4QIGA

Crystal structure of pdua with edge mutation k26a and pore mutation s40c
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGCGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 20
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qigA00
3N79A 3BN4A 4AXJA 4QIGA 4OLOA 5L38A 3VCDA 2A10A 3DN9A 4OX6A 4DDFA 3H8YA 3MPYA 3SSQA 4OX7A 4QIFA 3NGKA 4P2SA 2A1BA 4OLPA 4RBTA 3NWGA 4OX8A 3IA0A 2A18A 3PACA 4AXIA 4P7TA 3CIMA 3MPWA 4P7VA 2EWHA 3SSRA 2G13A 3SSSA 4LIWA 4QIVA 3CGIA 4PPDA 3I96A 5DJBA 4RBVA 3I6PA 4QIEA 4RBUA 3DNCA
chains in the Genus database with same CATH superfamily
3MPYA 3IAS9 3MOZA 4NA1A 5AXMA 3R5GA 4GKJJ 3V6DA 4PABA 3PV8A 4OHVA 1W26A 4NMLA 4CT9A 4KHPJ 3O44A 3E8OA 1N6QA 2B6AA 5HQMA 2C2DA 2UVVA 3CIZA 3UDVA 2F1FA 3HT3A 2MB0B 3Q8PB 4OYIA 3H2VE 5KG6A 4H4OB 2DVIA 2OLWA 2WSFC 3TAQA 3CMAS 1HI8A 1SUQA 3W2WB 1N56A 1UETA 3PHEA 5DGAA 2NPIA 2X7IA 3FK4A 4C11B 3VVTA 4DR4J 3MD3A 3JAMY 2GFFA 4B3MF 5CCMA 3PEJA 5IS2A 1L3KA 1AXQA 4X4SA 1VDHA 1HMVB 2XWXA 4OZ5A 4LBIA 4WFAQ 3X3UA 2PSZA 1RT6A 1LWEA 4DPYA 5J1NA 4IH6A 1OYEA 2E29A 1XNQJ 4NLPA 2E7XA 3KK1A 1TL3B 3KJVB 1Q81T 5K8MA 3T41A 1URRA 3MPUB 3DCAA 1XNRJ 2YX7A 3OJSA 2ROGA 1YJWS 3WZ0A 1NDLA 4WP8A 5C24B 5LSRA 3ENVA 1GQEA 2V4QA 2LEAA 2HNYB 3GCXP 3E51A 4WTOB 4KGKA 5AE1A 1T9WA 3US5A 3PTWA 2QG9B 4OV6A 2CJYB 1S6PA 1S72S 4J9PA 2IDLA 4NLOA 1TUWA 3NCRA 1OPZA 2LA6A 4NCGB 4W90B 4QZVB 3KNGA 4C6AA 1UPPA 2AMCB 3NL0A 1S77D 5F9NA 3UVJB 1NBEB 1IBMF 3BJYA 1FDAA 2W9CB 4USIA 4G65A 1TKXA 4X4OA 3MPDA 4OX8A 3MI7X 1HI0P 1ZBTA 2Q43A 3FUYA 2IM3A 4N8OA 3J81U 3T5HA 4OX9F 5CH7B 1FD2A 2CJKA 1RK8A 1RKJA 1RAEB 3GFXA 3J7A1 5J1PA 5F8JA 4GKKF 1RT2B 2HWHA 5L38A 2EBEA 2CQGA 3P96A 1L3TA 1X9MA 1WKKA 2RIJA 1V3SA 4M95A 2XQCA 2HBYB 4WF9Q 4I6YA 4YMEA 4CLFA 4YY3F 1NK6A 1MW7A 3DLBA 4UTGA 2QE5A 3MUVP 2WHOA 4HT5A 4ZVRB 4IYQA 4ELUA 5KT4A 4OI1A 1ZH5A 4N5SA 2YQ3A 2GGPA 5DDRC 4CT8A 2GVZB 5KT2A 2F4FA 2NXNA 4RL1A 2AEFA 1N48A 2HNDA 3O1LA 3JAMU 4FYVB 3N6NA 2ZE2B 2MZQA 1WG5A 4WK3A 1FD8A 4DCPB 1JLQB 3VGTA 1NM2A 3CCRS 3HHKA 3OVBA 1T9TA 2J0WA 3QAUA 1N36F 2FDNA 4YR3A 1O51A 2LKZA 1NSKL 5D0EA 4QW9A 3ZNUA 3H7HB 4NPOA 2CQ1A 2B4VA 5CAAA 2XSJA 1GTHA 2PN6A 1FRKA 2DIUA 2RE1A 4J9OA 3PXGa 3W5YA 2UUCJ 1NCLA 3QWUA 4IKAA 2LU2A 2DITA 3BEGB 3THPA 3OVAA 2HZCA 3HZGA 1HW9A 3CCMS 1NRKA 1PIEA 4LSLB 3W8PA 2NREA 4JI0F 5THWA 3PR4A 2R8GA 3RAMA 2DNPA 1LW0A 3HKZD 1NK0A 3D1HA 2UXCF 3IXQA 2V67A 4JI3J 1YVFA 2V4RA 4NCBA 4OI3A 2GHWA 4ZKAA 3DRRB 2CAJA 3UCUP 2I38A 2RQMA 1H2VZ 4JUZA 3IRWP 3RB0A 1ZA2B 2OP5A 1UEKA 5ETPA 5DLGA 3A13A 5A8KA 1KN6A 4OYPA 3A3OB 3UD3P 5B0CA 3E3XA 2P9EA 4HYKA 4X66F 3QJLA 2MKSA 2HRUA 3D0IE 2D1CA 1WEXA 1KHWA 1TKZA 3NLCA 5ETOA 2BKPA 3D67A 4OHYA 2QGFB 1EKSA 2GCFA 4YQWA 2Q66A 2VU5A 4NEZA 3PO4A 3HMJG 3J80Y 4NX9A 4IG0A 1XERA 1VBXA 1EX8A 4NI2A 2C2MB 2KU7A 2M52A 1VQ5S 3IFEA 4BBYA 3CULA 4ID5B 2UU9F 2Z56B 5B09A 2CZ4A 2CNOB 1CJVA 2GMLA 4TYBA 2MYFA 1C1BA 3VAIA 3ZTPA 2DB1A 4M5HA 1VBZA 2OPSA 3UO0A 4DV5J 2ZDPA 5CCLA 3MHYA 1NSAA 4DR1F 2HFVA 1FVSA 2K3KA 1HFEL 3DC2A 4CLSA 1KVJA 3SSQA 3K0JA 2E1CA 1HNXJ 1F5CA 1S10A 3W7BA 3CCWA 2I8EA 3VZHA 3SQOP 2EKYA 2EWHA 2FGOA 4HKQA 4UZCA 1JMTA 3K5LA 2NLWA 3D9BA 4EO8A 4Y0FA 1ZPVA 4A46A 2YX1A 3CJTA 4H54A 1IKXB 2GMHA 4J91A 1FFGB 1HKAA 1UZDA 2ATLA 3NXZA 3MWBA 2WTFA 4K0KJ 3C6TA 2QYCA 3IRXA 1UVNA 1C0UB 3GV8B 1Y9OA 4BCAA 4ZVEA 2RDDA 3R5AA 3OT9A 2MZJA 4NXNJ 5DM6Q 5KOWA 3A3PB 4DV6F 4J9QA 3UI3A 3GZ7A 1KRPA 2UUAF 5EUHA 2KT2A 3HHEA 1FRMA 1S6OA 3Q0AA 2D3ZA 4DPWA 1N34J 2XO6A 3FCWA 4WZQA 3DU5A 3ZXWA 3LH2S 4DS4A 5J1EB 2FC9A 2XZDB 2CQBA 2XMKA 4B3OA 1S9EB 3UFCX 1WHYA 2K7KA 3BGUA 4ECSA 2EFNA 3R7NB 4KPYA 1TR0A 1UJ5A 5DQHA 1SJ4P 3BF4A 1RWWB 4IG3B 2MDAA 5KT3A 3GV7B 3PYEA 4AT1B 2MEWA 4WBFA 1TFWA 3CCZA 1XIQA 3VAMA 2WOMA 1T03B 4F67A 3C15A 2BQUA 3LA0A 4G1QA 1Q7YT 2RT3A 4CLTA 3M2UB 5L1LA 4C4WA 2Y1LB 2HHTA 2QL9B 3UD5A 1U1PA 4P2XA 2RQCA 2OTJS 1WF0A 2KRRA 4C3MA 2I9SA 1NB7A 2E1PA 1S4FA 1IR0A 1KLNA 1Y3KA 3RW7A 3HVRA 2WK4A 2XMAA 2FHJD 4ZVUB 2RQKA 3IGNA 4DR2J 2D41A 1NLKL 3Q2SC 1LOUA 3BYPA 4MFBB 3J80U 2YH1A 4MKAA 3KMSA 2RNEA 4CYUB 4DQRA 2DISA 2KL8A 1ZZNA 1LXNA 3KXDA 4O44A 2CPXA 1MN9A 4KIAA 3TEHB 1UWBB 4EUVA 1RWVB 1F6TA 3KJFB 3NP5A 4LF2A 1K9MT 4GVBB 2AYEA 2XZTB 4ECZA 1FK9B 3LW5C 3PX6A 1RT5B 4ZLPA 4LF4F 1FF2A 2EBGA 1YJUA 4P2MA 4CLKA 3QIPA 3MURP 3OHBA 4E8UA 1RT3A 2FZCB 1BQNB 4LFBF 4IQXA 4R5PB 4YP3A 4LF7F 3MM6A 1S1UB 3NGSA 3H25A 1CS4A 2WZ1A 5F8MA 4AL7A 2R7SA 3TVZA 9ATCB 5AE3A 5DDOC 2W4DA 3SSRA 5KOXA 4ZHRB 3MUTP 1HNZF 1TFYA 2BOPA 3D4JA 4ZP6A 2BJ9A 4DOZA 2XMMA 3FNNA 1Q8LA 4W4MA 3MR3A 1M90T 1Q0NA 1HBUB 1NK8A 3OR2B 4DN0A 1RT4A 1LWXA 1NUEA 1SH2A 2KXNB 4Y34A 2J9DE 1FRXA 2ACYA 3MEKA 2GC8A 4I0WA 5KFFA 2HFSA 3LQVA 3TZWA 3EGVA 3A4TA 3M9MB 3TARA 3SV3A 3R8YA 1QAIA 1VK3A 3QBCA 4OJ1A 2IDEA 4RW8A 2J0QD 4Q2LA 2GV1A 2LDYA 5E0OA 4J7CA 2R2UA 2EI5A 3DM2A 4JI4F 4UUWA 3V6DB 1HBMB 4FS2A 3TZXA 4DR7F 2CPYA 2JLEA 4CRJA 4NCAA 1FRHA 4DV7J 5C42A 2HHUA 2RMLA 3I6PA 2ERRA 2F8MA 4WJBA 1S5ZA 4A8XA 3RBZA 5GAHI 2QT7A 2VG7B 2A18A 2K7JA 4NWBA 1H3DA 3H59A 4JV5J 3GG0A 2ZJPQ 2HHWA 5KTQA 