2IRYA

Crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
GSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA ligase-like protein Rv0938/MT0965
publication title Structure and function of a mycobacterial NHEJ DNA repair polymerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 86
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2006-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iryA02
2R9LA 4MKYA 2IRYA 3PKYA 2IRXA 2IRUA
chains in the Genus database with same CATH superfamily
1KC8T 3LUYA 2DYAA 2APOA 4PYAA 2DHAA 3M6UA 1FXLA 3MEDB 3RYLA 2E5HA 2J8SA 3MM9B 5HMZA 1PC4A 3KMSA 1K9MT 3QBCA 1GMWD 2DNLA 5KFAA 3KK2A 2MQPA 4IH5A 3VGSA 4K4VA 1NAQA 3N6NA 4LVNP 3V81B 3J7ZT 3UE2A 5IFMA 2YNGB 4M5NA 1V3ZA 3LWMA 1X5PA 1RAOA 3OW2R 4CM2A 4HACB 4DX6A 3VF0B 1DLOA 3B4DA 3M2RB 4C8NA 3PYDA 3VTIA 2XB2D 2ATLA 2CQ2A 2RQ4A 1NDLA 2IMWP 3RBDA 1KSPA 2CPYA 5KFFA 3GG1A 1NK5A 5AE3A 3MCOA 3I96A 3CJ2A 3BGFA 3DLLQ 2ZH2A 1YIJS 4RW6A 2JOQA 2V2KA 4YHHF 2RRBA 2D3ZA 1GX6A 3F41A 3L7OA 2PA8D 4OX7A 5LMNF 1FDBA 4OV1A 3CE8A 1TK0A 1HR0J 5HVFA 3RRGA 2GHWA 4MIAA 2A18A 2RF2A 5F9NA 1HNXJ 3M8PB 3MM5A 2JLGA 1H2UX 4DR6J 2MKKA 1S77D 3M1VA 1TAQA 4OFZA 3KLGA 1QUPA 4WCEQ 1XR5A 4Z7CA 4IFVA 5BYRA 1B4SA 4C3LA 1S1TB 2ZDOA 2CJQA 2L9DA 2K3IA 2LXFA 3MPYA 3DYAA 4J9RA 4DL2A 4DUYF 3LP2B 5KFDA 2OH2A 3NBPA 3DLEA 4A8KA 3UD5A 1G4CA 1WF1A 4CO4A 2BDPA 1H98A 2FVCA 4B9NA 1N32J 3K17A 1NJWA 3DC2A 2XO6A 3LW5C 2HFOA 1K73T 1P9YA 2UXDJ 2ZBRA 3V6JA 3EGZA 1R31A 4Y2AA 4N56A 4A47A 2V68A 2BM0A 1N88A 3VAHA 3V6KA 2QA2A 2G9OA 1QE1B 2HHTA 3OFGA 1LWEA 1UEVA 3KMQA 2MZSA 1HD1A 3OV7A 2OEMA 1XMQJ 4DR2F 3Q24A 1TK5A 5MLCV 1NKCA 3MM7A 4DR3J 2DGOA 3C3LA 5BR8J 2OJ3A 2HK2A 3DLKA 3NRBA 2R8HA 4RJVA 4DBQA 2G0IA 1DRZA 4J9VA 4LF7F 2LEBA 1F2HA 1YGYA 2AGQA 1K1SA 5FIIA 3QPIA 1RTDB 2R7OA 3HHLC 2WW4A 3B78A 5K14A 3VAGA 4YS2A 3CPWR 2XMTA 1UCNA 3W9HA 3I82A 3U1MA 4N77A 3LA0A 4JI7F 1I5OB 1H6KX 4C8OA 3QSYB 4E0DA 5E2QA 3LP1A 4PUOB 5H9EJ 4ZP6A 3TX8A 1M5SA 2HQ3A 4IFYA 1D0EA 1NCLA 5B0FA 3I0SB 3Q8UA 2ZDPA 4I7FB 3I32A 4FP9A 1NK4A 4YB6A 3T41A 4URGA 3PFEA 2Z0GA 3BREA 3NCRA 3DRYA 2HHPA 2FZKB 2X7IA 3Q8VA 4WF9Q 4MK8A 4G6VB 2GO9A 3HF5A 1TL7B 2DR5A 2NQPA 4ZK7M 3V5RA 1A9NB 5KG6A 3SMZA 2D7SA 3DU6A 4TNOA 2K1RB 3AQOA 2G2ZA 3HSDA 1R8HA 2GJIA 3OR1A 1RE1B 3OTOJ 1D9FA 2KXHA 5IT9U 1TL5A 2GV1A 1VRUA 1SV5A 1HQEB 1O6XA 5HK4A 1KTVA 4NMXA 1R6VA 5IXUA 3GB0A 3T1AA 1FX4A 2QFJA 3TA1A 1KP6A 1U1QA 4XIUA 3M9OB 2R2SA 1UFLA 3H5UA 4LF9F 1X9MA 4EO6A 3MMJA 5ETTA 3TA0A 2H54B 4HH0A 9RUBA 3FCWA 2ASDA 4NLYA 4U95A 2ZZTA 4QIWD 3K57A 1HWJA 2MKIA 2LVWA 4FPIA 3OL6A 2ASLA 4YR3A 2DXDA 2J8AA 1IJEB 5DQGA 1KQKA 2UP1A 2LMIA 1MN7A 4YY3F 3K5LA 2VKRA 4EO8A 4WP8A 2MQMA 4ECWA 5C25A 4IDKB 3J7YI 4HYKA 4ECZA 1JB0C 3TZXA 1WHYA 2WZ1A 4OHYA 4JYAJ 3O44A 4C6AA 1G7CB 4USTA 2HZCA 3QLHA 2EKYA 5HBMB 2MKHA 1JKHA 4DSIA 2CWKA 2JWNA 1I6JA 1LK7A 3HLUA 4B9MA 3BH7B 1HBNA 4EU0A 1FWPA 3UN3A 1N33F 2YH1A 3GQCA 1TKZA 2QG9B 3D6MB 5IS2A 1V5IB 5EN1A 2LDYA 3PZPA 2MJUA 1FJEB 3HPOA 5IM0B 3ZC4A 3GSDA 1NSAA 4ECVA 2CDQA 2RDDA 2OD6A 4KPYA 2ZM6F 2QIFA 2HNYB 4FYDA 4UF4A 1DQAA 3D2WA 1VC0A 1H38A 1J27A 4YDDB 2WHOA 3KJQB 4LIWA 4DV2J 5J1NA 2A2CA 2Z2YB 3PIPQ 1UZHA 4K0KJ 4BWJA 1RWMB 3MF5A 1FXRA 4X65J 4NXNJ 4ZMMA 1YDLA 2W8KA 1NMEB 1IKVA 4KHMA 4A48A 2QX0A 1VQOS 3ET6B 5LSOA 3JS9A 3H90A 4UQTA 4MYUA 4A8SA 2BJEA 3TZWA 4Y2IA 1WC3A 4NCGB 3AODA 4DL0C 1I1GA 1IBMJ 5IWAF 4ZN3A 5IOLA 3KUHA 4HDGA 1KQGB 3V6DB 3HT0A 4EGLA 4LF2A 2HQCA 2FGOA 4KAIA 4XDCA 1ROFA 5DLGA 4DFMA 1VS3A 2DH7A 2EK6A 1VQNS 1T95A 2CNLB 4Q8EA 2J6TA 3AT1B 4UW2A 2CJXB 1C0TB 2XS2A 3OFEA 5A2QY 3SEOA 4CLYA 2XMJA 4ID5A 1VBXA 1RK8A 4B3SJ 1FE0A 4JI0F 3H8YA 4TY8A 1U26A 2N3LA 2V8PA 4WIQA 1JJ4A 3I31A 2OPPB 2BQ3A 3ZZUA 1VIXA 2YVSA 1RA7A 4JB8B 4U8YA 4QPXA 4OZNA 1HI1A 4KFBB 3BDPA 3DN9A 4AUKA 4X4NA 2MQOA 5LXRA 2M8HA 4U96A 5E5NA 4OLPA 1V5VA 2ROGA 2ROPA 1X5TA 1C1BA 3OL9A 2ZH5A 3W8GA 4EFAC 4QWEA 2Z2MA 1IKYB 5J2PA 1NEEA 3OJUA 1HKAA 1CEZA 3PY8A 3D0HE 1NHVA 2B7BB 1VFJA 1OS5A 1Y00A 2KM8C 4U8VA 1UFWA 2JZ5A 3PYGA 2HSEB 5HJYA 4OYXA 3GG0A 4HH1A 2OSQA 3C2PA 3GMGA 2ZZMA 3N4WA 5FDLB 4DV6F 8AT1B 1YKWA 1P1LA 2I1RA 3J81j 3MECA 5ETNA 4OI2A 3BR9A 2R2TA 3S8SA 3IM8A 1RDRA 1Z1ZA 4FF2A 2VFTA 3ITHA 4WE1B 2V50A 1SJ1A 3RBXA 2OFGX 4AL7A 3KLHA 2IM2A 4X4QA 1L3SA 2ZH8A 2HBRB 3T1HF 2DXEA 4EEYA 5KFMA 4IOAQ 1SXLA 4M95A 4ILLA 2Z8QA 4TN2A 1SC1B 4ILMA 2V94A 2XSJA 2Y8WA 1S1XB 4KIAA 5DS7A 3RB0A 4RW8A 1MMLA 4M94A 2KYZA 5A6PA 1OIAA 1MROA 2VQFJ 2HHWA 4P10A 5I4MA 5EGYA 4P72A 2HHUA 4QW9A 4JI1J 3ETMA 2MY7A 5IV4A 3T1YJ 3W2WA 4ZITA 1ZA1B 2LDIA 4IQMA 1T9VA 2V67A 4HHHA 1S57A 2ZOGA 2K3KA 1U02A 3P5BP 4TLRA 3TANA 2IC3A 1YJTA 5L9NA 5CZVA 3EGVA 4MFBB 1Y4ZB 2FZGB 2R2RA 2RQCA 4ZJLA 2VQEJ 2W2OP 2FJDB 2MB0B 5D15A 4LF6F 3BKUA 3PKYA 1FJGF 2KFYA 1OY6A 5HQMA 1RTHA 2M9KA 1FO1A 4FPRA 3KG4A 4M5DA 3DRSA 1TKTA 4UQGA 2J5AA 1VI7A 3KWMA 4FKYA 3TVKA 4R8UA 4DR4J 2RIJA 5G0RA 2O3DA 1WOPA 2QMWA 2CZVC 4DEZA 2YBVA 2DNHA 1SQGA 4I4BA 2M5YA 1X4DA 4TQSA 2G2YA 1S4EA 3R5CA 1ULRA 1SH3A 5H9FK 1NSKL 2GVZB 4F7VA 2JEIA 1X4BA 1BXNA 1N54B 2OFHX 3RW6A 1W25A 4O3SA 