4M8LA

Crystal structure of rpia-r5p complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
b'KKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title crystal structure of RpiA-R5P complex
rcsb
source organism Francisella tularensis
molecule tags Isomerase
total genus 70
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4m8lA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m8lA01
4IO1A 2LQJA 1LK5A 2I9SA 5IT0A 4GO1A 3P96A 1JT9A 2RI0A 1O8BA 3LOUA 3AAWB 3AB4B 3OBIA 2RQKA 3LUYA 4NMLA 3HHEA 3CH7A 3IBWA 2RQMA 3KV1A 3OC6A 2QMXA 4L5IA 2QMWA 3OFHA 3O1LA 4L50A 4R7TA 2J0EA 3UW1A 3U7JA 2RE1A 3MWBA 4M8LA 3ENVA 3K5PA 3DHXA 3E15A 1M0SA 3IXQA 3DHWC 2P9EA 2P9CA 2W48A 4OQQA 3ENQA 2MDAA 2JOQA 3W7BA 5JJBA 3CSSA 3OFFA 4GMKA 1UJ6A 4OQPA 2DTJA 2J0WA 3ICOA 1U8SA 3BXFA 1FSFA 3NWPA 2FGCA 1LK7A 2PA3A 3OFGA 2F8MA 3EB9A 4L4ZA 2NYIA 1FQOA 3TX2A 1FS5A 1LKZA 2H9ZA 2P9GA 4TM7A 2JHEA 2KO1A 5IS2A 2LVWA 2PC6A 4L5JA 1ZPVA 2ZHOA 3AB2B 3MTJA 4GO5X 3NZEA 1PSDA 2RI1A 3LWDA 2F1FA 3TUIC 1DEAA 1UJ4A 3MAHA 4TM8A 5FIIA 3TUZC 1FRZA 3TUJC 4LUBA 3BXEA 1PBTA 3E7FA 2QRRA 1SC6A 1NE7A 2CDQA 1YGYA 3ENWA 4X84A 2R5FA 4R9NA 1YBAA 3S1TA 1VL1A 2BKXA 1KS2A 3HN6A 3CEDA 4L51A 2DT9A 2WU1A 1HOTA 2O0MA 3KWMA 2OKGA 1UJ5A 1Y89A 2J0XA 4GO7X 3BXGA 1RWUA 2QSWA 1CD5A 3DDNA 1XTZA 3OFEA 4L4YA 3N0VA 3L7OA 1HORA 2BKVA 5T41A 3EFBA 1Y7PA 3NRBA 1FS6A 5IT4A 2GNPA 5HJ5A 3DC2A 3LHIA 3BXHA 4PWUA
chains in the Genus database with same CATH superfamily
5L1KA 4KY3A 3W90A 2YCBA 2ZAYA 4YDDB 1E8MA 3ZGNA 3AFHA 2G13A 2PFKA 4PAWA 1BWPA 3B8HA 2A14A 3CJKA 5M3BA 1E3LA 2Z3WA 2FQ1A 2X0NA 4OIMA 4YQFA 2HZVA 2HSGA 2JA2A 3PS9A 1DTSA 2HV8A 2Z6VA 3KQKA 4GR9A 5HVFA 5K8TA 1Y5RA 3BA6A 2H9ZA 3KD3A 5IYZB 1LWFB 1I4WA 1FJ7A 2YZMA 1FX2A 1Q0RA 3CU5A 3MIZA 5I8PA 3FTEA 3UOGA 1VPWA 2IKQA 2V7UA 3KAPA 4ZOCA 1AE1A 3RCBA 2WAOA 5LN1A 4UHDA 3I9OA 3A14A 5FUVA 3QFSA 5JMNA 4YMIA 4IO0A 4YTEA 1BE0A 3U1MA 4D44A 3K5OA 3QJPA 1IBKJ 2HSEB 1H1TA 1ROFA 2J4CA 4Y2AA 3FMPB 4NAVA 2ERYA 2C95A 1F8XA 5D3MB 1X5OA 4ITRC 2OK7A 3M8KA 1I1NA 4M0FA 3DRPA 2HHPA 3IUPA 5TF0A 1U3VA 2OAP1 3PYMA 4CKYA 3N8DA 3IDAA 3AQIA 1YKWA 3VAJA 2Y1DA 2BPOA 4X94A 2DRIA 1ZISA 2Z3ZA 3W34A 5AW9A 1NKEA 1MNEA 3ML1A 1LDEA 3SS9X 2GN9A 3R3TA 3T3NA 1Z74A 2DTJA 1W52X 1J56A 2QTBA 3QRPA 1ZU4A 5THXA 5L3SA 2PSDA 1GA4A 5CX4A 3S29A 3VPCA 1QIIA 2GHVC 2YKOA 4RTMA 1ZLYA 1KI3A 2EKPA 1G8JA 1DBWA 2EATA 3EOAI 1RZUA 2DKFA 1ODJA 3VC3A 4IIFA 4OFBA 2PUDA 4CLLA 2A5FA 2XY6A 4WNCA 1CRWG 2JFOA 2Y0PA 2B4QA 4PTZA 2JLAA 3O73A 5FR2A 4IHAA 5BO5A 4F7WA 2HTEA 4ZAVA 1PX2A 2O01C 3I01M 4KUEA 1ZIPA 4LA4A 4JBIA 3GNQA 3VR2D 2H3EB 2ODEA 2J09A 2BJ1A 5J47A 5CT6A 4U7UD 4G89A 4CI9A 1YRYE 1B15A 4MB0A 5CFOA 4FB4A 4QQ8A 4GC7A 4CMJA 2WOMB 3N39C 3KOZA 5H9VA 5HIKA 3LP1A 1ZNWA 2PSEA 3DJYA 2FW1A 1CTQA 1VZ2A 4W98A 1JDBC 2F43A 4G63A 2V03A 4CLSA 4EJSB 1UJBA 2IDZA 4YOEA 3DRRB 1THTA 4PSKA 3LXRA 4KG7A 2HQDA 1GL3A 3EGXB 3VGUA 4CCHA 1RI4A 2CDCA 4UU8A 3QVUA 4IV8A 2XADA 621PA 5ELXA 1NDPA 4JV5F 4QNNA 1UBSB 1R7IA 2AB0A 5IH7A 3E3OA 4EYEA 4YCDA 4KT0C 1MFZA 4B3FX 2JDJA 1HBUA 1Y82A 3IG1B 1C4KA 4ARBA 4JP2A 3PRKE 3VNBA 1FVOA 3FG9A 4IXWA 2CWKA 3NY0A 4Y0VA 3S5JA 3CUSA 5EUBA 3UQZA 2DHXA 1G7TA 2E6UX 5KS2A 2G40A 3EE6A 5B37A 1FFXA 4NMLA 3QMQA 3OP1A 3PI7A 2X0KA 2EWHA 2COUA 4JVOA 3OQ6A 5KIAA 2G9ZA 1DV2A 2ZRFA 4Q4AB 4EBFA 3JD2A 4G07A 2O5DA 2HBZA 2W2KB 5KYNA 4MUNA 3HRKA 1PC5A 3RSGA 3ASUA 4BNXA 4FYVB 3EGWA 2AOTB 1RTHB 4BEBA 2G63A 1YDWA 4KXLA 2H7XA 2LWIA 1V3ZA 5AI8A 1X31C 4ES2A 1TTPB 5DM60 4MKYA 3RSLA 1V5WA 1I9GA 2XCLA 4URUR 3NTVA 2GK4A 3VOTA 4DXLA 4I3HA 1NHGA 1BWRA 3OF2A 3AIOA 1TL7B 2Q3JA 4W5QA 5AO9A 4DL9A 3HPOA 4ILEA 3AHEA 4AF6A 5KJ6A 1YOBA 2HGSA 1GKYA 3N0WA 2DBYA 2DP4E 4UZEA 3VO8A 1W96A 3QLEA 2WWXA 3IP8A 2J46A 2JD1A 2KRBA 4EKEA 2VG6A 1ZVJA 1Q7RA 1DTTB 4YLGA 2E5IA 1DHRA 3FDZB 4AQYF 6GPBA 2RJOA 1SIBE 2I67A 5BYKA 1SIZA 2IZZA 3G6XA 1XDUA 4BC0A 3ULKA 3SIPB 1LZKA 4DR4B 1RUSA 3M1AA 1QK5A 1Y8AA 4CL2A 1NW3A 3AUFA 4IXDA 3WV5A 4Z4QA 3HLUA 1A9SA 2Q6VA 4AO8A 4ENUA 5EGYA 1MU2A 5I4IA 2VG7A 1KVTA 3BPSA 4BHTA 5JV5A 1QX3A 4PWWA 1V6HA 1ZI8A 3HXOA 1W36C 4MYCA 3TLGB 5M29A 4V3BA 3RSSA 4NEQA 1X3LA 1ISPA 2DFKB 5CJJA 4M1YA 3RFFA 3ZWQA 4DCTA 2HHQA 4CF6A 1F51E 1VOMA 3OJXA 2FVXA 5L4NA 1BH6A 4NS4A 3GLQA 3G8SA 4UAVA 4KYZA 1O03A 1O95D 3GLRA 1RT3A 3KEGA 4D4MA 3R7AA 2VJMB 5B3KA 5KG6A 1GUDA 1QO7A 2PGJA 1ILWA 2O2HA 4P6QA 1UBJS 1YZ6A 4FGZA 1W4AA 1JPVA 3C85A 3JZFA 4ECQA 4P1ZA 1IR0A 4U7PB 4KQKA 3AJEA 1JLFB 4RW6A 2KS6A 5KFIA 1VJWA 3TAHA 2H4WA 4WU2A 4UXJA 1C7QA 4CQMB 5FTJA 1HBMB 2X76A 5J1TB 3GMGA 5AOBA 1RWMB 3DFZA 3R7FA 2YJZA 2H18A 3NYRA 3AVPA 3OCUA 1ZUWA 3FBEA 5H83A 2JJYA 5AVSA 2DT9A 2MSLA 3WYDA 3BM7A 5KFJA 2EERA 1CJKC 2QU8A 3D9QX 4PZAA 2Q3DA 2UZ1A 4IRXA 1V5GA 4UNNA 1I3NA 4V0KA 3VKHA 1NU4A 3K53A 3I2YX 2Z2YB 3EUNA 2ZXUA 4HF7A 3GPIA 3SMZA 4X1YA 1NDCA 3GT7A 4ZC8A 3HRHA 2JZOA 4QIFA 3I9KA 3WIDA 1SHTX 4FD2A 3QGGA 5CJ2A 2PRIA 1G3OA 4DPKA 4WKGA 3NDJA 3Q12A 4J6EA 4KN5A 4I14A 1EAYA 5AWFC 3BS4A 4KVZA 5F7XA 2FDCA 5IANA 1UQRA 4AZ3B 3F73A 4GW3A 4RZUA 3ZWOA 4JA0A 1FP1D 1XD9A 1NHUA 2XCPA 1ZXBA 