1NDKA

X-ray structure of nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
KERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIICGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title X-ray structure of nucleoside diphosphate kinase.
pubmed rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 45
structure length 148
sequence length 148
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndkA00
1W7WA 2AZ1A 3FCVA 3G2XA 3ZTRA 3PJ9A 1WKLA 1B4SA 1PAEX 3FBFA 2BEFA 3FKBA 2BX6A 1WKKA 4FKXA 1B99A 3FCWA 2HVDA 3FC9A 3VGTA 1EHWA 3WX8A 1NSKL 3B6BA 3VGSA 1BUXA 3BBCA 3GP9A 4WBFA 3FBCA 3ZTPA 3EJMA 1MN7A 1NDPA 1S59A 1U8WA 4UOHA 1WKJA 4F4AA 3FBBA 3DDIA 3BH7B 3FBEA 3PRVA 1NDLA 4ENOA 1PKUA 3GPAA 4O0NA 3Q86A 1KDNA 3BH6B 3ZTSA 2HVEA 3B54A 2DXEA 2DXFA 2B8PA 1HLWA 1NPKA 4DUTA 4DI6A 1NDCA 3ZTQA 1NLKL 4DZ6A 3EM1A 1BE4A 3NGSA 3VGUA 4ANEA 1NSQA 1VYAA 4ANDA 5CABA 3L7UA 3DKDA 1NUEA 4W98A 1BHNA 2ZUAA 3BBFA 4ANCA 3VVUA 1K44A 1HHQA 2DYAA 4EK2A 3VGVA 1S5ZA 2CWKA 3Q8VA 4F36A 4CP5A 1JXVA 3Q89A 3ZTOA 1NHKL 3EVMA 5IOLA 3ETMA 3BBBA 3ENAA 3VVTA 3NGTA 1LEOA 4UOFA 3EVWA 1LWXA 4C6AA 1XQIA 2NCKL 3EICA 3Q8YA 2DY9A 1NCLA 5CAAA 1S57A 1MN9A 2B8QA 5BXIA 1NB2A 1F3FA 3NGUA 1NSPA 4UOGA 2DXDA 4HR2A 3NGRA 1UCNA 1NDKA 3MPDA 3Q83A 4KPCA 5C7PA 3EE3A 3JS9A 1XIQA 3Q8UA 4S0MA 3EMTA 1ZS6A 2VU5A 3ELHA 3EVOA 1F6TA 3R9LA 4FKYA 2AZ3A 1HIYA 2HURA
chains in the Genus database with same CATH superfamily
3M8RA 3P96A 1RWVB 4QWAA 4N76A 4O44A 2HHHF 2K7JA 2CJAA 2XS5A 1VQ6S 3MEDB 4XK8C 1VRTB 2ABYA 3OL6A 4H4KA 4F4AA 1JKHB 2POKA 3BH7B 1NDLA 2DISA 3M6VA 4NXMF 2BANB 3PZPA 2YPZA 4ECYA 2WRMA 4L75A 4IG0B 2H5JB 4MAKA 2D9PA 5J1EA 3NP5A 5GAEI 3GIJA 3OSPA 4C11A 1N5SA 3EVMA 1Q5VA 3D2WA 2FHJA 3HSGA 3T6BA 2CQ4A 2YTCA 3X1LB 1H38A 1EAYC 3O8WA 2HGLA 3TWZA 1JLFB 4DEZA 3I56S 2I8EA 1MMLA 3ET6A 2DVIA 3NS6A 3PHEA 4Q2MA 2DGWA 3MPWA 2W2QP 3UFCX 3FK4A 1RTDA 2HQGA 1NU4A 5DGAA 1GEHA 2OPPB 4DPUA 2R7SA 2Q66A 1RWWB 3DHXA 1HNZF 1KVIA 2BJDA 4DQSA 1WHWA 4QIFA 1FEEA 4DBQA 1D9FA 3BGLA 3MURP 2EK6A 2QRRA 2P6TA 1T95A 5DQGA 3W7BA 4IH5A 3MMBB 4AXIA 2MHNA 1FK9B 3KK2B 2W9BA 3IWXA 2DITA 4HDHA 1NJWA 2KDOA 1ROFA 1HBUA 2BYCA 3RRGA 4RBTA 1T94A 1B70B 1X60A 2JC1A 5KFIA 5I3PA 2W9AA 1YX2A 1BQXA 4DV2F 3MUVP 5HP1A 1R0BG 4QIEA 4HTIA 2C2NA 3C14A 1D09B 3AODA 2RJZA 2ZC4A 2AJ0A 1AT1B 3GWCA 2BABA 1DTTB 3KHHA 4NLWA 3O44A 1GAOA 3ITHB 2VA2A 2HBZB 2QL5B 1DTQA 3PG9A 4R0JA 3MWBA 3NNAA 1OQ3A 4DUYF 4O4RA 1RHKB 1HMVA 3GIIA 4K7QA 1XR6A 2FHJD 1U26A 1H0HB 2E7XA 3IR5B 5IM0B 4JI2F 2BE2B 4IOBA 2ZJQQ 3PW4A 3IBWA 1NPPA 4ID5A 4V19J 1B7YB 2HHTA 2R8HA 1NDCA 4NA3A 4DL4A 2C28A 1BQMB 2DO4A 3MOZA 3OTOF 4NLTA 2EXUA 2W4DA 4HACB 2RH3A 1RJJA 2HFZA 1Y7PA 2HNYB 2MMYA 1U2FA 4ER8A 4QW8A 1T9TA 2LU1A 1WHVA 2CZVC 2L3MA 2KB2A 2F40A 2DRAA 2CA9A 1DY3A 2B7BB 1RLDA 1HPZB 3QFWA 2WVDA 5B0FA 4J9PA 1N4LA 3MI7X 1U6BA 4UOGA 1U1QA 4R8UB 2HMIB 3W65A 3DRYA 1LV5A 1AUDA 4DQIA 5CH7B 3K89A 4RW4A 4FF4A 3V81B 3FBFA 1MROA 2Q1LA 2V68A 4IQXA 1U25A 5K9FA 4X2BA 1S6UA 1CJKA 2E9TA 3CMAS 3UDLA 3MCNA 2WAQD 1RKJA 3BBCA 3ZZTA 4DV7F 2E7VA 3TUJC 2XI3A 3T1HJ 2NUUG 2FB0A 4DR7F 5CD4A 4ZHRB 3IR7B 2ADCA 1UPMB 1VC5A 1WORA 2LEPA 2M88A 2QJ3A 3VAHA 3O2IA 1FI4A 2APOA 2J76E 3ENQA 3GIKA 4PRFA 3SQGA 2JC0A 4ZPWR 1C1CB 4DR1F 1Y11A 1XNRJ 2GNKA 1B64A 5K5MA 5J2QA 3Q89A 3EXCX 1RHMB 5LSLA 1F3VA 2XULA 4ES3A 3GMGA 2F8HA 3KTQA 4BC7A 1HQ2A 2VODA 2CWXA 4MJKA 2CJYB 3TQ1A 1IKVB 2FVQA 3DOMA 2VJUA 2DNPA 1NM2A 3DLBA 1ZS6A 3ONQA 4OZ2A 1XR5A 3ZFVA 3NAIA 1TL3A 1F0XA 2GA7A 3G2XA 4DCOB 4NXNF 2LQBA 2GVZA 2Y0BB 3FKBA 2R2SA 3F41A 2AGOA 1U02A 5T14A 3VGTA 1SQGA 1HBNB 4ZS6A 1GXTA 1IWGA 1W26A 5A8KA 4WYWA 4B3SJ 5HAOA 3RR7A 4J9UE 2F7VA 1FKOB 4CH0S 3BH6B 4UY8T 1X9SA 1KHWA 2B8PA 3QGPA 2FVPA 2V94A 4G6VB 1KR4A 4GMKA 1FJCA 1WDTA 3NGSA 2RDJA 3ZC4A 2BACA 1RYRA 4KIAA 3V6HA 2UVWA 4NMLA 5KFYA 3CGIA 4CP5A 4DR2J 4AD6A 2MQLA 5KFTA 4ZIWA 4B3RF 4U7UK 4F3OA 2V4QA 4LBIA 2X1AA 3QBCA 2MQOA 1W2BR 5KFRA 1HNXJ 2OAUA 1SL0A 3MEKA 5CZXA 3QWPA 1YSJA 1HIYA 3PNIA 4YDDB 1FXDA 1A0OB 3RBDA 1IBKJ 3THVA 3BKUA 2EEYA 3GIRA 1S48A 2IYGA 4HHUA 5HQMA 3UDCA 4HEA9 2FJXA 4PWDA 3M2VA 2IM3A 2VG7B 3DN9A 2BKOA 2RB7A 4YDXA 2B4VA 2QYCA 4WIIA 1L3VA 3V2UC 3Q8QB 2NREA 3J81j 3ZZUA 3DLEB 3CJ5A 2NPIA 2PMWA 1FWKA 5D0GA 2IJFA 2OEKA 2Z57B 4L3KA 1UW4A 3CO9A 1WEXA 5F3ZA 1TMJA 1WC4A 1NH7A 1TL4A 4NLOA 1D8YA 2GMJA 3SZ2A 1EP4B 5KFJA 4JI4F 2Q3PA 3UDVA 4KGKA 4HVZA 4ERDA 5LSOA 3G71S 4QBUA 1TVRA 3M8PA 5KOWA 3V6DA 3D28A 1IKXB 1BMQB 5SZTA 3KLIA 4EYIB 3FCWA 1CPZA 2X1FA 5F8IA 3QRRA 4U95A 1HBOB 2MZQA 4OHYA 3DGPB 3LW5C 1LXNA 3QSIA 1RTJA 3GFYA 2FDNA 2LEAA 2DR7A 3ISNC 2XY5A 2N82B 2N4CA 2C2EA 5J2PB 1F5AA 3HSDA 3LP1B 4LT6A 4DV0J 2GMLA 1YJRA 4PR6A 5DLGA 1YJ7A 1VQ4S 1JJCB 3CJKA 2QEXS 4IKAA 4KO0A 4GKJJ 1PYOB 1FRIA 3GIMA 3TR5A 3CDBA 1I3OB 2X3DA 1RBLA 3M8ZA 5C7PA 2DKOB 3RB6A 3IM9A 1RTIB 3A3PB 2PDAA 1MW7A 4Y2CA 1WC1A 3RAMA 4ECTA 4EBDA 2MEWA 2YNFA 1HD0A 1MNEA 2IM2A 3TYTA 3UE2A 4X4VA 2O3DA 5F8MA 1HQUA 4ENOA 1TUWA 5KFFA 5GAGI 4JOUA 1P1LA 5KT5A 3M9MB 2HAFA 4FYDA 1PC4A 4IRDA 5IC4B 3ILLA 2AF6A 3HHKA 3CC7S 1ZAWA 4YMEA 5EUHA 2KVIA 3HDSA 4PG6A 1QE1B 4JV5J 1VCTA 2IYIA 1NCLA 4USKA 2ZH1A 2E44A 3U7JA 1OQ6A 3L9ZA 3T1YJ 4Z7YA 2XM3A 1JWWA 4LJMA 2UXDJ 2G2ZA 1WEYA 2ASLA 1HQEB 2HPUA 1HNIB 4I69A 2RVJA 2V5HG 3O6QA 1RBOB 1TV6A 1Q8IA 2DD8S 2HRYA 4DS5A 3IAM9 5AJ3F 1FRHA 4ZCMA 3FSXA 4K2JA 1ZM9A 4LF1A 1K9MT 3DRXA 1R6YA 4DL6A 3B82A 1Q7LB 3H0PA 2XLJA 5ETKA 4LF5J 5IQ6A 5HMYA 4FVMA 2UXCJ 2OH2A 1KP6A 4CLYA 1V3RA 1VR6A 1L3UA 1CBKA 4ANDA 3C3LA 3L7UA 3M05A 3FDSA 4DV3J 1XMQJ 1IKWB 2LXFA 4ZVQB 4F3MA 1HWIA 3VCDA 1M5OC 1RXOB 1YIJS 2XBPA 2KTQA 3D6MB 2AKWB 4RW8B 3OL8A 2LEBA 1FJGF 4FZVA 1RU2A 5BXIA 1D0EA 4DPOA 3SQOP 3M8QA 4FS2A 3C15B 1A9NB 2ZJPQ 3F0NA 3KDNA 3W66A 2AV5A 5F8JA 4FYXB 3P6YC 5GAHI 1K47A 2HHWA 2VQFJ 3B78A 1GTEA 3EGNA 5JJBA 2MPUA 3AB2B 1U8WA 3M2UB 2X7IA 1V5VA 3GQCA 4PKDB 5HROB 2WONA 3PO4A 2H5IB 4FPIA 4ED8A 2LFVA 3HF5A 2EBGA 2QC3A 1HR0F 2HGMA 2ROEA 1T9WA 1ZH5A 5E0OA 3J7Z5 2HQ3A 1FRXA 1IR2A 3CCUS 3RBEA 3GE9A 2KXNB 2AD9A 4OI6A 3M32A 3EVWA 1LWXA 3MM9B 4JB8B 4YR3A 4TY8B 2BJ1A 2R9LA 1UVIA 2RMLA 3NGUA 2CPIA 3RG6A 4G65A 3F44A 3AAWB 4X4OA 2ZH6A 5ADZA 4C8NA 2YNIA 1ICEB 3OUYA 3HULA 3I0SA 2ILYA 4OX9F 1XNQF 4DQRA 1CS4A 3ISZA 1Y9OA 4DCJB 3BR9A 2B9YA 2U2FA 1H72C 2PFFB 1WKKA 1XN9A 2ZUGA 5KFMA 4I2PA 2UUBF 1AUSL 5F0UA 1U1MA 2DBBA 4DSLA 5BJRA 3MM7B 4HLBA 1VJQA 1NJXA 5B0GA 3FRYA 4X4SA 3PR4A 2R8IA 4Z2XA 2GVDA 2YKMA 4DPWA 2CDRB 3QIPA 1TUVA 2YKAA 2ZOGA 2J8SA 2KT3A 1X4HA 4ECUA 4OZ5A 1WTBA 1PJ6A 2B5JA 4CH1A 1RT7B 1KWMA 2VV5A 1G6BA 1X4DA 1XJWB 2YY3A 4C48A 3VGVA 4OI2A 3IC1A 1SJRA 3NRBA 2YH1A 4B17A 1Y4ZB 4KC5A 4LF7J 2J6UA 3DOKA 3QLHA 4F4YA 1WI6A 4F67A 2W4CA 2YKOA 2K3KA 1LWFA 3V6KA 2FZGB 3NWGA 4CZCA 1K0VA 3FQKA 4RJVA 5LL6d 4OLOA 3A12A 2VICA 2BBEA 3MM8B 4QQBA 1YTYA 1U2CA 3OTCA 4Y2IA 3HXMA 2VPZB 4LSLA 1BLUA 3HD2A 2G0JA 1JLQB 3TQEA 1XTZA 4MT1A 3T19A 4R5PB 2FPHX 2ZZMA 1CG2A 2QSWA 4GVBB 3PR5B 1VQOS 3PJWA 1HNVA 2VPWB 3C8YA 4NLVA 2EKYA 2BOAA 2NXCA 3CCQS 1SI9A 3ZNUA 2CPXA 4X4QA 3D6FB 4ZPTR 2WK4A 3TRGA 2LMIA 1I51B 4G1QA 4KE5A 3OFGA 4RNOA 5B0CA 1K44A 3E01A 2VFRA 3FEZA 1FKPB 5E2QA 1IBLJ 2UZAA 4GC6A 2RS2A 1N33J 2WBMA 1F1BB 3FMWA 7AT1B 2YWKA 2OTLS 1M5HA 3HT3A 4DL3A 1WSRA 4JI8F 4LF4J 2C22A 4M5MA 1FRMA 4I6AA 1WF2A 5DRKA 4NCAA 3BF4A 4NA1A 4LBHA 5ETQA 2XMKA 2ZHAA 4IQMA 3PKMA 3DLHA 5HI7A 4C8YA 3MD3A 3VZHA 4OQJA 3GU0A 3OR1B 2KFNA 1SJ3P 3BN4A 2GHVC 4F25A 3KWMA 1C1BB 4P2SA 3MR5A 1JLFA 3ZZPA 1NDPA 2K1RB 4USTA 5KFNA 2CYYA 3BJYA 5G4DA 5A2QU 1D1UA 1N6QA 2QYGA 3TZXA 1VQ8S 4RU2A 5D15A 5AT1B 1SC3B 3I87A 4YR2A 2V9KA 3TZWA 2OPPA 5A0YB 4PEOA 3FZBA 3VAFA 1U47A 2WB1D 2OP5A 3PO5A 3CPWR 3CCTA 4RLEA 4LRBA 1Y3KA 2C42A 1CQNA 1QVFR 4K5SA 3R1HA 1UJ5A 3VTIA 4LUBA 1UFWA 3HJVA 3NMRA 4M8LA 5H1SV 1N8RT 2X1GA 3HVRA 4RW6A 4J91A 3I82A 3PJ9A 2XLKA 2Y3YA 1G2EA 4NI2B 1SIWB 1F9FA 3EGVA 1LFWA 4NMXA 4QIWD 3CJSA 2HVDA 4N8OA 1T9YA 3ILJA 3NCQA 4OJGA 2EPIA 4WK3A 4NASA 2I2YA 3WX8A 5F0WA 1KOOA 3MM5A 3PYFA 3UCZP 3HI9A 1IBMJ 4B08A 4N7TA 1S59A 2V63A 4IUFA 2BJ9A 3GPAA 3CXCR 4Q2LA 5M2UA 2CNKB 2AWZA 4CWBA 1KRPA 3JSMB 2PN6A 4K4ZA 1SVDA 1K73T 3GZ7A 1QLNA 1OSDA 2BV3A 1RA7A 2HWTA 3MECB 2QE5A 1O5JA 3DLJA 4KHMA 2H65B 1G4CA 2YNHB 3CJ2A 5ETMA 3WC0A 1JLEB 3M8SA 3KOAA 4DR6J 3SCKE 2FLOA 5L38A 3TUPA 3T1HF 2HRUA 2VOPA 2QLBB 3D54A 1VQPS 2MKKA 3R7SB 1P6TA 3NEKA 3NGRA 2R8KA 2PA8D 3ELHA 1FT8A 2IDEA 4TY9A 1VQKS 1N5QA 2CG8A 5HBMA 2HNYA 1XNRF 5D78A 3CJ0A 1NMEB 2V8DA 2OSQA 3LP0B 3TO8A 2YWFA 4AL6A 2G1HA 1HPZA 4DLGA 2JLFA 2Z2MA 4N5SA 1X7VA 2FZKB 2HMIA 2H5EA 1IWAA 4TKTA 1V5IB 1OYEA 3H2UB 2G13A 3PDNA 3HSJA 1DRZA 4JI5J 5HMWA 3PM9A 3R97A 3R5DA 3NY0A 2W2MP 2HKEA 4G3IA 2ZBIA 3U1NA 2VUGA 1U1NA 3CUNA 2GQQA 1TL7B 4ZLJA 5HLFB 3G8QA 4Y0FA 3C16B 4B3SF 3I5BA 3DHWC 2VBZA 1GK8A 3E51A 4NRUA 4Q0BB 2BM0A 1WOSA 2ZVSA 3A4TA 2A1BA 2RHSB 4FPRA 3I0RB 2P2CB 1SCJB 3GYNA 4K2XA 2QA4S 4LSNA 4RNHA 1NK7A 3PW5A 5LMUJ 1C1CA 1URNA 1WF1A 1SJFA 3IAS9 1KS2A 2UUAJ 4G1PA 1N5VA 3PV8A 4WBFA 3UVJB 4DSKA 1LWCB 3WZ0A 3OR2A 3S01A 1VGYA 3NS7B 1HNXF 3DCAA 2DHSA 1AXQA 2I6WA 1EIYB 3ZXWA 3NG8A 4O44B 1KVJA 5BYSA 4ETXA 2H1YA 2ZNZA 1IBKF 4CLSA 4O3SA 4LIRA 4ZJQA 3PW7A 2GO8A 3CDAA 3V5RA 2QLWA 5KG2A 2I38A 4LQ3A 4ED6A 4J37A 2MZTA 1H74A 5K14A 2MB0B 2LLZA 4PXCA 2CJ9A 4WU2A 1ZAXA 3M8YA 2XMVA 5ETRA 3EGZA 3BSOA 3BN7A 1RWPB 1M90T 4OZ1A 1IM6A 4C11B 5M2RA 4P2FA 3W8PA 1WTFA 3FSIA 1KD1T 4B02A 5KFQA 5A6PA 3OV7A 1FO1A 3GB0A 5SUHA 4DFMA 3ET6B 1Q8LA 3QT8A 4J9OA 3CF5Q 1GT8A 5KFEA 3V4IA 2VBXA 4RW7A 3M7VA 2RDDA 1RTDB 4LVNP 1FFGB 1Q78A 3H59A 1FRKA 1QAXA 1VQLS 1YRTA 3MFIA 1LWEA 2MTLA 4CTAB 4F50A 4KTQA 3G86A 1SL2A 4ED2A 3HHLA 4LR7A 4IG3A 1X9WA 2W9BB 3M6UA 3MMAA 3TOQA 4YQWA 3DLEA 3B4DA 1VQYA 2Y8WA 2B4OA 3MPDA 1REGX 5IT0A 3EGWB 2Q43A 3UPFA 3LAMA 2J0QD 3BKTA 4BDPA 5L1LA 5KFBA 3GSDA 2FGCA 2W8LA 4ECQA 4DV0F 4A8YA 1NKBA 5HP1B 2XCAA 3H5SA 5CD4H 2BEFA 2X1BA 3C14B 2DNNA 1JNZB 4K4WA 1CC7A 1EP4A 2WVFA 5CA5A 2G0IA 4MKYA 3A3OB 4F26A 2Z4PA 1YQHA 2E7WA 1EB0A 3AOBA 1PKUA 1DTQB 2J9CA 2VASA 2KU7A 4O3OA 2VQEJ 2XS2A 2IY5B 1HW8A 4DZ6A 2HLUA 1HMVB 4RKUC 2XB2D 1U6ZA 2XZTB 2KM8B 2GJFA 1GMVA 2PI5A 2YX4A 1VMBA 2DNYA 1KBRA 3G96A 2FY8A 2IMWP 1A6LA 4DFPA 1HBOA 4IR9A 3DGPA 1KNZA 4ED1A 5C25A 4JI6J 4AL5A 4ID5B 4V19X 4C3KA 2KYXA 2RIJA 3KJVA 3BYRA 3NBPA 4ICLB 5CAAA 2J0XA 1VBZA 5KFXA 3W2WA 5ETPA 1JXEA 1OPZA 4M5DA 4WTOB 4AQYJ 1AFJA 1TK5A 1NK8A 3UD4P 3EZOA 1FNMA 1FJEB 2OD6A 2KXHA 4JV5F 3HHLD 4X64J 4UTGA 4DSJA 4FF2A 3T41A 2HK3A 3R5CA 2M0GB 4U7CA 2KJVA 2NXJA 3T1YF 1NPRA 2UXDF 2DIUA 4RW4B 2AP6A 2AYMA 1MROB 3CCRS 