5FDLB

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with idx899
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
422
structure length
396
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords P51 Reverse transcriptase
publication title Discovery of the Aryl-phospho-indole IDX899, a Highly Potent Anti-HIV Non-nucleoside Reverse Transcriptase Inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 106
structure length 396
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5fdlB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlB03
1S1VB 3MFIA 4Y2CA 1RTIB 3DYAB 3E01B 4Y3CA 4KSEB 1IKVB 2OPRA 1NNDA 1TL1B 4FS1A 5KFOA 2IC3A 2BANB 3CIZA 3H2LA 4QWCA 2OPPA 1S1XB 3FDSA 3MEDB 4I2QA 5HLFA 4ZHRA 4WFXA 4Y2AA 1LWCA 1RT7A 1RT1A 5KFAA 4IKAA 4IFYB 4TY9A 1R0AB 4J9PA 5D3GB 4WFZA 2AX1A 3NAHA 5KFCA 5KFLA 1FKPB 4GC7A 3SI8A 1KLMA 2ILZA 2HNDB 4I2PA 4KB7A 5K14B 4NZ0A 4WYLA 1S0NA 3PJWA 3LALA 4J9SA 5I42B 2FJVA 4Q43A 3BSOA 5C5JA 3HVTB 4ECVA 1HQEA 5J2QB 2AGPA 1C0UB 2JEFA 3H5XA 5JUMA 3CJ0A 2RKIA 2JEGA 4ZPBA 3OLBA 4ICLB 3PW0A 5KFUA 3GV7B 3G6VA 3OHAA 1BQMA 4MK7A 1S1TB 1RT5B 4PQUA 2WONB 4KFBB 3MR5A 1S0OA 1RTHB 1MU2A 2I5JA 5KT5A 4O3RA 4FBUA 1LW0A 2JEIA 4G3IA 4RW4A 1TKZB 3MECB 4MH8A 4M94A 2D41A 3DLKB 5DGBA 2UUTA 1HYSA 3LAMA 4IH7A 4QPXA 5C42B 2XWYA 3FFIB 4O4RA 3M9MB 1TKTA 3DLEB 3KLHB 3GIJA 4DL3A 4NLQA 1RTIA 3DYAA 4TN2A 4ZVHA 2W7OA 1IKVA 3CO9A 4LSLB 3QGHA 3CDEA 2BANA 5KFRA 5FDLB 3OHBA 4LSNA 1JLCB 1S1XA 3IRXA 1HNVB 4KV8B 3MEDA 4IDKB 4ECTA 2JLEA 4ED7A 5KG0A 1RT6A 1S9EB 1TV6B 4NLTA 5HP1B 1S1WB 3DLGA 3NBPA 2VG5A 4IFYA 4F4XA 4U6PA 5D3GA 2HNZB 1FKPA 3GIKA 3H4BA 3DMJB 3MEGB 2HNDA 3T5KA 3H5SA 3G6XA 5KFMA 1UWBB 4ZPCA 3BQ0A 4O44B 3TAMA 5I42A 2IM2A 3HVTA 5F8GA 2FVRA 3DRPB 3EPIA 3IS9B 3T5LA 2R8GA 4NCGB 3CJ3A 4YMEA 2UVVA 5KT7A 4RW6B 3CDUA 3MTKA 4ICLA 2XC9A 4ED2A 4J9LA 2XCPA 1N56A 2AU0A 1T94A 1S1TA 1RT5A 2CJQA 2WONA 4KFBA 5DGAA 2ALZA 4NLDA 1QUVA 1RTHA 2VA2A 3OSNA 2J6UA 4DL7A 4RW8A 2HAIA 2VG7B 1S6PB 4URQU 4ZVEA 1S9FA 3BSCA 4G1QB 3DLKA 5KG3A 3PZPA 2OPPB 4RNMA 1OS5A 4I2QB 5HLFB 1KHVA 3H59A 5KG4A 2JEJA 4NLRA 4IQXA 5DQHA 3FFIA 1LWEA 1JX4A 3DLEA 4QW8A 1RT1B 3JSMB 5J2PB 2ZE2B 2XI2A 4MK9A 2J6SA 3DRSA 3IG1B 5C24B 4O3NA 2E9RX 3CJ5A 4NLGA 1S97A 3PR4A 1KLMB 1HNVA 2R2UA 3V4IB 4IDKA 4ZP9A 4RUAA 4J9MA 3OL9A 3FSIA 1S6QA 1S9EA 3BJYA 2DPIA 3I0SB 2C22A 5HP1A 3LP0A 1W25A 1S1WA 3OL8A 4EBEA 2HNZA 1JLGA 1NHVA 4IG3B 4K4TA 3DMJA 3MF5A 3QZ7A 4J9NA 5F8NA 5KT2A 2W9AA 1BQMB 1UWBA 3IGNA 5KFKA 3I5AA 3T19A 1MU2B 2I5JB 4O3QA 1TP7A 4Q45A 4YR2A 5DQGA 3MEEB 4KO0B 3DRPA 5J1EB 3DI6B 3HKWA 1ZTTA 2DPJA 1RA6A 1KHWA 1SH2A 4MIBA 1HYSB 3OL6A 3RB3A 3I5BA 4K4WA 1TKTB 3GV8B 3KMSA 5KG1A 4ECRA 5DG8A 3H4DA 1U09A 4ECSA 4H4MB 4KKOB 2VG7A 1S6PA 3DDKA 4QWBA 3V6KA 4NLPA 5DLFA 3LAKA 2ASLA 1S0MA 4G1QA 3UQSA 1RYRA 5EDWA 4I7FA 4LSNB 3RAXA 3IRXB 3KOAA 4ECQA 5KT6A 3BQ2A 3QGGA 1RT6B 2YNHB 4R5PB 5KFYA 4NRUA 1IKYB 1IKWA 1RT4B 4EBDA 3QLHB 2R8KA 2EC0A 4KHRA 2VG6B 3JSMA 2UVWA 5J2PA 2ZE2A 2R2RA 3OL7A 3DLGB 3IG1A 3NBPB 2VG5B 5C24A 1T03B 2GIQA 2BRLA 1RT2B 1HQUA 2QV6A 2BQRA 4ID5B 1N5YA 5KG2A 5L1JA 5F8JA 5I3UB 3G86A 4K4UA 3LANA 3V4IA 3QYYA 1IKXA 2HNYB 2GC8A 4URGA 1ZTWA 2YKMB 4ED8A 3C6UB 4MFBA 3KLGA 3I0SA 5T14A 3TAMB 3KLFB 2XCAA 5CYMA 2FLPA 2IJNA 4KE5A 2W9BA 4ECZA 3Q8PB 2FVSA 3KLIB 4ECXA 4DG1B 4IG3A 1JLQB 3C6TB 2RF2B 2D7SA 2FLNA 2QE5A 2YKNB 4ZVGA 2ASDA 2C2EA 5F9LA 1TVRB 4RW8B 3V6HA 3MEEA 4KO0A 3H5YA 5J1EA 3DI6A 2IM1A 4DL6A 3NMAA 4EEYA 2ILYA 1HARA 4M95A 5F8LA 4K4ZA 1JXLA 1LWEB 1HMVB 5C25A 4XPCA 3DRRB 3E51A 4PWDB 1RDRA 4RUCA 3DRSB 1TKXB 4H4MA 2FVQA 4KKOA 3CJ2A 2IM3A 4YR0A 4ED1A 3JYTB 4ED3A 1Z4UA 1HPZA 2B43A 4Q44A 4HKQA 2W9CA 4RW9A 4IH6A 1T05B 1QAJA 2YNHA 4R5PA 1S6QB 1IKYA 1RT4A 3QIDA 3QLHA 3UR0A 5KFSA 1RYSA 2VG6A 2ZD1A 5DG7A 3QGIA 3LP0B 4DL4A 2OH2A 1T03A 3NKYA 1SV5B 1RT2A 2BE2A 4ID5A 3DM2B 1JLGB 5I3UA 4ZP8A 1K1SA 3RBDA 4QWEA 4WZQA 1VRUB 2HNYA 3M9OB 5F9NA 2YKMA 2WOMA 3C6UA 1N6QB 4F4YA 5EWFA 3M8PA 3KLFA 3RB4A 1SUQA 4NLOA 4Q8EA 2R8HA 1CSJA 4NLVA 2WHOA 3KLIA 5KT4A 4DG1A 3SFGA 1JLQA 3C6TA 3G6YA 2RF2A 5J2NB 5EWGA 3RB6A 2YKNA 2UUWA 5KFIA 3RBEA 3KHRA 4RZRA 4K4VA 2AWZA 4IRCA 1NHUA 1TVRA 4RW7A 3CJ4A 2B5JA 1IM4A 4F4WA 5L1KA 4NLSA 4IG0A 4I7FB 3MR3A 2IAJB 3PW5A 4O4GA 1DTQA 1TL3B 3HVWA 1IKWB 1HMVA 2RDIA 5JXSA 3DRRA 2HWIA 4PWDA 5KFGA 1TKXA 1HQUB 3KLVA 4TQSA 3JYTA 4IFVB 1N5YB 1QAIA 4JUZA 3TVKA 3ICLA 4J9KA 4NRTA 3H98A 4ZVFA 4ED6A 1IKXB 3BGRB 2D3UA 5L9XA 5KFZA 3Q8RB 5HBMB 1T05A 3MFHA 1S49A 5J2MA 4MFBB 3KLGB 4RNFA 4NLYA 5CYMB 1SV5A 4MKAA 2W9BB 2D3ZA 1REVA 3DM2A 4NYZA 4Q8FA 4OL8A 1VRUA 2JC0A 2R8JA 4Q0BA 5L1LA 2BQUA 1FKOB 3OSPA 2YNGB 1N6QA 3N6MA 2OPSB 1YVFA 3HVAA 4F4ZA 4KAIA 3V6JA 4URSA 4EO8A 2W8LA 3N6LA 5EWEA 5KFTA 2HWHA 3RB0A 3KNAA 1D0EA 4IRKA 5J2NA 4JV0A 3BSNA 2WTFA 3KHHA 5KFBA 5C25B 5KG6A 3UDLA 4IR9A 3QO9B 3PR5B 3KHLA 3I0RA 4TY8B 4H4OA 4YP3A 1SH0A 3GIIA 4O3PA 1T3NA 1GX6A 1S48A 4KHMA 4WZMA 5EUHA 4R0EA 1HPZB 3ISNC 5DLGA 3NGDA 2IAJA 1D1UA 3GV5B 1J5OB 5KFFA 4RW9B 1RAJA 3M9NB 1TL3A 3M8QB 3MR2A 2W9CB 2J6TA 2V0NA 2HMIB 2ZD1B 3DOLB 3MR6A 3Q8QB 3KK2B 