1J5OB

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 99
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB03
4KO0B 4RW4B 2AGQA 3V81A 4TY8B 4O4GA 4MIBA 4K4UA 3BGRB 2UVUA 4PWDA 2J6UA 1CSJA 3C6UA 2C28A 2BRLA 4B3OA 3I5BA 3DM2B 2B43A 4PQUA 1HQEB 2XWYA 5KG4A 4RNOA 3GIJA 4IFVA 5L1KA 1S48A 4QWEA 2D3UA 2R8GA 1XR7A 3G6VA 5J1EA 4H4MA 2HAIA 1LW0B 4H54A 4LSNB 2YNFA 2WB4A 4WXWA 5C24B 3CJ0A 2IJNA 2C22A 4ZMMA 5L1IA 2B6AA 4ID5A 3DYAB 4MFBA 4IKAA 3HKWA 2F8EX 3GV5B 1S0MA 4O3NA 2UUWA 3PW5A 2I1RA 1HNIB 3JYTA 4QPXA 4ED8A 4KHRA 4Q43A 3OSNA 3M9NB 1JKHA 2FVCA 5EWGA 2E9TA 2WOMA 5KT4A 3QZ7A 3V4IA 2WCXA 4XPEA 4FBTA 1N6QB 1C0TA 4PUOA 4K4VA 2I5JB 3T5LA 3H5XA 5KFSA 3KLEA 3DRSA 5J2PA 4ED7A 1KLMA 5HP1A 5KFWA 4MKAA 2FLNA 2R8IA 5EWEA 2HMIA 1S1VB 5CYMA 4Q0BB 2BRKA 4YR3A 4FS2A 2IAJA 3QGGA 3BSAA 5K14A 3MR2A 1S9GB 3M9MB 1S6QB 4ECSA 5KFEA 4J9SA 4ZPDA 4WFZA 4ECZA 1S1XB 4ECQA 1T05A 3VQSA 4O3PA 4OL8A 1RT7B 2OPRA 4H4OB 1S4FA 4MK8A 1RT1B 5KFQA 4X2BA 5KFCA 5KG0A 1SV5B 3LP1B 3G6YA 4DL2A 4F4ZA 2XCAA 4DL7A 3IRXB 4IOBA 1SUQB 1N5YB 2FJWA 3MEEB 4HYKA 3MFHA 1RTIA 5KT5A 4MKBA 4RNNA 4I7FB 2AGOA 4URGA 5KT3A 1REVA 3ITHA 1T03A 3CJ5A 3Q8PB 2ALZA 4ZHRA 2VG7B 3H5SA 1S9FA 4KV8B 3OLAA 4IR1A 3BSCA 1RA6A 3HHKA 4EO8A 4ZPBA 3BQ2A 2AQ4A 2DPIA 3M8QB 3DOKA 3MR5A 2W8KA 5KFKA 4DL4A 5J2MA 5KFBA 3OLBA 1RTDA 5J2QA 3UPFA 1RT2B 1SH3A 5F8IA 3SFGA 1JLBB 2JEJA 4KFBB 3CJ2A 2JC0A 2YNGA 4G1QA 4TLRA 3QGIA 4O3SA 5HROB 3CDWA 4KKOA 2YNFB 4ICLA 1HPZA 2FVSA 2W7PA 4ECRA 3OL6A 4ED3A 1LWCB 3RAXA 1TL1B 1BQNA 3T5KA 2B6AB 1JXLA 1DLOB 1JLAA 3HVTA 5D3GB 3PJWA 4RZRA 4ECYA 2YNHA 3KK1A 1IKXB 5KFOA 3KHGA 4NLGA 3H4BA 2W9CB 1JKHB 4WZMA 2OPSB 2IM1A 3KK3B 3UR0A 3DI6A 3V6HA 1JLEB 1RTJB 2C2RA 1HNVA 3D28A 2UVVA 5KFIA 5KFZA 5KFYA 1C0TB 4EYIB 2R2SA 1S97A 4O4RA 1MU2A 2VG5A 5J2PB 4ZPAA 2V4RA 1LWEB 5DGBA 3CO9A 1IM4A 4JUZA 1RTHB 5K14B 1S1WB 4J9KA 2V0NA 5KFHA 4YR0A 3KHRA 4NCGA 4KHMA 2FVRA 2HNZA 4QW9A 4J9LA 4IRKA 3I5AA 1FKOB 2BANA 3NBPB 5F8JA 1RYRA 1C0UA 5KFLA 2RF2A 4IG0A 3UQSA 1DTQB 3H40A 3RAQA 2JC1A 1IKVA 3RB6A 4IG3B 2JEGA 2JEIA 2J6TA 3G6XA 1QE1A 5HBMA 4ED1A 3GV8B 5DLFA 4I2QA 4LSLA 4EO6A 3LAMA 3EPGA 3PW0A 3LANA 5KFTA 1RTIB 2IC3B 3RB3A 1KHWA 1IKWB 5L1LA 3MECA 3ISNC 4DG1A 2VA2A 3KLFA 4EBDA 3DRRA 5KFUA 2YNIB 2UUTA 2ZD1A 4DEZA 3LP2B 3PZPA 5F8HA 2WRMA 2HNDB 4RW8A 2W7OA 4MK9A 2RKIB 1GX6A 3KLVA 1JLCA 5J2MB 3NMAA 3Q8QB 1FKPA 3DLGA 3GIKA 1OS5A 3H4DA 1DTTA 1ZETA 4NLPA 1VRUB 1FK9A 1C1CB 3N6NA 1HQUA 2BE2B 2HWHA 3OHBA 2ASLA 3KLGA 2YKNA 5KFFA 1S6PB 1J5OB 2YNGB 4URSA 4G1QB 2CKWA 3JSMA 4QWCA 4K4WA 4ED6A 3C6TA 3QIPB 2VG6B 1ZTTA 4NLYA 3DLEB 3V6KA 5KG7A 4F4XA 1HPZB 2YKMB 3DMJA 2ILYA 4TYBA 2IBKA 1C2PA 4NRTA 4ZVGA 4NLDA 5J2NA 3BREA 2WONA 4NLWA 2FJXA 1JLAB 2B5JA 5HLFA 1C1BB 1EETA 1RT3A 1JIHA 5KG5A 4ECUA 1IKYA 1W25A 4IFYA 4MK7A 2JEFA 1S9EA 3QO9A 1R0AB 4LQ3A 5KT6A 4IDKA 4ED2A 3KJVA 4QW8A 1HNVB 3V6DB 1RT5A 3IG1A 3T5JA 4KBIA 5EUHA 2VG5B 4RW9A 4GC6A 1TVRB 2ZKUA 3QLHB 1LW2A 2HNYA 3TAMA 3PW4A 5KFDA 2IA6A 1TKZA 1UWBB 1JLFB 3RB4A 5C42B 4Q44A 3KMQA 3BQ1A 2E9RX 3I0SA 3FFIA 4DL3A 2E9ZA 1TV6B 4Y34A 5KG3A 3NGDA 1TKXA 2ZE2B 4YQWA 3GQCA 4XO0A 1RT6A 4NLQA 3DLKA 3BQ0A 3ISND 4IG0B 3KOAA 2OPPA 1HYSB 3KK2A 4R8UA 1EP4B 4ZP9A 2ASJA 3T1AA 3DRPB 1S1UA 4NLRA 2RDIA 3BR9A 4J9PA 3MEGA 1JLQA 1TKTB 1HMVA 5KG2A 2R8HA 2OPQA 4RW6B 4Q8FA 1D0EA 2AWZA 3H2LA 4J9NA 3V81B 3I0RA 3H5UA 5KFNA 4O4GB 5KFPA 3M8PA 4WE1A 4PWDB 3N6LA 3C6UB 3MEDA 3KLFB 5DG8A 3PVXA 3KLIA 4B3OB 2XCPA 4TQRA 4R5PA 4PQUB 4KO0A 4RW4A 2WK4A 4IFVB 3KLHA 2QE5A 2R2RA 3QIDA 1NHVA 2XGQA 1XR5A 5J1EB 4H4MB 3BGRA 1NNDA 1FKPB 3DLGB 1S0OA 1MMLA 2UVWA 3DM2A 3DDKA 4ID5B 4U6PA 1HQEA 1HQUB 4MFBB 4IR9A 2BQUA 2YKNB 4TYAA 4ZPCA 3QZ8A 3EZUA 3JSMB 3JYTB 3CJ4A 1N4LA 4LSNA 3C6TB 3CWJA 4NRUA 4ZVFA 4F4WA 3PW2A 4IH5A 3E51A 4O3RA 2WOMB 5C25A 3DYAA 4MH8A 3V4IB 4NLVA 5KFGA 1S0NA 4K50A 4PUOB 1NHUA 1GX5A 1HNIA 5HLFB 5KFVA 5DGAA 3KLEB 3DRSB 4KAIA 5DQGA 5F8NA 5F8GA 4IFYB 1KLMB 5HP1B 1JX4A 3QO9B 3FSIA 5CYMB 2HMIB 4IH7A 2ATLA 1N6QA 3OL9A 2IAJB 3MFIA 4F50A 2I5JA 3MR6A 3GILA 2XGPA 3KMSA 4YMEA 3Q8RB 5DQIA 1Z4UA 5JXSA 3PHEA 1T05B 3NL0A 4ECTA 2OPRB 2HNYB 4Q0BA 1TKZB 5KFMA 3KHHA 4DL6A 1S9GA 1S6QA 3PJXA 4JV0A 1LWFA 3IS9A 3IN5A 2RDJA 2FLPA 1S1XA 3PR4A 1RT7A 1RT1A 2AGPA 4WFXA 5CYQA 4EYHB 4G3IA 4NLTA 2R8KA 1RT6B 1XR6A 1SH2A 4J9MA 3OSPA 4ECVA 1SV5A 3TQ1A 3KK2B 4EEYA 1REVB 3ITHB 1T03B 4RU9A 4ZHRB 4QWAA 1N56A 3IRXA 1SUQA 1N5YA 1I6JA 2C2DA 5F8LA 2W8LA 3DOKB 2WTFA 2GIQA 1KHVA 1HARA 3GIMA 4I7FA 1TP7A 3I5CA 3M9OB 5FDLA 2IM0A 1RTDB 5J2QB 3T5HA 2AU0A 4KV8A 1ZTWA 4WE1B 4M94A 5EDWA 3GIIA 3KLIB 2IJFA 4FS1A 5KFAA 4R5PB 1TQLA 2IM2A 2R8JA 1BQMA 3KLHB 4LQ9A 4U7CA 4NLSA 4EBEA 4GC7A 1RT2A 5L9XA 1S10A 2FVQA 4KKOB 4ICLB 4ZVHA 4MIAA 5F9NA 1JLBA 1BQNB 4KFBA 4NLUA 3FDSA 4WXOA 4EBCA 2GIRA 3HVTB 3CIZA 3NAIA 5HROA 5I42A 5F8MA 2YNHB 3KK1B 3CVKA 3LP0A 3BSNA 2D41A 3GYNA 4QWBA 4RW7A 3T19A 1LWCA 4TQSA 1TL1A 3IGVA 3QYYA 3PR5B 3DI6B 5C25B 1RT4A 1YVFA 4FBUA 1DLOA 1RDRA 5D3GA 2W9BA 2V9WA 1IKXA 4I2PA 4WFYA 3BJYA 4YP3A 1MU2B 3LALA 4TXSA 1T3NA 