1R0AA 1CJKB 2HLTA 4QR2A 1R31A 3M4XA 4NZ6A 2XNQA 4WFZA 3OHBA 4KFBA 3W9IA 3NKYA 3T1AA 3AJDA 3Q8VA 4YP3A 4D3GA 2OO4A 1S0MA 1UWAA 5DDQC 3AQPA 1C0UA 2FY1A 2LQ5A 4ZN1A 3OW2R 5MLCV 4LRFA 2UUCJ 4LF5F 3SQGB 1QAJA 2UXCF 2C2KB 3SCLE 3OPKA 2DNRA 2JOQA 1XC9A 2NXUA 2JVOA 4WK1A 5JVHQ 1EX8A 4DV3F 5J2QB 1XMQF 2BJ8A 1RADB 5F8GA 4PPDA 1IUJA 3C46A 2FVCA 1GX5A 1BWEA 3A1YG 3SYZA 3DOMB 2EFVA 2LU2A 2V2ZA 3QZ8A 4GO5X 3V4MA 2ROPA 4O23A 3VGSA 4L3NA 3HZGA 2BJ7A 1TL3B 2LQ8A 1R8BA 4Z7CA 2CPYA 2GVZB 3MAAB 2IA0A 1ZM2A 1NPKA 1RQ0A 2JWNA 4ZPVR 2CPFA 3VGUA 3R5BA 1FFSB 5EX0A 5AE3A 5A8KB 3IS9A 3BS9A 3JXOA 4U8YA 3OVAA 2ZWPA 2VQFF 3R7BB 3PCOB 4ZP7A 4QWBA 5KG1A 2L9WA 1NHKL 2MZJA 6AT1B 4RO0A 2HHQA 4WYLA 1F5BA 3Q8SB 1IBCB 4ZVTB 4DUZF 1AYEA 2BMBA 2MKYA 2AZ3A 2AZ1A 1VDHA 1FXLA 4ZCLA 3PEJA 1S7IA 2OPSA 1TMMA 2F3JA 2OFGX 4CLZA 4TYAA 1NK6A 3POTA 1S76D 3OHAA 3FBCA 3ZTPA 3M8WA 2SXLA 1VC0A 2ERRA 4PXEA 4NOHA 1PBAA 1T11A 3QT7A 2HS4A 3P5TL 2EWHA 2J7UA 4YN3B 4C0HA 3PHTA 3QRQA 3M2VB 1SQFA 2J0SD 1VIOA 3QAUA 1X4GA 2V9WA 2V8HA 1RSCA 3CJTA 2MZSA 3L09A 3M2UA 3NGTA 4MK8A 2JX2A 3I55S 3T3FA 1CEZA 2N7YA 4X4TA 4DSEA 2BZ2A 3CULA 2BM1A 2D7SA 2P8IA 3ADAC 1Y5IB 3SV3A 1B0TA 1R43A 2B0GA 4E98A 1T9VA 4X62F 2X3GA 4NLDA 4YS2A 2OUGA 1YBUA 2AYGA 3MCSA 1D9AA 1S1WA 1IXKA 1NSKL 1RAJA 1TVRB 4LF7F 3M8PB 2F8MA 4QYZK 3B6BA 4DV4F 1MWYA 1PYTA 3V6DB 2AJ2A 5I4MA 3HKWA 4O0NA 2XYGB 5KG4A 3T5JA 3CO0P 3B54A 3SDEA 3MPUB 1YDLA 2B3TB 4M95A 3KLIB 4YHHJ 1WDDA 2YVSA 1I6JA 2FGOA 4NLUA 4A48A 1N54B 4HI1A 2C3UA 4H4KC 4CT8A 1RTJB 2K06A 2R2TA 4E8UA 2HIQA 3U1MA 3N01A 3OXLA 2YQ1A 3A13A 1HKAA 4F2RA 3DC2A 2R7UA 2JL9A 2CJBA 1FWPA 1RT3B 4AYBD 2FLPA 3HFVA 1RAHB 1I5OB 1S1XB 1VHFA 3ZO7A 3KUGA 2DXDA 1FHTA 2AMCB 2BXJA 3H5YA 3QPIA 2HRTA 5DDPC 4U7UD 3AA9A 1N56A 2VFTA 3CJKB 1RT7A 4KO0B 1HBMA 5KFDA 4ILRA 2XWYA 4ALZA 8AT1B 2YQ0A 3HVAA 3HFZB 1IBLF 1FNOA 3IM8A 3TVYA 1N33F 2ACMA 2GIRA 1VISA 2KRBA 3G82A 3GCXP 3QIDA 4LF4F 4PZVA 4K0KJ 4B3MJ 2Z0GA 2RHQB 1KQSR 1FA0A 2YNFB 4ES1A 1SH3A 4EU0A 4MTPA 1VQMS 1RHRB 4O0IA 1REVA 2EKNA 4A8QA 3H4BA 3HHNB 1JJHA 4WFBQ 4A8SA 5KTQA 3SSSA 3HPOA 3BBBA 4X65J 4B9LA 4P10A 1TZ0A 4CLLA 2DY9A 1XMBA 5ETTA 4P52A 2QL7B 2MQQA 4M1KA 4WP8A 4YFUA 7FD1A 4K4XA 3GG0A 2PO4A 1HARA 3OSNA 2VJVA 2M8DB 2I5JA 1JXLA 3OBIA 3T9NA 3VQSA 1UZDA 4C0OC 3DDKA 1UVJA 3KHRA 2QLFB 2FUG9 2OMLA 1FKPA 4OJ3A 2H9ZA 2MQNA 1CVJA 1TK8A 2ZD1A 1YITS 1G7CB 3J7YI 1YI2S 4ILMA 1S1VA 3TJAA 1U0HA 2DXEA 4LF8J 1CSJA 1MG7A 2KM8C 1QM9A 3MTKA 2R7QA 1TV6B 4GC7A 3PW0A 1APSA 1QJHA 2RF2A 5A8RB 4NCGA 5L1IA 4DFJA 3OJSA 2ZOFA 3OR1A 2NLWA 4ANCA 4PG7A 4M5HA 4NLYA 2PSZA 2YXLA 4XTTA 2CQHA 4V1Ak 2W8KA 1IBMF 1QSLA 1GXUA 4DLEA 3SFUA 2MKIA 3IN5A 4NLRA 4ZIVA 1URRA 4GRSA 1JLBA 3N28A 2DRBA 4ECWA 4HH0A 4S0MA 4EBEA 2D69A 4ID8A 1FERA 3TZYA 2C3MA 4DQPA 1XERA 2OELA 3CDEA 4P72A 1VI7A 1H6KX 4DR6F 5KG0A 1FX4A 1YRXA 4TXSA 1KLNA 3M8QB 2H3EB 2BQRA 2EC0A 2XSJB 2AJ1A 4Q7AA 3KG1A 3MMCA 4J9NA 4J90A 2A0FB 2RUSA 1H2TZ 2DRDA 2L9DA 4DU7A 4KT0C 2IPOB 5KFZA 1LK5A 2Y1LB 4WKRA 3VAGA 1U24A 2XS7A 1VQ7S 2F4FA 2GIFA 1Z4UA 1HA1A 2QTWA 2LXUA 2E9ZA 1FDNA 3G6VA 2E1AA 4MKAA 1HNWJ 1P1TA 2CVEA 2VFUA 3R5GA 5GVQA 2YKQA 1WSVA 3P4UB 2OLWA 2IC3B 1BGXT 1T3NA 1IJEB 2GIQA 2J9EA 2IDLA 1IM4A 2GJIA 4N41A 4JI5F 4TLRA 4HDGA 3AOAA 3C66A 2IAJB 2JHEA 3Q8RB 4USMA 4CNYA 3F73A 3CCWA 2YNHA 2RE1A 4DG1B 3M32B 2UV8G 3JAMU 1SC6A 3WX4A 3GTYX 3TAQA 2YBVA 1X4AA 3W5ZA 1X0PA 1YWXA 2YNIB 3OUYB 3I0SB 1DLOB 2PE8A 1CS4B 4CLUA 1WHXA 1SUQA 2Z30B 1RHUB 2HZCA 1DARA 1CLFA 3I4PA 3PX0A 4H4MA 4I2QB 3I96A 4E0DA 5KFUA 1SBRA 4I2PB 3TI0A 1OWXA 1K8AT 5A76A 2NR0A 1PAUB 3LP0A 2MY8A 3DRSA 2UUAF 4HT7A 3VVUA 5B0DA 2NZCA 2CADA 1PGZA 5FLXY 2GVDB 1VK3A 1Q86T 2YKMB 4LFAJ 3QIPB 4LFBJ 3MR3A 1ZOTA 1HR0J 4LSZB 2B5JB 1K1SA 2VG6B 2IJRA 1ZTWA 1MWZA 4I7FB 2GS8A 2BE9B 3J81U 4IO9Q 1FD8A 3HFKA 3DOKB 5DM7Q 3QLHB 1M5SA 3Q0AA 4Q0BA 1LWFB 4KBIA 1AZSB 4TN2A 1NEEA 1CJVA 5ETNA 4J7CA 3I0RA 2IVFB 2W2OP 1RT2A 4HYKA 2JH3A 5F8NA 3BO2A 1RAOA 2K8GA 4DUTA 2W4PA 4M5GA 4ZPBA 1D9DA 3FCHA 4IRKA 3M30A 4XAKA 1NSQA 1Q95G 3C2PA 1NUEA 4ATNA 2HWIA 2OEJA 3KYLA 1SH0A 4LRCA 1I1GA 5HMXA 4NZ0A 4CYUA 1YHQS 3CIMA 3M6XA 2I1RA 2F8EX 2GAGC 5E3CA 4YOEA 1T0TV 3GONA 1UJ6A 2HBRB 4UT4A 3CMQA 1RGVA 4G1QB 2WW4A 4DDFA 4JBCA 4JI7J 1GH8A 2L48A 1GNKA 3E01B 4EYHB 3BEGB 1VLYA 2E5JA 3TAMB 3K58A 4OYWA 2F9JA 1UL3A 2MGZA 3BPSP 5L8RC 2YWEA 1YZ7A 9RUBA 2EW9A 1WI8A 4ECSA 2R8GA 3HK2A 5IWAJ 4RWWA 4OYMA 2P9CA 2C2ZB 1RABB 3HJFA 2JZ5A 1EKRA 3UNGC 5LT5A 4OZ3A 2CQ1A 2F65A 1YKWA 4W4MA 4FXDA 2IIHA 3GR1A 1NLKL 4JYAJ 4OYAA 3IRXB 3TVKA 1U1RA 3MXHP 5D0HA 2HFVA 3J7AN 4QW9A 2QT7A 3DRPA 2ZH3A 4BBYA 1N6QB 1AROP 1UVMA 1D8ZA 2VQEF 1YRUA 3OFFA 5KFHA 2A6MA 1DAXA 3LQVA 3KLVA 4DFKA 4C9DA 4GKKJ 3K7RA 1XWLA 2R7TA 2AEFA 1TTHB 5E5NA 4CTAA 8ATCB 3GG1A 2VDIA 4JI6F 4OYIA 3H2VE 5D4LA 3QAEA 2GX8A 3VR1A 5HQLA 3KMQA 4RUHA 4JI8J 3VHQA 2Z56B 2QN6B 3VAKA 2R7OA 2B9WA 2QSFA 2HZVA 4RW6B 1ZA1B 2YNGA 5CHCB 3C6TA 2OPRA 2DXFA 2MSTA 4AQYF 3N9UC 4Y00A 4DV6J 3BB5A 5IT9Y 2D3ZA 2UP1A 5C2GA 1UA1A 1RYSA 4U6PA 2ASDA 4ECRA 3MM5B 1O8BA 1H7WA 1Y10A 2P5VA 3JQMA 3PFOA 1RACB 3RGIA 4HKQA 4B9MA 4X64F 3C19A 1QSYA 2CZ9A 3ILIA 2ZH2A 3NOGA 5F3TA 1KEKA 1CJTA 2NCKL 4CNZA 1IQZA 3UO0A 1L3SA 1GFWB 5DG9A 4Y2AA 3VQTA 1Y5NB 3M6WA 2CZ4A 2MKCA 3D66A 4B9NA 2KVQE 4QPTA 2VA3A 4PWWA 4KV8A 4FXVA 5KFKA 2GMHA 4QYRA 2IRUA 4OZ0A 2CAJA 2J9DE 4ICLA 5EWEA 5G0RA 2EFGA 4UUXA 2M8HA 2UUCF 3BV8A 3DDIA 2EK1A 1F2GA 4WF9Q 5HBMB 2DGSA 5KFVA 3H7HB 1RWUA 2VOOA 1RI7A 2ZE2B 5L1JA 3AY0A 2MLXA 4OYPA 1R0CB 4ANEA 2D3OR 1U49A 2WVBA 4QIGA 2BRLA 2DNHA 1S5ZA 4ED5A 4MKVA 2FLNA 5IOLA 1ZAVA 2XTJP 2DHAA 4UOFA 3KNAA 3SXLA 2QFIA 2BKNA 3VZIA 2V2VA 1WUUA 3DM2B 2V4RA 3KLEA 2VC0A 3AB4B 5I3UA 1F9HA 3PYGA 5HANA 2AU0A 3D67A 4OYBA 4F4KA 4ED3A 4PUOA 1RAAB 2MYFA 2VF3A 2JDJA 1JK9B 2NSBA 1WC0A 3NNHA 5IQQA 3KG4A 1NJYA 3G9CA 4K59A 4KAIA 2HVHA 4QU7A 1ELOA 4LSNB 3OQ2A 5KFLA 5J1PA 4IOCQ 2Q79A 5CYMB 4MYUA 4UZBA 4DPYA 3EDRB 4OJ1A 3PJXA 4B3OA 4USUA 3AFGA 1HLWA 5CXTA 4AXJA 4A8MP 1U2RA 2ALZA 4UZCA 1RWNB 4QR1A 4I64A 2BRKA 4O3RA 2VHGA 4PXDA 4NRTA 2J6TA 2ZZTA 1V3SA 4KGZB 4NYOA 3I4HX 3CT9A 3OTEA 4W98A 3K5PA 2JSXA 3OR2B 3QQCD 4I0WA 3R7NB 2DB1A 2DCLA 2RS8A 2GW8A 1U1LA 2CWKA 4K4SA 1FE0A 4CI0B 5HJXA 1LK7A 2E1MC 2Y9HA 1TKTA 3N0VA 3Q8YA 1B3TA 2B6AB 3MAAA 2JJ4D 3TARA 4O3NA 4PQUA 2FJDB 2JEGA 2MSSA 1JLGB 2LCWA 3TA0A 4D3HA 1XMOJ 2BQ3A 1ZZFA 4ELTA 4OHVA 5KG7A 5K14B 1KHVA 3R6LB 3LO3A 3EUNA 1N0UA 4DS4A 2RQMA 2Y1IA 1B99A 2KZZA 4XIUA 2GO9A 2ZEJA 4K8RA 5AXLA 3EWGA 3VV2B 1RWKB 1FTCA 2Z2LA 2DNKA 4U8VA 3MZIA 3GLJA 4WCEQ 3IG1A 5C2CA 3KJQB 3IWLA 3T5HA 3GILA 4Z37A 2BKPA 2MDAA 2OD4A 4NZ7A 3CEDA 4PG5A 5LXRA 1KFSA 5T7LB 3KLFA 3V4IB 2ZOMA 4RW7B 1HL6A 2V4JA 4C4WA 3GJRB 3TEHB 2CQBA 5FJ4A 4KYZA 1C0TA 4OJHA 3GFXA 4IO1A 4J9KA 4HI2A 4YHHF 4C2MA 1IKYA 2JEFA 1NB7A 3TVZA 1LWEB 3W63A 1X4CA 4LF9J 2QMUB 3HHLB 2N4DA 2HVZA 4IG3B 2CJKA 3DXBA 3MMAB 3EZ5A 1QUVA 3PX6A 4P74A 5T41A 4H54A 3TA1A 2C3PA 2ZBCA 1NSAA 3D9BA 4UOHA 4PQAA 5J2NA 4ZMMA 3PRVA 3NL0A 1UJ4A 1KC8T 3MDFA 2LQ9A 4ECVA 4QWDA 3Q23A 1GMWA 5H9EJ 1HWJA 5DQIA 3D6HB 4U96A 4C3LA 2NYHA 4A8WA 2LA4A 2VPYB 3NLCA 2ZBPA 3CCSS 4EO8A 3FNNA 2KI2A 3LGHA 3MCMA 2HFSA 5K8MA 3ZTOA 2UV8A 1KQKA 4E2FB 2CQCA 3CW2C 5HQ8A 3EICA 1YBTA 3QMQA 4K0KF 3PEHA 4B3MF 2H54B 1RZMA 4Y34A 4I1TA 4CRJA 4JV1A 3DXSX 3RYLA 5C25B 5JMNA 4MK7A 1TL1A 3IMQJ 3KJVB 3AQOA 3NBPB 3EX7B 2I9SA 5HSPA 3MF5A 3IXQA 1U1KA 2RD5C 1WC5A 1RAEB 4EWTA 3W2WB 4X65F 2QMXA 1VBKA 2NS1B 4QZVB 4X4UA 1RT3A 4M5DB 4YY3J 1RDRA 3W9HA 1S1XA 1WKJA 5D77A 5JXSA 3A3NB 1UTAA 1FDAA 1L3KA 4R0EA 4OV1A 3P5BP 2W2PP 3FFIB 1KKHA 2HW3A 3ZZOA 4A8XA 4L76A 1P9YA 2VZ9A 2DR8A 5F8LA 1WELA 1RWOB 3KK3A 3LALA 4WZQA 2KFYA 1RCXB 4P6QA 1NK0A 1R0AB 2P9GA 3SV4A 4ZITA 2IJNA 3RTVA 3BREA 4LF8F 1N36J 1GMWD 4Q45A 4EZ6A 3Q83A 3HP6A 3AJ1A 4KFBB 3K57A 3G8SA 2NXNA 4XO0A 4MIBA 4BHQA 4YB5A 3D1QA 5LM7E 4XPCA 2YX7A 1C0UB 4CM0A 2YX1A 1T02A 1LW0B 4DL0C 5E3PA 3ZZ0A 2E5LF 5LMNJ 2B4UA 4Y3CA 3EDQB 2ATCB 1WF0A 3MAHA 2HEKA 2A10A 2XZDB 4HTJA 2FVRA 2VL1A 2HVIA 5FDLA 1SC4B 1HI0P 2R7WA 2YQ3A 4FXWA 1PYSB 2E5HA 3CIZA 3ZZZA 1RAIB 2FJAB 1KSPA 3BYPA 3CCES 4UUWA 2K7KA 2L41A 4O4GB 4H4OB 2HQFA 3FQLA 3KFWX 2HNZA 1OS5A 1F60B 3BGRA 3THTA 1C4CA 3O5TB 5EX3A 3IS9B 5A8RA 1KONA 2DHGA 3QATA 4CLPA 2G2YA 4P71A 4IFYA 4K5RA 3KHLA 2ZZNA 4I6YA 1ZPWX 5D6GA 2Y8YA 1HNWF 1BQNA 2DNQA 1LW2B 2LVWA 2RQ4A 1VQ9S 2WVEA 2UUWA 1BUXA 3ZNJ1 4KPYA 1R6VA 1TKXA 1JLAA 4UQGA 4P73A 1U4BA 1KDNA 2OPSB 2UVVA 2XSFA 1RT5B 2KT5A 3POTB 4NE9C 1QTMA 5IZHA 3QJLA 2ASYA 2RSQA 4ZVOB 1R3NA 2GFFA 2XSJA 1O0PA 5E7OB 2VBYA 2PGCA 2VIHA 2ROGA 3KLGA 2AJQA 1NB2A 1TQLA 1EETA 1P9QC 2FHKA 5IFMA 2UVRA 1U09A 1S79A 3Q2TC 1VQNS 2VU5A 4ELVA 2ZH8A 2WW8A 1FFWB 2HQCA 4MFBA 2V34A 4FS1A 2KG1A 2EFPA 4JV0A 4OX7A 1PILA 2ZFHA 2IC3A 5HVHA 2G2OA 4RNFA 4LFAF 4U9RA 4DUZJ 4LFBF 5M2PA 1NHUA 2L9NA 3UN3A 4CQ1A 2WVCA 4IR1A 2IAJA 1DURA 3W9JA 5BR8F 2BE7D 2CPZA 3IBFB 1N52B 1S1WB 4DG1A 2HWHA 1VRQC 1JJ2R 3TAPA 1HWLA 4TNOA 2MLZA 4RZRA 3R5JB 2R7XA 5L9XA 1VOMA 1S0NA 3HZEA 3H42A 1YVFA 1JXVA 1DLOA 3SDEB 2DPJA 4PCQA 4F4WA 4TVAB 1XQIA 2FJWA 3I31A 1ZETA 5LSRA 1AB8A 3FSYA 2ZH9A 3BO3A 3RRKA 1CULA 4I2QA 6FDRA 7FDRA 2EFOA 4RNMA 4DPTA 1XK8A 3LA0A 2DIVA 3MUMP 5JUMA 5DG7A 1Y3JA 1IR0A 1S12A 3D0IE 4GO7X 2YWHA 3KNGA 1YJUA 2C3OA 3K8VA 2IFXA 1UWBA 3PXGa 2KJWA 3RRHA 2COLA 5C24A 3OL9A 1FF2A 4Q43A 1LKZA 2VDHA 4CO0A 4L74A 3MR7A 2RQKA 1U45A 3BSNA 2JFDA 4M63A 4X62J 1HBMB 2OTJS 2VG6A 4M5KA 3LWLA 2CIMA 4JI7F 2HVEA 1HFEL 1N32F 1SV5A 4I7FA 3MUTP 4OHXA 2C2DA 2DR9A 5AE2A 3D3BJ 3J7ZT 4RUBA 5D4PA 3ENWA 4X4RA 1TL5A 1RLCL 3BDPA 2FC9A 3QZ7A 4AUKA 4DV4J 3W1YC 1P8GA 4OI4A 2C2OB 1FJ7A 2RRBA 2DNZA 3BR8A 1AZSA 2J9DA 3G82B 4OZJA 5IWAF 4ZLPA 1JX4A 1KN6A 1JLCA 4DX6A 5LXYA 4F4XA 2XGQA 3ZZRA 3US5A 3PFEA 3LP2A 2XHWA 1QSSA 4OV6A 2B8QA 4MIWA 1REVB 2ACYA 2E5IA 4JYAF 3HHLC 2C2MB 2IM1A 5CZVA 3BZQA 3LAKA 5HVGA 4C8OA 2Z58B 5EWGA 4RUCA 4JI1J 4NLXA 4NLSA 4X66F 3AHPA 2LA6A 3TP2A 2QMWA 4NX9A 3AXKA 1JJ4A 4OI0A 3HVTA 3SCIE 2C1EB 1SKSA 4CO2A 1NKCA 1AFIA 2WB4A 3DLGA 2DNGA 2I5JB 4KR0B 2UXBJ 3R2CJ 3MR2A 1FCAA 3TJ9A 1MMNA 4ZLNA 3G6YA 4GKKF 3ILOA 3KJFB 3TAMA 1NO8A 2V2KA 1UP1A 3PRDA 3THPA 3U02A 4Y28C 2ZD1B 3KKFA 1N5YB 4IOAQ 3BQ1A 1TKZA 2IHR1 3U1LA 3GR0A 5KT4A 1S1VB 5H9EK 3RAXA 1U0HB 1DQ8A 1X5SA 2GZOA 3NS5A 3MMJA 2BW2A 1X5TA 2PD1A 2RF2B 2MZ1A 5L1KA 4NCGB 1TELA 1NBEB 4DV6F 2GCFA 3KG0A 3IRXA 1UCNA 5J1NA 4UW2A 5E3AA 1YBAA 2AYBA 3K8WA 4CLKA 2ZH7A 4FNHA 1SJQA 1S1TA 2DR5A 1UFLA 1JLBB 1UZHA 3SBMA 4B9SA 2FVSA 3QWUA 1YLXA 4DV1J 4NEZA 1S49A 2BJEA 4KHPJ 2QL9B 5L9NA 4M5IA 4RWXA 2E9RX 2CKWA 