1NDKA

X-ray structure of nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
KERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIICGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title X-ray structure of nucleoside diphosphate kinase.
pubmed rcsb
source organism Dictyostelium discoideum
total genus 45
structure length 148
sequence length 148
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndkA00
1PAEX 1WKLA 1ZS6A 3L7UA 1HLWA 4WBFA 3VGUA 5C7PA 3DKDA 5CAAA 1HIYA 2NCKL 3JS9A 4HR2A 4W98A 3Q86A 2CWKA 1EHWA 5BXIA 3Q89A 1NDLA 4S0MA 3ELHA 3FKBA 3GPAA 1VYAA 1BE4A 1B99A 1BHNA 2DYAA 4FKYA 3FCVA 1K44A 2ZUAA 1KDNA 3ZTSA 3EICA 3EVWA 3EE3A 2VU5A 2DXDA 4DZ6A 3NGTA 1NSKL 3DDIA 1U8WA 1NDPA 1NDKA 1XQIA 4ANEA 3B6BA 3VGTA 1BUXA 2AZ3A 3BBBA 3VVUA 3Q8VA 1NB2A 4UOGA 4FKXA 1HHQA 4C6AA 4KPCA 4F36A 4O0NA 1S5ZA 1NPKA 1B4SA 3EM1A 3VGSA 3BH6B 1UCNA 3FC9A 4ANDA 2DXFA 3VGVA 3ZTRA 4UOHA 4UOFA 1NSPA 1WKKA 3ETMA 4DI6A 4ENOA 3WX8A 2AZ1A 1NCLA 1S59A 3NGUA 4CP5A 4DUTA 1NSQA 3FBCA 3BBCA 1MN9A 3R9LA 2HURA 3ZTPA 2HVDA 1NLKL 1S57A 3B54A 2DY9A 3FBFA 3NGSA 1JXVA 3Q83A 1WKJA 1MN7A 1NHKL 3Q8YA 3NGRA 1W7WA 3FBBA 3Q8UA 5IOLA 1NDCA 2HVEA 3BBFA 3EJMA 3ENAA 4EK2A 2BEFA 4F4AA 1PKUA 1F6TA 3ZTQA 3EMTA 2B8QA 3G2XA 1NUEA 3GP9A 3MPDA 2BX6A 3ZTOA 4ANCA 5CABA 1XIQA 3PRVA 1LWXA 1LEOA 2B8PA 3BH7B 2DXEA 3FCWA 3PJ9A 3EVMA 3FBEA 3VVTA 3EVOA 1F3FA
chains in the Genus database with same CATH superfamily
5CD4H 2W01A 3MCNA 1V3SA 2JC1A 4DV2F 2LEPA 5E5NA 1B3TA 2W9CB 1H73A 4NX9A 4PPZA 3DRRA 4ZPBA 2CDQA 5DETA 3P49B 3W5YA 1RP5A 4LIWA 4KFBB 2DGTA 1YLXA 3ENQA 3CCES 2JEGA 2CUYA 2IJFA 5J2NA 4C6AA 2IJNA 2HFNA 3V4MA 4YDDB 4LUBA 1IXKA 1TFWA 4M5GA 3DOKA 2AZ1A 1UTAA 2DNRA 1RUSA 3K2YA 5KG5A 1U1KA 1TVRA 2KFYA 4KIAA 1TKXB 2AP6A 3ONQA 4YQWA 3TO8A 4GMKA 2R9LA 1HWJA 1JNRB 4IQXA 2ADBA 1SH2A 4MFBA 3BDPA 3Q8QB 3EMTA 2VG5A 3V6KA 4P71A 1LEOA 5L9NA 3MAQA 4MAKA 1XC9A 2OMLA 3P4UB 4K4WA 4X2BA 3L7UA 2VASA 2HLTA 4J9VA 4Y2CA 3JXOA 1N8RT 2XZWA 4J9RA 2XCAA 3I5BA 2DPJA 4CT9A 5KFTA 2KN4A 2QO3A 2CQPA 4B9LA 5D0GA 5IQ6A 1E6YB 2YWWA 2LQBA 1Y5NB 2CQCA 2BQUA 4P2XA 1CJUA 4USWA 2FLLA 3I31A 2QJ3A 4ED8A 3RR7A 2ZKTA 4J5OA 3AQOA 5EUHA 2YNIB 4OX7A 2XEXA 1NAQA 2GO9A 1T9YA 1V6HA 4MMOA 1UFLA 1D9FA 2CDRB 2HSEB 2Z0GA 5E3CA 2KT2A 2IFXA 2CADA 1QUVA 2EFNA 1VISA 3PTWA 3TAPA 4IDKB 3ZZYA 4DV4J 2I8EA 3ILOA 2HRUA 4ED1A 5HVFA 1S12A 3K8VA 2B9XA 3GJQB 3BQ0A 3X1LB 5KG1A 1RWUA 2JLEA 2BR0A 4KR0B 1ZTTA 1RI7A 3ISND 3CEDA 4BHQA 5D4PA 2Z2LA 1CJVA 3QBCA 2DR9A 1QAYA 2R7TA 1Q78A 3IGNA 1TL3B 2ROPA 3CJRA 1IN0A 3AA9A 3AOCA 3P96A 3G86A 1T9UA 1OPIA 3ISZA 4NXNJ 2DGQA 5EN1A 1MU2B 4OZ0A 1SPBP 3KUEA 5E41A 3C16A 1ZAXA 2H1YA 2I2YA 4CLYA 3TRGA 3LUYA 3M4XA 5K14A 4UW2A 1OIAA 1UFKA 4IFYA 4JV5J 3AA8A 1W25A 1HBMB 2L08A 1R0CB 3I96A 3VAGA 2CPXA 2YPYA 4ZJLA 3CC2S 4ED4A 3C8YA 1F1BB 2HHUA 2N7CA 3E8OA 3BZQA 4JI8J 3D9BA 4E8UA 2AKWB 2HFSA 4LSNB 3K8WA 1JLGA 4UOCA 1J5EJ 2XZTB 2ZJPQ 3H0PA 2KFZA 2P9GA 3HFKA 1WHVA 3UO0A 1IBKF 2NPIA 3SDEA 2I1RA 4J7CA 5CCLA 2GC8A 3NCPA 1YX2A 5IM0B 4IQMA 5GADI 3R3TA 4ES1A 1S6PB 1CJTA 4BC7A 3JB9k 3GPAA 2ZH5A 2FHMA 5KFWA 3CIZA 3H4DA 3MD1A 1FA0A 1AW0A 2W8LA 5KTQA 5HANA 4LF8J 1IBMJ 1U1PA 1CQNA 2HQFA 3D7SB 4IO9Q 4FKXA 3MXHP 4GC6A 2VA3A 2AEJA 3H5YA 3MM6B 4P7TA 2I6WA 4EMDA 4ZP9A 2ZH8A 3TQ1A 4WFXA 2CPHA 3R1LA 4FN5A 4JBCA 2FJAB 1NKCA 3D54A 3BR9A 2CWXA 4E0DA 3KG0A 3KFWX 2WONA 4JV0A 3M30A 2GGPB 1NNDA 1WHXA 2W2NP 4PAAA 1OSCA 2AEMA 4O4RA 3HXMA 1FXRA 4YS2A 1C1CA 4GKKJ 1D0EA 1RHMB 2JFDA 3M1VA 4O3QA 4MH8A 1TQLA 2NLWA 4Y2AA 4L3NA 2JSXA 3J7A1 3WC0A 3UD5A 1AB8A 2CFXA 3MR6A 2BMBA 2P8IA 3WIVA 2CJ9A 1JLBA 3KLFB 2R42A 2PMHA 1X8DA 2DPIA 4LT6A 3MPUB 1M5KC 3BSOA 2AJ0A 3CCJS 3OXFA 3CIMA 4X62F 1RTHB 2KTQA 4RKUC 1CEZA 5DJBA 4HDHA 1WACA 4Q2MA 4NLXA 2AJ2A 4B3OA 2BVZA 3R8YA 4QPXA 1WUUA 3GIIA 2EI5A 2RF2A 3B54A 2WBMA 3NGSA 2HNDB 5I42B 1DLOB 2C3PA 4CNYA 3OR1B 5L8RC 1AUDA 3SYZA 1FE0A 1FRLA 2XMTA 3MUVP 4IG0A 3TAQA 2B56A 2CG4A 1FKPB 2E5JA 2BE2B 2I9SA 5FDLB 4DUYF 4KPYA 1TL4A 4RUAA 2UXBF 2DGSA 4J37A 4HKQA 5I4MA 3UCGA 4OV6A 2MMYA 3LANA 4CYUB 4DSFA 2DHXA 3LALA 2EEYA 2GMHA 3FSXA 3PKMA 4ANDA 4JI7J 2G0IA 2RRBA 1NSPA 2UUWA 2HEKA 2A1BA 4Z2XA 3M8PB 4NLUA 2B5JA 1HWKA 2DNHA 3KK3A 1JLFB 2W9BB 2NZ4A 4X4UA 2Z4PA 2HWTA 1TZ0A 3QGHA 3JTNA 1Y00A 4URSA 3NLCA 1ZPWX 3ITHB 3D67A 5CABA 2ZE2B 4LBHA 4B3TF 3D28A 4EBCA 1RDRA 1AZSA 1P9QC 1R8CA 2RQKA 4ZLPA 3PW0A 5D3GB 2DK2A 1HBUB 3OUYA 5IV4A 1F5CA 1SI9A 3W5ZA 3GSDA 5DM6Q 4FYYB 2HG4A 3BGRB 4OZ5A 3SIPB 4CWBA 3BN4A 4C4WA 1GMUA 2RD5C 1IR0A 3AQPA 3DLKB 3J7ZT 1IM4A 1HQEA 2DNLA 5B0DA 3UW1A 3T3FA 3FQKA 1EB0A 3WHIA 4H4KC 4KHPF 1RT4A 3L7OA 3LP2A 5L38A 1SC4B 4DS4A 2DRDA 1HNIA 5IS2A 4MIBA 1HNZF 4WP8A 2H5EA 2EKYA 1M1GA 1R31A 5CH7B 2KJWA 4AQYJ 2QLBB 2OFGX 2DY9A 4LIRA 3EPIA 1LW0B 3R5CA 1IBLF 4KO0A 4ZK7M 2PMWA 1HNVB 3CVKA 4QW8A 2J8AA 2GAGC 3ZXWA 2J6UA 4XTTA 2ALZA 1NJXA 1SL2A 3EGWB 1XMQF 4OV1A 1WF1A 4B3RF 1QD1A 2QZ8A 2V2KA 4DFMA 4DV3F 4F0KA 1T3NA 3SSSA 2YKOA 1ZA2B 4K4UA 4KTQA 4PZVA 2BE7D 3HZGA 3DLEA 2BANA 2VF3A 1KFDA 1LKZA 4RWXA 5BYQA 1HNXF 3C19A 1N0UA 3WX4A 1PJ6A 2GIQA 3HHNB 3SBMA 2VQFF 4KJIA 2HHHJ 1RT3B 4OMFG 3HJFA 2FLPA 3MMAB 4QWCA 3BKUA 2JHEA 4YP3A 1NK0A 3KLEA 4O23A 2ATLA 3H20A 4GC7A 2AIRB 2HQCA 3BQ1A 1JXEA 1NK8A 1RISA 2ZOMA 3UNYA 1S0NA 5I3UA 4Z37A 2OFHX 3TQEA 3F0NA 1SH3A 4ILMA 4ICLA 3AXMA 2C22A 4NRUA 2F4FA 5JXSA 2GQCA 2CJYB 1DAXA 4KC5A 7FDRA 1YJVA 3R5GA 1L3TA 1OYEA 3SV4A 5LXRA 4WE1A 2HHSA 2A0FB 2NCKL 1EETB 3FDSA 2AF6A 2B43A 3U1MA 4KQZA 1RAAB 2YQ3A 1N34F 5J1EB 4RW9B 4DEZA 3HMJG 2HFOA 1S6QA 3VHQA 4X64F 3OPKA 1Y5IB 1CG2A 8AT1B 4AXIA 4OIXA 3B6BA 4U7UK 2C3UA 2GW8A 4TQRA 3ISNC 3W1YC 1N6QA 1XMOJ 1HPZA 4DPOA 4RL1A 3OHAA 5HMZA 2KG1A 3CW2C 1HI0P 1LQ9A 2R7RA 4K4TA 2K3IA 3MEEA 4ECUA 3W62A 4L6V3 2IDLA 3DRRB 3Q2TC 3M2UA 3OL6A 4NE9C 4UF4A 1N4LA 2XLKA 4U95A 1RB0A 2YWHA 1N33F 2ZBCA 1N5QA 2XLJA 4B3MF 5J2NB 2BX6A 1YKWA 2ZVIA 2D3ZA 4DR7J 1VRUA 1R27B 5IV3A 2QG9B 5GAHU 1RE1B 3VF0B 3DOKB 3MM5A 1G3OA 4OI2A 1IKXA 1RWOB 2HRTA 5D4NA 2ASLA 4QYZK 3GYXB 2DVIA 5IT9U 1TVRB 3UR0A 1RBLA 3CJTA 2ERRA 1RKIA 4MIWA 2IBOA 1NH8A 3DYAA 4WTYA 3FKBA 2AYEA 2VFSA 1RKJA 4MFBB 2XYPB 4B3SF 2FZCB 3A3NB 2C42A 1VQSA 1OWXA 3DLLQ 2WHOA 2ZUAA 1NJYA 2VG5B 3H2UB 4DZ6A 3F41A 3I87A 2UP1A 3QPIA 1Q82T 3EGZA 3KDNA 1I1GA 5DDOC 2BUNA 1KQSR 2KH9A 2E1MC 5KFYA 3AOBA 2KM8B 2GMJA 5F0UA 1RWXB 3AD7C 2CG8A 5C25A 2D74B 4ZPCA 4ZVUB 2COLA 1M5OC 1KS2A 2R7WA 1CJUB 2AQ4A 2W2PP 2OH2A 1IBCB 2FJDB 1FXLA 2X1FA 3QRPA 1V5VA 4DFKA 4YY3F 1MWQA 1RT2A 4JUZA 3BQ2A 3GFZA 2LU2A 1S1XA 2GHVC 4FNHA 1UWAA 2N3LA 3GU0A 2N7YA 3DGVA 4M5MA 3S8SA 3GMGA 1JLAA 5L1KA 4V19X 2OHDA 4F3MA 4USUA 2RE1A 2DGWA 2ZVSA 3KJVA 1S1UA 4ZA1A 2NSCA 2WVFA 2L9NA 3KNGA 2M8DB 1NK5A 3MR2A 2Y8WA 2VU5A 2XNRA 1XNQJ 2FTRA 3CCRS 1UJ5A 1QTNB 3EM1A 1CJVB 2BOAA 2UUBF 4JI0F 4DI6A 4LF6J 3IG1A 3NWGA 1AA1B 1PO6A 2L9DA 2E44A 4M5JA 4TY9A 2PMZD 4UT4A 4DQSA 1WKJA 3OHBA 4PKDB 4JI1J 1Y3JA 4XDDA 3N4WA 3I4HX 2KYXA 4DR3J 2MSTA 2R4FA 1QVGR 3K5LA 1PAEX 5K14B 4ZVEA 4IFYB 2YWFA 3WZ0A 4Y2IA 2N82B 4ZCIA 1RHUB 2GHWA 3V4IA 2WZ1A 5I3QA 2JX2A 5BXIA 1RTZA 3VAKA 4U6PA 2OEKA 5F8NA 5ETTA 4DV1F 1A7GE 2V68A 2CPZA 4M5NA 1K44A 4M5IA 5DM7Q 2WB4A 1JLGB 3BDEA 2F9JA 4KGKA 3J81j 3R97A 4H4MA 1JLQB 3VAHA 3KLGA 4DV2J 3HHLD 2AZ3A 5A8KA 4DF8A 3SDEB 4EI2A 3PRBA 1ITPA 2IA0A 2BJ1A 2RB7A 4ECYA 2IVMA 3TNVA 2V8PA 5LSOA 4F02A 1CJTB 2VG7A 2MQNA 4UTGA 3BBCA 1TP7A 3GCWP 1VRTA 4P6QA 4AE5A 5CYQA 4G1QB 2E1PA 3CF5Q 3Q83A 2ZWOA 4OZ2A 2WVBA 2VFVA 3CJ4A 1VRQC 3IAM9 3QJPA 4TLRA 4TU9A 3IXQA 1OYDA 1X31C 4RW7B 3ZZUA 2K7KA 1IKYA 1LXNA 1SQGA 3S1TA 3G9CA 1QTMA 2WONB 4DR2J 3K5PA 3M30B 2ZH7A 1HD1A 5DG8A 2MB0B 4ZCLA 1N5YB 4WP9A 2XM3A 1R8PA 4HHJA 4P52A 2LDYA 1S0VA 2M3DA 2H5IB 1HQUA 4DR1F 2KT5A 1C1CB 3CDBA 5DQGA 2RRAA 1SJQA 3M1VB 2QL9B 4HL9A 2APOA 3BH6B 5THWA 2MJUA 1HNWF 3OFGA 2Q1LA 2M70A 2KFNA 4NLWA 2LU1A 2DNPA 1FKOA 4OX9F 5L39A 1JLBB 5L1IA 1QLNA 3KJQB 5GMDA 4UZCA 4QW9A 1K73T 2DNZA 2HHXA 4YOEA 1VC0A 4Y3CA 5IT0A 2MSSA 5KFJA 2BKOA 2FY8A 2B4PA 4B3OB 3OLBA 2I38A 3PZPA 2FPHX 1DTQA 2RF2B 1HYSA 2KT3A 2R7XA 1DQAA 3QRRA 2F63A 4JI4J 3MUTP 3BPDA 3TYTA 2IYGA 3EE3A 5CYJA 4IG0B 4MKVA 1QSYA 2DGOA 3ET6A 5KFIA 2MQLA 1HW8A 4DCJB 5KFZA 4KHRA 5J2QA 4M8LA 1BQMA 4F0MA 3QT7A 1NCLA 1A9NB 2LEAA 5HSPA 4JI5F 1N36F 3SCLE 1WELA 1WI8A 2BE9B 2K06A 3VWSA 4PWDA 1RHQB 2QMWA 4QOTA 2CNKB 4A8MP 1FWPA 1UEKA 4DJBA 5ETQA 1NJZA 3ULHA 2EG2A 1VHFA 2DIUA 2E29A 4WBFA 3CD6S 3DKDA 4QR0A 4YB5A 2B5JB 2H5JB 2VDIA 1KHWA 3KK3B 3QSYB 3MI7X 4PXBA 4IUFA 3OVBA 1EHWA 2CYYA 4B02A 1VS3A 1M5SA 5IT4A 1FDAA 1PJ5A 2ZC3A 1FDBA 4RNMA 4GVBB 4MK9A 2J0SD 3MMBA 2IIHA 5LMNF 2NXNA 5KT3A 4DFJA 3MM7A 4KGXB 3OUYB 3OXGA 1SXLA 5E2QA 3KHHA 4LJMA 4RLEA 3Q23A 3H5UA 1S7HA 4R8UA 3IM8A 2VBZA 3R6LB 1YQHA 1FD8A 1KWMA 1NZAA 4F4AA 2YXLA 2MKKA 1RT4B 3LP2B 1VBYA 1XIQA 2KL8A 4F4YA 4F67A 1HNIB 1EX8A 2BZ2A 3HD2A 2DJWA 2FJXA 1J5OA 4CLLA 1FEHA 3G8QA 2J9CA 4J9MA 1EQMA 5ETMA 3PX6A 1LFWA 5KFHA 3MOZA 4A4JA 1TK5A 3KJNB 4KO0B 4CLTA 1CJKA 4USJC 2QSWA 3AODA 2R8JA 1Q5YA 1Y11A 1M5VC 3EGVA 4QIGA 1HBOA 1Q8BA 1U0SA 3KG1A 2CQBA 1CC7A 5B0FA 4NLPA 2HFZA 2HIQA 5IWAF 2B4UA 5ETOA 1FX2A 4U9RA 4X66F 4NOHA 1FXDA 2B6AA 4Q8EA 5AXKA 3QJJA 2W4CA 1G7CB 3DLEB 4MKAA 4OYPA 2HQGA 4IOCQ 2LVWA 4X62J 3PW5A 2MZQA 2UXCF 1JQGA 1M1KT 1BQNA 2OD4A 3EJMA 4U7UD 3NOGA 4I69A 3GP9A 1T9TA 4J9SA 1VR6A 1KN6A 1LXJA 1OQ6A 2J6SA 3KUHA 3OJUA 1C4AA 2G4BA 1HWUA 2Z58B 4CLPA 1JX4A 3QWPA 2DR7A 1B7FA 4R0JA 4P75A 3DFEA 1T05B 1ZM3A 3KLEB 3NY0A 2RS2A 1V5IB 2KHCA 3TAMA 1XJWB 3OTOJ 5I3UB 4C0OC 2HKEA 4ICLB 1Q53A 3MMCA 3PIPQ 2FDNA 4OI4A 2DT9A 1NK6A 4DUYJ 1FVSA 3IWNC 3ZZPA 1N48A 4KPCA 4R5PA 4NZ6A 1RTJA 2UXBJ 4EO8A 1N54B 1GXLA 4WE1B 1K47A 3JSMA 1URRA 1VQLS 2DB1A 2FC8A 1UFWA 3MURP 1NKBA 5C24A 1BWVA 1UZDA 1S6QB 3IRXA 3MPWA 3TUIC 3PCOB 4RUCA 3HD1A 3EUNA 4RNOA 3TJ9A 3A1YG 5T14A 5KFGA 4GKJF 1GNKA 3I5CA 1N6QB 2M52A 3UE2A 2C3OA 4ANCA 5DQIA 1HPZB 1X4FA 3SZ2A 2RQCA 2D69A 4OYAA 3MEEB 2D9PA 1O51A 1H2VZ 2ZHBA 2MHNA 3M2UB 1YZ6A 4IOAQ 2YKAA 4OYBA 2E5LJ 2V8HA 4IH5A 1KQGB 2OSRA 4DPUA 4J91A 3TVZA 1Q5VA 2AV5A 4NLYA 3EVWA 4NPOA 2W7OA 1VRUB 4QWDA 3TA2A 2OP5A 2VPYB 3FZ2A 2FLNA 3MM5B 1C1BB 4K4YA 1IKXB 2VG6A 2XQCA 1UCNA 2DITA 2V4RA 4QQBA 3PV8A 3DYAB 2J8SA 3IS9A 2M0GB 3ZTPA 3R5AA 3W7BA 4ZVOB 3UN5A 3JYTA 4FYVB 1R3NA 4YHHJ 4KHPJ 2FC9A 3BYPA 3JQJA 4JI6F 4DL2A 1FWLA 1HNZJ 1ZAVA 3LA0A 4PRFA 2D41A 1X5SA 2CAJA 4RW4A 4FP9A 3UD4P 4JI3F 2ZUGA 3OD2A 3BSCA 1RAFB 5KOXA 3OR2A 1WHYA 4ILRA 2CJKA 2VKRA 4NMLA 3LH2S 1IBLJ 2DH9A 2V4JA 5DDQC 3MEGB 5C25B 2LECA 4KV8B 3MTJA 3BREA 2F4VJ 4K4XA 4J9KA 