4QIGA

Crystal structure of pdua with edge mutation k26a and pore mutation s40c
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGCGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural protein
total genus 20
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qigA00
4RBVA 2A1BA 5L38A 2A18A 3I6PA 3MPYA 2A10A 4RBUA 4QIFA 3NWGA 4DDFA 3SSRA 4OX7A 3SSQA 3BN4A 3VCDA 4LIWA 4AXJA 3PACA 3H8YA 3IA0A 4P7TA 3CIMA 5DJBA 3I96A 4OLOA 4QIEA 3DNCA 4AXIA 4P2SA 3MPWA 2G13A 2EWHA 3DN9A 4OLPA 3N79A 4OX8A 4PPDA 3NGKA 4OX6A 4P7VA 3SSSA 4QIGA 4QIVA 4RBTA 3CGIA
chains in the Genus database with same CATH superfamily
3N01A 2PO4A 3M2RA 3M30A 3DOMB 1NSAA 3GJTB 2BJ1A 3MEGA 2H5JB 2JSXA 4DSIA 2VD3A 1M5HA 2HQGA 2HWIA 4FF1A 5MLCV 3AOCA 2EFNA 5DETA 1DTTA 2I2YA 3TUZC 1W26A 1VQ7S 5AE2A 2ZNYA 1JJ2R 4X4UA 2V6AA 4EI2A 2ZE2B 2RS8A 2X7IA 2XMJA 3K5LA 4QIFA 4DDFA 1VDHA 2BVZA 4C98A 3OT9A 1YZ6A 2H54B 2HS0A 4HT7A 2JEGA 2D7SA 3DGVA 1HD1A 1VQMS 2MKJA 4KPCA 1QTMA 1TL3A 3QO9A 4B3RJ 5I3QA 4EBDA 3PYDA 4X4OA 1G2EA 1A0OB 4KGVB 2APOA 4O44A 1WHVA 2W4CA 3T6JA 3AD9C 1KVJA 1LFPA 1UVJA 4RNOA 3EUNA 2BM1A 4K50A 1HQEA 2M52A 4W4MA 3C2PA 2H5EA 4HEA9 1NSQA 3QPIA 2GIQA 1K0TA 4J9LA 5F41A 4A4JA 2HSEB 4MJKA 1X8DA 4TLRA 1IR2A 2MZQA 1LW2A 1URNA 4A8KA 4WU2A 2GX8A 1X5PA 3OVBA 2EFPA 3G82B 2KZZA 3T41A 3NG8A 5EX3A 1RHMB 3RW7A 3GV5B 1GEHA 5CD4A 2UU9F 4ERDA 2V4JA 5F8LA 2IAJA 2CNKB 3FCVA 4F50A 5IZHA 3NGKA 2CQ2A 4Y28C 1H72C 2M8HA 1LXNA 3I0SB 3AA9A 2BV3A 2DHAA 4LSNA 3H25A 1PSDA 3RAXA 3IS9B 3M6VA 1S57A 3PHTA 2AGPA 1X31C 1QUPA 3MM9A 3GR1A 3NNCA 4USHA 4X62J 3TW0A 2LXFA 2E1MC 2ZZMA 3P4UB 5FJ4A 4B3RF 4RUCA 3HK2A 4RNHA 1PG5B 1S59A 2ZKTA 5A76A 2CPFA 2RF2A 3A3NB 1N6QB 2HIQA 4C8YA 2EFGA 5KFOA 2BR0A 4ZKAA 2RHSB 1R8AA 4FVCA 2P2CB 2X1FA 3KK1B 3IRXA 3I6PA 2B0GA 2MY8A 4IQXA 1YTYA 1U4BA 3ISZA 5J2QB 3EDRB 5LJ3Y 2QLFB 3TX0A 2AWZA 2BM0A 1VRUA 1RT7A 2AP6A 5DGAA 2VG5A 1S10A 4Q7AA 2IHR1 4DV5J 1SIWB 4NZ6A 4TU7A 3H5YA 2WSFC 4B9MA 5L1KA 4L3NA 4RNMA 3HM9A 1SH2A 3BO3A 3KLIA 2HBQB 3QZ8A 1B70B 5L1LA 4JI3J 3TVYA 4X64F 1TKZB 3EPIA 2A0FB 1XK8A 1WI8A 1TVRA 1T9UA 5F8IA 4WK3A 4C0OC 2A1BA 3JSRA 3I9ZA 4IOBA 1KOOA 4J7CA 2YWGA 1XERA 1K1QA 2OHDA 3O44A 1ZZFA 3PO5A 4JI5F 5F3TA 3HT0A 1TMJA 3DN9A 1AUDA 2EC0A 4USTA 4URSA 3HFZB 3K7RA 2BANA 2DK2A 5DDOC 1VQ8S 1FKOA 1O0PA 1FTCA 3R5JB 5IXUA 1KKHA 1J27A 1QAJA 2WONB 1Q78A 4QWAA 2B7CB 2E66A 4JV1A 2JJ4D 4P2MA 3LP2A 1WC1A 1N32J 3W9IA 1VHIA 1VQLS 2J6TA 4FXWA 4WF9Q 3DRSA 4ILLA 1FVQA 4ICLB 1RI7A 5LXRA 3J7YI 2WOMB 5GAEI 2MQPA 1HNZJ 1RB0A 4JI0F 5HVFA 2GZOA 3M7VA 3Q8RB 5HJYA 3KLEA 3MM8A 3UPFA 1OJ4A 2V94A 4DV5F 2OTJS 5D0RA 3OLAA 1RCXB 3TZXA 4K4SA 3MOZA 3K5MA 3TO8A 4TYBA 3DC2A 4BCAA 3L7UA 1JJHA 1HD0A 2R8GA 2HFNA 3NS6A 4FP9A 3PX4A 1YI2S 2GHVC 4OYWA 2HHSA 4QW8A 4M5KA 1N36J 2J6UA 3CJSA 4ED6A 3ELHA 2OPPA 3KG1A 4ELTA 3ISNC 2HNZB 2XMKA 1CJUA 2AMCB 4UT4A 1WNEA 3BR8A 5EWGA 1IKVB 3EZOA 2IJRA 2BYCA 3TQEA 3NMRA 4QW9A 4WCEQ 2HHWA 3NNAA 2QA4G 3K57A 2E29A 3D2WA 1FESA 4KE5A 4DX6A 3A8KA 2D3ZA 1Q8LA 1ZPWX 4PWWA 4FXVA 4K2XA 1LWFB 3E3XA 1MROA 5KFZA 4ANEA 3NRBA 4LT6A 2DHGA 1MU2B 3RUBL 4MYUA 2D9OA 1HNZF 3DLGA 1GMVA 2P9EA 1KN6A 2XWXA 2QEXS 1NPKA 1FERA 2B51A 2P5VA 3FMBA 1S7HA 3OTEA 4NE9C 2ATLA 2BJDA 4USVA 2G0IA 5J2MB 2ROGA 3GJRB 3SDEB 2J8SA 2R8KA 5GVQA 1AXQA 2XMUA 3TNVA 3Q86A 3FGVA 4F4XA 3NWGA 5C42A 1HL6A 2V4RA 2R7RA 2VL1A 3ZZOA 2BJ9A 1XTZA 4DQSA 4M5MA 2WW8A 1UTAA 2NXEA 4BWMA 1TV6B 1WF2A 1RT1A 1MN7A 3D1HA 4F3QA 1YKWA 2MLZA 1J5OA 2LVWA 1RHQB 1CJVA 1YJ7A 4KT0C 2IMOA 1M90T 5CHCB 1S6QB 2XY6A 4OI0A 2V8DA 3KLFB 5C24B 4F3OA 5HJXA 2IA0A 2GC8A 1MLAA 4RLEA 4UY8T 4BDPA 3ILLA 4LVNP 3KK3A 4KR0B 4JI4F 4YHHF 4FF2A 2MZRA 4NEZA 4C8KA 2OKQA 2W4PA 1KVIA 6AT1B 3HD1A 3V4IB 2QA4S 4N56A 1ROFA 2IBOA 2R7VA 4USJC 1BHNA 2KG1A 3SI8A 4B02A 3O1LA 4X4RA 4NMLA 4NXMJ 1FD2A 3AH6A 4RW6B 1QY7A 2G9OA 4DG1B 3CCVS 3QYYA 2IM1A 4DR1J 4LIRA 3SQGA 3ZC4A 3PIPQ 4DI6A 4C11A 1AFIA 1HARA 1CULB 1D9FA 1UVLA 2FJAB 2AZ3A 2VU5A 4TNOA 2V0NA 4A8SA 2C2NA 2XWYA 3PW4A 2GA7A 1KQKA 2FD2A 2RH3A 2MQMA 4HDGA 5H9EK 4B3SJ 4WFNQ 3DOLB 4DPTA 5KFNA 1Y4ZB 2DKOB 2CQHA 3NBPB 1C4CA 4CZCA 1WUUA 3QWPA 4RZRA 2B56A 2ZH9A 2XMWA 2LQ8A 3OTDA 1UETA 3ILOA 3E8OA 3GFYA 3W7BA 3Q8VA 1T9VA 4ID5B 5HMWA 4WJBA 2OPRB 3KFWX 2DD8S 1PC5A 2CVEA 1OQ3A 4OYXA 3MOJB 2ZWOA 3HHLB 1IBMF 3W5YA 3GFHA 2HRTA 2E1AA 5LT5A 3KHHA 4I7FA 3LW5C 3MMCB 3LANA 4TQRA 2GVDB 3DLKA 3C3LA 1KC8T 3MI7X 4V19X 1HBOB 5F8JA 4K7QA 4DHVA 1P8GA 4FYXB 2QSWA 2VPWB 3MM5A 3CJ5A 4G1QB 4KBIA 2YNHB 4B3TJ 5H9EJ 2OFGX 1TUWA 2G2OA 2Q6BA 3W66A 1S9GA 2DBBA 2UV8G 3OQ2A 2KFZA 4WZMA 1H3DA 3D1OA 4W90B 2WW4A 4OYAA 3AA8A 1OY9A 1X0FA 2LEAA 4WK1A 4ITSA 2W9BA 2DIUA 2L9NA 3KG4A 3NEKA 1OY8A 2VH7A 3I87A 3G71S 2F7VA 2NPFA 4B3SF 3FBCA 3EZ5A 3QBCA 5J2PA 1VIXA 4X4PA 2HFSA 4BHQA 1R0BG 3TAMA 3HZGA 2CNLB 3J7ZT 3N6NA 2M5YA 4OZ2A 3M8PA 3PNIA 2CA9A 2NLWA 4X66F 1JKHA 1VLOA 4C8NA 1B7FA 1U8SA 1E6YB 5HANA 3N28A 1XC9A 4ZVQB 1CEZA 2NPIA 3GSIA 5AXMA 3CJ8A 4MKYA 2QT7A 3BYPA 4OI4A 1NJZA 1EETB 4ZDNA 4I56A 3ENVA 2DNMA 1NK7A 2Z4PA 2ZH6A 2KXFA 1PKUA 4KKOB 4B3TF 1REGX 4K4UA 3H0PA 