1NCLA

Thermal stability of hexameric and tetrameric nucleoside, diphosphate kinases
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAGGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermal stability of hexameric and tetrameric nucleoside diphosphate kinases. Effect of subunit interaction.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nclA00
1NPKA 2B8PA 3ZTPA 4C6AA 2ZUAA 1U8WA 3NGTA 3VVTA 2AZ1A 1NCLA 3FBBA 4S0MA 3VGTA 4UOFA 1LEOA 4O0NA 3BH6B 3Q86A 4FKXA 3FKBA 1WKKA 3VGSA 3EJMA 3FBCA 2DY9A 1F6TA 2HVEA 1NDKA 3EVMA 3DKDA 1ZS6A 3FCVA 4EK2A 3Q8VA 3NGSA 1K44A 4F36A 3GPAA 1S59A 5C7PA 3VVUA 3Q83A 3NGUA 3PJ9A 1B4SA 2B8QA 3ETMA 1NLKL 1S5ZA 2VU5A 4FKYA 3VGUA 1NDCA 4UOGA 3GP9A 3BBCA 2BEFA 1F3FA 1KDNA 2BX6A 3NGRA 3EE3A 3BBFA 5CAAA 3BH7B 3Q89A 3FBFA 1HLWA 4DZ6A 3FBEA 3ZTRA 3EM1A 2HURA 3R9LA 3EMTA 2DXFA 4WBFA 3ZTOA 3JS9A 5IOLA 3ELHA 4ANEA 1NHKL 3EICA 2DYAA 4W98A 3ZTSA 1BHNA 1BUXA 4UOHA 3EVOA 4F4AA 1VYAA 1HIYA 3EVWA 3FCWA 1NDLA 1PAEX 1UCNA 1PKUA 2CWKA 3G2XA 3PRVA 4HR2A 1WKLA 3ZTQA 3WX8A 5CABA 1BE4A 2DXDA 2AZ3A 4KPCA 3VGVA 3Q8UA 4DUTA 1NSQA 1S57A 4CP5A 1MN7A 1XIQA 1NUEA 4ANCA 5BXIA 4DI6A 3FC9A 1NSKL 4ANDA 1W7WA 1JXVA 3DDIA 3BBBA 1NDPA 1MN9A 1WKJA 3B54A 4ENOA 3Q8YA 3MPDA 1NSPA 3B6BA 2NCKL 1NB2A 3ENAA 1EHWA 1HHQA 2DXEA 3L7UA 1B99A 1LWXA 2HVDA 1XQIA
chains in the Genus database with same CATH superfamily
4OX6A 4ELUA 3D1HA 5IC6B 2ZOFA 3AOCA 4KFBA 1GH8A 3PW2A 1PJ5A 4ZPVR 4OMFG 2F7VA 4RW6A 4WP3A 2HNZB 4C2MA 1RTZA 1WORA 2O67A 3NOCA 1YGYA 3FBBA 3SDEB 2ZJQQ 1U1QA 4TU9A 4L3NA 2CRLA 3S7RA 3NS5A 3OLAA 2FHOB 3MM8A 1JXLA 2AHOB 5HJYA 1VQMS 2UXDF 1JLBB 2ZNYA 1Y00A 1U45A 4PWDB 2O01C 1MMLA 1RT1B 2L9NA 4IG0B 4M5KA 2QA4S 4IQXA 1WI6A 1TKXB 5KFGA 1SIZA 1VRUB 2ZWPA 4ED3A 3UD3P 1YIJS 3D7SB 4MIBA 3M8ZA 1FA0A 2MQMA 3PTWA 3DGPB 2LP4A 5KFVA 3U1MA 2ILYA 4NA1A 5C25B 2PN6A 3HVRA 2RQMA 2FHKA 4ZN3A 3H42A 4K4ZA 4NYZA 1DBDA 1FDDA 4CT9A 3P4UB 3GV7B 1RT7B 3EZUA 4DPYA 2ZBIA 2W9BB 4JI5F 1AZSB 5AT1B 4ZDNA 5JUMA 1VRTA 1C0UB 2JLEA 4OIXA 5LMNF 1A9NB 1UVKA 3J7A1 1NM2A 1RXOB 4I6YA 3PW0A 3DLJA 2VU5A 4WE1B 5D0EA 5IT9Y 5L8RC 1XR5A 3T5JA 1WHYA 1NK4A 2HGNA 2I5JA 4BS2A 1NEEA 2F9DA 2BX6A 2MPUA 4NL5A 2D9OA 1S49A 1AT1B 3BR8A 2FY8A 1B0TA 2GJIA 1DAXA 5D0RA 4QQBA 2ZBRA 2VFRA 2K7KA 2B7CB 4DLEA 3FBFA 1H3DA 1RT4B 1HA1A 3M9MB 4OYBA 3R1HA 4TQRA 5D4PA 2F40A 2XBPA 4P6QA 4P71A 4HH1A 1T95A 1PBAA 1U1NA 3M05A 4O3RA 2AU0A 4NCAA 3N5BA 3KLHB 2KB2A 2QL9B 3ITHB 4LF9J 1FKPA 1JIHA 1M5HA 4RWXA 1W2BR 1CJKB 2QL5B 4ANEA 4Q0BB 3PYDA 1AUDA 1H0HB 4HKQA 2MLZA 4QYZJ 1RHQB 1H38A 1F9FA 3R27A 2R42A 3K7RA 1Y9OA 2H54B 4JI6F 3NRBA 1U26A 2RAQA 2J0QD 3NBPA 3EVOA 2DGUA 3CJKB 1FD2A 2XO7A 4CO0A 1VLYA 2WHOA 4U9RA 3V4IB 3NAHA 3TI0A 1FX4A 1NDLA 2IC3A 2XZWA 2RS2A 2AJFE 1NB7A 5E5NA 4HVZA 1WKLA 3ZTQA 1I3OB 5HMZA 1GMUA 2VPXB 6FD1A 2XLIA 3K59A 2XS7A 5BYQA 3JAMU 4OQJA 4I2QB 1HBUB 2H5JB 1CJTB 2GJ2A 2C2KB 3MCSA 3VHQA 2C28A 3EPIA 5J1EA 4F4YA 2YPYA 2QA4G 4B3MJ 4DL2A 1XNQF 4Y0FA 3MPVA 2D1CA 4JBCA 5G0RA 1YJTA 4WKRA 2OELA 4OI3A 5IQQA 4OLPA 2DHAA 2RMLA 2CPDA 5KG6A 1TUVA 1NBEB 2R3VA 4ZA1A 2R7WA 3N6MA 1GT8A 2IMOA 3CDBA 3GG1A 4URQU 1TKTA 3SCIE 5BXIA 3Q22A 3EZ5A 1K47A 1UKUA 2D3UA 2PT0A 4A4JA 4O3QA 2IJNA 1ZA2B 3NP5A 4NXMJ 3MUTP 2DBBA 1IM4A 4N56A 1NDPA 1MN9A 2Y0BB 2KO1A 2YNIB 4CWBA 4OI0A 2BV3A 1WDDA 2Z4PA 3MMCA 2B5JA 2RD5C 3BSAA 1NSPA 4OZLA 5L38A 5GAEU 4LFCF 2VG5A 3OR1A 4YHHF 4DWIA 4KHPJ 1RWMB 2BRLA 4J37A 3HX9A 4ECRA 3ZZPA 3VAIA 4N76A 1Q7LB 1RI7A 1LWXA 1R8BA 1VDHA 1T03B 1W26A 2FJWA 4K8RA 5KFWA 3KLFB 1DY3A 1NPKA 4ZVRB 4ECXA 1VISA 3QFWA 3V2UC 3ZZOA 2V8DA 4NZ7A 4A8MP 4V19X 4DN0A 1U6FA 2AZ1A 1Y11A 4K2XA 1GAOA 2LU1A 2ZBCA 5ETSA 1R0AA 2I2YA 1UJ4A 1U7LA 1FKPB 3MEDB 2UUAF 2E7XA 1XBWA 2JDJA 2JOQA 4ICLA 4PKDB 4L6V3 2VKZG 4KGZB 3POTA 1X5PA 1KOHA 3FEZA 5EX3A 1KQFB 4DQSA 4JV1A 3E01A 3TZWA 4ZCKA 1PGZA 1KHWA 3EVMA 1HQUA 1IKYA 1FJGF 2KRRA 4X62J 3NG8A 3QIDA 4EK2A 4CIOA 3LPYA 4Y2MA 2MY7A 1G2EA 3GFXA 1HBMA 1VS3A 5D4LA 2A6MA 1HD0A 1OY9A 1LWFB 3HSZA 1MW7A 3NGSA 4O3OA 4F36A 2XLJA 1NJIT 3BGRB 3HKWA 3LGHA 5K5MA 1MU2B 3RUBL 1FRJA 1FJGJ 1NLKL 1H2UX 4KHMA 1M1GA 2P8IA 2QSFA 1SKWA 1B64A 3OBIA 4HI2A 2IDLA 1DTQA 1KRPA 5IV4A 3Q2SC 4OZ1A 2XC9A 5HBMB 2E44A 2M4MA 2EG2A 3CJRA 4GVLA 2A6OA 2PI4A 4IKAA 4DSJA 1S77D 2E1PA 3MF5A 1E6YB 1NO8A 1Q7YT 4TY9A 4LF5J 3ISNC 2CQHA 4WCEQ 3V81A 2RSQA 2R7UA 2M88A 4OHWA 2VB6A 3KLGA 1WNEA 1N88A 4J9OA 1YDLA 2HEKA 4I69A 3X3UA 1UEKA 4A47A 1RT6A 4LRDA 3Q8SB 2A2CA 4RNNA 2QLFB 1UPPA 2GFFA 3DRXA 4I6AA 5LL6d 3KXDA 2FVRA 2GA7A 2HQFA 3IR7B 3SMZA 1NHKL 2O66A 3G82B 3HXMA 4NCGA 2VDIA 2RF2A 3KDNA 1CQMA 2CJ9A 2WSCC 3FZBA 4MKVA 4OLOA 3TRGA 1RU1A 1WG4A 2GCFA 3MR2A 3GIJA 3EX7B 3AD9C 3NKYA 2RDJA 1TELA 2QG9B 1YK9A 2RDIA 4DCOB 5DQHA 2BA9A 1JKHA 3AD7C 2F65A 1Y4ZB 1KC8T 3CDAA 2QFIA 1HYSB 4ZVPB 1FRKA 3OUYA 1VQ8S 1C1BB 1NHUA 3O8WA 3HO1A 2XULA 2DCLA 1HI1A 2WSFC 3R7SB 1F0XA 1RDRA 4M5HA 3US5A 4ZLPA 2AGPA 1TFYA 3PW5A 1TVRB 3PX0A 1TL3B 2E66A 2AW0A 1C4AA 3IM9A 5A8WB 2XMAA 1S76D 3DLEA 4G1QA 1Z2ZA 2UV8A 1NKCA 1WC5A 2KXHA 2VC1A 3IFEA 2VQEJ 4UUWA 2DHHA 4C48A 2V2QA 1RKIA 2CZVC 4YB5A 5GAGU 2ZH2A 2AGQA 1VQ9S 3JTNA 4LF7F 4XIUA 2XS2A 3P6YC 4GKJF 3BEGB 3EPGA 4F02A 3LQVA 3GQCA 3PG9A 4LF2A 3H8YA 4JI3J 1RISA 1S9EB 5KFXA 3PW4A 5BJRA 3BKUA 3NL0A 2RDDA 1U8SA 3RR7A 4ZPTR 4GC7A 5D4NA 4JI6J 2FUG9 3R6GB 4IFYA 3JAMY 2J0WA 2ZH1A 5B0FA 2N4CA 4MK7A 1SKUB 3DRSB 4CLSA 5F8GA 2SXLA 1NSAA 1NPRA 3CVKA 4EI2A 2CQBA 1PSDA 3GSIA 1U6BA 3S8SA 2RQ4A 2K3IA 4C11A 1JMTA 3IA0A 2JWNA 1AA1B 2IAJA 4JI8J 3TEGA 2GVDA 5AE1A 4RX6A 3A3PB 4NPOA 2CVIA 2CQ2A 4PUOA 4IRDA 5FJ4A 3LWMA 5A6PA 3FBCA 1PC5A 2Z30B 3DI6B 1HNVA 1Q0NA 1GXTA 4IDKA 3VF0B 3CCUS 4DV2F 2XMVA 3LUYA 2Z2ZA 5J2QA 3C46A 3D1OA 4KJIA 4CO3A 5ETQA 1XWLA 5A0YA 1NK8A 5HQ8A 2O1PA 1FXLA 4RUCA 1WC6A 2GO8A 2GAGC 2H1YA 3IWLA 4H4MA 2IPOB 3DLKB 3HMJG 1IBLJ 1PJ7A 3W66A 2HK3A 4USTA 2MTLA 4OYZA 2YPZA 4HDGA 3SDEA 2HZVA 3C3LA 2ASJA 1TV6B 4C9DA 2LQ5A 2W2PP 2AQ4A 1F5BA 3DHWC 3PNIA 1IN0A 1R8HA 1VGYA 4NLDA 4ZVTB 3ZZRA 2KFYA 4USMA 1TK8A 2EW9A 2CNNB 2YNGB 2XQCA 2WB1D 1FK9B 4ZS6A 3D1QA 2M8DB 5KT6A 3EE3A 3QRQA 1H2TZ 1RBOB 1HWIA 5I3QA 2L08A 4GRSA 4ZP8A 5F8HA 3BGFA 3IAS9 1IBLF 2Y0SD 5DQGA 1UAWA 3I96A 4DFPA 2D3O1 4C8KA 2ZKTA 1UWAA 3A8KA 3MEEB 1WTBA 1LWEA 2HAFA 2FC8A 2HHHF 1BMQB 2UUTA 4CO2A 4DR1J 2HW3A 4XPCA 5A76A 4NLSA 2KU7A 1NKBA 4LF9F 5I42A 1SL0A 2P9CA 2XSJB 1LW2B 2AP6A 3EICA 3GCWP 4CLKA 8RUCA 2MKKA 5DS7A 2G4BA 1AB8A 3T6BA 3TO8A 5ETTA 1SJ1A 5DLGA 1BHNA 2KHDA 4LF8F 3IC1A 4LBIA 1Z2LA 4TN2A 4DX5A 1CC8A 3M2RB 5L39A 2Z2LA 2FLNA 5K9FA 3DC2A 3DRSA 3NWRA 3FCWA 5ADZA 5J1EB 4ZIVA 2MZRA 2YX1A 3BB5A 2B4UA 4E2FB 5E7OB 5J1PA 4RW4B 5KFRA 3PV8A 1ZAVA 1NH8A 2OJ3A 4B3OB 2MEWA 3KMQA 2EVZA 3Q8UA 5CYMB 3BO3A 3NNHA 5KG5A 1JQGA 1RAFB 3V4IA 1S57A 1KQKA 3GJSB 4J9PA 2OPQB 2PO4A 2DHXA 2HRTA 4MH8A 2X1AA 3VAKA 2QC3A 2CDRB 1LXJA 2DGWA 3LH2S 2JLFA 3OFFA 1ACMB 4DDFA 4AQYJ 2AYGA 1X31C 4WYLA 4O3SA 3RBXA 4A46A 1YBTA 2XEXA 4O23A 1PAUB 2R8GA 5L46A 1V3SA 3DOLB 5EWGA 5J2MA 2IVYA 2YVSA 2R2SA 4CT8A 3MMBA 3W5XA 4DCJB 3KLHA 1Q8LA 1YJWS 4WFNQ 3UN2A 3SSRA 2BVZA 4LF7J 3FVYA 1WUUA 3CJ2A 3IBWA 2LXUA 2HQ3A 3DDNA 3MPDA 4DR5F 2XSFA 2AMCB 3IAM9 1SJRA 2YH1A 4J5OA 3H0PA 3P5BP 2Q6BA 3AY0A 2VODA 1HFEL 3MMJA 4X2BA 2F9JA 3KLVA 3FRYA 4K59A 3VAJA 2DNRA 4NWBA 3AOAA 4DR6J 3G86A 1A7GE 2Y3YA 1QVGR 3CCZA 3E3XA 3GG0A 4EUVA 5E0OA 4OHXA 2G9OA 3AXKA 1SXLA 3ZTPA 4B3MF 4NXNF 1REVB 3M8SA 4LR7A 2K1RB 1U0SA 2V67A 1LFPA 4DX8H 1XC9A 3KG1A 1JNRB 4X64F 4PABA 4DV1J 3PVXA 4ZITA 3I0RA 1LFWA 3GSDA 3QGGA 3OTDA 1YX2A 3I6PA 4BHQA 1VR6A 4Y6IA 1NK5A 5BR8J 3MFHA 4FF1A 1RAAB 1T0TV 1Y10A 1PC4A 3DOKA 4FKXA 4ES2A 4ETXA 4QPXA 4DUZF 1WJ9A 4K4VA 3OHAA 3RBZA 4DX6A 1SI9A 3ENQA 3V6DA 2H9ZA 2D7SA 1SJFA 1ZS6A 3B4DA 4GO5X 4DFJA 3RW7A 2VPYB 3KLEB 4OHVA 1L3UA 4X4SA 3K8VA 3NY0A 4DUYJ 5F0UA 4KPYA 3LAMA 2BOAA 3MUVP 3QSIA 2A2DA 2QZ8A 4XAKA 3W5YA 1K1SA 1YBUA 1BY9A 3JQKA 4NLYA 4BWJA 4EO6A 2GHVC 4DV6J 1T05A 5HVFA 1N34J 3WC2A 2DH7A 2ZBQA 1FDBA 2DKOB 1HQEA 1S9GB 1S5ZA 2B8QA 2AX0A 2CQ0A 3GLJA 4FKYA 4M5IA 4YB6A 3PIPQ 1URRA 3PW7A 1EQMA 3S6EA 2ASDA 1ULRA 4WK3A 4QIFA 5CYMA 3TOQA 3DOMA 3W64A 5C2GA 1SC4B 3H4BA 3UCUP 3BGLA 3IO1A 4P2MA 1HBMB 1C1CB 3GR0A 4M5JA 4NLTA 4ATNA 2RHQB 3DMJA 3M1VA 3IWNC 1IKYB 2XI2A 4LT6A 4EU0A 1O5JA 2VBXA 4IO1A 4DV1F 2UZAA 4IOAQ 2LYVA 3PR5B 1CG2A 2W4PA 3KNGA 3VV2B 3P8BB 2FHJD 1L3VA 3P49B 2HHQA 5ETMA 3JSRA 1QVFR 3W60A 3Q0AA 3ILJA 3VAFA 3K5PA 3MMAB 5E33A 4EZ6A 4I6WA 2PMHA 2DNOA 3FK4A 2XM3A 4OI2A 3OW2R 3CC4S 1R0AB 2BBEA 3TJ9A 5HMWA 5KG2A 1JX4A 2J9DA 1X4HA 5A2QU 5I3UB 2RQKA 4CCHA 2MYFA 2GGPB 1P1TA 2QLBB 4WP9A 2JJ4D 3UFCX 2M52A 1Y5NB 4CH7A 1VBZA 2MZQA 2WRMA 3H98A 1X5OA 4PG5A 2LMIA 1NMEB 2HFSA 2ZDPA 4G65A 2AD9A 4PG8A 2WW4A 1NH7A 1SJQA 4D3HA 5C25A 3BQ0A 3EVWA 1M5VC 3RW6A 2HHSA 3C16A 1D8YA 3HULA 4FBUA 2XCAA 5AXLA 2CWKA 5HMXA 1ZTWA 2VJUA 4HT7A 3POTB 4WFAQ 1URNA 3RAMA 3K0JA 2OEKA 1FX2A 1RHUB 1WEXA 3FQLA 1KWMA 5DO2A 3TVZA 4CLTA 4P10A 4FF3A 1P8GA 1VHFA 3BM7A 4KGKA 1Q8KA 3TVYA 4YOEA 1NSQA 4RU9A 2L48A 1MMNA 4ZJLA 3KYLA 2C2MB 5FD1A 1KN6A 1H98A 1TL5A 1UFWA 3KNAA 1AW0A 1VQYA 2D41A 1O6XA 4OV1A 1K0VA 2KJVA 2VZ9A 1TL4A 3M8PA 1YJVA 5JMNA 3OPKA 5DQIA 1FF2A 2G0JA 3GE9A 1U25A 3HJVA 2HS0A 4J90A 5DZ6A 5KG7A 4J9SA 1NK6A 3CGIA 2CADA 1RTJA 3WBZA 1RTDB 3KMSA 1I1GA 1XMOJ 4AFFA 3MCNA 3RRHA 2VPWB 2J8SA 2V0NA 4IG0A 5DETA 4LF8J 5IZHA 2IA6A 1CJVB 3KDOA 5KOXA 1HNWF 3RB4A 4QU7A 3FMWA 1TK0A 4UF4A 4N8NA 1QE1B 1RAHB 2ZKUA 1NK7A 1WELA 1R7IA 1WOPA 5B0DA 5IV3A 4LSNA 1W25A 1S1XA 4ZCMA 1LW0B 1J2VA 1Q8IA 1WACA 4KFBB 3AB4B 3W8GA 1IXKA 2GW8A 3D4JA 4I4BA 2EKYA 3RBEA 1WHWA 5LSLA 4QIGA 3T41A 4NX9A 2WB4A 3VWSA 4ID5B 3NMRA 1F5CA 1OY8A 1QUVA 1KTQA 4NLPA 3TJAA 4DFMA 3CXCR 3RAQA 2ATLA 4MKAA 5DG9A 3C14B 2W7PA 2QFJA 1KQSR 1QAIA 2AV5A 2X1BA 2Z2MA 4ZKAA 3LP0B 1APSA 3N0VA 2FC9A 1BGXT 1RHRB 1RT3B 2VUGA 1BC6A 1F6TA 2QL7B 2VFUA 2KYXA 3AA8A 1P6TA 2K8GA 1B0VA 4XK8C 1VQKS 2E7WA 1FTCA 2XGPA 2RU3A 1KFSA 5CD4H 2XO6A 4DV3F 3GJRB 5F8LA 4HI1A 4Q0BA 1YJ7A 1GMWD 3PJ9A 1B4SA 1IR2A 9ATCB 2VONA 3DRPA 4DCPB 1YQHA 4UOGA 1Q53A 2CUYA 4O44B 2R2UA 3BBCA 2RU9A 2WONB 1VRTB 3O44A 3BJYA 2EK6A 3QJJA 1MG7A 2ZOGA 4C0HA 5KAKA 1J27A 1MMDA 1TAQA 4U8VA 1N33J 3P96A 3UCGA 9RUBA 1S1UB 3G6YA 3M2UB 3QJLA 5KFKA 4IFYB 1RYRA 3UDCA 2QT7A 4B9LA 2PFFB 2F4VF 1X4AA 1U1KA 2BR0A 1N6QA 1LXNA 2GO9A 2E1RA 5CYJA 4NYOA 4BBYA 3NGDA 3I5BA 4ZVQB 2BJ1A 1IKXA 4BCAA 2HQCA 2CDQA 3W8PA 2UVWA 4X4PA 3UDVA 1ZPWX 3TANA 2VD3A 2HHXA 1TV6A 3I87A 4RWWA 3A8IA 4ZOSA 2RHSB 3HD1A 4OZ5A 3J80Y 3J80U 1G6BA 1RLCL 2DYAA 5CQGA 4M63A 3UN3A 1M1KT 