4OIXA 5CCMA 1LW0A 5IC6B 2YWGA 3QFWA 4ED8A 3G6VA 3DLBA 2JC1A 3GP9A 4X4OA 1OPIA 4NLRA 2M8DB 4ZVUB 1YJ9S 4OJGA 3G87A 3LAMA 1QSYA 1ZYQA 2XG8A 4NYPA 2XHWA 1CULA 4B9TA 3JSBA 2AMCB 5KT7A 5KFZA 3GCXP 4PG4A 3DCAA 1XNRF 1RJJA 1TP7A 3MEGA 2VASA 2B6AA 4WFAQ 2DCUB 3AY0A 5KT5A 2MQLA 2YH0A 2EFQA 1X4EA 2PE8A 4JV2A 4KO0A 3NNHA 4LREA 1A0OB 3SQGA 1KS2A 1WI8A 4BWMA 1VQ4S 4YUDA 1VIOA 4S0MA 3RRHA 3RBEA 2V2QA 3TYTA 2R7UA 3KK3A 1LWFB 5DG9A 2ZH9A 2LQ9A 1DARA 5JUMA 1N6QB 1N52B 3OUYA 4XDDA 2HHXA 2GHPA 5KFLA 3CCLS 2N7YA 5JJBA 1UAWA 3DRPA 2WSCC 1T9UA 3K5MA 3VAFA 1KLNA 2Y8YA 2AJQA 5BYQA 1RKIA 3WC0A 2E9RX 3VVTA 1SH2A 5A0YB 1IN0A 3HSZA 3QIPA 3N5FA 4HTJA 2HWHA 2JLFA 2D9OA 1U2RA 2MDAA 4WFBQ 5J1PA 2E44A 3LOUA 2XY5A 1RHUB 5HN0A 2ZH7A 2WTFA 2AX0A 3JSRA 4UOCA 3DKDA 4OX9F 5A8WB 4WYLA 2F63A 2VKZG 3W1YC 4H4OA 4X66J 2DEJA 4A8WA 5LSRA 4DV4J 4DOZA 2BE7D 4U9RA 3MFHA 4UZCA 4DQIA 1VBKA 3GIMA 3J7AN 4DL5A 4Q8FA 2QSFA 3ILJA 1HMVB 4I6AA 3D6TB 4OZ1A 4KR0B 3BO2A 3CCQS 4FNIA 3H5SA 2CQDA 2RNEA 3R5AA 3KK2B 1MN9A 5DDQC 4PR6A 1NJXA 1HNZJ 1U0HB 3HMJG 2L08A 5ADZA 4WTYA 4O3PA 3VGVA 2JEJA 2BQRA 4J9UE 3TAMA 4CZCA 3UVJA 2QMXA 4RWXA 3TO8A 2L9NA 3QRRA 1DBDA 2VDIA 5D0GA 3HD1A 3GFHA 1R7IA 4ZVOB 4K2XA 3IXQA 1S1WB 3EGWB 4AQYF 3AXKA 4I1TA 3EXYA 1U1RA 2BJ1A 4RUBA 4IOCQ 2PFFB 5C2CA 3NOGA 2DNGA 5DRKA 3MD3A 2Z58B 3GTYX 4I2PA 2AJ4A 3IWLA 1T03A 5HVHA 3V4IA 3D5MA 1DTQB 1NO8A 4PPZA 1X0FA 5DG7A 3KTQA 4ECXA 4ZVSB 4DU8A 5DLFA 4DR5F 2BM1A 4CLTA 2XMWA 4ANDA 2HAIA 2YQ0A 3KLGB 1HNWF 2VBYA 1VHIA 5EDWA 1WC4A 4IKAA 3CCES 4Y65A 1HHTP 4IFVB 1EETB 5IC4B 2H4YB 3U1NA 2XZTB 1B99A 1WDTA 1OJ4A 4ES2A 5EHHA 4ZPCA 4DV5F 2DGWA 4MJKA 3DLEB 4H4MA 2DKOB 3B8HA 4R5PA 4F50A 4DWIA 2ALZA 4O0IA 2B9EA 2JFDA 1X4HA 4F2SA 1J5EJ 4PQAA 2GIQA 4F4XA 4P71A 3TUJC 4USIA 2E9ZA 2C2KB 5GAHI 3GIIA 4DL7A 4PG6A 4PG7A 3TQEA 1X4FA 2HNZA 5IT0A 4X84A 4USKA 3HP6A 1Q8LA 5ETVA 3EVWA 1FEEA 1GNKA 3EVOA 2W2MP 3CCZA 4PG8A 2BJ7A 1DURA 3BDEA 2WOMA 3MM7B 2HQIA 3SCLE 1RAEB 1ZTWA 1O51A 4K7QA 1E6VB 3Q8RB 2BW7A 4U7CA 2LCWA 3OBIA 4JI5F 3FQKA 1S49A 1JLEA 2AJFE 4H4KA 2MZ1A 4PXCA 2DGUA 1IBKF 3SDEB 3BSAA 3GIKA 2GVDA 3ZTPA 5E0OA 4MKAA 4DHVA 4ZA1A 2LA6A 2HNDA 2A2DA 1B64A 5KFWA 5AE1A 4BC7A 5KFTA 5JMNA 3D4JA 1UVIA 2F8HA 3UDLA 2OSRA 2CIMA 3LP1B 2F4VF 3EJMA 4OHXA 4XPCA 4KGKA 3IR7B 3JAMY 4TU8A 1AUSL 2OO4A 4YY3J 5F3TA 5HMYA 2B9WA 2IVMA 1IR0A 1TUVA 2D74B 2PEHA 4QR2A 3Q8QB 4A8YA 4IG0A 5HLFA 4F26A 2XLIA 1R8BA 2V8GA 4ICLB 4I64A 3FMBA 4ZVFA 5HROB 1KONA 1IM6A 4RUCA 2HS0A 2J9DA 1MMNA 4IO9Q 3PX4A 5KG3A 1Q8BA 3RAQA 1JNZB 5B7WA 1FKAF 4NA3A 1BY9A 1KBRA 3OR1B 2B4UA 4ECQA 3ZZZA 1U6BA 1VC5A 4DL6A 4NA2A 5AXKA 2OKQA 1OY8A 4EYHB 4ZPTR 3OTCA 2ZH1A 2UUAF 4RW7B 1RT5A 4CO5A 3UWTA 1PG5B 3NNCA 4NXMF 2UXCJ 3PV8A 5GAGU 1WG5A 4LMZA 1NBEB 2RB7A 1WG4A 2HBZB 3TRGA 3W66A 5DQIA 2MQ8A 1F9EB 4OJHA 1Q0NA 3KOAA 3Q2TC 4IR9A 2E7WA 2IJFA 3ZTQA 1VK3A 3Q89A 2CVEA 4YOEA 3UR0A 4NLGA 3RB3A 4RNMA 2KI2A 4LF5J 2Z57B 1OSCA 5J1EA 5F8GA 1KN6A 1LOUA 1SL2A 1WI6A 2YKAA 3MUVP 1O0PA 4DQPA 1N0UA 3EYZA 5C25B 1WJ9A 1D1UA 2EW9A 3OJSA 2ZC4A 3Q8YA 4B3MJ 2W01A 1SIWB 3X1LB 1M5HA 2OUGA 1JKHB 1HBMA 4KKOB 3T5JA 3OFFA 1VQLS 3LPEA 5CYJA 3E51A 3NCPA 3GONA 4LRCA 5HAOA 1HQUA 1LFPA 1HBNB 2CPFA 2RS2A 4WIIA 2RDIA 4M5IA 2XLKA 3MI7X 1TKZB 2ZJQQ 1V3SA 2WVEA 4O3QA 1UVJA 1R43A 5MAOA 3DRRB 4NL5A 4LRBA 1GQEA 2CG8A 3TUPA 4B9LA 3CJ4A 3EMTA 4MT1A 1A7GE 2UUBJ 2DGTA 2C2OB 4JI0J 4USWA 3RZAA 1DTTA 3CGIA 1U4BA 1F6TA 1QY7A 1HYSA 3JYTA 1EX8A 4ECYA 2FPHX 2C2ZB 2DNKA 3CVKA 1T7PA 3CWJA 1EQ0A 3WBZA 4CO1A 2KL8A 4C2MA 5KG4A 5E3QA 4R0JA 4RO0A 4JI2J 1NK0A 2MPUA 4OI6A 5F8MA 4RX6A 3GV8B 4JI4J 3TVZA 4ZVPB 1SB6A 5K9FA 4AFFA 5CYMA 2WVFA 2R7TA 4UT4A 1X7VA 1QSSA 2IMOA 4TLQA 2CQ3A 1K47A 3IRXA 2UV8G 3EZ5A 2GW8A 5G4DA 3CD5A 1PJ5A 5B08A 1H2TZ 4Q43A 3PKMA 1LKZA 1S9EA 4ER8A 4ANEA 2KXNB 2ZJPQ 3VZHA 1EZZB 1X60A 4DLEA 2J0XA 1HNIB 3BQ1A 4F25A 3WIVA 5LJ5Y 2ASJA 3R8YA 3D7SB 2UU9F 2QV6A 4P2MA 3CCVS 2LU2A 3N5BA 4IG3A 2DR9A 4UUXA 4QYRA 3MMBB 1IBCB 3R6GB 4KGZB 1H3DA 4Y2KA 2JVOA 1SVDA 2HQGA 4M5HA 3MEEA 4EK2A 4TY8B 2XULA 3IR6B 3NWRA 3ISNC 1NPKA 2R9LA 3CC7S 3HULA 1JNRB 4YP3A 1WF2A 4M8LA 2O66A 4C8YA 1FD8A 2HMIB 2QLBB 2HW3A 1RAJA 3HJVA 2KB2A 5DDRC 1IQTA 3NS5A 3H20A 1EQMA 1R0AA 2G4BA 5KFKA 2MLXA 3OR2B 2GQ2A 4ECRA 1JLGA 4F4WA 1C1BB 2J7UA 1I3OB 3KJVA 5J2PB 1S1UB 2N3OA 4NCBA 3QO9A 3L95X 1S9FA 2J9CA 1UJ4A 4MK7A 2GC8A 4ZJQA 2O67A 2K7KA 2O5DA 2LLZA 2UXBJ 2VL1A 2A0FB 2B9XA 2Z30B 3DLHA 2ZITA 5D4PA 1AUDA 4FDFA 1HWUA 1MU2A 1Z2ZA 1U1OA 3PIOQ 2QLWA 2AGPA 2HWTA 4JI8J 3AA9A 1GH8A 3OVAA 1M90T 1OWXA 3MECB 2WB4A 1ZOTA 4QYZJ 3M9NB 1HR0F 1R0BG 2R4FA 1HNXF 3VWSA 4DR6F 3GR1A 1CC7A 4DS5A 3KLHB 3LPYA 2ZWPA 3PX6A 1FVSA 4CYUA 1YHQS 1EP4A 2X51A 3UCGA 1RT6A 3R27A 2XSFA 4DPOA 5T7LA 4F4AA 1PCAA 4QR0A 1N32F 2OMOA 2HS3A 2CQ4A 3P49B 3U02A 3GIRA 1U24A 1MROB 1SC3B 1RP5A 2X1GA 2UXDF 4GKJJ 4OYWA 2CNNB 2XBPA 2DHXA 5D78A 3N0VA 3I87A 4NRTA 1QD1A 4CWBA 1RT7B 2KM8B 2W1BA 3D1QA 1H0HB 2D3O1 2VC1A 3PFOA 4OZJA 5D0HA 3H5XA 4KHPJ 1V9OA 1XMQF 2A10A 3RGIA 1NZAA 4C0HA 1WC1A 4EUVA 3Q2SC 1RTHB 4NI2A 1DZ5A 2LP4A 4DR3F 2EPIA 1CG2A 3D0GE 5BR8F 3M2UA 4M5DB 