1NCLA

Thermal stability of hexameric and tetrameric nucleoside, diphosphate kinases
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAGGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Thermal stability of hexameric and tetrameric nucleoside diphosphate kinases. Effect of subunit interaction.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nclA00
3EICA 1HIYA 3JS9A 1BUXA 3VVTA 3ELHA 4S0MA 1UCNA 3DDIA 1WKKA 1NDLA 3ETMA 3NGRA 3B54A 3ZTRA 3BBFA 1B4SA 3Q8VA 1K44A 3VGTA 1S59A 1WKJA 1F6TA 2B8QA 3NGTA 3B6BA 2DY9A 3BH7B 4DUTA 5CABA 3EVMA 1NSQA 1NDKA 3VGUA 2DXDA 2AZ1A 3EE3A 4EK2A 2B8PA 1NLKL 3Q86A 2HURA 3PRVA 1W7WA 1NUEA 2CWKA 1HLWA 2HVEA 3ZTQA 2DXFA 1ZS6A 5BXIA 1NSKL 2BX6A 4KPCA 4W98A 1WKLA 1PAEX 1BHNA 3WX8A 3VVUA 3PJ9A 1LEOA 4FKYA 1BE4A 2VU5A 3FBFA 4O0NA 4ANEA 5IOLA 4FKXA 1PKUA 3Q8UA 3BH6B 1NHKL 3FBEA 3NGUA 1XIQA 3MPDA 3DKDA 3GP9A 1LWXA 3FCVA 1VYAA 3ZTPA 3R9LA 4ENOA 2ZUAA 1NPKA 1KDNA 3BBCA 2BEFA 4WBFA 1XQIA 3ZTSA 5C7PA 3FC9A 4UOGA 3VGSA 2NCKL 4CP5A 5CAAA 3L7UA 3FCWA 3EJMA 2AZ3A 1S57A 1NCLA 1JXVA 1MN7A 4DI6A 1MN9A 3FBCA 3ENAA 1HHQA 3GPAA 4F4AA 3BBBA 3FKBA 1EHWA 2DYAA 1NDPA 4ANCA 1NB2A 1S5ZA 3VGVA 1B99A 3Q83A 4C6AA 3EVOA 4F36A 3G2XA 2DXEA 3NGSA 3Q8YA 3EM1A 3FBBA 1F3FA 2HVDA 3Q89A 4ANDA 1U8WA 4DZ6A 1NSPA 4UOFA 4UOHA 3ZTOA 1NDCA 3EMTA 3EVWA 4HR2A
chains in the Genus database with same CATH superfamily
2R2RA 8AT1B 1NDLA 3DI6B 1LK5A 4O23A 3TAPA 1N36F 3LW5C 3GIMA 3RGIA 1UVNA 2WONA 2M2BA 1OPIA 4CI0B 3W2VA 5KFUA 4PQAA 3EGZA 2ZDOA 3OR1A 1WKLA 2R3VA 1N34J 4YR2A 2LKZA 2MY8A 3HJVA 2OH2A 2C3YA 3KK2B 2RS8A 1WI8A 3CJRA 5IV3A 2FHJA 2FJAB 2G4BA 3MURP 2F40A 1S1TA 4HH1A 3POTA 3HKZD 5AE3A 1X5SA 4X64J 2RJZA 2VA2A 2AJQA 1CJTB 3V6JA 4Q43A 3OJSA 4PG7A 3MEEA 1IM6A 2A6MA 3MM6B 2X1BA 4IFYA 4NA1A 5DG9A 3N5BA 4DU8A 2VPYB 1NRKA 1BUXA 2KDOA 2M88A 2RHSB 2N3OA 3QIDA 1OPZA 1BLUA 1ZZNA 1HNXF 2YX1A 2VQEF 3OVSA 1MU2B 3VAHA 2HNDA 1NXIA 3CC7S 4ED1A 2CJAA 2D3UA 3HHKA 5LSLA 2W7AA 4I0WA 4OV6A 4A48A 3DRPA 1JQGA 2JLGA 4AD6A 4ZPWR 2J0WA 2ZKTA 5FIIA 4WP3A 5IM0B 3T1HF 3EYZA 3ZO7A 2OTJS 5KG2A 1XIQA 3FQKA 4JI8F 4ZLPA 1E6YA 1UJ6A 4DV7J 4LSLB 2H48B 4M5DB 4CIOA 3THTA 4J7CA 3PW4A 2Y1LB 3SV3A 4UTGA 3TAMA 1RB0A 2W9BA 2ZH6A 3GIJA 1UJ4A 3IG1A 2DR8A 3N6NA 3J81Y 1KFSA 3VV2B 3RAXA 1L3TA 4RR5A 4YY3F 3IRXA 1PBAA 2VASA 3V4IA 4C6AA 1NBEB 1U02A 1UAWA 2ACYA 3MR5A 1HYSB 1C0UB 4O3RA 3KXDA 1U45A 1U1PA 3BJYA 4PCQA 3AY0A 3NP5A 1R3NA 4TU8A 4F3QA 2CRLA 1VFJA 4X4SA 3G82A 5KFKA 5C5JA 1JNZB 4FVMA 4A47A 4URQU 3GQCA 1N48A 4MK9A 2C2ZB 4O0IA 3MCNA 3T5JA 4B9LA 3GONA 2XZWA 1VLYA 2AEJA 4DUYF 2KYXA 3SSQA 2LDYA 4ECYA 3V81B 2E7WA 5GAEI 1QVGR 3TUPA 1S4FA 2CQHA 4DSIA 4CH1A 4C8ZA 1ZM4A 4IRCA 3RBEA 4YEAA 1S49A 3N9UC 5D77A 1VHFA 3OVAA 4JI5F 2EVZA 4M5NA 2ZZTA 2ATLA 1WC1A 2C2OB 3M32B 2X1GA 2BW2A 4NXNF 4J9LA 4ALZA 3JSMA 3MTJA 3OR2B 2MQMA 1OS5A 4AQYJ 1N5QA 4CNYA 2KTQA 3AH6A 3TVYA 2MXYA 5LMUF 1WF1A 1AT1B 2N7CA 1WWHA 1WHWA 4QYZJ 2CUYA 4MJKA 1SCJB 3NGTA 2CNOB 1JLCA 3DOLB 1N33F 4F0KA 1S9EB 3CDBA 4QZVB 5KG3A 3H0PA 3W5ZA 3W3SA 1S1UB 5KFWA 1JKHB 2N7YA 1ZYQA 4ILLA 1HNVB 2QSWA 3JYTB 4R0JA 5B08A 1VMBA 4CLLA 3I5AA 1RWPB 3W65A 3NAIA 1IKWB 4DV3J 4X4QA 4RW4B 5CZXA 1KFDA 1HWIA 1F2GA 1S10A 3UCUP 1F9EB 3OQ2A 3C8YA 1CS4A 3PTWA 3MMJA 1IM4A 1QAXA 5GMDA 4ZVFA 5LXRA 3RU0A 1DQAA 2FJVA 1X9WA 1S5ZA 2XYGB 1FK9B 4NCGB 3E01B 3MMCB 2UUWA 1V3ZA 4WZQA 1R27B 5BYRA 2V34A 5K14B 1JLGB 2BKPA 1WKKA 2OAUA 2RQ4A 5L1JA 2WVEA 4QYZK 3H2UB 2JFDA 2ZH8A 2QE5A 2C3MA 1KONA 5F8LA 3CJ2A 1XJWB 3MMAA 2YNIB 1D1UA 3MFIA 3MECA 5HBMA 1T9UA 1FEHA 3CJ5A 2CPIA 5KG5A 2HWHA 4ZP6A 5IQQA 5ADZA 3ZZYA 1RT7A 2RB7A 1NM2A 3W8PA 4ENOA 4Z37A 1S6QB 1Y3KA 2P8IA 1VIXA 4G3IA 2E5GA 1SI9A 4RX6A 1WNEA 2K1RB 4OHVA 3K59A 2LEBA 2EFNA 3NY0A 2JFKA 2HHTA 3PW2A 5GMEA 2WVBA 1EP4B 2GQ2A 3BN4A 1IR2A 2OLWA 1X5PA 2MGZA 4K0KJ 1I94J 3L3CA 4NI2B 3SSSA 3F0NA 2HS4A 1SL1A 1NZ8A 3B54A 2YXLA 3BSOA 1ZA1B 1NJIT 1VOMA 5B0EA 4M5LA 2L9DA 1C2PA 1WDDA 5D78A 5JVHQ 4TU7A 2UXBF 4LF1A 4Z7YA 2C3PA 1HQEB 4RU2A 1NSKL 2CAJA 2Z0GA 1H72C 1VIOA 4QWBA 2EG1A 4P73A 1QJHA 4LBPA 2H3EB 1NK6A 1IKVB 2V2ZA 2ZDPA 1REVA 3MM7B 1NHUA 4P7VA 3GMGA 4RNFA 2D3OR 3ZTSA 3LP0A 2J9DE 1Q1KA 2BM0A 4NYOA 2MPUA 4X4OA 3QGIA 3R5CA 3I96A 3T6BA 2RHQB 3LGHA 4CT9A 4HHJA 5HLFA 3MUMP 3T1YF 1HKAA 2GHWA 4F26A 5LMNJ 2AYGA 3T41A 2YKNA 2NS1B 2CQCA 1UW9A 2JDJA 4X4TA 4KAIA 1FXLA 2GX8A 3HDSA 3GJRB 3W62A 1E6VB 4DOZA 3NWRA 3VGTA 5F8HA 2E5JA 4KBIA 1UEUA 4ELTA 2XMUA 5K20B 4DR7J 1UWBA 4E8UA 2GJFA 1VK8A 4CLWA 1X4GA 2ILZA 4KHRA 1T3NA 3LTOA 4A8QA 1TL5A 1NHKL 3KDNA 3W61A 1SUQB 4OZ2A 4JI7F 1JJHA 1EQMA 1X4EA 1UETA 3UDLA 1R8HA 1PYTA 2B4PA 2V9WA 4NLQA 1K1SA 3WDOA 3SMZA 1YBAA 5D0RA 5DDQC 2DHXA 1M1GA 4YP3A 1VBYA 3R2CJ 3GFZA 4I2PA 2W9AA 2H51B 2CQ2A 2C2MB 1L3VA 4ZOSA 1TMJA 2F63A 2NREA 2J9EA 3DMJA 2H1YA 3OLAA 4WK1A 2LQ9A 2XQCA 2MZRA 5HVFA 4DR4J 2OEKA 4YB5A 2NSBA 1S6PB 2VPXB 3PV8A 4JYAJ 1NUEA 1HLWA 2B56A 5EX0A 4KV8A 2HBRB 1FFWB 2CNKB 2MKJA 1FJEB 4RBVA 2Q6BA 3TNVA 2PO4A 4CTAB 2QL9B 5FLXU 2VQFJ 8ATCB 1B3TA 2HQFA 2AMCB 2HFZA 4N47A 3RJMB 3K89A 5LSRA 3RR7A 4FF2A 3FC9A 3TZXA 2Y1IA 3KK1B 2HQGA 1HI0P 1U0HB 4A8FA 3JSRA 4P74A 2BV3A 3EGVA 2XS5A 5D3GB 3QFHA 4YHHF 2QZ8A 5IT0A 2GMJA 1SL0A 2CPXA 4OHXA 3BPDA 1W26A 1TR0A 5B7WA 4C8KA 1SIZA 5I42B 3RTVA 1MW7A 2XWYA 3BKTA 1F5BA 2M52A 1RWWB 1TL3B 2B6AB 2OMOA 3SFGA 3HZGA 4DUZJ 3KJQB 1IBKF 1HBMB 2EI5A 2XLJA 5L39A 3FMBA 3NL0A 3TVKA 2GO9A 3FNNA 2HMIB 1F3VA 4C48A 3EUNA 4GKKJ 4FDFA 2ASLA 3KJVA 4TLQA 4USTA 3R5GA 2HHUA 4DV0J 5A8KA 5GAGU 1JMTA 3DM2B 2M4MA 3DOKA 3FRZA 1JB0C 1HBOA 3R27A 5IV4A 2VG5A 5DM6Q 2YNGA 5EN1A 3CJTA 4I68A 3FZBA 3GPAA 4HTJA 4FPIA 4RWXA 5L9XA 4OX7A 1S1WA 1U1MA 3FRYA 4Y65A 3H5XA 1IXKA 4Y2KA 4K5RA 2UVRA 4QU6A 3M2RA 3W8GA 5ETRA 4ZP9A 1VDHA 2ZZNA 3HULA 5IWAJ 5L1IA 2BJ3A 4IDKA 3IBWA 2WVDA 2BOPA 1AZSA 1TL7A 3ZNUA 1YJRA 3EXYA 3EE3A 1D9DA 2BJ1A 1YTYA 1DLOA 3DRSB 3AOCA 3PRVA 4HACB 2E9TA 1MG7A 4LF6J 1LW0A 1RCOB 2PE8A 4W98A 6AT1B 2WB1D 3RRGA 1R8PA 2DIUA 1QSYA 2FLPA 3ZZZA 2UU9F 2C3UA 1T05A 2B9EA 1KLNA 2E7XA 1XMQJ 2YY3A 3GIRA 2JHEA 4LFBF 2DNPA 2CDRB 1R6VA 4OZ1A 2UVWA 3UCZP 1H73A 4KGXB 2FGCA 1H74A 1Q8IA 3D0GE 4D3HA 3R7SB 3PRDA 2HBZB 2GAHC 4YMEA 1F3FA 2H9ZA 1DBDA 1SV5A 3GG1A 1ACMB 4JI1F 3PG9A 4HI2A 4TKTA 3A13A 3P4UB 5ITHA 2V8PA 5I3PA 2DNHA 1ZBTA 4LF8F 3OFFA 3HMJG 5CABA 3BR9A 3QGGA 2HAFA 3MD3A 4EK2A 1YRXA 5F8JA 1KQGB 3Q86A 1KLMB 1R0AB 3U1MA 5DQGA 2QJ3A 3J7AN 1WG1A 5DDOC 3C15A 5L8RC 1RBOB 2J9DA 4DV1F 6FDRA 4IO9Q 1GTEA 3OTDA 3FCVA 3IO1A 3QFWA 3G87A 4FN5A 1Q95G 3NS5A 1H3DA 1WDTA 2MQLA 2SXLA 2RKIB 1S1VA 3SCLE 4D3GA 4EZ9A 4YB7A 2ZBQA 1QM9A 1NDPA 1FNOA 1CBKA 1VQYA 1B0TA 4DBQA 4B08A 2YPZA 4Y6IA 1XNQF 2P5VA 2XLKA 2BA9A 2RRBA 4XTTA 2UXCF 4TY8B 2XBPA 1MWQA 4CRJA 1O0PA 1RYRA 2HQIA 1F5CA 2Y8WA 1NKCA 3JXOA 5I3UB 2A1BA 1VR6A 1VJWA 1YJ7A 2LA4A 5CCMA 5B0CA 2IJRA 4DR1F 4WFBQ 4IRDA 4N5SA 1TTHB 3IGVA 1IBCB 1WD6A 1IJEB 2HURA 4ZVHA 3MDFA 4U9RA 2QLBB 2MJNA 1N32F 1JJ4A 4TN2A 2ERRA 4LR7A 2KXFA 3I0SA 4U95A 2V0NA 1L5UA 2ADCA 3ZZUA 3PNIA 4CO0A 1Q8BA 2IAJA 3TUJC 4JOUA 3DGPB 1QD1A 5DDRC 3LQVA 2W7PA 1V5VA 4WYWA 4B3RJ 2KVIA 3C3LA 2J8SA 3L7UA 2A6OA 3UDEA 4ID5B 2MKIA 3PW5A 1NKBA 3SYZA 4QIEA 2RIJA 4WKRA 2VFSA 4WFYA 1Q4RA 4E0DA 4N8OA 1HWLA 1TK5A 5D4LA 2ZNYA 4P7TA 4PG6A 5F8GA 5F3TA 3B4MA 5A6WA 2I8EA 4Y2IA 4B3SJ 2QTWA 4IR9A 1HBNA 4O3SA 2HQCA 4BLGA 2PFDA 4U7UK 4UT4A 3IS9B 3VAMA 4HT7A 3DRRA 4M63A 1K0TA 1SIWB 2MKHA 3BSNA 2VODA 1YJTA 1N36J 4LF7J 4USKA 4OI6A 2VUGA 4ZVPB 3SIPB 3HP6A 3M30A 3MCMA 1VI7A 4IH5A 1X0FA 4CLPA 5BYSA 2W1BA 1CSJA 4ZCIA 3PCOB 3JB9k 2QLXA 2RD5C 1FRMA 1PJ5A 4UY85 5KAKA 2R7OA 3OUYA 2OFGX 3DOMA 2JL9A 1YX2A 3A12A 1N6QB 1WELA 4AXIA 4KO0A 2JX2A 2YKPA 1EHWA 4FNIA 1LWEA 1VLOA 1M5KC 2XG8A 5D6GA 1S0NA 1NPPA 4LQ9A 1WG4A 1IBLJ 1RYSA 2BE2A 4ZIWA 4NLTA 1BQNA 4J9UE 3DLGB 2GV1A 1O5JA 2YKMB 3UD3P 3PY8A 3R5AA 5IC4B 5CYQA 3C46A 2VB6A 3H5UA 1N5TA 2D69A 4DPTA 2ZH1A 1PC5A 1KC8T 3HVTB 2ZZMA 4PXDA 1A9NB 2ZEJA 1VQ8S 2IBKA 1KNZA 2QMUB 4ZLLA 2VQEJ 1LV5A 5KG6A 3D1QA 3F73A 2BJ7A 3W63A 4B3OB 3HO1A 4OX6A 2C2EA 1U4BA 1XR6A 4JV0A 2Q1LA 1B7FA 4PG4A 1RTDB 3T1HJ 1FVSA 4LBHA 5J2NB 3FSYA 1KEKA 4X66F 2ZJQQ 1MN7A 2MZSA 3ENAA 1RAAB 2I5JB 2MQQA 2JLEA 1A6LA 4J91A 2LXUA 4LF9J 2HQ3A 3UN2A 2ZWOA 4JI6J 4R0EA 4CDIA 4XDDA 5J2PB 3PX6A 2KRRA 5KT3A 4NLXA 4IYQA 1D3WA 3ELHA 4ZVQB 3NGRA 4PWDB 3V4MA 4ZHRB 3QAEA 1NK8A 2CYYA 5CD4H 4MKAA 1MROA 1S76D 2KU7A 3N6LA 3LP2B 1LW2B 4UUWA 3HVAA 1HQUA 1KR4A 4HKQA 1B70B 1Q5YA 2JJ4D 1JJCB 3K5NA 2MYFA 3ENVA 2CQ3A 1EX8A 3ZNJ1 3GFYA 2HBYB 3Q8UA 3HHLA 2CJYB 1ZZFA 2JWNA 4B3MF 3PDNA 3FJ2A 3AQPA 1WC0A 2ILYA 1LKZA 2EK6A 4QQBA 2W2QP 4PYAA 4KHMA 1VRTB 4QIWD 3W9JA 1NB2A 3C6TA 1K1QA 2R8HA 1Y9OA 2PSZA 3CD0A 3RBXA 3MMBA 3QATA 4NXNJ 2O5DA 1OQ6A 3JQJA 3ZC4A 1HARA 3H42A 4RNHA 2O3DA 2R8GA 2GC8A 1HI1A 3M8PB 2CPDA 2I0XA 2HHQA 2VG6B 4JI2F 3CPWR 4LJMA 4ZVRB 2OSRA 3GR0A 3EGNA 3MCSA 5KFNA 1T0TV 2KT5A 2H5IB 1JLQB 1Q79A 2UUAJ 3QRRA 1N33J 1YJNS 1OYDA 1RT6B 3J80Y 4RKUC 3PHTA 2DT9A 4FYDA 1LWCA 1CJKA 1OY6A 3R8YA 4K4SA 4EGLA 2KG0A 2HK3A 5KFXA 1N54B 3NNCA 1H0HB 1FX2A 2AD9A 2OPSA 2I6WA 1PCAA 3QT8A 1TKXB 1SKWA 3M8SA 2WAQD 2B5JB 1Q8KA 2MLYA 1IKXB 4ILRA 4OYXA 4OZ0A 1U2FA 1HNZF 5CH7B 1S59A 3CCMS 2CQDA 1RWVB 5B0BA 4I67A 4IG3B 4WFNQ 4C0OC 2HZVA 4LSNB 2Q66A 5D8HB 2KZZA 2VG7A 2XYHB 4LT6A 4Y00A 4DN9A 1FWLA 2FJWA 3M2UA 4CCHA 2GMLA 4UW2A 2X1AA 4N77A 3ZZRA 3NNAA 2F4VJ 2MDAA 4DR2J 1EJ7L 2HWIA 2NYHA 1HNIA 1RAHB 3R5JB 3TARA 2ZM6F 4K4VA 2K2PA 2NXJA 5KT7A 4LF5F 3M2VA 3Q83A 1PJ7A 2RQMA 3PACA 1TKDA 3I0RA 4UOHA 3BDPA 1PYOB 3EMTA 2YX4A 1U6BA 7AT1B 1KVKA 4CLSA 1N56A 3LA0A 4NEZA 1F6TA 4LSZB 1X60A 3IR6B 4I2QA 3WQPA 3PKMA 2VC1A 1QAJA 3HZEA 5L1KA 4ZCLA 1FKPA 1RAIB 3Q8QB 2FVSA 3PO5A 1RLCL 2X3DA 3H7HB 3PVXA 1G1XA 4TNOA 3W2WA 3MPWA 1D09B 1M5SA 4K5SA 4RW7B 5D0EA 4NOHA 1RWUA 4NXMF 3HVRA 3M6UA 5KFSA 3LWLA 3NCPA 2KKHA 4KGVB 4ZP8A 1SJ3P 4RLEA 3QZ7A 4ZPDA 1RU1A 3CJSA 2G13A 1G2EA 1ZTTA 3D67A 2B4OA 2X3GA 4F04B 2JC1A 3A8EA 1L3UA 2V50A 4HH0A 1FD2A 1GEHA 4DWIA 1NDCA 1DHMA 3H25A 4JV1A 2OHDA 1OY8A 2WONB 5ETSA 1GXUA 3T1YJ 4H4KA 1M5HA 2J0SD 2VOPA 1SC4B 1Q5VA 3W2VB 1T3OA 3ET6A 3IP0A 1EIYB 2Z57B 3ZZTA 2AHOB 1BC6A 4KQZA 4ECTA 3CCLS 3RYLA 1NLKL 2GA7A 3JAMY 3GFHA 2GQCA 4PWUA 3NLCA 5GAEU 1FDBA 3J7Z5 1KOHA 3U1LA 1HQ2A 4J9VA 3A1YG 4NLRA 3AB2B 3SCJE 4ES2A 3POTB 4JI4F 4C7QA 1MLAA 4KHPJ 2BJDA 4ES1A 3UPFA 4X4UA 3Q8SB 2BJEA 1G4CA 3EXCX 3IFEA 2YQ1A 4IFYB 2V4JA 4ZJQA 2ZVIA 1YG0A 2HFSA 4OZNA 3U7JA 2CPEA 5A6PA 4NLUA 3D1OA 1X9SA 3HHNB 1YGYA 4LR9A 4LFCJ 1Y4ZB 1NSPA 1QDUB 2IM3A 3RR8A 4ZVOB 3WIUA 2VV5A 4WTOB 4CO3A 4F7VA 