2HGLA

Nmr structure of the first qrrm domain of human hnrnp f
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein F
publication title NMR structure of the three quasi RNA recognition motifs (qRRMs) of human hnRNP F and interaction studies with Bcl-x G-tract RNA: a novel mode of RNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 28
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hglA01
4A8XA 3U1LA 2DNZA 5IM0B 2MYFA 1WF0A 2K8GA 1G2EA 2CQPA 2HGLA 1A9NB 3IRWP 3S8SA 2A3JA 2EK6A 2YWKA 3UCUP 2XS7A 2CQDA 2DHAA 1WI8A 1R8PA 2J0QD 2RVJA 4OZ0A 4PKDB 1M1KT 1DBDA 2DH9A 2U1AA 1H6KX 1WG4A 5JVGQ 2KN4A 1FHTA 1D9AA 3TP2A 1WF2A 2XNRA 3BO4A 4EGLA 2LA4A 1Q82T 2M8HA 2HGMA 1M5OC 2B0GA 4UY8T 2LQ5A 2E5IA 3CCUS 1ZZFA 3NNAA 2CPIA 3UE2A 4PRFA 3D2WA 2MZ1A 2HGNA 5GVQA 1U1NA 2DH7A 2KXHA 5DDOC 1URNA 3PIPQ 1H2TZ 1UFWA 1U1KA 1VBYA 4TU7A 2M8DB 2ZJRQ 4QPTA 2E44A 3Q2TC 3R1HA 3CF5Q 1WEXA 2LXIA 2DNQA 4OZ1A 3VAIA 3NS6A 2LCWA 1L3KA 4IUFA 1P1TA 3BS9A 1U1RA 1VC0A 5GAEU 2MQPA 3NNHA 1JMTA 1ZZNA 4YUDA 3VALA 4ZKAA 1VQKS 2BOPA 2D9OA 2D3OR 3K0JA 2G0CA 3MI7X 2CQ2A 1P27B 2MKSA 1Q7YT 3EGNA 2MSSA 5D77A 3CC7S 1U1LA 1VQ9S 1KD1T 1D8ZA 1QVFR 4M5DB 1VC6A 1UW4A 1U6FA 2FPHX 1HD0A 3FEYB 3J7ZT 4RU2A 1HD1A 4YOEA 3CCMS 1M5KC 4WFAQ 2MY7A 2DGWA 2QA4S 3CCVS 4IO9Q 2CPEA 3LQVA 1VQOS 2MZQA 2ERRA 3US5A 1X4CA 2GO9A 2AYEA 2UP1A 2N3OA 2AYBA 2XNQA 2QFJA 1UP1A 4WF9Q 3NMRA 3G96A 4TU8A 3HI9A 2FHOB 2CPJA 4ED5A 4J5OA 2AYMA 5DETA 1FJEB 4CQ1A 1WG5A 1B7FA 3TO8A 2X1AA 4LMZA 1N52B 2F9JA 3IWNC 2X1FA 2YH0A 1M90T 2OTJS 1FJCA 1FNXH 2J0SD 2OSRA 2DNYA 3ULHA 2EK1A 5JVHQ 4FXVA 3VF0B 1JJ2R 2MKJA 1VQ6S 1X5OA 2MKIA 2WBRA 3FEXB 3ZZZA 4FXWA 1H2UX 3CPWR 2MGZA 3U1MA 3Q2SC 2DNKA 3JB9k 2XS2A 3HHNB 1RK8A 1U2FA 2MGZB 1O0PA 2LEAA 2KRRA 2BZ2A 3CC2S 1JJ4A 2XSFA 1K8AT 2DNRA 2LYVA 3S7RA 5LSOA 5LXYA 2DNLA 4WCEQ 3UCZP 2J76E 4CH0S 2PE8A 2CJKA 2YKAA 1FO1A 2L9WA 2CQIA 5LJ5Y 3SMZA 2NZ4A 5MLCV 3DLLQ 5HL7Q 3L3CA 3H2UB 1WEZA 2O3DA 2LEBA 2RU3A 3CCJS 1OWXA 3H2VE 1DRZA 5LXRA 2DNOA 2KH9A 3MD1A 2MJUA 5DM6Q 2X1BA 2LECA 2CQCA 5IFMA 1U1PA 4F26A 1F9FA 1OIAA 2M70A 2HYIB 2OJ3A 2VOOA 2U2FA 5FJ4A 2MKHA 1WG1A 2MQQA 1WHXA 2N3LA 2KG1A 2DNHA 5BJRA 2ZJPQ 1HL6A 2RS8A 4YB1P 3CMES 4W90B 2DGSA 2M9KA 4F25A 3CULA 4IOAQ 3MUVP 2MQMA 3THPA 5EN1A 2KRBA 4Y00A 1PGZA 1VC5A 3CCLS 2OSQA 3CCQS 4U67Q 5CXTA 2KM8C 2MZTA 1NU4A 2CPDA 2EVZA 1VQ8S 2DGVA 2JVOA 2CPHA 2MZRA 3CC4S 4LIRA 2YTCA 1X4AA 4PR6A 3CUNA 1WHWA 5GAHU 3MXHP 2CPZA 4C0OC 1FT8A 3R1LA 1JJHA 1WHVA 3UD4P 3I55S 1H2VZ 2DNPA 1U6BA 1QVGR 2MKCA 1WEYA 2D9PA 2VODA 3G4SS 2JX2A 2ZJQQ 3EGZA 3P5TL 1X4DA 2CQBA 2DHSA 2JWNA 2DHGA 3VAMA 3MURP 2RRAA 1SXLA 2MZSA 1X4GA 1VBXA 1YJ9S 1KOOA 2FC9A 1FJ7A 3MUTP 2DH8A 5ITHA 2V94A 3EX7B 1VBZA 2CQ0A 2DK2A 4TU9A 2F9DA 1QM9A 1K9MT 3CTRA 3SXLA 1YITS 1RKJA 5LJ3Y 2GHPA 2HZCA 1M5VC 4C4WA 3G8TA 2DGQA 3S01A 2MQNA 2LXUA 1R8HA 1SJFA 1SJ3P 1OPIA 3MD3A 2I2YA 1VQPS 2KHCA 2QEXS 4Z2XA 1YTYA 3I56S 5LSLA 3PIOQ 2M0GB 3DXBA 2DIVA 2AD9A 2KI2A 1SJ4P 3NNCA 5H1SV 2KT5A 2N7CA 2XS5A 1WF1A 5GMKa 2MQOA 1DZ5A 2MSTA 4WKRA 2KYXA 3CXCR 1YWXA 3N9UC 1N88A 2MPUA 5DDPC 1CVJA 1KC8T 3MOJB 2ADCA 2DITA 1KQSR 2KG0A 2OTLS 2RS2A 1VQ7S 2DIUA 3R27A 3P6YC 2Q79A 3UWTA 3CD6S 2CQHA 3P49B 2M2BA 3G8SA 4UQTA 1PO6A 4V19X 2DNGA 1X4BA 3CCSS 2DHXA 1IQTA 3LPYA 4CIOA 3VAJA 1WHYA 3G71S 1XN9A 3BO2A 2MZJA 2DB1A 2LKZA 1X4FA 1A7GE 4CH1A 1Q81T 2KM8B 2G4BA 2FC8A 4P6QA 2KFYA 2JRSA 1X5PA 5IQQA 3MUMP 1VQLS 2VOPA 2M88A 2VONA 2JVRA 1YJNS 2HVZA 3NS5A 4LJMA 2E5GA 3OW2R 2KXFA 2MXYA 3SDEA 1X5TA 3CCES 3VAHA 1WWHA 1HA1A 4WFBQ 3SDEB 2CQ1A 2DO4A 3J7YU 5GADU 2M52A 2M7SA 2SXLA 2DNNA 2DO0A 1VQNS 3S6EA 1S72S 1X4HA 2CQGA 3P3DA 4Y0FA 2L41A 3G9CA 2MJNA 2CPYA 2RQ4A 1M5PC 2LA6A 2KVIA 1NJIT 1X5SA 2J8AA 3THTA 2DGTA 3UD3P 1N8RT 4F02A 3BEGB 2MQLA 1YHQS 2NLWA 5DDRC 1WELA 5D78A 2RT3A 3CCRS 3MDFA 1SJQA 3CMAS 3VAKA 2MKKA 1Q86T 2CQ3A 2DGOA 4ERDA 2DISA 2DGUA 4QU7A 4QQBA 2G1DA 4WIIA 1VQMS 2DGXA 3G6ES 1U1OA 1X0FA 2XB2D 2KXNB 1AUDA 2YH1A 2RUGA 1OO0B 1VQ4S 1WI6A 1VQ5S 2CPXA 1NO8A 2DNMA 2RRBA 1YJWS 4C7QA 3UCGA 4IOCQ 2MB0B 5CA5A 5CYJA 3B4MA 3ZZYA 1YI2S 2CQ4A 1S79A 5DM7Q 2L08A 2K3KA 1K73T 5GAGU 1BY9A 3B4DA 3TYTA 2MMYA 1X4EA 1WTBA 5HO4A 3V4MA 1DHMA 2E5HA 2PEHA 2CPFA 2E5JA 2OIHA 2RNEA 4BS2A 2ADBA 2FY1A 2RQCA 2F3JA 1KOHA 2KU7A 2MY8A 2I38A 1W2BR 4QU6A 4WFNQ 3VAGA 1N54B 2LMIA 2X1GA 1YIJS 4W92B 4TLQA 2AYGA 5DDQC 1FXLA 1UAWA 1SJRA 3VAFA 1U1MA 1U1QA 1ZH5A 2MHNA 3BO3A 2M4MA 2N82B 3RW7A 3RW6A 5IM0A
chains in the Genus database with same CATH superfamily