2W9CA 2IM3A 2QV6A 2OPSA 2OH2A 3KK3A 1QAJA 4J9OA 3FRZA 1JLEA 1RTJA 3IGNA 4RNHA 4IRCA 5DLGA 3NKYA 4NLOA 3ICLA 5L1JA 4JV2A 2XC9A 4NCGB 4O44A 2HNZB 2FJVA 3EPIA 1VRTA 1LWEA 3FQKA 4K4XA 5KFJA 2BANB 5I3UA 2CJQA 1RYSA 2ASDA 1C0UB 2C2EA 1RTHA 2RF2B 1S1WA 1IKVB 4NLXA 1LWFB 3IS9B 1QE1B 3BSOA 5HBMB 3E01A 5KFXA 4I2QB 4LSLB 1TL3A 1S1TA 3OL8A 1FKOA 2AX1A 3NBPA 2HWIA 1WNEA 2EC0A 2IMWP 5CYQB 1DTQA 3G86A 3MTKA 4IG3A 5T14A 4RNFA 4ZP6A 3MECB 5KT7A 4Q45A 4DG1B 1JLGA 3H5YA 4KSEB 2VA3A 3TVKA 3DRRB 3OHAA 2BQRA 4ZP8A 3DOLA 2ZD1B 4M95A 1RA7A 4KE5A 5C5JA 2R2TA 4KB7A 2IC3A 4Y2AA 4RW8B 4TY8A 1IKWA 5EWFA 3D5MA 5F9LA 1JLCB 4JV1A 5FDLB 4K4YA 4O3QA 4J9QA 3H98A 2YNIA 1DTTB 2ILZA 3LP2A 1FK9B 4WZQA 2WHOA 4IQXA 3KLGB 2HNDA 2O5DA 1D1UA 4RUAA 1K1QA 4YR2A 2RKIA 3RBEA 1LW0A 1BQMB 3N6MA 4QWDA 5C24A 1S49A 2R2UA 1VRUA 2FVPA 1C1CA 3DMJB 3FQLA 2BE2A 2BR0A 4WYLA 3SFUA 1U09A 4DL5A 3RBDA 1S6PA 5J2NB 1J5OA 2GC8A 2WONB 4XPCA 4ECWA 2B5JB 3CDEA 1EETB 1RT3B 3QIPA 2VG6A 5I42B 3NAHA 3LP0B 3DLEA 3UDLA 1IKYB 4NYZA 4RNMA 3MR3A 2BQ3A 3Q8SB 2YKMA 1S9EB 4RW7B 2AX0A 4IH6A 4Q8EA 4WYWA 3HVWA 4ECXA 4IDKB 3KJVB 1RT4B 3RB0A 5KG6A 4HKQA 2W9BB 1C1BA 1RT5B 4I2PB 2XI2A 3IG1B 4URQU 2W9AA 4RW9B 3HVAA 1SH0A 3LAKA 3KHLA 1LW2B 1R0AA 2D3ZA 3QGHA 3TAMB 4F4YA 1S1VA 5KG1A 4Y3CA 2V4QA 3GV7B 1QUVA 4ZVEA 3V6DA 4O3OA 3I0SB 4K4ZA 5KFRA 3FFIB 5DG9A 3SI8A 3CDUA 4K4TA 1TVRA 5KT2A 2JLEA 3QLHA 4H4OA 5DQHA 4O44B 4RUCA 1VRTB 2J6SA 1UWBA 1JLFA 1TKXB 5C42A 5I3UB 4ED0A 3PW7A 3DLKB 1N48A 3LP1A 2OPPB 4R8UB 3OL7A 4Y2CA 4ZP7A 1TV6A 4K4SA 1S1UB 3E01B 4NZ0A 5JUMA 3MF5A 1T94A 3MEEA 1TL3B 1JLQB 1S1TB 2ZE2A 3MEGB 1HMVB 1RAJA 4J9RA 2DPJA 2FLLA 4IRDA 2OPQB 4R0EA 1K1SA 2XI3A 1HYSA 3CJ3A 4TN2A 4TY9A 2UVRA 1EP4A 3KNAA 2D7SA 3I0RB 3H59A 3DRPA 2VG7A 3M8PB 1JLGB 5DG7A 1TKTA 3MEDB 1QAIA 3M8QA 3V6JA 3DOLB 4RW6A
chains in the Genus database with same CATH superfamily
2MZ1A 1VRQC 1N36F 3FK4A 2YWFA 1BGXT 4MFBA 4DMZA 1S0MA 2YQ0A 1VQ9S 3OSNA 3M9NB 4OZNA 3V4IA 2WCXA 5IOLA 4X4VA 1X0FA 3HZGA 3TUJC 3W9JA 4FS2A 4Q0BB 1JK9B 2J8SA 3QGGA 2RQKA 2P2CB 3KDNA 4DX5A 1S4FA 2AZ3A 4L72B 3MEEB 2J9DA 1UVKA 1FE0A 1REVA 2V94A 2MGZB 1LNQA 4F67A 2R7OA 1RT2B 4Y2IA 4U8YA 4NYPA 3VAKA 4KKOA 4ECRA 3DKDA 2B6AB 1S57A 1YG0A 1VDHA 1JKHB 3UD4P 3KG4A 2UVVA 2LDIA 2VG5A 4DQQA 1LWEB 2KXNB 2EFVA 1RTHB 1LFPA 4EMDA 2GJ2A 5KFHA 2CUYA 2RH3A 4DV1F 1LFWA 3RAQA 1DTQB 5L9NA 3GV8B 2J0SD 3PW0A 3QRPA 2AV5A 3D4JA 1RTIB 2IC3B 1D9DA 4OYAA 3MECA 5A8KA 2FHJD 2YNIB 3KUEA 2UUTA 2ZD1A 2HS0A 3Q8QB 2M88A 3KLGA 4O0IA 3MAHA 3MCNA 3DFEA 2IBKA 4NRTA 2ZJPQ 1UTAA 1JIHA 2V2QA 1F2GA 3I55S 3KJVA 4ENOA 3OBIA 2A2DA 1MLAA 1RKJA 2GHWA 4U67Q 2ALYB 4KGKA 1CQMA 3HP6A 1TFWA 4DL3A 1U02A 1FEHA 2V2VA 3JTOA 4Y34A 3WX8A 4NLQA 2MZQA 3B8HA 3BQ0A 2RDIA 3BR9A 3C46A 3MHYA 4RW6B 4UUXA 1U1QA 4J9NA 2XM3A 2DO0A 4LF4J 3QIDA 4HI1A 3PM9A 4QU7A 3OFGA 4Y00A 3BBFA 3DDKA 4KR0B 4MFBB 1N5TA 4ZPCA 1P1TA 2YKAA 4OX7A 3ILOA 1FJGF 4O3RA 2HIYA 2HHWA 3V4IB 2DNHA 5DGAA 3R5BA 3QO9B 3TZYA 5LXRA 3EVOA 3GTYX 3JXOA 3M05A 2DH9A 1U1LA 2ZKTA 4X4OA 4OYPA 1S6QA 2XSJA 3KNGA 4HL9A 2O67A 2RT3A 4C2MA 1REVB 3GP9A 3K5NA 1NKEA 4F2SA 4TVAB 1HARA 1TP7A 3MZIA 1UEUA 3DOMA 5MAOA 4KKOB 3TX8A 2V69A 2LEPA 5F8MA 1WF2A 5DS7A 4RW7A 3LH2S 2OLWA 1NJZA 2W9BA 3G87A 1H98A 3D1QA 2Y1LB 4AL5A 4DR1F 2MLZA 3HXMA 1RTJA 1RWNB 3ICLA 4DV5J 2DTJA 2FJVA 5I3UA 3FZBA 3V4MA 2HW3A 3HSZA 4NLXA 1ZYQA 3SQGA 1WNEA 1FKOA 3HJVA 5L8RC 2IMWP 1NBEB 3OFEA 4DR2J 2KJWA 3J80U 3MECB 5KT7A 3R1LA 2ZHBA 5A8KB 3OHAA 2ZD1B 3MXHP 2NUUG 3D6FB 3KLGB 4FZVA 3K5LA 3NGRA 4X4PA 1C1CA 2HQGA 2E1MC 3T6JA 4FDFA 1S72S 1V3ZA 3ZTOA 3KJVB 2YWKA 2ACYA 2GQQA 2E1CA 1R0AA 1QDUB 4FKXA 2OTJS 4O44B 3J80Y 1SKRA 5DM6Q 2Q6CA 2JLGA 1U0SA 4NMLA 2JX2A 3W1YC 1TL3B 5CYJA 2NZCA 4DV6F 1HYSA 2AMCB 5K8PA 4MKVA 4P72A 2VOOA 3TEHB 5LT5A 2L08A 3JAMY 3C6UA 1RB0A 4NZ6A 3W63A 2XWYA 5KG4A 4DV3F 1UVIA 1SKUB 5ETPA 3G6VA 1NJYA 3BGFA 3QFWA 3HKWA 2F8EX 3KDOA 4O3NA 2XS7A 3AAWB 4QPXA 2HAFA 5B0GA 1HQ2A 5FJ4A 4OI0A 3ZFVA 3T9NA 4F02A 3BN4A 2R8IA 1S6QB 2XSJB 2R7QA 2MHEA 1M5KC 4WCEQ 4ECQA 4F7VA 4JYAJ 3TARA 2Z56B 2MJUA 1M1GA 3LP1B 3QATA 4DL7A 2UV8A 4IOBA 1VMBA 2PDAA 1SJ4P 3VAFA 4CO5A 3ZZPA 1UCNA 3VF0B 1NXIA 1T0TV 3DOMB 1WDDA 5AJ3F 1FI4A 1OY6A 1ZAXA 2E5GA 2QYGA 5A0YA 1RTDA 3NRBA 4TLRA 1Q81T 1R8CA 3LTOA 1CC7A 4CO3A 5IV3A 3W2VA 4ES1A 3VR1A 3J7Z5 4DSEA 4ECYA 2IVFB 3LGNA 4NLGA 2CQPA 1RTJB 3RJMB 3UN5A 3ILIA 5J2PB 1KSPA 3FC9A 2VASA 3QMQA 2G0CA 4C3MA 2CG8A 3SQGB 1FKOB 4PABA 4CH0S 3CXCR 4IG0A 5L38A 5IS2A 5KFTA 3TUZC 4M63A 4EBDA 1WHWA 1HNXF 1TUWA 1FO1A 2WRMA 1WC6A 5EGYA 1C1CB 3FBFA 3IMQJ 4QWCA 4C6AA 3UWTA 1RWKB 1W25A 1R0AB 3C3LA 4B3MF 3RR7A 3SCLE 5GAHU 3IG1A 3T5JA 1WDTA 2BACA 5KFDA 4Q44A 4CCHA 5FLXU 4B9SA 4ILMA 2GX8A 2KVQE 3VAHA 1HYSB 4A8YA 2EVZA 1FVQA 2B56A 1UMJA 1Y3JA 1U0HA 3C6UB 5E2QA 4RW4A 1XR5A 4LRDA 3RUBL 1CJTB 1XWLA 2PMHA 3UN3A 1VI7A 1RI7A 4EZ6A 3CJ4A 1AFIA 4LIRA 1NDLA 3UCUP 3PCOB 1AUDA 3CD0A 1FRMA 1N6QA 1Y0HA 4YMEA 3PYDA 5DQIA 2E5LF 4NCBA 2GQ2A 2XG8A 4ATNA 2EFGA 1FFSB 1RT1A 4BHQA 3MCSA 3TZZA 2OD6A 4KGXB 4JI2J 3BDPA 