1J5OB

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 99
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB03
4O4GB 4FBTA 3KHHA 2EC0A 3IG1A 1QAJA 3FQKA 3ISND 4ZMMA 4QW9A 2W7OA 4ICLB 3DOKA 2BRLA 1REVA 2VG6B 4WXWA 3CO9A 2R8JA 1RTHB 3MEEA 1RT7A 3DRSB 3M8PB 4IFYB 2F8EX 1IKYA 4URSA 4DL5A 4O3SA 3PW0A 1SH0A 4KSEB 3MEDB 4ECYA 1RTIB 3OHBA 4ZHRA 3FDSA 3H4DA 1RYRA 1C1CB 1DTQA 3KLGB 1KLMA 3IGVA 2IBKA 5HBMB 4M95A 4IG3B 1T05A 1TKZA 1TL1B 2BANA 2YNHA 3ITHA 3I0RB 4NLSA 4WXOA 4U6PA 4F50A 4G3IA 2YKNB 4O3PA 2JC1A 2FVQA 3V6DA 2R8HA 4ECXA 2C2EA 3KJVB 4XO0A 4NLRA 1SV5B 3OL9A 4WE1B 3DDKA 2WONB 5EWEA 1S1TB 4KHRA 1HNIA 1S1UA 4ZPCA 1MU2A 2D3UA 3M8QA 3NAHA 2E9RX 1JX4A 4TN2A 1JLAA 4H4MA 5KFWA 3OHAA 5KFUA 2IJFA 5EWFA 5DLFA 1RTJB 3GQCA 3MR3A 3HKWA 2IAJA 5F9NA 3DLKB 1T94A 3KK2B 4TXSA 3E51A 2B43A 4MFBB 5T14A 3RB0A 5L1LA 3SFGA 2IC3B 3KK1B 3BQ2A 2R8IA 4ICLA 1J5OB 5I3UB 3UDLA 3LP2B 5K14B 1RTHA 5EWGA 4KAIA 3M8PA 4IFYA 3FRZA 4IOBA 4NRTA 2XWYA 1S48A 4EBDA 4RNOA 1RA7A 4EO6A 1RTIA 3DLEA 2RDJA 5KT7A 3KLGA 1T03B 4TLRA 3H40A 5HBMA 4Y2AA 2R8GA 2UVRA 4JUZA 4O3QA 1TL1A 2ZE2A 2FJXA 4LSNB 4KFBA 3EZUA 3DRRA 1S10A 1RT3B 5C5JA 3PW5A 1IKWB 4PQUB 5J2MB 2IM1A 3TVKA 1VRTA 1HNVB 1SV5A 1TP7A 2QE5A 4K4SA 2WONA 2OPRB 4IH6A 1S1TA 4NLVA 5KT2A 2ILZA 3CVKA 5L1JA 4RW6A 4WZQA 3V81B 4NYZA 5C24A 3LANA 2AGOA 3CJ0A 1TVRB 3LP1B 4KO0A 4LQ3A 4IG0A 4ZP6A 4F4ZA 2HNYB 3CJ3A 4MFBA 3CDWA 4YR2A 5KT5A 2IC3A 1S0MA 2RF2A 5FDLB 3JSMB 4K4ZA 3RB4A 3MECB 4ZPBA 2OPQB 4MIAA 2C28A 3NGDA 1JLGB 3T5JA 3TAMA 1UWBA 5I3UA 3D5MA 3LP2A 5K14A 1JIHA 3MTKA 1FKPB 4ZVHA 1XR6A 1S0OA 3PVXA 1IM4A 2FLPA 4RNHA 2OH2A 1FK9B 4EYIB 4DG1B 4IDKB 4K4WA 1I6JA 4O44B 3KLIB 2WCXA 3Q8SB 1RT3A 3PHEA 4J9OA 4IH7A 1JLQA 5KFKA 5CYMB 1S0NA 1S1VA 5KG1A 2J6TA 5KFZA 4YR0A 2BQRA 5CYQA 2OPPA 2AX1A 3GV8B 1HARA 1S1WB 4URGA 3CJ5A 2W9CB 1S6PB 1JLFB 3DM2B 4MH8A 4WYLA 2ASLA 1JLBA 1RT5B 3HVTB 2HNZB 1TVRA 3LP1A 1S4FA 4IRDA 5KFIA 3DOLB 3IS9B 4WZMA 4MKAA 3Q8QB 4ZP8A 3KLHA 1N48A 2HMIB 3DRPB 1RA6A 3H5UA 3ICLA 4ZP9A 3Q8RB 4F4WA 1JLEA 5FDLA 5KFPA 3MECA 2JC0A 4TY8B 3SI8A 4XPEA 2B5JB 1RTDB 4O3OA 4QWEA 2VG5A 3C6TB 5KFVA 3M9NB 2AQ4A 1QE1B 4DL6A 4PUOA 3KLFA 3MFIA 3G6YA 3VQSA 3PJXA 5DQHA 1FKPA 5DLGA 2FLNA 5KG7A 4J9SA 1S49A 4RW8B 4ECUA 2XC9A 3OSPA 1HQUB 4TQRA 1RT1A 1LW2B 4NLYA 2IM2A 1FK9A 3EPGA 4Y2CA 4Y3CA 4O44A 3KLIA 3FFIB 4IRCA 4Q43A 2HNDA 2DPJA 2RDIA 1VRUB 4I7FB 4ECWA 3QLHB 3CDEA 5KFDA 5KT6A 2VA3A 4RW7B 3SFUA 1D1UA 4H4OB 2IJNA 4WFXA 4KKOB 3KHLA 2R2TA 4Q8FA 4J9LA 1S6PA 1JLFA 3DM2A 2JEFA 3HVTA 1RT5A 3MF5A 3BSNA 4EYHB 4ZVFA 3IS9A 5HP1B 4RNNA 3GILA 5KFRA 1FKOB 1SH2A 3BSOA 3PW4A 5KT3A 2HMIA 3DRPA 4K4YA 3OL8A 4QWAA 4LQ9A 2D41A 4EEYA 1OS5A 2WK4A 1EP4B 5KFMA 2B5JA 1N6QB 1RTDA 4M94A 2IM0A 3KMSA 3KHGA 3C6TA 2WTFA 2YKMB 4J9PA 4DL3A 3PW2A 2C2DA 3QIPB 1N4LA 3DLGB 2HAIA 4HYKA 4GC7A 2YNGB 4MK8A 4NLOA 2W8KA 4IR1A 4RUAA 4KV8B 1IKVB 3MEGB 3RAXA 2ZD1B 4O4GA 3H5YA 1N5YB 3I5CA 1JXLA 4IR9A 3PR4A 1HQUA 3V4IB 3H4BA 2WOMB 1LW2A 1K1SA 2V4QA 2BE2B 2B6AB 2W9AA 2D7SA 2VG6A 1RT2B 3FFIA 3LALA 4QPXA 1BQMB 3DRSA 4NLPA 4NRUA 2W8LA 1ZETA 3HHKA 5KG2A 1SUQB 3MEDA 3KNAA 3PW7A 4RW7A 2AU0A 2W7PA 1C1CA 5HLFB 4H4OA 3H98A 3LAMA 4KKOA 4IG3A 4TYAA 4WFYA 3H2LA 3I0SB 3I0RA 4DEZA 1NHUA 3UPFA 2AX0A 2YKNA 5F8GA 4EBEA 4J9NA 3KJVA 4QWDA 4ZPAA 1C0UB 4IH5A 4NCGB 4WE1A 4ZP7A 2FJVA 1LWEB 1FKOA 4G1QB 4LSLB 4PWDB 5C25B 1IKXB 4RUCA 4WFZA 5KFNA 5EDWA 1TKTB 2XCAA 1QAIA 1S6QB 2FVRA 4IFVB 1EP4A 2XI2A 1R0AB 1SH3A 2JEJA 4TYBA 3PJWA 1DTTB 2UUTA 3QGGA 1RYSA 5F8LA 2YKMA 1S9FA 5DGAA 1RTJA 2J6SA 3DLGA 1BQNB 2YNGA 3LP0B 2XGPA 3DLKA 4NLDA 2ATLA 3KK2A 5L9XA 5KFHA 1IKVA 4F4YA 2ZD1A 1N5YA 3BREA 5J2PB 3KK1A 1YVFA 1XR5A 2WOMA 4NLQA 5KFTA 4IQXA 5J2QB 2B6AA 4MK7A 3KLEB 1J5OA 3QZ7A 1RT2A 4NLGA 5JUMA 2I5JB 3DYAB 3QO9B 2R2UA 1BQMA 3T5HA 3D28A 3G6XA 4O3NA 1C2PA 4YR3A 1SUQA 4ED1A 1S97A 1QUVA 3QGHA 4O4RA 1T03A 1RAJA 3KLVA 5KFGA 2GIQA 4R8UB 5J1EB 5KG6A 4U7CA 1LW0B 2C22A 1JKHB 4LSNA 4YMEA 1IKWA 4PQUA 5J2MA 1HNVA 4I2PB 4NCGA 3JYTB 5KFFA 4ECQA 2JLEA 2OPRA 4LSLA 4RW9B 4PWDA 4MK9A 2R8KA 2XGQA 1IKXA 2AWZA 5DGBA 3RBDA 5KFXA 1TKTA 4R5PB 1S6QA 3V81A 3DMJB 1R0AA 2FJWA 1U09A 2V0NA 4URQU 3ISNC 4RNMA 4ED8A 1DLOB 3H59A 3IG1B 1BQNA 3LP0A 4K4VA 3IRXB 3NL0A 3G86A 3DOKB 2HNYA 2ILYA 4KB7A 1W25A 4NZ0A 3GIJA 5KT4A 2XCPA 3T5LA 3E01B 3JSMA 5KFOA 3MEEB 4ECZA 2UVUA 2OPQA 2UVWA 5HROB 5KG5A 4YP3A 1JLGA 3KLEA 1JLCB 2I1RA 1GX6A 3DYAA 4ZHRB 3QO9A 1RT4B 2C2RA 2UUWA 5DQIA 2D3ZA 1T05B 2BANB 2YNHB 5DG8A 2WB4A 1S9GB 4Q8EA 5F8HA 2CKWA 4K4TA 2AGPA 4DG1A 5J1EA 4IDKA 5F8IA 1LW0A 3KK3B 1JKHA 5KG0A 4ECTA 1C1BB 1KHVA 1HNIB 3M8QB 4I2PA 4RW4B 5CYMA 5KFLA 3BQ0A 4FBUA 4ED0A 3KHRA 4NLWA 4H4MB 2JEGA 5F8NA 1S1WA 4R5PA 3N6MA 2W9CA 1N56A 2VG7B 2IAJB 3DMJA 3T19A 1Z4UA 3CJ4A 5KFYA 2HNZA 2WRMA 1S9EB 1DLOA 3V6JA 3C6UB 3DOLA 4WYWA 4RZRA 1S1XB 3M9MB 3QIDA 3IRXA 5D3GB 3OL7A 4RU9A 5L1IA 1RDRA 3NAIA 3E01A 2IA6A 2IMWP 3OLAA 5C42B 4TY8A 4J9QA 5DG7A 5HROA 3UQSA 1JLCA 1QE1A 3DLEB 4B3OB 1LWFB 2FVPA 1RT4A 5KFCA 2UVVA 3T5KA 1HQEB 3OLBA 3RAQA 2ZE2B 1S9GA 