1FK9A 2H1YA 2ZZTA 1FK9B 2Z2LA 1AT1B 4AL7A 5BYQA 4X84A 6FDRA 2W2QP 2XEXA 1N4LA 2IA6A 5KT4A 3QAUA 2XNRA 2LA4A 3UO0A 5KT7A 2B0GA 4LFCF 3DCAA 2HW3A 3QRQA 3BBFA 4HHUA 2DH7A 2FIUA 1U1KA 1QLNA 1P9QC 2PA8D 4RNOA 5I3QA 5K8PA 1UVJA 2GJFA 2JZ5A 3OV7A 4GVBA 1NK6A 4K0KF 1FWLA 2ZITA 1YJ7A 4GVBB 4NMXA 2HWTA 4KIAA 4JI8F 4QIVA 1FTRA 1Q8KA 3HT0A 3MM5A 2ZM6J 4V19J 2F8MA 3MM5B 1PAEX 4MYTA 2V6AA 4X62F 4PQAA 3TZXA 3CC7S 5EX3A 1GMWD 1UW4A 3M32A 1AFIA 1U25A 3HCXA 4DR7J 3M32B 4G1PA 2CPEA 4A47A 2V67A 3QWUA 2PFFB 2XNQA 3N6NA 5HQ8A 1VDHA 2FHOB 5FLXU 2VHGA 3KTQA 2AGPA 2CIMA 2CUYA 2RDDA 3U1NA 5GAEI 3ULHA 2EK1A 4LSLA 5HN0A 3FSXA 2EKNA 2FLLA 2VKZG 2OKQA 1JJ2R 4LSLB 3JTNA 3HD2A 2B8QA 3JB9k 1QUPA 4AXJA 5LSOA 4ZVGA 1SL0A 2W2PP 5B09A 3MM9A 3L3CA 3HJVA 2EEYA 1NHVA 3MM9B 4ANDA 3VGVA 4F26A 1WG1A 1VJQA 2DGSA 3CULA 5G0RA 2E9TA 3THPA 1JLEA 1KVKA 3QGIA 4Y00A 5G0RB 3O2IA 3A3NB 2ZWOA 4U67Q 5CQGA 2BABA 1WC1A 1WHWA 1NB7A 1H98A 5D3GB 4K4YA 3UD4P 2XMJA 2D9PA 4KGMA 3OL9A 2OUGA 4OL8A 3W1YC 3NP5A 1X0PA 1SKUB 1GMVA 2I1RA 2VBXA 2CQ0A 4EK2A 4NWBA 2ZC4A 4ZVPB 4CO3A 3G6VA 1N5QA 1K1SA 2LXUA 1FX2A 5F8NA 1HBUA 4C3MA 1HBUB 4X4RA 1S6QA 1ULRA 2ZNZA 4ZHRA 3SZ2A 1D8YA 3PO4A 1F60B 1S6QB 5H9EJ 2DIVA 1UJ4A 3HHLC 4ZHRB 2BX6A 3CDAA 4CI0B 4DFMA 1N88A 2HWHA 2OTLS 3KFWX 1DTTA 4ES2A 3D1OA 5ETPA 4V19X 1DTTB 3D54A 2DNGA 2HVDA 4E0DA 4LF1A 4PG7A 2VBZA 3PV8A 5K8OA 2BDPA 3L7OA 2W4DA 2F65A 4YDXA 2WHOA 3BYPA 3A3OB 2OD4A 2CYYA 5DGBA 2EFPA 3GSDA 1XNQF 4DR6J 2HNYA 4B3MF 4ED7A 5FD1A 1FF2A 2ZNYA 2R7VA 2HNYB 1R3NA 1X5SA 1TL3A 4U7CA 3W9JA 4DU8A 4O3QA 4USHA 1TL3B 5D78A 3QMQA 3MDFA 3BSNA 3GILA 2A0FB 1Q86T 2CQ3A 4XO0A 4IQXA 5D8HB 4EZ6A 3G6ES 2DXDA 1DJ0A 4O4RA 2ZHOA 3UVJA 4OX9J 4P74A 3M8WA 3UVJB 4PUOA 1X8DA 2W4PA 3TUPA 1H74A 4PUOB 1RDRA 2WVBA 5L1JA 3PY8A 3KMQA 1M1GA 2HRUA 1VLOA 2GFFA 2CWKA 5RUBA 1N54B 4FS1A 5IQ6A 1FCAA 3JS9A 2F63A 1YBUA 5HLFA 2ZJQQ 5HLFB 1KR4A 3F56A 2BJEA 1V3ZA 1Y10A 1RHUB 4NLYA 3JAMY 1NPKA 1OYEA 3HSZA 4PKDB 2PO4A 1NDCA 3KDNA 4DJBA 3QNWB 1D9AA 2XYPB 1HBMA 3ILOA 4Q8EA 1HBMB 2XSJA 4ZA1A 3HKZD 3UN5A 2XSJB 2UVRA 1B70B 4OZLA 4J9RA 5L1KA 4YMEA 2POKA 2WSEC 1RQ0A 4O3RA 2MQPA 3I82A 1VI7A 3T5JA 1QSLA 1W7WA 2CWXA 5D15A 4B3TF 4WP9A 3D3CJ 2HFOA 2PN6A 1TTHB 2G0CA 4C9DA 4PEOA 2PT0A 3PX0A 4KKOA 4PG4A 1V9OA 4JI1F 1BLUA 1R8AA 4KKOB 3PX4A 4OLPA 4C11A 4DHVA 3LANA 1F3VA 2GJ2A 4C11B 3UPFA 5F8JA 5ETKA 3LQVA 2I6WA 4X65F 3OLBA 2OPRA 3MCNA 2RUSA 2OPRB 1XMOF 3G96A 5J2NA 5HVGA 3VCDA 3DXSX 3M2VA 3HZEA 3IXQA 1YVFA 3M2VB 2V8PA 2HFUA 1U26A 2EFGA 1JQGA 4LF2A 2B8PA 3M8YA 4A8KA 4ECQA 2L9DA 2VQEJ 4MK7A 3H59A 4UTGA 2DNKA 1U2FA 4MMOA 4CYUA 4Y65A 3PRBA 1NKEA 1UA0A 1LK5A 5KOXA 5IT0A 4CYUB 1RT7A 1D0EA 4R8UA 5C25A 1QY7A 1RT7B 2KTQA 4R8UB 3PKYA 5C25B 3C46A 1XIQA 4QCLA 2HAFA 2N3LA 2DNHA 4ES1A 1IWGA 2GIFA 4EEYA 3D0HE 4HYKA 3MUVP 3HDSA 1VC5A 5D6GA 3CCQS 3BBBA 2WVCA 3DOMA 4KGKA 3DOMB 3SSRA 3IA0A 2CPZA 4DUZF 4DQRA 4PZVA 5ETTA 5M2RA 2HVEA 2QX0A 3EGZA 2JWNA 2VFUA 3FJ2A 3OL7A 5A6WA 1WDTA 1SH3A 2BJ3A 4Y28C 2ZH5A 1KEKA 2ZDPA 1GMUA 3R2DJ 1NK8A 3GYGA 1ZM4A 2CNLB 2VUGA 1SPBP 2X3GA 4K5SA 1AZSA 2CVIA 5KFMA 4DS5A 4YR3A 2AV5A 3FMWA 4K4UA 1AZSB 4WPAA 1VOMA 4NI2A 1RTJA 3MR3A 4DL0C 4NI2B 4F4AA 1RTJB 3QZ8A 2Y1JA 4MYUA 3ISNC 2KT5A 4ZPTR 2MQOA 3OTEA 4AXIA 1CVJA 2KG0A 2ZH8A 3CMQA 5A8RB 2DT9A 3UI3A 2ZH4A 1RKIA 1T9XA 3A8IA 2XY7A 1WC4A 2H51B 2WTFA 1JLBA 3CCSS 1XTZA 2NPFA 2LLZA 1JLBB 5IC4B 3DRRA 4A46A 3FBEA 3RUBL 3DRRB 2YNFA 4CO4A 4P6QA 4NLUA 4ZIWA 1IKXA 2YNFB 2Y8YA 1IKXB 3SV3A 2HBQB 4J9NA 3VAHA 1NK7A 1RUSA 4P7TA 4LF7F 2CQ1A 3NRBA 2BBEA 1WC0A 3T1HF 1ACMB 1ZM9A 1KS2A 2DGTA 2ATCB 2HURA 2Y3YA 1Y9OA 2V5HG 2VQFF 1UFLA 2DGOA 2R7WA 2I5JA 2E9RX 2I5JB 4BWMA 1TR0A 1RLCL 2YH1A 1NO8A 3L4BC 2UXCF 2KHDA 1YI2S 4PG8A 2YNGA 5GAGU 2YKMA 1KQFB 2YNGB 3L95X 4U9RA 1HQ2A 2YKMB 4WXOA 4NXMF 2C3YA 4UUXA 1S4FA 1S6UA 1OQ6A 1QE1A 4DV1J 3DRPA 1U1MA 3TX8A 1ZH5A 3DRPB 1BQNA 4NZ6A 4AQYJ 2MYFA 1BQNB 2GV1A 2HGLA 3M8QA 2XS7A 2VJUA 1HNZJ 2C28A 1WI8A 1R8PA 1RBOB 3EVWA 3M8QB 2OPPA 5LSRA 2OAUA 2IRUA 3ZZTA 1FHTA 2OPPB 4N56A 2CJBA 3EJMA 3UDEA 4QWEA 1ZZFA 3NNAA 3D1HA 4GKKJ 4IH5A 1U1NA 1QTMA 4HEA9 4ZP9A 3BSOA 1G6BA 2FVCA 4FF4A 4QPTA 9ATCB 3Q2TC 4ZVUB 1WORA 3EXCX 4P7VA 1U1RA 1N33J 2FZKB 4LBHA 2WK4A 4JBCA 2VH7A 2FGOA 4QR0A 3GYNA 2DD8S 4ZKAA 1A6LA 5ETVA 4OZ3A 1BC6A 4DSEA 1NM2A 4ELTA 4RWWA 1OY8A 3A12A 2V0NA 2CNKB 1ZM2A 5KFLA 2EI5A 5CABA 1KD1T 3QYYA 4AE5A 4DDFA 2AIRB 2GC8A 1HD0A 3VVTA 3TVYA 1FDNA 4RUCA 4M95A 4Z7YA 4B3RJ 2AZ3A 5A2QU 4HT7A 2W2OP 1RISA 1RBAA 4DV6F 1AYEA 3LH2S 1NBEB 1FJEB 2R7SA 2VC1A 1WG5A 3HULA 2VDHA 1N52B 1S9EA 2VZ9A 4ZPVR 1S9EB 1FJCA 3HVRA 2MKJA 1VQ6S 2Q6CA 3PYEA 4I6WA 4NLXA 4K50A 4JV1A 1JJ4A 2DNRA 1B3TA 4P75A 1T9WA 2YKAA 2L9WA 1NK4A 2P2CB 2HMIA 1XK8A 5MLCV 5HL7Q 1UVKA 2HMIB 1HBOA 2BJDA 3DKDA 1PIEA 1HBOB 2HS3A 1NEEA 1TV6A 2CQCA 1OIAA 1TV6B 2YWFA 5B0FA 2VOOA 2BRLA 4K4VA 4HH0A 3ISZA 2RS8A 2RJZA 4EU0A 2MQMA 4M5JA 2J9EA 5KFAA 2B6AB 4Y2MA 1S9FA 1DY3A 4LIRA 4F0MA 2RAQA 3K5NA 5KFZA 1VISA 4PR6A 3H5XA 3T1AA 1U6ZA 1JJHA 3I55S 2R2SA 1DLOA 1NLKL 3NGKA 1Q95G 1DLOB 2OGUA 3MM6A 2XY5A 4G65A 2FJXA 1EARA 3D6MB 3MM6B 3M6UA 3HJFA 2RHSB 1VBZA 2YPZA 2UUBJ 1N0VC 4WP8A 1AFJA 2FJDB 3JSRA 3M9OB 3NY0A 2OELA 1YTYA 4ZCLA 3IR7B 2FLOA 2AGQA 2AD9A 2R2RA 1BXNA 1HI1A 2XS5A 4WKRA 1FVQA 2KYXA 1RWUA 1WC6A 3IBWA 3CCTA 2J6SA 1PJ5A 2C3UA 1GXLA 1RWPB 5HI7A 3C6TA 1KRPA 5K8NA 3FRZA 5KFGA 3GTYX 4M5IA 3C6TB 5B08A 5KFQA 2FVPA 2FHMA 3LPYA 3ZZPA 1VMBA 2ZH1A 3I9ZA 4NLTA 4DX7A 2KFNA 1DFDA 4DX5A 3G2XA 1SKWA 2M88A 2JVRA 4EWTA 2F4FA 4Q43A 2UZAA 2P6TA 5IT9U 4DN0A 4F04B 3E2EA 2HHVA 3S6EA 3CEDA 1X4HA 4JI0F 2XMTA 4JOUA 1SIZA 5AJ3F 2ZBRA 3EMTA 5DDRC 3KG1A 4RNHA 3VGTA 4EO6A 2LU1A 1IXKA 3E8OA 