3KXDA 4KHMA 1CBKA 2BKPA 5D8HB 5FIIA 3RW7A 3ZNJ1 1KDNA 3FQLA 1XMQJ 3O5TB 1KD1T 4B3RJ 1RT2B 3GV5B 4DV3J 2EPIA 4D3GA 1REVA 1S1XB 1JLEA 1HR0F 4LMZA 4F8RA 4F36A 4MK7A 2FUG9 2V6AA 3NOCA 1VQ5S 2IMOA 5GAEU 1JLAB 4KFBA 4FZVA 4LFCJ 3KJVB 1S1UB 1RAEB 1HNXJ 2B0GA 2F9DA 1E6VA 2B7CB 2QA2A 2DNGA 2KRRA 3DDKA 2VQFJ 1FRKA 4OX6A 4DN9A 2J6TA 3J7Z5 4ELVA 2R7OA 2A6OA 3G2XA 2YKPA 4CLWA 1S0MA 1LWXA 2BM1A 3MAAA 3TR5A 1UVKA 4ZPDA 4OJHA 3VZIA 5IC4B 2IA6A 3IG1B 2QMXA 2GIRA 4BWJA 3VAJA 1HW9A 4B9MA 4G3IA 1UA0A 2BQ3A 3HSJA 5KFFA 5K20B 4B9TA 1M90T 2DRAA 4B9VA 4CH1A 2KZZA 2LFVA 2MQMA 4RU2A 4DSKA 4NZ7A 2KXHA 5IC6B 5KFOA 1U09A 4Q43A 4OYXA 3FC9A 3V4IB 1N34J 2C3YA 3TEGA 1F9HA 4TU7A 2K2PA 4A48A 5HROA 2UXDF 1KR4A 1RYSA 1X9WA 2RDIA 2EC2A 2WK4A 2B9EA 1M1HA 5F3TA 5D4LA 2FYXA 1EP4B 4Y2MA 2FVSA 5ETKA 4ZP8A 5IOLA 1Q8LA 4H4MB 2HRYA 3KLGB 4ALZA 2ZH9A 1PAUB 1T9WA 5A8KB 3IR5B 4ZIWA 5E3RA 2V8GA 4F4KA 1U1MA 1C0UB 1YBTA 2EC0A 1UW9A 1JK9B 1GMWA 3HSZA 2VG7B 5JVGQ 3N6LA 1S72S 4L76A 4LVOP 3M2RA 1VRTB 3CDWA 2X3DA 4B3MJ 5CYQB 4BC9A 4NWBA 4ECRA 1FTCA 1HFEL 8RUCA 4PQAA 2C1EB 2WOMA 1WEXA 2DCUB 2WVDA 3EDQB 1FJ7A 4OZJA 5BYRA 3NEKA 3ZZ0A 3ILIA 5CYMB 4GRSA 3CD7A 4I6YA 3G96A 4ZVFA 4LSLA 3FSYA 1IKYB 3GCXP 5KFMA 4I7FA 4ENOA 4B3SJ 4FPRA 1NZ8A 1SKUB 5MLCV 4RNNA 4FS2A 1L3KA 1P9YA 4HDGA 3T5LA 3PO4A 2QGFB 1TFYA 2XS2A 2Q6BA 1HQUB 4K4SA 1U0HB 5DS7A 3IR7B 3UDCA 2A3JA 4DR6F 3VQSA 5JJBA 2HQDA 2JJ4D 3A3OB 3A8EA 5HQMA 4I67A 2JZ5A 2F5GA 3LPYA 2F8EX 3PACA 2Y1RI 1UEVA 2IRYA 5HMYA 4CZCA 5HLFA 4N7TA 1A0OB 1RBAA 4KKOA 4QCLA 4YY3J 4DQIA 4FXDA 5GAHI 4DV5F 3V81A 4Q8FA 1Q95G 4H4OA 4NASA 4K0KF 4WFYA 2WB1D 3SV3A 4NXMF 3Q8PB 4KB7A 1OO0B 3Q2SC 2UUCF 5I3PA 1CS4A 1DTQB 3BF4A 1HYSB 3DLBA 3NGUA 4QWEA 1HHTP 3TARA 2A2DA 2AD9A 1IWGA 4JP8A 5CD4A 3EWGA 2YNFA 3A4TA 2VHGA 1EIYB 4I56A 1GAOA 2XHWA 3KLIA 2DR8A 2Y9HA 3L9ZA 2UUBJ 4I2QB 3CC7S 3ZTOA 2AJQA 4WYLA 4HACA 4EZ6A 3RB6A 2XCPA 5J2QB 1TL1A 2XY5A 4RBVA 1D3WA 2F7VA 3JQKA 1BQMB 5KFSA 5C7PA 3ILJA 3ZO7A 4FVCA 4WK1A 2FLOA 1RQ0A 3LWMA 5B0CA 3K5OA 1Y7PA 4WPAA 1SJ3P 4PWDB 1RLCL 3DCAA 1H7WA 4PXCA 3OFFA 3JSRA 2YQ1A 1GH8A 3V6HA 2PFFB 1FD2A 2DH8A 1N5TA 5JUMA 1RA6A 1NK9A 2BABA 2ZBQA 4NA1A 1AYEA 4RJVA 2K7JA 2G2OA 3VQTA 1KVKA 9ATCB 1Y5LB 3THVA 1RTDA 3MMBB 1BWEA 1NDCA 3W3SA 3C66A 1FFWB 4O0IA 2R8HA 1TUWA 3HFZB 4ED3A 2F1FA 3M2VA 1NH7A 3MM7B 4LFBJ 2LDIA 3VVTA 3G6ES 5LMUF 2P9CA 1FFSB 2HNDA 4A8KA 3DLHA 3TANA 5I42A 3TUZC 2E1AA 1UWBA 4R8UB 3M8SA 4CLFA 1RT1A 4CH0S 2DKOB 3FCVA 2EFPA 1VBZA 4HTIA 2ZH3A 3US5A 3W8PA 1TELA 4LF9F 2HHWA 1KTQA 1X4DA 1YTYA 4JYAJ 3HVWA 1NB2A 1J5OB 2JC0A 2LCWA 4QR1A 2YY3A 2HS3A 2CQDA 4G65A 1Q8KA 4ZOSA 2VOPA 4NYZA 3BGUA 4ZPWR 2RIJA 1CJKB 1X60A 4QIVA 2KXNB 1Q86T 2G0CA 1JXLA 4DR1J 2UV8G 4PG8A 1MN7A 1HBOB 1DHMA 1TKDA 3W64A 1HNWJ 3O6QA 2E9RX 2QYGA 2IAJA 2IHR1 2EKNA 4EBDA 3UN3A 3K17A 3MPYA 2PC6A 4OX9J 1Y10A 4XPEA 5HAOA 3RR8A 2B6AB 1OJ4A 3H5SA 5D77A 3BO4A 2PFDA 1W2BR 4P74A 3ELHA 3RU0A 1AT1B 1B99A 1BQNB 3TJ8A 1ZTWA 2MY8A 1TU0B 5D3GA 2MYFA 2HNYA 5F41A 2EBEA 4DPWA 4E98A 1VK8A 4W92B 5D0HA 3CXCR 4DR4F 1T95A 4AT1B 2VL1A 2QX0A 4IRCA 4U8VA 5E3PA 1GMWD 1GFWB 4C11A 5KT5A 5KFPA 2VPXB 5ETVA 4DL3A 4QIFA 3T6BA 4NA3A 3MMCB 2VC1A 4OHZA 1VQPS 3CJ3A 2RMLA 3ZTQA 4EUVA 5CZXA 3AFGA 4PG6A 3DHXA 2XULA 1QSSA 4R5PB 1MSWD 1RTJB 1NHUA 3CMAS 1T9VA 4JI5J 4XPCA 2ASYA 3JSMB 3T1YJ 3E51A 3U1LA 4J90A 1N36J 5C24B 2MZJA 3HCXA 1HNVA 3IRXB 2ZM6F 2GA7A 2MY7A 2RHQB 3C2PA 4OHXA 5HJXA 1C2PA 6FD1A 5HL7Q 3DLJA 2BKNA 2PD1A 4RNFA 1S79A 4L72B 1LW2A 1U4BA 5CZVA 3RZAA 3CNQP 2G1HA 3U1NA 4RX6A 2GQ2A 3LGNA 1UJ4A 5BR8F 4ECSA 3CCVS 1SJRA 4ES2A 2H54B 1SVDA 4A8QA 3AT1B 2HHTA 4X65F 5LMNJ 1NO8A 2BV3A 3MPDA 4B17A 1YK9A 1WEZA 1SJ4P 2VG6B 3GFXA 3GQCA 2YWGA 3MCSA 1D8ZA 2IRXA 4EWTA 2GVZA 1F5AA 2Z2YB 4EBEA 4X4PA 3N01A 2HZCA 3JYTB 3RRGA 2FZGB 4X4OA 1S4EA 5SUHA 1T94A 1S7IA 2AHOB 1GMVA 3ENWA 5KT4A 4F26A 3ZZTA 5D6GA 5KG2A 5J2PA 4RW4B 2JRSA 5EX3A 3OL7A 1JNZB 3OR2B 3PEHA 2VQEJ 1S9FA 2DIVA 1VLYA 2QIFA 2G9OA 2V4JB 2HW3A 1QUPA 1R89A 4WWSA 3CMQA 5ETNA 3HLUA 1RWKB 2E9ZA 1F3VA 2HS0A 3B82A 2K1RA 1URNA 4IR9A 2QSFA 3LGMA 2WSFC 4QR2A 4ZVRB 5IWAJ 4DMZA 2CQIA 1FRXA 2ZNYA 4MT1A 3QJLA 2OPSB 2UUAJ 1REVB 1JLEB 1S6UA 4X66J 1VBXA 4WXOA 3N6MA 1S10A 3CCTA 1FJGF 4C8OA 2EWHA 2HHQA 2X1GA 3IC1A 5B0GA 1E6VB 4ED0A 4MK8A 2E5GA 3DOLA 5B09A 5CHCB 4YUDA 2ACMA 3L95X 1D8YA 3GV7B 1U2FA 1N88A 5EX0A 3MAAB 1WG5A 1NK4A 3VGTA 3I32A 4N56A 1CQMA 3OXLA 2BA9A 4NZ0A 4CLZA 4RW6A 1Q7LB 1RT5A 1QJHA 2GV1A 5HMWA 3OTCA 2V94A 1FT8A 2N4CA 2X1AA 3U27A 3UQSA 1VBKA 4BCAA 1EKRA 1JKHB 2HBYB 4Y28C 2PEHA 3V5RA 2ZJQQ 3M8RA 4N41A 3JAMU 2AWZA 1QVFR 3AJ1A 2OEJA 4DV0F 5D78A 5HROB 1TUVA 1IKWA 5A6PA 5LT5A 1JWWA 2XYHB 2DHHA 2MPUA 2A2CA 2CJBA 2PO4A 2LQJA 1V3RA 2O5DA 4OZLA 4NXNF 5H9FJ 4O3OA 5ADZA 1DBDA 2V34A 2HAIA 2Y0SD 1U26A 1NDPA 4Y0FA 4UOGA 4RUHA 1S1VA 2GZOA 3CO0P 3M2RB 2QLJB 1WDDA 1GXTA 2DBBA 3C14A 2RQ4A 4ED6A 4NA2A 1WF2A 2WOMB 3OLAA 4C8ZA 4ILLA 4JI8F 4DX5A 2XY6A 1WOPA 4W90B 1J5EF 4DV6F 4DPTA 2E1RA 4LSLB 4X4TA 2AYMA 5KFNA 3TI0A 2MQ8A 4UY8T 2M4MA 1YJWS 3D3BJ 4I7FB 4N47A 2X1BA 3HHDA 1UETA 4P2MA 2NS1B 2BRLA 4JI6J 3M9OB 4WXWA 1MG7A 2LXFA 3G6VA 3HVAA 4JI3J 3ZTSA 2ZH6A 1BY9A 4WK3A 2HGLA 2FQQB 4IOBA 3K0JA 3QT8A 3KK2A 5AXLA 5T7LA 2CQ0A 1KLMA 4A47A 1BMQB 4NLDA 3PDNA 3D68A 4K4ZA 1XR5A 5LJ3Y 1NB7A 3P5TL 1CULA 1TUGB 1N32F 3ZNUA 2VJUA 1YIJS 1IJEB 1YWXA 5HLFB 2Y3YA 4KKOB 3PRDA 4C0BA 4QU7A 5KFRA 2OI2A 1JLQA 3V81B 2W2MP 4IR1A 2JH3A 3FCHA 3QGPA 4H4OB 1KNZA 3E01B 2ZC4A 1X5TA 1S99A 2BEFA 2R8KA 3CCQS 4HYKA 1QAXA 4CRJA 1YJTA 4GKKF 3TP2A 1ZH5A 4NCGA 2KI2A 3LQVA 1CS4B 3WC2A 4G1QA 5KFUA 2IBKA 4FNIA 4X4SA 4NLRA 3H2VE 2MQOA 2RHSB 5D15A 2J7WA 2DD8S 4PWWA 4C98A 2W2QP 4FS1A 1KOHA 1XR7A 1PSDA 3BGLA 2YNFB 1L3UA 4RW7A 3KLIB 4ZPAA 5F8MA 2O66A 4I0WA 4OJGA 3K7RA 3V6DA 4HACB 3W65A 2K8GA 1BUXA 2KVQE 3QIDA 1TL1B 2H9ZA 1YBUA 3DRPA 3Q22A 3NGKA 1EARA 1N5YA 2JEFA 2WVCA 1VC6A 4DS5A 1KFSA 4ZVTB 1Z2LA 4P2FA 3FBFA 4DV7F 4CM0A 4LF4F 4DX6A 5GAEI 5IT9Y 3TZZA 4CTAA 1X4GA 2J9DA 2B8QA 1VFJA 3R5JB 3R6GB 2PN6A 5EWEA 2ZH2A 2UXDJ 3FUYA 2FY1A 2E7XA 3M8WA 3H5XA 4QWBA 4DX8H 4OFZA 1BGXT 5KG4A 3LOUA 2QRRA 3RYLA 4O3PA 1FNXH 4LBPA 3VR1A 4C97A 2ZJRQ 4NLGA 3S7RA 4NEZA 4CDIA 3DU5A 1RTDB 2VPWB 1QAJA 2XC9A 2CPJA 3QGGA 1SIWB 2NXUA 1ZYQA 3M2VB 2U2FA 3RBEA 2G1DA 1I6JA 1H98A 2Q3PA 4OYWA 3HSDA 1XNRF 2R2RA 3PW2A 2IY5B 3CCLS 2EBGA 3SEOA 3VV2B 4FYXB 4DG1A 1UWBB 5IXUA 2QE5A 3ZC4A 2W1BA 2CQ4A 3OFEA 2DNMA 2BJDA 3BSNA 5HQLA 2AEFA 3NG8A 2OJ3A 1RT1B 1X4EA 1RZMA 4P2SA 2HK3A 3T19A 5HK4A 1HWLA 2GIFA 3Q8UA 4KT0C 4PUOA 1MWYA 4JI2F 2PGCA 3RW6A 5B0BA 1HI1A 1J2VA 3HPOA 2YKNA 3BH7B 5K9FA 4C3MA 4ZPVR 3O1LA 2HZVA 5EWFA 4J9OA 3VGUA 4K2JA 1K1QA 1CSJA 4J9QA 2YNGA 1DURA 4Q7AA 4DR5F 2EFQA 5M2UA 4DR6J 2DO4A 1I5OB 1F2GA 4F3OA 2UVRA 4YB6A 4DN0A 2IAJB 2QL7B 1KEKA 1SV5A 1VIOA 2JEIA 3R5BA 4ZPTR 1UA1A 4RBUA 4HHUA 3NNHA 1OS5A 2JWNA 1VLOA 5HJYA 4Q5VA 3ZFVA 5KG3A 2CPIA 4F0HA 5GMEA 1PYSB 1U25A 2J9EA 4GVBA 1MN9A 4ZS6A 4WFNQ 4M94A 4K0KJ 1K9MT 2WW8A 4NXMJ 1YRTA 2HNYB 2VOOA 3R5DA 3LTOA 3D6FB 1PYTA 3W2VA 2H3EB 4RPFA 2Q6CA 1GEHA 4AD6A 1PCAA 1F3FA 4K5RA 2V2QA 4CM2A 1ZPVA 2XY7A 1WC3A 1UVMA 4C11B 1NU4A 1UMJA 1N52B 3HHEA 2J0WA 3TZYA 2P6TA 2DY1A 3M6WA 3KG4A 1D9AA 3N5BA 2HHHF 3FRZA 4YB7A 4KAIA 3HHLA 5HBMA 4WFBQ 4TXSA 1QSLA 1FRJA 1S97A 3TUPA 1JJ2R 3I55S 3CB4A 4I2PA 5LXYA 3R2CJ 4ECZA 4CO5A 2PI5A 1UVNA 2ADCA 4C8MA 1WSRA 1LW2B 3H42A 4ZVQB 1RACB 3CMES 2VZ9A 3SFUA 3WDOA 2Q79A 3IGVA 2PI4A 1FRMA 4LR9A 2PEBA 1GX5A 3MDFA 1UAWA 4DCOB 2F8MA 3UCZP 2D3UA 1NBEB 1ZZFA 3IBWA 5CAAA 1NHVA 2CRLA 3D1QA 5KFXA 4C8NA 2ZZMA 4X4VA 2MTLA 4C3LA 2CJQA 2B9YA 2C2EA 4KSEB 4DHVA 4QZVB 1T05A 2GO8A 4IRDA 1SH0A 3S01A 3UFCX 1IKVA 3GIRA 4M95A 1R43A 3N28A 3ICLA 2GVZB 5HN0A 3MFHA 3W9JA 5DLGA 4O4GA 2SXLA 2WRMA 1OQ3A 3DI6A 4LF9J 1B64A 4AL7A 2M8HA 5H9FK 1R8HA 5G0RA 3OBIA 2GFFA 2QLXA 4ECTA 4WFZA 3QZ7A 3VAIA 3PO5A 5J2PB 2VFTA 3QSIA 1VC5A 3FRYA 1BC6A 3TVYA 4O3NA 3T9NA 3FEZA 1FE4A 1WKLA 2IM0A 1RT6A 4DPYA 1PILA 2ZH1A 5EWGA 3T6JA 1K1SA 2K1RB 2IYIA 5M2PA 2RILA 2P5VA 2CPEA 2F3JA 4OYMA 2HBQB 1XK8A 1RU2A 4EU0A 4LQ3A 3U7JA 4L73A 2XI3A 2YWKA 4ZJOA 1ROFA 1R8AA 1H0HB 2L9WA 2KDOA 1C0TB 2PA8D 2YX7A 4NLOA 3CD0A 3VCDA 1HD0A 1X4CA 3ETOA 4J9NA 1DTTA 3DOLB 4UQGA 3FJ2A 1SC6A 2DHSA 1P27B 2O01C 1K0VA 4NMXA 3C3LA 1DQ8A 1SC1B 2C2MB 4CO4A 1X5PA 2LA6A 2RRNA 1C1BA 5GMKa 4PG5A 5B0AA 3CCWA 1G2EA 3H25A 1U48A 3KHLA 1XN9A 3T1AA 4RW6B 3G4SS 2MHEA 2FD2A 1RT5B 1U8SA 4PG4A 2CVIA 2YX1A 3MR7A 1FNOA 2XS7A 1U6BA 4ZIVA 4DLGA 2LQ8A 1G1XA 2UU9F 5KFDA 4C9DA 4GO5X 3PFOA 3NWRA 3DRSA 2HBZB 1WC6A 4TN2A 1WC1A 4LSZB 5DGBA 2ASJA 3H7HB 3TEHB 3C6UA 3GIMA 4ZVGA 3MEGA 4KV8A 1T02A 2PSZA 1Q16B 3EDRB 2ZM6J 5KG7A 1CC8A 1IKWB 1YBAA 3NCQA 1QAIA 4A8XA 1HARA 3H40A 2IJRA 3HO1A 1DQ9A 1ZBTA 4DUZF 2XGPA 1U49A 2B7BB 3BO3A 1FRIA 4USHA 3I0SB 4ZLNA 2GQQA 3M05A 1RHKB 3MECA 4USVA 4ER8A 2HGNA 1R0AA 2ZZTA 3TWZA 3PHEA 5IQQA 4DR3F 2O3DA 1OY6A 1S1VB 3PNIA 5EHHA 1U2CA 4F3QA 3HVTA 5KFEA 2OO4A 3HKZD 2W7PA 2UVVA 4HT5A 1X7VA 5HO4A 2DCLA 1H3DA 3C14B 1FNMA 3MPVA 3CJKB 4X65J 1KBRA 1D9DA 1F0XA 3AY0A 5L46A 5AJ3J 3ILLA 2VONA 2OTJS 2ZFHA 4KRWA 4J9PA 3K89A 1H38A 3OSNA 3MR5A 4F7VA 4QIEA 3I9V9 1Z1ZA 3GJRB 2XNQA 3LP1A 3CGIA 3C15A 4AL5A 5D0EA 2OAUA 4L74A 5DGAA 3AAWB 3NBPA 3GFHA 3KLHA 2QLFB 1T8EA 4MTPA 4ZVHA 1LWEB 5ETLA 4KYZA 4IO1A 1U45A 3AHPA 2XSFA 1RGVA 4NLQA 2HVDA 3MHYA 2RUGA 3CCUS 1WG4A 5A6WA 3G82A 4KGMA 4OX8A 1JJ4A 2W8KA 4M5HA 3KK2B 3J81Y 5T7LB 2C2DA 2FJEB 1KLMB 2XO7A 3KHRA 4X4QA 1CULB 3OV7A 4QPTA 2EFGA 1U2RA 2N3OA 1EP4A 2NUHA 1L5UA 2V9KA 4DR2F 4C8LA 4USTA 2D1CA 2OPRA 2V2VA 3LO3A 2Z2MA 4ZCMA 2VBYA 3MM8A 1FJGJ 3RAQA 3BO2A 1C0UA 2BOPA 1S76D 1FFGB 1TL5A 4K2XA 3RB0A 2Z2ZA 3M8YA 4NCGB 4USIA 5D4OA 3VAFA 1EKSA 5FLXU 1FJCA 4P10A 1VQYA 3W61A 1G6BA 3HULA 4EZ9A 1MWZA 4K8RA 1SIZA 1NSAA 4AXJA 2MLYA 1P1LA 1U1OA 3UD3P 2B4VA 4BLGA 2OKQA 3ENVA 5CYMA 3QZ8A 4DDFA 3TZXA 4Y2KA 2KHDA 5KFQA 4LF7F 3NNCA 2FJBB 3QFHA 2GCFA 4LF1A 3BBFA 4P73A 3V6DB 2BJEA 2AJ1A 3DRPB 4Q45A 2B8PA 2HVHA 4DL7A 4PG7A 3AJDA 1YI2S 4C8YA 3ZZRA 3PYFA 2ZBRA 1FERA 5B7WA 1LWFB 3D2WA 1U0HA 3J7AN 2QC3A 4JI4F 3DDNA 3DM2A 2C2OB 3R7SB 1BHNA 1YRUA 3CWJA 4WF9Q 4CTAB 3UCUP 3DHWC 4DV0J 2RUSA 3DOMA 1ULRA 1VQMS 2Q66A 4C0HA 5GVQA 3PR5B 2N4DA 2NR0A 1LOUA 3BN7A 5J2MA 2LLZA 4M1KA 4R25A 2Z56B 5HVGA 3Q8RB 2FZKB 1O6XA 4ZDNA 1WTBA 5CCMA 3MUMP 2RS8A 3PX4A 3MZIA 4Y65A 2DEJA 2XMVA 3HDSA 2CJXB 3AH6A 5FJ4A 4B9SA 4QYZJ 4ECVA 2MKSA 4F4ZA 4YDXA 1YJRA 3EVOA 4DG1B 3NS5A 4HH0A 4XIUA 3THTA 2OPPA 5A8WA 4Z7YA 2G13A 4DL4A 4K50A 3N79A 2KRBA 4ECWA 1TK0A 4DV6J 3A8JA 1NDLA 4I2QA 1S1TA 3Q8SB 