4KFBB 4RW8A 3DRRB 1ZTWA 3H5SA 3HVWA 1TV6B 3I5BA 3I5AA 3IGNA 5DG9A 4I2QB 4F4XA 4ECSA 1TKXB 4DL7A 3TQ1A 3BR9A 1VRTB 4NLTA 3KOAA 3MR6A 4MIBA 3KK3A 2ZKUA 2YNIB 3HVAA 1C1BA 4Y34A 1GX5A 2QV6A 5KFSA 1HPZB 3H5XA 1VRUA 4I7FA 4RW4A 1NHVA 3OL6A 4RW6B 1RT6B 2RKIB 3QLHA 5KG3A 3M9OB 1HMVB 5C24B 4TQSA 4KHMA 4QW8A 3MR5A 1TL3B 3GIMA 4KO0B 3QGIA 4ED3A 5KG4A 4IG0B 4K50A 2R2SA 1EETB 2VG7A 2ALZA 5EUHA 2E9ZA 1ZTTA 4ZPDA 1S9EA 5L1KA 4O3RA 5I42B 5DQGA 3C6UA 2RF2B 3LAKA 4KBIA 2YNFB 1S1XA 5HP1A 3QZ8A 4RNFA 5KFBA 5D3GA 3DI6B 2BRKA 3TAMB 1UWBB 3GIIA 2VA2A 5KFQA 1HYSB 2IM3A 5C42A 1N6QA 3N6LA 4ED2A 3V6HA 4K4UA 3QIPA 1LWFA 4B3OA 2OPSB 4K4XA 3GV7B 1HQEA 1T3NA 4KV8A 4QWCA 3MEGA 3RBEA 5F8MA 1TV6A 3V4IA 3BSAA 4I2QA 2V9WA 1JLQB 1TKXA 2GIRA 4DL2A 2BE2A 1KHWA 5F8JA 4MKBA 2BR0A 1C0TB 1S1VB 1D0EA 4FS1A 2JEIA 4ZVEA 2XI3A 2YNIA 4OL8A 3BGRB 3GYNA 2ASJA 5CYQB 2OPPB 5KFEA 3BSCA 1HPZA 5F9LA 2FVSA 3G6VA 4J9KA 5JXSA 1RT6A 2RKIA 1HMVA 2ASDA 3NMAA 1JLBB 3BQ1A 3OSNA 5HLFA 1TL3A 4QWBA 3EPIA 4ECVA 4R0EA 4Q45A 1EETA 3I0SA 3T1AA 3KLHB 4J9MA 5I42A 4JV0A 3NBPB 1C0UA 1JLEB 5KFJA 1LWCB 2BQ3A 2YNFA 2R2RA 4JV1A 5J2NB 1LWEA 2BQUA 4G1QA 3DI6A 4EBCA 5C25A 3CIZA 3N6NA 3MR2A 3MFHA 3PZPA 2VG5B 2J6UA 4ID5B 1HYSA 4Q0BB 4PUOB 1WNEA 3KLFB 2W9BB 3RB3A 4IFVA 3QYYA 3GIKA 1DTTA 4ED6A 3UR0A 3KMQA 1RT1B 2FVCA 2OPSA 2V4RA 3IN5A 3CJ2A 2AGQA 3V6KA 4GC6A 1REVB 4FS2A 2GC8A 2O5DA 4ECRA 1XR7A 5J2PA 1TQLA 1RT7B 2HNDB 2DPIA 1IKYB 5J2QA 3PR5B 3Q8PB 1C0TA 4KE5A 2I5JA 3BGRA 4XPCA 3RB6A 1DTQB 2HWIA 1KLMB 4H54A 2WHOA 1K1QA 1TKZB 3ITHB 5KFAA 4DL4A 4Q44A 4TY9A 4NLXA 3GV5B 4JV2A 3V6DB 4IRKA 2CJQA 4YQWA 4R8UA 4NLUA 4ZVGA 2FLLA 3BJYA 4X2BA 1S1UB 1CSJA 2E9TA 1MU2B 3CWJA 3NBPA 3JYTA 3FQLA 1LWCA 3CDUA 5J2NA 1NNDA 4HKQA 3NKYA 4RW9A 4ED7A 4EO8A 1JLAB 1MMLA 4IKAA 3FSIA 4ID5A 4Q0BA 2W9BA 4J9RA 2HWHA
chains in the Genus database with same CATH superfamily
4O4GB 2FHJA 1OO0B 4F8RA 2FPHX 2PC6A 3GG1A 1RHJB 3GJSB 4DUZF 1RTIB 3H4DA 2EFOA 4DR6J 3B4DA 1S12A 4XO0A 2QRRA 5EWEA 1S1TB 2D3UA 2E9RX 4TKTA 4LF6J 1SVDA 4CLSA 2YH0A 3C14B 3M7VA 3FBCA 2ZBIA 4DUYF 1SJQA 1J5OB 3M8YA 4FXDA 2BJ3A 2VFTA 3BN7A 2QA1A 3BYRA 3NP5A 1T03B 1VHIA 1G2EA 3M30B 1CC8A 2QE5A 2HHQA 4NLVA 4PCQA 4PRFA 2X7IA 2HGMA 1R89A 2BACA 4MIAA 4LIRA 1WHVA 3U1LA 2W24A 1RZMA 2ACYA 2DXDA 1PBAA 3Q86A 4ZVHA 3OVSA 1GAOA 1FK9B 5LXYA 3ENAA 2DY1A 4DS5A 2BQRA 2CQCA 1ACMB 2MY8A 1S1WB 3CJ5A 1S6PB 1XIQA 2UUAJ 2LP4A 4OYWA 4OI2A 3O5TB 1SL0A 1EKRA 3HPOA 2RB7A 4C3MA 4FNHA 4B9MA 4N5SA 4W90B 4LF5J 3T3FA 1L3TA 2HSEB 3CB4A 2JWNA 2UUBF 1QSYA 1DARA 2P8IA 2GAHC 1N6QB 5KFMA 4ZVOB 4DU7A 4C8KA 2WTFA 3QIPB 2JH3A 2A0FB 3AODA 2ZD1B 2OTJS 2B7CB 2V2QA 2VC0A 1U0HB 2PE8A 1SKRA 2D7SA 3MOZA 2KG1A 1FRHA 2NS1B 1YJRA 3I0RA 2IFXA 3VVUA 5D0GA 3IAS9 3NGKA 2Z2YB 1KQGB 2DXEA 1IBMJ 2MQOA 4RUCA 4WFZA 5KFNA 1IXKA 2HQFA 4FYYB 1VJWA 5D15A 2MKIA 5AJ3J 4NLDA 4FYVB 2YKQA 5ETNA 5J2QB 1VLOA 3CJSA 1CLFA 1PJ6A 1G6BA 2F4FA 2VHGA 1UPMB 3B4MA 2YXLA 4K5RA 2B4PA 2OEJA 1U1MA 1QY7A 1HNVA 3NRBA 4NCGA 3ZC4A 1GMWA 1NM2A 3QMQA 3GG0A 2B8QA 3ET6B 1KQKA 2FJWA 4URQU 3GTYX 2Q6BA 2ZEJA 3IRXB 3M05A 2HNYA 4ZOSA 2AV5A 2XCPA 2HFZA 3RRGA 1CJTB 2MTLA 2UVWA 5L9NA 1JLCB 5H9EK 2QFJA 1RT4B 3M2RA 5LMNF 3FUYA 1PYSB 5GVQA 2LXUA 3LPEA 2GMLA 2DBBA 1E6VB 3O8WA 2CQHA 4ED0A 4IOAQ 2JEGA 3QFHA 1S9EB 3G87A 3DOLA 3OR2A 3OL7A 1TMJA 4CO0A 1KLNA 4DQSA 2ZE2B 2QGFB 2ROEA 3BPSP 4JI0F 2E1PA 3L7OA 2ZOGA 4I7FA 5KG3A 1ZM9A 2E29A 4JI2F 1EETB 2VG7A 3KG1A 4I64A 4ZPDA 2R7OA 4F26A 3LQVA 5HP1A 2DH9A 2XMJA 1FO1A 4PG7A 1UEKA 2YKPA 2UXCJ 4QU7A 4PG4A 3J81Y 4E98A 2NXCA 4EZ6A 3W7BA 1R8PA 3RBEA 2QLWA 4CYUB 1C0TB 5ETMA 1CBKA 3GYNA 3FCVA 1HPZA 2C2ZB 3Q8VA 1R3NA 4HHJA 2BQ3A 4A8MP 3QATA 1I51B 2J6UA 4KY3A 1RJJA 1GXUA 1N52B 4N8NA 4A8OA 1Y5NB 2YWGA 3IWXA 4RBVA 3VCDA 1U49A 2MLZA 1DTQB 3Q0AA 3OFFA 1TKZB 4DL4A 2HEKA 4U8VA 4OJGA 4ZVGA 1FXDA 1NBEB 5H1SV 4F67A 4DV6F 3CDUA 3EICA 4YN3B 3Q2SC 2C2NA 3MR7A 3AQPA 2XMWA 3FQKA 2F40A 2BRLA 1U2RA 1TAQA 4DFKA 3FDSA 2BJ1A 3IGVA 4M95A 2KVQE 3KJVB 4WE1B 1N32J 1F2GA 3KDOA 4K8RA 2IJFA 2PEHA 4QJVA 4UY85 4J7CA 5A76A 2ZITA 5I3UB 1WG4A 2HAFA 3FRZA 4IFYA 4YY3J 2GW8A 2Z2ZA 3M2UB 1M1GA 4XTTA 4Y2AA 3K8WA 4DQIA 1H3DA 2HRUA 5LSRA 1SV5A 2ZBCA 1VRQC 5KT2A 2RQCA 4WZQA 2BJ7A 2AGOA 4ERDA 1NK8A 2X1AA 4OJ3A 1FCAA 4L75A 4AYBD 2MMYA 1OIAA 2XMAA 3SQOP 2HFVA 1RHQB 1UJ6A 4JI4F 3NG8A 1DQ9A 4K4WA 4X65J 5HVGA 2SXLA 1HA1A 3PX6A 4B3TF 1O8BA 3L3CA 4KHPF 3EGNA 3R2CJ 2IJRA 3TOQA 5DQHA 1SJ1A 1Q16B 4NLYA 2HFOA 4Y3CA 1Y9OA 1NK9A 2OFGX 3VZIA 3D1HA 4Z7YA 5LJ3Y 3HP6A 1Q8IA 2VBYA 2RH3A 2HK3A 2GO9A 2CQIA 2V94A 2BM1A 4ZLNA 2L41A 3MM5A 2Q1LA 3HT0A 3PRDA 2A3JA 2EW9A 3UFCX 4O4GA 4IR9A 1R0CB 3V4IB 3Q8UA 1SC6A 3D66A 2AKWB 1FNMA 3K5OA 2WBMA 2KO1A 2Y1JA 2B7BB 2DH7A 5E3QA 4ZS6A 3H2LA 3CULA 1NHUA 3SCIE 3M6XA 1U1QA 2DD8S 4FPRA 1SC1B 4ZP7A 4I69A 3GCWP 4FF1A 3UCZP 5IWAJ 3C14A 3SSSA 4XIUA 5B7WA 5DGAA 2J6SA 4ILLA 2VODA 3LP0B 2NXNA 3QAEA 1J5EF 1YVFA 2CPYA 1J5OA 4NLGA 3QO9B 4DPXA 3OV7A 1S97A 1T03A 3EX7B 3QJPA 1F6TA 3M30A 2KXFA 4MIWA 4ECQA 1M5SA 2DGVA 1DBDA 3RBDA 2RS2A 1ZM3A 4PEOA 3ISNC 2M7SA 2UZAA 3F73A 2OD6A 5K5MA 1RWKB 4LFCF 3UO0A 1P27B 2CA9A 1S9GB 3EGWB 3O44A 2ZUGA 1LW0A 4QIFA 1NK4A 1M5KC 4C8MA 1IBLF 1SIWB 1HNZJ 1S1WA 1ZBTA 1Y7PA 2Y8YA 1FD8A 1KEKA 3QIDA 2FJBB 1H2TZ 4GKKF 1LWFB 2BW7A 5F41A 4XDCA 3GZ7A 2HVZA 4TU7A 1CEZA 2VPWB 4F3MA 1P9QC 3HHLD 1RP5A 2J8AA 3HSZA 3M9OB 3J80Y 1HMVB 2E5IA 4QW8A 2DT9A 3PIPQ 2K1RA 1YLXA 2DITA 2EPIA 1N36F 2EFNA 1T95A 4QIEA 5M2RA 2QG9B 2EK6A 5D4OA 1N6QA 2MZ1A 2LQBA 5CHCB 3QIPA 2OPSB 3VGSA 1LXNA 3KUEA 1TV6A 1VYAA 2ASJA 2ZHOA 1XMQF 3NMAA 4J9VA 2V4JB 3US5A 2L48A 3UDCA 2G1DA 1OYDA 1HR0J 5J2NB 2BQUA 5LSOA 2FDNA 2J5AA 1KFDA 3HMJG 3VVTA 4C2MA 1NJXA 2GNKA 4IUFA 1RT7B 5J2QA 1YZ6A 5EX0A 1KLMB 2MQ8A 3BGLA 5KFAA 1IQTA 2CJQA 4YQWA 2HFNA 3BH6B 2UP1A 2QA2A 1WI8A 3WIUA 2LCWA 4J9UE 4ID5A 2UXDF 4J9RA 4HTIA 3KHHA 3CT9A 4OHYA 4WIQA 1K73T 1CJTA 3TEHB 1VQ8S 2OP5A 1TL1B 4OI3A 3HHLB 2GS8A 2E5LF 2R8HA 2I38A 4RO0A 2G13A 1JJCB 2IVMA 4KHRA 4LF1A 4KH1B 2NZ4A 4LFBF 4NI2B 4OQJA 3G2XA 2BOAA 3W9HA 3OT9A 3RB0A 3IMQJ 4DPOA 2ZHAA 2VPZB 1JJHA 2Z2MA 4CDIA 2CZVC 2ZE2A 3L09A 4EU0A 3MI7X 2RU3A 1R6YA 4BC7A 3VAHA 1Q86T 4FYXB 3W9IA 5EN1A 2QN6B 2RQKA 3CDWA 2BJEA 1S0MA 1YITS 3PEHA 3RZAA 2OPQB 1UAWA 4ZPWR 2HLUA 3MTKA 2G9OA 7FD1A 1X31C 4OHVA 1U1KA 2UU9F 1OSDA 3R1LA 3KLIB 4DV4F 4Y0FA 3OR1B 3GV8B 3SCLE 3HM9A 3LA0A 3DDIA 2P5VA 3IS9B 1NU4A 4NZ6A 3M6WA 2W2NP 2M2BA 2DGWA 1RWUA 1B0TA 1FTCA 4RW8B 4JV5F 3PTWA 3FBBA 5T7LB 1Y3JA 3HT3A 1RWXB 3D6HB 3PNIA 1EARA 1D1UA 4J9LA 3MF5A 4A46A 4YEAA 1TFYA 1KP6A 4BBYA 3NCRA 5LJ5Y 1PKUA 1OS5A 2F65A 4ED4A 5GMDA 5L38A 1TU0B 1HQUA 1Q1KA 2DHHA 1QJHA 1H98A 4QPXA 1XNRF 4ZCIA 3AA8A 4USMA 2W8LA 4TLQA 4FKYA 4CLFA 2KHCA 2QC3A 2APOA 1WKJA 3KJVA 3LW5C 4WE1A 1BY9A 2QSFA 1WEZA 4ZJLA 1QAIA 4IFVB 1SH3A 5A2QY 1AROP 4G6VB 1RYSA 3PACA 2NQPA 3DLGA 4LF4F 3HCXA 1NDLA 4X4PA 4U95A 2FGOA 2CNNB 3MCMA 4MK7A 2PDAA 1NDPA 2LVWA 3I56S 1IN0A 3M2UA 3TJ9A 3GFHA 1B0PA 1EZZB 2IHR1 4FYWB 3KLVA 4R8UB 3F44A 5E41A 4N8OA 2AF6A 3DCAA 1ZYQA 5FD1A 2QX0A 5KFFA 1KWMA 2JLEA 1RWVB 4LSLA 5DJBA 3M32B 5KFXA 2YWHA 1SKUB 5B0BA 5H9FJ 1D09B 3MEEB 2RS8A 4LF8F 3QJJA 2V5HG 2UUWA 2MSSA 3T1HJ 5DQIA 4F4KA 2BANB 2K7JA 1MWZA 1HNIB 2GGPB 2VPXB 3RTVA 2GQQA 2MGZA 4A8KA 3MUVP 1Z4UA 3EYZA 2YBVA 2MQMA 1DLOA 1S1XB 3M9MB 2HRTA 1X4FA 2NSBA 4B9UA 2BABA 4B3RJ 3OTCA 5C2CA 2VC1A 4DR4F 5DG9A 4F4XA 4I2QB 1RACB 1TELA 3TQ1A 2DGQA 4X62F 1NK6A 1NHVA 1BUXA 3GIMA 5IV3A 4IG0B 4KGXB 1P6TA 1N54B 5KFBA 4DV7F 4ELUA 5EGYA 3FZ2A 3J7ZT 3HFKA 3V4IA 1J27A 2YNIA 2CPZA 3J7YI 4DV5J 3IM8A 3CJTA 3OSNA 3QT8A 1A0OB 1BMQB 1LK7A 3NBPB 2GHPA 2PFFB 4ID8A 5DDRC 1IBKF 3CCWA 3UDEA 3G8QA 3HK2A 3FEYB 3KMQA 3D2WA 1XNQF 4GC6A 2G2ZA 2DGUA 2BE9B 2QFIA 4ECRA 2EFQA 2CVIA 3OTBA 4P73A 1F3FA 2CJKA 4H54A 2HWIA 2NXUA 2IVYA 3EZOA 4MJKA 4X2BA 3FRYA 4LRAA 3T6BA 2CWXA 2GQ2A 1SC4B 4IOCQ 3MM8B 5JVHQ 2YWFA 2N4DA 3UN5A 2LDYA 3QT6A 1LNQA 3KJFB 3PYFA 5CZXA 1WHXA 4G3IA 3P45B 4F50A 3GJQB 1WSVA 1S1UA 4ZPCA 4M5KA 4ED5A 3OVAA 5ETRA 2LMIA 4UZCA 3GQCA 1ROFA 2GVDB 4OYIA 4MFBB 1Q53A 4F36A 1U6BA 2RRAA 3UDLA 3LP2B 3QRPA 1L3UA 2RDJA 4TLRA 2R8GA 5BJRA 4KYZA 3J81U 3C15B 1X4GA 3OQ2A 2FZGB 2XWXA 1NSAA 2HKEA 1WOPA 2XNQA 1HHTP 2ZKTA 3JSYA 4USJC 1JNZB 3THTA 5IXUA 5RUBA 3Q8SB 4F3OA 4YR0A 4X66F 1NDCA 4B3MF 4QQBA 2XZTB 3DM2B 1K8AT 3VGTA 4ANEA 1KN6A 2V4JA 3T9ZA 4CO1A 3M9NB 3MXHP 3ETMA 4DV3F 4TQRA 3IBWA 1XMOJ 1X4HA 2GA7A 4FF4A 2G1HA 3CDEA 2VA3A 5I3PA 2MQLA 3JQKA 2HS3A 3SXLA 3N5FA 3PW2A 1N4LA 3MPUB 2HAIA 1RWOB 4DPUA 3MM9B 4KV8B 1N5YB 2XMMA 2CZ4A 2QMXA 3TUJC 1K1SA 2AEMA 2V4QA 3DRXA 4NRUA 1ZETA 3PW7A 2EFGA 3O1LA 4OX9J 3FKBA 4RKUC 2COLA 3AT1B 3HHLA 2D74B 3IC1A 4ZPAA 1NZAA 3P3DA 3TWZA 2DNOA 3N79A 1ZH5A 2XMUA 3ADAC 3W2WA 2XI2A 4TYBA 2UUTA 4NI2A 1S9FA 2CQ2A 1FWLA 2YNGA 4DF8A 3IR5B 1XR5A 2F5GA 5KFTA 2YQ1A 2OI2A 3G6XA 1TAUA 4OYZA 1QAXA 4MAKA 1T9YA 1Y0HA 3TZYA 1GXLA 4DPTA 2ZWOA 1TKTA 3W64A 1R0AA 3H59A 4NXMF 4JI5F 1QLNA 4WKRA 3KXDA 1NK5A 2OPQA 2HIYA 4JI3J 5DG8A 3U1NA 2LKZA 2V2VA 4DZ6A 1HBMB 1NAQA 4I6AA 4RW4B 1NKEA 1M0SA 4I6WA 2B3TB 3N6MA 1VQKS 4C7QA 4OV1A 3PG9A 4ITSA 1PAUB 3WZ0A 2DNKA 3Q83A 2BBEA 3OLBA 4RW8A 3TI0A 5T7LA 4K0KF 1NRKA 3ILLA 1AXQA 1GX5A 2DNPA 3H5XA 1WNEA 3M2VA 3KDNA 4NMLA 4K50A 2CPDA 4DDFA 1ZTTA 4AL7A 4HLBA 1VR6A 3RJMB 4LR7A 4DV2J 3R27A 3V5RA 1VDHA 4P9SA 4C98A 1S1VB 1RLCL 1UL3A 1RT6A 2AT1B 1VMBA 1CS4B 1U7LA 2DYAA 5J1PA 3KLHB 2H3EB 3DI6A 2QL9B 3LWLA 2P9CA 4JI8F 4B9NA 4IFVA 2FC8A 2DVIA 3UR0A 4LR9A 3V6KA 1MMDA 3PKYA 4DFJA 5HQ8A 1W7WA 3RB6A 2ZDPA 4QYRA 5K8MA 2WHOA 3TA0A 4NLXA 3B54A 4R8UA 1PCAA 1ZAXA 1OY8A 5AXLA 4LFAF 2OELA 2XBPA 4QIWD 3DFEA 2NREA 1X60A 2MXYA 1QAJA 3BGOP 4K2XA 4QW9A 3UVJB 4ICLB 1UVKA 3VGVA 1HW9A 3MEEA 3H7HB 1CPZA 2F9JA 1F9EB 1RYRA 4LF7F 2BANA 5ADZA 2JZ5A 4ECXA 1WG1A 1P1TA 2KRRA 3DDKA 3MAHA 3O6QA 1R6VA 1HNIA 3R6GB 2HRYA 4TN2A 5GAEI 1RTJB 1WKKA 4BWMA 4DR1J 3OW2R 3LWMA 2LXFA 2IC3B 3KK1B 3N9UC 1OWXA 3Q89A 5K14B 2ADBA 1N5TA 3EVWA 3QFWA 4JUZA 1FHTA 3OFEA 1CULA 2J9DE 1Y3KA 1VQ4S 3RW7A 3HSDA 1CJVB 1VI7A 2ILZA 2M9KA 4X4SA 3ZNJ1 2LYVA 4UZBA 5BYQA 4KPYA 3CD5A 4IG0A 4F4ZA 2E66A 3CD6S 