4LFBJ 2VKRA 1N56A 3IRXA 3G96A 3OVSA 3P5BP 2I38A 5A0YB 2DHSA 1RTDB 5IQQA 1B0VA 2DK2A 4B08A 2CQBA 3W2VB 4I69A 5D0EA 3PXGa 5F0WA 5ADZA 4DR3J 3GSIA 1VCTA 2BEFA 2HVDA 4C11A 3DGPA 2YPYA 1EQMA 3PIOQ 1RAEB 2VC1A 1OYEA 2JOQA 5KFJA 3EGZA 1K9MT 2PFFB 4KGZB 1XBWA 3LOUA 3WQPA 1U47A 4KGMA 4IUFA 5CYQB 3G86A 3D0HE 3QT6A 1PBAA 1D09B 3EZOA 3CNQP 1N52B 3CMAS 1U7LA 2K3KA 3R7SB 4DR4F 4NI2B 2RRNA 1Q5VA 2EBEA 1FEEA 1XK8A 2GVZB 1F3VA 2YKMA 4PXBA 4ETZA 3M8WA 4F8RA 3W64A 4WU3A 4I2PB 3IG1B 3K5MA 1TKDA 3CGIA 4OZLA 4X4UA 4F4YA 4N76A 1N36J 3DDIA 2IY5B 3QLHA 4H4OA 1AYEA 1YHQS 5DDQC 5I3QA 4K4SA 4O23A 4RWXA 4M5GA 3UFCX 3WX4A 1EP4A 4F04B 2XYPB 1TFYA 2WVFA 1U0HB 3I32A 1X60A 3M8QA 2YVSA 4U7UD 4RW4B 1O8BA 2AGQA 1F0XA 2QMWA 3DN9A 3J81j 2B7BB 4B3OA 1ZAVA 3NS7B 3HD1A 1DJ0A 1FWLA 3GYGA 4C7QA 5C24B 2NXJA 4X62F 1R8AA 2UUWA 1GXUA 2CJ9A 5EWGA 2DHXA 1N6QB 2V8HA 3M9MB 3SYZA 5HATA 2OPRA 1RT1B 4DN9A 3WDOA 3EGWB 2XULA 5U47A 4HH1A 1BXNA 3IRXB 2BJ1A 4GRSA 2KKHA 4HYKA 3C15A 1M5HA 4RNNA 3GG0A 3PFOA 4L75A 3OD2A 5GADI 1KQGB 3C8YA 4Q2MA 1H7XA 4DV1J 2VFTA 1ITPA 2JHEA 3OR2A 4C11B 1H2UX 2HIQA 3PJWA 1Y11A 2PA8D 3KK1A 2CVIA 1NPPA 2VFRA 4DZDA 4ELTA 2IM1A 4LF5F 4ITSA 2C2RA 5KFZA 1C0TB 4CIOA 2V4RA 3BYPA 3H0PA 1N34F 2ZHAA 5DZ6A 2RQCA 4QW9A 3F73A 1X4FA 3PY8A 1JMTA 1GFWB 2J9DE 2FZCB 1ZZFA 5L1LA 2AYMA 2GHVC 5BR8F 4I56A 4OLOA 3NGKA 4LFAF 2NLWA 2LEBA 1YSJA 1HBOA 2YNGB 1NEEA 2CKWA 2MKKA 2CJKA 2QFJA 2YKMB 3AH6A 5BYSA 1SC1B 5CD4H 3FMWA 2WVEA 1RT3A 3P8BB 2CPIA 1OPZA 4IFYA 3TZXA 1CBKA 2MQNA 3DU6A 4DFPA 1HI8A 1IBCB 1SL1A 1MMNA 3IR5B 3QLHB 2CJAA 3KMQA 3I0SA 3FFIA 4FPIA 4Y2KA 1FJGJ 1TKXA 4M5DB 4DN0A 4DJBA 1EP4B 1F9EB 2RIJA 2DHHA 3HSJA 4KJIA 4B3OB 2AJ1A 1TR0A 3OPKA 2W01A 4LREA 1I94F 2IYGA 1JJ2R 4ZLPA 2HSEB 3JSMB 3CWJA 3ZNUA 5DDOC 2DGVA 4QR1A 2HFOA 5HQMA 2LU2A 2POKA 1KTVA 3PKYA 1SI9A 4F26A 3FVYA 1YJWS 3Q23A 3GCXP 2OPRB 1GQEA 4LRAA 1H72C 3M2UA 1R0CB 4P9SA 4EYHB 3MPDA 3QWUA 1UVNA 3CC2S 2XMAA 2WTFA 2GIQA 2AIRB 5J1NA 2B4OA 3M9OB 4I0WA 3I9V9 4OJGA 2DR5A 3AOAA 4X64F 4WE1B 3EICA 2PEBA 5ETRA 5HQLA 3G82B 1TQLA 2IM2A 2ROPA 1JXEA 1Q53A 4HT7A 2FVQA 4K2JA 3OR2B 2M8HA 6FDRA 3KK1B 3RBZA 2KHDA 1DLOA 4RL1A 1CS4A 3U1MA 4JI3F 3IWXA 2M8DB 4CZCA 1WUUA 2CJQA 1S1WA 4USVA 4RNFA 4MIWA 1U4BA 3DOLA 4CLUA 5H9FK 5EWFA 1M5OC 5LSRA 2RKIA 2MDAA 1VGYA 3MMCA 4DL5A 3K17A 4DV6J 1RT3B 3FRYA 3MMAA 1IJEB 2MHNA 3R1HA 2JFDA 4URQU 1SH0A 4Y3CA 3I0SB 1EIYB 3FFIB 4DV3J 4CYUA 5E7OB 3FNNA 1TKXB 2LLZA 1RAHB 4P71A 4HT5A 4QBUA 3UCZP 3NWGA 1U26A 3ONQA 2XI3A 4TN2A 4NX9A 2L3MA 3DRPA 5B08A 4W98A 2W4DA 3TX0A 3ZZUA 3V81A 4TY8B 1HWKA 3MPWA 4RNOA 1YX2A 2R8GA 1S48A 1B64A 4H54A 3FBCA 2KZZA 3HF5A 4X4QA 2EKNA 3PHTA 2BZ2A 2W2OP 4HHHA 2E9TA 1X9WA 1D9AA 1HFEL 5AJ3J 3T1YF 3RW7A 2MY8A 2AKWB 2NYIA 4MKAA 2HGMA 1AT1B 3HSDA 4F25A 5K14A 3M2UB 3MPYA 4OL8A 4A4JA 2BOPA 2OHDA 2HVEA 3G8QA 5KAKA 1SJFA 2CZ4A 3MFHA 2CZVC 2FY1A 5M2PA 4MKYA 5KT3A 1T03A 2LXIA 3BSCA 5A8RA 3NLCA 1PIEA 2JC0A 3DRXA 2BKOA 3OTCA 3SV3A 1KOHA 3RRGA 2Z0GA 4TLQA 1FE4A 1DLOB 2BJEA 4FPRA 1CS4B 3H4BA 3J7AN 4WZMA 2EXUA 3UR0A 2EFNA 1YJRA 1HNXJ 2XMUA 1VQOS 4C8OA 2CVEA 1O0PA 3MM7A 1S1WB 2ACMA 4C0BA 3M1VA 1HNZF 1KRPA 4KQZA 3CULA 1RZMA 1PJ6A 2JC1A 4CLSA 2HHSA 4ED1A 2FIUA 5F3ZA 4UT4A 3R27A 3H25A 3MM9A 3K2YA 4B3MJ 1WTFA 3Q8VA 2KJVA 3KLFA 3LGHA 5H9FJ 3Q2SC 4RW8A 2RKIB 5J2MB 1QUPA 3AQOA 1FKPA 5GMEA 3VGVA 4K5RA 1ZA1B 3C6TA 1ZTTA 3ADAC 3MMAB 1FA0A 2RUSA 5ETLA 2YWGA 2E5JA 1JLAB 5HLFA 5D4LA 1IKYA 1CJUA 4ZIWA 3P5TL 2RU9A 4CYUB 1KTQA 2OFGX 1CJKA 1AZSA 1REGX 2IA6A 1TKZA 3C14B 3JTNA 1BWVA 3BH7B 4Y6IA 3KXDA 3KOAA 3KK2A 3OVAA 3DRPB 4OZJA 1HMVA 2FHMA 3CJRA 1D0EA 3V81B 3I0RA 2J0QD 4ID8A 2E5LJ 3E8OA 1YBTA 1TTHB 2B0GA 1DQ9A 2E5HA 2UVWA 6AT1B 3G8TA 3EX7B 2DITA 4CDIA 3RZAA 5C25A 1PILA 2DH8A 5HVHA 2JRSA 2MJNA 2KG1A 5CZXA 4C97A 4CO4A 4HDGA 4ECTA 2WW8A 3MM5A 5IM0A 2V63A 3W62A 2BJ7A 2XTJP 4C8LA 2DT9A 4NLTA 2XO7A 2VJUA 2HHXA 4PG5A 1T03B 2WVBA 3W8GA 5HI7A 2ZBQA 3MD1A 1FDBA 4OIXA 2IJFA 2CQHA 2DISA 1URRA 5LMNF 4MMOA 3FDSA 2GIRA 2MPUA 3WBZA 1CJVA 2RRBA 3R2DJ 3CUNA 2LCWA 2V9WA 4J90A 3M8YA 3B82A 1SVDA 1YDLA 4DR4J 3Q2TC 4PG8A 4CLTA 4XTTA 4ANCA 4Q7AA 1RYSA 3CCSS 1FTRA 1RSCA 3MM9B 2DBBA 3D6MB 2F9DA 4W90B 2FUG9 4UY8T 1NLKL 2BQRA 4ZP8A 3CCZA 4RW8B 5F9LA 5FDLB 4K4YA 1S79A 3PNIA 2ZH6A 2WBMA 5A2QY 4L3NA 2FVPA 3Q89A 4DCOB 5CXTA 3DLEA 5MLCV 1IKYB 1GH8A 1CJUB 2AX0A 2DGXA 2EG1A 1RT4B 3D1OA 3KG1A 3HVAA 1RAAB 2D3ZA 1O51A 1NKCA 4K4ZA 3SI8A 1R8BA 3I4HX 3UDVA 4OI6A 1TUGB 4X62J 2DNQA 1U48A 2DEIA 3OL7A 4CLYA 1HMVB 1QVFR 5CD4A 4ZIVA 3I56S 3I0RB 2Y1JA 5M2UA 5ETTA 4O4GA 1HIYA 2EI5A 1XNQF 1K8AT 5L1KA 3N79A 3KYLA 1PGZA 2YNFA 2D74B 3HO1A 1UZDA 3BO3A 1WSVA 3GV5B 1NB7A 3K8VA 2MKIA 4U7UK 2WOMA 4X66F 3LGMA 4K2XA 2CPDA 2E7VA 4ETXA 1KLMA 5KFWA 3JSBA 3MM5B 1V3SA 3QFHA 5D6GA 1KP6A 3P6YC 2XLKA 1KDNA 1VBYA 5KFCA 3QT8A 2KL8A 4OHZA 1YQHA 1RBLA 4LF5J 2G9OA 3L3CA 2M70A 3L09A 3IRWP 4QIWD 5C7PA 1N34J 3QNWB 3UPFA 2M2BA 4ZJLA 2C1EB 4G1QA 3MAAA 5CCLA 5IFMA 4PXEA 3MPUB 4ICLA 1CJVB 4ED3A 1AB8A 1K73T 2CDRB 5LSOA 3EUNA 4LF7F 5BR8J 3V6HA 3D28A 