4UZBA 4DFKA 2W2PP 3UI3A 4ZLNA 4KTQA 1ICEB 2I0XA 5LMUF 5F8HA 4R8UB 2DT9A 3MMAA 2PIIA 1P6TA 3FNNA 3DNCA 2JLEA 3M9MB 4KHRA 4F0MA 1B7YB 3MR7A 2K7JA 3FFIA 1S9GA 2QA1A 3IGNA 2GAGC 3MTJA 4A8OA 1RACB 2CQCA 4ECUA 1NLKL 3VZIA 2DRBA 2WONB 1WG1A 1C1CB 5GVQA 5HP1A 4B3OB 3SCIE 4C3MA 2JL9A 3IWNC 4WFZA 4OV6A 1AZSA 1N5YA 2R8IA 2JDJA 4Y28C 2GFFA 3CIZA 3AQPA 2Y1JA 1LW0B 2MGZA 2BA9A 3SV4A 2LXUA 2XZDB 3VHQA 3SI8A 2DY1A 3TI0A 3I0RA 1LXJA 5BYSA 1SC6A 2XNRA 3HI9A 4DQSA 2CJ9A 4KY3A 4CT9A 3BJYA 1RT1A 2Q1LA 3QT6A 3BS9A 5DGBA 2YKNA 2KHDA 1SCJB 4LSZB 2ZBCA 2DGSA 3HVRA 2OAUA 4NLDA 1GXLA 5C24A 4G1IA 1FDDA 1PJ6A 1RTJA 2YNFB 4NZ0A 3KLIB 3BPSP 2VODA 2CNKB 2MYFA 1L5UA 4V1Ak 1KFDA 4DL3A 3M6WA 1DQ9A 3OTOF 3O5TB 1T05A 1YITS 3CO9A 4WK1A 2Y3YA 4K59A 3SQGB 3GYGA 4IR1A 3O3LA 3R2DJ 3OVBA 4OJ1A 5C7PA 5B0GA 3IP0A 2XMVA 3DM2A 1PJ7A 3OUYB 1EKSA 1UA1A 2NYHA 3K8VA 4Y2MA 3H4DA 1NKBA 2KZMA 3QGPA 3OFHA 1SUQB 2UV8A 3X3UA 1RCXB 5K8NA 2QLXA 4G1QA 5KT6A 3LO3A 3IC1A 3F56A 3J7Z5 2ZJRQ 1X5OA 3FZBA 1DAXA 1CJTA 1RB0A 1RLDA 3GV7B 3TX0A 4PWDB 3RB6A 1UW9A 2NSBA 3BSOA 3W62A 3NG8A 3N6LA 1D8ZA 3MMCB 4CH1A 2WRMA 4OQJA 2E5GA 4JYAF 2HLUA 1WHWA 2FVRA 4F4YA 3RR7A 2GMJA 2IRYA 4DCJB 4DR5J 2IM0A 5IV3A 3DFEA 2OPQB 4BHQA 2VG6B 3GCWP 3ZXWA 3FBBA 3TZZA 3R7NB 4NLSA 2B8QA 1YI2S 5DETA 2YKQA 4KC5A 1GT8A 1JX4A 2JH3A 4QJVA 1VQ8S 1PBUA 3IO1A 4ZCKA 3AJDA 3L9ZA 3N9UC 1B70B 3CJ3A 2FVQA 1KVIA 3D1HA 4Z2XA 3H98A 4C48A 3DLJA 3HVTA 3MAQA 2WBMA 5IQQA 3G4SS 3BO3A 4LQ3A 3UVJB 2VBWA 4AYBD 4IUFA 2ZHBA 4DCOB 5GADU 4R0EA 2ZVSA 4F8RA 2F8MA 1L3VA 2B5JB 3Q86A 4DV2F 1S99A 4OYAA 4QR1A 4K0KF 5M2RA 2E1CA 3DMJB 5CH7B 2EC0A 2AJ1A 4X65F 1JLQA 4NXNF 1LWCA 2FJBB 2DXFA 2GQCA 3C8YA 3KLEA 4TYAA 3I4PA 4W4MA 4OI3A 1SC4B 1NK9A 4I2PB 1M1GA 2VC0A 4WP3A 3AAWB 1U7LA 1JQGA 2JC0A 1T94A 3C14A 3OTDA 1WEYA 2FB0A 5KFQA 2AV5A 1HBOB 6AT1B 2BRKA 5HL7Q 3O6QA 1EJ7L 4BLGA 4CLWA 3BM7A 1BE4A 2UUCJ 5B0BA 4RZRA 1REGX 2CRLA 3K8WA 4P6QA 2EKNA 5ETQA 1UL3A 4N47A 1RI7A 1IBKJ 4USVA 2MEWA 3WX8A 3SFUA 3KUEA 4C11B 3G9CA 1TVRA 4FYXB 4DV3F 2W8LA 3FGVA 2CA9A 4RL1A 4LFCJ 1KVJA 2YKPA 4H4MB 1FNOA 1SQEA 1MWQA 1RADB 3IFEA 2ZBIA 2J0QD 2XM3A 1RTIB 4B3SF 1VQ7S 4AD6A 2HQFA 3D28A 4K4YA 2GNKA 1IKWB 2CPDA 1A6LA 1X8DA 5C5JA 2HAFA 1WEZA 1U6ZA 1XMOJ 4X64F 3C16B 1YRUA 1FX2A 4DCPB 3CNQP 1PYTA 3EDRB 4WPAA 3PYFA 4CLLA 2HHHJ 3T9ZA 3BBFA 3P8BB 3QSIA 3TJ8A 1Z4UA 2ZKUA 3W2VB 5DZ7A 3QT8A 1NK8A 1JLCA 1DJ0A 2X1AA 3DOLA 4YMEA 1Z2LA 4RU2A 4DU7A 1EKRA 3CCRS 3G8TA 2WOMB 4N8OA 4NZ6A 4ZVRB 3WHIA 4ZLPA 2MHNA 3M30A 3QT5A 2GMLA 1RHQB 5KG0A 4GVLA 3SSSA 5HI7A 2L3MA 1JK9B 2XMMA 2G0CA 1N4LA 1TV6B 2UUAJ 2CFXA 3CD7A 4CH0S 1YRXA 1JLEB 1S6PA 3MM8A 4HTIA 5E3RA 5J2MB 5L8RC 3ZZ0A 1SJ3P 1MMDA 1FWKA 4NXMJ 2HIQA 5CZXA 2GVDB 2WK4A 1OPZA 2IHR1 1HPZA 2H4WB 3A8EA 3TWZA 2RVJA 3CCUS 1TL1A 4MK9A 5FJ4A 2K8GA 2QZ8A 3QWPA 4CO0A 1HBUA 3I9V9 2Q43A 4KE5A 2MZRA 3IN5A 1ZZFA 2XQCA 4RNOA 2LFVA 2C1EB 3DGPA 4DF8A 2IA6A 2BE9B 4CCHA 2DR8A 3LALA 3EE3A 3C6UB 5HVGA 5DDPC 2K06A 5L1LA 1RT3A 5HLFB 3DLGA 5B0EA 3TEHB 4WFXA 3DGVA 5ETMA 3UNGC 1D09B 1M5PC 2HHVA 3R5DA 4U67Q 3I6PA 2VQFF 5KOXA 2E9TA 1D9AA 3OSPA 4ZLLA 3M32A 3KXDA 3C6TA 4JI1F 1G3OA 3T1YF 4JV5J 4ED0A 2WVCA 3DOKB 3IAM9 4W90B 2CDRB 2RSQA 3MOZA 2HVZA 2HFVA 2CJBA 5AT1B 2IAJA 2AHOB 4U7UK 3AXMA 4OYZA 4B02A 4NYZA 3M2VB 3GZ7A 3HFZB 2KT5A 2VQEF 2V2VA 5ETOA 3DI6B 5AJ3J 2DHHA 2PGCA 3CJ8A 3J80Y 2CPXA 3IAS9 4L72B 2B9YA 3J81U 9ATCB 3MGJA 4WTOB 1UWBA 2P9CA 2E66A 3UFCX 4DR4F 2XCPA 3CJ5A 3V2UC 2E5LF 4CI0B 1Y5IB 5C42A 5M2UA 3DHWC 1RA6A 4AXJA 2IYIA 3DDNA 5KFGA 1RAHB 2CZ9A 4WYWA 3NXZA 2RKIB 4ED3A 2XS5A 4OYIA 2BKNA 2EWHA 3UDEA 2IDLA 4JUZA 1KHVA 2VPXB 5M2PA 3MAAA 1KWMA 3QT7A 3C15A 2W4DA 3OTEA 2UUWA 3FJ2A 4XO0A 1ZM3A 4QIEA 4DR7J 3B82A 2HGNA 4XAKA 2J7WA 2M4MA 2KH9A 2DO0A 2ZKTA 1GEHA 1AXQA 2U2FA 1Q1KA 4CLKA 1N36J 3NOCA 3HVWA 2DRDA 2G0JA 3RBZA 3RU0A 1FRIA 4MYTA 2NR0A 1NHKL 3K58A 4RKUC 5D77A 2D9PA 3R6LB 2DNQA 2N7CA 2YNGA 1ZA2B 4PXEA 3PW4A 4I2QA 4HACA 2GX8A 1SQFA 2WCXA 2VFVA 4C7QA 4IH7A 3LP0B 4LSNB 3VGUA 2Z2LA 3W63A 2DNPA 2MMYA 4QU7A 2MKSA 3GYXB 4Y34A 5BXIA 3F73A 5CYMB 2P2CB 3CDUA 1RBLA 1WORA 2IIHA 4FNHA 3VCDA 2VBZA 3IBCB 2FQQB 2XMUA 1KD1T 2FJEB 3TVYA 4A4JA 4J9QA 4DQRA 2Y1LB 4DSJA 2W9CA 2ILZA 2M88A 3W5ZA 2P9GA 2RILA 3RUBL 5HO4A 2QGFB 2ZFHA 4LRFA 4DPTA 1SIZA 3ZFVA 2KU7A 4QPTA 2KVQE 4X4TA 2BE2B 1SJ4P 2NZ4A 1MWZA 1S1TA 1FERA 4W92B 1U1NA 4DV7J 3HHDA 4X66F 3LP2A 4M1KA 1CJVB 3I5AA 3PTWA 2MKYA 1IUJA 4WWSA 4QWAA 2J6SA 2MHEA 1X4GA 4DV4F 3T5HA 1OO0B 2NXJA 2XYHB 4E2FB 1JWWA 1XIQA 4ZCLA 1S97A 1HWKA 3MEEB 4GO7X 2LA4A 2PO4A 2MXYA 2NXEA 2CPJA 5SZTA 3KLVA 3D3CJ 4K5SA 1NH7A 2EFVA 3OXGA 4I68A 2DNMA 2BVZA 1HNZF 4I67A 1VISA 2MLYA 2DH9A 3I55S 4J9LA 1LK5A 1NDKA 2WW8A 2I6WA 3DRXA 4CT8A 2CJAA 1R0AB 4FZVA 2HURA 1O5JA 5LT5A 1YBUA 3SZ2A 2AW0A 2AT1B 1FRXA 2AIRB 3K0JA 3KJVB 3G86A 4QW8A 5KFUA 2M3DA 2VD3A 1TR0A 2FDNA 1IXKA 2IYGA 1CVJA 4PRFA 3MD1A 1U8WA 1MLAA 3BYRA 1F5CA 3WZ0A 3L3CA 1T02A 2YNHA 4WJBA 2YPYA 2KFZA 4RNNA 4C9DA 1CSJA 4PQUA 1TL3B 1CS4B 2FJXA 3BQ0A 1X4AA 3N28A 2OP5A 4FYVB 3GSIA 1M5KC 4TU9A 2RH3A 2ZNYA 3CCWA 4E98A 1VQMS 1RUSA 3SCKE 