4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
molecule tags Isomerase
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
2QMXA 1KS2A 1PSDA 2CDQA 3BXGA 5JJBA 2F1FA 2JHEA 3LHIA 3OBIA 3MAHA 3DHXA 4OQPA 2P9CA 1Y89A 2OKGA 2F8MA 3MTJA 4GO7X 3P96A 2QMWA 1DEAA 1U8SA 1ZPVA 4GO1A 3CSSA 4X84A 2H9ZA 1FQOA 1FRZA 2RQKA 4NMLA 3BXFA 4L5IA 2WU1A 2P9EA 3MWBA 3HHEA 3E15A 1LK7A 2NYIA 3LUYA 4PWUA 3L7OA 3KV1A 1YGYA 3U7JA 2I9SA 4L5JA 2O0MA 4R7TA 3TUZC 3TUJC 3IXQA 4GMKA 3BXHA 3ENWA 3ENQA 3TX2A 3OFGA 3CH7A 1JT9A 3IBWA 2LQJA 1FSFA 4L4ZA 3DC2A 4IO1A 3BXEA 1NE7A 2LVWA 3AB2B 3NZEA 2KO1A 1Y7PA 2QSWA 1SC6A 1HOTA 1LKZA 3TUIC 2MDAA 5HJ5A 3UW1A 2W48A 4OQQA 3E7FA 3LOUA 1UJ5A 2BKVA 2J0EA 4LUBA 3S1TA 3ICOA 3K5PA 3ENVA 1UJ4A 3W7BA 4R9NA 5IT4A 1LK5A 3EB9A 3CEDA 3KWMA 2GNPA 1RWUA 1M0SA 2JOQA 1FS6A 3N0VA 4L50A 1XTZA 5FIIA 4TM7A 1UJ6A 1HORA 3NWPA 4L4YA 3AAWB 3OFEA 2RI0A 3O1LA 3AB4B 3DHWC 4GO5X 2RI1A 2DT9A 2RQMA 4M8LA 1O8BA 1CD5A 3EFBA 3DDNA 2DTJA 2J0WA 2BKXA 2R5FA 2QRRA 5T41A 5IS2A 2J0XA 3OFHA 5IT0A 3OC6A 2ZHOA 4L51A 3NRBA 2PC6A 2P9GA 4TM8A 3LWDA 3OFFA 2PA3A 1VL1A 3HN6A 2FGCA 1YBAA 1PBTA 2RE1A 1FS5A
chains in the Genus database with same CATH superfamily
4ZIRA 3TXAA 2LW7A 5A8RB 3MHPA 3AVQA 2H54B 3ADBA 4KQIA 2W9BB 1HBOA 4DSOA 1W7AA 3I05A 1Y89A 1FFGB 1YJAA 4KE7A 4B3RF 3H5UA 2IVFB 4KGDA 3GP8A 1A5ZA 3CW2C 1JAHA 3SR3A 2NU6A 3KUEA 5C4MA 1M5SA 4YDQA 4MLPA 3FGNA 5ALLA 2HZAA 4DMZA 1K6XA 2RHMA 3AF1A 2YNIB 3NIWA 1E2UA 1Y7HA 4UQGA 1OR8A 5IQ6A 1AU9A 1MHTA 4X93A 3JATB 3ON5A 2KG1A 2MHCA 3CEAA 3PJGA 3N01A 1ADCA 4C7JA 1LPSA 1KHHA 1YJRA 3D8SA 2ZYWX 1DCKA 2W2LA 3IODA 2OT3B 5HSGA 1KVSA 1JLFA 2DXEA 3B54A 1JNZB 3HHDA 4N5IX 4ESOA 4NQRA 4IDOA 3Q8WA 5JPIA 4CUKA 2UYGA 1EQ0A 1L5HA 2YZKA 5D3GB 3UJ9A 3H5TA 2A0FB 1T8YA 1W5FA 1BY9A 1TJ4A 4YASA 1J8DA 3HB1A 2JDID 2HNYB 3GLUA 3K72B 1WMAA 4WZAA 3RHZA 2AFVA 2CNLB 1GU0A 3K2IA 1U2DA 4MDYA 4NU5A 5E3IA 1CJSA 1CJMA 3SHOA 4PTLA 3EQ8A 2RHOA 4HDAA 4NLQA 1CQJB 1RJGA 2EKLA 4PX5A 2HURA 3H2UB 1GA1A 2HHWA 4FN5A 1U0JA 1XHLA 4N5DA 4A5OA 2JLQA 5IN4A 4GMHA 1TQDA 3RB4A 1A04A 4E2XA 1PQWA 1HFEL 4YUZA 2FHKA 1A9SA 3DOIA 3ZWXA 5DFAA 3D4NA 2DLCX 2RKBA 2VQDA 2Q28A 3B53X 4YDRA 2NZUG 4EUSA 1T5HX 2QW8A 3ILIA 4UW9A 4KVGA 4AD6A 5AKXA 3NEAA 4UT4A 3ANXA 1KMCA 3JWEA 3JRNA 1C7RA 1XC7A 3GCWP 3P2MA 1D4ZA 5IXJA 3RG8A 3VVCA 2OAQ1 5CGQB 3EXFA 4BJ1A 2Q49A 2GAIA 3I82A 1WXXA 1Z6YA 3D9QX 4NP6A 5EG5A 4PU0A 2CL5A 1O2DA 3L7KA 5FA5A 1GVHA 1B8VA 3V48A 5D0RA 4YR3A 4OYZA 1MXFA 3HCXA 1KL7A 4L8VA 3N8NA 2I2FA 1JG2A 4YI5A 3EDRA 2BDEA 5JXWA 1W46A 3GT3A 5JE8A 3ULKA 1VA4A 3EJMA 3ICWA 4A8XA 4KSCA 4WLFA 5A3SA 3IB6A 3ZDRA 3UJDA 3LD9A 1PGJA 1JIQA 3C98A 2NQ2C 3FF1A 3IUSA 3BJIC 1XVVA 4FFBA 4Y2MA 1L3IA 3JWPA 2XMTA 3UOGA 3NXSA 1L1RA 2YQ4A 5IAEA 4CO5A 2MEWA 3Q72A 4EX7A 1PAUA 3DNCA 1G2QA 4PZDA 3DHWC 3GDGA 1RTHA 4YRCA 1ODFA 4B02A 4EI8A 1RPTA 1SL0A 1SL2A 4BV2A 4OG2A 3K5OA 3B6KA 1L5GB 3JS9A 3L6CA 5IFLA 4N8SA 4UOZA 4EY6A 4BKUA 2VPZA 4K9PA 1RWQA 1X0XA 2PPVA 2IOHA 2RJNA 1H9CA 3DXZA 4JI6J 2MJNA 1W96A 4BU0A 2Q3MA 4NPAA 3CCQS 5AKYA 1ICIA 4KRGA 5A62A 1HLPA 3AESB 4EGAA 4LJLA 3PEVA 1WEKA 3S6JA 1I8TA 1KEEA 3OEEA 1GAJA 2BHSA 1UM8A 4QHSA 1CLEA 4LCEA 4QYRA 1DWQA 3D0OA 1RABA 1GARA 2J9FA 4MKIA 4ER7A 4D4HA 2R4QA 3HB9A 1TIBA 4RMIA 3QVJA 4N3BA 3FCXA 1HHTP 3RI3A 1C0LA 4IR1A 1PDOA 3DV2A 4KXWA 2MINB 2V5UA 2VDIA 2NU8A 3KVYA 1KETA 3RVMA 4IQGA 4X7RA 2EG5A 5EVJA 2RRBA 2IHR1 1SUAA 3EVMA 2AL7A 3CURA 1H2RS 3NOOA 1J70A 1S2IA 4F8YA 2VQFF 4BVEA 1CUAA 1J2RA 5BQXA 1FD8A 3CMES 3ILXA 1QRUA 3KTFA 2VNJA 4PM4A 4UZEA 1OLXA 3MGJA 3ZHTA 4LISA 8ATCA 3U17A 1VPEA 4XQCA 2ZTSA 1OMOA 1BSVA 2OHOA 1VXRA 1RYNA 1LH0A 1IJFA 1F7VA 1WKLA 2O2XA 3TRKA 3C39A 5HIMA 2FSIA 1EFTA 4PXYA 1G3RA 4HC4A 2A58A 2ZVDA 3BORA 1CYEA 1R0CA 3IAM6 1PC4A 1HYBA 4BP8A 1TM7E 4YMTA 3TWZA 3UW1A 2BGKA 2JFGA 2WJ4A 3LFTA 4RVUA 2OV4A 3N9IA 3K1AB 3L01A 2DE0X 3NCPA 2F1HA 1WPQA 1QO9A 2DB3A 4ZRNA 2OO5C 1KSFX 4X6LA 1NYQA 2E9SA 1PTJA 1LW2A 1QGDA 3TD2A 4TLRA 3G89A 2RGDA 2HZVA 4LC1A 1P19A 1SHKA 2K6GA 5I7UA 2WSCC 2ZATA 1I6JA 4P4TA 3FJ1A 3DWEX 3M5CA 2XUIA 1ENOA 4F1WA 3LUJA 5E6UA 4G1UC 4Q21A 2A5GA 1TK0A 1RXCA 4DEYA 1RHRA 2RCYA 1RRMA 3E22A 4IR7A 3S1AA 2AB0A 3L7DA 4MPTA 3LT4A 1OKKD 1RSCA 3AIOA 4IIJB 4ZHRB 3FRJA 3B85A 4JSYA 3JSXA 1OVMA 1QUPA 4R7ZA 4ZT4A 4UBIA 3NWOA 2ZUDA 2O2CA 2B3DA 2WIGA 4ZPAA 3A04A 2Q7DA 3OX4A 2YIDA 4HHJA 2ZKIA 4E03A 1S0MA 4L4RA 5FOWA 1ZUHA 2Q5LA 3U4GA 3VBEA 3CULA 3NWGA 1IHOA 2AGOA 2DMRA 3TFOA 4O3FA 3ISTA 5JMPA 4K1LA 4YMHA 3GUYA 3A11A 1K6MA 3AETA 4INPA 3TD9A 3Q9UA 4XWGA 5DBFA 1MTZA 4USVA 1VJ5A 3F5QA 2H59A 1ZJ5A 1ZUNB 3I62A 4JLUA 4DLLA 2E3JA 3W5ZA 4GLOA 1DRKA 2IUEA 1SCNE 3CZ5A 3FCHA 3FZGA 1GQEA 2I6XA 5GMOA 2JLYA 1SKMA 3KC2A 4PLPA 2GV1A 3OA2A 2H11A 5B37A 3D2LA 4RJLA 3NBXX 3GR1A 2BFPA 3AVPA 1BAPA 2PS0A 4ELTA 3N59A 3M70A 3O03A 3WGLA 4ECXA 1DC7A 3BXZA 4IDAA 2Q8NA 4EUFA 3VO1A 4YWHA 5IH7A 2CV2A 3FUWA 3BXFA 2Y1WA 4RE5A 1P4JA 4F11A 2GVDB 3TJ9A 1SU6A 1E9AA 4ENUA 4DLSA 5J4VA 2F4NA 2V58A 2B7BB 4ICLB 4FYVB 1U81A 3AHIA 3GILA 1QG4A 2HT6A 3RUPA 2WAAA 2YY5A 