4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
1VL1A 2RQMA 1LK5A 3BXHA 2H9ZA 1UJ6A 3OFHA 1FRZA 4OQQA 1RWUA 3CSSA 2RQKA 4TM7A 2NYIA 2PC6A 3ICOA 2BKXA 3CH7A 3N0VA 4L4YA 1Y7PA 1YBAA 4R7TA 2FGCA 2DTJA 2MDAA 2P9GA 1NE7A 3KWMA 2BKVA 3TX2A 2W48A 2RE1A 4GO1A 4R9NA 3L7OA 3S1TA 3LHIA 4IO1A 2QMXA 4L4ZA 2J0WA 1M0SA 3BXEA 2KO1A 1FS5A 1KS2A 2QRRA 2CDQA 3MTJA 4LUBA 3ENVA 3OFGA 2R5FA 2LQJA 1O8BA 1UJ5A 2ZHOA 3BXFA 1FS6A 4L51A 3EB9A 2JOQA 3MAHA 4GO5X 1SC6A 3HN6A 1DEAA 3AB2B 5T41A 3KV1A 5FIIA 2RI0A 2P9CA 4GMKA 5JJBA 3TUZC 1FQOA 1U8SA 1PBTA 3NZEA 2F1FA 2PA3A 3DDNA 3DHWC 3E7FA 3W7BA 2DT9A 3OC6A 1HORA 3ENWA 3HHEA 3OFEA 1XTZA 3IXQA 4GO7X 5HJ5A 1LKZA 2OKGA 3O1LA 1LK7A 2F8MA 2O0MA 4NMLA 4TM8A 5IT0A 3AB4B 3IBWA 3OBIA 4PWUA 2LVWA 4OQPA 2RI1A 1PSDA 2QMWA 3K5PA 3AAWB 2JHEA 1FSFA 3NWPA 3LUYA 3TUJC 2QSWA 3OFFA 4L50A 3CEDA 3E15A 1Y89A 2J0EA 3UW1A 3LOUA 1ZPVA 1CD5A 3EFBA 1HOTA 1JT9A 2P9EA 4L5IA 3DC2A 4M8LA 3LWDA 2J0XA 3BXGA 3DHXA 2I9SA 3NRBA 2GNPA 1UJ4A 3TUIC 3U7JA 1YGYA 5IT4A 4X84A 5IS2A 3P96A 2WU1A 3MWBA 3ENQA 4L5JA
chains in the Genus database with same CATH superfamily
2VZ0A 3SQXA 1DO8A 2AN5A 4YJKA 4P58A 3WIUA 2B69A 1QF9A 1VYHA 3O26A 2O54A 1S6PA 2L08A 1W4CA 5HILA 4R0EA 4D92A 4YP6A 4QXQA 4AMZA 1FF9A 3AFMA 3D0KA 1UBOS 3RS8A 3PG5A 3T8YA 3CJKB 2YXNA 1MABA 4EU0A 1CIJA 3NAMA 4XK8C 4ZZ2A 3EF0A 4OHUA 3B5EA 4WN9B 4BLUA 1YC2A 1F1BA 2XNRA 1G8JA 2R2SA 4F02A 5JSUA 5BR8J 4KIGA 4JAVC 2CLLB 5JBNA 1GTHA 5CVTA 4AYWA 3C14B 1KFKB 1SUPA 2AYBA 3MWJA 3KWFA 3B3JA 2NT3A 5F1KA 2B5OA 1AZSB 1Y8AA 4GC5A 3CGWA 3HXLA 2ZJ6A 3WMFA 3M5CA 4URUR 1RZVA 4Q3DA 2ZDOA 4MUIA 2WWTA 4J3FA 1CJBA 2YNMA 1NJ1A 5LLTA 2O1XA 3KNZA 2WHEA 1T03A 1L7RA 4FFMA 4RFSB 3GLGE 3N8IA 3IC1A 5AESA 4N5DA 1JQDA 2BQUA 4CT0A 4HRAA 4ZIVA 5BYAA 2ZYGA 1ESZA 1E9BA 1W4BA 3AQOA 4XR4A 2F7SA 2G1KA 1ZAKA 4IF4A 5HQ8A 3CVKA 2HBZB 1SXGA 3G1WA 4DI6A 5L45A 3KM0A 1CVLA 4I55A 4ZOCA 2C7GA 4YJGA 2H16A 3CQ9A 1OZFA 2G5GX 1WMEA 4TLRA 3AR5A 5LSAA 2V6MA 3KDNA 4B3BA 1ZC3A 4FE7A 1XP5A 2FLWA 2GEDA 2DH6A 2CMGA 2NVUA 2ATXA 1A50B 1YZTA 1LPOA 4WZ6A 1EXMA 3F7TA 1L5YA 2OEPA 5E2QA 1UAWA 5EA2A 3QF4B 4V1Ak 2O7VA 2MQLA 4UU0A 1NSPA 3RK1A 1RHJA 3SZ2A 2XLIA 1JA9A 2C4WA 3OCWA 3ZDDA 4MVJM 1XXHE 2NZ4A 4MKXA 4O3MA 1T9ZA 3CMMA 4ZDIA 4Q7AA 2BOPA 1XQ6A 4AP6A 4TS9A 3QE3A 2AKYA 4QHSA 2CWDA 3B2NA 1CFJA 2K3KA 3X3HA 5DFAA 3TLYA 1S3SA 5F8HA 3HKCA 3W5XA 2F4VF 2FEAA 3TLXA 2ZZTA 1MZVA 1DOAA 1YR3A 4U2EA 4RXTA 1XTBA 4TROA 2R6CA 2NU6B 3KTAB 5ALNA 5FBZA 1UDWA 2WFMA 3BZWA 3JAMA 3KKPA 4WAUA 4GEGA 2VWHA 3LNTA 1KYIA 1GMWA 1HGXA 1RJEA 4OBWA 1RHQA 3PRYA 4B5LA 2Q6BA 2QAJA 4PVDA 4JI0B 1XMOB 3D4PA 2R8IA 2JFOA 3RAQA 3FI0A 5LZ7A 3OUYA 3MPUB 5HI7A 4KXXA 4OL8A 2IFXA 4QGGA 3REQB 4WXWA 3UANA 4H3SA 4MZXA 3I9V6 1Q1BA 3QUTA 4K9MA 2Q5QA 1CC8A 5LZ9A 3EEYA 1GZSA 3JQ9A 4RD4A 2GJKA 4EPXA 2RKIA 3ORRA 4E07A 1U2PA 3LH5A 3T5JA 3MILA 4CTNA 2EXXA 2J08A 1M0EA 3KOUA 2R7NA 2FXIA 3VAYA 1PQ4A 3W5JA 3LXRA 1IY9A 1TM3E 1CUXA 2ODQA 3NIDB 2UUTA 2P27A 1UBFA 4ISCA 2J67A 3B6JA 1AXRA 2EX0A 4LF8F 3CF6R 2ZSJA 5DSTA 4S04A 5DKFA 2P2CA 1EE2A 4E2ZA 5AKIA 1D1TA 2DHGA 3NNNA 1Y9EA 4LDRA 4MH0R 1H2YA 3UUFA 4MUHA 1K1SA 4PGAA 2JOQA 2YKGA 2LXFA 4AF6A 2I6FA 3KPWA 1JIXA 4QXPA 2YOGA 2DLCX 1C8LA 2IGBA 3GA7A 4QZVB 3IBYA 4Y2RA 5ITHA 1QNFA 1AO0A 1RBMA 3BWDD 4IFYB 1BX3A 4Q3NA 2DRIA 3KMSA 4FZ3A 2B2XA 5IEJA 1NZDA 5K8NA 2WSIA 4R51A 4X64B 9ABPA 3IMKA 2B0GA 4PRYA 1IAQA 3KQUA 5D7BA 1P4JA 3HBNA 3QE4A 5AW3A 4URFA 5C4GB 1A9RA 1L4UA 3R5TA 4OQYA 4EATA 3FFXA 2R7UA 1K47A 4M9UA 3ILVA 3L3BA 4EY4A 1X9GA 1JJBA 5BRJA 3PNQA 5LYJB 1RWWA 1JMTA 3L8MA 4LXUA 4O63O 5BNZA 3GR0A 4HQ6A 4MIKA 1S96A 3L7MA 4NYJR 2JGDB 1FX2A 2KYXA 4GMGA 2VQSA 4RS4A 4H15A 4ZO7A 2GILA 4DUGA 1QY7A 2XY5A 5THQA 1TJYA 4JFRA 4UDNA 2EEPA 1KEWA 3C6QA 3GCZA 4K5QA 2P91A 2MB0B 1AXQA 1ZD1A 4DQSA 4F2RA 3U3MA 3BBBA 4QBGB 4CYMA 1SVWA 3FMIA 2YL2A 1R8YA 1AF4A 2NZ8A 4LEIA 4ZJZA 5L3QA 2VNAA 2N3OA 3I0SB 5KT3A 3TKYA 4UTVA 2E5WA 1XZPA 1EFUA 2A94A 3VYUB 5GOTA 3KR9A 4KQCA 2E85A 5HG0A 3TGPA 2YQ5A 4HEA1 4YGXB 3LDHA 1P2VA 4PZLA 5J4KA 3WRXA 4F3NA 1L7EA 2HHUA 1L5HB 3E15A 4JC0A 2W6JD 4ZKAA 4AG6A 2Q3BA 4MIYA 3NC1C 1RVDA 1QE3A 1J97A 1AU9A 3IURA 3MLBA 4FFOA 3CH6A 3JZMA 5HZKA 4QDJA 5BN3A 3EVAA 1V25A 5LBTA 1SBQA 1OMOA 1JR3A 2QEXS 1E6CA 1HRKA 1Q86T 4LF5F 2UVDA 2CC2A 5EIOA 2X6QA 3LKVA 4ZU6X 4GC9A 4K6GA 4RWXA 2CJAA 1B8OA 1XEWX 4N8OA 4C2UA 2WJAA 4Q4HB 1REVB 3EVOA 3D5TA 4H2DA 3FPAA 5BXQC 4Q16A 2BT4A 4PWWA 2XNSA 3DSRA 2UUOA 2Z9DA 2W2QP 4F5EA 2DH8A 3OOEA 5K3AA 3LGSA 1F8XA 1XPRA 3IEVA 3MBOA 1X7VA 1QHYA 1P6UA 3VR1A 1Y1SA 4C7OA 2ZFHA 2O7RA 1NM5A 3SLRA 4Q9JA 2OFFA 2G76A 4FQ5A 4KTTE 2IMWP 1CJKA 4HDSA 3GVXA 1X5OA 2RH5A 4CFZA 5FDLA 3NWGA 3EGDA 4RZUA 3Q11A 1IJKA 3FMFA 1N7JA 5IJ0B 4ZLLA 4P3KA 1GAEO 4KN6A 3D8TA 1G2QA 1V2HE 2Y4OA 3M05A 1VJGA 1CQIA 3FB1A 4QPPA 1ZNYA 2WB4A 4JLWA 2NYIA 4V24A 5HQ3A 4L4YA 1I4EB 2UZIR 2DLDA 5HKOA 4GG1A 3QH4A 1BOOA 4BQRA 9GPBA 3VVMA 1ESCA 3I4FA 1FS4A 5GAEI 2AQHA 3Q12A 4UM7A 3I8XA 2YWGA 5F5LA 4FN5A 4YJDA 4BB9A 7AT1A 3KKFA 4Z86A 3Q24A 1G5RA 1OD6A 5AH0A 