1NDKA

X-ray structure of nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
KERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIICGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of nucleoside diphosphate kinase.
pubmed rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 45
structure length 148
sequence length 148
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1993-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndkA00
1NUEA 1BE4A 3FCWA 1UCNA 3EM1A 5BXIA 1B4SA 1XQIA 4UOHA 3PRVA 1NDPA 4UOGA 4ENOA 3FBBA 3NGUA 1HLWA 1WKKA 3EVMA 3VGSA 3Q86A 1F3FA 3Q83A 4FKXA 1B99A 3PJ9A 1U8WA 2AZ3A 1BHNA 2HVEA 3EMTA 2VU5A 1HHQA 3VGVA 2HURA 3L7UA 4O0NA 1ZS6A 3R9LA 1LEOA 2BX6A 3EICA 4FKYA 4DI6A 3VGTA 2DXFA 4F4AA 1LWXA 3B54A 4KPCA 3Q89A 4UOFA 3DKDA 1S59A 3ENAA 1WKJA 3ZTOA 2AZ1A 3BBFA 3FC9A 3VVUA 3Q8UA 4CP5A 2NCKL 3NGSA 3B6BA 4S0MA 2DYAA 1NDKA 1NSKL 2BEFA 4ANEA 3DDIA 2DXEA 2DXDA 3FBEA 3Q8YA 3FKBA 1MN9A 2DY9A 4EK2A 4W98A 3G2XA 5IOLA 1MN7A 1NLKL 5CABA 1NSPA 2B8QA 1NCLA 4C6AA 4DUTA 1NB2A 3NGTA 1NPKA 1K44A 2ZUAA 4WBFA 5C7PA 1S57A 3ETMA 3EVWA 3ZTQA 1NDCA 3BH7B 4ANCA 3EE3A 3ZTRA 1W7WA 2B8PA 3FCVA 3GPAA 4HR2A 4F36A 1HIYA 3MPDA 3BBCA 3BH6B 1NDLA 1PKUA 3FBFA 1BUXA 1PAEX 3VGUA 3ELHA 1F6TA 1VYAA 1S5ZA 3NGRA 1NHKL 2HVDA 1XIQA 2CWKA 3EJMA 3FBCA 3EVOA 1KDNA 1WKLA 5CAAA 3WX8A 1NSQA 1EHWA 3GP9A 4ANDA 4DZ6A 3ZTPA 3VVTA 3Q8VA 3BBBA 3ZTSA 1JXVA 3JS9A
chains in the Genus database with same CATH superfamily
1SBRA 2CZ9A 2IVYA 3N6LA 1NUEA 3M1VA 4PG4A 1AUSL 3TEHB 2FGCA 1GT8A 3H98A 1K47A 2CZ4A 4D3GA 5BXIA 5D78A 1QAXA 2IM2A 4BWMA 3TYTA 2N3OA 3BGUA 5IWAJ 3GLJA 3E3XA 4DSIA 5KFKA 5ETNA 2GMHA 2JZ5A 1FNOA 2MKYA 5KAKA 2CVEA 2HFOA 1M1HA 3DMJA 4MKBA 4A4JA 4QIGA 3DRYA 3IS9B 2QA4G 2QIFA 1H38A 1FJCA 1NH7A 4HACB 2KJVA 3IG1A 3FVYA 5KFDA 4P2SA 3PDNA 3Q83A 1FVSA 5J2PA 1KFDA 2QJ3A 2FYXA 2L9NA 3CJTA 3RG6A 4CZCA 3NS7B 3W1YC 2BW7A 4I4BA 3W63A 1M1GA 3GIMA 1WOPA 4WZMA 4DR3F 2VL1A 4F4ZA 4JP8A 3QATA 2CRLA 2B9XA 1KRPA 1O0PA 2IA6A 1NZ8A 1OMSA 3RAXA 4DQQA 3EPIA 2NSBA 4NCAA 2BJ7A 3QLHB 1VC6A 3TZZA 1HW8A 2E7VA 4NX9A 5LMNJ 1XC9A 1S6UA 1S9EA 2EBGA 2ZOMA 1FT8A 4AXIA 2B9WA 1X5TA 1PBAA 3PJWA 2EC0A 4JV2A 4UOFA 2LDIA 2VASA 3DKDA 2IVFB 2NR0A 2E5JA 5DDQC 2N82B 3SMZA 2IC3B 1REGX 3R1LA 3QRQA 3FC9A 4DMZA 3BO2A 1UW4A 3S7RA 2C2NA 3LOUA 1YJTA 4NLSA 4OI4A 1VBXA 1MSWD 1JKHB 1S1TA 2Z4PA 3HZGA 1UVLA 2VG5B 2PFDA 1RHMB 5IM0B 4JI0J 1DZ5A 2HNYA 3PJXA 1PJ7A 4DR3J 2AQ4A 3KG1A 5F41A 2X1BA 1JLFB 4EUVA 3RW6A 3R27A 2VD3A 5HANA 4DSEA 1UVKA 5HLFA 1QM9A 1YJRA 2Y9HA 3PEJA 1GTEA 4H54A 1NKBA 2HNZB 3DRRA 3G2XA 4AL7A 1HWLA 1SQGA 1Y5LB 1NSPA 3BREA 4NYOA 3PR4A 5J2QB 3LPEA 4K4WA 3CC7S 2MHNA 1VQ9S 4RUHA 4F02A 2AYEA 2MZSA 1E6YA 4OZJA 4DR5J 4WBFA 1WC4A 3P5TL 3W2WA 1GXUA 2W8KA 2VQFF 2KB2A 3EGZA 2UXDJ 3MURP 3I32A 3KMSA 3OTOJ 1XEZA 2MKIA 1N0UA 2C28A 1S1XA 1RYSA 4WKYA 1W7WA 4KKOB 4MK8A 1S7IA 3VAGA 3IXQA 5AXNA 4C98A 4F3OA 4ZCLA 1WELA 3M30A 2FTRA 1N33F 1WOSA 2AJ0A 3KLGB 1H3DA 2D9OA 1LXNA 1RTIA 2PDAA 4FP9A 1VRQC 2EK1A 2IYGA 4OZ1A 1WJ9A 4WIQA 4DU8A 2DRBA 4B9MA 2J76E 2BRKA 5AE1A 4DL7A 2OPRA 5B0GA 1MMDA 3CJKB 2RU9A 1P1LA 5THWA 1NK9A 1ICEB 2O01C 4KGMA 3ILLA 2JOQA 4QWBA 3JTNA 5KFCA 3DLJA 5E3QA 1U49A 4EYHB 4KV8B 4EZ9A 2DR9A 3W9JA 5J1PA 2W7AA 1NHVA 3K7RA 2ZOFA 4GVBA 4RWWA 1SVDA 4HT7A 3ZZYA 5D15A 4DX8H 2B4UA 5CYMB 4LF9F 4DPYA 4CLWA 3DLGA 3SV4A 2RRNA 2JLEA 5A8WB 3MM7A 2J9CA 3ZZRA 3QWUA 4TU9A 4B9VA 1XN9A 3RUBL 2WOMB 3G8TA 3CULA 2UUAJ 1DBDA 3UCGA 1J27A 3O2IA 4DV7F 4JI5F 4HEA9 2CDRB 4HHUA 2Z8QA 4NCGA 3W9IA 2R7RA 4K50A 4P6QA 4CLLA 1UJ6A 1BE4A 1FXDA 2BJ8A 2R8JA 2YKQA 3JQKA 1ZAWA 4A8YA 2IRYA 3VF0B 1FJGF 3TX8A 5C25B 4QU7A 3FBBA 2FGOA 1F2HA 2CPJA 1VISA 2KJWA 2XHCA 1UMJA 1E6VA 3JQJA 2R8KA 3S6EA 4BS2A 4LFCF 4AUKA 1JLCB 3VQSA 2DPJA 1S12A 4DPTA 2CQCA 2KM8B 2OPQA 1GMWD 3ZZTA 4KB7A 3M8SA 4DR1F 2HRTA 2F4VF 1WORA 2HZAA 2GV1A 1LK7A 2V4JB 3IAM9 4URQU 4ED1A 3AT1B 1V5IB 3PJ9A 3SCKE 2QL7B 4K2XA 1OY8A 2Y8WA 4M1KA 3IM9A 2D1CA 2VFVA 5HQLA 3KK2B 3P49B 2UXCJ 1PJ5A 2F65A 4LFBJ 4X4SA 1OQ3A 3V4IB 2YVSA 2ACMA 1WHYA 2C22A 1IKXB 1H7WA 5AXKA 1IVZA 4P73A 1NO8A 1Q0NA 3H2VE 2E29A 1YBUA 2P5VA 3R8YA 3WC0A 4NLRA 2GHPA 1M0SA 3T41A 1TU0B 3OJUA 3F0NA 3QSYB 4JI3F 1S0NA 2Z30B 3PR5B 3I56S 4DV1J 4YFUA 1HR0F 5HK4A 5GAGU 2HGLA 3W5ZA 2ZOGA 3GV7B 3MUMP 4JYAJ 3AB2B 3W5XA 2BANB 5D8HB 1R27B 1XERA 3TJ9A 4DR4J 1X4FA 2X3DA 1C1CA 1S6QA 4DPWA 4LF9J 3N5BA 2XSJB 3CIZA 3OVAA 2YWGA 1F1BB 2W25A 2DYAA 3CJQA 4X4PA 2GA7A 2OPSB 2QGFB 4HHJA 3E8OA 1RK8A 2WSCC 1RISA 3DC2A 5D77A 5J2NB 3T6BA 4KHPJ 1NK6A 2QFIA 2MKSA 2R2UA 1UFWA 2KFYA 3MAAA 1T9TA 1MN9A 3EGWB 3KTQA 4P2FA 3KK3A 4NOHA 2YWEA 1F9EB 5IQQA 5A2QY 5FJ4A 1NLKL 3LO3A 3J7AN 1JLEA 4LSNA 4U7CA 1IBMF 1DFDA 5DDRC 1C0UA 1R0CB 3GIKA 3EXCX 3R7SB 1HI0P 1DQ9A 3LPYA 2WAQD 2R2TA 2XQCA 4ED7A 2GQ2A 1SH0A 1T05A 1R8PA 3NLCA 2A3JA 2ZVIA 3IC1A 3ZTRA 2D3OR 1RBOB 1Z4UA 4FYXB 1ZTWA 2VOOA 3IWLA 4HL9A 3HM9A 4DG1B 2VA3A 1TUWA 1MNEA 2QMWA 2Z58B 3CMES 5CD4H 3M6XA 4J5OA 3UN2A 2RHSB 4P10A 2CNOB 1EQMA 4KGVB 2V4QA 4YHHJ 4XAKA 4X4RA 4URSA 3TAMB 2EBEA 1BQMB 1N88A 3M1VB 1HBUB 4Y0FA 4LF8F 3C46A 1EETA 2DHSA 1R43A 1TL7A 3TA1A 1C4AA 2HNDA 1RAJA 1F6TA 2XMAA 2XTJP 2HSEB 3FEXB 1C0TA 3IRXB 2KYXA 3DFEA 1S6PB 3QWPA 1W2BR 1JQGA 2KXHA 4ZCIA 2OPPA 3IBFB 1REVB 2N7CA 4USJC 3UN5A 4NLWA 4I6YA 5D3GA 2AP6A 4ZKAA 4N47A 3ZZOA 4M95A 1K0TA 2DNOA 3PW4A 1Q53A 3KFWX 4ED6A 2FLLA 2V50A 4C0OC 1SJFA 1TL1B 2MLZA 3C16B 2Q3PA 4IO1A 1OSCA 1YRUA 1XK8A 2H5IB 3RGIA 5KFRA 5H9EK 4H4OA 1UEKA 2C42A 1EKSA 2RUGA 3NP5A 2XMVA 1T9YA 4OYBA 5C24B 5KFQA 4CO0A 4ATNA 4P74A 3PX6A 1D9DA 4Q44A 2VDIA 5HVFA 4UUXA 1X5OA 1RACB 4ECWA 4JI1F 1RWNB 4RWXA 1QE1A 1UCNA 1WHXA 3RJMB 1DQAA 4DWIA 1R0BG 3IMQJ 3LP2A 3QYYA 3JAMY 3EWGA 4TQRA 1U1MA 2DVIA 3DDKA 4IUFA 2ZBPA 1HNXF 3I96A 1VRTB 4K4YA 2ZZMA 1WKKA 4ILMA 4DV5F 4B9LA 4U96A 3C66A 3G86A 1WACA 1X4HA 5A8RA 3H7HB 2LECA 1NAQA 5GMEA 1U47A 3OTBA 5KG1A 2CKWA 2R8IA 2QMUB 1VQYA 4PCQA 4NMLA 3MMAB 3J7Z5 3ZXWA 1U1PA 3CCMS 3MOZA 2CJXB 2F8HA 3I0RB 1WSVA 5EUHA 2HVEA 2RRBA 6FDRA 3QIPB 4UZBA 4AQYF 2HWIA 1GXTA 1ROFA 1FNXH 1F60B 1NPPA 2MQ8A 4RUBA 3GJRB 4ZJOA 3R9LA 5K14A 1NK8A 4YS2A 1KKHA 1YBAA 4ZN1A 3HVAA 1KC8T 4HH0A 3B4MA 2X1FA 2VUGA 3RBDA 5CD4A 3KHLA 2AMCB 3K5LA 1J5EJ 2A18A 2MY8A 3AXMA 1D09B 3OPKA 3CT9A 1KEKA 2C2RA 1E6YB 2HBQB 4MMOA 3S1TA 1VI7A 3HSDA 4RW8B 3PKYA 2IM1A 3W3SA 4GKKJ 1QAYA 3PX0A 2B5JA 5F0UA 3Q0AA 3RB4A 1FKPA 1UFLA 4IKAA 4HT5A 4KKOA 2K7KA 3NGSA 3MWBA 1SC6A 3QZ8A 3KK1B 1MWQA 2YPZA 3O5TB 2JC1A 5I3PA 2RQKA 1NEEA 4TU7A 1VMBA 5B0CA 3EDRB 4C7QA 5I3UA 3FSYA 2WVBA 2HW3A 1S72S 1RTIB 3DDIA 4HDHA 1UPMB 1O5JA 2GJFA 1W26A 1ZZFA 4FNIA 2ABYA 1R8CA 3NMAA 2XG8A 4DQPA 2O5DA 2OLWA 4CH0S 3FNNA 3W62A 5KFVA 3SQGB 4OJ1A 2XHWA 1VJWA 2EG2A 4WPAA 5I3QA 1WG5A 3CDBA 4OZ2A 3CEDA 2M8DB 4X4VA 5ETTA 2XMTA 4DV5J 2DNPA 1IQZA 4FYYB 1N0VC 5DG9A 3ULHA 1C4CA 4I6WA 4Y3CA 4X65F 1NDCA 1UEVA 3GFXA 1I6JA 2XB2D 4K4TA 1R7IA 1X0PA 2B8PA 3OSPA 2ATCB 3KDNA 2HLTA 2EKYA 2PO4A 5B0AA 3SYZA 3UDLA 2L08A 2HIQA 4OYOA 5KFUA 4C8KA 1UVMA 3V6JA 4DS5A 2LA4A 2FC9A 2OTJS 3H5XA 1BUXA 4CLTA 3BPSP 3HFVA 2XYHB 3BGRA 3DRSB 3VGUA 4UQGA 4A8QA 3M2RA 2I2YA 4PPZA 5IT4A 1HA1A 2EI5A 4ZP7A 3W64A 5A6PA 2A6OA 1QUVA 2HKEA 2RE1A 3LGMA 1I1GA 3TO8A 4QR2A 2G2OA 2V8PA 4DZDA 3BN7A 2CQ3A 3DCAA 1KOHA 1NKCA 1GAOA 1FI4A 2VF3A 4ILRA 2V8DA 4JI6F 1PG5B 2LXIA 3H5UA 3TJ8A 4B3TJ 3A1YG 2GVZA 3O8WA 4QJVA 3DM2A 1SJRA 3WBZA 5A6WA 3LW5C 2A1BA 3MTKA 3HT3A 1NK5A 3PYDA 1JJ2R 4EWTA 2B7CB 3NMRA 4OZ5A 1SUQB 3Q2TC 2V8HA 1RT6B 3U1LA 1RE1B 2WONB 5M2UA 2E5LF 4CO2A 2GCFA 4CQ1A 3HHLB 2V4JA 3FQLA 3OQ2A 5KFIA 1K0VA 2CPFA 1ZM9A 3DLLQ 2B0GA 1Z2LA 2DGVA 1RABB 2DNRA 2MTLA 4JI2J 1X9WA 1FE4A 2BXJA 2R7XA 3D1QA 4QIFA 5ETPA 1T03A 4P7VA 1PC4A 4DL4A 2BOPA 4YEAA 3MEGA 1F3FA 3EZOA 5AXMA 2HFNA 3QLHA 4DX5A 2LEBA 2W2PP 2V4RA 2ZJRQ 2V0NA 1RAFB 3FFIB 3DYAB 1NBEB 2H3EB 4KO0A 3L4BC 3N5FA 3H5YA 3K5OA 2V68A 1WG4A 4J9MA 2F8MA 3LAKA 4OYMA 2VH7A 2XNRA 4DL2A 3QJJA 3RBXA 1HBMA 4USIA 5KG3A 1HNVB 5EGYA 3OW2R 4I2PA 1DY3A 4C8YA 4NPOA 7AT1B 4BBYA 4Y28C 1T94A 3M2VB 3D6TB 5IM0A 4LSNB 4OHYA 3MM5A 2UUWA 4KPCA 3HVRA 3CCSS 4RW6B 4OI0A 1NZAA 3D6FB 2ATLA 1Q82T 4JI2F 2KZMA 3NAIA 4ZIVA 2AZ1A 5BR8F 4N76A 3CVKA 4PWUA 4WFXA 1SJ4P 2BKNA 4B3TF 4EEYA 4RU2A 3PM9A 1R8BA 3ZO7A 3DRRB 1U2RA 1CC8A 2IDEA 2H65B 2MZQA 2WVFA 5GADU 3W65A 2H5JB 4Q43A 3B6BA 4ZITA 1RT2A 1CBKA 1WI6A 1VQNS 1CJUB 3D3CJ 1F3VA 4ELVA 3IWNC 1CSJA 5JVGQ 1TKZA 1X5PA 3BF4A 4NLDA 2Z56B 5KFWA 2V9WA 2I0XA 1XNQF 1F2GA 5LMUF 5BJRA 1CJKB 3SQOP 3T1YF 3NWGA 4IRDA 5HMXA 3H40A 1DQ8A 2N7YA 2HAFA 3DOMB 4C2MA 3MUVP 2MZRA 2QLBB 4WIIA 3DOKB 3K57A 4EBDA 4C3LA 1NNDA 3AH6A 1YJWS 2YNFB 2ZE2A 2M5YA 2KG0A 3QJLA 2WTFA 2GZOA 4OJGA 2HQGA 5D3GB 3HDSA 3BKUA 1KHVA 3HVTA 1WC6A 4DSKA 5AE3A 2DK2A 2IFXA 1TK0A 1VQKS 1BWVA 1HBUA 2B51A 3BH7B 1WTBA 1L3TA 4C8ZA 5KG0A 4ID5A 2LQBA 4NXNJ 2F3JA 1D8YA 1RWOB 1ZPWX 1HIYA 3PYGA 3R5DA 3CJ8A 4O3RA 1XNRJ 3QO9A 2E1MC 1XMQF 1N34J 4DQSA 4Q5VA 1PGZA 3DLHA 4B3SF 4Q2LA 2QYGA 3BH6B 2HHWA 1EJ7L 1RZMA 4QPTA 1HQ2A 3H5SA 1SKWA 1FERA 1X4CA 2QTWA 2DEJA 1U24A 4DSFA 5AT1B 2G13A 3MCMA 2N4CA 3AJ2A 3KLIA 3N0VA 3NBPA 3NGRA 2R8HA 4J9KA 2DITA 2UVUA 2G0JA 1Q7YT 1UJ5A 1RT5A 1YG0A 3T1AA 1U1QA 1KSPA 2E9ZA 1RADB 3P3DA 4O44A 1T9XA 2XS7A 4TXSA 2UUAF 1KDNA 3ET6A 4NCGB 3LWMA 3IR7B 2A6MA 3GWCA 4QU6A 1GMUA 2FJEB 2IAJA 3WX8A 3G6VA 2UXBJ 1T3NA 3IWXA 1UAWA 1HPZA 2K3KA 3VZIA 3RTVA 4JI4F 5C25A 2LEPA 1V9OA 3JSBA 3RRHA 1Q81T 1IKYA 3SSQA 1XMQJ 4K4UA 2P9CA 1JLCA 3HULA 4C0BA 2EVZA 2PN6A 4B3SJ 2YPYA 4X4UA 2V63A 2C3MA 1RAAB 1TUGB 2I1RA 4NASA 4J9PA 1YQHA 4ELTA 4W90B 4ECYA 3ZNJ1 3KLFB 1N5TA 5ETOA 3E01B 2XMUA 1HQEA 3V4MA 1ZM3A 3KK2A 4Y2IA 2PI5A 1HLWA 2DHAA 3GYNA 1GMWA 2D41A 2QE5A 3IBWA 4RBUA 3VAKA 4YMEA 2FJWA 1TL3B 1DRZA 3E2EA 3L7PA 3CIMA 1S1VA 1RBLA 3UCZP 1NKEA 2MGZA 2PE8A 1U6FA 2DJWA 2ZD1A 4F67A 3PACA 4KIAA 4TU8A 5JVHQ 3L7OA 4L3NA 1TTHB 3C16A 3L3CA 1N48A 3EMTA 3I4PA 1F5BA 4LVOP 5SZTA 4V19J 1M5PC 4QPXA 5DZ7A 5C24A 3THVA 1Q7LB 2DNHA 2FVPA 1IR2A 1ZS6A 4FN5A 4OYIA 1RQ0A 3A8KA 4DV3J 2YNGB 1WEYA 1UZHA 4Y2CA 5J2MA 1FKPB 4TLQA 4LQ9A 4LRCA 1SC1B 4OZLA 5KFGA 2DGTA 3NWRA 4IFYB 4A8SA 1TP7A 2OFHX 2MLXA 2CADA 1VRTA 3MTJA 3QT8A 4ZLNA 4URGA 3QT5A 3OBIA 4HKQA 1ZTTA 2RB7A 3CW2C 3PW2A 4EBCA 2BM1A 1KVIA 2XLJA 4RNOA 2LU2A 3OFEA 3QNWB 5CXTA 2Q1LA 4IDKA 3SDEB 3CMAS 2HHVA 4LIWA 1RHQB 4ZVUB 3PVXA 3ITHB 2F9JA 3FRZA 2AGQA 3BJYA 1SJQA 1SJ1A 2E5IA 1OY9A 2G2YA 4BC7A 1TVRB 2DNGA 2FHMA 2VZ9A 3BEGB 3PEHA 1UETA 3M05A 4M5KA 3OSNA 3H4DA 1ZZNA 4MKYA 3FBEA 3KLEB 2POKA 3DXBA 2E1RA 4HYKA 3WDOA 5H9FJ 2AWZA 2D74B 