4F2PA 3ZGLA 2EQAA 3TLJA 4NATA 1MWZA 2F1FA 4PUOB 3DAGA 3TA2A 2X6TA 3PDNA 3PNSA 2ZUAA 2IV7A 4MIBA 1G4CA 1E3SA 3AXKA 2R68A 3Q5DA 1JJBA 1PEDA 2R1VB 4PM4A 3HN2A 2FJXA 3DGEC 5B0BA 1CJUA 4AJEA 2HHVA 2HURA 4YB5A 3HKEA 2FMTA 3N2IA 2VFAA 2B1QA 5LP6B 4EJMA 4NLOA 2JRLA 1NQUA 1P1FA 3LCVB 3EVTA 3M8WA 4LTDA 2ZH2A 2W4MA 1JPJA 1B4SA 3CZMA 2QNIA 5KYGA 2KVQE 1SPBS 1A6LA 1RWVA 1SWVA 1NK6A 1FYWA 2EZ8A 4OQXA 3P4YA 3JV7A 1VZ3A 2XPCA 1QG4A 5H5JA 3CW9A 4XVCA 2ZUGA 2P40A 2B94A 4NZMA 3NOVA 3DMHA 3HO6A 3BMOB 3EYWA 4KODA 4LIRA 1Y5MA 2BFCB 1KP9A 3NBYC 4LYDA 1K5HA 5BNFA 2XF2A 4F72A 3BBLA 4HEA6 4B6EA 4GC6A 2YBVA 4J9KA 3EJ6A 2GZRA 3M6AA 1A7GE 2GEJA 4PFJA 1I4OA 1MO4A 2KXFA 4NCXA 3VAIA 5BORA 2QL7B 3HKCA 1E1NA 1JSCA 3AF4A 4DOMA 1YTUA 5IBCA 5ALDA 3NNHA 1JQJC 2C2OB 3FCSB 1O97C 3GWCA 4BMSA 3AA8A 2PA8D 2HU5A 4EUNA 2HGZA 1PDOA 4CV0A 1JZQA 5AQ1A 5ELMA 2WF6A 1XERA 2OAEA 2CK3D 5EZSA 3HJAA 4WYLA 4QQNA 3HCCA 1SQ5A 3QM1A 1I3OB 4JV5J 4K6GA 3H83A 3AV3A 1YJ9S 2BEFA 1YBHA 1BKYA 3R5BA 1NU6A 2CNLA 1Z5ZA 1EP3B 5J1SB 3GR6A 3DFFA 3KLPX 4DCGA 4DCSA 4QPPA 4AXBA 1X2EA 3MM9B 4MDHA 3ED1A 1VIYA 1GGFA 2WYVA 3L7YA 4FWBA 1JQKA 4N9WA 1VM6A 4K3VA 4PX5A 3G6ES 4RBNA 1TIBA 5F9NA 4HDNB 4AUNA 3NFYA 2OPRA 2XTZA 3FGNA 3IFEA 1UPPA 3M1LA 4FYXA 3VM6A 4LUBA 3IDZA 5IBQA 3HHLD 4XQEA 1P5ZB 5L6LB 3KAQA 3VGVA 2HA6A 3D1VA 4UBKA 1U2GC 3KDNA 1W0JA 4GQAA 5CD9A 1EETA 2AVNA 2CE2X 3DCNA 3D1LA 4PIMA 5LVAA 1MD9A 1HWIA 1X9IA 2VNSA 2QZ4A 1OV4A 2Y1CA 1MABB 3BS9A 5JTUA 1F9EA 2BSQA 3N58A 4C0JA 2HHCA 2HLPA 2D06A 5AUOB 2QLTA 1FMTA 4FXDA 1RAOA 2HSEA 3O91A 5GV7A 2BGLA 1AQ6A 4DUGA 1X9HA 1TQ6A 4BRSA 4XB6B 4MGHA 3FZBA 2OEJA 2QEXS 3WHKA 4IFTA 4NOKA 2W4PA 1IYZA 5D3KA 2D5CA 3OQBA 2XQJA 1QRAA 1T8YA 1IQUA 3DCJA 4IO9Q 1X9MA 4YAJA 4Q2LA 4UEWA 3PO5A 1NP7A 2YXDA 2B0JA 2QHXA 1CQJB 4AF8A 3CNNA 4P33A 2OFGX 2X8WA 5ADZA 2PVCA 3EXHC 1Q8KA 5C31A 1QBGA 3DF9A 1VKHA 3QBCA 2PANA 1EI9A 5KNDA 4HZUB 2AJ4A 3HA2A 4AFFA 4ZT7A 4AQYJ 3RG6A 3CKKA 4IHJF 2PMKA 4NLUA 4Y2TA 4R2MA 2IEAA 4PYDA 3K89A 4ZANA 4WP9A 2G9RA 1OR8A 2AYGA 3KPVA 2QBYA 4DPOA 4LC1A 5DS7A 1RADB 3C6QA 1Y1TA 3OQ2A 2GD2A 4L3NA 4W90B 3VAFA 1FVHA 3DI6A 2H3EA 3D64A 2R4UA 3C7AA 2GFFA 3BXPA 2WOMA 2ORYA 4R0MA 4NBTA 5DGHA 2JI4A 4RAQA 1KTQA 1C7FA 1LCIA 1GAJA 1P6XA 3L84A 2BONA 3C98A 1S1VA 1FU4A 3OQHA 4MJKA 2XMJA 3LPDA 3D6MB 5JJKA 2PU7A 5BV0A 1Y4AE 4EI2A 3D3NA 5BOSB 1TMYA 4AUKA 4D9IA 2NS1B 3NNSA 5A6PA 2REQA 3PE4A 3GONA 3CUEF 4QOEA 3DAYA 2GPJA 4UDXX 1A4IA 1NMEA 1J06A 1NRJB 1B6GA 4F50A 2NW6A 3HCPA 2FX2A 3T54A 4BO4A 2FWBA 4CEHB 1A5BB 5EESA 1CRZA 1KQNA 5A6SB 3W9BA 3BH6A 1W4BA 2XUPA 1F06A 5FTNA 2K7FA 2BQRA 4Z9FA 1NSYA 2AFRA 3PHIA 3ZD6A 4YP5A 2WJVA 1HPZB 3B4MA 3VJMA 4BB6A 2A6MA 4FI3C 1MOPA 1P39A 2QMQA 1XFDA 4M8IA 3LF2A 1GNPA 2L69A 1DBDA 5A8WB 1WC0A 3IG1A 4BJ1A 3F6CA 4NI2B 3W2EA 4RH1A 4Q1FA 4B1FA 4EKNB 4A03A 2XB6A 2QN9A 5K8MA 1BE4A 2R6JA 3DZJA 1WHSA 2QU7A 2WTEA 2KQUA 1NYTA 3VTKA 4E46A 3VFDA 4ZVOB 3UAWA 2Q5OA 2X15A 1OKKA 1AA9A 5KTPA 5T64A 2X3UA 2CZCA 4DSLA 3C3MA 3F5MA 4ECTA 2HA0A 3PYFA 1NE7A 4U8VA 1V71A 1YUMA 5FQOA 3DGFC 1TKBA 5FPKA 1LD3A 5K99A 3AILA 3C24A 1CJCA 2XE7A 3E7PA 4ESHA 2E49A 4QG7A 1Z2LA 1BX0A 1TZCA 1NRIA 2UUCB 2B6HA 4UDYX 3T3IA 4IG0B 5KWJA 2WW4A 3ELDA 4WPGA 5HEKA 5F0UA 4NLRA 1XWLA 5TGDA 3ZUPA 1ICIA 4FDLA 3U7GA 5CLJA 2Q2VA 2OE2A 5IOLA 2B82A 2E5GA 4EB8A 1BYIA 3QGPA 3SM9A 4RENA 3MWGA 4EB6A 4B43A 1XZPA 4FOSA 2W6QA 4WKYA 4O3MA 1M90T 3CUYA 1G5TA 3KR0A 5FWNA 1BO6A 3N01A 4AJLA 2WIBA 4KMMA 5JUWA 4KR6A 5T7BA 5JCZA 1J0AA 1T3GA 3EFOA 3FNFA 1SIWA 1JECA 1NBOA 3BM5A 5ILQA 1JHAA 5JFOA 4WACA 3ZS9A 1GTMA 2LVWA 4OH1A 3FDZA 2VTVA 3MFYA 1Y9AA 3MSXA 2MYTA 2J3JA 2LQ5A 4BMVA 2HVZA 4I64A 4PXSA 1EYZA 1VLQA 2QJRA 3BGOS 5EIBC 3SIPA 1KYXA 3D6JA 4DVGA 5DTMA 1T05A 3QKSA 4HD8A 1F8FA 2BN4A 4I1SA 3THOA 4MO9A 4AQDA 3N9IA 4GPIB 4TMVA 5GGYA 2RHDA 1GIAA 5SYAA 5J2UF 3SEZA 5DZSA 1U0HA 4PGMA 2H65B 2Z2MA 3R6LB 2ZRJA 3Q7SA 3NM6B 2BWJA 2O20A 3KD2A 1PDWA 3GCWA 2H4ZA 4J0DA 1ZM4A 4LGYA 5GP1A 1UZLA 1S1WA 4CDIA 2YQZA 2VJNA 3GROA 1N8KA 4XVHA 5IT9Y 4N3BA 4A8QA 1C80A 3GVPA 2WQ6A 3KWJA 2Y0CA 2FUNB 1Y1QA 3MM5B 1TYZA 5EMNA 3GVIA 2VJMA 3WRVA 4FGKA 4B73A 3VR3D 1YZYA 4TSFD 1O9HA 4QOGA 4CUJA 2GSWA 2WHRA 3OZWA 5DLEA 5H4GA 1Z62A 2E4WA 1QIJA 3HU3A 1UPUA 2APJA 3PDHA 5JG7A 4UOHA 5D6OA 5AVUA 1NBIA 2A84A 2VYNA 2BRKA 3U4IA 1M1NB 4ZTUB 5H9FJ 1IPEA 2B4UA 2PSHA 3N28A 4Q4JA 3TK1A 4K2JA 2WIKA 4CQMA 5LYJF 4BVJA 1HBMA 3GI1A 5KTRA 1LLFA 1TYDE 1ID1A 3PHBE 3EGVA 2QGZA 1RBAA 2CUYA 1RWMA 3DXYA 1G20B 5KTNA 1RTKA 1GU7A 4GR4A 3NO4A 4ZLLA 1B3TA 2IEZA 2V0CA 3WWEA 4LVNP 4L27A 5KYVA 4RACA 3T3DA 3V4ZA 3SSAA 2N0SA 1R8YA 2V7GA 1AXEA 2ROPA 3C6TB 4PRLA 4ABTA 2FZCA 4RR5A 1NM2A 3LC0A 2Z2YA 1EGMB 1N57A 2ZH6A 1SUWA 3DO6A 2ZYDA 3RFXA 1DJPA 3N5CA 2X4DA 2Q49A 3IQXA 1CETA 4RZRA 1CDDA 2WHYA 3L41A 2LKDA 1GZ5A 3OPQA 1MCZA 3JSMB 1TFRA 3EVAA 2D9OA 1G38A 5HL7Q 1L7XA 4AZ3A 2VAXA 2W24A 3TOXA 2GTHA 5IUJC 4PN3A 3H5WA 4E14A 5JS6A 2LZ0A 1YCDA 5AM3A 3LCMA 3BQNB 4L0CA 4CBVA 2IITA 3LLUA 3U3DA 2VF3A 5K1ZA 1B0UA 2YYAA 1XN9A 1U1KA 1JG1A 4CMGA 2WHQA 4IQXA 5JYBA 4FS8A 3CCES 1RKIA 2I2FA 4OFXA 1JHOA 2FVQA 