1NIPA 3FI9A 1C80A 2DUUA 1A4XA 4L0QA 2R2RA 4J1TC 2QMUB 1OZAA 1Y1TA 5EHNA 4I7FB 4NESA 3OFKA 1S8AA 1W85B 5CFQA 3CINA 1XMXA 4GKBA 3L7AA 4YS6A 1U04A 4U9UA 4RSMA 5DM70 4A16A 4P2SA 2IQ5A 2YWHA 3T99A 2EG2A 2ZDQA 3MS2A 1P17A 3QUAA 2APOA 3LY5A 3PLRA 3T4UA 5KT5A 1ZPVA 4TVKA 3PQ5A 3HBAA 2PFSA 3C7AA 1BYIA 4U7HA 4TYAA 5KIAA 3PWTA 4NENB 4CM2A 5CHCB 1T0BA 5MAOA 3ET6B 4BFUA 3UNGC 1T3OA 2NU7A 1K6XA 2PZAA 1P1KA 2XB8A 4EELA 1H6KX 2NAFA 1XFAA 4GU5A 1NK5A 3IEMA 1A76A 5KG4A 3BB5A 3D1LA 4LDQA 3VVCA 2ZBQA 1N2CA 1T9KA 4MV6A 1BCRA 2QLFB 2C9DA 1IBMJ 1V7PC 3DEYX 3THYB 3QKSB 2WV9A 3KLBA 2WHPB 2BGMA 2L69A 2DIUA 3FMPB 4HB0A 3C3DA 1PD1A 1EDDA 3TVTA 4LE1A 3ISND 2JIRA 1MJGA 2Q3LA 4M1YA 1Z8DA 2O2SA 5CEEA 4ZYTA 5HQTA 3KEOA 1DAFA 1CQJB 3IPAA 1AB8A 4FGSA 1KKLA 5ITSA 2OECA 4P2GA 1R5JA 4JBYA 1KRHA 2F4NA 1QONA 4YHHB 2F9LA 4ARCA 4S35A 3ZLUA 1KU6A 2UU9B 3A3OB 1Q1ZA 3UA4A 3MCMA 3DC2A 4EG0A 2CSUA 3ISZA 2R8KA 5WRFA 5KFWA 2XZLA 3IEKA 5F98A 4EO7A 4UOZA 3VKFA 1KKUA 1ZZNA 2O1PA 2H9ZA 3QTLA 4E1AA 3NJ4A 5KYYB 2FMXA 4WJKB 3W5UA 1II0A 2XCSB 3N0VA 4Y2SA 2QSFA 1NPDA 4W7HA 1WHWA 3LWMA 2JFKA 2BE7A 3DDSA 4FNGA 4I67A 4JDUA 1SG6A 3AJRA 1SVMA 4UUAA 4NYIQ 4ODIA 2HIHA 3PL5A 2O9JA 1E6KA 4R3UC 1Y42X 3JQBC 4C4WA 4CQMB 3KC2A 5EERA 4ZVKA 1JB0C 4MIOA 1VTKA 5C5JA 2IS2A 2DULA 4EQ6A 2ZCVA 4HXEB 4ES1A 4MQ5A 3NEAA 1TTHA 2WWFA 3LYHA 3G89A 4A8HA 3ND7A 1ROFA 1YVUA 3COSA 4Y6PA 5HOEA 4K88A 5JLAA 3G1UA 3TW4A 4ZU3A 4HTAA 4MDFA 2BJ7A 3RODA 3IMEA 3IS3A 5FWXB 1WQ3A 3CNNA 3B6KA 2GBGA 3BV8A 3AEKA 3D3WA 3D7NA 2ZVSA 4BO7A 2PTHA 4X71A 2HNZB 2ZIXB 1OB2A 4H4OA 2F3QA 2XULA 3BGLA 1KK3A 3N8DA 2WU1A 5CXQA 4W9MC 3TFWA 2JFWA 5IJAA 5CXSA 1N8RT 1X9HA 821PA 3BAZA 5LMNJ 2ZUUA 4NVRA 1AW0A 1E79D 3N7AA 1FJGJ 4OG2A 5JAUA 2Z5FA 4EZ6A 4M5KA 2NU8B 1DCFA 3TCKA 1OAOC 2FYXA 2FHKA 3HV0A 3NS6A 4K87A 3F56A 3CUTA 3NG8A 4HAZA 4LZPA 3SZUA 1QWOA 2HA6A 3NV9A 3RWMB 4IUBS 4I0WB 3FNQA 1Z2LA 5FNVF 1R9NA 4I14A 2IDKA 1FP1D 3RS3A 3NNDA 1Y4UA 5C1DA 4EBDA 3IBTA 4QAJA 3RFVA 2X8WA 2JCYA 4IOLA 2XSJA 4ZPDA 3FWHA 3DUFA 4P52A 4M60A 1PUJA 3KSRA 2H3EA 4UREA 3K59A 4BIIA 1J56A 2KT2A 3H5AA 3P19A 3DVSX 3U3RA 2XLCA 5HWSA 1TFUA 2EL7A 2RSLA 1D2EA 2NG1A 2Q3EA 1E32A 4WY8A 1XZQA 3LT4A 5KMGB 1I4WA 1V8OA 4COOA 4MDEA 4DB4A 2H4YB 2B1QA 3PNSA 1XOIA 1RT7A 2XZTB 1LXCA 1GXSA 1XRJA 5LWHA 5C34B 4TZTA 2O5EA 2VG5A 3GEBA 3N9UC 5K8JB 2GRUA 1C14A 2ZAIA 2FPUA 3ZIAD 4QGBA 3OR1B 3T5CA 1TL7B 3W5DA 3J81j 3DBVO 3V97A 3AUKA 4WF9Q 2YN2A 2W7OA 3W78A 5TQJA 4OTZA 3NATA 2FSUA 2LV8A 2CGEA 1G3QA 3GQVA 4P7JA 4IDAA 1IM8A 2JNJA 4FHZA 4TV9B 4NBLA 4WKOA 1N6HA 5B0AA 3BB3A 3OLQA 4HATA 2HFVA 1JVNA 1ESEA 5ALUA 2XMWA 4RLHA 2RGEA 1FNXH 1NONA 2XD4A 4TYMA 2ALJA 3KJHA 3DHWC 3HUEA 3BH7A 3KJFB 4KDFA 1D7AA 4JV1A 4LREA 4H18A 3TOQA 3NDBB 1NI4B 4DFJA 4TKLA 1DTTA 2VCEA 3NS7A 3D0IE 4DYDA 3DOMB 1VPDA 1UPAA 2Z9CA 3ZKWA 3TEHB 1N0HA 1OASA 3IP1A 5AW7A 4KE7A 2CXSA 1D1UA 1C0PA 5HGJA 1P61B 1RTHA 1J9GA 3OLCX 1YUMA 3DFZA 1MJ5A 2R1TB 4JYAF 1XF1A 1N3LA 2AYZA 4CLEA 3TL2A 5DHUA 1HDGO 1E6VA 2E9TA 2WA2A 3R97A 1EPUA 4EITA 3RTDA 1GNQA 3TEFA 1F5AA 1TUEA 3RFXA 4XKJA 4F5DA 5DDOC 1GTMA 2OV6A 2LCQA 1V3VA 4CNBA 1JFLA 3EDQA 4X4RA 4TOIA 5J4YA 3OE7A 2Q3FA 1T9TA 2F4VJ 3Q3JB 2FNAA 5EY5B 1NNEA 2G67A 3PRBA 3A12A 4A92A 1M2WA 3SPXA 1P3DA 4HT5A 3I05A 3M6LA 1ZUWA 1NJ2A 3H18A 1WQ1R 2BEVA 1IUPA 4WASA 2VYQA 2CZGA 4CZ2A 4QRHA 1SZPA 4TYPA 1NVAA 1R0WA 3I1FA 4N5LA 3WYBA 1D8AA 1Y4DE 3BMNB 2NO7A 2FUG1 3T3OA 2YWWA 1USUA 1ULRA 2QXTA 4E03A 1U6IA 2WFLA 4YP0A 1IOLA 4D25A 5HEKA 4KSYA 1DB3A 2V94A 5LDGA 3GLSA 4NATA 1UEVA 4P75A 4C01A 1XN9A 4ECWA 2YYYA 3IR5A 3A31A 5H82A 4QDKA 1TKAA 1B2RA 2IH2A 1VQ8S 2WIGA 2VDVE 4I9GA 1WX1A 5ADWA 4LF8J 4L3OA 4JX8A 1LU9A 3SK0A 1KONA 3ILHA 4KMRA 1Q0RA 4OLHA 3T7AA 3VQTA 6Q21A 4LRYA 4CMEC 4N8EA 2NV2B 5C9ZA 2BFWA 1FXSA 5F41A 3K70C 2IVMA 2JHEA 2DFDA 3IG1B 3HLTA 3SZRA 4HEA9 4TVAB 1E94E 2X40A 1M10A 2V8GA 4BV3A 4JOSA 2ES4A 4RZXA 1XQWA 3O5TB 3THTA 4NOMA 3NNAA 3DDIA 1NASA 4KE6A 2JI6A 2WJVA 5DZSA 1L7AA 4PYOA 5LSLA 3ROFA 4AICA 1S1VA 2YQ1A 2Z2LA 3G0CA 1QP8A 2ABWA 4RVCA 3AV3A 2PI5A 3KZNA 2WQ6A 2KVIA 1UDAA 3AETB 1G5FA 1FWLA 3QXCA 4O4JF 2P6MA 5J2NA 2I1WA 2GAFA 3FIUA 3MEGA 2YJZA 4TN5A 2CZQA 3HRKA 1Z8FA 1NDCA 4XGIA 2Z6VA 2KWIA 5AJWA 2IXEA 1VZ3A 5LN1A 4YRSA 1UW4A 4HDGA 5ALHA 4RNDB 4WBNF 3FR7A 2GXQA 3U4DA 2XB2A 1M5KC 3BERA 3KTOA 2RHOA 5DVZA 4PU0A 1CDZA 4DR5B 2FR0A 4D4HA 4Z3DA 1WXGA 4POOA 1S2MA 3BCSA 4P1ZA 5CHEA 1S1WA 2OFOA 1H7XA 5IHPA 1DS6A 2HTEA 3UCUP 1GGEA 2P35A 3T12A 1QCZA 4AAYA 2PSDA 4QXOA 3BSSA 3GT7A 1OQ3A 4JI7B 2HJVA 3AMVA 2OBLA 4B2IA 3PQDA 4GR5A 1AYEA 4CUZA 4DLTA 3FSEA 3H19A 4U7PB 4Q3OA 4NLOA 2BFEA 4Q05A 3HJCA 1YK1A 1RRPA 4XB1A 4ZPCA 3CD7A 4MQ6A 1ANKA 3EUNA 4XO0A 4ZI7B 2K3IA 3IJ5A 1UZDA 1LSJA 3HDQA 4U2BA 4BV9A 1J99A 2GAHC 1EKXA 3OLBA 3EDMA 1Z4PX 1JWWA 4TZKA 3Q8LA 1EJ6A 1PX2A 1U80A 1EP3B 5BW8A 4LF5J 3AHCA 1HNZF 1WPXA 4ZVSB 1RHUB 2R6ZA 4BP8A 4PBTA 3ZJUA 4FMBB 4IIUA 2QA4S 2O50A 3ZD6A 4GI2A 1YE3A 4JV2A 1PSDA 3LQQA 3UXYA 3IOYA 2I80A 1Z7GA 3L49A 1UWVA 2WVJA 3AVTA 5JYDA 2GVZB 4JU9A 3PXCX 1O77A 2CLIB 