4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
1M0SA 1FS5A 2BKXA 3OBIA 3CEDA 1HOTA 3MWBA 2RI1A 2RQMA 3DHWC 1HORA 1FS6A 1XTZA 3LHIA 2JOQA 3LUYA 3ENVA 1FRZA 2F8MA 4L4ZA 2RQKA 1Y89A 2FGCA 3K5PA 2QMWA 3LOUA 2RI0A 1FSFA 4NMLA 3TUJC 2J0XA 4X84A 2P9CA 2QSWA 3BXGA 2DT9A 4TM8A 4LUBA 3CSSA 5IT4A 3MTJA 4L51A 1RWUA 2MDAA 3ENWA 1PBTA 2QRRA 1VL1A 1YBAA 3N0VA 2LQJA 3KWMA 1KS2A 4IO1A 3E15A 4R7TA 1NE7A 3AB2B 3OFHA 3BXFA 3AAWB 4TM7A 3DC2A 3BXEA 5HJ5A 2H9ZA 3L7OA 5IS2A 1UJ6A 2J0WA 3DDNA 2NYIA 2P9GA 1ZPVA 3W7BA 3ICOA 4GO7X 3NWPA 2ZHOA 3U7JA 2BKVA 2P9EA 2WU1A 1LK5A 4L5IA 4OQQA 2PC6A 2O0MA 3MAHA 3LWDA 1FQOA 4GO1A 4GMKA 3HN6A 3O1LA 3BXHA 2JHEA 4M8LA 3P96A 4GO5X 3TUIC 3IXQA 1JT9A 3E7FA 4L50A 5JJBA 1SC6A 1PSDA 2J0EA 2DTJA 2W48A 1U8SA 3EB9A 3NRBA 3TUZC 2LVWA 2GNPA 4L4YA 5IT0A 3NZEA 1LKZA 2R5FA 3AB4B 2CDQA 3OFGA 3S1TA 1UJ4A 4R9NA 2F1FA 1DEAA 1Y7PA 4PWUA 5T41A 4L5JA 3ENQA 2RE1A 1O8BA 3OC6A 5FIIA 3UW1A 2I9SA 3CH7A 3KV1A 3TX2A 4OQPA 3HHEA 3OFFA 1YGYA 2KO1A 2PA3A 1CD5A 2OKGA 1LK7A 1UJ5A 2QMXA 3IBWA 3EFBA 3DHXA 3OFEA
chains in the Genus database with same CATH superfamily
3JYPA 1P4SA 2PRZA 3MM5A 4IUBS 1K1EA 2C96A 5AI5A 1N2OA 4FFRA 4EB6A 5ETMA 1Q0HA 2QV7A 4BNUA 2XO6A 5KFIA 2FZKA 1JLEA 3ZWXA 3REQA 2COEA 4CU5A 1XWLA 4O3QA 2R7NA 1G8YA 2N82B 2ACVA 3T34A 2ZUEA 3B9RA 4KV8B 3RVNA 2PJRA 2P2YA 4V02A 2C7RA 3MPUA 2FWPA 5FWDA 1AQJA 3B6IA 4BNIA 3HSZA 1SOMA 1D1QA 1T8SA 2HNYB 3FZBA 5G4DA 4PWDB 3T3MB 1L3UA 3KPVA 4MS4B 5I8WA 5A8RA 3WK7A 4YHHB 1N25A 4B6JA 5E4TA 4B0PA 1TCBA 2BISA 3CLTD 2E5LJ 2J0EA 1KGDA 1OLSA 5ECDA 1L2TA 3V2GA 1G6BA 2R1UA 5CB6A 1CNEA 4XH9B 5IWAJ 4OXKA 5ITZB 4D9NA 2OHFA 3NU1A 1QIEA 1N56A 4E70A 1T36A 3T0FA 4X64B 2FOXA 4PZVA 3MT7A 4L5JA 4PHCA 2CFIA 3R6DA 3WWZA 3QZ8A 3TQEA 4DUGD 3FR8A 2BTQA 2VP0A 3LFTA 4B0OA 2X3DA 2X1HA 4BV9A 2HSJA 2OXFA 3TRDA 2BLLA 2A0KA 2FI1A 1HOXA 3AOCA 5K03A 2A1UB 1OHHA 2V2QA 4HUJA 3RVLA 4NDAA 1KN6A 3ILLA 3MAAB 5F1YA 4QDJA 1G20A 4WFAQ 3AB7A 4Q66C 1D4FA 2C4TA 5AXLA 1S9GB 2NUAA 1B4DA 1KMNA 1KHTA 3MQFA 5J2QA 3FJ2A 5HDBB 2WF8A 1LDYA 1UMKA 1ZK1A 1T9UA 2ZH7A 4IICA 5E6UB 1RLJA 1D8YA 3PRDA 2JFXA 3MCSA 2BDPA 1UPPA 4YXWA 2CVPA 3JQFC 5D3ZA 3GELA 1UWBB 4M6WA 3MGBA 4PYKA 4COOA 3K9QO 4RESA 2GVNA 1R0CB 1PU2A 1N3YA 3KQYA 3QJYA 2WKPA 4LAFA 2Y71A 3O8DA 1RFLA 3T41A 4OSEA 3FCYA 4B35A 4G84A 3LO3A 4J7UA 5L45A 4ARZA 1NXQA 2JIDA 5J4KA 2IEDA 2Q1SA 1AA9A 2FX2A 3K53A 4A1FA 3K7RA 3WY9A 4ALKA 3OFEA 2AG5A 2OMKA 4YJHA 5B64A 3EF3A 3CO0P 3NI2A 4IZHA 3KHTA 3W5AA 1RDFA 1C0TA 1XJ5A 2WLTA 4HQKA 3URMA 1AS2A 4EW1A 1N2CA 1TP7A 3LOUA 3JSYA 4PZAA 2DNKA 5JWHA 1T11A 4IJUA 4P7JA 3DVLA 4P83A 5IAEA 1ADGA 5BSHA 1NNLA 1WF0A 3HJFA 2V7WA 2JLBA 2RAQA 1CWUA 1LC3A 2DB3A 3T1QA 2BW7A 3U39A 1HNXJ 1B93A 4A15A 1BMFD 3P9XA 4LFBB 3NYIA 4S3MA 2XM3A 1W4LA 5CUQA 2WKSA 3COPA 3JAMU 3GI1A 3EAGA 3GJ6A 4B47A 2O2SA 2ORYA 2CKDA 4ZXPA 3K8VA 3P2OA 4B1FA 5EKDA 1ES9A 1R8CA 4CZ2A 3ADDA 3F4LA 1D5CA 2P5VA 1I3CA 1NHGA 3HPQA 4D2IA 1LWOA 4RYLA 3D1VA 3ZLJA 5FUXA 5MAOA 4LISA 1BW9A 3ETCA 1VSQA 3K5IA 1E89A 3DTYA 3N2EA 4BX2A 4GBMA 2IY9A 2BMFA 5I4BA 5KTYA 4L8FA 2V8BA 2NU6A 3A6JA 3DLKA 3HFKA 1A5AB 2AK3A 1KBQA 1T5IA 3QIPB 2FSSA 3WKCA 1MABB 4MINA 2IQ5A 4X4NA 1U2EA 4ML3A 2QRGA 3T9CA 3KJNA 4B9TA 1TU3A 3K4QA 3KQHA 4NI2A 4DUYF 2FWMX 1O77A 2HHQA 1XA4A 5JCJA 1R6UA 2C29D 1N5VA 1XA0A 3PR3A 1BX1A 4N5LA 5DOZA 3FGNA 1C9KA 1L7EA 1M0EA 4NOKA 3P3DA 3VPDA 2Q5LA 5C2GA 5IFLA 2FEAA 2EJVA 3OEWA 5JH7B 3P9KA 4R3WA 1W35A 3LDHA 1PHRA 1SGWA 3HR4A 1G8AA 1ZFNA 4ID5B 1D1UA 2EFVA 5F8GA 5JBNA 2FPUA 1YS7A 3OF3A 3WRWA 3JR3A 4ENTA 4NLWA 3CMES 2PMZD 4B6RA 2YPZA 4OQXA 3SFGA 2ILVA 1GG2A 3KAQA 3AJ8A 5BUZA 5ENZA 1Y7HA 4GVXA 3PVZA 3CONA 3EZXA 2DBRA 2IU3A 1DQYA 4LF5F 3FGVA 2P35A 2WHYA 3A14A 3HKBB 1SUDA 2JVRA 2WIBA 4HTFA 2XBUA 3HC7A 2C0PA 2JRSA 4DS4A 1Z83A 3D68A 4QFDA 4M7OA 2WONB 4UKDA 1SV5B 4RJTA 1FZQA 3NJ8A 1VCOA 4XQEA 2FJAB 2P3QA 4CKYA 3WA6A 1MORA 4ER6A 4ZGGA 5DI3B 2UUCB 3N6LA 1SWVA 1L4EA 3GJ3A 1ZIPA 4RDXA 2C1XA 4XYMA 2IM2A 3VVCA 2KB0A 4DAOA 2Y0BA 5B7NA 4AL5A 3PPIA 5I7SA 1T0IA 2DNZA 4Y6SA 2VP3A 3RUFA 5ETOA 4OP2A 4UT4A 5HTKA 1X7WA 1R15A 5I9BA 3DLTA 2IZ6A 3BH7A 1GZSA 1FDIA 1XN4A 1TL4A 3ZWYA 1T03A 4KRWA 3M05A 2J9DE 4RS4A 2VG7B 3VTZA 4KQZA 2AQ8A 4RW4A 3ZZMA 1OBOA 4XKJA 1JNXX 1DJMA 3NYWA 1EFTA 4K03A 4EVIA 2QMUA 3K4HA 1GN8A 4E7PA 4RX6A 3ND6A 1E77A 1QCZA 1HIYA 4D80A 4ZVRB 4UTZA 1SUAA 1FXLA 2O7NA 2GZHA 1T1JA 4Z0NA 3EVGA 3CR7A 2HAEA 1FMTA 3ECAA 3G68A 1MO3A 3VCDA 5LB4A 2GS8A 3GCZA 3A3NA 3ZVNA 2B4PA 3EXIB 3IEUA 4AM8A 4D5EA 4M83A 5D6GA 1GQOA 3ENNA 3PR2B 1NW5A 1QVAA 6REQA 3GXBA 3A9WA 4OJKA 4ZN3A 2NO7A 2PFSA 3AL3A 1VHFA 2QA4G 3C6BA 2H9ZA 1KOJA 1XIQA 3FKBA 1MH1A 1IY2A 2N3LA 5F8LA 4JI1F 3PXDA 2Z09A 3VPHA 5HR5A 5KSZA 3ZTPA 4KB5A 2OPRB 3COVA 2ASVA 4AYWA 3KK2A 3DM9B 3GRVA 4RWXA 4O0LA 1HNXB 3W9BA 4R83A 1E9FA 1MJNA 3OZDA 2E7WA 2V59A 4GR9A 3MZIA 3LG2A 4KWCA 3NHYA 1R6TA 1VIDA 3TLMA 2VOJA 2W9CA 4GPEA 1U7LA 3BD8A 2H1CA 4Q48A 2CUNA 3GUZA 1GRVA 2G7MC 2FLVA 4LRCA 3S99A 4FFMA 2BKNA 3SXUB 4A8FA 2XV1A 4BFWA 5D0GA 1LC0A 4UE3S 1H3NA 