4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
1FS5A 3MAHA 1XTZA 1RWUA 3BXGA 1FQOA 2J0WA 4OQPA 4R9NA 3ENQA 4L5IA 1FS6A 3BXHA 4GO1A 3DC2A 3TX2A 2DTJA 2LVWA 2W48A 2ZHOA 2J0XA 1FSFA 4GMKA 2CDQA 2QMWA 1PSDA 2O0MA 3AB4B 2LQJA 2JHEA 3NZEA 3OFHA 1Y7PA 3AAWB 3K5PA 5IT0A 3MTJA 3BXEA 2DT9A 2F1FA 3AB2B 3LHIA 3TUJC 5IS2A 1HOTA 2BKXA 4TM8A 2RI0A 2PC6A 3NRBA 3MWBA 4OQQA 1YBAA 3E15A 1U8SA 1LK7A 1HORA 3OFFA 3OC6A 2WU1A 2PA3A 2RE1A 1LK5A 2JOQA 3ENVA 3LUYA 1PBTA 3UW1A 1LKZA 2GNPA 2RQMA 2P9EA 3DDNA 1YGYA 2FGCA 2OKGA 5JJBA 1UJ5A 1FRZA 3O1LA 3OFGA 3IXQA 4GO7X 2RI1A 5FIIA 1NE7A 3KV1A 2QRRA 4IO1A 3BXFA 1KS2A 1JT9A 2J0EA 2KO1A 3DHWC 1UJ4A 3HN6A 1UJ6A 5T41A 3TUIC 1CD5A 4GO5X 4M8LA 2P9GA 2P9CA 3ICOA 3TUZC 1SC6A 1VL1A 4LUBA 1DEAA 3DHXA 4X84A 3W7BA 4L50A 2QMXA 3CH7A 3KWMA 3NWPA 3CSSA 2H9ZA 2RQKA 4L51A 4L5JA 5IT4A 3E7FA 3S1TA 4TM7A 3P96A 3IBWA 3ENWA 2MDAA 3CEDA 3OBIA 4PWUA 4NMLA 2NYIA 4L4YA 1M0SA 1Y89A 3EFBA 1O8BA 2BKVA 3OFEA 3LWDA 3LOUA 4L4ZA 2R5FA 3L7OA 1ZPVA 3N0VA 3U7JA 2QSWA 3HHEA 4R7TA 3EB9A 2I9SA 5HJ5A 2F8MA
chains in the Genus database with same CATH superfamily
4YT4A 4MKYA 1I5OB 1T5DX 3ANNA 3HFKA 1RTHB 1SJ1A 2R8IA 2SECE 1AVTA 5D1NA 4J0FA 2R6GA 4CH1A 3AJAA 4O3OA 3LKVA 2P4UA 3VDNB 3A06A 4NPHA 3TAHA 5C18A 2IVZA 1J8QA 5A6VA 3ZXYA 1NW9B 3HEAA 2IT1A 2VNHA 1FNBA 4QGHA 4FYJA 1AC5A 3I9LA 2EBUA 3HHLA 3W1VA 5BQPA 4ID5B 4CLFA 3PW4A 1EHYA 2Y6UA 1IXSB 1LNSA 5IW8A 5CVEA 2G07A 4XDGA 4KPEC 3RAEC 1KS2A 2G9ZA 5DCWA 3U4GA 5AM3A 3FRZA 5HKKA 1GNLA 1MR3F 1PYOB 3GWGA 4PG6A 2C2BA 2BUAA 3RJMA 2JRLA 3G2MA 3WLRA 2F4FA 3EIWA 5FO0A 3JYPA 1G20B 3DMNA 4LXTA 5A8RB 4DCMA 4KIAA 5ITZA 3SXPA 4EA8A 1LRLA 1QAOA 1UBCA 3CEDA 4PG4A 1FLNA 1Y4ZA 1TIBA 1R4ZA 5FLXA 5EJEA 1E1CA 2PE8A 1TKTB 3SU8A 5KX5A 2E1CA 5DX0A 4BAGA 4ZPAA 4JOSA 1SKQA 3JQBC 4OHFA 4TZ6A 2ZU0C 4MJ7A 7ABPA 1E4YA 1MG7A 4PNEA 2IW1A 2ZXFA 1U8CB 4YECA 3EY4A 3NFYA 3ZZ1A 1GARA 3E82A 3ZJYA 4FYPA 8OHMA 5SY9A 1R0YA 4I08A 2UP1A 1K0FA 4RPGA 3U60B 1G8GA 2ZBFA 2PAAA 2QBYA 5DQGA 3CLTC 5CA0B 2R25B 5G4LA 4HBZA 3FIUA 1NJ6A 3EHEA 3B2EA 3EXIB 1RJFA 4ZDJA 3LPCA 4HTIA 4BJ3A 1Z88A 4DT1B 4ERDA 1TKZB 1X1QA 1LXCA 5FOSA 1RADA 5EJGA 4USMA 4U9UA 2LVBA 1SQEA 2OPHA 4EYSA 3TVTA 4PO3X 3DGPB 2D3OR 1E79A 2AOUA 1B1AA 1DJPA 4QJ5A 4B4KA 4H27A 4TNOA 5JJIA 3QPCA 2EW1A 4FFOA 4DUGD 4TVKA 5E3IA 2XMVA 4CLTA 1HT3A 1L5KA 1FFEA 3PHTA 2BZ0A 1LRKA 1LBEA 4LG1A 2R7RA 4RQBA 1RT1B 3OPXA 2YCLA 4M88A 4JI1J 3W9UA 5D0GA 4RTPA 3TECE 1MN6A 2FJBB 2JX2A 3PA8A 5KEIA 1DG3A 2OT3B 3VJLA 2VQ3A 2WB2A 1UMDB 3COWA 5LUBA 3H1EA 5FUVA 3HJFA 4UPVA 3RKUA 4YMEA 2PLFA 5FLYA 1IM4A 4TV9B 1V35A 3I4PA 2O3QA 2V6AA 2QV0A 3RVDA 3EVDA 1SXJE 2R4FA 1AZWA 1ZG3A 3V2UA 3C5VA 3HD2A 3VUEA 5KCZA 4MYCA 3GFBA 1NR5A 1VHTA 2NQPA 4NYMR 4TY8B 3QA9A 2XZLA 5AI6A 4FJ2A 3DVLA 4QVKA 1PU2A 4HNHA 3WMXA 3HI6A 4AT1B 4RYDA 2YWFA 4ZVUA 4E2ZA 1E3LA 2J87A 1YQXA 2XS2A 5EPOA 4O0LA 2AHOA 4Y2SA 4JV0A 4J9VA 5M2UA 1QH8A 3BHIA 5AUQA 3CJRA 3SS9X 4ZVPA 2B4UA 4XK8C 5EJAA 4UOZA 3NTOA 1ZD1A 3QZ7A 3VYRB 4U5QA 3E9EA 3PC6A 4ZPVR 4ZGGA 1SZCA 2VTBA 2CHUA 3I0MA 2V4MA 3ESXA 4Q12A 2H3EA 2UKDA 3F6RA 4EVQA 1U09A 2BKOA 1UM9B 1N2GA 3I0ZA 2ES4A 1A8QA 4HFJA 4PPFA 3SKYA 1QU3A 2FZCA 1VA4A 4YVFA 1FL9A 1VB3A 1CYEA 4EO9A 4BRZA 4AQYJ 1N2HA 4NQRA 1UAYA 1T1RA 2A88A 2Q2QA 4M4SA 3JD2A 1EK0A 4RSMA 5EIOA 3PGMA 4P2FA 1AW0A 4M46A 1OXSC 2HA7A 5LPNA 1GHTA 4U7JA 2PKRA 3SC2A 5AE2A 4D5EA 4EUSA 1J8FA 3LKDA 5DIFA 3OMWA 5AQ1A 3OM9A 5EIEA 4RBNA 1P29A 2VPZA 1H66A 1USUA 2RRBA 2F1RA 1CVRA 3CZCA 4HYEA 4B7AA 2ZJRQ 4IOBA 2XF2A 1D1TA 4I2PA 5JVDF 1T3HA 3NTXA 3WNVA 2Z8YA 3AFOA 2UYQA 4B80A 4XVCA 1ZIDA 1N2IA 2GZDA 4LJKA 5JALA 2Y4OA 1NR1A 1IOVA 3HXQA 4FD3A 4ZVQB 2CADA 3KLEA 1WMSA 2YKOA 4ARUA 1VZ3A 2FZGA 1JVSA 3MT0A 2G76A 2Y2VA 4B3GA 4HI2A 4NCNA 2DMRA 3GFFA 2B94A 1NKEA 4MQFB 2JGKA 1PT7A 1U04A 1UEXC 2BZ1A 1IG0A 5CD1A 4EF4A 3E5RA 3L06A 5LCXA 4OHYA 3LS2A 2I4OA 4FDLA 4GYJA 1TF7A 5A4DA 3DLIA 3GCZA 2QNBA 3N28A 3WA6A 2CNWA 1NIJA 3NGMA 1UDCA 1ZD3A 4OQZA 3I2KA 1Q7GA 1NSQA 3IAFA 1WP4A 4G0MA 4RY9A 3BJRA 1JJIA 1E6EA 4AP5A 1ZH6A 3FKSD 1AGYA 5KKNB 3Q8PB 3DD1A 4N5MA 1PK9A 5KFGA 1F2TB 2IV2X 2NXCA 1UCFA 4Q1CA 2ZUUA 2O1EA 4E88A 4PPGA 5CDYA 5EMKA 1EA5A 4DQXA 5ILGA 2VFVA 3EIOA 5A06A 2LDIA 4FFLA 2OORA 3G13A 1C7IA 4G25A 1KJYA 2Q2OA 1A27A 1BYUA 4CUZA 3R5GA 3I0SB 3RG2A 4M1YA 1PDWA 2B4PA 4GPD1 2XCSB 1AZSC 3Q2IA 2YIVX 1VQ6S 3KMSA 3GQBB 1F6TA 5KOJA 3FHOA 4L75A 4WN9A 4H3HB 2FZWA 3I2HA 4B7XA 3FX2A 4D4IA 3QX9A 3A8KA 1VR6A 2JC3A 1IOZA 1B6RA 3B1YA 3IIIA 2HA3A 1KEVA 1MOPA 1YAJA 3R0QA 1GXLA 2EXXA 3IAS1 1DAEA 4MPTA 2HNKA 3GFXA 4YRPA 5C3UA 5DB4A 3QJPA 3CJ2A 2D54A 1O51A 4YJHA 4UFNA 3I9V6 4EFMA 1EFRA 3TQEA 1RHJB 4MVJH 1Q0HA 4RLHA 4MWCA 4W5JA 1UOQA 3PX0A 2A9RA 2FW0A 4TKZA 1CQNA 3ZWAA 2R1UA 5FLXU 5FR1A 2XUHA 4CQMA 2P9TA 2Y1OA 2ZWMA 1Y6QA 3I9OA 2WHYA 4L6AA 2X58A 3FGZA 2P3LA 3HVTB 4WPAA 4I6EA 1VIOA 3GG0A 3UJ8A 1W25A 1JLFB 3HNOA 3GIMA 1MIOB 2IOFA 1XZHA 2P1DA 3N2ZB 3KB2A 5AI5A 1E2FA 1E60A 8RUCA 2MIIA 5CJPA 3TJAA 4PCAA 3PNPA 3M5PA 4X4TA 3SY8A 4M0UA 1DIGA 3MM9A 3HPRA 3M8QB 