1KYZA 3IR7A 2VEOA 2OZLA 1EUQA 2X6RA 2NV2B 2BP7A 4OREX 1RI7A 2DPGA 1ZK3A 4UJ5A 1IZ8A 3H16A 1WBJB 2W0MA 2HHPA 1CETA 2IYNA 2WWWA 5I8PA 4PSVA 3KZMA 4DUZJ 2HBQA 1K27A 4N41A 4P71A 1L9XA 4HX2A 3GQBA 3JD3A 1X92A 5A5FA 4FE4A 1WTCA 3GLHB 4H7DA 1O89A 4GGPA 1OFIA 3A8KA 4RL1A 4NA2A 4EO9A 3I32A 1ZKDA 4AKTA 4NH0A 4HADA 3VNBA 4EJFA 3KLFB 1VLHA 4MQMA 1NJ5A 4HFRA 4I6AA 3PJEA 4Z1OA 3LO3A 4PC6A 4NU0A 1JIVA 3I0ZA 2HK7A 3ONWA 4J4TA 3KYLA 1T5TA 1IKXB 2X23A 2FPIB 1DFGA 3DCIA 4ZEOA 1MOSA 2XE6A 3ORHA 1U2GC 1TX4B 2R1UA 3VVBA 3K4QA 3IQFA 2KFZA 2H5EA 1XTJA 3VVLA 1K3TA 1Q17A 4HO1X 1D09A 1QIHA 3Q5EA 3HU1A 3P0RA 4GLFA 1XDGA 3Q87B 3CZQA 2C2YA 1GLVA 8OHMA 4EFAC 3ZQ6A 1M5OC 3WA6A 3P4UB 1E89A 2XCPA 4OHOA 2J87A 1YCGA 5AR1A 1NBIA 1NQWA 3KKZA 3QBVA 1QPBA 4X91A 5FBZA 3PPWA 3CEJA 2FUEA 4R31A 4TRJA 4AZ0A 3KZCA 3QVSA 3TLCA 1W44A 4RW4B 2HVIA 4ZGBA 3GBPA 4YRKA 4P9SA 5DDPC 3TIVA 1UIRA 2ORVA 5CA1F 3I0SB 1NNEA 3NHLA 5A8RA 2LECA 2O01C 2YVSA 1WETA 2BY4A 5ILQA 5BVGA 1S96A 3ZTWA 5BR8J 3RZAA 4HB4A 2XF2A 4F38A 1P2BA 4ZVPA 4BL5A 2H5JA 2V45A 3H9BA 2AOVA 3P5TL 4FFSA 1IWBB 4USIA 1R9MA 2WTMA 4TYPA 4J9OA 1V6CA 2B98A 2DRBA 1U5CA 3E3MA 2IZOA 3Q0EA 2FMXA 4Y34A 1SBTA 3GAZA 3HY4A 4B3SJ 4ZXPA 3I28A 4IQFA 2HFSA 1DXOA 4F4UA 5K3EA 1EG2A 1NP3A 4OJ1A 4QOGA 4J1QA 4FF1A 1UC8A 5PNTA 2ACMA 4YBZA 1OS5A 3QPIA 1X2EA 1S79A 3NIGB 1U8EA 1C9MA 5F5NA 2X2FA 2EQAA 3FFIB 2RRAA 2IDEA 5EIHA 4QYIA 5DYNA 5AUQA 3PHCA 2ID4A 2HPHA 1JX4A 2X76A 3K9LA 3CF6R 6NULA 2CPHA 1E98A 2RHDA 1K4KA 4LF7B 2OJ3A 2V7EA 4QKQA 2GIRA 4QG3A 3WGOA 1UOQA 1QAJA 1UA1A 2A0FA 4D42A 5LJIA 1NYTA 3J7YU 3C8MA 3KR9A 1K7SN 3QO9A 3I5BA 1R5JA 1KSJA 3AZOA 1UDAA 1QHYA 2P27A 2CNLA 2OGWA 3ZNJ1 4L6V3 1YV9A 3S1SA 5JD3A 2VA3A 2HWYA 5B1YA 3N6VA 1YJCA 5C8DA 4IV8A 2DGUA 4DSAA 5DGAA 2DYAA 1D0IA 2GD6A 3CG4A 2BELA 3R5HA 5K3DA 1R8QA 4QT0A 1M1YE 4N8OA 4V0LA 5KFPA 4KJZA 1PNOA 5FOSA 3G1WA 2C2OB 1UJ5A 5HKKD 4RV9A 4ECYA 2OEMA 4ACAA 4Y2IA 1ZVVA 3G2IA 4OYYA 4I2QA 1WJ9A 3IG1B 3PT9A 3AIIA 2YQ3A 3NI2A 1JFLA 2GXUA 3A4NA 2AF3C 2JDIA 4MW1A 1QO0D 3RR8A 3V97A 2WSYB 2W42A 4KPUA 4F9GA 4TN1A 2QOEA 4JT8A 2P2CA 3VR4A 1N2HA 1AS2A 3TZWA 1KE1A 5L7YA 5JR3A 4M0EA 2Q9UA 4ZGWA 4YN3B 1E0SA 4AIRA 2D0IA 1FKPB 1XELA 3SQMA 1Z16A 1SXJD 2EKBA 3SXPA 1XRRA 2AG1A 4KN6A 2B5WA 1L7XA 2VHJA 2V2KA 3ZE6A 3B5EA 1FXDA 2NNLD 2JFDA 1E5XA 4PLGA 3PRBA 3MWGA 4UM9D 5C1BA 3A3NA 4G8BA 3C8UA 5F73A 2XITA 4EAAA 3D0IE 4JZYA 1ECLA 3JXOA 5FWAA 1JTFA 3V8VA 3AEUB 1O6ZA 5DQIA 3IBFB 4RTPA 1S49A 1HTTA 4K03A 5BSVA 3ZW9A 1U8WA 2CLEB 3LPAA 1YAHA 5EN4A 4FMCB 4C04A 1ULZA 3DDHA 1RHMA 1MQ9A 2AQKA 3H9JA 5KTTA 3UT6A 3SQXA 3HR7A 4A10A 3EGWA 5CT4A 2Z58B 5BUSA 3ANYB 1KRWA 3L5KA 1ZRSA 5L3SA 1VMBA 3R9KA 3DRRB 3VAZA 4LJAA 2E7VA 1A97A 4YO8A 2EG2A 4ZTUB 2XOXA 4J9LA 4FCWA 3GIKA 4A8FA 2B20A 4XUCA 4BFCA 3D28A 3O2JA 2GCPA 4CMCA 4MUFA 1A9NB 4QYTA 2ZRAA 3LXRA 1P2VA 2JF0A 1RP1A 4BO8A 4C05A 5H80A 3R5DA 3QP9A 3IBCA 4I7EA 2YJ6A 1C7ZA 2ZQZA 4DCSA 4H59A 4XCQA 2JAWA 2AEEA 1E0AA 721PA 4E08A 3KLBA 4AF8A 5KT4A 3TEHB 2OHGA 2AOTB 3BFJA 2B7CB 2W2MA 1YZFA 4TZKA 3MTAA 4JR0A 2FXVA 5EHNA 4LTDA 4EITA 1W5SA 2V63A 2NVOA 2O2ZA 3PW4A 2XQIA 2PJRA 3TNLA 1NPYA 2MINA 4M9RA 1GIAA 1R6TA 4K8OA 3CCVS 3TA0A 2P65A 1J8MF 1U2SA 4JI8F 3WMGA 2PSZA 4JROA 1BMTA 1U5AA 1OVGA 1VE3A 3H5XA 3RJZA 2I3ZA 1GZ5A 3FSXA 3D5EA 4MFBA 2PVPA 2X6QA 1RWWA 3FB4A 4QU6A 3M9MB 3PFIA 1ZBDA 5FNVA 1ZGHA 2C4HA 3SDEA 4FCTA 1E96A 2VG5A 3ZNQA 3Q8UA 2QD1A 5HVNA 3Q12A 4D81A 1PV4A 3GLKA 1KI6A 1TLLA 4H6VA 3VUFA 3EEFA 4N12A 3QYYA 2HQFA 1NAIA 4RU1A 4HT5A 4YV7A 3GN1A 3JPYA 4FOPA 2G82A 1FJCA 2YWHA 2B51A 1F3FA 3L05A 1HNVB 2V6GA 4X3OA 5HCIA 3FOCA 1V95A 1ZSVA 4BMYA 5FDLA 3RS7A 1HNIA 4WERA 5LUBA 5CBPB 2NSBA 2VO1A 5ETRA 5FA6A 1AUDA 2BV3A 1OI3A 5FEMA 1HYEA 1DXYA 1EEXB 2H0RA 5FTNA 3B13B 1BMQB 3ZDQA 2Q5JA 3BFPA 3OJSA 2ZYAA 4KWCA 3LXXA 3H40A 3FFBA 2R2GA 1E1YA 2J07A 4R0VA 4AY3A 1AQ6A 4LOJA 3OFFA 4OHRA 1TEXA 5IWAF 1C2PA 4J9VA 3R6GA 3GV0A 5JLJA 5GOZA 2AC2A 1KSPA 3WHKA 4GICA 4PQAA 3FDXA 1RI4A 3ZCRA 5IC5A 3U6BA 1AMOA 1PK9A 3W4KA 5JVGQ 1P1FA 3DAGA 3EPLA 2YL2A 2YMQA 4HWPA 1T25A 4Q7MB 3CUSA 2AX4A 3C43A 1JJHA 2H2IA 1ODCA 4ZOQI 4J9UE 1BQ3A 4E94A 1PL8A 2N46A 4FN4A 3P0HA 4CL3A 2QQ5A 1OE0A 3GRPA 3OIWA 1IQTA 3I6MA 4YR2A 3M30A 3CJ3A 1IU9A 2GPTA 3CVYA 4GP9A 5ETQA 4PUOA 3E8XA 2DNZA 3QM1A 2ID8A 1G6OA 2HVDA 3HXKA 5C18A 1KFBB 3C3WA 4L16A 2KKHA 1M66A 1NI3A 2I5JA 5EZYB 3QI7A 4FJ1A 4ZYWA 2A1BA 3IDFA 5M2QA 2GGPB 3A8TA 2X6TA 5AOVA 3EYZA 2JKYA 1DX4A 3JWGA 1BC6A 4KNVA 4BX0A 5C34B 1I5EA 4Z4HA 1U8UA 4A23A 3CE9A 2CVIA 2YXPX 3WGIA 4ZPDA 1EG7A 5IJ9B 3BRQA 3RBZA 4NFSA 3AVVA 3CPEA 1K73T 4DL9A 4R68A 4YRMA 1WC4A 4UUNA 4A2QA 3BK2A 3OM8A 3IFEA 4WP9A 3A1SA 2YN2A 3C3CA 1ISJA 5JQGA 3G49A 3E2EA 2CXPA 1WB5A 4W9MC 1SG6A 5F0WA 1QGOA 1EZ1A 4MVJP 1E3SA 2CN1A 3RKRA 3W2WA 1ZM7A 2V8DA 2B7LA 2VBZA 2X14A 4BMSA 1Z18A 3HHNB 4IFTA 3RYHA 1RC8A 2R7WA 4B6GA 1VL6A 4KFTA 1IBMB 2NZYA 3CJKB 3UCEA 1L2TA 1Z5ZA 2EP8A 4QTZA 3KK2B 4C7OB 4D8TA 2P8SA 1EQ2A 4YB5A 3SK0A 4M4SA 3MAQA 1THZA 3CU5A 3IMQJ 1SY7A 2GUWA 4MUMA 1ZTTA 1F8YA 1VL0A 1R8CA 5HLFB 4YMWA 