4JV0A 3OJUA 2N7CA 1HBOA 1JLFB 1LWEB 2EFGA 3CCWA 3RG6A 1VC0A 4CLLA 1VLOA 1HQUB 3T1YJ 4B3SJ 1VJWA 3BN7A 2J7WA 1PJ6A 3QAUA 1PAEX 1OQ6A 1QE1A 3MD3A 3ZXWA 1GTHA 2IVMA 2PEBA 5A8RB 4IDKB 5KT2A 3C6TB 4Z37A 3PX6A 4HHHA 4DSIA 2ZEJA 2GIQA 2LQ8A 5CABA 2LA6A 4O4GA 4ZVFA 1GXUA 2JX2A 1Q1KA 4DV4F 5HK4A 2AZ3A 2G2YA 3GYXB 1JLEA 2HBRB 3GTYX 4GVBB 4IG3B 4QWAA 2ZVSA 2NUHA 2YQ3A 3NWGA 3QJPA 4ID5A 1N0UA 2OD4A 1Q79A 3K5NA 1QTMA 2R7RA 2MJUA 5L9NA 4YHHJ 3DOLA 5LSRA 3Q8RB 3B78A 1CQNA 4RNMA 3TUJC 3GZ7A 2ZBPA 2XYPB 1TUGB 4KSEB 4UOCA 1DHMA 5GMDA 1EB0A 2QLJB 3W63A 4B9SA 1BQNA 2W2OP 5CCLA 5KFQA 1RZMA 3MUMP 1JJ4A 4AUKA 4YMEA 3PACA 4A8KA 4FNHA 1UTAA 1S1TA 4TLQA 2HRUA 4F0HA 4FXWA 2BZ2A 3WZ0A 1F9EB 1RCOB 2WW8A 2XZDB 1KOOA 3E01B 3IGVA 2YKMA 5E2QA 4YQWA 3G71S 2OFGX 2DNGA 5KG0A 4DV0J 4ETZA 2VICA 3BO2A 3ZFVA 2DHGA 3J7AN 1SKSA 2BE2A 3J81Y 2KRBA 2ZH8A 4MT1A 3UDEA 1WSVA 2UU9F 4HLBA 4NLRA 4DPUA 1TAUA 2MQOA 2EXUA 4OX9F 3K89A 3D2WA 3P45B 4I68A 3QLHA 2BYCA 2R7OA 4Y2IA 2QA1A 4QJVA 4JB8B 4RW7B 3C6UA 4M5DB 4ECUA 3CCJS 2ZUAA 1VIXA 1GFWB 2KXNB 1D8ZA 1YITS 2KYZA 1T03A 4GKJJ 1SL1A 4M94A 2XLKA 3ET6A 2B0GA 4NZ0A 1LOUA 4PG6A 4F2RA 4YR3A 2BJ8A 1IKXB 1FDNA 3CJ4A 3LO3A 4BC9A 2VOPA 2IMWP 2WVEA 4L73A 3VGSA 1N5TA 1OS5A 1SH3A 4UY85 1MWZA 2OEMA 3LALA 1SQEA 4N77A 8AT1B 2DR8A 2HVEA 4RNFA 3V81B 3JB9k 2WVFA 4IH7A 3UDLA 1UPMB 1ZTTA 3D54A 3VQSA 4NXNJ 3AT1B 2BM1A 2K2PA 2V5HG 3AD8C 3Q8VA 4XTTA 2B4VA 3VTIA 1RWPB 2BJ3A 3IR6B 5GVQA 3UD5A 4QBUA 4PYDA 2V6AA 4MFBB 2W7AA 5A2QY 3NMAA 1IVZA 4ZJOA 2P6SA 4X66J 1SB6A 3BYPA 4ILLA 5FDLA 4HTIA 5JJBA 1N6QB 2HPUA 1H2VZ 1U0HA 3IG1B 4V1Ak 4KO0A 2IVFB 1JNZB 3W2WB 4B3TF 2KTQA 3T19A 5B0GA 2MKYA 1LV5A 4A8FA 4JI2F 5CAAA 4GKKF 4HT5A 3R8YA 4QWDA 1TQLA 1HLWA 4LFAF 1NZ8A 2I38A 4C8OA 2OHDA 2CA9A 1IWGA 1VRUA 4L72B 4ED1A 3GB0A 1O51A 2OTLS 3CIZA 2Y1JA 2HMIA 3OQ2A 4R0EA 2C2RA 3I32A 4WBFA 1EAYC 3WC0A 4YUDA 5K8NA 1WG5A 1HQEB 1QJHA 4B17A 1YTYA 2NQPA 2HAIA 2XSJA 4FNIA 1VFJA 3B4MA 4O4RA 1JK9B 4USWA 1YJRA 4DZDA 1S97A 1D1UA 1BUXA 3ICLA 1G1XA 2DNNA 4DL0C 3GYGA 3OXLA 4UZBA 1FJCA 4ELVA 2ABYA 4I67A 1TR0A 2W24A 3CE8A 1JJCB 3I82A 4HEA9 1PKUA 3OVAA 3HT3A 4P74A 4X64J 1MWQA 4XPEA 2UVRA 5FLXY 4ZPWR 3CD7A 1E6YA 3D68A 3Q23A 1SUQA 1IKVB 3HHKA 2WSEC 1RT5B 5F8NA 3PKYA 2XG8A 3QGIA 4KH1B 1AYEA 2IM3A 3HVAA 4ZVHA 3KHLA 1CC7A 2MKSA 3R5AA 4R8UB 2K06A 5KOWA 5D0GA 1XIQA 3IP0A 2CG4A 4ILMA 2YY3A 2GQQA 1M5PC 3DDKA 1P9YA 1N33F 4DU7A 1NXIA 2B7BB 4C8LA 3G82A 3MM9B 4X4RA 3M9NB 3GIRA 1VBXA 3CJTA 3HZEA 4DI6A 2E9RX 4IRCA 1G7CB 2KDOA 3FC9A 3UO0A 3VALA 3T1HF 2DITA 2OSQA 1QM9A 1W7WA 3BSOA 4WKYA 2B56A 5EDWA 2LA4A 4DN9A 3B54A 3QWPA 5IS2A 2Y9HA 2HHTA 2CQ1A 1YG0A 2GV1A 3N5FA 3U27A 1R31A 3OL6A 2B4PA 1EIYB 2QE5A 2NCKL 2P9EA 3I31A 1JLBA 2UUWA 1U2CA 3BREA 3HLUA 4OYIA 2FPHX 3QMQA 3EXCX 1R0CB 3W2WA 2W2QP 3ZNJ1 2CJQA 2CQ3A 2EI5A 3M8PB 2I6WA 1N32F 3CC7S 4P72A 1KHVA 3M4XA 1B0PA 3OFEA 2WOMB 2VASA 1UP1A 2AJ0A 2M3DA 3ZZUA 2YX4A 4MIAA 4DEZA 1T05B 3NS7B 4NASA 5DJBA 1J5OA 4W90B 1KEKA 1U4BA 2DNMA 1UZHA 1YRTA 4OFZA 1IBKF 3G8QA 5KFZA 1FE4A 1FKOA 4PAAA 4NA2A 1WEYA 4OYWA 2YXLA 3C6TA 5F9LA 3RRKA 2VPZB 1R8CA 1S9EA 4B3RJ 2YTCA 4C8ZA 4Q8EA 2ZM6J 4WFZA 2FJXA 1X0FA 2AJQA 1PBUA 3DKDA 2ILZA 2BW7A 4LIRA 4C3LA 3ZC4A 2RS8A 4CH0S 3JSMA 2UUCF 2R7XA 2R9LA 2HYIB 2BANA 2MMYA 2IA0A 2C2DA 1NJXA 3PO4A 2BJDA 2A0FB 3VVUA 2HIQA 2YKQA 2QYCA 4P73A 3H5SA 4LBHA 5B0AA 4B3SF 3OVBA 4WZQA 4WZMA 4LBPA 1NDCA 3HKZD 4USUA 4DQPA 2HLTA 2QJ3A 3TAMB 3MR5A 6AT1B 3CW2C 4A8XA 3I5AA 2QLXA 2V63A 4JI0J 4KAIA 4NMXA 3UE2A 2UXCJ 4A8SA 4DHVA 3D28A 2ASLA 1TFWA 3TWZA 3BSNA 1JLCB 1FWKA 4RW9A 1L3KA 3BH7B 4X66F 4M5GA 2C3OA 2MZSA 3RTVA 2KKHA 2ZHOA 2CFXA 3DI6A 3FBEA 4EBCA 3IRWP 3D0HE 5ETVA 4FPIA 3EM1A 3HHLC 1ZYQA 2EWHA 4JP8A 2RKIB 4PR6A 2B51A 4F4WA 1ZPVA 2E1MC 3OV7A 4QU6A 3ELHA 4X62F 3QRRA 2LEBA 4LR9A 2PMWA 3C15A 1T9XA 3PFEA 4NLOA 3UN5A 4F0MA 1ZBTA 4JV5J 1R8PA 1RTIB 3R5BA 2J9DE 4C97A 3MAQA 3T3FA 2PIIA 2CQGA 1R0BG 2J8AA 1T9WA 2V68A 3M32B 4WP8A 2UXBF 4DU8A 2M7SA 4KIAA 4DSEA 1YLXA 4IYQA 4AYBD 2APOA 4DL5A 3AQPA 3D6FB 3IN5A 1T7PA 3WX8A 3OL9A 3IS9B 3OT9A 1ELOA 2OLWA 1JLGB 2OPPA 5DDPC 2CZ4A 2OMOA 4CM0A 3MEDA 3CPWR 5HP1A 4DR6F 2CPZA 4KPCA 2J7UA 2PE8A 3QO9A 3S01A 5KFSA 4K4YA 1VC5A 4PPDA 2MDAA 3UQSA 3CD5A 3HI9A 4PG7A 4I7FB 1KVIA 3PRBA 1Y5LB 4G6VB 4LF1A 3ZZZA 1S1TB 2MGZA 4DF8A 3R97A 1QSYA 4DR5J 4YDXA 4G3IA 1VBKA 1HBOB 2RJZA 1HWJA 2XMMA 2RE1A 3PEHA 4LSNB 2IYGA 3ZO7A 1R3NA 2JEFA 1HW8A 3DM2B 4H54A 3JTOA 3HT0A 3OTBA 4NCGB 5HI7A 2NPFA 1A6LA 4JI3F 2ZNZA 2KM8B 1HL6A 1ITPA 1RA6A 1UMJA 2ZHAA 3TZZA 4G1IA 1RHMB 3PCOB 2HBYB 3NCRA 3MMAA 4UW2A 1U02A 2C2NA 5DDQC 4X65F 4DQQA 1RWXB 4X4NA 3M7VA 1HD1A 2YQ0A 3DOKB 2F1FA 3KHRA 4LFBF 4PWDA 1DZ5A 4CLFA 3ENAA 2CPEA 1EHWA 1HHQA 2CPXA 2YKAA 2DNQA 4LSLA 4MK9A 3VR1A 2DB1A 1EZZB 3PJWA 3F0NA 4G1PA 1YI2S 2DR5A 2LCWA 2ZD1A 4AT1B 4PRFA 3ILLA 1X4BA 1D0EA 1IQTA 4CNZA 4DV5F 3TAQA 1REVA 4IUFA 2Q43A 3NXZA 2Z56B 2NYHA 1IKWA 4ZPAA 4FN5A 2FVQA 2Q66A 1IM6A 1EETB 1EJ7L 3VVTA 4Q5VA 1T9YA 3HFVA 4F3MA 1C0UA 4DL4A 2C42A 3AQOA 4OJGA 5E3RA 1SJ4P 4RBTA 2WVDA 3HF5A 2RKIA 3NLCA 3QT5A 5MAOA 4QIWD 3KJQB 2CVEA 2IBOA 5DDOC 3JSMB 4ZVOB 3FKBA 2XNQA 2DR7A 4DQIA 4K4SA 4B9NA 3CD0A 1FI4A 2PEHA 1VK3A 1FO1A 2CJYB 2YBVA 3LA0A 4IO9Q 5AJ3F 4DR1F 4ED0A 2EBEA 2RT3A 1H7WA 3W2VA 2HHHJ 5IT4A 2OPRA 4X4OA 2VDHA 3ENVA 5LOQA 4YP3A 3KFWX 1YRUA 2AEMA 1FEHA 2DK2A 1HMVA 2Q79A 4C3KA 4DS5A 2GGPA 5KFJA 3AHPA 1DQAA 4KGXB 1SBRA 4I0WA 4MAKA 3KK3A 2V8PA 4WK1A 4LF5F 5A8WA 1S9GA 1XN9A 5DG8A 1RKJA 2NXCA 4CLUA 4NLVA 2MXYA 1TMMA 3FFIB 4LF4J 3OLBA 3VAHA 4W92B 3QFHA 4RPFA 3L9ZA 5CZXA 1IUJA 1AFIA 5D3GB 4CO5A 3IR5B 1HARA 5AE3A 5KFAA 4HL9A 4C3MA 2KT3A 4GC6A 3JYTA 5DM7Q 2G1HA 5LMNJ 1C1CA 4C0BA 5C24B 3AJDA 4KT0C 2R8IA 1RQ0A 2V4JB 3ONQA 3R9LA 4Y3CA 1HQ2A 1JWWA 2MQLA 4ED8A 2OFHX 3BYRA 4P2FA 3AB2B 2F4FA 2X51A 2W1BA 1RWKB 2MZTA 3ET6B 3MM8B 1WEZA 2HNDB 2C22A 4OHYA 3BF4A 3MR7A 3SIPB 3OTOF 3I5CA 2HWIA 5CH7B 1U48A 3SQGA 3NCPA 2HQDA 1DJ0A 2HHPA 3FRZA 3H2UB 3BQ1A 1O0PA 3CDEA 3GU0A 5IM0A 3ITHA 2VA3A 2C3MA 1Q82T 2Y1LB 2UUAJ 1UW4A 2RNEA 1Q5YA 2MY8A 2L3MA 4AXIA 1OO0B 4F4XA 2ADCA 2YNFB 1GK8A 5ETKA 1LKZA 4HR2A 5DGAA 3IBCB 3EGWB 4GMKA 1FCAA 1TUWA 1RWNB 3H2LA 2B9XA 3RBDA 1VBYA 4ED5A 2OEJA 3LGMA 1UZDA 2RIJA 4F4ZA 4PUOB 4C8YA 3AJ1A 1MLAA 3H59A 4CZCA 2QYGA 2U1AA 4C98A 2XY5A 1NKEA 1M0SA 1I94J 3UR0A 2VJVA 1N54B 3NEKA 4Y2CA 2I8EA 4RW6B 2B43A 4U7UD 4ECYA 1FTRA 1S6UA 1SCJB 2UV8G 4NE9C 2PI5A 1XNRF 1HNWJ 1S1XB 2IRUA 3V4MA 2XMUA 2FJDB 4PXBA 4DL3A 1RAOA 2PSZA 2YKNA 2GQCA 1T9VA 5F41A 4F8RA 1V6HA 2YNHA 4HH0A 7FDRA 4C7QA 1B7FA 4PXCA 2NXUA 4D3GA 2FJBB 4NEYA 3IXQA 4OYPA 1U1OA 2GS8A 4F25A 1RU2A 3L4BC 4Q45A 1HNXF 2LU2A 3BBBA 4KKOA 1WKJA 2RUSA 4UY8T 1FHTA 2PFDA 3THVA 4WWSA 4CDIA 1BQMA 3H2VE 2BABA 1RTJB 4L76A 4RW4A 2V2VA 2J9EA 3FQKA 3H7HB 4MKBA 2DXEA 1V3RA 3LP1A 3QIPB 3ISZA 5HJXA 3BGOP 1S1WA 3O6QA 3GFHA 3JSYA 4WU3A 2QA2A 3UVJB 3F73A 4J9LA 3NS6A 1UVNA 3KTQA 3CB4A 3KLFA 1XR6A 4ELTA 2AEJA 3N28A 4Y65A 3GIIA 3GV8B 2NZCA 2OH2A 1X0PA 3CMQA 5G0RB 4A8WA 4FYWB 3VGTA 1QD1A 4KR0B 4ZVGA 3RU0A 4BC7A 5C42A 1NJZA 3JSBA 4KBIA 1CJTA 1LEOA 2W8LA 2DRBA 1VI7A 2FYXA 3F41A 3KK2B 3I0SB 2DR9A 1K73T 1U1MA 4K7QA 1VQ6S 1T11A 2KVQE 3EZOA 2HHWA 3TQ1A 1WKKA 3D66A 2FGOA 5GAHU 2HS4A 3FSYA 4CLWA 3D6MB 3HSJA 2HFVA 4PWWA 1RABB 3CDUA 4KC5A 5HP1B 1ZZFA 1S10A 5MLCV 2XCPA 2V34A 4EBDA 1ZAWA 5E3QA 4JI1J 1X4GA 1EQ0A 2FQQB 1RP5A 4K4WA 2A1BA 2DGVA 1REGX 3MM9A 5CCMA 4CTAB 1N4LA 3PXGa 3UD4P 2F4VJ 1YZ6A 2AJ2A 2EBGA 4M5MA 4NCBA 3H5YA 3HP6A 3M30B 1P9QC 4QIVA 3V5RA 2OPQA 2MKIA 1MROA 2H48B 2GVZB 3HCXA 3TZYA 2P5VA 2FD2A 3L3CA 1A0OB 2VKRA 2WVBA 3HHLA 4ZVUB 2E5LJ 2R2RA 4ECTA 4LRCA 4DV2J 4EBEA 3PDNA 4NLUA 5C24A 4TQSA 2R8HA 4FBTA 3CULA 2XMJA 4V19J 2J6UA 2V50A 2DNKA 2ZWOA 1P27B 1FVSA 4KV8B 3M2VB 4N5SA 3SCJE 1S0VA 2JVRA 2JEIA 4H4OB 2DT9A 2HVIA 2PMZD 2JC1A 1Q78A 4QW9A 3CIMA 2H5IB 3W61A 4XO0A 4J9KA 3GCXP 4OX7A 4K2JA 2IYIA 3OD2A 4Y2AA 3TEHB 4X84A 4EFAC 5AJ3J 3HHEA 1X9WA 1PO6A 1RT7A 2DJWA 2X3GA 4TNOA 4Q8FA 4K5RA 3AAWB 3D6HB 3DLEB 4G1QB 4M8LA 5KFOA 2MKHA 2W4DA 4LVNP 5CD4A 1OY6A 2ZE2B 5KG1A 4CNYA 2KT5A 3MAAB 3TP2A 2AYBA 2UXDJ 3G2XA 3LP1B 1F5AA 1ZM4A 2LDYA 4RUHA 3T1HJ 2HHVA 2D74B 3BSCA 2BW2A 5HATA 3W65A 5F8JA 3M1VB 2UVUA 1H7XA 2XWYA 4HTJA 4ECQA 5H9FK 5JVGQ 4XDDA 4F4KA 2RUGA 1VQLS 4TYAA 4DV5J 1BQXA 1OYEA 3OR2A 2W9CB 5DLFA 2CPHA 2V69A 3U1LA 4CP5A 4ZP7A 4ZVSB 2GZOA 5DDRC 3KK3B 5IM0B 3C6UB 3M8RA 2GJFA 3PO5A 2ZVIA 2Y1IA 1HW9A 3SXLA 5J2NB 3QIPA 2VQFF 4YS2A 4FF4A 1JXEA 3FSIA 4YEAA 1QY7A 3SI8A 5LJ5Y 3AH6A 1NPPA 1TVRA 4KGVB 3PYGA 4LSLB 5KFUA 4I7FA 4NYPA 4DBQA 4LQ3A 3HHNB 5IT9U 1IWAA 4RR5A 1OSCA 1VRQC 4A8YA 3MM5B 2RVJA 4LIWA 2GHPA 3KJNB 3QO9B 1M5KC 3KJFB 2H5EA 1FKOB 1GTEA 4M1KA 2BE7D 2CPIA 3R2CJ 5D77A 3G96A 5L1LA 1OJ4A 2HQIA 3FZ2A 3DMJB 4MKYA 3SFGA 3U1NA 4ERDA 5KT7A 1B99A 4DS4A 4JV2A 3BR9A 2X3DA 3HFZB 4F26A 4ES3A 2GHWA 2FZGB 1S48A 2HFUA 3M32A 1NNDA 3QGPA 2B8PA 3RZAA 4F3OA 4NLWA 4BDPA 2EFNA 3KHGA 1RBAA 1EX8A 1KR4A 4O3PA 1ZETA 4IR9A 3H5XA 1RTIA 3KLIB 3NGTA 4YDDB 4MFBA 3T5LA 1F2GA 3PEJA 1UEUA 2F8MA 1KVKA 4ALZA 4R5PB 1NCLA 4YR0A 2R8JA 1NJWA 3A1YG 4K50A 1OPIA 4JI2J 1RT5A 4NLGA 2ZC4A 3M8WA 4MJKA 1BQMB 3JQJA 1SIWB 4OZ2A 1KQGB 2DO4A 5K8PA 1P1LA 1XEZA 2UP1A 2IRYA 3DGPA 4HDHA 3W5ZA 1SL2A 5K8OA 4WF9Q 2HSEB 1QSSA 2BJEA 1HNVB 1S1VA 4MTPA 3THPA 4ID8A 1WHXA 3EGVA 2EKNA 4OZNA 1TTHB 5IFMA 4QR1A 2E9TA 2I5JB 5SZTA 5AXNA 4U7UK 2V8VA 1KP6A 4DG1A 2G13A 2NXJA 2C3PA 4PCQA 1KLMB 1N5SA 4I2PA 2AJ1A 5HROB 2FHMA 5T41A 1S79A 3HVWA 3K8WA 3N79A 5KFDA 4L75A 3PM9A 3LANA 3K57A 4IH6A 4ECVA 1S0MA 2VA2A 3UNYA 2W9CA 3G6VA 4OL8A 1RACB 3DN9A 1DQ9A 4KV8A 1HMVB 4FF2A 2DRDA 2MKJA 4JI7F 1SUQB 2ZZNA 2R8KA 1JLGA 5GAHI 3GWCA 3EYZA 5DM6Q 5G4DA 1JLCA 3SQOP 5H9EK 3R7BB 1QLNA 2ACMA 1U1RA 3CEDA 3DCAA 4CRJA 3NGKA 2ZE2A 2WBRA 3MM7A 3DOMB 2J7KA 3FNNA 1WDTA 2QV6A 5KFIA 4HYKA 1HI8A 1T9UA 2IM1A 3V6JA 3DFEA 2FLPA 5LMUF 4E0DA 2B9YA 1CEZA 4Q44A 2ROGA 3OSNA 4WJBA 3WQPA 2P9GA 3I4HX 3ZTSA 4QWEA 2KM8C 4ER8A 1U1PA 1FWLA 1HPZB 3S1TA 3M6WA 4B08A 3CO0P 2OUGA 4DV0F 2E1AA 4Y34A 5J1NA 3TW0A 5C2CA 3R5JB 2HQGA 1PILA 1IBCB 4HHJA 4IFVA 5GMEA 1IBKJ 3CJ0A 1B7YB 1UCNA 1Z1ZA 2XI3A 3OR2B 5H9EJ 4RBVA 5E3CA 3JXOA 4J9QA 4JOUA 1YZ7A 4I2QA 2E7VA 3LP0A 3WDOA 2FY1A 5M2PA 2VOOA 2OPPB 2Z8QA 1LK7A 3KG4A 4CO1A 5EGYA 2YNGA 3L95X 3SSSA 3IRXB 2DTJA 3TARA 3I9ZA 3M6VA 1DTQB 1VCTA 2ZITA 1CLFA 2HFNA 5HL7Q 3VAMA 3SZ2A 3H4DA 5DG7A 5KFLA 5HANA 1J5EF 1MN7A 2AYMA 1JLQA 3AFGA 5D15A 3ZZ0A 3M30A 2NYIA 4USJC 4FVMA 1XMOF 1Q4RA 3M6XA 2BE9B 4OJHA 5LM7E 4M5LA 3LF0A 3TX8A 4KE5A 2J0XA 1Z4UA 2P6TA 