3EZUA 3KHGA 1LWFB 2BE2B 1EP4A 3LP1B 2YNFA 4IFVA 4R8UA 3V81B 4LQ3A 3BREA 1C0TA 1I6JA 5KFXA 4RU9A 2B6AA 3PW7A 3BGRA 1BQNB 4WE1B 3T5HA 1C1CA 2WOMB 5CYQA 3M8PB 1JLAB 1SUQB 5KFDA 5HROA 3QIPA 3GILA 2ATLA 2WK4A 5KFNA 4H54A 2I1RA 3KK1B 2V9WA 2WCXA 2R8IA 2UVRA 2OPQB 1FKOA 4O3OA 2YNGA 2C2DA 2BR0A 4GC6A 3KMQA 4PUOA 3KK3A 2OPSA 4K4XA 5L1IA 4RW7B 3PW4A 2B5JB 2ASJA 5KFPA 2WRMA 4IG0B 4YQWA 4F50A 5KFWA 2AGQA 4B3OB 2V4QA 4O4GB 3UPFA 1DTQB 1WNEA 4TLRA 4EO6A 5DG9A 4NLXA 1QE1B 3V6DA 1S10A 3QO9A 3KLEB 1JLBB 2R2SA 3BSAA 4TY8A 3CDWA 2YNIB 1JKHA 2BRKA 2RDJA 1JLFA 1RTDB 1DLOB 1J5OA 3IGVA 3M8QA 4MIAA 2IMWP 3I5CA 1XR7A 4EYIB 5J2MB 2HMIA 3DOLA 3BQ1A 3KK2A 2W7PA 3DOKB 4TXSA 1LWFA 1LW2B 3LP1A 4X2BA 4EBCA 1REVB 4K50A 3V81A 5HBMA 2E9ZA 3KJVB 2BQ3A 5KG7A 1S1VA 3FRZA 1BQNA 4WE1A 4Q0BB 3H5UA 3E01A 4TYBA 1FK9B 1ZETA 4ZP7A 2XI3A 2AGOA 2VA3A 1HNIB 1JLEB 1TL1A 1JLAA 4XO0A 3D28A 4QWDA 2UVUA 1JIHA 4WYWA 1EETB 4QWAA 3QZ8A 2AX0A 2WB4A 3Q8SB 5F8HA 4FBTA 1DTTB 2IBKA 3NL0A 3KK1A 2R2TA 1S1UB 5F8IA 4LQ9A 2OPQA 4NLWA 3ITHB 3GQCA 4ZPAA 3I0RB 4H4OB 1R0AA 3LP2B 2FJXA 4K4SA 2O5DA 5KT3A 1VRTB 4DL5A 3CWJA 4DL2A 4ED0A 2XGPA 5K14A 2FVPA 1RTJB 2C2RA 5KFJA 3T1AA 4B3OA 4ECUA 3PVXA 4MK8A 4Y34A 4WXOA 3NAIA 1S9GB 1QE1A 2F8EX 1TQLA 3KLEA 5J2QA 1C0UA 1JLBA 2CKWA 2IJFA 3N6NA 1K1QA 3D5MA 1EP4B 2YNIA 2YNFB 4R8UB 3PW2A 1SH3A 1C0TB 1RT3B 1C1BB 4TYAA 1RTDA 2B6AB 1N48A 3FQLA 1DLOA 1XR5A 5KFEA 5KG5A 3EPGA 1C1CB 2E9TA 3VQSA 2OPRB 1GX5A 5CYQB 3PHEA 4WFYA 2GIRA 2IC3B 3QIPB 1TKZA 3MECA 3DOKA 5HROB 4EYHB 3HHKA 1LW2A 1MMLA 4IH5A 4ZMMA 2FJWA 4ZHRB 4KBIA 4RNHA 2AQ4A 5KFQA 4JV1A 1LWCB 5C42A 3KJVA 3IN5A 3KLHA 1RT7B 4MKBA 3FQKA 4IRDA 1FK9A 5KFHA 1S4FA 3OLAA 1HNIA 1JLEA 4LSLA 3KK3B 4PUOB 3GYNA 4IOBA 2W8KA 2FLLA 1EETA 5FDLA 3H40A 1JLCA 4KV8A 1DTTA 4I2PB 1C2PA 4NLUA 4WXWA 5DQIA 1S1UA 2FVCA 4RNOA 4YR3A 3T5JA 1TV6A 2V4RA 3V6DB 3ITHA 4J9RA 2C28A 2IM0A 4HYKA 1HQEB 3RAQA 3BR9A 4ECWA 4ZP6A 3GIMA 3LP2A 1XR6A 3CVKA 2RKIB 1JKHB 1VRTA 3MEGA 4ECYA 4O3SA 1RA7A 2XGQA 4J9OA 1JLFB 2JC1A 1RTJA 2IA6A 2ZKUA 4PQUB 4FS2A 1N4LA 5KFVA 4O44A 4DEZA 4QW9A 1S9GA 4JV2A 1LW0B 3SFUA 3TQ1A 4RW4B 4ZPDA 3ISND 3IS9A 4XPEA 4K4YA 4NCGA 4J9QA 4U7CA 4TQRA 4RW6A 4RNNA 1RT3A 4IR1A 1C1BA 5F8MA 3PJXA
chains in the Genus database with same CATH superfamily
5G0RB 4X84A 2W01A 4KSEB 3FDSA 8AT1B 4HL9A 3ZZYA 5D3GB 3PACA 2EFQA 4CLYA 4I2PA 2DR5A 2ZH9A 3H90A 2AGPA 2BOPA 2UUBJ 2FC8A 1U25A 4LMZA 3OLBA 3PW0A 1X4GA 1ZA2B 1S0OA 1X8DA 5GADU 1MU2A 4A8WA 5A6WA 2UUTA 3AJ1A 5JMNA 1KOHA 3DLEB 3DYAA 3J7YU 3CO9A 4ECTA 1OY9A 4ANEA 1JJCB 3D1HA 4LF9J 1VQPS 1K73T 3D0HE 5HO4A 4DR2J 4ZPCA 4B3TF 1RAGB 2FZGB 5A8WB 3IS9B 4M5MA 2CZVC 3D1QA 4EU0A 2OEKA 4A8YA 4ZVRB 5IV3A 3D6HB 1NKCA 1HNXF 1YITS 4IDKA 3PRVA 3UD5A 2PE8A 3FCHA 3OL8A 3BZQA 3LWLA 2EG2A 4YHHJ 3DMJA 4J9NA 5F8NA 2DNNA 2KFYA 2IVFB 2VOPA 3T19A 1MU2B 3H7HB 1PYTA 3DI6B 1RHMB 1RA6A 3SEOA 5DRKA 3EZOA 4P75A 4FXWA 5DG8A 3V6KA 4NLPA 3OR1B 5G4DA 2MGZA 2ZBRA 4NRUA 1GMVA 4ZVUB 3N5BA 1HWIA 2DNGA 2CNNB 5CZXA 1FTRA 2MKCA 2V4JA 5E33A 2W9BA 5C7PA 2XM3A 4MKVA 3VGSA 1HHTP 4ZCIA 2ASDA 2JVOA 3U1LA 1O51A 3OJUA 4J9VA 1RDRA 3NWGA 4S0MA 3D9BA 1XN9A 4RUBA 2N4CA 4IH6A 1BQXA 1IKYA 3K0JA 1FRJA 2L48A 3QGIA 1MG7A 5GVQA 2RRBA 1VRUB 4UZCA 3HD2A 3C6UA 5EWFA 3R6GB 2I38A 2WHOA 5EWGA 2GJIA 3KHRA 2OSQA 2XMAA 3Q8UA 1M5PC 4CZCA 2BYCA 4DJBA 1LFWA 4OYBA 1FJEB 4DQSA 1FD2A 2D3UA 1J2VA 5K9FA 2CZ4A 2ZUGA 2V4JB 2XMJA 3PXGa 2W9BB 5IT4A 3ONQA 2BE7D 3HVAA 2XWXA 3V6JA 2ZH5A 2OKQA 5LSLA 5HMWA 2HW3A 2VPZB 1SH0A 1YJWS 1GX6A 3TP2A 3RAMA 3MR2A 5A0YB 4DV0J 1M0SA 4L3KA 3EZ5A 2X3GA 3KHGA 5B0FA 3V81B 1KBRA 4JYAF 1S6UA 1XWLA 2VB6A 2WK4A 5KOWA 2VICA 3GLJA 1PBUA 1AFIA 1N36F 2NPIA 3OTBA 4FP9A 2KVQE 3W8PA 2KT5A 3R5DA 1X5SA 3IWXA 2G1DA 5A8KA 4MIAA 5DDPC 3I31A 2RQ4A 3CCZA 5D4LA 4DSEA 4TXSA 1YIJS 3KG1A 1FA0A 5KG7A 4P71A 4ZCKA 2ACYA 4HH1A 3OVBA 2HRYA 4NI2A 1FXRA 4ELUA 4M5NA 3G82B 1KVKA 4LF8F 4K0KF 3TOQA 4X62J 5IWAJ 1TL5A 1F60B 4Y34A 2KHDA 1QLNA 2J7UA 2I2YA 1AB8A 2YNIA 4DV6F 1EQMA 2K7KA 1N48A 2M8DB 3BH6B 2HHVA 1N0VC 3QNWB 3PHEA 2X1GA 3MECA 4N7TA 1CJVA 4M5JA 3IN5A 5BYSA 4U7UD 4WIIA 1HNIA 2W8KA 2VQEF 5DQIA 1C2PA 2LQBA 3F41A 1S1UA 2FVCA 4YOEA 2C3MA 3G8QA 5LXRA 3CVKA 5LOQA 4O3SA 3D2WA 1Y3JA 1RTJA 2RRNA 3HK2A 1GK8A 2DD8S 3B82A 4QCLA 3ISND 1UEVA 4R25A 4TQRA 3EYZA 3NMRA 4X4SA 1U2FA 1IKVB 3CGIA 2NXJA 2LU2A 1WUUA 2XYHB 5F0WA 1Z1ZA 1YJRA 4DXLA 2KM8C 5HN0A 4TY9A 2QA4G 3TX8A 3NAHA 2LDYA 5BR8F 4JI7J 2RS2A 4LFBF 1RHKB 1SJFA 4MK7A 2RRAA 4HTJA 5J1PA 1X4BA 3D7SB 3MECB 4OFZA 3GTYX 4NLQA 2Y8WA 1Q79A 1VQ8S 2ZKTA 1RT6A 1A6LA 3W1YC 4JI1J 1KVIA 4U6PA 4JI6F 1NSKL 2B9XA 1S0VA 5I42A 1ZAVA 1CS4B 5F8GA 2ZDPA 3K89A 4G1QB 5KG4A 3POTA 3DRSA 4ZLNA 1HBOB 5LSOA 2IYIA 4CP5A 1S57A 5HP1A 4HH0A 3WQPA 4FNHA 4IG3B 3TJAA 3QSYB 3W63A 4F4KA 4WKRA 1WEZA 1RWNB 2KJVA 1KRPA 3KMSA 3K8WA 4A8FA 2FQQB 5DLFA 3LAKA 4P7VA 3D67A 2M4MA 1HBUA 1RT6B 3PNIA 4R5PB 3BM7A 2VG6B 2MSSA 2BQ3A 4B9TA 1RT2B 2P9CA 3FBFA 2KYXA 1SIWB 3CMAS 3ZZPA 1YJ9S 1KTQA 1UPMB 4ED8A 1RWUA 2AJ1A 1H2TZ 4DG1B 2LCWA 3C6TB 4WFBQ 4ANDA 2ZBIA 2CQHA 4ZLLA 4HACB 1B0PA 4RUCA 4BCAA 3DRSB 