4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
molecule tags Isomerase
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
3DDNA 2RE1A 3TUIC 3TX2A 4LUBA 2J0XA 4NMLA 3IXQA 1FS5A 1YBAA 3S1TA 2J0EA 4TM7A 2RI1A 2OKGA 3NWPA 3HN6A 4R9NA 1LK7A 2RQKA 4GO1A 2QMXA 3BXGA 3EFBA 3ENWA 3OFHA 5T41A 3MAHA 4GO5X 4X84A 4OQQA 5FIIA 3NZEA 2MDAA 1SC6A 4GMKA 1U8SA 3MTJA 1DEAA 1RWUA 4L50A 5IS2A 3LUYA 2NYIA 5IT0A 4L4ZA 3NRBA 1JT9A 3ENVA 1FRZA 2P9CA 3ICOA 5HJ5A 2W48A 3OC6A 3DHWC 2R5FA 4L5IA 2QRRA 2FGCA 3L7OA 4IO1A 2DTJA 5IT4A 2P9EA 3BXEA 1UJ4A 2PC6A 3TUJC 2LQJA 2F1FA 1ZPVA 1HOTA 3OFEA 3O1LA 3EB9A 2PA3A 3HHEA 1Y89A 1FSFA 3AAWB 1O8BA 3K5PA 2QSWA 3AB4B 2RQMA 2DT9A 4L5JA 3AB2B 2O0MA 3MWBA 2LVWA 1Y7PA 3W7BA 3CH7A 2CDQA 1PSDA 3LWDA 1VL1A 3ENQA 2I9SA 4TM8A 3DC2A 1PBTA 1UJ5A 4L4YA 3OFFA 3BXFA 3U7JA 2BKVA 2WU1A 2KO1A 4R7TA 1M0SA 2RI0A 1UJ6A 2BKXA 3CEDA 3P96A 4GO7X 2JHEA 2GNPA 4M8LA 3CSSA 3OBIA 1XTZA 3E15A 4PWUA 2P9GA 1NE7A 3LHIA 2F8MA 2ZHOA 5JJBA 3E7FA 2J0WA 3OFGA 3KWMA 1FQOA 2QMWA 3DHXA 3KV1A 3BXHA 2JOQA 4OQPA 1HORA 2H9ZA 1KS2A 3N0VA 3UW1A 3TUZC 1YGYA 1LKZA 1FS6A 3IBWA 1CD5A 1LK5A 4L51A 3LOUA
chains in the Genus database with same CATH superfamily
3T5LA 2ZQZA 3VR3A 4Y1RB 5AW9A 5U1PA 1P9OA 1NUEA 4EEZA 4L1KA 2NXUA 4W4TA 2FFHA 2VA8A 3MWJA 1VGVA 2ZWPA 3PE4A 2AYXA 2OBBA 4FD3A 1GEGA 3HULA 4AI6A 2PH5A 2YIDA 3WGHA 2BABA 3PNPA 2EQAA 1N3YA 3M8PB 1DJOA 3ONVA 5B1DA 1E2BA 4WTYA 2OBMA 4X71A 3K89A 5I3QA 1M1YB 4YLGA 3LDFA 1I4EB 5HANA 1TMJA 1NI4A 3WL5A 1A4UA 2ZT5A 1MO5A 3OAAA 3H0PA 4RW9B 3W3AH 3M8KA 4L6IA 2ZWVA 3UUWA 5K6AA 3MGGA 4A15A 3ZHTA 2YFHA 4L8LA 5BYKA 5EHHA 1S7GA 2WRZA 1B0AA 5F4BA 2OPPA 3BB3A 3N8IA 2E4YA 4C30A 1W4RA 5DYYA 4MH0R 1W2BR 5A9SA 3SZGA 2DFTA 4WFZA 3OPVA 4DC1A 3B9QA 1AHHA 1SVMA 2WK4A 4IUBS 1W6UA 5GVQA 4I1SA 4WWHA 1JAXA 2D4HA 2C0PA 1F5CA 2OTJS 1LLUA 2HCBA 1K7YA 4YXFA 2C95A 1QSSA 1KVTA 4X3OA 4I3FA 3C5EA 3IUSA 4JS0A 3D4OA 1ZOPA 2E9SA 3QX8A 3PUIA 4RF5A 1IHUA 3W5BA 1X7ZA 4QNMA 1NK4A 3UWKA 2CPEA 4J2OA 4MGYR 1AO0A 2FGKA 3CLKA 4ILEA 2ZTSA 4P34A 4Y34A 4YONB 3K5PA 3PDJA 4L57A 1C4KA 4KRYA 2ZUAA 1QVZA 3HNPA 4KLRA 4U39A 3WLQA 4MFBB 3D6MA 5IJ9B 2FPPA 4ZVUB 1VCMA 2CXTA 4H6WA 2IXTA 4RY8A 2JI7A 3DOMB 4BC7A 1MG7A 3X2FA 2IDLA 3D2BA 4R8RA 1A2OA 4HZUB 4P3XA 1YR7A 1U2QA 1MV8A 1HLWA 1P5HA 1Q0QA 1Q16B 3A12A 2P1DA 3QRRA 2GJIA 4UZEA 1PHRA 1VQ9S 3D8BA 5LP6F 3SFUA 3OJ0A 1KU0A 1JWAB 3Q3CA 2IEGA 3PFOA 1C0TB 2GVZA 1F9HA 4BMCA 3RUEA 2VNAA 4WHMA 1UWBB 1R2QA 5FPPA 4MVWA 1NJXA 4XI9A 1ZVMA 1PJ6A 4RDHA 3MR3A 2VXYA 1AURA 2NTJA 2WV9A 4DY6A 3MERA 1NMXA 1YRBA 3HCCA 1REGX 1CZNA 2POCA 2Q0SA 2C4WA 1A9NB 3V2GA 3N59A 1SCJA 4EPXA 3OE4A 5EKSA 1UBGA 2HTEA 4IH6A 4G0XA 4MV4A 4NZ6A 1JJIA 4DBQA 5G1OA 5DRKA 4LE2A 3KD3A 2FVCA 3MM5A 3RIYA 2FHMA 3SP1A 5LD2C 1WLYA 1U0RA 1DBRA 1CK4A 4V0SA 1WHWA 3B1WA 5KJEA 1JLCA 2PS9A 4RKYA 3GLIE 1YKGA 3Q7IA 2OHJA 1WI6A 1R0RE 1UM9A 2MSSA 3ZLJA 5K3BA 3B82A 4NYZA 2IRWA 4NMMA 3MRVA 4BCAA 1T25A 2AKAB 5I8PA 1DBDA 3HS3A 4PXBA 4W90B 4XAKA 2X5XA 1FK9A 4CHGA 3AU9A 3QBVA 3O7WA 3K1TA 1U2FA 5L3SB 3KG0A 2Q2QA 4EW1A 1U8FO 3D1QA 3GUUA 4WXYB 1F8GA 1CJKB 3RAXA 3OIFA 3CCLS 4B4WA 4DDHA 1X39A 3DE5X 3C7KA 4CKEA 3RI3A 1T4CA 3NIDB 1IKXA 1EX6A 4U2KA 4A5OA 5FLXA 2MB0B 1KFDA 1K4MA 2POKA 2Q3LA 2AGPA 4ZPDA 1ZUWA 3ZXYA 3BTSA 4ZO9A 1JMYA 1YA8A 3AQIA 1EAYC 1SCKA 1T94A 4Q8EA 1PU2A 4MCAA 4BO7A 4A2QA 5ALLA 4D3DA 1N56A 2LEPA 3U4GA 1QMPA 2G09A 4JV0A 5KNBD 1UBFA 3RIMA 3LKZA 2XZPA 1QLWA 2C7RA 4CMJA 4RE5A 4YX9A 2WYOA 1KSPA 4R8UA 1Z75A 4FI3F 4DG5A 2C3YA 3DW1X 1VQLS 5B08A 1F0NA 2OAQ1 4JHLA 4PXCA 2BGLA 4F50A 5JC8A 2VDWB 4WK6A 1YV9A 3LHDA 1Y1TA 2OD9A 1AT1B 1C8KA 3UCGA 1XMIA 1OBCA 4FZRA 4YRGA 2WSSD 4OP2A 6REQA 4W9NC 1NBEA 3HB0A 4JNCA 1MROB 4F97A 1WM1A 4EHNA 2XKAA 2DUWA 3ZY6A 2QZ9A 2IT1A 2DPGA 2XUFA 2U2FA 3F9RA 1UBMS 1UKZA 5C5CA 3IQXA 4LNHA 4NOMA 4NYMQ 1EUCB 4FGKA 1XNRB 1XKQA 1M5SA 4ZCQA 1SU4A 1SQ6A 2BZ0A 5D5HA 2HWTA 1BDBA 3TW0A 3R3SA 2I6XA 4QAJA 3CNLA 3I6IA 1WO8A 3GJSA 2SCUA 4B47A 1NPRA 2A67A 1SUFA 1GR1A 4LX0A 2J9FB 3HYRA 4XARA 5KX5A 1KOGA 1XPUA 5J4HA 1NG9A 4OIXA 2EJBA 1N4DA 3AOBA 5DWDA 1Z88A 2ASYA 1KRXA 5CDGA 3OIYA 4ZP8A 3BREA 2FFQA 1ZN7A 3LLMA 1YZ7A 2X7XA 4TMYA 3BIFA 2VZEA 3KUCA 3TLMA 4YWJA 4B3CA 1H22A 4Z5XA 3LCJA 1JU3A 2ZBQA 4YO8A 3HMJG 1Y5RA 3ASZA 1ZA2A 2HF8A 3IUJA 2HA2A 4FFNA 1T9WA 2AYMA 1KFBB 1FUEA 3RT7A 4YNBA 4C2AA 3L7YA 4DLNA 2O2YA 1U2RA 4DPTA 3PFEA 4REQA 3VTKA 4DYVA 4MI9A 2ZIZA 4F21A 4Y3CA 5H0IA 1XZMA 3DMTC 3RWBA 2QUZA 4ZTBA 1QORA 4J1NA 2CWDA 4TMTA 2DHDA 4B4KA 4DFMA 1TIPA 1L5ZA 3OEEA 1P3Y1 3TARA 1JSXA 2FTRA 4KX3A 2Q2WA 3GN2A 1YMUA 3FETA 1M2WA 1L7BA 1P17A 5BQOA 1KKMA 4Y2VA 2MKSA 2ZIUB 1YX2A 1Z33A 2P2DA 3RS0A 5IBCA 3MECA 4GKAA 3CX8A 4YAOA 4ARBA 5AVRA 3NL0A 4I81A 2DT8A 4DLXA 1CC7A 3CU5A 3PG9A 4X1IB 3SCLE 3CCRS 2H4WB 3X1ZA 1IAVA 4G84A 2BDTA 3UR0A 1P5ZB 1XK6A 4Y2CA 2JKZA 2X86A 1D2NA 4ZOLB 1WG1A 4TUYF 2OXCA 4Q3AA 1DRWA 5I4IA 1N0WA 4QYIA 2DLDA 2NQTA 4LJ8A 4MA4A 5FL3A 2P1ZA 1H3DA 5B1HA 1CUZA 3P7MA 4CH0S 4MR8B 4QJBA 2HUNA 5F35A 5DXFA 2M6RA 2VH5R 3CMMA 3FPBA 1U25A 2Y99A 