3MECB 4ZPBA 3A8IA 3H90A 1TL4A 5CZVA 4JBCA 1XR6A 1PYTA 4Q2MA 5JJBA 4LVOP 1XBWA 3QWPA 3SEOA 2G0CA 1DJ0A 2X1FA 2HNZB 1TVRA 5ETSA 1QUPA 1KS2A 4OZLA 4UTGA 1AFJA 4WBFA 2H4WB 2CNOB 3L95X 2DGSA 4UOHA 3M8ZA 1PJ7A 4DR7F 5GADI 4PG6A 5AXNA 2LA6A 3VQTA 3P8BB 2AEFA 1U4BA 2JEFA 4EYHB 3KG4A 4QBUA 3GILA 1EP4B 2C2DA 2AGPA 4RUAA 2VV5A 3H4BA 2WSCC 1RT2B 2HVEA 2HS0A 4PXDA 3H98A 1SL1A 2MJUA 2BKPA 4AXIA 1KC8T 1LWEB 4G1QB 4PWDB 4FXWA 1HIYA 2OJ3A 1S0VA 1RHMB 4CO2A 4U8YA 2MKSA 1YRUA 2YKMA 1BQNB 1RK8A 1HBOB 2GVDA 5L9XA 4LBPA 1FWPA 5FJ4A 3N28A 2BE7D 1X4AA 2XYHB 2RD5C 4YB7A 2I5JB 1RQ0A 3ZZUA 4ANCA 1DFDA 1UETA 1SUQA 3BKFA 2XEXA 2NUUG 5SZTA 1HWLA 4I2PB 4L6V3 4PAAA 4Y00A 2OFHX 3G4SS 2JLGA 4WPAA 3H2UB 3D6FB 3M6UA 3SQGB 4ED8A 1SJRA 4DFMA 2HVHA 1OQ6A 2ILYA 3HD1A 1MG7A 2E5GA 3FZBA 3ZTOA 3DDNA 2F4VF 4AQYF 3DXBA 1U2FA 1Q79A 4Q8EA 1YRXA 4K4TA 3TX0A 3ZZZA 4ZCMA 1IUJA 1UEVA 1W26A 2CXEA 3SZ2A 1WOSA 2DH8A 4FF3A 3NS5A 2EC2A 2IAJB 1AYEA 1TUVA 4RZRA 4DR6F 4DUZJ 1MLAA 2IMWP 5C42B 5HROA 3RAMA 4CT9A 1YGYA 3T5KA 2DNLA 1RAEB 3I5BA 4K7QA 3CCRS 3DRRB 4V19X 3BBCA 1X5OA 5BYRA 3RBZA 2XM3A 1E6YB 3QGIA 2XB2D 4DUYJ 2QLJB 1HBUB 2RF2B 3G6ES 3TANA 4WTYA 5DZ7A 5FLXY 4NASA 4YHHF 3MM9A 4KV8A 3IWNC 4OZ3A 3BF4A 2XI3A 5H9EJ 5CYQB 5A2QU 3TUZC 3C8YA 3ILJA 1AT1B 2YX4A 2N82B 2O67A 5D6GA 2R3VA 3D0GE 4JV1A 3FJ2A 3ZFVA 1NH8A 5I3QA 3A3PB 2GJIA 2Z30B 2B9YA 3CD7A 2BEFA 1REVB 2GC8A 2UUAF 1DRZA 1G3OA 2CJ9A 1T9VA 2XZDB 4V1Ak 3UN2A 2RMLA 4OZ1A 4Q44A 3V6DB 1M5HA 4UOCA 2FLLA 3H20A 2FHJD 3JXOA 2E9TA 1LWCA 3NKYA 2JDJA 2QZ8A 4EWTA 5K8PA 3P96A 2ZH7A 4HDGA 2UUBJ 3M8PB 1LEOA 2ZJRQ 3GYXB 5JVGQ 3TO8A 2BKNA 2OSRA 3KLGB 4CLTA 5IT0A 4A48A 2Y0SD 3VAIA 4F0HA 1IWAA 4ZVQB 4M5IA 1D9FA 4OZJA 2OHDA 2W25A 1WC6A 3G9CA 5THWA 4Y2MA 3VAMA 2RE1A 5U47A 3W5YA 1RWNB 5KFUA 1T02A 4D3GA 4LRDA 1N5VA 4GVBB 2B43A 2R8IA 2QTWA 4ES1A 3WC2A 3CJKB 1UJ5A 1RA7A 1HHQA 5HBMA 4C48A 2LA4A 1RT3B 1VS3A 2DNNA 2WONA 2QA4G 2BJ8A 4W4MA 4FYDA 2RAQA 3VALA 3RYLA 3AJ2A 3LP1B 3MGJA 3CIMA 2AIRB 5B0GA 3DGPA 4M5DA 5KT5A 5FDLB 3HULA 2AJ0A 1RBOB 1JLGB 3T5JA 1NSQA 2DNMA 5IV4A 1PIEA 5KFKA 1U6FA 2HBRB 3ETOA 1S1VA 1WD6A 1RAAB 4URGA 5D78A 1VC0A 1RT5B 5M2UA 3GJTB 3KLHA 3DRPB 4PR6A 5KFPA 5LMNJ 2JC0A 3KYLA 1VGYA 3BBBA 3JAMY 5DLGA 1B3TA 3MAAB 1LW2B 3R7BB 4Y2CA 4CO3A 1T9TA 2QA4S 3DXSX 4Q43A 4F3QA 2J0QD 4OYXA 2JFDA 4A8YA 3BKTA 1U25A 4F25A 5L8RC 2A2DA 1VBXA 4H4KA 1JLFA 3AHPA 2Y8WA 3PO4A 2GMHA 5DO2A 3BSOA 1AZSA 4K4YA 4N77A 2CAJA 3C6TA 4JI0J 2VFSA 4MK8A 1IKVB 3RAXA 2E1MC 3BV8A 2OO4A 3CSKA 4JI2J 3HD2A 1ZS6A 3AFGA 1IQZA 2IRXA 2D9OA 2DNYA 3LF0A 3HLUA 4L3NA 4WFYA 3I0SB 2KHDA 4U9RA 3EJMA 2QL5B 3CCTA 2JSXA 3MD3A 2AJQA 1RKJA 5EDWA 2FVRA 2RHQB 2FGCA 5F8LA 6AT1B 1RTJA 1FDNA 4DSFA 5K8NA 4OLPA 2KJWA 3KK1A 4OI6A 4LBIA 2R2UA 1Q5VA 3DLJA 4QIGA 2AJ4A 1N5SA 3R5BA 3ZZ0A 2XY7A 1JKHB 3THVA 4YMEA 4OZ2A 4RR5A 2KJVA 2K7KA 3Q22A 4NCBA 2V8DA 1YJNS 3MPDA 4K4VA 2ZH3A 4Y2IA 1W25A 4NZ0A 4ZIVA 2VQFF 5EHHA 1SKWA 2JHEA 4YB5A 3KLEA 1ZPVA 4ES3A 3IA0A 3OTOF 2GAGC 4DV6J 4DSLA 3KK3B 2C2OB 1C1BB 1WWHA 3QRQA 2KFNA 1WG5A 2N3OA 2HNZA 2P9GA 4WYWA 1MMNA 2WVDA 4A4JA 1URNA 4DPYA 3PDNA 3BO3A 3N0VA 3UQSA 4I68A 4DSIA 4CM2A 5ETOA 1EAYC 5LOQA 2HS4A 4WFAQ 2QV6A 4RW6B 1HL6A 1KOOA 1RGVA 1FRJA 2V69A 3R9LA 3R5JB 4ILRA 3C6UA 3LAKA 3GB0A 5D3GA 4CTAB 3CCUS 2X1GA 4F7VA 4B3OA 4ETXA 3D1QA 1FEHA 3Q23A 1JLQB 1TKXA 4DFPA 2BR0A 2HGNA 2QMUB 2FVSA 3G6VA 1YJ9S 2VZ9A 4LRCA 1LWEA 4G1QA 3M4XA 4JYAF 4JI4J 3GIKA 2VH7A 2CJXB 3Q8YA 2H1YA 1RT1B 1HBOA 4Z2XA 1GQEA 1SQFA 2R7TA 1N8RT 2ZH4A 1G7CB 1IKYB 5HN0A 3CC2S 2I5JA 3W2VB 2OMOA 4B3TJ 1X4EA 4KHPJ 3ITHB 1Q4RA 4ATNA 4WP9A 3S1TA 2CYYA 3W60A 1BHNA 1RTZA 4P74A 1VBYA 2YX7A 2GIFA 2VFRA 1UZDA 4NWBA 4PXCA 2R7WA 4NZ7A 4DV0J 2VG6B 3X1LB 4BLGA 4HVZA 4P2FA 2DNZA 2X51A 4KGVB 4M1KA 1B99A 4J5OA 2FYXA 2JX2A 1M1KT 2ATCB 3MWBA 3I55S 3NAHA 2VFVA 3OFHA 2CJYB 3OHAA 4X84A 2IAJA 1T94A 3SMZA 3IR6B 4EUVA 5T14A 3R5CA 2ZWPA 1IM6A 4DV1F 1UVLA 4A8XA 5EWGA 4NRTA 5KT7A 3U1MA 2DR8A 5G4DA 3CCZA 3MM7B 2XMKA 3DRRA 4DR2J 2RUGA 4KJIA 2D3OR 2OPRB 1U24A 4Q2LA 2K2PA 1PSDA 1HD1A 3OXLA 1HBUA 2PT0A 2CQ4A 2RF2A 3JSMB 2DISA 2C28A 3TYTA 3D5MA 4GO5X 1NB7A 4UW2A 3CF5Q 1U47A 3DC2A 3ZNUA 2Z4PA 2YQ0A 3PRBA 3MMCB 3EVOA 5CYMB 1TL5A 2HZVA 1RU1A 2AJFE 5CYQA 3JTOA 2ZBRA 2ERRA 5KFIA 4BC9A 4Q5VA 4ZVRB 2HHVA 2J76E 2VICA 4LFCJ 1RTDB 5D4NA 2E1CA 1FDAA 2FLNA 1FKPA 3BH7B 1HNZF 3BYPA 1VLYA 2YTCA 2IM2A 1D9DA 1IBLJ 4C3KA 3C3LA 4IRCA 1OQ3A 2D69A 5KFDA 4EMDA 3TUPA 4KKOB 5SUHA 5DDOC 2FJEB 4RNNA 1FKOB 4GKKJ 5AE1A 2GCFA 2VKZG 2HMIA 4OI4A 4EEYA 2RQ4A 2WK4A 2B5JA 3E2EA 2W8KA 2A6OA 4NLOA 3MEGB 3PR4A 4X4UA 2WOMB 2MPUA 3NOCA 1CG2A 4GMKA 1QSLA 3RRHA 1NO8A 3KNAA 5ETKA 4NA3A 3TUIC 4RBTA 5F8GA 4J9NA 4LRBA 1RE1B 3PFOA 1X4DA 5FIIA 2EG2A 3CMES 4GVBA 2FY1A 3BREA 5J2PB 4IQXA 2B6AA 1XMQJ 1UA1A 2NZCA 1VCTA 2E7XA 1U26A 3QGHA 3LGHA 4DX7A 2WVFA 3JS9A 3MMAB 5J1EB 2E1RA 4MKVA 2H5JB 3ENQA 3EGZA 1V5IB 4HH0A 1T9UA 3DMJB 1U09A 4RNMA 3PFEA 1M5VC 1JLGA 4E2FB 5GMKa 3POTA 2D3ZA 1RHRB 2CWKA 2KXHA 3ILIA 2UXDJ 3M8QB 4E0DA 4H4MB 1I1GA 1S59A 3RRKA 3MPVA 