4ZGBA 4LZOA 1UWBA 4KQHA 2V63A 1R6VA 2PZJA 4N3CA 1E2HA 4WESA 4UEOA 2LQBA 1XZHA 5D3MB 2L9NA 4OQQA 2R4QA 4RDCA 1SMKA 5KVSA 3FCCA 4US0R 1V9SA 2HQOA 2CYAA 2JANA 2E29A 1DEXA 4BU0A 1FU4A 3ENKA 3DPSA 5FBLB 1AJEA 3UJDA 3ZDEA 2BP7A 3SC2B 1XLUA 2QV6A 4OIXA 3H20A 2W7AA 4K9OA 4QU0A 2MYPA 2A5YB 1HG0A 2EJCA 3K31A 3P9RA 3TR0A 1Q17A 3RUAA 1Z36A 3S2ZA 1U99A 4KFBB 2XEDA 2ZR9A 3CLHA 4C5CA 4UXJA 1MHTA 3FPCA 3P94A 3ZTYA 5M04A 1M8JA 4RJKA 4W99A 1BDHA 3ETOA 2VOEA 3JX9A 3MERA 3T7JA 2A0WA 1GO2A 1O6ZA 5EMLA 4EJSB 4C2AA 3IXLA 4O4LB 4PO1A 1KMQA 3TXXA 5K4GA 1U11A 4YCDA 3GLQA 4HNVA 4IQ4A 1RFLA 2ILYA 2QTWA 3YASA 2FZVA 2ZOFA 2AI1A 1D6SA 2G0CA 3RUCA 4DADA 1G5QA 3FDXA 1PO7A 3SSNA 5SZTA 5B12A 4LOAA 2BI8A 4D3SA 2FW8A 2HYIC 2EG5A 4FFBA 2ODWA 2YYZA 1GA4A 3L07A 3EWIA 4YMLA 3ETMA 3UYLA 3GLKA 2XIQA 4XJVA 3MWLA 3QJPA 4MDHA 3W61A 4KAJA 4ECZA 1JXEA 4FMDF 4X00A 3OL6A 5K20A 5EMKA 3CX8A 2VRNA 1QWSA 1OYWA 1NK4A 3T7DA 2QMQA 3NCTA 2E9SA 1WHSA 2JVKA 2V8DA 3FBGA 1DC5A 3DQZA 4KR0B 1JG1A 3TA0A 1IWGA 5F3DA 5CM8B 2WBMA 3OTDA 2RAPA 1ZJ4A 2RGBA 2FQXA 3T34A 1V16B 2MINB 3K73O 3MQ2A 1TKZA 1GITA 1Q5YA 3MECA 1CXZA 4LVNP 1EIZA 3GV5B 5H9VA 2OESA 3BDIA 1RAEB 1TL1A 4CKCB 2X7XA 4K03A 5CDGA 1VLQA 1WKVA 3L0OA 3A05A 1O4VA 2EC2A 5DDIP 3QJGA 2DM6A 2X1HA 3WGOA 4G85A 3RJMB 3OIFA 2BJ1A 3AJ9A 5CLFA 2IE0A 2AX1A 3GCXP 2XXJA 1ACJA 1QTQA 2QLTA 5BYJA 3MOSA 5HHTA 1UANA 1WDLA 3BXOA 4LS3A 2DNRA 5FPPA 2B8EA 4OATA 3KOZA 4CG3A 3G4SS 5CIQA 4ALMA 1X9IA 2QLJB 2B1RA 4J9LA 4PZEA 4UCFA 4N3NA 1ZS9A 2N7CA 4RXUA 1GXLA 3O8DA 1M3SA 5F23A 4MV5A 1EK5A 2FKNA 1UFLA 1M2EA 3R6GA 4YUZA 3NI2A 1IRXA 4EG5A 3UFBA 2ZAGA 1G41A 1U9CA 3UOWA 1J25A 1BFKA 3OJXA 4RK6A 1JK9B 1TL3A 4V0NA 4BVEA 3DW1X 1YWXA 1L6RA 1NBMD 3MWDB 2JZOA 3OI7A 5FUVA 2WIAA 3GJ7A 1MJGM 2O0JA 2XI2A 3R0QA 5JFGA 4AKSA 1NURA 4CMBA 3GSDA 2GKSA 1FW8A 2Q9CA 4TXMA 1VISA 3VHXA 5F5XA 4KPFC 2C20A 1LH0A 4ZZIA 3CX4A 1G16A 1RC8A 3DUWA 2H3HA 4H16A 1Z4LA 2LZ0A 5GP1A 1KAOA 2AYMA 5K3FB 3UT5A 3BULA 2VRWA 1YJUA 4NYMQ 2CVEA 4L5AA 1R8QA 1YZGA 3AD8C 5FTLA 1DDOA 4HUTA 4GSKA 1PV4A 2FTKE 1U7OA 3R5SA 1TOAA 3BL6A 1XK6A 3G7NA 2XAUA 1NL3A 4HBZA 3U9TA 2IYGA 3UDCA 4I7EA 1D0EA 2P41A 3OSUA 3BPDA 4DL6A 3NWEA 1YL6A 4V3BA 3WGZA 4RQBA 5F2EA 5GM2A 2MQOA 2ZJFA 3PACA 4XDDA 4TXLA 3DFFA 1L1EA 5KTSA 3VXKA 4ECAA 1C1CB 4JQCA 4LY3A 3LUPA 4PCAA 5KSWB 2O8BA 1C8VB 1H3FA 5KFNA 2ZYUX 1IUOA 3GX1A 2I7CA 3C7CB 1RJDA 4TWZA 1Y0HA 1UZUA 3I73A 4K4UA 5JNLA 4NAHA 3VSCA 3BMOB 3NRBA 3KB2A 4JKYA 1T2UA 2QTNA 3VAFA 4EW6A 1QVGR 1BZYA 2ATCA 1XTRA 4P08A 5TQ2B 1XMIA 2Y2VA 2QP4A 1WG1A 3OCZA 1L4FA 2CHUA 1D07A 1CDOA 3ZW8A 5YASA 1KZ7B 5EGYA 5EI5A 1TXGA 2DBQA 2H4ZA 3NHPA 3VALA 1Y5LB 2ATEA 1B73A 3PNYA 5LXTF 2ZHOA 3PGVA 3EZNA 3NUZA 3EDCA 2RH9B 4EHDA 5ETQA 5I8WA 2FFJA 3RK4A 2B4TO 3KZ1E 3GU0A 1YRQA 2VJUA 1RRVA 4LGVA 2AK2A 1WPRA 3HJGA 3QO9A 4FPXA 3I72A 3WMWA 4W5QA 1EQ2A 2QGFA 4ZI5A 1Z75A 2I33A 3GRYA 2VA8A 1EU1A 3B7PA 3V6DB 4A03A 3OHSX 4B4OA 3C1TA 3Q2TC 4KWHA 2ZOMA 1LD3A 3TPZA 3ZNPA 5CFZA 4J9MA 3KOAA 1TU0B 5JAIA 2VS1A 4P4UA 1O89A 4C03A 3SQWA 5ED4A 3AF3A 1Y3BE 2F00A 2FUG9 2GYVA 4O4HB 5CB0A 4L4SA 1URNA 1I2MA 4G8CA 3TR5A 3BXPA 3RDPA 4DBZA 5DEIA 4YUVA 4H7FA 3QVKA 4UBOA 3UUEA 2W9BA 3L7DA 2BR3A 1TELA 4REQB 1BH2A 5CA1B 1V1JA 2HWWA 4BDSA 4JYAJ 3FA2A 1W9HA 2B2CA 1DMSA 2CNNA 3WGUA 4A23A 2ZB2A 4DL5A 1J09A 2HHQA 3ZLTA 1LW0B 1JLGA 5TVKA 1KI9A 5JJIA 3ROTA 4OHXA 3EIQA 4OX8A 4NL4H 4MW9A 2HK2A 1LBTA 1OX6A 3IO1A 5D78A 1VE3A 2ZJOA 1OGJA 4J1QA 2WHXA 1O5OA 3O84A 4O3OA 1TPZA 3ND8A 5DZ7A 4Z53A 4X93A 3JSAA 1OCEA 3I5XA 3AH6A 1E3MA 3B6EA 1OH6A 3VTFA 3I30X 1OS5A 1V96A 2JIBA 3DV0A 4DKJA 3QPUA 2DNLA 2R86A 3ZE6A 2R96A 4KH1B 4MK4A 1JJ7A 1NVUQ 2J0WA 4MVJF 2P2ZA 2CKMA 4E5NA 1TM1E 4BHQA 1AKVA 3KVOA 4I50A 1J5OB 2L41A 3AF6A 3MEEB 2WVDA 1DNPA 5JH7F 5IT9U 1NQUA 2QRHA 3H75A 4QJVA 3L92A 1J07A 3HU2A 1U1QA 4RY0A 1S79A 3GD7A 4U0JA 4BJ5A 1FQOA 4M5GA 4U7CA 4KQKA 4RETA 1SXIA 2X0NA 2EKDA 1UPFA 4N3GA 4AQYF 3CLTD 1DEOA 2Y8WA 4YXWA 3ZI7A 5I5GA 3RV3A 2O01C 3FF1A 1XG5A 4NFLA 1PNQA 4KO3S 4BZZA 4JJFA 1ODFA 5AI4A 1E3EA 2JA2A 1E96A 3DEZA 1EE1A 3N8HA 2AUMA 3ER8A 2OORC 1VHLA 5HVGA 2Y0BA 4W5OA 3DP9A 4LKOA 2O3JA 3ESQA 4UQOA 1UBLS 1VKHA 5CT5A 4K0KJ 3X43A 3L7OA 5K5MA 4KYZA 3MWYW 4OJ1A 4YR0A 5C25B 1Q7RA 1RZUA 3Q7EA 2BWJA 1M1UA 3GZJA 1JQEA 4ER6A 3A8KA 4WHMA 2H1CA 4MWSA 4L3WA 1HYGA 3JQEA 3MURP 2CV1A 1QG6A 5CX1A 3H3FA 1CNEA 1T1EA 3E7FA 2J45A 1NMYA 4X1IB 3AU9A 4Q9AA 5EHXA 1TKXA 4ZC1A 5EYPA 2AZMA 3KJVB 4EHKA 5LP6F 1GTRA 2EW1A 3I5UA 4C29A 3U7JA 3W5BA 1PYOA 1M6NA 1HKAA 4C0WA 4PM4A 5LU9A 3CWCA 5HROB 5KOHB 2NZJA 4OFBA 4G07A 1G4CA 2CMFA 1QR6A 4X7RA 2VAWA 1TVKA 1I5OA 4DLXA 1D0VA 1N56A 3PDNA 2HEIA 1N0IA 5DLYA 3R3UA 3NTUA 3FYCA 4NCXA 2J9GA 4IXWA 1G2IA 1U5AA 1YL5A 2L82A 3GGPA 3QBDA 2X8LA 3ZU3A 4YEDA 4YMUA 3AUSA 4FYMA 3FNGA 4YAOA 4FYXB 4GM1A 1BCSA 5BT9A 4G6ZA 5DX1A 3NIFB 2M0GB 5C32A 3GFZA 2RRAA 1KPHA 2MJNA 5TQ0A 4X95A 2C88A 2N42A 3D4LA 3A3NA 1VLMA 4NEYA 2W8BA 3WG9A 5E3JA 3HYLA 3FDIA 2HHLA 3QG5A 4JZYA 5J2TF 3QGHA 1LQ2A 2D7JA 3DZIA 3NLCA 4XIUA 3O8QB 3G5AA 1R74A 2GYUA 1VDZA 