4WK3A 3Q6MA 2G1KA 3QFRA 4S0ZA 2ZBEA 4UAUA 2QC3A 2HZCA 4RLFA 5F9NA 3FLEA 5DO2A 1AUQA 3QRWA 3QELA 1F0PA 2QWXA 5BN5B 3TNLA 1IAQA 1OV6A 4URWR 1XU7A 1II9A 1QX3A 3S2UA 4C7JA 1DTQA 2FVQA 1GMWA 4ZPVR 3F74A 1ICIA 3GAAA 1NZAA 3VYSB 3TLAA 3VPHA 1E1DA 1BXRA 1Y8RB 1JLEA 2J0VA 3KPYA 2WSLA 1K2WA 3STXA 2JFHA 3ZZ1A 1YJBA 4GC5A 2W71A 4JI7F 4ME6A 4NJMB 1QAJA 1C1BA 1DUIA 3FNRA 1NW6A 5AKEA 4CMEA 1T13A 3IMEA 2W8BA 1Z0AA 3IUEA 4OJ1A 1LX7A 5CD4H 5HIJA 3ZV5A 1JKHA 5HZGA 4X4PA 3EVWA 3D54A 2P4SA 3KU4A 2VUTA 1WXIA 2ZIGA 1H85A 2XY4A 5AVWA 3LPNA 5HZHA 2P5YA 4G8DA 1B42A 1J06A 3LRPA 4Z2YA 3SIPA 3B7WA 3O93A 1CSEE 1Y5NB 4WXOA 4MKFA 3REQB 3RC8A 1G6Q1 3WRVA 4N56A 4W9MC 2BANA 3FGVA 3A27A 3GV0A 1J8FA 1VIAA 4IMPA 4OQXA 3RVOA 2GN6A 5HZMA 4DJEC 1VHLA 5JXJA 1YBVA 3D7SB 2NUTB 5EYPA 2TMGA 5EFOA 5IWAB 1K98A 2FZKB 1OZGA 2I4LA 4N5NA 3VZBA 4JP1A 2W6NA 2TMYA 3R0XA 5BVHA 1M1NA 3GJQA 1SIWB 4M5JA 2CDBA 4RD6A 4ED4A 5TLSA 2WBLC 4M9UA 4DV7J 2QFJA 1URRA 2JATA 2BQRA 2P40A 4A0QA 5J40A 3U62A 1FDIA 1J7KA 1JR3E 4UD2A 8AT1A 4KMSA 1R64A 1XFAA 1GAJA 3TIFA 1SA0A 3FM9A 9GPBA 2W2LA 2XMMA 4DY4A 3RJZA 1TQLA 1SVLA 1YOBA 1P77A 2VYVD 2XRZA 2LZ0A 3VZDA 2EZ9A 3J7ZT 5JADA 3JQGB 4JX9A 4JT2A 1ZO8A 4RULA 1E6KA 2XMUA 3IEPA 2Y6UA 3VALA 2X15A 2JCGA 5AM5A 4XQ0A 3IFSA 2QM7A 4BLQA 3NTUA 1E4EA 1NNUA 2E1CA 2HX1A 4JI6F 1G41A 3BKFA 1LQTA 3GLHA 2QXYA 3PXEA 3MM8B 2Z8YA 1CDEA 1OLXA 5JS2A 5JSFA 2XS7A 1U6FA 5HF9A 5HKKA 4UBJA 3X1YA 4O2BA 2XCTB 2G82A 2PL9A 4EHIA 2PUBA 4M0CA 1SZCA 2VCEA 2ZAOA 5J2TF 4OI6A 2GNOA 4GLBA 4USJC 2AG5A 1G9XA 4R7TA 1U2TA 1A8UA 1IY1A 1KARA 3GRUA 1MXFA 3QHAA 5K8LA 2NYUA 2FWJA 2OHXA 3VV3A 1DKPA 1NVDA 4CDMA 3HPOA 2QMWA 1C7EA 4GXQA 3MUOA 1IBCA 5FI0B 2J7PA 1XD2A 5B0BA 1VRCA 4B3TJ 4HVZA 2YR0A 2PXCA 4KITB 4HADA 4QBTA 3KSUA 1NVXQ 5JJCA 2FGOA 4I1YA 3J80U 4TKVB 1GUZA 1COWA 3LGAA 2R25B 1JZQA 3K0HA 4ICLA 4BB9A 1Y8ZA 4WU3A 1U99A 1AZLA 4HWKA 1TKCA 2VLIA 2Y2VA 4Q7MB 4NMHA 5IJZA 1SKYB 4ZOAA 4DV5B 2OAP1 3I9V1 1KI3A 3CF0A 2MYPA 4MB2A 3NWRA 4O44B 1R6YA 1R8YA 4J75A 2XO7A 1BXZA 2YNHA 3OL9A 1ECJA 1KJ9A 1NYTA 4CI0B 3UAXA 3MR5A 3ZU3A 1LEHA 5DN6A 4ZVEA 1FUUA 2X9VA 1H38A 4EKGA 2DXDA 1BE8A 2EI5A 1RXSA 1RYBA 1VG0B 1CQZA 3VSEA 3P0FA 1I7LA 1KQFB 4FZ3A 1AZSA 1P8JA 5G0SA 3TO5A 2FRDC 2YNGB 1CC8A 4KB5A 1SC1A 1JDBC 1P29A 4C97A 3EIFA 2EXUA 3QVXA 2ZI3A 3QKWA 2VG6A 2VJQA 1U2DA 3G1TA 2J3KA 2FNAA 2J0EA 2Z30B 3TLJA 4DMCA 2H07A 1XEZA 2CDRB 5DCLA 1YZ3A 1P9NA 2VWHA 1PQYA 5KYYA 5EX0A 4DV0F 3VAFA 2HFOA 5DDIP 1T9DA 4YTEA 1DG9A 5JAHA 3FZ2A 5DNYB 3N01A 1VDMA 1KC3A 3ZZNA 1JQEA 3IQFA 1YL5A 2W22A 3FRZA 2WF7A 1TUEA 5EMJA 4R84A 3TIIA 1TL3B 2XMJA 1YWGO 4OHFA 1P2GA 1LVGA 4CF4A 4IM7A 4HSGA 3A3KA 5JE8A 3U4HA 3L4EA 4M9RA 3QFFA 3QPIA 4NARA 1G3IA 5KWVA 3O2JA 3WNQA 2WE7A 4MS4B 3OTGA 3DOKB 2BMVA 1FPQA 2EKDA 2PA8D 5G4KA 1N34J 1TDJA 3UJ3X 1LW2B 2FMTA 1T91A 3SJUA 2Z5VA 3K0BA 5KKAA 2R9LA 4JI0B 4V1CI 2MLYA 2IODA 1U5CA 5DRYA 3L09A 5EWEA 1O6BA 5A8RA 2PKRA 3HJBA 3UAYA 2WWVD 1HD1A 1GX6A 1K8YB 4Q3CA 4YRLA 2RGYA 1Q91A 2GESA 1JLFB 4OJTA 3F49S 1ZD3A 2VJUA 3EVEA 2I6QA 2WHPB 5GAEI 1FP4A 2YASA 4CTMA 5HKBA 1T1JA 3GFZA 2NYIA 4RY9A 2E48A 3GE9A 5DLPA 1P3DA 3O2SB 4PHTA 5DJ5A 5L3QB 4BZZA 4U7UD 1D4OA 1Y8QA 2ZRJA 3DEKA 1A7AA 4JLDA 1I6LA 4Q21A 1JA9A 4MINA 3ZO7A 3VNAA 4PX5A 4LF8B 4KDFA 5JD3A 1NLZA 4URZR 1IQTA 5EG5A 4QLOA 4W1QA 1S9GB 4G6VB 1KFJB 3LP6A 3TAUA 1AF7A 4CTAB 3IQDB 3F5FA 1T4BA 1Y3IA 16PKA 3STHA 4TXHA 4R0JA 5C0OE 3TSCA 3EGWA 3K5LA 4A48A 4O3OA 5KDLA 1UP7A 3JQAB 5IAJA 3EUNA 2AT1B 1KI7A 1JHAA 2N3ZA 4TU7A 4TRNA 3EGXB 4GDMA 4MVJA 2QBYB 3H2UB 2PCJA 3LH2S 1S8NA 1LVHA 1GTL1 4HJRA 2NO7A 5J2NA 2BD0A 5TQ2A 3FZBA 4J2HA 4K9DA 5A3VA 1S8FA 4B3IA 5GIOE 4EYGA 3S4YA 1HI8A 3STYA 4JMPA 3K92A 1YDGA 3FHTA 4PICA 1S12A 4CLRA 2VEOA 4CWBA 4AY4A 3DDIA 4KV8A 4D9GA 1QRDA 2DFLA 3IJRA 3G2LA 1P9LA 3MQFA 1JXEA 3HB4X 1S9EA 4E5DA 2R7OA 1H42A 1FP2A 2XGSA 2KBEA 3O8QB 4BLSA 3O94A 4R1MA 1RCOB 2ZBVA 2VEDA 4GGMX 2O52A 3UMJA 2IKSA 4ID9A 2WABA 4R3WA 1G3UA 5K0EA 1OUMA 3AF6A 3FMFA 1PZFA 3EPLA 3T5DA 2JAXA 1KJZA 1VRVA 3DUFB 4IIDA 4CIWA 3C1AA 3DKDA 5LQCA 1NXOA 1WHSB 4C7OA 1X70A 3W5SA 1EXVA 3OD1A 4TVKA 3LKVA 1A82A 5E1OA 5TMPA 5SUHA 1S4FA 1XZPA 2XE8A 2YS7A 3C16C 3KM0A 1L3TA 5AK5A 1K3TA 5B3LA 3PJXA 1C1YA 4BGEA 4HG2A 3ZHCA 4FFMA 2VJCA 1YDEA 2Q5CA 5FORA 4QDZA 2CF6A 4F2RA 2I7DA 4OO3A 5C5IA 5K99A 4PBSA 3FFIB 4YMSA 3D64A 1QZ3A 3CH7A 4KODA 4LYYA 2X6RA 2O2HA 4WNCA 4N8SA 5D01A 1C9NA 5DMXA 3DLBA 5KT3A 2C22A 3NM5A 4B7UA 1XZIA 3L1KA 3L5OA 3EXFB 4MRSA 1V25A 3H84A 5JALA 3QQPA 2BGNA 4KHMA 2SKEA 3CRQA 3ED1A 4U8HA 1C4WA 1ZXXA 1VBFA 1RTTA 4CCYA 1NQ5A 4X41A 3EQ9A 2MQMA 4DEZA 5DM2A 5IEBA 3CO0P 1B3BA 2W4QA 2V96A 1VI7A 1LJ8A 3U4QA 1WI8A 2J0XA 1KBOA 4PHFA 2QX6A 4CKBB 4IZIA 4OYRA 3INRA 4GQBA 5A0YA 5ITWA 1MO6A 1PTJC 2YHBA 2VHEA 1E9DA 1JNRB 2C8LA 2H4FA 2ZI7A 1UPCA 4ZOBA 1U7UA 2UXDJ 3NDRA 4U7CA 4ZALA 2H08A 3ED5A 1NMEA 3FJYA 4G5SA 1RYHA 2H4YB 2KJVA 2WMYA 4AJHA 1EHIA 4HDNA 4P4TA 1AJEA 4F4FA 3VCDA 3FCOA 1S9DA 1CQIB 1KO4A 3RQIA 4Z53A 1NAQA 4HC4A 4GPIB 3VR6D 1L7XA 4ZJPA 1R0WA 1VCHA 3R5AA 3ZD6A 3RAJA 3S5JA 