5D4PA 2LEAA 2DH7A 3NXZA 1JJCB 4LFAJ 2C2KB 5DGBA 2JVOA 4DR6F 1QTMA 4J9LA 1NMEB 5T41A 4N56A 1CVJA 1X5PA 4LSLA 1VHFA 1UFLA 3A4TA 2BVZA 3R5GA 4ER8A 3IR7B 1NSQA 2Y8WA 5F8HA 2W7OA 3US5A 3DLGA 3D1HA 1T95A 3H4DA 2ZEJA 1ZETA 2ASLA 1IQZA 3N6NA 1V5VA 2YKNA 1YGYA 2E1AA 1T11A 4C8KA 3DLEB 3V6KA 5KG7A 5F41A 1HPZB 3QT7A 1N5SA 1F60B 2BDPA 1QTNB 2VQEF 1PYTA 2VFUA 4WK1A 3W3SA 2RQMA 3CE8A 4NMXA 3RW6A 2DD8S 5ETSA 1I94J 2A10A 1Q78A 3DRYA 1RCXB 4RUBA 2ZWOA 2ZM6F 4DR7F 4ELVA 3BYRA 4GKKF 2L9WA 5DDPC 4O4GB 2DCLA 2FYXA 1HD1A 1LV5A 2OEKA 2AEJA 2PSZA 3D7SB 1X9SA 4FYVB 4LVOP 5HK4A 1N4LA 4CM2A 4F4WA 2GVDA 4U8VA 2EPIA 2WOMB 4R25A 3DYAA 4NLVA 4Y65A 1ELOA 4LR9A 1DBDA 4UZCA 5DQGA 4DR5F 3CDAA 5F8GA 1KLMB 4X64J 3NCPA 3FSIA 2XNQA 3MD3A 4F50A 3MR6A 2NREA 1Z4UA 2CADA 4LF2A 1QY7A 1SQFA 2AJ2A 2YKOA 2LA6A 3PJXA 3RR8A 3NS5A 3PR4A 1P27B 2AGPA 2CPZA 4J9MA 1UETA 1NJXA 5FD1A 4WTYA 5CAAA 4DSIA 2CZ9A 1FNXH 2D1CA 4JI3J 3FCHA 4ALZA 2LU1A 4I7FA 3MR7A 4M5JA 3MAAB 3AXMA 4ILRA 2GAGC 4ICLB 4CLLA 4FXWA 1X4CA 1ZOTA 1GK8A 2HRTA 1LWCA 4DPOA 4ZVSB 1UPPA 1QAJA 2BX6A 2KO1A 3FRZA 3UO0A 4PEOA 3FQKA 2VU5A 4LF9F 1VISA 2RAQA 5HO4A 3AA8A 4DUTA 1XIQA 1Y7PA 4LSLB 1S1TA 1J5EF 3NBPA 3HM9A 2DJWA 1P9QC 2NYHA 1JB0C 5KTQA 4Q45A 1OJ4A 3DGVA 2VA3A 4EI2A 4ZJQA 3A3PB 2GO9A 4ED5A 2CPEA 2FD2A 4O3QA 2ZDPA 3LP2A 2WHOA 1EZZB 1D1UA 2OEMA 3CF5Q 1U1KA 3HFVA 1S49A 2ZH1A 2QSFA 4S0MA 3ULHA 2NSCA 2VPWB 3RB0A 5KG6A 1C1BA 3A8EA 1UVMA 4CLPA 3BPDA 1V6HA 1QD1A 3EDQB 2V4QA 5IT0A 1VQYA 1NJIT 2FZGB 4Y2CA 2MZRA 3T1YJ 1BY9A 2AYEA 5HVGA 2R9LA 4ZVUB 3W9HA 3CJ5A 3BKUA 2KFNA 1F3FA 5IZHA 1XERA 4KT0C 4QWEA 1XR7A 2VBZA 3FJ2A 1N8RT 2HAIA 1LW0B 4LR7A 3CJ0A 2IJNA 2GVDB 3DYAB 2LQ9A 3R3TA 4Q43A 1VLOA 3QJPA 3OJSA 4QQBA 1T8EA 1PC5A 3BSAA 1KQFB 1NK5A 2D9OA 3VQSA 2RS8A 1FD2A 4M8LA 4QYRA 4J5OA 4NPOA 2QT7A 2DVIA 4I7FB 3AD7C 2HZVA 4EZ9A 3PTWA 1LEOA 4OJ3A 2J7UA 2H4YB 5KFKA 3TUIC 1HNZJ 3R8YA 4B9TA 2HHVA 3QGIA 1LWCB 4DSFA 4P2FA 3JTPA 4QPTA 4LF8F 2XZTB 4PR6A 2R2SA 2G1DA 4ZPAA 2ADBA 2HHTA 4I68A 4HI2A 1SQGA 4WFAQ 5A76A 3GR0A 1HBMA 2I2YA 3NBPB 3HZEA 2UXDF 1IKVA 1KQSR 1DFDA 4DF4A 4LUBA 4PPDA 1IR0A 5E3AA 3DHXA 2MMYA 4OHYA 2CQ4A 3ISNC 4DG1A 5AXKA 2HFVA 3DRRA 2BE7D 3LP2B 2GFFA 4DPUA 4FXDA 2Q43A 4USWA 4EK2A 4QCLA 3K8WA 4NA1A 5AE3A 2HWHA 9ATCB 2HQCA 2JZ5A 1U1PA 1C2PA 1MSWD 5J2NA 2B5JA 1C1BB 3DNCA 3GJSB 4A8KA 2O1PA 2KTQA 3V5RA 1R27B 2EW9A 2CJYB 5D15A 2OSRA 2HLUA 2RD5C 3LPEA 1DHMA 2HS4A 2KFZA 4R8UA 2FHKA 1S1UA 2U1AA 4PPZA 3HHDA 3FEZA 5HMWA 1VQNS 2MYFA 1KONA 1MMLA 2MEWA 2J9EA 1B3TA 4ZA1A 2YX7A 5F8NA 2OMLA 4PCQA 1X5OA 3MFIA 3SSQA 4D3HA 4NZ7A 1RHUB 3NL0A 3BO4A 2HNYB 5I3PA 4NXNF 5KFMA 3FUYA 5LMNJ 3HDSA 4CNZA 1MWYA 1VYAA 1RT7A 1AROP 4C0HA 1RT6B 4NL5A 4NOHA 2H3EB 1NZ8A 1KHVA 3ZZTA 2IM0A 2UP1A 1NK4A 3B78A 4FS1A 1T9YA 1UAWA 4AUKA 2G2ZA 4UOCA 3N5FA 4C98A 4DPWA 5I42A 1OQ3A 3CT9A 5AXMA 1X7VA 2JFKA 5E5NA 5D3GA 1S6OA 2HWTA 2IVYA 4NCAA 3F0NA 2PT0A 2GMJA 3VTIA 1ROFA 1HBMB 1IKVB 1LWFB 1WEYA 3EVWA 3IS9B 3E01A 3M32B 4NWBA 1WELA 2DR8A 1D9FA 4DG1B 1VBXA 3DRRB 5HSPA 3D5MA 4OYXA 4ZPTR 1GTHA 5ETKA 5IT9U 4OX8A 2BOAA 3QJLA 5F0UA 4DLGA 2ZBIA 1TZ0A 4QWDA 4GKJF 2AEMA 4USHA 3OTOF 1RISA 1U2FA 4NA2A 4YEAA 2M0GB 3KJQB 5J2NB 2B5JB 5KFEA 4WP9A 3LP0B 3MR3A 5GAEI 3OXLA 3TRGA 1RAOA 1ZS6A 5G0RA 4C8ZA 4DSLA 3PYEA 3GV7B 1XNQJ 4QIEA 1U1NA 4LR8A 2JNJA 9RUBA 4EU0A 2PEHA 4LRCA 3HT0A 1AUSL 4IOCQ 3THPA 4R8UB 4ERDA 2BABA 3S7RA 1S1UB 4OYZA 3G2XA 2B4VA 2DY1A 4IYQA 3EE3A 4X66J 2Q66A 2HBZB 2Z58B 2Q1LA 2BMBA 3UE2A 1NH8A 2C22A 1XMQF 4AT1B 4GVBA 4C8NA 2HYIB 4Y2MA 1FDNA 3I87A 3DCAA 4HEA9 3AD8C 1WOSA 5BYRA 4CLFA 2ZZTA 3CEDA 4CO1A 2HZCA 2FB0A 2BRKA 4YR3A 3OXGA 3SSSA 2YBVA 4WFZA 1UL3A 4KC5A 1TK8A 1G2EA 2RMLA 4OJHA 1DAXA 1RT7B 3GZ7A 4C4WA 1OO0B 5K9FA 1EB0A 3OT9A 1T9TA 2CQIA 4LF7J 3S8SA 2XO6A 5KT5A 3AXKA 2VG7B 3H5SA 1IR2A 3SMZA 3VGTA 4DV7F 3NEKA 1ZPWX 4F0MA 1QSYA 2HHPA 4DR6J 1Q5YA 1LOUA 1FNMA 3CC4S 3W5ZA 1XN9A 3OTBA 1BQNA 1BUXA 4USTA 5D3GB 4RZRA 3D6TB 3N4WA 2V6AA 7FDRA 3HI9A 1HNVA 1ZA2B 5KFYA 1S97A 2OO4A 2HHHF 4DF8A 2GJFA 2V0NA 1JJ4A 1SIWB 3ZTPA 1WC3A 4WTOB 2OSQA 2VQEJ 1M5VC 3LANA 2BYCA 2HVHA 2JLFA 5KFUA 2HEKA 2BW7A 3PZPA 4N77A 3A12A 4MK9A 3KLVA 2DGTA 3IBWA 1U2CA 3OHBA 1VBKA 2G2OA 4JB8B 2ZM6J 4DR7J 4GKKJ 2N4CA 1S0VA 1XNRF 2Z2YB 5G0RB 1S9EA 4LQ3A 1SJQA 3RAMA 3NCQA 1FJ7A 3M6UA 3C16A 2Z4PA 2UUCF 2G13A 3BQ1A 4C8YA 3FEXB 3WIUA 4M5MA 3LO3A 2IRXA 2J9CA 2HBYB 3GQCA 5G4DA 4DR5J 1GMVA 1FJCA 8RUCA 1IBKF 1DZ5A 1Y5LB 1RWOB 2V34A 3EMTA 3KLIA 4RX6A 2HKEA 4FN5A 3FBEA 4FP9A 3BGOP 4GVBB 3PG9A 3J7YI 1WJ9A 3JQKA 1RHMB 3PRDA 1N54B 4IH5A 2MQMA 5KFGA 1Q8KA 1OMSA 3ETOA 3J7ZT 1Q8BA 1VQPS 2I5JA 4LBIA 3KMSA 4H4KC 1VHIA 2Y3YA 1YRXA 3THTA 2ZVSA 4V1Ak 1MWQA 2P6TA 2ZH8A 2QA1A 2YKQA 4WFXA 3OSPA 1KEKA 1SV5A 3PO5A 1Z1ZA 1SUQA 3S6EA 2C2DA 1I6JA 4DFMA 2YKPA 4CTAA 4PXDA 3B4DA 3GIIA 4LF9J 4P2SA 1BQMA 1SQEA 2VC0A 1J5EJ 1BQNB 2DNLA 1PJ7A 5HROA 4QJVA 4U9RA 4JI4J 2BKNA 4KH0B 2LECA 3V2UC 5D0RA 1NH7A 2MLYA 2M9KA 3BJYA 5A8WA 5DM7Q 3ET6B 2IM3A 5IT4A 3QSYB 1HNWF 2R42A 5DETA 2G0IA 3H8YA 1CEZA 3BM7A 4K4XA 2PIIA 