1UT5A 3UFBA 3DV9A 2XY4A 1M2FA 4NLDA 3UGKA 4XB1A 4KGMA 2KZZA 3KJQA 3BH6B 1U0GA 3AP2A 1LB1B 3F71A 1I7DA 1SQ6A 3PXXA 3U4QA 3N0RA 3I9JA 5A5EA 2KI2A 5JS2A 4XWYA 1Z13A 3ILVA 1JIUA 2I6FA 3ZZOA 4OGLA 3EG9A 3OIDA 3V7UA 5ALDA 4CH1A 2CPFA 2EFHB 4LF8F 1O9HA 3GNSA 4EPYA 3M2RA 2CDRB 1N77A 1RFLA 5DOVA 4EWLA 1JQDA 3S70A 1T03A 1NXIA 1BDJA 3CO0P 4OJQA 1AK2A 2ASLA 1EGMB 1MFPA 2V6MA 4G6ZA 3OFKA 2CFTA 1H2HA 3ZJTA 1HNZF 1NLKL 2XXAB 1RYBA 1AB5A 3PNYA 3CCES 4TXJA 2ZS7A 4ENOA 5SY4A 2VVTA 2H4YB 4ED8A 1QDLB 3DZBA 3RT1A 5JY6A 4RULA 2CBXA 4LF5B 4GLBA 1M54A 3DPIA 1JWAB 3P2OA 2GPJA 1NHKL 5EN1A 1NU8A 1LFAA 5ETVA 1XZQA 3ZH9B 5DK6A 4EEZA 3VR6D 2OCPA 3I0MA 3MM8B 1V5GA 4FEYA 1ZVKA 2HRUA 4E98A 4NCNA 5TPWA 3JVEA 3NVAA 4FDAA 4YQEA 3DWIA 2CXQA 1LI5A 4NCIA 2IH4A 5K3SA 3I0SA 2H3HA 2NZ8A 5AO9A 1OFTA 3AFGA 1Y1SA 4KVAA 3PX0A 1WCIA 4JL6A 1ZCBA 5D3MB 4FZJA 2RARA 2C5LA 3PYXA 2FWPA 1MO4A 2C99A 5IUJC 1NQVA 4AP5A 3RRFA 1B73A 2PK3A 2VQEF 3BTOA 5J2TB 4OFZA 4A3SA 1UM9B 4P7KA 2L42A 1KYIA 1Z4UA 5LL6P 2HQBA 2CFCA 3HKDA 3I96A 1E2NA 4W92B 5FUBA 3GMIA 3EHDA 3GRZA 3BD7A 3MINB 5LM7E 3P8BB 2IBSA 2GGSA 1DOZA 5I4KA 3FCWA 1GFWB 2X41A 3HN2A 4WASA 4C5BA 4KRYA 1CDDA 4EK2A 4MRVA 4S24A 4CKWB 2IUUA 1JLAA 3W6NA 3BA6A 2E7XA 5T5QA 1HR0F 3QVWA 3R5XA 1Q78A 1Y4ZA 1ND5A 3M1LA 2RT3A 4MQ6A 1JB1A 1RGVA 2PZJA 4LRAA 2GLUA 1RKXA 4LV6A 3W63A 5BSEA 1C7QA 1BVYF 1FMTA 3WB9A 4EJSC 3NWRA 1DB3A 3OFVA 1U9YA 4E2YA 3QMVA 3TSZA 4KITB 4CM9D 2EC2A 5H9EJ 4Y6GB 1EEHA 2YZNA 1J09A 2AHOB 4OMCA 4K05A 1IHPA 2F1RA 2O0HA 5ALFA 4DPTA 1E92A 4DV0J 4MIWA 2AR7A 3NTQA 5DW0A 3M1IA 2FN8A 2H2GA 1QE1B 2CZGA 3C3JA 3X43A 2UUBF 3JARB 4A0GA 3IG1A 4NWBA 2WJ3A 2GEVA 5THXA 5CYOA 8AT1A 2O3JA 5CM2Z 1PGNA 2ZCUA 1T2VA 3AHPA 2VWGA 1H3DA 1E58A 4CG2A 4S1VA 4CG1A 1FEEA 3IPAA 4GQIA 1U2PA 4XX0A 5GIOE 1TXGA 1QBGA 2C4KA 1YI8A 3B1VA 1GNRA 5G4KB 3UHOA 1ZGCA 3C7DB 4MPDA 3VHRA 2PQ2A 3M6LA 4DV4J 3ZIUA 5HKKA 3KO8A 2J9DA 4NLUA 4L5JA 2V59A 4ZVLA 4PGGA 2DQ4A 2A9JA 4F56A 5ETOA 3ZWYA 3UE2A 1E2HA 2QA1A 3PEYA 3CEHA 1QO0A 4FEEA 4ZP1A 3J80Y 2IZZA 2XYGA 4X4TA 1E2DA 4FJ2A 1TJNA 1QRSA 2XQJA 2BJ3A 4HEJA 5LMCA 3PNOA 1PJAA 4ZIRB 2WT4A 2LMIA 2GNPA 1XQVA 3RJTA 2W2LD 1JTEA 1YWGO 1WSRA 1HBOB 1TM5E 4HBGA 5DB4A 4TLMB 2K1RA 3WRVA 1SXJA 2AYBA 1BQ4A 4IDPA 5EYPA 2O3QA 2I8CA 5T14A 2V6IA 1LOUA 4WECA 3SC4A 2Z58A 2NU6B 3PNIA 1Q6YA 1DLOA 1KU6A 1VQOS 4HN9A 3EULA 2DH7A 1EMDA 2BDUA 2HMYB 2CUZA 3HSDA 4ZYVA 4DPUA 3P3DA 3RIHA 2F3QA 3I23A 4LBVA 1S8FA 3UMVA 1GYRA 5ICGA 2D74A 1XU7A 1QRDA 1EX6A 2L41A 3OJLA 5EQFA 3W6ZA 3VTZA 4U67Q 2A88A 2I34A 2ROQA 1RM5A 2UV8G 1U25A 3BWYA 3OKPA 4KG7A 3FFXA 3QVOA 1L5HB 3HZGA 1Y7PA 4P35A 4KBYA 2G4BA 5LMUJ 2PXXA 4KGZB 4M7PA 2EC5A 2AMJA 3UC9A 5B3AA 4GYYA 1N52B 2I6WA 4AYXA 4WZAB 1WDTA 2ETXA 1YRHA 1JI3A 2DNGA 4MV5A 4PWWA 4H6WA 4AQDA 3PXEA 1WHYA 3BDPA 2JFZA 2ZT6A 3K96A 4XGQA 3BYRA 2YXNA 4DV7B 4TROA 3R7DA 1EJBA 1ESZA 2HCFA 1B8NA 4WDRA 1I24A 1T5LA 4TNOA 2GM5A 1A8UA 3LKBA 3EK2A 1Z2CA 4LOIA 1K7EB 2JW5A 1GKIA 1W2HA 3F6BX 2O2DA 1K6JA 3V3KA 4NPCA 3LPNA 1TKBA 3SOPA 1U1KA 5CHYA 1XKXA 1WORA 3BK1A 2JPDA 1LXCA 1MMFB 3PFOA 3KTAA 1FRJA 4CYMA 4KXXA 3KAJA 5H02A 4FSDA 1CQNA 5F1OA 4XUDA 2GF2A 5LBIA 5DNYB 4AULA 4RF3A 1H8HD 5SZTA 3QEMA 5E5NA 3W9JA 3UAXA 5L39A 2NZ4A 2NZXA 1F9AA 3GEDA 5CLGA 1WF2A 1EFVA 5GAJA 4FOTA 3EZXA 3EXFB 5TLSA 1VE6A 1P18A 3C3EA 5CBPA 4DPLA 1JXOA 3WQQA 1HV8A 5DHFA 3Q15C 3IT0A 4UD2A 3JYHA 1S5ZA 3T3FA 2GJ2A 1O77A 3DQPA 3QXSA 5KNLA 2M6LA 2FVPA 2A7XA 4JSRA 2ICAA 2BLLA 5CVEA 1VE1A 4YJKA 1QP8A 2ZOFA 4LXQA 5LA6B 2XGOA 3ZKWA 1YQHA 5IULC 1YITS 4FF2A 4FFBB 5CDGA 2ZGVA 3TBHA 1JLEA 1U94A 1E2EA 2IC3A 3WQSB 1Q12A 4ZPVR 2P67A 5KREA 3LGAA 4NXMF 2XBPA 5I9LA 1RTHB 4E11A 2WVDA 5HUJA 4FYYA 4K4ZA 2FZ5A 1GH8A 3ZHYA 2V4JA 2RFLA 1N88A 2KO1A 3MHTA 3FI0A 3S44A 3UKDA 5ELMA 2YPZA 4PN7A 4YRSA 5SYMA 5H8WA 2WF7A 4Q0MA 3DLCA 1SJQA 1ZN7A 2KXNB 2JCYA 1JIHA 1NAQA 3QRRA 4JJFA 5HKBA 3DFZA 3QBTA 3TA1A 2DQZA 2Y2VA 2GGPA 4O2RA 1KEEB 1HWLA 1ULTA 3PFKA 1TZBA 3TIGA 2CADA 3HCWA 3IT2A 3IM8A 3PVZA 3T7EA 2YKPA 3CO5A 4EHNA 1W36C 5ALNA 1RABB 2FETA 2QX8A 3LECA 3K5IA 2FDXA 4AN0A 1KY3A 3BG5A 2C5GA 1M1HA 5LBUA 3SNKA 4A8OA 4UULA 1CZHA 4UPEA 1UZHA 3EBPA 1AQUA 4B47A 1W93A 3INRA 3IQEA 2I9PA 2NU8B 4PZ0A 2YRFA 2WB4A 3GJQB 2X22A 3BHJA 2HAFA 1IN5A 2DH8A 3VKFA 2CQ2A 1NRWA 2A6OA 1D6JA 2RD2A 4L28A 2AN9A 4P93A 2HLNA 1NSFA 4Q34A 3I53A 2IPOA 1Z2ZA 1K08A 5AVTA 4PIPA 4K6HA 4MNTA 1I2DA 1FF2A 2WYIA 2DHXA 3ETNA 2Y93A 2KBEA 3L8CA 4PRYA 4CIVA 8ATCB 3DBVO 1IAQA 3IWLA 3BDEA 1KERA 2F3RA 6GPBA 4A8JC 5CB6A 3C2PA 4DFDA 2J3IA 3FROA 2WJPA 4B31A 4W5RA 1C29B 1IJFB 3A8JA 1K0FA 1KBQA 2PO7A 3AD9C 2JLVA 2GO9A 4B83A 3PA6A 5AW8A 3FVTA 3M9XA 5KNDH 2VYVD 4KE5A 4AO6A 3KAKA 4LOHA 5T8KC 5KTYA 3ZUPA 3DZJA 1Q3HA 4P2GA 5E7OB 1STOA 2P7HA 5L46A 2FQ1A 3B36A 4CF4A 4B7AA 3HHEA 5HVFA 4G65A 5F9HA 3P94A 1NDQA 3ZNUA 2ZT7A 4UAVA 3U7IA 5KDOA 3SIRA 1LW2B 2KXFA 3GYGA 1F2HA 3FTDA 3OW2R 4MVXA 2GSDA 3I9MA 3Q41A 3BJZA 4P5EA 2O57A 3UJ3X 3AIKA 2QR3A 2FCRA 2MTLA 3ZW7A 2W4DA 1IHXA 3FH0A 5A76A 5E6UB 3KQNA 2CQIA 4MOWA 1RHRB 4MSUA 3E22B 1I7NA 3ZN2A 