2D41A 4XPEA 4OHZA 4FYYB 3PW2A 1VRUA 1Y5LB 2FIUA 2OFHX 2N3OA 2LP4A 3N79A 1SB6A 3RAQA 3MMCB 2DK2A 2X51A 5A8WA 2BR0A 3H5XA 2QLXA 4ZJOA 1AW0A 3SIPB 3LPYA 2LECA 3W5YA 2DT9A 2F1FA 3O3LA 4KPCA 2M7SA 2WSFC 1S6PB 5KFPA 1E6YA 4CH7A 4RBUA 2H48B 5EWFA 4WXOA 1B4SA 5EDWA 3FZ2A 3HD1A 2P6SA 5I42A 2W25A 4C98A 2CJQA 3CC4S 3TX8A 4ZPCA 5IXUA 2OSRA 2Z2ZA 3FBBA 2GGPA 3ZTSA 3GFZA 5U47A 3MM6B 1NJIT 8RUCA 2HQDA 4NEYA 5MAOA 2FD2A 4PG8A 1S72S 4UY85 3UW1A 3A8JA 1RU1A 5C5JA 1SUQB 3KLHB 1N34J 3TANA 4QOTA 2Z8QA 2D9OA 4H4MB 2QIFA 3HX9A 4MYTA 1U0SA 3J7YU 5ETSA 2ZE2A 4AT1B 3CB4A 5A6WA 5JVGQ 4LBPA 3J80U 2UVUA 3QT5A 3DRSB 3UD5A 2R3VA 4YUDA 2ZHOA 1RCOB 5DO2A 4NLPA 1S77D 1T9UA 4KQZA 3FJ2A 3LOUA 3I5AA 2J8AA 2B56A 3QNWB 3DM2A 2YKNA 2EBEA 3SFGA 2KT2A 2HNDA 3CD5A 4RBVA 4J9SA 2HZAA 4RPFA 2FJBB 4B3TF 5L39A 3PVXA 3N6LA 1WG4A 3BSAA 1XMOF 2CQGA 2MHEA 2OJ3A 4NPOA 1OY9A 4LR8A 3IP0A 2LDYA 1LOUA 1CJVB 1V3ZA 4TQRA 2V8PA 2AYEA 3MEGA 3L4BC 4KRWA 1X4EA 1SL1A 3OJUA 5KFWA 1RT2B 4DL7A 3DMJB 3AD8C 4QYZJ 5CYMA 4C7QA 3OFHA 3M30B 4DHVA 2LDIA 1M5KC 3K5MA 1A7GE 4KJIA 2O01C 2F4VF 3WHIA 1F9EB 4Y65A 1U6FA 2CDQA 4CYUB 5GMEA 3CCJS 2MJUA 3A8KA 4FKYA 2MY7A 3DRRA 2B7CB 2EFQA 1W25A 2HAIA 3ULHA 3G8TA 3FEXB 4IRCA 1S1UA 2CFXA 2B6AA 4F4ZA 1Z1ZA 3GP9A 4HHHA 1K0TA 1U8SA 2QA1A 3MTJA 1JLGA 1UVLA 5B0BA 2MGZB 4ED7A 2RT3A 3D4JA 3GJSB 2VG5B 2AGPA 5CYJA 4LF9F 2LYVA 1RKIA 2DNMA 1J5OB 4KHRA 4PG4A 4JI3J 4N77A 3K5OA 3OT9A 2CPEA 1UPPA 2DHXA 3RBZA 4KSEB 2FTRA 1T05B 4J9LA 3MGJA 3H40A 3JSYA 3N5FA 2VC1A 5KT6A 3HLUA 3JB9k 3IO1A 3BKFA 2ZBQA 2V8GA 2DHHA 3A8IA 5A2QY 1NZ8A 5AXKA 3DRPB 5D0EA 2CUYA 4EO6A 4ZLLA 5T7LA 3KK1B 3WQPA 2RNEA 4NWBA 3PY8A 3UR3C 3IWNC 3M2RA 3D3CJ 3G6XA 5GMDA 3AOCA 4DR3F 3MPYA 5K8PA 3DI6B 3SSQA 1MN7A 3W62A 2HBYB 2K2PA 3GFHA 1J2VA 2QFJA 2C3YA 1J5EJ 4QCLA 3X3UA 1RT6A 3B8HA 5DGBA 5DDOC 3L95X 3IBCB 3CCZA 1FVSA 3DU5A 2YNGB 4KKOA 5H9FJ 3UNYA 2W2NP 1RAGB 2HS0A 2XI2A 3C6TB 2OPRB 1L5UA 4YY3F 4DXLA 5AE1A 1RTZA 4WWSA 4M5LA 3ICLA 4UF4A 1S57A 1MN9A 2CPHA 3NCPA 4OYOA 3R3TA 2PA3A 4CCHA 4DSIA 2KHDA 1L3TA 2XC9A 5D3GA 1CQMA 5KOXA 4BCAA 5HN0A 4RL1A 1IQTA 1CJTB 5CCMA 1PJ7A 1VQ5S 2PEHA 5E33A 1J27A 3CD7A 2W7PA 4X4PA 4J9RA 1FESA 2QV6A 1S4FA 2DGXA 2RRNA 1N36F 2DGUA 4BS2A 1TU0B 1WOOA 4JUZA 3C6UB 2QZ8A 4WTYA 2KN4A 4KV8B 5F41A 4FNIA 2J5AA 1RBAA 2XEXA 3H25A 3JQJA 2KZMA 4URQU 4UOCA 3BSCA 2R7VA 1ZTTA 5G0RB 4OLPA 2GHPA 3HO1A 1WWHA 3KUEA 2CXEA 2V8VA 2VH7A 4RX6A 2VKZG 1TUGB 3B4MA 3Q8PB 1FRLA 3ETOA 2V6AA 3CJ3A 2PMZD 5LMNF 4KGMA 4DF8A 3J80Y 4WE1A 1K1QA 1VK8A 2E1RA 2R4FA 4ED4A 3PKYA 4ZVRB 1YGYA 2G9OA 1RA6A 4B9UA 3HMJG 1B0PA 1HYSA 1S4EA 2ASJA 2KH9A 3FFIA 3EMTA 3N5BA 2XQCA 4DR4J 3WIVA 2FYXA 1VC6A 4IFVA 2B9XA 1RTHA 4QU6A 1PAEX 1SC1B 4ZVFA 4Q44A 3GYGA 2C2RA 4K4UA 2LQJA 3CJ8A 1S99A 2XY6A 3KLEB 2E1PA 5I3UB 3W2VA 2ZH5A 4PUOB 3LF0A 1RT1A 2D74B 4CT9A 3EYZA 3QSYB 4ED0A 2NSCA 1H7XA 4LF6J 1T7PA 2I0XA 3DLKA 3QGHA 2V69A 1FD2A 2HFNA 1LW0A 2CPJA 2V50A 3S8SA 1FWLA 2D3O1 3D0GE 2J0WA 4Y6IA 1FEHA 4B3OB 5KT3A 2HSEB 2W24A 1CC8A 2ZH4A 3PYEA 1FRJA 1OJ4A 1V6HA 3QYYA 1F3FA 2F63A 4I68A 1EQMA 2NYIA 2CPDA 3JS9A 9ATCB 3DFEA 1S9EB 4N8NA 2CQDA 1WD6A 3ZTRA 3QGIA 5ETVA 1TKTB 2OHDA 4Q8FA 1UAWA 3AD9C 3KMSA 4O4GA 3P49B 4M94A 4H4OA 4PQUB 3W5XA 2DH8A 3PIOQ 3K59A 1RT4B 5J2MB 1U7LA 3HVWA 2P9EA 2PI4A 3FBEA 4ES2A 2QO3A 4RW9B 2PT0A 4LFCJ 1S0VA 1EKSA 3AJ2A 4ZVHA 4Q8EA 3OVBA 4KH0B 2IMOA 2KRRA 4IH6A 1OPIA 1Q4RA 3MPVA 3S1TA 4OZLA 1LW2A 2O66A 4N56A 2BDPA 2WTFA 1BWVA 4F7VA 3IG1B 4RNNA 4K4VA 1GTHA 4DCPB 1HI8A 5F8HA 2AX0A 2GQ2A 3I9V9 2EVZA 2XO7A 4ITSA 2W01A 1RT5A 4P2XA 3RBXA 5AXNA 4K50A 3KLFB 5B08A 3P8BB 3N6MA 2R2RA 2M52A 3I9ZA 2V4JB 2YPYA 3G4SS 2IVMA 1C0TB 2J7WA 1HWKA 1Y0HA 1IKYB 1MU2B 1FDDA 3QO9A 1I94J 4F0HA 5C42A 1XR7A 4CLWA 3L7PA 3UQSA 2VBWA 4OYXA 1Q53A 4EBCA 1RP5A 1PO6A 2K3IA 1KLMA 1NRKA 4CLFA 3DGVA 1Z2ZA 5J2NB 2ATLA 1SQEA 4XDCA 4F36A 3NMAA 2RKIA 1TAQA 3DOLB 1IR1A 3HCXA 2OPQA 1BC6A 1KTVA 1ZM4A 2OEMA 3SEOA 3D6TB 4W92B 1TAUA 4YEAA 3NAHA 3GSIA 4DN9A 4CM2A 3IGNA 3LANA 2AW0A 3G87A 1VLOA 1WNEA 2E29A 1T03B 4N47A 3VF0B 3S6EA 2R7RA 1W7WA 3NGKA 2E66A 5D0RA 2H4YB 3DYAB 3LTOA 2UU9J 3OLAA 1RE1B 3TW0A 2HHSA 1WHYA 3OVSA 3JYTA 5B09A 1RHQB 4WFAQ 1U1PA 1RWMB 1NK9A 2CQ3A 2AHOB 4LQ9A 1B0VA 4IYQA 1UEUA 1TL1B 2QX0A 2G4BA 3MD1A 2W1BA 4B9TA 5FIIA 4I4BA 3RU0A 2ZDOA 2CQPA 3AD7C 2MKHA 4JI1F 2YWWA 3OTDA 2WOMA 3M1VA 4OX6A 4F0KA 4F02A 3DKDA 2MJNA 3MEEA 4J5OA 2W9CA 2M9KA 4IDKB 3D1HA 2F9DA 4ZVEA 4URGA 3ENAA 2UXBF 4Y2KA 4C8ZA 4OI1A 4FF1A 1GMUA 3R27A 5B0EA 2XMTA 1SJ1A 3RW7A 4PYDA 3AA8A 3RW6A 1H2VZ 4FYWB 3MEDA 5DM6Q 3KUHA 4RU9A 1VRTA 3KK3B 1E6VB 3ENVA 4F8RA 1JKHA 4ZJLA 3MR6A 1WEZA 2PEBA 5HL7Q 3CC2S 2BANA 2IBOA 5RUBA 2DGQA 2JEJA 4FKXA 2KYZA 1NH8A 3LH2S 1AA1B 2FC8A 3D5MA 4FN5A 1ZBTA 4IG0A 1S9FA 3N6NA 1OSCA 1YJ9S 5DZ7A 5E3RA 4P9SA 1WG1A 3RB3A 3UN5A 1SJ4P 1KOHA 3BGOP 4USVA 3JSBA 3NXZA 3HHEA 3U27A 1VIXA 4ZPAA 5CCLA 4F04B 2HHXA 3ZZYA 5KFAA 3AT1B 4DV1F 1LXJA 1SKWA 4KHPF 1NJZA 5FDLB 1FDBA 2Q6CA 4IH7A 2IBKA 1QDUB 4J9QA 5H9FK 2ZWOA 1TKDA 4DF4A 2CQ0A 4FYVB 1EQ0A 4DN0A 2M2BA 3T9ZA 1N5YA 3EZUA 2HURA 2ADBA 4NCBA 1VBXA 2ZJRQ 3MMBA 1TFWA 2HNZB 3IA0A 1FK9A 3KK2A 1H98A 2GC8A 3BGRB 3DDNA 5DLFA 4KGXB 4WFXA 3JTOA 4WP9A 5KFSA 2AGQA 1JIHA 2CQ2A 4O3QA 2DGTA 2KO1A 3IGVA 2HFOA 1OO0B 4DWIA 2WSCC 4IFYB 4URSA 2KFZA 1PBUA 4BLGA 3H2LA 4I6WA 2BOPA 1BQNB 3CJ4A 2R8JA 2E5LJ 2BW7A 1RHJB 3D1OA 2HGNA 1DTTA 1TKXB 1JLAB 1GX6A 3ISND 4FDFA 2JVRA 4A8OA 2M3DA 1M1HA 3ITHA 5D4NA 2PC6A 2OI2A 2XHCA 1KQFB 1IJFB 2R2UA 3BQ2A 3WIUA 1PSDA 3LGNA 5FD1A 1TP7A 5AXMA 2A3JA 4ZDNA 2GAHC 2MKSA 1BY9A 2OIHA 1KVKA 5IM0A 3OD2A 2BE2A 2G0CA 3DU6A 3W61A 1SKRA 3H20A 4EI2A 3H8YA 2J7KA 1NXIA 1NNDA 2CNNB 3KLGB 3M9NB 4U67Q 3K5NA 1N34F 4FBTA 1BQMA 1MSWD 3CMES 1EETB 1Q79A 1U48A 5DS7A 4HACA 3VALA 2DEJA 4TLQA 1FTRA 1S9GB 4JI0J 2QGFB 2HHPA 4AL7A 3Q86A 1UW9A 4WFNQ 4MFBB 5IS2A 1S6PA 2NPFA 3AXMA 1S6QB 4RUAA 4FBUA 2AQ4A 2DGVA 1S97A 2E5GA 2EC2A 4R8UA 1WOPA 1Q1KA 4DSFA 2XYPB 2XG8A 4EEYA 3PACA 4OI3A 3Q24A 1Q8BA 3V81A 2ZM6J 4USIA 2QA4G 1ZPVA 3HT0A 3MM6A 3AH6A 2AIRB 3A8EA 1FE4A 3H4DA 3OXGA 5B0AA 2LKZA 2XO6A 1BXNA 1Q0NA 4TYBA 4DR5J 5D4OA 5CYQB 4DV5J 2V2QA 2VKRA 1UEVA 5E3QA 1GXLA 2FJEB 4ZHRA 3RJMB 1SPBP 3KLHA 2ALYB 1CJUB 2UUTA 3DNCA 3TNVA 4FF3A 1RUSA 1N88A 3I6PA 1CULB 1OYDA 2L08A 2G1DA 5GADU 2GJ2A 3EPGA 4OHWA 2ZNYA 5KT2A 2RQCA 1R7IA 1NK4A 4ZCIA 4C8KA 1O51A 1DQ9A 1H73A 4DR2F 3WC2A 4WFYA 3HKZD 5DETA 1UWBB 1BE4A 3LUYA 1SXLA 5C24B 4TU9A 2FHOB 4DQQA 1IKVA 1VHIA 1R27B 4DJBA 4X84A 3T5KA 5BR8J 1LFPA 4ECZA 1SV5B 2HK2A 4DMZA 2XMAA 4J9MA 4I67A 3I5CA 3VAMA 4FVCA 1X8DA 1SIZA 3BPDA 2FZCB 3UWTA 4C0BA 4ZA1A 1HBNA 2NZ4A 4NLGA 2PMHA 3MHYA 3D7SB 3H90A 4PXBA 1YJWS 2QLJB 1F6TA 4TU8A 1FKOA 4F3QA 4JI3F 1UMJA 1JLCB 5KG6A 3SI8A 2AEMA 2AT1B 3LP2B 2RUGA 3DMJA 2B43A 4USJC 5IC6B 2WZ1A 3CCMS 5J1EB 3QT6A 2KXFA 4L6V3 4A8KA 2WSEC 3JTNA 1PCAA 3D68A 2WBRA 3G6ES 2IM0A 1V9OA 4HT5A 3HVTB 1X5OA 1EARA 3DLGB 5CABA 3GV8B 3P45B 2ZUAA 2H51B 2BA9A 1N32J 1UETA 3OL7A 2HHHJ 2EG1A 4HHJA 2W7OA 3W60A 3OFEA 5ETOA 3WDOA 2Q6BA 3QGGA 5LJ3Y 1J5EF 3FMBA 2VG5A 4KY3A 1TKZB 1NDKA 1MWQA 4NXMJ 4LVOP 3QRPA 2VG7A 1PJ5A 1J5OA 3EVOA 2O1PA 1WKLA 3E2EA 2VD3A 1DFDA 1WG5A 2OGUA 3KDOA 1HBUB 1T05A 2WHOA 3EPIA 2D1CA 2RILA 5K8OA 2VONA 1ZM3A 2IRXA 4M5NA 1DQAA 4ZP8A 2M4MA 4X66J 1WACA 1F5CA 4JV2A 4GKJF 1S1TB 1H2UX 1RWXB 3ZTQA 3TUZC 3KK1A 1LQ9A 2RAQA 4WKYA 4CO5A 4MK9A 4C3MA 5HMZA 2FJVA 4ETZA 1ZYQA 5IV4A 4RR5A 3N4WA 3CDUA 4EK2A 2MQ8A 1IKXA 3DI6A 4A46A 1OY6A 5DQHA 5F9NA 3L7OA 1HNZJ 1VRUB 3FUYA 4DX8H 1LNQA 5KFGA 4EGLA 5HK4A 4KGVB 3E8OA 4K4TA 1EJ7L 4ZVGA 1Q81T 5A8WB 4CLTA 5KFCA 5THWA 3PYDA 2IRYA 4ZVPB 2CG4A 2BX6A 3MAQA 1R8HA 5J2PA 2FLLA 3K5LA 5L46A 3FRZA 1Q82T 1ACMB 4J9VA 3LP1A 2QG9B 3CNQP 3H5UA 4DV2J 3J7A1 4P75A 3UR0A 2NXEA 1E6YB 2DY1A 4MMOA 4ZVUB 4ZP6A 1U1OA 1HW9A 5GAEU 3KHGA 4DR4F 4LF2A 3O1LA 1FNXH 2JRSA 1JMTA 5I42B 2R42A 2RU3A 2MZRA 2XMUA 1RTIA 4DUYJ 3TA2A 2GGPB 4NL5A 3JAMY 5KT7A 3BQ0A 1C2PA 3C6UA 2DR6A 4ECXA 3VAJA 2BVZA 4JI2J 1VS3A 1S6OA 3W8GA 4LF6F 4EZ9A 1DJ0A 4QPXA 2XMJA 4OFZA 3NCRA 1QAIA 2ZDPA 3OTOJ 2PIIA 5KG3A 4ZP9A 3IFEA 2F5GA 4ZKAA 3L3CA 1KQGB 4QJVA 4USHA 4OIXA 5DG8A 2GQCA 2MXYA 1WJ9A 2N3LA 3V6JA 5CQGA 1QE1A 1PG5B 1NZAA 4WXWA 3IR6B 1S10A 3K2YA 4PYAA 4TU7A 3OXFA 4QIVA 3UI3A 3UD3P 1RK8A 1XBWA 3BGFA 2MQMA 2YKNB 2EG2A 1YZ6A 3J81Y 2HNDB 3GJQB 2W7AA 3LGMA 1HQEA 4BC9A 4QWCA 3FEYB 2HIYA 1HNIA 3TZZA 2B51A 1QAYA 4OX8A 3QJJA 2HBQB 4YB7A 4LFCF 3CCVS 4DV7J 3OLBA 1B7FA 1R8CA 4USWA 4DR7J 4CO1A 3MEGB 2V0NA 4DPXA 2XCPA 3MCOA 5K8NA 3OTBA 5LOQA 2Y1JA 4DR1J 1DBDA 5KFOA 1IKWA 1M1GA 4JP8A 4R25A 3DRRB 1HHSA 4DX7A 2HFUA 1OIAA 1Z2LA 1R89A 2U1AA 1S9EA 4WIQA 3RZAA 1X5PA 2VFSA 1UKUA 2HYIB 4ZPDA 4RW8A 2RU9A 4A4JA 3M9OB 3EM1A 1S1UB 4QR0A 2M70A 1X31C 2XMMA 4NXNJ 1S7HA 3TJ8A 3C15A 2H4WB 4B3TJ 3K17A 1KFDA 5J2MA 1RT4A 5D8HB 1Q5YA 1YK9A 1I94F 1QVGR 4HH1A 5DDRC 2XZWA 3VVTA 3QFHA 4WZMA 4L72B 4RW9A 1N0VC 4PWDB 1BD6A 3GV7B 4OZNA 3RB0A 2RRAA 4PPZA 2DH9A 1M5VC 5EGYA 4CIOA 2CJXB 2V67A 5HROA 2DNLA 1F2HA 2JLGA 2KHCA 4LRAA 3SMZA 3UDEA 1X4FA 2MKJA 2F4VJ 2DH7A 2HQIA 2ZVIA 1S0OA 1TK0A 4B3RJ 2RDIA 2VB6A 3SSRA 3BGUA 3CWJA 2DNOA 4UQTA 2CQIA 2FQQB 3MM9A 1ZZNA 3RUBL 4TY8A 3M2RB 4K4YA 4P2MA 1EZZB 1IVZA 2OKQA 2CNLB 2UU9F 3BDEA 3NNCA 2QA2A 1HHQA 2DYAA 2FHMA 1MU2A 2EFNA 4OYZA 2WCXA 4AE5A 1RT6B 3RB4A 4C6AA 4P7VA 3R2DJ 1D3WA 5BYRA 1SH2A 1UVNA 4KB7A 4B9VA 1JQGA 3E3XA 4KKOB 5KG5A 5F9LA 3CJRA 4CO3A 3MM7A 2ILZA 3R9LA 2OMOA 3T5LA 2DCUB 3FCVA 2A2DA 2KG0A 1FXRA 2XNRA 4F0MA 1T3OA 1YJTA 3JQKA 1ZA2B 5FLXU 2IA6A 3DOLA 4YB1P 2DPIA 4HL9A 4LIWA 4MIAA 4ZN3A 4W90B 3CTRA 3CVKA 4X4NA 5D3GB 1DZ5A 3GV5B 4JI4J 1T03A 2XWXA 3NOCA 1TR0A 1HWUA 2GV1A 2O67A 3DYAA 4DR3J 3GJTB 1VJWA 2DJWA 3I32A 5I3QA 4WP3A 3RR8A 2Z2YB 1BHNA 1YJVA 3T6JA 3GCWP 1NHVA 4PWUA 4PABA 2JEIA 2M5YA 1QTNB 1Y00A 3MM8A 4OL8A 3LPEA 1LEOA 4Q5VA 3CCLS 3TEGA 4YR0A 3BO4A 4WJBA 3H98A 1X0FA 1JLQA 3UCGA 1YJNS 1N48A 1HQUB 4R5PA 5EN1A 5ETLA 1QY7A 2B9EA 4GVBA 4DX5A 1M5PC 4BWJA 2J6SA 4WE1B 4IDKA 4F2SA 1NAQA 4Y2MA 1X9MA 2NQPA 1HYSB 5E41A 1YG0A 1WC3A 5LJ5Y 2HHVA 3CD0A 1NKEA 2IVYA 4IFVB 1RTHB 2CNOB 1VBYA 1E6VA 3NGDA 1DHMA 2DO0A 1KTQA 1UA0A 1VQSA 1P27B 4CO4A 3R1LA 4DU8A 1VYAA 3W2VB 3HM9A 2Y0SD 1M0SA 3Q22A 1RT1B 3BBFA 3GYXB 4OMFG 2AEJA 2ZHBA 1ULRA 3HSZA 2VPXB 3ETMA 3JTPA 3DLKB 1NK5A 1VFJA 3R8YA 2VFVA 3CDWA 1RB0A 1ITPA 2A6OA 1C1BA 4HR2A 1X4BA 1RISA 3EE3A 2CRLA 3F56A 4NYPA 2BUNA 2ZKTA 4EUVA 2ZC3A 4KH1B 2K1RA 4O3PA 1WC6A 4DL2A 1Q8KA 1HI1A 2NUHA 1RAFB 4C8LA 1R8AA 3UN2A 1MMDA 4ELUA 3W64A 1O6XA 4AFFA 3FC9A 2ZBRA 4NA2A 3IRWP 2HHUA 5IV3A 2ZITA 3FGVA 5K20B 3BM7A 5A0YA 3VAIA 3EXYA 3CJQA 3D0HE 4I56A 3TX0A 3EJMA 4A47A 3K0JA 1FVQA 2O5DA 3PRBA 2BQUA 2KKHA 1XEZA 5HJYA 4LMZA 4EFAC 2PFDA 5GADI 3LWMA 2AJ4A 5BYQA 2A18A 5DZ6A 4WPAA 1HD1A 1FKAF 5KAKA 3SCJE 1UEKA 2Y1RI 1QUPA 1JNRB 5ITHA 4JI0F 2CVIA 4NI2A 4BWMA 3CD6S 5AJ3J 4ZCKA 2AJFE 4QWEA 4DL5A 1QD1A 2JFKA 5IT9U 1JB0C 1OMSA 4TQSA 4WU3A 1XIQA 3PX4A 4ILLA 3VWSA 3UCUP 1IN0A 2WONB 4NYZA 4LR9A 2ZKUA 2HG4A 3JSMA 5HO4A 5GAGU 1EHWA 2ZM6F 2YH0A 2N7CA 1UFKA 3MECA 3PIPQ 1Q16B 3R6GB 1Q7YT 2E1CA 4XDDA 2EI5A 1G3OA 2DTJA 3PTWA 1FJGJ 1JLEA 4DI6A 4DR5F 4DV5F 4NLQA 3DLLQ 2XLIA 2HS3A 1HHTP 3QO9B 1TFYA 5HVFA 1UVKA 1T9XA 5C42B 3W3SA 4M5JA 2XMWA 4P7TA 2DGOA 1MLAA 4MKBA 1S9GA 5LMUF 1OY8A 2MQPA 2DEIA 4DZDA 4ZVSB 3TUIC 2XGPA 1KLMB 3MFHA 1S6QA 1FX2A 1C4AA 1GQEA 4C8MA 5EHHA 4G1IA 6FD1A 4LREA 2RKIB 4CDIA 3KJNB 2OPQB 4ZOSA 5HATA 1N5TA 4C97A 4LRDA 5GMKa 3WBZA 3R5AA 1TL7A 5DJBA 2B4PA 3FVYA 5HLFA 2AX1A 1SKUB 3C16A 1G1XA 4YB6A 5CYQA 4EMDA 2YKPA 4FP9A 3JYTB 2YWGA 4OX9J 1XNQJ 2GHWA 1CJUA 3CE8A 3JSRA 5IT4A 1R8PA 2MLYA 1H3DA 4DOZA 3P3DA 4LSLB 4PAAA 2BJ3A 2A2CA 4ZK7M 4MH8A 3Q2SC 2D3UA 2UUBJ 2XYHB 2JNJA 3HHDA 1T8EA 3NWRA 3KXDA 1W2IA 2WOMB 3MOJB 4GVLA 2XY7A 3QJPA 5B7WA 3M1VB 4L73A 1NSPA 3S7RA 5GAHU 4A8FA 2JLEA 1HNVB 1M1KT 1PC5A 1PIEA 3Q8UA 3UVJA 3MEEB 1LWCA 2W9CB 3CSKA 2KL8A 2LXIA
