1NCLA

Thermal stability of hexameric and tetrameric nucleoside, diphosphate kinases
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAGGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermal stability of hexameric and tetrameric nucleoside diphosphate kinases. Effect of subunit interaction.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nclA00
3VGSA 3BBBA 3DDIA 3VVTA 4ANEA 3EE3A 3FBCA 3ZTSA 3Q89A 1W7WA 1S57A 4HR2A 3VGVA 3FCVA 1BUXA 3R9LA 3EVWA 1EHWA 4C6AA 3NGSA 3EVOA 4EK2A 3BH6B 2BEFA 2DY9A 4ANDA 3Q8YA 3FBEA 1S5ZA 3FBBA 3VGUA 1WKKA 4WBFA 3JS9A 3DKDA 1F3FA 3MPDA 1WKJA 1MN9A 2CWKA 1B4SA 3ZTQA 1VYAA 1XQIA 3WX8A 2HVDA 3VVUA 1XIQA 2B8QA 2DXEA 4W98A 1NSPA 1F6TA 4KPCA 2ZUAA 3ELHA 3ZTPA 1WKLA 1HIYA 3EMTA 4O0NA 4FKXA 3EICA 3NGRA 3Q8UA 4ENOA 3G2XA 5BXIA 1K44A 2AZ3A 2BX6A 1NSQA 3NGUA 3EJMA 1NHKL 3B6BA 1NB2A 1LWXA 4DZ6A 3FC9A 2DXFA 3Q86A 3ZTOA 3BH7B 1NDPA 3ENAA 4UOHA 3EVMA 3GP9A 5CABA 3BBCA 3PRVA 4S0MA 1NUEA 3FKBA 1UCNA 4UOFA 3VGTA 3EM1A 3BBFA 1MN7A 2HVEA 1HHQA 1S59A 3B54A 4F4AA 4UOGA 3ETMA 5C7PA 1B99A 1NDCA 1HLWA 1NDLA 5CAAA 3FCWA 3L7UA 3FBFA 1NLKL 3ZTRA 2HURA 4FKYA 3NGTA 2VU5A 1ZS6A 4ANCA 2AZ1A 2DXDA 3GPAA 1JXVA 3PJ9A 1KDNA 1NDKA 1BHNA 1LEOA 1NCLA 2B8PA 1PKUA 1PAEX 4CP5A 4F36A 2NCKL 2DYAA 4DUTA 1BE4A 1NPKA 1U8WA 3Q83A 4DI6A 3Q8VA 1NSKL 5IOLA
chains in the Genus database with same CATH superfamily
2DPJA 2ZH1A 5K14B 4IH6A 2IMWP 5KFIA 2NYIA 1RLCL 2EG1A 1RTIA 1SV5B 4OYXA 5HANA 3WX4A 1XNQJ 4W4MA 2E5GA 3QSIA 1P8GA 2EK6A 4LFBJ 2BRKA 3JSRA 3W60A 4X4SA 2QV6A 1LW0A 1VDHA 3NMAA 4O4RA 2B7CB 3MPVA 4BWMA 4LF8J 3EVOA 2BJ8A 1REVB 3F41A 4DJBA 4V19J 5LJ5Y 4E0DA 3GJTB 1EZZB 4H4KA 3U1LA 4YUDA 2F4VJ 2VQEJ 3P5TL 1FCAA 5ETOA 1TMJA 2J6TA 3LA0A 1WC3A 1T03B 4ZPVR 2EKNA 2R7XA 2FQQB 3QZ8A 1IBMF 3M2VA 2XMMA 2OH2A 5L1KA 4FYWB 1NK7A 3IA0A 4YB5A 1NHUA 4L3NA 4RUAA 2NXNA 3ZTQA 5C2GA 2O67A 3ILLA 4LVNP 2AYEA 4BLGA 1HNZJ 3WX8A 4USKA 2DY1A 2B8QA 2RRBA 4FP9A 1UVIA 5CQGA 4YY3F 5E7OB 1N34J 3RBZA 1SJFA 2Z58B 2H4WB 2VH7A 4LSNB 5D4NA 3Q24A 4J90A 2MQ8A 2FZGB 3TJ9A 2DNRA 2PEBA 3BGRB 1B0TA 2J0QD 1H2VZ 1RISA 4HDGA 2HPUA 2QO3A 2ZOGA 3AODA 3DGPA 3CCZA 3G2XA 3HD2A 1N5QA 1U6FA 1FFGB 2DB1A 2HBQB 3QWPA 4NE9C 4DQSA 4LF9J 3QRPA 1JLFB 4WXWA 4Y2MA 1LW0B 1WG4A 3NS5A 1HWUA 1QM9A 2MPUA 2DH9A 4NA1A 4OV6A 4ECQA 2CFXA 5DLFA 2V8GA 5KT6A 4DF8A 4G3IA 1TFWA 1HFEL 4B3RF 3JSMA 2YWEA 1ZZNA 2EFNA 4KE5A 4K4UA 4JI0J 3TRGA 1RWXB 3CTRA 4Y28C 2DNQA 2V50A 5KG6A 3KMSA 2JVOA 1VQ9S 4NX9A 4NA2A 1M0SA 1KQGB 4HEA9 3ZTOA 2LECA 3QGPA 1RUSA 3M2VB 3V2UC 1REGX 2EK1A 4LFAJ 1RHUB 2ADCA 2A2DA 3MZIA 2YNFB 4URGA 3SMZA 2RF2B 3GFXA 5B09A 2Q3PA 4DR2J 1IKWA 3RW7A 2V5HG 4DFMA 1JLCB 3QT7A 5K9FA 3UDLA 3W66A 3IM8A 3KYLA 2W8KA 1CPZA 1WELA 4FXVA 4Y65A 5J2QA 2DEIA 2EC2A 4B9UA 2OTJS 2YKOA 3DMJA 3I0RB 4EMDA 3MMBB 5DETA 1BXNA 4P73A 4A8FA 3ZZYA 4K4YA 4LSNA 3HHKA 2BABA 2FJBB 2V2QA 5C7PA 3PX6A 1UJ4A 3G96A 3BQ2A 1J5EJ 1VFJA 2D74B 3V4IB 1NDLA 1O5JA 4ZIVA 4IRDA 4FBUA 1YJRA 5DM7Q 2PA8D 2LXFA 4PUOA 4F3OA 4RBVA 4DL4A 1TELA 3OUYB 3ET6A 5GAEI 3J81U 2ZDPA 2YWKA 2XHWA 5MLCV 1MU2B 1U1OA 4XO0A 2MGZB 2M88A 4P2FA 1TKDA 4C9DA 1XTZA 2B4VA 1UFKA 2WBMA 1SIWB 3PY8A 4K8RA 4IOBA 4GKKF 1U48A 5KFGA 3GLJA 1NZAA 1ZM2A 2BZ2A 2CQPA 2B8PA 1ITPA 1U26A 4DL7A 3SV4A 2QFJA 3W63A 1N33J 4FNHA 1S6PB 4HTIA 4DN9A 3LP1A 4HI2A 1QUPA 2A10A 3EGVA 4WFXA 4DL0C 2J0SD 1BLUA 2DHXA 3EWGA 3QAUA 2YKQA 3GIRA 2DGTA 4KHRA 2IVFB 3T19A 5LMNJ 3BR8A 1W25A 4DV1F 4CLLA 1RTJB 3DHXA 1T9VA 5KFHA 3J7YI 2AEJA 3H5YA 4M5JA 2XO6A 2APOA 1DHMA 1JLAA 1FNOA 1GMWD 2HS4A 1LFWA 2ZE2A 2ZH6A 4ZPTR 1TVRA 3MAAA 2RU3A 3OVBA 4F4WA 2D9OA 3LO3A 4IOCQ 2ZM6J 3MURP 1L3SA 1OO0B 4NMLA 1OSDA 2HNZB 4DN0A 4CO0A 1JQGA 5HMXA 2GHVC 3K57A 3W8GA 2V34A 2ALYB 3LAMA 2CIMA 2HHQA 2OD4A 4LR8A 4RPFA 4ZJOA 4Y00A 1C0UA 2DGQA 3K8WA 1RBAA 3KDOA 1FERA 1T02A 2OI2A 5LSOA 5E5NA 3V4MA 1SJ3P 4USHA 1X4CA 3MUTP 2WVFA 2D3O1 4NLDA 1IQTA 3CJKB 4JV2A 1HBUA 3DLEA 5D15A 4JV5F 3DHWC 5MAOA 4OLPA 4MKVA 2XLIA 4KJIA 2GS8A 2HWIA 3M32A 4AUKA 1N5SA 3VTIA 4U95A 1ACMB 2GNKA 2DVIA 2B9EA 2F3JA 2JHEA 1WG5A 3MEGA 2VQEF 2HQIA 4ED0A 1S97A 2A1BA 1DTTA 2IA6A 3D4JA 1G7CB 1GX5A 4X62F 1VJQA 4Y3CA 3G6XA 1TVRB 3MAAB 3HI9A 4UUWA 1ZA2B 3M8PA 4ZVTB 3POTA 5L9XA 4CQ1A 4OV1A 1NHKL 2DGUA 3TUJC 3MDFA 4AE5A 1J5EF 3KOAA 1DLOB 3HHLB 4YB1P 3Q0AA 1S1UB 3DRSA 3MM7B 3OHBA 5DG7A 2E5HA 1NDPA 1RK8A 2I5JB 3GMGA 4NLTA 4EI2A 2LQJA 1T95A 4RL1A 5L1JA 1HPZA 1UKUA 3H2LA 3GSIA 3MD3A 4X4RA 3SSQA 1RYSA 1ZM4A 1Q5YA 3CJ3A 4ECYA 1L5UA 2XB2D 4NLGA 4O3SA 3CCLS 1N0VC 3C14B 4O4GB 3MCNA 4ES3A 1CLFA 5B0GA 2IIHA 3CJ0A 4KHPF 1CC7A 2EEYA 3MTKA 3ULHA 3CMES 3KJQB 1FE0A 1Q5VA 3HKZD 1I5OB 4RUHA 2HHWA 3K5NA 1N88A 4PG5A 1NMEB 4LFCJ 1RP5A 3DFEA 1YJVA 2DIUA 3QRQA 3KWMA 2BXJA 4IR1A 5IS2A 3RB6A 2EG2A 2YNFA 3IG1A 4ZCMA 1B99A 3NNHA 5K5MA 5HQ8A 1ZZFA 2FLOA 3I4HX 1N48A 1UPMB 3PFOA 5DRKA 2KRRA 4DR3J 3TA0A 1NU4A 1RWWB 3GJQB 1RT7B 2DNPA 1QJHA 2VC0A 4GVLA 3I56S 4XAKA 3J80U 2DISA 3OSPA 2MQMA 4DQRA 4TLRA 2ZBPA 3AB4B 3POTB 4C97A 2W8LA 2UXCJ 3PW4A 2GVDB 1RAGB 1Z2ZA 2RRAA 3F73A 1B3TA 2I38A 1X4DA 2C2ZB 1UJ5A 3ILOA 4YDDB 2CKWA 1S1UA 1BQNA 1QUVA 2L9NA 3BDPA 3CVKA 2OD6A 1NK8A 1SJQA 4WXOA 2JLEA 1NEEA 3GCWP 3ZZOA 5DGBA 3L4BC 2CPDA 2XYHB 1YWXA 2CZ9A 1BE4A 2KJWA 2MSTA 1SC4B 4DV5J 4UQTA 2H48B 1JLBA 2ZBCA 3AA8A 3TAMB 1HI8A 4NZ6A 2FVSA 5B0BA 2IRUA 2CJ9A 4ANEA 1S1XA 4G65A 1YDLA 1RTZA 3EXYA 3G82B 3KXDA 3VAIA 2JEGA 4U8YA 4LRBA 1IBMJ 2OMOA 2ZZMA 3RBDA 3GYNA 1VISA 5C42A 3AQOA 4C11B 3UN3A 4QYZJ 2MLZA 1HR0F 1K8AT 3R7NB 2BYCA 3PACA 1IKVA 1VRQC 1MWQA 2DNZA 1H0HB 2VBWA 2YNGA 3H59A 4ZVRB 3DRPA 7AT1B 5L9NA 5DQIA 3R8YA 3KLFB 2R7RA 4RW9A 4C7QA 5DG8A 4HYKA 1M1KT 1RAHB 4P6QA 4LF6F 4NMXA 3GIJA 1Q8IA 4DS5A 2C3MA 4HACA 1KLNA 4O3PA 2DGXA 1JKHA 1Q79A 1VK8A 4A46A 2XSJA 4J9VA 1JLAB 1X0PA 3AA9A 5I3QA 3QJPA 1F5BA 2MZTA 1RTHB 1HNWJ 1RB0A 4X4PA 4YN3B 3MAQA 2W9CB 4OX7A 4L3KA 2Y1IA 5L1IA 3FCHA 2GJIA 1VQ4S 1Q0NA 4RW8A 4B9TA 1VQSA 4WU3A 3BKTA 2JEIA 1ROFA 1U1PA 4FF4A 1SC3B 3R6LB 1MSWD 5I3UA 1HBNB 2X51A 1E6YA 2YQ1A 2O01C 3G82A 5C24A 1WNEA 4OHZA 1RLDA 3BYRA 4HH0A 1NK0A 3QO9A 2YNHB 2O1PA 2HQCA 3BSAA 3QGGA 4Y2IA 3EZ5A 2UVWA 4C8MA 4DR2F 1S1WA 4N77A 1RT3A 2ZH4A 3D6HB 4HT5A 2QMUB 3LPYA 4CTAA 4XPCA 3JYTB 1DRZA 2XS7A 1NK6A 1NB2A 1L3TA 1S72S 4C8OA 2HQ3A 2QE5A 1FA0A 3TZXA 1JNRB 3FC9A 3M6VA 2JH3A 4JI3J 1KC8T 4HACB 1SJ1A 4RO0A 2ZZNA 5DM6Q 1S6OA 3ENVA 5CCMA 1U1QA 1M5PC 3NWRA 3A3NB 2XSJB 1VQYA 2LLZA 3MCMA 1N33F 4L72B 3D6TB 4U96A 1CVJA 2CDRB 3ENWA 1FX4A 1RT1B 1H2TZ 1LWFA 2BUNA 2F8MA 2O5DA 3I32A 5FIIA 3SCJE 4JB8B 2W9CA 2QA4S 3JAMY 4BBYA 3MCSA 4ZVSB 4UY8T 2H9ZA 2KB2A 5G4DA 1H73A 3AJ2A 4PWUA 4ZHRB 1TL7B 4NZ0A 2BE7D 3KLVA 4CT9A 3M9MB 2ZH5A 4FDFA 2P9EA 4X62J 4KPYA 4ILLA 3K5MA 2C3UA 3ISNC 3K7RA 2I5JA 2L9DA 4PABA 2ZH7A 4F4AA 3W2VB 4X64J 1VQPS 1FD2A 4JV1A 3OL9A 3CJRA 2YNIA 2WSFC 2HSEB 4P2XA 4QQBA 2NUHA 5ETTA 2UXBJ 4YOEA 1C1CA 5CAAA 5LXRA 4F2SA 4DL5A 3CD5A 4K4WA 4F8RA 3MCOA 3B4DA 3PYFA 2CQ0A 2ACMA 2G2YA 1S1WB 1N36F 1VQLS 2PT0A 3H7HB 4OYPA 3QAEA 5L46A 2HMIA 5D0HA 1M90T 4CNZA 4URQU 1YSJA 3MM6B 1WTBA 1U47A 2IHR1 5GMKa 4M63A 3C6UB 2OIHA 1WORA 1S7IA 4DQPA 1ZYQA 2DO0A 3M2RB 4C8ZA 4J7CA 2CXEA 3PYDA 3GIIA 2WZ1A 2B56A 1DTQA 2LXUA 2XBPA 5CYMA 5DGAA 2F4VF 4IG3B 3DYAA 1NCLA 3KK3A 4DU7A 1PAEX 3DOKA 3SBMA 2X1GA 2ROEA 1OIAA 2DYAA 2J5AA 3E51A 1NM2A 1U8WA 3IRXB 3TX0A 3W7BA 5ITHA 2MB0B 4LREA 1MROB 4DI6A 4DR5F 3V6DA 2MEWA 4LF7J 1UVJA 2XGPA 1V5IB 1QSLA 3BS9A 4WFYA 3FBCA 4Z2XA 2AT1B 1VQOS 1KFDA 1MMNA 1F3VA 3BN4A 2C42A 3TQEA 2ASJA 3TA2A 3KTQA 2VPYB 2VD3A 4AXJA 3R7BB 3FCVA 2X1AA 5ADZA 2YNIB 2XMUA 3L09A 3G71S 1RT6B 2C2KB 3FQLA 3LTOA 3NBPA 3DI6B 3O6QA 5M2RA 4ED4A 3HFKA 2QLFB 3U7JA 2HRUA 2DR8A 4ZVHA 3NKYA 4M5HA 2MQQA 4F4XA 1I94F 2XS2A 1WOSA 1U2CA 1KKHA 3CJSA 2QLXA 1G4CA 2OPQB 4KY3A 4I6AA 4JOUA 5A2QY 2IM3A 3IWXA 2HMIB 4CCHA 1Q95G 2W2OP 2HK3A 3G6ES 3ADAC 1UVKA 2DHHA 4JP8A 4Y2AA 4YR0A 1JXLA 4C0BA 2AX1A 4F02A 1GH8A 2H54B 3JS9A 2R7QA 3P4UB 2BBEA 1PYSB 4EEYA 3CCUS 3VAJA 2KZMA 1F60B 2XQCA 5CYMB 1IBCB 2VFRA 1YZ6A 3EZUA 3P5BP 1SJRA 5HVHA 3OHAA 2PFDA 4QR1A 4LFCF 4WZQA 1WF0A 1T3OA 5JXSA 3UWTA 3MAHA 4ES2A 5KFOA 5EWFA 3Q8SB 1UZHA 4KYZA 4R0EA 1S1VB 4MAKA 1ZTWA 3ZZZA 5A8RB 2R8JA 2XWYA 3NGRA 1NKBA 4O3RA 1C2PA 5JUMA 5BXIA 2XGQA 1H7XA 3E01B 4DUZF 1FXDA 4OL8A 1U0HA 4OYZA 1HMVA 1GT8A 4DWIA 2CPFA 2EW9A 3M8WA 5KG3A 2DGOA 1XMOJ 1ZM9A 2MKIA 4DV6F 4M5LA 4DV4F 3EJMA 3S01A 5KFFA 1FK9B 2ADBA 3HJVA 4PCQA 1FFSB 1E6YB 2HLTA 2ACYA 3OTCA 5THWA 4RNOA 1VQ7S 1L3UA 2MQPA 2AJ1A 3IR7B 4ED1A 4GO5X 5F9LA 2JRSA 1S1TB 4KBIA 2W2MP 3TUZC 3JXOA 3EVMA 1IBLF 2IMOA 2F8EX 4KQZA 5HMZA 5B0CA 2AQ4A 2HS3A 2LQBA 3JQMA 3LWMA 1TV6A 2FC8A 2ROGA 2YH0A 1RDRA 2VDIA 4NEZA 2BMBA 2JZ5A 3MM9A 1S0NA 4LFBF 2HHVA 4ID5A 2KHCA 1IN0A 2FIUA 4C8LA 2WAQD 5JVHQ 1YBUA 3R27A 2NZCA 4HLBA 5LJ3Y 1GTEA 3QSYB 2VG7A 1U45A 2JEJA 1HQ2A 1IWAA 5EHHA 2GIQA 5GAGI 2LYVA 1B64A 2XYPB 4JI1F 3O2IA 2AF6A 2V4JA 3QJJA 1N0UA 5J2NB 2UUAJ 4ERDA 4FKYA 3SSSA 3HLUA 2X1BA 3R5DA 1Q7YT 2XEXA 2AD9A 1KHVA 1HQUB 2CNKB 3G8SA 4WIIA 1FK9A 1BGXT 2LP4A 4DV2J 2MJNA 2AW0A 3HZGA 4HHHA 4OI1A 1SQGA 2O3DA 2W2QP 3CJTA 3J7YU 2PFFB 2UU9F 2LU1A 2GJ2A 3DRRA 2FY8A 3UVJA 4R5PA 2RQCA 3AXKA 3PJ9A 2R7WA 2CQDA 4U7UD 4JI5F 4XTTA 5EN1A 1YZ7A 3OJSA 1BWVA 2WCXA 3UDVA 4B9SA 2LQ9A 3KJFB 4CP5A 3JSMB 1TR0A 1UVMA 1S48A 3TEGA 4X66J 2L3MA 3Q83A 1WHVA 2E1PA 2ZUGA 4CO1A 5SZTA 4A4JA 2CZVC 3T1HJ 4Q2MA 4ECXA 5KFJA 4DLEA 1KNZA 1TKTB 4DPWA 2BR0A 3M6XA 2MJUA 3C46A 3RAXA 2DK2A 4ID5B 1GNKA 1IUJA 4Q2LA 1RWOB 2G2ZA 2YBVA 4MIAA 3W5ZA 4HR2A 2DGSA 2QA4G 2LA6A 2COLA 3DOKB 4NYZA 2J9EA 3B8HA 4UTGA 4LF2A 4Y34A 3HHNB 2R7VA 1U49A 4DV5F 4UZBA 3CCJS 3DRXA 3KUEA 4I0WA 1KTQA 4QZVB 2B7BB 4ANDA 2YKPA 3PYGA 4ZK7M 5A0YA 4CT8A 3NS6A 4N47A 1NK9A 2CPYA 5I3PA 1AUSL 4H4MA 3IBCB 2E7VA 2HGMA 1RCXB 2Q6BA 4ZP6A 4FVMA 2A18A 4ID8A 3UCUP 1WHXA 3LANA 4QCLA 1F3FA 2FDNA 3CJ5A 1WKJA 3KUHA 1HWIA 1HW9A 2POKA 2AGQA 4HKQA 3K2YA 2NQPA 3U1NA 3M8QB 4NI2B 4TXSA 2Y0BB 3R5JB 4DX5A 5B0DA 4Q45A 2D3OR 1S6UA 2IM2A 4B02A 4ED7A 5IT9Y 2AMCB 2CJAA 5H9EJ 4IDKA 1X4EA 1NSPA 2KHDA 5KFLA 4KTQA 4H4KC 2KTQA 2R7TA 3MECB 1D8YA 4YMEA 5J1PA 5IQQA 4PEOA 3HCXA 4ETZA 1IBLJ 5M2PA 3DLLQ 5E3RA 1S4EA 2G13A 1U2RA 1RA6A 2J0WA 4J9QA 2KDOA 1IBKF 2FGCA 3OFHA 4WCEQ 2VASA 3RRKA 3CUNA 3O44A 1WHWA 2DGVA 5DG9A 1YJUA 4KH1B 2DR7A 3P8BB 1FWLA 4LR7A 5DJBA 2KFZA 1PAUB 2JFKA 2YPZA 3QFHA 5IT4A 3G4SS 4WF9Q 1RBOB 4DS4A 3ZC4A 3WZ0A 3JAMU 1U6BA 4LRDA 2W25A 4PRFA 1RE1B 2BW2A 2CWXA 4KKOA 3LGMA 1G3OA 2ZE2B 3ZZUA 2OHDA 3M4XA 4YR3A 1R7IA 2IVYA 4OI6A 1KBRA 4MIBA 4AXIA 4C0HA 4B17A 3PRVA 