2ASYA 4DV0J 3GG0A 1SIZA 4ECQA 4ZPBA 3J80U 3NNHA 1NCLA 4K5SA 2KVIA 1U0HB 5A0YA 4EI2A 4C8OA 2QG9B 4RBTA 5K8MA 1YHQS 2C3UA 2JX2A 3EGVA 1CULA 4O3OA 2IMWP 4PXCA 3L9ZA 3VCDA 2LLZA 2HPUA 5HMWA 2CQ2A 1CS4A 5L8RC 2XO7A 4A8WA 2DGWA 1JLBB 1BD6A 1Q95G 2Z57B 3B78A 2HHHJ 1VLOA 2LU1A 4B9TA 2KHCA 4ZCKA 3MHYA 3OTDA 1HBOB 3DLKA 4YOEA 3AY0A 4K4XA 1Z2ZA 1QY7A 1FRIA 2MQLA 3O44A 5D0EA 4UUWA 1HNIA 1SXLA 1JNRB 2U2FA 4KBIA 3TZWA 3VQTA 1M5VC 2HFSA 2RKIA 4C4WA 3G6ES 1PKUA 1N5YA 2HRYA 4I64A 3QBCA 3T9ZA 1XR6A 1TL1A 3DM2B 4ID8A 4GC7A 4U95A 2FJDB 5F8IA 2R7QA 5D6GA 4DV0F 2HHXA 1AFIA 3AAWB 5HATA 3MFIA 4NYZA 1RAGB 3IBCB 4B9SA 2CWKA 4ELUA 4M5HA 4C9DA 1FDNA 2J0WA 2YTCA 5KG7A 3EX7B 5F3TA 1VLYA 1X5SA 1WKLA 5IT0A 1RKIA 2BJ1A 3LH2S 3MEGB 3NG8A 3NXZA 5BYRA 3OLAA 4PYDA 1MU2B 1UJ4A 3OL6A 3R5AA 1FCAA 3LP2B 2ASJA 4N8NA 3R7NB 4ANDA 5DQIA 1ZAXA 2CPHA 4X4QA 3F73A 4K4ZA 3QAEA 4M8LA 3DOLB 3VAJA 3HI9A 4KHRA 1RAEB 2FZKB 2M9KA 3JS9A 2QMXA 2VQEF 1W2IA 2JEFA 2ERRA 1I94J 4RLEA 2BABA 3MM8A 3AJDA 3HMJG 1TKTA 2ZNZA 3BYRA 2WHOA 4KC5A 2LQJA 3CDUA 4UW2A 4ZJLA 3U1MA 1LFPA 1KLMA 1UWBB 1Y5NB 4G65A 2B43A 2W4DA 2HBYB 2HQFA 4KO0B 3UD5A 4AQYJ 2HRUA 3MI7X 3OXFA 3Q86A 3GV8B 2AIRB 4CLFA 1VQ7S 1G6BA 3MR3A 4E8UA 4FKXA 3NAHA 1VK3A 2XZDB 3BQ1A 3A4TA 1U7LA 4IOBA 4C11A 4ETXA 5LMNF 1U8WA 2E1PA 3QIDA 2W7OA 2WB1D 2R42A 2A0FB 1CJUA 1Z1ZA 2DBBA 2C3YA 2RAQA 1TZ0A 2VU5A 4H4MA 5D4PA 3G96A 2G1DA 4TYBA 2QFJA 2DH9A 3HFKA 2WBMA 3TOQA 2MZ1A 2VQEJ 2NXUA 4ECXA 3FMWA 3D28A 4PABA 4FKYA 4U7UK 2CG8A 3A8EA 4DLEA 1U1OA 5K9FA 1I94F 2M3DA 2V2KA 2BE2A 4MIAA 4RPFA 4DUZJ 4LF7J 1AYEA 1LW2A 1EZZB 2XI2A 2XWYA 2MQMA 4AE5A 3GV5B 1NJZA 4LFAJ 4F4AA 3B54A 4RW7B 3TUZC 3GFZA 1Q1KA 5DGAA 1WKJA 1XWLA 2W9BB 4ECZA 1IM6A 2ZHBA 2GW8A 2JL9A 3PHTA 2JFDA 1TV6A 2DKOB 2QSFA 1YX2A 3C14B 5LJ3Y 2HFVA 3ENQA 5ETRA 3UI3A 2QRRA 2KRRA 3IAS9 4OFZA 5IC6B 4YY3J 4DUYF 4CP5A 3KHRA 3DNCA 3DOMA 1U45A 1HL6A 2VBWA 2CJ9A 4NZ6A 2I6WA 1UVNA 3EZ5A 2V8VA 1S99A 2XBPA 2OUGA 1NK0A 2IJFA 1RTDA 4E0DA 5E3PA 3PIOQ 3HT0A 3EXYA 4XO0A 2FJVA 3LAMA 2V67A 4ECUA 2W8LA 2RF2A 4OI3A 4LQ3A 1NJXA 5KFTA 5KT3A 2AU0A 1A9NB 2MQNA 2ZUGA 3F56A 1PCAA 1Q4RA 3C6TB 3K8WA 1H73A 1NMEB 1RAIB 3IO1A 4NEZA 2V34A 3M6VA 3MM5B 4TLRA 3TUJC 5HBMB 4ERDA 4FBUA 4YQWA 2MB0B 1GK8A 3JSYA 4ITSA 4KFBA 2PIIA 2ZM6F 2WCXA 2QEXS 2ZH8A 4AD6A 2J8SA 2GC8A 2EFNA 3DHWC 3ETMA 4DR7F 4FXVA 4NRUA 3BGOP 4H4KC 3W2VB 4HR2A 2HHPA 1RT2B 4WE1A 1JLAA 1OJ4A 4QZVB 4CTAB 1QAJA 4M5GA 2HZCA 4NI2B 3DLBA 4IG0A 2P9EA 3HD2A 4QYZJ 3G6YA 3TZYA 1WUUA 2NS1B 1H0HB 2Z0GA 5KFMA 1T9UA 2BV3A 5AE2A 3HD1A 3L09A 2KHDA 2GHVC 3GJSB 1SB6A 1S9EB 1N5QA 2HGNA 1TAQA 3M6UA 4FS2A 1KHWA 1UEUA 3RR8A 2BKPA 3TW0A 3VTIA 9RUBA 1K1QA 2DNNA 3FBCA 1S9FA 2JEJA 3WX4A 2CJYB 4OX9J 3TANA 5A8KA 1IBLJ 3GB0A 1UA0A 2Q6CA 5B0FA 4WYLA 4ES2A 4NXMJ 4CNYA 2QA4S 3AHPA 1JKHA 3HSGA 1ZM4A 5LM7E 1HYSB 3GP9A 4ID5B 4N77A 3THPA 1HQEB 3K0JA 3GR1A 3POTB 4N56A 3SI8A 1S97A 4UOCA 5EDWA 1JXVA 5IV4A 1UA1A 1K8AT 4QOTA 4ECSA 2HS3A 4RO0A 4G3IA 2FDNA 3VR1A 3OFGA 1HHSA 1JB0C 3BSAA 4DR1J 1RSCA 2CG4A 2GVDA 3FCWA 4LSLB 1R31A 2HWTA 1O8BA 2IPOB 2LKZA 2Q79A 2VICA 2D3ZA 4IFYA 2J7KA 4F2RA 4JV0A 2NLWA 5G0RA 1S9GA 2DHHA 1WF0A 4Y2KA 1RT5B 3TRGA 5F3ZA 2AHOB 1GX5A 3EYZA 1R89A 3GYXB 1FK9A 4PWDB 2ZJPQ 3T1HF 2K06A 4QBUA 4KY3A 2X1AA 4J9SA 2IJRA 3TP2A 3HJVA 2OELA 4CO4A 1N32F 1FJGJ 2AYMA 2AX1A 2MQOA 2G4BA 2FD2A 4JI4J 4PEOA 1OS5A 2HFZA 2MYFA 2WZ1A 4LIRA 4NYPA 4X4OA 2P2CB 1M5KC 3M8QB 2DIUA 4DR4F 4IRKA 4LMZA 5IWAF 1OYEA 3J81U 3E01A 1KWMA 2M88A 2I5JA 2V2VA 3CCJS 4Q8FA 2CJKA 1Q8BA 4UTGA 4GKJJ 1P27B 4ZDNA 4USTA 1TVRA 3KJNB 1GFWB 2NYHA 4J9NA 2E9TA 1TK8A 3MM6A 1KVJA 1S10A 4Y65A 1U1NA 5ETSA 3CJSA 1G3OA 1P1TA 1J2VA 3M6WA 2KT5A 3MPWA 2HFUA 2HNZA 3H4BA 1JK9B 5L38A 3PCOB 4CYUA 1RT1B 3V6DB 1SPBP 1TKXB 2AJQA 1PSDA 4P2XA 1MMLA 4NL5A 4Q2MA 4Y2MA 4F0MA 1DLOB 2LXFA 4XDDA 1PBUA 1L3SA 1FRLA 3VWSA 5C5JA 1BMQB 3GMGA 2YH1A 2Z2YB 2FHJD 4NLOA 4EK2A 4F50A 1JLBA 4X65J 4BCAA 2CPIA 1B0VA 4GO7X 1MWZA 3D66A 3CSKA 3HX9A 4WU2A 1AA1B 4DL6A 1OYDA 3QO9B 2GIRA 1HARA 1NPKA 2Y1IA 1Q86T 2BBEA 3DMJB 1N34F 3PO5A 1U2FA 3BR8A 4B3OA 1HD0A 4DR2F 3KNAA 3OVBA 3OR1B 3F44A 2RKIB 5HVGA 2VPXB 2GMLA 3CJRA 3EVWA 2D3UA 1ZA2B 4JBCA 4CLYA 3QGPA 5CCMA 3H8YA 3NBPB 3W8GA 2GJIA 5F8MA 4DV4F 3J7A1 3UDEA 2YKOA 3O1LA 1X8DA 4NLTA 2DCUB 3HHKA 3A13A 4DBQA 4F36A 1SH3A 2W2OP 1OQ6A 2JJ4D 3PNIA 2JLGA 4IH5A 5JUMA 1FTRA 2YKNA 3N6MA 3TA0A 2ZZTA 5KFZA 4B9NA 1U6ZA 1KR4A 2YKAA 2J0QD 2YY3A 1HNZF 1JLGB 1NHUA 4EMDA 3V4IA 2ZC3A 1VQ8S 3JAMU 2RU3A 3CJ5A 4DN0A 2ZH6A 4WKRA 4UY8T 2LVWA 2MY7A 3DLEA 3MEDA 1U6BA 5DJBA 4Q0BB 2PMHA 2CJAA 2KN4A 3AODA 2C2MB 1M5OC 4TY9A 2UV8A 2BJDA 4ES1A 4IG3B 2PT0A 2C3PA 3NS6A 1FXRA 3PYEA 4LR7A 4OX7A 2OD4A 1HNWF 2PMWA 1N54B 4ZN3A 2FQQB 3M7VA 2BANA 2FUG9 2YWWA 4FNHA 2GGPB 1SV5A 3CCQS 3M2UA 1HWUA 2BOAA 1T02A 2AJFE 2IHR1 3V6KA 2IBKA 3TAPA 3G82A 5GAHU 2NXCA 1RT4A 5ETMA 1URRA 2D69A 2ILZA 4OHZA 4U6PA 2VA2A 2BUNA 2FVCA 4H4MB 4RNFA 2PI4A 1GTHA 1RA7A 4L72B 2N3LA 3DU6A 4LRBA 2BJ9A 3RRKA 2OPQB 2RILA 4KQZA 4P75A 4FPIA 2VFUA 1YJNS 1RHUB 1TKDA 4IQXA 4UZCA 4EZ6A 2ADBA 5M2RA 1VBKA 1S49A 2RDIA 1HWIA 3U27A 1S0VA 1DAXA 5J2QA 3I6PA 2E5HA 4I0WA 3T5KA 2CVIA 1VK8A 3UN3A 4DR6F 1CQMA 5HMZA 3KG4A 1RT3B 2A2DA 3D68A 1SH2A 4ZLJA 3HHLC 1C2PA 1HW9A 1JJ4A 5BYQA 4F4YA 1S1XB 4ES3A 4FPRA 4MT1A 1K73T 2H4WB 1BHNA 1LV5A 4LF7F 1N36J 1FD8A 2MQPA 4C8MA 3NY0A 5CZVA 5D0GA 3D2WA 2BZ2A 2VPYB 1RTDB 3L7UA 3PRDA 1R6VA 2DCLA 4HLBA 1RTZA 4ETZA 2RVJA 1TFYA 2VFTA 3PRBA 2C2EA 2Y8YA 1TMMA 2LQ5A 3QGIA 2ASLA 1R8AA 4DQRA 4RNMA 2XSJA 2Y0SD 4CO5A 4EFAC 2KU7A 3CD7A 2UP1A 5HBMA 2Q66A 2CA9A 4KGZB 3B4DA 4OYAA 2ZH4A 3Q89A 2HNYB 1KP6A 1U02A 2GMJA 3TQ1A 5KFNA 3BBFA 3KLEA 1FRXA 2NXEA 2XY6A 5SUHA 1UKUA 3JTOA 5CHCB 1EAYC 1BQNB 3PW0A 1J5OA 4LF5F 1RWPB 2NCKL 3W2VA 1YLXA 2XNQA 1IJFB 2ACYA 2MSTA 3MM7B 3W9HA 4Y00A 4B08A 3LGNA 2BYCA 4IFVB 3UO0A 2UVVA 1B7FA 5T7LA 2GIFA 4H4OB 5A0YB 4OHWA 2K8GA 5KFOA 2UXCF 1YBTA 2HWHA 3M8WA 2YWHA 3T9NA 2DXDA 4OZ3A 4DXLA 4ZP9A 2RIJA 3GSIA 4DCJB 3C6UB 2DY9A 3H59A 3QGHA 3GYGA 3N79A 1D1UA 2HGMA 4NZ7A 2HHHF 5AJ3F 4YUDA 2DR6A 2ZZNA 4DUTA 4DOZA 3M30B 5F8HA 1FJEB 1NK4A 4DR6J 1FRKA 1V3RA 2ZKTA 3TZXA 3G6XA 1HNIB 3H42A 1H2TZ 3HKWA 4DCPB 3IRWP 4RKUC 4JI8J 2ZUAA 1D3WA 2FJBB 4ZP6A 1M5SA 4MJKA 3IP0A 1H2VZ 3ZTQA 2MZTA 1F0XA 3GFHA 4FS1A 3CCES 5E0OA 1ZH5A 1ZPVA 1RA6A 2MDAA 4ZVQB 1IKWA 5LJ5Y 2QLJB 5E7OB 1C0TB 3POTA 5KFJA 4ED5A 3M32B 2KXFA 5GMDA 2NXNA 1U48A 2DR7A 3ZZ0A 2IA0A 1JXEA 1KD1T 3K89A 4OX9F 2RDJA 1B0PA 1NDLA 3KHGA 4KHPF 3OD2A 2HHQA 3K17A 2APOA 4HDGA 3IN5A 4USKA 4AFFA 2I38A 2L9WA 2V6AA 3C3LA 1CPZA 2UXBF 3UDVA 4UY85 3TA2A 2XI3A 2ZBRA 3HP6A 1GNKA 1V3ZA 3N01A 3D1OA 2RMLA 2NSCA 2XYPB 5HL7Q 4DV1F 2AJ2A 2IRUA 1QD1A 1XR7A 3ICLA 4ZPDA 1IBMJ 1FHTA 3OTCA 2JH3A 2HQCA 3PX4A 3R5CA 5HQMA 1V3SA 3NOGA 4MYTA 4J37A 5EWFA 1HWKA 4USUA 4F8RA 1AZSA 1N32J 1UW9A 4XDCA 4AL5A 1S4EA 2W2QP 5CCLA 2HK3A 5EWGA 3WZ0A 2M4MA 2RDDA 3ZTPA 2F5GA 3TI0A 2PC6A 4WE1B 4W92B 3K5PA 2OPSA 4YR2A 2B56A 3R5BA 3UNYA 4CTAA 1EQ0A 4M63A 1CJTA 1X60A 2ASDA 4XTTA 3M8PA 3IR5B 2BMBA 1IWAA 4R0JA 4YB1P 3J80Y 4AL6A 3CCZA 2VIHA 4G1QB 2AYGA 1RGVA 4WF9Q 5ITHA 3NKYA 4TNOA 3VAMA 2Y1RI 1NDPA 4X4TA 5JMNA 2GNKA 3QIPA 1KQKA 1M5HA 3SCLE 1C0UB 2JHEA 1JMTA 3AXKA 4ZVGA 3Q8PB 1LWEA 3AB4B 3HHDA 3UDCA 4JI1J 2E5LJ 1H7XA 1DTQB 1KVKA 1SL1A 4LR9A 3WQPA 1FKOA 2BE2B 1X4GA 2RSQA 3I55S 4FYVB 4P2MA 2R7SA 3ADAC 3SCJE 2BVZA 3CJ2A 2ZH3A 4RW7A 3TX0A 5HJYA 4LFAF 1DLOA 2XM3A 3CF5Q 3LWLA 2J0SD 1QTNB 5KOXA 4CWBA 5GAEU 3GQCA 4I7FA 1WF2A 2QA2A 3C14A 4MK7A 3IA0A 3VHQA 4ALZA 1RWVB 1HHTP 2MEWA 2XY7A 1VIXA 4YY3F 3CDWA 4X64F 2VKZG 4FF4A 4IYQA 2FY1A 2L3MA 4CO1A 3KK1A 1JNZB 1WOOA 2LMIA 1S6PA 4ZVTB 3D6MB 4PG6A 1RT1A 3V6DA 1LWXA 2V8GA 1X4BA 3R3TA 2HBRB 3BQ2A 3BKFA 4WWSA 4XK8C 2XULA 5DLFA 3LP0B 5F8NA 2RRAA 1T0TV 1FNMA 1IKVA 3RR7A 4ZCMA 1GQEA 4KYZA 4ILLA 3I5AA 4TKTA 4ED2A 1B64A 4KAIA 2QC3A 1YK9A 2L9DA 2HG4A 3ZNUA 2FJXA 4A48A 4KH0B 5KG2A 3NNAA 4PG5A 4K0KF 1S6OA 1KTVA 3DDNA 4M5LA 3W61A 3SFUA 1S79A 1RT6A 3MGJA 2WBRA 1T05B 4FXDA 2G0CA 1QE1B 3MR7A 1I5OB 2LEAA 4PAAA 4WXOA 4DCOB 1X31C 2CXEA 2IBOA 4UT4A 3KLHB 1ZOTA 3OJSA 5L1KA 1K44A 2JVOA 4E98A 2YKNB 4P71A 4Z7YA 4YR0A 2VBZA 1C1BB 3H2UB 1VRUB 2JC0A 1S57A 2ZC4A 4G1IA 1LFWA 4L74A 1B7YB 1NU4A 1EETB 4TQSA 1U0SA 2P6SA 4OHXA 4X84A 2R7TA 2K1RB 1YKWA 2XGQA 3BSOA 3CTRA 3CCLS 3MMJA 3FCVA 3ZFVA 1RT4B 1JWWA 2M52A 2H48B 4CYUB 2PA3A 2RS2A 2OPPB 2R7OA 3CCWA 1QSLA 4U67Q 2JVRA 1P9QC 4FDFA 3VAIA 1FFWB 4NA3A 2V69A 2HEKA 2YQ3A 1BC6A 5B0EA 3UFCX 4DR7J 1D9AA 1X4AA 1BXNA 2P8IA 3AFGA 2DR8A 4NXMF 1HNWJ 2DH7A 4I2PB 2GGPA 1ULRA 2YX7A 4ZPAA 2IVMA 2VKRA 1Q79A 2QLWA 4Q45A 1KLNA 3OLBA 1J5EF 5IQ6A 3M2VA 2C2KB 1LWFA 3NCPA 4MKVA 2UUTA 2D7SA 4B3OB 1LQ9A 3D0HE 2DGSA 2QL5B 2WSFC 3ZZPA 2NREA 4V1Ak 3DHXA 2XS2A 3BGLA 5HI7A 4DZ6A 2CAJA 1QUPA 1IN0A 1QJHA 3MEEB 3NEKA 3CC4S 3ZTSA 2R3VA 3D54A 4RUCA 2X7IA 2CWXA 2AGOA 1S76D 3FRYA 3FMBA 5LXYA 1N33J 3NOCA 4J7CA 1L3VA 1WEZA 4IO9Q 4PPDA 2XLKA 2JFKA 3SQGA 5RUBA 3UD4P 2OI2A 3DYAA 1ITPA 4UOGA 3F41A 2DGQA 2YNFA 2ZE2B 2BW2A 4F0KA 5KFXA 4UF4A 2CPXA 2XMMA 1HMVB 2RS8A 2H9ZA 2FC8A 1Q16B 2PMZD 3HVTB 3AQPA 5K14B 2O1PA 8AT1B 3FZBA 1WC5A 3UVJA 5D4LA 5D0HA 1LW0B 5I42B 3M9NB 2MXYA 1WNEA 2ZH9A 2X51A 4HTJA 3HF5A 4M5MA 2CFXA 3DRPA 1EIYB 3MM9A 1WF1A 2NXJA 3AA9A 2UV8G 5F9NA 4ED0A 3WHIA 3MCNA 5IV3A 3GZ7A 4RW8A 4DL5A 3FQKA 2JLFA 3G8SA 4DV7J 5GAEI 1PYOB 4DHVA 1M1KT 4BWJA 5AJ3J 1J5OB 2YNIA 5I4MA 1SKSA 1HFEL 4KHMA 2DB1A 4OX6A 1X9MA 2J0XA 3AOAA 3NNCA 5J1EB 4IFVA 2DXFA 3FJ2A 1RAOA 2OSRA 4PXDA 4DL3A 2CQIA 2IM0A 2MKJA 2ROEA 3ENAA 4I1TA 1HQUA 1RT3A 5ETVA 3SBMA 5HQ8A 3CD5A 2J6UA 5C42B 4R5PA 2RNEA 2HVZA 3Q23A 3VVUA 3QSIA 5ETLA 4QQBA 3R1HA 8RUCA 2VFRA 1VQOS 2DY1A 3M32A 3NGDA 4RW9A 2E7XA 2DEIA 1TMJA 2HQ3A 1SUQA 1NDKA 1WDTA 4DEZA 4DPOA 1X9SA 4O3SA 4ANEA 3OR1A 5E3CA 5KFLA 2UU9F 2BACA 1PYTA 3CDAA 4QR0A 1CQNA 3N28A 4R8UA 3KLVA 4DJBA 2HLUA 3D0GE 4DUYJ 3C2PA 1Y7PA 4V19X 4B3RJ 1CJVA 2DO4A 3TVZA 3VAHA 1S1TB 3V2UC 1MN7A 2C2ZB 5D4NA 1FA0A 4LF1A 3NGTA 1QSYA 3C8YA 3KJQB 1UWAA 2FVRA 2HYIB 2DGXA 5M2PA 4DFPA 4YN3B 4DPUA 2UVRA 9ATCB 1VQ6S 2KFNA 2HQDA 2QL9B 3AD7C 1AT1B 5IXUA 3DRSA 3PZPA 1S48A 1BQNA 5CYQA 2P6TA 2ZITA 4NLXA 1OY6A 1Q5YA 1RAHB 2JSXA 1GEHA 2ZDOA 3KLIB 3GPAA 3QPIA 3PHEA 2YBVA 4FVCA 2ALYB 3THTA 5HN0A 4WU3A 1VBYA 1M90T 1OWXA 4IG3A 1FX4A 4C3KA 4PQUA 4PXEA 1CG2A 3K2YA 4AT1B 4WFAQ 4K4SA 3BBCA 1Y0HA 4ZPWR 3W2WB 3K5MA 3OL9A 2OP5A 2VG7B 1RTHA 3OL8A 1NJWA 1SV5B 3TUPA 1VIOA 1VOMA 5HMYA 2XLIA 4ZHRB 3KYLA 1VYAA 2GO8A 2QLFB 2Q43A 2VV5A 3FSXA 3G82B 3MD1A 5EX0A 4PKDB 1URNA 1D0EA 2ZKUA 