chains in the Genus database with same CATH topology
1W7WA 2AZ1A 3FCVA 3G2XA 3ZTRA 3PJ9A 1WKLA 1B4SA 1PAEX 3FBFA 2BEFA 3FKBA 2BX6A 1WKKA 4FKXA 1B99A 3FCWA 2HVDA 3FC9A 3VGTA 1EHWA 3WX8A 1NSKL 3B6BA 3VGSA 1BUXA 3BBCA 3GP9A 4WBFA 3FBCA 3ZTPA 3EJMA 1MN7A 1NDPA 1S59A 1U8WA 4UOHA 1WKJA 4F4AA 3FBBA 3DDIA 3BH7B 3FBEA 3PRVA 1NDLA 4ENOA 1PKUA 3GPAA 4O0NA 3Q86A 1KDNA 3BH6B 3ZTSA 2HVEA 3B54A 2DXEA 2DXFA 2B8PA 1HLWA 1NPKA 4DUTA 4DI6A 1NDCA 3ZTQA 1NLKL 4DZ6A 3EM1A 1BE4A 3NGSA 3VGUA 4ANEA 1NSQA 1VYAA 4ANDA 5CABA 3L7UA 3DKDA 1NUEA 4W98A 1BHNA 2ZUAA 3BBFA 4ANCA 3VVUA 1K44A 1HHQA 2DYAA 4EK2A 3VGVA 1S5ZA 2CWKA 3Q8VA 4F36A 4CP5A 1JXVA 3Q89A 3ZTOA 1NHKL 3EVMA 5IOLA 3ETMA 3BBBA 3ENAA 3VVTA 3NGTA 1LEOA 4UOFA 3EVWA 1LWXA 4C6AA 1XQIA 2NCKL 3EICA 3Q8YA 2DY9A 1NCLA 5CAAA 1S57A 1MN9A 2B8QA 5BXIA 1NB2A 1F3FA 3NGUA 1NSPA 4UOGA 2DXDA 4HR2A 3NGRA 1UCNA 1NDKA 3MPDA 3Q83A 4KPCA 5C7PA 3EE3A 3JS9A 1XIQA 3Q8UA 4S0MA 3EMTA 1ZS6A 2VU5A 3ELHA 3EVOA 1F6TA 3R9LA 4FKYA 2AZ3A 1HIYA 2HURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7W A;  2AZ1 A;  3FCV A;  3G2X A;  3ZTR A;  3PJ9 A;  1WKL A;  1B4S A;  1PAE X;  3FBF A;  2BEF A;  3FKB A;  2BX6 A;  1WKK A;  4FKX A;  1B99 A;  3FCW A;  2HVD A;  3FC9 A;  3VGT A;  1EHW A;  3WX8 A;  1NSK L;  3B6B A;  3VGS A;  1BUX A;  3BBC A;  3GP9 A;  4WBF A;  3FBC A;  3ZTP A;  3EJM A;  1MN7 A;  1NDP A;  1S59 A;  1U8W A;  4UOH A;  1WKJ A;  4F4A A;  3FBB A;  3DDI A;  3BH7 B;  3FBE A;  3PRV A;  1NDL A;  4ENO A;  1PKU A;  3GPA A;  4O0N A;  3Q86 A;  1KDN A;  3BH6 B;  3ZTS A;  2HVE A;  3B54 A;  2DXE A;  2DXF A;  2B8P A;  1HLW A;  1NPK A;  4DUT A;  4DI6 A;  1NDC A;  3ZTQ A;  1NLK L;  4DZ6 A;  3EM1 A;  1BE4 A;  3NGS A;  3VGU A;  4ANE A;  1NSQ A;  1VYA A;  4AND A;  5CAB A;  3L7U A;  3DKD A;  1NUE A;  4W98 A;  1BHN A;  2ZUA A;  3BBF A;  4ANC A;  3VVU A;  1K44 A;  1HHQ A;  2DYA A;  4EK2 A;  3VGV A;  1S5Z A;  2CWK A;  3Q8V A;  4F36 A;  4CP5 A;  1JXV A;  3Q89 A;  3ZTO A;  1NHK L;  3EVM A;  5IOL A;  3ETM A;  3BBB A;  3ENA A;  3VVT A;  3NGT A;  1LEO A;  4UOF A;  3EVW A;  1LWX A;  4C6A A;  1XQI A;  2NCK L;  3EIC A;  3Q8Y A;  2DY9 A;  1NCL A;  5CAA A;  1S57 A;  1MN9 A;  2B8Q A;  5BXI A;  1NB2 A;  1F3F A;  3NGU A;  1NSP A;  4UOG A;  2DXD A;  4HR2 A;  3NGR A;  1UCN A;  1NDK A;  3MPD A;  3Q83 A;  4KPC A;  5C7P A;  3EE3 A;  3JS9 A;  1XIQ A;  3Q8U A;  4S0M A;  3EMT A;  1ZS6 A;  2VU5 A;  3ELH A;  3EVO A;  1F6T A;  3R9L A;  4FKY A;  2AZ3 A;  1HIY A;  2HUR A; 
#chains in the Genus database with same CATH topology
 3M8R A;  3P96 A;  1RWV B;  4QWA A;  4N76 A;  4O44 A;  2HHH F;  2K7J A;  2CJA A;  2XS5 A;  1VQ6 S;  3MED B;  4XK8 C;  1VRT B;  2ABY A;  3OL6 A;  4H4K A;  4F4A A;  1JKH B;  2POK A;  3BH7 B;  1NDL A;  2DIS A;  3M6V A;  4NXM F;  2BAN B;  3PZP A;  2YPZ A;  4ECY A;  2WRM A;  4L75 A;  4IG0 B;  2H5J B;  4MAK A;  2D9P A;  5J1E A;  3NP5 A;  5GAE I;  3GIJ A;  3OSP A;  4C11 A;  1N5S A;  3EVM A;  1Q5V A;  3D2W A;  2FHJ A;  3HSG A;  3T6B A;  2CQ4 A;  2YTC A;  3X1L B;  1H38 A;  1EAY C;  3O8W A;  2HGL A;  3TWZ A;  1JLF B;  4DEZ A;  3I56 S;  2I8E A;  1MML A;  3ET6 A;  2DVI A;  3NS6 A;  3PHE A;  4Q2M A;  2DGW A;  3MPW A;  2W2Q P;  3UFC X;  3FK4 A;  1RTD A;  2HQG A;  1NU4 A;  5DGA A;  1GEH A;  2OPP B;  4DPU A;  2R7S A;  2Q66 A;  1RWW B;  3DHX A;  1HNZ F;  1KVI A;  2BJD A;  4DQS A;  1WHW A;  4QIF A;  1FEE A;  4DBQ A;  1D9F A;  3BGL A;  3MUR P;  2EK6 A;  2QRR A;  2P6T A;  1T95 A;  5DQG A;  3W7B A;  4IH5 A;  3MMB B;  4AXI A;  2MHN A;  1FK9 B;  3KK2 B;  2W9B A;  3IWX A;  2DIT A;  4HDH A;  1NJW A;  2KDO A;  1ROF A;  1HBU A;  2BYC A;  3RRG A;  4RBT A;  1T94 A;  1B70 B;  1X60 A;  2JC1 A;  5KFI A;  5I3P A;  2W9A A;  1YX2 A;  1BQX A;  4DV2 F;  3MUV P;  5HP1 A;  1R0B G;  4QIE A;  4HTI A;  2C2N A;  3C14 A;  1D09 B;  3AOD A;  2RJZ A;  2ZC4 A;  2AJ0 A;  1AT1 B;  3GWC A;  2BAB A;  1DTT B;  3KHH A;  4NLW A;  3O44 A;  1GAO A;  3ITH B;  2VA2 A;  2HBZ B;  2QL5 B;  1DTQ A;  3PG9 A;  4R0J A;  3MWB A;  3NNA A;  1OQ3 A;  4DUY F;  4O4R A;  1RHK B;  1HMV A;  3GII A;  4K7Q A;  1XR6 A;  2FHJ D;  1U26 A;  1H0H B;  2E7X A;  3IR5 B;  5IM0 B;  4JI2 F;  2BE2 B;  4IOB A;  2ZJQ Q;  3PW4 A;  3IBW A;  1NPP A;  4ID5 A;  4V19 J;  1B7Y B;  2HHT A;  2R8H A;  1NDC A;  4NA3 A;  4DL4 A;  2C28 A;  1BQM B;  2DO4 A;  3MOZ A;  3OTO F;  4NLT A;  2EXU A;  2W4D A;  4HAC B;  2RH3 A;  1RJJ A;  2HFZ A;  1Y7P A;  2HNY B;  2MMY A;  1U2F A;  4ER8 A;  4QW8 A;  1T9T A;  2LU1 A;  1WHV A;  2CZV C;  2L3M A;  2KB2 A;  2F40 A;  2DRA A;  2CA9 A;  1DY3 A;  2B7B B;  1RLD A;  1HPZ B;  3QFW A;  2WVD A;  5B0F A;  4J9P A;  1N4L A;  3MI7 X;  1U6B A;  4UOG A;  1U1Q A;  4R8U B;  2HMI B;  3W65 A;  3DRY A;  1LV5 A;  1AUD A;  4DQI A;  5CH7 B;  3K89 A;  4RW4 A;  4FF4 A;  3V81 B;  3FBF A;  1MRO A;  2Q1L A;  2V68 A;  4IQX A;  1U25 A;  5K9F A;  4X2B A;  1S6U A;  1CJK A;  2E9T A;  3CMA S;  3UDL A;  3MCN A;  2WAQ D;  1RKJ A;  3BBC A;  3ZZT A;  4DV7 F;  2E7V A;  3TUJ C;  2XI3 A;  3T1H J;  2NUU G;  2FB0 A;  4DR7 F;  5CD4 A;  4ZHR B;  3IR7 B;  2ADC A;  1UPM B;  1VC5 A;  1WOR A;  2LEP A;  2M88 A;  2QJ3 A;  3VAH A;  3O2I A;  1FI4 A;  2APO A;  2J76 E;  3ENQ A;  3GIK A;  4PRF A;  3SQG A;  2JC0 A;  4ZPW R;  1C1C B;  4DR1 F;  1Y11 A;  1XNR J;  2GNK A;  1B64 A;  5K5M A;  5J2Q A;  3Q89 A;  3EXC X;  1RHM B;  5LSL A;  1F3V A;  2XUL A;  4ES3 A;  3GMG A;  2F8H A;  3KTQ A;  4BC7 A;  1HQ2 A;  2VOD A;  2CWX A;  4MJK A;  2CJY B;  3TQ1 A;  1IKV B;  2FVQ A;  3DOM A;  2VJU A;  2DNP A;  1NM2 A;  3DLB A;  1ZS6 A;  3ONQ A;  4OZ2 A;  1XR5 A;  3ZFV A;  3NAI A;  1TL3 A;  1F0X A;  2GA7 A;  3G2X A;  4DCO B;  4NXN F;  2LQB A;  2GVZ A;  2Y0B B;  3FKB A;  2R2S A;  3F41 A;  2AGO A;  1U02 A;  5T14 A;  3VGT A;  1SQG A;  1HBN B;  4ZS6 A;  1GXT A;  1IWG A;  1W26 A;  5A8K A;  4WYW A;  4B3S J;  5HAO A;  3RR7 A;  4J9U E;  2F7V A;  1FKO B;  4CH0 S;  3BH6 B;  4UY8 T;  1X9S A;  1KHW A;  2B8P A;  3QGP A;  2FVP A;  2V94 A;  4G6V B;  1KR4 A;  4GMK A;  1FJC A;  1WDT A;  3NGS A;  2RDJ A;  3ZC4 A;  2BAC A;  1RYR A;  4KIA A;  3V6H A;  2UVW A;  4NML A;  5KFY A;  3CGI A;  4CP5 A;  4DR2 J;  4AD6 A;  2MQL A;  5KFT A;  4ZIW A;  4B3R F;  4U7U K;  4F3O A;  2V4Q A;  4LBI A;  2X1A A;  3QBC A;  2MQO A;  1W2B R;  5KFR A;  1HNX J;  2OAU A;  1SL0 A;  3MEK A;  5CZX A;  3QWP A;  1YSJ A;  1HIY A;  3PNI A;  4YDD B;  1FXD A;  1A0O B;  3RBD A;  1IBK J;  3THV A;  3BKU A;  2EEY A;  3GIR A;  1S48 A;  2IYG A;  4HHU A;  5HQM A;  3UDC A;  4HEA 9;  2FJX A;  4PWD A;  3M2V A;  2IM3 A;  2VG7 B;  3DN9 A;  2BKO A;  2RB7 A;  4YDX A;  2B4V A;  2QYC A;  4WII A;  1L3V A;  3V2U C;  3Q8Q B;  2NRE A;  3J81 j;  3ZZU A;  3DLE B;  3CJ5 A;  2NPI A;  2PMW A;  1FWK A;  5D0G A;  2IJF A;  2OEK A;  2Z57 B;  4L3K A;  1UW4 A;  3CO9 A;  1WEX A;  5F3Z A;  1TMJ A;  1WC4 A;  1NH7 A;  1TL4 A;  4NLO A;  1D8Y A;  2GMJ A;  3SZ2 A;  1EP4 B;  5KFJ A;  4JI4 F;  2Q3P A;  3UDV A;  4KGK A;  4HVZ A;  4ERD A;  5LSO A;  3G71 S;  4QBU A;  1TVR A;  3M8P A;  5KOW A;  3V6D A;  3D28 A;  1IKX B;  1BMQ B;  5SZT A;  3KLI A;  4EYI B;  3FCW A;  1CPZ A;  2X1F A;  5F8I A;  3QRR A;  4U95 A;  1HBO B;  2MZQ A;  4OHY A;  3DGP B;  3LW5 C;  1LXN A;  3QSI A;  1RTJ A;  3GFY A;  2FDN A;  2LEA A;  2DR7 A;  3ISN C;  2XY5 A;  2N82 B;  2N4C A;  2C2E A;  5J2P B;  1F5A A;  3HSD A;  3LP1 B;  4LT6 A;  4DV0 J;  2GML A;  1YJR A;  4PR6 A;  5DLG A;  1YJ7 A;  1VQ4 S;  1JJC B;  3CJK A;  2QEX S;  4IKA A;  4KO0 A;  4GKJ J;  1PYO B;  1FRI A;  3GIM A;  3TR5 A;  3CDB A;  1I3O B;  2X3D A;  1RBL A;  3M8Z A;  5C7P A;  2DKO B;  3RB6 A;  3IM9 A;  1RTI B;  3A3P B;  2PDA A;  1MW7 A;  4Y2C A;  1WC1 A;  3RAM A;  4ECT A;  4EBD A;  2MEW A;  2YNF A;  1HD0 A;  1MNE A;  2IM2 A;  3TYT A;  3UE2 A;  4X4V A;  2O3D A;  5F8M A;  1HQU A;  4ENO A;  1TUW A;  5KFF A;  5GAG I;  4JOU A;  1P1L A;  5KT5 A;  3M9M B;  2HAF A;  4FYD A;  1PC4 A;  4IRD A;  5IC4 B;  3ILL A;  2AF6 A;  3HHK A;  3CC7 S;  1ZAW A;  4YME A;  5EUH A;  2KVI A;  3HDS A;  4PG6 A;  1QE1 B;  4JV5 J;  1VCT A;  2IYI A;  1NCL A;  4USK A;  2ZH1 A;  2E44 A;  3U7J A;  1OQ6 A;  3L9Z A;  3T1Y J;  4Z7Y A;  2XM3 A;  1JWW A;  4LJM A;  2UXD J;  2G2Z A;  1WEY A;  2ASL A;  1HQE B;  2HPU A;  1HNI B;  4I69 A;  2RVJ A;  2V5H G;  3O6Q A;  1RBO B;  1TV6 A;  1Q8I A;  2DD8 S;  2HRY A;  4DS5 A;  3IAM 9;  5AJ3 F;  1FRH A;  4ZCM A;  3FSX A;  4K2J A;  1ZM9 A;  4LF1 A;  1K9M T;  3DRX A;  1R6Y A;  4DL6 A;  3B82 A;  1Q7L B;  3H0P A;  2XLJ A;  5ETK A;  4LF5 J;  5IQ6 A;  5HMY A;  4FVM A;  2UXC J;  2OH2 A;  1KP6 A;  4CLY A;  1V3R A;  1VR6 A;  1L3U A;  1CBK A;  4AND A;  3C3L A;  3L7U A;  3M05 A;  3FDS A;  4DV3 J;  1XMQ J;  1IKW B;  2LXF A;  4ZVQ B;  4F3M A;  1HWI A;  3VCD A;  1M5O C;  1RXO B;  1YIJ S;  2XBP A;  2KTQ A;  3D6M B;  2AKW B;  4RW8 B;  3OL8 A;  2LEB A;  1FJG F;  4FZV A;  1RU2 A;  5BXI A;  1D0E A;  4DPO A;  3SQO P;  3M8Q A;  4FS2 A;  3C15 B;  1A9N B;  2ZJP Q;  3F0N A;  3KDN A;  3W66 A;  2AV5 A;  5F8J A;  4FYX B;  3P6Y C;  5GAH I;  1K47 A;  2HHW A;  2VQF J;  3B78 A;  1GTE A;  3EGN A;  5JJB A;  2MPU A;  3AB2 B;  1U8W A;  3M2U B;  2X7I A;  1V5V A;  3GQC A;  4PKD B;  5HRO B;  