5JVGQ 3R5AA 2BM0A 1CS4B 2FUG9 1QAYA 3FKBA 1H98A 4WTYA 4JI6F 1CQNA 5KFMA 5D4LA 4N5SA 2KFYA 1F2GA 1NSAA 1D09B 1O6XA 2CPEA 3CC4S 4CIOA 1C0UB 2H3EB 1U8SA 3MM5B 8RUCA 3A8JA 4LJMA 4ECTA 4P52A 2XMAA 4UOGA 3CCES 4P75A 1XMQJ 2V9WA 2FZKB 4NPOA 4ECZA 1SH3A 1YJ7A 2W2NP 2ZBQA 5CD4H 1URRA 2WW8A 5BYQA 4N7TA 2JWNA 2UUWA 2KT3A 3FBFA 3L7OA 3VQSA 3TJAA 4KGMA 1U1NA 3M32B 5AE1A 3H8YA 2MQLA 4QYRA 1RU1A 2XI2A 5AE3A 1JLEA 1VJWA 3EPGA 3M8SA 4PG8A 2F40A 4JI8J 1M5VC 1DQ8A 4Q0BA 1QDUB 2M70A 4KKOB 4ZPAA 4B3TF 3H5XA 4YP3A 4M1KA 2GVZB 2J6UA 3OR2B 2A0FB 4B3MJ 5IT9U 1C4AA 2LDYA 2QFIA 4LSLB 1TL3B 3PFEA 4HTJA 1REVA 2MLYA 1RAJA 5IOLA 3W2WB 1W2IA 3PR5B 3K5PA 4DFPA 2ASLA 3LW5C 1KSPA 1KQKA 4RX6A 1PBUA 3D9BA 1EETA 2B0GA 1H38A 3GWCA 2CA9A 2FB0A 3A8IA 4XK8C 4QW8A 1X8DA 3CGIA 5HQLA 3TVZA 4CM0A 4CO5A 2AGPA 3G9CA 3CDBA 3HVTA 1AUDA 3OTOJ 5HBMB 2C22A 3RR8A 1Y4ZB 2YY3A 7FD1A 1HNVB 2QL7B 3C6TA 4O4GA 3CC2S 3SEOA 1VS3A 3R1HA 4OZ2A 1HA1A 3THPA 1BMQB 3O1LA 5B08A 4G1PA 2HHHJ 3Q8YA 1JLEB 5DZ7A 4WFNQ 4TU9A 1HBOB 2NUUG 4A8OA 2HVHA 1SXLA 1FKOA 1XK8A 2DNNA 2M5YA 3AT1B 4ZA1A 3W5YA 3SZ2A 2Y8WA 1MW7A 3DKDA 3MPDA 1J2VA 3PYEA 1PSDA 3DGPB 2PMZD 1K9MT 1MN9A 3H2VE 5IWAF 1FNMA 5EX0A 5DDPC 2KZZA 1FHTA 2UUBF 1R6YA 3LGNA 5KG2A 1GFWB 2MQNA 1RWVB 2N3LA 4MYTA 3UE2A 4AL6A 3UD4P 1TFYA 1NJWA 1TL3A 3KFWX 4MYUA 2VF3A 3IGNA 2I9SA 3HP6A 1G2EA 1OY6A 3ELHA 3IFEA 1NPRA 5F3TA 2YKNB 3EMTA 4GC6A 1FF2A 3THTA 4FKXA 3EYZA 1KVIA 2HBRB 2CVIA 2JJ4D 2G1DA 1QSYA 2V69A 1HW8A 5KFDA 3MR6A 2BKOA 1TK0A 5HBMA 2OSRA 2SXLA 3C6TB 4WFZA 5E3PA 1SKUB 2BQ3A 5CHCB 4D3GA 4QWCA 1RSCA 2NXUA 3D0HE 1CJTB 1E6VA 2DD8S 1VBZA 4JUZA 2B6AA 3VV2B 4DU8A 5DQGA 5GADU 3V6JA 4YS2A 3GTYX 4ZCIA 4ER8A 4GO7X 2ILZA 1SKSA 1IKWB 2B4PA 3P45B 4ZVGA 2V94A 3NGDA 5E2QA 4ECVA 3DRPB 5CABA 3ETOA 4MTPA 2Y9HA 2OTLS 2WONB 2OPPB 1T94A 4ZLNA 3V81A 4AT1B 3NGKA 1X5TA 2LEAA 4RZRA 1PG5B 4QR0A 3HFZB 4M5DA 5SUHA 5HLFB 1GMVA 1RWKB 3IMQJ 1U24A 3ZXWA 5E33A 3ZZPA 2JLFA 1FWKA 4USTA 3IRWP 3DLHA 2XC9A 2V63A 4B3OB 1UEKA 3W9JA 2FJVA 4ICLA 1LFPA 3OPKA 1P9YA 4AQYF 1K0VA 2AYBA 4KV8B 1I51B 3RU0A 4G6VB 3KK2B 4WZMA 1X5OA 4QYZK 2AHOB 3CSKA 4J5OA 1LWCA 2ABYA 1RKJA 2AJ2A 1RZMA 1U7LA 2DH7A 2VU5A 1HBNA 2OO4A 3OV7A 1RT2A 2ZC4A 1L3VA 1ZAXA 3RBXA 2OAUA 4DQIA 2YX1A 3OFFA 4F4ZA 2OFHX 4KB7A 4MK7A 4NYPA 3UNGC 1VLYA 1R27B 3SDEB 2HQGA 3MM8B 3MEEA 4KHMA 2HIYA 3IM9A 1U4BA 9ATCB 3B4MA 2NCKL 3T9ZA 4OYAA 1XNRJ 5KFUA 5KOWA 1WC6A 2GMLA 1TK8A 4BWJA 2P9GA 1R0BG 2KT2A 1ZBTA 3TI0A 5DDRC 1S9FA 5T7LB 3D67A 1UWBA 5KT3A 4ED6A 1QAJA 2E7XA 2GJFA 4M5DB 3NAIA 1ZPWX 3C19A 3FQKA 4LRAA 4U7CA 3M30A 1N5TA 3BJYA 2F65A 2BA9A 1HD1A 2MHEA 2CRLA 1PILA 1VQ8S 3QWUA 1FX2A 2JFDA 5C25B 3EVWA 1ICEB 4C6AA 2R8KA 1VIOA 5AXMA 2U2FA 4B3TJ 1SH0A 2C3YA 1YBAA 1YJNS 1TL7A 1FEHA 2VPWB 3B78A 3LQVA 3W64A 4L74A 3PW2A 1CEZA 5IC4B 1HI0P 2CJKA 3D5MA 1Z2LA 1GXTA 5FDLB 2M2BA 1RT2B 1JIHA 3MMCB 4RW6B 3FBBA 1C1CB 4GVBA 2Z4PA 1FE4A 5AXKA 3ILJA 4DUYJ 2ATLA 3CJKA 2ZKUA 3TO8A 3DM2B 3N5FA 1FJEB 1VHFA 1HNVA 4O3QA 5HVFA 3NCQA 3TZYA 1K1SA 1T9UA 4Q8EA 4O0IA 5HP1B 4DG1A 1B7FA 1QD1A 2VFUA 3FGVA 1H72C 8AT1B 2L48A 3OTOF 2QLBB 3AQPA 3R5GA 4OI2A 4W98A 1RQ0A 3LOUA 3AJDA 3W65A 4C2MA 2B51A 4PG6A 2EFOA 2VOPA 1TAUA 4JI4F 4NLWA 2AWZA 1CC8A 1WKLA 2BV3A 2M0GB 3LPEA 4BC9A 5T14A 1DLOA 3HHLA 2VA3A 5ETPA 3W62A 2LA4A 4LUBA 4DV3J 2QIFA 1SH2A 3KLEA 3CD6S 3W8PA 3I5AA 5D3GA 1R89A 2DR6A 1M5HA 3BV8A 1YRXA 1DTTB 3ISND 4DPUA 4C98A 3EGWB 5KFRA 3CDUA 1XC9A 2KM8C 3WC2A 3KG4A 4QOTA 5KG7A 3OQ2A 3L3CA 1NK5A 4DZ6A 4RNHA 3M6WA 2QSWA 5D4OA 3S8SA 4WK3A 1NJXA 2PMHA 3HVRA 2IYGA 5H9EK 2EI5A 3C8YA 3DRSB 3W1YC 4R0JA 2F9DA 3K5OA 4KGKA 5ETRA 2MZQA 4RW7A 5E41A 1EKSA 4RUCA 1HNXF 4DG1B 4FS1A 1UCNA 2CG4A 3D6MB 4NLSA 1KP6A 3NWGA 5IC6B 1LW2A 4LF5F 2MKCA 4ZOSA 4P74A 3SCKE 3SSRA 2MKKA 3H40A 3EZOA 4KGZB 3IP0A 3H25A 2W4PA 2ZBIA 3I31A 2P9CA 3IS9B 4RLEA 1M5OC 4PQAA 2PDAA 1FDAA 5G0RA 3NLCA 1X31C 5KFWA 2E5LF 2VFTA 3K17A 1RT7A 3THVA 2E1MC 2QA1A 3FJ2A 3JQJA 3JTPA 3J7A1 3BKUA 3G6VA 2OPPA 3IG1B 6FD1A 3Q22A 4DR1F 2FVQA 5IQ6A 2MLXA 5F8GA 4LQ3A 3BYPA 2EFGA 4YB6A 1WSVA 2DCUB 2VDHA 4PXEA 5IM0B 3GFYA 5L1LA 4ZPCA 1WC1A 1WTFA 1N8RT 3AHPA 1OPZA 5FLXY 1FXRA 1IKXA 1OSCA 3KHRA 4DPYA 2ZD1B 4M5NA 4LRFA 4B3OA 1Z4UA 2R7UA 2GZOA 2ZBRA 3UN2A 4OX9J 1PJ6A 1IKYB 3PRBA 2QJ3A 3NEKA 1NDKA 1BHNA 4KV8A 3FFIB 4OZ3A 4C11A 1HR0J 4Y0FA 2MKSA 1S12A 1IKVB 2CJYB 4MMOA 4N8OA 1LQ9A 1FDBA 1S9GB 1X9MA 1P6TA 2I2YA 2XY6A 1R8BA 1SC6A 1FEEA 2ZFHA 5GAEU 1R8HA 5GMDA 5AJ3J 3IXQA 1LW2B 1EJ7L 3HHEA 4DHVA 4NXNJ 3TAMA 5IWAJ 4WP9A 5DQHA 3KK1B 1FKAF 1IM6A 1NHVA 4I2PA 2HW3A 3O3LA 3PIPQ 1XBWA 2LCWA 3IS9A 4DLGA 4W90B 1EP4B 1KR4A 2B43A 1R6VA 5EDWA 3MEEB 3R9LA 2IVMA 2UUTA 2QZ8A 1RTHA 4FNIA 1FXLA 4X4UA 3PW7A 1CG2A 5AT1B 1I1GA 3FUYA 1K1QA 2OLWA 3JTOA 3NGSA 2UU9J 3ILIA 2RF2A 1TL5A 1Q8LA 3QT8A 4CDIA 4K4XA 4DMZA 4PYAA 2CNOB 2DTJA 2DY9A 5CA5A 1JLCA 3CCQS 2DCLA 3EUNA 4ES1A 5LOQA 1NKCA 3OXGA 4WP8A 4JI2J 4RW9B 2ZC3A 2KO1A 1LXJA 4RW4B 2R8GA 1NO8A 2FTRA 1KS2A 2X7IA 4OIXA 3MMBA 3J81Y 2AGOA 2E9ZA 3R7SB 3HK2A 3PIOQ 1IR2A 4C0OC 4MK8A 1NXIA 2EWHA 2FHJA 1YG0A 3QO9B 5DLGA 3FDSA 4M8LA 1R0AB 2IAJB 4OZJA 1FO1A 2N82B 2VG5B 3PO4A 2R7OA 4I69A 1S49A 2YQ0A 4OZ0A 3V4IA 2HS0A 1HHTP 4K7QA 2IJNA 4EU0A 3S1TA 4A8SA 2YKMA 1S9EA 5LSRA 4B3MF 4IR9A 3PCOB 4R25A 2PO4A 5D0EA 4G1QB 1UPPA 4EFAC 5HO4A 5D6GA 4GVBB 3D0GE 3NOGA 2MGZA 2BJDA 1LV5A 3HJFA 3R2CJ 4PWDA 4I2PB 4NLPA 1UA1A 3RRGA 3C66A 2H5EA 2BVZA 3PM9A 2J9CA 4FXDA 2FJEB 4CTAB 1ZA1B 1YJ9S 3NY0A 4ZPBA 4WFBQ 4X4NA 1ZAVA 3IWNC 4NXMF 1UETA 3I82A 2R9LA 1U0SA 1W26A 1VOMA 3EXCX 3TAPA 3PV8A 1RT3B 1Y5IB 2V8PA 6FDRA 4FVCA 2R4FA 3QT5A 1K73T 1YX2A 2IFXA 1M5SA 1DURA 2KYXA 3KLGA 3SQGB 3NOCA 3MMAA 1NJYA 4LF9F 3CT9A 4ITSA 4ZP9A 1Q4RA 2UUAF 4ZS6A 3OL8A 1FFWB 2NPIA 1LK5A 4UOHA 2HHSA 3BO4A 1WDTA 2WB4A 3NL0A 3A1YG 4ZHRA 2R2UA 1HBUB 3PZPA 4FYDA 1VRTA 4ECRA 2CVEA 3KG0A 4CO4A 4CZCA 1VRUA 2Q6CA 1VQ6S 1FJGF 3VAGA 3AD7C 1VQKS 2JL9A 2VL1A 2K1RB 3R1LA 2J9DA 2CJQA 2IBOA 4ECWA 4I2QB 2VC1A 4J9NA 2ILYA 2HEKA 1EARA 1NJZA 1TKZA 4PWDB 2MY8A 4RKUC 2AJ0A 5E3CA 4NCAA 3Q2TC 2R7SA 2IDLA 5JJBA 3GILA 2XWXA 1M5KC 2E29A 2VJVA 4BHQA 2AJ4A 3KDNA 1KTVA 2KI2A 3TVYA 4CLZA 2KKHA 3M8PB 2HGLA 4P7VA 4KO0B 3NCPA 9RUBA 3W9IA 2HHXA 2RMLA 2Z2MA 2KYZA 3GFHA 4M94A 1RABB 3GIMA 2G2OA 3MUMP 3M2RA 2QGFB 2HFVA 3K5LA 5HQMA 2ZKTA 2RIJA 2A6MA 4DV2F 4DBQA 4LMZA 4U9RA 3T3FA 3MM7A 2UXDJ 1OY8A 2NSCA 3GPAA 3MM6A 3I5CA 5KG0A 2JC0A 2Z8QA 2HYIB 4N76A 5BYRA 2GC8A 1MMDA 2VBYA 4QIEA 2M52A 2MHNA 5D77A 3HFVA 4MKBA 1FESA 1GXUA 5K8OA 2VQFJ 1S77D 4I7FB 2CQ1A 2RU9A 3K0JA 4AL5A 3PDNA 2KXNB 2PI4A 1VC6A 3UPFA 1T11A 4Q8FA 2UVVA 1HHSA 3MFHA 2IM0A 1BD6A 3DU5A 5GADI 3C14A 2RDDA 3VGSA 3OTBA 3BBBA 4CNYA 1GXLA 3MPWA 1JXEA 3HSGA 4FN5A 2MDAA 4P7TA 4DSFA 2HVIA 3CC7S 2AJFE 2HNYB 3OXLA 2RILA 2XYGB 2LMIA 1T9TA 1N5VA 2GQQA 3RGIA 3SFUA 4QIGA 3NNAA 2GO8A 3PKMA 1IM4A 4GKJF 2LFVA 2JDJA 3BSCA 3BPSP 2I8EA 4YY3J 1N34F 1TZ0A 3M2UA 2E5LJ 3F44A 1CSJA 3MOZA 2BM1A 4X65J 3QPIA 4KFBA 1ZETA 4B3SJ 3I4PA 1P27B 1SBRA 2BEFA 2F63A 3PHEA 1YRUA 4M5KA 3J7ZT 1N56A 3I5BA 2HFSA 4P10A 2BRLA 4EBCA 1UEUA 1RYRA 1S5ZA 2CNNB 3QFWA 1WC4A 1BQMA 5F0UA 3P3DA 2E44A 2BJ3A 4EBDA 1WF2A 2FJDB 1IWGA 1JB0C 2B9WA 2FD2A 3SXLA 4E8UA 4QIVA 5M2UA 4P72A 4KT0C 4AYBD 1VYAA 4J9KA 2K06A 2LQ5A 2Y1RI 3UNYA 1VQMS 2C2RA 1V3ZA 2HVDA 2WRMA 3HVAA 1AZSB 4NCGB 2E1CA 1XIQA 4OHYA 4E98A 3A12A 4K0KF 1F6TA 1D9AA 3CD0A 4DV6J 4DV0J 4EZ6A 4LF8F 1B7YB 3G86A 2Z56B 1IVZA 1UL3A 2AX0A 2MZJA 2HG4A 1KHWA 1RI7A 4LIRA 3I87A 2FHMA 2ZM6F 1JNZB 2OFGX 2XCAA 2XHCA 2CG8A 5EUHA 2XY7A 2I6WA 2Y3YA 2UV8G 3LGHA 1V5VA 3BZQA 4PWWA 1N54B 3TP2A 3CXCR 1NNDA 2K3IA 3T1YJ 2C2EA 3W3SA 3H0PA 4J37A 2D7SA 1KFSA 3HHDA 5HN0A 3A3PB 3OD2A 1SL2A 5RUBA 3OL7A 3SCIE 1EETB 3HM9A 4JYAJ 4JI4J 1DY3A 2VKZG 3T41A 4Z7CA 3QJLA 1AFJA 3S6EA 3M7VA 2WVBA 3G8TA 1NH8A 3Q86A 8ATCB 1QY7A 3DOLB 3R97A 1JKHB 4DR3F 3RAQA 2HBYB 4CH0S 3ISZA 3M8ZA 2LEBA 1HQEB 4A47A 2XG8A 5KOXA 1NH7A 1YHQS 3W9HA 3MM9B 2QSFA 3UO0A 2KRBA 3EM1A 4NCGA 3RJMB 2GMJA 2GGPB 2ZNZA 2WVEA 3IBWA 3SFGA 3MEDA 5BJRA 3OFEA 2VHGA 1EX8A 3UD5A 2GIRA 1X0FA 2UVRA 2WHOA 3CNQP 3ETMA 3IBFB 4F25A 3GIKA 1G1XA 3UVJB 1RHRB 3RUBL 4K4TA 1NDCA 1HLWA 1P9QC 3FCWA 1X4AA 1HKAA 4F3QA 3A8EA 1KD1T 3BGLA 2XI3A 1VRTB 3HX9A 3P49B 1WEXA 1TL4A 2W9BB 3OR1A 3CULA 1HARA 1TUVA 4PKDB 4LBIA 2MKHA 3CEDA 5DO2A 2OEJA 3ONQA 4LF7F 1D9DA 1X4GA 1ZS6A 2JVRA 3PEHA 3BQ1A 2OEMA 1R3NA 1S0VA 3R2DJ 1GX6A 1SIZA 3TA1A 3CCMS 5FJ4A 2ZWPA 3QNWB 2WOMA 4LQ9A 3H98A 2RAQA 2KVIA 1X5SA 3WC0A 5KFBA 2XMTA 2R8HA 2XNRA 1Y7PA 3CJQA 3UQSA 2I0XA 2GV1A 4FYXB 4WU2A 3T6JA 1VR6A 2F1FA 3QMQA 4F36A 5B7WA 1J27A 1SUQA 3N6LA 1JJ4A 1WEYA 2DHSA 4J9RA 1YQHA 2BE9B 1E6VB 2BOAA 2ZHBA 2ZHOA 4PXCA 2E5JA 2DJWA 2EC0A 3A13A 2B9XA 1D1UA 1WC5A 2HLUA 2IPOB 1SKWA 1I3OB 1AB8A 4JBCA 4WWSA 3WIUA 1JLGA 1FRLA 2R42A 1Q82T 4ZLLA 4F0MA 4WK1A 3T9NA 1DBDA 4J9MA 4J9LA 1EHWA 2PEHA 2JX2A 1AA1B 3IAM9 2BKNA 3VF0B 4QBUA 2DRDA 4LR9A 4EK2A 2QT7A 4DL6A 2FPHX 4IYQA 4H4MB 2BJ7A 4EZ9A 3T5KA 2Y8YA 4DQQA 1P1TA 3PRDA 4DR7F 4IQMA 5FLXU 2WB1D 3R3TA 3RB3A 1JX4A 1URNA 4ZJLA 2GAGC 2FHJD 4NLQA 1JMTA 4RWXA 4Y2KA 4ELTA 2C3OA 3PJWA 1KOHA 1Z1ZA 2Q1LA 2RQ4A 5IT0A 1RA7A 1IR0A 2KM8B 3WDOA 5E0OA 2QEXS 3PG9A 1S6QB 2F9JA 4DF4A 3N5BA 3D1HA 2DXEA 4HVZA 5J1EA 1LWEB 3PO5A 1WSRA 3V6DB 3C2PA 3NXZA 1SL0A 4OYBA 2R2RA 1NBEB 5EX3A 3T5HA 3ZTPA 2V0NA 4IUFA 1TKXB 2V67A 4M5MA 1PIEA 4OYIA 5D8HB 1F9HA 3CDEA 4B08A 1J5OA 2Y0SD 4ED2A 2XLKA 3D7SB 3Q8UA 4ENOA 1DARA 1IQZA 3G6YA 2I1RA 1Y0HA 1SC1B 2AZ3A 2J7WA 2LDIA 4TN2A 3TUIC 4Z7YA 2EPIA 3LP0A 1TK5A 5D78A 1RWPB 4X4VA 1RT6A 2UV8A 5KT2A 1AZSA 1DQ9A 4O44A 4F67A 3FSYA 3OL6A 3AFGA 3H20A 1YI2S 2CDQA 1HBMB 2RQKA 3B82A 3VWSA 1RAAB 2F7VA 3AD9C 2XMJA 2YX4A 1RTIB 1SV5A 2K8GA 2VFVA 4HL9A 2K7KA 3IO1A 1N5YB 3PNIA 2FHOB 1UJ6A 4FF2A 2EBGA 5IFMA 3BO3A 4YFUA 1UW4A 2J9DE 2EKYA 1RGVA 4FPIA 3CIZA 2F4FA 2J6SA 1N32J 2W9AA 4DL2A 1F0XA 2QL5B 3K58A 3GP9A 3BBCA 3IR5B 2R8IA 5KFNA 2C28A 1VQNS 4J9SA 2XS5A 2AJQA 1OYDA 4UOFA 5GAHI 1YKWA 1KVJA 3SCLE 5K14A 3L9ZA 5J1EB 1Q7LB 1NKEA 3ZNUA 2KVQE 2ASDA 3HO1A 2EFPA 2XSFA 4JI8F 1W2BR 3QIPA 1X9WA 3CIMA 1DFDA 2E66A 2MYFA 2ZVSA 1PGZA 2DR9A 1RXOB 1EIYB 3D54A 4ZCLA 3T6BA 2VB6A 4RWWA 3TARA 3UR0A 5F8IA 2H65B 4LT6A 4H4OB 5GAGU 1YVFA 4TYBA 4USMA 3PTWA 1D8ZA 4NWBA 2B4UA 5GMEA 3U1MA 5HMYA 5LMNF 3V6HA 2MSSA 4K4SA 2RRNA 3CPWR 1FVQA 3OFGA 1CJUB 3NGTA 4P2SA 3X3UA 1BY9A 3W61A 5EWGA 2ZH2A 1QTMA 3D2WA 4I64A 2XZWA 1Y11A 3DN9A 4LBHA 3KHHA 2RJZA 4V1Ak 4ATNA 3C16B 1N5YA 3KLEB 1UWAA 2XZDB 1NRKA 3RG6A 5CD4A 3Q8QB 3HXMA 4L75A 3M1VA 1NPPA 1N6QA 1S1VA 1Q53A 1AW0A 