1S9GA 1NJXA 2I1RA 3C16A 3PRVA 2B7BB 3IG1A 3HP6A 2L41A 2DGWA 5IV4A 4PG7A 3T9ZA 1KVKA 5I3PA 3IM8A 2C2ZB 2XYHB 5L9XA 2AKWB 4JI7F 3CCUS 3OFGA 2CNLB 1JKHA 2PE8A 1IBKJ 1RT6B 2PDAA 3C46A 1I51B 5KFCA 1LWEB 1HL6A 2G4BA 2ZZNA 1YK9A 1BLUA 4OHZA 3L7PA 1YIJS 2MQLA 1TELA 1FCAA 4EYHB 4J9NA 1C2PA 2OEMA 3CTRA 2NCKL 2E5HA 4Z7YA 3RR8A 3CEDA 4PZVA 1N5TA 2DR6A 1LWCA 1U0HA 2KYZA 5BYRA 4U67Q 2QSFA 5EDWA 4JV1A 1RB0A 3PYGA 1S4EA 4M5MA 1RTIA 2W7PA 4O3NA 4XK8C 3CC4S 1VQLS 1S1WA 5F3ZA 3DOKB 4IOCQ 3CCQS 4CLYA 2ADBA 1T94A 1I3OB 3WBZA 2P2CB 3SXLA 1FKOA 2WB4A 5I42A 4ATNA 1HQEA 4P9SA 2EPIA 1HR0F 3S1TA 4DR6J 4O3QA 4AUKA 3EM1A 4TKTA 3I56S 2AX0A 3RZAA 4ZJOA 5BR8J 5KFRA 3TUZC 2ASJA 1UW4A 4L74A 3Q22A 4F4WA 4X65J 4RNHA 4DL3A 2OPPA 2ALYB 2BJ7A 3M8PA 4U7UD 2VZ9A 2JHEA 3BSNA 1VK8A 1XJWB 3I5AA 3LP0A 1FJGF 3KLFB 1VQNS 4RW7B 2YKMA 3I9V9 2DGSA 4UOGA 5H9FJ 2LYVA 2L9NA 1RA6A 5GADI 1TV6A 5HP1B 2J7WA 2VG5A 1UFWA 3M6WA 2FLPA 1QSLA 2UUBF 3W5ZA 2YNIB 1JLGA 3MR2A 3WIVA 3MEGB 4JYAF 1FNXH 4OI4A 1B64A 5HQ8A 4BWMA 1SJ1A 2CPJA 3EVWA 4K4YA 3G86A 4DR5J 1WI6A 4LBHA 3KLHA 1HHTP 1K1QA 1VFJA 1B3TA 4ZPDA 1WJ9A 2GGPB 2RQ4A 3FKBA 1RWNB 1HARA 3RW6A 3NS7B 2EG1A 3C2PA 1EHWA 3ILOA 4W98A 5CYQB 2AYGA 2XMWA 2QMXA 3B4DA 3HDSA 4DPTA 3CJ5A 4GO5X 3FMWA 5T41A 5D78A 4KHMA 4DPOA 3ILLA 2ROEA 1S0MA 1R8HA 2X51A 2KG1A 2BVZA 2FD2A 1WG4A 1S6QB 2QIFA 1GAOA 3IWLA 5A0YB 4CH1A 4DV4J 2MJUA 4OLPA 5KFKA 3FBFA 2J9DA 3NNAA 3O6QA 1FERA 5EWFA 1UVKA 3N0VA 3T1AA 3HPOA 4O3OA 1R8BA 2YNFA 4C3KA 4DU7A 2J76E 1FXLA 1C0TA 1UEVA 1UZHA 4Q5VA 1ZAVA 4P52A 1N0UA 2M3DA 2V8PA 3TA1A 4ELVA 4ICLB 3GU0A 4DSKA 2HNZB 3MM7A 3OTOF 3DRSA 1YSJA 1N5SA 3OR1A 2XS7A 3A1YG 1PYTA 2ACMA 1VBYA 3KLEA 4DV0F 4HH1A 2RS2A 3T1YJ 2MSSA 4WIQA 4ZIWA 2CG8A 2XSFA 4M5DA 4EU0A 4KY3A 1BQMB 4ID8A 3AD8C 4C8YA 3S7RA 3B6BA 2VJUA 3RBDA 5A8KB 1EQMA 4B9LA 4HHUA 2JL9A 3UE2A 2UXDF 5E3RA 2OELA 5DLFA 1XMOF 4RBVA 1MMNA 3D2WA 1KONA 5HMXA 1YLXA 1XEZA 4HTJA 5FD1A 4QJVA 4ED0A 4IG0B 1B0TA 3MAAA 3KUHA 2DPIA 3DXSX 3VWSA 4C2MA 1F9HA 4ES1A 2Y0BB 2ZBQA 1RJJA 1CJVB 3HVWA 1U49A 2DXEA 4CH0S 1DQ9A 3ISZA 1QE1B 4UQTA 3JYTA 3NAIA 2DYAA 3IWNC 2R9LA 4ZVQB 3QQCD 5FDLB 2DCLA 1IKYB 4U96A 3Q2TC 1K8AT 1T8EA 3O2IA 1WSVA 4ZP8A 3IS9A 3T5LA 4B9NA 3QZ8A 1ZM3A 4ES3A 4ETZA 5KFIA 5CD4H 4QYZK 4USKA 4X64J 2QL5B 1TL1A 1RHMB 3Q24A 3R6LB 1MN7A 5KT6A 2KFNA 3MCOA 3AQPA 5HBMB 4C3LA 5LXYA 4AXIA 4LR8A 2XCPA 2MKHA 4DUZJ 4RPFA 4Y3CA 2KJVA 4WWSA 1WF1A 2BE7D 5DQIA 4ZP9A 1JLCA 2WB1D 1RTDA 5M2RA 1VCTA 2IYIA 3FBEA 1EQ0A 3DLKB 4HACB 1FEHA 3BGLA 1X31C 1LKZA 2LCWA 2G13A 3SCIE 1SPBP 4LRFA 4OYXA 5GVQA 3N01A 2HFNA 2PA8D 2ZD1A 4ED6A 2DJWA 3QWPA 2W2QP 4IRDA 2E5GA 2HLUA 6FD1A 1GX6A 1S6UA 3FFIA 1S57A 1XBWA 5KFAA 3H5SA 1KKHA 4Y65A 4L3KA 4PAAA 4ECRA 3DLLQ 3HT0A 3ULHA 2DNZA 4L3NA 1N33J 4FNIA 2VICA 2CUYA 2KB2A 2CFXA 1JWWA 4TU7A 4FXVA 3TW0A 2BBEA 4U7CA 4NL5A 3N9UC 3BYRA 1SXLA 3V2UC 4OI6A 2DIVA 1AZSB 3JQJA 1Q5YA 3HVTB 2W9BA 5FIIA 2RUSA 2Y3YA 2HWIA 5F3TA 4X84A 1IR1A 4ZPWR 1BUXA 1HWUA 2CWKA 3TJAA 1KNZA 4C8ZA 4FS1A 2NSCA 4ZVHA 3FQLA 1NH7A 1PKUA 4DN9A 1SBRA 3QGPA 5LL6d 3AH6A 1E6VB 3AA9A 5A6WA 4N76A 2CWXA 3OTEA 4K5RA 2D74B 1CJTA 4P73A 4RKUC 4PXEA 3PKMA 3RUBL 1SKRA 3M2RA 3PR5B 5AXNA 1YZ7A 1RABB 4O3PA 1OQ3A 4JI2J 1BD6A 1PC5A 2LVWA 1WWHA 2W4PA 4LIWA 1NZ8A 3PG9A 4J9LA 3CMQA 3CO9A 4C8MA 5GAEI 1RT3B 3ETOA 5ETLA 1QUPA 2N3OA 5KT7A 3QNWB 2AV5A 2VDIA 4DV3F 1CS4B 3W62A 3GWCA 4WE1A 2VQEJ 1SQEA 3TQ1A 4FBUA 3IR5B 4DPXA 4LF5F 2E1AA 3MMJA 2Z2MA 1F1BB 1GXUA 1NDKA 3QZ7A 3K7RA 1LK5A 2H4WB 3ZTOA 1VC5A 1WKJA 3M05A 2FJXA 2NXEA 4Q44A 1IVZA 2J6SA 4BLGA 2ZM6J 5ETRA 1Q95G 2YY3A 2XNRA 4RUBA 1M5KC 1RT4B 4DZ6A 4DV2F 5D4NA 3QLHB 1P9YA 3TYTA 4B9SA 1RWPB 3NG8A 4DL6A 2DNOA 1RT1A 5AXLA 3V4IA 4F4YA 5HSPA 4KGMA 2BOAA 3DLGA 3L3CA 1G4CA 2DK2A 5HJXA 4OIXA 3LALA 3KKFA 5GAGI 2KRBA 2VA3A 2RF2B 1IJFB 3EVMA 1JXEA 6FDRA 5CZXA 4KSEB 1ZZFA 1SB6A 1YJNS 4QR0A 4ZN3A 4LF9F 4FF3A 2BKNA 4OI0A 4FN5A 1R6VA 3U27A 2CG4A 4EFAC 2BZ2A 4KGXB 2JWNA 4LF8J 3HSZA 3F0NA 2DTJA 4FKYA 1FFSB 1JLFB 3EMTA 2OPQA 2JZ5A 2BUNA 1U1NA 5J2PB 1ROFA 2B43A 3UCGA 1HWIA 3ITHB 1FNOA 3TP2A 4KJIA 2HS4A 5A8WB 2VFRA 1IKWB 4J9KA 3CJKB 2HKEA 2HIQA 1PJ6A 2GQQA 3G87A 3L09A 4X4UA 2J5AA 4ZN1A 4LR9A 4J9RA 1GTEA 2LFVA 5E33A 3O8WA 5IT0A 3BV8A 2V68A 4WXOA 2V2ZA 3AAWB 2Q6BA 3T6JA 1PAUB 1Z1ZA 1FKPA 1RHRB 4NLRA 5IWAF 3CDUA 3V81A 4ALZA 2HIYA 1PO6A 3LWMA 1LXJA 5KFUA 4ILRA 3OW2R 1SL2A 3DHXA 1DTQB 3LP2B 5KFBA 3ZZYA 3T5KA 4F02A 1BQXA 1Q5VA 2QFIA 4RJVA 2Z58B 4HHJA 2JSXA 3DRPB 9RUBA 5E7OB 3AQOA 3CJ8A 2DHSA 4O3SA 2D9PA 4KB7A 4JI5F 3U7JA 4O23A 3IP0A 4LFCJ 3PZPA 2OGUA 2XMTA 3PDNA 3M6VA 2FVQA 1VQ6S 1FKOB 5I42B 2J6UA 4X4NA 3CVKA 1HQEB 5J2MB 2YWHA 4H4OA 1EB0A 4BC7A 3BPSP 3VVUA 3ZZZA 1DARA 5L39A 4CO2A 3ENWA 1YJTA 4B9UA 2DGVA 1XR6A 3ISND 3AJ1A 3D5MA 4C11A 1OJ4A 4OYOA 1X4EA 3BSAA 1DFDA 1WC1A 3IAM9 3OPKA 3CCLS 1AUSL 4DLEA 1MLAA 5K14A 2ZOGA 3IBCB 2CPIA 1X5SA 4M5LA 1OSCA 2R7TA 3U1LA 3GSIA 2OHDA 2MXYA 4RWWA 4IOAQ 3BGOP 3J81j 1CVJA 3PJXA 2XS2A 2FJDB 2ZH7A 2QMWA 4AYBD 1Y11A 3GR1A 2MZSA 3DNCA 1YKWA 2RU9A 1WOPA 4NZ6A 1UFLA 1TV6B 5L1KA 1UAWA 1Q86T 