4ZVFA 2E44A 5ETNA 4YOEA 2DR5A 4PRFA 2HWTA 3VAJA 2RU9A 1HWJA 3NXZA 1NSKL 2OMLA 3PX0A 3UR0A 3LGHA 5KFGA 2K8GA 4L3KA 3IFEA 3LTOA 4HACB 3GCWP 4EFAC 1YK9A 3FKBA 2YKMB 2LXIA 1WC4A 5HVHA 1EARA 3LGNA 1SH0A 1FD8A 1N33J 2FJWA 2MJUA 1Y10A 1GMUA 5KFLA 4N8NA 3TVKA 2J7UA 2ZFHA 2C2DA 4TQSA 1W2BR 3GONA 1B64A 3DYAB 4I2PA 4HH0A 2ZDPA 3LF0A 1KQSR 2KH9A 3D6HB 1SV5B 1DLOA 1GX6A 2K7JA 2ZM6F 3BSAA 4K5RA 3SSSA 2HW3A 3AAWB 2VOPA 3CJRA 3OJUA 4CT9A 4CLPA 1T8EA 3W65A 2NXCA 3WIUA 3W9HA 2EG1A 4U7UD 3CJKB 4NWBA 1REVB 3EWGA 4X4NA 1M1KT 3NGDA 4PXEA 2DNYA 2D74B 3D7SB 3UD3P 4Q5VA 2GQ2A 3OHBA 4P72A 2XCPA 1HNWJ 2MB0B 3UQSA 2WAQD 2GFFA 4IRCA 2XB2D 2PN6A 2XBPA 3DRRA 3HJVA 4ZLNA 3GJQB 3CO9A 1B3TA 3BSOA 4DL0C 1YRXA 3H90A 1RT5B 1CQNA 2CQGA 2W7OA 5A8RA 1CC7A 2DGUA 1HYSA 4AFFA 1VQ6S 3M2RB 2ZBCA 2DR6A 2QLWA 1EKRA 2WSCC 1SL0A 1LW0A 3VV2B 5CABA 2FJXA 1DTTB 2R3VA 4KGMA 4KO0A 2CPZA 4DZ6A 1FO1A 2JFDA 3FRZA 1OWXA 1CJTB 1WTFA 2M3DA 1MMDA 1OSCA 2NUUG 3N6LA 4FKYA 1S1UA 1ELOA 1RHKB 2AYBA 1CQMA 3RAQA 3BGRA 1FWKA 1TL3B 3KMQA 1VC5A 3QO9B 1HQ2A 1LWCB 4YS2A 2KT5A 2V8PA 3H59A 2DNOA 4FYDA 4TYAA 2Q3PA 4O44B 4DR6F 4ECQA 2RQMA 3QT6A 2Z2ZA 1QJHA 1FX2A 1TAUA 3H2VE 4EEYA 3QATA 1K47A 3HXMA 3E2EA 1MNEA 2J76E 2ABYA 3ZZZA 1LV5A 2E5HA 2M4MA 2ZJPQ 1LFWA 2K06A 2FHMA 3LUYA 3H98A 3ILIA 3DI6A 4ZPCA 2VBZA 1LK7A 1JLBA 4KB7A 3M6WA 3QRPA 2RJZA 3R2DJ 3HCXA 3MD1A 4CO0A 3DM2A 1X4FA 3TJ8A 5HBMA 3DLBA 3Q83A 4UZBA 3PO4A 4MAKA 4XIUA 3MM6B 2IAJB 2UUWA 2U2FA 1Q0NA 1PGZA 2L9DA 3HVRA 3D66A 1SQFA 2DXDA 1PAUB 3JQJA 4WIIA 4I67A 1VR6A 4BLGA 4M5JA 1D09B 1Y9OA 4N7TA 1RKJA 3U1MA 4M1KA 1TP7A 4LSNB 2WVCA 3NP5A 1L3UA 3G6XA 5L46A 5KFUA 2FZKB 4PXDA 3I55S 2YH1A 2GJIA 4OI6A 4J9KA 2V2KA 3BV8A 4KGKA 1SCJB 2C28A 2G1DA 3TZZA 2R7WA 2EI5A 3BO2A 5D78A 4CLZA 3BS9A 2MLYA 3GQCA 4LF9F 2VV5A 2HIYA 1U02A 2IYGA 4JI6J 3SBMA 1XBWA 5D4OA 2XGPA 2VPZB 2CQ3A 4DX8H 4IFYA 1HI1A 2GW8A 2RF2B 1QAIA 2Z2YB 3DGPA 1S1XB 3N9UC 3F56A 1YIJS 1NK0A 1U6FA 2H4WB 2AJ2A 4L73A 3TUJC 2AJQA 1UJ6A 4U7CA 3OTCA 5JVHQ 2RS2A 1NDLA 3M8WA 4AL6A 4LF7J 4P2XA 3US5A 3FFIA 4MK9A 2DNKA 3KUEA 2GS8A 3ZZPA 1RT7B 1MWZA 1IBCB 3BN7A 2HRYA 4MT1A 4DPXA 1WKJA 3B82A 5D4LA 2H9ZA 4O4GA 1KSPA 4JBCA 4P52A 1R27B 2E5LF 3HHLC 1Y3JA 2FLPA 1IQZA 2MQLA 4ETXA 2AT1B 4OZJA 1RTZA 2IM3A 3ILJA 2JEIA 3KNAA 1FWLA 4ALZA 5KOWA 1OMSA 4FBTA 3FBBA 1JWWA 1X9WA 4NLWA 1KTVA 3PX6A 2ZJRQ 2F65A 2BZ2A 2W7PA 3MM7A 5DQHA 5D3GA 2AIRB 3HHEA 4I4BA 3KJVA 1DRZA 4LRAA 4NYZA 3FQKA 2MQOA 1NDCA 1FKOB 3OUYB 4NLRA 3D6MB 5KFXA 5CYMA 4F26A 1VLYA 2J7WA 5KG1A 2ZH2A 2LXUA 3C15A 4QCLA 1Y0HA 2CPYA 3AD7C 2HGNA 3DRSB 3ZXWA 3R1HA 4FDFA 1S1TB 1R7IA 2CJBA 2PMHA 4LMZA 4USMA 3N0VA 3QSYB 2E7WA 1Z2ZA 5F3ZA 1RLCL 2RQCA 1RAOA 3KLEB 3J81U 4F36A 4ECVA 4CO2A 2QLJB 4XTTA 1S99A 2ZH4A 3NGTA 5ITHA 1SKUB 4RWWA 2YQ1A 3CCUS 1S1VB 4JI2J 1FWPA 4WE1A 1B4SA 1M5PC 2ZBQA 2YY3A 4I68A 4EK2A 5KFRA 1KWMA 2DY9A 3GU0A 4M94A 3KHRA 1TKTA 1YDLA 4QQBA 3ULHA 4ENOA 4LSZB 1NDKA 5JVGQ 1N8RT 3HSJA 2H1YA 4MFBB 1HQUA 1RZMA 4P73A 4P10A 3A13A 3UVJB 3BGUA 3A4TA 2XS7A 1CJUB 4C8MA 5EWEA 3HX9A 2XY5A 2G1HA 1OYEA 1UVMA 4F2SA 4R5PB 3HI9A 1F3VA 4CH0S 2GVZA 2QLBB 1XQIA 2HG4A 1WDTA 2DNLA 3I5AA 3Q22A 1N0VC 3QIPB 2BQUA 1TL7A 3NY0A 4MIBA 3DRPA 4ECZA 1X5TA 3IRWP 1O6XA 1NK8A 2QC3A 4DFPA 4L74A 1MROB 1PJ6A 5I3PA 3VR1A 3O3LA 3DOMA 1RT3A 5GAHU 2FB0A 2ASJA 1U1QA 3MUTP 1CS4A 2PMWA 1URRA 1RGVA 2ZC3A 4Q44A 3HP6A 2CG8A 1F60B 5B0AA 2ZE2A 2B9WA 4FYVB 3RG6A 3M6UA 1VJWA 5CQGA 4RW4A 2FVPA 1Q8BA 3EJMA 2JEFA 5E3PA 3CCQS 3DLEA 2HNDA 4FYWB 2U1AA 3ISND 4JI2F 3TX8A 5D8HB 3VGVA 5C42B 4RNFA 2OGUA 1XR5A 5C2CA 5JXSA 2R8IA 2KYXA 1Q4RA 4URQU 4UOFA 2WB4A 3M05A 3VWSA 1RBOB 2JVOA 2CZ4A 1RT1B 3O5TB 2FC9A 1N52B 1XR7A 1BY9A 2C2EA 2VFSA 4B9SA 1MW7A 1SJQA 1T03A 1RHRB 3I82A 5EHHA 2JHEA 5DG7A 2CQCA 2Z8QA 2ZWPA 1UW4A 2NXUA 2ZHAA 3PKYA 3V5RA 4JYAJ 3KJQB 5C5JA 4O3RA 1A9NB 4ZVEA 4Q43A 2C3MA 2GIFA 2VZ9A 1TU0B 4OX6A 1SC4B 2VJVA 4LSLA 3KOAA 1WEZA 2DO4A 5AE3A 2DYAA 2FUG9 4P75A 4WP9A 3P45B 3CCLS 3WIVA 3RGIA 3EVMA 5KFVA 3I0SA 1NJYA 1AW0A 2J9DE 1NSPA 3SQGB 2F3JA 4S0MA 3QQCD 1L3TA 5AJ3J 1XR6A 3IS9A 1SL1A 4NEYA 4C11B 4M5DA 1YVFA 4I1TA 2BKNA 4Y34A 3NNHA 2CNOB 4CO1A 4DQIA 1WSVA 3OTOJ 2AJFE 2RUSA 1RAEB 4FVMA 4P6QA 5HMYA 1O51A 1Q16B 5JMNA 1M5OC 1SC6A 3H5SA 1TQLA 4OHZA 4WXWA 5KT3A 3GP9A 2FJEB 3EGWB 2LYVA 3PEJA 2XZWA 4RNNA 1NB7A 1MG7A 3EGVA 1TAQA 3HVWA 2V50A 2DPJA 5KG0A 1OPIA 2EBGA 3KK1A 3T1YF 1IWGA 4CM0A 2XS2A 3LPYA 2PSZA 2DGQA 4DV0J 2D3UA 1K44A 2WSEC 4QYRA 4H4MA 5KTQA 5F8MA 4JYAF 2YPZA 2DH8A 2HQDA 1N5VA 2AYGA 2VG7B 3C6UB 3H2LA 1Q1KA 3PRVA 4OZ5A 1H2TZ 4C0BA 1S97A 1JLQB 4ZIVA 2HQ3A 3EVOA 5JJBA 2R2RA 3T3FA 3IP0A 3S6EA 2KHDA 1JJCB 4MYTA 4B3MJ 4DUYJ 2HVZA 1KR4A 3P5BP 4HKQA 2EKYA 2FGOA 3N4WA 1TKZA 4F2RA 1GNKA 2V5HG 3PRDA 3IR6B 2VPXB 5SZTA 1VGYA 2N4DA 1FRHA 1X60A 1XMBA 5LXYA 1GT8A 2F40A 2HQCA 4UOCA 1VBKA 4ILRA 5B7WA 5CCLA 2LQ9A 2K1RA 4NA1A 2IPOB 3VHQA 3OTOF 3W3SA 1OO0B 2J9CA 1UA0A 1QVFR 2RDJA 2YWKA 2CPJA 2QMWA 4ZCMA 1U1LA 2WONA 4CLWA 2MHEA 2JEJA 5J2PB 2W8KA 3J80U 3W5XA 1WC6A 4U7UK 4ZVTB 1HNVA 3TAMB 3RB0A 3IAM9 4MH8A 5HMXA 1FCAA 3M8PB 