4AP9A 4J37A 4FDUA 1HNZJ 4FX2A 4EYEA 3PWSA 5H0IA 1A7GE 3W2TA 2HF2A 5J2PB 3KZKA 2C2ZB 1J7KA 3J7Z5 3A58B 3LH2S 4FINA 1LXJA 1XFDA 2R4UA 1RE0A 4H4MA 3BG5A 4UD2A 3WGGA 2WTEA 4ED4A 4IDQA 3SX0A 3R3WA 4IH5A 1BGVA 1TF5A 5JS7A 4EW3A 2HK3A 2VHXA 4KOEC 5DYTA 5LZ2A 4M5MA 1WOPA 3RUIA 2DQYA 4OQEA 1RTDB 4F86A 2ZUAA 2OLWA 2Q1TA 3CCZA 3OWHA 3W06A 1SH3A 3KTFA 4DHEA 4FWIB 4ZN3A 1OWOA 2O2YA 4OZ5A 1JR4A 2HRTA 2V6FA 3CSDA 2MSNA 3JD2A 4LMAA 1LW6E 1NXVA 1X38A 2PNJA 2PJUA 4IGIA 2BRUA 4LW8A 1OFHA 2FDNA 4YXWD 3WLQA 4UPEA 1QK4A 2HO5A 1Z0AA 3I76A 5LB2A 3K0JA 4O4GA 3GMGA 3QI7A 5LFAA 1PK8A 2F59A 3DO6A 5JNTA 3HCOA 2PBRA 3OM1A 2G6TA 4XDYA 4RKEA 4ZCKA 4MIWA 3I9LA 4BC1A 4LJSA 3G2IA 2DPMA 1MIOA 1VG1A 4DV7F 1E0AA 9RUBA 3A26A 3IO5A 3E8SA 5ETSA 2OD6A 3G6KA 3ENVA 2R8ZA 5DTJA 4A0FA 1UMBA 1OB5A 2YHIA 3FEYB 2VK1A 4CTJA 1C0UA 1CC1S 3HKDB 4I4TF 5DRKA 2MZSA 1FI4A 5C8VA 4Z2XA 3C6YA 3NNCA 4MR8B 5EXTA 3S44A 2MQMA 4BPRA 3SOZA 1BFUA 3WYFA 1VP3A 4H4KA 3IKTA 3EVGA 1UBUS 3PO5A 1HNXF 4B3RF 4DPMA 4P81A 4EI2A 3FDSA 3BKXA 4W8OA 3I9JA 4YAIA 4WDQA 3VYSB 3VV3A 5KREA 4IGFA 1OI7A 4XDHA 4Q7LA 4ZOSA 2VF8A 1FYXA 3GG2A 3FLBA 5AVXA 5ICGA 1FYVA 1TVCA 9ATCB 2OMOA 1UTAA 1LWNA 4KRWA 3AOBA 3CMQA 3PR5B 2RHQB 2DP4E 1JZQA 4AX8A 1O2DA 3CDEA 2XXAA 4MKIA 2ZJ8A 2QTBA 3G0DA 2IP2A 2V6JA 3I0RB 1C30B 1Y3CE 1AQJA 2ON6A 1SOVA 2HPUA 1TCVA 5K8MA 2Q9AA 4KVAA 1JLLA 2CDNA 4IS3A 5KPDA 2E4AA 3NGXA 5BV8A 5HPYB 1ZM9A 4PYRA 5AI0A 2QLNA 2DQ4A 3V9AA 3GLVA 2CDRA 2A35A 1XCPA 2ZS9A 3BJYA 3UMYA 3FPJA 4FZRA 5A5DA 4GC6A 4DV1B 1Z45A 1IBKB 5IAGA 1RRMA 1XEXB 3D6JA 2V0NA 1JZSA 3L7PA 5K0JA 4G36A 2FDCA 3A13A 1A5BB 2CJBA 2Y0EA 4I5GA 3KSBC 4XX0B 3WFZA 2VK8A 5KYGA 2U1AA 1XVAA 3ESCA 1S9GB 2CBXA 3H0CA 1NRIA 3FY4A 2OOSA 1IHYA 1FDRA 3I96A 1QGUA 4TWIA 1TC1A 2Z08A 2GVDA 4PSKA 5DISB 4IDOA 1M8FA 2DERA 1O96B 4BUJA 5CH3A 3CCES 1RWVA 3WDLA 1QRTA 5KOIA 1L5OA 3OPQA 3L6EA 1BH6A 5LQDA 2GGPB 4P4GA 2FRXA 4FWBA 1TK0A 2H17A 1EFHA 4M46A 3VZSA 3PIDA 1ZX1A 2YZGA 4ED2A 4X54A 3GFSA 1MA3A 3KUKA 2B4QA 3W6UA 3LW5C 4D97A 4EY5A 5DK6A 1WV0A 1KERA 4NKRA 3ZHQA 1Z3IX 3QTTA 1XNRF 2JFFA 1AXGA 1EP1B 2UVRA 2DPYA 4LSNA 3BD8A 4TYNA 4USWA 5ADHA 1MEOA 4PZCA 6AT1A 4HDNA 4MI9A 3NEPX 3MJSA 2JHAA 2J76E 3FBBA 2VH2A 1WEHA 3ZHBA 3D4BA 2Q3MA 2NXCA 2ZJRQ 2C03A 4LF4B 2HKIA 3OCXA 1HARA 1AQUA 1J24A 3CZAA 3EBOA 1NKEA 1F3LA 4OV6B 2WY2D 1GKKA 2WJWA 1P1FA 2NWQA 1YTUA 3DZBA 2HYDA 1JPNA 2G72A 1WCWA 2D1YA 4UM5A 1S6UA 5B3JA 4CO2A 1PLJA 3QVUA 3TL6A 2YVUA 5T4FA 3PQFA 3H11A 1C9DB 4TM7A 4HWOA 1U1LA 3A7DA 5JD6A 3AHEA 4AKEA 3PU6A 4J75A 2VYVD 1PUIA 1TU3A 2IT1A 3DMTA 1CJVC 2ZTMA 4NLSA 1JEAA 4K05A 5GADU 3F6EX 4FSDA 3ZBQA 4LF9F 3ZDAA 2WMDA 1GQQA 2W6JA 1EFPB 4UBJA 3P27A 2D3OR 1QGOA 4A0QA 1IN1A 1L1QA 3K0CC 5J1EB 5CM2Z 1DEHA 4HF7A 3EA0A 4LJMA 4GP7A 4GRIA 4W6QA 2AN9A 2ZBFA 3W5CA 1SCQA 1X2BA 3HY6A 4FE4A 2XYQA 3SXJA 1SCNE 3WLFA 3PO4A 1LOUA 1A4RA 3LKDA 3LG2A 5LL6P 1UOOA 2XTNA 5KTMA 4RVNA 4TLBA 2QD3A 5H68A 1FP2A 3RS5A 4IG3A 2QYSA 3JYPA 2R5NA 4B87A 4X65B 2GA9A 3QEBZ 1WAMA 2CHQA 3I58A 2LCWA 5ADZA 2GMWA 3TAUA 1T3GA 3CISA 5BR4A 4NLTA 3QEKA 3TW8A 1C3EA 2NLWA 2RGYA 1SC4A 4ZAYA 1ULTA 2IBOA 3BGFA 1LZLA 3NWOA 2GD6A 5MN4A 2CL5A 1NHKL 1J0BA 2GVNA 3KETA 1NKVA 3OU6A 2YZ2A 3GGGA 4MYHA 1UBKS 1X1DA 4G1UC 5IJWA 2C4TA 3RRGA 4BO2A 2WRMA 1DJLA 4GQIA 1OY1A 3N76A 4TMWA 3PLAE 1XT6A 2O1SA 3WMRA 3F78A 4GYJA 1CQNA 2P1DA 4JL8A 5KJCA 2B94A 4ER3A 3FXAA 5CCLA 3EXHB 2C8LA 2O2EA 5LM7E 3HKWA 1MX5A 2QRVB 1V5IA 5AK4A 4TT8A 1JKIA 2YY3A 1JHAA 3RNLA 4W7SA 2ZUFA 4MK8A 3A4IA 1U9JA 4CV0A 1BMQA 5IH7A 3O82A 5I3CA 4OV1A 5HE8A 3JVVA 5ICEA 3UICA 3DZJA 3TTWA 4CEJB 1NSFA 5F2OA 2XGJA 4J4TA 3GDOA 4B76A 2XA2A 1WCIB 4IGAA 1N0UA 3GJSA 1VQPS 5FV7A 4CH0S 2H2GA 3QA3E 3LQ4A 3JQ7A 2AR9A 2YRXA 1D2MA 4GO1A 2PANA 1K9MT 5E7MA 4EUSA 3G71S 4HP8A 1FNBA 4LF6B 1UDBA 1SUIA 3GBSA 4IOJA 2FZGB 1SHZA 3JQCA 1ZR2A 3VR2D 1HSZA 5KOJA 3P8ZA 2C0PA 4XUDA 5JZMA 4F4IA 3FD8A 5KT2A 3CT4A 3NDRA 2GIFA 1AG9A 1HZZC 2X7HA 4NBSA 1ISHA 3FMBA 2YJ4A 3DWFA 5EG5A 2B4OA 3JQPA 2D2EA 2VNHA 2ZYWX 5COQA 1U2DC 4KCGA 3AB8A 5JXGA 1SJ1A 1K63A 2Q5HA 2BTQA 3JQGB 1XMSA 2D54A 2QA1A 4DCNA 1OZ0A 1PKUA 5JNUA 4JYCA 3DE3X 1S1XA 4JBGA 4CT9A 5GGYA 1G3RA 1MDFA 4UUWA 4LXGA 2Q6KA 1NP7A 4XX1A 1SUWA 1CD5A 3W9JA 1WOYA 3LOQA 3HXMA 4C48A 3L40A 4J0QA 4HDHA 5LXRA 2FZKB 4GVLA 3MT7A 4QPDA 3OUZA 4AQYJ 4HX9A 1W73A 4I55F 1H2TZ 4KLCA 5AI8A 3HE3A 4KWEA 4DCPA 5GVSA 3FAKA 2I22A 1N7GA 5A6SB 4ZP6A 1ULAA 4J7UA 2PH5A 1SGWA 1L4GA 3ZV6A 5ALTA 1HWJA 5A0VA 2VDUE 1DWQA 4ZVPA 2LXIA 2RC5A 4TVBA 2J8SA 2A18A 3R24A 5HS4A 2DKOA 2FR8A 2IPAB 1J33A 5DLPA 4W5HA 3ML1A 2NUBA 5EQFA 1E66A 5B58C 3N7UA 5JQGB 3SXLA 1I32A 2Q28A 1QH0A 1HK7A 1QUPA 2WU4A 1SUFA 1H0HA 1RC0A 4ED8A 3BGRA 3KUCA 1MOZA 3THPA 2LP4Y 1N9KA 4GNRA 2RH4A 1NR5A 1MKYA 1JTVA 4PYLA 3E7DA 4C3VA 3UOGA 1XD8A 5K4HA 3AY7A 2CLMB 1D9DA 2P9YA 4J43A 3L82B 2XCIA 3CDWA 3SYNA 3IOCA 4O23A 4U96A 3Q9NA 1RSCA 1RSZA 2CPHA 2ZOGA 2W6PA 1JQBA 2J9DE 4KGKA 4G8JA 1PCXA 2HXYA 1RAAA 4AD8A 5CB4B 1HT2E 4XR9A 4G9EA 4DLBA 2W2OP 4DUZB 3R6WA 5DDPC 2V8VA 4O02B 4JUCA 5E1BA 4NLXA 