3CB4A 2HNDB 4HI1A 2KG0A 1LEOA 4DR1J 4Q44A 1TL1A 4R8UA 1SL1A 3OR1B 4DX8H 2E1RA 1IXKA 4DFJA 4QWBA 3E2EA 3DLGA 1Q86T 2VOOA 1OWXA 3G8QA 2DNOA 1S7HA 5KFTA 1TV6B 3J80Y 2M8DB 1R31A 2VKRA 3PX4A 3DDIA 3OTEA 4PG7A 2ERRA 2DR5A 4A8YA 4NA3A 4ZKAA 2G1HA 2ZVIA 3A8KA 2FYXA 2KT5A 2VBXA 1OMSA 4ALZA 2CADA 3EGNA 3VGVA 4I68A 3HHLD 4B3RJ 1JLFA 2QX0A 2V9KA 2VG7B 2DNMA 1WDDA 1XR5A 1LK7A 2RHQB 5CZXA 4CLUA 4TYAA 3VR1A 1SB6A 3BB5A 4H4OA 2BANB 4OFZA 2HWTA 4E2FB 5BR8J 4KR0B 1U09A 1V6HA 2UXBF 5D0GA 3VHQA 1RAFB 5F8MA 5I42A 2OSQA 3DXBA 3QIDA 4OZNA 4WTOB 1KQFB 4RNMA 3DDKA 1CBKA 1VBYA 5CCLA 1PBAA 2G9OA 1WD6A 3O8WA 4MIWA 2LXIA 3TJ8A 1N32F 5KFVA 2YKNA 3D3BJ 3PXGa 3VGUA 1WWHA 1PC4A 2N3OA 3MR2A 2EVZA 5F41A 1FJCA 5A8KA 2GW8A 2Y1JA 1KEKA 4PUOB 3ZZRA 3D6FB 5EGYA 4OI4A 2CWKA 2FLLA 1U1RA 4FS2A 3RTVA 5IM0A 3A3OB 1PYTA 4YB7A 4NXMJ 1PJ5A 3DMJB 3I0RA 3BR9A 3QLHA 2ZUAA 3HDSA 4TU7A 3OW2R 1CJTA 1T9WA 2GQCA 1IKYA 2PSZA 4YQWA 4ZVFA 5HK4A 2VV5A 2NS1B 2PN6A 3AJ1A 3ITHA 4KGVB 1SPBP 2VJUA 1RACB 1VHIA 4LFAF 2F8HA 3IAS9 1APSA 4R5PB 5U47A 1S6QA 5KG4A 4DSIA 3EX7B 2BANA 1R8AA 2E7WA 3HHLC 3D1OA 2WVDA 4USWA 1U2FA 3G87A 1SKRA 2HZVA 2K3KA 3OBIA 4ILRA 5HAOA 1XMBA 3KK1A 2MZ1A 4MT1A 4WYLA 3TAQA 3OJUA 4NLVA 4NCBA 2CQCA 2BACA 3BEGB 3WIVA 4ZN1A 1VBXA 4OJGA 2M8HA 2J76E 2YWFA 1BQXA 4X4OA 1Q78A 4MJKA 2CQGA 2KJVA 2Y1LB 1VMBA 3FEXB 3X1LB 3RRHA 4K2JA 4C48A 2CUYA 1YK9A 3H4DA 3KHGA 1RHJB 2HNZA 3O5TB 1HBMA 2HZCA 1NUEA 4DV7F 2HHPA 3FMBA 2OPRB 2OPSA 2RHSB 1T8EA 2C1EB 1HNWF 3BBFA 4NLRA 4OX9F 4IDKB 5C5JA 3D28A 3VAMA 1S59A 1C0TB 2UZAA 1RAOA 3JSYA 4A8WA 1UFLA 4MKYA 4URSA 5A0YB 2DIVA 3GFZA 1OQ6A 1WEZA 5J1NA 4NYOA 4CYUA 4DV0F 3GR1A 3ICLA 2BJ1A 5BYSA 1GMWA 4MFBB 5CXTA 4IG0B 3P6YC 2GHPA 2OMLA 4U8VA 4NXNF 1RADB 1RWUA 3GSDA 2RDIA 4ICLB 4CI0B 4YHHJ 3GQCA 3MR7A 1GQEA 2YKMB 3KJNB 3MF5A 4C8NA 1FKPA 1FDDA 4OYOA 3U27A 1LOUA 3UFCX 5L38A 3KK2A 4DL3A 3KLHA 2G4BA 3E3XA 5A8WA 2W2PP 1QAIA 1WC0A 4CLFA 3LAKA 5L39A 3IN5A 3QYYA 4DSKA 3KNGA 2CJBA 4ANCA 2QG9B 5GVQA 1TUWA 5ETSA 2D41A 4FBTA 1KDNA 5J2PA 1ZM3A 3DLEB 5IV4A 4A8XA 2FY1A 3M6UA 4DR7J 1NPKA 3TYTA 3MM8A 1CJUA 3I0SA 1NSKL 4A8KA 4A8MP 3CCSS 2ZWOA 1D0EA 4OYWA 3UR3C 3BPDA 5HROA 5T7LA 3QBCA 2JC1A 1H74A 3CWJA 1S57A 3F56A 1AFIA 2D3ZA 3TQ1A 2UXCF 4RW6A 1WOOA 2XZTB 3VCDA 3M30B 5LXYA 1YLXA 4CYUB 3KKFA 2DEJA 2FGOA 2O66A 4ETXA 4PAAA 3SQOP 2MZRA 2ZEJA 5HJXA 5HSPA 3R5CA 3KJVA 1TQLA 3GR0A 1TMMA 4I2QA 1C1BA 3DLKB 4TY9A 4A48A 2XO7A 4NLXA 3SV3A 2DKOB 3CDAA 3K8VA 4CLPA 3FMWA 4IKAA 1UVNA 4IOAQ 4L73A 1T03A 4F2RA 3UW1A 2A6OA 1M1GA 2GHWA 1FWPA 4PPDA 3HSJA 4DV1J 1WI6A 4GMKA 1B4SA 1SI9A 2XMKA 2GVZA 2BW7A 2XNQA 4YDXA 5ETQA 4F04B 3AY0A 2R2TA 1YJWS 2HFUA 3AB2B 1ZPVA 4OHVA 4LSLA 3VVUA 3KHLA 5HP1A 3KMQA 1G6BA 4I6YA 1IJEB 1RTDB 1AT1B 3FK4A 4KSEB 3VQTA 3CD7A 5KFEA 3NS7B 2B3TB 3CJ8A 2QMWA 3JTNA 4B9NA 2IM1A 3FNNA 2XM3A 2KG1A 1B70B 1YBTA 2F5GA 2JSXA 2J7UA 4IRCA 2E9RX 3N9UC 1K44A 3RB4A 3LALA 4Q0BB 4CM2A 3QZ7A 2UUBJ 4OX8A 3NAHA 1XR6A 2PIIA 3OSNA 3OTDA 3QGHA 1ULRA 3OR2A 3GV5B 2WTFA 2GVDA 4CH1A 2H5IB 3OVSA 4ZPDA 2UP1A 1LWXA 4TY8A 1R0CB 2JOQA 4GC7A 3MXHP 3BGRA 3QGIA 3JB9k 1I6JA 4JV0A 3CO9A 4DSLA 3WQPA 1HBOA 4TVAB 4ZVUB 5C2CA 3C15A 3IWLA 1QSSA 2RH3A 3WBZA 4OHXA 4RW7B 1ZOTA 3SYZA 2FJXA 4QIWD 3BGUA 2IDEA 4KFBB 1A6LA 3HVTB 1S79A 5J2QB 4N56A 3RZAA 4LF4J 1HI1A 4IRKA 1YIJS 1SQFA 2MZSA 2RVJA 3HZEA 4S0MA 3H2UB 1XEZA 2P6TA 5FD1A 4ZLPA 2UVUA 1RWNB 2B5JB 3CMAS 1X9SA 2IRYA 3B54A 4USUA 5AXLA 4RU2A 2C3PA 3PW0A 3MEKA 3DCAA 2HVZA 2D1CA 4YEAA 4X66F 3HSDA 3VAFA 4F0KA 1FNXH 4F4KA 1P1LA 1TUGB 2Q43A 1NLKL 2R2SA 3ZTRA 4DPTA 2HFNA 2V2VA 2GCFA 3Q8RB 1XMQF 3KNAA 3ET6B 4MKAA 4J91A 4DV7J 3TANA 3V6KA 4TY8B 1JJHA 2LU2A 1F9EB 3VZIA 2YNHA 1XR7A 2XLJA 1FJGJ 3FFIA 2AZ1A 1TTHB 2DXDA 4ZPWR 2CQIA 2AYGA 1JXVA 4USJC 4MFBA 3A4TA 2W4DA 3HVWA 1O51A 5HVGA 3HPOA 3LWLA 1S9GA 3Q23A 4N41A 1CULB 1S6PA 2GX8A 1RKIA 1PKUA 5A2QU 4Y6IA 1JLQB 1R8CA 2RUGA 4RW8B 1MU2A 4Q7AA 3FZBA 1BC6A 3KLHB 4I1TA 4B3SF 5HI7A 4PYDA 3DNCA 2IJRA 3TNVA 4WFAQ 2AU0A 2D69A 3Q89A 4C3MA 3I9ZA 4DR4F 1N36J 3GJSB 5KT5A 1RT1A 2MMYA 1LWFB 1RWMB 3N4WA 4JV5J 1RTJA 1QTNB 2P8IA 4O23A 4M5IA 4F50A 2Z30B 2FVPA 2HZAA 4ZP7A 4UZCA 4TU8A 4JYAF 2HIQA 3GZ7A 4PQUA 3JSBA 5AXNA 1HWKA 2GGPA 2GO9A 2C2OB 2HGNA 3LP1B 4EBEA 3AAWB 1Q1KA 1UEVA 3NG8A 4K2XA 4Y2CA 2EBEA 4D3HA 1DAXA 2DPIA 1N52B 4OI3A 5KFYA 1U6ZA 3ZZ0A 1WOPA 1HYSA 2DNLA 1A9NB 2AIRB 3TX8A 2RB7A 5F0WA 1WKKA 2LKZA 2A2CA 4WYWA 2UUCF 3QATA 2OELA 1HWLA 3DC2A 1U02A 3KG1A 1NK4A 1XNQF 4ZJQA 4UUXA 3SDEA 3QQCD 4M5GA 3AOCA 4AFFA 2DRBA 5KFAA 1X4HA 1BWEA 4F3MA 3VALA 2ZZTA 1U1KA 1NJIT 3FEZA 5ETVA 1JLQA 2L41A 4I4BA 4V19X 4RNFA 3FRYA 1NAQA 4G1QA 2VIHA 4M95A 1L3KA 1SVDA 2AP6A 1UWBB 4OZ1A 5BR8F 2OKQA 2D9PA 4ZDNA 4Z37A 2XY5A 3MEGB 1KONA 2KXFA 1U1MA 2N7YA 5H9FJ 3HMJG 1LKZA 1RJJA 1DTQB 3EICA 4HH1A 3I9V9 3DDNA 5CZVA 4EO8A 4DR6J 1V9OA 3MTJA 3I55S 4LF5J 2P2CB 2V6AA 4USVA 3U02A 2PC6A 1MROA 3Q8PB 2ZH9A 3RR7A 1NSQA 3GV8B 2ZJQQ 2OP5A 2PMWA 4LIWA 1LXNA 4PQUB 1XWLA 2HKEA 1VIXA 1VK3A 4C8YA 4OJ1A 2IJFA 2MKYA 6AT1B 2EFQA 5A6PA 4HDHA 4KAIA 2NXCA 3CCRS 1PCAA 2QYCA 2DXFA 3NRBA 4DEZA 4HHUA 2PI5A 1HPZB 3N6NA 2RNEA 2HQFA 3CE8A 3GCXP 3MMCA 3L95X 3DI6A 2BQRA 1PJ7A 1YGYA 4O3NA 3OVAA 1S0OA 1WG1A 4ED3A 4DXLA 4QPXA 3M8RA 3IRXA 4OZLA 1T9YA 5F8JA 2M3DA 1U25A 3AH6A 4DR6F 1HD0A 1XN9A 2JNJA 2RKIB 2DGWA 2W7AA 1H3DA 5B0AA 3VGTA 3DGVA 4K4ZA 2NYHA 2HVEA 1HHQA 2LEPA 4RNNA 4JI3F 4P2MA 3RBEA 1ZH5A 1OS5A 4P71A 4K0KJ 2LVWA 2W4CA 2K1RA 3MHYA 5A6WA 3UD3P 2W24A 1B0PA 2KH9A 3DLJA 3BQ0A 3GYXB 2RUSA 4ECSA 3H5UA 2MQOA 1B0VA 4I6WA 2B4OA 1IBKJ 2KXHA 4NLYA 2N4CA 4IFYB 4WPAA 2CZ4A 4CRJA 1VC5A 2OPQA 2DT9A 3HKWA 2OGUA 5ETLA 1F5AA 1RT4B 2M4MA 2QRRA 4QPTA 1A7GE 4XDDA 2EXUA 3TEHB 4BCAA 3OLBA 4KO0A 1TU0B 3MGJA 3MPUB 1HNIB 1JJCB 4NRTA 1SQEA 1MMLA 2FZCB 2QA2A 4FPRA 5EWEA 2P6SA 3E01A 5ETKA 1EAYC 5K20B 3D66A 2HBZB 4DX7A 5KFPA 4X65F 1OY9A 4PXBA 2K2PA 4F26A 1Y5LB 2U1AA 4FYYB 4X4QA 2HQDA 1X4FA 2Q66A 2FVRA 3UDEA 3BSOA 4ZVOB 4DUTA 4OJHA 3HSZA 4QWDA 4RBTA 2V8VA 3Q8VA 4FF3A 4ECUA 4CH7A 4TLQA 2RE1A 3VVTA 2DH8A 1WACA 3BN7A 1MWYA 4TQSA 5LMUF 2P5VA 4IFVA 1IJFB 4DCJB 5D3GB 2Z2ZA 2GA7A 1VLOA 1BQMB 1XJWB 4F0HA 5LT5A 1HNZF 4DCPB 5G0RB 1DZ5A 3VZHA 1BUXA 1CULA 4CO2A 1HMVB 3N79A 1KOOA 3LP2B 3N0VA 2X1FA 3UCZP 4X4TA 5LSLA 1YTYA 1ELOA 1JLBB 3D0IE 4DV3F 4IFYA 4DDFA 3M2UB 1MG7A 5D4PA 3GJRB 1S1XB 2RD5C 3KLFA 4YHHF 1NZ8A 2W7PA 1QVGR 1JK9B 4QW9A 1IKXB 2HK2A 1KN6A 2UXDF 3TVKA 3J81j 2L08A 2DO4A 5C42B 2NXEA 2G0CA 1RCOB 1Y3KA 4ED8A 1M1HA 1VI7A 4OX6A 2N7CA 4DFKA 1XMOF 5J2NA 2X3GA 2BE2B 2A3JA 2FC9A 2N4DA 3D1QA 4LSZB 5HJYA 3J7Z5 2VODA 1FJ7A 2JEFA 1EKRA 2AYMA 1WI8A 3HD1A 2GMHA 5CYJA 2BOPA 4NASA 2YVSA 1T0TV 2QYGA 2W1BA 4KPCA 3OUYA 1HYSB 3N01A 1MWZA 1JJ2R 4AD6A 1UW9A 3AOAA 4O0NA 1N4LA 2BDPA 5J2MA 4QWEA 3CJ4A 4C8KA 2BKPA 4GKKJ 4JI7J 1X7VA 2MTLA 1PC5A 2XULA 2BJEA 4IFVB 2ZD1A 3W5XA 1T3NA 4IQXA 3IR6B 4CLSA 5C24B 4R8UB 4P9SA 1CJKB 1T9XA 3HT0A 4JI2F 4BS2A 2V4JB 4WKRA 1D9FA 3DLGB 3GYGA 3V5RA 3EDRB 4LRCA 3LP2A 1S4FA 2YWHA 4GRSA 2WSEC 4NLUA 3TWZA 4J9OA 1UAWA 2IC3A 2NLWA 3BSNA 1RBLA 3BGFA 3NGUA 1HQUA 3GG1A 3B6BA 3MR5A 3UCGA 1D3WA 4PXDA 5C25A 4OYMA 2M7SA 5KG1A 3JYTA 5F9NA 4LVOP 4ZVQB 1QVFR 1X5PA 2E9TA 2V8DA 3DRRB 4RW4A 4OLOA 1FTRA 2NPFA 4QWAA 3ENAA 3LH2S 4JI6J 1VBKA 3K59A 3GB0A 1U1LA 1HQEA 4DZDA 1KQSR 3H5SA 3DOLA 1S10A 1KVKA 4H54A 5AJ3F 1EP4A 3S7RA 4ZVPB 3FRZA 4XIUA 2IAJA 2LQ8A 4J9PA 2VG5A 4WJBA 1UFWA 3ZZTA 5DS7A 4Q43A 2Q79A 4QU7A 1FRMA 3T1YF 5DDOC 2CPIA 4UY85 1Y3JA 3DU6A 1FVSA 1FT8A 2VG6A 1CQMA 1OJ4A 4DV4J 3I96A 3GU0A 5KT7A 1RAEB 1SJ4P 2QMXA 2QLWA 4DR5J 2YX7A 4UF4A 2ROPA 2W9BA 3L7UA 1CJKA 4ZN3A 2HFZA 3T1HF 2XCPA 2HHUA 2ATCB 2RKIA 1R0AA 3MECA 4B9LA 1SUQB 2IRXA 1RHMB 4AQYJ 2VUGA 3ZO7A 4RJVA 1EB0A 1S0MA 3MI7X 2CNLB 5IZHA 2CAJA 2E5IA 5KAKA 5K8PA 5CYQB 1VCTA 2W7OA 1V3SA 1Q81T 4NRUA 2H51B 3ITHB 3W2VA 3MPYA 4QU6A 1S9EB 2CYYA 1CJVB 4TQRA 2KU7A 3KLGB 4L6V3 3SQGA 1GMUA 4OJ3A 1TAQA 2VPZB 1X4BA 4I56A 3C6UA 2MY7A 2IYIA 3CW2C 2WOMB 1UP1A 1C4CA 4ZCKA 2AEMA 3FZ2A 3R5BA 3RW6A 2RDJA 2OUGA 5ETNA 2QL9B 5ETMA 2HRYA 2YWGA 1V3RA 3DYAB 4IO1A 1QE1A 1MNEA 1RT4A 4NOHA 1WUUA 3I6PA 4JI7F 2WSCC 1VRUB 3EDQB 1HNIA 2YPYA 3EE3A 3LF0A 5D0RA 3Q2SC 3CF5Q 3CCWA 2VG6B 1UZDA 1T7PA 2VONA 2XMVA 3MOJB 2ZNYA 1FDNA 3DOMA 2B9YA 4KIAA 1VQ5S 4WE1A 2OJ3A 4BDPA 3VAHA 1KWMA 3MD1A 4IG3A 4WKYA 3MMAB 3KK3B 2UUCJ 2JLGA 2G0JA 2YTCA 2H5JB 3HULA 2PE8A 2ZITA 4NZ7A 1HWJA 4DOZA 5F8NA 2CPHA 3TZZA 1LNQA 2FJAB 5HMWA 4KRWA 3NCRA 1XNRF 2RT3A 2HRTA 4LF1A 3VAKA 1RHKB 3FBEA 3UN5A 3BO2A 2DBBA 2DHGA 1TKXA 2QC3A 3DXSX 5CYQA 1PO6A 1S76D 4HT7A 2CQHA 4WBFA 5F8HA 3OT9A 3M9OB 2RQMA 2YQ3A 3NBPB 1NB7A 4XDCA 4I67A 1FRKA 1CS4A 5KFZA 2WVCA 4DR4J 1TKZB 4MK9A 1XQIA 5KFXA 1UMJA 2GQ2A 2HHTA 2YH1A 3GG0A 1DJ0A 2AEFA 2BQUA 3ENQA 4LBPA 1QE1B 3LUYA 1F1BB 5B0FA 5T41A 3GONA 5L8RC 4B9VA 2NSBA 3QRRA 1HIYA 1LWEA 3IC1A 4DUYF 2HHHF 4W92B 2ALZA 2V4RA 1KLMA 3AD8C 2BE2A 4UQGA 2V4QA 1AYEA 1BQNB 1PYOB 2CJXB 2CPXA 2W01A 3CCTA 3TOQA 4EO6A 3W2WA 4QR2A 4AL7A 1WF1A 3D68A 4DPOA 2VBZA 3KLIA 2VICA 1U0HB 3PKYA 3PW5A 4JI1J 2E1AA 4I7FA 4X64F 2WBRA 2IY5B 3J7AN 2H1YA 1GTHA 5KG5A 1Q16B 4F7VA 5J2MB 1MLAA 3F0NA 2VA2A 5A8RA 4OQJA 4TNOA 4EWTA 2VQFF 4K50A 1H2UX 2PA3A 3BH7B 4ELUA 4ZIWA 3BM7A 1FI4A 4ELVA 2HNYA 1YJTA 1S1TA 5LL6d 4IO9Q 4A8QA 1AROP 4CLYA 2HWHA 2IC3B 1F9FA 5HLFA 1C1BB 1O0PA 3DLKA 2Z2YB 4NL5A 5KFKA 1QLNA 2CQ4A 1RT5B 3QIPB 2YNGB 1MN7A 4IH5A 5LM7E 4UOCA 2CPJA 1FKOB 1OYEA 2L9WA 3TR5A 3H42A 4ILMA 4EUVA 2QTWA 3OLAA 5KFCA 1R8PA 4CLWA 3JQKA 4JI0F 3EPIA 1UA0A 3BF4A 3M1VB 1N6QB 3AXMA 3H4BA 1Y9OA 1EQMA 5F3ZA 1QAXA 2ZDOA 3PJXA 3MWBA 1K47A 1Y5NB 4OZ5A 1TL1B 5E3AA 5DZ6A 3ZNJ1 5A76A 2FHKA 2HURA 5IV3A 1RTDA 4ED5A 3KLIB 3SI8A 4FZVA 3C16A 4ZITA 5JMNA 2C2MB 4PR6A 4ZLJA 1Q8KA 2K7JA 4OI0A 3BGOP 3M05A 1XERA 2HNDA 3ZFVA 2ZH8A 3N6MA 1GEHA 2WK4A 2PD1A 3OXFA 1RAIB 4K4VA 2V2KA 4UT4A 5I3UB 4TKTA 2ZJRQ 4C3KA 1UVLA 3BREA 3T5LA 2J7KA 5HATA 3UDCA 2IA0A 5KFQA 2CQ3A 3CO0P 2YWWA 2B6AB 4EGLA 1RT5A 2HFOA 4U7UK 2Z0GA 3C15B 3M8YA 1FTCA 3N28A 4IH7A 4OMFG 3ZTSA 1CJVA 1FRIA 2R3VA 1W7WA 2YKAA 5K8MA 4DSJA 1DQAA 4CO3A 4CLTA 4KHPJ 1SCJB 5KT4A 1IR1A 7FDRA 2C2DA 2FLPA 4QJVA 3BDEA 3FVYA 5KFSA 4DX6A 3V81B 2GAHC 2DNYA 3GV7B 2ZOFA 2VPXB 3H90A 4O3OA 2B5JA 5GAHU 1Y00A 4FYVB 3BH6B 4JI5J 1T05B 3D3CJ 2CPZA 1TKTA 2DNGA 3QT6A 3P96A 5I42B 3QLHB 5DDQC 2DHAA 1UTAA 4UW2A 4RUBA 4L76A 5A8KB 2V8HA 3DOMB 3MEDB 4WE1B 1GAOA 2FJWA 4FXWA 3CCVS 2NR0A 3DLBA 5H1SV 3BKFA 2G0IA 1FRXA 2GFFA 4WIQA 5LMUJ 4USIA 3PVXA 2DNKA 2QN6B 4CWBA 2DRAA 3AOBA 2WONA 1RHQB 2RS8A 4K5RA 4NEYA 3HT3A 1H7WA 3M8QA 2M9KA 3CMQA 3NNCA 1R43A 3TW0A 4PPZA 4NLOA 2Z57B 3MFIA 1KRPA 2KFNA 3MMJA 4MH8A 2PGCA 4G1IA 3RYLA 4HHJA 4WP3A 1RU2A 1S99A 2XMWA 4K5SA 3SIPB 2J0XA 2VZ9A 2X3DA 2CQBA 4YR2A 2FLNA 4ZMMA 3KUGA 2RS2A 3C3LA 4LF4F 2HAFA 4RBUA 4LF6J 4ZVEA 4NI2A 2Z2LA 2BX6A 3US5A 3EGZA 4EYIB 3RB0A 5KTQA 3UI3A 5AE2A 2HAIA 1FD8A 2RSQA 1LWCB 4BC7A 3RAMA 5K8NA 2J8AA 3NP5A 4KGXB 1F2HA 1H6KX 4PZVA 1X60A 1A0OB 2OPSB 2OPRA 3T5JA 5B0EA 2WW4A 1FRJA 3PR4A 1T05A 4X2BA 3HF5A 3TUPA 1EQ0A 3K89A 1F5CA 4J9UE 2C2NA 4DSEA 1KLMB 3TZWA 4EYHB 2KL8A 4RR5A 2VFSA 4C4WA 4FF1A 2V68A 2XTJP 3IGVA 2NZ4A 2BJ9A 1HL6A 1JLGB 4U67Q 2GIFA 2CQ2A 2OEKA 1Y10A 3GE9A 4B9MA 4U6PA 3CJ2A 4K59A 1O8BA 3MR3A 4DUZJ 3PX0A 1C0TA 2D3UA 1ZTTA 4QIFA 3M9NB 2QLJB 3NMRA 2ZHAA 2EFVA 4DPXA 4OHWA 2YXLA 4N8NA 2NXJA 4DCOB 4Q5VA 3CDWA 2FVCA 2KN4A 3E8OA 1J5OB 2AKWB 2NREA 4ZP8A 1K0TA 1VGYA 2ZOMA 1GK8A 2J8SA 5F8LA 4X84A 3LP0B 2MXYA 2DITA 2AV5A 2MKJA 3FSIA 3L7PA 2V2ZA 4IG0A 2ZJPQ 3PHTA 1YRTA 1OPIA 3FSXA 4O44B 4PG4A 5A8WB 2IBKA 1Q8BA 4CLKA 5HL7Q 2ZH3A 3I0SB 5FDLA 1YITS 1JWWA 3MM5A 1AXQA 1FKPB 1HNXJ 3R6GB 5CH7B 2H4YB 3DRYA 5HROB 4RU9A 5H9FK 4GKJJ 1FRHA 1WJ9A 3MUVP 3WHIA 5J2PB 3DM2A 3FEYB 5E3QA 5I4MA 1WHYA 5IXUA 1I94J 2DNHA 1ZAWA 2ASYA 1TP7A 4XPEA 4C3LA 4KH0B 1VC0A 4KC5A 1OQ3A 3PEJA 3T1AA 4F4YA 3KJVB