2WON A;  3PO4 A;  2H5I B;  4FPI A;  4ED8 A;  2LFV A;  3HF5 A;  2EBG A;  2QC3 A;  1HR0 F;  2HGM A;  2ROE A;  1T9W A;  1ZH5 A;  5E0O A;  3J7Z 5;  2HQ3 A;  1FRX A;  1IR2 A;  3CCU S;  3RBE A;  3GE9 A;  2KXN B;  2AD9 A;  4OI6 A;  3M32 A;  3EVW A;  1LWX A;  3MM9 B;  4JB8 B;  4YR3 A;  4TY8 B;  2BJ1 A;  2R9L A;  1UVI A;  2RML A;  3NGU A;  2CPI A;  3RG6 A;  4G65 A;  3F44 A;  3AAW B;  4X4O A;  2ZH6 A;  5ADZ A;  4C8N A;  2YNI A;  1ICE B;  3OUY A;  3HUL A;  3I0S A;  2ILY A;  4OX9 F;  1XNQ F;  4DQR A;  1CS4 A;  3ISZ A;  1Y9O A;  4DCJ B;  3BR9 A;  2B9Y A;  2U2F A;  1H72 C;  2PFF B;  1WKK A;  1XN9 A;  2ZUG A;  5KFM A;  4I2P A;  2UUB F;  1AUS L;  5F0U A;  1U1M A;  2DBB A;  4DSL A;  5BJR A;  3MM7 B;  4HLB A;  1VJQ A;  1NJX A;  5B0G A;  3FRY A;  4X4S A;  3PR4 A;  2R8I A;  4Z2X A;  2GVD A;  2YKM A;  4DPW A;  2CDR B;  3QIP A;  1TUV A;  2YKA A;  2ZOG A;  2J8S A;  2KT3 A;  1X4H A;  4ECU A;  4OZ5 A;  1WTB A;  1PJ6 A;  2B5J A;  4CH1 A;  1RT7 B;  1KWM A;  2VV5 A;  1G6B A;  1X4D A;  1XJW B;  2YY3 A;  4C48 A;  3VGV A;  4OI2 A;  3IC1 A;  1SJR A;  3NRB A;  2YH1 A;  4B17 A;  1Y4Z B;  4KC5 A;  4LF7 J;  2J6U A;  3DOK A;  3QLH A;  4F4Y A;  1WI6 A;  4F67 A;  2W4C A;  2YKO A;  2K3K A;  1LWF A;  3V6K A;  2FZG B;  3NWG A;  4CZC A;  1K0V A;  3FQK A;  4RJV A;  5LL6 d;  4OLO A;  3A12 A;  2VIC A;  2BBE A;  3MM8 B;  4QQB A;  1YTY A;  1U2C A;  3OTC A;  4Y2I A;  3HXM A;  2VPZ B;  4LSL A;  1BLU A;  3HD2 A;  2G0J A;  1JLQ B;  3TQE A;  1XTZ A;  4MT1 A;  3T19 A;  4R5P B;  2FPH X;  2ZZM A;  1CG2 A;  2QSW A;  4GVB B;  3PR5 B;  1VQO S;  3PJW A;  1HNV A;  2VPW B;  3C8Y A;  4NLV A;  2EKY A;  2BOA A;  2NXC A;  3CCQ S;  1SI9 A;  3ZNU A;  2CPX A;  4X4Q A;  3D6F B;  4ZPT R;  2WK4 A;  3TRG A;  2LMI A;  1I51 B;  4G1Q A;  4KE5 A;  3OFG A;  4RNO A;  5B0C A;  1K44 A;  3E01 A;  2VFR A;  3FEZ A;  1FKP B;  5E2Q A;  1IBL J;  2UZA A;  4GC6 A;  2RS2 A;  1N33 J;  2WBM A;  1F1B B;  3FMW A;  7AT1 B;  2YWK A;  2OTL S;  1M5H A;  3HT3 A;  4DL3 A;  1WSR A;  4JI8 F;  4LF4 J;  2C22 A;  4M5M A;  1FRM A;  4I6A A;  1WF2 A;  5DRK A;  4NCA A;  3BF4 A;  4NA1 A;  4LBH A;  5ETQ A;  2XMK A;  2ZHA A;  4IQM A;  3PKM A;  3DLH A;  5HI7 A;  4C8Y A;  3MD3 A;  3VZH A;  4OQJ A;  3GU0 A;  3OR1 B;  2KFN A;  1SJ3 P;  3BN4 A;  2GHV C;  4F25 A;  3KWM A;  1C1B B;  4P2S A;  3MR5 A;  1JLF A;  3ZZP A;  1NDP A;  2K1R B;  4UST A;  5KFN A;  2CYY A;  3BJY A;  5G4D A;  5A2Q U;  1D1U A;  1N6Q A;  2QYG A;  3TZX A;  1VQ8 S;  4RU2 A;  5D15 A;  5AT1 B;  1SC3 B;  3I87 A;  4YR2 A;  2V9K A;  3TZW A;  2OPP A;  5A0Y B;  4PEO A;  3FZB A;  3VAF A;  1U47 A;  2WB1 D;  2OP5 A;  3PO5 A;  3CPW R;  3CCT A;  4RLE A;  4LRB A;  1Y3K A;  2C42 A;  1CQN A;  1QVF R;  4K5S A;  3R1H A;  1UJ5 A;  3VTI A;  4LUB A;  1UFW A;  3HJV A;  3NMR A;  4M8L A;  5H1S V;  1N8R T;  2X1G A;  3HVR A;  4RW6 A;  4J91 A;  3I82 A;  3PJ9 A;  2XLK A;  2Y3Y A;  1G2E A;  4NI2 B;  1SIW B;  1F9F A;  3EGV A;  1LFW A;  4NMX A;  4QIW D;  3CJS A;  2HVD A;  4N8O A;  1T9Y A;  3ILJ A;  3NCQ A;  4OJG A;  2EPI A;  4WK3 A;  4NAS A;  2I2Y A;  3WX8 A;  5F0W A;  1KOO A;  3MM5 A;  3PYF A;  3UCZ P;  3HI9 A;  1IBM J;  4B08 A;  4N7T A;  1S59 A;  2V63 A;  4IUF A;  2BJ9 A;  3GPA A;  3CXC R;  4Q2L A;  5M2U A;  2CNK B;  2AWZ A;  4CWB A;  1KRP A;  3JSM B;  2PN6 A;  4K4Z A;  1SVD A;  1K73 T;  3GZ7 A;  1QLN A;  1OSD A;  2BV3 A;  1RA7 A;  2HWT A;  3MEC B;  2QE5 A;  1O5J A;  3DLJ A;  4KHM A;  2H65 B;  1G4C A;  2YNH B;  3CJ2 A;  5ETM A;  3WC0 A;  1JLE B;  3M8S A;  3KOA A;  4DR6 J;  3SCK E;  2FLO A;  5L38 A;  3TUP A;  3T1H F;  2HRU A;  2VOP A;  2QLB B;  3D54 A;  1VQP S;  2MKK A;  3R7S B;  1P6T A;  3NEK A;  3NGR A;  2R8K A;  2PA8 D;  3ELH A;  1FT8 A;  2IDE A;  4TY9 A;  1VQK S;  1N5Q A;  2CG8 A;  5HBM A;  2HNY A;  1XNR F;  5D78 A;  3CJ0 A;  1NME B;  2V8D A;  2OSQ A;  3LP0 B;  3TO8 A;  2YWF A;  4AL6 A;  2G1H A;  1HPZ A;  4DLG A;  2JLF A;  2Z2M A;  4N5S A;  1X7V A;  2FZK B;  2HMI A;  2H5E A;  1IWA A;  4TKT A;  1V5I B;  1OYE A;  3H2U B;  2G13 A;  3PDN A;  3HSJ A;  1DRZ A;  4JI5 J;  5HMW A;  3PM9 A;  3R97 A;  3R5D A;  3NY0 A;  2W2M P;  2HKE A;  4G3I A;  2ZBI A;  3U1N A;  2VUG A;  1U1N A;  3CUN A;  2GQQ A;  1TL7 B;  4ZLJ A;  5HLF B;  3G8Q A;  4Y0F A;  3C16 B;  4B3S F;  3I5B A;  3DHW C;  2VBZ A;  1GK8 A;  3E51 A;  4NRU A;  4Q0B B;  2BM0 A;  1WOS A;  2ZVS A;  3A4T A;  2A1B A;  2RHS B;  4FPR A;  3I0R B;  2P2C B;  1SCJ B;  3GYN A;  4K2X A;  2QA4 S;  4LSN A;  4RNH A;  1NK7 A;  3PW5 A;  5LMU J;  1C1C A;  1URN A;  1WF1 A;  1SJF A;  3IAS 9;  1KS2 A;  2UUA J;  4G1P A;  1N5V A;  3PV8 A;  4WBF A;  3UVJ B;  4DSK A;  1LWC B;  3WZ0 A;  3OR2 A;  3S01 A;  1VGY A;  3NS7 B;  1HNX F;  3DCA A;  2DHS A;  1AXQ A;  2I6W A;  1EIY B;  3ZXW A;  3NG8 A;  4O44 B;  1KVJ A;  5BYS A;  4ETX A;  2H1Y A;  2ZNZ A;  1IBK F;  4CLS A;  4O3S A;  4LIR A;  4ZJQ A;  3PW7 A;  2GO8 A;  3CDA A;  3V5R A;  2QLW A;  5KG2 A;  2I38 A;  4LQ3 A;  4ED6 A;  4J37 A;  2MZT A;  1H74 A;  5K14 A;  2MB0 B;  2LLZ A;  4PXC A;  2CJ9 A;  4WU2 A;  1ZAX A;  3M8Y A;  2XMV A;  5ETR A;  3EGZ A;  3BSO A;  3BN7 A;  1RWP B;  1M90 T;  4OZ1 A;  1IM6 A;  4C11 B;  5M2R A;  4P2F A;  3W8P A;  1WTF A;  3FSI A;  1KD1 T;  4B02 A;  5KFQ A;  5A6P A;  3OV7 A;  1FO1 A;  3GB0 A;  5SUH A;  4DFM A;  3ET6 B;  1Q8L A;  3QT8 A;  4J9O A;  3CF5 Q;  1GT8 A;  5KFE A;  3V4I A;  2VBX A;  4RW7 A;  3M7V A;  2RDD A;  1RTD B;  4LVN P;  1FFG B;  1Q78 A;  3H59 A;  1FRK A;  1QAX A;  1VQL S;  1YRT A;  3MFI A;  1LWE A;  2MTL A;  4CTA B;  4F50 A;  4KTQ A;  3G86 A;  1SL2 A;  4ED2 A;  3HHL A;  4LR7 A;  4IG3 A;  1X9W A;  2W9B B;  3M6U A;  3MMA A;  3TOQ A;  4YQW A;  3DLE A;  3B4D A;  1VQY A;  2Y8W A;  2B4O A;  3MPD A;  1REG X;  5IT0 A;  3EGW B;  2Q43 A;  3UPF A;  3LAM A;  2J0Q D;  3BKT A;  4BDP A;  5L1L A;  5KFB A;  3GSD A;  2FGC A;  2W8L A;  4ECQ A;  4DV0 F;  4A8Y A;  1NKB A;  5HP1 B;  2XCA A;  3H5S A;  5CD4 H;  2BEF A;  2X1B A;  3C14 B;  2DNN A;  1JNZ B;  4K4W A;  1CC7 A;  1EP4 A;  2WVF A;  5CA5 A;  2G0I A;  4MKY A;  3A3O B;  4F26 A;  2Z4P A;  1YQH A;  2E7W A;  1EB0 A;  3AOB A;  1PKU A;  1DTQ B;  2J9C A;  2VAS A;  2KU7 A;  4O3O A;  2VQE J;  2XS2 A;  2IY5 B;  1HW8 A;  4DZ6 A;  2HLU A;  1HMV B;  4RKU C;  2XB2 D;  1U6Z A;  2XZT B;  2KM8 B;  2GJF A;  1GMV A;  2PI5 A;  2YX4 A;  1VMB A;  2DNY A;  1KBR A;  3G96 A;  2FY8 A;  2IMW P;  1A6L A;  4DFP A;  1HBO A;  4IR9 A;  3DGP A;  1KNZ A;  4ED1 A;  5C25 A;  4JI6 J;  4AL5 A;  4ID5 B;  4V19 X;  4C3K A;  2KYX A;  2RIJ A;  3KJV A;  3BYR A;  3NBP A;  4ICL B;  5CAA A;  2J0X A;  1VBZ A;  5KFX A;  3W2W A;  5ETP A;  1JXE A;  1OPZ A;  4M5D A;  4WTO B;  4AQY J;  1AFJ A;  1TK5 A;  1NK8 A;  3UD4 P;  3EZO A;  1FNM A;  1FJE B;  2OD6 A;  2KXH A;  4JV5 F;  3HHL D;  4X64 J;  4UTG A;  4DSJ A;  4FF2 A;  3T41 A;  2HK3 A;  3R5C A;  2M0G B;  4U7C A;  2KJV A;  2NXJ A;  3T1Y F;  1NPR A;  2UXD F;  2DIU A;  4RW4 B;  2AP6 A;  2AYM A;  1MRO B;  3CCR S;  1R0A A;  1CJK B;  2HLT A;  4QR2 A;  1R31 A;  3M4X A;  4NZ6 A;  2XNQ A;  4WFZ A;  3OHB A;  4KFB A;  3W9I A;  3NKY A;  3T1A A;  3AJD A;  3Q8V A;  4YP3 A;  4D3G A;  2OO4 A;  1S0M A;  1UWA A;  5DDQ C;  3AQP A;  1C0U A;  2FY1 A;  2LQ5 A;  4ZN1 A;  3OW2 R;  5MLC V;  4LRF A;  2UUC J;  4LF5 F;  3SQG B;  1QAJ A;  2UXC F;  2C2K B;  3SCL E;  3OPK A;  2DNR A;  2JOQ A;  1XC9 A;  2NXU A;  2JVO A;  4WK1 A;  5JVH Q;  1EX8 A;  4DV3 F;  5J2Q B;  1XMQ F;  2BJ8 A;  1RAD B;  5F8G A;  4PPD A;  1IUJ A;  3C46 A;  2FVC A;  1GX5 A;  1BWE A;  3A1Y G;  3SYZ A;  3DOM B;  2EFV A;  2LU2 A;  2V2Z A;  3QZ8 A;  4GO5 X;  3V4M A;  2ROP A;  4O23 A;  3VGS A;  4L3N A;  3HZG A;  2BJ7 A;  1TL3 B;  2LQ8 A;  1R8B A;  4Z7C A;  2CPY A;  2GVZ B;  3MAA B;  2IA0 A;  1ZM2 A;  1NPK A;  1RQ0 A;  2JWN A;  4ZPV R;  2CPF A;  3VGU A;  3R5B A;  1FFS B;  5EX0 A;  5AE3 A;  5A8K B;  3IS9 A;  3BS9 A;  3JXO A;  4U8Y A;  3OVA A;  2ZWP A;  2VQF F;  3R7B B;  3PCO B;  4ZP7 A;  4QWB A;  5KG1 A;  2L9W A;  1NHK L;  2MZJ A;  6AT1 B;  4RO0 A;  2HHQ A;  4WYL A;  1F5B A;  3Q8S B;  1IBC B;  4ZVT B;  4DUZ F;  1AYE A;  2BMB A;  2MKY A;  2AZ3 A;  2AZ1 A;  1VDH A;  1FXL A;  4ZCL A;  3PEJ A;  1S7I A;  2OPS A;  1TMM A;  2F3J A;  2OFG X;  4CLZ A;  4TYA A;  1NK6 A;  3POT A;  1S76 D;  3OHA A;  3FBC A;  3ZTP A;  3M8W A;  2SXL A;  1VC0 A;  2ERR A;  4PXE A;  4NOH A;  1PBA A;  1T11 A;  3QT7 A;  2HS4 A;  3P5T L;  2EWH A;  2J7U A;  4YN3 B;  4C0H A;  3PHT A;  3QRQ A;  3M2V B;  1SQF A;  2J0S D;  1VIO A;  3QAU A;  1X4G A;  2V9W A;  2V8H A;  1RSC A;  3CJT A;  2MZS A;  3L09 A;  3M2U A;  3NGT A;  4MK8 A;  2JX2 A;  3I55 S;  3T3F A;  1CEZ A;  2N7Y A;  4X4T A;  4DSE A;  2BZ2 A;  3CUL A;  2BM1 A;  2D7S A;  2P8I A;  3ADA C;  1Y5I B;  3SV3 A;  1B0T A;  1R43 A;  2B0G A;  4E98 A;  1T9V A;  4X62 F;  2X3G A;  4NLD A;  4YS2 A;  2OUG A;  1YBU A;  2AYG A;  3MCS A;  1D9A A;  1S1W A;  1IXK A;  1NSK L;  1RAJ A;  1TVR B;  4LF7 F;  3M8P B;  2F8M A;  4QYZ K;  3B6B A;  4DV4 F;  1MWY A;  1PYT A;  3V6D B;  2AJ2 A;  5I4M A;  3HKW A;  4O0N A;  2XYG B;  5KG4 A;  3T5J A;  3CO0 P;  3B54 A;  3SDE A;  3MPU B;  1YDL A;  2B3T B;  4M95 A;  3KLI B;  4YHH J;  1WDD A;  2YVS A;  1I6J A;  2FGO A;  4NLU A;  4A48 A;  1N54 B;  4HI1 A;  2C3U A;  4H4K C;  4CT8 A;  1RTJ B;  2K06 A;  2R2T A;  4E8U A;  2HIQ A;  3U1M A;  3N01 A;  3OXL A;  2YQ1 A;  3A13 A;  1HKA A;  4F2R A;  3DC2 A;  2R7U A;  2JL9 A;  2CJB A;  1FWP A;  1RT3 B;  4AYB D;  2FLP A;  3HFV A;  1RAH B;  1I5O B;  1S1X B;  1VHF A;  3ZO7 A;  3KUG A;  2DXD A;  1FHT A;  2AMC B;  2BXJ A;  3H5Y A;  3QPI A;  2HRT A;  5DDP C;  4U7U D;  3AA9 A;  1N56 A;  2VFT A;  3CJK B;  1RT7 A;  4KO0 B;  1HBM A;  5KFD A;  4ILR A;  2XWY A;  4ALZ A;  8AT1 B;  2YQ0 A;  3HVA A;  3HFZ B;  1IBL F;  1FNO A;  3IM8 A;  3TVY A;  1N33 F;  2ACM A;  2GIR A;  1VIS A;  2KRB A;  3G82 A;  3GCX P;  3QID A;  4LF4 F;  4PZV A;  4K0K J;  4B3M J;  2Z0G A;  2RHQ B;  1KQS R;  1FA0 A;  2YNF B;  4ES1 A;  1SH3 A;  4EU0 A;  4MTP A;  1VQM S;  1RHR B;  4O0I A;  1REV A;  2EKN A;  4A8Q A;  3H4B A;  3HHN B;  1JJH A;  4WFB Q;  4A8S A;  5KTQ A;  3SSS A;  3HPO A;  3BBB A;  4X65 J;  4B9L A;  4P10 A;  1TZ0 A;  4CLL A;  2DY9 A;  1XMB A;  5ETT A;  4P52 A;  2QL7 B;  2MQQ A;  4M1K A;  4WP8 A;  4YFU A;  7FD1 A;  4K4X A;  3GG0 A;  2PO4 A;  1HAR A;  3OSN A;  2VJV A;  2M8D B;  2I5J A;  1JXL A;  3OBI A;  3T9N A;  3VQS A;  1UZD A;  4C0O C;  3DDK A;  1UVJ A;  3KHR A;  2QLF B;  2FUG 9;  2OML A;  1FKP A;  4OJ3 A;  2H9Z A;  2MQN A;  1CVJ A;  1TK8 