3ZZRA 3M9MB 3NCRA 1F3FA 2C2RA 5HVGA 4DR3F 3IM9A 2QV6A 2WOMA 2MKHA 5KFCA 3RR7A 2VOOA 4F02A 1BXNA 3H7HB 5HP1B 2HHVA 2KG0A 2C2ZB 3K58A 4OLOA 2R7TA 4DX5A 3FCHA 4DL3A 1L5UA 3BSCA 4I6WA 4ZP8A 5JUMA 2Q79A 2GMHA 1S12A 3LPEA 4LVOP 4Y3CA 4C0HA 4WTYA 3OR1A 1X4BA 4B3MF 3PKMA 2NXNA 1IUJA 1R8HA 4ZPAA 3CMES 1RABB 2DY1A 1KVKA 2KT3A 4EZ6A 3OL8A 3UE2A 3OFGA 4N76A 3CULA 3VCDA 5IV3A 1WEYA 3A3PB 2HNZA 1NPRA 3QWUA 2Y8WA 5FLXY 2HZAA 4CT8A 2NR0A 3GTYX 5KFPA 3ZTOA 5F8NA 2B4VA 2LKZA 2YNFB 1NK5A 5IM0A 3HSZA 3Q8SB 4P2FA 2RD5C 4DV7F 1XEZA 2DTJA 2OSRA 3CCRS 4NL5A 3UDEA 4MKAA 4KGZB 3QZ7A 3HPOA 1YITS 5F0UA 2D1CA 3QJJA 3MR2A 3MR7A 1GX5A 3MHYA 2GMLA 1UZDA 2V8VA 3CEDA 4U6PA 1MU2A 1H98A 3UNGC 4GC6A 1FJCA 3GG1A 2QYGA 4DF4A 2Z2LA 2BMBA 2IRXA 4X4VA 3CDUA 4JI8J 1XJWB 3I9V9 3DRXA 5L39A 2DXFA 2BE7D 3KJFB 3J7AN 2GGPA 1S49A 1D1UA 2N3LA 3DRRB 4KSEB 1B0TA 2FJBB 2YPYA 3KLHA 2OLWA 2M0GB 3UDLA 1IR0A 3PRBA 2Y0SD 5A8RB 3Q23A 3OFFA 1QSSA 2KVIA 3IBWA 1FRJA 1U49A 4UW2A 3A8IA 4CH1A 2Y1IA 3FVYA 3NGRA 1UVNA 2VKRA 1LW0B 1WACA 4PCQA 1C1BA 3L4BC 1GXUA 2XS5A 1QDUB 5J1EA 1S6QA 3D0GE 4HL9A 3KLFA 3SXLA 2V63A 2KI2A 4NASA 3AD8C 3D1QA 5BR8J 1VC0A 1RT4B 1HKAA 2MJNA 4I0WA 4KFBB 3GIJA 1NMEB 1AROP 1FRLA 1U1KA 3BGRB 2FTRA 3VVUA 4HLBA 2YX4A 3MF5A 5A2QY 3JS9A 4M5NA 2JH3A 1FKAF 4OZ3A 3O2IA 1TKXB 4IRDA 4DG1A 4UTGA 4ZVUB 5L1JA 1GQEA 1VOMA 4MIAA 3THPA 1UEKA 4DF8A 4A8XA 1CULA 2RNEA 3F41A 2IDLA 1NH8A 1YJWS 3FEYB 4EWTA 5DDRC 3DI6B 1IN0A 1N0UA 3DDIA 2R42A 2I5JB 3I0RA 5DRKA 1UA1A 1JLBB 2XMMA 4E2FB 4QWEA 4K5SA 4ZJQA 2A6OA 3D28A 1QE1B 3JQKA 3DM2B 1LK5A 3C14B 2KYZA 3R1LA 5HBMB 1FDAA 4TU9A 1CJKA 1C0TA 4GKJJ 1BQNA 4F3MA 2CQIA 4DS5A 2WTFA 3V4MA 2I1RA 2UUTA 4IH6A 2O01C 5LM7E 3Q2SC 4CH7A 2R2SA 4YP3A 2W4DA 1IJEB 1HMVA 4ID5A 2GQCA 1F2HA 2DCLA 2OPRA 3RJMB 4ELUA 1TL1A 3EXYA 1F0XA 4ES3A 1F6TA 2LCWA 1HHSA 1LOUA 1S0NA 2WBMA 3HT3A 3CD0A 3CT9A 5KFSA 1WC0A 4ED0A 4QIGA 4CLSA 3M8QA 4J9RA 1EB0A 1L3VA 3MMCA 4YN3B 3OVSA 1MMNA 3BF4A 1VBYA 2GVDA 3LGMA 4DV3J 3Q0AA 4CLYA 1IM4A 3TANA 3UI3A 3LH2S 5HI7A 1MWQA 1R8BA 3AOBA 3CUNA 2VASA 4OJGA 2O3DA 4NLVA 3R8YA 4IFYB 3DGPB 2Y1LB 3I5BA 4P7TA 4ZN1A 2YNHA 1FXLA 2BJ7A 1T9XA 4Q8FA 4EYHB 1UZHA 2K2PA 2B43A 2VQFJ 3JSYA 4DFMA 5KG2A 3FQLA 4Y0FA 5EUHA 1NPPA 1FRXA 2E9ZA 1G1XA 4U9RA 3HULA 3FFIB 2Q43A 3CJ2A 4PQUA 3S1TA 3PJ9A 3J81j 5E33A 2AJ1A 1D9DA 4CLUA 1S6UA 1DARA 2DO0A 3P5TL 5E2QA 3GG0A 5K5MA 2X3GA 4RW7B 4F4AA 2YNIA 4GKJF 3R6LB 3IBCB 1U25A 4LR9A 5THWA 4ZCIA 1PYOB 5FD1A 1KFDA 2B9YA 3ZTQA 1N54B 7FD1A 4I2QB 2VBYA 1G7CB 2EKNA 1ZM3A 1FRKA 1VBXA 4OJHA 2V68A 5GMEA 1VRQC 1JB0C 1PIEA 4RBVA 2QTWA 1ZETA 3AOAA 1KOHA 1IR1A 3UW1A 4CLFA 5DDPC 1AUSL 5D3GB 3TRGA 3BQ1A 2LQJA 3KJVB 3QLHA 2BKPA 1VBZA 1IXKA 3JTOA 4Y2IA 4WPAA 4LREA 3MUVP 4DV3F 3PR5B 3W2WB 2M88A 2CG4A 4RPFA 2MLXA 1I51B 3SV3A 5HROB 2V34A 2XLKA 5A6PA 3MFHA 2F1FA 1FVSA 1CPZA 3POTA 3GE9A 4ZHRB 2BRKA 4YB7A 2M70A 2ZHOA 2MQNA 2DGTA 2AGOA 5G0RA 3IWLA 1RP5A 4DN9A 4NXNF 4M63A 3M2UA 3LQVA 5ETQA 3TA2A 3T6BA 1D8ZA 1WKLA 1FK9B 4ZLLA 2VQFF 2ZH5A 1U1RA 2VC0A 1R3NA 1TL4A 3HHLD 4Q0BB 3UN2A 3CCZA 3KYLA 2KT2A 3WX8A 5B0GA 3D9BA 1V6HA 1KHVA 3VQTA 4CLKA 2R2TA 2A6MA 4KC5A 4DPUA 2CZ9A 3CXCR 2MTLA 2A10A 2XMAA 3PJXA 4CP5A 2OEMA 1NUEA 2VQEJ 1OY6A 2CZVC 2GNKA 4Y2KA 3DYAA 2BA9A 5KFBA 2CJQA 4DMZA 4TY8B 5KFDA 2VBXA 3D6FB 2MKCA 5B09A 5ETVA 1TKTB 3AY0A 5DG8A 3CJ0A 3RB4A 3M8YA 2ASLA 3M9NB 3U27A 1LWEA 2QL9B 3PJWA 1HQUB 1A7GE 2V8GA 4EBEA 1Y5IB 1KRPA 1KHWA 1IWAA 2MZJA 3CJKA 4DEZA 2M7SA 2MY7A 2PEBA 1REVA 2RT3A 1PAEX 2C3UA 3MCOA 3CDBA 1T05A 3MCNA 4O3SA 2GVZB 1TFWA 4JV5F 3CJ4A 1IBKJ 1FFWB 2DNZA 1C1CB 5M2RA 3NAHA 3BN4A 3DRPB 1FXDA 1RT5A 2VUGA 4OMFG 4ELVA 3HO1A 2XI2A 1B0PA 1F9HA 3K89A 5BYQA 4YMEA 4X4TA 2FDNA 5E7OB 3RB6A 1RT3B 3ENWA 2ZDOA 2RIJA 1GXLA 2ZBPA 5DJBA 1CS4B 2ZZNA 1SKRA 4I69A 4NYPA 3I4HX 1QD1A 2D69A 4K4VA 2ZUAA 2C3YA 2COLA 5J2NA 2RILA 4RW4B 1XN9A 2ZC4A 1CJTA 1DBDA 1ZBTA 3DLEB 2HNDB 3KJNB 4LJMA 4KHRA 2VG6B 5KFQA 4F0HA 2VQEF 4QR2A 3OHAA 3T1HF 3EDQB 2XCAA 5KFMA 2WB1D 4USUA 1LWCA 4OHYA 2KM8B 3U02A 4C8OA 3DLJA 2D9PA 1TK0A 1X0PA 4OZ0A 2B9EA 3FCWA 4LQ9A 2RUGA 1WEXA 1T03B 1RCOB 2RQ4A 1L3SA 4AT1B 3L95X 1YWXA 1P1TA 2EK1A 3C6TA 4N77A 1EJ7L 1NRKA 4ZPDA 2VDIA 4JP8A 2E5JA 1RWPB 2QLXA 1QM9A 1IBKF 3H8YA 2KN4A 5T41A 3JYTB 1SJRA 3PCOB 1IKXA 2BJ8A 4CCHA 4PXCA 5H1SV 1SJFA 1TZ0A 1PO6A 4LFBJ 3D67A 1X9SA 4E0DA 4LSLB 1K9MT 9ATCB 3MM6A 2FHOB 2OEKA 1JLCB 2YWHA 1JXLA 2FQQB 2H65B 4X64J 2P6TA 3VVTA 4ZN3A 4ZMMA 2J6SA 3HVAA 1HNXJ 1S0OA 1ZZNA 4GC7A 2AGQA 2OPQA 3HF5A 2JDJA 4QWCA 4M5DB 4KRWA 2BW2A 4JI5J 5LMNJ 4A8QA 3MPYA 3BR9A 3SSRA 2UUCF 3HSGA 4ATNA 5AXKA 1EZZB 4JB8B 4N47A 2KHCA 3NCPA 2J0WA 1Q95G 2FYXA 7FDRA 1VQOS 4OIXA 2Z58B 3VAIA 1TK8A 4C3LA 2IIHA 3T9NA 2UUBF 2FLNA 1LXJA 2IRUA 1JNZB 2ALYB 5ETPA 4K0KF 1EHWA 1S1XA 3TVZA 2ATCB 1RE1B 3EGNA 2FIUA 2O66A 1IKWB 1RT2A 2Z30B 1FEHA 4YY3J 4DQQA 4FS1A 5C25B 4J9OA 1HI8A 1YGYA 2NCKL 1TFYA 4H4MB 4JI0J 1RHUB 4M5HA 1TUGB 4B17A 3GYGA 1V5VA 1Y5NB 2GO8A 1DY3A 1UKUA 3ADAC 5KAKA 2KB2A 3KDOA 4LFBF 2DH7A 4ED8A 2VF3A 1SUQB 1XNRJ 2AU0A 2LEPA 2RRAA 1RU1A 2OEJA 3VGSA 3KHGA 1FJ7A 