3R1HA 3MDFA 2HRTA 2VPWB 4F0HA 4B17A 3H2LA 5LMUJ 3P45B 5J2NB 2W4PA 4KV8B 2Y9HA 3ULHA 3D68A 3FUYA 3R9LA 3SXLA 4I6YA 2YX7A 4OZ3A 5AXLA 1JIHA 2QC3A 3KYLA 2W9BB 4XK8C 4WKRA 1Y7PA 4PUOA 3I5CA 1RISA 1WTBA 3HKWA 3A12A 3BSNA 1RAAB 2W24A 2EC2A 3M6VA 4D3GA 3I0SA 5IT4A 4Z37A 4I7FA 4LFBF 2YKMB 1NRKA 3KUGA 2VG5B 3PW5A 2D3UA 4QQBA 3TQ1A 2I9SA 3BYPA 1X5SA 2EXUA 4DV1J 1ZS6A 1DHMA 1W26A 4OZ5A 4P2SA 1RT2B 4YEAA 4RU9A 1J5EF 1TL7A 1XBWA 2DIVA 4AXIA 2AEFA 2IM1A 4UY85 1LW2B 1N48A 2AEMA 2QA4G 4TQRA 4QU6A 1ITPA 3IBWA 3E2EA 4WK3A 3K2YA 5DZ6A 1RWVB 4RW9A 4B9UA 3FC9A 2PT0A 4QBUA 1JMTA 2ZOFA 1TFWA 4OLOA 3QWUA 4QIGA 2POKA 3KDNA 4M5GA 2XHCA 1XJWB 5BJRA 5KFXA 3MCNA 1JXLA 1HQEA 3PEJA 1FRKA 1FK9A 2FLLA 3SIPB 5KG7A 2HLTA 4L75A 2QFIA 5LXYA 4NI2B 1VDHA 3M2UB 1SKRA 1N5SA 2HBYB 4NLVA 1FVQA 3S6EA 5CD4A 2C2MB 3HHNB 2OPRB 2YQ3A 4LVOP 4CO3A 4ES3A 4ZHRB 1S9GB 4IYQA 1RKJA 1PC5A 1VJWA 2RDJA 2EBEA 3S01A 4TXSA 2NPIA 3TUIC 2E5IA 4DDFA 1F0XA 5HP1B 4IDKA 5B0AA 1HI0P 1Q4RA 4L6V3 1S72S 2XGQA 4DFPA 2L48A 1SJRA 3FRZA 5KT3A 3U27A 2EI5A 5HBMA 3NNAA 3VGTA 2HZAA 3TOQA 2R2UA 1M0SA 4HKQA 3RR8A 3I0RB 3OQ2A 1AT1B 4ALZA 2KRBA 4LBPA 1QAXA 1REVA 2FC9A 1TKXB 5DO2A 4DXLA 4KRWA 1HIYA 2YKNB 3M8ZA 1FDAA 1N5TA 4ELVA 3CDBA 3H40A 4DUZJ 2YKOA 2PDAA 1R8PA 4DZ6A 3MR3A 3BKTA 5I3UB 4NLWA 2HHQA 3S7RA 5IM0A 1R8CA 2KT3A 3CDAA 1PAEX 1CJUA 1GFWB 4PWUA 2IJNA 3M8YA 2HNYA 1SI9A 5FD1A 2VICA 1M1KT 5KFYA 3IBFB 3PACA 4EZ9A 1YZ6A 2YX1A 3M8QB 5L1JA 1T05B 4M5MA 3JB9k 1FCAA 1U49A 2CQHA 1O8BA 1I94F 1MNEA 5HMWA 3PHEA 2VOOA 2UXCF 3MTKA 1M1HA 3QJLA 1VGYA 2L41A 2V34A 5D4LA 2KJWA 3US5A 3A1YG 4FVMA 1VCTA 3ET6A 2AZ3A 2HZVA 1SL0A 4ZLJA 3BB5A 2DTJA 4CM0A 2V8DA 1WHXA 2BKPA 2IRXA 4N41A 2HPUA 4K4SA 4LF5F 2H5JB 2BBEA 4NCGA 3KK1A 3HZEA 1G6BA 1S12A 1CJTB 4ENOA 2OIHA 1RABB 3VV2B 5HMXA 3Q23A 1GXUA 3IMQJ 1KQFB 3FK4A 4IRKA 3MAHA 2QJ3A 2IM3A 1YRTA 3AA8A 2ZBQA 2JHEA 4RW4B 4B3MF 2HGLA 3LQVA 1KVKA 1BQNB 1BC6A 3UCUP 2FYXA 4ZVEA 2H5IB 2VPYB 2MSTA 1S6QA 2KHCA 2FY8A 8ATCB 5E41A 3IS9B 1HW8A 1JLAA 2DEIA 2VJVA 1KQSR 2OPPA 5B0CA 4DV3J 2WAQD 3QZ8A 2Y0SD 3PW0A 1RLCL 3AHPA 4KFBA 4C0BA 3HVTB 3PJXA 2UUBF 2Y1RI 4YN3B 1ZBTA 3CF5Q 1FKOB 1IKYA 3T6JA 3H25A 3D3BJ 4X64J 1FWLA 3KHRA 1JXVA 3BBCA 4JI2F 3MR6A 2V4RA 1TMJA 4JI4F 1ZZNA 3ETOA 5SUHA 1TUGB 1YJRA 1LWCB 3HM9A 2AGOA 3NMRA 3KLEB 3ADAC 2Q66A 2JVRA 3OTBA 3OL7A 1U1KA 5FDLA 1UPPA 3VAIA 2EBGA 3OHAA 3HXMA 4I69A 5F9LA 4LIRA 4FXVA 2JX2A 3HSJA 3QJJA 2DITA 3CD6S 4WE1A 4O4GB 3AOAA 3J7A1 1WEXA 1LFWA 4JI3J 3CJTA 2GO8A 2UVRA 4CLUA 2PEBA 4WU2A 2NZCA 4USUA 2V9KA 2BZ2A 2KDOA 1TZ0A 1FFGB 2DGQA 1TVRB 1Y5NB 2XYGB 1SPBP 1S1XA 5C2GA 1EARA 2IVYA 3F0NA 1NHUA 4JP8A 2UVWA 1SKWA 4LF8J 1VQ6S 3D0IE 4C8MA 2HFUA 2YX4A 3KDOA 3L4BC 2GJ2A 5CABA 4J9SA 3PO4A 4CNYA 3QRQA 1OSDA 2W7OA 5D3GB 2CWXA 3JSMA 3BZQA 3MUMP 2CADA 4LFAF 4QZVB 5GMDA 1Q7YT 4OL8A 1IWAA 4NLUA 4MFBA 2NXCA 3MR2A 1UETA 2U1AA 1R3NA 4LQ9A 2LEPA 3OD2A 1AW0A 1CQNA 2BABA 1FKPA 1IBLJ 4BBYA 1U09A 3KNAA 1S7IA 1WOSA 1BGXT 1F9FA 1Q5VA 5ETKA 3D6HB 4DPWA 2UXBF 4F3OA 2IA0A 1CJKA 1S0VA 4DPXA 5GAGI 1YG0A 3EM1A 4F0KA 1NJIT 2KTQA 2ZHOA 4ELTA 3MM8B 1S10A 3ZZPA 5DDOC 1NPPA 3JQKA 2CVIA 3BN4A 3THPA 2AZ1A 2HEKA 4JI8F 2RJZA 3ZNUA 2GVZA 2B7CB 4QIFA 4J91A 1S76D 3NGTA 2E5LJ 1K0TA 4LT6A 4FN5A 1QDUB 4MAKA 3RRKA 2OI2A 5H9FJ 1GXTA 2XMKA 3OPKA 4OHWA 2VUGA 3DGPB 1BQMB 1ZTTA 1WD6A 3GJTB 1JJ2R 1URRA 4TY9A 4GKKF 3FKBA 4UY8T 2VJUA 1B0VA 4FBTA 2PA3A 3BPDA 7AT1B 2KG1A 4K4XA 1MSWD 1RT3B 4C8KA 1KOHA 2YPZA 4NX9A 1WKLA 2ADCA 1R0CB 1VQ5S 4OZ2A 2R7RA 1Q79A 4GKJF 1Q53A 4MKVA 3PM9A 1NNDA 4P7TA 4HLBA 1S6OA 4KH1B 3KLFB 4DLGA 4ECSA 2QTWA 3BKFA 1EHWA 2IAJB 2FC8A 6FDRA 1ZM9A 1UEKA 3UPFA 2C3YA 1UVMA 3ILLA 4LUBA 3VQSA 4Y0FA 2IY5B 3O2IA 5ETSA 4KHPF 2RQKA 2Y1IA 4C8LA 1WSRA 1XERA 1RT4B 3SCJE 1N6QA 4P9SA 4RWWA 2N82B 3CUNA 4WZMA 4K8RA 1TL4A 4QCLA 5IT9Y 1KR4A 4Q7AA 2HHSA 4BCAA 4X4RA 3LGHA 1ZM4A 3DHXA 3W7BA 4FF1A 1HL6A 2KN4A 4IOBA 4ECTA 2J6UA 1NDCA 2ZWOA 4WU3A 1BMQB 3TW0A 1C4AA 3E01B 2DR7A 3BN7A 2CQBA 3TAQA 3D1OA 3MAAB 3C15B 3TR5A 4K2JA 2V5HG 3WQPA 3SV3A 3GU0A 1SH0A 3UN5A 1NJZA 1F1BB 4LJMA 2QLJB 3KNGA 5CXTA 4RNFA 1WOOA 2DO4A 1JJCB 2OD4A 4NZ7A 5A2QU 4NEYA 3HSGA 2KO1A 1HMVA 1UP1A 4P75A 1D3WA 1FXDA 1RYRA 1SBRA 2MZTA 3T5KA 2ERRA 2H9ZA 5K8PA 1U0HA 5A8KA 2DRAA 1OYDA 1WUUA 4CO2A 2EG2A 1UFKA 1YBTA 1GMWA 4ZN1A 4I2QB 4Q2LA 3ZZTA 1UW4A 2E1AA 2BQUA 4X62J 2A3JA 3KHGA 1S1WA 3UN2A 2W2NP 1JLBA 2BXJA 3N79A 2Z56B 1DLOB 1XWLA 1VRQC 1F2GA 3AFGA 4CLFA 2PC6A 1DTQA 2G1DA 2CJYB 1S7HA 1N34J 2XI2A 1XNQJ 2YWKA 1Y0HA 5ETLA 4O3RA 3CW2C 2R8GA 2W9CB 1YWXA 1XQIA 4RW6B 2ZC3A 2XTJP 3AOBA 4ZIVA 3I5BA 1EETA 5AXMA 2FHJD 3TA2A 7FD1A 3Q0AA 2E7XA 3K7RA 4KT0C 3CIMA 2EFGA 3CB4A 3THVA 2RF2B 4DI6A 1WC6A 3MM5B 4O44A 4OZLA 2A6MA 1BLUA 3M1VB 1U45A 2FHJA 4DG1A 5KFVA 1VLOA 4H4KC 4YR2A 4A8XA 3DYAB 2HVHA 1X0PA 5GAEU 2RD5C 3NBPB 3B4MA 4LFBJ 1UMJA 1ZM2A 4ANCA 2N4CA 2ZZNA 1LWXA 4ED4A 2GIFA 3A13A 3H7HB 4LSLA 3DXBA 5EX0A 2VF3A 4DSEA 2UVVA 4EBDA 3PW2A 2MQNA 5F8JA 4HHJA 1QAJA 2YNHB 1RBAA 1E6VA 4C4WA 4PQUB 1LWEB 2WB1D 4TU7A 4OI1A 4NEZA 3SDEA 5CQGA 1PYOB 1LXNA 2VFUA 1J5OA 3HFVA 1PGZA 3DLKB 1T3NA 