1NCLA

Thermal stability of hexameric and tetrameric nucleoside, diphosphate kinases
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAGGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Thermal stability of hexameric and tetrameric nucleoside diphosphate kinases. Effect of subunit interaction.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nclA00
3BH6B 3L7UA 2AZ3A 2HVEA 3Q8UA 3WX8A 4ANCA 3FBEA 1S5ZA 3EVMA 1UCNA 1NUEA 3BBBA 2BX6A 2DY9A 1U8WA 3BBCA 4CP5A 3NGTA 3VGTA 1VYAA 5CAAA 4ANEA 4UOHA 1HLWA 3ZTQA 4ENOA 4KPCA 2DYAA 3FBCA 4F36A 1NSPA 4EK2A 2HVDA 3ZTPA 2B8PA 2VU5A 1K44A 4DI6A 1EHWA 1BE4A 1MN7A 1BHNA 2BEFA 5CABA 4ANDA 1PAEX 2HURA 3VVTA 1F3FA 4DUTA 5C7PA 1NPKA 2DXDA 4WBFA 3B54A 3Q8YA 2DXFA 3Q8VA 1NDPA 1F6TA 1WKKA 2NCKL 3ELHA 1S57A 3VGVA 3G2XA 3MPDA 4FKXA 2DXEA 3GPAA 3FBFA 1NHKL 1HIYA 3JS9A 3FC9A 4O0NA 1NSKL 3EE3A 3Q89A 3PRVA 3BBFA 3DKDA 1MN9A 1S59A 3ZTRA 3FBBA 3Q83A 3R9LA 2CWKA 3EVWA 5IOLA 1LEOA 1XIQA 1HHQA 4FKYA 1W7WA 4C6AA 1B4SA 3EVOA 4DZ6A 1NSQA 3EM1A 1XQIA 4F4AA 1NDCA 3VGSA 1NCLA 4HR2A 1B99A 4UOGA 3ENAA 1LWXA 3VVUA 2AZ1A 1ZS6A 4UOFA 1PKUA 3EICA 3EJMA 2ZUAA 1NDLA 1KDNA 3ZTSA 3FCWA 3EMTA 3FKBA 5BXIA 3NGSA 1NLKL 3FCVA 3B6BA 3NGUA 3VGUA 2B8QA 1NB2A 3BH7B 3NGRA 3DDIA 3ZTOA 3GP9A 1WKJA 4W98A 3Q86A 1BUXA 1JXVA 1WKLA 3ETMA 3PJ9A 1NDKA 4S0MA
chains in the Genus database with same CATH superfamily
2YKAA 3MF5A 3IWXA 1L3SA 4MT1A 4DR7J 1JK9B 3BPDA 2WB4A 1IBLF 1RTDA 3M7VA 1ZBTA 1V6HA 3BN4A 2GC8A 1HNIA 3SFUA 5B08A 1UEKA 3S01A 3M8YA 5LJ3Y 2QO3A 1F5BA 4N8NA 2C3UA 4K4ZA 3GIMA 1FKAF 2HURA 3VVTA 2QL9B 4IO1A 2XYGB 3I0SB 2I1RA 2VBWA 2K1RB 1WUUA 2ACMA 3PX6A 4MKAA 2MKHA 4TVAB 3DGPA 2IDEA 2JSXA 1HNVA 1XR5A 2EC2A 4IR1A 5A8KB 4ECVA 2CVEA 2MQMA 2F40A 4DR6F 1SJRA 1S9GA 3CCZA 2FVCA 3HSDA 1SJ3P 2ZZNA 5G0RB 1HBOB 3LPEA 3ZXWA 4Q0BA 2WOMB 4DOZA 1JLAA 1ZPWX 2WONA 4XDDA 3W2VB 2MJUA 2DNLA 1RP5A 4QYRA 2RNEA 1GMWD 1WELA 4O44A 2GX8A 4WYLA 3GIRA 2OAUA 2A1BA 2M8HA 2LXUA 3D1QA 4RX6A 3DRPB 5ETNA 5F8IA 3H5UA 2J5AA 4DLEA 4DV3J 4CLFA 3ZNJ1 4LFBJ 4CNZA 4Q2LA 4WIIA 2EC0A 5CHCB 1IBMF 2GNKA 4IFVB 1LWEB 2CJXB 2OEMA 2B7BB 4MKVA 2IPOB 3C46A 3NOGA 2F63A 3MWBA 1C2PA 3I5AA 4YDDB 1JKHA 2H5EA 3ISND 2JZ5A 3MD1A 2K7JA 4LF4F 3T5KA 3PW4A 4K7QA 4D3GA 1R8HA 3TEHB 2LDIA 1YLXA 3HVAA 2FVPA 5J2PB 1NZ8A 3MM8B 3N5BA 4AL6A 1WKLA 5AJ3F 1VQ7S 1T8EA 2HLUA 3K5NA 3GZ7A 1VK8A 3M6UA 2QFJA 4B3RJ 1RTJA 4F4YA 1HBMA 2V68A 3C8YA 4ZCKA 3R2CJ 1OWXA 2U1AA 4Z7YA 2XMAA 1D8YA 2KXHA 1VIXA 2A18A 1EHWA 1K47A 2DK2A 2NXNA 2JLGA 4DUTA 3MEGA 2DXFA 4DR4J 4M5KA 4RW4A 2BJ8A 2G0CA 2OFHX 1MMNA 4OHXA 1Y10A 4ECYA 4KO0B 1H3DA 4A8KA 3PY8A 4X64J 2NXEA 3D66A 1CS4B 5E3AA 2ASJA 4RU2A 2MB0B 1HI1A 1MWZA 2HWIA 1AFJA 3OFHA 3ENAA 4UOFA 3EGVA 2E1AA 2EK6A 2HNYA 4UY8T 4H54A 2P9CA 4P73A 4B3MF 3QIDA 1RA6A 1YBUA 1RKJA 3TAPA 3IWNC 2YXLA 1GNKA 1GXLA 4RW9A 2CXEA 2ERRA 5DDQC 2GMHA 2MYFA 1NUEA 3K0JA 1HMVA 3G86A 4DX8H 1IQTA 4L74A 2PO4A 1N8RT 1BXNA 3I32A 3VAFA 4DR2J 1H7WA 1FK9A 2HZVA 3B54A 1L5UA 2BQRA 3IMQJ 2MQNA 3HHLA 1AZSA 3G9CA 2M8DB 4C11B 2MZQA 5KFFA 3MI7X 1HA1A 1UA0A 4A8OA 5JUMA 2VFUA 3OT9A 2FC8A 2MZ1A 4USJC 2WHOA 1FEEA 4QIGA 4NI2A 1VBZA 3C19A 4L3KA 4B3OB 3LO3A 1IBCB 2H51B 1ZAWA 4UUXA 3POTB 2G2ZA 3MMCB 1JXVA 4KR0B 4DQPA 5J2MA 3D68A 1S99A 4AQYF 3CCLS 2DGXA 2G2OA 3DRRA 2F1FA 1S1VB 4P71A 3OVBA 2CJ9A 4XDCA 1HFEL 3TVZA 3GFXA 2QZ8A 3TAMA 4X4QA 3G6VA 2X1FA 4C7QA 1X31C 2HQCA 2VA2A 3G96A 3IO1A 1Q82T 1RE1B 4YFUA 3OHAA 4NLDA 4LF8J 1XC9A 2H4YB 4J9LA 3EGNA 3UD5A 1WORA 4CLKA 1DTQB 4F02A 2JC1A 4CZCA 2KRRA 4DSKA 2V8PA 3K89A 2V2QA 1C0TA 3J80Y 2FJXA 1XIQA 4GKKF 3QATA 1A9NB 2GS8A 3L9ZA 2WW4A 4P9SA 3BSNA 3NL0A 5T7LA 2XSJB 4DR5F 2C2ZB 4HT5A 4DMZA 1R8AA 3IRXA 3RU0A 5H9FK 4M5IA 4QR2A 2ABYA 4ED5A 1O6XA 1U26A 1RZMA 3D2WA 4P7VA 3WIUA 2BACA 3D9BA 4DL6A 2GVZB 3VR1A 1P9YA 2M7SA 3SZ2A 5IWAF 1FNMA 2RKIB 3LP2A 1U1NA 2W4CA 2OJ3A 2A3JA 2BEFA 3H5SA 4F26A 4K5SA 4EBDA 1TL1A 2P2CB 4U7CA 3VGVA 2VDIA 1B7YB 3EE3A 4PG4A 5C24B 2XI2A 2GV1A 1YHQS 4TYAA 1SXLA 3G82B 5D0EA 4RW7A 4FN5A 1S1UB 1NO8A 3UVJA 2G0JA 3JB9k 2FLPA 3E2EA 4X4TA 2RQCA 1DLOA 1XQIA 1X4EA 4N47A 2E9ZA 1H73A 3BGRB 3EGWB 2CNOB 3CCSS 2QX0A 3KDNA 2PFFB 3LWMA 2P9GA 4G65A 4IOAQ 2NREA 4ECRA 1NKBA 5KFIA 4C97A 2ZJPQ 3CSKA 4NZ0A 3QRPA 3U27A 2G13A 1WC0A 5JMNA 4ZP8A 4NLOA 3SQGB 1RABB 3BBBA 4D3HA 4P74A 3CO9A 3PYEA 3CC4S 2YNHA 3SMZA 2GGPA 3JYTA 1FVSA 4JI6F 2H48B 3DLGB 1RTIA 3KWMA 1WEXA 3O8WA 1RU1A 3IR6B 1RA7A 4ECQA 1SJFA 1WACA 2H9ZA 5ETPA 2JFKA 3ILOA 4P2SA 3W9JA 4X4SA 1NHKL 4ZVOB 3HSGA 2CJAA 3RG6A 3AXMA 2V4JB 5A8WA 3GCXP 1J5EF 2RE1A 2C2KB 2D74B 4MTPA 2UXDJ 1WJ9A 2BJDA 5HMXA 2M5YA 1Z1ZA 5IC6B 1JMTA 2I9SA 2W9CB 2RB7A 4RNOA 2ATCB 3IR5B 1TFYA 2XCPA 1JLFA 4IDKB 2QE5A 2ZNZA 3I6PA 2JLEA 3I9ZA 3M8WA 4KKOA 2QT7A 3SCLE 5D0GA 3B6BA 4JI0F 1VBKA 3FQLA 1NHUA 5KTQA 3KG1A 4M5LA 1O0PA 4NLYA 4J9KA 4OIXA 2HG4A 2FVQA 1JLQA 3CW2C 3E51A 4QPXA 5C42A 4EGLA 2KT5A 5F3ZA 3PKMA 2AWZA 1F2HA 4FXVA 1KWMA 3HHLD 1RT5B 3DRYA 2ALZA 4NWBA 1D9DA 5DG8A 1PCAA 2ZWPA 4ZVPB 2WZ1A 1URRA 3QGIA 3M32B 3JSBA 1FX2A 3FC9A 4DL5A 2DR7A 1S49A 6FDRA 5KT4A 3G6ES 2ZUGA 4LF7F 2HYIB 2V94A 2LFVA 4QWAA 4V1Ak 1VQOS 2XS7A 3FZ2A 4ETZA 1P8GA 5BYRA 3W64A 1XR7A 3M6XA 5D0HA 2NXCA 3NGSA 4EI2A 3M30A 5F41A 5KT6A 3LWLA 5L1IA 2NYIA 4S0MA 2FGCA 4NL5A 3U1LA 3M2RA 3Q8UA 2FPHX 5HP1A 4FS1A 1ZZFA 3R8YA 3HFZB 1RT4A 1HL6A 4K59A 1R0BG 2UUWA 1XK8A 4QIFA 3VCDA 1UVIA 1VQSA 1Y7PA 4CLPA 1NKEA 1HNWJ 4FPRA 1T3OA 1T95A 3DRSB 3BSAA 2YWKA 4M5GA 4KH0B 1RAEB 2MKYA 1HYSB 3THPA 3ITHB 2MQLA 4RUCA 5A2QU 1AXQA 2HFNA 2EBGA 1MSWD 2HVZA 4X4UA 1VBXA 4ZPDA 3PW5A 3CCES 5KG4A 4X66F 2HRYA 5CCLA 2D7SA 2PMWA 4USMA 1G6BA 2IAJB 5IQ6A 4HDGA 4WTYA 1K1QA 2H5IB 3MEDB 2V9WA 2VG6A 1RACB 2MZJA 3HHLC 3LW5C 3BGLA 5DG9A 3MDFA 3TZXA 2QN6B 1YRXA 3GMGA 3UN5A 2ZH2A 2UUAF 4I0WA 1K0VA 2DR5A 1PC5A 2EFVA 5K14B 3QGGA 1QUPA 3VAHA 2O67A 2ZNYA 4ZDNA 5J2QA 4A8XA 1S10A 1YJUA 2NYHA 2YWEA 3CJTA 3BQ2A 3TJ9A 4WFBQ 4DFJA 3SCKE 2LXFA 1H2UX 2BQUA 2R42A 1TL5A 3NRBA 3CMAS 1S6PA 1BE4A 5SZTA 4ALZA 4F3QA 2DJWA 4DUZF 5H9EJ 4DCJB 4CQ1A 1TQLA 2VICA 3NGKA 1HI0P 3PW7A 4YDXA 2DEJA 1S9EA 1SIWB 2OIHA 3EPGA 2VIHA 1JLGA 2XQCA 3NY0A 1NSQA 1ZAXA 3TOQA 2WSFC 2HHXA 4QYZJ 2HZCA 3GU0A 1D1UA 2VFRA 4CLWA 5LMUJ 4CO5A 1RT1B 5B0CA 2V4RA 5LM7E 3HVTA 1UL3A 2MZSA 3WBZA 1YJWS 4O4GA 3NCPA 1N5VA 5J1PA 4OHZA 1RWVB 3BZQA 4ZLJA 3I56S 3IWLA 5A0YA 4FYXB 4OZ2A 1LW2A 1HW9A 3J81Y 5D4NA 3WC0A 3CO0P 2CQBA 2HQFA 4WCEQ 2VG5B 3GYNA 4ANDA 2IDLA 3FEYB 4P7TA 1HBUB 4K4WA 4CO0A 4OI0A 2X7IA 3HMJG 2W8LA 3MTKA 4Z7CA 4PYAA 3R9LA 3EDQB 5IV3A 2E7XA 2YTCA 1NH7A 1GMVA 2BBEA 3K58A 1FCAA 3JQKA 2B4VA 1M5SA 3NOCA 1JLCA 2DH8A 1N5YA 2YWGA 1R0AA 4F7VA 2OD4A 4X62F 4HTJA 1RHMB 1HHTP 3QT5A 5K9FA 3H0PA 3VAIA 4DF4A 4HACB 2R7UA 4RJVA 2UZAA 4AXIA 4YUDA 1QVGR 2D41A 3OTBA 3MTJA 2DNQA 2K2PA 1AA1B 2HNZB 2UU9F 3DC2A 2YX7A 2WVDA 1RXOB 3MHYA 3GFZA 1YBTA 1P1LA 4DR3J 1T05B 1Q8BA 2K3IA 4ED2A 2HS4A 3QIPB 4NRUA 1TFWA 2D3ZA 4F4KA 1J5OA 4I2PB 4ED8A 4Y00A 3AODA 4F25A 1RAIB 3T1YF 3DLLQ 2R2RA 1J2VA 3RB0A 4JI7F 1C4CA 3IBWA 3AQPA 1SH3A 1RBOB 3H2VE 5D6GA 2QL7B 4F0MA 3AAWB 3ZZUA 1Y5NB 4ZVQB 4ZLPA 5HVGA 1PKUA 1CVJA 4CO4A 5KFAA 2DHAA 3QRRA 4DG1A 1BMQB 2OFGX 3V6DB 3QGPA 2B9XA 2J0WA 2XGPA 2IC3A 1XWLA 1KNZA 1U02A 2Q3PA 3DFEA 5HK4A 3TI0A 1TTHB 3F0NA 2W2NP 2JJ4D 2AEJA 4ZP6A 3HK2A 5CAAA 2FY8A 1KLMB 5CA5A 2JEFA 1HNZF 1BWEA 4GMKA 2HBZB 1OY9A 4KTQA 1FERA 4P10A 3ETOA 3EWGA 1S0NA 3NS5A 1NM2A 3DU5A 4KFBB 3J7YU 3QSYB 3IXQA 1RU2A 2KT2A 2DH7A 1SQEA 3LPYA 3QPIA 4N41A 2R2TA 2ZD1B 4NCAA 4LFAJ 1WTFA 2N7CA 3B4MA 1TL4A 2CA9A 2V50A 1TL3B 3TO8A 2MMYA 4RW8A 3BKFA 4I6YA 3QLHB 2AP6A 3GSDA 4CYUA 4DSIA 1CJKB 5BR8F 4B3SJ 1YTYA 1T0TV 2DNOA 1PYTA 5J2NB 8AT1B 6FD1A 3LP0A 1S97A 4ZVUB 3CVKA 2C3MA 4WYWA 4DV6F 3V6KA 4RPFA 3KLFA 2BKPA 3AA8A 1GMUA 2ASDA 2ZJQQ 2AD9A 3R5GA 2LEAA 5HQ8A 2MEWA 2W24A 1R43A 3D6HB 3J7YI 2HK2A 4HI1A 4U6PA 3JQJA 1W2BR 2DR8A 2KJWA 3CT9A 1WHVA 2IJNA 4CH7A 4YR3A 1UPPA 2C2OB 3J7Z5 3R1HA 2GQCA 1M0SA 3T5LA 1OSCA 4M1KA 3E8OA 3KLIB 2J6UA 2HHWA 3DGVA 2QFIA 4FP9A 4MKBA 4JI2F 4QOTA 1OS5A 1Q78A 3A8IA 1FJGJ 2XI3A 1IM6A 2ATLA 2KFNA 5KOXA 4OYMA 2R3VA 4KGVB 1OY6A 2POKA 2DNZA 3KHGA 4KGZB 1RYSA 3MPVA 2YKNA 3V6JA 1FWPA 1Y5IB 1QE1B 1NJZA 1CJVA 1FKOA 1WEYA 2HZAA 4W98A 1AYEA 4ICLB 3CTRA 2EXUA 3W61A 4A46A 4JV5F 3M8PA 5E3RA 3MOJB 2UUTA 4OHWA 4IO9Q 3J7A1 4K2JA 2R7RA 3GIIA 1T9WA 3M8QA 4JI3J 1RHJB 1YK9A 4R5PB 4OZ5A 5DLFA 2PA8D 3FRZA 3PEJA 1U1PA 5E3CA 4WXWA 3BM7A 3O3LA 4M94A 2HHHJ 2OPPA 4K4TA 1IKVB 3BO4A 2UVUA 1GK8A 4OMFG 3KJVB 2AHOB 5BJRA 2L08A 3I4PA 4MK9A 1M5PC 4GKJJ 3SXLA 3R1LA 5ETTA 1DFDA 4NCGB 4PKDB 1BD6A 3GFHA 5I42B 3RB6A 1XMQJ 2DGWA 4M5DB 1S1TB 5IFMA 1ZAVA 1NJWA 5HAOA 3TRGA 2IM3A 4ZLLA 4ECZA 4NRTA 1U49A 3PR4A 1T9TA 3LALA 1TUVA 3R2DJ 1QSSA 3PZPA 5LMNF 2C42A 2HVEA 4K8RA 2LQ8A 2CVIA 4O3QA 1XMOJ 4GC7A 1VR6A 2GO8A 3P8BB 1C0UA 1RWNB 2RDJA 2VPZB 1M5HA 3DLEA 1UKUA 4KAIA 2RS2A 3DM2A 4DSFA 2ROPA 1T9UA 3A1YG 2ZBPA 2B9WA 2ZVIA 4FVMA 2ZH9A 3Q2TC 1EKSA 1HWLA 3TQEA 4DSJA 4PG6A 1DRZA 3OV7A 3CJ8A 2BJEA 4ATNA 3A8KA 4HHHA 1AB8A 3X1LB 1NSAA 4NLTA 2YVSA 1OMSA 3GYGA 3KG0A 3K5PA 1Q81T 3M05A 2AW0A 1WD6A 2Q79A 3NBPA 3FEZA 2CKWA 4RWWA 1BQNA 1JNRB 3HFKA 4ILMA 4CLLA 1X9WA 4AUKA 3PO4A 4K4UA 4OHYA 1HNXJ 3CJ5A 2BZ2A 1HQUA 2CQ2A 4CP5A 1QDUB 4DSLA 4DS4A 2P9EA 5KFXA 2PE8A 1X0FA 3OVAA 5KG5A 1PYSB 1NMEB 2A2CA 4HHJA 1R6YA 2LCWA 3HJVA 1C1CA 1JLEA 4YY3F 3PFEA 3T5HA 3C66A 2LYVA 1NSKL 3SQOP 1EB0A 2FHJA 2HNDB 2VUGA 1S59A 4X2BA 4H4MA 2JEJA 1D9AA 3IFEA 2EVZA 3MPWA 1Y3KA 2J9DE 2RQ4A 4JI1J 4ZVEA 3MM9A 5F0UA 1AUDA 1DY3A 2RQMA 2L9NA 3KK1A 3NS7B 4LBIA 3WZ0A 3EJMA 2R8HA 3T41A 3ZTSA 5CXTA 5HLFA 2MGZB 3P45B 4M5HA 2MHEA 4UTGA 4C2MA 1FJEB 2J6TA 4E0DA 3DMJA 2BVZA 3D0IE 1NK5A 2CQ4A 1CULA 3HD1A 2GJIA 4LRBA 2MY8A 1RKIA 2M4MA 2XULA 3KK2A 1HHSA 1Z2LA 2PSZA 1D3WA 2L48A 4ECSA 3IGNA 4X84A 4MIBA 4OI6A 1N6QB 4V19J 3R7BB 3VAGA 3KLGB 4TXSA 2Z4PA 2GIRA 4RKUC 3ILIA 2AJ4A 3AA9A 1H2TZ 5HBMA 2FGOA 3BV8A 4LUBA 1VRTB 4ZCLA 1VQPS 2JVOA 2RJZA 1L3TA 3UPFA 4RU9A 2DCUB 4J9NA 5L1KA 3P6YC 2C2NA 1JLBB 4DV2F 2AYBA 2W9BB 4F3OA 4Q5VA 4C4WA 5EN1A 1DZ5A 2WCXA 3I0SA 2KYXA 3PW2A 3K2YA 3PACA 4DU8A 4URSA 2R8JA 1LFPA 2E9TA 3EX7B 1FWKA 3QJJA 1F9FA 4AD6A 1UW4A 5DRKA 1BQXA 3MMAB 4YP3A 5DQHA 5ITHA 1PC4A 4A8SA 2DY9A 3GQCA 2OPQB 4HH0A 5G0RA 1HBOA 2ZM6F 2XB2D 2V69A 2WOMA 1KQGB 5I3PA 5CCMA 2V63A 3ISZA 4RNHA 2IMOA 9RUBA 1IBMJ 1M90T 4ELVA 2E5LF 4RR5A 3W2VA 4I64A 4HTIA 2CQ0A 2ZOMA 4DEZA 3Q8VA 1RWXB 1WKKA 2ZH3A 1KSPA 4IR9A 5DGBA 5H9FJ 2MLXA 4CIOA 4O0NA 1X9MA 4XIUA 1MROB 3ILLA 1H2VZ 1WDTA 3MEEB 3DRPA 2NZCA 