3PXGa 4QQBA 2R8JA 5HAOA 1RWXB 3Q23A 2WAQD 4DV2F 1HBNA 5LL6d 3LALA 3BBCA 3WDOA 2AZ1A 1WOPA 3V4MA 1DHMA 3JTPA 2PMHA 3DRYA 2HS4A 3CJTA 3GYXB 3TJ8A 2F3JA 2MY8A 2V69A 2R2UA 4QU6A 3MWBA 1UWAA 3ITHA 5T7LA 5E3PA 4J90A 3OQ2A 3P8BB 1FE4A 5T7LB 3TX0A 3BO3A 3RW6A 1FERA 2HG4A 1IVZA 2CJQA 2EK6A 4ECRA 2J0QD 4YB6A 3ILJA 4PPDA 2R42A 4ZP6A 4ZJQA 3MR6A 2R8IA 2BM0A 1IQZA 3G82A 2HZAA 3TUIC 2HGMA 5A8WB 2AP6A 2E5IA 3G82B 1D3WA 3UDCA 1R0CB 1OJ4A 2ACYA 2KXHA 2V4RA 4ECYA 2UUTA 3BH7B 2GCFA 3CD7A 1RHKB 4LFCJ 2XMKA 1XWLA 1U0HA 4BWJA 5KG4A 2DXFA 1U0HB 3H4BA 1IBKF 4ECUA 3G86A 2IBKA 2HQCA 2HFVA 3HHLD 4K0KJ 1I5OB 2Q1LA 4WZMA 2AJ2A 1P8GA 4JI8J 1HD1A 3D66A 4I68A 3CCVS 3R7SB 4IO9Q 1UVNA 1VQOS 3QJPA 2HRTA 2QFJA 4X62J 1HNIA 2J7WA 2C2NA 4ILMA 2CPJA 1HNIB 2CZ9A 2ABYA 2NUHA 1RAAB 1TKDA 1HQUA 2IA0A 2OTJS 1HQUB 3HSDA 4ICLA 5JVHQ 2GHWA 3NGSA 4ZPCA 4ICLB 5E2QA 1X5OA 3NXZA 4DR4F 3KUEA 3V2UC 1CC7A 4NASA 3PHTA 1Y3JA 4ITSA 1RK8A 5BYRA 2L48A 1O0PA 1EJ7L 1RBLA 4WCEQ 2J76E 2PI4A 4I0WA 2Y8WA 2Y1LB 3C3LA 3H2UB 4PYAA 1UEKA 3FCWA 5LXRA 1UWBA 2B5JA 5ETRA 1MROA 4Y6IA 1H0HB 1UWBB 2B5JB 1TU0B 5IFMA 1U1PA 2DHHA 2QLJB 1MROB 3UR3C 1OQ3A 3DGPA 3JQJA 2QMUB 3GPAA 7AT1B 3DGPB 4OX6A 3QT6A 4LIWA 3KOAA 4J9UE 4CO2A 2VFVA 2BA9A 5G4DA 3W66A 3V81B 2CPDA 4F3MA 4NEYA 2A1BA 3QSYB 3TARA 2BM1A 4ZVEA 1RE1B 1RGVA 4UF4A 2NQPA 4M5GA 1FI4A 5ETSA 3FZ2A 5AXLA 3VAMA 1ROFA 2FY8A 3SV4A 4MAKA 2JFDA 4OHWA 2Q43A 2H5JB 3SFGA 2BYCA 1FDDA 3JSMA 2HZCA 3JSMB 1ZA1B 3LP0A 4ECXA 1NSKL 3LP0B 4Z2XA 4PXEA 5IZHA 1Y00A 3OPKA 4WE1A 2QT7A 3UDLA 4FBTA 4WE1B 2IM0A 2KI2A 4R25A 2DEJA 3DI6A 2GGPA 2W1BA 4ZN1A 2MSTA 3DI6B 2GGPB 5CYMA 2LDYA 2AMCB 3W62A 3AA8A 5CYMB 5A6PA 2RS2A 5I42A 4KT0C 2BEFA 5I42B 3M9NB 7FD1A 3H5SA 4USKA 3R2CJ 2DEIA 1U8SA 3RBEA 2J0WA 1TK8A 4DFKA 3RAXA 3GJQB 1C0UA 5IQQA 4ZPBA 1C0UB 1TFWA 3SDEA 1Q8LA 3BGRA 4DV5F 1WWHA 2G0IA 3SDEB 3BGRB 1R6VA 2ZM6F 3GCWP 3I4PA 4J9PA 3K5OA 1SH2A 3ZTSA 1CJVA 2J8AA 1GX6A 3C14A 4NYOA 4F02A 3DFEA 4U6PA 2LEPA 3E3XA 3LP2A 1JNRB 2VL1A 1VBKA 2G0JA 4U7UK 5DLFA 1NK0A 3LP2B 3CD0A 4B3SF 1XNQJ 4B3MJ 4P2XA 4TKTA 4B9MA 2O5DA 3N01A 1J5EF 2RUGA 3MZIA 2MEWA 2YQ3A 2CA9A 4LRAA 2L9NA 1WKLA 1HHSA 1KHVA 2NXCA 2DR8A 2ZH3A 2CQ4A 1FJGF 2XMMA 4OZJA 2E1PA 3TYTA 1CEZA 1WSVA 1TKZA 2AJFE 2RH3A 1TKZB 5BXIA 3W2WA 2DRAA 3HHKA 2KJWA 2XYGB 1WJ9A 3W2WB 4B9UA 2RQMA 1W2IA 3R6GB 4W92B 4RW7A 3TRGA 2OMLA 1FXLA 4C0BA 1RAJA 2NYIA 3NAIA 3AJ1A 4RW7B 3DM2A 3GQCA 2V4JA 3RU0A 3DM2B 2V4JB 4P71A 2CQPA 1RT4A 4KR0B 2DHAA 2YPYA 1RT4B 4DV3F 2KZMA 5LMNF 1DQ9A 3GMGA 2E66A 4LUBA 1S77D 4DUYJ 1Y5LB 2FJBB 1EZZB 2B4UA 1IR0A 3D2WA 5GVQA 4B9TA 3AODA 3ZZOA 3PIPQ 1H2TZ 2P6SA 2AJ1A 3UN3A 4UOCA 1VFJA 4I56A 3NG8A 3WC2A 3KLIA 3KJQB 5B0GA 3KLIB 5C2GA 1TMJA 3CJKA 3KJNB 2D3OR 3CDWA 1P27B 3CJKB 2YNIA 3ISND 1QAXA 2YNIB 2XMAA 1U1LA 2YQ0A 3J7Z5 3FEZA 3QWPA 4H4KC 1B64A 2WB4A 4RNMA 3AXKA 4Z37A 4A4JA 2EFNA 2M5YA 5IT4A 2IJNA 3O8WA 2XO7A 2ZBIA 4KHMA 4JI1J 4C8OA 1OY6A 3NMRA 4JI5F 4YR2A 2AYMA 2H48B 3I31A 2YKPA 4DZ6A 4X65J 4WXWA 1RWOB 1XMOJ 3VF0B 1JLAA 3G8QA 1HNVA 1JK9B 3J7AN 1JLAB 1HNVB 5KFWA 3D3BJ 1RYRA 2KRRA 5E3QA 1XEZA 3UCZP 1RCOB 3NS7B 3TZWA 1KFSA 2XTJP 2W7OA 1PBUA 1EIYB 1Y5NB 1OWXA 2C3OA 4JI7F 1G3OA 4URQU 5LT5A 4DR6F 1T3OA 3N79A 1RP5A 1AXQA 1JIHA 1TUVA 5D0HA 1SC4B 2KRBA 5EN1A 1ZTWA 4FVMA 1UVMA 3AT1B 2R7RA 1NU4A 4NLOA 4OYIA 4N76A 4HL9A 2YTCA 5BYSA 4MH8A 4I67A 1E6YA 4Q5VA 3MCSA 1E6YB 1PJ7A 1U6BA 1SC1B 5KFHA 5H9FK 3PEJA 1TMMA 3FNNA 2N7YA 2YBVA 3MFIA 1OSCA 4L72B 2V94A 4TU9A 3PYDA 1LEOA 3JTOA 4N77A 3A3PB 1OMSA 1SC3B 4WYWA 2QC3A 1OYDA 5KG6A 4MK9A 1SJ4P 2BJ8A 2Y9HA 2G2YA 3EVOA 3CXCR 4ANCA 2G2ZA 2B9EA 2IRXA 2Z2ZA 5DO2A 2Y1RI 3MAAA 1IJEB 3VGUA 3QSIA 1LW2B 3MAAB 1U48A 1XERA 1QAYA 4P10A 1QJHA 2C2EA 4X66F 5L46A 2O1PA 2FUG9 2HVIA 3WIUA 4N47A 1R27B 1QUVA 2FC8A 3QT7A 3JXOA 2VONA 4HTJA 3M05A 1SKRA 3OW2R 1RLDA 3QQCD 1XC9A 1FWPA 1HPZA 1HPZB 3LO3A 1HR0F 4URGA 2LA6A 3RR8A 1BWVA 4RKUC 5HJYA 3BV8A 1Y0HA 3BKTA 5CD4H 1S1WA 1TUWA 4LF7J 4E98A 2EFOA 1S1WB 1UJ5A 1C4CA 4DSLA 4RW9A 1YDLA 3UQSA 5JXSA 2KXNB 4RW9B 1MSWD 3GFHA 2E1AA 4QR1A 2AJ4A 1HW9A 1KLNA 3TQEA 3B4MA 1L3VA 1GMWA 3HFVA 4BHQA 3PDNA 5KG0A 5HMXA 5HO4A 3CJSA 2E5JA 2GVDA 3EVMA 3M7VA 2UXCJ 2GVDB 2FVRA 1UZDA 3MPWA 1QSSA 1UTAA 2DR6A 1AUSL 1HLWA 3QAEA 5KFYA 1SJRA 1FDBA 1U1QA 4NZ7A 2N82B 4R0JA 5KT2A 4ED3A 4NXMJ 3LAKA 2K8GA 2A3JA 4PABA 1KHWA 1RAOA 1TL7A 3KLEA 2DH9A 4O3PA 1WG4A 3ENAA 4YN3B 3FKBA 3KLEB 1WF2A 2J5AA 4KY3A 1HKAA 1SQGA 4FF2A 1FX4A 2HGNA 1RT2A 3AD7C 1ITPA 2IAJA 1URNA 3CIMA 5HQMA 1SI9A 1RT2B 2IAJB 3LAMA 3TR5A 2K3IA 3OL8A 1MW7A 3CF5Q 4PXDA 1L3KA 5IOLA 4RZRA 3GIJA 1IBLJ 3B78A 1VC0A 2DY1A 1JMTA 1ZPVA 3HP6A 3VALA 2DRBA 3IO1A 1VQKS 2IPOB 4OYZA 4OMFG 4P9SA 4OI2A 4TQRA 3VHQA 5L38A 3KUHA 2CFXA 4YP3A 3GG0A 3H42A 3MR5A 4J9MA 4DF4A 4RX6A 3ZTRA 1NMEB 5KFJA 1EKSA 1T94A 1LNQA 1D09B 3R5AA 2XM3A 5CAAA 5L39A 2HFZA 3W2VA 2GO9A 3EWGA 3N5FA 2R3VA 1F1BB 3OVBA 2IVMA 2E7WA 3N6MA 3R9LA 4OV1A 4NPOA 3KLHA 1K0VA 3DGVA 2A18A 3KLHB 5L1IA 2OPSA 2W4CA 4ZCIA 1VS3A 2OPSB 2Q66A 8AT1B 3G87A 2JEIA 2DNYA 1REVA 1J2VA 1V6HA 3GJTB 2ZH7A 1REVB 4DV6J 4ZVFA 2ZHBA 4AD6A 5IWAF 