2HGLA

Nmr structure of the first qrrm domain of human hnrnp f
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein F
publication title NMR structure of the three quasi RNA recognition motifs (qRRMs) of human hnRNP F and interaction studies with Bcl-x G-tract RNA: a novel mode of RNA recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hglA01
4F25A 5H1SV 2AD9A 1AUDA 3CXCR 2LA4A 1H2VZ 2CQ1A 1VQKS 3H2UB 2J0SD 1ZZFA 2MMYA 2BZ2A 3CC2S 1WF2A 3I55S 3CTRA 2DNMA 3FEXB 3U1LA 3VAIA 2CQHA 5GAHU 2CPEA 2KHCA 3R27A 2G1DA 5DDOC 2L08A 1X4GA 1WEZA 1WEYA 4C0OC 3UD3P 2Q79A 2RQ4A 3D2WA 1M5PC 4FXVA 1WHVA 1WF0A 4WFNQ 4QPTA 3G96A 2RT3A 1VBXA 1D8ZA 3MOJB 3EGZA 4TU9A 1YJNS 1VC5A 5DM6Q 2M2BA 5GAGU 4C4WA 3HHNB 3MUTP 2CQBA 1VBZA 3BEGB 2RNEA 3G6ES 2CPFA 1B7FA 2KM8C 2KM8B 2FHOB 5HO4A 1OWXA 2MZSA 5GVQA 3L3CA 1VQOS 2VOOA 5HL7Q 3BS9A 2YH1A 2GO9A 2CPHA 4EGLA 2CQ4A 2HGNA 2JVOA 3SDEB 1X0FA 1DZ5A 1JJHA 1R8HA 1WG5A 3G4SS 2DNZA 2LEBA 2MQMA 3CC7S 2MGZA 2BOPA 3S6EA 2O3DA 2ERRA 4ZKAA 2HVZA 2N3LA 2MKKA 2YKAA 2RQCA 3CCQS 4WFBQ 2DNNA 1W2BR 3MDFA 3VAJA 4RU2A 1Q7YT 3MUVP 4PRFA 2FC9A 2G4BA 2M8HA 2RRBA 3CCVS 2DHSA 4PKDB 1CVJA 1VQ6S 2DO0A 2QEXS 3CULA 2CQDA 2HYIB 3PIOQ 1WWHA 2OTLS 2CPDA 3ULHA 1SJ4P 2J0QD 2DHXA 2DNGA 2LXIA 2KXFA 4WFAQ 1HD1A 3NMRA 1WF1A 5LJ5Y 2HGMA 2E5JA 3S8SA 1UAWA 4P6QA 3R1HA 2X1BA 1SJFA 2X1GA 1U6FA 2PE8A 1HL6A 3BO3A 2F9JA 1VQ7S 2EVZA 3UWTA 4CH1A 2MQLA 1NJIT 2KI2A 2XB2D 4ED5A 2J76E 4UY8T 2OIHA 4FXWA 1M5KC 3CCSS 1SJRA 3J7YU 3NNCA 1M5OC 1VQLS 3CD6S 2DGXA 3UCGA 3CCJS 4IOCQ 3B4MA 5BJRA 1K9MT 2AYBA 2N3OA 1X4CA 1UW4A 1FXLA 5GADU 1U1RA 3LQVA 3DLLQ 2N82B 5JVGQ 2D3OR 1O0PA 4LJMA 4M5DB 2LMIA 3EGNA 1U2FA 3MD3A 2ADCA 1A9NB 1VQNS 2LA6A 1PGZA 2KXNB 1X4BA 1FJCA 4QU7A 2KXHA 5ITHA 2DO4A 2MQQA 2RU3A 3CMES 1SXLA 2MKHA 4W90B 2MZTA 4IUFA 1YJWS 3S01A 2RS8A 1YIJS 1ZZNA 2MKJA 1YTYA 2N7CA 4YB1P 5CXTA 2CQ3A 2MZRA 3TYTA 3FEYB 4WF9Q 3MURP 3JB9k 1WI8A 2KVIA 3K0JA 2MJUA 2ZJRQ 1YHQS 3I56S 1OO0B 4F26A 3U1MA 1HD0A 3P3DA 5LSOA 4BS2A 2XS7A 2RVJA 4F02A 2L41A 2M0GB 2CPIA 2DISA 2MKSA 3VAHA 2KRBA 3Q2TC 1RK8A 2KU7A 2JWNA 4CIOA 3CF5Q 4V19X 5LJ3Y 3LPYA 2MSTA 2OJ3A 2I38A 3B4DA 5JVHQ 4OZ1A 3G8SA 1U1OA 2CQIA 4IO9Q 3TO8A 3VAFA 1M90T 1VC0A 2CQGA 1H6KX 2CJKA 3EX7B 3BO2A 1WG4A 2MSSA 3UCUP 2ZJPQ 1P1TA 2KG1A 2DH9A 2DB1A 2DIVA 2OSQA 1YI2S 2K8GA 1FHTA 1X4HA 1DRZA 4TU7A 2MQOA 3CCUS 2EK6A 1IQTA 2AYEA 2M88A 3G8TA 1UP1A 2D9OA 5CA5A 2M4MA 1U1PA 2LXUA 2MGZB 3SMZA 2MY7A 1VBYA 2CQ0A 2DH8A 1X4AA 1A7GE 2M9KA 2YTCA 1X4DA 1VC6A 1P27B 3MD1A 3DXBA 1FO1A 2DNPA 5GMKa 2CQPA 1L3KA 1URNA 3NNHA 2DITA 4LIRA 2DIUA 1X5TA 3P5TL 1HA1A 5DETA 2DHGA 3P6YC 5GAEU 4QQBA 2DNLA 2E44A 1KOOA 1U1NA 2YH0A 1U1QA 2VODA 3BO4A 2NLWA 2XS5A 2DNHA 3PIPQ 1K73T 2DHAA 2DGUA 2RRAA 4CH0S 2DGQA 5LXRA 1VQ4S 3J7ZT 3CCLS 2DGTA 1X5SA 2VOPA 3ZZYA 2F3JA 2X1AA 2KT5A 2MZ1A 1SJ3P 5IM0A 3OW2R 4YOEA 1VQMS 2JVRA 2MPUA 2K3KA 3CPWR 5MLCV 1H2TZ 2CQCA 5DDQC 3HI9A 4OZ0A 3CCES 2RS2A 2M52A 2DNOA 2SXLA 5D78A 3TP2A 1X5OA 3IWNC 1OPIA 2QA4S 3SXLA 1N52B 5D77A 2MKIA 1FJ7A 2I2YA 2EK1A 1WHWA 5EN1A 2MQNA 4Y0FA 1YITS 1KC8T 2KH9A 2KN4A 2NZ4A 3US5A 2B0GA 1U1KA 2VONA 1D9AA 3UE2A 2OTJS 2MQPA 1S79A 1K8AT 1H2UX 2L9WA 1JMTA 2DH7A 3THPA 4WCEQ 1N8RT 2XS2A 2X1FA 1JJ2R 3IRWP 2DGOA 2FY1A 3H2VE 1RKJA 2MKCA 2G0CA 2LEAA 1NU4A 4J5OA 3THTA 2M70A 2MY8A 1PO6A 1N54B 1WEXA 4PR6A 2ZJQQ 3R1LA 2DNQA 2MHNA 2XSFA 1JJ4A 2LYVA 5IQQA 3UD4P 2JRSA 2DGWA 3CCMS 3MUMP 2D9PA 1WI6A 2PEHA 5DDPC 1WTBA 2V94A 3CCRS 1Q86T 2MZQA 2M8DB 2HZCA 3MI7X 4A8XA 3V4MA 4LMZA 3G9CA 1S72S 3SDEA 2E5GA 4W92B 4QU6A 1FNXH 4WKRA 1YJ9S 1QVGR 2E5IA 4UQTA 2YWKA 2U1AA 2XNQA 3RW6A 4WIIA 3P49B 5CYJA 2DNYA 1M5VC 4IOAQ 2LQ5A 2AYGA 2KG0A 3RW7A 1N88A 2WBRA 1Q82T 5LXYA 2M7SA 2CPXA 1KD1T 1BY9A 4U67Q 1VQ8S 2FC8A 2RUGA 1X4FA 1U1LA 2CPZA 3VAMA 2KFYA 4ERDA 2KYXA 2FPHX 4YUDA 3VALA 1R8PA 1G2EA 2DNKA 1DBDA 1VQPS 2DGSA 2MYFA 3UCZP 4TU8A 3ZZZA 1UFWA 2MXYA 2CPYA 1KQSR 1X5PA 2UP1A 1FT8A 4Y00A 1X4EA 3VAKA 5LSLA 2XNRA 1U1MA 2DNRA 2AYMA 1Q81T 1WELA 4C7QA 1OIAA 2F9DA 2LCWA 2MZJA 2E5HA 1NO8A 1SJQA 3CUNA 2ADBA 3N9UC 2A3JA 3NS6A 1VQ9S 3Q2SC 1M1KT 1F9FA 2DK2A 5IM0B 1XN9A 2GHPA 5IFMA 1WHYA 1WHXA 3MXHP 2MB0B 2CPJA 3CC4S 4Z2XA 2MJNA 3G71S 2LKZA 1WG1A 3VF0B 2DGVA 1VQ5S 1YWXA 4TLQA 1ZH5A 2HGLA 3CMAS 3NNAA 2U2FA 4CQ1A 2KRRA 2LECA 3VAGA 2OSRA 5DDRC 5DM7Q 1DHMA 2CQ2A 2J8AA 3S7RA 5FJ4A 2JX2A 3NS5A 1KOHA 2QFJA 1QVFR 1QM9A 1U6BA 1FJEB
chains in the Genus database with same CATH superfamily