4ZCIA 2W7PA 3QGIA 4NMLA 4HR2A 2UUCF 2F3JA 1S59A 2WSFC 2VHGA 2GZOA 3VAKA 2IVFB 2OPSA 4OI0A 1F9HA 4JBCA 5KFIA 3W3SA 5K14B 3VAMA 3FQLA 2I5JA 2FLOA 3PRVA 5H9EK 4LFCF 1D8YA 4ICLA 1G2EA 4NYOA 1WDDA 3FSYA 3MPDA 5HROA 4DSKA 3D54A 3LGNA 2VONA 1FTCA 4JI6J 3BF4A 1AFIA 1KRPA 1BQXA 1SKUB 4KSEB 4IFYB 3MZIA 5D0RA 5K5MA 3MPUB 1F5AA 1XMOF 3ZZRA 3UQSA 1CLFA 2ZE2A 3NS7B 2IDEA 3OLBA 2JEGA 4EWTA 4RW9B 3H59A 3HHLD 1RWKB 2CQGA 2HHHF 4YB7A 1RHMB 1Y11A 2AF6A 4F3MA 5DGAA 4RW7A 1FK9B 2AYEA 4ZP8A 1AROP 2DNOA 3HHLA 2R42A 2YWWA 1PKUA 3GWCA 3QAEA 4RPFA 3MHYA 2XCAA 3FSXA 2J0SD 1R89A 3AJ1A 5I42A 1VRUB 1SV5B 2B4PA 1YQHA 2EEYA 3ISZA 1H7WA 1M5OC 1I94J 3FVYA 1YVFA 4E8UA 3GFYA 4DV0J 2MZJA 1UVKA 4CQ1A 1S6UA 1S0OA 1K0VA 3CJKA 1VQSA 3H4BA 1VQPS 2VOPA 4K4TA 2GS8A 2ZHAA 3QZ7A 3BGRA 4IH6A 2DH8A 4DUTA 2AU0A 4AL6A 4KKOA 3UD4P 3UR3C 1MWYA 1DFDA 3QIDA 2QO3A 4ZP9A 1LV5A 1CC8A 2MKCA 3NGKA 3MR5A 3P4UB 1H74A 1REVB 1W2IA 2ZVIA 4LF4J 2X3GA 1BWVA 5KFHA 4URQU 4DJBA 2BANA 3ONQA 5KFBA 3VALA 3DRRA 3NGSA 4X4VA 3QLHB 3MM6A 4PXBA 2QN6B 3AH6A 1RAFB 3W65A 2DHSA 2HYIB 1CJUB 4JV5F 2FVSA 3BGUA 4PKDB 2KKHA 2HFSA 3QATA 2EFPA 3MFIA 2HVDA 1T11A 2LQ5A 2DY9A 2IPOB 3B6BA 1H72C 2LQBA 2C2EA 2C2RA 4F04B 1QJHA 3JXOA 4MH8A 5KFCA 5AJ3F 5GADI 3AOCA 1MW7A 1QTMA 3EGNA 1V6HA 2DCLA 2YWEA 1RTZA 2NREA 1UJ6A 3RAXA 2DPJA 2NXUA 1F5BA 2V63A 3EZOA 1L3KA 3FBEA 1NM2A 2RRNA 4DZDA 2RRAA 1VK8A 2WSEC 1VYAA 5T14A 1T9YA 4GMKA 2IJRA 1XN9A 1IKXA 3W9JA 2X1FA 2B4OA 3KK1B 4GVBA 1IKVB 3LTOA 1OY9A 3EZUA 1Q82T 4RBVA 5E3AA 1HNIA 3GR0A 2NUUG 1H2VZ 1W7WA 1WNEA 1RHRB 3W5YA 3G82A 4Q5VA 3HX9A 1X9SA 2MLZA 5JVHQ 1GTEA 2H65B 3KFWX 4DR7F 3MMBA 2AQ4A 1S6QB 2CG4A 4G1PA 4ED1A 3EUNA 2G1HA 1JLAB 3MCMA 2XZWA 1N36F 1KTQA 4Q44A 2QA4S 3OXLA 1HQ2A 2HMIA 1RCOB 2RUSA 1R6YA 4ID5B 3RTVA 4B3TJ 2J9DE 1JJHA 3M6XA 3OR2A 1T9WA 2MZQA 2PSZA 2DNRA 1S1UA 1IR1A 5HSPA 2IFXA 4DPUA 5RUBA 4LFAJ 4L73A 2R7VA 2I8EA 4NWBA 1Q95G 4I6WA 4WFYA 1PO6A 2CQIA 5LL6d 2GCFA 4ZVHA 3HHKA 2RE1A 2EFOA 3PW7A 3R7SB 4CLSA 2C2DA 2A1BA 4YDXA 3G8QA 1GX5A 2R8JA 4QOTA 2P6TA 4WP9A 2R7SA 1VLYA 4B3RF 3L7UA 5K8MA 2PI5A 4C8ZA 3ENWA 4AE5A 1AYEA 4LBHA 4B08A 2FHKA 1QM9A 1T0TV 3FCHA 3IM9A 1WKKA 4DV7F 4J7CA 4KGMA 3ELHA 2JEFA 1PIEA 1WC0A 2M52A 5CYQA 3JAMU 3ITHB 1BD6A 3H2UB 4NOHA 5J2QA 2BV3A 2Z4PA 3KJFB 1QTNB 2KXFA 3ENVA 1HWIA 1NSQA 5KFEA 3DDIA 4NE9C 5ITHA 2HQDA 3PXGa 2V2ZA 4GKKJ 1FFSB 7FDRA 3EPGA 5KFPA 2JRSA 4P73A 3FCVA 1JLFA 5LJ3Y 2XSJB 4K50A 4ID8A 3JSMB 1OYEA 4K5RA 4LR8A 4F67A 3NGDA 2GGPA 1RT7A 4RW8B 2GQQA 3DOMA 3WDOA 1GAOA 1VRTA 3TJ9A 2C3UA 1TTHB 3WX4A 1H73A 1TQLA 1F3VA 3AB4B 1IR2A 3W2WB 1XC9A 4F2RA 1N8RT 2GAHC 1NB7A 1FKPB 2ADBA 3TARA 4XPEA 4DL4A 2IC3B 2EG1A 2HVIA 3VR1A 1CJKB 3AD9C 4J90A 4CP5A 2RHSB 3GV5B 2FHOB 1EAYC 1KDNA 3UCZP 2ZBPA 3W5XA 4C0OC 1HNVA 5IZHA 4N7TA 1U47A 1FDNA 4DX5A 3DU5A 2OHDA 3THTA 2YQ1A 1YBAA 3DRSB 1TKTB 3CJSA 3BGOP 2F4FA 2OEKA 2WONA 5B0DA 1C1CA 2FD2A 4B3OA 4CLZA 2F9DA 3CJ0A 4J9KA 1WF0A 4L74A 4QIVA 1YJNS 5G0RB 2CQ0A 2LYVA 5EX3A 4ZKAA 3AJ2A 1R27B 3MCSA 3FDSA 1FJ7A 5I3PA 3R5BA 2BRLA 2W25A 2DGXA 2E1MC 1OQ6A 3W61A 3KJNB 1FRMA 3HCXA 5LSLA 4I56A 4Z7YA 1ZPVA 4DV1F 4ZDNA 1VQ9S 3G6YA 4ED2A 1CPZA 3CSKA 1ZAVA 2V9WA 4ILRA 2YNFA 1Q5YA 2W9AA 3V4MA 3GJSB 2DD8S 3KLIA 4KB7A 1U6FA 1HFEL 2HKEA 3AB2B 4O3NA 4YB5A 1FRLA 4GC7A 4RUHA 1N5VA 3OSNA 3HZGA 1VC6A 1CULB 1PILA 2DISA 1Q16B 3IGVA 3ENQA 4I0WA 4P2FA 3BSCA 1Q78A 3P6YC 2QL9B 2FLPA 3MEGB 2B6AB 2F5GA 3PX0A 3PVXA 2ZUAA 1NH8A 2BOAA 3JSYA 2AP6A 5D4NA 4O4RA 4KO0B 4DX7A 1SUQA 3JTPA 3IA0A 2ABYA 4NLQA 1C2PA 2V8HA 3RB4A 1KEKA 3KK3B 3I9ZA 4ES1A 4C97A 3SYZA 2HRYA 3HD2A 1QUVA 1DQ8A 3D6FB 4J5OA 4BC9A 4D3HA 4PWDA 3MXHP 3C46A 3DRPB 2R7WA 4IO1A 4YHHJ 4HEA9 2D41A 5DQHA 3K5NA 3MMCA 5LMNJ 4OX8A 1ZAXA 3HFKA 2Y0BB 3QIPB 2VDHA 3PNIA 2BOPA 3M8SA 4DX8H 3BEGB 3FBFA 2OPQA 4WXOA 2P6SA 3J7YU 4IRDA 2VFSA 4FXDA 1TAUA 2VG6A 1TUWA 2CZ4A 4Q2MA 2ZD1A 2E1RA 2B51A 5GMKa 3NP5A 3TAPA 3V6HA 3KG1A 4LF1A 2RMLA 4DUZF 2CAJA 4H4OB 2PMHA 3K5OA 4DUYJ 2AYGA 1RAGB 4BS2A 3H42A 3QNWB 4PZVA 4YQWA 5D0EA 2NS1B 1UZDA 1C0UA 1RXOB 5F8NA 5A8KB 2JSXA 3T6BA 1HW9A 2MQQA 2V4JA 2O01C 1X9WA 1S4FA 2H3EB 3EICA 3BH6B 3CC2S 4ELUA 2CQPA 1NJYA 2B5JA 5CD4H 2A6OA 1E6YA 2P8IA 3POTA 3CULA 3S1TA 1UTAA 3DMJA 3L7PA 1IVZA 2VFRA 1ELOA 1U8SA 1JLBB 3TAMB 4Q0BA 1FHTA 3QMQA 4DR2J 3P5TL 1XR6A 5DG8A 1NU4A 4K4ZA 5FLXU 4Y00A 4URSA 1YJVA 1Y10A 5HJXA 1YZ7A 1B3TA 1HBOA 2B56A 2Q6BA 1VQYA 3U1LA 4OX6A 4DR1F 4C98A 4PG5A 2ATCB 1PYSB 4LF7J 1FJCA 3A3NB 2V69A 3CMES 4RBUA 2D3OR 1T03B 1IJFB 1RQ0A 4PAAA 3V4IB 1SL1A 3MEKA 4C11A 1Y3JA 2XC9A 3PDNA 5U47A 2QE5A 4H54A 2GIRA 4DN0A 4O44B 2RQMA 2JNJA 2AJ2A 4JI7J 1TKDA 1RTIA 4DG1B 3NAHA 2KYXA 1VHFA 3MURP 2ZH6A 1IKWA 4R25A 1LNQA 1Q81T 5JXSA 2RS8A 4F4ZA 3C16A 1PAUB 2Z2ZA 4R5PB 3SFGA 4RLEA 3ZZYA 3PJWA 4RR5A 1S79A 1AFJA 2AYMA 3A3PB 2DPIA 2YNIA 4M63A 3FEYB 3W2VA 1ZH5A 3E8OA 4LSLB 3SSQA 4FYYB 3ENAA 1NDPA 3BR8A 5CAAA 2HFZA 1S1VA 4PABA 3GE9A 5B09A 2HNZB 4B9SA 4X4PA 1KLMA 4K4WA 1RSCA 2CYYA 2MY8A 4OJ3A 1TV6A 3NLCA 5J2MA 4QWCA 5LOQA 3CC4S 1C4CA 2X3DA 5KFJA 2NCKL 4EMDA 4M5LA 3TJAA 2VA3A 1R8AA 1J5OB 5IQ6A 2LU1A 4CTAA 