2MGZA 2YX1A 2IDEA 2MGZB 2XI2A 4KH0B 1RWNB 3DDIA 2EBGA 3C2PA 4F4XA 4F4ZA 2DNLA 4CH0S 2CJKA 2BVZA 4FNHA 4CNYA 1ZAXA 4ZLPA 4DEZA 4ED1A 3CCZA 1BWEA 3K8VA 1TAQA 3PW2A 2PMZD 3BDEA 3IFEA 2ZZNA 2X51A 2IMWP 1S1VA 5HMWA 4IG0A 4BDPA 1TL4A 2CNNB 4Q0BA 4IG0B 5E41A 3OL6A 2F5GA 4QWAA 4Q0BB 1T0TV 5E3RA 4BC9A 3BYRA 1VQ8S 4X4OA 4OX8A 2VFSA 3CUNA 3N0VA 2HZVA 3ZZ0A 1PBAA 3KDOA 4MTPA 4M5HA 3TA0A 2Y0BB 1KVIA 4A8SA 3Q83A 1WEYA 1WUUA 3LP1A 1GH8A 3LP1B 1C1BA 1VBXA 3FQKA 1C1BB 2DH8A 2VPWB 3FK4A 4OX7A 1EB0A 2DK2A 3D68A 4DMZA 3OFFA 1QM9A 4NEZA 1YITS 4USUA 4EYIB 2VC0A 4FP9A 1F9HA 1LQ9A 2YVSA 4USVA 1TK5A 2EBEA 2QSFA 4NA2A 5H1SV 2K1RA 4PAAA 4Y34A 4DI6A 2ZD1A 4L73A 2K1RB 1KC8T 1KQSR 1PYTA 2ZD1B 5KFBA 4DR1F 1UEUA 4ZVTB 4WKYA 2ILZA 3AAWB 2W7PA 2IJFA 2DHXA 2VJVA 4ZPAA 1NZ8A 1HQEA 4OYMA 5I3PA 1HQEB 2KFYA 1NSQA 4C8ZA 4K4XA 3FUYA 4CLZA 4I2QA 2E29A 2HVZA 4I2QB 4C3KA 1X5TA 1V3SA 3MPYA 2SXLA 1KQKA 4ECTA 3I5AA 3C19A 4LBIA 3ZNJ1 5F41A 3P5BP 3I96A 5DJBA 3MEGA 4UQGA 1WELA 3MEGB 1FNOA 4XDCA 2MKKA 2C1EB 4P2SA 4JI0J 8RUCA 1IM4A 2DISA 4RNNA 2J7UA 1U7LA 3AH6A 3HSJA 4F7VA 2LQBA 4NLPA 5AJ3J 3M9MB 1HI8A 4C7QA 4X64F 3NAHA 2QL5B 5C5JA 4KBIA 1K73T 2BXJA 4WU3A 3AA9A 2QJ3A 1NKBA 2VKRA 7FDRA 3UDVA 2ZH6A 1C2PA 2JC1A 2X1GA 2GMHA 3GU0A 4C98A 2KZZA 4LBPA 2PC6A 2YQ1A 3VAFA 5IM0A 5IS2A 4PCQA 4NCAA 1RA6A 5KFFA 4ZP8A 5IM0B 3H5UA 2JC0A 3J81Y 3S8SA 1RCXB 2BKOA 3PW5A 4UZCA 2XYHB 4DPYA 4J9OA 4QW8A 2A2CA 1HNWJ 2C2RA 4IQMA 3BO4A 1RTZA 2FLNA 4G3IA 1Q4RA 4OJ3A 3DNCA 3IAS9 2B9YA 5AE1A 4AYBD 1VQSA 2ZJRQ 2UUWA 2KB2A 4AT1B 2DR7A 2AJQA 1JNZB 3THVA 2LCWA 4F8RA 4HVZA 1KBRA 3NNHA 1BQMA 2CZ4A 5EGYA 5AXMA 1BQMB 1M1HA 2GZOA 2VBYA 2HQDA 2QYCA 3LGHA 1ZETA 2XLJA 4M5DA 2J7KA 2VA3A 2UUBF 3HHEA 4L74A 4M5DB 4Y2CA 3J7ZT 3SCJE 3C16A 2XQCA 1L3UA 1RSCA 5DG7A 3C16B 5THWA 3QIPA 4ILRA 1YJRA 3QIPB 4WBFA 4QIWD 3W63A 3CJ5A 3R5BA 2VPZB 2WSCC 2J0SD 2YWGA 4I6YA 5J2PA 4GRSA 5J2PB 4Q45A 5ETQA 3BDPA 3IWXA 2R2TA 5B0DA 4LF4J 5EDWA 2QFIA 3SMZA 1H73A 3NEKA 2W9AA 2LU2A 3O6QA 4CO5A 4PWDA 3OJSA 3I32A 4PWDB 1FRIA 4G1IA 2BKNA 1F9FA 5K20B 2AX1A 2ASLA 2FD2A 3AB4B 4WIQA 1FDAA 2JEJA 4EBDA 4K7QA 3KKFA 4OLOA 3K8WA 3B82A 4GKJF 2XHWA 4CLSA 1VYAA 2ROGA 3X3UA 3W61A 2DTJA 3G4SS 5KG1A 1FRLA 4CLTA 3HVAA 5ETNA 2GAGC 2R7QA 3AB2B 2PI5A 1S0MA 2GAHC 1N6QA 2GQCA 4O44A 1N6QB 1F5CA 3DHWC 3TNVA 2Z30B 4O44B 3CTRA 5HP1A 3UW1A 3OSPA 2ZKUA 2W25A 1SJ3P 5HP1B 1RADB 3TW0A 4F4KA 4YQWA 2QEXS 3T5KA 3PRVA 2V34A 3DXBA 5HQLA 1JXLA 2CG8A 3MR7A 1YZ6A 1I94F 3RBZA 2C3PA 3TJ9A 2Y0SD 3EZOA 3V6HA 1JB0C 1YZ7A 1LWXA 5A8KA 5AXKA 3IN5A 2ZOMA 5A8KB 4F2SA 4DQPA 2NXUA 3N5BA 2H54B 1FRXA 4JP8A 3K58A 2KM8B 2B4OA 2R8KA 1VQLS 4IH7A 1DARA 2ASYA 2UVWA 2C2MB 1DQAA 1HA1A 4WFBQ 4WFXA 1CS4A 1VGYA 4KC5A 2DNNA 5KT5A 1CS4B 4FZVA 1GAOA 2VG7A 1M5PC 2HNDA 3CD5A 5DGAA 2JNJA 2VG7B 3RB0A 2OEMA 3FBBA 3UD3P 2HNDB 4RW8A 4DV5J 1Q8BA 3FSIA 3NGDA 4RW8B 1YQHA 1CULA 2C2OB 1CULB 4QU7A 4E8UA 1EQ0A 4KH1B 5F8MA 4JV5F 1B0VA 3VTIA 3PHEA 3QT5A 5KFKA 1UMJA 3AXMA 3DYAA 4ZJOA 4B3SJ 3V6DA 2VU5A 4L3NA 2P9CA 3V6DB 3B4DA 4QIEA 1LXJA 3RJMB 1FKPA 1JLQA 1J5EJ 3EM1A 1JLQB 1FKPB 3M8PA 2V50A 2Z8QA 2B9WA 3M8PB 3R7BB 1FJGJ 2BJ7A 3IG1A 2XLIA 5HJXA 2B4PA 1S10A 3IG1B 4LSZB 1AROP 4DL3A 1PAUB 1TK0A 4IRDA 3MOZA 2G13A 1RAGB 4ECSA 4PG5A 3CB4A 3SSQA 1FKAF 3DU5A 4GO5X 4R0EA 5KG7A 4DL5A 4BBYA 4UY8T 2V2KA 4DPWA 2CPIA 1HNXF 4FVCA 3AJDA 4DV3J 2OFGX 2XMWA 5LMNJ 4TU7A 2P8IA 1B7YB 2LXIA 3OHAA 2IYIA 4IUFA 4KYZA 2QA1A 2BW7A 3OVAA 4DSKA 3Q22A 1ZZNA 1JLEB 1R0BG 3CJ2A 3KHHA 4HR2A 1TL5A 1GXUA 3R5DA 5L1LA 3EUNA 5F3TA 1Q7YT 4QYRA 3BH6B 3Q89A 2ZVSA 2JEFA 2NREA 1KFDA 4ZLLA 4GO7X 3ETMA 2ERRA 4OYBA 4J9LA 2FHJD 3HD1A 3NKYA 1N5TA 3S1TA 3D4JA 4CQ1A 3P45B 1JWWA 2X1AA 2JEGA 3DLJA 4YEAA 1VHIA 3BKFA 2ILYA 3W60A 4OYWA 5CH7B 3AY0A 4CLFA 1T02A 2RDIA 3QGGA 2A2DA 2CADA 2EG1A 2FHKA 5EWEA 3FQLA 2K7KA 2OSRA 1S0NA 4JI5J 1JXVA 1RHMB 2WBRA 3ZZZA 5DZ6A 1RHJB 3PFOA 4ANEA 1YSJA 5EHHA 4JYAJ 2XS2A 2QMXA 3U02A 2IIHA 5GAHI 1S4EA 1S6PA 2LEAA 3BJYA 3J80U 2OLWA 1P6TA 1E6VA 3CC2S 1NZAA 4MFBA 2LYVA 1E6VB 4MFBB 4NLQA 1IWAA 2HBRB 4FYWB 3SCLE 2DRDA 3BGFA 2O3DA 1KSPA 3Q8YA 2KH9A 2GX8A 1APSA 4GC7A 4M63A 2LECA 3ICLA 4KGXB 2GQQA 2W9BA 3ELHA 1HL6A 2W9BB 1KNZA 4W90B 4NL5A 3KLGA 2IBOA 4IOAQ 2HQFA 4IO1A 2FZCB 4FXDA 3R5JB 4JI7J 1PGZA 2CDRB 3MEKA 3KHGA 4ZVQB 4QBUA 4NYZA 1ZAVA 3NBPA 1I1GA 1SVDA 1FT8A 2H4WB 3NBPB 4FPRA 1F2GA 1HI0P 3W7BA 1T9YA 3D67A 2LFVA 2MZSA 1X4GA 4P73A 3C8YA 4FKXA 3F41A 1SBRA 5ITHA 4DBQA 5ADZA 3DLKA 2CG4A 5KT3A 2PD1A 3DLKB 2GHPA 2WRMA 2YKNA 3FFIA 1U2CA 1YBTA 2XI3A 2YKNB 3FFIB 3BGOP 4C8YA 3FGVA 4JI2F 4WFZA 2PDAA 4J91A 5LSLA 2MKYA 5C7PA 3PIOQ 1U09A 1NUEA 3J7YI 3DU6A 1NK5A 1J5OA 3EZ5A 3D1QA 4ZVOB 1S76D 3Q8VA 1MMLA 1ZA2B 3OSNA 1YWXA 1PG5B 5DDPC 2OI2A 5SZTA 1X31C 1RAFB 4CP5A 4NRUA 1VQ7S 3OR1A 2V8VA 1UJ6A 4DUYF 3UR0A 3OR1B 1LFWA 3VAJA 1ZPWX 4CH1A 1X4FA 3D6HB 5AE2A 3I5CA 2XZWA 1N56A 1FRKA 3BPDA 1AB8A 5E3CA 4X66J 1LWFA 3DOLA 3T3FA 2M52A 2NUUG 4KE5A 2DO0A 1LWFB 3DOLB 2DPJA 2ZOFA 5EWGA 4A8WA 3KWMA 1ZM3A 2C3MA 1C1CA 1SC6A 4OHVA 1C1CB 5D4LA 1VQYA 5LM7E 5ETLA 3VAKA 2OPQA 3DMJA 2BE7D 3AJ2A 1T9VA 1HR0J 