2BRKA 3PRVA 2ZH1A 2QG9B 2R7UA 4B9MA 5HROA 3KJNB 4F50A 1URRA 2KHCA 1WEYA 3PY8A 2ROGA 3KHGA 4FXVA 1RWPB 1Z2ZA 3GLJA 1D8ZA 5M2UA 2HNZB 1YJNS 4KGZB 4AXIA 3MUTP 1DFDA 2IY5B 4K8RA 2FHOB 3H0PA 1OWXA 4JUZA 5L39A 2FGOA 1R8HA 3NRBA 5A8RB 1YX2A 2AX0A 5HMWA 4PWDB 2RUSA 4F8RA 3BN7A 2DNNA 4HT5A 1Q7YT 1XEZA 1NAQA 2VQEJ 3CULA 4CO5A 1ROFA 4K5RA 3W9HA 4G1QA 2C2OB 3OXFA 2DY9A 1Y3JA 2X1BA 3U1NA 1WC1A 1M5HA 2EVZA 5ETTA 1JLFB 4TYAA 2V4RA 3W1YC 3K59A 5HBMA 4HKQA 4U7UK 3H4DA 2WHOA 5FDLA 4GVLA 3UCGA 1RAJA 4DV6J 2C3OA 4CLYA 1TVRA 1Z2LA 1O0PA 2K2PA 3TJ9A 1S0VA 4F36A 2VG6B 2GGPA 3RR8A 3T1HF 2NPFA 3PW5A 1SXLA 4W90B 3W2VB 4KKOB 2RQMA 1YIJS 4I2PB 1SCJB 1TMMA 3A4TA 1WI8A 1V5VA 3OSNA 2E9ZA 4F3MA 2ZH5A 5HROB 4LR9A 2KFZA 3MCMA 2V8HA 5HVHA 2CWXA 3IXQA 5ETPA 1S0OA 3R7BB 2DY1A 2MSTA 2W2QP 2HHSA 4YS2A 4RO0A 2GA7A 3TEGA 3HHKA 1UZHA 2CNNB 3HFVA 1SJ1A 5M2RA 1WG4A 4L3KA 5KFNA 2AGQA 1ZM2A 4LVOP 2D9OA 2YQ0A 1RE1B 3MM5A 4B9TA 3MR3A 2W9BA 4KHPJ 1KLMA 4DL2A 3KLIA 1PIEA 4XIUA 4ZCKA 3JQKA 4EYHB 3BBCA 4DR3F 2F8MA 3KUGA 2R8IA 1V6HA 4RU9A 4G1QB 3D0IE 3V2UC 5BR8J 1LWCB 1FFSB 3H5UA 3JSBA 4QYZK 3W8PA 2DGUA 2UVVA 3CT9A 3FCVA 3H20A 1HHSA 8RUCA 5HBMB 3GQCA 1RWNB 2QZ8A 2Z57B 5FDLB 4OQJA 1EQ0A 3R9LA 4LBIA 3CCES 1TVRB 5KFLA 1UVJA 2Y9HA 4MTPA 3IWNC 4PWWA 1NEEA 4NYPA 3DOKA 5D77A 2UU9J 3QRQA 3CD0A 1S48A 5EN1A 4RUCA 3US5A 2GMJA 4K0KF 3UE2A 2ZM6F 4LSZB 3NXZA 5AXNA 4X4PA 4JV0A 2FVRA 2XY5A 3MPDA 1UA1A 4Q2LA 4F4YA 4OYPA 3DDKA 2W25A 3QIDA 1JB0C 3T41A 3JS9A 3E01A 1EIYB 3B54A 2JRSA 4NRUA 1HQUA 2BE2A 3GCWP 2V94A 3UNGC 1C1BA 3SEOA 4KQZA 2CJXB 3RW6A 3MEKA 3MM5B 2YNHA 2W9BB 3QAUA 3GIRA 2VV5A 2B7CB 1N88A 2YKMA 2HBYB 2EFOA 4ZVFA 3C2PA 1Y00A 2CPZA 2W9CA 2H9ZA 3MMBB 3DNCA 4URGA 2DCLA 4WTYA 2PI5A 3MF5A 4OYWA 3HT3A 4Y28C 1SH3A 1CJKA 1Q4RA 2I0XA 4M5HA 1CLFA 4OHVA 4ATNA 4EWTA 4DPXA 4WYLA 4AL5A 3NGDA 1V5IB 1LEOA 2E29A 3CUNA 2VPWB 4N8NA 4UT4A 2QL7B 3FGVA 5IFMA 5IT9Y 1HWIA 3K5PA 5IZHA 4CLKA 3HFZB 2LKZA 6AT1B 4PXBA 2HGLA 4CQ1A 3DI6A 3EICA 3JQMA 5A6WA 4QOTA 4ZLLA 2D1CA 3DOKB 5CABA 3NS5A 1Q95G 1U6BA 1HQEA 4KYZA 2JFKA 2RIJA 3ILIA 2HRTA 3LGNA 3U1LA 3LOUA 2FZGB 3ETMA 4I1TA 3AB2B 3CJ5A 5DDOC 3RAXA 5G4DA 3OSPA 5DS7A 2QIFA 2JHEA 3E01B 1VC5A 1ZS6A 4ED3A 5GAGU 3HHNB 3BPDA 1HQUB 2M5YA 1UWAA 2R9LA 2KT2A 3BYPA 2FJWA 3TOQA 3D6HB 4UOGA 1C1BB 2JVOA 1DZ5A 4C8YA 3IBWA 2HAIA 4U9RA 3CC7S 4DV5J 1KFSA 2RD5C 2YNHB 3B82A 3GIIA 1XMQF 4ED6A 1HNZJ 2EXUA 2YKMB 4EUVA 2FLNA 4NASA 3DFEA 3JTOA 3PEJA 2Z2MA 4ED8A 1TUGB 4CI0B 4DUZF 2FGCA 1GH8A 2W9CB 4UZCA 2WSFC 3I31A 2HFSA 4O0IA 2HBRB 5KFKA 2HGMA 1FE0A 3HKZD 2HHUA 4NPOA 4DF4A 1DJ0A 4J90A 5D15A 1PYTA 3DYAA 4CNZA 1FRXA 1BWVA 4EBEA 3H5SA 1J5OB 2J5AA 3I4PA 3DI6B 1VLOA 5AE3A 2QLXA 1TL1A 1ZYQA 4EBCA 1F5CA 1DY3A 2GNKA 3T9NA 2HSEB 2YX7A 3KFWX 1FCAA 5CXTA 1HQEB 4WBFA 4B3TF 3ENVA 4N77A 1RXOB 2E7VA 4C6AA 2MJUA 1S0MA 4GKJJ 4FP9A 4PABA 1GTHA 2L41A 4OI3A 2DISA 2R8JA 3Q23A 3CCZA 3WC0A 2FHJD 1VDHA 2D74B 4WTOB 4IO9Q 3VAFA 4QBUA 1HMVA 3HFKA 4OLPA 2YWHA 2YNIA 3CJ2A 4DHVA 3IMQJ 3UCUP 2K7KA 2CDQA 3QSYB 2DT9A 3FMBA 3N01A 3DKDA 2NXCA 1GQEA 2LDYA 3D7SB 2Q66A 1OY8A 3F44A 3RZAA 3MD1A 1N5QA 2Y8WA 4LF4F 2RB7A 2F63A 2V68A 2VFVA 3KLHA 1T05B 2XEXA 4CH7A 1KOOA 1U1NA 4I6WA 3DHXA 1U1QA 4JI3J 2H54B 2ZDPA 3EVOA 3J7ZT 5LOQA 4NEZA 3R2DJ 2OPSA 4YOEA 4K4UA 1F5AA 5EUHA 3GB0A 3OL6A 4GC6A 3L09A 3GIMA 2JJ4D 3QO9A 2M52A 1ZA2B 1W26A 5D78A 5AXLA 5HSPA 2UXBF 5CCLA 3GFXA 1NK4A 3RAMA 1TL1B 2O66A 4CNYA 3VR1A 4J9VA 1CJUA 4ECXA 2FJXA 3KK1B 2V4QA 3H5XA 4WE1A 1K47A 5F8NA 4YDXA 1FDBA 2BKOA 5KAKA 4D3GA 3IRWP 3KG4A 1Q8KA 4I0WA 1PO6A 1T9UA 2MHNA 4O44B 2XSFA 1H73A 4HT7A 1HMVB 5ETKA 4E98A 4GRSA 3QGGA 1N0VC 4YHHF 1L3VA 3HZEA 3SDEA 1RTHB 5E3QA 3MCOA 5KTQA 4WZMA 2CNKB 1Q7LB 2V2KA 2FJVA 1M5VC 2RJZA 3IGNA 3PRDA 1FESA 4ES3A 5HP1B 1YZ7A 4PWUA 1LV5A 5AT1B 2LQBA 4F0KA 2BE7D 2V9WA 1F2HA 2LQ9A 3DLBA 4ZOSA 4ECVA 1K1QA 3DN9A 4GO7X 3C15A 1U09A 1OIAA 3DDNA 4OZ5A 4FN5A 1Q78A 3MCNA 2OPSB 4DX8H 2DK2A 3DRSB 3W9JA 2RMLA 4P9SA 3AA9A 3QBCA 5E3RA 5K9FA 5BYRA 2B4VA 4LREA 5EHHA 3CMAS 2RDJA 2W24A 4ZVOB 5L9XA 5H9FK 2QFJA 3T1HJ 1SL0A 1GK8A 1AUDA 2VFSA 2C3YA 1CJUB 1C0UA 2HHVA 2HQ3A 4R0JA 2W7OA 1YJ7A 3OJSA 3QFHA 4K50A 1RHQB 3UD3P 4TQSA 5ETOA 1YBAA 4Q5VA 2HURA 2CQBA 3T3FA 1VJQA 1UEUA 3D3CJ 4F67A 2QE5A 4K2XA 3FMWA 3SDEB 5KFTA 1WG5A 2HHTA 2MQMA 1Q53A 4D3HA 1NZAA 1VIOA 1LK7A 3RBEA 2N3LA 3BPSP 3PTWA 2F65A 1O8BA 3UR3C 3L7UA 4DR3J 1YSJA 2BBEA 1TKZA 3ETOA 8ATCB 3H98A 4DOZA 1FI4A 2FQQB 4IO1A 3MPUB 4MKYA 4LF5F 4C11A 1KEKA 5AE2A 5D4NA 3C15B 2DEJA 4CLZA 2Y0BB 4C3MA 3RBXA 2WB4A 2OPRA 4QIVA 2N3OA 3VWSA 1QAIA 1C1CA 1RT6A 2FD2A 2VJVA 1F2GA 1APSA 3H25A 3HVTB 2KXHA 2YQ1A 3HSGA 3T5HA 4OHWA 5DG9A 4CLSA 3PJ9A 2NYIA 1F5BA 2GQCA 2QMUB 3I82A 1R31A 1YJUA 3MR2A 2DR5A 1C0UB 3CJ8A 3SV4A 1HBNA 2QL5B 2ZM6J 5ETLA 4ZCLA 3BREA 3P3DA 2DEIA 4FZVA 3BKUA 4V19X 3LPYA 1JKHB 3TEHB 4OI6A 2QTWA 1BUXA 4OZ1A 2D3UA 4CRJA 3EDRB 4MFBB 3KHRA 2POKA 3BO2A 3OBIA 3I0RA 4V1Ak 1TMJA 1RSCA 1UP1A 3CDWA 1FK9A 3PW4A 4O4RA 2MY7A 1X4AA 4FVMA 3AB4B 2YTCA 3V5RA 5KFOA 4U7CA 3ZXWA 1OSDA 2C22A 3N28A 2VBWA 2ASYA 4DL5A 2VF3A 2YKQA 2CAJA 1GMWA 3QAEA 2DR8A 4LRFA 4ZDNA 4PYDA 5DETA 1VISA 3V81B 1TKZB 1UETA 2YH0A 4C3LA 2GHVC 3ILLA 2BACA 2GMHA 2CG8A 4C11B 4B9NA 1YZ6A 5HJXA 3CCLS 3KKFA 2Q43A 4MIAA 3AOCA 2X1AA 1SI9A 5KT5A 2YX4A 3HXMA 1VQMS 4NEYA 1Y3KA 2OPRB 2I8EA 2GHWA 5HVFA 4LFBF 4Y2CA 1C1CB 1RT6B 1T8EA 4IRCA 4CLFA 2BW2A 1TFWA 2ZFHA 2BJ7A 5E2QA 2KH9A 4JI2F 1SL2A 2ZHAA 1BXNA 2DD8S 1XJWB 4PCQA 1F3VA 1KTQA 1HBNB 4ENOA 2XS2A 2KYZA 2QRRA 3UNYA 2IM2A 3NGRA 4LF7F 3SSRA 2DKOB 4ALZA 5D0RA 2DGWA 3CCMS 2V63A 2D9PA 4EBDA 4FF2A 1VGYA 2V8VA 4M5MA 2CA9A 3CEDA 1S76D 2UZAA 1KQGB 3I0RB 4HYKA 4QR2A 3WIVA 1S72S 3CJ0A 4J9RA 2HBQB 1FK9B 3C6TA 1LQ9A 3FK4A 