4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
1FS6A 2J0XA 3TX2A 2OKGA 3LWDA 2J0WA 3W7BA 4R9NA 1HOTA 3DHXA 3KV1A 1XTZA 4OQPA 2O0MA 3MTJA 2W48A 3NWPA 4GO5X 3LHIA 2DT9A 5T41A 3IBWA 3EFBA 3MAHA 3OFEA 1FQOA 3DHWC 3DDNA 4TM7A 1UJ6A 1YGYA 3CEDA 2RE1A 1FS5A 2ZHOA 3OBIA 2NYIA 3TUJC 3ENWA 2P9CA 3P96A 3AB2B 2QRRA 3LOUA 2BKXA 3E15A 3U7JA 3ENVA 1UJ5A 1M0SA 4L50A 2F1FA 4OQQA 3L7OA 3CH7A 2LVWA 4NMLA 5FIIA 3HN6A 3AAWB 2JOQA 3UW1A 2KO1A 4L5JA 3IXQA 4GO1A 3BXFA 3K5PA 1U8SA 3HHEA 2PC6A 1NE7A 1UJ4A 2FGCA 4PWUA 4M8LA 5JJBA 3KWMA 1JT9A 3OFGA 3E7FA 1O8BA 2H9ZA 1PSDA 1LK5A 2DTJA 2RQKA 2F8MA 3TUIC 1LKZA 4GMKA 2QMXA 1HORA 3ICOA 3BXGA 4GO7X 3NRBA 1FSFA 2PA3A 2R5FA 3TUZC 1CD5A 3S1TA 1Y89A 3AB4B 3BXEA 2I9SA 2J0EA 2QSWA 1RWUA 2RI0A 4R7TA 5IT4A 3DC2A 3NZEA 1KS2A 4LUBA 2P9GA 1Y7PA 1FRZA 3OFHA 4L4ZA 4L51A 4TM8A 5IT0A 5IS2A 1PBTA 2RI1A 2WU1A 2RQMA 3LUYA 2BKVA 5HJ5A 1ZPVA 4IO1A 1YBAA 3ENQA 1SC6A 2MDAA 3O1LA 1DEAA 2GNPA 2JHEA 1LK7A 4X84A 3MWBA 3CSSA 1VL1A 2QMWA 3BXHA 2CDQA 3EB9A 4L5IA 4L4YA 3OC6A 2LQJA 3N0VA 2P9EA 3OFFA
chains in the Genus database with same CATH superfamily
4D44A 2QUIA 3BBPA 4DIMA 1TFWA 4F0JA 5F5LA 1RTKA 3PCXA 4RV5A 2XRFA 4UXJA 2ZSHA 3FYUC 4RMGA 2CFSA 3TSYA 4H6XA 5F8NA 1O94C 2H4FA 4YRPA 5C51B 3L1KA 5CITA 1Z1ZA 4J1TA 4G4IA 5FA5A 5GWXA 1T4BA 3LBYA 3H2IA 2O1WA 5FWAA 1T2NA 2CL5A 4HGRA 3ZK7A 5TS2A 4OYOA 2I4RA 2VHQA 2E4YA 5J2QA 4NMXA 3A37A 2CMKA 4IVQA 5BN3A 3HZZA 2JJMA 2DH7A 1L9KA 5H80A 2DT8A 3DT6A 2O5DA 4WUTA 2YJTD 4HH0A 4DCOB 3AP3A 2VH7A 3AA8A 1N5TA 1AURA 4OAOA 5ESWA 1XQIA 2PZ8A 2QAGA 4W90B 3D6AA 5CA1F 3ROPA 2W90A 1W2WB 3QJGA 3AG6A 1W5BA 2D0PB 1DFGA 2WE8A 3FLBA 1DIGA 4D3SA 2XIJA 4WFBQ 2GKOA 1P91A 5MFPA 2CLEB 2V65A 5AVTA 4C7OB 2QX7A 5EEGA 3GPIA 4MR7A 1AKWA 5AXNA 3X44A 3JD2A 1BMFA 3R9WA 3IPAA 4ZVUB 1FQOA 1Q21A 1YFKA 4A03A 2QMHA 4UE2A 5DMHA 4P92A 4Q3NA 2JBAB 4ZREA 2ZPAA 4WFYA 2BFEA 2AOTA 3FGPA 3UVJA 3I5BA 1YJQA 4KODA 4M95A 3NXSA 2CDNA 5J43A 1DTWA 2YQ0A 2VQEF 1PSWA 1ZH4A 1ZSNA 4QELA 1KOJA 4GLOA 1E6WA 1L5NA 3T3EA 3Q8MA 3BKXA 1Y9ZA 3DMPA 2I67A 4KW7A 1QVZA 3VAKA 4I3HA 1KSGA 4ZPTR 2IY8A 2AJ8A 1EFTA 3NEYA 3SYMA 4F46A 3QGHA 3GQBA 2QLXA 3Q7IA 1G8JA 4YAIA 4ETMA 3DTVB 2QW8A 2BF4A 4EUNA 3RBVA 2BKVA 4FNHA 2GN0A 2PX4A 4W63A 3I2IA 5C1DA 4CQMB 2NXEA 2R66A 1W9HA 1VOTA 2EL9A 3E7DA 3KZCA 5FL7A 1RJEA 4N7MA 1RT5B 3MGGA 1PJLA 3VKWA 3NPMA 1MR3F 1QDUB 4HB3A 3JSBA 1YQHA 3VGUA 2AK3A 3ROMA 2QN3A 4BEVA 1J99A 1RXSA 1I7SB 3KYBA 1G21A 1P39A 3CNOA 4BVGA 1RRGA 3U7EB 4K6MA 3GJYA 4O3SA 4ZTZB 5HZGA 3MAQA 2C2KA 1DC5A 2AOTB 3W7VA 4CNQA 2QA4S 3C8UA 4NIMA 1CG2A 2I9PA 3DBRA 5A0YB 1UPPA 4FYMA 3GAFA 1KHVA 1RBYA 4DLAA 5I9MA 4B83A 3CEPB 4E11A 1MQSA 2R4TA 1H05A 3AEKA 2IHNA 3BGOS 3K9FC 3PNOA 2M2BA 4MIEA 2H07A 3PKIA 3VSCA 5DETA 4ROTA 5BSVA 1TJ4A 1R0LA 2JHEA 1X70A 4XIGS 4LCBA 4UUXA 2CBXA 3NBXX 1QYCA 4L0MA 3IRWP 2ATCB 1P1CA 4M5NA 4ONEA 4LFAB 2FG7C 4YDDB 2AMFA 1FSSA 1EX8A 2IKQA 2MKJA 5T7LA 2JGMA 4J0KA 2PE8A 3ZDBA 2PU5A 1BFUA 4MHSA 3ETGA 3EVMA 2PA0A 3BGRB 2ZG6A 4LJMA 3D0IE 5AM4A 3GV8B 4GQIA 1XP5A 2B3TB 3AI7A 4DCOA 3R7SA 2UUOA 3C6BA 3MMAB 4K8RA 2O3UA 4RTSA 4N6NA 3HH8A 3UQSA 1FUEA 2NUUG 5DDIP 2CSXA 1KA9H 4WUVA 4LRFA 3ZY3A 3S28A 2YKGA 3ECCA 4AX4A 2YNHB 4PRLA 5D77A 3LNCA 5H3CA 1CY4A 3PD7A 5B3KA 2REBA 1EI9A 2IHR1 1IJEB 4CL2A 3I0ZA 5SV2A 4CNBA 1P6UA 2OM2A 3BL6A 1O95C 3KK2B 1U3FA 2I8CA 4BS2A 2UYGA 3AM1A 4HR2A 4HT3B 2ZPTX 4USHA 3O31A 4CO4A 4FN4A 5BN4A 3CNNA 3MAHA 1T8TA 4CUJA 3IMGA 4YUDA 4HX5A 1YRXA 4RZQA 5AK3A 3OTWA 1KQKA 2XDAA 1YJ9S 2RHGB 5H3LA 2BGJA 2Q5EA 2PT5A 1ADJA 1Z5ZA 1KYYA 2I5JA 5CG2A 4GZMA 2QC3A 2L08A 2HBRB 3ELHA 3IDFA 3WXBA 1EBBA 3RAQA 5AXCA 1J70A 2NZ4A 4UUWA 4UOHA 4TVBA 1OA0A 2FMFA 1CB7A 3KLPX 1SVUA 2FH5B 1LPPA 3T7IA 4R8VA 3MR5A 2EG1A 2GUGA 4FYVA 2CLFB 1WSDA 1U7XA 1PIWA 3LY8A 1B0TA 5B08A 1EGHA 2PZLA 3W9BA 2E5WA 3GLUA 4HWGA 1C9DB 2D6FA 2GHIA 2CLKB 2Q0XA 4M99A 2VT6A 2MB0B 2QVCA 3K5MA 2FPRA 4MK8A 1EKXA 2I71A 2P79A 1W5TA 4NJMA 3S5JA 4E2WA 4QO7A 4ZP8A 2O23A 5CH7B 3YASA 2CLMB 1KZ9A 5EE9A 2YS6A 1GUFA 5F77A 3VAMA 3H8YA 3IJEB 3MM9B 1RJ9B 3WFJA 5BQ3A 1WKLA 2PWYA 4OO3A 4J16C 4BUJA 2V5HG 3A4MA 3X1DA 4C0HA 3EX7C 3OWOA 1NW7A 1TUIA 1Z28A 2J9EA 3ACBA 2DCLA 3VNAA 4CIDA 2Q07A 4KOAA 5JAMA 2NTJA 2N0SA 4PZEA 5L1JA 5I7VA 4IIGA 3AZOA 4FPXA 4MYSA 5G02A 4UAVA 4Q1BA 2WDPA 2P68A 4KHMA 3FBCA 4JWKA 1G38A 3WGUA 1UAGA 5FTJA 4ANCA 2OCLA 3AKEA 2XVMA 4IJUA 3DL0A 1FP7A 4C4YA 4RAQA 4C5CA 1ABBA 3N3BC 1QOQB 3HI4A 2R6CA 4ZVQA 4ZEWA 1JYSA 1Z4QA 1PAEX 4YGXB 1H4TA 3GLTA 2WKQA 1MG0A 3KSRA 2PVCA 3NKYA 4G1IA 5LMUF 3NJRA 3D6FB 1FTQA 3E9DA 3WRWA 2EWWA 1DHTA 2HNDA 4F5DA 2XXAB 1WUUA 3P0EA 4WFNQ 1RJ9A 1YIDA 1LW2B 5EFOA 4PRFA 2I2WA 2V4JB 3PEUA 4CDNA 8OHMA 2YWGA 2VNHA 3IEVA 2G82A 1K1EA 1D4ZA 1P72A 3VDNB 3KWLA 3ZCQA 1P4RA 2W83A 3W2WA 4UNSA 2V7VA 2V4MA 4Z9FA 4GZLA 1HZZC 3B3QA 3ANNA 2F1FA 2ON6A 2AW5A 4MHTA 2VCYA 3SQXA 1CS4A 4JYZA 4NBTA 2FF7A 2P1ZA 2DTJA 1QFZA 4BWJA 1G9SA 2LW7A 3SE0A 4YUYA 4MPDA 1VMBA 3VPDA 3AZPA 2R2RA 4UD2A 1O8CA 3NBKA 2ZFHA 1K0VA 4EEYA 4JC8A 2NYRA 3OPYA 3EICA 2IK8A 