3L09A 4JYAF 4LF4J 2EG2A 4OZ1A 3MPYA 4LSLB 2HWHA 4F4AA 4WK3A 1Z4UA 4HLBA 2MQOA 4JV1A 1FRLA 4QIEA 1VLOA 4IFVA 1LWEA 4UT4A 1NU4A 5T41A 4DL4A 2CPFA 4OYXA 1RK8A 1WHWA 2FHKA 1SC4B 2ZE2B 1UJ5A 1S12A 4O0IA 2LA4A 1CJTB 5F8NA 4RBVA 1N5QA 4V19X 2DGQA 2Q6BA 2C2MB 3TYTA 3MM8A 3UDVA 3U1MA 4B08A 2DHHA 5THWA 4E2FB 4QWEA 3FEXB 3AB4B 3UCGA 1SQFA 3GONA 4G1QB 4JI4F 1F6TA 2J9EA 2DGSA 2LA6A 2HFUA 4C8YA 2BM0A 4Q8FA 5F8LA 1XNRF 1KVIA 4KGXB 3BO2A 3GR0A 2EKNA 5G4DA 3ENQA 1X9SA 4ZCMA 3W66A 4URGA 1ACMB 4KO0A 1N88A 4F2RA 2OMLA 2HHQA 3W2WB 4C8MA 1IJEB 1CS4A 4F0KA 3HCXA 2QYCA 5CD4A 4DX7A 2V2VA 1HQEB 3KTQA 2QGFB 2RDIA 3OTDA 4LF5J 4LFCF 5EWGA 3VF0B 1N0UA 4I6AA 4KY3A 3VV2B 5D78A 1GX6A 1IBKJ 2AJFE 5KFBA 1YGYA 3AJ2A 4I4BA 2XO6A 1K73T 3MOZA 2RH3A 2YY3A 5IV4A 4OV1A 1SV5B 3SV3A 3FSIA 2QSWA 3HLUA 2IYGA 5KOWA 4ELUA 2R7XA 2E9RX 2YKPA 4CWBA 4HYKA 3SDEB 3C16A 2AEFA 4NOHA 4XPEA 4CTAB 1OPIA 3ULHA 4YB7A 5F9LA 3N6MA 2V6AA 2QA4S 1U09A 1H38A 3E01B 2OSQA 3BPSP 1LNQA 1T9XA 2MLYA 4OYIA 4WE1A 5KFEA 4PUOB 3CJKB 4C11A 1NLKL 1JLAB 4AQYJ 2WONB 2BJ3A 5L38A 3SV4A 4O4RA 3HKZD 3T6BA 1UW9A 2DHXA 2B4OA 4GO5X 1VQ8S 5IQQA 3ZO7A 1OYDA 3R27A 1PBAA 2HBYB 5CYQB 1APSA 4EO6A 4CH1A 4C3KA 1VJWA 2KU7A 3MMCA 3LQVA 1Q8KA 3ZZTA 3DHWC 4KC5A 1NJYA 1PO6A 2XMTA 4RW6B 1S1VA 5F0WA 3BDEA 1QVFR 3RBDA 2H1YA 4WU3A 4DR5J 3NGDA 3RRHA 2EFNA 4DV3F 4WU2A 3PJXA 1WSVA 3THVA 1DTQA 4J9RA 2DRDA 4K2XA 1S0OA 3EPIA 1VC5A 4LSNB 2RHQB 3ETMA 5HL7Q 3UD3P 3NMAA 2KFYA 1HBMB 4J9VA 3DLHA 2XSJA 3P96A 5IT9Y 2EPIA 2N3LA 3T5JA 2CG8A 2AYGA 1X5SA 2HAFA 2ADBA 1WC5A 3C6UB 1T94A 2XGQA 5IZHA 4AE5A 5K8OA 5LJ5Y 3TZYA 2QA4G 3JXOA 2MQPA 5GADU 3TX8A 2KHDA 2ZBCA 1FRHA 4ECWA 3H25A 4M8LA 5BYQA 1MMDA 4A8WA 1VQ6S 2XZWA 4XO0A 2VA3A 2GJ2A 2FJDB 3M4XA 3KFWX 2CNKB 4B3RF 1D09B 3TVYA 4F50A 2RKIA 4PG5A 1FE4A 1T11A 2E5IA 1B7FA 2HAIA 2QLBB 4DZ6A 3LTOA 3TZWA 2CPJA 1JXEA 4HT7A 3MZIA 4OI1A 4DR4F 2MSSA 1AT1B 3BGFA 5C24A 1X4GA 3OFGA 3G82A 1VFJA 5F8GA 4MKYA 1KONA 4X64F 3IG1B 1S1UA 2WSEC 3NLCA 2C28A 1IKWA 5L46A 3KNGA 4FYWB 2R8IA 4PPZA 1F5AA 3OSNA 3BGRA 3M2UB 1R27B 1ZM2A 2MTLA 3GV5B 3G8QA 4TNOA 5GADI 3BN7A 5B0EA 4LRDA 4DHVA 4Y2AA 3R7NB 1RAAB 1WC6A 1L3VA 5D4PA 2J0SD 3OJUA 1YZ7A 3AFGA 2QV6A 1RT7B 3SQGA 4JI8F 4CLSA 3V2UC 1TU0B 3VZHA 2BE2B 4DV4J 1S4EA 3CJSA 4YS2A 3DLGA 2GFFA 1HKAA 1VISA 1ULRA 3MM6B 2VBZA 3PR5B 1F5CA 4X4NA 2E44A 3H8YA 2XLJA 4JI0J 3R6GB 2MJNA 2ZBIA 4N56A 2V4JA 1YVFA 4UZCA 5KT7A 4PAAA 3B8HA 3I0RA 2V8DA 1N48A 2I2YA 1D0EA 1T02A 1N5TA 2W9CA 4ZVSB 4P52A 2K8GA 4IDKA 3LGHA 4QIWD 4CO2A 2FIUA 3I4HX 4IOBA 3RAQA 3O44A 1R31A 3CD6S 2EFOA 2EBEA 2NUHA 1KEKA 2AGOA 2RU3A 1RBLA 3G2XA 2VQFJ 3GFYA 4LF7J 4ZN1A 2FZCB 1FFSB 2RUGA 3AT1B 2R7VA 1RAHB 2Z56B 5KFNA 3UNYA 5T7LB 2A2DA 1R8CA 9ATCB 2LEBA 1TK5A 4PXBA 5JJBA 1U47A 5D0RA 2GIQA 1R89A 4IQMA 4Y28C 5KT2A 1I5OB 2CPXA 1QTNB 3NEKA 2V5HG 4C3LA 2KZZA 3DLKB 4QQBA 2ADCA 3TUIC 3V81A 2OELA 2R7TA 2IY5B 4UQGA 2L3MA 3ZZ0A 5HROB 4GVBB 2VONA 4USTA 5FDLB 2BANB 4A4JA 3AB2B 2ZFHA 1RHKB 1UAWA 4O23A 1ZM3A 4XPCA 2GCFA 3DHXA 1QJHA 4DQQA 3MUVP 2HVIA 4ILRA 4X66J 2J7WA 2NZ4A 2Y1LB 1RQ0A 4F4XA 2D3UA 3DKDA 4OJ1A 1EX8A 2FLLA 2E7WA 3OTCA 3VZIA 1VQNS 4C8LA 1PAUB 4DWIA 1SBRA 1M5OC 3HP6A 4YR0A 3DRSA 3GYXB 1WF0A 1NAQA 1PYOB 3MMJA 3D67A 5KFZA 2UUAJ 2WK4A 1OO0B 1IKYB 1HYSA 4ED3A 4HI2A 2IBOA 1Q1KA 3PJWA 3RR8A 5B0BA 1U1KA 1S1XB 4OYOA 2MKSA 4TU7A 1PBUA 2IAJA 1YJNS 4EO8A 1YJ7A 3MEDA 3EVMA 1EIYB 1ZA2B 1N4LA 1OYEA 3ICLA 1FNXH 5EHHA 2YKOA 2CZVC 5K14A 5IT9U 1EARA 3BR8A 3U02A 1BHNA 2P8IA 2HQDA 4FF3A 1HWUA 4OLPA 1HR0J 2Y8WA 2XMVA 4BDPA 3IR7B 4IRCA 2R8KA 1UVKA 3W9HA 2NCKL 3FGVA 1NB7A 4AL5A 2IRXA 4FVCA 3TARA 2CDRB 2VQEJ 1DTTB 1N34J 2QTWA 2VC0A 2LU2A 3MM7B 5D8HB 3WC2A 2ACYA 3ET6B 1DAXA 2Z2ZA 5LSRA 4KKOB 4JP8A 4CI0B 1LXJA 1FD2A 3LANA 4A8MP 3FFIB 4IG0B 5KT5A 1DQ9A 2CG4A 3QT7A 4WP3A 2LQ5A 1ZTTA 2DVIA 3UN3A 2HHVA 1KQFB 2X3GA 4USIA 1S5ZA 4HDHA 5C42B 2FZGB 2RS8A 4DV1F 1C4AA 2J0QD 5F8JA 2GHVC 3WDOA 2J0XA 1RT1A 2AJ0A 4Y2MA 2ASYA 1PG5B 3I55S 1NBEB 1RT2B 2A0FB 2DNHA 3ZZRA 3W5ZA 3EZ5A 3W9IA 2HVDA 4NMXA 5KFPA 3W60A 4UOCA 1PAEX 3H4BA 2G2YA 4NX9A 3T6JA 2UXCJ 2ZHOA 2FJAB 4DLGA 4TN2A 4O3RA 2C3OA 1U0SA 2VODA 3SBMA 1WF1A 4ID5B 4PXDA 3HHDA 3OLAA 3FSXA 2QSFA 2ASLA 4ZVRB 2ROEA 5IT0A 5EDWA 3DRXA 5ETVA 1S0MA 3OQ2A 2VG5A 1NZAA 1TKXB 4C6AA 3D3BJ 3EM1A 2GVDA 1NDCA 4NLPA 2JL9A 3MR5A 4NYPA 4Q45A 4O3OA 4YB1P 3J7AN 3MFHA 3FCWA 2NR0A 5CYMB 1ROFA 3BH7B 3M6VA 4ES3A 3QNWB 1YKWA 5EUHA 1VC6A 4RWXA 4B9UA 2E1MC 4LSZB 4IFYB 3UDLA 5GAGI 2XO7A 4IKAA 3ZTQA 4YMEA 2OEJA 3T3FA 2A6MA 2UVVA 4EMDA 1WSRA 4HACA 1UP1A 3IP0A 3NWRA 2DXDA 2Z58B 3UO0A 4WF9Q 2GMLA 3TVKA 2HNZA 1SB6A 4OV6A 3CD7A 2B6AB 3RBZA 3W63A 3FBBA 2VFVA 5E5NA 4TQSA 3A3OB 1FDDA 1T05A 1K0TA 3LAMA 3R5JB 1HBNB 4ILLA 3QIPA 3OL6A 2B9YA 3PCOB 4UF4A 4ZK7M 3V4IB 4NA3A 2MKKA 4I2PA 3R5AA 1VRUA 4Q2MA 3K5MA 4OZ3A 2B3TB 2LMIA 4F0HA 1OY8A 4J9PA 3MR2A 4ZJOA 3P5BP 1RDRA 4OZLA 4W90B 3OW2R 3CCMS 4GO7X 1DARA 1HNZJ 1R6VA 1KR4A 2COLA 1JJHA 1LWFA 3NMRA 1S6PB 5ETKA 1H7XA 3FVYA 1UFLA 4DCPB 4JI5J 3TWZA 5CABA 2Z0GA 1X5TA 3NAIA 3W8PA 2XBPA 1VOMA 1QUVA 1LK7A 1S9EB 3I82A 1GXTA 2ZC4A 3W3SA 2CJYB 1KLMA 1YI2S 1RAJA 4DUYJ 3BSCA 5AXNA 3C2PA 2R2UA 1KVKA 1TVRB 5J1EB 2GJFA 2YWFA 4TKTA 1B99A 4WFNQ 4MIAA 3GG0A 3B78A 4ZVFA 1PIEA 4PQUB 5LSOA 5I3UB 3FKBA 2AEMA 2VFTA 3NGRA 2NSCA 3IAM9 3QSIA 1UFKA 3RB3A 2ZD1A 3BH6B 1GH8A 2P6SA 1TL3A 3QLHA 2B4UA 3BS9A 1TV6B 1CJKA 1I94J 4HL9A 1SJQA 5FIIA 5KFVA 1VQYA 1LWCB 4WTOB 1Y5LB 4DPUA 2ZOFA 2HBQB 1NK4A 5J2NA 1LW0B 1RHRB 1RT3A 3MECB 4G6VB 1HW8A 2BW7A 4ETXA 1S1WB 2KT3A 1A0OB 4ID8A 1YIJS 5E2QA 2DIUA 2Z2MA 2NXJA 3GILA 1HIYA 2PIIA 3PRVA 3TR5A 4CH0S 4NLGA 2R9LA 1MU2B 3GJRB 3LF0A 1TMJA 1ZYQA 3OXGA 4NZ7A 2HSEB 4Y3CA 4ZOSA 2KJVA 4A8FA 2YH0A 3KLIA 4PZVA 4K0KJ 2CJBA 2C3PA 3I5BA 1YSJA 3L7PA 2V8VA 2X1AA 3RJMB 3O6QA 4JV5J 1E6YB 1S6OA 1IQZA 3IS9B 3F44A 1RISA 1Y3JA 3CDUA 1YJ9S 4TY8B 2ZOGA 3TJ8A 3KHLA 2CNNB 3CC7S 4E98A 3F41A 5A2QY 2R7OA 3DOLB 3OTOJ 3RW6A 1U1OA 2N4CA 1XTZA 2ZH4A 1Q95G 4DFPA 2WBMA 3LUYA 2YNIB 4YR2A 3QMQA 2CNLB 3WX4A 1KTQA 2WVCA 1N33F 4M5NA 2XYPB 1S48A 4CLUA 4ICLA 3PG9A 1TK0A 3BSOA 1NDPA 4MFBB 5C25B 4WFZA 3MPUB 3SIPB 1VBYA 2KI2A 3PYFA 4R5PA 2HQGA 4CT8A 3AHPA 2F8MA 5A76A 2IVYA 4PCQA 1B4SA 2OPRB 1QAXA 2FB0A 1P6TA 1IKVA 1IR2A 3HF5A 2RAQA 4ITSA 1UZHA 3H2UB 4C8OA 4OHVA 3MXHP 3RYLA 3KJVA 1X4AA 3CWJA 4ECXA 2HQIA 3CJQA 2J8AA 2E29A 5KFKA 1DQAA 1IWAA 1N56A 3NNAA 4NCGA 3SYZA 4WPAA 2LECA 2W4DA 5I42A 4ED0A 4M5DA 3MAQA 5JVGQ 1S1TA 1MW7A 5KFHA 2OHDA 1KRPA 4O3NA 2ILYA 3D7SB 2AU0A 2DCLA 1CJUB 2DR6A 4EK2A 2DITA 3GJQB 2GIFA 2VOOA 3NCQA 4LREA 4NLSA 1F3FA 2FUG9 1GFWB 3ZZYA 1E6VB 4OYPA 2MKCA 4OX8A 1NK8A 3OXFA 1KHVA 3CIMA 4EWTA 3ZNUA 1SVDA 3FCHA 3BKTA 4YHHF 2P5VA 2M52A 4R8UB 2DGVA 2M2BA 4ZIWA 3NNCA 1Q53A 3N6LA 1F2GA 3AOAA 4YOEA 3VHQA 3OR1B 4HR2A 3M6WA 1FNOA 3R5DA 1G4CA 2CWXA 2F8EX 1MWYA 4OYAA 1S6QB 3R6LB 3RR7A 3QT6A 2HHTA 1B70B 2XC9A 2JNJA 4C98A 4LFAF 4R25A 5H9EK 2P6TA 2A6OA 2HK3A 2QMWA 2VC1A 4OI2A 3W5XA 2I5JA 2GMJA 3RZAA 2DEIA 3AOCA 3P3DA 4B3SF 2X51A 2Z30B 2B8PA 4DI6A 4PR6A 3VAKA 2AF6A 1U2FA 5DGAA 4E8UA 2EFGA 1URNA 3MAAB 4QYZK 3V4MA 3HFVA 2R7QA 5DDOC 4WFXA 3MR3A 4W92B 3TA2A 2UUCJ 3OHBA 2OMOA 3KK3B 1FF2A 4CDIA 3PXGa 5HVFA 1TKZB 1AFIA 4PPDA 3WQPA 2YKMB 1S79A 2QLFB 1UEVA 1S7IA 4B17A 4MMOA 1WTBA 2JX2A 1S9FA 3C3LA 4RBUA 3PW0A 3RB4A 2UXBJ 1T9VA 2J9DA 2H54B 2BRKA 2FQQB 1TUWA 2PC6A 2VF3A 2BKOA 1JB0C 2V34A 2I0XA 3HDSA 1TELA 1WKJA 4MIWA 2XCAA 3H98A 4ZVGA 2ZDPA 4ZIVA 2BUNA 2CFXA 3QWUA 1KS2A 4OYZA 3VAJA 1L3KA 3HXMA 2KZMA 2MGZA 2LLZA 3IRWP 2MQ8A 1QAIA 1U1MA 4KJIA 2CQ1A 3LP1B 1TL7B 1HARA 2O3DA 4I7FB 1FTRA 5L9NA 4OL8A 4PQAA 1M1KT 3GPAA 4DV2J 4OI3A 1T3NA 1GMWA 2XHCA 4BS2A 2SXLA 1N6QA 3NCRA 4DPTA 1VQLS 3KLHB 1WG5A 3Q83A 1CBKA 1LEOA 3AH6A 3KLGA 2KDOA 2DR9A 2EFPA 4QR1A 1PSDA 1Q16B 2AZ1A 1ZS6A 3RAXA 2MLZA 1JJ2R 3IA0A 4AYBD 1FESA 1NB2A 3ONQA 1MG7A 1JLBA 1GX5A 2W9BA 4KIAA 2CPHA 4GKJF 1FXRA 2R7WA 4KHRA 3D4JA 4QW8A 4H4OB 1CQMA 4ZVTB 3GWCA 4GC6A 4USWA 1VRQC 1XMQF 2E66A 2V4QA 1NK7A 3JSMB 3H4DA 4F36A 2UV8A 2A10A 2AT1B 2LKZA 3MMAA 2NLWA 1RCXB 3GCWP 3MM5B 3OR2B 3LOUA 4FDFA 4JYAJ 1YJVA 2HGMA 3FBFA 1SC6A 4DPWA 4QZVB 3JTOA 4N76A 1XMOF 1VLYA 4NLUA 4WP9A 4Q7AA 2OI2A 1TZ0A 4KV8B 3T9NA 4FXDA 4JUZA 4Z37A 2M3DA 1SUQB 1NDLA 1KDNA 2RSQA 4NYOA 3QZ8A 1MROA 3QAUA 5DZ7A 3MEEA 2KO1A 3OBIA 1Y11A 3HJFA 2W2QP 3PNIA 3BQ0A 3UI3A 4LSLA 1AW0A 1WDDA 2Q66A 2L9WA 3HSZA 1FRXA 5HJYA 1UVJA 1KC8T 4C9DA 4A8QA 2M88A 5KG1A 1JLEB 2ZE2A 4OX6A 2RVJA 5E41A 2HMIB 5E33A 2RRNA 4WWSA 1HNXF 4OX7A 1XNRJ 4IG3A 3U7JA 4H4MB 4NEZA 2KRBA 2J6SA 4WFYA 1UVMA 3ZTRA 2M70A 3DOMB 3QQCD 1S0VA 2V2ZA 1ZA1B 4CM0A 4FKYA 2ZZMA 1N32J 1CG2A 3KK1B 3AD7C 2JDJA 1O51A 2Y0SD 5B0GA 4NXMJ 3AQOA 5GMDA 4CRJA 4ZP7A 3RRGA 4K5RA 1K9MT 1UWBB 3PX0A 1FHTA 5L1LA 5B09A 3DMJB 4B3TF 2ZDOA 4JV0A 4G1PA 1JWWA 1CULB 4LR7A 1VQ9S 3CCUS 2YX1A 3DCAA 3GG1A 5ETOA 3S6EA 1SL0A 3C6TB 4J91A 2BA9A 3D6TB 3OUYB 1MNEA 1Q4RA 3VQSA 2RUSA 1OIAA 1JJCB 3BQ1A 3EUNA 3W2WA 5F9NA 2YX4A 2VG7B 2XSFA 5HBMB 1NKCA 2KTQA 5GMEA 1HQEA 3D1OA 3CE8A 3DYAB 2ZH5A 4Y2KA 2XY7A 4NZ6A 3M8RA 2MPUA 2OPSB 1KBRA 4LRFA 3PM9A 2AQ4A 1F9EB 3KUHA 3RGIA 2EKYA 2JWNA 2FC9A 5FLXY 2PT0A 3UN2A 3CJRA 2DY1A 3ZZZA 1SV5A 2ALYB 4I2QA 3TUJC 4PABA 3CC2S 4J9OA 4KGKA 3HT3A 4ZKAA 3UW1A 1U8SA 3SDEA 2UVRA 3GSIA 2G1HA 4CTAA 5IT4A 2XG8A 2KG1A 3A8EA 2AJ1A 4FNIA 2W9AA 2RRAA 2KHCA 1MWQA 3E01A 2MKIA 2AV5A 1T7PA 1X5OA 4PUOA 4KH1B 3GJTB 3CJKA 4TU9A 2KH9A 2OTLS 1X4HA 1VQMS 3JAMU 2UV8G 5CH7B 2OGUA 4KHPJ 3PRBA 2WB1D 2Y1RI 2C22A 2W8KA 3ELHA 2HFOA 2F5GA 2QA1A 2E5GA 4Y2IA 1QSYA 5CYQA 2ZBQA 1U6BA 1XNQJ 3QJLA 4NLQA 2MDAA 3HX9A 5IM0A 5KG2A 2CADA 2YQ0A 2ZKTA 4EBEA 3P49B 2JLFA 1AROP 3N0VA 1YRUA 4RW6A 2BW2A 2DD8S 4MK8A 3FJ2A 3M8SA 2K06A 4ERDA 1REVB 1FO1A 3EMTA 2IM1A 5BXIA 3GP9A 3H2LA 2BJ1A 3CNQP 2YQ1A 3O2IA 3ZFVA 1P1TA 1H6KX 3HT0A 4IH5A 2GHWA 4F3MA 2D3OR 3H7HB 1TKTB 1HLWA 3CMES 4LSNA 1NSPA 5F8HA 4RO0A 1HWIA 2L41A 2MZRA 3T1HJ 2Q1LA 4DN9A 3FK4A 3IM9A 4QBUA 3K8VA 1HI8A 5U47A 1HWKA 2PI4A 2E1RA 2YQ3A 4NLWA 3C14B 1KOHA 4QWDA 2IYIA 4ZMMA 2F4VJ 4HEA9 4TY9A 4DPOA 7FDRA 2G1DA 1RBAA 2X3DA 3C6UA 3R3TA 3EVWA 2KXNB 4CLYA 5EWFA 1CPZA 1WHXA 3Q22A 1NK0A 3BREA 2QJ3A 2Q43A 4X65F 3GIJA 2YNGB 3DDNA 3Q2SC 4AFFA 3CEDA 4OZ0A 3TEGA 3V6HA 2E1PA 3SI8A 2E5HA 3PJ9A 1IN0A 4DL3A 3DOKB 5HN0A 2H5JB 4DXLA 2DRBA 3BJYA 5KG6A 1VGYA 2HGNA 2RILA 4DV7J 3H40A 3BBCA 4LQ9A 4KSEB 4DU7A 3Q23A 3PO5A 2XNQA 3DLJA 2LXIA 4JI8J 3IG1A 4WXOA 3K7RA 4HKQA 2CIMA 3K8WA 3M2UA 4LF5F 3ISNC 1SKSA 3MPDA 1KLNA 5A8RB 1IKXB 5KT3A 2AGPA 3JS9A 3C16B 2DNGA 1U25A 5L39A 4K4VA 