3VKUA 4L6IA 1U6FA 2EFJA 1NJ2A 1NRXA 2WIDA 3THXB 4OI1A 2RQMA 4JI8B 2P3OA 1T2VA 3VAIA 1YJ9S 3HLKA 5BXIA 3K8QA 2C77A 5KAKA 4BCBA 1WNFA 3KTAB 2Z8ZA 3UHFA 3C15A 1JHVA 3I3SR 3V32A 4HEA6 3AOBA 4NC9A 1M1NB 3WGJA 1OBOA 1EFHA 3ZUPA 4ZQIA 4X84A 4BC0A 1JLGA 3MWKA 5CUQA 2IELA 1IHXA 4DV2J 5A5EA 5D5PA 1UVIA 5KUTA 3QNWA 5A4IS 2W6IA 1S99A 1MABB 2ZBCA 2D1QA 4KIFA 3GLFB 4M83A 4JUDX 5HJ5A 1S6QA 2ZD1A 4B7UA 5FA6A 2AFIB 5CFNA 1ITPA 4MVJF 4ECXA 4BO4A 3OCXA 3ZTPA 2Z2JA 3WKEA 4Y2JA 5SZJA 2FDNA 2WVFA 1J1IA 3JVDA 3OPNA 2W2TA 3M6WA 3NDIA 3NGKA 2D2IA 3A11A 3WYAA 3L4JA 4RQAA 4F4FA 2V7UA 2FAXA 4X4QA 1DFIA 4KR0B 2IA6A 5BOSA 3O82A 1YJCA 4Q37A 1S0MA 2Q3JA 2HY7A 1L4FA 5BVGB 1DZIA 1YJBA 4IH4A 2VPWA 2PEHA 3X3HA 3N3BC 3NS7B 4RNDB 2Q28A 3E4CA 3R3XA 2YQ3A 3FUUA 4KQZA 1CQXA 5B0FA 1DCMA 4OQ4A 1V16A 1GGMA 4FZVA 3BM5A 3I2JA 4WZMA 2BHLA 1X70A 2A9JA 3F8WA 4D9KA 3VF0B 2COEA 3KOWA 4LN1A 4MZDA 1JFVA 2IS1A 3DDOA 3B38A 1YH3A 4AXXA 2YVLA 4AXBA 1D5CA 4OZ3A 1BDIA 3FH0A 2RJZA 3OF2A 2XRMA 4UMVA 1FUEA 5LXYA 3IPAA 4EH1A 1E9SA 2GYWA 2G4LA 3OQ6A 2XHZA 2AJ8A 3II6X 4U9RA 3ME5A 1RKXA 3VQTA 2CHGA 1UMCB 1MG0A 2ROEA 1I94F 4GDMA 1U5AA 5HROA 2N47A 2QX0A 3M8ZA 1JLHA 2VBXA 4W90B 3R9WA 3JWIA 3U44B 3GMDA 2Q6KA 2CKDA 1R0CA 2VWQA 4RM3A 3SSRA 1E3QA 1JIXA 4CHTA 1K1QA 2W2OP 1RWPA 2WQ6A 4R8SA 1FK9A 3NGSA 1WTAA 2D4AA 2WA1A 4YDDB 2BH2A 5F8GA 2RHSB 2VJNA 4H77A 2HAEA 2F7VA 2RF2B 3N2LA 3GGDA 4ED3A 4PHHA 3NIBA 5E2AA 3H5TA 1T3OA 2VKTA 2YYYA 2VUHB 3FYUA 3H3XA 3DULA 4KVFA 4LRWA 1T9YA 3LW7A 4JSRA 2VA2A 5D3KA 5JJ5A 4WKPA 3WI7A 3MN1A 3OTEA 2GPBA 6REQA 3QGIA 4G5FA 3UJ7A 1OZ0A 1Z4OA 4PLTA 3WLEA 4A8HA 3Q7QA 2MWMA 3INYA 4GX5A 1NI4A 3IEKA 1TQLA 1H6KX 2O8EB 4RVCA 3QFFA 3ZY5A 3E3NA 1ZJYA 3W7VA 1ICEA 2H2IA 1MQSA 3N2NA 4OK3A 2R60A 3PFNA 4ZO9A 2HRQA 1FB5A 2FJXA 3H87A 2FR0A 2QTLA 4GI1A 2ZJ0A 2AYXA 3ZHVA 3BC1A 5JNLA 2ILTA 3EUNA 5GVRA 2FVSA 3Q9LA 4AZ0B 5JT1A 2RAQA 5EJ8A 1D9FA 4F4CA 5JROA 2V58A 3AM4A 1HDGO 4CF6A 1X87A 3WMGA 4DBLC 3I82A 1Y5IA 3BRWD 4KT0C 1Q7YT 3AR6A 2C5HA 5BYKA 1CJBA 1RYRA 2I2FA 4AKSA 4FNIA 5MFZA 1YIDA 1A9ZA 2YHAA 4HGOA 2QUAA 1CW2B 3D3EA 4BLGA 4DTCA 3WWCA 4ABTA 5A3VA 3HUDA 3RSFA 3ROXA 4N3NA 1EVIA 5DBEX 4IQ0A 2H9AA 3VVLA 1D1PA 3EDQA 3H16A 3TM5A 1I6LA 1KFDA 1R0BA 2EFYA 1AGNA 4JI3F 3GP5A 3HU3A 1LDNA 3KLEB 1L5OA 4MYHA 1T2UA 1E9VA 3PHEA 1U1DA 2HPVA 5DQHA 1XDWA 3K53A 2R6JA 5G0RA 1CC1S 1ULRA 1DO8A 1CE8A 4TWJA 2DNQA 2EZ4A 3DAHA 1UA0A 3AP3A 3HV2A 4DG8A 5KFDA 1RT4A 1PZNA 3V6KA 3FG9A 3H11B 2KFNA 2NUAB 1E3SA 2ECOA 2ZH6A 1EE1A 5CZVA 2M9MA 1JB0C 3QV2A 2HHWA 1JFTA 3O92A 1QZXA 4GLLA 5K09A 3G6KA 4YJHB 2HVDA 2YYSA 4DKXA 3N0TA 4EHHA 1AKUA 5KJCA 3CO9A 4YP9A 1ZEJA 1ZJ4A 4II3A 1U9JA 4JLJA 1AZLA 1YI0A 1L7EA 4NLSA 2PQMA 1OD6A 4WU2A 1TUGA 3T5MA 5G0RB 3G6WA 3W2GA 3EJ6A 3GWCA 2P2NA 3IHKA 2RARA 4QUAA 4AK9A 5K9ZA 2ZC3A 4OYIA 1OU0A 1VE5A 1ZJWA 3CG0A 2I0XA 4FF1A 1VPWA 2IYNA 4OXNA 2QTHA 2HHHF 4D0SA 4TV8B 3RB8A 4MYRA 4KQHA 3K0FB 3UPFA 4Q19A 4A8PA 3KQVA 1M5VC 2Z3WA 3HYCA 4EVIA 4QWWA 1FTWA 3IXQA 5JXHA 1C3JA 1NR7A 1VHIA 3DDCA 2WF5A 4CMEA 3C4JA 3ON5A 1OY8A 3O21A 2C8VA 2QJRA 1JXVA 4J16A 2Y8EA 5CIYA 4G0ZA 2CEAA 3LGSA 1XZCA 3DDWA 5K8CA 4IX9A 1JEOA 3OZFA 2R8BA 3O73A 3PZPA 1ODSA 3DEIA 4K87A 1X7WB 4ZYZA 3MJVA 1AK2A 1HFKA 2I4LA 3ED5A 5B55A 2I4IA 5HOEA 1J39A 3LY9A 4ILMA 4FYVA 3QKTA 2Y0CA 2ZYAA 5ALEA 5AXLA 4LI3X 3NM4A 4BU0A 3VPBA 4IH5A 2MINA 3G82A 3GLGB 1OB5A 4AKGA 3GFZA 3MCUA 2I9PA 3GP3A 5LMNB 2M3DA 2XUKA 2AOXA 3QQ5A 6YASA 1HR0J 1BGWA 4OQNA 2QPTA 4CRJA 4M5HA 4AS1A 3IS9A 3QK7A 3KE8A 2U2FA 5KBYA 5A04A 1GNKA 2JK1A 3FDXA 1DKRA 3BGRA 1HARA 1JALA 4EW6A 4X62B 2YV5A 4A6PA 1GPLA 3V5NA 4CUJA 4I6AA 4EFKA 4G84A 3K5OA 3RU7A 3FMPB 5A62A 5HTKA 1EAYA 3KPVA 1AK1A 5A8RA 5J2QA 2CMGA 1RHUA 3WLKX 5EE3A 2DFVA 4ZVRB 1WTBA 3IS3A 1LFAA 1Q8LA 4MV1A 1H8EA 2WD9A 1KYIA 1OO0B 3VZDA 1ISJA 3QUQA 2OPQA 1KI1A 2RKWA 2ZH1A 3PWKA 2LCFA 3EARA 2OCDA 5HR5A 3IP5A 5FFNA 4OZ0A 1S1VA 4FHZA 3WLQA 1T0JB 1Z29A 1OXXK 1ABEA 1U1OA 3SK0A 2NU8B 3IJEB 2C95A 3HMKA 3AB7A 5BYAA 4XM0A 2IMOA 4MPPA 4C2TA 3PKYA 1QC5A 4ELUA 2VG5B 4JI0F 4FXWA 1GGNA 5TF4A 4QPTA 3MSCA 4CM0A 3M8PB 5K6TA 1LQUA 2V2QA 1Z39A 6AT1B 1LZKA 1HBNA 3PX4A 3TCNA 1KVTA 1QE1A 1HIYA 1Y00A 2DRBA 4K8OA 1C0IA 2XVZA 4QO7A 1TX4B 1Z0KA 2V9WA 4OGKA 3E9QA 4LJMA 1FNDA 2HJ9A 2QZ4A 4XOUA 1IWAA 3ZDXB 4W8OA 1XHFA 1BROA 4BLWA 2PE5A 1WHTB 4X7RA 5BN1A 4FQ8A 1RBQA 3ETEA 1K8QA 5ITWA 5I7HA 1XA0A 4YUYA 4QECA 4KV8A 1YE5A 2HJVA 3ZNJ1 1CQWA 3M8RA 4QARA 3KXPA 3N58A 3KUKA 4O3MA 2BEKA 3G0CA 5EE1A 5JCZA 5B7WA 2DQSA 4BWVA 4CG2A 2YWBA 3W3AA 1XQ9A 3LWNA 2G5PA 1GEGA 4JLDA 3QFTA 1MKYA 1ODIA 3DJYA 4QRHA 5JANA 2OELA 2ZRGA 4FSXA 2CBXA 4ZCRA 5BN3B 3CVKA 3CVOA 2GTPA 3BTOA 1DRKA 2AR7A 1JT9A 3VZRA 3KLPX 3P0IA 5J47A 2YNMD 1QIEA 2FP4A 2HWYA 3RUPA 3C6TA 5T8KC 3V6MA 1FDIA 2BFCB 2XUAA 5G0VA 5NLLA 3OL6A 2VJKA 3VU0A 2QTRA 4EEXA 3Q7PA 2V7QA 2DM6A 4F72A 3FRIA 1XLTA 2W2LA 5DOVA 1Q79A 4O3FA 2ERRA 5LOVA 5EG5A 4L15A 3L7NA 3FZQA 3DI6B 1KPIA 1RRVA 1EP4A 2FK8A 3ABIA 1FEZA 4IKPA 1RLIA 1KTQA 4P3NA 2R00A 2IA0A 1Y82A 3D1QA 2O52A 1TLFA 4MIKA 1IY0A 1W5BA 