4I6GA 3OZBA 4EO6A 1J1UA 2IJFA 4B7CA 2XCOA 2P6RA 4HZGA 1X1AA 4ITSA 1B16A 1U0HB 4XIJA 4EPYA 4FXDA 3GGDA 3MAHA 4XJXA 4JENA 4GSLA 2VH7A 5JY6A 2H0QA 2ZXFA 1HD1A 3GJ8A 2B3TB 5ICCA 3IGVA 1SU8A 3I4HX 2ZTHA 3T3NA 1M5OC 2IWRA 1I7PA 2NQ8A 1JQ5A 3C8MA 5GZ1A 2ACWA 4ZAXA 3OAAD 4Q2LA 2CJWA 1E79A 5EXSA 4OJQA 1DAMA 4LR7A 2ZE5A 1T5OA 3K5IA 2F6RA 3OT4A 1R5OA 4CM4B 5AXBA 3GLHB 3P0FA 3B6IA 3S1LA 2IOQA 3D1VA 4MR7B 3SKVA 2IVZA 3K0SA 3IN5A 1APSA 5TXGA 3UB3A 2CNWD 1FQJA 3ES9A 3AI7A 2MXYA 4S2EA 3WB1A 2FPLA 1FFSB 1X15A 4UHKA 4R7TA 2REQB 4QQKA 5A4FS 2Y1LA 1OWMA 1N2HA 5IC4B 1XAJA 2LA6A 3JSXA 1EVKA 2B4UA 3DOEA 2FWBA 1GIAA 4CLOB 1FTYA 4DL3A 2MKHA 5A5EA 4EHBA 3H2IA 1LBSA 5HKLA 2X5JO 1KEUA 3FF4A 3L7LA 2FE1A 5BOSA 3SYZA 1IIRA 3IFEA 2IMOA 1R6TA 2QN2A 1W1WA 2VRBA 2EKNA 4IMRA 2CUKA 5H80A 5EJ7A 3PV0A 4YNBA 3PXBA 1WMFA 4J90A 2ZI7A 4RWEA 2VVTA 2MCFA 3R0IA 2GRAA 1QP7A 3ZIAA 1LDEA 2QRGA 1EFRD 3DLEB 4D6YA 1CY6A 4ER8A 1R4AA 2V7TA 4RTQA 3FBWA 4USTA 4W92B 2MYUA 1D9ZA 4EF5A 2OH2A 1L7QA 1OLUA 1OFUA 3P9QA 4QWWA 3NLLA 3M8SA 1T6XA 4Q47A 2V98A 1Y34E 2B56A 2NREA 5D1HA 4QDZA 4MP8A 4EI7A 2BGIA 1XKQA 4R9NA 2A2DA 4TUYA 5AJ3F 4QPXA 2BBTA 2AHOA 1HD0A 2QLBB 4G0XA 3GK3A 3B3GA 1L2TA 3WB9A 3IQFA 3BBLA 3SQOA 4HH4A 1RYBA 4IUDS 3WWOA 2VSNA 3MM8B 5DGXA 5EZYA 3D67A 1U28A 2M6SA 2YC2C 4Z51A 3TI0A 1RXVA 5FIIA 3K6KA 1EFVA 2ET6A 3AOEC 3PX0A 2IYOA 5B7GA 1LEOA 4YUYA 3FIJA 3NCQA 1K7SN 3QVMA 4XPIB 2JLFA 2EI5A 4DV7J 1V9LA 1F20A 5IW8A 3QEMB 2R68A 3BDEA 5JTTA 2HRZA 1B2LA 3R09A 3GUCA 2HR1A 2QL9B 2FZEA 1Q95G 2GZAA 4KPUB 3C3JA 1ZH0A 4KIWA 4UNQA 4DGQA 4FCWA 2XKKA 3G8AA 1IM5A 3VR0A 1DELA 4GKAA 2H1OA 3BFVA 4K9DA 3MJEA 1VJCA 3OFHA 3QXXA 1XJWB 4M0LA 3GL9A 3TEMA 3G0GA 4GOXA 3DQQA 1HNXJ 4B3RJ 1HV8A 2XE7A 2PQ6A 1ONNA 1TV6B 3S01A 2B25A 1N5LA 2DITA 3IJPA 3ONDA 3ZWNA 3VNVA 1Z5GA 3KHLA 1Q0SA 3KALA 2F9FA 3I32A 5GQSA 2GJAA 1PSZA 2CHEA 1F48A 4NBKA 2YH2A 2YQZA 3LFHA 2MU1A 4DLYA 2PR2A 3KHTA 3I6PA 1FFAA 1H22A 3RFFA 3ZDRA 4E6PA 1N6LA 3RTEA 3N6LA 2B98A 2WW4A 3FPSA 4YACA 2AUTA 3TBKA 4PNEA 4B44A 2FVPA 3PTZA 2DGXA 1TJ3A 1KLMB 4CIOA 2ZUVA 3M5PA 5B2ZA 2EK1A 4IMJB 1I6JA 2X4LA 2ZIWB 4RVGA 4D0NA 5L1IA 3ADAC 4YHBA 3OY2A 4HNAB 2E7XA 1TFYA 3LUYA 1YZYA 3QIPA 4YECA 2WJHA 1E2EA 1M5PC 4WXMA 3TLGA 3TZKA 2VK4A 3HCWA 4YB5A 3J80Y 1NJ8A 4Y9SA 5J1PA 5DJ5A 1IZ9A 5G53C 2EU8A 3UG6A 1PQPA 4HWKA 2D3ZA 4PLYA 3WLIA 4B9AA 2CVZA 3WK4A 4UQTA 2G1JA 4LRBA 3TZZA 2X4GA 1CRZA 2ZP1A 5I47A 2O3SA 1Y5NA 2EQBA 2NZCA 4ED1A 5DT9A 3U7GA 1NBEB 1R4NB 4YUWA 2MZRA 3IL2A 3MRXA 2YKPA 1ECPA 2TECE 3QV2A 1VHQA 2CUZA 4MWDA 1JTEA 2ZSFA 1NPPA 1WCYA 3KXPA 1GAWA 2C7RA 4DA4A 2PD3A 5FPHA 3W2WB 1Q0PA 5A3SA 2WG1A 4ZIRB 1FP4A 4BP3A 2GERA 3T3PB 3DD5A 1HDIA 3KJQA 2LEPA 2QPTA 1FTRA 3PPWA 6REQA 2JZCA 2R11A 3VU9A 1Q74A 1Z5OA 2EWVA 3COJA 1QLJA 4NYMR 2CQPA 2Q2OA 2PQMA 4YRMA 1XNRJ 3UW1A 5GINE 3N79A 1RAIA 3BD9A 3RYCA 1D0IA 3S7TA 4A4JA 4FC7A 4DIFA 1MDBA 3PFIA 1F4LA 2X22A 4MTPA 2H5EA 2IAJB 3P7MA 4Q3KA 3BIFA 2GSWA 4KHZA 2V69A 1D5CA 1DLIA 4B79A 3CH7A 1NK0A 3ZDZB 2FPGB 1G5IA 4CMGA 2KJWA 3RYTC 1FB5A 5JALA 4TUYF 4TLAA 5HRCA 4LWZA 1CUAA 1ZBQA 3VKHA 1CYEA 3VZHA 3JZFA 2C9YA 1V5VA 1B0ZA 1OV4A 4YROA 5G1NA 4BGDA 3LU1A 3O2NA 2VFRA 5CVCA 2WUWE 2R8PA 5KYTA 5EZYF 2G9QA 4M0DA 4M21A 5IU6A 2J9XB 5LIPA 2QMYA 1HI1A 2AVDA 1FFCA 1OTHA 3A7EA 1KMHA 2PZLA 2O2XA 5EZ5A 1RT6A 3BWEA 1WEXA 4K7JA 5H7XA 3CURA 4PCQA 3ANSA 1SXHA 3D02A 1CJUB 3NEKA 2DGTA 4NJOA 4CM8B 2IDEA 4OGLA 1PCAA 4F38A 5KINB 5DM4A 3SYLA 4BNDB 4O44B 4LF9J 2ZSHA 2PKCA 4Y1FA 2JGJA 1DCKA 3HXPA 2J48A 3IP6A 2GJ9A 4MAKA 1D3WA 3WWCA 2RBGA 1AA6A 2VFAA 4KE8A 4ECQA 1ISGA 1R0CA 4IUYA 3PDWA 2VJQA 4DPUA 1N34F 5AVVA 1P2DA 1HFWA 7FD1A 3FVRA 4DZRA 3DXSX 1I2AA 1UPXA 3CUUA 1JHDA 3IPCA 1P1CA 4G5OA 5B5SA 3N2LA 4PFSA 4YIHA 1N5QA 1EX8A 4DXLA 4J0FA 3VAAA 1M5SA 1DZ3A 4CN8A 1E5TA 1UOQA 1NP6A 1FLAA 3WS7A 1TNDA 5BV0A 1MU2B 3BB4A 5DNWA 4F7DA 1S6QB 1ZETA 3RC2A 1HC7A 2YJ3A 1GV1A 5SY4A 2QE5A 2Z95A 1K5DA 1U4NA 3M2TA 2EJBA 3PFEA 4QDXA 3RG2A 4I6AA 3EOBI 2ZI6A 3HI9A 2OCGA 1BRMA 2A3JA 4QGAA 2JJ1D 4HCJA 4TRRA 1ZVKA 3RKUA 1KC1A 5F35A 3W5SA 2ZSAA 1H85A 4D81A 5EJFA 4I1PA 3UPFA 3PICA 3EXG2 4EWLA 5GY7A 2LDIA 4YC7A 3CIOA 1NY5A 5DMXA 2GTPA 4X62F 2FJVA 2V2KA 3KEFA 4IJ5A 3POTB 1UBHS 1G20B 2XDQA 2IZOA 1ESMA 5A3VA 1TM7E 5AM5A 2DUJA 3EFOB 5D6NA 5FWYB 3NC4A 2ADMA 3VAHA 1L7VC 1OXKB 1GPJA 4RL6A 1U1DA 1F9HA 3KK1B 3ZCUA 2XSZD 3JARB 5CBPA 2NTVA 5LIRA 2Q50A 4HUQA 1K97A 2OAUA 3FNBA 3IIIA 1U1NA 2UXDB 2HBYA 3V4MA 4YQFA 2BSXA 5EE5B 4FMCF 2I3ZA 1JKHA 4ES3A 4ARZB 4Q03A 5KFXA 3HJVA 1TT5A 5DMHA 3OOWA 4K0KF 1F2HA 5FL3A 3MTBA 5D5PA 4JR2A 5AQEA 2I7VA 2IZ0A 3VOTA 4G63A 5JG7A 3OLXA 1IU9A 3SMQA 2ECOA 1TZBA 2JFZA 3DBLA 1VRTA 3QYAA 4UXHA 3NHLA 4N6GA 2OFPA 2HQFA 2X9NA 4IRXA 3H4MA 2QX9A 4DPLA 1NX6A 2FA9A 4O3PA 1YVRA 4ENRA 1OIXA 3VTZA 2OV8A 1DRZA 2KZZA 4I1VA 4ZYYA 1L5FA 5KPJA 5KTOA 5DNYB 3K1AB 5AM3A 1RCOB 5FB3A 1E4EA 3KVYA 2VJCA 3PQCA 2V7GA 2K6GA 5JRDS 4KQXA 4ZAFA 1TUGA 4DYHA 1YDWA 3VVLA 1Z33A 5FBKA 1AK9A 3ADDA 2CQ2A 1SRRA 3B82A 4PG6A 3GVIA 1SURA 3M2VB 5F0WA 4QUIA 3D6FA 1NAIA 4OLJA 