2OPQB 3DMJB 8ATCB 2QA4G 4DL7A 3LPEA 2BRKA 3PO5A 4KHPJ 4CO0A 3HHLA 2W01A 5CA5A 5CYJA 2C2ZB 3LW5C 3HHLB 5CHCB 3MM8A 4C8KA 3VWSA 3MM8B 4DX6A 4CNZA 4F4WA 4MT1A 2PEHA 5B0AA 2QA2A 2OIHA 4QWDA 5J2NB 4F3QA 3POTA 4ATNA 4LSNA 1O5JA 2J9CA 3POTB 1SCJB 4K59A 1F6TA 1T03A 3D7SB 3A8JA 1KTVA 4U96A 1T03B 3R6LB 3RW7A 1G2EA 3OTBA 3IRWP 4HH1A 4M1KA 1SQFA 2RVJA 1RB0A 4CLKA 4DQSA 4WU2A 4PXCA 3TP2A 2RIJA 4C2MA 4N41A 1N5VA 4ZS6A 3I0SA 4ZK7M 3I0SB 3UNYA 2VV5A 3QJLA 2ZKTA 5D0EA 2DNQA 4KGZB 3KMSA 3GB0A 3MECA 4Y2IA 2BOPA 3MECB 4K2XA 2JLFA 1HFEL 1XJWB 1HWIA 4L75A 1KKHA 3EGNA 1LFPA 4ZCKA 5D77A 4ZVHA 4ZN3A 4QYZJ 4DLEA 1VC6A 2QMWA 1RAIB 3C15A 1PSDA 3CCMS 3IRXA 2DGWA 4LR8A 3O44A 2R7OA 3C15B 2MZQA 5C24A 3IRXB 2K7JA 5C24B 3IM8A 2N3OA 4ZP7A 4FKYA 4WF9Q 1CLFA 4KGVB 4DL4A 1W25A 5KFSA 3OFEA 5EUHA 3H7HB 1WC3A 4QW9A 1LOUA 5KAKA 4RJVA 2HFNA 2ALYB 2OHDA 3F73A 1J27A 5FLXY 1D9DA 1K1QA 1U2RA 2QZ8A 4O4GA 3U1MA 4O4GB 1NJXA 1JJCB 5B0EA 1C0TA 5FIIA 3FVYA 4C8NA 4RWXA 3MCMA 3MM7A 4PXBA 4C0HA 5LJ5Y 3I9V9 3MM7B 3HVWA 3DDNA 3Q8RB 4YB7A 5IWAJ 3JSYA 3U27A 5HMZA 3H2VE 2R7TA 3HLUA 4OYAA 2UUCF 4B02A 3H90A 2FJWA 2IC3A 2MKHA 3K5LA 3DLEA 4QOTA 1YLXA 3VQSA 3DLEB 2M9KA 1CBKA 2C42A 2ROEA 2WVEA 2EKYA 5U47A 2HHUA 5AXNA 4C0OC 4C8LA 3QIDA 3H0PA 1QVGR 2WONA 4FDFA 2DHSA 2XY6A 4A8QA 2WONB 2RRAA 1SXLA 1XNRF 4ID8A 2AQ4A 1NSAA 4D3HA 4D3GA 3EX7B 4AL6A 2HQ3A 3LF0A 1RAEB 2DVIA 4C4WA 2ZWPA 2UXDF 3R5GA 4QYZK 4U7UD 3QZ7A 2KHCA 4LFAF 1QDUB 4FN5A 1T11A 4ZOSA 2F8EX 1UFKA 2RDJA 4HT5A 4DF8A 1YKWA 3V6JA 2J6TA 4X4TA 3GP9A 4MKVA 3AOCA 2DIUA 1MNEA 1QE1B 2Q79A 3UWTA 5KG5A 3NL0A 2QLBB 2QE5A 3SYZA 2C22A 2J6UA 4HACA 2VPXB 4HACB 1WHYA 2MZJA 4RBUA 3K5PA 4DR1J 1RABB 2RRNA 2OP5A 4WZQA 3RB6A 4TY8A 3AQPA 2HHXA 1IBLF 3FRYA 2AU0A 4K4SA 4TY8B 3MCOA 4IFYA 4IFYB 2QG9B 1Q16B 2DO4A 4JI6F 3W5YA 5MAOA 3PR5B 2QLFB 2AW0A 3P3DA 3RYLA 4Y0FA 3G9CA 2MJNA 2GW8A 4ZIVA 4IR1A 1R0AA 4F36A 1R0AB 4NA3A 2RT3A 1FESA 1R6YA 1SL2A 1DURA 4ZDNA 4ERDA 3JQKA 2ALZA 4PG6A 1M5HA 1VQMS 4UOFA 2ZBQA 4DV7F 2OEKA 3GFZA 2CPXA 2ZZMA 3D9BA 5KFCA 3IP0A 1NK9A 4IOCQ 2Z56B 1LW0A 3ZZYA 4FYDA 4I6AA 1RJJA 4QJVA 1S59A 2X3DA 2L08A 1LW0B 1B0TA 1EKRA 3KK3A 1S49A 4KB7A 2AHOB 2QLXA 3KK3B 3ILIA 3ZXWA 5F9LA 4X64J 4DUTA 3QO9A 1KOHA 4LQ9A 3W9HA 2D3ZA 3QO9B 1KP6A 4Y2AA 4DX8H 3GG1A 3JAMU 4I7FA 4Q44A 2XC9A 3KHRA 4F2RA 2ZVIA 4I7FB 1I51B 4TY9A 3I4HX 1EETA 1EETB 5AT1B 4B17A 2MDAA 2X7IA 4MIWA 1TUGB 1HHQA 1M5SA 2E1CA 1TZ0A 1FEEA 3H98A 3I87A 2RMLA 1ZOTA 3WBZA 1IKWA 4KHRA 1YRXA 1XR6A 1VK3A 4OHZA 1IKWB 3NGUA 2BE2A 2H5EA 3OTDA 2BE2B 3D5MA 4DCPB 4LF5F 2K2PA 3MI7X 2CQ2A 3VQTA 3HSGA 3WX4A 3BB5A 1YK9A 3O3LA 5LMUF 1NJWA 3VV2B 1IBMF 4YOEA 1M5KC 4DL6A 3ZO7A 1UEVA 2AYEA 4XAKA 4X4QA 3PNIA 4M5LA 2IVFB 4V1Ak 4O23A 2CAJA 2FLPA 1B7FA 3MPVA 4LMZA 1RA7A 2R4FA 1S1UA 1S1UB 3R3TA 4CO1A 3NGTA 4L6V3 5HMYA 2RB7A 3CPWR 4C48A 2M3DA 3M8ZA 1YBAA 3IR6B 2XULA 3HHNB 4C6AA 4RUBA 1YGYA 3IS9A 4HLBA 3W3SA 3PR4A 3BGUA 3IS9B 2XSFA 4CWBA 5LXYA 4U8VA 4AFFA 3OTOF 4ETXA 2CQIA 4ZVSB 1A0OB 2QSWA 2KJVA 4KSEB 4DPOA 4BLGA 1WOOA 3NOCA 1S7HA 2KG1A 2BKPA 2JJ4D 2HK2A 4C3LA 2XCPA 5BR8F 3MPUB 4OZNA 2OO4A 1N32F 2VA2A 3PTWA 2JVOA 3GONA 3L09A 3BR9A 3SIPB 1Z2LA 4LF9F 3R1LA 4DOZA 5KFPA 2DNPA 2OD6A 2HPUA 2CQBA 3A8KA 3MURP 2YWEA 4WYLA 4A8MP 4GKJJ 2QGFB 3UD5A 2VFRA 2HAIA 1RTIA 3K59A 1FNMA 4RBVA 4W4MA 1RTIB 4IYQA 2RKIA 4ZJLA 3CJ8A 4DSFA 3K2YA 1RKJA 2EG2A 3MGJA 1RHQB 2RKIB 3V6KA 1VRTA 3G8TA 4KV8A 5A76A 2MQNA 1HBNB 1VRTB 4K5RA 4KV8B 1RXOB 2PIIA 3O1LA 4X4UA 2RU9A 1NB2A 1S48A 3GJSB 3HXMA 3IMQJ 3CDBA 4ED2A 5GADI 4LT6A 4MJKA 4ED8A 2JLGA 2KT3A 1HARA 3OFHA 2GA7A 3N9UC 1RI7A 3N4WA 2WBMA 1I6JA 5I3UA 3ITHB 4FYVB 1PILA 1HNWF 3DN9A 3CD6S 1AW0A 5I3UB 2VG6A 4ID5A 3G8SA 3MPDA 2VG6B 4ID5B 2KDOA 4CLWA 1I94J 1MWYA 2MLZA 5K8MA 4NX9A 3BO2A 1YJTA 4YY3F 4CZCA 1Q79A 2G4BA 4J37A 4ED0A 4QPXA 3TWZA 4M5MA 2KXFA 3T6JA 2MXYA 4EUVA 4YDDB 3BF4A 4C97A 1VQNS 2FB0A 1S72S 3ZZRA 5D3GA 2XLKA 2B43A 1XR5A 4UZBA 4ENOA 1UPMB 1N8RT 2DCUB 3R5CA 2FGCA 3SSSA 1SIWB 2RHQB 3KK1A 3AD8C 2AGOA 2DGXA 1KN6A 3KK1B 3M6XA 3IM9A 2P9EA 2V2ZA 5IXUA 1LKZA 1S79A 1ZYQA 2BACA 2G9OA 1BY9A 2DY9A 2QL7B 3J7A1 4JV5J 2HHPA 3A4TA 1S0VA 2I38A 3CT9A 4LF4F 1G1XA 5K5MA 1UAWA 2M4MA 3GV8B 3GFYA 1RWVB 4Q2LA 3U1LA 3HX9A 2JLEA 4DLGA 4OI0A 3UFCX 2H3EB 1FXDA 3GCXP 3FBCA 3KK2A 5CZXA 3KK2B 2IMOA 2KN4A 5JUMA 1YJVA 4HI1A 2G1HA 1RU2A 3K89A 2MZ1A 4GVLA 1UFWA 2DJWA 1CC8A 4OZ1A 3H40A 1H38A 1P1TA 2XG8A 2VASA 5GAEU 2N4DA 2HHSA 4TVAB 1HNXJ 4YUDA 5L9XA 1Q5YA 4RU9A 2JDJA 2P5VA 3OFGA 5KFNA 2KT2A 5B0CA 2IVYA 2HLUA 4LRFA 2MKSA 4EFAC 1D8ZA 1U6FA 3OXLA 1S5ZA 5KFEA 4WFAQ 2A6MA 4HDHA 1MU2A 3US5A 1MU2B 2B7BB 5CCMA 1N48A 4J9QA 4USIA 2J9DA 3BN4A 2HHWA 3IWNC 2YH0A 3FCHA 5A2QY 1BHNA 3LOUA 4TLRA 4M5NA 5M2UA 4FXVA 2HQIA 3W8PA 3PRDA 1D9FA 3W8GA 1H2UX 1B99A 1Y11A 1KDNA 5H9EK 4DR5F 3BM7A 2W7AA 4NLSA 1Q78A 1PC4A 3M8RA 4DFJA 1XMQJ 3OTCA 3FBFA 3DLLQ 3WHIA 2LEBA 1FD2A 3CCJS 1WSRA 3MD1A 1FFGB 2MJUA 3A13A 3CMES 5F8GA 5KOWA 4H4MA 1UZHA 1VRUA 3PW7A 4LFBF 4K4ZA 4H4MB 2PMWA 1VRUB 3CCLS 2O66A 1N34F 1TELA 2DGVA 1BMQB 2P9GA 4X4VA 2QL9B 5GAHU 3NCPA 2IRYA 4MIBA 1CJVB 1NDPA 3W5ZA 