4AXIA 3UD5A 3TZYA 1HNXF 1RT6A 1KQGB 3WC2A 4W92B 2YTCA 3R7BB 3VGTA 5LMNF 1VQSA 3G8QA 3E51A 4G1PA 2K1RB 2G4BA 1SKSA 2GAHC 2YKPA 1R6VA 4CLTA 2HQFA 4ZVHA 2MEWA 1Y11A 2HGMA 4LRBA 5ETOA 3AQPA 3OUYA 2W2QP 3R5CA 2DGXA 3ET6B 2EG2A 3IWNC 1KDNA 1HNVB 4R8UA 4DLEA 5KFHA 3ETMA 1S1TA 4MK7A 3IC1A 4YY3F 4F0MA 3DHXA 1FX4A 4YDXA 4BWJA 3PG9A 3FEZA 2XZDB 5HN0A 3CTRA 5AXLA 3SYZA 1X9MA 5K20B 3KHLA 4C7QA 2H51B 2H3EB 2HFUA 4DCJB 3M9OB 5BYRA 4CLLA 2BDPA 4KV8A 3BKTA 2X51A 4IDKA 2KFYA 4TU8A 3HFVA 1HBNB 1XNRF 1S1VA 4DCOB 1PILA 1FE4A 3OR1B 2SXLA 1R89A 4NLXA 5LMUJ 2QG9B 4OJ1A 1HBMA 1NK4A 3NAIA 3IBFB 3UDVA 3BPSP 2YKAA 4MFBA 4OV1A 2K7KA 4CI0B 1DHMA 1BC6A 4AYBD 3UVJA 2PFDA 1CLFA 2DCUB 4NRUA 5LOQA 2DNPA 4OYOA 3K2YA 1RDRA 2QA2A 5L9XA 3K5NA 5IM0B 2XSJA 3LAMA 2VA3A 2ZD1B 1T11A 4AE5A 4R5PA 4I6YA 1FKPB 1EIYB 1HW8A 1YJ9S 4JI4J 4YHHJ 2OO4A 3THTA 3QIPA 1N5SA 2E9RX 4IO9Q 5GMKa 2PD1A 4QOTA 1RWMB 1YRTA 1RACB 3E01A 2CADA 1RBLA 3QAEA 4ZVRB 4NLSA 1H7WA 1WG1A 4BBYA 5ETKA 4Y6IA 2BABA 5AT1B 1MMLA 3QSIA 2NQPA 3KUHA 3H5UA 2GGPB 2P9CA 2MHNA 2LMIA 3CDAA 2H4YB 2XMVA 5I3UB 2RKIB 2IVMA 3PACA 3KLHB 5LMUF 1ZH5A 4J9NA 3HHDA 2Q66A 1Q5YA 1YHQS 2VONA 2ROPA 2AEFA 1M5VC 1T9TA 3TUIC 1ZAVA 3MCMA 4DSFA 2ADBA 1C1BB 3A3OB 4N8OA 4IOCQ 5J1EB 1TL5A 1HNIB 3RAMA 2PE8A 3TA0A 3JTNA 3F73A 4FF3A 1RWWB 1IBMJ 2CQPA 1NB2A 1ZTWA 3MZIA 2LA4A 1ZTTA 6FDRA 1Q86T 1DURA 2ZITA 4X2BA 2Y8YA 2B5JB 1WHWA 3OL9A 3P96A 4DR4J 4OL8A 2BOPA 1YBTA 3GPAA 3LWMA 5DLFA 4FN5A 4FPRA 3TEHB 3D68A 2UVVA 2ZZTA 1PJ7A 4NI2B 2FJDB 3IM8A 3JSBA 4DV1F 2XLIA 3OFHA 2MYFA 3CW2C 3CIMA 1WG5A 2KM8C 3QT5A 3RBDA 2CPHA 1JK9B 1T3NA 3SQOP 1KLMB 1FJEB 2X1BA 4H4KC 2POKA 2QRRA 2V2QA 5E3AA 3FSYA 3I0RB 3NL0A 4RL1A 2XZTB 2PIIA 5A8KA 4DR2F 2A3JA 2ZBRA 2I0XA 1U0SA 1S6PB 1VS3A 4UY85 2QSFA 2AEJA 1ZAXA 1CJKB 1C0TB 2NZCA 3AJ1A 1BQNB 1ZS6A 4L75A 1GMWA 3V6DB 2HLUA 2HHPA 4LUBA 4O4RA 5CYQB 2DRAA 2VFUA 2BQ3A 2XG8A 2DEJA 1UJ5A 4HI2A 2CKWA 2FVQA 1HMVB 4X66J 1FFSB 4PQAA 4YDDB 2OIHA 1TL1B 2AW0A 4O3NA 4ZPBA 2VBWA 3PYGA 3HHNB 1HHTP 1S4FA 3L9ZA 1Q7YT 3S8SA 3EGZA 2UP1A 1V3RA 3M8QB 3M1VB 2VG7A 2M9KA 3C6UA 2EC2A 4A8WA 3V6KA 3K5OA 3S01A 4IG0A 2KFNA 4NA2A 5M2UA 5EX0A 3R5AA 3JTPA 4DR4F 3FJ2A 2I6WA 1JLQA 1ZA1B 2J5AA 2ILZA 3EX7B 2I9SA 1QAXA 1BQMB 3UCGA 3R7SB 1UWAA 2QA1A 2W2NP 2XI3A 1S9FA 4LBIA 2HHTA 4DPWA 2W2OP 2ADCA 1U2CA 4LF5J 2K3KA 4Y00A 5A8WB 1DTQA 3M2VB 4WKYA 5CXTA 4PQUB 3AXKA 2DNNA 5IOLA 3KK2B 1QUVA 3H42A 5CZXA 4UF4A 2XHCA 5G4DA 3QFHA 4N5SA 3SV4A 4QR0A 1U48A 1NBEB 1HI0P 2YNIB 2OPSB 1RBAA 4MKVA 2B6AB 1YG0A 1OS5A 3QFWA 4Z2XA 3MMAB 2YH0A 4ECTA 1U1PA 4X84A 2CXEA 3VGUA 3TA1A 2ZM6J 1WJ9A 5ETLA 2ACYA 4V19J 2EEYA 2C22A 3U1LA 1T0TV 3MWBA 3ZO7A 3CF5Q 3LOUA 5E3CA 1PBAA 5IV4A 2JLEA 5HP1A 4X65J 2ZH3A 3B8HA 4DQPA 2MDAA 1KNZA 2JX2A 3QLHB 2CQ1A 4NCAA 2PFFB 4DV6J 2C3OA 1XIQA 1QTNB 1NO8A 1NKCA 1OQ6A 3Q8UA 4AQYF 5CD4H 2OP5A 2ZNZA 4LF4F 2B4PA 3NKYA 1Y00A 1RTHB 3POTB 1GMWD 4NRTA 1I1GA 5LSLA 4CIOA 4YR2A 2HHQA 3R6GB 5G0RB 5CCMA 1RA6A 4J37A 4IOAQ 3M2UB 1HWIA 3O8WA 2PC6A 4J9SA 4LF5F 1C4AA 4A47A 5HLFA 3W8GA 2R4FA 5EDWA 2GQQA 4EO6A 2YNFA 4KYZA 3HJFA 4CWBA 1PYTA 4WFAQ 3FUYA 5DQGA 3V81B 2M8DB 2AKWB 4PG5A 4RUAA 3X1LB 4AD6A 4FF4A 3OLBA 4PUOA 1JQGA 1M5SA 3LP0B 2IDEA 3GV8B 2DT9A 3HDSA 4P71A 3W63A 4DR6J 4O23A 2KKHA 3P6YC 4C8ZA 1LWEB 3PVXA 5KFYA 1GK8A 5T14A 2UXBJ 2G2ZA 5LJ5Y 3F0NA 3ZZTA 3M4XA 3M8ZA 5KG3A 2HAIA 4USIA 4WU3A 4CTAB 1Q7LB 2BE2B 5HQMA 5IFMA 4MMOA 2ZHBA 4XDDA 4X65F 1N34J 5F9NA 1BD6A 2DRBA 2CYYA 4ED4A 1EQ0A 1HBUB 1LNQA 2MKKA 2FZCB 4DV6F 3MR5A 4NZ0A 2HK3A 1T05B 4YR3A 5D0GA 2YKNA 5ETSA 4DV2J 2MKIA 2O67A 4IFVB 3TJAA 3VF0B 3QRRA 2RU3A 1T94A 3PV8A 4OX9J 1YBUA 1Z1ZA 3G2XA 2YNGB 3UD4P 2DHSA 4U8YA 1Q79A 3ICLA 3KLGA 1I94F 2HS3A 4F4KA 3BBFA 2ZOFA 3PDNA 3AXMA 3C16B 3MEEB 1PJ5A 1GFWB 1U6BA 4KQZA 1RTDA 1NCLA 1J5EJ 5KFFA 2HAFA 2AX1A 2AV5A 4DSLA 5J2NB 3CDEA 2KJVA 4TKTA 4CDIA 4LRFA 4Q2LA 4ZIWA 4NOHA 3K0JA 1IQTA 4K2JA 1RT4A 1X4AA 3FZBA 3TAPA 4RUBA 1UCNA 4Y65A 4YB5A 4KFBA 3JSMB 3W2VB 2F4FA 1GTEA 4LF9J 1OYDA 5B0CA 4USKA 3MXHP 3KDNA 1U8WA 2AHOB 2PEHA 4IR1A 3MPDA 5F9LA 3GIRA 2LQ5A 1Z2LA 1T9YA 2E5GA 4ZPWR 1VQ5S 1R43A 2UXBF 2JL9A 2HVHA 2KJWA 3MECB 2DNHA 1TKXA 3PYFA 5B0DA 5IT9Y 1RKIA 2W25A 1F1BB 1VHFA 1N34F 2MKYA 1KD1T 3THVA 2R7SA 3C6TB 2IVFB 1P6TA 4WWSA 4KH0B 5FDLB 5GMDA 4CNZA 4E98A 1X4HA 1RAIB 2I5JA 1S1WB 1H73A 5HQ8A 2HFOA 1V3ZA 4DV2F 3NGUA 1H2VZ 1QE1A 3GIIA 3MAHA 4HTJA 2E9TA 1IKXB 5B08A 3C14A 4DS4A 2Z0GA 4OX9F 4JI7J 3SMZA 2E5LJ 5CA5A 2CQBA 4QIVA 2AJ0A 1FRIA 3X3UA 3BO4A 1J5EF 3OJSA 3QAUA 4J9UE 1FNMA 1RA7A 2R7QA 3TZWA 2HHXA 2OPQB 1H2UX 1UVIA 4B08A 3BSNA 2VJUA 2HFVA 2UUAJ 5H9FK 2WVDA 4MTPA 3S7RA 1M0SA 1SKWA 4DSKA 1NHUA 3U1NA 3KWMA 5IC4B 3FSXA 1WHXA 2WK4A 4CRJA 2XSFA 5HL7Q 4EUVA 1SB6A 3NCQA 4EGLA 1YJRA 4NPOA 4L6V3 3T5JA 2ZEJA 4Y2CA 4DOZA 4CQ1A 4J91A 2BRLA 1RT2B 1YJUA 4NLTA 1WSRA 4NX9A 2XNQA 3EVWA 3PEHA 4UOHA 4YEAA 2YQ3A 1FHTA 1HIYA 2RMLA 2KL8A 3L09A 1UAWA 3SSQA 2PT0A 2CVIA 2Z2MA 4C3MA 2RAQA 3W60A 1BWEA 2Q1LA 2F8MA 1ICEB 3C46A 1SL2A 4JI7F 4FYYB 2IBKA 4L76A 4R0JA 4RW7A 3ONQA 4X4QA 3ETOA 5H9FJ 3QGHA 4Q2MA 