2QZPA 4ECVA 1IEVA 3DLPX 2P0YA 4MYRA 3VALA 3EIXA 1I2ZA 2H48B 3CVUA 2WJHA 4DSAA 5I42A 2H1HA 3IBGA 1NQAO 4IO0A 1VCIA 4DHVA 1UH5A 3VR5H 3J7AC 1M7HA 2FNAA 3OPNA 1CNMA 3STYA 3CVWA 2W2OP 2GWHA 3BL5A 1V6HA 2YKQA 1Z2AA 2I6GA 4JVSB 2IUYA 3Q7QA 2WHOA 2R4QA 3LH5A 3LT4A 4JEIA 3ZTRA 3TZ6A 2WYVA 3HRIA 5KFZA 5JMOA 4BV8A 1KY4A 3ISVA 3JASB 4Z0NA 1XCPA 2XV1A 3CM0A 1E4YA 3AC0A 3UCEA 4RZSA 3UA3A 1LW0A 3HS3A 1PFWA 2Z4PA 4JJFA 3T34A 4RA6A 2CUZA 4H7DA 4A0FA 2Q62A 1TXGA 2B82A 4IDPA 2XCOA 4Y9TA 3MCTA 3F49S 3W6PA 3GLFB 1TUVA 2OC4A 3I52A 4G9GA 4FI3C 1EXWA 1A88A 4PPYA 4CF6A 4IOLA 2BFFA 1NMZA 4V03A 2XMKA 4ISCA 4PG8A 4YH1A 2FMHA 3PCOB 1PC4A 3H3JA 1KETA 3B12A 5IS2A 1U3DA 3FB4A 1GL7A 2FYTA 4UNPA 2AE2A 4ISBA 2XTAA 1DL5A 2RD5C 1ZD3A 2FLPA 4KWCA 1WOPA 3U4MA 2GCIA 1U1LA 1TYDE 4IF6A 2DQSA 3S27A 1EKSA 5K8IA 3HT0A 5EMJA 1VRWA 4BXOA 4YHHF 2O4CA 4HDRA 3PQ4A 3EZ6A 4DN6A 3BK1A 5F41A 3L0ZA 1CDOA 4DILA 2RI6A 3T19A 1IEXA 1W6RA 1HLGA 2CZQA 3KVYA 2R68A 4FYYB 4X0EA 5CT8A 5B1DA 5E41A 1PJSA 3WO0A 1JAXA 2ZTVA 1N78A 4C05A 1N0IA 3B1WA 4LMPA 1IBLJ 1WHYA 4KQZA 2H2WA 2WV9A 5JAHA 5A9SB 3IERA 5JASA 3MCZA 2VKQA 1H0HA 2J0UB 1M10A 1I2CA 4D81A 5FR1A 3NZEA 4H08A 3S8SA 1U1DA 2H65B 1YS4A 4USTA 2DE0X 3G2PA 3B3FA 2QF7A 3PXBA 2XYGB 1WEZA 2IEZA 2P41A 4XCXA 3A4TA 4HAZA 1T15A 3H2GA 3M4YA 3SHTA 5CMLA 4FFPA 5E2BA 1G8MA 1PLKA 5AI9A 1A6LA 4I36A 4ENWA 4JROA 4R3UC 2P5UA 3JYNA 2LLZA 4LF4F 3IP8A 1IBLB 3Q8PB 4YACA 4OBEA 4ID5A 2P40A 2IDLA 3OF3A 3MD3A 4KYVA 2OCBA 1EXDA 1RLDA 3P0RA 3T4XA 3TINA 4W5HA 2P77A 4ZDNA 3EVOA 2QJ3A 3ZBPA 2HLNA 4JYAB 3WADA 4JB3A 1KPGA 4DX8H 1O3YA 2J3DA 4TS3A 3OPMA 5KYUA 1LK5A 1Q92A 2JARA 4A8MP 4IR7A 4ZZ3A 4L4UA 3B9RA 1B74A 4WD3A 1ZM3A 1CZOA 4A9AA 1JG2A 4EHIA 1CC7A 1FKPB 4X4UA 3TEFA 5CW2A 1XMOF 1RXOB 1JE0A 4URZR 2C97A 3C4QA 1AO0A 4OYAA 1CEYA 4P6VF 3HD2A 4BZPA 1PIEA 1V9OA 8ATCA 1C0LA 4HL6A 3RIYA 5I7EA 3QT6A 1P7YA 1PUJA 5L3SB 1A76A 3QE0A 1JQEA 4GX1A 3PQCA 4QSMA 1GAOA 1VC2A 4RU9A 3OLQA 3EVEA 3VPCA 2VJMA 1NRIA 3FLEA 1VISA 3I4LA 4IXDA 3FWNA 4J9PA 1BCSA 1RAGB 4DOZA 4BVJA 1KI4A 3E9YA 4BNDB 2AJ4A 3Q88A 3EIFA 5AW6A 2W11A 4DLEA 5KTRA 5CAEA 2YNIA 3JPWA 1FP1D 3DBLA 2H18A 2ATIA 1KZ6A 3CZ9A 2HJGA 2P2CB 1AZWA 3RVQA 1JIHA 5HLFB 2DZDA 1I3KA 3NVDA 1M90T 1P5HA 3DEHA 5A6VA 3R09A 1FYEA 1WV1A 4TLBA 3GRFA 3M7IA 2OYSA 1LXNA 2P6MA 1NZJA 4ND1A 2VP6A 3WSWA 3F90A 4R8MA 1XCOA 1RBMA 5LXYA 4PYQA 5BXYA 1KP2A 4LHWA 3PGJA 2I7DA 4LI0A 4C7XA 4KR2A 3O6QA 4UEJA 4G8BA 5FQOA 1Z34A 3HVRA 2JGAA 4ARBA 2HSEA 1SU8A 1BZYA 3Q6NA 3HVTA 4K3UA 1M6WA 5U47A 3P2EA 1FERA 5ALPA 5IVKA 2MJLA 1FRVA 3DR5A 2F8LA 1FFXA 3QOXA 1QIKA 2COEA 2VPXB 1CJTC 4R40A 3AEYA 5BYSA 4QR0A 3ZNNA 4YQWA 4PWDA 1PFKA 1FJGB 4U2BA 1CY8A 3HWSA 3OH8A 3M2UB 2ZE6A 3VU0A 3QKUA 3DW1X 4L16A 3L77A 1J0BA 5ALJA 4K6FA 4J7UA 2D4HA 4UAUA 3LWBA 2MTBA 2O20A 2AHOB 4M7PA 2O1XA 4IO9Q 2VZ8A 3IMFA 2QM3A 5M2QA 2V0NA 2AUTA 1YI2S 3ZYCA 4MIBA 3MOJB 2PGOA 4P93A 3QMMA 2CLOB 2Q5IA 1SUQB 3U1NA 1KJWA 3KHRA 1PGZA 2AMLA 3D0GE 3VYVA 1GLVA 2CFRA 3JQ7A 5BNWA 1OVGA 4UVHA 4N0DA 3CO9A 4IQ4A 1JDZA 3VTFA 1FYDA 4E09A 1Q7TA 1JKXA 1VZ3A 4IF4A 1B6RA 2A5LA 1J6UA 4UJ3A 3ZBTA 1IVNA 3T8YA 4MUFA 1UMDA 4JI2B 4A1OA 5EXPA 4LFCF 1C4AA 4EYEA 2X5XA 5J2UA 1XWFA 1S7CA 4OZ0A 3KSUA 2O2IA 3X2EA 2FD2A 2ZJ0A 3D4OA 1T5BA 4WMLA 1VPEA 2Q3MA 2PKYX 3Q2SC 3LF2A 2VLIA 4PC7A 3WHPA 5CW1A 1N32B 3LWZA 4J8PA 4ZYWA 4RTQA 1V3ZA 3F47A 2IPMA 1NM5C 2M9KA 3CRMA 4CL8A 5I7WA 3GVIA 5F8JA 2E9ZA 3X1WA 2Y1FA 3Q8KA 3R3YA 1I30A 3WRYA 1HNXF 3DV0B 1NVVR 4TOIA 4QECA 5EERA 1XTIA 2WSIA 2W6NA 4LT6A 5TMEA 4J2OA 3S68A 4MGHA 4K8OA 5K5MA 2OR3A 1T0TV 4DB4A 2D00A 5TQ0B 3L6BA 3P2OA 2EBGA 3VM6A 2GXSA 3SS8A 3RW6A 3BWEA 5LQJA 1T0IA 3OZGA 1Z2ZA 1E1QD 4Q3AA 4M4SA 1WM1A 1U1QA 4XIYA 1RAJA 4MICA 4B3IA 4K4TA 3ILLA 4MB2A 4L8GA 3E5NA 5EY5B 2W1BA 1RRMA 5KFPA 2ECKA 5TS3A 4CLKA 3ROFA 4RAOA 4WERA 4DDUA 2R8GA 2GCPA 4LDZA 5LXTF 1G5TA 4J3NA 1RISA 1XELA 1LBEA 1W34A 1AKYA 3S6JA 2H63A 2EK1A 3JAWA 1YS9A 3ZDXB 2LBPA 2PD4A 3MTJA 4QYZK 4MW0A 3NLLA 4YRQA 3NCHA 1B70B 1OPZA 1QOZA 2XWQA 1DX9A 1Q1ZA 1G6HA 4FF2A 1EJ2A 5CHYA 3EXCX 4IVPA 1N8SA 4BIMA 5JAUA 5GTDA 1WL8A 2WOMB 3MPUA 1V1MA 3PUHA 5CLFA 1D2GA 5K8MA 3IV7A 2ZYTX 3PDJA 4X85A 3TLJA 2FQYA 1WSWA 4EB3A 3ZC4A 3D4PA 1F20A 2HB6A 1YOVB 2VR1A 2H9IA 1J5XA 3GRPA 4YB6A 3UWSA 1PR9A 4MQUA 1II8B 2ETXA 1AU9A 3H17A 4V1CI 4WT7A 4YAGA 2VHWA 2YWRA 1NOKA 2HA2A 2A0UA 1HKHA 1CJTB 1U24A 2HHVA 1NUEA 2IOHA 2GESA 2YNGA 1I1OA 1S6UA 3TA0A 4QFDA 3FKBA 3K2IA 3M3HA 1GFWA 2XLKA 3E7PA 4IHKA 4OP3A 2X9LA 1KARA 1O87A 1Z38A 4F67A 3NGTA 1BMFD 3C3AA 3H8WA 4TN1A 1SKAA 2BFFB 1RT2B 4QXQA 3AUYA 4O0NA 4GOLD 1JTFA 1HE2A 4U7FA 1YUNA 2EFCB 3N1UA 4G0ZA 2PD3A 3ZE6A 2C2KB 3LYUA 1QH8A 5HVGA 4LYHA 2HSDA 3VC3A 5ECWA 4ESOA 2BBEA 2G2ZA 4TGLA 5BQ5A 5EKUA 3UW1A 4PTLA 2YJ3A 2IUEA 5FNZA 1R15A 1PBAA 2JGLA 3W0LB 1RPTA 2UUCF 1SV5A 4B9VA 3N28A 1X5TA 1Z29A 4CIXA 4E70A 3FJ2A 3BQ1A 4GD3Q 2V68A 3V80A 2R8YA 2BVZA 5IOLA 2YJ6A 1M0TA 2MZRA 2KB0A 2WP0A 3JQAB 2PCLA 4KWIA 5EMLA 1B26A 2HBZB 2BH2A 1Y82A 1VG9B 1EHWA 4P5PA 5IP5A 5E1OA 2PS1A 1DJPA 4N01A 4RMJA 1N9GA 