3P3DA 1OYVA 4Z99A 4OK6A 1TJ5A 1D1UA 3UDEA 4G1EB 5DLDA 1QMPA 2FZKB 1UDAA 2IX3A 4AS1A 1U2DC 5A1TA 1IM8A 2OPSB 4G8CA 1LZLA 5HQTA 2ZHBA 5GJBA 2X86A 1U0BB 4KQ2A 2ZJ8A 2HVEA 1P91A 2OXTA 2RK4A 5DDIP 1AHIA 3Q8LA 2NP6A 1R66A 1YIDA 5DW3A 2YKNB 3O2QB 5C24B 4DUZB 2FP4A 1MF7A 3QI7A 1JI3A 5HDBB 5IZCC 1IMJA 3OURA 4WH0A 5DHSA 3T1NA 1PL0A 3UK0A 2CDNA 4FX2A 1OBFO 4CKEA 1RCTE 4FYYA 1ZN9A 4IIJF 3KIPA 1QGDA 2HV9A 3MF5A 3PDIB 3C6BA 3MTEA 1PV4A 2X9QA 3TEHB 1TXGA 4E2FA 4R8MA 2VWPA 4IHJA 3G49A 2FG5A 1IY9A 1GUBA 3M32B 3ME5A 4HHHA 3HJNA 4F2RA 1IONA 5HIMA 4ED4A 4FNIA 3E27A 1O0BA 4HEQA 2V7QD 1TEXA 3A2NA 4DRYA 1MENA 1XEZA 3OQVA 2MQ8A 1FRMA 1FVXA 3FWYA 3GQCA 3M9WA 3BL5A 4DSAA 4L72B 4CDGA 1XR5A 5FI1B 4HHJA 1NXIA 2R1UA 5E3HA 1M2GA 3O8OA 5G0RB 1H69A 3OHMA 4U2KA 4WTOA 4QVKA 3WZLA 4QASA 4B6RA 5IG2A 1FFWB 1ZCAA 3HCEA 1M5KC 1QFMA 5LSLA 3OEED 3FHJA 3G2PA 4DLWA 9ATCB 4X44A 1AK1A 4NBWA 2OBNA 1B6RA 2XA1A 3PXXA 3LRXA 5B09A 4LF5F 3ZGVA 1T91A 4F3MA 1ND5A 1FTCA 5LMUJ 3K0AA 1CUEA 5KT6A 2P9YA 3N75A 1N0WA 2IIVA 2OQIA 4D82A 1E6VA 3W5XA 4UUOA 3TM5A 2ODPA 2UYOA 1HDXA 3ZHSA 2AF3C 3T1OA 4TYAA 2ZEJA 2AMCB 1MABA 1JP7A 3N0RA 1DT5A 3A8JA 2Q4TA 4UM5A 1IY0A 5G0TA 3JAWB 4RPIA 4C3KA 3WRXA 4ZZIA 4EA8A 5EXPA 5JW6A 4WLFA 1OAKA 2V1UA 4KH1A 1R0BG 3A3YA 2C2ZB 3D43A 4ODIA 4BO3A 4JP5A 1J22A 2VSQA 2ZQZA 3GG1A 1OX6A 3R9WA 3NGSA 2VDPB 4FEAA 2BIFA 2ZB7A 3RFUA 3GYGA 3RRHA 1IN0A 3QKRB 4E5YA 3RW9A 3KT8A 1KH1A 5EXTA 1N8SA 4CM9D 4WK6A 2QYOA 4MTPA 4TQGA 2Q4DA 1QYRA 3SWWA 4J6FA 4LSZB 5F9LA 1OQAA 3TSCA 3QNWB 1L4YA 3PEFA 5HVGA 5A0YA 4UTRA 4R5PA 3GQBA 4XTTA 2CQBA 1W2WB 2B7BB 3NOCA 3FPBA 1T8RA 3REFA 1VIAA 4MRMB 4NVRA 5BW8A 2LR0A 3TNJA 4RANA 3OTOF 1JG7A 4F71A 4BX9A 4CV2A 1RADA 1E6KA 1STOA 1R12A 5EHXA 2AG1A 4ES3A 3BG5A 2DJIA 1T7PA 4LXQA 3UV7A 3BBCA 1W1IA 4FZRA 4AFNA 1HQ2A 4DB2A 2FN8A 4HAXA 2VL1A 4FMCF 1GGHA 1D7AA 3OLQA 3E70C 2AD9A 4PG6A 1SC9A 1KE2A 2Q6OA 2PI5A 1KJQA 2HXGA 3CJKB 4TLDA 2J4DA 3PFIA 5L1IA 3HP7A 3FN4A 5B30A 2C28A 2QVLA 3MGGA 3C3LA 2C2HA 4Z49A 1OWOA 1CFJA 2MT9A 5EFZA 4KQIA 3VKGA 1HFJA 2VBXA 3FB1A 3R0IA 4ELVA 2D1CA 1UBGA 3EGIA 1XMXA 5E5NA 5J2UA 2XYPB 2XUZA 1HA1A 3PTAA 3U80A 3KHGA 3QU5A 4CEHA 3OZTA 3MSCA 4YUZA 2PL1A 2AJLI 3ANXA 4BN4A 5AW5A 1V8BA 4RU1A 3F0TA 4BVLA 1PD0A 2Y67A 1F8UA 5H1SV 1FF2A 1YNOA 5DU2A 3H05A 4DANA 4L3KA 1RWNB 1WTFA 4EZ6A 3RT1A 3FYHA 3ICPA 2BEJA 3QKWA 3U37A 3MJEA 1KNXA 3KEFA 2O5CA 1XXHE 2C3PA 4BJHB 2RKWA 1LWOA 3ZZZA 3IOMA 4D43A 3E5HA 4NI2A 4BMDA 4Q21A 1U7ZA 1R6AA 1KO7A 2SBTA 3DRPB 4Y6SA 3K5MA 3KK0A 2ADCA 2JBWA 1GNSA 5JSZA 2MLZA 4EF6A 3PNPA 2I2AA 3QH4A 3LHSA 1BMFA 2YMMA 3KR9A 2H00A 2HZ7A 2DO4A 1ORVA 3ST7A 2GEUA 3EMVA 4YB8A 2ZH5A 1VYVA 1REVA 2Y71A 4ZGBA 1YR3A 3WZMA 1IBKB 1Q7CA 5L3SB 3WI7A 1BMDA 3ENZA 5LYJA 1GK8A 3NTUA 2ODBA 4ZV7A 4A15A 1X4CA 4IO1A 4MQEB 4ZT3A 1UEUA 4HB4A 1T0IA 3O8BA 2ZTLA 1KBOA 3W4JA 4LZZA 1QE3A 1Z4UA 2LGJA 5IZ4A 3THTA 3OQJA 2J8ZA 4OJQA 3KU1A 3V3KA 2MSNA 4HT3B 4FFLA 4IG0A 1FEEA 5LD2C 2EFCB 4JQYA 3ILVA 1CDEA 1U7XA 2DERA 1WD5A 2FUG9 4KQ9A 3B1JA 4NU6A 5KYYA 5ETPA 1B4DA 3TA0A 4J1NA 5BMVF 4S0ZA 2NPOA 2HCFA 3DLKA 5A5GA 4DJDC 4JLKA 2ROEA 5EA2A 5I7OA 2VUSA 4FOOA 4ZVEA 2G9VA 3PHJA 1SHZA 5KKCA 5LUAA 4USJC 3DEZA 4XSGA 3LP1B 2QNRA 3R7NA 1E1RA 4CM3A 3VNAA 3B53X 4E2XA 1G21E 2CHUA 2F43B 3ROEA 2N75A 4RV9A 2YWDA 1JNZB 5K3OA 4GC5A 3MNFA 2YXBA 5B64A 4F0JA 4BNVA 5LQUA 2Q8PA 1S3GA 1KZ4A 2R11A 4P8RA 3AR6A 4NKRA 2C58A 2QO3A 4U63A 1WB5A 3C8HA 3F3MA 5E2AA 2FYTA 1KP3A 3S7RA 3TGWA 3NAHA 1OXUA 2HQGA 2JCSA 4OM7A 3IBGA 1MA0A 1GXTA 3QSYA 1U6BA 2NTJA 3OM1A 1HBUB 2A5DA 2QE6A 3KLBA 1AZLA 2HMIA 3HHNB 3MA0A 1SK9A 4FMPA 1XV5A 4ENTA 1QB8A 4E1BA 4JS0A 3ESRA 5CK4A 1VI7A 1ZN7A 3W9YA 3ELBA 4GPBA 1U1FA 2OGZA 2JEYA 3WLHA 1T5TA 2MB0B 2YQ4A 2V5AA 1FDSA 3EH2A 1PYDA 1FFXB 1S12A 5I9MA 1IUJA 2ZUEA 4HN4B 5DCUA 2R96A 2XMGA 4BCAA 3MM5A 2ZIVB 3QUQA 4W82A 4M49A 3E7FA 1YR9A 4FDMA 4X84A 1CVJA 4IBOA 3F0NA 3UR0A 3E3NA 3NHPA 3FOFC 4REQA 3AP2A 3JYOA 3TIGA 3K30A 3L7KA 4IIJA 1W35A 2OO5C 4LDPA 2RSQA 2HBZB 2DT5A 2IEYA 4ZOSA 1C2TA 3EGWB 1PJBA 4LKOA 1EKRA 4IQ0A 4I9FA 1M1NA 3GXOA 4PVCA 3SC3A 4BHQA 3GPDG 4N65A 3FPFA 1XWFA 2CJQA 3A1SA 1NNSA 2HYDA 4P58A 1DXQA 4U02A 4ZU6X 4TV9F 5IJXA 2O5VA 5BR7A 2JW5A 3CO0S 3VR1A 4IXMA 3J7A1 2B0CA 2MZRA 3VHXB 3GMIA 4ZKAA 4RTLA 1E1DA 2YX7A 1SCAA 3OO0A 4J9OA 3CZCA 2GBLC 4OZJA 4D99A 4LF5J 1EP9A 3IMEA 5DM4A 3GZNA 3NT4A 2H1YA 3ZIDA 5LLDA 4UM9B 2QY9A 2IC3A 1D1PA 3PUIA 2J0SA 3B8EA 5K3CA 2QW0X 2VVTA 3ZZYA 3MR5A 4B82A 3QPAA 4XWYA 1X8JA 4NXNF 1MN7A 2M9KA 4EA9A 4G0UA 3I0SA 2LQJA 5KCMA 4NPCA 1MU2B 2VG7B 5BWCA 1Y48E 3ZTRA 1TU4A 2IOFA 4LYEA 4P5EA 3OLXA 4MV8A 5IM5A 3N1UA 2RUGA 1NSAA 2HFNA 2CLIB 3BB1A 3LQQA 5DRTA 3NOQA 3UV6A 5JLJA 4AULA 3TI7A 3JPWA 4IYRA 3HRIA 2W98A 4FFVA 5EXSA 1Q1GA 1VXOA 4IVRA 2ZVJA 2I3ZA 1RT3B 3CURA 4GVPA 1QLNA 4KPCA 1K6JA 1ZAVA 1FD2A 4ZZ3A 4Q9JA 5DVZA 2HLDA 3QK7A 2RB7A 3Q6MA 1WC4A 5E41A 4RK7A 1X94A 1IY2A 3BMCA 2YKNA 3MGCA 2JEIA 4H6VA 1RRKA 3WAGA 3RUCA 2WYIA 2YBEA 3W3AH 4FYMA 4JUDX 3I45A 1KO1A 4QBUA 4W5HA 3NP5A 2GZOA 4RW6B 1G0OA 1U2TA 4NCJA 4PC2A 2H4WB 3OTOJ 3KBOA 2CV2A 3I30X 3GRKA 