4F2RA 4H4MA 3CJ2A 1WSRA 2D9OA 2HK2A 3JYTB 2ZJQQ 4C8ZA 3EE3A 5E3CA 3T1YF 2ZD1A 5GMKa 1SV5B 2J0XA 4CH1A 2D69A 3O2IA 2YKMA 5CCMA 1R3NA 3TUJC 5C2GA 3CMQA 2YWHA 2CPDA 3RBEA 4OZ0A 3UDVA 1YI2S 4C6AA 3JTOA 1HBUB 3TUZC 2DKOB 1NO8A 2F9DA 3C2PA 2QA4S 3MCNA 4NLYA 2KJWA 4ZVSB 1CULA 4MKAA 1REVA 5L1LA 1U8WA 3FVYA 4F4ZA 2OPSB 2HQIA 4URSA 4EO8A 3MI7X 3R7SB 1D0EA 1VJWA 1WI6A 4NA2A 1VDHA 3KHLA 2CQ4A 1XNRF 5AJ3F 4X64F 1VC6A 2HZAA 1HNWF 2ZD1B 2CQGA 2ZWPA 4OZ1A 2CNLB 3HXMA 1K47A 5KFXA 2WBRA 2ZH4A 2W4PA 3MXHP 2MTLA 1JLAB 2ZH2A 2HBQB 4NX9A 5KOXA 3BN4A 2YNGA 2BR0A 4PUOA 4K4XA 4YQWA 1U1NA 3K2YA 3UPFA 1DQAA 4DFMA 4J91A 1XQIA 1HI8A 3PY8A 1OJ4A 3I87A 1CJUB 4OQJA 3D0IE 3U27A 2ZOMA 5GAEI 3I5CA 4C8LA 1L3UA 1PAUB 1WHXA 4OYOA 3SMZA 2W7PA 4X2BA 1REVB 4K50A 2B4VA 2XNQA 5A2QU 2Q79A 1N5QA 1FERA 3I4HX 4QWAA 1RBAA 3MPYA 4ZLJA 3NL0A 2R2TA 2HYIB 4QJVA 1KP6A 1UZHA 2P5VA 2DY1A 3EVMA 1CVJA 1S9GB 3KLEA 3N6NA 4UUWA 4PG4A 4FF2A 2HVEA 1SH3A 4TYAA 1RTDA 4WJBA 5KFEA 5KG5A 2CZ9A 4RR5A 4WFYA 2H4YB 1VK3A 2NS1B 3JTPA 4B3SJ 4L76A 4MMOA 2KXHA 1PO6A 4LSLA 4PUOB 3H20A 1QSSA 2G4BA 4C3LA 2H65B 3NG8A 1G7CB 3SBMA 2YPZA 5BYQA 4HYKA 3GIMA 1XMQF 1SVDA 1H38A 2PEHA 2ZKUA 5LM7E 2RUSA 4DPUA 4OX7A 2PFFB 1RJJA 4DX7A 1YBTA 4DR5F 4B3MF 2Y1LB 1R27B 1LWCA 1URRA 2WZ1A 2GHWA 1VBZA 1BLUA 2DGXA 1S0NA 2IY5B 1UAWA 4JI5J 4NCBA 4J9SA 3MPVA 1HQEA 2XLIA 3D3BJ 1FJCA 4JI4F 4ICLB 3MM9A 4JI2F 1OYDA 4PQUA 5A8RB 5KT5A 4ZLPA 4DSIA 3LWMA 3F73A 2V8PA 4U96A 4LSLB 3QGHA 1EIYB 3OHBA 3MPWA 3MEDA 3OT9A 1DZ5A 2ZNZA 4LF6J 3FEYB 3MAAB 3W9IA 2ZZNA 1EB0A 4PAAA 2ZH8A 3CD5A 3HVTA 4MYTA 3SIPB 3EGWB 2UVVA 4LREA 4DV1F 2H4WB 2ZH7A 1GEHA 1MWYA 4DOZA 5GAGU 4DSLA 3H59A 1KHVA 5SZTA 3DLBA 1WG1A 3VR1A 2HPUA 3OL9A 1F3VA 3JSRA 2CVIA 3IR7B 2MZTA 2MQ8A 4QR0A 1UWBA 4DPYA 5KFKA 3A4TA 1N33F 4YUDA 1S6OA 4KO0B 3VQTA 3DRPA 2V67A 4EMDA 2FJBB 5E2QA 3DXSX 3GV8B 4BWJA 1NJWA 4ECRA 3H4DA 2M88A 1TU0B 2PMWA 2L9WA 3C46A 4ECQA 4M5LA 3UNGC 1RT4B 2BKNA 2E1MC 1N5YA 2DNZA 2HNYB 4DR6F 1OSCA 5T14A 5DJBA 1UJ4A 4CO0A 4PABA 2YY3A 4QZVB 4L73A 4PKDB 2FYXA 1CC7A 2JLGA 4EEYA 3I82A 2KTQA 1VQKS 3P4UB 3R5BA 4LF4F 4Q44A 2J7KA 4KTQA 4NXMF 4W98A 1LXJA 3DM2B 4B3TJ 5ETNA 2DHHA 4LIWA 4LBHA 3D6MB 3KLFA 2XLKA 2JSXA 3EJMA 4OZLA 3CC2S 3FSYA 3FKBA 7FDRA 5DDOC 4CDIA 1IM4A 2H1YA 1F3FA 1HNXJ 3W60A 4LR8A 4EI2A 2DIVA 4CLZA 4QR2A 5ETPA 1N5YB 5HQLA 2H54B 1RHJB 1NK8A 4A8QA 2V69A 3HZGA 2J7WA 5B0GA 4Q7AA 3L7PA 3SV3A 1GTEA 3DN9A 3H25A 1VIOA 4FVCA 2R7TA 2NLWA 1Q78A 4PQAA 3O44A 3ISNC 1NPPA 2J0QD 4PZVA 5ETRA 2B7BB 1IVZA 2AW0A 3KK2B 1LWFB 4IFVA 1S5ZA 3BREA 1A9NB 2ZBQA 2BACA 4X4UA 1N5VA 2V2KA 3QIPA 5KFNA 2MDAA 3HSDA 3KK1B 3OTOF 2R8IA 2V9KA 2V6AA 1RU1A 2KVIA 2KYZA 2ASJA 3K8VA 4OLPA 2CYYA 3CDAA 3QO9A 1JLBB 1MROA 4PPZA 1QJHA 2DXEA 4CTAA 2HQCA 3HX9A 1SQGA 2LEBA 5HBMA 3DGVA 3E01A 1FK9B 2AGOA 2CPXA 1TL1A 1KQFB 1VIXA 5LT5A 5CD4A 2CPZA 1VRTB 1Q16B 3CWJA 3SQGA 2HBZB 4B3OA 5LMNF 3NAIA 3NEKA 3FC9A 3ZNUA 4Q5VA 2VODA 4LR9A 1XR5A 1MWQA 3EPGA 1GX5A 3D3CJ 3QIPB 3FCWA 1F2HA 3NGRA 5EX3A 2FJWA 3FQKA 2HRUA 2JHEA 1U1LA 2H5JB 4EZ9A 2BJ8A 2JJ4D 1IM6A 2UP1A 3PO4A 5FDLA 3T3FA 1DTTA 3AQPA 1JXEA 1TV6A 2V4RA 2FY8A 2NZ4A 3L95X 2DH7A 1RWMB 4DEZA 2QRRA 4YB6A 4CTAB 1VBXA 4JYAJ 1RADB 3RBXA 5HBMB 1UFLA 3E01B 4FZVA 5K5MA 1TL1B 1QDUB 5KFOA 2IC3A 1PC4A 1FX2A 1N36J 4C7QA 3DGPB 1HA1A 2ILZA 3TO8A 3SQGB 4DMZA 2OFGX 4P7TA 3LGHA 4CLKA 2J9DE 1CJTA 3QT6A 1JMTA 2ZVIA 3U02A 1RWWB 3L7OA 2Q1LA 3OQ2A 3PCOB 2YQ0A 1Y0HA 5D0GA 1TKTA 4DL3A 1P6TA 4LF8J 1RQ0A 5FDLB 4K0KJ 2IVYA 1X0PA 5D0RA 3UDCA 4F26A 2HVHA 1TV6B 2K06A 4JI8F 3VALA 4YB7A 3RRHA 4JBCA 4Y28C 3MTKA 1S1TA 4DUZF 1RTHA 4HEA9 2Y0SD 4HR2A 2MQOA 1S7HA 4RNMA 1OS5A 5CQGA 4ZN3A 3IRWP 1LWEA 2JLFA 1JX4A 2XI2A 3IG1B 5C24B 2HS4A 1HL6A 5ADZA 2EKNA 3E2EA 3M2VB 2HWTA 2XSFA 4ER8A 2YVSA 2M7SA 1FD8A 3NNHA 2VOOA 2B3TB 3IGNA 5A76A 3HFVA 1TFYA 2P6TA 3CJRA 1ZTTA 2AEFA 5FD1A 1TKTB 4RX6A 1S6PA 2RHSB 3TRGA 5IQQA 4I7FA 3LOUA 3RYLA 1FE4A 3RB3A 3CW2C 4F3QA 1U2CA 3GJQB 3MM7B 2DCLA 4OJHA 2NXCA 2HHSA 4DZ6A 4LFBJ 3EGVA 4KE5A 2FVSA 2N4DA 4MIWA 1UTAA 4QR1A 3JSYA 4ZVGA 1QSYA 5CXTA 1X9WA 3H5YA 2KT3A 2PDAA 4DL6A 2CPEA 3GJRB 1LWEB 1HMVB 2RD5C 1N34J 4CIOA 2BJDA 2MY8A 2Q3PA 2OUGA 2LXIA 2AV5A 3QIDA 3UR0A 5DG7A 4JI6J 3RGIA 4ZP8A 2XY5A 3ZZUA 1N6QB 3JSBA 3R2DJ 3MM6A 3IO1A 3NWRA 4WWSA 3MUTP 1NHUA 3CJ4A 2HIYA 3MUMP 4IG0A 4I7FB 2QMUB 3PW5A 2CQPA 2N7YA 3AAWB 3QATA 2PI4A 2OEMA 2ZHAA 2OLWA 3PHTA 2RU3A 4ZA1A 4B9VA 4ED6A 3Q8RB 1S49A 2OSRA 1LNQA 2Y1IA 4WCEQ 3THTA 4Q8FA 2XLJA 4Q0BA 3BGUA 1V3ZA 3LH2S 2B9WA 3C14A 2RDDA 4KGXB 2J8AA 3RB0A 2K8GA 4I0WA 1QVFR 6AT1B 4TY8B 4YP3A 1RWPB 1S48A 3MMBA 2B8QA 1HWJA 4EWTA 3DFEA 5KFFA 3VF0B 3D54A 2WSEC 3UDEA 1T95A 3VZHA 2NCKL 4LQ3A 1U0HA 2D3OR 1S7IA 2CQ1A 2C2KB 4RJVA 1WF2A 3NCRA 2V9WA 2KB2A 1NSAA 2R7SA 3J7Z5 1EKRA 4QIVA 4IG0B 2AGQA 1UEKA 1F9HA 2R2SA 2EXUA 3R2CJ 5EGYA 1RACB 5DZ7A 1WDTA 2RJZA 4H4KC 1S1VA 4WE1A 4Q0BB 1ZAXA 3D28A 2ADBA 1S79A 2IBKA 3UVJA 3CJQA 4NA1A 4EZ6A 3ETOA 1EHWA 1QAYA 3M8YA 2K7JA 4KPCA 1U0HB 4F0KA 2DEIA 1FDAA 2OPRB 3NNAA 4KBIA 2AQ4A 4RKUC 2LECA 3AXKA 3WHIA 2QIFA 3CNQP 1GAOA 1FDNA 1SJ4P 1PAEX 1XNRJ 4XK8C 