1D3AA 3AM5A 4JUZA 2UYOA 4NCGA 1MH9A 2VHTA 2OZVA 4ZJQA 3DEZA 4CI0B 2VS1A 3LY5A 4QA9A 5KYTA 3H0CA 3P9XA 1DAHA 3KQYA 4IY1A 1O5TA 4URZR 3Q85A 2IELA 1SVWA 2WF8A 4S35A 2HL6A 4IV5A 4IXNA 1I2ZA 2XLCA 1QIIA 3Q8MA 1Q7LB 1NXQA 3AETB 4YQFA 5HZMA 3C6BA 4TVSA 5EIAA 1MRSA 4NJMA 2OV2A 3MT0A 2C88A 4PSAA 1OBCA 2P1RA 2P1ZA 3B7GA 4Q9HA 1RT7A 1W4CA 3GT0A 1SG9A 4LUBA 2DG2A 3HXLA 4L9WA 2OPPA 2CQHA 1YTYA 2UXDF 3OP4A 3CX7A 4OV6A 5ER9A 3D3BJ 2VYFA 5JZBA 3OFEA 3UN2A 1UEKA 4YY3F 2NP6A 1N3IA 3GUCA 4IHJA 1QB8A 2KTQA 4QUDA 3I2GA 4BWMA 1FJGB 3N58A 3NTUA 2EP7A 3CMQA 3E7WA 2WEKA 3EX7C 1USVA 3KDSE 5IYZA 3AKYA 1RYEA 2MYFA 1JHVA 3CN9A 3I5UA 3A6JA 3M89A 2E44A 2GEJA 3IR7B 1M2JA 4WBFA 3R0QA 3J7YI 2D2VA 4KAAA 4I55A 1R6BX 1RLCL 1MMLA 2OZLB 4KFCA 4ZS6A 2BP7B 1PJLA 2XUDA 1PR6A 2P6MA 4Q3EA 5LKAA 1XWFA 1Y7TA 2QTHA 5T7BA 1OPXA 1FRQA 3A9RA 2OD7A 1DG9A 4AFFA 4QOHA 4E15A 2MY7A 4BMCA 1PS9A 1P5JA 3N7UA 4ZP7A 3GQBB 5EWEA 2ODWA 2JFPA 4ZCKA 3EOBI 4GD3Q 1VZ2A 1T9YA 2WYWA 4FOSA 3R2CJ 4BGDA 4NDNE 1AHIA 2J8AA 4YMVA 3RU3A 1RACA 5IT0A 1U4BA 3L1VA 1JG1A 2E87A 3FCCA 3BBFA 1Q0PA 5JC8A 4B9SA 3D0HE 3EVCA 1QGYA 4QC2A 4NEGA 4PFKA 4C4SA 4O1IA 1ISRA 3P97A 4FYIA 4CM9A 5L7WA 1UXHA 2BABA 3MTJA 1ZJJA 2ACVA 4M9QA 2HCTA 4TPKA 1RU1A 1KY2A 2QYCA 3X1JA 1I5OA 1U5BA 1RB0A 3DZ8A 3SHTA 3CH6A 4AMUA 3P0FA 4Y2YA 1O03A 2Y1XA 2HHAA 2DPXA 1OFUX 4M37A 1D09B 1P6XA 1T3HA 5HMLA 3QY0A 4D4GA 2GK7A 2B4UA 1NK6A 3S2SA 1XN1A 5IXYA 2CJKA 1Y00A 2E9RX 4PAQA 2EFOA 5M2PA 4Z8YA 4QWCA 5SV2A 1QOZA 1ZK0A 3TGLA 4FDTA 5F41A 1NOKA 3ENNA 2IAJA 1EWVA 5DGXA 4E21A 3UOAB 1MJGM 4KYUA 4BNGA 3DFEA 1PS8A 4KQMA 3E4CA 1NJ8A 1NXVA 1Q1GA 3ZV5A 2ZXUA 1TUIA 4I36A 1KK3A 1MIHA 3CUEF 3P8ZA 1W2GA 4LQDA 4KODA 5CNJA 1K5PA 5BN1A 5BVGB 4AS2A 2OGSA 4F4AA 4BCCA 3JSYA 1KAMA 4ZVPB 2O20A 3U60B 2H5JB 1P8JA 5A7HA 3KEQA 4R9UC 3CDAA 4W8HA 5IC4B 2FP3A 4TXHA 2UUWA 5EGSA 1W4AA 1XPRA 1E6EA 3RF7A 3MUEA 4NZ9A 2WVAA 4CLEA 1EP2B 2X3DA 2XB8A 5HKLA 3T61A 3TLBA 2HFZA 1M5TA 1JH9A 1BMDA 4XK8C 4QYIB 4PYAA 3CRZA 2MLYA 3ED5A 4F8JA 3QHPA 1MC4A 4P80A 4PXCA 5EPOA 3CX3A 3CRVA 4RETA 1P8GA 2PBRA 2X9VA 3N0XA 2DT5A 1FLDA 1X0VA 1Z8HA 3ICOA 5CEFA 1X4EA 1K98A 2BIFA 2PX8A 1F9EA 3TSYA 3CC8A 3FJYA 4KGZA 4ZO7A 4EFKA 5I01A 4MYSA 3QO9B 1P6TA 2C3OA 1N2CE 2KFNA 3SC6A 1L7QA 4JVLA 4OKNA 2BRUC 3N39C 2JFWA 4UXHA 5FH9A 2CCJA 4PBSA 4LC0A 4L51A 3VR4D 2LXUA 3EIXA 3IIKA 1GNSA 4IQ0A 2BR4A 1XYYA 2V8VA 1DEXA 1SOWA 3EW9A 3JZFA 4K6KA 5DNVA 3JAMY 1JP7A 5B3LA 1I4DD 2O0LA 2JIQA 1C7FA 2RQKA 1NF8A 3D7SB 4I2QB 1T4MA 2GKOA 2GBCA 1WCWA 3CWJA 2E55A 2QW1A 3AEZA 5THWA 1LX7A 1CEYA 1T2FA 1KMMA 1UVMA 4MP8A 2D4AA 4KPUB 4F04A 4HVCA 2WPNA 1Q86T 5SZJA 1PGZA 2P2CB 3V00A 2SKEA 4KSYA 1TL1A 1ZITA 5CH8A 3G13A 1H0SA 1A5BB 2D62A 1SEPA 4Q4AB 4HAOA 3LP5A 2Z95A 1HORA 1P4AA 3IP1A 1UAWA 5C1IA 1SUCA 1JQ5A 2GCOA 3IUEA 4Q4CA 3TTSA 4OHCA 4JX8A 2MR5A 1Q2UA 3WQPA 1WB6A 4L78A 3A3NB 2QRNA 2XM3A 5KTNA 2DECA 4PRFA 3NG8A 4RVNA 3ZBPA 4YUYA 4RJ2A 3VNQA 1KKMA 4ND4A 1EWTA 2V7QD 2KHCA 1K0UA 2IJGX 4LBIA 3FTFA 4X6XA 2PZMA 1H8HA 5EPEA 4GYJA 3Q3HA 5LA6A 2Z5FA 3VR0A 3KXLA 4FXOA 5JSFA 3OLVA 2JGAA 1RHMB 2ZULA 4D0GA 1FDIA 3FUXA 4CT9A 3KSMA 4CHTA 2DNHA 1K0TA 4MIOA 4EVQA 3V4LA 3EGWB 1E2IA 1T3NA 1Q1EA 5J2UA 4URYR 2ZE5A 5L3SB 1NV9A 4C0SA 1RADA 5HIIA 2ZVIA 1P0PA 3DDSA 4G5GA 4JLWA 5IKMA 3UV3A 3ILOA 1W1IA 1E99A 4NRDA 1FA0A 5JHHB 4D98A 1DP4A 3RC1A 2YQ0A 1URPA 3W5BA 2LDYA 2BKAA 4LJ7A 4D8WA 2VF2A 3IBCB 1HT2E 3D64A 4YEDA 2GD0A 3GEBA 4DQQA 1EXMA 4G5HA 4U2GA 1I7LA 4L6IA 5FAXA 4LJ5A 1FX4A 2IY8A 1E9VA 4DQDA 3BX1A 4L15A 1EIYB 3ODPA 4WRRA 1UFRA 1QLHA 3OEYA 1N4DA 3DL2A 2HFNA 2HXGA 2CZQA 3BDVA 3K31A 1I2AA 4CCHA 2HHJA 4EY7A 1NBME 3LMKA 2ZDOA 5B36A 3ZG6A 3GJQA 5EEHA 2V5HG 3FKBA 5E3PA 2XVMA 4I46A 16PKA 4EQ6B 3OD2A 4KI7A 3WLQA 4WBNF 1N2BA 1RISA 3HYCA 3ITNA 3DNMA 4S04A 3MBKA 3MGAA 1Q82T 3BO4A 4MFBB 3QWHA 1RWWB 3CIMA 1MN7A 3QPBA 2WTEA 4X60A 2H2AA 5BW4A 3U1LA 5FNVB 3OQBA 1JXVA 3SDEB 3EXAA 1OSCA 2VG5B 2K3IA 3L8FA 4QARA 4X4NA 1KI6B 3RC3A 2MMGA 4K6MA 4B6PA 4JHXA 3N28A 3DBIA 4X1OA 3ZZUA 5CDHA 5JO0A 3QAEA 4MWZA 2LKDA 1U9ZA 3GBSA 3GCXP 3JD2A 3PDWA 5HZGA 1OU0A 3JSBA 4FHCA 1T5SA 5FDLB 1HNIB 1OPZA 2AX0A 5DZ7A 2VN8A 1NKEA 2WTAA 4HXEB 4DJTA 2ZUUA 3GDFA 4E70A 1MJHA 1SBZA 4M2LA 3LKVA 1YR3A 5IFKA 3OLWA 1HI0P 5ENZA 4NZMA 4QCLA 3QENA 4AX8A 3TDNA 4JT9A 2NO4A 1KQPA 1PT9A 3M2UB 1VPVA 2FKAA 1FUIA 5DGCA 1PWEA 4BFYA 5JNTA 3VPGA 4DC9A 4R1QA 2MSLA 4TTJA 1T9VA 3R6GB 3IVMA 4PQEA 2C57A 3MNFA 4XQEA 3FHLA 1Q92A 3DTYA 1WEZA 2XYPB 5LD2C 1R6XA 4TV8F 3FWKA 2VYVA 1A7GE 2O1WA 2RQMA 4U9UA 2XS7A 1KBOA 2BE7D 2WDPA 3HK2A 3W1VA 3BQNB 3FR8A 4DVJA 2QN7A 2AW0A 3UHPA 1PBTA 3AFHA 3MCWA 3VAKA 4HAVA 1GGMA 3N2EA 4YP6A 3QPCA 2MSNA 3TI0A 2XS5A 1E94E 1VYHA 2RE8A 1ZD8A 4JI0J 3M30B 4BBPA 4B6JA 4PUOB 1G8YA 1WLSA 4TU9A 1I3MA 2XXJA 5E9AA 2GEDA 4JYPA 2PEBA 3RYLA 4Y6OA 1HM5A 2I5JB 1MBZA 2ZYHA 3COJA 1XZFA 1J06A 1B1CA 1HQCA 5CFQA 3FYHA 3I9LA 4R9VA 4F4FA 3ZX5A 4AKGA 1MX1A 1UBGA 2YDXA 4U39A 1EAYC 4HVZA 3G2JA 5B5SA 2PT6A 4UZFA 3MM5A 1OI7A 1M5RA 3PDJA 3U1NA 4OHKA 2R8XA 2BCEA 3GL9A 4C7BA 2XRYA 1RJWA 2LE0A 