2LQ8A 4WKNA 5DM2A 2CFCA 2D8MA 2OH2A 2C0CA 2PGDA 4QX6A 1E7QA 2PI4A 5G53C 3UJBA 1H4QA 2PSFA 3T5PA 1YBTA 2HMTA 3MAGA 1PUXA 2EX0A 2VK1A 1IBCA 2YRWA 3HVAA 3TEFA 1SAYA 2UZ1B 1T24A 3NV9A 4DL4A 3PZBA 4EW6A 3DVLA 2VC0A 2CLEB 4UPVA 4P82A 2OM2A 3WBJA 4Z7QB 2WU8A 5B1EA 2FEWB 1P8AA 4DMZA 1WC6A 5EE1A 3GLIE 3KHKA 3ESBA 4OLHA 4NASA 4H7FA 5E2QA 3LE8A 3MCAA 4JV0A 4OLOA 1SCDA 2I6SA 2LYVA 1XNQF 4U7WA 3CUWA 3TX8A 2M9MA 1G2PA 1Q0UA 4Q00A 1ONOA 5EGSA 1G1MA 3CE6A 3DVQX 2FDNA 3GGPA 2IYVA 1I51B 4H2DA 3QE2A 1GQRA 3GA0A 4AAYA 3F46A 4BP8A 5JNRA 4LZPA 3AVUA 4P4UA 2IVMA 2FPGA 4BO7A 4GGMX 2HVDA 1L4LA 5HOQA 5EUCA 2HBYA 1PJ2A 4BLUA 5KTSA 2I0FA 4BB9A 1WPXA 3NGLA 3VYVA 1OZ0A 4LVOA 2VC2B 1MC8A 1CJUB 4KC5A 4WZBA 3KRTA 3HKEB 3O5TB 3IUJA 4MZDA 4CETA 2DHQA 3D28A 2DKOA 1JRLA 4W8HA 2QLFA 4L5JA 3OLZA 3RGIA 1ULZA 3H99A 2FPKA 2WHXA 5K9ZA 1XEWX 2DWCA 3LW8A 4NC9A 3GILA 2QPLA 4QM7A 4E5VA 4U4AA 3BGIA 5CLLA 1FPMA 4RM2A 2IHYA 4NU8X 1RWVB 3DU5A 3HCNA 1A2BA 4W5NA 4FYDA 3JAWA 2EFNA 1CBUA 4AY5A 3MOSA 1R7RA 3CNQP 4V39A 2DIUA 4RUCA 3GIIA 1EAMA 1OFIA 1BQNA 4HGZA 1Y7PA 1W49A 3LVRE 5ALIA 1QIEA 2K4MA 1HZZA 4MQ5A 1M2JA 3DB2A 1I10A 1VC0A 1VQ7S 4N7MA 4WLVA 5HF6A 5GWXA 1O8CA 4ZCRA 1U98A 2IM2A 1J0CA 4E98A 3X1KA 1UC5B 3PW4A 3F74A 3I76A 4TRRA 3QKRA 5LWHA 3MOZA 1XHLA 5CNJA 1U28A 4FF4A 1TUEA 2HF9A 3CINA 3EULA 1P0IA 2CV0A 2WJAA 3L04A 2LKZA 1E2UA 2W0MA 2ZRDA 3IS9A 2YYZA 1PK7A 3CLRD 2OHOA 4XTCS 1CZOA 1FFBA 1HWLA 3EPRA 3OJUA 2R8JA 1Z0UA 3W8PA 1DX6A 4ENQA 1YMUA 2QMEA 1JLKA 4M0PA 4GX0A 4FU0A 2EI5A 3D68A 4MRMA 4Y6QA 3OLBA 5J2TB 1JLQA 3KZOA 1C4CA 1XK8A 3ZXUB 2CNLB 1VHIA 4FDVA 2F9JA 1SQEA 2QX7A 2AZ1A 1FTGA 4RMNA 2JEZA 3NHJA 4TMXA 5CBKA 3CX4A 5CP8A 3CUUA 3CX7A 4C5AA 2NO6A 1NM5A 1P9LA 4XX0B 3E53A 3ZQ6A 3RAJA 5FEUA 3F98A 3P96A 2OPRB 5F9FA 2YWGA 2E4VA 4EYGA 4NE9A 4FYXB 2X0DA 1RKJA 3NNDA 2XUHA 4Y9RA 1ZTTA 4G0PA 4JV5B 3ENVA 2BD0A 1YDLA 1CUVA 4OHFA 3WGQA 2Q3BA 3DPSA 1YZTA 2DH8A 2XYPA 2NT3A 3N5KA 3VDNB 1P9NA 2CQ4A 1SD2A 5IEBA 4OHRA 2XZOA 1EETB 4KUHA 3WKDA 5F8IA 2W6ID 5AVKA 4IDNA 3HABA 5KSYA 3Q5EA 5REQA 1G3IA 3BILA 4NBKA 1RWNA 1F9EB 3IP1A 2EBUA 4XDHA 2BTQA 1N6PA 1YJBA 5FBLB 5J4YA 2GH1A 4QDXA 5IT5A 1QTRA 1W7AA 2C4NA 4JI8F 1N5OX 5JAHA 2QPTA 3ID6C 3GJ5A 3C48A 3UO0A 3H3XA 4HGPA 2J08A 2RAPA 2QT0A 4AK9A 2HAIA 3O3MB 4CCWA 2FQYA 1KQKA 4GIBA 1S2MA 2ETVA 3HHEA 2Q2NA 3NAZA 4EO9A 4DJAA 2OLKA 3JQAA 5HGXA 4DMRA 1Z5NA 4MGZR 4Q45A 4EPYA 2ZVDA 4FT4A 4MQEA 5K4GA 3SXLA 3MDFA 2WAXA 4M1EA 4TV9A 1JKHA 1KDPA 2O8EA 2ICAA 5J40A 1CQWA 4FUQA 4C0KA 2C59A 2YWXA 4BPBA 5KOIA 2OGWA 2WBRA 1L6RA 4OO3A 4KAFA 3BWCA 2QBYB 2B30A 4GMXA 4NXNJ 1T2EA 2AOXA 3DE0X 2WMNB 4LMRA 4B3MJ 4R1OA 3E4DA 2WV9A 1VE6A 4MP6A 3DI6B 1QHIA 5UKDA 2CDQA 2AF6A 2GNOA 4ZITA 4Q66C 1MHTA 1RWWA 4AQYB 4U2FA 1R6YA 1RLIA 5J2TF 4JI5F 2FSPA 3FZEA 2DHAA 2WB1D 3Q4GA 5MN4A 2YV4A 5BYQA 1RFLA 1SVUA 1CQNA 2BCGY 4EELA 3GJ3A 5G0UA 2EKLA 1S1VB 2EZTA 2P6OA 4PWUA 4XJVA 1BC5A 1S8OA 1I36A 1CQXA 4B48A 3NKFA 1U7HA 2JJ1D 4WOJA 2VAWA 4TQAA 4IIGA 2REQB 2M6RA 2FSFA 1NMEB 1CZNA 3SIRA 3BXOA 3SQDA 3NJRA 3BH6B 3DFEA 1VLLA 2MMYA 3F4KA 1UFWA 1VHQA 2ZSJA 2RD5C 2WOJA 3NPMA 2A0XA 1N78A 3M5PA 3PT5A 4TXMA 4B3CA 3D1HA 5IDVA 1RWXA 1P7YA 2IS6A 4CIAA 3U6BA 2PRSA 3Q8RB 4DYDA 3T5BA 2Z04A 5A02A 3ZDXB 1Q1BA 5CB4F 1YQHA 2W22A 4B75A 1TE2A 3OQ1A 1EJ7L 4AWAA 1PNTA 2SNIE 5G40A 4RETA 1JXVA 2ZFUA 1WHSB 2WJHA 4EENA 1RB0A 3IEMA 2BDEA 3OSPA 1HW8A 1V6CA 2AI1A 4ZT5A 4R9SA 1C50A 3CVKA 1UK6A 4KUGA 4KSYA 4OA8A 4BP1A 3UFBA 2GBFA 5JDIC 5HANA 1E6WA 5IMBA 1Z07A 2M2BA 3Q0AA 3C39A 1DHMA 4NICA 2DT8A 4R8KA 2OBFA 3M1VB 5DXJA 4MKVA 1VRCA 4U2BA 1H2FA 1XNQJ 1DEHA 4XQCA 2IHR1 4JXXA 1ATIA 3DKIA 2KJVA 4G8BA 1CF2O 4D8UA 4OYXA 1XZLA 2V2ZA 2X1BA 3C14A 3RU7A 4L0QA 2FEKA 1SKYE 4QTZA 4YCLA 4N0MA 5CITA 3OTDA 2YZ7A 2N4DA 4JLSA 3QOWA 1X14A 1P9RA 1AUVA 2YOHA 4EB6B 1WC5A 2AD1A 3TNYA 3VHXA 4DF3A 2HJGA 4A2WA 4G0VA 3RC7A 4JYBA 3ETMA 4XPIA 3GEPA 3SQXA 3TVYA 3H1FA 1SVNA 4J7XA 2ZYVX 5ALQA 3EFOB 2R6CA 4AG6A 1SIWB 5AVJA 1LQTA 1EKXA 2RGNC 3IDOA 1J9EA 5CDFE 1C8BA 1WB4A 5FHRA 3V9AA 3SBXA 4L7QA 5K0EA 3EOZA 3MD1A 1JEDA 3EAQA 1E61A 4I3GA 4BPRA 1XLWA 3R77A 3DGPA 1NJZA 3QKSB 2A18A 1T05B 3DBRA 3PV0A 5CIQA 3MLBA 1DCKA 2CJAA 2CLFB 2EDAA 5EXDA 1U0HB 4HATA 1JEYA 3ZHUA 2M0GB 2QSZA 2F40A 2HRUA 4MRPA 2FJEB 2HRBA 3EK2A 4HTAA 2OV3A 3B51X 4DVJA 2Q5CA 2H08A 4OLBA 1S1WB 1HYBA 2CPZA 3IMCA 2I6TA 3WKAA 3V1UA 3MGJA 4EI7A 2H5LA 1NI5A 2NT4A 5JMPA 2SCUB 4EHHA 3WHLA 4B34A 3SSMA 2C2WA 4GHWA 4FFSA 1ZNQO 4A8KA 2HIGA 1SB9A 1JDZA 1V26A 1EE1A 3BQMB 3A3NA 3BAFA 1KO4A 4OXRA 1M2OA 3N70A 1BJRE 4B47A 3J7Z5 3VYTB 2EJUA 1TUVA 4KLAA 3BGUA 1NVWQ 2CXEA 4ESVA 2J0VA 4BUZA 5EE3A 4KX3A 4FKYA 1EVZA 4US1R 4O4JF 1V8DA 3DDWA 5KQPA 1I8TA 3ZTOA 3P8ZA 4Q4JB 4KJXA 4BKOA 3FSIA 2CG4A 3NKLA 3IQEA 3OU7A 3P20A 3NEJA 1EBUA 1N9KA 1P77A 1Q57A 4C11A 5E6RB 4CU2A 3O9MA 3S2SA 3J81j 2VDNB 2QUJA 3LIIA 4CIXA 3KXLA 3PITA 2F4VF 2C5EA 4BGEA 2JSXA 3PVXA 1GT8A 1S9DA 1LX6A 5BQ5A 4NNJA 4LGCA 4P34A 1Q1ZA 2FZCB 1JQLB 1SXIA 4TX1A 3GP8A 1YBAA 1VGQA 1FDVA 4DLKA 1SXJE 3P97A 4HNVA 4RVOA 1R8BA 2H48B 3BHJA 2AYXA 1D2CA 1R0CA 3MAAC 1LH0A 3OCVA 