5AJ3J 4J9RA 4X64J 3RAQA 2EWHA 4CRJA 4Y2MA 4ID8A 1HNWJ 2XGQA 1YTYA 2DNKA 2IJRA 3HLUA 1LW0B 1E6VB 3HPOA 4J9QA 2AKWB 4PYAA 1S1VB 2XMKA 1X9SA 1MN9A 1RTIB 1G3OA 4YFUA 3UVJB 4LVNP 4Y2AA 4OI1A 1IBKF 2CAJA 1YWXA 1FESA 1WACA 1KLMA 2W1BA 4KB7A 2YKPA 1TL7B 2VFVA 4Q43A 2DY9A 2DR6A 3CJKA 4ZPVR 3GSDA 3FK4A 2A18A 2KM8B 1Q5YA 5F3ZA 2VD3A 5K8MA 1UP1A 4O3RA 1SKWA 3ILLA 3PX0A 3NCPA 3QMQA 1H74A 2F7VA 2PT0A 5ETTA 1IR0A 1S1XA 2AYBA 1FTCA 4UTGA 2UXDF 1FO1A 3NBPA 2VH7A 4F4AA 2HNDA 5KFMA 2PA3A 2WAQD 2H9ZA 1K44A 2DXFA 1K8AT 4M8LA 1UVKA 3CDUA 4ED2A 1IR1A 3DHXA 1UCNA 2HAIA 1S9FA 1PSDA 4IO9Q 3TVYA 1U2RA 3P6YC 4MK9A 2ZE2B 4Y0FA 4P72A 3CJ5A 2FLOA 3ULHA 1KLMB 1VMBA 4PG6A 3FSIA 1TK5A 1XMQJ 4GMKA 4RBVA 2IRYA 3CJKB 1U45A 3MF5A 3AHPA 3AA9A 2VV5A 1PCAA 4YR2A 5DQGA 5J1EB 4DR5J 1WC3A 1WC5A 1HHSA 4C0HA 1KKHA 4RWXA 2GQ2A 2LXFA 4KKOB 2VU5A 2QT7A 3WIUA 1SQFA 3NBPB 2GIQA 5KG2A 5F8JA 5I3UB 3DLJA 2GC8A 4JI2J 2YPYA 2K3KA 1HI1A 3MEEA 2B56A 2EPIA 4NMLA 2I0XA 1T9YA 2GV1A 1NZAA 4PWDB 4USJC 1RXOB 3MURP 1HBNB 2E7XA 2A1BA 5KFSA 2VASA 2GVDA 3I55S 4DL4A 1T03A 3NS7B 4F2SA 1YBAA 1PC5A 4ZVQB 1SUQA 4LBIA 4DV1J 3BDEA 2UV8G 2K1RB 1JLQA 4RZRA 4TNOA 4CQ1A 1VQSA 4AL6A 4DPWA 3DOMB 1HD0A 1ZS6A 2X1AA 5JXSA 3VAHA 1U47A 4JUZA 2ZM6F 3P5TL 2DRBA 1FI4A 3G87A 1IBLF 1AXQA 2CPHA 4FPIA 4NYZA 2V8GA 1N33J 4A4JA 1X5PA 2APOA 2G9OA 3UE2A 3VWSA 3GIIA 4MTPA 1U1MA 5EUHA 1KFSA 2HS3A 1RAJA 1TUGB 1X4EA 3DOLB 2VFUA 2ACMA 4DR6J 3LA0A 1VC5A 2B6AA 1G4CA 3PW7A 3BGRA 4LRFA 4ED5A 4C8NA 5DM6Q 3UN3A 1SUQB 2ATLA 1P1TA 4PWUA 1RWKB 3GJTB 1R8HA 2V8VA 1MW7A 3TA0A 4Y2IA 1NJYA 5KFPA 5ETQA 3V4MA 3WX4A 2HQ3A 1S10A 2Y9HA 2QLXA 5FLXY 1N88A 4ENOA 2YWEA 2BBEA 4USUA 5FIIA 4WK1A 4NXMJ 3BDPA 3D6TB 2QEXS 5IS2A 1EKSA 2RILA 3D1OA 5B0CA 1ZETA 4ZP7A 4YDDB 3W65A 4WYWA 1NK4A 1RK8A 2NREA 4LQ9A 3ITHB 4ZPAA 3QSIA 3EXYA 2PEBA 1TUVA 2FPHX 1TMJA 5K14A 5KFJA 4ZIVA 2BA9A 2EC2A 3ILOA 1I94F 5GAEU 1RB0A 1C1BB 2GZOA 2B6AB 4ELVA 2HHQA 3DOKA 5CHCB 4ZMMA 2MKSA 3AA8A 1SC3B 3W62A 1WC4A 1RT7B 4IRDA 1Y5NB 2ZOFA 3W61A 1W2IA 3GPAA 4FYVB 5JVHQ 2LEPA 3EUNA 1NDLA 1FCAA 1FXDA 2O67A 3OR2A 3GB0A 4LIRA 1F5AA 3IP0A 2Q43A 1YJTA 1FWPA 3TQ1A 3MPUB 2CQBA 4K4YA 4IR1A 2OMLA 2MHEA 4FS1A 2FGCA 3OTOJ 2NSCA 4QWCA 5ETVA 4WFXA 1L5UA 1CG2A 3SCIE 2QFJA 1FKPB 4C11A 5K14B 3LALA 4RPFA 1V3RA 3BSOA 2WVBA 1NJIT 1NSQA 3I4PA 5AE1A 4AYBD 1RT5B 4KFBB 3FMWA 4KIAA 1SKUB 1NHKL 1I51B 3GONA 3NLCA 3LAMA 1AYEA 2XY7A 3BS9A 2W7OA 4ZVHA 1MWZA 1BXNA 2LQ8A 2AF6A 5KG0A 1NKEA 1S9EB 3MEKA 1K9MT 1APSA 5LMNJ 3H4BA 4CM0A 4XTTA 1VQOS 3Q23A 3HZEA 1O0PA 1KSPA 2R7QA 2CJBA 4I4BA 1Y3KA 2GMHA 4QQBA 4URQU 3DLKA 2JEJA 4NLRA 4OJGA 2QGFB 4QW8A 1HR0F 3M2RA 2VC1A 3M05A 4C11B 3TEGA 3CMES 3UFCX 4I69A 2FHOB 2MPUA 3ILJA 4CO3A 2RB7A 4R0JA 3AOAA 3FJ2A 2ZZTA 3PV8A 3TYTA 4RLEA 4WU3A 5E3PA 4AFFA 4K8RA 1T11A 2ASLA 1S0MA 2HHUA 3JAMY 2C3OA 3O6QA 4GO7X 5J2PA 2R2RA 4J37A 1HQUA 1KEKA 2DRDA 5B7WA 1F5BA 1UPPA 3K5NA 4IOCQ 4B08A 4USTA 2IRXA 4D3HA 4ECZA 3KLIB 4ZCLA 2DHAA 2QE5A 5GAHI 2DIUA 1VBKA 2RQMA 3AY0A 2IM1A 1VLYA 1JXLA 3DRRB 3M2RB 3IWLA 2FVQA 2AMCB 4ED3A 1OQ3A 1HPZA 1ZAWA 4RW9A 4JI8J 1T05B 3S6EA 1URNA 1TZ0A 3T1HJ 3QJLA 3CF5Q 1GXTA 4DUZJ 3HJVA 3AJ2A 1PJ7A 1DAXA 2POKA 5B09A 2AWZA 2YKAA 4RW7A 1XC9A 2A10A 1FRMA 4F4WA 1R89A 2DVIA 1LKZA 2E1PA 2ZUAA 2E5IA 2WBMA 1HQUB 1QAIA 2KXFA 2CPIA 2VL1A 5KFZA 3MFHA 2DTJA 2IBOA 1TAQA 4DQRA 2B4UA 5KFTA 3EGZA 2OD6A 1YRTA 5J2NA 5DDRC 5KG6A 2R7OA 3I0RA 3DRXA 4DQPA 1HPZB 4RW9B 1TL3A 3M8QB 1RHUB 3PFEA 4Y6IA 1WF0A 3M6UA 4F3MA 1I6JA 2DNRA 3FZ2A 4OV1A 2EG1A 4OYAA 2ROGA 2LQJA 4UW2A 3OFFA 2GGPA 2XZWA 2XQCA 2FGOA 1OYEA 4DCPB 1Q81T 4RW7B 1RWVB 5KFWA 1HBMB 4O0NA 3V6DA 3ET6A 3IAS9 1J5OA 1KDNA 5H9EJ 4EYIB 4B9LA 1F6TA 1R8BA 1Z2ZA 3BGLA 1KQSR 2F40A 1BQNA 3IBCB 4C48A 2XI3A 2GHPA 3J81Y 1JIHA 3I0RB 5HAOA 4DF4A 1FDDA 3PVXA 4WXOA 3GJSB 5D4PA 2F8EX 3OTCA 1B7YB 3CD6S 3OTEA 1P1LA 4EYHB 4WFNQ 4A8XA 4RNHA 3KJVA 3BO2A 3KLHA 4MKBA 1IBMJ 1EETA 5B0DA 2GHVC 2KZMA 4YR3A 4RNOA 4LT6A 2E5JA 3V6DB 3CCLS 4PG5A 2F4FA 5EX0A 4DR3F 2WVFA 4QW9A 4DF8A 2F9JA 5HK4A 3PIPQ 3ZTSA 3AT1B 4Y2CA 4FYDA 4Y3CA 1NNDA 1X5OA 3MZIA 2BEFA 5BYRA 1IWAA 2DXDA 4M1KA 2BUNA 1RT1A 3K57A 4E0DA 5KFLA 4AUKA 1WELA 1LFPA 1KQGB 1S59A 3J81j 3O3LA 5JUMA 1LWXA 2ZBCA 5KFUA 1WG4A 4OI0A 3SCLE 1BD6A 1TMMA 4RW4A 4M94A 4MH8A 2EW9A 3M9MB 3KLHB 3PFOA 1CQNA 5E41A 1C4CA 1HNVB 3SDEB 4NLTA 3DDIA 3IR6B 4F4XA 4IFYA 2HFZA 3QAEA 2G0JA 3BQ0A 2VFTA 2WSCC 5KT7A 1RWOB 3L7UA 2J8SA 3S7RA 2AU0A 2CJQA 1N52B 2WONA 1U7LA 4KGKA 2VG7B 1UEUA 3FFIA 4HT5A 1RT1B 2E9RX 2AJ4A 2VKRA 4O3NA 2O1PA 4FXVA 4J9MA 2I9SA 9ATCB 4WBFA 2AJ2A 4K2XA 3QZ7A 2M70A 1UA1A 2MZQA 4Q45A 4DLEA 3UCGA 4WTOB 3EDRB 1SH2A 2M2BA 1QTNB 2XG8A 1IBKJ 2XSJA 5EDWA 3KOAA 1IKWA 1YLXA 2V2QA 3QLHB 2R8KA 3BBFA 3R5AA 3C15B 1A0OB 1NRKA 3TA2A 1X31C 1Y00A 3LANA 3V4IA 3VGVA 4IOAQ 2FLPA 2OHDA 3I0SA 2NQPA 2KG1A 5K8OA 4KQZA 2C2EA 3CC4S 4MJKA 4WP9A 3SSSA 4M95A 3MCOA 3NGUA 2MZRA 3TUPA 4Y00A 3E51A 6FD1A 5AXLA 4CO1A 4QBUA 1QAJA 3A13A 1AT1B 4ID5A 3TZYA 2G13A 2VBXA 1V3SA 3RB4A 1FRKA 2YQ3A 4X4OA 3NXZA 3FSXA 3AD8C 2AIRB 3K17A 2HFUA 4IRCA 1TVRA 1XERA 4LF6F 5B0BA 2NUHA 4M5IA 