4ECZA 4FP9A 4UZCA 5E3PA 2R7SA 1HBNB 1SVDA 2D69A 2CWXA 2M9KA 5AXMA 1BXNA 1S1VB 2GMHA 5E41A 5ITHA 5T14A 4DPOA 4BLGA 1DFDA 1JXVA 1QSLA 4WFYA 2ALZA 1RWWB 2AIRB 3ENWA 3T1AA 4QWCA 1CULA 3V6HA 3OL7A 4DR3F 3QNWB 1DTTA 3DLLQ 3BGUA 3B6BA 4NZ6A 3TX0A 3OSPA 2X1FA 3M2UA 1VIOA 3MEGB 2UU9J 5T7LA 2ZHBA 2Z57B 1JKHB 2A10A 2NUUG 5J2MB 3DYAB 3B82A 1I51B 3CMAS 1R27B 2Z58B 2CQCA 2HVDA 4ECSA 3W3SA 4TVAB 2R7TA 3TAMA 2V2KA 2EK1A 2PD1A 2KHCA 4OI4A 3N6LA 3MD1A 1WC3A 2CQ4A 4RU2A 1X4FA 2MQNA 1GX6A 1OSDA 2F63A 3OXGA 4S0MA 3CCES 2B6AA 3UNGC 2KH9A 4PWUA 2N82B 4GKKJ 5LXRA 2E5IA 3IWXA 3Q2TC 3NNCA 3BH6B 1XNRJ 5EHHA 2ASYA 2DISA 2EEYA 1VHIA 4CI0B 4DF4A 2NXNA 3RB0A 2XNRA 3R5GA 5C5JA 3DXSX 1U2RA 2GIFA 4ZP9A 5A8RA 2BUNA 5K14B 3U02A 5GMKa 2E1CA 2OI2A 2XTJP 1X7VA 2J6SA 4P52A 1Y5IB 3N6NA 1JJ2R 2YKNB 1QAXA 3RGIA 4MK8A 5HBMA 4MYUA 1TL7B 3MPYA 1SJ3P 2K7JA 3GPAA 1FRMA 3CNQP 5HLFA 1TK5A 3VGUA 1G4CA 3GP9A 4JI4F 2DNPA 3AXMA 2EFPA 3H90A 1N52B 2CQIA 4MMOA 3SCLE 4CLZA 1GEHA 4Y28C 1RT6B 3WIUA 4ES1A 2BEFA 8ATCB 2LFVA 4GO7X 3GIMA 3G4SS 4OHZA 4FS2A 4P2SA 3NGRA 3THTA 4RJVA 3ILIA 1RJJA 1YKWA 1F9HA 2QLWA 4RW9B 2BJ9A 5BYSA 1N34F 3TQEA 2YNFA 3J7YU 3UR3C 2YWEA 3UWTA 3C16B 3J81U 4DZ6A 2XY6A 3ZTRA 2FTRA 2GC8A 4X4TA 1N48A 1WC4A 2HURA 2G2OA 2O3DA 3N9UC 2HNYB 1SH2A 2N3LA 1MNEA 1WSRA 2M2BA 3L7OA 2PC6A 3JS9A 3W7BA 3PFOA 2AKWB 5IOLA 5C42B 5CA5A 3MAHA 1S6OA 3O5TB 3C15B 3AODA 4N8OA 1S4FA 3K5LA 3T5HA 4USIA 1FJ7A 4DUZJ 1DQ8A 4Q2LA 2ZH9A 2HFZA 4H4MB 2CPYA 1UFKA 5IWAF 3WIVA 1C0TB 4M5DA 1VYAA 2E5JA 3W2VB 1YBAA 3D67A 2KVIA 5B0CA 2LECA 4JI8F 1RA7A 1GXLA 1SC1B 2DGOA 1X60A 3CWJA 5IT0A 1XMQF 2L41A 4DV3J 3VAGA 1UVJA 3BO4A 3G8TA 5KFPA 3MTJA 2MLYA 4B9TA 2C3YA 1LWCB 4FYDA 2GVDB 1FRLA 2NZ4A 3I0RB 4NA3A 2DGQA 5EWFA 1RT2A 4FVCA 2HGLA 4WFBQ 2BKPA 1R43A 1X5TA 3VCDA 4ECWA 4N47A 1VOMA 1N36F 4TXSA 1RAGB 3NBPB 1VQ7S 1XNQJ 3G9CA 5F3TA 5BR8F 4EYIB 2RRAA 2HRYA 2LLZA 3C66A 2MSTA 3D3CJ 2HWHA 2FZCB 4QR0A 3EUNA 2KT2A 5I42B 2D3OR 4ZMMA 3NAIA 2J0SD 2QMWA 3MEGA 4B9UA 2XYGB 3L7PA 1H72C 2PGCA 4H4OA 5I3PA 5ETRA 3QGHA 3PIOQ 1U47A 3BV8A 4OYXA 1Q5VA 2WTFA 1KLNA 4ED2A 4L74A 1RTDA 2FLOA 3SYZA 4IRKA 2VG6A 3R5CA 1D09B 1KVJA 5D8HB 2C1EB 3A8EA 4FDFA 3B8HA 4ZN1A 2M0GB 3KUGA 2LVWA 5SUHA 4L3KA 4TY8A 4R5PA 4NRTA 2ZOMA 4U95A 2CZ9A 4LQ9A 2KG0A 3NOGA 1PYTA 2AX1A 3CCLS 1LQ9A 1RAJA 2R2TA 3EWGA 2FVSA 4RL1A 3TNVA 1XMQJ 1NRKA 1N0VC 4DR2F 2M8HA 1VJQA 2BXJA 4QYRA 1N8RT 4ED7A 2MSSA 3OFGA 4PZVA 4YY3J 3L09A 3CC2S 4RNHA 4DR7F 4NLQA 4DV7J 2V9WA 3QATA 2FJEB 4KH0B 2P2CB 3OR1B 4O0NA 3UI3A 5L9XA 3C19A 1R89A 3M9OB 1UVIA 2OKQA 3M2VA 3DLGB 3KG0A 4LF4F 1RGVA 5ETNA 3MMBB 4WIQA 3JYTB 1QUPA 2HG4A 3KKFA 5LMUJ 1S1UA 4QZVB 1FKAF 1HWUA 2DHSA 3FCVA 1RWUA 5CYQB 2AEFA 1OYDA 3Q8PB 4OI6A 1S72S 2BDPA 1KNZA 5J2NA 3F44A 3ADAC 2COLA 4USKA 4OYOA 1FJEB 5IC4B 2HZAA 1K44A 3IMQJ 4QOTA 2XY7A 1IQZA 4ZK7M 2DH9A 3MHYA 2HNDA 5D0HA 5HO4A 5ETLA 2GVZA 1MROB 3CCTA 3MI7X 2UXCF 3R5DA 3ZNUA 2HNYA 3AOBA 4QR2A 4B02A 3BDPA 2K3KA 3P5TL 2OTJS 5IWAJ 2HIYA 4C8MA 2J76E 3MM7B 2MQ8A 2J6TA 4ZPDA 1F3FA 2IIHA 4B3OA 3DNCA 5B0BA 3M8QB 2ATCB 2HK2A 5A0YB 3BBFA 2L9WA 1IBMJ 5EUHA 5HSPA 1DTTB 3KWMA 1XMBA 1FFWB 4QIEA 1S12A 3X1LB 4QCLA 4F04B 2QO3A 5FDLB 4QW8A 4O0IA 4EGLA 1HPZA 2XHWA 3CCQS 1S6QA 2ZM6F 3C14A 3SBMA 3LGNA 3MURP 3H40A 2MJNA 5HLFB 1IBMF 4DSFA 2BQUA 3R2DJ 3LPEA 2JHEA 7FD1A 1F60B 2HBZB 1V9OA 1YJ9S 2HVHA 3FJ2A 3FGVA 2CNLB 5D78A 2UUBJ 4W98A 4EWTA 2CJBA 2XMKA 2W9BA 1BWEA 5KFMA 1WF1A 2JLGA 4YB1P 4F4AA 1CS4B 1I5OB 3GR1A 2OIHA 4X65J 1B70B 1HNXJ 2IM2A 4QWBA 1FNOA 4URSA 2EFVA 4DV6F 1RT2B 4K4UA 2Y8WA 3G8SA 4WIIA 1L3TA 2JEJA 5ETOA 3A3OB 4J7CA 4RUBA 4RKUC 2VG5B 2VFTA 4DUYF 1U09A 3D9BA 4U7CA 1D9DA 1DLOA 2C2OB 2MKCA 5RUBA 2MQQA 1S0NA 5L1IA 1QDUB 2OO4A 2WONA 1WOOA 3HHLB 4F50A 1FRXA 2A18A 3KLIA 1S7IA 1NUEA 3E8OA 2QN6B 3IM8A 1EP4B 4LRAA 5F9NA 1K9MT 2VV5A 4CQ1A 3CTRA 1RB0A 3AA9A 3BKFA 4USHA 1TKZB 4ZPBA 5A8KB 2NR0A 2VHGA 2BANB 2ZFHA 1RHKB 4UQTA 2N4DA 2FB0A 1SC6A 2DIUA 3KLEA 3CCSS 1NAQA 1FNMA 5H1SV 1N5YA 4NXMF 5T7LB 4RNOA 2DRAA 2FVCA 4IOBA 2LKZA 2QX0A 3A3NB 3HVTA 4R0JA 2Q6CA 3DDIA 3SCKE 4FYVB 4ZLNA 2ZH4A 2ERRA 1U1LA 1VC6A 1S0OA 1U49A 3CMES 1C4CA 2YKMB 1FXDA 2X7IA 3IS9A 4PXDA 3FMBA 2GAHC 4UQGA 1AROP 1UJ5A 2IAJB 2OPSA 3DLHA 2WCXA 2NLWA 1KKHA 1CJUB 3SFUA 2CNKB 3KK1B 3QBCA 1RHJB 2W8KA 2A3JA 2Q3PA 3W9HA 2XMTA 1SKRA 5IXUA 1ZAXA 4WE1A 1SPBP 2HZCA 4RW7A 3DLBA 1S1WB 1U2FA 3ZZTA 1KLMA 3A12A 3QT7A 3T1YF 4EZ9A 2YWKA 4ZJQA 1ZA1B 4YR2A 4PXEA 1JLEB 1FXRA 2RB7A 2B4OA 3IRXA 4HHUA 1RLDA 1HHTP 1C1BA 1NU4A 2ZDOA 3K2YA 3Q86A 4J91A 4MIWA 5CYQA 4CYUB 3TUZC 1ZZNA 5K20B 2DH8A 1SC3B 3DU5A 4Q7AA 1N36J 4EMDA 4IR1A 4F3QA 1T8EA 1EARA 4PQUB 1R6YA 3UW1A 4Q43A 3BDEA 2XYHB 3K5MA 4DR4F 1NDKA 2EFQA 2RILA 3ETOA 4DLGA 2X1GA 5CZVA 1DRZA 3M8QA 2JZ5A 4I1TA 3MWBA 5B08A 4Z7YA 3CDWA 5FIIA 4K4XA 3WHIA 3HSGA 1F2HA 2HGMA 3TA1A 1FWPA 4FS1A 1S59A 2HNZA 1WHVA 2CIMA 3E51A 5HROA 2DY1A 3UPFA 4K5SA 4QYZK 2YH0A 3TA0A 1LW0A 2OD6A 1NHVA 3JQMA 4NRUA 3MEEA 4NMLA 1FRHA 3EDRB 2YKOA 4TYBA 3DGVA 3M6UA 4O4GB 3C2PA 3MZIA 3DYAA 2DD8S 5B7WA 2W7OA 1H73A 3MOZA 4HACB 3OJSA 4YN3B 2FJVA 2VG6B 2XZTB 3QYYA 2MLXA 5KG3A 4RW8B 4PQAA 4FZVA 4NEZA 5GAGI 2JFDA 3M2RA 2DGSA 3SV3A 1S6PA 3ZTOA 3T5KA 2ROEA 1N32J 1LNQA 3LOUA 3T9NA 4AL5A 2BQ3A 5I3UA 1WD6A 3CJ5A 1VQ4S 2O5DA 1Y7PA 5HAOA 1PG5B 5KFCA 3R1LA 1PYOB 1BD6A 2BRKA 4JI0F 4X4QA 5J2PA 1NK9A 3TR5A 2YWHA 1X4EA 4PYAA 3G6ES 1K8AT 4JI4J 2EC0A 3CJQA 2I0XA 2HWTA 1X9SA 1HIYA 2PA8D 2POKA 2RRNA 3QLHB 3G6XA 5J2QB 1T94A 1V5VA 3KUEA 1YHQS 2OPSB 1VQOS 2BACA 3RJMB 1PIEA 3PRVA 4DR7J 3GMGA 3EDQB 1G3OA 2ZZMA 2VH7A 2I1RA 4AL6A 3MPUB 4FXDA 4EEYA 2VBZA 1WC1A 3IG1A 4ZIWA 4TU7A 2UUCJ 2W4CA 2BMBA 2YWGA 1HWLA 3VGVA 1MSWD 2RRBA 5D4OA 3HVTB 2FDNA 1OIAA 2YX7A 3FDSA 5EX0A 3TAPA 2KZZA 1WOSA 2VC0A 1K1QA 1TKTB 2MB0B 1C0TA 1FT8A 1TP7A 1RWVB 2E5GA 2LQ9A 1ZM9A 2Q1LA 2R7QA 3MCMA 1ZOTA 4TLRA 1JLAB 3CJSA 3SQGB 2I9SA 2KI2A 1CJUA 1VK8A 1ZM3A 2ALYB 4FPRA 5BYRA 5DRKA 3KK1A 3DXBA 4DL6A 1WTFA 1NSKL 1YJNS 1FERA 3RAXA 5HN0A 3PYFA 3HD2A 1X5SA 3VZHA 3Q8YA 4J9RA 4RBUA 2GMJA 3MPWA 2B9WA 3PHTA 2EFOA 4LJMA 3ILOA 3HSDA 3HZGA 5F3ZA 3FEXB 2FGCA 2LEPA 4KHPF 1U0HB 1HNIB 4NLXA 1AUSL 2DEJA 4TU8A 2V4RA 2RH3A 3PJXA 2KZMA 4LMZA 1N5VA 1K0TA 3MCOA 1WWHA 3J7YI 3CUNA 1U6ZA 4DFKA 1VQSA 1PYSB 3GONA 2AYEA 4I2PB 4Z7CA 4AXJA 3DRRA 1OPZA 3MEKA 3MECB 4LFAJ 3QT6A 2V9KA 3H20A 4IH5A 4UOFA 3H25A 4WXOA 3QT8A 2IJRA 3FSXA 3PY8A 1CJVA 2CAJA 3Q8QB 3RYLA 3TYTA 3W9JA 2LQJA 1Q95G 3KHHA 2FLLA 2E9ZA 2DY9A 4RUAA 2AWZA 3OTOJ 2R7VA 5D3GA 2BKNA 1IR0A 3EXYA 2GNKA 3R6LB 4ILRA 2JVOA 2JEGA 3EGZA 5L1JA 1TL1A 1N56A 2RF2B 2RQCA 2CNOB 2DEIA 1EP4A 3KUHA 5LSOA 3I56S 4O44A 2CJKA 3TA2A 3ETMA 3GJQB 1E6VB 1H6KX 3CCMS 3D3BJ 1R6VA 3N4WA 1XTZA 3GV5B 4K4TA 1TMJA 1JJHA 1S6PB 4OV6A 5AE2A 1PCAA 2VBYA 1W2IA 1O8BA 1OWXA 4RW8A 5LXYA 1JB0C 1HYSA 2NREA 4CH1A 4ED6A 2M5YA 3Q89A 5HQMA 4CLYA 1RSCA 2JNJA 4H4KA 4DPXA 2W9AA 5KFFA 2ADBA 3RRGA 3NCQA 5KT4A 2OSRA 4KKOB 3OVSA 1UEVA 2OGUA 2IFXA 2DNZA 5E3AA 2LDIA 1HKAA 4QPTA 3DRPB 2H4WB 5ETPA 2B6AB 4EO8A 3GILA 2JH3A 3HFKA 2W2NP 3R3TA 2DR6A 4OZ3A 4P7TA 1UA1A 1QTNB 2ZH7A 1LWFA 3F56A 4ZVEA 3KJVA 4DSLA 2FZKB 1UETA 3UVJA 2W25A 2PDAA 5F0WA 4YY3F 2ZH3A 1HNIA 1QAYA 4U8YA 2CXEA 2C3UA 1RT4A 2W2MP 2EPIA 3K17A 4LVOP 2IHR1 3DLGA 4UT4A 1RBLA 2IDEA 5KFNA 4K0KJ 4JYAJ 4JI5J 2VF3A 2VFSA 2WBMA 6FDRA 3I0SA 1Y3JA 3QZ7A 2D9PA 2QMUB 2F5GA 2JL9A 4KB7A 5HVHA 4AL7A 2EG1A 3PRDA 1VQNS 2YKPA 4DUTA 4J9MA 3FCHA 4YB7A 2BKOA 1N5YB 1QAJA 5B09A 1JLFA 4PEOA 3OL8A 3PR4A 4ANCA 2VL1A 1L3SA 1KS2A 2F3JA 3I9V9 4F7VA 2DPJA 1GX5A 1UL3A 5LJ3Y 2HS3A 3PKMA 1T02A 4M95A 2MGZB 3H5UA 2FHJA 3RR8A 2F8HA 3OFHA 5K14A 1WF2A 1XR7A 2HVZA 3AJ2A 3D0IE 3CJ8A 4GVBA 4AQYF 1B3TA 1HBUA 2QSWA 4UUXA 2ZJRQ 1WI8A 4DOZA 3HDSA 4ZHRA 2HBQB 2QIFA 3KK2A 4Y2KA 2CQDA 5K8MA 1HHSA 2CJXB 1RCXB 2ZJPQ 1XJWB 2CQPA 1RWOB 4KO0B 4EYHB 1F3VA 2IM0A 1BQNB 5H9FJ 1JLAA 2BM0A 3RB6A 4USVA 5HVGA 1Q8BA 1WC0A 2YWWA 4DQRA 1RADB 4C6AA 1U8WA 2AGOA 2XGQA 3LTOA 2C2EA 5J2PB 2J9CA 4R8UA 3VQTA 3CJ3A 1V5IB 2YWFA 4LRFA 2CPFA 4J9VA 1FNXH 4OX8A 1TL1B 1LWCA 4OJ3A 2ROPA 1DARA 2UUBF 3A8JA 3CT9A 3TZXA 3MMCB 4JV5F 2LQBA 1FFGB 3TVKA 3MM5A 1UVLA 1U24A 3BZQA 4NOHA 5F8IA 4U6PA 4F2SA 3MAAA 1D9AA 1IJEB 1CSJA 4FYXB 1FD8A 4WFXA 4P7VA 2ZH5A 5KFYA 2VFVA 3N01A 1S99A 4OJ1A 5GADI 4C0OC 5HQLA 3KJVB 5GADU 2DPIA 2NXEA 1SQGA 2QMXA 3DU6A 1FEEA 2JSXA 3UCZP 2DNYA 1S9FA 2WZ1A 4LREA 7AT1B 1TZ0A 3DRRB 4CLPA 5HMYA 3Q83A 1OMSA 2KJWA 4DPWA 1Q81T 1HNZF 2G0IA 1UFLA 2WAQD 3T6JA 2BOPA 3Q24A 4N7TA 5F8MA 3HJFA 4YFUA 3OTEA 3RB3A 3BQ2A 2HMIB 1AXQA 4CTAA 5LT5A 4JI7J 4NI2A 1IKVA 1FESA 2XHCA 4TY8B 1S4EA 1UWBB 2L9DA 1R8AA 4CM2A 5KFHA 5KT5A 5KT3A 1IR1A 3QAEA 1X9MA 4OZ0A 3A13A 2GIRA 2HLUA 2B5JB 3K58A 4ED4A 2DGTA 2GQ2A 4U96A 4B9MA 1KONA 2ZH6A 3EMTA 2CJAA 1EKSA 3MGJA 1ZH5A 2HHUA 2DIVA 2KXFA 4E98A 2VIHA 2GX8A 4KGMA 3NNAA 1YRXA 3QSYB 1MU2A 2DVIA 1GQEA 1TU0B 5KTQA 4B3RF 1EKRA 2UVVA 1D3WA 4Z2XA 2OAUA 4P75A 3QRPA 1RE1B 1C2PA 3DLKA 2KG1A 1KTVA 5FLXU 3MFIA 4LF6J 1TKDA 1KSPA 2N3OA 4UOHA 1AFJA 4IOCQ 2KFNA 1S7HA 1ZM2A 1UVMA 2U2FA 1UW9A 2DCUB 2AT1B 1BWVA 4DXLA 5KFTA 1NZAA 2V8HA 2H4YB 1TKXA 1M5SA 2N7YA 2M70A 4O3NA 4KQZA 1L5UA 3OUYB 5JXSA 3J81j 4JI1F 3PHEA 2YNIA 4RLEA 4WU2A 3R7NB 3ZZYA 3MR6A 4N41A 3PX4A 2V8GA 3W9IA 3FFIA 4DR4J 4AE5A 2E29A 4RO0A 1EETA 1M5OC 4KY3A 3PZPA 2K1RA 5A6WA 3SV4A 2G0CA 2JFKA 4X4VA 4BWMA 2DGXA 3MM6A 1TKZA 5A8KA 3TJ8A 4DV4J 4LUBA 1KD1T 3FUYA 3HK2A 4DX7A 3MOJB 4P2XA 1CPZA 3LW5C 2JRSA 1FE0A 2G2ZA 2QRRA 3BPSP 5DZ7A 2Z2YB 5AXKA 2XWXA 1GMVA 4WYWA 3GYNA 4DR2J 2XS5A 3OHBA 2VG7B 4RZRA 4PQUA 3MR3A 4OYMA 4IG3A 1RT3A 4DPTA 2Z0GA 2VQFJ 2WK4A 3TUIC 4CYUA 4C4WA 1HWKA 3W62A 2VQEF 1NB2A 4Y00A 4ITSA 3GFZA 5JVHQ 3L7UA 2ACYA 1FK9A 1YJUA 3GFYA 4PPZA 2FJAB 1J5OB 4E8UA 4NI2B 4WXWA 3P3DA 5THWA 1RUSA 3ISND 1CS4A 3CD6S 1X4DA 1XQIA 2WOMA 3CSKA 4JYAF 3BKTA 3D6TB 3C8YA 3O1LA 4X4UA 1CBKA 2KL8A 3QQCD 4KHRA 3GJTB 4ZP6A 5KFEA 2PA3A 1RTHB 2B9EA 1SV5A 3MTKA 1F1BB 3BGRA 2CYYA 3LAKA 4LRBA 4A8OA 4DG1B 4ZCIA 4U67Q 1NJYA 3SEOA 1SQFA 1WG1A 1Y0HA 1N5QA 2VBWA 4AD6A 1UJ6A 1IJFB 4CO4A 4ZHRB 3J7ZT 4OYAA 1DURA 2V4JA 2FVPA 5I4MA 3EJMA 3D5MA 3LWLA 3KOAA 1GNKA 2YQ1A 4F67A 3GIKA 4IFVB 4ZLJA 3CO9A 4HACA 4R25A 2H65B 2HKEA 1RT1A 1X4CA 1UWBA 2IRXA 1SH0A 3HHDA 4FXVA 1VQPS 2LXFA 4JUZA 1Q16B 3QZ8A 4H4KC 2AF6A 1X8DA 3OTCA 3MECA 4WPAA 4KTQA 2CKWA 5C7PA 4C8NA 5EWEA 3NGUA 3M8YA 1CJKA 1WF0A 2E5HA 5KG4A 4A8QA 4B3TJ 1Y3KA 1FVQA 1H74A 1VQ5S 3DHXA 1FFSB 4M5NA 2NPIA 4URGA 1AZSA 2EC2A 2KFZA 4J9NA 2CG8A 3LP2B 1KDNA 1YWXA 2CPJA 2ZD1B 1YVFA 1HNZJ 2R4FA 4DSKA 1CVJA 1RAIB 2WVCA 5GAEI 2E5LF 2OMLA 2DNLA 1M90T 3U7JA 3V6DB 4WTOB 2IC3B 2AJ4A 2OP5A 4MYTA 2Y1RI 2QGFB 4OZJA 1CULB 3ULHA 3O2IA 4XDCA 4F0KA 4ZCLA 2ZUGA 1RK8A 5M2RA 2XB2D 2LXIA 2DXFA 3MXHP 3HPOA 4DMZA 1M1HA 2H51B 3SSQA 1E6VA 3J7Z5 2LEAA 2NSCA 4DL7A 2MZJA 4P9SA 2DNHA 2V94A 2YNHB 5DGBA 2UXBJ 1TL7A 1FDAA 2H3EB 3D0GE 4IQMA 4C11B 1S6QB 4LFBJ 1XK8A 3IBFB 4KRWA 1JLQB 2ZC3A 1UA0A 4ZPCA 2OPRB 4OI1A 3WX4A 4DJBA 2QTWA 1Q86T 4PG4A 1RYSA 5IQ6A 3BPDA 2Y8YA 2GMLA 3A4TA 5D6GA 1OQ3A 3QWUA 4Q2MA 1T9TA 4WTYA 3V6KA 4A48A 4LR8A 5M2UA 2BE2B 3PYEA 1T3NA 2D3ZA 1DLOB 1BE4A 2DXDA 3BS9A 1HR0F 1I6JA 2NS1B 3W1YC 4ZLLA 3JTPA 1KFDA 2VG7A 2ZZTA 4I64A 1I94F 1SV5B 1VMBA 1ICEB 2MHEA 1T3OA 3BN4A 3HHLD 4OX9J 3CJKA 2NSBA 4KYZA 4B9VA 4LFCJ 2C2ZB 5KFBA 2DO0A 2V4QA 1GMWA 3I4PA 2JC0A 4W4MA 2BJ7A 4TKTA 1HR0J 1RAEB 2V2ZA 1LK5A 1KBRA 3OXFA 2MZ1A 5U47A 1LW2A 3CF5Q 4DV7F 1HI0P 1BLUA 2F8EX 2FIUA 2G1DA 1TL3A 3IGNA 3CCVS 1FRIA 2IBKA 2XMWA 2QEXS 3FEYB 3K5OA 5B0EA 4ANDA 5L1KA 2IJFA 1YSJA 3EGNA 3E2EA 3MDFA 4J9UE 1V3ZA 2HFOA 3G87A 3TUPA 3QPIA 4ENOA 4FYYB 3O3LA 4ICLB 3VZIA 1ROFA 4I56A 5CHCB 3KLGB 2B3TB 1J5EJ 5CXTA 3CCRS 1D9FA 4LF6F 2IY5B 4UTGA 2KN4A 3I55S 1HBNA 2J5AA 4K0KF 5EN1A 2MHNA 4LSZB 1XERA 1RTHA 3DRYA 3LP2A 3T9ZA 4DR3J 2BQRA 3DM2A 3HM9A 1NK0A 1MWYA 2W01A 3MM6B 2MQPA 1IKWB