2EJVA 4GECA 4Y2KA 4QPJC 2X13A 4IQ8A 4I4NA 4M7RA 1R8HA 3LK7A 4R51A 3ZH9B 1SUCA 1PFQA 2VXOA 2B25A 2PX4A 3ZXIA 1XVTA 4B9SA 4GD3Q 2ZB4A 5IKOA 2WJ3A 3D0HE 1I51A 3DDOA 2NN3C 3HBAA 2J3HA 1NDHA 1P1CA 3FKSA 2GJKA 5DNDA 2GZ1A 5LXRA 1JLBA 2MDAA 3JQBA 3OFFA 1EXNA 2HMVA 5F2KA 3QT8A 4JI8J 5HE9A 4K40A 1FK9B 4MWOA 4PYNA 4AP6A 1BWVA 2GA7A 3AOEC 5CYJA 3DD1A 4XIIA 2HRYA 4HMQA 4RQUA 4DFMA 2XDQA 2Q6LA 5EKSA 2FFAA 1UBCA 4EG6A 2PFFB 4O44B 2V4MA 4AP9A 2IHKA 1RP7A 4DQXA 3SF0A 4B6QA 2G04A 2WKRA 1S76D 2JLYA 3DZIA 3VZCA 1QU2A 4N8EA 4GMFA 3EVMA 3G7SA 2V3VA 4Y67A 1TVKA 1IBLF 1GPAA 4URSA 1AHPA 4DLSA 4XM2A 2GCPA 2LQBA 1V3TA 2GJ2A 3F47A 2O1EA 3QHPA 2FP4B 4R2HA 5LLSA 1R74A 2W6CX 4JV1A 3GRVA 3CIZA 2PT6A 1BQ3A 4RNMA 4MO2A 4CI0B 4XASA 2CPEA 2EXUA 1YJXA 3SQNA 5T4EA 5E8RA 2CPDA 4CKEB 5FBKA 4FYYB 4KGXA 1U0SA 2MQLA 5EKUA 4C4TA 2LDIA 4HAUA 4DSTA 2MMCA 3WKCA 3AEQA 3TFQA 3I3OA 4DCNA 4E2FB 2HR1A 3CW2A 4IHJB 2V94A 4C3UA 5JY6A 1OLXB 2A86A 3DULA 4N8OA 4JI5J 4O8CA 1QQBA 5ESRA 1PJAA 2JJ2A 2LMIA 1XMJA 4BLVA 2HZAA 3IA0A 2IIQA 2Z8ZA 1NOKA 4CH7A 4JEHA 3EHDA 3T99A 2Q6TA 2FFJA 3HDGA 1Z1ZA 2CQHA 1WABA 2JAPA 5AYVA 3IN5A 4R9NA 2B4VA 2ZD1B 1MTZA 2VOJA 2Y1FA 4O08A 3KJXA 4UOFA 3LZ6A 1QO0D 2FRDA 4RW7A 5J2TA 3UBMA 5NLLA 1UBUS 2QS9A 4KJIA 1NZJA 1WM1A 4WJLA 3KAJA 3O8OB 3K57A 4PXBA 1AA6A 4K4XA 4WTOB 2XAAA 4I4CA 1QPBA 3FBWA 5LIRA 5DBFA 3OFHA 2JHGA 1AB6A 5AW8A 3LPNA 4UREA 1Q0TA 5GOTA 1EX7A 3CF6R 4LXGA 1IKVA 1WDKA 4XX0A 1U24A 2IYTA 3DZ8A 1CW2B 2NZWA 3GSIA 1U0NA 3K9GA 1QKIA 4PCVA 1A69A 5I3ZA 2PFSA 4LYAA 1D9XA 3DOOA 3FI9A 4D6PA 3FZGA 1T3HA 4H16A 3T3GA 2QVYX 2VOOA 1ISSA 2G4BA 3PWKA 1B23P 4L6CA 3B6KA 3K0AB 4OSEA 1EHWA 3D1QA 1PG2A 4GZ6A 1E6VB 3OT4A 1X39A 3SCJE 3LUGA 3G5AA 2CJXB 1F8YA 1T36A 4TV8F 4DLRA 1Z0SA 2WV7A 5FOQA 2M88A 1ZD8A 3PIIA 4KIFA 3QMMA 1OI4A 3F6YA 5CB4A 2HQ3A 1A9TA 1SQFA 1O6BA 3LF1A 5BWOA 5K20A 4NX9A 3O31A 4OH7A 3DBOB 1Y0HA 4WXPA 2ID9A 1NAIA 3OP4A 2LQ9A 3TIVA 3RAMA 1U0LA 2Q3CA 5EJ2A 1CEEA 4URVR 4Q12A 2Z08A 4Y9DA 5LMUB 3NG1A 5AHWA 2CGEA 4KH1B 2O0JA 1FFEA 4LR7A 3WWYA 4EMTA 4KNVA 4MT1A 1ZHHA 4V24A 3OBBA 1Z5PA 1L5SA 2QQ0A 3HEMA 3SYLA 1OTHA 4NH0A 1XDWA 1BDJA 2HVIA 3BFJA 2P79A 1IKWA 1OF1A 3V6KA 4P2FA 3DW1X 3KLVA 2VCYA 1FY2A 2FJ0A 5E38A 1NK5A 2RHLA 3WGZA 4WOKA 4DMFA 2JGRA 3C16C 4UEQA 4V0ME 1KJYA 3LQ1A 2V34A 3PXAA 3GT4A 1N5YA 4OGLA 1GMWD 1AGNA 4KN6A 4F06A 5A0YB 5LL6P 3RUBL 3V2UA 3TG8A 4R5PB 3GQBB 5J9FA 5CDTA 1M2FA 3LY9A 2D5AA 3PIDA 1JKXA 1UVLA 1G0NA 1RP5A 3MUNA 5FA8A 4Q3NA 2JL1A 1I9CA 4D5GA 3FDIA 2X2EA 5G02A 1ZVKA 2YZKA 1UCNA 1OIWA 1RQ2A 3GRPA 2QN2A 2PD1A 4A9AA 6FDRA 4E5DA 3W5VA 3FPGA 2SKCA 1EX8A 3NNNA 4QUBA 3R5DA 1QAQA 1TCUA 4IJ5A 4Z7YA 1C9MA 1HQEA 3TRJA 3KOUA 1A7UA 1ZEJA 1IK6A 4KIJA 3P5SA 1FXUA 2NU7A 1CLEA 1NBAA 3IXQA 1OWNA 3ZLBA 4NQRA 2R6DA 5CPFA 1TEVA 3ZIAA 4DX6A 2Q28A 4I8XA 4ZCKA 4RIGA 2LFVA 3AWIA 4OQEA 2IW3A 5J2UB 5KT2A 4Q5VA 4V19X 3FRYA 1DTEA 1RQLA 1JB0C 3WK6A 2XQCA 3KPUA 1PT7A 2VPXA 4JI2F 5LJ3Y 2AH5A 4A8JA 1TW3A 1FXWF 3DEFA 1N5JA 1OBVA 4YR0A 2ZVPX 1P29A 2DPHA 3MCUA 2B4YA 4G1CA 3H97A 1OZFA 3A6JA 1RLDA 1BD6A 5KKNB 1OBOA 3PDJA 3GW8A 3QHAA 2AX0A 2I2DA 1KI2A 1HWYA 3PFNA 1PDVA 4MW5A 2W2NA 3H9JA 4IFYB 4PSUA 2R6GA 5JSZB 2GFHA 3ASYA 2F4VJ 3LPEA 1HH4A 4OZ0A 3U5ZB 1REVB 4MNTA 2E4UA 3EZXA 1ULUA 1VG0B 3GJ7A 3GP3A 5LMUF 2XVZA 4O4JA 1X4DA 3IPXA 3HYSA 1PZFA 4DSUA 4IINA 4Q43A 3F3KA 5LYJB 2UZ3A 3IEKA 4JLMA 1WXEA 3T6KA 3QF7A 3EC7A 3MFIA 3PJXA 1DADA 4ND5A 2LEAA 3M1VA 2OQVA 1NIPA 1Z6ZA 2Y1JA 1BGXT 1R4AA 2WUEA 1K0UA 3LGMA 3QVJA 4BCCA 3VISA 2L08A 1I7DA 2ACWA 3FSEA 2ZUTA 4NP6A 4ICIA 1DAXA 3UGJA 5ALVA 1Y80A 2V7XA 2L48A 5KYYB 3HSYA 4ZOLF 3QOXA 1K08A 2CNNA 4AO6A 3DLKB 1HE4A 1I33A 3AB3A 5BXQC 1YV9A 1DOAA 4G0ZA 5CM8B 1WHTA 1MW8X 5K2OA 4IX1A 2DNOA 2ZI3A 4PZPA 1W29A 3R7NB 4OLFA 5CNIA 5DBGA 5IABA 4O23A 1F2UA 2FSSA 4LDRA 2MKCA 1X42A 3K09C 4ACAA 4ZCPA 4PQEA 5KFOA 2CJWA 1FB5A 3I1YA 4HKQA 4DCOA 5KQMA 2XWYA 1CZLA 4PSCA 4JOUA 1IBLJ 1ISJA 4B7UA 5JYDA 2IHUA 1JI0A 4BO9A 2Z8QA 4C2TA 2EX4A 1P61B 2FN4A 2H2IA 3RVOA 3RC1A 2GN0A 5IH3A 5LSAA 2RS8A 3PRHA 5E8JA 3IBFA 4RPKA 1B73A 4UMVA 3QSYB 4ZWNA 1IXYA 4HS9A 1ISGA 4ECVA 2IWHA 2HMIB 2IIBA 4QOFA 3VPBA 1SK8A 3WFIA 2K87A 1NF3A 2YQ5A 1XKLA 5IKXA 3UCFA 4ZQCB 5FO1A 2OPBA 4MKXA 4A0SA 2SCUA 2XCTB 1V5VA 5LYYA 5ABPA 1NQTA 5AUPB 2I4OA 3USZA 5IN5A 3K6JA 3Q3IA 3A28A 1DRWA 3STHA 2GKSA 4OIXA 4REQB 3KKMA 4KSBA 4RZHA 1P9QC 4IIJB 1J1ZA 3PXBA 1W0CA 4ZDKA 3LP8A 4UC0A 2WM3A 3TEGA 5KNBA 1OQ3A 3A1TA 1EX9A 2MKIA 4MIEA 4KTQA 1FDOA 3P2KA 4QGGA 1E2PA 3B2NA 3I0RA 1UODA 3ZYCA 4ZC1A 2ACEA 5BR4A 1QTNA 5E6RA 1E66A 5DASA 1GUZA 3AF2A 1PKEA 1A2OA 3LH2S 3UPUA 5IDYA 2FSUA 4UMFA 2V3CC 2B8QA 3VJLA 4BYMA 4DSNA 1TL5A 3JZIA 4IEFB 1IB0A 3GLGA 1CR6A 1XNJA 3GIMA 1T15A 1ACMA 1W94A 1ORIA 2WBMA 2GZMA 5KG3A 4G1IA 3C4QA 2JLZA 3KLHA 3ZZRA 1K3TA 3CJSA 2C20A 4K46A 3FNQA 4C2AA 2E0IA 2CJYA 2EFOA 3ESZA 4PTLA 4R05A 4JC4A 5KWIA 4KDCA 2H48A 4M76B 4Z2YA 5KOHA 1L7MA 3GZNB 4QFMA 2FPLA 2RJ3A 2B4PA 1M0SA 4ARSA 2IC3B 3DHWC 3B13B 1F5NA 2G1AA 1BOOA 1JHZA 4PPYA 2QGFA 4DCCA 5DTIA 3INNA 3NHYA 2BEWA 5B3AA 3VPXA 2WZDA 3GJTB 4GPAA 5I3PA 3TZBA 