3EDRB 2JX2A 2AEFA 3C14B 4K8RA 1UVIA 3TA1A 5KFDA 3RRHA 1VR6A 3QPIA 4I64A 2BQUA 2UU9F 3CDEA 3S01A 5ETOA 1SJFA 1SKSA 4P52A 3WZ0A 1RWMB 5KFTA 1IUJA 1R31A 1CJKA 4LVOP 3TA2A 1F5AA 2UV8A 4ZVRB 1CJKB 4LF8F 3JQMA 4UOGA 4NCGA 1NAQA 4K4TA 2RILA 2NXJA 5J1NA 2ADCA 2DITA 4NCGB 4JI2J 1WD6A 3PCOB 3EPIA 4YFUA 4UQTA 2W8KA 1Z2ZA 3DLBA 1F0XA 1X4BA 4CLPA 3MTKA 1FFWB 1HW8A 5E5NA 4OI1A 4OJHA 2BW2A 2K06A 1A7GE 3QJJA 1Q81T 3FDSA 2FDNA 3HFKA 4E2FB 4CM2A 3JSBA 2E5GA 4WWSA 1FE0A 4JI3F 5D0RA 5KFXA 2HHHF 2E5LF 1NDLA 3J7YU 1RAHB 2JH3A 1O8BA 4AUKA 2ZBPA 4UW2A 2L41A 5H9FJ 3MR2A 2O67A 4H54A 3THTA 3I6PA 5IT9Y 4WTOB 2LQ8A 4MIAA 2B56A 2MQ8A 1C4AA 2BV3A 2UUAF 1Y7PA 5IC6B 1LWEA 4LREA 2D41A 1WI6A 1HYSA 1LWEB 4TYAA 1HYSB 1WDDA 3MMAA 3FC9A 3OVSA 2UXBF 1SJ1A 2K3KA 3MMAB 1SV5A 4K4WA 1Q53A 3WX8A 3M8SA 1X4EA 1SV5B 2XZTB 3RG6A 1FFSB 4JYAF 4USWA 4Q2MA 2LMIA 5HROA 3WQPA 3U7JA 2EW9A 5A8RA 2WW8A 5HROB 3CJ3A 4DQIA 2IDLA 2CXEA 1ZAWA 3PJWA 1TQLA 2DNZA 4OI6A 2XCAA 2GS8A 2ZOGA 3TAQA 5F8HA 2GNKA 2AF6A 2V2VA 2VPYB 3AOBA 2JL9A 3MMCA 3MMCB 1H6KX 1UW9A 5B7WA 4LQ3A 2DR5A 3Q8PB 3H25A 1M5OC 4YR0A 4PRFA 1V3RA 2RQKA 2NXNA 2WZ1A 3KJVA 2CZVC 2YY3A 3DLGA 4QZVB 3R1HA 1WEXA 3KJVB 3Q86A 2XWYA 3DLGB 4XIUA 2F40A 2CNOB 1NDKA 2IM2A 1U45A 1VIOA 1JLFA 4H4OA 4QIGA 1JLFB 2H4YB 4DR3F 4HKQA 4H4OB 3KNGA 2XMVA 4LF6F 2OMOA 1H3DA 3Q8QB 3D0GE 4DV0F 1MMNA 1QVFR 2W24A 2KFZA 2DR9A 3AOAA 1CJTA 4CM0A 3W64A 1CJTB 5KFUA 5ETMA 2AYBA 4I2PA 2HLTA 2C2DA 4I2PB 5DETA 2VG5A 3W9IA 3TO8A 2VG5B 3ZC4A 2F9JA 5DQIA 2X1FA 3FZBA 3OJUA 4F50A 3KJFB 2KYZA 3BQ2A 1U4BA 3RTVA 4PWWA 4LR7A 3NWRA 2MKIA 3QLHA 1F9EB 3QLHB 1V5IB 1Q8IA 1K8AT 3HT3A 1FRHA 4B9NA 3QRRA 2BJ9A 2NZ4A 3AFGA 2ACMA 1ZTTA 4ED6A 1DRZA 1NH8A 3DRSA 3BQ1A 3DRSB 2MQQA 5BJRA 5CZVA 4F4YA 4F25A 3K57A 4NMLA 4U8YA 2D1CA 2UUCJ 1R8BA 4H4KA 5T14A 2EVZA 5KG3A 4RW6A 4X4NA 4OHXA 4ECZA 1X4AA 3BGLA 2NZCA 1VLYA 4RW6B 1KTQA 2Q3PA 2ZE2A 1H2VZ 2MKCA 5HK4A 4KHPF 5DZ7A 2ZE2B 3OXFA 3PVXA 4XTTA 2FYXA 3HPOA 2HQGA 3HMJG 2E1RA 5D0GA 2HRYA 1WACA 1TP7A 2F9DA 2IFXA 4K2JA 6FD1A 3EDQB 3VVUA 4XPCA 3BSAA 4JI4F 1XNRJ 4WK1A 4M8LA 6AT1B 1HIYA 4JB8B 1X7VA 3EYZA 3TVKA 2XZDB 2I2YA 1NH7A 4HTIA 2HS0A 2H65B 3QRPA 3HKWA 3PYFA 2GMLA 3ET6A 3GIKA 2UXDJ 3NNCA 2ZH9A 2VBWA 3ENVA 1P1LA 3ET6B 1I3OB 1V5VA 2F4VF 4RO0A 2MPUA 4LFAJ 3E51A 2WSFC 3G6XA 5J1PA 1VHFA 2I8EA 3P49B 5GMEA 1WOSA 2IM3A 1CJUA 4OFZA 2DBBA 4CT8A 1CJUB 2QIFA 2XMUA 5DQGA 4ZMMA 3G71S 1BD6A 1S12A 3UNGC 2DB1A 5L8RC 3IWLA 4KTQA 2PSZA 2HIYA 3BN7A 1MG7A 1TL7B 2YX7A 1X5PA 3N28A 4CCHA 3SBMA 4X2BA 1CQNA 3FMBA 3TUJC 2B6AA 4WFYA 3GZ7A 1IJFB 1PKUA 1KQGB 4LRCA 4XDDA 1X9SA 1NJZA 1YHQS 5KFRA 3ENWA 3Q8SB 4GC6A 4JI6J 2PGCA 1SJQA 3WC0A 3CMAS 2ZEJA 2V9WA 3IAM9 5HANA 2W2NP 4I69A 1G7CB 4DQQA 1L3SA 2XHCA 1FXRA 1REGX 4OYXA 2RD5C 3W2VB 5DG8A 4EYHB 4USTA 1NPPA 2Z58B 4DV7J 2XGPA 2WVDA 2CPFA 2YNHA 5E0OA 5GMDA 4M94A 2FHJA 5CD4A 2YNHB 2ADBA 2FY1A 2KU7A 1W2BR 2FVQA 2V2QA 4P2FA 2XBPA 3M2RA 1LWCA 3M2RB 1LWCB 2D3UA 4ZITA 2GHVC 4DV4F 2V63A 4OZ0A 1DBDA 3TOQA 1VRQC 4AL5A 3T19A 2V9KA 2IYGA 3BQ0A 2D74B 2LQ5A 3IC1A 2YWHA 5DDOC 2BMBA 3V4IA 1VBYA 4IFVA 3LWLA 4DS4A 4S0MA 3IR5B 2E44A 3V4IB 3GR1A 4O3OA 1S1VB 4IFVB 1PC5A 3OLAA 1RTDA 3MEDA 4OV6A 1F3FA 1RTDB 2QV6A 2NS1B 3MEDB 1QAIA 5DG9A 5C2CA 3MMJA 2B4VA 3TJAA 5A0YA 3DHXA 5A0YB 3TVZA 3C66A 3KXDA 2W2MP 4QR2A 1VQ9S 2ATLA 3B6BA 2KKHA 4NLRA 5D4PA 4LF5J 3FEYB 4RU2A 3EXYA 4DSJA 2ZC3A 2WVFA 4DR2F 3K17A 1UP1A 1JX4A 4TU8A 3HI9A 4ED5A 5E33A 5LMUJ 4IDKA 1IBMJ 4IDKB 2BE9B 1S6OA 4JV2A 3PW0A 1S7IA 1NCLA 3BKUA 2VF3A 4OJGA 3NOGA 4RL1A 4A8YA 1HWKA 1PYSB 5KG2A 4QWBA 3CNQP 1F5BA 3H4DA 4TQSA 4EZ9A 4DXLA 2IJRA 2KL8A 1UETA 2BOAA 4URSA 4JUZA 5A8WA 5DQHA 2A10A 1KWMA 3JYTA 3JYTB 3NMAA 5J2QA 1GTHA 1ZBTA 3OTOJ 5J2QB 4YB1P 4ECVA 3K7RA 4DL2A 2R7XA 2OSQA 3CWJA 3GSIA 1RT1A 2MZRA 4F0HA 3H5YA 1RT1B 3MMBA 1TKXA 1Y3KA 1MLAA 3MMBB 1TKXB 5BR8J 4LR9A 4KQZA 5SUHA 1EAYC 5E3AA 1N32J 3GWCA 2DHGA 1WNEA 1UL3A 1R7IA 2R8HA 1RT5A 4PQUA 1EP4A 2CKWA 4LF9J 1RT5B 4X4SA 4PQUB 1EP4B 2VFTA 4PPZA 5EX0A 1IKYA 2AEMA 3M30A 2DGQA 2HSEB 2EC0A 3OD2A 1IKYB 3M30B 3MD3A 5KFOA 1VQPS 2UV8G 3PW4A 3ZTPA 5IV4A 4UOHA 2FQQB 1U47A 4Q7AA 3N6LA 3MTJA 4C8MA 3D6FB 4USJC 1WF1A 1VIXA 3CIZA 1KLMA 2FJVA 1DTQA 3OXGA 2AWZA 3T9ZA 1KLMB 2B51A 1DTQB 3GIIA 1O6XA 3P6YC 4FNIA 1U0SA 1QSYA 2M2BA 4FF3A 2Q6BA 2CJXB 1N36F 2QTWA 2KVQE 2VICA 1H7XA 3GV7B 2HBYB 1IQTA 4P72A 1K0TA 1XN9A 1Z1ZA 1MN7A 3GIRA 1S99A 1DQ8A 1L3TA 1LXNA 4TXSA 3Q24A 1YJNS 2B9XA 4FYXB 4NXNF 2NCKL 3O5TB 4A48A 3V81A 2ASDA 1RT3A 1JKHA 3CO9A 5GADU 1RU1A 2M7SA 3ZTOA 3MF5A 1RT3B 1JKHB 3T1YF 4RPFA 4W98A 4YY3J 1BGXT 3CVKA 4FBUA 4NRTA 3KHLA 2I9SA 4R5PA 4R5PB 2AT1B 4CDIA 2VB6A 3KLVA 2DGUA 2HBZB 1VQ4S 2Z2YB 2DNMA 2LXFA 3LUYA 1FD8A 1RZMA 1NNDA 4XK8C 5D4NA 4MKBA 2J9DE 3RBDA 3DLHA 4CT9A 4YHHF 2YWWA 2E5HA 4PYDA 2XWXA 3M4XA 1YX2A 5DLGA 1GT8A 4ILLA 2ZH2A 4WFNQ 3VAGA 2J0XA 1RT6A 3EZUA 2OEJA 4O0IA 1RT6B 1UVLA 5CCLA 3T5HA 5C42A 1M0SA 4A8XA 4BC7A 5C42B 2QLWA 1FRJA 1NHUA 2BR0A 2QO3A 3VZIA 1M1KT 1SL1A 2U1AA 2EPIA 5JVGQ 5D4OA 4EGLA 3TZZA 3RAQA 3UE2A 3CO0P 2LDIA 2DPIA 1ELOA 3KUGA 5HSPA 4NLDA 3VAIA 4F67A 