4YFUA 2U1AA 4ZA1A 2HFZA 3THVA 2LXIA 2RHSB 2G0JA 1EJ7L 2HGNA 2ZKTA 2EW9A 1TL3A 3KJVA 2AT1B 3Q8VA 2IMWP 2QA2A 5LT5A 4TQRA 1Y00A 3DXBA 3VALA 2DNKA 2IVFB 2BKOA 2V4JB 5LMNF 3HX9A 1APSA 2L48A 1R89A 4JI1J 2B7CB 4ECWA 5C24A 1TVRB 2ZH8A 2LQ8A 4Q43A 2HVHA 3THTA 2QN6B 2HNYA 3MPVA 2QV6A 2O1PA 4E98A 2QSWA 1KQKA 2A0FB 2C3MA 1TUVA 4DHVA 3JSYA 4WPAA 1OS5A 1G1XA 3HK2A 2BXJA 3GIJA 1Z4UA 2OMOA 2LECA 1RP5A 1J5EF 2G1HA 3CF5Q 2LP4A 3MCMA 1U26A 3ETMA 4RO0A 5KFDA 1YJVA 4CLWA 3CO0P 2HQDA 2ZNZA 3MOJB 3UVJA 2MKCA 1RT7B 1GEHA 4DUYF 4ZPCA 2DRBA 8ATCB 4DL5A 4LRBA 3AB4B 3EDQB 1IBCB 2K8GA 1F0XA 5KG0A 4G1PA 5CYJA 2ZEJA 4OYBA 2GIQA 1Q78A 2MLZA 3N28A 2HHQA 1TKTB 1VQMS 1IWGA 3POTB 5BYQA 1M5VC 3U02A 2GIRA 3MEEB 4RW9B 5I4MA 4ITSA 2XI2A 3MR5A 4DQPA 4DFMA 2EK6A 2GAHC 2GJIA 2ZH1A 4X4RA 2J8SA 2GQ2A 3TAMB 1B0PA 1WKLA 4ZMMA 5L1IA 4ED7A 1T9UA 2ZNYA 4YR0A 4M5DB 1RBAA 1NKCA 1VQOS 3TOQA 3BKFA 2E5JA 3R7BB 1BWEA 3DRYA 4ZVOB 2UXBF 4B3MJ 4YUDA 3CCTA 3BO4A 2GVZA 1EZZB 3DMJB 4TNOA 1R8CA 4KGVB 1UVJA 1PGZA 2UVRA 2I5JB 1UEUA 1U25A 4KE5A 1RLCL 2ZE2A 5F8GA 1DAXA 3MECB 3IR7B 2COLA 4HT7A 4DL2A 2FHOB 1JLQA 1GMUA 2B9EA 4N56A 4DS5A 2QA4S 2DRAA 4BC9A 4USMA 1ZTWA 3JB9k 1ZAWA 3MAAB 3GTYX 3AXKA 3D28A 3MMBB 1U7LA 3NWRA 3ZZOA 2FIUA 2JC0A 2J9EA 1UJ4A 1YGYA 3QPIA 1SVDA 2MQ8A 2Z2YB 3MM5A 3OSPA 3RRGA 2LU1A 4K5SA 3BGRB 5CXTA 4EZ6A 5K8PA 2DH8A 2W7AA 1FKAF 2RHQB 2E9RX 3MR7A 4DFKA 3BQ0A 1MNEA 1U45A 3KJNB 3HXMA 1Q53A 1FJEB 3R97A 2B8QA 3KTQA 3EXYA 3BKUA 1YZ6A 4UQGA 2K06A 2M2BA 3RG6A 2JH3A 2ZWOA 2UV8A 4C8KA 3IS9B 4TY8B 2NXCA 3D0GE 3CNQP 3GB0A 1TTHB 1RCOB 2PIIA 1FXDA 5K9FA 3Q8YA 3UDEA 4RR5A 2F7VA 3B4MA 2GO9A 4FYXB 4FF2A 3KYLA 3PW7A 1N5YB 4WKRA 1PBAA 4QPXA 1IBMJ 4B02A 3NBPB 3P6YC 1HWKA 1YI2S 2GW8A 1F2HA 1GMWD 4QWEA 2HWTA 4QIFA 5U47A 2NPFA 4NLDA 4RNFA 4F4ZA 1KLMB 3KG4A 1JLCB 4OJHA 1RTDB 3LUYA 2NUHA 1JB0C 4IOBA 5KFLA 2FQQB 5LXRA 3Q86A 4DQSA 2R3VA 4TVAB 4ERDA 4OX9J 3SMZA 1VQKS 3FBBA 1IWAA 5E5NA 4DV1F 4ANCA 3PCOB 2CQIA 2MHEA 2AU0A 1TU0B 1QVGR 2ZHBA 4GKKJ 5KFJA 1TUGB 2WVEA 3QFWA 5A6PA 3TX8A 4X4VA 3FEXB 4Y2IA 2A1BA 2WSEC 2ZZTA 3D66A 2NR0A 3C6UB 4ANEA 3FFIB 2VKZG 4YY3J 4IO9Q 2IRUA 2VBZA 1ZTTA 4N8NA 2VUGA 4ID5A 4K7QA 5A8RB 4OX6A 2KVQE 3ZZUA 3MTJA 2AWZA 4JOUA 2I6WA 3NOGA 4OYWA 2M7SA 2FTRA 4FF1A 1URNA 1X8DA 2Z2LA 1QVFR 2XC9A 3DLEB 5HROA 4EI2A 3BKTA 3R5BA 1WF2A 2R7WA 2HFUA 1N36J 5B0EA 4WFYA 3PY8A 3CCVS 3EZOA 1OPIA 3O3LA 5E3CA 3T1HF 4Q2MA 4QIGA 2PO4A 3BR9A 2BABA 3RRKA 5B7WA 4USHA 3H8YA 2XZWA 5KFXA 2G0IA 1RAAB 5JVHQ 1QM9A 3KLGB 3SDEB 2QX0A 1RWXB 3SSSA 3JXOA 1C0UA 3M2RB 3LP1A 4F04B 2IJNA 3N6LA 2HMIB 3NGKA 1U1KA 3ONQA 2VFUA 1NXIA 3MXHP 1PJ5A 4JI0J 1SL1A 3KHHA 1FA0A 3FCVA 4OJ3A 5EN1A 3WQPA 3KLIB 2VOPA 1G7CB 2YWFA 1T9YA 3FDSA 4R0EA 3MCSA 2C2KB 4OZ1A 2N4CA 2UXCJ 4F3QA 2YKPA 2IRXA 4WE1B 3TUJC 1D3WA 2YQ0A 5J1EA 2FLLA 4WZMA 1NPKA 2PFFB 2M4MA 2P8IA 4P72A 1S9EA 2V2QA 3RU0A 2VJVA 4CM0A 3DLHA 4EO6A 4F0MA 2X1AA 2M8DB 3AT1B 5F8LA 4IG3A 5KFOA 3OV7A 2W24A 4NZ7A 2AYBA 3H42A 1O0PA 2PI5A 4X66J 5GAHU 1T03A 2M88A 5ITHA 1U1RA 2JVRA 3M2UA 1M5PC 4Y2KA 1U47A 2HK3A 1K44A 2HVEA 4ZS6A 1SC4B 2IA6A 3UDCA 2KTQA 2V94A 4B3RF 5BXIA 2RH3A 2PEBA 3FJ2A 3N4WA 2OJ3A 4M5GA 3P45B 2R2SA 2OFGX 2EEYA 6AT1B 2F4VF 3UNYA 3AFGA 1JXVA 3KHGA 3PHTA 1RTJB 2WAQD 1H38A 2LQ5A 2G9OA 2F65A 3GR0A 1VQ9S 2B4OA 4CYUA 5KG1A 2HVIA 5HN0A 2CVIA 2X3DA 2GAGC 2H5JB 1RAJA 4ENOA 3VGVA 2FC8A 1UWBA 4A8KA 2CQDA 4DWIA 4GC7A 4DR1J 2GQCA 3SQGA 2RRNA 4GVBA 1FK9A 5KG5A 2JJ4D 4G6VB 2U2FA 1RT5A 1IQTA 2HYIB 3VF0B 3R2DJ 2V5HG 1XK8A 1WDDA 3UR0A 2VPYB 1BQNA 1Z2ZA 1I6JA 4R5PA 1S1UA 1FEEA 3FVYA 1KDNA 4J9SA 3VAJA 3CCES 5KG2A 1FO1A 4UZBA 2R7OA 4OZ2A 2ZHOA 4WFXA 3MAQA 4ED8A 1L5UA 4I67A 4Z37A 5K8OA 2DEJA 5I3UB 2VB6A 3AHPA 4ZHRA 4V1Ak 4OZNA 5HATA 2V8HA 5KFNA 3GV5B 3DYAB 4TLQA 1SQGA 4NA3A 1QDUB 3J7ZT 3BQ2A 1HBNB 1CLFA 4URGA 1HBUA 1HNWF 1YJRA 3OR2A 1AUDA 1BWVA 4WYWA 4JI8F 2DGQA 1NJWA 2C2RA 1V6HA 3DGVA 3DN9A 5JJBA 3IO1A 4N7TA 3RAQA 2RILA 2CRLA 1FE0A 2OEKA 4DV6J 4TLRA 3K57A 2UUAJ 1SCJB 4J5OA 1B4SA 2DGTA 1N32F 5E3QA 2VBWA 3RRHA 1VRUB 2QLBB 1KQGB 4A8MP 2C22A 3D0HE 3SCKE 2H9ZA 5JVGQ 3NAHA 1HBMA 2R7VA 1HD0A 1XMQF 1VHFA 4ECYA 5DJBA 2C1EB 2HHXA 3MF5A 2BJ8A 3D6MB 4LRAA 1REVB 3Q83A 2MQQA 2VG7A 4ZVPB 2HAIA 5D0GA 1K0TA 3HHLD 2DNGA 1UJ6A 1S1VB 3HF5A 2XYPB 3SFUA 3R5JB 1TQLA 3A8EA 1UMJA 5K14B 3PW5A 3EICA 2RS8A 4CO1A 2K2PA 1F3FA 1UA1A 4C8NA 3MGJA 3G96A 7AT1B 4YN3B 4C7QA 2J7KA 1JNZB 4CH7A 2AJ2A 3WHIA 2G0CA 3UPFA 3QT8A 1RHJB 1MWYA 3KK3A 4Y6IA 5EHHA 3EVOA 1X5TA 2WONA 1RAOA 3FRYA 3GQCA 3N79A 1T3OA 4PPZA 1CEZA 3FCHA 2A2DA 4KGZB 5HVFA 3G2XA 2Z0GA 4WP3A 3M32B 3G8QA 2BW2A 3CWJA 4LF4J 1RAIB 3O5TB 2IBOA 2VQFF 3N5FA 4I2PA 2K1RB 1VQYA 4A8WA 3AODA 5DQGA 3DLJA 3I9ZA 3FZBA 5KFPA 4AL6A 1T05A 8RUCA 3V6JA 1F9EB 3C3LA 4LFBJ 3V6HA 1QD1A 2J7UA 4LF7J 4FZVA 4ED1A 4CIOA 2V2VA 1Y5IB 4KPCA 2C3YA 4HTIA 4B9TA 3M8YA 1ICEB 2QLJB 5H9FK 4JB8B 1HNIB 1N0VC 2B9YA 3DOKA 1KQFB 1HNZJ 3DGPB 3DFEA 4CP5A 1O5JA 5ETQA 5LMUF 4DF8A 2AYMA 4I2QB 2DNMA 1J2VA 3CJ0A 5F8HA 5JXSA 1UWAA 2AJ1A 2AGQA 2FY1A 2DBBA 2DHXA 1U1LA 5D15A 4OYMA 3Q8UA 3AY0A 3TVYA 