3EDRB 1BQMA 3QWPA 1N36J 1IBKF 5KFCA 1Y9OA 3N28A 2OD6A 4F4WA 1FKPB 1EP4A 3LA0A 5HQMA 4HVZA 1FFGB 4XAKA 1S6UA 2E1CA 1RT7A 4WE1B 4F4ZA 4QWCA 1NXIA 3UWTA 1U1LA 4RZRA 2AGQA 5E3PA 1B64A 3PYGA 2BE2A 1J27A 1HPZB 4TU8A 4ZS6A 5IC4B 2K7KA 3W5YA 1C1BB 1RWKB 3OLBA 2QA2A 2V0NA 3MM6A 1QAYA 3CIZA 3HKWA 2W7OA 2KM8B 4TLQA 4OI4A 3V5RA 4IYQA 4USVA 4WZMA 5CZVA 1EETA 2JFDA 4ED1A 1SPBP 2PFDA 3TANA 2HHSA 2XMKA 3HPOA 4EFAC 5KFRA 2Z2YB 3S7RA 4DR1F 3Q8SB 3TP2A 2BM1A 1WOSA 2FVRA 2YWWA 3I87A 4NPOA 4ES1A 4LF6F 5DO2A 4P72A 5D77A 2OO4A 2FLNA 5DQGA 2LEPA 1IR1A 3IAS9 1RAOA 2IJRA 2F4FA 1M1HA 2BV3A 5KFQA 5FLXU 2VBXA 5D3GB 5DDRC 3UE2A 3UFCX 4OX9F 4OFZA 2GAHC 1KVJA 4WJBA 1VHFA 3D28A 4ZPVR 1R3NA 4L72B 2XTJP 2Y8YA 3FRYA 3CD5A 4LBHA 3BF4A 1DJ0A 5KFJA 2JOQA 3LAKA 5HVHA 3QO9B 1FWLA 1FFWB 3M9NB 5KG0A 1K44A 1CEZA 1UETA 1FRIA 2X1GA 2YNFB 5K20B 1I1GA 4CLTA 1HD1A 1NPKA 3DLKA 2XY6A 2Y1IA 4RNNA 5D4LA 2IVMA 5LXYA 2CQCA 5RUBA 4P2XA 4DL2A 5HROA 3BBFA 3GR1A 1XR6A 2HW3A 4GVBA 5FDLA 3W8GA 2BANA 1YITS 3HVWA 5EX3A 2W25A 4Z2XA 3FZBA 3CPWR 2B43A 4JOUA 1I51B 1NNDA 2DKOB 2KN4A 2PI5A 1BY9A 2F9DA 2WRMA 3M1VB 4IQXA 3HHKA 3CULA 5GVQA 1S77D 2FJEB 1IKWB 3UNGC 4OJ3A 2UUBJ 3HI9A 2DGTA 1IKYA 1U8WA 4N8OA 2CQHA 3VGTA 3LGNA 3BDPA 4LMZA 4ANEA 3I96A 4ENOA 4KPCA 1YWXA 2GQ2A 1WNEA 1YJRA 2F65A 1UJ6A 1S1XA 2QC3A 2PN6A 3ZTPA 2Y0BB 2YH1A 4LT6A 5HMYA 3WIVA 1PGZA 2CPEA 2CZ4A 2B56A 5IS2A 1JQGA 1WOOA 1NH8A 3K57A 1LQ9A 3KLEA 5LT5A 1RTZA 3UDEA 3HHEA 4K50A 4CLZA 2GO9A 4M5MA 3I5CA 1IBLJ 1TKDA 1JXLA 2OTJS 1RT6A 1SKUB 2ZH7A 4DV5F 1VC0A 2V9KA 4XTTA 4Y34A 1U0HB 1KHWA 1OQ6A 2WW8A 4WKYA 3KMSA 4PWDB 1DTTA 3JTPA 2XS2A 3QGHA 2KFZA 2H65B 3I0RB 5B7WA 4DV4F 4J7CA 3MM7A 4DV1J 3CCRS 2I8EA 3ET6A 5HMWA 2DISA 4GVLA 4ANCA 1ZOTA 4X4OA 3S8SA 1UWAA 3F73A 4BWMA 5KG7A 4Q44A 3HD2A 1UFWA 3ENVA 5AXLA 1CLFA 4LR9A 1D9FA 3FFIA 1NJXA 4LF2A 4IG0A 2C1EB 3CF5Q 4A8YA 4KB7A 2XY5A 1SL1A 4C8NA 4EYHB 3QFHA 4DR6J 4OZJA 1FDBA 3G6YA 1LFWA 4ZPTR 3C15B 3GV8B 1S57A 1BWVA 3KKFA 3CD0A 2FJBB 1H72C 1LOUA 4C0OC 2ZC3A 2IA0A 5HJXA 2OSRA 2K1RA 3G8SA 3A13A 2BE7D 1RT2A 5CYJA 4IH7A 4R0JA 3THTA 1MN9A 1RJJA 3L4BC 3Q8RB 1QLNA 1VHIA 4M5JA 2O1PA 2W01A 4L6V3 7FD1A 5D4OA 3H59A 4BWJA 5A8KA 2RF2B 2MXYA 5AT1B 3H20A 4J9QA 1R7IA 3TJAA 4CO3A 2BJ7A 4ID5A 2VQFF 3PDNA 4TQRA 2WVEA 3VQTA 2AX1A 5HO4A 2HQ3A 2ZWOA 1TKXA 4C0BA 2GA7A 2ZVSA 2Y9HA 4EBCA 1SCJB 3V81B 3IBCB 4C8ZA 4UUWA 3OXLA 2BR0A 3CDEA 3NG8A 3T1AA 4ZHRB 4Q8EA 2DO4A 1F1BB 4G3IA 2KVQE 4QJVA 3UCUP 1KFDA 3VALA 2KG0A 1DQ8A 1Q8IA 1YRTA 4MYTA 5CYMA 2FDNA 1MLAA 3MMBB 4DX6A 5ADZA 3TW0A 1ZM4A 5C7PA 1OQ3A 3KJNB 3DNCA 3D6MB 4IFYA 3DI6B 3LGMA 1EJ7L 5AJ3J 4RUAA 1HHQA 1CC8A 2NXUA 3MCOA 1M1GA 4BHQA 3SEOA 4KHMA 4U7UK 1LWXA 1WG1A 2XMWA 2VBYA 2WVFA 2B6AA 1SJ4P 4ZA1A 2R8GA 2B5JB 1REGX 4DV0F 3QT8A 1FTCA 4J90A 4A47A 3J80U 5J2PA 2OUGA 5AXKA 2HRTA 2JEIA 1HBNA 3T9ZA 1R8PA 2W2MP 3V4IA 2VOPA 3TUZC 1T9YA 4EEYA 1RAGB 3PHEA 3M2VB 4PWWA 3M8ZA 4USUA 4PXEA 1U48A 3MGJA 5DETA 4O3SA 4JB8B 4PG7A 2CQPA 4IH6A 2XLKA 1T03B 3KG4A 4DCOB 3UD4P 2BXJA 4B3MJ 4LF9F 4L76A 1V3SA 4X4RA 4OJHA 1RTHB 1IVZA 4PG8A 3MURP 4K4SA 4ECUA 1DBDA 1FA0A 1N0VC 4YB6A 3EVOA 3PV8A 2W2PP 2MSTA 2BMBA 3OJSA 3MEKA 2J7UA 1HR0F 3JSRA 1RTDB 1Y0HA 4FBUA 3TQ1A 3HZGA 1HNIB 4FPIA 2MY7A 2VQEF 1N34F 3CDWA 3W62A 1VK3A 5KFMA 1TVRA 4BBYA 4MAKA 4TYBA 4QWBA 5J1EA 4NXNF 4QU7A 2AX0A 2FJWA 1EQ0A 2FHJD 2BX6A 3N5FA 4WIQA 5FJ4A 4R0EA 4DL0C 2RIJA 3DGPB 4PQUA 5I3UA 2JRSA 4DR7F 4N77A 4DQIA 2ZBRA 1HNVB 1K1SA 3PKYA 2RDDA 2JH3A 2AJQA 4RL1A 2KB2A 2DNPA 1BGXT 3W65A 3MFIA 1DHMA 1R8BA 2HHPA 1S9GB 1TV6A 5AE2A 1V5VA 1G3OA 2MKJA 1GAOA 2XZTB 2FTRA 2C2DA 1LWCA 3J81j 3IBFB 4Q0BB 2VKZG 2HHUA 4LBPA 4P2MA 2GVDB 5IOLA 1LW0A 3MECA 4LVOP 1S1WA 2W7AA 2QLJB 1G1XA 4ELTA 3HZEA 4O44B 2UXCF 2CQ3A 3FMBA 3K5LA 1WF2A 4ER8A 1FXDA 1FT8A 3OSPA 1FDNA 1PJ7A 3BGOP 1O5JA 4C8KA 2X1BA 4B3OA 4OZNA 2ZH6A 1MU2A 1RHQB 1X5PA 3POTA 1AUSL 1Q5YA 3FBEA 2IFXA 4U8YA 4YEAA 2QMUB 1FVQA 1X7VA 1N33J 2ZKUA 4USKA 3SSRA 3D3CJ 5L8RC 4BLGA 4GKKJ 1NHVA 5KFYA 2WVBA 1E6YA 4X4VA 3IS9A 3W7BA 1JKHB 3A8JA 4TY8A 2N82B 5E7OB 4LFBF 3DOLA 4U7UD 2XMUA 1SKRA 1VJQA 4FF2A 3H5XA 2NUUG 3QJPA 5KG3A 2R4FA 3KJFB 2YNIA 4EZ6A 2IBKA 5ETMA 4MH8A 2HIYA 4UW2A 2W1BA 1YDLA 1PJ6A 1VRUB 3FQKA 1RTJB 2DPJA 4MFBA 5C25A 5IWAJ 2OKQA 3BKUA 4ZP9A 3EICA 3KOAA 4WKRA 4J5OA 1X4DA 1P27B 2BOAA 2EWHA 4J37A 2CQIA 4C48A 2UP1A 1WC3A 4LRCA 1BUXA 1X4CA 3OPKA 4B9VA 4P75A 2OPRA 3MEGB 5L1JA 4RW4B 1UVNA 2GZOA 1LWFB 2ILZA 2K3KA 3W1YC 3AD9C 4UOHA 2GVZA 3KNAA 2CJKA 1F60B 5KFOA 3AJDA 1NJIT 1O8BA 3L95X 2KVIA 1K8AT 2DPIA 2HRUA 2NQPA 2NS1B 4DQSA 1QTMA 4LIWA 1OPZA 4YHHJ 4IOCQ 1TK8A 3UR0A 3ILJA 4NLVA 4FYVB 2XWXA 2HNYB 2G0IA 3BR9A 2LDYA 1NEEA 1TR0A 1CJUA 1RWUA 3D6FB 2IHR1 2RT3A 2CUYA 4RW9B 4BC9A 2RD5C 5KFLA 5M2PA 4JI5F 4Y65A 4YN3B 3IN5A 3DXBA 1FJCA 1E6VA 3K59A 1RWPB 3VVUA 1X4BA 4RLEA 1HMVB 1X60A 2XWYA 4HH1A 4JI6J 2LQJA 1EKRA 4ZPAA 2B51A 4FYYB 4R8UA 3TZZA 1FK9B 3AD8C 1Z2ZA 3L7UA 2N4DA 4DUYF 2VASA 2HFVA 2ZH8A 2C2RA 3OR1A 3OD2A 3DDKA 2LU1A 1BLUA 1YBAA 2XM3A 3HHLB 1AZSB 3UQSA 4EUVA 1X0PA 2L9DA 1KFSA 1LV5A 1J5EJ 1N52B 3JQMA 4M63A 5KFGA 1ZTWA 4FZVA 4Y2CA 1S6QA 2DHGA 1X4FA 1RT3B 2F8HA 5KAKA 1ELOA 3WHIA 2PDAA 1Q7YT 4DR2F 3NP5A 4NI2B 3B82A 4C3MA 8ATCB 1G7CB 3CCQS 3SCJE 2KKHA 3QYYA 4Q43A 1I94F 1Q8LA 3UR3C 5C2GA 1RLDA 1S76D 3DN9A 5J2MB 1GT8A 1IWGA 3PVXA 3MCNA 3RAMA 4UZBA 1U6ZA 3H90A 3MAAA 3DRRB 1KKHA 1NPRA 2LQBA 3VAMA 3FSYA 4F67A 3KK3A 5MAOA 4DPXA 1VI7A 3TAMB 4N5SA 1RGVA 4C0HA 1TKZA 3VTIA 2YKMA 5BYSA 3Q86A 1EZZB 2PEHA 3D5MA 3GTYX 1R0CB 2BQ3A 4I1TA 4AXJA 1CC7A 1FRJA 1GQEA 4K0KF 1KQKA 1C0TB 3MUTP 2VU5A 3PHTA 3FUYA 3JTNA 2B0GA 2AMCB 1RT5A 2DGOA 4DN0A 1LK5A 5HANA 2EEYA 3KUEA 2AYEA 4LF8F 3IRXB 3OTOF 3G71S 1CSJA 3M32A 4K4YA 1H0HB 3J81U 5ETQA 4KGMA 5LOQA 3LP1A 1TL7A 4I7FA 1TAQA 2V2KA 2R2SA 1KTVA 2F7VA 3VGSA 2GHPA 4UOGA 3SCIE 4PWUA 4DF8A 4NYZA 1S7HA 3CUNA 1N5SA 2IRYA 3TA1A 1SL2A 3LH2S 4NA2A 3T19A 4Y6IA 4NEYA 3BO3A 3LP2B 3DU6A 2B8QA 1Y00A 3ZTOA 3KLHA 5B0DA 2U2FA 3D0HE 3HHNB 1SQGA 4I67A 2FLOA 1TL1B 2V67A 1XMBA 1RLCL 3EGZA 1VQ5S 3KXDA 3KYLA 1VYAA 2HFSA 2IVFB 1QY7A 5CZXA 3HSJA 4RW7B 2GW8A 3UVJB 3MAHA 2EW9A 5SUHA 3Q0AA 1DLOB 2QMXA 2VZ9A 1U6FA 1OSDA 2YPZA 3N01A 4FXWA 4H4OA 1FRKA 4PYDA 2DNKA 1VDHA 4ED7A 2OEKA 4FKXA 2WSCC 2HIQA 2AJ2A 1QM9A 3NS6A 1VIOA 1Q5VA 3ITHA 3JSMA 2XMMA 1A7GE 1P9QC 1UJ4A 2DBBA 1ZETA 1W7WA 2FY1A 2CPYA 3M9OB 1B0VA 3KHRA 3EXYA 3MM5A 3OR2A 3EYZA 4DBQA 2YBVA 2APOA 2YNHB 4RNFA 2GGPB 3JYTB 2ZHBA 3GJSB 2QRRA 2QLWA 1RTIB 4OYBA 3ZC4A 4U9RA 1S4FA 1TAUA 4DUZJ 2QYGA 4JBCA 4FYDA 4KV8A 1TMMA 2VH7A 4MYUA 1G2EA 2I5JB 2C2EA 1VQKS 2W2OP 4FF4A 3EXCX 4WZQA 2GQQA 5DS7A 1SUQA 3BB5A 4RNMA 5A8WB 2C3YA 2DYAA 2VPYB 3CCWA 5AXMA 3SSQA 5HATA 4LRAA 3FMWA 4IRKA 5J1NA 2PEBA 5JXSA 5KFDA 2R7SA 5T14A 1JLFB 4CT9A 3US5A 2VHGA 3N79A 2GAGC 4OLOA 4BCAA 4ED6A 4ZN3A 1NK6A 5K8NA 2O01C 4DS5A 4DQRA 2EG1A 1JNZB 3KUGA 4ZVHA 3G87A 1IR0A 3KHHA 2HMIA 3EZUA 1H98A 1JLQB 4B3TJ 2B4PA 2UXDF 4B9NA 4NA1A 1IM4A 1U24A 3PEHA 4QR0A 2ZUAA 3IM8A 1RYRA 2WTFA 3CB4A 5ETSA 3KMQA 1YZ6A 2UUCF 2IRUA 1PILA 4U67Q 4F04B 3DOMA 2LVWA 1UA1A 1F9HA 4KBIA 3HVRA 2W7PA 2BDPA 1UEUA 3CCJS 1ZPVA 2CQDA 3BEGB 5GAGU 1RCOB 1UWBA 2VPXB 4W4MA 2YPYA 1SH2A 1F0XA 4B9TA 5GAEU 2UXBF 1YJTA 1QAJA 1MN7A 2Q6CA 5A6PA 2V8GA 3C6TA 3I9V9 4X62J 2AYMA 4NLRA 3MR7A 3CGIA 3OUYA 1HBUA 1Q7LB 4YQWA 2B9EA 4HHUA 3M30B 2VG7A 2Y1JA 3RBEA 1D8ZA 3M2RB 3VWSA 2DNNA 2UU9J 5HP1B 3DYAA 2DRAA 1RHUB 4I56A 2O5DA 1V5IB 2VB6A 1RT4B 2OPSA 5B0AA 4LVNP 4H4KA 2B7CB 3RTVA 2DB1A 2Y3YA 3FDSA 3KLVA 4FS2A 5GAEI 2O66A 1KQSR 1U2CA 1GXUA 4DSEA 5DDPC 3NNHA 3T1YJ 3PFOA 4JI7J 4N7TA 3P5TL 1WEZA 2N7YA 4QPTA 2XMJA 2VG6B 2WAQD 4EU0A 1HNWF 2DXEA 3QZ7A 4IRDA 2HLTA 1ICEB 1EAYC 2ZITA 2UVWA 2Z8QA 1U45A 4ZPBA 2D1CA 3GLJA 4ZLNA 5F8MA 1EQMA 3PIPQ 5KFTA 3NKYA 3R5CA 5J2QB 3CJ0A 3AY0A 3Q8QB 3K5OA 2VL1A 4YB5A 2BOPA 3IGVA 3M9MB 5C5JA 2ROGA 4B9MA 2CYYA 2VJVA 1M5KC 1UZDA 5DM6Q 1HD0A 3DDIA 3V6DA 5GAHU 3ZZPA 4DFMA 3L7OA 1IUJA 1QD1A 2XYHB 1FE0A 3HM9A 3TNVA 4QIVA 2D69A 2HPUA 4G1IA 2M0GB 3N4WA 3CMQA 2XEXA 2HKEA 1FEHA 1XBWA 2CDQA 2XHWA 1REVA 4OYWA 1WI8A 2DO0A 4MJKA 2DT9A 1YQHA 1JLGB 2D9PA 4ZITA 3H5YA 1KN6A 2PA3A 3TUPA 4IG3B 1FX4A 5BR8J 3CJ2A 3PTWA 2YWHA 3TAQA 3BYRA 3A4TA 1SJ1A 4KFBA 3S1TA 4B9LA 1TKTA 3MCMA 3HVTB 2I6WA 4JV2A 4X65J 2HS0A 2VD3A 4ES2A 1FI4A 4O4GB 4DV6J 5ETLA 4J9UE 2CQGA 1FDAA 2VKRA 3U1NA 5C2CA 5GAHI 5B0FA 3C14A 2IJFA 2KYZA 5A0YB 4WP8A 3PX4A 1FJ7A 2J9CA 1LW2B 2ZZTA 1RWWB 2H4WB 3NXZA 5LMUF 3DXSX 3MUMP 3SSSA 3JSYA 3R5BA 1SI9A 2G9OA 2BABA 3OTEA 4USHA 1N32F 1B3TA 2MQQA 2QEXS 4NXMF 2YNGA 4JI2J 2PMHA 1WC4A 2E5JA 4M95A 3B4DA 1WG4A 4KT0C 1QSLA 4LR8A 3RW7A 2VV5A 3MD3A 4F2SA 1U1QA 3DOKA 1V3RA 3Q8YA 1JLCB 2RU9A 4P6QA 1N5YB 4KQZA 1RB0A 3TX0A 1R0AB 2FHOB 2PMZD 5MLCV 1W2IA 4J9SA 4B02A 5H1SV 3RRKA 4PRFA 4I69A 2MHNA 1BC6A 2FD2A 3CJ3A 4FNHA 2DGUA 2CWKA 3O5TB 1H74A 4GRSA 1TP7A 2F3JA 2QIFA 4I2QB 5JVHQ 1IXKA 8RUCA 1HQ2A 3GE9A 4Y0FA 2OH2A 5HI7A 4UY85 4KE5A 5A8RA 1IKXA 4DDFA 1GTHA 1V9OA 4B9SA 4FF1A 4AT1B 3A3PB 4J9MA 1QE1A 1B0TA 2CAJA 4LIRA 1FKPA 1VQ4S 2VJUA 3H42A 2FHMA 1J5OB 5IXUA 3NGTA 1U1RA 3GB0A 2CRLA 4L73A 2BKNA 4CO1A 1HPZA 4ZJLA 4DR1J 1XJWB 2BRLA 4U8VA 1C1BA 4RUBA 5I3QA 2HVHA 4LF6J 1GTEA 2VFSA 1HWJA 4DR3F 2WBRA 3HULA 5D15A 2BYCA 4U95A 1JJ4A 2XS5A 4WK1A 4DG1B 2KXFA 5LSLA 3UCZP 3Q89A 2HWTA 5IM0B 5DLGA 1WWHA 2ZH1A 5LMNJ 1YX2A 1B0PA 2IC3B 4WFAQ 2HFZA 4BC7A 3HO1A 1Q79A 4OX9J 4KHPF 3F56A 5M2RA 4NCBA 3N6NA 5LL6d 1I3OB 2QLXA 3NGUA 3NAHA 4UQTA 2RRBA 1Q0NA 1XNQF 1WOPA 4P2FA 1UCNA 4EZ9A 5D3GA 3P4UB 4CM2A 2AKWB 3EZOA 4X4PA 4QW9A 3Q24A 4I6WA 1WI6A 3MCSA 1JIHA 4DX5A 2DNYA 4URQU 1SKWA 3NWGA 1SC3B 1Y4ZB 1ZM9A 2D9OA 4RW8B 1OJ4A 2JEGA 4CNYA 1A6LA 2DTJA 4CYUB 4ZPCA 4EYIB 2QL5B 2VDHA 3QO9A 5HQLA 3KDOA 2MZTA 3PIOQ 2IMWP 2HGLA 2XNRA 3R7SB 3SFGA 3LP0B 1L3UA 3ENWA 1VS3A 2YNFA 5EWEA 1ZH5A 3T1HF 2FYXA 3BGUA 3J7ZT 3KLFB 4AL7A 3K17A 3DLBA 2AIRB 3UDCA 4A48A 3ADAC 2F4VF 4DL7A 1X8DA 2NPIA 4DZDA 1RUSA 3TA0A 4YY3J 1NDKA 5L9XA 2DHSA 1RWMB 3D1HA 3AJ1A 3FNNA 4OQJA 1NPPA 2W4PA 4H4KC 5E3QA 1Q86T 3RUBL 3M1VA 1NK9A 2KL8A 4L3NA 3FBCA 4RUHA 2CJQA 1LKZA 2V8HA 4IUFA 1V3ZA 3PYDA 6AT1B 2F9JA 2CZ9A 4ED4A 2RQKA 3IC1A 1KOOA 2YKNB 4DV7F 5ETRA 1BQMB 4LF1A 1CJVB 5K8PA 2LP4A 2DH9A 1VMBA 1FKOB 3OFFA 1EP4B 1RI7A 2IIHA 2HNDA 4DV5J 2YKQA 3R97A 1FJGF 3M8PB 2DIVA 3D54A 4F8RA 2JVRA 3M8QB 4O3PA 7AT1B 2CPIA 1MMLA 1GEHA 5DJBA 3VGUA 2HS3A 1PJ5A 5DG7A 3JAMY 5K5MA 5AE3A 4TLRA 2I38A 1N36F 4NASA 2OPPB 1EETB 3OFEA 1U0HA 1KD1T 3BYPA 2PD1A 4PWDA 3ZZOA 3CDAA 4XK8C 3AOBA 2ZHAA 4JI3F 2RMLA 4WBFA 2NPFA 1ITPA 2IM2A 2LQ9A 4CCHA 4PEOA 1RWOB 5CD4H 2NSBA 2HHHF 5KFWA 5FD1A 1RADB 1SH0A 4U96A 3G6XA 3CXCR 1VRTA 3QRQA 4QU6A 2J76E 5F3TA 2BE9B 3AXKA 3L3CA 2DNRA 3OL7A 2IA6A 1NCLA 1U7LA 3C15A 2G4BA 5M2UA 2ZM6J 4DPYA 2XZDB 4NLXA 3OL9A 3A12A 3FCVA 1C0UB 2FVSA 3CCTA 3DLEB 2E5LJ 1U2RA 1I6JA 1S72S 3DM2B 3MR6A 2ZJRQ 1CQNA 1RSCA 2RF2A 1FRMA 1XN9A 2D3O1 1W25A 2Z2LA 2JC0A 1UVLA 2N3OA 3I31A 4LJMA 1SIZA 2OLWA 1M5VC 2J8SA 4ECTA 3RBXA 4DJBA 2OPQA 1KP6A 2M9KA 3CDBA 2XLIA 1LXNA 3O1LA 1YG0A 2ZEJA 3GIKA 3OL8A 4ZHRA 3OVSA 4ZCIA 3KJQB 2IM0A 3QBCA 3NBPB 1BQNB 4L75A 3G8TA 4MK7A 4DFKA 3MMBA 3CCVS 4KRWA 2CPDA 5EX0A 2FZKB 2Z57B 5EGYA 5HSPA 4KPYA 2H3EB 2HEKA 1VCTA 1HQUB 5KFUA 1F3VA 4DV0J 5DM7Q 1W26A 4LQ3A 3DI6A 5I4MA 1U4BA 3G4SS 1JX4A 1DURA 3QAEA 1C1CB 2J7KA 4K4XA 4JI4J 2AZ3A 3WX8A 4PXCA 4RBTA 1ZZNA 1UPMB 2EI5A 1FXLA 4QCLA 2PGCA 5A6WA 3A3NB 5KFSA 3PRDA 3N9UC 5AE1A 2CPZA 5CQGA 4OJGA 2EFQA 2QG9B 4NE9C 2B5JA 1CJTA 5HMZA 5LXRA 1WHYA 3E3XA 2OP5A 3D0GE 5DZ6A 2RHSB 4LF9J 1SC1B 2EK1A 3MM9B 1TUGB 2DNMA 1IJFB 2UUBF 5E0OA 4NMLA 1NRKA 4FBTA 4ZPWR 1FD8A 3KLEB 4G1QA 5HLFB 1WC1A 1XEZA 1UMJA 2FJVA 3M2VA 2BJ9A 2HBRB 2E7VA 3GV7B 4LFCJ 1RT6B 2KM8C 3QFWA 1T03A 1N54B 2JHEA 1UTAA 2VPWB 1XERA 5DQIA 3KK2B 4JI1F 4KYZA 3CJ4A 5GMKa 4NXNJ 4I68A 1RTHA 1RAFB 4ZJQA 3X3UA 3Q8PB 5K8MA