4A6PA 5H70A 3I0SB 3HJRA 2GDJA 1P2SA 5H80A 5B0CA 3T9EA 4HRAA 1EVEA 1BCRA 1ZTWA 4LF5B 4ISBA 5EGNA 2H59A 3B6IA 3LUPA 1H6CA 5SICE 2R7SA 4AROA 1N0UA 3AL3A 4C43A 2Z2ZA 1USUA 3LFHA 1FK9A 1TM4E 3GIDA 2CD7A 3T7CA 4V2UA 4EU0A 3TCKA 4CHTA 6FD1A 1XVLA 1GX5A 4DJJA 4TV8A 1Q74A 2WWHA 3L3BA 3HUEA 2M3DA 4NLTA 2G08A 4ZALA 4MK8A 5EAIA 4O44A 1ZX1A 3F67A 2QUIA 4YUXA 2ZZMA 2ROQA 3H5SA 3CO9A 4ZMRA 2XYGB 4LV5B 1U6KA 3DRYA 4RLHA 2DPLA 1XK7A 2DSTA 1MMDA 5GM1A 2QAGC 4O2LA 3N76A 2K6GA 3PVZA 1WOOA 1UJ2A 1IHOA 2FSGA 3BMCB 3L1VA 4FDUA 1FD8A 2HLTA 1RFGE 3SZGA 1ZUIA 4ZVHA 1YJVA 3A70A 1U7OA 2PMWA 3UWTA 4IFIA 4WDQA 3E01A 2B37A 4CCSA 4M9RA 2KI5A 3H75A 2B56A 1LPMA 4H3SA 4TXLA 3SX2A 4DY4A 4X24A 2IDEA 3HK2A 2QD4A 4R8LA 1KA9H 3BICA 5CFRA 3LLSA 5KFNA 4F3CA 3LX8A 5AK0A 3MI7X 3CE8A 4G01B 1HARA 1IBCB 5KFPA 4ND3A 2FOXA 3GN1A 1X5TA 1OLXA 1QHYA 1SKAA 2FV8A 3VH2A 5SZKB 4V1Ak 1AIPA 3KJIA 2JFXA 4KR7A 3HFKA 3Q40A 5DX1A 4H15A 3KWMA 5MAOA 2IFTA 5ERXA 4E07A 5DEIA 2QSWA 3QUAA 4KACA 4TS4A 3V4OA 1V4BA 5F3WB 1HORA 4DV1F 4DXHA 3OTOB 2PWZA 1W47A 2FX5A 4YROA 5FOSA 1ULBA 2IIHA 1QJCA 5K03A 4MV3A 5AM1A 5I01A 2P90A 3MBOA 3N2EA 4C14A 2ZD1A 1OB5A 2D3ZA 1N3LA 1W87A 2YXPX 4PHGA 3NIBA 5B2FA 4AL4A 4QWWA 1O6FA 1N5QA 3LGXA 1NUEA 2GJSA 4FMCB 2A57A 4A4JA 2QYCA 4NYMQ 1X38A 3TINA 4JI2J 2Y1WA 5TMEA 3EQ8A 3UOWA 2QZ9A 3X3HA 2RJNA 1DQ8A 4NR0A 3FBBA 2WJZB 2CF5A 2BELA 2BW2A 4BFTA 1V9LA 1T2VA 4CT4B 4CL0A 1ZMXA 1J00A 2FPGB 4M1KA 3ZCTA 1JVBA 3PACA 2MZJA 4N3CA 2NYAA 4XR4A 2HBYB 2ZI4A 3AM1A 3TZHA 2PCLA 4MQBA 4UFOA 3BXEA 4DZZA 2IGTA 4IZOA 3D7MA 2R751 3SV3A 3NOOA 1FXWA 2JFBA 2QSUA 3UVJB 4NEHB 2I6WA 1JPUA 3L93A 2Q7DA 2GF2A 2YZGA 4WZBB 3KQVA 3BVPA 2CVIA 3VAZA 2WA2A 1IVZA 1TJPB 5KO2A 4FMDF 3TX6A 2UZIR 1M74A 3OZRA 2DKOB 3SSOA 2CJXA 2QLFB 3UATA 4NHOA 3N6RA 1S2LA 1S4EA 5ADWA 3ZTTA 5WRFA 3LV8A 3PNIA 3L8EA 4PY2A 1N0VC 2VDHA 1OPIA 5M2QA 1TLLA 1I5OB 4CNYA 3FUTA 2XVXA 2W25A 1H5UA 2PUBA 4PYIA 2RRBA 3SI8A 1XYVA 4MUJA 3B85A 3W62A 4B33A 1CULC 5K8PA 4ETWA 1BQNB 2WK4A 2WC1A 3RUHA 4DARA 3T1VA 2JAOA 3E58A 3FMIA 4MXDA 2IYOA 3PRJA 4QOHA 4NZ7A 3T7SA 1TB4A 2R5NA 2XOKD 3EVOA 3ZGOA 2QB5A 1LDNA 4QW8A 5BSKA 1CUAA 5D5HA 2VSFA 1GQSA 1G7RA 5BQPA 3OXFA 1GGEA 3L0OA 1LLDA 1O4VA 2R48A 1XC7A 2R5FA 3D3WB 4R5HA 3WYNA 3ROPA 3CEDA 2P6RA 5JCPA 2VYVA 4BJ5A 4F26A 1TVRB 4TY8A 3IS9B 5ITZB 2B1GA 3LF0A 1HE3A 4XCXA 1D04A 2Y77A 2GBPA 3PFFA 3DC2A 4HAIA 3QA9A 3A1WA 5BMVB 2VA2A 4FR0A 1NVKA 1Z4LA 5IJ0B 4EHIA 3NTLA 3HDQA 1JLQB 5JQWA 3BJZA 5K2MA 2C22A 1E98A 4AJ4A 5HF9A 4QA9A 4FXPA 4KXVA 1SUQB 3D3QA 1U1DA 2EFGA 1TMJA 1RTJB 3BO4A 3SZ2A 3LUFA 2BY4A 4FS2A 5SZHB 3EGNA 3IQGX 2JFKA 2WMOB 1PJ4A 4DV2F 1PYSB 4DIOA 3HB0A 5FDLA 5H68A 1GADO 1U3FA 3O5AA 5F9HA 1C5KA 2AC2A 1GSIA 2FUEA 2GO7A 3DAOA 3WMGA 3MMCB 1J5EF 1GPBA 8OHMA 1QWSA 1YXMA 4JLAA 2CPHA 5ETJA 1C4WA 4B81A 1DC4A 1QRDA 2NTVA 5A76A 5F8NA 2WSLA 5EUHA 3ISZA 1T5LA 3IEUA 4KBIA 2E9TA 4L6AA 1XZMA 4DG1A 1L4GA 4GBGA 5A9RA 5ES3A 2BR3A 1Z56C 5F7OA 5REQB 3WO1A 1YMQA 1J24A 3MPUB 3UVEA 2IJNA 1ZQ9A 2BTQB 3ENNA 4ENRA 3R6GB 3DFMA 2V67A 3V1LA 1HPLA 2RH9B 3D0RA 2BGJA 3I04A 2ASLA 3H98A 4L8FA 4DEZA 2I5PO 2NZ4A 1KJ9A 1RRMA 4UDOA 5EERA 3RTVA 3GH3A 4C4ZA 4IKAA 5ERYA 4IFYA 1UKBA 1FSFA 1SUEA 4YB7A 5TEWA 3UPTA 3DFIA 3CC8A 4QGHA 4YVFA 4D92A 2B51A 1L6IA 3QWHA 1CQIB 3MCWA 2CNWA 5KNCD 4PYKA 4TTRA 1SBNE 1V39A 3NZEA 3DZKA 3OZ7A 3KE8A 1SOUA 2DYAA 3JQAB 1VC5A 2ZTVA 2HNAA 4RF5A 1AQJA 4EYSA 3BWXA 2BJ8A 4TV9B 1JKHB 4PAQA 3ZVMA 5I9BA 3A6EA 3VHLB 4G86A 4JBHA 2O8EB 5L45A 5ICSA 3EFBA 2NYHA 2J7PA 1BAPA 2VPYA 1ZCFA 1YA8A 1N5DA 1UETA 1VE7A 2CQDA 4D74A 1PJSA 5D1NA 1DBRA 2Q2QA 1D9DA 3OZSA 1R8AA 1UBFA 1YS2X 2ZULA 2IHNA 3WMRA 3JXEA 2I2BA 1E2NA 4J1TA 3PP8A 2GAOA 4G5GA 3LCJA 1RWWB 4DLGA 1LLCA 2BA9A 4GOND 4DV0F 4WKPA 5I5EA 5K0SA 1P9YA 5B7PA 3E61A 2OFHX 5GVQA 4M0CA 2LEBA 2MDTA 2FMKA 4GOKA 5JXIA 4QBFA 2WSIA 5KFVA 4BO5A 3WTCA 2J9DE 1RXWA 2PDAA 4NXNB 1CUZA 4G09A 2C7QA 4B3MB 1GCOA 4U0JA 3R5FA 2GA9A 1XMBA 3RVQA 2AK2A 2B5OA 3R2JA 1FNDA 3RV4A 3HWRA 1N2XA 2DPIA 4ARZA 2PJDA 4AZSA 4ZCIA 1QDUA 4EG7A 2CXHA 1QX4A 2Q46A 3NHBA 1QYCA 5EP2A 3C6KA 1CRLA 5HZKA 1R9MA 3I9MA 4C8LA 3WOVA 3D4OA 2Y05A 1CRPA 4ZEMA 1RWXB 3P94A 2BP7A 2LP4A 2X3FA 3AJ2A 2A9PA 3QU2A 4ZJLA 2PLRA 3RLFA 1N6NA 2BFAA 2B0GA 2ZRGA 1W0KD 5EJGA 2P62A 1OS5A 4RW9A 4X5OA 2HFUA 4X4NA 2D6FA 1GO2A 3M70A 4DL7A 2J8AA 4J1SA 1JYEA 3ZU6A 2L82A 2NUHA 1G63A 5LJIA 2FGCA 2I34A 4Q15A 4BEVA 5H9FK 5PGMA 5HPYB 4ZZ0A 2K2PA 1ZH8A 3RRJA 4P52A 2V68A 3V2GA 4DV1J 4ZYWA 5CIYA 3NGUA 1GGMA 2DFDA 3LO3A 3X0DA 1P8GA 3M4XA 3O83A 3IEIA 2BDUA 1S1XA 1GRVA 1IK4A 2GV1A 2PYZA 4BQQA 1A2KC 3CT6A 2DBVO 4L5YA 5F8LA 3RW7A 1A8HA 4KGDA 4PBRA 4K2XA 3DXXA 4ZOEA 1WXQA 2HLUA 4IR7A 3C14B 2BGKA 1FRLA 5H59A 1TAHA 3QKUA 3QX3A 1EVYA 2CL5A 3A6FA 5LT5A 1QUVA 2AJQA 2G82A 4LBWA 2PRZA 3UCZP 4M0KA 4IG4A 3L4BC 3GDWA 4N5MA 5CAEB 3L1UA 1WR8A 2R6ZA 4E5SA 2ZB2A 4XPEA 1QDEA 1Y7TA 2XXJA 3GFGA 3GCDA 5ENVA 5AK3A 4DMMA 3L8ZA 3FYSA 1X7WA 2BISA 1XNQB 2F7SA 4XPIB 4NAHA 5KFUA 3ZJTA 1DDIA 4URWR 1B42A 3B2QA 4B7AA 1FFCA 3P9IA 3EGCA 1ODTC 5BR1A 4Z0HO 4EF5A 2XO7A 1MJGM 2E37A 3AB8A 2A0WA 