A;  2ZD1 A;  1YIT S;  1G7C B;  3J7Y I;  1YI2 S;  4ILM A;  1S1V A;  3TJA A;  1U0H A;  2DXE A;  4LF8 J;  1CSJ A;  1MG7 A;  2KM8 C;  1QM9 A;  3MTK A;  2R7Q A;  1TV6 B;  4GC7 A;  3PW0 A;  1APS A;  1QJH A;  2RF2 A;  5A8R B;  4NCG A;  5L1I A;  4DFJ A;  3OJS A;  2ZOF A;  3OR1 A;  2NLW A;  4ANC A;  4PG7 A;  4M5H A;  4NLY A;  2PSZ A;  2YXL A;  4XTT A;  2CQH A;  4V1A k;  2W8K A;  1IBM F;  1QSL A;  1GXU A;  4DLE A;  3SFU A;  2MKI A;  3IN5 A;  4NLR A;  4ZIV A;  1URR A;  4GRS A;  1JLB A;  3N28 A;  2DRB A;  4ECW A;  4HH0 A;  4S0M A;  4EBE A;  2D69 A;  4ID8 A;  1FER A;  3TZY A;  2C3M A;  4DQP A;  1XER A;  2OEL A;  3CDE A;  4P72 A;  1VI7 A;  1H6K X;  4DR6 F;  5KG0 A;  1FX4 A;  1YRX A;  4TXS A;  1KLN A;  3M8Q B;  2H3E B;  2BQR A;  2EC0 A;  2XSJ B;  2AJ1 A;  4Q7A A;  3KG1 A;  3MMC A;  4J9N A;  4J90 A;  2A0F B;  2RUS A;  1H2T Z;  2DRD A;  2L9D A;  4DU7 A;  4KT0 C;  2IPO B;  5KFZ A;  1LK5 A;  2Y1L B;  4WKR A;  3VAG A;  1U24 A;  2XS7 A;  1VQ7 S;  2F4F A;  2GIF A;  1Z4U A;  1HA1 A;  2QTW A;  2LXU A;  2E9Z A;  1FDN A;  3G6V A;  2E1A A;  4MKA A;  1HNW J;  1P1T A;  2CVE A;  2VFU A;  3R5G A;  5GVQ A;  2YKQ A;  1WSV A;  3P4U B;  2OLW A;  2IC3 B;  1BGX T;  1T3N A;  1IJE B;  2GIQ A;  2J9E A;  2IDL A;  1IM4 A;  2GJI A;  4N41 A;  4JI5 F;  4TLR A;  4HDG A;  3AOA A;  3C66 A;  2IAJ B;  2JHE A;  3Q8R B;  4USM A;  4CNY A;  3F73 A;  3CCW A;  2YNH A;  2RE1 A;  4DG1 B;  3M32 B;  2UV8 G;  3JAM U;  1SC6 A;  3WX4 A;  3GTY X;  3TAQ A;  2YBV A;  1X4A A;  3W5Z A;  1X0P A;  1YWX A;  2YNI B;  3OUY B;  3I0S B;  1DLO B;  2PE8 A;  1CS4 B;  4CLU A;  1WHX A;  1SUQ A;  2Z30 B;  1RHU B;  2HZC A;  1DAR A;  1CLF A;  3I4P A;  3PX0 A;  4H4M A;  4I2Q B;  3I96 A;  4E0D A;  5KFU A;  1SBR A;  4I2P B;  3TI0 A;  1OWX A;  1K8A T;  5A76 A;  2NR0 A;  1PAU B;  3LP0 A;  2MY8 A;  3DRS A;  2UUA F;  4HT7 A;  3VVU A;  5B0D A;  2NZC A;  2CAD A;  1PGZ A;  5FLX Y;  2GVD B;  1VK3 A;  1Q86 T;  2YKM B;  4LFA J;  3QIP B;  4LFB J;  3MR3 A;  1ZOT A;  1HR0 J;  4LSZ B;  2B5J B;  1K1S A;  2VG6 B;  2IJR A;  1ZTW A;  1MWZ A;  4I7F B;  2GS8 A;  2BE9 B;  3J81 U;  4IO9 Q;  1FD8 A;  3HFK A;  3DOK B;  5DM7 Q;  3QLH B;  1M5S A;  3Q0A A;  4Q0B A;  1LWF B;  4KBI A;  1AZS B;  4TN2 A;  1NEE A;  1CJV A;  5ETN A;  4J7C A;  3I0R A;  2IVF B;  2W2O P;  1RT2 A;  4HYK A;  2JH3 A;  5F8N A;  3BO2 A;  1RAO A;  2K8G A;  4DUT A;  2W4P A;  4M5G A;  4ZPB A;  1D9D A;  3FCH A;  4IRK A;  3M30 A;  4XAK A;  1NSQ A;  1Q95 G;  3C2P A;  1NUE A;  4ATN A;  2HWI A;  2OEJ A;  3KYL A;  1SH0 A;  4LRC A;  1I1G A;  5HMX A;  4NZ0 A;  4CYU A;  1YHQ S;  3CIM A;  3M6X A;  2I1R A;  2F8E X;  2GAG C;  5E3C A;  4YOE A;  1T0T V;  3GON A;  1UJ6 A;  2HBR B;  4UT4 A;  3CMQ A;  1RGV A;  4G1Q B;  2WW4 A;  4DDF A;  4JBC A;  4JI7 J;  1GH8 A;  2L48 A;  1GNK A;  3E01 B;  4EYH B;  3BEG B;  1VLY A;  2E5J A;  3TAM B;  3K58 A;  4OYW A;  2F9J A;  1UL3 A;  2MGZ A;  3BPS P;  5L8R C;  2YWE A;  1YZ7 A;  9RUB A;  2EW9 A;  1WI8 A;  4ECS A;  2R8G A;  3HK2 A;  5IWA J;  4RWW A;  4OYM A;  2P9C A;  2C2Z B;  1RAB B;  3HJF A;  2JZ5 A;  1EKR A;  3UNG C;  5LT5 A;  4OZ3 A;  2CQ1 A;  2F65 A;  1YKW A;  4W4M A;  4FXD A;  2IIH A;  3GR1 A;  1NLK L;  4JYA J;  4OYA A;  3IRX B;  3TVK A;  1U1R A;  3MXH P;  5D0H A;  2HFV A;  3J7A N;  4QW9 A;  2QT7 A;  3DRP A;  2ZH3 A;  4BBY A;  1N6Q B;  1ARO P;  1UVM A;  1D8Z A;  2VQE F;  1YRU A;  3OFF A;  5KFH A;  2A6M A;  1DAX A;  3LQV A;  3KLV A;  4DFK A;  4C9D A;  4GKK J;  3K7R A;  1XWL A;  2R7T A;  2AEF A;  1TTH B;  5E5N A;  4CTA A;  8ATC B;  3GG1 A;  2VDI A;  4JI6 F;  4OYI A;  3H2V E;  5D4L A;  3QAE A;  2GX8 A;  3VR1 A;  5HQL A;  3KMQ A;  4RUH A;  4JI8 J;  3VHQ A;  2Z56 B;  2QN6 B;  3VAK A;  2R7O A;  2B9W A;  2QSF A;  2HZV A;  4RW6 B;  1ZA1 B;  2YNG A;  5CHC B;  3C6T A;  2OPR A;  2DXF A;  2MST A;  4AQY F;  3N9U C;  4Y00 A;  4DV6 J;  3BB5 A;  5IT9 Y;  2D3Z A;  2UP1 A;  5C2G A;  1UA1 A;  1RYS A;  4U6P A;  2ASD A;  4ECR A;  3MM5 B;  1O8B A;  1H7W A;  1Y10 A;  2P5V A;  3JQM A;  3PFO A;  1RAC B;  3RGI A;  4HKQ A;  4B9M A;  4X64 F;  3C19 A;  1QSY A;  2CZ9 A;  3ILI A;  2ZH2 A;  3NOG A;  5F3T A;  1KEK A;  1CJT A;  2NCK L;  4CNZ A;  1IQZ A;  3UO0 A;  1L3S A;  1GFW B;  5DG9 A;  4Y2A A;  3VQT A;  1Y5N B;  3M6W A;  2CZ4 A;  2MKC A;  3D66 A;  4B9N A;  2KVQ E;  4QPT A;  2VA3 A;  4PWW A;  4KV8 A;  4FXV A;  5KFK A;  2GMH A;  4QYR A;  2IRU A;  4OZ0 A;  2CAJ A;  2J9D E;  4ICL A;  5EWE A;  5G0R A;  2EFG A;  4UUX A;  2M8H A;  2UUC F;  3BV8 A;  3DDI A;  2EK1 A;  1F2G A;  4WF9 Q;  5HBM B;  2DGS A;  5KFV A;  3H7H B;  1RWU A;  2VOO A;  1RI7 A;  2ZE2 B;  5L1J A;  3AY0 A;  2MLX A;  4OYP A;  1R0C B;  4ANE A;  2D3O R;  1U49 A;  2WVB A;  4QIG A;  2BRL A;  2DNH A;  1S5Z A;  4ED5 A;  4MKV A;  2FLN A;  5IOL A;  1ZAV A;  2XTJ P;  2DHA A;  4UOF A;  3KNA A;  3SXL A;  2QFI A;  2BKN A;  3VZI A;  2V2V A;  1WUU A;  3DM2 B;  2V4R A;  3KLE A;  2VC0 A;  3AB4 B;  5I3U A;  1F9H A;  3PYG A;  5HAN A;  2AU0 A;  3D67 A;  4OYB A;  4F4K A;  4ED3 A;  4PUO A;  1RAA B;  2MYF A;  2VF3 A;  2JDJ A;  1JK9 B;  2NSB A;  1WC0 A;  3NNH A;  5IQQ A;  3KG4 A;  1NJY A;  3G9C A;  4K59 A;  4KAI A;  2HVH A;  4QU7 A;  1ELO A;  4LSN B;  3OQ2 A;  5KFL A;  5J1P A;  4IOC Q;  2Q79 A;  5CYM B;  4MYU A;  4UZB A;  4DPY A;  3EDR B;  4OJ1 A;  3PJX A;  4B3O A;  4USU A;  3AFG A;  1HLW A;  5CXT A;  4AXJ A;  4A8M P;  1U2R A;  2ALZ A;  4UZC A;  1RWN B;  4QR1 A;  4I64 A;  2BRK A;  4O3R A;  2VHG A;  4PXD A;  4NRT A;  2J6T A;  2ZZT A;  1V3S A;  4KGZ B;  4NYO A;  3I4H X;  3CT9 A;  3OTE A;  4W98 A;  3K5P A;  2JSX A;  3OR2 B;  3QQC D;  4I0W A;  3R7N B;  2DB1 A;  2DCL A;  2RS8 A;  2GW8 A;  1U1L A;  2CWK A;  4K4S A;  1FE0 A;  4CI0 B;  5HJX A;  1LK7 A;  2E1M C;  2Y9H A;  1TKT A;  3N0V A;  3Q8Y A;  1B3T A;  2B6A B;  3MAA A;  2JJ4 D;  3TAR A;  4O3N A;  4PQU A;  2FJD B;  2JEG A;  2MSS A;  1JLG B;  2LCW A;  3TA0 A;  4D3H A;  1XMO J;  2BQ3 A;  1ZZF A;  4ELT A;  4OHV A;  5KG7 A;  5K14 B;  1KHV A;  3R6L B;  3LO3 A;  3EUN A;  1N0U A;  4DS4 A;  2RQM A;  2Y1I A;  1B99 A;  2KZZ A;  4XIU A;  2GO9 A;  2ZEJ A;  4K8R A;  5AXL A;  3EWG A;  3VV2 B;  1RWK B;  1FTC A;  2Z2L A;  2DNK A;  4U8V A;  3MZI A;  3GLJ A;  4WCE Q;  3IG1 A;  5C2C A;  3KJQ B;  3IWL A;  3T5H A;  3GIL A;  4Z37 A;  2BKP A;  2MDA A;  2OD4 A;  4NZ7 A;  3CED A;  4PG5 A;  5LXR A;  1KFS A;  5T7L B;  3KLF A;  3V4I B;  2ZOM A;  4RW7 B;  1HL6 A;  2V4J A;  4C4W A;  3GJR B;  3TEH B;  2CQB A;  5FJ4 A;  4KYZ A;  1C0T A;  4OJH A;  3GFX A;  4IO1 A;  4J9K A;  4HI2 A;  4YHH F;  4C2M A;  1IKY A;  2JEF A;  1NB7 A;  3TVZ A;  1LWE B;  3W63 A;  1X4C A;  4LF9 J;  2QMU B;  3HHL B;  2N4D A;  2HVZ A;  4IG3 B;  2CJK A;  3DXB A;  3MMA B;  3EZ5 A;  1QUV A;  3PX6 A;  4P74 A;  5T41 A;  4H54 A;  3TA1 A;  2C3P A;  2ZBC A;  1NSA A;  3D9B A;  4UOH A;  4PQA A;  5J2N A;  4ZMM A;  3PRV A;  3NL0 A;  1UJ4 A;  1KC8 T;  3MDF A;  2LQ9 A;  4ECV A;  4QWD A;  3Q23 A;  1GMW A;  5H9E J;  1HWJ A;  5DQI A;  3D6H B;  4U96 A;  4C3L A;  2NYH A;  4A8W A;  2LA4 A;  2VPY B;  3NLC A;  2ZBP A;  3CCS S;  4EO8 A;  3FNN A;  2KI2 A;  3LGH A;  3MCM A;  2HFS A;  5K8M A;  3ZTO A;  2UV8 A;  1KQK A;  4E2F B;  2CQC A;  3CW2 C;  5HQ8 A;  3EIC A;  1YBT A;  3QMQ A;  4K0K F;  3PEH A;  4B3M F;  2H54 B;  1RZM A;  4Y34 A;  4I1T A;  4CRJ A;  4JV1 A;  3DXS X;  3RYL A;  5C25 B;  5JMN A;  4MK7 A;  1TL1 A;  3IMQ J;  3KJV B;  3AQO A;  3NBP B;  3EX7 B;  2I9S A;  5HSP A;  3MF5 A;  3IXQ A;  1U1K A;  2RD5 C;  1WC5 A;  1RAE B;  4EWT A;  3W2W B;  4X65 F;  2QMX A;  1VBK A;  2NS1 B;  4QZV B;  4X4U A;  1RT3 A;  4M5D B;  4YY3 J;  1RDR A;  3W9H A;  1S1X A;  1WKJ A;  5D77 A;  5JXS A;  3A3N B;  1UTA A;  1FDA A;  1L3K A;  4R0E A;  4OV1 A;  3P5B P;  2W2P P;  3FFI B;  1KKH A;  2HW3 A;  3ZZO A;  4A8X A;  4L76 A;  1P9Y A;  2VZ9 A;  2DR8 A;  5F8L A;  1WEL A;  1RWO B;  3KK3 A;  3LAL A;  4WZQ A;  2KFY A;  1RCX B;  4P6Q A;  1NK0 A;  1R0A B;  2P9G A;  3SV4 A;  4ZIT A;  2IJN A;  3RTV A;  3BRE A;  4LF8 F;  1N36 J;  1GMW D;  4Q45 A;  4EZ6 A;  3Q83 A;  3HP6 A;  3AJ1 A;  4KFB B;  3K57 A;  3G8S A;  2NXN A;  4XO0 A;  4MIB A;  4BHQ A;  4YB5 A;  3D1Q A;  5LM7 E;  4XPC A;  2YX7 A;  1C0U B;  4CM0 A;  2YX1 A;  1T02 A;  1LW0 B;  4DL0 C;  5E3P A;  3ZZ0 A;  2E5L F;  5LMN J;  2B4U A;  4Y3C A;  3EDQ B;  2ATC B;  1WF0 A;  3MAH A;  2HEK A;  2A10 A;  2XZD B;  4HTJ A;  2FVR A;  2VL1 A;  2HVI A;  5FDL A;  1SC4 B;  1HI0 P;  2R7W A;  2YQ3 A;  4FXW A;  1PYS B;  2E5H A;  3CIZ A;  3ZZZ A;  1RAI B;  2FJA B;  1KSP A;  3BYP A;  3CCE S;  4UUW A;  2K7K A;  2L41 A;  4O4G B;  4H4O B;  2HQF A;  3FQL A;  3KFW X;  2HNZ A;  1OS5 A;  1F60 B;  3BGR A;  3THT A;  1C4C A;  3O5T B;  5EX3 A;  3IS9 B;  5A8R A;  1KON A;  2DHG A;  3QAT A;  4CLP A;  2G2Y A;  4P71 A;  4IFY A;  4K5R A;  3KHL A;  2ZZN A;  4I6Y A;  1ZPW X;  5D6G A;  2Y8Y A;  1HNW F;  1BQN A;  2DNQ A;  1LW2 B;  2LVW A;  2RQ4 A;  1VQ9 S;  2WVE A;  2UUW A;  1BUX A;  3ZNJ 1;  4KPY A;  1R6V A;  1TKX A;  1JLA A;  4UQG A;  4P73 A;  1U4B A;  1KDN A;  2OPS B;  2UVV A;  2XSF A;  1RT5 B;  2KT5 A;  3POT B;  4NE9 C;  1QTM A;  5IZH A;  3QJL A;  2ASY A;  2RSQ A;  4ZVO B;  1R3N A;  2GFF A;  2XSJ A;  1O0P A;  5E7O B;  2VBY A;  2PGC A;  2VIH A;  2ROG A;  3KLG A;  2AJQ A;  1NB2 A;  1TQL A;  1EET A;  1P9Q C;  2FHK A;  5IFM A;  2UVR A;  1U09 A;  1S79 A;  3Q2T C;  1VQN S;  2VU5 A;  4ELV A;  2ZH8 A;  2WW8 A;  1FFW B;  2HQC A;  4MFB A;  2V34 A;  4FS1 A;  2KG1 A;  2EFP A;  4JV0 A;  4OX7 A;  1PIL A;  2ZFH A;  2IC3 A;  5HVH A;  2G2O A;  4RNF A;  4LFA F;  4U9R A;  4DUZ J;  4LFB F;  5M2P A;  1NHU A;  2L9N A;  3UN3 A;  4CQ1 A;  2WVC A;  4IR1 A;  2IAJ A;  1DUR A;  3W9J A;  5BR8 F;  2BE7 D;  2CPZ A;  3IBF B;  1N52 B;  1S1W B;  4DG1 A;  2HWH A;  1VRQ C;  1JJ2 R;  3TAP A;  1HWL A;  4TNO A;  2MLZ A;  4RZR A;  3R5J B;  2R7X A;  5L9X A;  1VOM A;  1S0N A;  3HZE A;  3H42 A;  1YVF A;  1JXV A;  1DLO A;  3SDE B;  2DPJ A;  4PCQ A;  4F4W A;  4TVA B;  1XQI A;  2FJW A;  3I31 A;  1ZET A;  5LSR A;  1AB8 A;  3FSY A;  2ZH9 A;  3BO3 A;  3RRK A;  1CUL A;  4I2Q A;  6FDR A;  7FDR A;  2EFO A;  4RNM A;  4DPT A;  1XK8 A;  3LA0 A;  2DIV A;  3MUM P;  5JUM A;  5DG7 A;  1Y3J A;  1IR0 A;  1S12 A;  3D0I E;  4GO7 X;  2YWH A;  3KNG A;  1YJU A;  2C3O A;  3K8V A;  2IFX A;  1UWB A;  3PXG a;  2KJW A;  3RRH A;  2COL A;  5C24 A;  3OL9 A;  1FF2 A;  4Q43 A;  1LKZ A;  2VDH A;  4CO0 A;  4L74 A;  3MR7 A;  2RQK A;  1U45 A;  3BSN A;  2JFD A;  4M63 A;  4X62 J;  1HBM B;  2OTJ S;  2VG6 A;  