3Q24A 2CUYA 1YIJS 1Q8LA 3VALA 4RW6A 5H1SV 5CH7B 2NZ4A 2J9DE 1LWEB 1RP5A 2W7PA 5KFEA 5H9FK 2DHGA 3ETOA 3WIUA 3KG0A 5F8GA 1TAUA 4LR8A 2DPIA 1U1RA 4LJMA 1UVIA 5U47A 2QT7A 1RI7A 1SI9A 4BC9A 3CUNA 4PRFA 3BBBA 4X2BA 4OIXA 2L48A 1U1KA 1TL3A 3N9UC 1KFSA 1XNQJ 1IUJA 1RCOB 2C2OB 2RD5C 1DTQA 3EDQB 5HLFB 2M8HA 4ECRA 1XQIA 4ZS6A 5CYMA 1BWEA 5IC4B 1SKUB 4ZPCA 4ENOA 1FD2A 2EW9A 3NGUA 4KJIA 2BM0A 4TN2A 3EVMA 1NM2A 1U0HA 4WK1A 4YDDB 1S0OA 2R4FA 2O66A 1LWCA 4F4WA 2XY5A 5F9LA 3G4SS 3MUTP 2R2RA 4X66J 4I7FB 5FLXU 4XPCA 3T6JA 1DURA 2OJ3A 1XMOF 1IJEB 2GFFA 5BYSA 2V2QA 1LXJA 5DRKA 2CJBA 2W9AA 4NA1A 2E7WA 1FXLA 2B6AB 1HBOA 2G2ZA 2RHQB 2OAUA 3MAHA 3PFEA 4O0NA 3K5NA 2NPIA 1OPZA 2J7WA 3IG1B 3M8PB 1UL3A 3QFWA 1UTAA 1FFSB 2DNKA 1Y3JA 1SL0A 2OO4A 5K20B 4IDKB 3KKFA 1WC0A 1YVFA 3L95X 1LKZA 4I56A 5E3AA 3CJKA 2ZHAA 4CCHA 3ITHA 1UVJA 2MJUA 2DHXA 1N6QA 1GMVA 4ZIWA 2AD9A 2DNYA 2UUCJ 1T3OA 2E9RX 1ELOA 1A7GE 1RLCL 4QYRA 2FLOA 3OR2A 4ICLB 2BR0A 1EB0A 4DV3F 1MLAA 3BSNA 4G1PA 3DXSX 4WYWA 3M9MB 3A3PB 5EN1A 4PUOA 5A8WA 4S0MA 3CGIA 1B0TA 2MKHA 2QLXA 1U26A 4B3MF 3QJPA 1IR0A 1RTJA 3MZIA 2H51B 4WTYA 4WFBQ 3J7YI 1WC3A 3BZQA 4U8VA 3Q8QB 4J9QA 2VQFJ 5LT5A 2UXDF 4WXWA 3UWTA 3MM8B 1I51B 3OTOF 5IOLA 1IKWB 3BSCA 1R6YA 3LALA 1KQFB 3CCRS 4O23A 2CQ0A 2RT3A 2V9KA 3R2DJ 4MTPA 3BM7A 3IM8A 4ZMMA 4IR9A 4LFCJ 3G9CA 4RJVA 3FZ2A 1CC7A 2UUCF 2F4FA 4HACA 4YR3A 3KOAA 5KG5A 4FVMA 1OPIA 1YRXA 3J81j 4FF1A 3LP0A 2FHJA 1HNZJ 2VODA 1T7PA 3MEEA 3BPDA 2EFGA 2JEIA 2PSZA 1R3NA 2QX0A 1XJWB 4F4KA 4JI8F 3TARA 2PEBA 1IXKA 4Y2AA 4B3MJ 4PG8A 1SC4B 1RT7B 4E2FB 1RHRB 2V94A 2LFVA 3ELHA 3MCOA 5K5MA 1XBWA 4ZLLA 5KFSA 4OV1A 2KI2A 4ZPTR 5E2QA 2A10A 2DRDA 3LA0A 4CI0B 3KLHA 4JI3J 1WTFA 3PFOA 2GHWA 1CJTB 4RUAA 5D0RA 5FIIA 2HMIA 4LBHA 5DM7Q 1Y9OA 2YX4A 2C3OA 2IDLA 4DFJA 5DQHA 2I9SA 1VRUA 3KUEA 3JSMA 3ZZUA 5EX3A 2H5EA 2OTLS 4C8LA 2E44A 1IBCB 4NLGA 3C15B 5HAOA 1TL7B 4F7VA 2WVCA 3DGVA 3RRGA 1YJ9S 4FXWA 3MM9B 1MWYA 3VVTA 5L39A 2AYBA 5IZHA 1D9FA 5ADZA 3RAQA 3RBEA 1U2CA 5IFMA 3OTEA 4IRCA 2R7UA 3HLUA 3PW5A 5DS7A 5D4OA 2LXUA 3C19A 2ZH1A 2KT2A 4MH8A 2MGZB 4JI7J 4LF4F 1JLQA 2ZD1B 4HI2A 4WTOB 1YJUA 4YDXA 2L41A 2B9YA 2AJ4A 2J9EA 1N52B 1SC3B 3MOJB 1PJ6A 5CA5A 3TUIC 4CNZA 2P9GA 3CJ4A 5L1LA 4DV2J 3I5CA 4R25A 5DDOC 4QWDA 1MROA 4J9VA 4LF6F 1CULB 3SXLA 3JSRA 2FLPA 3OXLA 4X62F 4QWCA 1RWXB 5HROA 1R8HA 2FVSA 2YNGA 5J2MB 4DFMA 4TYAA 3CD0A 2AZ3A 2YNIB 4WP9A 1L5UA 1YRTA 3I82A 4NLQA 2B4VA 4FF3A 4DG1A 1LW2B 4RW4B 2CQ4A 1HHQA 2WW4A 2HURA 3CE8A 3DGPB 1Q78A 3G87A 5B0BA 3KLGA 4NI2A 2BRLA 4MAKA 1HQUB 5FDLB 1HR0J 2YQ0A 5F8JA 1F9HA 3MR5A 4B3RF 1TV6B 3M8RA 1F9FA 2EG1A 3CJ0A 3MR6A 1RB0A 1CJVB 4R0EA 5CYJA 3I0RA 2DGUA 3OHBA 3H25A 1G2EA 1QDUB 3PV8A 3RW7A 4CIOA 2COLA 3DN9A 1VS3A 1PIEA 4BLGA 1WSRA 4K5RA 3T1YJ 2BKOA 2ZHOA 4WZQA 5IT9Y 1SQEA 2W4PA 3VAFA 1FE0A 1HMVA 2DNLA 4KV8A 4PG7A 2U1AA 3HPOA 4DV2F 3CNQP 1KTQA 3R5GA 3HVWA 8ATCB 3CC2S 2W1BA 4TVAB 4WCEQ 3GIJA 4DUZF 3Q8UA 5LL6d 3UW1A 3CCUS 4Q8EA 1BLUA 1VQSA 3AD9C 2KRBA 4QR1A 3DRPB 2CQGA 4RX6A 3KMQA 4NE9C 4PQUB 1NSKL 2VG6A 5B0DA 2R7VA 4GO5X 4KT0C 2KKHA 4DSJA 2YKPA 1RTHB 3Q8YA 2K1RA 2MZJA 1W25A 4N41A 1RWMB 2MMYA 3D4JA 2ZFHA 3BB5A 1APSA 2WSEC 5F0WA 4O4RA 3QT6A 5CABA 2DRAA 3NS5A 1F5AA 3DLKB 4CLSA 3VZHA 5LOQA 2YQ1A 4N7TA 2IIHA 2RUSA 2MKCA 1FK9B 4WK3A 4X66F 3NCRA 1AUDA 4PWDA 3HHEA 5C42A 2FZCB 5KFBA 2YX1A 2M70A 2VG7A 4FYWB 4F25A 1VHIA 3KK3B 2OKQA 3K59A 1SKRA 4B9UA 3S01A 2G1HA 4ZHRA 2B7BB 2DR5A 2OGUA 2XZWA 1JLEB 3MPDA 1V5VA 2RQ4A 3SFGA 2WW8A 5C2CA 2D3O1 2OMLA 2ALZA 2F9DA 4ZOSA 2HHSA 1AB8A 3JYTA 2FLNA 2ZH5A 1SJ3P 3EZUA 4K59A 4OJ3A 2FY8A 3GU0A 4QWEA 1R0AB 2YKMA 4X4NA 3B8HA 1RBAA 2AW0A 1EKRA 3TEGA 4A8FA 1FVQA 1NH8A 4OI6A 1XIQA 3TNVA 2IY5B 1LWCB 3I87A 2XGPA 4PXBA 3HJFA 4NLYA 2ZM6J 1KQSR 2BJ3A 3MEKA 1X0FA 4J9OA 1NSQA 4A8MP 3J7ZT 3BGRB 2CNLB 1EHWA 3J7YU 5E3RA 3IRXA 1YZ6A 4O3QA 3E51A 4XIUA 3Q8VA 3Q22A 2ZWPA 3IGVA 2EEYA 5DETA 4IH6A 2MPUA 5DQGA 2SXLA 4Q7AA 5JJBA 1U8SA 1YJVA 2KDOA 1UPPA 2PD1A 5I42A 4C11B 3EM1A 3H2LA 1XMOJ 1F5CA 1B4SA 3PO4A 1O6XA 2W9CA 5DM6Q 3M4XA 1N5VA 2W2NP 4P72A 4M5NA 2VHGA 1VQ4S 4DF4A 2XO6A 1O51A 4LSZB 5MAOA 4ICLA 2YWFA 3DI6B 2XMWA 3V81B 4FYDA 3T3FA 4ZPVR 1X4DA 3CXCR 2X3GA 2WONA 2EWHA 2HK2A 5T41A 3VV2B 4IOCQ 2VJUA 1NJYA 3X3UA 3HHLA 1RWKB 3AA8A 2HAIA 1DTTB 3A12A 3O3LA 4LF2A 3SZ2A 2DNQA 1XNRF 4YB6A 3FGVA 4WP3A 4U9RA 3HKZD 4BDPA 1Q5VA 4K4VA 5A8RB 4GMKA 4N5SA 1X7VA 4IG0B 4USVA 3MR2A 3OR2B 2IM3A 2K3IA 3T1HJ 3RB0A 3SEOA 3K8VA 2VONA 1JLGA 4LUBA 1KN6A 3W66A 4ER8A 3JXOA 2FJAB 5GVQA 1VQMS 2UVWA 2WB4A 4C3MA 4DI6A 3BQ0A 3BDPA 4F2SA 2V2ZA 4U7UD 4KSEB 2QV6A 4N8OA 3Q2SC 1REVA 3MPYA 2VOPA 2EKNA 4WP8A 2ZDPA 4CLUA 4LFBF 2DNMA 1HBNA 3ZTOA 2HBZB 4OYXA 4Z2XA 1HBMB 2QSWA 3CWJA 3Q8RB 1UFKA 1G4CA 4J9UE 2GQCA 3BN4A 3MFHA 5H9EJ 4X64J 4EBEA 4GVLA 4H4KA 2CQDA 3I0SB 7FDRA 1BY9A 5DZ6A 3C6TA 1FRHA 4K8RA 4JV1A 3QMQA 1N8RT 5L9NA 2BEFA 2OSQA 3ONQA 3PXGa 3RZAA 3RAMA 2BDPA 4OX8A 2DXEA 2ZWOA 5E33A 4Y6IA 1XMBA 2KZZA 1RT7A 1VDHA 3V5RA 1FESA 3D6HB 3KJFB 4LSLA 4CLPA 4GRSA 5IS2A 5HVHA 4A8XA 4LRAA 2W24A 1IQTA 4CLZA 3U02A 4C6AA 1S9GB 2AV5A 4WJBA 1S0MA 2PEHA 5I3UB 5JXSA 4DLGA 4M5DB 2OIHA 2XCPA 4CH7A 5L1IA 1XTZA 1YSJA 1OSDA 3W60A 1ACMB 4O3NA 4GC6A 1L3UA 1U25A 4P9SA 4LREA 4DX6A 1RWWB 1ZM2A 3MMAA 1VGYA 2DGOA 2GX8A 3EE3A 2JWNA 4RZRA 1BQXA 1QVFR 3DLEB 4WFZA 3TJAA 4XPEA 3MXHP 4QIEA 1YDLA 4Q0BA 2F63A 2BJEA 3D5MA 1DJ0A 1JJCB 4C48A 4OLOA 3TQEA 5DGBA 4FF2A 1KBRA 4KRWA 2AEJA 4ZP8A 5KT5A 1RTJB 3M8QA 2BQRA 1S77D 2EC2A 4IQMA 3QZ7A 3JSMB 3NL0A 1PAEX 3SIPB 1NB7A 2ROGA 1H2UX 4F0HA 3D3BJ 3GJTB 3W5YA 5C2GA 4OLPA 3GIIA 2XS5A 1FEHA 4C97A 1U4BA 1P6TA 1T95A 3M9OB 2I5JB 2HQIA 2LA6A 4OZNA 3BS9A 2Z2ZA 5GADI 1AROP 3D9BA 2F40A 3EJMA 3SSRA 3DU5A 4HHHA 4MIWA 2CQBA 3ENVA 3MM6B 3WC2A 1TK5A 4I67A 1X4EA 2QN6B 2B5JB 3HSJA 4ED8A 4LF8J 1PYSB 4P7TA 1YWXA 5T14A 4O0IA 4NLPA 3M2RB 4B17A 3I31A 4O3PA 4KR0B 1B70B 5HJXA 2WRMA 5CZXA 3DRXA 4KGKA 3ZC4A 4B02A 2LQ8A 4RW4A 4K7QA 3TVKA 2NZCA 4ZVEA 2KO1A 3IR6B 2B9EA 1LOUA 2E1AA 5T7LB 3JB9k 2GJ2A 3I9ZA 2HZVA 2GS8A 4DL0C 3D7SB 2CZVC 1D8ZA 1IBKF 2GVZB 2X1GA 2XMJA 2IAJB 3KUGA 1HPZB 4PWWA 1VQ5S 2JEGA 3PRVA 2EFOA 3OVSA 3H0PA 4RNHA 2RH3A 1T9VA 3UVJB 4LBIA 2CQHA 5BR8J 1S1UA 2HMIB 2KL8A 4A46A 1VFJA 2F1FA 1ZYQA 5DG7A 1YJ7A 3JQMA 1NPRA 4HVZA 2GAGC 3GILA 4MYUA 3RB6A 3D0IE 4DS4A 2E5GA 1BGXT 3KLFA 1VBZA 4M5IA 4JV5J 4W4MA 3HCXA 5LSOA 3CDEA 1SCJB 3FUYA 3LP1B 3MMCA 1YTYA 1NXIA 2HVHA 1HD1A 4C0HA 2XYGB 3EGNA 4RNNA 4O4GA 2B4OA 2YNHB 2EK6A 4G6VB 2OH2A 2BX6A 1HI8A 2NUHA 3EICA 2OD6A 4F4XA 3BV8A 1IBKJ 4JYAF 3VGTA 4NWBA 3KJVB 3FFIA 4CM2A 2DNZA 4A47A 1QTMA 3RYLA 4LRFA 1SL2A 2IMOA 1TKXA 1MG7A 3GTYX 2WVEA 2UZAA 4ECTA 2LP4A 3UNGC 2CPYA 4O44B 3NRBA 4M94A 1MROB 3D1HA 3BO3A 1VQLS 3ET6B 4MFBA 4OI1A 1EARA 1GXLA 1HNVA 2K7JA 4ZA1A 3T5LA 1FJ7A 2MLYA 1WWHA 2KG1A 4CM0A 3M2UB 3LTOA 5KFAA 2KXNB 2ZJQQ 2ROPA 3UE2A 4A8OA 4EO8A 1IWGA 4EO6A 1Q8IA 1TUVA 3U1NA 3PW7A 4JV5F 4MKAA 3I5BA 3DGPA 4OI2A 4OYWA 5HP1B 5IT9U 3ISND 1I3OB 4DR5F 4IR1A 4RR5A 5FDLA 5LSLA 3OXGA 5KTQA 3GCWP 3M8YA 1N56A 2YKMB 1Y5IB 2DD8S 3BKTA 3ILJA 4OQJA 5KG6A 3FEYB 1T03B 3MMBA 4NZ0A 1RHKB 3TR5A 1S1WB 1TKZB 2MHEA 5L9XA 2MJNA 3GR0A 3MECB 2Y1JA 2EXUA 5ETKA 4HTIA 1CJKA 4CH1A 1JLFA 2WVDA 1NRKA 3OHAA 4ANCA 2AKWB 3MEDB 1FKOB 2M2BA 3MCSA 1A0OB 5L46A 4Z7CA 1VC0A 3CPWR 3CJ3A 3R6LB 2H54B 2V5HG 3AD8C 2LDYA 3OFFA 1NSAA 5CQGA 2VG6B 4NRTA 3AQOA 3TAQA 4DF8A 3QRRA 4Z37A 1Y4ZB 2AGPA 2AJ1A 5J1NA 2RQMA 5GAGI 3UQSA 3C15A 5MLCV 3PIPQ 2BE9B 1T8EA 1S5ZA 2XWXA 1AW0A 2LQ9A 2FZGB 3GCXP 3HHLD 1RXOB 1NHKL 2ZBCA 3OFHA 4TY8B 1RU1A 1YZ7A 2W9CB 2MKKA 2BA9A 3IS9A 3LUYA 1H6KX 1QAIA 1CVJA 1JLQB 5J2PB 4G1QA 2ZVSA 3OUYA 1WD6A 3A8JA 1U09A 4KTQA 3QRPA 1JIHA 4OZ0A 1PAUB 3IFEA 4U8YA 2OEKA 3AOBA 2E66A 1WI8A 5GMKa 3PYFA 1JJHA 4F04B 1RCXB 1FDDA 1FWKA 3ILOA 3EPGA 1HNXJ 2VC1A 4QW9A 1YI2S 1KONA 1SQFA 2VBXA 1VJQA 1EP4B 4I2QA 5HROB 1IR1A 3KUHA 2I8EA 4KGXB 3P96A 4NA2A 4CLKA 3C6UA 1MU2A 3JYTB 1VCTA 2BE7D 2DH8A 4DSLA 3X1LB 3UR0A 3DOKA 3ISNC 4UOHA 1FO1A 2DIVA 3P8BB 4Y34A 5AXLA 7FD1A 2AX0A 2XCAA 1IBLF 2GIQA 1FRMA 2YH0A 5K8NA 2QYCA 3VGSA 1FKAF 2UUBF 3WIVA 4P52A 2CNNB 3OT9A 3R2CJ 1NK7A 2VBYA 2CYYA 1VQPS 1UP1A 2YXLA 2J7UA 4ZVOB 4NCBA 2HVIA 5B7WA 2W01A 1KOOA 5EHHA 4DV4J 2WK4A 1H74A 2IRXA 3A3NB 3FEZA 2XEXA 3R5JB 3RBZA 4EYIB 4QCLA 4J90A 2KTQA 2FPHX 2GAHC 1QVGR 5K8OA 4USWA 1E6VB 2XMKA 2O67A 4LF6J 3EUNA 2AEMA 1S1VB 4CT8A 5K8PA 1LEOA 3B82A 3HFZB 3LF0A 5LXRA 3ZZZA 3J81Y 1RUSA 3UD3P 1N5YB 3R97A 1Y10A 1RHJB 3SSSA 2H1YA 4I68A 4DV6F 3HHNB 3I0SA 3GIRA 2EFPA 1EX8A 1RDRA 4L76A 4PYAA 5L1JA 3KNGA 2R9LA 4DR2J 1LWFB 1S59A 4USHA 4ZJQA 4HI1A 1PILA 2PA8D 4DX7A 1RYRA 2UUBJ 1YGYA 1JXLA 4K2JA 2DISA 1FDAA 3G71S 1TQLA 3LGHA 4A8KA 1AFJA 3KHHA 4QIVA 3PG9A 3RU0A 3G8QA 4OHVA 4OYZA 5DO2A 5KFPA 1IKYB 2MSSA 2ZEJA 4AXJA 2BQUA 4NLVA 2CPEA 4GKKF 1A6LA 1FFGB 2OFGX 2DO0A 3OV7A 5KG4A 2RQCA 2IC3A 4JB8B 5F8LA 2OMOA 6FD1A 2FHOB 3SDEA 1RJJA 3FKBA 4CRJA 3UPFA 5E41A 3KWMA 3O6QA 3ISZA 3W7BA 2BQ3A 3HK2A 4DFKA 2LYVA 1U1LA 4I6AA 4NXNF 2PGCA 2NYIA 3GONA 4J9LA 2Z2MA 1LK5A 4DDFA 2A2CA 4UQTA 5A76A 4GKJF 4HH1A 3H20A 1KNZA 1WEXA 2W2MP 2QZ8A 1R0AA 2CPDA 4LVNP 5KFHA 2ZBQA 4DPXA 1Y11A 3BGFA 1T9WA 1ZETA 2VFSA 4OMFG 4MIBA 2LCWA 1N5SA 2VG5A 4C8NA 1FTCA 2IYIA 2EFQA 1P8GA 4D3HA 1JX4A 2VB6A 4OJHA 4USMA 1Q8KA 3CCTA 4JI6J 4ZVPB 2OHDA 1AZSB 1T11A 2YWKA 3M8ZA 3LQVA 3Q8SB 4I69A 3BYPA 5KFFA 3MPVA 2HS0A 2HIYA 2HVDA 3FCHA 4FZVA 2CQ1A 5KOWA 5KT2A 2G9OA 1S1UB 1SIWB 3FDSA 4YHHF 2J6TA 2EPIA 3BR9A 2VC0A 3EVOA 5LSRA 2W9BA 2MQQA 1IKVB 1BQMA 3KDOA 2ZH7A 4PQAA 3V6HA 2W4CA 2OPRB 4EU0A 4BHQA 1ZBTA 2VDHA 1FDBA 3BO4A 5FD1A 1VC5A 2XZTB 1ZA1B 2GQQA 5ETQA 1G1XA 1WHVA 2ZH2A 4K0KJ 1FWPA 3I4HX 1V6HA 2M0GB 3DI6A 4O4GB 2J8AA 1MW7A 1WC1A 2YNHA 3V81A 1PO6A 4QYZK 4X62J 1KS2A 4GVBB 4RBVA 1LNQA 3UCUP 1WHWA 4EGLA 2Z2LA 3MD3A 1FRJA 3KJVA 1LW0A 3QQCD 3TWZA 3US5A 4MK9A 2IJNA 3MDFA 1DTTA 2KYZA 3P6YC 2FB0A 4PZVA 5DDPC 1HYSA 4JOUA 4L3KA 3QGGA 3GG1A 1RLDA 3NCQA 5EWEA 4QWAA 2EFVA 3MMCB 1C1BA 4KFBB 2CDQA 4JI7F 4LF4J 2QA1A 3QFHA 2VJVA 4ECVA 1CS4B 5B08A 4CO3A 2HS4A 1B99A 1TKTB 3CMQA 2QO3A 4L73A 4L75A 3P45B 4ZLPA 1N4LA 1DHMA 3DLGB 1K9MT 3BDEA 3TVYA 5E5NA 2K2PA 5G0RB 4CDIA 1JLAB 5B09A 3T5HA 3VGVA 3T5JA 5J2NA 2WOMA 3N4WA 2KM8C 1HBNB 3K58A 3CD6S 1P9YA 2D9PA 2KVQE 3P5BP 4WFYA 1IM4A 4J91A 6AT1B 3HO1A 1FWLA 2Y1LB 3N6NA 2JRSA 4R5PB 4QIWD 5A2QU 3MAQA 1Y3KA 2KH9A 3GSDA 2CQPA 3MMBB 2FHKA 3W8PA 1WDDA 2ZNYA 2KT3A 1S1WA 3PTWA 2Q6BA 2B3TB 1FX2A 1H98A 2FIUA 1TELA 3JTPA 2Y0BB 4RW9B 3LANA 4M5JA 1L3KA 1HI1A 3OL7A 4LT6A 4RL1A 5HP1A 4IOAQ 4F3MA 2HHUA 3U7JA 5A8KB 2AT1B 4FBTA 5LMUJ 4LBPA 1KQGB 2H4YB 3I9V9 1TR0A 2F4VJ 3QAUA 3CO0P 2E1CA 3SV3A 3AJ1A 1HWJA 2XSFA 1RWUA 2ZBIA 3HZEA 3R7BB 5HSPA 5FLXY 5KFYA 3H90A 2C2DA 3DOLA 4M5DA 1AXQA 4ZVHA 3LP1A 4DN9A 4NLUA 2NUUG 3QT7A 2NQPA 1HKAA 4IH7A 3TAMA 3PY8A 3CO9A 2OEMA 3HSZA 4JI5J 4F3QA 2XC9A 1IKXA 3CB4A 3PKMA 2GVDB 2O3DA 4WFNQ 5CYQB 1C1CB 1S6QB 1VHFA 4OV6A 4W98A 2CPZA 1OO0B 4RU9A 2R8GA 3SCIE 1KLMB 1UWBA 2B8QA 2DT9A 1NB2A 4OYPA 4TY8A 4AYBD 5KT6A 3FK4A 3R6GB 1UZDA 4LRDA 1G7CB 3P4UB 1NJIT 4OL8A 1FEEA 2ADCA 3ENWA 2J5AA 5C7PA 1GH8A 2RJZA 3T19A 3S8SA 3GFYA 3NGKA 4QW8A 4MFBB 3MAAB 3FSIA 5HO4A 2F8EX 3RB3A 5G4DA 2F7VA 3A3OB 3OUYB 2RF2B 2HHTA 2KFZA 2NPFA 4DQIA 4ZVSB 2GO9A 4F26A 1S4FA 1GX6A 4YP3A 1B3TA 1QSSA 2B4PA 1N36F 2FVQA 2J6SA 1Y00A 2B6AA 2JNJA 3MF5A 2CIMA 1MMNA 4KH1B 4ZVFA 3D67A 3GJQB 4L6V3 4YB7A 1YITS 4KE5A 1EP4A 4I2QB 1RU2A 4ZK7M 1TL5A 2M7SA 3FBFA 4ZVRB 2R2SA 3CCVS 2J9DA 3AOCA 1DARA 1S7HA 2CNKB 2Y3YA 3GE9A 4PR6A 5DLGA 4DU7A 4DV6J 1TFWA 4JUZA 1RKJA 2OEJA 5KT4A 1K1SA 5J1EA 4KPYA 1N6QB 2CJQA 1CLFA 3MPUB 4J9RA 2DTJA 4NEYA 3MECA 3HXMA 3UR3C 2G0IA 1FF2A 1H72C 3IGNA 5CAAA 5DG8A 1WG1A 4LF5J 2HNDB 2VPWB 2C1EB 2N4DA 1OIAA 1VR6A 3ILIA 5KT7A 4ED3A 1ZAVA 2R7WA 2ILYA 2JDJA 2VPZB 1TL4A 4CT9A 4PUOB 1CEZA 4NMXA 4YB5A 2PFFB 3A8IA 4JI0F 3KXDA 1QLNA 5GAHI 2AEFA 1XR5A 2AF6A 4ED4A 2UU9J 1PC5A 4R8UB