1C4AA 1WKJA 4IG3A 4ZN1A 4IO9Q 1NO8A 3FMBA 3R6GB 5C5JA 1DY3A 4OFZA 1VQ7S 4E0DA 4HHUA 1PBUA 1SC4B 1GAOA 2IPOB 3RGIA 4YR2A 1R6VA 2N4DA 5LSLA 1S6PA 3MM6B 2OMOA 3UDLA 2HFSA 4WFBQ 1S9EB 4ANEA 5BYQA 4RBUA 5IQ6A 4HLBA 1WHXA 1OPIA 3AHPA 3C16B 4DQIA 1S1VA 2D3OR 1FJEB 1NK0A 4NA3A 1FHTA 1R7IA 2CQ3A 1TVRA 1VRTB 2DNRA 4KHPF 1RU1A 3CPWR 1B0PA 3MF5A 3CJKA 1ULRA 4YHHF 1A6LA 2DYAA 3FGVA 3J81U 2KXFA 2HLTA 2C28A 4PYDA 4IFVA 4WXWA 4PQAA 5GAGI 1V3RA 1GXLA 4ZITA 3HKZD 1HR0F 4FBTA 2I5JB 1NZAA 1Y10A 4B3TF 3Q83A 3A8KA 3D67A 3MWBA 2IAJA 4ECSA 3MUVP 4J9SA 4GVLA 2UU9F 2NXEA 5KFQA 2QN6B 1SV5B 4DL2A 1WKKA 4DUYF 1SUQB 2FJWA 1WC1A 4LF8J 1NJWA 4CO2A 2VONA 4CTAB 1D3WA 1RCOB 4EO8A 3BQ2A 4ELUA 4DL4A 5HQ8A 1TMJA 2NQPA 3SFGA 2JEJA 2UXDJ 5HROB 3H2VE 2FVSA 1D8YA 3ZTSA 4ANDA 3RAXA 2CPHA 1RK8A 1VQ5S 1E6YA 4CNYA 2RQ4A 2LMIA 5A8WB 5D0GA 2XQCA 2OEJA 4L73A 4Z7CA 4EYIB 2ZBCA 1VK8A 4USMA 1IBLF 2Y1IA 1F9FA 1PSDA 4YR0A 3N5BA 2KH9A 5IV4A 5DRKA 4X84A 4PKDB 1C0UA 3H40A 3NNHA 4IG3B 5DLFA 1YJUA 2YWEA 1ZM4A 3G6ES 4HTIA 4R0JA 1KHWA 2COLA 3SSRA 1RWPB 3BEGB 2YH0A 3NS6A 4ZCMA 2M4MA 3D9BA 5K8NA 1UEKA 1S6PB 3L95X 4ED6A 2DXDA 1L3TA 4ES3A 4B9MA 2C2OB 4NLWA 4P74A 2KVIA 1SJ3P 4MK7A 2C3YA 2YX4A 4LIWA 4M5KA 2C2NA 5EUHA 2VG5B 4RW9A 1TVRB 2VL1A 2ZKUA 3TAMA 3PW4A 1Q95G 1WORA 2MKJA 3RB4A 5DJBA 3H90A 1QJHA 1VK3A 2VB6A 3CJKB 1U1MA 2B9YA 5EN1A 2AJ0A 3O3LA 4J9PA 1JLQA 1VQ4S 2WVCA 5KG2A 3UDEA 4Q8FA 3FSYA 2AWZA 1RADB 3M8PA 3VQTA 3PVXA 5K20B 4NXNJ 4IFVB 4WP8A 2QE5A 4B9VA 2MZTA 4DX8H 2DNNA 2KN4A 5H1SV 4XDDA 3VZIA 1BMQB 3PW2A 5ITHA 4BWJA 1WKLA 3MOZA 1NHUA 4E98A 2IRYA 1JX4A 2IAJB 4DBQA 2GGPA 3GILA 1I51B 1KLNA 1Q4RA 2J0WA 3KWMA 3PHEA 2H9ZA 3RBXA 1VC0A 4I4BA 4DX6A 2E66A 4F0HA 4JOUA 2KU7A 2BM1A 4OI1A 2XY5A 3I5CA 3IP0A 1PC4A 4LJMA 1ZTWA 4FVCA 3VAMA 2CPXA 3IAS9 4N7TA 1UA1A 4Q2LA 4WXOA 2XBPA 1E6YB 3BSNA 3P4UB 2D41A 1W7WA 2GAHC 3T19A 2EK6A 5E3RA 4YY3F 4RNHA 5DLGA 1Y3KA 2GQCA 2FTRA 1U1OA 4GKJJ 1NDCA 1WG5A 3OTOJ 1C0UB 3BSOA 3CCLS 3DLLQ 4WKRA 3MTKA 3T9ZA 4F0KA 2A6MA 5C2GA 1UEVA 3FKBA 3TVKA 1HI1A 5H9EK 1XQIA 2CPYA 2XZWA 4ZLJA 2PGCA 1RJJA 2CQ0A 2CG4A 2KI2A 2X1FA 1ZAWA 1YRTA 1VRUA 2BR0A 4XPCA 3CDEA 2ROEA 4WKYA 1APSA 3M8ZA 1X5SA 4RW7B 2A2CA 2W9BB 4JI8F 1X0PA 4QIVA 4RW9B 3TAMB 2QL7B 1NSAA 3UNYA 3V6DA 3BKFA 3ILJA 1XMQJ 2RHSB 5I3UB 4UOHA 2ZWPA 4DSKA 3W60A 1JLQB 1WEXA 1RAJA 1NPRA 2Q3PA 1NDKA 2FLOA 3M8PB 3W8PA 4I6YA 4AE5A 2NSBA 1WC4A 4C3KA 4A46A 1E6VA 1YITS 4JI6F 2KZMA 2XS2A 4DS4A 3G71S 4ZVOB 4P73A 1SJRA 4HACA 2B7CB 4DV7J 1TL7A 2GGPB 4W92B 5CYMA 1HWUA 4OZ0A 2IDLA 1F6TA 1VQ8S 3UVJA 1HWJA 1W2IA 2BJ3A 2P9EA 3ZZZA 3ISZA 3TI0A 3CCWA 3ITHA 3CTRA 1S9FA 3OLAA 2HHHJ 4ZPBA 4ZPVR 2AQ4A 1NKBA 2U2FA 1BQXA 1U24A 2ZOMA 2NPIA 5F8IA 1HBNA 2GMHA 5HN0A 1U45A 5BXIA 1CG2A 5E3CA 1S99A 4P75A 2V8DA 1SXLA 4DUZF 1MU2A 2NZ4A 4YOEA 2DGWA 5FLXY 1D8ZA 3KHRA 2VBWA 3GFYA 5F8JA 3W7BA 2IA0A 2GA7A 4ED4A 4WU2A 4CO0A 4EWTA 1XNRJ 1RHRB 3LWLA 5D4OA 2XMKA 1A9NB 2WB1D 2VPYB 1ZM9A 3IWLA 4LF1A 1UA0A 4M5LA 3S01A 3CIMA 2HRUA 2PFDA 2HURA 3I6PA 5H9EJ 2CRLA 5DZ7A 4PRFA 2AJ4A 3GR1A 2O66A 1OS5A 1VRUB 1HQUA 2EFOA 5I4MA 1A7GE 4TYBA 4YN3B 1EKRA 4NLDA 1K44A 3BREA 3PJ9A 1IBKJ 1ICEB 3VCDA 1YJTA 4I64A 4QW8A 3V6DB 2F63A 3L7PA 1YBUA 2HBQB 4FF2A 1KC8T 2ZNZA 3DLKA 4IG0B 1X4EA 2DHAA 4DPTA 4OV1A 3U7JA 4P2XA 4DQPA 2VH7A 3K89A 3H2LA 5AXLA 5KFPA 1U6FA 3AT1B 5DG8A 2ABYA 4R5PA 2V2KA 1SBRA 1OSCA 3KLHA 1E6VB 3BGRA 1ZZNA 2H5JB 3B4MA 2QG9B 1N0UA 5B7WA 2BQUA 4TYAA 2N3OA 4LSNA 3X1LB 1BLUA 1DURA 2V50A 1TL7B 2B8QA 1GX5A 1TAUA 2QLFB 2B9EA 4YB5A 5CYMB 5L39A 2E29A 1RP5A 3LF0A 4A47A 1HKAA 2LP4A 2HBRB 4CLKA 3ITHB 4X65F 1N5VA 4QWAA 3TUPA 2E1PA 1HNWJ 2VODA 3MAQA 4JI0F 2JJ4D 4KV8A 1NPKA 4M94A 4DOZA 3JB9k 1HBNB 4U7CA 3Q86A 4EBEA 4NEZA 4ZVHA 2EWHA 3NWRA 1SIZA 4YB1P 3I9ZA 1WF0A 4I6AA 1QAXA 4TQSA 1TL1A 1YVFA 4RU2A 3ZO7A 1FXDA 2BE9B 1XMOF 1MU2B 4CLWA 2ZVIA 4UQGA 3IGNA 1RAFB 1RLCL 3CSKA 4K7QA 1VJQA 3OQ2A 3TANA 3AFGA 1K0TA 4UTGA 3SXLA 2AYGA 1SJ1A 2HQFA 3AB4B 3OVBA 3PRVA 4NYOA 2XNRA 3DDNA 4ZP6A 5HAOA 5HJYA 1JLGA 3IFEA 1X4BA 3VALA 3CCQS 4M95A 4KE5A 5E0OA 1Q16B 4J9VA 3PX0A 2RB7A 4KB7A 2EBGA 3DLHA 4OHVA 2KYZA 2FGOA 3HHEA 1H2TZ 4KHPJ 4DS5A 4A8XA 3D0IE 3RBDA 4ECWA 2BQ3A 3QAUA 3PEHA 3Q8SB 4YHHJ 1X31C 4OI4A 4B9UA 3SIPB 2Y1RI 3DGPB 2YTCA 3KHLA 5KG1A 1VC6A 1HLWA 1YK9A 1RBOB 1S4EA 5DG9A 3TO8A 5KT2A 1PCAA 2J6SA 1UWBA 4CI0B 5C42A 4MYUA 3DLKB 1YKWA 3AQPA 4L76A 4NZ0A 3MEEA 2X3DA 4JI1F 1HR0J 2UVRA 1R0BG 2CQGA 4B3TJ 2MGZA 2P9GA 5LMUF 4ZVRB 3BGRB 1U25A 4RBVA 4PWDA 2UU9J 1T02A 2B43A 3AJ2A 4L74A 4LSNB 4QR2A 3CCJS 4C8MA 2ZJQQ 2B6AA 4DUYJ 1KVKA 4RLEA 2JVRA 4WBFA 4KHRA 1JKHA 3D68A 4CH1A 1RAIB 1U6ZA 1TK5A 2HG4A 2X7IA 3KTQA 3RTVA 3GFZA 4H4OB 1WI8A 3JSYA 1U8SA 2XCAA 4A48A 4ZVPB 2RS2A 3HHLC 1RTIA 1KVJA 1B0TA 1AXQA 4KV8B 1IBLJ 3M8QB 2DXEA 1WTBA 2QGFB 3X3UA 4UOFA 3R2CJ 2HZAA 3CDWA 1EQ0A 2AJFE 1EX8A 1NHKL 1TL1B 3T5KA 4LBPA 2FHOB 2F1FA 2XHCA 4LMZA 4K59A 4OI3A 3TJAA 3HT3A 4AYBD 3NGTA 3HD2A 3UR3C 1R31A 1T9UA 2DXFA 3NNCA 1S59A 3I82A 4IQMA 4TKTA 3P3DA 1L3SA 3FCVA 1T9WA 3G8SA 2BJDA 2ZH7A 4BWMA 