chains in the Genus database with same CATH topology
3VGSA 3BBBA 3DDIA 3VVTA 4ANEA 3EE3A 3FBCA 3ZTSA 3Q89A 1W7WA 1S57A 4HR2A 3VGVA 3FCVA 1BUXA 3R9LA 3EVWA 1EHWA 4C6AA 3NGSA 3EVOA 4EK2A 3BH6B 2BEFA 2DY9A 4ANDA 3Q8YA 3FBEA 1S5ZA 3FBBA 3VGUA 1WKKA 4WBFA 3JS9A 3DKDA 1F3FA 3MPDA 1WKJA 1MN9A 2CWKA 1B4SA 3ZTQA 1VYAA 1XQIA 3WX8A 2HVDA 3VVUA 1XIQA 2B8QA 2DXEA 4W98A 1NSPA 1F6TA 4KPCA 2ZUAA 3ELHA 3ZTPA 1WKLA 1HIYA 3EMTA 4O0NA 4FKXA 3EICA 3NGRA 3Q8UA 4ENOA 3G2XA 5BXIA 1K44A 2AZ3A 2BX6A 1NSQA 3NGUA 3EJMA 1NHKL 3B6BA 1NB2A 1LWXA 4DZ6A 3FC9A 2DXFA 3Q86A 3ZTOA 3BH7B 1NDPA 3ENAA 4UOHA 3EVMA 3GP9A 5CABA 3BBCA 3PRVA 4S0MA 1NUEA 3FKBA 1UCNA 4UOFA 3VGTA 3EM1A 3BBFA 1MN7A 2HVEA 1HHQA 1S59A 3B54A 4F4AA 4UOGA 3ETMA 5C7PA 1B99A 1NDCA 1HLWA 1NDLA 5CAAA 3FCWA 3L7UA 3FBFA 1NLKL 3ZTRA 2HURA 4FKYA 3NGTA 2VU5A 1ZS6A 4ANCA 2AZ1A 2DXDA 3GPAA 1JXVA 3PJ9A 1KDNA 1NDKA 1BHNA 1LEOA 1NCLA 2B8PA 1PKUA 1PAEX 4CP5A 4F36A 2NCKL 2DYAA 4DUTA 1BE4A 1NPKA 1U8WA 3Q83A 4DI6A 3Q8VA 1NSKL 5IOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGS A;  3BBB A;  3DDI A;  3VVT A;  4ANE A;  3EE3 A;  3FBC A;  3ZTS A;  3Q89 A;  1W7W A;  1S57 A;  4HR2 A;  3VGV A;  3FCV A;  1BUX A;  3R9L A;  3EVW A;  1EHW A;  4C6A A;  3NGS A;  3EVO A;  4EK2 A;  3BH6 B;  2BEF A;  2DY9 A;  4AND A;  3Q8Y A;  3FBE A;  1S5Z A;  3FBB A;  3VGU A;  1WKK A;  4WBF A;  3JS9 A;  3DKD A;  1F3F A;  3MPD A;  1WKJ A;  1MN9 A;  2CWK A;  1B4S A;  3ZTQ A;  1VYA A;  1XQI A;  3WX8 A;  2HVD A;  3VVU A;  1XIQ A;  2B8Q A;  2DXE A;  4W98 A;  1NSP A;  1F6T A;  4KPC A;  2ZUA A;  3ELH A;  3ZTP A;  1WKL A;  1HIY A;  3EMT A;  4O0N A;  4FKX A;  3EIC A;  3NGR A;  3Q8U A;  4ENO A;  3G2X A;  5BXI A;  1K44 A;  2AZ3 A;  2BX6 A;  1NSQ A;  3NGU A;  3EJM A;  1NHK L;  3B6B A;  1NB2 A;  1LWX A;  4DZ6 A;  3FC9 A;  2DXF A;  3Q86 A;  3ZTO A;  3BH7 B;  1NDP A;  3ENA A;  4UOH A;  3EVM A;  3GP9 A;  5CAB A;  3BBC A;  3PRV A;  4S0M A;  1NUE A;  3FKB A;  1UCN A;  4UOF A;  3VGT A;  3EM1 A;  3BBF A;  1MN7 A;  2HVE A;  1HHQ A;  1S59 A;  3B54 A;  4F4A A;  4UOG A;  3ETM A;  5C7P A;  1B99 A;  1NDC A;  1HLW A;  1NDL A;  5CAA A;  3FCW A;  3L7U A;  3FBF A;  1NLK L;  3ZTR A;  2HUR A;  4FKY A;  3NGT A;  2VU5 A;  1ZS6 A;  4ANC A;  2AZ1 A;  2DXD A;  3GPA A;  1JXV A;  3PJ9 A;  1KDN A;  1NDK A;  1BHN A;  1LEO A;  1NCL A;  2B8P A;  1PKU A;  1PAE X;  4CP5 A;  4F36 A;  2NCK L;  2DYA A;  4DUT A;  1BE4 A;  1NPK A;  1U8W A;  3Q83 A;  4DI6 A;  3Q8V A;  1NSK L;  5IOL A; 
#chains in the Genus database with same CATH topology
 2DPJ A;  2ZH1 A;  5K14 B;  4IH6 A;  2IMW P;  5KFI A;  2NYI A;  1RLC L;  2EG1 A;  1RTI A;  1SV5 B;  4OYX A;  5HAN A;  3WX4 A;  1XNQ J;  4W4M A;  2E5G A;  3QSI A;  1P8G A;  2EK6 A;  4LFB J;  2BRK A;  3JSR A;  3W60 A;  4X4S A;  2QV6 A;  1LW0 A;  1VDH A;  3NMA A;  4O4R A;  2B7C B;  3MPV A;  4BWM A;  4LF8 J;  3EVO A;  2BJ8 A;  1REV B;  3F41 A;  4DJB A;  4V19 J;  5LJ5 Y;  4E0D A;  3GJT B;  1EZZ B;  4H4K A;  3U1L A;  4YUD A;  2F4V J;  2VQE J;  3P5T L;  1FCA A;  5ETO A;  1TMJ A;  2J6T A;  3LA0 A;  1WC3 A;  1T03 B;  4ZPV R;  2EKN A;  2R7X A;  2FQQ B;  3QZ8 A;  1IBM F;  3M2V A;  2XMM A;  2OH2 A;  5L1K A;  4FYW B;  1NK7 A;  3IA0 A;  4YB5 A;  1NHU A;  4L3N A;  4RUA A;  2NXN A;  3ZTQ A;  5C2G A;  2O67 A;  3ILL A;  4LVN P;  2AYE A;  4BLG A;  1HNZ J;  3WX8 A;  4USK A;  2DY1 A;  2B8Q A;  2RRB A;  4FP9 A;  1UVI A;  5CQG A;  4YY3 F;  5E7O B;  1N34 J;  3RBZ A;  1SJF A;  2Z58 B;  2H4W B;  2VH7 A;  4LSN B;  5D4N A;  3Q24 A;  4J90 A;  2MQ8 A;  2FZG B;  3TJ9 A;  2DNR A;  2PEB A;  3BGR B;  1B0T A;  2J0Q D;  1H2V Z;  1RIS A;  4HDG A;  2HPU A;  2QO3 A;  2ZOG A;  3AOD A;  3DGP A;  3CCZ A;  3G2X A;  3HD2 A;  1N5Q A;  1U6F A;  1FFG B;  2DB1 A;  2HBQ B;  3QWP A;  4NE9 C;  4DQS A;  4LF9 J;  3QRP A;  1JLF B;  4WXW A;  4Y2M A;  1LW0 B;  1WG4 A;  3NS5 A;  1HWU A;  1QM9 A;  2MPU A;  2DH9 A;  4NA1 A;  4OV6 A;  4ECQ A;  2CFX A;  5DLF A;  2V8G A;  5KT6 A;  4DF8 A;  4G3I A;  1TFW A;  1HFE L;  4B3R F;  3JSM A;  2YWE A;  1ZZN A;  2EFN A;  4KE5 A;  4K4U A;  4JI0 J;  3TRG A;  1RWX B;  3CTR A;  4Y28 C;  2DNQ A;  2V50 A;  5KG6 A;  3KMS A;  2JVO A;  1VQ9 S;  4NX9 A;  4NA2 A;  1M0S A;  1KQG B;  4HEA 9;  3ZTO A;  2LEC A;  3QGP A;  1RUS A;  3M2V B;  3V2U C;  1REG X;  2EK1 A;  4LFA J;  1RHU B;  2ADC A;  2A2D A;  3MZI A;  2YNF B;  4URG A;  3SMZ A;  2RF2 B;  3GFX A;  5B09 A;  2Q3P A;  4DR2 J;  1IKW A;  3RW7 A;  2V5H G;  4DFM A;  1JLC B;  3QT7 A;  5K9F A;  3UDL A;  3W66 A;  3IM8 A;  3KYL A;  2W8K A;  1CPZ A;  1WEL A;  4FXV A;  4Y65 A;  5J2Q A;  2DEI A;  2EC2 A;  4B9U A;  2OTJ S;  2YKO A;  3DMJ A;  3I0R B;  4EMD A;  3MMB B;  5DET A;  1BXN A;  4P73 A;  4A8F A;  3ZZY A;  4K4Y A;  4LSN A;  3HHK A;  2BAB A;  2FJB B;  2V2Q A;  5C7P A;  3PX6 A;  1UJ4 A;  3G96 A;  3BQ2 A;  1J5E J;  1VFJ A;  2D74 B;  3V4I B;  1NDL A;  1O5J A;  4ZIV A;  4IRD A;  4FBU A;  1YJR A;  5DM7 Q;  2PA8 D;  2LXF A;  4PUO A;  4F3O A;  4RBV A;  4DL4 A;  1TEL A;  3OUY B;  3ET6 A;  5GAE I;  3J81 U;  2ZDP A;  2YWK A;  2XHW A;  5MLC V;  1MU2 B;  1U1O A;  4XO0 A;  2MGZ B;  2M88 A;  4P2F A;  1TKD A;  4C9D A;  1XTZ A;  2B4V A;  1UFK A;  2WBM A;  1SIW B;  3PY8 A;  4K8R A;  4IOB A;  4GKK F;  1U48 A;  5KFG A;  3GLJ A;  1NZA A;  1ZM2 A;  2BZ2 A;  2CQP A;  2B8P A;  1ITP A;  1U26 A;  4DL7 A;  3SV4 A;  2QFJ A;  3W63 A;  1N33 J;  4FNH A;  1S6P B;  4HTI A;  4DN9 A;  3LP1 A;  4HI2 A;  1QUP A;  2A10 A;  3EGV A;  4WFX A;  4DL0 C;  2J0S D;  1BLU A;  2DHX A;  3EWG A;  3QAU A;  2YKQ A;  3GIR A;  2DGT A;  4KHR A;  2IVF B;  3T19 A;  5LMN J;  3BR8 A;  1W25 A;  4DV1 F;  4CLL A;  1RTJ B;  3DHX A;  1T9V A;  5KFH A;  3J7Y I;  2AEJ A;  3H5Y A;  4M5J A;  2XO6 A;  2APO A;  1DHM A;  1JLA A;  1FNO A;  1GMW D;  2HS4 A;  1LFW A;  2ZE2 A;  2ZH6 A;  4ZPT R;  1TVR A;  3MAA A;  2RU3 A;  3OVB A;  4F4W A;  2D9O A;  3LO3 A;  4IOC Q;  2ZM6 J;  3MUR P;  1L3S A;  1OO0 B;  4NML A;  1OSD A;  2HNZ B;  4DN0 A;  4CO0 A;  1JQG A;  5HMX A;  2GHV C;  3K57 A;  3W8G A;  2V34 A;  2ALY B;  3LAM A;  2CIM A;  2HHQ A;  2OD4 A;  4LR8 A;  4RPF A;  4ZJO A;  4Y00 A;  1C0U A;  2DGQ A;  3K8W A;  1RBA A;  3KDO A;  1FER A;  1T02 A;  2OI2 A;  5LSO A;  5E5N A;  3V4M A;  1SJ3 P;  4USH A;  1X4C A;  3MUT P;  2WVF A;  2D3O 1;  4NLD A;  1IQT A;  3CJK B;  4JV2 A;  1HBU A;  3DLE A;  5D15 A;  4JV5 F;  3DHW C;  5MAO A;  4OLP A;  4MKV A;  2XLI A;  4KJI A;  2GS8 A;  2HWI A;  3M32 A;  4AUK A;  1N5S A;  3VTI A;  4U95 A;  1ACM B;  2GNK A;  2DVI A;  2B9E A;  2F3J A;  2JHE A;  1WG5 A;  3MEG A;  2VQE F;  2HQI A;  4ED0 A;  1S97 A;  2A1B A;  1DTT A;  2IA6 A;  3D4J A;  1G7C B;  1GX5 A;  4X62 F;  1VJQ A;  4Y3C A;  3G6X A;  1TVR B;  3MAA B;  3HI9 A;  4UUW A;  1ZA2 B;  3M8P A;  4ZVT B;  3POT A;  5L9X A;  4CQ1 A;  4OV1 A;  1NHK L;  2DGU A;  3TUJ C;  3MDF A;  4AE5 A;  1J5E F;  3KOA A;  1DLO B;  3HHL B;  4YB1 P;  3Q0A A;  1S1U B;  3DRS A;  3MM7 B;  3OHB A;  5DG7 A;  2E5H A;  1NDP A;  1RK8 A;  2I5J B;  3GMG A;  4NLT A;  4EI2 A;  2LQJ A;  1T95 A;  4RL1 A;  5L1J A;  1HPZ A;  1UKU A;  3H2L A;  3GSI A;  3MD3 A;  4X4R A;  3SSQ A;  1RYS A;  1ZM4 A;  1Q5Y A;  3CJ3 A;  4ECY A;  1L5U A;  2XB2 D;  4NLG A;  4O3S A;  3CCL S;  1N0V C;  3C14 B;  4O4G B;  3MCN A;  4ES3 A;  1CLF A;  5B0G A;  2IIH A;  3CJ0 A;  4KHP F;  1CC7 A;  2EEY A;  3MTK A;  3ULH A;  3CME S;  3KJQ B;  1FE0 A;  1Q5V A;  3HKZ D;  1I5O B;  4RUH A;  2HHW A;  3K5N A;  1N88 A;  4PG5 A;  1NME B;  4LFC J;  1RP5 A;  3DFE A;  1YJV A;  2DIU A;  3QRQ A;  3KWM A;  2BXJ A;  4IR1 A;  5IS2 A;  3RB6 A;  2EG2 A;  2YNF A;  3IG1 A;  4ZCM A;  1B99 A;  3NNH A;  5K5M A;  5HQ8 A;  1ZZF A;  2FLO A;  3I4H X;  1N48 A;  1UPM B;  3PFO A;  5DRK A;  2KRR A;  4DR3 J;  3TA0 A;  1NU4 A;  1RWW B;  3GJQ B;  1RT7 B;  2DNP A;  1QJH A;  2VC0 A;  4GVL A;  3I56 S;  4XAK A;  3J80 U;  2DIS A;  3OSP A;  2MQM A;  4DQR A;  4TLR A;  2ZBP A;  3AB4 B;  3POT B;  4C97 A;  2W8L A;  2UXC J;  3PW4 A;  2GVD B;  1RAG B;  1Z2Z A;  2RRA A;  3F73 A;  1B3T A;  2I38 A;  1X4D A;  2C2Z B;  1UJ5 A;  3ILO A;  4YDD B;  2CKW A;  1S1U A;  1BQN A;  1QUV A;  2L9N A;  3BDP A;  3CVK A;  2OD6 A;  1NK8 A;  1SJQ A;  4WXO A;  2JLE A;  1NEE A;  3GCW P;  3ZZO A;  5DGB A;  3L4B C;  2CPD A;  2XYH B;  1YWX A;  2CZ9 A;  1BE4 A;  2KJW A;  2MST A;  1SC4 B;  4DV5 J;  4UQT A;  2H48 B;  1JLB A;  2ZBC A;  3AA8 A;  3TAM B;  1HI8 A;  4NZ6 A;  2FVS A;  5B0B A;  2IRU A;  2CJ9 A;  4ANE A;  1S1X A;  4G65 A;  1YDL A;  1RTZ A;  3EXY A;  3G82 B;  3KXD A;  3VAI A;  2JEG A;  4U8Y A;  4LRB A;  1IBM J;  2OMO A;  2ZZM A;  3RBD A;  3GYN A;  1VIS A;  5C42 A;  3AQO A;  4C11 B;  3UN3 A;  4QYZ J;  2MLZ A;  1HR0 F;  1K8A T;  3R7N B;  2BYC A;  3PAC A;  1IKV A;  1VRQ C;  1MWQ A;  2DNZ A;  1H0H B;  2VBW A;  2YNG A;  3H59 A;  4ZVR B;  3DRP A;  7AT1 B;  5L9N A;  5DQI A;  3R8Y A;  3KLF B;  2R7R A;  4RW9 A;  4C7Q A;  5DG8 A;  4HYK A;  1M1K T;  1RAH B;  4P6Q A;  4LF6 F;  4NMX A;  3GIJ A;  1Q8I A;  4DS5 A;  2C3M A;  4HAC A;  1KLN A;  4O3P A;  2DGX A;  1JKH A;  1Q79 A;  1VK8 A;  4A46 A;  2XSJ A;  4J9V A;  1JLA B;  1X0P A;  3AA9 A;  5I3Q A;  3QJP A;  1F5B A;  2MZT A;  1RTH B;  1HNW J;  1RB0 A;  4X4P A;  4YN3 B;  3MAQ A;  2W9C B;  4OX7 A;  4L3K A;  2Y1I A;  5L1I A;  3FCH A;  2GJI A;  1VQ4 S;  1Q0N A;  4RW8 A;  4B9T A;  1VQS A;  4WU3 A;  3BKT A;  2JEI A;  1ROF A;  1U1P A;  4FF4 A;  1SC3 B;  3R6L B;  1MSW D;  5I3U A;  1HBN B;  2X51 A;  1E6Y A;  2YQ1 A;  2O01 C;  3G82 A;  5C24 A;  1WNE A;  4OHZ A;  1RLD A;  3BYR A;  4HH0 A;  1NK0 A;  3QO9 A;  2YNH B;  2O1P A;  2HQC A;  3BSA A;  3QGG A;  4Y2I A;  3EZ5 A;  2UVW A;  4C8M A;  4DR2 F;  1S1W A;  4N77 A;  1RT3 A;  2ZH4 A;  3D6H B;  4HT5 A;  2QMU B;  3LPY A;  4CTA A;  4XPC A;  3JYT B;  1DRZ A;  2XS7 A;  1NK6 A;  1NB2 A;  1L3T A;  1S72 S;  4C8O A;  2HQ3 A;  2QE5 A;  1FA0 A;  3TZX A;  1JNR B;  3FC9 A;  3M6V A;  2JH3 A;  4JI3 J;  1KC8 T;  4HAC B;  1SJ1 A;  4RO0 A;  2ZZN A;  5DM6 Q;  1S6O A;  3ENV A;  5CCM A;  1U1Q A;  1M5P C;  3NWR A;  3A3N B;  2XSJ B;  1VQY A;  2LLZ A;  3MCM A;  1N33 F;  4L72 B;  3D6T B;  4U96 A;  1CVJ A;  2CDR B;  3ENW A;  1FX4 A;  1RT1 B;  1H2T Z;  1LWF A;  2BUN A;  2F8M A;  2O5D A;  3I32 A;  5FII A;  3SCJ E;  4JB8 B;  2W9C A;  2QA4 S;  3JAM Y;  4BBY A;  3MCS A;  4ZVS B;  4UY8 T;  2H9Z A;  2KB2 A;  5G4D A;  1H73 A;  3AJ2 A;  4PWU A;  4ZHR B;  1TL7 B;  4NZ0 A;  2BE7 D;  3KLV A;  4CT9 A;  3M9M B;  2ZH5 A;  4FDF A;  2P9E A;  4X62 J;  4KPY A;  4ILL A;  3K5M A;  2C3U A;  3ISN C;  3K7R A;  2I5J A;  2L9D A;  4PAB A;  2ZH7 A;  4F4A A;  3W2V B;  4X64 J;  1VQP S;  1FD2 A;  4JV1 A;  3OL9 A;  3CJR A;  2YNI A;  2WSF C;  2HSE B;  4P2X A;  4QQB A;  2NUH A;  5ETT A;  2UXB J;  4YOE A;  1C1C A;  5CAA A;  5LXR A;  4F2S A;  4DL5 A;  3CD5 A;  4K4W A;  4F8R A;  3MCO A;  3B4D A;  3PYF A;  2CQ0 A;  2ACM A;  2G2Y A;  1S1W B;  1N36 F;  1VQL S;  2PT0 A;  3H7H B;  4OYP A;  3QAE A;  5L46 A;  2HMI A;  5D0H A;  1M90 T;  4CNZ A;  4URQ U;  1YSJ A;  3MM6 B;  1WTB A;  1U47 A;  2IHR 1;  5GMK a;  4M63 A;  3C6U B;  2OIH A;  1WOR A;  1S7I A;  4DQP A;  1ZYQ A;  2DO0 A;  3M2R B;  4C8Z A;  4J7C A;  2CXE A;  3PYD A;  3GII A;  2WZ1 A;  2B56 A;  1DTQ A;  2LXU A;  2XBP A;  5CYM A;  5DGA A;  2F4V F;  4IG3 B;  3DYA A;  1NCL A;  3KK3 A;  4DU7 A;  1PAE X;  3DOK A;  3SBM A;  2X1G A;  2ROE A;  1OIA A;  2DYA A;  2J5A A;  3E51 A;  1NM2 A;  1U8W A;  3IRX B;  3TX0 A;  3W7B A;  5ITH A;  2MB0 B;  4LRE A;  1MRO B;  4DI6 A;  4DR5 F;  3V6D A;  2MEW A;  4LF7 J;  1UVJ A;  2XGP A;  1V5I B;  1QSL A;  3BS9 A;  4WFY A;  3FBC A;  4Z2X A;  2AT1 B;  1VQO S;  1KFD A;  1MMN A;  1F3V A;  3BN4 A;  2C42 A;  3TQE A;  2ASJ A;  3TA2 A;  3KTQ A;  2VPY B;  2VD3 A;  4AXJ A;  3R7B B;  3FCV A;  2X1A A;  5ADZ A;  2YNI B;  2XMU A;  3L09 A;  3G71 S;  1RT6 B;  2C2K B;  3FQL A;  3LTO A;  3NBP A;  3DI6 B;  3O6Q A;  5M2R A;  4ED4 A;  3HFK A;  2QLF B;  3U7J A;  2HRU A;  2DR8 A;  4ZVH A;  3NKY A;  4M5H A;  2MQQ A;  4F4X A;  1I94 F;  2XS2 A;  1WOS A;  1U2C A;  1KKH A;  3CJS A;  2QLX A;  1G4C A;  2OPQ B;  4KY3 A;  4I6A A;  4JOU A;  5A2Q Y;  2IM3 A;  3IWX A;  2HMI B;  4CCH A;  1Q95 G;  2W2O P;  2HK3 A;  3G6E S;  3ADA C;  1UVK A;  2DHH A;  4JP8 A;  4Y2A A;  4YR0 A;  1JXL A;  4C0B A;  2AX1 A;  4F02 A;  1GH8 A;  2H54 B;  3JS9 A;  2R7Q A;  3P4U B;  2BBE A;  1PYS B;  4EEY A;  3CCU S;  3VAJ A;  2KZM A;  1F60 B;  2XQC A;  5CYM B;  1IBC B;  2VFR A;  1YZ6 A;  3EZU A;  3P5B P;  1SJR A;  5HVH A;  3OHA A;  2PFD A;  4QR1 A;  4LFC F;  4WZQ A;  1WF0 A;  1T3O A;  5JXS A;  3UWT A;  3MAH A;  4ES2 A;  5KFO A;  5EWF A;  3Q8S B;  1UZH A;  4KYZ A;  4R0E A;  1S1V B;  4MAK A;  1ZTW A;  3ZZZ A;  5A8R B;  2R8J A;  2XWY A;  3NGR A;  1NKB A;  4O3R A;  1C2P A;  5JUM A;  5BXI A;  2XGQ A;  1H7X A;  3E01 B;  4DUZ F;  1FXD A;  4OL8 A;  1U0H A;  4OYZ A;  1HMV A;  1GT8 A;  4DWI A;  2CPF A;  2EW9 A;  3M8W A;  5KG3 A;  2DGO A;  1XMO J;  1ZM9 A;  2MKI A;  4DV6 F;  4M5L A;  4DV4 F;  3EJM A;  3S01 A;  5KFF A;  1FK9 B;  2ADB A;  3HJV A;  4PCQ A;  1FFS B;  1E6Y B;  2HLT A;  2ACY A;  3OTC A;  5THW A;  4RNO A;  1VQ7 S;  1L3U A;  2MQP A;  2AJ1 A;  3IR7 B;  4ED1 A;  4GO5 X;  5F9L A;  2JRS A;  1S1T B;  4KBI A;  2W2M P;  3TUZ C;  3JXO A;  3EVM A;  1IBL F;  2IMO A;  2F8E X;  4KQZ A;  5HMZ A;  5B0C A;  2AQ4 A;  2HS3 A;  2LQB A;  3JQM A;  3LWM A;  1TV6 A;  2FC8 A;  2ROG A;  2YH0 A;  1RDR A;  2VDI A;  4NEZ A;  2BMB A;  2JZ5 A;  3MM9 A;  1S0N A;  4LFB F;  2HHV A;  4ID5 A;  2KHC A;  1IN0 A;  2FIU A;  4C8L A;  2WAQ D;  5JVH Q;  1YBU A;  3R27 A;  2NZC A;  4HLB A;  5LJ3 Y;  1GTE A;  3QSY B;  2VG7 A;  1U45 A;  2JEJ A;  1HQ2 A;  1IWA A;  5EHH A;  2GIQ A;  5GAG I;  2LYV A;  1B64 A;  2XYP B;  4JI1 F;  3O2I A;  2AF6 A;  2V4J A;  3QJJ A;  1N0U A;  5J2N B;  2UUA J;  4ERD A;  4FKY A;  3SSS A;  3HLU A;  2X1B A;  3R5D A;  1Q7Y T;  2XEX A;  2AD9 A;  1KHV A;  1HQU B;  2CNK B;  3G8S A;  4WII A;  1FK9 A;  1BGX T;  2LP4 A;  4DV2 J;  2MJN A;  2AW0 A;  3HZG A;  4HHH A;  4OI1 A;  1SQG A;  2O3D A;  2W2Q P;  3CJT A;  3J7Y U;  2PFF B;  2UU9 F;  2LU1 A;  2GJ2 A;  3DRR A;  2FY8 A;  3UVJ A;  4R5P A;  2RQC A;  3AXK A;  3PJ9 A;  2R7W A;  2CQD A;  4U7U D;  4JI5 F;  4XTT A;  5EN1 A;  1YZ7 A;  3OJS A;  1BWV A;  2WCX A;  3UDV A;  4B9S A;  2LQ9 A;  3KJF B;  4CP5 A;  3JSM B;  1TR0 A;  1UVM A;  1S48 A;  3TEG A;  4X66 J;  2L3M A;  3Q83 A;  1WHV A;  2E1P A;  2ZUG A;  4CO1 A;  5SZT A;  4A4J A;  2CZV C;  3T1H J;  4Q2M A;  4ECX A;  5KFJ A;  4DLE A;  1KNZ A;  1TKT B;  4DPW A;  2BR0 A;  3M6X A;  2MJU A;  3C46 A;  3RAX A;  2DK2 A;  4ID5 B;  1GNK A;  1IUJ A;  4Q2L A;  1RWO B;  2G2Z A;  2YBV A;  4MIA A;  3W5Z A;  4HR2 A;  2DGS A;  2QA4 G;  2LA6 A;  2COL A;  3DOK B;  4NYZ A;  2J9E A;  3B8H A;  4UTG A;  4LF2 A;  4Y34 A;  3HHN B;  2R7V A;  1U49 A;  4DV5 F;  4UZB A;  3CCJ S;  3DRX A;  3KUE A;  4I0W A;  1KTQ A;  4QZV B;  2B7B B;  4AND A;  2YKP A;  3PYG A;  4ZK7 M;  5A0Y A;  4CT8 A;  3NS6 A;  4N47 A;  1NK9 A;  2CPY A;  5I3P A;  1AUS L;  4H4M A;  3IBC B;  2E7V A;  2HGM A;  1RCX B;  2Q6B A;  4ZP6 A;  4FVM A;  2A18 A;  4ID8 A;  3UCU P;  1WHX A;  3LAN A;  4QCL A;  1F3F A;  2FDN A;  3CJ5 A;  1WKJ A;  3KUH A;  1HWI A;  1HW9 A;  2POK A;  2AGQ A;  4HKQ A;  3K2Y A;  2NQP A;  3U1N A;  3M8Q B;  4NI2 B;  4TXS A;  2Y0B B;  3R5J B;  4DX5 A;  5B0D A;  4Q45 A;  2D3O R;  1S6U A;  2IM2 A;  4B02 A;  4ED7 A;  5IT9 Y;  2AMC B;  2CJA A;  5H9E J;  4IDK A;  1X4E A;  1NSP A;  2KHD A;  5KFL A;  4KTQ A;  4H4K C;  2KTQ A;  2R7T A;  3MEC B;  1D8Y A;  4YME A;  5J1P A;  5IQQ A;  4PEO A;  3HCX A;  4ETZ A;  1IBL J;  5M2P A;  3DLL Q;  5E3R A;  1S4E A;  2G13 A;  1U2R A;  1RA6 A;  2J0W A;  4J9Q A;  2KDO A;  1IBK F;  2FGC A;  3OFH A;  4WCE Q;  2VAS A;  3RRK A;  3CUN A;  3O44 A;  1WHW A;  2DGV A;  5DG9 A;  1YJU A;  4KH1 B;  2DR7 A;  3P8B B;  1FWL A;  4LR7 A;  5DJB A;  2KFZ A;  1PAU B;  2JFK A;  2YPZ A;  3QFH A;  5IT4 A;  3G4S S;  4WF9 Q;  1RBO B;  4DS4 A;  3ZC4 A;  3WZ0 A;  3JAM U;  1U6B A;  4LRD A;  2W25 A;  4PRF A;  1RE1 B;  2BW2 A;  2CWX A;  4KKO A;  3LGM A;  1G3O A;  2ZE2 B;  3ZZU A;  2OHD A;  3M4X A;  4YR3 A;  1R7I A;  2IVY A;  4OI6 A;  1KBR A;  4MIB A;  4AXI A;  4C0H A;  4B17 A;  3PRV A;  5JVG Q;  3R5A A;  2BM0 A;  1CS4 B;  2FUG 9;  1QAY A;  3FKB A;  1H98 A;  4WTY A;  4JI6 F;  1CQN A;  5KFM A;  5D4L A;  4N5S A;  2KFY A;  1F2G A;  1NSA A;  1D09 B;  1O6X A;  2CPE A;  3CC4 S;  4CIO A;  1C0U B;  2H3E B;  1U8S A;  3MM5 B;  8RUC A;  3A8J A;  4LJM A;  4ECT A;  4P52 A;  2XMA A;  4UOG A;  3CCE S;  4P75 A;  1XMQ J;  2V9W A;  2FZK B;  4NPO A;  4ECZ A;  1SH3 A;  1YJ7 A;  2W2N P;  2ZBQ A;  5CD4 H;  1URR A;  2WW8 A;  5BYQ A;  4N7T A;  2JWN A;  2UUW A;  2KT3 A;  3FBF A;  3L7O A;  3VQS A;  3TJA A;  4KGM A;  1U1N A;  3M32 B;  5AE1 A;  3H8Y A;  2MQL A;  4QYR A;  1RU1 A;  2XI2 A;  5AE3 A;  1JLE A;  1VJW A;  3EPG A;  3M8S A;  4PG8 A;  2F40 A;  4JI8 J;  1M5V C;  1DQ8 A;  4Q0B A;  1QDU B;  2M70 A;  4KKO B;  4ZPA A;  4B3T F;  3H5X A;  4YP3 A;  4M1K A;  2GVZ B;  2J6U A;  3OR2 B;  2A0F B;  4B3M J;  5IT9 U;  1C4A A;  2LDY A;  2QFI A;  4LSL B;  1TL3 B;  3PFE A;  4HTJ A;  1REV A;  2MLY A;  1RAJ A;  5IOL A;  3W2W B;  1W2I A;  3PR5 B;  3K5P A;  4DFP A;  2ASL A;  3LW5 C;  1KSP A;  1KQK A;  4RX6 A;  1PBU A;  3D9B A;  1EET A;  2B0G A;  1H38 A;  3GWC A;  2CA9 A;  2FB0 A;  3A8I A;  4XK8 C;  4QW8 A;  1X8D A;  3CGI A;  5HQL A;  3TVZ A;  4CM0 A;  4CO5 A;  2AGP A;  3G9C A;  3CDB A;  3HVT A;  1AUD A;  3OTO J;  5HBM B;  2C22 A;  3RR8 A;  1Y4Z B;  2YY3 A;  7FD1 A;  1HNV B;  2QL7 B;  3C6T A;  4O4G A;  3CC2 S;  3SEO A;  1VS3 A;  3R1H A;  4OZ2 A;  1HA1 A;  3THP A;  1BMQ B;  3O1L A;  5B08 A;  4G1P A;  2HHH J;  3Q8Y A;  1JLE B;  5DZ7 A;  4WFN Q;  4TU9 A;  1HBO B;  2NUU G;  4A8O A;  2HVH A;  1SXL A;  1FKO A;  1XK8 A;  2DNN A;  2M5Y A;  3AT1 B;  4ZA1 A;  3W5Y A;  3SZ2 A;  2Y8W A;  1MW7 A;  3DKD A;  3MPD A;  1J2V A;  3PYE A;  1PSD A;  3DGP B;  2PMZ D;  1K9M T;  1MN9 A;  3H2V E;  5IWA F;  1FNM A;  5EX0 A;  5DDP C;  2KZZ A;  1FHT A;  2UUB F;  1R6Y A;  3LGN A;  5KG2 A;  1GFW B;  2MQN A;  1RWV B;  2N3L A;  4MYT A;  3UE2 A;  4AL6 A;  3UD4 P;  1TFY A;  1NJW A;  1TL3 A;  3KFW X;  4MYU A;  2VF3 A;  3IGN A;  2I9S A;  3HP6 A;  1G2E A;  1OY6 A;  3ELH A;  3IFE A;  1NPR A;  5F3T A;  2YKN B;  3EMT A;  4GC6 A;  1FF2 A;  3THT A;  4FKX A;  3EYZ A;  1KVI A;  2HBR B;  2CVI A;  2JJ4 D;  2G1D A;  1QSY A;  2V69 A;  1HW8 A;  5KFD A;  3MR6 A;  2BKO A;  1TK0 A;  5HBM A;  2OSR A;  2SXL A;  3C6T B;  4WFZ A;  5E3P A;  1SKU B;  2BQ3 A;  5CHC B;  4D3G A;  4QWC A;  1RSC A;  2NXU A;  3D0H E;  1CJT B;  1E6V A;  2DD8 S;  1VBZ A;  4JUZ A;  2B6A A;  3VV2 B;  4DU8 A;  5DQG A;  5GAD U;  3V6J A;  4YS2 A;  3GTY X;  4ZCI A;  4ER8 A;  4GO7 X;  2ILZ A;  1SKS A;  1IKW B;  2B4P A;  3P45 B;  4ZVG A;  2V94 A;  3NGD A;  5E2Q A;  4ECV A;  3DRP B;  5CAB A;  3ETO A;  4MTP A;  2Y9H A;  2OTL S;  2WON B;  2OPP B;  1T94 A;  4ZLN A;  3V81 A;  4AT1 B;  3NGK A;  1X5T A;  2LEA A;  4RZR A;  1PG5 B;  4QR0 A;  3HFZ B;  4M5D A;  5SUH A;  5HLF B;  1GMV A;  1RWK B;  3IMQ J;  1U24 A;  3ZXW A;  5E33 A;  3ZZP A;  2JLF A;  1FWK A;  4UST A;  3IRW P;  3DLH A;  2XC9 A;  2V63 A;  4B3O B;  1UEK A;  3W9J A;  2FJV A;  4ICL A;  1LFP A;  3OPK A;  1P9Y A;  4AQY F;  1K0V A;  2AYB A;  4KV8 B;  1I51 B;  3RU0 A;  4G6V B;  3KK2 B;  4WZM A;  1X5O A;  4QYZ K;  2AHO B;  3CSK A;  4J5O A;  1LWC A;  2ABY A;  1RKJ A;  2AJ2 A;  1RZM A;  1U7L A;  2DH7 A;  2VU5 A;  1HBN A;  2OO4 A;  3OV7 A;  1RT2 A;  2ZC4 A;  1L3V A;  1ZAX A;  3RBX A;  2OAU A;  4DQI A;  2YX1 A;  3OFF A;  4F4Z A;  2OFH X;  4KB7 A;  4MK7 A;  4NYP A;  3UNG C;  1VLY A;  1R27 B;  3SDE B;  2HQG A;  3MM8 B;  