3ELHA 1NHKL 3H0PA 3PNIA 1D0EA 4NLYA 4BS2A 1N5QA 4I69A 2WW4A 3KNAA 2HQGA 3KWMA 3OXFA 3C8YA 3TJ8A 1H2UX 1R8PA 3KLFA 1NJIT 1GK8A 2DNNA 4RW7A 4JI4J 2AP6A 2Y8YA 5CD4A 4DR7J 2MJNA 3K8WA 3G82A 2FVPA 2V8DA 1NSPA 2HGLA 4ZPAA 7FD1A 4NLGA 2ZFHA 3GYGA 5HP1A 4LRCA 4MH8A 3CJRA 4ZPBA 2N82B 4FF4A 2C2EA 1H73A 2YWEA 2GHPA 1X4FA 4LF6F 2E9TA 2YNIA 4NLWA 4G3IA 3MEGA 5L9NA 1SJ3P 2EFQA 1V5VA 3HFKA 3OLBA 4ED5A 4C97A 3Q89A 3W65A 3FBCA 3EJMA 1Q79A 1J27A 1LW2A 2C42A 3C66A 1T9VA 1SL0A 2WVDA 1BY9A 4RW4B 3ADAC 4IDKB 4CO0A 2YX4A 1UVIA 5CYQA 5EX0A 3UQSA 4PYAA 4JI7J 4GO7X 1CQMA 5J2QB 1RYSA 1HNVA 2W01A 3GSDA 3IN5A 4A48A 3SEOA 4RWXA 2ROPA 2V69A 2XYGB 1JJ2R 1JK9B 1S6QA 1JXLA 3R2CJ 1JLEB 3QO9B 4UOHA 3CXCR 3OQ2A 3GG1A 2Z4PA 3LPYA 1ITPA 2DT9A 5A0YA 1RWMB 2R8JA 3G4SS 3MM5B 1NK5A 3GONA 3KFWX 1F9FA 1FWKA 2CQ0A 5KG3A 1IUJA 4GRSA 5KFQA 4ZOSA 2OSRA 1A6LA 4KKOB 3BREA 2ZKUA 1R3NA 1P9QC 4ICLA 1TAQA 2HNZA 3M8WA 2Z2ZA 5EWEA 2GVDB 1R0AA 5B0FA 2KG0A 1PBUA 4LSNA 2MKIA 1UVMA 1U2RA 3VGUA 4Q45A 4LRDA 3I0RB 3M9NB 4K4VA 2I2YA 1HR0J 1Y5LB 1SQFA 1HQ2A 4OZ3A 4Y00A 4RUAA 4O4RA 4DX6A 3BBBA 4USTA 1BQMA 3ET6B 4IFYB 1T0TV 3NRBA 3R5DA 1AFIA 2VKRA 4L72B 4XTTA 4FKXA 2W25A 1HWJA 4OYZA 2JX2A 1S1XB 1FJGJ 4MT1A 2IVMA 5GMEA 4BWJA 1RISA 3BN7A 1D1UA 2YXLA 2ZH6A 2AHOB 5B0BA 1L3VA 1KHVA 4FPRA 1BXNA 5JUMA 2FZGB 2ZC3A 5H9EK 4LFAF 1NSQA 3NGTA 2UUBJ 3PW0A 2ZITA 2XWYA 5HMYA 4JYAJ 3IBWA 2IY5B 1UA0A 2VG6A 2XTJP 5HK4A 5C25B 1J5OB 1QAJA 5IXUA 3CW2C 5DG8A 1UVLA 1QSSA 4CO3A 1QE1A 4RBTA 1RHKB 2C2OB 4AFFA 2CJQA 1D9FA 3OLAA 5FDLA 3A3NB 2YKAA 2E7WA 1IKYA 4QIEA 3P5TL 1VRTA 3KG1A 2OI2A 2JLFA 3W66A 5HROB 4UW2A 2LMIA 2Z8QA 3MPWA 3W61A 5GAEU 4ZDNA 5F8NA 2KZZA 1S7HA 1XTZA 3TAPA 4F4AA 3BQ1A 2OIHA 5DGBA 4LQ9A 5HBMA 2VC1A 4DR3J 1X7VA 1ZM2A 2OO4A 3NGDA 1DJ0A 3TUIC 4LJMA 4F50A 1VLYA 1EETA 1K73T 2YKQA 3UWTA 2VFSA 4FP9A 3LP1B 2UZAA 1X4AA 3DLKA 4HACA 4MMOA 3PYDA 2FHJA 3EYZA 5HVGA 1Q82T 3I0SA 2D7SA 4ZPVR 2A6OA 3OTOJ 1E6YA 4JI6F 3E2EA 2HBQB 2DPJA 2BE9B 4CO4A 2CQHA 2IC3A 1LNQA 1Q7LB 2MMYA 4U7UK 3MTKA 4EWTA 2EC0A 4F0KA 1LQ9A 3CCJS 4DV0J 3HFZB 5IFMA 1IKVB 1DLOB 2D3OR 4R0JA 4NXMF 5ETSA 1TK0A 1NMEB 3BZQA 1DY3A 1KFDA 3TUPA 1EAYC 1WNEA 3CPWR 3ICLA 3D54A 4WKYA 1FWLA 2ZUAA 5DS7A 4DXLA 2QFJA 2UXDJ 4UT4A 2AW0A 2DCUB 2RDJA 1XMOJ 1WG1A 5CABA 3KHRA 3OL8A 1AZSA 2DR5A 3NCQA 3HVTA 2YWKA 4QQBA 4DX8H 4D3HA 2ZVIA 1RI7A 5K5MA 1CJUB 2CPEA 1JJ4A 4XDCA 4MIBA 2QYGA 4V19X 4WK1A 3BPDA 4WU3A 2GS8A 3GMGA 1KTVA 2HURA 1E6VA 1VISA 2V2KA 1N4LA 1I5OB 4PXBA 2Q1LA 1KD1T 4B9VA 2AZ1A 2FVSA 2YNHB 1AYEA 2MQPA 2YPYA 2VBYA 3HM9A 1T11A 1RBOB 3ZFVA 2VV5A 3VR1A 3OXLA 1NK4A 3FEYB 3SQGB 3ISNC 1IM4A 5MAOA 2AEJA 4F2SA 2DHGA 5IQ6A 2KZMA 1T7PA 2JOQA 5T14A 4CDIA 5EX3A 4EEYA 4ECTA 4AL5A 2B4PA 3LTOA 4IR9A 2OH2A 1RTZA 3OTCA 4P10A 3G6ES 2CXEA 1FTRA 3MMCB 1KFSA 2KKHA 3M6UA 2IJRA 3HHLB 3MFIA 5HMWA 2MLYA 2NZCA 3RBXA 3CCSS 2M70A 2GHVC 2M5YA 2NUUG 3PKYA 3B78A 2ZC4A 3UN2A 1X4DA 2FVCA 5LJ3Y 1XQIA 2NZ4A 3QLHA 2Q79A 1T95A 1WI8A 2MPUA 3VQTA 4G1IA 2B3TB 4QWAA 3CC7S 1NK7A 2B51A 1BHNA 4DEZA 3DI6B 4QWDA 3KK2B 3EUNA 4ED2A 2DD8S 1Y7PA 3PFOA 4L76A 3JQMA 2RF2A 1PJ7A 1ZOTA 3L9ZA 3IC1A 1KQSR 1VLOA 2ZOMA 4TY9A 4EGLA 1X4BA 1Y5NB 4H4KA 2MLXA 2DRDA 1RHQB 2IM1A 3W5XA 1SH3A 3CJ2A 4Y2CA 4EBEA 2ZBCA 1I94F 2AGOA 4A8QA 4X62F 5KFEA 1WOOA 1JLFA 4DBQA 1AA1B 2XHCA 4E2FB 2JFDA 3W60A 5KFZA 5M2PA 2IFXA 1Y10A 2OFHX 5J2PA 4HR2A 4F7VA 4DPUA 2W4CA 3ITHA 2BYCA 4B3SF 3MDFA 3CT9A 5F8IA 1TZ0A 5A8WA 3ZZ0A 5KFVA 1IKWA 3CJKA 1RGVA 3EPGA 1U6ZA 4PYDA 4WYLA 1LK7A 3KOAA 3PFEA 3KK3B 2PA3A 5DG9A 3TO8A 2WONB 3IGVA 4WU2A 3AJDA 2OPRB 2H5IB 2V8GA 4U9RA 3K5NA 3I96A 1BMQB 1YG0A 3TANA 2KN4A 3IR6B 1SIZA 2XY5A 1R0BG 4I4BA 4LF1A 1R8AA 1W7WA 4K59A 2XMVA 3M30B 3PEHA 3U1MA 4B08A 5C2CA 1DTQA 3LP2A 2H48B 4I2PB 1G6BA 4P6QA 4ZCLA 2R4FA 4LMZA 3QYYA 1T05B 3CJ4A 2HGMA 4HH0A 1M0SA 1VBKA 3DRPA 4RUCA 3JTPA 1K0VA 1HHSA 4DV3J 5IOLA 3HI9A 2P6TA 3NMAA 1HYSB 2MY8A 4LF5J 1G3OA 1NNDA 2BACA 4MJKA 5D6GA 4XPEA 5ETVA 4CQ1A 3SBMA 2ATCB 4HL9A 2FY8A 3S6EA 4KT0C 4HLBA 5J2MA 2R2TA 1N54B 4XDDA 3GCWP 4DV2J 3M1VB 4Q8EA 4MYUA 1NO8A 2FYXA 2BJ3A 2IA0A 4DFJA 2O01C 2CPHA 3KMQA 3LGNA 3TZZA 1RAFB 2CJXB 2CQPA 3BSCA 3UR3C 2XY6A 1IBLF 4IRKA 5C5JA 5B0GA 4JBCA 4PQAA 1YBTA 2MSTA 1DRZA 1RKIA 4F2RA 3H4DA 1WEYA 5AXKA 4DLGA 4K4WA 3G82B 1QY7A 3M8QB 4LF9J 3TNVA 4OFZA 4I1TA 1SV5B 1C4AA 3J7AN 3KDNA 1TP7A 4A47A 3JS9A 2CQ2A 3CDAA 4X4PA 3W63A 2CADA 3N6MA 5G0RB 1HBOB 2HQ3A 2G1DA 3FZ2A 1NZAA 4L75A 2FUG9 1QLNA 2Y0SD 2VIHA 2E44A 2V4JA 1A7GE 3HCXA 1S0NA 5L8RC 2KI2A 3D68A 3TA0A 1YBAA 4CCHA 1TVRA 4KV8B 2DGOA 1LW2B 1WSRA 4KQZA 4OMFG 1DQAA 1KOOA 5HL7Q 5IC6B 4IFVB 4Y2MA 4I64A 5AJ3F 3C14A 1HNVB 4FNHA 2A3JA 7FDRA 3EPIA 5IT4A 2HHVA 3MD1A 1LWFA 3QT6A 2PEHA 2KFYA 2HRTA 1MROA 5IWAJ 5F0UA 2GJFA 3D3BJ 4FVMA 2HVZA 2DXFA 2CPZA 2HHHF 1RT7A 5D77A 3RAXA 1RU2A 1YQHA 5CQGA 3GJSB 5CYMB 2CA9A 1DQ8A 3AOCA 3P8BB 5LOQA 2CJAA 2OUGA 2E5LF 2AD9A 4ECVA 1GXLA 1TKTA 2WRMA 2NYIA 4JI5J 2CZ9A 1P8GA 3NGRA 4N41A 1S7IA 3POTA 4URSA 8AT1B 1R0AB 2KXHA 1TMJA 1AB8A 3QGGA 3M4XA 4LSNB 3QRPA 3MEEA 4RW9A 5F0WA 4ZCMA 2JEJA 1C1CA 