1J5OB

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 99
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB03
1D0EA 4RNNA 3N6MA 4Y34A 2FLNA 1ZTWA 1KHWA 2W7OA 1SH0A 5D3GA 4IFVA 1N5YA 1HNIA 2GIQA 4J9OA 1IKYA 2XCPA 3IRXA 5KG1A 4R5PA 4KE5A 2ATLA 4NLXA 2I5JA 4ECSA 1JLAB 3HVTA 1S1UA 4RW6B 4O3NA 2FLPA 4O44B 2UUTA 4QWCA 3KK3A 2W8KA 2C28A 1HNVB 2WHOA 4ZHRA 1C1BA 4YR2A 4MFBA 2AX0A 2IAJA 4U7CA 3E01B 5EDWA 3IS9B 1TKXB 4DL6A 1QE1A 1TL1B 3C6UA 4MKBA 5J2QB 5KFGA 2IM3A 4KV8B 1Z4UA 4PQUA 2XCAA 4QPXA 4F4ZA 4ECZA 2VA2A 3KNAA 1WNEA 1LWFA 3KK2B 3PJXA 4KB7A 2R2RA 3KHRA 2R8HA 4DL2A 1FKPB 2HNZA 2QV6A 1TP7A 4ICLB 4NLQA 4RNHA 2R8IA 2V0NA 3CDWA 1IKVA 1ZTTA 3NL0A 2JEJA 5L1JA 3UDLA 4R8UB 4XPCA 3IGNA 2V4QA 5K14B 4IG3A 3RBDA 3BREA 5C25B 1RYRA 1K1SA 2B43A 5KFVA 1S9EB 2RDIA 3FSIA 3DMJA 5FDLA 2YKMB 3DLEB 1C0TB 3CO9A 5KT6A 3NGDA 3DYAA 3RAQA 4LSNA 3NAHA 5F9LA 5KFCA 3OL6A 4IR9A 3V81A 4WZMA 2WONB 5EWGA 5KFLA 5HLFB 4NCGA 3M9MB 3PHEA 3M9NB 4ZP6A 3ICLA 1T05B 3ITHB 1IM4A 3IG1B 4NLPA 3DOKA 1TKZA 4G1QB 3NMAA 3LP1A 1RT4A 3Q8SB 4LSLB 1MMLA 4O4GA 1T94A 3PVXA 4Q8EA 5F9NA 3CJ0A 3G6YA 4DL4A 4O3RA 4JV2A 2BE2B 5KG6A 1RT6A 1TL3B 2V4RA 3PR5B 3OLAA 4TY8B 2ZE2A 2XC9A 1JXLA 4K4YA 3G86A 3BQ0A 2WB4A 4R0EA 5KT5A 1DLOA 3LP2B 1BQMA 2C2EA 5CYQB 3DLGA 1JLBA 4IH5A 4F4YA 1UWBA 2R2UA 4ECYA 1JLEB 2VG6B 4J9SA 1HPZA 1RT5B 1DTQB 5J2MB 4PUOA 4MKAA 1LW2A 2WOMB 3QLHA 1RAJA 5F8IA 3OSPA 5J1EB 1SH3A 1TQLA 1RA7A 5J2NB 3PW2A 1RTDA 1YVFA 3GV8B 1N6QA 2B6AB 4JV1A 4EBCA 5F8GA 3OL9A 3I0SA 2CKWA 3KLFB 5DQHA 2ZD1B 4DG1B 5HBMA 3V4IB 1N56A 4IFYA 2J6TA 3DRRB 3OLBA 2E9RX 2ILYA 4QW8A 3MECB 3E51A 1GX5A 1SV5B 3CDEA 3FQKA 3DLKA 2OPRA 3KLGA 5KT3A 1T03B 3I5BA 1VRTB 5DGAA 5KFAA 2VG5A 5KFWA 4F4XA 2VA3A 5T14A 4J9QA 1JLFA 1BQNB 2XWYA 4IH6A 4NLUA 4TYBA 4ZP9A 1K1QA 1TVRA 4QWDA 3MFHA 3GILA 4K4WA 4ECUA 5DG7A 3RB3A 2ALZA 2YNHA 3LALA 4KFBA 4YR0A 1S10A 2FLLA 3T5KA 1S1XB 4EBDA 1HQUA 2HNDA 5DGBA 4MK7A 3OHBA 1S9GA 4KO0B 3JSMA 4RNFA 2UVUA 3QGGA 1TKTA 4I2QA 2WRMA 4ZVFA 3MEEA 3MR2A 3UR0A 5HP1A 3LP0B 4IG0B 1S6PA 3JYTB 1S0OA 2UVVA 1S0NA 3DRPB 2W9CA 1TV6B 1MU2A 4QW9A 3CJ3A 1RTIB 2AGQA 1S6QB 4HKQA 4DL7A 3SI8A 4IRKA 2OPSB 4K4VA 2BANA 4ECVA 3I5CA 2VG7A 4ZP7A 5EWEA 4RW8B 5L1LA 1RTJA 4EBEA 4IDKA 1S1WB 1RYSA 2JC1A 2YNGB 3CDUA 1I6JA 3NBPB 4ID5B 4I7FA 4KBIA 5KT2A 1HMVB 2RF2A 2JLEA 3DOLB 3M8QB 4H4OB 4YR3A 2D3UA 4NYZA 2IM0A 3GV7B 4H4MA 4QWBA 5D3GB 2B5JA 4IFVB 1RA6A 4ED3A 1HNIB 1JKHB 3FDSA 1IKYB 3MEGB 3IRXB 4FBUA 1JLCA 1SUQA 4R5PB 2RDJA 4F4WA 2J6SA 2OPPA 2OPQB 2I5JB 3H59A 3HVTB 1C2PA 1S1UB 3KK3B 2DPJA 2YNFB 3T5JA 5DQIA 4NLOA 1C1BB 3HVAA 3KLIA 4MFBB 2IAJB 3MEDB 3KHGA 3PW4A 1EETB 1HNVA 4ZPBA 1QE1B 3C6UB 3PR4A 4ED1A 5C24A 2BR0A 2W9AA 3IS9A 1TKXA 4PWDB 2FVCA 4ED2A 2AU0A 4K4SA 4NLVA 3TAMA 4PQUB 3IGVA 4WYWA 2WTFA 1W25A 1LWFB 2JEFA 4MIAA 1LWCA 1RT1B 3Q8QB 3BSOA 4K4XA 2HNZB 5I42B 4Y2AA 3Q8PB 3OHAA 2XGPA 5KFSA 4Q0BB 4URSA 3MR6A 3DM2A 3DRSA 3QO9A 1QUVA 3QIDA 2R8JA 4URQU 5KFXA 2BQRA 2FVPA 4IH7A 4FBTA 4IG3B 4ECRA 2O5DA 2BRLA 3KLVA 3H4DA 1VRUB 3H4BA 2YKNA 3SFGA 4NRUA 5KFMA 4Q8FA 5C25A 2E9TA 4MH8A 3DDKA 2JC0A 4KKOB 5FDLB 4RW4A 4I2PB 3H5XA 4U6PA 3DYAB 1JX4A 3KK1B 4Y2CA 5KG0A 3V81B 4QWEA 1S1VA 4RW7B 2IM1A 4YMEA 4WZQA 1RT3A 5KG4A 3GIMA 4K4ZA 3UQSA 1T05A 1JIHA 3ITHA 3DOKB 4NLDA 1HYSB 1LWEB 2ZKUA 1TKZB 3GIKA 2C2RA 1JLGA 3LP1B 3I0RA 3IG1A 3ISND 3LAMA 4O4GB 3KMSA 2YNIA 2OH2A 1NNDA 3VQSA 5KT7A 4IRCA 5C42B 4IRDA 1RT6B 5KFZA 2BE2A 4XO0A 2BQ3A 1DLOB 5KFRA 4MK8A 1KLMA 3DLGB 1JLBB 3M8PA 3LAKA 4EO6A 4F50A 1OS5A 3V6JA 1HPZB 5CYQA 3C6TA 1LW2B 3QLHB 5HROA 1D1UA 3PZPA 