3DYAA 2HNDB 4OLPA 2R7RA 2F1FA 3DDIA 1S9GA 1JK9B 2YKAA 2C2RA 4ERDA 3C16A 3E8OA 3DC2A 3DRPB 5IFMA 3R5BA 2VBWA 3UNGC 1QE1A 4DV5J 3PKYA 2PN6A 4RNNA 3A3PB 3MOZA 1NJWA 4PQUA 1WEYA 3MM9A 4OYIA 2DCLA 4KFBA 3ITHA 1QSLA 3NS7B 3VVUA 1E6YB 2BDPA 4NLGA 3Q8PB 3CJ3A 1YITS 3CF5Q 5KG7A 2RQKA 2B9WA 5B0DA 3TAMB 3DI6A 2W9BB 4FF1A 2EXUA 4RW6A 2FY1A 1DAXA 1SC3B 3BGOP 2HG4A 4ZPTR 3CCUS 3GFXA 3IRXB 4NZ7A 4GO7X 4PXCA 2MZTA 1IJFB 3UO0A 2OPRA 2RNEA 1OQ3A 1B99A 2P6TA 3G82B 3FEXB 5HJXA 3CMQA 3QJPA 2WOMA 2AEMA 5DLFA 1OYEA 2O66A 3H4BA 3GJQB 2FLOA 4F4XA 4BC9A 4GKJJ 4IKAA 4CM0A 3QJLA 3OFGA 5AE2A 1U1RA 2BR0A 3GYNA 4R5PA 1RU2A 2EBEA 2M5YA 2KN4A 2OIHA 5M2PA 2WBRA 3AOAA 4RWWA 2W01A 2HVEA 3RB4A 2FUG9 1ZPWX 4TQRA 4OHYA 5KFOA 3IM9A 4O4GA 2HK2A 2QV6A 6FD1A 1XR7A 1P9QC 3SQOP 1TK8A 2GJIA 1OO0B 4WBFA 3KOAA 2DNZA 3G96A 4PG8A 5B0FA 3JSMB 2ACMA 2E5LJ 1K47A 3S1TA 5ETNA 4RNOA 1V3RA 1GMUA 2HNZA 2DH7A 2IFXA 3LAMA 3RG6A 1TL1B 3SZ2A 5DJBA 4JP8A 2HGMA 1VBZA 4QPXA 5IXUA 2CIMA 1JLCB 2HAIA 2GVDA 3AQOA 1CJUA 4DSEA 1IVZA 4LSLA 3J81U 1VQKS 3LAKA 3EZUA 4UZBA 3VAGA 1RJJA 1WTBA 2YBVA 1NSQA 3N79A 3QZ8A 3MEDB 4O4RA 4ED5A 3ZTQA 4DL3A 3OFEA 2ABYA 2RDDA 1WC6A 1S0OA 2DNYA 2HLTA 2DRBA 1CS4B 2ZBIA 1Y5IB 4KC5A 1S7HA 1Y0HA 3M9NB 1FTCA 3BBCA 3KNAA 2DJWA 1RE1B 4DS5A 2UU9J 3WZ0A 3CDAA 2AZ3A 3DLEA 4CO4A 1HA1A 2BYCA 1FWPA 5KFQA 4DQQA 4KKOA 1EKRA 1YJVA 4P72A 4LFBJ 2E1RA 1N52B 1WORA 1UPPA 2F8MA 3G2XA 3BEGB 3MAHA 1UTAA 3WC0A 4IUFA 4L73A 3H98A 3MMAB 2PD1A 2A3JA 3OTOF 3W64A 2ZKUA 1T03A 4CZCA 5HBMB 2R8KA 4AL7A 1UMJA 4ZJOA 2Z2ZA 1R7IA 5HANA 4DMZA 2DXDA 3NEKA 1TAQA 1RK8A 1RT7B 4I64A 4O44A 1IR0A 3R97A 3D5MA 3IR5B 1U24A 5A8RA 2AQ4A 3OR2A 2EBGA 2W25A 2JC0A 2LQJA 3VWSA 2FVQA 3NOGA 2YKOA 5GVQA 2VA3A 2V67A 3NXZA 3UD5A 3A8JA 1XNRJ 2BANB 2J76E 2QA1A 2RU9A 5D4NA 5G4DA 3BZQA 4J5OA 5KFRA 5G0RA 4K4XA 4CLFA 3O6QA 4XDCA 3NKYA 4OYZA 4OJGA 4WP9A 2DPIA 2MGZB 3M8QA 2OI2A 3LALA 3NCRA 4DF4A 1YJ9S 4NLPA 4DEZA 3JYTA 2PMHA 3QBCA 4HDGA 1H2VZ 2GZOA 1UZHA 2QLFB 1IKWA 1TQLA 1WG5A 3DLLQ 3O44A 3AJ2A 2KI2A 1O51A 1XN9A 5DZ7A 2F7VA 2DGTA 2H5EA 2E1AA 2AX1A 3DXBA 3HFZB 4OZJA 1HR0F 1CPZA 1FEEA 2EEYA 3A3NB 3AFGA 4J9SA 1S99A 3K0JA 4NLWA 2CFXA 2ZUGA 1REVB 4UZCA 3MMCA 3ZZPA 4ZCMA 2VICA 2GQQA 2FGOA 2BBEA 1VQMS 5K14A 3LP0B 9RUBA 3VAJA 4C4WA 4FVCA 4LIRA 1HW8A 3OL6A 3BQ1A 1FO1A 3N6MA 3UD4P 3P3DA 1RA6A 5HLFB 5DM7Q 3GR1A 2KT2A 4LBIA 3ZXWA 3TYTA 1ZTWA 4NMXA 5LSOA 1JXVA 1PAUB 4WXOA 2YKNB 5DGAA 1UEKA 3Q23A 3DU6A 1B7YB 4Q2LA 3JTPA 2OPQB 2HIQA 1WTFA 3IWNC 5KG0A 3H59A 2RDJA 5A8WA 3V2UC 2UUCF 3AT1B 3K5OA 5A76A 1FFSB 5E2QA 2B4UA 1UWBB 4EO6A 2XSJA 4X4RA 5BYQA 1FRKA 2B8QA 2AJ1A 4NLYA 2MY7A 1FJ7A 2WHOA 4P2FA 1U26A 5JXSA 5A2QY 2ZH9A 4DV6F 2KT3A 2VOOA 1CEZA 2CJXB 3QIPA 4OIXA 2RUGA 1S72S 3TQEA 3IAM9 3KDOA 5L9NA 5ETPA 2HPUA 4DQIA 3K2YA 4MIBA 1H7WA 2H5JB 4XK8C 2NXCA 2HHHJ 1R8AA 2A0FB 5EUHA 4ZDNA 1WI6A 4OHZA 4HTIA 4FYXB 4QWCA 1NCLA 5IS2A 2DNOA 2MQ8A 2MKCA 4U7UD 2JLFA 5K8OA 1JLEA 4PWWA 3MAAB 3DMJB 2M70A 4PXBA 2RILA 2RVJA 2QA4S 4LMZA 4MFBA 3GYGA 2L3MA 2QL7B 4A8XA 3M8ZA 1YSJA 1V9OA 4EYIB 1NK0A 4KV8B 4K2XA 3JTNA 2CQ4A 4WF9Q 2RU3A 3PR4A 4BC7A 3VZHA 3L09A 3AD7C 1XC9A 3DHWC 1YJUA 4RJVA 5KT4A 4OX8A 2PGCA 1UVIA 2R7VA 3R1LA 5DLGA 1HNWJ 1IBMJ 1UVJA 2N82B 2EG2A 5MAOA 1K9MT 2XY6A 4NLVA 1KHVA 3J81j 4O3NA 2DVIA 1XMOF 1RHUB 4NA2A 1YKWA 4L6V3 3I4HX 4C8OA 3OT9A 2ZFHA 4QR2A 3H5SA 2D9OA 2IJNA 2CG8A 1JLAA 2UZAA 5ETTA 5E33A 3AXKA 4FYYB 3BO4A 3MM8A 1M1HA 2P9GA 3BH7B 2QT7A 1FESA 3KJVB 5L46A 2CWKA 3ILOA 3EPGA 5DZ6A 3UDVA 1NNDA 2H65B 3KWMA 3WHIA 2XHCA 4NASA 5A8KB 1DTTA 3M05A 2WW4A 5KFPA 3DOKB 2V63A 2BM1A 1HBOB 2DR6A 4EI2A 2VG5B 2YNGB 4G65A 2CG4A 1F5AA 2JRSA 3MPYA 2FIUA 2WK4A 2R2UA 1S1WB 1RTZA 5F41A 4KYZA 3T5HA 3I55S 2V8VA 1S6PA 3FCWA 1PSDA 4C2MA 3M2RB 4K2JA 4DL4A 3I6PA 3TA2A 4DU7A 1N4LA 1KN6A 3FSIA 3UVJA 1R8CA 4OFZA 1XBWA 3EVOA 4QR1A 4IDKB 1R43A 2AGPA 1AZSB 3MR3A 3L7PA 1TL7B 1JIHA 3THVA 1HWJA 5F9LA 3FFIA 1LW0B 4IQMA 1X4DA 3CEDA 1FTRA 3QYYA 1FRJA 4MK8A 4ETXA 3LGNA 5HMYA 2ZHOA 2YQ0A 1SPBP 3RRKA 1QY7A 1L3KA 3BGLA 3SCIE 4BWJA 4XO0A 1U1OA 3MPDA 4JI2J 3PYEA 3K5MA 4G1PA 2FLLA 1VQ7S 4OZ3A 2DNNA 2C42A 4AT1B 2XGPA 4CO5A 1RHRB 3D66A 3E51A 3PFOA 3MHYA 2XULA 3UR3C 3LOUA 1S6UA 2FTRA 4Q8FA 1SV5B 2HVZA 2ZD1A 3M6WA 4FPRA 2JH3A 2HSEB 2DGOA 4I4BA 2KO1A 5D4OA 2IMWP 2OFHX 3KG4A 1S79A 4F36A 4ZMMA 4AQYF 1SKRA 4DR3J 4A8WA 4DCJB 4K59A 4IG0B 1DARA 2N4DA 1TL4A 1TV6A 4P2XA 4DX5A 4F67A 2HQDA 3IWLA 2GFFA 5DG8A 1Q81T 4C3MA 2PI5A 2AZ1A 3BO3A 4CWBA 5CHCB 3ADAC 2R7XA 1GT8A 1WEZA 1HNZJ 4L74A 1TFWA 4KTQA 2GMHA 2KFZA 1K0VA 2NZ4A 3IAS9 1YZ7A 2Y8YA 3KJFB 2HRYA 3HSDA 3KUEA 4LVOP 3FBEA 4HEA9 1S1VB 4B9NA 4DV3F 1CULA 2IA6A 3UNYA 3I31A 4FP9A 1R0CB 1KD1T 1FJGJ 1G6BA 1NJZA 1BQMB 5FDLA 4MIWA 2QFJA 2YVSA 4PG5A 1RTJB 4DFJA 2OP5A 2QRRA 1FA0A 4M8LA 3TUZC 1FFGB 4ED0A 5D0GA 4LF5J 4IOCQ 2FYXA 5HVHA 3Q2SC 2BQ3A 4AL6A 1RWMB 1GFWB 2HFUA 4ED7A 5IC6B 1NDKA 2XHWA 1TK0A 4P2MA 3KLHA 4QWAA 4ZVGA 3RB3A 3I0SB 2ROEA 4EEYA 3CT9A 3CD7A 2IAJB 3EDQB 4C9DA 1XR5A 1NHVA 3MXHP 3DLBA 2RUSA 3KMSA 3HLUA 5HQMA 1C0TB 4J9MA 1QAIA 1HBUA 3S7RA 4UOGA 4HDHA 3J7YI 3ICLA 3U27A 1N5VA 4ZPVR 1GXLA 3WIVA 1T7PA 2VIHA 2FHOB 4NXMJ 2YNFB 1GMWD 3MI7X 3DGVA 4MKYA 1TUVA 1NZAA 4ANDA 4DV2F 3FVYA 2M7SA 4S0MA 1T94A 3TZWA 3G6ES 2ZOFA 5HP1A 3OPKA 3UN3A 4RNMA 4UUXA 2DH9A 2R2SA 2H4YB 3KLFA 3M30B 2FPHX 4KT0C 2ASYA 4G1QA 4RUHA 4OYAA 4LF4J 2O67A 4I6AA 1SJRA 1PAEX 2EW9A 4J9NA 1YZ6A 1FXDA 1M90T 1QTNB 3OUYB 4USJC 1D9AA 4MYUA 4RW9A 3BGRA 4PYDA 2DCUB 5I3UA 3I9V9 1HPZA 5T7LA 5FD1A 4KO0B 1XERA 2K06A 3D0IE 4JI4J 2F8EX 1LWEB 5KFDA 2XYPB 1DTQA 1T8EA 4N41A 4RL1A 2V2QA 4OHWA 4Q2MA 2OD6A 5J2MA 1QSSA 4LFAJ 4Z7CA 4JV5F 1RADB 4MMOA 3LPYA 3S6EA 4Q0BA 3TJ9A 5K8PA 1DY3A 2XY5A 1RT3A 4QBUA 5KOXA 2J6TA 2MZJA 1J5OA 2LDIA 3DDNA 3EICA 1SBRA 5CYQB 1KHWA 1GQEA 5L38A 1F0XA 4C8LA 5GAHI 2IVFB 3W9HA 4MK7A 3IGNA 2DRDA 3RBZA 4HLBA 2DISA 3G4SS 4NZ6A 4URGA 2V8HA 1OSDA 2IJFA 2QFIA 4M5GA 1CJVB 1OMSA 1SJ4P 1FXRA 1H2UX 1S6OA 4A46A 4MH8A 2B7BB 3P5TL 1C1CA 3R7BB 3TZZA 1IR1A 2BE9B 3VAFA 4Y2AA 1HHTP 1MWZA 3IC1A 2M9KA 4M5KA 4WK3A 2C1EB 2YX7A 3D6FB 4DZ6A 3C19A 3OV7A 1JWWA 1MROB 3KUGA 3CMES 4F3OA 3CVKA 3CUNA 3OD2A 1FD8A 4DQPA 3QJJA 2XI3A 1HQUB 3W7BA 3DU5A 3RAQA 4PXEA 5KFTA 1WKJA 3KK3B 1RTHA 2YWEA 3ILIA 4WE1A 3IM8A 4DXLA 2LVWA 3CJ8A 5F8IA 1NB7A 5C24A 3T5KA 1H38A 4X65F 3HHLB 1KS2A 4JYAF 3M8YA 2QEXS 4J90A 3NWGA 4KH0B 4QPTA 2HHPA 2L41A 1GX5A 4ECUA 2NXUA 2D9PA 4OV1A 4BDPA 2ZJPQ 4F3MA 2QLWA 3HJFA 3GE9A 1U1NA 2J7KA 3C6TB 2VFTA 3GJSB 2MLXA 3D28A 1LK7A 2DNGA 1Z2LA 3MMBB 5CQGA 2RE1A 2EKNA 2WVCA 2E1PA 1RZMA 1WSVA 3SDEA 4FYVB 4OMFG 5C42B 2IMOA 1JLFA 3HCXA 3I9ZA 2G1HA 2HFOA 1RHQB 1S48A 2XS7A 1KQSR 4K4TA 4KGMA 5J2NA 3KNGA 5CXTA 1H6KX 2UUBF 3EVMA 4DUZF 3K5PA 2MMYA 2L08A 3NG8A 3H2LA 2LFVA 3HF5A 5BXIA 2RT3A 4KH1B 5HO4A 2EFQA 1LWCB 1CJKB 1QUPA 1UA1A 2FHJD 1U48A 1ULRA 3LH2S 3CULA 2NSCA 1XQIA 1WEXA 3TUIC 3OTCA 2OPSB 4OJ1A 4CQ1A 3RUBL 1FE4A 4DR5J 1JX4A 5C25A 4F4AA 3QT6A 2KZMA 2GW8A 8RUCA 4WU3A 2DYAA 2X51A 4W4MA 2YWWA 4OZLA 2COLA 4B9MA 3PM9A 3MFHA 4U96A 4KY3A 1HMVA 1RHKB 2HW3A 1AFIA 1PYSB 1UL3A 3K7RA 2FDNA 3KLGA 2JNJA 3ZTRA 5B0AA 3BBFA 3AODA 3A8KA 2FHMA 1VK3A 1IWAA 2DKOB 2VG7B 3QRQA 3M8WA 4B3TJ 1RT1A 2D74B 1PC4A 3M2UB 1KWMA 2XZTB 3F44A 3M1VA 2HS0A 1Q8LA 3FBFA 2WSEC 1HNIB 1PKUA 1MMLA 2MTLA 4EBEA 1RT2A 3HFKA 2VFRA 2ZNZA 5KFVA 1XMQF 5E7OB 2AW0A 1CC7A 1ROFA 2R8JA 1W25A 3R7NB 3M2VB 4NLOA 3M8PA 4YQWA 4M5HA 3I0RB 5DQIA 4U8YA 1U0SA 1BGXT 3J80U 2CWXA 1W2IA 2ZH3A 3LP1A 4OYBA 3O2IA 4QR0A 3NGKA 5HQLA 4F50A 3BN7A 5D15A 4LRCA 4PPDA 1ZETA 4I2QB 3KKFA 2NUUG 2IHR1 5KFLA 2XGQA 1IKYA 3Q8VA 1N8RT 1ZM3A 3KFWX 4YDDB 4EUVA 2YH1A 4OYPA 2QO3A 1BMQB 4NWBA 3W2WB 3KLEA 5A0YB 4MKBA 3EZOA 1IQTA 1PBUA 3TJ8A 5F3ZA 4DSLA 3QO9B 1CVJA 2IPOB 2CPHA 2CQ0A 3DLJA 1IKXA 4YR0A 3MM5A 5HROA 3D3BJ 1VBKA 2KHDA 1TP7A 2DHHA 2ZC4A 3AOBA 2UVVA 2WTFA 2MHNA 2OPPA 3RW6A 4C11A 4DN0A 2Q3PA 1RGVA 5ETVA 1RKJA 3P8BB 3Q8YA 1PGZA 3PO4A 3C6UA 3MUVP 3EVWA 2DO4A 3ET6B 2I1RA 4ZA1A 1Y11A 2CQPA 1U1LA 2CQGA 3CCVS 2MKSA 2UUCJ 3W5YA 3A3OB 5LJ3Y 2HGNA 3ENQA 3K58A 5KFIA 4C8MA 3SFUA 2BX6A 2CNLB 4LUBA 3DNCA 4LREA 3C14A 2QMXA 4CYUA 2MLZA 5KFHA 2XCAA 1T9TA 3Q8RB 2V4JB 3PIOQ 2Y1JA 1R0BG 4BWMA 1Y5NB 3D54A 4QYRA 1RT4A 2Z2MA 5LXYA 4B3RF 3RW7A 2DGQA 1ZA2B 5DETA 3OXGA 2HHVA 4Q45A 1P6TA 3CWJA 3DYAB 1U7LA 3TA0A 1S9GB 5D0HA 2QYCA 1TU0B 3C16B 1SXLA 1X4BA 4HR2A 4XPEA 2HGLA 4USUA 1QE1B 1EB0A 2J6SA 4B3SF 1SKUB 4PQUB 3GG0A 5LL6d 2BXJA 2R2TA 2OSQA 1C4AA 4KFBB 3ITHB 1FT8A 1UVKA 4DUTA 3M6VA 3GJTB 3L7OA 1N88A 3P96A 1XMBA 4ED3A 4GC7A 4PKDB 1NK5A 2J9CA 2HRTA 4M5MA 4RW6B 4M95A 4FF3A 3D0HE 3G71S 2IDEA 4A4JA 4LF7F 4NYZA 5BR8J 1IN0A 2G1DA 3OL7A 3EPIA 3JAMU 4NRTA 2OPRB 2Q6CA 4HL9A 2EC2A 4UQGA 2WOMB 3TP2A 4F4WA 2EC0A 1RAGB 1XWLA 2ROPA 2VBYA 3KHGA 5CCLA 2K3KA 3QWPA 1GNKA 4ETZA 1SC6A 2ZITA 1T9XA 4DR6F 1XMOJ 5HL7Q 4R5PB 1X7VA 3WX4A 3PYGA 2FB0A 3VVTA 1RLDA 2PFFB 3TX8A 3G8TA 3CW2C 3PR5B 3D9BA 4WZMA 4O3PA 3QMQA 3W5XA 3OLBA 2IC3A 2KM8B 1IBLF 3OHAA 1N0UA 2LYVA 4O4GB 4NCAA 4A8YA 1B64A 5EGYA 2XMTA 2OO4A 2FQQB 4J9QA 2ZOMA 5HN0A 2IVYA 4A8SA 3H20A 1GK8A 1VC6A 2YQ3A 2GIRA 1RBAA 3LPEA 1UA0A 4ED4A 2MZ1A 4Q5VA 2HFNA 3O5TB 2HNZB 1B0PA 3D6MB 2DB1A 2CNNB 3CJ0A 2HYIB 5F0UA 5FJ4A 1HHQA 3FKBA 4KB7A 2WBMA 3QGPA 2GVDB 4EU0A 1CJUB 4J9PA 2E5IA 1UWAA 4LF9F 1MSWD 3GWCA 3LO3A 2K7KA 1P1LA 4JI6F 3B8HA 1Q16B 1KTQA 2VFVA 1K73T 3KG0A 3TR5A 2ZH4A 2ASJA 1GX6A 5BJRA 3H40A 3QRPA 1UCNA 5E3AA 3MEKA 3WC2A 4DLGA 2UVUA 3SBMA 4EBDA 2Z56B 3DLKA 5DRKA 5E3RA 2W2OP 2WSCC 3A8IA 4ICLA 4NZ0A 4JUZA 1Z1ZA 2EFOA 3MEGA 1LXNA 3UN5A 4EMDA 3G8QA 2BVZA 1WF0A 2RMLA 5KFJA 2A2CA 2CPJA 1TZ0A 4ZITA 2HHXA 3QNWB 3Q0AA 1VC0A 3C66A 4V19X 3DLEB 5KFFA 1PG5B 2G2OA 5DG7A 1U2RA 3LANA 1N0VC 2IIHA 4KKOB 3SQGA 3TWZA 2VBXA 5CZVA 2Y0SD 1G7CB 2XTJP 4M5IA 1G3OA 3SV4A 3JTOA 2LECA 3Q22A 3DFEA 1SQGA 2BRKA 2PMWA 5ETQA 4IH7A 2ALYB 4GO5X 2WB4A 3QLHA 2RQCA 1T03B 4JBCA 1FNMA 3FDSA 2W8LA 3ZTOA 1VBXA 2XMAA 4K50A 2ZE2B 3NBPA 2CPYA 1CLFA 4K4WA 2VD3A 3UFCX 5KG1A 1HNXJ 4QU7A 4O44B 4DQSA 3I56S 2WVFA 3CD5A 5A8RB 1HW9A 1X9MA 1MNEA 2ZC3A 3D1HA 4ILMA 2GNKA 1RT5A 3KG1A 2DR9A 4JV2A 4I69A 1REGX 3LGMA 1S1XA 1T95A 1TL1A 5HSPA 4FXDA 2JVOA 4DLEA 1TUWA 4R8UA 4Q8EA 4QIGA 2W7OA 2UUAF 5G0RB 1LWXA 2BUNA 4JI8J 3M7VA 2PA8D 2F5GA 3T3FA 1GTHA 1DJ0A 3GYXB 1FDAA 4WJBA 3M8QB 4TVAB 4NA3A 5IQ6A 4USWA 1U49A 3KLVA 1RACB 3MEDA 1S77D 2DK2A 2G0CA 2QGFB 3KJNB 4QWEA 4YY3J 1MMNA 3BB5A 1I3OB 1LWFA 3AJ1A 3QT7A 2FC9A 4OI1A 4EBCA 3CO0P 5U47A 3W66A 3F41A 2WRMA 1URRA 1VQLS 1W2BR 3CCTA 1M5PC 3CJKB 2W24A 1C1BA 5KFEA 