chains in the Genus database with same CATH topology
1NUEA 1BE4A 3FCWA 1UCNA 3EM1A 5BXIA 1B4SA 1XQIA 4UOHA 3PRVA 1NDPA 4UOGA 4ENOA 3FBBA 3NGUA 1HLWA 1WKKA 3EVMA 3VGSA 3Q86A 1F3FA 3Q83A 4FKXA 1B99A 3PJ9A 1U8WA 2AZ3A 1BHNA 2HVEA 3EMTA 2VU5A 1HHQA 3VGVA 2HURA 3L7UA 4O0NA 1ZS6A 3R9LA 1LEOA 2BX6A 3EICA 4FKYA 4DI6A 3VGTA 2DXFA 4F4AA 1LWXA 3B54A 4KPCA 3Q89A 4UOFA 3DKDA 1S59A 3ENAA 1WKJA 3ZTOA 2AZ1A 3BBFA 3FC9A 3VVUA 3Q8UA 4CP5A 2NCKL 3NGSA 3B6BA 4S0MA 2DYAA 1NDKA 1NSKL 2BEFA 4ANEA 3DDIA 2DXEA 2DXDA 3FBEA 3Q8YA 3FKBA 1MN9A 2DY9A 4EK2A 4W98A 3G2XA 5IOLA 1MN7A 1NLKL 5CABA 1NSPA 2B8QA 1NCLA 4C6AA 4DUTA 1NB2A 3NGTA 1NPKA 1K44A 2ZUAA 4WBFA 5C7PA 1S57A 3ETMA 3EVWA 3ZTQA 1NDCA 3BH7B 4ANCA 3EE3A 3ZTRA 1W7WA 2B8PA 3FCVA 3GPAA 4HR2A 4F36A 1HIYA 3MPDA 3BBCA 3BH6B 1NDLA 1PKUA 3FBFA 1BUXA 1PAEX 3VGUA 3ELHA 1F6TA 1VYAA 1S5ZA 3NGRA 1NHKL 2HVDA 1XIQA 2CWKA 3EJMA 3FBCA 3EVOA 1KDNA 1WKLA 5CAAA 3WX8A 1NSQA 1EHWA 3GP9A 4ANDA 4DZ6A 3ZTPA 3VVTA 3Q8VA 3BBBA 3ZTSA 1JXVA 3JS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUE A;  1BE4 A;  3FCW A;  1UCN A;  3EM1 A;  5BXI A;  1B4S A;  1XQI A;  4UOH A;  3PRV A;  1NDP A;  4UOG A;  4ENO A;  3FBB A;  3NGU A;  1HLW A;  1WKK A;  3EVM A;  3VGS A;  3Q86 A;  1F3F A;  3Q83 A;  4FKX A;  1B99 A;  3PJ9 A;  1U8W A;  2AZ3 A;  1BHN A;  2HVE A;  3EMT A;  2VU5 A;  1HHQ A;  3VGV A;  2HUR A;  3L7U A;  4O0N A;  1ZS6 A;  3R9L A;  1LEO A;  2BX6 A;  3EIC A;  4FKY A;  4DI6 A;  3VGT A;  2DXF A;  4F4A A;  1LWX A;  3B54 A;  4KPC A;  3Q89 A;  4UOF A;  3DKD A;  1S59 A;  3ENA A;  1WKJ A;  3ZTO A;  2AZ1 A;  3BBF A;  3FC9 A;  3VVU A;  3Q8U A;  4CP5 A;  2NCK L;  3NGS A;  3B6B A;  4S0M A;  2DYA A;  1NDK A;  1NSK L;  2BEF A;  4ANE A;  3DDI A;  2DXE A;  2DXD A;  3FBE A;  3Q8Y A;  3FKB A;  1MN9 A;  2DY9 A;  4EK2 A;  4W98 A;  3G2X A;  5IOL A;  1MN7 A;  1NLK L;  5CAB A;  1NSP A;  2B8Q A;  1NCL A;  4C6A A;  4DUT A;  1NB2 A;  3NGT A;  1NPK A;  1K44 A;  2ZUA A;  4WBF A;  5C7P A;  1S57 A;  3ETM A;  3EVW A;  3ZTQ A;  1NDC A;  3BH7 B;  4ANC A;  3EE3 A;  3ZTR A;  1W7W A;  2B8P A;  3FCV A;  3GPA A;  4HR2 A;  4F36 A;  1HIY A;  3MPD A;  3BBC A;  3BH6 B;  1NDL A;  1PKU A;  3FBF A;  1BUX A;  1PAE X;  3VGU A;  3ELH A;  1F6T A;  1VYA A;  1S5Z A;  3NGR A;  1NHK L;  2HVD A;  1XIQ A;  2CWK A;  3EJM A;  3FBC A;  3EVO A;  1KDN A;  1WKL A;  5CAA A;  3WX8 A;  1NSQ A;  1EHW A;  3GP9 A;  4AND A;  4DZ6 A;  3ZTP A;  3VVT A;  3Q8V A;  3BBB A;  3ZTS A;  1JXV A;  3JS9 A; 
#chains in the Genus database with same CATH topology
 1SBR A;  2CZ9 A;  2IVY A;  3N6L A;  1NUE A;  3M1V A;  4PG4 A;  1AUS L;  3TEH B;  2FGC A;  1GT8 A;  3H98 A;  1K47 A;  2CZ4 A;  4D3G A;  5BXI A;  5D78 A;  1QAX A;  2IM2 A;  4BWM A;  3TYT A;  2N3O A;  3BGU A;  5IWA J;  3GLJ A;  3E3X A;  4DSI A;  5KFK A;  5ETN A;  2GMH A;  2JZ5 A;  1FNO A;  2MKY A;  5KAK A;  2CVE A;  2HFO A;  1M1H A;  3DMJ A;  4MKB A;  4A4J A;  4QIG A;  3DRY A;  3IS9 B;  2QA4 G;  2QIF A;  1H38 A;  1FJC A;  1NH7 A;  4HAC B;  2KJV A;  3IG1 A;  3FVY A;  5KFD A;  4P2S A;  3PDN A;  3Q83 A;  1FVS A;  5J2P A;  1KFD A;  2QJ3 A;  2FYX A;  2L9N A;  3CJT A;  3RG6 A;  4CZC A;  3NS7 B;  3W1Y C;  2BW7 A;  4I4B A;  3W63 A;  1M1G A;  3GIM A;  1WOP A;  4WZM A;  4DR3 F;  2VL1 A;  4F4Z A;  4JP8 A;  3QAT A;  2CRL A;  2B9X A;  1KRP A;  1O0P A;  2IA6 A;  1NZ8 A;  1OMS A;  3RAX A;  4DQQ A;  3EPI A;  2NSB A;  4NCA A;  2BJ7 A;  3QLH B;  1VC6 A;  3TZZ A;  1HW8 A;  2E7V A;  4NX9 A;  5LMN J;  1XC9 A;  1S6U A;  1S9E A;  2EBG A;  2ZOM A;  1FT8 A;  4AXI A;  2B9W A;  1X5T A;  1PBA A;  3PJW A;  2EC0 A;  4JV2 A;  4UOF A;  2LDI A;  2VAS A;  3DKD A;  2IVF B;  2NR0 A;  2E5J A;  5DDQ C;  2N82 B;  3SMZ A;  2IC3 B;  1REG X;  3R1L A;  3QRQ A;  3FC9 A;  4DMZ A;  3BO2 A;  1UW4 A;  3S7R A;  2C2N A;  3LOU A;  1YJT A;  4NLS A;  4OI4 A;  1VBX A;  1MSW D;  1JKH B;  1S1T A;  2Z4P A;  3HZG A;  1UVL A;  2VG5 B;  2PFD A;  1RHM B;  5IM0 B;  4JI0 J;  1DZ5 A;  2HNY A;  3PJX A;  1PJ7 A;  4DR3 J;  2AQ4 A;  3KG1 A;  5F41 A;  2X1B A;  1JLF B;  4EUV A;  3RW6 A;  3R27 A;  2VD3 A;  5HAN A;  4DSE A;  1UVK A;  5HLF A;  1QM9 A;  1YJR A;  2Y9H A;  3PEJ A;  1GTE A;  4H54 A;  1NKB A;  2HNZ B;  3DRR A;  3G2X A;  4AL7 A;  1HWL A;  1SQG A;  1Y5L B;  1NSP A;  3BRE A;  4NYO A;  3PR4 A;  5J2Q B;  3LPE A;  4K4W A;  3CC7 S;  2MHN A;  1VQ9 S;  4RUH A;  4F02 A;  2AYE A;  2MZS A;  1E6Y A;  4OZJ A;  4DR5 J;  4WBF A;  1WC4 A;  3P5T L;  3W2W A;  1GXU A;  2W8K A;  2VQF F;  2KB2 A;  3EGZ A;  2UXD J;  3MUR P;  3I32 A;  3KMS A;  3OTO J;  1XEZ A;  2MKI A;  1N0U A;  2C28 A;  1S1X A;  1RYS A;  4WKY A;  1W7W A;  4KKO B;  4MK8 A;  1S7I A;  3VAG A;  3IXQ A;  5AXN A;  4C98 A;  4F3O A;  4ZCL A;  1WEL A;  3M30 A;  2FTR A;  1N33 F;  1WOS A;  2AJ0 A;  3KLG B;  1H3D A;  2D9O A;  1LXN A;  1RTI A;  2PDA A;  4FP9 A;  1VRQ C;  2EK1 A;  2IYG A;  4OZ1 A;  1WJ9 A;  4WIQ A;  4DU8 A;  2DRB A;  4B9M A;  2J76 E;  2BRK A;  5AE1 A;  4DL7 A;  2OPR A;  5B0G A;  1MMD A;  3CJK B;  2RU9 A;  1P1L A;  5THW A;  1NK9 A;  1ICE B;  2O01 C;  4KGM A;  3ILL A;  2JOQ A;  4QWB A;  3JTN A;  5KFC A;  3DLJ A;  5E3Q A;  1U49 A;  4EYH B;  4KV8 B;  4EZ9 A;  2DR9 A;  3W9J A;  5J1P A;  2W7A A;  1NHV A;  3K7R A;  2ZOF A;  4GVB A;  4RWW A;  1SVD A;  4HT7 A;  3ZZY A;  5D15 A;  4DX8 H;  2B4U A;  5CYM B;  4LF9 F;  4DPY A;  4CLW A;  3DLG A;  3SV4 A;  2RRN A;  2JLE A;  5A8W B;  3MM7 A;  2J9C A;  3ZZR A;  3QWU A;  4TU9 A;  4B9V A;  1XN9 A;  3RUB L;  2WOM B;  3G8T A;  3CUL A;  2UUA J;  1DBD A;  3UCG A;  1J27 A;  3O2I A;  4DV7 F;  4JI5 F;  4HEA 9;  2CDR B;  4HHU A;  2Z8Q A;  4NCG A;  3W9I A;  2R7R A;  4K50 A;  4P6Q A;  4CLL A;  1UJ6 A;  1BE4 A;  1FXD A;  2BJ8 A;  2R8J A;  2YKQ A;  3JQK A;  1ZAW A;  4A8Y A;  2IRY A;  3VF0 B;  1FJG F;  3TX8 A;  5C25 B;  4QU7 A;  3FBB A;  2FGO A;  1F2H A;  2CPJ A;  1VIS A;  2KJW A;  2XHC A;  1UMJ A;  1E6V A;  3JQJ A;  2R8K A;  3S6E A;  4BS2 A;  4LFC F;  4AUK A;  1JLC B;  3VQS A;  2DPJ A;  1S12 A;  4DPT A;  2CQC A;  2KM8 B;  2OPQ A;  1GMW D;  3ZZT A;  4KB7 A;  3M8S A;  4DR1 F;  2HRT A;  2F4V F;  1WOR A;  2HZA A;  2GV1 A;  1LK7 A;  2V4J B;  3IAM 9;  4URQ U;  4ED1 A;  3AT1 B;  1V5I B;  3PJ9 A;  3SCK E;  2QL7 B;  4K2X A;  1OY8 A;  2Y8W A;  4M1K A;  3IM9 A;  2D1C A;  2VFV A;  5HQL A;  3KK2 B;  3P49 B;  2UXC J;  1PJ5 A;  2F65 A;  4LFB J;  4X4S A;  1OQ3 A;  3V4I B;  2YVS A;  2ACM A;  1WHY A;  2C22 A;  1IKX B;  1H7W A;  5AXK A;  1IVZ A;  4P73 A;  1NO8 A;  1Q0N A;  3H2V E;  2E29 A;  1YBU A;  2P5V A;  3R8Y A;  3WC0 A;  4NLR A;  2GHP A;  1M0S A;  3T41 A;  1TU0 B;  3OJU A;  3F0N A;  3QSY B;  4JI3 F;  1S0N A;  2Z30 B;  3PR5 B;  3I56 S;  4DV1 J;  4YFU A;  1HR0 F;  5HK4 A;  5GAG U;  2HGL A;  3W5Z A;  2ZOG A;  3GV7 B;  3MUM P;  4JYA J;  3AB2 B;  3W5X A;  2BAN B;  5D8H B;  1R27 B;  1XER A;  3TJ9 A;  4DR4 J;  1X4F A;  2X3D A;  1C1C A;  1S6Q A;  4DPW A;  4LF9 J;  3N5B A;  2XSJ B;  3CIZ A;  3OVA A;  2YWG A;  1F1B B;  2W25 A;  2DYA A;  3CJQ A;  4X4P A;  2GA7 A;  2OPS B;  2QGF B;  4HHJ A;  3E8O A;  1RK8 A;  2WSC C;  1RIS A;  3DC2 A;  5D77 A;  5J2N B;  3T6B A;  4KHP J;  1NK6 A;  2QFI A;  2MKS A;  2R2U A;  1UFW A;  2KFY A;  3MAA A;  1T9T A;  1MN9 A;  3EGW B;  3KTQ A;  4P2F A;  3KK3 A;  4NOH A;  2YWE A;  1F9E B;  5IQQ A;  5A2Q Y;  5FJ4 A;  1NLK L;  3LO3 A;  3J7A N;  1JLE A;  4LSN A;  4U7C A;  1IBM F;  1DFD A;  5DDR C;  1C0U A;  1R0C B;  3GIK A;  3EXC X;  3R7S B;  1HI0 P;  1DQ9 A;  3LPY A;  2WAQ D;  2R2T A;  2XQC A;  4ED7 A;  2GQ2 A;  1SH0 A;  1T05 A;  1R8P A;  3NLC A;  2A3J A;  2ZVI A;  3IC1 A;  3ZTR A;  2D3O R;  1RBO B;  1Z4U A;  4FYX B;  1ZTW A;  2VOO A;  3IWL A;  4HL9 A;  3HM9 A;  4DG1 B;  2VA3 A;  1TUW A;  1MNE A;  2QMW A;  2Z58 B;  3CME S;  5CD4 H;  3M6X A;  4J5O A;  3UN2 A;  2RHS B;  4P10 A;  2CNO B;  1EQM A;  4KGV B;  2V4Q A;  4YHH J;  4XAK A;  4X4R A;  4URS A;  3TAM B;  2EBE A;  1BQM B;  1N88 A;  3M1V B;  1HBU B;  4Y0F A;  4LF8 F;  3C46 A;  1EET A;  2DHS A;  1R43 A;  1TL7 A;  3TA1 A;  1C4A A;  2HND A;  1RAJ A;  1F6T A;  2XMA A;  2XTJ P;  2HSE B;  3FEX B;  1C0T A;  3IRX B;  2KYX A;  3DFE A;  1S6P B;  3QWP A;  1W2B R;  1JQG A;  2KXH A;  4ZCI A;  2OPP A;  3IBF B;  1REV B;  2N7C A;  4USJ C;  3UN5 A;  4NLW A;  4I6Y A;  5D3G A;  2AP6 A;  4ZKA A;  4N47 A;  3ZZO A;  4M95 A;  1K0T A;  2DNO A;  3PW4 A;  1Q53 A;  3KFW X;  4ED6 A;  2FLL A;  2V50 A;  4C0O C;  1SJF A;  1TL1 B;  2MLZ A;  3C16 B;  2Q3P A;  4IO1 A;  1OSC A;  1YRU A;  1XK8 A;  2H5I B;  3RGI A;  5KFR A;  5H9E K;  4H4O A;  1UEK A;  2C42 A;  1EKS A;  2RUG A;  3NP5 A;  2XMV A;  1T9Y A;  4OYB A;  5C24 B;  5KFQ A;  4CO0 A;  4ATN A;  4P74 A;  3PX6 A;  1D9D A;  4Q44 A;  2VDI A;  5HVF A;  4UUX A;  1X5O A;  1RAC B;  4ECW A;  4JI1 F;  1RWN B;  4RWX A;  1QE1 A;  1UCN A;  1WHX A;  3RJM B;  1DQA A;  4DWI A;  1R0B G;  3IMQ J;  3LP2 A;  3QYY A;  3JAM Y;  3EWG A;  4TQR A;  1U1M A;  2DVI A;  3DDK A;  4IUF A;  2ZBP A;  1HNX F;  3I96 A;  1VRT B;  4K4Y A;  2ZZM A;  1WKK A;  4ILM A;  4DV5 F;  4B9L A;  4U96 A;  3C66 A;  3G86 A;  1WAC A;  1X4H A;  5A8R A;  3H7H B;  2LEC A;  1NAQ A;  5GME A;  1U47 A;  3OTB A;  