM8A 1Z4UA 3ITHB 3VAJA 2VUGA 1WHYA 5ETQA 3G9CA 2YNHA 2FC9A 1GXLA 1XWLA 1VQSA 1RB0A 2AJQA 1L3UA 2FVQA 4CI0B 1J2VA 1LWFA 4ALZA 1NBEB 1D3WA 5FDLB 1RHRB 4DEZA 3FMWA 3CJKB 1AFJA 2HRYA 1VQ8S 2MGZB 7FD1A 1TKTB 2U2FA 1TU0B 4ZHRA 4DV0J 1B99A 4M5HA 3NBPA 1NJZA 2HZAA 3BSNA 2FC8A 4WP3A 4LSNA 3JSYA 2K2PA 3FBFA 3B6BA 2HPUA 2CUYA 1SH3A 4J9NA 2V5HG 1KC8T 2NQPA 4DZ6A 3OSPA 1VBZA 2L08A 3GSDA 1HARA 1YI2S 3O3LA 3ZZZA 1UFWA 3RBEA 2C2OB 3MMBA 1J5OA 2J0WA 2V8GA 1WEZA 2XO6A 1R8BA 1SQGA 1RYSA 1F9FA 3G82A 1H2VZ 1BWEA 3M6XA 3EXCX 1M90T 1VIXA 1PAUB 3Q22A 3NEKA 2IYGA 2B5JA 3T1YJ 2F8MA 2UXBJ 3CCES 3SDEB 3KTQA 2A1BA 2G13A 2J6TA 1EX8A 1T9WA 2AGPA 2UUBF 2K7JA 3RAQA 2R2TA 1S99A 4H4MA 3LWLA 4WCEQ 1HQ2A 1Y3KA 3BV8A 1RWWB 2WVBA 2CADA 1HMVA 2C2EA 2ZJQQ 2Y1IA 2CDRB 2WAQD 4DG1A 4NLPA 5IT9Y 5KFVA 1GFWB 2KG0A 5J1EB 3ZTOA 2GIQA 1T3OA 4MIBA 4ECWA 3M8QA 3BREA 1T11A 4FYYB 4V19J 4OI2A 3K58A 4R5PB 1IBKF 5D3GA 5T7LA 3BGRB 3AD9C 1N33F 2OLWA 4F67A 3OTEA 4P75A 1CC7A 2LMIA 4RKUC 2B51A 4DV5J 3MOZA 4F2SA 2XB2D 3OVBA 2V94A 2CPDA 2V2ZA 4LIWA 1RZMA 4Y0FA 1WEXA 4M5DB 2BM1A 2KZMA 3HHLD 4Q5VA 1LW0B 1DQ9A 1JWWA 3DLJA 5HLFA 2HQDA 4LRDA 4LBIA 5L9XA 3C66A 2J6SA 4HLBA 2AWZA 3NGUA 4O3NA 4YY3F 5KFBA 2R9LA 3HLUA 3MM7B 2ASYA 3G71S 4LFAF 1VISA 1VMBA 2AF6A 2DKOB 2E44A 4J5OA 1OY8A 3MFHA 3TAPA 2Y1JA 4FVMA 1Y0HA 2HHWA 3IP0A 2ZH9A 1RT5A 5CCLA 2OTLS 2DIUA 3UVJB 2E9ZA 3CO9A 4Y2KA 4M5KA 5FD1A 3NLCA 2N7YA 4DFKA 2YNGB 4PQUB 2WK4A 1ZS6A 1KVIA 2D3UA 3E2EA 1W2BR 2HQCA 5HP1B 5J2MA 4K7QA 4O0NA 3ZZYA 5HVHA 1XMOJ 3L7PA 2ZH5A 3DI6A 2AT1B 4AL5A 2H51B 1XBWA 2XTJP 2XZWA 4DBQA 3JTNA 1S1XA 3N5FA 1VRTB 2RRAA 2QT7A 4DUZF 3ZZTA 5EUHA 3MF5A 1VC0A 1Q95G 2PMWA 2WZ1A 3UDVA 3DOMA 4PG6A 2XULA 2Z2MA 1WORA 1RP5A 1OY9A 3CJRA 2FY8A 3HKZD 2J7UA 3R6LB 1U0HB 