2DEJA 1ZAXA 4MIAA 3CIMA 4K4UA 5J2QA 4H4OA 3CIZA 4DJBA 3ETMA 3AHPA 1CG2A 2Y9HA 2CZ4A 2C2DA 2R7QA 1WSRA 5EHHA 4QOTA 3BSAA 3FMWA 3CJQA 4Y0FA 2ROGA 1Y10A 2PT0A 4OI2A 3TW0A 4DUYJ 4PUOA 2RAQA 2UXDF 1OJ4A 2U1AA 4OQJA 5HATA 2E1CA 3BM7A 4WWSA 5IOLA 5MLCV 4AE5A 2L48A 4AYBD 1PIEA 1RTIA 3LWMA 4RUBA 3VHQA 1S0MA 2F4VF 2RS2A 1D0EA 4DR2F 5LJ5Y 3ILJA 3CJ4A 4C98A 4DL2A 4JI5J 5A8WB 3CCJS 3NMAA 1WC5A 4IFVA 4KPYA 1VQPS 2MKKA 3CD6S 1A7GE 1UJ5A 1I51B 4FNHA 2P9CA 2XSJB 2YNHA 1YBTA 3TEHB 1UFWA 4JI3F 4I7FB 4URSA 2IA0A 1JXLA 5LMUJ 3WBZA 4X62F 1OSCA 2B0GA 2YTCA 2BANA 3V6DA 3DXSX 3DRYA 5F8MA 4ECXA 3QIPB 1TMMA 4DV2J 2CJ9A 2HNYA 2FLNA 1X4CA 1EETA 1ELOA 1S4EA 3R6LB 2E9ZA 4IR1A 2LQ5A 2XNQA 3PYFA 5T14A 1YI2S 2C28A 4F0MA 1PILA 4H4MA 5SZTA 2J5AA 2VKRA 5HVGA 4GRSA 2HZCA 1TVRA 1SJFA 2WW8A 1TKTA 1PJ6A 2FY8A 2HHSA 4M5JA 4TY9A 3GP9A 1M5VC 2W2MP 3I82A 2AYEA 2QN6B 2Z8QA 1KTVA 1JLEB 1KQFB 2W9CA 4BS2A 4DL6A 3QAUA 4YN3B 3MR6A 4ES3A 4DG1A 4WCEQ 4MFBB 2G2ZA 4ZN3A 1X5TA 3H5YA 1F2HA 2CQIA 3D2WA 4O3QA 2VZ9A 4IOAQ 3K5LA 2PA3A 4DF8A 4NRUA 3H90A 4QIVA 3U1NA 2OJ3A 1HWUA 3SSRA 3MAQA 1UVMA 4JV5J 3BGFA 2AGOA 3PJXA 4CO2A 2GVZA 2VONA 3ETOA 2KYZA 4F2RA 2G0IA 3BYPA 2AGQA 5IT9Y 2XLIA 2XNRA 5KFGA 2HBQB 2VF3A 3QWUA 3MZIA 2OPQA 2XI2A 2RDIA 5AJ3F 2GAGC 3RB0A 2VL1A 4PABA 3P45B 2LU2A 1BE4A 2R7SA 4ER8A 2IYGA 2ZOGA 3KLIA 3R1HA 3QSYB 3FSXA 4PZVA 2GGPA 5J1EA 2FVCA 4KHPF 5A2QU 3OHBA 3J7A1 2AIRB 4WP8A 3BQ0A 2LXIA 2W4DA 1NSAA 2NCKL 1KOOA 2ZBCA 2WZ1A 3GTYX 2Z2YB 3MGJA 4UF4A 2QG9B 2QA4G 1JLAB 4CLTA 2G0JA 2GJ2A 1Q78A 2KJWA 4X2BA 1Y5LB 4LFCF 2DRAA 4U67Q 4ECWA 2ZHBA 3MM8B 5GADI 3AJDA 3OSNA 1S9FA 5EWFA 4YS2A 2DNMA 2YWKA 1ICEB 1VRUA 3HHEA 1HWKA 5IZHA 1RKIA 4LVNP 7FDRA 4B9TA 2CKWA 1DTTB 4RW8A 1Q86T 2UXBJ 4DV5F 3OTEA 3MAAA 1U09A 3TA1A 1W7WA 3K17A 3JSYA 1SKSA 2J0QD 4ZPCA 4LF2A 4RZRA 2QIFA 3NMRA 4X65J 4ZN1A 1NAQA 4CT8A 4C0BA 3TRGA 3HKWA 2XMJA 4GVBA 3UVJB 1LFPA 2CZ9A 1VC5A 1Y00A 5CYMA 2DNLA 1JLBA 2O01C 1MWYA 2VJVA 3EM1A 4CNZA 3HHLC 3OR1B 2IM1A 3FFIB 1WJ9A 5F9NA 2XMMA 4L72B 2C22A 2Y0BB 2V9KA 1HIYA 4BHQA 4GKJF 5HMWA 1YIJS 4ZJLA 2RF2A 5SUHA 4J9OA 4P71A 1FKOA 1S1TB 3OFHA 4DSKA 5EX3A 1NKEA 2DY9A 3BREA 4MYTA 2L9NA 1S97A 4E2FB 4JB8B 1RWNB 2ATCB 2HFVA 1FRHA 5DGBA 4OI0A 3PZPA 3I5CA 2CJBA 2POKA 2B9XA 3MEEB 1FRIA 2UUBJ 3GCWP 3ONQA 1LEOA 1MMDA 2XMVA 4WPAA 4ANEA 3J7YU 2BQUA 1N5YA 4OYMA 4JI7J 2AEFA 3T9ZA 4V19J 1TKZA 2ZD1B 3VGSA 4DPWA 3CGIA 3ULHA 2ZJRQ 5AXKA 2E5LF 3PXGa 2BJ9A 4TXSA 2UUTA 1ITPA 2JZ5A 3OW2R 4CH7A 3CNQP 2NLWA 3CCQS 4ZVEA 4YFUA 2K7JA 4OX9F 4FBUA 4I6WA 1TV6B 5DO2A 1SJQA 3UI3A 3L9ZA 5EDWA 3LUYA 2XEXA 4DS4A 1I1GA 4ZP7A 1ZPVA 1YWXA 4QWDA 4WTYA 3ZFVA 5J1PA 4L75A 3QSIA 4DSJA 2D41A 3IBFB 1RQ0A 3IG1B 1S7IA 3HSJA 4WFXA 4PPZA 2VDHA 3V4IB 2EWHA 1CULB 4B9VA 2BOAA 4CM2A 2CJQA 1RAOA 3CB4A 1VQSA 4NLSA 3DCAA 2EFPA 1R89A 5AT1B 2QL5B 1RAEB 1HHSA 2BEFA 2ZBRA 3BDEA 5K5MA 1TUGB 5FDLB 4DCPB 1U25A 3KK2A 1R6YA 2GO8A 1RSCA 4YOEA 4DI6A 1VQ9S 2W4CA 3GLJA 3BBBA 9ATCB 2CPFA 4YHHJ 2CQ1A 4YUDA 2B3TB 5KFAA 4B02A 4NX9A 3RRHA 2HVDA 5GAHU 1CJTA 3MCOA 3CDUA 4LR8A 3MM6A 3KLHB 1HI8A 2KXHA 1WHXA 2KG1A 3HD2A 2FD2A 1IBKJ 4OLOA 4F25A 1Q0NA 3OXFA 2FZGB 3CCES 1KVIA 4XAKA 3VGUA 3N4WA 2FJBB 4EO8A 2O1PA 3BSCA 4Q44A 1MU2A 4A8KA 3EDRB 3WX8A 5M2UA 1HBUB 3TJAA 3HHLD 4GC6A 4ZKAA 4IG0A 1P9YA 3BH6B 5KFMA 1RHMB 4EYHB 2C2KB 2FJEB 2FHKA 5H9EJ 1Q7LB 4IH6A 5IM0A 3BQ2A 1XNRF 4B9UA 4DPUA 4TU9A 5E3PA 2W4PA 2AP6A 1Y3JA 1V6HA 2DIVA 3NOCA 3O1LA 1XTZA 4P2SA 3EGWB 4ZVSB 2V6AA 2VDIA 4M5DA 3D6HB 4G6VB 5M2RA 4AFFA 1VJQA 1U8WA 5HP1B 2JEIA 4NPOA 2HRUA 3B78A 4DL5A 4CH0S 3KLFB 5LOQA 3JQKA 5B09A 4G1QB 5CYJA 3G6XA 1HYSA 2FC8A 1C0UA 4USHA 3L4BC 4MTPA 4J37A 3NAHA 2LEPA 3SI8A 2LXFA 1BQMA 3O3LA 3W60A 4RW9B 3FCHA 3BGRB 4YDXA 2MKYA 1RCXB 1RTJA 1AROP 1R8BA 1VHIA 3CDEA 1HPZB 5T7LB 4ELUA 1AUSL 2V4RA 2OUGA 2ZH7A 1JXEA 2D7SA 1UEVA 4H4KC 1URNA 2J0XA 1DTQB 3THPA 1YVFA 1N5SA 4PEOA 5J2MB 5H9EK 2BE7D 2ADBA 1BWVA 3O8WA 1YDLA 3V81A 5KFCA 4Q0BB 4U8VA 1RAJA 3VALA 1RT3B 4DHVA 4CLYA 4U7CA 1J5OB 3T1AA 2GHPA 1HL6A 3MECB 2YH0A 1RABB 1AYEA 1M5OC 2HVIA 2F4FA 2FZKB 4JI1J 4LRFA 3GV8B 2PEHA 3M32A 1FHTA 3M6XA 1C0TA 1DQ9A 1U6FA 4HT5A 3PW7A 3G86A 4R25A 2FJXA 4ID8A 4LF8J 2DO0A 1NU4A 1H2TZ 2JOQA 1X31C 4ECSA 4WXWA 2B43A 2VHGA 3SEOA 2QC3A 2YNFA 4CLZA 2Z30B 2DNRA 3D6TB 1C1CB 4FXWA 4DV1J 2LMIA 2VC0A 2E1MC 3DOLA 1Y7PA 2B9YA 1S9EA 3NGUA 4LRDA 1J5EF 1S1UA 2DITA 3ZTPA 4N7TA 1JKHA 3CCSS 2MJUA 2R8IA 1YRUA 3CCZA 1LFWA 1D8YA 1IUJA 1WUUA 1HNVA 4FS1A 2HHHF 3M9MB 2HZAA 2DBBA 5DS7A 4AL5A 3EJMA 1F60B 4F4KA 5K9FA 4DV4F 1MN9A 2DH8A 3IBCB 2AJFE 4RW4A 2H4WB 3K57A 3VAKA 3EZ5A 1XNQJ 2D1CA 1TELA 2UXCJ 3FUYA 1RTHB 3AA8A 3HM9A 5E3CA 4WE1B 3X3UA 4PAAA 1CC8A 5C24B 2RH3A 1FK9A 4NCGA 3E01A 4UQTA 5LT5A 4DR1J 5ETKA 1D8ZA 4DR6J 3UQSA 5KT6A 1JLGA 1B0VA 2WCXA 3KMQA 4J9KA 3TO8A 5I3QA 1NJYA 4B17A 2DXFA 2JVRA 4DSFA 1KRPA 1KVJA 1F9HA 1N32J 4H54A 3R5DA 3DRXA 4TLRA 2EKYA 1I5OB 2YNIA 4F4ZA 4KIAA 3BO2A 3V6HA 2WSFC 3CCWA 1HNWF 4CO1A 3ENWA 1IBMF 2C3OA 4N76A 2CADA 3CDWA 4HHHA 2KM8C 4RUCA 3SDEB 3GZ7A 4NE9C 5GMKa 3MTKA 1S6QA 1NH7A 3AA9A 3F56A 1JLFB 1CJVA 2DGXA 3EX7B 1VS3A 4TQSA 3KTQA 2K1RA 1APSA 2MSTA 2DGWA 3HVWA 3N0VA 2AU0A 2QX0A 2PDAA 1XEZA 4Y2CA 1SL2A 4FF4A 2OEMA 1EP4A 2DPJA 1WOOA 2H54B 3S01A 3I32A 3UDCA 1ZAVA 2R4FA 1UP1A 4JI0F 4RUAA 2JEFA 3PYDA 5THWA 4XIUA 3VAIA 3D68A 4UY8T 4NI2A 2GS8A 1SB6A 2MQOA 2JSXA 2F65A 4W90B 4I2PB 1WHYA 1WC3A 2GIQA 1SH0A 4RBTA 4HHUA 4FZVA 1U6ZA 1VQ6S 4FKXA 3BF4A 3UE2A 4ZLNA 1HQEA 1RXOB 3NGDA 2FJDB 2BJ8A 5C25B 2CJKA 3KK3A 1VQ4S 5KT5A 4C3KA 3OVBA 1GH8A 4L3NA 2XWXA 1CQNA 1IKVA 3DHXA 3MM7A 2M0GB 1HMVB 2LU1A 1U1QA 2NXEA 2XMWA 3G6YA 3AXMA 4FYWB 2MZQA 3HHDA 3KLGB 2M8DB 1UPMB 5ETMA 3T19A 4C3LA 7FD1A 1FNXH 2FVPA 3I5BA 4N56A 4I6YA 2UV8G 4ECQA 4ECRA 2BABA 1RT1B 3QGHA 5KT2A 2XS2A 1QAYA 2YKQA 2KFNA 2BW7A 3V6KA 2ZH5A 3M1VB 1N34F 3RAMA 5FLXY 5B0GA 1LXJA 4F02A 3HX9A 2P9EA 2NQPA 1WHVA 4FBTA 1E6VA 2AF6A 1K8AT 1Q82T 1RT2B 1ZM2A 3MPUB 2I38A 4C8YA 2BMBA 3R3TA 5C42A 2XC9A 1RISA 3HD1A 2I9SA 2LEAA 3AD8C 1FRXA 1RBLA 4X64F 1VYAA 1GMVA 4X4PA 3ISNC 4PRFA 3ILLA 3HSZA 4X66J 1F9FA 1SUQA 1S57A 5AE1A 2PIIA 3LP1B 2E66A 1DQ8A 4ELVA 1AXQA 3L95X 3ZZ0A 3CMAS 3PHEA 2OELA 2ASDA 2B4VA 1IKYB 4EZ6A 2OD4A 3HK2A 2VH7A 4OI4A 1NO8A 1R31A 3TZYA 4DR3F 2HEKA 5KTQA 1FKAF 5H1SV 3KLEB 3E2EA 1B4SA 4KGKA 3CCRS 1C4CA 2QLJB 4TYAA 4WYLA 1VGYA 2R7UA 3GILA 2PI4A 2A10A 3K8WA 4ITSA 1QUVA 2X1FA 3LF0A 5ETLA 1LNQA 3MM5B 5HROB 2DNKA 2LLZA 4ED2A 5EWGA 4DV7F 3PJWA 3B4DA 4O0NA 2C2NA 3VF0B 4B3MJ 2OPPB 4C11B 3GB0A 1V5IB 4F0HA 3NS6A 4ED8A 3PFEA 5E3QA 3VTIA 3C2PA 4X4NA 2UXDJ 1PO6A 4CTAA 4USVA 4Z2XA 1QTMA 2BKNA 2IYIA 5AXLA 1DURA 2V68A 2AV5A 3C6UB 4P9SA 1F1BB 3GIIA 1RP5A 1DLOB 5IT4A 1FJGF 3OBIA 3KK1A 4ZIVA 1U0HA 4QW8A 2W2PP 4ZVTB 2Y1RI 1JJ2R 3I87A 1EZZB 2JEJA 4BCAA 3P49B 4X84A 5CAAA 2R7WA 5D3GA 5L1LA 2Z2LA 1T05B 3KHRA 1RUSA 2IDLA 4DL7A 3NNHA 2DR5A 2NPFA 4WU2A 3TI0A 4F2SA 5I42A 4P6QA 4KGZB 4JI3J 2DY1A 4P52A 3C14B 2AKWB 4X62J 4CYUB 2B8PA 2EPIA 5JJBA 1TL3A 1UVLA 3BS9A 2B6AA 1ZOTA 1S12A 2LQ8A 1TFYA 1HBMA 1IWGA 4AUKA 4MAKA 2KB2A 5D4PA 4WFZA 1RT4B 5HQ8A 4DPYA 3RB6A 3RBDA 1Z2ZA 2A2DA 3US5A 2HMIA 2XM3A 3BR8A 2AYBA 4Y2MA 4USIA 1Z4UA 2IBOA 2MQNA 4Y34A 2F8HA 3HXMA 3TEGA 4A8MP 1GAOA 3IXQA 3CO9A 3PX0A 5A0YA 4ECZA 2CVEA 2LA6A 3QO9A 4WIQA 3DM2A 4ANCA 2E44A 4M1KA 3BYRA 3M4XA 4DFPA 3HT3A 3C15B 3Q2TC 3D4JA 2E9RX 4DQRA 1X0PA 1U8SA 2VKZG 3S8SA 1NK9A 4Y28C 5JUMA 3R6GB 4DDFA 4XPCA 2V69A 3ISND 3IMQJ 4N8NA 3PRBA 5DQHA 2YWFA 4F8RA 4FS2A 2VPWB 1O8BA 1FJCA 3CC4S 1VQOS 1X4HA 3MPVA 4NEYA 3M9OB 3KHHA 3MWBA 5JVGQ 1AA1B 2W8KA 4LF4F 2J7UA 2AJ2A 5H9FJ 1LQ9A 2N4CA 2AWZA 1BY9A 3DRSA 5HJYA 2HKEA 3FGVA 4HACA 2R42A 4YB1P 2JEGA 2Q79A 2E29A 2VPZB 1EAYC 5AJ3J 4DL0C 2XO6A 2PMZD 5KOWA 2ZM6J 4OI3A 1T02A 3FBCA 1YK9A 4UOCA 1JNRB 2BACA 2W2NP 2XCPA 4LFAF 4BBYA 1KKHA 3VGVA 1HD1A 2IC3B 1OWXA 1FF2A 4YR3A 3OL9A 2HS3A 1SH2A 3SCKE 3BKUA 3NCQA 2Q43A 1FX4A 1LOUA 3DN9A 2ZHAA 3IA0A 1AUDA 2IY5B 1TAUA 5CD4A 4NYPA 2CA9A 2Z4PA 2OKQA 2V2KA 5E41A 1BHNA 3TVZA 2XMKA 1KLMA 5H9FK 4IO1A 2F9DA 1NK4A 1R0AA 4P10A 1NMEB 2DGUA 1NPRA 2ZUAA 4CLKA 1NPKA 3UWTA 1RWXB 1Q53A 1EARA 2V2VA 1HBNB 1NK7A 3W9IA 2NUHA 4RBUA 2J6UA 1BXNA 2F3JA 4K0KF 2N3LA 3UR0A 1I94F 5GAGI 3DRRB 3I4PA 4B9SA 2M3DA 2DXEA 3JQMA 1AFJA 2OMLA 2RKIA 3PIPQ 4UOFA 3J7ZT 3GV5B 3DLKB 1FWKA 2HWTA 4C8NA 1RWOB 3JS9A 4LIWA 1WOSA 4ICLB 4OJ3A 1J27A 2A18A 2DTJA 5E5NA 2VJUA 1FVQA 4I56A 3T9NA 3MEGB 2CPZA 4ZLJA 4TY8A 4W92B 2FZCB 4DPOA 2J8AA 1AW0A 3B6BA 4ZCKA 3AB4B 3OSPA 1YRTA 1UW4A 3DOMB 1DFDA 1SVDA 5HAOA 4OYWA 1X4AA 1RA7A 3FQLA 1U2CA 2G9OA 2KFYA 1SQFA 5T41A 1QLNA 5KG4A 2EFGA 4FKYA 2MSSA 4DFMA 1YHQS 2VU5A 3SQGB 4IRKA 1X8DA 4OZ5A 5KFYA 4G1IA 3BV8A 3G6VA 2OEJA 3FZ2A 2XB2D 1T11A 2B7CB 2BE2B 1X4FA 4QCLA 3QLHB 1BQNB 1FERA 4CP5A 5LMNF 4NLDA 3FEZA 3TAQA 2KXNB 4K4ZA 2V4QA 4NL5A 2Z58B 3DGPA 4TYBA 3MOJB 3NBPB 2BQRA 3QT5A 2NR0A 1OY9A 4ID5A 4QIFA 3Q89A 1BWEA 3DLHA 1S0VA 4Q7AA 2KH9A 4DX8H 4ED6A 4DR7F 1RT5B 4MT1A 2MQPA 1HFEL 1ZAWA 4OX9J 5F0WA 2BZ2A 2RSQA 3T6JA 1S1XB 2KRBA 5RUBA 4WKYA 3HSGA 5K8MA 1UKUA 3N01A 4R8UB 4AXJA 2EK1A 1VISA 2APOA 3VCDA 3GIKA 3DDKA 2ZBPA 3IS9A 4GVLA 3KYLA 3FEYB 5C2CA 2IRUA 4V1Ak 3HT0A 3BPSP 3PX4A 5ETOA 2R7TA 2PC6A 3E3XA 4FXVA 3BKFA 1LWFB 1P1TA 2K3IA 1KQKA 3MF5A 3RZAA 4DR5F 2HHWA 4NMLA 1C1BB 1Q7YT 2RRAA 4WIIA 5J2QB 2UV8A 4H4OB 4K8RA 2ZWPA 3NGSA 2K8GA 3CXCR 1N6QA 2YWGA 2NXNA 4CLUA 1D9FA 4DR4F 4M94A 4F4YA 5EWEA 1QVFR 4HVZA 2R9LA 2P6SA 4MKVA 1UFLA 4DZDA 4PUOB 2B51A 2IRXA 1WACA 2QA2A 4B3TF 2DHAA 2VQFF 3GU0A 1RTIB 3DLGA 2YKMA 4I1TA 1FCAA 1SH3A 3W1YC 3VQSA 3K8VA 2ZE2A 1RAFB 3HVTA 2F9JA 4LRBA 2IRYA 4LQ3A 2ALZA 3R9LA 4IFVB 4ATNA 3AD9C 4USMA 4K4YA 4B3OA 3T5LA 3GSDA 5GADU 2YNHB 1O6XA 2LP4A 3D7SB 1RTDA 3MR7A 5J1NA 2EFVA 4ZS6A 2IM0A 3V6DB 1KBRA 1U47A 1P27B 1UZDA 5F8NA 2QMWA 1L3SA 1FDDA 2I5JA 1FE0A 2HNYB 1IQZA 3QPIA 1EETB 2NYIA 2FVRA 4WFAQ 3QQCD 1H98A 5J2PA 2DR7A 2D3ZA 2E7VA 1DRZA 1XK8A 2LQBA 1T9YA 4GKKF 4KSEB 4H4MB 5HMZA 1KSPA 2AJ4A 1OIAA 1TVRB 1TKTB 4PWDA 4ZHRA 2MEWA 5KFZA 1VCTA 2LCWA 3MUTP 4LRAA 4DV0F 4DX6A 5LM7E 3LP2A 2VBZA 1GXTA 4ZPAA 4QJVA 1LW2A 4HYKA 1T9VA 2DHGA 2GHVC 2W9CB 3CJKA 1NJXA 3KUHA 3H8YA 2HIYA 2XZDB 3DKDA 2QSFA 2RRNA 1T9WA 4ZPBA 4DG1B 2CVIA 2CQBA 3ISZA 5C7PA 4ECVA 1EKSA 1ZM9A 2BRLA 3HPOA 3R2DJ 1EQ0A 3H2VE 1J2VA 4P75A 1VQ5S 1M0SA 5IWAF 2NZCA 3TX0A 4EWTA 2E5HA 5E0OA 1GMWA 2IM2A 2KHCA 1WF2A 3IR7B 3VZIA 2GVZB 4ZK7M 2MB0B 3CSKA 1VRTA 3U02A 3OTOJ 4HI1A 2D3O1 5JMNA 2IVMA 3CTRA 2CDQA 2XSFA 1P8GA 2HVHA 4LF6F 3V5RA 4DPXA 2OGUA 3IWXA 1RHJB 2YWHA 4E98A 1KP6A 3B82A 2V8DA 3KLIB 2GGPB 3G8SA 5J1EB 1HD0A 5AXNA 2L9WA 4X4VA 4I7FA 3PJ9A 4J9RA 1DZ5A 2QYGA 4K7QA 2VG6A 3D3CJ 3MD1A 3OXLA 1RI7A 4KE5A 1JLQA 3JSBA 2PEBA 3ZZOA 1AB8A 4U6PA 1J5EJ 2CXEA 1RT6A 3AAWB 3VR1A 1YLXA 2MHEA 3HI9A 3M8RA 4O3OA 1SQEA 2GIFA 2P2CB 1RDRA 1VRUB 2G2YA 2V8GA 2M8HA 1FKPB 2X7IA 2ZH2A 4A8OA 4OJHA 4DV4J 4IOBA 2AYMA 4C97A 4PR6A 3Q24A 4RW8B 3PW0A 4L3KA 2UP1A 1TKXA 1BD6A 2B5JA 1HR0J 3N28A 4YB6A 1YJWS 2DD8S 5KFBA 1M1KT 2U2FA 2AT1B 2GCFA 3N5FA 3GV7B 1ZS6A 4KRWA 2YPYA 4KPCA 4KJIA 4NCBA 1RWKB 4IG3A 3OJUA 1FI4A 1YQHA 4LSNA 2XY7A 4GVBB 3P6YC 5IT9U 4DCOB 1CQMA 5BR8F 2AJ0A 5C2GA 3A4TA 5CYMB 4L76A 4ZVUB 1H7XA 3OL8A 1VRQC 3PEJA 5HMXA 1JLBB 3HFVA 2KL8A 4RPFA 1FDNA 1NH8A 2ZVSA 1VQNS 4KR0B 2VFUA 3FK4A 3EWGA 3PEHA 4RU9A 3H4DA 3CC2S 3OTBA 3FBBA 3UW1A 2RF2B 3KHLA 4DFKA 3P5BP 4Y3CA 1FRLA 1FKOB 4RO0A 3NRBA 2V94A 2DGSA 1WOPA 5K8NA 4C0HA 5AXMA 2XO7A 2V5HG 2KJVA 2I2YA 4OYOA 2CZVC 3IRWP 3GSIA 1K44A 3CE8A 5HK4A 4OL8A 3G9CA 4DV6J 1I6JA 1N5YB 3TANA 4DX7A 1ZH5A 1TKZB 4JI0J 4GMKA 2Y3YA 4QW9A 2DNQA 2NPIA 5I4MA 4EFAC 3IN5A 1BQXA 2BKOA 1WC4A 3X1LB 3BGUA 1NEEA 1A0OB 1KDNA 5HI7A 3GCXP 4IQXA 3TOQA 5DDPC 4RW7A 1UFKA 2DGVA 2DEIA 1SJ1A 2HLUA 1V3SA 2DHSA 1SC1B 2AX0A 1YBUA 2KVQE 2OTLS 3MR2A 3UCGA 3VQTA 1U1KA 3MM9B 5CA5A 3TQ1A 2J7WA 1X5OA 3SXLA