2VG6A 4J9NA 2AQ4A 1RT5A 1DTQA 5J2MA 2FJWA 4NRTA 1LW0A 5I3UA 3FQLA 3SFUA 5J1EA 3NAIA 4WFYA 1HQEB 1EP4B 1N6QB 3KLEA 1FKOA 3V6DA 2IM2A 3I0SB 3V6HA 4TYAA 1R0AA 2B6AA 3T5HA 1RT2A 5HBMB 4DL5A 4IFYB 2BRKA 3N6NA 4B3OA 4Q44A 3OSNA 2HMIB 2UUWA 3V4IA 3GYNA 3I5AA 3UPFA 4ED7A 5F8JA 4EEYA 1J5OA 5KFHA 4ZVHA 4JV0A 2FVSA 2JEIA 1S1TA 5L9XA 3BQ1A 3KJVA 3BGRA 3DLKB 3RAXA 1IKXA 4K50A 2FVQA 5KFPA 5F8MA 5DLGA 2RKIB 3H5YA 4IQXA 2J6UA 3DI6A 2F8EX 3N6LA 4K4TA 2VG5B 1C1CA 3G6XA 1RTHA 3KLHA 1JLFB 1RT7A 3CJ4A 4ZPDA 2HWHA 1TVRB 4RW9B 2IA6A 4ZPAA 1BQNA 5J2PA 1DTTB 4KFBB 4ECTA 3BSAA 2E9ZA 3Q8RB 4WE1A 3H5UA 3QYYA 2EC0A 1HQUB 2HNDB 4J9MA 5CYMA 3JSMB 5DG9A 3IN5A 4ED8A 1S1XA 1JLQA 4IKAA 1IKWA 1C0UA 3FFIA 1TKTB 4I2QB 4ED6A 4K4UA 3MEEB 1FK9B 1REVA 4EO8A 2HNYA 4ECWA 1S6PB 4NLWA 5JUMA 3QZ7A 2W9CB 2XGQA 1MU2B 3LP0A 2IC3B 3QIPA 2IJFA 3DRPA 3CJ2A 3BQ2A 2R8KA 1TV6A 2FJXA 2W9BB 3T1AA 5KFQA 5KG3A 5L1KA 4TN2A 5JXSA 3CVKA 4RNMA 4J9KA 5KFIA 2AWZA 1RTJB 4IDKB 2D41A 4OL8A 2GIRA 3HHKA 1N5YB 4H54A 3PW5A 4WXWA 5KFUA 2YNGA 2RF2B 4RU9A 3CJ5A 5KFDA 2XI2A 2IMWP 5KFKA 4ID5A 2ASJA 3GIIA 4FS1A 5KT4A 4H4MB 2UVWA 2B5JB 4RZRA 2ASLA 1JLAA 4RW6A 4ZHRB 4O44A 3FRZA 4TXSA 1JLCB 1SUQB 3NKYA 1JKHA 3KHHA 2C2DA 2OPPB 3MEGA 4M94A 3E01A 4FS2A 2OPQA 1TL1A 1U09A 2JEGA 3EPGA 4ED0A 5J2QA 3KLIB 4KV8A 1XR7A 2YNFA 4Q43A 4Y3CA 3KK2A 5C24B 1XR5A 3MEDA 3H5SA 3TQ1A 4XPEA 1EETA 1FKPA 3CIZA 1IKVB 2D3ZA 3TAMB 3OL8A 4ICLA 3HKWA 4KHRA 4GC6A 4PWDA 5KFTA 4O3QA 5KFYA 1LWCB 1S0MA 2IJNA 2QE5A 3QGHA 3OL7A 4R8UA 1RT1A 3LANA 4YQWA 5K14A 3GIJA 4ECQA 3PJWA 5I42A 3DM2B 3DRSB 3QO9B 3TVKA 4Q0BA 3MR5A 2V9WA 1S9EA 3DMJB 1XR6A 3EZUA 4LQ3A 5L1IA 2YKNB 4LSNB 2YKMA 3DLEA 1C0TA 1QAIA 1VRUA 2IBKA 4NCGB 4ZVGA 4QWAA 3BJYA 2WONA 3QZ8A 4IR1A 4RW4B 5HLFA 4LQ9A 4ZMMA 4KKOA 4WXOA 3RBEA 4I2PA 4Q45A 1S1VB 1N48A 3RB4A 1T3NA 3KK1A 4JUZA 1RT4B 1HARA 1RT3B 2HAIA 4NLGA 4G1QA 4RW7A 2FVRA 1NHUA 2D7SA 5EUHA 5KFBA 5F8LA 5KG5A 4LSLA 4NLTA 2FJVA 3KHLA 3M9OB 3KMQA 1NHVA 2AGPA 5KFEA 1JLGB 2ZE2B 3I0RB 1S4FA 3H98A 2HWIA 3PW7A 1TL3A 2YNIB 1LWEA 1HYSA 1BQMB 4TY8A 4NLRA 4NLSA 4RUAA 4RNOA 4HYKA 1UWBB 1S97A 3LP2A 1QAJA 4PUOB 4WYLA 5C42A 1JLEA 1S48A 1SH2A 2WOMA 4ZPCA 2ASDA 5KG2A 4IOBA 1KLMB 3M8PB 1RTDB 3H2LA 5DQGA 5J2NA 3C6TB 4WFXA 5HROB 4TQSA 4TLRA 2CJQA 4MK9A 3KLFA 1LW0B 5I3UB 3MFIA 2ZD1A 4J9LA 4X2BA 4DG1A 4URGA 2XI3A 3GQCA 1KHVA 3KLEB 1FKOB 3DRRA 3V6DB 1N4LA 3BSCA 3BSNA 4EYHB 4NLYA 2C22A 4O3PA 4G3IA 1HQEA 1EP4A 3MECA 1R0AB 2W7PA 1RT2B 5F8NA 4TY9A 2R8GA 1SV5A 2OPRB 4B3OB 3KLGB 2GC8A 2W8LA 4KAIA 1J5OB 2HMIA 4KHMA 4DEZA 4ZVEA 1T03A 2AGOA 1VRTA 1S1TB 4RUCA 3KJVB 3MF5A 3BGRB 2DPIA 1IKXB 3HVWA 5EWFA 4MIBA 1GX6A 2BQUA 2YNHB 4ECXA 4YP3A 3DI6B 4ZP8A 3H40A 2RKIA 4KSEB 1C1CB 4NZ0A 4TQRA 1RTHB 3D28A 3KLHB 3RB6A 1ZETA 4O3SA 1S9GB 1RT7B 3D5MA 2R2SA 3G6VA 1CSJA 2WCXA 3ISNC 3V6KA 4KO0A 5HP1B 5J2PB 1RDRA 3KOAA 4RW9A 4WE1B 3RB0A 4EYIB 5DG8A 1DTTA 4IG0A 5CYMB 3JYTA 1JLQB 4DL3A 1IKWB 1C0UB 3FFIB 2BANB 1S49A 4WFZA 5C5JA 1RTIA 5KFFA 1S6QA 4J9RA 1REVB 2VG7B 2HNYB 3T5LA 4O4RA 2OPSA 3MTKA 5DLFA 2ILZA 3MR3A 3QGIA 4O3OA 5KG7A 1FK9A 4M95A 2R2TA 1S9FA 4RW8A 2I1RA 3EPIA 3BR9A 4J9PA 1S1WA 3QIPB 4I7FB 4GC7A 2AX1A 5KFNA 5KFOA 5KFJA 2IC3A 3NBPA 3PW0A 3CWJA 3T19A 2WK4A 1HMVA 2UVRA 2W9BA 3DOLA 3M8QA 4H4OA 3GV5B 5F8HA
chains in the Genus database with same CATH superfamily
