1NDKA

X-ray structure of nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
KERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIICGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of nucleoside diphosphate kinase.
pubmed rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 45
structure length 148
sequence length 148
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndkA00
3BBBA 1NSPA 3VGUA 1NSQA 4ANDA 1B4SA 1NLKL 3EVOA 3Q86A 5IOLA 2HVEA 1NSKL 3VGSA 1PKUA 3G2XA 1W7WA 2BX6A 3ETMA 1LWXA 1WKJA 3EVWA 1HLWA 3VGVA 1NDKA 3WX8A 4F4AA 3NGRA 3NGSA 4ENOA 2AZ3A 1MN7A 3BBCA 2CWKA 1NDPA 3ELHA 2B8PA 3NGUA 4EK2A 1U8WA 3DKDA 3GP9A 3Q89A 3PRVA 3VVTA 4FKYA 3PJ9A 1NPKA 3B54A 3ENAA 1KDNA 3Q8VA 1NB2A 1K44A 1NCLA 3Q8YA 3ZTOA 4WBFA 4ANEA 1BUXA 4W98A 1MN9A 3BH6B 2DXFA 3FBBA 1NHKL 1WKKA 1LEOA 4O0NA 1NDLA 4UOHA 1S57A 2DY9A 3B6BA 3ZTSA 2NCKL 5BXIA 2ZUAA 3ZTQA 4KPCA 4F36A 3VVUA 4CP5A 1VYAA 1NDCA 2VU5A 1HHQA 3ZTRA 3EE3A 1XQIA 1EHWA 1PAEX 3GPAA 4DZ6A 4FKXA 5CAAA 1WKLA 3EICA 2B8QA 3FKBA 3L7UA 4DUTA 3MPDA 4ANCA 1BE4A 4UOFA 3EJMA 1F3FA 2BEFA 1XIQA 3BH7B 4UOGA 1S59A 1F6TA 3VGTA 5CABA 2HVDA 1NUEA 1B99A 4S0MA 3FC9A 3FCWA 3Q8UA 1HIYA 5C7PA 3FBEA 3EM1A 3FBFA 3EMTA 3Q83A 1ZS6A 3R9LA 1JXVA 3BBFA 3FCVA 1S5ZA 4C6AA 3DDIA 2DXEA 2DXDA 1BHNA 1UCNA 3FBCA 3JS9A 2AZ1A 3ZTPA 4DI6A 2DYAA 4HR2A 2HURA 3NGTA 3EVMA
chains in the Genus database with same CATH superfamily
2V68A 2B3TB 1AUSL 5HMXA 2E1CA 3IBFB 3GFHA 2VC0A 3L7PA 2UP1A 2VG7A 1LW2A 1B4SA 4GO7X 3T41A 4DOZA 4XDCA 4XTTA 1VRUB 5JXSA 4DQIA 4H4MA 4WFXA 1F5BA 2FJWA 4BBYA 4ZA1A 1RA6A 2ZZTA 4DL0C 3M05A 2QL5B 1TELA 3M8QB 4C8NA 1D9FA 1XNRJ 4FYWB 1O5JA 2R7XA 2A10A 2KU7A 1LNQA 1U26A 3NGRA 4KHMA 3THTA 3WX8A 4F04B 2A1BA 3CCWA 3J7Z5 2OH2A 5GAHI 2IYIA 1NJWA 1HBOA 2EKNA 4DV5F 3G6YA 5F0UA 1UL3A 3AD7C 3K17A 4M5IA 4ZOSA 3JSMA 1KC8T 1QAIA 2I9SA 2ZVIA 2IPOB 4J9VA 3MR3A 1JIHA 1MROB 3GP9A 4ID8A 2AQ4A 2BDPA 3W9IA 1PYSB 2ZBIA 4NMXA 3M8PB 3A12A 3TAMA 4DU8A 1NH8A 4N5SA 4C3LA 4ZJQA 3N5FA 2U1AA 3PKYA 4KY3A 4YEAA 5BR8F 1N8RT 4KKOA 4LUBA 5FD1A 3HHLD 2BW2A 3SMZA 2ADBA 4PQUA 2HSEB 3KDNA 1X7VA 3QRQA 2EC2A 3KNAA 2KG0A 1GMWA 1OSDA 1YJNS 4ZVEA 1NEEA 5G0RB 3LAMA 5IXUA 5CH7B 3J7AN 1OQ6A 2N4CA 3MM7A 4UOHA 4LFBJ 3M1VB 4JV0A 2DB1A 1J2VA 2K8GA 2OELA 3B6BA 1GK8A 3CSKA 3NY0A 5HMZA 3WHIA 1JKHB 4L3KA 4ECWA 1KQGB 2KZMA 2AV5A 1O0PA 2IFXA 2V2KA 3JSRA 2CPZA 3I4HX 1NHUA 5DQHA 3PRDA 4WFZA 1RJJA 4FYXB 4CP5A 1FNOA 5DG9A 4WP9A 3M9OB 4JV2A 1NM2A 4LF6J 1MU2A 3T6JA 1EJ7L 4YR3A 1HHQA 5DG7A 1XQIA 2DVIA 1S6PA 3UFCX 4FKXA 2ZUGA 4IOCQ 1TKZA 1YJRA 4KGXB 3SIPB 4FBTA 1HNWF 4JI8F 4B3SJ 4ZJLA 4F50A 3UE2A 2W4DA 4M63A 4HHHA 3A8KA 4CH7A 3H5YA 4F8RA 1HBMA 1S1XA 2HNYA 1H2VZ 1K1QA 1U0HA 4NRUA 4V1Ak 4KO0A 4B08A 4FNHA 1RHQB 3FGVA 2FHKA 3TUIC 3TYTA 1RBOB 3H98A 1S79A 1D9AA 1WF0A 4LR9A 1F3FA 4R0EA 2WVDA 4RBVA 2CQ4A 1S4FA 1JLBA 3NRBA 3T1YJ 1S0MA 2R8KA 4CRJA 1B3TA 1EIYB 3P6YC 5BYSA 3RRGA 2CRLA 3W61A 3AHPA 2HMIB 3SCKE 4FS2A 2V4QA 2W4PA 3OV7A 1RWUA 2VQEJ 2OHDA 2J6SA 1WDDA 3I6PA 3PY8A 2HHSA 3AB4B 3KLIA 4J90A 4Y65A 2KVQE 4X4TA 2J0XA 1RWPB 2F3JA 2HS3A 2Y3YA 1TQLA 2CPIA 2H9ZA 3D5MA 3DHXA 5GMEA 4B3RF 1IKVA 1FWPA 1GMWD 4OHWA 2XY6A 4X4OA 4YB1P 1IKXB 4X62F 3OUYA 4JI4F 2DRAA 3Q8QB 2RUSA 1UKUA 2ZHBA 4ZVUB 4CTAB 4RU9A 5A8RA 2BQUA 5DDRC 4LSNB 4CI0B 1JXVA 1RT7A 1VHIA 1SKRA 1TL1A 4H4OA 4ZITA 3IWNC 1D0EA 2CVIA 3MM5A 3SBMA 4LF1A 2DXEA 2IDEA 3VHQA 5IS2A 3JS9A 4OL8A 1X4AA 1WSRA 3FFIA 3GWCA 1Q16B 5HQMA 4CCHA 1U0SA 3R2DJ 2CPYA 2Z4PA 2CJ9A 2EFNA 4QWAA 1FWLA 2VBZA 2FHMA 1VLOA 2KXNB 3I55S 4X4VA 5FJ4A 2F1FA 5CHCB 2ZH1A 5A0YA 4DPWA 1TV6A 2W9AA 1IUJA 3K5NA 2CJAA 2AJ2A 3BKFA 3LGNA 4AXIA 2XO7A 3HXMA 3W5XA 2CUYA 2MQNA 4QR2A 2XEXA 2WVFA 1BGXT 2C3UA 2VDIA 2M2BA 3MTJA 3PEJA 4OI6A 3VGSA 4DUZF 1YTYA 2MSSA 4BC9A 1OY6A 3MEKA 4DL7A 2CPFA 3MPUB 2PMHA 3GIIA 5CXTA 4Q8EA 3D0GE 3AD9C 2GO9A 3VTIA 1MMLA 1PJ5A 3T5HA 1REGX 3FVYA 1UVMA 3Q2TC 1VLYA 4PABA 2RNEA 1S0NA 4PUOB 4HVZA 5MLCV 3VAKA 2KFZA 2OPRA 2N7YA 3HHLC 4WP8A 4ZDNA 2MTLA 4HEA9 1RT3A 2WVCA 3PDNA 2QEXS 3VVTA 2IJRA 3Q24A 1GEHA 2GX8A 4B02A 1DQ8A 4F3QA 3EX7B 2UZAA 4RNMA 4DSEA 1GMUA 1DHMA 1WTBA 2BOAA 2WW4A 5C2CA 2R7QA 4A8WA 2AJ4A 2XB2D 1DURA 1F5CA 4U7UD 1HBUA 1FE4A 2IC3B 2BKPA 1DFDA 3QO9A 1OIAA 1RLCL 1RKJA 4LR7A 3MR6A 4OYPA 3I96A 3BH6B 2RB7A 5AXKA 1FJ7A 2UUCF 1WC3A 1WKKA 2RHSB 1RTJA 2KRRA 4G1QA 2QFJA 4IDKA 4I0WA 5IQQA 3FK4A 4ED0A 1S7HA 1S57A 2R7TA 4OJ3A 3KLEB 1RWNB 4AXJA 2CG4A 2XMKA 3G6ES 4CO2A 2IBKA 1T02A 4NYPA 5DQIA 1CJUB 4K0KJ 3BPSP 3CDAA 3QMQA 3GFZA 2CJQA 4DCOB 2KM8C 1RT5A 4B9NA 2KZZA 1B70B 4OYMA 1HA1A 2ZH6A 2D3ZA 1RT2B 2HW3A 1URRA 5B0DA 3BSOA 4P7TA 1RBLA 4DQRA 2LDYA 4LQ9A 5CAAA 3MCNA 3K7RA 2X7IA 4O3QA 1KVJA 4RBUA 1WHXA 4YFUA 1DZ5A 2OEJA 3H2LA 5BJRA 1S1WB 4YB6A 5LL6d 3M4XA 2RKIB 1KHWA 1HW9A 5I42B 2VIHA 2E5IA 2JFKA 2VJVA 1BQXA 3SFGA 3KJNB 1M1HA 3C6TA 4CT9A 3OL7A 1HHTP 4ZP7A 2HVZA 3HHNB 1KHVA 4K4TA 1F2HA 3OL6A 3PHEA 1YJTA 2KB2A 3NGDA 1WF1A 2WOMA 4O44B 4OI4A 2I38A 4ZVTB 3KFWX 5M2PA 3D67A 2CQDA 4WTOB 3Q23A 2CNKB 2QL9B 2VFSA 4Y6IA 1QE1A 3GJTB 3H59A 5DGBA 3SFUA 3VQTA 5GADU 2Z2ZA 3EM1A 5AXMA 3E01B 4O0IA 4DQSA 2DGXA 4QWDA 2B43A 4DSFA 3NOCA 2O67A 3P4UB 2D74B 1KR4A 3O5TB 2B51A 2CQBA 2RU9A 2V8PA 3C3LA 5CYMB 2AT1B 3MMCA 2ZJQQ 2PDAA 1UEUA 1WG4A 2E44A 2UUCJ 1S5ZA 3S01A 4X66J 4C6AA 5A2QU 2ADCA 4MFBA 2VHGA 1JJHA 2CADA 4YY3F 5IT0A 3QLHA 4A8MP 2HWTA 2DNOA 2B56A 1FNXH 2ZH2A 4NPOA 3VQSA 2Y8YA 2FLLA 2I1RA 5HVGA 2XTJP 1H0HB 3HKWA 2UXDF 2Z30B 4NLOA 3K89A 5KG4A 4IG3A 4RNNA 2LVWA 1U1KA 3BSNA 2AU0A 4I4BA 1S49A 5AE2A 5KTQA 2R8GA 1Y9OA 1S1UA 5GAGI 3DN9A 4MIBA 5SZTA 3EVOA 4KSEB 3ZXWA 2EK6A 1NSKL 4YUDA 3CD7A 1N56A 1H7WA 4I2QA 2HFZA 3ZZZA 1F9HA 1JLEB 2AEFA 1HW8A 2RAQA 3TJ8A 1RTIB 3TX0A 3EVWA 1MROA 1UFWA 1U1MA 2LQJA 2YKPA 4LVNP 3DLJA 2DNQA 2KDOA 3CDBA 1U02A 2JH3A 2AMCB 3H8YA 2QYGA 1NJYA 5CCLA 3OLBA 4RUBA 1AA1B 3H20A 1SKWA 3I0SA 3PCOB 4OJGA 2ZFHA 4WZMA 1S6UA 4RW6A 2YX7A 3E01A 4FKYA 4F0MA 4NRTA 4QW8A 3OL9A 3ENAA 4I6WA 1Q8BA 2W7PA 1VQ6S 2HK2A 4UUWA 3E51A 5B0GA 3CD5A 4HL9A 1YBTA 4FVMA 4ETZA 2R2TA 3PO4A 1FRLA 1NB2A 2RQMA 3A3PB 4WTYA 4FXWA 3ZZRA 3Q22A 1JLAA 1JNZB 3C16B 1S9EB 1RA7A 3SCIE 4HDHA 1FD2A 1VQ4S 4ANEA 1FESA 3CCTA 2BZ2A 4DZDA 1LWFA 1V3SA 2L9DA 4HKQA 3ADAC 5E41A 1N5YB 3M9NB 1TUVA 2IBOA 2XY5A 1N36F 4Q44A 3KHLA 1P6TA 4U8YA 4LBHA 1S9FA 4QYZJ 4NA3A 2FLPA 3AQOA 1LW0B 1EETB 1K9MT 4I68A 1UETA 1DTTA 2WONB 4P72A 4ZJOA 3CCQS 5IFMA 4ID5A 3GJQB 3I0RA 1FRIA 3LWLA 1KKHA 2UXDJ 2E7WA 1N34J 4FYVB 3ZZYA 4Y2AA 3EGNA 3PX4A 1GXTA 5HJYA 1U47A 5KAKA 4DS4A 2BA9A 4E2FB 3WC2A 4M94A 5F8IA 3J81Y 3NLCA 2OPQB 3K8WA 2AX0A 4RPFA 3QFHA 2I5JB 3CC4S 3G96A 3CDEA 4LREA 1WSVA 3TJAA 2Z2YB 2YKMA 3JAMU 4ZP8A 1YBUA 2FYXA 3BO2A 3G87A 4K4XA 1VBXA 2A2DA 2VZ9A 5E7OB 3MPVA 4ANCA 4LF5F 2E7XA 2JFDA 1TKXA 3FSXA 3MDFA 3H5XA 2UXBF 1WACA 5I3UB 5AJ3F 4K4UA 5DG8A 1V6HA 4P10A 1F6TA 1R89A 4DSLA 4B3OA 1EQ0A 5LSOA 3OFEA 4HT5A 5ETRA 3OSNA 4LQ3A 4Z2XA 3C6UA 1M0SA 1RU1A 1RP5A 4S0MA 4WXOA 3MAQA 1HYSB 2JLEA 1FFGB 4KC5A 4M8LA 1TL3A 3VAHA 3TZYA 2OSQA 3GV5B 4IFYA 4A8FA 1RGVA 3DLKB 4PXCA 1JK9B 5CA5A 2ZDPA 2QLJB 2K1RA 4MTPA 4YQWA 4DV4J 1J5OA 3LGMA 2PC6A 3RAMA 2EBEA 2VD3A 3JYTB 4UTGA 2DGWA 1OJ4A 2YKQA 4MH8A 4MYTA 3OTCA 4P2XA 1CULA 3MM6B 4J9QA 2WHOA 4DR5F 2E1PA 4TXSA 1VQYA 3UDVA 1FERA 1YQHA 1O8BA 2JVOA 1BLUA 3CIZA 3ILOA 7FD1A 1KEKA 1R43A 3RR7A 4KHPJ 3BSAA 5KFUA 4ICLB 2V9KA 2NXCA 4ED7A 2G13A 2DO4A 3IO1A 5KFYA 4OX6A 5JVHQ 5KG0A 4B3MJ 4M5HA 2AEMA 2AJFE 2JL9A 3QT6A 2BVZA 2E66A 4LT6A 4XIUA 1UA1A 4NI2B 3DXSX 5DETA 2R7RA 2WBRA 3V6DA 3PFOA 5F8GA 2DGSA 1KOOA 1RQ0A 1OQ3A 2GMHA 2YWHA 3HVTA 5FIIA 4O3OA 5LMNJ 3T5LA 1HMVB 2YH1A 4NOHA 3UI3A 2ROEA 1H74A 3MUVP 3CW2C 1WC0A 3G82A 3VV2B 2CYYA 3SZ2A 1Y3JA 2QZ8A 3K5PA 5HANA 1RAJA 4GKJJ 3VGVA 3KK1B 3BQ2A 2IM1A 2HHPA 2XMMA 2JSXA 2WCXA 4F4AA 2JVRA 4NXMJ 1MSWD 4QIFA 3BBCA 1CJTB 1U2CA 1QY7A 5J1EA 1XMOJ 4DFKA 1NRKA 3OR1A 5DS7A 1GAOA 1BWVA 4ZN3A 3WZ0A 2VH7A 4EK2A 4USTA 3IWXA 3OHAA 3TUJC 3TZZA 2W2QP 5HLFA 1T9TA 1IN0A 3GJRB 4NEYA 1Q8LA 2DNHA 2WZ1A 4NWBA 3JTPA 1RTHB 2OEKA 1GQEA 3M8ZA 2BKNA 3MPYA 1G1XA 4K59A 1XC9A 1TL4A 2HKEA 3O6QA 4M5DB 2HS4A 3DRRA 3EWGA 3JQKA 4FNIA 2N3OA 3LP2A 2OD4A 4GC6A 4LF9J 3KDOA 3EZ5A 4DPUA 3OTEA 3KLEA 2X1BA 3JSBA 4ECVA 1HHSA 2XNQA 3HHEA 1LOUA 2NSBA 1Q86T 1FJGF 2V8GA 4CH1A 1NHKL 4A8KA 5DDQC 4NYZA 2UUAJ 2RQ4A 1U6FA 2BJEA 2LU1A 4K7QA 2L08A 4DCJB 1TMMA 5J2QB 1NDLA 4Q8FA 3RBDA 4JP8A 2E5LF 2UXCF 1F2GA 2ASDA 5A8KA 1YDLA 4ZCIA 4UOFA 2XZDB 3DI6A 1K1SA 1HMVA 3IBWA 1YBAA 3IGNA 5GVQA 4CO1A 3M2UB 4BWMA 3MURP 1VYAA 4NLRA 1SQEA 3LP0B 2EC0A 1IWAA 4GMKA 1BQNB 3UDCA 3F0NA 5J1NA 2FHOB 2KJWA 4RW9A 2OLWA 1Y5NB 3JAMY 3IP0A 1S10A 3PACA 2L41A 2I0XA 1XNQJ 4NLSA 4U6PA 1AUDA 2V50A 1OYEA 1FI4A 3UO0A 4ECSA 1XNRF 4PWDA 2B4VA 2JOQA 4DPTA 2XLJA 2HIQA 4ZPWR 1EX8A 2VQFF 2VV5A 2LYVA 1K73T 2XI2A 1M90T 1Y00A 1VDHA 1BE4A 2OFHX 2WW8A 2XZWA 2ZE2A 4KGZB 1IKYB 4RJVA 4ZCMA 1RWVB 5E3AA 1O51A 1VISA 1S59A 4M95A 2A3JA 4DR7J 1S0OA 2EG2A 3UCZP 1L3UA 3HD2A 3HI9A 2DRDA 3MFIA 1X4DA 4E8UA 3W65A 1A6LA 1LWCA 2KFYA 4WWSA 2COLA 2Q6BA 2YKAA 5GAEU 3E2EA 2LU2A 3U1MA 3AY0A 3TEGA 4KR0B 1SUQA 1IBKF 1Q7LB 4JV5F 5KFHA 4OFZA 1SV5B 4ETXA 2AP6A 1U2RA 2Q79A 4DG1B 1S7IA 4UQTA 1UVIA 2VFVA 5DDPC 3N6NA 2XS2A 1UP1A 1NZAA 5KG2A 1RT4B 2ZH4A 2DNPA 5L8RC 1N5QA 1WEXA 2ZC3A 3DDIA 3ZZTA 3PIPQ 3HO1A 1T03A 3K5LA 1PSDA 1V3RA 4FXVA 4DR4F 2XGPA 3T1AA 3RU0A 3PYFA 2RRNA 1N32F 1V5IB 3BV8A 2XQCA 1T3OA 2D9PA 2MZSA 3V4IA 2YXLA 2LQBA 2K06A 1AFJA 8RUCA 1TMJA 4H4KA 3NNHA 5J2NA 3G6XA 1UTAA 2VG5B 4B17A 4FS1A 2NXNA 4USVA 4ZHRA 5C24A 3KJVA 4DR1F 4QIVA 2Q6CA 5FDLA 4IKAA 2R2RA 2OPRB 3FNNA 2G2YA 3UVJB 1HNVB 4M5KA 4X4QA 3CCVS 4BC7A 1UMJA 2GQQA 1X5OA 3SSSA 1YJWS 3I5AA 3N9UC 4IOAQ 2C2RA 3CJKB 2BE2A 3NS5A 3PVXA 3QIPB 5I4MA 4C4WA 2X51A 2IVMA 3NWRA 5IWAJ 3BKUA 4FDFA 4I2PB 4AL7A 4WK3A 4XPEA 1YSJA 2MLYA 2DGOA 2DITA 3POTA 4EUVA 1DLOA 2WB1D 1I6JA 2CJKA 2MQOA 1HQ2A 1PYOB 1KD1T 5B7WA 3TW0A 3G9CA 4HI1A 4ED8A 1TVRA 2MKKA 4Q0BA 2JEFA 2OGUA 4DV7F 1NKBA 1KDNA 3VAFA 1R8AA 2A0FB 5C5JA 2AD9A 2BQ3A 2GNKA 3TNVA 3M7VA 3TVKA 1FK9B 4WFNQ 4CLLA 4UT4A 2E1MC 2NS1B 1VC6A 3DOLB 1JMTA 1Q8KA 3EXCX 2YKOA 2YWWA 4CQ1A 4AL6A 1MN9A 2CQIA 5EGYA 3H4BA 1RTDB 4CLUA 1FJCA 4LF4F 3HVAA 4LFAJ 5ETNA 3P45B 4DV6J 5IV3A 1HWUA 5E0OA 1VQ9S 1BY9A 5HSPA 2ZWPA 4Y2IA 4RW7A 2HNDA 3MWBA 1RWXB 3M30A 1R6VA 1SVDA 4NLWA 4RWWA 4L3NA 3SSRA 3UVJA 3OJSA 4ED6A 3EXYA 3HFZB 4N76A 4USWA 1TKTB 4DL3A 1SKSA 2PT0A 2HRYA 3EDRB 9ATCB 1MMDA 2VASA 2GHWA 2NLWA 3EE3A 4USHA 5KFFA 3CPWR 1ITPA 3AODA 1TAUA 3PXGa 1YJVA 2NREA 2EK1A 1RHMB 