1NSPA 2YKOA 4HVZA 4NLTA 2CUYA 3TAPA 4DSLA 1XMQJ 1V3SA 2NSBA 3MTJA 3A3OB 3IAS9 1B0TA 4ERDA 2FPHX 1KVJA 3J81U 2MYFA 1S99A 3TQ1A 2XSJA 3AFGA 1FT8A 1S12A 4KB7A 2G2YA 5E5NA 3Q8QB 4RW7A 2V0NA 3WIUA 4NL5A 1Y9OA 1WHXA 2EBEA 5M2PA 1Q16B 5E3PA 3BKFA 1IWGA 4I56A 1RBOB 1IBLF 2KRRA 2QSFA 4IDKA 2FVQA 4G1IA 2J8AA 5K5MA 4OZJA 3UN3A 3M32A 5T7LA 1HBMA 4B3TJ 4M95A 2CPEA 4OI0A 2G1DA 4ZVEA 1T03B 1YJVA 3DRXA 3H42A 2L48A 3QGIA 1YG0A 4DPUA 4B02A 1ZA1B 2A1BA 2GFFA 1EETA 5GMEA 1QE1B 5LMNF 3DU5A 1GMVA 1NH8A 1MWZA 2XQCA 1QSLA 4G1PA 2PD1A 4EGLA 1PYSB 4DUYF 2LEBA 4DQSA 2XZTB 3C6TB 2GVZA 1W7WA 4CT8A 3N6NA 3PNIA 1CVJA 2VDHA 4HACB 1LWFA 4ECYA 4LF4J 2PSZA 2HFUA 1CULB 2CPDA 1RTJA 3UN2A 2KXFA 4J9KA 3C19A 2PEBA 3R1HA 2XSJB 1ZAXA 2XMVA 2WSCC 4JYAF 1NJIT 2KI2A 4ED2A 1O6XA 4RW7B 4X4VA 3J7YU 4ZPDA 3CD6S 2CZ4A 1HI8A 2HFNA 3KHHA 3EGNA 3MD3A 2LA6A 4TVAB 1S9EA 5CAAA 5GAGI 4IDKB 4A47A 3CMES 5IT0A 2UXBJ 4IUFA 1GEHA 1VRQC 4DF8A 1KNZA 3CDUA 3OR2A 1RHRB 4YB1P 4DR6F 2XM3A 3M32B 5T7LB 1HBMB 2ZJRQ 5BYQA 3EXYA 2Z30B 5LSOA 5F8HA 1FX4A 1HHTP 4RKUC 2E1AA 2VFRA 2ALZA 3CD7A 2JWNA 4ECZA 5LJ3Y 1O51A 3EVWA 1Y5IB 3VQSA 2W2PP 1KHVA 4HLBA 3BQ0A 2MSSA 4Q43A 4ICLA 2OSQA 2M88A 4YHHJ 1U1PA 4FS2A 5B0AA 4PEOA 3RTVA 4I64A 5K8NA 2PI4A 4KR0B 2FZKB 2GVZB 2ZH4A 1YRTA 3DXBA 3OTBA 4DL0C 1KWMA 2BV3A 1IQZA 3NNHA 2UVRA 3TX0A 1LWFB 1X5TA 1RTJB 2HFOA 3UPFA 2XC9A 2CXEA 2AX1A 2K1RA 2DRAA 1YKWA 1FWKA 4OX9F 2FVPA 3NAHA 4DR5F 3HX9A 1T9VA 1KONA 5EGYA 2BJEA 2ROEA 4WFXA 2F3JA 2IAJA 3T6JA 1IVZA 2HMIB 4ZN1A 4NYOA 2MPUA 2K3KA 4H4KC 1WOSA 3PFOA 3W7BA 2OAUA 3TAQA 2EG2A 3J7Z5 1S9EB 1FJ7A 1NHVA 2I2YA 3KLVA 5K14A 2AJ2A 1U6ZA 3AD9C 3OR2B 4KC5A 4AE5A 3KDOA 2PC6A 1S1VB 1WDTA 2RAQA 3SCIE 3W60A 4J9PA 3A13A 3MEDA 2GW8A 3EZOA 1JLEA 1REGX 3ICLA 3OVBA 1BQNA 4DFJA 3OTCA 4WK1A 4DV3F 1UVKA 2D69A 2M8DB 1IJFB 4ICLB 4YN3B 4QU6A 3BSCA 3TANA 3PR5B 3T5JA 4YDDB 4WIIA 4XPCA 4IH7A 2KFNA 3AH6A 4LSNB 2KG0A 2W2OP 2M7SA 2CPXA 2Z2YB 1SC4B 2AJFE 4DV0F 1MSWD 2DNKA 1CQMA 2GV1A 2BMBA 1ZAWA 1KQKA 2R8KA 1BHNA 4ZPCA 4NE9C 2I5JA 5D6GA 4LR8A 4LF5J 2ZE2A 2GQ2A 1SQGA 2IAJB 4FNHA 4J9UE 2V2ZA 2CPJA 4PG5A 5GAHI 1YWXA 4TLQA 4L3NA 1TL5A 4H4KA 2V5HG 2E9RX 1RTZA 4C2MA 1CJTA 2MQ8A 3OJUA 3TI0A 4R5PA 5K14B 1XQIA 2D3ZA 2ZBIA 4RL1A 3VZHA 2CQ1A 1U4BA 3I55S 2FHMA 1IKYB 1U26A 3VAIA 3T6BA 1N5TA 4ZMMA 3EGWB 1B0VA 4F4KA 4DBQA 2P9GA 5L1KA 3FBBA 3MEDB 1S6PA 3D28A 1HNXF 1YQHA 1LOUA 3MTKA 1JLEB 1VBXA 5IQ6A 3GYGA 3RYLA 4FF3A 1HWJA 2RNEA 2CPFA 1BQMB 1QAYA 3LALA 1RU2A 2HHXA 2CPHA 4GVBA 2PN6A 2JC1A 4DS4A 1Q1KA 1MG7A 1U7LA 4RX6A 4QIFA 2YBVA 4RR5A 2BOPA 4OYOA 1VYAA 1RWOB 1V9OA 4TNOA 1N48A 6FDRA 3M6XA 3ZNJ1 2G4BA 2M8HA 1UW9A 4PKDB 4URSA 2CQDA 3RB0A 2XYPB 4PUOA 4QCLA 4OI1A 3FJ2A 3TW0A 1CSJA 3P96A 4FXDA 5BXIA 1UVIA 3Q8PB 1H0HB 3T5LA 2JZ5A 1QJHA 1VQ7S 2I5JB 1TV6A 3GSDA 1N34F 1M5KC 3WBZA 2ZE2B 2GIRA 2HWTA 4ANCA 2VBZA 4IOCQ 2AMCB 3IWLA 4DSKA 4WXWA 3QWUA 3I5BA 4M8LA 2B56A 5F8GA 2B9EA 4LFBJ 5CD4H 4QU7A 5CHCB 1CJTB 5C2CA 4OZ2A 1LWEA 1BC6A 1X9WA 4DSFA 4R5PB 4KY3A 1SC6A 1RQ0A 5U47A 2VBYA 4I2QA 3JB9k 2J0XA 3C16A 4JI2J 1VHFA 3TUPA 4F2RA 2X51A 2P2CB 1EAYC 2RDIA 3U1MA 4RUBA 5C2GA 3GZ7A 4IOBA 1S6PB 5L38A 4LF7J 1WC6A 4OYAA 1N33F 2EFNA 1D3WA 3M9OB 1NM2A 2AEMA 2CQGA 1TU0B 2YVSA 4DU7A 4IRDA 1Z1ZA 4DCPB 1FRIA 3AODA 3N4WA 4GVBB 2B8PA 1W2IA 1WKJA 4CT9A 3OTEA 3SMZA 5IV4A 1WKLA 2PO4A 1X4DA 4KPCA 3HO1A 1DAXA 2HEKA 1PJ7A 3BDPA 3N6MA 4PUOB 4FNIA 3OHBA 4N7TA 2RHSB 4DUTA 2GS8A 2WONA 5C25B 2ALYB 3PIPQ 2FJEB 2XI3A 3EYZA 2FHKA 3CO0P 3IS9A 1VQ4S 3UFCX 1MLAA 4RWWA 1TV6B 2JLFA 1X5SA 1RWWB 1S6OA 4P2FA 4IG3A 2BKNA 3JYTA 4K4YA 4OV1A 4JI4F 3TUJC 4MKBA 2BM0A 5DDQC 2Y8YA 4M94A 3Q8UA 4OJ3A 2E1PA 3MZIA 2BRLA 4USUA 1IBLJ 1JJCB 1XWLA 1KC8T 2C2DA 1WOPA 3K5LA 3GV8B 2NZ4A 1U1KA 3PW2A 2XGPA 4Y6IA 3GJQB 1GMUA 5J2QA 4EFAC 4I2QB 4TN2A 3R3TA 3C16B 2HAFA 2GQQA 1N8RT 4HI1A 4EI2A 4HL9A 4I7FB 2FY1A 2Y3YA 2MKCA 2G0CA 3BGLA 3HD1A 2XZWA 3JTNA 4LIWA 5KG5A 1N56A 4U6PA 2B3TB 1WI6A 2VIHA 1FDDA 1HKAA 5LMNJ 3CCRS 1HW8A 1HBOA 4A8XA 1OY9A 3C6UB 3M8YA 4DUYJ 2WAQD 3SFGA 3GSIA 3N79A 4DEZA 1RGVA 2RDDA 1QLNA 2KFYA 3LWMA 2HIQA 3TR5A 5H9EJ 2CVEA 2UP1A 3ENWA 1KQSR 3VAKA 4PPDA 5C7PA 5LSLA 2WONB 3RB4A 3KUHA 3IS9B 3LTOA 1W25A 2ZKTA 4UTGA 1F9FA 2CFXA 4IG3B 2JL9A 2EW9A 1FVQA 2MB0B 3JYTB 2IDLA 4Z2XA 3HHEA 1WG1A 2GCFA 2FUG9 3QT8A 1H38A 2DPJA 3G6VA 1EP4A 1GX6A 3QFWA 3TVZA 3LAMA 4F25A 2AD9A 3N5FA 1VHIA 4Y2KA 2FTRA 5J2QB 1GXUA 4Y65A 4DR6J 4I68A 4C8LA 1A6LA 2ASDA 2RQ4A 3D2WA 2GC8A 4DXLA 3JAMU 3MOJB 4TU9A 3DGVA 4KH0B 3BEGB 1FWLA 1FDAA 1KSPA 4IQXA 5HO4A 1T3OA 1VQOS 3BS9A 3Q83A 1HBOB 3KNAA 2CQ4A 1NDPA 1JJHA 2IA0A 2XYGB 4K5SA 4DV2J 3TUZC 5AJ3F 2W8KA 3SSQA 3WQPA 1XERA 3A3NB 4UOFA 2ZH3A 4WFBQ 4JBCA 3DMJB 3UDCA 4ECTA 1T0TV 3R5DA 2DO0A 4P72A 4YP3A 4RPFA 4Z7CA 1ZTWA 2YPYA 4WFAQ 3RRHA 2FLPA 4CLTA 1IBCB 4OX9J 1NUEA 1OYDA 3UQSA 1R89A 2OIHA 4FXWA 4DR5J 3NOGA 4KHMA 4F7VA 2OMLA 2CG4A 3BR8A 1TQLA 3OL8A 3F56A 2RU9A 1YGYA 1NK8A 5EWGA 5JVGQ 2CJQA 4QIGA 1VQNS 3VHQA 4A4JA 2DO4A 1EP4B 2ASLA 1Y5LB 4ELVA 1YJWS 1FJGF 3PCOB 2EFGA 4DL6A 3QQCD 5D4PA 4NA2A 5T14A 2Y1JA 2XHWA 4NLSA 1D0EA 3K5OA 