3R5AA 3MZIA 2YQ3A 3RGIA 2YX1A 2CPJA 3QBCA 3WDOA 2E5LJ 3R7NB 1NSKL 1KTQA 1HQEB 4F0MA 1ZTWA 4KH0B 1RAHB 3DU6A 2BKOA 4LFBJ 3QSIA 3JQMA 5DDPC 1GEHA 3L4BC 1VBZA 2RKIB 2J7WA 4BWJA 3I4PA 2R2SA 2E9ZA 2GJFA 5DQGA 2V50A 4KBIA 4I6YA 2YNFB 1UVIA 1Q8BA 3D4JA 2WVCA 1HYSB 4HR2A 2IBOA 2VDIA 2DR5A 1YIJS 3MEKA 2B9EA 5F8MA 3BSAA 2V9WA 2GIRA 1KHWA 3K5MA 4MKBA 3GCXP 3HKZD 3R1HA 4DN0A 2HQIA 2HFSA 3IWLA 1Q5YA 3AB4B 3BEGB 1Q95G 3I0SA 3CCJS 3OTDA 3WC0A 1IVZA 3MFHA 2UU9J 4Q0BB 1UWAA 3KLFB 2VBZA 4FXVA 4LR8A 2Q3PA 1U0SA 2RDDA 5HO4A 5CCMA 2BMBA 4DV4J 4ZDNA 3KKFA 2KM8C 1S99A 3MMJA 1RAGB 1OSCA 3BGRA 4P71A 2Q43A 2C2KB 3RUBL 3MUMP 4I0WA 3D0IE 3SIPB 4DMZA 2X3DA 1UZHA 4NLUA 2MKJA 5IOLA 2VB6A 3BJYA 1MU2B 2F8MA 5CD4H 1S6UA 3OVBA 2XYPB 1ZOTA 4UUXA 2VDHA 1MMLA 3D67A 4F2SA 4JV5J 2ZZNA 2W9BA 2CQ1A 4ZMMA 3PO5A 1RTHB 2ZVIA 2VFUA 1ZZFA 4O3PA 1WHWA 3LGNA 3J7AN 3R8YA 4LT6A 2E5HA 4FF2A 1GMUA 1JLAA 5A8WB 1X0PA 3HKWA 1Q8LA 8RUCA 2PN6A 1HBNB 2WBRA 1FJGF 3HZEA 4KAIA 2DRBA 3ZZPA 1HNXJ 2C2MB 1K47A 1M1HA 3RU0A 2FJXA 2XY6A 4K4SA 1ZZNA 4CWBA 5MAOA 4LF4J 4RW6A 2RRBA 5FLXU 3WIVA 3FGVA 1B0VA 3CJ3A 4QZVB 4K4ZA 3G96A 1Y5LB 2V2ZA 3D1OA 5LMUF 4WP8A 1KD1T 1U1PA 1LWXA 1IM4A 1O5JA 2R9LA 2NPFA 4DG1B 4O44B 1N5QA 1V5VA 4QYZK 1JLQA 2EEYA 2CDRB 2XTJP 2J6TA 5C2GA 2VOOA 1ELOA 1RWPB 4LF8J 2ROGA 1N48A 5EX3A 1HD0A 4YUDA 1HW8A 2B8PA 3MFIA 4NA2A 2OSQA 3TAQA 2AYGA 2G2OA 1S49A 4USUA 3ZXWA 4ECUA 2R7XA 2L08A 1RT1A 5A8KA 4NEYA 2MB0B 4QR0A 4ECWA 1N0VC 4X4OA 4RW7B 1L3VA 1H7XA 2IJNA 2ROPA 1BD6A 3H8YA 3HVTA 2YKOA 1WEXA 3ZZRA 5KT3A 3F0NA 4LQ9A 1CJUA 2VOPA 4DLEA 2OH2A 1MROB 3MMBB 2L9NA 5B0AA 2JOQA 1JXLA 4DWIA 2GJ2A 4B9VA 1GMVA 4X62J 2BE2B 2VG6A 3FFIA 1BQMB 1SL2A 1EQMA 4H4OA 3UPFA 4DV7J 2DTJA 2JFKA 1RI7A 4YDXA 1IKXB 1VIXA 1S6QB 1KVIA 1FX4A 2DHXA 4DV5F 2DNGA 1UKUA 1S7IA 2EVZA 4OHWA 3RW6A 1GNKA 4F4YA 1MWYA 3NEKA 2NYHA 4LBHA 3D28A 1C2PA 2EG1A 1B4SA 5T41A 3PX0A 2ASYA 4U7CA 1Q78A 1IBKJ 1WDTA 2OPRA 3MCSA 3K17A 4R5PB 1XNQJ 1HWUA 1TKDA 3AD9C 4KB7A 3E01B 3JSMA 4TNOA 1QVGR 2OIHA 3L7PA 3MUTP 1JXVA 3DYAA 1NJIT 4NYPA 1FX2A 4PZVA 1TK5A 2W4DA 4CH7A 3MMCA 3J7YU 4AT1B 2Z58B 2MLYA 4FBUA 5CYMA 3JAMU 3C16A 1AB8A 4LF9F 1N56A 3CJ4A 2HIQA 4HT5A 3NCQA 4UOGA 4X4TA 1Z1ZA 1NKCA 1ZAVA 1HI0P 1U6ZA 2X3GA 5BYSA 5D4LA 3TAPA 2XULA 3RB3A 5J1NA 4MIBA 2MZTA 1YZ7A 4BCAA 2AW0A 4HACB 2JVOA 1TL3B 4ED3A 2GX8A 5E3AA 2ALZA 3M1VA 3HHEA 5I42B 3VGUA 2J0SD 4EI2A 4DS4A 4X4RA 4P7TA 5HI7A 3BZQA 2HLTA 1MNEA 3MEGA 1WF2A 1D0EA 2J7UA 5MLCV 2OPPB 3PYEA 4YB1P 2ASDA 2O01C 5B09A 3DOMA 3BGUA 4ELTA 5HMWA 2W1BA 4P2MA 5IC4B 1S72S 3MR2A 1ZAWA 2XSFA 2DR6A 3D3BJ 3R5DA 4FS2A 5J2PA 1TQLA 2A18A 3UDVA 4B3MJ 1V3SA 2WVBA 3WBZA 4ZN3A 4JV2A 3UE2A 2CIMA 3MMAA 5DM6Q 1CSJA 3WX8A 2OGUA 2R7VA 4DV3J 2HWHA 4LUBA 2PFDA 4AXJA 2HK2A 4O3SA 1N0UA 3HVRA 1SH0A 3UWTA 3MEDB 2OLWA 3OHBA 4X64F 3NGUA 2QLXA 1RB0A 2L9DA 5HL7Q 3HDSA 1FESA 3I4HX 4ENOA 2H9ZA 3QRRA 4BS2A 2ZHBA 3M8QA 1JX4A 4H4MA 3PYGA 4C0BA 1HNWJ 1GTHA 2KFZA 3E51A 1Z2ZA 1DY3A 2HZAA 2BXJA 4EZ9A 1RTIA 3H40A 2XYGB 2UVRA 3TX8A 3ULHA 3QT5A 1TP7A 4USIA 4IH6A 1S1TA 3BB5A 4CZCA 1FRIA 4YB6A 2O3DA 4RPFA 2N3LA 1QM9A 1S0OA 1VQ6S 4DPWA 1JNRB 1FVQA 2ZH8A 4EYIB 4WF9Q 4IDKB 1KOHA 2K3IA 1O0PA 1KFSA 2ZVSA 1D8ZA 4NXMJ 1ZM2A 4JI5J 3Q8QB 1PC5A 1RA6A 2F63A 3A8JA 2M3DA 3QAUA 2M8HA 3PJ9A 5KFVA 3KLFA 1VQ9S 1FK9A 2CDQA 2LQ9A 1V3RA 2BOPA 3NGSA 1S6PA 1M5PC 2LQ8A 3CPWR 1IR1A 1K44A 2FLOA 4PG5A 2ZFHA 4M94A 5AXMA 1YJWS 4IRDA 3HI9A 4K0KJ 2W2QP 5DS7A 2MY7A 2KFYA 3W8PA 2VL1A 4NLPA 3VR1A 1EQ0A 1TK0A 3DHWC 3A12A 3OBIA 1C0UB 4NCGB 1X4CA 5C25B 3J7Z5 1KR4A 5KAKA 4DCJB 3PJWA 3F41A 4DQQA 5A8WA 1LQ9A 2EFVA 2ZD1A 1HBNA 1U0HA 3MM6B 4K59A 1YBUA 2GIQA 4N56A 5KG6A 3P5BP 4NXNF 3HSGA 4JI8J 4DR3F 1WTBA 2AWZA 2P6TA 2FD2A 4ZVPB 2ZOFA 1UMJA 3IG1B 3PCOB 3OR2B 4JI7J 5KT4A 1FXLA 1C4CA 4G1IA 5KG5A 2I1RA 2B0GA 4ZHRB 3NGRA 3ZTSA 4O0NA 1NCLA 4PXEA 5F8HA 2CKWA 4PWUA 4DG1A 1LOUA 5LL6d 3R5GA 4U7UD 2VG7B 3ET6A 2I6WA 3IRXA 3C46A 5L1IA 2LEBA 4LF7J 5DG7A 1JLCA 1RT4A 4F2RA 3T41A 4JI6F 3H5SA 3THPA 2CPIA 1E6VA 3HVAA 1XMBA 2CPEA 2HHSA 3HFVA 1HPZB 3FSXA 2ABYA 1YX2A 1B7YB 1F9FA 4DJBA 5EUHA 1S9EA 1S5ZA 4O3RA 4N47A 2V2KA 4C8LA 4OYAA 2IM3A 1YJTA 3MMBA 3M8WA 2EWHA 2R7RA 4CLZA 4QWCA 5GMEA 4JP8A 4OV6A 2BE2A 1V9OA 4FS1A 2PI4A 5E3CA 5F9LA 2ZOMA 4N41A 5JXSA 5K9FA 2OKQA 3LH2S 3EPIA 2CQ3A 1EETA 4XK8C 4JV0A 1JLEB 4WWSA 4OYPA 5GAEU 3PZPA 4ZPVR 4ED6A 1RCXB 4K2JA 4M5JA 2GQCA 2V4RA 2WVEA 4GRSA 3IBCB 1XR7A 1XERA 2IIHA 4CYUA 4DX8H 1C0TA 3D68A 1S4EA 2CG4A 5ETTA 5BR8F 1I5OB 1CC7A 4GO7X 3MOJB 2Y9HA 3K5PA 1NB2A 3NS6A 6FDRA 3PKMA 2EC0A 2R4FA 3NY0A 4DR7J 2W7OA 2V8HA 2L3MA 3GSDA 3DRSB 4IFYB 4DL5A 1DTQA 2MHEA 1TKZA 1Q81T 3R6LB 3DN9A 2JC1A 2FVQA 4NLRA 3D0HE 1SV5B 1U02A 2KT5A 3CEDA 1HFEL 3CCSS 5F9NA 1Y00A 4CO5A 2KB2A 4EBDA 4EO6A 3IO1A 3EZUA 1S10A 3L7UA 4PQUB 4JB8B 1RXOB 5GADU 1UFKA 4L76A 3IFEA 5L1JA 4NYZA 4HACA 3LANA 1N34F 1AUSL 4ZP6A 3D7SB 2AJ1A 4ZVTB 4DHVA 5I3UA 2XG8A 4A8WA 3W8GA 2FLPA 4UUWA 5HVHA 3FSYA 2MKHA 2BJDA 3FEXB 1FJ7A 3G82B 2N7YA 1U8SA 3GYGA 1WELA 4R25A 1ZM4A 2OPPA 2J9CA 3UN3A 