chains in the Genus database with same CATH topology
3EICA 1HIYA 3JS9A 1BUXA 3VVTA 3ELHA 4S0MA 1UCNA 3DDIA 1WKKA 1NDLA 3ETMA 3NGRA 3B54A 3ZTRA 3BBFA 1B4SA 3Q8VA 1K44A 3VGTA 1S59A 1WKJA 1F6TA 2B8QA 3NGTA 3B6BA 2DY9A 3BH7B 4DUTA 5CABA 3EVMA 1NSQA 1NDKA 3VGUA 2DXDA 2AZ1A 3EE3A 4EK2A 2B8PA 1NLKL 3Q86A 2HURA 3PRVA 1W7WA 1NUEA 2CWKA 1HLWA 2HVEA 3ZTQA 2DXFA 1ZS6A 5BXIA 1NSKL 2BX6A 4KPCA 4W98A 1WKLA 1PAEX 1BHNA 3WX8A 3VVUA 3PJ9A 1LEOA 4FKYA 1BE4A 2VU5A 3FBFA 4O0NA 4ANEA 5IOLA 4FKXA 1PKUA 3Q8UA 3BH6B 1NHKL 3FBEA 3NGUA 1XIQA 3MPDA 3DKDA 3GP9A 1LWXA 3FCVA 1VYAA 3ZTPA 3R9LA 4ENOA 2ZUAA 1NPKA 1KDNA 3BBCA 2BEFA 4WBFA 1XQIA 3ZTSA 5C7PA 3FC9A 4UOGA 3VGSA 2NCKL 4CP5A 5CAAA 3L7UA 3FCWA 3EJMA 2AZ3A 1S57A 1NCLA 1JXVA 1MN7A 4DI6A 1MN9A 3FBCA 3ENAA 1HHQA 3GPAA 4F4AA 3BBBA 3FKBA 1EHWA 2DYAA 1NDPA 4ANCA 1NB2A 1S5ZA 3VGVA 1B99A 3Q83A 4C6AA 3EVOA 4F36A 3G2XA 2DXEA 3NGSA 3Q8YA 3EM1A 3FBBA 1F3FA 2HVDA 3Q89A 4ANDA 1U8WA 4DZ6A 1NSPA 4UOFA 4UOHA 3ZTOA 1NDCA 3EMTA 3EVWA 4HR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIC A;  1HIY A;  3JS9 A;  1BUX A;  3VVT A;  3ELH A;  4S0M A;  1UCN A;  3DDI A;  1WKK A;  1NDL A;  3ETM A;  3NGR A;  3B54 A;  3ZTR A;  3BBF A;  1B4S A;  3Q8V A;  1K44 A;  3VGT A;  1S59 A;  1WKJ A;  1F6T A;  2B8Q A;  3NGT A;  3B6B A;  2DY9 A;  3BH7 B;  4DUT A;  5CAB A;  3EVM A;  1NSQ A;  1NDK A;  3VGU A;  2DXD A;  2AZ1 A;  3EE3 A;  4EK2 A;  2B8P A;  1NLK L;  3Q86 A;  2HUR A;  3PRV A;  1W7W A;  1NUE A;  2CWK A;  1HLW A;  2HVE A;  3ZTQ A;  2DXF A;  1ZS6 A;  5BXI A;  1NSK L;  2BX6 A;  4KPC A;  4W98 A;  1WKL A;  1PAE X;  1BHN A;  3WX8 A;  3VVU A;  3PJ9 A;  1LEO A;  4FKY A;  1BE4 A;  2VU5 A;  3FBF A;  4O0N A;  4ANE A;  5IOL A;  4FKX A;  1PKU A;  3Q8U A;  3BH6 B;  1NHK L;  3FBE A;  3NGU A;  1XIQ A;  3MPD A;  3DKD A;  3GP9 A;  1LWX A;  3FCV A;  1VYA A;  3ZTP A;  3R9L A;  4ENO A;  2ZUA A;  1NPK A;  1KDN A;  3BBC A;  2BEF A;  4WBF A;  1XQI A;  3ZTS A;  5C7P A;  3FC9 A;  4UOG A;  3VGS A;  2NCK L;  4CP5 A;  5CAA A;  3L7U A;  3FCW A;  3EJM A;  2AZ3 A;  1S57 A;  1NCL A;  1JXV A;  1MN7 A;  4DI6 A;  1MN9 A;  3FBC A;  3ENA A;  1HHQ A;  3GPA A;  4F4A A;  3BBB A;  3FKB A;  1EHW A;  2DYA A;  1NDP A;  4ANC A;  1NB2 A;  1S5Z A;  3VGV A;  1B99 A;  3Q83 A;  4C6A A;  3EVO A;  4F36 A;  3G2X A;  2DXE A;  3NGS A;  3Q8Y A;  3EM1 A;  3FBB A;  1F3F A;  2HVD A;  3Q89 A;  4AND A;  1U8W A;  4DZ6 A;  1NSP A;  4UOF A;  4UOH A;  3ZTO A;  1NDC A;  3EMT A;  3EVW A;  4HR2 A; 
#chains in the Genus database with same CATH topology
 2R2R A;  8AT1 B;  1NDL A;  3DI6 B;  1LK5 A;  4O23 A;  3TAP A;  1N36 F;  3LW5 C;  3GIM A;  3RGI A;  1UVN A;  2WON A;  2M2B A;  1OPI A;  4CI0 B;  3W2V A;  5KFU A;  4PQA A;  3EGZ A;  2ZDO A;  3OR1 A;  1WKL A;  2R3V A;  1N34 J;  4YR2 A;  2LKZ A;  2MY8 A;  3HJV A;  2OH2 A;  2C3Y A;  3KK2 B;  2RS8 A;  1WI8 A;  3CJR A;  5IV3 A;  2FHJ A;  2FJA B;  2G4B A;  3MUR P;  2F40 A;  1S1T A;  4HH1 A;  3POT A;  3HKZ D;  5AE3 A;  1X5S A;  4X64 J;  2RJZ A;  2VA2 A;  2AJQ A;  1CJT B;  3V6J A;  4Q43 A;  3OJS A;  4PG7 A;  3MEE A;  1IM6 A;  2A6M A;  3MM6 B;  2X1B A;  4IFY A;  4NA1 A;  5DG9 A;  3N5B A;  4DU8 A;  2VPY B;  1NRK A;  1BUX A;  2KDO A;  2M88 A;  2RHS B;  2N3O A;  3QID A;  1OPZ A;  1BLU A;  1ZZN A;  1HNX F;  2YX1 A;  2VQE F;  3OVS A;  1MU2 B;  3VAH A;  2HND A;  1NXI A;  3CC7 S;  4ED1 A;  2CJA A;  2D3U A;  3HHK A;  5LSL A;  2W7A A;  4I0W A;  4OV6 A;  4A48 A;  3DRP A;  1JQG A;  2JLG A;  4AD6 A;  4ZPW R;  2J0W A;  2ZKT A;  5FII A;  4WP3 A;  5IM0 B;  3T1H F;  3EYZ A;  3ZO7 A;  2OTJ S;  5KG2 A;  1XIQ A;  3FQK A;  4JI8 F;  4ZLP A;  1E6Y A;  1UJ6 A;  4DV7 J;  4LSL B;  2H48 B;  4M5D B;  4CIO A;  3THT A;  4J7C A;  3PW4 A;  2Y1L B;  3SV3 A;  4UTG A;  3TAM A;  1RB0 A;  2W9B A;  2ZH6 A;  3GIJ A;  1UJ4 A;  3IG1 A;  2DR8 A;  3N6N A;  3J81 Y;  1KFS A;  3VV2 B;  3RAX A;  1L3T A;  4RR5 A;  4YY3 F;  3IRX A;  1PBA A;  2VAS A;  3V4I A;  4C6A A;  1NBE B;  1U02 A;  1UAW A;  2ACY A;  3MR5 A;  1HYS B;  1C0U B;  4O3R A;  3KXD A;  1U45 A;  1U1P A;  3BJY A;  4PCQ A;  3AY0 A;  3NP5 A;  1R3N A;  4TU8 A;  4F3Q A;  2CRL A;  1VFJ A;  4X4S A;  3G82 A;  5KFK A;  5C5J A;  1JNZ B;  4FVM A;  4A47 A;  4URQ U;  3GQC A;  1N48 A;  4MK9 A;  2C2Z B;  4O0I A;  3MCN A;  3T5J A;  4B9L A;  3GON A;  2XZW A;  1VLY A;  2AEJ A;  4DUY F;  2KYX A;  3SSQ A;  2LDY A;  4ECY A;  3V81 B;  2E7W A;  5GAE I;  1QVG R;  3TUP A;  1S4F A;  2CQH A;  4DSI A;  4CH1 A;  4C8Z A;  1ZM4 A;  4IRC A;  3RBE A;  4YEA A;  1S49 A;  3N9U C;  5D77 A;  1VHF A;  3OVA A;  4JI5 F;  2EVZ A;  4M5N A;  2ZZT A;  2ATL A;  1WC1 A;  2C2O B;  3M32 B;  2X1G A;  2BW2 A;  4NXN F;  4J9L A;  4ALZ A;  3JSM A;  3MTJ A;  3OR2 B;  2MQM A;  1OS5 A;  4AQY J;  1N5Q A;  4CNY A;  2KTQ A;  3AH6 A;  3TVY A;  2MXY A;  5LMU F;  1WF1 A;  1AT1 B;  2N7C A;  1WWH A;  1WHW A;  4QYZ J;  2CUY A;  4MJK A;  1SCJ B;  3NGT A;  2CNO B;  1JLC A;  3DOL B;  1N33 F;  4F0K A;  1S9E B;  3CDB A;  4QZV B;  5KG3 A;  3H0P A;  3W5Z A;  3W3S A;  1S1U B;  5KFW A;  1JKH B;  2N7Y A;  1ZYQ A;  4ILL A;  1HNV B;  2QSW A;  3JYT B;  4R0J A;  5B08 A;  1VMB A;  4CLL A;  3I5A A;  1RWP B;  3W65 A;  3NAI A;  1IKW B;  4DV3 J;  4X4Q A;  4RW4 B;  5CZX A;  1KFD A;  1HWI A;  1F2G A;  1S10 A;  3UCU P;  1F9E B;  3OQ2 A;  3C8Y A;  1CS4 A;  3PTW A;  3MMJ A;  1IM4 A;  1QAX A;  5GMD A;  4ZVF A;  5LXR A;  3RU0 A;  1DQA A;  2FJV A;  1X9W A;  1S5Z A;  2XYG B;  1FK9 B;  4NCG B;  3E01 B;  3MMC B;  2UUW A;  1V3Z A;  4WZQ A;  1R27 B;  5BYR A;  2V34 A;  5K14 B;  1JLG B;  2BKP A;  1WKK A;  2OAU A;  2RQ4 A;  5L1J A;  2WVE A;  4QYZ K;  3H2U B;  2JFD A;  2ZH8 A;  2QE5 A;  2C3M A;  1KON A;  5F8L A;  3CJ2 A;  1XJW B;  3MMA A;  2YNI B;  1D1U A;  3MFI A;  3MEC A;  5HBM A;  1T9U A;  1FEH A;  3CJ5 A;  2CPI A;  5KG5 A;  2HWH A;  4ZP6 A;  5IQQ A;  5ADZ A;  3ZZY A;  1RT7 A;  2RB7 A;  1NM2 A;  3W8P A;  4ENO A;  4Z37 A;  1S6Q B;  1Y3K A;  2P8I A;  1VIX A;  4G3I A;  2E5G A;  1SI9 A;  4RX6 A;  1WNE A;  2K1R B;  4OHV A;  3K59 A;  2LEB A;  2EFN A;  3NY0 A;  2JFK A;  2HHT A;  3PW2 A;  5GME A;  2WVB A;  1EP4 B;  2GQ2 A;  3BN4 A;  1IR2 A;  2OLW A;  1X5P A;  2MGZ A;  4K0K J;  1I94 J;  3L3C A;  4NI2 B;  3SSS A;  3F0N A;  2HS4 A;  1SL1 A;  1NZ8 A;  3B54 A;  2YXL A;  3BSO A;  1ZA1 B;  1NJI T;  1VOM A;  5B0E A;  4M5L A;  2L9D A;  1C2P A;  1WDD A;  5D78 A;  5JVH Q;  4TU7 A;  2UXB F;  4LF1 A;  4Z7Y A;  2C3P A;  1HQE B;  4RU2 A;  1NSK L;  2CAJ A;  2Z0G A;  1H72 C;  1VIO A;  4QWB A;  2EG1 A;  4P73 A;  1QJH A;  4LBP A;  2H3E B;  1NK6 A;  1IKV B;  2V2Z A;  2ZDP A;  1REV A;  3MM7 B;  1NHU A;  4P7V A;  3GMG A;  4RNF A;  2D3O R;  3ZTS A;  3LP0 A;  2J9D E;  1Q1K A;  2BM0 A;  4NYO A;  2MPU A;  4X4O A;  3QGI A;  3R5C A;  3I96 A;  3T6B A;  2RHQ B;  3LGH A;  4CT9 A;  4HHJ A;  5HLF A;  3MUM P;  3T1Y F;  1HKA A;  2GHW A;  4F26 A;  5LMN J;  2AYG A;  3T41 A;  2YKN A;  2NS1 B;  2CQC A;  1UW9 A;  2JDJ A;  4X4T A;  4KAI A;  1FXL A;  2GX8 A;  3HDS A;  3GJR B;  3W62 A;  1E6V B;  4DOZ A;  3NWR A;  3VGT A;  5F8H A;  2E5J A;  4KBI A;  1UEU A;  4ELT A;  2XMU A;  5K20 B;  4DR7 J;  1UWB A;  4E8U A;  2GJF A;  1VK8 A;  4CLW A;  1X4G A;  2ILZ A;  4KHR A;  1T3N A;  3LTO A;  4A8Q A;  1TL5 A;  1NHK L;  3KDN A;  3W61 A;  1SUQ B;  4OZ2 A;  4JI7 F;  1JJH A;  1EQM A;  1X4E A;  1UET A;  3UDL A;  1R8H A;  1PYT A;  2B4P A;  2V9W A;  4NLQ A;  1K1S A;  3WDO A;  3SMZ A;  1YBA A;  5D0R A;  5DDQ C;  2DHX A;  1M1G A;  4YP3 A;  1VBY A;  3R2C J;  3GFZ A;  4I2P A;  2W9A A;  2H51 B;  2CQ2 A;  2C2M B;  1L3V A;  4ZOS A;  1TMJ A;  2F63 A;  2NRE A;  2J9E A;  3DMJ A;  2H1Y A;  3OLA A;  4WK1 A;  2LQ9 A;  2XQC A;  2MZR A;  5HVF A;  4DR4 J;  2OEK A;  4YB5 A;  2NSB A;  1S6P B;  2VPX B;  3PV8 A;  4JYA J;  1NUE A;  1HLW A;  2B56 A;  5EX0 A;  4KV8 A;  2HBR B;  1FFW B;  2CNK B;  2MKJ A;  1FJE B;  4RBV A;  2Q6B A;  3TNV A;  2PO4 A;  4CTA B;  2QL9 B;  5FLX U;  2VQF J;  8ATC B;  1B3T A;  2HQF A;  2AMC B;  2HFZ A;  4N47 A;  3RJM B;  3K89 A;  5LSR A;  3RR7 A;  4FF2 A;  3FC9 A;  3TZX A;  2Y1I A;  3KK1 B;  2HQG A;  1HI0 P;  1U0H B;  4A8F A;  3JSR A;  4P74 A;  2BV3 A;  3EGV A;  2XS5 A;  5D3G B;  3QFH A;  4YHH F;  2QZ8 A;  5IT0 A;  2GMJ A;  1SL0 A;  2CPX A;  4OHX A;  3BPD A;  1W26 A;  1TR0 A;  5B7W A;  4C8K A;  1SIZ A;  5I42 B;  3RTV A;  1MW7 A;  2XWY A;  3BKT A;  1F5B A;  2M52 A;  1RWW B;  1TL3 B;  2B6A B;  2OMO A;  3SFG A;  3HZG A;  4DUZ J;  3KJQ B;  1IBK F;  1HBM B;  2EI5 A;  2XLJ A;  5L39 A;  3FMB A;  3NL0 A;  3TVK A;  2GO9 A;  3FNN A;  2HMI B;  1F3V A;  4C48 A;  3EUN A;  4GKK J;  4FDF A;  2ASL A;  3KJV A;  4TLQ A;  4UST A;  3R5G A;  2HHU A;  4DV0 J;  5A8K A;  5GAG U;  1JMT A;  3DM2 B;  2M4M A;  3DOK A;  3FRZ A;  1JB0 C;  1HBO A;  3R27 A;  5IV4 A;  2VG5 A;  5DM6 Q;  2YNG A;  5EN1 A;  3CJT A;  4I68 A;  3FZB A;  3GPA A;  4HTJ A;  4FPI A;  4RWX A;  5L9X A;  4OX7 A;  1S1W A;  1U1M A;  3FRY A;  4Y65 A;  3H5X A;  1IXK A;  4Y2K A;  4K5R A;  2UVR A;  4QU6 A;  3M2R A;  3W8G A;  5ETR A;  4ZP9 A;  1VDH A;  2ZZN A;  3HUL A;  5IWA J;  5L1I A;  2BJ3 A;  4IDK A;  3IBW A;  2WVD A;  2BOP A;  1AZS A;  1TL7 A;  3ZNU A;  1YJR A;  3EXY A;  3EE3 A;  1D9D A;  