1Y9DA 3A31A 3D6JA 1QVFR 3PHCA 2TMKA 3C3PA 4NBWA 1VYVA 4E5NA 1P4GA 1TF7A 4HGRA 2PGJA 3MUEA 2AOUA 1TD9A 4ND6A 2AYZA 5HBRA 5A76A 3A9RA 4OU4A 5ALFA 4BQSA 1R8XA 2WVCA 1O6FA 3BV8A 3R5DA 4DIOA 4FBUA 4NBNA 4KPYA 2ZVIA 1N8SA 3V5NA 4NG4A 3E82A 2QN8A 1N4LA 3FYUA 3KJIA 2RB7A 1IZ8A 1FSGA 4KT0C 3KQOA 4ZHQF 4IKEA 2N42A 4G5FA 1U3FA 3SVZA 1OR8A 2Q4TA 4GD3Q 2V3CC 1Q7GA 3UOAB 3GLQA 4WLUA 2ONYA 2OHOA 4C8NA 3HP1A 3HB5X 4ZMRA 4E0BA 3D4PA 1CETA 5GV7A 1XWLA 4ZLLA 2FC9A 4KNWA 3FMIA 2W2QP 4LSNB 4ZN3A 1DAOA 1FB5A 3ORSA 3QKSA 2Q62A 3N76A 2IXEA 1MENA 1EWKA 2R6ZA 2II6A 2HMWA 1IATA 4LN1A 1UKYA 3C66A 3EA4A 4DXAA 1IVSA 5F33A 2CV1A 2CBZA 3RBVA 1WL8A 4W8GA 2VDVE 4E5KA 2OOKA 4FFLA 4OLPA 4R4JA 2IPOA 3CVWA 1Z5ZA 4YIKA 3QE4A 2WI8A 3GGGA 3UQSA 5HVGA 1LW0B 4DPOA 1M1KT 2HH9A 3PDCA 4B08A 2CXUA 4D8YA 3ZQ4A 3BD8A 2F9JA 3LT0A 4HT3B 1ORRA 1XMPA 4DA6A 4FYDA 4KBIA 3OU7A 3G6VA 1FY2A 3OL7A 1L6IA 3ZHBA 4TKMA 3B4MA 1UPPA 3V48A 1FHTA 5A6WA 1IUOA 5KOJB 2GVNA 2Q0QA 1BW9B 1ZIXA 3MCNA 3W8GA 1S3GA 4R01A 3PDIA 4M7PA 3F5MA 4C4AA 4D43A 4KTQA 3FSEA 3WC0A 5IAAA 3L8CA 3W5CA 5IVKA 1S6QB 3SVLA 2WR8A 1S72S 3SQMA 4R2IA 2XCPA 4DL7A 2R79A 3O9MA 4DV3F 3CPHA 5JCPA 3NLCA 1IXRC 3DTYA 1VSVA 4QUKA 1XCGB 4A6XA 3IULA 2XNDA 1QIKA 1QTRA 3OUYA 4XTTA 1BA3A 1WSDA 4OLJA 1ESCA 5DSTA 4JSYA 1MU0A 1M6EX 3ZK9A 3WIDA 2JAHA 3OQPA 5E1DA 4TSRA 1FF2A 2GBFA 1YJCA 3W2WB 1GPAA 2C84A 3A3PB 2ZAMA 4ZVRA 4K9LA 4MEAA 1T0UA 3MTJA 4WGGA 4FFOA 1L3UA 3TQRA 2WILA 4UQTA 3BEGB 4F45A 3WISA 4HTIA 3FSGD 5NLLA 2DO4A 4QEDA 1CWUA 1AZTA 2JLAA 4WP8A 1U4OA 3GPIA 3LT2A 1A4IA 4XLZA 2RU9A 2W90A 1VBXA 4G36A 4LMPA 3H5OA 2R5WA 4ZO8A 4LY0A 3H87A 4JLVA 4CF5A 4OYZA 1L5HB 3DT9A 3K2BA 1RT3A 1FNOA 3O82A 4IGEA 3EJ6A 2GJ4A 1N5SA 5HNKA 5KFEA 3IWLA 1CSJA 1H9CA 1KLMB 2DERA 3DV0B 5LQRA 4BFYA 1ZA1A 2GA7A 2PRSA 3N8HA 4KFUA 3JATB 2YICA 3X44A 4OAQA 1YR2A 1TKZB 5CBPA 4YCCA 4IQMA 1J1UA 4F0MA 3EPIA 4XGQA 2H52A 4CDRA 1P91A 5JT1A 2FLKA 3TJ9A 4IHAA 5HLFB 1PF7E 4PSAA 2WHQA 3CEAA 3GG0A 2AN3A 4DPKA 3ZFVA 1SK8A 2AN9A 3P3DA 1ZOIA 3T4EA 4J9LA 4AJLA 4GEKA 2FLPA 2H2AA 3ZNPA 3JQ9A 5BN4A 4KSEB 3RKRA 5G0RB 2I1QA 4LHWA 1YQ9A 1QE1A 2EKZA 2HPZA 1HQKA 2CEAA 1GTRA 2BKVA 1M5OC 5C8YB 4CT0A 1C1XA 4J0DA 2AE2A 3LS2A 2ZGVA 1PO6A 5EJ5A 1T2UA 4ARIA 3DMDA 1FRIA 3TFQA 3I5UA 4IFBA 5FWXB 4OZ5A 4D9HA 3CSDA 1Y3AA 1EDDA 4DUTA 4RXMA 1N33J 1NA5A 4QG3A 4LRYA 1QTIA 3VI3B 5LOVB 1Y9AA 3IEIA 3KOAA 1X7WB 1YZKA 4KUEA 1O5OA 3EZLA 4C7XA 1I94J 5HIMA 1Z62A 3E35A 3QWPA 2D74A 2FX3A 3HM2A 4KL8S 4ZVOB 2P6UA 4X9XA 4XDHA 2PTHA 2GEUA 3IVCA 1YMVA 3K71B 2WJ6A 3IAXA 2YKGA 1T8SA 1EJ6A 3CCFA 3PQ6A 4AW9A 3O1LA 3NYIA 2WSCC 3SYZA 4WXWA 2GAHC 1LBEA 2ZULA 4IS2A 2UXCJ 1R8JA 1TO1E 3ZY2A 2VNJA 3HUFA 2YFQA 1BQ3A 5E9WA 4N82A 1TL1B 4P9NA 1E1CA 3LPLA 1QVVA 3U49A 2RKIB 2O2DA 2VA2A 4QOEA 2VRCA 1LS1A 4J76A 3R7SA 1JB1A 1HNXB 2VQFF 2WTEA 1OHHD 5DNAA 1CUCA 4S1TA 2P9HA 4YRJA 2Y76A 3S81A 1EX8A 1RACA 4Q93A 4M5DA 1TVMA 4Z49A 1S7CA 2VDMB 2TMDA 1U8ZA 3MEDB 1DE0A 2WSFC 4XJTA 4K5SA 2VBCA 1KI8A 3EAFA 2JRLA 1X1TA 1HDZA 4KQEA 4Z9YA 1QP7A 1C50A 2IWRA 4Y9SA 4GL4A 5KPJA 5A2GA 3FOZA 3BXPA 4ZYZA 5LYJF 3PFIA 2ZR8A 1FUYB 3R7BA 2FSFA 3RU7A 4EO9A 1JB0C 5B0FA 1U94A 3FLAA 2CDQA 4KXNA 1GYQA 4ZK2A 1AQNA 4DL4A 2QLMA 1E4VA 5GAHU 2PMDA 4OZ1A 5IASA 2MQOA 2J9GA 2HSEB 2AZDA 4DR7J 3V33A 1SVDA 4QWEA 3PT5A 4UPEA 2I4RA 1EKXA 3KL2A 3VNSA 3HU1A 4DWIA 1AK1A 4U2BA 3M2VA 4Y2UA 1EINA 1NR1A 3NDPA 2BHLA 4MTPA 1RBOB 3QYYA 4EI8A 2FUEA 2DK2A 2W2MP 1TKAA 1BHO1 2PKYX 2OO7A 1JJ2R 5BOSA 5DGIA 1FXLA 3HFVA 2O2JA 3T95A 4E22A 3SU8A 4NL4H 3VHQA 1FT8A 2D1RA 4YB6A 2QTMA 1CVJA 1V3VA 1LBIA 1YTYA 3RSOA 2MU1A 1QKKA 1O6XA 1SELA 1JHUA 3DEJA 3KQKA 5LP1A 1MB3A 2QD3A 1RJFA 1SC4B 1H8EA 4PR0A 2ZRIA 4X3PA 2HLPA 2O8BA 2IYEA 3VO2A 3JQMA 4RTMA 4MKIA 2BM0A 4X61A 1ZOLA 4R2HA 3DLAA 1UT5A 5CJJA 1UK8A 4RANA 3BG5A 1TV6B 2A2CA 1TK8A 4OQJA 4C05A 1QDEA 2O5EA 1Q53A 4RIGA 1U04A 1NBIA 4C2UA 3POTA 1XCOA 4G25A 3P32A 2DY9A 1T02A 3OXLA 4HNUA 2AGOA 1TM5E 3BWXA 1JSRA 1NONA 3FF4A 3A3OB 1LSJA 1P7WA 4JEUA 1P6TA 2VOOA 2VJPA 5DISB 5E41A 3M5WA 3EG5A 3IC5A 4LJ5A 5DFAA 1N2ZA 4R81A 3DLCA 4LQDA 5KFWA 1DT3A 2HVZA 4RH0A 1O57A 2VDRB 5AJWA 4LOLA 3P0EA 4DQIA 4B17A 3RVJA 4O29A 1S0NA 5JG7A 1CB0A 4OGKA 5K8PA 3W5YA 4M0LA 5LBIA 3C6ZA 2P62A 1Z6AA 2XZTA 4QZVB 3G13A 1II8A 5CXXA 4IV0A 5AKKA 1XXHB 1HHTP 1Z3IX 4MUJA 1HC7A 5FWYA 5DNWA 4X64B 2O3RA 1DAXA 3K32A 3GSIA 1UFQA 2AK2A 5KIAA 3C8ZA 3LFTA 2BTQA 2BKXA 1KHVA 3FDIA 3M9WA 5T7LA 3JSRA 2GS8A 2UV8A 4LGVA 4ZCTA 2V6FA 1RPNA 3RTCA 5BSEA 1NVUQ 1XU4A 2VAVA 4H1HA 3NHAA 3A9TA 4HTAA 1RTDA 3LUKA 4MK7A 1O4VA 2HIHA 3CMCO 2C7GA 2HK8A 3R7SB 4M49A 1NULA 4S12A 3VJMA 3K0SA 2HJRA 1VHWA 4KAIA 1B2LA 2DPHA 2X4GA 1T4GA 4ESEA 1X13A 2DTDA 1B3TA 4BLTA 1PIWA 1ZN2A 1LWEB 2VPXA 1LPBB 3GRZA 4BLGA 2VOEA 3NBZC 3JWHA 2ZCVA 2C5SA 2OZLA 4B73A 1G66A 2MYNA 2BJ9A 1TQ2A 4Y1RA 1HNZJ 3B6JA 1S9FA 3JZFA 5BV1A 4CZ2A 1JHXA 4NH0A 4NY1A 4TYNA 4K9QA 5EE9A 1I6WA 2CG4A 4KPGA 4D1YA 4G0PA 3OJLA 2GLUA 2FEMA 2OTLS 2OCKA 1LLDA 2UXBB 1HA1A 2M7SA 3TWZA 5AJ3J 2V7XA 5BO5A 4RZSA 4G9EA 4C1NA 3M8PA 1ZUD1 2IZ0A 5JVGQ 