1QDUB 1GTEA 1F60B 4PUOB 3D6MB 1RT7A 2GX8A 3UVJA 3CT9A 3Q0AA 2MKJA 1RCXB 2YKNB 3OTBA 4DQRA 4DWIA 5JMNA 5E3QA 4GO7X 4KH0B 4E2FB 2AYGA 2YNGB 5F9NA 2K3KA 4YFUA 2ZNZA 4UOHA 3KK1A 2J0QD 3TUJC 3IR6B 4PYAA 1XWLA 4O44B 3KUGA 2LQ9A 3FBCA 1M5HA 4FYWB 2UUTA 2ZD1A 5CXTA 4WIIA 2CZVC 1SV5B 2U1AA 2NQPA 3OW2R 4WFAQ 2H65B 3HJVA 3CE8A 2XMKA 1N32J 4ZLLA 3O44A 4DSJA 5K5MA 3GYGA 2IVFB 1HA1A 4N8NA 1P8GA 2DNQA 3KMSA 4OHYA 4CQ1A 1EAYC 1I3OB 1HLWA 4ECQA 1LNQA 1WOSA 4OQJA 4MKBA 1IBKJ 2GJIA 5U47A 4HEA9 1ZA1B 3FMWA 2FGOA 2OGUA 4MKYA 2L41A 1WF0A 2A18A 2Y1LB 4BS2A 1TAQA 1U6FA 4N77A 3M32A 4FVMA 2FHJA 2CPFA 3AXKA 2RAQA 4IH7A 4ZHRA 1CLFA 3NS6A 3W2VB 2DNNA 4OZ3A 1SJFA 3VVUA 4UY85 4ELTA 1JJCB 3KKFA 2IM3A 2B51A 2PA3A 4PEOA 3PFEA 3UNGC 4LRCA 4QYRA 3W9HA 4ZMMA 5LM7E 1PIEA 4BDPA 1LWCA 3FEYB 4MIAA 2DGUA 5D0RA 4TNOA 4C48A 3R7BB 3HZEA 1VQOS 2MKHA 3IWXA 2CQ2A 3QIPA 5HI7A 1WORA 4I64A 4X84A 4RWWA 2MLZA 2IPOB 4FDFA 4ED2A 1U6ZA 3N9UC 1VK3A 3HHLB 5HBMB 2JVOA 4U8YA 3RAMA 3IM9A 1PC5A 4DV7J 2OPQA 4LF4J 4I2PB 1S0OA 2BBEA 2GNKA 3AOAA 2XSJA 4W98A 3H2LA 2ROGA 5KFKA 3OTOF 2NYHA 3WIUA 3A12A 3SCIE 1VYAA 3U02A 1MMDA 4FKYA 1JLCB 4P72A 4LRDA 2RDDA 3GB0A 1IWAA 3HSGA 1F9FA 8ATCB 4EYHB 3WBZA 4RO0A 2CPDA 1TL7B 3M9NB 3UWTA 5HVHA 2HVIA 3TA1A 2W25A 3QATA 2ZHAA 3HVRA 4OYOA 3W8GA 3M8ZA 2ROEA 2ZBPA 3QQCD 1B7YB 4TYBA 3RAXA 3PR4A 3PYDA 1T0TV 4HVZA 4OHWA 4NI2A 3SQOP 3AJ2A 3EXCX 1ZM2A 2I5JB 3PX0A 4ECXA 2MGZA 3HP6A 3Q8YA 2NPFA 3MAHA 3MR3A 4ETXA 1XNRJ 2XLIA 3D0GE 1IKVB 3J81U 2L3MA 3J7YU 5DG7A 4L75A 3MCOA 5EGYA 4YR0A 1UVJA 3LWLA 4LF5F 5EDWA 2FVQA 1VQNS 1H72C 4O4GB 4JV2A 5DRKA 3MEDB 1SBRA 3UDEA 4M5DB 2E5LF 3DI6B 4YB1P 2JLGA 1RABB 1UP1A 2NXJA 4OJ3A 4JI2J 2QLWA 3HM9A 5G0RB 2YH0A 4YN3B 2DYAA 1TMJA 4IKAA 3H90A 3CD5A 9RUBA 1FJEB 4OL8A 2EVZA 3P45B 3W63A 2GVDA 4DR5J 1RT6B 2YBVA 2RH3A 1KLNA 2QN6B 3SCJE 1QE1A 2HK2A 3RRHA 2D7SA 1R6VA 2HHPA 4KY3A 2FIUA 2V2ZA 2RSQA 3I56S 1IQZA 1RTIA 4YHHF 1W2IA 2D3O1 2VB6A 1N5SA 2OSQA 2VPZB 3ENAA 4C7QA 1MLAA 2VIHA 5AE2A 2AGOA 1H2TZ 3D1OA 3OT9A 5F9LA 3VTIA 4WU3A 2CQ1A 4HH1A 4B3TJ 3T1HF 4OLPA 1K0TA 1DTTB 2C28A 3BS9A 3RRKA 1X5OA 3B4DA 5KT6A 2F4VF 2YWEA 3UDVA 5CQGA 1U7LA 5KG6A 2Q43A 1MW7A 1KQKA 4U96A 3D6HB 2VDHA 2RT3A 4CO3A 3CJ8A 4N76A 2DTJA 2ZKUA 4K7QA 4UZBA 4IFVA 1FDNA 2GHPA 4NLTA 3KOAA 3EYZA 1T3OA 4LFCF 1ACMB 4ITSA 2CZ4A 4PXDA 3HHLC 2BM0A 3QWUA 3W5XA 2V9WA 5A0YB 3BGFA 2DGXA 3DRSB 5KAKA 2GMLA 3FEXB 3GZ7A 4PCQA 4DOZA 4G1PA 1B0VA 1YJ7A 1YJNS 4DL5A 3C6UB 2MXYA 2XS5A 3DNCA 4J9UE 2VODA 5GAGU 1FX4A 3J80Y 3GYNA 3H59A 3PJWA 1D09B 4ED5A 4EEYA 2NUUG 1ZM9A 3LAKA 2Y1JA 3OVAA 3KYLA 3MOJB 3ADAC 2NXEA 1OPZA 3GWCA 5H1SV 2WCXA 4CI0B 2OPSA 1MMNA 2WVEA 1VMBA 4NYOA 2E7VA 1X0FA 1S4FA 2EFOA 3MECB 3DRXA 2ASDA 3I5AA 4DPXA 1R0AB 3QLHA 1RWPB 5LJ5Y 1YZ7A 3UI3A 4RU9A 3TW0A 1XQIA 2DR6A 3HVTB 1UW4A 3GTYX 1TV6A 3QMQA 4FXWA 2HFUA 1FDDA 2ZWPA 1S1WA 1RSCA 3F73A 3PHTA 1U1RA 3KHGA 4AUKA 1VHIA 5K8PA 3I9ZA 4OZNA 1VQKS 1AUSL 3C6TA 1HMVA 2LKZA 4FPIA 2MDAA 2R7UA 2V5HG 1VDHA 5L1JA 2HBRB 3LP1B 3DXBA 3C15B 4URGA 1HL6A 3NBPB 2QYCA 1S9GA 3KLHB 4FF2A 2IMWP 3M7VA 4TVAB 2FHJD 4PYDA 5ETSA 2R2SA 4K59A 4Z7CA 1JKHA 4TYAA 4PQUA 2KXFA 1IR2A 3D3CJ 4I1TA 3JTPA 4OJ1A 1VQ7S 1S77D 1BLUA 4OYIA 3IWLA 3G82B 5LSLA 2XMWA 4CNZA 1NJIT 4HI1A 5A8RA 2JOQA 3A3PB 3M6XA 1KKHA 4ZVSB 1RYRA 2W7AA 5C2CA 2HLUA 4X64J 2ZZNA 2V69A 2VD3A 3MWBA 2XMAA 2I0XA 1SQFA 3PVXA 5AE1A 4RW8A 2O67A 4Q2LA 3EZ5A 5J1NA 1DARA 1S5ZA 2AX1A 3GIJA 2G0JA 3QYYA 1KC8T 1H6KX 1IM6A 2OPRB 4Y6IA 1H7XA 3TVKA 3MM8B 4TQSA 1RCOB 2P6SA 3G8SA 4EYIB 1X9MA 1NHKL 3H98A 2IDEA 1N33J 3FBBA 1RWVB 3GR0A 2W9AA 2XMUA 1U1LA 1R7IA 1ZAWA 7AT1B 1HBNA 2ZOGA 3SCKE 3EX7B 1KVJA 4YMEA 3HT3A 4F4XA 3MGJA 1RHRB 3JQMA 1NXIA 4LREA 2QMUB 1I94F 4OI6A 3NGTA 4QIWD 1FCAA 4TKTA 4K4VA 3QT6A 1ZOTA 4XO0A 4LBIA 2UU9J 3D66A 5IZHA 2DNOA 2YTCA 2WSCC 4U67Q 3D0HE 1HKAA 1VIXA 3DM2B 3DGPA 3KMQA 2C2NA 5CA5A 2VH7A 4WIQA 3L7PA 2H4WB 1ZM4A 5AE3A 5DDPC 3DOMB 2ATCB 3OTDA 2HVEA 3LP0A 4I68A 4C2MA 2P2CB 1NPRA 4O3RA 5J2MB 3BSAA 3M9MB 2EK6A 2JDJA 4DL6A 4DUZJ 3C46A 3EVMA 4RNHA 4IG3A 2ZH4A 2YKQA 3G71S 1IQTA 3K5MA 1DRZA 4RBTA 3GR1A 3OL9A 1OMSA 3E01A 1RLDA 4HR2A 4Q0BA 3TZWA 3Q86A 4ZLJA 2VV5A 4CT8A 3C16B 3G87A 4M63A 2F40A 4USMA 4BBYA 1PBAA 3I0RA 5KFVA 4HT7A 3CDEA 4RR5A 1NSKL 3THPA 2XG8A 4OI1A 2IC3A 3T41A 2HQIA 2D3OR 2V50A 3N6NA 5G4DA 4FYDA 1BXNA 3CJ2A 3TOQA 1NPKA 1YGYA 2OPPB 5A8WB 5DZ6A 4WCEQ 1T7PA 1NRKA 1RK8A 1SL0A 4JI0J 1NSQA 4PABA 1S1TB 2HURA 5K8NA 3P3DA 4PWUA 2BW7A 4LF2A 1VQ6S 4FF4A 4KGVB 1RT7B 2AT1B 3UVJB 3KJFB 4NYPA 2RKIA 5KT7A 1EZZB 4DBQA 1KSPA 3JSBA 1Z4UA 3MM9A 2E66A 4LFBF 2GJFA 5KT2A 1RADB 2DXEA 3FCWA 1PYOB 2ZBIA 3KK1B 1O5JA 3PW4A 1MROA 2V67A 1VJQA 2ZD1B 4M5KA 3AB4B 1VQ8S 2BDPA 1ZETA 2CJAA 2FGCA 4ED7A 3PIOQ 4DV1J 1APSA 1UZHA 1PJ7A 3HFVA 3LAMA 4NRTA 1N5VA 4JYAF 2PDAA 1BD6A 4U7CA 1U1QA 1FTRA 1N56A 4LR8A 4NLVA 4KE5A 2KM8C 3HKWA 1RA7A 3LGHA 2NSBA 7FD1A 1VOMA 4OZ1A 1T9XA 3JAMY 1YHQS 4LFAF 2CNOB 3M32B 4A8YA 2KVIA 2YNHA 3OJSA 3G8TA 4ZHRB 4RUBA 1W7WA 1VI7A 2XMMA 3S6EA 3LF0A 2MKCA 2FJVA 5LSRA 2WTFA 4F4WA 5IFMA 3GG0A 2QL5B 3PJ9A 3J80U 4QJVA 2HVZA 2E5HA 1Q4RA 3QO9A 4FXVA 3RGIA 1LWCB 1REGX 4LF7J 2HYIB 4PR6A 1RAHB 3JS9A 3BKFA 1VGYA 1IJFB 3DXSX 2W4PA 4KH1B 2OMOA 4J9LA 2CNNB 3JTOA 3QIPB 4ID5A 2BJ9A 4K5SA 1EQ0A 2V8DA 3TX0A 4ZCKA 2JEJA 3D6TB 4NLSA 2DXDA 3BYRA 3BGOP 5HQ8A 2AYBA 2H48B 5AT1B 2GS8A 2XYGB 2CNLB 2YQ0A 2OPQB 2E1CA 2G2YA 1UKUA 3MTKA 4UUWA 2GJ2A 2ZOFA 2XSJB 4AYBD 1GXUA 2UZAA 3RJMB 1FEEA 2VC0A 1ICEB 2V8VA 2RNEA 3KNAA 2C3MA 2YKMA 1TKTA 3L09A 2FVRA 4ERDA 1L3VA 2NZCA 3P6YC 5C5JA 5J1PA 2Y0BB 4A8SA 2W4DA 3LPEA 1AFJA 1WJ9A 3T1YF 3GFYA 3IAS9 3GIKA 2JNJA 3M8QA 2KB2A 4NCAA 2NXCA 2MZ1A 1ZZNA 4NI2B 3CCMS 2CXEA 3GILA 1FWKA 1WNEA 1TMMA 2LEBA 2ZEJA 2MGZB 5E0OA 3NS7B 4LQ9A 1DFDA 4YR3A 3A8IA 4CLSA 3POTA 3A13A 2DNKA 3CO9A 2AGPA 1RWNB 1FK9A 4B9UA 4MYUA 1IR1A 4ZITA 4DU8A 3OTEA 3CJ5A 4OYZA 4OI0A 5SZTA 1HWIA 3ETMA 4DU7A 4F2SA 2BYCA 1U24A 3NP5A 4CP5A 2HGMA 1AROP 2XMJA 1UJ6A 1Q7YT 4USKA 1AZSB 1SJ1A 4CO0A 3BKTA 2XGQA 3IMQJ 3DMJA 5L1LA 5KFLA 4IH6A 1J27A 2DH7A 2RJZA 4ES3A 3MD3A 2L48A 2OLWA 5C42A 3PG9A 1NEEA 1NUEA 2X7IA 3H8YA 2GVDB 2PIIA 3PYEA 1I51B 3NMAA 3FBEA 2HMIA 1QE1B 3HK2A 1HQEB 1CPZA 1KONA 1GQEA 3SSRA 5HP1A 2KKHA 3D1HA 3DLGA 1RTIB 3KLVA 1YG0A 2CWKA 1RJJA 2HNZA 3TA0A 2VUGA 3CULA 1K8AT 1WSVA 4NEYA 3MCMA 3EZOA 5DZ7A 3MFIA 3N0VA 4HLBA 3RB4A 3PYGA 1VCTA 2LA4A 3HX9A 2VQEF 1Y3KA 3SSQA 1FKAF 3O3LA 4A8WA 2DXFA 3PW7A 4UOFA 3P5BP 2B4OA 3GSIA 2E9TA 3V2UC 2M7SA 2V4QA 1SUQA 2AU0A 2J9DE 2OD6A 4TY8A 4LVNP 5KFAA 1IVZA 2UUAF 1LK5A 2QA4S 2LP4A 2MKIA 2C2RA 2JLFA 2B9WA 4IFVB 1O8BA 3GJTB 5AXNA 2BANB 3VAMA 2CZ9A 4ZP7A 3RBZA 3IP0A 1KVIA 4DF4A 4MJKA 4JV1A 2ZDPA 4CO2A 2DGVA 4V19J 1A6LA 2WW4A 6FDRA 1WTFA 1RAJA 2CPYA 1Z2ZA 4UQTA 4CCHA 3B8HA 1GK8A 1NDKA 3PJXA 1WC4A 3CSKA 2ALYB 3Q8VA 2CQGA 2MJNA 3FFIA 3OVSA 4ZJQA 1Q79A 4X4RA 1VJWA 1WKKA 2KZMA 2LXUA 1SL1A 1S59A 3IO1A 2HZAA 4FBTA 3A8KA 2M9KA 3QLHB 1B70B 2YVSA 2QFJA 1C0TA 5F8IA 1TKZA 1SKSA 4FF3A 5F0WA 3SI8A 2UXCJ 1Q81T 1R6YA 2VBXA 3OQ2A 1TV6B 5M2RA 2CQ3A 3F56A 1S1WB 2BACA 5F8HA 4YEAA 2NYIA 1RWMB 4G1IA 3IA0A 3DC2A 3DU6A 3KWMA 3C6TB 2XWYA 1HMVB 1Y0HA 1JB0C 2CQHA 5ETRA 3IBCB 3T5HA 2AGQA 4S0MA 3M6UA 2H51B 2DEIA 4LF5J 3TX8A 2Z57B 1P6TA 1X4HA 3NRBA 1S9GB 2KYZA 1NM2A 5K8OA 4O3SA 5RUBA 1M5PC 4ANEA 2YPZA 4JB8B 1U47A 1BQXA 1YITS 2DO0A 2DISA 2J5AA 4DV4F 1PBUA 1B4SA 2OTLS 4ZVPB 4PQUB 3VGVA 2UVWA 1XERA 3AB2B 3R1HA 1Q8IA 1KQFB 1S9EA 3SMZA 3FGVA 1AXQA 3JSYA 2Z30B 2R7VA 5A8RB 3E3XA 2EK1A 4GVLA 2E7WA 2XO6A 3NGRA 2M5YA 4JOUA 3RG6A 3W2WA 2HQ3A 2V63A 5GADU 2CKWA 5B0EA 2VBWA 4H54A 4RW8B 1UEUA 4WU2A 4GKJJ 4DQPA 4WJBA 2F8HA 4QBUA 3I0SA 3NL0A 1ZS6A 4DX7A 2F65A 3SQGA 2LMIA 2HHVA 1T03A 3J7YI 4XAKA 4P7VA 2DNYA 2YH1A 2MZTA 5KFBA 4LRAA 3UR3C 1BE4A 4NCBA 4WP3A 4JV5F 3IBFB 3T1HJ 3IFEA 1QY7A 3DDIA 1HBNB 1YDLA 3CJKA 3L3CA 2HAFA 3QT5A 2FJWA 2MKYA 3MMJA 3R27A 4WKYA 1XMBA 4TLQA 4MYTA 1ELOA 4ZKAA 2RU3A 2XBPA 2J7KA 1UL3A 1FHTA 2EW9A 2W9CA 5LOQA 1DJ0A 2AJ4A 6AT1B 1W26A 4CH7A 1LWEA 5DO2A 4N5SA 2R2UA 4LRBA 1S49A 4I4BA 3I6PA 3BM7A 4URQU 3R7NB 5B08A 2ACYA 3GE9A 2KO1A 5BJRA 1V3ZA 1RU1A 2RDJA 4LF8F 1IBMF 1SB6A 3V6JA 4LR7A 3DGPB 3UN2A 4XDCA 2MQQA 3UPFA 2OEMA 1WWHA 3HF5A 1TKXA 3W60A 4B9NA 3LP0B 2BQRA 1FRHA 2FB0A 3MF5A 4V1Ak 1F5BA 4IG3B 2IM2A 1HR0J 3VGSA 3IN5A 2KJVA 3PXGa 4PPDA 3BJYA 3LW5C 4Q0BB 4HTJA 4WKRA 1MMLA 5H9EJ 4OHVA 5DQHA 2A10A 3VZHA 1R0BG 1FO1A 5KOWA 2LYVA 3DRYA 2J7UA 3I0RB 1SCJB 2XZDB 4DL0C 3L4BC 2VJVA 2IC3B 1E6YA 1F6TA 3D0IE 5DG9A 4CLKA 1KTVA 2QA4G 1S48A 3CDUA 2EXUA 2PT0A 2NREA 4A8FA 3RTVA 4KGZB 2YNIA 3NMRA 2Y8YA 5KFCA 2IVYA 2HWIA 1OSDA 4YR2A 3NAIA 1OY9A 5GAGI 3X3UA 2RKIB 4I6AA 2E5IA 4I6WA 4WTOB 4IDKA 3MM9B 1NPPA 1SC3B 3FVYA 3QFWA 2QFIA 4F04B 1LWFA 3KTQA 3QAUA 3T9ZA 2R7SA 2BXJA 2FVCA 2P9EA 3HT0A 1MNEA 2ZHOA 2CVEA 1Y4ZB 1LV5A 1MROB 1XR6A 4ETZA 1CVJA 1NJWA 2MZRA 3CTRA 3G6XA 5KG0A 2G2ZA 1JXVA 1TL3A 2FVPA 3OL8A 4DSLA 4F25A 1XEZA 3CC4S 2HPUA 2C2KB 1YJ9S 2EG1A 2HFVA 3OFHA 5E7OB 1MU2A 1R8BA 2M88A 4TU8A 2RQMA 1XBWA 3O8WA 5JVHQ 3GONA 1WC0A 1YJUA 4CLUA 1HIYA 2DR5A 1UPPA 1C4CA 3K5NA 2YNHB 1HBMA 2ILZA 3P8BB 4PXEA 4JI7F 1RAGB 2QEXS 2WAQD 3VALA 2LXIA 4A46A 2GAHC 3BV8A 1FKOB 3Q24A 2J76E 5T41A 4DSIA 2X51A 2BJ3A 1U02A 4LSNA 3IRWP 1V9OA 3NXZA 3QO9B 4ELUA 4X4NA 2OIHA 5A2QY 2MEWA 4L3KA 2ABYA 3UDLA 4AFFA 1VQ9S 2QT7A 2XHCA 4DLEA 1I94J 4DUTA 2ZDOA 4KBIA 3R9LA 5IM0A 4ID5B 2W24A 4P9SA 1EJ7L 3PEJA 1S6PA 1RHJB 3CPWR 3TJAA 2AX0A 3BB5A 2POKA 4F50A 3W9IA 1S6OA 2A6MA 1WDTA 2H4YB 4O44A 1YRXA 1B0TA 2BJ7A 4OI3A 3MM6A 5BYSA 5ITHA 2WSEC 3B78A 3NKYA 4HI2A 2O1PA 3ET6B 1GTHA 2YKMB 1F9EB 4ID8A 1TKTB 1HI8A 4EFAC 3FZBA 3OSPA 4M5LA 3EZUA 4DV5J 1HHSA 4AQYF 2X3GA 4H4KA 2GGPA 2AJFE 1UPMB 3CJQA 4BWMA 2CA9A 2MZSA 3M6VA 3F44A 3M8QB 4N8OA 4DXLA 1HHQA 2JL9A 3CCSS 5F8GA 2MLXA 2W2OP 2VFUA 2R8GA 5FD1A 2UUCJ 5E3AA 3HHKA 3PM9A 1G4CA 1F2HA 3EPGA 3D5MA 1S57A 1P1TA 1Q0NA 1PC4A 3POTB 2R7QA 3QGIA 1FVQA 3ZZOA 3N5FA 1FK9B 4IYQA 1PGZA 3KLFA 1KRPA 1PKUA 4A8OA 2JVRA 1KHVA 2ILYA 4Y34A 1NK7A 1RXOB 1JMTA 5DLFA 1RTHA 3BR8A 5HMXA 3FSIA 3GJSB 4WZMA 1WG1A 5E33A 2QV6A 5FLXY 1GT8A 4D3HA 3GV8B 3DMJB 1B0PA 3RBDA 3SXLA 1YSJA 1QM9A 4AL6A 1NKEA 5C42B 3NAHA 2C2ZB 4FBUA 1DLOA 3ZZZA 3CUNA 3AD8C 2FHOB 4Q44A 3OR1A 5F8LA 2HMIB 4W4MA 2VKZG 3E2EA 2KU7A 2HS4A 3FK4A 5HP1B 3DLGB 1FKPA 3CCZA 1JLCA 1PG5B 2BE2A 3I4PA 3G6YA 1H2UX 5FDLA 2IM1A 2UV8A 4EO6A 2HNZB 1RBOB 2KG0A 1TL7A 4DSEA 1FESA 3NCRA 1DY3A 2YX4A 3K57A 2V0NA 2VA2A 2UVUA 3CJ0A 1FI4A 4CYUA 1Y9OA 2QA1A 3KDOA 4ZN3A 1SKWA 2I5JA 4LFAJ 2BJ8A 3B4MA 5ETPA 1L3SA 1JJHA 5LMUJ 2XWXA 4OLOA 2R2TA 1GX6A 1SUQB 3MEKA 3EGNA 1XMOF 3M8PA 4TY8B 3K58A 5DDRC 2VICA 1JLFA 4CIOA 3SFGA 2W9BA 3EXYA 3EICA 2AW0A 2BRKA 1X4AA 3CDAA 2DHAA 3MEDA 4ZP6A 4M5DA 2EFVA 3WQPA 2HWHA 1VQ4S 3ITHA 1WC5A 1NMEB 2ZE2A 1N0VC 4O0NA 4RZRA 2M2BA 1TR0A 4EGLA 4G6VB 5F8JA 3HI9A 4DR7F 3WX8A 5LL6d 2OUGA 1HBUA 1TK8A 3QRQA 4C8KA 1WEYA 2RU9A 5A76A 1O0PA 3QNWB 4ZN1A 4QU6A 1AFIA 1TTHB 3BEGB 3BGRA 1LK7A 2BW2A 1FF2A 2IRUA 1UVIA 3QAEA 4B08A 4EK2A 5F3ZA 2MQPA 1M0SA 3DLKA 3TAMB 2R8IA 1X4BA 3FFIB 2OELA 1YVFA 1SQEA 2R3VA 3W66A 1D1UA 1WOOA 3BPSP 3GG1A 4C3KA 1KP6A 3T5KA 2AMCB 3AD9C 4DCPB 1TKZB 3H4BA 2Y1IA 1X0PA 3O2IA 3FMBA 1LW0A 1OY8A 4NL5A 1U8WA 3BBBA 3DN9A 4WZQA 4Y00A 1HQ2A 4DZDA 2JFKA 1SKRA 4DR4J 1WI6A 2VFRA 5AXMA 3D4JA 2DRBA 1NLKL 5L9XA 4WYWA 2Z8QA 4IRKA 2QTWA 3PY8A 2HIYA 4F2RA 2B3TB 4DQQA 2XB2D 3R2DJ 5MAOA 5A0YA 2PE8A 5H9EK 4UUXA 1RT3A 1IUJA 1WD6A 1XNQF 2XI2A 1S9EB 3MMAA 5AJ3F 2WBRA 2D9OA 4HHHA 3Q89A 3T5JA 3RBXA 3FNNA 1X9SA 3W2WB 5K8MA 4LF6F 2J0XA 3RB3A 1RAIB 1H74A 3IS9B 3NGDA 2ZITA 2LQ5A 3CJSA 1KOOA 1LFPA 3GLJA 2DHGA 3PKYA 3K59A 4JI1F 5A2QU 1U1NA 3SQGB 4CO1A 3ZTRA 4FF1A 1XTZA 1T03B 1Q1KA 4XK8C 1JIHA 2XTJP 5BR8J 4LRFA 4ATNA 2RVJA 1EETA 5HATA 1UVLA 4DFPA 5J1EA 4RW9A 2CIMA 1RAOA 3NNAA 5C2GA 2FHKA 4R0EA 3I82A 1T11A 1DZ5A 4QWAA 3PRVA 3RUBL 1TAUA 1WHWA 1RWWB