1Z2ZA 4ZLLA 5RUBA 1WHWA 2OMOA 3QT8A 4WJBA 4Z37A 2ACMA 3D7SB 2DR7A 3FKBA 3PFEA 3HPOA 4TQRA 1JLFA 5B0AA 1QSYA 4OZ2A 1P9YA 2RMLA 3QWPA 4QCLA 1HBMB 2HNYB 2PEBA 2RF2A 2XYGB 4JI1F 4HTJA 1G2EA 3W5ZA 2Y9HA 3HHKA 1M5VC 2G0IA 5JMNA 2ZJPQ 1RWWB 5KT2A 2EFPA 4U9RA 3BO4A 4B9UA 2E9TA 1WD6A 2G0CA 3O8WA 5G0RA 5E3CA 1DY3A 5C2GA 2J9DA 2V63A 4ELTA 2NXJA 4UY85 2W9BA 3CF5Q 1EP4B 3L95X 1VQ5S 5J2MB 4FF2A 1JWWA 1QUPA 3TI0A 2SXLA 5DRKA 1R27B 3HK2A 1RE1B 2Z58B 1TK8A 1ZM4A 3D54A 5KT5A 3OHBA 1OY9A 2QX0A 3DYAB 2MQQA 5DLFA 1UJ5A 3PJXA 3U7JA 1UPPA 2W7OA 2HRUA 5CYQB 1Q8IA 1ICEB 4OV6A 4DV2F 2XYHB 1YIJS 2OD6A 2B7BB 2VFRA 1IBLF 3J7A1 2WAQD 1UCNA 2RD5C 1K0TA 2BXJA 2OUGA 4ZP9A 3KJQB 3UD3P 4DV1J 1NXIA 2D1CA 2F4FA 2V4JB 4I7FB 3TO8A 3DOKA 2DPJA 1QVFR 2C1EB 2DT9A 3B82A 3R5CA 1H7XA 1RAHB 2YWKA 5ETQA 4O3RA 4ED1A 4NXNF 2YQ3A 2W9CA 4A8SA 4Q43A 1TV6B 5ITHA 3ENWA 1LW2B 1AT1B 1WHYA 2PGCA 3AOBA 3CO0P 5IOLA 4CZCA 1HWIA 5G4DA 2ZBPA 4JBCA 2XM3A 2MKCA 3R3TA 3QFWA 3CJ5A 4JI7J 2VODA 5D0RA 1UWBA 3CCMS 1W25A 2VKRA 3HVWA 3O2IA 1Q79A 3UN5A 2I2YA 2VONA 3M6UA 4O3NA 1NK8A 2AEJA 1QJHA 2GVDB 4QU7A 1WELA 2MZTA 3RRHA 1Q78A 4HTIA 1NJXA 5KFRA 1IKVB 4LF8F 3N5BA 2JLGA 1HQEB 2YQ0A 3DDNA 3GMGA 3IAM9 1XJWB 2GW8A 3IM8A 4DPYA 1S48A 2EEYA 1RUSA 5GAEI 2B4UA 2BMBA 2WVEA 4QU6A 1NPKA 1Q5VA 1NKEA 2ZM6F 1TP7A 2EFGA 1HPZA 2PA3A 5CYQA 1FCAA 2OSRA 3CEDA 5A8WA 2FHJA 3CD0A 1DTQA 1PJ6A 3I4PA 1SC4B 3KXDA 4M5NA 1LWEA 4WBFA 3G86A 2DRBA 3KLGB 4BDPA 3CWJA 1PC4A 1VC0A 3DM2A 3ET6B 3LALA 4ELUA 4U7CA 2QT7A 3UD4P 4OV1A 3R1LA 3PO5A 2P9CA 3MEDB 4MYUA 5D15A 2MQPA 1X5PA 2ALYB 2GVZB 1PAUB 1YVFA 4PG6A 2V2VA 4K8RA 5F8LA 3KK2B 1FVSA 2DEJA 4NZ0A 2FJXA 4ZPTR 4CLFA 3UNGC 4N47A 2DGQA 2GQ2A 3ZZPA 2OIHA 4IQMA 1NDCA 3CC7S 3CD6S 2PIIA 1KSPA 4DV0F 2JEIA 3GR1A 4EZ9A 3RB4A 5D4PA 4TY9A 4KO0B 1VK3A 4UZCA 1EHWA 1F1BB 2EBGA 4X4PA 1RAEB 3GYGA 4Q2LA 1ZAVA 1R0CB 2DIVA 5K9FA 4EBEA 3VF0B 1RADB 1GNKA 3HD1A 3U1LA 2LEPA 3C6UB 2EKYA 2YY3A 2B8QA 4CYUB 1ZM3A 1LFWA 3KLVA 2GAHC 4LF5J 3OVAA 4F2RA 3R7SB 3QQCD 2IC3A 1LWCB 3HSGA 1IKWB 1XIQA 3BH7B 1KTQA 2MYFA 5HQLA 1J5OB 4X2BA 3RBZA 1R8CA 2F8HA 4IR9A 4GVBB 1TUWA 1GFWB 3PYEA 2IAJB 2QYCA 4KV8B 2AJ1A 3Q8RB 4GKKJ 4LSLA 3EPGA 3DFEA 3QZ7A 3A13A 4PYDA 4RNFA 3D6FB 2GGPB 3V6KA 2C3MA 3GILA 4ILRA 3NKYA 3Q8UA 1VBYA 5J2PA 1L5UA 4HACB 4JI5F 1VQLS 4NLDA 4P71A 3CGIA 2IDLA 2HLTA 3FRZA 5D0HA 3W63A 5A2QY 4UZBA 4ECTA 2J6TA 2XLIA 1REVA 2ZNZA 3EMTA 3MMAB 4XPCA 2BV3A 1WI8A 4G65A 2VQEF 1UFLA 3OR2B 4XDDA 1O6XA 4M5GA 1NK4A 2DR6A 4LSNA 4OYXA 4KJIA 1N36J 1GTEA 1Q4RA 3RRKA 4K5SA 3ZTPA 2DR8A 4ILLA 1FO1A 1KONA 1UW9A 1N33J 1S6OA 4X62J 1QTNB 2AYMA 2OPQA 1JXEA 1PBUA 2HURA 3GFYA 3MCSA 1KQKA 1UZHA 2BRLA 3J80U 4KBIA 1NBEB 1UZDA 3CJTA 3PW2A 4FYDA 3CTRA 1JJ2R 4WPAA 2HWHA 3QJLA 2NQPA 1C1BA 2GAGC 3AA8A 3UD5A 2ASYA 1NSQA 2MEWA 5H9EJ 3NAHA 2B6AA 2YNHB 5EDWA 2HK3A 3BO3A 2HFUA 2P8IA 4ECXA 4N77A 1SC1B 2RIJA 3MEEB 2R8JA 3BREA 1TKXB 4OZJA 2BX6A 2Y1RI 2BANB 5L1LA 1U48A 1SJFA 5T14A 3FZBA 2EW9A 2M4MA 4BWJA 3GIJA 2BACA 1H3DA 2NUUG 4YN3B 4ERDA 5IT9U 3QZ8A 2P6TA 1CQMA 2RT3A 2DTJA 3H2VE 3I31A 4ENOA 2AZ3A 2AYBA 2QA1A 3RAQA 2XYPB 1T94A 1VJWA 2AKWB 4OYBA 4MK7A 4DUZJ 2APOA 4DF8A 2RU3A 2EI5A 1U45A 3CJRA 1ZYQA 1ZTTA 2G9OA 4NCAA 3BR8A 4ZPDA 1Z4UA 4DEZA 5EUHA 1NO8A 3HDSA 2RS2A 4WF9Q 1F5AA 3K59A 2HAIA 1KLMB 3H42A 3MR5A 3M8YA 2KL8A 5CCMA 2CPEA 3H40A 5HN0A 4EBDA 2CQ1A 4ZLJA 1I94F 3RB6A 2F4VF 3E3XA 1YI2S 5D78A 3X1LB 3GYXB 1UAWA 2IHR1 5GMDA 5HL7Q 1JLGA 5KT7A 1VOMA 2IJFA 2NYIA 3FBBA 2XC9A 4ED4A 1TAQA 4PPZA 1SJ4P 2ZH8A 1EQMA 5KG1A 3MAHA 4DR6F 1KTVA 2VJUA 2XMWA 3HVRA 2OTLS 4U96A 1RT7B 2DHGA 2F63A 2P6SA 2J76E 2LP4A 3EGVA 1RI7A 2DGTA 2LEAA 5E3RA 3UN2A 5HBMB 9RUBA 1A0OB 4PAAA 1L3KA 1S97A 5IM0B 1FJEB 5D3GA 4IFVA 1GXLA 2BJ7A 3RJMB 5GAHU 4L6V3 3NBPA 3AFGA 4E0DA 4RKUC 4LF6F 4F4WA 5ETLA 2ZNYA 3KOAA 1I51B 2YX4A 2WBMA 3AXKA 5CD4A 1IXKA 2QA4S 5LSRA 1I1GA 2GA7A 5C25B 3QATA 2ABYA 1G6BA 4I64A 3J81j 4IOBA 1QAJA 3TA0A 2UUBJ 2OTJS 2N82B 3KUGA 1KNZA 1DBDA 1N4LA 1RT1A 4JUZA 4KFBA 4JV1A 3IR5B 2VFUA 4ES1A 2RQCA 4ZK7M 2Z8QA 2AF6A 1HR0F 5K8NA 3OTOJ 1VGYA 1QLNA 2H4WB 4A8OA 1Y5LB 3HM9A 1N0UA 4M5LA 3L7OA 2KT3A 4UQGA 5C42B 5EWGA 3M8PA 2XWYA 3TAMB 3CJ0A 1Y3KA 2GMJA 3L09A 2HVDA 2XZTB 3UQSA 1CS4B 3PV8A 2M8HA 4YMEA 2CA9A 1JLGB 4ECQA 1FWKA 1S6QA 2KXFA 3G8SA 4AQYF 3W2WA 4PQUB 2YNGB 5C7PA 4ZVSB 1B7FA 2QA4G 1FDBA 1F9FA 1EETA 1RAFB 1SIZA 2XCPA 5IV4A 2WONA 3BM7A 2M70A 3FBFA 1R0AA 4LSZB 2GJIA 3DMJB 3QO9B 4J9LA 3R2CJ 3M2VB 2AGOA 1BQMA 3QT5A 3IR6B 1NNDA 2FZCB 3MD3A 4HH0A 3DU5A 3NCQA 4DR4J 1FKOB 1TTHB 2LDIA 3ILLA 4WFAQ 4F4ZA 1RKIA 2ZD1B 1RAOA 4R5PB 4QYZK 1Q82T 4DV3J 4DCPB 2IIHA 2AZ1A 3MEGA 4HLBA 3KLHB 5L1KA 4Y2CA 2KHCA 2CQ0A 3GU0A 5T41A 2DK2A 3DRSA 3CJKA 3KG1A 4DR1J 2DISA 4O4GB 3D28A 3H0PA 3T19A 2EPIA 4ILMA 1DJ0A 3V81A 2NSCA 2XSFA 1T05B 1YITS 3T5JA 1VBKA 1AYEA 2DNYA 3I82A 3ISNC 5L46A 5KFWA 2UVUA 3AT1B 4Y3CA 2PA8D 3OQ2A 3O3LA 3KUEA 4P2MA 4YY3J 4PXDA 3BGLA 4C0HA 1TL7B 2DY1A 3FQKA 1M1KT 1XNQF 1Q5YA 2G2OA 3U02A 1E6VA 1S1VA 3HCXA 4CM2A 1RHJB 2Q3PA 2VDHA 3M2RA 3NMRA 2YH0A 1U6BA 1D3WA 1Q7YT 2RKIA 2J9DE 5ETVA 3IN5A 2W2MP 3I32A 3US5A 2KM8B 2MB0B 3G8QA 1X4HA 3A8JA 3DXBA 2IVFB 3S7RA 4EFAC 2VBWA 3ISZA 2BJDA 1FX4A 5LSLA 1HWJA 4DG1A 3BQ1A 3C14A 1CC7A 4OX9F 3D4JA 2MGZB 1FEEA 1QTMA 3KLIB 2HFSA 3LAKA 4KE5A 2YQ1A 1FKOA 2YNFA 3VWSA 1MLAA 2KHDA 4DR3F 1M5HA 3OBIA 1KVKA 4USJC 5FLXY 4RZRA 1BC6A 1T9XA 4CTAA 1VRTB 1IKXA 2JDJA 3OUYB 2U2FA 2V0NA 5LMNF 1CJKA 1VQKS 4O3PA 3TA2A 2CG8A 2ZVSA 2QLBB 4WYWA 3V4MA 2F65A 1R7IA 3DCAA 3NGKA 4ZHRB 1S0VA 2H1YA 2DY9A 1L3SA 1WJ9A 2CQCA 3BKTA 1ROFA 3D1QA 3M1VA 1N54B 2CNNB 5DZ7A 5D4NA 5BXIA 1U6ZA 4MK8A 4ZVHA 1YJ7A 2DH8A 3CJSA 4J5OA 1MWZA 4OYWA 4QQBA 3VVUA 3DI6B 4PXEA 2FVRA 1DRZA 4IR1A 3BGRA 3O1LA 5KFNA 2XS7A 2DHAA 2ZH5A 2FC8A 3ZTRA 2IRUA 2E1RA 1MU2B 1T9WA 3R5DA 4H4KC 3GE9A 4OI3A 4OLPA 3MMBA 1VS3A 1HI0P 3GIKA 3W8GA 3OSPA 1H2TZ 3QSYB 4Q2MA 3KHHA 2P9GA 2HZCA 2OPPA 2P9EA 4Y34A 2O3DA 3V6JA 2FVPA 1C1CA 4BHQA 3DRYA 1QM9A 1WC6A 4ZPAA 3M32B 3W2VB 3MOZA 2BE9B 2Y1JA 2BJ9A 3C46A 3M6XA 3W7BA 4J9NA 3S6EA 1ACMB 2MKHA 3TANA 4RNOA 2EG1A 4CLSA 4B9VA 4PQAA 3CCJS 1W2IA 2FDNA 3LP1B 4B9LA 1URNA 2IA0A 3OFHA 3CXCR 4F2SA 4ZMMA 4DV5J 4OJHA 3QRPA 2V5HG 4WIQA 1BXNA 4F0HA 2HYIB 2K3IA 4GRSA 3UWTA 2EFVA 3MECB 1S9GA 1C0UA 4EU0A 1HBUB 1E6YA 4I6AA 4ICLA 2HRTA 1U1LA 5F3TA 2V67A 2HZAA 2ROPA 3GIRA 4DDFA 3LOUA 5HMYA 4JI1J 3PYDA 3W9JA 3NWGA 3SQOP 4L73A 1GH8A 2MZQA 3V6DB 3TWZA 3CJ2A 4TY8A 5IC4B 3RW6A 2F9JA 1M5OC 2XULA 5KFGA 2W8LA 2DIUA 2ERRA 4FF1A 2CDRB 3J81U 1DQ9A 2MKIA 4P52A 4MIAA 1TUGB 5L1JA 2HQDA 5E33A 5D0GA 3KJVB 2BW7A 2LQ5A 4TYBA 3T1HJ 3BR9A 1SIWB 2QRRA 3R7NB 2LXIA 5IT9Y 3H2UB 4JI7F 3MZIA 4NMLA 5U47A 4JI0F 3MHYA 3L3CA 3OR1B 3BN7A 4ZVRB 3ETMA 4LR8A 1GXUA 4TU7A 2Y0SD 1U2FA 1Z2LA 1ZBTA 1W26A 4XAKA 3SCJE 4NLGA 2OAUA 1R3NA 4B3TF 4U7UK 3PZPA 4OYAA 1VQSA 3G8TA 2HQFA 1L3TA 1XK8A 1IM6A 1KFSA 5J2MA 2BKOA 3QIPA 4USKA 1F3VA 1SV5A 3TA1A 1PC5A 2EWHA 3CMES 4IG0B 4QW9A 1QDUB 1C4CA 4K4YA 3MECA 1N5VA 4C8ZA 3Q89A 1JXLA 1RCXB 2GCFA 3IG1B 3R5BA 4W4MA 2XMVA 4C9DA 3T9NA 4DJBA 5A6PA 3PW5A 4PKDB 4ATNA 3DLGB 2RHQB 4NCBA 5H1SV 4LFBF 4YR0A 3NS7B 3N4WA 3SV4A 1EKRA 1SKUB 2J9EA 3ZO7A 5HROA 3X3UA 1ZH5A 5F0WA 4CNYA 3ZTOA 1U1RA 1P27B 2IRXA 4OYOA 2IM3A 3DC2A 3IMQJ 4C97A 1ULRA 4K50A 3MM5B 2KFNA 5DZ6A 1KP6A 3ZZOA 5BR8J 1LEOA 4O0NA 1CULB 3MM6A 1VBZA 2V4RA 2FLNA 2J7WA 4ZLNA 3I5CA 1TL5A 5C25A 2DKOB 4J91A 2GO8A 3R6GB 2PFDA 1TK0A 4LF9F 2HQGA 3ZTSA 5L9NA 5LT5A 1IJEB 3C66A 4DUYF 2L3MA 2ZOGA 3CB4A 5L38A 2R7SA 2CQPA 3DLEB 4K2JA 3DU6A 4DV1F 1XMQF 2B9EA 1AZSA 1FJGJ 2LLZA 1KFDA 1VCTA 2VB6A 1RT1B 1FKPB 4OZ0A 4RW4A 4ZP6A 5KFCA 2A6OA 3KMQA 4OZ5A 1YJUA 1S6PB 3LPEA 1VQPS 1ZTWA 1KBRA 2YWFA 3BDEA 3QGHA 4NZ6A 3GPAA 5BYQA 2J8SA 4OI1A 3UDLA 4P2SA 3D2WA 1WKLA 5I3UA 4OHYA 2HBQB 3HHLA 3RAXA 5DQGA 5CD4H 2C28A 4DLEA 4J9RA 4KV8A 3D6TB 4HYKA 4NCGA 1U0HB 1U1NA 2C2KB 2E1AA 2VUGA 4EWTA 5LMUJ 2IRYA 2H54B 3QWUA 2QGFB 2Y1LB 3M8QA 4B3TJ 4PYAA 4RBTA 1JLFB 2VOPA 2FIUA 1F60B 2CZ4A 1JB0C 2HLUA 2ZBRA 2RDIA 5GADI 1RACB 2CNOB 1VIXA 2V9WA 1SUQB 2GFFA 4X4NA 3FZ2A 4ZKAA 3TJ9A 5ETKA 4ZLPA 4ECUA 1D9DA 3K58A 4MT1A 4X64F 3C15B 4IDKB 3UNYA 2HS0A 1UJ4A 1P1LA 4LF2A 3AA9A 1VIOA 1T9VA 3NEKA 2F8MA 4RW7B 4JI2F 3KHRA 1J5EF 3VAIA 3NNAA 2PMWA 1QSLA 2BABA 3MM8A 3VAJA 4ED2A 1JJ4A 2XMJA 3ETOA 1IBMJ 1X31C 2DGVA 3TR5A 5LXRA 2DD8S 2J0QD 2ZJRQ 1XWLA 2D7SA 1HNZF 2OJ3A 3DRSB 4TQSA 3ICLA 1OPZA 1B64A 2ZC4A 4K4WA 2BM0A 2MY7A 4F26A 2R2UA 4YDXA 3FFIB 4AE5A 4CH0S 1UEVA 4DI6A 4B3MF 2QO3A 1WTFA 4KH1B 3C19A 1C0TA 3MAAB 3SI8A 4C8LA 3OVBA 4CNZA 1YRTA 1S1TA 4HHUA 2PMZD 2LCWA 1FF2A 3NGTA 4LF7J 3V4IB 1UWAA 2UU9F 1HNWJ 2MHEA 4MKVA 3BBBA 3KTQA 2R8HA 4KH0B 2V4JA 4I7FA 3TAQA 1KVIA 4OHXA 2CKWA 4BCAA 4R8UB 1N6QA 4ANDA 2CJXB 3BEGB 3H4DA 3AD8C 2E9RX 1NLKL 4PWWA 1WF2A 4TYAA 3J7ZT 5EN1A 2WRMA 5M2UA 1T8EA 4ZCLA 2CZ9A 2VL1A 4YHHJ 4DL6A 3QIDA 5HLFB 2LQ8A 3N28A 1R6YA 1RWOB 3I9V9 3K2YA 3LH2S 4NLUA 4KAIA 1U1PA 4A8QA 1RTIA 3RGIA 4ES3A 2BE2B 2QMXA 2MKSA 4AFFA 3PW7A 2XY7A 2FVSA 4HH1A 3MTKA 4JB8B 4WKRA 1CJVB 5A76A 1VMBA 2GVDA 5L1IA 2LECA 4C2MA 5E3QA 2C2DA 3CE8A 4EEYA 2ZWOA 4WCEQ 3PRVA 1YHQS 2IMWP 2HFVA 4EZ6A 4ZS6A 1WOSA 4DWIA 3PX0A 1QSSA 2FGCA 1REVB 4DR2J 3BB5A 4NLTA 1X8DA 2C42A 5DO2A 5JUMA 5KFQA 2QMUB 4M1KA 3I87A 3UR0A 1IBCB 2HIYA 4WE1A 4JI2J 3Q8SB 4NLXA 3DOMA 2UV8A 3JYTA 2NUHA 1SQFA 1I3OB 1ZPVA 4K0KF 1BUXA 2E5HA 1GTHA 1PYTA 3OD2A 1R8BA 3FEXB 4PXBA 5B09A 1S1TB 2HGLA 3KK3B 2AGQA 1IBMF 3AJ2A 4MFBB 4J9PA 3JSYA 2HHQA 4CO0A 2XBPA 4P2FA 4TLQA 5EHHA 2GIQA 5F8HA 1QUVA 2GMLA 3LANA 1L3VA 5F8NA 2DO0A 1YG0A 1RZMA 4K4VA 2NCKL 3N0VA 3M8SA 1M5PC 3TP2A 3G6VA 4FVCA 4X66F 4DS5A 1CJUA 4WFBQ 4LF7F 5DM7Q 1CVJA 4C8YA 2VG6A 1TKTA 2HHWA 2MSTA 4IRCA 2YNIB 2BJ8A 3FCHA 3HSDA 3LO3A 1R8PA 3OTDA 2UUBF 4GO5X 2NR0A 1HNIA 3DNCA 1XR5A 5AXNA 3KHGA 2YBVA 2ZDOA 5D4LA 4V19J 2I5JA 1VFJA 7FDRA 1G3OA 2FTRA 2JWNA 2FVCA 3PG9A 1N48A 3PKMA 4EBCA 1GMVA 3IWLA 3GG1A 3CUNA 2HFOA 4P75A 5ETMA 3JSMB 2RF2B 1MWYA 3VAMA 3THPA 4CO4A 1SC6A 1JLQB 2CVEA 4DQQA 1S72S 3CMAS 1VQNS 4F4XA 3KMSA 4F7VA 1B99A 4QR1A 1VQOS 1RT3B 3IXQA 4UUXA 3RTVA 3SV3A 1TVRB 4Q0BB 1IJFB 3J80Y 2W2NP 3K5OA 2IM2A 3D6MB 4P74A 1U09A 3DDKA 4M5DA 1RHKB 3W60A 3F73A 2FVQA 3D3BJ 1EB0A 3GONA 1FTCA 3SDEA 2HNZA 4PG5A 1LWFB 1N52B 2XG8A 4CIOA 3UW1A 4UY8T 3R27A 1P8GA 4RL1A 3D3CJ 1SL0A 1TR0A 2J5AA 4KIAA 3W64A 2M7SA 2CQHA 5J2QA 2LA4A 3VCDA 4DR6J 2JNJA 4NYOA 3MM7B 4O23A 3ZNUA 2MY8A 4G1IA 1UVLA 1T11A 3NG8A 4UOCA 4A8YA 3HJFA 4Z7CA 5KFIA 1SQGA 2DNLA 2MJNA 4PCQA 3RW7A 2JRSA 2W2PP 2PI5A 4FF4A 1QAYA 3FUYA 3QGIA 5LJ3Y 