2IRUA 1P9YA 1FNXH 4GKJJ 1RU2A 4F4WA 2F4VJ 4AQYJ 4M5MA 1I94F 1F3VA 4FNIA 1M90T 4ZITA 3SV4A 3VQSA 3OTEA 5KG7A 1Q0NA 2FJAB 3H2VE 3EPGA 2X1BA 2W2OP 2ALYB 3OXFA 3R97A 2RDIA 3FNNA 4P7VA 1HI1A 2A1BA 3ENWA 3KHGA 4GC7A 4AUKA 4KQZA 4UT4A 1RLDA 5CAAA 3S01A 5GAGI 5ITHA 2PA8D 3HHKA 3MEDA 2AU0A 1KNZA 2LQJA 2M88A 3LAMA 2Q79A 3MDFA 1PG5B 4QWDA 4V19J 1PILA 2ZC3A 3TZWA 5I4MA 2H5EA 1SJFA 4YHHJ 2XCAA 5B08A 1H72C 1X8DA 2CQDA 1OYEA 3HF5A 3IXQA 3R7SB 2BW2A 1BWVA 5JUMA 2VJVA 2Y1LB 4O3NA 2H48B 3GR0A 4O4RA 3KWMA 1LW0B 1RHUB 4MK9A 2CFXA 2V0NA 4IO1A 4ZN1A 4CIOA 3LP0A 3TZXA 4NX9A 4OJHA 2F8HA 3GIJA 2RU9A 2IMOA 2OEMA 1Y4ZB 1IR0A 1T9WA 2NSCA 3QO9A 2DNQA 3CTRA 1P1LA 2IYIA 4CRJA 3HXMA 4IDKA 2GO8A 3WX4A 2FQQB 1VQ5S 1SPBP 3QSYB 1TFWA 2K1RB 2YKAA 3PX4A 3T19A 1B64A 4TU8A 3V6JA 2MHNA 2RQMA 1NK7A 1WDDA 2QIFA 1YTYA 5KFCA 2UVVA 2RUSA 1S9GA 1TV6B 1JK9B 3TA1A 5HANA 1YBAA 4DX5A 5HMZA 1YJUA 5C24B 2YVSA 1TMMA 4DUTA 3CC7S 4RNFA 2A10A 3VZHA 4KPCA 2VA2A 3CCVS 2EXUA 5D77A 4ED2A 4K4UA 1CQNA 4ZLLA 1LWFA 2AYBA 3QGPA 3GV7B 7AT1B 1FA0A 3BBFA 1WOOA 1FNOA 1ITPA 4ZVSB 2XMTA 3QPIA 5KFEA 3BSCA 2NLWA 1PBUA 4J9KA 1HMVA 1TL7B 4RUHA 4OI0A 4ECVA 3PIOQ 4J9MA 1UA0A 2DHSA 1C0UA 2E44A 2R2RA 2D1CA 5C25A 3AXKA 4ID5B 1CJKB 3BM7A 3QYYA 4KGZB 2ZJPQ 2XQCA 2OPSA 4DCPB 3IN5A 2AGQA 4OYBA 3Q8PB 4M5LA 3CUNA 1RSCA 3MM6A 4KE5A 3HJVA 3S8SA 2ZJQQ 3BKUA 1IR2A 2G0JA 4W92B 3LTOA 3CWJA 2J9EA 4HI1A 4ED7A 5J2NA 1NNDA 4HKQA 5K8OA 1T0TV 3HHNB 4CI0B 3AD7C 1MW7A 3AAWB 1FI4A 3IG1A 4I1TA 4RJVA 2VQEF 1RT7A 1L3SA 4ZHRA 1KLMA 1U1LA 3JSBA 1YKWA 5G0RB 1VISA 4CLPA 4Z37A 1F1BB 3W65A 2H4YB 3CDAA 4UQGA 1TZ0A 2HZCA 3OJSA 2B9XA 4KC5A 5L1LA 3ELHA 3I31A 2XZWA 5E5NA 4IOBA 1X9MA 2CJAA 1VFJA 1FXRA 1JJ4A 2HHHF 1UVMA 1H2VZ 1TL1A 2PMZD 2EKYA 3TVKA 3NOGA 3CJRA 1H7WA 1FERA 4CH0S 5IQQA 1RADB 2ZNYA 1NZ8A 3OUYB 1DAXA 1H38A 2J9DA 2CVEA 1VQLS 1AFIA 3B6BA 2DNRA 3EE3A 4DBQA 2MKKA 4WCEQ 1RBAA 5KFZA 4DSJA 3OFGA 2DIUA 1UVNA 1DQAA 3A3NB 4O23A 1VQSA 2VF3A 2VQFJ 2OUGA 4WZMA 4MKAA 4PKDB 4ZP8A 3RG6A 3W66A 2HVDA 2CNKB 3VAFA 3Q8RB 1JLEA 3OTOJ 1X9SA 4XPEA 1F0XA 2DRDA 4O3OA 2I0XA 3G6YA 2PMHA 3PJXA 1HQUB 4HEA9 1FKAF 2AP6A 1SQGA 3KLIA 1TTHB 2DPJA 1YQHA 1VRUB 4WP3A 1VK8A 3OR1A 4WFXA 3VHQA 2MSTA 4Q8FA 4ZVFA 3IS9A 4ZCLA 3OL8A 4X4QA 2K3KA 4J9PA 2JVRA 4WTOB 4P10A 3DLGB 3IR7B 2F9DA 2BYCA 2EFPA 2HHWA 1VC5A 3KFWX 5IZHA 1N33F 3DRSA 1FDDA 1XJWB 2H54B 2M8DB 2AX0A 3E8OA 4N7TA 3CC4S 4LVNP 1IWGA 1UVJA 4LSLB 1EX8A 2QYCA 1SJ4P 1IBCB 1W2BR 3QGGA 3H25A 4CLWA 4OIXA 3DKDA 4WK1A 2XGPA 4QR1A 1WF0A 4AD6A 4FVCA 4D3HA 3BDPA 5KOWA 4MYUA 3T5HA 4N76A 4ED1A 3CDBA 3AJ1A 1RAJA 4PQUA 3EMTA 4JYAJ 3CCLS 2MGZB 2XGQA 1V3ZA 1DLOB 2VJUA 4DL0C 2V8GA 1GX6A 3N5BA 4UQTA 3OJUA 6FD1A 3G82A 2DR7A 4DV0F 1FFGB 4NLWA 3RR7A 3M32A 3TR5A 4MT1A 1JXEA 5DM7Q 2GVZB 3QJLA 2RHSB 4J9QA 2DKOB 1S6OA 3Q2TC 4KFBB 1NEEA 5JMNA 1VRTB 4B3SF 2C1EB 4C8YA 2YNIB 5B0CA 2GGPA 2WSEC 3GR1A 4JI1F 4DV1J 1S77D 1S1XA 4C4WA 3PXGa 3PEJA 4DR2F 4YDDB 4WK3A 4P52A 3AOAA 1Q7LB 3UNGC 2HBZB 3T1YF 2UUCF 3SYZA 4DN9A 4A8QA 2ZC4A 4I2QA 4DL2A 2Y1RI 3O2IA 2ACMA 3SCKE 3FMBA 4OL8A 2ZM6J 4RBUA 4G1PA 1IJFB 2XS5A 4Q45A 3B8HA 1EHWA 2AZ3A 2YWKA 3T1AA 4EBCA 4F0KA 2V6AA 3MTJA 3I96A 1MN9A 2XLIA 1H0HB 4ZJOA 2P6SA 1Y5IB 3VWSA 2A2CA 1QTNB 1KVKA 2B51A 5DETA 2DEIA 3AJDA 1MSWD 4C3LA 3VAGA 2LXIA 3EVMA 2HW3A 1S1UB 1SBRA 3NBPA 2NR0A 4J91A 2QL7B 5IT9Y 4C0HA 1WF1A 1WUUA 1TUGB 4RX6A 3CO9A 3GFYA 3B82A 4R0JA 2AHOB 3AOBA 4KGMA 1C1CB 2BV3A 2C2EA 2NUHA 1APSA 2UV8A 3DNCA 5A8RB 5LXRA 3PM9A 4OFZA 4Y2KA 5DLFA 1FRMA 5IT4A 2RVJA 5M2PA 3JB9k 3MM8A 3BQ2A 2VPYB 4YS2A 2Z2LA 4LIWA 2KZMA 3P6YC 2AD9A 4DI6A 1HWIA 1S48A 4ZKAA 2Z8QA 3TZZA 4LSNB 2I8EA 4S0MA 1FVSA 4NCAA 2U1AA 1BE4A 4USKA 1RUSA 5C24A 3CJ0A 5HJXA 2V67A 1NJZA 2RT3A 4PG8A 4MFBA 4OHZA 1VQMS 4YR2A 3M8SA 2BM0A 3RB4A 4WKYA 3LP2A 2MJNA 1TR0A 1NDKA 4RNHA 5KTQA 5LM7E 4WU3A 5D4PA 2JLFA 3PHEA 4J9OA 3DLBA 3GFXA 3HFZB 2J0WA 2BDPA 3PV8A 2AZ1A 1VHFA 2UXBF 1TL7A 3C15A 2ZH6A 2Y0BB 3CCES 4DR5F 2DGXA 3M8RA 2DXFA 4FN5A 1YHQS 4TY8B 4QWEA 1KVJA 1CJKA 4OYOA 2DCLA 4TVAB 1H2UX 3KUGA 5ETPA 2YY3A 3CE8A 2KKHA 2HHPA 2HG4A 3DM2A 1RAIB 4PQAA 4P6QA 1SH2A 3QNWB 4OZ5A 4LJMA 4QWAA 2D41A 3W2WB 3FCWA 4DL3A 1OPIA 4HYKA 2YNGB 4LF6F 2KT2A 2Z57B 2DB1A 3K58A 4O0IA 2CQBA 2DY9A 4L74A 4UY8T 1RAFB 5KG2A 2J8SA 5HLFB 5G0RA 4TYAA 3MAQA 3DU5A 3FCHA 2VUGA 3IP0A 1NSPA 2OD4A 4QYZJ 2DGOA 2GFFA 1TKTB 2KN4A 5IC6B 1R0AB 3HO1A 5HVFA 4MYTA 1N5YA 3QZ7A 5CQGA 4W98A 4YR3A 3M6VA 1UW4A 5KFGA 2V8VA 1WEYA 2FIUA 3JYTB 2PEBA 4B02A 4J90A 3OUYA 2WW4A 1FJCA 1SQEA 2KH9A 3W3SA 1T05B 2YNHB 5F8IA 4LF5F 1EKSA 2RJZA 3M2VB 4FKXA 3VAKA 5F8NA 1BXNA 2BA9A 3ZZOA 3T6JA 4RU9A 1HWKA 3NAIA 2IA6A 3K89A 4KR0B 3HSJA 4ECSA 1J2VA 4DL7A 4WJBA 3MR6A 1HBMA 4Y34A 1H73A 2D3O1 1VRUA 4RW4A 1RT6B 1WC5A 5KG4A 1SXLA 2K06A 4ZIWA 3SDEB 2KI2A 2BX6A 1HNXF 1FJGJ 1ZA2B 3DI6B 1SCJB 5CD4A 5CXTA 3VF0B 4P75A 1IBMF 1SKSA 5AJ3F 2FB0A 1FE0A 1F5AA 1RWMB 1JB0C 1KRPA 1HKAA 1JLBB 5LT5A 4USVA 4U96A 3BN4A 3QQCD 5LMUJ 4QPTA 3N6NA 2VG5B 3UR3C 1U2CA 3GP9A 3UNYA 2FHMA 2QO3A 2W2PP 4NYOA 1GFWB 1NXIA 