3MEE A;  4KHM A;  2HIY A;  3IM9 A;  1U4B A;  9ATC B;  3B4M A;  2NCK L;  3T9Z A;  4OYA A;  1XNR J;  5KFU A;  5KOW A;  1WC6 A;  2GML A;  1TK8 A;  4BWJ A;  2P9G A;  1R0B G;  2KT2 A;  1ZBT A;  3TI0 A;  5DDR C;  1S9F A;  5T7L B;  3D67 A;  1UWB A;  5KT3 A;  4ED6 A;  1QAJ A;  2E7X A;  2GJF A;  4M5D B;  3NAI A;  1ZPW X;  3C19 A;  3FQK A;  4LRA A;  4U7C A;  3M30 A;  1N5T A;  3BJY A;  2F65 A;  2BA9 A;  1HD1 A;  2MHE A;  2CRL A;  1PIL A;  1VQ8 S;  3QWU A;  1FX2 A;  2JFD A;  5C25 B;  3EVW A;  1ICE B;  4C6A A;  2R8K A;  1VIO A;  5AXM A;  2U2F A;  4B3T J;  1SH0 A;  2C3Y A;  1YBA A;  1YJN S;  1TL7 A;  1FEH A;  2VPW B;  3B78 A;  3LQV A;  3W64 A;  4L74 A;  3PW2 A;  1CEZ A;  5IC4 B;  1HI0 P;  2CJK A;  3D5M A;  1Z2L A;  1GXT A;  5FDL B;  2M2B A;  1RT2 B;  1JIH A;  3MMC B;  4RW6 B;  3FBB A;  1C1C B;  4GVB A;  2Z4P A;  1FE4 A;  5AXK A;  3ILJ A;  4DUY J;  2ATL A;  3CJK A;  2ZKU A;  3TO8 A;  3DM2 B;  3N5F A;  1FJE B;  1VHF A;  1HNV A;  4O3Q A;  5HVF A;  3NCQ A;  3TZY A;  1K1S A;  1T9U A;  4Q8E A;  4O0I A;  5HP1 B;  4DG1 A;  1B7F A;  1QD1 A;  2VFU A;  3FGV A;  1H72 C;  8AT1 B;  2L48 A;  3OTO F;  2QLB B;  3AQP A;  3R5G A;  4OI2 A;  4W98 A;  1RQ0 A;  3LOU A;  3AJD A;  3W65 A;  4C2M A;  2B51 A;  4PG6 A;  2EFO A;  2VOP A;  1TAU A;  4JI4 F;  4NLW A;  2AWZ A;  1CC8 A;  1WKL A;  2BV3 A;  2M0G B;  3LPE A;  4BC9 A;  5T14 A;  1DLO A;  3HHL A;  2VA3 A;  5ETP A;  3W62 A;  2LA4 A;  4LUB A;  4DV3 J;  2QIF A;  1SH2 A;  3KLE A;  3CD6 S;  3W8P A;  3I5A A;  5D3G A;  1R89 A;  2DR6 A;  1M5H A;  3BV8 A;  1YRX A;  1DTT B;  3ISN D;  4DPU A;  4C98 A;  3EGW B;  5KFR A;  3CDU A;  1XC9 A;  2KM8 C;  3WC2 A;  3KG4 A;  4QOT A;  5KG7 A;  3OQ2 A;  3L3C A;  1NK5 A;  4DZ6 A;  4RNH A;  3M6W A;  2QSW A;  5D4O A;  3S8S A;  4WK3 A;  1NJX A;  2PMH A;  3HVR A;  2IYG A;  5H9E K;  2EI5 A;  3C8Y A;  3DRS B;  3W1Y C;  4R0J A;  2F9D A;  3K5O A;  4KGK A;  5ETR A;  2MZQ A;  4RW7 A;  5E41 A;  1EKS A;  4RUC A;  1HNX F;  4DG1 B;  4FS1 A;  1UCN A;  2CG4 A;  3D6M B;  4NLS A;  1KP6 A;  3NWG A;  5IC6 B;  1LW2 A;  4LF5 F;  2MKC A;  4ZOS A;  4P74 A;  3SCK E;  3SSR A;  2MKK A;  3H40 A;  3EZO A;  4KGZ B;  3IP0 A;  3H25 A;  2W4P A;  2ZBI A;  3I31 A;  2P9C A;  3IS9 B;  4RLE A;  1M5O C;  4PQA A;  2PDA A;  1FDA A;  5G0R A;  3NLC A;  1X31 C;  5KFW A;  2E5L F;  2VFT A;  3K17 A;  1RT7 A;  3THV A;  2E1M C;  2QA1 A;  3FJ2 A;  3JQJ A;  3JTP A;  3J7A 1;  3BKU A;  3G6V A;  2OPP A;  3IG1 B;  6FD1 A;  3Q22 A;  4DR1 F;  2FVQ A;  5IQ6 A;  2MLX A;  5F8G A;  4LQ3 A;  3BYP A;  2EFG A;  4YB6 A;  1WSV A;  2DCU B;  2VDH A;  4PXE A;  5IM0 B;  3GFY A;  5L1L A;  4ZPC A;  1WC1 A;  1WTF A;  1N8R T;  3AHP A;  1OPZ A;  5FLX Y;  1FXR A;  1IKX A;  1OSC A;  3KHR A;  4DPY A;  2ZD1 B;  4M5N A;  4LRF A;  4B3O A;  1Z4U A;  2R7U A;  2GZO A;  2ZBR A;  3UN2 A;  4OX9 J;  1PJ6 A;  1IKY B;  3PRB A;  2QJ3 A;  3NEK A;  1NDK A;  1BHN A;  4KV8 A;  3FFI B;  4OZ3 A;  4C11 A;  1HR0 J;  4Y0F A;  2MKS A;  1S12 A;  1IKV B;  2CJY B;  4MMO A;  4N8O A;  1LQ9 A;  1FDB A;  1S9G B;  1X9M A;  1P6T A;  2I2Y A;  2XY6 A;  1R8B A;  1SC6 A;  1FEE A;  2ZFH A;  5GAE U;  1R8H A;  5GMD A;  5AJ3 J;  3IXQ A;  1LW2 B;  1EJ7 L;  3HHE A;  4DHV A;  4NXN J;  3TAM A;  5IWA J;  4WP9 A;  5DQH A;  3KK1 B;  1FKA F;  1IM6 A;  1NHV A;  4I2P A;  2HW3 A;  3O3L A;  3PIP Q;  1XBW A;  2LCW A;  3IS9 A;  4DLG A;  4W90 B;  1EP4 B;  1KR4 A;  2B43 A;  1R6V A;  5EDW A;  3MEE B;  3R9L A;  2IVM A;  2UUT A;  2QZ8 A;  1RTH A;  4FNI A;  1FXL A;  4X4U A;  3PW7 A;  1CG2 A;  5AT1 B;  1I1G A;  3FUY A;  1K1Q A;  2OLW A;  3JTO A;  3NGS A;  2UU9 J;  3ILI A;  2RF2 A;  1TL5 A;  1Q8L A;  3QT8 A;  4CDI A;  4K4X A;  4DMZ A;  4PYA A;  2CNO B;  2DTJ A;  2DY9 A;  5CA5 A;  1JLC A;  3CCQ S;  2DCL A;  3EUN A;  4ES1 A;  5LOQ A;  1NKC A;  3OXG A;  4WP8 A;  4JI2 J;  4RW9 B;  2ZC3 A;  2KO1 A;  1LXJ A;  4RW4 B;  2R8G A;  1NO8 A;  2FTR A;  1KS2 A;  2X7I A;  4OIX A;  3MMB A;  3J81 Y;  2AGO A;  2E9Z A;  3R7S B;  3HK2 A;  3PIO Q;  1IR2 A;  4C0O C;  4MK8 A;  1NXI A;  2EWH A;  2FHJ A;  1YG0 A;  3QO9 B;  5DLG A;  3FDS A;  4M8L A;  1R0A B;  2IAJ B;  4OZJ A;  1FO1 A;  2N82 B;  2VG5 B;  3PO4 A;  2R7O A;  4I69 A;  1S49 A;  2YQ0 A;  4OZ0 A;  3V4I A;  2HS0 A;  1HHT P;  4K7Q A;  2IJN A;  4EU0 A;  3S1T A;  4A8S A;  2YKM A;  1S9E A;  5LSR A;  4B3M F;  4IR9 A;  3PCO B;  4R25 A;  2PO4 A;  5D0E A;  4G1Q B;  1UPP A;  4EFA C;  5HO4 A;  5D6G A;  4GVB B;  3D0G E;  3NOG A;  2MGZ A;  2BJD A;  1LV5 A;  3HJF A;  3R2C J;  4PWD A;  4I2P B;  4NLP A;  1UA1 A;  3RRG A;  3C66 A;  2H5E A;  2BVZ A;  3PM9 A;  2J9C A;  4FXD A;  2FJE B;  4CTA B;  1ZA1 B;  1YJ9 S;  3NY0 A;  4ZPB A;  4WFB Q;  4X4N A;  1ZAV A;  3IWN C;  4NXM F;  1UET A;  3I82 A;  2R9L A;  1U0S A;  1W26 A;  1VOM A;  3EXC X;  3TAP A;  3PV8 A;  1RT3 B;  1Y5I B;  2V8P A;  6FDR A;  4FVC A;  2R4F A;  3QT5 A;  1K73 T;  1YX2 A;  2IFX A;  1M5S A;  1DUR A;  2KYX A;  3KLG A;  3SQG B;  3NOC A;  3MMA A;  1NJY A;  4LF9 F;  3CT9 A;  4ITS A;  4ZP9 A;  1Q4R A;  2UUA F;  4ZS6 A;  3OL8 A;  1FFW B;  2NPI A;  1LK5 A;  4UOH A;  2HHS A;  3BO4 A;  1WDT A;  2WB4 A;  3NL0 A;  3A1Y G;  4ZHR A;  2R2U A;  1HBU B;  3PZP A;  4FYD A;  1VRT A;  4ECR A;  2CVE A;  3KG0 A;  4CO4 A;  4CZC A;  1VRU A;  2Q6C A;  1VQ6 S;  1FJG F;  3VAG A;  3AD7 C;  1VQK S;  2JL9 A;  2VL1 A;  2K1R B;  3R1L A;  2J9D A;  2CJQ A;  2IBO A;  4ECW A;  4I2Q B;  2VC1 A;  4J9N A;  2ILY A;  2HEK A;  1EAR A;  1NJZ A;  1TKZ A;  4PWD B;  2MY8 A;  4RKU C;  2AJ0 A;  5E3C A;  4NCA A;  3Q2T C;  2R7S A;  2IDL A;  5JJB A;  3GIL A;  2XWX A;  1M5K C;  2E29 A;  2VJV A;  4BHQ A;  2AJ4 A;  3KDN A;  1KTV A;  2KI2 A;  3TVY A;  4CLZ A;  2KKH A;  3M8P B;  2HGL A;  4P7V A;  4KO0 B;  3NCP A;  9RUB A;  3W9I A;  2HHX A;  2RML A;  2Z2M A;  2KYZ A;  3GFH A;  4M94 A;  1RAB B;  3GIM A;  2G2O A;  3MUM P;  3M2R A;  2QGF B;  2HFV A;  3K5L A;  5HQM A;  2ZKT A;  2RIJ A;  2A6M A;  4DV2 F;  4DBQ A;  4LMZ A;  4U9R A;  3T3F A;  3MM7 A;  2UXD J;  1OY8 A;  2NSC A;  3GPA A;  3MM6 A;  3I5C A;  5KG0 A;  2JC0 A;  2Z8Q A;  2HYI B;  4N76 A;  5BYR A;  2GC8 A;  1MMD A;  2VBY A;  4QIE A;  2M52 A;  2MHN A;  5D77 A;  3HFV A;  4MKB A;  1FES A;  1GXU A;  5K8O A;  2VQF J;  1S77 D;  4I7F B;  2CQ1 A;  2RU9 A;  3K0J A;  4AL5 A;  3PDN A;  2KXN B;  2PI4 A;  1VC6 A;  3UPF A;  1T11 A;  4Q8F A;  2UVV A;  1HHS A;  3MFH A;  2IM0 A;  1BD6 A;  3DU5 A;  5GAD I;  3C14 A;  2RDD A;  3VGS A;  3OTB A;  3BBB A;  4CNY A;  1GXL A;  3MPW A;  1JXE A;  3HSG A;  4FN5 A;  2MDA A;  4P7T A;  4DSF A;  2HVI A;  3CC7 S;  2AJF E;  2HNY B;  3OXL A;  2RIL A;  2XYG B;  2LMI A;  1T9T A;  1N5V A;  2GQQ A;  3RGI A;  3SFU A;  4QIG A;  3NNA A;  2GO8 A;  3PKM A;  1IM4 A;  4GKJ F;  2LFV A;  2JDJ A;  3BSC A;  3BPS P;  2I8E A;  4YY3 J;  1N34 F;  1TZ0 A;  3M2U A;  2E5L J;  3F44 A;  1CSJ A;  3MOZ A;  2BM1 A;  4X65 J;  3QPI A;  4KFB A;  1ZET A;  4B3S J;  3I4P A;  1P27 B;  1SBR A;  2BEF A;  2F63 A;  3PHE A;  1YRU A;  4M5K A;  3J7Z T;  1N56 A;  3I5B A;  2HFS A;  4P10 A;  2BRL A;  4EBC A;  1UEU A;  1RYR A;  1S5Z A;  2CNN B;  3QFW A;  1WC4 A;  1BQM A;  5F0U A;  3P3D A;  2E44 A;  2BJ3 A;  4EBD A;  1WF2 A;  2FJD B;  1IWG A;  1JB0 C;  2B9W A;  2FD2 A;  3SXL A;  4E8U A;  4QIV A;  5M2U A;  4P72 A;  4KT0 C;  4AYB D;  1VYA A;  4J9K A;  2K06 A;  2LQ5 A;  2Y1R I;  3UNY A;  1VQM S;  2C2R A;  1V3Z A;  2HVD A;  2WRM A;  3HVA A;  1AZS B;  4NCG B;  2E1C A;  1XIQ A;  4OHY A;  4E98 A;  3A12 A;  4K0K F;  1F6T A;  1D9A A;  3CD0 A;  4DV6 J;  4DV0 J;  4EZ6 A;  4LF8 F;  1B7Y B;  3G86 A;  2Z56 B;  1IVZ A;  1UL3 A;  2AX0 A;  2MZJ A;  2HG4 A;  1KHW A;  1RI7 A;  4LIR A;  3I87 A;  2FHM A;  2ZM6 F;  1JNZ B;  2OFG X;  2XCA A;  2XHC A;  2CG8 A;  5EUH A;  2XY7 A;  2I6W A;  2Y3Y A;  2UV8 G;  3LGH A;  1V5V A;  3BZQ A;  4PWW A;  1N54 B;  3TP2 A;  3CXC R;  1NND A;  2K3I A;  3T1Y J;  2C2E A;  3W3S A;  3H0P A;  4J37 A;  2D7S A;  1KFS A;  3HHD A;  5HN0 A;  3A3P B;  3OD2 A;  1SL2 A;  5RUB A;  3OL7 A;  3SCI E;  1EET B;  3HM9 A;  4JYA J;  4JI4 J;  1DY3 A;  2VKZ G;  3T41 A;  4Z7C A;  3QJL A;  1AFJ A;  3S6E A;  3M7V A;  2WVB A;  3G8T A;  1NH8 A;  3Q86 A;  8ATC B;  1QY7 A;  3DOL B;  3R97 A;  1JKH B;  4DR3 F;  3RAQ A;  2HBY B;  4CH0 S;  3ISZ A;  3M8Z A;  2LEB A;  1HQE B;  4A47 A;  2XG8 A;  5KOX A;  1NH7 A;  1YHQ S;  3W9H A;  3MM9 B;  2QSF A;  3UO0 A;  2KRB A;  3EM1 A;  4NCG A;  3RJM B;  2GMJ A;  2GGP B;  2ZNZ A;  2WVE A;  3IBW A;  3SFG A;  3MED A;  5BJR A;  3OFE A;  2VHG A;  1EX8 A;  3UD5 A;  2GIR A;  1X0F A;  2UVR A;  2WHO A;  3CNQ P;  3ETM A;  3IBF B;  4F25 A;  3GIK A;  1G1X A;  3UVJ B;  1RHR B;  3RUB L;  4K4T A;  1NDC A;  1HLW A;  1P9Q C;  3FCW A;  1X4A A;  1HKA A;  4F3Q A;  3A8E A;  1KD1 T;  3BGL A;  2XI3 A;  1VRT B;  3HX9 A;  3P49 B;  1WEX A;  1TL4 A;  2W9B B;  3OR1 A;  3CUL A;  1HAR A;  1TUV A;  4PKD B;  4LBI A;  2MKH A;  3CED A;  5DO2 A;  2OEJ A;  3ONQ A;  4LF7 F;  1D9D A;  1X4G A;  1ZS6 A;  2JVR A;  3PEH A;  3BQ1 A;  2OEM A;  1R3N A;  1S0V A;  3R2D J;  1GX6 A;  1SIZ A;  3TA1 A;  3CCM S;  5FJ4 A;  2ZWP A;  3QNW B;  2WOM A;  4LQ9 A;  3H98 A;  2RAQ A;  2KVI A;  1X5S A;  3WC0 A;  5KFB A;  2XMT A;  2R8H A;  2XNR A;  1Y7P A;  3CJQ A;  3UQS A;  2I0X A;  2GV1 A;  4FYX B;  4WU2 A;  3T6J A;  1VR6 A;  2F1F A;  3QMQ A;  4F36 A;  5B7W A;  1J27 A;  1SUQ A;  3N6L A;  1JJ4 A;  1WEY A;  2DHS A;  4J9R A;  1YQH A;  2BE9 B;  1E6V B;  2BOA A;  2ZHB A;  2ZHO A;  4PXC A;  2E5J A;  2DJW A;  2EC0 A;  3A13 A;  2B9X A;  1D1U A;  1WC5 A;  2HLU A;  2IPO B;  1SKW A;  1I3O B;  1AB8 A;  4JBC A;  4WWS A;  3WIU A;  1JLG A;  1FRL A;  2R42 A;  1Q82 T;  4ZLL A;  4F0M A;  4WK1 A;  3T9N A;  1DBD A;  4J9M A;  4J9L A;  1EHW A;  2PEH A;  2JX2 A;  1AA1 B;  3IAM 9;  2BKN A;  3VF0 B;  4QBU A;  2DRD A;  4LR9 A;  4EK2 A;  2QT7 A;  4DL6 A;  2FPH X;  4IYQ A;  4H4M B;  2BJ7 A;  4EZ9 A;  3T5K A;  2Y8Y A;  4DQQ A;  1P1T A;  3PRD A;  4DR7 F;  4IQM A;  5FLX U;  2WB1 D;  3R3T A;  3RB3 A;  1JX4 A;  1URN A;  4ZJL A;  2GAG C;  2FHJ D;  4NLQ A;  1JMT A;  4RWX A;  4Y2K A;  4ELT A;  2C3O A;  3PJW A;  1KOH A;  1Z1Z A;  2Q1L A;  2RQ4 A;  5IT0 A;  1RA7 A;  1IR0 A;  2KM8 B;  3WDO A;  5E0O A;  2QEX S;  3PG9 A;  1S6Q B;  2F9J A;  4DF4 A;  3N5B A;  3D1H A;  2DXE A;  4HVZ A;  5J1E A;  1LWE B;  3PO5 A;  1WSR A;  3V6D B;  3C2P A;  3NXZ A;  1SL0 A;  4OYB A;  2R2R A;  1NBE B;  5EX3 A;  3T5H A;  3ZTP A;  2V0N A;  4IUF A;  1TKX B;  2V67 A;  4M5M A;  1PIE A;  4OYI A;  5D8H B;  1F9H A;  3CDE