2J0WA 2XSJB 3C16A 1FDBA 1IKWB 3EMTA 4P2MA 2ZITA 4DN9A 1TKXA 2MLYA 3UNYA 3BPSP 2GS8A 1JWWA 3MMAB 1FVSA 3GIRA 2VC0A 2AHOB 4OI6A 3MUVP 2E44A 3EGNA 2RVJA 3LO3A 3RR7A 4JV0A 4DR7F 2CQDA 2XHWA 4R0EA 3SYZA 2ABYA 2SXLA 4ZKAA 3ISZA 3Q8QB 4A48A 2VKZG 1U4BA 2CQ0A 4Z37A 4GVBA 3T5HA 2DNOA 2D74B 4ILLA 3M8RA 3PKMA 1FKOA 2C2DA 2DNQA 4OHVA 3IC1A 4F50A 1FRXA 4KGVB 3QGPA 2RDJA 3PEJA 3H0PA 2BVZA 5L39A 2NYHA 1H2UX 4X4NA 1LW2B 4UZBA 3I56S 3DU6A 2E9ZA 4F0MA 5J1NA 1SQEA 2UVUA 2HQFA 2HVZA 3JS9A 2HHHF 4NLWA 3W2WB 4DL5A 1PYSB 4LVOP 3TAPA 2F8HA 2ZM6J 5J2QA 1AZSA 3P5BP 4PR6A 1RT3B 3CXCR 1CQMA 1IBLJ 5THWA 5HMXA 2C1EB 4GVBB 1EZZB 3SCKE 2YWKA 4HLBA 1EJ7L 3CJ8A 4C8KA 2AD9A 5KFHA 4I2PB 4LFAF 3HCXA 5B0EA 3Q0AA 3LP2A 3I96A 3VVUA 2RUGA 3IBWA 3MM8A 2XBPA 4PRFA 4OYWA 2V34A 4TLQA 3KDOA 5F8MA 3TZWA 1QUPA 3QFWA 3DYAB 1WC0A 3H2LA 4P10A 4WKYA 1FRIA 3PG9A 5HLFA 3Q2TC 5KFAA 2UXCF 4ZJLA 3H2UB 2EK1A 2FB0A 4CO5A 2G2ZA 3PJWA 4V19J 1UA0A 5J2QB 1AZSB 1NDCA 1GMWA 4EUVA 2RKIA 3FNNA 2ZEJA 4P2SA 5MAOA 2W4CA 4FYXB 5DETA 5DGBA 2DEJA 3WDOA 4OMFG 1WI8A 3IBFB 2HBRB 2E7VA 4NL5A 4IDKB 4LRAA 1V5IB 3UI3A 5I4MA 1KTVA 3NNCA 5HVFA 1ZM4A 1HWKA 1JJHA 1Q82T 3DMJB 4AD6A 1R6VA 3TAMA 1I94J 4BWMA 4U8YA 2R8GA 1LK5A 2F1FA 3FGVA 5AXMA 2HSEB 2MJUA 1SL0A 1Y7PA 4PEOA 1RBLA 5HLFB 2MGZB 2A6OA 4ZVTB 3R7BB 1S1WA 3PDNA 3FEZA 4CI0B 3W8GA 5KT2A 2W9AA 1CPZA 1HHQA 1PJ6A 2XMTA 4M5DA 1T9XA 2RQKA 4F02A 3UQSA 1ZM2A 3UN2A 4I64A 2QTWA 1IKYB 5AXNA 2D3O1 3JSMA 3BPDA 3TAQA 2FZCB 3B78A 4XIUA 3BO4A 2CQ3A 4DPTA 3C6UB 3TAMB 5CYMA 3L9ZA 1XNQJ 3OBIA 3W5ZA 5IQ6A 1SC4B 1OMSA 2NXNA 2M9KA 1BHNA 1N32J 5AXKA 3QRRA 3UR3C 5HATA 4DX8H 1XIQA 3RW7A 1UKUA 2F63A 3W5YA 2YQ1A 2KN4A 3HJFA 2OH2A 4E98A 4A8OA 3J80U 5AE2A 2NSBA 2KT2A 2M8HA 1K1SA 1NU4A 5DM7Q 4KGZB 2VIHA 4HHUA 3BV8A 5D4OA 1GMUA 5L9NA 1IR2A 3S8SA 3RU0A 2RF2A 1QAXA 1WOSA 2M52A 1VQYA 2GQQA 5ETKA 2B4OA 4M5HA 3CCES 3MR3A 3ZTQA 4QIFA 1HR0J 4O4GA 7FD1A 1FX4A 2HFVA 3W9HA 2FHKA 2ASYA 2K2PA 2LA6A 2EVZA 3I9ZA 5CYMB 1YJ7A 2BJ3A 1WHYA 2HFOA 1X9MA 3CULA 3IMQJ 3CCQS 2N3OA 3OSPA 1NH7A 1F1BB 4QOTA 4U67Q 2CJAA 4TVAB 3CE8A 3BSNA 4UOHA 3KHHA 3UDLA 4O3PA 2YWGA 4PXEA 3WZ0A 2IAJA 1VK8A 5A8KB 2QL5B 2RSQA 2HAFA 4PPDA 4FDFA 4JI0F 2YNFA 2IHR1 1HW9A 1X5TA 1U1RA 4I67A 4O0IA 2HURA 1D3WA 4NI2B 1T8EA 2I1RA 4M5KA 2PO4A 3M2UA 5HANA 2MKIA 2QJ3A 4B02A 1NK6A 2DGVA 3CT9A 1RAEB 4O4GB 4EO6A 1YZ7A 2YNIB 2X51A 1X0FA 4IYQA 2ZH1A 3IGVA 3R1HA 2IMWP 1O6XA 4ERDA 4DCOB 4LUBA 2YX1A 4K2JA 3QBCA 3G71S 4F3OA 1CJVB 1P27B 3MM5A 1D9AA 3ZZ0A 2MQNA 1RLCL 5F3TA 1HNIB 3OD2A 1N34F 1WEYA 2DB1A 1S1UB 5F8IA 2DITA 3T41A 2OPQA 5CZVA 1NCLA 1R0AA 1N54B 3F56A 5KT3A 2VZ9A 3ZO7A 1RTJB 3THVA 5ETLA 4MK8A 1YG0A 4QIGA 1K1QA 2YNFB 1RP5A 2PGCA 2EFPA 3QT7A 2ZC3A 5U47A 2E9TA 2C2NA 4UOCA 1V5VA 3NGKA 1IJFB 3M2UB 3K5MA 5HVHA 3GYNA 1RAHB 2FLLA 4AT1B 1TUWA 4ETXA 1JLCA 1FNMA 3R5JB 4DI6A 3GSIA 4RBTA 5JJBA 1Y4ZB 4MT1A 1RA7A 2IA6A 4U7UK 4FS2A 3RBZA 1M1KT 2LLZA 1BGXT 3HF5A 4ETZA 5IZHA 2IPOB 2FZKB 3HHLA 4NA3A 3UD3P 2KFNA 3PYDA 2AZ3A 1OY8A 2VBZA 1R0AB 2A3JA 2M0GB 4WFZA 2NYIA 5KFCA 1F5CA 2OMOA 3MPDA 1BUXA 4WYLA 3B4DA 5I42B 2FJVA 3CCMS 3FUYA 3GV7B 1BQMA 3MD3A 5HSPA 2MEWA 2C3UA 3POTB 2CDRB 2KO1A 2UUAF 3KDNA 2BANA 3M6WA 1JLCB 2MKYA 3SSQA 4CLWA 5H9EK 5HP1B 2VPYB 2KHCA 5M2UA 3Q86A 2CQCA 3J7A1 3CCSS 2MMYA 2ALZA 1ROFA 4Z7CA 4ZVEA 1SC1B 5LL6d 2ZBPA 2RNEA 2YKOA 4I1TA 4NLGA 1N5SA 2JNJA 3QWPA 3BJYA 3VTIA 2B51A 4EBEA 4DR3J 2HNZA 5AE3A 1RUSA 3AD9C 1BQMB 3A3NB 3I5AA 4O3QA 3UO0A 2KZZA 2B9YA 2DHGA 2YH1A 4H4MB 1QSLA 3TUIC 4WF9Q 2PN6A 2QSWA 2BRLA 3QYYA 4URGA 1KS2A 5FLXU 1NLKL 2YKMB 2XTJP 3CCVS 3W2VA 2AYEA 1HWLA 3G8SA 2I6WA 2LKZA 4IQMA 3KKFA 5GAGI 1RKIA 2U2FA 4C2MA 3F44A 2JZ5A 1QVGR 4ZIWA 2B43A 3A8EA 3BYPA 2YNHA 1CULB 2VPWB 4DV7J 1AFJA 4QWEA 3NP5A 2RS8A 2W2PP 2DCUB 3GE9A 1CSJA 1H0HB 2UXBF 2QN6B 3RB6A 2YKNA 3ZZTA 2HHWA 4NYOA 1Y9OA 1S76D 3KLVA 2BX6A 2DO0A 4ZVOB 2D3ZA 4USIA 1U1OA 2YNGB 1YRXA 9RUBA 4KAIA 2IVMA 3KNAA 4RU2A 2WTFA 4KPYA 1D8ZA 1VQNS 2UV8A 4B17A 2OO4A 4H4OA 2F8MA 4JP8A 2HK3A 3M8WA 3CCRS 1TELA 4DWIA 2YBVA 1EP4A 2IMOA 4RU9A 2P2CB 4DU8A 1N8RT 3WC2A 1YZ6A 2UVRA 3BH7B 1WTFA 3KK3A 3D6FB 2ROPA 2BM1A 5K8PA 2V4QA 3RZAA 3KLEB 3BSAA 1IWGA 3CDWA 1L3VA 3ZTOA 1KFDA 2HKEA 1RTDB 1XR7A 2HMIA 2GO9A 3LW5C 3LTOA 4P9SA 3LP1A 1VS3A 3G96A 1VQ9S 1ICEB 3AOCA 2W7AA 4QWDA 3QZ8A 1U1KA 3TA1A 1UVNA 4H4OB 1S12A 1B0VA 3GP9A 4L74A 4K4SA 3SXLA 3SQOP 1B70B 4U9RA 3IWNC 4OHYA 1VISA 4CLPA 1QE1A 1C0UA 3AOBA 1EP4B 3PW2A 2WSFC 5E3AA 1DLOA 3V2UC 2NPFA 3OXGA 4NXNF 1LWCB 3FBBA 1MSWD 4YY3F 4IOBA 1JLEA 3KK3B 1Q1KA 1VR6A 4YDXA 2CG8A 2B9EA 4U95A 4DR7J 1VQLS 1FVQA 2X1FA 1HQEB 3BR9A 2G0IA 3VAKA 2B4PA 3OV7A 3JAMU 3MM9B 4HI2A 1VQ7S 4J9OA 1L3TA 5K8NA 4PQUB 1VQ4S 1N4LA 1RABB 4JV2A 4U7CA 3CC7S 2XS7A 3H2VE 1RI7A 2JL9A 3OXFA 3MTJA 3MEDB 1S77D 4ZHRA 3CDBA 2HZVA 4IKAA 1I3OB 2ZHOA 1L3SA 3G8TA 1DRZA 3HVTB 1C0UB 4USHA 4QU6A 4CO4A 3R5GA 2JDJA 3R97A 5DS7A 4P74A 2R3VA 5G0RA 1L3KA 3A3PB 4LSNA 3KUHA 2HHHJ 4LFCF 1B3TA 2P9EA 3HVRA 5D3GA 2XZTB 3AD7C 2EBGA 4N56A 4DR4F 3H5SA 1UWBB 1C4AA 2W2NP 1UZDA 3PTWA 3HP6A 2YX4A 4C97A 3DRPB 3EPIA 4YMEA 1N56A 1U0SA 