chains in the Genus database with same CATH topology
1NPKA 2B8PA 3ZTPA 4C6AA 2ZUAA 1U8WA 3NGTA 3VVTA 2AZ1A 1NCLA 3FBBA 4S0MA 3VGTA 4UOFA 1LEOA 4O0NA 3BH6B 3Q86A 4FKXA 3FKBA 1WKKA 3VGSA 3EJMA 3FBCA 2DY9A 1F6TA 2HVEA 1NDKA 3EVMA 3DKDA 1ZS6A 3FCVA 4EK2A 3Q8VA 3NGSA 1K44A 4F36A 3GPAA 1S59A 5C7PA 3VVUA 3Q83A 3NGUA 3PJ9A 1B4SA 2B8QA 3ETMA 1NLKL 1S5ZA 2VU5A 4FKYA 3VGUA 1NDCA 4UOGA 3GP9A 3BBCA 2BEFA 1F3FA 1KDNA 2BX6A 3NGRA 3EE3A 3BBFA 5CAAA 3BH7B 3Q89A 3FBFA 1HLWA 4DZ6A 3FBEA 3ZTRA 3EM1A 2HURA 3R9LA 3EMTA 2DXFA 4WBFA 3ZTOA 3JS9A 5IOLA 3ELHA 4ANEA 1NHKL 3EICA 2DYAA 4W98A 3ZTSA 1BHNA 1BUXA 4UOHA 3EVOA 4F4AA 1VYAA 1HIYA 3EVWA 3FCWA 1NDLA 1PAEX 1UCNA 1PKUA 2CWKA 3G2XA 3PRVA 4HR2A 1WKLA 3ZTQA 3WX8A 5CABA 1BE4A 2DXDA 2AZ3A 4KPCA 3VGVA 3Q8UA 4DUTA 1NSQA 1S57A 4CP5A 1MN7A 1XIQA 1NUEA 4ANCA 5BXIA 4DI6A 3FC9A 1NSKL 4ANDA 1W7WA 1JXVA 3DDIA 3BBBA 1NDPA 1MN9A 1WKJA 3B54A 4ENOA 3Q8YA 3MPDA 1NSPA 3B6BA 2NCKL 1NB2A 3ENAA 1EHWA 1HHQA 2DXEA 3L7UA 1B99A 1LWXA 2HVDA 1XQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPK A;  2B8P A;  3ZTP A;  4C6A A;  2ZUA A;  1U8W A;  3NGT A;  3VVT A;  2AZ1 A;  1NCL A;  3FBB A;  4S0M A;  3VGT A;  4UOF A;  1LEO A;  4O0N A;  3BH6 B;  3Q86 A;  4FKX A;  3FKB A;  1WKK A;  3VGS A;  3EJM A;  3FBC A;  2DY9 A;  1F6T A;  2HVE A;  1NDK A;  3EVM A;  3DKD A;  1ZS6 A;  3FCV A;  4EK2 A;  3Q8V A;  3NGS A;  1K44 A;  4F36 A;  3GPA A;  1S59 A;  5C7P A;  3VVU A;  3Q83 A;  3NGU A;  3PJ9 A;  1B4S A;  2B8Q A;  3ETM A;  1NLK L;  1S5Z A;  2VU5 A;  4FKY A;  3VGU A;  1NDC A;  4UOG A;  3GP9 A;  3BBC A;  2BEF A;  1F3F A;  1KDN A;  2BX6 A;  3NGR A;  3EE3 A;  3BBF A;  5CAA A;  3BH7 B;  3Q89 A;  3FBF A;  1HLW A;  4DZ6 A;  3FBE A;  3ZTR A;  3EM1 A;  2HUR A;  3R9L A;  3EMT A;  2DXF A;  4WBF A;  3ZTO A;  3JS9 A;  5IOL A;  3ELH A;  4ANE A;  1NHK L;  3EIC A;  2DYA A;  4W98 A;  3ZTS A;  1BHN A;  1BUX A;  4UOH A;  3EVO A;  4F4A A;  1VYA A;  1HIY A;  3EVW A;  3FCW A;  1NDL A;  1PAE X;  1UCN A;  1PKU A;  2CWK A;  3G2X A;  3PRV A;  4HR2 A;  1WKL A;  3ZTQ A;  3WX8 A;  5CAB A;  1BE4 A;  2DXD A;  2AZ3 A;  4KPC A;  3VGV A;  3Q8U A;  4DUT A;  1NSQ A;  1S57 A;  4CP5 A;  1MN7 A;  1XIQ A;  1NUE A;  4ANC A;  5BXI A;  4DI6 A;  3FC9 A;  1NSK L;  4AND A;  1W7W A;  1JXV A;  3DDI A;  3BBB A;  1NDP A;  1MN9 A;  1WKJ A;  3B54 A;  4ENO A;  3Q8Y A;  3MPD A;  1NSP A;  3B6B A;  2NCK L;  1NB2 A;  3ENA A;  1EHW A;  1HHQ A;  2DXE A;  3L7U A;  1B99 A;  1LWX A;  2HVD A;  1XQI A; 
#chains in the Genus database with same CATH topology
 4OX6 A;  4ELU A;  3D1H A;  5IC6 B;  2ZOF A;  3AOC A;  4KFB A;  1GH8 A;  3PW2 A;  1PJ5 A;  4ZPV R;  4OMF G;  2F7V A;  4RW6 A;  4WP3 A;  2HNZ B;  4C2M A;  1RTZ A;  1WOR A;  2O67 A;  3NOC A;  1YGY A;  3FBB A;  3SDE B;  2ZJQ Q;  1U1Q A;  4TU9 A;  4L3N A;  2CRL A;  3S7R A;  3NS5 A;  3OLA A;  2FHO B;  3MM8 A;  1JXL A;  2AHO B;  5HJY A;  1VQM S;  2UXD F;  1JLB B;  2ZNY A;  1Y00 A;  1U45 A;  4PWD B;  2O01 C;  1MML A;  1RT1 B;  2L9N A;  4IG0 B;  4M5K A;  2QA4 S;  4IQX A;  1WI6 A;  1TKX B;  5KFG A;  1SIZ A;  1VRU B;  2ZWP A;  4ED3 A;  3UD3 P;  1YIJ S;  3D7S B;  4MIB A;  3M8Z A;  1FA0 A;  2MQM A;  3PTW A;  3DGP B;  2LP4 A;  5KFV A;  3U1M A;  2ILY A;  4NA1 A;  5C25 B;  2PN6 A;  3HVR A;  2RQM A;  2FHK A;  4ZN3 A;  3H42 A;  4K4Z A;  4NYZ A;  1DBD A;  1FDD A;  4CT9 A;  3P4U B;  3GV7 B;  1RT7 B;  3EZU A;  4DPY A;  2ZBI A;  2W9B B;  4JI5 F;  1AZS B;  5AT1 B;  4ZDN A;  5JUM A;  1VRT A;  1C0U B;  2JLE A;  4OIX A;  5LMN F;  1A9N B;  1UVK A;  3J7A 1;  1NM2 A;  1RXO B;  4I6Y A;  3PW0 A;  3DLJ A;  2VU5 A;  4WE1 B;  5D0E A;  5IT9 Y;  5L8R C;  1XR5 A;  3T5J A;  1WHY A;  1NK4 A;  2HGN A;  2I5J A;  4BS2 A;  1NEE A;  2F9D A;  2BX6 A;  2MPU A;  4NL5 A;  2D9O A;  1S49 A;  1AT1 B;  3BR8 A;  2FY8 A;  1B0T A;  2GJI A;  1DAX A;  5D0R A;  4QQB A;  2ZBR A;  2VFR A;  2K7K A;  2B7C B;  4DLE A;  3FBF A;  1H3D A;  1RT4 B;  1HA1 A;  3M9M B;  4OYB A;  3R1H A;  4TQR A;  5D4P A;  2F40 A;  2XBP A;  4P6Q A;  4P71 A;  4HH1 A;  1T95 A;  1PBA A;  1U1N A;  3M05 A;  4O3R A;  2AU0 A;  4NCA A;  3N5B A;  3KLH B;  2KB2 A;  2QL9 B;  3ITH B;  4LF9 J;  1FKP A;  1JIH A;  1M5H A;  4RWX A;  1W2B R;  1CJK B;  2QL5 B;  4ANE A;  4Q0B B;  3PYD A;  1AUD A;  1H0H B;  4HKQ A;  2MLZ A;  4QYZ J;  1RHQ B;  1H38 A;  1F9F A;  3R27 A;  2R42 A;  3K7R A;  1Y9O A;  2H54 B;  4JI6 F;  3NRB A;  1U26 A;  2RAQ A;  2J0Q D;  3NBP A;  3EVO A;  2DGU A;  3CJK B;  1FD2 A;  2XO7 A;  4CO0 A;  1VLY A;  2WHO A;  4U9R A;  3V4I B;  3NAH A;  3TI0 A;  1FX4 A;  1NDL A;  2IC3 A;  2XZW A;  2RS2 A;  2AJF E;  1NB7 A;  5E5N A;  4HVZ A;  1WKL A;  3ZTQ A;  1I3O B;  5HMZ A;  1GMU A;  2VPX B;  6FD1 A;  2XLI A;  3K59 A;  2XS7 A;  5BYQ A;  3JAM U;  4OQJ A;  4I2Q B;  1HBU B;  2H5J B;  1CJT B;  2GJ2 A;  2C2K B;  3MCS A;  3VHQ A;  2C28 A;  3EPI A;  5J1E A;  4F4Y A;  2YPY A;  2QA4 G;  4B3M J;  4DL2 A;  1XNQ F;  4Y0F A;  3MPV A;  2D1C A;  4JBC A;  5G0R A;  1YJT A;  4WKR A;  2OEL A;  4OI3 A;  5IQQ A;  4OLP A;  2DHA A;  2RML A;  2CPD A;  5KG6 A;  1TUV A;  1NBE B;  2R3V A;  4ZA1 A;  2R7W A;  3N6M A;  1GT8 A;  2IMO A;  3CDB A;  3GG1 A;  4URQ U;  1TKT A;  3SCI E;  5BXI A;  3Q22 A;  3EZ5 A;  1K47 A;  1UKU A;  2D3U A;  2PT0 A;  4A4J A;  4O3Q A;  2IJN A;  1ZA2 B;  3NP5 A;  4NXM J;  3MUT P;  2DBB A;  1IM4 A;  4N56 A;  1NDP A;  1MN9 A;  2Y0B B;  2KO1 A;  2YNI B;  4CWB A;  4OI0 A;  2BV3 A;  1WDD A;  2Z4P A;  3MMC A;  2B5J A;  2RD5 C;  3BSA A;  1NSP A;  4OZL A;  5L38 A;  5GAE U;  4LFC F;  2VG5 A;  3OR1 A;  4YHH F;  4DWI A;  4KHP J;  1RWM B;  2BRL A;  4J37 A;  3HX9 A;  4ECR A;  3ZZP A;  3VAI A;  4N76 A;  1Q7L B;  1RI7 A;  1LWX A;  1R8B A;  1VDH A;  1T03 B;  1W26 A;  2FJW A;  4K8R A;  5KFW A;  3KLF B;  1DY3 A;  1NPK A;  4ZVR B;  4ECX A;  1VIS A;  3QFW A;  3V2U C;  3ZZO A;  2V8D A;  4NZ7 A;  4A8M P;  4V19 X;  4DN0 A;  1U6F A;  2AZ1 A;  1Y11 A;  4K2X A;  1GAO A;  2LU1 A;  2ZBC A;  5ETS A;  1R0A A;  2I2Y A;  1UJ4 A;  1U7L A;  1FKP B;  3MED B;  2UUA F;  2E7X A;  1XBW A;  2JDJ A;  2JOQ A;  4ICL A;  4PKD B;  4L6V 3;  2VKZ G;  4KGZ B;  3POT A;  1X5P A;  1KOH A;  3FEZ A;  5EX3 A;  1KQF B;  4DQS A;  4JV1 A;  3E01 A;  3TZW A;  4ZCK A;  1PGZ A;  1KHW A;  3EVM A;  1HQU A;  1IKY A;  1FJG F;  2KRR A;  4X62 J;  3NG8 A;  3QID A;  4EK2 A;  4CIO A;  3LPY A;  4Y2M A;  2MY7 A;  1G2E A;  3GFX A;  1HBM A;  1VS3 A;  5D4L A;  2A6M A;  1HD0 A;  1OY9 A;  1LWF B;  3HSZ A;  1MW7 A;  3NGS A;  4O3O A;  4F36 A;  2XLJ A;  1NJI T;  3BGR B;  3HKW A;  3LGH A;  5K5M A;  1MU2 B;  3RUB L;  1FRJ A;  1FJG J;  1NLK L;  1H2U X;  4KHM A;  1M1G A;  2P8I A;  2QSF A;  1SKW A;  1B64 A;  3OBI A;  4HI2 A;  2IDL A;  1DTQ A;  1KRP A;  5IV4 A;  3Q2S C;  4OZ1 A;  2XC9 A;  5HBM B;  2E44 A;  2M4M A;  2EG2 A;  3CJR A;  4GVL A;  2A6O A;  2PI4 A;  4IKA A;  4DSJ A;  1S77 D;  2E1P A;  3MF5 A;  1E6Y B;  1NO8 A;  1Q7Y T;  4TY9 A;  4LF5 J;  3ISN C;  2CQH A;  4WCE Q;  3V81 A;  2RSQ A;  2R7U A;  2M88 A;  4OHW A;  2VB6 A;  3KLG A;  1WNE A;  1N88 A;  4J9O A;  1YDL A;  2HEK A;  4I69 A;  3X3U A;  1UEK A;  4A47 A;  1RT6 A;  4LRD A;  3Q8S B;  2A2C A;  4RNN A;  2QLF B;  1UPP A;  2GFF A;  3DRX A;  4I6A A;  5LL6 d;  3KXD A;  2FVR A;  2GA7 A;  2HQF A;  3IR7 B;  3SMZ A;  1NHK L;  2O66 A;  3G82 B;  3HXM A;  4NCG A;  2VDI A;  2RF2 A;  3KDN A;  1CQM A;  2CJ9 A;  2WSC C;  3FZB A;  4MKV A;  4OLO A;  3TRG A;  1RU1 A;  1WG4 A;  2GCF A;  3MR2 A;  3GIJ A;  3EX7 B;  3AD9 C;  3NKY A;  2RDJ A;  1TEL A;  2QG9 B;  1YK9 A;  2RDI A;  4DCO B;  5DQH A;  2BA9 A;  1JKH A;  3AD7 C;  2F65 A;  1Y4Z B;  1KC8 T;  3CDA A;  2QFI A;  1HYS B;  4ZVP B;  1FRK A;  3OUY A;  1VQ8 S;  1C1B B;  1NHU A;  3O8W A;  3HO1 A;  2XUL A;  2DCL A;  1HI1 A;  2WSF C;  3R7S B;  1F0X A;  1RDR A;  4M5H A;  3US5 A;  4ZLP A;  2AGP A;  1TFY A;  3PW5 A;  1TVR B;  3PX0 A;  1TL3 B;  2E66 A;  2AW0 A;  1C4A A;  3IM9 A;  5A8W B;  2XMA A;  1S76 D;  3DLE A;  4G1Q A;  1Z2Z A;  2UV8 A;  1NKC A;  1WC5 A;  2KXH A;  2VC1 A;  3IFE A;  2VQE J;  4UUW A;  2DHH A;  4C48 A;  2V2Q A;  1RKI A;  2CZV C;  4YB5 A;  5GAG U;  2ZH2 A;  2AGQ A;  1VQ9 S;  3JTN A;  4LF7 F;  4XIU A;  2XS2 A;  3P6Y C;  4GKJ F;  3BEG B;  3EPG A;  4F02 A;  3LQV A;  3GQC A;  3PG9 A;  4LF2 A;  3H8Y A;  4JI3 J;  1RIS A;  1S9E B;  5KFX A;  3PW4 A;  5BJR A;  3BKU A;  3NL0 A;  2RDD A;  1U8S A;  3RR7 A;  4ZPT R;  4GC7 A;  5D4N A;  4JI6 J;  2FUG 9;  3R6G B;  4IFY A;  3JAM Y;  2J0W A;  2ZH1 A;  5B0F A;  2N4C A;  4MK7 A;  1SKU B;  3DRS B;  4CLS A;  5F8G A;  2SXL A;  1NSA A;  1NPR A;  3CVK A;  4EI2 A;  2CQB A;  1PSD A;  3GSI A;  1U6B A;  3S8S A;  2RQ4 A;  2K3I A;  4C11 A;  1JMT A;  3IA0 A;  2JWN A;  1AA1 B;  2IAJ A;  4JI8 J;  3TEG A;  2GVD A;  5AE1 A;  4RX6 A;  3A3P B;  4NPO A;  2CVI A;  2CQ2 A;  4PUO A;  4IRD A;  5FJ4 A;  3LWM A;  5A6P A;  3FBC A;  1PC5 A;  2Z30 B;  3DI6 B;  1HNV A;  1Q0N A;  1GXT A;  4IDK A;  3VF0 B;  3CCU S;  4DV2 F;  2XMV A;  3LUY A;  2Z2Z A;  5J2Q A;  3C46 A;  3D1O A;  4KJI A;  4CO3 A;  5ETQ A;  1XWL A;  5A0Y A;  1NK8 A;  5HQ8 A;  2O1P A;  1FXL A;  4RUC A;  1WC6 A;  2GO8 A;  2GAG C;  2H1Y A;  3IWL A;  4H4M A;  2IPO B;  3DLK B;  3HMJ G;  1IBL J;  1PJ7 A;  3W66 