2W7OA 5EHHA 4IFVA 1FESA 4C11A 4DMZA 4F25A 5K8OA 1CJVA 2IAJA 2EPIA 3KG4A 2AP6A 1CULB 5EDWA 2DY1A 3RRKA 3KNAA 1AW0A 3IMQJ 3G71S 5JVHQ 3UDLA 4XPCA 2FD2A 4JI6F 2DNLA 3DMJA 1U1KA 1G3OA 4W92B 2IDLA 3RR8A 5A2QU 1XC9A 1RADB 2KXNB 3Q8SB 1URNA 2P9GA 4YB5A 1TL3B 4C8MA 2FJAB 1GXLA 3G86A 3AHPA 5KT5A 5E3PA 1WDDA 2DIUA 1P8GA 4PUOA 1DTQB 1GXUA 1SH3A 1TQLA 2O1PA 3R7NB 4PRFA 2J9EA 1A9NB 5J2NB 3CXCR 4I6WA 1YK9A 4L6V3 2ZD1B 3QWPA 4OJHA 4IFYA 4TU7A 3RUBL 4PYAA 2PA8D 2FZGB 2PO4A 4RU2A 3FQKA 3DOMA 4GVBB 1HWUA 2QLXA 4NLUA 3MFHA 3GILA 1YKWA 3IBFB 1UVKA 1VK3A 1T9UA 2BJDA 2V9KA 4NMXA 4UZCA 1J5EF 2I6WA 4WK3A 5L1LA 1WELA 2JC1A 2AJQA 4AYBD 1ZOTA 2GMJA 3MMCA 1CQMA 1DY3A 4ZJLA 1H6KX 2I5JB 3HSDA 4DV5J 2QZ8A 3TVZA 1EETB 1ACMB 5C24A 5B0DA 1VI7A 1W25A 2KFZA 1AXQA 2ZH5A 3P49B 2B8PA 4URSA 2GZOA 2Y8YA 1WHWA 3BPDA 3NG8A 3FVYA 2YKNA 2Z57B 4A8XA 4B08A 2NPFA 1AROP 1JX4A 1PGZA 2VJUA 3GJQB 2CQ2A 2ZH4A 3Q8VA 2OFGX 3LP1B 2CQ3A 2NS1B 2RAQA 1NNDA 3VQSA 2DR5A 5ETKA 4YDDB 2FHKA 2EEYA 4B9NA 4ES1A 2VD3A 2HZVA 2LEAA 2Y0BB 1DAXA 3SV4A 2G1DA 2FJWA 5I3UA 3SFUA 2Q66A 3KLEA 1R0AA 2ATCB 1VBYA 3TANA 3R6LB 4LF4F 1SC1B 3GONA 1HR0F 5KFHA 4J9VA 4ZVHA 2F7VA 2B0GA 2RKIB 1YDLA 2J6UA 5HVGA 2ZOMA 4ZLJA 2ZH3A 3KLHA 3GTYX 3ZZ0A 4UTGA 1UFKA 1B64A 4C6AA 3IN5A 4ED8A 1S1XA 2XS2A 4DUYF 2ZH2A 1K8AT 2E7WA 1RU1A 2R8KA 2OTJS 3E3XA 5DM6Q 2MDAA 4C2MA 4OYZA 1VK8A 5KFUA 2EK6A 3RJMB 9ATCB 1BY9A 1WG5A 4RZRA 2UU9F 3MPVA 4ZHRB 3PNIA 2KT5A 2LQ9A 4M94A 3M7VA 1S79A 3ELHA 1VHFA 1XR7A 1CC7A 5B0CA 1NB7A 3OL8A 4PWDA 3ILIA 5T41A 1RT1A 3LANA 4AQYF 3SBMA 1FX2A 1GMVA 1HIYA 4A8OA 2BKOA 2W7AA 1QTMA 5MAOA 3QGPA 4O23A 3DGVA 3PYGA 2R4FA 4P75A 4JI2J 4HR2A 1HI8A 2HFVA 4F67A 3IWNC 2FJVA 4DV3F 3M9OB 4OV1A 4YN3B 3J7ZT 3RRHA 3TX0A 1SJ3P 1SH2A 2F40A 5D0RA 1RTDB 2QA2A 1X5PA 4NL5A 4ELVA 4DG1A 1OSCA 3OR2A 1LOUA 3EGNA 3A8IA 2GJIA 3MECA 2W7PA 5A0YA 1Q8LA 5F0WA 1KTQA 4OYBA 2YQ3A 4KHMA 1HL6A 3GLJA 1HD0A 1TTHB 3BN7A 4LF8J 3PKMA 4K2JA 4DSEA 1RWXB 2WCXA 1HHTP 3HHNB 5HP1B 1RDRA 2PEBA 4UOFA 2UV8A 4NCBA 3VWSA 2RU9A 1K0VA 1UFWA 3UD4P 2BJEA 1RBOB 4LVOP 3QIPB 5KFNA 2B56A 1YZ6A 2K3IA 4CT8A 2IC3A 2X3GA 2QFIA 3LUYA 1T11A 3M8QA 2FC9A 4UOHA 5D3GA 1RJJA 3PHTA 2K06A 4J9OA 3A8EA 3C2PA 3WZ0A 2ATLA 4BHQA 4O44B 2C28A 4WU2A 2AX0A 2V4JA 4KV8B 4ECZA 1RHKB 2MZTA 2CYYA 4DUZF 3F56A 1TP7A 1CS4B 4A47A 3OW2R 5ETVA 4ELUA 1CJTA 1QSLA 4FKYA 4MT1A 3NGTA 5THWA 2WONB 5KFLA 3G82A 3ITHB 3SIPB 5B09A 4LSLB 1KS2A 2ZOGA 2L08A 1L3VA 2EWHA 5F9NA 2BE2B 1RT6A 3OLAA 5F0UA 3BQ0A 4R0EA 2BJ7A 1FKAF 1Q86T 2XY7A 4RWXA 1H72C 5J2MB 4ZVRB 4UT4A 3ET6A 1XEZA 2ZITA 3CJTA 4OYAA 2E44A 1GX5A 1CJUB 4PZVA 2H5JB 2J76E 5KFAA 2E1CA 2VBWA 1TMMA 3RB3A 2VASA 1S10A 3AA9A 4EBDA 3L4BC 1KQGB 3JYTB 1S0OA 3OJSA 2H5EA 2AGQA 4K4VA 3R5AA 2VG7A 2P9CA 4RX6A 4JI1J 3MCNA 2LFVA 4JI8F 3M32A 4H4MA 1JLCA 4DV7J 2RDJA 2AJ4A 3CUNA 2WVFA 3GSDA 2Y0SD 3C14B 4FYXB 1YJVA 5HO4A 5GAEU 3PX0A 2AIRB 1LWFB 1RCXB 4A8SA 1XMOJ 2KI2A 3DRXA 5IT0A 3P5TL 2K1RA 3SYZA 4L76A 3MPDA 4U9RA 2DRAA 3NNCA 4DV5F 5HN0A 4HDGA 1WHYA 3V81B 2GVDB 3CCES 4ZITA 4NLDA 2C2RA 1HYSB 2CNKB 1CBKA 3LAMA 2RHSB 4F0MA 2MLZA 4BC9A 1ZS6A 1YG0A 2ZKTA 2G2ZA 2QO3A 3DFEA 1LW2B 3QLHB 1VMBA 1D1UA 3NY0A 5J1EA 2UZAA 3DU5A 4CTAA 4OYIA 2C2ZB 3PKYA 5D0HA 2UUWA 2ZNZA 4KGXB 4EEYA 3BN4A 5MLCV 2R42A 1FDAA 4E8UA 4FYYB 4NX9A 1OPIA 2YKPA 1FF2A 2JVRA 3VAHA 2M70A 2OUGA 4ECWA 3P8BB 3MPYA 3NS7B 2W9CB 2KH9A 1NSAA 5KFQA 3SI8A 4IDKB 2XZDB 3DNCA 1Q82T 3CJ5A 4DX7A 1L3TA 1WTFA 2CPIA 2OPQA 1TAQA 2JEGA 4FF2A 1N34J 5J2QA 3HM9A 3P3DA 2E5JA 4X4QA 2GIFA 2DH9A 3CJSA 4ICLA 3EUNA 4DLEA 1UTAA 3OL7A 4JI7J 1FDDA 2OD6A 2AZ3A 3IAM9 3DRSB 1BD6A 1F5CA 4USJC 2FHMA 3CJRA 4YOEA 3F41A 4AL6A 4X65J 2HPUA 4DQIA 3ONQA 5HLFA 4DX5A 1NMEB 1D8ZA 5DM7Q 3RB4A 5HATA 1F1BB 2KU7A 4NLTA 1SC6A 2MY8A 2NZCA 4X4SA 3BDEA 1PAEX 1BQMB 2Q43A 3K5LA 4ZPCA 2NXJA 1ZZNA 