2CZVC 4C8NA 2VKRA 1SVDA 2HNYA 1KSPA 3JSMA 3RRKA 4PXEA 2VPYB 3NS7B 4OZ2A 3CGIA 4JV0A 1WF0A 4DR7F 2CJBA 1NDPA 3DU5A 2H5IB 1ZAXA 3B8HA 1FCAA 1K44A 1HBOB 4XDCA 3E3XA 3NNCA 4DL4A 3HHEA 1V5IB 4ZPTR 3LH2S 2HFNA 2NXUA 4N8NA 3T5HA 3GG0A 3ILIA 4U9RA 4DCJB 1QJHA 5D4OA 1SXLA 1AW0A 2Y0SD 4QIFA 3DGPA 2X1FA 5EN1A 1S6PA 4I1TA 1SCJB 1SPBP 2YH0A 5CA5A 2BDPA 3SQGB 2Z0GA 2V34A 3P5BP 2G9OA 3QT7A 4FS2A 2F9DA 3CCUS 2IPOB 6FDRA 4ED5A 1ZAVA 1E6YA 2MQPA 4H4KA 2B7BB 2VH7A 3C14B 4RBTA 1JB0C 1RAGB 3DLHA 3P4UB 2KXFA 1UW9A 4WKRA 4OI4A 2HHUA 1GTEA 4NWBA 1XNQJ 2B7CB 3DHWC 4KHMA 3IWNC 1Q4RA 1WKLA 1LFPA 2QL7B 2GCFA 3OR2B 3E8OA 1RT3B 3ISNC 4B3SF 4B3MF 3DLEB 2XMTA 2GQQA 1PYTA 3KK2A 2J76E 2M3DA 3M1VB 2ZKUA 1R7IA 3CJ8A 2CG4A 2IFXA 4B9LA 1X0PA 3CJ2A 4K8RA 5KOWA 5GAEU 2QFIA 4QPTA 5D0HA 2D69A 4M5GA 1JK9B 2CQ2A 2QMXA 4IG3B 2HHPA 2HS4A 4Q0BB 4WF9Q 5KG7A 1YRXA 2BVZA 2P6TA 2DCUB 2CYYA 3CCZA 2HS0A 3IN5A 3CNQP 1DTTB 2IC3B 2R2UA 1GXTA 4A46A 4ELUA 2HNZB 3VZHA 3CW2C 1ZPWX 4W92B 2B4OA 1RE1B 1U2FA 4LSLA 3J80Y 4XTTA 3DOLA 4DMZA 5AXLA 4J9RA 4CCHA 3NGRA 1K1SA 2YNFB 2CWXA 1EAYC 2H48B 4K4TA 3CC4S 4WXOA 3DM2B 4RW9A 1YZ7A 2KT5A 1U2RA 4FPRA 1CBKA 1NRKA 1JX4A 2R7QA 2KXNB 3ISZA 4ES3A 3V6DA 4NXNF 1QY7A 3SV3A 5A2QU 2B56A 3SYZA 1AFIA 3H2UB 4EO6A 5F8NA 4A8WA 5KFOA 4IG0B 1SH0A 5KG6A 1TK5A 2MZSA 4I67A 1S9GB 5A76A 2EFNA 4USWA 5ETLA 1JXLA 2FLPA 4DUYF 3TANA 2AU0A 1Q7YT 3A13A 2ACYA 3QRPA 1EZZB 5BYSA 2PD1A 2ASJA 4K50A 5I4MA 4JI1F 3HVWA 1E6VA 1SL1A 1G6BA 4DOZA 2BJDA 1M5HA 1FWLA 2ZUAA 3Q8PB 2DIVA 4B3OB 1U6ZA 4OZNA 2GMLA 4DV2F 4PPZA 2OD6A 1U4BA 4NCGA 1H72C 1Y5LB 1BD6A 2UXDJ 3SMZA 3KMQA 4ECUA 1ZA1B 3J81Y 4CM2A 1WSRA 1PILA 3GCXP 3TEGA 1BY9A 2ILZA 1S9EA 3SBMA 4GVLA 4YMEA 1U1MA 2DEJA 2C42A 1X4HA 2HHVA 3HVTA 3VR1A 1XTZA 5K8PA 