chains in the Genus database with same CATH topology
1PAEX 1WKLA 1ZS6A 3L7UA 1HLWA 4WBFA 3VGUA 5C7PA 3DKDA 5CAAA 1HIYA 2NCKL 3JS9A 4HR2A 4W98A 3Q86A 2CWKA 1EHWA 5BXIA 3Q89A 1NDLA 4S0MA 3ELHA 3FKBA 3GPAA 1VYAA 1BE4A 1B99A 1BHNA 2DYAA 4FKYA 3FCVA 1K44A 2ZUAA 1KDNA 3ZTSA 3EICA 3EVWA 3EE3A 2VU5A 2DXDA 4DZ6A 3NGTA 1NSKL 3DDIA 1U8WA 1NDPA 1NDKA 1XQIA 4ANEA 3B6BA 3VGTA 1BUXA 2AZ3A 3BBBA 3VVUA 3Q8VA 1NB2A 4UOGA 4FKXA 1HHQA 4C6AA 4KPCA 4F36A 4O0NA 1S5ZA 1NPKA 1B4SA 3EM1A 3VGSA 3BH6B 1UCNA 3FC9A 4ANDA 2DXFA 3VGVA 3ZTRA 4UOHA 4UOFA 1NSPA 1WKKA 3ETMA 4DI6A 4ENOA 3WX8A 2AZ1A 1NCLA 1S59A 3NGUA 4CP5A 4DUTA 1NSQA 3FBCA 3BBCA 1MN9A 3R9LA 2HURA 3ZTPA 2HVDA 1NLKL 1S57A 3B54A 2DY9A 3FBFA 3NGSA 1JXVA 3Q83A 1WKJA 1MN7A 1NHKL 3Q8YA 3NGRA 1W7WA 3FBBA 3Q8UA 5IOLA 1NDCA 2HVEA 3BBFA 3EJMA 3ENAA 4EK2A 2BEFA 4F4AA 1PKUA 1F6TA 3ZTQA 3EMTA 2B8QA 3G2XA 1NUEA 3GP9A 3MPDA 2BX6A 3ZTOA 4ANCA 5CABA 1XIQA 3PRVA 1LWXA 1LEOA 2B8PA 3BH7B 2DXEA 3FCWA 3PJ9A 3EVMA 3FBEA 3VVTA 3EVOA 1F3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAE X;  1WKL A;  1ZS6 A;  3L7U A;  1HLW A;  4WBF A;  3VGU A;  5C7P A;  3DKD A;  5CAA A;  1HIY A;  2NCK L;  3JS9 A;  4HR2 A;  4W98 A;  3Q86 A;  2CWK A;  1EHW A;  5BXI A;  3Q89 A;  1NDL A;  4S0M A;  3ELH A;  3FKB A;  3GPA A;  1VYA A;  1BE4 A;  1B99 A;  1BHN A;  2DYA A;  4FKY A;  3FCV A;  1K44 A;  2ZUA A;  1KDN A;  3ZTS A;  3EIC A;  3EVW A;  3EE3 A;  2VU5 A;  2DXD A;  4DZ6 A;  3NGT A;  1NSK L;  3DDI A;  1U8W A;  1NDP A;  1NDK A;  1XQI A;  4ANE A;  3B6B A;  3VGT A;  1BUX A;  2AZ3 A;  3BBB A;  3VVU A;  3Q8V A;  1NB2 A;  4UOG A;  4FKX A;  1HHQ A;  4C6A A;  4KPC A;  4F36 A;  4O0N A;  1S5Z A;  1NPK A;  1B4S A;  3EM1 A;  3VGS A;  3BH6 B;  1UCN A;  3FC9 A;  4AND A;  2DXF A;  3VGV A;  3ZTR A;  4UOH A;  4UOF A;  1NSP A;  1WKK A;  3ETM A;  4DI6 A;  4ENO A;  3WX8 A;  2AZ1 A;  1NCL A;  1S59 A;  3NGU A;  4CP5 A;  4DUT A;  1NSQ A;  3FBC A;  3BBC A;  1MN9 A;  3R9L A;  2HUR A;  3ZTP A;  2HVD A;  1NLK L;  1S57 A;  3B54 A;  2DY9 A;  3FBF A;  3NGS A;  1JXV A;  3Q83 A;  1WKJ A;  1MN7 A;  1NHK L;  3Q8Y A;  3NGR A;  1W7W A;  3FBB A;  3Q8U A;  5IOL A;  1NDC A;  2HVE A;  3BBF A;  3EJM A;  3ENA A;  4EK2 A;  2BEF A;  4F4A A;  1PKU A;  1F6T A;  3ZTQ A;  3EMT A;  2B8Q A;  3G2X A;  1NUE A;  3GP9 A;  3MPD A;  2BX6 A;  3ZTO A;  4ANC A;  5CAB A;  1XIQ A;  3PRV A;  1LWX A;  1LEO A;  2B8P A;  3BH7 B;  2DXE A;  3FCW A;  3PJ9 A;  3EVM A;  3FBE A;  3VVT A;  3EVO A;  1F3F A; 
#chains in the Genus database with same CATH topology
 5CD4 H;  2W01 A;  3MCN A;  1V3S A;  2JC1 A;  4DV2 F;  2LEP A;  5E5N A;  1B3T A;  2W9C B;  1H73 A;  4NX9 A;  4PPZ A;  3DRR A;  4ZPB A;  2CDQ A;  5DET A;  3P49 B;  3W5Y A;  1RP5 A;  4LIW A;  4KFB B;  2DGT A;  1YLX A;  3ENQ A;  3CCE S;  2JEG A;  2CUY A;  2IJF A;  5J2N A;  4C6A A;  2IJN A;  2HFN A;  3V4M A;  4YDD B;  4LUB A;  1IXK A;  1TFW A;  4M5G A;  3DOK A;  2AZ1 A;  1UTA A;  2DNR A;  1RUS A;  3K2Y A;  5KG5 A;  1U1K A;  1TVR A;  2KFY A;  4KIA A;  1TKX B;  2AP6 A;  3ONQ A;  4YQW A;  3TO8 A;  4GMK A;  2R9L A;  1HWJ A;  1JNR B;  4IQX A;  2ADB A;  1SH2 A;  4MFB A;  3BDP A;  3Q8Q B;  3EMT A;  2VG5 A;  3V6K A;  4P71 A;  1LEO A;  5L9N A;  3MAQ A;  4MAK A;  1XC9 A;  2OML A;  3P4U B;  4K4W A;  4X2B A;  3L7U A;  2VAS A;  2HLT A;  4J9V A;  4Y2C A;  3JXO A;  1N8R T;  2XZW A;  4J9R A;  2XCA A;  3I5B A;  2DPJ A;  4CT9 A;  5KFT A;  2KN4 A;  2QO3 A;  2CQP A;  4B9L A;  5D0G A;  5IQ6 A;  1E6Y B;  2YWW A;  2LQB A;  1Y5N B;  2CQC A;  2BQU A;  4P2X A;  1CJU A;  4USW A;  2FLL A;  3I31 A;  2QJ3 A;  4ED8 A;  3RR7 A;  2ZKT A;  4J5O A;  3AQO A;  5EUH A;  2YNI B;  4OX7 A;  2XEX A;  1NAQ A;  2GO9 A;  1T9Y A;  1V6H A;  4MMO A;  1UFL A;  1D9F A;  2CDR B;  2HSE B;  2Z0G A;  5E3C A;  2KT2 A;  2IFX A;  2CAD A;  1QUV A;  2EFN A;  1VIS A;  3PTW A;  3TAP A;  4IDK B;  3ZZY A;  4DV4 J;  2I8E A;  3ILO A;  2HRU A;  4ED1 A;  5HVF A;  1S12 A;  3K8V A;  2B9X A;  3GJQ B;  3BQ0 A;  3X1L B;  5KG1 A;  1RWU A;  2JLE A;  2BR0 A;  4KR0 B;  1ZTT A;  1RI7 A;  3ISN D;  3CED A;  4BHQ A;  5D4P A;  2Z2L A;  1CJV A;  3QBC A;  2DR9 A;  1QAY A;  2R7T A;  1Q78 A;  3IGN A;  1TL3 B;  2ROP A;  3CJR A;  1IN0 A;  3AA9 A;  3AOC A;  3P96 A;  3G86 A;  1T9U A;  1OPI A;  3ISZ A;  4NXN J;  2DGQ A;  5EN1 A;  1MU2 B;  4OZ0 A;  1SPB P;  3KUE A;  5E41 A;  3C16 A;  1ZAX A;  2H1Y A;  2I2Y A;  4CLY A;  3TRG A;  3LUY A;  3M4X A;  5K14 A;  4UW2 A;  1OIA A;  1UFK A;  4IFY A;  4JV5 J;  3AA8 A;  1W25 A;  1HBM B;  2L08 A;  1R0C B;  3I96 A;  3VAG A;  2CPX A;  2YPY A;  4ZJL A;  3CC2 S;  4ED4 A;  3C8Y A;  1F1B B;  2HHU A;  2N7C A;  3E8O A;  3BZQ A;  4JI8 J;  3D9B A;  4E8U A;  2AKW B;  2HFS A;  4LSN B;  3K8W A;  1JLG A;  4UOC A;  1J5E J;  2XZT B;  2ZJP Q;  3H0P A;  2KFZ A;  2P9G A;  3HFK A;  1WHV A;  3UO0 A;  1IBK F;  2NPI A;  3SDE A;  2I1R A;  4J7C A;  5CCL A;  2GC8 A;  3NCP A;  1YX2 A;  5IM0 B;  4IQM A;  5GAD I;  3R3T A;  4ES1 A;  1S6P B;  1CJT A;  4BC7 A;  3JB9 k;  3GPA A;  2ZH5 A;  2FHM A;  5KFW A;  3CIZ A;  3H4D A;  3MD1 A;  1FA0 A;  1AW0 A;  2W8L A;  5KTQ A;  5HAN A;  4LF8 J;  1IBM J;  1U1P A;  1CQN A;  2HQF A;  3D7S B;  4IO9 Q;  4FKX A;  3MXH P;  4GC6 A;  2VA3 A;  2AEJ A;  3H5Y A;  3MM6 B;  4P7T A;  2I6W A;  4EMD A;  4ZP9 A;  2ZH8 A;  3TQ1 A;  4WFX A;  2CPH A;  3R1L A;  4FN5 A;  4JBC A;  2FJA B;  1NKC A;  3D54 A;  3BR9 A;  2CWX A;  4E0D A;  3KG0 A;  3KFW X;  2WON A;  4JV0 A;  3M30 A;  2GGP B;  1NND A;  1WHX A;  2W2N P;  4PAA A;  1OSC A;  2AEM A;  4O4R A;  3HXM A;  1FXR A;  4YS2 A;  1C1C A;  4GKK J;  1D0E A;  1RHM B;  2JFD A;  3M1V A;  4O3Q A;  4MH8 A;  1TQL A;  2NLW A;  4Y2A A;  4L3N A;  2JSX A;  3J7A 1;  3WC0 A;  3UD5 A;  1AB8 A;  2CFX A;  3MR6 A;  2BMB A;  2P8I A;  3WIV A;  2CJ9 A;  1JLB A;  3KLF B;  2R42 A;  2PMH A;  1X8D A;  2DPI A;  4LT6 A;  3MPU B;  1M5K C;  3BSO A;  2AJ0 A;  3CCJ S;  3OXF A;  3CIM A;  4X62 F;  1RTH B;  2KTQ A;  4RKU C;  1CEZ A;  5DJB A;  4HDH A;  1WAC A;  4Q2M A;  4NLX A;  2AJ2 A;  4B3O A;  2BVZ A;  3R8Y A;  4QPX A;  1WUU A;  3GII A;  2EI5 A;  2RF2 A;  3B54 A;  2WBM A;  3NGS A;  2HND B;  5I42 B;  1DLO B;  2C3P A;  4CNY A;  3OR1 B;  5L8R C;  1AUD A;  3SYZ A;  1FE0 A;  1FRL A;  2XMT A;  3MUV P;  4IG0 A;  3TAQ A;  2B56 A;  2CG4 A;  1FKP B;  2E5J A;  2BE2 B;  2I9S A;  5FDL B;  4DUY F;  4KPY A;  1TL4 A;  4RUA A;  2UXB F;  2DGS A;  4J37 A;  4HKQ A;  5I4M A;  3UCG A;  4OV6 A;  2MMY A;  3LAN A;  4CYU B;  4DSF A;  2DHX A;  3LAL A;  2EEY A;  2GMH A;  3FSX A;  3PKM A;  4AND A;  4JI7 J;  2G0I A;  2RRB A;  1NSP A;  2UUW A;  2HEK A;  2A1B A;  4Z2X A;  3M8P B;  4NLU A;  2B5J A;  1HWK A;  2DNH A;  3KK3 A;  1JLF B;  2W9B B;  2NZ4 A;  4X4U A;  2Z4P A;  2HWT A;  1TZ0 A;  3QGH A;  3JTN A;  1Y00 A;  4URS A;  3NLC A;  1ZPW X;  3ITH B;  3D67 A;  5CAB A;  2ZE2 B;  4LBH A;  4B3T F;  3D28 A;  4EBC A;  1RDR A;  1AZS A;  1P9Q C;  1R8C A;  2RQK A;  4ZLP A;  3PW0 A;  5D3G B;  2DK2 A;  1HBU B;  3OUY A;  5IV4 A;  1F5C A;  1SI9 A;  3W5Z A;  3GSD A;  5DM6 Q;  4FYY B;  2HG4 A;  3BGR B;  4OZ5 A;  3SIP B;  4CWB A;  3BN4 A;  4C4W A;  1GMU A;  2RD5 C;  1IR0 A;  3AQP A;  3DLK B;  3J7Z T;  1IM4 A;  1HQE A;  2DNL A;  5B0D A;  3UW1 A;  3T3F A;  3FQK A;  1EB0 A;  3WHI A;  4H4K C;  4KHP F;  1RT4 A;  3L7O A;  3LP2 A;  5L38 A;  1SC4 B;  4DS4 A;  2DRD A;  1HNI A;  5IS2 A;  4MIB A;  1HNZ F;  4WP8 A;  2H5E A;  2EKY A;  1M1G A;  1R31 A;  5CH7 B;  2KJW A;  4AQY J;  2QLB B;  2OFG X;  2DY9 A;  4LIR A;  3EPI A;  1LW0 B;  3R5C A;  1IBL F;  4KO0 A;  4ZK7 M;  2PMW A;  1HNV B;  3CVK A;  4QW8 A;  2J8A A;  2GAG C;  3ZXW A;  2J6U A;  4XTT A;  2ALZ A;  1NJX A;  1SL2 A;  3EGW B;  1XMQ F;  4OV1 A;  1WF1 A;  4B3R F;  1QD1 A;  2QZ8 A;  2V2K A;  4DFM A;  4DV3 F;  4F0K A;  1T3N A;  3SSS A;  2YKO A;  1ZA2 B;  4K4U A;  4KTQ A;  4PZV A;  2BE7 D;  3HZG A;  3DLE A;  2BAN A;  2VF3 A;  1KFD A;  1LKZ A;  4RWX A;  5BYQ A;  1HNX F;  3C19 A;  1N0U A;  3WX4 A;  1PJ6 A;  2GIQ A;  3HHN B;  3SBM A;  2VQF F;  4KJI A;  2HHH J;  1RT3 B;  4OMF G;  3HJF A;  2FLP A;  3MMA B;  4QWC A;  3BKU A;  2JHE A;  4YP3 A;  1NK0 A;  3KLE A;  4O23 A;  2ATL A;  3H20 A;  4GC7 A;  2AIR B;  2HQC A;  3BQ1 A;  1JXE A;  1NK8 A;  1RIS A;  2ZOM A;  3UNY A;  1S0N A;  5I3U A;  4Z37 A;  2OFH X;  3TQE A;  3F0N A;  1SH3 A;  4ILM A;  4ICL A;  3AXM A;  2C22 A;  4NRU A;  2F4F A;  5JXS A;  2GQC A;  2CJY B;  1DAX A;  4KC5 A;  7FDR A;  1YJV A;  3R5G A;  1L3T A;  1OYE A;  3SV4 A;  5LXR A;  4WE1 A;  2HHS A;  2A0F B;  2NCK L;  1EET B;  3FDS A;  2AF6 A;  2B43 A;  3U1M A;  4KQZ A;  1RAA B;  2YQ3 A;  1N34 F;  5J1E B;  4RW9 B;  4DEZ A;  3HMJ G;  2HFO A;  1S6Q A;  3VHQ A;  4X64 F;  3OPK A;  1Y5I B;  1CG2 A;  8AT1 B;  4AXI A;  4OIX A;  3B6B A;  4U7U K;  2C3U A;  2GW8 A;  4TQR A;  3ISN C;  3W1Y C;  1N6Q A;  1XMO J;  1HPZ A;  4DPO A;  4RL1 A;  3OHA A;  5HMZ A;  2KG1 A;  3CW2 C;  1HI0 P;  1LQ9 A;  2R7R A;  4K4T A;  2K3I A;  3MEE A;  4ECU A;  3W62 A;  4L6V 3;  2IDL A;  3DRR B;  3Q2T C;  3M2U A;  3OL6 A;  4NE9 C;  4UF4 A;  1N4L A;  2XLK A;  4U95 A;  1RB0 A;  2YWH A;  1N33 F;  2ZBC A;  1N5Q A;  2XLJ A;  4B3M F;  5J2N B;  2BX6 A;  