4KHRA 2M0GB 1RK8A 1S4FA 4QW8A 3EJMA 1RYRA 1Y4ZB 4XDCA 1VRUA 3TO8A 1M90T 3OFHA 3V6DA 4X4QA 3A8EA 4N8OA 1CC8A 4O3RA 1RWKB 4DV3J 4R8UB 2YX1A 4TU7A 2MQOA 3CCUS 2EK6A 2VFTA 4F0MA 1EKSA 2NR0A 2AT1B 1M0SA 5KFZA 2AIRB 3KHLA 4J9LA 2VICA 2OP5A 1SL1A 3EUNA 4DV0J 3IGVA 1FEEA 5KFVA 4C48A 1K73T 1K1SA 2DHAA 1JIHA 4DPOA 3NG8A 3QATA 4DU8A 5FLXY 3AXKA 3O3LA 1IBKF 1ULRA 1RT7A 8AT1B 1MNEA 5CZXA 1KBRA 3A12A 2MLZA 1OPIA 4E8UA 2HS3A 2BQRA 3LANA 2QYCA 3HHLA 3I0SA 3R5CA 1JXEA 4DQRA 3AQOA 4CWBA 4OHZA 3I5AA 5JMNA 3J7AN 1H2UX 2NUHA 2OFGX 3QGHA 4H4MA 4HH0A 4DR1F 3OT9A 4J9NA 2YNFA 4ES2A 1GMWD 2CZVC 2CNLB 2K3IA 5F9NA 5IQQA 1HNXJ 2W4PA 3MEGA 2IC3A 2H5JB 2PEHA 2H3EB 4ZK7M 3V6DB 1IKWA 1MN9A 3G9CA 2OEKA 3MPVA 1FNXH 1UPMB 3DDIA 1LWXA 1ZPWX 1NCLA 4MH8A 4NYZA 3ZZOA 4J9QA 1S1UB 1E6VA 2BDPA 3SI8A 2OPPA 3BSOA 2IMOA 2KYXA 1Q8IA 2YWGA 5LL6d 3IM9A 5KG6A 3WX4A 3R5BA 3K17A 1IM4A 1N5YA 3AA8A 1EZZB 4C7QA 5IOLA 1SIZA 2E5HA 3OV7A 5E3CA 2EWHA 2EEYA 1UCNA 3H59A 1KN6A 1RTIA 1M1KT 1N34J 4NCAA 2R4FA 3CC4S 2ZH8A 2MJNA 3ZZTA 1RT7B 4DS5A 3TZXA 3CW2C 2OMOA 3HHDA 2B9XA 3ZZPA 2D41A 1XC9A 2J7WA 4ZVQB 3I0SB 3HHLB 3LH2S 1UWBA 3NWRA 2RHQB 1H2VZ 4DN9A 3CC2S 1Q8LA 4GO5X 3E3XA 4O3SA 3IFEA 2IM1A 4H4MB 3D0GE 3IC1A 2PMZD 3KK3A 2ZBRA 2G1HA 1I1GA 2KHDA 3T1AA 5C24A 5D4LA 4WK3A 2W7AA 1M5PC 1RAAB 1WHVA 5J2MA 1U2RA 1NSQA 1CS4A 2YNFB 3G96A 3KLFA 1HNWF 2Y0SD 1PBUA 2XG8A 3MEGB 4GKKF 5K8MA 2IC3B 1N33J 3D66A 2KM8B 1IKWB 4FPRA 5HL7Q 2GO9A 3NGSA 3J80Y 1REVA 1S9GA 4DV5F 5HN0A 2JSXA 4JV1A 4NXMJ 2AWZA 4O3PA 3L4BC 4ITSA 3M05A 3H40A 1DTTA 1E6VB 4KGKA 1NDKA 3A8IA 4P73A 2OPPB 3M2RA 5E0OA 4PG7A 5D3GA 4H54A 2DNGA 2B4PA 3HVWA 3BF4A 3NMRA 3PX0A 4RW4A 4WKYA 3AD7C 7FDRA 1WOOA 3AAWB 2X3GA 2YKNA 3UWTA 1T94A 4M5GA 1N5YB 3BQ1A 3CCSS 4F0HA 3D3BJ 4YQWA 1VQLS 1X8DA 1RTIB 3CDEA 4JI4J 4CO3A 4M5DB 3Q22A 2HRUA 4HDHA 4F4WA 4Z37A 2AJ1A 5ITHA 5KOXA 2MZTA 1BWEA 2Y1IA 2V4JA 2HQCA 1UWBB 1X7VA 4USTA 5F0WA 2O5DA 2HZVA 4F3QA 5FIIA 1OO0B 4DR4F 1PJ6A 4GKJF 3MOZA 3ZTOA 5K8OA 4CLPA 3KK3B 5C24B 1NH7A 1Y10A 2YQ3A 1WC4A 1IWAA 4NI2B 4ZVRB 1NNDA 4HEA9 4X4OA 3KOAA 2BKPA 5J2MB 2J9DE 2OJ3A 2GVDB 3KLFB 1YBTA 2QV6A 3ILJA 4AYBD 2HVDA 2DJWA 2DIVA 3ENAA 3M8ZA 2MHEA 5KFHA 1REVB 1S9GB 5KT4A 4NA3A 4DX7A 2RE1A 4UUWA 2KL8A 1FO1A 2DR6A 2OGUA 3O8WA 3QWPA 1URNA 1L3KA 1HI0P 1U47A 1S10A 3P4UB 2W4DA 3M2RB 5D3GB 1P6TA 4YEAA 5GAEU 2QMWA 2HQFA 3VVUA 3Q8YA 4DV7J 4NZ6A 1HQ2A 2MDAA 2YKNB 2Z2LA 4DQIA 1JLFA 3FSXA 1KLNA 1N5SA 3BGRA 3CIZA 1BQXA 3I9V9 1FWPA 1S97A 2OO4A 2QA4S 1N52B 2MKIA 1IUJA 2HHQA 2WVBA 1U49A 3C8YA 3W2VA 2ZNYA 1U2CA 2V4JB 2XMJA 2QA2A 2VQFF 3FNNA 1S79A 4Z7YA 1D09B 1C4CA 3MGJA 1H74A 4RW8A 3CJSA 1RKJA 2A2CA 2VPYB 3OUYB 1NU4A 2AZ3A 2ZJQQ 2VUGA 4ZVSB 3R1LA 3K7RA 3MMAA 4ZVHA 4ZPWR 1R8BA 5D0EA 2DXFA 4FDFA 4QWBA 1Q86T 3WHIA 1TK8A 1S6UA 1OYEA 3SFUA 3EZUA 2E5IA 3GMGA 1FKPA 3CGIA 5DQIA 5AXKA 1S9FA 5AJ3J 1VFJA 2IVFB 2WBRA 3OTOF 3RU0A 2FZCB 3WZ0A 1RHJB 5B0FA 1FRHA 2YWWA 1S77D 3JSRA 1L3SA 3PW0A 4B9VA 2QL9B 3QT7A 3HK2A 2Y1LB 4XDDA 1LWCA 1OMSA 4HHJA 1NRKA 1R6YA 4UF4A 1Y0HA 3HSDA 3ISND 2F9DA 2AF6A 2A3JA 3M2VA 4R25A 1RB0A 3BGRB 4X84A 2OEMA 3VTIA 2HVHA 3KJVB 3HSZA 4A8YA 4LF6F 1RHMB 1YRXA 4Y34A 4C3KA 2AZ1A 2E7XA 3IAM9 2LECA 3OTDA 3S7RA 4OIXA 3BH6B 4YR0A 3DXSX 4PG8A 1FJGJ 3B8HA 1RZMA 2NPIA 1HARA 1RT4A 3CTRA 4ECSA 3HKWA 2NS1B 4ZJQA 2XCAA 5KFQA 3FUYA 4RW8B 3IR7B 4IG0A 2QSWA 1IXKA 2OUGA 4CLUA 4WFNQ 4QPTA 2HZAA 2VG5A 2HVEA 1TKTA 2HLUA 3KXDA 4QW9A 3MMAB 4C4WA 4NWBA 4X65F 3M6WA 4KV8A 2RH3A 3OR1A 1XMBA 1M1HA 4HTIA 1FKPB 1NHKL 2WBMA 4ECUA 2MKKA 2RQCA 1FKOB 1SH2A 1W2BR 5A2QU 4WFYA 3BGUA 4P74A 4UQGA 1VQ6S 1KVKA 3L7PA 1FRMA 3D1QA 3DU6A 1YLXA 1NKBA 3MMBA 2HVIA 3FDSA 1WORA 1UAWA 1ZOTA 2AEFA 5HMXA 3W64A 1U6FA 1FVSA 4RNHA 2XI2A 3HJFA 3CIMA 2LP4A 3KK2A 4B3RF 3M2VB 3NNCA 4YB5A 4RLEA 3B4MA 4LQ9A 4ZCIA 1IBKJ 1NJWA 2IHR1 1U1RA 1LFPA 2E5LF 2LMIA 2R3VA 2R7SA 2VPXB 3S01A 2BJ1A 1Y7PA 2RS8A 2XY6A 4C97A 1WJ9A 1S4EA 1XBWA 4ZJOA 3K0JA 1RT4B 3I56S 4B3OA 2DRBA 1F60B 2VG7A 4IG0B 4L76A 3PEHA 2XHCA 2H5EA 3R97A 4DR1J 1HW9A 3D68A 1KVIA 2KJWA 2VG5B 3IR5B 1TKTB 1WSRA 4DZ6A 2COLA 3NCQA 5CCMA 1T9XA 4WXOA 1ZTTA 2CNOB 2KG1A 4KV8B 1RISA 3OR1B 3DCAA 3AOBA 2C2MB 2J9CA 2CQ0A 2HS0A 5C42A 1AFIA 3DC2A 1A7GE 4OZ3A 1BGXT 3RB6A 2VZ9A 3P5TL 1RLDA 5IC4B 2G2ZA 4U96A 1X0PA 3OFGA 5EX0A 5LXRA 4K59A 2XMKA 3OLBA 5HQLA 1YDLA 2V69A 1PC4A 3KK2B 2QLWA 2MZ1A 2HK2A 2VA2A 2QLJB 2BJ8A 2Z2ZA 1RU1A 2N7YA 4WU3A 5KFGA 3QIPA 1RWXB 4ZIVA 1S6QA 1TUVA 1J5OA 3PFEA 5B0EA 3UO0A 4DSEA 3W5ZA 4N41A 3SQOP 2OTJS 3U27A 4P71A 2R42A 4OYXA 3THPA 1YRUA 5KT7A 4XO0A 3BSAA 3D54A 2RF2B 2IM3A 1HIYA 3GWCA 4B3OB 4ELTA 2VG7B 4F4AA 3KWMA 2M70A 1H7WA 1JJ4A 4JI5F 4XAKA 1UJ5A 1HNWJ 5DDPC 2LXFA 2I1RA 4JP8A 4GKKJ 3FSYA 3P8BB 3PR4A 1NKEA 4TXSA 4CO0A 4LF9F 3Q0AA 3P49B 3TARA 1XR7A 4LT6A 5C42B 1RA7A 2XMTA 3K5MA 4NMLA 2IJRA 1F1BB 1RACB 3Q8VA 2N4DA 1G2EA 3RAQA 1FXRA 3FFIA 1T05A 4FBUA 2XNRA 1NK7A 3TJ8A 3P5BP 1N36J 1RKIA 3CCWA 3UD5A 4ECRA 4WP8A 3ISZA 1AUSL 2FVSA 1KP6A 4B9SA 4ZPAA 2BW7A 1ZH5A 2HBZB 2KVQE 3QIPB 4F3OA 5F41A 4FF1A 1R8AA 5DM7Q 1S6QB 1J27A 1WUUA 1J5EF 4DL3A 4MKVA 1IBMF 