2L41A 2RVJA 2DH9A 4PPDA 1S7IA 4D3HA 4QR1A 4X62F 4I2QA 1SJ4P 1DAXA 1JLFB 1SI9A 4DZDA 1S9EB 3QGIA 4ZJOA 4PAAA 1HPZA 5A6WA 2GO9A 4OYMA 1RT6B 1RAJA 2ZH1A 2GIRA 2ILYA 5E5NA 4OX8A 2YXLA 4C2MA 2UUAF 1I6JA 3KKFA 3C8YA 3CPWR 4K4ZA 1UJ4A 3DDNA 2PDAA 1PCAA 2CNNB 3IA0A 3CC2S 3W2WA 2XYHB 4OHVA 3LO3A 4GVBA 3TR5A 5KOXA 2ERRA 2GJFA 5KT5A 5HROA 1NZ8A 4A48A 3VAFA 3RBEA 4ZHRA 4R8UB 3AHPA 2FLOA 1GH8A 4OYIA 4RW8A 5FLXU 5GAHI 3EXCX 5E0OA 4FBUA 1VI7A 3IGVA 1FA0A 2W2PP 3CWJA 2J7KA 1FK9A 3IMQJ 3CCWA 3TI0A 4WIQA 2CPEA 3I31A 1SBRA 4LFCJ 1LKZA 2OI2A 4Q0BA 3FBEA 4ZLJA 4P2SA 3RW6A 2G13A 3GSDA 3EZUA 5KFJA 2MGZA 4PWUA 1VQPS 1NZAA 4JI3F 1RTIB 3SCKE 2ZBIA 3RRHA 2QYCA 5EGYA 3CCSS 4IUFA 2C2OB 2QFIA 2BUNA 2HRUA 4IH5A 4KV8B 4IDKB 4PYAA 2HVIA 3T5HA 4XPCA 1UFWA 5B0FA 3A1YG 4F04B 4TY8A 3HMJG 2F4VJ 1HBMB 4Y2MA 2MZ1A 1GXTA 2HQIA 5IT0A 5D4NA 2JNJA 3D0HE 1HFEL 4B3OB 5A0YB 5IC6B 4EZ9A 1N32F 3W62A 3JXOA 1ZAWA 2XSJB 3MFIA 1SJ3P 4RU2A 2MQ8A 2XGQA 5U47A 2NREA 3TP2A 3PHEA 1X4GA 1NHKL 4ECSA 4DR5J 4FNIA 3A12A 2J0QD 3BH7B 1C1CA 2XHWA 1IM6A 5K8OA 4MIWA 1BUXA 2EFOA 1RISA 1NJIT 4U8VA 3J7YU 1S4EA 3OL6A 2WRMA 3D3CJ 5GAEU 3E01B 1MN9A 1SC1B 2UVRA 3TQ1A 2VA2A 5BJRA 4C48A 2CPXA 5KG6A 3BKFA 2FLLA 2UZAA 3DFEA 4ECXA 1IKYA 4B9VA 4LFCF 3JAMU 1BWVA 4RU9A 1KP6A 2G0CA 2OJ3A 1ZOTA 4J9VA 1D3WA 2XYPB 5J1PA 1N5YB 1S76D 1RTJA 1N36F 2CAJA 2J9EA 1JLAA 1UW9A 2R7XA 4WFYA 2VG6A 1P27B 5A2QU 3N5BA 4LF1A 4EU0A 1WWHA 1E6VB 1F2GA 1U0HA 2F9JA 2R2UA 4B9NA 3L7PA 4DJBA 2EFQA 3BBCA 2F4VF 1ZM9A 4H4KA 1RJJA 4YB1P 1MSWD 2LP4A 5E41A 5DM7Q 2ACMA 3MPWA 1NM2A 2FY8A 3U7JA 5KFKA 1JLGB 1VRTB 1R8PA 3EICA 4U95A 3D6TB 2HFZA 3T1YJ 1CSJA 1JIHA 3RYLA 1LEOA 2N4CA 1IJFB 3NWRA 1RWXB 2AX0A 3R2CJ 2XY7A 1ZPVA 1FRMA 5K8NA 4A8YA 3I32A 4DR5F 4OI2A 3AJ2A 3JYTA 4N41A 2CJAA 5LSRA 2GCFA 2V67A 4I64A 3HSDA 4C8LA 1W25A 3B78A 3BEGB 1JLCA 2JC0A 4UOGA 2YKQA 2C2KB 2V4QA 4HDHA 4ED3A 4NLUA 2RHQB 4QZVB 1ZYQA 3SIPB 2LU2A 2DHXA 1HLWA 3DOKB 2ALZA 2VFVA 1JNRB 3NS7B 5L38A 2QJ3A 1NXIA 4P74A 4JV0A 1HW9A 4QIEA 1KLNA 4PR6A 2ZUGA 1X5OA 1TTHB 1CBKA 2O5DA 2GAGC 3CSKA 5DO2A 4ECWA 4Z7YA 3I56S 4DCPB 3CD5A 5L1IA 5A8KB 3PFEA 1SQGA 2XMTA 3KLVA 1U26A 2XULA 3O6QA 2MKSA 3VALA 2ZKUA 3DXBA 3R9LA 4F67A 1EP4A 3G6VA 2J9DA 2HHUA 1V3SA 3EM1A 4AXJA 4CM2A 4O0IA 1GTHA 2CJXB 1IKWA 2DIVA 1UFKA 1JLEB 2XTJP 2YVSA 5C25A 4QU7A 4HVZA 4DSEA 2N3OA 3H4DA 1U47A 4DR3J 5SUHA 1FEEA 3HFKA 1APSA 2VC1A 3CCMS 4ANDA 5KFEA 4HHUA 5E3RA 3SFGA 4DFKA 3MAAA 2HEKA 1VYAA 3MMBA 4UQTA 1WI6A 1H74A 1A6LA 2Y1RI 4Y2AA 4NXMF 5B0EA 3RBXA 4WKRA 3K8VA 4IG0B 3VAHA 4DR1F 4J9PA 2BXJA 1QSLA 3D3BJ 4EYIB 1SUQA 2W01A 2B8PA 2LDYA 4TN2A 4DL2A 4J90A 4OZLA 3CVKA 1ITPA 2FPHX 1UWBA 3D4JA 2BE9B 2V2VA 5F8GA 2HLTA 4J5OA 1IBLJ 2B7BB 1LWXA 2FY1A 4GO7X 3W8PA 1VIOA 2YX1A 3WDOA 3PW5A 2HKEA 1DTQB 5EN1A 2XQCA 2D3O1 2HNYB 4NZ7A 3Q89A 2KDOA 4WTOB 4J9MA 2UV8A 3HKWA 2CPIA 3T1AA 4HT5A 4ZK7M 4DV7J 4DU8A 2X1AA 1N88A 2F8HA 2OAUA 3WBZA 2R8HA 3MDFA 3ET6A 1U1NA 1OIAA 1VJQA 2CIMA 2HMIB 1OPZA 2K3IA 1HR0J 2BACA 1OSDA 5DS7A 2AF6A 2RDDA 2KU7A 5KFWA 1WG4A 2KO1A 4JV2A 4OX7A 4QBUA 1NU4A 1J2VA 3GIKA 4YQWA 5KT2A 3C66A 3MD3A 2OELA 3MEDB 1G3OA 3HVTA 3CJQA 2UXCJ 4ZP6A 4P9SA 2WVFA 5C2GA 2ZVIA 2JFKA 4FKXA 4PPZA 3OSNA 3SCJE 1FXRA 5T7LA 1FNXH 2LDIA 3MTKA 3ITHA 2GHPA 4OFZA 2NXJA 2L08A 2N7CA 4QU6A 4K59A 8ATCB 1N4LA 1NAQA 2C42A 1HBNA 5C7PA 3RU0A 3EPGA 2WVBA 2CUYA 3DXSX 4A46A 1DQAA 1IBLF 3QT7A 2QL7B 1WKKA 3IG1A 4C4WA 3IO1A 1WELA 1P9QC 3W5ZA 4NCGB 4ZVGA 3FEXB 4M5GA 4H4OB 1BQXA 3F44A 2CJYB 2F5GA 5HLFB 2B4OA 1EQMA 2FZGB 3OXFA 2KTQA 2ZD1A 3W9JA 2BJEA 3LP1B 1WF1A 1NKEA 5HK4A 1FE0A 3QRQA 3B54A 3UCUP 1FKPA 2WBRA 2OD6A 2AD9A 2J0XA 5KG4A 3MAQA 4LBHA 2VDHA 5BXIA 3AODA 5MAOA 3CCES 4PUOB 1HR0F 2JWNA 3WHIA 2DGVA 1WD6A 4LR7A 3D5MA 3WZ0A 2IVYA 4PG8A 3HZEA 1RWNB 1U09A 1FI4A 3CD7A 2B3TB 2PMZD 2PI4A 3RTVA 2UXCF 1YX2A 2A2CA 4WZQA 2HBRB 3W64A 4DSJA 1Q5VA 1U1MA 2GMJA 4ES1A 4F7VA 4OV6A 1U7LA 3DRYA 3CCJS 4NMXA 1R0AB 2ASDA 3BDEA 4HR2A 4DX7A 3LALA 2IJFA 2YKNB 3M30B 3CNQP 3MEGB 2ZOGA 1QLNA 5I3UA 2RKIA 1PC4A 1UVKA 1T7PA 4DUTA 4DUZJ 1RYSA 3RB3A 3GLJA 3KLGB 1H7XA 1FDDA 1S0MA 1TKDA 3EMTA 4WFBQ 2CRLA 1VK3A 4Q8EA 1RTDB 1N33F 5FIIA 3SZ2A 1ZM2A 5RUBA 4TY9A 1CC8A 5DLGA 4WP8A 1HNIA 3UCZP 5ETMA 3FMWA 2XEXA 5HAOA 4HH1A 3BGLA 2WZ1A 2M2BA 2W9CA 4ZLPA 4ZITA 4MK8A 2X3DA 4PZVA 1FNOA 4M5IA 1KONA 2AJ4A 4MKBA 4AL5A 5AXNA 3C19A 1HQEB 1RSCA 2XC9A 2B5JA 4OYBA 3PM9A 2D3OR 4G65A 5K14A 2WVEA 1VC6A 4F25A 1D0EA 1UPMB 3QIDA 4DPOA 4NI2A 1LW2B 3VZHA 1HNWF 3MPVA 4RW9A 3BBBA 1YRUA 3VZIA 2IMWP 1TMMA 3PR4A 2V4JB 1KLMA 4ZVPB 5I42A 2EBEA 4IYQA 3GILA 5EWFA 3BREA 3BZQA 4ZOSA 3TEGA 1BLUA 1N48A 3AFGA 4NLOA 1SH3A 5KT4A 3K5PA 3M32A 4ECRA 1T02A 2JLGA 1S6PA 2R8JA 2NSCA 4DUZF 2OTLS 4O3OA 2AZ1A 4BC9A 3V6DA 2CPDA 4PG6A 3GYXB 5DZ6A 2NUHA 5CYQA 1G4CA 3MM9B 3QGGA 3GFXA 4IQMA 3MR3A 3K59A 4FS2A 2UVWA 1YJNS 1NH7A 5F8HA 2BW7A 1H6KX 5IS2A 2J8AA 4UZCA 2VFRA 4DBQA 2IC3A 3OSPA 3G6ES 4NLGA 3OXGA 4G6VB 3M1VA 1VCTA 1CVJA 3GCXP 1NK6A 3BGOP 3SCLE 4BS2A 3UN5A 1FDNA 4KJIA 3IRXB 4OZNA 1FF2A 3RZAA 1XNQJ 3KMSA 2YQ0A 4UUXA 2D41A 2QO3A 2YKOA 