4QR1A 1FKOB 5EN1A 4JI2F 1LK7A 1J5OB 5GMEA 2HMIA 2VZ9A 1T03A 4RUCA 1PAUB 1VJQA 3G2XA 4N41A 4B17A 4TQRA 2XY5A 2Y3YA 1ULRA 3V6KA 3TAPA 3KOAA 5GMDA 1IR0A 2OAUA 5C5JA 3AD8C 2ILZA 2N4DA 4ZIVA 4C3MA 5IM0B 1HD1A 1O6XA 1XTZA 3C16B 4LF8F 1IKYA 2XCPA 3UCZP 4KE5A 5CD4A 1R8CA 2FLPA 1RP5A 2UXCJ 3E01B 2IRUA 1RHJB 3NWGA 1Z4UA 2RDDA 1FD8A 3PIPQ 3HDSA 4FYVB 3OFFA 1LFPA 5L1JA 3RBDA 3D1OA 5GAGU 3IM8A 2XMUA 3JS9A 4V19X 1CJKA 3CO9A 2ZHOA 1RAAB 5AE2A 2DY9A 1RAEB 4PEOA 2MQ8A 1VQYA 3R5JB 2UXDF 2DYAA 1RT4A 1KP6A 2HW3A 4RLEA 3KUEA 1U1MA 4DL4A 3SEOA 4JV2A 5LMUJ 4K4YA 2VDHA 3I6PA 1U0HA 3IR7B 5BYSA 2VG6B 2M7SA 4F0KA 3S8SA 5F8IA 1R8AA 4EMDA 2MB0B 1WF2A 2DGTA 3UO0A 4OHYA 5F8GA 1UW4A 1U8WA 3N01A 1GMWD 3HT3A 1UL3A 3TZYA 3CD7A 2R7XA 4YEAA 2OPRA 1SJFA 2L3MA 4W4MA 2VG5A 2C2NA 2YX1A 3QSIA 2KRRA 3ENWA 1TUVA 3CC4S 1UJ6A 4OZLA 4U8YA 3KDOA 1HQUA 2IBOA 5DGBA 3FEZA 3UR0A 3PXGa 4NYOA 1NKBA 2C3PA 4CLFA 3FCVA 1RTJA 2MZSA 2HIYA 3GJRB 5KT2A 2ZDOA 4IFVB 3BV8A 3FDSA 5M2UA 4C11B 3H59A 1GMWA 3RW6A 3WIUA 5D4LA 2DPJA 2IAJB 2W24A 3VCDA 4NZ7A 4ZPBA 2A2DA 2B4PA 2ZHAA 5HQ8A 1U48A 4YS2A 2CZ4A 1S12A 2JJ4D 5KFXA 1RSCA 2BRLA 1GMUA 2VBYA 4DV7F 4QYZJ 5C25A 3VALA 1TZ0A 1WACA 2O67A 5KG4A 2OTLS 1X9SA 3LOUA 1XMOF 2Q6BA 3TJ9A 3H7HB 4MKYA 2CNOB 3M1VA 3D1HA 1HWJA 4K5SA 3AJ2A 2W01A 2RT3A 1RT5A 1X4FA 2ZZTA 3JQJA 3NAIA 4LFAJ 1EJ7L 1UCNA 1TFYA 4CO3A 5KOWA 1RWUA 3R7BB 2CDQA 3TX8A 4IFYB 2HHHJ 5LT5A 4WFAQ 1RZMA 2EG2A 2XEXA 1XERA 1R8PA 1PG5B 3KJVA 3BGRA 2OMLA 3DOMB 5KFPA 1SI9A 1SJ4P 1C1CA 3AJDA 4P2XA 4RWWA 1FDBA 3H5UA 1Y0HA 3GG1A 2E1PA 1U6BA 2WBRA 1FK9B 3Q8YA 5AXLA 4CCHA 1WKKA 2F65A 1XK8A 1Q53A 2CZVC 1NJZA 2IMWP 1VQ4S 1YRUA 3MMCB 3S1TA 4RL1A 2HBQB 1U6FA 4KJIA 3FRZA 3MI7X 1JKHA 4CDIA 2BUNA 5K8NA 3HSZA 4IQMA 1H2TZ 5C24B 4OJ3A 5B0FA 4D3HA 3CCMS 4DR6J 2KYZA 4R8UA 1SKWA 5I42A 3U7JA 3J7AN 1HBOA 4LQ3A 2YKNB 2YKMA 2QLJB 2Q3PA 1SPBP 3ZZOA 5I3QA 1VRUA 3L7PA 4U8VA 1F9HA 4LF1A 4KKOA 1N34F 5IV3A 1U7LA 4L72B 2UUBJ 1OSDA 2FVRA 3AQOA 1M1HA 4EFAC 4JI7F 3PW7A 2FY8A 4QOTA 1QAJA 3M8ZA 1FO1A 1VOMA 4TVAB 2GJFA 2BJ3A 4X65F 2FZKB 2OEJA 5I3UB 4J9LA 3KLEB 4G3IA 1HQEA 1R0AB 3D0GE 3I4HX 4MYUA 3E8OA 4DCPB 4U96A 1DBDA 4DF4A 3BB5A 2LYVA 2K7KA 2YPYA 1Y00A 3D28A 2HZAA 3KLHB 2WW4A 1BGXT 1W26A 3R8YA 4CT9A 1Z2ZA 3B78A 2VIHA 3W65A 2YTCA 3FJ2A 3PW0A 1HMVA 3GV5B 4HHHA 2Y1RI 2DH7A 1SH0A 1N5YA 1F9FA 3AOCA 1S1UA 1YWXA 3HD2A 2W8KA 3MAQA 7FD1A 2GHVC 3IS9B 1TKXB 1TU0B 2RUSA 5GVQA 3KHRA 3PJXA 4MMOA 1YTYA 2R8IA 3PV8A 2JEJA 3UD3P 3IGNA 1T9XA 2H51B 1RKIA 3J7YI 3CF5Q 3QT5A 4CYUB 4ILLA 5KT6A 1Q95G 3ZFVA 2UXCF 1VQSA 3TQEA 2WBMA 1RWMB 2MKYA 3Q23A 3M9MB 3LPYA 3HX9A 4X84A 3NMAA 3K58A 4OI4A 3MR7A 4RUHA 2ZNYA 2BYCA 4C9DA 2XC9A 2MTLA 4OLOA 3V4MA 2IMOA 2JVOA 2KL8A 3BBCA 4DSJA 2XNRA 4WK1A 2RRAA 1NBEB 1BXNA 1SKUB 4DG1B 3OR2B 2YWKA 2PE8A 3MECB 2M88A 5A0YB 3JB9k 4OHVA 4OZ2A 5HL7Q 4OX8A 5LMUF 2GO8A 4F02A 3Q8PB 2JH3A 2YNHA 4Q2LA 1WWHA 2CNNB 3T5KA 2H9ZA 5H9EK 3T6JA 1WC3A 3KWMA 4X66F 4QW9A 4HKQA 4QYZK 1B0PA 2EI5A 2NZ4A 2IIHA 2AD9A 2YNGB 4USTA 5CAAA 3M8QB 3THVA 4NYZA 4EZ6A 4DPTA 1WG1A 5D3GB 3MEGB 1GAOA 1VQ6S 1YITS 2ZZMA 4J37A 1PJ5A 3POTB 1HNVA 2HVZA 2AU0A 4X4VA 4NLVA 2DHAA 2EK1A 2L41A 1FWKA 1JJHA 4F04B 3NGUA 5D4OA 5DJBA 2P6SA 3SCLE 1WG4A 1SIWB 3H4BA 3QSYB 4J90A 3TWZA 2DD8S 4I2PB 3PRDA 1SIZA 1U47A 2M8HA 5HVHA 3I56S 3UD5A 1L3SA 3K5NA 2HFNA 2NSBA 3GCXP 3GYGA 1T05A 1JIHA 4ETZA 3U27A 2BMBA 5L38A 2R9LA 3NXZA 3VAJA 3UDCA 1RT6B 2MQQA 2E1RA 1T9YA 1YRTA 2EFQA 4OI1A 3PZPA 3IM9A 1WF0A 4QQBA 3PO5A 2M9KA 1RT2A 2A1BA 4OHZA 2FVSA 1B99A 3HJVA 4KH0B 2V68A 2O3DA 4DCJB 2F8EX 3WC2A 4KT0C 