1ODCA 4ZICA 2ZAYA 1I7DA 1GPBA 2Q1XA 3SQLA 2XPCA 2CXHA 5CCDA 1EIWA 3LP2A 1X4DA 1X5PA 1NDQA 3A4MA 3B2QA 4ETNA 5AXBA 3MM8A 4AJ4A 4I68A 3QHAA 5L3QB 3I96A 1HWJA 5HRCA 2JH8A 1VLJA 3GIRA 3W3ZB 4HH4A 1EM8A 1NMSA 3W5ZA 2SHKA 5KHLB 1LZLA 1XZMA 1ZSNA 4WTOB 4OLFA 2R6AA 4YMLA 4TM7A 3CC8A 4UE3S 4K6CA 2YKAA 1N9ZA 1HC7A 1VCMA 5AD1A 2Y9PB 3E9ZA 1H1TA 2VHUA 2G0IA 3L7OA 1GDHA 4KH0B 1HE5A 1DQSA 4EKYA 3J7YI 1HBOB 2I6TA 2VL7A 4C3OB 4WE1B 1T26A 1FSFA 1USKA 3AFNA 4A27A 1KU0A 4OAOA 1Y7PA 4NLGA 3VNVA 4M76B 4OP3A 1A2BA 5FOUA 5JS2A 3HU1A 3LX5A 4MHTA 4DCPB 2NWQA 2TMDA 2DCUA 4MIYA 4DQRA 3KHGA 3CBQA 5ADHA 3SEAA 4HNUA 4UOFA 2HU7A 1SCDA 1CV2A 4YT8A 2PUGA 3Q8LA 1P2VA 3RFFA 2PXXA 2NZWA 2CXEA 3KZKA 5CLGA 1H4TA 1N2CE 4Q8EA 1CZNA 3VHXB 4Z7JA 5DTRA 3R6LA 4EYKA 4C48A 3ZDEA 2DNGA 1BX0A 1ZM2A 1ISSA 2VUGA 1Q0TA 4J7AA 4EVRA 3PDIB 4X62J 5FT9A 3R3UA 1XMSA 1IL0A 3RUCA 3HE3A 4C0XA 4EG5A 4XR4A 5FPQA 2GA8A 3NJ4A 4KPYA 1Y89A 2O2XA 1XWFA 1VIXA 5JARA 1AN9A 2WVDA 4OI3A 2O8BB 4K7QA 4ZN1A 4Y2RA 2O8DB 3CIZA 1KKUA 5IKOA 1YUMA 4ZVSB 2AFVA 3TX6A 3PIPQ 4PQUA 1Q7TA 5CXUA 2BKPA 1IZ7A 2CNKA 4ROSA 4JI0J 2XNKA 3W3AH 3S8YA 3ZTSA 3IUQA 3DLEA 3C43A 3ANXA 1Y3CE 2AQHA 3WWYA 3AHPA 2DKFA 4M1ZA 4MLCA 3N7UA 2AOTB 1FESA 5TF0A 3D3CJ 1NX9A 4OY3A 2DY1A 3U5ZB 4IQFA 2PGNA 2Z2YA 4MCAA 2XWYA 1C0LA 1Z0FA 3FUVA 4HPXB 2F65A 3GB9A 3IJ5A 2KH9A 4Y28C 3UMCA 1K4MA 3RRZA 3F5DA 5KNBH 1KY3A 2FSPA 3B1WA 1A88A 3CC4S 2NQTA 3NC4A 5B1DA 2FFHA 2V50A 4KAJA 4DF8A 1EI9A 1VRQC 4B3CA 1XNRF 4RF3A 1YR1A 2BJ7A 3CEJA 4UULA 3KB1A 1IEXA 1FNNA 4ANDA 2ZKTA 5IJ9B 2KT3A 2I1VB 1DS6A 5J1EB 3BFJA 3WP0A 2A9KA 5U1PA 4ZO6A 3T7SA 2YMPA 2I5JA 4NCKA 3NYWA 2OLWA 1YDWA 3CIMA 3EIFA 4EW1A 4O63O 1HLWA 1EH5A 3H4MA 4BMZA 2B69A 1E1YA 1OI3A 4GRAA 1L4LA 4PWDA 2BJ3A 5HFAA 1AT1A 2R7QA 3DB1A 4MO9A 4LF1A 5ES4B 4CNYA 5KFQA 3EGIA 3H9EO 4UTNA 1H6AA 4LC9A 3RQSA 2K3KA 3G2QA 1K8AT 2MKHA 3DDNA 1JSRA 2QRVB 5M3BA 3W5IA 4I3HA 2WTNA 4RNOA 1KMIY 2FC9A 5JCOA 2FPHX 3H1AA 2WP8J 3IBCA 3TTWA 3PFWO 4C6AA 5GM2A 1FTNA 2Q4RA 5KYXB 2Y1DA 5ADUS 2JGNA 1JE1A 2AU0A 4QU5A 2XODA 1FDSA 4MVYA 4NWBA 1GUFA 3SQOP 1OY1A 3AKEA 2ZI9A 2RHTA 2I7DA 2R6R1 1H2YA 1VL6A 4WCDA 1PZHA 4BO5A 1X7GA 3IC1A 4DV5F 1QSGA 4YCBA 4DS4A 3V2HA 2JA1A 4GL4A 4JI7F 1RTZA 2CQ3A 1VMAA 4FMDF 1IKXA 2P2CB 1LRJA 3T95A 3FB1A 1Z73A 3QEBZ 1GZ3A 3TLYA 3MMAB 3IHWA 4PG8A 2D59A 2AW3A 3MHPA 4F2GA 3V4MA 1RT5A 1THGA 2IYVA 2I3GA 4HT3B 1X77A 5FA5A 5EHNA 1T6NA 4G1IA 2ZB3A 4UC0A 2CPIA 1NXIA 3DM9B 1C2TA 1ILWA 2J9DA 4IUYA 1KP6A 3IBFB 3STXA 4HGPA 4B02A 2QRVA 2WU8A 1XMOF 4ND2A 3IP1A 3H5NA 5DKFA 4LIPD 5IHXA 1A9XA 5LIRA 3MS7A 1MAWA 4Q24A 4EJSA 1KQPA 3V4IB 2IE0A 2AT1A 3L7DA 4IHJB 4AZ3B 1XKXA 3U13A 3LHKA 2AYEA 3H2VE 2VG7A 3KFVA 3THWA 4Z0HO 3ROZA 3SEOA 3BKWA 4KYVA 1QVFR 3OKFA 1PGNA 4Y2MA 1MA3A 4V0KA 1M1ZA 2WSSA 4DR2B 3VKWA 1JSLA 2JDID 4K28A 4FBMA 2WUVA 4RNHA 3QF4A 5EGSA 1C1CB 1BD3A 4NI2B 2R8HA 2AJQA 2CNLB 4C22A 4B08A 1Q6ZA 3GBPA 1SOMA 4QTTB 2VD3A 4TWRA 1BMTA 2CZQA 1AFJA 2IBTA 4Z3KA 1EWYA 4ETXA 4BECA 4OHCA 1P8AA 1G17A 4Y1RA 1OUMA 2O2HA 2AXPA 4YI3A 2VXOA 1K5HA 1H2WA 4GPEA 2HO5A 3EGXB 4K26A 4FXDA 1BW9A 3C6UA 1AUQA 1BWQA 3RYIA 3LBHA 4FR5A 5LYJA 4LVCA 1SI9A 1UVJA 4NCIA 4BIIA 3ZCXA 4FTWA 1E2LA 3VTIA 5GJVC 3J81j 1N2OA 1M5UA 1UETA 1QPBA 4ZEMA 1XU9A 1H1DA 3F9RA 2DLCX 2H11A 3T38A 1FYFA 2MPUA 2B7LA 3DLKA 1P7VA 1NW3A 4PNPA 4AWAA 2J6IA 3WG9A 4FMBB 2LP4Y 2BJVA 2VAXA 4QREA 3SZOA 3HFRA 4GI2A 4DR3B 1BE4A 1XJWA 2H2DA 2D1SA 5B3KA 4H7PA 3P45B 3ZTQA 4QBGB 2A0YA 4LFCJ 1SJQA 5BSHA 3ZS9A 5LSAA 1NAQA 3LFUA 3V8QA 3P2EA 2FN4A 5TRTA 5BUSA 2CZCA 4UOCA 2W9XA 5TB5A 1UEIA 1XFDA 2EZTA 5LNK6 1HE3A 1MOZA 4U39A 1V7ZA 4MRRA 1UBFA 2WY2D 4EFDA 5ERXA 2IJNA 2A14A 3U3KA 2HRRA 3NGTA 2BGKA 3AOEC 3CVJA 2H7XA 5DBHX 3WSTA 1UXJA 2W2QP 3OA0A 3DL2A 2F3QA 5BR7A 1G3UA 2G8NA 5JDCA 2NU9A 1CF9A 3CZ9A 3MGBA 1L7XA 3EN0A 4OQXA 3OCZA 4P31A 1OLSA 4E5PA 4IG9A 4AY2A 1OSNA 3W2HA 2ZWOA 2PANA 4PEVA 4ITUA 1GSIA 2DFPA 3FTFA 3CW2A 1B73A 4QQBA 1FUKA 3IS9B 1NVFA 4RSRA 4P4TA 1QJCA 4F6CA 3HWSA 3CDWA 4JOCA 4Y1EA 1YZUA 5IWAB 4UUOA 2QS9A 5F9HA 2NSYA 4HS9A 1XVIA 1HXHA 3KE9A 4YBRA 2XSFA 4ZGWA 4MJXA 4PRYA 1ZUWA 2PMWB 1Q7CA 3W8GA 3D3WA 4QWEA 4IDHA 4Q66C 2XUDA 3JQDA 4Q1EA 1PFWA 3GGJA 1RT6A 4WTYA 1TVEA 1GU0A 4RO0A 1G7CB 2PWAA 3G6VA 3L7JA 3VOTA 3G0HA 2IJFA 2VJVA 1QHGA 3P9NA 2WM2A 1VDMA 3K2EA 3ELDA 5IV3A 4DUTA 3ZDDA 3D28A 1YQQA 3MRTA 4RD3A 1MVOA 1H05A 2A4KA 1YI8A 5L45A 1SVDA 3EGEA 4OHMA 3B9PA 4DNFA 3OOYA 3TE7A 2YY6A 3ZWKA 5DEOA 3QELA 3AEZA 3QI7A 3EISA 1ZGAA 4E1AA 5FX2A 4KHMA 1QKIA 4D0GA 5KJFA 1CJKC 3DOHA 1RPNA 5JSYA 2XXBA 1GXTA 4C04A 4L08A 4HWKA 3H1BA 1QHHA 2YFYA 4UTPA 1ZSVA 1DBVO 4YJGB 1N2SA 5IAKA 1SD1A 1J2JA 2NCKL 3TD2A 1AM4D 3Q8RB 3ELHA 3JSBA 2UZ1A 2ODTX 1W19A 4KN6A 1P5JA 5KTRA 5E6SA 4MHOA 4LFCB 4R2WA 3I8OA 1QDUB 3LDFA 4ZHRA 3DB2A 4TRMA 1SKAA 4W5TA 3S5JA 1O97D 4EKGA 4B3TJ 3BRWA 2FG7C 1HR0F 3RG8A 3C3DA 4KXXA 4D79A 1HD1A 3T4UA 1A72A 1F48A 3ILSA 3V42A 1Z5NA 2J6BA 3IRXA 2LLZA 1JWBB 2FWAA 3RQIA 3H59A 4RWWA 3CH6A 1QE0A 4MMZB 4L16A 3U7QB 1E6LA 2FWJA 4NFLA 2AC4A 3TAPA 2XZTA 