1TK5A 2R2SA 1HQUB 1NSPA 3HZEA 1S1UB 4IG3B 3CCUS 4DSKA 2FHJD 3NCPA 1RTJB 2CJBA 1KOHA 1EKSA 1U8SA 2QN6B 4G1QB 5KFZA 4C0OC 4I67A 4N56A 4YB7A 4D3HA 5B0BA 2YWGA 1S99A 2FY8A 4QZVB 2NYHA 1HQEA 4YS2A 2XWXA 1JLEA 1SCJB 2QA2A 2MLXA 2IMOA 5F41A 2MZ1A 1HLWA 1RHRB 3K0JA 1NDKA 1S1XB 2R3VA 3PM9A 1RLDA 3GYNA 4OYIA 3NGSA 1T3NA 2ZH7A 3HJVA 4MAKA 3DGPB 3KLFA 2XI3A 4OX8A 1TFYA 4PRFA 3HSJA 1SH3A 2V8HA 2XSJB 3C6TB 4KB7A 4V19X 5K20B 4J9OA 5D6GA 2RE1A 3DGVA 4IRKA 2V34A 4C7QA 2FLOA 2HNZB 2IM0A 3D66A 5T7LB 2FD2A 4CLTA 3LPYA 3VAGA 4EYIB 2MXYA 4TLRA 3RB3A 2NZCA 3DMJA 2H5JB 2E29A 3Q8VA 3AJ1A 2JEJA 2WOMB 2H5IB 4O44A 4JOUA 4OZ1A 1H73A 3TUZC 2X1FA 2HHXA 1RISA 2K1RB 1FHTA 1ZAXA 2Q43A 2Z57B 3PR4A 4QR0A 3GIMA 4OI0A 3EZUA 2FJVA 2YX1A 2MZJA 2RDDA 2ZD1A 3PYGA 1UVNA 2M9KA 2FQQB 1IBLJ 4NL5A 2HPUA 5L39A 5HP1A 2KTQA 2DXFA 3RBEA 1MWQA 2CPHA 1TU0B 2MZRA 2GHVC 3MFHA 4WK1A 2OO4A 3HVTB 3MD1A 5LXYA 4CM0A 1FX2A 3T5KA 1YLXA 3PRBA 1LV5A 1HD1A 4QIEA 3L4BC 1D8ZA 3W9HA 2J7UA 4LBIA 2PI4A 3HF5A 4WFYA 4DV3F 2CNLB 1WG1A 2RILA 4CO5A 3ZTQA 4Y28C 2G1DA 3VALA 1S12A 2KVIA 1DTTB 2CPJA 4WYLA 4IFVB 1RT2A 4X4SA 2VG7B 1XERA 5JVGQ 2JC0A 2FZGB 3RZAA 2ZBCA 3AOCA 4NA1A 2F8EX 2VU5A 4OZNA 3P49B 5K14A 1VHFA 3V6HA 1U1QA 1NMEB 5IZHA 4FYYB 4DFPA 3A8EA 3QAEA 1FFSB 5LM7E 2RH3A 2JLFA 2C2OB 3OPKA 2W01A 4B9TA 2UXBJ 1RAIB 1YRXA 2B9YA 2DNRA 4TVAB 3EICA 2GQCA 1HNXJ 3QLHB 1WC5A 2HBZB 1B7YB 3D9BA 3LP1A 3V5RA 1LXNA 4J9SA 3QGGA 4WKYA 4ZPCA 1ELOA 4GVBA 2KO1A 3P96A 2HBYB 4PWUA 3OL8A 3MCMA 2FY1A 1RSCA 2K7JA 3L7UA 2KYXA 3PEHA 4NEZA 1AW0A 1B0PA 4NLVA 3IRXA 2IVYA 1OMSA 3MM9B 3EJMA 2BEFA 1CSJA 1E6YB 1RK8A 2XHCA 3B8HA 2C2ZB 2QMWA 1WOPA 3HFKA 4CLZA 2YNFB 3SSQA 4A47A 4A4JA 1FFWB 4J9KA 1IR1A 1YX2A 1WEYA 4NLYA 1RWMB 3KWMA 3FMBA 4RW6B 2X3DA 3FRYA 3TRGA 1VR6A 2B4OA 4QYRA 3GCXP 5HP1B 1XMOF 5F8MA 1VJQA 3FC9A 1FK9A 2M5YA 5KT3A 2UVWA 5HBMA 4WU2A 1SXLA 4U95A 2ILZA 3IS9A 2IY5B 2ZOMA 2ZZMA 1NPPA 1U4BA 3LA0A 4LFCJ 3I56S 4KGVB 2W1BA 4DX8H 4IO1A 1N88A 4NA2A 2V8DA 1LWEB 4GKKF 2AW0A 3QJJA 3GSDA 3RUBL 1RBAA 2C3OA 3N79A 2RUGA 2KH9A 2B4PA 2DXDA 2XMTA 1M5KC 2H65B 1RYSA 2Q66A 1N34F 5KFTA 3R5AA 4USMA 2BOPA 1SJRA 2E7VA 3N01A 4ES2A 4M5JA 1R8HA 3C16A 4DPXA 3H25A 4DLGA 1LW0A 1QAXA 1X4BA 4NI2A 1RAGB 5KFMA 2VC1A 3TARA 1XN9A 3T1HF 3TAPA 3P5BP 1VRUA 5LJ5Y 1VC5A 4KHPF 2YKNB 1IWGA 5H9EK 2B6AB 2M8DB 2UV8G 5B0CA 5KOXA 3GJSB 2KN4A 1T9YA 3FSYA 5HVFA 6FDRA 2LQ9A 1KQFB 3G82B 4O3SA 3WBZA 2HEKA 2E5LJ 1CBKA 3HLUA 2OI2A 1QD1A 5E2QA 3FSIA 3NMAA 4IH5A 1XR7A 4EMDA 1X4GA 2BYCA 3W62A 3JQMA 5B0FA 2FB0A 2FUG9 4ZIVA 1UVJA 4B3SF 1WC4A 1CPZA 4EO8A 4OJ1A 1FRXA 3UN3A 2VA3A 4AYBD 3RYLA 3DLHA 4K4ZA 3TZWA 1BMQB 2FC9A 3QAUA 4QJVA 1R0AB 1XBWA 4CLPA 1N0VC 2DNMA 3IS9B 1DLOB 2W9BB 3MXHP 1EP4A 2DNNA 1RTHA 2RQKA 2FGOA 4RO0A 4DL5A 4C3MA 1M5SA 4Q5VA 1HYSA 4R5PA 4N8NA 5KFAA 4JI4J 1S77D 4I56A 2L48A 1NCLA 3DRXA 1X9MA 1EZZB 1RXOB 2WSEC 4NZ7A 1VQ8S 2F9DA 1MW7A 2DHXA 2VF3A 3N6MA 1JLCA 3MI7X 5A8RB 5ETOA 2BQRA 2NZ4A 4P6QA 6AT1B 7AT1B 3ENVA 3MMCB 4NLQA 1T7PA 2O66A 3PW0A 2R4FA 3MMAA 2MHNA 2V69A 4DX6A 2FZKB 5CYMA 5FDLB 3MR2A 2CAJA 5ADZA 3A3NB 1YRUA 3H90A 2KXHA 1FDAA 4LRCA 4OX7A 1NK9A 5KFDA 1Y0HA 2OFGX 4RR5A 4LRFA 5KG5A 4JI8J 4DV0J 4Y00A 4OI2A 4USUA 1SI9A 3PIOQ 3ILIA 4IH7A 3CJQA 5B08A 3CCRS 2BR0A 2KYZA 2CZVC 2IJNA 2RDJA 3CCSS 2EXUA 2H48B 4RW9B 1RT6A 3T9ZA 1JKHA 3UCUP 2UXCJ 5J1PA 4HHJA 2VPZB 3IAS9 4ZN1A 3TEHB 2YKMB 4A8XA 1HBNB 4CLKA 4JI3F 4PG4A 2CFXA 1PIEA 2JZ5A 2X3GA 1JLQA 3F44A 4XO0A 1VK8A 3IRWP 4AT1B 1H38A 2R7OA 5IQ6A 3M6WA 3CC2S 5KFSA 4DUTA 4FPRA 2C2NA 3K57A 5KT4A 3POTB 5AXLA 3I0SB 5DDOC 4B3RJ 2QE5A 4J9UE 3GFXA 5HROB 3WC0A 4YB5A 4C8OA 5D4OA 5AE1A 1ZOTA 3FMWA 2POKA 2D3OR 2DNZA 2OPSA 5CABA 1K8AT 3C2PA 1JLCB 4F3MA 5IWAF 2QG9B 4ZVPB 3BGFA 1V3ZA 2QLXA 3DHWC 3OTOF 1ZPWX 1HI1A 1S76D 2L9WA 2UVVA 2DBBA 2VQFJ 3RG6A 3FCWA 1VQ7S 1HWKA 5A8WB 1HPZB 2DJWA 2OMLA 1FRJA 4NXMF 4TU9A 2XMAA 2D3UA 2ZBQA 1S9EA 2D69A 3HFVA 3JTOA 3M6VA 4X4RA 1TL1B 2F7VA 3DM2B 3ET6A 1NK6A 2LKZA 2W24A 2WVBA 4JI6J 2QSFA 4OZ3A 2M88A 5GMKa 1XEZA 3MEEA 5E3PA 3SCLE 2XS5A 4JV5J 2LA6A 4AD6A 2Z2LA 2KRBA 2DH7A 1U25A 5HJXA 1K47A 3AXMA 4C48A 3CMQA 1YWXA 5KFVA 4AUKA 3K8VA 1XMQJ 3FEZA 3A4TA 5F3ZA 1X9SA 4QPXA 1PCAA 2VG5A 3VGUA 1KRPA 1FRKA 5C24B 1AB8A 3E8OA 4ED5A 3LW5C 1PBAA 3Q86A 4CWBA 1ZETA 1HR0J 1BWEA 4X4UA 2FJDB 5MAOA 2AHOB 3BSCA 2HFNA 3ZFVA 2KG1A 4WIIA 1U24A 4PG7A 5A0YB 5AE3A 2RRBA 5LOQA 4X84A 3HMJG 1LWXA 3KK1A 1TFWA 3BGOP 1Y11A 3AOAA 2K3KA 2QFIA 2ROGA 4ECRA 2OPSB 3OFGA 1UWBB 2YTCA 1KLNA 4HT7A 1CLFA 3PNIA 3GG0A 4I2PA 3EGZA 1VQMS 1NDPA 1PILA 2B8PA 1IKWA 4AQYJ 2FJEB 3M9MB 2AJQA 1OWXA 2HBRB 3BDPA 4L74A 1IM4A 5ETTA 3B4DA 3I5BA 3IGVA 1PGZA 1IBKJ 1UJ6A 4WXWA 1J5EJ 4KKOB 4LFAF 2IAJA 3IM9A 4LSLB 2LFVA 2GIRA 1RU2A 2J9CA 2E5GA 4F4YA 2F4VJ 3BYRA 5CQGA 5SUHA 4NASA 5IM0A 4ER8A 1PO6A 1VRQC 2QSWA 2O1PA 4DU7A 1APSA 2V94A 1Y5IB 4W98A 2GS8A 1N32J 4JYAJ 1SC3B 2C3PA 4ZVOB 2AYGA 3GR0A 1UW4A 2BM1A 4GVLA 1AROP 2HQ3A 2MQLA 4JI6F 5A8KB 1HWLA 2D9OA 1GT8A 2PN6A 3A8IA 5K14B 4RW8A 3CCES 3J7YI 3CULA 1LXJA 1IVZA 3BJYA 3MMBB 2ACYA 1M1GA 2QLFB 3CVKA 3TZXA 3SYZA 3EPIA 1RT5B 1RHUB 4ED3A 1RABB 1RWKB 1BQNA 1T0TV 2B5JB 4C11B 4KRWA 2I6WA 1FTRA 2PO4A 4H4OB 2BJ3A 1TKZB 1X4EA 2VA2A 5ETSA 4ALZA 1LFPA 2N7CA 1HKAA 4YR2A 3IRXB 3H5UA 3MM9A 2R8IA 2YWEA 1S1WA 4MK9A 3RB0A 3DLLQ 5FLXU 5HO4A 1XR6A 3DLBA 2J0WA 4C0BA 3I0RB 4IYQA 4LMZA 2CPDA 4NCGB 2YNGA 4DBQA 3VZHA 1IKYA 2G4BA 3NL0A 4OX9J 1BD6A 3FDSA 5I3QA 3MOJB 2V6AA 3PHTA 2XMUA 2HWIA 1HNVA 3IA0A 4WE1B 1C0UB 1X5SA 1HL6A 1SJQA 2ZITA 4XK8C 3W3SA 1D8YA 3MCOA 4N41A 1NU4A 3CJ3A 1HBOB 2X1GA 3JB9k 1H6KX 4HI2A 3D1OA 4YP3A 2MGZA 4LF4J 2NXUA 1KLMA 2ZKUA 4TNOA 3SQGA 1ZAWA 4RW8B 2ZM6J 2WSCC 3SXLA 3OJUA 4ECZA 1N5YA 1NK7A 4YOEA 1QVGR 3BBFA 2MKYA 3EGWB 2QJ3A 3FEYB 2HHHJ 1FD8A 2IA6A 4JYAF 2W4CA 2O01C 1ZA2B 2B5JA 2JX2A 2XHWA 4O4RA 1BHNA 4C11A 3CCLS 4FXDA 4M5MA 1MG7A 1ZM2A 2LMIA 2YKNA 4ID5B 1P1TA 3NBPB 1H2UX 5D77A 5J2NB 1HNIB 4HR2A 3KYLA 4A48A 5D3GB 1FXRA 2Z2MA 3EVMA 4Z7YA 5EWFA 4Y2KA 2DR5A 2HVHA 3DOKB 2AIRB 3PR5B 4CT8A 3QT7A 2Z56B 3HSZA 1Y7PA 4H54A 3ILJA 4DV2J 4BS2A 2XSJA 3KNGA 3CT9A 1U49A 4LF8J 3BN4A 3WQPA 3R1HA 4OQJA 2HZVA 1SH2A 4N7TA 4C8MA 3G2XA 1X4CA 1N5TA 1OSCA 2LXUA 2P5VA 4LRDA 4ZPVR 4KQZA 5EWEA 1Z1ZA 2ILYA 5H9FJ 4DFJA 1TKDA 4KHRA 3TUPA 3HT3A 3GCWP 1WG5A 1NH7A 1UPMB 3WDOA 4RUAA 4PUOA 5J2PB 4GKJF 1MN7A 4MKYA 3T1YF 3ELHA 3QGPA 2GIFA 4H4MB 3SQGB 4B9MA 1N5SA 3DKDA 4OIXA 3OXGA 3OT9A 2FPHX 3AJDA 4OLOA 3GQCA 3G4SS 4DX5A 2UVRA 2KT2A 4IH6A 3B54A 1S6QB 4R0JA 4ZIWA 2R7WA 1PG5B 3W2WB 1IQZA 1FEHA 1PJ7A 1UVKA 2WSFC 2BJ1A 2K7KA 4F02A 3NS6A 2O5DA 2P2CB 4C3KA 2CIMA 2ZEJA 4F3OA 1K44A 4OHVA 3MUMP 1P9QC 2H51B 2HMIA 1A9NB 1NHVA 3LWMA 3ZZUA 5KFXA 3TOQA 4I1TA 4RX6A 1RT4A 2W25A 3MGJA 1RDRA 3OW2R 3OXFA 4F0KA 4JI5J 4EI2A 1B0VA 4TKTA 4DXLA 5AT1B 2YNHA 2RVJA 1MNEA 3FJ2A 2F40A 4DV4F 2HNDB 1T03B 1VI7A 4ZVGA 2HVIA 1EARA 5K8PA 4DL2A 4QOTA 1QE1B 2HHHF 4DR5J 4IQXA 3RR8A 2HAFA 2VFTA 2ZUAA 2MMYA 3OLAA 4W90B 1C1CB 3QPIA 1JJCB 3C8YA 4K5RA 5KG7A 2RRAA 2CPXA 1AZSB 1I5OB 2VPWB 3GTYX 3KG0A 4DFMA 4DL4A 3IFEA 3QRRA 3R5JB 2VBXA 2B9XA 4P7VA 1XMBA 1ZM9A 2CQ2A 1R0BG 3MF5A 4FPIA 5A6WA 2V2QA 3S1TA 2RSQA 4OYZA 3TX8A 3GSIA 4LRAA 1X60A 1ZZFA 2Q1LA 2PEHA 4DX7A 4F25A 4QWEA 5IT4A 5I42A 4EO6A 2GHPA 5JJBA 2DHSA 3M2UA 1FKAF 4CYUA 5T7LA 4LIWA 1X9WA 5DGAA 3MPDA 4QWBA 3ULHA 3KJFB 1SL2A 3EUNA 2ATLA 4Q7AA 1JNRB 3V2UC 3R6LB 3QSIA 4K2XA 1NAQA 2F5GA 5BYRA 3TQEA 2ZHOA 2MQMA 1G4CA 4RUCA 2MDAA 2CDQA 3OVSA 3KK3A 2J0SD 2ZH9A 4PEOA 2OEMA 5EX3A 4DR7F 3JQJA 1TL3B 2OP5A 3TVYA 3D0HE 3IG1A 2JC1A 4Y2MA 3GV7B 3C15A 4F4KA 1CS4A 3DRRB 4KGMA 4DSIA 4URSA 3LP2B 4I69A 1HIYA 4E98A 3H5SA 3HT0A 3EDQB 3ITHA 8ATCB 5KFOA 1SJ3P 3NOGA 1ZA1B 2ZHAA 4NE9C 1JLBB 3OFFA 1NJZA 2AGPA 5D8HB 1RTDA 3DOLA 3NAIA 1X0FA 2VPXB 5IC6B 2BBEA 1K0VA 4X64J 2PD1A 1OS5A 2MLZA 2Z0GA 1KS2A 2YNIA 4ITSA 1BQMB 2WK4A 3HX9A 2NPIA 1TZ0A 4NLPA 2PE8A 3LGHA 2JJ4D 3FBCA 4R8UA 1NK0A 4J7CA 5KFKA 2XLKA 2H5EA 1DQAA 3BQ0A 2XO6A 3OXLA 2ALZA 1D1UA 2UUAF 4FBUA 1ZZNA 3D6HB 3S8SA 3I9ZA 3KUHA 2HQCA 2DNGA 2KJVA 2OKQA 1GX6A 2CJYB 4RNHA 4DN0A 5HVHA 4DF4A 4ELVA 1C1BB 4ZVFA 3MEDA 1HQUA 4JI0J 1YGYA 3CDWA 3MMJA 4MKAA 3P5TL 2HVEA 3SEOA 5LMUF 2PFFB 5HI7A 1PKUA 3M8WA 1RCOB 2QC3A 1FNMA 1W7WA 4DHVA 1HNXF 2EVZA 5K8MA 4FF3A 2E5JA 2DCUB 2Y0BB 1OO0B 4F67A 2DGUA 2BANA 4UF4A 4PG8A 3BPDA 3JTNA 4QPTA 1RAAB 4QIWD 3PX6A 3LQVA 1FRMA 4NX9A 1F9EB 2ZOFA 1NB7A 2FJAB 3M2RB 1FDDA 4CO3A 4ZCKA 1MMNA 4L72B 5CZXA 3SDEB 1C2PA 3QYYA 1U1OA 2WB4A 3R7BB 4CLYA 3NGUA 1U8WA 2GC8A 3ITHB 3UDEA 1WI6A 2D41A 4IRDA 3M2VA 1EAYC 1WHVA 2ZKTA 2DCLA 4FZVA 3PJ9A 3K5MA 1WC1A 3ZC4A 5THWA 3D0IE 2K2PA 1CJTA 1G7CB 2GJFA 4DMZA 1R31A 2LXFA 4OMFG 3AQPA 4N8OA 4ECYA 4HDGA 2C22A 1RYRA 4DQPA 2IYGA 1LKZA 1UFKA 2C3YA 1WORA 3JXOA 3KLHA 1HNZJ 2UUTA 3WIVA 2J8AA 3IR7B 2KT5A 3Q2SC 3Q8YA 2I8EA 2MJUA 4LFCF 4WZQA 5L9XA 2CQ3A 3R5GA 4CDIA 2VICA 1N33F 2H3EB 3BZQA 4A46A 5EX0A 5KFBA 4PPDA 4IO9Q 1S4EA 2AJ0A 3KK2A 4U8VA 2GGPA 4DUYJ 2MKJA 3TVZA 3CCZA 1HBNA 3DLKA 2E9ZA 2FJBB 2JHEA 3QBCA 3CJ4A 1LK5A 5HK4A 1J27A 1C0TB 3MAAA 5H9FK 2RJZA 3HKZD 3KKFA 3LP0A 3R8YA 3ZZ0A 2J6UA 2WTFA 1SL1A 2VG6B 3BGRB 1FT8A 3RBXA 2HGMA 4JI3J 1H98A 2AYEA 2CQGA 2BRKA 2W2OP 2DNKA 3EYZA 1T95A 2BE7D 2X1AA 1SJ1A 2QIFA 3R97A 3EZOA 2Y8WA 3F56A 2B9WA 2ZE2B 3N6LA 1SBRA 2DH9A 2KKHA 4DR2F 3T6BA 1JQGA 2M52A 4YDDB 2C2MB 1VRTA 4K4SA 1OPIA 4LRBA 3VGTA 2ZZNA 1NUEA 5D0EA 1UA0A 1I94J 1NK5A 2DPIA 4MKBA 4ZPBA 4C98A 2L9NA 3BS9A 1FXLA 4G1PA 1FXDA 3FBEA 4L75A 1V5VA 4ZVQB 3PJWA 3U1NA 4EYHB 2HGNA 3H7HB 4CLWA 5J1EB 4J9MA 4DV7J 3LUYA 4EGLA 3KLGA 1KQSR 3CNQP 4LVOP 3W66A 3DOMB 2VOOA 1WUUA 3PTWA 1ZS6A 5I3PA 3FQLA 4URGA 3NP5A 1IR2A 3Q8PB 3MUTP 3FCVA 1WEZA 2CXEA 2M0GB 2R42A 5KFEA 3HHDA 2JEGA 2RS8A 1JLAB 2UUWA 3HULA 3MEGB 2GVZA 2XGQA 4KPYA 4MMOA 3HZGA 1NZ8A 4I6YA 2UU9J 2AWZA 3DLEA 2DYAA 2N3LA 4DV6F 4DSJA 4USIA 4WP3A 3UR3C 1Q0NA 3V81B 2ZH3A 1WNEA 5M2RA 3DYAA 5HQ8A 1Q81T 1HD0A 3AAWB 5DLGA 4C8KA 2QLWA 5CZVA 5HAOA 1X0PA 1CJVA 2PSZA 1RB0A 4Y0FA 4P9SA 3CO9A 2V8VA 1T05A 4YHHF 4G3IA 3ZNJ1 3QJPA 3D68A 1SH0A 1Y10A 3DGPA 3KLFB 4FN5A 2HQIA 2LEBA 3ENQA 1E6VB 1HARA 1S1VB 1TL7A 4FP9A 1CG2A 3ONQA 1WKJA 2J7KA 4PR6A 3W2VA 6FD1A 2CWXA 4J37A 5F9NA 1JX4A 4RU2A 4MIWA 1HI8A 2HHVA 3TQ1A 1X5TA 1HFEL 1Q95G 2CWKA 2H4YB 2W9CB 3DRPB 3BGUA 4KT0C 5ETPA 3W1YC 2XCAA 3GV8B 8AT1B 4DR3J 3HP6A 4I2QB 2N4DA 2GZOA 4IG0A 5CYJA 5KT6A 4X65J 5DJBA 2V2ZA 4KFBB 3GB0A 1NKCA 1NJIT 2GJ2A 3C14B 3LTOA 4Q45A 1S9GB 1WDTA 4RLEA 4HACA 2ASJA 3Q0AA 2G2ZA 2XNRA 1UEKA 1CC8A 2A6MA 2G0JA 3NXZA 1B0TA 1KWMA 2A18A 4MJKA 3UCGA 4B3OB 3J7YU 1XTZA 1AFIA 1LQ9A 4OZLA 4TN2A 5C42A 3IBCB 2VBYA 2YVSA 3MM8B 3O44A 5KG6A 4BLGA 3W8PA 4IFYB 4RUHA 1CJKB 4GC7A 3OR2A 3U27A 3WX4A 2HHTA 1SB6A 5B0EA 3QNWB 1IQTA 2VKZG 4IUFA 3A1YG 4L76A 3KG4A 3F41A 4KYZA 1CEZA 3WIUA 3D1HA 4DPOA 4G6VB 1FVQA 2MPUA 4WU3A 4TU8A 2Y1IA 3P8BB 4KPCA 4F36A 1CQNA 3B78A 4QBUA 5KOWA 2A2CA 2M3DA 1H72C 5KFJA 2VPYB 2B7CB 3BF4A 3MPWA 1N6QB 2EFOA 2DR9A 1X4FA 1OYDA 4R25A 1YK9A 1DARA 3MR7A 4LJMA 1C4AA 1FE0A 1FKPA 3NCRA 3M30B 4RW4B 3W5YA 1PAEX 4DZ6A 5K8OA 2W7AA 5KFPA 4QWCA 4KTQA 1DAXA 5KG3A 4RWXA 1AXQA 3A3OB 1WOOA 3DRPA 4P73A 2BUNA 3GLJA 3P3DA 1F0XA 5HATA 2ASLA 3HHLB 4NXNJ 3BYPA 3NNCA 4PWDB 1Y4ZB 2EFQA 3AB2B 3CIMA 2OPPB 3M32A 5K5MA 5KFLA 1A7GE 1WWHA 4QIGA 2R7UA 2NPFA 1SPBP 1T9UA 5HMWA 1GX5A 1YZ6A 2HG4A 2R9LA 1Q1KA 2HHUA 2KI2A 3L9ZA 4UOGA 4LBPA 2DEIA 1YKWA 3IC1A 5AJ3J 4D3GA 5GAGU 2MQ8A 3PW4A 1KN6A 3DLGA 1Q53A 2AX1A 3OTBA 3THVA 4X65F 4DN9A 1OY8A 4AL5A 5DM6Q 1V9OA 3CDUA 2QV6A 2B0GA 2C2EA 1NSAA 1DTQB 3G71S 1IR0A 4UW2A 3B4MA 2YPZA 5F9LA 2G1HA 2QTWA 2NXEA 3M8RA 1LK7A 1D09B 3VR1A 4U67Q 4OHZA 1FRHA 1YJ9S 3Q83A 2QL7B 1YZ7A 3R9LA 1NPRA 3UPFA 2GV1A 4KGKA 1RT6B 2YPYA 3CJ8A 2ATCB 3GZ7A 3LF0A 3T3FA 3AH6A 1U7LA 2DHHA 4B9SA 1FDNA 4TY8B 4PZVA 1RTZA 4W92B 2R7VA 3ISND 2W8KA 3VZIA 1FA0A 5E5NA 4O4GA 5F8JA 1W2BR 4URQU 4LIRA 2D3O1