4ZPDA 2HWHA 2YX4A 2HLTA 1RWPB 4NEZA 4LFAF 1REVA 4IO1A 3QZ7A 3LP0A 2HHHF 3DRPA 2W9BB 5A6PA 1NSKL 2PN6A 4P2MA 4BLGA 5ETQA 2EFPA 4PABA 2LP4A 3M32B 4H4MB 1JLCB 3BM7A 2YKOA 1NDPA 3W61A 1XR5A 3H5SA 2MGZA 3BBFA 3KFWX 4DJBA 1DARA 4ZA1A 2Y9HA 4B9TA 5K14A 3IWLA 4OI3A 4ZJOA 2K1RB 4OYMA 1CLFA 1RI7A 3CULA 4ZLLA 4NWBA 4ILMA 5EUHA 1V5IB 2FB0A 2F1FA 4OYWA 4DR6F 2MPUA 5KFEA 3EGVA 4DR4J 1MN7A 4TY8A 3TJAA 3ZTQA 1S97A 2CQBA 2J0WA 3K8WA 3DKDA 4XTTA 1ITPA 2XI3A 2L9DA 4CWBA 3TZXA 3QJLA 3BSNA 2UUBF 2H48B 3K0JA 1N5VA 1S76D 4LR8A 1EAYC 3A4TA 1I3OB 1T9VA 2DITA 4WTOB 1YSJA 5H9FJ 3D5MA 1RK8A 2JFKA 1KEKA 3FGVA 2ZBCA 5HMYA 2E5GA 3RB6A 4XIUA 4LF5J 2OPSA 1RLDA 4WTYA 4AFFA 2WK4A 1UVLA 1GFWB 1JWWA 4UOGA 2C3MA 4ECSA 5HANA 2V50A 1AFIA 2WHOA 3KJNB 4QU6A 5J2QB 1F5BA 2QSWA 5DO2A 4DV6J 4ICLB 3BS9A 2V0NA 2GQ2A 1ZTTA 5IFMA 3AA8A 3F0NA 4KY3A 5IQ6A 1KQKA 3CGIA 3MCOA 2DNNA 4BWMA 2CPXA 1EIYB 5KFCA 5HLFB 3K5PA 4F4AA 2VH7A 3OQ2A 1MWQA 3IG1B 3BGOP 4GMKA 3CCTA 1UJ5A 2CVEA 4O3RA 4DPYA 2V4RA 3PR5B 1DLOA 5CYQB 1UWBA 3OSPA 3ZZTA 2V2VA 1PKUA 2N82B 3UR3C 2MHNA 2PD1A 4FKXA 2COLA 2QA1A 2KT3A 1Y4ZB 4O0IA 1KWMA 4MYTA 2VC1A 2MJUA 1JB0C 1T03B 4JBCA 4NPOA 3T9ZA 1NK4A 3H5XA 4KFBA 3R9LA 2G13A 4P2FA 3GR0A 3MR2A 1H38A 2D1CA 4U95A 3KYLA 2BANA 5D6GA 2VB6A 3I5CA 4KGKA 3ENQA 2W1BA 4P7TA 2D9OA 3GPAA 1NAQA 2BX6A 3GV7B 3T1HJ 1RA6A 4DLGA 1IKYB 2HQFA 2OEMA 2EFGA 4QCLA 2J6SA 4DSFA 4L73A 4ED1A 2CPDA 1AA1B 4MIAA 4ED5A 1RWOB 2V67A 5CH7B 2ABYA 2A0FB 3QIDA 2YWFA 2FY1A 3FEYB 2O5DA 4CO2A 1VQ8S 3SSQA 4NRUA 1AUDA 2PMHA 4ETXA 3BKUA 2HQ3A 4RW4A 4C3KA 2IM1A 4WZQA 1VCTA 2CJKA 3AD9C 2OH2A 4Z37A 3VGVA 4IRCA 5C42B 1U4BA 5HQMA 2SXLA 6FDRA 2HG4A 3QQCD 3T3FA 1U0HB 2RQCA 1DTQA 4C3LA 4X4RA 3K89A 4W90B 1X5OA 2JWNA 3D2WA 3GE9A 1OQ3A 3D0IE 4DPOA 2W2OP 3KKFA 4GVBA 4WFBQ 2VG5B 1TFWA 1N52B 2E9ZA 4DV1J 4WE1A 1HQUB 3FFIA 1SXLA 2X1GA 3CCJS 2CPZA 3SV3A 1HQ2A 2HFUA 3B4MA 4DQQA 4TN2A 1RTJB 3UFCX 4USMA 4H54A 1YQHA 4B9MA 4DR3J 2ASJA 1PSDA 4X4OA 2DT9A 3EXYA 2C2DA 3D4JA 4QR0A 2DNQA 1M5SA 4ED0A 2LDYA 4FF1A 3M2RA 1EETA 4DR1J 1SJRA 5ADZA 1FFSB 5CZXA 3LH2S 3LGNA 1YBUA 2ZC4A 3QRPA 1S9EA 2QMUB 1YJNS 4LSNB 2W2NP 2JHEA 2IBKA 1W2IA 1REGX 3GIRA 1FDNA 2UXBJ 2QGFB 4CM2A 1J2VA 2NYIA 2K2PA 1NHVA 2ZE2B 2WB1D 1X4BA 3ETOA 3M1VB 3CC2S 5H1SV 2WOMA 4OX7A 2R7WA 4ZK7M 4IYQA 4KPCA 4TQSA 4ZLPA 3UN2A 4EYHB 1R6VA 4MTPA 1SJQA 3HXMA 3KLGB 2JLFA 1TAUA 3SCJE 3KJVB 1K44A 3BGRB 8AT1B 4A8YA 2DPIA 4JI4F 2HZCA 2RKIA 1C1CB 2KKHA 1K0TA 3ISNC 1EB0A 2Z2YB 2LQ8A 5AXKA 2Z2ZA 2OHDA 1HW9A 1NK0A 3BR9A 1S1WA 5ETPA 3W1YC 4IOAQ 3T19A 1U45A 3OBIA 1WEZA 4YB1P 2X1BA 1KONA 1FWLA 4B9SA 3TEHB 2DNRA 2V69A 3CNQP 2R7VA 2IRYA 4HI1A 4ZHRA 4AXIA 4U7CA 1GTHA 1LXNA 1P1TA 2ZBRA 2AJ0A 3D6MB 2IM3A 4RKUC 4LF5F 4LR7A 3J7Z5 3C8YA 2LU2A 2NXEA 4I68A 4R8UB 4K0KJ 4IG3A 5GADU 4U7UK 1IBKJ 2B43A 1NK6A 2HHPA 2RDIA 1HBOB 4OX9J 5FDLA 2YKMB 2RIJA 2QLFB 1NO8A 3W9HA 1N36J 3G8SA 2J9DE 4NLPA 1TKZA 4DV6F 4EI2A 5D15A 4H4KA 4B3RJ 3EGZA 3G6YA 4WKRA 2M0GB 2GHWA 5B0EA 1FRJA 3AB2B 1IR1A 3DLGA 1JLBA 4YHHJ 2IY5B 4DQRA 1RTDA 1Q79A 1UW9A 2AEFA 3V4IB 2C2MB 2R7OA 3C46A 3FSXA 3NNHA 1WI6A 1FTCA 2CG8A 2GAHC 4IH6A 2QYGA 2KFNA 1Y7PA 2J7KA 2ALZA 3TP2A 5GAGI 4YR0A 2DTJA 1YJ9S 2Z4PA 4GO5X 5HP1A 2XULA 1TV6B 4IRKA 1A7GE 3HFVA 1RXOB 1HKAA 3HSGA 1HMVB 2G0CA 2IM0A 1V6HA 4ED3A 4FBUA 3HKZD 1SUQA 2D69A 2DHGA 2GV1A 1S1UB 2IPOB 1RHUB 2MQNA 4FNIA 5A8KB 3MTJA 1WC6A 3I87A 2BACA 2OLWA 3AAWB 3GFXA 4Y2AA 3AJ1A 3EVMA 5CHCB 1FFGB 1YIJS 4I4BA 1MWZA 3T1HF 3PCOB 3H4DA 1AZSA 3SFGA 3PO4A 5GAHU 1L3KA 2GQQA 3W64A 3AFGA 1RHQB 1F6TA 1AT1B 2QA4S 3CMQA 1MSWD 1NB2A 