4HACB 1TO2E 3ZIUA 3NP9A 5FUBA 1WQ4A 2WJPA 4CV0A 4ZVQA 3CGGA 3ZU2A 1TK3A 2BKOA 2C7VA 1BQNB 1CXZA 1PUXA 2JGRA 5BXIA 4MGEA 2FLLA 2EIXA 3M6AA 4PM4A 4H7EA 4LZPA 4UMEA 3DNFA 3QVVA 2VP2A 3C70A 3OM0A 1XGKA 2EWMA 4H4KC 3UY4A 5KU7A 1RPJA 2P0EA 4K9SA 2F9JA 3QYAA 4PTYA 3IS9A 3LSTA 5IG2A 3CGIA 2O3JA 4MJ3A 1J06A 3FWPA 1FKOA 1DX9A 4BEVA 3GIIA 4FPRA 1CBKA 4AG6A 3L4JA 3ZJ4A 5K0EA 5K8CA 4ONEA 5AW8A 4U8GA 3K6RA 3WIEA 3OLWA 4LYEA 3GVCA 5KG5A 3N8DA 4RMIA 1D2NA 4FQ5A 1OH5A 2DC1A 3CLRD 4I5FA 4ILKA 3EJ6A 4YJ2B 1I4LD 4JNCA 2JCGA 3GO4A 4HKQA 3MAAA 3ILOA 2GO7A 5ALWA 1A4XA 3L92A 1NQUA 4PHFA 2OQ2A 4HVZA 1VBFA 1W8IA 2HMIA 4MYTA 3TR0A 4CL0A 5C5JA 1VGVA 1R2QA 4Y0AA 4ME6A 4C9DA 4R1PA 2KT3A 1DAGA 5BV8A 1CB7A 2NXEA 1S6OA 2LP4Y 1XZEA 3QLHA 5K8NA 3I53A 4G5HA 2DHDA 4EA9A 2Z1DA 1BQEA 2APOA 1EEHA 3EZ6A 5FTNA 5FUMA 2PE5A 3A9CA 3PW0A 4HLBA 4OP3A 3KCQA 3OTOB 3NETA 1WF2A 3VOTA 2Q5CA 2FJEB 1XYGA 3QEOA 3RVSA 2ZH3A 1SURA 3LZDA 1NDHA 4FNGA 2MQQA 2C0CA 2BE2B 1HKAA 3TBFA 2F00A 1G64A 2BDUA 5JAPA 3DLHA 3DP9A 4DCJB 1E92A 3AUSA 1AW0A 3HUUA 1TMOA 1DAOA 1WDLA 4BUJA 4FF4A 1V0JA 4KR9A 2VF3A 4XWYA 4DPUA 3I9OA 1XE3A 1GQYA 1K86A 1H6BA 5GONB 4IF4A 1FE8A 4RH3A 1GGMA 4FYIA 1TVRB 2HSGA 4GMFA 2YBEA 3IESA 4TRJA 1FTYA 1F2VA 4PVCA 3DMDA 3KELA 4L3WA 3OCWA 4KWHA 3HV2A 1KHWA 1ZZEA 4ECUA 3V8VA 1TL5A 1KVKA 3PFNA 1HLGA 1C7RA 1FNSA 2GVDC 2J4CA 1P19A 1RJGA 2D7JA 4AFNA 2D9PA 3SV3A 4WWHA 5KWSA 3MTJA 2P2CA 1RSCA 4LRAA 1NBME 1THGA 2ZI6A 4DG1B 4MUHA 2PNJA 4M5HA 3WK6A 4YUVA 2I78A 4OQDA 3FEXB 3JX9A 3WK5A 4YV1A 2Q8QA 4UY85 2EKYA 4DL4A 4BLSA 4OX9B 2PH3A 2YMMA 1RKVA 3TLEA 2CFSA 4FE4A 1GKLA 2PYIA 1Z74A 1Q0UA 3KEFA 4L9WA 2CMKA 2HLDD 1E7MA 4CO2A 5IBPA 2QTWB 4L50A 2QA2A 2HGSA 1Z4UA 1Y00A 2OCPA 2BFCA 1KOLA 4CF5A 2JGLA 3D43A 3BL5A 2HLPA 2IHJA 3ZY5A 3TPFA 3PEVA 1L3VA 3U1MA 4FCTA 3HXTA 4R7GA 2RE1A 4FE7A 4RA9B 1WAMA 1PZGA 3NT2A 2VQEJ 1H42A 3I3OA 5B1EA 3KQNA 1I5OA 3RRKA 3H11A 1Q3TA 1Y8QB 1TZBA 1YZQA 2ALZA 2I87A 5JIBA 2AOTA 3HHDA 1KRHA 4JP2A 1HL3A 1Q0RA 3QFCA 4A2QA 4XWAA 5AR1A 1DB3A 4CKBA 1KP9A 2QTZA 4B4UA 2QRLA 3QGHA 1NZFA 5KYYB 1FRMA 1Y5MA 1RU2A 1DV2A 4IH7A 4ALNA 1REVA 2M6KA 3OPQA 1JLLA 1X70A 1QF6A 4A0QA 4J1SA 1M1XB 3F46A 3EDOA 4FT2A 5KFVA 5JBQA 2Q07A 3A9UA 4D1YA 3MTEA 3E7WA 1NT4A 2QTNA 4E31A 4RBVA 3BFJA 4JELA 2K8GA 4WZAA 1QTIA 4KBYA 2FEPA 1H2BA 3OOJA 5ADZA 5A5FA 1UBRS 3EW7A 5EESA 2CDQA 3H5YA 2BJ1A 1NAIA 2IBSA 2IYSA 1JNZB 1YDGA 2PJZA 3R97A 2FPPA 4WFZA 4H4KA 1SD5A 1NDPA 1J9EA 3R1LA 3W64A 2BC9A 1KVIA 3SSRA 1VC6A 4G4JA 2RKWA 3STTA 2GN6A 5EFZA 10MHA 4CM8A 5K14B 2BDTA 2WE8A 4RX1A 1R8SA 4PXAA 4JI4B 5HNKA 2C5SA 2EPIA 4AKSA 3DFZA 4JAVC 4BNMA 2CL7X 4HYEA 3U31A 3AR7A 2VUUA 1M5HA 5IJ9B 2I9KA 3NEJA 1TFYA 5JCXA 3UXHA 4CKZA 1GL3A 2F8SA 2X5KO 1RT7B 3O8OA 3EX7B 3UMJA 2ZJPQ 1VFPA 6NULA 4J16C 3FA2A 2W8ZA 3ELDA 1FKPB 2PUWA 3ET4A 1JQAA 1S1VA 3E9NA 2YVKA 4C3LA 1XNHA 1MSWD 3THRA 1A9OA 4ZP1A 5JVDA 3CVVA 4RU1A 2RAVA 1G2IA 2QT9A 3DXBA 4AIIA 2FDNA 3LWNA 3W6UA 4ZVRA 3BIOA 2IIQA 1CS4C 4I69A 2G82A 3D3JA 4HNGA 3P9NA 4OH7A 4JLJA 4PIMA 5WRFA 3RYIA 2FW6A 4BP8A 3B1XA 2GMHA 2MSDB 3RKUA 4LPKA 1GQ2A 2PZAA 2QD1A 3M4NA 2FLWA 4MW6A 2BGGA 4WOBA 3MMZA 1OC2A 1VBZA 1YWGO 4F2PA 4WXMA 1RRCA 1JKHA 3L7BA 2H18A 3CD7A 3NAMA 1BWRA 3BB1A 1ZNQO 1FP4A 4ZIWA 4QBHA 2PL9A 1II8B 1CJCA 1RQ2A 1HT0A 3CG0A 4H59A 5JH7F 4R69A 3GJYA 2ZJ5A 4D4IA 1MX9A 2R7SA 2D5AA 4Y2MA 3KFLA 4RSRA 2CLDX 3PEFA 3QMMA 3VOAA 1PSDA 2MJLA 3UO0A 1ENYA 3PG5A 2G9QA 1S59A 2I7XA 4JASB 4KACA 3OFKA 4DM7A 4EO9A 4IW3B 1E1QA 3WKEA 3LF2A 1JG6A 4HYKA 2II6A 3TK1A 5KFTA 1A9NB 1U0JA 2WFLB 5DN6A 4ZEOA 3D4NA 4OFXA 3ER8A 5CAAA 3KJVB 13PKA 1N5QA 3LY8A 2QVLA 1CF9A 1RRMA 2OBMA 2I2AA 4HGZA 2HPVA 1KSGA 3L6CA 3RK4A 4IFTA 1F4PA 1LI4A 4Y2XA 3VISA 1YDHA 3DGEC 4ZVSA 4RSMA 4D41A 1KO7A 4MTLA 4HVCA 2FAXA 4UHKA 3C66A 3HU2A 4YAEA 3O1JC 2I2FA 2RK4A 3FMOB 3R5CA 3GAMA 1C3JA 4ED8A 1XTJA 1GUBA 3RIMA 5BV2P 1PG5B 4TS1A 3EBLA 3AUTA 3PFBA 2JG3A 4HI1A 3INRA 1EETB 2P9EA 1UKUA 5ITSA 1J22A 2GA9A 1VSUA 1BU8A 4JB0A 2VHTA 3TM4A 1GTJ1 2AFHA 4CL8A 4TROA 4NOHA 4B7UA 2XRFA 3KAJA 1EFAA 3RW7A 2WVDA 3QU4A 3OUYB 3D9QX 2UYGA 1RHKA 1MU2B 4DWIA 4CIYA 4BX0A 2ZRMA 4JNKA 3OQ6A 2E9SA 2HMTA 1WLSA 4B3GA 1C0IA 2VTVA 4DUZB 3TX0A 1RWKA 4JCOA 1XCOA 5KYGA 4KR0A 4CGYA 5JSZA 3EW9A 3FLEA 2GN0A 2Y77A 5ADVA 3RBEA 1R8XA 2HYDA 3QLJA 2ZJZA 3P71T 2C5BA 4OL0A 5FPYA 1VPLA 2J32A 5F9HA 1CQMA 1L4MA 3GPBA 4B9MA 2BCJQ 3VYSB 2I33A 1U5BB 4JR1A 4WGFA 4Y1RB 5D51S 1P31A 1NLMA 2IH4A 1XELA 2BMJA 1P62B 5B2EA 2HPAA 3HBFA 4YV2A 3HHLB 1HO3A 3WDOA 2HNZA 3HBLA 5DDIP 4R0NA 5B1HA 4YHBA 1UAAA 2DGWA 3DBOB 4CUKA 2ZQZA 2AYEA 5BYBA 2VYVA 2OPSB 3B2QA 3CX3A 5IABA 4F4WA 1RWWA 1UF9A 1F8XA 4K1LA 3QO9B 5K51A 3CZCA 4MW2A 4CF3A 2X6TA 3L7UA 2FWNA 2IYAA 4GKKB 3Q41A 1A98A 3TJAA 1X7YB 1R74A 1G2PA 1BXGA 4G65A 3VGJA 1U4NA 4XDZA 4LDNA 4AYBD 4WACA 3LT2A 1N36J 2N46A 4HZUB 3N2GB 1G63A 1KAQA 2OZEA 4K40A 4BB6A 3L9XA 4QAJA 2MSNA 2IJRA 1KAOA 2AN4A 1GSIA 2PRYA 3MBKA 3MMNA 4PLTA 3QKIA 1YLXA 2BGTA 3UCFA 4QO8A 5DYYA 4IDHA 3B3AA 2YV2A 2JHAA 3PQ2A 2PWYA 3R41A 3T6JA 1KC8T 1OGIA 5EKTA 