chains in the Genus database with same CATH topology
3BBBA 1NSPA 3VGUA 1NSQA 4ANDA 1B4SA 1NLKL 3EVOA 3Q86A 5IOLA 2HVEA 1NSKL 3VGSA 1PKUA 3G2XA 1W7WA 2BX6A 3ETMA 1LWXA 1WKJA 3EVWA 1HLWA 3VGVA 1NDKA 3WX8A 4F4AA 3NGRA 3NGSA 4ENOA 2AZ3A 1MN7A 3BBCA 2CWKA 1NDPA 3ELHA 2B8PA 3NGUA 4EK2A 1U8WA 3DKDA 3GP9A 3Q89A 3PRVA 3VVTA 4FKYA 3PJ9A 1NPKA 3B54A 3ENAA 1KDNA 3Q8VA 1NB2A 1K44A 1NCLA 3Q8YA 3ZTOA 4WBFA 4ANEA 1BUXA 4W98A 1MN9A 3BH6B 2DXFA 3FBBA 1NHKL 1WKKA 1LEOA 4O0NA 1NDLA 4UOHA 1S57A 2DY9A 3B6BA 3ZTSA 2NCKL 5BXIA 2ZUAA 3ZTQA 4KPCA 4F36A 3VVUA 4CP5A 1VYAA 1NDCA 2VU5A 1HHQA 3ZTRA 3EE3A 1XQIA 1EHWA 1PAEX 3GPAA 4DZ6A 4FKXA 5CAAA 1WKLA 3EICA 2B8QA 3FKBA 3L7UA 4DUTA 3MPDA 4ANCA 1BE4A 4UOFA 3EJMA 1F3FA 2BEFA 1XIQA 3BH7B 4UOGA 1S59A 1F6TA 3VGTA 5CABA 2HVDA 1NUEA 1B99A 4S0MA 3FC9A 3FCWA 3Q8UA 1HIYA 5C7PA 3FBEA 3EM1A 3FBFA 3EMTA 3Q83A 1ZS6A 3R9LA 1JXVA 3BBFA 3FCVA 1S5ZA 4C6AA 3DDIA 2DXEA 2DXDA 1BHNA 1UCNA 3FBCA 3JS9A 2AZ1A 3ZTPA 4DI6A 2DYAA 4HR2A 2HURA 3NGTA 3EVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBB A;  1NSP A;  3VGU A;  1NSQ A;  4AND A;  1B4S A;  1NLK L;  3EVO A;  3Q86 A;  5IOL A;  2HVE A;  1NSK L;  3VGS A;  1PKU A;  3G2X A;  1W7W A;  2BX6 A;  3ETM A;  1LWX A;  1WKJ A;  3EVW A;  1HLW A;  3VGV A;  1NDK A;  3WX8 A;  4F4A A;  3NGR A;  3NGS A;  4ENO A;  2AZ3 A;  1MN7 A;  3BBC A;  2CWK A;  1NDP A;  3ELH A;  2B8P A;  3NGU A;  4EK2 A;  1U8W A;  3DKD A;  3GP9 A;  3Q89 A;  3PRV A;  3VVT A;  4FKY A;  3PJ9 A;  1NPK A;  3B54 A;  3ENA A;  1KDN A;  3Q8V A;  1NB2 A;  1K44 A;  1NCL A;  3Q8Y A;  3ZTO A;  4WBF A;  4ANE A;  1BUX A;  4W98 A;  1MN9 A;  3BH6 B;  2DXF A;  3FBB A;  1NHK L;  1WKK A;  1LEO A;  4O0N A;  1NDL A;  4UOH A;  1S57 A;  2DY9 A;  3B6B A;  3ZTS A;  2NCK L;  5BXI A;  2ZUA A;  3ZTQ A;  4KPC A;  4F36 A;  3VVU A;  4CP5 A;  1VYA A;  1NDC A;  2VU5 A;  1HHQ A;  3ZTR A;  3EE3 A;  1XQI A;  1EHW A;  1PAE X;  3GPA A;  4DZ6 A;  4FKX A;  5CAA A;  1WKL A;  3EIC A;  2B8Q A;  3FKB A;  3L7U A;  4DUT A;  3MPD A;  4ANC A;  1BE4 A;  4UOF A;  3EJM A;  1F3F A;  2BEF A;  1XIQ A;  3BH7 B;  4UOG A;  1S59 A;  1F6T A;  3VGT A;  5CAB A;  2HVD A;  1NUE A;  1B99 A;  4S0M A;  3FC9 A;  3FCW A;  3Q8U A;  1HIY A;  5C7P A;  3FBE A;  3EM1 A;  3FBF A;  3EMT A;  3Q83 A;  1ZS6 A;  3R9L A;  1JXV A;  3BBF A;  3FCV A;  1S5Z A;  4C6A A;  3DDI A;  2DXE A;  2DXD A;  1BHN A;  1UCN A;  3FBC A;  3JS9 A;  2AZ1 A;  3ZTP A;  4DI6 A;  2DYA A;  4HR2 A;  2HUR A;  3NGT A;  3EVM A; 
#chains in the Genus database with same CATH topology
 2V68 A;  2B3T B;  1AUS L;  5HMX A;  2E1C A;  3IBF B;  3GFH A;  2VC0 A;  3L7P A;  2UP1 A;  2VG7 A;  1LW2 A;  1B4S A;  4GO7 X;  3T41 A;  4DOZ A;  4XDC A;  4XTT A;  1VRU B;  5JXS A;  4DQI A;  4H4M A;  4WFX A;  1F5B A;  2FJW A;  4BBY A;  4ZA1 A;  1RA6 A;  2ZZT A;  4DL0 C;  3M05 A;  2QL5 B;  1TEL A;  3M8Q B;  4C8N A;  1D9F A;  1XNR J;  4FYW B;  1O5J A;  2R7X A;  2A10 A;  2KU7 A;  1LNQ A;  1U26 A;  3NGR A;  4KHM A;  3THT A;  3WX8 A;  4F04 B;  2A1B A;  3CCW A;  3J7Z 5;  2OH2 A;  5GAH I;  2IYI A;  1NJW A;  1HBO A;  2EKN A;  4DV5 F;  3G6Y A;  5F0U A;  1UL3 A;  3AD7 C;  3K17 A;  4M5I A;  4ZOS A;  3JSM A;  1KC8 T;  1QAI A;  2I9S A;  2ZVI A;  2IPO B;  4J9V A;  3MR3 A;  1JIH A;  1MRO B;  3GP9 A;  4ID8 A;  2AQ4 A;  2BDP A;  3W9I A;  1PYS B;  2ZBI A;  4NMX A;  3M8P B;  3A12 A;  3TAM A;  4DU8 A;  1NH8 A;  4N5S A;  4C3L A;  4ZJQ A;  3N5F A;  2U1A A;  3PKY A;  4KY3 A;  4YEA A;  5BR8 F;  1N8R T;  4KKO A;  4LUB A;  5FD1 A;  3HHL D;  2BW2 A;  3SMZ A;  2ADB A;  4PQU A;  2HSE B;  3KDN A;  1X7V A;  3QRQ A;  2EC2 A;  3KNA A;  2KG0 A;  1GMW A;  1OSD A;  1YJN S;  4ZVE A;  1NEE A;  5G0R B;  3LAM A;  5IXU A;  5CH7 B;  3J7A N;  1OQ6 A;  2N4C A;  3MM7 A;  4UOH A;  4LFB J;  3M1V B;  4JV0 A;  2DB1 A;  1J2V A;  2K8G A;  2OEL A;  3B6B A;  1GK8 A;  3CSK A;  3NY0 A;  5HMZ A;  3WHI A;  1JKH B;  4L3K A;  4ECW A;  1KQG B;  2KZM A;  2AV5 A;  1O0P A;  2IFX A;  2V2K A;  3JSR A;  2CPZ A;  3I4H X;  1NHU A;  5DQH A;  3PRD A;  4WFZ A;  1RJJ A;  4FYX B;  4CP5 A;  1FNO A;  5DG9 A;  4WP9 A;  3M9O B;  4JV2 A;  1NM2 A;  4LF6 J;  1MU2 A;  3T6J A;  1EJ7 L;  4YR3 A;  1HHQ A;  5DG7 A;  1XQI A;  2DVI A;  1S6P A;  3UFC X;  4FKX A;  2ZUG A;  4IOC Q;  1TKZ A;  1YJR A;  4KGX B;  3SIP B;  4FBT A;  1HNW F;  4JI8 F;  4B3S J;  4ZJL A;  4F50 A;  3UE2 A;  2W4D A;  4M63 A;  4HHH A;  3A8K A;  4CH7 A;  3H5Y A;  4F8R A;  1HBM A;  1S1X A;  2HNY A;  1H2V Z;  1K1Q A;  1U0H A;  4NRU A;  4V1A k;  4KO0 A;  4B08 A;  4FNH A;  1RHQ B;  3FGV A;  2FHK A;  3TUI C;  3TYT A;  1RBO B;  3H98 A;  1S79 A;  1D9A A;  1WF0 A;  4LR9 A;  1F3F A;  4R0E A;  2WVD A;  4RBV A;  2CQ4 A;  1S4F A;  1JLB A;  3NRB A;  3T1Y J;  1S0M A;  2R8K A;  4CRJ A;  1B3T A;  1EIY B;  3P6Y C;  5BYS A;  3RRG A;  2CRL A;  3W61 A;  3AHP A;  2HMI B;  3SCK E;  4FS2 A;  2V4Q A;  2W4P A;  3OV7 A;  1RWU A;  2VQE J;  2OHD A;  2J6S A;  1WDD A;  3I6P A;  3PY8 A;  2HHS A;  3AB4 B;  3KLI A;  4J90 A;  4Y65 A;  2KVQ E;  4X4T A;  2J0X A;  1RWP B;  2F3J A;  2HS3 A;  2Y3Y A;  1TQL A;  2CPI A;  2H9Z A;  3D5M A;  3DHX A;  5GME A;  4B3R F;  1IKV A;  1FWP A;  1GMW D;  4OHW A;  2XY6 A;  4X4O A;  4YB1 P;  1IKX B;  4X62 F;  3OUY A;  4JI4 F;  2DRA A;  3Q8Q B;  2RUS A;  1UKU A;  2ZHB A;  4ZVU B;  4CTA B;  4RU9 A;  5A8R A;  2BQU A;  5DDR C;  4LSN B;  4CI0 B;  1JXV A;  1RT7 A;  1VHI A;  1SKR A;  1TL1 A;  4H4O A;  4ZIT A;  3IWN C;  1D0E A;  2CVI A;  3MM5 A;  3SBM A;  4LF1 A;  2DXE A;  2IDE A;  3VHQ A;  5IS2 A;  3JS9 A;  4OL8 A;  1X4A A;  1WSR A;  3FFI A;  3GWC A;  1Q16 B;  5HQM A;  4CCH A;  1U0S A;  3R2D J;  2CPY A;  2Z4P A;  2CJ9 A;  2EFN A;  4QWA A;  1FWL A;  2VBZ A;  2FHM A;  1VLO A;  2KXN B;  3I55 S;  4X4V A;  5FJ4 A;  2F1F A;  5CHC B;  2ZH1 A;  5A0Y A;  4DPW A;  1TV6 A;  2W9A A;  1IUJ A;  3K5N A;  2CJA A;  2AJ2 A;  3BKF A;  3LGN A;  4AXI A;  2XO7 A;  3HXM A;  3W5X A;  2CUY A;  2MQN A;  4QR2 A;  2XEX A;  2WVF A;  1BGX T;  2C3U A;  2VDI A;  2M2B A;  3MTJ A;  3PEJ A;  4OI6 A;  3VGS A;  4DUZ F;  1YTY A;  2MSS A;  4BC9 A;  1OY6 A;  3MEK A;  4DL7 A;  2CPF A;  3MPU B;  2PMH A;  3GII A;  5CXT A;  4Q8E A;  3D0G E;  3AD9 C;  2GO9 A;  3VTI A;  1MML A;  1PJ5 A;  3T5H A;  1REG X;  3FVY A;  1UVM A;  3Q2T C;  1VLY A;  4PAB A;  2RNE A;  1S0N A;  4PUO B;  4HVZ A;  5MLC V;  3VAK A;  2KFZ A;  2OPR A;  2N7Y A;  3HHL C;  4WP8 A;  4ZDN A;  2MTL A;  4HEA 9;  1RT3 A;  2WVC A;  3PDN A;  2QEX S;  3VVT A;  2IJR A;  3Q24 A;  1GEH A;  2GX8 A;  4B02 A;  1DQ8 A;  4F3Q A;  3EX7 B;  2UZA A;  4RNM A;  4DSE A;  1GMU A;  1DHM A;  1WTB A;  2BOA A;  2WW4 A;  5C2C A;  2R7Q A;  4A8W A;  2AJ4 A;  2XB2 D;  1DUR A;  1F5C A;  4U7U D;  1HBU A;  1FE4 A;  2IC3 B;  2BKP A;  1DFD A;  3QO9 A;  1OIA A;  1RLC L;  1RKJ A;  4LR7 A;  3MR6 A;  4OYP A;  3I96 A;  3BH6 B;  2RB7 A;  5AXK A;  1FJ7 A;  2UUC F;  1WC3 A;  1WKK A;  2RHS B;  1RTJ A;  2KRR A;  4G1Q A;  2QFJ A;  4IDK A;  4I0W A;  5IQQ A;  3FK4 A;  4ED0 A;  1S7H A;  1S57 A;  2R7T A;  4OJ3 A;  3KLE B;  1RWN B;  4AXJ A;  2CG4 A;  2XMK A;  3G6E S;  4CO2 A;  2IBK A;  1T02 A;  4NYP A;  5DQI A;  1CJU B;  4K0K J;  3BPS P;  3CDA A;  3QMQ A;  3GFZ A;  2CJQ A;  4DCO B;  2KM8 C;  1RT5 A;  4B9N A;  2KZZ A;  1B70 B;  4OYM A;  1HA1 A;  2ZH6 A;  2D3Z A;  1RT2 B;  2HW3 A;  1URR A;  5B0D A;  3BSO A;  4P7T A;  1RBL A;  4DQR A;  2LDY A;  4LQ9 A;  5CAA A;  3MCN A;  3K7R A;  2X7I A;  4O3Q A;  1KVJ A;  4RBU A;  1WHX A;  4YFU A;  1DZ5 A;  2OEJ A;  3H2L A;  5BJR A;  1S1W B;  4YB6 A;  5LL6 d;  3M4X A;  2RKI B;  1KHW A;  1HW9 A;  5I42 B;  2VIH A;  2E5I A;  2JFK A;  2VJV A;  1BQX A;  3SFG A;  3KJN B;  1M1H A;  3C6T A;  4CT9 A;  3OL7 A;  1HHT P;  4ZP7 A;  2HVZ A;  3HHN B;  1KHV A;  4K4T A;  1F2H A;  3OL6 A;  3PHE A;  1YJT A;  2KB2 A;  3NGD A;  1WF1 A;  2WOM A;  4O44 B;  4OI4 A;  2I38 A;  4ZVT B;  3KFW X;  5M2P A;  3D67 A;  2CQD A;  4WTO B;  3Q23 A;  2CNK B;  2QL9 B;  2VFS A;  4Y6I A;  1QE1 A;  3GJT B;  3H59 A;  5DGB A;  3SFU A;  3VQT A;  5GAD U;  2Z2Z A;  3EM1 A;  5AXM A;  3E01 B;  4O0I A;  4DQS A;  2DGX A;  4QWD A;  2B43 A;  4DSF A;  3NOC A;  2O67 A;  3P4U B;  2D74 B;  1KR4 A;  3O5T B;  2B51 A;  2CQB A;  2RU9 A;  2V8P A;  3C3L A;  5CYM B;  2AT1 B;  3MMC A;  2ZJQ Q;  2PDA A;  1UEU A;  1WG4 A;  2E44 A;  2UUC J;  1S5Z A;  3S01 A;  4X66 J;  4C6A A;  5A2Q U;  2ADC A;  4MFB A;  2VHG A;  1JJH A;  2CAD A;  4YY3 F;  5IT0 A;  3QLH A;  4A8M P;  2HWT A;  2DNO A;  2B56 A;  1FNX H;  2ZH2 A;  4NPO A;  3VQS A;  2Y8Y A;  2FLL A;  2I1R A;  5HVG A;  2XTJ P;  1H0H B;  3HKW A;  2UXD F;  2Z30 B;  4NLO A;  3K89 A;  5KG4 A;  4IG3 A;  4RNN A;  2LVW A;  1U1K A;  3BSN A;  2AU0 A;  4I4B A;  1S49 A;  5AE2 A;  5KTQ A;  2R8G A;  1Y9O A;  1S1U A;  5GAG I;  3DN9 A;  4MIB A;  5SZT A;  3EVO A;  4KSE B;  3ZXW A;  2EK6 A;  1NSK L;  4YUD A;  3CD7 A;  1N56 A;  1H7W A;  4I2Q A;  2HFZ A;  3ZZZ A;  1F9H A;  1JLE B;  2AEF A;  1HW8 A;  2RAQ A;  3TJ8 A;  1RTI B;  3TX0 A;  3EVW A;  1MRO A;  1UFW A;  1U1M A;  2LQJ A;  2YKP A;  4LVN P;  3DLJ A;  2DNQ A;  2KDO A;  3CDB A;  1U02 A;  2JH3 A;  2AMC B;  3H8Y A;  2QYG A;  1NJY A;  5CCL A;  3OLB A;  4RUB A;  1AA1 B;  3H20 