1IVZA 1F9EB 2HHHJ 2VB6A 4LRDA 4DR7J 2DGOA 4HHHA 4EMDA 3UDCA 4RWXA 1BQMA 1VRUB 2R9LA 3BQ2A 3VAMA 1SJ1A 2VG5B 1HA1A 4NXNJ 5HSPA 3OFEA 3EYZA 3CIZA 2YWWA 2F9DA 5A8WA 4IKAA 3AB4B 3M2VA 2LLZA 4IR9A 4RKUC 4PWDA 4G1IA 5K8MA 4OYZA 5GADI 3Q2TC 1RWOB 3KLIB 2QMXA 4C3KA 3KK2A 1T9WA 2WCXA 3FDSA 1I5OB 4IO1A 3MPUB 1Y5LB 1H38A 3V6JA 5KFAA 2IM2A 1JX4A 1TVRB 1FT8A 2VKZG 4ER8A 3OR2A 3OVAA 2UXDJ 2B4UA 4NLPA 3R97A 2RDIA 2OPSA 5HMZA 2B6AA 3KNGA 3DKDA 1Q8KA 3DU5A 2KXHA 3IWXA 3MMAA 3H5XA 4KY3A 1JMTA 2EFVA 5HQLA 4GVLA 4F4ZA 1S0VA 4NLYA 1HPZB 1N5QA 2BANB 4K4YA 4A8FA 4DLGA 4JI6F 2EVZA 4ILMA 6FD1A 2MZTA 3LP2B 5D77A 1KQFB 2H48B 1AYEA 3UR3C 5KT6A 4YFUA 2FVCA 4CYUA 3GYNA 4ECYA 4K4TA 4LF6J 4GVBB 2O1PA 1XNQF 2OSQA 4JV5J 2HHHF 5KFIA 4A8OA 4DR7F 1RQ0A 1PBUA 3UO0A 4LF7F 1RTHA 4WP3A 5DM6Q 1WC3A 1F5AA 3HLUA 3D54A 4RX6A 4RW8B 3MM8B 5HO4A 3OXLA 3ZTSA 3AQOA 5D4PA 2Y9HA 1AZSA 2F8EX 4O3PA 3K8WA 1C0UA 4LBPA 1Q53A 3L7OA 3V2UC 3G86A 2EWHA 1TK5A 4EO8A 2YWFA 1VQYA 3P3DA 3FRYA 1RWUA 3DMJA 2GV1A 2MGZB 3PW2A 3ZNJ1 1UEUA 2J0SD 5GADU 3I5CA 4K8RA 1RYRA 3MMJA 3VAGA 3V81A 3JB9k 2UXDF 2OPPB 2NSBA 1V9OA 3D0IE 3ZTRA 5CH7B 4WFXA 1UP1A 1O5JA 4ZJLA 3T1HJ 1PYSB 4W98A 4ZS6A 3RBZA 2CQDA 2LECA 3LP0A 2HYIB 3GWCA 1RU2A 4JOUA 4P7VA 5ETRA 1S79A 2A2DA 2CJKA 2KZMA 2F63A 1SPBP 3MEKA 2W2MP 2ZVSA 1WHYA 4GRSA 1NKBA 2NS1B 1K1SA 3TWZA 1RWVB 3SEOA 1EX8A 2OMOA 1RAGB 4USWA 4CTAA 3UN3A 2BE2A 2ZH7A 1NK9A 1VQ4S 5GAGI 2E7XA 4PKDB 2MZSA 1HBUA 1X4DA 2R7UA 4IG3A 1YJTA 3BQ0A 1NJXA 2DR9A 2LEBA 4LF6F 4AL7A 4B9UA 3P49B 2Y3YA 5K8PA 3NOGA 1RHJB 4PEOA 3VAKA 4OZ1A 1UEVA 4IFVA 3DLGB 4ZCLA 4LF2A 3MCSA 3W1YC 3BKUA 3CC4S 2YNGA 1EAYC 2L3MA 2RE1A 3PTWA 3C16A 1DQ9A 3MEEA 2FVRA 4O0NA 1IKYB 2C3PA 1U2RA 4DL4A 3AB2B 4ID8A 3DLLQ 2BKOA 3I4PA 3UFCX 2DR7A 1L3KA 2N82B 4QWBA 1M1HA 1JJ4A 1EKSA 1RTJB 3R27A 3DCAA 3G8SA 1U6ZA 1JLAB 4PABA 4LQ3A 2JRSA 2UUCJ 1NEEA 2FHJA 3PXGa 5K9FA 2RSQA 3HHKA 3JSMA 1J5OB 3W2VA 1CJVB 4ED5A 3R5BA 1M5KC 2A18A 2C2MB 3IXQA 1U0HB 4J9QA 1RAAB 1Z4UA 2UUBJ 2JC1A 3PFOA 4DN0A 4PG7A 1HWKA 3LWLA 4R25A 4K0KJ 3MECA 3KK3B 1B99A 2EXUA 3ZFVA 3CC7S 4X4SA 1DJ0A 2GHWA 3G82A 1RXOB 5KG5A 3BGFA 2DGSA 2RB7A 4YB6A 2ZJQQ 4HHJA 3AT1B 1JXEA 3RRGA 3PW7A 5L8RC 5FDLA 5GAGU 3SCIE 4OI1A 4ZVOB 1S1WA 3Q24A 5CYJA 3RR8A 3GZ7A 2H5IB 3N6MA 4K4XA 2DGWA 4DV4J 4RBTA 3BH6B 4FPIA 1AFJA 2V69A 3ZZUA 4RBUA 1YZ7A 3R5DA 4DXLA 2C1EB 2R7OA 1X4EA 3G4SS 2OFHX 3CMAS 4DFJA 4Z7CA 1YLXA 3GB0A 3BPDA 4QWDA 1WTBA 4BC7A 1AT1B 2Z56B 4NA3A 2KVQE 5IT4A 3J7A1 2RRBA 1O8BA 2CFXA 4EBCA 2BEFA 4A8MP 3K17A 1Q81T 2E1RA 3KTQA 5KT7A 1N6QA 2XO7A 1UPPA 2AEMA 3CJ3A 5DG9A 2MPUA 3DNCA 1DZ5A 2QMUB 3GR0A 1XMQJ 3H4BA 2I38A 3ENQA 4YUDA 2XM3A 3M8SA 1RLDA 3QGPA 1EP4B 5J2QA 2DB1A 5F0WA 2HBZB 2IRYA 1N5TA 4KAIA 4I7FB 3ZZYA 3CMQA 5BYSA 5L9NA 3DLKB 3TOQA 3HKZD 4WBFA 3GFZA 2DPIA 2KXNB 4PYDA 4HTIA 3CJTA 4O3QA 4C6AA 4KTQA 3MAAB 3TAQA 2QIFA 3MMBB 2LU1A 3Q8PB 4WXOA 3MM5B 2LFVA 2FHJD 2BQRA 3GJSB 4QPTA 3ENAA 4U96A 3CB4A 4OHWA 1S5ZA 2IM0A 1YJVA 4DV4F 1Q82T 1X7VA 2I8EA 1VQ9S 2QZ8A 3M8RA 5AJ3F 5DDQC 3VQSA 5D15A 1S9GB 5D0EA 4I6AA 4JI1J 3HD2A 3KG0A 1UWBB 3WQPA 4RJVA 1JLFA 1WORA 1S9EA 2W9BB 2AQ4A 1R8CA 1BGXT 2OD4A 1SC3B 4C9DA 1VMBA 1WF0A 4C97A 1TELA 3L3CA 3T19A 4Q45A 2LQBA 1NLKL 2P8IA 3MGJA 5E3QA 2OUGA 4ICLA 4JUZA 1XMQF 2P6SA 3A8JA 4DV0F 3BJYA 1JKHB 3N79A 3UWTA 4D3GA 1NJWA 2P9GA 2EPIA 5KG7A 3FK4A 3CD6S 4ED7A 1GAOA 3FZ2A 1SXLA 4DQRA 4B9LA 4KGXB 1M1GA 4H54A 2DR8A 3HVTB 3QMQA 3MURP 2KRRA 3VTIA 2IA6A 4DUYF 1RTIA 4CO5A 1B0VA 5T7LB 2W7AA 1NNDA 1KBRA 3T5KA 3ITHB 1KEKA 4ZCKA 1U24A 3OPKA 4DU7A 3IR5B 2V2ZA 2JLFA 1H0HB 5IWAJ 5CZVA 5DGBA 3M6XA 1HHQA 1ZM4A 4LF8J 2FVSA 4IRKA 2PGCA 4JI1F 3T5LA 1UMJA 5M2PA 4OJ3A 1QVGR 1IKVA 3IG1B 2OH2A 3AJDA 3Q8QB 1WOOA 4B3OA 5A0YA 1FFGB 3A8EA 1X5SA 3J81Y 2NZ4A 1F9FA 3OL7A 4ECUA 8RUCA 1Y3KA 1VQKS 1P9YA 4AUKA 4ETZA 4I2PB 3IN5A 1FTRA 3BB5A 1I3OB 1LWFA 1TUVA 2BX6A 2IJNA 4TLQA 1R6YA 4URGA 1DLOB 1ACMB 4QJVA 4ED2A 2MXYA 3ZNUA 2QN6B 4ZPTR 4CO3A 1SQEA 3B6BA 4XPEA 4OQJA 2Q6CA 5ADZA 4XAKA 2ASYA 3FSIA 4B9TA 2JZ5A 5J2MA 2GJ2A 2XYGB 3OD2A 3SDEA 4F8RA 4DV1J 3TUPA 1F5BA 2V9WA 2L9WA 3NGSA 2CQ0A 2LA6A 4IH7A 2DVIA 2HZCA 1VFJA 2HBYB 3DU6A 4LIWA 1N5YA 1V5IB 3R7NB 3T9ZA 2VODA 1HYSB 4HI1A 1TV6A 4RO0A 2EK6A 3H40A 5IWAF 4DL7A 1Y7PA 2Z57B 4QYZK 1S48A 1F5CA 4LF8F 4NLDA 1T95A 3DDKA 4DR2J 1WDDA 1E6VA 2HVDA 4KO0B 4FZVA 1AA1B 1NHVA 1UL3A 5KFTA 5IT9U 3PZPA 2E1CA 5C24A 1RUSA 2FHKA 1K8AT 4F0KA 3G9CA 1HWUA 1K0VA 3RRKA 1RAFB 2MSSA 2FJVA 3JAMY 2XNRA 4GO5X 4K4WA 3V6HA 1AB8A 1JLGA 1VRTA 2CJ9A 4E8UA 3MUMP 1S1UB 4RR5A 3GV7B 3CO0P 1FDBA 3V4IA 4GKKJ 1SVDA 2W9AA 1U45A 2BJ3A 2W9CB 3SFUA 2QL5B 2Y1JA 1FJGJ 1RK8A 3FNNA 4GMKA 1CG2A 2RQKA 5J1NA 2ROEA 2DEIA 1W2IA 4KPYA 3JQMA 4RW6A 2L48A 1S72S 2N7YA 1TR0A 5K14B 8AT1B 5IQ6A 4NYOA 1RADB 2W24A 4ES2A 3G6YA 4UUWA 4JI8F 3GIMA 2VPYB 4FXDA 1YSJA 1VQNS 2VICA 2DNGA 4RW9B 2MMYA 4QYZJ 3DOKA 2HZVA 4OI3A 4ED1A 4WFZA 2DISA 2HS4A 4KHMA 3NS5A 3UNYA 1WC5A 1D8YA 4PG4A 3EE3A 5I42B 3DOLA 4UQGA 3WC0A 1JXVA 2NYHA 2EW9A 3NBPA 1Q8IA 3FC9A 1K73T 5DZ7A 4NCBA 4F4YA 2FGCA 3IR7B 2VIHA 3QNWB 2B9XA 2PA8D 