5KG1 A;  2CKW A;  2R8I A;  2QMU B;  1VQY A;  4PCQ A;  4NML A;  3MMA B;  3J7Z 5;  3ZXW A;  1U1P A;  3CCM S;  3MOZ A;  2CJX B;  2F8H A;  3I0R B;  1WSV A;  5EUH A;  2HVE A;  2RRB A;  6FDR A;  3QIP B;  4UZB A;  4AQY F;  2HWI A;  1GXT A;  1ROF A;  1FNX H;  1F60 B;  1NPP A;  2MQ8 A;  4RUB A;  3GJR B;  4ZJO A;  3R9L A;  5K14 A;  1NK8 A;  4YS2 A;  1KKH A;  1YBA A;  4ZN1 A;  3HVA A;  1KC8 T;  4HH0 A;  3B4M A;  2X1F A;  2VUG A;  3RBD A;  5CD4 A;  3KHL A;  2AMC B;  3K5L A;  1J5E J;  2A18 A;  2MY8 A;  3AXM A;  1D09 B;  3OPK A;  3CT9 A;  1KEK A;  2C2R A;  1E6Y B;  2HBQ B;  4MMO A;  3S1T A;  1VI7 A;  3HSD A;  4RW8 B;  3PKY A;  2IM1 A;  3W3S A;  4GKK J;  1QAY A;  3PX0 A;  2B5J A;  5F0U A;  3Q0A A;  3RB4 A;  1FKP A;  1UFL A;  4IKA A;  4HT5 A;  4KKO A;  2K7K A;  3NGS A;  3MWB A;  1SC6 A;  3QZ8 A;  3KK1 B;  1MWQ A;  2YPZ A;  3O5T B;  2JC1 A;  5I3P A;  2RQK A;  1NEE A;  4TU7 A;  1VMB A;  5B0C A;  3EDR B;  4C7Q A;  5I3U A;  3FSY A;  2WVB A;  2HW3 A;  1S72 S;  1RTI B;  3DDI A;  4HDH A;  1UPM B;  1O5J A;  2GJF A;  1W26 A;  1ZZF A;  4FNI A;  2ABY A;  1R8C A;  3NMA A;  2XG8 A;  4DQP A;  2O5D A;  2OLW A;  4CH0 S;  3FNN A;  3W62 A;  5KFV A;  3SQG B;  4OJ1 A;  2XHW A;  1VJW A;  2EG2 A;  4WPA A;  5I3Q A;  1WG5 A;  3CDB A;  4OZ2 A;  3CED A;  2M8D B;  4X4V A;  5ETT A;  2XMT A;  4DV5 J;  2DNP A;  1IQZ A;  4FYY B;  1N0V C;  5DG9 A;  3ULH A;  1C4C A;  4I6W A;  4Y3C A;  4X65 F;  1NDC A;  1UEV A;  3GFX A;  1I6J A;  2XB2 D;  4K4T A;  1R7I A;  1X0P A;  2B8P A;  3OSP A;  2ATC B;  3KDN A;  2HLT A;  2EKY A;  2PO4 A;  5B0A A;  3SYZ A;  3UDL A;  2L08 A;  2HIQ A;  4OYO A;  5KFU A;  4C8K A;  1UVM A;  3V6J A;  4DS5 A;  2LA4 A;  2FC9 A;  2OTJ S;  3H5X A;  1BUX A;  4CLT A;  3BPS P;  3HFV A;  2XYH B;  3BGR A;  3DRS B;  3VGU A;  4UQG A;  4A8Q A;  3M2R A;  2I2Y A;  4PPZ A;  5IT4 A;  1HA1 A;  2EI5 A;  4ZP7 A;  3W64 A;  5A6P A;  2A6O A;  1QUV A;  2HKE A;  2RE1 A;  3LGM A;  1I1G A;  3TO8 A;  4QR2 A;  2G2O A;  2V8P A;  4DZD A;  3BN7 A;  2CQ3 A;  3DCA A;  1KOH A;  1NKC A;  1GAO A;  1FI4 A;  2VF3 A;  4ILR A;  2V8D A;  4JI6 F;  1PG5 B;  2LXI A;  3H5U A;  3TJ8 A;  4B3T J;  3A1Y G;  2GVZ A;  3O8W A;  4QJV A;  3DM2 A;  1SJR A;  3WBZ A;  5A6W A;  3LW5 C;  2A1B A;  3MTK A;  3HT3 A;  1NK5 A;  3PYD A;  1JJ2 R;  4EWT A;  2B7C B;  3NMR A;  4OZ5 A;  1SUQ B;  3Q2T C;  2V8H A;  1RT6 B;  3U1L A;  1RE1 B;  2WON B;  5M2U A;  2E5L F;  4CO2 A;  2GCF A;  4CQ1 A;  3HHL B;  2V4J A;  3FQL A;  3OQ2 A;  5KFI A;  1K0V A;  2CPF A;  1ZM9 A;  3DLL Q;  2B0G A;  1Z2L A;  2DGV A;  1RAB B;  2DNR A;  2MTL A;  4JI2 J;  1X9W A;  1FE4 A;  2BXJ A;  2R7X A;  3D1Q A;  4QIF A;  5ETP A;  1T03 A;  4P7V A;  1PC4 A;  4DL4 A;  2BOP A;  4YEA A;  3MEG A;  1F3F A;  3EZO A;  5AXM A;  2HFN A;  3QLH A;  4DX5 A;  2LEB A;  2W2P P;  2V4R A;  2ZJR Q;  2V0N A;  1RAF B;  3FFI B;  3DYA B;  1NBE B;  2H3E B;  4KO0 A;  3L4B C;  3N5F A;  3H5Y A;  3K5O A;  2V68 A;  1WG4 A;  4J9M A;  2F8M A;  3LAK A;  4OYM A;  2VH7 A;  2XNR A;  4DL2 A;  3QJJ A;  3RBX A;  1HBM A;  4USI A;  5KG3 A;  1HNV B;  5EGY A;  3OW2 R;  4I2P A;  1DY3 A;  4C8Y A;  4NPO A;  7AT1 B;  4BBY A;  4Y28 C;  1T94 A;  3M2V B;  3D6T B;  5IM0 A;  4LSN B;  4OHY A;  3MM5 A;  2UUW A;  4KPC A;  3HVR A;  3CCS S;  4RW6 B;  4OI0 A;  1NZA A;  3D6F B;  2ATL A;  1Q82 T;  4JI2 F;  2KZM A;  3NAI A;  4ZIV A;  2AZ1 A;  5BR8 F;  4N76 A;  3CVK A;  4PWU A;  4WFX A;  1SJ4 P;  2BKN A;  4B3T F;  4EEY A;  4RU2 A;  3PM9 A;  1R8B A;  3ZO7 A;  3DRR B;  1U2R A;  1CC8 A;  2IDE A;  2H65 B;  2MZQ A;  2WVF A;  5GAD U;  3W65 A;  2H5J B;  4Q43 A;  3B6B A;  4ZIT A;  1RT2 A;  1CBK A;  1WI6 A;  1VQN S;  1CJU B;  3D3C J;  1F3V A;  4ELV A;  3IWN C;  1CSJ A;  5JVG Q;  1TKZ A;  1X5P A;  3BF4 A;  4NLD A;  2Z56 B;  5KFW A;  2V9W A;  2I0X A;  1XNQ F;  1F2G A;  5LMU F;  5BJR A;  1CJK B;  3SQO P;  3T1Y F;  3NWG A;  4IRD A;  5HMX A;  3H40 A;  1DQ8 A;  2N7Y A;  2HAF A;  3DOM B;  4C2M A;  3MUV P;  2MZR A;  2QLB B;  4WII A;  3DOK B;  3K57 A;  4EBD A;  4C3L A;  1NND A;  3AH6 A;  1YJW S;  2YNF B;  2ZE2 A;  2M5Y A;  2KG0 A;  3QJL A;  2WTF A;  2GZO A;  4OJG A;  2HQG A;  5D3G B;  3HDS A;  3BKU A;  1KHV A;  3HVT A;  1WC6 A;  4DSK A;  5AE3 A;  2DK2 A;  2IFX A;  1TK0 A;  1VQK S;  1BWV A;  1HBU A;  2B51 A;  3BH7 B;  1WTB A;  1L3T A;  4C8Z A;  5KG0 A;  4ID5 A;  2LQB A;  4NXN J;  2F3J A;  1D8Y A;  1RWO B;  1ZPW X;  1HIY A;  3PYG A;  3R5D A;  3CJ8 A;  4O3R A;  1XNR J;  3QO9 A;  2E1M C;  1XMQ F;  1N34 J;  4DQS A;  4Q5V A;  1PGZ A;  3DLH A;  4B3S F;  4Q2L A;  2QYG A;  3BH6 B;  2HHW A;  1EJ7 L;  1RZM A;  4QPT A;  1HQ2 A;  3H5S A;  1SKW A;  1FER A;  1X4C A;  2QTW A;  2DEJ A;  1U24 A;  4DSF A;  5AT1 B;  2G13 A;  3MCM A;  2N4C A;  3AJ2 A;  3KLI A;  3N0V A;  3NBP A;  3NGR A;  2R8H A;  4J9K A;  2DIT A;  2UVU A;  2G0J A;  1Q7Y T;  1UJ5 A;  1RT5 A;  1YG0 A;  3T1A A;  1U1Q A;  1KSP A;  2E9Z A;  1RAD B;  3P3D A;  4O44 A;  1T9X A;  2XS7 A;  4TXS A;  2UUA F;  1KDN A;  3ET6 A;  4NCG B;  3LWM A;  3IR7 B;  2A6M A;  3GWC A;  4QU6 A;  1GMU A;  2FJE B;  2IAJ A;  3WX8 A;  3G6V A;  2UXB J;  1T3N A;  3IWX A;  1UAW A;  1HPZ A;  2K3K A;  3VZI A;  3RTV A;  4JI4 F;  5C25 A;  2LEP A;  1V9O A;  3JSB A;  3RRH A;  1Q81 T;  1IKY A;  3SSQ A;  1XMQ J;  4K4U A;  2P9C A;  1JLC A;  3HUL A;  4C0B A;  2EVZ A;  2PN6 A;  4B3S J;  2YPY A;  4X4U A;  2V63 A;  2C3M A;  1RAA B;  1TUG B;  2I1R A;  4NAS A;  4J9P A;  1YQH A;  4ELT A;  4W90 B;  4ECY A;  3ZNJ 1;  3KLF B;  1N5T A;  5ETO A;  3E01 B;  2XMU A;  1HQE A;  3V4M A;  1ZM3 A;  3KK2 A;  4Y2I A;  2PI5 A;  1HLW A;  2DHA A;  3GYN A;  1GMW A;  2D41 A;  2QE5 A;  3IBW A;  4RBU A;  3VAK A;  4YME A;  2FJW A;  1TL3 B;  1DRZ A;  3E2E A;  3L7P A;  3CIM A;  1S1V A;  1RBL A;  3UCZ P;  1NKE A;  2MGZ A;  2PE8 A;  1U6F A;  2DJW A;  2ZD1 A;  4F67 A;  3PAC A;  4KIA A;  4TU8 A;  5JVH Q;  3L7O A;  4L3N A;  1TTH B;  3C16 A;  3L3C A;  1N48 A;  3EMT A;  3I4P A;  1F5B A;  4LVO P;  5SZT A;  4V19 J;  1M5P C;  4QPX A;  5DZ7 A;  5C24 A;  3THV A;  1Q7L B;  2DNH A;  2FVP A;  1IR2 A;  1ZS6 A;  4FN5 A;  4OYI A;  1RQ0 A;  3A8K A;  4DV3 J;  2YNG B;  1WEY A;  1UZH A;  4Y2C A;  5J2M A;  1FKP B;  4TLQ A;  4LQ9 A;  4LRC A;  1SC1 B;  4OZL A;  5KFG A;  2DGT A;  3NWR A;  4IFY B;  4A8S A;  1TP7 A;  2OFH X;  2MLX A;  2CAD A;  1VRT A;  3MTJ A;  3QT8 A;  4ZLN A;  4URG A;  3QT5 A;  3OBI A;  4HKQ A;  1ZTT A;  2RB7 A;  3CW2 C;  3PW2 A;  4EBC A;  2BM1 A;  1KVI A;  2XLJ A;  4RNO A;  2LU2 A;  3OFE A;  3QNW B;  5CXT A;  2Q1L A;  4IDK A;  3SDE B;  3CMA S;  2HHV A;  4LIW A;  1RHQ B;  4ZVU B;  3PVX A;  3ITH B;  2F9J A;  3FRZ A;  2AGQ A;  3BJY A;  1SJQ A;  1SJ1 A;  2E5I A;  1OY9 A;  2G2Y A;  4BC7 A;  1TVR B;  2DNG A;  2FHM A;  2VZ9 A;  3BEG B;  3PEH A;  1UET A;  3M05 A;  4M5K A;  3OSN A;  3H4D A;  1ZZN A;  4MKY A;  3FBE A;  3KLE B;  2POK A;  3DXB A;  2E1R A;  4HYK A;  3WDO A;  5H9F J;  2AWZ A;  2D74 B;  2ASY A;  4DV0 J;  3GG0 A;  1SIZ A;  4ECQ A;  4ZPB A;  3J80 U;  3NNH A;  1NCL A;  4K5S A;  2KVI A;  1U0H B;  5A0Y A;  4EI2 A;  4C8O A;  2QG9 B;  4RBT A;  5K8M A;  1YHQ S;  2C3U A;  2JX2 A;  3EGV A;  1CUL A;  4O3O A;  2IMW P;  4PXC A;  3L9Z A;  3VCD A;  2LLZ A;  2HPU A;  5HMW A;  2CQ2 A;  1CS4 A;  5L8R C;  2XO7 A;  4A8W A;  2DGW A;  1JLB B;  1BD6 A;  1Q95 G;  2Z57 B;  3B78 A;  2HHH J;  1VLO A;  2LU1 A;  4B9T A;  2KHC A;  4ZCK A;  3MHY A;  3OTD A;  1HBO B;  3DLK A;  4YOE A;  3AY0 A;  4K4X A;  1Z2Z A;  1QY7 A;  1FRI A;  2MQL A;  3O44 A;  5D0E A;  4UUW A;  1HNI A;  1SXL A;  1JNR B;  2U2F A;  4KBI A;  3TZW A;  3VQT A;  1M5V C;  2HFS A;  2RKI A;  4C4W A;  3G6E S;  1PKU A;  1N5Y A;  2HRY A;  4I64 A;  3QBC A;  3T9Z A;  1XR6 A;  1TL1 A;  3DM2 B;  4ID8 A;  4GC7 A;  4U95 A;  2FJD B;  5F8I A;  2R7Q A;  5D6G A;  4DV0 F;  2HHX A;  1AFI A;  3AAW B;  5HAT A;  3MFI A;  4NYZ A;  1RAG B;  3IBC B;  4B9S A;  2CWK A;  4ELU A;  4M5H A;  4C9D A;  1FDN A;  2J0W A;  2YTC A;  5KG7 A;  3EX7 B;  5F3T A;  1VLY A;  1X5S A;  1WKL A;  5IT0 A;  1RKI A;  2BJ1 A;  3LH2 S;  3MEG B;  3NG8 A;  3NXZ A;  5BYR A;  3OLA A;  4PYD A;  1MU2 B;  1UJ4 A;  3OL6 A;  3R5A A;  1FCA A;  3LP2 B;  2ASJ A;  4N8N A;  3R7N B;  4AND A;  5DQI A;  1ZAX A;  2CPH A;  4X4Q A;  3F73 A;  4K4Z A;  3QAE A;  4M8L A;  3DOL B;  3VAJ A;  3HI9 A;  4KHR A;  1RAE B;  2FZK B;  2M9K A;  3JS9 A;  2QMX A;  2VQE F;  1W2I A;  2JEF A;  2ERR A;  1I94 J;  4RLE A;  2BAB A;  3MM8 A;  3AJD A;  3HMJ G;  1TKT A;  2ZNZ A;  3BYR A;  2WHO A;  4KC5 A;  2LQJ A;  3CDU A;  4UW2 A;  4ZJL A;  3U1M A;  1LFP A;  1KLM A;  1UWB B;  1Y5N B;  4G65 A;  2B43 A;  2W4D A;  2HBY B;  2HQF A;  4KO0 B;  3UD5 A;  4AQY J;  2HRU A;  3MI7 X;  3OXF A;  3Q86 A;  3GV8 B;  2AIR B;  4CLF A;  1VQ7 S;  1G6B A;  3MR3 A;  4E8U A;  4FKX A;  3NAH A;  1VK3 A;  2XZD B;  3BQ1 A;  3A4T A;  1U7L A;  4IOB A;  4C11 A;  4ETX A;  5LMN F;  1U8W A;  2E1P A;  3QID A;  2W7O A;  2WB1 D;  2R42 A;  2A0F B;  1CJU A;  1Z1Z A;  2DBB A;  2C3Y A;  2RAQ A;  1TZ0 A;  2VU5 A;  4H4M A;  5D4P A;  3G96 A;  2G1D A;  4TYB A;  2QFJ A;  2DH9 A;  3HFK A;  2WBM A;  3TOQ A;  2MZ1 A;  2VQE J;  2NXU A;  4ECX A;  3FMW A;  3D28 A;  4PAB A;  4FKY A;  4U7U K;  2CG8 A;  3A8E A;  4DLE A;  1U1O A;  5K9F A;  1I94 F;  2M3D A;  2V2K A;  2BE2 A;  4MIA A;  4RPF A;  4DUZ J;  4LF7 J;  1AYE A;  1LW2 A;  1EZZ B;  2XI2 A;  2XWY A;  2MQM A;  4AE5 A;  3GV5 B;  1NJZ A;  4LFA J;  4F4A A;  3B54 A;  4RW7 B;  3TUZ C;  3GFZ A;  1Q1K A;  5DGA A;  1WKJ A;  1XWL A;  2W9B B;  4ECZ A;  1IM6 A;  2ZHB A;  2GW8 A;  2JL9 A;  3PHT A;  2JFD A;  1TV6 A;  2DKO B;  2QSF A;  1YX2 A;  3C14 B;  5LJ3 Y;  2HFV A;  3ENQ A;  5ETR A;  3UI3 A;  2QRR A;  2KRR A;  3IAS 9;  4OFZ A;  5IC6 B;  4YY3 J;  4DUY F;  4CP5 A;  3KHR A;  3DNC A;  3DOM A;  1U45 A;  1HL6 A;  2VBW A;  2CJ9 A;  4NZ6 A;  2I6W A;  1UVN A;  3EZ5 A;  2V8V A;  1S99 A;  2XBP A;  2OUG A;  1NK0 A;  2IJF A;  1RTD A;  4E0D A;  5E3P A;  3PIO Q;  3HT0 A;  3EXY A;  4XO0 A;  2FJV A;  3LAM A;  2V67 A;  4ECU A;  2W8L A;  2RF2 A;  4OI3 A;  4LQ3 A;  1NJX A;  5KFT A;  5KT3 A;  2AU0 A;  1A9N B;  2MQN A;  2ZUG A;  3F56 A;  1PCA A;  1Q4R A;  3C6T B;  3K8W A;  1H73 A;  1NME B;  1RAI B;  3IO1 A;  4NEZ A;  2V34 A;  3M6V A;  3MM5 B;  4TLR A;  3TUJ C;  5HBM B;  4ERD A;  4FBU A;  4YQW A;  2MB0 B;  1GK8 A;  3JSY A;  4ITS A;  4KFB A;  2PII A;  2ZM6 F;  2WCX A;  2QEX S;  2ZH8 A;  4AD6 A;  2J8S A;  2GC8 A;  2EFN A;  3DHW C;  3ETM A;  4DR7 F;  4FXV A;  4NRU A;  3BGO P;  4H4K C;  3W2V B;  4HR2 A;  