2XULA 2VA2A 3OSNA 1RGVA 3CJTA 3I6PA 1OO0B 1R8CA 4A8SA 1NK9A 4IQXA 4CNYA 3DLEA 5L8RC 5HL7Q 3CCWA 4LFAJ 4U8VA 1GMWD 4ZP9A 1S6QA 3ADAC 1SBRA 2C22A 1M90T 3BKTA 3AQOA 2DGUA 2Z2MA 1HWUA 2E5HA 2YTCA 5CD4H 1RZMA 3UN5A 1F9EB 2OEJA 5LSRA 5A8WA 2FIUA 5D15A 1VCTA 2DH8A 4KT0C 4NMXA 1FHTA 4LSNB 2UXCJ 2P8IA 3OL7A 3I32A 4A47A 3RW6A 1JXVA 4K4UA 3BYRA 4MFBA 3KLFB 2OD4A 1SB6A 4DLGA 1WKLA 1NBEB 2D7SA 1LOUA 1FJGF 2ZOGA 2HHTA 2KI2A 2A2DA 1YX2A 3DI6A 1Q8KA 3DLHA 5F8LA 3J81U 4DR1F 4UY85 4FKXA 1SC6A 4ED1A 1VOMA 1Z4UA 4OI4A 3OR1A 2Y1RI 3GG0A 4N77A 4F7VA 2C2MB 1S6QB 2WB1D 2MKHA 2KH9A 3N79A 3RBDA 3HHEA 3CD0A 4WZQA 4FF1A 2CWXA 3R6LB 1KWMA 2HBYB 2VPXB 3G6YA 3OVSA 1YBUA 1VYAA 2KRBA 2GW8A 2CJXB 1CC8A 2CJ9A 1K0VA 4F67A 2XO6A 3B8HA 1RAAB 4QYZJ 4IFVB 3TVKA 4J9KA 3W66A 4MFBB 4DUTA 2GMJA 1GQEA 1VRUA 1U02A 1YJNS 2W2OP 3MMJA 2W8LA 3N6LA 2HWHA 4J5OA 5KFBA 3GFZA 3QO9B 1MROB 2DNPA 3CCUS 4ZITA 1R0BG 5DLGA 4OHXA 4WTYA 1XTZA 3PEHA 3EZUA 1CLFA 3BGFA 3NS5A 4DZDA 5CYQA 2ATCB 2WW8A 4RWWA 2PI5A 4HDHA 3KMQA 2MQQA 5L1IA 1OPZA 1NB2A 2MHNA 4B3OB 1WNEA 4C8MA 1VGYA 3TZXA 5BJRA 2E5LF 1TR0A 4K5RA 5A0YA 4TU7A 1ITPA 4AL5A 1MLAA 3WX8A 2KFZA 1AA1B 3V81A 1FF2A 4W92B 2VA3A 4GRSA 1SI9A 5D0EA 5HJXA 2OELA 5F8HA 1DTTB 1J27A 2BKOA 3R8YA 3T1HF 2CKWA 3T6BA 2IJFA 2E5GA 2W25A 3FQLA 2GQCA 5CYQB 2IC3B 1TKZA 4OHWA 3KFWX 5KFQA 5D4NA 3L4BC 4AXJA 3DDNA 4ANCA 1REGX 2GVZA 3G82A 2ZH6A 2RIJA 2COLA 3V5RA 4NYPA 4ES3A 4FYWB 1JB0C 1CJTB 1RAIB 3FZBA 3OFGA 3MOZA 2JC1A 4USMA 5KFVA 4JI0J 3O1LA 2HRTA 3Q83A 1ACMB 2FHJA 4OX8A 3EICA 2LQ5A 3BGOP 1U26A 1KD1T 2WVEA 1T3OA 2RT3A 1HFEL 2BJ9A 3CJ0A 4BC7A 1S1TB 3MR5A 1RTHB 2I5JA 3NGSA 2JVRA 4DPXA 4FBUA 2JEIA 3QAUA 1TKZB 3VVTA 2XWYA 4OIXA 1IKVA 3CDEA 3HT0A 4B3RJ 3QJJA 2GVZB 2F3JA 2BMBA 5LXYA 1E6YA 4E2FB 1T9TA 2OTJS 3HHLD 3HMJG 3NCQA 4ZK7M 1S6PB 1Q7YT 3PZPA 2Z2YB 1GT8A 1LK7A 1ZOTA 4A8KA 1WOPA 5EHHA 3P96A 3PR4A 2HEKA 4RUAA 3B54A 1UVIA 1W25A 3X1LB 2AJQA 2BJ1A 2Z58B 2XYGB 4RUHA 2I5JB 1CS4A 4HHJA 2ZZMA 4IO1A 4MIBA 1IBMF 4ITSA 4NEZA 2W24A 3WIVA 4X4PA 1U24A 2QLFB 4ECSA 1U09A 5ETSA 3DDKA 2C3PA 3GZ7A 4G1QA 3GYXB 3RAXA 4C9DA 3QPIA 5L46A 3BQ2A 5KFYA 1QD1A 3MCMA 1S72S 2JWNA 1HBOA 2QV6A 3K58A 5L1JA 1E6YB 2DNLA 3A12A 2GCFA 2ZNYA 1VLOA 4ED4A 2H51B 3MM6B 2A6MA 4IG3A 3UCUP 2XYPB 4L75A 2QA2A 4HT7A 2HHXA 3IXQA 5M2PA 1ZBTA 2UUAJ 4HHHA 2Y0BB 1RWXB 4X65F 2JX2A 3P45B 1ZM3A 4R5PA 2R7RA 2VG6A 1Q8IA 1RT2A 2AEMA 2ZDOA 3UW1A 2OJ3A 3BBBA 3FCVA 2IA0A 3IFEA 3C14B 3MMCA 4Q8EA 3EM1A 4CLFA 1Q7LB 4OHZA 4DG1A 3SFGA 3C6TA 4K4VA 2R7XA 2MLZA 3QQCD 5IOLA 3MMBB 1X4DA 5F41A 3VZIA 3J80Y 3F0NA 4F04B 3GU0A 1NK5A 4HACA 2HWIA 5D77A 3LPEA 2F4VJ 2OP5A 1KQKA 4IUFA 3JYTA 2Z2LA 2JFDA 2VQFF 1PBAA 4OZNA 5A6PA 1SV5A 4J9UE 1I5OB 1Q0NA 1Q5VA 4ES2A 2BQUA 1H98A 3K7RA 1VFJA 3RRKA 3L09A 1T02A 4IRKA 1DQ8A 3KG0A 4LF2A 2HGMA 3ENWA 1NPRA 4USVA 3NGDA 3TI0A 3D68A 2MXYA 1HW8A 1XMBA 5B0AA 1T0TV 4RL1A 1VC0A 4WE1B 2CPFA 2QSFA 2CJYB 1PKUA 3MMCB 5HROA 3GILA 2OGUA 2OI2A 4OJ3A 2Q66A 2OPSA 4F25A 3PJ9A 4CO2A 2B0GA 3IR5B 3UCZP 2EI5A 5E5NA 3H8YA 2QC3A 4OZ3A 1LV5A 4C8YA 4FN5A 1GTHA 3SSRA 4DV5F 2J9EA 3TQEA 2UXBJ 3HM9A 4XO0A 1JLAA 2XMMA 3TX0A 3MDFA 4DX6A 4RBUA 3C8YA 2XHCA 2QX0A 4N8OA 1TK0A 3KJNB 5H1SV 2R7WA 8RUCA 1CJUA 1ZYQA 3RR8A 2BE9B 3PX6A 1UVMA 4LJMA 2CNKB 3KJFB 4JI3F 4YN3B 3LPYA 3N0VA 2Y3YA 5HROB 2BKPA 2QA1A 5C42A 4CNZA 1U48A 4EGLA 1QM9A 1DJ0A 3H40A 4KV8A 4F8RA 4ECWA 4ZP6A 3U7JA 3HT3A 1S9GA 4ZPDA 1WSVA 2IYGA 4N76A 2PIIA 2RU9A 3PYGA 1Z2LA 1S1XB 4P6QA 2WVCA 1UW9A 2KG0A 2FHMA 3AB2B 1WC6A 4NASA 2HNDB 1X4CA 2LMIA 2X7IA 2B7CB 2JEGA 1R7IA 4ZPBA 1IJEB 4CM2A 2D41A 4FF3A 2FUG9 3MD1A 5C42B 2CWKA 3BKUA 1BY9A 4BDPA 4YS2A 4KV8B 3IRXA 5H9FK 1CEZA 1H72C 4QIWD 2J9CA 1DY3A 2CADA 3HFZB 5CYJA 2V63A 3GIKA 2ALYB 3T5KA 2ZH3A 2JRSA 3HI9A 1SCJB 4CLLA 4F0HA 1M1HA 1FWLA 3T9NA 3T5LA 2G2YA 2E66A 3PX4A 4ICLA 5A8RA 2J6UA 4CCHA 4NXNJ 3BSCA 4KR0B 2XEXA 3JB9k 4YY3J 5DQHA 2O66A 2J6SA 1DQ9A 2R2UA 2W2QP 3MAAA 4OI2A 3GCXP 2HGNA 3VHQA 1G6BA 3E8OA 3MEEB 1U8SA 5LMUF 2MYFA 1IBCB 3VAJA 3A3OB 1GXLA 1NXIA 2GO8A 3IRXB 5RUBA 3R9LA 2RH3A 4ECVA 2E1CA 4O23A 2EBEA 1NPKA 2GVDB 1T03B 2D1CA 1RAFB 1IKXA 1ZTWA 3LF0A 1YJUA 1NB7A 4X4TA 2CDQA 1JLQB 4KHPF 3VAGA 1PJ5A 1GH8A 4KO0A 3ZXWA 4B9NA 1VBYA 2LQ9A 2YKQA 4CLUA 4WFAQ 1HARA 2DR8A 1XMOJ 4Y2KA 4HI1A 4N47A 4LFCJ 4DPOA 3EXCX 4JV5F 1RT4A 1H7XA 4EK2A 4DR4J 3NKYA 3TJ9A 2BE2A 4Z2XA 2VJUA 2HNYA 4DX5A 1XK8A 2E29A 2R8HA 3K59A 2XS5A 2LYVA 3VAFA 3NY0A 2UUWA 1RCXB 4JOUA 1FFGB 1WG5A 2B5JA 1F9FA 2L41A 4GKJF 4FKYA 3HVWA 3OJSA 4LF1A 1TTHB 5KFGA 3NGTA 1W7WA 3ICLA 4NRTA 2BDPA 1IKXB 3BGRB 1JJ4A 1DURA 3DM2A 1K0TA 4OL8A 3FRYA 4PXDA 1HLWA 3NOGA 3BO3A 3M1VA 2V0NA 5D0HA 2MZ1A 5HMZA 2BE2B 2ZFHA 1C0TA 1JJ2R 1C1CA 2MJNA 4ZPWR 1T9UA 1FJGJ 3QRQA 1FFSB 4LF5F 3AH6A 3MGJA 3G9CA 2B5JB 5LJ3Y 4DR1J 4DQQA 4TLRA 3ENVA 4CLSA 1YKWA 1XNQF 2QL7B 3MAQA 2V2VA 2M5YA 3N9UC 3BQ1A 3KK2A 3DOKB 1N32F 1LWFA 3EDQB 4ZDNA 5M2RA 3H5UA 4TYBA 2O01C 2C2ZB 1FFWB 3GWCA 2QLJB 2WB4A 3KK1A 1KVJA 3HSZA 1WHWA 3MWBA 3PO5A 4A8MP 1R8AA 5B08A 3CJSA 2LEAA 2O5DA 3OR2B 2XNRA 2AJFE 3M1VB 2R9LA 3HHLC 4EFAC 1SJQA 4LRCA 2H5IB 1JLBA 