2BJ1 A;  1YTY A;  1DLO A;  3DRS B;  3AOC A;  3PRV A;  4HAC B;  2E9T A;  1MG7 A;  4LF6 J;  1LW0 A;  1RCO B;  2PE8 A;  4W98 A;  6AT1 B;  2WB1 D;  3RRG A;  1R8P A;  2DIU A;  1QSY A;  2FLP A;  3ZZZ A;  2UU9 F;  2C3U A;  1T05 A;  2B9E A;  1KLN A;  2E7X A;  1XMQ J;  2YY3 A;  3GIR A;  2JHE A;  4LFB F;  2DNP A;  2CDR B;  1R6V A;  4OZ1 A;  2UVW A;  3UCZ P;  1H73 A;  4KGX B;  2FGC A;  1H74 A;  1Q8I A;  3D0G E;  4D3H A;  3R7S B;  3PRD A;  2HBZ B;  2GAH C;  4YME A;  1F3F A;  2H9Z A;  1DBD A;  1SV5 A;  3GG1 A;  1ACM B;  4JI1 F;  3PG9 A;  4HI2 A;  4TKT A;  3A13 A;  3P4U B;  5ITH A;  2V8P A;  5I3P A;  2DNH A;  1ZBT A;  4LF8 F;  3OFF A;  3HMJ G;  5CAB A;  3BR9 A;  3QGG A;  2HAF A;  3MD3 A;  4EK2 A;  1YRX A;  5F8J A;  1KQG B;  3Q86 A;  1KLM B;  1R0A B;  3U1M A;  5DQG A;  2QJ3 A;  3J7A N;  1WG1 A;  5DDO C;  3C15 A;  5L8R C;  1RBO B;  2J9D A;  4DV1 F;  6FDR A;  4IO9 Q;  1GTE A;  3OTD A;  3FCV A;  3IO1 A;  3QFW A;  3G87 A;  4FN5 A;  1Q95 G;  3NS5 A;  1H3D A;  1WDT A;  2MQL A;  2SXL A;  2RKI B;  1S1V A;  3SCL E;  4D3G A;  4EZ9 A;  4YB7 A;  2ZBQ A;  1QM9 A;  1NDP A;  1FNO A;  1CBK A;  1VQY A;  1B0T A;  4DBQ A;  4B08 A;  2YPZ A;  4Y6I A;  1XNQ F;  2P5V A;  2XLK A;  2BA9 A;  2RRB A;  4XTT A;  2UXC F;  4TY8 B;  2XBP A;  1MWQ A;  4CRJ A;  1O0P A;  1RYR A;  2HQI A;  1F5C A;  2Y8W A;  1NKC A;  3JXO A;  5I3U B;  2A1B A;  1VR6 A;  1VJW A;  1YJ7 A;  2LA4 A;  5CCM A;  5B0C A;  2IJR A;  4DR1 F;  4WFB Q;  4IRD A;  4N5S A;  1TTH B;  3IGV A;  1IBC B;  1WD6 A;  1IJE B;  2HUR A;  4ZVH A;  3MDF A;  4U9R A;  2QLB B;  2MJN A;  1N32 F;  1JJ4 A;  4TN2 A;  2ERR A;  4LR7 A;  2KXF A;  3I0S A;  4U95 A;  2V0N A;  1L5U A;  2ADC A;  3ZZU A;  3PNI A;  4CO0 A;  1Q8B A;  2IAJ A;  3TUJ C;  4JOU A;  3DGP B;  1QD1 A;  5DDR C;  3LQV A;  2W7P A;  1V5V A;  4WYW A;  4B3R J;  2KVI A;  3C3L A;  2J8S A;  3L7U A;  2A6O A;  3UDE A;  4ID5 B;  2MKI A;  3PW5 A;  1NKB A;  3SYZ A;  4QIE A;  2RIJ A;  4WKR A;  2VFS A;  4WFY A;  1Q4R A;  4E0D A;  4N8O A;  1HWL A;  1TK5 A;  5D4L A;  2ZNY A;  4P7T A;  4PG6 A;  5F8G A;  5F3T A;  3B4M A;  5A6W A;  2I8E A;  4Y2I A;  4B3S J;  2QTW A;  4IR9 A;  1HBN A;  4O3S A;  2HQC A;  4BLG A;  2PFD A;  4U7U K;  4UT4 A;  3IS9 B;  3VAM A;  4HT7 A;  3DRR A;  4M63 A;  1K0T A;  1SIW B;  2MKH A;  3BSN A;  2VOD A;  1YJT A;  1N36 J;  4LF7 J;  4USK A;  4OI6 A;  2VUG A;  4ZVP B;  3SIP B;  3HP6 A;  3M30 A;  3MCM A;  1VI7 A;  4IH5 A;  1X0F A;  4CLP A;  5BYS A;  2W1B A;  1CSJ A;  4ZCI A;  3PCO B;  3JB9 k;  2QLX A;  2RD5 C;  1FRM A;  1PJ5 A;  4UY8 5;  5KAK A;  2R7O A;  3OUY A;  2OFG X;  3DOM A;  2JL9 A;  1YX2 A;  3A12 A;  1N6Q B;  1WEL A;  4AXI A;  4KO0 A;  2JX2 A;  2YKP A;  1EHW A;  4FNI A;  1LWE A;  1VLO A;  1M5K C;  2XG8 A;  5D6G A;  1S0N A;  1NPP A;  4LQ9 A;  1WG4 A;  1IBL J;  1RYS A;  2BE2 A;  4ZIW A;  4NLT A;  1BQN A;  4J9U E;  3DLG B;  2GV1 A;  1O5J A;  2YKM B;  3UD3 P;  3PY8 A;  3R5A A;  5IC4 B;  5CYQ A;  3C46 A;  2VB6 A;  3H5U A;  1N5T A;  2D69 A;  4DPT A;  2ZH1 A;  1PC5 A;  1KC8 T;  3HVT B;  2ZZM A;  4PXD A;  1A9N B;  2ZEJ A;  1VQ8 S;  2IBK A;  1KNZ A;  2QMU B;  4ZLL A;  2VQE J;  1LV5 A;  5KG6 A;  3D1Q A;  3F73 A;  2BJ7 A;  3W63 A;  4B3O B;  3HO1 A;  4OX6 A;  2C2E A;  1U4B A;  1XR6 A;  4JV0 A;  2Q1L A;  1B7F A;  4PG4 A;  1RTD B;  3T1H J;  1FVS A;  4LBH A;  5J2N B;  3FSY A;  1KEK A;  4X66 F;  2ZJQ Q;  1MN7 A;  2MZS A;  3ENA A;  1RAA B;  2I5J B;  2MQQ A;  2JLE A;  1A6L A;  4J91 A;  2LXU A;  4LF9 J;  2HQ3 A;  3UN2 A;  2ZWO A;  4JI6 J;  4R0E A;  4CDI A;  4XDD A;  5J2P B;  3PX6 A;  2KRR A;  5KT3 A;  4NLX A;  4IYQ A;  1D3W A;  3ELH A;  4ZVQ B;  3NGR A;  4PWD B;  3V4M A;  4ZHR B;  3QAE A;  1NK8 A;  2CYY A;  5CD4 H;  4MKA A;  1MRO A;  1S76 D;  2KU7 A;  3N6L A;  3LP2 B;  1LW2 B;  4UUW A;  3HVA A;  1HQU A;  1KR4 A;  4HKQ A;  1B70 B;  1Q5Y A;  2JJ4 D;  1JJC B;  3K5N A;  2MYF A;  3ENV A;  2CQ3 A;  1EX8 A;  3ZNJ 1;  3GFY A;  2HBY B;  3Q8U A;  3HHL A;  2CJY B;  1ZZF A;  2JWN A;  4B3M F;  3PDN A;  3FJ2 A;  3AQP A;  1WC0 A;  2ILY A;  1LKZ A;  2EK6 A;  4QQB A;  2W2Q P;  4PYA A;  4KHM A;  1VRT B;  4QIW D;  3W9J A;  1NB2 A;  3C6T A;  1K1Q A;  2R8H A;  1Y9O A;  2PSZ A;  3CD0 A;  3RBX A;  3MMB A;  3QAT A;  4NXN J;  2O5D A;  1OQ6 A;  3JQJ A;  3ZC4 A;  1HAR A;  3H42 A;  4RNH A;  2O3D A;  2R8G A;  2GC8 A;  1HI1 A;  3M8P B;  2CPD A;  2I0X A;  2HHQ A;  2VG6 B;  4JI2 F;  3CPW R;  4LJM A;  4ZVR B;  2OSR A;  3GR0 A;  3EGN A;  3MCS A;  5KFN A;  1T0T V;  2KT5 A;  2H5I B;  1JLQ B;  1Q79 A;  2UUA J;  3QRR A;  1N33 J;  1YJN S;  1OYD A;  1RT6 B;  3J80 Y;  4RKU C;  3PHT A;  2DT9 A;  4FYD A;  1LWC A;  1CJK A;  1OY6 A;  3R8Y A;  4K4S A;  4EGL A;  2KG0 A;  2HK3 A;  5KFX A;  1N54 B;  3NNC A;  1H0H B;  1FX2 A;  2AD9 A;  2OPS A;  2I6W A;  1PCA A;  3QT8 A;  1TKX B;  1SKW A;  3M8S A;  2WAQ D;  2B5J B;  1Q8K A;  2MLY A;  1IKX B;  4ILR A;  4OYX A;  4OZ0 A;  1U2F A;  1HNZ F;  5CH7 B;  1S59 A;  3CCM S;  2CQD A;  1RWV B;  5B0B A;  4I67 A;  4IG3 B;  4WFN Q;  4C0O C;  2HZV A;  4LSN B;  2Q66 A;  5D8H B;  2KZZ A;  2VG7 A;  2XYH B;  4LT6 A;  4Y00 A;  4DN9 A;  1FWL A;  2FJW A;  3M2U A;  4CCH A;  2GML A;  4UW2 A;  2X1A A;  4N77 A;  3ZZR A;  3NNA A;  2F4V J;  2MDA A;  4DR2 J;  1EJ7 L;  2HWI A;  2NYH A;  1HNI A;  1RAH B;  3R5J B;  3TAR A;  2ZM6 F;  4K4V A;  2K2P A;  2NXJ A;  5KT7 A;  4LF5 F;  3M2V A;  3Q83 A;  1PJ7 A;  2RQM A;  3PAC A;  1TKD A;  3I0R A;  4UOH A;  3BDP A;  1PYO B;  3EMT A;  2YX4 A;  1U6B A;  7AT1 B;  1KVK A;  4CLS A;  1N56 A;  3LA0 A;  4NEZ A;  1F6T A;  4LSZ B;  1X60 A;  3IR6 B;  4I2Q A;  3WQP A;  3PKM A;  2VC1 A;  1QAJ A;  3HZE A;  5L1K A;  4ZCL A;  1FKP A;  1RAI B;  3Q8Q B;  2FVS A;  3PO5 A;  1RLC L;  2X3D A;  3H7H B;  3PVX A;  1G1X A;  4TNO A;  3W2W A;  3MPW A;  1D09 B;  1M5S A;  4K5S A;  4RW7 B;  5D0E A;  4NOH A;  1RWU A;  4NXM F;  3HVR A;  3M6U A;  5KFS A;  3LWL A;  3NCP A;  2KKH A;  4KGV B;  4ZP8 A;  1SJ3 P;  4RLE A;  3QZ7 A;  4ZPD A;  1RU1 A;  3CJS A;  2G13 A;  1G2E A;  1ZTT A;  3D67 A;  2B4O A;  2X3G A;  4F04 B;  2JC1 A;  3A8E A;  1L3U A;  2V50 A;  4HH0 A;  1FD2 A;  1GEH A;  4DWI A;  1NDC A;  1DHM A;  3H25 A;  4JV1 A;  2OHD A;  1OY8 A;  2WON B;  5ETS A;  1GXU A;  3T1Y J;  4H4K A;  1M5H A;  2J0S D;  2VOP A;  1SC4 B;  1Q5V A;  3W2V B;  1T3O A;  3ET6 A;  3IP0 A;  1EIY B;  2Z57 B;  3ZZT A;  2AHO B;  1BC6 A;  4KQZ A;  4ECT A;  3CCL S;  3RYL A;  1NLK L;  2GA7 A;  3JAM Y;  3GFH A;  2GQC A;  4PWU A;  3NLC A;  5GAE U;  1FDB A;  3J7Z 5;  1KOH A;  3U1L A;  1HQ2 A;  4J9V A;  3A1Y G;  4NLR A;  3AB2 B;  3SCJ E;  4ES2 A;  3POT B;  4JI4 F;  4C7Q A;  1MLA A;  4KHP J;  2BJD A;  4ES1 A;  3UPF A;  4X4U A;  3Q8S B;  2BJE A;  1G4C A;  3EXC X;  3IFE A;  2YQ1 A;  4IFY B;  2V4J A;  4ZJQ A;  2ZVI A;  1YG0 A;  2HFS A;  4OZN A;  3U7J A;  2CPE A;  5A6P A;  4NLU A;  3D1O A;  1X9S A;  3HHN B;  1YGY A;  4LR9 A;  4LFC J;  1Y4Z B;  1NSP A;  1QDU B;  2IM3 A;  3RR8 A;  4ZVO B;  3WIU A;  2VV5 A;  4WTO B;  4CO3 A;  4F7V A;  3DYA A;  2HND B;  4OLP A;  2R7R A;  2F1F A;  3DDI A;  1S9G A;  1JK9 B;  2YKA A;  2C2R A;  4ERD A;  3C16 A;  3E8O A;  3DC2 A;  3DRP B;  5IFM A;  3R5B A;  2VBW A;  3UNG C;  1QE1 A;  4DV5 J;  3PKY A;  2PN6 A;  4RNN A;  3A3P B;  3MOZ A;  1NJW A;  4PQU A;  1WEY A;  3MM9 A;  4OYI A;  2DCL A;  4KFB A;  3ITH A;  1QSL A;  3NS7 B;  3VVU A;  1E6Y B;  2BDP A;  4NLG A;  3Q8P B;  3CJ3 A;  1YIT S;  3CF5 Q;  5KG7 A;  2RQK A;  2B9W A;  5B0D A;  3TAM B;  3DI6 A;  2W9B B;  4FF1 A;  2EXU A;  4RW6 A;  2FY1 A;  1DAX A;  1SC3 B;  3BGO P;  2HG4 A;  4ZPT R;  3CCU S;  3GFX A;  3IRX B;  4NZ7 A;  4GO7 X;  4PXC A;  2MZT A;  1IJF B;  3UO0 A;  2OPR A;  2RNE A;  1OQ3 A;  1B99 A;  2P6T A;  3G82 B;  3FEX B;  5HJX A;  3CMQ A;  3QJP A;  2WOM A;  2AEM A;  5DLF A;  1OYE A;  2O66 A;  3H4B A;  3GJQ B;  2FLO A;  4F4X A;  4BC9 A;  4GKJ J;  4IKA A;  4CM0 A;  3QJL A;  3OFG A;  5AE2 A;  1U1R A;  2BR0 A;  3GYN A;  4R5P A;  1RU2 A;  2EBE A;  2M5Y A;  2KN4 A;  2OIH A;  5M2P A;  2WBR A;  3AOA A;  4RWW A;  2W01 A;  2HVE A;  3RB4 A;  2FUG 9;  1ZPW X;  4TQR A;  4OHY A;  5KFO A;  3IM9 A;  4O4G A;  2HK2 A;  2QV6 A;  6FD1 A;  1XR7 A;  1P9Q C;  3SQO P;  1TK8 A;  2GJI A;  1OO0 B;  4WBF A;  3KOA A;  2DNZ A;  3G96 A;  4PG8 A;  5B0F A;  3JSM B;  2ACM A;  2E5L J;  1K47 A;  3S1T A;  5ETN A;  4RNO A;  1V3R A;  1GMU A;  2HNZ A;  2DH7 A;  2IFX A;  3LAM A;  3RG6 A;  1TL1 B;  3SZ2 A;  5DJB A;  4JP8 A;  2HGM A;  1VBZ A;  4QPX A;  5IXU A;  2CIM A;  1JLC B;  2HAI A;  2GVD A;  3AQO A;  1CJU A;  4DSE A;  1IVZ A;  4LSL A;  3J81 U;  1VQK S;  3LAK A;  3EZU A;  4UZB A;  3VAG A;  1RJJ A;  1WTB A;  2YBV A;  1NSQ A;  3N79 A;  3QZ8 A;  3MED B;  4O4R A;  4ED5 A;  3ZTQ A;  4DL3 A;  3OFE A;  2ABY A;  2RDD A;  1WC6 A;  1S0O A;  2DNY A;  2HLT A;  2DRB A;  1CS4 B;  2ZBI A;  1Y5I B;  4KC5 A;  1S7H A;  1Y0H A;  3M9N B;  1FTC A;  3BBC A;  3KNA A;  2DJW A;  1RE1 B;  4DS5 A;  2UU9 J;  3WZ0 A;  3CDA A;  2AZ3 A;  3DLE A;  4CO4 A;  1HA1 A;  2BYC A;  1FWP A;  5KFQ A;  4DQQ A;  4KKO A;  1EKR A;  1YJV A;  4P72 A;  4LFB J;  2E1R A;  1N52 B;  1WOR A;  1UPP A;  2F8M A;  3G2X A;  3BEG B;  3MAH A;  1UTA A;  3WC0 A;  4IUF A;  4L73 A;  3H98 A;  3MMA B;  2PD1 A;  2A3J A;  3OTO F;  3W64 A;  2ZKU A;  1T03 A;  4CZC A;  5HBM B;  2R8K A;  4AL7 A;  1UMJ A;  4ZJO A;  2Z2Z A;  1R7I A;  5HAN A;  4DMZ A;  2DXD A;  3NEK A;  1TAQ A;  1RK8 A;  1RT7 B;  4I64 A;  4O44 A;  1IR0 A;  3R97 A;  3D5M A;  3IR5 B;  1U24 A;  5A8R A;  2AQ4 A;  3OR2 A;  2EBG A;  2W25 A;  2JC0 A;  2LQJ A;  3VWS A;  2FVQ A;  3NOG A;  2YKO A;  5GVQ A;  2VA3 A;  2V67 A;  3NXZ A;  3UD5 A;  3A8J A;  1XNR J;  2BAN B;  2J76 E;  2QA1 A;  2RU9 A;  5D4N A;  5G4D A;  3BZQ A;  4J5O A;  5KFR A;  5G0R A;  4K4X A;  4CLF A;  3O6Q A;  4XDC A;  3NKY A;  4OYZ A;  4OJG A;  4WP9 A;  2DPI A;  2MGZ B;  3M8Q A;  2OI2 A;  3LAL A;  3NCR A;  4DF4 A;  1YJ9 S;  4NLP A;  4DEZ A;  3JYT A;  2PMH A;  3QBC A;  4HDG A;  1H2V Z;  2GZO A;  1UZH A;  2QLF B;  1IKW A;  1TQL A;  1WG5 A;  3DLL Q;  3O44 A;  3AJ2 A;  2KI2 A;  1O51 A;  1XN9 A;  5DZ7 A;  2F7V A;  2DGT A;  2H5E A;  2E1A A;  2AX1 A;  3DXB A;  3HFZ B;  4OZJ A;  1HR0 F;  1CPZ A;  1FEE A;  2EEY A;  3A3N B;  3AFG A;  4J9S A;  1S99 A;  3K0J A;  4NLW A;  2CFX A;  2ZUG A;  1REV B;  4UZC A;  3MMC A;  3ZZP A;  4ZCM A;  2VIC A;  2GQQ A;  2FGO A;  2BBE A;  1VQM S;  5K14 A;  3LP0 B;  9RUB A;  3VAJ A;  4C4W A;  4FVC A;  4LIR A;  1HW8 A;  3OL6 A;  3BQ1 A;  1FO1 A;  3N6M A;  3UD4 P;  