1YKW A;  2ZVI A;  2D3Z A;  4DR7 J;  1VRU A;  1R27 B;  5IV3 A;  2QG9 B;  5GAH U;  1RE1 B;  3VF0 B;  3DOK B;  3MM5 A;  1G3O A;  4OI2 A;  1IKX A;  1RWO B;  2HRT A;  5D4N A;  2ASL A;  4QYZ K;  3GYX B;  2DVI A;  5IT9 U;  1TVR B;  3UR0 A;  1RBL A;  3CJT A;  2ERR A;  1RKI A;  4MIW A;  2IBO A;  1NH8 A;  3DYA A;  4WTY A;  3FKB A;  2AYE A;  2VFS A;  1RKJ A;  4MFB B;  2XYP B;  4B3S F;  2FZC B;  3A3N B;  2C42 A;  1VQS A;  1OWX A;  3DLL Q;  2WHO A;  2ZUA A;  1NJY A;  2VG5 B;  3H2U B;  4DZ6 A;  3F41 A;  3I87 A;  2UP1 A;  3QPI A;  1Q82 T;  3EGZ A;  3KDN A;  1I1G A;  5DDO C;  2BUN A;  1KQS R;  2KH9 A;  2E1M C;  5KFY A;  3AOB A;  2KM8 B;  2GMJ A;  5F0U A;  1RWX B;  3AD7 C;  2CG8 A;  5C25 A;  2D74 B;  4ZPC A;  4ZVU B;  2COL A;  1M5O C;  1KS2 A;  2R7W A;  1CJU B;  2AQ4 A;  2W2P P;  2OH2 A;  1IBC B;  2FJD B;  1FXL A;  2X1F A;  3QRP A;  1V5V A;  4DFK A;  4YY3 F;  1MWQ A;  1RT2 A;  4JUZ A;  3BQ2 A;  3GFZ A;  2LU2 A;  1S1X A;  2GHV C;  4FNH A;  1UWA A;  2N3L A;  3GU0 A;  2N7Y A;  3DGV A;  4M5M A;  3S8S A;  3GMG A;  1JLA A;  5L1K A;  4V19 X;  2OHD A;  4F3M A;  4USU A;  2RE1 A;  2DGW A;  2ZVS A;  3KJV A;  1S1U A;  4ZA1 A;  2NSC A;  2WVF A;  2L9N A;  3KNG A;  2M8D B;  1NK5 A;  3MR2 A;  2Y8W A;  2VU5 A;  2XNR A;  1XNQ J;  2FTR A;  3CCR S;  1UJ5 A;  1QTN B;  3EM1 A;  1CJV B;  2BOA A;  2UUB F;  4JI0 F;  4DI6 A;  4LF6 J;  3IG1 A;  3NWG A;  1AA1 B;  1PO6 A;  2L9D A;  2E44 A;  4M5J A;  4TY9 A;  2PMZ D;  4UT4 A;  4DQS A;  1WKJ A;  3OHB A;  4PKD B;  4JI1 J;  1Y3J A;  4XDD A;  3N4W A;  3I4H X;  2KYX A;  4DR3 J;  2MST A;  2R4F A;  1QVG R;  3K5L A;  1PAE X;  5K14 B;  4ZVE A;  4IFY B;  2YWF A;  3WZ0 A;  4Y2I A;  2N82 B;  4ZCI A;  1RHU B;  2GHW A;  3V4I A;  2WZ1 A;  5I3Q A;  2JX2 A;  5BXI A;  1RTZ A;  3VAK A;  4U6P A;  2OEK A;  5F8N A;  5ETT A;  4DV1 F;  1A7G E;  2V68 A;  2CPZ A;  4M5N A;  1K44 A;  4M5I A;  5DM7 Q;  2WB4 A;  1JLG B;  3BDE A;  2F9J A;  4KGK A;  3J81 j;  3R97 A;  4H4M A;  1JLQ B;  3VAH A;  3KLG A;  4DV2 J;  3HHL D;  2AZ3 A;  5A8K A;  4DF8 A;  3SDE B;  4EI2 A;  3PRB A;  1ITP A;  2IA0 A;  2BJ1 A;  2RB7 A;  4ECY A;  2IVM A;  3TNV A;  2V8P A;  5LSO A;  4F02 A;  1CJT B;  2VG7 A;  2MQN A;  4UTG A;  3BBC A;  1TP7 A;  3GCW P;  1VRT A;  4P6Q A;  4AE5 A;  5CYQ A;  4G1Q B;  2E1P A;  3CF5 Q;  3Q83 A;  2ZWO A;  4OZ2 A;  2WVB A;  2VFV A;  3CJ4 A;  1VRQ C;  3IAM 9;  3QJP A;  4TLR A;  4TU9 A;  3IXQ A;  1OYD A;  1X31 C;  4RW7 B;  3ZZU A;  2K7K A;  1IKY A;  1LXN A;  1SQG A;  3S1T A;  3G9C A;  1QTM A;  2WON B;  4DR2 J;  3K5P A;  3M30 B;  2ZH7 A;  1HD1 A;  5DG8 A;  2MB0 B;  4ZCL A;  1N5Y B;  4WP9 A;  2XM3 A;  1R8P A;  4HHJ A;  4P52 A;  2LDY A;  1S0V A;  2M3D A;  2H5I B;  1HQU A;  4DR1 F;  2KT5 A;  1C1C B;  3CDB A;  5DQG A;  2RRA A;  1SJQ A;  3M1V B;  2QL9 B;  4HL9 A;  2APO A;  3BH6 B;  5THW A;  2MJU A;  1HNW F;  3OFG A;  2Q1L A;  2M70 A;  2KFN A;  4NLW A;  2LU1 A;  2DNP A;  1FKO A;  4OX9 F;  5L39 A;  1JLB B;  5L1I A;  1QLN A;  3KJQ B;  5GMD A;  4UZC A;  4QW9 A;  1K73 T;  2DNZ A;  2HHX A;  4YOE A;  1VC0 A;  4Y3C A;  5IT0 A;  2MSS A;  5KFJ A;  2BKO A;  2FY8 A;  2B4P A;  4B3O B;  3OLB A;  2I38 A;  3PZP A;  2FPH X;  1DTQ A;  2RF2 B;  1HYS A;  2KT3 A;  2R7X A;  1DQA A;  3QRR A;  2F63 A;  4JI4 J;  3MUT P;  3BPD A;  3TYT A;  2IYG A;  3EE3 A;  5CYJ A;  4IG0 B;  4MKV A;  1QSY A;  2DGO A;  3ET6 A;  5KFI A;  2MQL A;  1HW8 A;  4DCJ B;  5KFZ A;  4KHR A;  5J2Q A;  4M8L A;  1BQM A;  4F0M A;  3QT7 A;  1NCL A;  1A9N B;  2LEA A;  5HSP A;  4JI5 F;  1N36 F;  3SCL E;  1WEL A;  1WI8 A;  2BE9 B;  2K06 A;  3VWS A;  4PWD A;  1RHQ B;  2QMW A;  4QOT A;  2CNK B;  4A8M P;  1FWP A;  1UEK A;  4DJB A;  5ETQ A;  1NJZ A;  3ULH A;  2EG2 A;  1VHF A;  2DIU A;  2E29 A;  4WBF A;  3CD6 S;  3DKD A;  4QR0 A;  4YB5 A;  2B5J B;  2H5J B;  2VDI A;  1KHW A;  3KK3 B;  3QSY B;  3MI7 X;  4PXB A;  4IUF A;  3OVB A;  1EHW A;  2CYY A;  4B02 A;  1VS3 A;  1M5S A;  5IT4 A;  1FDA A;  1PJ5 A;  2ZC3 A;  1FDB A;  4RNM A;  4GVB B;  4MK9 A;  2J0S D;  3MMB A;  2IIH A;  5LMN F;  2NXN A;  5KT3 A;  4DFJ A;  3MM7 A;  4KGX B;  3OUY B;  3OXG A;  1SXL A;  5E2Q A;  3KHH A;  4LJM A;  4RLE A;  3Q23 A;  3H5U A;  1S7H A;  4R8U A;  3IM8 A;  2VBZ A;  3R6L B;  1YQH A;  1FD8 A;  1KWM A;  1NZA A;  4F4A A;  2YXL A;  2MKK A;  1RT4 B;  3LP2 B;  1VBY A;  1XIQ A;  2KL8 A;  4F4Y A;  4F67 A;  1HNI B;  1EX8 A;  2BZ2 A;  3HD2 A;  2DJW A;  2FJX A;  1J5O A;  4CLL A;  1FEH A;  3G8Q A;  2J9C A;  4J9M A;  1EQM A;  5ETM A;  3PX6 A;  1LFW A;  5KFH A;  3MOZ A;  4A4J A;  1TK5 A;  3KJN B;  4KO0 B;  4CLT A;  1CJK A;  4USJ C;  2QSW A;  3AOD A;  2R8J A;  1Q5Y A;  1Y11 A;  1M5V C;  3EGV A;  4QIG A;  1HBO A;  1Q8B A;  1U0S A;  3KG1 A;  2CQB A;  1CC7 A;  5B0F A;  4NLP A;  2HFZ A;  2HIQ A;  5IWA F;  2B4U A;  5ETO A;  1FX2 A;  4U9R A;  4X66 F;  4NOH A;  1FXD A;  2B6A A;  4Q8E A;  5AXK A;  3QJJ A;  2W4C A;  1G7C B;  3DLE B;  4MKA A;  4OYP A;  2HQG A;  4IOC Q;  2LVW A;  4X62 J;  3PW5 A;  2MZQ A;  2UXC F;  1JQG A;  1M1K T;  1BQN A;  2OD4 A;  3EJM A;  4U7U D;  3NOG A;  4I69 A;  3GP9 A;  1T9T A;  4J9S A;  1VR6 A;  1KN6 A;  1LXJ A;  1OQ6 A;  2J6S A;  3KUH A;  3OJU A;  1C4A A;  2G4B A;  1HWU A;  2Z58 B;  4CLP A;  1JX4 A;  3QWP A;  2DR7 A;  1B7F A;  4R0J A;  4P75 A;  3DFE A;  1T05 B;  1ZM3 A;  3KLE B;  3NY0 A;  2RS2 A;  1V5I B;  2KHC A;  3TAM A;  1XJW B;  3OTO J;  5I3U B;  4C0O C;  2HKE A;  4ICL B;  1Q53 A;  3MMC A;  3PIP Q;  2FDN A;  4OI4 A;  2DT9 A;  1NK6 A;  4DUY J;  1FVS A;  3IWN C;  3ZZP A;  1N48 A;  4KPC A;  4R5P A;  4NZ6 A;  1RTJ A;  2UXB J;  4EO8 A;  1N54 B;  1GXL A;  4WE1 B;  1K47 A;  3JSM A;  1URR A;  1VQL S;  2DB1 A;  2FC8 A;  1UFW A;  3MUR P;  1NKB A;  5C24 A;  1BWV A;  1UZD A;  1S6Q B;  3IRX A;  3MPW A;  3TUI C;  3PCO B;  4RUC A;  3HD1 A;  3EUN A;  4RNO A;  3TJ9 A;  3A1Y G;  5T14 A;  5KFG A;  4GKJ F;  1GNK A;  3I5C A;  1N6Q B;  2M52 A;  3UE2 A;  2C3O A;  4ANC A;  5DQI A;  1HPZ B;  1X4F A;  3SZ2 A;  2RQC A;  2D69 A;  4OYA A;  3MEE B;  2D9P A;  1O51 A;  1H2V Z;  2ZHB A;  2MHN A;  3M2U B;  1YZ6 A;  4IOA Q;  2YKA A;  4OYB A;  2E5L J;  2V8H A;  4IH5 A;  1KQG B;  2OSR A;  4DPU A;  4J91 A;  3TVZ A;  1Q5V A;  2AV5 A;  4NLY A;  3EVW A;  4NPO A;  2W7O A;  1VRU B;  4QWD A;  3TA2 A;  2OP5 A;  2VPY B;  3FZ2 A;  2FLN A;  3MM5 B;  1C1B B;  4K4Y A;  1IKX B;  2VG6 A;  2XQC A;  1UCN A;  2DIT A;  2V4R A;  4QQB A;  3PV8 A;  3DYA B;  2J8S A;  3IS9 A;  2M0G B;  3ZTP A;  3R5A A;  3W7B A;  4ZVO B;  3UN5 A;  3JYT A;  4FYV B;  1R3N A;  4YHH J;  4KHP J;  2FC9 A;  3BYP A;  3JQJ A;  4JI6 F;  4DL2 A;  1FWL A;  1HNZ J;  1ZAV A;  3LA0 A;  4PRF A;  2D41 A;  1X5S A;  2CAJ A;  4RW4 A;  4FP9 A;  3UD4 P;  4JI3 F;  2ZUG A;  3OD2 A;  3BSC A;  1RAF B;  5KOX A;  3OR2 A;  1WHY A;  4ILR A;  2CJK A;  2VKR A;  4NML A;  3LH2 S;  1IBL J;  2DH9 A;  2V4J A;  5DDQ C;  3MEG B;  5C25 B;  2LEC A;  4KV8 B;  3MTJ A;  3BRE A;  2F4V J;  4K4X A;  4J9K A;  3KXD A;  4KHM A;  1CBK A;  2BKP A;  5D8H B;  5FII A;  3RW7 A;  3ZNJ 1;  1KDN A;  3FQL A;  1XMQ J;  3O5T B;  1KD1 T;  4B3R J;  1RT2 B;  3GV5 B;  4DV3 J;  2EPI A;  4D3G A;  1REV A;  1S1X B;  1JLE A;  1HR0 F;  4LMZ A;  4F8R A;  4F36 A;  4MK7 A;  2FUG 9;  2V6A A;  3NOC A;  1VQ5 S;  2IMO A;  5GAE U;  1JLA B;  4KFB A;  4FZV A;  4LFC J;  3KJV B;  1S1U B;  1RAE B;  1HNX J;  2B0G A;  2F9D A;  1E6V A;  2B7C B;  2QA2 A;  2DNG A;  2KRR A;  3DDK A;  2VQF J;  1FRK A;  4OX6 A;  4DN9 A;  2J6T A;  3J7Z 5;  4ELV A;  2R7O A;  2A6O A;  3G2X A;  2YKP A;  4CLW A;  1S0M A;  1LWX A;  2BM1 A;  3MAA A;  3TR5 A;  1UVK A;  4ZPD A;  4OJH A;  3VZI A;  5IC4 B;  2IA6 A;  3IG1 B;  2QMX A;  2GIR A;  4BWJ A;  3VAJ A;  1HW9 A;  4B9M A;  4G3I A;  1UA0 A;  2BQ3 A;  3HSJ A;  5KFF A;  5K20 B;  4B9T A;  1M90 T;  2DRA A;  4B9V A;  4CH1 A;  2KZZ A;  2LFV A;  2MQM A;  4RU2 A;  4DSK A;  4NZ7 A;  2KXH A;  5IC6 B;  5KFO A;  1U09 A;  4Q43 A;  4OYX A;  3FC9 A;  3V4I B;  1N34 J;  2C3Y A;  3TEG A;  1F9H A;  4TU7 A;  2K2P A;  4A48 A;  5HRO A;  2UXD F;  1KR4 A;  1RYS A;  1X9W A;  2RDI A;  2EC2 A;  2WK4 A;  2B9E A;  1M1H A;  5F3T A;  5D4L A;  2FYX A;  1EP4 B;  4Y2M A;  2FVS A;  5ETK A;  4ZP8 A;  5IOL A;  1Q8L A;  4H4M B;  2HRY A;  3KLG B;  4ALZ A;  2ZH9 A;  1PAU B;  1T9W A;  5A8K B;  3IR5 B;  4ZIW A;  5E3R A;  2V8G A;  4F4K A;  1U1M A;  1C0U B;  1YBT A;  2EC0 A;  1UW9 A;  1JK9 B;  1GMW A;  3HSZ A;  2VG7 B;  5JVG Q;  3N6L A;  1S72 S;  4L76 A;  4LVO P;  3M2R A;  1VRT B;  3CDW A;  2X3D A;  4B3M J;  5CYQ B;  4BC9 A;  4NWB A;  4ECR A;  1FTC A;  1HFE L;  8RUC A;  4PQA A;  2C1E B;  2WOM A;  1WEX A;  2DCU B;  2WVD A;  3EDQ B;  1FJ7 A;  4OZJ A;  5BYR A;  3NEK A;  3ZZ0 A;  3ILI A;  5CYM B;  4GRS A;  3CD7 A;  4I6Y A;  3G96 A;  4ZVF A;  4LSL A;  3FSY A;  1IKY B;  3GCX P;  5KFM A;  4I7F A;  4ENO A;  4B3S J;  4FPR A;  1NZ8 A;  1SKU B;  5MLC V;  4RNN A;  4FS2 A;  1L3K A;  1P9Y A;  4HDG A;  3T5L A;  3PO4 A;  2QGF B;  1TFY A;  2XS2 A;  2Q6B A;  1HQU B;  4K4S A;  1U0H B;  5DS7 A;  3IR7 B;  3UDC A;  2A3J A;  4DR6 F;  3VQS A;  5JJB A;  2HQD A;  2JJ4 D;  3A3O B;  3A8E A;  5HQM A;  4I67 A;  2JZ5 A;  2F5G A;  3LPY A;  2F8E X;  3PAC A;  2Y1R I;  1UEV A;  2IRY A;  5HMY A;  4CZC A;  5HLF A;  4N7T A;  1A0O B;  1RBA A;  4KKO A;  4QCL A;  4YY3 J;  4DQI A;  4FXD A;  5GAH I;  4DV5 F;  3V81 A;  4Q8F A;  1Q95 G;  4H4O A;  4NAS A;  4K0K F;  4WFY A;  2WB1 D;  3SV3 A;  4NXM F;  3Q8P B;  4KB7 A;  1OO0 B;  3Q2S C;  2UUC F;  5I3P A;  1CS4 A;  1DTQ B;  3BF4 A;  1HYS B;  3DLB A;  3NGU A;  4QWE A;  1HHT P;  3TAR A;  2A2D A;  2AD9 A;  1IWG A;  4JP8 A;  5CD4 A;  3EWG A;  2YNF A;  3A4T A;  2VHG A;  1EIY B;  4I56 A;  1GAO A;  2XHW A;  3KLI A;  2DR8 A;  2Y9H A;  3L9Z A;  2UUB J;  4I2Q B;  3CC7 S;  3ZTO A;  2AJQ A;  4WYL A;  4HAC A;  4EZ6 A;  3RB6 A;  2XCP A;  5J2Q B;  1TL1 A;  2XY5 A;  4RBV A;  1D3W A;  2F7V A;  3JQK A;  1BQM B;  5KFS A;  5C7P A;  3ILJ A;  3ZO7 A;  4FVC A;  4WK1 A;  2FLO A;  1RQ0 A;  3LWM A;  5B0C A;  3K5O A;  1Y7P A;  4WPA A;  1SJ3 P;  4PWD B;  1RLC L;  3DCA A;  1H7W A;  4PXC A;  3OFF A;  3JSR A;  2YQ1 A;  1GH8 A;  3V6H A;  2PFF B;  1FD2 A;  2DH8 A;  1N5T A;  5JUM A;  1RA6 A;  1NK9 A;  2BAB A;  2ZBQ A;  4NA1 A;  1AYE A;  4RJV A;  2K7J A;  2G2O A;  3VQT A;  1KVK A;  9ATC B;  1Y5L B;  3THV A;  1RTD A;  3MMB B;  1BWE A;  1NDC A;  3W3S A;  3C66 A;  1FFW B;  4O0I A;  2R8H A;  1TUW A;  3HFZ B;  4ED3 A;  2F1F A;  3M2V A;  1NH7 A;  3MM7 B;  4LFB J;  2LDI A;  3VVT A;  3G6E S;  5LMU F;  2P9C