3RUFA 4MUNA 1RQXA 5ALWA 3VHLB 2DR6A 5IJWA 2D06A 3SHWA 4G1QA 3R5HA 3KQUA 1W8IA 4R2MA 4EY6A 4W5OA 4JV5B 4TYYA 3HGMA 1XN4A 1SB8A 3HXTA 4QL3A 3TXXA 1JHDA 1KI4A 2RGRA 3WJ1A 3T1AA 4PSKA 3CULA 3R0VA 3N5CA 2XMPA 1P9OA 4WXYB 4CF5A 2IU0A 3S6EA 1QIGA 4NBLA 4KREA 1FA0A 4QATA 3PIIA 2YQZA 3N6RA 1RLDA 3GLHE 2AN1A 3OWOA 4NFSA 2ZVDA 3X1MA 4M8NE 2RGGA 1DRUA 4DR1F 1MENA 2FETA 2V4JA 1F51E 3IODA 4INJA 2R8PA 5JY1A 5J2QB 1W9MA 5ADWA 2PUHA 4BPRA 2VF2A 1T02A 1D03A 1O0PA 1NASA 2P7IA 1W59A 1S3GA 5F35A 3FR7A 2JKZA 2DBZA 2I7VA 4JI3B 1COWD 3IULA 4H18A 1Q5VA 3V3KA 3BBFA 4JH0A 4BO8A 4OBEA 2VTVA 3DXZA 1RAGA 3P4UA 5HRUA 3EUEA 2DTXA 1QYXA 4JLSA 3JQPA 4YV0A 1VFJA 3GZJA 2L42A 1TM3E 1VFNA 3H9UA 3KWLA 5KFAA 2KDOA 1EJ2A 2X1AA 2RB4A 1FP6A 3R1IA 4F91B 2J6TA 1SC1A 2V7EA 1U4OA 1H42A 2JFDA 1JIHA 3DUWA 2BF4A 4M54A 3K6SB 4JC4A 4J29A 2P2ZA 3P9CA 1PAEX 4B85A 4NNPA 3DLTA 5IXJA 3ONVA 2IFXA 3I6YA 2Z8XA 4BKQA 5KNDA 3KSZO 1SD5A 5GMKa 3THYA 2P2GA 5HMYA 2R7UA 3DL4A 1K44A 2FJWA 3L8DA 3PRJA 4PYNA 2DD8S 2DO4A 3UJNA 2XMAA 3KB8A 4DDFA 2RK3A 5HKKD 1NQUA 2QL7B 3UAXA 4R05A 1BFUA 1W7AA 2XM3A 2OPBA 1E89A 1OVMA 4P80A 4D26A 3EQ6A 2Z5FA 1L4YA 1Y6JA 3UXYA 5BSKA 1TC2A 4L85A 5K0CA 5B08A 4WYLA 3KVNA 3KLOA 3R8CA 1XQXA 1CCWA 3F4LA 3M7IA 2HBQB 3HYNA 4NYJQ 4Y2QA 1KE1A 1QCDA 1X8KA 3HNPA 2H3HA 2V7PA 3ESBA 1PL0A 1FJHA 1WI8A 2C31A 3EEBA 4F7DA 5LJ3Y 4NCBA 4TUYB 4FYIA 4WVLA 4EAQA 3KHHA 3DWFA 4MTLA 3ZXXA 4ZJYA 2B3TA 3UATA 4E0DA 3AILA 3MD9A 4PXYA 4KR2A 3GIIA 2C9BA 3WGTA 5BWOA 3P9IA 4ZOBA 4TL8A 4D8WA 5A2QA 1V6CA 4ZDIA 1MJFA 3P5TL 4C8MA 4MEJA 4DNXA 2AJ1A 3OR2B 1ZCAA 1NE7A 3EYZA 4MGHA 3HFSA 2ZS8A 2E5LJ 4DR4J 1QOZA 2ZTVA 1L7QA 5E4FA 3D8TA 1EA7A 3MJEA 4EF5A 4LRBA 1ACMA 2F3RA 4E31A 1NI3A 2WYHA 3EXAA 3FLBA 3RT9A 4L95C 3PDJA 2C9ZA 3X2SA 2XDAA 5DISB 1YJWS 3T5BA 5G40A 1WABA 5AVKA 2II6A 2HHJA 2E6KA 3DFUA 4O3QA 4I6JA 3CCSS 2QZZA 2C2MB 4CUKA 2I03A 4XUDA 4DUZJ 3G5TA 2VHQA 5I01A 2P7HA 4ARCA 1HBJA 5AUOB 1LEHA 3CKLA 2RAFA 3BG5A 4WLVA 2O7VA 3MW8A 2WAYA 3GP8A 4PX9A 3PX2A 4E14A 4YR3A 5LVAA 3OE5A 4PLHA 1N9GA 1X39A 4URVR 5LXTA 3ORRA 3UICA 3DO8A 3AHFA 4I5FA 3B2NA 2L17A 1BEEA 3D6MB 1FQJA 2P77A 5SYMA 1X7ZA 5DXFA 1RHMA 1F5CA 1IM6A 2M4MA 2ZJ3A 4YCMA 3AQ4A 1UAWA 1VCIA 1M5RA 3OO1A 4H60A 1J5OB 5KNBA 4QJBA 1N2EA 4I9GA 2I1RA 3S7ZA 3TSCA 4RK6A 2O2DA 4BX8A 1OC4A 3EVTA 3UF0A 2X1BA 4W99A 4X71A 4HR2A 1BRMA 1KY2A 1U7HA 1Z33A 1CP3A 4O1HA 4GRDA 1DRJA 3EDYA 4IJQA 2QSZA 4ZP6A 4OA8A 3AJ2A 4OJ3A 1TK3A 3PYXA 3ELUA 3QWAA 5I7SA 3ZE8A 3A9VA 4AMBA 3PNYA 3TOSA 3I2FA 2QP4A 5C7OO 4H4OA 4PLVA 4F8RA 3BKUA 3A9TA 2ZM6J 2QUIA 1NBMD 1AGXA 1PJ2A 4I9NA 3TVDA 3FHLA 4G0PA 4UATA 3KLBA 4M5NA 4Q4DA 4F4YA 1TKBA 1EVYA 3WGLA 4KI0A 5TNXA 3ROMA 4UHJA 5ENDA 4A03A 2FW9A 4N39A 1RAOA 1HFJA 2IZZA 4L4UA 3S0JA 4L1KA 5CX1A 2NUPA 3TANA 2H2WA 3OPMA 1UIMA 1VA5A 2FA9A 1KMQA 3CRRA 4LY0A 2ZUSA 1DJQA 5GTDA 4OQEA 2VKQA 3QNUA 4NZ6A 2W4PA 2DRIA 3R7NA 2HQSA 2I6WA 1UP1A 4XDYA 3O8RA 1ZAVA 3Q6MA 4HH3C 4UTXA 3AETA 2IPLA 2BKVA 4B3HA 4L4ZA 3KTFA 5A8KB 2O1PA 5AIAA 2O8BA 1ZPVA 2PKCA 2V6IA 7MHTA 3NKLA 1XD2A 4AQDA 3O84A 4LY3A 4KX3A 1JAHA 2DETA 1VE3A 2JVIA 3AG6A 1T10A 5DCLA 4FHGA 4ZOLA 3P9RA 1M8GA 1OOEA 2A8YA 1JWAB 1SUIA 1FEHA 3IR6B 1I1QB 1JKFA 1W49A 3HTXA 2IYXA 3BVPA 1A76A 1U2DA 4HDAA 2QI9C 2VDRB 4Q9NA 4M0EA 1YTLA 1E4VA 4CM8B 3W5AA 4EECA 3RADC 4DYHA 3IQGX 1KQGB 4IFBA 1GV0A 4POOA 4I2QB 3GPAA 3PFIA 1KHTA 1RTKA 3DE1X 4E3WA 1OX5A 2B5OA 3VH1A 3LX6A 1KVJA 1TPYA 1VDZA 1J6UA 1EVEA 3FMBA 3MECA 3CD0A 2DGVA 4TXHA 1N3YA 3WJ2A 3MFQA 1J0DA 4I5EA 2G09A 4QDZA 1ST3A 4P92A 3SQDA 2BZSA 2GPNA 1PX2A 2OM2A 2I34A 3MLAA 3VZCA 3SX4A 3K9HA 2KXFA 2I65A 5CCBA 1HE8B 2SXLA 3RYHA 3K70D 1KBQA 4P3OA 3A1CA 2VF7A 2Y0DA 3T5KA 3W4KA 4CM9D 4AD8A 4HAUA 2WBLC 5F5NA 4NE9A 1FFGA 4OJTA 2L41A 2VDNB 1XEXA 1PTJC 1E6CA 4UNPA 1B26A 5KO2A 1F3LA 4ENTA 1VIVA 3UV3A 3AIOA 1IAVA 4Q8FA 1L4NA 5EJ6A 3QXHA 1B43A 4USWA 1U0HB 5LDGA 2R7LA 1EBUA 2QV7A 4ER8A 3FUWA 5ICEA 3MWYW 4LUBA 2I8AA 3ZVRA 3V8PA 4ZPWR 3OUUA 2JLRA 1P1HA 4FVMA 1UINA 4GE0A 3B36A 1XVLA 2WIFA 4X65J 3CCUS 3CS3A 4P4LA 4FYYB 1FFYA 3R40A 3VO2A 1VMDA 3M6LA 4J0CA 1VBNA 4EI7A 4HN2A 3W2TA 3JQRA 4LHYA 1H9BA 2AKYA 3D6AA 3EIQA 4LA4A 1I51A 3CO0P 4GZ6A 3N2KA 3U6BA 3G9XA 2ODEA 3Q3JB 3FCOA 3NBZC 2OO4A 3PZBA 5BN3A 3FWNA 4A8WA 1Z37A 4RBVA 1RWVA 2E4UA 2AOWA 2PWYA 3PT9A 3LPAA 1TO1E 1KSHA 4OHRA 2FKAA 2B4YA 1A98A 3Q3EA 2XUIA 2IY7A 3MPVA 4QPXA 3OKCA 2MTBA 5CB0A 2J0SA 2P4EA 4DR3F 3AKDA 1ADGA 4KMOA 3IO3A 1JSXA 5JUMA 3T7JA 4UEOA 1M7GA 2DHDA 2DPIA 1JXLA 3MJSA 4C7OA 2VBWA 2NLOA 1J9EA 3R75A 2RHHA 4TMKA 3MTDA 1WCV1 1S76D 4OM7A 5B1HA 3WQHA 3ITDA 3KJEA 1NH8A 2POCA 2V6GA 1ZH4A 1S89A 5L9AA 1VC6A 1XOIA 1GYQA 3MEDA 5A0TA 3CNOA 1BA3A 2IA5A 4OMUA 3SMZA 1EE9A 4Y7CA 3IT0A 3KKFA 4B4DA 4IFVB 1K6JA 2QRKA 5EMLA 3VDXA 3PQDA 3LA8A 4MB0A 4DSJA 1UDBA 4B0OA 3LCMA 1F6WA 2AMYA 2D1RA 3P9YA 3E1SA 2OXFA 1BJKA 1UBHS 2AJ0A 4XX0B 4ALMA 2GK4A 4BVAA 1SXJB 1SH0A 2B8JA 1YR9A 4R5PB 2Y99A 3L6EA 4O1IA 4LVOA 3O9MA 3PUWA 4BGEA 2ODBA 2YWJA 5MDHA 5ADVA 2YBEA 1WC3A 4AL7A 1TYZA 4LF6B 4DRZA 3L7YA 4L7VA 1RSZA 4UBOA 