5HATA 1RHKB 3P3DA 2XMAA 4LF9J 2BACA 1HARA 2C42A 2I38A 1RWNB 1URNA 2J7KA 3LGMA 3UNYA 4JI3F 2XY7A 1IWGA 2OPSB 3W8PA 3ILOA 2H51B 4RNHA 4DSFA 4ZOSA 2HWIA 4TVAB 1FRJA 3G6XA 2OGUA 3C6UA 3UDVA 3EVMA 5KG2A 4DF4A 2I5JB 2HNDB 1U1PA 4GRSA 3JTOA 2XWXA 3ZTRA 1T9TA 2GA7A 3M4XA 6FD1A 3F44A 1FTRA 4WBFA 2FJWA 4LF8F 1H7XA 2HIYA 1UVLA 3EX7B 4NLOA 3DOKA 3HHEA 2ZE2B 2NSCA 4ETZA 3DXSX 1LQ9A 1N33J 3IG1A 3LANA 4IG0B 1HWLA 2HFNA 2ACYA 3M2VA 1KNZA 1VOMA 3C66A 2F8EX 4NLTA 4NLXA 2CPHA 4ZS6A 3WC2A 1KKHA 4U6PA 3DI6A 5L9XA 4FVCA 4F4KA 4A46A 3LWLA 2WVDA 2XS7A 1WACA 3HHLB 1IBLF 4UOGA 2ZM6J 3PJ9A 3PYEA 4W98A 2K2PA 2AX1A 2DNYA 2HBQB 3R7BB 3GJQB 4OYMA 5I42B 2NLWA 2R7QA 4A8FA 3CT9A 1RT5B 4TKTA 1VBZA 2UUTA 2B0GA 2VZ9A 2I2YA 5D6GA 2RKIA 4L76A 3CJKB 1N56A 5EWFA 2OEJA 2BW2A 1F60B 2E5JA 4M5KA 3AD7C 2MKJA 2X1BA 1Q8KA 1U1MA 2VG7A 4P2XA 2BKOA 2JJ4D 3BGRB 2R3VA 4X4UA 2C22A 3CCJS 3JTNA 5IWAJ 5J1EB 1TELA 1FEHA 5L1KA 4GC6A 1MG7A 2FHMA 5A8RA 1FI4A 2B4VA 2M2BA 5E3PA 5E7OB 1X4CA 2IRUA 3CJQA 1YJ7A 5E33A 2BANB 2OMLA 1RU2A 4NCAA 5HANA 3MM6B 4AL5A 3TP2A 2R8KA 2V8VA 5GMEA 1HBMB 3FBCA 3RJMB 4ETXA 1T9XA 3G71S 3HJFA 2P9EA 3H0PA 5KFSA 3MEDA 1CQMA 1HQUB 3MM9A 4ZPDA 2COLA 3HK2A 1FF2A 3IWXA 4ED7A 2LQ8A 3QGHA 3N01A 2HS4A 5E3CA 2G2OA 4U7UD 2YWFA 2HG4A 3FMWA 3A4TA 3KHLA 1L3UA 2VU5A 3LP0A 3NEKA 2FGCA 4LSNA 5F0WA 4ATNA 2FIUA 3TZYA 3V81A 3OT9A 2ZUGA 1NSPA 3E3XA 1DTTB 1UVNA 2QL5B 3EDQB 4MIWA 1HYSB 3JYTB 3NS6A 4MKBA 2O1PA 2MJNA 4CLPA 5KOWA 2OLWA 3A8IA 4OYBA 3M2RA 1Y3KA 4CRJA 3K59A 2KZZA 2NXNA 2WBRA 5EUHA 2C3OA 3FEZA 4X4SA 3QJPA 1U48A 2ASYA 4FYWB 2XNQA 5KT2A 4WFNQ 1J2VA 1IKXB 3WIUA 3HVAA 2CPZA 2FY1A 1UWAA 4GVBB 1RGVA 2R7XA 4NLPA 4DV6J 2BE2A 3D9BA 1M5VC 2XWYA 4KQZA 1RWPB 3IRXB 5F8LA 4PYDA 2J9EA 1CJVA 1QLNA 3G82B 1DY3A 3M8PA 2XI3A 3MOJB 1UEUA 3W64A 4B3RJ 2F9JA 1NPRA 4HL9A 1BUXA 3FZ2A 4CIOA 1S9EB 2VB6A 4O0NA 1HLWA 2DR6A 2ZH3A 2PMWA 1UKUA 1HHSA 3CCTA 2V0NA 4F3QA 3T1HJ 1WSVA 3OHBA 2CXEA 2E1PA 1HD0A 1RZMA 5LM7E 3H5YA 3TUZC 2AKWB 4FF3A 4IG3B 1SJQA 1ZETA 3O1LA 2XEXA 3HKZD 3SBMA 2M70A 1Q8IA 1CBKA 1UA0A 5D8HB 1RWXB 4DS4A 3CCSS 4J9MA 4IRCA 2CJKA 1S48A 4X62F 2M7SA 3ZNJ1 4USJC 4TYBA 1QE1A 4V19J 1TL3A 4FKXA 1CS4A 5K20B 3A8KA 2XYPB 3NMAA 4AT1B 3R5JB 3G8SA 1JLGB 1U2CA 4MIBA 1AB8A 1S5ZA 8RUCA 3EPIA 1GMVA 4LF6J 5FLXY 1FJGJ 2UZAA 4NASA 3QO9B 4J9NA 4ERDA 3M7VA 4IQXA 1N34F 1VMBA 3ISND 5KFOA 2KRRA 1XNQF 5J2NA 2CUYA 4KV8A 1XEZA 1WWHA 3D66A 1VJQA 2F40A 2W9BA 4QYZK 1RTDA 1MU2B 2C28A 1WELA 3PR4A 2NUHA 2G13A 4PPDA 2QYCA 2LQJA 2QMUB 1VBYA 2RT3A 2RU3A 3GYNA 2BJ9A 5CYQB 4A8QA 3PEHA 3OL8A 2YKMA 2VG5A 2ZNZA 3MPWA 5J2QB 1YJWS 1F3FA 1UPMB 3FRYA 1RT2A 3R1LA 3CMQA 2FTRA 2BJ8A 4HI2A 4CYUB 1LW2A 4YB1P 3U7JA 1EP4B 1RT6B 2RU9A 2AYBA 1P27B 1JLFB 4P52A 3KG0A 5T7LB 2CKWA 2GGPB 5GAHU 1QSLA 3DOMB 2DB1A 3ZTSA 4OYPA 3D67A 1VRTB 1BWEA 1U25A 1S0NA 3MUTP 3AD8C 1XNRJ 3CDEA 1HA1A 2KJVA 2BR0A 4CDIA 3ICLA 2B43A 2MSSA 2K1RA 2FVPA 4L3NA 3PCOB 4N5SA 3J80U 3SQOP 4LRDA 1JXEA 1N5QA 2W7AA 3GIJA 1X31C 4MMOA 2NPFA 2QL7B 4OZ0A 4P7VA 5H1SV 2OPRA 2PMZD 1HNVB 4ED5A 1Q86T 5ETPA 4ZHRA 4OHZA 2QT7A 4WZQA 3QRPA 1FESA 1D9DA 2D69A 1GTHA 1TFYA 3R3TA 2DK2A 4FF4A 3MMAB 2SXLA 4LR7A 5A6WA 4HDHA 2WVBA 4LBIA 3FFIB 1FA0A 1PBAA 2DGVA 4LRAA 3PO5A 4DPYA 5L1IA 1NZ8A 3A3OB 3NWGA 4RBTA 4EZ6A 3K5PA 1RBOB 2AD9A 1VR6A 1TKXA 4ZJOA 1K44A 3M8WA 1RWWB 5I3QA 3I4HX 4OX9J 1AZSB 2RUGA 3G96A 1N5YB 4M5JA 1LEOA 3BO4A 2VPZB 1HI8A 1WTFA 4JI6F 5I3UA 2IBKA 2MGZB 4J9OA 1KOOA 1NK6A 4DQQA 1YX2A 2P5VA 3A8JA 4G3IA 1QAYA 4YFUA 2CPEA 1RT1B 2PD1A 2XGPA 5EWGA 2E29A 4PEOA 5KG1A 2YXLA 4F36A 3M8QA 5C24B 5CHCB 5F3ZA 2BYCA 3I56S 2KFNA 4UOFA 3MPVA 1RTJB 2YY3A 5KFNA 1U0SA 1NK7A 3QAUA 3UD3P 2Q3PA 3GLJA 2W2QP 2XO7A 2OTJS 3CTRA 2H1YA 2LKZA 1RWUA 4AQYJ 4KGXB 3NGRA 4HT7A 3T3FA 3J81Y 3R5GA 3R97A 4CH7A 2XLJA 4G65A 3DDKA 2GJFA 4DV0F 4EI2A 5KT4A 3DM2B 4O23A 1B0TA 1G1XA 3RAMA 2DVIA 5EWEA 4Q45A 3CO0P 3VQTA 2FLNA 1B7FA 2NYIA 4FBUA 3T9NA 3TNVA 4G1QB 2L9WA 3CEDA 4PXDA 4WXWA 4RW4A 3IRWP 1K1QA 3OXFA 4DR1J 1IM4A 1BQNA 2FUG9 1QAIA 3ZTOA 5HQ8A 3V6DA 1HNWJ 2ZD1B 2HK3A 5DM6Q 3O8WA 2FZCB 4X2BA 2V6AA 2RAQA 4RUAA 4A8MP 3IS9A 4LF4F 5F8IA 2EFNA 2DNNA 4ZPBA 1XK8A 3NCQA 1S0MA 4DV5J 1Q7LB 1P1TA 1Y9OA 2B8PA 1C0TA 5AE2A 3M8RA 2M0GB 4OI4A 1FD2A 4YR0A 5GAEI 1C0UB 1KFSA 1U1LA 2VH7A 2MTLA 4LR9A 3UO0A 2V4JB 3PRDA 3NGUA 2QEXS 5DM7Q 2CNOB 1FKOA 1P9QC 4ZIWA 4FXWA 1YTYA 1E6YB 3POTB 2PI4A 3N6MA 2DBBA 2DHGA 1YJUA 3CD0A 3H2VE 3W60A 3P96A 4UOHA 5THWA 4NA1A 3LF0A 3KKFA 1RHJB 1TU0B 1AA1B 4USHA 3Q22A 1TMMA 4Q0BB 3HDSA 3M05A 4F02A 4DFJA 3NY0A 3R2CJ 2KT2A 4Y6IA 1RYSA 2E7VA 1I51B 5AXNA 2CQ1A 2DIUA 1JLQB 1FRHA 4HT5A 3UDCA 3CMAS 4USMA 1TK8A 2ZEJA 4O4GA 2ILYA 1IBMF 5CA5A 3ZO7A 4JI5J 3T19A 3K89A 2F7VA 3MWBA 1YSJA 2BMBA 1RAIB 4ZP7A 3OLAA 3HO1A 2C2NA 3ZZOA 2GMHA 2ALYB 1FT8A 1NUEA 3Q8SB 2AWZA 4L3KA 3GPAA 4ZPAA 3C14B 1SJFA 4XTTA 3PR5B 3EXCX 3PG9A 3RG6A 3EWGA 5JVGQ 4OMFG 1RWOB 4WKYA 4OHVA 1ZPWX 2FJVA 1N0VC 3SSRA 1L3TA 3NAIA 2HRUA 2F4VJ 2J76E 1NKEA 4Y2CA 5L38A 5D3GA 4V19X 3NL0A 1ZAWA 1GK8A 4HI1A 3GFZA 3FEXB 3RW7A 1YLXA 1ACMB 4ITSA 2YNIB 4B3TF 4BDPA 3Q8PB 2DNZA 3CXCR 4PWWA 