1WEZA 3HLUA 2JVOA 2HBRB 3PIOQ 2FPHX 2MGZB 3TAMA 4IH5A 1B99A 3CD5A 3D6HB 1HA1A 4K4ZA 3CB4A 3HSDA 2IJFA 3CJ3A 1ZA1B 4I68A 4KFBA 2GZOA 5L46A 1TL5A 3B54A 2HHPA 1NEEA 2MQNA 2L9WA 2PI4A 2CDQA 3CDWA 3Q8RB 4KYZA 2KXFA 1IM6A 3DMJA 2YQ1A 4P2SA 4R8UB 2F8HA 3EGNA 2I5JA 3JSMB 3MECA 3GFHA 4QU7A 1D09B 4RW6B 3HD1A 3AD9C 3I4PA 2BJEA 4DL7A 2IPOB 2DNLA 1OY6A 4I6WA 3OFEA 1H98A 4F3OA 4AQYF 2VFTA 2W7OA 4QYRA 3GLJA 3MMBA 4H4MB 2O67A 2VPZB 4OI2A 1SI9A 2NSBA 2HQFA 4Q0BB 4DX7A 2VG6B 5C2GA 2V0NA 4PG5A 4YDXA 5LMNJ 2WVFA 4ED3A 2W8LA 3BGRA 4PUOB 3OL7A 4IR1A 3D1OA 4NLXA 1LV5A 4F36A 4OZ0A 2F63A 4XPCA 2O3DA 2VD3A 2QA1A 1FT8A 2QZ8A 1VRTB 2V9KA 4MTPA 3AA8A 5E3PA 3DOLB 4OHXA 1SJRA 2R7QA 3MCNA 4TY8A 4DDFA 3PW2A 1VC6A 5DG7A 2W8KA 1J5EJ 5H9EJ 3UW1A 4MK7A 2BE2B 2ZVSA 2B56A 4C48A 4O4GA 3NY0A 4HVZA 5G4DA 1IJEB 2KH9A 1N5YA 1YRXA 1UFKA 5HMZA 3M2VB 2ASLA 3NBPA 5KFTA 1L3UA 4DUYJ 1OIAA 4CI0B 1RTHA 1DURA 2LLZA 3NWGA 3J7YU 2BMBA 4C9DA 4KRWA 2ZDOA 1EETB 1KLMA 3H40A 2F9JA 3W9HA 4FYYB 1PYSB 2BR0A 1JJHA 4QPTA 4R25A 2V6AA 1FX2A 5ETNA 1CJKB 3I0SB 2XMJA 1E6YB 1KWMA 4LVOP 3DKDA 5A2QY 1FX4A 1RCXB 5B0AA 2IC3B 4QWCA 2XCAA 2HLTA 3W9IA 2PD1A 1H7XA 4PWWA 5F41A 1U1QA 2E9ZA 3C6UA 1XC9A 1VQ8S 2X1FA 5KFSA 1O8BA 4X4QA 1N5VA 3P5BP 5A8RA 3TZYA 3WDOA 4KO0B 3BSOA 2UXBJ 5IT9Y 5D0RA 2J8AA 2CJ9A 3CUNA 5KG4A 1KP6A 1CC8A 1S1TB 2G2ZA 1QAYA 3SIPB 4LVNP 3NKYA 4K2JA 4F0HA 1CSJA 4HI1A 4ZVSB 3MM9A 1NDCA 3X1LB 3LAKA 1M1HA 2JEGA 3DLEA 2MQOA 4P2FA 1NU4A 2BX6A 1FHTA 4LREA 2BANA 3K2YA 2QJ3A 2NYHA 4KH1B 3CD7A 2IHR1 1NKBA 1L3SA 3FEZA 3ZC4A 1WOSA 1R6YA 2E5IA 3WX4A 3R27A 4K4UA 3GFYA 3W2VB 3ZZPA 2QA4G 3KLGA 3SDEA 1FVQA 3QAEA 4K4XA 1ZM4A 1R31A 3HHLC 2UV8G 4M5NA 3OL9A 4RNOA 1MU2B 1RADB 1YRUA 2HMIA 4B3TF 2YTCA 2DNRA 4Q7AA 3D6TB 4V19J 4U95A 4CLPA 3NGUA 3KLIA 2HQIA 4IUFA 1R27B 4RU9A 2IM0A 1RYRA 4P71A 5AT1B 1M5SA 2UVUA 1SJQA 3TR5A 2AJ0A 4YHHF 1NAQA 2OSQA 4WP9A 4C0HA 3RYLA 1U1MA 1KR4A 2ZH2A 3HSJA 1WTFA 3GYXB 4TN2A 2NS1B 4AXJA 4MKVA 3QGHA 2VODA 1X4GA 1EP4B 3ZZTA 1MWZA 1RDRA 4DL0C 4DV1J 3LGHA 4NYPA 4ZLNA 2D3UA 2X1BA 3QSIA 1JLBB 4PWDB 4I7FB 2Y8WA 2DH7A 3M7VA 1VR6A 3PX4A 2KM8C 3L7OA 3GP9A 3KUEA 1U2FA 4F4KA 3DRXA 4GKJF 2VC0A 5A2QU 4DG1A 1DTTB 2NXUA 3A12A 4KHPF 3OUYB 3R1HA 4DQIA 3PJ9A 4L6V3 1RTJA 1F5AA 5SUHA 1WHVA 4UUXA 2YNGA 2YBVA 3Q8QB 3VZIA 3H2LA 1NB2A 4KAIA 1SC1B 3E01B 3TJ9A 1F3VA 4FPIA 3MFHA 2YH0A 1D8YA 3DU6A 2EFVA 4PXDA 1K1SA 2XGPA 5KAKA 1TK8A 2ILYA 4DR4F 3AXMA 5IT9U 4X2BA 2ZWPA 3EX7B 1RE1B 1OWXA 1GNKA 5EWGA 2RJZA 4EK2A 5KFGA 2K3IA 4NOHA 2A10A 4PG6A 1HQUB 3PM9A 2DR9A 2J0SD 4C0BA 2ZBRA 2I0XA 1H72C 5HLFB 2DNYA 2B5JB 2Q6CA 2HEKA 2EFPA 1RU1A 3T1HJ 1VC0A 4M5IA 2XNQA 5I3UA 1U6FA 4ILMA 3JSRA 4ZVGA 1XNQF 3HJFA 3I4HX 3K59A 2FLOA 3OXGA 1PILA 3SFGA 3DYAA 1HPZA 2BDPA 4MKYA 3IWXA 4ANDA 1HBNA 1S12A 5D4LA 5J2NA 2IBKA 2HZVA 1B7FA 5D3GB 3NOCA 1QTNB 1XNRF 2KHDA 1FDNA 2XMUA 3NS5A 3H98A 1FFWB 3I87A 2CVEA 2H5EA 2FJEB 3HO1A 3D6FB 2CNNB 4DFPA 1U4BA 2R7RA 4DSFA 5H1SV 2N4DA 1NHUA 3BDEA 3K5MA 3UD4P 1IQZA 1VRUA 3EGWB 2QMUB 1JJCB 2BM0A 3LPEA 4J9VA 4I56A 2DHAA 4UY85 3CD6S 3PO5A 3KHLA 2CJBA 3MMAB 3NEKA 1D9AA 2W2PP 3RB4A 1YJ7A 1JX4A 1FE4A 1JLAB 5I3QA 4FYDA 2DNHA 4PQUB 1REVA 3QIDA 5B08A 2IYGA 4DCOB 3MM8A 2A2CA 4PWUA 1B7YB 1GT8A 5KFHA 1S1VA 2VBXA 3VHQA 1S59A 3GJQB 1JNRB 1X4CA 4B3RJ 1U24A 1X9WA 3HSGA 2HPUA 2JNJA 3W8GA 3JSBA 3CC2S 2FHKA 2FJAB 2F4VJ 1Y0HA 1N6QB 2B6AB 2IRYA 2GA7A 4DL4A 1RWUA 2Z30B 3G8SA 5E41A 2OMLA 3PW4A 4NMXA 4NRUA 1SUQB 4BHQA 4KTQA 1T9XA 2ZH5A 4RX6A 1AROP 5HI7A 4OHWA 1LFWA 4J9UE 1WACA 1QSYA 3M6XA 3M32A 2ZJQQ 3ENQA 4TQSA 2JEFA 2LQBA 2XLIA 2K1RA 3F56A 5HQLA 1HW8A 5IC4B 1FNMA 4C8LA 2OD4A 1X5PA 4EBDA 3PJWA 5EGYA 4OX7A 4Z2XA 4RU2A 2RD5C 4HDHA 2LQ9A 1MG7A 3C14B 3KUGA 3PX0A 4YB5A 3FMBA 1HNIA 3DGPA 4J90A 1VQSA 3C19A 2AIRB 1LWFB 3KK1B 3AD7C 3RBEA 1OY9A 1MROB 2CPDA 4I2QA 1NH8A 2XULA 1HNWJ 5GMKa 4QIVA 2B0GA 2MKJA 4QIWD 2IAJA 4JI8J 2UUCF 3FSIA 3QJJA 2M9KA 5ADZA 3QATA 2DY1A 3K5OA 1QJHA 2Y1RI 2KJWA 4KC5A 1N32J 4RZRA 4Y28C 5KFMA 5M2UA 1AFJA 2N3LA 3MEDA 1S6PB 1OO0B 3AOAA 4ER8A 1U1OA 4URQU 3DDIA 1ULRA 1XMQJ 1HI1A 1RWOB 1TK5A 4FYWB 1C1CB 4JI3F 3Q8SB 4ZIVA 2HSEB 3D1QA 3KG0A 4NLQA 3NMRA 3IBFB 3DDKA 4WFBQ 1TKXB 3BN4A 4DSJA 4KFBB 2BJ1A 3VCDA 3R3TA 2G2OA 2FJBB 4RLEA 2W2OP 2QEXS 4NLSA 2VPXB 4O3RA 3HZEA 2IM2A 1KC8T 1VI7A 1VRQC 2A6MA 2V50A 2OTLS 2O5DA 4PG4A 4RW4A 4IDKA 1DZ5A 2BRKA 4ZCIA 4USJC 5D4OA 1I1GA 1B0VA 5J2QA 1O6XA 4LIRA 3JTNA 5HO4A 1GMWA 3HKWA 4P74A 2MKKA 1YHQS 2JDJA 4OJGA 4MK8A 4YB6A 1VHIA 1JLEA 3QO9A 1MWQA 4Z7CA 3R1LA 2YVSA 2OEJA 2ALZA 3BGFA 4UOCA 3H90A 4LR7A 2UP1A 2LA4A 4ECUA 4M5KA 5DZ6A 2X1GA 3RGIA 3OL6A 2VQFJ 1VMBA 2AX1A 4DV5F 2D69A 1CQNA 1DBDA 1Q8BA 2DY9A 2BQ3A 1SC6A 1V9OA 2HNDB 3V5RA 3CGIA 2FHMA 4KKOA 1RQ0A 4NRTA 1RLDA 2C2NA 1KVIA 2HBZB 1HNXF 3K89A 2UUTA 1BGXT 3DOMA 4NEYA 1M5HA 4JV0A 1UKUA 2GVDA 2XLKA 3I31A 3VAGA 3OTBA 3ZZRA 3A8KA 1SJFA 4A8FA 5LJ5Y 2AJ4A 1U2CA 5LMUJ 4CM2A 3I0RA 2XSJB 1ZM9A 3HJVA 4O4GB 4DR3F 4J37A 2L9DA 4DI6A 4IO1A 3RTVA 1RTHB 3PYFA 1KEKA 4K0KF 3ET6A 2LEPA 3VV2B 4J9MA 4IFYA 2W1BA 4EMDA 1S97A 3K58A 3WC2A 4UOFA 