4M5K A;  3LWL A;  2CIM A;  4JI7 F;  2HVE A;  1HFE L;  1N32 F;  1SV5 A;  4I7F A;  3MUT P;  4OHX A;  2C2D A;  2DR9 A;  5AE2 A;  3D3B J;  3J7Z T;  4RUB A;  5D4P A;  3ENW A;  4X4R A;  1TL5 A;  1RLC L;  3BDP A;  2FC9 A;  3QZ7 A;  4AUK A;  4DV4 J;  3W1Y C;  1P8G A;  4OI4 A;  2C2O B;  1FJ7 A;  2RRB A;  2DNZ A;  3BR8 A;  1AZS A;  2J9D A;  3G82 B;  4OZJ A;  5IWA F;  4ZLP A;  1JX4 A;  1KN6 A;  1JLC A;  4DX6 A;  5LXY A;  4F4X A;  2XGQ A;  3ZZR A;  3US5 A;  3PFE A;  3LP2 A;  2XHW A;  1QSS A;  4OV6 A;  2B8Q A;  4MIW A;  1REV B;  2ACY A;  2E5I A;  4JYA F;  3HHL C;  2C2M B;  2IM1 A;  5CZV A;  3BZQ A;  3LAK A;  5HVG A;  4C8O A;  2Z58 B;  5EWG A;  4RUC A;  4JI1 J;  4NLX A;  4NLS A;  4X66 F;  3AHP A;  2LA6 A;  3TP2 A;  2QMW A;  4NX9 A;  3AXK A;  1JJ4 A;  4OI0 A;  3HVT A;  3SCI E;  2C1E B;  1SKS A;  4CO2 A;  1NKC A;  1AFI A;  2WB4 A;  3DLG A;  2DNG A;  2I5J B;  4KR0 B;  2UXB J;  3R2C J;  3MR2 A;  1FCA A;  3TJ9 A;  1MMN A;  4ZLN A;  3G6Y A;  4GKK F;  3ILO A;  3KJF B;  3TAM A;  1NO8 A;  2V2K A;  1UP1 A;  3PRD A;  3THP A;  3U02 A;  4Y28 C;  2ZD1 B;  3KKF A;  1N5Y B;  4IOA Q;  3BQ1 A;  1TKZ A;  2IHR 1;  3U1L A;  3GR0 A;  5KT4 A;  1S1V B;  5H9E K;  3RAX A;  1U0H B;  1DQ8 A;  1X5S A;  2GZO A;  3NS5 A;  3MMJ A;  2BW2 A;  1X5T A;  2PD1 A;  2RF2 B;  2MZ1 A;  5L1K A;  4NCG B;  1TEL A;  1NBE B;  4DV6 F;  2GCF A;  3KG0 A;  3IRX A;  1UCN A;  5J1N A;  4UW2 A;  5E3A A;  1YBA A;  2AYB A;  3K8W A;  4CLK A;  2ZH7 A;  4FNH A;  1SJQ A;  1S1T A;  2DR5 A;  1UFL A;  1JLB B;  1UZH A;  3SBM A;  4B9S A;  2FVS A;  3QWU A;  1YLX A;  4DV1 J;  4NEZ A;  1S49 A;  2BJE A;  4KHP J;  2QL9 B;  5L9N A;  4M5I A;  4RWX A;  2E9R X;  2CKW A;  2D41 A;  4XPE A;  4OHZ A;  4FYY B;  3PW2 A;  1VRU A;  1Y5L B;  2FIU A;  2OFH X;  2N3O A;  2LP4 A;  3N79 A;  1SB6 A;  3RAQ A;  3MMC B;  2DK2 A;  2X51 A;  5A8W A;  2BR0 A;  3H5X A;  2QLX A;  4ZJO A;  1AW0 A;  3SIP B;  3LPY A;  2LEC A;  3W5Y A;  2DT9 A;  2F1F A;  3O3L A;  4KPC A;  2M7S A;  2WSF C;  1S6P B;  5KFP A;  1E6Y A;  4CH7 A;  4RBU A;  2H48 B;  5EWF A;  4WXO A;  1B4S A;  5EDW A;  3FZ2 A;  3HD1 A;  2P6S A;  5I42 A;  2W25 A;  4C98 A;  2CJQ A;  3CC4 S;  3TX8 A;  4ZPC A;  5IXU A;  2OSR A;  2Z2Z A;  3FBB A;  2GGP A;  3ZTS A;  3GFZ A;  5U47 A;  3MM6 B;  1NJI T;  8RUC A;  2HQD A;  4NEY A;  5MAO A;  2FD2 A;  4PG8 A;  1S72 S;  4UY8 5;  3UW1 A;  3A8J A;  1RU1 A;  5C5J A;  1SUQ B;  3KLH B;  1N34 J;  3TAN A;  4QOT A;  2Z8Q A;  2D9O A;  4H4M B;  2QIF A;  3HX9 A;  4MYT A;  1U0S A;  3J7Y U;  5ETS A;  2ZE2 A;  4AT1 B;  3CB4 A;  5A6W A;  5JVG Q;  4LBP A;  3J80 U;  2UVU A;  3QT5 A;  3DRS B;  3UD5 A;  2R3V A;  4YUD A;  2ZHO A;  1RCO B;  5DO2 A;  4NLP A;  1S77 D;  1T9U A;  4KQZ A;  3FJ2 A;  3LOU A;  3I5A A;  2J8A A;  2B56 A;  3QNW B;  3DM2 A;  2YKN A;  2EBE A;  3SFG A;  2KT2 A;  2HND A;  3CD5 A;  4RBV A;  4J9S A;  2HZA A;  4RPF A;  2FJB B;  4B3T F;  5L39 A;  3PVX A;  3N6L A;  1WG4 A;  3BSA A;  1XMO F;  2CQG A;  2MHE A;  2OJ3 A;  4NPO A;  1OY9 A;  4LR8 A;  3IP0 A;  2LDY A;  1LOU A;  1CJV B;  1V3Z A;  4TQR A;  2V8P A;  2AYE A;  3MEG A;  3L4B C;  4KRW A;  1X4E A;  1SL1 A;  3OJU A;  5KFW A;  1RT2 B;  4DL7 A;  3DMJ B;  3AD8 C;  4QYZ J;  5CYM A;  4C7Q A;  3OFH A;  3M30 B;  4DHV A;  2LDI A;  1M5K C;  3K5M A;  1A7G E;  4KJI A;  2O01 C;  2F4V F;  3WHI A;  1F9E B;  4Y65 A;  1U6F A;  2CDQ A;  4CYU B;  5GME A;  3CCJ S;  2MJU A;  3A8K A;  4FKY A;  2MY7 A;  3DRR A;  2B7C B;  2EFQ A;  1W25 A;  2HAI A;  3ULH A;  3G8T A;  3FEX B;  4IRC A;  1S1U A;  2CFX A;  2B6A A;  4F4Z A;  1Z1Z A;  3GP9 A;  4HHH A;  1K0T A;  1U8S A;  2QA1 A;  3MTJ A;  1JLG A;  1UVL A;  5B0B A;  2MGZ B;  4ED7 A;  2RT3 A;  3D4J A;  3GJS B;  2VG5 B;  2AGP A;  5CYJ A;  4LF9 F;  2LYV A;  1RKI A;  2DNM A;  1J5O B;  4KHR A;  4PG4 A;  4JI3 J;  4N77 A;  3K5O A;  3OT9 A;  2CPE A;  1UPP A;  2DHX A;  3RBZ A;  4KSE B;  2FTR A;  1T05 B;  4J9L A;  3MGJ A;  3H40 A;  3JSY A;  3N5F A;  2VC1 A;  5KT6 A;  3HLU A;  3JB9 k;  3IO1 A;  3BKF A;  2ZBQ A;  2V8G A;  2DHH A;  3A8I A;  5A2Q Y;  1NZ8 A;  5AXK A;  3DRP B;  5D0E A;  2CUY A;  4EO6 A;  4ZLL A;  5T7L A;  3KK1 B;  3WQP A;  2RNE A;  4NWB A;  3PY8 A;  3UR3 C;  3IWN C;  3M2R A;  3D3C J;  3G6X A;  5GMD A;  3AOC A;  4DR3 F;  3MPY A;  5K8P A;  3DI6 B;  3SSQ A;  1MN7 A;  3W62 A;  2HBY B;  2K2P A;  3GFH A;  1J2V A;  2QFJ A;  2C3Y A;  1J5E J;  4QCL A;  3X3U A;  1RT6 A;  3B8H A;  5DGB A;  5DDO C;  3L95 X;  3IBC B;  3CCZ A;  1FVS A;  3DU5 A;  2YNG B;  4KKO A;  5H9F J;  3UNY A;  2W2N P;  1RAG B;  2HS0 A;  2XI2 A;  3C6T B;  2OPR B;  1L5U A;  4YY3 F;  4DXL A;  5AE1 A;  1RTZ A;  4WWS A;  4M5L A;  3ICL A;  4UF4 A;  1S57 A;  1MN9 A;  2CPH A;  3NCP A;  4OYO A;  3R3T A;  2PA3 A;  4CCH A;  4DSI A;  2KHD A;  1L3T A;  2XC9 A;  5D3G A;  1CQM A;  5KOX A;  4BCA A;  5HN0 A;  4RL1 A;  1IQT A;  1CJT B;  5CCM A;  1PJ7 A;  1VQ5 S;  2PEH A;  5E33 A;  1J27 A;  3CD7 A;  2W7P A;  4X4P A;  4J9R A;  1FES A;  2QV6 A;  1S4F A;  2DGX A;  2RRN A;  1N36 F;  2DGU A;  4BS2 A;  1TU0 B;  1WOO A;  4JUZ A;  3C6U B;  2QZ8 A;  4WTY A;  2KN4 A;  4KV8 B;  5F41 A;  4FNI A;  2J5A A;  1RBA A;  2XEX A;  3H25 A;  3JQJ A;  2KZM A;  4URQ U;  4UOC A;  3BSC A;  2R7V A;  1ZTT A;  5G0R B;  4OLP A;  2GHP A;  3HO1 A;  1WWH A;  3KUE A;  2CXE A;  2V8V A;  2VH7 A;  4RX6 A;  2VKZ G;  1TUG B;  3B4M A;  3Q8P B;  1FRL A;  3ETO A;  2V6A A;  3CJ3 A;  2PMZ D;  5LMN F;  4KGM A;  4DF8 A;  3J80 Y;  4WE1 A;  1K1Q A;  1VK8 A;  2E1R A;  2R4F A;  4ED4 A;  3PKY A;  4ZVR B;  1YGY A;  2G9O A;  1RA6 A;  4B9U A;  3HMJ G;  1B0P A;  1HYS A;  1S4E A;  2ASJ A;  2KH9 A;  3FFI A;  3EMT A;  3N5B A;  2XQC A;  4DR4 J;  3WIV A;  2FYX A;  1VC6 A;  4IFV A;  2B9X A;  1RTH A;  4QU6 A;  1PAE X;  1SC1 B;  4ZVF A;  4Q44 A;  3GYG A;  2C2R A;  4K4U A;  2LQJ A;  3CJ8 A;  1S99 A;  2XY6 A;  3KLE B;  2E1P A;  5I3U B;  3W2V A;  2ZH5 A;  4PUO B;  3LF0 A;  1RT1 A;  2D74 B;  4CT9 A;  3EYZ A;  3QSY B;  4ED0 A;  2NSC A;  1H7X A;  4LF6 J;  1T7P A;  2I0X A;  3DLK A;  3QGH A;  2V69 A;  1FD2 A;  2HFN A;  1LW0 A;  2CPJ A;  2V50 A;  3S8S A;  1FWL A;  2D3O 1;  3D0G E;  2J0W A;  4Y6I A;  1FEH A;  4B3O B;  5KT3 A;  2HSE B;  2W24 A;  1CC8 A;  2ZH4 A;  3PYE A;  1FRJ A;  1OJ4 A;  1V6H A;  3QYY A;  1F3F A;  2F63 A;  4I68 A;  1EQM A;  2NYI A;  2CPD A;  3JS9 A;  9ATC B;  3DFE A;  1S9E B;  4N8N A;  2CQD A;  1WD6 A;  3ZTR A;  3QGI A;  5ETV A;  1TKT B;  2OHD A;  4Q8F A;  1UAW A;  3AD9 C;  3KMS A;  4O4G A;  3P49 B;  4M94 A;  4H4O A;  4PQU B;  3W5X A;  2DH8 A;  3PIO Q;  3K59 A;  1RT4 B;  5J2M B;  1U7L A;  3HVW A;  2P9E A;  2PI4 A;  3FBE A;  4ES2 A;  2QO3 A;  4RW9 B;  2PT0 A;  4LFC J;  1S0V A;  1EKS A;  3AJ2 A;  4ZVH A;  4Q8E A;  3OVB A;  4KH0 B;  2IMO A;  2KRR A;  4IH6 A;  1OPI A;  1Q4R A;  3MPV A;  3S1T A;  4OZL A;  1LW2 A;  2O66 A;  4N56 A;  2BDP A;  2WTF A;  1BWV A;  4F7V A;  3IG1 B;  4RNN A;  4K4V A;  1GTH A;  4DCP B;  1HI8 A;  5F8H A;  2AX0 A;  2GQ2 A;  3I9V 9;  2EVZ A;  2XO7 A;  4ITS A;  2W01 A;  1RT5 A;  4P2X A;  3RBX A;  5AXN A;  4K50 A;  3KLF B;  5B08 A;  3P8B B;  3N6M A;  2R2R A;  2M52 A;  3I9Z A;  2V4J B;  2YPY A;  3G4S S;  2IVM A;  1C0T B;  2J7W A;  1HWK A;  1Y0H A;  1IKY B;  1MU2 B;  1FDD A;  3QO9 A;  1I94 J;  4F0H A;  5C42 A;  1XR7 A;  4CLW A;  3L7P A;  3UQS A;  2VBW A;  4OYX A;  1Q53 A;  4EBC A;  1RP5 A;  1PO6 A;  2K3I A;  1KLM A;  1NRK A;  4CLF A;  3DGV A;  1Z2Z A;  5J2N B;  2ATL A;  1SQE A;  4XDC A;  4F36 A;  3NMA A;  2RKI A;  1TAQ A;  3DOL B;  1IR1 A;  3HCX A;  2OPQ A;  1BC6 A;  1KTV A;  1ZM4 A;  2OEM A;  3SEO A;  3D6T B;  4W92 B;  1TAU A;  4YEA A;  3NAH A;  3GSI A;  4DN9 A;  4CM2 A;  3IGN A;  3LAN A;  2AW0 A;  3G87 A;  1VLO A;  1WNE A;  2E29 A;  1T03 B;  4N47 A;  3VF0 B;  3S6E A;  2R7R A;  1W7W A;  3NGK A;  2E66 A;  5D0R A;  2H4Y B;  3DYA B;  3LTO A;  2UU9 J;  3OLA A;  1RE1 B;  3TW0 A;  2HHS A;  1WHY A;  3OVS A;  3JYT A;  5B09 A;  1RHQ B;  4WFA Q;  1U1P A;  1RWM B;  1NK9 A;  2CQ3 A;  2AHO B;  4LQ9 A;  1B0V A;  4IYQ A;  1UEU A;  1TL1 B;  2QX0 A;  2G4B A;  3MD1 A;  2W1B A;  4B9T A;  5FII A;  4I4B A;  3RU0 A;  2ZDO A;  2CQP A;  3AD7 C;  2MKH A;  4JI1 F;  2YWW A;  3OTD A;  2WOM A;  3M1V A;  4OX6 A;  4F0K A;  4F02 A;  3DKD A;  2MJN A;  3MEE A;  4J5O A;  2W9C A;  2M9K A;  4IDK B;  3D1H A;  2F9D A;  4ZVE A;  4URG A;  3ENA A;  2UXB F;  4Y2K A;  4C8Z A;  4OI1 A;  4FF1 A;  1GMU A;  3R27 A;  5B0E A;  2XMT A;  1SJ1 A;  3RW7 A;  4PYD A;  3AA8 A;  3RW6 A;  1H2V Z;  4FYW B;  3MED A;  5DM6 Q;  3KUH A;  4RU9 A;  1VRT A;  3KK3 B;  1E6V B;  3ENV A;  4F8R A;  1JKH A;  4ZJL A;  3MR6 A;  1WEZ A;  2PEB A;  5HL7 Q;  3CC2 S;  2BAN A;  2IBO A;  5RUB A;  2DGQ A;  2JEJ A;  4FKX A;  2KYZ A;  1NH8 A;  3LH2 S;  1AA1 B;  2FC8 A;  3D5M A;  4FN5 A;  1ZBT A;  4IG0 A;  1S9F A;  3N6N A;  1OSC A;  1YJ9 S;  5DZ7 A;  5E3R A;  4P9S A;  1WG1 A;  3RB3 A;  3UN5 A;  1SJ4 P;  1KOH A;  3BGO P;  4USV A;  3JSB A;  3NXZ A;  3HHE A;  3U27 A;  1VIX A;  4ZPA A;  5CCL A;  4F04 B;  2HHX A;  3ZZY A;  5KFA A;  3AT1 B;  4DV1 F;  1LXJ A;  1SKW A;  4KHP F;  1NJZ A;  5FDL B;  1FDB A;  2Q6C A;  4IH7 A;  2IBK A;  1QDU B;  4J9Q A;  5H9F K;  2ZWO A;  1TKD A;  4DF4 A;  2CQ0 A;  4FYV B;  1EQ0 A;  4DN0 A;  2M2B A;  3T9Z A;  1N5Y A;  3EZU A;  2HUR A;  2ADB A;  4NCB A;  1VBX A;  2ZJR Q;  3MMB A;  1TFW A;  2HNZ B;  3IA0 A;  1FK9 A;  3KK2 A;  1H98 A;  2GC8 A;  3BGR B;  3DDN A;  5DLF A;  4KGX B;  4WFX A;  3JTO A;  4WP9 A;  5KFS A;  2AGQ A;  1JIH A;  2CQ2 A;  4O3Q A;  2DGT A;  2KO1 A;  3IGV A;  2HFO A;  1OO0 B;  4DWI A;  2WSC C;  4IFY B;  4URS A;  2KFZ A;  1PBU A;  4BLG A;  3H2L A;  4I6W A;  2BOP A;  1BQN B;  3CJ4 A;  2R8J A;  2E5L J;  2BW7 A;  1RHJ B;  3D1O A;  2HGN A;  1DTT A;  1TKX B;  1JLA B;  1GX6 A;  3ISN D;  4FDF A;  2JVR A;  4A8O A;  2M3D A;  1M1H A;  3ITH A;  5D4N A;  2PC6 A;  2OI2 A;  2XHC A;  1KQF B;  1IJF B;  2R2U A;  3BQ2 A;  3WIU A;  1PSD A;  3LGN A;  5FD1 A;  1TP7 A;  5AXM A;  2A3J A;  4ZDN A;  2GAH C;  2MKS A;  1BY9 A;  2OIH A;  1KVK A;  5IM0 A;  3OD2 A;  2BE2 A;  2G0C A;  3DU6 A;  3W61 A;  1SKR A;  3H20 A;  4EI2 A;  3H8Y A;  2J7K A;  1NXI A;  1NND A;  2CNN B;  3KLG B;  3M9N B;  4U67 Q;  3K5N A;  1N34 F;  4FBT A;  1BQM A;  1MSW D;  3CME S;  1EET B;  1Q79 A;  1U48 A;  5DS7 A;  4HAC A;  3VAL A;  2DEJ A;  4TLQ A;  1FTR A;  1S9G B;  4JI0 J;  2QGF B;  2HHP A;  4AL7 A;  3Q86 A;  1UW9 A;  4WFN Q;  4MFB B;  5IS2 A;  1S6P A;  2NPF A;  3AXM A;  1S6Q B;  4RUA A;  4FBU A;  2AQ4 A;  2DGV