4HSGA 3V9PA 4Y2RA 2K5UA 1JLHA 1RI7A 5IXSA 1ZQ1A 1E0SA 3I6YA 2QL7B 2CDCA 2J7WA 4OXRA 3WB1A 3KS9A 1JHPA 4JP3A 4P33A 5D8DA 4KIJA 1FMCA 2IQIA 4Z7CA 2BZ2A 3FJ1A 5KTTA 2O14A 4P8RA 1FLDA 3RVLA 1Q8KA 1RJWA 3QVGA 3T06B 1YNSA 5DXFA 3M5PA 4R6WA 5EP1A 5FI5A 3MM6A 2VQDA 4Y1GA 4XM2A 1UJMA 4YUVA 3QLVA 1N1EA 4EYQA 2PJRA 4NXNJ 1RP1A 3Q3IA 4N76A 4EP1A 3A8EA 3QX9A 5BN5A 4DL3A 2G4VA 2ECFA 4FZ3A 4IEEA 1RACA 4IICA 4OZ1A 3CTRA 1Q91A 3KQUA 1R2QA 1RLJA 2R4FA 4NWBA 3KE8A 3SC2B 3D4BA 3Q87B 5B5SA 3R8XA 4ENPA 2X3GA 3AERA 5F1OA 2HBYB 3EK2A 1C8VB 1TPZA 3THYB 1TT7A 4XB6B 4F3KA 3U81A 1RFGE 2FZEA 1U2GA 3LXMA 2HWHA 2IWHA 1TZKA 2BGUA 1KKLA 3CX6A 4MEAA 3H3XA 2HVIA 3NKVA 3P5BP 3NP9A 1JI0A 4OJKA 5KG7A 2YIMA 3NEJA 3GP8A 4D26A 4QYZJ 3QMVA 3BYZA 3R3VA 3OZTA 4IUBS 5KOIA 2XF2A 4YHHJ 5KOJA 3Q8WA 3WGTA 5EX0A 4BLGA 3JTEA 2R84A 3L8YA 4BC9A 2Z8ZA 2YY7A 2APOA 2Z98A 4BFCA 4HX9A 4ZHRA 1N5VA 5F2OA 1PDWA 3VDXA 5LOVA 4DCSA 4LJ6A 3DBLB 4OP2A 1L3KA 3IAS9 2VFSA 1OPXA 5CVJA 3C6KA 3HJVA 3EGXA 1H23A 3FFBA 2EJWA 4P82A 1GX5A 4F11A 3VR6D 1HIYA 5D5PA 3ZY6A 1GL3A 1JT2A 5A62A 1C9MA 2HHSA 4WBNF 3VUFA 4FHDA 3UKDA 4D57A 4WK4B 1WE2A 2QXTA 2JHGA 5CVDA 3R7BA 3QVJA 4DV5B 1ORIA 2VQFF 4PYMA 2H57A 5AOVA 4Y65A 2WINI 4DV7J 4XDGA 1SKWA 2C8KA 2G5CA 2PMBA 2FZKA 5TLSA 1TMGE 3OLZA 4I14A 1U80A 1CR4A 5GJCA 2HQOA 121PA 4JBIA 1JU9A 1ZUNB 4F3YA 3SYKA 2J3HA 5JFTA 5DGIA 1YZFA 4D0NA 4NENA 1I7DA 1Z4LA 2ODTX 4FCWA 1WAMA 1EHCA 4TKUB 1DFDA 1AROP 4BVHA 4MDYA 2Q46A 1QHGA 1XMQB 1ZJ5A 3HBFA 2KH9A 1T9DA 1Z13A 4F97A 2UXCJ 3JQBA 3D3JA 4FWIB 1AMOA 1W8IA 1VJDA 3FPHA 1N8NA 1M2KA 3GRCA 3GFFA 3BKTA 2O5RA 3AB7A 4D4IA 3LRPA 4O4RA 2H2FA 1PW7A 4DEXA 1CRPA 2H1IA 4MRAA 4HTAA 2R00A 3AD8C 5MFZA 5JPDA 4E30A 3SGLA 2CIMA 2XB8A 4FXOA 4QT4A 3A36A 3CF5Q 4J0EA 2KLHA 3W61A 5L6MB 3VZCA 4B9UA 1HLPA 4EYGA 2FZLA 3TVDA 1IY9A 2YX7A 1W26A 1GPDG 2I2FA 3A3NA 3E5HA 4CLXA 2KFNA 3F7MA 5AIAA 2QGFA 3N8GA 4G36A 4X7PA 1ODFA 3FFWA 3PUXA 4OJQA 1C2PA 3LAKA 4PR0A 2JDJA 1WO8A 3CLTC 4NU0A 3H16A 1IY1A 1EFVA 2B94A 3IDOA 1HWUA 3E1GA 4PYDA 3R5AA 2WRZA 4O02B 3REQB 2WTUA 1VQNS 1NNI1 5KI6A 5IBCA 2Z95A 2X8BA 4I4TB 1USGA 5B3LA 5F9HA 1RSZA 2OCYC 1Z7BA 1EK2A 1TRKA 4ZXFA 3RV3A 1PO6A 3KK1A 1AGPA 5HE8A 4BX2A 3C24A 1IN0A 3RF6A 5IT9Y 2RH3A 4IDHA 5E6RA 3EOAI 5TR9A 3UJBA 3MUOA 4PNZA 1CR6A 5ILOA 3KZVA 4U96A 1DE0A 1GNKA 2M0GB 2VPWB 1J8DA 5DH9A 3VXKA 2BKEA 1LV7A 2GK7A 3QHAA 3PRYA 4U5XA 3K9CA 3Q8XB 1C5KA 3GMGA 1MAUA 1AGYA 1XGKA 2GYUA 2DBYA 2X41A 4DCUA 3OUUA 4W5JA 3VYWA 3QJLA 4EMUA 2E9RX 1JR2A 1SKUA 5E1DA 1OXXK 2JZNA 1USUA 3W4JA 2Y3YA 1E8NA 2P4HX 4K0KJ 5M2UA 1UQUA 2JFXA 5BWMA 2WYWA 3K9BA 3AVOA 5GONF 1GKKA 5D85A 1O6BA 2ZEJA 3HJUA 2V59A 4AZ0B 1V8FA 2BFAA 3H5OA 2VTVA 2ZHBA 2AD1A 1RADB 2GIFA 4GXTA 2C61A 3HCFA 3FCEA 4NEHB 1KQGB 3FNBA 4HAXA 3NWOA 2V98A 4YHBA 4XGQA 3TJ8A 1THZA 1N6HA 3ACDA 4JP8A 1EIWA 4LY0A 2D7JA 4WY8A 3CDUA 1X7WB 4CEIB 2ICAA 5LP6C 3GJ6A 1LDGA 3QUTA 2Y1LA 4PX5A 3US5A 1ZD8A 1FYVA 3KVNA 3A0UA 2RGCA 3WKEA 1WSRA 1H4VB 2F4VJ 2ZWIA 3SBDA 1ONPA 3JYTA 4BJ5A 2QLBB 1VBXA 1GILA 4QUIA 2COKA 1H9BA 3BFXA 4NA2A 3NH9A 3DOOA 3DWFA 2A1UA 3VH1A 5DYIA 5EXEA 3Q83A 3ER6A 4WCDA 4ZCLA 1C3EA 2XLIA 5FR2A 2XYHB 4PY2A 4E15A 2YXNA 1CC1S 3RPEA 4ARSA 5GP1A 4GO7X 4D74A 1BS9A 1IBKB 3KKMA 3E9MA 3OWHA 1TQHA 4WZBA 1MVLA 2QUAA 3MCUA 1X94A 2YHUA 1UBUS 4A5OA 2ZU0C 3TGWA 3ONDA 5HZHA 1R0XA 3HU2A 3ZKWA 2J7PA 2B25A 3F9CA 3RYIA 3PT5A 2VDVE 2J46A 3K5NA 1LDNA 1GTRA 3A3NB 5ALIA 1WVGA 2P2GA 1JNYA 1WXGA 2X7XA 2CPFA 1NBOA 4BLUA 4TVAB 1D9DA 1UADA 5LDGA 3DNCA 1AX9A 3UAWA 4J76A 3AOCA 2P5TB 2DH5A 2JNJA 4N49A 5JADA 2PH5A 2I2DA 1T6YA 4GVBB 1L4LA 1KQFB 5JNRA 5KWVA 1XT6A 3UHAA 1MBZA 2R1ZA 4ATNA 4R1UA 1V1RB 4QEDA 1G3UA 4FR5A 1KFCB 3OOWA 2P9BA 3OETA 1EU1A 3ZNJ1 7YASA 5TQ2A 1MJ5A 3PBKA 3UK2A 2X4GA 5FWXB 2LZ0A 3D0OA 2HVDA 3A70A 5KYGA 5FP0A 1U9IC 3PX2A 4I9NA 2BUAA 1GU0A 2OT3B 3GDFA 4KQGA 1KI3A 2Z4SA 4BEWA 2JHFA 4M76B 4NF2A 1VQKS 2AJFE 3H0CA 1II8A 1BHO1 5LD2C 2AQ4A 4NBLA 1PW5A 2JD2A 4X6YA 3ZWOA 5D4LA 3AUFA 1NQTA 4OV6B 2IH4A 3BB3A 5KEIA 5TGDA 4DR2F 3WNZA 3BJYA 3GA7A 4OMUA 3P9PA 4UBNA 4ABYA 1LLCA 4EJSB 4OHVA 5DGBA 2OCXA 3VU9A 3AIKA 3ME5A 4WGGA 3R6GB 3PQ7A 4Q5VA 1J33A 2PKRA 1X2EA 3G0BA 5L95A 1XWLA 3NHZA 2I3BA 2JEFA 4WXMA 3VNBA 3FWPA 3ZZPA 5EWMA 2X1GA 4EJ0A 1YZGA 3ELYA 4EZIA 4EYHB 2Z57B 2V63A 3IR5A 4IYQA 3TOXA 4BATA 2RHTA 1DQZA 1X42A 3TE6A 2VNKA 4NI2B 2Q21A 4M5IA 3X1ZA 4L15A 3UMCA 2B1QA 3KUXA 4REOA 3U4HA 4ZARA 5CB6A 1DG1G 2XSJB 2IA0A 2B7LA 3Q9LA 3M49A 1NULA 2HF7A 4XD2A 1XDZA 2LVBA 1G0OA 2HUPA 4U8GA 2W0SA 2V3WA 2YNFA 2NPOA 1P5RA 2C7PA 3CSDA 2GHWA 2PFDA 5KYKA 3MTDA 2OZPA 1JU3A 4ZU1X 4QO8A 4CMIA 4B3OA 4TRRA 3R9XA 1GK8A 1KOOA 1HPZB 4EGLA 5JMPA 3BBBA 4MQFA 5DTJA 3W5XA 2F67A 4ED8A 3N8IA 1QD1A 3UDVA 2JDIA 4EU0A 2RGNC 1W73A 3RT9A 1RHKB 4M87A 1UBRS 1IN6A 4DEZA 4DGSA 2HHQA 4IOAQ 3N5FA 2A2DA 2A6OA 2XM3A 1C4XA 1VCOA 4ND2A 3KIPA 4EKNB 2H1LA 2ZCUA 3OHSX 3OUYB 3O2QB 3OKCA 4FQ5A 4FBUA 3CT6A 3OTQA 4AD6A 2JIRA 1PAUB 4P4SA 1GYQA 4WKCA 2MINA 5EYPB 3RS5A 2FDNA 4QDTA 2CVOA 4Z6KA 1NXOA 4TU7A 3G9UA 3L04A 2NUTA 