2XA9A 4FUQA 4QASA 4KO0A 4IDBA 2ZIXA 2XGPA 4HHHA 3BMCB 5IBCA 2R8EA 2WIDA 1Z5NA 1G18A 2CV0A 2D1FA 3BJMA 1S9GA 2YX4A 3UNGC 1WWKA 1OA0A 4JODA 3UHJA 3GG9A 5MLCV 5ESWA 3ZBUA 3TJ8A 1NRJB 2L0XA 2XY5A 3SJBA 4DV7J 5BVHB 3RC3A 2YH2A 1RSZA 1DTSA 1FFXB 1I30A 2IKQA 4K0KF 1VGQA 2Z6QA 5K9FA 2RGEA 2QV0A 3K8OE 1S6PB 4DDWA 1DEAA 1FJ7A 5L53A 3EARA 2A9KA 1TD1A 5LR6A 2XE6A 1QORA 4RFSB 4ETXA 5GVRA 4DPOA 2K7JA 2JIMA 5KYWB 5DZ7A 2H11A 3BHNA 3HYSA 3BRQA 3GQBA 1ZM4A 2VQFJ 3BD6A 3G9ZA 3U4QA 3JZAA 2HBYA 4DQSA 4OI6A 1R0LA 1X4AA 4QT0A 4CLYA 4NZ0A 1SJQA 1O96A 3EGNA 4CKCB 2MLYA 3VKGA 2MMYA 5TMPA 2GZ3A 3NWBA 1ZEJA 4JI5B 4B3DA 4TLLB 1PAUA 5IKPA 3WZ0A 3H5AA 1JDBB 4CV3A 5DQIA 1JQEA 3A36A 4EF4A 3UGKA 2IS6A 1XEWX 1H73A 2RMKA 4EBCA 4XIIA 3RABA 4WCFB 1AKNA 4UXJA 4A8SA 3T52A 2ABYA 2B56A 2FN3A 2HAIA 1SUCA 3DB2A 5K0GA 1UM9B 1WVIA 1FU8A 2MKIA 4HHEA 3UNXA 3THWA 2JEFA 4BLRA 4PCQA 1LRKA 4FMCF 2NO1A 3ZUPA 4JSYA 1EFRD 3RG8A 1TJ3A 3QLUA 1GG9A 3U48A 2F48A 3ZGVA 2RCYA 4D0NA 1FX0B 4LQCA 1JG1A 3R0JA 1XMIA 3DBLA 3B54A 1C41A 3LUPA 1E3IA 3NDJA 4JJEA 1P0PA 4JA2A 4XQCA 3SD7A 1OFIA 3SKXA 1X2BA 3AR8A 3SCJE 1XR3A 1W36C 4F38A 3LBFA 3SI7A 3S7RA 4MYSA 3OQMA 3DCJA 3K58A 3I1JA 2N7CA 2PA0A 3G2NA 4GPD1 2ZKTA 4UTOA 3HDTA 2BD0A 1MRNA 4E0BA 5HM6A 4EX7A 2V0CA 2FEWB 4ZVTB 4V1CI 3SICE 2XLIA 4R41A 3RGIA 4II2A 2FSPA 3KJGA 1L6IA 2OI2A 1E3TA 5KQPA 5FA6A 3ET6B 1DTWA 4DNPA 4WCFA 1SUFA 2C7BA 2I66A 4Y2UA 2AUMA 1XVVA 2U2FA 4INJA 2YVSA 4HVAA 4J8PA 5LZ9A 4REQB 4MS1A 3I73A 3CG4A 1R37A 4DR7B 5KC9A 1HZJA 5EJ8A 4WFBQ 3QJGA 1W85A 3J80U 4AKHA 2CKMA 3BMQB 1KOOA 1QMGA 3C3MA 1PAUB 4IIYA 1JAIA 4MA0A 5IK2D 4OQMA 1U0SA 1GQRA 3MSCA 4HN2A 4BB5A 4TPKA 4L76A 2ZG6A 4PZDA 3QUQA 1OHHD 5AJTA 4Z2AA 2GIQA 2QN7A 4CG3A 2PPVA 2WNSA 1ZVJA 5JXGA 2XVYA 3R09A 3GROA 1FRXA 1RAGB 1CZKA 5BSFA 2N1BA 5CFNA 3SQNA 3KLHB 3P2EA 4QO7A 1WXDA 4TY8B 4D42A 4RVDA 1HT3A 1KDZA 2QTRA 5AK5A 1B41A 2HMUA 1AN0A 4C88A 1IOWA 1BWSA 3O31A 3I28A 1JDJA 4IDCA 3QKUA 2IDJA 5G2OA 3OOYA 4CCHA 1XEWY 2CJPA 4ZQEA 3ZTWA 4IJ5A 4RZQA 4D8XA 4KNWA 3MOSA 4UM5A 3T7JA 2AEEA 1TK8A 2JAPA 2HHPA 2IRWA 1KS9A 2XCPA 2FPLA 1TU4A 3E1SA 4RK1A 2M0GB 1LNQA 1J49A 3H1PA 5BSGA 5C4GB 3A13A 4RPLA 1NV9A 1YI8A 1TADA 5AJXA 5F8HA 3GRAA 1VFJA 4LF8F 3GRUA 1KXJA 1A2KC 3MJSA 4I4CA 2IYLD 4P82A 2ZH8A 2J87A 3EUFA 5TQ2A 2J67A 4RENA 3DL2A 3H1AA 2OZVA 2ZS8A 1EBFA 4ZWNA 2ZLBA 2HPZA 4ED9A 3W34A 4U2FA 1P1IA 1K3UB 3Q22A 4JEMA 4NPOA 2HQRA 5B1SA 3AVQA 3TFOA 2WVCA 4MR8B 2DMRA 3QVXA 2PJUA 2J7UA 3EFHA 1QS0B 4ZCSA 4KQ9A 3D3EA 4ACAA 3KTAB 2V4MA 1SCKA 1HE8B 1CVJA 3PHHA 2VJLA 4QTTB 3DA8A 1Q14A 3OR2A 1GG8A 4EG8A 1ZUHA 2XBLA 1M72A 2W4QA 4R16A 3OE7D 1XR6A 3W1WA 1D03A 2JKVA 2MY8A 3G6KA 3B1KA 1K1SA 4R0MA 2HQGA 3BZQA 4FYMA 2B36A 3DV0A 1W59A 4DRXB 4NMXB 4TNOA 2JC0A 1BVUA 1UWVA 4AUNA 5CYQA 1EDDA 5IFKA 3DRSA 4NESA 3N39C 2WVFA 4BKUA 4BCDA 1UKCA 1YIAA 3OJLA 1B2RA 1JR4A 1TYEB 1EGAA 3DVSX 3IKVA 4FILA 3OSPA 4TKLA 2P1RA 5IPFA 3T4UA 4S1VA 1JXLA 2PUHA 4GGMX 3ZU3A 1IJKA 1IM6A 2ATCB 3T5GA 2QTVB 4URWR 1IJBA 1XVLA 4XAQA 2ON6A 1X9GA 2RHRA 3R5GA 4DARA 3P9ZA 1MO4A 3B3QA 3HZRA 4ZPCA 1S2MA 3IIJA 4Z2YA 2VPZB 2FSHA 4Q93A 4ZHSA 5PGMA 1T9WA 2I2BA 5A1TA 1RQ0A 1SXHA 3DTTA 4RNDB 4H16A 1FSZA 3VTAA 3HF5A 1NDCA 3J7TA 2IFXA 4IDDA 4CWAA 3DLEA 1COWA 4BC9A 3GN1A 2EL7A 1U49A 1S0MA 2WWVD 3AF1A 3PUJA 4I36A 3JS9A 1ZO8A 1ISIA 5D6OA 3M6LA 1UBEA 2G0NA 3KLIA 1FFBA 1QGZA 3IRVA 3PI7A 1BQXA 1WHTA 1H6AA 1WXGA 2UUCF 3CNLA 2QN2A 4DL5A 4YMTA 3PG9A 2I1RA 1YCGA 3CMQA 4WT7A 2CPEA 3DFMA 4DGSA 2C7GA 4HZGA 2BYTA 2P11A 4KJIA 4X6XA 3IHTA 1XJCA 4LXGA 3LFUA 5I3UA 4LJRA 4PHTA 2VSNA 1S7GA 2R2TA 2R8KA 2DGUA 1ATIA 2GXAA 3QLUC 1YR8A 5JI3E 1U1CA 2LBPA 1MOSA 5HLFA 4BO9A 3IEPA 4QGAA 2YWGA 3LALA 4W92B 1AU9A 4EDFA 2PL1A 5JSUA 3PKMA 4MICA 3C8DA 4E88A 1CG2A 3BQ9A 1JHYA 1XZBA 4OHKA 2B51A 5K20A 2FJBB 2HDNB 3RR7A 3VH1A 2KH9A 2GXSA 2BONA 4TTTS 5C5DA 4MUIA 3KOZA 1MF7A 2VYQA 2ZYGA 1VKOA 3C6KA 1NC1A 3I72A 6ABPA 4NVRA 1H8EA 2FB0A 4TMXA 4Z4FA 5C8YA 3WGZA 5KWEA 1DOZA 1GUZA 2PT6A 1R0WA 4J1QA 5KT7A 1XVUA 2C77A 4DCGA 1ADBA 2YRWA 4LF7F 4KQXA 1X1QA 4ZTZB 3UDLA 4HFRA 1DAEA 3KKPA 1J24A 1WB5A 3GT0A 3T1OA 3W9SA 1DKMA 3GPCA 3QZ7A 3TVDA 4BGEA 1JLGA 4LK3A 3PJFA 5GIOE 3M4YA 3R0XA 1QGED 2VG5A 3HZZA 4WKOA 1JEOA 4RKEA 4JGBA 5H9WA 1XAIA 3DM2A 3EFOB 1C81A 3J81A 3ENAA 1UFOA 4BC0A 1U1IA 2PGXA 1C7JA 3RIXA 5H4GA 2AYGA 5H83A 1NXIA 5AYVA 1MMDA 2Q6TA 5CB4F 3ZHYA 3PWTA 1M6VA 4HMOA 2AJDA 3TTWA 1B43A 4K4YA 5AJVB 4ER7A 3GU0A 1YQWA 4CL3A 2JH9A 4C3ZA 2DETA 4ZKDA 4OSPA 4OLHA 5DNUA 2PWZA 4HDMA 2X22A 5MN6A 4DJAA 1HW8A 3G4SS 3K89A 3SFVA 4LFBJ 2CQ3A 4Q7QA 1XF9A 2VJNA 2CYCA 4OYXA 4RMNA 3GUVA 3HSSA 1MLAA 4B3FX 3HO8A 2H48A 4DEZA 1Y9AA 1I2CA 4IEEA 2GUGA 4Y3CA 1PS0A 5IRCD 3H17A 3O8OB 3OEEA 4OQPA 5TB5A 2DPJA 2JZNA 2AQ4A 1XRJA 3MUTP 2GZDA 4KP7A 3L06A 4PYAA 3K35A 5HSGA 5AUNB 3DLCA 1ZD5A 1X3SA 1E9BA 5K6TA 1S96A 4ED7A 4H15A 3RU9A 4KQKA 2PZFA 4BS2A 1VYUA 4G07A 2P9ZA 2IBKA 4FW8A 3BGSA 1S2OA 2K1RA 5K3OA 4CLTA 1NKBA 4KE5A 5I4IA 2HUPA 5KYVA 4C14A 5F41A 3RAQA 1UT8A 4GKJJ 1YDMA 3G9CA 4P9NA 4B46A 4OMCA 