3VUFA 2HXYA 2C1EB 1O6GA 1TYCA 3MAGA 5BYSA 1M1YA 2JNJA 4PEOA 3ZTYA 4MULA 3N9UC 4OHXA 1E6MA 4UCXA 2VSQA 3QPCA 1RTJB 3DB1A 4PC3A 4RW9A 2Y77A 4HQLA 5G4DA 1JG2A 3B53X 1W47A 1E2QA 2IYQA 4WD3A 2R97A 1KFSA 4Z9AA 2BOPA 3L43A 4B2YA 5A4AA 2JW5A 1V8OA 1AHNA 5E8JA 2W25A 2O59A 4I9GA 1AUSL 1BCSB 2PKWA 4ER3A 2VO1A 5BP7A 4OYPA 1PJRA 4A8WA 2BEVB 5FPQA 2HDWA 3CVYA 3G9QA 2V4UA 1YG0A 5A2QY 1KK1A 4ON9A 4D56A 4PAGA 1XNJA 3C48A 3TXYA 2GBCA 5DHUA 4K9NA 2WTFA 1E2IA 2B25A 1PJLA 5H5JA 4RHUA 3WWDA 2XRYA 2LUOA 4CMHA 1YQHA 4LIPD 3U4DA 4G0QA 1G21E 1JS1X 3SIXA 4BVFA 2HF2A 5THQA 2I9KA 3C3LA 4KH0B 1U90A 5GMEA 4MFBA 2QFIA 5IJ9A 4OB8A 4W99A 2XYVA 4ZVUA 4YT5A 2W11A 1YASA 3FMBA 4CF6A 4YH1A 5A4JA 3DOMA 1JTFA 1NXSA 3M1YA 2HYIB 2VJVA 4HZUA 3IMGA 3B1FA 5B1IA 1Q16A 5FRDA 4C7KA 1CUGA 1T3LA 3ID6C 2Q6BA 4YRTA 3OZDA 2WWIA 3S55A 1CZLA 3W0LB 1T6YA 1QO7A 3CB4A 5FF9A 4GC7A 1C0TA 1XTUA 4TVSA 1E3EA 5H9FJ 2ZUVA 1UWBA 1JKXA 1WP4A 3EBOA 2LQ8A 1MTOA 2YKQA 4QECA 1G3OA 3WGQA 3VGUA 4QNRA 4PTLA 2KYRA 4HH1A 4BPRA 1WQ4A 3FPFA 1SCNE 1VJWA 1K9MT 5CA1F 5JHHB 3OIDA 4NEZA 3HPQA 3M8ZA 4I7EA 3GUVA 3QWIA 4B40A 1L7VC 3JAMA 2B4AA 2CNLB 2ACEA 2OCDA 3RVRA 4QPZA 3ABIA 1REQB 4Q9LA 1RT6B 5TC4A 1ZUIA 4JIMA 1ZD4A 3ND6A 4HYQA 4AULA 1WZIA 1RTZA 2QNBA 4MI6A 1QF6A 4L50A 4GM1A 3S7RA 2EFEB 3N6NA 1BQMB 3H3XA 1A5TA 2ROEA 4QPXA 4POAA 3T3EA 5LQKA 4TMFA 2Q3FA 1T11A 3HDTA 3IP1A 2FXVA 4IS3A 3HCWA 4YRFA 1J25A 3U2QA 5EWGA 5L3SA 1PJ2A 2R8XA 3M2RB 4B6QA 3ICQB 4N6GA 3ANMA 3J81A 3I4HX 1CJKA 4Z2XA 3OZBA 3FBWA 5KFAA 3H5TA 2FJBB 3QVKA 1DJNA 1ECLA 1VPEA 4IIYA 1OWXA 3GLGB 4DBLE 5C8VA 5CD9A 4PKDB 4U67Q 2O8CB 3A7EA 5KNCH 3DNMA 3M33A 5CNKA 3Q9LA 2GO1A 1ONOA 3K09C 3ONWA 2BFEB 4TPKA 1HPZB 4FS3A 1NBME 4NJOA 2GZ3A 5DM0A 2B8JA 1NU4A 2QF7A 4OY3A 2UZ4A 4OPMA 3HGTA 4WOPA 3ISJA 4E4TA 4P3PA 4DJ5X 3ML1A 3IEVA 4C6HA 4C3UA 4ABYA 4ES3A 3KVYA 4WESB 4DF8A 4KXVA 3PX4A 4BRZA 2M9KA 2CVQA 2C78A 1PJ5A 1D9ZA 2AW5A 3NP7A 2VDWA 4MARA 4P5EA 2P0AA 5BV7A 1U3WA 1UW9A 3ZWMA 5EXPA 1AT1A 3DV2A 5D85A 3IA7A 4IJMA 5D1NA 2ZKTA 4OI3A 4FNMA 1H6DA 5F3WB 2F8EX 1EDZA 1MROA 4A9AA 2HI0A 3EY4A 3H90A 3ADKA 4D42A 2DPMA 4QFCA 3R3TA 3PR4A 3E7WA 3FYTA 1PBUA 3LIIA 3S44A 4KE7A 2ZJRQ 4MKYA 2B6AB 2JAWA 4G41A 1EUCA 4NBKA 1L4UA 1FVQA 2YHIB 1GU1A 4DZZA 3L0DA 5JISA 4FBGA 1Q12A 1XOIA 1CFZA 1J21A 3RB8A 4L0DA 4NBLA 1TXGA 1O89A 5C3UA 1SZPA 3SC2B 2J9EA 3KO8A 4C3VA 4U7WA 4JIGA 1ORVA 3BXHA 5F2KA 1QCCA 2D1CA 2QN6B 3I5MA 5IEJA 1F5SA 1PAUB 4LRDA 4N3GA 1PEYA 2OO4A 1NTOA 2J9FA 4USIA 4KKXB 3TW8B 3I4FA 1F60A 2YIMA 2V1UA 1H2FA 2W8LA 4NICA 1ESDA 1ZR4A 2QLJB 4H54A 4UJ3A 4RH3A 4D82A 4PPZA 2J8ZA 3R5FA 4B3DA 2OEJA 5CCEA 3L4BC 3MZ0A 1T10A 1NPYA 3H42B 3VVLA 3AHHA 3DFKA 3KS9A 4KQ9A 2GR9A 3V32A 3LTNC 5K0TA 1Y6GA 3P5SA 1X4CA 3EVZA 1WOSA 3IBGA 4JLAA 2IEIA 2QGNA 4FGSA 2A33A 1FC0A 1Q84A 4OKNA 2ZWMA 2NNWB 3MVEA 1N5IA 3BO4A 4CFSA 2XF8A 4YYZA 4J9NA 2BSAA 2JGIA 2D69A 4GG1A 3NGLA 1U3VA 1Y7IA 3AV0B 2I8AA 1V1JA 4O0NA 5IBQA 3EVCA 1RPTA 5AVJA 1Y33E 4F7WA 4CUJA 4FJ2A 1F8UA 2F3UA 2OGZA 1ZTWA 4X1IA 4EGQA 2ZKUA 1RU3A 2RRAA 2H4WA 1QIEA 3WGIA 2WRMA 5HS4A 4ZOLA 2EFJA 1E1RA 4S2EA 3LE8A 4KHPF 2CUZA 3QLVA 5EJGA 3FR8A 3W8FA 4EUKA 3D8HA 3DMGA 1ZK0A 2PZ8A 3T7TA 5FNVF 1GGHA 1H2WA 5EJ9A 1TO6A 1MWZA 4MR8A 1ADCA 3PB3A 2YH2A 2ZR9A 4EQ6B 2CJYB 3Q8UA 4NF2A 1DINA 2R7QA 3ZTPA 2ZH5A 4ZQIA 4LYDA 1M6YA 2CXSA 5FUQA 3QJYA 1U80A 3IUMA 4ZN6A 4ZV4A 2HYDA 3UMVA 5CU7A 2PX6A 1FOEB 2AJ8A 1ACMB 2J6BA 1HDRA 4GI2A 4UM8B 3OTCA 3CPWR 3HB9A 4QTYA 1UBOS 4I55F 5BN5A 4DR3J 3WLAA 1ZOTA 4WZMA 3T9ZA 1NF3A 4Q39A 2VF3A 3PHHA 4HBGA 1MD9A 4S0XA 3AM3A 3HHLC 4XW2A 2WAQD 1A95A 3DMPA 4ILMA 4KDRA 3RE1A 5B2FA 2IYXA 1Y8RA 3PEFA 1NH7A 2HS3A 5I4MA 1OBOA 1SKBA 4QYXA 3K1AB 5LL6P 4NMLA 2G9VA 4BB0A 1IG0A 3ON5A 3HJFA 2V2ZA 1YBHA 4HAUA 2VT7A 1TF5A 4L5YA 4MVJH 4NJMA 1YE8A 2LVBA 3F7OA 4X7RA 4EA6A 2CMHA 5BT9A 2H16A 1M1XB 2BUCA 1X42A 2HJSA 4DU8A 3OZSA 4NBSA 5SY9A 4MDFA 4O6VA 3AUUA 3DP7A 3EA0A 2OK7A 4L5IA 5C31A 5CP8A 2OBYA 2K7JA 2GQCA 1I2ZA 3HO1A 5A5EA 1R0XA 3PC6A 3JYPA 5AJZA 1TJPB 1DO2A 3OIVA 1CPYA 1Y5NA 3KQSA 4O1HA 3REQA 4L08A 5FQOA 1BXNA 3JZMA 4GYJA 2ZRHA 4WVFA 4Q7QA 1SCUB 3GLSA 2CA9A 3BEOA 2LPMA 4TL8A 4ECYA 1P8GA 4JI3B 3G5LA 2C3UA 1R3UA 1ZBDA 2OTCA 3D7SA 2NUTA 5JRZA 2XEXA 2QQ5A 3ZS8A 1M83A 2FZKA 1E5VA 4TV9F 1SU6A 4ZGBA 1NP3A 1QXSA 1SIWA 2Z3ZA 3W1WA 5BQPA 4AY6A 1XEXB 4F1WA 3UN1A 1NC3A 4KC0A 1M76A 1HT1E 4LFAF 1RT5B 1VLVA 4JFRA 4LT6A 1K4KA 2QX0A 5DCWA 4J0HA 5JBNA 3WY9A 5F12A 3IAS1 2ZWAA 3X1MA 4OJNA 4RTKA 1D3WA 2N82B 1RP7A 4OKSA 1JT9A 3VWSA 1M67A 4IJQA 1J5EF 1E9BA 3F7TA 3DGFC 2ZROA 2R2SA 3JX9A 3JQGA 3QGGA 3ZK7A 1F60B 2C98A 5FPSA 3I5XA 4L3WA 4ZDKA 5ED4A 4DR4B 4G97A 2VPIA 4NNPA 4MYSA 2D1TA 2D2VA 3WO1A 3QU9A 3T3PB 2CZVC 3CUNA 2NZ8A 4D57A 3E05A 2QSFA 2O3QA 4A0HA 3MM8A 5FPTA 3P9YA 1BX3A 4OP1A 2GPJA 2IUTA 4BO5A 5GZ3A 4Q9HA 4GOOD 2H4ZA 4RTLA 2CCKA 3AO0B 1EE1A 3WLOA 4MUIA 1RCUA 5B0CA 1GTJ1 2D4AA 1Q83A 3OOEA 1SAYA 3X1DA 2IXBA 4DIEA 3A1CA 2CUNA 4CM9A 4B3FX 3AW8A 4HR2A 3QEAZ 3THOA 3G0GA 2VBFA 3LHSA 4C4WA 2UU9F 1A6LA 4KFRA 1Q1BA 5B1SA 2P4UA 1S0UA 2LW7A 