3P3D A;  1RA6 A;  5HLF B;  5DM7 Q;  3GR1 A;  2KT2 A;  4LBI A;  3ZXW A;  3TYT A;  1ZTW A;  4NMX A;  5LSO A;  1JXV A;  1PAU B;  4WXO A;  2YKN B;  5DGA A;  1UEK A;  3Q23 A;  3DU6 A;  1B7Y B;  4Q2L A;  3JTP A;  2OPQ B;  2HIQ A;  1WTF A;  3IWN C;  5KG0 A;  3H59 A;  2RDJ A;  5A8W A;  3V2U C;  2UUC F;  3AT1 B;  3K5O A;  5A76 A;  1FFS B;  5E2Q A;  2B4U A;  1UWB B;  4EO6 A;  2XSJ A;  4X4R A;  5BYQ A;  1FRK A;  2B8Q A;  2AJ1 A;  4NLY A;  2MY7 A;  1FJ7 A;  2WHO A;  4P2F A;  1U26 A;  5JXS A;  5A2Q Y;  2ZH9 A;  4DV6 F;  2KT3 A;  2VOO A;  1CEZ A;  2CJX B;  3QIP A;  4OIX A;  2RUG A;  1S72 S;  3TQE A;  3IAM 9;  3KDO A;  5L9N A;  5ETP A;  2HPU A;  4DQI A;  3K2Y A;  4MIB A;  1H7W A;  2H5J B;  4XK8 C;  2NXC A;  2HHH J;  1R8A A;  2A0F B;  5EUH A;  4ZDN A;  1WI6 A;  4OHZ A;  4HTI A;  4FYX B;  4QWC A;  1NCL A;  5IS2 A;  2DNO A;  2MQ8 A;  2MKC A;  4U7U D;  2JLF A;  5K8O A;  1JLE A;  4PWW A;  3MAA B;  3DMJ B;  2M70 A;  4PXB A;  2RIL A;  2RVJ A;  2QA4 S;  4LMZ A;  4MFB A;  3GYG A;  2L3M A;  2QL7 B;  4A8X A;  3M8Z A;  1YSJ A;  1V9O A;  4EYI B;  1NK0 A;  4KV8 B;  4K2X A;  3JTN A;  2CQ4 A;  4WF9 Q;  2RU3 A;  3PR4 A;  4BC7 A;  3VZH A;  3L09 A;  3AD7 C;  1XC9 A;  3DHW C;  1YJU A;  4RJV A;  5KT4 A;  4OX8 A;  2PGC A;  1UVI A;  2R7V A;  3R1L A;  5DLG A;  1HNW J;  1IBM J;  1UVJ A;  2N82 B;  2EG2 A;  5MAO A;  1K9M T;  2XY6 A;  4NLV A;  1KHV A;  3J81 j;  4O3N A;  2DVI A;  1XMO F;  1RHU B;  4NA2 A;  1YKW A;  4L6V 3;  3I4H X;  4C8O A;  3OT9 A;  2ZFH A;  4QR2 A;  3H5S A;  2D9O A;  2IJN A;  2CG8 A;  1JLA A;  2UZA A;  5ETT A;  5E33 A;  3AXK A;  4FYY B;  3BO4 A;  3MM8 A;  1M1H A;  2P9G A;  3BH7 B;  2QT7 A;  1FES A;  3KJV B;  5L46 A;  2CWK A;  3ILO A;  3EPG A;  5DZ6 A;  3UDV A;  1NND A;  2H65 B;  3KWM A;  3WHI A;  2XHC A;  4NAS A;  5A8K B;  1DTT A;  3M05 A;  2WW4 A;  5KFP A;  3DOK B;  2V63 A;  2BM1 A;  1HBO B;  2DR6 A;  4EI2 A;  2VG5 B;  2YNG B;  4G65 A;  2CG4 A;  1F5A A;  2JRS A;  3MPY A;  2FIU A;  2WK4 A;  2R2U A;  1S1W B;  1RTZ A;  5F41 A;  4KYZ A;  3T5H A;  3I55 S;  2V8V A;  1S6P A;  3FCW A;  1PSD A;  4C2M A;  3M2R B;  4K2J A;  4DL4 A;  3I6P A;  3TA2 A;  4DU7 A;  1N4L A;  1KN6 A;  3FSI A;  3UVJ A;  1R8C A;  4OFZ A;  1XBW A;  3EVO A;  4QR1 A;  4IDK B;  1R43 A;  2AGP A;  1AZS B;  3MR3 A;  3L7P A;  1TL7 B;  1JIH A;  3THV A;  1HWJ A;  5F9L A;  3FFI A;  1LW0 B;  4IQM A;  1X4D A;  3CED A;  1FTR A;  3QYY A;  1FRJ A;  4MK8 A;  4ETX A;  3LGN A;  5HMY A;  2ZHO A;  2YQ0 A;  1SPB P;  3RRK A;  1QY7 A;  1L3K A;  3BGL A;  3SCI E;  4BWJ A;  4XO0 A;  1U1O A;  3MPD A;  4JI2 J;  3PYE A;  3K5M A;  4G1P A;  2FLL A;  1VQ7 S;  4OZ3 A;  2DNN A;  2C42 A;  4AT1 B;  2XGP A;  4CO5 A;  1RHR B;  3D66 A;  3E51 A;  3PFO A;  3MHY A;  2XUL A;  3UR3 C;  3LOU A;  1S6U A;  2FTR A;  4Q8F A;  1SV5 B;  2HVZ A;  2ZD1 A;  3M6W A;  4FPR A;  2JH3 A;  2HSE B;  2DGO A;  4I4B A;  2KO1 A;  5D4O A;  2IMW P;  2OFH X;  3KG4 A;  1S79 A;  4F36 A;  4ZMM A;  4AQY F;  1SKR A;  4DR3 J;  4A8W A;  4DCJ B;  4K59 A;  4IG0 B;  1DAR A;  2N4D A;  1TL4 A;  1TV6 A;  4P2X A;  4DX5 A;  4F67 A;  2HQD A;  3IWL A;  2GFF A;  5DG8 A;  1Q81 T;  4C3M A;  2PI5 A;  2AZ1 A;  3BO3 A;  4CWB A;  5CHC B;  3ADA C;  2R7X A;  1GT8 A;  1WEZ A;  1HNZ J;  4L74 A;  1TFW A;  4KTQ A;  2GMH A;  2KFZ A;  1K0V A;  2NZ4 A;  3IAS 9;  1YZ7 A;  2Y8Y A;  3KJF B;  2HRY A;  3HSD A;  3KUE A;  4LVO P;  3FBE A;  4HEA 9;  1S1V B;  4B9N A;  4DV3 F;  1CUL A;  2IA6 A;  3UNY A;  3I31 A;  4FP9 A;  1R0C B;  1KD1 T;  1FJG J;  1G6B A;  1NJZ A;  1BQM B;  5FDL A;  4MIW A;  2QFJ A;  2YVS A;  4PG5 A;  1RTJ B;  4DFJ A;  2OP5 A;  2QRR A;  1FA0 A;  4M8L A;  3TUZ C;  1FFG B;  4ED0 A;  5D0G A;  4LF5 J;  4IOC Q;  2FYX A;  5HVH A;  3Q2S C;  2BQ3 A;  4AL6 A;  1RWM B;  1GFW B;  2HFU A;  4ED7 A;  5IC6 B;  1NDK A;  2XHW A;  1TK0 A;  4P2M A;  3KLH A;  4QWA A;  4ZVG A;  3RB3 A;  3I0S B;  2ROE A;  4EEY A;  3CT9 A;  3CD7 A;  2IAJ B;  3EDQ B;  4C9D A;  1XR5 A;  1NHV A;  3MXH P;  3DLB A;  2RUS A;  3KMS A;  3HLU A;  5HQM A;  1C0T B;  4J9M A;  1QAI A;  1HBU A;  3S7R A;  4UOG A;  4HDH A;  3J7Y I;  3ICL A;  3U27 A;  1N5V A;  4ZPV R;  1GXL A;  3WIV A;  1T7P A;  2VIH A;  2FHO B;  4NXM J;  2YNF B;  1GMW D;  3MI7 X;  3DGV A;  4MKY A;  1TUV A;  1NZA A;  4AND A;  4DV2 F;  3FVY A;  2M7S A;  4S0M A;  1T94 A;  3TZW A;  3G6E S;  2ZOF A;  5HP1 A;  3OPK A;  3UN3 A;  4RNM A;  4UUX A;  2DH9 A;  2R2S A;  2H4Y B;  3KLF A;  3M30 B;  2FPH X;  4KT0 C;  2ASY A;  4G1Q A;  4RUH A;  4OYA A;  4LF4 J;  2O67 A;  4I6A A;  1SJR A;  1PAE X;  2EW9 A;  4J9N A;  1YZ6 A;  1FXD A;  1M90 T;  1QTN B;  3OUY B;  4USJ C;  1D9A A;  4MYU A;  4RW9 A;  3BGR A;  4PYD A;  2DCU B;  5I3U A;  3I9V 9;  1HPZ A;  5T7L A;  5FD1 A;  4KO0 B;  1XER A;  2K06 A;  3D0I E;  4JI4 J;  2F8E X;  1LWE B;  5KFD A;  2XYP B;  1DTQ A;  1T8E A;  4N41 A;  4RL1 A;  2V2Q A;  4OHW A;  4Q2M A;  2OD6 A;  5J2M A;  1QSS A;  4LFA J;  4Z7C A;  4JV5 F;  1RAD B;  4MMO A;  3LPY A;  3S6E A;  4Q0B A;  3TJ9 A;  5K8P A;  1DY3 A;  2XY5 A;  1RT3 A;  4QBU A;  5KOX A;  2J6T A;  2MZJ A;  1J5O A;  2LDI A;  3DDN A;  3EIC A;  1SBR A;  5CYQ B;  1KHW A;  1GQE A;  5L38 A;  1F0X A;  4C8L A;  5GAH I;  2IVF B;  3W9H A;  4MK7 A;  3IGN A;  2DRD A;  3RBZ A;  4HLB A;  2DIS A;  3G4S S;  4NZ6 A;  4URG A;  2V8H A;  1OSD A;  2IJF A;  2QFI A;  4M5G A;  1CJV B;  1OMS A;  1SJ4 P;  1FXR A;  1H2U X;  1S6O A;  4A46 A;  4MH8 A;  2B7B B;  3P5T L;  1C1C A;  3R7B B;  3TZZ A;  1IR1 A;  2BE9 B;  3VAF A;  4Y2A A;  1HHT P;  1MWZ A;  3IC1 A;  2M9K A;  4M5K A;  4WK3 A;  2C1E B;  2YX7 A;  3D6F B;  4DZ6 A;  3C19 A;  3OV7 A;  1JWW A;  1MRO B;  3KUG A;  3CME S;  4F3O A;  3CVK A;  3CUN A;  3OD2 A;  1FD8 A;  4DQP A;  3QJJ A;  2XI3 A;  1HQU B;  3W7B A;  3DU5 A;  3RAQ A;  4PXE A;  5KFT A;  1WKJ A;  3KK3 B;  1RTH A;  2YWE A;  3ILI A;  4WE1 A;  3IM8 A;  4DXL A;  2LVW A;  3CJ8 A;  5F8I A;  1NB7 A;  5C24 A;  3T5K A;  1H38 A;  4X65 F;  3HHL B;  1KS2 A;  4JYA F;  3M8Y A;  2QEX S;  4J90 A;  3NWG A;  4KH0 B;  4QPT A;  2HHP A;  2L41 A;  1GX5 A;  4ECU A;  2NXU A;  2D9P A;  4OV1 A;  4BDP A;  2ZJP Q;  4F3M A;  2QLW A;  3HJF A;  3GE9 A;  1U1N A;  2J7K A;  3C6T B;  2VFT A;  3GJS B;  2MLX A;  3D28 A;  1LK7 A;  2DNG A;  1Z2L A;  3MMB B;  5CQG A;  2RE1 A;  2EKN A;  2WVC A;  2E1P A;  1RZM A;  1WSV A;  3SDE A;  4FYV B;  4OMF G;  5C42 B;  2IMO A;  1JLF A;  3HCX A;  3I9Z A;  2G1H A;  2HFO A;  1RHQ B;  1S48 A;  2XS7 A;  1KQS R;  4K4T A;  4KGM A;  5J2N A;  3KNG A;  5CXT A;  1H6K X;  2UUB F;  3EVM A;  4DUZ F;  3K5P A;  2MMY A;  2L08 A;  3NG8 A;  3H2L A;  2LFV A;  3HF5 A;  5BXI A;  2RT3 A;  4KH1 B;  5HO4 A;  2EFQ A;  1LWC B;  1CJK B;  1QUP A;  1UA1 A;  2FHJ D;  1U48 A;  1ULR A;  3LH2 S;  3CUL A;  2NSC A;  1XQI A;  1WEX A;  3TUI C;  3OTC A;  2OPS B;  4OJ1 A;  4CQ1 A;  3RUB L;  1FE4 A;  4DR5 J;  1JX4 A;  5C25 A;  4F4A A;  3QT6 A;  2KZM A;  2GW8 A;  8RUC A;  4WU3 A;  2DYA A;  2X51 A;  4W4M A;  2YWW A;  4OZL A;  2COL A;  4B9M A;  3PM9 A;  3MFH A;  4U96 A;  4KY3 A;  1HMV A;  1RHK B;  2HW3 A;  1AFI A;  1PYS B;  1UL3 A;  3K7R A;  2FDN A;  3KLG A;  2JNJ A;  3ZTR A;  5B0A A;  3BBF A;  3AOD A;  3A8K A;  2FHM A;  1VK3 A;  1IWA A;  2DKO B;  2VG7 B;  3QRQ A;  3M8W A;  4B3T J;  1RT1 A;  2D74 B;  1PC4 A;  3M2U B;  1KWM A;  2XZT B;  3F44 A;  3M1V A;  2HS0 A;  1Q8L A;  3FBF A;  2WSE C;  1HNI B;  1PKU A;  1MML A;  2MTL A;  4EBE A;  1RT2 A;  3HFK A;  2VFR A;  2ZNZ A;  5KFV A;  1XMQ F;  5E7O B;  2AW0 A;  1CC7 A;  1ROF A;  2R8J A;  1W25 A;  3R7N B;  3M2V B;  4NLO A;  3M8P A;  4YQW A;  4M5H A;  3I0R B;  5DQI A;  4U8Y A;  1U0S A;  1BGX T;  3J80 U;  2CWX A;  1W2I A;  2ZH3 A;  3LP1 A;  4OYB A;  3O2I A;  4QR0 A;  3NGK A;  5HQL A;  4F50 A;  3BN7 A;  5D15 A;  4LRC A;  4PPD A;  1ZET A;  4I2Q B;  3KKF A;  2NUU G;  2IHR 1;  5KFL A;  2XGQ A;  1IKY A;  3Q8V A;  1N8R T;  1ZM3 A;  3KFW X;  4YDD B;  4EUV A;  2YH1 A;  4OYP A;  2QO3 A;  1BMQ B;  4NWB A;  3W2W B;  3KLE A;  5A0Y B;  4MKB A;  3EZO A;  1IQT A;  1PBU A;  3TJ8 A;  5F3Z A;  4DSL A;  3QO9 B;  1CVJ A;  2IPO B;  2CPH A;  2CQ0 A;  3DLJ A;  1IKX A;  4YR0 A;  3MM5 A;  5HRO A;  3D3B J;  1VBK A;  2KHD A;  1TP7 A;  2DHH A;  2ZC4 A;  3AOB A;  2UVV A;  2WTF A;  2MHN A;  2OPP A;  3RW6 A;  4C11 A;  4DN0 A;  2Q3P A;  1RGV A;  5ETV A;  1RKJ A;  3P8B B;  3Q8Y A;  1PGZ A;  3PO4 A;  3C6U A;  3MUV P;  3EVW A;  2DO4 A;  3ET6 B;  2I1R A;  4ZA1 A;  1Y11 A;  2CQP A;  1U1L A;  2CQG A;  3CCV S;  2MKS A;  2UUC J;  3W5Y A;  3A3O B;  5LJ3 Y;  2HGN A;  3ENQ A;  3K58 A;  5KFI A;  4C8M A;  3SFU A;  2BX6 A;  2CNL B;  4LUB A;  3DNC A;  4LRE A;  3C14 A;  2QMX A;  4CYU A;  2MLZ A;  5KFH A;  2XCA A;  1T9T A;  3Q8R B;  2V4J B;  3PIO Q;  2Y1J A;  1R0B G;  4BWM A;  1Y5N B;  3D54 A;  4QYR A;  1RT4 A;  2Z2M A;  5LXY A;  4B3R F;  3RW7 A;  2DGQ A;  1ZA2 B;  5DET A;  3OXG A;  2HHV A;  4Q45 A;  1P6T A;  3CWJ A;  3DYA B;  1U7L A;  3TA0 A;  1S9G B;  5D0H A;  2QYC A;  1TU0 B;  3C16 B;  1SXL A;  1X4B A;  4HR2 A;  4XPE A;  2HGL A;  4USU A;  1QE1 B;  1EB0 A;  2J6S A;  4B3S F;  1SKU B;  4PQU B;  3GG0 A;  5LL6 d;  2BXJ A;  2R2T A;  2OSQ A;  1C4A A;  4KFB B;  3ITH B;  1FT8 A;  1UVK A;  4DUT A;  3M6V A;  3GJT B;  3L7O A;  1N88 A;  3P96 A;  1XMB A;  4ED3 A;  4GC7 A;  4PKD B;  1NK5 A;  2J9C A;  2HRT A;  4M5M A;  4RW6 B;  4M95 A;  4FF3 A;  3D0H E;  3G71 S;  2IDE A;  4A4J A;  4LF7 F;  4NYZ A;  5BR8 J;  1IN0 A;  2G1D A;  3OL7 A;  3EPI A;  3JAM U;  4NRT A;  2OPR B;  2Q6C A;  4HL9 A;  2EC2 A;  4UQG A;  2WOM B;  3TP2 A;  4F4W A;  2EC0 A;  1RAG B;  1XWL A;  2ROP A;  2VBY A;  3KHG A;  5CCL A;  2K3K A;  3QWP A;  1GNK A;  4ETZ A;  1SC6 A;  2ZIT A;  1T9X A;  4DR6 F;  1XMO J;  5HL7 Q;  4R5P B;  1X7V A;  3WX4 A;  3PYG A;  2FB0 A;  3VVT A;  1RLD A;  2PFF B;  3TX8 A;  3G8T A;  3CW2 C;  3PR5 B;  3D9B A;  4WZM A;  4O3P A;  3QMQ A;  3W5X A;  3OLB A;  2IC3 A;  2KM8 B;  1IBL F;  3OHA A;  1N0U A;  2LYV A;  4O4G B;  4NCA A;  4A8Y A;  1B64 A;  5EGY A;  2XMT A;  2OO4 A;  2FQQ B;  4J9Q A;  2ZOM A;  5HN0 A;  2IVY A;  4A8S A;  3H20 A;  1GK8 A;  1VC6 A;  2YQ3 A;  2GIR A;  1RBA A;  3LPE A;  1UA0 A;  4ED4 A;  2MZ1 A;  4Q5V A;  2HFN A;  3O5T B;  2HNZ B;  1B0P A;  3D6M B;  2DB1 A;  2CNN B;  3CJ0 A;  2HYI B;  5F0U A;  5FJ4 A;  1HHQ A;  3FKB A;  4KB7 A;  2WBM A;  3QGP A;  2GVD B;  4EU0 A;  1CJU B;  4J9P A;  2E5I A;  1UWA A;  4LF9 F;  1MSW D;  3GWC A;  3LO3 A;  2K7K A;  1P1L A;  4JI6 F;  3B8H A;  1Q16 B;  1KTQ A;  2VFV A;  1K73 T;  3KG0 