1N33J 3TARA 2M52A 3ITHA 3Q86A 2A10A 3ISND 4D3GA 4WP9A 3D9BA 2XLIA 4JI3F 1UAWA 5KT7A 3UDVA 3TUZC 3FKBA 2BE2A 4XO0A 2ZUAA 2ZM6J 5J2MA 4NRTA 1LW0A 3CB4A 3FQLA 1KSPA 4I67A 1EP4B 4HHUA 3K8VA 3H20A 5C2GA 4DL5A 2BRKA 3OSNA 4ZJQA 4JV0A 5F41A 2ROPA 5F8MA 4LREA 2NUUG 3W60A 2MKJA 1RT7A 1M5VC 2B4VA 1DTTB 3PYDA 3R3TA 3CO0P 5B0BA 2ZUGA 2ASYA 2M3DA 3IR5B 5KG3A 1EKSA 4DXLA 3W9JA 2ACYA 1M1GA 2RHQB 2XI2A 2YX7A 1RLCL 5KT4A 3VQTA 3CMAS 3NKYA 4DV1F 3LQVA 1YBTA 1VISA 2GFFA 3OR1B 4GC6A 1VBKA 3MMJA 2E7VA 1SC3B 4YQWA 4DSKA 1UMJA 2M2BA 1E6VB 1NKEA 4DR3F 2V8PA 6AT1B 3PTWA 4NCGB 3LGMA 4LQ9A 4ZVSB 2MZQA 2YWEA 3VV2B 1X7VA 3MMBA 1IM6A 1TMJA 4N8OA 4DR1F 2O66A 2J7WA 1HYSA 4DS5A 4GVLA 4UY85 2E5LJ 2DNZA 2E66A 2DH8A 2UXBF 3KLFA 1Q8IA 4X2BA 1RTZA 3RR7A 3NCQA 5E7OB 1KHVA 3BSCA 3KJFB 3W8PA 1Z1ZA 3QFWA 1RT2B 3BGLA 3FSYA 4DX6A 1VGYA 3FBBA 1VRTA 1IXKA 5D8HB 2EFVA 1HA1A 2IRXA 5G0RB 2FGOA 3QWUA 2C2KB 4QU7A 1REVB 3EWGA 4AL5A 3EPIA 1H74A 1R8HA 2AX1A 5E33A 3NBPA 1FNXH 3MM9A 2P5VA 5F8HA 1D0EA 4RNNA 1ZTWA 4QIEA 1UVIA 2F4VJ 2RS8A 1T3OA 4NLXA 3VGTA 2OSQA 4WU3A 1Y5NB 4P7VA 4DQSA 1RAFB 2R8HA 2MGZB 3QMQA 3EZ5A 2OELA 3M6UA 2C1EB 2IVFB 2A3JA 3NL0A 4CH7A 5K14B 5SZTA 1H98A 1U02A 5F9LA 5EWGA 3H0PA 3R7SB 4ENOA 1IM4A 3HFZB 2LA4A 3PACA 3HZGA 3M8RA 2HVIA 4K0KF 4TY8B 1FJCA 4QJVA 1IBKF 1BQMA 3KUGA 4OX9F 4J9SA 2DEIA 1RA7A 1XWLA 1YVFA 1U1NA 2B6AB 3N4WA 2DRDA 5HBMA 1S6UA 1QAYA 1QDUB 2GAGC 3R1LA 2ILYA 4B3RF 4FDFA 2JL9A 1JLFA 4TYBA 2XY6A 4K4WA 1K1QA 4PWWA 3QATA 1B3TA 3LALA 2JZ5A 4HT5A 4YHHF 1NU4A 4L3KA 3OHBA 4ED4A 2UU9J 3QGGA 2HVDA 4OZ0A 4LFBJ 5F3TA 1SVDA 4DL7A 4M63A 2OPSB 1WC4A 4K2XA 5JMNA 1LQ9A 4HHJA 2XM3A 2HEKA 4ZLNA 2DXFA 2CFXA 2RH3A 1HNWJ 1OWXA 2OPPA 1R0CB 1TL5A 2YWHA 1Q8KA 3MEDB 3PW4A 3PR4A 1Y11A 3IO1A 1AUSL 3T6BA 2HBYB 4K4XA 4C8NA 7FDRA 1G2EA 2OFHX 5A8WA 4ZN1A 1QUVA 3ZTPA 3W66A 1TL7B 3KNGA 1LXJA 2MLYA 3GFHA 3ADAC 1S1VA 2DNOA 3M30A 3GIMA 2E7XA 3OTBA 4MAKA 3G6ES 3I0RA 3NS5A 1DLOB 3MEKA 3BO4A 5HROA 2VG6A 2DNHA 3MXHP 1N33F 3N6NA 4B3OA 2E5HA 6FD1A 5BR8J 3DU6A 3SCIE 3DI6A 4K4TA 1B4SA 3CJ4A 2ZM6F 4KFBB 2XG8A 1YX2A 5CYMA 5DG9A 2HHVA 1BWEA 1IKWA 2VC0A 4LR9A 2HFZA 3MM5A 2PT0A 2CJ9A 1KRPA 3RGIA 1A6LA 4RU9A 4Q7AA 4CO0A 1GXTA 1NJYA 2ASLA 4M1KA 3KHHA 3K59A 4FS2A 2DHXA 1N32J 1WEYA 4Y3CA 3KK2A 4DFKA 2AT1B 5DETA 4O3QA 1S0MA 4N56A 4DF8A 2BW7A 1N5QA 3K57A 2VPZB 1XR6A 4PCQA 3DLEA 1QAIA 4PPZA 4RW4B 2BW2A 4X4NA 3ULHA 4KYZA 1VLOA 2HAIA 3KHLA 2DGQA 3KMQA 3H98A 2DXEA 4HYKA 3VAFA 3LP2A 4BC7A 3WDOA 1ICEB 2IVYA 5K9FA 2ASDA 4OQJA 3ENAA 2G4BA 1VQLS 3QNWB 1IQTA 1VQOS 2LQ5A 2R8GA 4FXDA 5M2PA 4DS4A 4DEZA 2X1AA 2E5LF 2F3JA 2Z2MA 3NWRA 4YP3A 3TEGA 3R97A 1EHWA 5DDOC 2MSTA 4JI8J 1EZZB 2DB1A 3FZ2A 4WE1B 2NR0A 3FFIB 3CDAA 3QT7A 2A2CA 4E0DA 1FK9A 4M95A 2I1RA 4PAAA 4Y2IA 1WHVA 4ELTA 1QY7A 3I9ZA 1FVSA 3J80Y 4HLBA 1QE1A 3C6UA 3UVJA 4UUXA 2XCAA 2VA2A 4KB7A 3M2RB 1OY6A 2FGCA 3OTCA 2AJ2A 3H90A 3BREA 2AJFE 1EKRA 4KGMA 2F4VF 1S9EB 2ZWOA 4WZMA 4IR9A 2XS7A 1WORA 3GFZA 4LBHA 2VPXB 4C8YA 3ZZPA 5FJ4A 1MW7A 3UN5A 4CLWA 1FT8A 2ZHBA 4M5DA 2RS2A 1HPZA 2WOMB 2GHPA 4KIAA 2B7BB 2CKWA 1U1RA 5IWAJ 2MKKA 1WF1A 3OV7A 1KBRA 1VQ9S 4LRFA 2XWXA 4R0JA 2DGXA 3CDEA 3R2CJ 2R7RA 3BH7B 1S57A 1BQNB 2QMWA 4ZP9A 5DG7A 4MK7A 4PQAA 4RNFA 5C7PA 4ZS6A 2J0SD 1NSPA 3CCWA 4RBUA 3THTA 5T7LA 3Q83A 2U2FA 1RAIB 1S1WB 1T95A 2NLWA 1B0TA 2RF2A 4C0BA 4WIIA 2QX0A 4QWBA 3T41A 1TL4A 2AW0A 1WKJA 2HVHA 3OUYA 3MM7A 1XMQJ 2EXUA 2YNFB 3KLIA 3HMJG 4LFBF 5HMXA 3M4XA 2ROEA 2B3TB 2W9AA 3IS9A 1TKXA 4K4SA 3IGVA 2NPIA 1LWCA 3Q8QB 4WF9Q 1ZYQA 3FMBA 4LT6A 2FTRA 2Y1LB 4IG3B 1VBZA 1Y5LB 3MPWA 