A;  1FFS B;  2HND A;  4A8K A;  3DLH A;  3TAN A;  5I42 A;  3TUZ C;  2E1A A;  1UWB A;  4R8U B;  3M8S A;  4CLF A;  1RT1 A;  4CH0 S;  2DKO B;  3FCV A;  2EFP A;  1VBZ A;  4HTI A;  2ZH3 A;  3US5 A;  3W8P A;  1TEL A;  4LF9 F;  2HHW A;  1KTQ A;  1X4D A;  1YTY A;  4JYA J;  3HVW A;  1NB2 A;  1J5O B;  2JC0 A;  2LCW A;  4QR1 A;  2YY3 A;  2HS3 A;  2CQD A;  4G65 A;  1Q8K A;  4ZOS A;  2VOP A;  4NYZ A;  3BGU A;  4ZPW R;  2RIJ A;  1CJK B;  1X60 A;  4QIV A;  2KXN B;  1Q86 T;  2G0C A;  1JXL A;  4DR1 J;  2UV8 G;  4PG8 A;  1MN7 A;  1HBO B;  1DHM A;  1TKD A;  3W64 A;  1HNW J;  3O6Q A;  2E9R X;  2QYG A;  2IAJ A;  2IHR 1;  2EKN A;  4EBD A;  3UN3 A;  3K17 A;  3MPY A;  2PC6 A;  4OX9 J;  1Y10 A;  4XPE A;  5HAO A;  3RR8 A;  2B6A B;  1OJ4 A;  3H5S A;  5D77 A;  3BO4 A;  2PFD A;  1W2B R;  4P74 A;  3ELH A;  3RU0 A;  1AT1 B;  1B99 A;  1BQN B;  3TJ8 A;  1ZTW A;  2MY8 A;  1TU0 B;  5D3G A;  2MYF A;  2HNY A;  5F41 A;  2EBE A;  4DPW A;  4E98 A;  1VK8 A;  4W92 B;  5D0H A;  3CXC R;  4DR4 F;  1T95 A;  4AT1 B;  2VL1 A;  2QX0 A;  4IRC A;  4U8V A;  5E3P A;  1GMW D;  1GFW B;  4C11 A;  5KT5 A;  5KFP A;  2VPX B;  5ETV A;  4DL3 A;  4QIF A;  3T6B A;  4NA3 A;  3MMC B;  2VC1 A;  4OHZ A;  1VQP S;  3CJ3 A;  2RML A;  3ZTQ A;  4EUV A;  5CZX A;  3AFG A;  4PG6 A;  3DHX A;  2XUL A;  1QSS A;  4R5P B;  1MSW D;  1RTJ B;  1NHU A;  3CMA S;  1T9V A;  4JI5 J;  4XPC A;  2ASY A;  3JSM B;  3T1Y J;  3E51 A;  3U1L A;  4J90 A;  1N36 J;  5C24 B;  2MZJ A;  3HCX A;  1HNV A;  3IRX B;  2ZM6 F;  2GA7 A;  2MY7 A;  2RHQ B;  3C2P A;  4OHX A;  5HJX A;  1C2P A;  6FD1 A;  5HL7 Q;  3DLJ A;  2BKN A;  2PD1 A;  4RNF A;  1S79 A;  4L72 B;  1LW2 A;  1U4B A;  5CZV A;  3RZA A;  3CNQ P;  2G1H A;  3U1N A;  4RX6 A;  2GQ2 A;  3LGN A;  1UJ4 A;  5BR8 F;  4ECS A;  3CCV S;  1SJR A;  4ES2 A;  2H54 B;  1SVD A;  4A8Q A;  3AT1 B;  2HHT A;  4X65 F;  5LMN J;  1NO8 A;  2BV3 A;  3MPD A;  4B17 A;  1YK9 A;  1WEZ A;  1SJ4 P;  2VG6 B;  3GFX A;  3GQC A;  2YWG A;  3MCS A;  1D8Z A;  2IRX A;  4EWT A;  2GVZ A;  1F5A A;  2Z2Y B;  4EBE A;  4X4P A;  3N01 A;  2HZC A;  3JYT B;  3RRG A;  2FZG B;  4X4O A;  1S4E A;  5SUH A;  1T94 A;  1S7I A;  2AHO B;  1GMV A;  3ENW A;  5KT4 A;  4F26 A;  3ZZT A;  5D6G A;  5KG2 A;  5J2P A;  4RW4 B;  2JRS A;  5EX3 A;  3OL7 A;  1JNZ B;  3OR2 B;  3PEH A;  2VQE J;  1S9F A;  2DIV A;  1VLY A;  2QIF A;  2G9O A;  2V4J B;  2HW3 A;  1QUP A;  1R89 A;  4WWS A;  3CMQ A;  5ETN A;  3HLU A;  1RWK B;  2E9Z A;  1F3V A;  2HS0 A;  3B82 A;  2K1R A;  1URN A;  4IR9 A;  2QSF A;  3LGM A;  2WSF C;  4QR2 A;  4ZVR B;  5IWA J;  4DMZ A;  2CQI A;  1FRX A;  2ZNY A;  4MT1 A;  3QJL A;  2OPS B;  2UUA J;  1REV B;  1JLE B;  1S6U A;  4X66 J;  1VBX A;  4WXO A;  3N6M A;  1S10 A;  3CCT A;  1FJG F;  4C8O A;  2EWH A;  2HHQ A;  2X1G A;  3IC1 A;  5B0G A;  1E6V B;  4ED0 A;  4MK8 A;  2E5G A;  3DOL A;  5B09 A;  5CHC B;  4YUD A;  2ACM A;  3L95 X;  1D8Y A;  3GV7 B;  1U2F A;  1N88 A;  5EX0 A;  3MAA B;  1WG5 A;  1NK4 A;  3VGT A;  3I32 A;  4N56 A;  1CQM A;  3OXL A;  2BA9 A;  4NZ0 A;  4CLZ A;  4RW6 A;  1Q7L B;  1RT5 A;  1QJH A;  2GV1 A;  5HMW A;  3OTC A;  2V94 A;  1FT8 A;  2N4C A;  2X1A A;  3U27 A;  3UQS A;  1VBK A;  4BCA A;  1EKR A;  1JKH B;  2HBY B;  4Y28 C;  2PEH A;  3V5R A;  2ZJQ Q;  3M8R A;  4N41 A;  3JAM U;  2AWZ A;  1QVF R;  3AJ1 A;  2OEJ A;  4DV0 F;  5D78 A;  5HRO B;  1TUV A;  1IKW A;  5A6P A;  5LT5 A;  1JWW A;  2XYH B;  2DHH A;  2MPU A;  2A2C A;  2CJB A;  2PO4 A;  2LQJ A;  1V3R A;  2O5D A;  4OZL A;  4NXN F;  5H9F J;  4O3O A;  5ADZ A;  1DBD A;  2V34 A;  2HAI A;  2Y0S D;  1U26 A;  1NDP A;  4Y0F A;  4UOG A;  4RUH A;  1S1V A;  2GZO A;  3CO0 P;  3M2R B;  2QLJ B;  1WDD A;  1GXT A;  2DBB A;  3C14 A;  2RQ4 A;  4ED6 A;  4NA2 A;  1WF2 A;  2WOM B;  3OLA A;  4C8Z A;  4ILL A;  4JI8 F;  4DX5 A;  2XY6 A;  1WOP A;  4W90 B;  1J5E F;  4DV6 F;  4DPT A;  2E1R A;  4LSL B;  4X4T A;  2AYM A;  5KFN A;  3TI0 A;  2MQ8 A;  4UY8 T;  2M4M A;  1YJW S;  3D3B J;  4I7F B;  4N47 A;  2X1B A;  3HHD A;  1UET A;  4P2M A;  2NS1 B;  2BRL A;  4JI6 J;  3M9O B;  4WXW A;  1MG7 A;  2LXF A;  3G6V A;  3HVA A;  4JI3 J;  3ZTS A;  2ZH6 A;  1BY9 A;  4WK3 A;  2HGL A;  2FQQ B;  4IOB A;  3K0J A;  3QT8 A;  3KK2 A;  5AXL A;  5T7L A;  2CQ0 A;  1KLM A;  4A47 A;  1BMQ B;  4NLD A;  3PDN A;  3D68 A;  4K4Z A;  1XR5 A;  5LJ3 Y;  1NB7 A;  3P5T L;  1CUL A;  1TUG B;  1N32 F;  3ZNU A;  2VJU A;  1YIJ S;  1IJE B;  1YWX A;  5HLF B;  2Y3Y A;  4KKO B;  3PRD A;  4C0B A;  4QU7 A;  5KFR A;  2OI2 A;  1JLQ A;  3V81 B;  2W2M P;  4IR1 A;  2JH3 A;  3FCH A;  3QGP A;  4H4O B;  1KNZ A;  3E01 B;  2ZC4 A;  1X5T A;  1S99 A;  2BEF A;  2R8K A;  3CCQ S;  4HYK A;  1QAX A;  4CRJ A;  1YJT A;  4GKK F;  3TP2 A;  1ZH5 A;  4NCG A;  2KI2 A;  3LQV A;  1CS4 B;  3WC2 A;  4G1Q A;  5KFU A;  2IBK A;  4FNI A;  4X4S A;  4NLR A;  3H2V E;  2MQO A;  2RHS B;  5D15 A;  2J7W A;  2DD8 S;  4PWW A;  4C98 A;  2W2Q P;  4FS1 A;  1KOH A;  1XR7 A;  1PSD A;  3BGL A;  2YNF B;  1L3U A;  4RW7 A;  3KLI B;  4ZPA A;  5F8M A;  2O66 A;  4I0W A;  4OJG A;  3K7R A;  3V6D A;  4HAC B;  3W65 A;  2K8G A;  1BUX A;  2KVQ E;  3QID A;  1TL1 B;  2H9Z A;  1YBU A;  3DRP A;  3Q22 A;  3NGK A;  1EAR A;  1N5Y A;  2JEF A;  2WVC A;  1VC6 A;  4DS5 A;  1KFS A;  4ZVT B;  1Z2L A;  4P2F A;  3FBF A;  4DV7 F;  4CM0 A;  4LF4 F;  4DX6 A;  5GAE I;  5IT9 Y;  3TZZ A;  4CTA A;  1X4G A;  2J9D A;  2B8Q A;  1VFJ A;  3R5J B;  3R6G B;  2PN6 A;  5EWE A;  2ZH2 A;  2UXD J;  3FUY A;  2FY1 A;  2E7X A;  3M8W A;  3H5X A;  4QWB A;  4DX8 H;  4OFZ A;  1BGX T;  5KG4 A;  3LOU A;  2QRR A;  3RYL A;  4O3P A;  1FNX H;  4LBP A;  3VR1 A;  4C97 A;  2ZJR Q;  4NLG A;  3S7R A;  4NEZ A;  4CDI A;  3DU5 A;  1RTD B;  2VPW B;  1QAJ A;  2XC9 A;  2CPJ A;  3QGG A;  1SIW B;  2NXU A;  1ZYQ A;  3M2V B;  2U2F A;  3RBE A;  2G1D A;  1I6J A;  1H98 A;  2Q3P A;  4OYW A;  3HSD A;  1XNR F;  2R2R A;  3PW2 A;  2IY5 B;  3CCL S;  2EBG A;  3SEO A;  3VV2 B;  4FYX B;  4DG1 A;  1UWB B;  5IXU A;  2QE5 A;  3ZC4 A;  2W1B A;  2CQ4 A;  3OFE A;  2DNM A;  2BJD A;  3BSN A;  5HQL A;  2AEF A;  3NG8 A;  2OJ3 A;  1RT1 B;  1X4E A;  1RZM A;  4P2S A;  2HK3 A;  3T19 A;  5HK4 A;  1HWL A;  2GIF A;  3Q8U A;  4KT0 C;  4PUO A;  1MWY A;  4JI2 F;  2PGC A;  3RW6 A;  5B0B A;  1HI1 A;  1J2V A;  3HPO A;  2YKN A;  3BH7 B;  5K9F A;  4C3M A;  4ZPV R;  3O1L A;  2HZV A;  5EWF A;  4J9O A;  3VGU A;  4K2J A;  1K1Q A;  1CSJ A;  4J9Q A;  2YNG A;  1DUR A;  4Q7A A;  4DR5 F;  2EFQ A;  5M2U A;  4DR6 J;  2DO4 A;  1I5O B;  1F2G A;  4F3O A;  2UVR A;  4YB6 A;  4DN0 A;  2IAJ B;  2QL7 B;  1KEK A;  1SV5 A;  1VIO A;  2JEI A;  3R5B A;  4ZPT R;  1UA1 A;  4RBU A;  4HHU A;  3NNH A;  1OS5 A;  2JWN A;  1VLO A;  5HJY A;  4Q5V A;  3ZFV A;  5KG3 A;  2CPI A;  4F0H A;  5GME A;  1PYS B;  1U25 A;  2J9E A;  4GVB A;  1MN9 A;  4ZS6 A;  4WFN Q;  4M94 A;  4K0K J;  1K9M T;  2WW8 A;  4NXM J;  1YRT A;  2HNY B;  2VOO A;  3R5D A;  3LTO A;  3D6F B;  1PYT A;  3W2V A;  2H3E B;  4RPF A;  2Q6C A;  1GEH A;  4AD6 A;  1PCA A;  1F3F A;  4K5R A;  2V2Q A;  4CM2 A;  1ZPV A;  2XY7 A;  1WC3 A;  1UVM A;  4C11 B;  1NU4 A;  1UMJ A;  1N52 B;  3HHE A;  2J0W A;  3TZY A;  2P6T A;  2DY1 A;  3M6W A;  3KG4 A;  1D9A A;  3N5B A;  2HHH F;  3FRZ A;  4YB7 A;  4KAI A;  3HHL A;  5HBM A;  4WFB Q;  4TXS A;  1QSL A;  1FRJ A;  1S97 A;  3TUP A;  1JJ2 R;  3I55 S;  3CB4 A;  4I2P A;  5LXY A;  3R2C J;  4ECZ A;  4CO5 A;  2PI5 A;  1UVN A;  2ADC A;  4C8M A;  1WSR A;  1LW2 B;  3H42 A;  4ZVQ B;  1RAC B;  3CME S;  2VZ9 A;  3SFU A;  3WDO A;  2Q79 A;  3IGV A;  2PI4 A;  1FRM A;  4LR9 A;  2PEB A;  1GX5 A;  3MDF A;  1UAW A;  4DCO B;  2F8M A;  3UCZ P;  2D3U A;  1NBE B;  1ZZF A;  3IBW A;  5CAA A;  1NHV A;  2CRL A;  3D1Q A;  5KFX A;  4C8N A;  2ZZM A;  4X4V A;  2MTL A;  4C3L A;  2CJQ A;  2B9Y A;  2C2E A;  4KSE B;  4DHV A;  4QZV B;  1T05 A;  2GO8 A;  4IRD A;  1SH0 A;  3S01 A;  3UFC X;  1IKV A;  3GIR A;  4M95 A;  1R43 A;  3N28 A;  3ICL A;  2GVZ B;  5HN0 A;  3MFH A;  3W9J A;  5DLG A;  4O4G A;  2SXL A;  2WRM A;  1OQ3 A;  3DI6 A;  4LF9 J;  1B64 A;  4AL7 A;  2M8H A;  5H9F K;  1R8H A;  5G0R A;  3OBI A;  2GFF A;  2QLX A;  4ECT A;  4WFZ A;  3QZ7 A;  3VAI A;  3PO5 A;  5J2P B;  2VFT A;  3QSI A;  1VC5 A;  3FRY A;  1BC6 A;  3TVY A;  4O3N A;  3T9N A;  3FEZ A;  1FE4 A;  1WKL A;  2IM0 A;  1RT6 A;  4DPY A;  1PIL A;  2ZH1 A;  5EWG A;  3T6J A;  1K1S A;  2K1R B;  2IYI A;  5M2P A;  2RIL A;  2P5V A;  2CPE A;  2F3J A;  4OYM A;  2HBQ B;  1XK8 A;  1RU2 A;  4EU0 A;  4LQ3 A;  3U7J A;  4L73 A;  2XI3 A;  2YWK A;  4ZJO A;  1ROF A;  1R8A A;  1H0H B;  2L9W A;  2KDO A;  1C0T B;  2PA8 D;  2YX7 A;  4NLO A;  3CD0 A;  3VCD A;  1HD0 A;  1X4C A;  3ETO A;  4J9N A;  1DTT A;  3DOL B;  4UQG A;  3FJ2 A;  1SC6 A;  2DHS A;  1P27 B;  2O01 C;  1K0V A;  4NMX A;  3C3L A;  1DQ8 A;  1SC1 B;  2C2M B;  4CO4 A;  1X5P A;  2LA6 A;  2RRN A;  1C1B A;  5GMK a;  4PG5 A;  5B0A A;  3CCW A;  1G2E A;  3H25 A;  1U48 A;  3KHL A;  1XN9 A;  3T1A A;  4RW6 B;  3G4S S;  2MHE A;  2FD2 A;  1RT5 B;  1U8S A;  4PG4 A;  2CVI A;  2YX1 A;  3MR7 A;  1FNO A;  2XS7 A;  1U6B A;  4ZIV A;  4DLG A;  2LQ8 A;  1G1X A;  2UU9 F;  5KFD A;  4C9D A;  4GO5 X;  3PFO A;  3NWR A;  3DRS A;  2HBZ B;  1WC6 A;  4TN2 A;  1WC1 A;  4LSZ B;  5DGB A;  2ASJ A;  3H7H B;  3TEH B;  3C6U A;  3GIM A;  4ZVG A;  3MEG A;  4KV8 A;  1T02 A;  2PSZ A;  1Q16 B;  3EDR B;  2ZM6 J;  5KG7 A;  1CC8 A;  1IKW B;  1YBA A;  3NCQ A;  1QAI A;  4A8X A;  1HAR A;  3H40 A;  2IJR A;  3HO1 A;  1DQ9 A;  1ZBT A;  4DUZ F;  2XGP A;  1U49 A;  2B7B B;  3BO3 A;  1FRI A;  4USH A;  3I0S B;  4ZLN A;  2GQQ A;  3M05 A;  1RHK B;  3MEC A;  4USV A;  4ER8 A;  2HGN A;  1R0A A;  2ZZT A;  3TWZ A;  3PHE A;  5IQQ A;  4DR3 F;  2O3D A;  1OY6 A;  1S1V B;  3PNI A;  5EHH A;  1U2C A;  4F3Q A;  3HVT A;  5KFE A;  2OO4 A;  3HKZ D;  2W7P A;  2UVV A;  4HT5 A;  1X7V A;  5HO4 A;  2DCL A;  1H3D A;  3C14 B;  1FNM A;  3MPV A;  3CJK B;  4X65 J;  1KBR A;  1D9D A;  1F0X A;  3AY0 A;  5L46 A;  5AJ3 J;  3ILL A;  2VON A;  2OTJ S;  2ZFH A;  4KRW A;  4J9P A;  3K89 A;  1H38 A;  3OSN A;  3MR5 A;  4F7V A;  4QIE A;  3I9V 9;  1Z1Z A;  3GJR B;  2XNQ A;  3LP1 A;  3CGI A;  3C15 A;  4AL5 A;  5D0E A;  2OAU A;  4L74 A;  5DGA A;  3AAW B;  3NBP A;  3GFH A;  3KLH A;  2QLF B;  1T8E A;  4MTP A;  4ZVH A;  1LWE B;  5ETL A;  4KYZ A;  4IO1 A;  1U45 A;  3AHP A;  2XSF A;  1RGV A;  4NLQ A;  2HVD A;  3MHY A;  2RUG A;  3CCU S;  1WG4 A;  5A6W A;  3G82 A;  4KGM A;  4OX8 A;  1JJ4 A;  2W8K A;  4M5H A;  3KK2 B;  3J81 Y;  5T7L B;  