3OVSA 4KBIA 3QQCD 4HVZA 1YK9A 2C3MA 2CPIA 2QYGA 4J37A 1Y5LB 2C3PA 2H5EA 5F41A 1S1VB 1SKSA 2OTLS 2AEJA 2LXIA 1K8AT 1EIYB 2BEFA 3BBBA 1OMSA 3PRBA 4CNZA 1KLMB 1KHWA 1NB2A 3GJRB 1JLCB 2F1FA 4ZVGA 4DMZA 2BUNA 4EBEA 3DOLB 2V4QA 2GHVC 4DSLA 5KFRA 3HT3A 5A76A 2HVEA 2B3TB 2OELA 1VQKS 3B54A 3M30B 4K4UA 4CTAB 1HHQA 2D1CA 2YTCA 2W4CA 3FSIA 5KTQA 1EB0A 4J9PA 2DJWA 4C3KA 1XMBA 4ZPWR 4KPCA 3BV8A 4MKYA 1FFWB 5F0UA 2PN6A 4NPOA 1S6PB 2N4DA 4P74A 1B0PA 2F65A 1WKJA 2YWHA 4JV1A 1BQMA 4N8NA 1RU1A 2AJ0A 1T8EA 4UTGA 4ZPVR 1HPZB 3LH2S 1V3RA 3VVUA 4O3OA 5KAKA 1TL1B 4PCQA 4B9VA 1GMUA 5HQLA 1HBUB 2XY6A 3W9IA 1W2BR 3G6ES 1APSA 2H48B 4ED6A 4HHUA 4KYZA 1IQZA 3CCMS 4KH0B 2IBOA 3PHTA 5KG5A 3ILIA 1PSDA 2QRRA 4ZVTB 2KG0A 2PFDA 3TEGA 3QYYA 2VV5A 3KLFA 3IG1B 2VIHA 3DLGB 2JFKA 5ETRA 5D4OA 1XTZA 1WC5A 2BJ3A 1T3OA 4QWBA 5K8OA 3M32B 4MTPA 3C6TB 2J0WA 3JQJA 1XR7A 2Q6CA 1RT4A 1OQ3A 2QLFB 2UVUA 4ZCMA 4GO5X 5DJBA 2LEAA 2ZH4A 4JOUA 2FJAB 2HGMA 2ZOMA 1UJ5A 3UW1A 3QFHA 4OYOA 1FNMA 3VAJA 1FNXH 2BX6A 1U2FA 1LWFA 2KVIA 4KGVB 4KJIA 1WHVA 4JV0A 3BGLA 3BQ2A 2ACMA 2LECA 1QVGR 3C19A 3IR5B 1QVFR 3E01A 1UWBB 5T41A 3GFXA 2RHQB 2VBXA 4FS1A 3T5LA 3LAKA 4DN9A 4N76A 5C42B 2VG7B 2QSWA 5A0YA 3NKYA 1FE4A 4Y3CA 3G2XA 5L39A 4FS2A 1NXIA 2EK1A 3JQMA 5CCLA 2EVZA 3GILA 4UUWA 3KHHA 2BJDA 4EBCA 3Q83A 5A8RB 4ZVQB 5A8WA 1P8GA 5L46A 2Q79A 3L09A 2ROEA 3QGGA 4NRUA 2VA2A 2UU9J 4EYIB 4QWDA 1BHNA 3CDWA 3CJRA
chains in the Genus database with same CATH topology
5D4LA 1DTTA 3CGIA 1KC8T 3HFKA 2KJWA 3LUYA 3US5A 3A1YG 2APOA 1U4BA 4FVMA 1QY7A 3QIPB 1HYSA 3JYTA 2DHAA 3M6UA 4ECYA 1FXLA 3PNIA 1SL0A 3MEDB 3BB5A 2BOPA 2FPHX 2DTJA 3RYLA 2E5HA 3M8SA 4DX8H 3BEGB 2DNKA 3CVKA 3MM9B 2OPQA 2V8DA 2P6SA 3CWJA 4WXOA 5HMZA 3J7YU 1T7PA 4IRDA 2VFSA 1PC4A 3WBZA 1WHXA 4FXDA 1TAUA 2VG6A 4CO1A 2IRXA 3KMSA 4N41A 2HPUA 4K4SA 2CZ4A 4C2MA 4Q2MA 5KG4A 4LF5F 2ZD1A 2E1RA 5E3QA 2B51A 2BBEA 4NCGA 5GMKa 4R0JA 1K9MT 3NP5A 3KK1A 3HZEA 3TAPA 1NK0A 1G6BA 2MPUA 4OI6A 5F8MA 3V6HA 4RX6A 2OIHA 3GV8B 3KG1A 2DNLA 5KFAA 3KK2A 3TVZA 2MQPA 1SB6A 2RMLA 5HMXA 1GXUA 5K9FA 1KQFB 3Q23A 4DUZF 4IRKA 3MAHA 4H4OB 2PMHA 3K5OA 4IH5A 2IM3A 5CYMA 1YRTA 3AA8A 4AFFA 4K4VA 2AYGA 2R7TA 1NAQA 3N6NA 4LVNP 3V81B 2JHEA 3J7ZT 4BS2A 1X7VA 3PKMA 3UE2A 5IFMA 2YNGB 1V3ZA 4RW4B 1QSSA 2IMOA 4B3MF 4YQWA 2HGLA 3LWMA 2NS1B 1X5PA 3LQVA 3OW2R 1C0UA 4TLQA 5F8NA 3VF0B 1BQNB 1DLOA 3B4DA 5A8KB 2JSXA 2CQ3A 3M2RB 3UCUP 1BC6A 4C8NA 3T6BA 1HW9A 2MQQA 3IRXA 2V4JA 2UV8G 2O01C 4ZVEA 1X9WA 3VTIA 1S4FA 2XB2D 2VPYB 3EZ5A 2MSTA 2ATLA 1S6QA 2KHCA 2CQ2A 2GW8A 5G4DA 2RQ4A 3CD5A 3CC2S 4ELUA 2CQPA 5B08A 1NJYA 1H2TZ 4Q43A 2B5JA 1LKZA 5CD4H 1S9EA 3IS9B 1HW8A 5E41A 3RBDA 1JLAA 1KSPA 2IMWP 2CPYA 1E6YA 3POTA 5KFFA 3GG1A 1NK5A 5AE3A 1KQSR 2OPPA 5B0CA 3CULA 2KXNB 3S1TA 3I96A 2WAQD 3CJ2A 2ZJPQ 3BGFA 3QZ8A 3DLLQ 2Y0SD 3VZHA 3DMJA 3PW0A 2ZH2A 3L7PA 1YIJS 1J5OA 4DLEA 2VFRA 4RW6A 2JOQA 2V2KA 2J0XA 1HNIB 3AHPA 1ELOA 4KFBA 4YHHF 2RRBA 4F25A 2D3ZA 3BQ1A 1GX6A 1U8SA 3F41A 5LJ5Y 2ASJA 3L7OA 4C0BA 1JLBB 3TAMB 2PA8D 2QV6A 4OX7A 3CCVS 2UU9F 3HVTB 3PJXA 4Q0BA 5LMNF 1FHTA 2UUBF 1FDBA 3QMQA 2LU2A 3P5TL 2Y1RI 3N5BA 4IG3A 4OV1A 1XR6A 2DR9A 5DG8A 4UUXA 3CE8A 1TK0A 4QYRA 1NU4A 1ZBTA 3MMBB 3RRGA 1H3DA 4Y2KA 4K4ZA 2GHWA 2JVOA 3CF5Q 1FKOB 2A18A 2RF2A 4MIAA 5F9NA 4Y00A 4URSA 3M8PB 1YJVA 1IKYA 3MM5A 2JLGA 1H2UX 3MEEA 4TY8B 2XULA 1HBOA 3T6JA 3IR6B 2MKKA 3M1VA 3H25A 3ISNC 1S77D 1TAQA 2B56A 4OFZA 3KLGA 2Q6BA 1VQYA 3U1LA 4OX6A 4DR1F 1QUPA 3KHRA 2R9LA 3CC7S 4C98A 4PG5A 4JI2F 4WCEQ 3MR6A 1XR5A 2V4RA 4IFVA 5BYRA 1FJCA 4JI4F 1JNRB 1ZZNA 4YP3A 1WF2A 3ETOA 4M8LA 2O66A 5SUHA 4C8YA 4C3LA 1S1TB 1FD8A 3CMES 2HMIB 2ZDOA 2CJQA 1YJRA 4RBUA 2L9DA 2K3IA 2LXFA 3MPYA 1LWCB 3DYAA 3HM9A 4J9RA 2D3OR 2AGOA 4DL2A 1T03B 3NMRA 2HW3A 4DUYF 1IJFB 1RQ0A 1RAJA 3LP2B 5KFDA 2OH2A 3NBPA 3DLEA 3V4IB 3KLEB 2KB2A 5DDRC 1SL1A 2Q66A 3NS5A 1IQTA 3H20A 3MEKA 4C11A 1Y3JA 2JVRA 2XC9A 5KFKA 3OTBA 4A8KA 3OL7A 1R0AA 2G4BA 1U1KA 3OR2B 5FDLA 2GQ2A 1WF1A 4ECRA 4CO4A 3PDNA 1JLGA 2BDPA 1H98A 2FVCA 3VAIA 2EBGA 4B9NA 4F4WA 1C1BB 3OHAA 5U47A 3HXMA 4I69A 2QE5A 2J7UA 4H54A 5F9LA 1NJWA 3DC2A 2GIRA 3KJVA 4DN0A 5J2PB 4O44B 1S1UB 2N3OA 4NCBA 2RQMA 4LIRA 3LW5C 4FXVA 2JX2A 2HFOA 3QO9A 3L95X 1K73T 3QJJA 1S9FA 2J9CA 1TKDA 2DITA 3CD6S 1UJ4A 1RTIA 4WE1A 4MK7A 4DG1B 2GC8A 3NAHA 3V6JA 4O4GB 3EGZA 2KYXA 1VHFA 1R31A 4Y2AA 4N56A 3MURP 3J7A1 1WEXA 2O67A 1LFWA 2K7KA 4A47A 2ZH6A 2O5DA 2LLZA 1IKWA 4R25A 2BM0A 2VL1A 1N88A 5JXSA 1Q81T 2UVRA 2RS8A 2B9XA 4WU2A 3VAHA 3V6KA 2QA2A 2G9OA 4F4ZA 3DLHA 1QE1B 2V9KA 2HHTA 2BZ2A 2ZITA 3OFGA 2KDOA 1TZ0A 5D4PA 1AUDA 4R5PB 1LWEA 3SFGA 1UEVA 2DGQA 1HWUA 2MZSA 3KMQA 1MU2A 4RLEA 1Z2ZA 3PJWA 3ZZYA 1U1OA 1TVRB 3PIOQ 1Y5NB 2QLWA 1HD1A 2AGPA 3OV7A 1S79A 1AFJA 2AYMA 2DPIA 2YNIA 4M63A 4DR2F 3Q24A 2HWTA 3AA9A 1GH8A 3FEYB 3OVAA 1TK5A 1S1XA 1M90T 1OWXA 3MECB 5MLCV 2WB4A 3W2VA 2IVYA 1ZH5A 1ZOTA 4QYZJ 3M9NB 1HR0F 1NKCA 3E8OA 4LSLB 3SSQA 3MM7A 2R4FA 2DGOA 3C3LA 1NHUA 2OJ3A 1HNXF 3VWSA 3DLKA 2UVWA 4DR6F 3GR1A 3NRBA 1CC7A 4DS5A 1SKWA 1VQ6S 3D0IE 4C8MA 2YX4A 2R8HA 3BR8A 3KLHB 4DBQA 2GJ2A 