4OZJA 1ELOA 3VAHA 2XHWA 1S1XA 3MR6A 4NXNF 5KFYA 3LANA 3GIKA 5IQQA 2XBPA 4PKDB 3U1NA 3CDEA 5BYSA 4CTAA 1LW0B 1TKDA 1N34F 1IN0A 1QAXA 2B4UA 2POKA 4DX5A 2VFVA 3BH7B 1HIYA 3OBIA 2WW8A 3H5UA 3QMQA 4JP8A 4LF6J 2XEXA 1V3RA 1CPZA 4F4XA 1FJCA 2F9DA 4GVLA 2BW7A 4ZP7A 2C3OA 5C25A 1J5OA 1T3NA 1DHMA 2YKNA 4A8SA 2O66A 4B9MA 1FRJA 3CJQA 2MKYA 4IH7A 1B70B 1IXKA 3CJSA 5FLXY 1TKZB 2BV3A 1SKUB 1P27B 2GO8A 4YR2A 2UVWA 3MM9B 1FXRA 2F3JA 1RAGB 5CZVA 1X9SA 4EBCA 4NI2B 2BANB 3VTIA 4DR2F 4W92B 4WFZA 3NS6A 2L08A 1N8RT 3TWZA 4EZ9A 3F44A 2KYXA 1C1BB 2FGCA 1X0FA 2OPSB 4M5JA 1XN9A 1YDLA 4QR1A 4DF4A 2Y1IA 1NJYA 2MTLA 3P3DA 4OQJA 2V63A 4QOTA 4QW8A 3FC9A 3GILA 1RBLA 4NLVA 2XI3A 3V4MA 2H51B 2NXJA 3D3CJ 4YB1P 4KH0B 2JFKA 1C4CA 2YWGA 3LOUA 5GMDA 2R8IA 3I32A 1TAUA 1S0VA 1WC3A 3PRBA 1KBRA 2EXUA 1IKVA 2UUWA 1DLOA 2V34A 4P75A 1XR7A 2DKOB 3WC0A 4CZCA 4KHRA 4OL8A 1AT1B 3C6TB 1CG2A 4NE9C 3IRXB 1VQ4S 2QLXA 4DZDA 1RHUB 4XAKA 2H4YB 2XM3A 3H2UB 5CA5A 2WVCA 4WTYA 2YWWA 2RU3A 4ZPTR 1U02A 1ZAXA 3EDRB 2XGQA 2CPFA 3R9LA 5T7LA 4KBIA 2ZH3A 3I5CA 4ZLLA 2PC6A 1CJUA 4LFAJ 1H2TZ 4HI2A 4GMKA 4DG1B 2AJFE 4B3OB 3QRRA 2ZJRQ 1V3ZA 3ZTSA 4PXCA 4DV7F 2UU9J 1GXTA 1GMVA 1KSPA 2PT0A 2YNGB 4Y2AA 4ECQA 5KG7A 2RDIA 2MZTA 2C3UA 2WOMB 3C15B 4ETXA 2YNHA 1S48A 2P9GA 3G6YA 3JTOA 4G1QB 2AEMA 3ENAA 4JV5F 1PSDA 2VONA 2YKOA 1X5OA 3OFHA 3G8TA 5FLXU 5A76A 2NQPA 2DH9A 3NNCA 2H1YA 4NYZA 3HVAA 4LSZB 3SCLE 5C7PA 1H7WA 3VAFA 1IBKF 1SKSA 1Y3JA 3MMCA 3HHLA 1XR5A 2EVZA 1OMSA 2PMHA 2W2NP 4O44B 3RR7A 3L4BC 5LSLA 3G6VA 1AW0A 2FVRA 1HD1A 3ILIA 1HPZB 3HULA 3FGVA 4PEOA 4WIIA 5J2NB 4ZJLA 1G2EA 4M1KA 2BEFA 5DO2A 2FLNA 3FSXA 3RJMB 5HAOA 3QIPB 3EGZA 3I5BA 4JI6J 3NCPA 3T9NA 2IIHA 2EC2A 5ETTA 3IMQJ 4LT6A 3MM6B 5LSOA 2KT5A 3OHAA 1ACMB 2JRSA 3BO3A 4DSLA 3DI6A 3KK2A 4DMZA 5K20B 2BJDA 5RUBA 3M8SA 2XB2D 4NXMJ 3H4BA 5JMNA 4TXSA 5CHCB 4YEAA 1M1KT 4HHHA 5GADU 4YS2A 2PMZD 4B17A 4EYIB 3BH6B 5DM7Q 4DR6F 2ZZMA 1VIOA 3G6XA 2ADCA 2RRBA 2IMOA 1WELA 5BR8F 5DETA 3TX0A 2OD6A 3MM8B 3BM7A 5KT5A 3PVXA 4X65F 3AB2B 1P6TA 2RKIA 5DDQC 2VH7A 2DR8A 1HHQA 1P1LA 1YWXA 3J7Z5 1VQPS 3EE3A 3KJQB 3IA0A 3K5PA 4RW8B 4F8RA 3DM2B 4CO5A 1RWKB 3QRQA 2EFGA 3PIPQ 2DO0A 2F8EX 1NPPA 4CLLA 3SZ2A 3VAKA 5C42B 4TU9A 4P7VA 1VQ7S 4LQ3A 2OPRA 2DHHA 4RNMA 4ZK7M 2QLWA 2ZOFA 1UPMB 4DU8A 3OSNA 3BDPA 2Y1JA 3OVSA 4DR5F 5IM0A 3S01A 1S9GB 2Y9HA 2BQRA 1UL3A 1FJ7A 3A8JA 3M30A 3C16B 5F9LA 4ED4A 3IG1B 4UY8T 2R7UA 2R42A 1FTCA 1TL7A 2CQ4A 4HDGA 1CULA 3BS9A 2F5GA 5D8HB 1H6KX 3CSKA 2HS0A 4C0OC 2EK1A 2C3PA 4CLUA 3T3FA 1JKHB 2OKQA 2E1MC 3AJ2A 2VF3A 1WC4A 2ZUGA 1WC0A 1HYSA 3SYZA 1A0OB 2HHSA 3WIUA 2CIMA 2KO1A 1S99A 4IQMA 1ZPWX 1PC4A 1MSWD 1YITS 1REGX 1YX2A 1Q8IA 1SKWA 4DV4F 4MYTA 2R7XA 4M63A 3M1VA 2IAJB 3EXCX 4K4SA 1D8ZA 1LWCB 1U0HB 3UCZP 4O0IA 3N5BA 2ZBIA 2R8HA 4XIUA 2PFDA 4DCJB 4E0DA 1RTIB 2VA2A 1S1WB 3MEDB 3BO2A 5DRKA 3T6BA 4U8YA 3L7UA 3FQKA 3DDNA 3QT7A 1NJZA 4I6AA 3M8QA 3BB5A 1SV5A 1XWLA 4OV1A 2M0GB 3T1YF 2IVYA 3KDOA 1WTBA 2PGCA 1I94J 4X62J 2JC1A 2LDIA 1N52B 1WDTA 3W2WA 2QO3A 3AOBA 5G0RA 3GIRA 1HBOA 2W9AA 2G2YA 2RAQA 2HAFA 2KHCA 2OPPB 1FRLA 3M8PB 3TQEA 1NPRA 3HHNB 3W1YC 2LXFA 3LP0B 4A8YA 3CMES 4B3SJ 4KV8A 3NNHA 1HMVA 1WC6A 2ABYA 2YKMB 1YTYA 1N88A 4Q8FA 2J9CA 4A4JA 1S79A 1VGYA 4IFVA 4PR6A 2QRRA 3DHWC 2XG8A 1PAEX 2VG5B 4F3MA 2CZVC 1M1GA 2CKWA 3QJPA 4USVA 5D4PA 3H5YA 4ES2A 2WVBA 1JLGB 4QBUA 1S9FA 2DGXA 1UW9A 4DQQA 2W2MP 4NLUA 3GJTB 3R6GB 3EZ5A 3HD2A 2P5VA 1Q16B 3KLHB 2X3GA 2Z57B 4JV2A 2VOOA 5CYMA 2ZH9A 1U48A 4PPDA 4KR0B 1U0SA 1U09A 2LQJA 4FBTA 1Z2LA 2BRLA 1RA7A 1PYOB 1BC6A 4A8OA 2GJ2A 4USWA 4RNNA 1OYDA 3GYNA 2V8VA 4DSIA 4NA2A 4F26A 3GIIA 4RBUA 3DOMB 4YDDB 4IRCA 3L95X 2FB0A 4X64F 4NCGA 3T19A 2AZ3A 2AGPA 3GFZA 1EARA 1X4HA 3BR8A 4NLTA 3LWLA 2MGZA 2JEIA 5K8NA 1F5BA 4YOEA 2BA9A 2W9CA 3H5XA 4DUZF 1RACB 2WBMA 5DDPC 2YNFB 2CDRB 3OFFA 3ZO7A 1FDBA 1C0TB 2DGUA 2HRYA 2WBRA 4ECXA 1NHVA 1Q4RA 5HANA 2EG2A 3S8SA 1IBLJ 4FXWA 3G71S 1Y4ZB 1VJWA 4R8UA 3MM7B 1OY8A 2VDHA 3DRSB 3OR1B 5KFWA 3JSMA 2D9OA 3F41A 1RT2A 4CTAB 4RW6A 1BE4A 4F25A 5E2QA 3KLEB 3LF0A 1NKEA 2CQCA 2D3O1 1YRTA 1WHXA 4UF4A 1WORA 2H54B 4H4MA 3HFVA 2FZKB 3KLVA 2CNKB 1QUVA 4AE5A 4QWBA 1EIYB 1VYAA 4ZVTB 1N33F 1WC5A 4Q0BA 2GX8A 1GH8A 2YKNB 3GE9A 1NK9A 2KVIA 4PUOA 1R7IA 2N7CA 4PCQA 1RZMA 2F40A 2DEIA 4OYAA 3QT5A 1A9NB 3OJUA 1RXOB 1FESA 3W3SA 1LEOA 5AJ3J 3Q23A 2VASA 3OTDA 2SXLA 3DOLA 4PRFA 3MZIA 1UTAA 1XMBA 2HK2A 1ZETA 5D0HA 2HVDA 2ILZA 2ASYA 4C8OA 1F2GA 2BE2A 1RAHB 2CYYA 5SZTA 3VGSA 2HHHJ 4BDPA 2RB7A 4QCLA 1HWLA 3M2VA 3PACA 5LM7E 1UCNA 4N77A 2RUGA 1S49A 3JYTB 2E1RA 1P1TA 3M8ZA 2HS3A 2ASDA 1WD6A 4CWBA 5E3AA 2E5LJ 3BBFA 4JI2F 1X0PA 4FVCA 2EKNA 4LSLA 1GFWB 1CJKA 2LEBA 2HG4A 3TVKA 2RRAA 1TL1B 5ETMA 3T5JA 4D3GA 1K47A 3MAHA 3RB6A 2VQEF 1U8WA 2LXUA 2ZBPA 2KT3A 3DRRA 4WXWA 1RSCA 5IZHA 1ZS6A 2B9WA 1U6BA 5GAGU 2AJQA 2P6SA 2KDOA 1EKRA 2XY7A 4ZCKA 4ELTA 1MMDA 4KO0A 2ZM6F 1U8SA 3P4UB 2DNQA 4QR2A 4USUA 4WCEQ 3UDLA 1PCAA 2HZAA 1W25A 1FWPA 2ZH4A 1S1TA 2DXDA 2AF6A 2EFOA 2ZD1B 5T7LB 3GJRB 4QYZJ 3FRZA 1IR2A 1R0CB 2MHNA 2WCXA 4CNYA 4OZLA 4X4TA 3CD0A 