chains in the Genus database with same CATH topology
3BH6B 3L7UA 2AZ3A 2HVEA 3Q8UA 3WX8A 4ANCA 3FBEA 1S5ZA 3EVMA 1UCNA 1NUEA 3BBBA 2BX6A 2DY9A 1U8WA 3BBCA 4CP5A 3NGTA 3VGTA 1VYAA 5CAAA 4ANEA 4UOHA 1HLWA 3ZTQA 4ENOA 4KPCA 2DYAA 3FBCA 4F36A 1NSPA 4EK2A 2HVDA 3ZTPA 2B8PA 2VU5A 1K44A 4DI6A 1EHWA 1BE4A 1MN7A 1BHNA 2BEFA 5CABA 4ANDA 1PAEX 2HURA 3VVTA 1F3FA 4DUTA 5C7PA 1NPKA 2DXDA 4WBFA 3B54A 3Q8YA 2DXFA 3Q8VA 1NDPA 1F6TA 1WKKA 2NCKL 3ELHA 1S57A 3VGVA 3G2XA 3MPDA 4FKXA 2DXEA 3GPAA 3FBFA 1NHKL 1HIYA 3JS9A 3FC9A 4O0NA 1NSKL 3EE3A 3Q89A 3PRVA 3BBFA 3DKDA 1MN9A 1S59A 3ZTRA 3FBBA 3Q83A 3R9LA 2CWKA 3EVWA 5IOLA 1LEOA 1XIQA 1HHQA 4FKYA 1W7WA 4C6AA 1B4SA 3EVOA 4DZ6A 1NSQA 3EM1A 1XQIA 4F4AA 1NDCA 3VGSA 1NCLA 4HR2A 1B99A 4UOGA 3ENAA 1LWXA 3VVUA 2AZ1A 1ZS6A 4UOFA 1PKUA 3EICA 3EJMA 2ZUAA 1NDLA 1KDNA 3ZTSA 3FCWA 3EMTA 3FKBA 5BXIA 3NGSA 1NLKL 3FCVA 3B6BA 3NGUA 3VGUA 2B8QA 1NB2A 3BH7B 3NGRA 3DDIA 3ZTOA 3GP9A 1WKJA 4W98A 3Q86A 1BUXA 1JXVA 1WKLA 3ETMA 3PJ9A 1NDKA 4S0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  3L7U A;  2AZ3 A;  2HVE A;  3Q8U A;  3WX8 A;  4ANC A;  3FBE A;  1S5Z A;  3EVM A;  1UCN A;  1NUE A;  3BBB A;  2BX6 A;  2DY9 A;  1U8W A;  3BBC A;  4CP5 A;  3NGT A;  3VGT A;  1VYA A;  5CAA A;  4ANE A;  4UOH A;  1HLW A;  3ZTQ A;  4ENO A;  4KPC A;  2DYA A;  3FBC A;  4F36 A;  1NSP A;  4EK2 A;  2HVD A;  3ZTP A;  2B8P A;  2VU5 A;  1K44 A;  4DI6 A;  1EHW A;  1BE4 A;  1MN7 A;  1BHN A;  2BEF A;  5CAB A;  4AND A;  1PAE X;  2HUR A;  3VVT A;  1F3F A;  4DUT A;  5C7P A;  1NPK A;  2DXD A;  4WBF A;  3B54 A;  3Q8Y A;  2DXF A;  3Q8V A;  1NDP A;  1F6T A;  1WKK A;  2NCK L;  3ELH A;  1S57 A;  3VGV A;  3G2X A;  3MPD A;  4FKX A;  2DXE A;  3GPA A;  3FBF A;  1NHK L;  1HIY A;  3JS9 A;  3FC9 A;  4O0N A;  1NSK L;  3EE3 A;  3Q89 A;  3PRV A;  3BBF A;  3DKD A;  1MN9 A;  1S59 A;  3ZTR A;  3FBB A;  3Q83 A;  3R9L A;  2CWK A;  3EVW A;  5IOL A;  1LEO A;  1XIQ A;  1HHQ A;  4FKY A;  1W7W A;  4C6A A;  1B4S A;  3EVO A;  4DZ6 A;  1NSQ A;  3EM1 A;  1XQI A;  4F4A A;  1NDC A;  3VGS A;  1NCL A;  4HR2 A;  1B99 A;  4UOG A;  3ENA A;  1LWX A;  3VVU A;  2AZ1 A;  1ZS6 A;  4UOF A;  1PKU A;  3EIC A;  3EJM A;  2ZUA A;  1NDL A;  1KDN A;  3ZTS A;  3FCW A;  3EMT A;  3FKB A;  5BXI A;  3NGS A;  1NLK L;  3FCV A;  3B6B A;  3NGU A;  3VGU A;  2B8Q A;  1NB2 A;  3BH7 B;  3NGR A;  3DDI A;  3ZTO A;  3GP9 A;  1WKJ A;  4W98 A;  3Q86 A;  1BUX A;  1JXV A;  1WKL A;  3ETM A;  3PJ9 A;  1NDK A;  4S0M A; 
#chains in the Genus database with same CATH topology
 2YKA A;  3MF5 A;  3IWX A;  1L3S A;  4MT1 A;  4DR7 J;  1JK9 B;  3BPD A;  2WB4 A;  1IBL F;  1RTD A;  3M7V A;  1ZBT A;  1V6H A;  3BN4 A;  2GC8 A;  1HNI A;  3SFU A;  5B08 A;  1UEK A;  3S01 A;  3M8Y A;  5LJ3 Y;  2QO3 A;  1F5B A;  4N8N A;  2C3U A;  4K4Z A;  3GIM A;  1FKA F;  2HUR A;  3VVT A;  2QL9 B;  4IO1 A;  2XYG B;  3I0S B;  2I1R A;  2VBW A;  2K1R B;  1WUU A;  2ACM A;  3PX6 A;  4MKA A;  2MKH A;  4TVA B;  3DGP A;  2IDE A;  2JSX A;  1HNV A;  1XR5 A;  2EC2 A;  4IR1 A;  5A8K B;  4ECV A;  2CVE A;  2MQM A;  2F40 A;  4DR6 F;  1SJR A;  1S9G A;  3CCZ A;  2FVC A;  3HSD A;  1SJ3 P;  2ZZN A;  5G0R B;  1HBO B;  3LPE A;  3ZXW A;  4Q0B A;  2WOM B;  4DOZ A;  1JLA A;  1ZPW X;  2WON A;  4XDD A;  3W2V B;  2MJU A;  2DNL A;  1RP5 A;  4QYR A;  2RNE A;  1GMW D;  1WEL A;  4O44 A;  2GX8 A;  4WYL A;  3GIR A;  2OAU A;  2A1B A;  2M8H A;  2LXU A;  3D1Q A;  4RX6 A;  3DRP B;  5ETN A;  5F8I A;  3H5U A;  2J5A A;  4DLE A;  4DV3 J;  4CLF A;  3ZNJ 1;  4LFB J;  4CNZ A;  4Q2L A;  4WII A;  2EC0 A;  5CHC B;  1IBM F;  2GNK A;  4IFV B;  1LWE B;  2CJX B;  2OEM A;  2B7B B;  4MKV A;  2IPO B;  3C46 A;  3NOG A;  2F63 A;  3MWB A;  1C2P A;  3I5A A;  4YDD B;  1JKH A;  2H5E A;  3ISN D;  2JZ5 A;  3MD1 A;  2K7J A;  4LF4 F;  3T5K A;  3PW4 A;  4K7Q A;  4D3G A;  1R8H A;  3TEH B;  2LDI A;  1YLX A;  3HVA A;  2FVP A;  5J2P B;  1NZ8 A;  3MM8 B;  3N5B A;  4AL6 A;  1WKL A;  5AJ3 F;  1VQ7 S;  1T8E A;  2HLU A;  3K5N A;  3GZ7 A;  1VK8 A;  3M6U A;  2QFJ A;  4B3R J;  1RTJ A;  4F4Y A;  1HBM A;  2V68 A;  3C8Y A;  4ZCK A;  3R2C J;  1OWX A;  2U1A A;  4Z7Y A;  2XMA A;  1D8Y A;  2KXH A;  1VIX A;  2A18 A;  1EHW A;  1K47 A;  2DK2 A;  2NXN A;  2JLG A;  4DUT A;  3MEG A;  2DXF A;  4DR4 J;  4M5K A;  4RW4 A;  2BJ8 A;  2G0C A;  2OFH X;  1MMN A;  4OHX A;  1Y10 A;  4ECY A;  4KO0 B;  1H3D A;  4A8K A;  3PY8 A;  4X64 J;  2NXE A;  3D66 A;  1CS4 B;  5E3A A;  2ASJ A;  4RU2 A;  2MB0 B;  1HI1 A;  1MWZ A;  2HWI A;  1AFJ A;  3OFH A;  3ENA A;  4UOF A;  3EGV A;  2E1A A;  2EK6 A;  2HNY A;  4UY8 T;  4H54 A;  2P9C A;  4P73 A;  4B3M F;  3QID A;  1RA6 A;  1YBU A;  1RKJ A;  3TAP A;  3IWN C;  2YXL A;  1GNK A;  1GXL A;  4RW9 A;  2CXE A;  2ERR A;  5DDQ C;  2GMH A;  2MYF A;  1NUE A;  3K0J A;  1HMV A;  3G86 A;  4DX8 H;  1IQT A;  4L74 A;  2PO4 A;  1N8R T;  1BXN A;  3I32 A;  3VAF A;  4DR2 J;  1H7W A;  1FK9 A;  2HZV A;  3B54 A;  1L5U A;  2BQR A;  3IMQ J;  2MQN A;  3HHL A;  1AZS A;  3G9C A;  2M8D B;  4C11 B;  2MZQ A;  5KFF A;  3MI7 X;  1HA1 A;  1UA0 A;  4A8O A;  5JUM A;  2VFU A;  3OT9 A;  2FC8 A;  2MZ1 A;  4USJ C;  2WHO A;  1FEE A;  4QIG A;  4NI2 A;  1VBZ A;  3C19 A;  4L3K A;  4B3O B;  3LO3 A;  1IBC B;  2H51 B;  1ZAW A;  4UUX A;  3POT B;  2G2Z A;  3MMC B;  1JXV A;  4KR0 B;  4DQP A;  5J2M A;  3D68 A;  1S99 A;  4AQY F;  3CCL S;  2DGX A;  2G2O A;  3DRR A;  2F1F A;  1S1V B;  4P71 A;  3OVB A;  2CJ9 A;  4XDC A;  1HFE L;  3TVZ A;  3GFX A;  2QZ8 A;  3TAM A;  4X4Q A;  3G6V A;  2X1F A;  4C7Q A;  1X31 C;  2HQC A;  2VA2 A;  3G96 A;  3IO1 A;  1Q82 T;  1RE1 B;  4YFU A;  3OHA A;  4NLD A;  4LF8 J;  1XC9 A;  2H4Y B;  4J9L A;  3EGN A;  3UD5 A;  1WOR A;  4CLK A;  1DTQ B;  4F02 A;  2JC1 A;  4CZC A;  2KRR A;  4DSK A;  2V8P A;  3K89 A;  2V2Q A;  1C0T A;  3J80 Y;  2FJX A;  1XIQ A;  4GKK F;  3QAT A;  1A9N B;  2GS8 A;  3L9Z A;  2WW4 A;  4P9S A;  3BSN A;  3NL0 A;  5T7L A;  2XSJ B;  4DR5 F;  2C2Z B;  4HT5 A;  4DMZ A;  1R8A A;  3IRX A;  3RU0 A;  5H9F K;  4M5I A;  4QR2 A;  2ABY A;  4ED5 A;  1O6X A;  1U26 A;  1RZM A;  3D2W A;  4P7V A;  3WIU A;  2BAC A;  3D9B A;  4DL6 A;  2GVZ B;  3VR1 A;  1P9Y A;  2M7S A;  3SZ2 A;  5IWA F;  1FNM A;  2RKI B;  3LP2 A;  1U1N A;  2W4C A;  2OJ3 A;  2A3J A;  2BEF A;  3H5S A;  4F26 A;  4K5S A;  4EBD A;  1TL1 A;  2P2C B;  4U7C A;  3VGV A;  2VDI A;  1B7Y B;  3EE3 A;  4PG4 A;  5C24 B;  2XI2 A;  2GV1 A;  1YHQ S;  4TYA A;  1SXL A;  3G82 B;  5D0E A;  4RW7 A;  4FN5 A;  1S1U B;  1NO8 A;  3UVJ A;  2G0J A;  3JB9 k;  2FLP A;  3E2E A;  4X4T A;  2RQC A;  1DLO A;  1XQI A;  1X4E A;  4N47 A;  2E9Z A;  1H73 A;  3BGR B;  3EGW B;  2CNO B;  3CCS S;  2QX0 A;  3KDN A;  2PFF B;  3LWM A;  2P9G A;  4G65 A;  4IOA Q;  2NRE A;  4ECR A;  1NKB A;  5KFI A;  4C97 A;  2ZJP Q;  3CSK A;  4NZ0 A;  3QRP A;  3U27 A;  2G13 A;  1WC0 A;  5JMN A;  4ZP8 A;  4NLO A;  3SQG B;  1RAB B;  3BBB A;  4D3H A;  4P74 A;  3CO9 A;  3PYE A;  3CC4 S;  2YNH A;  3SMZ A;  2GGP A;  3JYT A;  1FVS A;  4JI6 F;  2H48 B;  3DLG B;  1RTI A;  3KWM A;  1WEX A;  3O8W A;  1RU1 A;  3IR6 B;  1RA7 A;  4ECQ A;  1SJF A;  1WAC A;  2H9Z A;  5ETP A;  2JFK A;  3ILO A;  4P2S A;  3W9J A;  4X4S A;  1NHK L;  4ZVO B;  3HSG A;  2CJA A;  3RG6 A;  3AXM A;  2V4J B;  5A8W A;  3GCX P;  1J5E F;  2RE1 A;  2C2K B;  2D74 B;  4MTP A;  2UXD J;  1WJ9 A;  2BJD A;  5HMX A;  2M5Y A;  1Z1Z A;  5IC6 B;  1JMT A;  2I9S A;  2W9C B;  2RB7 A;  4RNO A;  2ATC B;  3IR5 B;  1TFY A;  2XCP A;  1JLF A;  4IDK B;  2QE5 A;  2ZNZ A;  3I6P A;  2JLE A;  3I9Z A;  3M8W A;  4KKO A;  2QT7 A;  3SCL E;  5D0G A;  3B6B A;  4JI0 F;  1VBK A;  3FQL A;  1NHU A;  5KTQ A;  3KG1 A;  4M5L A;  1O0P A;  4NLY A;  4J9K A;  4OIX A;  2HG4 A;  2FVQ A;  1JLQ A;  3CW2 C;  3E51 A;  4QPX A;  5C42 A;  4EGL A;  2KT5 A;  5F3Z A;  3PKM A;  2AWZ A;  1F2H A;  4FXV A;  1KWM A;  3HHL D;  1RT5 B;  3DRY A;  2ALZ A;  4NWB A;  1D9D A;  5DG8 A;  1PCA A;  2ZWP A;  4ZVP B;  2WZ1 A;  1URR A;  3QGI A;  3M32 B;  3JSB A;  1FX2 A;  3FC9 A;  4DL5 A;  2DR7 A;  1S49 A;  6FDR A;  5KT4 A;  3G6E S;  2ZUG A;  4LF7 F;  2HYI B;  2V94 A;  2LFV A;  4QWA A;  4V1A k;  1VQO S;  2XS7 A;  3FZ2 A;  4ETZ A;  1P8G A;  5BYR A;  3W64 A;  1XR7 A;  3M6X A;  5D0H A;  2NXC A;  3NGS A;  4EI2 A;  3M30 A;  5F41 A;  5KT6 A;  3LWL A;  5L1I A;  2NYI A;  4S0M A;  2FGC A;  4NL5 A;  3U1L A;  3M2R A;  3Q8U A;  2FPH X;  5HP1 A;  4FS1 A;  1ZZF A;  3R8Y A;  3HFZ B;  1RT4 A;  1HL6 A;  4K59 A;  1R0B G;  2UUW A;  1XK8 A;  4QIF A;  3VCD A;  1UVI A;  1VQS A;  1Y7P A;  4CLP A;  1NKE A;  1HNW J;  4FPR A;  1T3O A;  1T95 A;  3DRS B;  3BSA A;  2YWK A;  4M5G A;  4KH0 B;  1RAE B;  2MKY A;  1HYS B;  3THP A;  3ITH B;  2MQL A;  4RUC A;  5A2Q U;  1AXQ A;  2HFN A;  2EBG A;  1MSW D;  2HVZ A;  4X4U A;  1VBX A;  4ZPD A;  3PW5 A;  3CCE S;  5KG4 A;  4X66 F;  2HRY A;  5CCL A;  2D7S A;  2PMW A;  4USM A;  1G6B A;  2IAJ B;  5IQ6 A;  4HDG A;  4WTY A;  1K1Q A;  2H5I B;  3MED B;  2V9W A;  2VG6 A;  1RAC B;  2MZJ A;  3HHL C;  3LW5 C;  3BGL A;  5DG9 A;  3MDF A;  3TZX A;  2QN6 B;  1YRX A;  3GMG A;  3UN5 A;  2ZH2 A;  2UUA F;  4I0W A;  1K0V A;  2DR5 A;  1PC5 A;  2EFV A;  5K14 B;  3QGG A;  1QUP A;  3VAH A;  2O67 A;  