A;  1SKW A;  3I0S A;  3PCO B;  4OJG A;  2ZFH A;  4WZM A;  1S6U A;  4RW6 A;  2YX7 A;  3E01 A;  4FKY A;  4F0M A;  4NRT A;  4QW8 A;  3OL9 A;  3ENA A;  4I6W A;  1Q8B A;  2W7P A;  1VQ6 S;  2HK2 A;  4UUW A;  3E51 A;  5B0G A;  3CD5 A;  4HL9 A;  1YBT A;  4FVM A;  4ETZ A;  2R2T A;  3PO4 A;  1FRL A;  1NB2 A;  2RQM A;  3A3P B;  4WTY A;  4FXW A;  3ZZR A;  3Q22 A;  1JLA A;  1JNZ B;  3C16 B;  1S9E B;  1RA7 A;  3SCI E;  4HDH A;  1FD2 A;  1VQ4 S;  4ANE A;  1FES A;  3CCT A;  2BZ2 A;  4DZD A;  1LWF A;  1V3S A;  2L9D A;  4HKQ A;  3ADA C;  5E41 A;  1N5Y B;  3M9N B;  1TUV A;  2IBO A;  2XY5 A;  1N36 F;  4Q44 A;  3KHL A;  1P6T A;  4U8Y A;  4LBH A;  1S9F A;  4QYZ J;  4NA3 A;  2FLP A;  3AQO A;  1LW0 B;  1EET B;  1K9M T;  4I68 A;  1UET A;  1DTT A;  2WON B;  4P72 A;  4ZJO A;  3CCQ S;  5IFM A;  4ID5 A;  3GJQ B;  3I0R A;  1FRI A;  3LWL A;  1KKH A;  2UXD J;  2E7W A;  1N34 J;  4FYV B;  3ZZY A;  4Y2A A;  3EGN A;  3PX4 A;  1GXT A;  5HJY A;  1U47 A;  5KAK A;  4DS4 A;  2BA9 A;  4E2F B;  3WC2 A;  4M94 A;  5F8I A;  3J81 Y;  3NLC A;  2OPQ B;  3K8W A;  2AX0 A;  4RPF A;  3QFH A;  2I5J B;  3CC4 S;  3G96 A;  3CDE A;  4LRE A;  1WSV A;  3TJA A;  2Z2Y B;  2YKM A;  3JAM U;  4ZP8 A;  1YBU A;  2FYX A;  3BO2 A;  3G87 A;  4K4X A;  1VBX A;  2A2D A;  2VZ9 A;  5E7O B;  3MPV A;  4ANC A;  4LF5 F;  2E7X A;  2JFD A;  1TKX A;  3FSX A;  3MDF A;  3H5X A;  2UXB F;  1WAC A;  5I3U B;  5AJ3 F;  4K4U A;  5DG8 A;  1V6H A;  4P10 A;  1F6T A;  1R89 A;  4DSL A;  4B3O A;  1EQ0 A;  5LSO A;  3OFE A;  4HT5 A;  5ETR A;  3OSN A;  4LQ3 A;  4Z2X A;  3C6U A;  1M0S A;  1RU1 A;  1RP5 A;  4S0M A;  4WXO A;  3MAQ A;  1HYS B;  2JLE A;  1FFG B;  4KC5 A;  4M8L A;  1TL3 A;  3VAH A;  3TZY A;  2OSQ A;  3GV5 B;  4IFY A;  4A8F A;  1RGV A;  3DLK B;  4PXC A;  1JK9 B;  5CA5 A;  2ZDP A;  2QLJ B;  2K1R A;  4MTP A;  4YQW A;  4DV4 J;  1J5O A;  3LGM A;  2PC6 A;  3RAM A;  2EBE A;  2VD3 A;  3JYT B;  4UTG A;  2DGW A;  1OJ4 A;  2YKQ A;  4MH8 A;  4MYT A;  3OTC A;  4P2X A;  1CUL A;  3MM6 B;  4J9Q A;  2WHO A;  4DR5 F;  2E1P A;  4TXS A;  1VQY A;  3UDV A;  1FER A;  1YQH A;  1O8B A;  2JVO A;  1BLU A;  3CIZ A;  3ILO A;  7FD1 A;  1KEK A;  1R43 A;  3RR7 A;  4KHP J;  3BSA A;  5KFU A;  4ICL B;  2V9K A;  2NXC A;  4ED7 A;  2G13 A;  2DO4 A;  3IO1 A;  5KFY A;  4OX6 A;  5JVH Q;  5KG0 A;  4B3M J;  4M5H A;  2AEM A;  2AJF E;  2JL9 A;  3QT6 A;  2BVZ A;  2E66 A;  4LT6 A;  4XIU A;  1UA1 A;  4NI2 B;  3DXS X;  5DET A;  2R7R A;  2WBR A;  3V6D A;  3PFO A;  5F8G A;  2DGS A;  1KOO A;  1RQ0 A;  1OQ3 A;  2GMH A;  2YWH A;  3HVT A;  5FII A;  4O3O A;  5LMN J;  3T5L A;  1HMV B;  2YH1 A;  4NOH A;  3UI3 A;  2ROE A;  1H74 A;  3MUV P;  3CW2 C;  1WC0 A;  3G82 A;  3VV2 B;  2CYY A;  3SZ2 A;  1Y3J A;  2QZ8 A;  3K5P A;  5HAN A;  1RAJ A;  4GKJ J;  3VGV A;  3KK1 B;  3BQ2 A;  2IM1 A;  2HHP A;  2XMM A;  2JSX A;  2WCX A;  4F4A A;  2JVR A;  4NXM J;  1MSW D;  4QIF A;  3BBC A;  1CJT B;  1U2C A;  1QY7 A;  5J1E A;  1XMO J;  4DFK A;  1NRK A;  3OR1 A;  5DS7 A;  1GAO A;  1BWV A;  4ZN3 A;  3WZ0 A;  2VH7 A;  4EK2 A;  4UST A;  3IWX A;  3OHA A;  3TUJ C;  3TZZ A;  2W2Q P;  5HLF A;  1T9T A;  1IN0 A;  3GJR B;  4NEY A;  1Q8L A;  2DNH A;  2WZ1 A;  4NWB A;  3JTP A;  1RTH B;  2OEK A;  1GQE A;  3M8Z A;  2BKN A;  3MPY A;  1G1X A;  4K59 A;  1XC9 A;  1TL4 A;  2HKE A;  3O6Q A;  4M5D B;  2HS4 A;  3DRR A;  3EWG A;  3JQK A;  4FNI A;  2N3O A;  3LP2 A;  2OD4 A;  4GC6 A;  4LF9 J;  3KDO A;  3EZ5 A;  4DPU A;  3OTE A;  3KLE A;  2X1B A;  3JSB A;  4ECV A;  1HHS A;  2XNQ A;  3HHE A;  1LOU A;  2NSB A;  1Q86 T;  1FJG F;  2V8G A;  4CH1 A;  1NHK L;  4A8K A;  5DDQ C;  4NYZ A;  2UUA J;  2RQ4 A;  1U6F A;  2BJE A;  2LU1 A;  4K7Q A;  2L08 A;  4DCJ B;  1TMM A;  5J2Q B;  1NDL A;  4Q8F A;  3RBD A;  4JP8 A;  2E5L F;  2UXC F;  1F2G A;  2ASD A;  5A8K A;  1YDL A;  4ZCI A;  4UOF A;  2XZD B;  3DI6 A;  1K1S A;  1HMV A;  3IBW A;  1YBA A;  3IGN A;  5GVQ A;  4CO1 A;  3M2U B;  4BWM A;  3MUR P;  1VYA A;  4NLR A;  1SQE A;  3LP0 B;  2EC0 A;  1IWA A;  4GMK A;  1BQN B;  3UDC A;  3F0N A;  5J1N A;  2FHO B;  2KJW A;  4RW9 A;  2OLW A;  1Y5N B;  3JAM Y;  3IP0 A;  1S10 A;  3PAC A;  2L41 A;  2I0X A;  1XNQ J;  4NLS A;  4U6P A;  1AUD A;  2V50 A;  1OYE A;  1FI4 A;  3UO0 A;  4ECS A;  1XNR F;  4PWD A;  2B4V A;  2JOQ A;  4DPT A;  2XLJ A;  2HIQ A;  4ZPW R;  1EX8 A;  2VQF F;  2VV5 A;  2LYV A;  1K73 T;  2XI2 A;  1M90 T;  1Y00 A;  1VDH A;  1BE4 A;  2OFH X;  2WW8 A;  2XZW A;  2ZE2 A;  4KGZ B;  1IKY B;  4RJV A;  4ZCM A;  1RWV B;  5E3A A;  1O51 A;  1VIS A;  1S59 A;  4M95 A;  2A3J A;  4DR7 J;  1S0O A;  2EG2 A;  3UCZ P;  1L3U A;  3HD2 A;  3HI9 A;  2DRD A;  3MFI A;  1X4D A;  4E8U A;  3W65 A;  1A6L A;  1LWC A;  2KFY A;  4WWS A;  2COL A;  2Q6B A;  2YKA A;  5GAE U;  3E2E A;  2LU2 A;  3U1M A;  3AY0 A;  3TEG A;  4KR0 B;  1SUQ A;  1IBK F;  1Q7L B;  4JV5 F;  5KFH A;  4OFZ A;  1SV5 B;  4ETX A;  2AP6 A;  1U2R A;  2Q79 A;  4DG1 B;  1S7I A;  4UQT A;  1UVI A;  2VFV A;  5DDP C;  3N6N A;  2XS2 A;  1UP1 A;  1NZA A;  5KG2 A;  1RT4 B;  2ZH4 A;  2DNP A;  5L8R C;  1N5Q A;  1WEX A;  2ZC3 A;  3DDI A;  3ZZT A;  3PIP Q;  3HO1 A;  1T03 A;  3K5L A;  1PSD A;  1V3R A;  4FXV A;  4DR4 F;  2XGP A;  3T1A A;  3RU0 A;  3PYF A;  2RRN A;  1N32 F;  1V5I B;  3BV8 A;  2XQC A;  1T3O A;  2D9P A;  2MZS A;  3V4I A;  2YXL A;  2LQB A;  2K06 A;  1AFJ A;  8RUC A;  1TMJ A;  4H4K A;  3NNH A;  5J2N A;  3G6X A;  1UTA A;  2VG5 B;  4B17 A;  4FS1 A;  2NXN A;  4USV A;  4ZHR A;  5C24 A;  3KJV A;  4DR1 F;  4QIV A;  2Q6C A;  5FDL A;  4IKA A;  2R2R A;  2OPR B;  3FNN A;  2G2Y A;  3UVJ B;  1HNV B;  4M5K A;  4X4Q A;  3CCV S;  4BC7 A;  1UMJ A;  2GQQ A;  1X5O A;  3SSS A;  1YJW S;  3I5A A;  3N9U C;  4IOA Q;  2C2R A;  3CJK B;  2BE2 A;  3NS5 A;  3PVX A;  3QIP B;  5I4M A;  4C4W A;  2X51 A;  2IVM A;  3NWR A;  5IWA J;  3BKU A;  4FDF A;  4I2P B;  4AL7 A;  4WK3 A;  4XPE A;  1YSJ A;  2MLY A;  2DGO A;  2DIT A;  3POT A;  4EUV A;  1DLO A;  2WB1 D;  1I6J A;  2CJK A;  2MQO A;  1HQ2 A;  1PYO B;  1KD1 T;  5B7W A;  3TW0 A;  3G9C A;  4HI1 A;  4ED8 A;  1TVR A;  2MKK A;  4Q0B A;  2JEF A;  2OGU A;  4DV7 F;  1NKB A;  1KDN A;  3VAF A;  1R8A A;  2A0F B;  5C5J A;  2AD9 A;  2BQ3 A;  2GNK A;  3TNV A;  3M7V A;  3TVK A;  1FK9 B;  4WFN Q;  4CLL A;  4UT4 A;  2E1M C;  2NS1 B;  1VC6 A;  3DOL B;  1JMT A;  1Q8K A;  3EXC X;  2YKO A;  2YWW A;  4CQ1 A;  4AL6 A;  1MN9 A;  2CQI A;  5EGY A;  3H4B A;  1RTD B;  4CLU A;  1FJC A;  4LF4 F;  3HVA A;  4LFA J;  5ETN A;  3P45 B;  4DV6 J;  5IV3 A;  1HWU A;  5E0O A;  1VQ9 S;  1BY9 A;  5HSP A;  2ZWP A;  4Y2I A;  4RW7 A;  2HND A;  3MWB A;  1RWX B;  3M30 A;  1R6V A;  1SVD A;  4NLW A;  4RWW A;  4L3N A;  3SSR A;  3UVJ A;  3OJS A;  4ED6 A;  3EXY A;  3HFZ B;  4N76 A;  4USW A;  1TKT B;  4DL3 A;  1SKS A;  2PT0 A;  2HRY A;  3EDR B;  9ATC B;  1MMD A;  2VAS A;  2GHW A;  2NLW A;  3EE3 A;  4USH A;  5KFF A;  3CPW R;  1ITP A;  3AOD A;  1TAU A;  3PXG a;  1YJV A;  2NRE A;  2EK1 A;  1RHM B;  1Z2Z A;  4ZLL A;  5RUB A;  1WHW A;  2OMO A;  3QT8 A;  4WJB A;  4Z37 A;  2ACM A;  3D7S B;  2DR7 A;  3FKB A;  3PFE A;  3HPO A;  4TQR A;  1JLF A;  5B0A A;  1QSY A;  4OZ2 A;  1P9Y A;  2RML A;  3QWP A;  4QCL A;  1HBM B;  2HNY B;  2PEB A;  2RF2 A;  2XYG B;  4JI1 F;  4HTJ A;  1G2E A;  3W5Z A;  2Y9H A;  3HHK A;  1M5V C;  2G0I A;  5JMN A;  2ZJP Q;  1RWW B;  5KT2 A;  2EFP A;  4U9R A;  3BO4 A;  4B9U A;  2E9T A;  1WD6 A;  2G0C A;  3O8W A;  5G0R A;  5E3C A;  1DY3 A;  5C2G A;  2J9D A;  2V63 A;  4ELT A;  2NXJ A;  4UY8 5;  2W9B A;  3CF5 Q;  1EP4 B;  3L95 X;  1VQ5 S;  5J2M B;  4FF2 A;  1JWW A;  1QUP A;  3TI0 A;  2SXL A;  5DRK A;  1R27 B;  3HK2 A;  1RE1 B;  2Z58 B;  1TK8 A;  1ZM4 A;  3D54 A;  5KT5 A;  3OHB A;  1OY9 A;  2QX0 A;  3DYA B;  2MQQ A;  5DLF A;  1UJ5 A;  3PJX A;  3U7J A;  1UPP A;  2W7O A;  2HRU A;  5CYQ B;  1Q8I A;  1ICE B;  4OV6 A;  4DV2 F;  2XYH B;  1YIJ S;  2OD6 A;  2B7B B;  2VFR A;  1IBL F;  3J7A 1;  2WAQ D;  1UCN A;  2RD5 C;  1K0T A;  2BXJ A;  2OUG A;  4ZP9 A;  3KJQ B;  3UD3 P;  4DV1 J;  1NXI A;  2D1C A;  2F4F A;  2V4J B;  4I7F B;  3TO8 A;  3DOK A;  2DPJ A;  1QVF R;  2C1E B;  2DT9 A;  3B82 A;  3R5C A;  1H7X A;  1RAH B;  2YWK A;  5ETQ A;  4O3R A;  4ED1 A;  4NXN F;  2YQ3 A;  2W9C A;  4A8S A;  4Q43 A;  1TV6 B;  5ITH A;  3ENW A;  1LW2 B;  1AT1 B;  1WHY A;  2PGC A;  3AOB A;  3CO0 P;  5IOL A;  4CZC A;  1HWI A;  5G4D A;  2ZBP A;  4JBC A;  2XM3 A;  2MKC A;  3R3T A;  3QFW A;  3CJ5 A;  4JI7 J;  2VOD A;  5D0R A;  1UWB A;  3CCM S;  1W25 A;  2VKR A;  3HVW A;  3O2I A;  1Q79 A;  3UN5 A;  2I2Y A;  2VON A;  3M6U A;  4O3N A;  1NK8 A;  2AEJ A;  1QJH A;  2GVD B;  4QU7 A;  1WEL A;  2MZT A;  3RRH A;  1Q78 A;  4HTI A;  1NJX A;  5KFR A;  1IKV B;  4LF8 F;  3N5B A;  2JLG A;  1HQE B;  2YQ0 A;  3DDN A;  3GMG A;  3IAM 9;  1XJW B;  2GW8 A;  3IM8 A;  4DPY A;  1S48 A;  2EEY A;  1RUS A;  5GAE I;  2B4U A;  2BMB A;  2WVE A;  4QU6 A;  1NPK A;  1Q5V A;  1NKE A;  2ZM6 F;  1TP7 A;  2EFG A;  1HPZ A;  2PA3 A;  5CYQ A;  1FCA A;  2OSR A;  3CED A;  5A8W A;  2FHJ A;  3CD0 A;  1DTQ A;  1PJ6 A;  3I4P A;  1SC4 B;  3KXD A;  4M5N A;  1LWE A;  4WBF A;  3G86 A;  2DRB A;  3KLG B;  4BDP A;  3CWJ A;  1PC4 A;  1VC0 A;  3DM2 A;  3ET6 B;  3LAL A;  4ELU A;  4U7C A;  2QT7 A;  3UD4 P;  4OV1 A;  3R1L A;  3PO5 A;  2P9C A;  3MED B;  4MYU A;  5D15 A;  2MQP A;  1X5P A;  2ALY B;  2GVZ B;  1PAU B;  1YVF A;  4PG6 A;  2V2V A;  4K8R A;  5F8L A;  3KK2 B;  1FVS A;  2DEJ A;  4NZ0 A;  2FJX A;  4ZPT R;  4CLF A;  3UNG C;  4N47 A;  2DGQ A;  2GQ2 A;  3ZZP A;  2OIH A;  4IQM A;  1NDC A;  3CC7 S;  3CD6 S;  2PII A;  1KSP A;  4DV0 F;  2JEI A;  3GR1 A;  4EZ9 A;  3RB4 A;  5D4P A;  4TY9 A;  4KO0 B;  1VK3 A;  4UZC A;  1EHW A;  1F1B B;  2EBG A;  4X4P A;  1RAE B;  3GYG A;  4Q2L A;  1ZAV A;  1R0C B;  2DIV A;  5K9F A;  4EBE A;  3VF0 B;  1RAD B;  1GNK A;  3HD1 A;  3U1L A;  2LEP A;  3C6U B;  2EKY A;  2YY3 A;  2B8Q A;  4CYU B;  1ZM3 A;  1LFW A;  3KLV A;  2GAH C;  4LF5 J;  3OVA A;  4F2R A;  3R7S B;  3QQC D;  2IC3 A;  1LWC B;  3HSG A;  1IKW B;  1XIQ A;  3BH7 B;  1KTQ A;  2MYF A;  5HQL A;  1J5O B;  4X2B A;  3RBZ A;  1R8C A;  2F8H A;  4IR9 A;  4GVB B;  1TUW A;  1GFW B;  3PYE A;  2IAJ B;  2QYC A;  4KV8 B;  2AJ1 A;  3Q8R B;  4GKK J;  4LSL A;  3EPG A;  3DFE A;  3QZ7 A;  3A13 A;  4PYD A;  4RNF A;  3D6F B;  2GGP B;  3V6K A;  2C3M A;  3GIL A;  4ILR A;  3NKY A;  3Q8U A;  1VBY A;  5J2P A;  1L5U A;  4HAC B;  4JI5 F;  1VQL S;  4NLD A;  4P71 A;  3CGI A;  2IDL A;  2HLT A;  3FRZ A;  5D0H