3HJTA 3TBKA 2WUWE 4O4LF 3WNBA 2XB4A 1GZHB 3ERCA 1Z2EA 5HL7Q 2VXBA 4JDPA 2WSMA 2HRRA 4UUOA 3DYAA 1Y6JA 5JQGB 2I8AA 1QQTA 2LU2A 4CMIA 1NK0A 1VG1A 1O51A 1YQEA 3ST7A 1QVZA 3LTNC 3LT0A 3FEXB 4LF2A 4JELA 2B6AB 3ADKA 3OPVA 4Z7JA 4LFBB 1DU4A 3W2WB 3RVKA 3PFHA 2I3GA 3AYZB 1BVHA 2JVJA 5ALMA 4ZZ0A 4IDHA 3HDSA 1U2GA 3RYHB 4YHHJ 1TK2A 3T1HB 2PL5A 1AZSC 2KB0A 1L6RA 3T1YJ 5IKOA 3DKIA 4B3RB 1K44A 3EZ9A 1DGQA 3TUJC 1K7YA 4KK3A 3OFGA 3KOOA 1XMQB 1VHJA 4D9GA 1M8JA 3WB0A 4PQYA 1R16A 3UCXA 2M6SA 2YHSA 4J9KA 2IPAB 2XOKA 5JXHA 3ZJVA 2WM3A 2CVFA 4RZXA 3COWA 3RVDA 5HZHA 2DRDA 1UOOA 3ZD6A 3KJQB 4L02A 1WMBA 1UVIA 3M1VA 4MVJG 4PLWA 4M5IA 3F3YA 1G6BA 2QTNA 5AXDA 5F1KA 2PGJA 3U4QB 8ADHA 3PQ4A 3I9ZA 1JJVA 4PPZA 2VPWA 3KOMA 1E5QA 2BZ2A 2N3ZA 2PKXA 3EG9B 5DYGA 4MYDA 2QS9A 1HQ2A 2QT9A 3KHKA 2JLWA 3NHRA 4C7VA 1RVV1 1NW3A 5KTKA 3PJDA 2APOA 3M2RB 5JWHA 3N86A 2X9NA 3OMXA 1T03B 3DOMA 2R3SA 3OZDA 3CZ4A 4GT1A 1KDPA 1IIBA 1G4AE 3PUKA 2VAPA 4ZK6A 4J0QA 2R00C 1TKTA 2QKYA 4YLEA 1NP6A 3ZWQA 5KSOA 3HBLA 1I1HA 1Y9ZA 5JWOA 1IATA 3HBMA 1USGA 2HCBA 2X3YA 4TS1A 1KSGA 4BV3A 4OSEA 1YI2S 3H1EA 2OILA 2KE5A 1X39A 1ZJ6A 5KFTA 4JI2F 4YIKA 2Q43A 2H5IA 2A67A 1L3SA 3JTMA 4FHFA 1NLUA 1KVUA 3N7TA 1W1WA 2U1AA 3IP6A 5TPWB 3FOEC 4N65A 2LTAA 2H2WA 3D31A 5DYYA 3ID6C 5EMNA 5KTOA 4CV2A 1UR5A 4E1BA 1CCWA 1WTBA 3QMWA 4YRFA 4C7MA 5JYEA 2P6OA 1KJQA 2EL9A 3SC3A 2HEKA 1WCIB 1FUEA 4BLSA 1UINA 4Z0HO 1GL9B 1N0HA 2EWMA 4NH4A 3KSDO 5KG7A 1S2NA 1A2KC 1HKHA 2JHEA 4QYZK 1ITZA 1K8ZB 2Z1MA 2QG6A 5IC4A 3D8TA 2IK8A 4FE7A 3L0SA 1RLOA 1T9HA 4BUJA 2QTGA 1H5NA 1M2WA 1D0SA 2PT0A 1XEWX 1G9SA 2J5XA 3VPFA 4F4YA 3H3XA 3WGVA 5AXBA 1L5ZA 4LRXA 4DA8A 1WZIA 3HKDB 4FBLA 2F90A 2P2LA 3E9RA 3TTXA 2CJYA 1LNZA 3WWZA 5FQNA 2WYHA 1TCCA 1EQUA 5AK4A 3VDXA 5AM2A 3ESZA 3DL7A 4EW6A 1GRQA 4RXMA 2V3CC 3T3NA 1V6HA 1JLAB 2ZJQQ 4LI3X 4MCHA 1ATIA 3ZDYB 3JAKA 4IIVA 1JFTA 5A3JA 3FTQA 1NVTA 1Y0HA 1QV6A 3C1TA 5TS2A 1Y4ZB 1BXRA 4H60A 2ZWMA 2CPXA 1CX9B 1ST2A 1S8NA 3LVFO 5JEDA 4PPFA 4IX1A 2JGMA 4Z2YA 1K0VA 1GKYA 1Q5YA 5MGBA 2FSGA 1KDZA 2KLHA 4FNOA 4CLHA 4O4JA 1U3UA 2HK9A 4DR5J 2XDWA 1VIMA 4EJMA 2VG6A 4FJ0A 4OIFA 3VVTA 4PO3X 3UH0A 4LDZA 2EGUA 2IRWA 1VC6A 4PF1A 3GVHA 3M6AA 1CYDA 4MMYB 2G70A 4E51A 3PPIA 1GUZA 4LWPA 3TUPA 4YDDB 2YJTD 1OW3B 3D7SA 2IMOA 4MRSA 5AM5A 2LCWA 3KFVA 3QLJA 1Q1ZA 8AT1B 3MLBA 5FDFA 2BKOA 2HRDA 4KYVA 3DHVA 1JB9A 4E5MA 3KXDA 4F4WA 3DFKA 2C54A 3BCSA 2ZDHA 3KB2A 1HLDA 2AI2A 2NIPA 4XX0B 1S89A 3Q88A 5EXPA 4G01B 5DLQC 1X9WA 2IYGA 3FBCA 2IYAA 4Q4AA 5AXAA 3MAJA 4NZYA 4LBPA 1V9SA 1T02A 4OHZA 5ED4A 4DS3A 2UXBB 3WQBA 2LR0A 1X1RA 4HVTA 1N5QA 1E5TA 4W7HA 5D77A 2Q4DA 1AA6A 4Q2MA 3SDSA 1HZZA 2AU0A 4ZEWA 3DKPA 2FN4A 3L4BC 5JXGA 2W4CA 4CT0A 4B6SA 1E2BA 2XYGB 3TW8A 3VU8A 1T9DA 2O5CA 3TQCA 1F5NA 2QB5A 5A5DA 4EBEA 4TY9A 2FK7A 4XUEA 2LXIA 3ILYA 5EZQA 3UN5A 2ILYA 3JR3A 4MYRA 1UJNA 2VLBA 1G3OA 3B60A 4UVDA 2WF9A 2K1RB 2EJWA 1SXJB 4RV4A 1EFLA 1SUIA 5EYPB 4EGCB 4V3CA 4OGKA 4TYWA 1L3CA 3HGQA 3QY9A 4UATA 2XV1A 2UDPA 3DOEA 1DLOB 2LP4A 4UM9B 3CEDA 2QRJA 3F1LA 4XIYA 2XT9A 2N4CA 3WOVA 1WHXA 1Z63A 3ZQUA 2AKWB 1H72C 5HBMA 4UEKA 2XMKA 3HCEA 5ETSA 3DPSA 2V7QA 1W75A 3SJCA 1HW8A 4HZIA 2AFIA 2YCLA 2G9NA 3GUVA 3ZHOA 2D74B 1M5PC 3E7PA 2R86A 3O1HB 2KRBA 4Y0AA 4YOEA 4WZQA 3O7MA 1Q7RA 4RGYA 2HRBA 3B12A 2WJZB 4MWGA 2JEFA 1XP5A 4U8GA 5JNRA 1JLHA 4KNWA 2HQRA 1U8CB 1A1SA 3J81k 2Q4TA 3IJPA 2PL9A 3TM4A 5AH0A 1K7FB 1FU7A 4PHFA 3HA5A 5DETA 3RTEA 4IOMA 1QHSA 1WELA 1OXMA 3OJWA 4Q2LA 1PHPA 4K26A 2SECE 4BBYA 1XJCA 4IIYA 3ZE9A 2HQ3A 5AJYA 2D6FA 2JI4A 3L82B 1GMUA 1RUSA 4R3UC 2HIYA 2WSFC 4OV1A 4DV2B 1B93A 3QGMA 4X95A 4IUFA 2ADBA 2EHJA 2WAYA 4KPGA 2Y1DA 1NTOA 2G7MC 2J33A 2R6ZA 4NLYA 3LUPA 1T1JA 4RWWA 1NZ8A 3D3NA 1EJ7L 1VRQC 4DR4J 3EVZA 1EWYA 1QGZA 1FPMA 3W34A 2JD0A 4XD7D 4EQ6A 1RP7A 1MWQA 3TQEA 1ZGBA 1PUIA 4B8WA 1UL1X 3NBMA 1GT8A 2H7YA 4JASB 4XM2A 5M34A 3QELA 2H4HA 3HD1A 2C9OA 3QUTA 1EBUA 1N34J 2QJWA 1EKSA 2DBZA 5EWLA 1T6NA 3DD5A 3JQDA 4G1EB 2O59A 1F0KA 2VPPA 3O0DA 5EUCA 4KQHA 4LFAB 3KTAB 3D1LA 4B34A 4FDUA 3JAMA 2O1PA 3QU4A 1S3GA 5DSZA 2X8BA 4YRRA 1ZVMA 4M7OA 3E35A 3B48A 3OZGA 4UEOA 3QEMB 5HVGA 4BFXA 2H18A 3DR3A 1UKBA 2HQCA 3V6LA 4F2PA 1EFVB 3KEGA 4YFUA 3EWAA 4J4BA 1LPOA 2BGNA 1NV8A 4C30A 1Y42X 3BSOA 2I4LA 3M9LA 4MRRA 1TCVA 2JFOA 3D3KA 3ZQKA 1F3VA 1IB6A 4QELA 1UFQA 4RUCA 4D6XA 3ZNOA 2H1IA 4P10A 3EWGA 3DULA 4RWXA 3M2UA 4DUYB 4IQXA 1QO7A 1GZUA 3NTRA 1GSIA 4KXLA 3L07A 1E61A 2R2AA 2FZVA 1S99A 3FPCA 2P41A 3NORA 4FHZA 4R9SA 2Z09A 4D3SA 4JLAA 5CVUA 3OETA 1QSYA 3SZ2A 2FN7A 2XYPA 4KQFA 4N03A 3ZKWB 4KPEC 4CVNA 2JAPA 3TSCA 5F8LA 4I4TA 5TJHA 1QE0A 1JLEB 3ED1A 4NYOA 2XMAA 2IC3B 4XSGA 2IL1A 1LEOA 3WAGA 1ZN8A 1SBQA 3SEFA 3O93A 1TK3A 3OZ7A 2BI4A 1GCAA 3MYYA 4FYYB 3GXBA 1N6QA 4QX6A 1OQ6A 2EKYA 2V4JB 2RU9A 1LVGA 1RRFA 2PD6A 2BUCA 1EDEA 2OKCA 3TRFA 2FEXA 1J8FA 3QOFA 1NATA 1NULA 1Q6ZA 2OCKA 3DTTA 1KI2A 2DNMA 1NG1A 2XUFA 3UI3A 3IXQA 2AJDA 3IOBA 1YCDA 2XMWA 3NAIA 1ZX1A 5I5EA 1R4NA 1NO8A 3NX4A 4J2HA 3FGVA 5CFNA 2ZM5A 4HGYA 2PMHA 4CV3A 5DHSA 2BE7A 4QM6A 2QX6A 1IB0A 