2LA4A 2HQGA 1QAXA 3GJRB 1UKUA 3KK1A 2DNMA 3W9IA 5DRKA 2VC0A 1QSYA 4DR4J 3EE3A 3QNWB 3HPOA 4X66F 3GFZA 3EDQB 3H7HB 2BR0A 1SB6A 3MM9A 3AD8C 4IYQA 3SQGA 4O44A 2LDIA 3SCKE 4TLRA 5KFSA 2IDEA 5F8JA 1B7FA 1S7IA 4WIQA 3B6BA 2UUWA 2AJQA 3L3CA 2ZDOA 4DR2F 1RTHA 3QJPA 3T1YF 2R8GA 4YR2A 4NLDA 3ZFVA 4PRFA 3N0VA 4AXJA 4ED4A 2WVEA 3OPKA 1D8YA 2HYIB 2O01C 1I5OB 1WWHA 2QO3A 5HP1A 4USIA 4O3NA 3R2CJ 2G9OA 3PX4A 4G6VB 1TL3A 3FFIB 2CZ9A 4KGMA 3SCJE 5HJYA 2XWXA 2CWKA 2QYGA 2FYXA 2K06A 4HTJA 4CH1A 5IWAF 1IN0A 2YY3A 1SJRA 4WWSA 4M5JA 2KO1A 3W61A 4C98A 3NGKA 2NQPA 1X4CA 3DRSA 5LSRA 3E51A 1H3DA 3BBFA 2JNJA 4LJMA 1A9NB 4FYWB 3G82A 1G6BA 4L75A 4AD6A 1B3TA 1R3NA 5KG0A 4PZVA 2WVCA 1WDDA 1NDLA 1YTYA 4RUHA 3M4XA 4ZLJA 3FEYB 4I4BA 2FIUA 5IXUA 2AJ0A 1S57A 2VQFJ 1RAOA 3DLEA 5KG3A 3TWZA 2DCUB 3QJLA 4N5SA 4CLLA 1X9SA 2CQIA 3MM9B 1VOMA 4Y2IA 3SQGB 1H6KX 4A46A 1P8GA 4QJVA 4MK8A 1YJTA 1RUSA 2ZJPQ 2ZH7A 5HMZA 2HNYA 5B0CA 2R7RA 2EFPA 1X4HA 3QMQA 2IPOB 3G8QA 2LXUA 5B0GA 3Q8RB 1FDNA 3HD2A 3W2WA 4CYUA 1SKWA 3OTOJ 3BSNA 3P6YC 2ZH2A 2FJBB 1TL3B 3HMJG 2NLWA 3AQPA 4CM2A 2RRAA 1OY6A 2IRXA 4JI0J 4USJC 4AT1B 5B0DA 5HMYA 4A8KA 1X9MA 2HFZA 5MLCV 2CQCA 1Z4UA 4P2XA 3N5BA 5SZTA 3TP2A 2W2NP 4LF6J 4AL7A 3U7JA 2G0JA 2VA3A 3G82B 3HVTA 1L5UA 4FYDA 5E3AA 3ADAC 1QD1A 4CLWA 1K8AT 1SQFA 1T11A 3PX6A 4B3MJ 5D0GA 2DGOA 3FQKA 1S49A 3KNGA 4OI4A 2IBKA 3DLEB 2J6UA 5THWA 4J5OA 5EDWA 5KFEA 4ZLPA 2LLZA 4A8FA 4ZP6A 2BM1A 1JKHA 5GAEI 2DTJA 1E6YB 4MFBA 4X65J 3ILOA 3PKYA 1ZBTA 2A18A 2A6OA 2HNYB 1UJ6A 2ZC3A 4UQTA 1IR0A 2WOMA 2H48B 2LQ5A 4O3OA 2AYGA 3H2LA 2PT0A 5LXYA 1KD1T 2BX6A 4ZPTR 3W2WB 1U1LA 4CYUB 2JDJA 3VAMA 4X4TA 4WU2A 4NLRA 3QRPA 2OD6A 1NMEB 3HHLD 3V81A 4OMFG 4OYIA 1UFWA 1CEZA 4UOCA 1U1MA 2DNRA 1FE4A 1S0NA 4NZ7A 1WELA 1O5JA 4ETXA 3PHEA 5A0YA 5CH7B 2IJNA 4QIEA 4B3RJ 3DRRB 3CVKA 3FBCA 4EU0A 5A8WB 3FRYA 2HS4A 4MMOA 3DRPB 3GILA 2E5LJ 5F8IA 2OSRA 4KAIA 4MJKA 2XTJP 5FJ4A 3M7VA 1RT1B 3OFEA 5H1SV 3V6JA 1FFGB 2BANA 4OX6A 2J0SD 4JI8F 2JEFA 1U0SA 2NSCA 3T9ZA 3R6GB 3UN5A 2OH2A 1JLGA 1DLOB 1RT2A 4HI2A 1YBUA 1I51B 3JSMB 1R43A 2R2TA 4QPXA 3T5KA 5DM6Q 5CZVA 2QGFB 1VBZA 4FKXA 2IRYA 3ZZRA 3PJWA 4LR7A 1X0FA 3BDEA 3R7SB 2HVZA 2KJVA 1HWKA 2YKAA 4PYAA 4ZP9A 4PXCA 2WOMB 3OXLA 1XNQF 1XR6A 3PACA 2XMAA 3UW1A 1RAHB 2J0QD 1SJ4P 3PYDA 4BWJA 4OHXA 5AE1A 2E5JA 1SJFA 4P6QA 2GJ2A 1HL6A 3PHTA 2G13A 3M6VA 4FF4A 4PG6A 1OPZA 1Q8BA 4UY8T 4ZVGA 1N5VA 3QYYA 4H4OA 2B4OA 5A0YB 1QAJA 3TNVA 4UUXA 1F9HA 1K9MT 3LPEA 2CDRB 3M8RA 3LQVA 1R6VA 1VQYA 2JEJA 2Z0GA 2YWEA 3CE8A 1IJEB 1PCAA 2AW0A 2EC2A 1TZ0A 3PV8A 3M8PA 2Z58B 1ZZNA 3DGPA 2WCXA 5KT2A 1FD8A 4WF9Q 5DZ6A 2BANB 3Q86A 1IKVA 3BKTA 4YB7A 1QSSA 5KT3A 4BS2A 1GXLA 2XS7A 2RVJA 3A3PB 3GG1A 5KFYA 2B7BB 1T03A 1VK3A 1JLGB 2WRMA 1RT2B 4K4XA 4B3SF 3D67A 2AEJA 4MK7A 5JUMA 4JI5J 1QE1A 1UPPA 1GT8A 3DHWC 1MW7A 2PFDA 2DB1A 3NKYA 4RJVA 4F4XA 3G8TA 3DLGA 2GJFA 2P8IA 2GX8A 4J9SA 3CJTA 4LF9J 1IKXA 4WP3A 1ELOA 5GMKa 3X1LB 1ITPA 2EI5A 4HACA 4RBUA 2R7XA 3TVKA 2ZWOA 1CULA 2E44A 3UI3A 2VODA 3NMAA 3MMJA 3M8SA 4QWDA 3NGTA 4XK8C 2B51A 4Y2MA 4H4OB 4LFAF 4IFYA 2ABYA 3BR9A 3LA0A 2ZZNA 1XR5A 3W62A 3ZC4A 3CJKA 1I94F 3QZ8A 1SIWB 3AJ2A 1U48A 3RJMB 5KFWA 3IRXA 1YITS 2J7KA 1JNZB 3M8PB 1FXDA 1D9AA 1PILA 3DGPB 3KMSA 3M8QA 1H72C 1J5EJ 1IBMJ 4EZ6A 4F4ZA 1IKVB 3TA1A 5IS2A 2X1FA 2QC3A 3KDNA 3NBPA 2CJAA 3EVMA 2DBBA 4WZQA 2LEAA 2EBGA 4NLYA 2V9KA 4UW2A 3GG0A 2V8PA 3OL9A 4KBIA 4X66J 4KPYA 3RG6A 1R7IA 3EM1A 4DFMA 5EX3A 1CC7A 2B4UA 3MI7X 4W92B 4TYBA 3R5AA 2VD3A 3DLGB 4JI7F 4QYZJ 4OLOA 3J80U 4DR2J 4ZITA 1IKXB 2RSQA 4OHYA 4ZCMA 1Q82T 3T1YJ 1VR6A 2FC8A 2JFDA 2RUGA 1C0TA 2ZHOA 3L7OA 1AZSA 4LFCF 1A0OB 3IBFB 1PSDA 3DOMA 2KTQA 4J7CA 3UCZP 2UUAF 1X5PA 1X4EA 1TP7A 3W5XA 5F8LA 2X7IA 2ATCB 1YJRA 4KSEB 1U02A 4G65A 3NS6A 4U7UD 3LAKA 5IWAJ 4USKA 1AROP 4IFYB 2HQIA 2HMIA 2APOA 3CJKB 4OI2A 1VQ5S 5DZ7A 2DVIA 2GGPB 4O4GA 4P75A 1P9YA 2ZUGA 5D4OA 2KZZA 3TZYA 1QUPA 1NB2A 3IRXB 1QM9A 2H1YA 1T95A 3CJRA 3ISNC 3M8QB 4E2FB 1U8WA 2MMYA 4DQPA 3FEXB 1S1VA 3NBPB 1HNIA 2MTLA 1WEZA 1NPKA 5I3PA 2VKRA 1FEHA 1C4AA 4M5NA 4U8VA 1WNEA 2DXDA 5KFPA 1RAFB 1LXJA 3OVAA 2MZSA 3HM9A 2HGNA 5I3QA 1KLMB 3KLIB 4DV2F 2O3DA 4DFPA 3VAJA 4L74A 2BE9B 1CBKA 3CCVS 4LSNA 3ZZ0A 2Q1LA 1C0TB 5J1PA 1AZSB 2DHXA 1B0PA 4B08A 3DOMB 3UDVA 4DFKA 2ZNZA 3IBCB 1U25A 1UVMA 3C14A 3HVAA 2NZCA 4CM0A 3C66A 3MMCA 4ED5A 1M5OC 1F6TA 3M30A 2R7OA 3CCJS 2QMXA 3LF0A 3JSYA 5GADU 2UUBJ 4J37A 2QN6B 1JLBA 4USMA 5KFXA 2ADCA 3HF5A 3LGHA 4O4GB 2KXNB 3R5JB 3ZTPA 1G1XA 1VS3A 1M5SA 5LM7E 2RU3A 3PZPA 2K7JA 3DM2A 2EC0A 5B09A 3MURP 2QA1A 4F26A 3N6LA 3RRKA 3PKMA 1IKYA 1SKRA 1HNIB 4KGXB 4N56A 2W8LA 3B4DA 2BE2B 3C3LA 4MAKA 1KKHA 2EKYA 1I3OB 2I6WA 3EPGA 1RBAA 2OLWA 1HR0J 2CJKA 3K89A 1EARA 2WW4A 2KDOA 3SV3A 1P1TA 1BQMA 5A6PA 2IA6A 2AHOB 4USVA 1YI2S 5CA5A 2M4MA 2DRDA 2F1FA 3E8OA 1SH0A 2UUCF 3O5TB 2OHDA 4CZCA 1WSVA 4M5IA 1S59A 1HYSA 2DIUA 4EEYA 2IJFA 1UFKA 4OJ1A 4ILRA 1CJKB 4PXEA 3K2YA 2MLYA 1UZDA 2WTFA 1RHKB 3PDNA 4M5KA 3C14B 4CH0S 4ZN3A 2VJUA 4J9OA 2DGTA 3MMCB 1RT3A 4ZVTB 4QYRA 4CO1A 2KT5A 4URQU 3M30B 1UA0A 4PG4A 2BJDA 2JOQA 2SXLA 