2RG7A 1NIJA 1CYEA 3KZXA 5TQ0B 2BI8A 3DGPB 1XRRA 4MK9A 2JBHA 3DKVA 3DBRB 2DBRA 3TD6A 3GJTA 1B8OA 1ABEA 2PA0A 2G5GX 2G9NA 4B3MF 5LM3A 2WYUA 1JEYB 2EFHB 2OG2A 4D56A 3MXOA 4GVBA 3GB9A 1CEXA 2VD3A 1CUDA 3AYXB 2H4XA 5HBGA 1RU1A 1MV5A 4MVJD 4J03A 3H9UA 3I6IA 1L4NA 4IDQA 4O02B 4BN5A 1D2AA 1FYEA 4DS5A 1XRPA 1KC1A 5JBQA 2I80A 1M1YE 5B53A 2XYGA 1TKTB 1T8EA 4R0NA 2GPNA 1M2KA 3U1TA 2G71A 4DUTA 1QNLA 3A3NB 4CO2A 4GRSA 4LQ3A 3TJ8A 1ZY2A 2FEPA 1M2OB 4XB2A 3D0QA 5D51S 4HSEA 4MRNA 4CM4A 2DPGA 1QH8A 3OL8A 3D5QA 4N5LA 1OGIA 3LVQE 3C1OA 3SDEA 4PG5A 3PKYA 5CLGA 2CFSA 4YHBA 2EJTA 2YVUA 5D6GA 3EN0A 2YJ6A 3DO5A 5CZVA 3EODA 4ES1A 2X19A 5I3QA 1V3UA 4FC7A 5K6AC 3SK0A 1OY8A 4GSKA 2A94A 2RBEA 3FYCA 4C11B 3OG9A 4X1IA 5CCDA 1MGPA 1I1GA 3FFAA 3PNYA 4ILRA 1U8AA 1WELA 3RBAA 1H9AA 2FOLA 2O67A 2GWRA 4H0CA 3NBZC 3DMTA 2AQ8A 1O1YA 3BREA 3ZWDA 4DV2J 1M5UA 2G1UA 3OJEA 3MAJA 3ELWA 3QE9Y 4XAQA 4Y2GA 2XE4A 1BXKA 2GO8A 1X9WA 1DQPA 4YMTA 3SZMA 1TM5E 1J5EJ 3PUYA 2RHMA 1R0CB 3NS7A 1GL7A 3I9JA 1M1HA 1N52B 2IXAA 4CLXA 2FUCA 2JLXA 3RK0A 1YB6A 2Z3VA 3EDCA 3HGQA 2WHEA 3QGIA 2IE8A 1MB2A 1A9PA 3UNYA 2JBAA 2M1XA 3O2SB 4EECA 1JLSA 4LJLA 1MJ5A 3T95A 1JLBB 3BJIC 3NMAA 3B7PA 3ZW7A 4QDKA 1YQDA 1IG3A 5T4BA 3ULHA 3OJCA 3VYSB 4FZ3A 4WXWA 2ZC3A 2EK1A 1XIQA 3V9PA 2XDQB 1LV8A 3RRGA 2HHAA 5JSUA 4FOTA 3SHOA 3RFVA 3H4BA 3UVJA 3TSWA 1CFZA 1ZZNA 3O95A 5BRNA 3CTRA 4C07A 4JJ6A 1A9NB 2RGRA 4OAQA 1U80A 2W9XA 4N0PA 5A71A 3X2EA 2DUJA 4F25A 1DEKA 3CH4B 2FY8A 1TVKB 4D0SA 4JI8B 2JAWA 3VHRA 2F3QA 1X0VA 4H1VA 2QTWA 2IJRA 1CR2A 5DYYA 4Y6GB 1I5OA 4Q24A 1Z22A 3H86A 2V7TA 4F1WA 5KKAA 4LRCA 4XQ0A 3VTFA 5B1HA 4X92A 3S3TA 1JJ4A 2H1RA 3DLLQ 3SG0A 4KGXB 3BCUA 3BPSP 2OT3B 2RFLA 1QGAA 4F9EA 3AEQB 3KHLA 2K7KA 3LC1O 4WECA 2J0XA 3HBFA 3V8BA 2ZJ7A 4JAVC 2G6TA 4JDPA 1BEEA 4M5MA 1E0KA 5T3UA 3ONEA 5U9CA 1G7SA 4N4AA 2AJ0A 2I22A 4DV0J 2NIPA 1RQ7A 2DNMA 3S2EA 3TSYA 2PT7A 4PAGA 5HBMA 1K68A 2XZDA 3D3WA 2XY5A 2OG1A 1KORA 1KAMA 5ALXA 4MUBA 1TVRA 3PHHA 1E77A 3ROQA 2I7XA 5ITZA 4F4XA 5FL7A 2YXNA 4Q7LA 4MHSA 2I3AA 4EY4A 3ACBA 3QT6A 4Z4FA 3N2ZB 3SHTA 5BMVA 4GPZA 1Q2XA 1QR6A 2QZSA 6CHYA 4A82A 4IGKA 4WE1A 4RW7B 3DQPA 1IHDA 5IJ0A 2I2XB 3BJMA 4JI5B 3U4DA 4HR2A 1N2JA 1T9ZA 3EPPA 1T0JB 4BQIA 2ANCA 3GOHA 1UJMA 3A0UA 3A1CA 5B6IA 2OZKA 1SUQA 2VHVA 3QMVA 4ZYYA 4ZAGA 2JC3A 3DU6A 1R10A 1RTJA 1KXJA 4YT5A 4E70A 4DJFC 5FLXY 2XLKA 3IO5A 1H2TZ 1IKVB 3H7HB 2Y9MB 1KY2A 2IZOA 2EX1A 4Y2VA 2I4TA 5JROA 3HJFA 4BO1A 3FVRA 3C74A 4CNZA 2DF8A 3N2GB 4DCJA 5KOYA 1TA4A 3MMCA 4CP5A 5A2QU 2PQ2A 1K47A 2WM9B 2WSSD 4ZIWA 4M9QA 1YVFA 1REGX 4FQ7A 1T36B 4ECZA 5BN3A 1SB6A 4EP1A 3K35A 4OBWA 5CB4B 3MPUA 2PWBA 4I1TA 4IY1A 1VIMA 5K20B 1C3EA 1NTRA 2GPSA 4FVCA 2WYWA 2XOXA 4WCFC 3R6GA 1G64A 3ICWA 4BX2A 3PY8A 2R6AA 3LGNA 1CZKA 4HQRA 2Q07A 2X6QA 4EEXA 4MAAA 6AT1A 2BMWA 3FMGA 3T3OA 4NI5A 1U8XX 2HQBA 1QM9A 2QR3A 1SJ1A 5F8JA 4YA6A 2C8VA 1N5IA 1Y0BA 3C19A 3PPVA 2CF6A 1FYXA 5TMDA 4B9VA 3HFVA 4EK2A 1S4MA 2D41A 5BUSA 2XSZA 1IWPB 1XP5A 3W5DA 2PT0A 1KI1A 5AKKA 5H02A 2BT4A 3VAMA 1CQIA 5FAKA 1MC5A 4OB7A 2CADA 1M2NA 2C00A 1L3VA 1IKWB 2ZRKA 4IEEA 1CB7A 1N3IA 1NPYA 1ORHA 2AK3A 1LFPA 4JI3F 4FE7A 4MICA 2ANBA 2GGSA 4P93A 3G2JA 4LDZA 3U39A 3SY8A 2DGDA 2ZR9A 3DBHA 1VRTA 5CM9C 1FNBA 1MMNA 1GTG1 2FPUA 1GG2A 1E4YA 1MAVA 3RG8A 1N5YB 1H8ED 2OXIA 4DC1A 1X4EA 2A9VA 3BTUA 4PXDA 4DPXA 1YAHA 5KJ1A 2ZYIA 4EB3A 3LT5A 1PJLA 3HT0A 3JWHA 1EVJA 2PJRA 2AKWB 3O0DA 1T5OA 1XO1A 3HTXA 1D2HA 1Q0NA 1NVVQ 3CBQA 1Z4IA 2QUZA 4BKRA 3N7AA 5EIOA 3BD9A 2F8MA 2QQ5A 4IRCA 1DWUA 4UBNA 1I5EA 4RLQA 4Y6OA 2KB0A 5IVIA 3L1KA 4UOCA 3SXPA 4IM7A 1RXOB 1HQEB 3IRWP 2R7XA 1FUEA 4QJ4A 4MV9A 2WVEA 4P0TA 4AZTA 2NU7B 5F8MA 3D6TB 3PYEA 4I2PA 1J42A 1QG2A 2CFTA 1JSLA 2MSEB 1UT6A 2PFDA 2YFHA 3KFLA 1B74A 4RDCA 2LCWA 3GQVA 2G0AA 1Z83A 2YNMC 2XMAA 4B4VA 1RS0A 3ZBUA 4I7FA 3CEJA 3M6UA 3N59A 3HWSA 3PEWA 2Q3PA 3QUBA 1AH2A 4QR1A 4F6LA 4FCCA 1WNEA 1J2EA 3FWPA 5BV1A 2VPXB 1S2NA 1QAYA 4NV0A 5DWQA 3G6KA 4O3PA 4JNCA 4LW8A 4A8JB 3QYAA 3H2YA 4MCHA 4YRSA 3KYIB 3WIOA 5EJ8A 1DCTA 1C9DB 2WU4A 2Y66A 2A4KA 3L8GA 3VR4A 3UV3A 3VO2A 3ZR4B 1YE3A 1LDYA 1NOJA 1S72S 2HNBA 1KMMA 5IJ9A 4Q3OA 2V8HA 4AXJA 3VTZA 2R7LA 5K5EA 2GW8A 1MAUA 1A5AB 1P1IA 1T2NA 2Q45A 3QVTA 2XVAA 5G1PA 3ZNPA 2A9FA 3AXSA 3FCUB 2ATIA 3OQNA 3OJWA 4O4JB 1JAIA 1OYDA 2C7BA 3GIRA 3EX7B 5LKRA 2G67A 2GEKA 1ZKMA 4Q7JB 1GAQA 1SKRA 1CYDA 1S6UA 5DDOC 1KEKA 1PFKA 3IP6A 2CPJA 3M1IA 4UUBA 4RUHA 5BSUA 5FIUA 5JUMA 4OJYA 7FDRA 5PNTA 1CZHA 2ETXA 2F4VB 3CISA 2X0EA 4ED9A 1JK9B 1Q1EA 3GP5A 4RQTA 4RL4A 4ECRA 2NR0A 2Z6UA 1F3FA 3MWBA 3H7AA 1QFJA 9MHTA 2IYZA 3F8TA 1F2GA 1VQ6S 4R2XA 2MSSA 2IOFK 1TJ4A 4JDUA 3UCUP 5C34B 3O9VA 3RYTC 3RRNA 2VJPA 2CNNB 1QGUB 5CAEA 4X93A 2EKBA 3H8VA 3UK2A 5KFGA 3PF8A 2P2NA 4LQ4A 3MT0A 4PCQA 3HFRA 1TKRA 1WHTB 3IELA 5LQDA 3VYRB 1S7IA 2IQ5A 4QJBA 1Q20A 2PUFA 2QLNA 3CXUA 2JAQA 1OWLA 1AX9A 1F2UB 5HILA 5A8RA 1QYXA 2JI7A 1PE0A 4FCWA 5MF6A 5F76A 1H6DA 2CJWB 5ETRA 1Q22A 4C87A 3M05A 2Y0BA 4Z4CA 1OW3B 3K0HA 2V7BA 5TQ0A 1JWBB 4DCOB 4MYTA 4PR3A 3CUTA 3G79A 2NMVA 2KSQA 4LOJA 1R4ZA 5B6JA 5BQ3A 4OHVA 1V8FA 2V6GA 