3LPYA 1DRZA 2HFZA 4LF7F 1S1VA 4J9SA 3PX6A 2LEBA 3GE9A 5B09A 2HNZB 3PO4A 4CNYA 1YGYA 1FVSA 1OSDA 2W7OA 4B9SA 2AGQA 5D3GB 1K1SA 4X4PA 1KLMA 1YHQS 5FIIA 4K4WA 3JSMA 3QPIA 1RTDB 3BZQA 1EP4A 2CYYA 3MUMP 4LFAF 2X51A 3UCGA 4QZVB 1RT6A 2MY8A 1Q7YT 3R27A 4OL8A 4OJ3A 1TV6A 3NLCA 2R7OA 2XSFA 3HHLC 4NLUA 3B78A 5K14A 3VAGA 5J2MA 4DPOA 4MFBA 4QWCA 5T7LA 3CC4S 3CPWR 1C4CA 2XMTA 3MR2A 1UETA 5KFJA 2U1AA 1R3NA 3I82A 4QR0A 1N32F 2VA3A 2OMOA 2HS3A 2CQ4A 3P49B 1R8AA 4LQ9A 3U1MA 3U02A 2LEPA 1J5OB 1AW0A 1U24A 5IQ6A 1MROB 2LU1A 4N77A 4CTAA 1CQNA 1RP5A 2BABA 1FKPA 3P3DA 4JI7F 2X1GA 1H6KX 2UXDF 2BACA 4BBYA 4C8OA 1U09A 4E0DA 3KNAA 1HARA 5E2QA 2C42A 2I38A 3LP1A 4PUOB 5H9EJ 4ZP6A 1BGXT 1F9FA 3TX8A 1URNA 1M5SA 2XBPA 2DHXA 2HQ3A 2J7KA 3LGMA 4IFYA 2UXBF 1D0EA 4JI3F 5D78A 4F3OA 2XY7A 2IA0A 3N0VA 1S0VA 2OPSB 3I87A 5GAGI 1YG0A 5B0FA 3I0SB 4NRTA 1NJIT 4RNHA 4DSFA 2ZDPA 2KTQA 4ZOSA 1RT7B 2HWIA 2KM8B 4I7FB 2ZHOA 3I32A 4FP9A 1NK4A 4ELTA 4YB6A 3MM8B 1FRJA 1S10A 3ZZPA 3G6XA 5DDOC 4URGA 3PFEA 2Z0GA 3D1QA 1H0HB 3BREA 3C6UA 2VC1A 3NCRA 3DRYA 5KG2A 4DF4A 2CVIA 2HHPA 2I5JB 3BN4A 3PFOA 4OZJA 3THPA 3H5XA 2HNDB 1U1PA 4WF9Q 1V9OA 4MK8A 1XMQF 4G6VB 4JI8F 2A10A 3JTOA 2XWXA 2GO9A 1NZAA 4C0HA 2RJZA 3HF5A 4EUVA 2DR5A 2NQPA 4ZK7M 3Q2SC 1RTHB 2GA7A 3M4XA 2B7CB 6FD1A 3F44A 4DR3F 3V5RA 1DZ5A 2EPIA 1A9NB 1CG2A 5KG6A 3D0GE 4QIFA 5BR8F 1FTRA 3M2UA 4M5DB 3SMZA 4DFKA 1S76D 3UI3A 2D7SA 2FJWA 4KTQA 3DU6A 1K0TA 2I0XA 4LT6A 5LMUF 4FN5A 4LF8F 4TNOA 2K1RB 1H7XA 3AQOA 5F8HA 4R8UB 2DT9A 1UVLA 3MMAA 4MAKA 3RRKA 5H9FJ 2PIIA 1P6TA 3FNNA 3EX7B 1GXTA 2XMKA 1R8HA 3OPKA 4NLOA 2VUGA 4OHWA 3DOKA 2GJIA 3OR1A 1BQMB 1ZTTA 3DNCA 3HHEA 1WD6A 2JLEA 1JJ2R 2ZE2B 4KHRA 3M9MB 2NSCA 1URRA 4ETZA 4TY9A 3DXSX 1LQ9A 1D9FA 3IG1A 3LANA 4IG0B 2KXHA 4GKKF 1HWLA 1TL5A 2GV1A 1VRUA 2K7JA 2HFNA 3FFIA 4UY8T 1S9GA 1SV5A 2ACYA 2QA1A 3IGNA 1HQEB 1B0VA 3MTJA 1KTVA 4FBTA 4A8OA 2PA3A 5IXUA 3GB0A 3T1AA 3M2VA 2CQCA 4ECUA 2KG1A 4K4XA 1MSWD 1RT3B 4C8KA 1KNZA 1KOHA 1VOMA 3C66A 3VZIA 2F8EX 2WONB 4NLTA 1WG1A 4NLXA 2DRBA 2CPHA 4ZS6A 2QFJA 1C1CB 5GVQA 3TA1A 3WC2A 1U1QA 5HP1A 4B3OB 3SCIE 4NX9A 4C3MA 2JL9A 4U6PA 4XIUA 3IWNC 3DI6A 5L9XA 4WFZA 4FVCA 3M9OB 2R2SA 2ADCA 1UFLA 4A46A 4F4KA 3H5UA 3LWLA 1VQ5S 2R7RA 1N5YA 2R8IA 2XS7A 2JDJA 4LF9F 1Q79A 1WACA 3HHLB 4Y28C 1IBLF 1X9MA 2GFFA 4EO6A 3CIZA 3AQPA 4GKJF 3MMJA 2Y1JA 1Q53A 3TA0A 1LW0B 4HH0A 2MGZA 2BA9A 3SV4A 2ASDA 4NLYA 2LXUA 3PM9A 1NNDA 2K2PA 3SI8A 4P7TA 2AX1A 3I0RA 2DNYA 4HLBA 3TI0A 1S6OA 1LXJA 5BYSA 4QIWD 1SC6A 3K57A 1HWJA 2MKIA 3KLFB 2XNRA 3HI9A 4DQSA 4DLGA 4ECSA 2LVWA 5I42B 2CJ9A 3OL6A 2ASLA 2IAJB 2FC8A 4CT9A 1ZM9A 6FDRA 3BJYA 4YR3A 1RT1A 2NLWA 2R7QA 3CT9A 4A8FA 2J8AA 1RT5B 4TKTA 2Q1LA 3UPFA 1VBZA 2C3YA 3BS9A 5DGBA 1IJEB 2UUTA 1KQKA 5DQGA 2B0GA 2YKNA 2VZ9A 2UP1A 2KHDA 2I2YA 1UVMA 2LMIA 4LUBA 3VQSA 2ZBCA 4YY3F 5D6GA 4Y0FA 2RKIA 2VKRA 3O2IA 3K5LA 4EO8A 4KHPF 2MQMA 2RQKA 4ECWA 2DGSA 2Y1IA 5C25A 2OAUA 4IDKB 4NLDA 3HVRA 4C8LA 3J7YI 3CJKB 1GXLA 4HYKA 1XERA 4ECZA 5C24A 1N56A 1JB0C 1RT4B 5EWFA 1WHYA 4OHYA 4G1IA 1FDDA 3SCJE 3O44A 1N6QA 2BW2A 4RWWA 1F60B 2N82B 3CUNA 1G7CB 2E5JA 1RTJA 2YNFB 4WZMA 2HZCA 3QLHA 1TL4A 2MKJA 2X1BA 4QCLA 2EKYA 5HBMB 2MKHA 4NZ0A 1U1MA 2VG7A 5IT9Y 3KLIB 1JKHA 2VODA 4DSIA 2JJ4D 3BGRB 1KR4A 2MYFA 4Q7AA 2JWNA 1I6JA 1LK7A 1L5UA 2HHSA 3HLUA 4BCAA 4X4RA 4B9MA 4X4UA 1KFDA 4DL3A 2C22A 1HBNA 1ZM4A 3CCJS 3DHXA 3JTNA 4EU0A 3M6WA 1DQ9A 3W7BA 5J1EB 3OTOF 4FF1A 1HL6A 1N33F 1FEHA 5L1KA 4GC6A 2YH1A 3O5TB 3GQCA 1T05A 1YITS 1TKZA 2KN4A 3CO9A 4IOBA 4ECTA 4WK1A 2FHMA 2J6UA 4WU3A 4K59A 3SQGB 5IS2A 4IR1A 3TW0A 1C4AA 3O3LA 5A8RA 2B4VA 5EN1A 3OVBA 2M2BA 5E3PA 5E7OB 4OJ1A 2LDYA 1X4CA 3PZPA 2MJUA 3E01B 5B0GA 1FJEB 2IRUA 3HPOA 2DR7A 2XMVA 3DM2A 5IM0B 3ZC4A 3BN7A 3OUYB 2CQBA 5E33A 2BANB 1UA1A 2OMLA 3GSDA 3TAQA 4NCAA 3D1OA 3MM6B 4AL5A 4ECVA 3K8VA 3TP2A 2CDQA 4Y2MA 3TR5A 2R8KA 2V8VA 2OD6A 1HBMB 3H4DA 1NKBA 4KPYA 2KZMA 3QGPA 2V5HG 3OFHA 4ETXA 1SUQB 2UV8A 3X3UA 5K8NA 2ZM6F 3G71S 3HJFA 2QIFA 2P9EA 2QLXA 2HNYB 5KFSA 4FYDA 4G1QA 3MEDA 1CQMA 1DQAA 5KT6A 3D2WA 1VC0A 3SV3A 1HQUB 3MM9A 1SH0A 1NJZA 3LO3A 4ZPDA 2COLA 3IC1A 1H38A 4LJMA 3HK2A 3F56A 4YDDB 3J7Z5 1FF2A 3KNGA 5CXTA 4RNFA 2WHOA 3IWXA 2ZJRQ 1X5OA 2DO4A 4LIWA 3FZBA 3QGHA 4ED7A 5J1NA 3N01A 2HS4A 2A2CA 2OD4A 1DAXA 3PIPQ 5E3CA 4NZ7A 4BWJA 2YWFA 3GV7B 2HG4A 3FMWA 4PWDB 2KO1A 3MF5A 1FXRA 3MOJB 3RB6A 1HMVA 1UP1A 2NSBA 3KHLA 1L3UA 1D3WA 4ZMMA 1FXDA 3BSOA 3LP0A 3NG8A 3N6LA 2FGCA 2W8KA 1D8ZA 4LSNA 5F0WA 3MMCB 4ATNA 2FIUA 4CH1A 1RYRA 1IKVA 1SBRA 2WRMA 4OQJA 2E5GA 3V81A 4JYAF 4KHMA 2MZTA 2HLUA 4A48A 3T5KA 1WHWA 2ZUGA 2ERRA 2FVRA 2H9ZA 4F4YA 3E3XA 1DTTB 3RR7A 1VQOS 2GMJA 1UVNA 5K8PA 2IRYA 4MIWA 1HYSB 3JYTB 3NS6A 4MKBA 2O1PA 2MJNA 5KOWA 2OLWA 5A8KA 2DRAA 2IM0A 5LSOA 3M2RA 4UQTA 3DFEA 2OPQB 4MYUA 1Y3KA 3K59A 4A8SA 4CO2A 2EG2A 2BJEA 4BHQA 2VG6B 4Y2IA 2KZZA 4I2QB 4NLSA 2WBRA 1YI2S 5EUHA 2C3OA 5DETA 4NCGB 3FEZA 2YKQA 4X4SA 4KC5A 4DL0C 1U48A 3QJPA 4Q2LA 1I1GA 2ASYA 3ZZTA 5IWAF 2XNQA 1UW4A 1GT8A 2E1AA 1JX4A 5KT2A 2JH3A 4WFNQ 4HDGA 4QJVA 2BQUA 1KQGB 1VQ8S 3V6DB 1J2VA 2A3JA 4EGLA