4F1WA 3W8GA 1ZINA 2A3RA 1CHNA 3BAFA 4CIVA 5FBZA 3CD5A 4ZRMA 5JFOA 1XL1A 3AL0C 3NDRA 1WXIA 3O6VA 5K8JB 3DFIA 4DLGA 1J0CA 3ESQA 1G55A 1F60B 3OCVA 3UO0A 4R71A 3UFXA 4C0BA 5FBRB 4FR0A 3MGKA 3F6CA 3SE7A 5LUBA 4EJ2A 4ENVA 3OVMA 1UJCA 1VE5A 4M7OA 1ZS6A 1OREA 3PX4A 3QJJA 3ZJTA 1P1KA 4RD1A 5KVAA 3PR2B 3MJTA 1C30B 2P3LA 3S8MA 1MO4A 3QH4A 4ED2A 3G8DA 4PPDA 4Z7YA 1BUXA 1J2TA 4N5MA 1Z0KA 2AJQA 2DBQA 5U4QA 5JMNA 1YL6A 2XD9A 2V2VA 4LZJA 2PUHA 4C07A 1E6VA 5CNMA 1KL7A 2KTQA 2KJQA 1EETB 3BILA 5FIUA 3WYNA 1F5AA 2HY7A 1HT2E 1AZSB 5E9JA 3AHIA 3U4GA 2R97A 1E92A 5AJHA 5AKEA 2RRBA 1PHPA 4TZTA 1G5FA 5CDGA 3Q7TA 5LB4A 4N5NA 1VB3A 4PXCA 5HXAA 6AT1B 4S2EA 3P45B 2GMWA 3CIOA 3THPA 1BROA 1RYDA 1YJWS 4EPWA 3CA8A 1Q2UA 3OXFA 5B0DA 4CKEB 1MN7A 1X77A 1ZKMA 5JNUA 1GA6A 3L09A 2ACYA 4MGKR 2OD7A 4DWIA 4Q9HA 3R75A 4G5FA 3NAHA 1E1CB 5JPCA 4JMPA 4Z1MD 1WZCA 2DF8A 2TMGA 1UVIA 4FX5A 2FZVA 4CQJA 4JJ8A 5AVWA 4P08A 3HD1A 3WV4A 4LZOA 3ZWVA 4TTJA 1EX7A 5LNK1 3G7UA 2M70A 2WHYA 1CVIA 3R5KA 3V4VB 3AB8A 4UUPA 1T9BA 4KGMA 3G49A 3SYNA 3KQNA 2CPXA 4I50A 2ZDHA 3RFFA 1P8GA 2CVPA 4CFZA 3HHPA 3EGOA 2HA4A 2BRKA 1Q19A 3SQWA 4CCAA 3AH8A 1PZGA 3MQ2A 3D43A 1MHTA 3B3AA 3EZNA 2WJPA 1CUIA 5IJWA 1E1DA 3JARA 4Y2QA 3PCRB 4FHCA 1GUBA 3IDQA 4IGAA 3N2ZB 5B1EA 2IM1A 2AZMA 2VC2B 1FA9A 3TIIA 4MH8A 3TO8A 5EUHA 3LKZA 4OX9Y 1KQGA 1EFKA 3ZE7A 2Y0BA 3MTIA 4WZAA 1GWNA 2ZGVA 3NTOA 2HHCA 1PWHA 4S0XA 2WIJA 3GEMA 1XI2A 1TAHA 2J87A 5B1HA 3I5AA 2ABYA 4KQMA 4LIWA 4HSEA 1B8OA 3DE2X 1PL7A 1L7PA 3HTXA 1DKUA 3HXTA 2YKNA 1B3RA 4NG5A 1OI2A 3TTXA 4JI4J 1R6VA 3D6HB 3TD2A 4EEXA 1ULZA 4LC1A 1R37A 1UBJS 3P1JA 2V7WA 2DNOA 4I1IA 3EXHA 1GTZA 4Q47A 4UULA 1GUAA 5H70A 2EAUA 4JEMA 2JH9A 5A5GA 4O4LA 2IBSA 2CNOB 4M49A 5EXDA 4WI1A 2PL5A 3V4IA 1RMYA 5TARA 4XAKA 4RHCA 2I7CA 1U31A 1RXEA 1J9EA 1U2DC 1PEYA 4Q12A 3R7NA 3T9NA 3WGQA 3DLJA 1A71A 4K0RA 4YIKA 1QH0A 1XZ8A 4CMBA 3BE8A 5GQSA 4DI6A 2II6A 4ZVSA 2I5PO 1MEEA 3EVCA 4U8YA 5HX7A 3JQ6A 3S2SA 3UB3A 4FSDA 3K0FA 3GJ8A 3RYIB 2XT9A 5ALDA 4RBVA 3E3AA 4NX2A 5DOVA 1RTJB 1PQYA 3DE5X 1G6KA 3SZRA 1U0EA 2AH5A 1F6WA 2HRTA 2YJNA 3H83A 1OWNA 4PAMA 3U60B 3EASA 3E0QA 1Z2NX 2Z04A 2Q29A 4LIRA 1YB2A 1K75A 1NVWQ 3KOMA 4L6CA 3EPGA 4DARA 4YP3A 4HWTA 2PTGA 2WAQD 1RAGA 3CURA 3KR1A 4G81A 5C32A 1HR0F 4FMBB 2DFKB 1L5KA 3M1IA 4ZC1A 3NIWA 1XCJA 4RD3A 4F4AA 2PEYA 3ZS8A 1D8TA 2W2PA 3EYWA 5T67A 2PS9A 2B7BA 5BYAA 3SOPA 2P9FA 2PR2A 3IFEA 4HI0E 3PXDA 3DLGB 4WK1A 2X5OA 5K8OA 4DSOA 2OUKA 4ZCKA 5T4HA 3AY7A 3WYFA 3WL7A 5KVCA 1GY8A 8AT1A 1A7AA 1U7DA 1BIFA 3G2MA 1NVAA 1RTHA 4AJKA 3PIDA 1XBWA 4N8SA 1DDIA 1RJDA 1EJ6A 3CCTA 3H5XA 5M2RA 2HSEB 1Q86T 3G23A 3HB4X 3BH6B 3OFND 1SWVA 2YICA 4TXLA 2H9ZA 4DCPB 2JANA 1U1NA 1RW4A 3FMFA 1ZZGA 5FO0A 3IAM6 4MDHA 4XPIB 1FSGA 2P8JA 1IBMF 2BIFA 1TZBA 1G63A 1QHXA 5TC4A 1XDSA 4DX6A 1CJKC 1JA9A 1N5LA 1QGUB 2AMVA 1SVIA 1TL7C 1KAHA 2R7MA 1NXQA 4G1QA 4ER7A 2C0CA 5DP1A 3EX7B 1MU2B 3G5UA 1HV8A 4K4VA 2H31A 4N03A 5PGMA 1H85A 2QYHA 3QXHA 5HBGA 3EZOA 5AVUA 3D3NA 4WKNA 3KG1A 1NZ8A 2GA9A 3S2GA 2VICA 2DT9A 5FAXA 4CQ1A 2Y27A 2RRNA 1Z88A 3LSTA 1NK7A 5IASA 2QI9C 4FIZA 2ZDOA 1TCVA 3UM9A 2QL5A 1UPMB 2P8IA 3AY6A 1S6OA 2DHSA 5A8WB 3RVKA 4X1KA 3CO5A 3SS7X 5KFYA 4G1CA 3LT5A 3M2TA 1U48A 5DEOA 5JD5A 4MOWA 1Z12A 2CXPA 4H4MA 1GZSA 1JR3A 4YCJA 4K9LA 1S97A 1Y4SA 1GIAA 5GOTA 4YN3A 3WKDA 3BREA 3GGSA 4HDOB 3SJAA 3NB0A 3P2KA 2FJXA 5JCZA 1I94B 2W4MA 2O2SA 1FVSA 1IUOA 1CPYA 3AEUB 1Q1AA 2FYXA 1U2TA 4MJ7A 3BHIA 1WPRA 3GF4A 4ZZIA 3VGSA 3DI6A 4J16A 5U9CA 4GPEA 3GEDA 5F8GA 3VR2A 2UU9F 4MZXA 3QWPA 4CR8A 4EQ6A 4ZN6A 4OD0A 1H2WA 1X1BA 3U49A 3FJYA 4JI3F 5J2UF 4DR4B 5HM8A 4KPFC 3SYRA 2OBNA 1F3LA 1EG2A 4C1BA 4BYGA 2Q3CA 3QGGA 5A4DA 5BUQA 3V8NA 1VPVA 1S49A 1BOOA 2ZW9A 2WWRA 3SEQA 3K31A 4LYEA 2ZH2A 2Z3WA 3F9IA 3KQPA 4B9EA 3UOWA 2ZVSA 3OM8A 3MOZA 4WJBA 1Q16B 1ONOA 3KKOA 3HDVA 2HJ9A 3OFJA 2CLIB 3Q8VA 1AQUA 3FUYA 1V25A 5HR5A 1FNMA 2UYOA 4EJFA 2QAIA 4UHDA 3MD1A 1XTUA 4AJNA 1XPRA 4WA7A 3HBMA 4G5RA 5CJPA 2VIIA 2YX1A 3BERA 4TMWA 4YB5A 3KZ1E 3NNSA 2IEIA 3RJ9A 3TNYA 4ENTA 1SKMA 4LZNA 4A6XA 1L3VA 3MJSA 3NBAA 1L7QA 3QLEA 3WL5A 3EFHA 4F92B 1L1QA 4RTMA 5CUQA 4YDQA 1D0IA 5ITZB 3GJ4A 5KO2A 2HFKA 2CYBA 1NGSA 5JLAA 5HOEA 1XXHE 2E55A 2KHZA 3HMJG 5IUKC 5A6WA 1KLMA 1U94A 2E66A 2RDMA 1KC8T 1IQ0A 1N2JA 1EZ4A 1XQYA 4XE5A 1NPKA 1N6OA 3IR5B 3ODPA 4TMVA 5EJ7A 5DBGA 3AETA 3T5JA 4X6LA 5IRCD 4LAFA 1FFSB 2X22A 5IDYA 3O2JA 2ZH7A 2FWNA 2ZVQX 5EN1A 3KZOA 2I6FA 1AN0A 2PMEA 5T4FA 5A7GA 2KZMA 1V5WA 4OQDA 4X8LA 3GIRA 3PCTA 1SKUB 2XZDB 1KO7A 4G97A 4CT4B 2EP5A 4J7XA 4EITA 3L01A 4Z1OA 5IK2A 1NKSA 3PJXA 4MWEA 4Z0HO 4CUKA 2H1SA 1F8UA 2PYZA 3P45A 4JIMA 3QNWB 4RBTA 3RC7A 4EI8A 5AVYA 3ZE1B 3CCBA 4IH6A 1N6QA 4CM9A 3PO5A 4KFTA 4UY8T 4AL7A 3AEZA 1Z45A 2MWMA 3V4FA 5LSAA 4I50F 2BFEB 1LDBA 3IH5A 3PU6A 5IUJC 2BM0A 4DLVA 3H5RA 2P7HA 3NS7A 1KO1A 3IIKA 1FNOA 4C0KA 5A9RA 1NI5A 2QY9A 4FF4A 2ZYGA 4LMRA 1N34B 1AXQA 1SXQA 2HCRA 1G60A 1BDIA 3IO1A 4LX0A 3T7EA 3FQLA 3NT5A 3GCGA 1QP0A 3LCJA 1N0VC 2DECA 3MPWA 1NP7A 4G1PA 1MX5A 4HHHA 2RAQA 2ZR9A 3C8DA 2AYYA 