2W6QA 3C8ZA 4HKTA 1E5LA 2ERYA 3AUFA 4FDVA 1H65A 4ZA2A 4DUGD 4PC1A 1OZAA 1X2BA 1M0SA 1QR6A 1RQ0A 1ESEA 1Y5NB 1S8AA 3UFCX 2HWUA 4ECTA 2VTVA 4Q6BA 1FY2A 4CM5A 4BO9A 4BQSA 1PFYA 2WNSA 2HHSA 3PJXA 4HY3A 5BNIA 4LV5B 1RKQA 2IRXA 3R7NA 3LLVA 4DIMA 1UH5A 4FW9A 1PWHA 4P3PA 3X0DA 5KOIA 3VCDA 2NO5A 3MS7A 2I33A 5K8CA 1TKXA 2B6AA 4CM2A 1XDZA 2IPOB 3V7NA 2E48A 1ZA1A 1RWXA 4WNIA 5CB4F 3UHAA 1HO3A 3R44A 2DPYA 3SSAA 4DLPA 5AM4A 2XXBA 4BFUA 1SD1A 3ZH2A 2FUKA 2HHHF 5CYQA 4PHGA 5I5GA 2UUAF 5DTEA 2ISCA 1I33A 2VYND 1FSZA 1VB3A 1M1NA 2QW0X 2NMVA 2YHUA 4TYMA 3REGA 1K5HA 3AIMA 2B2NA 5AVKA 4L27A 4EQZA 2D00A 3D3QA 2FJEB 4EG5A 1UETA 4R1NA 4I1IA 1ZMRA 2EKPA 2YJ3A 3VV2A 2BFWA 2RGUA 1I30A 2BF7A 1KQKA 1DKRA 4DPOA 2CW5A 3AGQA 5K2OA 1JHOA 1FD2A 5TPZA 2YTCA 3AFNA 1FE0A 4FDMA 4B3TF 3ZV6A 4QU5A 4X4SA 5DLYA 3BBLA 4MRPA 4G81A 4RJVA 3K32A 1UEUA 4MVJM 4X94A 4HDRA 2ADOA 1JJ4A 4XYMA 5LQMA 3DMFA 5AI4A 3C6ZA 3GLIA 2V5VA 3NYWA 2MKKA 1UWBA 1ESDA 1DJLA 1MDFA 2QFIA 1X13A 2Y1EA 4NCGB 1U3WA 4AJIA 1HHQA 1RTTA 3EMKA 4KMRA 2B69A 3A9TA 2C9CA 1E3MA 3CJRA 3F98A 2VUHB 2AZDA 2QUHA 2YHIA 1I3CA 4BFWA 2EEZA 1G8SA 1KO1A 3A3OA 4DADA 4S1PA 3R6LA 1UPTA 5ICEA 3A0RB 4JI7J 4R8VA 1PJRA 4HYEA 3VSCA 4LYAA 3G2QA 3UO8B 3WJ1A 2OHIA 2JHPA 2CMFA 2YR0A 1RS0A 4LZLA 2JSXA 3QIVA 5B30A 1NBEA 1VJGA 1E2QA 4EJSA 3WICA 1GR1A 4DZZA 4NJMB 4Q3KA 3WAJA 1HWYA 3IDAA 2SXLA 3LJKA 1XLTC 1PW5A 3MELA 4F26A 1I51A 4NXNB 1NBHA 2XHCA 5EWMA 1RT7B 1PJ5A 2L17A 2XO7A 3W5YA 5HRAA 4XPEA 1H05A 2QF7A 2DT8A 4KC5A 1TCBA 2OPPB 1DPFA 1BHJA 4Y2QA 3O94A 2BZSA 4OV6B 4CMAA 4RY8A 2HIMA 3CS3A 1ULHA 4OPMA 4OJYA 3UCFA 3W5XA 4HTFA 4IHJB 1LW0A 2WWTA 3IIJA 2N4DA 2VNKA 3LUHA 4TT8A 4ZN6A 2IDLA 4QWWA 5IYZB 4LC9A 3K8VA 4CDIA 1AY0A 1L7AA 4CH0S 3OWHA 1P7ZA 4ARBA 3LUGA 1RI1A 4K1XA 2ZS8A 3CR3C 2ALJA 4I55B 5E4JA 3AZPA 1TIKA 1VKRA 2ZH4A 4M1YA 1Y3DE 3JZAA 1YK0A 2DHSA 4HEA9 2CUTA 1X5TA 2FUNB 4RSHA 3GBVA 2P3LA 4IKPA 4OYMA 5LL6d 1RDRA 3D4LA 1VRVA 3K5NA 1GDDA 3WWPA 2FZ4A 2B2CA 4CLUA 1QJCA 2ZM6B 2YXEA 3UDCA 3HKEA 2WTXA 4RTOA 2HSJA 3VHQA 2Z57A 5LVAA 2RK4A 1RAGA 1VHIA 5B55A 4F7VA 1TC2A 4BPBA 2Z5GA 2LYVA 5IXUA 2GPYA 3DMTC 2XSFA 4CLPA 3OWXA 4R8KA 1XROA 1RACB 1U26A 4X90A 1HX7A 4DL6A 3DM2A 2AMYA 2IU4A 3E5HA 4PAMA 2CMHA 4AQYB 2B1IA 4TS3A 2PKRA 4NLLA 1F9HA 2Z0GA 3G0HA 4B44A 2BKLA 4A36A 1I5OB 1U5BB 3AOEC 3N5KA 1NT2A 1H6DA 1Y7LA 3LC0A 3G0BA 4HGNA 2FGOA 4TX1A 2XCLA 1XWWA 3KHGA 1Z2NX 4D80A 2XUOA 1S2MA 5DP2A 5KEIA 1ORHA 4ZCLA 3TAXA 1YIAA 4IQMA 3DF7A 4GKJF 3E8OA 4DDFA 4YP9A 2IAJB 2OFXA 2B8PA 3I45A 4IEIA 4Y2VA 1WCXA 1X14A 3PU6A 3T1TA 3PWSA 4X8MA 1GPDG 5JV5A 1QUVA 4OYHA 4WXPA 4TLDA 3P4XA 1VPLA 1VQMS 5SZIA 2PXAA 4A1FA 1ZI9A 3W90A 1FERA 3Q24A 4NI5A 1WTAA 4OMUA 2X0KA 4EB8A 4UHCA 5A0TA 4WVFA 2I1RA 3SS8A 1Z6ZA 4RZ2A 3A4LA 3WDMA 1MX9A 3ZXIA 3N9UC 2VASA 3P71T 2FJUA 3PCXA 1RC0A 3U4HA 4RIHA 3ZHVA 1ML4A 3QG1A 3F8TA 1T36B 1MMNA 2FJXA 1YZLA 4C6HA 2J6SA 4BO3A 1BWVA 3A12A 4ZQIA 3LF1A 1OFGA 5CFMA 4DMKA 1A6LA 4GC7A 2A84A 3AF0A 5RUBA 3L0BA 4LVCA 1WKCA 1V45E 4R1TA 1OWPA 1ABBA 2UZIR 4N39A 4I66A 1V4VA 1JQKA 5DGHA 2PE5A 3EICA 1L8LA 3X44A 1QTRA 2ZYDA 3K17A 1LZLA 1F9EB 1G2EA 3CW9A 4LI0A 1X94A 1D6MA 4YTEA 4DFMA 4ZN3A 2WQ6A 3C7CB 3NBPA 1J2YA 1S2DA 4C0OC 1KDOA 4JY7A 2I80A 1NJFA 2VPQA 4HJXA 5K0CA 3AF2A 2H2FA 3W5DA 3O8WA 3P9NA 4QPJC 1RMTA 3G5TA 2HSDA 1M6VB 5F3DA 4DY4A 3W8DA 1OV6A 3T8YA 2Q6BA 2VZLA 4YP7A 3I0NA 2W9XA 4E07A 1WC3A 3N3AC 2PAAA 2PVCA 5CR9A 4A2CA 3ZY4A 2YQ1A 3TM5A 1KAOA 3F6YA 4BATA 2GFQA 4CLSA 1XPOA 5CXUA 1OA1A 4DM3A 3FCSB 3O4VA 4F04B 3TIXB 1SB9A 4XKJA 4QTUB 1WUTA 2FOXA 5K9ZA 1TL1B 2DKOA 4C98A 3K2YA 1UBNA 4H77A 4OP3A 1T1GA 4MMZB 5ALJA 1UFKA 4Z2AA 3HJFA 4O4LA 1RCUA 5IEJA 1QFXA 4RBVA 2IVZA 3OL9A 4U7HA 3QIDA 4XD7A 1OH6A 2Q1YA 4CPDA 4CCSA 5ILGA 2P9TA 2WRZA 4YQWA 1SELA 1TM4E 2BMDA 5KU1A 2GCOB 4MWSA 2P9FA 4U1RA 1DSSG 2E5WA 3RSZA 3HZHA 4JOCA 4IGIA 2W48A 3P9IA 2GQ2A 3HS3A 2OECA 4WFKA 2FWIA 4B7ZA 2WTUA 4ED6A 5CXTA 2CQGA 1FJHA 1XNQB 3T4UA 2BEUB 1RJDA 1A8HA 2G13A 3O90A 4XPCA 1R43A 3PHGA 4M0FA 1F6WA 2EZ9A 3I6YA 5M7EA 1CD5A 1NW4A 1XNRF 2PGCA 4K2AA 3KSBC 1G4HA 2HADA 4ACBA 2VRCD 4HAWA 1IHUA 4ZPTR 4LZJA 2XCAA 1V7QA 3PQ6A 5CDFE 4OD0A 1PE0A 1PG2A 2WAQD 2RQ4A 1JGTA 4ESVA 3R6WA 4RVDA 2IDMA 3ZDCA 4P58A 3QKSA 5KYWA 5J2UB 4BY9E 1I6MA 4S2EA 5CT5A 4DR6J 5G0TA 2LQBA 4LR9A 1RADB 5FOUA 5SUHA 4ITRC 3MEKA 3KOUA 1SIOA 1CZNA 4U2BA 4BP9A 1GG9A 4M5JA 3LA0A 5KOYA 2H8KA 4U00A 4WWHA 3BSSA 3M81A 4LVNA 4OX6A 3W2FA 1XLVA 4A0QA 2VOPA 3T54A 1ZA2B 4A8JA 3LCJA 3WV4A 2PZLA 3U4IA 4F3MA 4Q4LA 3POTA 4V0MA 1XWLA 4XVCA 3F9RA 3DP9A 4E2WA 2ZBPA 3KHUA 3G1UA 2A86A 1HNZB 1OAAA 5T8KA 4LJ6A 3NHAA 4R05A 3HUEA 2HMWA 1Y5NA 2BOVA 4YB7A 2IZ0A 4RGQA 3DRYA 3B3QA 1VG0B 3W5AA 3S40A 2O48X 2DITA 1QVFR 1M8FA 2VP6A 3I37X 4RUBA 3HCPA 1Z3IX 1Y1RA 1CY8A 3VOAA 4ZYZA 1I94B 4GRDA 2PRYA 2AMFA 1P2FA 3TMAA 1QG6A 4KW7A 2I03A 3QRWA 3E8SA 5CGZA 3W5HA 1IBLJ 1H4VB 5LU9A 1S10A 4LSNA 1VIAA 2VDUE 3Q86A 2AQHA 1GKKA 2LUOA 1DJNA 1KAEA 2H1HA 3DCNA 5CA1A 2X7IA 1WEXA 4DUGA 2CNWA 4ZOEA 2DGXA 3W3AH 1SUBA 1NY5A 3M4NA 1Z07A 4GLJA 3DAPA 1MW8X 