2E7VA 2FJWA 3ILJA 4TYAA 1FDDA 4ZLJA 5IV3A 4AQYJ 3SCJE 2H65B 4DJBA 2HQCA 4K4TA 2C28A 4DSEA 4ZITA 2HW3A 1MMLA 2XO7A 4LF8F 1ZYQA 1JQGA 1OSDA 4U8VA 4M8LA 1KOHA 3W2VA 2N7YA 2ZHAA 1W2IA 3K17A 1F60B 1S76D 3ZTQA 1D9DA 3LAMA 3IM9A 1MU2A 2W9BB 4ZJQA 4MAKA 3CE8A 1R43A 2AQ4A 4CLZA 1NDPA 3V6KA 2GNKA 5L1JA 3R7SB 1JIHA 4GC6A 2RSQA 2XS5A 3M9OB 2MY7A 1IKXA 2B9XA 2J0XA 2R2RA 3M8RA 2APOA 1YJ9S 3FSYA 2PMWA 5MLCV 1CJTB 2H3EB 2MZ1A 4K50A 5HVHA 4OLOA 2Q3PA 2JLGA 3A8IA 1EP4A 2QL7B 2CQ3A 4LUBA 1FI4A 3B8HA 1JLBA 1VOMA 1SIWB 4PWDA 1VJQA 4I7FA 4XO0A 4ILLA 2DO4A 3CIMA 4MIWA 3RB3A 4U6PA 1KTQA 4CNZA 3JQKA 1HLWA 1DTTA 4LFCF 3OUYA 2XLJA 3J7YI 1QTMA 2R8KA 3MUMP 1YBUA 3WX8A 4NYOA 3K8VA 4MK9A 2E66A 3HHDA 1WUUA 3LO3A 4K2XA 2HFOA 4PG8A 1X60A 5DZ7A 3E01A 2KM8B 1PG5B 3PRDA 4DUTA 1TMMA 3CDBA 4H4KC 1RT1B 4QU6A 3V4IB 3EWGA 3UN3A 5B0DA 2RKIB 2DR7A 4K8RA 3UN5A 3DLGB 3R5CA 1WHWA 2WSCC 2QC3A 2BM1A 2MQMA 4FDFA 3SV4A 3D7SB 4C98A 4L73A 2OAUA 4S0MA 3G9CA 5FJ4A 1HQUA 1V5IB 2MZRA 2GMJA 3VQSA 3I82A 4MFBA 5HLFA 3TI0A 5AE2A 2B5JA 1LFPA 2GIFA 4FXDA 1VS3A 3OD2A 5HJYA 3LGMA 2YPZA 3EZUA 1H0HB 2KFZA 3TEGA 1RUSA 3H20A 1Q1KA 3GIMA 4P7TA 3QFHA 1Q8KA 1H74A 1GX5A 3TRGA 2QTWA 2OPQB 2QLFB 5ETKA 5D3GA 5IM0B 4TU8A 3UNGC 3F73A 4B3TJ 4JI1F 4LBPA 2VHGA 4O0NA 4YB7A 3ZTRA 4ZVFA 1TL7B 1CULB 2VPWB 5BJRA 4NZ0A 3TA2A 4AD6A 1FRIA 2B8PA 1W2BR 4MIAA 1CBKA 3BBCA 3W64A 3QGIA 4WFNQ 2L3MA 4YHHJ 1UP1A 4MKBA 2VL1A 1TL4A 1KS2A 3I55S 3W9JA 1M5OC 1FKPB 3MMAA 4M94A 1SC3B 1OQ6A 3V81B 3SI8A 2V9WA 1JLAA 1S0OA 2RVJA 4PQUA 3J81Y 4NASA 3QSYB 3B82A 2M8HA 2P9CA 4HEA9 2J6TA 4RUHA 1VIXA 1T02A 2FJVA 3ZNJ1 1CC7A 1SH0A 3P49B 3GPAA 4N47A
chains in the Genus database with same CATH topology
3CO9A 4C8MA 1VRTA 2OTLS 2O5DA 4PG4A 4RW4A 3MPYA 3KG1A 4IDKA 5GAEI 1DZ5A 1RT3B 3ETOA 2BRKA 2JLFA 4ZCIA 4USJC 3IAS9 1QUPA 3MOZA 4NA1A 5AXMA 5D4OA 2N3OA 5KT7A 5HROB 3V6DA 2AV5A 4UW2A 2LMIA 2Z8QA 4DV3F 3MPWA 3PV8A 4OHVA 1I1GA 1B0VA 4NMLA 3GWCA 4CT9A 5GAEU 5J2QA 4LIRA 4WE1A 3O44A 3E8OA 4ZDNA 3JTNA 1N6QA 2B6AA 5HO4A 5F8NA 1SQEA 3TQ1A 2C2DA 4FBUA 3IR5B 3HKWA 4LF5F 2E1AA 2KZZA 1S7HA 2UVVA 3MMJA 3CIZA 2Z2MA 2F1FA 1XTZA 3TAPA 3HT3A 1GXUA 2MKKA 1YHQS 2MB0B 3QZ7A 3BQ1A 2JDJA 4OJGA 3K7RA 2OIHA 4MK8A 5DGBA 3Q8PB 4LQ9A 4YB6A 1LK5A 5HBMA 1VC5A 1JLEA 3H2VE 2VC1A 3M05A 3QO9A 4H4OB 5KG6A 2DVIA 2OLWA 2FJXA 1X7VA 3R1LA 2YVSA 1ZM2A 2WSFC 4Q44A 3TAQA 2J6SA 2OO4A 3NGDA 1DJ0A 3CMAS 2ALZA 1HI8A 1SUQA 3TUIC 4LJMA 3BGFA 4F50A 4UOCA 2YY3A 1VLYA 3W2WB 1EETA 2XNRA 2UP1A 2LA4A 4ECUA 1M5KC 2X1GA 1RT4B 1N56A 1UETA 3PHEA 3OL6A 5DGAA 4DV2F 5D4NA 1K73T 2NPIA 3QLHB 4C11B 4B9SA 2YKQA 3TYTA 1VMBA 2AX1A 4DV5F 3MD3A 3NG8A 4DL6A 3JAMY 3UWTA 1CQNA 1DBDA 1Q8BA 2BQ3A 2VFSA 2GFFA 4FP9A 2DNOA 4B3MF 3LP1B 1SC6A 2UZAA 1X4AA 3DLKA 5CCMA 4MMOA 1V9OA 1RT1A 2HNDB 3PEJA 3V5RA 5IS2A 3CGIA 2FHJA 5AXLA 3EYZA 2FHMA 3V4IA 4KKOA 4F4YA 1Q82T 1L3KA 1RQ0A 3I0SA 2D7SA 4KGMA 4NRTA 4ZPVR 1AXQA 4X4SA 3DLGA 3L3CA 1E6YA 4JI6F 1KVIA 1HMVB 1HNXF 3E2EA 2UUTA 2DPJA 1BGXT 2DK2A 3DOMA 4CO4A 2CQHA 1M5HA 2XWXA 4OZ5A 2IC3A 4OIXA 1UKUA 3LALA 4JV0A 1Q7LB 4WFAQ 2MMYA 4U7UK 3KKFA 3MTKA 2XLKA 3X3UA 4EWTA 5GAGI 3I31A 2PSZA 2KRBA 3VAGA 1RT6A 2VA3A 2RF2B 3OTBA 3ZZRA 2EC0A 1IJFB 1JXEA 1LQ9A 6FDRA 5CZXA 3CCJS 4KSEB 1SJFA 1LWEA 1ZZFA 5IFMA 1IKVB 4A8FA 5LJ5Y 1SB6A 1YJNS 2AJ4A 1DLOB 5J1NA 2D3OR 4QR0A 4IH6A 4R0JA 3I0RA 4NXMF 2E29A 4LF9F 4FF3A 2XSJB 1TK0A 4OI0A 1ZM9A 4NLPA 4FN5A 4O4GB 2E7XA 3U27A 2CG4A 3BZQA 4EFAC 4DR3F 1KFDA 4J37A 3KK1A 2L9DA 2BZ2A 2JWNA 1TL3B 3KJVB 1Q81T 4IO1A 5K8MA 1WNEA 3RTVA 3CPWR 1RTHB 1URRA 3ICLA 1KEKA 3DCAA 2DTJA 3D54A 4WKYA 1JLFB 4K0KF 2LEPA 2YX7A 4J9MA 2OPQA 4IFYA 3OJSA 5DS7A 1S97A 2JZ5A 2ROGA 3K58A 3WC2A 2QFJA 1YJWS 2AW0A 2BUNA 3WZ0A 1U1NA 4OZJA 5C24B 2DCUB 5J2PB 5LSRA 1ELOA 3VAHA 2RDJA 1ROFA 3ENVA 1GQEA 2V4QA 2B43A 2XHWA 2LEAA 1S1XA 1HWIA 3UCGA 3ITHB 3MR6A 2HNYB 4NXNF 3E51A 4KGKA 1WG1A 1FNOA 3TP2A 5AE1A 4KJIA 2HS4A 5KFYA 5A8WB 2VFRA 3KHRA 3OL8A 3LANA 2DR5A 3NCQA 1IKWB 3US5A 3HVTA 3GIKA 4J9KA 2YWKA 5IQQA 2XBPA 4PKDB 4QQBA 3CJKB 3U1NA 3CDEA 2HIQA 4DX8H 4D3HA 2GQQA 5BYSA 4CTAA 3L09A 4X4UA 1RI7A 1LW0B 5K5MA 1TKDA 2J5AA 1IN0A 1S6PA 1N34F 1QAXA 2B4UA 2CPEA 2POKA 4J9PA 1S72S 4NLOA 4J9RA 1JJ4A 2VFVA 4XDCA 1GTEA 3NCRA 1OPZA 4MIBA 4V19X 2LA6A 4WK1A 4NCGB 5E33A 3O8WA 3OBIA 4W90B 4QZVB 5IT0A 3KNGA 4WU3A 2WW8A 3H5UA 3GMGA 3QMQA 4WXOA 1KTVA 2XEXA 3AAWB 2Q6BA 3T6JA 3NL0A 1V3RA 1S77D 1E6VA 5F9NA 2V2KA 1CPZA 1Z1ZA 4F4XA 1N4LA 1FJCA 1FKPA 1IBMF 3BJYA 4NLRA 5IWAF 4PXBA 3CDUA 2F9DA 3V81A 4ZP7A 2Q1LA 1KD1T 4B9VA 2C3OA 1FDAA 2W9CB 4ALZA 2FVSA 5C25A 1J5OA 1T3NA 2YNHB 1DHMA 4USIA 2YKNA 2MQPA 4A8SA 2VBYA 3HM9A 2O66A 1PO6A 1TKXA 4X4OA 3LWMA 4B9MA 3ZFVA 1FRJA 1LXJA 5KFUA 4ILRA 4OX8A 3OW2R 2VV5A 3MI7X 4IH7A 1SL2A 3DHXA 3VR1A 1IXKA 1HI0P 3OXLA 1NK4A 1DTQB 3LP2B 1ZBTA 3FEYB 3SQGB 5FLXY 2Q43A 5KFBA 3ISNC 1TKZB 3ZZYA 2IM3A 1IM4A 4N8OA 5MAOA 2BV3A 3T5KA 3T5HA 4F02A 1P27B 1BQXA 4F2SA 4HHJA 2DHGA 5IQ6A 4OX9F 2GO8A 2JSXA 2KZMA 3DRPB 1T7PA 2JOQA 5CH7B 5E7OB 1FD2A 3AQOA 2CJKA 4YR2A 2DHSA 2UVWA 1RK8A 5T14A 5EX3A 1RKJA 