4KH1B 2AYEA 2V9KA 3M32B 2DNQA 1C2PA 3QT8A 4TXSA 3H20A 2YX7A 3GMGA 3MR6A 2XO6A 3TJ9A 4TVAB 4NLQA 4WYLA 3QJPA 4QPXA 4FNHA 3HHLA 3KXDA 2G2YA 1ULRA 5BR8F 2DJWA 4ZP7A 2QFJA 1HWLA 1JLEA 5IQQA 1W7WA 1NDPA 2MSTA 4GKKF 4XO0A 2YWEA 3OV7A 4Z37A 2CQ4A 1HBOA 4G3IA 2VHGA 1FJGF 2KRBA 5LSOA 2IC3B 2QE5A 1QAYA 4LFAJ 2UVUA 4G1QA 2IYIA 1U2FA 4DL6A 4OLPA 3R5GA 4CO4A 2PI5A 2QX0A 4AQYJ 7AT1B 3CDWA 2BBEA 4LF4J 2CDQA 3G96A 2HPUA 3LAKA 1YBAA 4ZA1A 1DQ8A 2DHHA 1RWKB 2FC8A 3BYRA 2MQQA 3BM7A 1P1LA 1XMOJ 2YBVA 2BOAA 4KHPJ 5HATA 2Y0BB 3R3TA 5D0HA 3NLCA 3TARA 4M95A 1WOPA 2CWKA 4O4GB 2E1PA 3I96A 4LRCA 2HNYA 3NMAA 2HVEA 4PWDB 1S77D 3Q8YA 3B4MA 1R0CB 1KTQA 1MWYA 1VK8A 2JOQA 2W1BA 4QIWD 1RAHB 3PY8A 2IY5B 3DHWC 3OR2B 1ZA2B 1T3OA 4M5LA 3OW2R 4M8LA 3CE8A 2HMIA 1N56A 1E6YA 1VISA 3PW0A 4ZVSB 4KIAA 3G8TA 3MM7B 2DITA 2QGFB 2RRNA 3PYEA 5AE1A 5CAAA 1BMQB 4YR0A 1YQHA 2V8HA 2CWXA 4OYPA 3MEDA 5CYMB 3TYTA 2HGLA 4HYKA 3WX4A 1EETA 2JVRA 4LFAF 4WYWA 4CYUB 3C15B 3OBIA 3CGIA 3BDPA 2E5IA 3OTBA 1G6BA 3B4DA 3PIOQ 4ZP9A 1D9AA 4KKOA 1WOSA 2AYMA 3J80Y 3DLHA 1X4CA 1DFDA 4ZPVR 1UFLA 3IAS9 2PA3A 2HK2A 2ZH8A 1XMOF 1KS2A 2DXEA 4KHPF 1LQ9A 4HACA 1AZSB 3LA0A 4DL5A 3N5FA 1I94J 1C0UB 2YKMA 2CDRB 3KUGA 4NCGA 4R0EA 4DWIA 1KFSA 2VFTA 3J7Z5 1BE4A 4H4OA 4WE1B 5ETTA 1B7YB 3DMJB 2B8QA 1U1OA 5D6GA 2X1GA 4ANCA 3CCTA 3LP1A 2W8LA 3G87A 2DNRA 5I4MA 4RUHA 1SV5A 1R31A 3NOCA 1SIZA 3FBFA 2IFXA 5DQIA 5B0BA 3ZZ0A 1XWLA 3MTJA 4V1Ak 2HURA 5LL6d 3ZTPA 3IGNA 4PXBA 2G0JA 3QJLA 4DPYA 2NYIA 2ZOMA 9RUBA 4XK8C 4L72B 2XLJA 2HWHA 4U67Q 4LR8A 2DRDA 2WHOA 1TL7B 1S6OA 2UU9J 1R0AA 2E7VA 3W61A 4IG3B 4F4WA 1QSYA 4CNYA 4OHXA 3P8BB 3H2UB 4XDCA
chains in the Genus database with same CATH topology
2FB0A 3N01A 2PO4A 2ASJA 1WG1A 3M2RA 3M30A 4BBYA 1U1QA 3MUTP 3BDEA 4Y6IA 2BABA 3MEGA 3LALA 2JSXA 2IJFA 4DSIA 1URRA 1RGVA 2VD3A 2YKNB 2ZC3A 1M5HA 2HWIA 3M30B 1MMLA 4Q44A 4FF1A 5MLCV 3HP6A 1F60B 3MEGB 2EFNA 2ZOGA 5B0AA 1QLNA 5DETA 2ZE2A 2NQPA 1DTTA 2B9WA 2I2YA 3TUZC 2RKIA 3M6UA 5I3UA 1VJWA 5CQGA 3H5UA 4RW4A 1PC4A 2FVPA 1Q8BA 1VQ7S 2GGPB 2P9CA 5AE2A 2JEFA 2ZNYA 1UVKA 1JJ2R 1T7PA 2MHNA 4X4UA 2LMIA 3CDAA 2XMVA 2ZE2B 2RS8A 5E3PA 2XMJA 3K5LA 5I3UB 2RKIB 2IVMA 4QIFA 3DLEA 4DDFA 3CCQS 2HNDA 2U1AA 3ISND 3PACA 1RYSA 2BVZA 4C98A 4JI2F 3TX8A 3KLHB 5LMUF 3RB3A 2HS0A 1ZH5A 4HT7A 4RNFA 5C42B 2JEGA 5D8HB 4J9NA 2D7SA 3KLGB 1H7XA 3HHDA 1FDDA 1XR5A 1TKDA 1S0MA 2Q66A 4WFBQ 2CRLA 1YHQS 2VONA 1HD1A 2ROPA 1VK3A 5JXSA 1M5VC 1VQMS 4Q8EA 1RTDB 1N33F 2MKJA 3TUIC 2KYXA 5FIIA 2R8IA 1ZAVA 1Q4RA 4URQU 3SZ2A 1QTMA 1TL3A 2WB4A 4DSFA 1ZM2A 3M05A 3QO9A 4TY9A 1CC8A 3VWSA 2ADBA 5DLGA 1HNIA 1C1BB 3UCZP 2JVOA 5I3QA 2CZ4A 1RT1B 4N8OA 4EBDA 3FMWA 4X4OA 3O5TB 1G2EA 4O44A 2APOA 1WHVA 1N52B 2FC9A 2W4CA 2XEXA 1XR7A 3T6JA 4IOCQ 4HH1A 1KVJA 3BGLA 1BY9A 1LFPA 5J1EB 2M2BA 2C2EA 1TL5A 1HNIB 2W9CA 1UVJA 4ZLPA 2VFSA 3EUNA 4RNOA 3RAMA 2PE8A 4B9SA 1MW7A 1SJQA 3TA0A 1T03A 4MK8A 3JTNA 3F73A 3I82A 4FF3A 2BM1A 4K50A 1HQEA 2M52A 5EHHA 1FNOA 2JHEA 5DG7A 2CQCA 1KONA 2CQPA 2Z8QA 1UW4A 2AJ4A 1ZTWA 2NXUA 4MKBA 2ZHAA 3C2PA 2H5EA 3MZIA 4HEA9 2LA4A 5AXNA 1ZTTA 4AL5A 1HQEB 2GIQA 3QPIA 3PKYA 6FDRA 2B5JA 2XC9A 3PM9A 1Q86T 1K0TA 1DURA 2ZITA 2D3OR 4X2BA 3V5RA 4J9LA 5K14A 5F41A 4A4JA 4MJKA 2B5JB 1WHWA 1X8DA 3OL9A 3P96A 1VC6A 4OL8A 4TLRA 5C5JA 4F25A 1D0EA 2MZQA 2BOPA 4O3RA 1LW2A 1URNA 1A9NB 4ZVEA 4A8KA 4Q43A 3LWMA 5DLFA 4FN5A 4FPRA 4WU2A 3QIDA 2GX8A 4DPOA 1X5PA 2C3MA 3OVBA 2EFPA 2UVVA 1LW2B 2VZ9A 2KZZA 4OX6A 3VZHA 1HNWF 3MPVA 3NG8A 4RW9A 5EX3A 3RW7A 3GV5B 4LSLA 2UU9F 3KOAA 4ERDA 1WEZA 2V4JA 2DO4A 1YRUA 3VZIA 5AE3A 2FJDB 2IMWP 3JSBA 4DV1F 2FUG9 2XLIA 3CCLS 5F8LA 2IAJA 3OFHA 3PR4A 2MYFA 2V4JB 3CIMA 1KLMA 1WG5A 5KFVA 5I42A 3I0SA 4F50A 1NJYA 5IZHA 2EBEA 4IYQA 2KM8C 1AW0A 2J9DE 3RBDA 2CPHA 3NGKA 3GILA 1JK9B 1T3NA 5EWFA 1KLMB 2CQ2A 4Y28C 2X1BA 2M8HA 3BREA 3SQGB 4H4KC 2POKA 1FJEB 2F3JA 1L3TA 1XR6A 1LXNA 3I0SB 2QRRA 3BZQA 3IS9A 3AA9A 2BV3A 1SL1A 2DHAA 4LSNA 5E3AA 4C11B 4ZOSA 3FSYA 3H25A 1BLUA 1N48A 1PSDA 3I0RB 4M5DA 3RAXA 3IS9B 1SH3A 4NLOA 5KT4A 1YVFA 3K5PA 3M6VA 3NL0A 3M32A 4I1TA 4ECRA 1T02A 2JLGA 4Y34A 1S6PA 3NNHA 2AGPA 2R8JA 2NSCA 4CO1A 4DUZF 4DQIA 2PIIA 2AJFE 5A8KA 2A3JA 4DR2F 1QUPA 3MM9A 2OTLS 3GR1A 2I0XA 1VS3A 1S6PB 4O3OA 3NNCA 4UY85 4BC9A 4USHA 3V6DA 2CPDA 4PG6A 4FVMA 2QSFA 4P6QA 3GYXB 2NUHA 1ZAXA 5CYQA 5HMYA 1O51A 1Q16B 3TW0A 1C0TB 2LXFA 3AJ1A 1BQNB 3MM9B 3QGGA 1M5OC 3GFXA 1SC6A 3H5SA 4IQMA 1TQLA 3MR3A 3V6DB 3K59A 2HLUA 2E1MC 2HHPA 4OHZA 4WXWA 5KT3A 2FJEB 4FS2A 2ZZMA 4LUBA 4O4RA 5CYQB 2UVWA 2DRAA 3EGWB 2LYVA 2VFUA 3PEJA 2BQ3A 2XZWA 4RNNA 5FJ4A 1NB7A 2XG8A 1YJNS 4B3RF 1UJ5A 1TAQA 4HI2A 1NH7A 4RUCA 2CKWA 3HK2A 3HVWA 4RNHA 2FVQA 5F8HA 1H6KX 5IS2A 2DPJA 2J8AA 5KG0A 1HMVB 2VFRA 1OPIA 2ZKTA 2CPFA 2EBGA 2RF2A 4PQAA 4DBQA 4YDDB 3KK1A 3T1YF 2HIQA 2IC3A 1N6QB 3OSPA 2EFGA 5KFOA 2OIHA 4C8YA 3G6ES 2BR0A 4ZKAA 2XS2A 1TL1B 2AW0A 4O3NA 1R8AA 4ZPBA 4FVCA 2VBWA 4NLGA 3OXGA 4G6VB 3M1VA 3LPYA 2X1FA 3HHNB 2PSZA 1S4FA 2DGQA 3KK1B 1NK6A 2D3UA 3IRXA 1HHTP 1CVJA 2WSEC 4QYRA 1Q7YT 3S8SA 3EGZA 3I6PA 2UP1A 3SCLE 