2ENWA 3T12A 1IQPA 4FBGA 4KR2A 4DSIA 1LTHR 5KJCA 3K7EA 2DEIA 1C7FA 2HFNA 1UOOA 1QDUA 3ELBA 4YASA 4FLFA 4P0TA 5LXYA 3H5UA 1T9TA 2I80A 2Q2OA 2JFPA 2XYHA 3OECA 4B3BA 4O0NA 2DHQA 4OJ1A 2A5DA 2X1AA 2WFMA 1I6WA 4WDRA 3VAKA 1MO2A 4PINA 4GPAA 1QG4A 2H4WA 3EIWA 4GXRA 3FHOA 4K4VA 2NUTA 2GZ1A 1JE1A 2F17A 2OD4A 3KDAA 3SY8A 3TIFA 1B0VA 4GMGA 4LG1A 3UGTA 1QDUB 2GZSA 2W0MA 3W8FA 5K0FA 3OLYA 1J5EF 3O9VA 4J03A 2NUUG 1CJUB 1AXGA 1I2ZA 1QX4A 2X23A 4UW9A 2LPMA 2YHUA 3GGPA 4X90A 1XZAA 3FW1A 4WXPA 1KRWA 1QP4A 2G09A 4URXR 3M4JA 3OCVA 1IBCA 4ZOEA 4YRTA 2OEJA 3EXFA 3M8ZA 4QOSA 4FMDB 3PCRB 1WTAA 3IBTA 3L7PA 1JYFA 1UPFA 4UZEA 5SY4A 4P4SB 3BQMB 3DE6X 4KREA 4TSKA 3WAJA 3L7KA 3ZZ0A 2Q3FA 4WZAE 2XZTB 1N9GB 1SUQA 4KAAA 1OSNA 1SI9A 1TPYA 1PFKA 2WI8A 3O8CA 1EFPA 3BXXA 5CITA 4JIMA 1YVUA 4RBNA 2IF0A 2ZYRA 2QU8A 3NWOA 1OQ6A 3WBKA 2IYXA 4F3CA 4FZJA 3QIVA 2F7SA 2QL5A 4MQFB 4EVRA 3P0JA 4N54A 2DIVA 1UZLA 3CR3C 2QFIA 4CFSA 2XE4A 4J0JA 3GLVA 3VMMA 1N5RA 4ZV4A 2ZWOA 2IT1A 4KSBA 2I4RA 4OBWA 4HTJA 1RYSA 4QARA 3D1LA 1K98A 3GMTA 4K6OA 1P0MA 2WWGA 3Q7SA 2ZRDA 4DV7B 4NHOA 2BGJA 2P9CA 3U4GA 5CFOA 4U2KA 2Y66A 1YE3A 1R3DA 2H4JA 4BCCA 3AAWB 2VWPA 3RASA 1VCTA 5EJ7A 5IXJA 1M6WA 4DR4B 1T4CB 2CVOA 5I42A 2UUTA 2VJDA 2XX3A 4EFDA 1WPXA 1NVGA 1A7GE 1O5TA 3L1UA 3Q9SA 4KG7A 1PZMA 4IQ0A 3BT7A 3OZGA 2VA8A 4UFNA 4DSJA 5BW8A 3LDAA 3GLIE 2YWRA 3LGAA 5A0TA 1YJBA 1CULB 5G1OA 4B7AA 1ZA2A 1OS5A 1Z8DA 3N79A 1C0EA 1ZHFA 4RWZA 1ZC4A 4FD2A 3LL7A 4KHPF 4TYAA 4MQEA 4F04B 1Y9EA 5JMWA 3CJTA 1X4CA 2J8AA 4NXNF 1NU4A 5FLXY 4E8UA 4MS3B 4C4AA 4TQUS 1B26A 5CB0A 3OQHA 3OIYA 2OYCA 2B69A 1SIBE 3VKFA 5A2GA 3CVWA 3UZUA 2ZTLA 2CLFB 5EPEA 3B78A 4YMVA 2BOPA 5KFJA 2EXUA 1GNRA 1EM8A 3E3MA 3ZCXA 4G1CA 1H2FA 1WEHA 2VN8A 4HTIA 3S01A 1U0FA 4WIQA 4J0EA 2ENUA 2NO9A 2XOXA 4OB8A 2ZS9A 5C52B 1F3LA 3DNPA 2IIBA 1JEQB 1XKXA 5E3IA 2LDYA 3V6KA 3MD1A 4NWIA 2IXEA 1X1EA 5D3QA 3ICOA 2MSLA 1D2GA 3OKCA 2VP5A 4JQZA 4AZ0A 3FHLA 1YR6A 1UVJA 2D3OR 4DJTA 4DR1B 1MIOB 2VYNA 3B3FA 3Q8VA 1B23P 1OX5A 4HDMB 3TGLA 2OK7A 5JD4A 3DMTC 3PKIA 3B1ZA 4DIUA 2OQVA 3OLBA 1CS0B 1YB5A 3OFSA 1CDZA 2KU7A 2JFVA 5CIYA 2ZDHA 3K9WA 3NCHA 3T9AA 1YJNS 2TSYB 4U8VA 3K8WA 2V4ZA 3RB4A 3VDQA 3WLJA 4IHJB 4BPRA 3NBPA 2C9DA 4ZDNA 3TVKA 2J3LA 1SOWA 1O95C 3PY8A 2X7JA 3TW8A 5JE8A 3RVMA 3G71S 3QVGA 4L8VA 5BYQA 1TF5A 1BROA 1DLOA 3W6NA 4TTSA 4B4KA 2E9ZA 2X15A 1KNXA 2V8PA 5AJ3F 1MENA 4R5MA 1P9OA 2PKRA 2GERA 1ZR4A 1I14A 5T6MA 4Q7LA 3IKMB 5TPWA 3ZE0B 2FWRA 5SYAA 1JHPA 3GFZA 1PJTA 5C8YB 3GP3A 5D0EA 4R1MA 5JDIC 4IDKA 1KSPA 5LQRA 4C4OA 3JU3A 2W48A 4WOCA 3KKZA 3EA5A 2ISCA 2BRLA 2VA9A 4EMDA 3FI0A 2Z6AA 3H5VA 5TXGA 1PJLA 3NVAA 4P0QB 1AB5A 1H0RA 3RJ9A 1L4LA 1OWMA 5IXSA 5K8MA 4O4LB 4TVAB 1JRLA 4MV1A 1TK0A 2F4VF 1AQLA 5HQ8A 3IO3A 1NBEA 3IQZA 3R3YA 4UMFA 3R8XA 1C30A 2QN1A 3FOZA 3PITA 5AE3A 5FWXA 3MUFA 4MWGA 1ZUWA 4X3OA 3ZWVA 1RP7A 4ZLNA 5CYMA 1F0YA 4PX9A 1WZNA 4CYUA 3H5WA 2RSLA 5JY1A 3DXFA 5B7QA 3IS3A 5C51B 2CLCX 5CAEA 1N0WA 4EBFA 4MLCA 1DUVG 3UJ3X 3E58A 4ND1A 1V39A 3O4RA 1KYYA 4DCTA 4LE2A 5KFGA 5HBGA 1I2BA 2G9RA 5GGYA 1MN6A 1GPYA 2FXVA 8GPBA 5EXEA 1H9AA 4PS1A 3EWGA 1HBJA 3OIVA 1QG0A 2GFQA 4ZLLA 5DN6D 1UFVA 1JIJA 1CDOA 1J2VA 3MZ0A 2R8HA 2XOKA 5CW1A 2AT1A 4F36A 2UZ4A 4O4LA 2HRQA 2KT2A 3ZDXB 4JKIA 5JNTA 5JNLA 3ISTA 4Y67A 5EEHA 3JPWA 2Q21A 2Y8WA 4RTSA 1Q95G 1NNI1 1RI7A 5D00A 1ONSA 2WFLA 1VLQA 1VPEA 3BSYA 3QUCA 2HGNA 2FRXA 3DR5A 5EX0A 2BFEB 1DCFA 3KG1A 5DK6A 1E2IA 2J0VA 2AW3A 3Q9LA 2H4XA 4MYCA 1K27A 4GR5A 3FZNA 1WC1A 1RTHA 2FPMA 4KLCA 5ALOA 4Z4QA 1QYDA 4CTKA 3DBHA 3NGKA 1U0HA 4JJAA 4RVCA 2WFAA 4EPWA 1GNVA 3C5HA 2DCUB 2DY1A 5AXDA 3K2IA 5BT8A 1ODKA 1E3EA 1MWZA 3U81A 3EYWA 2MU1A 3HYRA 1OXXK 1K8YB 4YR7A 2W2OP 1IWPB 4GL2A 3UWSA 4AJ1A 1OGJA 1AX9A 1XHEA 4P7GA 5KG2A 3E18A 5ALXA 1W96A 1WRBA 3VPAA 3CLHA 3VX3A 3KPYA 4KXLA 3VZDA 1MG7A 5BN5A 1H4SA 3FPCA 2YZMA 1VMEA 1R0KA 1FRIA 4B3SF 2AEFA 1NJXA 5HJ7A 2MZRA 1U9IC 1G7RA 2YY3A 5JVGQ 1VRQC 3BE5A 1VBKA 2PU7A 1Z13A 4RKQA 1U2CA 3EXG1 8OHMA 1IK6A 1ZAWA 3PKYA 4C05A 4KZPA 5BN1A 3JWEA 2G36A 3DT6A 5GADI 3BBPA 4MYRA 3HX9A 3FXAA 1YBFA 5FBKA 3V4RA 3H99A 2WV7A 1X8DA 5BYRA 2W00A 3Q83A 3I31A 2OVBA 1G21E 2FHMA 3UUGA 4KE7A 1T26A 3GNTA 4MIAA 5DYWA 4I68A 1F8YA 1FNNA 2M2BA 3BULA 1UKYA 1UKVY 4G2TA 2WHRA 2VI5A 2IH2A 3UYKA 3GLIB 4OX9J 5SICE 5AJWA 4F6RA 3RE1A 1KQOA 1O54A 4B08A 3HXPA 4QHYA 2H51A 5IM4A 2D3TA 2DNLA 1CVIA 3DZBA 3F6EX 3KVNA 2VHYA 4DG5A 2DT5A 4RU2A 2PMCA 1SQFA 1EWTA 2BGWA 2ZVDA 4KQEA 2WA2A 4TYPA 3G88A 5ICEA 4YR3A 3TCXB 1XQ1A 1I6KA 1MB4A 1IN7A 1SK9A 2X8WA 3OIUA 2QR2A 2F59A 2OR3A 4EGAA 1G4CA 1JHMA 4D81A 1PFVA 2M1ZA 4WZBE 3WGLA 4MIEA 3VAGA 4QGBA 2C1ZA 4HWTA 1GPMA 4UJ5A 1VL6A 5KTMA 4YP6A 3HVUA 2OYRA 2ECOA 1V25A 3NG1A 4WY5A 2V1XA 3OQVA 4N3BA 4A47A 2AGQA 5DH9A 5A9SA 3C45A 4QM7A 3SR0A 1E8NA 1XTBA 3LK7A 1ORRA 1O0SA 5AVWA 2N9UA 5BN4B 1SXJD 4L4XA 1YV9A 2NTJA 4DSLA 3IEVA 5DXAA 4AJEA 1Q91A 4Z4HA 2XE7A 2ZUCA 1ZH5A 4OQEA 1NVDA 2VASA 2OC4A 4F06A 3L2OB 2D4AA 5D77A 5C7LO 1W34A 5HP1A 1KQFB 1MJGA 2QVYX 5LMNB 1PT5A 1GGJA 1W5FA 1N3LA 3OFVA 1OH8A 