2C2D A;  2FJE B;  1KLM B;  2XO7 A;  3KHR A;  4X4Q A;  1CUL B;  3OV7 A;  4QPT A;  2EFG A;  1U2R A;  2N3O A;  1EP4 A;  2NUH A;  1L5U A;  2V9K A;  4DR2 F;  4C8L A;  4UST A;  2D1C A;  2OPR A;  2V2V A;  3LO3 A;  2Z2M A;  4ZCM A;  2VBY A;  3MM8 A;  1FJG J;  3RAQ A;  3BO2 A;  1C0U A;  2BOP A;  1S76 D;  1FFG B;  1TL5 A;  4K2X A;  3RB0 A;  2Z2Z A;  3M8Y A;  4NCG B;  4USI A;  5D4O A;  3VAF A;  1EKS A;  5FLX U;  1FJC A;  4P10 A;  1VQY A;  3W61 A;  1G6B A;  3HUL A;  4EZ9 A;  1MWZ A;  4K8R A;  1SIZ A;  1NSA A;  4AXJ A;  2MLY A;  1P1L A;  1U1O A;  3UD3 P;  2B4V A;  4BLG A;  2OKQ A;  3ENV A;  5CYM A;  3QZ8 A;  4DDF A;  3TZX A;  4Y2K A;  2KHD A;  5KFQ A;  4LF7 F;  3NNC A;  2FJB B;  3QFH A;  2GCF A;  4LF1 A;  3BBF A;  4P73 A;  3V6D B;  2BJE A;  2AJ1 A;  3DRP B;  4Q45 A;  2B8P A;  2HVH A;  4DL7 A;  4PG7 A;  3AJD A;  1YI2 S;  4C8Y A;  3ZZR A;  3PYF A;  2ZBR A;  1FER A;  5B7W A;  1LWF B;  3D2W A;  1U0H A;  3J7A N;  2QC3 A;  4JI4 F;  3DDN A;  3DM2 A;  2C2O B;  3R7S B;  1BHN A;  1YRU A;  3CWJ A;  4WF9 Q;  4CTA B;  3UCU P;  3DHW C;  4DV0 J;  2RUS A;  3DOM A;  1ULR A;  1VQM S;  2Q66 A;  4C0H A;  5GVQ A;  3PR5 B;  2N4D A;  2NR0 A;  1LOU A;  3BN7 A;  5J2M A;  2LLZ A;  4M1K A;  4R25 A;  2Z56 B;  5HVG A;  3Q8R B;  2FZK B;  1O6X A;  4ZDN A;  1WTB A;  5CCM A;  3MUM P;  2RS8 A;  3PX4 A;  3MZI A;  4Y65 A;  2DEJ A;  2XMV A;  3HDS A;  2CJX B;  3AH6 A;  5FJ4 A;  4B9S A;  4QYZ J;  4ECV A;  2MKS A;  4F4Z A;  4YDX A;  1YJR A;  3EVO A;  4DG1 B;  3NS5 A;  4HH0 A;  4XIU A;  3THT A;  2OPP A;  5A8W A;  4Z7Y A;  2G13 A;  4DL4 A;  4K50 A;  3N79 A;  2KRB A;  4ECW A;  1TK0 A;  4DV6 J;  3A8J A;  1NDL A;  4I2Q A;  1S1T A;  3Q8S B;  1QDU B;  1GTE A;  1F60 B;  4PUO B;  3D6M B;  1RT7 A;  2GX8 A;  3UVJ A;  3CT9 A;  3Q0A A;  2MKJ A;  1RCX B;  2YKN B;  3OTB A;  4DQR A;  4DWI A;  5JMN A;  5E3Q A;  4GO7 X;  4KH0 B;  4E2F B;  2AYG A;  2YNG B;  5F9N A;  2K3K A;  4YFU A;  2ZNZ A;  4UOH A;  3KK1 A;  2J0Q D;  3TUJ C;  3IR6 B;  4PYA A;  1XWL A;  4O44 B;  3KUG A;  2LQ9 A;  3FBC A;  1M5H A;  4FYW B;  2UUT A;  2ZD1 A;  5CXT A;  4WII A;  2CZV C;  1SV5 B;  2U1A A;  2NQP A;  3OW2 R;  4WFA Q;  2H65 B;  3HJV A;  3CE8 A;  2XMK A;  1N32 J;  4ZLL A;  3O44 A;  4DSJ A;  5K5M A;  3GYG A;  2IVF B;  1HA1 A;  4N8N A;  1P8G A;  2DNQ A;  3KMS A;  4OHY A;  4CQ1 A;  1EAY C;  1I3O B;  1HLW A;  4ECQ A;  1LNQ A;  1WOS A;  4OQJ A;  4MKB A;  1IBK J;  2GJI A;  5U47 A;  4HEA 9;  1ZA1 B;  3FMW A;  2FGO A;  2OGU A;  4MKY A;  2L41 A;  1WF0 A;  2A18 A;  2Y1L B;  4BS2 A;  1TAQ A;  1U6F A;  4N77 A;  3M32 A;  4FVM A;  2FHJ A;  2CPF A;  3AXK A;  2RAQ A;  4IH7 A;  4ZHR A;  1CLF A;  3NS6 A;  3W2V B;  2DNN A;  4OZ3 A;  1SJF A;  3VVU A;  4UY8 5;  4ELT A;  1JJC B;  3KKF A;  2IM3 A;  2B51 A;  2PA3 A;  4PEO A;  3PFE A;  3UNG C;  4LRC A;  4QYR A;  3W9H A;  4ZMM A;  5LM7 E;  1PIE A;  4BDP A;  1LWC A;  3FEY B;  4MIA A;  2DGU A;  5D0R A;  4TNO A;  4C48 A;  3R7B B;  3HZE A;  1VQO S;  2MKH A;  3IWX A;  2CQ2 A;  3QIP A;  5HI7 A;  1WOR A;  4I64 A;  4X84 A;  4RWW A;  2MLZ A;  2IPO B;  4FDF A;  4ED2 A;  1U6Z A;  3N9U C;  1VK3 A;  3HHL B;  5HBM B;  2JVO A;  4U8Y A;  3RAM A;  3IM9 A;  1PC5 A;  4DV7 J;  2OPQ A;  4LF4 J;  4I2P B;  1S0O A;  2BBE A;  2GNK A;  3AOA A;  2XSJ A;  4W98 A;  3H2L A;  2ROG A;  5KFK A;  3OTO F;  2NYH A;  3WIU A;  3A12 A;  3SCI E;  1VYA A;  3U02 A;  1MMD A;  4FKY A;  1JLC B;  4P72 A;  4LRD A;  2RDD A;  3GB0 A;  1IWA A;  3HSG A;  1F9F A;  8ATC B;  4EYH B;  3WBZ A;  4RO0 A;  2CPD A;  1TL7 B;  3M9N B;  3UWT A;  5HVH A;  2HVI A;  3TA1 A;  2W25 A;  3QAT A;  2ZHA A;  3HVR A;  4OYO A;  3W8G A;  3M8Z A;  2ROE A;  2ZBP A;  3QQC D;  1B7Y B;  4TYB A;  3RAX A;  3PR4 A;  3PYD A;  1T0T V;  4HVZ A;  4OHW A;  4NI2 A;  3SQO P;  3AJ2 A;  3EXC X;  1ZM2 A;  2I5J B;  3PX0 A;  4ECX A;  2MGZ A;  3HP6 A;  3Q8Y A;  2NPF A;  3MAH A;  3MR3 A;  4ETX A;  1XNR J;  2XLI A;  3D0G E;  1IKV B;  3J81 U;  2L3M A;  3J7Y U;  5DG7 A;  4L75 A;  3MCO A;  5EGY A;  4YR0 A;  1UVJ A;  3LWL A;  4LF5 F;  5EDW A;  2FVQ A;  1VQN S;  1H72 C;  4O4G B;  4JV2 A;  5DRK A;  3MED B;  1SBR A;  3UDE A;  4M5D B;  2E5L F;  3DI6 B;  4YB1 P;  2JLG A;  1RAB B;  1UP1 A;  2NXJ A;  4OJ3 A;  4JI2 J;  2QLW A;  3HM9 A;  5G0R B;  2YH0 A;  4YN3 B;  2DYA A;  1TMJ A;  4IKA A;  3H90 A;  3CD5 A;  9RUB A;  1FJE B;  4OL8 A;  2EVZ A;  3P45 B;  3W63 A;  2GVD A;  4DR5 J;  1RT6 B;  2YBV A;  2RH3 A;  1KLN A;  2QN6 B;  3SCJ E;  1QE1 A;  2HK2 A;  3RRH A;  2D7S A;  1R6V A;  2HHP A;  4KY3 A;  2FIU A;  2V2Z A;  2RSQ A;  3I56 S;  1IQZ A;  1RTI A;  4YHH F;  1W2I A;  2D3O 1;  2VB6 A;  1N5S A;  2OSQ A;  2VPZ B;  3ENA A;  4C7Q A;  1MLA A;  2VIH A;  5AE2 A;  2AGO A;  1H2T Z;  3D1O A;  3OT9 A;  5F9L A;  3VTI A;  4WU3 A;  2CQ1 A;  4HH1 A;  4B3T J;  3T1H F;  4OLP A;  1K0T A;  1DTT B;  2C28 A;  3BS9 A;  3RRK A;  1X5O A;  3B4D A;  5KT6 A;  2F4V F;  2YWE A;  3UDV A;  5CQG A;  1U7L A;  5KG6 A;  2Q43 A;  1MW7 A;  1KQK A;  4U96 A;  3D6H B;  2VDH A;  2RT3 A;  4CO3 A;  3CJ8 A;  4N76 A;  2DTJ A;  2ZKU A;  4K7Q A;  4UZB A;  4IFV A;  1FDN A;  2GHP A;  4NLT A;  3KOA A;  3EYZ A;  1T3O A;  4LFC F;  1ACM B;  4ITS A;  2CZ4 A;  4PXD A;  3HHL C;  2BM0 A;  3QWU A;  3W5X A;  2V9W A;  5A0Y B;  3BGF A;  2DGX A;  3DRS B;  5KAK A;  2GML A;  3FEX B;  3GZ7 A;  4PCQ A;  4DOZ A;  4G1P A;  1B0V A;  1YJ7 A;  1YJN S;  4DL5 A;  3C6U B;  2MXY A;  2XS5 A;  3DNC A;  4J9U E;  2VOD A;  5GAG U;  1FX4 A;  3J80 Y;  3GYN A;  3H59 A;  3PJW A;  1D09 B;  4ED5 A;  4EEY A;  2NUU G;  1ZM9 A;  3LAK A;  2Y1J A;  3OVA A;  3KYL A;  3MOJ B;  3ADA C;  2NXE A;  1OPZ A;  3GWC A;  5H1S V;  2WCX A;  4CI0 B;  2OPS A;  1MMN A;  2WVE A;  1VMB A;  4NYO A;  2E7V A;  1X0F A;  1S4F A;  2EFO A;  3MEC B;  3DRX A;  2ASD A;  3I5A A;  4DPX A;  1R0A B;  3QLH A;  1RWP B;  5LJ5 Y;  1YZ7 A;  3UI3 A;  4RU9 A;  3TW0 A;  1XQI A;  2DR6 A;  3HVT B;  1UW4 A;  3GTY X;  1TV6 A;  3QMQ A;  4FXW A;  2HFU A;  1FDD A;  2ZWP A;  1S1W A;  1RSC A;  3F73 A;  3PHT A;  1U1R A;  3KHG A;  4AUK A;  1VHI A;  5K8P A;  3I9Z A;  4OZN A;  1VQK S;  1AUS L;  3C6T A;  1HMV A;  2LKZ A;  4FPI A;  2MDA A;  2R7U A;  2V5H G;  1VDH A;  5L1J A;  2HBR B;  3LP1 B;  3DXB A;  3C15 B;  4URG A;  1HL6 A;  3NBP B;  2QYC A;  1S9G A;  3KLH B;  4FF2 A;  2IMW P;  3M7V A;  4TVA B;  2FHJ D;  4PYD A;  5ETS A;  2R2S A;  4K59 A;  4Z7C A;  1JKH A;  4TYA A;  4PQU A;  2KXF A;  1IR2 A;  3D3C J;  4I1T A;  3JTP A;  4OJ1 A;  1VQ7 S;  1S77 D;  1BLU A;  4OYI A;  3IWL A;  3G82 B;  5LSL A;  2XMW A;  4CNZ A;  1NJI T;  4HI1 A;  5A8R A;  2JOQ A;  3A3P B;  3M6X A;  1KKH A;  4ZVS B;  1RYR A;  2W7A A;  5C2C A;  2HLU A;  4X64 J;  2ZZN A;  2V69 A;  2VD3 A;  3MWB A;  2XMA A;  2I0X A;  1SQF A;  3PVX A;  5AE1 A;  4RW8 A;  2O67 A;  4Q2L A;  3EZ5 A;  5J1N A;  1DAR A;  1S5Z A;  2AX1 A;  3GIJ A;  2G0J A;  3QYY A;  1KC8 T;  1H6K X;  1IM6 A;  2OPR B;  4Y6I A;  1H7X A;  3TVK A;  3MM8 B;  4TQS A;  1RCO B;  2P6S A;  3G8S A;  4EYI B;  1X9M A;  1NHK L;  3H98 A;  2IDE A;  1N33 J;  3FBB A;  1RWV B;  3GR0 A;  2W9A A;  2XMU A;  1U1L A;  1R7I A;  1ZAW A;  7AT1 B;  1HBN A;  2ZOG A;  3SCK E;  3EX7 B;  1KVJ A;  4YME A;  3HT3 A;  4F4X A;  3MGJ A;  1RHR B;  3JQM A;  1NXI A;  4LRE A;  2QMU B;  1I94 F;  4OI6 A;  3NGT A;  4QIW D;  1FCA A;  4TKT A;  4K4V A;  3QT6 A;  1ZOT A;  4XO0 A;  4LBI A;  2UU9 J;  3D66 A;  5IZH A;  2DNO A;  2YTC A;  2WSC C;  4U67 Q;  3D0H E;  1HKA A;  1VIX A;  3DM2 B;  3DGP A;  3KMQ A;  2C2N A;  5CA5 A;  2VH7 A;  4WIQ A;  3L7P A;  2H4W B;  1ZM4 A;  5AE3 A;  5DDP C;  3DOM B;  2ATC B;  3OTD A;  2HVE A;  3LP0 A;  4I68 A;  4C2M A;  2P2C B;  1NPR A;  4O3R A;  5J2M B;  3BSA A;  3M9M B;  2EK6 A;  2JDJ A;  4DL6 A;  4DUZ J;  3C46 A;  3EVM A;  4RNH A;  4IG3 A;  2ZH4 A;  2YKQ A;  3G71 S;  1IQT A;  3K5M A;  1DRZ A;  4RBT A;  3GR1 A;  3OL9 A;  1OMS A;  3E01 A;  1RLD A;  4HR2 A;  4Q0B A;  3TZW A;  3Q86 A;  4ZLJ A;  2VV5 A;  4CT8 A;  3C16 B;  3G87 A;  4M63 A;  2F40 A;  4USM A;  4BBY A;  1PBA A;  3I0R A;  5KFV A;  4HT7 A;  3CDE A;  4RR5 A;  1NSK L;  3THP A;  2XG8 A;  4OI1 A;  2IC3 A;  3T41 A;  2HQI A;  2D3O R;  2V50 A;  3N6N A;  5G4D A;  4FYD A;  1BXN A;  3CJ2 A;  3TOQ A;  1NPK A;  1YGY A;  2OPP B;  5A8W B;  5DZ6 A;  4WCE Q;  1T7P A;  1NRK A;  1RK8 A;  1SL0 A;  4JI0 J;  1NSQ A;  4PAB A;  1S1T B;  2HUR A;  5K8N A;  3P3D A;  4PWU A;  2BW7 A;  4LF2 A;  1VQ6 S;  4FF4 A;  4KGV B;  1RT7 B;  2AT1 B;  3UVJ B;  3KJF B;  4NYP A;  2RKI A;  5KT7 A;  1EZZ B;  4DBQ A;  1KSP A;  3JSB A;  1Z4U A;  3MM9 A;  2E66 A;  4LFB F;  2GJF A;  5KT2 A;  1RAD B;  2DXE A;  3FCW A;  1PYO B;  2ZBI A;  3KK1 B;  1O5J A;  3PW4 A;  1MRO A;  2V67 A;  1VJQ A;  2ZD1 B;  4M5K A;  3AB4 B;  1VQ8 S;  2BDP A;  1ZET A;  2CJA A;  2FGC A;  4ED7 A;  3PIO Q;  4DV1 J;  1APS A;  1UZH A;  1PJ7 A;  3HFV A;  3LAM A;  4NRT A;  1N5V A;  4JYA F;  2PDA A;  1BD6 A;  4U7C A;  1U1Q A;  1FTR A;  1N56 A;  4LR8 A;  4NLV A;  4KE5 A;  2KM8 C;  3HKW A;  1RA7 A;  3LGH A;  2NSB A;  7FD1 A;  1VOM A;  4OZ1 A;  1T9X A;  3JAM Y;  1YHQ S;  4LFA F;  2CNO B;  3M32 B;  4A8Y A;  2KVI A;  2YNH A;  3OJS A;  3G8T A;  4ZHR B;  4RUB A;  1W7W A;  1VI7 A;  2XMM A;  3S6E A;  3LF0 A;  2MKC A;  2FJV A;  5LSR A;  2WTF A;  4F4W A;  5IFM A;  3GG0 A;  2QL5 B;  3PJ9 A;  3J80 U;  4QJV A;  2HVZ A;  2E5H A;  1Q4R A;  3QO9 A;  4FXV A;  3RGI A;  1LWC B;  1REG X;  4LF7 J;  2HYI B;  4PR6 A;  1RAH B;  3JS9 A;  3BKF A;  1VGY A;  1IJF B;  3DXS X;  2W4P A;  4KH1 B;  2OMO A;  4J9L A;  2CNN B;  3JTO A;  3QIP B;  4ID5 A;  2BJ9 A;  4K5S A;  1EQ0 A;  2V8D A;  3TX0 A;  4ZCK A;  2JEJ A;  3D6T B;  4NLS A;  2DXD A;  3BYR A;  3BGO P;  5HQ8 A;  2AYB A;  2H48 B;  5AT1 B;  2GS8 A;  2XYG B;  2CNL B;  2YQ0 A;  2OPQ B;  2E1C A;  2G2Y A;  1UKU A;  3MTK A;  4UUW A;  2GJ2 A;  2ZOF A;  2XSJ B;  4AYB D;  1GXU A;  2UZA A;  3RJM B;  1FEE A;  2VC0 A;  1ICE B;  2V8V A;  2RNE A;  3KNA A;  2C3M A;  2YKM A;  1TKT A;  3L09 A;  2FVR A;  4ERD A;  1L3V A;  2NZC A;  3P6Y C;  5C5J A;  5J1P A;  2Y0B B;  4A8S A;  2W4D A;  3LPE A;  1AFJ A;  1WJ9 A;  3T1Y F;  3GFY A;  3IAS 9;  3GIK A;  2JNJ A;  3M8Q A;  2KB2 A;  4NCA A;  2NXC A;  2MZ1 A;  1ZZN A;  4NI2 B;  3CCM S;  2CXE A;  3GIL A;  1FWK A;  1WNE A;  1TMM A;  2LEB A;  2ZEJ A;  2MGZ B;  5E0O A;  3NS7 B;  4LQ9 A;  1DFD A;  4YR3 A;  3A8I A;  4CLS A;  3POT A;  3A13 A;  2DNK A;  3CO9 A;  2AGP A;  1RWN B;  1FK9 A;  4B9U A;  4MYU A;  1IR1 A;  4ZIT A;  4DU8 A;  3OTE A;  3CJ5 A;  4OYZ A;  4OI0 A;  