4V02A 2LIPA 4HRXA 4W92B 3W5YA 2D3TA 2HQDA 5F7JA 1ZITA 1GTEA 2I0FA 1M9NA 4C7JA 3BRWA 5YASA 2E4ZA 4EO7A 4Q1EA 5LXRA 4C30A 2ZUWA 4KC0A 2FY8A 2VBXA 5C4GB 2HK2A 3DMHA 1TX4B 2W8KA 3TKAA 4MRNA 4HVZA 2I87A 3W63A 4LY6A 2PZJA 1QR2A 5ENZA 3HJRA 2DNKA 1R5BA 1IH8A 3EF1A 1KIAA 5DSXA 1LX7A 4EFAC 1SCBA 1B43A 3GZNB 3WX0A 4NFSA 3M0EA 3U13A 2JFFA 4E5SA 5TEWA 2FMXA 2C4NA 1NXPA 3K16A 3AEKB 3AUUA 3L8EA 2C9CA 2XPCA 3D3WA 2BABA 3ISNC 1UR5A 1LWNA 3WTCA 3MCAA 4URUR 2UYYA 5KFEA 1PBNA 5IFLA 2H4XA 5LB2A 1KQFA 4KIFA 2XTJA 2BM9A 3TW8A 3JSRA 1X1QA 5D3GB 1RQLA 1HHSA 1YOBA 4LDJA 4C8KA 3HJTA 2AGOA 3WZMA 4L6V3 1I5OA 1P7ZA 5CM8B 4HEJA 1OXUA 4ZVOB 3K59A 3IMEA 3T0IA 2EJTA 4FS3A 1O9GA 4IIFA 2R7SA 5M7EA 1R6DA 1IBRA 4PSAA 4ND8A 1S7GA 3VX3A 1PWEA 1T35A 1S3GA 2VAWA 4O4GB 4OQYA 3UNGC 1O97D 4O63O 4BJHB 1NDUA 4Y6RA 2BBWA 4MR8A 2L19A 2QYOA 4EL5A 5EWEA 4X1IA 4DR7J 1WTAA 4LWZA 2W4DA 4WNCA 2OLWA 4O2AF 1XKTA 1ATIA 3KEQA 2QRGA 2P9EA 4CMEA 4MJXA 1C1XA 4RWXA 2J0XA 3JASA 1N36B 4KO1S 3DZKA 4HVCA 3F8TA 1B7YB 4QQ8A 3GONA 3GPCA 2O1EA 1MDFA 4XYGA 5MLCV 1PFQA 2DJIA 3INYA 5FPKA 5ALKA 2WG1A 4B9LA 5KDLA 3MMSA 3BCUA 1CEEA 2COUA 1GADO 1KQPA 3VPXA 2J7UA 2BJ8A 2GGPA 1GD1O 1WQ1R 5DXAA 5E3IA 5DHFA 3WLRA 1YIJS 3AJRA 1NW8A 3ADBA 3JARB 4C0LA 4ZA1A 4MJ3A 3I4CA 4P71A 5E9AA 1QC5A 4GMKA 3HZRA 3IJPA 4B32A 1QUPA 3KDNA 2V8BA 2R85A 4KBIA 5DO9A 1ZMBA 4ILMA 5KOXA 3ZJVA 3FPLA 1JYEA 2VPYB 3A12A 2GXUA 3G1TA 4XSVA 2OO3A 3OQIB 1WTCA 3S70A 3B1YA 1PVVA 3LPDA 3U3JA 1FX4A 1S77D 4BKRA 3L5OA 1XZPA 2QLFB 4RA9A 1NXSA 1NWCA 5L1KA 4YMTA 3U3OA 1SG6A 4BNYA 3DTTA 1JKMA 4UHFA 1HZZA 1NN5A 3A4NA 1RXCA 2RUGA 3D6HA 2DLNA 1QO9A 2IXFA 4NARA 2ZJ2A 4FCCA 3PQ6A 2Z9CA 3A8IA 2I91A 2O7RA 4QUDA 3MJFA 3QXCA 1P9NA 2QDKA 2MCFA 3UN3A 1S1UA 2ID7A 1J00A 5J4KA 2AUMA 1JYFA 4M36A 3IUPA 1NJFA 1IHUA 5CD4H 3UH0A 1NUUA 3QX7A 5K0NA 3OJUA 4KPGA 1DKOA 2AQHA 2GRAA 4X62F 3N7UA 4UMVA 4LRDA 1L5YA 2OD6A 2BN4A 3LP2A 3NTVA 1ITZA 2ZATA 4RULA 5JV5A 4QIGA 1AJEA 4C3KA 1T2UA 3H19A 1DJLA 3TZZA 2JLZA 1F4LA 4J9OA 5GAHU 2J9FA 2QTBA 2GPAA 1XQ9A 1JJFA 2R79A 4QEKA 1Z3CA 3EULA 1U8AA 5LA6A 1E2IA 1IM8A 1UDCA 2VDQB 4CLRA 1VOMA 1YONA 3AKCA 1RWOB 1XR6A 4I46A 3LDUA 3ZH9B 1Y9JA 4J6EA 4YWJA 3CEDA 1VKRA 1NSYA 4L02A 2R48A 5HQLA 5AJVB 2W2VA 1D07A 1PT9A 2C88A 5CFPA 2VA3A 1XA3A 2WWYA 3B85A 1LW6E 2HEGA 5CCMA 5TPZD 1U98A 4EKGA 4WKPA 2AL7A 3UNXA 2H0AA 8ATCB 3VPGA 3EBLA 3DOLB 4BC7A 2IS4A 1TK8A 4E46A 4DS3A 1MFZA 2EWVA 1EKRA 3CRRA 3UR0A 1A97A 2P75A 2Q9CA 1YUMA 1LQ2A 4PR6A 2WJ6A 4EZ6A 3D6UA 2H4YB 3DFUA 1L8XA 3Q72A 4YJHA 1LWEA 2VJBA 3OLAA 5HHTA 4DL2A 3W60A 3L1UA 3D1HA 2V1UA 4DUZF 2OBMA 1ZR2A 2MR6A 2ZULA 1OAKA 2ZTSA 3IUBA 1FS6A 1NJSA 3FCSB 2PMDA 2GSDA 1Q78A 4GECA 4QUGA 1QLWA 1Y5IB 1P1FA 3CE6A 1S89A 4WV3A 1RKUA 4UUBA 4ER3A 3B4MA 3IE2A 1WZUA 1J4AA 3P2YA 4KN5A 2VSOA 3UVEA 3IAS1 2CHQA 1OHHD 2ALZA 2VYQA 1X9SA 2ADOA 5AKXA 1I0ZA 4RXMA 3CC2S 6REQB 3EQ2A 4FNAA 5J4HA 3J7AN 2IYWA 3ZQJA 2IYUA 1IOVA 3D8HA 4KTQA 1DLOB 1NIJA 3CIZA 2Y8EA 3QT7A 3F5MA 3A9WA 1D6JA 5JCPA 3EPPA 2GERA 3CW9A 1PN3A 3K0AB 2YNMA 5CT9A 4DJAA 1VJRA 3P52A 4ER6A 1R8CA 1QIDA 3LXUX 2OESA 3UB4A 4JI7F 1Q50A 2DVMA 4QIVA 2MZ1A 1YBAA 1PUIA 3OZRA 3L9ZA 1SR8A 5FBHA 4BNXA 1GRCA 4RV9A 2L18A 3SG0A 5JJKA 2G7ZA 4Z3DA 5LIPA 5FWNA 4PYIA 2XWSA 2Q1SA 1YK9A 3DI6B 2WJIA 4CL0A 3QBTA 2JI9A 3AINA 4CM0A 3DXYA 3J81A 2WV7A 2XCTB 1MUUA 3M6MD 3CLUD 3D9QX 3VR3A 5C46F 5J5CA 4RW8B 3L0YA 4E2YA 3OVBA 3C4JA 2HLDA 4DNOA 4Z9YA 2DB3A 2WFZA 5HF9A 2N4DA 5BW6B 4MMZB 3P8BB 2EGGA 3VQSA 2AFIA 3OEED 5A4IS 5T7LB 1QH1B 1XTPA 4YDSA 2XSJA 3L7DA 1P5JA 2EYUA 4JLAA 5IM5A 3IEXA 3PL1A 2XMBA 4BNJA 3KU1A 1B76A 4R0EA 3PFKA 2IHUA 3DM2A 3MXTA 4Q7LA 1Q22A 3FBBA 2WWWA 3ZU6A 4A8YA 3QTBA 3C3XA 5FPSA 1A2KC 1RT6A 3RVSA 4MINA 1JG7A 2OMLA 4JL6A 5KFDA 1T94A 4BCBA 3AR2A 4HPJB 4DLBA 1QHYA 2DUNA 2OQRA 5J2TF 4XVCA 2UYCA 3COZA 3OCWA 3LGAA 1HWKA 4CT5A 3PKJA 1XZQA 3ZE2B 4QPDA 1O95A 3L0SA 4QOEA 3KTOA 3AUXA 3D4JA 1YK0A 1JHVA 4L78A 5T8KA 3NCTA 1NLUA 1NUQA 2J7KA 1M1YB 1Z6QA 3BFVA 1K6EA 4LBPA 1WC5A 2YZ7A 2DKOB 1FNCA 1FQWA 2C3YA 2F1KA 4KGVA 1BE8A 1GEEA 1H2RS 3CZQA 4O44A 3SQGA 1IK4A 1F2TA 4TUYA 2G7MC 2E4UA 4UOQA 3Q40A 3QYJA 1IIRA 2HQCA 3IUEA 3IAXA 4FFBB 5H82A 3ZXXA 1JLLB 2J3KA 3AV0B 4RF2A 3MEGA 4HNVA 3D8RA 3KJEA 1Q0HA 2ZNZA 4ZXPA 1M5RA 3P0JA 1TFRA 1I4LD 3ULKA 3VNQA 1G8FA 1D9AA 1QFYA 2R8JA 3QEJA 1G19A 3EZ5A 1XRNA 2OMKA 5E1BA 4ZVTA 1PJTA 2ILZA 4TNOA 4GM0A 3KETA 5FKJA 1RBQA 2MHNA 4P86A 5CA0B 4HZUA 1OJLA 1IU9A 1WRBA 4WE3A 1FEZA 4X93A 3T3IA 4QNMA 2JJQA 4OAPA 2FC8A 4LSNA 2P4UA 1KJJA 1LCIA 2KS6A 5DVZA 5AJZA 4P72A 1QAXA 1DADA 5JS8A 2ZD1A 5HJYA 2CG8A 4OHFA 2E4VA 2B9XA 3ZHVA 4XB1A 5GGXA 1LBSA 3JD0A 1R0ZA 4UY85 1ZUD1 1D8ZA 4RK7A 2WVFA 2ASEA 5K0EA 1UJ4A 1FVHA 1TQ2A 5F3DA 4QKQA 4POAA 3AU8A 1RB0A 3IVXA 2CL0X 2QA4G 2YTZA 5AICA 3EPIA 4L8WB 5CT4A 1BCSB 1G9XA 4WVLA 2QSWA 1D6NA 3DC2A 4EYKA 5K05A 5D15A 2V6AA 3HKEA 1QE1A 3DYIA 1Y5NB 4KGKA 2ZYRA 2WF7A 1GZ3A 3OE7D 2MYPA 4FDUA 3V33A 1KZGB 4RUKA 3GWGA 3GUHA 3AKDA 4Q21A 3GMIA 1VZ2A 3M82A 4TL9A 3DDZX 3WGLA 3VGPA 4US0R 3KHGA 4XX0B 4LOAA 