A;  2HK3 A;  4UST A;  2MTL A;  4OYZ A;  2YPZ A;  4HDG A;  3SDE A;  2HZV A;  3C3L A;  2ASJ A;  1TV6 B;  4C9D A;  2LQ5 A;  2W2P P;  2AQ4 A;  1F5B A;  3DHW C;  3PNI A;  1IN0 A;  1R8H A;  1VGY A;  4NLD A;  4ZVT B;  3ZZR A;  2KFY A;  4USM A;  1TK8 A;  2EW9 A;  2CNN B;  2YNG B;  2XQC A;  2WB1 D;  1FK9 B;  4ZS6 A;  3D1Q A;  2M8D B;  5KT6 A;  3EE3 A;  3QRQ A;  1H2T Z;  1RBO B;  1HWI A;  5I3Q A;  2L08 A;  4GRS A;  4ZP8 A;  5F8H A;  3BGF A;  3IAS 9;  1IBL F;  2Y0S D;  5DQG A;  1UAW A;  3I96 A;  4DFP A;  2D3O 1;  4C8K A;  2ZKT A;  1UWA A;  3A8K A;  3MEE B;  1WTB A;  1LWE A;  2HAF A;  2FC8 A;  2HHH F;  1BMQ B;  2UUT A;  4CO2 A;  4DR1 J;  2HW3 A;  4XPC A;  5A76 A;  4NLS A;  2KU7 A;  1NKB A;  4LF9 F;  5I42 A;  1SL0 A;  2P9C A;  2XSJ B;  1LW2 B;  2AP6 A;  3EIC A;  3GCW P;  4CLK A;  8RUC A;  2MKK A;  5DS7 A;  2G4B A;  1AB8 A;  3T6B A;  3TO8 A;  5ETT A;  1SJ1 A;  5DLG A;  1BHN A;  2KHD A;  4LF8 F;  3IC1 A;  4LBI A;  1Z2L A;  4TN2 A;  4DX5 A;  1CC8 A;  3M2R B;  5L39 A;  2Z2L A;  2FLN A;  5K9F A;  3DC2 A;  3DRS A;  3NWR A;  3FCW A;  5ADZ A;  5J1E B;  4ZIV A;  2MZR A;  2YX1 A;  3BB5 A;  2B4U A;  4E2F B;  5E7O B;  5J1P A;  4RW4 B;  5KFR A;  3PV8 A;  1ZAV A;  1NH8 A;  2OJ3 A;  4B3O B;  2MEW A;  3KMQ A;  2EVZ A;  3Q8U A;  5CYM B;  3BO3 A;  3NNH A;  5KG5 A;  1JQG A;  1RAF B;  3V4I A;  1S57 A;  1KQK A;  3GJS B;  4J9P A;  2OPQ B;  2PO4 A;  2DHX A;  2HRT A;  4MH8 A;  2X1A A;  3VAK A;  2QC3 A;  2CDR B;  1LXJ A;  2DGW A;  3LH2 S;  2JLF A;  3OFF A;  1ACM B;  4DDF A;  4AQY J;  2AYG A;  1X31 C;  4WYL A;  4O3S A;  3RBX A;  4A46 A;  1YBT A;  2XEX A;  4O23 A;  1PAU B;  2R8G A;  5L46 A;  1V3S A;  3DOL B;  5EWG A;  5J2M A;  2IVY A;  2YVS A;  2R2S A;  4CT8 A;  3MMB A;  3W5X A;  4DCJ B;  3KLH A;  1Q8L A;  1YJW S;  4WFN Q;  3UN2 A;  3SSR A;  2BVZ A;  4LF7 J;  3FVY A;  1WUU A;  3CJ2 A;  3IBW A;  2LXU A;  2HQ3 A;  3DDN A;  3MPD A;  4DR5 F;  2XSF A;  2AMC B;  3IAM 9;  1SJR A;  2YH1 A;  4J5O A;  3H0P A;  3P5B P;  2Q6B A;  3AY0 A;  2VOD A;  1HFE L;  3MMJ A;  4X2B A;  2F9J A;  3KLV A;  3FRY A;  4K59 A;  3VAJ A;  2DNR A;  4NWB A;  3AOA A;  4DR6 J;  3G86 A;  1A7G E;  2Y3Y A;  1QVG R;  3CCZ A;  3E3X A;  3GG0 A;  4EUV A;  5E0O A;  4OHX A;  2G9O A;  3AXK A;  1SXL A;  3ZTP A;  4B3M F;  4NXN F;  1REV B;  3M8S A;  4LR7 A;  2K1R B;  1U0S A;  2V67 A;  1LFP A;  4DX8 H;  1XC9 A;  3KG1 A;  1JNR B;  4X64 F;  4PAB A;  4DV1 J;  3PVX A;  4ZIT A;  3I0R A;  1LFW A;  3GSD A;  3QGG A;  3OTD A;  1YX2 A;  3I6P A;  4BHQ A;  1VR6 A;  4Y6I A;  1NK5 A;  5BR8 J;  3MFH A;  4FF1 A;  1RAA B;  1T0T V;  1Y10 A;  1PC4 A;  3DOK A;  4FKX A;  4ES2 A;  4ETX A;  4QPX A;  4DUZ F;  1WJ9 A;  4K4V A;  3OHA A;  3RBZ A;  4DX6 A;  1SI9 A;  3ENQ A;  3V6D A;  2H9Z A;  2D7S A;  1SJF A;  1ZS6 A;  3B4D A;  4GO5 X;  4DFJ A;  3RW7 A;  2VPY B;  3KLE B;  4OHV A;  1L3U A;  4X4S A;  3K8V A;  3NY0 A;  4DUY J;  5F0U A;  4KPY A;  3LAM A;  2BOA A;  3MUV P;  3QSI A;  2A2D A;  2QZ8 A;  4XAK A;  3W5Y A;  1K1S A;  1YBU A;  1BY9 A;  3JQK A;  4NLY A;  4BWJ A;  4EO6 A;  2GHV C;  4DV6 J;  1T05 A;  5HVF A;  1N34 J;  3WC2 A;  2DH7 A;  2ZBQ A;  1FDB A;  2DKO B;  1HQE A;  1S9G B;  1S5Z A;  2B8Q A;  2AX0 A;  2CQ0 A;  3GLJ A;  4FKY A;  4M5I A;  4YB6 A;  3PIP Q;  1URR A;  3PW7 A;  1EQM A;  3S6E A;  2ASD A;  1ULR A;  4WK3 A;  4QIF A;  5CYM A;  3TOQ A;  3DOM A;  3W64 A;  5C2G A;  1SC4 B;  3H4B A;  3UCU P;  3BGL A;  3IO1 A;  4P2M A;  1HBM B;  1C1C B;  3GR0 A;  4M5J A;  4NLT A;  4ATN A;  2RHQ B;  3DMJ A;  3M1V A;  3IWN C;  1IKY B;  2XI2 A;  4LT6 A;  4EU0 A;  1O5J A;  2VBX A;  4IO1 A;  4DV1 F;  2UZA A;  4IOA Q;  2LYV A;  3PR5 B;  1CG2 A;  2W4P A;  3KNG A;  3VV2 B;  3P8B B;  2FHJ D;  1L3V A;  3P49 B;  2HHQ A;  5ETM A;  3JSR A;  1QVF R;  3W60 A;  3Q0A A;  3ILJ A;  3VAF A;  3K5P A;  3MMA B;  5E33 A;  4EZ6 A;  4I6W A;  2PMH A;  2DNO A;  3FK4 A;  2XM3 A;  4OI2 A;  3OW2 R;  3CC4 S;  1R0A B;  2BBE A;  3TJ9 A;  5HMW A;  5KG2 A;  1JX4 A;  2J9D A;  1X4H A;  5A2Q U;  5I3U B;  2RQK A;  4CCH A;  2MYF A;  2GGP B;  1P1T A;  2QLB B;  4WP9 A;  2JJ4 D;  3UFC X;  2M52 A;  1Y5N B;  4CH7 A;  1VBZ A;  2MZQ A;  2WRM A;  3H98 A;  1X5O A;  4PG5 A;  2LMI A;  1NME B;  2HFS A;  2ZDP A;  4G65 A;  2AD9 A;  4PG8 A;  2WW4 A;  1NH7 A;  1SJQ A;  4D3H A;  5C25 A;  3BQ0 A;  3EVW A;  1M5V C;  3RW6 A;  2HHS A;  3C16 A;  1D8Y A;  3HUL A;  4FBU A;  2XCA A;  5AXL A;  2CWK A;  5HMX A;  1ZTW A;  2VJU A;  4HT7 A;  3POT B;  4WFA Q;  1URN A;  3RAM A;  3K0J A;  2OEK A;  1FX2 A;  1RHU B;  1WEX A;  3FQL A;  1KWM A;  5DO2 A;  3TVZ A;  4CLT A;  4P10 A;  4FF3 A;  1P8G A;  1VHF A;  3BM7 A;  4KGK A;  1Q8K A;  3TVY A;  4YOE A;  1NSQ A;  4RU9 A;  2L48 A;  1MMN A;  4ZJL A;  3KYL A;  2C2M B;  5FD1 A;  1KN6 A;  1H98 A;  1TL5 A;  1UFW A;  3KNA A;  1AW0 A;  1VQY A;  2D41 A;  1O6X A;  4OV1 A;  1K0V A;  2KJV A;  2VZ9 A;  1TL4 A;  3M8P A;  1YJV A;  5JMN A;  3OPK A;  5DQI A;  1FF2 A;  2G0J A;  3GE9 A;  1U25 A;  3HJV A;  2HS0 A;  4J90 A;  5DZ6 A;  5KG7 A;  4J9S A;  1NK6 A;  3CGI A;  2CAD A;  1RTJ A;  3WBZ A;  1RTD B;  3KMS A;  1I1G A;  1XMO J;  4AFF A;  3MCN A;  3RRH A;  2VPW B;  2J8S A;  2V0N A;  4IG0 A;  5DET A;  4LF8 J;  5IZH A;  2IA6 A;  1CJV B;  3KDO A;  5KOX A;  1HNW F;  3RB4 A;  4QU7 A;  3FMW A;  1TK0 A;  4UF4 A;  4N8N A;  1QE1 B;  1RAH B;  2ZKU A;  1NK7 A;  1WEL A;  1R7I A;  1WOP A;  5B0D A;  5IV3 A;  4LSN A;  1W25 A;  1S1X A;  4ZCM A;  1LW0 B;  1J2V A;  1Q8I A;  1WAC A;  4KFB B;  3AB4 B;  3W8G A;  1IXK A;  2GW8 A;  3D4J A;  4I4B A;  2EKY A;  3RBE A;  1WHW A;  5LSL A;  4QIG A;  3T41 A;  4NX9 A;  2WB4 A;  3VWS A;  4ID5 B;  3NMR A;  1F5C A;  1OY8 A;  1QUV A;  1KTQ A;  4NLP A;  3TJA A;  4DFM A;  3CXC R;  3RAQ A;  2ATL A;  4MKA A;  5DG9 A;  3C14 B;  2W7P A;  2QFJ A;  1KQS R;  1QAI A;  2AV5 A;  2X1B A;  2Z2M A;  4ZKA A;  3LP0 B;  1APS A;  3N0V A;  2FC9 A;  1BGX T;  1RHR B;  1RT3 B;  2VUG A;  1BC6 A;  1F6T A;  2QL7 B;  2VFU A;  2KYX A;  3AA8 A;  1P6T A;  2K8G A;  1B0V A;  4XK8 C;  1VQK S;  2E7W A;  1FTC A;  2XGP A;  2RU3 A;  1KFS A;  5CD4 H;  2XO6 A;  4DV3 F;  3GJR B;  5F8L A;  4HI1 A;  4Q0B A;  1YJ7 A;  1GMW D;  3PJ9 A;  1B4S A;  1IR2 A;  9ATC B;  2VON A;  3DRP A;  4DCP B;  1YQH A;  4UOG A;  1Q53 A;  2CUY A;  4O44 B;  2R2U A;  3BBC A;  2RU9 A;  2WON B;  1VRT B;  3O44 A;  3BJY A;  2EK6 A;  3QJJ A;  1MG7 A;  2ZOG A;  4C0H A;  5KAK A;  1J27 A;  1MMD A;  1TAQ A;  4U8V A;  1N33 J;  3P96 A;  3UCG A;  9RUB A;  1S1U B;  3G6Y A;  3M2U B;  3QJL A;  5KFK A;  4IFY B;  1RYR A;  3UDC A;  2QT7 A;  4B9L A;  2PFF B;  2F4V F;  1X4A A;  1U1K A;  2BR0 A;  1N6Q A;  1LXN A;  2GO9 A;  2E1R A;  5CYJ A;  4NYO A;  4BBY A;  3NGD A;  3I5B A;  4ZVQ B;  2BJ1 A;  1IKX A;  4BCA A;  2HQC A;  2CDQ A;  3W8P A;  2UVW A;  4X4P A;  3UDV A;  1ZPW X;  3TAN A;  2VD3 A;  2HHX A;  1TV6 A;  3I87 A;  4RWW A;  3A8I A;  4ZOS A;  2RHS B;  3HD1 A;  4OZ5 A;  3J80 Y;  3J80 U;  1G6B A;  1RLC L;  2DYA A;  5CQG A;  4M63 A;  3UN3 A;  1M1K T;  4JV0 A;  3OJU A;  2N7C A;  1HBO A;  1JLF B;  1LWE B;  2EFG A;  3CCW A;  3RG6 A;  1VC0 A;  4CLL A;  1VLO A;  1HQU B;  3T1Y J;  4B3S J;  1VJW A;  3BN7 A;  2J7W A;  1PJ6 A;  3QAU A;  1PAE X;  1OQ6 A;  1QE1 A;  3MD3 A;  3ZXW A;  1GTH A;  2IVM A;  2PEB A;  5A8R B;  4IDK B;  5KT2 A;  3C6T B;  4Z37 A;  3PX6 A;  4HHH A;  4DSI A;  2ZEJ A;  2GIQ A;  2LQ8 A;  5CAB A;  2LA6 A;  4O4G A;  4ZVF A;  1GXU A;  2JX2 A;  1Q1K A;  4DV4 F;  5HK4 A;  2AZ3 A;  2G2Y A;  3GYX B;  1JLE A;  2HBR B;  3GTY X;  4GVB B;  4IG3 B;  4QWA A;  2ZVS A;  2NUH A;  2YQ3 A;  3NWG A;  3QJP A;  4ID5 A;  1N0U A;  2OD4 A;  1Q79 A;  3K5N A;  1QTM A;  2R7R A;  2MJU A;  5L9N A;  4YHH J;  3DOL A;  5LSR A;  3Q8R B;  3B78 A;  1CQN A;  4RNM A;  3TUJ C;  3GZ7 A;  2ZBP A;  2XYP B;  1TUG B;  4KSE B;  4UOC A;  1DHM A;  5GMD A;  1EB0 A;  2QLJ B;  3W63 A;  4B9S A;  1BQN A;  2W2O P;  5CCL A;  5KFQ A;  1RZM A;  3MUM P;  1JJ4 A;  4AUK A;  4YME A;  3PAC A;  4A8K A;  4FNH A;  1UTA A;  1S1T A;  4TLQ A;  2HRU A;  4F0H A;  4FXW A;  2BZ2 A;  3WZ0 A;  1F9E B;  1RCO B;  2WW8 A;  2XZD B;  1KOO A;  3E01 B;  3IGV A;  2YKM A;  5E2Q A;  4YQW A;  3G71 S;  2OFG X;  2DNG A;  5KG0 A;  4DV0 J;  4ETZ A;  2VIC A;  3BO2 A;  3ZFV A;  2DHG A;  3J7A N;  1SKS A;  2BE2 A;  3J81 Y;  2KRB A;  2ZH8 A;  4MT1 A;  3UDE A;  1WSV A;  2UU9 F;  4HLB A;  4NLR A;  4DPU A;  1TAU A;  2MQO A;  2EXU A;  4OX9 F;  3K89 A;  3D2W A;  3P45 B;  4I68 A;  3QLH A;  2BYC A;  2R7O A;  4Y2I A;  2QA1 A;  4QJV A;  4JB8 B;  4RW7 B;  3C6U A;  4M5D B;  4ECU A;  3CCJ S;  2ZUA A;  1VIX A;  1GFW B;  2KXN B;  1D8Z A;  1YIT S;  2KYZ A;  1T03 A;  4GKJ J;  1SL1 A;  4M94 A;  2XLK A;  3ET6 A;  2B0G A;  4NZ0 A;  1LOU A;  4PG6 A;  4F2R A;  4YR3 A;  2BJ8 A;  1IKX B;  1FDN A;  3CJ4 A;  3LO3 A;  4BC9 A;  2VOP A;  2IMW P;  2WVE A;  4L73 A;  3VGS A;  1N5T A;  1OS5 A;  1SH3 A;  4UY8 5;  1MWZ A;  2OEM A;  3LAL A;  1SQE A;  4N77 A;  8AT1 B;  2DR8 A;  2HVE A;  4RNF A;  3V81 B;  3JB9 k;  2WVF A;  4IH7 A;  3UDL A;  1UPM B;  1ZTT A;  3D54 A;  3VQS A;  4NXN J;  3AT1 B;  2BM1 A;  2K2P A;  2V5H G;  3AD8 C;  3Q8V A;  4XTT A;  2B4V A;  3VTI A;  1RWP B;  2BJ3 A;  3IR6 B;  5GVQ A;  3UD5 A;  4QBU A;  4PYD A;  2V6A A;  4MFB B;  2W7A A;  5A2Q Y;  3NMA A;  1IVZ A;  4ZJO A;  2P6S A;  4X66 J;  1SB6 A;  3BYP A;  4ILL A;  5FDL A;  4HTI A;  5JJB A;  1N6Q B;  2HPU A;  1H2V Z;  1U0H A;  3IG1 B;  4V1A k;  4KO0 A;  2IVF B;  1JNZ B;  3W2W B;  4B3T F;  2KTQ A;  3T19 A;  5B0G A;  2MKY A;  1LV5 A;  4A8F A;  4JI2 F;  5CAA A;  4GKK F;  4HT5 A;  3R8Y A;  4QWD A;  1TQL A;  1HLW A;  4LFA F;  1NZ8 A;  2I38 A;  4C8O A;  2OHD A;  2CA9 A;  1IWG A;  1VRU A;  4L72 B;  4ED1 A;  3GB0 A;  1O51 A;  2OTL S;  3CIZ A;  2Y1J A;  2HMI A;  3OQ2 A;  4R0E A;  2C2R A;  3I32 A;  4WBF A;  1EAY C;  3WC0 A;  4YUD A;  5K8N A;  1WG5 A;  1HQE B;  1QJH A;  4B17 A;  1YTY A;  2NQP A;  2HAI A;  2XSJ A;  4FNI A;  1VFJ A;  3B4M A;  4O4R A;  1JK9 B;  4USW A;  1YJR A;  4DZD A;  1S97 A;  1D1U A;  1BUX A;  3ICL A;  1G1X A;  2DNN A;  4DL0 C;  3GYG A;  3OXL A;  4UZB A;  1FJC A;  4ELV A;  2ABY A;  4I67 A;  1TR0 A;  2W24 A;  3CE8 A;  1JJC B;  3I82 A;  4HEA 9;  1PKU A;  3OVA A;  3HT3 A;  4P74 A;  4X64 J;  1MWQ A;  4XPE A;  2UVR A;  5FLX Y;  4ZPW R;  3CD7 A;  1E6Y A;  3D68 A;  3Q23 A;  1SUQ A;  1IKV B;  3HHK A;  2WSE C;  1RT5 B;  5F8N A;  3PKY A;  2XG8 A;  3QGI A;  4KH1 B;  1AYE A;  2IM3 A;  3HVA A;  4ZVH A;  3KHL A;  1CC7 A;  2MKS A;  3R5A A;  4R8U B;  