4NA1A 3GR0A 3RZAA 3F0NA 2AEJA 1JLCA 1LV5A 4DR7F 4B9SA 1JLCB 2D9OA 3K0JA 1LK7A 1S1TA 4Z7CA 2DKOB 1S1TB 2MSSA 2ASJA 2V8DA 4IKAA 2PA3A 1ZS6A 3P4UB 4J7CA 3OR2A 9RUBA 4TYBA 3OR2B 2CJYB 4FYYB 2EFVA 1NRKA 4WJBA 1M90T 2JFKA 3H2LA 1Q5VA 2KO1A 3D28A 4B9LA 4YS2A 1S1XA 3KG0A 4LRDA 4DN9A 1S1XB 4ZCMA 4TNOA 3R97A 2GO8A 3S7RA 4HDGA 1RHRB 1AA1B 4O0NA 3GV5B 5EWFA 2GVZA 4FS2A 1S9GA 2GVZB 2DNOA 4DR5J 1RWWB 1S9GB 2X1BA 1CSJA 1GEHA 1FVSA 3HZGA 2HYIB 2M70A 4WK3A 4ECWA 2U2FA 5CYQA 5FJ4A 4I4BA 1MN9A 1S0OA 3TEGA 1X60A 5CYQB 3ZTQA 3IBFB 1VK8A 2Z2MA 4OZ5A 3SCKE 1UKUA 3M6VA 4DG1A 3TI0A 2BUNA 1HWUA 4DG1B 3NGRA 2VIHA 2GQ2A 3B54A 3MXHP 4ZLJA 2NSCA 1WHVA 4LFBJ 4EMDA 1X4DA 1N34J 2HIQA 4B3TJ 1WKJA 2EXUA 4A8FA 4OYPA 3RRKA 2GJIA 1KOOA 2FC9A 1YRUA 2DXEA 2FZGB 3V5RA 2JOQA 2JSXA 4ELVA 1M5VC 2W8LA 2BJ1A 3NCQA 1PYOB 1R8HA 1OPIA 3DYAB 3RBXA 1GXTA 2WW4A 3I56S 4EI2A 3TUZC 2Z4PA 3UN2A 3SI8A 2UU9J 4N8OA 1URRA 3LWMA 3I5BA 4N5SA 1MWZA 2F1FA 3MOJB 3L7PA 4UT4A 3M6WA 3EPGA 2LQJA 1GX5A 1MWQA 4EO8A 3AHPA 4LF8J 2H5IB 3QFHA 3HHDA 1RTHA 2LKZA 5LOQA 1RTHB 2JRSA 1TFYA 3PFEA 2CDQA 1XQIA 3CE8A 4RNFA 3NS5A 1GNKA 4X4PA 1NSPA 3CJRA 3T41A 4Y3CA 5HVHA 2CPYA 4BCAA 1HWLA 4I1TA 1NJIT 1G4CA 2BANA 3BEGB 4JI3J 2MQLA 1QAJA 2BANB 2HHHJ 4PWUA 3R7NB 4OX9F 2E5LJ 5F3ZA 1JLGA 4CLUA 5JMNA 1JLGB 2G1DA 3KNAA 2NR0A 2XB2D 1X0FA 4DUZJ 1OO0B 3ADAC 1WTFA 1VQ5S 2YXLA 2HFSA 2RRBA 4RUAA 1YJWS 2FJAB 2E9ZA 3FCVA 1WKKA 2MB0B 3PM9A 4IRKA 2QRRA 1H7WA 5K9FA 2UUAJ 2RF2A 1CG2A 2MMYA 1Q7LB 4L3KA 2RF2B 4DFPA 4CH7A 2PFDA 5KFVA 2RQCA 1TVRA 3J81U 2UXBJ 2F8HA 5E7OB 1TVRB 4ED4A 2MHNA 4A8OA 1XMQF 1LW2A 4OI4A 2DCLA 2NXEA 4NLGA 2HVHA 3UCUP 2CQDA 3K5MA 1S6PB 3EICA 4DCJB 3F44A 1BE4A 1JXEA 2IY5B 2NSBA 1VJWA 1T8EA 2M8HA 2V8GA 5F0UA 2G2OA 1TAUA 3CJ0A 2M8DB 5T41A 4MKAA 2Y1IA 4OHYA 3HK2A 3LGNA 1IKVA 3KLGB 3SQGA 2ZDOA 1IKVB 2HEKA 1P9YA 1S57A 2D69A 1KONA 1T9TA 3SQGB 4KPYA 2AKWB 1Y4ZB 3T1HJ 3BR8A 2R8GA 2N4CA 4Q8FA 1ICEB 3TAPA 4O3NA 1OPZA 2E7XA 3NLCA 1D1UA 4QWCA 3BPSP 2VQFJ 4L76A 2FPHX 1GTEA 2MY7A 2QA4S 4ES3A 2J8SA 1QD1A 4DR3J 2UP1A 4LF6J 5HVFA 1MMDA 4DV0J 2HHTA 3DC2A 2HNZA 5HATA 2VQEF 2HNZB 1O51A 3TQ1A 4CLYA 1FNXH 3IGNA 4DU7A 4OYOA 3L9ZA 2RSQA 3MAHA 4ALZA 1H72C 3FEXB 1J5OB 3OHBA 4OQJA 1B0PA 4B3OA 2PEBA 2BQRA 3IGVA 4DPXA 2AX0A 2V8HA 4B3OB 3E01A 1FO1A 1FA0A 5J1EA 1YG0A 3E01B 4N7TA 2GMJA 4OZ2A 4UY85 5J1EB 2RU3A 1DAXA 5DM6Q 3OT9A 3L7UA 1KVJA 2WOMA 5HBMA 4NCBA 2WOMB 2AJ0A 2NPIA 3RB3A 1YRTA 2QN6B 1Y5IB 5HBMB 5DS7A 2WCXA 1SB6A 3IBCB 2MHEA 1F2HA 3GFXA 4KPCA 5CXTA 4IH6A 4J9KA 1R43A 3PX6A 3DDKA 3H20A 2CPHA 3CW2C 4DPTA 4KAIA 3HM9A 2D3O1 1U02A 2D7SA 5F0WA 2MLYA 3M2UA 4ZLNA 2LQ9A 3Q8UA 3M2UB 5IV3A 4N8NA 3NCRA 3AQOA 3EGVA 1K9MT 3PZPA 3BSCA 1U24A 4NLVA 1SUQA 1XMBA 4EBCA 3LGMA 4G1QA 1SUQB 4RR5A 4GMKA 3R8YA 1IN0A 4J9SA 4G1QB 3I0RA 3A1YG 3I0RB 2B3TB 1HMVA 4HHHA 4JI4J 1DZ5A 2EC2A 1HMVB 2V4QA 3LA0A 4LSNB 1Z4UA 1PCAA 2ZBCA 3RB4A 5L9NA 1PO6A 2I0XA 4ELUA 3CJ4A 4DCOB 2F4VJ 1B4SA 2IM1A 3BREA 2APOA 4MKYA 4USMA 5M2PA 4LJMA 4CLLA 5GAGI 1L5UA 1T9UA 3CCES 3FSYA 3OBIA 2CRLA 1RACB 4O3SA 1IR2A 2RQ4A 4B08A 1T3NA 1NJYA 2KVIA 4FF1A 3KG4A 2V68A 4IR9A 2NLWA 2R7UA 4IOBA 5K14A 4NOHA 2UVUA 1UCNA 3CCWA 5K14B 4DSIA 3T6BA 4IRCA 2QYGA 4WIIA 1GK8A 1AUDA 4RW4A 1IBCB 3PJXA 1T95A 2VDIA 4RW4B 1UPPA 3A8EA 4F3OA 3H8YA 1HWJA 3HVTA 2XGQA 3CSKA 2FTRA 5DM7Q 3HVTB 1T05A 2EFQA 3SEOA 3OUYA 3PEHA 4RLEA 4DV1F 1T05B 2E1MC 1WTBA 3OUYB 3PACA 3PG9A 3D0IE 3PYGA 2NYHA 4AQYF 2RNEA 3CJQA 3MEEA 3QGHA 3J81j 1UA1A 1HNZF 1YIJS 5KFIA 1OSDA 3MEEB 1NKCA 5DDQC 1VCTA 2ROPA 4HI2A 2WB1D 3VZHA 3GLJA 1OS5A 1FWKA 2JHEA 3M1VA 3BZQA 3WIVA 1WF0A 3M1VB 4EBEA 1A9NB 4GKKF 2YWKA 1EX8A 4WP3A 2Z57B 1C0TB 3PKMA 1N0UA 4MK8A 1IM6A 1N5SA 1Q82T 1NXIA 5AE3A 1U8WA 1N33F 3CCUS 2O01C 4DV4J 4TN2A 4NZ0A 1FEHA 4FPIA 1BQXA 1X9MA 5F8IA 4OIXA 2IC3B 2BQ3A 4DZDA 3NS6A 3ILLA 4M5KA 2W9CA 3BS9A 1HHTP 1QTNB 4NYPA 2W9CB 5DRKA 3G6YA 3GIMA 3AD9C 3Q0AA 2H9ZA 1TL1A 3TZYA 3DOKA 4P2MA 4B3RF 4F0KA 1TL1B 1GFWB 3DOKB 3KLFA 4RBTA 4NLWA 3KLFB 2YKOA 1EQMA 3T9NA 3W5XA 1X4CA 2RE1A 4XPEA 1SQEA 1X9WA 2L3MA 5B0BA 4KFBA 4KJIA 4KFBB 3TAMA 2GIQA 3ETOA 2UVVA 5F8LA 4J5OA 3RR7A 3TAMB 4DV2J 4LRBA 1T7PA 3VR1A 2YKQA 4U95A 1PJ6A 4DR2J 2ZUGA 2IHR1 4FXWA 2LVWA 3Q2SC 2ZUAA 2EWHA 2BZ2A 4YB5A 1XBWA 2ZHAA 4Y2KA 3QFWA 2PE8A 2OFHX 3MAQA 1EHWA 4B9VA 3HFZB 5J2MA 4IG3A 1WEZA 2GIRA 5J2MB 4IG3B 3VGSA 3J80Y 1CPZA 2E7VA 4G6VB 1IR1A 2FJEB 2F7VA 2OJ3A 4KRWA 4UUWA 3P96A 1WHXA 2ZJPQ 2HHQA 1Q0NA 3W65A 1K47A 3X1LB 3D6TB 1OY9A 1BUXA 5F9NA 2KM8C 2MZTA 1RWKB 3CC4S 2C2KB 4JV0A 3PJ9A 3QATA 1RYSA 1R89A 4RUHA 3SFUA 4ETZA 2VODA 3P5TL 2MLXA 3ENQA 1Q1KA 5I4MA 1IBKJ 4CTAA 3ZNUA 1YJ9S 4QIFA 5KT6A 1FJ7A 3MUTP 4CTAB 3MFHA 1W26A 1YJUA 1CQMA 3NWGA 3SXLA 3SCIE 5LJ3Y 4ZPDA 2R9LA 3MHYA 3QBCA 2OH2A 2M0GB 2DYAA 3HO1A 2N7CA 4DPUA 5GMKa 3RAMA 2A6OA 3CGIA 3ZFVA 3TANA 3R27A 4CRJA 2HWIA 1N5YA 2CQHA 1NHKL 1N5YB 3LTOA 1K44A 4DR4J 2YX4A 3C6UA 3ONQA 3RGIA 4CIOA 3C6UB 3TEHB 1FKOA 4OJ1A 1FKOB 3QGPA 4NE9C 1WC5A 3MUMP 1N36J 2VOPA 2CVEA 2XO6A 1GQEA 4ER8A 4KO0A 2Z0GA 1FRMA 4KO0B 1S97A 2CJAA 2CQGA 3CDUA 1R8CA 4ZPWR 3EE3A 2COLA 4LVNP 4NXNJ 3B8HA 3CCRS 3T5LA 3HF5A 3T1YJ 4J9VA 3DRXA 2LP4A 5KTQA 1SH0A 3KYLA 1U1OA 3QT8A 4OI3A 2HK3A 1NPRA 2HKEA 3UCGA 1XR7A 2FVSA 1TKTA 1U49A 2MTLA 3RRGA 3EGWB 1TKTB 2ZFHA 5FDLA 3SQOP 4BS2A 5FDLB 1FTCA 2CJ9A 4WTYA 3GJRB 4HHJA 3ZZUA 4TLQA 2AYGA 4YHHJ 2B7CB 4DWIA 5JJBA 3GE9A 2VD3A