1NLMA 5CK5A 1RGVA 3LT2A 5TJHA 1QD1A 1TU3A 1T9UA 5A3RA 1KZYC 3ZJ4A 5ALFA 2FDXA 2ZROA 4LPKA 1QV6A 3DE0X 4OX9Y 2BANB 4NENB 3CD7A 3KYIB 1WETA 4D4KA 3FHTA 1UIRA 3GCDA 5DM60 2J0UB 1YB6A 1IE3A 2CY0A 3AVVA 2PUBA 1MWQA 1ZCZA 1ZD4A 3Q22A 2B0GA 4UTVA 4C6TA 2FEKA 5HK4A 3FUTA 1X7WA 1A5BB 2VQEJ 4S0XA 1BWPA 1KI3A 4CM5A 1R9JA 5IYZF 1N0WA 3CLVA 4M49A 5FWNA 3GLFE 2C4WA 1X1AA 1X94A 4K9NA 1BCRA 3FSGD 2JFVA 4CMGA 1DKNA 3GTYX 2RE8A 1V1RB 3I2YX 3H9QA 1Y6GA 4QICA 3D8UA 3F97A 1T13A 3AQPA 2E2WA 3I52A 2EF0A 2OZEA 3UANA 2R87A 4WNCA 2NXWA 1FRKA 4IICA 2B4QA 4RTKA 1NK6A 4ZP1A 5AUPB 1FDAA 4EO8A 1NLYA 2EKBA 1XQWA 5ER9A 3PC2A 3G9UA 4DF4A 1NZ8A 1SCAA 5F9MA 1N34B 2EHJA 4TLQA 1PCAA 4M37A 2AC2A 4RZUA 2J67A 2V55B 2ZWIA 3ILYA 3QBTA 2GN9A 5B58C 4QYSA 2FN3A 3GFPA 4IS3A 2A59A 3H86A 1O6ZA 2C4HA 2HQRA 5KDDA 4NBKA 3SC4A 4EMBA 1KE2A 4UD2A 3PJ9A 4TYMA 4DZDA 3I0NA 1P1IA 2A0KA 2AJFE 4HLDA 3AHDA 3BSSA 3IGNA 1YFZA 2F3UA 2C94A 4NZOA 3RW6A 5DULA 1V11B 2IHJA 1YRXA 2UVWA 4QNMA 4B3OB 1BVHA 4GR9A 5C34B 1FS4A 4MEBA 2VNIA 5G53C 2J3EA 1J5EJ 2JGEA 4RCVA 3S01A 4ECAA 1FF2A 1Q77A 3DW1X 1GKIA 4M89A 3KUHA 4UW9A 3QVWA 3V4VB 1GFIA 3EMVA 1GPJA 3UDCA 4M9UA 1HNVA 2YX1A 1U9ZA 2C3UA 3UKOA 2UU9B 4V0NA 4TWBA 1YKGA 3FFWA 5JSQA 2IPNA 5I8PA 1WF2A 2BFNA 3UGQA 2OJ3A 1KR5A 3A4TA 1Y8AA 3GH1A 1UBGA 3OI7A 2IDMA 2WQZA 2NYHA 2VA8A 2FZCB 3GJ8A 2DISA 2VH7A 3N7TA 5F12A 2R4UA 2KG1A 1XRQA 3AM5A 3VR4D 4U3JB 2OFPA 5JIBA 4LIWA 2WUGA 5J2PB 2D7CA 1IWBB 3NNCA 1P4RA 3OL7A 1W6UA 1PWHA 2ZR7A 5LZ8A 1M2OB 3WAGA 5DHRA 5IQ6A 4EDFA 2XMGA 5HJXA 4NARA 2IZ5A 5TQ2B 4ZIVA 2CDRB 3B6EA 4ID3A 2J6SA 3BXHA 2QRGA 3N2KB 3MEDB 4CLRA 3D1VA 1XIVA 2QEQA 4AW9A 1ULSA 1FTRA 4I1RA 3JYTA 3SJUA 1CS4B 1VJRA 3EZNA 5KVQA 3LP0B 5KYUB 3HDJA 4OLPA 1K63A 4KQ1A 1A95A 1S49A 4DARA 3OBBA 3P71T 4JBHA 1C4CA 3CX4A 1JTEA 4OMFG 2WJPA 2FJPA 4I9HA 4LZOA 2I3AA 3AR8A 2ZRKA 4PAGA 2X51A 2F62A 3OMXA 3SSNA 1YU6A 4X1KA 2IYWA 5F2EA 2DUUA 5DTJA 4FBUA 3IWXA 1DC8A 1RXUA 3L4BC 4EFAC 3OFKA 1RYEA 1Q2XA 2X9GA 4N56A 1EIZA 4AMGA 5AW9A 2ORYA 1LFDB 4B81A 1T2AA 5HOQA 5B2ZA 4C97A 3ELBA 3M9XA 5FB3A 2C2OB 4W7SA 4Q4HA 3S5UA 3AA9A 4MP6A 1BTOA 1V5IA 5KNCA 1QQ5A 1UKZA 1V96A 1RXIA 1TK9A 1DINA 5MLCV 4P86A 1F5AA 5KWSA 3BULA 3NHWA 4M3NA 4K6OA 4A73A 3FZNA 1V0JA 2R85A 3U19A 1HEYA 2AE1A 3BT7A 2DC1A 2CG8A 1M34E 2F43A 1AJEA 2OMOA 1RRGA 5E1OA 1U1RA 3ZO7A 3P4XA 2BGTA 1XKTA 1VYTA 3LVBA 4FLFA 2XT0A 3V4OA 1EU1A 1Q8BA 5H3LA 4L5YA 1A9NB 1KDYA 1BKYA 3HWRA 4CLZA 5EIAA 5EZYF 5DDPC 3L1VA 3ANLA 1V7QA 2YC2C 3I53A 1Q0ZA 3HF5A 3A14A 1R0XA 2WAAA 5LP6F 1N8TA 2FHMA 4J0IA 5C53B 2EYUA 3OJFA 3K0AB 2AT1B 3SDZA 4CEHB 2H54A 3V4FA 2DNOA 3CEPB 1FRMA 2MDTA 4QXMA 1ISRA 3GZ4A 5BSFA 3CJ8A 5CW1A 3P8ZA 4IDOA 3M2RB 3AMVA 1CUFA 2Z4SA 1CUCA 2EARA 1EFLA 5JXJA 1YVFA 5CVJA 2G83A 3EJWA 5FTLA 3IVMA 3OTWA 3KCNA 1A4IA 3FMFA 2ZAIA 1NJSA 1II8B 4KBFA 1TL4A 2YH0A 2ZRAA 4L2IB 3ZY2A 4G07A 4P36A 3R7AA 2G0CA 5B3JC 3ZV7A 3V9AA 2QLFA 4OBBA 4O2AB 3OOHA 2AQ4A 3NGRA 2XIJA 1O7JA 2SCUB 3FK4A 1WF3A 4OXIA 1QRTA 1BQ3A 3GH3A 1IBMF 4DL0C 2P41A 2OP5A 4IZ6A 5JS7A 1FX0B 3WBZA 3O47A 3V7NA 5H9WA 5LQCA 2ZJQQ 2HIGA 2I6SA 1NY5A 3ZHRA 1W2IA 1T4BA 1OX4A 4B31A 2J4DA 3EVOA 3A1VA 5DNEA 5FPKA 4PFJA 1PL6A 1OQ3A 4CLYA 4PHFA 4AP6A 1NU4A 1R5BA 3BB4A 3K1ZA 1OKKD 3KJVB 3VYWA 4H1TA 4NYIR 2ZAOA 4E5YA 3T7RA 4FYXB 4K9RA 3PW2A 2QU8A 1EVJA 1EFTA 4KB5A 3LBYA 3Q8KA 3H2BA 4TS4A 4DL3A 1UW4A 1GQSA 1IHOA 3P5SA 3AIIA 5UKDA 2AA3A 1DJOA 1APBA 5BVGA 1WCWA 2FPPA 3ABSB 2Q66A 4HDQB 4YQZA 3UAYA 2B8PA 2MR5A 4NIMA 4OSEA 1KNZA 2X1LA 1UEVA 2Q2WA 3ISTA 1DEAA 2GYUA 3E5HA 4PSCA 2FJVA 3Q8XB 1MX1A 3RRJA 1SJRA 2PH7A 5AW1A 2C2KB 1UP4A 1I0IA 1X13A 2FW8A 3RS2A 3QW4B 5TARA 2G4CA 1EUQA 4G5GA 3EC1A 4MH8A 3H7AA 4M7WA 2MYNA 1E6VB 2AGPA 3SYKA 1ZN7A 1Z5GA 3MMBB 1PJ7A 5AT1A 2C04A 2NPFA 2YOHA 4NEQA 5JRDS 2DWCA 2N1BA 2Y67A 1GPH1 4EHAA 4R8MA 3EPPA 2HRUA 1N8SA 1HKAA 2JEIA 1E8MA 3TOZA 4MKAA 4LISA 4D9CA 2WK4A 2O3DA 3DPIA 2VPTA 5M34A 1BCSB 1LBQA 3R3YA 3K0SA 4TV9F 3AJ9A 1HORA 2PXHA 1ADFA 3S68A 1U1NA 4UHCA 4A0GA 3KMQA 1F8GA 4X20B 5M29A 2I7XA 3D3WB 1II9A 1JHAA 5HS6A 4RZRA 3FVYA 4U6PA 5JWHA 1OILA 3FYSA 3DMGA 2ZYTX 3VKHA 1J8MF 3FPJA 2G0JA 2ICAA 4IDFA 1IJFB 3TW8B 3BL8A 4LF6F 1TE2A 2FUKA 4C7OB 3RU9A 5C46F 3U3RA 1M34B 3VGPA 1CJVC 5EQFA 3NNHA 5CXQA 4LVUA 1XZJA 1UZDA 4F25A 2X4IA 5K20A 5AI4A 3MEGB 4DCOB 4J1NA 4OIMA 3HBAA 2O66A 1KTIA 5E6SB 2V97A 2JL1A 1P7PA 5C37A 1NWHA 1ZTTA 3FOFC 1NXTA 5FBRB 3O3CA 1FKOA 2AS0A 4N0PA 4LZNA 3AB2B 5EYPA 2DHHA 3MUMP 3FVTA 4L6CA 3Q6IA 5JAUA 2XEXA 1C3LA 1KOFA 1RI4A 3AINA 1GNVA 2XE4A 5K3OA 3CE6A 3FNHA 3RFXA 4G5XA 3E01B 5H7XA 4S3MA 3EE3A 2Q7DA 3FOEC 1XD9A 3F6YA 3KEMA 3PCRB 3UTCA 2AB0A 4UUQA 2HSGA 3L6UA 4DL9A 1XDBA 4Q47A 4Z0TA 2XGPA 4WBNA 3DLCA 4G37A 2BWJA 5GONB 5DHAA 2E7WA 4CEJA 1X2BA 2J0QA 3IUYA 3VR5D 2Y27A 2D2EA 3K70B 3CCFA 3TW8A 2IDEA 3S1TA 3SM3A 2MDAA 1GA1A 4BO6A 4TXSA 1SHLA 1RT3A 3G0IA 1EEHA 5G1PA 2AYBA 1U25A 1ZZFA 5CYMA 1CUXA 3K57A 3G2LA 4Y18A 3VPCA 3ZN2A 2FPRA 3K0KA 4DSFA 2JFWA 4K6GA 3OEWA 4HEHA 1MQ8B 1YC5A 2GTIA 2LECA 4RDCA 5EPUA 1E8NA 1XRNA 3FNGA 