A;  1S97 A;  2E5G A;  2EC2 A;  4R8U A;  1WOP A;  1Q1K A;  4DSF A;  2XYP B;  2XG8 A;  4EEY A;  3PAC A;  4OI3 A;  3Q24 A;  1Q8B A;  3V81 A;  2ZM6 J;  4USI A;  2QA4 G;  1ZPV A;  3HT0 A;  3MM6 A;  3AH6 A;  2AIR B;  3A8E A;  1FE4 A;  3H4D A;  3OXG A;  5B0A A;  2LKZ A;  2XO6 A;  1BXN A;  1Q0N A;  4TYB A;  4DR5 J;  5D4O A;  5CYQ B;  4DV5 J;  2V2Q A;  2VKR A;  1UEV A;  5E3Q A;  1GXL A;  2FJE B;  4ZHR A;  3RJM B;  1SPB P;  3KLH A;  2ALY B;  1CJU B;  2UUT A;  3DNC A;  3TNV A;  4FF3 A;  1RUS A;  1N88 A;  3I6P A;  1CUL B;  1OYD A;  2L08 A;  2G1D A;  5GAD U;  2GJ2 A;  3EPG A;  4OHW A;  2ZNY A;  5KT2 A;  2RQC A;  1R7I A;  1NK4 A;  4ZCI A;  4C8K A;  1O51 A;  1DQ9 A;  1H73 A;  4DR2 F;  3WC2 A;  4WFY A;  3HKZ D;  5DET A;  1UWB B;  1BE4 A;  3LUY A;  1SXL A;  5C24 B;  4TU9 A;  2FHO B;  4DQQ A;  1IKV A;  1VHI A;  1R27 B;  4DJB A;  4X84 A;  3T5K A;  5BR8 J;  1LFP A;  4ECZ A;  1SV5 B;  2HK2 A;  4DMZ A;  2XMA A;  4J9M A;  4I67 A;  3I5C A;  3VAM A;  4FVC A;  1X8D A;  1SIZ A;  3BPD A;  2FZC B;  3UWT A;  4C0B A;  4ZA1 A;  1HBN A;  2NZ4 A;  4NLG A;  2PMH A;  3MHY A;  3D7S B;  3H90 A;  4PXB A;  1YJW S;  2QLJ B;  1F6T A;  4TU8 A;  1FKO A;  4F3Q A;  4JI3 F;  1UMJ A;  1JLC B;  5KG6 A;  3SI8 A;  2AEM A;  2AT1 B;  3LP2 B;  2RUG A;  3DMJ A;  2B43 A;  4USJ C;  5IC6 B;  2WZ1 A;  3CCM S;  5J1E B;  3QT6 A;  2KXF A;  4L6V 3;  4A8K A;  2WSE C;  3JTN A;  1PCA A;  3D68 A;  2WBR A;  3G6E S;  2IM0 A;  1V9O A;  4HT5 A;  3HVT B;  1X5O A;  1EAR A;  3DLG B;  5CAB A;  3GV8 B;  3P45 B;  2ZUA A;  2H51 B;  2BA9 A;  1N32 J;  1UET A;  3OL7 A;  2HHH J;  2EG1 A;  4HHJ A;  2W7O A;  3W60 A;  3OFE A;  5ETO A;  3WDO A;  2Q6B A;  3QGG A;  5LJ3 Y;  1J5E F;  3FMB A;  2VG5 A;  4KY3 A;  1TKZ B;  1NDK A;  1MWQ A;  4NXM J;  4LVO P;  3QRP A;  2VG7 A;  1PJ5 A;  1J5O A;  3EVO A;  2O1P A;  1WKL A;  3E2E A;  2VD3 A;  1DFD A;  1WG5 A;  2OGU A;  3KDO A;  1HBU B;  1T05 A;  2WHO A;  3EPI A;  2D1C A;  2RIL A;  5K8O A;  2VON A;  1ZM3 A;  2IRX A;  4M5N A;  1DQA A;  4ZP8 A;  2M4M A;  4X66 J;  1WAC A;  1F5C A;  4JV2 A;  4GKJ F;  1S1T B;  1H2U X;  1RWX B;  3ZTQ A;  3TUZ C;  3KK1 A;  1LQ9 A;  2RAQ A;  4WKY A;  4CO5 A;  4MK9 A;  4C3M A;  5HMZ A;  2FJV A;  4ETZ A;  1ZYQ A;  5IV4 A;  4RR5 A;  3N4W A;  3CDU A;  4EK2 A;  2MQ8 A;  1IKX A;  3DI6 A;  4A46 A;  1OY6 A;  5DQH A;  5F9N A;  3L7O A;  1HNZ J;  1VRU B;  3FUY A;  4DX8 H;  1LNQ A;  5KFG A;  4EGL A;  5HK4 A;  4KGV B;  3E8O A;  4K4T A;  1EJ7 L;  4ZVG A;  1Q81 T;  5A8W B;  4CLT A;  5KFC A;  5THW A;  3PYD A;  2IRY A;  4ZVP B;  2CG4 A;  2BX6 A;  3MAQ A;  1R8H A;  5J2P A;  2FLL A;  3K5L A;  5L46 A;  3FRZ A;  1Q82 T;  1ACM B;  4J9V A;  3LP1 A;  2QG9 B;  3CNQ P;  3H5U A;  4DV2 J;  3J7A 1;  4P75 A;  3UR0 A;  2NXE A;  1E6Y B;  2DY1 A;  4MMO A;  4ZVU B;  4ZP6 A;  1U1O A;  1HW9 A;  5GAE U;  3KHG A;  4DR4 F;  4LF2 A;  3O1L A;  1FNX H;  2JRS A;  1JMT A;  5I42 B;  2R42 A;  2RU3 A;  2MZR A;  2XMU A;  1RTI A;  4DUY J;  3TA2 A;  2GGP B;  4NL5 A;  3JAM Y;  5KT7 A;  3BQ0 A;  1C2P A;  3C6U A;  2DR6 A;  4ECX A;  3VAJ A;  2BVZ A;  4JI2 J;  1VS3 A;  1S6O A;  3W8G A;  4LF6 F;  4EZ9 A;  1DJ0 A;  4QPX A;  2XMJ A;  4OFZ A;  3NCR A;  1QAI A;  2ZDP A;  3OTO J;  2PII A;  5KG3 A;  4ZP9 A;  3IFE A;  2F5G A;  4ZKA A;  3L3C A;  1KQG B;  4QJV A;  4USH A;  4OIX A;  5DG8 A;  2GQC A;  2MXY A;  1WJ9 A;  2N3L A;  3V6J A;  5CQG A;  1QE1 A;  1PG5 B;  1NZA A;  4WXW A;  3IR6 B;  1S10 A;  3K2Y A;  4PYA A;  4TU7 A;  3OXF A;  4QIV A;  3UI3 A;  3UD3 P;  1RK8 A;  1XBW A;  3BGF A;  2MQM A;  2YKN B;  2EG2 A;  1YZ6 A;  3J81 Y;  2HND B;  3GJQ B;  2W7A A;  3LGM A;  1HQE A;  4BC9 A;  4QWC A;  3FEY B;  2HIY A;  1HNI A;  3TZZ A;  2B51 A;  1QAY A;  4OX8 A;  3QJJ A;  2HBQ B;  4YB7 A;  4LFC F;  3CCV S;  4DV7 J;  3OLB A;  1B7F A;  1R8C A;  4USW A;  4DR7 J;  4CO1 A;  3MEG B;  2V0N A;  4DPX A;  2XCP A;  3MCO A;  5K8N A;  3OTB A;  5LOQ A;  2Y1J A;  4DR1 J;  1DBD A;  5KFO A;  1IKW A;  1M1G A;  4JP8 A;  4R25 A;  3DRR B;  1HHS A;  4DX7 A;  2HFU A;  1OIA A;  1Z2L A;  1R89 A;  2U1A A;  1S9E A;  4WIQ A;  3RZA A;  1X5P A;  2VFS A;  1UKU A;  2HYI B;  4ZPD A;  4RW8 A;  2RU9 A;  4A4J A;  3M9O B;  3EM1 A;  1S1U B;  4QR0 A;  2M70 A;  1X31 C;  2XMM A;  4NXN J;  1S7H A;  3TJ8 A;  3C15 A;  2H4W B;  4B3T J;  3K17 A;  1KFD A;  5J2M A;  1RT4 A;  5D8H B;  1Q5Y A;  1YK9 A;  1I94 F;  1QVG R;  4HH1 A;  5DDR C;  2XZW A;  3VVT A;  3QFH A;  4WZM A;  4L72 B;  4RW9 A;  1N0V C;  4PWD B;  1BD6 A;  3GV7 B;  4OZN A;  3RB0 A;  2RRA A;  4PPZ A;  2DH9 A;  1M5V C;  5EGY A;  4CIO A;  2CJX B;  2V67 A;  5HRO A;  2DNL A;  1F2H A;  2JLG A;  2KHC A;  4LRA A;  3SMZ A;  3UDE A;  1X4F A;  2MKJ A;  2F4V J;  2DH7 A;  2HQI A;  2ZVI A;  1S0O A;  1TK0 A;  4B3R J;  2RDI A;  2VB6 A;  3SSR A;  3BGU A;  3CWJ A;  2DNO A;  4UQT A;  2CQI A;  2FQQ B;  3MM9 A;  1ZZN A;  3RUB L;  4TY8 A;  3M2R B;  4K4Y A;  4P2M A;  1EZZ B;  1IVZ A;  2OKQ A;  2CNL B;  2UU9 F;  3BDE A;  3NNC A;  2QA2 A;  1HHQ A;  2DYA A;  2FHM A;  1MU2 A;  2EFN A;  4OYZ A;  2WCX A;  4AE5 A;  1RT6 B;  3RB4 A;  4C6A A;  4P7V A;  3R2D J;  1D3W A;  5BYR A;  1SH2 A;  1UVN A;  4KB7 A;  4B9V A;  1JQG A;  3E3X A;  4KKO B;  5KG5 A;  5F9L A;  3CJR A;  4CO3 A;  3MM7 A;  2ILZ A;  3R9L A;  2OMO A;  3T5L A;  2DCU B;  3FCV A;  2A2D A;  2KG0 A;  1FXR A;  2XNR A;  4F0M A;  1T3O A;  1YJT A;  3JQK A;  1ZA2 B;  5FLX U;  2IA6 A;  3DOL A;  4YB1 P;  2DPI A;  4HL9 A;  4LIW A;  4MIA A;  4ZN3 A;  4W90 B;  3CTR A;  3CVK A;  4X4N A;  5D3G B;  1DZ5 A;  3GV5 B;  4JI4 J;  1T03 A;  2XWX A;  3NOC A;  1TR0 A;  1HWU A;  2GV1 A;  2O67 A;  3DYA A;  4DR3 J;  3GJT B;  1VJW A;  2DJW A;  3I32 A;  5I3Q A;  4WP3 A;  3RR8 A;  2Z2Y B;  1BHN A;  1YJV A;  3T6J A;  3GCW P;  1NHV A;  4PWU A;  4PAB A;  2JEI A;  2M5Y A;  1QTN B;  1Y00 A;  3MM8 A;  4OL8 A;  3LPE A;  1LEO A;  4Q5V A;  3CCL S;  3TEG A;  4YR0 A;  3BO4 A;  4WJB A;  3H98 A;  1X0F A;  1JLQ A;  3UCG A;  1YJN S;  1N48 A;  1HQU B;  4R5P A;  5EN1 A;  5ETL A;  1QY7 A;  2B9E A;  4GVB A;  4DX5 A;  1M5P C;  4BWJ A;  2J6S A;  4WE1 B;  4IDK A;  4F2S A;  1NAQ A;  4Y2M A;  1X9M A;  2NQP A;  1HYS B;  5E41 A;  1YG0 A;  1WC3 A;  5LJ5 Y;  2HHV A;  3CD0 A;  1NKE A;  2IVY A;  4IFV B;  1RTH B;  2CNO B;  1VBY A;  1E6V A;  3NGD A;  1DHM A;  2DO0 A;  1KTQ A;  1UA0 A;  1VQS A;  1P27 B;  4CO4 A;  3R1L A;  4DU8 A;  1VYA A;  3W2V B;  3HM9 A;  2Y0S D;  1M0S A;  3Q22 A;  1RT1 B;  3BBF A;  3GYX B;  4OMF G;  2AEJ A;  2ZHB A;  1ULR A;  3HSZ A;  2VPX B;  3ETM A;  3JTP A;  3DLK B;  1NK5 A;  1VFJ A;  3R8Y A;  2VFV A;  3CDW A;  1RB0 A;  1ITP A;  2A6O A;  1C1B A;  4HR2 A;  1X4B A;  1RIS A;  3EE3 A;  2CRL A;  3F56 A;  4NYP A;  2BUN A;  2ZKT A;  4EUV A;  2ZC3 A;  4KH1 B;  2K1R A;  4O3P A;  1WC6 A;  4DL2 A;  1Q8K A;  1HI1 A;  2NUH A;  1RAF B;  4C8L A;  1R8A A;  3UN2 A;  1MMD A;  4ELU A;  3W64 A;  1O6X A;  4AFF A;  3FC9 A;  2ZBR A;  4NA2 A;  3IRW P;  2HHU A;  5IV3 A;  2ZIT A;  3FGV A;  5K20 B;  3BM7 A;  5A0Y A;  3VAI A;  3EXY A;  3CJQ A;  3D0H E;  4I56 A;  3TX0 A;  3EJM A;  4A47 A;  3K0J A;  1FVQ A;  2O5D A;  3PRB A;  2BQU A;  2KKH A;  1XEZ A;  5HJY A;  4LMZ A;  4EFA C;  2PFD A;  5GAD I;  3LWM A;  2AJ4 A;  5BYQ A;  2A18 A;  5DZ6 A;  4WPA A;  1HD1 A;  1FKA F;  5KAK A;  3SCJ E;  1UEK A;  2Y1R I;  1QUP A;  1JNR B;  5ITH A;  4JI0 F;  2CVI A;  4NI2 A;  4BWM A;  3CD6 S;  5AJ3 J;  4ZCK A;  2AJF E;  4QWE A;  4DL5 A;  1QD1 A;  2JFK A;  5IT9 U;  1JB0 C;  1OMS A;  4TQS A;  4WU3 A;  1XIQ A;  3PX4 A;  4ILL A;  3VWS A;  3UCU P;  1IN0 A;  2WON B;  4NYZ A;  4LR9 A;  2ZKU A;  2HG4 A;  3JSM A;  5HO4 A;  5GAG U;  1EHW A;  2ZM6 F;  2YH0 A;  2N7C A;  1UFK A;  3MEC A;  3PIP Q;  1Q16 B;  3R6G B;  1Q7Y T;  2E1C A;  4XDD A;  2EI5 A;  1G3O A;  2DTJ A;  3PTW A;  1FJG J;  1JLE A;  4DI6 A;  4DR5 F;  4DV5 F;  4NLQ A;  3DLL Q;  2XLI A;  2HS3 A;  1HHT P;  3QO9 B;  1TFY A;  5HVF A;  1UVK A;  1T9X A;  5C42 B;  3W3S A;  4M5J A;  2XMW A;  4P7T A;  2DGO A;  1MLA A;  4MKB A;  1S9G A;  5LMU F;  1OY8 A;  2MQP A;  2DEI A;  4DZD A;  4ZVS B;  3TUI C;  2XGP A;  1KLM B;  3MFH A;  1S6Q A;  1FX2 A;  1C4A A;  1GQE A;  4C8M A;  5EHH A;  4G1I A;  6FD1 A;  4LRE A;  2RKI B;  4CDI A;  3KJN B;  2OPQ B;  4ZOS A;  5HAT A;  1N5T A;  4C97 A;  4LRD A;  5GMK a;  3WBZ A;  3R5A A;  1TL7 A;  5DJB A;  2B4P A;  3FVY A;  5HLF A;  2AX1 A;  1SKU B;  3C16 A;  1G1X A;  4YB6 A;  5CYQ A;  4EMD A;  2YKP A;  4FP9 A;  3JYT B;  2YWG A;  4OX9 J;  1XNQ J;  2GHW A;  1CJU A;  3CE8 A;  3JSR A;  5IT4 A;  1R8P A;  2MLY A;  1H3D A;  4DOZ A;  3P3D A;  4LSL B;  4PAA A;  2BJ3 A;  2A2C A;  4ZK7 M;  4MH8 A;  3Q2S C;  2D3U A;  2UUB J;  2XYH B;  2JNJ A;  3HHD A;  1T8E A;  3NWR A;  3KXD A;  1W2I A;  2WOM B;  3MOJ B;  4GVL A;  2XY7 A;  3QJP A;  5B7W A;  3M1V B;  4L73 A;  1NSP A;  3S7R A;  5GAH U;  4A8F A;  2JLE A;  1HNV B;  1M1K T;  1PC5 A;  1PIE A;  3Q8U A;  3UVJ A;  3MEE B;  1LWC A;  2W9C B;  3CSK A;  2KL8 A;  2LXI A; 
#chains in the Genus database with same CATH homology
 1W7W A;  2AZ1 A;  3FCV A;  3G2X A;  3ZTR A;  3PJ9 A;  1WKL A;  1B4S A;  1PAE X;  3FBF A;  2BEF A;  3FKB A;  2BX6 A;  1WKK A;  4FKX A;  1B99 A;  3FCW A;  2HVD A;  3FC9 A;  3VGT A;  1EHW A;  3WX8 A;  1NSK L;  3B6B A;  3VGS A;  1BUX A;  3BBC A;  3GP9 A;  4WBF A;  3FBC A;  3ZTP A;  3EJM A;  1MN7 A;  1NDP A;  1S59 A;  1U8W A;  4UOH A;  1WKJ A;  4F4A A;  3FBB A;  3DDI A;  3BH7 B;  3FBE A;  3PRV A;  1NDL A;  4ENO A;  1PKU A;  3GPA A;  4O0N A;  3Q86 A;  1KDN A;  3BH6 B;  3ZTS A;  2HVE A;  3B54 A;  2DXE A;  2DXF A;  2B8P A;  1HLW A;  1NPK A;  4DUT A;  4DI6 A;  1NDC A;  3ZTQ A;  1NLK L;  4DZ6 A;  3EM1 A;  1BE4 A;  3NGS A;  3VGU A;  4ANE A;  1NSQ A;  1VYA A;  4AND A;  5CAB A;  3L7U A;  3DKD A;  1NUE A;  4W98 A;  1BHN A;  2ZUA A;  3BBF A;  4ANC A;  3VVU A;  1K44 A;  1HHQ A;  2DYA A;  4EK2 A;  3VGV A;  1S5Z A;  2CWK A;  3Q8V A;  4F36 A;  4CP5 A;  1JXV A;  3Q89 A;  3ZTO A;  1NHK L;  3EVM A;  5IOL A;  3ETM A;  3BBB A;  3ENA A;  3VVT A;  3NGT A;  1LEO A;  4UOF A;  3EVW A;  1LWX A;  4C6A A;  1XQI A;  2NCK L;  3EIC A;  3Q8Y A;  2DY9 A;  1NCL A;  5CAA A;  1S57 A;  1MN9 A;  2B8Q A;  5BXI A;  1NB2 A;  1F3F A;  3NGU A;  1NSP A;  4UOG A;  2DXD A;  4HR2 A;  3NGR A;  1UCN A;  1NDK A;  3MPD A;  3Q83 A;  4KPC A;  5C7P A;  3EE3 A;  3JS9 A;  1XIQ A;  3Q8U A;  4S0M A;  3EMT A;  1ZS6 A;  2VU5 A;  3ELH A;  3EVO A;  1F6T A;  3R9L A;  4FKY A;  2AZ3 A;  1HIY A;  2HUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...