4PPDA 2XMGA 2FVYA 1U2RA 3WLTA 3Q3VA 3CUKA 5F7ZA 2G70A 1VSBA 2CD9A 5CUQA 2CZ4A 4AURA 2CD7A 4B3OA 5IAOA 2ZWVA 2AFHA 2F8EX 2XVAA 3JQBA 1MQ9A 4B80A 4WK2B 1LBHA 2OO4A 2SKDA 4MUFA 4E30A 3OZRA 5F51A 2CJXB 1S7HA 3LKBA 4L8GA 4ZZ1A 3OTEA 2G83A 5F9LA 4MQFB 3LZCA 3S2UA 2D13A 2AFIB 4AJEA 4EGSA 1FEHA 2Q1SA 1CEQA 3UQYS 4AC9A 1Y00A 1IR1A 1ZSYA 1YI8A 2GCOA 3DULA 4WERA 4U4AA 5E6SA 4TX1A 2XMRA 5E3AA 4MVXA 3UMCA 2RGNC 2WD9A 1WV1A 4HHHA 2YRFA 1NUQA 1WZNA 4CKYA 2G9VA 4NASA 1PVVA 1TYZA 1GZDA 3QSIA 2AWNA 3DRXA 2DNGA 4BS9A 4C78A 1QCCA 1H2ZA 5E7OB 1LDBA 1NBMA 3UNXA 3HVHA 1SBIA 5BVHA 1VE7A 2AHRA 3K8WA 4U7DA 4PIPA 5KYWA 1O8BA 2CL7X 3PYXA 4EUEA 4YAUA 4WZAA 5JSQA 3NIBA 2WF5A 1HBNA 1GPWB 1QTNA 1V41E 4LZJA 2FJDB 3W9YA 3VPXA 3NOOA 2WWYA 1O6FA 3ZEIA 3NJRA 3WL3A 3B1ZA 2QNRA 4JN6B 1Z8HA 2ZPTX 1J5EB 1V43A 4UVDA 4TQRA 3TGWA 1UPPA 4P98A 1NLUA 4KMSA 2ZRFA 3N39C 1KBZA 3KYCA 1R8BA 1NJXA 5L38A 2I4OA 3M3HA 3WK6A 3OSPA 1E69A 3U5ZB 4WFYA 4LGYA 3DCJA 1TMJA 4PAWA 3NWBA 1HQKA 3QLVC 4R9RA 4LYFA 3VPAA 1CUVA 1SRQA 1LW2B 3N2GA 3H1BA 3OJWA 4C22A 3MGCA 3OKCA 4YYZA 4B4DA 3EGWB 4XUCA 5ETKA 3UMGA 2GGSA 3L7NA 5BQOA 8ADHA 4IKAA 2QUZA 1N9GB 2WHQA 1JHVA 2C8VA 1RTZA 2O67A 2XOXA 4LHSA 4EGCB 2MSCB 1I30A 3ZU5A 1U45A 1JLRA 3KLVA 1QC5A 2HS3A 4GI5A 1IFXA 3V4SA 4ZMSA 2BGRA 2DH7A 4F04B 3PEFA 3VDRA 2HMIA 2CKDA 4QASA 4P74A 2BE2A 4P10A 2GZ3A 3AZQA 2Y0DA 4CIAA 2HT1A 1JHOA 1C4XA 4IHQA 3O90A 4EA6A 5E0OA 2J0EA 4V39A 3TW6A 1QF6A 5J23A 3OPVA 4QREA 2PNFA 1U63A 4URWR 1U2FA 1IXSB 3AV0B 3OZAA 3GNTA 3GJ3A 2FFRA 1YR2A 3CKMA 1QZ3A 2RBKA 4NNJA 3T9DA 5EIFA 1D0SA 3DE0X 5G1PA 2BLLA 4JP1A 1MF7A 3OXFA 1KMMA 3I53A 3K17A 3N6MA 3KYDA 3F5QA 3PC2A 4AWAA 2C31A 1CS4C 2DETA 3GLFB 4M0PA 4UU1A 3HZZA 1P1JA 3H1FA 1AK2A 3LP5A 1E18A 1QUVA 2R7LA 3GJZA 1JQAA 5HP1B 3I2GA 2V4ZA 4X8LA 2Y8YA 3NT5A 4IYRA 1K8RA 2PRYA 4RHUA 3NGLA 2Z1NA 1S1TA 5AJ3J 4FYYB 1K8ZB 3VVBA 3MD1A 3RB6A 4AO8A 2D6FA 1AZWA 1DC4A 3U44A 1HQUB 1JE0A 4DJ5X 1NE2A 1GAXA 4P80A 1OWPA 3IEUA 1EZ4A 4HGRA 1QRSA 4C6TA 1J2YA 4MPPA 1LVGA 3DOKA 3CX7A 1Q91A 2P4EA 5CDFE 1WKKA 1X77A 1VL5A 3V5NA 2EFCB 3ICEA 2AMYA 1D9FA 1VL1A 2V5AA 3GPLA 1DZIA 5IZCC 4KKOA 3AL3A 3CEMA 1KP2A 2FQQB 4JUDX 3WV5A 1MO6A 1T8EA 3RUDA 2P79A 2E4ZA 3WLJA 1DCTA 2IIBA 4J9NA 1RWPB 2VN8A 4DDVA 4NX2A 5CYQA 4DCJB 2WM3A 5FAKA 2HBRB 1BO6A 1RACB 3IALA 3LHKA 2IZ7A 4LUCA 3DAHA 3R6TA 1JLEB 4NI5A 1RADA 3OHMA 1RJWA 2HXSA 3DEIA 4G9GA 1FX0B 5HF8A 2QP3A 4OA5A 1L7NA 5MFZA 4DS5A 4CXMA 4G5QA 2H08A 3P0JA 4UQGA 4INAA 1SOUA 7ABPA 5TV2A 3FMVA 5FV4A 5DBOA 3D6VA 3M3DA 4MJ7A 4FGLA 4P0TA 4HACA 3H5VA 4TKMA 2WVBA 1N2JA 4Y9UA 2D0IA 1K0VA 4CDGA 2AYGA 2VOJA 2HZBA 3SMVA 2ZE2A 2AMCB 4DUYB 2ESRA 3T1AA 1Y7TA 4CMEA 3FLMA 1RPZA 4II2A 3K0FA 3NORA 4IFEA 4WNYA 5L4NA 1EUCB 1IH8A 2WHOA 3K0EA 1ZI6A 5IBCA 3FCAA 1UA1A 3FNNA 1PI3A 3O38A 1KYQA 4EX6A 2WVAA 3M32B 2J07A 4JI1B 1B4DA 3H40A 4UOHA 3CJ8A 1GFSA 1FVSA 2NO9A 4ITRC 3FZGA 1GG8A 1LI4A 5T7LA 2H7XA 3RE1A 2FOLA 2N46A 1F0NA 1YRXA 5SZHB 2BR4A 4H3VA 2GF0A 4V0KA 3R5JA 3NVDA 3H8JA 1WDTA 2RS2A 1DEAA 4BNFA 3ORYA 3JQAB 4OJHA 3A4MA 4N5HX 2PZGA 1RABB 3THWA 2O57A 3KLHB 2O8FA 4ENOA 2QTVB 2KRRA 2Y0CA 3UN3A 4YR3A 3NAHA 3CCRS 4R1QA 2UZ1A 4PLVA 5HDQA 3T9ZA 4DREA 1MCZA 3OFVA 2FC8A 2J3KA 4KLZA 4D02A 1R7IA 5UKDA 4HWRA 5EN1A 1VQ6S 3FOAA 2DX7A 1DC3A 3GDWA 3AYXB 4BBYA 1Q0HA 2IPOB 1ABBA 4NK4A 1RXUA 3UQZA 3HVTB 2H6EA 1JWBB 4I4BA 3IUNA 4OI1A 4C89A 3A14A 4N54A 1QD1A 4AKIA 2V3WA 2FWJA 2VG7A 1QTRA 1FFYA 2VK2A 2GN4A 5IANA 3PDCA 5AW6A 4CWAA 1O3YA 1FMTA 2GA7A 4EP1A 3TAMA 4AT1B 3PR3A 3K5HA 1UZNA 9LDBA 2HC9A 1QAXA 1NQAO 4NCAA 1PEAA 1EA7A 3U81A 1QF7A 5DX0A 4XPZA 4DV6B 2YWBA 5ELMA 1GNKA 2ZT8A 3OT1A 1DLOB 4KMOA 4RX6A 1A8QA 3M8WA 2FEKA 5AHXA 2PVCA 3C48A 2FFHA 2DFVA 2CAJA 1SD1A 1KO4A 2J7KA 2R7SA 2O05A 5C7OO 2E7WA 3VPHA 4UVIA 4BIMA 5AVZA 1LKZA 1NBWB 2WYOA 2O5VA 3LCUA 2W11A 3OXLA 1XJ0A 1KMNA 1EP4A 4V02A 1C3OA 1MSWD 3EVFA 2VCHA 3OKAA 5EE0A 2PPVA 4QGHA 4RDIA 2XB4A 3JQFA 5LMZA 1NBHA 3KUUA 3L1JA 4LECA 4DXAA 3A6LA 4X66J 2IEDA 1HF3A 5JDIA 1G5HA 3GJTA 3VGSA 4YV2A 1RI4A 4OKIA 4RBNA 2PYDA 2HLPA 2Q8QA 3TG8A 1VPVA 5LKRA 2ODPA 4GI7A 5PGMA 3ZKAA 2WLSA 1USGA 2BHTA 1ZA1A 3SN6A 3HD2A 4LRWA 1UFWA 3ZXSA 2H5IA 3IERA 4OI2A 3LECA 2ZU0C 1N34J 1JAIA 5CVVA 4MYCA 2QRNA 4YAJA 4KQ2A 1QYVA 4J29A 5ALQA 1X4BA 2EBEA 4CIVA 2IRXA 1DIHA 4B45A 3EZGA 2JFQA 5KO2A 3UTCA 1NXWA 2PQ0A 4EUHA 3WZLA 5FIUA 1FTWA 1VC5A 3IBFB 3OWOA 3LP1B 4RYDA 1TL4A 2P1RA 1CRPA 1JLMA 1V2GA 5FBHA 2CG4A 2IEYA 1YB4A 5ECGC 4EX7A 1LRKA 1XEAA 4TV8A 4ENQA 2VQFF 3H5SA 1MEEA 3HI6A 2HIGA 3WL7A 2D5IA 2AD5A 1U65A 2E6UX 1S97A 3ESXA 2HJHA 1SXJB 5G0UA 1IZ0A 1N2SA 3K70D 2FMUA 2O8EB 2CMKA 3BXZA 3FRZA 2P2YA 3K4PA 2IC5A 1RRGA 5KSZA 4J9UE 4L5BA 3A9CA 1V8DA 3S99A 4JITA 5DJBA 5DXJA 4X62J 5DT2A 4J16A 3GQBA 3ZI0A 2QK4A 1BAPA 1VRUA 3AZPA 1VJWA 4H6VA 4BNHA 1T4GA 2HA0A 2JCBA 2OUIA 4W8GA 4EEZA 2RHDA 2ZDHA 3EY9A 4X92A 4PG4A 4TS1A 1YOVB 2XCUA 3N2YA 1I94B 3W3AD 5KKAA 4TN1A 2ZJQQ 2Y92A 2WTNA 3EVNA 4M6WA 2BEJA 5KG1A 5AIAA 2GEUA 3R7BA 3LT5A 4JKIA 2OCLA 2VTKA 4ZD6A 5DLQC 2HU2A 5TDHA 3ZFVA 