4DGSA 2NXNA 3TZLA 2OCAA 4I1YA 4I50F 3MMCA 1NMQA 3BWYA 3S28A 2HHHB 1E58A 3OPVA 1DBPA 1WULS 4GOKA 5BXYA 5GADI 4JB8A 3TKAA 3O9ZA 4R0JA 4B3MJ 2HSJA 3MUOA 1U8AA 3ZI0A 3ROPA 3B6MA 2MZQA 1PX0A 1NW8A 1LSJA 4ZS6A 1EWRA 1A9SA 4HDSB 5FULA 1HQDA 5FIIA 5J2UF 2FHKA 1OROA 3SV4A 1ZY2A 4FONA 2WCXA 5K8VA 4V3BA 2BBEA 4UE6A 5L9NA 2NSCA 3AKZA 3C3BA 3QOXA 5K8JB 3B4DA 5HF5A 1MC5A 4QJ4A 1V3SA 3TEFA 1SO8A 2Z08A 4D9NA 1JSCA 4HGYA 2V3CC 4J9NA 1YS4A 5AJTA 4M5DB 1YOBA 1UOEA 4YQYA 5D77A 1Y8RB 3KT6A 2CUYA 2HLPA 3BZUA 2XG8A 1HNZJ 4I1PA 1BO6A 1FQOA 2O8NA 5ED4A 2OGTA 2GD0A 1G4CA 2VF5X 2DY9A 4LQ9A 3TO5A 2XB8A 1IUJA 4JJ7A 1U2EA 1R8CA 1HOXA 4DV3J 3U02A 1F5SA 2WG2A 2PKXA 1UBEA 3AUKA 1Y9DA 1CB0A 5KYWA 4G0VA 2G04A 3O5AA 2PUTA 5FCDA 4HTJA 4Z3OA 2BEWB 3PXDA 3S27A 1KI2A 2MY7A 3R97A 1FJGB 4I7FB 1QF9A 2RI1A 4O2BF 2RGUA 1X92A 2ORIA 1GXSB 1P2DA 4HDGA 3DFMA 4TMWA 1PAUB 4REOA 3X1XA 1KO4A 4JBNA 4X60A 5DDQC 1JG2A 1XCJA 4QQFA 4Z4IA 2L82A 4DE5A 3J81k 1E9RA 4YHBA 4NH4A 3V2UC 2AD5A 1PSZA 4JI4F 4Q0BA 4FFDA 3SZMA 2W2NP 2TS1A 3BO3A 1ZOOA 4XDHA 3K0HA 1WAMA 3SJAA 4UNNA 4IVPA 2OLEA 3KK2A 1KF0A 1FLAA 2RHOA 3GJZA 1V2GA 4PYRA 3OLVA 3SC3A 2VC0A 3I5CA 5LMZA 2VEOA 2Q62A 2QN1A 1UFOA 4OK5A 2G5CA 4MUMA 3BBLA 2C98A 3HP7A 2EFVA 2O0JA 3TXYA 1CLFA 2KXNB 5AHOA 4E5DA 1V7PC 5DNAA 2Y05A 4NEHB 3NDBB 1ESZA 3V97A 1E2UA 2JGMA 2YXPX 4Q9JA 2CJBA 5FI3A 2HV9A 1EUZA 5CCEA 1F17A 3JYNA 3WGKA 4OV6A 3ET6B 2EW9A 3VC3A 5C5DA 2ZRCA 2OHHA 1C1YA 3ER9A 1WCXA 4PYOA 4FS8A 3U7RA 1ODKA 5AXMA 1WB5A 4AKIA 3IIJA 1H93A 3SVLA 3HHKA 3AH6A 3PUIA 3VVTA 2ZATA 4ZRMA 4MULA 2ZSKA 4DR7B 4P2SA 2O54A 1Y9ZA 2VJPA 1YS2X 2FR8C 1B15A 2QAJA 2ROGA 2XCIA 4I55B 1GSAA 1ZP6A 1VOTA 3VR6A 2VBZA 2DXIA 2Y1RI 1OH6A 1C1CA 1WY5A 2TRSB 5CTAA 2FGOA 4CRWB 3L93A 1IM5A 3HBJA 3KYDA 3I4FA 3ET6A 4KE8A 5G4KB 2RDDA 4Q9IA 2X19A 4AYXA 1FU4A 4UZEA 5A1TA 4BNLA 2B1JA 2ROQA 1KONA 1XTTA 3N53A 5B4TA 3G5MA 1W0KD 5C1DA 1P0PA 3NNSA 3W5HA 1E0SA 2WKWA 3C8YA 4G1PA 1TKZA 1CUJA 4BC1A 1VJ0A 1L5FA 1G20E 2FZ4A 1TUWA 4P7TA 1XCPA 1LBIA 3LQYA 1T1GA 4OFWA 5CX4A 2WLTA 2WJ4A 4NYOA 4ATNA 5JY6A 3HFVA 2VQEF 2GZSA 3KK1A 2XGQA 2M8HA 1CUAA 1XERA 4OATA 1Y8CA 1QH9A 3SEZA 1N77A 1R6BX 3QIPA 2DGOA 3RBAA 5IF9A 5TDHA 5F5LA 5LP6B 1NFRA 4OXXA 4W1QA 3MBOA 2CDRA 3ETDA 3I83A 1U5CA 1NVXQ 1ZR2A 1ZBTA 3RB4A 3K4HA 5DWQA 3SSAA 3CNBA 1G55A 1KYQA 4Q9KA 5EMJA 1NJYA 2RGXA 4O0IA 3BCUA 2W6JD 1GD1O 2ZTSA 5U9CA 1M0TA 4L5AA 4RZSA 1YJ7A 2IF0A 2QL6A 4J37A 4UUXA 3LCRA 4PO9A 4HQRA 4N47A 3HB1A 1FKPB 2JJQA 5E6RA 2QTTA 4YRAA 3IAAA 5FUYA 2G28A 4ZJUA 4NBNA 1YBTA 2OPPA 5ALNA 5KVVA 4BX0A 2QA2A 2F67A 4FD2A 2JWNA 3UWMA 1I94B 1Q86T 2EIXA 4S1TA 2B99A 2PUCA 1N6PA 1SVOA 4AS3A 1HA3A 3NHLA 3PUXA 4GZ3A 5K0BA 2JHFA 1NQ5A 1Z8NA 1BXKA 5DHQA 3CM0A 5HDQA 3I4LA 1BWSA 1TZCA 3ZXSA 2ST1A 3NVAA 4UAUA 2QUKA 1Q2UA 4JI3J 2V8OA 5BSVA 4ZVEA 3T3DA 1UBTS 4LRTB 4L4SA 3O2JA 1Z83A 1AB5A 2IDZA 1GR1A 4L57A 1FVXA 5KG3A 4FSHA 2P2DA 3T5CA 1BD6A 3VAGA 1OV4A 2PMDA 4U2DA 3P9XA 2R96A 3DMJB 3G5UA 4JITA 4TLEA 5L3VA 3R4VA 1VQOS 3ZY4A 4FDTA 3W60A 4JAVC 1RC0A 2KBEA 1FRQA 4RORA 3GGOA 1UL1X 3LHDA 2VJOA 1EGAA 4L72A 1N75A 5ELMA 1AE1A 1W1WA 4LXUA 1IHPA 4KSYA 5JEEA 5AE3A 3PWSA 1H3FA 5AOAA 2Z30B 2ZT5A 5IT9A 4MNTA 2P1RA 3PUYA 1QK4A 1XMQJ 2WW8A 2C2HA 2M2BA 4IH1A 5C7PA 2NAFA 1HKHA 3PP8A 2G0AA 2HUNA 3CMCO 5GAGI 1UPBA 5HBMB 4G9EA 3SEFA 4MKBA 1X9MA 1RC1A 3FD8A 4NCHA 2PL5A 3HHLD 1X9IA 3GN2A 2I80A 3C6MA 4KN5A 5FD1A 5K5MA 1YHZA 3BEDA 5DG7A 2J45A 4HPWA 4O6VA 2IHUA 4IHAA 3GU0A 3H1TA 3LUBA 2VJMB 1ONOA 3M4JA 5JD4A 5IAOA 3EFEA 1YRAA 3LCJA 3G9TA 3D6MA 4MWGA 3LGHA 4RF4A 2G1JA 5I51A 1WCIA 3FHCB 4BJ5A 4PZLA 2FU5C 4AM8A 4P0PB 2A92A 4FNOA 3HFZB 2QXUA 5F76A 3QLEA 3SOZA 2E7VA 1N3IA 4C0QC 1ZOLA 5HA5A 5HKAA 2ZRJA 5F64A 1GNPA 3STVA 1XMOJ 4IDPA 3LBNA 1CUYA 4RESA 2H18A 2ZYIA 3RLFA 5L1LA 5TMEA 1SBRA 4DG1B 4ISBA 2JHAA 3Q8UA 3AVWA 3HP4A 5JSKA 5DM7Q 1P73A 4YACA 4LFAB 1XZDA 4HVLA 2FLLA 4CXMA 2X2OA 5L3SA 3BWVA 2LCIA 1IY2A 4DQLA 2QQ0A 4BBAA 1C1XA 2H1VA 3FPFA 4H31A 4ZEVA 3WDSA 5FR2A 3MMXA 4RTNA 3OZDA 4HNRA 2CLDX 2W9CB 4BX9A 1KJJA 1S5PA 3HJTA 3F7TA 3BWEA 2IYTA 5EOVA 3QSGA 4K2XA 2G1PA 2HD4A 2IVFB 3ZHXA 2M7SA 1KJWA 2ONJA 4DQQA 2UVPA 1KN6A 4JC8A 2IUTA 2ALJA 2E4AA 3LC1O 1B7GO 3MEKA 3EWSA 4G1QB 4IF6A 3CH5A 3W2WB 1GQOA 2AX0A 4GZ5A 4UZFA 4LHWA 3BMNA 1SQ6A 1RM5A 3ITEA 3PB3A 2LP4A 4ZMRA 3USZA 3FMIA 3I6PA 2XJ4A 4M5IA 2RHMA 4QUIA 2W4QA 3QAEA 4LK2A 2UVDA 2WTXA 1F20A 2AZTA 1J7KA 2AR9A 1E0AA 2JLZA 4HZGA 2Z58A 1WKCA 2YHUA 1K3UB 3SHVA 2C9MA 1QCYA 3DWGA 5GPBA 2A6OA 2HBRA 2PU5A 1CVIA 2OXTA 2YH1A 5FP0A 1E7WA 4RKWA 3UB4A 3Q8WA 3OETA 3SCKE 1QVRA 2Y4NA 5DLEA 4BBZA 2WB1D 3M8KA 5HMWA 4KR6A 1ZD9A 3KXIA 1ZM9A 1U2QA 5F98A 4ZI2A 4KO4S 1I0ZA 3Q89A 2PJUA 3ZCSA 2PUDA 3HX9A 5KSYA 3WRYC 4X4OA 1JG7A 2DF8A 1PDVA 4U02A 4MRAA 2QNIA 4XXHA 4F96A 4K9DA 4AF6A 3GJ7A 2YJ6A 1L6RA 3TCKA 4JYPA 1LX7A 2YNHA 4OJQA 1RM3A 5KFEA 1R0KA 2R79A 1I4OA 5EP1A 3EXCX 3D6JA 1E6UA 1EFVA 3R7BB 4A8SA 4C4WA 5AVVA 2VP3A 1K5GA 2WVHA 3JQAD 1DEXA 4ZOEA 3H0EA 1M1KT 1ATZA 2GN6A 3WKDA 1H4QA 1J2VA 1UTAA 4QTZA 2EPIA 3VHXA 3OVAA 2P9GA 