4OX6A 1S4EA 1C0TB 1C1CB 2J76E 4K7QA 1MMLA 4JV1A 4KY3A 3RG6A 1FK9A 4QYZK 1OY6A 2R7VA 2UUCF 4PCQA 3D4JA 1KOOA 3GFXA 1VRTA 1P8GA 4I6YA 4FF4A 4LBPA 4O44A 3JXOA 3WBZA 3W9JA 1EX8A 1SJRA 2RAQA 1NUEA 2DISA 1JQGA 2IDEA 5IT9Y 4N41A 3CTRA 1SL1A 5AT1B 4PXCA 2OPPA 4UT4A 4J9PA 2VJVA 3SI8A 4G6VB 3M4XA 3KJQB 2XMWA 4BHQA 2XS2A 3TWZA 2VUGA 2E5LJ 1PILA 2FJEB 3G6VA 2Z30B 2GA7A 3DLKB 4QPXA 4OYMA 2CG4A 5KFRA 3CB4A 4BBYA 1WC1A 4CWBA 4NWBA 1U6FA 3AODA 4ZN1A 1X4FA 3DLGA 2DH9A 3DGPA 3BBCA 2A0FB 3G6XA 4O44B 4ELTA 2IM2A 2FHJD 4KC5A 1M5SA 2EKYA 1GNKA 4J9LA 1BC6A 5DGAA 5E0OA 4ZCMA 4OX9F 3H42A 2OPPB 2LXUA 2WVDA 2CJKA 3HULA 5J2PB 5HJYA 2ZVSA 2LDIA 2KU7A 2D9PA 3OXLA 2LU1A 1JLGA 4K4TA 4DUYF 5GMDA 2DGOA 1LQ9A 1TP7A 3SV4A 3VGTA 3PRBA 5I3QA 5DZ6A 3I5BA 1J5EF 4X66F 4ALZA 1RSCA 2R4FA 1RYRA 5HMYA 3R27A 1MMDA 1D8YA 3FBCA 4NE9C 3OPKA 1R8PA 4B9UA 2EC0A 1O5JA 1FEEA 1KONA 2UVWA 3DLGB 3IG1A 5C24A 1ZPWX 3T9ZA 1SJ1A 3G86A 3AB4B 3M2VA 4HDGA 4I68A 2PMZD 2ERRA 4KYZA 5KAKA 2Y1JA 5BXIA 4PG8A 2BABA 2DGQA 4AQYF 4XDDA 3VGUA 2HLUA 2XMVA 3ENQA 1UJ6A 3CIMA 5IV4A 1HNZF 4XPCA 1IUJA 2DHXA 4V1Ak 1ULRA 2VBYA 2G2OA 3MM7A 3OTDA 1JLGB 2WOMA 1EQ0A 2X1BA 4DV6J 2DR9A 5E7OB 1NDPA 4NLVA 3RTVA 2K3IA 3MAHA 5J2NB 1CJKA 3THPA 2L9NA 5GMEA 2GMLA 5L1KA 1DARA 1DTQA 1TL3B 1HMVA 2VQEJ 2Z56B 4TQSA 3LGMA 3N5FA 3ZTRA 4K59A 5J2MA 2IDLA 4DV3F 2GGPB 4DU7A 1LXNA 2DNMA 3N28A 4Y65A 3GR0A 2R8JA 1N6QA 2PD1A 3R7NB 4AXIA 5CH7B 5E3QA 2CPJA 3M8SA 2IRUA 3ET6B 3PR5B 1Q4RA 3LUYA 2VF3A 4WZMA 1B0TA 3FBEA 1D1UA 1J5OB 1WEXA 3DLLQ 1D9FA 5BR8J 2ZWOA 3ZC4A 1BQNB 2WOMB 1PIEA 4UOGA 4H54A 5CABA 4W4MA 1CJKB 2DGTA 4L72B 1AW0A 1WORA 3QRPA 3GYGA 4B9MA 1DTQB 4NLXA 2ROEA 4DL0C 4X65J 4TY8A 2BW7A 4OZ2A 2BRKA 1A7GE 5J2MB 1FJ7A 2MLXA 4DV4F 3KJVB 1YK9A 3DCAA 1EETB 3CCTA 3B4MA 1SKRA 3Q22A 4ZJOA 2EFOA 4LF7F 3VAIA 1H3DA 2YWWA 4ED0A 2XGPA 2C2RA 2CRLA 4DV7F 4UY8T 2UU9F 3TVZA 2VQFJ 2CQIA 2MSTA 1TKDA 5F0UA 2W2MP 3HFKA 3VQSA 1QY7A 4IH5A 1O8BA 4UF4A 3IA0A 1S4FA 5L38A 4GO5X 3JQKA 4WXWA 2R42A 3S1TA 3K5LA 4FYYB 2VBWA 1NZ8A 3KYLA 2OAUA 1XR6A 2DK2A 3PIOQ 4ECYA 3L3CA 1H6KX 3RJMB 3DHWC 2PSZA 1NKBA 1UFWA 3BEGB 3SFUA 5GADI 4RW4B 4XPEA 4RNNA 3MFIA 4ILMA 2OPRA 3J7YI 2CFXA 2H48B 3WC0A 4I2QA 3ENAA 3K5PA 1NK7A 4XAKA 4IFYB 4CH0S 2LA4A 4NZ0A 4GVLA 2Z0GA 3VV2B 5C5JA 2JEFA 3H5XA 3T1YJ 1NH8A 2DNHA 2WONB 2Q6CA 3HKZD 3IM9A 4DV5J 1LW0A 3Q8YA 1E6VA 3P8BB 2GX8A 4DFJA 5ITHA 4IH7A 3FFIB 2HFSA 3M6VA 3GIJA 1RTIA 4TN2A 1IN0A 1BWVA 2FJAB 4ED7A 3ZFVA 2MB0B 4OYXA 2B8PA 2FTRA 3HDSA 2EK6A 1TL7A 3ZZZA 1KC8T 4MKYA 1RE1B 1XBWA 1SKSA 1V6HA 2XC9A 4JI3J 4RW8A 5KG3A 1DHMA 3ZZOA 4I2QB 2V8DA 2CPYA 3A8JA 1LEOA 4DFKA 4DV2F 1AROP 4DSJA 1T9VA 1PYOB 3V4IB 3GG1A 4GKKF 2HIQA 3I0SB 1TAUA 1UL3A 1NHVA 1HQ2A 3JTNA 2U1AA 1N0UA 5CAAA 1OIAA 4ZPTR 4G1IA 3EWGA 1KHWA 4WIQA 2N82B 2V5HG 5KG1A 3BKFA 7AT1B 3OUYA 4QWBA 3R3TA 5KT6A 5CCLA 4EBDA 1WD6A 2VONA 2ZE2A 3HHDA 4ID5B 3C66A 2XB2D 1U49A 4ZVPB 1SIZA 2IJNA 1X7VA 4ECXA 2RHQB 1NM2A 3IAM9 4LR7A 2V68A 2CA9A 1TVRB 4RW8B 5F9LA 2Z8QA 5J1EA 3C16B 1EARA 1YHQS 5SUHA 3W5XA 3CPWR 1TKXB 4KKOA 2IM3A 1UETA 3M6XA 3A1YG 4ZOSA 1FXLA 1X4AA 5EN1A 5IM0A 2HQGA 4QIEA 5I3UA 1P9YA 1UVLA 4W90B 6FDRA 5F9NA 4AL7A 3M8PA 4KH1B 2AP6A 4Q2LA 2DGWA 4J7CA 5KFIA 3G4SS 4LSZB 3OUYB 1H7WA 1ZZFA 3X3UA 2RDIA 2Y8YA 4PWDA 3M7VA 2R7UA 4ZVFA 1HBNA 5K20B 1WKKA 4QPTA 1S99A 5ETMA 1NEEA 1FKOB 5LMUJ 1YVFA 3PM9A 3M32A 4B3MJ 2K1RA 1WOOA 2F65A 2PC6A 2KRRA 1FRHA 4G1PA 3DOMA 3CSKA 2YX7A 1RKJA 3M9NB 2DNYA 4ES1A 2J6TA 4PXBA 2V50A 3Q89A 5IM0B 2XO7A 3M8PB 4JI4J 3JQJA 2VFRA 4BS2A 4KHPJ 4DDFA 5MLCV 1F0XA 5DDQC 4OI3A 4O3OA 4RO0A 4HTIA 2C3YA 4UQGA 2N7CA 1RHQB 2OTLS 4MAKA 1UFKA 2AT1B 1T9WA 4JV5J 2UUBF 2VHGA 1I1GA 1Y5IB 2E1AA 5E3RA 3D66A 5HI7A 3DOLA 3SCJE 2RE1A 3TNVA 1NDKA 2BZ2A 1FEHA 3T6JA 3Q8SB 4FBTA 4DSFA 3M32B 2M3DA 2ZHBA 3AXMA 4DSKA 3J7ZT 4P2FA 3GQCA 4GKJJ 3LP2B 3DXBA 3KXDA 3W7BA 2IFXA 1WWHA 3R5CA 4YEAA 2LFVA 4DL2A 3TARA 4MYUA 4G65A 4LF9F 3MM8B 1JNZB 1TQLA 3QT8A 3ZTPA 2X3DA 2CVEA 4DR2F 2GNKA 2YH0A 4NCAA 2L3MA 4C0OC 3AJDA 1VJQA 1ZA1B 2MQPA 4V19X 5IXUA 3W64A 1XJWB 3NS6A 4NLUA 2NZCA 1NJZA 3T5JA 2BM0A 3TZZA 3CD7A 4C8OA 4FPRA 2C28A 3ITHA 2V2ZA 2IM0A 3QWUA 2F5GA 1KLNA 2RKIB 2MKJA 1VQ6S 2DJWA 2HLTA 3GCWP 1KN6A 4YHHF 2AJ0A 4ATNA 1ZH5A 1HD1A 3OFEA 1M5VC 4KGMA 1C1BA 1SL2A 1H73A 2BW2A 4LF5J 3KWMA 2XZDB 3DU5A 2QO3A 1RT7A 1SPBP 1P9QC 5IFMA 3KNGA 2AX1A 3GFHA 3EVWA 1GFWB 4LF4J 4OLOA 2HG4A 4KJIA 2EEYA 4DHVA 3OHAA 4I6AA 4G3IA 4OV6A 3U1MA 1BE4A 2G1HA 2N3LA 1OPIA 2HGLA 3LGNA 2JLEA 2H3EB 3N4WA 1DFDA 2ZJPQ 1S1WB 2L9DA 2ZC4A 3RUBL 1FKPA 3E3XA 2PFDA 1YJVA 1V9OA 5A2QY 2FVRA 3VCDA 1OQ6A 3KG4A 1CBKA 4M5DB 2XCPA 1T94A 1RT5A 4KFBA 4NLDA 2KDOA 1QUVA 1UW4A 1Q8LA 2DT9A 2NXUA 1FKAF 5T41A 3JSMB 4WU2A 1S97A 2UUCJ 1SJ3P 1AUSL 1DBDA 5HVGA 4NEYA 1YSJA 1S9EA 3GFYA 2DPIA 3PKYA 2C2OB 4CT8A 2KXNB 2KKHA 1F2GA 2AZ1A 1B7FA 4DCJB 3CCJS 3HKWA 2DPJA 1ELOA 3OL6A 3DRYA 4K4WA 2MZSA 1YRUA 4XDCA 5JVGQ 1Y10A 1KNZA 4KHRA 2Z4PA 3A8IA 2BQRA 4DV0F 4NZ7A 3KUEA 2C42A 1FWKA 2FC9A 1NAQA 2RF2B 2FLNA 4DBQA 3GMGA 1UWAA 3NMAA 1KR4A 1X60A 3TW0A 3SZ2A 2JH3A 5D8HB 2L08A 2W9CA 1R31A 1VI7A 