A;  3W63 A;  5A2Q Y;  4UZB A;  4ECT A;  2J6T A;  2XLI A;  1REV A;  2ZNZ A;  3EMT A;  3MMA B;  4XPC A;  2BV3 A;  1WI8 A;  4G65 A;  2VQE F;  1UFL A;  3OR2 B;  4XDD A;  1O6X A;  4M5G A;  1NK4 A;  2DR6 A;  4LSN A;  4OYX A;  4KJI A;  1N36 J;  1GTE A;  1Q4R A;  3RRK A;  4K5S A;  3ZTP A;  2DR8 A;  4ILL A;  1FO1 A;  1KON A;  1UW9 A;  1N33 J;  1S6O A;  4X62 J;  1QTN B;  2AYM A;  2OPQ A;  1JXE A;  1PBU A;  2HUR A;  3GFY A;  3MCS A;  1KQK A;  1UZH A;  2BRL A;  3J80 U;  4KBI A;  1NBE B;  1UZD A;  3CJT A;  3PW2 A;  4FYD A;  3CTR A;  1JJ2 R;  4WPA A;  2HWH A;  3QJL A;  2NQP A;  1C1B A;  2GAG C;  3AA8 A;  3UD5 A;  2ASY A;  1NSQ A;  2MEW A;  5H9E J;  3NAH A;  2B6A A;  2YNH B;  5EDW A;  2HK3 A;  3BO3 A;  2HFU A;  2P8I A;  4ECX A;  4N77 A;  1SC1 B;  2RIJ A;  3MEE B;  2R8J A;  3BRE A;  1TKX B;  4OZJ A;  2BX6 A;  2Y1R I;  2BAN B;  5L1L A;  1U48 A;  1SJF A;  5T14 A;  3FZB A;  2EW9 A;  2M4M A;  4BWJ A;  3GIJ A;  2BAC A;  1H3D A;  2NUU G;  4YN3 B;  4ERD A;  5IT9 U;  3QZ8 A;  2P6T A;  1CQM A;  2RT3 A;  2DTJ A;  3H2V E;  3I31 A;  4ENO A;  2AZ3 A;  2AYB A;  2QA1 A;  3RAQ A;  2XYP B;  1T94 A;  1VJW A;  2AKW B;  4OYB A;  4MK7 A;  4DUZ J;  2APO A;  4DF8 A;  2RU3 A;  2EI5 A;  1U45 A;  3CJR A;  1ZYQ A;  1ZTT A;  2G9O A;  4NCA A;  3BR8 A;  4ZPD A;  1Z4U A;  4DEZ A;  5EUH A;  1NO8 A;  3HDS A;  2RS2 A;  4WF9 Q;  1F5A A;  3K59 A;  2HAI A;  1KLM B;  3H42 A;  3MR5 A;  3M8Y A;  2KL8 A;  5CCM A;  2CPE A;  3H40 A;  5HN0 A;  4EBD A;  2CQ1 A;  4ZLJ A;  1I94 F;  3RB6 A;  2F4V F;  3E3X A;  1YI2 S;  5D78 A;  3X1L B;  3GYX B;  1UAW A;  2IHR 1;  5GMD A;  5HL7 Q;  1JLG A;  5KT7 A;  1VOM A;  2IJF A;  2NYI A;  3FBB A;  2XC9 A;  4ED4 A;  1TAQ A;  4PPZ A;  1SJ4 P;  2ZH8 A;  1EQM A;  5KG1 A;  3MAH A;  4DR6 F;  1KTV A;  2VJU A;  2XMW A;  3HVR A;  2OTL S;  4U96 A;  1RT7 B;  2DHG A;  2F63 A;  2P6S A;  2J76 E;  2LP4 A;  3EGV A;  1RI7 A;  2DGT A;  2LEA A;  5E3R A;  3UN2 A;  5HBM B;  9RUB A;  1A0O B;  4PAA A;  1L3K A;  1S97 A;  5IM0 B;  1FJE B;  5D3G A;  4IFV A;  1GXL A;  2BJ7 A;  3RJM B;  5GAH U;  4L6V 3;  3NBP A;  3AFG A;  4E0D A;  4RKU C;  4LF6 F;  4F4W A;  5ETL A;  2ZNY A;  3KOA A;  1I51 B;  2YX4 A;  2WBM A;  3AXK A;  5CD4 A;  1IXK A;  2QA4 S;  5LSR A;  1I1G A;  2GA7 A;  5C25 B;  3QAT A;  2ABY A;  1G6B A;  4I64 A;  3J81 j;  4IOB A;  1QAJ A;  3TA0 A;  2UUB J;  2OTJ S;  2N82 B;  3KUG A;  1KNZ A;  1DBD A;  1N4L A;  1RT1 A;  4JUZ A;  4KFB A;  4JV1 A;  3IR5 B;  2VFU A;  4ES1 A;  2RQC A;  4ZK7 M;  2Z8Q A;  2AF6 A;  1HR0 F;  5K8N A;  3OTO J;  1VGY A;  1QLN A;  2H4W B;  4A8O A;  1Y5L B;  3HM9 A;  1N0U A;  4M5L A;  3L7O A;  2KT3 A;  4UQG A;  5C42 B;  5EWG A;  3M8P A;  2XWY A;  3TAM B;  3CJ0 A;  1Y3K A;  2GMJ A;  3L09 A;  2HVD A;  2XZT B;  3UQS A;  1CS4 B;  3PV8 A;  2M8H A;  4YME A;  2CA9 A;  1JLG B;  4ECQ A;  1FWK A;  1S6Q A;  2KXF A;  3G8S A;  4AQY F;  3W2W A;  4PQU B;  2YNG B;  5C7P A;  4ZVS B;  1B7F A;  2QA4 G;  1FDB A;  1F9F A;  1EET A;  1RAF B;  1SIZ A;  2XCP A;  5IV4 A;  2WON A;  3BM7 A;  2M70 A;  3FBF A;  1R0A A;  4LSZ B;  2GJI A;  3DMJ B;  3QO9 B;  4J9L A;  3R2C J;  3M2V B;  2AGO A;  1BQM A;  3QT5 A;  3IR6 B;  1NND A;  2FZC B;  3MD3 A;  4HH0 A;  3DU5 A;  3NCQ A;  4DR4 J;  1FKO B;  1TTH B;  2LDI A;  3ILL A;  4WFA Q;  4F4Z A;  1RKI A;  2ZD1 B;  1RAO A;  4R5P B;  4QYZ K;  1Q82 T;  4DV3 J;  4DCP B;  2IIH A;  2AZ1 A;  3MEG A;  4HLB A;  3KLH B;  5L1K A;  4Y2C A;  2KHC A;  2CQ0 A;  3GU0 A;  5T41 A;  2DK2 A;  3DRS A;  3CJK A;  3KG1 A;  4DR1 J;  2DIS A;  4O4G B;  3D28 A;  3H0P A;  3T19 A;  2EPI A;  4ILM A;  1DJ0 A;  3V81 A;  2NSC A;  2XSF A;  1T05 B;  1YIT S;  3T5J A;  1VBK A;  1AYE A;  2DNY A;  3I82 A;  3ISN C;  5L46 A;  5KFW A;  2UVU A;  3AT1 B;  4Y3C A;  2PA8 D;  3OQ2 A;  3O3L A;  3KUE A;  4P2M A;  4YY3 J;  4PXD A;  3BGL A;  4C0H A;  1TL7 B;  2DY1 A;  3FQK A;  1M1K T;  1XNQ F;  1Q5Y A;  2G2O A;  3U02 A;  1E6V A;  1S1V A;  3HCX A;  4CM2 A;  1RHJ B;  2Q3P A;  2VDH A;  3M2R A;  3NMR A;  2YH0 A;  1U6B A;  1D3W A;  1Q7Y T;  2RKI A;  2J9D E;  5ETV A;  3IN5 A;  2W2M P;  3I32 A;  3US5 A;  2KM8 B;  2MB0 B;  3G8Q A;  1X4H A;  3A8J A;  3DXB A;  2IVF B;  3S7R A;  4EFA C;  2VBW A;  3ISZ A;  2BJD A;  1FX4 A;  5LSL A;  1HWJ A;  4DG1 A;  3BQ1 A;  3C14 A;  1CC7 A;  4OX9 F;  3D4J A;  2MGZ B;  1FEE A;  1QTM A;  3KLI B;  2HFS A;  3LAK A;  4KE5 A;  2YQ1 A;  1FKO A;  2YNF A;  3VWS A;  1MLA A;  2KHD A;  4DR3 F;  1M5H A;  3OBI A;  1KVK A;  4USJ C;  5FLX Y;  4RZR A;  1BC6 A;  1T9X A;  4CTA A;  1VRT B;  1IKX A;  2JDJ A;  3OUY B;  2U2F A;  2V0N A;  5LMN F;  1CJK A;  1VQK S;  4O3P A;  3TA2 A;  2CG8 A;  2ZVS A;  2QLB B;  4WYW A;  3V4M A;  2F65 A;  1R7I A;  3DCA A;  3NGK A;  4ZHR B;  1S0V A;  2H1Y A;  2DY9 A;  1L3S A;  1WJ9 A;  2CQC A;  3BKT A;  1ROF A;  3D1Q A;  3M1V A;  1N54 B;  2CNN B;  5DZ7 A;  5D4N A;  5BXI A;  1U6Z A;  4MK8 A;  4ZVH A;  1YJ7 A;  2DH8 A;  3CJS A;  4J5O A;  1MWZ A;  4OYW A;  4QQB A;  3VVU A;  3DI6 B;  4PXE A;  2FVR A;  1DRZ A;  4IR1 A;  3BGR A;  3O1L A;  5KFN A;  2XS7 A;  2DHA A;  2ZH5 A;  2FC8 A;  3ZTR A;  2IRU A;  2E1R A;  1MU2 B;  1T9W A;  3R5D A;  4H4K C;  3GE9 A;  4OI3 A;  4OLP A;  3MMB A;  1VS3 A;  1HI0 P;  3GIK A;  3W8G A;  3OSP A;  1H2T Z;  3QSY B;  4Q2M A;  3KHH A;  2P9G A;  2HZC A;  2OPP A;  2P9E A;  4Y34 A;  2O3D A;  3V6J A;  2FVP A;  1C1C A;  4BHQ A;  3DRY A;  1QM9 A;  1WC6 A;  4ZPA A;  3M32 B;  3W2V B;  3MOZ A;  2BE9 B;  2Y1J A;  2BJ9 A;  3C46 A;  3M6X A;  3W7B A;  4J9N A;  3S6E A;  1ACM B;  2MKH A;  3TAN A;  4RNO A;  2EG1 A;  4CLS A;  4B9V A;  4PQA A;  3CCJ S;  1W2I A;  2FDN A;  3LP1 B;  4B9L A;  1URN A;  2IA0 A;  3OFH A;  3CXC R;  4F2S A;  4ZMM A;  4DV5 J;  4OJH A;  3QRP A;  2V5H G;  4WIQ A;  1BXN A;  4F0H A;  2HYI B;  2K3I A;  4GRS A;  3UWT A;  2EFV A;  3MEC B;  1S9G A;  1C0U A;  4EU0 A;  1HBU B;  1E6Y A;  4I6A A;  4ICL A;  2HRT A;  1U1L A;  5F3T A;  2V67 A;  2HZA A;  2ROP A;  3GIR A;  4DDF A;  3LOU A;  5HMY A;  4JI1 J;  3PYD A;  3W9J A;  3NWG A;  3SQO P;  4L73 A;  1GH8 A;  2MZQ A;  3V6D B;  3TWZ A;  3CJ2 A;  4TY8 A;  5IC4 B;  3RW6 A;  2F9J A;  1M5O C;  2XUL A;  5KFG A;  2W8L A;  2DIU A;  2ERR A;  4FF1 A;  2CDR B;  3J81 U;  1DQ9 A;  2MKI A;  4P52 A;  4MIA A;  1TUG B;  5L1J A;  2HQD A;  5E33 A;  5D0G A;  3KJV B;  2BW7 A;  2LQ5 A;  4TYB A;  3T1H J;  3BR9 A;  1SIW B;  2QRR A;  3R7N B;  2LXI A;  5IT9 Y;  3H2U B;  4JI7 F;  3MZI A;  4NML A;  5U47 A;  4JI0 F;  3MHY A;  3L3C A;  3OR1 B;  3BN7 A;  4ZVR B;  3ETM A;  4LR8 A;  1GXU A;  4TU7 A;  2Y0S D;  1U2F A;  1Z2L A;  1ZBT A;  1W26 A;  4XAK A;  3SCJ E;  4NLG A;  2OAU A;  1R3N A;  4B3T F;  4U7U K;  3PZP A;  4OYA A;  1VQS A;  3G8T A;  2HQF A;  1L3T A;  1XK8 A;  1IM6 A;  1KFS A;  5J2M A;  2BKO A;  3QIP A;  4USK A;  1F3V A;  1SV5 A;  3TA1 A;  1PC5 A;  2EWH A;  3CME S;  4IG0 B;  4QW9 A;  1QDU B;  1C4C A;  4K4Y A;  3MEC A;  1N5V A;  4C8Z A;  3Q89 A;  1JXL A;  1RCX B;  2GCF A;  3IG1 B;  3R5B A;  4W4M A;  2XMV A;  4C9D A;  3T9N A;  4DJB A;  5A6P A;  3PW5 A;  4PKD B;  4ATN A;  3DLG B;  2RHQ B;  4NCB A;  5H1S V;  4LFB F;  4YR0 A;  3NS7 B;  3N4W A;  3SV4 A;  1EKR A;  1SKU B;  2J9E A;  3ZO7 A;  5HRO A;  3X3U A;  1ZH5 A;  5F0W A;  4CNY A;  3ZTO A;  1U1R A;  1P27 B;  2IRX A;  4OYO A;  2IM3 A;  3DC2 A;  3IMQ J;  4C97 A;  1ULR A;  4K50 A;  3MM5 B;  2KFN A;  5DZ6 A;  1KP6 A;  3ZZO A;  5BR8 J;  1LEO A;  4O0N A;  1CUL B;  3MM6 A;  1VBZ A;  2V4R A;  2FLN A;  2J7W A;  4ZLN A;  3I5C A;  1TL5 A;  5C25 A;  2DKO B;  4J91 A;  2GO8 A;  3R6G B;  2PFD A;  1TK0 A;  4LF9 F;  2HQG A;  3ZTS A;  5L9N A;  5LT5 A;  1IJE B;  3C66 A;  4DUY F;  2L3M A;  2ZOG A;  3CB4 A;  5L38 A;  2R7S A;  2CQP A;  3DLE B;  4K2J A;  3DU6 A;  4DV1 F;  1XMQ F;  2B9E A;  1AZS A;  1FJG J;  2LLZ A;  1KFD A;  1VCT A;  2VB6 A;  1RT1 B;  1FKP B;  4OZ0 A;  4RW4 A;  4ZP6 A;  5KFC A;  2A6O A;  3KMQ A;  4OZ5 A;  1YJU A;  1S6P B;  3LPE A;  1VQP S;  1ZTW A;  1KBR A;  2YWF A;  3BDE A;  3QGH A;  4NZ6 A;  3GPA A;  5BYQ A;  2J8S A;  4OI1 A;  3UDL A;  4P2S A;  3D2W A;  1WKL A;  5I3U A;  4OHY A;  2HBQ B;  3HHL A;  3RAX A;  5DQG A;  5CD4 H;  2C28 A;  4DLE A;  4J9R A;  4KV8 A;  3D6T B;  4HYK A;  4NCG A;  1U0H B;  1U1N A;  2C2K B;  2E1A A;  2VUG A;  4EWT A;  5LMU J;  2IRY A;  2H54 B;  3QWU A;  2QGF B;  2Y1L B;  3M8Q A;  4B3T J;  4PYA A;  4RBT A;  1JLF B;  2VOP A;  2FIU A;  1F60 B;  2CZ4 A;  1JB0 C;  2HLU A;  2ZBR A;  2RDI A;  5GAD I;  1RAC B;  2CNO B;  1VIX A;  2V9W A;  1SUQ B;  2GFF A;  4X4N A;  3FZ2 A;  4ZKA A;  3TJ9 A;  5ETK A;  4ZLP A;  4ECU A;  1D9D A;  3K58 A;  4MT1 A;  4X64 F;  3C15 B;  4IDK B;  3UNY A;  2HS0 A;  1UJ4 A;  1P1L A;  4LF2 A;  3AA9 A;  1VIO A;  1T9V A;  3NEK A;  2F8M A;  4RW7 B;  4JI2 F;  3KHR A;  1J5E F;  3VAI A;  3NNA A;  2PMW A;  1QSL A;  2BAB A;  3MM8 A;  3VAJ A;  4ED2 A;  1JJ4 A;  2XMJ A;  3ETO A;  1IBM J;  1X31 C;  2DGV A;  3TR5 A;  5LXR A;  2DD8 S;  2J0Q D;  2ZJR Q;  1XWL A;  2D7S A;  1HNZ F;  2OJ3 A;  3DRS B;  4TQS A;  3ICL A;  1OPZ A;  1B64 A;  2ZC4 A;  4K4W A;  2BM0 A;  2MY7 A;  4F26 A;  2R2U A;  4YDX A;  3FFI B;  4AE5 A;  4CH0 S;  1UEV A;  4DI6 A;  4B3M F;  2QO3 A;  1WTF A;  4KH1 B;  3C19 A;  1C0T A;  3MAA B;  3SI8 A;  4C8L A;  3OVB A;  4CNZ A;  1YRT A;  1S1T A;  4HHU A;  2PMZ D;  2LCW A;  1FF2 A;  3NGT A;  4LF7 J;  3V4I B;  1UWA A;  2UU9 F;  1HNW J;  2MHE A;  4MKV A;  3BBB A;  3KTQ A;  2R8H A;  4KH0 B;  2V4J A;  4I7F A;  3TAQ A;  1KVI A;  4OHX A;  2CKW A;  4BCA A;  4R8U B;  1N6Q A;  4AND A;  2CJX B;  3BEG B;  3H4D A;  3AD8 C;  2E9R X;  1NLK L;  4PWW A;  1WF2 A;  4TYA A;  3J7Z T;  5EN1 A;  2WRM A;  5M2U A;  1T8E A;  4ZCL A;  2CZ9 A;  2VL1 A;  4YHH J;  4DL6 A;  3QID A;  5HLF B;  2LQ8 A;  3N28 A;  1R6Y A;  1RWO B;  3I9V 9;  3K2Y A;  3LH2 S;  4NLU A;  4KAI A;  1U1P A;  4A8Q A;  1RTI A;  3RGI A;  4ES3 A;  2BE2 B;  2QMX A;  2MKS A;  4AFF A;  3PW7 A;  2XY7 A;  2FVS A;  4HH1 A;  3MTK A;  4JB8 B;  4WKR A;  1CJV B;  5A76 A;  1VMB A;  2GVD A;  5L1I A;  2LEC A;  4C2M A;  5E3Q A;  2C2D A;  3CE8 A;  4EEY A;  2ZWO A;  4WCE Q;  3PRV A;  1YHQ S;  2IMW P;  2HFV A;  4EZ6 A;  4ZS6 A;  1WOS A;  4DWI A;  3PX0 A;  1QSS A;  2FGC A;  1REV B;  4DR2 J;  3BB5 A;  4NLT A;  1X8D A;  2C42 A;  5DO2 A;  5JUM A;  5KFQ A;  2QMU B;  4M1K A;  3I87 A;  3UR0 A;  1IBC B;  2HIY A;  4WE1 A;  4JI2 J;  3Q8S B;  4NLX A;  3DOM A;  2UV8 A;  3JYT A;  2NUH A;  1SQF A;  1I3O B;  1ZPV A;  4K0K F;  1BUX A;  2E5H A;  1GTH A;  1PYT A;  3OD2 A;  1R8B A;  3FEX