2BGWA 5DF1A 3V2GA 4JBXA 4YRQA 2H48A 4MA0A 2ZW9A 3CZMA 2VQEB 2XVAA 3LS2A 2L3MA 5ELXA 1CY4A 2ZJYA 2ESRA 1QHNA 5M5BA 1RKUA 2ZJ6A 4OAPA 5F8JA 2FR1A 3HZZA 5HJEA 1OT3A 1G5IA 1OZHA 3AR8A 2FGJA 3H18A 4RHUA 5JXSA 1YQGA 3QUQA 4RVGA 4BNUA 2OZPA 3U19A 3ACDA 2RJ3A 4C08A 1II0A 3IB3A 3PEHA 1V3RA 2I7DA 1BGVA 1QHXA 2XQKA 1DAOA 2OHDA 1SUWA 4L5CA 2B6NA 3DLPX 4FF3A 2VYNA 3RKUA 2WPDA 1R7RA 3AVTA 3F3MA 2CE2X 3M3HA 3WDOA 5BV2P 2V6FA 1MWZA 4M5HA 1JW9B 2Z6VA 3FK4A 1K8YB 3WV5A 3NGUA 3KETA 2AJ8A 1NQUA 1G2PA 3IMCA 3FCAA 4WP8A 2FGKA 5B53A 5K45A 2HI0A 2Q9BA 7AT1B 3GLFE 2P2NA 2OCGA 3LLMA 2GILA 5E4TA 4LY0A 3P5BA 1IQZA 1KLNA 1PI3A 3HBJA 4HFMA 3M3PA 3RIYA 3ICCA 1J0XO 2UUBB 1SQEA 2W2TA 1OPIA 1NK7A 3FM9A 4GBED 2FLLA 4ALKA 2XUAA 4RA6A 3HO6A 1U7ZA 4K2JA 3H19A 5BRJA 2XMPA 4B9TA 2CRLA 3K5LA 3WKEA 4DL5A 4QAJA 3NWJA 1P45A 1H2ZA 1ZXXA 4EO4A 3MM5B 4QWDA 4GFDA 3TAPA 1UBJS 5CHEA 2GJ9A 4EO6A 2Q07A 3GPLA 5B2FA 1RT6B 1Z68A 5KVQA 1RAHA 3H1FA 4FZ3A 5F4BA 4BMXA 3DYAB 1L3KA 5I3QA 4UDXX 2XOKD 3U16A 3EC1A 4CMIB 4I1PA 4XWWA 3S1LA 1BHQ1 1SL1A 4U2EA 4IIUA 4BO0A 2ZDPA 1IQ0A 5KNBD 5HF6A 2BYTA 2OP0A 3CSDA 3RR2A 1YDMA 3AOAA 4C3UA 1KEKA 5REQB 5AXNA 3RCBA 3NRBA 1K2WA 3LGHA 1GRVA 1K75A 4X4VA 4JI3F 1GPJA 2Q0SA 1G20E 4YB8A 5JCJD 5H4HA 3MPDA 3B3JA 1B6GA 4RU9A 1GUDA 1JKIA 2HREA 5BRNA 2I2AA 3NVMB 4DI6A 3MN1A 1US8A 3NHYA 2JATA 3M1VB 2PSFA 2B21A 4NFLA 1C81A 3DZIA 2FHMA 3GA5A 4YJ3F 2D1FA 1ZVQA 2OCIA 2VPWB 3H2KA 4PPGA 2ZUAA 4ODIA 2ZH3A 4CMJA 3BO2A 3GQCA 3MJVA 1YR6A 3RUIA 2D9PA 1ZGJA 3RWOA 3GLJA 2KT5A 2QRHA 5KYNA 3R5KA 3CW2A 4NYMQ 1GXSA 1P8AA 3QFHA 3O8QA 3TL2A 1RWOA 1P0IA 4EPWA 3DOMB 4TQRA 3CR7A 2PQ0A 4I1RA 4FILA 5KDLA 5BV8A 3GFGA 1O5IA 3OZEA 3VNRA 3QF4A 3F4BA 2EZ4A 1DRUA 4MQEA 3IGNA 2JEOA 5FUQA 4QJVA 1YFJA 4YCLA 1DIAA 1TKTB 3LC1O 1KA9H 4NBUA 5BWOA 2VR1A 1B3RA 5EAIA 4PINA 1XJQA 4CYUA 2IYYA 4PLFA 8LDHA 4PS1A 3HADA 4AJEA 4B4KA 4L4XA 3VGSA 1PJ6A 1SI9A 2NTYC 2VAMA 2WJWA 1LEHA 4BNXA 5I6DA 5D51S 3EVWA 4A4DA 2H5IB 5KVAA 3L3BA 4ZQGA 4LF4J 2CHGA 1FXRA 4GSKA 3GHYA 1THTA 4N6OA 1YR2A 1MB2A 4ZCIA 4ND1A 2GERA 5L4NA 2GA9A 4B3IA 1JHAA 3A9SA 3BQ2A 5GAEU 2P5UA 2G72A 3W7VA 3RJ5A 1C3OA 5LDHA 2HRZA 1JZSA 2WIBA 4RDHA 2DR6A 1IQUA 1CUJA 4QXMA 4USHA 3PPXA 5AK6A 1MH1A 2VH5R 2GA7A 3LX8A 4GI5A 1Y4AE 2IITA 5ED0A 3V4SA 4R71A 5CDYA 3S6EA 5KKAA 3F56A 1IPFA 2DT9A 1AXRA 2XA1A 1VE7A 4I5DA 4BP3A 5J4YA 3MJ4A 3C14C 3BPSP 1T36A 1JDBC 3WAKA 4X4QA 2QV6A 2G77B 1FP1D 4UAUA 5DXJA 1N32F 3G9QA 4RC9A 4N76A 5CNKA 1RTDA 4P98A 3QKIA 2CJYB 3R77A 4WW0A 1MW9X 1Q74A 3FEZA 2AZTA 3N70A 3NPAA 3ZZMA 2G4LA 4NMLA 4U7GA 5BURA 3I4CA 4OKSA 3E15A 3KJGA 4K3UA 5EFOA 2NYRA 3O83A 2V6JA 1RZMA 4JEHA 2FPRA 5JSYA 3CTMA 2KYZA 3SDZA 1B7FA 4EKIA 3JAKB 4EYOA 4PN3A 4DNFA 2MSKA 3ABRB 4JN6B 4NA1A 1JNXX 1H0RA 5J59A 1YZKA 1BXRB 1PRYA 4NXMB 3USCS 121PA 1MOPA 4QIGA 4GI2A 3S8YA 4IR9A 3I9NA 4WLVA 3UV7A 4FGUA 1FSSA 2PMWA 2QY9A 4ZHQF 3GY0A 4O4JB 3OPKA 2FRXA 3CJ8A 4L50A 2NYHA 1WHTA 1CVLA 2VG6B 4EABA 5ALGA 1M6VA 2HFOA 1XGKA 2R5FA 3HE3A 4MYHA 1U31A 4C0JA 2A1UA 4USKA 1YULA 3EJ6A 4W9RA 4EHKA 4ALLA 2GTPA 2F1FA 1MO6A 3N8KA 4EKYA 1YD7A 2BA9A 2HS0A 2AOWA 5A2QU 2W2KB 2CPIA 4GSLA 1TKRA 3N0TA 4ALMA 5LQDA 4F60A 5BV1A 3ZVLA 4ZJOA 2DSNA 3UAWA 4OLAA 3F6EX 2V96A 1E3EA 1U90A 4B2IA 1NE7A 4F3TA 4AICA 4U0JA 4ZDNA 1DDOA 5IUKC 2FEWB 1IIRA 1UANA 2PU5A 2XCTB 4HH4A 1SU7A 1D1UA 5I8ZA 4R2JA 5EJAA 2Q4BA 4JBCA 1H7WA 3CH5A 2W4IA 1TYCA 1IVZA 4G23A 3U3ZA 4CG3A 2NVUB 4OYOA 2MU1A 2BEUA 3TW8B 2RAUA 3OJEA 2XYQA 3N76A 5CB4A 3CWQA 3EFBA 2R4UA 3SQOA 4E4YA 3GRKA 5D5PA 1IN1A 4WUTA 1KQGA 1YF3A 3IELA 1OZ0A 4MA4A 1ULBA 3G0IA 3HPQA 5ARCA 1NY6A 3OCZA 1GG5A 4LIRA 2CVZA 3K0KA 4HMPA 1FDRA 1T9XA 4MGKR 3RGIA 4NHOA 4ENPA 3LGSA 3MRTA 2VONA 1SKYB 1KDTA 3J80A 4X64F 3IAAA 2AOXA 5BT8A 4GPZA 2E89A 2B3TA 2W90A 5B0DA 4IOLA 1TECE 5DSXA 3AYXB 3L7AA 1VBMA 4H0CA 2F65A 5HBMB 4QR1A 4GBJA 3RS4A 3NDJA 4GGMX 1OC4A 5FTLA 4DSNA 2AJBA 5KG3A 3L8EA 3QFRA 3IBTA 4DB4A 1EB8A 4NV0A 4G56A 2AFIB 2C3UA 2G0CA 2YINC 2R1VA 3MG9A 4HL6A 4XGRA 1M2VA 2QZSA 2A18A 1W76A 3QLUC 1XAJA 1ZA2A 2VRCA 3TNVA 1IY0A 4UCQA 2OSVA 4HRYA 4DLBA 5LNK1 4I1VA 3VNUA 1OGIA 1N8NA 1OXUA 2NYVA 2OYSA 4FINA 3K8YA 3MGKA 4UTRA 4YJHA 1Z47A 1XNGA 1DV1A 5HUQA 4KIAA 1UADA 5EPUA 2QU7A 5EHIA 3IWXA 4DPMA 4HDSA 2REBA 1Q81T 5DRTA 4RKUC 3BD9A 3MOJB 2OO5A 1J27A 3UENA 1PLJA 3SQNA 1IHYA 1GL7A 1CEQA 1GZSA 5KFVA 5D01A 5IK2D 1RQ2A 3I2FA 1QQ6A 3OE4A 3VOTA 1GKUB 1FDNA 3Q22A 1FXUA 3HR8A 2OP1A 2IH2A 3QELB 1DY3A 3KKKA 3U9LA 3KD2A 5EWLB 1AYEA 2VIHA 3QSGA 3E7FA 4UC0A 4YV0A 4YMGA 5HM6A 1TFRA 3GP5A 2JA1A 1N5MA 2H9YA 2GPWA 1N2IA 3OEHD 3RU2A 2C8KA 4ZAGA 2AN1A 5HBRA 2X3UA 3OLBA 4U2FA 3CKYA 2UXDB 3VM6A 3DM5A 1GQFA 1ACMA 4QYZJ 4TSKA 1RFGE 4YY3B 1G8HA 4RVOA 3V32A 2YV4A 1RU2A 4MRMB 5JFOA 1GPUA 3KVOA 3QPVA 1G8FA 3PIRA 3THSA 2HUNA 1MUUA 2FV8A 4IH4A 5CEJA 2O8DA 4BPRA 4H1UA 2OVFA 2DNKA 5A3RA 3TGWA 2WBMA 2HEGA 3Q2TC 2JCVA 1G38A 2P6SA 1RTJB 4F9FA 3B4MA 4OX9F 2LCIA 4DV5J 1QK4A 2OAGA 2ONCA 1EAYA 8RUCA 5E4YA 1FK8A 1E7RA 4GMDA 2HQ1A 1IZ9A 1ZHOA 1LZKA 2KPOA 3EPJA 3J7Z5 4EPXA 1V3SA 2RB7A 1JL3A 1KK2A 