1JLBB 2IIHA 2CVIA 3D9BA 3SXLA 1D9FA 1NJYA 3CD5A 1GAOA 2FJDB 2E1RA 3QJJA 4QWEA 2KN4A 4IR1A 2B0GA 2FY8A 3DM2B 1LXNA 2PA3A 1CQNA 1UEKA 3D0HE 5KFMA 2DH7A 3V4IA 3JAMY 4JI8J 4YMEA 2P5VA 3ELHA 2CJYB 4KGVB 2NXNA 4A8WA 1DQAA 4DV4J 1UEVA 4OYMA 2GIQA 2UVWA 4JV5F 5CYQA 2LVWA 1Q5YA 2XMWA 3V4MA 4RNMA 3KUEA 3ZNUA 2W01A 3QGPA 2XNQA 3M9NB 2AGPA 5CYJA 1WTFA 5JXSA 3JXOA 4IOAQ 3U02A 2BVZA 4EO8A 1RCOB 1QTNB 1XNQJ 1X4FA 3D4JA 1HYSB 2E9TA 2C3PA 1ZETA 1FA0A 3IO1A 3MFHA 2A2DA 3LW5C 2OEJA 3QT6A 2ILYA 2CIMA 4DL4A 5C25A 3BGFA 3DYAB 5DGBA 2C2KB 3TX8A 1RT3B 3IM8A 1QTMA 2IVYA 4LBPA 3MXHP 3OXGA 1XIQA 1KTVA 1NJXA 4DPYA 3C46A 2C2EA 2ZH6A 4DZDA 2XULA 3GFHA 1RBLA 2U2FA 3I96A 4K2JA 1FRLA 2LFVA 2MEWA 1DHMA 4AUKA 1KOHA 3V6HA 4IRKA 6FD1A 1CG2A 1UVNA 2J7UA 5L8RC 3D1HA 2OFHX 3V4IB 1HBUA 2CQHA 5GAHU 3VGUA 2L08A 4I7FA 1X4GA 4C0OC 2FVCA 3FSIA 1R27B 2RT3A 1JXLA 3EXCX 3PRBA 3RB3A 1S5ZA 2M2BA 2YNIB 3PJXA 4NX9A 1CPZA 4B3SJ 3TQEA 3G6ES 5DQGA 2UV8G 1TR0A 1U24A 3DLJA 5CYQB 5GVQA 1R0AA 1FFWB 3RBDA 3FVYA 1XK8A 1LNQA 2BA9A 3S6EA 4KH1B 3FCWA 5F9LA 1H7XA 2X3DA 3C6UA 1XMOF 2O67A 4DJBA 4NXMF 2C2RA 1DQ9A 1FERA 2FC9A 1XTZA 4FVCA 4LRDA 3AHPA 9ATCB 3PIOQ 3KLHB 2XBPA 2YWFA 1OQ6A 2BXJA 5JJBA 2LXIA 2IM0A 4KTQA 4YFUA 1WF1A 3UDEA 3EWGA 4PAAA 1SPBP 5H9FJ 3GONA 3SBMA 3GR1A 1S7HA 2QT7A 4LFAJ 3QO9B 4Q45A 4FPIA 1I94J 1U2FA 4UY85 4NLWA 1FJCA 2V50A 4ED7A 3W66A 5IT9U 4JI1F 2N7CA 4WE1B 1T02A 3HSJA 4Q2MA 3NS7B 1PKUA 1VJWA 1KHWA 2ZKUA 1HBUB 2FLLA 2KRBA 3CF5Q 3K58A 3CDBA 2BQ3A 2I38A 4QR0A 2BOAA 3ZTSA 3NGUA 2CJBA 2VBXA 1VRTA 2VASA 4BLGA 1NDCA 3EX7B 1K0VA 3UVJA 1SV5A 1R8CA 1TELA 1R0AB 2EFVA 4LRBA 5I42A 4X64F 2ILZA 3HVRA 1S1XA 4PQAA 1VBYA 4LQ3A 2DH8A 2VH7A 3M8WA 4QWCA 2ZZMA 4JI7J 3DMJA 2XZDB 3VQTA 2DITA 4QIWD 4MT1A 4K7QA 5HLFA 5KG2A 4DSIA 4LFCJ 4OZNA 4IFVA 3POTA 2UUAJ 2ZBCA 4DV7F 2C2ZB 4C0HA 4DCOB 1HNVA 2GMLA 2VOPA 1TL4A 3K8WA 2JEIA 1JX4A 2F4VF 3MR5A 2WK4A 5H9EK 3M2UA 1H2TZ 4OZ0A 2WVFA 3CB4A 1LW0A 2IFXA 4A48A 1Q0NA 4DG1A 1C2PA 4V19J 3TJAA 1EQMA 2ZBQA 1GNKA 2VONA 4K0KJ 3H4BA 2MQPA 4JV2A 4LF1A 2L9WA 4RZRA 1TUWA 4HDGA 4ZP8A 3H2VE 2HHWA 2MY8A 1N54B 4ZJLA 1R0CB 4Q7AA 1FTRA 4NLUA 3UDLA 4CCHA 3CNQP 4PXDA 3M1VA 1GFWB 5CD4A 1VRTB 4FYXB 1EB0A 1FF2A 3IG1A 1EHWA 4OL8A 3UVJB 1SV5B 2NXUA 4R8UA 5I42B 2U1AA 2B9WA 4M63A 1S1XB 2WZ1A 4P2SA 2MKYA 5DJBA 2DNYA 2PMWA 3GV7B 4NLGA 2QLBB 2XLJA 1LK5A 1BY9A 2EPIA 1VQ8S 2WSEC 2Z4PA 2ZD1A 4B9UA 1FNOA 1MMDA 5J1EA 3QT5A 5HLFB 3VALA 1PAEX 5KFDA 3GPAA 4GC7A 4TU8A 4IFVB 3POTB 2MXYA 2CPYA 2ACMA 3CJ3A 5KFCA 4IH6A 2NYHA 2JLEA 2UUTA 2DYAA 5DG8A 1Q81T 1HNVB 4ZVPB 2ZH9A 1ZM9A 1UL3A 4I6YA 2P6TA 4O3QA 5L9NA 3NEKA 3TUIC 5B7WA 4NLXA 2GHPA 1WHYA 4M5LA 2V2VA 3M2UB 4AQYF 2IVMA 1LW0B 3JQJA 3BQ2A 3VAGA 3SCLE 1NK6A 5DDRC 3VGVA 4DG1B 3HHLC 3BJYA 1T9YA 1RADB 1VLYA 3R7NB 1HHQA 4JI6F 4Y2AA 5A76A 1U0HA 2R2RA 2QFIA 5HVGA 4X2BA 1DQ8A 1VI7A 5ETQA 3THVA 3TA2A 3CSKA 1NSKL 4RNNA 4DX5A 3M1VB 1X31C 5L46A 5DLGA 4HR2A 3QRRA 2KM8C 4ANDA 4S0MA 3IG1B 4BC9A 3CWJA 3PYEA 2ZHBA 1JLCA 1DARA 4BHQA 3G4SS 1N0UA 2MGZA 2ERRA 4ZKAA 3MAHA 1Y5NB 3ZO7A 1FX2A 3MUVP 2KZMA 3J7YI 2UUCJ 1QY7A 4CO4A 4NXNF 2ZD1B 1KQFB 1S1UA 4DUZJ 4ECWA 5J1EB 5G0RA 1MROA 5DG7A 2H65B 4MYUA 5F0UA 4AL6A 1BMQB 4P10A 2J8SA 1PC5A 2VKZG 2YXLA 1JLAA 2F9JA 3HZGA 2VB6A 4ECQA 1K0TA 4JOUA 4OJGA 1D1UA 2DGXA 4CTAA 3BM7A 5HATA 2V2QA 5MAOA 3RGIA 3ENQA 1QUVA 4ED1A 2D3OR 2F40A 3QLHA 1X4BA 3FQLA 2B6AA 2L3MA 2MQQA 3DOLA 3ET6A 2B8QA 2ZITA 2MKJA 2MZRA 2HHHF 4P7TA 1FNMA 4RUAA 4EMDA 2ZOGA 1YHQS 1HD0A 1UMJA 1U0HB 5DO2A 2ZOFA 1FRKA 4OV6A 3OVSA 3Q2TC 2DXEA 5J2NA 4ZA1A 1KFDA 1HPZA 2D7SA 2J0WA 5DLFA 9RUBA 1AA1B 2DH9A 4ER8A 4JV5J 2J6SA 3I4HX 2ATLA 1JLCB 2AYEA 3KJFB 2W7PA 2MGZB 2C2NA 3Q89A 3MM6A 2IYIA 4U95A 2DNPA 2Y1RI 1UTAA 3NL0A 5GADI 4J91A 3MECA 3HLUA 3MHYA 2R7VA 3VGTA 5G0RB 2F4FA 3WC2A 1MROB 4MIBA 2XO7A 1Q5VA 1PJ5A 1ZM4A 4YB6A 3KYLA 1JLAB 3ZZYA 2XYHB 4HH1A 1SJ3P 2JVRA 4DI6A 4CTAB 5K8PA 3I9ZA 3HI9A 2VDIA 3ONQA 4XPEA 3MWBA 4N76A 2ZVSA 1PBAA 4M5DA 2W4CA 3QLHB 3NP5A 4R0EA 2OPQA 2B6AB 3SZ2A 1NK9A 2MQNA 3DOLB 4MK9A 1HWUA 3ET6B 3MM7A 3E2EA 1RABB 2NCKL 2RRNA 4P7VA 2Q6BA 2YNGA 3AT1B 4A8MP 1P9QC 2C3UA 2LQ8A 4RWXA 1EETB 3G2XA 1AYEA 2DNQA 4DCJB 4NI2A 1TTHB 2E7WA 5J2NB 5E33A 1HPZB 3M6UA 2GVDA 2Q3PA 4NZ0A 3W63A 4FS1A 1WTBA 1JXVA 2UXDF 4IQMA 2UVUA 5A2QY 2NUUG 1VBKA 4OX8A 1YJ9S 2YWKA 3W65A 4Q8FA 3KLEA 2XMMA 4RNFA 1TK0A 1XMOJ 3MM6B 4ILMA 2HW3A 5ETMA 4F2SA 1JWWA 4NLVA 3MECB 3LO3A 2DGSA 5ETNA 4CDIA 2ZUAA 5F3ZA 4DR7F 3Q8SB 2A10A 4EZ9A 4Y00A 1MWQA 1RHUB 4EK2A 1T7PA 4ZS6A 1N36F 3TRGA 4J9MA 2LCWA 2LU1A 2MZJA 1NO8A 2B9YA 2GIFA 4DPTA 5KFJA 3I6PA 3CDAA 3O2IA 2EG1A 4NLQA 5ETSA 4C8KA 3G71S 2AKWB 4I6AA 3F73A 2BYCA 2AU0A 3O1LA 2DPIA 3I87A 5E41A 3I32A 1KRPA 2OPQB 1WC3A 4JI1J 3MM7B 5KFBA 3CXCR 3R8YA 4ZHRA 2YNGB 1JK9B 4YY3F 1RYSA 3QZ7A 4B9LA 3B78A 3OUYA 1ZM3A 2J6TA 2V8DA 2FDNA 1FD2A 1HLWA 1UFLA 2VC1A 4X4SA 5B0BA 3NLCA 4TY9A 4KRWA 4X64J 5F3TA 2IYGA 3CCQS 3KLEB 4OYBA 2B43A 3JTPA 3MDFA 1IM6A 1NZ8A 3H8YA 2HRYA 2RRBA 2H5IB 2JH3A 1B7YB 1KS2A 1U8SA 3OLAA 7AT1B 2K1RB 2E66A 2W9AA 4PQUA 2XCPA 2V67A 3CMQA 5LJ5Y 3S8SA 2FB0A 