B;  4PXB A;  5B09 A;  1S1T B;  2HGL A;  3KK3 B;  2AGQ A;  1IBM F;  3AJ2 A;  4MFB B;  4J9P A;  3JSY A;  2HHQ A;  4CO0 A;  2XBP A;  4P2F A;  4TLQ A;  5EHH A;  2GIQ A;  5F8H A;  1QUV A;  2GML A;  3LAN A;  1L3V A;  5F8N A;  2DO0 A;  1YG0 A;  1RZM A;  4K4V A;  2NCK L;  3N0V A;  3M8S A;  1M5P C;  3TP2 A;  3G6V A;  4FVC A;  4X66 F;  4DS5 A;  1CJU A;  4WFB Q;  4LF7 F;  5DM7 Q;  1CVJ A;  4C8Y A;  2VG6 A;  1TKT A;  2HHW A;  2MST A;  4IRC A;  2YNI B;  2BJ8 A;  3FCH A;  3HSD A;  3LO3 A;  1R8P A;  3OTD A;  2UUB F;  4GO5 X;  2NR0 A;  1HNI A;  3DNC A;  1XR5 A;  5AXN A;  3KHG A;  2YBV A;  2ZDO A;  5D4L A;  4V19 J;  2I5J A;  1VFJ A;  7FDR A;  1G3O A;  2FTR A;  2JWN A;  2FVC A;  3PG9 A;  1N48 A;  3PKM A;  4EBC A;  1GMV A;  3IWL A;  3GG1 A;  3CUN A;  2HFO A;  4P75 A;  5ETM A;  3JSM B;  2RF2 B;  1MWY A;  3VAM A;  3THP A;  4CO4 A;  1SC6 A;  1JLQ B;  2CVE A;  4DQQ A;  1S72 S;  3CMA S;  1VQN S;  4F4X A;  3KMS A;  4F7V A;  1B99 A;  4QR1 A;  1VQO S;  1RT3 B;  3IXQ A;  4UUX A;  3RTV A;  3SV3 A;  1TVR B;  4Q0B B;  1IJF B;  3J80 Y;  2W2N P;  3K5O A;  2IM2 A;  3D6M B;  4P74 A;  1U09 A;  3DDK A;  4M5D A;  1RHK B;  3W60 A;  3F73 A;  2FVQ A;  3D3B J;  1EB0 A;  3GON A;  1FTC A;  3SDE A;  2HNZ A;  4PG5 A;  1LWF B;  1N52 B;  2XG8 A;  4CIO A;  3UW1 A;  4UY8 T;  3R27 A;  1P8G A;  4RL1 A;  3D3C J;  1SL0 A;  1TR0 A;  2J5A A;  4KIA A;  3W64 A;  2M7S A;  2CQH A;  5J2Q A;  2LA4 A;  3VCD A;  4DR6 J;  2JNJ A;  4NYO A;  3MM7 B;  4O23 A;  3ZNU A;  2MY8 A;  4G1I A;  1UVL A;  1T11 A;  3NG8 A;  4UOC A;  4A8Y A;  3HJF A;  4Z7C A;  5KFI A;  1SQG A;  2DNL A;  2MJN A;  4PCQ A;  3RW7 A;  2JRS A;  2W2P P;  2PI5 A;  4FF4 A;  1QAY A;  3FUY A;  3QGI A;  5LJ3 Y;  1TK5 A;  2R2S A;  1HQU B;  1NSP A;  3HZE A;  1S1U B;  4IG3 B;  3CCU S;  4DSK A;  2FHJ D;  3NCP A;  1RTJ B;  2CJB A;  1KOH A;  1EKS A;  1U8S A;  2QN6 B;  4G1Q B;  5KFZ A;  4C0O C;  4I67 A;  4N56 A;  4YB7 A;  4D3H A;  5B0B A;  2YWG A;  1S99 A;  2FY8 A;  4QZV B;  2NYH A;  1HQE A;  4YS2 A;  2XWX A;  1JLE A;  1SCJ B;  2QA2 A;  2MLX A;  2IMO A;  5F41 A;  2MZ1 A;  1HLW A;  1RHR B;  3K0J A;  1NDK A;  1S1X B;  2R3V A;  3PM9 A;  1RLD A;  3GYN A;  4OYI A;  3NGS A;  1T3N A;  2ZH7 A;  3HJV A;  4MAK A;  3DGP B;  3KLF A;  2XI3 A;  4OX8 A;  1TFY A;  4PRF A;  3HSJ A;  1SH3 A;  2V8H A;  2XSJ B;  3C6T B;  4KB7 A;  4V19 X;  5K20 B;  4J9O A;  5D6G A;  2RE1 A;  3DGV A;  4IRK A;  2V34 A;  4C7Q A;  2FLO A;  2HNZ B;  2IM0 A;  3D66 A;  5T7L B;  2FD2 A;  4CLT A;  3LPY A;  3VAG A;  4EYI B;  2MXY A;  4TLR A;  3RB3 A;  2NZC A;  3DMJ A;  2H5J B;  2E29 A;  3Q8V A;  3AJ1 A;  2JEJ A;  2WOM B;  2H5I B;  4O44 A;  4JOU A;  4OZ1 A;  1H73 A;  3TUZ C;  2X1F A;  2HHX A;  1RIS A;  2K1R B;  1FHT A;  1ZAX A;  2Q43 A;  2Z57 B;  3PR4 A;  4QR0 A;  3GIM A;  4OI0 A;  3EZU A;  2FJV A;  2YX1 A;  2MZJ A;  2RDD A;  2ZD1 A;  3PYG A;  1UVN A;  2M9K A;  2FQQ B;  1IBL J;  4NL5 A;  2HPU A;  5L39 A;  5HP1 A;  2KTQ A;  2DXF A;  3RBE A;  1MWQ A;  2CPH A;  1TU0 B;  2MZR A;  2GHV C;  3MFH A;  4WK1 A;  2OO4 A;  3HVT B;  3MD1 A;  5LXY A;  4CM0 A;  1FX2 A;  3T5K A;  1YLX A;  3PRB A;  1LV5 A;  1HD1 A;  4QIE A;  3L4B C;  1D8Z A;  3W9H A;  2J7U A;  4LBI A;  2PI4 A;  3HF5 A;  4WFY A;  4DV3 F;  2CNL B;  1WG1 A;  2RIL A;  4CO5 A;  3ZTQ A;  4Y28 C;  2G1D A;  3VAL A;  1S12 A;  2KVI A;  1DTT B;  2CPJ A;  4WYL A;  4IFV B;  1RT2 A;  4X4S A;  2VG7 B;  1XER A;  5JVG Q;  2JC0 A;  2FZG B;  3RZA A;  2ZBC A;  3AOC A;  4NA1 A;  2F8E X;  2VU5 A;  4OZN A;  3P49 B;  5K14 A;  1VHF A;  3V6H A;  1U1Q A;  1NME B;  5IZH A;  4FYY B;  4DFP A;  3A8E A;  3QAE A;  1FFS B;  5LM7 E;  2RH3 A;  2JLF A;  2C2O B;  3OPK A;  2W01 A;  4B9T A;  2UXB J;  1RAI B;  1YRX A;  2B9Y A;  2DNR A;  4TVA B;  3EIC A;  2GQC A;  1HNX J;  3QLH B;  1WC5 A;  2HBZ B;  1B7Y B;  3D9B A;  3LP1 A;  3V5R A;  1LXN A;  4J9S A;  3QGG A;  4WKY A;  4ZPC A;  1ELO A;  4GVB A;  2KO1 A;  3P96 A;  2HBY B;  4PWU A;  3OL8 A;  3MCM A;  2FY1 A;  1RSC A;  2K7J A;  3L7U A;  2KYX A;  3PEH A;  4NEZ A;  1AW0 A;  1B0P A;  4NLV A;  3IRX A;  2IVY A;  1OMS A;  3MM9 B;  3EJM A;  2BEF A;  1CSJ A;  1E6Y B;  1RK8 A;  2XHC A;  3B8H A;  2C2Z B;  2QMW A;  1WOP A;  3HFK A;  4CLZ A;  2YNF B;  3SSQ A;  4A47 A;  4A4J A;  1FFW B;  4J9K A;  1IR1 A;  1YX2 A;  1WEY A;  4NLY A;  1RWM B;  3KWM A;  3FMB A;  4RW6 B;  2X3D A;  3FRY A;  3TRG A;  1VR6 A;  2B4O A;  4QYR A;  3GCX P;  5HP1 B;  1XMO F;  5F8M A;  1VJQ A;  3FC9 A;  1FK9 A;  2M5Y A;  5KT3 A;  2UVW A;  5HBM A;  4WU2 A;  1SXL A;  4U95 A;  2ILZ A;  3IS9 A;  2IY5 B;  2ZOM A;  2ZZM A;  1NPP A;  1U4B A;  3LA0 A;  4LFC J;  3I56 S;  4KGV B;  2W1B A;  4DX8 H;  4IO1 A;  1N88 A;  4NA2 A;  2V8D A;  1LWE B;  4GKK F;  2AW0 A;  3QJJ A;  3GSD A;  3RUB L;  1RBA A;  2C3O A;  3N79 A;  2RUG A;  2KH9 A;  2B4P A;  2DXD A;  2XMT A;  1M5K C;  2H65 B;  1RYS A;  2Q66 A;  1N34 F;  5KFT A;  3R5A A;  4USM A;  2BOP A;  1SJR A;  2E7V A;  3N01 A;  4ES2 A;  4M5J A;  1R8H A;  3C16 A;  4DPX A;  3H25 A;  4DLG A;  1LW0 A;  1QAX A;  1X4B A;  4NI2 A;  1RAG B;  5KFM A;  2VC1 A;  3TAR A;  1XN9 A;  3T1H F;  3TAP A;  3P5B P;  1VRU A;  5LJ5 Y;  1VC5 A;  4KHP F;  2YKN B;  1IWG A;  5H9E K;  2B6A B;  2M8D B;  2UV8 G;  5B0C A;  5KOX A;  3GJS B;  2KN4 A;  1T9Y A;  3FSY A;  5HVF A;  6FDR A;  2LQ9 A;  1KQF B;  3G82 B;  4O3S A;  3WBZ A;  2HEK A;  2E5L J;  1CBK A;  3HLU A;  2OI2 A;  1QD1 A;  5E2Q A;  3FSI A;  3NMA A;  4IH5 A;  1XR7 A;  4EMD A;  1X4G A;  2BYC A;  3W62 A;  3JQM A;  5B0F A;  2FB0 A;  2FUG 9;  4ZIV A;  1UVJ A;  4B3S F;  1WC4 A;  1CPZ A;  4EO8 A;  4OJ1 A;  1FRX A;  3UN3 A;  2VA3 A;  4AYB D;  3RYL A;  3DLH A;  4K4Z A;  3TZW A;  1BMQ B;  2FC9 A;  3QAU A;  4QJV A;  1R0A B;  1XBW A;  4CLP A;  1N0V C;  2DNM A;  3IS9 B;  1DLO B;  2W9B B;  3MXH P;  1EP4 A;  2DNN A;  1RTH A;  2RQK A;  2FGO A;  4RO0 A;  4DL5 A;  4C3M A;  1M5S A;  4Q5V A;  1HYS A;  4R5P A;  4N8N A;  5KFA A;  4JI4 J;  1S77 D;  4I56 A;  2L48 A;  1NCL A;  3DRX A;  1X9M A;  1EZZ B;  1RXO B;  2WSE C;  4NZ7 A;  1VQ8 S;  2F9D A;  1MW7 A;  2DHX A;  2VF3 A;  3N6M A;  1JLC A;  3MI7 X;  5A8R B;  5ETO A;  2BQR A;  2NZ4 A;  4P6Q A;  6AT1 B;  7AT1 B;  3ENV A;  3MMC B;  4NLQ A;  1T7P A;  2O66 A;  3PW0 A;  2R4F A;  3MMA A;  2MHN A;  2V69 A;  4DX6 A;  2FZK B;  5CYM A;  5FDL B;  3MR2 A;  2CAJ A;  5ADZ A;  3A3N B;  1YRU A;  3H90 A;  2KXH A;  1FDA A;  4LRC A;  4OX7 A;  1NK9 A;  5KFD A;  1Y0H A;  2OFG X;  4RR5 A;  4LRF A;  5KG5 A;  4JI8 J;  4DV0 J;  4Y00 A;  4OI2 A;  4USU A;  1SI9 A;  3PIO Q;  3ILI A;  4IH7 A;  3CJQ A;  5B08 A;  3CCR S;  2BR0 A;  2KYZ A;  2CZV C;  2IJN A;  2RDJ A;  3CCS S;  2EXU A;  2H48 B;  4RW9 B;  1RT6 A;  3T9Z A;  1JKH A;  3UCU P;  2UXC J;  5J1P A;  4HHJ A;  2VPZ B;  3IAS 9;  4ZN1 A;  3TEH B;  2YKM B;  4A8X A;  1HBN B;  4CLK A;  4JI3 F;  4PG4 A;  2CFX A;  1PIE A;  2JZ5 A;  2X3G A;  1JLQ A;  3F44 A;  4XO0 A;  1VK8 A;  3IRW P;  4AT1 B;  1H38 A;  2R7O A;  5IQ6 A;  3M6W A;  3CC2 S;  5KFS A;  4DUT A;  4FPR A;  2C2N A;  3K57 A;  5KT4 A;  3POT B;  5AXL A;  3I0S B;  5DDO C;  4B3R J;  2QE5 A;  4J9U E;  3GFX A;  5HRO B;  3WC0 A;  4YB5 A;  4C8O A;  5D4O A;  5AE1 A;  1ZOT A;  3FMW A;  2POK A;  2D3O R;  2DNZ A;  2OPS A;  5CAB A;  1K8A T;  3C2P A;  1JLC B;  4F3M A;  5IWA F;  2QG9 B;  4ZVP B;  3BGF A;  1V3Z A;  2QLX A;  3DHW C;  3OTO F;  1ZPW X;  1HI1 A;  1S76 D;  2L9W A;  2UVV A;  2DBB A;  2VQF J;  3RG6 A;  3FCW A;  1VQ7 S;  1HWK A;  5A8W B;  1HPZ B;  2DJW A;  2OML A;  1FRJ A;  4NXM F;  4TU9 A;  2XMA A;  2D3U A;  2ZBQ A;  1S9E A;  2D69 A;  3HFV A;  3JTO A;  3M6V A;  4X4R A;  1TL1 B;  2F7V A;  3DM2 B;  3ET6 A;  1NK6 A;  2LKZ A;  2W24 A;  2WVB A;  4JI6 J;  2QSF A;  4OZ3 A;  2M88 A;  5GMK a;  1XEZ A;  3MEE A;  5E3P A;  3SCL E;  2XS5 A;  4JV5 J;  2LA6 A;  4AD6 A;  2Z2L A;  2KRB A;  2DH7 A;  1U25 A;  5HJX A;  1K47 A;  3AXM A;  4C48 A;  3CMQ A;  1YWX A;  5KFV A;  4AUK A;  3K8V A;  1XMQ J;  3FEZ A;  3A4T A;  5F3Z A;  1X9S A;  4QPX A;  1PCA A;  2VG5 A;  3VGU A;  1KRP A;  1FRK A;  5C24 B;  1AB8 A;  3E8O A;  4ED5 A;  3LW5 C;  1PBA A;  3Q86 A;  4CWB A;  1ZET A;  1HR0 J;  1BWE A;  4X4U A;  2FJD B;  5MAO A;  2AHO B;  3BSC A;  2HFN A;  3ZFV A;  2KG1 A;  4WII A;  1U24 A;  4PG7 A;  5A0Y B;  5AE3 A;  2RRB A;  5LOQ A;  4X84 A;  3HMJ G;  1LWX A;  3KK1 A;  1TFW A;  3BGO P;  1Y11 A;  3AOA A;  2K3K A;  2QFI A;  2ROG A;  4ECR A;  2OPS B;  3OFG A;  1UWB B;  2YTC A;  1KLN A;  4HT7 A;  1CLF A;  3PNI A;  3GG0 A;  4I2P A;  3EGZ A;  1VQM S;  1NDP A;  1PIL A;  2B8P A;  1IKW A;  4AQY J;  2FJE B;  3M9M B;  2AJQ A;  1OWX A;  2HBR B;  3BDP A;  4L74 A;  1IM4 A;  5ETT A;  3B4D A;  3I5B A;  3IGV A;  1PGZ A;  1IBK J;  1UJ6 A;  4WXW A;  1J5E J;  4KKO B;  4LFA F;  2IAJ A;  3IM9 A;  4LSL B;  2LFV A;  2GIR A;  1RU2 A;  2J9C A;  2E5G A;  4F4Y A;  2F4V J;  3BYR A;  5CQG A;  5SUH A;  4NAS A;  5IM0 A;  4ER8 A;  1PO6 A;  1VRQ C;  2QSW A;  2O1P A;  4DU7 A;  1APS A;  2V94 A;  1Y5I B;  4W98 A;  2GS8 A;  1N32 J;  4JYA J;  1SC3 B;  2C3P A;  4ZVO B;  2AYG A;  3GR0 A;  1UW4 A;  2BM1 A;  4GVL A;  1ARO P;  2HQ3 A;  2MQL A;  4JI6 F;  5A8K B;  1HWL A;  2D9O A;  1GT8 A;  2PN6 A;  3A8I A;  5K14 B;  4RW8 A;  3CCE S;  3J7Y I;  3CUL A;  1LXJ A;  1IVZ A;  3BJY A;  3MMB B;  2ACY A;  1M1G A;  2QLF B;  3CVK A;  3TZX A;  3SYZ A;  3EPI A;  1RT5 B;  1RHU B;  4ED3 A;  1RAB B;  1RWK B;  1BQN A;  1T0T V;  2B5J B;  4C11 B;  4KRW A;  2I6W A;  1FTR A;  2PO4 A;  4H4O B;  2BJ3 A;  1TKZ B;  1X4E A;  2VA2 A;  5ETS A;  4ALZ A;  1LFP A;  2N7C A;  1HKA A;  4YR2 A;  3IRX B;  3H5U A;  3MM9 A;  2R8I A;  2YWE A;  1S1W A;  4MK9 A;  3RB0 A;  3DLL Q;  5FLX U;  5HO4 A;  1XR6 A;  3DLB A;  2J0W A;  4C0B A;  3I0R B;  4IYQ A;  4LMZ A;  2CPD A;  4NCG B;  2YNG A;  4DBQ A;  3VZH A;  1IKY A;  2G4B A;  3NL0 A;  4OX9 J;  1BD6 A;  3FDS A;  5I3Q A;  3MOJ B;  2V6A A;  3PHT A;  2XMU A;  2HWI A;  1HNV A;  3IA0 A;  4WE1 B;  1C0U B;  1X5S A;  1HL6 A;  1SJQ A;  2ZIT A;  4XK8 C;  3W3S A;  1D8Y A;  3MCO A;  4N41 A;  1NU4 A;  3CJ3 A;  1HBO B;  2X1G A;  3JB9 k;  1H6K X;  4HI2 A;  3D1O A;  4YP3 A;  2MGZ A;  4LF4 J;  2NXU A;  1KLM A;  2ZKU A;  4TNO A;  3SQG A;  1ZAW A;  4RW8 B;  2ZM6 J;  2WSC C;  3SXL A;  3OJU A;  4ECZ A;  1N5Y A;  1NK7 A;  4YOE A;  1QVG R;  3BBF A;  2MKY A;  3EGW B;  2QJ3 A;  3FEY B;  2HHH J;  1FD8 A;  2IA6 A;  4JYA F;  2W4C A;  2O01 C;  1ZA2 B;  2B5J A;  2JX2 A;  2XHW A;  4O4R A;  1BHN A;  4C11 A;  3CCL S;  4FXD A;  4M5M A;  1MG7 A;  1ZM2 A;  2LMI