2ZNY A;  4ZDN A;  5J2Q A;  4A8X A;  1S10 A;  1YJU A;  2NYH A;  2YWE A;  3CJT A;  3BQ2 A;  3TJ9 A;  4WFB Q;  4DFJ A;  3SCK E;  2LXF A;  1H2U X;  2BQU A;  2R42 A;  1TL5 A;  3NRB A;  3CMA S;  1S6P A;  1BE4 A;  5SZT A;  4ALZ A;  4F3Q A;  2DJW A;  4DUZ F;  5H9E J;  4DCJ B;  4CQ1 A;  1TQL A;  2VIC A;  3NGK A;  1HI0 P;  3PW7 A;  4YDX A;  2DEJ A;  1S9E A;  1SIW B;  2OIH A;  3EPG A;  2VIH A;  1JLG A;  2XQC A;  3NY0 A;  1NSQ A;  1ZAX A;  3TOQ A;  2WSF C;  2HHX A;  4QYZ J;  2HZC A;  3GU0 A;  1D1U A;  2VFR A;  4CLW A;  5LMU J;  4CO5 A;  1RT1 B;  5B0C A;  2V4R A;  5LM7 E;  3HVT A;  1UL3 A;  2MZS A;  3WBZ A;  1YJW S;  4O4G A;  3NCP A;  1N5V A;  5J1P A;  4OHZ A;  1RWV B;  3BZQ A;  4ZLJ A;  3I56 S;  3IWL A;  5A0Y A;  4FYX B;  4OZ2 A;  1LW2 A;  1HW9 A;  3J81 Y;  5D4N A;  3WC0 A;  3CO0 P;  2CQB A;  2HQF A;  4WCE Q;  2VG5 B;  3GYN A;  4AND A;  2IDL A;  3FEY B;  4P7T A;  1HBU B;  4K4W A;  4CO0 A;  4OI0 A;  2X7I A;  3HMJ G;  2W8L A;  3MTK A;  4Z7C A;  4PYA A;  3R9L A;  3EDQ B;  5IV3 A;  2E7X A;  2YTC A;  1NH7 A;  1GMV A;  2BBE A;  3K58 A;  1FCA A;  3JQK A;  2B4V A;  1M5S A;  3NOC A;  1JLC A;  2DH8 A;  1N5Y A;  2YWG A;  1R0A A;  4F7V A;  2OD4 A;  4X62 F;  4HTJ A;  1RHM B;  1HHT P;  3QT5 A;  5K9F A;  3H0P A;  3VAI A;  4DF4 A;  4HAC B;  2R7U A;  4RJV A;  2UZA A;  4AXI A;  4YUD A;  1QVG R;  2D41 A;  3OTB A;  3MTJ A;  2DNQ A;  2K2P A;  1AA1 B;  2HNZ B;  2UU9 F;  3DC2 A;  2YX7 A;  2WVD A;  1RXO B;  3MHY A;  3GFZ A;  1YBT A;  1P1L A;  4DR3 J;  1T05 B;  1Q8B A;  2K3I A;  4ED2 A;  2HS4 A;  3QIP B;  4NRU A;  1TFW A;  2D3Z A;  4F4K A;  1J5O A;  4I2P B;  4ED8 A;  4Y00 A;  3AOD A;  4F25 A;  1RAI B;  3T1Y F;  3DLL Q;  2R2R A;  1J2V A;  3RB0 A;  4JI7 F;  1C4C A;  3IBW A;  3AQP A;  1SH3 A;  1RBO B;  3H2V E;  5D6G A;  2QL7 B;  4F0M A;  3AAW B;  3ZZU A;  1Y5N B;  4ZVQ B;  4ZLP A;  5HVG A;  1PKU A;  1CVJ A;  4CO4 A;  5KFA A;  2DHA A;  3QRR A;  4DG1 A;  1BMQ B;  2OFG X;  3V6D B;  3QGP A;  2B9X A;  2J0W A;  2XGP A;  2IC3 A;  1XWL A;  1KNZ A;  1U02 A;  2Q3P A;  3DFE A;  5HK4 A;  3TI0 A;  1TTH B;  3F0N A;  2W2N P;  2JJ4 D;  2AEJ A;  4ZP6 A;  3HK2 A;  5CAA A;  2FY8 A;  1KLM B;  5CA5 A;  2JEF A;  1HNZ F;  1BWE A;  4GMK A;  2HBZ B;  1OY9 A;  4KTQ A;  1FER A;  4P10 A;  3ETO A;  3EWG A;  1S0N A;  3NS5 A;  1NM2 A;  3DU5 A;  4KFB B;  3J7Y U;  3QSY B;  3IXQ A;  1RU2 A;  2KT2 A;  2DH7 A;  1SQE A;  3LPY A;  3QPI A;  4N41 A;  2R2T A;  2ZD1 B;  4NCA A;  4LFA J;  1WTF A;  2N7C A;  3B4M A;  1TL4 A;  2CA9 A;  2V50 A;  1TL3 B;  3TO8 A;  2MMY A;  4RW8 A;  3BKF A;  4I6Y A;  3QLH B;  2AP6 A;  3GSD A;  4CYU A;  4DSI A;  1CJK B;  5BR8 F;  4B3S J;  1YTY A;  1T0T V;  2DNO A;  1PYT A;  5J2N B;  8AT1 B;  6FD1 A;  3LP0 A;  1S97 A;  4ZVU B;  3CVK A;  2C3M A;  4WYW A;  4DV6 F;  3V6K A;  4RPF A;  3KLF A;  2BKP A;  3AA8 A;  1GMU A;  2ASD A;  2ZJQ Q;  2AD9 A;  3R5G A;  2LEA A;  5HQ8 A;  2MEW A;  2W24 A;  1R43 A;  3D6H B;  3J7Y I;  2HK2 A;  4HI1 A;  4U6P A;  3JQJ A;  1W2B R;  2DR8 A;  2KJW A;  3CT9 A;  1WHV A;  2IJN A;  4CH7 A;  4YR3 A;  1UPP A;  2C2O B;  3J7Z 5;  3R1H A;  2GQC A;  1M0S A;  3T5L A;  1OSC A;  4M1K A;  3E8O A;  3KLI B;  2J6U A;  2HHW A;  3DGV A;  2QFI A;  4FP9 A;  4MKB A;  4JI2 F;  4QOT A;  1OS5 A;  1Q78 A;  3A8I A;  1FJG J;  2XI3 A;  1IM6 A;  2ATL A;  2KFN A;  5KOX A;  4OYM A;  2R3V A;  4KGV B;  1OY6 A;  2POK A;  2DNZ A;  3KHG A;  4KGZ B;  1RYS A;  3MPV A;  2YKN A;  3V6J A;  1FWP A;  1Y5I B;  1QE1 B;  1NJZ A;  1CJV A;  1FKO A;  1WEY A;  2HZA A;  4W98 A;  1AYE A;  4ICL B;  3CTR A;  2EXU A;  3W61 A;  4A46 A;  4JV5 F;  3M8P A;  5E3R A;  3MOJ B;  2UUT A;  4OHW A;  4IO9 Q;  3J7A 1;  4K2J A;  2R7R A;  3GII A;  1T9W A;  3M8Q A;  4JI3 J;  1RHJ B;  1YK9 A;  4R5P B;  4OZ5 A;  5DLF A;  2PA8 D;  3FRZ A;  3PEJ A;  1U1P A;  5E3C A;  4WXW A;  3BM7 A;  3O3L A;  4M94 A;  2HHH J;  2OPP A;  4K4T A;  1IKV B;  3BO4 A;  2UVU A;  1GK8 A;  4OMF G;  3KJV B;  2AHO B;  5BJR A;  2L08 A;  3I4P A;  4MK9 A;  1M5P C;  4GKJ J;  3SXL A;  3R1L A;  5ETT A;  1DFD A;  4NCG B;  4PKD B;  1BD6 A;  3GFH A;  5I42 B;  3RB6 A;  1XMQ J;  2DGW A;  4M5D B;  1S1T B;  5IFM A;  1ZAV A;  1NJW A;  5HAO A;  3TRG A;  2IM3 A;  4ZLL A;  4ECZ A;  4NRT A;  1U49 A;  3PR4 A;  1T9T A;  3LAL A;  1TUV A;  3R2D J;  1QSS A;  3PZP A;  5LMN F;  2C42 A;  2HVE A;  4K8R A;  2LQ8 A;  2CVI A;  4O3Q A;  1XMO J;  4GC7 A;  1VR6 A;  2GO8 A;  3P8B B;  1C0U A;  1RWN B;  2RDJ A;  2VPZ B;  1M5H A;  3DLE A;  1UKU A;  4KAI A;  2RS2 A;  3DM2 A;  4DSF A;  2ROP A;  1T9U A;  3A1Y G;  2ZBP A;  2B9W A;  2ZVI A;  4FVM A;  2ZH9 A;  3Q2T C;  1EKS A;  1HWL A;  3TQE A;  4DSJ A;  4PG6 A;  1DRZ A;  3OV7 A;  3CJ8 A;  2BJE A;  4ATN A;  3A8K A;  4HHH A;  1AB8 A;  3X1L B;  1NSA A;  4NLT A;  2YVS A;  1OMS A;  3GYG A;  3KG0 A;  3K5P A;  1Q81 T;  3M05 A;  2AW0 A;  1WD6 A;  2Q79 A;  3NBP A;  3FEZ A;  2CKW A;  4RWW A;  1BQN A;  1JNR B;  3HFK A;  4ILM A;  4CLL A;  1X9W A;  4AUK A;  3PO4 A;  4K4U A;  4OHY A;  1HNX J;  3CJ5 A;  2BZ2 A;  1HQU A;  2CQ2 A;  4CP5 A;  1QDU B;  4DSL A;  4DS4 A;  2P9E A;  5KFX A;  2PE8 A;  1X0F A;  3OVA A;  5KG5 A;  1PYS B;  1NME B;  2A2C A;  4HHJ A;  1R6Y A;  2LCW A;  3HJV A;  1C1C A;  1JLE A;  4YY3 F;  3PFE A;  3T5H A;  3C66 A;  2LYV A;  1NSK L;  3SQO P;  1EB0 A;  2FHJ A;  2HND B;  2VUG A;  1S59 A;  4X2B A;  4H4M A;  2JEJ A;  1D9A A;  3IFE A;  2EVZ A;  3MPW A;  1Y3K A;  2J9D E;  2RQ4 A;  4JI1 J;  4ZVE A;  3MM9 A;  5F0U A;  1AUD A;  1DY3 A;  2RQM A;  2L9N A;  3KK1 A;  3NS7 B;  4LBI A;  3WZ0 A;  3EJM A;  2R8H A;  3T41 A;  3ZTS A;  5CXT A;  5HLF A;  2MGZ B;  3P45 B;  4M5H A;  2MHE A;  4UTG A;  4C2M A;  1FJE B;  2J6T A;  4E0D A;  3DMJ A;  2BVZ A;  3D0I E;  1NK5 A;  2CQ4 A;  1CUL A;  3HD1 A;  2GJI A;  4LRB A;  2MY8 A;  1RKI A;  2M4M A;  2XUL A;  3KK2 A;  1HHS A;  1Z2L A;  2PSZ A;  1D3W A;  2L48 A;  4ECS A;  3IGN A;  4X84 A;  4MIB A;  4OI6 A;  1N6Q B;  4V19 J;  3R7B B;  3VAG A;  3KLG B;  4TXS A;  2Z4P A;  2GIR A;  4RKU C;  3ILI A;  2AJ4 A;  3AA9 A;  1H2T Z;  5HBM A;  2FGO A;  3BV8 A;  4LUB A;  1VRT B;  4ZCL A;  1VQP S;  2JVO A;  2RJZ A;  1L3T A;  3UPF A;  4RU9 A;  2DCU B;  4J9N A;  5L1K A;  3P6Y C;  2C2N A;  1JLB B;  4DV2 F;  2AYB A;  2W9B B;  4F3O A;  4Q5V A;  4C4W A;  5EN1 A;  1DZ5 A;  2WCX A;  3I0S A;  2KYX A;  3PW2 A;  3K2Y A;  3PAC A;  4DU8 A;  4URS A;  2R8J A;  1LFP A;  2E9T A;  3EX7 B;  1FWK A;  3QJJ A;  1F9F A;  4AD6 A;  1UW4 A;  5DRK A;  1BQX A;  3MMA B;  4YP3 A;  5DQH A;  5ITH A;  1PC4 A;  4A8S A;  2DY9 A;  3GQC A;  2OPQ B;  4HH0 A;  5G0R A;  1HBO A;  2ZM6 F;  2XB2 D;  2V69 A;  2WOM A;  1KQG B;  5I3P A;  5CCM A;  2V63 A;  3ISZ A;  4RNH A;  2IMO A;  9RUB A;  1IBM J;  1M90 T;  4ELV A;  2E5L F;  4RR5 A;  3W2V A;  4I64 A;  4HTI A;  2CQ0 A;  2ZOM A;  4DEZ A;  3Q8V A;  1RWX B;  1WKK A;  2ZH3 A;  1KSP A;  4IR9 A;  5DGB A;  5H9F J;  2MLX A;  4CIO A;  4O0N A;  1X9M A;  4XIU A;  1MRO B;  3ILL A;  1H2V Z;  1WDT A;  3MEE B;  3DRP A;  2NZC A;  3L09 A;  4JYA F;  4LF4 J;  2EG2 A;  4OZ1 A;  3MPY A;  4LSL B;  2HWH A;  4F4A A;  4WK3 A;  1Z4U A;  4HLB A;  2MQO A;  4JV1 A;  1FRL A;  4QIE A;  1VLO A;  4IFV A;  1LWE A;  4UT4 A;  1NU4 A;  5T41 A;  4DL4 A;  2CPF A;  4OYX A;  1RK8 A;  1WHW A;  2FHK A;  1SC4 B;  2ZE2 B;  1UJ5 A;  1S12 A;  4O0I A;  2LA4 A;  1CJT B;  5F8N A;  4RBV A;  1N5Q A;  4V19 X;  2DGQ A;  2Q6B A;  2C2M B;  3TYT A;  3MM8 A;  3UDV A;  3U1M A;  4B08 A;  2DHH A;  5THW A;  4E2F B;  4QWE A;  3FEX B;  3AB4 B;  3UCG A;  1SQF A;  3GON A;  4G1Q B;  4JI4 F;  1F6T A;  2J9E A;  2DGS A;  2LA6 A;  2HFU A;  4C8Y A;  2BM0 A;  4Q8F A;  5F8L A;  1XNR F;  1KVI A;  4KGX B;  3BO2 A;  3GR0 A;  2EKN A;  5G4D A;  3ENQ A;  1X9S A;  4ZCM A;  3W66 A;  4URG A;  1ACM B;  4KO0 A;  1N88 A;  4F2R A;  2OML A;  2HHQ A;  3W2W B;  4C8M A;  1IJE B;  1CS4 A;  4F0K A;  3HCX A;  2QYC A;  5CD4 A;  4DX7 A;  2V2V A;  1HQE B;  3KTQ A;  2QGF B;  2RDI A;  3OTD A;  4LF5 J;  4LFC F;  5EWG A;  3VF0 B;  1N0U A;  4I6A A;  4KY3 A;  3VV2 B;  5D78 A;  1GX6 A;  1IBK J;  2AJF E;  5KFB A;  1YGY A;  3AJ2 A;  4I4B A;  2XO6 A;  1K73 T;  3MOZ A;  2RH3 A;  2YY3 A;  5IV4 A;  4OV1 A;  1SV5 B;  3SV3 A;  3FSI A;  2QSW A;  3HLU A;  2IYG A;  5KOW A;  4ELU A;  2R7X A;  2E9R X;  2YKP A;  4CWB A;  4HYK A;  3SDE B;  3C16 A;  2AEF A;  4NOH A;  4XPE A;  4CTA B;  1OPI A;  3ULH A;  4YB7 A;  5F9L A;  3N6M A;  2V6A A;  2QA4 S;  1U09 A;  1H38 A;  3E01 B;  2OSQ A;  3BPS P;  1LNQ A;  1T9X A;  2MLY A;  4OYI A;  4WE1 A;  5KFE A;  4PUO B;  3CJK B;  4C11 A;  1NLK L;  1JLA B;  4AQY J;  2WON B;  2BJ3 A;  5L38 A;  3SV4 A;  4O4R A;  3HKZ D;  3T6B A;  1UW9 A;  2DHX A;  2B4O A;  4GO5 X;  1VQ8 S;  5IQQ A;  3ZO7 A;  1OYD A;  3R27 A;  1PBA A;  2HBY B;  5CYQ B;  1APS A;  4EO6 A;  4CH1 A;  4C3K A;  1VJW A;  2KU7 A;  3MMC A;  3LQV A;  1Q8K A;  3ZZT A;  3DHW C;  4KC5 A;  1NJY A;  1PO6 A;  2XMT A;  4RW6 B;  1S1V A;  5F0W A;  3BDE A;  1QVF R;  3RBD A;  2H1Y A;  4WU3 A;  4DR5 J;  3NGD A;  3RRH A;  2EFN A;  4DV3 F;  4WU2 A;  3PJX A;  1WSV A;  3THV A;  1DTQ A;  4J9R A;  2DRD A;  4K2X A;  1S0O A;  3EPI A;  1VC5 A;  4LSN B;  2RHQ B;  3ETM A;  5HL7 Q;  3UD3 P;  3NMA A;  2KFY A;  1HBM B;  4J9V A;  3DLH A;  2XSJ A;  3P96 A;  5IT9 Y;  2EPI A;  2N3L A;  3T5J A;  2CG8 A;  2AYG A;  1X5S A;  2HAF A;  2ADB A;  1WC5 A;  3C6U B;  1T94 A;  2XGQ A;  5IZH A;  4AE5 A;  5K8O A;  5LJ5 Y;  3TZY A;  2QA4 G;  3JXO A;  2MQP A;  5GAD U;  3TX8 A;  2KHD A;  2ZBC A;  1FRH A;  4ECW A;  3H25 A;  4M8L A;  5BYQ A;  1MMD A;  4A8W A;  1VQ6 S;  2XZW A;  4XO0 A;  2VA3 A;  2GJ2 A;  2FJD B;  3M4X A;  3KFW X;  2CNK B;  4B3R F;  1D09 B;  3TVY A;  4F50 A;  2RKI A;  4PG5 A;  1FE4 A;  1T11 A;  2E5I A;  1B7F A;  2HAI A;  2QLB B;  4DZ6 A;  3LTO A;  3TZW A;  2CPJ A;  1JXE A;  4HT7 A;  3MZI A;  4OI1 A;  4DR4 F;  2MSS A;  1AT1 B;  3BGF A;  5C24 A;  1X4G A;  3OFG A;  3G82 A;  1VFJ A;  5F8G A;  4MKY A;  1KON A;  4X64 F;  3IG1 B;  1S1U A;  2WSE C;  3NLC A;  2C28 A;  1IKW A;  5L46 A;  3KNG A;  4FYW B;  2R8I A;  4PPZ A;  1F5A A;  3OSN A;  3BGR A;  3M2U B;  1R27 B;  1ZM2 A;  2MTL A;  3GV5 B;  3G8Q A;  4TNO A;  5GAD I;  3BN7 A;  5B0E A;  4LRD A;  4DHV A;  4Y2A A;  3R7N B;  1RAA B;  1WC6 A;  1L3V A;  5D4P A;  2J0S D;  3OJU A;  1YZ7 A;  3AFG A;  2QV6 A;  1RT7 B;  3SQG A;  4JI8 F;  4CLS A;  3V2U C;  1TU0 B;  3VZH A;  2BE2 B;  4DV4 J;  1S4E A;  3CJS A;  4YS2 A;  3DLG A;  2GFF A;  1HKA A;  1VIS A;  1ULR A;  3MM6 B;  2VBZ A;  3PR5 B;  