2X1GA 2PE8A 2HK3A 4DX6A 1RAIB 2KT3A 4C8ZA 2H4WB 2W1BA 3MEEA 3AY0A 4Q44A 3BGOP 5BJRA 4TY8A 2F4VJ 1CJVA 3FC9A 1LKZA 2N82B 3KJVA 2PDAA 4JB8B 4TQRA 3L95X 2MKHA 2NXJA 2BABA 2CQ3A 4NCGA 3SYZA 2Z56B 3NWGA 3EGVA 5I3UA 4UOHA 3LGMA 4ZHRB 4NRTA 4YR3A 2I9SA 1KDNA 2KU7A 4USHA 1B99A 4CIOA 1JLQA 1F0XA 1NKCA 1BQNB 5JVHQ 4LBHA 5FD1A 1VC0A 1SQEA 2XO6A 3AXMA 4CP5A 1HI1A 2J9EA 2UXCF 1IR1A 2UV8A 2C1EB 3OFFA 3MR6A 5KG7A 4W4MA 2K8GA 3BYRA 2HNDA 2ZOMA 1MU2A 5B08A 2ACYA 4ZIWA 1FKOA 3FRZA 4ANEA 5KG1A 3H5YA 2HLTA 4HHUA 3H90A 1HA1A 2DHGA 4ED0A 1RWMB 4PQUB 5J2PA 3HCXA 4LSLA 4ES1A 2V6AA 2C28A 3LP0A 4JI0F 4DLEA 4LVNP 2ZC4A 4NLOA 1N6QA 1RI7A 5IM0A 5KG4A 3WX8A 3OW2R 3MEEB 4G3IA 1I6JA 4TY8B 3VGSA 1CJVB 4LF8F 2GJIA 1UJ4A 4QZVB 3OL7A 2VPZB 3G6YA 1LFWA 4AQYJ 2EK1A 2RILA 4DQQA 3PXGa 1N32F 4X4RA 5KOWA 4NCGB 3LWLA 1V3ZA 3IN5A 2KKHA 2RKIA 5I3UB 4A8SA 1JJ2R 4B3MF 3FZBA 2O1PA 1YK9A 2WB1D 4JI6J 3D1OA 5ETVA 3MPYA 4KJIA 1TFYA 1JLQB 2F7VA 2LYVA 3R6LB 4OX7A 5EWEA 3UD4P 2EFQA 2A0FB 5AXMA 1OS5A 3MUMP 1XNRF 4K4SA 3VVTA 4MKAA 2H51B 4L6V3 1OQ3A 3OD2A 2E5GA 2CKWA 1QVGR 3F0NA 2HNDB 5BYSA 1MU2B 2JLGA 1EKRA 3V6KA 2OD4A 2AGOA 4KO0A 2CADA 5KFUA 4AFFA 4NXNJ 1WC5A 1NLKL 4LUBA 1RAEB 5HK4A 3GV5B 1G4CA 4NLPA 3K8VA 4L72B 1WKKA 3EPIA 1T9TA 5J2PB 3BZQA 4LSLB 4B17A 4BC7A 3ITHA 3LP0B 4DWIA 3FKBA 3N9UC 5GMDA 1AW0A 3KLGA 1N6QB 5IM0B 3PG9A 2IMWP 4DN0A 3IA0A 4WJBA 3NNAA 1PAUB 1S1TA 1RDRA 3BH7B 3TAMA 1LWEB 4WP9A 1YVFA 2JX2A 2XMUA 4A8QA 1NK5A 1VQKS 3H2UB 3VCDA 1ZZFA 1WC0A 2BZ2A 2RKIB 2HHHJ 4IH5A 2XLIA 5K20B 2EKNA 3IWXA 3R27A 2RF2A 2IRUA 2GAGC 2Q79A 4ETZA 2DR7A 2LQJA 4DLGA 4HHHA 2QX0A 3KTQA 4M1KA 1EJ7L 2HQDA 4QR1A 5J1NA 4ZPBA 1T3NA 2VOOA 2ROPA 3SSSA 1UVLA 2DNZA 4N47A 4C0BA 4DL7A 1HWLA 2ZBPA 2DHSA 4KO0B 3BBBA 2QEXS 3RUBL 2FHJA 2L9NA 2OTLS 3TZWA 5C5JA 3ULHA 5ADZA 4RBVA 4X4NA 4X62F 5HQMA 5HQ8A 3GFYA 4K4ZA 4BCAA 2OELA 1ZAVA 3PYFA 1DTQA 4JYAJ 4I67A 4RW6A 3ITHB 3M9MB 2W2MP 5D8HB 3HP6A 4Y3CA 2JEGA 3KLGB 1RWVB 1FKAF 2D3O1 1UW4A 1FXLA 4DPWA 4OZLA 3RR7A 3DRYA 2OI2A 5LMUF 1S1TB 4DV1F 3TAMB 1RLCL 3LUYA 2MLXA 2F8EX 3KG0A 3TYTA 3HJVA 4NCBA 4RW9A 3G6XA 4NA1A 3D6FB 3BV8A 3HDSA 2H4YB 4LRAA 4F02A 4ID8A 2CPIA 3VAHA 3QPIA 1PG5B 3GJTB 1MMNA 2NREA 2BUNA 4USWA 3G8SA 2VU5A 3WDOA 1NK0A 2XWYA 2QJ3A 1KR4A 1NJZA 5A8KA 3X3UA 2UXDJ 1FHTA 3LP1A 1IQTA 2GO8A 2ASJA 1AFJA 2Z8QA 1TKDA 2BJ9A 2VQEF 1P27B 4ELUA 2CQPA 3I5CA 4C8MA 4LIRA 5EWFA 1S1WA 1F9EB 1MN7A 3MPWA 3KJQB 1RA6A 2BEFA 2DNLA 4MIWA 1H98A 3BO4A 1WD6A 4DR7J 3NAIA 2HWHA 5L1IA 1V3RA 1DTQB 3AOAA 2XY7A 2GZOA 4RW6B 3MCSA 3LP2A 4DV6F 1NB7A 3G87A 3CPWR 1RTDA 1GX5A 2RS2A 2DNOA 4UZBA 3CO9A 3R5GA 1WHWA 4Y0FA 5KFFA 2HIYA 2C42A 3J81j 3PO4A 1VQSA 1DURA 3PO5A 4P52A 2ZZTA 1JMTA 1SUQA 4RW9B 4WCEQ 2C3MA 4YY3J 3THTA 3HULA 1WEXA 1SC1B 5D0HA 4O0NA 4DMZA 1MWYA 5DQHA 2XGQA 5F8MA 3RBZA 3GR0A 4RNOA 4MYTA 5A8KB 5KT6A 2MZQA 2HZCA 3TA0A 4LMZA 2NXEA 1SKUB 4KHPF 1L3UA 4WKRA 3GIJA 3MAAA 3LP1B 1J2VA 2ZWPA 2BQUA 1FTCA 4K4VA 4XTTA 2DHHA 2HPUA 3RW7A 3GP9A 3BB5A 1BE4A 5LT5A 1WACA 2BJ3A 2PGCA 1RCXB 3QSIA 5E7OB 5BR8F 1S1WB 4YUDA 1GTEA 4KFBA 1DBDA 3T19A 1B4SA 1VQPS 1ZPVA 3ZZZA 3D6TB 2WW8A 5CYMA 2AYMA 4EO6A 5IV3A 4LF2A 3LP2B 3Q2SC 3EMTA 2PFFB 1XN9A 4Q8EA 1RWUA 2WVDA 4DSJA 2L9DA 3VF0B 1RTDB 3L9ZA 2AP6A 3GYXB 3J7A1 3CCTA 3PW7A 2UU9F 1EX8A 2CQ2A 5KFIA 1NPRA 2V8GA 4BBYA 2YKPA 3HT0A 4FBTA 4KE5A 2HFVA 5CQGA 1WF2A 3IP0A 5KFRA 1R0BG 1SUQB 1TKXA 2CRLA 3K5NA 1NPPA 2QLFB 1Y11A 3G86A 5IC6B 1WF0A 4C9DA 1VRUB 1FRJA 4L73A 3GJSB 3EGZA 2CJ9A 1IR2A 4FKYA 5DGAA 2GAHC 2V34A 3FEZA 1T9WA 3PVXA 1ACMB 4FYYB 1E6YA 3IR6B 2YH1A 2R2UA 3UR0A 1NBEB 2UXCJ 3BN4A 3MAAB 2A6MA 1SBRA 4ZVUB 2FJAB 5KFAA 4RU2A 2JC0A 1MMLA 1RP5A 4E0DA 3DLKA 1TL7A 3D6MB 3J81Y 2R7TA 2R7WA 2AJ4A 3A8JA 3MFIA 3TVYA 1OJ4A 1B70B 1AT1B 4ZP7A 4KFBB 1HD1A 1L3TA 5T41A 4ZPVR 5CYMB 3BO3A 3FZ2A 4K4WA 3MM8A 3NCRA 2MQLA 4GMKA 2XB2D 2J76E 5L1LA 2DR9A 1GXTA 3P45B 4EYIB 2AYBA 5HANA 3DRRA 2P9CA 2UUBF 3DLLQ 4O23A 1N4LA 5A8WA 1G7CB 2R7QA 4LF8J 1PGZA 1P1LA 3DRPA 2RQKA 3S1TA 2M3DA 2PA8D 5RUBA 3NOCA 5I4MA 1RT1A 1N32J 3K57A 1OSCA 2KVIA 2AV5A 1SC3B 3GYNA 3F41A 1NHUA 1TKXB 2XLKA 4ID5A 5HI7A 3FBFA 2MKSA 4C8OA 1RAGB 4PPZA 4WFZA 4IR9A 7FD1A 2E1CA 2F8HA 2VL1A 1U1OA 1DLOA 4IKAA 3PM9A 1SKSA 3JSMA 1HR0F 2IBOA 5IT4A 3NCPA 1XNRJ 4CO2A 4ZLNA 2FLOA 4WPAA 4U8YA 3GIKA 1DRZA 2HHPA 1AXQA 3D5MA 2B5JA 1JNRB 1G3OA 1HNZF 4ILLA 5ETRA 2J9DA 4W98A 4F04B 2M9KA 3MAQA 1VC6A 1VMBA 2F5GA 2LEPA 3GE9A 3DLKB 3PYGA 1TL7B 1M1GA 5SUHA 3GCXP 4QQBA 2VFUA 2ZEJA 4Q0BA 2XS5A 1VCTA 2P9EA 1Q79A 2DNHA 1NSAA 4KIAA 2YPZA 1NXIA 1F3FA 2DGQA 3MM8B 3KMQA 1BLUA 4P2MA 3DLHA 3A1YG 2AQ4A 5HAOA 5L1JA 3AJ1A 1VIXA 4OFZA 2VHGA 2G2OA 1LW2A 3VV2B 2P6SA 1X5OA 3Q24A 2HG4A 4BWMA 2CYYA 3GU0A 1RT5A 4RBTA 3RRGA 3ZZUA 1K44A 2R2SA 4NMXA 4X4UA 1PYOB 4ID5B 1TK5A 1CS4B 4QWAA 4K4TA 4PR6A 3O6QA 1JQGA 1D9DA 1HFEL 4DV4F 2HNZA 4WYWA 3GTYX 2ZVIA 2G0IA 4C8NA 2QA4G 4BDPA 2R8HA 1BD6A 3FBEA 2PMHA 5A8RA 3SIPB 3TZZA 2HKEA 4PWDA 1AB8A 2B5JB 3NY0A 1DTTB 1TAQA 3ZTQA 4U67Q 3W8GA 4OYZA 3VZIA 2OKQA 3AJDA 1R8PA 4JI3F 4RW4B 3O44A 3OQ2A 1QDUB 4A8OA 3CJQA 2KB2A 1B64A 2PIIA 4Q0BB 3OHAA 2E1MC 4X62J 4DDFA 4LRCA 3ZTRA 3W5YA 3CJ4A 1SJQA 4I69A 2ADBA 4TKTA 1VQ9S 1VK8A 4KT0C 1X60A 1ICEB 1RJJA 2N4CA 2DGVA 4NOHA 1TAUA 1LW2B 2LU2A 3FCHA 1SVDA 4FYVB 3KG1A 4OJHA 2VG6A 3W3SA 5FLXU 3EZ5A 2Q6CA 2HWIA 5LMUJ 3MR7A 3A8KA 1U45A 4DV1J 1QVFR 4KKOA 4I2PA 1FJEB 1RT5B