1HNWF 4LIWA 4CYUA 5FDLB 1O0PA 4OZ5A 4Y2CA 2FYXA 2W4CA 3B8HA 4UZBA 4GRSA 2ZKUA 1TKZB 3M8SA 5IOLA 4OYOA 1BC6A 1T9TA 4MK8A 1G7CB 3DLGB 1JLBB 4F50A 4ZCMA 1SB6A 3V6DA 3D7SB 4TYAA 4HACA 3VGSA 4Q44A 3GP9A 2GA7A 2WVDA 2CQCA 4DFJA 1FRIA 4K50A 1ZH5A 2PIIA 3R5DA 3G6XA 2NYHA 3M2UA 1X4DA 3PIOQ 3CTRA 1FJEB 1KN6A 4TLQA 1I1GA 1RB0A 5BR8F 3QRRA 2FJXA 1TR0A 3T1AA 3DCAA 3CJQA 4M5NA 3RBZA 2BDPA 1IWGA 2YNGA 2EFOA 3IFEA 4FS1A 2RQ4A 2OJ3A 4M5HA 1SUQB 1U1LA 4OLPA 3MEGA 1TK5A 2CJYB 3PEJA 3POTA 2DXDA 3BEGB 1D9FA 4X4UA 3TQ1A 3CIZA 2D3ZA 4OHWA 5DDQC 5KFTA 4DL0C 1OYDA 3FZBA 2Y8WA 2OMOA 3I9V9 2UXDJ 1QVGR 3TVKA 3LO3A 3QFHA 5L1IA 1AZSB 2F4FA 5HVFA 1N32F 3T1YF 3QZ8A 4I2PA 2VPWB 1RISA 4G1QA 2F8MA 3N5BA 3UI3A 1S4FA 1NK5A 5D78A 2VKRA 5GMKa 2XNQA 3EYZA 1S48A 4C0OC 2C3YA 4AD6A 5KG2A 3H2LA 3NGRA 2N7CA 5M2RA 4RR5A 2CJQA 1LW0B 3D0HE 1SKRA 4O3PA 4FXVA 5F8NA 3R5BA 3MOJB 2FLOA 4KAIA 4MIBA 1ZM3A 3FC9A 3W9IA 2LVWA 1ZETA 1RT7B 1V9OA 2CDRB 1Q7YT 4ZCLA 3RB0A 5DG8A 3LWMA 1MWYA 1S6QA 1MMDA 3FRYA 1K9MT 1L5UA 1RABB 4RW8A 3M05A 3CCRS 4I7FB 3PX6A 3NCRA 3LF0A 3TYTA 1VR6A 2YY3A 2W9BA 3TA0A 3JSYA 2VFTA 4HTJA 5IZHA 2W4DA 4LF9J 2HAFA 1VC6A 4M5KA 3WC0A 3ZO7A 3W2VA 1X4AA 1GT8A 2H4WB 4QIVA 1DJ0A 3HHEA 1LKZA 5CZVA 2BKNA 3UNYA 4DR7J 1X0PA 3VGUA 2VODA 2QG9B 2ZDPA 3MMBB 4C7QA 4Q8EA 5G4DA 2CPFA 1M5KC 2AHOB 5KG6A 2RRBA 1P9YA 1ROFA 3NLCA 3A8JA 3SQOP 4F4YA 3KUHA 1YJTA 4ES2A 2YWGA 1N6QA 3VHQA 3KLFB 1V3SA 3OFGA 1CC8A 1VRTB 4ED7A 5GADI 1WSRA 3WHIA 4F36A 4WCEQ 4WBFA 4C8ZA 4OX6A 1KVJA 4UY8T 3PG9A 2X3DA 3D66A 2VPYB 1U2RA 3QJJA 5IWAF 1S6PA 2JLGA 2JFDA 2UVVA 1QUPA 3CJ3A 4WPAA 1N5SA 1R3NA 2CPHA 1UEUA 3CDUA 2RUGA 3NBPB 3MM9B 4KQZA 3R1HA 4PPDA 2ZH9A 3N28A 2VHGA 4F3OA 3M8WA 2D9PA 4X62J 4F4WA 4R25A 2LCWA 4OYPA 1PYOB 2DGWA 1VS3A 2M4MA 3CT9A 3ILLA 3SSRA 2PMWA 4NA3A 3OHAA 2OO4A 1NCLA 2K3KA 3SZ2A 2R8JA 5CCMA 3IWXA 3KXDA 2VBZA 1Q1KA 4KTQA 3L7OA 3UWTA 4B3TJ 1XMQF 1D9DA 1I51B 1NPRA 1FRHA 1Q5VA 1E6YA 3SQGA 3PY8A 1LWEB 2CQ1A 3IG1A 2HS0A 2WVCA 2YNIA 2YH0A 1NXIA 3OFHA 5DDPC 1F3VA 1UVMA 4G1PA 3N5FA 4QIGA 1KQFB 1X60A 4ES3A 5KFRA 2NXNA 3LAKA 5CYQA 3CCZA 1F2GA 3UNGC 2I2YA 2FZCB 2RRNA 5HBMB 1KVKA 1X4EA 3GYNA 2AYEA 3UPFA 2F5GA 3MD1A 3MMAA 3X3UA 1UPMB 3JXOA 1JLFB 1GQEA 1UEVA 2MKCA 1RBLA 5GAHI 3QYYA 3JQMA 3MM6A 4CLZA 2BM1A 3W8GA 1JLQA 5SUHA 1C0UA 4F3MA 4HT7A 2HNYA 4I6YA 5JUMA 4U7UD 3A8KA 2HHSA 4USIA 3CMES 2HHXA 1D9AA 5IC6B 2ZZNA 3W5ZA 1ZM2A 5KFKA 1FD2A 2KG1A 1VQ7S 4RW6A 3VR1A 2OSRA 3U1MA 2OPPB 1S77D 5HSPA 1JXEA 3ILOA 4XPEA 2ZH7A 3HP6A 4NI2B 5KFYA 1NDKA 3GJSB 2V2KA 5ITHA 2OGUA 1MROA 2KVQE 5A8WB 2JX2A 2DO0A 8ATCB 4KGVB 4CLKA 2A6OA 4EGLA 1RAHB 3EXCX 4IR1A 2CQ0A 2O01C 2HBRB 3CDBA 2MQLA 4Q45A 1S1VB 1RACB 5ETSA 3CEDA 1SCJB 2Y1JA 4RJVA 3M30B 1B7YB 2D7SA 2BBEA 2Q79A 5F8LA 5KG5A 1O5JA 2B9WA 2POKA 1CQNA 3I0RB 4LVNP 4ZVTB 3I96A 4NLRA 4HL9A 4C4WA 5C42A 9RUBA 4LMZA 2J8AA 3O1LA 5HROB 1UZHA 1FHTA 4KH1B 1JQGA 2HYIB 2B4OA 1JJ2R 4B3OB 2CPEA 3L09A 4X66J 4Y2MA 4KRWA 5DRKA 3UW1A 2M8DB 5EWFA 3DI6B 2VOOA 4O3SA 2Z30B 1S9GB 1NK9A 2R7UA 4A8WA 5EX0A 2AZ1A 3H8YA 5CYMB 4DL3A 1IKWB 1RTIA 2AKWB 5DLFA 1PJ7A 1S9FA 2GQCA 3MM5B 4GC7A 3QBCA 1A0OB 2W25A 1SQFA 2MY7A 1IR2A 1ZPWX 1OQ6A 1HNIA 2Z2LA 3OVBA 4DWIA 4LF6J 1NM2A 1Y3KA 4O3NA 4PXDA 1BMQB 5KFGA 2LA6A 3KK2B 1KOHA 2HNZA 4RNHA 1U6ZA 2HQCA 1WD6A 1DURA 3MOZA 2DGOA 1RYRA 3FSIA 2I8EA 4LF9F 5H9EJ 4AT1B 3DLEB 3NGDA 1M90T 1F2HA 4M5JA 4LSNA 3OL6A 4HH1A 5B7WA 1U1QA 5ETNA 2CZ9A 2VL1A 3DOKA 3ISZA 2GGPB 3HT0A 1BQXA 4G6VB 2V94A 2DJWA 3DLBA 2QTWA 4IO9Q 2ZE2A 2ZFHA 2LMIA 1NDCA 2WB4A 4DV4J 3LP2B 2CVIA 8RUCA 3KJQB 2XQCA 4PG6A 