5SZT A;  1HWI A;  3ETM A;  4DU7 A;  4F2S A;  2BYC A;  1U24 A;  3NP5 A;  4CP5 A;  2HGM A;  1ARO P;  2XMJ A;  1UJ6 A;  1Q7Y T;  4USK A;  1AZS B;  1SJ1 A;  4CO0 A;  3BKT A;  2XGQ A;  3IMQ J;  3DMJ A;  5L1L A;  5KFL A;  4IH6 A;  1J27 A;  2DH7 A;  2RJZ A;  4ES3 A;  3MD3 A;  2L48 A;  2OLW A;  5C42 A;  3PG9 A;  1NEE A;  1NUE A;  2X7I A;  3H8Y A;  2GVD B;  2PII A;  3PYE A;  1I51 B;  3NMA A;  3FBE A;  2HMI A;  1QE1 B;  3HK2 A;  1HQE B;  1CPZ A;  1KON A;  1GQE A;  3SSR A;  5HP1 A;  2KKH A;  3D1H A;  3DLG A;  1RTI B;  3KLV A;  1YG0 A;  2CWK A;  1RJJ A;  2HNZ A;  3TA0 A;  2VUG A;  3CUL A;  1K8A T;  1WSV A;  4NEY A;  3MCM A;  3EZO A;  5DZ7 A;  3MFI A;  3N0V A;  4HLB A;  3RB4 A;  3PYG A;  1VCT A;  2LA4 A;  3HX9 A;  2VQE F;  1Y3K A;  3SSQ A;  1FKA F;  3O3L A;  4A8W A;  2DXF A;  3PW7 A;  4UOF A;  3P5B P;  2B4O A;  3GSI A;  2E9T A;  3V2U C;  2M7S A;  2V4Q A;  1SUQ A;  2AU0 A;  2J9D E;  2OD6 A;  4TY8 A;  4LVN P;  5KFA A;  1IVZ A;  2UUA F;  1LK5 A;  2QA4 S;  2LP4 A;  2MKI A;  2C2R A;  2JLF A;  2B9W A;  4IFV B;  1O8B A;  3GJT B;  5AXN A;  2BAN B;  3VAM A;  2CZ9 A;  4ZP7 A;  3RBZ A;  3IP0 A;  1KVI A;  4DF4 A;  4MJK A;  4JV1 A;  2ZDP A;  4CO2 A;  2DGV A;  4V19 J;  1A6L A;  2WW4 A;  6FDR A;  1WTF A;  1RAJ A;  2CPY A;  1Z2Z A;  4UQT A;  4CCH A;  3B8H A;  1GK8 A;  1NDK A;  3PJX A;  1WC4 A;  3CSK A;  2ALY B;  3Q8V A;  2CQG A;  2MJN A;  3FFI A;  3OVS A;  4ZJQ A;  1Q79 A;  4X4R A;  1VJW A;  1WKK A;  2KZM A;  2LXU A;  1SL1 A;  1S59 A;  3IO1 A;  2HZA A;  4FBT A;  3A8K A;  2M9K A;  3QLH B;  1B70 B;  2YVS A;  2QFJ A;  1C0T A;  5F8I A;  1TKZ A;  1SKS A;  4FF3 A;  5F0W A;  3SI8 A;  2UXC J;  1Q81 T;  1R6Y A;  2VBX A;  3OQ2 A;  1TV6 B;  5M2R A;  2CQ3 A;  3F56 A;  1S1W B;  2BAC A;  5F8H A;  4YEA A;  2NYI A;  1RWM B;  4G1I A;  3IA0 A;  3DC2 A;  3DU6 A;  3KWM A;  3C6T B;  2XWY A;  1HMV B;  1Y0H A;  1JB0 C;  2CQH A;  5ETR A;  3IBC B;  3T5H A;  2AGQ A;  4S0M A;  3M6U A;  2H51 B;  2DEI A;  4LF5 J;  3TX8 A;  2Z57 B;  1P6T A;  1X4H A;  3NRB A;  1S9G B;  2KYZ A;  1NM2 A;  5K8O A;  4O3S A;  5RUB A;  1M5P C;  4ANE A;  2YPZ A;  4JB8 B;  1U47 A;  1BQX A;  1YIT S;  2DO0 A;  2DIS A;  2J5A A;  4DV4 F;  1PBU A;  1B4S A;  2OTL S;  4ZVP B;  4PQU B;  3VGV A;  2UVW A;  1XER A;  3AB2 B;  3R1H A;  1Q8I A;  1KQF B;  1S9E A;  3SMZ A;  3FGV A;  1AXQ A;  3JSY A;  2Z30 B;  2R7V A;  5A8R B;  3E3X A;  2EK1 A;  4GVL A;  2E7W A;  2XO6 A;  3NGR A;  2M5Y A;  4JOU A;  3RG6 A;  3W2W A;  2HQ3 A;  2V63 A;  5GAD U;  2CKW A;  5B0E A;  2VBW A;  4H54 A;  4RW8 B;  1UEU A;  4WU2 A;  4GKJ J;  4DQP A;  4WJB A;  2F8H A;  4QBU A;  3I0S A;  3NL0 A;  1ZS6 A;  4DX7 A;  2F65 A;  3SQG A;  2LMI A;  2HHV A;  1T03 A;  3J7Y I;  4XAK A;  4P7V A;  2DNY A;  2YH1 A;  2MZT A;  5KFB A;  4LRA A;  3UR3 C;  1BE4 A;  4NCB A;  4WP3 A;  4JV5 F;  3IBF B;  3T1H J;  3IFE A;  1QY7 A;  3DDI A;  1HBN B;  1YDL A;  3CJK A;  3L3C A;  2HAF A;  3QT5 A;  2FJW A;  2MKY A;  3MMJ A;  3R27 A;  4WKY A;  1XMB A;  4TLQ A;  4MYT A;  1ELO A;  4ZKA A;  2RU3 A;  2XBP A;  2J7K A;  1UL3 A;  1FHT A;  2EW9 A;  2W9C A;  5LOQ A;  1DJ0 A;  2AJ4 A;  6AT1 B;  1W26 A;  4CH7 A;  1LWE A;  5DO2 A;  4N5S A;  2R2U A;  4LRB A;  1S49 A;  4I4B A;  3I6P A;  3BM7 A;  4URQ U;  3R7N B;  5B08 A;  2ACY A;  3GE9 A;  2KO1 A;  5BJR A;  1V3Z A;  1RU1 A;  2RDJ A;  4LF8 F;  1IBM F;  1SB6 A;  3V6J A;  4LR7 A;  3DGP B;  3UN2 A;  4XDC A;  2MQQ A;  3UPF A;  2OEM A;  1WWH A;  3HF5 A;  1TKX A;  3W60 A;  4B9N A;  3LP0 B;  2BQR A;  1FRH A;  2FB0 A;  3MF5 A;  4V1A k;  1F5B A;  4IG3 B;  2IM2 A;  1HR0 J;  3VGS A;  3IN5 A;  2KJV A;  3PXG a;  4PPD A;  3BJY A;  3LW5 C;  4Q0B B;  4HTJ A;  4WKR A;  1MML A;  5H9E J;  4OHV A;  5DQH A;  2A10 A;  3VZH A;  1R0B G;  1FO1 A;  5KOW A;  2LYV A;  3DRY A;  2J7U A;  3I0R B;  1SCJ B;  2XZD B;  4DL0 C;  3L4B C;  2VJV A;  2IC3 B;  1E6Y A;  1F6T A;  3D0I E;  5DG9 A;  4CLK A;  1KTV A;  2QA4 G;  1S48 A;  3CDU A;  2EXU A;  2PT0 A;  2NRE A;  4A8F A;  3RTV A;  4KGZ B;  2YNI A;  3NMR A;  2Y8Y A;  5KFC A;  2IVY A;  2HWI A;  1OSD A;  4YR2 A;  3NAI A;  1OY9 A;  5GAG I;  3X3U A;  2RKI B;  4I6A A;  2E5I A;  4I6W A;  4WTO B;  4IDK A;  3MM9 B;  1NPP A;  1SC3 B;  3FVY A;  3QFW A;  2QFI A;  4F04 B;  1LWF A;  3KTQ A;  3QAU A;  3T9Z A;  2R7S A;  2BXJ A;  2FVC A;  2P9E A;  3HT0 A;  1MNE A;  2ZHO A;  2CVE A;  1Y4Z B;  1LV5 A;  1MRO B;  1XR6 A;  4ETZ A;  1CVJ A;  1NJW A;  2MZR A;  3CTR A;  3G6X A;  5KG0 A;  2G2Z A;  1JXV A;  1TL3 A;  2FVP A;  3OL8 A;  4DSL A;  4F25 A;  1XEZ A;  3CC4 S;  2HPU A;  2C2K B;  1YJ9 S;  2EG1 A;  2HFV A;  3OFH A;  5E7O B;  1MU2 A;  1R8B A;  2M88 A;  4TU8 A;  2RQM A;  1XBW A;  3O8W A;  5JVH Q;  3GON A;  1WC0 A;  1YJU A;  4CLU A;  1HIY A;  2DR5 A;  1UPP A;  1C4C A;  3K5N A;  2YNH B;  1HBM A;  2ILZ A;  3P8B B;  4PXE A;  4JI7 F;  1RAG B;  2QEX S;  2WAQ D;  3VAL A;  2LXI A;  4A46 A;  2GAH C;  3BV8 A;  1FKO B;  3Q24 A;  2J76 E;  5T41 A;  4DSI A;  2X51 A;  2BJ3 A;  1U02 A;  4LSN A;  3IRW P;  1V9O A;  3NXZ A;  3QO9 B;  4ELU A;  4X4N A;  2OIH A;  5A2Q Y;  2MEW A;  4L3K A;  2ABY A;  3UDL A;  4AFF A;  1VQ9 S;  2QT7 A;  2XHC A;  4DLE A;  1I94 J;  4DUT A;  2ZDO A;  4KBI A;  3R9L A;  5IM0 A;  4ID5 B;  2W24 A;  4P9S A;  1EJ7 L;  3PEJ A;  1S6P A;  1RHJ B;  3CPW R;  3TJA A;  2AX0 A;  3BB5 A;  2POK A;  4F50 A;  3W9I A;  1S6O A;  2A6M A;  1WDT A;  2H4Y B;  4O44 A;  1YRX A;  1B0T A;  2BJ7 A;  4OI3 A;  3MM6 A;  5BYS A;  5ITH A;  2WSE C;  3B78 A;  3NKY A;  4HI2 A;  2O1P A;  3ET6 B;  1GTH A;  2YKM B;  1F9E B;  4ID8 A;  1TKT B;  1HI8 A;  4EFA C;  3FZB A;  3OSP A;  4M5L A;  3EZU A;  4DV5 J;  1HHS A;  4AQY F;  2X3G A;  4H4K A;  2GGP A;  2AJF E;  1UPM B;  3CJQ A;  4BWM A;  2CA9 A;  2MZS A;  3M6V A;  3F44 A;  3M8Q B;  4N8O A;  4DXL A;  1HHQ A;  2JL9 A;  3CCS S;  5F8G A;  2MLX A;  2W2O P;  2VFU A;  2R8G A;  5FD1 A;  2UUC J;  5E3A A;  3HHK A;  3PM9 A;  1G4C A;  1F2H A;  3EPG A;  3D5M A;  1S57 A;  1P1T A;  1Q0N A;  1PC4 A;  3POT B;  2R7Q A;  3QGI A;  1FVQ A;  3ZZO A;  3N5F A;  1FK9 B;  4IYQ A;  1PGZ A;  3KLF A;  1KRP A;  1PKU A;  4A8O A;  2JVR A;  1KHV A;  2ILY A;  4Y34 A;  1NK7 A;  1RXO B;  1JMT A;  5DLF A;  1RTH A;  3BR8 A;  5HMX A;  3FSI A;  3GJS B;  4WZM A;  1WG1 A;  5E33 A;  2QV6 A;  5FLX Y;  1GT8 A;  4D3H A;  3GV8 B;  3DMJ B;  1B0P A;  3RBD A;  3SXL A;  1YSJ A;  1QM9 A;  4AL6 A;  1NKE A;  5C42 B;  3NAH A;  2C2Z B;  4FBU A;  1DLO A;  3ZZZ A;  3CUN A;  3AD8 C;  2FHO B;  4Q44 A;  3OR1 A;  5F8L A;  2HMI B;  4W4M A;  2VKZ G;  3E2E A;  2KU7 A;  2HS4 A;  3FK4 A;  5HP1 B;  3DLG B;  1FKP A;  3CCZ A;  1JLC A;  1PG5 B;  2BE2 A;  3I4P A;  3G6Y A;  1H2U X;  5FDL A;  2IM1 A;  2UV8 A;  4EO6 A;  2HNZ B;  1RBO B;  2KG0 A;  1TL7 A;  4DSE A;  1FES A;  3NCR A;  1DY3 A;  2YX4 A;  3K57 A;  2V0N A;  2VA2 A;  2UVU A;  3CJ0 A;  1FI4 A;  4CYU A;  1Y9O A;  2QA1 A;  3KDO A;  4ZN3 A;  1SKW A;  2I5J A;  4LFA J;  2BJ8 A;  3B4M A;  5ETP A;  1L3S A;  1JJH A;  5LMU J;  2XWX A;  4OLO A;  2R2T A;  1GX6 A;  1SUQ B;  3MEK A;  3EGN A;  1XMO F;  3M8P A;  4TY8 B;  3K58 A;  5DDR C;  2VIC A;  1JLF A;  4CIO A;  3SFG A;  2W9B A;  3EXY A;  3EIC A;  2AW0 A;  2BRK A;  1X4A A;  3CDA A;  2DHA A;  3MED A;  4ZP6 A;  4M5D A;  2EFV A;  3WQP A;  2HWH A;  1VQ4 S;  3ITH A;  1WC5 A;  1NME B;  2ZE2 A;  1N0V C;  4O0N A;  4RZR A;  2M2B A;  1TR0 A;  4EGL A;  4G6V B;  5F8J A;  3HI9 A;  4DR7 F;  3WX8 A;  5LL6 d;  2OUG A;  1HBU A;  1TK8 A;  3QRQ A;  4C8K A;  1WEY A;  2RU9 A;  5A76 A;  1O0P A;  3QNW B;  4ZN1 A;  4QU6 A;  1AFI A;  1TTH B;  3BEG B;  3BGR A;  1LK7 A;  2BW2 A;  1FF2 A;  2IRU A;  1UVI A;  3QAE A;  4B08 A;  4EK2 A;  5F3Z A;  2MQP A;  1M0S A;  3DLK A;  3TAM B;  2R8I A;  1X4B A;  3FFI B;  2OEL A;  1YVF A;  1SQE A;  2R3V A;  3W66 A;  1D1U A;  1WOO A;  3BPS P;  3GG1 A;  4C3K A;  1KP6 A;  3T5K A;  2AMC B;  3AD9 C;  4DCP B;  1TKZ B;  3H4B A;  2Y1I A;  1X0P A;  3O2I A;  3FMB A;  1LW0 A;  1OY8 A;  4NL5 A;  1U8W A;  3BBB A;  3DN9 A;  4WZQ A;  4Y00 A;  1HQ2 A;  4DZD A;  2JFK A;  1SKR A;  4DR4 J;  1WI6 A;  2VFR A;  5AXM A;  3D4J A;  2DRB A;  1NLK L;  5L9X A;  4WYW A;  2Z8Q A;  4IRK A;  2QTW A;  3PY8 A;  2HIY A;  4F2R A;  2B3T B;  4DQQ A;  2XB2 D;  3R2D J;  5MAO A;  5A0Y A;  2PE8 A;  5H9E K;  4UUX A;  1RT3 A;  1IUJ A;  1WD6 A;  1XNQ F;  2XI2 A;  1S9E B;  3MMA A;  5AJ3 F;  2WBR A;  2D9O A;  4HHH A;  3Q89 A;  3T5J A;  3RBX A;  3FNN A;  1X9S A;  3W2W B;  5K8M A;  4LF6 F;  2J0X A;  3RB3 A;  1RAI B;  1H74 A;  3IS9 B;  3NGD A;  2ZIT A;  2LQ5 A;  3CJS A;  1KOO A;  1LFP A;  3GLJ A;  2DHG A;  3PKY A;  3K59 A;  4JI1 F;  5A2Q U;  1U1N A;  3SQG B;  4CO1 A;  3ZTR A;  4FF1 A;  1XTZ A;  1T03 B;  1Q1K A;  4XK8 C;  1JIH A;  2XTJ P;  5BR8 J;  4LRF A;  4ATN A;  2RVJ A;  1EET A;  5HAT A;  1UVL A;  4DFP A;  5J1E A;  4RW9 A;  2CIM A;  1RAO A;  3NNA A;  5C2G A;  2FHK A;  4R0E A;  3I82 A;  1T11 A;  1DZ5 A;  4QWA A;  3PRV A;  3RUB L;  1TAU A;  1WHW A;  1RWW B; 
#chains in the Genus database with same CATH homology
 1PAE X;  1WKL A;  1ZS6 A;  3L7U A;  1HLW A;  4WBF A;  3VGU A;  5C7P A;  3DKD A;  5CAA A;  1HIY A;  2NCK L;  3JS9 A;  4HR2 A;  4W98 A;  3Q86 A;  2CWK A;  1EHW A;  5BXI A;  3Q89 A;  1NDL A;  4S0M A;  3ELH A;  3FKB A;  3GPA A;  1VYA A;  1BE4 A;  1B99 A;  1BHN A;  2DYA A;  4FKY A;  3FCV A;  1K44 A;  2ZUA A;  1KDN A;  3ZTS A;  3EIC A;  3EVW A;  3EE3 A;  2VU5 A;  2DXD A;  4DZ6 A;  3NGT A;  1NSK L;  3DDI A;  1U8W A;  1NDP A;  1NDK A;  1XQI A;  4ANE A;  3B6B A;  3VGT A;  1BUX A;  2AZ3 A;  3BBB A;  3VVU A;  3Q8V A;  1NB2 A;  4UOG A;  4FKX A;  1HHQ A;  4C6A A;  4KPC A;  4F36 A;  4O0N A;  1S5Z A;  1NPK A;  1B4S A;  3EM1 A;  3VGS A;  3BH6 B;  1UCN A;  3FC9 A;  4AND A;  2DXF A;  3VGV A;  3ZTR A;  4UOH A;  4UOF A;  1NSP A;  1WKK A;  3ETM A;  4DI6 A;  4ENO A;  3WX8 A;  2AZ1 A;  1NCL A;  1S59 A;  3NGU A;  4CP5 A;  4DUT A;  1NSQ A;  3FBC A;  3BBC A;  1MN9 A;  3R9L A;  2HUR A;  3ZTP A;  2HVD A;  1NLK L;  1S57 A;  3B54 A;  2DY9 A;  3FBF A;  3NGS A;  1JXV A;  3Q83 A;  1WKJ A;  1MN7 A;  1NHK L;  3Q8Y A;  3NGR A;  1W7W A;  3FBB A;  3Q8U A;  5IOL A;  1NDC A;  2HVE A;  3BBF A;  3EJM A;  3ENA A;  4EK2 A;  2BEF A;  4F4A A;  1PKU A;  1F6T A;  3ZTQ A;  3EMT A;  2B8Q A;  3G2X A;  1NUE A;  3GP9 A;  3MPD A;  2BX6 A;  3ZTO A;  4ANC A;  5CAB A;  1XIQ A;  3PRV A;  1LWX A;  1LEO A;  2B8P A;  3BH7 B;  2DXE A;  3FCW A;  3PJ9 A;  3EVM A;  3FBE A;  3VVT A;  3EVO A;  1F3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...