2ZAYA 4DPTA 5E4YA 2QLFB 3NIWA 3DWIA 2QTFA 2R6R1 1F12A 2PT5A 2I5JB 5A4IS 4JZKA 1ZSVA 2MSEB 2XVAA 3AC0A 1NHVA 3B7GA 4LQ4A 4CG2A 1C7EA 2O3TA 2CXTA 1EGHA 1ZISA 1JXVA 3W2FA 3LUCA 2EKQA 3NAZA 5J2TB 2ASJA 2JLSA 3DAYA 2BRKA 2F1HA 3W5VA 3D0HE 3DE3X 3OLAA 1PKXA 3OTBA 5EGNA 4D0SA 3S28A 2KN4A 4LNHA 4DT1B 4EKYA 4XWKA 2F7VA 3DHVA 3BXOA 4U7UK 2YTCA 1DADA 5L51A 1V3VA 3C6QA 1VB5A 4TWIA 1URRA 3FPJA 1DCMA 4LKOA 4BNYA 4P10A 2NYUA 1DQPA 3DPSA 4LJLA 2NUBA 1X7YA 3G3EA 5D3GB 2CJ9A 3M0EA 3PGLA 1FF2A 3BDVA 1NJGA 3C14C 1VG1A 5JCOA 1LOUA 1U4OA 1DZIA 2HIHA 2G40A 3OOSA 1UC9A 1FQWA 3I92A 2Q3HA 1E79D 2CCKA 1ODIA 2YY5A 4UQLA 3VR6H 3FKSA 4TSFD 2F8TA 3OTOF 3VDRA 3LW8A 4K0RA 5DPMA 2LQ8A 1VECA 3T1VA 4OB7A 4NJMB 3RS5A 3GYXB 2ZIVB 5EE3A 3THXA 4NBRA 4HHJA 1PYSB 1P6XA 1VZ3A 4NKRA 3A1VA 4XJXA 3ZU6A 1XDZA 2DU8A 3I8OA 4ND8A 1ZW6A 3TRIA 3E9ZA 1JEYB 1N5JA 3L79A 4LRSB 2JJ4D 4M22A 3KQUA 1VG9B 2LKZA 3HDHA 3IDQA 1KR2A 3S1AA 3WL7A 3UCGA 2IRYA 4QL3A 2F3PA 3BMXA 5AKHA 4DIOA 3E3OA 1BE6A 3D7SB 1MU2A 5FAKA 1FD2A 1L8LA 3JQPA 4ZYTA 2AFVA 3BF4A 4BQFA 4KGDA 2XD9A 1H69A 2I8LA 4RANA 4L3NA 3U16A 2FZWA 1U45A 2A58A 2YJNA 2DBQA 3MFYA 1NX6A 3HZEA 1NULA 4N6OA 1Y9DA 1POWA 2ZIXB 4K6HA 2XUHA 4LZJA 3I4LA 5FBWB 2OTJS 4FFVA 2V7UA 1NVAA 3V2UC 1I6JA 1WL8A 1CJVC 4K8RA 4N5SA 4M0KA 3M5PA 3MN1A 5AHRA 3GJTB 5CVCA 5C3MA 1KYQA 3N6XA 2QMOA 3UT6A 4RZUA 2DHHA 1YTLA 3HVKA 3LHFA 2G25A 2VODA 2PO4A 3MVEA 2QW0X 5JC8A 1FDAA 3FC9A 1NXPA 3N2GA 4HNVA 1IG0A 4ZVSB 3VSCA 5JZBA 1MAUA 4AS1A 3G2MA 4O2BF 4RMGA 4PGMA 5ES4B 3R24A 3WOHA 1Q0PA 3IAAA 3IT2A 3QX3A 1R27A 4BMXA 5IM0A 4ZHQF 4NARA 3QO9A 2G04A 4IVNA 1Q7GA 4BAUA 3HBNA 3MOGA 2FPKA 2RHDA 1W581 1WXXA 2B2NA 4B2LA 5LKAA 1G17A 1S8NA 5ETRA 3ABIA 4UPEA 4EKEA 5F9LA 4JYAF 4EUKA 2R6CA 2JLXA 4OYIA 4RW6A 3DR3A 2KHCA 3O26A 4HDCA 2X0FA 2FB9A 3K9FC 5GZ3A 1I1NA 1KJ8A 1Q12A 5HGJA 2BJ3A 4HADA 4YRGA 5JJKA 3WKBA 1VQMS 3BGDA 3TAHA 1M7BA 2BE7A 1FY2A 3DAPA 4CIBA 4KQIA 5E1MA 3U19A 5I8PA 4LHSA 2B43A 3B9QA 4TS3A 2HRBA 2HK6A 1PHPA 1JU4A 3PV0A 4KR0B 1N2ZA 3KMSA 2FW8A 5K3AA 4GRSA 4DIMA 4ED4A 3E9DA 1EX7A 1EGMB 3W8DA 2IEYA 4CU2A 2UUCJ 5EQJB 2B82A 4OZ3A 4GE3A 1U2GA 2J0SD 2HBRB 3LKBA 1HQYE 4B02A 1NK7A 2QA1A 1DX4A 2FJVA 4M0FA 1T8UA 3T06B 3QEMA 5L1KA 5KVCA 2ZH5A 2QY6A 3QBDA 3SM9A 3L8HA 4JC0A 3HR8A 3NLLA 2HQSA 4EEXA 2BEFA 2WPDD 3WO1A 2GM5A 2B1QA 1CEEA 5EHQA 2YH1A 1P2UA 1RT4A 4TKUB 1R8QA 5CT9A 3KKMA 5M5BA 4N41A 2MZQA 3RYCB 3I0NA 4NCKA 2FZEA 1TV6B 2KLBA 3TN7A 5TC4A 5KWVA 4DMHA 2E6KA 2PO7A 1RT4B 4TKUA 4M54A 5DBEX 3UAWA 3GUHA 4GE0A 4S0ZA 3GA5A 4Z8XA 4YPFA 1LZKA 3S1LA 2UUBJ 1PL8A 1F0NA 3NBAA 3AEZA 3UC9A 3MUNA 1II0A 2WBLC 4MRPA 2O3QA 5IJ9A 2A84A 2OEKA 3N7AA 3K9NA 4QWCA 1SKSA 1HMYA 1CLEA 2VRBA 1E6UA 4BLQA 3STVA 5BUQA 4TRMA 3AIKA 4TMKA 2G7ZA 4E14A 3ZEAA 4JJ8A 2ILTA 2KW5A 3GIRA 5G41A 1ETUA 2ET6A 2MPUA 5I5EA 2GK3A 4M8SA 1KK2A 4LF7J 2IEBA 1HC7A 3TRFA 3HHPA 1EJBA 5KO2A 1MRZA 2CQ4A 3AFOA 4OHMA 3DTNA 1QFSA 3RC2A 5G4LA 4H7PA 2CY0A 2WWTA 4NZ9A 4EY3A 5TT0A 4XIJA 3SN6A 5IANA 2HO4A 2WG1A 2PT9A 5CXXA 1MZVA 4AULA 5U4XA 4UD6A 3KLGB 2ZT8A 4D25A 3CA8A 4B9EA 3EVAA 5GJBA 2HFUA 5DV9A 1KJNA 4KI7A 1RQPA 3ISZA 2O14A 3DMYA 2XMZA 3U3JA 2DPYA 3R5SA 3OKFA 3PQDA 4BIMA 1Q74A 1UPAA 3ZZPA 4C22A 4ED2A 1QH1B 1JJIA 1UP6A 3ICLA 1U80A 1LXNA 1F4LA 5LXTA 4LDQA 3DRPB 4WJBA 4N56A 1Y8QA 2RT3A 1P6UA 1ZVQA 2JKYA 1L5ZA 3GJTA 2XSJA 1SIWB 4HI2A 1EAYA 1FNCA 1GT91 3A1UA 1H8ED 1JEQA 2IYYA 2YXEA 3CWCA 4IQ8A 2MINB 3HKZD 1EWKA 3HUDA 4EWTA 4JI3J 1FA0A 2I7DA 3LXMA 1KOGA 4TWAA 1CUBA 3UMYA 3MGJA 1H4QA 3Q8WA 4NYMR 4V0OA 4ZPXA 4B84A 3FOFC 3M2RB 2HIAA 2C0QA 2J9CA 2ZH4A 2DAPA 3RQIA 2PA8D 1H7WA 3CLKA 5FPQA 3K0CA 1U0TA 2RGAA 4WASA 1SVIA 3V9PA 2IZOA 2YVQA 5ETKA 1GPLA 1GCIA 4R0JA 1N6KA 5J2PA 2DR3A 2OO5A 5FTKA 4XJSA 5FA5A 5K8LA 1KPIA 5IMBA 2OE2A 1DBWA 1Y7IA 5DXFA 2JGIA 1GM5A 3LYUA 5C1BA 3HO1A 3ZH9B 4HWSA 2DWUA 2LXNA 4YWJA 4KN5A 2KBEA 5FNVA 1DWPA 4PIVA 2QJRA 3MT8A 2CYAA 3USCS 1N33J 4IFVB 3FCXA 1QPBA 1X42A 1U1PA 1HQEA 4PNEA 2HRUA 2I6QA 4YAFA 1ELOA 1QB7A 5GONA 3GLJA 2IXAA 3ZCVA 1UEKA 1RT3A 2AFIE 3H0CA 2ZTHA 2YJ6A 4DUYJ 2D7DA 1IUNA 3GV8B 4GVBB 3EICA 1Z0KA 4TMFA 4DFPA 4Y28C 3QQ5A 1X39A 3ZGOA 2C58A 2YMLA 1UDBA 2AHRA 4JYPA 1CUYA 2HA4A 3DTVB 4BMVA 3ESDA 3KFXA 3R77A 1OPZA 3LGMA 3H1GA 1SJRA 1XD2B 1L0BA 4IZ6A 1XI2A 4LFAF 1RZMA 1TTHB 1YRQA 1M1UA 2H59A 1X80A 2UVPA 1ORTA 4LX0A 1NEEA 3HFGA 3Q2IA 5AW5A 2EFDB 4B6SA 3B3JA 1LTKA 4HNUA 4ZO6A 4YV0A 4RHEA 2OCKA 1ISRA 3N7UA 4AK9A 2Z5LA 2TMYA 2E5LB 4ILLA 3AJ2A 3KQVA 4KIJA 5IZCC 2IZ1A 5IJWA 4KQMA 4KUGA 4B6QA 3WLAA 1ZHHA 3RF6A 4I81A 4CRWB 2O52A 5LQKA 4K4WA 2C07A 4LWOA 5KJ6A 4LW8A 3KWLA 1MNQA 1CQIA 3FF4A 4YXFA 2LIVA 3H4VA 2WD7B 2ZYAA 3FNHA 3K2BA 4QUAA 1H7XA 4OZ2A 4BLGA 4LSZB 1V48A 2C04A 2CJQA 2ZUSA 3PEHA 2GFFA 4PCAA 5DW0A 1KQKA 1RKQA 16PKA 3GFGA 1HKHA 1NJIT 4AN1A 3QOXA 5JD5A 3FLMA 3OCCA 1WMEA 4ZMSA 1VMKA 1TYDE 5HEKA 5ITZA 4H31A 5AXMA 4DY4A 3OLXA 5CLHA 2XZWA 2A88A 1DIOB 4IJKA 5LSAA 3CX6A 3G0IA 2G1HA 3HEAA 1LWCB 1EDEA 1ZTTA 3MCMA 3PGA1 4BZPA 3NHFA 1B8NA 4PWDA 4M1YA 1M6HA 2HNAA 5KDDA 4C2AA 3C19A 