1NCLA 4EO6A 4ZK7M 3C15B 1S77D 1RKIA 2N3LA 2RNEA 4HH0A 1UW4A 4DR1J 2XMMA 2ZNYA 1BC6A 4QIFA 1WWHA 3A3NB 1N33F 3VWSA 3ENVA 5E41A 4K4WA 1Y5IB 3SQOP 4F4XA 1HL6A 3HCXA 4LSZB 4RUHA 3QO9A 2G4BA 2MXYA 2XEXA 4KBIA 3GONA 1NRKA 1UWBB 5C42B 2NXCA 2E9RX 1FRHA 4KY3A 3AD9C 3BB5A 4F3OA 5F3TA 2B9WA 5HMZA 2OTLS 3D66A 3F41A 2R8HA 1JWWA 3RU0A 4PWDB 3H2UB 2OFHX 1NNDA 3T3FA 3VV2B 1TK0A 1HBOB 2VUGA 2F7VA 4NRUA 1DRZA 5CZVA 2NUHA 1QSLA 2ZJRQ 3AJDA 5KFVA 3ZZOA 4IFYB 2NR0A 5CQGA 4IH7A 3ENAA 2RU3A 3AOCA 2IHR1 3VGUA 2DNOA 4KRWA 2Z8QA 2G1HA 3CJTA 3K57A 4LBHA 3IN5A 2FLPA 1UFKA 3T1HF 1XR6A 1YJVA 1FRKA 1WD6A 1B4SA 4RU9A 2HQ3A 4YY3J 1P1LA 5F8LA 3CCRS 4C9DA 3AY0A 1ZH5A 1S5ZA 4OZ3A 2GS8A 2AU0A 4USJC 2K8GA 4BC9A 4LQ9A 5E3PA 4WFNQ 4GC7A 2N7CA 2UV8G 4KFBA 1I1GA 1N5QA 3TYTA 1X4DA 1L5UA 3MDFA 4K8RA 1H74A 2F65A 1RQ0A 2H1YA 2OPSA 2ZOFA 4IRCA 3NKYA 4NLOA 3BR8A 4OMFG 5L1JA 3K0JA 4FF1A 3TR5A 2DEJA 4O44A 4YUDA 2AD9A 3CO0P 1WOPA 1C4CA 1WG4A 3KJNB 4A8QA 1R89A 3IM8A 1TL3A 2FZKB 1VOMA 2VV5A 4JI8J 1FD8A 3BO2A 3H5YA 1KVIA 2BBEA 2CQ2A 3E2EA 4Y2AA 4GMKA 2DR7A 3HULA 3H98A 2ILZA 2MQPA 2E7WA 4RUAA 4OLPA 1RWXB 1FTCA 2K3IA 4FNHA 1U09A 1N0VC 1Q8LA 4NYZA 4KGVB 4Q8EA 3MUTP 4ECXA 4RJVA 1BD6A 2OP5A 3SBMA 1WHYA 2XI2A 2MKHA 1G4CA 4UQTA 1AFJA 1TUVA 2L41A 3PX4A 4NE9C 3CCTA 3CDUA 3TA1A 3RYLA 3WIVA 4F3QA 2KRBA 3SV4A 4JI6J 2DNZA 2B9XA 3LP1A 2R7RA 5C2CA 2OI2A 1DQ8A 4R0EA 5GMDA 4LF6F 5B0EA 1KFSA 2GW8A 1JQGA 2B4UA 3MTJA 3V6JA 3DOLB 4V19X 1KWMA 1J2VA 2BRLA 3ILLA 5J1EA 1K47A 3QAEA 3CCES 3MMCB 2I1RA 4WJBA 2WBRA 3UDCA 3UI3A 3BBCA 4XPEA 4PUOA 4K4VA 2XB2D 5J2PA 4DCPB 3BDEA 1P8GA 2QX0A 3KUHA 3FBBA 2AZ1A 1T05A 3J7A1 4M5HA 2A1BA 5EX3A 1HHQA 4LFCF 1OSDA 5KG0A 4F4ZA 4G1IA 4AL7A 1NK9A 2CQ1A 4DUZJ 3Q8PB 2ALZA 4ZHRA 3HHKA 1ACMB 3MR5A 2QEXS 3OLBA 4M5NA 3JAMU 4KFBB 3CJSA 1EHWA 3OL6A 3EDRB 1IR1A 4WIQA 3KHGA 2EK1A 2OPSB 3HK2A 2PD1A 1G1XA 2HK2A 5KFIA 1HW9A 2VQFF 3NNAA 5K14B 4F3MA 1X5TA 4NCGA 2FVRA 1TU0B 4IRKA 4CT8A 5KFLA 2V8PA 5HJXA 3LAMA 2IDEA 1RLDA 2VOPA 1IWAA 3POTA 2HQDA 2CXEA 3UW1A 5HANA 1YIJS 4G6VB 6FD1A 5A8RB 1CJTA 4OX6A 1FERA 3GSDA 1FK9A 3MCOA 4AXJA 3MMBA 3QPIA 3TJ8A 2C2ZB 2ZUAA 2ILYA 2XMJA 2V67A 2ZC3A 3GJRB 4FF3A 1EETA 2MKCA 4ZCKA 5KT6A 2ZH5A 4B3SF 3CD6S 4B3RF 1RT5A 5JMNA 2YY3A 2VJVA 1M5SA 1SB6A 1UJ4A 2VD3A 2CNLB 3MM7B 1RAGB 3M1VB 5KG3A 2UUBF 1MW7A 2I6WA 1UJ6A 4UF4A 2VFSA 4NLRA 3KFWX 4ZDNA 1Q7LB 2P5VA 3DLJA 3M4XA 3IC1A 3BPSP 3OUYA 3OFFA 3CMQA 3KLFB 3CB4A 3OR1A 2XCPA 4UOGA 4TQRA 4RPFA 3D54A 5J1EB 3THVA 2LKZA 1FKPB 3DM2A 5CHCB 4U6PA 3KUGA 1FFWB 2VDHA 4EUVA 2CPJA 1SC6A 4EGLA 3C6TB 1G7CB 2DNKA 4X65J 4PUOB 5HLFB 4KAIA 4JI0J 3OXFA 3R9LA 1WHVA 3OL9A 2HGNA 5SUHA 3HVRA 2C2MB 4XDCA 2LQ5A 3M2RA 2DGOA 1T05B 2C3UA 1CJKB 1AZSB 1TKZB 5AE1A 3RRKA 4CT9A 2CWKA 4O0NA 1KD1T 4XIUA 5CYQA 2R8KA 4DU8A 5GAEU 1GT8A 2M3DA 4ECVA 5D0HA 3KK2B 2BM0A 4EEYA 1XMOJ 4ZHRB 1EAYC 1N5YA 2WZ1A 3VHQA 2QLJB 1AA1B 3R7BB 3PRBA 4IOAQ 2V4JA 3DHWC 4NI2A 1Q86T 1YBAA 1GEHA 2GVZA 5ETMA 1KS2A 1JLBA 5LJ5Y 1B7YB 1RTZA 2ZH3A 4BBYA 2RHQB 4FBUA 3IGVA 3QYYA 5C25B 5DO2A 1NK6A 4I2PA 4YB7A 4YP3A 4ZJOA 5E3QA 3W9IA 2H5IB 2Y0SD 4NCGB 3EPIA 1S7IA 5IM0B 2XMTA 2KXHA 1ZBTA 1GMWA 3MCMA 3RG6A 3TVZA 2WW4A 3POTB 2Y0BB 1RWWB 1CLFA 5B0AA 4FF4A 2QLBB 2LQBA 4J9QA 1R6YA 2QL5B 3GPAA 1FK9B 4WZQA 2O5DA 2HNDA 4AXIA 1K1QA 3RBEA 3MMBB 5C24A 3OTDA 1OIAA 3SEOA 2BE2A 3GG1A 4JI1J 1EETB 1FRIA 4HKQA 1NK7A 1RT5B 2HQIA 1UKUA 5LMUJ 2W2NP 1H2VZ 3BN7A 4NEYA 4W4MA 2C3MA 3TWZA 5HL7Q 1JLFA 4A8MP 2MKSA 1IXKA 1P6TA 2QC3A 3JS9A 1LQ9A 2O3DA 4CP5A 2DPJA 2GV1A 3OUYB 4QIGA 3OR1B 4PAAA 2HFUA 1FDAA 5B0DA 2Q6BA 4MIBA 4K4UA 2D3O1 4H4KA 3I5BA 3DM2B 2D3UA 1X8DA 4PZVA 2DR9A 3ETMA 3UN2A 3GU0A 1TAQA 3IBFB 2FVCA 1VQKS 3QZ7A 1C0TA 1WG1A 2A0FB 3TA2A 3H5XA 2KM8B 3M2RB 2KG0A 1NSKL 3Q8YA 4BS2A 5EWEA 5JVGQ 1X4GA 3MR2A 2OGUA 3JSRA 2IRUA 4O3PA 4OZ5A 4PWUA 1CQNA 4X2BA 5LXYA 3GCWP 4PG7A 1N5YB 4OX9F 2RVJA 4ZCIA 4CWBA 3TP2A 2V4JB 1JJHA 1KFDA 2BJ9A 1LK5A 5J2QA 3R5CA 4P7TA 4HTJA 4G1PA 1JLBB 4AD6A 2YNGA 4TU8A 2A18A 4OHXA 2YNFB 3AOBA 3MMJA 5SZTA 3O5TB 4USUA 2XY6A 3HVTA 2F3JA 4P10A 5KFOA 2Q79A 3HFKA 4MT1A 4F36A 1VR6A 3D2WA 4P52A 1VS3A 2PC6A 1N33J 4JI7F 3J7YU 2HNZA 3I5AA 2K06A 2BANA 1QM9A 4M5DA 1DARA 3RB6A 2J6TA 4ZVQB 2IIHA 1H7WA 4KYZA 2DNMA 3B54A 1KBRA 2X1BA 3PYFA 2HNDB 1WC0A 3TA0A 1DTTA 2I8EA 2J8AA 2XSFA 5K8OA 2BE2B 4G1QB 3JSMA 1SCJB 4ZLLA 2ADCA 1IN0A 2VDIA 1UZHA 2WONA 1DQAA 2ZUGA 1ZM2A 3D0GE 1RE1B 8ATCB 2PE8A 3U02A 2BA9A 4TU7A 4FVMA 1JLFB 2ZZNA 2CQCA 4OQJA 1WEZA 3MM8A 4PXCA 2AYBA 3FZ2A 2W7AA 3O8WA 2AHOB 2IJRA 2GJIA 2ZC4A 2W25A 1HW8A 4RO0A 4A8FA 3ISND 2ZBPA 4UW2A 4U96A 3VVUA 3LA0A 3EGVA 3N9UC 3H5UA 4WE1A 4E8UA 5D78A 3G82A 3GWCA 1G3OA 1H73A 2K2PA 3DLGB 3T1HJ 2H51B 4ILLA 2YKNB 3ZNJ1 1S0NA 3AA9A 3SCKE 2M52A 2R7UA 1HNIA 3W2WA 3JQMA 1GMUA 4JBCA 1FWKA 2XGPA 2Y9HA 3EM1A 3MEKA 4EFAC 1S9GA 3BKTA 4DZ6A 2JDJA 3Q8UA 1S1XA 1K0VA 1PAEX 4KPCA 1X4HA 2ZZMA 5B09A 1B7FA 3PACA 3NP5A 5J2QB 3HMJG 5EDWA 2EKYA 4XAKA 2QJ3A 2W1BA 2CNKB 2YWHA 2KT5A 4MIAA 4WP3A 4WWSA 3NAIA 3HVTB 4ZN3A 1FRLA 3W5YA 1Q7YT 3MGJA 