1F5C A;  4X4N A;  2E44 A;  3H8Y A;  2XLJ A;  4JI0 J;  3R6G B;  2MJN A;  2ZBI A;  4N56 A;  2V4J A;  1YVF A;  4UZC A;  5KT7 A;  4PAA A;  3B8H A;  3I0R A;  2V8D A;  1N48 A;  2I2Y A;  1D0E A;  1T02 A;  1N5T A;  2W9C A;  4ZVS B;  4P52 A;  2K8G A;  4IDK A;  3LGH A;  4QIW D;  4CO2 A;  2FIU A;  3I4H X;  4IOB A;  3RAQ A;  3O44 A;  1R31 A;  3CD6 S;  2EFO A;  2EBE A;  2NUH A;  1KEK A;  2AGO A;  2RU3 A;  1RBL A;  3G2X A;  2VQF J;  3GFY A;  4LF7 J;  4ZN1 A;  2FZC B;  1FFS B;  2RUG A;  3AT1 B;  2R7V A;  1RAH B;  2Z56 B;  5KFN A;  3UNY A;  5T7L B;  2A2D A;  1R8C A;  9ATC B;  2LEB A;  1TK5 A;  4PXB A;  5JJB A;  1U47 A;  5D0R A;  2GIQ A;  1R89 A;  4IQM A;  4Y28 C;  5KT2 A;  1I5O B;  2CPX A;  1QTN B;  3NEK A;  2V5H G;  4C3L A;  2KZZ A;  3DLK B;  4QQB A;  2ADC A;  3TUI C;  3V81 A;  2OEL A;  2R7T A;  2IY5 B;  4UQG A;  2L3M A;  3ZZ0 A;  5HRO B;  4GVB B;  2VON A;  4UST A;  5FDL B;  2BAN B;  4A4J A;  3AB2 B;  2ZFH A;  1RHK B;  1UAW A;  4O23 A;  1ZM3 A;  4XPC A;  2GCF A;  3DHX A;  1QJH A;  4DQQ A;  3MUV P;  2HVI A;  4ILR A;  4X66 J;  2J7W A;  2NZ4 A;  2Y1L B;  1RQ0 A;  4F4X A;  2D3U A;  3DKD A;  4OJ1 A;  1EX8 A;  2FLL A;  2E7W A;  3OTC A;  3VZI A;  1VQN S;  4C8L A;  1PAU B;  4DWI A;  1SBR A;  1M5O C;  3HP6 A;  4YR0 A;  3DRS A;  3GYX B;  1WF0 A;  1NAQ A;  1PYO B;  3MMJ A;  3D67 A;  5KFZ A;  2UUA J;  2WK4 A;  1OO0 B;  1IKY B;  1HYS A;  4ED3 A;  4HI2 A;  2IBO A;  1Q1K A;  3PJW A;  3RR8 A;  5B0B A;  1U1K A;  1S1X B;  4OYO A;  2MKS A;  4TU7 A;  1PBU A;  2IAJ A;  1YJN S;  4EO8 A;  1YJ7 A;  3MED A;  3EVM A;  1EIY B;  1ZA2 B;  1N4L A;  1OYE A;  3ICL A;  1FNX H;  5EHH A;  2YKO A;  2CZV C;  5K14 A;  5IT9 U;  1EAR A;  3BR8 A;  3U02 A;  1BHN A;  2P8I A;  2HQD A;  4FF3 A;  1HWU A;  4OLP A;  1HR0 J;  2Y8W A;  2XMV A;  4BDP A;  3IR7 B;  4IRC A;  2R8K A;  1UVK A;  3W9H A;  2NCK L;  3FGV A;  1NB7 A;  4AL5 A;  2IRX A;  4FVC A;  3TAR A;  2CDR B;  2VQE J;  1DTT B;  1N34 J;  2QTW A;  2VC0 A;  2LU2 A;  3MM7 B;  5D8H B;  3WC2 A;  2ACY A;  3ET6 B;  1DAX A;  2Z2Z A;  5LSR A;  4KKO B;  4JP8 A;  4CI0 B;  1LXJ A;  1FD2 A;  3LAN A;  4A8M P;  3FFI B;  4IG0 B;  5KT5 A;  1DQ9 A;  2CG4 A;  3QT7 A;  4WP3 A;  2LQ5 A;  1ZTT A;  2DVI A;  3UN3 A;  2HHV A;  1KQF B;  2X3G A;  4USI A;  1S5Z A;  4HDH A;  5C42 B;  2FZG B;  2RS8 A;  4DV1 F;  1C4A A;  2J0Q D;  5F8J A;  2GHV C;  3WDO A;  2J0X A;  1RT1 A;  2AJ0 A;  4Y2M A;  2ASY A;  1PG5 B;  3I55 S;  1NBE B;  1RT2 B;  2A0F B;  2DNH A;  3ZZR A;  3W5Z A;  3EZ5 A;  3W9I A;  2HVD A;  4NMX A;  5KFP A;  3W60 A;  4UOC A;  1PAE X;  3H4B A;  2G2Y A;  4NX9 A;  3T6J A;  2UXC J;  2ZHO A;  2FJA B;  4DLG A;  4TN2 A;  4O3R A;  2C3O A;  1U0S A;  2VOD A;  3SBM A;  1WF1 A;  4ID5 B;  4PXD A;  3HHD A;  3OLA A;  3FSX A;  2QSF A;  2ASL A;  4ZVR B;  2ROE A;  5IT0 A;  5EDW A;  3DRX A;  5ETV A;  1S0M A;  3OQ2 A;  2VG5 A;  1NZA A;  1TKX B;  4C6A A;  3D3B J;  3EM1 A;  2GVD A;  1NDC A;  4NLP A;  2JL9 A;  3MR5 A;  4NYP A;  4Q45 A;  4O3O A;  4YB1 P;  3J7A N;  3MFH A;  3FCW A;  2NR0 A;  5CYM B;  1ROF A;  3BH7 B;  3M6V A;  4ES3 A;  3QNW B;  1YKW A;  5EUH A;  1VC6 A;  4RWX A;  4B9U A;  2E1M C;  4LSZ B;  4IFY B;  3UDL A;  5GAG I;  2XO7 A;  4IKA A;  3ZTQ A;  4YME A;  2OEJ A;  3T3F A;  2A6M A;  2UVV A;  4EMD A;  1WSR A;  4HAC A;  1UP1 A;  3IP0 A;  3NWR A;  2DXD A;  2Z58 B;  3UO0 A;  4WF9 Q;  2GML A;  3TVK A;  2HNZ A;  1SB6 A;  4OV6 A;  3CD7 A;  2B6A B;  3RBZ A;  3W63 A;  3FBB A;  2VFV A;  5E5N A;  4TQS A;  3A3O B;  1FDD A;  1T05 A;  1K0T A;  3LAM A;  3R5J B;  1HBN B;  4ILL A;  3QIP A;  3OL6 A;  2B9Y A;  3PCO B;  4UF4 A;  4ZK7 M;  3V4I B;  4NA3 A;  2MKK A;  4I2P A;  3R5A A;  1VRU A;  4Q2M A;  3K5M A;  4OZ3 A;  2B3T B;  2LMI A;  4F0H A;  1OY8 A;  4J9P A;  3MR2 A;  4ZJO A;  3P5B P;  1RDR A;  4OZL A;  4W90 B;  3OW2 R;  3CCM S;  4GO7 X;  1DAR A;  1HNZ J;  1R6V A;  1KR4 A;  2COL A;  1JJH A;  1LWF A;  3NMR A;  1S6P B;  5ETK A;  1H7X A;  3FVY A;  1UFL A;  4DCP B;  4JI5 J;  3TWZ A;  5CAB A;  2Z0G A;  1X5T A;  3NAI A;  3W8P A;  2XBP A;  1VOM A;  1QUV A;  1LK7 A;  1S9E B;  3I82 A;  1GXT A;  2ZC4 A;  3W3S A;  2CJY B;  1KLM A;  1YI2 S;  1RAJ A;  4DUY J;  3BSC A;  5AXN A;  3C2P A;  2R2U A;  1KVK A;  1TVR B;  5J1E B;  2GJF A;  2YWF A;  4TKT A;  1B99 A;  4WFN Q;  4MIA A;  3GG0 A;  3B78 A;  4ZVF A;  1PIE A;  4PQU B;  5LSO A;  5I3U B;  3FKB A;  2AEM A;  2VFT A;  3NGR A;  2NSC A;  3IAM 9;  3QSI A;  1UFK A;  3RB3 A;  2ZD1 A;  3BH6 B;  1GH8 A;  2P6S A;  1TL3 A;  3QLH A;  2B4U A;  3BS9 A;  1TV6 B;  1CJK A;  1I94 J;  4HL9 A;  1SJQ A;  5FII A;  5KFV A;  1VQY A;  1LWC B;  4WTO B;  1Y5L B;  4DPU A;  2ZOF A;  2HBQ B;  1NK4 A;  5J2N A;  1LW0 B;  1RHR B;  1RT3 A;  3MEC B;  4G6V B;  1HW8 A;  2BW7 A;  4ETX A;  1S1W B;  2KT3 A;  1A0O B;  4ID8 A;  1YIJ S;  5E2Q A;  2DIU A;  2Z2M A;  2NXJ A;  3GIL A;  1HIY A;  2PII A;  3PRV A;  3TR5 A;  4CH0 S;  4NLG A;  2R9L A;  1MU2 B;  3GJR B;  3LF0 A;  1TMJ A;  1ZYQ A;  3OXG A;  4NZ7 A;  2HSE B;  4Y3C A;  4ZOS A;  2KJV A;  4A8F A;  2YH0 A;  3KLI A;  4PZV A;  4K0K J;  2CJB A;  2C3P A;  3I5B A;  1YSJ A;  3L7P A;  2V8V A;  2X1A A;  3RJM B;  3O6Q A;  4JV5 J;  1E6Y B;  1S6O A;  1IQZ A;  3IS9 B;  3F44 A;  1RIS A;  1Y3J A;  3CDU A;  1YJ9 S;  4TY8 B;  2ZOG A;  3TJ8 A;  3KHL A;  2CNN B;  3CC7 S;  4E98 A;  3F41 A;  5A2Q Y;  2R7O A;  3DOL B;  3OTO J;  3RW6 A;  1U1O A;  2N4C A;  1XTZ A;  2ZH4 A;  1Q95 G;  4DFP A;  2WBM A;  3LUY A;  2YNI B;  4YR2 A;  3QMQ A;  2CNL B;  3WX4 A;  1KTQ A;  2WVC A;  1N33 F;  4M5N A;  2XYP B;  1S48 A;  4CLU A;  4ICL A;  3PG9 A;  1TK0 A;  3BSO A;  1NDP A;  4MFB B;  5C25 B;  4WFZ A;  3MPU B;  3SIP B;  1VBY A;  2KI2 A;  3PYF A;  4R5P A;  2HQG A;  4CT8 A;  3AHP A;  2F8M A;  5A76 A;  2IVY A;  4PCQ A;  1B4S A;  2OPR B;  1QAX A;  2FB0 A;  1P6T A;  1IKV A;  1IR2 A;  3HF5 A;  2RAQ A;  4ITS A;  1UZH A;  3H2U B;  4C8O A;  4OHV A;  3MXH P;  3RYL A;  3KJV A;  1X4A A;  3CWJ A;  4ECX A;  2HQI A;  3CJQ A;  2J8A A;  2E29 A;  5KFK A;  1DQA A;  1IWA A;  1N56 A;  3NNA A;  4NCG A;  3SYZ A;  4WPA A;  2LEC A;  2W4D A;  5I42 A;  4ED0 A;  4M5D A;  3MAQ A;  5JVG Q;  1S1T A;  1MW7 A;  5KFH A;  2OHD A;  1KRP A;  4O3N A;  2ILY A;  3D7S B;  2AU0 A;  2DCL A;  1CJU B;  2DR6 A;  4EK2 A;  2DIT A;  3GJQ B;  2GIF A;  2VOO A;  3NCQ A;  4LRE A;  4NLS A;  1F3F A;  2FUG 9;  1GFW B;  3ZZY A;  1E6V B;  4OYP A;  2MKC A;  4OX8 A;  1NK8 A;  3OXF A;  1KHV A;  3CIM A;  4EWT A;  3ZNU A;  1SVD A;  3FCH A;  3BKT A;  4YHH F;  2P5V A;  2M52 A;  4R8U B;  2DGV A;  2M2B A;  4ZIW A;  3NNC A;  1Q53 A;  3N6L A;  1F2G A;  3AOA A;  4YOE A;  3VHQ A;  3OR1 B;  4HR2 A;  3M6W A;  1FNO A;  3R5D A;  1G4C A;  2CWX A;  2F8E X;  1MWY A;  4OYA A;  1S6Q B;  3R6L B;  3RR7 A;  3QT6 A;  2HHT A;  1B70 B;  2XC9 A;  2JNJ A;  4C98 A;  4LFA F;  4R25 A;  5H9E K;  2P6T A;  2A6O A;  2HK3 A;  2QMW A;  2VC1 A;  4OI2 A;  3W5X A;  2I5J A;  2GMJ A;  3RZA A;  2DEI A;  3AOC A;  3P3D A;  4B3S F;  2X51 A;  2Z30 B;  2B8P A;  4DI6 A;  4PR6 A;  3VAK A;  2AF6 A;  1U2F A;  5DGA A;  4E8U A;  2EFG A;  1URN A;  3MAA B;  4QYZ K;  3V4M A;  3HFV A;  2R7Q A;  5DDO C;  4WFX A;  3MR3 A;  4W92 B;  3TA2 A;  2UUC J;  3OHB A;  2OMO A;  3KK3 B;  1FF2 A;  4CDI A;  3PXG a;  5HVF A;  1TKZ B;  1AFI A;  4PPD A;  3WQP A;  2YKM B;  1S79 A;  2QLF B;  1UEV A;  1S7I A;  4B17 A;  4MMO A;  1WTB A;  2JX2 A;  1S9F A;  3C3L A;  4RBU A;  3PW0 A;  3RB4 A;  2UXB J;  1T9V A;  2J9D A;  2H54 B;  2BRK A;  2FQQ B;  1TUW A;  2PC6 A;  2VF3 A;  2BKO A;  1JB0 C;  2V34 A;  2I0X A;  3HDS A;  1TEL A;  1WKJ A;  4MIW A;  2XCA A;  3H98 A;  4ZVG A;  2ZDP A;  4ZIV A;  2BUN A;  2CFX A;  3QWU A;  1KS2 A;  4OYZ A;  3VAJ A;  1L3K A;  3HXM A;  2KZM A;  2MGZ A;  2LLZ A;  3IRW P;  2MQ8 A;  1QAI A;  1U1M A;  4KJI A;  2CQ1 A;  3LP1 B;  1TL7 B;  1HAR A;  2O3D A;  4I7F B;  1FTR A;  5L9N A;  4OL8 A;  4PQA A;  1M1K T;  3GPA A;  4DV2 J;  4OI3 A;  1T3N A;  1GMW A;  2XHC A;  4BS2 A;  2SXL A;  1N6Q A;  3NCR A;  4DPT A;  1VQL S;  3KLH B;  1WG5 A;  3Q83 A;  1CBK A;  1LEO A;  3AH6 A;  3KLG A;  2KDO A;  2DR9 A;  2EFP A;  4QR1 A;  1PSD A;  1Q16 B;  2AZ1 A;  1ZS6 A;  3RAX A;  2MLZ A;  1JJ2 R;  3IA0 A;  4AYB D;  1FES A;  1NB2 A;  3ONQ A;  1MG7 A;  1JLB A;  1GX5 A;  2W9B A;  4KIA A;  2CPH A;  4GKJ F;  1FXR A;  2R7W A;  4KHR A;  3D4J A;  4QW8 A;  4H4O B;  1CQM A;  4ZVT B;  3GWC A;  4GC6 A;  4USW A;  1VRQ C;  1XMQ F;  2E66 A;  2V4Q A;  1NK7 A;  3JSM B;  3H4D A;  4F36 A;  2UV8 A;  2A10 A;  2AT1 B;  2LKZ A;  3MMA A;  2NLW A;  1RCX B;  3GCW P;  3MM5 B;  3OR2 B;  3LOU A;  4FDF A;  4JYA J;  1YJV A;  2HGM A;  3FBF A;  1SC6 A;  4DPW A;  4QZV B;  3JTO A;  4N76 A;  1XMO F;  1VLY A;  4NLU A;  4WP9 A;  4Q7A A;  2OI2 A;  1TZ0 A;  4KV8 B;  3T9N A;  4FXD A;  4JUZ A;  4Z37 A;  2M3D A;  1SUQ B;  1NDL A;  1KDN A;  2RSQ A;  4NYO A;  3QZ8 A;  1MRO A;  3QAU A;  5DZ7 A;  3MEE A;  2KO1 A;  3OBI A;  1Y11 A;  3HJF A;  2W2Q P;  3PNI A;  3BQ0 A;  3UI3 A;  4LSL A;  1AW0 A;  1WDD A;  2Q66 A;  2L9W A;  3HSZ A;  1FRX A;  5HJY A;  1UVJ A;  1KC8 T;  4C9D A;  4A8Q A;  2M88 A;  5KG1 A;  1JLE B;  2ZE2 A;  4OX6 A;  2RVJ A;  5E41 A;  2HMI B;  5E33 A;  2RRN A;  4WWS A;  1HNX F;  4OX7 A;  1XNR J;  4IG3 A;  3U7J A;  4H4M B;  4NEZ A;  2KRB A;  2J6S A;  4WFY A;  1UVM A;  3ZTR A;  2M70 A;  3DOM B;  3QQC D;  1S0V A;  2V2Z A;  1ZA1 B;  4CM0 A;  4FKY A;  2ZZM A;  1N32 J;  1CG2 A;  3KK1 B;  3AD7 C;  2JDJ A;  1O51 A;  2Y0S D;  5B0G A;  4NXM J;  3AQO A;  5GMD A;  4CRJ A;  4ZP7 A;  3RRG A;  4K5R A;  1K9M T;  1UWB B;  3PX0 A;  1FHT A;  5L1L A;  5B09 A;  3DMJ B;  4B3T F;  2ZDO A;  4JV0 A;  4G1P A;  1JWW A;  1CUL B;  4LR7 A;  1VQ9 S;  3CCU S;  2YX1 A;  3DCA A;  3GG1 A;  5ETO A;  3S6E A;  1SL0 A;  3C6T B;  4J91 A;  2BA9 A;  3D6T B;  3OUY B;  1MNE A;  1Q4R A;  3VQS A;  2RUS A;  1OIA A;  1JJC B;  3BQ1 A;  3EUN A;  3W2W A;  5F9N A;  2YX4 A;  2VG7 B;  2XSF A;  5HBM B;  1NKC A;  2KTQ A;  5GME A;  1HQE A;  3D1O A;  3CE8 A;  3DYA B;  2ZH5 A;  4Y2K A;  2XY7 A;  4NZ6 A;  3M8R A;  2MPU A;  2OPS B;  1KBR A;  4LRF A;  3PM9 A;  2AQ4 A;  1F9E B;  3KUH A;  3RGI A;  2EKY A;  2JWN A;  2FC9 A;  5FLX Y;  2PT0 A;  3UN2 A;  3CJR A;  2DY1 A;  3ZZZ A;  1SV5 A;  2ALY B;  4I2Q A;  3TUJ C;  4PAB A;  3CC2 S;  4J9O A;  4KGK A;  3HT3 A;  4ZKA A;  3UW1 A;  1U8S A;  3SDE A;  2UVR A;  3GSI A;  2G1H A;  4CTA A;  5IT4 A;  2XG8 A;  2KG1 A;  3A8E A;  2AJ1 A;  4FNI A;  2W9A A;  2RRA A;  2KHC A;  1MWQ A;  3E01 A;  2MKI A;  2AV5 A;  1T7P