3WQHA 1G3MA 3PNOA 3R9LA 5C1PA 5P21A 3UE2A 4YO7A 1SJFA 2GJAA 4JBLA 3SXUA 1VHLA 2IK8A 5C1DA 1TUGB 3G6YA 2DB1A 1Z45A 3NFYA 2J09A 2MGZA 2ONZA 1GOTA 2QRKA 1K8QA 4BNKA 1RHJA 4L4YA 5I47A 4D74A 1G0NA 3QKSB 4JI8B 4KTTE 5EWFA 3X1MA 2NUPA 3RBDA 1AV6A 1WDKA 1GGVA 3N59A 3PZRA 4TMVA 1BD4A 5FIIA 1BVYF 2DUJA 2VPXA 5HK9A 3DDHA 2V7EA 4PAQA 3P94A 4I9GA 1PJSA 4QODA 3HS3A 4ENRA 3TDKA 1N2CE 3IILA 3RYLA 2Q0XA 4AY4A 3OJSA 5IMSA 5HI7A 5CEJA 2Y1CA 1AKUA 1NBIA 1CC1S 3P2MA 3V4PB 1OZAA 4CLHA 1GITA 4XWTA 2WAAA 4RXTA 1IOZA 2MINA 2GVDB 4GUAA 1QYWA 2ZKLA 4X20B 1VMAA 5TVKA 4I50B 1L1EA 2QM7A 5JANA 4RMJA 1LLQA 2VCEA 5REQB 4YAWA 3GUCA 1ZM3A 1N2GA 3J7AC 2X8BA 2FZGB 4ED0A 2RVJA 2PQ0A 1H2UX 4YP3A 2P4HX 1NVVQ 4LTNA 1YO6A 5A9TA 4CP5A 1XTQA 2F1RA 1YTUA 3MJEA 2HPHA 1YQUA 4KGXA 3T5BA 5F7JA 4IL5A 2JFHA 3NKYA 5HANA 2QRVB 4W98A 3AZOA 4YIKA 1TPZA 1M3SA 4IYJA 2WUWE 1Q1NA 3NM6B 4KYUA 4FFDA 3NNAA 3DYAA 1OUMA 2SKEA 1QU2A 1BKDR 1JU9A 2PV7A 5IP5A 1X7WB 4H7IA 3ZNNA 1T6XA 3FZGA 3MCAA 3ADKA 1PW5A 4ZU6X 3W3AD 1L4HA 2PBRA 3AILA 4O0IA 1TZ2A 1SR8A 4PGHA 3OAAD 1B0TA 2QN6B 3JQGA 2PNFA 5EIBC 4RNOA 1GZ7A 4FR0A 5K5MA 4UD2A 1TCUA 4X92A 3FSIA 3NH6A 5AT1A 4M9RA 3MCOA 3ZGNA 2FX3A 1PV1A 2FUKA 3L6DA 4Y18A 5K7SA 1I94B 3CD0A 2A5FA 3E8SA 1WMBA 1QP0A 1JBKA 3LX8A 4FPXA 2WM8A 3O1IC 3ZLVA 1AYEA 2IVFA 3O8BA 2F3JA 4MB2A 3A37A 4MLDA 1G21B 4TYNA 1J00A 4EBDA 3P20A 2HJ9A 4WU3A 4BO0A 5C7OO 4M7PA 3KHLA 4ZU1X 3AD9C 5ALTA 2W11A 2I8EA 3KEOA 2X8AA 3NCRA 4Z3DA 4FDFA 3KDSE 1RLUA 2PZKA 2R87A 2YRFA 3NIGB 4GEGA 1WKKA 3MLAA 5DDPC 2DLNA 3LRXA 4HWKA 3EA4A 5F78A 4DCNA 3T54A 4UFPA 4TTPA 4UVEA 2N1MA 1C3EA 4D9HA 3BGOS 5EY5B 3OZUA 4PANA 4DR7J 3GJ0A 4ZK7M 4W9NA 5B36A 5HK4A 4E6PA 4FYYA 1C1HA 3QVJA 1GXSA 2D00A 3RJTA 1JJ7A 3UC5A 3H2JA 1QHHB 2ZSHA 2O3RA 5KU1A 3WNVA 3CSSA 4NPCA 2BEWB 1UZNA 2KJWA 4QGSA 5JECA 1W8DA 3WNZA 2AW5A 1P45A 3FEYB 2V34A 1DAMA 4MPDA 2B4YA 1U2ZA 5BMVF 1Y3AA 1DRKA 4AYXA 3OIGA 3I96A 4R9RA 1AV7A 1RT5B 4YYEA 4CUZA 4MUKA 1FQOA 2P8JA 4UDYX 3DLEB 1ESCA 2XDYA 4UCQA 2QNRA 5CMLA 5LDGA 2HBRA 1S97A 1HMPA 3WSWA 1GA1A 3FPSA 2B3TA 4KFUA 821PA 3IR6B 4FIZA 4HR7A 1W4ZA 5AQ1A 3QJLA 3SIPA 4IG3A 3EXAA 3Q7QA 1BA3A 1DDGA 4RULA 4P98A 1YVFA 2CSXA 3NAQA 2ATCA 1FEHA 5EAIA 3CNQP 1P9LA 3AVOA 1P18A 2HLDA 2JGJA 1IAQA 4IHJF 1WSDA 2MZ1A 3WIBA 4ELUA 5P8WA 3HH8A 4KRXA 3P6YC 4U02A 2IDMA 1LWEA 5BPHA 3I52A 3ICCA 4X66F 2Y0CA 3FMIA 1PBUA 1BUXA 4BGUA 1E9VA 3RYFB 4UTGA 3AP1A 1JDTA 1Y4SA 1FP7A 2GW8A 1KWGA 2ZOSA 1E2HA 4I5EA 4MV9A 4IMPA 2P6UA 4U7FA 1QFJA 1SJ1A 1IY0A 4B2PA 2GBGA 3QVGB 1SKMA 4CR7A 5ILGA 2CUYA 4ES2A 1WC0A 5JALA 1W93A 2BJHA 1IEVA 2B8WA 3EXHA 2QG9B 2E7ZA 1VJ0A 3ISJA 4DXAA 5T41A 1VLHA 2Y93A 4ZN6A 2KG0A 3OLVA 4AVYA 2O2HA 4UQTA 4XPZA 3PSHA 1RWPA 2BZ1A 3RNOA 4RTPA 4FTWA 5DYTA 1F8UA 3MB5A 2DBZA 4NBUA 4KE6A 2ETXA 3P26A 4F4JA 1KKLA 3A1CA 2FPIA 2OHVA 3U13A 4O8ZA 2HTFA 2OUGA 1KYIA 3QOFA 2IVMA 4O1HA 4DR2J 2NT4A 1K9SA 2R44A 1RWMA 2ZCJA 1ZOPA 1UK6A 3LH5A 5EJMA 3WB1A 4A0GA 5T7LB 1QK3A 2WP8J 4OYZA 1QIJA 3CRNA 4KEAA 2A2CA 3PK0A 1CJMA 4J7CA 3QT5A 3L9WA 1NSAA 4NCIA 1FFYA 2F3UA 5KTNA 1ZM2A 521PA 5E1OA 1V3SA 4FVCA 5K8PA 2VDHA 8ABPA 1RTJA 3JSXA 4QR0A 3RK1A 4N40A 3SQDA 4AIRA 4DMFA 3T5PA 1R6XA 4TQRA 4PR3A 5K14A 2PWPA 2WQ6A 1Y6RA 1VR6A 1F38A 4PRZA 2D2FA 2JGNA 4FBUA 5EKUA 3OETA 1ETHA 1K4KA 1UL3A 2A67A 3CN7A 1Q77A 5CCBA 4U9UA 3V8MA 5FFMA 4MS4A 4JP5A 3H5IA 3II6X 5TJ9A 2EQBA 2XYRA 4KSCA 3D8BA 4TM8A 5DCUA 1M34B 3N1UA 4ZICA 4BP3A 2R7TA 1NP7A 2YWFA 1TLLA 2PQ2A 3JAWA 4JSTA 3EGOA 2XMTA 3C24A 1E20A 1SKUB 5ALIA 3X1KA 3AJ1A 1GA4A 4PBTA 2FZKB 3O4GA 1SIUA 2L82A 1M66A 4TXNA 4Z3KA 5JMNA 1HWLA 1I80A 1XDUA 2Y1KA 4BBAA 1QOPB 1ISGA 1P3Y1 4Y9RA 2GGPB 4FD3A 3L7AA 1KHVA 1OFHA 3GLGE 4JEIA 1GLGA 3ZCTA 3VNVA 2C3OA 1ZNXA 3F0TA 2PGNA 3NBKA 1OMSA 5IVIA 3M4XA 3JATA 3WV4A 4M5IA 4UUBA 4NZNA 3HP1A 3BH6B 4LV5B 2H4ZA 4A5SA 1NXSA 2HPUA 3HY4A 4LSZA 4MUMA 5TRTA 3MOZA 4Q2LA 3PNBA 4ZK6A 4EJ0A 3WHKA 1R8PA 2J3KA 4GEKA 1S1WA 2GD6A 3HJAA 2FEKA 1JFTA 5E7IA 4OXYA 1NQOA 3AOBA 2ZT5A 5HMWA 1QAIA 1EFPB 5JJLA 3MJ4A 3RJMA 3MG9A 4A9AA 4LDRA 5H16A 1HI0P 3BMNA 2J3HA 4WYLA 1F0XA 1WI6A 4JXZA 2JFQA 2QGFA 4Z7YA 2GEFA 4H35A 2EATA 1FVSA 3UGQA 4I7FB 4YYZA 2JBAA 1EM8B 1XYVA 2VF8A 1BY9A 3NWPA 5JVDF 4FHGA 3IMKA 4KR6A 2YNIA 2ZB3A 5COQA 4URYR 5ITVA 4QPJC 4AMUA 5IFMA 4J3NA 1E5QA 2K7ZA 2PL3A 4HLUA 3QP9A 4RCVA 2PDAA 3DMGA 4MK9A 2GYUA 1IKVA 3W65A 2H2IA 2P2CB 2CQ1A 3ZZZA 1A76A 2WF6A 3R1HA 3SOZA 3QVOA 2BFFA 4AO7A 4CIAA 1D7AA 1W2HA 1T9GS 3T3IA 2FHSA 4AQ7A 2WUDA 3FJ1A 1RC0A 4TVBA 1NRWA 1RCXB 1BGXT 2WJ4A 3R3HA 3ZV7A 1COZA 4G36A 4NZ6A 3DHWC 5HBMB 1D2HA 2I3AA 3I62A 1Z6YA 4LV6A 3OD5A 5ER6A 2OAQ1 3T19A 1IJFB 4CIXA 1JAZA 5CM8B 3PFWO 1WPGA 2Z8XA 1E9DA 5IJAA 5CFLA 4X84A 2A4KA 4IFVA 5DO2A 1DBIA 5G3YA 3D2AA 3IA7A 1WABA 4IIFA 1FB5A 4QYXA 4CT0A 4OJHA 4Y6LA 4UUOA 1WOMA 1NE7A 1LQ2A 2BE2A 4EX6A 3KKQA 4OHYA 4IG0A 2I03A 1F6TA 1FFXA 2QPTA 2R68A 3AYZB 4EZIA 1BCRA 3ZV5A 1S9HA 3N2KB 3LPYA 3IRXB 4QOGA 1UJ4A 2P90A 3OJWA 4BQQA 4U9RA 1SEPA 4RK0A 1K9MT 2PMDA 4KVGA 4KYIB 3C3XA 3KLEA 3SBOA 1QV6A 2GBIA 1NSKL 1WBDA 