2W2MA 3WGJA 2VPZB 5IHXA 3ESAA 2Z2YA 2YVSA 3FROA 2A10A 1IXRC 3LBNA 1ZESA 4INZA 2F43A 4UBNA 2V58A 3UC5A 1Q20A 4ENWA 5BVGB 1SJ3P 4DLPA 1L8LA 3DLKB 4UUPA 2AP6A 2A67A 4KQGA 1NUSA 2BEUB 3T7IA 4MTCA 3GP8A 2PX4A 3TX0A 1JJCB 2OO3A 2FOXA 3BSYA 3KT3A 1HL6A 3FYUA 1XRQA 1ZAXA 3LF0A 5K8PA 4LBVA 3OLYA 1ZISA 4DNFA 4A5OA 3GYGA 1IHOA 1YI0A 1X39A 1Z6QA 3TAPA 3SKXA 2GPJA 2W71A 2IDJA 5ESXA 1IK4A 1U49A 4K6HA 4FDTA 2XO6A 3COZA 1FD2A 1XXLA 2OCBA 4ZVRA 4ZJUA 2ZH6A 4G86A 1Z2DA 2IF0A 4E51A 1W4AA 1KZYC 1U47A 4LRQA 3NOGA 1GM5A 1TA4A 1SK9A 1JHYA 1MOQA 5BNIA 3E22B 5DM1A 4D3GA 4O8ZA 1I01A 3DBOB 3R7AA 3T3EA 1R27B 4RNNA 5CCBA 3UK0A 1T8PA 1RPAA 3F67A 3Q8XB 4CM3A 2BDPA 3AEXA 4OZJA 3H9UA 2GJ4A 2QKYA 1GKLA 1HYBA 2IK8A 2V96A 2PS3A 3KK2B 1F2GA 2JH8A 5KDLA 4LT6A 2QI9C 3PFWO 2UAGA 2L19A 3O1JC 1XTQA 3SDSA 5CABA 4GSYA 4YAKA 2DEIA 1LGYA 1UWCA 2OZLB 3ZZTA 5BT8A 3DBRA 1LVUA 4X6YA 1EGAA 4R9SA 3RKRA 4BXOB 1N1DA 2O06A 3V8RA 1P27B 3ZY6A 4E5VA 3RTBA 3CEHA 2ZVPX 2FHOB 2Y1CA 1CQMA 4QWCA 2W83A 3BZUA 1TYCA 3HCDA 4L3KA 3PA6A 2Z56B 1JR6A 4D9CA 4QECA 4BZXA 1A98A 4YYEA 3V55A 5HFJA 4EFNA 1DDGA 2FFQA 1FFGB 1KYZA 1KO1A 2VDWB 5GMOA 5ITZA 2UUPA 2Y1GA 1COWD 1T1RA 2WAXA 5JI2E 1ZK4A 4UCQA 3PV8A 3Q3IA 4C1NA 3PF8A 1YIOA 3D0HE 4ZK6A 1S9EB 4QXAA 4RW9A 5AHKA 4INJA 4TV8F 3NY0A 1USIA 1VB5A 3NH9A 3CH4B 5IJ9B 3P4XA 2GBLC 2HNDA 4YMIA 4JOBA 1V6CA 3C6UB 2VG8A 4I50F 3VYVA 3M6AA 3RYLA 3N5FA 1KBQA 4ZJPA 3T0GA 1QFXA 3TSOA 2BKUA 5DHPA 1O5JA 3C5CA 4WH0A 5D15A 4UQLA 3P1JA 3Q7QA 3ZW7A 1T3NA 4DSFA 4QGFA 5J2UA 4ZJLA 2FN8A 3TTXA 3MXTA 5G0RB 1LLFA 1E3DA 5K2MA 2CDQA 3PD1A 4F4KA 4TSRA 2V4MA 4RM2A 1HYEA 1PQWA 3EHDA 3T5PA 4Q4JB 3JAWA 1F6BA 2XMBA 4IRKA 1I3CA 1ZMBA 3CJ4A 5KFHA 3RNOA 3I01A 2YNIA 3M6XA 3D28A 4ID5A 3G49A 2E1MC 2HCTA 2QFJA 4KZPA 4TKVB 2ZH5A 1KAQA 2VKRA 4E5DA 1YZNA 2BOVA 3KR0A 3RRMA 3RTAA 1EZZA 2PX8A 1E1MA 1GKIA 2WU8A 5HBMA 2VZ9A 5ETPA 4E3WA 1T5DX 3A10A 4QLBA 3R6DA 1ZD3A 1Q16B 3FPFA 4NJMB 3DU5A 3RBAA 2JJMA 5U47A 2VYVA 4YUAA 3X2FA 2Q5IA 3DVAB 1WZ2A 3SOPA 1T3ZA 1UDRA 4EGAA 4GQAA 2P4HX 1WC5A 4AJHA 4G56A 5KFCA 4IOCQ 4EFKA 2K87A 2VO1A 2Z9BA 5IM4A 1EG7A 2XMSA 5A0YA 1LRJA 3MDFA 1N5TA 3P5TL 4JB0A 2AQ4A 4C9BA 4CKBB 2HHWA 3G82C 1RTIA 4AJNA 2MKCA 2I8CA 3TAHA 4H1VA 3MJCA 1NF8A 1UFOA 2FJXA 3KK3B 4CMAA 4MW1A 1N52B 1X86B 3F9IA 3SX2A 1P7CA 4JLKA 3J81Y 3M70A 2GAGC 5DLFA 5DHSA 3AB2B 3PM9A 5T41A 1NXPA 3K53A 4RGVA 2FEOA 4NRTA 2P9CA 2WICA 3CC8A 3O9VA 2DLNA 2GO7A 1KD1T 3EG5A 5CT4A 2I03A 1W87A 2DHAA 2P1ZA 3W2VA 1GR0A 5LBIA 4F9FA 2Z5GA 3MAAA 4Z0TA 5ILOA 3NTOA 3HZRA 1TF7A 3FCEA 1T3SA 1QFJA 3IRVA 4YQZA 4IW3B 4BJ1A 4N82A 3I9MA 4R1UA 5JS6A 3HKEA 2H65A 5DBHX 4UQPA 5CXUA 2YJTD 5FWNA 2XTMA 3C46A 1R18A 1A9XB 3LYLA 3SQNA 2WJ4A 3PJRA 5JY1A 2KXHA 2YXDA 4K4XA 3GFXA 3KYLA 5CFMA 4KTVE 3B52X 3MTIA 3U61B 5DO9A 5AJUA 3V1KA 1HBMA 4YFYA 4RE6A 3TFQA 2OP0A 1G6HA 1WD5A 1V8BA 2YJGA 1FYEA 2CLKB 3CVUA 1AK1A 1QQ7A 7REQB 4MRNA 3EVWA 1SZDA 3EIUA 3IAM6 4NPCA 3U9SA 4IR1A 2Y76A 5A1TA 1H74A 1P9NA 1CW2B 2UVPB 4NZPA 1VQSA 4Q15A 1UXKA 4LQDA 4ZVNA 3ODPA 1SVUA 5HDBB 1QIDA 1Q77A 2ZSDA 1G7CB 1QKKA 3IP7A 4HX5A 4OXXA 4X20B 1GZVA 4Q7QA 4QU8A 4NYIR 1Y7HA 4RW7B 4BVAA 4ZU1X 1QIMA 1FVQA 5AICA 1FL9A 3R44A 4JVLA 4E31A 1ORTA 1ZL2A 1MLDA 5J5AA 4Z4IA 1KEEA 3S2YA 3ZGVA 4C8MA 4UZEA 2MSKA 4QBTA 4RABA 3VR2A 3OQBA 4CLHA 4I5EA 5DCWA 4DTIA 1OJ4A 2ATVA 3QG1A 3ZHSA 1E3SA 3P5BA 1YZKA 1WUJS 3HKZD 2WA1A 1WSBA 1Z2AA 5IXJA 4USMA 3GDHA 1TMOA 4MITA 2YZKA 1UQUA 3HR7A 1WI6A 1JJFA 2Z43A 1G7RA 1K2VN 4RD0A 1JLFB 2I3GA 5FH9A 2X8AA 3ZTWA 1E4YA 3K09A 1ODTC 1QFYA 3D8UA 3D6UA 4I8XA 4XCVA 5IDQA 2DBRA 3OFND 3TINA 4B7ZA 1IBMB 6LDHA 2VSOA 2ADBA 4AJKA 4YDXA 1X80A 3TF5A 3WQRA 2B7BA 5DLEA 1VFNA 5KYKA 3PHGA 5E9AA 1NF9A 3QP9A 5HLFA 5IQQA 3DLPX 1N2OA 1CEEA 2CQIA 4B9NA 2OY0A 1PN3A 2Y1OA 2K1RA 3DKKA 1QZUA 4L5IA 2FIUA 2OPRA 5K14B 4BNWA 3FVWA 2I54A 5ETMA 3UF0A 4HB4A 2N3LA 2YKNB 1TVMA 3D4IA 1Z0UA 2GDZA 3K9FC 4G0YA 1XNJA 3WGLA 4OMFG 1Y6GA 2EWHA 5IWCA 1U9IC 4H0CA 4RNCA 3UJ9A 2J7WA 4HTFB 4PLHA 1X60A 1M1YB 1NSTA 4GOLD 4FIDA 3BWXA 4FLFA 2J6BA 5AXMA 2JGLA 4F4AA 4BMVA 1OBCA 4R81A 5B0EA 3PC7A 3LUJA 5E3CA 5A2GA 3EJWA 2GRJA 2E55A 4ZQBA 3AXTA 1IKYB 4Q6WA 1SIZA 2F3JA 2C2KB 1G6OA 3X1XA 2OKQA 4QTZA 5BJRA 3LDGA 3JTPA 3IBWA 1OJLA 1K7FB 2XMDA 4DRYA 3LWLA 2DRBA 1TJPB 3M4ZA 3LA6A 4LOHA 3F6CA 1KKMA 1ZINA 4ANEA 4F4WA 1G5TA 2YNHA 4A8PA 4PHFA 2VHGA 3HP1A 3EQ6A 4UXIA 1NMEB 1RHKB 1WVIA 2C9OA 4DBVO 1L3CA 5JS8A 3ZXYA 2KBEA 2IYZA 2QRQA 3RYFA 2IS4A 3IUBA 3QLJA 4M22A 3AD9C 3BRQA 4UOCA 1HE3A 4OXRA 3QELA 3ZD8A 3CLUC 2QZSA 3OAAA 1QFSA 4LFBB 5AW4A 3C4QA 4I1RA 3C3XA 3VAJA 3PCRB 4H17A 2FCRA 4WZBA 2V4JA 1HKHA 3Q22A 3L9ZA 5JS2A 2GM4A 3FUYA 1J0EA 1FRFS 1E1QD 4D4JA 2CNWA 1FWKA 3I9V9 2D3WA 1BVHA 4IR7A 5HBGA 5A62A 1MG0A 3LQKA 1CDDA 3DKVA 4EWTA 5I7SA 1IAVA 2IY9A 3MCVA 4YREA 2RU3A 4JI8F 1VSQA 4USJC 3SCLE 1UKYA 3CF2A 4UJ3A 1PEDA 1IZ8A 4YAGA 2PL1A 5B2EA 1RXSA 2FHMA 1KQOA 3JAMY 1YH3A 2Q0XA 4JCOA 4RNOA 1XRPA 2NOAA 1J2UA 4EBCA 4XWAA 3NHJA 3WL5A 4YCBA 1IJFB 1YQEA 1UEUA 3G6XA 1RJFA 4TKUA 5HQMA 4EKEA 2A9JA 2I8LA 