2HHP A;  1RT2 B;  4WE1 A;  1JLA A;  1OJ4 A;  4QZV B;  4CTA B;  1QAJ A;  4M5G A;  2HZC A;  4NI2 B;  3DLB A;  4IG0 A;  2P9E A;  3HD2 A;  4QYZ J;  3G6Y A;  3TZY A;  1WUU A;  2NS1 B;  1H0H B;  2Z0G A;  5KFM A;  1T9U A;  2BV3 A;  5AE2 A;  3HD1 A;  3L09 A;  2KHD A;  2GHV C;  3GJS B;  1SB6 A;  1S9E B;  1N5Q A;  2HGN A;  1TAQ A;  3M6U A;  4FS2 A;  1KHW A;  1UEU A;  3RR8 A;  2BKP A;  3TW0 A;  3VTI A;  9RUB A;  1K1Q A;  2DNN A;  3FBC A;  1S9F A;  2JEJ A;  3WX4 A;  2CJY B;  4OX9 J;  3TAN A;  5A8K A;  1IBL J;  3GB0 A;  1UA0 A;  2Q6C A;  5B0F A;  4WYL A;  4ES2 A;  4NXM J;  4CNY A;  2QA4 S;  3AHP A;  1JKH A;  3HSG A;  1ZM4 A;  5LM7 E;  1HYS B;  3GP9 A;  4ID5 B;  4N77 A;  3THP A;  1HQE B;  3K0J A;  3GR1 A;  3POT B;  4N56 A;  3SI8 A;  1S97 A;  4UOC A;  5EDW A;  1JXV A;  5IV4 A;  1UA1 A;  1K8A T;  4QOT A;  4ECS A;  2HS3 A;  4RO0 A;  4G3I A;  2FDN A;  3VR1 A;  3OFG A;  1HHS A;  1JB0 C;  3BSA A;  4DR1 J;  1RSC A;  2CG4 A;  2GVD A;  3FCW A;  4LSL B;  1R31 A;  2HWT A;  1O8B A;  2IPO B;  2LKZ A;  2Q79 A;  2VIC A;  2D3Z A;  4IFY A;  2J7K A;  4F2R A;  4JV0 A;  2NLW A;  5G0R A;  1S9G A;  2DHH A;  1WF0 A;  4Y2K A;  1RT5 B;  3TRG A;  5F3Z A;  2AHO B;  1GX5 A;  3EYZ A;  1R89 A;  3GYX B;  1FK9 A;  4PWD B;  2ZJP Q;  3T1H F;  2K06 A;  4QBU A;  4KY3 A;  2X1A A;  4J9S A;  2IJR A;  3TP2 A;  3HJV A;  2OEL A;  4CO4 A;  1N32 F;  1FJG J;  2AYM A;  2AX1 A;  2MQO A;  2G4B A;  2FD2 A;  4JI4 J;  4PEO A;  1OS5 A;  2HFZ A;  2MYF A;  2WZ1 A;  4LIR A;  4NYP A;  4X4O A;  2P2C B;  1M5K C;  3M8Q B;  2DIU A;  4DR4 F;  4IRK A;  4LMZ A;  5IWA F;  1OYE A;  3J81 U;  3E01 A;  1KWM A;  2M88 A;  2I5J A;  2V2V A;  3CCJ S;  4Q8F A;  2CJK A;  1Q8B A;  4UTG A;  4GKJ J;  1P27 B;  4ZDN A;  4UST A;  1TVR A;  3KJN B;  1GFW B;  2NYH A;  4J9N A;  2E9T A;  1TK8 A;  3MM6 A;  1KVJ A;  1S10 A;  4Y65 A;  1U1N A;  5ETS A;  3CJS A;  1G3O A;  1P1T A;  1J2V A;  3M6W A;  2KT5 A;  3MPW A;  2HFU A;  2HNZ A;  3H4B A;  1JK9 B;  5L38 A;  3PCO B;  4CYU A;  1RT1 B;  3V6D B;  1SPB P;  1TKX B;  2AJQ A;  1PSD A;  4P2X A;  1MML A;  4NL5 A;  4Q2M A;  4Y2M A;  4F0M A;  1DLO B;  2LXF A;  4XDD A;  1PBU A;  1L3S A;  1FRL A;  3VWS A;  5C5J A;  1BMQ B;  3GMG A;  2YH1 A;  2Z2Y B;  2FHJ D;  4NLO A;  4EK2 A;  4F50 A;  1JLB A;  4X65 J;  4BCA A;  2CPI A;  1B0V A;  4GO7 X;  1MWZ A;  3D66 A;  3CSK A;  3HX9 A;  4WU2 A;  1AA1 B;  4DL6 A;  1OYD A;  3QO9 B;  2GIR A;  1HAR A;  1NPK A;  2Y1I A;  1Q86 T;  2BBE A;  3DMJ B;  1N34 F;  3PO5 A;  1U2F A;  3BR8 A;  4B3O A;  1HD0 A;  4DR2 F;  3KNA A;  3OVB A;  3OR1 B;  3F44 A;  2RKI B;  5HVG A;  2VPX B;  2GML A;  3CJR A;  3EVW A;  2D3U A;  1ZA2 B;  4JBC A;  4CLY A;  3QGP A;  5CCM A;  3H8Y A;  3NBP B;  3W8G A;  2GJI A;  5F8M A;  4DV4 F;  3J7A 1;  3UDE A;  2YKO A;  3O1L A;  1X8D A;  4NLT A;  2DCU B;  3HHK A;  3A13 A;  4DBQ A;  4F36 A;  1SH3 A;  2W2O P;  1OQ6 A;  2JJ4 D;  3PNI A;  2JLG A;  4IH5 A;  5JUM A;  1FTR A;  2YKN A;  3N6M A;  3TA0 A;  2ZZT A;  5KFZ A;  4B9N A;  1U6Z A;  1KR4 A;  2YKA A;  2J0Q D;  2YY3 A;  1HNZ F;  1JLG B;  1NHU A;  4EMD A;  3V4I A;  2ZC3 A;  1VQ8 S;  3JAM U;  2RU3 A;  3CJ5 A;  4DN0 A;  2ZH6 A;  4WKR A;  4UY8 T;  2LVW A;  2MY7 A;  3DLE A;  3MED A;  1U6B A;  5DJB A;  4Q0B B;  2PMH A;  2CJA A;  2KN4 A;  3AOD A;  2C2M B;  1M5O C;  4TY9 A;  2UV8 A;  2BJD A;  4ES1 A;  4IG3 B;  2PT0 A;  2C3P A;  3NS6 A;  1FXR A;  3PYE A;  4LR7 A;  4OX7 A;  2OD4 A;  1HNW F;  2PMW A;  1N54 B;  4ZN3 A;  2FQQ B;  3M7V A;  2BAN A;  2FUG 9;  2YWW A;  4FNH A;  2GGP B;  1SV5 A;  3CCQ S;  3M2U A;  1HWU A;  2BOA A;  1T02 A;  2AJF E;  2IHR 1;  3V6K A;  2IBK A;  3TAP A;  3G82 A;  5GAH U;  2NXC A;  1RT4 A;  5ETM A;  1URR A;  2D69 A;  2ILZ A;  4OHZ A;  4U6P A;  2VA2 A;  2BUN A;  2FVC A;  4H4M B;  4RNF A;  2PI4 A;  1GTH A;  1RA7 A;  4L72 B;  2N3L A;  3DU6 A;  4LRB A;  2BJ9 A;  3RRK A;  2OPQ B;  2RIL A;  4KQZ A;  4P75 A;  4FPI A;  2VFU A;  1YJN S;  1RHU B;  1TKD A;  4IQX A;  4UZC A;  4EZ6 A;  2ADB A;  5M2R A;  1VBK A;  1S49 A;  2RDI A;  1HWI A;  3U27 A;  1S0V A;  1DAX A;  5J2Q A;  3I6P A;  2E5H A;  4I0W A;  3T5K A;  2CVI A;  1VK8 A;  3UN3 A;  4DR6 F;  1CQM A;  5HMZ A;  3KG4 A;  1RT3 B;  2A2D A;  3D68 A;  1SH2 A;  4ZLJ A;  3HHL C;  1C2P A;  1HW9 A;  1JJ4 A;  5BYQ A;  4F4Y A;  1S1X B;  4ES3 A;  4FPR A;  4MT1 A;  1K73 T;  2H4W B;  1BHN A;  1LV5 A;  4LF7 F;  1N36 J;  1FD8 A;  2MQP A;  4C8M A;  3NY0 A;  5CZV A;  5D0G A;  3D2W A;  2BZ2 A;  2VPY B;  1RTD B;  3L7U A;  3PRD A;  1R6V A;  2DCL A;  4HLB A;  1RTZ A;  4ETZ A;  2RVJ A;  1TFY A;  2VFT A;  3PRB A;  2C2E A;  2Y8Y A;  1TMM A;  2LQ5 A;  3QGI A;  2ASL A;  1R8A A;  4DQR A;  4RNM A;  2XSJ A;  2Y0S D;  4CO5 A;  4EFA C;  2KU7 A;  3CD7 A;  2UP1 A;  5HBM A;  2Q66 A;  2CA9 A;  4KGZ B;  3B4D A;  4OYA A;  2ZH4 A;  3Q89 A;  2HNY B;  1KP6 A;  1U02 A;  2GMJ A;  3TQ1 A;  5KFN A;  3BBF A;  3KLE A;  1FRX A;  2NXE A;  2XY6 A;  5SUH A;  1UKU A;  3JTO A;  5CHC B;  1EAY C;  1BQN B;  3PW0 A;  1J5O A;  4LF5 F;  1RWP B;  2NCK L;  3W2V A;  1YLX A;  2XNQ A;  1IJF B;  2ACY A;  2MST A;  3MM7 B;  3W9H A;  4Y00 A;  4B08 A;  3LGN A;  2BYC A;  4IFV B;  3UO0 A;  2UVV A;  1B7F A;  5T7L A;  2GIF A;  4H4O B;  5A0Y B;  4OHW A;  2K8G A;  5KFO A;  2UXC F;  1YBT A;  2HWH A;  3M8W A;  2YWH A;  3T9N A;  2DXD A;  4OZ3 A;  4DXL A;  4ZP9 A;  2RIJ A;  3GSI A;  4DCJ B;  3C6U B;  2DY9 A;  3H59 A;  3QGH A;  3GYG A;  3N79 A;  1D1U A;  2HGM A;  4NZ7 A;  2HHH F;  5AJ3 F;  4YUD A;  2DR6 A;  2ZZN A;  4DUT A;  4DOZ A;  3M30 B;  5F8H A;  1FJE B;  1NK4 A;  4DR6 J;  1FRK A;  1V3R A;  2ZKT A;  3TZX A;  3G6X A;  1HNI B;  3H42 A;  1H2T Z;  3HKW A;  4DCP B;  3IRW P;  4RKU C;  4JI8 J;  2ZUA A;  1D3W A;  2FJB B;  4ZP6 A;  1M5S A;  4MJK A;  3IP0 A;  1H2V Z;  3ZTQ A;  2MZT A;  1F0X A;  3GFH A;  4FS1 A;  3CCE S;  5E0O A;  1ZH5 A;  1ZPV A;  1RA6 A;  2MDA A;  4ZVQ B;  1IKW A;  5LJ5 Y;  2QLJ B;  5E7O B;  1C0T B;  3POT A;  5KFJ A;  4ED5 A;  3M32 B;  2KXF A;  5GMD A;  2NXN A;  1U48 A;  2DR7 A;  3ZZ0 A;  2IA0 A;  1JXE A;  1KD1 T;  3K89 A;  4OX9 F;  2RDJ A;  1B0P A;  1NDL A;  3KHG A;  4KHP F;  3OD2 A;  2HHQ A;  3K17 A;  2APO A;  4HDG A;  3IN5 A;  4USK A;  4AFF A;  2I38 A;  2L9W A;  2V6A A;  3C3L A;  1CPZ A;  2UXB F;  3UDV A;  4UY8 5;  3TA2 A;  2XI3 A;  2ZBR A;  3HP6 A;  1GNK A;  1V3Z A;  3N01 A;  3D1O A;  2RML A;  2NSC A;  2XYP B;  5HL7 Q;  4DV1 F;  2AJ2 A;  2IRU A;  1QD1 A;  1XR7 A;  3ICL A;  4ZPD A;  1IBM J;  1FHT A;  3OTC A;  2JH3 A;  2HQC A;  3PX4 A;  3R5C A;  5HQM A;  1V3S A;  3NOG A;  4MYT A;  4J37 A;  5EWF A;  1HWK A;  4USU A;  4F8R A;  1AZS A;  1N32 J;  1UW9 A;  4XDC A;  4AL5 A;  1S4E A;  2W2Q P;  5CCL A;  2HK3 A;  5EWG A;  3WZ0 A;  2M4M A;  2RDD A;  3ZTP A;  2F5G A;  3TI0 A;  2PC6 A;  4WE1 B;  4W92 B;  3K5P A;  2OPS A;  4YR2 A;  2B56 A;  3R5B A;  3UNY A;  4CTA A;  1EQ0 A;  4M63 A;  1CJT A;  1X60 A;  2ASD A;  4XTT A;  3M8P A;  3IR5 B;  2BMB A;  1IWA A;  4R0J A;  4YB1 P;  3J80 Y;  4AL6 A;  3CCZ A;  2VIH A;  4G1Q B;  2AYG A;  1RGV A;  4WF9 Q;  5ITH A;  3NKY A;  4TNO A;  3VAM A;  2Y1R I;  1NDP A;  4X4T A;  5JMN A;  2GNK A;  3QIP A;  1KQK A;  1M5H A;  3SCL E;  1C0U B;  2JHE A;  1JMT A;  3AXK A;  4ZVG A;  3Q8P B;  1LWE A;  3AB4 B;  3HHD A;  3UDC A;  4JI1 J;  2E5L J;  1H7X A;  1DTQ B;  1KVK A;  1SL1 A;  4LR9 A;  3WQP A;  1FKO A;  2BE2 B;  1X4G A;  2RSQ A;  3I55 S;  4FYV B;  4P2M A;  2R7S A;  3ADA C;  3SCJ E;  2BVZ A;  3CJ2 A;  2ZH3 A;  4RW7 A;  3TX0 A;  5HJY A;  4LFA F;  1DLO A;  2XM3 A;  3CF5 Q;  3LWL A;  2J0S D;  1QTN B;  5KOX A;  4CWB A;  5GAE U;  3GQC A;  4I7F A;  1WF2 A;  2QA2 A;  3C14 A;  4MK7 A;  3IA0 A;  3VHQ A;  4ALZ A;  1RWV B;  1HHT P;  2MEW A;  2XY7 A;  1VIX A;  4YY3 F;  3CDW A;  4X64 F;  2VKZ G;  4FF4 A;  4IYQ A;  2FY1 A;  2L3M A;  4CO1 A;  3KK1 A;  1JNZ B;  1WOO A;  2LMI A;  1S6P A;  4ZVT B;  3D6M B;  4PG6 A;  1RT1 A;  3V6D A;  1LWX A;  2V8G A;  1X4B A;  3R3T A;  2HBR B;  3BQ2 A;  3BKF A;  4WWS A;  4XK8 C;  2XUL A;  5DLF A;  3LP0 B;  5F8N A;  2RRA A;  1T0T V;  1FNM A;  1IKV A;  3RR7 A;  4ZCM A;  1GQE A;  4KYZ A;  4ILL A;  3I5A A;  4TKT A;  4ED2 A;  1B64 A;  4KAI A;  2QC3 A;  1YK9 A;  2L9D A;  2HG4 A;  3ZNU A;  2FJX A;  4A48 A;  4KH0 B;  5KG2 A;  3NNA A;  4PG5 A;  4K0K F;  1S6O A;  1KTV A;  3DDN A;  4M5L A;  3W61 A;  3SFU A;  1S79 A;  1RT6 A;  3MGJ A;  2WBR A;  1T05 B;  4FXD A;  2G0C A;  1QE1 B;  3MR7 A;  1I5O B;  2LEA A;  4PAA A;  4WXO A;  4DCO B;  1X31 C;  2CXE A;  2IBO A;  4UT4 A;  3KLH B;  1ZOT A;  3OJS A;  5L1K A;  1K44 A;  2JVO A;  4E98 A;  2YKN B;  4P71 A;  4Z7Y A;  4YR0 A;  2VBZ A;  1C1B B;  3H2U B;  1VRU B;  2JC0 A;  1S57 A;  2ZC4 A;  4G1I A;  1LFW A;  4L74 A;  1B7Y B;  1NU4 A;  1EET B;  4TQS A;  1U0S A;  2P6S A;  4OHX A;  4X84 A;  2R7T A;  2K1R B;  1YKW A;  2XGQ A;  3BSO A;  3CTR A;  3CCL S;  3MMJ A;  3FCV A;  3ZFV A;  1RT4 B;  1JWW A;  2M52 A;  2H48 B;  4CYU B;  2PA3 A;  2RS2 A;  2OPP B;  2R7O A;  3CCW A;  1QSL A;  4U67 Q;  2JVR A;  1P9Q C;  4FDF A;  3VAI A;  1FFW B;  4NA3 A;  2V69 A;  2HEK A;  2YQ3 A;  1BC6 A;  5B0E A;  3UFC X;  4DR7 J;  1D9A A;  1X4A A;  1BXN A;  2P8I A;  3AFG A;  2DR8 A;  4NXM F;  1HNW J;  2DH7 A;  4I2P B;  2GGP A;  1ULR A;  2YX7 A;  4ZPA A;  2IVM A;  2VKR A;  1Q79 A;  2QLW A;  4Q45 A;  1KLN A;  3OLB A;  1J5E F;  5IQ6 A;  3M2V A;  2C2K B;  1LWF A;  3NCP A;  4MKV A;  2UUT A;  2D7S A;  4B3O B;  1LQ9 A;  3D0H E;  2DGS A;  2QL5 B;  2WSF C;  3ZZP A;  2NRE A;  4V1A k;  3DHX A;  2XS2 A;  3BGL A;  5HI7 A;  4DZ6 A;  2CAJ A;  1QUP A;  1IN0 A;  1QJH A;  3MEE B;  3NEK A;  3CC4 S;  3ZTS A;  2R3V A;  3D54 A;  4RUC A;  2X7I A;  2CWX A;  2AGO A;  1S76 D;  3FRY A;  3FMB A;  5LXY A;  1N33 J;  3NOC A;  4J7C A;  1L3V A;  1WEZ A;  4IO9 Q;  4PPD A;  2XLK A;  2JFK A;  3SQG A;  5RUB A;  3UD4 P;  2OI2 A;  3DYA A;  1ITP A;  4UOG A;  3F41 A;  2DGQ A;  2YNF A;  2ZE2 B;  2BW2 A;  4F0K A;  5KFX A;  4UF4 A;  2CPX A;  2XMM A;  1HMV B;  2RS8 A;  2H9Z A;  2FC8 A;  1Q16 B;  2PMZ D;  3HVT B;  3AQP A;  5K14 B;  2O1P A;  8AT1 B;  3FZB A;  1WC5 A;  3UVJ A;  5D4L A;  5D0H A;  1LW0 B;  5I42 B;  3M9N B;  2MXY A;  1WNE A;  2ZH9 A;  2X51 A;  4HTJ A;  3HF5 A;  4M5M A;  2CFX A;  3DRP A;  1EIY B;  3MM9 A;  1WF1 A;  2NXJ A;  3AA9 A;  2UV8 G;  5F9N A;  4ED0 A;  3WHI A;  3MCN A;  5IV3 A;  3GZ7 A;  4RW8 A;  4DL5 A;  3FQK A;  2JLF A;  3G8S A;  4DV7 J;  5GAE I;  1PYO B;  4DHV A;  1M1K T;  4BWJ A;  5AJ3 J;  1J5O B;  2YNI A;  5I4M A;  1SKS A;  1HFE L;  4KHM A;  2DB1 A;  