A;  3TR5 A;  2ZH4 A;  2ASJ A;  1GX6 A;  5BJR A;  3H40 A;  3QRP A;  1UCN A;  5E3A A;  3MEK A;  3WC2 A;  4DLG A;  2UVU A;  3SBM A;  4EBD A;  2Z56 B;  3DLK A;  5DRK A;  5E3R A;  2W2O P;  2WSC C;  3A8I A;  4ICL A;  4NZ0 A;  4JUZ A;  1Z1Z A;  2EFO A;  3MEG A;  1LXN A;  3UN5 A;  4EMD A;  3G8Q A;  2BVZ A;  1WF0 A;  2RML A;  5KFJ A;  2A2C A;  2CPJ A;  1TZ0 A;  4ZIT A;  2HHX A;  3QNW B;  3Q0A A;  1VC0 A;  3C66 A;  4V19 X;  3DLE B;  5KFF A;  1PG5 B;  2G2O A;  5DG7 A;  1U2R A;  3LAN A;  1N0V C;  2IIH A;  4KKO B;  3SQG A;  3TWZ A;  2VBX A;  5CZV A;  2Y0S D;  1G7C B;  2XTJ P;  4M5I A;  1G3O A;  3SV4 A;  3JTO A;  2LEC A;  3Q22 A;  3DFE A;  1SQG A;  2BRK A;  2PMW A;  5ETQ A;  4IH7 A;  2ALY B;  4GO5 X;  2WB4 A;  3QLH A;  2RQC A;  1T03 B;  4JBC A;  1FNM A;  3FDS A;  2W8L A;  3ZTO A;  1VBX A;  2XMA A;  4K50 A;  2ZE2 B;  3NBP A;  2CPY A;  1CLF A;  4K4W A;  2VD3 A;  3UFC X;  5KG1 A;  1HNX J;  4QU7 A;  4O44 B;  4DQS A;  3I56 S;  2WVF A;  3CD5 A;  5A8R B;  1HW9 A;  1X9M A;  1MNE A;  2ZC3 A;  3D1H A;  4ILM A;  2GNK A;  1RT5 A;  3KG1 A;  2DR9 A;  4JV2 A;  4I69 A;  1REG X;  3LGM A;  1S1X A;  1T95 A;  1TL1 A;  5HSP A;  4FXD A;  2JVO A;  4DLE A;  1TUW A;  4R8U A;  4Q8E A;  4QIG A;  2W7O A;  2UUA F;  5G0R B;  1LWX A;  2BUN A;  4JI8 J;  3M7V A;  2PA8 D;  2F5G A;  3T3F A;  1GTH A;  1DJ0 A;  3GYX B;  1FDA A;  4WJB A;  3M8Q B;  4TVA B;  4NA3 A;  5IQ6 A;  4USW A;  1U49 A;  3KLV A;  1RAC B;  3MED A;  1S77 D;  2DK2 A;  2G0C A;  2QGF B;  3KJN B;  4QWE A;  4YY3 J;  1MMN A;  3BB5 A;  1I3O B;  1LWF A;  3AJ1 A;  3QT7 A;  2FC9 A;  4OI1 A;  4EBC A;  3CO0 P;  5U47 A;  3W66 A;  3F41 A;  2WRM A;  1URR A;  1VQL S;  1W2B R;  3CCT A;  1M5P C;  3CJK B;  2W24 A;  1C1B A;  5KFE A;  2DEJ A;  1ZAX A;  4MIA A;  3CIM A;  4K4U A;  5J2Q A;  4H4O A;  3CIZ A;  4DJB A;  3ETM A;  3AHP A;  1CG2 A;  2Y9H A;  2CZ4 A;  2C2D A;  2R7Q A;  1WSR A;  5EHH A;  4QOT A;  3BSA A;  3FMW A;  3CJQ A;  4Y0F A;  2ROG A;  1Y10 A;  2PT0 A;  4OI2 A;  3TW0 A;  4DUY J;  4PUO A;  2RAQ A;  2UXD F;  1OJ4 A;  2U1A A;  4OQJ A;  5HAT A;  2E1C A;  3BM7 A;  4WWS A;  5IOL A;  5MLC V;  4AE5 A;  2L48 A;  4AYB D;  1PIE A;  1RTI A;  3LWM A;  4RUB A;  3VHQ A;  1S0M A;  2F4V F;  2RS2 A;  1D0E A;  4DR2 F;  5LJ5 Y;  3ILJ A;  3CJ4 A;  4C98 A;  4DL2 A;  4JI5 J;  5A8W B;  3CCJ S;  3NMA A;  1WC5 A;  4IFV A;  4KPY A;  1VQP S;  2MKK A;  3CD6 S;  1A7G E;  1UJ5 A;  1I51 B;  4FNH A;  2P9C A;  2XSJ B;  2YNH A;  1YBT A;  3TEH B;  1UFW A;  4JI3 F;  4I7F B;  4URS A;  2IA0 A;  1JXL A;  5LMU J;  3WBZ A;  4X62 F;  1OSC A;  2B0G A;  2YTC A;  2BAN A;  3V6D A;  3DXS X;  3DRY A;  5F8M A;  4ECX A;  3QIP B;  1TMM A;  4DV2 J;  2CJ9 A;  2HNY A;  2FLN A;  1X4C A;  1EET A;  1ELO A;  1S4E A;  3R6L B;  2E9Z A;  4IR1 A;  2LQ5 A;  2XNQ A;  3PYF A;  5T14 A;  1YI2 S;  2C28 A;  4F0M A;  1PIL A;  4H4M A;  5SZT A;  2J5A A;  2VKR A;  5HVG A;  4GRS A;  2HZC A;  1TVR A;  1SJF A;  2WW8 A;  1TKT A;  1PJ6 A;  2FY8 A;  2HHS A;  4M5J A;  4TY9 A;  3GP9 A;  1M5V C;  2W2M P;  3I82 A;  2AYE A;  2QN6 B;  2Z8Q A;  1KTV A;  1JLE B;  1KQF B;  2W9C A;  4BS2 A;  4DL6 A;  3QAU A;  4YN3 B;  3MR6 A;  4ES3 A;  4DG1 A;  4WCE Q;  4MFB B;  2G2Z A;  4ZN3 A;  1X5T A;  3H5Y A;  1F2H A;  2CQI A;  3D2W A;  4O3Q A;  2VZ9 A;  4IOA Q;  3K5L A;  2PA3 A;  4DF8 A;  4NRU A;  3H90 A;  4QIV A;  3U1N A;  2OJ3 A;  1HWU A;  3SSR A;  3MAQ A;  1UVM A;  4JV5 J;  3BGF A;  2AGO A;  3PJX A;  4CO2 A;  2GVZ A;  2VON A;  3ETO A;  2KYZ A;  4F2R A;  2G0I A;  3BYP A;  2AGQ A;  5IT9 Y;  2XLI A;  2XNR A;  5KFG A;  2HBQ B;  2VF3 A;  3QWU A;  3MZI A;  2OPQ A;  2XI2 A;  2RDI A;  5AJ3 F;  2GAG C;  3RB0 A;  2VL1 A;  4PAB A;  3P45 B;  2LU2 A;  1BE4 A;  2R7S A;  4ER8 A;  2IYG A;  2ZOG A;  3KLI A;  3R1H A;  3QSY B;  3FSX A;  4PZV A;  2GGP A;  5J1E A;  2FVC A;  4KHP F;  5A2Q U;  3OHB A;  3J7A 1;  2AIR B;  4WP8 A;  3BQ0 A;  2LXI A;  2W4D A;  1NSA A;  2NCK L;  1KOO A;  2ZBC A;  2WZ1 A;  3GTY X;  2Z2Y B;  3MGJ A;  4UF4 A;  2QG9 B;  2QA4 G;  1JLA B;  4CLT A;  2G0J A;  2GJ2 A;  1Q78 A;  2KJW A;  4X2B A;  1Y5L B;  4LFC F;  2DRA A;  4U67 Q;  4ECW A;  2ZHB A;  3MM8 B;  5GAD I;  3AJD A;  3OSN A;  1S9F A;  5EWF A;  4YS2 A;  2DNM A;  2YWK A;  1ICE B;  1VRU A;  3HHE A;  1HWK A;  5IZH A;  1RKI A;  4LVN P;  7FDR A;  4B9T A;  2CKW A;  1DTT B;  4RW8 A;  1Q86 T;  2UXB J;  4DV5 F;  3OTE A;  3MAA A;  1U09 A;  3TA1 A;  1W7W A;  3K17 A;  3JSY A;  1SKS A;  2J0Q D;  4ZPC A;  4LF2 A;  4RZR A;  2QIF A;  3NMR A;  4X65 J;  4ZN1 A;  1NAQ A;  4CT8 A;  4C0B A;  3TRG A;  3HKW A;  2XMJ A;  4GVB A;  3UVJ B;  1LFP A;  2CZ9 A;  1VC5 A;  1Y00 A;  5CYM A;  2DNL A;  1JLB A;  2O01 C;  1MWY A;  2VJV A;  3EM1 A;  4CNZ A;  3HHL C;  3OR1 B;  2IM1 A;  3FFI B;  1WJ9 A;  5F9N A;  2XMM A;  4L72 B;  2C22 A;  2Y0B B;  2V9K A;  1HIY A;  4BHQ A;  4GKJ F;  5HMW A;  1YIJ S;  4ZJL A;  2RF2 A;  5SUH A;  4J9O A;  4P71 A;  1FKO A;  1S1T B;  3OFH A;  4DSK A;  5EX3 A;  1NKE A;  2DY9 A;  3BRE A;  4MYT A;  2L9N A;  1S97 A;  4E2F B;  4JB8 B;  1RWN B;  2ATC B;  2HFV A;  1FRH A;  5DGB A;  4OI0 A;  3PZP A;  3I5C A;  2CJB A;  2POK A;  2B9X A;  3MEE B;  1FRI A;  2UUB J;  3GCW P;  3ONQ A;  1LEO A;  1MMD A;  2XMV A;  4WPA A;  4ANE A;  3J7Y U;  2BQU A;  1N5Y A;  4OYM A;  4JI7 J;  2AEF A;  3T9Z A;  4V19 J;  1TKZ A;  2ZD1 B;  3VGS A;  4DPW A;  3CGI A;  3ULH A;  2ZJR Q;  5AXK A;  2E5L F;  3PXG a;  2BJ9 A;  4TXS A;  2UUT A;  1ITP A;  2JZ5 A;  3OW2 R;  4CH7 A;  3CNQ P;  2NLW A;  3CCQ S;  4ZVE A;  4YFU A;  2K7J A;  4OX9 F;  4FBU A;  4I6W A;  1TV6 B;  5DO2 A;  1SJQ A;  3UI3 A;  3L9Z A;  5EDW A;  3LUY A;  2XEX A;  4DS4 A;  1I1G A;  4ZP7 A;  1ZPV A;  1YWX A;  4QWD A;  4WTY A;  3ZFV A;  5J1P A;  4L75 A;  3QSI A;  4DSJ A;  2D41 A;  3IBF B;  1RQ0 A;  3IG1 B;  1S7I A;  3HSJ A;  4WFX A;  4PPZ A;  2VDH A;  3V4I B;  2EWH A;  1CUL B;  4B9V A;  2BOA A;  4CM2 A;  2CJQ A;  1RAO A;  3CB4 A;  1VQS A;  4NLS A;  3DCA A;  2EFP A;  1R89 A;  5AT1 B;  2QL5 B;  1RAE B;  1HHS A;  2BEF A;  2ZBR A;  3BDE A;  5K5M A;  1TUG B;  5FDL B;  4DCP B;  1U25 A;  3KK2 A;  1R6Y A;  2GO8 A;  1RSC A;  4YOE A;  4DI6 A;  1VQ9 S;  2W4C A;  3GLJ A;  3BBB A;  9ATC B;  2CPF A;  4YHH J;  2CQ1 A;  4YUD A;  2B3T B;  5KFA A;  4B02 A;  4NX9 A;  3RRH A;  2HVD A;  5GAH U;  1CJT A;  3MCO A;  3CDU A;  4LR8 A;  3MM6 A;  3KLH B;  1HI8 A;  2KXH A;  1WHX A;  2KG1 A;  3HD2 A;  2FD2 A;  1IBK J;  4OLO A;  4F25 A;  1Q0N A;  3OXF A;  2FZG B;  3CCE S;  1KVI A;  4XAK A;  3VGU A;  3N4W A;  2FJB B;  4EO8 A;  2O1P A;  3BSC A;  4Q44 A;  1MU2 A;  4A8K A;  3EDR B;  3WX8 A;  5M2U A;  1HBU B;  3TJA A;  3HHL D;  4GC6 A;  4ZKA A;  4IG0 A;  1P9Y A;  3BH6 B;  5KFM A;  1RHM B;  4EYH B;  2C2K B;  2FJE B;  2FHK A;  5H9E J;  1Q7L B;  4IH6 A;  5IM0 A;  3BQ2 A;  1XNR F;  4B9U A;  4DPU A;  4TU9 A;  5E3P A;  2W4P A;  2AP6 A;  1Y3J A;  1V6H A;  2DIV A;  3NOC A;  3O1L A;  1XTZ A;  4P2S A;  3EGW B;  4ZVS B;  2V6A A;  2VDI A;  4M5D A;  3D6H B;  4G6V B;  5M2R A;  4AFF A;  1VJQ A;  1U8W A;  5HP1 B;  2JEI A;  4NPO A;  2HRU A;  3B78 A;  4DL5 A;  4CH0 S;  3KLF B;  5LOQ A;  3JQK A;  5B09 A;  4G1Q B;  5CYJ A;  3G6X A;  1HYS A;  2FC8 A;  1C0U A;  4USH A;  3L4B C;  4MTP A;  4J37 A;  3NAH A;  2LEP A;  3SI8 A;  2LXF A;  1BQM A;  3O3L A;  3W60 A;  4RW9 B;  3FCH A;  3BGR B;  4YDX A;  2MKY A;  1RCX B;  1RTJ A;  1ARO P;  1R8B A;  1VHI A;  3CDE A;  1HPZ B;  5T7L B;  4ELU A;  1AUS L;  2V4R A;  2OUG A;  2ZH7 A;  1JXE A;  2D7S A;  1UEV A;  4H4K C;  1URN A;  2J0X A;  1DTQ B;  3THP A;  1YVF A;  1N5S A;  4PEO A;  5J2M B;  5H9E K;  2BE7 D;  2ADB A;  1BWV A;  3O8W A;  1YDL A;  3V81 A;  5KFC A;  4Q0B B;  4U8V A;  1RAJ A;  3VAL A;  1RT3 B;  4DHV A;  4CLY A;  4U7C A;  1J5O B;  3T1A A;  2GHP A;  1HL6 A;  3MEC B;  2YH0 A;  1RAB B;  1AYE A;  1M5O C;  2HVI A;  2F4F A;  2FZK B;  4JI1 J;  4LRF A;  3GV8 B;  2PEH A;  3M32 A;  1FHT A;  3M6X A;  1C0T A;  1DQ9 A;  1U6F A;  4HT5 A;  3PW7 A;  3G86 A;  4R25 A;  2FJX A;  4ID8 A;  4LF8 J;  2DO0 A;  1NU4 A;  1H2T Z;  2JOQ A;  1X31 C;  4ECS A;  4WXW A;  2B43 A;  2VHG A;  3SEO A;  2QC3 A;  2YNF A;  4CLZ A;  2Z30 B;  2DNR A;  3D6T B;  1C1C B;  4FXW A;  4DV1 J;  2LMI A;  2VC0 A;  2E1M C;  3DOL A;  1Y7P A;  2B9Y A;  1S9E A;  3NGU A;  4LRD A;  1J5E F;  1S1U A;  2DIT A;  3ZTP A;  4N7T A;  1JKH A;  3CCS S;  2MJU A;  2R8I A;  1YRU A;  3CCZ A;  1LFW A;  1D8Y A;  1IUJ A;  1WUU A;  1HNV A;  4FS1 A;  2HHH F;  3M9M B;  2HZA A;  2DBB A;  5DS7 A;  4AL5 A;  3EJM A;  1F60 B;  4F4K A;  5K9F A;  4DV4 F;  1MN9 A;  2DH8 A;  3IBC B;  2AJF E;  4RW4 A;  2H4W B;  3K57 A;  3VAK A;  3EZ5 A;  1XNQ J;  2D1C A;  1TEL A;  2UXC J;  3FUY A;  1RTH B;  3AA8 A;  3HM9 A;  5E3C A;  4WE1 B;  3X3U A;  4PAA A;  1CC8 A;  5C24 B;  2RH3 A;  1FK9 A;  4NCG A;  3E01 A;  4UQT A;  5LT5 A;  4DR1 J;  5ETK A;  1D8Z A;  4DR6 J;  3UQS A;  5KT6 A;  1JLG A;  1B0V A;  2WCX A;  3KMQ A;  4J9K A;  3TO8 A;  5I3Q A;  1NJY A;  4B17 A;  2DXF A;  2JVR A;  4DSF A;  1KRP A;  1KVJ A;  1F9H A;  1N32 J;  4H54 A;  3R5D A;  3DRX A;  4TLR A;  2EKY A;  1I5O B;  2YNI A;  4F4Z A;  4KIA A;  3BO2 A;  3V6H A;  2WSF C;  3CCW A;  1HNW F;  4CO1 A;  3ENW A;  1IBM F;  2C3O A;  4N76 A;  2CAD A;  3CDW A;  4HHH A;  2KM8 C;  4RUC A;  3SDE B;  3GZ7 A;  4NE9 C;  5GMK a;  3MTK A;  1S6Q A;  1NH7 A;  3AA9 A;  3F56 A;  1JLF B;  1CJV A;  2DGX A;  3EX7 B;  1VS3 A;  4TQS A;  3KTQ A;  2K1R A;  1APS A;  2MST A;  2DGW A;  3HVW A;  3N0V A;  2AU0 A;  2QX0 A;  2PDA A;  1XEZ A;  4Y2C A;  1SL2 A;  4FF4 A;  2OEM A;  1EP4 A;  2DPJ A;  1WOO A;  2H54 B;  3S01 A;  3I32 A;  3UDC A;  1ZAV A;  2R4F A;  1UP1 A;  4JI0 F;  4RUA A;  2JEF A;  3PYD A;  5THW A;  4XIU A;  3VAI A;  3D68 A;  4UY8 T;  4NI2 A;  2GS8 A;  1SB6 A;  2MQO A;  2JSX A;  2F65 A;  4W90 B;  4I2P B;  1WHY A;  1WC3 A;  2GIQ A;  1SH0 A;  4RBT A;  4HHU A;  4FZV A;  1U6Z A;  1VQ6 S;  4FKX A;  3BF4 A;  3UE2 A;  4ZLN A;  1HQE A;  1RXO B;  3NGD A;  2FJD B;  2BJ8 A;  5C25 B;  2CJK A;  3KK3 A;  1VQ4 S;  5KT5 A;  4C3K A;  3OVB A;  1GH8 A;  4L3N A;  2XWX A;  1CQN A;  1IKV A;  3DHX A;  3MM7 A;  2M0G B;  1HMV B;  2LU1 A;  1U1Q A;  2NXE A;  2XMW A;  3G6Y A;  3AXM A;  4FYW B;  2MZQ A;  3HHD A;  3KLG B;  2M8D B;  1UPM B;  5ETM A;  3T19 A;  4C3L A;  7FD1 A;  1FNX H;  2FVP A;  3I5B A;  4N56 A;  4I6Y A;  2UV8 G;  4ECQ A;  4ECR A;  2BAB A;  1RT1 B;  3QGH A;  5KT2 A;  2XS2 A;  1QAY A;  2YKQ A;  2KFN A;  2BW7 A;  3V6K A;  2ZH5 A;  3M1V B;  1N34 F;  3RAM A;  5FLX Y;  