A;  4B08 A;  1J5O A;  2Y0S D;  4ED2 A;  2XLK A;  3D7S B;  3Q8U A;  4ENO A;  1DAR A;  1IQZ A;  3G6Y A;  2I1R A;  1Y0H A;  1SC1 B;  2AZ3 A;  2J7W A;  2LDI A;  4TN2 A;  3TUI C;  4Z7Y A;  2EPI A;  3LP0 A;  1TK5 A;  5D78 A;  1RWP B;  4X4V A;  1RT6 A;  2UV8 A;  5KT2 A;  1AZS A;  1DQ9 A;  4O44 A;  4F67 A;  3FSY A;  3OL6 A;  3AFG A;  3H20 A;  1YI2 S;  2CDQ A;  1HBM B;  2RQK A;  3B82 A;  3VWS A;  1RAA B;  2F7V A;  3AD9 C;  2XMJ A;  2YX4 A;  1RTI B;  1SV5 A;  2K8G A;  2VFV A;  4HL9 A;  2K7K A;  3IO1 A;  1N5Y B;  3PNI A;  2FHO B;  1UJ6 A;  4FF2 A;  2EBG A;  5IFM A;  3BO3 A;  4YFU A;  1UW4 A;  2J9D E;  2EKY A;  1RGV A;  4FPI A;  3CIZ A;  2F4F A;  2J6S A;  1N32 J;  2W9A A;  4DL2 A;  1F0X A;  2QL5 B;  3K58 A;  3GP9 A;  3BBC A;  3IR5 B;  2R8I A;  5KFN A;  2C28 A;  1VQN S;  4J9S A;  2XS5 A;  2AJQ A;  1OYD A;  4UOF A;  5GAH I;  1YKW A;  1KVJ A;  3SCL E;  5K14 A;  3L9Z A;  5J1E B;  1Q7L B;  1NKE A;  3ZNU A;  2KVQ E;  2ASD A;  3HO1 A;  2EFP A;  2XSF A;  4JI8 F;  1W2B R;  3QIP A;  1X9W A;  3CIM A;  1DFD A;  2E66 A;  2MYF A;  2ZVS A;  1PGZ A;  2DR9 A;  1RXO B;  1EIY B;  3D54 A;  4ZCL A;  3T6B A;  2VB6 A;  4RWW A;  3TAR A;  3UR0 A;  5F8I A;  2H65 B;  4LT6 A;  4H4O B;  5GAG U;  1YVF A;  4TYB A;  4USM A;  3PTW A;  1D8Z A;  4NWB A;  2B4U A;  5GME A;  3U1M A;  5HMY A;  5LMN F;  3V6H A;  2MSS A;  4K4S A;  2RRN A;  3CPW R;  1FVQ A;  3OFG A;  1CJU B;  3NGT A;  4P2S A;  3X3U A;  1BY9 A;  3W61 A;  5EWG A;  2ZH2 A;  1QTM A;  3D2W A;  4I64 A;  2XZW A;  1Y11 A;  3DN9 A;  4LBH A;  3KHH A;  2RJZ A;  4V1A k;  4ATN A;  3C16 B;  1N5Y A;  3KLE B;  1UWA A;  2XZD B;  1NRK A;  3RG6 A;  5CD4 A;  3Q8Q B;  3HXM A;  4L75 A;  3M1V A;  1NPP A;  1N6Q A;  1S1V A;  1Q53 A;  1AW0 A;  3CB4 A;  2HND B;  4HI1 A;  2KG0 A;  1LEO A;  4DR1 J;  4Q44 A;  1TL1 A;  4R8U A;  1SL1 A;  3OR1 B;  4DX8 H;  2E1R A;  1IXK A;  4DFJ A;  4QWB A;  3E2E A;  3DLG A;  1Q86 T;  2VOO A;  1OWX A;  3G8Q A;  2DNO A;  1S7H A;  5KFT A;  1TV6 B;  3J80 Y;  2M8D B;  1R31 A;  2VKR A;  3PX4 A;  3DDI A;  3OTE A;  4PG7 A;  2ERR A;  2DR5 A;  4A8Y A;  4NA3 A;  4ZKA A;  2G1H A;  2ZVI A;  3A8K A;  2FYX A;  2KT5 A;  2VBX A;  1OMS A;  4ALZ A;  2CAD A;  3EGN A;  3VGV A;  4I68 A;  3HHL D;  4B3R J;  1JLF A;  2QX0 A;  2V9K A;  2VG7 B;  2DNM A;  1WDD A;  1XR5 A;  1LK7 A;  2RHQ B;  5CZX A;  4CLU A;  4TYA A;  3VR1 A;  1SB6 A;  3BB5 A;  4H4O A;  2BAN B;  4OFZ A;  2HWT A;  4E2F B;  5BR8 J;  4KR0 B;  1U09 A;  1V6H A;  2UXB F;  5D0G A;  3VHQ A;  1RAF B;  5F8M A;  5I42 A;  2OSQ A;  3DXB A;  3QID A;  4OZN A;  4WTO B;  1KQF B;  4RNM A;  3DDK A;  1CBK A;  1VBY A;  5CCL A;  1PBA A;  2G9O A;  1WD6 A;  3O8W A;  4MIW A;  2LXI A;  3TJ8 A;  1N32 F;  5KFV A;  2YKN A;  3D3B J;  3PXG a;  3VGU A;  1WWH A;  1PC4 A;  2N3O A;  3MR2 A;  2EVZ A;  5F41 A;  1FJC A;  5A8K A;  2GW8 A;  2Y1J A;  1KEK A;  4PUO B;  3ZZR A;  3D6F B;  5EGY A;  4OI4 A;  2CWK A;  2FLL A;  1U1R A;  4FS2 A;  3RTV A;  5IM0 A;  3A3O B;  1PYT A;  4YB7 A;  4NXM J;  1PJ5 A;  3DMJ B;  3I0R A;  3BR9 A;  3QLH A;  2ZUA A;  3HDS A;  4TU7 A;  3OW2 R;  1CJT A;  1T9W A;  2GQC A;  1IKY A;  2PSZ A;  4YQW A;  4ZVF A;  5HK4 A;  2VV5 A;  2NS1 B;  2PN6 A;  3AJ1 A;  3ITH A;  4KGV B;  1SPB P;  2VJU A;  1RAC B;  1VHI A;  4LFA F;  2F8H A;  3IAS 9;  1APS A;  4R5P B;  5U47 A;  1S6Q A;  5KG4 A;  4DSI A;  3EX7 B;  2BAN A;  1R8A A;  2E7W A;  3HHL C;  3D1O A;  2WVD A;  4USW A;  1U2F A;  3G87 A;  1SKR A;  2HZV A;  2K3K A;  3OBI A;  4ILR A;  5HAO A;  1XMB A;  3KK1 A;  2MZ1 A;  4MT1 A;  4WYL A;  3TAQ A;  3OJU A;  4NLV A;  4NCB A;  2CQC A;  2BAC A;  3BEG B;  3WIV A;  4ZN1 A;  1VBX A;  4OJG A;  2M8H A;  2J76 E;  2YWF A;  1BQX A;  4X4O A;  1Q78 A;  4MJK A;  2CQG A;  2KJV A;  2Y1L B;  1VMB A;  3FEX B;  3X1L B;  3RRH A;  4K2J A;  4C48 A;  2CUY A;  1YK9 A;  3H4D A;  3KHG A;  1RHJ B;  2HNZ A;  3O5T B;  1HBM A;  2HZC A;  1NUE A;  4DV7 F;  2HHP A;  3FMB A;  2OPR B;  2OPS A;  2RHS B;  1T8E A;  2C1E B;  1HNW F;  3BBF A;  4NLR A;  4OX9 F;  4IDK B;  5C5J A;  3D28 A;  3VAM A;  1S59 A;  1C0T B;  2UZA A;  1RAO A;  3JSY A;  4A8W A;  1UFL A;  4MKY A;  4URS A;  5A0Y B;  2DIV A;  3GFZ A;  1OQ6 A;  1WEZ A;  5J1N A;  4NYO A;  4CYU A;  4DV0 F;  3GR1 A;  3ICL A;  2BJ1 A;  5BYS A;  1GMW A;  4MFB B;  5CXT A;  4IG0 B;  3P6Y C;  2GHP A;  2OML A;  4U8V A;  4NXN F;  1RAD B;  1RWU A;  3GSD A;  2RDI A;  4ICL B;  4CI0 B;  4YHH J;  3GQC A;  3MR7 A;  1GQE A;  2YKM B;  3KJN B;  3MF5 A;  4C8N A;  1FKP A;  1FDD A;  4OYO A;  3U27 A;  1LOU A;  3UFC X;  5L38 A;  3KK2 A;  4DL3 A;  3KLH A;  2G4B A;  3E3X A;  5A8W A;  2W2P P;  1QAI A;  1WC0 A;  4CLF A;  3LAK A;  5L39 A;  3IN5 A;  3QYY A;  4DSK A;  3KNG A;  2CJB A;  4ANC A;  2QG9 B;  5GVQ A;  1TUW A;  5ETS A;  2D41 A;  4FBT A;  1KDN A;  5J2P A;  1ZM3 A;  3DLE B;  5IV4 A;  4A8X A;  2FY1 A;  3M6U A;  4DR7 J;  1NPK A;  3TYT A;  3MM8 A;  1CJU A;  3I0S A;  1NSK L;  4A8K A;  4A8M P;  3CCS S;  2ZWO A;  1D0E A;  4OYW A;  3UR3 C;  3BPD A;  5HRO A;  5T7L A;  3QBC A;  2JC1 A;  1H74 A;  3CWJ A;  1S57 A;  3F56 A;  1AFI A;  2D3Z A;  3TQ1 A;  2UXC F;  4RW6 A;  1WOO A;  2XZT B;  3VCD A;  3M30 B;  5LXY A;  1YLX A;  4CYU B;  3KKF A;  2DEJ A;  2FGO A;  2O66 A;  4ETX A;  4PAA A;  3SQO P;  2MZR A;  2ZEJ A;  5HJX A;  5HSP A;  3R5C A;  3KJV A;  1TQL A;  3GR0 A;  1TMM A;  4I2Q A;  1C1B A;  3DLK B;  4TY9 A;  4A48 A;  2XO7 A;  4NLX A;  3SV3 A;  2DKO B;  3CDA A;  3K8V A;  4CLP A;  3FMW A;  4IKA A;  1UVN A;  4IOA Q;  4L73 A;  1T03 A;  4F2R A;  3UW1 A;  2A6O A;  1M1G A;  2GHW A;  1FWP A;  4PPD A;  3HSJ A;  4DV1 J;  1WI6 A;  4GMK A;  1B4S A;  1SI9 A;  2XMK A;  2GVZ A;  2BW7 A;  2XNQ A;  4YDX A;  5ETQ A;  4F04 B;  3AY0 A;  2R2T A;  1YJW S;  2HFU A;  3AB2 B;  1ZPV A;  4OHV A;  4LSL A;  3VVU A;  3KHL A;  5HP1 A;  3KMQ A;  1G6B A;  4I6Y A;  1IJE B;  1RTD B;  1AT1 B;  3FK4 A;  4KSE B;  3VQT A;  3CD7 A;  5KFE A;  3NS7 B;  2B3T B;  3CJ8 A;  2QMW A;  3JTN A;  4B9N A;  2IM1 A;  3FNN A;  2XM3 A;  2KG1 A;  1B70 B;  1YBT A;  2F5G A;  2JSX A;  2J7U A;  4IRC A;  2E9R X;  3N9U C;  1K44 A;  3RB4 A;  3LAL A;  4Q0B B;  4CM2 A;  3QZ7 A;  2UUB J;  4OX8 A;  3NAH A;  1XR6 A;  2PII A;  3OSN A;  3OTD A;  3QGH A;  1ULR A;  3OR2 A;  3GV5 B;  2WTF A;  2GVD A;  4CH1 A;  2H5I B;  3OVS A;  4ZPD A;  2UP1 A;  1LWX A;  4TY8 A;  1R0C B;  2JOQ A;  4GC7 A;  3MXH P;  3BGR A;  3QGI A;  3JB9 k;  1I6J A;  4JV0 A;  3CO9 A;  4DSL A;  3WQP A;  1HBO A;  4TVA B;  4ZVU B;  5C2C A;  3C15 A;  3IWL A;  1QSS A;  2RH3 A;  3WBZ A;  4OHX A;  4RW7 B;  1ZOT A;  3SYZ A;  2FJX A;  4QIW D;  3BGU A;  2IDE A;  4KFB B;  1A6L A;  3HVT B;  1S79 A;  5J2Q B;  4N56 A;  3RZA A;  4LF4 J;  1HI1 A;  4IRK A;  1YIJ S;  1SQF A;  2MZS A;  2RVJ A;  3HZE A;  4S0M A;  3H2U B;  1XEZ A;  2P6T A;  5FD1 A;  4ZLP A;  2UVU A;  1RWN B;  2B5J B;  3CMA S;  1X9S A;  2IRY A;  3B54 A;  4USU A;  5AXL A;  4RU2 A;  2C3P A;  3PW0 A;  3MEK A;  3DCA A;  2HVZ A;  2D1C A;  4YEA A;  4X66 F;  3HSD A;  3VAF A;  4F0K A;  1FNX H;  4F4K A;  1P1L A;  1TUG B;  2Q43 A;  1NLK L;  2R2S A;  3ZTR A;  4DPT A;  2HFN A;  2V2V A;  2GCF A;  3Q8R B;  1XMQ F;  3KNA A;  3ET6 B;  4MKA A;  4J91 A;  4DV7 J;  3TAN A;  3V6K A;  4TY8 B;  1JJH A;  2LU2 A;  1F9E B;  3VZI A;  2YNH A;  1XR7 A;  2XLJ A;  1FJG J;  3FFI A;  2AZ1 A;  1TTH B;  2DXD A;  4ZPW R;  2CQI A;  2AYG A;  1JXV A;  4USJ C;  4MFB A;  3A4T A;  2W4D A;  3HVW A;  1O51 A;  5HVG A;  3HPO A;  3LWL A;  1S9G A;  3Q23 A;  4N41 A;  1CUL B;  1S6P A;  2GX8 A;  1RKI A;  1PKU A;  5A2Q U;  4Y6I A;  1JLQ B;  1R8C A;  2RUG A;  4RW8 B;  1MU2 A;  4Q7A A;  3FZB A;  1BC6 A;  3KLH B;  4I1T A;  4B3S F;  5HI7 A;  4PYD A;  3DNC A;  2IJR A;  3TNV A;  4WFA Q;  2AU0 A;  2D69 A;  3Q89 A;  4C3M A;  3I9Z A;  4DR4 F;  1N36 J;  3GJS B;  5KT5 A;  1RT1 A;  2MMY A;  1LWF B;  1RWM B;  3N4W A;  4JV5 J;  1RTJ A;  1QTN B;  2P8I A;  4O23 A;  4M5I A;  4F50 A;  2Z30 B;  2FVP A;  2HZA A;  4ZP7 A;  4UZC A;  4TU8 A;  4JYA F;  2HIQ A;  3GZ7 A;  4PQU A;  3JSB A;  5AXN A;  1HWK A;  2GGP A;  2GO9 A;  2C2O B;  2HGN A;  3LP1 B;  4EBE A;  3AAW B;  1Q1K A;  1UEV A;  3NG8 A;  4K2X A;  4Y2C A;  2EBE A;  4D3H A;  1DAX A;  2DPI A;  1N52 B;  4OI3 A;  5KFY A;  1U6Z A;  3ZZ0 A;  1WOP A;  1HYS A;  2DNL A;  1A9N B;  2AIR B;  3TX8 A;  2RB7 A;  5F0W A;  1WKK A;  2LKZ A;  2A2C A;  4WYW A;  2UUC F;  3QAT A;  2OEL A;  1HWL A;  3DC2 A;  1U02 A;  3KG1 A;  1NK4 A;  1XNQ F;  4ZJQ A;  4UUX A;  3SDE A;  3QQC D;  4M5G A;  3AOC A;  4AFF A;  2DRB A;  5KFA A;  1X4H A;  1BWE A;  4F3M A;  3VAL A;  2ZZT A;  1U1K A;  1NJI T;  3FEZ A;  5ETV A;  1JLQ A;  2L41 A;  4I4B A;  4V19 X;  4RNF A;  3FRY A;  1NAQ A;  4G1Q A;  2VIH A;  4M95 A;  1L3K A;  1SVD A;  2AP6 A;  1UWB B;  4OZ1 A;  5BR8 F;  2OKQ A;  2D9P A;  4ZDN A;  4Z37 A;  2XY5 A;  3MEG B;  1KON A;  2KXF A;  1U1M A;  2N7Y A;  5H9F J;  3HMJ G;  1LKZ A;  1RJJ A;  1DTQ B;  3EIC A;  4HH1 A;  3I9V 9;  3DDN A;  5CZV A;  4EO8 A;  4DR6 J;  1V9O A;  3MTJ A;  3I55 S;  4LF5 J;  2P2C B;  2V6A A;  4USV A;  3U02 A;  2PC6 A;  1MRO A;  3Q8P B;  2ZH9 A;  3RR7 A;  1NSQ A;  3GV8 B;  2ZJQ Q;  2OP5 A;  2PMW A;  4LIW A;  1LXN A;  4PQU B;  1XWL A;  2HKE A;  1VIX A;  1VK3 A;  4C8Y A;  4OJ1 A;  2IJF A;  2MKY A;  6AT1 B;  2EFQ A;  5A6P A;  4HDH A;  4KAI A;  2NXC A;  3CCR S;  1PCA A;  2QYC A;  2DXF A;  3NRB A;  4DEZ A;  4HHU A;  2PI5 A;  1HPZ B;  3N6N A;  2RNE A;  2HQF A;  3CE8 A;  3GCX P;  3MMC A;  3L95 X;  3DI6 A;  2BQR A;  1PJ7 A;  1YGY A;  4O3N A;  3OVA A;  1S0O A;  1WG1 A;  4ED3 A;  4DXL A;  4QPX A;  3M8R A;  3IRX A;  4OZL A;  1T9Y A;  5F8J A;  2M3D A;  1U25 A;  3AH6 A;  4DR6 F;  1HD0 A;  1XN9 A;  2JNJ A;  2RKI B;  2DGW A;  2W7A A;  1H3D A;  5B0A A;  3VGT A;  3DGV A;  4K4Z A;  2NYH A;  2HVE A;  1HHQ A;  2LEP A;  4RNN A;  4JI3 F;  4P2M A;  3RBE A;  1ZH5 A;  1OS5 A;  4P71 A;  4K0K J;  2LVW A;  2W4C A;  2K1R A;  3MHY A;  5A6W A;  3UD3 P;  2W24 A;  1B0P A;  2KH9 A;  3DLJ A;  3BQ0 A;  3GYX B;  2RUS A;  4ECS A;  3H5U A;  2MQO A;  1B0V A;  4I6W A;  2B4O A;  1IBK J;  2KXH A;  4NLY A;  2N4C A;  4IFY B;  4WPA A;  2CZ4 A;  4CRJ A;  1VC5 A;  2OPQ A;  2DT9 A;  3HKW A;  2OGU A;  5ETL A;  1F5A A;  1RT4 B;  2M4M A;  2QRR A;  4QPT A;  1A7G E;  4XDD A;  2EXU A;  3TEH B;  4BCA A;  3OLB A;  4KO0 A;  1TU0 B;  3MGJ A;  3MPU B;  1HNI B;  1JJC B;  4NRT A;  1SQE A;  1MML A;  2FZC B;  2QA2 A;  4FPR A;  5EWE A;  2P6S A;  3E01 A;  5ETK A;  1EAY C;  5K20 B;  3D66 A;  2HBZ B;  4DX7 A;  5KFP A;  