chains in the Genus database with same CATH topology
2D3ZA 2BRKA 1IBMF 2ZBIA 2ZH1A 2LA4A 1QAXA 3VZHA 2CQ1A 1UKUA 1U4BA 3I55S 3KK1A 2R7UA 4JI6F 4B9MA 2DNMA 2FHMA 4Y2AA 1IKYB 1U26A 3VAIA 5HROA 3T6BA 5DRKA 1N5TA 2VC0A 4ZMMA 1QSYA 3EGWB 4F50A 1B0VA 1URRA 2KHCA 2R2RA 4F4KA 4DBQA 2P9GA 5L1KA 1WEYA 4X2BA 3PY8A 2ROGA 3HPOA 3MEDB 1S6PA 3D28A 4X66F 3GFZA 3KHGA 1DQ8A 4FXVA 1VI7A 1HNXF 1YQHA 1LOUA 1Z2ZA 3MTKA 1JLEB 3THVA 2BR0A 1SB6A 3TA2A 1D8ZA 3CSKA 3MM9A 5IQ6A 5M2UA 4RNNA 2HNZB 4IYQA 3SQGA 1YJNS 4O44A 2LDIA 3M1VB 3RYLA 4FF3A 3SCKE 4AXIA 3MUTP 4TLRA 1DFDA 5KFSA 1HWJA 2RNEA 5DLGA 2CPFA 5F8JA 1B7FA 2KM8C 1BQMB 1QAYA 3LALA 2FHOB 2UUWA 3IG1B 1OWXA 4BC9A 2AJQA 3CWJA 4JUZA 3L3CA 5L39A 2FGOA 2HHXA 2CPHA 2PN6A 2ZHBA 1JLCA 2JC1A 4DS4A 1DARA 2ZDOA 4BHQA 1R8HA 3NRBA 1Q1KA 5A8RB 3G4SS 1U7LA 4RX6A 4DR2F 1N0UA 4QIFA 2MGZA 2BOPA 2AX0A 1RTHA 5HMWA 2ERRA 4ZKAA 4PWDB 3MAHA 1Y5NB 3QJPA 4F8RA 3T1YF 3BN7A 2R8GA 1V9OA 2DNNA 4HT5A 4TNOA 1N48A 4YR2A 6FDRA 4NLDA 1Q7YT 3MUVP 3ZFVA 3M6XA 4PRFA 3N0VA 1XEZA 2KZMA 2G4BA 2M8HA 4AXJA 1NAQA 4PKDB 3J7YI 4URSA 1QY7A 3OPKA 3CULA 4CO4A 1D8YA 2CQDA 3RB0A 4CO5A 2HYIB 4NXNF 1ROFA 2O01C 2ZD1B 1S1UA 1KQFB 4ECWA 1WWHA 2QO3A 5HP1A 4PUOA 5J1EB 4QCLA 4OI1A 4K5RA 3FJ2A 4G1QA 4USIA 4O3NA 3TW0A 3OXFA 5G0RA 1CSJA 2G9OA 3P96A 1MROA 3PX4A 4G6VB 4FXDA 1UVIA 5DG7A 1TL3A 3FFIB 4KGMA 4MYUA 3Q8PB 1H0HB 1Y3JA 5F0UA 3SCJE 3T5LA 2X1BA 2XWXA 2JZ5A 3U1NA 4AL6A 1PC5A 1QJHA 2VKZG 1M5HA 1JLAA 4HTJA 2F9JA 1VQ7S 2EVZA 4CH1A 2I5JB 1TV6A 1JLFB 5IWAF 3GSDA 4TYAA 2V4RA 4LQ3A 3HZGA 2VB6A 1N34F 4ECQA 1M5KC 3K59A 1IN0A 5HBMA 4HKQA 4U7UK 3WBZA 2YY3A 2ZE2B 1SJRA 2GIRA 2HWTA 3H4DA 1K0TA 2WHOA 2VBZA 4JOUA 5FDLA 4OJGA 1D1UA 2KO1A 2DGXA 3UCGA 4CTAA 4IOCQ 3BM7A 1RAJA 5MAOA 2C3OA 4C98A 3IWLA 3NGKA 4DSKA 4WXWA 2NQPA 3QWUA 1X4CA 3DRSA 3ENQA 1QUVA 3I5BA 5LSRA 4ED1A 4M8LA 1TVRA 1Z2LA 3E51A 1H3DA 2B56A 5F8GA 2D3OR 1O0PA 4LJMA 1A9NB 2K2PA 1S0VA 2F40A 3QLHA 5CD4H 1X4BA 2VG6B 4QU7A 3FQLA 1G6BA 2GGPA 2B6AA 5CHCB 2L3MA 3T1HF 2NPFA 3RR8A 3PW5A 2MQQA 1SXLA 3DOLA 4W90B 3W2VB 1R3NA 1LWEA 1BC6A 5KG0A 1X9WA 4DSFA 4R5PB 2ZITA 2RQMA 4KKOB 1YIJS 4I2PB 2MKJA 1YTYA 4RUHA 3M4XA 1SC6A 2MZRA 3FEYB 1RQ0A 2HHHF 5U47A 2VBYA 4I2QA 4P7TA 4I4BA 1FNMA 1WI8A 4RUAA 2J0XA 3JB9k 2FIUA 5IXUA 1VHFA 2AJ0A 2ZOGA 3OSNA 4F2RA 2X51A 4F3MA 1YHQS 2E9ZA 2RDIA 1HD0A 3U1MA 2ZH5A 5HROB 3DLEA 1UMJA 5KG3A 2KFZA 3GZ7A 5DO2A 2ZOFA 1FRKA 2V8HA 2DCUB 3OVSA 3Q2TC 3QJLA 4IOBA 3IXQA 1S6PB 1S0OA 5L38A 4N5SA 2MSTA 2HHSA 5J2NA 4ZA1A 1X9SA 2CQIA 1KFDA 1N33F 1HPZA 3MM9B 1VOMA 2EFNA 1D3WA 2GA7A 4Y2IA 3SQGB 3M9OB 3HHKA 2CQGA 2D7SA 1H6KX 2YVSA 2J0WA 4A46A 1P8GA 5DLFA 4IRDA 1SJ1A 4MK8A 4QJVA 1YJTA 5M2RA 1WG4A 1Z1ZA 2ZJPQ 5KFNA 2ZH7A 2AGQA 5HMZA 2DH9A 1FRIA 2HNYA 3N4WA 2J6SA 5B0CA 1ZM2A 3I4HX 2EFPA 1X4HA 4LVOP 2R7RA 2ATLA 1JLCB 3QMQA 2AYEA 2D9OA 1W2IA 3G8QA 3MM5A 2W7PA 4B9TA 3MR3A 4CT9A 2LXUA 2MGZB 2W9BA 3OTEA 3SMZA 1KLMA 4DL2A 3KLIA 2PO4A 5B0GA 4ZCKA 4XIUA 3Q8RB 1FDNA 4EYHB 1X4DA 3MM6A 2IYIA 3HO1A 1DAXA 2DNPA 4DR3F 3BDPA 2F8MA 2Y1RI 3W2WA 3NL0A 5GADI 2R8IA 3MECA 3HLUA 3N6MA 3MHYA 1SKWA 1V6HA 4RU9A 4PUOB 3BSNA 2R7VA 4G1QB 4FNIA 3OHBA 3D0IE 3P6YC 5G0RB 2ZH2A 3V2UC 3WC2A 1LWCB 1MROB 4MIBA 2FJBB 2XO7A 1TL3B 3H5UA 3JSBA 3HMJG 2NLWA 3AQPA 2WONA 1ZM4A 5C25B 3PIPQ 2FJEB 2XI3A 3EYZA 2DGUA 4YB6A 2RRAA 2FHKA 2IRXA 3IS9A 1VQ4S 2UVVA 3KYLA 1JLAB 3UFCX 3CT9A 4RWWA 1TV6B 3H20A 2JLFA 4USJC 1X5SA 1HHSA 3ZZYA 1S6OA 5B0DA 4HH1A 5HBMB 5HMYA 3GQCA 4IG3A 1SJ3P 2QZ8A 4A8KA 5FDLB 4OQJA 3JYTA 1X9MA 2JVRA 4K4YA 4CTAB 2HFZA 4OV1A 4JI4F 3TUJC 5K8PA 4MKBA 5MLCV 2BM0A 2CQCA 3I9ZA 5DDQC 3HI9A 3CCES 1Z4UA 1TVRB 3ONQA 5KFLA 3N5BA 4M94A 4XPEA 3MWBA 4N76A 5SZTA 1UVJA 3TP2A 4OJ3A 4MTPA 2ZVSA 3MZIA 2BRLA 4AL7A 3IWNC 4M5DA 2W4CA 3QLHB 1NEEA 4NYPA 3U7JA 3DOKA 3NP5A 4R0EA 5D77A 2VA3A 2OPQA 2B6AB 3SZ2A 1NK9A 3CD0A 1S48A 5EN1A 2MQNA 3DOLB 1XWLA 3HVTA 4MK9A 1KC8T 4RUCA 1HWUA 1L5UA 2C2DA 3MM7A 3K5LA 3GV8B 3E2EA 4FYDA 2NZ4A 3US5A 5E3AA 1U1KA 2GMJA 3PW2A 4K0KF 2XGPA 2RRNA 4C8YA 4Y6IA 3UE2A 4P7VA 2ZM6F 5J2QA 4EFAC 2Q6BA 2YNGA 4I2QB 4TN2A 1K8AT 3R3TA 5AXNA 4X4PA 4JV0A 2GQQA 3PX6A 1N8RT 2FVRA 2XY5A 4HI1A 1UA1A 4HL9A 4I7FB 4A8MP 2DGOA 3FQKA 1S49A 3KNGA 4Q2LA 2FY1A 4OI4A 2IBKA 3DLEB 2MKCA 2J6UA 2G0CA 5THWA 4F4YA 4J5OA 5EDWA 5KFEA 3DDKA 4ZLPA 2W25A 2LLZA 3QIDA 1P9QC 1JB0C 2C3UA 3BGLA 4A8FA 4ZP6A 2XZWA 4RWXA 3JTNA 1EETB 2BM1A 4LIWA 2DNQA 3E01A 5KG5A 2E7WA 5J2NB 1JKHA 2JRSA 5E33A 4U6PA 1N56A 1HPZB 3M6UA 2Q3PA 4NRUA 4NZ0A 2B3TB 1HQUA 2BE2A 5GAEI 4FS1A 1WI6A 1WTBA 1FDDA 2DTJA 2UXDF 1E6YB 2V94A 3CCRS 4MFBA 4IQMA 2UVUA 5A2QY 1HW8A 2NUUG 3UNGC 1C1BA 3SEOA 1HBOA 4A8XA 3PKYA 1ZBTA 2A18A 4OX8A 2HNYB 1UJ6A 4KQZA 1YJ9S 2ZC3A 3C6UB 4UQTA 2YWKA 3RW6A 3MEKA 1IR0A 3MM5B 4Q8FA 2YNHA 2W9BB 3QAUA 3KLEA 2WAQD 2WOMA 3SFGA 2VV5A