4ZVQB 2NYHA 1N34J 1LWCB 2FLNA 3U27A 2IA6A 1RT2B 4FYVB 4LF9F 2V69A 3KJQB 1UA0A 2GAGC 4GVBB 2V67A 1FNOA 1TKXB 3MMCA 2ZHOA 2I0XA 1NJXA 1JLEA 3OLAA 4JI0F 2GJIA 1S0NA 2XSJA 5HVGA 5F8IA 2M7SA 5A8RA 4DV4J 1DTQA 3MGJA 3MR5A 1RABB 3HHLA 2HAFA 1SL0A 2X3DA 3ENAA 4NLDA 2B9WA 4C8YA 4J9QA 2PI4A 3BN7A 1AUDA 3MM5B 2QO3A 1LWXA 3C19A 2E7VA 1RKJA 3QRQA 4ZP6A 1VRQC 5GMEA 1K0VA 4CQ1A 3BBBA 2KRRA 3GIRA 2LYVA 3GJSB 1ZZNA 1Q8KA 4YDXA 2R7UA 4QU7A 3DMJB 4UZCA 2WW4A 1W26A 1HNZF 4F2RA 2WCXA 3RB6A 1NSKL 2Y9HA 3SCIE 4CO2A 1K1QA 2OP5A 2Q3PA 3TX0A 2D3OR 1RWNB 2A18A 1YITS 2JC0A 4LF7F 2ZE2A 1XIQA 2OSRA 4TYAA 3FC9A 2PSZA 4DU7A 4I6AA 5LMNF 4OMFG 1H0HB 4KGMA 3PNIA 3QYYA 2OPQB 4O3OA 3V2UC 1EHWA 4QWAA 2R42A 4EMDA 4CDIA 4I7FB 1D1UA 4YB6A 3CCVS 2EK1A 5F0UA 5HROB 2KU7A 3UCZP 1UEKA 2AX0A 2D74B 4J9PA 4DHVA 3JYTA 3N01A 2ZM6F 3DDKA 4NA3A 2HHHF 3PTWA 2CFXA 5KFUA 2HBQB 3MUVP 1GK8A 1A9NB 1ZA2B 2LEPA 5KG4A 3NKYA 2UXCF 4JI8F 3CWJA 2RRBA 3S8SA 1U0SA 1VI7A 3IBWA 2DHXA 2DNPA 4F0HA 2RKIB 3G8QA 5E3CA 1L3VA 3MMAB 3PW4A 2NXCA 1MWQA 2KYXA 3D0HE 1RKIA 4Q2LA 3HSDA 2D7SA 2NXJA 4R8UA 2VG5B 4HEA9 2FLOA 3QAEA 3UWTA 4M8LA 1FDAA 1HNVA 5E5NA 2LQ9A 4QW9A 2V9KA 1ZM9A 4NLXA 4DR3J 1P8GA 5GVQA 4H54A 5EHHA 2Y3YA 2BJ8A 3LP1B 1ELOA 3PJWA 4LFCF 4OYZA 2H54B 1FI4A 4CWBA 3R1LA 3GYGA 3AD8C 4U7UK 3HVAA 1WDDA 4MIAA 2IHR1 2QMWA 4A47A 4DR5J 5J1EA 4U8YA 4O0IA 2G1DA 4HI2A 1LXNA 1LV5A 3M6VA 3V81B 4AE5A 4X84A 3BH6B 3TAMB 3OXLA 1KR4A 5DDRC 4LFBJ 3BGRA 2XY6A 1FRHA 3RRGA 4O3QA 1S57A 2CZ9A 2WVCA 1NK5A 4AXIA 3B82A 4P74A 1YRTA 1G7CB 3NL0A 1F2HA 2KHCA 5LM7E 3OL8A 2C3MA 4LF6J 5F9NA 1WC0A 1HWJA 4M5DA 4JI2J 5D77A 3OBIA 1U1KA 4ZN3A 3GIKA 3VQTA 2W25A 2RILA 4DSLA 3EDQB 4ES2A 2N82B 3BSCA 5M2RA 4QWEA 1FJGJ 4QR0A 5LSLA 1T02A 3OR1A 1N5SA 1IBLF 5D8HB 1WJ9A 