A;  2YKN A;  4ID5 B;  1P1T A;  3NBP B;  1H2U X;  5D77 A;  5J2N B;  1HNI B;  4HR2 A;  3KYL A;  4A48 A;  5D3G B;  1FXR A;  2Z2M A;  3EVM A;  4Z7Y A;  5EWF A;  4Y2K A;  2DR5 A;  2HVH A;  3DOK B;  2AIR B;  3PR5 B;  4CT8 A;  3QT7 A;  2Z56 B;  3HSZ A;  1Y7P A;  4H54 A;  3ILJ A;  4DV2 J;  4BS2 A;  2XSJ A;  3KNG A;  3CT9 A;  1U49 A;  4LF8 J;  3BN4 A;  3WQP A;  3R1H A;  4OQJ A;  2HZV A;  1SH2 A;  4N7T A;  4C8M A;  3G2X A;  1X4C A;  1N5T A;  1OSC A;  2LXU A;  2P5V A;  4LRD A;  4ZPV R;  4KQZ A;  5EWE A;  1Z1Z A;  2ILY A;  5H9F J;  4DFJ A;  1TKD A;  4KHR A;  3TUP A;  3HT3 A;  3GCW P;  1WG5 A;  1NH7 A;  1UPM B;  3WDO A;  4RUA A;  4PUO A;  5J2P B;  4GKJ F;  1MN7 A;  4MKY A;  3T1Y F;  3ELH A;  3QGP A;  2GIF A;  4H4M B;  3SQG B;  4B9M A;  1N5S A;  3DKD A;  4OIX A;  3OXG A;  3OT9 A;  2FPH X;  3AJD A;  4OLO A;  3GQC A;  3G4S S;  4DX5 A;  2UVR A;  2KT2 A;  4IH6 A;  3B54 A;  1S6Q B;  4R0J A;  4ZIW A;  2R7W A;  1PG5 B;  3W2W B;  1IQZ A;  1FEH A;  1PJ7 A;  1UVK A;  2WSF C;  2BJ1 A;  2K7K A;  4F02 A;  3NS6 A;  2O5D A;  2P2C B;  4C3K A;  2CIM A;  2ZEJ A;  4F3O A;  1K44 A;  4OHV A;  3MUM P;  1P9Q C;  2H51 B;  2HMI A;  1A9N B;  1NHV A;  3LWM A;  3ZZU A;  5KFX A;  3TOQ A;  4I1T A;  4RX6 A;  1RT4 A;  2W25 A;  3MGJ A;  1RDR A;  3OW2 R;  3OXF A;  4F0K A;  4JI5 J;  4EI2 A;  1B0V A;  4TKT A;  4DXL A;  5AT1 B;  2YNH A;  2RVJ A;  1MNE A;  3FJ2 A;  2F40 A;  4DV4 F;  2HND B;  1T03 B;  1VI7 A;  4ZVG A;  2HVI A;  1EAR A;  5K8P A;  4DL2 A;  4QOT A;  1QE1 B;  2HHH F;  4DR5 J;  4IQX A;  3RR8 A;  2HAF A;  2VFT A;  2ZUA A;  2MMY A;  3OLA A;  4W90 B;  1C1C B;  3QPI A;  1JJC B;  3C8Y A;  4K5R A;  5KG7 A;  2RRA A;  2CPX A;  1AZS B;  1I5O B;  2VPW B;  3GTY X;  3KG0 A;  4DFM A;  4DL4 A;  3IFE A;  3QRR A;  3R5J B;  2VBX A;  2B9X A;  4P7V A;  1XMB A;  1ZM9 A;  2CQ2 A;  1R0B G;  3MF5 A;  4FPI A;  5A6W A;  2V2Q A;  3S1T A;  2RSQ A;  4OYZ A;  3TX8 A;  3GSI A;  4LRA A;  1X60 A;  1ZZF A;  2Q1L A;  2PEH A;  4DX7 A;  4F25 A;  4QWE A;  5IT4 A;  5I42 A;  4EO6 A;  2GHP A;  5JJB A;  2DHS A;  3M2U A;  1FKA F;  4CYU A;  5T7L A;  4LIW A;  1X9W A;  5DGA A;  3MPD A;  4QWB A;  3ULH A;  3KJF B;  1SL2 A;  3EUN A;  2ATL A;  4Q7A A;  1JNR B;  3V2U C;  3R6L B;  3QSI A;  4K2X A;  1NAQ A;  2F5G A;  5BYR A;  3TQE A;  2ZHO A;  2MQM A;  1G4C A;  4RUC A;  2MDA A;  2CDQ A;  3OVS A;  3KK3 A;  2J0S D;  2ZH9 A;  4PEO A;  2OEM A;  5EX3 A;  4DR7 F;  3JQJ A;  1TL3 B;  2OP5 A;  3TVY A;  3D0H E;  3IG1 A;  2JC1 A;  4Y2M A;  3GV7 B;  3C15 A;  4F4K A;  1CS4 A;  3DRR B;  4KGM A;  4DSI A;  4URS A;  3LP2 B;  4I69 A;  1HIY A;  4E98 A;  3H5S A;  3HT0 A;  3EDQ B;  3ITH A;  8ATC B;  5KFO A;  1SJ3 P;  3NOG A;  1ZA1 B;  2ZHA A;  4NE9 C;  1JLB B;  3OFF A;  1NJZ A;  2AGP A;  5D8H B;  1RTD A;  3DOL A;  3NAI A;  1X0F A;  2VPX B;  5IC6 B;  2BBE A;  1K0V A;  4X64 J;  2PD1 A;  1OS5 A;  2MLZ A;  2Z0G A;  1KS2 A;  2YNI A;  4ITS A;  1BQM B;  2WK4 A;  3HX9 A;  2NPI A;  1TZ0 A;  4NLP A;  2PE8 A;  3LGH A;  2JJ4 D;  3FBC A;  4R8U A;  1NK0 A;  4J7C A;  5KFK A;  2XLK A;  2H5E A;  1DQA A;  3BQ0 A;  2XO6 A;  3OXL A;  2ALZ A;  1D1U A;  2UUA F;  4FBU A;  1ZZN A;  3D6H B;  3S8S A;  3I9Z A;  3KUH A;  2HQC A;  2DNG A;  2KJV A;  2OKQ A;  1GX6 A;  2CJY B;  4RNH A;  4DN0 A;  5HVH A;  4DF4 A;  4ELV A;  1C1B B;  4ZVF A;  3MED A;  1HQU A;  4JI0 J;  1YGY A;  3CDW A;  3MMJ A;  4MKA A;  3P5T L;  2HVE A;  3SEO A;  5LMU F;  2PFF B;  5HI7 A;  1PKU A;  3M8W A;  1RCO B;  2QC3 A;  1FNM A;  1W7W A;  4DHV A;  1HNX F;  2EVZ A;  5K8M A;  4FF3 A;  2E5J A;  2DCU B;  2Y0B B;  1OO0 B;  4F67 A;  2DGU A;  2BAN A;  4UF4 A;  4PG8 A;  3BPD A;  3JTN A;  4QPT A;  1RAA B;  4QIW D;  3PX6 A;  3LQV A;  1FRM A;  4NX9 A;  1F9E B;  2ZOF A;  1NB7 A;  2FJA B;  3M2R B;  1FDD A;  4CO3 A;  4ZCK A;  1MMN A;  4L72 B;  5CZX A;  3SDE B;  1C2P A;  3QYY A;  1U1O A;  2WB4 A;  3R7B B;  4CLY A;  3NGU A;  1U8W A;  2GC8 A;  3ITH B;  3UDE A;  1WI6 A;  2D41 A;  4IRD A;  3M2V A;  1EAY C;  1WHV A;  2ZKT A;  2DCL A;  4FZV A;  3PJ9 A;  3K5M A;  1WC1 A;  3ZC4 A;  5THW A;  3D0I E;  2K2P A;  1CJT A;  1G7C B;  2GJF A;  4DMZ A;  1R31 A;  2LXF A;  4OMF G;  3AQP A;  4N8O A;  4ECY A;  4HDG A;  2C22 A;  1RYR A;  4DQP A;  2IYG A;  1LKZ A;  1UFK A;  2C3Y A;  1WOR A;  3JXO A;  3KLH A;  1HNZ J;  2UUT A;  3WIV A;  2J8A A;  3IR7 B;  2KT5 A;  3Q2S C;  3Q8Y A;  2I8E A;  2MJU A;  4LFC F;  4WZQ A;  5L9X A;  2CQ3 A;  3R5G A;  4CDI A;  2VIC A;  1N33 F;  2H3E B;  3BZQ A;  4A46 A;  5EX0 A;  5KFB A;  4PPD A;  4IO9 Q;  1S4E A;  2AJ0 A;  3KK2 A;  4U8V A;  2GGP A;  4DUY J;  2MKJ A;  3TVZ A;  3CCZ A;  1HBN A;  3DLK A;  2E9Z A;  2FJB B;  2JHE A;  3QBC A;  3CJ4 A;  1LK5 A;  5HK4 A;  1J27 A;  1C0T B;  3MAA A;  5H9F K;  2RJZ A;  3HKZ D;  3KKF A;  3LP0 A;  3R8Y A;  3ZZ0 A;  2J6U A;  2WTF A;  1SL1 A;  2VG6 B;  3BGR B;  1FT8 A;  3RBX A;  2HGM A;  4JI3 J;  1H98 A;  2AYE A;  2CQG A;  2BRK A;  2W2O P;  2DNK A;  3EYZ A;  1T95 A;  2BE7 D;  2X1A A;  1SJ1 A;  2QIF A;  3R97 A;  3EZO A;  2Y8W A;  3F56 A;  2B9W A;  2ZE2 B;  3N6L A;  1SBR A;  2DH9 A;  2KKH A;  4DR2 F;  3T6B A;  1JQG A;  2M52 A;  4YDD B;  2C2M B;  1VRT A;  4K4S A;  1OPI A;  4LRB A;  3VGT A;  2ZZN A;  1NUE A;  5D0E A;  1UA0 A;  1I94 J;  1NK5 A;  2DPI A;  4MKB A;  4ZPB A;  4C98 A;  2L9N A;  3BS9 A;  1FXL A;  4G1P A;  1FXD A;  3FBE A;  4L75 A;  1V5V A;  4ZVQ B;  3PJW A;  3U1N A;  4EYH B;  2HGN A;  3H7H B;  4CLW A;  5J1E B;  4J9M A;  4DV7 J;  3LUY A;  4EGL A;  3KLG A;  1KQS R;  3CNQ P;  4LVO P;  3W66 A;  3DOM B;  2VOO A;  1WUU A;  3PTW A;  1ZS6 A;  5I3P A;  3FQL A;  4URG A;  3NP5 A;  1IR2 A;  3Q8P B;  3MUT P;  3FCV A;  1WEZ A;  2CXE A;  2M0G B;  2R42 A;  5KFE A;  3HHD A;  2JEG A;  2RS8 A;  1JLA B;  2UUW A;  3HUL A;  3MEG B;  2GVZ A;  2XGQ A;  4KPY A;  4MMO A;  3HZG A;  1NZ8 A;  4I6Y A;  2UU9 J;  2AWZ A;  3DLE A;  2DYA A;  2N3L A;  4DV6 F;  4DSJ A;  4USI A;  4WP3 A;  3UR3 C;  1Q0N A;  3V81 B;  2ZH3 A;  1WNE A;  5M2R A;  3DYA A;  5HQ8 A;  1Q81 T;  1HD0 A;  3AAW B;  5DLG A;  4C8K A;  2QLW A;  5CZV A;  5HAO A;  1X0P A;  1CJV A;  2PSZ A;  1RB0 A;  4Y0F A;  4P9S A;  3CO9 A;  2V8V A;  1T05 A;  4YHH F;  4G3I A;  3ZNJ 1;  3QJP A;  3D68 A;  1SH0 A;  1Y10 A;  3DGP A;  3KLF B;  4FN5 A;  2HQI A;  2LEB A;  3ENQ A;  1E6V B;  1HAR A;  1S1V B;  1TL7 A;  4FP9 A;  1CG2 A;  3ONQ A;  1WKJ A;  2J7K A;  4PR6 A;  3W2V A;  6FD1 A;  2CWX A;  4J37 A;  5F9N A;  1JX4 A;  4RU2 A;  4MIW A;  1HI8 A;  2HHV A;  3TQ1 A;  1X5T A;  1HFE L;  1Q95 G;  2CWK A;  2H4Y B;  2W9C B;  3DRP B;  3BGU A;  4KT0 C;  5ETP A;  3W1Y C;  2XCA A;  3GV8 B;  8AT1 B;  4DR3 J;  3HP6 A;  4I2Q B;  2N4D A;  2GZO A;  4IG0 A;  5CYJ A;  5KT6 A;  4X65 J;  5DJB A;  2V2Z A;  4KFB B;  3GB0 A;  1NKC A;  1NJI T;  2GJ2 A;  3C14 B;  3LTO A;  4Q45 A;  1S9G B;  1WDT A;  4RLE A;  4HAC A;  2ASJ A;  3Q0A A;  2G2Z A;  2XNR A;  1UEK A;  1CC8 A;  2A6M A;  2G0J A;  3NXZ A;  1B0T A;  1KWM A;  2A18 A;  4MJK A;  3UCG A;  4B3O B;  3J7Y U;  1XTZ A;  1AFI A;  1LQ9 A;  4OZL A;  4TN2 A;  5C42 A;  3IBC B;  2VBY A;  2YVS A;  3MM8 B;  3O44 A;  5KG6 A;  4BLG A;  3W8P A;  4IFY B;  4RUH A;  1CJK B;  4GC7 A;  3OR2 A;  3U27 A;  3WX4 A;  2HHT A;  1SB6 A;  5B0E A;  3QNW B;  1IQT A;  2VKZ G;  4IUF A;  3A1Y G;  4L76 A;  3KG4 A;  3F41 A;  4KYZ A;  1CEZ A;  3WIU A;  3D1H A;  4DPO A;  4G6V B;  1FVQ A;  2MPU A;  4WU3 A;  4TU8 A;  2Y1I A;  3P8B B;  4KPC A;  4F36 A;  1CQN A;  3B78 A;  4QBU A;  5KOW A;  2A2C A;  2M3D A;  1H72 C;  5KFJ A;  2VPY B;  2B7C B;  3BF4 A;  3MPW A;  1N6Q B;  2EFO A;  2DR9 A;  1X4F A;  1OYD A;  4R25 A;  1YK9 A;  1DAR A;  3MR7 A;  4LJM A;  1C4A A;  1FE0 A;  1FKP A;  3NCR A;  3M30 B;  4RW4 B;  3W5Y A;  1PAE X;  4DZ6 A;  5K8O A;  2W7A A;  5KFP A;  4QWC A;  4KTQ A;  1DAX A;  5KG3 A;  4RWX A;  1AXQ A;  3A3O B;  1WOO A;  3DRP A;  4P73 A;  2BUN A;  3GLJ A;  3P3D A;  1F0X A;  5HAT A;  2ASL A;  3HHL B;  4NXN J;  3BYP A;  3NNC A;  4PWD B;  1Y4Z B;  2EFQ A;  3AB2 B;  3CIM A;  2OPP B;  3M32 A;  5K5M A;  5KFL A;  1A7G E;  1WWH A;  4QIG A;  2R7U A;  2NPF A;  1SPB P;  1T9U A;  5HMW A;  1GX5 A;  1YZ6 A;  2HG4 A;  2R9L A;  1Q1K A;  2HHU A;  2KI2 A;  3L9Z A;  4UOG A;  4LBP A;  2DEI A;  1YKW A;  3IC1 A;  5AJ3 J;  4D3G A;  5GAG U;  2MQ8 A;  3PW4 A;  1KN6 A;  3DLG A;  1Q53 A;  2AX1 A;  3OTB A;  3THV A;  4X65 F;  4DN9 A;  1OY8 A;  4AL5 A;  5DM6 Q;  1V9O A;  3CDU A;  2QV6 A;  2B0G A;  2C2E A;  1NSA A;  1DTQ B;  3G71 S;  1IR0 A;  4UW2 A;  3B4M A;  2YPZ A;  5F9L A;  2G1H A;  2QTW A;  2NXE A;  3M8R A;  1LK7 A;  1D09 B;  3VR1 A;  4U67 Q;  4OHZ A;  1FRH A;  1YJ9 S;  3Q83 A;  2QL7 B;  1YZ7 A;  3R9L A;  1NPR A;  3UPF A;  2GV1 A;  4KGK A;  1RT6 B;  2YPY A;  3CJ8 A;  2ATC B;  3GZ7 A;  3LF0 A;  3T3F A;  3AH6 A;  1U7L A;  2DHH A;  4B9S A;  1FDN A;  4TY8 B;  4PZV A;  1RTZ A;  4W92 B;  2R7V A;  3ISN D;  2W8K A;  3VZI A;  1FA0 A;  5E5N A;  4O4G A;  5F8J A;  1W2B R;  4URQ U;  4LIR A;  2D3O 1; 
#chains in the Genus database with same CATH homology
 3BBB A;  1NSP A;  3VGU A;  1NSQ A;  4AND A;  1B4S A;  1NLK L;  3EVO A;  3Q86 A;  5IOL A;  2HVE A;  1NSK L;  3VGS A;  1PKU A;  3G2X A;  1W7W A;  2BX6 A;  3ETM A;  1LWX A;  1WKJ A;  3EVW A;  1HLW A;  3VGV A;  1NDK A;  3WX8 A;  4F4A A;  3NGR A;  3NGS A;  4ENO A;  2AZ3 A;  1MN7 A;  3BBC A;  2CWK A;  1NDP A;  3ELH A;  2B8P A;  3NGU A;  4EK2 A;  1U8W A;  3DKD A;  3GP9 A;  3Q89 A;  3PRV A;  3VVT A;  4FKY A;  3PJ9 A;  1NPK A;  3B54 A;  3ENA A;  1KDN A;  3Q8V A;  1NB2 A;  1K44 A;  1NCL A;  3Q8Y A;  3ZTO A;  4WBF A;  4ANE A;  1BUX A;  4W98 A;  1MN9 A;  3BH6 B;  2DXF A;  3FBB A;  1NHK L;  1WKK A;  1LEO A;  4O0N A;  1NDL A;  4UOH A;  1S57 A;  2DY9 A;  3B6B A;  3ZTS A;  2NCK L;  5BXI A;  2ZUA A;  3ZTQ A;  4KPC A;  4F36 A;  3VVU A;  4CP5 A;  1VYA A;  1NDC A;  2VU5 A;  1HHQ A;  3ZTR A;  3EE3 A;  1XQI A;  1EHW A;  1PAE X;  3GPA A;  4DZ6 A;  4FKX A;  5CAA A;  1WKL A;  3EIC A;  2B8Q A;  3FKB A;  3L7U A;  4DUT A;  3MPD A;  4ANC A;  1BE4 A;  4UOF A;  3EJM A;  1F3F A;  2BEF A;  1XIQ A;  3BH7 B;  4UOG A;  1S59 A;  1F6T A;  3VGT A;  5CAB A;  2HVD A;  1NUE A;  1B99 A;  4S0M A;  3FC9 A;  3FCW A;  3Q8U A;  1HIY A;  5C7P A;  3FBE A;  3EM1 A;  3FBF A;  3EMT A;  3Q83 A;  1ZS6 A;  3R9L A;  1JXV A;  3BBF A;  3FCV A;  1S5Z A;  4C6A A;  3DDI A;  2DXE A;  2DXD A;  1BHN A;  1UCN A;  3FBC A;  3JS9 A;  2AZ1 A;  3ZTP A;  4DI6 A;  2DYA A;  4HR2 A;  2HUR A;  3NGT A;  3EVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...