2B0GA 2MY8A 4H4MA 1V3RA 3M8QB 5KTQA 4IQXA 5F8MA 4BS2A 3M1VB 1FDNA 1YTYA 2VG7A 2M9KA 3C6UA 3IRXB 4OZNA 1FF2A 3RZAA 4KJIA 4A8WA 4JYAF 3V6KA 3KMSA 3K5OA 1U4BA 2DH8A 4UUXA 2D41A 4IG0A 3S01A 2KFNA 2QO3A 2YKOA 4NA2A 1N5VA 5M2UA 5EX0A 3R5AA 3JTPA 3ISZA 2VB6A 2AYGA 5J2QB 4DR4F 5LJ3Y 2VG7B 3C6UB 2AWZA 2BM0A 2DGOA 1VRUA 3FJ2A 1RT7A 3UDCA 4RWXA 1JLQA 3H2LA 2AP6A 1Q1KA 5DGAA 1BQMA 2VG5A 2J5AA 4OZ5A 1H2TZ 4C0BA 2ILZA 1S10A 4Q7AA 1VRUB 2R9LA 2IHR1 1S97A 3BQ2A 3VAMA 1JLQB 1SJ1A 3EX7B 2I9SA 1SIWB 2HQ3A 1QAXA 1BQMB 2VG5B 2R2RA 4NZ6A 5JJBA 1HA1A 3T3FA 4TU7A 3H5YA 3S6EA 2KHDA 3OFEA 3UCGA 4MYTA 2WSFC 4B9MA 3EYZA 2QA1A 3CIZA 5L1KA 4L3NA 2HVZA 1KR4A 4RNMA 2XI3A 1S9FA 3HM9A 2F9DA 1SH2A 4HKQA 2EKYA 2HHTA 2FGOA 3N4WA 1TKZA 4F2RA 5A8WA 1GNKA 2V5HG 4IKAA 3BO3A 3KLIA 2ADCA 3AB4B 3IR6B 3PRDA 3M2VA 3QZ8A 2LLZA 5L1LA 3TVYA 4IR9A 4RKUC 4X64F 4PWDA 2K3KA 4G1IA 4Y00A 5K8MA 1TKZB 5GADI 2VPXB 5A8WB 1DTQA 3Q2TC 3KLIB 2QMXA 4C3KA 3KK2A 5SZTA 2WCXA 3M2VB 3EPIA 1XK8A 1VGYA 1WI8A 3FDSA 4WKYA 2N4DA 1FRHA 1TVRA 5F8IA 4WK3A 4IO1A 5CXTA 4PQUB 1XMBA 1Y5LB 4C0OC 5LXYA 2DNNA 1GT8A 2A1BA 2F40A 1H38A 3JSRA 3KK2B 1QUVA 5CZXA 3V6JA 3I9ZA 4IOBA 5KFAA 4UOCA 1KOOA 4ILRA 2IM2A 5G4DA 1JX4A 1TVRB 5B7WA 5CCLA 4N5SA 1FT8A 2YWGA 2VKZG 1XERA 1K1QA 2LQ9A 3OR2A 2K1RA 3O44A 4NA1A 3OVAA 3SV4A 2B4UA 4QR0A 3OTOF 1ZZFA 4NLPA 3PO5A 1U48A 1QAJA 4JI5F 2RDIA 5F3TA 1OO0B 2OPSA 2J9CA 3DN9A 3W3SA 5HMZA 1AUDA 2B6AA 2EC0A 3KNGA 4URSA 1UA0A 1QVFR 1HI0P 2RDJA 2YWKA 2YNIB 2CPJA 2OPSB 3DU5A 2QMWA 4ZCMA 2KXHA 3K7RA 3IWXA 2B6AB 3MMAA 1U1LA 2WONA 3H5XA 1YG0A 2MHEA 1JMTA 2BANA 2DK2A 5DDOC 2JEJA 1VQ8S 1FKOA 1O0PA 1OS5A 5J2PB 2W8KA 2EFVA 4F4ZA 1FTCA 5IXUA 4Z2XA 1S0VA 3MMAB 4NLYA 1HPZB 2YH0A 2WONB 1N5QA 1Q78A 2B7CB 2E66A 4U7UK 1HNVA 4QWAA 4ECTA 2BANB 3TAMB 3RB0A 2JJ4D 3LP2A 4K4YA 3IAM9 4A8FA 1U1PA 4X84A 4DLGA 4MH8A 3TA1A 4JI6F 5HMXA 2EVZA 1VQLS 1FCAA 2J6TA 3M8PB 4FXWA 6FD1A 4ILMA 2ACYA 2MZTA 4V19J 3LP2B 3ZZRA 3M9MB 4WF9Q 3NCRA 5D77A 2C22A 3DRSA 1KQFB 4ILLA 3U1LA 1FVQA 3UR3C 5KT6A 4ICLB 2C2RA 4YFUA 3MWBA 1RI7A 2FVCA 4DR3F 2QV6A 2WOMA 2MKHA 3CF5Q 5KFCA 3LOUA 5E3CA 3GYNA 5LXRA 2JLEA 5HP1A 4ECYA 3J7YI 2ZH3A 3RR7A 2VOOA 3B8HA 4DQPA 4K4TA 2MDAA 4F02A 1KNZA 2JX2A 2WOMB 3QLHB 2CQ1A 2O1PA 1XNQF 5GAEI 2MQPA 2OSQA 4NCAA 5HP1B 2PFFB 2HHVA 4JI0F 2KG0A 2HHHF 5KFIA 2C3OA 4A8OA 4DR7F 1NO8A 1RQ0A 1NKCA 1OQ6A 3K58A 3Q8RB 4AQYF 4LF7F 1RTHA 4OLOA 2R7TA 3FCHA 3KLEA 5CD4H 4DL3A 3MM8A 5DM6Q 1L5UA 2OP5A 3BSCA 3UPFA 2ZNZA 1F5AA 4I6WA 4LF4F 4ZP8A 5JUMA 2B4PA 3HLUA 3NKYA 1Y00A 2Q79A 3D54A 1RTHB 3POTB 4RX6A 2V94A 2GMHA 4DV5F 2OTJS 4RW8B 4NRTA 4LVOP 3MM8B 5HO4A 3OXLA 1I1GA 3AQOA 5D4PA 5LSLA 4CIOA 3OLAA 4Y3CA 4YR2A 2F8EX 4O3PA 4C0HA 4K4SA 2HHQA 3K8WA 5G0RB 5CCMA 1RA6A 3OR1A 3MOZA 4WTYA 1C0UA 3K5MA 3TO8A 1X4BA 4J37A 4B3MF 4IOAQ 3PKMA 1Q53A 3L7OA 3M2UB 1HWIA 4TYBA 1IUJA 3DC2A 3O8WA 3V2UC 4BCAA 3G86A 2EWHA 1JJHA 1TK5A 1R8HA 4ZPAA 4EO8A 2YWFA 1HD0A 2R8GA 3CMES 1VQYA 2PC6A 2HFNA 4J9SA 3NS6A 3P3DA 3FRYA 4LF5F 4FP9A 1RWUA 3DMJA 1C4AA 2GV1A 2KT3A 3PX4A 4EZ6A 3OL8A 2MGZB 3UE2A 3OFGA 4N76A 3PW2A 1YI2S 2GHVC 3VCDA 3CULA 4QW8A 4A47A 2HHSA 2J6UA 5HLFA 1WEYA 2R4FA 5EDWA 2HNZA 4ED6A 3QWUA 2GQQA 2OPPA 2YNFA 3KG1A 4EO6A 4CT8A 5FLXY 1UEUA 4ELTA 3ISNC 2J0SD 2NR0A 5GADU 5KFPA 3HJFA 3I5CA 2HNZB 5F8NA 1RYRA 3MMJA 3VAGA 3V81A 2B4VA 3JB9k 2LKZA 2UXDF 2OPPB 2YNFB 2NSBA 1V9OA 1NK5A 2XMKA 5IM0A 4WFAQ 3D0IE 5CH7B 4WFXA 3Q8SB 1UP1A 2RD5C 1O5JA 5DQGA 3V81B 4DV7F 1WNEA 1XEZA 3BR8A 2M8DB 5EWGA 1IKVB 2DTJA 2OSRA 4ZS6A 3CCRS 2BYCA 4NL5A 4PG5A 2CQDA 4RUAA 3NMRA 3X1LB 4MKAA 2LECA 3LP0A 2HYIB 3GWCA 4JOUA 4P7VA 4QW9A 1S79A 4WCEQ 3QZ7A 2A2DA 3OLBA 3HPOA 2CJKA 4PUOA 4FF4A 2KZMA 3MEKA 1YITS 5F0UA 2HHWA 2ZVSA 1WHYA 3NNAA 1M5SA 3LP0B 2QA4G 2D1CA 3GV8B 3K57A 1NKBA 2E29A 2NS1B 3QJJA 3MR2A 2DT9A 3D2WA 1K1SA 3HDSA 1FESA 4KE5A 1GX5A 3MHYA 3SEOA 4O23A 2KKHA 3P6YC 2GMLA 2OMOA 4C8ZA 2D3ZA 1LWEB 3PVXA 5KFYA 4CTAA 1Q8LA 1ZPWX 5T14A 2BE2A 2ZH7A 1NK9A 2V8VA 3CEDA 5LJ5Y 1VQ4S 5GAGI 3ZZTA 4U6PA 3M4XA 4FXVA 4K2XA 5KG3A 1MU2A 2E7XA 1H98A 1LWFB 2HAIA 4USIA 4WU3A 4PKDB 3E3XA 1Q7LB 2MZSA 4CTAB 3UNGC 2BE2B 1HBUA 1MROA 4GC6A 1X4DA 5KFZA 5IFMA 4MMOA 4IG3A 1YJTA 3NRBA 4XDDA 4X65F 2ZHBA 3BQ0A 2R7UA 3GG1A 4LT6A 2DHGA 1NJXA 2DR9A 5F9NA 2LEBA 1MU2B 1BD6A 2DRBA 2CYYA 4AL7A 4LF6F 4MYUA 4B9UA 1HBUB 2D9OA 4JV1A 3P49B 4DF4A 1HNZF 5K8PA 3DLGA 2MKKA 4DV6F 2Z2LA 3MR5A 4NZ0A 1T05B 2P9EA 2IRXA 1KN6A 4X4VA 3VAKA 4OZ1A 4YR3A 1UEVA 2XWXA 2YKNA 3CDUA 2QEXS 4IFVA 3DLGB 4ZCLA 3MCSA 1FERA 3I9V9 3DRXA 5L39A 2B51A 2P5VA 3FMBA 2MKIA 1S7HA 3OTEA 2O67A 4IFVB 2ATLA 2BJDA 4B3OA 2GGPA 3CC4S 1S49A 2YNGA 3VF0B 1D1UA 2RU3A 5J2MB 1T94A 2ROGA 2N3LA 3DRRB 3SDEB 3PV8A 2R8KA 5GVQA 2L3MA 1Z1ZA 2YNGB 2RE1A 4KSEB 3UD4P 1B0TA 1AXQA 2FJBB 2XMUA 2DHSA 3TNVA 3KLHA 3FGVA 1Q79A 4F4XA 3NWGA 5C42A 1HL6A 1DQ9A 2OLWA 2M0GB 3MEEA 3UDLA 3ICLA 3KLGA 1IR0A 2V4RA 1I94F 2FVRA 2HS3A 3PRBA 2R7RA 4F4KA 1IKYB 2VL1A 2Y0SD 2C3PA 1U2RA 2ZOFA 3PDNA 3ZZOA 5A8RB 4DL4A 3Q23A 3AB2B 3OFFA 1XTZA 3MEEB 4DQSA 1QSSA 2KVIA 4ID8A 1U6BA 3IBWA 1FRJA 4KQZA 1RTDA