4OX6 A;  1X9M A;  2J0X A;  3AOA A;  3NNC A;  5J1E B;  4IFV A;  2DXF A;  3FJ2 A;  1RAO A;  2OSR A;  4PXD A;  4DL3 A;  2CQI A;  2IM0 A;  2MKJ A;  2ROE A;  3ENA A;  4I1T A;  1HQU A;  1RT3 A;  5ETV A;  3SBM A;  5HQ8 A;  3CD5 A;  2J6U A;  5C42 B;  4R5P A;  2RNE A;  2HVZ A;  3Q23 A;  3VVU A;  3QSI A;  5ETL A;  4QQB A;  3R1H A;  8RUC A;  2VFR A;  1VQO S;  2DY1 A;  3M32 A;  3NGD A;  4RW9 A;  2E7X A;  2DEI A;  1TMJ A;  2HQ3 A;  1SUQ A;  1NDK A;  1WDT A;  4DEZ A;  4DPO A;  1X9S A;  4O3S A;  4ANE A;  3OR1 A;  5E3C A;  5KFL A;  2UU9 F;  2BAC A;  1PYT A;  3CDA A;  4QR0 A;  1CQN A;  3N28 A;  4R8U A;  3KLV A;  4DJB A;  2HLU A;  3D0G E;  4DUY J;  3C2P A;  1Y7P A;  4V19 X;  4B3R J;  1CJV A;  2DO4 A;  3TVZ A;  3VAH A;  1S1T B;  3V2U C;  1MN7 A;  2C2Z B;  5D4N A;  1FA0 A;  4LF1 A;  3NGT A;  1QSY A;  3C8Y A;  3KJQ B;  1UWA A;  2FVR A;  2HYI B;  2DGX A;  5M2P A;  4DFP A;  4YN3 B;  4DPU A;  2UVR A;  9ATC B;  1VQ6 S;  2KFN A;  2HQD A;  2QL9 B;  3AD7 C;  1AT1 B;  5IXU A;  3DRS A;  3PZP A;  1S48 A;  1BQN A;  5CYQ A;  2P6T A;  2ZIT A;  4NLX A;  1OY6 A;  1Q5Y A;  1RAH B;  2JSX A;  1GEH A;  2ZDO A;  3KLI B;  3GPA A;  3QPI A;  3PHE A;  2YBV A;  4FVC A;  2ALY B;  3THT A;  5HN0 A;  4WU3 A;  1VBY A;  1M90 T;  1OWX A;  4IG3 A;  1FX4 A;  4C3K A;  4PQU A;  4PXE A;  1CG2 A;  3K2Y A;  4AT1 B;  4WFA Q;  4K4S A;  3BBC A;  1Y0H A;  4ZPW R;  3W2W B;  3K5M A;  3OL9 A;  2OP5 A;  2VG7 B;  1RTH A;  3OL8 A;  1NJW A;  1SV5 B;  3TUP A;  1VIO A;  1VOM A;  5HMY A;  2XLI A;  4ZHR B;  3KYL A;  1VYA A;  2GO8 A;  2QLF B;  2Q43 A;  2VV5 A;  3FSX A;  3G82 B;  3MD1 A;  5EX0 A;  4PKD B;  1URN A;  1D0E A;  2ZKU A;  3Q24 A;  2CUY A;  1YIJ S;  1Q8L A;  3VAL A;  4RW6 A;  5H1S V;  5CH7 B;  2NZ4 A;  2J9D E;  1LWE B;  1RP5 A;  2W7P A;  5KFE A;  5H9F K;  2DHG A;  3ETO A;  3WIU A;  3KG0 A;  5F8G A;  1TAU A;  4LR8 A;  2DPI A;  1U1R A;  4LJM A;  1UVI A;  5U47 A;  2QT7 A;  1RI7 A;  1SI9 A;  4BC9 A;  3CUN A;  4PRF A;  3BBB A;  4X2B A;  4OIX A;  2L48 A;  1U1K A;  1TL3 A;  3N9U C;  1KFS A;  1XNQ J;  1IUJ A;  1RCO B;  2C2O B;  2RD5 C;  1DTQ A;  3EDQ B;  5HLF B;  2M8H A;  4ECR A;  1XQI A;  4ZS6 A;  5CYM A;  1BWE A;  5IC4 B;  1SKU B;  4ZPC A;  4ENO A;  1FD2 A;  2EW9 A;  3NGU A;  4KJI A;  2BM0 A;  4TN2 A;  3EVM A;  1NM2 A;  1U0H A;  4WK1 A;  4YDD B;  1S0O A;  2R4F A;  2O66 A;  1LWC A;  4F4W A;  2XY5 A;  5F9L A;  3G4S S;  3MUT P;  2R2R A;  4X66 J;  4I7F B;  5FLX U;  4XPC A;  3T6J A;  1DUR A;  2OJ3 A;  1XMO F;  1IJE B;  2GFF A;  5BYS A;  2V2Q A;  1LXJ A;  5DRK A;  2CJB A;  2W9A A;  4NA1 A;  2E7W A;  1FXL A;  2B6A B;  1HBO A;  2G2Z A;  2RHQ B;  2OAU A;  3MAH A;  3PFE A;  4O0N A;  3K5N A;  2NPI A;  1OPZ A;  2J7W A;  3IG1 B;  3M8P B;  1UL3 A;  3QFW A;  1UTA A;  1FFS B;  2DNK A;  1Y3J A;  1SL0 A;  2OO4 A;  5K20 B;  4IDK B;  3KKF A;  1WC0 A;  1YVF A;  3L95 X;  1LKZ A;  4I56 A;  5E3A A;  3CJK A;  2ZHA A;  4CCH A;  3ITH A;  1UVJ A;  2MJU A;  2DHX A;  1N6Q A;  1GMV A;  4ZIW A;  2AD9 A;  2DNY A;  2UUC J;  1T3O A;  2E9R X;  1ELO A;  1A7G E;  1RLC L;  4QYR A;  2FLO A;  3OR2 A;  4ICL B;  2BR0 A;  1EB0 A;  4DV3 F;  1MLA A;  3BSN A;  4G1P A;  3DXS X;  4WYW A;  3M9M B;  3A3P B;  5EN1 A;  4PUO A;  5A8W A;  4S0M A;  3CGI A;  1B0T A;  2MKH A;  2QLX A;  1U26 A;  4B3M F;  3QJP A;  1IR0 A;  1RTJ A;  3MZI A;  2H51 B;  4WTY A;  4WFB Q;  3J7Y I;  1WC3 A;  3BZQ A;  4U8V A;  3Q8Q B;  4J9Q A;  2VQF J;  5LT5 A;  2UXD F;  4WXW A;  3UWT A;  3MM8 B;  1I51 B;  3OTO F;  5IOL A;  1IKW B;  3BSC A;  1R6Y A;  3LAL A;  1KQF B;  3CCR S;  4O23 A;  2CQ0 A;  2RT3 A;  2V9K A;  3R2D J;  4MTP A;  3BM7 A;  3IM8 A;  4ZMM A;  4IR9 A;  4LFC J;  3G9C A;  4RJV A;  3FZ2 A;  1CC7 A;  2UUC F;  2F4F A;  4HAC A;  4YR3 A;  3KOA A;  5KG5 A;  4FVM A;  1OPI A;  1YRX A;  3J81 j;  4FF1 A;  3LP0 A;  2FHJ A;  1HNZ J;  2VOD A;  1T7P A;  3MEE A;  3BPD A;  2EFG A;  2JEI A;  2PSZ A;  1R3N A;  2QX0 A;  1XJW B;  4F4K A;  4JI8 F;  3TAR A;  2PEB A;  1IXK A;  4Y2A A;  4B3M J;  4PG8 A;  1SC4 B;  1RT7 B;  4E2F B;  1RHR B;  2V94 A;  2LFV A;  3ELH A;  3MCO A;  5K5M A;  1XBW A;  4ZLL A;  5KFS A;  4OV1 A;  2KI2 A;  4ZPT R;  5E2Q A;  2A10 A;  2DRD A;  3LA0 A;  4CI0 B;  3KLH A;  4JI3 J;  1WTF A;  3PFO A;  2GHW A;  1CJT B;  4RUA A;  5D0R A;  5FII A;  2HMI A;  4LBH A;  5DM7 Q;  1Y9O A;  2YX4 A;  2C3O A;  2IDL A;  4DFJ A;  5DQH A;  2I9S A;  1VRU A;  3KUE A;  3JSM A;  3ZZU A;  5EX3 A;  2H5E A;  2OTL S;  4C8L A;  2E44 A;  1IBC B;  4NLG A;  3C15 B;  5HAO A;  1TL7 B;  4F7V A;  2WVC A;  3DGV A;  3RRG A;  1YJ9 S;  4FXW A;  3MM9 B;  1MWY A;  3VVT A;  5L39 A;  2AYB A;  5IZH A;  1D9F A;  5ADZ A;  3RAQ A;  3RBE A;  1U2C A;  5IFM A;  3OTE A;  4IRC A;  2R7U A;  3HLU A;  3PW5 A;  5DS7 A;  5D4O A;  2LXU A;  3C19 A;  2ZH1 A;  2KT2 A;  4MH8 A;  2MGZ B;  4JI7 J;  4LF4 F;  1JLQ A;  2ZD1 B;  4HI2 A;  4WTO B;  1YJU A;  4YDX A;  2L41 A;  2B9Y A;  2AJ4 A;  2J9E A;  1N52 B;  1SC3 B;  3MOJ B;  1PJ6 A;  5CA5 A;  3TUI C;  4CNZ A;  2P9G A;  3CJ4 A;  5L1L A;  4DV2 J;  3I5C A;  4R25 A;  5DDO C;  4QWD A;  1MRO A;  4J9V A;  4LF6 F;  1CUL B;  3SXL A;  3JSR A;  2FLP A;  3OXL A;  4X62 F;  4QWC A;  1RWX B;  5HRO A;  1R8H A;  2FVS A;  2YNG A;  5J2M B;  4DFM A;  4TYA A;  3CD0 A;  2AZ3 A;  2YNI B;  4WP9 A;  1L5U A;  1YRT A;  3I82 A;  4NLQ A;  2B4V A;  4FF3 A;  4DG1 A;  1LW2 B;  4RW4 B;  2CQ4 A;  1HHQ A;  2WW4 A;  2HUR A;  3CE8 A;  3DGP B;  1Q78 A;  3G87 A;  5B0B A;  3KLG A;  4NI2 A;  2BRL A;  4MAK A;  1HQU B;  5FDL B;  1HR0 J;  2YQ0 A;  5F8J A;  1F9H A;  3MR5 A;  4B3R F;  1TV6 B;  3M8R A;  1F9F A;  2EG1 A;  3CJ0 A;  3MR6 A;  1RB0 A;  1CJV B;  4R0E A;  5CYJ A;  3I0R A;  2DGU A;  3OHB A;  3H25 A;  1G2E A;  1QDU B;  3PV8 A;  3RW7 A;  4CIO A;  2COL A;  3DN9 A;  1VS3 A;  1PIE A;  4BLG A;  1WSR A;  4K5R A;  3T1Y J;  2BKO A;  2ZHO A;  4WZQ A;  5IT9 Y;  1SQE A;  2W4P A;  3VAF A;  1FE0 A;  1HMV A;  2DNL A;  4KV8 A;  4PG7 A;  2U1A A;  3HPO A;  4DV2 F;  3CNQ P;  1KTQ A;  3R5G A;  3HVW A;  8ATC B;  3CC2 S;  2W1B A;  4TVA B;  4WCE Q;  3GIJ A;  4DUZ F;  3Q8U A;  5LL6 d;  3UW1 A;  3CCU S;  4Q8E A;  1BLU A;  1VQS A;  3AD9 C;  2KRB A;  4QR1 A;  3DRP B;  2CQG A;  4RX6 A;  3KMQ A;  4NE9 C;  4PQU B;  1NSK L;  2VG6 A;  5B0D A;  2R7V A;  4GO5 X;  4KT0 C;  2KKH A;  4DSJ A;  2YKP A;  1RTH B;  3Q8Y A;  2K1R A;  2MZJ A;  1W25 A;  4N41 A;  1RWM B;  2MMY A;  3D4J A;  2ZFH A;  3BB5 A;  1APS A;  2WSE C;  5F0W A;  4O4R A;  3QT6 A;  5CAB A;  2DRA A;  3NS5 A;  1F5A A;  3DLK B;  4CLS A;  3VZH A;  5LOQ A;  2YQ1 A;  4N7T A;  2IIH A;  2RUS A;  2MKC A;  1FK9 B;  4WK3 A;  4X66 F;  3NCR A;  1AUD A;  4PWD A;  3HHE A;  5C42 A;  2FZC B;  5KFB A;  2YX1 A;  2M70 A;  2VG7 A;  4FYW B;  4F25 A;  1VHI A;  3KK3 B;  2OKQ A;  3K59 A;  1SKR A;  4B9U A;  3S01 A;  2G1H A;  4ZHR A;  2B7B B;  2DR5 A;  2OGU A;  2XZW A;  1JLE B;  3MPD A;  1V5V A;  2RQ4 A;  3SFG A;  2WW8 A;  5C2C A;  2D3O 1;  2OML A;  2ALZ A;  2F9D A;  4ZOS A;  2HHS A;  1AB8 A;  3JYT A;  2FLN A;  2ZH5 A;  1SJ3 P;  3EZU A;  4K59 A;  4OJ3 A;  2FY8 A;  3GU0 A;  4QWE A;  1R0A B;  2YKM A;  4X4N A;  3B8H A;  1RBA A;  2AW0 A;  1EKR A;  3TEG A;  4A8F A;  1FVQ A;  1NH8 A;  4OI6 A;  1XIQ A;  3TNV A;  2IY5 B;  1LWC B;  3I87 A;  2XGP A;  4PXB A;  3HJF A;  4NLY A;  2ZM6 J;  1KQS R;  2BJ3 A;  3MEK A;  1X0F A;  4J9O A;  1NSQ A;  4A8M P;  3J7Z T;  3BGR B;  2CNL B;  1EHW A;  3J7Y U;  5E3R A;  3IRX A;  1YZ6 A;  4O3Q A;  3E51 A;  4XIU A;  3Q8V A;  3Q22 A;  2ZWP A;  3IGV A;  2EEY A;  5DET A;  4IH6 A;  2MPU A;  5DQG A;  2SXL A;  4Q7A A;  5JJB A;  1U8S A;  1YJV A;  2KDO A;  1UPP A;  2PD1 A;  5I42 A;  4C11 B;  3EM1 A;  3H2L A;  1XMO J;  1F5C A;  1B4S A;  3PO4 A;  1O6X A;  2W9C A;  5DM6 Q;  3M4X A;  1N5V A;  2W2N P;  4P72 A;  4M5N A;  2VHG A;  1VQ4 S;  4DF4 A;  2XO6 A;  1O51 A;  4LSZ B;  5MAO A;  4ICL A;  2YWF A;  3DI6 B;  2XMW A;  3V81 B;  4FYD A;  3T3F A;  4ZPV R;  1X4D A;  3CXC R;  2X3G A;  2WON A;  2EWH A;  2HK2 A;  5T41 A;  3VV2 B;  4IOC Q;  2VJU A;  1NJY A;  3X3U A;  3HHL A;  1RWK B;  3AA8 A;  2HAI A;  1DTT B;  3A12 A;  3O3L A;  4LF2 A;  3SZ2 A;  2DNQ A;  1XNR F;  4YB6 A;  3FGV A;  4WP3 A;  4U9R A;  3HKZ D;  4BDP A;  1Q5V A;  4K4V A;  5A8R B;  4GMK A;  4N5S A;  1X7V A;  4IG0 B;  4USV A;  3MR2 A;  3OR2 B;  2IM3 A;  2K3I A;  3T1H J;  3RB0 A;  3SEO A;  3K8V A;  2VON A;  1JLG A;  4LUB A;  1KN6 A;  3W66 A;  4ER8 A;  3JXO A;  2FJA B;  5GVQ A;  1VQM S;  2UVW A;  2WB4 A;  4C3M A;  4DI6 A;  3BQ0 A;  3BDP A;  4F2S A;  2V2Z A;  4U7U D;  4KSE B;  2QV6 A;  4N8O A;  3Q2S C;  1REV A;  3MPY A;  2VOP A;  2EKN A;  4WP8 A;  2ZDP A;  4CLU A;  4LFB F;  2DNM A;  1HBN A;  3ZTO A;  2HBZ B;  4OYX A;  4Z2X A;  1HBM B;  2QSW A;  3CWJ A;  3Q8R B;  1UFK A;  1G4C A;  4J9U E;  2GQC A;  3BN4 A;  3MFH A;  5H9E J;  4X64 J;  4EBE A;  4GVL A;  4H4K A;  2CQD A;  3I0S B;  7FDR A;  1BY9 A;  5DZ6 A;  3C6T A;  1FRH A;  4K8R A;  4JV1 A;  3QMQ A;  1N8R T;  5L9N A;  2BEF A;  2OSQ A;  3ONQ A;  3PXG a;  3RZA A;  3RAM A;  2BDP A;  4OX8 A;  2DXE A;  2ZWO A;  5E33 A;  4Y6I A;  1XMB A;  2KZZ A;  1RT7 A;  1VDH A;  3V5R A;  1FES A;  3D6H B;  3KJF B;  4LSL A;  4CLP A;  4GRS A;  5IS2 A;  5HVH A;  4A8X A;  4LRA A;  2W24 A;  1IQT A;  4CLZ A;  3U02 A;  4C6A A;  1S9G B;  2AV5 A;  4WJB A;  1S0M A;  2PEH A;  5I3U B;  5JXS A;  4DLG A;  4M5D B;  2OIH A;  2XCP A;  4CH7 A;  5L1I A;  1XTZ A;  1YSJ A;  1OSD A;  3W60 A;  1ACM B;  4O3N A;  4GC6 A;  1L3U A;  1U25 A;  4P9S A;  4LRE A;  4DX6 A;  1RWW B;  1ZM2 A;  3MMA A;  1VGY A;  2DGO A;  2GX8 A;  3EE3 A;  2JWN A;  4RZR A;  1BQX A;  1QVF R;  3DLE B;  4WFZ A;  3TJA A;  4XPE A;  3MXH P;  4QIE A;  1YDL A;  4Q0B A;  2F63 A;  2BJE A;  3D5M A;  1DJ0 A;  1JJC B;  4C48 A;  4OLO A;  3TQE A;  5DGB A;  4FF2 A;  1KBR A;  4KRW A;  2AEJ A;  4ZP8 A;  5KT5 A;  1RTJ B;  3M8Q A;  2BQR A;  1S77 D;  2EC2 A;  4IQM A;  3QZ7 A;  3JSM B;  3NL0 A;  1PAE X;  3SIP B;  1NB7 A;  2ROG A;  1H2U X;  4F0H A;  3D3B J;  3GJT B;  3W5Y A;  5C2G A;  4OLP A;  3GII A;  2XS5 A;  1FEH A;  4C97 A;  1U4B A;  1P6T A;  1T95 A;  3M9O B;  2I5J B;  2HQI A;  2LA6 A;  4OZN A;  3BS9 A;  2Z2Z A;  5GAD I;  1ARO P;  3D9B A;  2F40 A;  3EJM A;  3SSR A;  3DU5 A;  4HHH A;  4MIW A;  2CQB A;  3ENV A;  3MM6 B;  3WC2 A;  1TK5 A;  4I67 A;  1X4E A;  2QN6 B;  2B5J B;  3HSJ A;  4ED8 A;  4LF8 J;  1PYS B;  4P7T A;  1YWX A;  5T14 A;  4O0I A;  4NLP A;  3M2R B;  4B17 A;  3I31 A;  4O3P A;  4KR0 B;  1B70 B;  5HJX A;  2WRM A;  5CZX A;  3DRX A;  4KGK A;  