1VHDA 4J0HA 4RA6A 4NA2A 4IZOA 5HUJA 4D3ZA 4KKXB 1NFFA 1M0EA 4R3WA 3P20A 2XY5A 1J97A 5ENZA 4BP8A 1NNSA 3DBLB 4RETA 2Q1LA 4RQUA 3WB2A 3V6DB 1GEEA 4EBDA 2QW8A 4DPUA 1QYVA 3HY6A 3FDJA 3G4SS 1MRNA 4OJMX 1X1DA 3AODA 3ITHA 1SU7A 4JU9A 2QVBA 3ROTA 3D5EA 5FDLB 2QUJA 2VJDA 3RS3A 1YXMA 3D6HA 2REQB 1QVZA 4K9SA 5C4GB 1URRA 3IQWA 1SVSA 1FFGB 4IRCA 1YVEI 2HBZB 4Q9HA 1HOTA 2RJNA 2ZB8A 4TKUA 4BV9A 2RS2A 2GTHA 3SXJA 1KZ4A 2QYGA 4PABA 3VPFA 4WK6A 4KYTA 2FDCA 1E2BA 3N5BA 3LBAA 2HV8A 1DCTA 5U47A 3PY8A 5F73A 3W8NA 5BSEA 3D7MA 5DGDA 3TZHA 4MW2A 4LDZA 5H80A 4MPRA 4CM9A 3DHXA 2PDAA 1QH0A 3R23A 4AJEA 2GAIA 3GVHA 3QJGA 4KDFA 1E0DA 4YV7A 3JU3A 4C8NA 3KK1B 3L8HA 2WNSA 3BGOS 1KARA 3E9MA 4HZIA 4PXCA 4N03A 3TN7A 1IXRC 3HHEA 3PLRA 3C4VA 4NCJA 4DV6B 1HNVB 1SGWA 4C4XA 1M6YA 1LWXA 3EWGA 4M9XA 3MSXA 4GUAA 4KMRA 5HIKA 3PTLA 4ZV9A 3I39X 3OCCA 4DA8A 4QPCA 4P53A 4B3OA 1QR6A 2QD3A 3UDEA 4CTKA 4HDSA 4U67Q 3V4SA 5LNK1 3HN2A 4UEJA 4ECTA 5DEIA 2GVDA 3THYB 4ASUD 2CWXA 3JQEA 1PI3A 3IL2A 3PW7A 3V33A 3VJKA 3AUFA 3DMTA 1SJFA 5EJMA 1YBUA 2UXDJ 4LXHA 4BB9A 2IH2A 2X8JA 1RTIB 3MD0A 2KYRA 1IKWB 4JGBA 4LR8A 4CR8A 2CDBA 1MJGA 4NQZA 3Q72A 4CEIB 3E51A 1RDFA 2WE8A 1R8BA 3PK0A 4DNQA 4AJPA 1JTFA 4ADSG 1WHXA 2C8LA 2BM1A 5KTKA 3ASVA 1DBIA 3BGUA 3PYMA 1JLMA 1E4OA 4USVA 5IPFA 2V6MA 1RTDB 3V8EA 2X42A 1Z9BA 1G3OA 3BYZA 3A10A 1UKEA 2VC1A 1TKTA 2RC6A 2AW0A 3I5AA 5E1MA 4A8TA 3OQBA 2VT7A 4GC5A 1XALA 2XHWA 1T8WA 4JI6F 2IUUA 1XZLA 3SBXA 3F2IA 4MK9A 4M0MA 1VE1A 2GN4A 3WHLA 3NEYA 3GLTA 4N7MA 2RGCA 4FYHA 1J0XO 1S0OA 5TGDA 3C4QA 1CG6A 4GX1A 4QGAA 1TAHA 1K1EA 1H7WA 1GA6A 2W4IA 4MUFA 3M9MB 3QY0A 2GB4A 1OTYA 3PIDA 4LCEA 1XMIA 2HN9A 3AI7A 2CAJA 1Z4UA 1KIFA 5KIAA 1EJBA 5J9FA 2OYSA 2VZLA 3ZWOA 4ZOLF 4HBGA 3SCJE 4O2AA 3LUKA 1G16A 4PGMA 2A2DA 1M9NA 1I4EB 2NR0A 3T9EA 4B71A 3NORA 2Z5LA 1KI9A 2Q4DA 3P9QA 4N6NA 1S1UB 4ZXFA 2WPDA 1PO7A 1A8PA 4UU1A 3NCQA 2PZFA 3PC7A 3AFHA 2W0SA 4Y2VA 4EOGA 4BS9A 5E3QA 3B1XA 2B7CB 2WJHA 5GV7A 1B76A 3GJQA 1AO0A 2ZK7A 1HL6A 1FMCA 3DP9A 4MICA 3ZKWA 2UYCA 2VYNA 3OICA 2YNIA 2DEJA 3LALA 3VZSA 4DFJA 1WBBA 1P0MA 1RYBA 3G7NA 4BLQA 4PFQA 2X3YA 2MJNA 2X14A 1SL1A 2ZHAA 2ZULA 3WWEA 3YASA 3A58B 2NPOA 5DW3A 2CJPA 4NZMA 1TLTA 4M9SA 4Z0PA 2QDXA 3PR1A 3PTAA 1D1QA 6ABPA 1N0VC 1U2TA 3PICA 1KC1A 4ZHQA 3FZEA 4B48A 2WDPA 3UGJA 5LSRA 2ZPTX 1VSVA 4QEDA 4QDJA 4WK0B 5CDGA 3VR6H 1OBVA 3LQ2A 4Y2CA 4QQRA 2Z4RA 4DLXA 1BC5A 5ALDA 5A03A 4M8SA 3DLGB 1M2GA 1Q0QA 3AERA 5DWVA 3ICEA 3G49A 3N05A 2DY0A 1RWKB 4TSFA 2YVQA 5D78A 5EWLB 2YKPA 2MLZA 2F8HA 3AI2A 2VK8A 4FDUA 4DV5B 3UJDA 3DZIA 1OI4A 1O8CA 2F7SA 1JLGB 4NJMA 3TTVA 3M6XA 2BLLA 3C97A 2YVKA 2XT6A 2WLSA 4ARAA 3BM7A 3GJTA 4U7GA 1C3EA 4YCSA 5IVDA 1KFCB 3AEKB 2JIRA 4LI0A 1H8HA 3QKSB 2VP5A 4PY2A 2ZTHA 4G5YA 2JIZA 4EU0A 3OHSX 4XTRA 2IXBA 1E6VA 5KT5A 3I1IA 2ZE7A 1G6OA 2C92A 4FGSA 1JIQA 5EGYA 5AIBA 3KAPA 4NR0A 3LNTA 2GVDB 3N2GA 1MX9A 2WF6A 1GRRA 1VSUA 5CRIA 5EKSA 3DZBA 4P4GA 1XYVA 1HTBA 4OP2A 5REQB 3A25A 3U16A 4ANFA 3VNSA 3QOYA 1C1DA 4YRSA 4FNAA 3S8MA 3BN7A 4YDQA 1FP4B 4WSOA 1E6YB 4DAEA 3GUYA 2QVZX 2QE6A 2FYXA 2GH1A 3KHUA 4DXAA 1JIVA 2CJXA 2H1CA 4YI5A 2FZVA 5CLJA 3ZTWA 3RAJA 4HMPA 3A1SA 2H2HA 1MW7A 2EFCB 4IY1A 1JYSA 2KI5A 4QODA 1KI7A 4KO1S 4EUVA 3EY9A 4BNDB 1OS5A 1XR7A 1GX6A 3TOQA 3DO5A 4ZVHA 2CB0A 4QFCA 2WFLA 2K7ZA 3IEMA 4O4JF 4LYEA 1S5ZA 1RSCA 2YV1A 2MZJA 1P0FA 4DLSA 2DH8A 2WPNA 3FPCA 5AYVA 4FR2A 3WICA 3Q1LA 5JYDA 3K16A 2V5AA 3VGTA 4E46A 2QTBA 2C83A 3QJ5A 1CDZA 2GAAA 4RWZA 1WEKA 5JO0A 3GEHA 4LYJA 1HWLA 2R751 1YACA 3F6BX 1OR8A 1EUDB 1BGVA 1DADA 2OPSA 3J80Y 5GV8A 3H25A 2V5VA 3O95A 3WGVA 3HR4A 1FFBA 5IJXA 2BELA 1NBIA 1ND5A 2Y1JA 2WJWA 1TL3A 3UN2A 2BH9A 3KNGA 1BXGB 1YV9A 4Q9DA 4MA4A 3BS9A 1K4KA 2IDJA 2ZRNA 4B44A 5JDIA 5JEDA 4D3YA 2JC0A 5ADZA 4WD3A 5K2OA 5D7NA 2I71A 3A2NA 4E6EA 2G9NA 2CPXA 1D5WA 5K1ZA 1F1BA 4ZYUA 2WTUA 4A0RA 4C3UA 2GJFA 2W7AA 1N2BA 1MIHA 3O7MA 2FHJA 3BH0A 2FLKA 1QX4A 4Z51A 4I4BA 1MO4A 2QYSA 1U2GC 3GCXP 1MWYA 4NX9A 1RTJA 2XE6A 5IZCC 1U49A 2NTJA 3A4IA 2P11A 2ZH5A 2AV6A 1F60B 2KKHA 4IP0A 4EY4A 3RRYA 3FOCA 3O8CA 5I9MA 3MMPA 3BJIC 2JLEA 4C3VA 2MQPA 2XKJE 1VFPA 4KRWA 1T9BA 5DNCA 4LF9F 1RWVB 5K0LA 4TUYF 5CA1F 1JLAA 1AG9A 1FS5A 2OM6A 4R98A 2VQ6A 2NZ4A 4KQ6A 3D2AA 4K1XA 2HBYA 2WC1A 2A5JA 1ZVKA 1ZA1B 2CUKA 2XS5A 3MILA 3RU3A 1DWUA 2MSWA 3DU6A 2A0UA 3BRSA 3NGDA 2CNBA 1XLTC 1NBEB 5GAGU 2J7WA 2GCOA 1TAQA 5FNZA 2G4VA 4ECUA 1VP3A 1CZKA 4G8DA 1B4DA 1ZMBA 1RMQA 4NOHA 3PC4A 1U3DA 3LP0A 4W9RA 2BGWA 3JVVA 2IEIA 1UJ4A 3HVRA 3G86A 5JCJA 4CHGA 3FPEA 3GR1A 4X8LA 1ZCBA 3F0NA 1H85A 1EYZA 3WK5A 3A7EA 4RGYA 3HZEA 4P2MA 1YMVA 1WXIA 1BDJA 3AHHA 2HHTA 2W9CA 5DGCA 1NK8A 4PIPA 5LUAA 3CXCR 3PDUA 2VZ0A 1TUGB 4OFZA 4IHKA 4KSCA 2NNWB 1EG2A 1WUKS 3SICE 4X6XA 3K1TA 4Q16A 4GXNA 4MVJE 4X5OA 3STHA 2VXBA 4LNUB 3S99A 3LUGA 3HHLB 4WZAE 5H1SV 1RI7A 3JYHA 2IYLD 1ZNXA 1KEZA 2YY5A 1IMJA 2HDNB 2QYCA 3Q8QB 2FPWA 5K8OA 3AM3A 5FFMA 1UCNA 5TT1A 3ZNQA 1XVTA 3SSSA 1OZAA 3RJTA 4XFJA 2ENUA 4AAYA 1VJGA 4INZA 1JJ7A 2OHIA 2P3QA 5DJ5A 2BBTA 5H9FJ 3QYAA 2WZ1A 2SBTA 