4O63O 1ORWA 1ZJ6A 4EG1A 1L5RA 3ZLTA 2DNYA 2J9FA 1KMHA 3FB1A 4IDNA 2GPYA 4N03A 5BVGA 1XZGA 3H05A 1RM0A 4EY5A 4LGYA 4HDNB 1IBCB 1B3RA 4PS0A 1G7CA 4DV1J 1PFGA 1VC2A 3AOGA 4ED3A 3B89A 4GU5A 4DV0B 2ZUVA 5KTQA 3K5OA 3HLTA 4XLZA 3A2KA 3R5TA 5A2QY 5F7XA 1RP1A 3Q3GE 4XM0A 1PYDA 5ED4A 4JYAJ 3C4VA 3TB4A 2HWYA 2WUVA 4G6VB 2IPXA 4W63A 1BX0A 1C3OA 5DHSA 3HYTA 4MKFA 4BC1A 4WBFA 2XTJA 3PFEA 4A6DA 1L4BA 3GDOA 5CNKA 3COJA 1TC2A 3SEQA 3IOMA 1KD1T 1MZPA 1FDDA 3P9SA 2OHIA 4F45A 1HEUA 4MX8A 4BFVA 4GP6A 1J5OA 1MU0A 1Q82T 1LU9A 2HVHA 4ZAYA 1RAIB 2J0UB 5FJJA 2DTXA 4BO2A 1SD1A 4K50A 1T9KA 5E9QA 3HY6A 3K5LA 3K71B 4CMAA 1YKGA 4R6WA 3BKXA 1OU0A 1UJBA 4QECA 4HQOA 2GHQA 4FEGA 1M2NA 4GP9A 4WKGA 2IC3B 4MZXA 2CW5A 3OVAA 3GP8A 4NV0A 4ZAGA 4A6XA 2I4NA 1E8DA 2BACA 4GKKF 4C3UA 1TQ6A 4WY2A 4J1TA 4HDGA 3T95A 1NG9A 3EVTA 2FKAA 4RD2A 4WOJA 1OBCA 4E2YA 2P78A 1RI4A 1HDXA 1NUUA 2PRKA 3KE8A 2YDYA 1YVPA 4CN8A 2YNMD 3PHEA 3O1LA 2MYNA 4X1YB 5KAMA 2J8ZA 4OJ3A 4D92A 3E53A 1VLOA 3NEKA 4D8UA 1C8BA 1QAXA 3N6MA 4CT5A 3P5SA 3HRIA 4NZYA 1IBMF 2I38A 5E4JA 6REQB 2VUSA 2MZTA 5B08A 4HXFB 3KB2A 3TRHA 3LY5A 1DARA 3D6UA 3FFBA 3I4CA 4YDSA 2AJ1A 4EGJA 3TB6A 4HUQB 3EA0A 4TL9A 1DMSA 1TMYA 1DQ9A 3LT1A 1Z2ZA 1JSRA 4DF8A 4MGIR 2WUFA 2W70A 4RAOA 3OJEA 1LW0B 4AJKA 2EEZA 3M6WA 5HMMA 2C7OA 1GT8A 5ALUA 3PRVA 5JRDS 2XRZA 3ES9A 5H9EJ 3JVIA 3B2NA 1E6VB 3D1HA 1CEXA 4O4IA 1L1RA 3LIPA 5A1JA 1O2DA 2VPZA 2J0WA 1PS9A 3CPJB 5HROB 3GVHA 2W6JD 4X6LA 1WHSB 3QPDA 5FUYA 1LW2A 3ANNA 1PAEX 4DTCA 3GT4A 4CG0A 3UCZP 5DEIA 5DCLA 1XWIA 3E5MA 4QLBA 3LWDA 1OTHA 3FYTA 4MWSA 1XOIA 2L18A 4ND2A 4LRTB 1F06A 4J90A 3ZXYA 4D9GA 3FOEC 4E2XA 5IEJA 5BV0A 4DR7F 1L7DA 4UOCA 2O48X 4LUCA 5KFBA 2RRBA 5F8IA 1GPJA 5FFFA 4YUWA 1GGFA 1VKRA 5EYPB 3RU7A 3VALA 3SS8A 5KINB 4P92A 2VPYB 2KSQA 1R8BA 1PTKA 4RH0A 1V11A 5FPSA 2I29A 4CL2A 4ARBA 4N8EA 4R98A 4ZHRB 5DRKA 3NXZA 2VOEA 2J0QD 5EINA 3CRMA 1HMVA 3R8CA 5B09A 4OATA 1OZHA 4RPJA 4IO0A 5F8NA 4U7JA 1T2VA 4MUFA 1BO6A 2EAUA 1N2EA 4Y1FA 2SECE 3MGCA 2W2KB 1UBNA 4LJSA 2ZBIA 2Z5VA 2VDWB 3RRNA 2ZFUA 1PX0A 2YIMA 3VVUA 2YPYA 1P7VA 2X9LA 1HDZA 3TIGA 3AXKA 4Z9YA 1L7VC 2ORED 2OSQA 1ECFA 1WJGA 5JS2A 2NO6A 4H1HA 3MEDB 2AU0A 4B3IA 2GEDA 2R7RA 3OPXA 3R0QA 1ZICA 1V1JA 4D9EA 4GDFA 2V7QA 4US1R 4EH1A 3B8HA 4F2GA 1Z7YA 3EUAA 3D2WA 4QOTA 3O6VA 5D5QA 2C3MA 4QXRA 1T9ZA 3FUXA 2Z2YA 3IUMA 3PTLA 4G6ZA 2G80A 1MABA 1DPGA 4N5MA 4K88A 1LK7A 3KT3A 3WHLA 4ZO9A 3DLKB 3HN2A 4A8KA 4DWWA 5EPOA 2OV6A 3PKZA 3W5YA 4FWBA 3RV4A 3IJ5A 4IG9A 1V4VA 1XKQA 3TI7A 4QOEA 1G7SA 1KEPA 4YMSA 3HL0A 4E5SA 3JQCA 4MS3A 1R7IA 2BQUA 3F2VA 3WWYA 1AH2A 1X5SA 5A3QA 2B7BA 4F04A 2HA2A 2HJHA 3ZWQA 3M32B 3D2BA 1L9XA 3KYCA 1UEXC 2RH4A 1O6CA 2L9DA 2IXGA 2RH5A 3AI7A 4UNSA 3VUEA 4BATA 2O67A 4KUHA 5KYXB 1NURA 4LRQA 4YBZA 3U6BA 2W8KA 3NB0A 3W4IA 2VPWB 4OLBA 1I2AA 5FWNA 4PO8A 2OBFA 2EI5A 3NGUA 4MK7A 2B4AA 4KWTA 2HI0A 3GGCA 4RVOA 4L5CA 4AUEA 1FERA 4HAUA 2F9DA 3W61A 4ECTA 4LRYA 3QQPA 4HQFA 3A4NA 1FFCA 4MGYR 2XCRB 4IS3A 1TK2A 4C11B 2XUIA 5HHTA 3HJBA 5D3GA 3R5XA 5LQDA 3RV3A 1SELA 2ZH1A 1W94A 4GSLA 1XMQF 4QYIA 2W37A 4G01B 3GIWA 1FRFS 3G17A 1GRRA 4LJKA 1UAWA 1JBQA 1WXWA 4JKYA 1N8RT 3QNWA 3B6BA 2HREA 2O2EA 4DT1A 5AI0A 3LYAA 3LVRE 2D2XA 5FJIA 3GRFA 2J9FB 4FFBA 2WPDA 1MP0A 3FWHA 4J6EA 1AUXA 1Y33E 2WVHA 1KJZA 1Z4JA 1CF2O 2Q99A 3BJIC 5ETLA 3ND9A 4H17A 5DETA 4CO4A 3I45A 2Z30A 8LDHA 3C8MA 3L4BC 1Q5PA 4E03A 1O6ZA 1F9EB 2WVAA 5JMPA 4JHXA 2LVWA 2BMBA 4NMWA 5BRJA 3KU1A 2QN9A 2F8LA 1SXPA 5KUTA 4E09A 4X4UA 2AJTA 3FFIB 2VXCA 1SN7A 1XCMA 1TMKA 3ZTTA 4DWJA 5HJXA 5L1JA 4HFJA 3IBSA 3SPXA 1HLDA 2RK3A 3DGPB 5IKMA 3P9PA 4RJLA 3SYKA 4Y0VA 3FBBA 2IYPA 2VDUE 4KDRA 1GGNA 3V4IA 3DOIA 3MBOA 1JFSA 4EJSA 2DXFA 1UAYA 2C2MA 4Y0FA 3F5MA 4PYJA 1CJUA 2NSYA 2FEOA 1XR5A 3HVWA 4P38A 4Z0PA 4WE3A 5CH7B 1UP1A 1UETA 2K5UA 2ZI5A 4LY9A 4LHEA 2EGHA 1BFUA 5GTDA 4Q82A 2OAGA 2VBZA 1HDOA 1HH4A 4R9UC 1NW9B 2JCYA 2HU5A 4YHHJ 4C4WA 3THTA 4FYVA 4BVHA 4CLSA 2X8JB 4QFBA 1GYQA 3A11A 3O93A 4O4RA 4R1TA 4KR3A 3JARB 4CF6A 1VGRA 4KDFA 1TKXA 1W4RA 3KQQA 1IHDA 3DEAA 3UXMA 3RS7A 5KNLA 4RSHA 2BEJA 4QSMA 3GQBB 3TYTA 5HM8A 3D31A 4C01A 2Q5IA 3I87A 3QVUA 1ZYUA 1X94A 1CS4B 1SRQA 3IBGA 2DKNA 1WBJB 721PA 1E4OA 1V6SA 3TX2A 1SM4A 3LQYA 2ZRBA 2GAFA 2PKYX 3EGCA 3H7HB 2BTOA 3HFRA 3ONNA 5EFOA 1WOYA 1OYEA 3MM6B 1C1BB 5TEWA 3VFDA 2HHUA 2QLNA 1Q21A 3RGGA 1N54B 4HEA6 3AD8C 3TNFA 5IC4A 3WDSA 2HK3A 5L7YA 2VZLA 1MT0A 4Y2SA 1YNOA 4F21A 1Z7GA 2JD2A 4YJ2A 1SCAA 2Q6CA 3L7DA 3GJ7A 3CDBA 1DG9A 3N86A 3IQDB 4JUFA 3GPIA 3D9BA 1SPBP 4TYYA 2WJAA 4PYQA 5TQ0B 2QJWA 4DSKA 1A4RA 3UG7A 2H1LA 4QJBA 5JZ9A 1JR3E 3IX7A 1JIHA 3GCWP 3UCUP 2FJWA 1P5RA 3OU2A 4ZXFA 2I4LA 4B3OA 5DOVA 3W04A 1NJZA 1YG0A 1XK6A 2MKSA 3MWEA 4QUBA 3NJ4A 4YP0A 1FESA 1GR0A 2GRJA 2EJCA 2BI8A 2OMLA 3W9YA 4DNQA 3T94A 1J27A 1RHUB 3ACCA 1O87A 2XI3A 4RELA 2JVJA 3OX4A 4WECA 4IRKA 221PA 1P2DA 3W1EA 2VG5B 3EPLA 2VNHA 3KFWX 3HYNA 4D56A 2OUKA 2JDJA 2W6IA 3H40A 2YNFB 4HWOA 1YVRA 2FWAA 3PFFA 4QU5A 1GZHB 2YJ3A 2F4VJ 1J39A 4RA6B 2JFBA 1OIXA 2YKAA 1U2TA 3S8EA 4K2HA 