1TQ4A 4F3NA 4LFBB 4PGMA 3HB1A 1QSLA 2AC4A 4M0FA 3K2BA 3V5RA 3UAZA 1OMOA 1XRLA 1ICIA 2Z09A 1Z0DA 5J3JA 4I56A 1VLZA 1U7PA 4RNNA 2VOPA 2RGDA 3B78A 2WONB 2VJYA 4A48A 1FX2A 3FTDA 1BVRA 1VL5A 1SV5B 4IX1A 4DMMA 4E14A 5IZCA 5JZVA 2A0XA 5A0TA 2ZUSA 3EA5A 1OAAA 2JBHA 5ED4A 3W1VA 1FJCA 4ZEXA 3WLSA 3A1NA 2YC2C 5EYPA 2OSQA 3NG1A 5GIPE 1HRDA 3CC8A 1NBEB 2PGXA 3OI7A 1CE8A 4B6RA 1OUMA 2QQFA 1MORA 3FMPB 5G40A 4I6AA 1N1MA 2I2AA 1FK8A 2XSZD 1GZVA 1FYFA 3ESAA 1TKZB 4BMSA 2BR0A 5JXSA 1RCUA 1EGQA 2BKUA 4RW6B 2CNLB 1JFSA 4JI8J 5EUMA 3MCMA 1D1QA 3PIIA 3BGVA 2FJPA 4ED0A 1I3OA 4DV3B 1HYBA 2B5VA 3QU5A 4JEUA 1DQPA 2WI8A 1DWPA 4I81A 4B0OA 3GAAA 1BVYF 5A7FA 3GLIE 4I55B 1DBDA 5CFQA 5CDHA 2CQ3A 5BMVB 3DFFA 4B8WA 1CIVA 1QRUA 4PGHA 4HXFB 1NN1A 2XUQA 3B6IA 3R2DJ 1YB1A 1T5OA 1UWBA 3LALA 2ZIWB 3R3TA 2DR0A 2G4CA 1Q1BA 1GPUA 3A1YG 1OZFA 4RLFA 2I2XB 2X0EA 3K9HA 2VIHA 2EFGA 1KAOA 2I1VB 4LDPA 4G0QA 3QPIA 4DV5F 3GYGA 4K9KA 5JECA 1S0VA 1AZSC 6AT1A 3IQXA 3C1AA 1NP3A 4AKGA 3HNOA 1UXOA 2IMWP 4FMPA 4L4ZA 3OW2R 3DLHA 4RWWA 2VTKA 2R7WA 4IOCQ 3UUGA 3BRWD 3ZV6A 3F6EX 2JHAA 3A6JA 4RNDB 4EFLA 3U4IA 3OZVA 1O77A 1XNJA 3MG9A 2IC3A 4X4TA 3EIWA 1JNXX 5AQEA 1Y11A 1CJVC 5JTUA 4Q3LA 3TIGA 3EMDA 4X91A 2OB2A 3WLHA 1WHSA 5HEKA 3H11B 1P2GA 2LWIA 1HBMA 1F9EA 2NSBA 1T5SA 5KTPA 3OQMA 1UC9A 2FW1A 4G85A 3OIUA 5JYEA 5ED0A 1Z22A 2VHCA 4GMDA 1HBNA 2GTIA 5CYQA 1VCMA 3AR3A 4N5DA 1XVAA 1V41E 2ROQA 5HK9A 2PUBA 4QYIB 4XDHA 1OY1A 3L82B 1LLDA 4P0PB 3T1YJ 2Y05A 1QRAA 1SC4A 5HKOA 2DNPA 3X1KA 4B3FX 3ZTOA 1H8EA 3QXSA 1ZH2A 4PSCA 2JS7A 1N6QB 1X7GA 3A58B 4FYYA 3ZKAA 3D7SB 1MGPA 2Z58A 2RBEA 2WJAA 1S1VB 3I42A 3AODA 2LQ9A 2G6TA 2JI6A 2ZZNA 3DXFA 3F5QA 5DGTA 4UAJA 3GCWA 4B3SJ 1DLOA 3FSGA 2BI7A 2YW2A 1KYWA 3WAKA 3KLFA 1B0UA 1XALA 3ZLVA 1A0OA 2GM5A 3L41A 3EGIA 4QC2A 5FNVB 1YVRA 3ABIA 3PRHA 3H42B 4OX7A 3I9KA 1UWLA 2FJ0A 2XB4A 3IIJA 4WBXC 1DJNA 1Y3KA 4FF3A 3LM8A 1JXVA 3LX4A 4NLXA 4CU2A 3H9CA 4PU0A 5BO5A 2VH2A 2YH1A 1KH3A 3GT0A 4UM5A 4J49A 1WOYA 1FNXH 5CABA 3MELA 2GN6A 4IDOA 4HX2A 2NTEA 2PUWA 1PQWA 4BKUA 1VHLA 2CMGA 3O4HA 3D59A 2QRPA 1VLOA 5IC5A 4TY8A 3CJ4A 3SCIE 3QGPA 5CAAA 1TIKA 3HYRA 1XQ1A 2XHWA 3UWMA 3WGMA 1OVMA 3KT0A 2WOJA 3ILHA 1CP2A 1KD1T 1A4XA 3ECAA 5HBMA 4QM7A 1U8UA 3BIWA 4M2LA 4OKNA 2E7ZA 4X00A 2VNAA 1H1TA 1SQGA 2VPZB 4EA8A 2VUIB 3VAIA 4DL4A 5IHXA 2R9LA 4A8PA 3AD7C 1G6Q1 4LRBA 1YJ5A 3GHYA 1N1GA 3MFHA 4H7KA 3OZDA 5JH7A 3MOSA 5JSYA 1XJWB 1ID8A 5FI3A 3HBAA 3TARA 5ALSA 1OOEA 1FNNA 1N5QA 1TCCA 3E2PA 4QX6A 4MGYR 4QRIA 1Z56C 3QHQA 4GRDA 2FW0A 2NIPA 1M1KT 1YR6A 5FRDA 2OAUA 2OXIA 4IDNA 1DV1A 4W4TA 3RUPA 1K8YB 2VYFA 1QV7A 4Y2XA 1FX0B 3AWDA 3WDKA 4EI2A 2ZYWX 3U3KA 2F4VF 3OIYA 3JXOA 2PL9A 5E4TA 2Y8YA 1B42A 2R4UA 3SQNA 2BPOA 5ADHA 1PTJC 2QX8A 3FAKA 3TOVA 2MLXA 4G0PA 3MTAA 3AVQA 4KUEA 2K2WA 5JZMA 2D1CA 3IUMA 2WZCA 4HACA 4NNJA 1NJ1A 3MLEA 3F78A 2G88A 2VF4X 1IKXA 5BNZA 4W9MC 3HY4A 1T2AA 1TQLA 4BB6A 3KLIB 5KAPA 1DMRA 5KOHA 3TO5A 1ZJWA 1E58A 1SUEA 2HL6A 5J58A 1N6LA 3FOZA 3I2GA 4MPJA 4URHA 2UUTA 2ZBQA 2RK6A 3QXGA 3D5TA 3GNQA 3BFJA 1CX9B 3COYA 4Y00A 3RU7A 3W9UA 2E5HA 2ZSDA 3BE6A 1RBLA 5T5QA 4XRGA 3OD1A 1HY3A 1OAOA 5CLIA 1F2HA 5DM1A 2J6TA 5FBQB 1BJTA 4M8NE 4YRJA 1C1DB 5AKYA 1BCRB 1VKNA 2HOQA 4PHFA 3E8MA 1QAIA 1MABA 3WL4A 4Z51A 3TDNA 2OSRA 5KKAA 1V6SA 2IBKA 2OO5C 1IKVB 1JPNA 4DV6J 3CJ0A 3ONQA 1K9MT 1SELA 4OBXA 1IOWA 1JLFA 3L0DA 3ZD9A 4W8HA 3DKRA 1KEWA 4L3VA 3LTEA 4XZ3A 4RTNA 4QSHA 2NTYC 5K7SA 4YP1A 3NIFB 3VDQA 1GM5A 3BIFA 1JA0A 4BFUA 4QWCA 4ILRA 2WA2A 2OEPA 1RAHA 4TSKA 1L7OA 4F7VA 5FUYA 5DU2A 4F5ZA 1YAHA 2JBWA 4NAHA 1PFVA 1QE1B 3HKEB 3ZHCA 2YVLA 2RVJA 2EGHA 2ZXEA 3R27A 4N5SA 2GYVA 1QV9A 1ZH8A 3PC4A 2Q8QA 2EZTA 2JGRA 2AYXA 3IBFB 2XNSA 1K7YA 1TOAA 3JAKA 3FR7A 4DMLA 3KPUA 4IFVB 2MTLA 1MVNA 3WRYC 4CTKA 1XFDA 2WAOA 4EHLA 2WONA 1I9GA 2A18A 2GCOA 4KFRA 3A2NA 3K57A 5THWA 3VO2A 4XR9A 4ARZB 1E2MA 2I9KA 2V0GA 1EFPB 3IGFA 3GJZA 1EAYC 5BSFA 1M8JA 2FP4A 2AE1A 1TTHA 3PFGA 2R8HA 1DUVG 4I6JA 1XA0A 4RLSA 1N4LA 3QBJA 4Q03A 2VG6B 1IMOA 1OTYA 2V9KA 4Q9AA 1UJNA 3N2LA 3TQCA 1NI4A 3DWGA 3BSNA 3AFGA 3VHXB 4HDSA 1CJKB 2XZTB 1PEKE 4M46A 1E79A 1J90A 1ESEA 4C8ZA 1KDRA 2JVIA 3CMAS 4DSNA 2XBPA 2QTHA 2YMLA 3PDCA 5GVRA 5J63A 1I8TA 1PBUA 3CUKA 4PRZA 4Y67A 3AOAA 2AJCA 1MW9X 1X4GA 4F0HA 3GJQB 4NR0A 2FPPA 3PDWA 2ZC4A 3VOAA 1EWYA 2P5YA 3OTGA 1Y00A 4IFVA 2PDAA 4YRMA 2GBPA 2XB2A 1B6TA 1YBVA 2CXSA 1WULS 2V69A 4Q4CA 4DGQA 2XTZA 4TTAA 4BZZA 1T0BA 2FDRA 1TIPA 3LDHA 5IVPA 1T03A 1YKGA 2TMDA 4NXMJ 3AONB 2PU7A 4UZCA 5GMOA 5A05A 2LYVA 5DLFA 3KM0A 1W5EA 4OHXA 1RWWB 3CXUA 1LWEB 4YYZA 1VL1A 1UWBB 4MKZA 3BJRA 3ZE8A 1ZD5A 4TWIA 4MI1A 2JX2A 3EEBA 1EA7A 1ILEA 4DR6F 1B0VA 3PYLA 4XIIA 3RTVA 1Q95G 1E1KA 4YMLA 1GJRA 3OFSA 3TAXA 2AFIE 1QHNA 1KZ4A 4ED7A 1KQSR 3N0WA 3LJKA 1DJQA 2QTAA 1GKYA 4XW2A 1C0IA 4CHGA 1QY7A 1RLOA 3N6VA 1H42A 3NALA 4B2IA 4B3RB 2J8SA 1E96A 5I5GA 4IZIA 2E5LJ 4C4PA 5JWHA 1MABB 4AC9A 3NX4A 5DN6D 5JS7A 3K2EA 3EE3A 1RRPA 4G3IA 4H3KB 3CUSA 2R2AA 3Q89A 1I10A 1K6JA 3KOAA 4C0WA 1AQNA 3HNPA 2IRUA 2ZTUA 1FRMA 1IHYA 1KBOA 1CUAA 