4EZEA 5EPUA 4Q2LA 2XECA 3R5TA 4CIVA 3HHDA 2LXUA 3QXGA 3GWGA 1DS6A 2Z4RA 4REMA 5JDCC 2AYYA 2BTOA 3PXDA 4TKVA 3ZC3A 2VP4A 3VVMA 4CKXA 2V4JB 3SQGB 5ERXA 5ALXA 1GA6A 4HDKB 1MGOA 4KGKA 1JWLA 4DU7A 4NAHA 1FVSA 4BHQA 3E6AA 3H13A 4BVLA 2IJGX 3UN3A 3OEWA 3KKOA 1YK0A 4MWCA 3RROA 2ONCA 2DB3A 3HU5A 3JYTB 4A82A 3WBZA 4O44A 1X9IA 2VJYA 1RAAB 3E7FA 4X65J 4HZIA 2OY0A 2YNIB 3GK3A 2ENWA 5HN0A 4GZ5A 2UUAJ 4ZEMA 1FFBA 4KXXA 4HATA 2VUUA 4D6XA 3GP3A 4D79A 1KY3A 3EARA 5IVHA 4MUFA 1J97A 2Y1GA 2Z6UA 3AESB 4TLEA 1TFRA 2KJWA 3R3JA 4JJZA 1A98A 3IT0A 1QLHA 4QW9A 1KQFA 1SXGA 1IOLA 2FC8A 5KQGA 2C00A 1XHEA 4F96A 3VR5D 1GSIA 5AHWA 1H6AA 4MQEB 1FRXA 5I3UB 1NJ2A 2YNGA 4YDHB 3EIWA 1ORIA 1WHYA 5LSLA 4O4IF 1KTIA 1J5PA 5LNK6 1GCAA 4DV1B 2Z30A 2CDRA 4JUBA 2AHRA 1A4RA 2DB1A 5JAOA 5EWMB 3H5VA 5BSKA 3DVQX 3SHVA 2QT7A 1BNCA 1GEEA 3G2JA 1X1AA 3QIPB 5TPWB 1HI1A 3KV3O 2CNOB 3OFVA 1H98A 3F7NA 1BO6A 4MPJA 3QATA 2UYOA 3J7YI 3KWMA 3HD2A 1TL3A 4CM7A 3ZYZA 3ZGZA 3GCGA 4E13A 2FJWA 3L8FA 3DTTA 1Z6GA 5HQ3B 2C0QA 2ECPA 1TTQB 4WY8A 1DCFA 3AF5A 4MS4A 1SB9A 1T9UA 1L4BA 3DOKA 3MCWA 1KC1A 4TQ9A 3V4FA 1VJCA 4DDTA 1V5FA 1Y3KA 1LW2A 1R31A 4CO0A 5KINB 2VKRA 2AV6A 1Z7YA 4JEMA 5LJLA 4JYMA 2KWIA 3KXDA 1VB5A 2XI3A 3HSZA 4JY7A 1NRKA 3VKFA 1BHNA 1JLFA 3H86A 2YYYA 4XA8A 2RQMA 2WHPA 5I7FA 2R8EA 1BE6A 4TLBA 3IKJA 2DULA 5FOTA 3LGMA 3KYIB 2J87A 1ZWLA 3ZBPA 4EGFA 2RHTA 3SI7A 3LCUA 5KFZA 3EH1A 1N78A 4M5IA 2NSBA 2I2DA 1DDOA 1UTAA 1EFPB 4X62B 4M9ZA 2BYCA 5L3QA 5KAPA 3VYRB 3IL2A 5K1ZA 1ZOOA 5CVJA 4TS1A 2RDDA 3G0HA 4JYAJ 4I4BA 3LDAA 2VDJA 3OVSA 2X42A 1IQUA 1XMQB 1VPDA 2QAJA 1PV4A 1Q5VA 2FWMX 1F2TB 4PGGA 3BIJA 2VJBA 1S9GA 2VJKA 3EDCA 2CYBA 1OIVA 3NKVA 4BMVA 4CTAA 3GLHE 3I1YA 1KDPA 1VJRA 1H05A 3OZGA 1JTEA 2LD4A 4P33A 1GPDG 3UMFA 4Q66C 4PCUA 1UKEA 2Y05A 3G8SA 5M04A 2PI5A 1WB4A 5ETRA 3HLYA 1MG0A 2PSHA 3JQAA 2AT1A 5AW0A 1AKMA 4TZ6A 1TFUA 4TLCA 3R76A 3VO9A 4ZZ3A 3KPVA 4BNUA 5FBRB 3EGXA 5B0DA 4HI2A 2QBYA 4N5DA 2EFYA 4P0QB 2DGXA 2F4VB 2OV8A 1M72A 4DFKA 2ZB4A 3HY4A 3KCQA 3RFUA 2CVOA 4OHCA 3CCWA 2R2AA 4IDEA 2BGTA 3W9SA 1RJEA 3V7UA 4FYWB 4J9RA 2GHTA 1G8PA 2NLOA 2HHXA 3AUKA 1ZITA 5CB4F 4XQ9A 2DU8A 2AFHE 5DTEA 2AJ1A 2DWQA 2UVDA 3ZWVA 1HNWB 2FSHA 5HX7A 2CIMA 3DOOA 3Q2OA 1USUA 2DKNA 2XDAA 3IE0A 2Q3DA 1CUIA 5IT9U 3P5BP 2G0NA 1USIA 3O8QA 2DYKA 3F0TA 1XR7A 5DGXA 4P08A 2WG0A 3CJ2A 2Q5LA 2PUEA 3WBBA 3VAIA 1ADJA 5KCZA 3HKZD 3A9SA 3GPCA 1SUPA 2ANBA 4CLEA 3Q7EA 2KL8A 4YAJA 1N7JA 4QAQA 4X2BA 3GIKA 5IAOA 3KT8A 1JHVA 3DUFA 1NK0A 4KXYA 3VZHA 5LDHA 4TYMA 1WHSA 3WB0A 1YGPA 3NGTA 4P2BA 1R1DA 2VIHA 3LPMA 2ATCB 4CUKA 2QAIA 3PVZA 4K9MA 3MCSA 3CNBA 3K8WA 3ZTTA 5DETA 4D0NA 2WFLB 5E7MA 1XZAA 3DO8A 4URGA 3GCXA 5AVUA 1MORA 4F06A 4B3SF 2O8DB 1AMOA 4JD5A 2FZ5A 5JY1A 1GNLA 2RAVA 1L5NA 3UGJA 3GJZA 3H9CA 3SSQA 2MKIA 3AVOA 1N5DA 1GZ6A 1WY7A 2OYSA 3FFIA 2HCTA 3LYAA 1GA4A 1RHUB 2MT9A 4B9EA 4I3GA 5CEFA 4JOCA 5EIWA 1A5SB 1LPPA 4AJOA 2CY0A 3G8BA 4O4LF 3WJ2A 4NWIA 5AJXA 3WDLA 4Q18A 1T1RA 1Z4MA 3EXFA 4MV6A 3EXHB 2Y1DA 2PMFA 2PBRA 1A9OA 1H2UX 3THWB 2IZ6A 4QRDA 4HYTA 2XITA 4MVXA 3R7WB 4I19A 5HQLA 3MOJB 4O3MA 4KKOB 2HVHA 4K4XA 1GNKA 3I6ZA 2FN8A 1QVRA 2RAUA 5G1NA 4YXWD 3FBBA 1E1NA 2D1SA 2X0FA 3SV3A 4H2DA 4CKBA 1NPTO 1FU8A 3S70A 2ZB3A 5HCUA 4C7BA 3KXIA 3T9NA 4DR1B 1ZIOA 2ERRA 3FNNA 3ILOA 4I4LA 2BE9A 4AMYA 1QDUB 1IR2A 2J48A 4GI5A 4XVUA 3K3PA 2X2EA 4FYIA 1NE7A 3W5XA 2DWPA 3U56A 2H4YA 4CG3A 1P33A 1XUOA 4HXEB 4V0KA 4BWMA 1VPTA 3JTMA 2AW3A 3UB3A 2IJRA 1CQIA 121PA 4WU2A 2JEIA 2ZJPQ 4P53A 5F4ZA 1JFFB 3U3OA 4U8GA 4IUCS 2BKUA 3SF0A 2WUVA 4WFXA 4TMVA 1NVBA 2RGWA 1RAGB 2CXNA 1H5UA 1CEYA 2CPHA 2PQ0A 4RY0A 1WR8A 1EUYA 3GEGA 1KZ4A 4PBRA 3BGFA 1JV2B 3TRFA 4A92A 5T8KC 5CB8A 5K01A 2PRZA 1AU9A 5DF1A 2GXQA 2HMUA 2MYTA 5DBOA 2FWNA 4G1BA 5JH7F 3DKKA 1UPFA 3EVDA 4D41A 3RD5A 3CKKA 3CKYA 3QLUA 5IHXA 1FTRA 2GQ2A 1U8YA 3ONNA 3P2JA 2BFMA 3KJHA 2FPUA 4G85A 3DLEB 3N2NA 4AUMA 1TGVA 10MHA 4F8YA 5JXHA 3FWZA 2P9JA 4LI3X 2QTWB 3TAXA 4MVJE 4YASA 5TMBA 1KN6A 4MPRA 2H9YA 1QAXA 4EZIA 1DAHA 1WA5A 1XX6A 4ZREA 2N4DA 1XZJA 2X2FA 2FPKA 3MCMA 5EESA 4FIDA 3NMRA 4BNMA 1YQQA 1QONA 4LSNA 3BBLA 4W5RA 3D2CA 3I92A 1Q20A 4OYBA 4RV5A 4PLFA 2R6HA 3PYFA 1G59A 1J8YF 4CRWB 4BJ3A 4DQ0A 3EGZA 3N6MA 1FD2A 3ROKA 2EX1A 3A6PC 1NHWA 3GMSA 4OZ2A 4UQLA 4XDGA 3RS7A 5DGBA 2XB2A 1ZZNA 2QS9A 3FNEA 2MZSA 1L9XA 4C04A 1QFYA 1RABB 2DUNA 4JX8A 4C9BA 4JLPA 1LTQA 1LW0A 3FKJA 1J0EA 4HXYA 1Q0TA 4RMIA 2UUWA 3TKAA 1XALA 5GONB 2IHTA 1Q5YA 1AUOA 1RJGA 2G83A 2PGOA 3PGLA 4YRNA 3MIIA 1E77A 2WLSA 3TSZA 2D5IA 4TKLA 1D6NA 3PIPQ 5IC4B 3R1HA 2ZH6A 4JC0A 4AFNA 1Q0RA 2ZUGA 1PFWA 2GVDC 2JVKA 2EJUA 3HB1A 3DHXA 3FVVA 5KOJA 1UXHA 3OC0A 3OTOB 1P2VA 1BW9A 1RRCA 3FSXA 1EJBA 4OJMX 2NXCA 5B55A 3OY2A 1JI0A 4DCTA 2C2MB 5F1YA 4BJ5A 4OXXA 2FB9A 3CE6A 4DIUA 2HLHA 3EULA 5CLHA 3NOQA 3KKEA 1OF1A 4AWXA 2J3JA 1XK7A 4HWGA 2IPAB 1S6QA 3IXQA 3QWBA 3U13A 2AQ4A 3KHUA 3TEGA 1FS4A 3WGYA 5EP1A 5C1BA 2I71A 1EK0A 1KA9H 1DG3A 2DT5A 1PWYE 4PW0A 5DHRA 5CRIA 5D5PA 4FILA 4D3SA 4RU9A 4RLHA 4KFSA 1C9KA 3FEYB 1QH8B 2AG1A 1QBGA 1X92A 4FDVA 