A;  1X5O A;  4PUO A;  4KH1 B;  3GJT B;  3CJK A;  4TU9 A;  2KH9 A;  2OTL S;  1X4H A;  1VQM S;  3JAM U;  2UV8 G;  5CH7 B;  2OGU A;  4KHP J;  3PRB A;  2WB1 D;  2Y1R I;  2C22 A;  2W8K A;  3ELH A;  2HFO A;  2F5G A;  2QA1 A;  2E5G A;  4Y2I A;  1QSY A;  5CYQ A;  2ZBQ A;  1U6B A;  1XNQ J;  3QJL A;  4NLQ A;  2MDA A;  3HX9 A;  5IM0 A;  5KG2 A;  2CAD A;  2YQ0 A;  2ZKT A;  4EBE A;  3P49 B;  2JLF A;  1ARO P;  3N0V A;  1YRU A;  4RW6 A;  2BW2 A;  2DD8 S;  4MK8 A;  3FJ2 A;  3M8S A;  2K06 A;  4ERD A;  1REV B;  1FO1 A;  3EMT A;  2IM1 A;  5BXI A;  3GP9 A;  3H2L A;  2BJ1 A;  3CNQ P;  2YQ1 A;  3O2I A;  3ZFV A;  1P1T A;  1H6K X;  3HT0 A;  4IH5 A;  2GHW A;  4F3M A;  2D3O R;  3H7H B;  1TKT B;  1HLW A;  3CME S;  4LSN A;  1NSP A;  5F8H A;  4RO0 A;  1HWI A;  2L41 A;  2MZR A;  3T1H J;  2Q1L A;  4DN9 A;  3FK4 A;  3IM9 A;  4QBU A;  3K8V A;  1HI8 A;  5U47 A;  1HWK A;  2PI4 A;  2E1R A;  2YQ3 A;  4NLW A;  3C14 B;  1KOH A;  4QWD A;  2IYI A;  4ZMM A;  2F4V J;  4HEA 9;  4TY9 A;  4DPO A;  7FDR A;  2G1D A;  1RBA A;  2X3D A;  3C6U A;  3R3T A;  3EVW A;  2KXN B;  4CLY A;  5EWF A;  1CPZ A;  1WHX A;  3Q22 A;  1NK0 A;  3BRE A;  2QJ3 A;  2Q43 A;  4X65 F;  3GIJ A;  2YNG B;  3DDN A;  3Q2S C;  4AFF A;  3CED A;  4OZ0 A;  3TEG A;  3V6H A;  2E1P A;  3SI8 A;  2E5H A;  3PJ9 A;  1IN0 A;  4DL3 A;  3DOK B;  5HN0 A;  2H5J B;  4DXL A;  2DRB A;  3BJY A;  5KG6 A;  1VGY A;  2HGN A;  2RIL A;  4DV7 J;  3H40 A;  3BBC A;  4LQ9 A;  4KSE B;  4DU7 A;  3Q23 A;  3PO5 A;  2XNQ A;  3DLJ A;  2LXI A;  4JI8 J;  3IG1 A;  4WXO A;  3K7R A;  4HKQ A;  2CIM A;  3K8W A;  3M2U A;  4LF5 F;  3ISN C;  1SKS A;  3MPD A;  1KLN A;  5A8R B;  1IKX B;  5KT3 A;  2AGP A;  3JS9 A;  3C16 B;  2DNG A;  1U25 A;  5L39 A;  4K4V A;  3EDR B;  1BQM A;  3QWP A;  1N36 J;  1IBK F;  5KFC A;  1Y9O A;  3N28 A;  2OD6 A;  4F4W A;  1FKP B;  1EP4 A;  3LA0 A;  5HQM A;  4HVZ A;  1FFG B;  4XAK A;  1S6U A;  2E1C A;  1RT7 A;  4WE1 B;  4F4Z A;  4QWC A;  1NXI A;  3UWT A;  1U1L A;  4RZR A;  2AGQ A;  5E3P A;  1B64 A;  3PYG A;  2BE2 A;  1J27 A;  1HPZ B;  4TU8 A;  4ZS6 A;  5IC4 B;  2K7K A;  3W5Y A;  1C1B B;  1RWK B;  3OLB A;  2QA2 A;  2V0N A;  3MM6 A;  1QAY A;  3CIZ A;  3HKW A;  2W7O A;  2KM8 B;  4TLQ A;  4OI4 A;  3V5R A;  4IYQ A;  4USV A;  4WZM A;  5CZV A;  1EET A;  2JFD A;  4ED1 A;  1SPB P;  2PFD A;  3TAN A;  2HHS A;  2XMK A;  3HPO A;  4EFA C;  5KFR A;  2Z2Y B;  3S7R A;  4DR1 F;  3Q8S B;  3TP2 A;  2BM1 A;  1WOS A;  2FVR A;  2YWW A;  3I87 A;  4NPO A;  4ES1 A;  4LF6 F;  5DO2 A;  4P72 A;  5D77 A;  2OO4 A;  2FLN A;  5DQG A;  2LEP A;  1IR1 A;  3IAS 9;  1RAO A;  2IJR A;  2F4F A;  1M1H A;  2BV3 A;  5KFQ A;  5FLX U;  2VBX A;  5D3G B;  5DDR C;  3UE2 A;  3UFC X;  4OX9 F;  4OFZ A;  2GAH C;  1KVJ A;  4WJB A;  1VHF A;  3D28 A;  4ZPV R;  1R3N A;  4L72 B;  2XTJ P;  2Y8Y A;  3FRY A;  3CD5 A;  4LBH A;  3BF4 A;  1DJ0 A;  5KFJ A;  2JOQ A;  3LAK A;  5HVH A;  3QO9 B;  1FWL A;  1FFW B;  3M9N B;  5KG0 A;  1K44 A;  1CEZ A;  1UET A;  1FRI A;  2X1G A;  2YNF B;  5K20 B;  1I1G A;  4CLT A;  1HD1 A;  1NPK A;  3DLK A;  2XY6 A;  2Y1I A;  4RNN A;  5D4L A;  2IVM A;  5LXY A;  2CQC A;  5RUB A;  4P2X A;  4DL2 A;  5HRO A;  3BBF A;  3GR1 A;  1XR6 A;  2HW3 A;  4GVB A;  5FDL A;  3W8G A;  2BAN A;  1YIT S;  3HVW A;  5EX3 A;  2W25 A;  4Z2X A;  3FZB A;  3CPW R;  2B43 A;  4JOU A;  1I51 B;  1NND A;  2DKO B;  2KN4 A;  2PI5 A;  1BY9 A;  2F9D A;  2WRM A;  3M1V B;  4IQX A;  3HHK A;  3CUL A;  5GVQ A;  1S77 D;  2FJE B;  1IKW B;  3UNG C;  4OJ3 A;  2UUB J;  3HI9 A;  2DGT A;  1IKY A;  1U8W A;  4N8O A;  2CQH A;  3VGT A;  3LGN A;  3BDP A;  4LMZ A;  4ANE A;  3I96 A;  4ENO A;  4KPC A;  1YWX A;  2GQ2 A;  1WNE A;  1YJR A;  2F65 A;  1UJ6 A;  1S1X A;  2QC3 A;  2PN6 A;  3ZTP A;  2Y0B B;  2YH1 A;  4LT6 A;  5HMY A;  3WIV A;  1PGZ A;  2CPE A;  2CZ4 A;  2B56 A;  5IS2 A;  1JQG A;  1WOO A;  1NH8 A;  3K57 A;  1LQ9 A;  3KLE A;  5LT5 A;  1RTZ A;  3UDE A;  3HHE A;  4K50 A;  4CLZ A;  2GO9 A;  4M5M A;  3I5C A;  1IBL J;  1TKD A;  1JXL A;  2OTJ S;  1RT6 A;  1SKU B;  2ZH7 A;  4DV5 F;  1VC0 A;  2V9K A;  4XTT A;  4Y34 A;  1U0H B;  1KHW A;  1OQ6 A;  2WW8 A;  4WKY A;  3KMS A;  4PWD B;  1DTT A;  3JTP A;  2XS2 A;  3QGH A;  2KFZ A;  2H65 B;  3I0R B;  5B7W A;  4DV4 F;  4J7C A;  3MM7 A;  4DV1 J;  3CCR S;  2I8E A;  3ET6 A;  5HMW A;  2DIS A;  4GVL A;  4ANC A;  1ZOT A;  4X4O A;  3S8S A;  1UWA A;  3F73 A;  4BWM A;  5KG7 A;  4Q44 A;  3HD2 A;  1UFW A;  3ENV A;  5AXL A;  1CLF A;  4LR9 A;  1D9F A;  3FFI A;  1NJX A;  4LF2 A;  4IG0 A;  2C1E B;  3CF5 Q;  4A8Y A;  4KB7 A;  2XY5 A;  1SL1 A;  4C8N A;  4EYH B;  3QFH A;  4DR6 J;  4OZJ A;  1FDB A;  3G6Y A;  1LFW A;  4ZPT R;  3C15 B;  3GV8 B;  1S57 A;  1BWV A;  3KKF A;  3CD0 A;  2FJB B;  1H72 C;  1LOU A;  4C0O C;  2ZC3 A;  2IA0 A;  5HJX A;  2OSR A;  2K1R A;  3G8S A;  3A13 A;  2BE7 D;  1RT2 A;  5CYJ A;  4IH7 A;  4R0J A;  3THT A;  1MN9 A;  1RJJ A;  3L4B C;  3Q8R B;  1QLN A;  1VHI A;  4M5J A;  2O1P A;  2W01 A;  4L6V 3;  7FD1 A;  5D4O A;  3H59 A;  4BWJ A;  5A8K A;  2RF2 B;  2MXY A;  5AT1 B;  3H20 A;  4J9Q A;  1R7I A;  3TJA A;  4CO3 A;  2BJ7 A;  4ID5 A;  2VQF F;  3PDN A;  4TQR A;  2WVE A;  3VQT A;  2AX1 A;  5HO4 A;  2HQ3 A;  2ZWO A;  1TKX A;  4C0B A;  2GA7 A;  2ZVS A;  2Y9H A;  4EBC A;  1SCJ B;  3V81 B;  3IBC B;  4C8Z A;  4UUW A;  3OXL A;  2BR0 A;  3CDE A;  3NG8 A;  3T1A A;  4ZHR B;  4Q8E A;  2DO4 A;  1F1B B;  4G3I A;  2KVQ E;  4QJV A;  3UCU P;  1KFD A;  3VAL A;  2KG0 A;  1DQ8 A;  1Q8I A;  1YRT A;  4MYT A;  5CYM A;  2FDN A;  1MLA A;  3MMB B;  4DX6 A;  5ADZ A;  3TW0 A;  1ZM4 A;  5C7P A;  1OQ3 A;  3KJN B;  3DNC A;  3D6M B;  4IFY A;  3DI6 B;  3LGM A;  1EJ7 L;  5AJ3 J;  4RUA A;  1HHQ A;  1CC8 A;  2NXU A;  3MCO A;  1M1G A;  4BHQ A;  3SEO A;  4KHM A;  4U7U K;  1LWX A;  1WG1 A;  2XMW A;  2VBY A;  2WVF A;  2B6A A;  1SJ4 P;  4ZA1 A;  2R8G A;  2B5J B;  1REG X;  4DV0 F;  3QT8 A;  1FTC A;  4J90 A;  4A47 A;  3J80 U;  5J2P A;  2OUG A;  5AXK A;  2HRT A;  2JEI A;  1HBN A;  3T9Z A;  1R8P A;  2W2M P;  3V4I A;  2VOP A;  3TUZ C;  1T9Y A;  4EEY A;  1RAG B;  3PHE A;  3M2V B;  4PWW A;  3M8Z A;  4USU A;  4PXE A;  1U48 A;  3MGJ A;  5DET A;  4O3S A;  4JB8 B;  4PG7 A;  2CQP A;  4IH6 A;  2XLK A;  1T03 B;  3KG4 A;  4DCO B;  3UD4 P;  2BXJ A;  4B3M J;  4LF9 F;  4L76 A;  1V3S A;  4X4R A;  4OJH A;  1RTH B;  1IVZ A;  4PG8 A;  3MUR P;  4K4S A;  4ECU A;  1DBD A;  1FA0 A;  1N0V C;  4YB6 A;  3EVO A;  3PV8 A;  2W2P P;  2MST A;  2BMB A;  3OJS A;  3MEK A;  2J7U A;  1HR0 F;  3JSR A;  1RTD B;  1Y0H A;  4FBU A;  3TQ1 A;  3HZG A;  1HNI B;  4FPI A;  2MY7 A;  2VQE F;  1N34 F;  3CDW A;  3W62 A;  1VK3 A;  5KFM A;  1TVR A;  4BBY A;  4MAK A;  4TYB A;  4QWB A;  5J1E A;  4NXN F;  4QU7 A;  2AX0 A;  2FJW A;  1EQ0 A;  2FHJ D;  2BX6 A;  3N5F A;  4WIQ A;  5FJ4 A;  4R0E A;  4DL0 C;  2RIJ A;  3DGP B;  4PQU A;  5I3U A;  2JRS A;  4DR7 F;  4N77 A;  4DQI A;  2ZBR A;  1HNV B;  1K1S A;  3PKY A;  2RDD A;  2JH3 A;  2AJQ A;  4RL1 A;  2KB2 A;  2DNP A;  1BGX T;  3W65 A;  3MFI A;  1DHM A;  1R8B A;  2HHP A;  1S9G B;  1TV6 A;  5AE2 A;  1V5V A;  1G3O A;  2MKJ A;  1GAO A;  2XZT B;  2FTR A;  2C2D A;  1LWC A;  3J81 j;  3IBF B;  4Q0B B;  2VKZ G;  2HHU A;  4LBP A;  4P2M A;  2GVD B;  5IOL A;  1LW0 A;  3MEC A;  4LVO P;  1S1W A;  2W7A A;  2QLJ B;  1G1X A;  4ELT A;  3HZE A;  4O44 B;  2UXC F;  2CQ3 A;  3FMB A;  3K5L A;  1WF2 A;  4ER8 A;  1FXD A;  1FT8 A;  3OSP A;  1FDN A;  1PJ7 A;  3BGO P;  1O5J A;  4C8K A;  2X1B A;  4B3O A;  4OZN A;  2ZH6 A;  1MU2 A;  1RHQ B;  1X5P A;  3POT A;  1AUS L;  1Q5Y A;  3FBE A;  2IFX A;  4U8Y A;  4YEA A;  2QMU B;  1FVQ A;  1X7V A;  1N33 J;  2ZKU A;  4USK A;  3SSR A;  3D3C J;  5L8R C;  4BLG A;  4GKK J;  1NHV A;  5KFY A;  2WVB A;  1E6Y A;  4X4V A;  3IS9 A;  3W7B A;  1JKH B;  3A8J A;  4TY8 A;  2N82 B;  5E7O B;  4LFB F;  3DOL A;  4U7U D;  2XMU A;  1SKR A;  1VJQ A;  4FF2 A;  3H5X A;  2NUU G;  3QJP A;  5KG3 A;  2R4F A;  3KJF B;  2YNI A;  4EZ6 A;  2IBK A;  5ETM A;  4MH8 A;  2HIY A;  4UW2 A;  2W1B A;  1YDL A;  1PJ6 A;  1VRU B;  3FQK A;  1RTJ B;  2DPJ A;  4MFB A;  5C25 A;  5IWA J;  2OKQ A;  3BKU A;  4ZP9 A;  3EIC A;  3KOA A;  4WKR A;  4J5O A;  1X4D A;  1P27 B;  2BOA A;  2EWH A;  4J37 A;  2CQI A;  4C48 A;  2UP1 A;  1WC3 A;  4LRC A;  1BUX A;  1X4C A;  3OPK A;  4B9V A;  4P75 A;  2OPR A;  3MEG B;  5L1J A;  4RW4 B;  1UVN A;  2GZO A;  1LWF B;  2ILZ A;  2K3K A;  3W1Y C;  3AD9 C;  4UOH A;  2GVZ A;  3KNA A;  2CJK A;  1F60 B;  5KFO A;  3AJD A;  1NJI T;  1O8B A;  3L95 X;  2KVI A;  1K8A T;  2DPI A;  2HRU A;  2NQP A;  2NS1 B;  4DQS A;  1QTM A;  4LIW A;  1OPZ A;  4YHH J;  4IOC Q;  1TK8 A;  3UR0 A;  3ILJ A;  4NLV A;  4FYV B;  2XWX A;  2HNY B;  2G0I A;  3BR9 A;  2LDY A;  1NEE A;  1TR0 A;  1CJU A;  1RWU A;  3D6F B;  2IHR 1;  2RT3 A;  2CUY A;  4RW9 B;  4BC9 A;  2RD5 C;  5KFL A;  5M2P A;  4JI5 F;  4Y65 A;  4YN3 B;  3IN5 A;  3DXB A;  1FJC A;  1E6V A;  3K59 A;  1RWP B;  3VVU A;  1X4B A;  4RLE A;  1HMV B;  1X60 A;  2XWY A;  4HH1 A;  4JI6 J;  2LQJ A;  1EKR A;  4ZPA A;  2B51 A;  4FYY B;  4R8U A;  3TZZ A;  1FK9 B;  3AD8 C;  1Z2Z A;  3L7U A;  2N4D A;  4DUY F;  2VAS A;  2HFV A;  2ZH8 A;  2C2R A;  3OR1 A;  3OD2 A;  3DDK A;  2LU1 A;  1BLU A;  1YBA A;  2XM3 A;  3HHL B;  1AZS B;  3UQS A;  4EUV A;  1X0P A;  2L9D A;  1KFS A;  1LV5 A;  1J5E J;  1N52 B;  3JQM A;  4M63 A;  5KFG A;  1ZTW A;  4FZV A;  4Y2C A;  1S6Q A;  2DHG A;  1X4F A;  1RT3 B;  2F8H A;  5KAK A;  1ELO A;  3WHI A;  2PDA A;  1Q7Y T;  4DR2 F;  3NP5 A;  4NI2 B;  3B82 A;  4C3M A;  8ATC B;  1G7C B;  3CCQ S;  3SCJ E;  2KKH A;  3QYY A;  4Q43 A;  1I94 F;  1Q8L A;  3UR3 C;  5C2G A;  1RLD A;  1S76 D;  3DN9 A;  5J2M B;  1GT8 A;  1IWG A;  3PVX A;  3MCN A;  3RAM A;  4UZB A;  1U6Z A;  3H90 A;  3MAA A;  3DRR B;  1KKH A;  1NPR A;  2LQB A;  3VAM A;  3FSY A;  4F67 A;  3KK3 A;  5MAO A;  4DPX A;  1VI7 A;  3TAM B;  4N5S A;  1RGV A;  4C0H A;  1TKZ A;  3VTI A;  2YKM A;  5BYS A;  3Q86 A;  1EZZ B;  2PEH A;  3D5M A;  3GTY X;  1R0C B;  2BQ3 A;  4I1T A;  4AXJ A;  1CC7 A;  1FRJ A;  1GQE A;  4K0K F;  1KQK A;  1C0T B;  3MUT P;  2VU5 A;  3PHT A;  3FUY A;  3JTN A;  2B0G A;  2AMC B;  1RT5 A;  2DGO A;  4DN0 A;  1LK5 A;  5HAN A;  2EEY A;  3KUE A;  2AYE A;  4LF8 F;  3IRX B;  3OTO F;  3G71 S;  1CSJ A;  3M32 A;  4K4Y A;  1H0H B;  3J81 U;  5ETQ A;  4KGM A;  5LOQ A;  3LP1 A;  1TL7 A;  4I7F A;  1TAQ A;  2V2K A;  2R2S A;  1KTV A;  2F7V A;  3VGS A;  2GHP A;  4UOG A;  3SCI E;  4PWU A;  4DF8 A;  4NYZ A;  