4EEYA 4ECTA 3GFXA 4AL5A 3MM9B 1FXRA 2F3JA 2D9PA 4KB7A 4O3SA 3J7A1 4JI5F 5J1PA 2B4PA 3U7JA 5CZVA 1X9SA 5F8JA 4GKKF 4O23A 4IR9A 1RT2B 2HWHA 4EBCA 2OH2A 5L38A 2EBEA 3OTCA 2CQGA 3PZPA 2BANB 3P96A 3VTIA 1L3TA 1X9MA 3G6ES 4DR2F 2XMTA 3PDNA 1FTRA 4W92B 2RIJA 1V3SA 4M95A 3MMCB 4WFZA 1KFSA 3NS6A 2KKHA 3M6UA 3M6VA 4WF9Q 3HHLB 3MFIA 5HMWA 2L08A 4I6YA 2FVQA 1VQ6S 1FKOB 4YMEA 4YY3F 3CCSS 2M70A 1NK6A 1MW7A 5I42B 1N8RT 2J6UA 3DLBA 4X4NA 2GHVC 1HQEB 2M5YA 3CVKA 5J2MB 2YWHA 4EZ9A 2NUUG 2QE5A 3F44A 2KYXA 4H4OA 4BC7A 3PKYA 1C1BB 3MUVP 2WHOA 2FGCA 1X0FA 4HT5A 3ZZZA 1DARA 5L39A 2OPSB 3ENWA 4CO2A 4IYQA 4ELUA 1XN9A 5KT4A 1YJTA 3B78A 2ZC4A 4B9UA 2DGVA 1XR6A 1X4DA 3ISND 4QR1A 2FVCA 4OI1A 5LJ3Y 4N5SA 4DF4A 1ZH5A 2YQ3A 2Y1IA 1NJYA 3P3DA 2GGPA 4OQJA 3AJ1A 4QOTA 3D5MA 4CT8A 5DDRC 2NZ4A 5KT2A 3QLHA 4C11A 1X4EA 2Q79A 3BSAA 1T95A 1WI8A 1DFDA 4QW8A 2MPUA 3IAM9 3OPKA 3VQTA 3CCLS 4DLEA 3GILA 4G1IA 2B3TB 1N48A 4NLVA 5K14A 2ZOGA 2HNDA 3O1LA 2CPIA 2XI3A 3V4MA 4QWAA 1X5SA 3CC7S 1OSCA 2R7TA 3N6NA 2ZE2B 4YB1P 1NK7A 3U1LA 2MZQA 2B51A 2JFKA 1C4CA 1WG5A 2YWGA 3LOUA 4WK3A 2MXYA 4RWWA 1FD8A 4IOAQ 2R8IA 1JLQB 3I32A 1CVJA 4DEZA 1TAUA 3PJXA 3CCRS 2XS2A 3DI6B 4QWDA 2FJDB 3KK2B 2ZH7A 3EUNA 2QMWA 2DD8S 3HHKA 4AYBD 4ED2A 1S0VA 3GR1A 2MZSA 3DNCA 1Y7PA 3PRBA 3OVBA 3PFOA 2J0WA 3QAUA 2RF2A 1N36F 2FDNA 2RU9A 4YR3A 1O51A 1ZOTA 4NZ6A 1UFLA 1TV6B 2LKZA 5L1KA 4QW9A 3IC1A 1UAWA 1Q86T 1IKVA 4NPOA 4YFUA 2U1AA 1KQSR 2ZOMA 2UUWA 1DLOA 4ZA1A 2HFZA 2CQ1A 1XR7A 3WC0A 3THVA 4TY9A 2LXIA 1X4BA 4EGLA 4CZCA 2B4VA 1Y5NB 4KHRA 4H4KA 2XSJA 1GTHA 4OL8A 2PN6A 1FRKA 2IM1A 2HGNA 2DIUA 1SH3A 2RE1A 3C6TB 3CJ2A 4J9OA 1CG2A 2EW9A 2ZKTA 1TL3A 3IRXB 4Y2CA 3KJVA 1VQ4S 4EBEA 3PXGa 2ZBCA 2IMWP 1I94F 2AGOA 4A8QA 4X62F 2QA2A 5LT5A 4TQRA 1Y00A 3DXBA 2QLXA 2DNKA 3VALA 5KFEA 2IVFB 4XAKA 2V4JB 1JLFA 3QWUA 4DBQA 4IKAA 2LU2A 5LMNF 2JFDA 3HX9A 1APSA 3H2UB 5CA5A 2L48A 2DITA 1R89A 4WTYA 3BEGB 5KFZA 2IFXA 5M2PA 3THPA 2B7CB 4ECWA 3OVAA 2OFHX 2RU3A 5C24A 1TVRB 4ZPTR 2ZH8A 2HZCA 5J2PA 1ZAXA 3HZGA 2XGQA 2CPFA 1HW9A 4Q43A 2HVHA 3THTA 3CCMS 2W4CA 1NRKA 3ITHA 2HNYA 2BYCA 5T7LA 3MPVA 4LSLB 2QV6A 4KBIA 2NREA 4B3SF 3MDFA 3CT9A 5F8IA 1TZ0A 2O1PA 2ZH3A 4E98A 5A8WA 2QSWA 4JI0F 3ZZ0A 5THWA 3I5CA 1KQKA 5KFVA 1IKWA 3PR4A 2R8GA 2C3MA 3CJKA 3RAMA 1RGVA 2DNPA 3EPGA 2PC6A 1TUVA 1U6ZA 1LW0A 3HKZD 1NK0A 4DHVA 3JSYA 1H2TZ 3D1HA 4WYLA 1OS5A 4HI2A 1LK7A 3IXQA 4GMKA 2UXCF 3HK2A 1G1XA 4DG1B 3KOAA 2AJFE 2BXJA 4B3OB 3GIJA 1YVFA 1Z4UA 2PA3A 2OMOA 3PFEA 3KK3B 2LECA 1RP5A 2ZJRQ 5DG9A 1J5EF 1V3ZA 3TO8A 2WONB 3IGVA 4PXCA 4DV7F 2V4RA 3CF5Q 4OI3A 2GHWA 4NCBA 4WU2A 4ZKAA 2OPRB 3DRRB 3UCUP 2I38A 2RQMA 1H2VZ 1U26A 2V8GA 4U9RA 3K5NA 1GXTA 3I96A 4JUZA 2PT0A 5KFDA 1YJVA 3IRWP 3RB0A 1KSPA 2ZNZA 3MOJB 1YG0A 2YNGB 4Y2AA 2OP5A 2MKCA 1RT7B 3TANA 4ECQA 2KN4A 3IR6B 4DUYF 1SIZA 4ZPCA 5KG7A 5DLGA 2RDIA 2MZTA 5A8KA 2C3UA 2WOMB 2DRBA 2XY5A 4DL5A 1KN6A 3AB4B 4ETXA 2YNHA 1S48A 2P9GA 4I4BA 3G6YA 2K8GA 3JTOA 4G1QB 3UD3P 1R8AA 4K59A 5B0CA 3E3XA 4JV5F 1F0XA 1PSDA 5KG0A 2P9EA 2XMVA 3M30B 3PEHA 4HYKA 3U1MA 4B08A 4G1PA 5CYJA 4X66F 2VONA 2YKOA 3QJLA 2MKSA 1DTQA 3LP2A 4I2PB 2HRUA 3D0IE 2D1CA 1X5OA 1WEXA 1G6BA 1KHWA 4P6QA 1TKZA 4ZCLA 2R4FA 3NLCA 4LMZA 3OFHA 2GIQA 3QYYA 3G8TA 1Q78A 1T05B 3N28A 3CJ4A 2HGMA 2HHQA 4OHYA 1TKTB 4HH0A 1VQMS 1M0SA 2GCFA 3DRPA 4RUCA 3JTPA 4YQWA 2NQPA 1K0VA 1HHSA 2Q66A 3POTB 3HI9A 5BYQA 2P6TA 1M5VC 3PO4A 2DH9A 3HMJG 3J80Y 4NX9A 3NNCA 4NYZA 4IG0A 1XERA 3NMAA 3U02A 2GIRA 1VBXA 3HVAA 1HYSB 2MY8A 3MEEB 4RW9B 1G3OA 1NNDA 5I4MA 3SCLE 4ITSA 2XI2A 2BACA 1H7WA 3MR5A 3VAFA 1IBKF 1SKSA 4DQPA 4DFMA 4MJKA 5D6GA 2EK6A 4XPEA 2GJIA 1Y3JA 3MMCA 2ZH1A 2KU7A 4CQ1A 4X4RA 2M52A 1VQ5S 2GQ2A 3IFEA 3TAMB 1B0PA 3HHLA 1XR5A 2EVZA 4ZMMA 4HL9A 5L1IA 4ED7A 4BBYA 3CULA 4ID5B 2PMHA 2UU9F 5B09A 2CZ4A 2ZNYA 4O44B 3S6EA 4YR0A 4KT0C 4HLBA 5J2MA 4M5DB 3RR7A 1NKCA 5LSLA 2R2TA 1VQOS 2GMLA 3TOQA 1N54B 4TYBA 4XDDA 3G6VA 2MYFA 1AW0A 1C1BA 2FVRA 3VAIA 1HD1A 1HPZB 2DB1A 3M1VB 4Q8EA 2E5JA 4MYUA 1NO8A 2OPSA 1VBZA 3FGVA 4WIIA 1BWEA 3DRYA 2IA0A 5J2NB 4DFJA 2O01C 2UXBF 1G2EA 2ZDPA 4M1KA 2CPHA 4YUDA 5DO2A 5CCLA 3CCTA 3BO4A 3MHYA 4DR1F 3KMQA 2FLNA 3DMJB 4TNOA 3FSXA 3LGNA 1FVSA 3QIPB 1R8CA 2CQPA 2K3KA 3BSCA 3UR3C 2XY6A 1PGZA 1HFEL 1UVJA 3EGZA 3I5BA 3DC2A 2UVRA 1KVJA 2I5JB 3SSQA 1IBLF 1UEUA 4IRKA 5C5JA 3K0JA 2E1CA 1U25A 5B0GA 3NCPA 4JBCA 1F5CA 3T9NA 1S10A 3W7BA 3CCWA 4KE5A 2I8EA 3VZHA 2ZE2A 2EKYA 3MM6B 4LT6A 5F8GA 4PQAA 1DAXA 5LSOA 3MECB 2MSTA 2EWHA 2FGOA 1DRZA 3IR7B 1RKIA 2COLA 4HKQA 4F2RA 2KT5A 4HT7A 3OHAA 1JMTA 4DL2A 2JRSA 3H4DA 3K5LA 3BO3A 2FHOB 1WEYA 1JLQA 2NLWA 5AXKA 4DSLA 4EO8A 3DI6A 3KK2A 4DLGA 4Y0FA 4DMZA 4N56A 1ZPVA 4DS5A 4A46A 2QA4S 2DRAA 4K4WA 4BC9A 1ZTWA 2BJDA 1ZAWA 3JB9k 3M8SA 1QY7A 3M8QB 2XB2D 3TNVA 2YX1A 4OFZA 3H4BA 3D28A 4H54A 1IKXB 2GMHA 4I1TA 1SV5B 1C4AA 4TXSA 5CHCB 3MMBB 4YEAA 1U7LA 1TP7A 3ZZOA 4A47A 2FIUA 1M1KT 2ATLA 2CQ2A 2JC0A 5GADU 3CDAA 2J9EA 1UJ4A 1YGYA 3QPIA 4X4PA 3MWBA 2PMZD 3MM5A 2WTFA 4B17A 3OSPA 4EYIB 3RRGA 3N6MA 5DM7Q 4DR6F 3C6TA 5G0RB 1HBOB 2QYCA 2HQ3A 2G1DA