5D0HA 3KHSA 1YS9A 3LFTA 2JX2A 3WTBA 4XR9A 3IBFB 2RGDA 2WNIA 3ER8A 5HK8A 3U3XA 1FFAA 4HQ6A 3KCQA 1NRXA 1AA1B 4MMOA 4QEKA 4P7TA 2UVWA 1WPRA 2B3TB 3EQ9A 2DXDA 2GC8A 3AT1B 3KMQA 3RSOA 4J37A 4WKBA 5U4QA 4AJHA 3F97A 1IBLB 1UMCA 5AJTA 4AG3A 1TKTA 2ZCJA 4BQFA 2FPMA 1EWYA 2BM0A 1HDGO 1TT7A 3WMEA 4WMLA 1L5FA 1Q1KA 1VMAA 1KL7A 2IVFB 5FWYA 2AN5A 4C6TA 3L46A 5J4VA 4AJ9A 5BXYA 3HCRA 1VK8A 3K59A 2XQVA 5K5MA 3I9ZA 2JL9A 4ZVGA 2WJWA 1N56A 4JD5A 4MVJG 3I0RB 4QZVA 1Q0PA 4RVCA 4WJBA 3QVSA 5AJHA 1JJAA 1QTNB 5HRCA 1I7SB 1ICEA 2FVPA 1YJQA 2WTNA 1S79A 2E44A 2B61A 4BNFA 4MQ6A 2Z8YM 5J5AA 1WUHS 1N1MA 1DG3A 1GM5A 3BGLA 2R62A 1WW3A 4RORA 2CYAA 3IPYA 1QAMA 5DLQC 4EYIB 1N33F 2NU9B 2BABA 4MW4A 4RVSA 4GP7A 3VR5A 3GLGB 1E8NA 3N9UC 1T0HB 4RKFA 1ACMB 3I0MA 4CO4A 1I3CA 3E3MA 3KLHB 4KQJA 2JIBA 4MKHA 3KL4A 5I5GA 4USUA 1N7GA 4PONA 1E2IA 2JHEA 2CJYB 3BDIA 1JJHA 4XUCA 4Q1DA 4Y7CA 3AB2B 5KOHB 2GZDA 6YASA 2BGRA 1F0YA 5JWHA 1Z47A 5AW7A 3QEMA 3ORYA 1E1QD 3CJ8A 3NV7A 5F7JA 2RBKA 2HZCA 3WNCA 1IULA 5KUTA 4ZCQA 1ZW6A 2AJCA 3V7WA 2QGFB 1YH3A 2DQYA 2V98A 2BEWB 4HEJA 2VJVA 3URMA 4BP3A 2I66A 2EKNA 1VKNA 3HI6A 4I08A 2AFVA 3SNKA 4RXUA 2BGMA 3A9RA 1Q6YA 3MINA 3QKTA 4PLYA 3OPKA 1EIYB 1BCRB 1N6QA 2PPVA 3TNLA 4MUEA 1GY8A 1DY3A 1XDSA 3BQ9A 3M4JA 1HYSA 1V48A 4L50A 4URFA 4M1ZA 1RKBA 2R7VA 4B4DA 2W9BA 1U25A 4GL2A 3WP0A 4TV8B 1JFVA 4BO6A 1KOLA 1XLTA 3IQDB 3TDMA 1U8EA 2R8OA 4AF7A 3EZ2A 3V6LA 2QUHA 3CJ5A 2QJTA 3G6YA 3FY4A 4XE5A 2N7CA 3WQSB 4JI3J 4KI7A 4B3DA 4QATA 4Z54A 1Z12A 4D57A 1BQ4A 4IDBA 3UJ8A 3K8WA 3NCPA 1LVUA 4BFVA 2IWRA 4HNGA 4USVA 4K03A 4GZMA 1ZA2A 4RX6A 4OX7A 2DWOA 3PUKA 5DDRC 2PMWB 3NGDA 3E01B 1SH3A 1NATA 2ZDQA 1VLYA 2RHSB 4J75A 4QAQA 5I7AA 3MEGA 1E58A 2ZBEA 2OP1A 5I9IA 3OJOA 5THKA 1QHHA 3Q0TA 1NN3A 3LX5A 1VL2A 4IOLA 1GPDG 3ZGXA 3KQTA 8AT1B 3IV9A 1SCIA 1XEWY 3GRZA 3RVJA 3S7ZA 4JB2A 4LS3A 4Y2UA 5EINA 1NC1A 1HY3A 5IDWA 4OZNA 1OX4B 5KG4A 4FZJA 5KQLA 4ZVKA 1KAEA 3KUKA 1C81A 2GAAA 4K9KA 4HWRA 2C5GA 3ILXA 5FWAA 1A98A 1IAQA 1CV2A 3DHEA 5C3UA 4HYTA 1ZGJA 4WKCA 3KNZA 3LJKA 1YJ7A 3RS2A 3M9MB 3WDMA 3ETGA 1GPLA 3UWDA 3M4ZA 2BE2A 5CCXA 4JT8A 4IW3B 4IHQA 2X23A 4B8ZA 3AXMA 4KLNA 3BZUA 1EDZA 5F3ZA 1G2IA 3WNVA 1G17A 1JJ2R 4KVFA 4AYWA 1K97A 2ZAOA 3R0JA 3UKOA 1GTEA 3B5IA 2W43A 5IC6A 2KBFA 4LSNA 3JZMA 3TB4A 2C9OA 2ZNZA 4FFRA 3OD1A 5FP0A 2VSYA 5E3AA 2CVQA 1TQ8A 4XGIA 2JFDA 3N2GA 3QELA 4JI2B 3HSKA 4X54A 1GU1A 2W7OA 3LZDA 1DRJA 1II0A 2CZ4A 4QTUB 4FIDA 5LB4A 3CPSA 4FP9A 1UL1X 3BZBA 5HO4A 5I48A 1MXFA 4FNOA 3GLHE 4RWWA 4M1SA 3GR0A 2VPQA 4JSYA 4D41A 5IM0A 1RQPA 2LTAA 1RJGA 1D9AA 1KEZA 3DQZA 3V6DA 4P3KA 1K8QA 5BSFA 4QULA 2DFVA 2FK8A 1UVMA 4NU5A 4GXRA 4HI0E 1ZLXA 2ZE6A 4JSTA 4UHCA 4I2VA 3O8RA 2OTJS 2JGIA 3MM8A 3OAAD 1YGYA 2WWFA 1WCIA 3VU3A 2XKBA 3WZ2A 2XYRA 2IEGA 3DOFA 2AU0A 2J6IA 4I81A 4UZCA 3UE2A 3IDSA 2LW7A 3EQ2A 1T3LA 1JX4A 4N5HX 1F48A 5LDHA 1MAWA 4XDCA 3T0GA 4BO0A 2AE1A 1BA3A 4HAYA 3WS7A 1ITZA 2YUTA 3DLBA 3EDYA 3KFXA 4HCJA 1DX4A 4C5CA 3BE8A 1L5GB 4DZTA 3HVJA 4X2BA 4WYWA 3L8DA 4HXFB 1KFCB 1PGQA 1H0SA 4WW0A 1Y98A 2CHGA 4LBPA 4TY8B 3OKAA 1C41A 4AJ2A 1QTMA 3SC4A 3RR7A 4ZOLB 2P4HX 1BSVA 4OIFA 2PC6A 2VKQA 3TXYA 5AI9A 1B0TA 3LUJA 1W36D 1UC8A 4LZJA 1VKRA 2AF4C 1SL0A 7REQA 3ILYA 1JSZA 4FOPA 3FTPA 1PIWA 4M5GA 4L4YA 1ESEA 3UR3C 4G0XA 5FDLB 4HVCA 2DYKA 4MRVA 2CFXA 3AHFA 2ZRQA 3X2SA 4Z9AA 5HJ5A 5CFLA 3OIGA 2B9WA 2R2TA 2ZIEA 5B6PA 1ZI6A 2HDNB 3QZ7A 4CLPA 4LRAA 1ZFNA 1WB6A 4KRWA 3RC8A 1SURA 3IB6A 4GL4A 4QPTA 1SQ0A 5J2QA 2DR6A 4UF4A 1H1LB 1OFTA 3JSYA 1ZJ5A 4DBLE 4IVNA 4DG1B 1P4SA 2XBUA 1OFVA 2CY0A 4IMIB 2WWYA 1E6EA 4DEXA 4E4YA 3O4RA 4M0DA 4F7VA 5EHGA 4DQKA 2O0KA 1F60B 4JI1F 3ZKAA 1NMSA 3MELA 3KR1A 2Y6UA 3CNOA 1FU8A 3FGOA 5FPTA 4E7PA 3P9RA 4A27A 4H1TA 5B0GA 1JAYA 2QW1A 1NKSA 5DTEA 3CDWA 2DWUA 1FXSA 3H1TA 3OVMA 3PJFA 4TQSA 4GUAA 4JQOA 1N33J 4RD3A 1M76A 2WWVD 4EGQA 1UAWA 3OSUA 4JQCA 4CQ1A 3OTWA 5HFJA 3S6JA 3EAFA 2D0OB 1WXDA 5AUNB 5A5FA 1H93A 5M5BA 4LDJA 3S40A 2QRPA 4QECA 2E85A 2WAQD 4JT4A 4LRDA 3TBFA 5F1YA 2VRCA 4F0KA 1LEHA 5LZ8A 3V7FA 1M75A 3NETA 1U2QA 1KIMA 3ZLJA 5ETTA 4E5MA 1PI3A 4RWXA 4I19A 4KRXA 2DHCA 3RHSA 2Q0SA 2VPYB 1T95A 2L41A 3G7NA 2PR7A 1WQ1R 3NIDB 1CIJA 2V7PA 4S3MA 1GP2A 4ZVTA 3GJZA 1I2BA 2CL6X 5JDCA 5CGZA 3U9SA 3VKVA 3N3BC 1HHTP 2AS0A 4YRKA 2X3GA 4U95A 1HI1A 1L3UA 3MGBA 4EJSC 1QGUA 1OWMA 3QEJA 5CAAA 2ZRMA 1CUJA 2A9KA 1J23A 3WGJA 1BGWA 3OIFA 2LA4A 1NVUQ 3MJTA 3FLEA 4MKRA 2QQEA 2PYIA 1S6QA 1UOOA 1EP4A 3MRTA 1P80A 2GO9A 4M89A 3WV4A 5JCXA 1U9JA 4R9VA 3K6KA 2IVYA 2XGPA 2PMEA 1U48A 2W5UA 4MLDA 4E7OA 1WHXA 3WQPA 4RADA 2CWDA 1KSFX 4AP5A 2DAPA 2JVJA 4ARZB 2ZHAA 4V1CA 1COWD 1QDUB 4F0MA 5JO9A 2M8HA 4WK0B 1BX1A 2WSCC 4P81A 1IHUA 2Q5LA 5K0TA 2VH5R 3D3BJ 4K9DA 1BDIA 4NJMA 3KHTA 3H20A 1BJTA 2BP7B 4CMCA 2I87A 2GQ0A 3DP9A 2B3TA 2NXCA 5BP7A 2CQGA 3AT1A 4HT5A 4I5EA 1DUSA 3QVGA 1E5LA 1P2TA 4W5TA 4K50A 4RW9B 3GRFA 4LAFA 4IR9A 2QRGA 3BWEA 3HSJA 1ZD4A 4PLCA 2J9YB 2FB9A 1Y34E 3W6PA 1EFAA 4M0UA 4HNRA 5BUZA 4B5LA 2O19A 3MYRA 1TRKA 5AJUA 5FFNA 3U7EB 1VRQC 1IHXA 4PLPA 1O97D 4S12A 1B99A 1H3FA 3TS1A 3QOFA 4HV4A 2QL6A 2OFO