5F8LA 1RRFA 4QRDA 3NHAA 1XNGA 4UOQA 3VKUA 2DAPA 1GOTA 3AOAA 1JG3A 4U6PA 1D8TA 2XWSA 1LTQA 2VQFJ 2HREA 2PLWA 4DWVA 3NNSA 2X9GA 2XH8A 1EFRA 3T06B 3O8CA 2KQUA 5CP8A 1XNHA 3ZXWA 3N01A 2JJ8A 4N6OA 4UKDA 1QPGA 2IELA 1DBWA 4BRZA 3MM9A 2JBAA 4PFKA 4CPDA 3AM4A 3AKCA 1TIPA 2MIIA 3IR6B 4OBXA 4DSKA 4B84A 3NBPA 5JATA 2LGJA 4WWHA 1T6ZA 1QYRA 2RH3A 1QMPA 1N8KA 3L05A 5BRNA 5AHOA 4QM6A 1C0TA 4H0NA 4O2BA 1WL8A 3RWOA 4J0GA 4L2IA 1T05B 2QUJA 4F60A 5FUYA 3TSWA 5IFLA 4O3NA 4DCCA 4UZFA 5C7LO 1N48A 4CF3A 5C51B 4K6CA 3L0PA 3AUUA 2OP5A 3B1XA 2ZTLA 4F9GA 1QH8B 1C1XA 4KE5A 3H9CA 2VA9A 3N3BC 1PWHA 4DV0F 2Q3JA 3GXBA 1F51E 2QF7A 4BNUA 2CPIA 3WSVA 3BTOA 3OLZA 3CUSA 3RAFC 2B7CA 1GYRA 2CKWA 1NRKA 3FTFA 4R69A 2HFUA 3ZS8A 2PK3A 1C9EA 3WZMA 2WB1D 4Q4CA 2M9MA 4EKDA 3TZEA 4HDMA 4QFBA 1SCDA 1MFZA 4LZWA 4HYEA 1W94A 2N75A 3O2JA 3HEMA 1HBOA 2FLNA 4BHTA 1UKVY 3QEJA 2YDXA 3ANMA 3UJNA 3WRWA 5HJ7A 4HSGA 4G1PA 1ZXBA 3QRPA 3EW7A 3H04A 3N4WA 2VDPB 3QWPA 3BEOA 3CXRA 1NW6A 3QYYA 3KE8A 1ZD4A 2CJKA 4GZ3A 1C1HA 3OPNA 1F8YA 4BLWA 3CZQA 4ENVA 3R9XB 4DV3B 4TXSA 1H5QA 5C5DA 1P74A 3I5MA 4EB6A 2QC3A 2J9CA 5AE3A 4D9BA 1ZGJA 3HCNA 4EFLA 2RK6A 2EZ8A 4MCAA 2G2OA 2F1IA 4EKIA 3ZCVA 5H9FK 3HVWA 3O4IA 3QNWB 2FUEA 4IIJA 3IP3A 1XIQA 1VM6A 4F0HA 3CMCO 2AU0A 1EX6A 4NOHA 3R40A 5FEMA 4OREX 2R1VB 2AJDA 5ECYA 1RMQA 5K45A 4AJJA 5SZIA 2MSLA 2VDIA 4Q02A 4OUDB 4LF8B 3PNVA 2PKWA 4FXPA 2R6AA 1QJHA 2DJIA 3UK6A 3QY0A 3HSZA 3KQQA 2VTBB 4O3QA 3S8MA 3G1TA 1MC1A 3OSZA 4DANA 3W9BA 1YQTA 2XB6A 4K59A 2YV5A 5FPTA 3ENQA 1XKLA 4PSVA 4WA7A 1FJEB 5KNDH 1P4GA 4TL8A 1M74A 2R8JA 1L5UA 4XGKA 4NXMF 4QHTA 2R6FA 1C81A 1AIPA 4RNMA 2RJNA 4FNOA 2CT8A 1KAMA 3QVWA 1T0IA 5FCDA 3WWEA 1W25A 1ELOA 4I3FA 4DWJA 1VRWA 2WU0A 1UEKA 5ETJA 1RZRD 2BEKA 1JIVA 1SCJB 5DDQC 3PXXA 3BIOA 4FFPA 3LLSA 4ZV4A 4ZMRA 4LYHA 1I3NA 2XWYA 5JMPA 1RT1B 3JQMA 2B8TA 1V6HA 2J3EA 2NQ2C 1T0PA 4QX6A 1ONSA 3P4UA 4UFNA 4AY5A 4C9DA 5KSOA 2JEFA 3HHEA 4NAVA 5K3OA 4OHYA 1RA7A 4NWBA 5IM0B 4QKQA 5ENDA 1P7YA 2JEOA 1ZUNA 3AR3A 3RVDA 4QXMA 3KLIA 3H6HA 4ZMMA 1LC3A 1A7UA 2YWEA 5AT1B 2NYAA 1PFYA 2JEIA 1ZYQA 5CURA 1E3JA 4J9PA 1J8MF 1U5BA 3OJFA 1T8YA 4P3NA 3FUUA 4LC0A 1IM4A 1XDUA 4PX2A 5KNDA 4EHJA 5ECWA 3ZCSA 5EPOA 4U8GA 1KFBB 3VVTA 3JVUA 2AI2A 3JQ8B 2VHVA 4DQVA 5ADVA 3ABSB 2Z30B 2HZAA 1LQ9A 1I3OB 1N5OX 4FU0A 3M33A 1G1AA 4H1UA 3C0KA 4MGZR 4RH1A 3F41A 2X58A 3ZYCA 3LA8A 4D82A 1QYCA 2XS2A 4ESEA 1HDEA 4OJYA 4M49A 1U3UA 1AUOA 2SBTA 5KT7A 1HW8A 1L3UA 4PR0A 5H5JA 4IIGA 5TT1A 3WWDA 1KPIA 4KXQA 1I33A 3PDIB 5DN6D 3LW7A 1WKCA 4MCHA 2PEYA 3OFEA 2GLUA 3I01M 2EOAA 5KYVA 2NX2A 4TTRA 3BHMA 2XLJA 3L6RA 2XWBF 5CAEA 2O1WA 3SF0A 3SIRA 5A5VA 3O8RA 2HIMA 2RDJA 1HI9A 2J9YB 4F1WA 4X97A 2ZJZA 2IKQA 4Z54A 4W5JA 1K68A 1X0PA 1U0NA 2VFTA 3GEDA 3CJ0A 3RU2A 1I3MA 1QVVA 1A4UA 4D6PA 1R6DA 1EXVA 2I8EA 4N48A 3PJEA 5CIWA 1JIQA 4DT1B 1OYEA 4KNWA 3NMUF 1NFQA 1NTRA 2HCBA 1VLJA 2ZB4A 5LQCA 3IIMA 4WSOA 3FETA 2CN1A 3FDFA 2JJ1A 2EFPA 3OOHA 2ZUDA 4RUKA 4EYGA 5AFSA 1Q8LA 2PGNA 4W9RA 2P5YA 2D7DA 4CLRA 4O4IA 1JHUA 4MS3B 1ZZFA 3VNQA 1RW4A 1WD7A 1U0RA 3HXTA 1LFAA 2VUUA 5AYVA 4BTLA 4MRMB 5BN4A 3P9IA 1JMKC 2ID7A 2OMEA 1R0RE 3Q72A 3D6MA 1XKTA 1U2DA 4TTIA 2XSZA 3GB9A 3LAWA 4MA4A 4GOMD 1JH9A 1FHTA 5I8ZA 1BG6A 1F0YA 4HG2A 2VJMB 1UVIA 2YHBA 1JDBB 4XW2A 1VDHA 1TZ2A 2PUBA 1XU4A 1PJ5A 5M7EA 1K3FA 1F4PA 2HA5A 1BMDA 4L78A 4JB8B 1G0OA 1Y8RB 2JGNA 3A8JA 5JAHA 5K9ZA 1WHTA 1W1UA 4MUXA 4YY3B 4PC3A 2Q4RA 3OQIA 4NDNE 3R5HA 2LEAA 4PLCA 3T9AA 1U6FA 4ALKA 2GIRA 4DPWA 1UEIA 1U1FA 2FQYA 2O7NA 2OPSB 3QLTA 3QFFA 3I45A 1S0MA 1PS0A 5EJ6A 3L0YA 3ZBTA 5KFIA 4BYMA 2LW7A 4UBIA 4IOAQ 5EXPA 4YCJA 4V0OA 3KK0A 2BTEA 3GG9A 3STWA 2A9FA 4YRLA 3L1UA 1R0YA 1MWYA 5B4TA 2VWPA 1BJTA 4QU5A 5F64A 3KQPA 4F21A 3RAPR 1NMXA 4ZODA 1HMVA 5AVJA 2RE8A 3FFTA 5AKJA 1DRJA 4LMRA 4ZLJA 1HLFA 1K6EA 5EWJB 1R4MB 2IZ6A 3TZWA 1RC1A 1QVRA 4HUJA 4Q3LA 3F47A 2HL6A 2V7WA 4ETWA 3KKZA 1O6CA 4N8DA 4JMPA 2HIQA 2YHUA 4DPYA 3KTDA 4QOEA 3U4HA 1QU3A 3EIFA 5A7GA 4OQMA 1M7GA 3MFIA 4KTQA 4ND3A 1EGMB 4F1JA 4UOEA 1KI6B 1WXHA 5KNDD 2IZ5A 4M63A 2ZKTA 4D3HA 4CG0A 2RDDA 5GJVC 2Y0PA 2JLVA 2BFDA 4GLBA 2X9VA 2B4RO 1QRDA 3RB8A 4LRAA 2QQ0A 4X66F 3IBGA 4DSOA 2PGLA 5CTAA 3RWBA 3PC8C 3DMPA 4Q1FA 2MKKA 1SCKA 1EB0A 2HI0A 3BL5A 1QRRA 3QK7A 4RW4B 3BHIA 4RKWA 4CCYA 1PJZA 4JX9A 2XOEA 3DNMA 1OMSA 1HQDA 1WZEA 1C1DA 1I6WA 5F7OA 4D9KA 1IMJA 3K0AA 1C7JA 4OB8A 2IHUA 3U7EB 4G1IA 1U0GA 2YCLA 2OCDA 6FD1A 3ELHA 2QG9B 3HRIA 4GOND 3VPDA 2V0CA 5LNK6 3GGOA 4WGFA 4RSGA 3UW3A 1SKYB 3RHSA 1DBQA 2F3SA 3GRAA 2XUKA 2ZANA 1MH1A 3DOJA 3LHFA 4PXDA 3UMRA 3F96A 3I6YA 2ZYRA 5EJ9A 1M2KA 5TPWB 2H9YA 2ETVA 2IHJA 1ABFA 1JU4A 1QDLB 1KWMA 1VG9B 1Y48E 2W6MA 1K66A 3NBUA 2YX4A 1QLHA 2DQKA 4O4IF 4B0OA 5LQNA 5F3ZA 4UFPA 2ZM5A 2JFNA 3PQEA 5CW1A 3EHEA 4J1TA 2E9RX 4D74A 2E3JA 3BJRA 2OD7A 4CKEB 1IM2A 3TQSA 4HOYA 1ZOSA 2P3QA 1IOVA 1T7PA 1ZBTA 1B64A 2YV2A 4OYIA 3KQHA 5BR1A 4Y6QA 1J8DA 3MM4A 3V6JA 3ZTOA 2G7ZA 4Q0BB 3FBEA 3V6LA 2FW6A 1U24A 2GI4A 3ZNJ1 4HFRA 1GSHA 1ENZA 5B7QA 2CNBA 1RWMB 1EEHA 1O1YA 1RAGB 4NFSA 1Z47A