3TJAA 4XAKA 1KSPA 4L3KA 2IYGA 1XN9A 2C3UA 1CS4A 1NPKA 2C3YA 2MEWA 3TARA 2B9WA 3FEZA 2KM8B 4CP5A 4C8ZA 2CADA 5B0EA 2XO6A 5E3PA 1A9NB 4M63A 1F5CA 3ZTRA 1R31A 2AMCB 3C2PA 1H6KX 1SB6A 2R7UA 1G1XA 5L39A 2EBGA 3SSQA 2D9PA 4NLSA 2FUG9 2YKNB 3AXMA 3EWGA 2G0IA 1CULB 2CQGA 3OL9A 4NE9C 3H0PA 2HFUA 1WC3A 4NOHA 1KQFB 5EWFA 4B17A 4Y6IA 3MR3A 3PHTA 3KK2B 4TXSA 3D9BA 2PD1A 2IPOB 1YWXA 3UVJA 4ICLA 2GVZA 3OD2A 1S79A 1OMSA 1F60B 3WHIA 2KDOA 2MZJA 2UXCF 3OXGA 2MQNA 4KFBA 4NEZA 1GH8A 5E33A 1GT8A 1RWWB 1YDLA 2IM1A 1VRTA 1LFWA 2G4BA 4LSZB 3K59A 1TVRB 3BGFA 1XK8A 2M5YA 3G8SA 5B0DA 2IC3A 3S7RA 2RRNA 3NGDA 5K14A 4Y28C 1NUEA 3PVXA 4HHUA 2AYMA 3AQOA 3EUNA 4HTJA 2XLKA 1S0NA 5CH7B 5KG1A 3F56A 4HDHA 3UCUP 1CJVA 1HARA 1UW9A 2W9CB 2ASLA 2DRAA 3P49B 3H5UA 3MD1A 4X4NA 3MECA 2AQ4A 4QCLA 1ULRA 1X5SA 3MPWA 2P2CB 2WB1D 3TJ8A 4CM0A 3R2DJ 4LF9J 3S6EA 1RAOA 4AL5A 2GZOA 4F04B 1F2HA 2R7QA 2M0GB 1DURA 1FWKA 1KONA 1PJ5A 1AW0A 4OYMA 5L46A 1N32F 2H65B 5AXKA 2YKMB 1LXJA 2VONA 4I4BA 2W9AA 3NNHA 4CNYA 1SUQB 1GXTA 1BC6A 1C1CA 5HJYA 4YY3F 1Y10A 4EBEA 1FDBA 2ZBQA 3TEGA 5CCLA 4IH5A 1PYOB 5A8RA 2KT3A 2LDIA 4C8OA 1EP4A 3ZTQA 4UF4A 2V63A 2NYIA 2L9WA 3PYDA 2ATLA 4WIIA 2MYFA 5KOXA 3I9ZA 1RT2A 5A0YB 3PRVA 4L72B 3AOCA 3GLJA 1SI9A 2C22A 4LSNA 4XDDA 3A13A 4X65F 2VIHA 4PWDA 1UJ4A 3QT7A 2HQCA 1X5PA 1GK8A 1BQNA 3ZTPA 3HZGA 3G86A 3PY8A 3T5LA 4ECZA 2UVUA 5HROB 2Q66A 2KYXA 2UV8G 1EJ7L 2IRYA 5AE2A 3LPYA 1D9AA 4I2PA 3KHRA 1O6XA 1QD1A 2EK1A 2NCKL 2ZH2A 1NK0A 1VQPS 3D54A 3SQGA 4AFFA 1FFSB 1HHSA 2CRLA 2DNHA 1XEZA 2FJDB 4IO9Q 4X64J 4TY8A 1NJWA 2M52A 3DLEB 4C6AA 1H74A 3I5AA 1HNWF 3FVYA 1U1RA 1LK5A 2ZKUA 2DO0A 2M70A 4Y65A 4NMXA 2FHOB 2E5JA 3ILOA 2IDLA 2CNLB 3EDRB 1NPPA 2CG8A 1UCNA 2O66A 3QZ8A 3TAMB 5C42A 1A7GE 1KKHA 5GAHU 5IWAF 2F3JA 2QSWA 4DU8A 3BO4A 1X7VA 1UFWA 1WTFA 4ZVEA 4DOZA 1UPPA 2OEKA 1M5OC 5HLFA 1E6YA 1J5EJ 2FZCB 4X4VA 1WKLA 1X9WA 3GONA 4B9SA 1LWCB 4PUOB 3I6PA 2LEPA 5HSPA 5DRKA 4JOUA 1YK9A 2E7WA 2BZ2A 2FVCA 3EM1A 3I9V9 2XS2A 3JSRA 4M5GA 3GU0A 2EBEA 4U67Q 3W5XA 3JYTA 3VTIA 2WSFC 3FSIA 3K5NA 3NWGA 1R7IA 1WSRA 3HHLC 4DX6A 4FBTA 3TVZA 3ISND 1QTMA 1REVA 4WXWA 4HT7A 4PYAA 4URSA 2LFVA 2QMWA 5A6WA 3UCGA 2DIVA 4ECYA 1QAYA 2IBKA 1A6LA 5HBMB 2IY5B 1T05A 2YNHA 2C42A 3V6DA 3AY0A 4C0OC 2ZH5A 5HAOA 2ADCA 1X0FA 2WONB 2GMJA 1YSJA 4NPOA 4F02A 1FEEA 1FF2A 3DGPB 4M5DB 3CXCR 2KXNB 3SFGA 1BQXA 2XHCA 4NL5A 3EZ5A 3M8PA 1HLWA 3WQPA 1I3OB 1N36J 4RNOA 2W4PA 4TU9A 3KLGA 4HL9A 3EGVA 2G2YA 3NCPA 4PXBA 1IKWB 5J2MB 1Q7YT 2NPIA 2VU5A 2RNEA 3CVKA 3V81B 1S76D 3SDEA 1U48A 2VBWA 2MKCA 3CGIA 1U1NA 1HR0F 4ES2A 3CJKA 3SV3A 2LQ5A 5IM0B 4NXNJ 2MKYA 3R3TA 5CYJA 1I6JA 4LMZA 4DR3J 4B9LA 3G8TA 1RT3A 4JI7F 2POKA 2VASA 1V6HA 2AX1A 1VQOS 1JLFB 4WYLA 1JLBA 3CCMS 1LKZA 3LP1A 1S4FA 2QLFB 4M5HA 1RISA 1AZSB 4ZP9A 5FDLA 3SI8A 3GJRB 2LEAA 3CJQA 2PSZA 2VG5A 3C6TB 3LGMA 2XC9A 4DQRA 2YPYA 4WFNQ 4FPIA 5IT9U 3QLHB 3SFUA 2R2TA 1O51A 2I2YA 3U7JA 1RT5A 3EDQB 1WC1A 4P2SA 4ELVA 3PW4A 1TUWA 3DRPA 3K0JA 2ZZTA 3ZO7A 2IM0A 1R8BA 4JI6J 4YFUA 3CMQA 2XSJB 4KTQA 3MAAA 5AT1B 3I5CA 1LW2A 3J80U 1TK8A 1B7FA 4DZDA 3E3XA 1BWEA 4EFAC 4FVMA 2W7PA 4CO4A 2N4CA 2NXJA 3FMWA 1VJQA 2KVIA 4DEZA 2YKNA 1RHKB 1WC4A 1VQYA 2FJVA 2LLZA 2QEXS 3GFZA 2QJ3A 3ZZYA 1DTTB 5IFMA 1CQMA 3QWUA 2XLJA 3KK2A 1IKVA 3CNQP 4DSKA 1EB0A 5ETQA 3KLEB 2M4MA 3P4UB 5DDQC 1VQ7S 2AYEA 3AB2B 1QUVA 3HJFA 2CZ9A 5CABA 4ER8A 2XY5A 1WHYA 1NHKL 3DOKB 4HH1A 2DCUB 4F4AA 4RUBA 1NLKL 1R0BG 2DHAA 3IAM9 1T7PA 5BR8J 1T9XA 4DSEA 5HMYA 1B70B 5KG0A 1JKHA 1KHVA 3NGTA 1YI2S 3BQ0A 3GE9A 4IYQA 1F9HA 2K8GA 1F5BA 1YRTA 2RIJA 2W9CA 1QVFR 3MCOA 5KFYA 2WRMA 3X3UA 3C6UB 3T9NA 3TP2A 5D3GB 4OZ0A 4Q7AA 1HQ2A 1S57A 2HBQB 4B3OB 2FVPA 3U27A 3AD8C 1U1OA 1TKXB 2CPXA 3J81j 3DLHA 3AA9A 3KK3A 2O1PA 1C1BA 1RCOB 4TQSA 4KO0B 2WW8A 3I87A 2QT7A 2W01A 1U45A 4LRFA 4ETZA 1XNRJ 2BRKA 4LF2A 2B4UA 1UWBB 5HMXA 2W7AA 3CW2C 3ENVA 3V6HA 5HQLA 2HPUA 2Y1IA 1T3NA 1FRLA 3N4WA 1YG0A 1IJEB 2HVIA 5F8JA 2CUYA 1NH7A 2JEIA 1N34J 2KG0A 3MPYA 4KGKA 3CMAS 2B4VA 5D0RA 4PPDA 4R0EA 1HI8A 1RABB 1U8WA 3EXCX 1UFLA 1R8CA 1ICEB 4CTAA 3TRGA 3NS7B 1Y11A 9RUBA 1YJVA 5ETLA 2PO4A 1R8AA 2V68A 1PO6A 4CLKA 1SIZA 3RR8A 2HNDB 2GHWA 4GKJF 2H51B 4XPCA 1JWWA 1WC0A 5A0YA 3ONQA 5D8HB 2JRSA 4IRKA 3T1HF 4AE5A 1I94J 3DGVA 3FQLA 1KBRA 4G65A 1OPZA 1FJEB 3U02A 3UD4P 2F1FA 3KUHA 8ATCB 5BXIA 2R8JA 4YOEA 1IKYA 1T8EA 2HYIB 4ZA1A 3W2VA 3K57A 2ZZMA 4K5SA 4B3RF 4IG3B 3ITHA 4U6PA 4WXOA 1Q8KA 3W62A 2JJ4D 3W5ZA 2E7VA 1G4CA 5IQ6A 5E7OB 4DR4J 1UEUA 3DLKB 4USWA 2ZBPA 2J0XA 4DLGA 2IVFB 2FY8A 3KTQA 2EI5A 2XWYA 3VAJA 3DHXA 4KRWA 3DLEA 3UI3A 5F3TA 3W61A 2VD3A 1S7HA 4QIVA 3NWRA 4RLEA 2YH1A 4J37A 3TA2A 1ZA1B 4LQ3A 2DK2A 1KDNA 3D6TB 1SC3B 3TAMA 1LFPA 3IBFB 3K8VA 4ZVUB 1FKPB 1WI6A 1MWQA 1OJ4A 2B56A 3MM7A 5GAGU 2WCXA 3SCJE 1NJYA 2RILA 2PA3A 3NLCA 3GPAA 2XS7A 3A1YG 1VC6A 1YBTA 2W4CA 2BVZA 3ZZTA 5C7PA 3G71S 2VBXA 5HATA 3KG0A 4U7UK 2HMIB 1R27B 3HHDA 2Z0GA 2E1AA 2B5JB 1QE1B 3MURP 3NXZA 4DL6A 4PUOA 4C11B 4CNZA 3FBEA 3GMGA 4EGLA 3OSPA 2FZKB 3CJ8A 1BLUA 3K2YA 3O3LA 2IDEA 4P72A 