chains in the Genus database with same CATH topology
1FK9A 3DM2B 2V4JB 1FK9B 1G2EA 3OTBA 2CQPA 2GHVC 2Z2LA 3IRWP 4AL7A 1RT4A 4DV4F 5BYQA 4HH1A 4M1KA 4KR0B 4X84A 6FDRA 2XEXA 1N4LA 2IA6A 2DHAA 4DV3F 1RT4B 2KZMA 2RVJA 5LMNF 1DQ9A 5KT4A 4OZ0A 3QAUA 1DBDA 3TOQA 3GMGA 2E66A 4AL5A 4LUBA 1S77D 4DQSA 4WU2A 4PXCA 3TP2A 2XNRA 3T19A 2LA4A 2RIJA 1Y5LB 2V9KA 4C2MA 4N41A 2IYGA 1N5VA 2FJBB 3BQ0A 2D74B 5KT7A 2B0GA 2B4UA 3DCAA 2LQ5A 3BSOA 4LFCF 2HW3A 1IR0A 3IC1A 4ZS6A 3I0SA 3D2WA 4ZK7M 5GVQA 2YWHA 4B9TA 2DH7A 2FIUA 3ZZOA 5DDOC 3I0SB 3PIPQ 1H2TZ 1U1KA 3V4IA 1QLNA 1VBYA 1P9QC 4IFVA 3LWLA 2P6SA 4DS4A 2VV5A 3IR5B 3QJLA 2E44A 2PA8D 4RNOA 2AJ1A 2ZKTA 5I3QA 3V4IB 3GR1A 4O3OA 5K8PA 1S1VB 4IFVB 1UVJA 2DNQA 1PC5A 4UOCA 3OLAA 1VFJA 4I56A 2JZ5A 3OV7A 1RTDA 1NK6A 4K0KF 3MEDA 3NG8A 3KMSA 2ZITA 1RTDB 3GB0A 2QV6A 3WC2A 2NS1B 3MEDB 2HWTA 1QAIA 3KLIA 5DG9A 4KIAA 3MECA 4JI8F 4Y2IA 5B0GA 4QIVA 1FTRA 2BOPA 3MMJA 3KLIB 3MM5A 2B4VA 3MECB 3CJKA 4V19J 4K2XA 2D3OR 2F8MA 2JLFA 5A0YA 3MM5B 1HFEL 3CDWA 3DHXA 1P27B 3CJKB 1HWIA 2YNIA 4MYTA 5A0YB 4X62F 4PQAA 3EGNA 3TVZA 3C66A 1LFPA 3ISND 5D77A 4ZVHA 4ZCKA 3CC7S 1QAXA 2YNIB 4QR2A 1U1LA 4DLEA 1VQ9S 4QYZJ 2ATLA 3J7Z5 5EX3A 2KKHA 4NLRA 5D4PA 3FEZA 3QWPA 4H4KC 1UW4A 3M32A 1VC6A 2QMWA 1B64A 3FEYB 2WB4A 1AFIA 4RU2A 1PSDA 1U25A 3CCMS 4RNMA 3M32B 4G1PA 3EXYA 2DGWA 3IRXA 3O44A 4DSJA 2CPEA 2ZC3A 2R7OA 2MZQA 5C24A 4A47A 4Z37A 3IRXB 2K7JA 4A4JA 3QWUA 2EFNA 2M5YA 5IT4A 2PFFB 2IJNA 3O8WA 2XO7A 2ZBIA 5C24B 2N3OA 4DR2F 4KHMA 2XNQA 4ZP7A 1UP1A 3N6NA 4WF9Q 4C8OA 1CLFA 5HQ8A 3NMRA 4JI5F 1JX4A 4DL4A 4TU8A 3HI9A 1W25A 2FHOB 5KFSA 5E33A 4ED5A 4YR2A 2AYMA 4IDKA 3KTQA 2AGPA 3OFEA 3I31A 2YKPA 4IDKB 5EUHA 1S6OA 4QW9A 2CIMA 4WXWA 4JV2A 1LOUA 5KAKA 3PW0A 2HFNA 3U1NA 3ULHA 5GAEI 2EK1A 4LSLA 5HN0A 3FSXA 3F73A 2FLLA 3VF0B 1JLAA 3G8QA 2VKZG 5FLXY 1D9DA 2OKQA 1JJ2R 4OJGA 1HNVA 4LSLB 1K1QA 1U2RA 1JK9B 1JLAB 2QZ8A 3JTNA 4O4GA 1HNVB 4A8YA 1HWKA 5KFWA 5KG2A 3U1MA 4QWBA 3JB9k 1RYRA 4O4GB 1NJXA 1F5BA 1QUPA 4AXJA 5B0EA 3H4DA 2KRRA 1C0TA 5FIIA 4TQSA 3FVYA 4EZ9A 4C8NA 5E3QA 5LSOA 1XEZA 3UCZP 4RWXA 3MM7A 4PXBA 1UETA 4ZVGA 1SL0A 4URSA 4C0HA 1KFSA 5LJ5Y 3I9V9 3MM7B 3HVWA 3DDNA 4JUZA 3Q8RB 2W7OA 4YB7A 5A8WA 5B09A 5DQHA 3MM9A 3L3CA 4B3RF 2A10A 1Y5NB 3JSYA 3U27A 5HMZA 1OWXA 1NHVA 2C3OA 3H2VE 3MM9B 4JI7F 3JYTA 2R7TA 3HLUA 2UUCF 1G3OA 3JYTB 4B02A 4F26A 4URQU 3NMAA 5LT5A 5J2QA 1GTHA 2FJWA 2IC3A 4DR6F 2MKHA 1WG1A 1ZBTA 3K5LA 3DLEA 4QOTA 1T3OA 3VQSA 3N79A 5J2QB 4YB1P 1RP5A 1AXQA 3DLEB 2DGSA 2M9KA 3CULA 1JIHA 1TUVA 5G0RA 2E9TA 2C42A 2ROEA 1JLEA 3THPA 2KRBA 5EN1A 1ZTWA 3QGIA 4Y00A 4ECVA 4FVMA 3K7RA 4DL2A 2EKYA 2OSQA 5G0RB 3O2IA 3CWJA 2R7XA 4U67Q 1UVMA 5U47A 2R7RA 2HHUA 1NU4A 4NLOA 4N76A 1RT1A 4HL9A 2MZRA 5CQGA 2YTCA 5BYSA 5AXNA 3H5YA 4MH8A 2BABA 1RT1B 4I67A 1E6YA 4Q5VA 1WHWA 3MMBA 1NB7A 1H98A 5D3GB 1TKXA 4C0OC 3MCSA 4K4YA 1Y3KA 3UD4P 1E6YB 3MMBB 4C8LA 1TKXB 3QIDA 4KQZA 1U6BA 1QVGR 5KFHA 2XMJA 2D9PA 2WONA 5SUHA 4KGMA 5E3AA 3OL9A 2DHSA 3PEJA 2XY6A 3GWCA 2DHGA 4A8QA 1WNEA 1UL3A 2WONB 2RRAA 1SXLA 1XNRF 3FNNA 2N7YA 4OL8A 1R7IA 4ID8A 2R8HA 1RT5A 3NP5A 1X0PA 2AQ4A 1EP4A 4D3HA 2CKWA 4PQUA 3MFIA 1RT5B 4D3GA 4X4SA 1OSCA 2I1RA 4L72B 2VBXA 4PQUB 1EP4B 2V94A 3EX7B 4AL6A 2CQ0A 2VFTA 4PPZA 5EX0A 4TU9A 2HQ3A 3LF0A 4NWBA 2DVIA 4C4WA 1IKYA 3M30A 2ZC4A 2UXDF 3JTOA 4CO3A 3G6VA 1N5QA 4N77A 2DGQA 1K1SA 2LXUA 2EC0A 5F8NA 1HBUA 1IKYB 3M30B 3MD3A 4C3MA 5KFOA 1VQPS 1HBUB 2KHCA 2UV8G 4X4RA 3QZ7A 3PW4A 4LFAF 4WYWA 1S6QA 4FN5A 1ULRA 1U47A 2ZNZA 4Q7AA 4ZOSA 3N6LA 4ZHRA 3SZ2A 1D8YA 3PO4A 1F60B 1S6QB 5H9EJ 2DIVA 1UJ4A 2F8EX 3MTJA 5KG6A 4MK9A 4C8MA 3HHLC 4ZHRB 1SJ4P 4USJC 2RDJA 4HT5A 3CDAA 4CI0B 1WF1A 1VIXA 4DF8A 3V6JA 3CXCR 2J6TA 3CIZA 4X4TA 1KLMA 2FJVA 4DFMA 1DTQA 2IRXA 3OXGA 1N88A 2AWZA 2HWHA 3T9ZA 1KLMB 2B51A 2OTLS 1DTQB 5DO2A 2DIUA 3GIIA 1MNEA 2Y1RI 3KFWX 1QE1B 3P6YC 2Q79A 4FNIA 3UWTA 1DTTA 5KG5A 3NL0A 1IJEB 1QSYA 2M2BA 4ES2A 4FF3A 2Q6BA 1N36F 3D1OA 1LW2B 4V19X 1DTTB 2QE5A 3D54A 2DNGA 1U48A 1XERA 3SYZA 2C22A 1QAYA 2J6UA 4E0DA 2VPXB 1H7XA 3GV7B 4PG7A 1QJHA 2VBZA 2C2EA 1IQTA 4X66F 3PV8A 2O1PA 5K8OA 2BDPA 1WHYA 2FUG9 2HVIA 1K0TA 1XN9A 1Z1ZA 3L7OA 2MZJA 1R27B 4RBUA 4N47A 3K5PA 1QUVA 2W4DA 2FC8A 1S99A 1DQ8A 2RRNA 2OP5A 4WZQA 3RB6A 1L3TA 1LXNA 4TY8A 4TXSA 3AQPA 4YDXA 3Q24A 2VONA 2HHXA 1IBLF 3FRYA 1YJNS 2B9XA 2WHOA 4HTJA 3M05A 1SKRA 2AU0A 4K4SA 4NXNF 4TY8B 3OW2R 4IFYA 3O5TB 4A48A 3V81A 2ASDA 2OD4A 1XC9A 1RT3A 1JKHA 2CYYA 3CO9A 1HPZA 4IFYB 1Q16B 2DO4A 5DGBA 5GADU 4JI6F 2M7SA 5MAOA 3MF5A 1RT3B 3PR5B 1JKHB 2EFPA 3GSDA 1HPZB 3T1YF 1XNQF 2HNYA 3LO3A 1HR0F 2AW0A 3P3DA 3RYLA 4Y0FA 5FD1A 4ED7A 4B3MF 1FF2A 4URGA 3G9CA 2ZNYA 2MJNA 2GW8A 1BGXT 3CVKA 2R7VA 2HNYB 2LA6A 3RR8A 4RKUC 1R3NA 4IR1A 4FBUA 1X5SA 1Y0HA 4NRTA 1R0AA 1TL3A 4U7CA 3KHLA 5CD4H 2I9SA