2K06 A;  5KOW A;  5D0G A;  1XIQ A;  3IP0 A;  2CG4 A;  4ILM A;  2YY3 A;  2GQQ A;  1M5P C;  3DDK A;  1P9Y A;  1N33 F;  4DU7 A;  1NXI A;  2B7B B;  4C8L A;  3G82 A;  3MM9 B;  4X4R A;  3M9N B;  3GIR A;  1VBX A;  3CJT A;  3HZE A;  4DI6 A;  2E9R X;  4IRC A;  1G7C B;  2KDO A;  3FC9 A;  3UO0 A;  3VAL A;  3T1H F;  2DIT A;  2OSQ A;  1QM9 A;  1W7W A;  3BSO A;  4WKY A;  2B56 A;  5EDW A;  2LA4 A;  4DN9 A;  3B54 A;  3QWP A;  5IS2 A;  2Y9H A;  2HHT A;  2CQ1 A;  1YG0 A;  2GV1 A;  3N5F A;  3U27 A;  1R31 A;  3OL6 A;  2B4P A;  1EIY B;  2QE5 A;  2NCK L;  2P9E A;  3I31 A;  1JLB A;  2UUW A;  1U2C A;  3BRE A;  3HLU A;  4OYI A;  2FPH X;  3QMQ A;  3EXC X;  1R0C B;  3W2W A;  2W2Q P;  3ZNJ 1;  2CJQ A;  2CQ3 A;  2EI5 A;  3M8P B;  2I6W A;  1N32 F;  3CC7 S;  4P72 A;  1KHV A;  3M4X A;  1B0P A;  3OFE A;  2WOM B;  2VAS A;  1UP1 A;  2AJ0 A;  2M3D A;  3ZZU A;  2YX4 A;  4MIA A;  4DEZ A;  1T05 B;  3NS7 B;  4NAS A;  5DJB A;  1J5O A;  4W90 B;  1KEK A;  1U4B A;  2DNM A;  1UZH A;  1YRT A;  4OFZ A;  1IBK F;  3G8Q A;  5KFZ A;  1FE4 A;  1FKO A;  4PAA A;  4NA2 A;  1WEY A;  4OYW A;  2YXL A;  3C6T A;  5F9L A;  3RRK A;  2VPZ B;  1R8C A;  1S9E A;  4B3R J;  2YTC A;  4C8Z A;  4Q8E A;  2ZM6 J;  4WFZ A;  2FJX A;  1X0F A;  2AJQ A;  1PBU A;  3DKD A;  2ILZ A;  2BW7 A;  4LIR A;  4C3L A;  3ZC4 A;  2RS8 A;  4CH0 S;  3JSM A;  2UUC F;  2R7X A;  2R9L A;  2HYI B;  2BAN A;  2MMY A;  2IA0 A;  2C2D A;  1NJX A;  3PO4 A;  2BJD A;  2A0F B;  3VVU A;  2HIQ A;  2YKQ A;  2QYC A;  4P73 A;  3H5S A;  4LBH A;  5B0A A;  4B3S F;  3OVB A;  4WZQ A;  4WZM A;  4LBP A;  1NDC A;  3HKZ D;  4USU A;  4DQP A;  2HLT A;  2QJ3 A;  3TAM B;  3MR5 A;  6AT1 B;  3CW2 C;  4A8X A;  3I5A A;  2QLX A;  2V63 A;  4JI0 J;  4KAI A;  4NMX A;  3UE2 A;  2UXC J;  4A8S A;  4DHV A;  3D28 A;  2ASL A;  1TFW A;  3TWZ A;  3BSN A;  1JLC B;  1FWK A;  4RW9 A;  1L3K A;  3BH7 B;  4X66 F;  4M5G A;  2C3O A;  2MZS A;  3RTV A;  2KKH A;  2ZHO A;  2CFX A;  3DI6 A;  3FBE A;  4EBC A;  3IRW P;  3D0H E;  5ETV A;  4FPI A;  3EM1 A;  3HHL C;  1ZYQ A;  2EWH A;  4JP8 A;  2RKI B;  4PR6 A;  2B51 A;  4F4W A;  1ZPV A;  2E1M C;  3OV7 A;  4QU6 A;  3ELH A;  4X62 F;  3QRR A;  2LEB A;  4LR9 A;  2PMW A;  3C15 A;  1T9X A;  3PFE A;  4NLO A;  3UN5 A;  4F0M A;  1ZBT A;  4JV5 J;  1R8P A;  1RTI B;  3R5B A;  2J9D E;  4C97 A;  3MAQ A;  3T3F A;  2PII A;  2CQG A;  1R0B G;  2J8A A;  1T9W A;  2V68 A;  3M32 B;  4WP8 A;  2UXB F;  4DU8 A;  2M7S A;  4KIA A;  4DSE A;  1YLX A;  4IYQ A;  4AYB D;  2APO A;  4DL5 A;  3AQP A;  3D6F B;  3IN5 A;  1T7P A;  3WX8 A;  3OL9 A;  3IS9 B;  3OT9 A;  1ELO A;  2OLW A;  1JLG B;  2OPP A;  5DDP C;  2CZ4 A;  2OMO A;  4CM0 A;  3MED A;  3CPW R;  5HP1 A;  4DR6 F;  2CPZ A;  4KPC A;  2J7U A;  2PE8 A;  3QO9 A;  3S01 A;  5KFS A;  4K4Y A;  1VC5 A;  4PPD A;  2MDA A;  3UQS A;  3CD5 A;  3HI9 A;  4PG7 A;  4I7F B;  1KVI A;  3PRB A;  1Y5L B;  4G6V B;  4LF1 A;  3ZZZ A;  1S1T B;  2MGZ A;  4DF8 A;  3R97 A;  1QSY A;  4DR5 J;  4YDX A;  4G3I A;  1VBK A;  1HBO B;  2RJZ A;  1HWJ A;  2XMM A;  2RE1 A;  3PEH A;  4LSN B;  2IYG A;  3ZO7 A;  1R3N A;  2JEF A;  1HW8 A;  3DM2 B;  4H54 A;  3JTO A;  3HT0 A;  3OTB A;  4NCG B;  5HI7 A;  2NPF A;  1A6L A;  4JI3 F;  2ZNZ A;  2KM8 B;  1HL6 A;  1ITP A;  1RA6 A;  1UMJ A;  2ZHA A;  3TZZ A;  4G1I A;  1RHM B;  3PCO B;  2HBY B;  3NCR A;  3MMA A;  4UW2 A;  1U02 A;  2C2N A;  5DDQ C;  4X65 F;  4DQQ A;  1RWX B;  4X4N A;  3M7V A;  1HD1 A;  2YQ0 A;  3DOK B;  2F1F A;  3KHR A;  4LFB F;  4PWD A;  1DZ5 A;  4CLF A;  3ENA A;  2CPE A;  1EHW A;  1HHQ A;  2CPX A;  2YKA A;  2DNQ A;  4LSL A;  4MK9 A;  3VR1 A;  2DB1 A;  1EZZ B;  3PJW A;  3F0N A;  4G1P A;  1YI2 S;  2DR5 A;  2LCW A;  2ZD1 A;  4AT1 B;  4PRF A;  3ILL A;  1X4B A;  1D0E A;  1IQT A;  4CNZ A;  4DV5 F;  3TAQ A;  1REV A;  4IUF A;  2Q43 A;  3NXZ A;  2Z56 B;  2NYH A;  1IKW A;  4ZPA A;  4FN5 A;  2FVQ A;  2Q66 A;  1IM6 A;  1EET B;  1EJ7 L;  3VVT A;  4Q5V A;  1T9Y A;  3HFV A;  4F3M A;  1C0U A;  4DL4 A;  2C42 A;  3AQO A;  4OJG A;  5E3R A;  1SJ4 P;  4RBT A;  2WVD A;  3HF5 A;  2RKI A;  3NLC A;  3QT5 A;  5MAO A;  4QIW D;  3KJQ B;  2CVE A;  2IBO A;  5DDO C;  3JSM B;  4ZVO B;  3FKB A;  2XNQ A;  2DR7 A;  4DQI A;  4K4S A;  4B9N A;  3CD0 A;  1FI4 A;  2PEH A;  1VK3 A;  1FO1 A;  2CJY B;  2YBV A;  3LA0 A;  4IO9 Q;  5AJ3 F;  4DR1 F;  4ED0 A;  2EBE A;  2RT3 A;  1H7W A;  3W2V A;  2HHH J;  5IT4 A;  2OPR A;  4X4O A;  2VDH A;  3ENV A;  5LOQ A;  4YP3 A;  3KFW X;  1YRU A;  2AEM A;  1FEH A;  2DK2 A;  1HMV A;  2Q79 A;  4C3K A;  4DS5 A;  2GGP A;  5KFJ A;  3AHP A;  1DQA A;  4KGX B;  1SBR A;  4I0W A;  4MAK A;  3KK3 A;  2V8P A;  4WK1 A;  4LF5 F;  5A8W A;  1S9G A;  1XN9 A;  5DG8 A;  1RKJ A;  2NXC A;  4CLU A;  4NLV A;  2MXY A;  1TMM A;  3FFI B;  4LF4 J;  3OLB A;  3VAH A;  4W92 B;  3QFH A;  4RPF A;  3L9Z A;  5CZX A;  1IUJ A;  1AFI A;  5D3G B;  4CO5 A;  3IR5 B;  1HAR A;  5AE3 A;  5KFA A;  4HL9 A;  4C3M A;  2KT3 A;  4GC6 A;  3JYT A;  5DM7 Q;  2G1H A;  5LMN J;  1C1C A;  4C0B A;  5C24 B;  3AJD A;  4KT0 C;  2R8I A;  1RQ0 A;  2V4J B;  3ONQ A;  3R9L A;  4Y3C A;  1HQ2 A;  1JWW A;  2MQL A;  4ED8 A;  2OFH X;  3BYR A;  4P2F A;  3AB2 B;  2F4F A;  2X51 A;  2W1B A;  1RWK B;  2MZT A;  3ET6 B;  3MM8 B;  1WEZ A;  2HND B;  2C22 A;  4OHY A;  3BF4 A;  3MR7 A;  3SIP B;  3OTO F;  3I5C A;  2HWI A;  5CH7 B;  1U48 A;  3SQG A;  3NCP A;  2HQD A;  1DJ0 A;  2HHP A;  3FRZ A;  3H2U B;  3BQ1 A;  1O0P A;  3CDE A;  3GU0 A;  5IM0 A;  3ITH A;  2VA3 A;  2C3M A;  1Q82 T;  2Y1L B;  2UUA J;  1UW4 A;  2RNE A;  1Q5Y A;  2MY8 A;  2L3M A;  4AXI A;  1OO0 B;  4F4X A;  2ADC A;  2YNF B;  1GK8 A;  5ETK A;  1LKZ A;  4HR2 A;  5DGA A;  3IBC B;  3EGW B;  4GMK A;  1FCA A;  1TUW A;  1RWN B;  3H2L A;  2B9X A;  3RBD A;  1VBY A;  4ED5 A;  2OEJ A;  3LGM A;  1UZD A;  2RIJ A;  4F4Z A;  4PUO B;  4C8Y A;  3AJ1 A;  1MLA A;  3H59 A;  4CZC A;  2QYG A;  2U1A A;  4C98 A;  2XY5 A;  1NKE A;  1M0S A;  1I94 J;  3UR0 A;  2VJV A;  1N54 B;  3NEK A;  4Y2C A;  2I8E A;  4RW6 B;  2B43 A;  4U7U D;  4ECY A;  1FTR A;  1S6U A;  1SCJ B;  2UV8 G;  4NE9 C;  2PI5 A;  1XNR F;  1HNW J;  1S1X B;  2IRU A;  3V4M A;  2XMU A;  2FJD B;  4PXB A;  4DL3 A;  1RAO A;  2PSZ A;  2YKN A;  2GQC A;  1T9V A;  5F41 A;  4F8R A;  1V6H A;  2YNH A;  4HH0 A;  7FDR A;  4C7Q A;  1B7F A;  4PXC A;  2NXU A;  4D3G A;  2FJB B;  4NEY A;  3IXQ A;  4OYP A;  1U1O A;  2GS8 A;  4F25 A;  1RU2 A;  3L4B C;  4Q45 A;  1HNX F;  2LU2 A;  3BBB A;  4KKO A;  1WKJ A;  2RUS A;  4UY8 T;  1FHT A;  2PFD A;  3THV A;  4WWS A;  4CDI A;  1BQM A;  3H2V E;  2BAB A;  1RTJ B;  4L76 A;  4RW4 A;  2V2V A;  2J9E A;  3FQK A;  3H7H B;  4MKB A;  2DXE A;  1V3R A;  3LP1 A;  3QIP B;  3ISZ A;  5HJX A;  3BGO P;  1S1W A;  3O6Q A;  3GFH A;  3JSY A;  4WU3 A;  2QA2 A;  3UVJ B;  3F73 A;  4J9L A;  3NS6 A;  1UVN A;  3KTQ A;  3CB4 A;  3KLF A;  1XR6 A;  4ELT A;  2AEJ A;  3N28 A;  4Y65 A;  3GII A;  3GV8 B;  2NZC A;  2OH2 A;  1X0P A;  3CMQ A;  5G0R B;  4A8W A;  4FYW B;  3VGT A;  1QD1 A;  4KR0 B;  4ZVG A;  3RU0 A;  4BC7 A;  5C42 A;  1NJZ A;  3JSB A;  4KBI A;  1CJT A;  1LEO A;  2W8L A;  2DRB A;  1VI7 A;  2FYX A;  3F41 A;  3KK2 B;  3I0S B;  2DR9 A;  1K73 T;  1U1M A;  4K7Q A;  1VQ6 S;  1T11 A;  2KVQ E;  3EZO A;  2HHW A;  3TQ1 A;  1WKK A;  3D66 A;  2FGO A;  5GAH U;  2HS4 A;  3FSY A;  4CLW A;  3D6M B;  3HSJ A;  2HFV A;  4PWW A;  1RAB B;  3CDU A;  4KC5 A;  5HP1 B;  1ZZF A;  1S10 A;  5MLC V;  2XCP A;  2V34 A;  4EBD A;  1ZAW A;  5E3Q A;  4JI1 J;  1X4G A;  1EQ0 A;  2FQQ B;  1RP5 A;  4K4W A;  2A1B A;  2DGV A;  1REG X;  3MM9 A;  5CCM A;  4CTA B;  1N4L A;  3PXG a;  3UD4 P;  2F4V J;  1YZ6 A;  2AJ2 A;  2EBG A;  4M5M A;  4NCB A;  3H5Y A;  3HP6 A;  3M30 B;  1P9Q C;  4QIV A;  3V5R A;  2OPQ A;  2MKI A;  1MRO A;  2H48 B;  2GVZ B;  3HCX A;  3TZY A;  2P5V A;  2FD2 A;  3L3C A;  1A0O B;  2VKR A;  2WVB A;  3HHL A;  4ZVU B;  2E5L J;  2R2R A;  4ECT A;  4LRC A;  4DV2 J;  4EBE A;  3PDN A;  4NLU A;  5C24 A;  4TQS A;  2R8H A;  4FBT A;  3CUL A;  2XMJ A;  4V19 J;  2J6U A;  2V50 A;  2DNK A;  2ZWO A;  1P27 B;  1FVS A;  4KV8 B;  3M2V B;  4N5S A;  3SCJ E;  1S0V A;  2JVR A;  2JEI A;  4H4O B;  2DT9 A;  2HVI A;  2PMZ D;  2JC1 A;  1Q78 A;  4QW9 A;  3CIM A;  2H5I B;  3W61 A;  4XO0 A;  4J9K A;  3GCX P;  4OX7 A;  4K2J A;  2IYI A;  3OD2 A;  4Y2A A;  3TEH B;  4X84 A;  4EFA C;  5AJ3 J;  3HHE A;  1X9W A;  1PO6 A;  1RT7 A;  2DJW A;  2X3G A;  4TNO A;  4Q8F A;  4K5R A;  3AAW B;  3D6H B;  3DLE B;  4G1Q B;  4M8L A;  5KFO A;  2MKH A;  2W4D A;  4LVN P;  5CD4 A;  1OY6 A;  2ZE2 B;  5KG1 A;  4CNY A;  2KT5 A;  3MAA B;  3TP2 A;  2AYB A;  2UXD J;  3G2X A;  3LP1 B;  1F5A A;  1ZM4 A;  2LDY A;  4RUH A;  3T1H J;  2HHV A;  2D74 B;  3BSC A;  2BW2 A;  5HAT A;  3W65 A;  5F8J A;  3M1V B;  2UVU A;  1H7X A;  2XWY A;  4HTJ A;  4ECQ A;  5H9F K;  5JVG Q;  4XDD A;  4F4K A;  2RUG A;  1VQL S;  4TYA A;  4DV5 J;  1BQX A;  1OYE A;  3OR2 A;  2W9C B;  5DLF A;  2CPH A;  2V69 A;  3U1L A;  4CP5 A;  4ZP7 A;  4ZVS B;  2GZO A;  5DDR C;  3KK3 B;  5IM0 B;  3C6U B;  3M8R A;  2GJF A;  3PO5 A;  2ZVI A;  2Y1I A;  1HW9 A;  3SXL A;  5J2N B;  3QIP A;  2VQF F;  4YS2 A;  4FF4 A;  1JXE A;  3FSI A;  4YEA A;  1QY7 A;  3SI8 A;  5LJ5 Y;  3AH6 A;  1NPP A;  1TVR A;  4KGV B;  3PYG A;  4LSL B;  5KFU A;  4I7F A;  4NYP A;  4DBQ A;  4LQ3 A;  3HHN B;  5IT9 U;  1IWA A;  4RR5 A;  1OSC A;  1VRQ C;  4A8Y A;  3MM5 B;  2RVJ A;  4LIW A;  2GHP A;  3KJN B;  3QO9 B;  1M5K C;  3KJF B;  2H5E A;  1FKO B;  1GTE A;  4M1K A;  2BE7 D;  2CPI A;  3R2C J;  5D77 A;  3G96 A;  5L1L A;  1OJ4 A;  2HQI A;  3FZ2 A;  3DMJ B;  4MKY A;  3SFG A;  3U1N A;  4ERD A;  5KT7 A;  1B99 A;  4DS4 A;  4JV2 A;  3BR9 A;  2X3D A;  3HFZ B;  4F26 A;  4ES3 A;  2GHW A;  2FZG B;  1S48 A;  2HFU A;  3M32 A;  1NND A;  3QGP A;  2B8P A;  3RZA A;  4F3O A;  4NLW A;  4BDP A;  2EFN A;  3KHG A;  1RBA A;  1EX8 A;  1KR4 A;  4O3P A;  1ZET A;  4IR9 A;  3H5X A;  1RTI A;  3KLI B;  3NGT A;  4YDD B;  4MFB A;  3T5L A;  1F2G A;  3PEJ A;  1UEU A;  2F8M A;  1KVK A;  4ALZ A;  4R5P B;  1NCL A;  4YR0 A;  2R8J A;  1NJW A;  3A1Y G;  4K50 A;  1OPI A;  4JI2 J;  1RT5 A;  4NLG A;  2ZC4 A;  3M8W A;  4MJK A;  1BQM B;  3JQJ A;  1SIW B;  4OZ2 A;  1KQG B;  2DO4 A;  5K8P A;  1P1L A;  1XEZ A;  2UP1 A;  2IRY A;  3DGP A;  4HDH A;  3W5Z A;  1SL2 A;  5K8O A;  4WF9 Q;  2HSE B;  1QSS A;  2BJE A;  1HNV B;  1S1V A;  4MTP A;  3THP A;  4ID8 A;  1WHX A;  3EGV A;  2EKN A;  4OZN A;  1TTH B;  5IFM A;  4QR1 A;  2E9T A;  2I5J B;  5SZT A;  5AXN