3INTA 1S6QA 4JB3A 4I4TB 2AGQA 3TNFA 1UBRS 4YJFA 4YNBA 1WTFA 2ATXA 3V8RA 1JN0A 3CGGA 1LJUA 1YJNS 4LN1A 1RYHA 1MC8A 1N6QB 2QJRA 4EW2A 1U2RA 5K0NA 1AKYA 2DLNA 2G25A 3H2YA 4X7BA 4DSEA 5KFOA 5E41A 7AT1A 2ZT8A 2QRRA 1QFSA 2QA5A 2F48A 2GBIA 4DQLA 2IYWA 2CLCX 3E6AA 3OZVA 4PPNA 2DFTA 4M1ZA 1H0KA 1QP4A 4V0KA 1XMXA 2CSXA 2F8SA 1JEEA 2M9MA 5AKGA 1R4NB 3UW3A 4D3DA 4QDXA 2QNRA 1MA0A 4KE9A 3BGRA 2I2CA 4Z4FA 1Y7IA 3VC3A 3U02A 1H7XA 1SIUA 2PUEA 2XTMA 3PYDA 4KGXA 4R0MA 5G40A 1NJWA 1M34B 3EVTA 4UVIA 4YYEA 2DPHA 5H9FK 3ZCXA 3BS4A 1RT6A 2AKYA 4HAZA 1I4TD 3IULA 1GTEA 2PTGA 2WUFA 4IFEA 2I6TA 2O2JA 5E0OA 2H4WA 3R7NB 2YH1A 4K4SA 2GHRA 3BGVA 3INYA 3GWGA 1MO3A 1N5OX 4QQKA 2QRVB 3Q0AA 3RSHA 1TKXB 3CD7A 4MWBA 4P84A 5CURA 4H7HA 2GZHA 4BP1A 1ZOSA 1IUNA 2EFVA 1ZA1B 4F5YA 1JYEA 1MAHA 1RWXB 3NNAA 2W2QP 3KFWX 1YB1A 1WSAA 3FDJA 5REQA 1Z83A 1JG7A 1KMQA 5AVRA 5ETNA 5TPZD 1I10A 4ZTZB 4I9NA 2KYRA 1XZLA 2OD9A 4JR1A 4DGQA 3C6XA 3N2LA 4EY4A 1P1BA 3AY6A 4PV7A 5CYQB 4NBVA 3ISNC 4CM7A 3M6WA 1XO1A 1ORIA 4P7FA 4ESHA 3IRWP 2XQFA 4OI1A 1M1NB 3K70C 4WKYA 5KNBA 3CYFA 4Q4DA 4P7GA 5KFBA 3NS7B 2FLNA 2Z98A 3RK4A 2H4ZA 5GMDA 5EWGA 3ZE8A 4PCLA 5ETPA 3VV2B 5IKEA 4UU7A 2JH9A 1JA9A 1LV5A 2V1UA 1UWAA 4PGHA 5DX8A 4IUYA 4X92A 3DE2X 5LZ5A 2EFGA 4QAQA 5JCJA 3IOMA 1CPZA 2XNCA 2R8PA 1D2AA 5F7JA 5IDXA 4OB8A 1KDRA 4IFYA 2D5CA 4KX3A 4HDRB 3DOLA 1C1XA 2HG4A 4WKCA 4UUAA 1G5RA 1R6DA 3GLIB 4OEHA 1MEOA 1UWBB 3GNQA 4JH0A 1KARA 4ZAYA 1CP2A 6ADHA 4GR4A 2A2DA 4G67A 3K15A 4NRTA 1E9CA 3GSDA 2Z8XA 5K8MA 2WG2A 5HSPA 5LIRA 2GK6A 2F9MA 4B3OB 2IYZA 1DO0A 4CDRA 5F23A 2Q3FA 1H6AA 4JI5J 3BCRA 4RKRA 5L3VA 2QX7A 2OB2A 1KI7A 2XMZA 1WLYA 3SAJA 4NQZA 4RM3A 2YHIB 1SUPA 4WLEA 5JZSA 2BC9A 3A3OB 1PZHA 1UKVY 3R6LB 1WAMA 4J1SA 3DAHA 5HDBB 3SJ7A 5CJPA 1L8XA 3RK0A 1U0FA 4AX4A 4ED4A 1UA0A 5B6PA 1TA9A 3GH1A 1GPAA 4O4HF 5L1KA 3BO3A 1NBEB 4EJSB 1RAEA 3TZKA 4A6EA 1NMQA 3U4MA 3IMFA 2QD2A 2FX2A 1WXWA 1DZ5A 1E9FA 1I51B 5LBTA 3OZXA 3TPFA 5AJVB 3O7WA 4OX9Y 4YT5A 5EWMB 3R5AA 4UBNA 4BWGA 4GGOA 4PRZA 2IYQA 1Y6FA 2BKNA 4MVCA 1Y3HA 4ZMRA 1PJ4A 4MV6A 5LYYA 4X62J 3RBEA 5MF6A 3SJBA 1EFPA 3OSPA 4I5EA 3TQIA 4HTFB 1LW0B 1TW3A 4CN8A 1VQ6S 4PYQA 5E3QA 2FPKA 4FNHA 3KRTA 1VCOA 1GSHA 4DNOA 5ER6A 1G55A 1OIWA 2MT9A 4OYBA 4MS1A 2JASA 4YMIA 2VUSA 4UTGA 4V0NA 4KLNA 3M8PA 2IV2X 3LWBA 4OJTA 2Y6VA 3L6OO 2WNHA 1IQPA 5CCLA 1WDMA 1XRJA 3W6UA 4YRIA 3FA2A 3CMAS 5ES3A 4K9OA 3I04A 4LNAA 3GLGB 2ZZMA 1N5KA 1CQXA 2JCSA 5HANA 3P49B 3G3EA 1CRQA 4C8MA 1SB6A 5KX5F 4IJMA 3WLNA 5P8WA 4YAWA 4WX2B 1Z6PA 3QKRA 5L8RC 3AHFA 2RHTA 3SVZA 1IKYB 1I0LA 4ES6A 4FBUA 3ZYCA 5G4DA 3KKQA 3R0ZA 3MM4A 2Y9PB 1WD7A 4LXIA 4NLOA 2OK7A 5LB4A 2GRAA 5DJBA 2VUUA 3SZ3A 2EXXA 1QQ5A 5IT9U 4XZ3A 4NBLA 3TCKA 4EHBA 3Q8LA 3OZRA 2BDTA 3HKEB 3QVXA 2Z57B 1RAGB 1NBOA 4UTZA 2BYCA 1VLMA 4ALZA 1W25A 3TJ8A 1PDVA 4IGAA 2Y8EA 3AHHA 4IW3B 1GGFA 4K9NA 3BTVA 3UJCA 1KH3A 4A8WA 3A1WA 3ZCSA 1GQRA 4NEYA 4FD2A 4HH1A 3DM2B 3SSRA 5KNCD 2IEYA 2W2KA 1TE2A 1ZNZA 3H7HB 2QDXA 2FFQA 2OUKA 3DZGA 5KFWA 1OWNA 3T3PB 2QM7A 2G1HA 2C5AA 4B48A 2BH2A 1UXKA 3EEYA 1CUGA 3L8MA 1T4CA 1UWCA 5ILOA 2CJXA 2KT3A 2TECE 3V9PA 2HJVA 1E9EA 4DMMA 3FI9A 1C1YA 3VH3A 3DOJA 4ZCMA 4JLBA 2VQFB 4BB9A 1Y37A 4WBNB 2BWJA 2PBZA 1G4CA 3K6SA 1YR9A 2JRCA 1GPWB 2QTMA 3WLKX 2ILZA 1GYQA 2XKKA 2DB1A 2NVUA 2L0XA 3HMKA 2ZH9A 3TZLA 1YK9A 3FMVA 1X6VA 2MHNA 1LD3A 1Q0LA 1F8UA 2CKMA 3K16A 3NBUA 1Q44A 2PZBA 4RLHA 4UU1A 3WJ2A 1ILWA 1QOQB 4HQFA 3URKA 4G6VB 3QXXA 1CS0A 2FWBA 1X8JA 3I9V9 2W2NA 4JYCA 3D5QA 4XDCA 3TWOA 3OIFA 2RC6A 3TI9A 2GJ4A 2DY9A 1SZDA 3ZE1B 4BFZA 1UBOS 3WNVA 3S4YA 2WYUA 1HT0A 3TS1A 4RFLA 1ZJ4A 1BDMA 1UBLS 3I9KA 2A9KA 4BZZA 4JI1J 3T12A 4R69A 1JEAA 3IAS9 2QTZA 5K8TA 2OE2A 2XMJA 1XT6A 4KRXA 1PIWA 4EJ0A 5JANA 4AK9A 5KQSA 5FI1B 2W0SA 2RRNA 4DJFC 1H22A 3NDIA 4DIFA 1W0CA 4NONA 2VL1A 2K4MA 1TTTA 1G9XA 1EVKA 2V3WA 1SBHA 1G1MA 4H1HA 2CPZA 1HHSA 4RPCA 3RUEA 1KKHA 4P4SB 5J2QA 1MPXA 4BTEA 1YQXA 3VZQA 3EVBA 5JADA 1RRKA 2BEVA 2RGGA 2HGZA 1T43A 5HNKA 3SZUA 1X1BA 3NBPB 3DEYX 4PZAA 3K3PA 2VT3A 3PNQA 3T15A 1NYRA 5FBLB 2BGIA 3PB3A 4KEAA 3AXMA 3M6FA 1TQ8A 4F4HA 3Q7TA 1E6UA 5TIIA 2XE7A 2I66A 4WFYA 1ULSA 3F78A 4NARA 2JH3A 3NKLA 4QWBA 3KTOA 4I4BA 3DHEA 1RKBA 4DYVA 1HE5A 5MGNA 4WZMA 3KB6A 3ND7A 2XHEA 1PV2A 1ZMBA 1SXLA 2VTEA 5GZ1A 1FC0A 5J3JA 1P0CA 4UHFA 1RVDA 1C30A 3K9QO 1Q4RA 3BGLA 2YWEA 2I4IA 4TXMA 2W6NA 1D3WA 2XLJA 4UEWA 1L1EA 1QPZA 1WV0A 2AJCA 1W36D 5E1MA 1S2OA 1NC3A 5GAGU 4PCUA 2DKOB 1RZ3A 3BMOA 3AXTA 1GSOA 2NTVA 5KBYA 4MUIA 2VDPB 3M7IA 2B8NA 1HBNB 4O4LB 2QN2A 3ZY5A 2JI6A 5E7IA 2HS3A 4RENA 5IK2A 1EINA 2H6EA 2G09A 1XRPA 3ZWAA 3LTOA 5HROA 4MRMA 3PR5B 2DGVA 3GSIA 4I3HA 1V2HE 4KP7A 5LZ8A 2BW7A 3TINA 4N40A 2QPLA 1GADO 4ENTA 2VCEA 3ACBA 1JSRA 3CJ5A 1SOUA 1RTJA 4HRAA 3GVXA 3IVRA 4EUVA 3K9BA 1W36B 1DEOA 4GZMA 1HDIA 3TMYA 1C9NA 2V7WA 3GU3A 3JYTA 3OEHA 1X8KA 1IM5A 2P4EA 1DBSA 4MQ4A 1RRPA 3ECSA 5DU2A 1BJTA 4NK4A 2Y1GA 1SJ4P 5GJCA 2VF8A 2XZPA 2QL6A 5HHTA 2WHQA 2ZPUA 2F1JA 1K2VN 5CPBA 3IHKA 2OTLS 1TUGA 4DMGA 3FE2A 4UKDA 5F52A 4CQ1A 3AV3A 2IRUA 1QYCA