4GWKA 3ZDFA 2GNKA 3FKSA 3K9QO 3H1AA 5LLDA 3BVPA 5EJEA 1PV4A 2ZROA 2GNPA 4YRKA 3EWSA 3QUCA 4AJOA 5B2ZA 4BP3A 2LUOA 1KOGA 3V1KA 2EATA 1X7DA 3G0IA 3DFKA 1SHTX 3I61A 5KX5B 2HEIA 4CDMA 2OORA 2OKGA 1VHFA 4S1VA 3AJDA 4Y7CA 3A6FA 1EFDN 4ILKA 5EPEA 4DZ6A 3GT4A 2QPOA 3T4UA 4DU8A 1T0UA 2PJDA 2KT2A 2R96A 1NWHA 4C4ZA 4W8GA 4DV3J 3UUEA 1X4DA 4JR2A 1VPWA 2WT4A 3CCVS 3OQ6A 4L85A 4YBRA 5ETPA 3FEZA 3IE0A 3MUEA 4WN9B 2XQGA 4RW8A 3EXAA 1HDCA 2VAPA 4RE6A 2ZRQA 3VV3A 4I55A 2PLWA 1V95A 1VYVA 1EUYA 1RHRB 1RYMA 4QTXA 3M1VB 3LQYA 5JD6A 2FCRA 4MVJG 1UEJA 1DG9A 2YCLA 2GQCA 2FLVA 3N2EA 2V6MA 2JIBA 3PFOA 2OKQA 1FUYB 1VSTA 2V54A 4YR3A 1Z6YA 4DUGA 1I5RA 1C0PA 3P2IA 2VUGA 1CULA 4NXMF 1NN3A 3KNGA 5JXIA 4BX0A 1M54A 1MNAA 3VJLA 3I8SA 2Y1XA 1IRIA 4V2UA 1VK3A 4QFBA 1OLXA 3CH6A 5A06A 1UPTA 2ZIXB 2F4VB 2PO4A 2PZAA 4ZHQF 4KXFB 1FDSA 5ALUA 2MKHA 5HS6A 3N58A 3UCXA 4DJTA 2D9OA 1VQPS 2ILTA 1OBVA 4HVAA 3PNSA 3DNPA 1JVSA 2XA9A 2WNHA 3FRJA 2CCJA 1I6MA 4CIBA 1O7JA 5LQNA 3PDHA 5LJ3Y 2SECE 1T8UA 3TSWA 3SICE 3M2RB 3AX6A 1E1YA 5CDYA 5DM70 1N3BA 4ZOCA 3G5MA 4XASA 1EH5A 5K8PA 1F9EB 5CXUA 5CB8A 2XA1A 2JAUA 3Q6IA 4WECA 1OBFO 2PQMA 4KV7A 2HYIB 3KKZA 1CY1A 1WEYA 1X1AA 3Q2IA 4MCJA 1NA5A 2GHTA 4BLQA 3U09A 3FTNA 4H77A 1E69A 1NUPA 1OCEA 3QPWA 3R3ZA 4BO3A 4CLRB 2EG5A 4TVSA 1KRHA 2ISQA 1O2DA 3PPVA 2QYSA 1ECGA 4TLEA 2UUAB 1HEYA 5DDOC 3FTCA 2EBEA 2G3YA 4YY3F 1VYAA 1DFIA 1ZJ6A 5ITZA 1AYEA 3H2UB 2WHXA 3BPDA 2QO3A 3HI6A 2PN1A 5L6LB 1TTQB 1CJSA 2E18A 5IBQA 2AVDA 5HL7Q 1HSZA 5B58T 1MQ8B 3FYDA 2WHQA 1H2FA 2BUBA 4PYAA 4F3MA 4KH0A 4ICLA 3T1TA 3VPFA 4URVR 4JUFA 4PPFA 3ND6A 1RJGA 2VDWA 5FHQA 2IXTA 4UFPA 3QYYA 3K70D 3EEQA 1IUKA 1NQ5A 4JMLA 4K4XA 5IXJA 4DR5B 3LFHA 2JEZA 3G7NA 1JHQA 4HXEB 3H9JA 2JATA 2OY0A 5LDHA 4DJJA 2XX3A 2QX4A 4GF5A 5DNEA 3EFOB 1DOAA 2OP0A 2DP4E 5EI5A 4CV3A 1CTQA 3R2CJ 5CCLA 1TUEA 4S12A 5DNDA 1SD1A 3CR7A 4G8DA 4QCLA 1M2EA 3SR0A 5KT4A 1DGQA 1JFTA 3ORYA 2NR0A 1DUIA 3NMUF 1D3AA 2B4UA 2ZVIA 1OLUB 3OQPA 3KYLA 1FFDA 2FPOA 4HMOA 2QM7A 4WE1A 2CYYA 1HW8A 1KEEA 2FVSA 4EPXA 3FZEA 4B09A 2XO6A 4DNQA 2WMYA 4C4WA 2XVYA 2RAVA 2WZDA 1UINA 4S1WA 4E7OA 3EDMA 1FDRA 4DLTA 2EU8A 2EBFX 3S7RA 5C8XA 2Z0GA 2CN1A 2HHAA 2MSTA 4Z8YA 5DYYA 1CDEA 2PGCA 4Z54A 1Q7GA 4AF6A 2X13A 4MO2A 5D3ZA 3FEYB 2AHRA 2PNJA 4R2MA 3P97A 1XAJA 1V9SA 4MV7A 2G72A 3KUEA 4JVLA 5IXUA 1Q7LB 4G65A 1E3JA 4OOFA 3OPVA 3AZQA 4AMUA 3R9XB 4DNPA 1YDEA 3P49B 2UVVA 1QP4A 1Y1RA 2KM1A 4PYRA 1WCIA 1QGUA 1FDIA 4PZAA 4R5PA 4FYJA 3GCXA 4U5QA 2AXPA 5I8ZA 5L4SA 2M6RA 5E3AA 1KZ1A 3FEXB 3HCEA 2G2YA 4M98A 2CDQA 4LSGA 1WETA 2J0UA 1EP9A 2LXNA 2XUJA 2IS6A 3UJHA 1I3OB 5BR8F 4WOCA 1Z0AA 1E2UA 5KTOA 1D6SA 3H7HB 3SBXA 1A5BB 3KJZA 2F1JA 3B89A 4ARZA 5TGZA 4XUCA 5JALA 1T6ZA 1ZMXA 3GL9A 3NGUA 2V2KA 3I0SA 5ALTA 1BDJA 1QCDA 4Y6QA 4I1UA 3RKUA 4FKZA 4WLUA 3NWEA 2ID4A 3X43A 5EOVA 4F2SA 4IIXA 3IGVA 4X3OA 3B38A 1YRBA 1NOJA 1R16A 3D0KA 5EGNA 4KUHA 5HJ7A 5A4FS 4GMGA 4PO9A 5D3MB 3GLRA 1COZA 1DC7A 5CEEA 5AXBA 3LCMA 1EM8B 4ZI3A 5JUMA 4E88A 5BV8A 2C2MA 1UT6A 2IDEA 4QVKA 1O6ZA 1K8QA 3SDEA 5FUQA 3IKJA 5B55A 3ZWAA 2CT8A 4ZQBA 3W2GA 2HU8A 3OZUA 3D2BA 3KELA 1R9JA 3GZJA 3OX3A 3FDXA 3PK0A 2QGNA 1Q0PA 5PNTA 3DMGA 2LEPA 3GJRA 5DNUA 3JWHA 3G8SA 1SUFA 3DOFA 4BO2A 2XOXA 4MYTA 4RFVA 5HUJA 3LUAA 4ARIA 1YS2X 3NHPA 2EFQA 4LRWA 1X92A 4AY3A 2HIMA 1QIGA 4MTPA 4BLVA 1ZOPA 3OSUA 4H4EA 4PE5B 5EDWA 2LECA 3M7VA 3QZ7A 3HB7A 3CDEA 1WDWB 3FHOA 4CEIA 1X13A 5CLJA 5DTQA 1JX6A 1UBOS 2ZWPA 1ECCA 4D6PA 5SZKB 1H69A 4FKMA 2P69A 5K0FA 1HWIA 4B3MF 1WY7A 3KT3A 3MBOA 4MRVA 1J8YF 3K9LA 3BEGB 2F00A 2JK1A 3FKJA 4NLGA 2ODPA 4RUHA 2GNOA 1GNSA 4GP6A 1JZTA 3IO3A 1W9MA 1G20A 1E1LA 4LGYA 3H9EO 4XQCA 1IPFA 4WK3A 4AI6A 2X6RA 2AN4A 1T1EA 4LSNB 1XX6A 2RGGA 3GEIA 4TWJA 4YAWA 1UETA 3NHRA 1OLSB 3LZ6A 4C4SA 4OQEA 1MTOA 4XIUA 3KLFB 1JDNA 1GSOA 3I2YX 4NABA 5EJ6A 2G13A 4MV6A 4HDCA 2N7CA 2YH0A 2NXNA 3X2SA 2HM7A 4AJHA 1VE3A 3ZTSA 4DDTA 3EZUA 2E1RA 3AVVA 4A92A 3VKGA 3TQTA 2IY7A 1CWUA 3ILJA 4DM3A 3W8PA 1NK5A 3TZYA 3DOMB 1P0QA 1PNQA 2E87A 2HNAA 1SVSA 3ICEA 1ZZNA 1VA4A 1LPMA 3STXA 4JXZA 1Q5YA 2F9JA 2Y76A 5KG1A 2QIPA 2Z30A 1CLEA 4LOKA 1RT4B 4IFEA 1XNRB 4ZPCA 1WEXA 5G4KB 2G9VA 3QTTA 3EIOA 1LX6A 2YDYA 3A1UA 1WOMA 5J2MA 3K4QA 4MLDA 3OXLA 3GYBA 4YR2A 1XTKA 4MP3A 2QMEA 4UTNA 1BQ3A 3D8NA 4ZLPA 3E3MA 4V0MA 3N6XA 4F9FA 1ZP6A 4NBNA 5D8HB 1F7UA 3UQYS 3SJZA 3HRHA 4KSCA 3FMWA 2GHQA 4K9MA 3DCNA 3CJKB 4PZ0A 1HD1A 2NVUA 1JVNA 1NVTA 3R23A 4AJPA 4EAQA 3O2IA 2WD9A 3V6DA 3ESBA 1SVMA 2H16A 1HE4A 2OBLA 5ALMA 3S0JA 1F3OA 2ZXFA 4OB6A 2ERCA 1M6VB 2X6TA 1CY6A 2N4CA 1GT8A 2H4JA 4F38A 3UTCA 3M2VB 4E0DA 3HHKA 3I96A 1E64A 1SJRA 3E8SA 2P9TA 3IAAA 5FPQA 3PENA 3ISJA 4C2UA 2JOQA 2HVZA 4RJTA 2XB6A 1JBQA 4QGAA 1CB0A 4UM8B 1LEOA 3RUBL 1RC1A 1TAGA 3QWUA 3RAJA 1K73T 3DE7X 2X8AA 2IYIA 2H5EA 2REQB 3GIKA 5KHLB 3QVTA 1P4GA 4TSFD 1DRVA 1FZTA 3PGXA 3A05A 1SHKA 1HDXA 3O3NB 1RT7A 2CNKA 5I45A 1OW3B 2QSYA 2FLLA 3R7SB 1N5OX 1UW9A 2GXAA 3TAPA 1WV0A 3ZZRA 3ONNA 4ZCSA 1XCMA 2O8DA 1ZXXA 4C0AC 3T5PA 3LYHA 2QD1A 4Y6OA 2EC5A 5FOUA 1GZ6A 4EHDA 