A;  4U7U K;  2V8V A;  1KP6 A;  4DG1 A;  2G13 A;  2NXJ A;  2C3P A;  4PCQ A;  1KLM B;  1N5S A;  4I2P A;  2AJ1 A;  5HRO B;  2FHM A;  5T41 A;  1S79 A;  3HVW A;  3K8W A;  3N79 A;  5KFD A;  4L75 A;  3PM9 A;  3LAN A;  3K57 A;  4IH6 A;  4ECV A;  1S0M A;  2VA2 A;  3UNY A;  2W9C A;  3G6V A;  4OL8 A;  1RAC B;  3DN9 A;  1DQ9 A;  4KV8 A;  1HMV B;  4FF2 A;  2DRD A;  2MKJ A;  4JI7 F;  1SUQ B;  2ZZN A;  2R8K A;  1JLG A;  5GAH I;  3GWC A;  3EYZ A;  5DM6 Q;  5G4D A;  1JLC A;  3SQO P;  5H9E K;  3R7B B;  1QLN A;  2ACM A;  1U1R A;  3CED A;  3DCA A;  4CRJ A;  3NGK A;  2ZE2 A;  2WBR A;  3MM7 A;  3DOM B;  2J7K A;  3FNN A;  1WDT A;  2QV6 A;  5KFI A;  4HYK A;  1HI8 A;  1T9U A;  2IM1 A;  3V6J A;  3DFE A;  2FLP A;  5LMU F;  4E0D A;  2B9Y A;  1CEZ A;  4Q44 A;  2ROG A;  3OSN A;  4WJB A;  3WQP A;  2P9G A;  3I4H X;  3ZTS A;  4QWE A;  2KM8 C;  4ER8 A;  1U1P A;  1FWL A;  1HPZ B;  3S1T A;  3M6W A;  4B08 A;  3CO0 P;  2OUG A;  4DV0 F;  2E1A A;  4Y34 A;  5J1N A;  3TW0 A;  5C2C A;  3R5J B;  2HQG A;  1PIL A;  1IBC B;  4HHJ A;  4IFV A;  5GME A;  1IBK J;  3CJ0 A;  1B7Y B;  1UCN A;  1Z1Z A;  2XI3 A;  3OR2 B;  5H9E J;  4RBV A;  5E3C A;  3JXO A;  4J9Q A;  4JOU A;  1YZ7 A;  4I2Q A;  2E7V A;  3LP0 A;  3WDO A;  2FY1 A;  5M2P A;  2VOO A;  2OPP B;  2Z8Q A;  1LK7 A;  3KG4 A;  4CO1 A;  5EGY A;  2YNG A;  3L95 X;  3SSS A;  3IRX B;  2DTJ A;  3TAR A;  3I9Z A;  3M6V A;  1DTQ B;  1VCT A;  2ZIT A;  1CLF A;  2HFN A;  5HL7 Q;  3VAM A;  3SZ2 A;  3H4D A;  5DG7 A;  5KFL A;  5HAN A;  1J5E F;  1MN7 A;  2AYM A;  1JLQ A;  3AFG A;  5D15 A;  3ZZ0 A;  3M30 A;  2NYI A;  4USJ C;  4FVM A;  1XMO F;  1Q4R A;  3M6X A;  2BE9 B;  4OJH A;  5LM7 E;  4M5L A;  3LF0 A;  3TX8 A;  4KE5 A;  2J0X A;  1Z4U A;  2P6T A;  4ECZ A;  4FP9 A;  4UZC A;  5E3P A;  2R7S A;  1HBN B;  1SVD A;  2D69 A;  2CWX A;  2M9K A;  5AXM A;  1BXN A;  1S1V B;  2GMH A;  5E41 A;  5ITH A;  5T14 A;  4DPO A;  4BLG A;  1DFD A;  1JXV A;  1QSL A;  4WFY A;  2ALZ A;  1RWW B;  2AIR B;  3ENW A;  3T1A A;  4QWC A;  1CUL A;  3V6H A;  3OL7 A;  4DR3 F;  3QNW B;  1DTT A;  3DLL Q;  3BGU A;  3B6B A;  4NZ6 A;  3TX0 A;  3OSP A;  2X1F A;  3M2U A;  1VIO A;  3MEG B;  2UU9 J;  5T7L A;  2ZHB A;  2Z57 B;  1JKH B;  2A10 A;  2NUU G;  5J2M B;  3DYA B;  3B82 A;  1I51 B;  3CMA S;  1R27 B;  2Z58 B;  2CQC A;  2HVD A;  4ECS A;  3W3S A;  4TVA B;  2R7T A;  3TAM A;  2V2K A;  2EK1 A;  2PD1 A;  2KHC A;  4OI4 A;  3N6L A;  3MD1 A;  1WC3 A;  2CQ4 A;  4RU2 A;  1X4F A;  2MQN A;  1GX6 A;  1OSD A;  2F63 A;  3OXG A;  4S0M A;  3CCE S;  2B6A A;  3UNG C;  2KH9 A;  4PWU A;  2N82 B;  4GKK J;  5LXR A;  2E5I A;  3IWX A;  3Q2T C;  3NNC A;  3BH6 B;  1XNR J;  5EHH A;  2ASY A;  2DIS A;  2EEY A;  1VHI A;  4CI0 B;  4DF4 A;  2NXN A;  3RB0 A;  2XNR A;  3R5G A;  5C5J A;  3DXS X;  1U2R A;  2GIF A;  4ZP9 A;  5A8R A;  2BUN A;  5K14 B;  3U02 A;  5GMK a;  2E1C A;  2OI2 A;  2XTJ P;  1X7V A;  2J6S A;  4P52 A;  1Y5I B;  3N6N A;  1JJ2 R;  2YKN B;  1QAX A;  3RGI A;  4MK8 A;  5HBM A;  4MYU A;  1TL7 B;  3MPY A;  1SJ3 P;  2K7J A;  3GPA A;  1FRM A;  3CNQ P;  5HLF A;  1TK5 A;  3VGU A;  1G4C A;  3GP9 A;  4JI4 F;  2DNP A;  3AXM A;  2EFP A;  3H90 A;  1N52 B;  2CQI A;  4MMO A;  3SCL E;  4CLZ A;  1GEH A;  4Y28 C;  1RT6 B;  3WIU A;  4ES1 A;  2BEF A;  8ATC B;  2LFV A;  4GO7 X;  3GIM A;  3G4S S;  4OHZ A;  4FS2 A;  4P2S A;  3NGR A;  3THT A;  4RJV A;  3ILI A;  1RJJ A;  1YKW A;  1F9H A;  2QLW A;  4RW9 B;  2BJ9 A;  5BYS A;  1N34 F;  3TQE A;  2YNF A;  3J7Y U;  3UR3 C;  2YWE A;  3UWT A;  3C16 B;  3J81 U;  4DZ6 A;  2XY6 A;  3ZTR A;  2FTR A;  2GC8 A;  4X4T A;  1N48 A;  1WC4 A;  2HUR A;  2G2O A;  2O3D A;  3N9U C;  2HNY B;  1SH2 A;  2N3L A;  1MNE A;  1WSR A;  2M2B A;  3L7O A;  2PC6 A;  3JS9 A;  3W7B A;  3PFO A;  2AKW B;  5IOL A;  5C42 B;  5CA5 A;  3MAH A;  1S6O A;  3O5T B;  3C15 B;  3AOD A;  4N8O A;  1S4F A;  3K5L A;  3T5H A;  4USI A;  1FJ7 A;  4DUZ J;  1DQ8 A;  4Q2L A;  2ZH9 A;  2HFZ A;  4H4M B;  2CPY A;  1UFK A;  5IWA F;  3WIV A;  1C0T B;  4M5D A;  1VYA A;  2E5J A;  3W2V B;  1YBA A;  3D67 A;  2KVI A;  5B0C A;  2LEC A;  4JI8 F;  1RA7 A;  1GXL A;  1SC1 B;  2DGO A;  1X60 A;  3CWJ A;  5IT0 A;  1XMQ F;  2L41 A;  4DV3 J;  3VAG A;  1UVJ A;  3BO4 A;  3G8T A;  5KFP A;  3MTJ A;  2MLY A;  4B9T A;  2C3Y A;  1LWC B;  4FYD A;  2GVD B;  1FRL A;  2NZ4 A;  3I0R B;  4NA3 A;  2DGQ A;  5EWF A;  1RT2 A;  4FVC A;  2HGL A;  4WFB Q;  2BKP A;  1R43 A;  1X5T A;  3VCD A;  4ECW A;  4N47 A;  1VOM A;  1N36 F;  4TXS A;  1RAG B;  3NBP B;  1VQ7 S;  1XNQ J;  3G9C A;  5F3T A;  5BR8 F;  4EYI B;  2RRA A;  2HRY A;  2LLZ A;  3C66 A;  2MST A;  3D3C J;  2HWH A;  2FZC B;  4QR0 A;  3EUN A;  2KT2 A;  5I42 B;  2D3O R;  4ZMM A;  3NAI A;  2J0S D;  2QMW A;  3MEG A;  4B9U A;  2XYG B;  3L7P A;  1H72 C;  2PGC A;  4H4O A;  5I3P A;  5ETR A;  3QGH A;  3PIO Q;  1U47 A;  3BV8 A;  4OYX A;  1Q5V A;  2WTF A;  1KLN A;  4ED2 A;  4L74 A;  1RTD A;  2FLO A;  3SYZ A;  4IRK A;  2VG6 A;  3R5C A;  1D09 B;  1KVJ A;  5D8H B;  2C1E B;  3A8E A;  4FDF A;  3B8H A;  4ZN1 A;  2M0G B;  3KUG A;  2LVW A;  5SUH A;  4L3K A;  4TY8 A;  4R5P A;  4NRT A;  2ZOM A;  4U95 A;  2CZ9 A;  4LQ9 A;  2KG0 A;  3NOG A;  1PYT A;  2AX1 A;  3CCL S;  1LQ9 A;  1RAJ A;  2R2T A;  3EWG A;  2FVS A;  4RL1 A;  3TNV A;  1XMQ J;  1NRK A;  1N0V C;  4DR2 F;  2M8H A;  1VJQ A;  2BXJ A;  4QYR A;  1N8R T;  4ED7 A;  2MSS A;  3OFG A;  4PZV A;  4YY3 J;  3L09 A;  3CC2 S;  4RNH A;  4DR7 F;  4NLQ A;  4DV7 J;  2V9W A;  3QAT A;  2FJE B;  4KH0 B;  2P2C B;  3OR1 B;  4O0N A;  3UI3 A;  5L9X A;  3C19 A;  1R89 A;  3M9O B;  1UVI A;  2OKQ A;  3M2V A;  3DLG B;  3KG0 A;  4LF4 F;  1RGV A;  5ETN A;  3MMB B;  4WIQ A;  3JYT B;  1QUP A;  2HG4 A;  3KKF A;  5LMU J;  1S1U A;  4QZV B;  1FKA F;  1HWU A;  2DHS A;  3FCV A;  1RWU A;  5CYQ B;  2AEF A;  1OYD A;  3Q8P B;  4OI6 A;  1S72 S;  2BDP A;  1KNZ A;  5J2N A;  3F44 A;  3ADA C;  2COL A;  4USK A;  4OYO A;  1FJE B;  5IC4 B;  2HZA A;  1K44 A;  3IMQ J;  4QOT A;  2XY7 A;  1IQZ A;  4ZK7 M;  2DH9 A;  3MHY A;  2HND A;  5D0H A;  5HO4 A;  5ETL A;  2GVZ A;  1MRO B;  3CCT A;  3MI7 X;  2UXC F;  3R5D A;  3ZNU A;  2HNY A;  3AOB A;  4QR2 A;  4B02 A;  3BDP A;  2K3K A;  3P5T L;  2OTJ S;  5IWA J;  2HIY A;  4C8M A;  2J76 E;  3MM7 B;  2MQ8 A;  2J6T A;  4ZPD A;  1F3F A;  2IIH A;  4B3O A;  3DNC A;  5B0B A;  3M8Q B;  2ATC B;  2HK2 A;  5A0Y B;  3BBF A;  2L9W A;  1IBM J;  5EUH A;  5HSP A;  1DTT B;  3KWM A;  1XMB A;  1FFW B;  4QIE A;  1S12 A;  3X1L B;  4QCL A;  4F04 B;  2QO3 A;  5FDL B;  4QW8 A;  4O0I A;  4EGL A;  1HPZ A;  2XHW A;  3CCQ S;  1S6Q A;  2ZM6 F;  3C14 A;  3SBM A;  3LGN A;  3MUR P;  3H40 A;  2MJN A;  5HLF B;  1IBM F;  4DSF A;  2BQU A;  3R2D J;  3LPE A;  2JHE A;  7FD1 A;  1F60 B;  2HBZ B;  1V9O A;  1YJ9 S;  2HVH A;  3FJ2 A;  3FGV A;  2CNL B;  5D78 A;  2UUB J;  4W98 A;  4EWT A;  2CJB A;  2XMK A;  2W9B A;  1BWE A;  5KFM A;  1WF1 A;  2JLG A;  4YB1 P;  4F4A A;  1CS4 B;  1I5O B;  3GR1 A;  2OIH A;  4X65 J;  1B70 B;  1HNX J;  2IM2 A;  4QWB A;  1FNO A;  4URS A;  2EFV A;  4DV6 F;  1RT2 B;  4K4U A;  2Y8W A;  3G8S A;  4WII A;  1L3T A;  2JEJ A;  5ETO A;  3A3O B;  4J7C A;  4RUB A;  4RKU C;  2VG5 B;  2VFT A;  4DUY F;  1U09 A;  3D9B A;  4U7C A;  1D9D A;  1DLO A;  2C2O B;  2MKC A;  5RUB A;  2MQQ A;  1S0N A;  5L1I A;  1QDU B;  2OO4 A;  2WON A;  1WOO A;  3HHL B;  4F50 A;  1FRX A;  2A18 A;  3KLI A;  1S7I A;  1NUE A;  3E8O A;  2QN6 B;  3IM8 A;  1EP4 B;  4LRA A;  5F9N A;  1K9M T;  2VV5 A;  4CQ1 A;  3CTR A;  1RB0 A;  3AA9 A;  3BKF A;  4USH A;  1TKZ B;  4ZPB A;  5A8K B;  2NR0 A;  2VHG A;  2BAN B;  2ZFH A;  1RHK B;  4UQT A;  2N4D A;  2FB0 A;  1SC6 A;  2DIU A;  3KLE A;  3CCS S;  1NAQ A;  1FNM A;  5H1S V;  1N5Y A;  4NXM F;  5T7L B;  4RNO A;  2DRA A;  2FVC A;  4IOB A;  2LKZ A;  2QX0 A;  3A3N B;  3HVT A;  4R0J A;  2Q6C A;  3DDI A;  3SCK E;  4FYV B;  4ZLN A;  2ZH4 A;  2ERR A;  1U1L A;  1VC6 A;  1S0O A;  1U49 A;  3CME S;  1C4C A;  2YKM B;  1FXD A;  2X7I A;  3IS9 A;  4PXD A;  3FMB A;  2GAH C;  4UQG A;  1ARO P;  1UJ5 A;  2IAJ B;  2OPS A;  3DLH A;  2WCX A;  2NLW A;  1KKH A;  1CJU B;  3SFU A;  2CNK B;  3KK1 B;  3QBC A;  1RHJ B;  2W8K A;  2A3J A;  2Q3P A;  3W9H A;  2XMT A;  1SKR A;  5IXU A;  1ZAX A;  4WE1 A;  1SPB P;  2HZC A;  4RW7 A;  3DLB A;  1S1W B;  1U2F A;  3ZZT A;  1KLM A;  3A12 A;  3QT7 A;  3T1Y F;  4EZ9 A;  2YWK A;  4ZJQ A;  1ZA1 B;  4YR2 A;  4PXE A;  1JLE B;  1FXR A;  2RB7 A;  2B4O A;  3IRX A;  4HHU A;  1RLD A;  1HHT P;  1C1B A;  1NU4 A;  2ZDO A;  3K2Y A;  3Q86 A;  4J91 A;  4MIW A;  5CYQ A;  4CYU B;  3TUZ C;  1ZZN A;  5K20 B;  2DH8 A;  1SC3 B;  3DU5 A;  4Q7A A;  1N36 J;  4EMD A;  4IR1 A;  4F3Q A;  1T8E A;  1EAR A;  4PQU B;  1R6Y A;  3UW1 A;  4Q43 A;  3BDE A;  2XYH B;  3K5M A;  4DR4 F;  1NDK A;  2EFQ A;  2RIL A;  3ETO A;  4DLG A;  2X1G A;  5CZV A;  1DRZ A;  3M8Q A;  2JZ5 A;  4I1T A;  3MWB A;  5B08 A;  4Z7Y A;  3CDW A;  5FII A;  4K4X A;  3WHI A;  3HSG A;  1F2H A;  2HGM A;  3TA1 A;  1FWP A;  4FS1 A;  1S59 A;  2HNZ A;  1WHV A;  2CIM A;  3E51 A;  5HRO A;  2DY1 A;  3UPF A;  4K5S A;  4QYZ K;  2YH0 A;  3TA0 A;  1LW0 A;  2OD6 A;  1NHV A;  3JQM A;  4NRU A;  3MEE A;  4NML A;  1FRH A;  3EDR B;  2YKO A;  4TYB A;  3DGV A;  3M6U A;  4O4G B;  3C2P A;  3MZI A;  3DYA A;  2DD8 S;  5B7W A;  2W7O A;  1H73 A;  3MOZ A;  4HAC B;  3OJS A;  4YN3 B;  2FJV A;  2VG6 B;  2XZT B;  3QYY A;  2MLX A;  5KG3 A;  4RW8 B;  4PQA A;  4FZV A;  4NEZ A;  5GAG I;  2JFD A;  3M2R A;  2DGS A;  3SV3 A;  1S6P A;  3ZTO A;  3T5K A;  2ROE A;  1N32 J;  1LNQ A;  3LOU A;  3T9N A;  4AL5 A;  2BQ3 A;  5I3U A;  1WD6 A;  3CJ5 A;  1VQ4 S;  2O5D A;  1Y7P A;  5HAO A;  1PG5 B;  5KFC A;  3R1L A;  1PYO B;  1BD6 A;  2BRK A;  4JI0 F;  4X4Q A;  5J2P A;  1NK9 A;  3TR5 A;  2YWH A;  1X4E A;  4PYA A;  3G6E S;  1K8A T;  4JI4 J;  2EC0 A;  3CJQ A;  2I0X A;  2HWT A;  1X9S A;  1HIY A;  2PA8 D;  2POK A;  2RRN A;  3QLH B;  3G6X A;  5J2Q B;  1T94 A;  1V5V A;  3KUE A;  1YHQ S;  2OPS B;  1VQO S;  2BAC A;  3RJM B;  1PIE A;  3PRV A;  4DR7 J;  3GMG A;  3EDQ B;  1G3O A;  2ZZM A;  2VH7 A;  2I1R A;  4AL6 A;  3MPU B;  4FXD A;  4EEY A;  2VBZ A;  1WC1 A;  3IG1 A;  4ZIW A;  4TU7 A;  2UUC J;  2W4C A;  2BMB A;  2YWG A;  1HWL A;  3VGV A;  1MSW D;  2RRB A;  5D4O A;  3HVT B;  2FDN A;  1OIA A;  2YX7 A;  3FDS A;  5EX0 A;  3TAP A;  2KZZ A;  1WOS A;  2VC0 A;  1K1Q A;  1TKT B;  2MB0 B;  1C0T A;  1FT8 A;  1TP7 A;  1RWV B;  2E5G A;  2LQ9 A;  1ZM9 A;  2Q1L A;  2R7Q A;  3MCM A;  1ZOT A;  