4X65 F;  1OY9 A;  4PXB A;  2K2P A;  4F26 A;  1Y5L B;  2U1A A;  4FYY B;  4X4Q A;  2HQD A;  1X4F A;  2Q66 A;  2FVR A;  3UDE A;  3BSO A;  4ZVO B;  4DUT A;  4OJH A;  3HSZ A;  4QWD A;  4RBT A;  2V8V A;  3Q8V A;  4FF3 A;  4ECU A;  4CH7 A;  4TLQ A;  2RE1 A;  3VVT A;  2DH8 A;  1WAC A;  3BN7 A;  1MWY A;  4TQS A;  5LMU F;  2P5V A;  4IFV A;  1IJF B;  4DCJ B;  5D3G B;  2Z2Z A;  2GA7 A;  1VLO A;  1BQM B;  1XJW B;  4F0H A;  5LT5 A;  1HNZ F;  4DCP B;  5G0R B;  1DZ5 A;  3VZH A;  1BUX A;  1CUL A;  4CO2 A;  1HMV B;  3N79 A;  1KOO A;  3LP2 B;  3N0V A;  2X1F A;  3UCZ P;  4X4T A;  5LSL A;  1YTY A;  1ELO A;  1JLB B;  3D0I E;  4DV3 F;  4IFY A;  4DDF A;  3M2U B;  1MG7 A;  5D4P A;  3GJR B;  1S1X B;  2RD5 C;  3KLF A;  4YHH F;  1NZ8 A;  2W7P A;  1QVG R;  1JK9 B;  4QW9 A;  1IKX B;  2HK2 A;  1KN6 A;  2UXD F;  3TVK A;  3J81 j;  2L08 A;  2DO4 A;  5C42 B;  2NXE A;  2G0C A;  1RCO B;  1Y3K A;  4ED8 A;  1M1H A;  1VI7 A;  4OX6 A;  2N7C A;  4DFK A;  1XMO F;  5J2N A;  2X3G A;  2BE2 B;  2A3J A;  2FC9 A;  2N4D A;  3D1Q A;  4LSZ B;  5HJY A;  3J7Z 5;  2VOD A;  1FJ7 A;  2JEF A;  1EKR A;  2AYM A;  1WI8 A;  3HD1 A;  2GMH A;  5CYJ A;  2BOP A;  4NAS A;  2YVS A;  1T0T V;  2QYG A;  2W1B A;  4KPC A;  3OUY A;  1HYS B;  3N01 A;  1MWZ A;  1JJ2 R;  4AD6 A;  1UW9 A;  3AOA A;  4O0N A;  1N4L A;  2BDP A;  5J2M A;  4QWE A;  3CJ4 A;  4C8K A;  2BKP A;  4GKK J;  4JI7 J;  1X7V A;  2MTL A;  1PC5 A;  2XUL A;  2BJE A;  4IFV B;  2ZD1 A;  3W5X A;  1T3N A;  4IQX A;  3IR6 B;  4CLS A;  5C24 B;  4R8U B;  4P9S A;  1CJK B;  1T9X A;  3HT0 A;  4JI2 F;  4BS2 A;  2V4J B;  4WKR A;  1D9F A;  3DLG B;  3GYG A;  3V5R A;  3EDR B;  4LRC A;  3LP2 A;  1S4F A;  2YWH A;  4GRS A;  2WSE C;  4NLU A;  3TWZ A;  4J9O A;  1UAW A;  2IC3 A;  2NLW A;  3BSN A;  1RBL A;  3BGF A;  3NGU A;  1HQU A;  3GG1 A;  3B6B A;  3MR5 A;  3UCG A;  1D3W A;  4PXD A;  5C25 A;  4OYM A;  2M7S A;  5KG1 A;  3JYT A;  5F9N A;  4LVO P;  4ZVQ B;  1QVF R;  1X5P A;  2E9T A;  2V8D A;  3DRR B;  4RW4 A;  4OLO A;  1FTR A;  2NPF A;  4QWA A;  3ENA A;  3LH2 S;  4JI6 J;  1VBK A;  3K59 A;  3GB0 A;  1U1L A;  1HQE A;  4DZD A;  1KQS R;  3H5S A;  3DOL A;  1S10 A;  1KVK A;  4H54 A;  5AJ3 F;  1EP4 A;  3S7R A;  4ZVP B;  3FRZ A;  4XIU A;  2IAJ A;  2LQ8 A;  4J9P A;  2VG5 A;  4WJB A;  1UFW A;  3ZZT A;  5DS7 A;  4Q43 A;  2Q79 A;  4QU7 A;  1FRM A;  3T1Y F;  5DDO C;  2CPI A;  4UY8 5;  1Y3J A;  3DU6 A;  1FVS A;  1FT8 A;  2VG6 A;  1CQM A;  1OJ4 A;  4DV4 J;  3I96 A;  3GU0 A;  5KT7 A;  1RAE B;  1SJ4 P;  2QMX A;  2QLW A;  4DR5 J;  2YX7 A;  4UF4 A;  2ROP A;  2W9B A;  3L7U A;  1CJK A;  4ZN3 A;  2HFZ A;  3T1H F;  2XCP A;  2HHU A;  2ATC B;  2RKI A;  1R0A A;  3MEC A;  4B9L A;  1SUQ B;  2IRX A;  1RHM B;  4AQY J;  2VUG A;  3ZO7 A;  4RJV A;  1EB0 A;  1S0M A;  3MI7 X;  2CNL B;  5IZH A;  2CAJ A;  2E5I A;  5KAK A;  5K8P A;  5CYQ B;  1VCT A;  2W7O A;  1V3S A;  1Q81 T;  4NRU A;  2H51 B;  3ITH B;  3W2V A;  3MPY A;  4QU6 A;  1S9E B;  2CYY A;  1CJV B;  4TQR A;  2KU7 A;  3KLG B;  4L6V 3;  3SQG A;  1GMU A;  4OJ3 A;  1TAQ A;  2VPZ B;  1X4B A;  4I56 A;  3C6U A;  2MY7 A;  2IYI A;  3CW2 C;  2WOM B;  1UP1 A;  1C4C A;  4ZCK A;  2AEM A;  3FZ2 A;  3R5B A;  3RW6 A;  2RDJ A;  2OUG A;  5ETN A;  2QL9 B;  5ETM A;  2HRY A;  2YWG A;  1V3R A;  3DYA B;  4IO1 A;  1QE1 A;  1MNE A;  1RT4 A;  4NOH A;  1WUU A;  3I6P A;  4JI7 F;  2WSC C;  1VRU B;  3EDQ B;  1HNI A;  2YPY A;  3EE3 A;  3LF0 A;  5D0R A;  3Q2S C;  3CF5 Q;  3CCW A;  2VG6 B;  1UZD A;  1T7P A;  2VON A;  2XMV A;  3MOJ B;  2ZNY A;  1FDN A;  3DOM A;  2B9Y A;  4KIA A;  1VQ5 S;  4WE1 A;  2OJ3 A;  4BDP A;  3VAH A;  1KWM A;  3MD1 A;  4IG3 A;  4WKY A;  3MMA B;  3KK3 B;  2UUC J;  2JLG A;  2G0J A;  2YTC A;  2H5J B;  3HUL A;  2PE8 A;  2ZIT A;  4NZ7 A;  1HWJ A;  4DOZ A;  5F8N A;  2CPH A;  3TZZ A;  1LNQ A;  2FJA B;  5HMW A;  4KRW A;  3NCR A;  1XNR F;  2RT3 A;  2HRT A;  4LF1 A;  3VAK A;  1RHK B;  3FBE A;  3UN5 A;  3BO2 A;  2DBB A;  2DHG A;  1TKX A;  2QC3 A;  3DXS X;  5CYQ A;  1PO6 A;  1S76 D;  4HT7 A;  2CQH A;  4WBF A;  5F8H A;  3OT9 A;  3M9O B;  2RQM A;  2YQ3 A;  3NBP B;  1NB7 A;  4XDC A;  4I67 A;  1FRK A;  1CS4 A;  5KFZ A;  2WVC A;  4DR4 J;  1TKZ B;  4MK9 A;  1XQI A;  5KFX A;  1UMJ A;  2GQ2 A;  2HHT A;  2YH1 A;  3GG0 A;  1DJ0 A;  2AEF A;  2BQU A;  3ENQ A;  4LBP A;  1QE1 B;  3LUY A;  1F1B B;  5B0F A;  5T41 A;  3GON A;  5L8R C;  4B9V A;  2NSB A;  3QRR A;  1HIY A;  1LWE A;  3IC1 A;  4DUY F;  2HHH F;  4W92 B;  2ALZ A;  2V4R A;  1KLM A;  3AD8 C;  2BE2 A;  4UQG A;  2V4Q A;  1AYE A;  1BQN B;  1PYO B;  2CJX B;  2CPX A;  2W01 A;  3CCT A;  3TOQ A;  4EO6 A;  3W2W A;  4QR2 A;  4AL7 A;  1WF1 A;  3D68 A;  4DPO A;  2VBZ A;  3KLI A;  2VIC A;  1U0H B;  3PKY A;  3PW5 A;  4JI1 J;  2E1A A;  4I7F A;  4X64 F;  2WBR A;  2IY5 B;  3J7A N;  2H1Y A;  1GTH A;  5KG5 A;  1Q16 B;  4F7V A;  5J2M B;  1MLA A;  3F0N A;  2VA2 A;  5A8R A;  4OQJ A;  4TNO A;  4EWT A;  2VQF F;  4K50 A;  1H2U X;  2PA3 A;  3BH7 B;  4ELU A;  4ZIW A;  3BM7 A;  1FI4 A;  4ELV A;  2HNY A;  1YJT A;  1S1T A;  5LL6 d;  4IO9 Q;  4A8Q A;  1ARO P;  4CLY A;  2HWH A;  2IC3 B;  1F9F A;  5HLF A;  1C1B B;  1O0P A;  3DLK A;  2Z2Y B;  4NL5 A;  5KFK A;  1QLN A;  2CQ4 A;  1RT5 B;  3QIP B;  2YNG B;  1MN7 A;  4IH5 A;  5LM7 E;  4UOC A;  2CPJ A;  1FKO B;  1OYE A;  2L9W A;  3TR5 A;  3H42 A;  4ILM A;  4EUV A;  2QTW A;  3OLA A;  5KFC A;  1R8P A;  4CLW A;  3JQK A;  4JI0 F;  3EPI A;  1UA0 A;  3BF4 A;  3M1V B;  1N6Q B;  3AXM A;  3H4B A;  1Y9O A;  1EQM A;  5F3Z A;  1QAX A;  2ZDO A;  3PJX A;  3MWB A;  1K47 A;  1Y5N B;  4OZ5 A;  1TL1 B;  5E3A A;  5DZ6 A;  3ZNJ 1;  5A76 A;  2FHK A;  2HUR A;  5IV3 A;  1RTD A;  4ED5 A;  3KLI B;  3SI8 A;  4FZV A;  3C16 A;  4ZIT A;  5JMN A;  2C2M B;  4PR6 A;  4ZLJ A;  1Q8K A;  2K7J A;  4OI0 A;  3BGO P;  3M05 A;  1XER A;  2HND A;  3ZFV A;  2ZH8 A;  3N6M A;  1GEH A;  2WK4 A;  2PD1 A;  3OXF A;  1RAI B;  4K4V A;  2V2K A;  4UT4 A;  5I3U B;  4TKT A;  2ZJR Q;  4C3K A;  1UVL A;  3BRE A;  3T5L A;  2J7K A;  5HAT A;  3UDC A;  2IA0 A;  5KFQ A;  2CQ3 A;  3CO0 P;  2YWW A;  2B6A B;  4EGL A;  1RT5 A;  2HFO A;  4U7U K;  2Z0G A;  3C15 B;  3M8Y A;  1FTC A;  3N28 A;  4IH7 A;  4OMF G;  3ZTS A;  1CJV A;  1FRI A;  2R3V A;  1W7W A;  2YKA A;  5K8M A;  4DSJ A;  1DQA A;  4CO3 A;  4CLT A;  4KHP J;  1SCJ B;  5KT4 A;  1IR1 A;  7FDR A;  2C2D A;  2FLP A;  4QJV A;  3BDE A;  3FVY A;  5KFS A;  4DX6 A;  3V81 B;  2GAH C;  2DNY A;  3GV7 B;  2ZOF A;  2VPX B;  3H90 A;  4O3O A;  2B5J A;  5GAH U;  1Y00 A;  4FYV B;  3BH6 B;  4JI5 J;  1T05 B;  3D3C J;  2CPZ A;  1TKT A;  2DNG A;  3QT6 A;  3P96 A;  5I42 B;  3QLH B;  5DDQ C;  2DHA A;  1UTA A;  4UW2 A;  4RUB A;  4L76 A;  5A8K B;  2V8H A;  3DOM B;  3MED B;  4WE1 B;  1GAO A;  2FJW A;  4FXW A;  3CCV S;  2NR0 A;  3DLB A;  5H1S V;  3BKF A;  2G0I A;  1FRX A;  2GFF A;  4WIQ A;  5LMU J;  4USI A;  3PVX A;  2DNK A;  2QN6 B;  4CWB A;  2DRA A;  3AOB A;  2WON A;  1RHQ B;  2RS8 A;  4K5R A;  4NEY A;  3HT3 A;  1H7W A;  3M8Q A;  2M9K A;  3CMQ A;  3NNC A;  1R43 A;  3TW0 A;  4PPZ A;  4NLO A;  2Z57 B;  3MFI A;  1KRP A;  2KFN A;  3MMJ A;  4MH8 A;  2PGC A;  4G1I A;  3RYL A;  4HHJ A;  4WP3 A;  1RU2 A;  1S99 A;  2XMW A;  4K5S A;  3SIP B;  2J0X A;  2VZ9 A;  2X3D A;  2CQB A;  4YR2 A;  2FLN A;  4ZMM A;  3KUG A;  2RS2 A;  3C3L A;  4LF4 F;  2HAF A;  4RBU A;  4LF6 J;  4ZVE A;  4NI2 A;  2Z2L A;  2BX6 A;  3US5 A;  3EGZ A;  4EYI B;  3RB0 A;  5KTQ A;  3UI3 A;  5AE2 A;  2HAI A;  1FD8 A;  2RSQ A;  1LWC B;  4BC7 A;  3RAM A;  5K8N A;  2J8A A;  3NP5 A;  4KGX B;  1F2H A;  1H6K X;  4PZV A;  1X60 A;  1A0O B;  2OPS B;  2OPR A;  3T5J A;  5B0E A;  2WW4 A;  1FRJ A;  3PR4 A;  1T05 A;  4X2B A;  3HF5 A;  3TUP A;  1EQ0 A;  3K89 A;  1F5C A;  4J9U E;  2C2N A;  4DSE A;  1KLM B;  3TZW A;  4EYH B;  2KL8 A;  4RR5 A;  2VFS A;  4C4W A;  4FF1 A;  2V68 A;  2XTJ P;  3IGV A;  2NZ4 A;  2BJ9 A;  1HL6 A;  1JLG B;  4U67 Q;  2GIF A;  2CQ2 A;  2OEK A;  1Y10 A;  3GE9 A;  4B9M A;  4U6P A;  3CJ2 A;  4K59 A;  1O8B A;  3MR3 A;  4DUZ J;  3PX0 A;  1C0T A;  2D3U A;  1ZTT A;  4QIF A;  3M9N B;  2QLJ B;  3NMR A;  2ZHA A;  2EFV A;  4DPX A;  4OHW A;  2YXL A;  4N8N A;  2NXJ A;  4DCO B;  4Q5V A;  3CDW A;  2FVC A;  2KN4 A;  3E8O A;  1J5O B;  2AKW B;  2NRE A;  4ZP8 A;  1K0T A;  1VGY A;  2ZOM A;  1GK8 A;  2J8S A;  5F8L A;  4X84 A;  3LP0 B;  2MXY A;  2DIT A;  2AV5 A;  2MKJ A;  3FSI A;  3L7P A;  2V2Z A;  4IG0 A;  2ZJP Q;  3PHT A;  1YRT A;  1OPI A;  3FSX A;  4O44 B;  4PG4 A;  5A8W B;  2IBK A;  1Q8B A;  4CLK A;  5HL7 Q;  2ZH3 A;  3I0S B;  5FDL A;  1YIT S;  1JWW A;  3MM5 A;  1AXQ A;  1FKP B;  1HNX J;  3R6G B;  5CH7 B;  2H4Y B;  3DRY A;  5HRO B;  4RU9 A;  5H9F K;  4GKJ J;  1FRH A;  1WJ9 A;  3MUV P;  3WHI A;  5J2P B;  3DM2 A;  3FEY B;  5E3Q A;  5I4M A;  1WHY A;  5IXU A;  1I94 J;  2DNH A;  1ZAW A;  2ASY A;  1TP7 A;  4XPE A;  4C3L A;  4KH0 B;  1VC0 A;  4KC5 A;  1OQ3 A;  3PEJ A;  3T1A A;  4F4Y A;  3KJV B; 
#chains in the Genus database with same CATH homology
 3VGS A;  3BBB A;  3DDI A;  3VVT A;  4ANE A;  3EE3 A;  3FBC A;  3ZTS A;  3Q89 A;  1W7W A;  1S57 A;  4HR2 A;  3VGV A;  3FCV A;  1BUX A;  3R9L A;  3EVW A;  1EHW A;  4C6A A;  3NGS A;  3EVO A;  4EK2 A;  3BH6 B;  2BEF A;  2DY9 A;  4AND A;  3Q8Y A;  3FBE A;  1S5Z A;  3FBB A;  3VGU A;  1WKK A;  4WBF A;  3JS9 A;  3DKD A;  1F3F A;  3MPD A;  1WKJ A;  1MN9 A;  2CWK A;  1B4S A;  3ZTQ A;  1VYA A;  1XQI A;  3WX8 A;  2HVD A;  3VVU A;  1XIQ A;  2B8Q A;  2DXE A;  4W98 A;  1NSP A;  1F6T A;  4KPC A;  2ZUA A;  3ELH A;  3ZTP A;  1WKL A;  1HIY A;  3EMT A;  4O0N A;  4FKX A;  3EIC A;  3NGR A;  3Q8U A;  4ENO A;  3G2X A;  5BXI A;  1K44 A;  2AZ3 A;  2BX6 A;  1NSQ A;  3NGU A;  3EJM A;  1NHK L;  3B6B A;  1NB2 A;  1LWX A;  4DZ6 A;  3FC9 A;  2DXF A;  3Q86 A;  3ZTO A;  3BH7 B;  1NDP A;  3ENA A;  4UOH A;  3EVM A;  3GP9 A;  5CAB A;  3BBC A;  3PRV A;  4S0M A;  1NUE A;  3FKB A;  1UCN A;  4UOF A;  3VGT A;  3EM1 A;  3BBF A;  1MN7 A;  2HVE A;  1HHQ A;  1S59 A;  3B54 A;  4F4A A;  4UOG A;  3ETM A;  5C7P A;  1B99 A;  1NDC A;  1HLW A;  1NDL A;  5CAA A;  3FCW A;  3L7U A;  3FBF A;  1NLK L;  3ZTR A;  2HUR A;  4FKY A;  3NGT A;  2VU5 A;  1ZS6 A;  4ANC A;  2AZ1 A;  2DXD A;  3GPA A;  1JXV A;  3PJ9 A;  1KDN A;  1NDK A;  1BHN A;  1LEO A;  1NCL A;  2B8P A;  1PKU A;  1PAE X;  4CP5 A;  4F36 A;  2NCK L;  2DYA A;  4DUT A;  1BE4 A;  1NPK A;  1U8W A;  3Q83 A;  4DI6 A;  3Q8V A;  1NSK L;  5IOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...