1JNRB 3KK3A 3CCMS 4FNIA 1VQ6S 2HNZB 3LW5C 4YFUA 2BANB 3N01A 2MZJA 2K1RA 4ZVTB 2BKPA 5GAGU 3WC0A 5B0FA 1UVLA 1KKHA 2EC0A 1UFWA 2DY9A 3LWMA 4TY8A 1FF2A 5KOXA 1L3UA 4PG4A 4PWWA 1DTTB 2FJEB 3IO1A 4IQXA 2Y8YA 1SKWA 4NASA 2YXLA 2NS1B 2CFXA 1YI2S 4I6WA 1J5OA 2WONB 1IQTA 4RNMA 4LF6J 2IBOA 4IH6A 3N0VA 3IR6B 2DIUA 1FDDA 2QSWA 3I96A 4K4TA 3P96A 3OTEA 2M7SA 2XHWA 3MM8B 2FPHX 4CH7A 4HDHA 2W2QP 2QO3A 2E5IA 2GZOA 2OELA 1S1TB 4J9RA 2FLLA 3QRRA 1VQSA 2W4CA 3GYXB 2BW2A 1NDPA 4OI2A 3ZC4A 4HVZA 2D9PA 1Q8IA 5KOWA 1KNZA 2RILA 2AJQA 3GIJA 3H7HB 4N8NA 4LFCJ 1MMDA 1H0HB 3PKMA 2EFQA 1YRUA 4LT6A 2PA3A 2H54B 2GCFA 2WAQD 1B70B 4JV5F 3BBBA 1HNIB 1U2RA 2CQDA 3MUMP 3W2WB 3DRSA 2QTWA 1OWXA 3GFXA 1S9GB 4ZPDA 2CJXB 1S1XB 3HJFA 1NK8A 1IBMF 1M1KT 2DO4A 3CC7S 4URGA 2VQFJ 4IR1A 2HPUA 1RA6A 2LFVA 3I4PA 3F44A 5J2MA 3GJQB 2I0XA 2XS5A 4DL0C 2J5AA 3NGUA 2VBYA 1HI0P 1CC8A 2Z57B 2UXCF 1JLAA 2IYIA 2AW0A 1QLNA 3KK3B 3DI6A 4M5IA 4DPXA 3GFHA 4MAKA 2YWWA 2HRYA 3C14A 2K1RB 3ZZRA 2SXLA 1VJWA 2R7SA 3M6XA 3QT5A 1I5OB 1O5JA 5HBMA 2BV3A 2OJ3A 3M2VA 2R7WA 2YX1A 5E33A 4B3SJ 1EARA 4B3RJ 2HHQA 3R6LB 4KTQA 4DEZA 2DGUA 1JLCA 1T9XA 2UUBJ 3QWPA 2QA2A 1J5OB 2DRBA 2NXUA 4OYIA 3DMJA 3PX6A 1KN6A 2ZITA 5KG5A 2R3VA 1QVGR 4FYXB 4X4TA 1SC3B 3QBCA 2P6SA 2MTLA 2ZFHA 2ATCB 4X4RA 3GE9A 4UZBA 1KOOA 4BLGA 1LW2A 3U27A 4DU7A 3UD3P 3WHIA 3ZXWA 1RUSA 1W2BR 4NXMF 4HHJA 1CULA 3AJ1A 1TMMA 2F5GA 2QRRA 3A3OB 5KFNA 2DRAA 5IWAF 1GMWD 3NCRA 4DV4F 3TVYA 1HHTP 4ZCLA 4IR9A 1WACA 4ZVFA 5RUBA 2ZH4A 3E51A 4FYDA 1Q0NA 1G6BA 4N41A 4YDXA 3DRSB 3LUYA 3A13A 4J37A 3R5DA 2ATLA 1TL4A 2VIHA 2R7TA 1LK7A 2EC2A 4Z2XA 2QL9B 4ZS6A 1IVZA 1U8WA 2CNNB 3U1LA 1SH2A 5AXNA 3BF4A 2L9NA 3P45B 3VAGA 1WC5A 4OZ1A 2QMXA 5FDLA 2AT1B 3SDEA 5IT9Y 3H20A 5GAHI 2C3OA 5A6PA 1F9HA 1U49A 5EX0A 5F9NA 4DXLA 4QR0A 4Q5VA 4A8SA 4QWBA 3DI6B 1RT4A 3HLUA 4WFYA 3LALA 1QAYA 4N8OA 3PEJA 4CLZA 4J9OA 1TELA 1OY9A 2XC9A 3GMGA 3UCGA 4QOTA 3M6VA 3A1YG 4C0OC 3CD7A 5HBMB 5KFXA 3A8JA 2HWIA 3M2VB 1F5AA 5IC6B 1FWPA 3T41A 3HX9A 5LL6d 1LXJA 3FEYB 4KSEB 2R2TA 3VGSA 1JLCB 2IFXA 3QSIA 2GMLA 1HBUA 1FKAF 4LRBA 4FYYB 3N6MA 2R2UA 3DMJB 3FQLA 2F4VF 1UP1A 4AFFA 4RBTA 5I42B 3QIPA 4Z7YA 1M0SA 2UUAF 2V8VA 2FJAB 4WYWA 3W65A 2Z2MA 3HSGA 1VQMS 2NCKL 5CA5A 2W9AA 2I9SA 1LW2B 1XMBA 4OYOA 2FJDB 1FX2A 2WVDA 5FIIA 3PV8A 2JLEA 4RUCA 1HWIA 1RHKB 2N7YA 2PN6A 4ED0A 3Q22A 1CULB 3E01B 2X1GA 4IRDA 3L7UA 1K1SA 2FJBB 2JH3A 3UNGC 2PMWA 4DV0F 2CDQA 1FXRA 3NG8A 3IA0A 2HVZA 1RABB 1UVJA 2E44A 1L3VA 5A2QU 4ID5A 4IKAA 4OX9J 3KG0A 3M8SA 1XTZA 5KFSA 3O44A 2H4WB 4X4NA 2F8MA 2HK3A 4ECZA 1RHJB 2QA4S 4MK8A 1UPMB 4Z37A 5BJRA 3G6YA 3NY0A 3ENWA 4OYMA 3F56A 4MKBA 3SDEB 3CDBA 2HGLA 1MG7A 2W4PA 5KFBA 4JI7J 1RHQB 2WSEC 1R43A 3CJ2A 2JWNA 3QRQA 2B3TB 1HPZA 2W7PA 3NOGA 3I31A 3OFHA 2MQQA 3DC2A 2KDOA 2M5YA 4O4RA 2X1AA 4JUZA 2FY8A 4KH1B 4J9KA 2DGSA 4PG6A 4KHMA 4LRFA 4GO5X 3D3BJ 3M30A 3G6XA 4K0KF 3ENQA 4I2QA 3IXQA 3GIRA 3EPGA 4RR5A 2W2MP 1MNEA 2MSTA 4BC7A 5HVFA 1HBUB 2L9DA 2ERRA 4JI5F 4B9NA 1FVSA 3MI7X 2V5HG 1N32F 2V2ZA 4DLEA 5KFFA 1U1RA 3QIPB 4NLYA 1RU2A 2DNYA 4F4KA 4DQRA 5LM7E 2XWXA 2FJXA 2VF3A 4CRJA 3QJJA 3O1LA 2B8PA 4IDKA 4DPYA 1ZPVA 1HNVB 2C42A 2WSFC 4GC6A 1Z2ZA 2RUGA 3C19A 2ROGA 4XK8C 1WOOA 4FKYA 2GNKA 2H48B 4QYZK 4XO0A 1IM6A 1IWGA 2P9CA 3OJUA 2QA4G 1QSSA 2ZDOA 4DFJA 4KO0A 2XGQA 3C66A 1KR4A 3JQJA 4ID5B 3L9ZA 1HQEA 2CAJA 1RACB 3GJTB 1IUJA 1OYDA 4MJKA 4MH8A 2V8GA 3HHLA 2G2YA 2OD4A 2MQ8A 2P8IA 1LXNA 5CH7B 5GADU 4WIIA 3KHHA 4DL6A 1N88A 3EYZA 2J0XA 2VICA 2RDJA 3M8RA 3CCUS 2NXNA 2CWXA 2MKYA 3T5HA 1WSRA 3KLIB 4KPYA 3M6WA 4NLSA 2MY7A 1S10A 1A0OB 1F5CA 3NOCA 4EBCA 3CIZA 1FT8A 3CVKA 1YJ9S 5T7LA 5M2RA 3GYNA 3TQEA 4BCAA 2KB2A 3PR5B 1RDRA 4YS2A 2W9CA 2G0JA 1XJWB 2UXBF 4AQYF 3BH6B 2ASDA 3M30B 4I2QB 1XC9A 2RJZA 5J1PA 1O6XA 3MURP 3W5XA 5K5MA 4CM0A 1XEZA 3J81Y 2DB1A 4OYBA 1LW0A 1BQMB 3CMES 2E7XA 4WYLA 3SFUA 2GC8A 2FGCA 3NAHA 1NU4A 4OHWA 3HVWA 3R5JB 4IDKB 3L4BC 3KKFA 4DV2F 2BJ8A 3CCVS 3B6BA 4OJ1A 2OAUA 2EEYA 4JV5J 1URNA 3PW7A 1TV6A 3Q0AA 4QYZJ 2KT3A 4DHVA 5JUMA 1T94A 3IAM9 1WI6A 3EVMA 4DDFA 1VBZA 3SCIE 2K7KA 3H59A 2ZH2A 4USKA 3UD5A 1TKTA 1QAIA 2V9KA 4KO0B 3EWGA 4RWWA 2UVUA 1YJNS 4PQUA 1HQEB 3LQVA 1X9MA 4MYTA 2EFPA 1BHNA 4ZMMA 5L1IA 4WF9Q 1IBMJ 3ZZ0A 5A6WA 3JYTA 3HHLB 2HFZA 1PJ5A 1M90T 1GTEA 3IBCB 1U6BA 1YZ6A 2GHPA 3KLEA 4ED7A 1H38A 1FRJA 2FLNA 4B9LA 2HMIA 1S1VB 2HVIA 2LXUA 2B51A 3TOQA 1H6KX 3L7OA 3KJFB 2Z30B 2UXCJ 4M1KA 5JJBA 1YTYA 4JI4F 2XLJA 4X4SA 3R5AA 1VLYA 4AL6A 5B0BA 3GLJA 4ZKAA 5K8MA 2NPFA 5ETOA 3W66A 1RWVB 1SH3A 8AT1B 2DIVA 2XYHB 3AB2B 2HFNA 4O3SA 3A8IA 5HMXA 5T7LB 2KHCA 4RKUC 1JXLA 5LJ3Y 3BV8A 4J7CA 2YNHA 4E2FB 4HR2A 2W9CB 4DWIA 2LXFA 3OW2R 2E1RA 4C3LA 1IM4A 3ZTQA 1OQ6A 1JNZB 3UQSA 3BS9A 2JEIA 2JEGA 1GXTA 1SL2A 1QE1A 4I1TA 2VZ9A 1PKUA 3RB3A 2VA2A 1VIOA 3CJQA 1VIXA 4DQSA 2KFYA 1MN9A 2RRAA 5D4NA 4ZOSA 3H42A 1F5BA 3GIKA 3G9CA 4NLPA 2O01C 4URSA 4NXMJ 1TL5A 3EGNA 4ZVGA 2ZOGA 1OY8A 2XMVA 2JEFA 4PYAA 5IC4B 5IWAJ 1FX4A 1YJ7A 3AODA 1LKZA 2RDDA 2YQ3A 4DV4J 2IMOA 2HNYA 4DCJB 3K5PA 2MQOA 1TV6B 