4Z6KA 3G82B 1W19A 1UP4A 4BLPA 2E44A 1JB0C 1G98A 4YMWA 3BKUA 3G2KA 3ZNPA 4LF9B 2SHKA 2C4MA 3KL4A 1GZ6A 3UD3P 2XT6A 1ST3A 5LMUB 1MVLA 4LF7B 3CF4A 1WUTA 1BOOA 4O4HB 2UXCF 1GARA 2TRSB 4WINA 3OJ0A 4ILRA 4JI2B 3DBRB 4BNZA 4PLFA 2HO5A 4CCYB 2IOFA 5AVKA 2GN1A 2LVBA 2GO8A 5JS7A 3EF1A 2CFCA 1FDUA 5FDFA 4YJKA 1I94F 1QXSA 1SBCA 1UDWA 1ZGGA 1Z0IA 2QD4A 4W5TA 1MC1A 1HDEA 3JWJA 4GM0A 2AYZA 5T7LA 1EQ2A 4M9ZA 4BXOA 3KUGA 2C4VA 2IZZA 421PA 3RTGA 3IQFA 1X13A 4MDYA 4FKXA 1GADO 2DQYA 1LX7A 2AFHB 1OLUA 2ZPTX 3RRBA 2C5FA 2OORA 9ABPA 4PXCA 5JLAA 2IUYA 1IKXA 1PEYA 1PGJA 1Z0UA 2MR5A 3GG2A 2FMXA 4EKIA 1S7IA 2FQQB 3KQMA 2QLTA 1M8KA 2M6RA 1Q92A 1E2UA 2XKAA 4DDFA 3G79A 4LECA 2ZSJA 2Y4NA 4K81B 3L82B 4WLNA 4R7ZA 4U9IS 1JA9A 1H2TZ 3MLBA 1NFFA 1QHGA 2GWHA 4BQPA 1V2HE 1M8GA 4YRNA 1YJUA 1O95A 4IRMA 3HKEA 2J07A 3PFOA 3EXHB 5BXYA 4YJFB 2BANA 4LJ4A 4WCDA 3I2YX 3HMKA 2F1KA 1Z0ZA 3CJKA 3UT0A 3K0BA 1FRVA 3MRXA 1M1HA 4I1IA 3WJ1A 4H6XA 3NTLA 3ADOA 3O38A 2GN8A 3CEPB 4KO3S 2HJRA 2P30A 3B5JA 4QVIA 1H9CA 3OVBA 1OVMA 5ALEA 1ODTC 3QYFA 2DO4A 1NNDA 3E51A 1GGKA 2XAUA 5I3QA 4F56A 1VE6A 4XE5A 3JQMA 4YJGB 4Z4IA 3ROGA 3S2SA 4WZBA 5TS2A 2B9XA 2HFVA 1ONNA 1HA1A 4JYCA 1W25A 1MV8A 4FHEA 3TLGA 3G2LA 5IXUA 3K2YA 1D6MA 3FOWA 2IA0A 3PYGA 2DPIA 2VHEA 4GSKA 4RQAA 1NRIA 5F5NA 4ANFA 3E27A 3BGUA 1U1MA 4FPIA 3SIWA 1YQXA 4JI5F 1QQAA 2Q4TA 4AMYA 2ZANA 3ETNA 1S2IA 1THMA 3RJZA 3TBKA 5DGXA 5DO9A 1FCAA 5HROA 2XVMA 1ZPWX 4P3XA 4HN4B 1BXRB 1RHKB 1J1UA 1C4KA 3MGGA 4FX2A 1Z18A 3KTAA 4U39A 5IC5A 1P2GA 3AKEA 5BOSB 3Q40A 3W4KA 3C6TA 3LCVB 4DLVA 4PAGA 4WZQA 4G8DA 2AI3A 2CVZA 5BSRA 2C4WA 1Y37A 5L38A 2C9OA 4A6EA 1XF1A 2YKMB 1FX2A 5F12A 3FR7A 4K5SA 2NYHA 2N75A 3HSYA 3W78A 2OPBA 4W7IA 1T5OA 3N5BA 4LY0A 3PDJA 3H75A 4LE0A 4OI3A 4BJHB 4ESEA 4C0JA 4L3KA 4E1VA 2I2DA 3WTCA 2AJFE 2XMGA 1NZAA 4ZOSA 3AB2B 1VMIA 5E7MA 3FQLA 4X3PA 4BQIA 5B0GA 3Q5GA 1RT7A 2B4TO 4FK8A 4F7DA 3JTNA 2VICA 3BJYA 2VQFB 3OPYB 3ZWDA 2H0QA 4ARSA 4X1OA 2IMOA 4ZAZA 4DTIA 2O2GA 4CO0A 2NWQA 1V37A 1H2YA 3U80A 1CNMA 3A1NA 3GLSA 5HJYA 2RHCA 2YKGA 1EVEA 4WXWA 1D9ZA 5MF6A 1OD6A 5EG5A 1VQPS 2V4RA 5K0ZA 5HILA 2VG6A 4PPNA 3KAPA 2NV6A 1H5NA 3DZFA 4MB0A 1YL7A 1WPQA 4DVJA 4O4HA 5LC1A 2JFOA 1OZ0A 2E4UA 4G63A 1E5LA 1Z2EA 4I4TA 4K2AA 1FBTA 2DR9A 1VPWA 4H3SA 1CULA 1UCFA 2VJCA 2LV8A 1WM1A 2J5QA 5AT1B 3NMUF 1C0TB 1RAIA 2J0UA 5LJLA 2HMVA 3BGLA 3I58A 4RA6A 5H1YA 3ANYB 3FFWA 3SJCA 4N6NA 4FYPA 1S6QB 3I9V9 1BTOA 4F0HA 2BHRA 2WEKA 3DN9A 5F1PA 3PC2A 2PXHA 1LRJA 5M04A 1TQ8A 2CXPA 3S68A 1L7RA 4G1VA 1WEZA 3RUCA 1ZI9A 1AZLA 1KQPA 1HE2A 4CEJB 4C48A 4TU7A 2OZKA 3RAJA 1XMXA 3PCOB 4WFQA 2FOLA 4K6CA 1Y1PA 3TNYA 2UUWA 1HL6A 4PN3A 4DLBA 3N0XA 4HLQB 3ZU5A 2BFDA 4ZDIA 5JWRA 2WAXA 2CDBA 5DJ5A 5E6UA 2EZUA 2W4PA 4J1TC 2X0RA 4TKTA 1G7CB 1L7AA 1I3NA 2P5TB 1LV8A 2Q3MA 3VR2A 1E9RA 2BBOA 1EBUA 4KQHA 3SYLA 3Q3JB 4OJYA 1E60A 2O2XA 3ZHBA 4WJZA 2VJUA 4B3JA 4WKRA 2QW8A 2JJ8A 1AK2A 2QL9A 1JMTA 3R2DJ 1KKUA 1CCWA 2QAGB 4G5RA 1KDVA 3T1HF 4X20A 4B09A 5AESA 1ZMRA 4BKOA 4KK4A 4D79A 2BFCB 4L28A 1OV4A 1T3ZA 3Q8RB 5E3JA 3K5HA 3VU1A 4FGZA 4Q0BB 3UOWA 3ZYZA 5M2PA 1ICIA 4QU7A 1PT6A 4HO1X 1TCCA 2OKQA 1AFIA 3AESB 3RFCA 1U1LA 1M0TA 4RGYA 1K3FA 4EZEA 4RUBA 2ZGVA 4QXOA 1ANKA 4JJ7A 2HA5A 2HRYA 2DERA 2DFKB 1CPZA 1RZVA 3IUBA 1K5HA 2PGLA 4Z7CA 1QTMA 3SS9X 1V9LA 1JT9A 3BB3A 1C4WA 4K4ZA 3THYA 2QX8A 1OXKB 4G8JA 3GD5A 4HEHA 1UVLA 4ELTA 3OTCA 3DO6A 5G0SA 4MKGA 4XDYA 2QT1A 2HNYA 2EFNA 1F17A 1Z16A 3W7VA 5A3RA 2QKYA 4IIVA 4ZJYA 3H5RA 5AE1A 2UVDA 3JXOA 1T8TA 3INNA 3SHWA 1Z4QA 2CGEA 1UZHA 5KNDA 1TUEA 3UPDA 3N2YA 4ZO8A 3H5LA 5IJ0B 5LQMA 1NW4A 3NHJA 3H25A 2RHQB 1A96A 2Q6OA 4ECZA 1XDWA 1KAEA 2Q2VA 2C95A 7AT1B 3MF5A 5KT2A 1R0RE 4WBNF 1NVUQ 4IXMA 3V4VB 1Y3DE 4RLQA 1U31A 4B5KA 5JADA 1T1EA 1O95D 3V4IB 4X45A 5EJGA 1CW2B 1NJ5A 3K0AA 2MHNA 1SCDA 3CULA 5KFKA 3D1OA 2PSSA 4RIGA 2KZMA 3M1LA 4QEKA 3U3ZA 4KGVA 3WLFA 4ZCQA 1A77A 2G07A 1SCJA 3D6AA 4YT8A 4RW9B 3SKYA 1EFKA 4M0EA 4DR3B 5K99A 2CYBA 2PH7A 5EIAA 1PYOB 3OT1A 3MXHP 4XW2A 3ETDA 4G67A 4RK5A 1ITPA 1CZOA 2OZPA 4LOIA 2IZ5A 5AHXA 2GA7A 2X5OA 3NW9A 1R6VA 4DQLA 4OKNA 3WLSA 1FF9A 1AS3A 1P2BA 1J9GA 4P36A 4DOZA 1JGTA 3JZDA 4RHFA 1PNTA 4JDPA 2VBXA 3R9WA 4ZVFA 1JS1X 3G8SA 3ELWA 3MD3A 3DE1X 1WJ9A 4CT8A 1NJ1A 1S3FA 1U81A 4UE2A 3KFVA 3KXLA 1JR3A 5BYSA 1ZD9A 5DXJA 1VI7A 1YBAA 1RTTA 2JA2A 2YNHB 1KEVA 3WYNA 5EZYB 4LF4J 2C4KA 4Y2TA 1MRSA 1IM4A 3MHYA 1ISFA 2JIQA 2Y1IA 4KH1A 3DDWA 2H08A 4ZVUA 3AR3A 1YXMA 1OKKA 3BA1A 2PE8A 2ADCA 1U7ZA 3JTPA 1AE1A 5HRCA 1P80A 2BX6A 1T5TA 3L1IA 2BSXA 1DKUA 3DMFA 4Q4AB 5BSTA 1ZUNB 2HNZB 2VF4X 4R1NA 1E2EA 4QRHA 3R7AA 4Z9BA 1KI6A 3V34A 3TZXA 3TD9A 1CD5A 1UXOA 4P2SA 2NZ4A 3DGFC 4GC9A 3M89A 2Z8QA 2WC1A 1WMAA 2WJ3A 5AVJA 3QKRA 1XMOB 3L84A 4FVTA 2EFEB 5I9LA 2FLOA 1NZDA 4C7MA 1U1OA 1GHTA 3UJ8A 4TXLA 4DUZJ 4PX2A 5ICFA 2H17A 2UV8G 5EWMB 2QMZA 1I0LA 5MHTA 4XDDA 3HQ4O 4ZP7A 4IP0A 4QYWA 3WLTA 1FRKA 4BYMA 2FPXA 1DBSA 1BRTA 1WSWA 1Q7BA 2OEMA 2OTCA 3FPEA 4IQXA 1T24A 3DI6A 3IKLA 2Y1FA 4YRJA 4UNRA 3P96A 4R1UA 2E5WA 3U3OA 5CB4B 2GCOB 4DCOB 4PSDA