3ZC4 A;  4B02 A;  2LQ8 A;  4RW4 A;  4K7Q A;  3TVK A;  2NZC A;  4ZVE A;  2KO1 A;  3IR6 B;  2B9E A;  1LOU A;  2E1A A;  5T7L B;  3JB9 k;  2GJ2 A;  3I9Z A;  2HZV A;  2GS8 A;  4DL0 C;  3D7S B;  2CZV C;  1D8Z A;  1IBK F;  2GVZ B;  2X1G A;  2XMJ A;  2IAJ B;  3KUG A;  1HPZ B;  4PWW A;  1VQ5 S;  2JEG A;  3PRV A;  2EFO A;  3OVS A;  3H0P A;  4RNH A;  2RH3 A;  1T9V A;  3UVJ B;  4LBI A;  2CQH A;  5BR8 J;  1S1U A;  2HMI B;  2KL8 A;  4A46 A;  1VFJ A;  2F1F A;  1ZYQ A;  5DG7 A;  1YJ7 A;  3JQM A;  1NPR A;  4HVZ A;  2GAG C;  3GIL A;  4MYU A;  3RB6 A;  3D0I E;  4DS4 A;  2E5G A;  1BGX T;  3KLF A;  1VBZ A;  4M5I A;  4JV5 J;  4W4M A;  3HCX A;  5LSO A;  3CDE A;  1SCJ B;  3FUY A;  3LP1 B;  3MMC A;  1YTY A;  1NXI A;  2HVH A;  1HD1 A;  4C0H A;  2XYG B;  3EGN A;  4RNN A;  4O4G A;  2B4O A;  2YNH B;  2EK6 A;  4G6V B;  2OH2 A;  2BX6 A;  1HI8 A;  2NUH A;  3EIC A;  2OD6 A;  4F4X A;  3BV8 A;  1IBK J;  4JYA F;  3VGT A;  4NWB A;  3KJV B;  3FFI A;  4CM2 A;  2DNZ A;  4A47 A;  1QTM A;  3RYL A;  4LRF A;  1SL2 A;  2IMO A;  1TKX A;  1MG7 A;  3GTY X;  2WVE A;  2UZA A;  4ECT A;  2LP4 A;  3UNG C;  2CPY A;  4O44 B;  3NRB A;  4M94 A;  1MRO B;  3D1H A;  3BO3 A;  1VQL S;  3ET6 B;  4MFB A;  4OI1 A;  1EAR A;  1GXL A;  1HNV A;  2K7J A;  4ZA1 A;  3T5L A;  1FJ7 A;  2MLY A;  1WWH A;  2KG1 A;  4CM0 A;  3M2U B;  3LTO A;  5KFA A;  2KXN B;  2ZJQ Q;  2ROP A;  3UE2 A;  4A8O A;  4EO8 A;  1IWG A;  4EO6 A;  1Q8I A;  1TUV A;  3U1N A;  3PW7 A;  4JV5 F;  4MKA A;  3I5B A;  3DGP A;  4OI2 A;  4OYW A;  5HP1 B;  5IT9 U;  3ISN D;  1I3O B;  4DR5 F;  4IR1 A;  4RR5 A;  5FDL A;  5LSL A;  3OXG A;  5KTQ A;  3GCW P;  3M8Y A;  1N56 A;  2YKM B;  1Y5I B;  2DD8 S;  3BKT A;  3ILJ A;  4OQJ A;  5KG6 A;  3FEY B;  1T03 B;  3MMB A;  4NZ0 A;  1RHK B;  3TR5 A;  1S1W B;  1TKZ B;  2MHE A;  5L9X A;  2MJN A;  3GR0 A;  3MEC B;  2Y1J A;  2EXU A;  5ETK A;  4HTI A;  1CJK A;  4CH1 A;  1JLF A;  2WVD A;  1NRK A;  3OHA A;  4ANC A;  2AKW B;  3MED B;  1FKO B;  2M2B A;  3MCS A;  1A0O B;  5L46 A;  4Z7C A;  1VC0 A;  3CPW R;  3CJ3 A;  3R6L B;  2H54 B;  2V5H G;  3AD8 C;  2LDY A;  3OFF A;  1NSA A;  5CQG A;  2VG6 B;  4NRT A;  3AQO A;  3TAQ A;  4DF8 A;  3QRR A;  4Z37 A;  1Y4Z B;  2AGP A;  2AJ1 A;  5J1N A;  2RQM A;  5GAG I;  3UQS A;  3C15 A;  5MLC V;  3PIP Q;  2BE9 B;  1T8E A;  1S5Z A;  2XWX A;  1AW0 A;  2LQ9 A;  2FZG B;  3GCX P;  3HHL D;  1RXO B;  1NHK L;  2ZBC A;  3OFH A;  4TY8 B;  1RU1 A;  1YZ7 A;  2W9C B;  2MKK A;  2BA9 A;  3IS9 A;  3LUY A;  1H6K X;  1QAI A;  1CVJ A;  1JLQ B;  5J2P B;  4G1Q A;  2ZVS A;  3OUY A;  1WD6 A;  3A8J A;  1U09 A;  4KTQ A;  3QRP A;  1JIH A;  4OZ0 A;  1PAU B;  3IFE A;  4U8Y A;  2OEK A;  3AOB A;  2E66 A;  1WI8 A;  5GMK a;  3PYF A;  1JJH A;  4F04 B;  1RCX B;  1FDD A;  1FWK A;  3ILO A;  3EPG A;  1HNX J;  2VC1 A;  4QW9 A;  1YI2 S;  1KON A;  1SQF A;  2VBX A;  1VJQ A;  1EP4 B;  4I2Q A;  5HRO B;  1IR1 A;  3KUH A;  2I8E A;  4KGX B;  3P96 A;  4NA2 A;  4CLK A;  3C6U A;  1MU2 A;  3JYT B;  1VCT A;  2BE7 D;  2DH8 A;  4DSL A;  3X1L B;  3UR0 A;  3DOK A;  3ISN C;  4UOH A;  1FO1 A;  2DIV A;  3P8B B;  4Y34 A;  5AXL A;  7FD1 A;  2AX0 A;  2XCA A;  1IBL F;  2GIQ A;  1FRM A;  2YH0 A;  5K8N A;  2QYC A;  3VGS A;  1FKA F;  2UUB F;  3WIV A;  4P52 A;  2CNN B;  3OT9 A;  3R2C J;  1NK7 A;  2VBY A;  2CYY A;  1VQP S;  1UP1 A;  2YXL A;  2J7U A;  4ZVO B;  4NCB A;  2HVI A;  5B7W A;  2W01 A;  1KOO A;  5EHH A;  4DV4 J;  2WK4 A;  1H74 A;  2IRX A;  3A3N B;  3FEZ A;  2XEX A;  3R5J B;  3RBZ A;  4EYI B;  4QCL A;  4J90 A;  2KTQ A;  2FPH X;  2GAH C;  1QVG R;  5K8O A;  4USW A;  1E6V B;  2XMK A;  2O67 A;  4LF6 J;  3EUN A;  2AEM A;  1S1V B;  4CT8 A;  5K8P A;  1LEO A;  3B82 A;  3HFZ B;  3LF0 A;  5LXR A;  3ZZZ A;  3J81 Y;  1RUS A;  3UD3 P;  1N5Y B;  3R97 A;  1Y10 A;  1RHJ B;  3SSS A;  2H1Y A;  4I68 A;  4DV6 F;  3HHN B;  3I0S A;  3GIR A;  2EFP A;  1EX8 A;  1RDR A;  4L76 A;  4PYA A;  5L1J A;  3KNG A;  2R9L A;  4DR2 J;  1LWF B;  1S59 A;  4USH A;  4ZJQ A;  4HI1 A;  1PIL A;  2PA8 D;  4DX7 A;  1RYR A;  2UUB J;  1YGY A;  1JXL A;  4K2J A;  2DIS A;  1FDA A;  3G71 S;  1TQL A;  3LGH A;  4A8K A;  1AFJ A;  3KHH A;  4QIV A;  3PG9 A;  3RU0 A;  3G8Q A;  4OHV A;  4OYZ A;  5DO2 A;  5KFP A;  1IKY B;  2MSS A;  2ZEJ A;  4AXJ A;  2BQU A;  4NLV A;  2CPE A;  4GKK F;  1A6L A;  1FFG B;  2OFG X;  2DO0 A;  3OV7 A;  5KG4 A;  2RQC A;  2IC3 A;  4JB8 B;  5F8L A;  2OMO A;  6FD1 A;  2FHO B;  3SDE A;  1RJJ A;  3FKB A;  4CRJ A;  3UPF A;  5E41 A;  3KWM A;  3O6Q A;  3ISZ A;  3W7B A;  2BQ3 A;  3HK2 A;  4DFK A;  2LYV A;  1U1L A;  4I6A A;  4NXN F;  2PGC A;  2NYI A;  3GON A;  4J9L A;  2Z2M A;  1LK5 A;  4DDF A;  2A2C A;  4UQT A;  5A76 A;  4GKJ F;  4HH1 A;  3H20 A;  1KNZ A;  1WEX A;  2W2M P;  2QZ8 A;  1R0A A;  2CPD A;  4LVN P;  5KFH A;  2ZBQ A;  4DPX A;  1Y11 A;  3BGF A;  1T9W A;  1ZET A;  2VFS A;  4OMF G;  4MIB A;  2LCW A;  1N5S A;  2VG5 A;  4C8N A;  1FTC A;  2IYI A;  2EFQ A;  1P8G A;  4D3H A;  1JX4 A;  2VB6 A;  4OJH A;  4USM A;  1Q8K A;  3CCT A;  4JI6 J;  4ZVP B;  2OHD A;  1AZS B;  1T11 A;  2YWK A;  3M8Z A;  3LQV A;  3Q8S B;  4I69 A;  3BYP A;  5KFF A;  3MPV A;  2HS0 A;  2HIY A;  2HVD A;  3FCH A;  4FZV A;  2CQ1 A;  5KOW A;  5KT2 A;  2G9O A;  1S1U B;  1SIW B;  3FDS A;  4YHH F;  2J6T A;  2EPI A;  3BR9 A;  2VC0 A;  3EVO A;  5LSR A;  2W9B A;  2MQQ A;  1IKV B;  1BQM A;  3KDO A;  2ZH7 A;  4PQA A;  3V6H A;  2W4C A;  2OPR B;  4EU0 A;  4BHQ A;  1ZBT A;  2VDH A;  1FDB A;  3BO4 A;  5FD1 A;  1VC5 A;  2XZT B;  1ZA1 B;  2GQQ A;  5ETQ A;  1G1X A;  1WHV A;  2ZH2 A;  4K0K J;  1FWP A;  3I4H X;  1V6H A;  2M0G B;  3DI6 A;  4O4G B;  2J8A A;  1MW7 A;  1WC1 A;  2YNH A;  3V81 A;  1PO6 A;  4QYZ K;  4X62 J;  1KS2 A;  4GVB B;  4RBV A;  1LNQ A;  3UCU P;  1WHW A;  4EGL A;  2Z2L A;  3MD3 A;  1FRJ A;  3KJV A;  1LW0 A;  3QQC D;  3TWZ A;  3US5 A;  4MK9 A;  2IJN A;  3MDF A;  1DTT A;  2KYZ A;  3P6Y C;  2FB0 A;  4PZV A;  5DDP C;  1HYS A;  4JOU A;  4L3K A;  3QGG A;  3GG1 A;  1RLD A;  3NCQ A;  5EWE A;  4QWA A;  2EFV A;  3MMC B;  1C1B A;  4KFB B;  2CDQ A;  4JI7 F;  4LF4 J;  2QA1 A;  3QFH A;  2VJV A;  4ECV A;  1CS4 B;  5B08 A;  4CO3 A;  2HS4 A;  1B99 A;  1TKT B;  3CMQ A;  2QO3 A;  4L73 A;  4L75 A;  3P45 B;  4ZLP A;  1N4L A;  1DHM A;  3DLG B;  1K9M T;  3BDE A;  3TVY A;  5E5N A;  2K2P A;  5G0R B;  4CDI A;  1JLA B;  5B09 A;  3T5H A;  3VGV A;  3T5J A;  5J2N A;  2WOM A;  3N4W A;  2KM8 C;  1HBN B;  3K58 A;  3CD6 S;  1P9Y A;  2D9P A;  2KVQ E;  3P5B P;  4WFY A;  1IM4 A;  4J91 A;  6AT1 B;  3HO1 A;  1FWL A;  2Y1L B;  3N6N A;  2JRS A;  4R5P B;  4QIW D;  5A2Q U;  3MAQ A;  1Y3K A;  2KH9 A;  3GSD A;  2CQP A;  3MMB B;  2FHK A;  3W8P A;  1WDD A;  2ZNY A;  2KT3 A;  1S1W A;  3PTW A;  2Q6B A;  2B3T B;  1FX2 A;  1H98 A;  2FIU A;  1TEL A;  3JTP A;  2Y0B B;  4RW9 B;  3LAN A;  4M5J A;  1L3K A;  1HI1 A;  3OL7 A;  4LT6 A;  4RL1 A;  5HP1 A;  4IOA Q;  4F3M A;  2HHU A;  3U7J A;  5A8K B;  2AT1 B;  4FBT A;  5LMU J;  4LBP A;  1KQG B;  2H4Y B;  3I9V 9;  1TR0 A;  2F4V J;  3QAU A;  3CO0 P;  2E1C A;  3SV3 A;  3AJ1 A;  1HWJ A;  2XSF A;  1RWU A;  2ZBI A;  3HZE A;  3R7B B;  5HSP A;  5FLX Y;  5KFY A;  3H90 A;  2C2D A;  3DOL A;  4M5D A;  1AXQ A;  4ZVH A;  3LP1 A;  4DN9 A;  4NLU A;  2NUU G;  3QT7 A;  2NQP A;  1HKA A;  4IH7 A;  3TAM A;  3PY8 A;  3CO9 A;  2OEM A;  3HSZ A;  4JI5 J;  4F3Q A;  2XC9 A;  1IKX A;  3CB4 A;  3PKM A;  2GVD B;  2O3D A;  4WFN Q;  5CYQ B;  1C1C B;  1S6Q B;  1VHF A;  4OV6 A;  4W98 A;  2CPZ A;  1OO0 B;  4RU9 A;  2R8G A;  3SCI E;  1KLM B;  1UWB A;  2B8Q A;  2DT9 A;  1NB2 A;  4OYP A;  4TY8 A;  4AYB D;  5KT6 A;  3FK4 A;  3R6G B;  1UZD A;  4LRD A;  1G7C B;  3P4U B;  1NJI T;  4OL8 A;  1FEE A;  2ADC A;  3ENW A;  2J5A A;  5C7P A;  1GH8 A;  2RJZ A;  3T19 A;  3S8S A;  3GFY A;  3NGK A;  4QW8 A;  4MFB B;  3MAA B;  3FSI A;  5HO4 A;  2F8E X;  3RB3 A;  5G4D A;  2F7V A;  3A3O B;  3OUY B;  2RF2 B;  2HHT A;  2KFZ A;  2NPF A;  4DQI A;  4ZVS B;  2GO9 A;  4F26 A;  1S4F A;  1GX6 A;  4YP3 A;  1B3T A;  1QSS A;  2B4P A;  1N36 F;  2FVQ A;  2J6S A;  1Y00 A;  2B6A A;  2JNJ A;  3MF5 A;  2CIM A;  1MMN A;  4KH1 B;  4ZVF A;  3D67 A;  3GJQ B;  4L6V 3;  4YB7 A;  1YIT S;  4KE5 A;  1EP4 A;  4I2Q B;  1RU2 A;  4ZK7 M;  1TL5 A;  2M7S A;  3FBF A;  4ZVR B;  2R2S A;  3CCV S;  2J9D A;  3AOC A;  1DAR A;  1S7H A;  2CNK B;  2Y3Y A;  3GE9 A;  4PR6 A;  5DLG A;  4DU7 A;  4DV6 J;  1TFW A;  4JUZ A;  1RKJ A;  2OEJ A;  5KT4 A;  1K1S A;  5J1E A;  4KPY A;  1N6Q B;  2CJQ A;  1CLF A;  3MPU B;  4J9R A;  2DTJ A;  4NEY A;  3MEC A;  3HXM A;  3UR3 C;  2G0I A;  1FF2 A;  1H72 C;  3IGN A;  5CAA A;  5DG8 A;  1WG1 A;  4LF5 J;  2HND B;  2VPW B;  2C1E B;  2N4D A;  1OIA A;  1VR6 A;  3ILI A;  5KT7 A;  4ED3 A;  1ZAV A;  2R7W A;  2ILY A;  2JDJ A;  2VPZ B;  1TL4 A;  4CT9 A;  4PUO B;  1CEZ A;  4NMX A;  4YB5 A;  2PFF B;  3A8I A;  4JI0 F;  3KXD A;  1QLN A;  5GAH I;  2AEF A;  1XR5 A;  2AF6 A;  4ED4 A;  2UU9 J;  1PC5 A;  4R8U B; 
#chains in the Genus database with same CATH homology
 1NUE A;  1BE4 A;  3FCW A;  1UCN A;  3EM1 A;  5BXI A;  1B4S A;  1XQI A;  4UOH A;  3PRV A;  1NDP A;  4UOG A;  4ENO A;  3FBB A;  3NGU A;  1HLW A;  1WKK A;  3EVM A;  3VGS A;  3Q86 A;  1F3F A;  3Q83 A;  4FKX A;  1B99 A;  3PJ9 A;  1U8W A;  2AZ3 A;  1BHN A;  2HVE A;  3EMT A;  2VU5 A;  1HHQ A;  3VGV A;  2HUR A;  3L7U A;  4O0N A;  1ZS6 A;  3R9L A;  1LEO A;  2BX6 A;  3EIC A;  4FKY A;  4DI6 A;  3VGT A;  2DXF A;  4F4A A;  1LWX A;  3B54 A;  4KPC A;  3Q89 A;  4UOF A;  3DKD A;  1S59 A;  3ENA A;  1WKJ A;  3ZTO A;  2AZ1 A;  3BBF A;  3FC9 A;  3VVU A;  3Q8U A;  4CP5 A;  2NCK L;  3NGS A;  3B6B A;  4S0M A;  2DYA A;  1NDK A;  1NSK L;  2BEF A;  4ANE A;  3DDI A;  2DXE A;  2DXD A;  3FBE A;  3Q8Y A;  3FKB A;  1MN9 A;  2DY9 A;  4EK2 A;  4W98 A;  3G2X A;  5IOL A;  1MN7 A;  1NLK L;  5CAB A;  1NSP A;  2B8Q A;  1NCL A;  4C6A A;  4DUT A;  1NB2 A;  3NGT A;  1NPK A;  1K44 A;  2ZUA A;  4WBF A;  5C7P A;  1S57 A;  3ETM A;  3EVW A;  3ZTQ A;  1NDC A;  3BH7 B;  4ANC A;  3EE3 A;  3ZTR A;  1W7W A;  2B8P A;  3FCV A;  3GPA A;  4HR2 A;  4F36 A;  1HIY A;  3MPD A;  3BBC A;  3BH6 B;  1NDL A;  1PKU A;  3FBF A;  1BUX A;  1PAE X;  3VGU A;  3ELH A;  1F6T A;  1VYA A;  1S5Z A;  3NGR A;  1NHK L;  2HVD A;  1XIQ A;  2CWK A;  3EJM A;  3FBC A;  3EVO A;  1KDN A;  1WKL A;  5CAA A;  3WX8 A;  1NSQ A;  1EHW A;  3GP9 A;  4AND A;  4DZ6 A;  3ZTP A;  3VVT A;  3Q8V A;  3BBB A;  3ZTS A;  1JXV A;  3JS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...