1OFHA 1Z4LA 1DMRA 2A59A 1X19A 3GFVA 3GV7B 4S1PA 1UQRA 3QUTA 3AB8A 5H82A 2ORIA 4BZQA 3W2WA 2XYRA 4C0WA 3A3PA 2L08A 3OF2A 5TQ0B 3IAM9 2ASDA 1R7RA 2HSJA 1MJHA 5D51S 3WBJA 3GPBA 2KJQA 1AS3A 2B34A 3HN7A 2HCFA 3ICPA 1Q3HA 5I9TA 1QV7A 3Q86A 3GQCA 2C42A 4CBVA 4DNQA 1T9CA 5ILOA 3CCJS 5K3FB 3AP1A 4QJIA 1H2HA 1QTQA 4BAZA 4DUYF 2K7KA 1CKEA 3UW1A 4A8TA 5KS2A 2B37A 3EZYA 4I8DA 3SZRA 1K0UA 4ZI7F 5EZ6B 2BE9B 4CIAA 1RLOA 1A69A 1QGAA 4MVJI 1EJ7L 4LCJA 3W9UA 1YQEA 5AXLA 3NFRA 3RK0A 3T1NA 3QFCA 2BI7A 2F3RA 2FW0A 1N32J 1FYWA 4C88A 4X4TA 2QYHA 1L5HA 1VPWA 2QW8A 1HR0B 3ZW9A 5ALHA 1SOMA 3I23A 3NT4A 4F9GA 1XRSB 2V8GA 2ZUDA 4WJKB 4PPYA 4XX0B 5F3TA 4MROA 1KLMA 3DV0A 3NO4A 4O4JF 1MXHA 1KY5A 3JATA 1N9GB 3IV9A 3OPYB 2AFRA 1TKZA 3FOCA 2JIZA 3D3BJ 4KQIA 3U4CA 1PI3A 1PT8A 5F8GA 4E4YA 1U1MA 4KI7A 4ITSA 5CCMA 4YY3B 3PW5A 3DKVA 1MC4A 1HKUA 2JRSA 5HLFA 1Z5GA 4C89A 2YV4A 3GZJA 4KFBB 1E5QA 1QHNA 3HZZA 2O3JA 1YVPA 5GAGI 1FXDA 3SZMA 5CMLA 2GCFA 3QFHA 3WL7A 3WMWA 2OPBA 3ROXA 3ESBA 1VG8A 1R3DA 5K0FA 5G0RA 1N6PA 2DBYA 2N75A 5IBRA 4B3JA 2ZRMA 4RPJA 5C8YA 5AK4A 1GXSB 3EFBA 2ZTMA 4N48A 4JI4F 4I56A 1UBNA 3O90A 5IP5A 1SKQA 1K5HA 3QVLA 4MUMA 2RGRA 2W48A 1WLSA 2JGDB 2A4MA 5FWXA 9RUBA 1ISSA 3JD3A 2MKCA 1AUVA 5BWMA 4QBUA 3CSUA 1KE2A 3A6KA 2YTZA 5LOVA 2VBYA 2ZJYA 5AE1A 1RSZA 1X7WA 2RVJA 1ZH0A 3IJPA 1M10A 2Z2LA 3IM8A 2WKQA 3GX1A 3GDWA 4ZVOA 2I7XA 2ZRKA 4FDFA 3HEBA 2Q6VA 3LP5A 1ZS6A 1YBMA 4OMUA 3D02A 3KL4A 3TQOA 1QZXA 5CT5A 4LJMA 2Y1OA 2J7KA 4KAFA 4M7OA 3PXGa 1UAWA 3TAMB 3H11B 2IJNA 4GC6A 4KX5A 1JAIA 1BFDA 1AW0A 3E53A 4CO4A 4LISA 1TL1A 1QZUA 3DZDA 3JQ8B 4CO3A 3IRWP 3OPKA 1ACJA 2RKIA 4MYUA 4EARA 4MZXA 2RDMA 1GV0A 4EJSB 2FFRA 5E6UB 4LJAA 1NW3A 5KKNB 1LNQA 2J9DE 2JZCA 5JO0A 1ODFA 2VBIA 1T0HB 3FYSA 2VJDA 3K0CA 5KQRA 4JJ4A 2QPOA 5IJ0B 3KAJA 4R2LA 3DOEA 3KLBA 3OFJA 1SXQA 4YMUA 3RSGA 1PNOA 1I1NA 3NVKI 4G2NA 4KIJA 4Q1AA 4MAFA 3BJMA 1LV5A 5C4IA 2WKRA 5TF4A 2L2QA 4NOKA 1RI7A 1VYHA 1R8BA 1RAIB 3I62A 3MEDA 2PUHA 1GQRA 1S7IA 3I9OA 2X5OA 1CR6A 3N7UA 2QYCA 2NR0A 3WMFA 4C20A 2F8HA 4PYDA 1HETA 5LDDC 1U3CA 1H6BA 2KXFA 4DDWA 1IXZA 3OM9A 3MJCA 3BMCB 3LLUA 4N0QA 1F3FA 1FJGB 5DWQA 4U95A 1ARZA 3QYPA 3OVBA 2DISA 3N0VA 3QYFA 3I6PA 1T9VA 5I4CA 2X0EA 1KK2A 1GT8A 3SHTA 3MJVA 3K9NA 1ULZA 4CM3A 1N36F 3FYDA 3T54A 4PONA 3VC3A 3I01M 3UBMA 2XVXA 2VFVA 3IE1A 4DTIA 1TM4E 2HSEA 2JSXA 4ZTZB 4LFBJ 4B6RA 3IVRA 2WUGA 1Z56C 2FDXA 3O3NB 4BNDB 1CUYA 3DOFA 2Z6QA 2LDYA 3BDAA 3ILSA 1EP9A 3U0VA 1C4CA 1IU9A 2PRYA 5KU7A 4BKMA 1ZZEA 1DOZA 1M8JA 3ZYCA 2LQ9A 3K5HA 1PSDA 2FJEB 4R41A 4PYNA 4KIAA 4X00A 2XB4A 2WZBA 1WVIA 4QGHA 4LF7F 1OI4A 2V45A 4NU8X 2QDKA 2B4VA 4F4JA 4CG1A 1UANA 2W2XA 4OX9B 4ROTA 1T6BY 1LSSA 2GZHA 3UV6A 2ZR0A 2Y8EA 1SC4A 3OCXA 1BN6A 5HSPA 1RAJA 3VH1A 4KNVA 3WAJA 5BNFA 4LSWA 3FPJA 1QJCA 1QTMA 3BFKA 2Q3MA 3K16A 4JJ7A 3EXG1 4AM8A 2H2HA 2VJNA 4LQ3A 3E5RA 1TV6A 5TGZA 1WC4A 4TXJA 3JQQA 2JDID 1IG3A 1W0JA 1NW7A 4M1MA 1AF4A 1AYEA 4YGYA 1WCWA 4GBJA 3NOGA 4FN4A 3WXBA 5A3JA 4KGDA 2IX9A 3C6BA 4HDMB 3BHNA 2NPFA 1R12A 5FTLA 2YY3A 1XG5A 1AKTA 3H40A 4CM8B 4Y2KA 3L7BA 3VPFA 3A3OA 2V4MA 4Y2QA 3FNIA 1ULTA 1OJLA 1Z16A 4JI2F 3VZRA 2ZS7A 3TRDA 4USWA 1XDSA 2NXWA 3BGLA 1M1ZA 2HAEA 2F3TA 4E2XA 1TC1A 4K88A 1MJGM 1S9HA 1V71A 1DJLA 3ZWQA 3WLIA 3LTOA 1RKXA 2FN4A 4I9FA 1RHMB 2I67A 1X8XA 1HE3A 3WIEA 4N8NA 3LBNA 5DYWA 1IY2A 1IHDA 4IHJB 1SJ4P 4QZVA 1XXHA 4JP2A 2Z98A 4RU1A 3RHFA 4JODA 2RI1A 3CNOA 2KX7A 2GXSA 2FPXA 4CLXA 3KAPA 4RUBA 2FJXA 4IIVA 1Q7BA 7FD1A 1SUAA 2ZOSA 4QVGA 4CR8A 4U7GA 2UUCF 3ORYA 2R85A 2WA2A 1SL2A 4W1RA 3D1JA 2GMLA 4B2IA 2O66A 4E2ZA 3KJZA 3V7FA 2IV2X 3ASYA 2VZ8A 1HDEA 3LQ4A 1E61A 1AQJA 5JNLA 2XTZA 4IAOA 1O95D 1GSAA 3RS9A 3LDGA 3HTXA 2NS1B 4PHHA 1PDOA 1KDRA 5KFRA 1QB7A 1PJ7A 2BEFA 1M0SA 1LWEA 4C4YA 1PBNA 3GG1A 4A8JB 5BNIA 2ZRBA 3U4IA 3LIPA 4I7FB 3THYB 4JB8B 1VQ4S 4HAVA 5ENDA 4M54A 3Q87B 1T29A 2CGEA 5JARA 1LPMA 1SQ5A 3KNAA 1OLSB 5C5EA 1SEPA 1Y1LA 2QRLA 4NR0A 4D0RA 3HV0A 5I47A 4A8XA 2VYND 1EH5A 5C34B 3PFGA 5IZCA 4KO2S 2HHHF 2F40A 2QN1A 1A8HA 3IMCA 5FDFA 3BRQA 1Y98A 5KJ6A 2ZBFA 3VFDA 1LFDB 1PD1A 3SSSA 4DL6A 2C1EA 5AVOA 3RANA 2WB1D 4OK5A 1I1GA 1AIPA 4Q34A 1DDIA 3PW4A 5B2EA 2BQUA 4JBIA 3WKAA 1RTJA 2AWOA 4P0PB 5EUCA 3RO7A 3M81A 3TZHA 4LJLA 4YMVA 3ETOA 4G4SO 4FF1A 3WNDA 4JB0A 3WFIA 1TLTA 1WSRA 2Y71A 3ZV6A 3LWBA 2VT2A 1AZWA 4CIDA 3RS8A 4PNZA 2I78A 2ZAGA 3NWBA 4P7JA 1BCSA 3HEMA 3R7DA 1MEJA 3CEDA 5E9JA 3QY0A 1IFXA 1WWHA 4K0KF 2BEVA 1EVQA 3L8YA 1N6NA 4BMYA 2H2FA 5T67A 1CUHA 2C94A 1L5SA 3MK31 4UDNA 3WGKA 2ECKA 4IGKA 3QEMB 3LY9A 5HG0A 2A35A 2VH2A 1SVWA 1K6IA 3VJRA 1ZYQA 1UM8A 2WNIA 1KOLA 4Z3OA 1E6UA 5JSUA 2YQ5A 1J5OB 1A5AB 3RKUA 4C8ZA 2QW1A 1EFKA 5H3LA 3JXEA 1G2EA 1MZVA 1PE0A 2YMPA 3V1LA 1JHRA 4CLLA 4Q3KA 4RYDA 1GZHB 2CZGA 1FX1A 4KH0A 5A4IS 5E7OB 5DMHA 3KU1A 1AUXA 2XMKA 2FPLA 3J7AC 7MDHA 3GMIA 2J3QA 5FH9A 1JJBA 4OM8A 4EY8A 2ZRFA 3OTDA 4H4DA 3LX4A 3B5EA 3O2IA 2A0FB 1JQBA 2QT9A 3QENA 1JX6A 1JG1A 3AR7A 4YUZA 3CINA 2HHLA 1FE4A 2KTQA 1SXJB 2VTVA 3DRPB 4UVHA 3NHYA 2IVZA 3VPCA 4OREX 1NKEA 2FIUA 2QUIA 3AEYA 