1JR3E 1NBMD 5AT1A 3Q8RB 1UC8A 4GRAA 2V4QA 4BNMA 3BR8A 5K3AA 5C31A 3RAXA 3EAGA 1JQ5A 4H54A 5AKGA 1C14A 1LSSA 2E82A 3F46A 2G76A 4ZVNA 1AXRA 1RYSA 2BZGA 4F06A 2QS9A 1QYXA 4X20B 5GAGI 1NU8A 3JALA 3M9XA 3CVKA 1UTAA 2QWXA 2VKZG 1DI0A 3IBTA 4IMJB 4OLHA 2JFKA 4K6OA 3MWDA 5A3SA 5DK6A 5BN4B 4XD7A 3WB2A 1XDBA 3HP1A 4N82A 4H1HA 1R7RA 1ARZA 1WDTA 3WAJA 1SU4A 4JELA 1GVHA 2XNCA 5KT5A 4LK3A 3V4LA 3MCOA 3CLTD 2W0MA 2QB5A 4AURA 3WLAA 5LWHA 3H9BA 1RABA 2M1XA 2IX3A 5AHXA 3GBSA 2BKLA 4HTIA 4XVQA 2ZLBA 2BFPA 4HQ0A 4D9EA 5ETKA 1R5JA 2HRBA 4ETXA 1HNWJ 4L76A 1IDOA 2J3MA 2O8FA 3HJHA 2GARA 2KW5A 4LJKA 4JXXA 5BVGA 2EARA 3PJDA 3H8VA 3TSAA 1WOOA 3UWDA 3ITHB 1IM6A 4TYPA 2ZH8A 1RCTE 4P73A 1R00A 4JLPA 4JC4A 3FWHA 2FG6C 1U49A 5KQPA 5E2QA 1Y3CE 2B8EA 4CL3A 1DKQA 3J80U 1F0YA 1V6AA 5LFAA 2XF8A 4IOJA 1XNQB 1GQEA 2WFMA 2AXEA 4JLBA 3DRRA 3JATA 2DCMA 4FYWB 1NXWA 2FSUA 3TJRA 1AK1A 2YH2A 1HH4A 3LRXA 2IYEA 1L5FA 2EDAA 4RBNA 4NL4H 4JJIA 3V6JA 1NDQA 1K7XB 4IL5A 2HFZA 4MR9B 1ZAVA 1U11A 3CQ9A 3UPFA 3F74A 2CWWA 4MUJA 3GH3A 4C7QA 1ZNYA 3K4PA 3MWGA 1SBQA 4GKBA 2XMAA 4AJLA 1QRTA 2J4CA 2QZZA 1B15A 1PT6A 4UAGA 4MK4A 3FCCA 4LV6A 5DTIA 2Z2MA 1CR0A 2GQQA 3UYLA 5AJXA 5IWCA 1OH6A 5L9XA 1CJMA 1W30A 4RACA 1Z16A 4U00A 3COSA 1T95A 3D1LA 2HHHF 3TW8B 4X4OA 4U3JA 2W2KA 2XY6A 4J37A 7MHTA 3LHKA 4CO3A 5I4MA 1MLDA 4HFNA 3OT9A 1B1AA 4C8YA 2FGKA 3PWSA 2PSDA 2H11A 1Q77A 2NYUA 3DE3X 1E9VA 5ITVA 2H1CA 4RORA 3GVPA 2NU8A 2DGWA 4WX2B 4J9SA 3ZLUA 3WKCA 3W3SA 2HQIA 4RTJA 5C4IA 4CCHA 3PYFA 1GAWA 1JT9A 1VDMA 5FL3A 1E9RA 4C88A 1EGVB 3IQIX 3IQFA 3Q0IA 3DMDA 2JLVA 4A8QA 1TT5A 3ZQ6A 3CBQA 3ROTA 3K2YA 2WA1A 4DMHA 1F2TB 3B6BA 2RGXA 1MO6A 2VS1A 4KVFA 3C98A 3BGSA 1V7PC 5I42B 1ZGBA 4H3VA 5DYTA 3CNEA 3GFYA 5DGXA 3FZBA 4H60A 4DL7A 2B4PA 4R2XA 2WUEA 3KOOA 2WPNA 1A5TA 3SYLA 1HLFA 4UBMA 1XNRF 2IX9A 5JWOA 5IAEA 3EG9A 3CJ8A 4EX7A 3RYCB 1ZU5A 2ANBA 3N4WA 2GXQA 2Q3LA 2WIKA 1T8YA 4JL8A 3ZVMA 2P30A 4EQZA 1CIPA 1RAAB 2O0JA 1U6KA 1TMKA 2LMIA 1HMVB 4TQRA 5HUHA 1T36A 2C2MB 2HHWA 1ZK1A 2CF6A 3TK1A 2XQIA 1C1CB 1ZVMA 1MIOA 1SI9A 4BMCA 2C7OA 1UMJA 2W70A 4KPUB 1IN4A 2K3KA 4DUYF 2JGDA 2J8ZA 4EK9A 4XUEA 1K66A 1C7IA 1H6CA 3KXPA 3WRXC 3HWRA 2FPGB 4GM4A 1XVUA 1RLCL 3DZFA 2PXCA 4L8LA 3SF8A 2VSYA 1K8XB 5BVHA 3PW4A 3ETOA 3ROGA 4AULA 3AKZA 5CZXA 4ELVA 2B1JA 1N5JA 4XWKA 1NHUA 4NH4A 3D6MA 5EIAA 2JFNA 2DG2A 5ES4B 3PQ3A 1DEAA 5C34B 1V2GA 1U3TA 4BTEA 1S4MA 1O97C 1VL0A 1PJBA 4GZ5A 4RWZA 2XZDA 3QEMA 2W9CA 2FZKB 3SC6A 1UFVA 1U4OA 1WQ3A 3W2VB 2ZWMA 1Y5NA 3DBHA 2PK3A 4R1OA 4MQ6A 1DZ5A 5H1YA 3T1AA 3B6ZA 1AC5A 5FLXA 4DQPA 1ACMA 5KIAA 4HNQA 4EBDA 1RYBA 2LDIA 1ZHOA 3NHKA 4NLWA 2XG8A 1JPJA 2DNGA 3TCNA 3IAFA 3ZE9A 4NPHA 3IR6A 2PGIA 2UVUA 1Y63A 5AVSA 2PSJA 2BTQB 2VTBB 4XLZA 1L5RA 1YI8A 2Q45A 2DGUA 3SXUB 3ASZA 3N0TA 1UDAA 2XXBA 3U1BA 1OFHA 4G4SO 4YC7A 4K4YA 2W00A 4TZKA 5KAMA 4TXSA 3B51X 4BX3A 4EATA 3QPBA 1XTVA 4K7JA 1QCZA 1RT3A 1XKXA 3DMYA 3H2LA 1UJBA 1YHYA 5AJTA 1LI7A 1U45A 3D8SA 3GJ7A 1BEZA 4RGYA 3TLZA 1K27A 2IYFA 1ZMRA 4HMPA 3UTDA 5IF3A 2B6HA 4KHPF 1JFLA 1T10A 2QJOA 4OH7A 4DFPA 3D3EA 3ND9A 1Z25A 3LW5C 4PG4A 1VQ8S 2PI5A 2ENWA 1KC3A 2HWTA 4YFYA 1Q1NA 3H99A 3DM5A 1KAEA 3FX2A 2WG2A 2R42A 1JR3D 2OGUA 2VK8A 3OCCA 2AFHE 3UBTA 2ZREA 1ZU4A 3IRUA 3GP5A 1N5KA 3GG9A 5BV1A 2OHIA 3KQKA 2XA2A 3NFYA 5C24A 2C2XA 3VTAA 3U9LA 2HQBA 1JLRA 3NASA 3Q0EA 1K0FA 4UVEA 4EB0A 4JUAA 2P2YA 1BDHA 3PIOQ 4CM4B 4MPRA 2UUBJ 5KFAA 3KKEA 4EPTA 3L3BA 3E5RA 2RH5A 3P9NA 3WHKA 4LC9A 3Q86A 5LC1A 1B3BA 3I5UA 1ISRA 3PXGa 2QBYA 3FOBA 4YPFA 1X7HA 1Z6XA 4NYIR 1BU5A 3OT5A 3BRCA 2DO4A 4JI7J 4IEFB 5H8WA 4MWBA 2ZI4A 1QDLB 3S01A 4GMHA 5CTJA 4A8TA 5CVTA 2ZI9A 4M0KA 4FBMA 3LKVA 5IKEA 3QWIA 2PKQP 2F3QA 4MKXA 2R8IA 1JJAA 4J0FA 4KVZA 4PEVA 5G1PA 3CNLA 1W4BA 4ZQFA 4L0DA 2GJFA 1D5CA 2A57A 2PHZA 1D6MA 2J3QA 5K6RA 2Y0EA 4MWOA 1NBIA 3QVGB 5DASA 3VAYA 4HDNB 1EQ2A 3COJA 4FZ5A 4B4KA 2X42A 1PLJA 1U5BA 2JLXA 3OUTA 3R7AA 3TL6A 4M9RA 1Y10A 2BLLA 3C5WP 4B35A 1QGYA 2CBZA 1RZMA 1TZCA 4NNPA 4V3BA 3L40A 4J9MA 1MB4A 3FTEA 1M2WA 2HDNB 1JDBC 3AY3A 2C7QA 4X1YB 3QEMB 2QVYX 5MF6A 2PR7A 3C1UA 3L43A 3OX4A 4GEKA 3HPRA 2XS5A 1YRAA 4JL5A 3IA7A 2QUZA 5C4MA 4P7VA 2WTMA 4QRHA 3ZGYA 3KDOA 4EOGA 3G5TA 2IYRA 3MGAA 4DQIA 1A7GE 4CN8A 3RBZA 1UFRA 4LYFA 2OXEA 3JQBC 2LQJA 4DA8A 1H7WA 3W4KA 1ZGHA 4ZTBA 2GZ2A 1S9GB 2ISCA 4ZIRA 4ETIA 4LDNA 3CJKA 1D7AA 1U9JA 3BS9A 4LXGA 1TL4A 2FUG9 1JXQA 1S12A 3CVJA 2A1TS 3EGWB 3CCMS 1F8YA 5TXGA 2AHOA 1JLSA 3T5BA 4KH1A 3Q1KA 3CEJA 1MROB 1KY2A 3QU7A 3KSBC 3SXUA 3TZKA 3MZIA 2NLWA 5IZ4A 3P2MA 3DAYA 3S2FA 1Y1KE 2VG6A 1HM5A 2XAUA 4GE3A 4OK5A 1KRPA 1P45A 5C37A 1CD5A 5KFBA 4IDFA 3A4IA 2WM9B 5FJIA 4TLMB 2XGOA 4BQRA 5EJ8A 4BKQA 1T3OA 3BSYA 4RLEA 3PWTA 4JI6F 3QLTA 2Y0DA 3THWA 4Q34A 4G2TA 2XY5A 3LA8A 3BQ0A 1RA7A 2GEJA 3Q3HA 2IZ6A 1FJGJ 1HE3A 2EFOA 3FVTA 4JQOA 4UQLA 1PJ5A 3DCYA 3RSHA 2HHPA 4XYEA 3AH6A 1BW9B 5F7ZA 4GC9A 3ILYA 4D6YA 2ATCA 2AYZA 2XNRA 2CVQA 2BCGY 3OURA 1IKYB 2EBHX 1N34J 5J1EA 4MW5A 3WL8A 3GHHA 3I1IA 3V5NA 2E4XA 4KQEA 3QI7A 5BSRA 5IJ0B 5DLYA 3QUSA 1OMSA 4K59A 2O9JA