1S7H A;  3CUN A;  1N5S A;  2IRY A;  3TA1 A;  1SL2 A;  3LH2 S;  4NA2 A;  3T19 A;  4Y6I A;  4NEY A;  3BO3 A;  3LP2 B;  3DU6 A;  2B8Q A;  1Y00 A;  3ZTO A;  3KLH A;  5B0D A;  2U2F A;  3D0H E;  3HHN B;  1SQG A;  4I67 A;  2FLO A;  1TL1 B;  2V67 A;  1XMB A;  1RLC L;  3EGZ A;  1VQ5 S;  3KXD A;  3KYL A;  1VYA A;  2HFS A;  2IVF B;  1QY7 A;  5CZX A;  3HSJ A;  4RW7 B;  2GW8 A;  3UVJ B;  3MAH A;  2EW9 A;  5SUH A;  3Q0A A;  1DLO B;  2QMX A;  2VZ9 A;  1U6F A;  1OSD A;  2YPZ A;  3N01 A;  4FXW A;  4H4O A;  1FRK A;  4PYD A;  2DNK A;  1VDH A;  4ED7 A;  2OEK A;  4FKX A;  2WSC C;  2HIQ A;  2AJ2 A;  1QM9 A;  3NS6 A;  1VIO A;  1Q5V A;  3ITH A;  3JSM A;  2XMM A;  1A7G E;  1P9Q C;  1UJ4 A;  2DBB A;  1ZET A;  1W7W A;  2FY1 A;  2CPY A;  3M9O B;  1B0V A;  3KHR A;  3EXY A;  3MM5 A;  3OR2 A;  3EYZ A;  4DBQ A;  2YBV A;  2APO A;  2YNH B;  4RNF A;  2GGP B;  3JYT B;  2ZHB A;  3GJS B;  2QRR A;  2QLW A;  1RTI B;  4OYB A;  3ZC4 A;  4U9R A;  1S4F A;  1TAU A;  4DUZ J;  2QYG A;  4JBC A;  4FYD A;  4KV8 A;  1TMM A;  2VH7 A;  4MYU A;  1G2E A;  2I5J B;  2C2E A;  1VQK S;  2W2O P;  4FF4 A;  3EXC X;  4WZQ A;  2GQQ A;  5DS7 A;  1SUQ A;  3BB5 A;  4RNM A;  5A8W B;  2C3Y A;  2DYA A;  2VPY B;  3CCW A;  5AXM A;  3SSQ A;  5HAT A;  4LRA A;  3FMW A;  4IRK A;  5J1N A;  2PEB A;  5JXS A;  5KFD A;  2R7S A;  5T14 A;  1JLF B;  4CT9 A;  3US5 A;  2VHG A;  3N79 A;  2GAG C;  4OLO A;  4BCA A;  4ED6 A;  4ZN3 A;  1NK6 A;  5K8N A;  2O01 C;  4DS5 A;  4DQR A;  2EG1 A;  1JNZ B;  3KUG A;  4ZVH A;  3G87 A;  1IR0 A;  3KHH A;  2HMI A;  3EZU A;  1H98 A;  1JLQ B;  4B3T J;  2B4P A;  2UXD F;  4B9N A;  4NA1 A;  1IM4 A;  1U24 A;  3PEH A;  4QR0 A;  2ZUA A;  3IM8 A;  1RYR A;  2WTF A;  3CB4 A;  5ETS A;  3KMQ A;  1YZ6 A;  2UUC F;  2IRU A;  1PIL A;  4U67 Q;  4F04 B;  3DOM A;  2LVW A;  1UA1 A;  1F9H A;  4KBI A;  3HVR A;  2W7P A;  2BDP A;  1UEU A;  3CCJ S;  1ZPV A;  2CQD A;  3BEG B;  5GAG U;  1RCO B;  1UWB A;  2VPX B;  4W4M A;  2YPY A;  1SH2 A;  1F0X A;  4B9T A;  5GAE U;  2UXB F;  1YJT A;  1QAJ A;  1MN7 A;  2Q6C A;  5A6P A;  2V8G A;  3C6T A;  3I9V 9;  4X62 J;  2AYM A;  4NLR A;  3MR7 A;  3CGI A;  3OUY A;  1HBU A;  1Q7L B;  4YQW A;  2B9E A;  4HHU A;  3M30 B;  2VG7 A;  2Y1J A;  3RBE A;  1D8Z A;  3M2R B;  3VWS A;  2DNN A;  2UU9 J;  5HP1 B;  3DYA A;  2DRA A;  1RHU B;  4I56 A;  2O5D A;  1V5I B;  2VB6 A;  1RT4 B;  2OPS A;  5B0A A;  4LVN P;  4H4K A;  2B7C B;  3RTV A;  2DB1 A;  2Y3Y A;  3FDS A;  3KLV A;  4FS2 A;  5GAE I;  2O66 A;  1KQS R;  1U2C A;  1GXU A;  4DSE A;  5DDP C;  3NNH A;  3T1Y J;  3PFO A;  4JI7 J;  4N7T A;  3P5T L;  1WEZ A;  2N7Y A;  4QPT A;  2XMJ A;  2VG6 B;  2WAQ D;  4EU0 A;  1HNW F;  2DXE A;  3QZ7 A;  4IRD A;  2HLT A;  1ICE B;  1EAY C;  2ZIT A;  2UVW A;  2Z8Q A;  1U45 A;  4ZPB A;  2D1C A;  3GLJ A;  4ZLN A;  5F8M A;  1EQM A;  3PIP Q;  5KFT A;  3NKY A;  3R5C A;  5J2Q B;  3CJ0 A;  3AY0 A;  3Q8Q B;  3K5O A;  2VL1 A;  4YB5 A;  2BOP A;  3IGV A;  3M9M B;  5C5J A;  2ROG A;  4B9M A;  2CYY A;  2VJV A;  1M5K C;  1UZD A;  5DM6 Q;  1HD0 A;  3DDI A;  3V6D A;  5GAH U;  3ZZP A;  4DFM A;  3L7O A;  1IUJ A;  1QD1 A;  2XYH B;  1FE0 A;  3HM9 A;  3TNV A;  4QIV A;  2D69 A;  2HPU A;  4G1I A;  2M0G B;  3N4W A;  3CMQ A;  2XEX A;  2HKE A;  1FEH A;  1XBW A;  2CDQ A;  2XHW A;  1REV A;  4OYW A;  1WI8 A;  2DO0 A;  4MJK A;  2DT9 A;  1YQH A;  1JLG B;  2D9P A;  4ZIT A;  3H5Y A;  1KN6 A;  2PA3 A;  3TUP A;  4IG3 B;  1FX4 A;  5BR8 J;  3CJ2 A;  3PTW A;  2YWH A;  3TAQ A;  3BYR A;  3A4T A;  1SJ1 A;  4KFB A;  3S1T A;  4B9L A;  1TKT A;  3MCM A;  3HVT B;  2I6W A;  4JV2 A;  4X65 J;  2HS0 A;  2VD3 A;  4ES2 A;  1FI4 A;  4O4G B;  4DV6 J;  5ETL A;  4J9U E;  2CQG A;  1FDA A;  2VKR A;  3U1N A;  5C2C A;  5GAH I;  5B0F A;  3C14 A;  2IJF A;  2KYZ A;  5A0Y B;  4WP8 A;  3PX4 A;  1FJ7 A;  2J9C A;  1LW2 B;  2ZZT A;  1RWW B;  2H4W B;  3NXZ A;  5LMU F;  3DXS X;  3MUM P;  3SSS A;  3JSY A;  3R5B A;  1SI9 A;  2G9O A;  2BAB A;  3OTE A;  4USH A;  1N32 F;  1B3T A;  2MQQ A;  2QEX S;  4NXM F;  2YNG A;  4JI2 J;  2PMH A;  1WC4 A;  2E5J A;  4M95 A;  3B4D A;  1WG4 A;  4KT0 C;  1QSL A;  4LR8 A;  3RW7 A;  2VV5 A;  3MD3 A;  4F2S A;  1U1Q A;  3DOK A;  1V3R A;  3Q8Y A;  1JLC B;  2RU9 A;  4P6Q A;  1N5Y B;  4KQZ A;  1RB0 A;  3TX0 A;  1R0A B;  2FHO B;  2PMZ D;  5MLC V;  1W2I A;  4J9S A;  4B02 A;  5H1S V;  3RRK A;  4PRF A;  4I69 A;  2MHN A;  1BC6 A;  2FD2 A;  3CJ3 A;  4FNH A;  2DGU A;  2CWK A;  3O5T B;  1H74 A;  4GRS A;  1TP7 A;  2F3J A;  2QIF A;  4I2Q B;  5JVH Q;  1IXK A;  8RUC A;  1HQ2 A;  3GE9 A;  4Y0F A;  2OH2 A;  5HI7 A;  4UY8 5;  4KE5 A;  5A8R A;  1IKX A;  4DDF A;  1GTH A;  1V9O A;  4B9S A;  4FF1 A;  4AT1 B;  3A3P B;  4J9M A;  1QE1 A;  1B0T A;  2CAJ A;  4LIR A;  1FKP A;  1VQ4 S;  2VJU A;  3H42 A;  2FHM A;  1J5O B;  5IXU A;  3NGT A;  1U1R A;  3GB0 A;  2CRL A;  4L73 A;  2BKN A;  4CO1 A;  1HPZ A;  4ZJL A;  4DR1 J;  1XJW B;  2BRL A;  4U8V A;  1C1B A;  4RUB A;  5I3Q A;  2HVH A;  4LF6 J;  1GTE A;  2VFS A;  1HWJ A;  4DR3 F;  2WBR A;  3HUL A;  5D15 A;  2BYC A;  4U95 A;  1JJ4 A;  2XS5 A;  4WK1 A;  4DG1 B;  2KXF A;  5LSL A;  3UCZ P;  3Q89 A;  2HWT A;  5IM0 B;  5DLG A;  1WWH A;  2ZH1 A;  5LMN J;  1YX2 A;  1B0P A;  2IC3 B;  4WFA Q;  2HFZ A;  4BC7 A;  3HO1 A;  1Q79 A;  4OX9 J;  4KHP F;  3F56 A;  5M2R A;  4NCB A;  3N6N A;  5LL6 d;  1I3O B;  2QLX A;  3NGU A;  3NAH A;  4UQT A;  2RRB A;  1Q0N A;  1XNQ F;  1WOP A;  4P2F A;  1UCN A;  4EZ9 A;  5D3G A;  3P4U B;  4CM2 A;  2AKW B;  3EZO A;  4X4P A;  4QW9 A;  3Q24 A;  4I6W A;  1WI6 A;  3MCS A;  1JIH A;  4DX5 A;  2DNY A;  4URQ U;  1SKW A;  3NWG A;  1SC3 B;  1Y4Z B;  1ZM9 A;  2D9O A;  4RW8 B;  1OJ4 A;  2JEG A;  4CNY A;  1A6L A;  2DTJ A;  4CYU B;  4ZPC A;  4EYI B;  2QL5 B;  2VDH A;  3QO9 A;  5HQL A;  3KDO A;  2MZT A;  3PIO Q;  2IMW P;  2HGL A;  2XNR A;  3R7S B;  3SFG A;  3LP0 B;  1L3U A;  3ENW A;  1VS3 A;  2YNF A;  5EWE A;  1ZH5 A;  3T1H F;  2FYX A;  3BGU A;  3J7Z T;  3KLF B;  4AL7 A;  3K17 A;  3DLB A;  2AIR B;  3UDC A;  4A48 A;  3ADA C;  2F4V F;  4DL7 A;  1X8D A;  2NPI A;  4DZD A;  1RUS A;  3TA0 A;  4YY3 J;  1NDK A;  5L9X A;  2DHS A;  1RWM B;  3D1H A;  3AJ1 A;  3FNN A;  4OQJ A;  1NPP A;  2W4P A;  4H4K C;  5E3Q A;  1Q86 T;  3RUB L;  3M1V A;  1NK9 A;  2KL8 A;  4L3N A;  3FBC A;  4RUH A;  2CJQ A;  1LKZ A;  2V8H A;  4IUF A;  1V3Z A;  3PYD A;  6AT1 B;  2F9J A;  2CZ9 A;  4ED4 A;  2RQK A;  3IC1 A;  1KOO A;  2YKN B;  4DV7 F;  5ETR A;  1BQM B;  4LF1 A;  1CJV B;  5K8P A;  2LP4 A;  2DH9 A;  1VMB A;  1FKO B;  3OFF A;  1EP4 B;  1RI7 A;  2IIH A;  2HND A;  4DV5 J;  2YKQ A;  3R97 A;  1FJG F;  3M8P B;  2DIV A;  3D54 A;  4F8R A;  2JVR A;  3M8Q B;  4O3P A;  7AT1 B;  2CPI A;  1MML A;  1GEH A;  5DJB A;  3VGU A;  2HS3 A;  1PJ5 A;  5DG7 A;  3JAM Y;  5K5M A;  5AE3 A;  4TLR A;  2I38 A;  1N36 F;  4NAS A;  2OPP B;  1EET B;  3OFE A;  1U0H A;  1KD1 T;  3BYP A;  2PD1 A;  4PWD A;  3ZZO A;  3CDA A;  4XK8 C;  3AOB A;  2ZHA A;  4JI3 F;  2RML A;  4WBF A;  2NPF A;  1ITP A;  2IM2 A;  2LQ9 A;  4CCH A;  4PEO A;  1RWO B;  5CD4 H;  2NSB A;  2HHH F;  5KFW A;  5FD1 A;  1RAD B;  1SH0 A;  4U96 A;  3G6X A;  3CXC R;  1VRT A;  3QRQ A;  4QU6 A;  2J76 E;  5F3T A;  2BE9 B;  3AXK A;  3L3C A;  2DNR A;  3OL7 A;  2IA6 A;  1NCL A;  1U7L A;  3C15 A;  2G4B A;  5M2U A;  2ZM6 J;  4DPY A;  2XZD B;  4NLX A;  3OL9 A;  3A12 A;  3FCV A;  1C0U B;  2FVS A;  3CCT A;  3DLE B;  2E5L J;  1U2R A;  1I6J A;  1S72 S;  3DM2 B;  3MR6 A;  2ZJR Q;  1CQN A;  1RSC A;  2RF2 A;  1FRM A;  1XN9 A;  2D3O 1;  1W25 A;  2Z2L A;  2JC0 A;  1UVL A;  2N3O A;  3I31 A;  4LJM A;  1SIZ A;  2OLW A;  1M5V C;  2J8S A;  4ECT A;  3RBX A;  4DJB A;  2OPQ A;  1KP6 A;  2M9K A;  3CDB A;  2XLI A;  1LXN A;  3O1L A;  1YG0 A;  2ZEJ A;  3GIK A;  3OL8 A;  4ZHR A;  3OVS A;  4ZCI A;  3KJQ B;  2IM0 A;  3QBC A;  3NBP B;  1BQN B;  4L75 A;  3G8T A;  4MK7 A;  4DFK A;  3MMB A;  3CCV S;  4KRW A;  2CPD A;  5EX0 A;  2FZK B;  2Z57 B;  5EGY A;  5HSP A;  4KPY A;  2H3E B;  2HEK A;  1VCT A;  1HQU B;  5KFU A;  1F3V A;  4DV0 J;  5DM7 Q;  1W26 A;  4LQ3 A;  3DI6 A;  5I4M A;  1U4B A;  3G4S S;  1JX4 A;  1DUR A;  3QAE A;  1C1C B;  2J7K A;  4K4X A;  4JI4 J;  2AZ3 A;  3WX8 A;  4PXC A;  4RBT A;  1ZZN A;  1UPM B;  2EI5 A;  1FXL A;  4QCL A;  2PGC A;  5A6W A;  3A3N B;  5KFS A;  3PRD A;  3N9U C;  5AE1 A;  2CPZ A;  5CQG A;  4OJG A;  2EFQ A;  2QG9 B;  4NE9 C;  2B5J A;  1CJT A;  5HMZ A;  5LXR A;  1WHY A;  3E3X A;  2OP5 A;  3D0G E;  5DZ6 A;  2RHS B;  4LF9 J;  1SC1 B;  2EK1 A;  3MM9 B;  1TUG B;  2DNM A;  1IJF B;  2UUB F;  5E0O A;  4NML A;  1NRK A;  4FBT A;  4ZPW R;  1FD8 A;  3KLE B;  4G1Q A;  5HLF B;  1WC1 A;  1XEZ A;  1UMJ A;  2FJV A;  3M2V A;  2BJ9 A;  2HBR B;  2E7V A;  3GV7 B;  4LFC J;  1RT6 B;  2KM8 C;  3QFW A;  1T03 A;  1N54 B;  2JHE A;  1UTA A;  2VPW B;  1XER A;  5DQI A;  3KK2 B;  4JI1 F;  4KYZ A;  3CJ4 A;  5GMK a;  4NXN J;  4I68 A;  1RTH A;  1RAF B;  4ZJQ A;  3X3U A;  3Q8P B;  5K8M A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  3L7U A;  2AZ3 A;  2HVE A;  3Q8U A;  3WX8 A;  4ANC A;  3FBE A;  1S5Z A;  3EVM A;  1UCN A;  1NUE A;  3BBB A;  2BX6 A;  2DY9 A;  1U8W A;  3BBC A;  4CP5 A;  3NGT A;  3VGT A;  1VYA A;  5CAA A;  4ANE A;  4UOH A;  1HLW A;  3ZTQ A;  4ENO A;  4KPC A;  2DYA A;  3FBC A;  4F36 A;  1NSP A;  4EK2 A;  2HVD A;  3ZTP A;  2B8P A;  2VU5 A;  1K44 A;  4DI6 A;  1EHW A;  1BE4 A;  1MN7 A;  1BHN A;  2BEF A;  5CAB A;  4AND A;  1PAE X;  2HUR A;  3VVT A;  1F3F A;  4DUT A;  5C7P A;  1NPK A;  2DXD A;  4WBF A;  3B54 A;  3Q8Y A;  2DXF A;  3Q8V A;  1NDP A;  1F6T A;  1WKK A;  2NCK L;  3ELH A;  1S57 A;  3VGV A;  3G2X A;  3MPD A;  4FKX A;  2DXE A;  3GPA A;  3FBF A;  1NHK L;  1HIY A;  3JS9 A;  3FC9 A;  4O0N A;  1NSK L;  3EE3 A;  3Q89 A;  3PRV A;  3BBF A;  3DKD A;  1MN9 A;  1S59 A;  3ZTR A;  3FBB A;  3Q83 A;  3R9L A;  2CWK A;  3EVW A;  5IOL A;  1LEO A;  1XIQ A;  1HHQ A;  4FKY A;  1W7W A;  4C6A A;  1B4S A;  3EVO A;  4DZ6 A;  1NSQ A;  3EM1 A;  1XQI A;  4F4A A;  1NDC A;  3VGS A;  1NCL A;  4HR2 A;  1B99 A;  4UOG A;  3ENA A;  1LWX A;  3VVU A;  2AZ1 A;  1ZS6 A;  4UOF A;  1PKU A;  3EIC A;  3EJM A;  2ZUA A;  1NDL A;  1KDN A;  3ZTS A;  3FCW A;  3EMT A;  3FKB A;  5BXI A;  3NGS A;  1NLK L;  3FCV A;  3B6B A;  3NGU A;  3VGU A;  2B8Q A;  1NB2 A;  3BH7 B;  3NGR A;  3DDI A;  3ZTO A;  3GP9 A;  1WKJ A;  4W98 A;  3Q86 A;  1BUX A;  1JXV A;  1WKL A;  3ETM A;  3PJ9 A;  1NDK A;  4S0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...