5G53C 1DEOA 4GWKA 5FJIA 3FYHA 4DZRA 2B36A 1K5GA 3VVCA 4FTWA 5LC1A 3MMPA 5EKDA 2IH4A 2Y27A 3RVLA 1E96A 3AIMA 2MJUA 3BS9A 1PS9A 5TRTA 2HU5A 3ROQA 4LEIA 1B8PA 1GTEA 3RARA 4CLHA 2JCYA 2VBXA 4LNUA 4E8UA 2WZCA 1VL8A 2CNLA 1FCAA 2FPGB 3RBEA 4KJIA 1KHHA 1U7LA 3EGCA 1PGPA 2IBSA 2H3EB 4QATA 1REQA 3P97A 3BR9A 3OQ6A 4BVAA 4DL2A 1RT6A 1L7MA 1VL2A 4BWJA 3ZXSA 1STOA 4MICA 3WLNA 2ZWOA 1MOPA 3CVOA 5D3MB 1SPBS 1N9KA 4D6YA 1BQMA 1FW8A 4MS1B 2DETA 5DIFA 1C4AA 3ZHXA 2GPAA 1G55A 4Q4AB 2QSJA 5HFAA 2YVSA 2XQJA 1RJJA 3M2RA 3ENZA 1K1QA 3OO1A 4PZLA 4M38A 2DYAA 2OV3A 4LBHA 4OMDA 1Z0JA 5A8WB 1FXSA 3B6EA 4L15A 1DMSA 3GLGA 3MSCA 3SR0A 3LBYA 3MF5A 2O8CA 1Z0UA 2JEJA 3E3MA 1VHQA 1K89A 1ZC4A 4H1UA 1OGJA 2Q46A 3K9LA 2BFEA 1ZAXA 3TKLA 2V8PA 5CVUA 1HPZA 1J22A 4J8PA 2QLBB 3DBHB 1UVLA 3X3UA 4N18A 3FF1A 2DUJA 3WGZA 3R7AA 2GD2A 3M6FA 2A9VA 4M0EA 5IQQA 4WESA 2ZS8A 4I99A 4H16A 2IY7A 3IAEA 1KH2A 3B1YA 4RTQA 4IRKA 7ABPA 2JDJA 3OLVA 5EVJA 3OLCX 1VDHA 1A88A 2PD1A 4HQRA 4XIIA 4OZLA 2XF2A 2IH2A 2Q43A 3RJ5A 1M1YE 3BGIA 4PLYA 1K7FB 4WLFA 1V95A 4TOIA 3FBEA 4GBGA 1MO2A 4ELTA 2RHCA 1OWNA 4CP5A 2Y9HA 3QAEA 2QTGA 4EYEA 5CYOA 3Q10A 2BJHA 3LL4A 5CK4A 1ZKMA 2ZJ1A 1XKXA 1Z2PX 1HWIA 3LFUA 5F23A 2B6AA 6ABPA 4LRUA 5AW3A 1CCWA 2YHIA 3BWMA 1WDDA 5A62A 2ZBRA 3PJFA 4TS3A 3SC2A 5JNVA 2V9CA 2O5DA 4E1BA 1CQPA 5EHZA 3B3FA 3SMQA 2WV7A 5BOVA 3HHLD 4QWBA 1R4ZA 2QN6A 3TPFA 1YVRA 4ZPXA 1PAUA 2RGGA 4NXNJ 4IZHA 1T24A 5F0UA 2HURA 2NVWA 3HH8A 5LA6F 1A97A 2O0MA 3TW8A 1P45A 1E98A 3D7KA 2OHHA 3CCES 3O1HB 2QLJA 1IL0A 3FCYA 3FOWA 3WK8A 5I9BA 5T5QA 3P19A 1ORDA 1X5OA 4XWWA 3URMA 3H42A 2R6FA 4ZU6X 5C18A 1WIWA 4PWUA 1O95C 3KZKA 3WIVA 3HVHA 1M8GA 4KPCA 1LV8A 4UNSA 3SE0A 2AYGA 2JOQA 1F5BA 1PG0A 1TCBA 3IOCA 1OIXA 2M0GB 4TY8B 1IBRA 2QI9C 5F5LA 1WCV1 3X0DA 1B7YB 2EWMA 4MGHA 5K09A 4EY7A 1SUCA 2ZXEA 4Z4EA 2ZC3A 2WP0A 3DCNA 1EHCA 2XOXA 3GGSA 3HGQA 4JGGA 3ZWKA 4LSGA 4NASA 3OFHA 4A2CA 1RXWA 1HUQA 1Z22A 2GT1A 3RB6A 4JI6J 1JECA 4WK0B 4P4SB 4XSVA 4V3BA 4OHUA 5M29A 2YVLA 1P0FA 5DO9A 4EJMA 1Y1KE 1KYQA 2DHGA 3H25A 2LLZA 2JEZA 1QFXA 2F48A 5HQ8A 5HMMA 1YHZA 4HS4A 1U45A 4L75A 2VWQA 1KDZA 5LM7E 4ZP1A 2HQRA 3V1NA 2W6PA 4QQRA 3QIAA 2QZPA 3N0TA 2GPTA 3C8YA 3MHPA 1TZBA 1S1VB 3UDEA 1E8MA 3LQRA 5TF0A 2CSXA 4LNUB 3I5AA 3V8QA 2XI2A 1FYEA 4M99A 3V8EA 1W30A 3NJ8A 3PR2B 4EQ6A 3S1SA 2CJYA 3O8NA 3GFHA 3K17A 2RHHA 1FYFA 2VG8A 1F8XA 1Y6ZA 3L4KA 2A2DA 1S8AA 3AEZA 4O3NA 1VTKA 1DOHA 4D4HA 2EOAA 5DE3A 1ACMA 5D0RA 2OZVA 1IZ7A 1SY7A 1NUUA 1Y3BE 2E5LJ 4FXWA 3AMVA 5IV3A 1U1LA 5L7TA 3QT5A 4KQGA 1G8GA 1T35A 1C7FA 1YI8A 2IUUA 4RFLA 3M4ZA 3TB6A 5D4PA 2FHJD 2O2CA 4LYJA 1RWMB 3HCEA 4PGMA 3ZZPA 1UPTA 3KUHA 1ZM4A 4E09A 2VKQA 2V6GA 1J07A 5GMOA 2QM3A 3K1AA 2QD2A 2R2TA 4MV3A 2J8AA 1QIGA 4MYCA 2JGRA 2QG6A 2WYWA 2IS6A 2FR8A 3Q0TA 5BSVA 4PV7A 1CW2B 5BR4A 2CKDA 1YZTA 2PVPA 1YZLA 2XTJP 4KLZA 3PEYA 2P75A 2AKWB 3LC7O 2EYUA 4R1OA 4ZIRB 4ZRNA 4HN2A 3U3ZA 5JMTA 3I3SR 2FUG6 2NACA 3T6JA 1K44A 4F3KA 3DEAA 3QZUA 1SURA 1HBOB 3EICA 1YJTA 2OUIA 4RWXA 4HRAA 3EFHA 3TXXA 4B35A 1VLOA 2QMYA 2FEWB 3ENAA 1RTKA 4AE5A 4UUQA 1SCUA 5CA0F 3BH7B 4DR2F 4PE5B 1XIVA 1IUKA 1I2MA 3A04A 1SJFA 4ENOA 3UAVA 5D6NA 1XLWA 1PDWA 4ZAWA 4PX2A 1TW3A 4OXQA 4F2GA 4PZDA 4EYSA 4NLYA 2M6KA 3OCYA 1IHYA 2PMBA 5TMDA 4UPDA 3JRNA 1NDQA 1XEXA 2XWBF 2GM5A 4NK5A 3FNQA 1BTOA 4GP9A 4V0NA 1KY4A 1RT5A 3VSBA 1V4BA 3D31A 4JKOA 5HTOA 3GBVA 4AN0A 1NJFA 1R9MA 3DZFA 4H4KA 3P2KA 2GNPA 3NAIA 1CVIA 1E5LA 3GAZA 1T9ZA 3MZIA 2XQFA 3QMVA 4C08A 3FZGA 3OU6A 5AVYA 2F3SA 3UMCA 4ECTA 1U0EA 3WJ1A 3BK2A 3HCOA 3RSLA 3AOGA 1CD5A 4N3BA 4UASA 3KNGA 1H3NA 3D2WA 5GV8A 1XD9A 1S3IA 1S2DA 4DV7B 3HYTA 4EFNA 1R4MB 3ADBA 1TVEA 4DQSA 1TZCA 4GYKA 4UU8A 2G0CA 4FNHA 1PRYA 1XMBA 1OTHA 4YRKA 1SC6A 2X3GA 5I5EA 3GELA 4L4ZA 1H0RA 4ZDWA 1HDYA 1TKXB 1EQ0A 2RGAA 1CNMA 4J7UA 1X9MA 3OR1B 1OROA 1E9CA 2CLKB 3AG5A 1RT2B 1CEXA 2BE7A 5K0NA 4ZO6A 5ADZA 4OJ3A 1FFAA 2WZQA 4IUFA 4GICA 2OV1A 1ZH8A 3FUTA 4ZPTR 4NECA 2VRNA 3OLAA 1TKDA 4CLTA 2WVGA 4FW8A 2IAJB 5AK6A 3UMSA 3O03A 1X8LA 2NPOA 1JNYA 4I0WB 4DRZA 1G8KA 1TCCA 3AP3A 4QUEA 2IPMA 1H94A 2IDMA 2HZAA 2GERA 3ROGA 3WLSA 4QPNA 2Y0DA 2V4JA 3SQGA 3C6KA 4HDKA 4I64A 3UK6A 3F9IA 1QIFA 2FWBA 3A26A 3IE2A 3RC2A 4HHJA 4Q1DA 4XSHA 4JUIA 1FFSB 1T9XA 3CF2A 1NM5C 5HGXA 3JYTA 3LYHA 4IP0A 2D2IA 1PFUA 2J3MA 1RAAA 1JIJA 1XELA 1GQEA 2A0XA 4PYRA 3B6MA 4FDUA 4MWGA 2YNIA 3AUSA 2FWAA 2W70A 3NEYA 2ECFA 5LMNF 4BE4A 4JI8J 5TNXA 4L85A 2H8GA 2EVZA 4QICA 1ZINA 4FU0A 1B4DA 6FDRA 1TQ4A 3T5PA 2BMBA 3AESA 4OBWA 4B3TB 2ZE7A 2DR5A 1VG9B 5BYRA 4IFVB 2QRVB 4A46A 1X4AA 4F1JA 4FUQA 3AFNA 2Z2XA 3JQPA 3CKLA 1IYZA 1KYWA 4NU6A 4US2R 4MQEA 4LWPA 4BP3A 5I3UA 1IMOA 2R42A 1GARA 1LC3A 1EWTA 1JILA 4M55A 1N0UA 2ZUTA 3EASA 1XTZA 2ADMA 1GG5A 5F7XA 4KDEA 1CV2A 1M8PA 621PA 2V8BA 3T5JA 4BX2A 3ITHB 3FLMA 1LWOA 3ZUGA 1A9QA 1SQEA 4Z9BA 1R7IA 1DGQA 3MEQA 2PZJA 5EWMA 3FGZA 5K3EA 1RADB 1YIAA 3UQYS 2Y8WA 2JHCA 4O4HB 1NEEA 3QIPA 5TPWA 1JZTA 1X5TA 1H9AA 2CNOA 2PZLA 4XJSA 1RBAA 3QOYA 1FJ2A 1VRWA 1DRKA 2J9XB 4RD0A 4HX9A 5EIEA 1R8AA 4Z7CA 3T35A 1Y5LB 1Q1ZA 