3JZMA 4Z5XA 2ZBVA 1LPOA 5D3ZA 1M2WA 2OTJS 2W2KB 1O95C 4JI4B 3AF5A 1ZC3A 4KN9S 5EIHA 1RYSA 2E6UX 4NBSA 1VE9A 4MJKA 5EE5B 2ZUFA 4M99A 4AT1A 5JD6A 3ZV4A 4ZYLA 2YFQA 4KXQA 3HFGA 1YQDA 4PZYA 1SRQA 3BH7B 4NYIQ 2EC0A 1V48A 2WFLB 2H59A 1T1IA 1AUVA 3AOGA 3U4HA 4RIGA 2XQCA 1R0RE 1CS4C 1YVRA 2QRNA 2V7WA 3EDOA 4UE2A 5DW0A 3R9LA 4K3VA 2DLDA 2VAPA 4LF7F 3MAQA 4CMKA 1RVV1 2ZBPA 4DT1A 2L48A 1JIIA 5KWIA 4YT2A 4YK7A 1JQEA 2QR5A 1EK1A 4MTCA 1FNXH 3EVMA 4N5LA 5K3FB 4QDUA 1VMIA 1E5XA 3QZUA 1M10A 4MAKA 4JP8A 2OGSA 5BT8A 2PFDA 2RFLA 2COKA 1MPXA 1JQLB 3D64A 1HDZA 2QGFB 3HDHA 4OL0A 3TBHA 5KVCA 1LW0A 4X62F 2PUVA 5JQWA 2BISA 2B6NA 2BE9A 2KS6A 3A32A 1YO6A 2WKPA 4W4MA 2BR5A 2WUDA 5C7IO 2JG3A 2JLQA 1SCBA 4YASA 4AUNA 1QOQB 4DR1J 4UCQA 5AOBA 2R4TA 4JEHA 1RXSA 1HR0B 1RXWA 3R9IA 2X3GA 5DO9A 1QH1B 2BGUA 2R8OA 1RD4A 3QPIA 3ZZPA 2YL2A 3QHPA 1JPNA 4LSLA 3R7WB 2YN4A 4ZPJA 2XHCA 3UOWA 4BLTA 9ATCB 1W36B 2HR1A 4LFAJ 4YRQA 3GVCA 4WQMA 3GSDA 3GG2A 2J5RA 2C61A 1PG0A 2IYIA 4GC7A 4DZTA 3L77A 2H92A 1P91A 4FC6A 4Y2XA 3SYLA 3NOQA 1FKPA 4B33A 1G9XA 1IVNA 4X6YA 2DGXA 1Q1NA 2Q5LA 4DBVO 3O83A 4DCJB 1BHSA 4QASA 3LAKA 3THPA 4EPYA 1SG0A 1IEWA 1UXHA 1X42A 4R8UA 3FJOA 3BQMB 5E3PA 3TGLA 4LECA 2VFUA 3U9SA 1EDEA 1O5JA 1R8HA 2WYIA 1XNRJ 5DG8A 3TJRA 4W6QA 2XCOA 2HVHA 3WDKA 2BACA 1DRVA 1KFEB 1RWQA 2WIGA 3B6IA 2W6CX 4Y67A 2PNJA 1W30A 3LSYA 4WFIA 1E1NA 3B8HA 3ZYZA 3O2IA 1RI3A 5EZYA 4ETIA 3B9QA 3ER8A 4QFDA 2A18A 1NYLA 5E1BA 2K7FA 3DVAA 1TPZA 3LXXA 2LU1A 1M7HA 4RW9A 3Q85A 3COPA 2GFIA 4KGMA 4HLQB 4EKNB 4R8UB 2WM3A 1JA0A 3DMPA 2Y1FA 4Q2MA 1TW3A 4KRGA 5B58T 1SHUX 3NOOA 2CK3D 1RWMB 3UPUA 2IRYA 2HBQA 1MT0A 2PX2A 3DZJA 3P2YA 4CTJA 1QFSA 1FY2A 4IDBA 5B0GA 5K8IA 1I9GA 3HKBB 1Y9AA 3RSSA 1FMFA 2BDPA 3K6RA 5CJJA 3OEHD 4I2NA 2VDUE 2Q49A 4QNRA 5EWMB 3B82A 4GQAA 3OVSA 2HHHJ 2Q07A 2H8KA 2VLIA 4M5DA 1RT7B 4GR5A 1Z2AA 4EJFA 4P5DA 4FE4A 4YRLA 2HF8A 3M32B 1TYEB 2AV5A 2GEJA 2XRZA 1I2DA 4ZU1X 4DB2A 2GHVC 3R5FA 4A8KA 3TNLA 4DF3A 3DFZA 3L46A 2NMVA 1JG3A 3JASA 4V19X 4XTTA 2LDBA 4YO7A 2IP2A 1Z0IA 4PO1A 3PHBE 2P0EA 4RMJA 5ERGB 1S0VA 4HMOA 4EMSA 2LXIA 1C3OA 1RYFA 2LE0A 2Z9BA 2ZOMA 1W73A 5GONF 5ETNA 4GLBA 5JAQA 2GM3A 4JI7B 3T8YA 3W65A 1BMFD 1R9MA 4Y6LA 421PA 5KNDH 1WI6A 1HTWA 3LECA 4G24A 1NC3A 1RCFA 3LUFA 1NVWQ 4EMTA 4TXMA 5ALQA 3K6KA 2OSVA 1GTSA 3ZHYA 2R3VA 2WV9A 2HK2A 3MZ0A 5HP1A 3U37A 4B5LA 4IYJA 3EYWA 1UADA 3D6VA 4G65A 3PNOA 5KREA 3AHCA 3IJPA 2JL9A 1MC4A 4E4RA 3UJHA 1RT7A 5KFFA 2X8WA 3C87A 3L7BA 5GMEA 4DA4A 3DBHA 1C7QA 1SK9A 1KZ1A 4R7ZA 4LKRA 3BQ0A 1WU8A 1S4QA 3CVXA 3TFWA 1K5PA 4G26A 2VKZG 4LMPA 4WK1A 3BXZA 3W6NA 2RRNA 2YYZA 1CTQA 4R01A 4UM7A 2GUGA 1R0AA 1Q12A 3S7TA 5CEEA 2GRAA 2EF1A 4ON9A 4N9QA 1CIPA 1JAIA 4KH0A 3RS0A 1IZ0A 5BR1A 3K9CA 5BN5A 2YJNA 3FYUC 3W61A 3R6WA 2AWNA 4A0QA 4CG3A 1PJ8A 4QGBA 4BMPB 4RL6A 4Y9TA 4GOMD 2J7KA 5T5QA 3VSAA 4EHBA 2BEWA 3DDUA 1DPGA 2PGIA 4I64A 3GIDA 3EDRA 5CNKA 3E84A 2BZGA 3FEYB 1M6VA 4IH6A 4O4RA 3ZDZB 1B0TA 5IVKA 5KU1A 4HB2A 2SICE 3SR3A 1YI1A 4GKBA 1CUSA 1G1XA 4YRBA 1GCUA 1EMDA 1DLOB 4ZI5A 5KOJB 1PJRA 2ODQA 3TSWA 4RY0A 3SHOA 3AP2A 2ZJ7A 4B9EA 2C88A 1R27A 3QJJA 3C3MA 3HSYA 3NQ41 2HF2A 1EUCB 3ZDAA 2CQHA 3JQ7A 4DWIA 1TL7B 3MJTA 3L1JA 3G8TA 4NLRA 2XGSA 3KJNB 4QFMA 2BW2A 3TCXB 1C30A 2QMQA 4PBSA 4JJ4A 2UXBJ 2A94A 1L4BA 1S9GB 5JISA 4CFYA 3L92A 3DEZA 5TVKA 4MROA 5JH7A 2MR6A 5B7NA 4MGZR 4F4XA 3D3QA 2Z9DA 4IUCS 3M1YA 1BYIA 5BYSA 1GG5A 1AS0A 5PGMA 3RF7A 1Q16B 1X5SA 3OE1A 4UHHA 2Y0EA 2XMUA 4EQZA 2FQXA 2HQGA 2A84A 5CDTA 2ADMA 1SY7A 1URPA 2CYAA 2IYEA 3HSDA 4NE2A 3EB9A 5JI3E 2GOYA 3A6DA 3HVAA 1UPUA 4OHWA 3RKSA 3ITKA 1GPKA 3P0JA 2PZJA 3JARB 3V1MA 1FX1A 2NZ2A 3UAZA 2XGJA 1DEOA 4DDUA 1MGOA 4QEZA 3NBPB 2BKUA 4GGOA 1FPMA 1X1SA 4B6SA 5AW7A 4FF3A 2BY4A 4K0RA 5D0RA 2C99A 4C7KA 5CYOA 2W25A 3W6PA 2PL1A 1ISFA 3VX4A 1VBFA 5AJWA 1MLAA 3N2IA 2IDKA 3BAFA 4BQPA 3S2FA 1Y34E 2IJRA 3KVRA 4LXYA 4CYUB 2DHEA 4G5HA 4OZNA 5LZ7A 2GNAA 3N0XA 4GECA 2D7SA 4CQMD 2FVCA 1JMTA 5JOQA 3CUTA 5T67A 1UPTA 2MKYA 1ES9A 3EOBI 5E2QA 4N82A 3WLTA 1NDHA 4WPGA 3MECB 4NK5A 3JXEA 4GKJF 3BR8A 4DPXA 3NUGA 2W2LD 4ALLA 2Y76A 4UMFA 4ED2A 4JVLA 1M2KA 2QA4S 1NVVR 5GJCA 1M2VA 2CLHB 2E0IA 3GC6A 1C4KA 3RW7A 4BJ1A 3T3EA 2YWDA 4CKEA 1CKEA 5KYXA 2X8BA 1QYWA 3FTEA 3UIEA 3ZY6A 4YB7A 3WLFA 3FCHA 1SKSA 1Q78A 4ES2A 2OE2A 3W2FA 4ZK7M 4ZFNA 1IR2A 1BZYA 3RUEA 4X4PA 3HMJG 1NN1A 3NZEA 3SHTA 1TC1A 4NECA 2Z2ZA 2XA9A 4PLGA 4L27A 5JNRA 1C5KA 1ABBA 1SRRA 1G4AE 3DVAB 2ATLA 4DR6F 4K6KA 3EIUA 1AXEA 1MEEA 2HCFA 2EIHA 3QJYA 1SBCA 3K2IA 4LR7A 3BBPA 2ABWA 2CJYA 3O4VA 1KIAA 4YJFA 5K9FA 1XEWX 3L0DA 4U7FA 3P96A 1C9MA 3RTCA 2C2XA 2A3JA 3AKCA 2B9YA 2C2ZB 3IG1B 2I7TA 4DSTA 4GP6A 3EFBA 4RY2A 4PWDB 3EMKA 4RUBA 3EEQA 3BF7A 4XVHA 2Q6LA 2PT6A 1IONA 3MMBA 1WPXA 1F06A 2YWHA 3GUCA 4I4CA 4E3ZA 1T3SA 2VP4A 2D7JA 2QRZA 3VI3B 1I5RA 3L9XA 3KQHA 2JGIA 1RISA 4I1VA 2GCOB 3STWA 3JSMB 1HA1A 1ZH0A 2O7NA 4M36A 4R0MA 4HB3A 3HJNA 2FPPB 1R1DA 2O50A 4JUIA 3MQFA 4U2GA 2LKDA 4Q4JB 3DNPA 5JRJA 2K2PA 2VYND 5EHXA 3RO7A 1IN0A 5G0WA 2CN1A 1G2IA 5AXKA 2Q1SA 2R6CA