4TLR A;  1JLA B;  3CJS A;  3SQG B;  2I9S A;  2KI2 A;  1CJU A;  1VK8 A;  1ZM3 A;  2ALY B;  4FPR A;  5BYR A;  5DRK A;  3KK1 A;  3DXB A;  4DL6 A;  1WTF A;  1NSK L;  1YJN S;  1FER A;  3RAX A;  5HN0 A;  3PYF A;  3HD2 A;  1X5S A;  3VZH A;  3Q8Y A;  4J9R A;  4RBU A;  2GMJ A;  3MPW A;  2B9W A;  3PHT A;  2EFO A;  4LJM A;  3ILO A;  3HSD A;  3HZG A;  5F3Z A;  3FEX B;  2FGC A;  2LEP A;  4KHP F;  1U0H B;  1HNI B;  4NLX A;  1AUS L;  2DEJ A;  4TU8 A;  2V4R A;  2RH3 A;  3PJX A;  2KZM A;  4LMZ A;  1N5V A;  1K0T A;  3MCO A;  1WWH A;  3J7Y I;  3CUN A;  1U6Z A;  4DFK A;  1VQS A;  1PYS B;  3GON A;  2AYE A;  4I2P B;  4Z7C A;  4AXJ A;  3DRR A;  1OPZ A;  3MEK A;  3MEC B;  4LFA J;  3QT6 A;  2V9K A;  3H20 A;  4IH5 A;  4UOF A;  3H25 A;  4WXO A;  3QT8 A;  2IJR A;  3FSX A;  3PY8 A;  1CJV A;  2CAJ A;  3Q8Q B;  3RYL A;  3TYT A;  3W9J A;  2LQJ A;  1Q95 G;  3KHH A;  2FLL A;  2E9Z A;  2DY9 A;  4RUA A;  2AWZ A;  3OTO J;  2R7V A;  5D3G A;  2BKN A;  1IR0 A;  3EXY A;  2GNK A;  3R6L B;  4ILR A;  2JVO A;  2JEG A;  3EGZ A;  5L1J A;  1TL1 A;  1N56 A;  2RF2 B;  2RQC A;  2CNO B;  2DEI A;  1EP4 A;  3KUH A;  5LSO A;  3I56 S;  4O44 A;  2CJK A;  3TA2 A;  3ETM A;  3GJQ B;  1E6V B;  1H6K X;  3CCM S;  3D3B J;  1R6V A;  3N4W A;  1XTZ A;  3GV5 B;  4K4T A;  1TMJ A;  1JJH A;  1S6P B;  4OV6 A;  5AE2 A;  1PCA A;  2VBY A;  1W2I A;  1O8B A;  1OWX A;  4RW8 A;  5LXY A;  1JB0 C;  1HYS A;  2NRE A;  4CH1 A;  4ED6 A;  2M5Y A;  3Q89 A;  5HQM A;  4CLY A;  1RSC A;  2JNJ A;  4H4K A;  4DPX A;  2W9A A;  5KFF A;  2ADB A;  3RRG A;  3NCQ A;  5KT4 A;  2OSR A;  4KKO B;  3OVS A;  1UEV A;  2OGU A;  2IFX A;  2DNZ A;  5E3A A;  2LDI A;  1HKA A;  4QPT A;  3DRP B;  2H4W B;  5ETP A;  2B6A B;  4EO8 A;  3GIL A;  2JH3 A;  3HFK A;  2W2N P;  3R3T A;  2DR6 A;  4OZ3 A;  4P7T A;  1UA1 A;  1QTN B;  2ZH7 A;  1LWF A;  3F56 A;  4ZVE A;  3KJV A;  4DSL A;  2FZK B;  1UET A;  3UVJ A;  2W25 A;  2PDA A;  5F0W A;  4YY3 F;  2ZH3 A;  1HNI A;  1QAY A;  4U8Y A;  2CXE A;  2C3U A;  1RT4 A;  2W2M P;  2EPI A;  3K17 A;  4LVO P;  2IHR 1;  3DLG A;  4UT4 A;  1RBL A;  2IDE A;  5KFN A;  4K0K J;  4JYA J;  4JI5 J;  2VF3 A;  2VFS A;  2WBM A;  6FDR A;  3I0S A;  1Y3J A;  3QZ7 A;  2D9P A;  2QMU B;  2F5G A;  2JL9 A;  4KB7 A;  5HVH A;  4AL7 A;  2EG1 A;  3PRD A;  1VQN S;  2YKP A;  4DUT A;  4J9M A;  3FCH A;  4YB7 A;  2BKO A;  1N5Y B;  1QAJ A;  5B09 A;  1JLF A;  4PEO A;  3OL8 A;  3PR4 A;  4ANC A;  2VL1 A;  1L3S A;  1KS2 A;  2F3J A;  3I9V 9;  4F7V A;  2DPJ A;  1GX5 A;  1UL3 A;  5LJ3 Y;  2HS3 A;  3PKM A;  1T02 A;  4M95 A;  2MGZ B;  3H5U A;  2FHJ A;  3RR8 A;  2F8H A;  3OFH A;  5K14 A;  1WF2 A;  1XR7 A;  2HVZ A;  3AJ2 A;  3D0I E;  3CJ8 A;  4GVB A;  4AQY F;  1B3T A;  1HBU A;  2QSW A;  4UUX A;  2ZJR Q;  1WI8 A;  4DOZ A;  3HDS A;  4ZHR A;  2HBQ B;  2QIF A;  3KK2 A;  4Y2K A;  2CQD A;  5K8M A;  1HHS A;  2CJX B;  1RCX B;  2ZJP Q;  1XJW B;  2CQP A;  1RWO B;  4KO0 B;  4EYH B;  1F3V A;  2IM0 A;  1BQN B;  5H9F J;  1JLA A;  2BM0 A;  3RB6 A;  4USV A;  5HVG A;  1Q8B A;  1WC0 A;  2YWW A;  4DQR A;  1RAD B;  4C6A A;  1U8W A;  2AGO A;  2XGQ A;  3LTO A;  2C2E A;  5J2P B;  2J9C A;  4R8U A;  3VQT A;  3CJ3 A;  1V5I B;  2YWF A;  4LRF A;  2CPF A;  4J9V A;  1FNX H;  4OX8 A;  1TL1 B;  1LWC A;  4OJ3 A;  2ROP A;  1DAR A;  2UUB F;  3A8J A;  3CT9 A;  3TZX A;  3MMC B;  4JV5 F;  2LQB A;  1FFG B;  3TVK A;  3MM5 A;  1UVL A;  1U24 A;  3BZQ A;  4NOH A;  5F8I A;  4U6P A;  4F2S A;  3MAA A;  1D9A A;  1IJE B;  1CSJ A;  4FYX B;  1FD8 A;  4WFX A;  4P7V A;  2ZH5 A;  5KFY A;  2VFV A;  3N01 A;  1S99 A;  4OJ1 A;  5GAD I;  4C0O C;  5HQL A;  3KJV B;  5GAD U;  2DPI A;  2NXE A;  1SQG A;  2QMX A;  3DU6 A;  1FEE A;  2JSX A;  3UCZ P;  2DNY A;  1S9F A;  2WZ1 A;  4LRE A;  7AT1 B;  1TZ0 A;  3DRR B;  4CLP A;  5HMY A;  3Q83 A;  1OMS A;  2KJW A;  4DPW A;  1Q81 T;  1HNZ F;  2G0I A;  1UFL A;  2WAQ D;  3T6J A;  2BOP A;  3Q24 A;  4N7T A;  5F8M A;  3HJF A;  4YFU A;  3OTE A;  3RB3 A;  3BQ2 A;  2HMI B;  1AXQ A;  4CTA A;  5LT5 A;  4JI7 J;  4NI2 A;  1IKV A;  1FES A;  2XHC A;  4TY8 B;  1S4E A;  1UWB B;  2L9D A;  1R8A A;  4CM2 A;  5KFH A;  5KT5 A;  5KT3 A;  1IR1 A;  3QAE A;  1X9M A;  4OZ0 A;  3A13 A;  2GIR A;  2HLU A;  2B5J B;  3K58 A;  4ED4 A;  2DGT A;  2GQ2 A;  4U96 A;  4B9M A;  1KON A;  2ZH6 A;  3EMT A;  2CJA A;  1EKS A;  3MGJ A;  1ZH5 A;  2HHU A;  2DIV A;  2KXF A;  4E98 A;  2VIH A;  2GX8 A;  4KGM A;  3NNA A;  1YRX A;  3QSY B;  1MU2 A;  2DVI A;  1GQE A;  1TU0 B;  5KTQ A;  4B3R F;  1EKR A;  2UVV A;  1D3W A;  4Z2X A;  2OAU A;  4P75 A;  3QRP A;  1RE1 B;  1C2P A;  3DLK A;  2KG1 A;  1KTV A;  5FLX U;  3MFI A;  4LF6 J;  1TKD A;  1KSP A;  2N3O A;  4UOH A;  1AFJ A;  4IOC Q;  2KFN A;  1S7H A;  1ZM2 A;  1UVM A;  2U2F A;  1UW9 A;  2DCU B;  2AT1 B;  1BWV A;  4DXL A;  5KFT A;  1NZA A;  2V8H A;  2H4Y B;  1TKX A;  1M5S A;  2N7Y A;  2M70 A;  4O3N A;  4KQZ A;  1L5U A;  3OUY B;  5JXS A;  3J81 j;  4JI1 F;  3PHE A;  2YNI A;  4RLE A;  4WU2 A;  3R7N B;  3ZZY A;  3MR6 A;  4N41 A;  3PX4 A;  2V8G A;  3W9I A;  3FFI A;  4DR4 J;  4AE5 A;  2E29 A;  4RO0 A;  1EET A;  1M5O C;  4KY3 A;  3PZP A;  2K1R A;  5A6W A;  3SV4 A;  2G0C A;  2JFK A;  4X4V A;  4BWM A;  2DGX A;  3MM6 A;  1TKZ A;  5A8K A;  3TJ8 A;  4DV4 J;  4LUB A;  1KD1 T;  3FUY A;  3HK2 A;  4DX7 A;  3MOJ B;  4P2X A;  1CPZ A;  3LW5 C;  2JRS A;  1FE0 A;  2G2Z A;  2QRR A;  3BPS P;  5DZ7 A;  2Z2Y B;  5AXK A;  2XWX A;  1GMV A;  4WYW A;  3GYN A;  4DR2 J;  2XS5 A;  3OHB A;  2VG7 B;  4RZR A;  4PQU A;  3MR3 A;  4OYM A;  4IG3 A;  1RT3 A;  4DPT A;  2Z0G A;  2VQF J;  2WK4 A;  3TUI C;  4CYU A;  4C4W A;  1HWK A;  3W62 A;  2VQE F;  1NB2 A;  4Y00 A;  4ITS A;  3GFZ A;  5JVH Q;  3L7U A;  2ACY A;  1FK9 A;  1YJU A;  3GFY A;  4PPZ A;  2FJA B;  1J5O B;  4E8U A;  4NI2 B;  4WXW A;  3P3D A;  5THW A;  1RUS A;  3ISN D;  1CS4 A;  3CD6 S;  1X4D A;  1XQI A;  2WOM A;  3CSK A;  4JYA F;  3BKT A;  3D6T B;  3C8Y A;  3O1L A;  4X4U A;  1CBK A;  2KL8 A;  3QQC D;  4KHR A;  3GJT B;  4ZP6 A;  5KFE A;  2PA3 A;  1RTH B;  2B9E A;  1SV5 A;  3MTK A;  1F1B B;  3BGR A;  2CYY A;  3LAK A;  4LRB A;  4A8O A;  4DG1 B;  4ZCI A;  4U67 Q;  1NJY A;  3SEO A;  1SQF A;  1WG1 A;  1Y0H A;  1N5Q A;  2VBW A;  4AD6 A;  1UJ6 A;  1IJF B;  4CO4 A;  4ZHR B;  3J7Z T;  4OYA A;  1DUR A;  2V4J A;  2FVP A;  5I4M A;  3EJM A;  3D5M A;  3LWL A;  3KOA A;  1GNK A;  2YQ1 A;  4F67 A;  3GIK A;  4IFV B;  4ZLJ A;  3CO9 A;  4HAC A;  4R25 A;  2H65 B;  2HKE A;  1RT1 A;  1X4C A;  1UWB A;  2IRX A;  1SH0 A;  3HHD A;  4FXV A;  1VQP S;  2LXF A;  4JUZ A;  1Q16 B;  3QZ8 A;  4H4K C;  2AF6 A;  1X8D A;  3OTC A;  3MEC A;  4WPA A;  4KTQ A;  2CKW A;  5C7P A;  4C8N A;  5EWE A;  3NGU A;  3M8Y A;  1CJK A;  1WF0 A;  2E5H A;  5KG4 A;  4A8Q A;  4B3T J;  1Y3K A;  1FVQ A;  1H74 A;  1VQ5 S;  3DHX A;  1FFS B;  4M5N A;  2NPI A;  4URG A;  1AZS A;  2EC2 A;  2KFZ A;  4J9N A;  2CG8 A;  3LP2 B;  1KDN A;  1YWX A;  2CPJ A;  2ZD1 B;  1YVF A;  1HNZ J;  2R4F A;  4DSK A;  1CVJ A;  1RAI B;  2WVC A;  5GAE I;  2E5L F;  2OML A;  2DNL A;  1M90 T;  3U7J A;  3V6D B;  4WTO B;  2IC3 B;  2AJ4 A;  2OP5 A;  4MYT A;  2Y1R I;  2QGF B;  4OZJ A;  1CUL B;  3ULH A;  3O2I A;  4XDC A;  4F0K A;  4ZCL A;  2ZUG A;  1RK8 A;  5M2R A;  2XB2 D;  2LXI A;  2DXF A;  3MXH P;  3HPO A;  4DMZ A;  1M1H A;  2H51 B;  3SSQ A;  1E6V A;  3J7Z 5;  2LEA A;  2NSC A;  4DL7 A;  2MZJ A;  4P9S A;  2DNH A;  2V94 A;  2YNH B;  5DGB A;  2UXB J;  1TL7 A;  1FDA A;  2H3E B;  3D0G E;  4IQM A;  4C11 B;  1S6Q B;  4LFB J;  1XK8 A;  3IBF B;  4KRW A;  1JLQ B;  2ZC3 A;  1UA0 A;  4ZPC A;  2OPR B;  4OI1 A;  3WX4 A;  4DJB A;  2QTW A;  1Q86 T;  4PG4 A;  1RYS A;  5IQ6 A;  3BPD A;  2Y8Y A;  2GML A;  3A4T A;  5D6G A;  1OQ3 A;  3QWU A;  4Q2M A;  1T9T A;  4WTY A;  3V6K A;  4A48 A;  4LR8 A;  5M2U A;  2BE2 B;  3PYE A;  1T3N A;  2D3Z A;  1DLO B;  1BE4 A;  2DXD A;  3BS9 A;  1HR0 F;  1I6J A;  2NS1 B;  3W1Y C;  4ZLL A;  3JTP A;  1KFD A;  2VG7 A;  2ZZT A;  4I64 A;  1I94 F;  1SV5 B;  1VMB A;  1ICE B;  2MHE A;  1T3O A;  3BN4 A;  3HHL D;  4OX9 J;  3CJK A;  2NSB A;  4KYZ A;  4B9V A;  4LFC J;  2C2Z B;  5KFB A;  2DO0 A;  2V4Q A;  1GMW A;  3I4P A;  2JC0 A;  4W4M A;  2BJ7 A;  4TKT A;  1HR0 J;  1RAE B;  2V2Z A;  1LK5 A;  1KBR A;  3OXF A;  2MZ1 A;  5U47 A;  1LW2 A;  3CF5 Q;  4DV7 F;  1HI0 P;  1BLU A;  2F8E X;  2FIU A;  2G1D A;  1TL3 A;  3IGN A;  3CCV S;  1FRI A;  2IBK A;  2XMW A;  2QEX S;  3FEY B;  3K5O A;  5B0E A;  4AND A;  5L1K A;  2IJF A;  1YSJ A;  3EGN A;  3E2E A;  3MDF A;  4J9U E;  1V3Z A;  2HFO A;  3G87 A;  3TUP A;  3QPI A;  4ENO A;  4FYY B;  3O3L A;  4ICL B;  3VZI A;  1ROF A;  4I56 A;  5CHC B;  3KLG B;  2B3T B;  1J5E J;  5CXT A;  3CCR S;  1D9F A;  4LF6 F;  2IY5 B;  4UTG A;  2KN4 A;  3I55 S;  1HBN A;  2J5A A;  4K0K F;  5EN1 A;  2MHN A;  4LSZ B;  1XER A;  1RTH A;  3DRY A;  3LP2 A;  3T9Z A;  4DR3 J;  2BQR A;  3DM2 A;  3HM9 A;  1NK0 A;  1MWY A;  2W01 A;  3MM6 B;  2MQP A;  1IKW B; 
#chains in the Genus database with same CATH homology
 1NPK A;  2B8P A;  3ZTP A;  4C6A A;  2ZUA A;  1U8W A;  3NGT A;  3VVT A;  2AZ1 A;  1NCL A;  3FBB A;  4S0M A;  3VGT A;  4UOF A;  1LEO A;  4O0N A;  3BH6 B;  3Q86 A;  4FKX A;  3FKB A;  1WKK A;  3VGS A;  3EJM A;  3FBC A;  2DY9 A;  1F6T A;  2HVE A;  1NDK A;  3EVM A;  3DKD A;  1ZS6 A;  3FCV A;  4EK2 A;  3Q8V A;  3NGS A;  1K44 A;  4F36 A;  3GPA A;  1S59 A;  5C7P A;  3VVU A;  3Q83 A;  3NGU A;  3PJ9 A;  1B4S A;  2B8Q A;  3ETM A;  1NLK L;  1S5Z A;  2VU5 A;  4FKY A;  3VGU A;  1NDC A;  4UOG A;  3GP9 A;  3BBC A;  2BEF A;  1F3F A;  1KDN A;  2BX6 A;  3NGR A;  3EE3 A;  3BBF A;  5CAA A;  3BH7 B;  3Q89 A;  3FBF A;  1HLW A;  4DZ6 A;  3FBE A;  3ZTR A;  3EM1 A;  2HUR A;  3R9L A;  3EMT A;  2DXF A;  4WBF A;  3ZTO A;  3JS9 A;  5IOL A;  3ELH A;  4ANE A;  1NHK L;  3EIC A;  2DYA A;  4W98 A;  3ZTS A;  1BHN A;  1BUX A;  4UOH A;  3EVO A;  4F4A A;  1VYA A;  1HIY A;  3EVW A;  3FCW A;  1NDL A;  1PAE X;  1UCN A;  1PKU A;  2CWK A;  3G2X A;  3PRV A;  4HR2 A;  1WKL A;  3ZTQ A;  3WX8 A;  5CAB A;  1BE4 A;  2DXD A;  2AZ3 A;  4KPC A;  3VGV A;  3Q8U A;  4DUT A;  1NSQ A;  1S57 A;  4CP5 A;  1MN7 A;  1XIQ A;  1NUE A;  4ANC A;  5BXI A;  4DI6 A;  3FC9 A;  1NSK L;  4AND A;  1W7W A;  1JXV A;  3DDI A;  3BBB A;  1NDP A;  1MN9 A;  1WKJ A;  3B54 A;  4ENO A;  3Q8Y A;  3MPD A;  1NSP A;  3B6B A;  2NCK L;  1NB2 A;  3ENA A;  1EHW A;  1HHQ A;  2DXE A;  3L7U A;  1B99 A;  1LWX A;  2HVD A;  1XQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...