1W26A 1UWAA 2OKQA 4YQWA 4UY85 4GO7X 2QLWA 1RT6A 4ZP9A 3TNVA 3T1AA 3QQCD 3PYGA 1TKTB 3GB0A 1GNKA 1Q82T 1FESA 4K5SA 3SZ2A 3N6LA 4PQUB 2N82B 1BWEA 3ZZYA 4BDPA 1S0OA 3T6BA 2LQJA 4V19J 3EZUA 3JYTB 1NSPA 2H65B 3CD5A 3KLEB 1PO6A 3FCWA 3HHNB 2PMZD 2LVWA 2F9JA 2HMIB 1MROA 1FNOA 4CQ1A 3TJ9A 5JXSA 3M7VA 4LF4F 1F1BB 2B4PA 4JV0A 1LWFA 3IS9A 2FHJA 1B99A 3M32A 3E3XA 7AT1B 2XLIA 2A3JA 1HA1A 2FDNA 1JXVA 1Z2LA 1KQKA 3BGUA 3O2IA 1BE4A 1L3KA 1HD0A 5KFAA 2CPFA 2HS3A 3CW2C 5L9XA 1T9VA 2XY7A 2YQ1A 1MN7A 2DR6A 2YNHB 2DNPA 3LP0A 1SKSA 3PFEA 2X51A 2EG2A 4TU9A 1IKXA 3WZ0A 4TXSA 3CJ8A 1T3NA 5D77A 2BUNA 1S12A 2QV6A 2OH2A 3QGPA 1JLEA 1UJ5A 3LPYA 1RWUA 2OUGA 4JV2A 2DRDA 5LOQA 2F4VJ 2C2EA 1QE1B 4F4AA 2AX1A 2UUAJ 3WC2A 2L48A 2D69A 5T14A 1Y4ZB 1H3DA 1RA7A 1IKWA 2FQQB 4JV1A 1HHSA 3P49B 4J9UE 2LDYA 4MTPA 1YLXA 5HMYA 4DV5F 3N28A 2UZAA 3G4SS 3DXSX 5CCMA 2MB0B 1PYOB 2VG6A 2MZSA 5IXUA 2GO8A 4DR2F 4A8WA 4DV0J 3PO4A 2YH1A 3LAKA 2DHGA 3QGHA 3TAQA 2J7WA 1QUVA 2LYVA 1EKSA 5KFRA 2MLXA 5DQHA 4P7VA 2DKOB 1EJ7L 4FXVA 1R8PA 2VPZB 2YPZA 3VZHA 2QZ8A 5GMKa 1N48A 4ZP7A 2ZE2A 1RBAA 2CIMA 1Y9OA 3CJ3A 3KNAA 2D7SA 2VG7A 2J6UA 1CSJA 1PYSB 2PI4A 2UUCJ 3TW0A 4H4MA 1X4AA 2WB4A 2FC9A 1Y5NB 3K58A 2F40A 3PW5A 5ETNA 4ED8A 4DI6A 3K5OA 2AF6A 5KT4A 3BZQA 1MROB 3T5LA 2R7XA 3DXBA 5HP1A 4P6QA 2CNOB 4QU6A 3HFZB 2LQ8A 1SPBP 3TZWA 2QIFA 4C48A 1V5IB 2AGOA 1Q79A 3EXYA 2DPIA 3DOKA 2W8KA 3EZ5A 2ZHOA 5ETQA 1FRXA 2F8HA 3BGLA 2DGQA 2J76E 4Y28C 4JYAF 2XYGB 4K0KJ 2QLXA 3EJMA 1NAQA 2CYYA 1S7HA 1IKXB 4WPAA 1CPZA 4KIAA 5CABA 4USIA 3SCJE 1JLEB 4HACB 4JI5J 1I3OB 2JSXA 4N47A 1V9OA 3CO9A 4YB6A 1N32J 2CA9A 2BXJA 1MWZA 2RSQA 1FXLA 3UVJB 3HHLD 3W61A 1RYRA 2RF2A 4DX7A 1NM2A 2OIHA 4B17A 4DFKA 3D6HB 2XZDB 1YZ7A 2XMWA 1F2HA 2A6OA 1IKWB 4B02A 3IM9A 4LVNP 1GX6A 3NMAA 1P9YA 2DNGA 4DSJA 4YDDB 2MSSA 2VG6B 1RXOB 4IO1A 3TAPA 1PAUB 4ECUA 5L46A 4OYWA 4ED2A 2ZBRA 5GVQA 4UUWA 1RGVA 3U1NA 3DU5A 4WK3A 2V68A 2E9ZA 3NGDA 2ZE2B 2OPPA 2CJBA 3DLBA 2ASJA 7FD1A 3MEGA 3VAJA 1FCAA 2KM8C 1IJFB 2OPQA 3PIPQ 2K7JA 4OZ2A 3K59A 5AT1B 3MEDA 2FC8A 3R97A 2WK4A 4P2MA 2R2RA 1NHVA 3PDNA 1M1HA 4H4MB 2MQLA 2C3PA 1HQUB 3QZ8A 3EXCX 4K50A 4TNOA 1ZM3A 5THWA 2R7VA 4G65A 3ET6A 2ZH9A 5HP1B 2LA4A 2APOA 2VPXB 1T3OA 3Q8RB 2AEFA 1R3NA 4D3GA 4F2RA 2W24A 4Q0BA 3VVTA 2W2PP 1PG5B 5D8HB 4N5SA 3K7RA 2QFIA 1NB2A 4G3IA 2KRRA 3TQ1A 1HWLA 1YWXA 1NUEA 2QMUB 2W8LA 4L6V3 3DOKB 1R8HA 3GIMA 3NGSA 2UXBJ 3MOJB 1VC5A 4AQYJ 1FFGB 3RRHA 2ASYA 1Y00A 4R5PB 1LWXA 2R8JA 3KLHB 4QZVB 1RT2A 1UW9A 2KT2A 2VKZG 4NLUA 3MM6A 3IWNC 2WSCC 5JVHQ 2KYXA 4JI2F 4L3KA 4LFBF 1VFJA 4ZPWR 3MPVA 3Q24A 1RWMB 4A8OA 2Z2ZA 1VRTA 1LWEA 2VBXA 1RTHA 2RF2B 2QYCA 2IVMA 3D3CJ 1SL0A 2JL9A 3OL8A 3S1TA 1DTQA 4DR3F 2HHUA 1WF1A 4FYWB 3VAIA 2DCUB 2RE1A 4DV2J 4OV6A 2IC3A 4ZLNA 2GIFA 3C2PA 5EHHA 2YNIA 3O6QA 4JP8A 3NMRA 1Q1KA 2R4FA 4ES2A 5ETVA 4Y0FA 2Z2LA 5B0CA 5DDRC 1S76D 5AE2A 4I67A 2J7KA 3OV7A 1M5PC 3ELHA 2PO4A 2F4FA 4ZVEA 4O3OA 4U95A 2PI5A 1T7PA 4J91A 3FSXA 2H5EA 2AP6A 1VQLS 2OPPB 1S6UA 3HPOA 3ZTRA 3MEGB 2OPQB 4TY9A 1J27A 2VFVA 3R7NB 1AW0A 1JLGB 5DG7A 3MEDB 2VHGA 2X3GA 3TEGA 4RW6A
chains in the Genus database with same CATH topology
2BW2A 2MZ1A 4O4GA 4OI2A 2EI5A 4HVZA 3ZC4A 2D9PA 1Q8IA 5KOWA 4C3KA 1XNQF 1KNZA 1K8AT 5L1KA 2RILA 1N36F 2AJQA 3GIJA 4A46A 4N8NA 1E6VA 3N79A 3KYLA 1MMDA 1PGZA 1YITS 2YWFA 2YNFA 1H0HB 2EFQA 2D74B 1YRUA 3PKMA 4JI6F 3HO1A 4LT6A 2PA3A 1BGXT 2KZMA 2WAQD 2GCFA 4JV5F 4MFBA 2XS2A 3BO3A 4DMZA 4DS4A 3GV5B 1S0MA 1HNIB 1U2RA 2CQDA 3MUMP 3G71S 1NB7A 1VQ9S 3OSNA 3K8VA 3M9NB 2MKIA 4OZNA 4U7UK 3W2WB 2WOMA 3V4IA 1SJRA 2B7CB 2WCXA 4X66F 3LGMA 4X4VA 4K2XA 2GGPB 3DRSA 2CPDA 1X0FA 4ETXA 4W92B 1OWXA 3HZGA 1KLMA 3TUJC 5KFWA 3GFXA 5CYMA 3JSBA 4Q0BB 1JK9B 3MM5B 4FS2A 3QGGA 2RQKA 1S9GB 1HWUA 1V3SA 4OZ0A 4ZPDA 5D6GA 1VQ8S 1S1XB 3P6YC 1HWJA 1W2IA 2XLKA 1S4FA 3HJFA 1NK8A 2P9EA 3ZZZA 1VBYA 3ISZA 5KFCA 4L72B 4OHZA 1YQHA 3MEEB 1IBMF 1M1KT 2DO4A 3TI0A 3CC7S 3CCWA 2G9OA 3L3CA 2J9DA 1UVKA 4URGA 1FE0A 1REVA 3ITHA 2M70A 3CTRA 3L09A 1S9FA 3IRWP 4QIWD 3OLAA 4IR1A 2HPUA 1RA6A 4ZPBA 4ZPVR 2AQ4A 3I4PA 1NKBA 2V94A 2MGZB 3F44A 5J2MA 1BQXA 1U24A 2U2FA 2ZOMA 4F67A 2I0XA 3UPFA 2R7OA 1RT2B 2NPIA 2XS5A 5F8IA 2M2BA 4DL0C 4Y2IA 4NYPA 2J5AA 4G1QA 1HBNA 2VBYA 2GMHA 5CCLA 5HN0A 5IFMA 3VAKA 1U45A 4PXEA 1HI0P 4KKOA 4ICLA 4ECRA 1CG2A 1CC8A 4ED3A 2B6AB 2UXCF 5E3CA 1JLAA 1S99A 1YG0A 1K73T 2IYIA 2AW0A 5LSOA 1QLNA 2V8DA 3EUNA 1JKHB 3UD4P 4LF7F 3KK3B 3V6HA 3DI6A 3KG4A 1SXLA 2UVVA 3D28A 2LDIA 5D4PA 2LEAA 4DUZF 2DH7A 1MU2A 3GFHA 2NZ4A 2VG5A 4DQQA 4MAKA 1LWEB 5DGBA 2KXNB 2HRYA 4YOEA 2EFVA 2DGWA 1RTHB 2JVOA 5FLXY 2K1RB 1D8ZA 1LFPA 2GJ2A 3ZZRA 5KFHA 3KHRA 2SXLA 4DR6F 1QTMA 4J9LA 2VBWA 1VJWA 2R7SA 2RH3A 3M6XA 4DV1F 3GFYA 5F8JA 3W7BA 2IA0A 5T41A 2GA7A 4N56A 1LFWA 3RAQA 1DTQB 4WU2A 4CO0A 4EWTA 5L9NA 1O5JA 3LWLA 5HBMA 1CVJA 3GV8B 2BV3A 1X5PA 4LSLA 5D4OA 1VHFA 2XMKA 2OJ3A 1UFLA 2J0SD 3PW0A 3M2VA 1A9NB 2WB1D 2VPYB 2R7WA 2AV5A 1ZM9A 2BVZA 2YX1A 1RTIB 3IWLA 2IC3B 5E33A 1D9DA 1UA0A 3MECA 2HHQA 3S01A 3CIMA 2HRUA 3IR7B