5B0G A;  1LXJ A;  4F02 A;  3HX9 A;  2P9E A;  2NQP A;  1WHV A;  4FBT A;  1E6V A;  2AF6 A;  1K8A T;  1Q82 T;  1RT2 B;  1ZM2 A;  3MPU B;  2I38 A;  4C8Y A;  2BMB A;  3R3T A;  5C42 A;  2XC9 A;  1RIS A;  3HD1 A;  2I9S A;  2LEA A;  3AD8 C;  1FRX A;  1RBL A;  4X64 F;  1VYA A;  1GMV A;  4X4P A;  3ISN C;  4PRF A;  3ILL A;  3HSZ A;  4X66 J;  1F9F A;  1SUQ A;  1S57 A;  5AE1 A;  2PII A;  3LP1 B;  2E66 A;  1DQ8 A;  4ELV A;  1AXQ A;  3L95 X;  3ZZ0 A;  3CMA S;  3PHE A;  2OEL A;  2ASD A;  2B4V A;  1IKY B;  4EZ6 A;  2OD4 A;  3HK2 A;  2VH7 A;  4OI4 A;  1NO8 A;  1R31 A;  3TZY A;  4DR3 F;  2HEK A;  5KTQ A;  1FKA F;  5H1S V;  3KLE B;  3E2E A;  1B4S A;  4KGK A;  3CCR S;  1C4C A;  2QLJ B;  4TYA A;  4WYL A;  1VGY A;  2R7U A;  3GIL A;  2PI4 A;  2A10 A;  3K8W A;  4ITS A;  1QUV A;  2X1F A;  3LF0 A;  5ETL A;  1LNQ A;  3MM5 B;  5HRO B;  2DNK A;  2LLZ A;  4ED2 A;  5EWG A;  4DV7 F;  3PJW A;  3B4D A;  4O0N A;  2C2N A;  3VF0 B;  4B3M J;  2OPP B;  4C11 B;  3GB0 A;  1V5I B;  4F0H A;  3NS6 A;  4ED8 A;  3PFE A;  5E3Q A;  3VTI A;  3C2P A;  4X4N A;  2UXD J;  1PO6 A;  4CTA A;  4USV A;  4Z2X A;  1QTM A;  2BKN A;  2IYI A;  5AXL A;  1DUR A;  2V68 A;  2AV5 A;  3C6U B;  4P9S A;  1F1B B;  3GII A;  1RP5 A;  1DLO B;  5IT4 A;  1FJG F;  3OBI A;  3KK1 A;  4ZIV A;  1U0H A;  4QW8 A;  2W2P P;  4ZVT B;  2Y1R I;  1JJ2 R;  3I87 A;  1EZZ B;  2JEJ A;  4BCA A;  3P49 B;  4X84 A;  5CAA A;  2R7W A;  5D3G A;  5L1L A;  2Z2L A;  1T05 B;  3KHR A;  1RUS A;  2IDL A;  4DL7 A;  3NNH A;  2DR5 A;  2NPF A;  4WU2 A;  3TI0 A;  4F2S A;  5I42 A;  4P6Q A;  4KGZ B;  4JI3 J;  2DY1 A;  4P52 A;  3C14 B;  2AKW B;  4X62 J;  4CYU B;  2B8P A;  2EPI A;  5JJB A;  1TL3 A;  1UVL A;  3BS9 A;  2B6A A;  1ZOT A;  1S12 A;  2LQ8 A;  1TFY A;  1HBM A;  1IWG A;  4AUK A;  4MAK A;  2KB2 A;  5D4P A;  4WFZ A;  1RT4 B;  5HQ8 A;  4DPY A;  3RB6 A;  3RBD A;  1Z2Z A;  2A2D A;  3US5 A;  2HMI A;  2XM3 A;  3BR8 A;  2AYB A;  4Y2M A;  4USI A;  1Z4U A;  2IBO A;  2MQN A;  4Y34 A;  2F8H A;  3HXM A;  3TEG A;  4A8M P;  1GAO A;  3IXQ A;  3CO9 A;  3PX0 A;  5A0Y A;  4ECZ A;  2CVE A;  2LA6 A;  3QO9 A;  4WIQ A;  3DM2 A;  4ANC A;  2E44 A;  4M1K A;  3BYR A;  3M4X A;  4DFP A;  3HT3 A;  3C15 B;  3Q2T C;  3D4J A;  2E9R X;  4DQR A;  1X0P A;  1U8S A;  2VKZ G;  3S8S A;  1NK9 A;  4Y28 C;  5JUM A;  3R6G B;  4DDF A;  4XPC A;  2V69 A;  3ISN D;  3IMQ J;  4N8N A;  3PRB A;  5DQH A;  2YWF A;  4F8R A;  4FS2 A;  2VPW B;  1O8B A;  1FJC A;  3CC4 S;  1VQO S;  1X4H A;  3MPV A;  4NEY A;  3M9O B;  3KHH A;  3MWB A;  5JVG Q;  1AA1 B;  2W8K A;  4LF4 F;  2J7U A;  2AJ2 A;  5H9F J;  1LQ9 A;  2N4C A;  2AWZ A;  1BY9 A;  3DRS A;  5HJY A;  2HKE A;  3FGV A;  4HAC A;  2R42 A;  4YB1 P;  2JEG A;  2Q79 A;  2E29 A;  2VPZ B;  1EAY C;  5AJ3 J;  4DL0 C;  2XO6 A;  2PMZ D;  5KOW A;  2ZM6 J;  4OI3 A;  1T02 A;  3FBC A;  1YK9 A;  4UOC A;  1JNR B;  2BAC A;  2W2N P;  2XCP A;  4LFA F;  4BBY A;  1KKH A;  3VGV A;  1HD1 A;  2IC3 B;  1OWX A;  1FF2 A;  4YR3 A;  3OL9 A;  2HS3 A;  1SH2 A;  3SCK E;  3BKU A;  3NCQ A;  2Q43 A;  1FX4 A;  1LOU A;  3DN9 A;  2ZHA A;  3IA0 A;  1AUD A;  2IY5 B;  1TAU A;  5CD4 A;  4NYP A;  2CA9 A;  2Z4P A;  2OKQ A;  2V2K A;  5E41 A;  1BHN A;  3TVZ A;  2XMK A;  1KLM A;  5H9F K;  4IO1 A;  2F9D A;  1NK4 A;  1R0A A;  4P10 A;  1NME B;  2DGU A;  1NPR A;  2ZUA A;  4CLK A;  1NPK A;  3UWT A;  1RWX B;  1Q53 A;  1EAR A;  2V2V A;  1HBN B;  1NK7 A;  3W9I A;  2NUH A;  4RBU A;  2J6U A;  1BXN A;  2F3J A;  4K0K F;  2N3L A;  3UR0 A;  1I94 F;  5GAG I;  3DRR B;  3I4P A;  4B9S A;  2M3D A;  2DXE A;  3JQM A;  1AFJ A;  2OML A;  2RKI A;  3PIP Q;  4UOF A;  3J7Z T;  3GV5 B;  3DLK B;  1FWK A;  2HWT A;  4C8N A;  1RWO B;  3JS9 A;  4LIW A;  1WOS A;  4ICL B;  4OJ3 A;  1J27 A;  2A18 A;  2DTJ A;  5E5N A;  2VJU A;  1FVQ A;  4I56 A;  3T9N A;  3MEG B;  2CPZ A;  4ZLJ A;  4TY8 A;  4W92 B;  2FZC B;  4DPO A;  2J8A A;  1AW0 A;  3B6B A;  4ZCK A;  3AB4 B;  3OSP A;  1YRT A;  1UW4 A;  3DOM B;  1DFD A;  1SVD A;  5HAO A;  4OYW A;  1X4A A;  1RA7 A;  3FQL A;  1U2C A;  2G9O A;  2KFY A;  1SQF A;  5T41 A;  1QLN A;  5KG4 A;  2EFG A;  4FKY A;  2MSS A;  4DFM A;  1YHQ S;  2VU5 A;  3SQG B;  4IRK A;  1X8D A;  4OZ5 A;  5KFY A;  4G1I A;  3BV8 A;  3G6V A;  2OEJ A;  3FZ2 A;  2XB2 D;  1T11 A;  2B7C B;  2BE2 B;  1X4F A;  4QCL A;  3QLH B;  1BQN B;  1FER A;  4CP5 A;  5LMN F;  4NLD A;  3FEZ A;  3TAQ A;  2KXN B;  4K4Z A;  2V4Q A;  4NL5 A;  2Z58 B;  3DGP A;  4TYB A;  3MOJ B;  3NBP B;  2BQR A;  3QT5 A;  2NR0 A;  1OY9 A;  4ID5 A;  4QIF A;  3Q89 A;  1BWE A;  3DLH A;  1S0V A;  4Q7A A;  2KH9 A;  4DX8 H;  4ED6 A;  4DR7 F;  1RT5 B;  4MT1 A;  2MQP A;  1HFE L;  1ZAW A;  4OX9 J;  5F0W A;  2BZ2 A;  2RSQ A;  3T6J A;  1S1X B;  2KRB A;  5RUB A;  4WKY A;  3HSG A;  5K8M A;  1UKU A;  3N01 A;  4R8U B;  4AXJ A;  2EK1 A;  1VIS A;  2APO A;  3VCD A;  3GIK A;  3DDK A;  2ZBP A;  3IS9 A;  4GVL A;  3KYL A;  3FEY B;  5C2C A;  2IRU A;  4V1A k;  3HT0 A;  3BPS P;  3PX4 A;  5ETO A;  2R7T A;  2PC6 A;  3E3X A;  4FXV A;  3BKF A;  1LWF B;  1P1T A;  2K3I A;  1KQK A;  3MF5 A;  3RZA A;  4DR5 F;  2HHW A;  4NML A;  1C1B B;  1Q7Y T;  2RRA A;  4WII A;  5J2Q B;  2UV8 A;  4H4O B;  4K8R A;  2ZWP A;  3NGS A;  2K8G A;  3CXC R;  1N6Q A;  2YWG A;  2NXN A;  4CLU A;  1D9F A;  4DR4 F;  4M94 A;  4F4Y A;  5EWE A;  1QVF R;  4HVZ A;  2R9L A;  2P6S A;  4MKV A;  1UFL A;  4DZD A;  4PUO B;  2B51 A;  2IRX A;  1WAC A;  2QA2 A;  4B3T F;  2DHA A;  2VQF F;  3GU0 A;  1RTI B;  3DLG A;  2YKM A;  4I1T A;  1FCA A;  1SH3 A;  3W1Y C;  3VQS A;  3K8V A;  2ZE2 A;  1RAF B;  3HVT A;  2F9J A;  4LRB A;  2IRY A;  4LQ3 A;  2ALZ A;  3R9L A;  4IFV B;  4ATN A;  3AD9 C;  4USM A;  4K4Y A;  4B3O A;  3T5L A;  3GSD A;  5GAD U;  2YNH B;  1O6X A;  2LP4 A;  3D7S B;  1RTD A;  3MR7 A;  5J1N A;  2EFV A;  4ZS6 A;  2IM0 A;  3V6D B;  1KBR A;  1U47 A;  1P27 B;  1UZD A;  5F8N A;  2QMW A;  1L3S A;  1FDD A;  2I5J A;  1FE0 A;  2HNY B;  1IQZ A;  3QPI A;  1EET B;  2NYI A;  2FVR A;  4WFA Q;  3QQC D;  1H98 A;  5J2P A;  2DR7 A;  2D3Z A;  2E7V A;  1DRZ A;  1XK8 A;  2LQB A;  1T9Y A;  4GKK F;  4KSE B;  4H4M B;  5HMZ A;  1KSP A;  2AJ4 A;  1OIA A;  1TVR B;  1TKT B;  4PWD A;  4ZHR A;  2MEW A;  5KFZ A;  1VCT A;  2LCW A;  3MUT P;  4LRA A;  4DV0 F;  4DX6 A;  5LM7 E;  3LP2 A;  2VBZ A;  1GXT A;  4ZPA A;  4QJV A;  1LW2 A;  4HYK A;  1T9V A;  2DHG A;  2GHV C;  2W9C B;  3CJK A;  1NJX A;  3KUH A;  3H8Y A;  2HIY A;  2XZD B;  3DKD A;  2QSF A;  2RRN A;  1T9W A;  4ZPB A;  4DG1 B;  2CVI A;  2CQB A;  3ISZ A;  5C7P A;  4ECV A;  1EKS A;  1ZM9 A;  2BRL A;  3HPO A;  3R2D J;  1EQ0 A;  3H2V E;  1J2V A;  4P75 A;  1VQ5 S;  1M0S A;  5IWA F;  2NZC A;  3TX0 A;  4EWT A;  2E5H A;  5E0O A;  1GMW A;  2IM2 A;  2KHC A;  1WF2 A;  3IR7 B;  3VZI A;  2GVZ B;  4ZK7 M;  2MB0 B;  3CSK A;  1VRT A;  3U02 A;  3OTO J;  4HI1 A;  2D3O 1;  5JMN A;  2IVM A;  3CTR A;  2CDQ A;  2XSF A;  1P8G A;  2HVH A;  4LF6 F;  3V5R A;  4DPX A;  2OGU A;  3IWX A;  1RHJ B;  2YWH A;  4E98 A;  1KP6 A;  3B82 A;  2V8D A;  3KLI B;  2GGP B;  3G8S A;  5J1E B;  1HD0 A;  5AXN A;  2L9W A;  4X4V A;  4I7F A;  3PJ9 A;  4J9R A;  1DZ5 A;  2QYG A;  4K7Q A;  2VG6 A;  3D3C J;  3MD1 A;  3OXL A;  1RI7 A;  4KE5 A;  1JLQ A;  3JSB A;  2PEB A;  3ZZO A;  1AB8 A;  4U6P A;  1J5E J;  2CXE A;  1RT6 A;  3AAW B;  3VR1 A;  1YLX A;  2MHE A;  3HI9 A;  3M8R A;  4O3O A;  1SQE A;  2GIF A;  2P2C B;  1RDR A;  1VRU B;  2G2Y A;  2V8G A;  2M8H A;  1FKP B;  2X7I A;  2ZH2 A;  4A8O A;  4OJH A;  4DV4 J;  4IOB A;  2AYM A;  4C97 A;  4PR6 A;  3Q24 A;  4RW8 B;  3PW0 A;  4L3K A;  2UP1 A;  1TKX A;  1BD6 A;  2B5J A;  1HR0 J;  3N28 A;  4YB6 A;  1YJW S;  2DD8 S;  5KFB A;  1M1K T;  2U2F A;  2AT1 B;  2GCF A;  3N5F A;  3GV7 B;  1ZS6 A;  4KRW A;  2YPY A;  4KPC A;  4KJI A;  4NCB A;  1RWK B;  4IG3 A;  3OJU A;  1FI4 A;  1YQH A;  4LSN A;  2XY7 A;  4GVB B;  3P6Y C;  5IT9 U;  4DCO B;  1CQM A;  5BR8 F;  2AJ0 A;  5C2G A;  3A4T A;  5CYM B;  4L76 A;  4ZVU B;  1H7X A;  3OL8 A;  1VRQ C;  3PEJ A;  5HMX A;  1JLB B;  3HFV A;  2KL8 A;  4RPF A;  1FDN A;  1NH8 A;  2ZVS A;  1VQN S;  4KR0 B;  2VFU A;  3FK4 A;  3EWG A;  3PEH A;  4RU9 A;  3H4D A;  3CC2 S;  3OTB A;  3FBB A;  3UW1 A;  2RF2 B;  3KHL A;  4DFK A;  3P5B P;  4Y3C A;  1FRL A;  1FKO B;  4RO0 A;  3NRB A;  2V94 A;  2DGS A;  1WOP A;  5K8N A;  4C0H A;  5AXM A;  2XO7 A;  2V5H G;  2KJV A;  2I2Y A;  4OYO A;  2CZV C;  3IRW P;  3GSI A;  1K44 A;  3CE8 A;  5HK4 A;  4OL8 A;  3G9C A;  4DV6 J;  1I6J A;  1N5Y B;  3TAN A;  4DX7 A;  1ZH5 A;  1TKZ B;  4JI0 J;  4GMK A;  2Y3Y A;  4QW9 A;  2DNQ A;  2NPI A;  5I4M A;  4EFA C;  3IN5 A;  1BQX A;  2BKO A;  1WC4 A;  3X1L B;  3BGU A;  1NEE A;  1A0O B;  1KDN A;  5HI7 A;  3GCX P;  4IQX A;  3TOQ A;  5DDP C;  4RW7 A;  1UFK A;  2DGV A;  2DEI A;  1SJ1 A;  2HLU A;  1V3S A;  2DHS A;  1SC1 B;  2AX0 A;  1YBU A;  2KVQ E;  2OTL S;  3MR2 A;  3UCG A;  3VQT A;  1U1K A;  3MM9 B;  5CA5 A;  3TQ1 A;  2J7W A;  1X5O A;  3SXL A; 
#chains in the Genus database with same CATH homology
 3EIC A;  1HIY A;  3JS9 A;  1BUX A;  3VVT A;  3ELH A;  4S0M A;  1UCN A;  3DDI A;  1WKK A;  1NDL A;  3ETM A;  3NGR A;  3B54 A;  3ZTR A;  3BBF A;  1B4S A;  3Q8V A;  1K44 A;  3VGT A;  1S59 A;  1WKJ A;  1F6T A;  2B8Q A;  3NGT A;  3B6B A;  2DY9 A;  3BH7 B;  4DUT A;  5CAB A;  3EVM A;  1NSQ A;  1NDK A;  3VGU A;  2DXD A;  2AZ1 A;  3EE3 A;  4EK2 A;  2B8P A;  1NLK L;  3Q86 A;  2HUR A;  3PRV A;  1W7W A;  1NUE A;  2CWK A;  1HLW A;  2HVE A;  3ZTQ A;  2DXF A;  1ZS6 A;  5BXI A;  1NSK L;  2BX6 A;  4KPC A;  4W98 A;  1WKL A;  1PAE X;  1BHN A;  3WX8 A;  3VVU A;  3PJ9 A;  1LEO A;  4FKY A;  1BE4 A;  2VU5 A;  3FBF A;  4O0N A;  4ANE A;  5IOL A;  4FKX A;  1PKU A;  3Q8U A;  3BH6 B;  1NHK L;  3FBE A;  3NGU A;  1XIQ A;  3MPD A;  3DKD A;  3GP9 A;  1LWX A;  3FCV A;  1VYA A;  3ZTP A;  3R9L A;  4ENO A;  2ZUA A;  1NPK A;  1KDN A;  3BBC A;  2BEF A;  4WBF A;  1XQI A;  3ZTS A;  5C7P A;  3FC9 A;  4UOG A;  3VGS A;  2NCK L;  4CP5 A;  5CAA A;  3L7U A;  3FCW A;  3EJM A;  2AZ3 A;  1S57 A;  1NCL A;  1JXV A;  1MN7 A;  4DI6 A;  1MN9 A;  3FBC A;  3ENA A;  1HHQ A;  3GPA A;  4F4A A;  3BBB A;  3FKB A;  1EHW A;  2DYA A;  1NDP A;  4ANC A;  1NB2 A;  1S5Z A;  3VGV A;  1B99 A;  3Q83 A;  4C6A A;  3EVO A;  4F36 A;  3G2X A;  2DXE A;  3NGS A;  3Q8Y A;  3EM1 A;  3FBB A;  1F3F A;  2HVD A;  3Q89 A;  4AND A;  1U8W A;  4DZ6 A;  1NSP A;  4UOF A;  4UOH A;  3ZTO A;  1NDC A;  3EMT A;  3EVW A;  4HR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...