1NKEA 4IH5A 3D6MB 2VBWA 1Q79A 3MM7A 4V1Ak 3J81j 4UOGA 3DLLQ 1TFYA 4I2PB 2YPZA 5SUHA 1X4DA 5FLXU 3UVJA 1TV6A 2VFUA 4DV0F 1F3FA 2YNGA 3DDNA 4MJKA 3PYFA 4ZLLA 5KG1A 5HP1A 1T9YA 4ECYA 3K2YA 4B17A 3QZ7A 5HATA 2XLIA 1BQNB 3RBXA 1FO1A 2CPFA 2HVIA 3NG8A 3HD1A 2X1GA 4ER8A 4BDPA 1X60A 5THWA 2D41A 3TVYA 1VQLS 3CCWA 1RLCL 1U7LA 4I6YA 3A8EA 4Q44A 3PR5B 1U6FA 1X4BA 3D1HA 1XR5A 4PYAA 1S77D 3UCUP 1EJ7L 4ZVTB 4KFBB 2FGCA 1D09B 1U0HA 4DL7A 3C3LA 3EWGA 2HFSA 2Q43A 4ILMA 3DRPB 4DR4F 2XHCA 1MU2B 1NK4A 2UUAF 1NH8A 4DX5A 3CMAS 3PO4A 1JJ4A 4KGVB 1S1WB 4N5SA 3CVKA 4CO5A 1MSWD 1HBOA 4CNYA 4U8VA 3KJVB 3QQCD 4M5IA 4KQZA 2XMJA 2PEHA 2HW3A 5BR8F 4OI0A 2CQHA 3Q23A 3UDEA 1S79A 1HYSB 2IA0A 2V2QA 1FKAF 4WE1A 4IFYB 3LGNA 4HTJA 1JJCB 1KQKA 1NPRA 1PC4A 2GNKA 2JLGA 3PYEA 1KONA 3VTIA 1Q8LA 4DV6F 3CEDA 4TQRA 2CIMA 4DL3A 1SKUB 2BBEA 4M94A 2YKPA 2BM0A 1FWPA 2ZNZA 1Q8IA 2WVEA 3M8ZA 4G1QB 3POTB 1BMQB 3FSIA 1N36J 2FVCA 4EEYA 3QJLA 2XS2A 1ZYQA 3OR2A 3D54A 4G3IA 1RT3A 3VGSA 1NMEB 5HMZA 3ZO7A 1U26A 3DLEA 3JXOA 1WG1A 2V4JB 5DG9A 3TYTA 3VAIA 4DSIA 2JEGA 3M1VA 1OS5A 1YIJS 3IS9B 3MZIA 1HWUA 2C2DA 2VG6B 1DQ8A 2YBVA 3ENWA 2B4VA 3VGUA 2QN6B 1FD2A 3CD5A 1B64A 1QTNB 1LK5A 2H5EA 1J5EF 1FTRA 4MYTA 2FD2A 3M9NB 5IC6B 3G8TA 4DLGA 1YBAA 1R6YA 3QIPB 4TU9A 2HQFA 2O01C 2VL1A 2NXNA 1Q78A 3FUYA 2UVWA 4GKJJ 4DPOA 1WC6A 2ADBA 4TN2A 2JJ4D 3K0JA 3KMSA 2W2NP 4B9UA 2Y1LB 2MLXA 5KFRA 3DGVA 2HNZA 2PDAA 2H5JB 1CQNA 2N3LA 1GMUA 5A6PA 2QRRA 5KAKA 3M2RB 4OYMA 1TL3B 2P2CB 2PA8D 3RAXA 2GQCA 2CNOB 1NXIA 4I69A 4NLTA 3GIJA 5DJBA 3J7Z5 4CLPA 4CT9A 5B0BA 2WONB 4HH1A 5CZVA 4F4XA 1TKZB 1T9UA
chains in the Genus database with same CATH topology