9ATCB 3W1YC 3KHLA 1X4BA 3A8KA 1K9MT 3P5TL 5KFRA 5H9FK 3JTNA 3SBMA 1RTDA 4OX6A 3MHYA 4IR1A 2PI5A 3H5YA 3NNAA 3A3OB 2B6AB 4OHXA 4B08A 3LALA 4PYDA 4M5NA 3DLLQ 2V9KA 1VOMA 4CH1A 4KKOA 1VBKA 1D8YA 2BUNA 1REGX 1FKOA 1RKIA 2MZSA 4Z7CA 2PGCA 2LU2A 3CO0P 2C3PA 5KFHA 2ZH1A 4NA1A 2WOMA 1N88A 4NLQA 2AEJA 1KTVA 3POTB 2ZDOA 1VK3A 4QU6A 1YJ7A 2QYGA 1IKWA 2KRBA 5J2MA 4RW9B 2GV1A 5DGBA 4UOFA 3V81A 5B0FA 2ZH9A 1PC4A 3TVYA 3NL0A 3J7A1 2Z56B 1HWJA 4FDFA 4X66J 1ZPWX 4YP3A 2C2RA 3JQJA 5K20B 5IM0A 3D3CJ 4PWWA 1Q82T 2FC9A 5J1EA 1P8GA 1RBLA 1XQIA 4ECTA 4RWXA 4DQPA 5KFLA 1XMOF 4HI2A 4CLYA 1UP1A 2DHGA 3DMJA 5GAHI 1FT8A 2VQEJ 1NKBA 4KT0C 1DHMA 1RDRA 1XTZA 2AJ2A 3OLAA 1QDUB 4MKYA 1GTEA 3HX9A 5A6PA 3TW0A 3IGNA 2B4OA 4NLTA 2KL8A 4OJ1A 5KFSA 2HQDA 4RL1A 3OL6A 3IRWP 3QLHA 4OMFG 5E3RA 4KHMA 3MR5A 1DZ5A 1UTAA 4ZK7M 1Z2LA 4OX9F 3NNCA 1L3KA 3GIRA 4OZNA 3GIIA 2HHHJ 5KFQA 2XO7A 2XSJA 4K4XA 1HQEA 2C3OA 3LUYA 8AT1B 2HQGA 3BGRB 2RSQA 1GMWD 4HHHA 2YPZA 2RKIA 3BQ1A 4QWBA 4RU2A 5D0EA 2KZZA 1AA1B 1CVJA 3W63A 2CJBA 5KFJA 4LREA 2YNFA 1HYSA 3JTPA 2W9BB 4C97A 1DTTA 4H4KC 4GVLA 2DO4A 2OMLA 1PAEX 3CJ2A 2EKNA 2DPIA 4QOTA 1W2IA 2VKRA 1NPRA 2HGLA 4USHA 2HHTA 4JI3F 3GWCA 3BS9A 1T11A 4EO8A 1JLAB 4Q0BA 4FZVA 2N7CA 2Q6CA 3DOKA 4WFBQ 3C19A 4CCHA 2F8EX 4OI1A 3PW0A 4KSEB 5E0OA 3I0RB 3V4MA 4BHQA 2HURA 2OAUA 1MU2A 2HHXA 2LECA 5KFWA 2CQ0A 3KJNB 5LSLA 1N33J 4L73A 3LO3A 1AUDA 1RTHA 3FBFA 4ZLPA 3Q24A 2C3MA 2MZQA 2Y3YA 4IQMA 4O3QA 4DV2F 1BGXT 2MZRA 5C5JA 3PW5A 2HWTA 1HNVB 2CPFA 4DCOB 4ZLJA 3A4TA 2DR9A 4CQ1A 5AE3A 4KO0A 2CQPA 2XHWA 2V34A 1R43A 2HNYB 1WACA 7FDRA 2HQ3A 4EK2A 2R42A 3KNGA 3K7RA 1UWBA 1JIHA 3M2RB 4PPZA 2MLXA 4BDPA 3VV2B 2I9SA 5A8KB 4A8SA 4IH7A 3B78A 4OX8A 4ALZA 3H42A 4MH8A 3HVTB 3DOLB 4P2XA 3CCQS 2A6MA 3ICLA 2MDAA 1CJUB 1R8HA 4ILMA 2V8PA 2PIIA 2WZ1A 4USTA 4J9SA 2YWEA 1NMEB 1OY6A 4LFAJ 4O44A 3FFIB 2HNDA 2PMWA 4I7FB 3W9JA 5KT6A 4H4OB 3CD0A 4I56A 4CLLA 3I82A 1JQGA 3BSNA 4A8FA 5HP1B 4KIAA 2R7SA 3KMSA 1FD2A 3N01A 3BR8A 4C9DA 4B3SJ 4MTPA 3FK4A 4ZCKA 4DR1F 4C8NA 1EIYB 1T3OA 4JI1J 4RW7A 2ZUAA 2MQPA 2JNJA 4IG3A 5F3ZA 2QLBB 4PABA 1VQNS 2DJWA 2DEJA 3BO2A 3T1YJ 3SSRA 2JEJA 2UUCJ 2ZM6F 2KYZA 1MROA 3DLKA 4B9TA 1FFWB 3UD5A 3DYAB 1BQMA 2OTLS 4WU2A 2FTRA 4E8UA 3LOUA 3TNVA 4DF4A 1OY9A 3C16B 4ANDA 2R8KA 1IKXA 3MCNA 1S6QA 3D6MB 3BPDA 3OPKA 2YWWA 3V2UC 3AH6A 5KFOA 5D0HA 3EXYA 1MN7A 5E2QA 4ZJQA 2W2MP 2WB4A 5DZ6A 2JL9A 2H5IB 2DGTA 5CA5A 2ZNZA 4CLUA 4AL6A 4R5PA 3RBXA 5F0UA 4RWWA 3M1VB 2CPHA 1C4AA 3ISZA 4FP9A 5IS2A 3UD3P 3E01A 1LV5A 5ETVA 1QE1A 1JJ2R 4C11A 3L9ZA 1L5UA 3RAQA 3HVWA 2FHKA 3BR9A 3KOAA 2KTQA 3UW1A 2WAQD 2IA0A 3IM9A 1X5TA 1XC9A 2LU1A 3DOMB 3KJQB 1WORA 1FE4A 2NXEA 1DQ8A 5HK4A 5L1KA 4QR2A 4A47A 2XMVA 1QSSA 1FRKA 3K5LA 1XWLA 2XNRA 2BJ9A 3N6LA 4OX7A 2F7VA 1KQSR 1FTRA 1JMTA 1WJ9A 4M8LA 4OLOA 1TL3A 2U2FA 1FRXA 1URRA 2J7KA 3FC9A 5I42A 3C66A 3GSIA 4ZPTR 3CIZA 4DXLA 4MMOA 4I67A 2MQQA 1K0VA 3BDEA 2GHVC 2O5DA 4CT8A 2P9EA 3PR5B 2HBYB 2UXBJ 2KU7A 1VIOA 1K1QA 3TQEA 4DR5J 1SJ3P 1PGZA 4TY9A 3GV5B 1K0TA 1D3WA 3A8EA 3NMRA 3I32A 3DRYA 4RW9A 4IKAA 5F0WA 5HQMA 3MM5B 2HHUA
chains in the Genus database with same CATH topology
1A9NB 4O4GB 2MXYA 1QAJA 4K2XA 2FHJA 1OO0B 4M63A 4QW9A 4F8RA 1F5CA 4ICLB 2FPHX 1UVKA 1HW9A 4LUBA 1R31A 2PC6A 3MEEA 3GG1A 4AXJA 4O3SA 1N0UA 3HVRA 1H6KX 1SB6A 3C2PA 2F9JA 1CPZA 1SH0A 3UWTA 2R7UA 4DUZF 3MEDB 2OLWA 1RTIB 3OHBA 1G1XA 3H4DA 1RYRA 4X64F 5L39A 4LF7F 2EBGA 3SSQA 2QLXA 2D9PA 2L9DA 2EFOA 2BANA 4NLSA 5ADZA 2JZ5A 5HL7Q 2FUG9 2YKNB 3HDSA 1FESA 3I4HX 3B4DA 4ECXA 1WG1A 4XO0A 1P1TA 2CQGA 2H9ZA 2KRRA 3OL9A 3DDKA 3MAHA 3O6QA 2QRRA 5EWEA 1S1TB 4BS2A 1HNIA 2ZHBA 2D3UA 3M8QA 2E9RX 4TKTA 4NOHA 2YH0A 1KQFB 2HRYA 1JX4A 4TN2A 5GAEI 4H4MA 5EWFA 4B17A 1RTJB 4C0BA 4Y6IA 3MR3A 4BWMA 1GTHA 3KK2B 4TXSA 3OW2R 3E51A 2ZBIA 1Z2ZA 2LXFA 3LWMA 2KFZA 2IC3B 2PD1A 3KK1B 4DUYF 1YWXA 3N9UC 4ICLA 1SJQA 1J5OB 2BXJA 4FXDA 1OWXA 1S79A 5K14B 2VFTA 1F60B 3BN7A 2ADBA 2QA1A 1N5TA 2KDOA 4EZ9A 2MZJA 1RTIA 3NP5A 1T03B 3H40A 3OXGA 2UXCF 2UVRA 1G2EA 2MQNA 4JUZA 3TX8A 3M30B 4KFBA 1CC8A 3ULHA 1FHTA 1GH8A 3OFEA 1GT8A 2IM1A 5E33A 1VRTA 1LFWA 1TP7A 2QE5A 2G4BA 2HHQA 4USIA 4IH6A 1S1TA 2J9DE 4NLVA 1Y3KA 3BB5A 4PCQA 1VQ4S 4PRFA 3RW7A 1VI7A 2ILZA 2M9KA 4CZCA 3K59A 4X4SA 1FRIA 2LYVA 1TVRB 3BGFA 5BYQA 3CD5A 1XK8A 4KPYA 2M5YA 4IG0A 3G8SA 4F4ZA 2HGMA 4YB6A 5B0DA 2E66A 3CD6S 2IC3A 1R89A 2O3DA 3S7RA 2BACA 3MECB 4ZPBA 2RRNA 4MIAA 2N3LA 1TL4A 3NGDA 4LIRA 5CZVA 1WHVA 3U1LA 5K14A 2W24A 4Y28C 2ACYA 4JBCA 1QM9A 4ZVHA 1XR6A 1S0OA 1VQ6S 3PVXA 3OVSA 4Q2MA 2AYMA 1JNRB 1FVQA 1GAOA 3AQOA 2ZH8A 5JJBA 1FK9B 4EYIB 4LVOP 4WF9Q 5LXYA 4IDKB 1KOHA 2K3IA 1XBWA 3EUNA 3QWPA 4HTJA 1O0PA 2XLKA 3SEOA 1S0NA 5CH7B 5KG1A 2G0CA 3F56A 4HDHA 3UCUP 4DS5A 2BQRA 2CQCA 1KFSA 1DJ0A 2ZVSA 1D8ZA 1HARA 2MY8A 1S1WB 2X1FA 1ZM2A 3CJ5A 2W9CB 1S6PB 2ASLA 2HNZB 1TVRA 2DRAA 3P49B 3Q8QB 1QUPA 1KS2A 1PC5A 3H5UA 3MD1A 1RA6A 4OI2A 3O5TB 4X4NA 2M3DA 3QAUA 1SL0A 3HPOA 3MECA 2M8HA 4OZLA 2RB7A 1AFJA 2AQ4A 5KFVA 1NJZA 4C3MA 4FNHA 3KLFA 4QCLA 1ULRA