3ENVA 3C4JA 4L76A 2HQFA 4DZ6A 5ES3A 4UOGA 3CC8A 1USVA 3ZW8A 4DGQA 2P4EA 5HQ3A 4Y0NA 3UGKA 5ALYA 4S24A 1UFLA 2B61A 3AF2A 4DB4A 3VPSA 2P4QA 1TAUA 4WNYA 3DFMA 1H5QA 3G82C 4I6EA 3MT8A 3L84A 4MTLA 2VT6A 2WM8A 1OB2A 3R0QA 3LPDA 1GAEO 3BGWA 5IXJA 3AR9A 1AOXA 1SCAA 3EODA 4EJ6A 4EWLA 1SMKA 1S1TB 3P4XA 2O0LA 2G9QA 5JUWA 3G2QA 3H6GA 2A9RA 5LP6C 3KUKA 2VSYA 3CE9A 1VP9A 3LUGA 1LJUA 2CCJA 1HQYE 2L9NA 1IBSA 4OXYA 3KV1A 1ZCAA 4DLAA 1MW8X 1PJSA 3WA7A 4MV1A 2VSXA 5A5FA 5HKAA 2ZH3A 5CFNA 3LOUA 2VKTA 4GKJJ 4EO7A 4RK5A 3HYCA 1CEEA 3CEPB 1W25A 1QPGA 3AR8A 1UDAA 3IUQA 4KH1B 5CVEA 3UHOA 3GP9A 2EKPA 1BCRB 2JH8A 5BSFA 1EFPA 2YW2A 1E1LA 3AJAA 1VBMA 4U9RA 2HG4A 3VAHA 4RNDB 2IHUA 1N34B 5KT6A 1VA5A 3TLZA 2AEFA 2XO6A 1WTFA 1KMCA 1DXOA 1B41A 1F2TA 3IOBA 3DXZA 2ZLBA 1R8SA 1FTSA 1YFJA 3H59A 3ADAC 2MJNA 1PGNA 2Q3CA 3ZI0A 3LT4A 1YUBA 4M1YA 4M6WB 4FHDA 4AYXA 4A10A 1YZNA 2ZM6J 4BL5A 4MW9A 4JL5A 4DSLA 4PIMA 5KWSA 3A28A 5GZ1A 1FI4A 3KC2A 3QBTA 1ZD1A 3GG2A 4MJKA 4Q1BA 5CITA 3NOVA 4AKGA 1OASA 3GEDA 3TQTA 1A8SA 3OQ2A 2PV0A 4OYLA 4M1SA 4C43A 2IOFK 3A58B 5B0AA 2EFGA 4CF3A 2PT0A 2R8ZA 3C24A 5IK2A 4NCBA 3K2EA 1N7GA 2R6JA 4G1QB 1N9ZA 1PVOA 1XRMA 4TZTA 1WUJS 2GDZA 1ST2A 1J8DA 4FYWA 4QWMA 4RDCA 3EGOA 3AY3A 1RLTA 4NYOA 2F1KA 2HCJB 3LHKA 2V4QA 3SHQA 2X13A 1YDWA 3BN3A 1MB9A 1VIXA 3QLTA 1SHJA 2PSDA 2WAYA 4OYAA 4R3NA 4JI5F 5E7QA 1N5KA 1Y7LA 1TELA 2WTMA 4FI3C 3FWKA 4BUCA 3RF7A 2GHWA 3DEYX 2O01C 5IFKA 4IDOA 3U9SA 1JFVA 3BZWA 4ZVLA 4CV2A 3F96A 4ZPJA 2YOGA 1SKYE 1ZKDA 2OMKA 4LTNA 2FZGB 1LDBA 8GPBA 2WU1A 1ZVJA 3Q41A 5HM8A 5CVVA 2ODNA 4NI2B 4J0EA 1QUPA 1N2IA 2QY9A 1DRUA 1Q0SA 3ZQUA 3WRYC 3L7IA 1QH1B 1EJ2A 1GAXA 2VDIA 4UTOA 3KVRA 4NPCA 1BFKA 2ATCA 5KWEA 3LUDA 5KWIA 2OO5A 4W1SA 4QQBA 3ETMA 1BG6A 4ENVA 4EMBA 3NY0A 2WFLA 2XT0A 2XMRA 5IYZB 1E2NA 3ILVA 3PX0A 1VQYA 2VODA 2AR9A 1C0EA 4IZOA 4CIBA 2O8DA 1M6WA 2E4VA 4Z9FA 1ESMA 1C3EA 2VRWA 1OU0A 3GA0A 1MWYA 3IIIA 1OV4A 1RHUA 3UVEA 2QL9B 2I2BA 4E3ZA 3T9FA 3UUEA 4OV6B 4WIQA 5SZTA 1NVVR 2F1RA 3RRJA 4HYEA 4GGOA 3OT1B 3MMNA 1ENYA 1RC8A 1QHIA 2FPRA 2Q4OA 3GMTA 4WERA 3EXHA 2CFOA 4ZRDA 1R66A 5KTNA 2Y4NA 1DQNA 1G17A 3THWA 2ZNZA 1HBUB 3O4VA 5COQA 3R7WA 4KKOA 4U7DA 1JHPA 4DDMA 3FBGA 3EPJA 4ZO4A 2YOFA 1JA0A 1Q95A 1ZN9A 5D0HA 3OKCA 4C8OA 4AMGA 4DV3J 4FXOA 3VR2D 1RK8A 4RCVA 5ALSA 2QL7B 2KT5A 4C0QC 2JGNA 2C9MA 3E8MA 1HWKA 3ANNA 4IGFA 2RKWA 4II7A 2CNNB 4RH1A 4DV4F 2O5VA 2ALYB 4QPPA 4HVCA 1QDUA 1W2WB 3JARB 2XCAA 4CWAA 4ECQA 3B9RA 3SKYA 3FVRA 4DLRA 5THWA 4EF6A 1FMLA 4CLKA 4BEBA 2I4IA 1ZL2A 5GGYA 4NYJR 2OMOA 3P94A 5ETSA 4DL9A 1OBHA 1VMEA 1XJWB 1O0SA 1ZDMA 4AN1A 3HFKA 3BN7A 2J3EA 1ESEA 2H17A 2W43A 4ZQCB 5HK4A 2EFDB 3NBFA 1T34A 4E15A 3K31A 4ZYWA 5G0VA 3V55A 1JFFA 5AXDA 2V6IA 1GKYA 1FVFA 4HDOB 4XUGB 3MMAB 4IY1A 3OKPA 1CF4A 1RAGA 1E9SA 4CCWA 2R3VA 1PR2A 2UUBF 3ODGA 2CVZA 4RWEA 1QMGA 4TS9A 5L6LB 4IR9A 2MZQA 2QENA 1CR4A 5DOZA 4CR7A 3PC4A 3AY0A 3AF1A 1A96A 3MMCB 3NI2A 2VPWB 1E5XA 5IC6A 1TI7A 1VFPA 4F8JA 3LYLA 3RVBA 2G71A 2VHXA 4B4DA 3MCVA 4P73A 3EGNA 3EX7C 2D1FA 1GZUA 4BB6A 4UTXA 4R8VA 2C4HA 4PY2A 3UENA 1E79A 1QHXA 4UCQA 1WDLA 2VD3A 4F5DA 5EUQB 2X7IA 3K1JA 3DLEA 4ZGWA 2DFVA 1QH9A 2ZJ7A 4IVNA 2QTWA 4QASA 2JLBA 3LOPA 1OKKD 1GSOA 1NQVA 4DHVA 2PO7A 3GL9A 2WT9A 3KOYA 4FVTA 3TE7A 1QYDA 3B4DA 5ALDA 4PN3A 4U0JA 4WBFA 3ZDFA 3TG2A 1TZJA 2Q8QA 4PHCA 1B6GA 4GR4A 1RISA 5LM3A 1XNHA 8LDHA 1OD6A 3OHBA 4RD3A 4Q44A 3JASB 3SQOP 1Z2LA 5KFUA 1XDDA 3K0JA 4LRAA 3DTVD 4GRDA 3WIUA 2WW4A 4ZITA 2V7QD 1RABA 2YY7A 1T5DX 2H57A 4FFDA 3Q9SA 1NHKL 4OSPA 5H1SV 4UXJA 1IZ0A 3EN0A 3W4IA 3PTWA 4QQKA 4FBTA 3RH0A 4O3QA 2I34A 4PFKA 5GONA 4G5QA 3K8YA 1KBZA 4TT3D 3RRNA 2ZETA 4Y98A 3GFTA 1J2UA 1EPUA 1YNOA 5IC4A 4I6JA 1PQ4A 1FKAF 1M5KC 1L5OA 4BV8A 3NRBA 3TE6A 1P1KA 2NP6A 1BVHA 2HEIA 4IMRA 3F7MA 2C2MA 1UZLA 4FFVA 3RAFC 3TA0A 2A5FA 5C8XA 2JASA 3RBAA 4WFIA 3GBSA 1YDFA 3ZXWA 2XSZD 2ILYA 3SPXA 4ZANA 2OWDA 3R3XA 3UCEA 1OY6A 1UJBA 1EAMA 5CCLA 2WU4A 4YJ3F 3DT8A 3A1NA 1FRQA 1O2DA 5F2EA 4U9IS 4A03A 2K5UA 2IOFA 3TOCA 5ICFA 4LNAA 1YB6A 4KXWA 1QH8A 1GPJA 2CZ4A 1NDHA 3MLEA 1XNQJ 4BLRA 5BN3B 4DCOB 4F38A 2HQOA 1UAYA 4EI2A 2YXNA 4Q03A 2B1RA 3ICEA 5K14B 2ID4A 5C2GA 1E6VB 2NZXA 2G4BA 1RGVA 3S8EA 1HE4A 4DQUA 1J49A 2RFLA 3EK2A 1S0VA 1TLFA 1C8VB 5TQ0A 4AT1B 3R5KA 3UN2A 1TMOA 1CRPA 1TJNA 4EECA 1B00A 3NAGA 4ZP7A 1T3HA 1NUTA 1LFPA 1D8ZA 1RRMA 5K3FA 1W8DA 3PA6A 4XCXA 1T6ZA 2BVNA 5E3PA 2MKYA 2BMAA 4QIGA 1EJ0A 3S8YA 1D8TA 4N9WA 2W2KB 2IA6A 1EIYB 3QPAA 3CIMA 2RGNC 4JBCA 2D1QA 4M9SA 4L3NA 3TQQA 3J81k 1P6QA 2B78A 2QYOA 2JX2A 3T5MA 3AYZB 1NJIT 3MELA 3BM5A 5LYYA 1D5WA 3ZCVA 2GN9A 4TXLA 1F8FA 3JAWB 3LGHA 3A4YA 1QGYA 2Q1SA 4Y67A 5EWJB 2ZZKA 4GKKJ 1RXOB 1KZYC 1FU4A 5C25B 2QK4A 4XX0A 2HHWA 5C4MA 1UKCA 2RK6A 1GCOA 3SOPA 3LP1B 3MBOA 2X1BA 3F5QA 1N9GA 4R31A 5LT5A 1DT5A 1EFAA 3OPYA 5E4JA 2VQEJ 4PPDA 1MIOB 2G67A 1O9GA 1U8EA 1XBTA 4B80A 3ODPA 3M82A 5I7HA 3FHOA 5LD2B 4TSFA 3PZPA 1UJ2A 3ONFA 3H2IA 1Z6YA 1RVDA 3I2GA 2WJPA 2Q4EA 2ZOMA 2QNRA 1XVVA 1RKIA 4KFBA 3HWX1 4DSKA 4GPAA 1ZONA 5IC6B 5DBIA 3P2YA 4KPFC 1U63A