1ZM2A 2RF2B 2F7VA 1XNRF 4DSKA 1X5PA 2L9DA 1JLBA 1X0FA 3QJPA 4RW8A 3G6ES 1KQGB 2DD8S 4MKYA 2MSTA 1N88A 3FSXA 3OSNA 1FE4A 1P1TA 3ISND 1JXEA 3KLIB 4O44B 4I2QA 3CPWR 3NNAA 2GO8A 2EI5A 2QA2A 3SFUA 3TA1A 4IG0A 3FEYB 5D6GA 2ZH6A 3I5BA 2HGMA 3LP2A 1HBMB 5KFYA 3HZEA 1B7FA 1RI7A 1VQKS 2MKHA 3C46A 4CO3A 1FD8A 5GAGI 2QYCA 2HGNA 4P7TA 3QMQA 4C11B 2CJQA 4DL5A 3FRYA 4LF4F 4WFZA 1SV5B 2RQMA 4OI6A 1FTCA 1T03B 5KFSA 1Q86T 1S0MA 2M0GB 4OIXA 4C8ZA 2J9CA 1MROA 5IS2A 2ZDOA 3DLBA 2DHAA 1V3ZA 2BACA 2L9WA 4OZLA 4O4GA 3GG1A 1REVB 2FB0A 3H5UA 3UNGC 3G86A 1YJ9S 2KFNA 3K5MA 1SKSA 3MTJA 1YQHA 4A4JA 4X4QA 1S6QB 3L09A 2CQ3A 3TW0A 1E6VB 4ECZA 1FNXH 2KVIA 3KK3A 2CKWA 1RYRA 2DNMA 3D0GE 3CCQS 1FJCA 1N0UA 2LKZA 2CJ9A 1SKRA 2BYCA 2YH1A 2HRUA 1V3RA 5F3ZA 5KFEA 4KHPF 2P9CA 3MI7X 4NCAA 3SDEA 1T05B 3TARA 4ATNA 3RR8A 2AGOA 1QAJA 3BQ0A 1OWXA 2J8AA 4Y34A 4DV1F 3HXMA 1NKCA 1SIZA 4KRWA 3R5AA 4B02A 2KXHA 2CPHA 2ROPA 1OSDA 2IAJA 3MM9A 4RWWA 1RTIA 2ASLA 4WTYA 1KLMB 4M95A 1T7PA 3NWGA 3O6QA 4NLVA 5J2QB 4WU2A 3N4WA 2GX8A 2OPSB 1RT7B 4PG5A 4NCGB 4RLEA 4J9KA 1UJ6A 2QZ8A 4LQ3A 2EW9A 3HF5A 1K8AT 5C42A 1CEZA 2EFGA 1X4EA 4RW7A 1DURA 4WE1B 1UVKA 1XEZA 3BO2A 3RR7A 2HWIA 2HQIA 2NYIA 2MQLA 1D0EA 5KG3A 2DT9A 1SJ4P 3CMES 2PI5A 1FKPB 1N4LA 2IRXA 2U1AA 4DL0C 4A8KA 2UUTA 4QWBA 2N7CA 1UMJA 4KE5A 3KHRA 4MYUA 1VOMA 2CQ1A 5KG0A 2ZJPQ 1ZM4A 3CCLS 5AE2A 3G4SS 1QTMA 2VG7A 2LDIA 3CCTA 1KQSR 2R8IA 4IFVA 5AE1A 5K8MA 1S9EB 3NRBA 4DN0A 1DLOB 4YHHF 3WC2A 4N77A 3AA8A 1P27B 2Y1RI 2R8KA 1S4FA 1U1QA 4J9OA 5A2QY 4QBUA 1GAOA 3HVTB 4RW6B 1IJFB 2K1RB 2HMIB 2RVJA 1KNZA 3KLHA 3T5KA 1S1TA 4Q2MA 5F8MA 1JNRB 1ZAWA 2ZH4A 2DPIA 3F73A 2KFZA 2QEXS 2QSFA 2XI3A 2FJBB 2I9SA 2EVZA 3DLGB 2WBRA 4R5PA 2W9BB 5FIIA 4KT0C 2QSWA 3KHHA 3K57A 5G0RB 3DRYA 2W9CA 3B4DA 3MAHA 1KHWA 1SC6A 1N8RT 2KHDA 3FZ2A 3ZFVA 5GADU 4RNMA 4LF8F 2JLEA 1RT4B 4F26A 4CTAA