1RYSA 1ZM9A 1FNXH 3I9V9 3HO1A 2YWFA 2CQ2A 1R43A 4C98A 5KTQA 2ZJRQ 3M9OB 3PYEA 4NLOA 1BMQB 1UMJA 2XMUA 2HHPA 3KLIA 4OX9J 4B3RF 4YB5A 4JB8B 2QG9B 1WKJA 5IT0A 4X62F 2DYAA 1EAYC 4DS4A 2IAJB 5IWAF 3DRRA 4QYRA 4USWA 3MHYA 2EFGA 3P49B 1RISA 2NUUG 1M5OC 2FD2A 1T05A 4WP3A 3PRDA 2I8EA 4DUYJ 4WP8A 3VAMA 2QLBB 3JQMA 5FJ4A 1FT8A 2HVIA 3N6MA 2FY1A 3LQVA 3HSJA 2DBBA 1M5KC 2DR7A 1J5EJ 4X66J 1G2EA 1YDLA 4PYDA 2BV3A 3OFHA 1FNOA 4IR9A 4OYZA 1T3NA 4KHMA 2BJEA 2W9CB 1B99A 4LRDA 2PA8D 2V94A 2CUYA 4R8UA 1MN7A 3MM5B 2O3DA 1GXUA 4AQYJ 1HI0P 4TU9A 2HVDA 2DO4A 4DFPA 4K5SA 3KTQA 2OPQB 1ZZNA 2WW4A 4GC6A 3BR8A 3PW4A 4KRWA 1HNZJ 4J90A 5DG9A 4PWWA 4JI7F 4KH0B 1JKHA 2OFHX 3G2XA 1JLFA 4UOFA 3M8QA 2HZCA 2CNOB 1W26A 4EBCA 1RAOA 4OZ5A 3FRZA 1JK9B 1RBOB 4M5GA 2VFSA 4ZJQA 3U1NA 3DNCA 2CIMA 2MKKA 1IQZA 1R6YA 2FJXA 4JI1F 3HHNB 2BJ7A 3MCSA 2FVPA 1B64A 1UVJA 1HBMA 4NPOA 4R8UB 2FJDB 3ILIA 4A46A 2GAHC 4DV3J 2GIRA 3HHLB 3HHKA 3TANA 4I6WA 2QMWA 2F4VF 4QU7A 1U6ZA 2A2CA 5CA5A 2DHSA 4NOHA 1QTMA 1JKHB 2JFKA 3MEGA 3C19A 1JLFB 3CUNA 2UZAA 2MZJA 4ZS6A 4TU8A 1OSDA 4NCGA 2G0CA 4RW6A 2EFVA 4OJ1A 2BANB 2FDNA 3CIZA 4YB1P 1Q86T 4DN0A 1VQMS 2NR0A 1MNEA 4F36A 3MR7A 4GC7A 2GAGC 2RQCA 2CXEA 1Y5LB 2DGSA 1T7PA 2XY6A 4X4VA 1MMNA 2P9GA 5IC6B 1M5HA 4DV4J 4OYPA 5D78A 4WPAA 4M63A 1HYSA 4O4RA 1VQ5S 5HQ8A 4LF7J 2Q6BA 1HKAA 1WHVA 3BB5A 4BLGA 3UD4P 1YQHA 3CO0P 3US5A 4OZJA 2GJFA 4E8UA 2VG5A 1YGYA 2MQLA 2HNZB 3MEGB 2VDHA 5ETOA 4N8NA 2UU9J 2DRAA 5HQMA 1TFWA 2QZ8A 4AE5A 3TJ8A 4NCGB 3CJ3A 4RW6B 1WJ9A 5GAHU 3BF4A 3OVAA 4FVMA 4CT9A 3TEHB 1X4HA 4DL7A 2BOAA 3S01A 4X4RA 3R1LA 3NRBA 8ATCB 2Z57B 2GFFA 2IIHA 1PG5B 2NXEA 4CLTA 4UUXA 3W3SA 2OIHA 3AFGA 2MY7A 1HNVA 3SDEA 5C2CA 3MOJB 1Y11A 3LP0A 3W2VB 1SXLA 5D6GA 4NZ6A 2QYGA 2AYMA 2LP4A 3KUGA 1NSPA 4TKTA 1UJ5A 1HYSB 3Q24A 2H5EA 2HQDA 2Z2ZA 2J5AA 2VG7A 2E7WA 1AUDA 1VRQC 1IXKA 3EVOA 3QGGA 2YNHB 1BWEA 2KL8A 4L3NA 1Q95G 4ILRA 2VG5B 3G6ES 3QT5A 1TK8A 1HIYA 2P6SA 3EX7B 3M30A 3KLGA 1TL4A 2XCAA 1WTBA 3Q8PB 3DC2A 1R0CB 2YKNB 1PGZA 2QL9B 1RHRB 3V6HA 2LVWA 5T7LA 2ILYA 4K4ZA 5C25A 1IQTA 2RMLA 3QJPA 1FRLA 3ELHA 4YR0A 3HD1A 1WF1A 3J7AN 5H9FJ 4CYUA 4HKQA 1VHIA 1N5TA 4I56A 3QLHA 2VDIA 3LP0B 3C15A 2W4DA 4UQTA 1B4SA 3HSGA 5IC4B 3UWTA 2QLWA 1OWXA 4F4YA 3P3DA 3M8ZA 2GIFA 1WDDA 5KT4A 3ZZRA 4C3MA 2ADCA 4HVZA 4OYIA 4DS5A 3OW2R 4NLSA 1Q8BA 1NJXA 3O5TB 4DV2J 1FE0A 4GKKJ 3O8WA 3H98A 2AYGA 1RTZA 3CEDA 5L9XA 3M30B 3KLGB 4RNFA 1RCOB 1NK0A 4D3GA 2AEJA 1NMEB 2JC0A 3ZNJ1 3D0GE 4B3SF 5T7LB 5EWEA 1U6BA 5IT9U 5C25B 5I3PA 4CYUB 3GV5B 3RRGA 2HMIB 1D9DA 3MR6A 3C3LA 1RU2A 2V8HA 3LP1B 4PG7A 4BC9A 3Q8VA 3NOCA 4C3KA 3MMAA 5KFDA 2WCXA 3Q2SC 4N5SA 1M1GA 4WK3A 1U1QA 2WRMA 4FXDA 3GR1A 2J9DA 2HS0A 1QE1B 3PYFA 4JI5F 2QMXA 4Q2MA 1XEZA 3K5OA 3FEXB 1DLOB 2UXDJ 2J0SD 2JOQA 2PMHA 4C0BA 2YXLA 4Z7YA 5LJ5Y 1Q53A 3N01A 3DKDA 5DO2A 4B9SA 1H2VZ 1JLEB 1XMOF 2QYCA 4L6V3 2MQMA 2AX0A 3A8KA 4C4WA 3B6BA 3FMBA 2GJ2A 1D09B 2QFIA 3BN7A 4FNIA 3T1AA 4X4QA 4ECUA 3ETMA 3D5MA 2BXJA 3IM8A 2E1RA 1G1XA 1LW2A 4ZHRB 3OLAA 4DQIA 4P52A 2EFNA 3W2WA 4H4KA 2HFNA 1ZPVA 4CH7A 1W2BR 1RLDA 4USKA 1JNRB 1U1PA 4P73A 4LRBA 3QFHA 3IS9A 3TR5A 1RT3A 1VHFA 4P2XA 3PJXA
chains in the Genus database with same CATH topology
1S1VB 2XMKA 1X9SA 5G0RB 4X84A 1RTIB 5IT9Y 4N41A 4KSEB 3CTRA 1SL1A 4PXCA 3HHLA 2OPPA 1G3OA 3FDSA 4NA3A 4YFUA 3UD3P 4LVNP 2KFNA 4Y2AA 4OI1A 1IBKF 4HL9A 1YWXA 3ZZYA 2VBZA 1R0AB 2A3JA 4J9PA 5D3GB 1FESA 2M0GB 4WFZA 2NYIA 2EFQA 3PACA 1WACA 1F5CA 5KFCA 3SI8A 1KLMA 4I2PA 2OMOA 4KB7A 4WYLA 2YKPA 2ZH9A 4G6VB 2DR5A 3M4XA 3B4DA 2VFVA 2XMWA 4BHQA 2XS2A 5I42B 2FJVA 4Q43A 2VUGA 3CCMS 2AGPA 2BOPA 2FC8A 1U25A 1PILA 2FJEB 4ZPVR 3CJKA 4LMZA 3GSDA 2A18A 3OLBA 3PW0A 1X4GA 2KM8B 3GV7B 3G6VA 1BQMA 5F3ZA 2VD3A 5K8MA 1S0OA 1X8DA 1UP1A 3MD3A 5GADU 1MU2A 4O3RA 4A8WA 5A6WA 2GA7A 3DLKB 1SKWA 3PX0A 2UUTA 3AJ1A 4QPXA 3NCPA 1KOHA 2C3UA 3POTB 3DLEB 2KO1A 3QMQA 2F7VA 3DYAA 2PT0A 3J7YU 2UUAF 3CO9A 2CG4A 2BANA 1IR0A 5KFRA 3M6WA 1JLCB 1S1XA 3CB4A 2AYBA 1FTCA 4BBYA 4ECTA 3SSQA 4NWBA 1U6FA 1X4FA 2UXDF 5HP1B 1FO1A 3DLGA 3NBPA 2VH7A 2VPYB 2DH9A 2KHCA 3D1HA 5M2UA 3DGPA 2CQCA 1VQPS 2HNDA 1K73T 3D0HE 5HO4A 3G6XA 5KFMA 4ZPCA 2PA3A 4B3TF 4O44B 3J7A1 2WAQD 4ELTA 2H9ZA 2IM2A 5A8WB 2FHJD 4KC5A 1M5SA 3CCSS 1K8AT 2EKYA 3IS9B 4M8LA 1UVKA 3CDUA 2MMYA 1GNKA 4J9LA 4ED2A 2CZVC 2ALZA 1BC6A 5DGAA 1ROFA 3D1QA 5E0OA 4ZCMA 3DHXA 4OX9F 2HAIA 4EU0A 4ZVEA 4A8YA 1S9FA 2OPPB 1PSDA 4IO9Q 3TVYA 2LXUA 5LL6d 1U2RA 3P6YC 1NKCA 2CJKA 2RNEA 1HNXF 4MK9A 5J2PB 2ZE2B 2YKOA 4Y0FA 4I1TA 3CJ5A 2FLOA 4NLGA 2ZVSA 3ULHA 1KLMB 2KU7A 2D9PA 2LDIA 1YITS 1N5SA 4IDKA 1VMBA 4PG6A 3FSIA 3QWPA 3OXLA 2LU1A 3BJYA 1TK5A 3VTIA 2PE8A 4GMKA 4RBVA 2IRYA 3FCHA 3OL8A 2B51A 4EBEA 3CJKB 2HNZA 3BZQA 3LWLA 1JLGA 5AE3A 2EG2A 4K4TA 4DUYF 3DMJA 2DGOA 3MF5A 4J9NA 5F8NA 2DNNA 1BQMB 3AHPA 3AA9A 2IVFB 2KFYA 2VOPA 2VV5A 3I5AA 3T19A 1MU2B 1LQ9A 4O3QA 1TP7A 4YR2A 5DQGA 3SV4A 3PRBA 5J1EB 3DI6B 1RA6A 3SEOA 1HHSA 4C0HA 5DRKA 2B9YA 2DHGA 5I3QA 4RWXA 2KZZA 3I5BA 2GQ2A 1J5EF 4X66F 4ALZA 2YH1A 4FXWA 2LXFA 5DG8A 4H4MB 1QSLA 4KKOB 2R4FA 3V6KA 3TUIC 4NLPA 1RYRA 5HMYA