2R2UA 4QR2A 4DR7F 3EE3A 4WJBA 4YFUA 1HBMB 1VC5A 1AFJA 2WSFC 5I3PA 1FRKA 3GMGA 3KLGA 2RQMA 3I5BA 3VTIA 2VA3A 1TVRA 2NXUA 3BZQA 3OD2A 3FUYA 4DV0J 3CIMA 3JSMA 2E1MC 1X5TA 2DNGA 3MEEA 4X4TA 4A8FA 4Z7YA 2GO9A 2VONA 1YLXA 5CA5A 2XO7A 4ID5B 4PYDA 4ZCKA 4ITSA 2CG4A 2DIVA 2KXHA 5J1PA 3NS6A 3RZAA 3D6TB 4FYDA 2C3OA 2UUAJ 4J9UE 3I31A 1EARA 3JSRA 4P74A 1W7WA 2RMLA 1KFSA 3TNVA 2HURA 3MM8B 2G9OA 1QE1B 3C6UB 3UVJB 2BR0A 3MPUB 4DZDA 2FVCA 3IBCB 3MHYA 4YB6A 4WYWA 2XGPA 4C48A 4Q0BB 3W5YA 3MR6A 3I55S 1J27A 4FZVA 3W2WB 3BKFA 4X62F 2JC0A 5A8RA 2UUCJ 4UOCA 3KK1B 5KG0A 4QWEA 1Y9OA 4B3SJ 3BYPA 1OJ4A 3DGPB 4LBIA 2XMWA 3H2UB 1NH7A 2CIMA 4OIXA 1XJWB 4N7TA 3CC7S 4M5DB 1HPZB 4B3TF 5AT1B 4J9NA 3LA0A 2N4CA 1QAXA 2X51A 2N7YA 3T5HA 3V4IA 1V3ZA 1QD1A 3B54A 1S1TA 2B9YA 1IKXA 4PXBA 4IQXA 1H2UX 4XDCA 1DQ9A 4RW9B 3P5BP 4DN9A 4ECTA 2EC0A 2ZH1A 2F8HA 4J9MA 4ED6A 2I9SA 4K4UA 1WJ9A 2PFFB 4U67Q 2XBPA 3O2IA 5LXRA 3ZZZA 3CJ2A 5T7LB 1TV6A 1KQSR 4J9KA 3CVKA 4NMLA 2BEFA 2R3VA 4L74A 2ZVSA 5L9NA 2RF2B 1UVNA 3L3CA 4TNOA 1S99A 3ZZYA 1PILA 2C2OB 5B08A 4NA2A 1H73A 2XMTA 3OUYB 2V34A 3MM7B 3KLIB 2KXFA 4Q43A 2HRYA 1FKPA 5A8KA 1F3FA 3HHLD 2EG1A 1LWCB 3FCHA 2Z0GA 2DO4A 1N54B 4ECQA 4C8KA 1KKHA 2CQPA 3JTNA 2V9WA 2D3OR 5BYRA 2CUYA 3M6VA 4DX8H 1TUWA 2V8GA 4NXNJ 1UKUA 4XK8C 2YBVA 1FRXA 3MDFA 1WOSA 2W2PP 4ALZA 3H2VE 3SDEA 3PDNA 3TZZA 2DR9A 4ZPTR 4FVCA 2HKEA 2VFUA 4YB7A 4NZ6A 4MJKA 4WIQA 4G65A 5DQGA 4CIOA 4TLRA 2YH1A 3HHLA 3PFEA 3HZEA 3VVTA 3V6DB 4CO5A 1EP4A 4HACB 2IJRA 1SV5A 3PEHA 3RG6A 2DNYA 1VJWA 3HD1A 2XYHB 2HQGA 4KSEB 1Q81T 1HWIA 2J5AA 3M2UB 1VQPS 3N0VA 4OZ1A 3P6YC 2H4YB 1TELA 1DTTA 4IG0A 4AXJA 4KC5A 1QSSA 5KFFA 5FIIA 4JP8A 1LEOA 5KFOA 4M5LA 2FLNA 1DRZA 3HVTA 1I94J 5L39A 3KTQA 2QJ3A 1ZAVA 3HK2A 2V6AA 1PJ6A 3OPKA 2V63A 1UWAA 2XZTB 1Z2LA 4FN5A 2QV6A 2ZH6A 3L9ZA 4FYWB 3OR1A 1YJUA 3GCWP 1VIOA 3R27A 1U2CA 2IDEA 3OTOJ 5KFVA 3Q2SC 1E6VA 2HFSA 3GG0A 4LF6F 1WI8A 2MKSA 4NCGA 5U47A 3ICLA 1R43A 1IN0A 4G1QB 4ZVQB 5LXYA 1T94A 5CABA 3DHXA 1FERA 3IBWA 3AODA 4FPIA 4JV1A 4EBCA 2G1HA 2G0IA 2RD5C 3W7BA 3UDEA 1RAGB 2PSZA 3EGWB 4I6AA 1XQIA 3C66A 2ADCA 2CAJA 5DGAA 3UE2A 4DV4F 2XLJA 2FLLA 1Q4RA 5G0RA 3TUPA 2MEWA 2CXEA 4A8MP 5FD1A 1S6QB 4DQPA 2XSJB 2HHUA 4ECVA 4OZ3A 2R7SA 4RW8B 4IOCQ 1RYSA 4DDFA 4X64F 4P71A 4P73A 1URRA 1KR4A 1M0SA 1HBNB 1NJWA 2HSEB 4DV0F 1IJFB 3T9NA 5DQIA 4NLOA 3W2VB 2GMHA 3E2EA 3TAMA 3GZ7A 4LFCJ 3O5TB 5KFSA 2R7QA 4FBTA 3KLVA 2UUAF 4CLSA 2BOPA 2HK3A 1NZAA 2ZOFA 1N0VC 4RW7B 2LXFA 3QJPA 4A8QA 5LMNJ 4V1Ak 5IV4A 2HLUA 1KNZA 2FC8A 4F0HA 4OHXA 2H54B 3A1YG 2BQ3A 3BO2A 4JI4J 3C6TA 2UUCF 4Z7CA 3FK4A 3PFOA 3EM1A 1N6QB 4ZOSA 3J80U 2P9EA 2U1AA 2NREA 2B6AA 4B3SF 3PJ9A 4P2SA 4Y0FA 1MNEA 1IVZA 1WSVA 2DGSA 3I5AA 5E5NA 1FVQA 3M6WA 2KG0A 3D6HB 2EVZA 4LF7J 1RTHA 2XMJA 2HQIA 1KOOA 1SJ1A 1N8RT 1S6PB 2XGQA 2NQPA 4RNMA 1IBMJ 5KFIA 2D41A 4CH1A 3ZNJ1 5KFDA 5IC4B 4M5MA 4C8OA 3CCVS 1RUSA 1FRLA 4A48A 4TXSA 3GWCA 3B82A 1GK8A 2AF6A 4CO4A 3I32A 2XMVA 3HLUA 1BLUA 2MHEA 4ATNA 3MEDA 3S01A 2CPJA 1IKVB 2IA0A 3HKWA 4FF4A 3ETMA 1NK8A 2QLBB 2KDOA 4DUTA 3EZUA 1TL7A 2V8DA 3ZXWA 4DR5J 3BJYA 4RPFA 1RHRB 1I5OB 2V5HG 4LRDA 3RBEA 2MKHA 2KN4A 1ZA2B 5AJ3J 2ZJRQ 1T3NA 2KJVA 5K8PA 1VYAA 1E6YB 3SQGB 1CVJA 3VAMA 2QIFA 1FX4A 4BWJA 2RVJA 2YNIB 5D4PA 4NLSA 2MZ1A 1Y5IB 1SC4B 1Q7LB 2BJ8A 2WAQD 4NXNF 2QSFA 2MXYA 1G6BA 1M5HA 1XIQA 5IT9Y 2DK2A 1FEEA 3DRRA 3R6GB 3C15A 2CQIA 2XYPB 2GC8A 2CQHA 2V2ZA 2CJAA 4C0HA 4LF2A 3MF5A 3MMAB 2K7JA 4TU8A 3G6VA 5HJXA 2KTQA 3LGHA 3NGKA 5A76A 1ZAXA 4EYIB 3MM6B 3HI9A 1JLQB 4JV5J 1C0UB 2RE1A 1NH8A 4J9RA 2HNYB 4O4RA 1M1KT 3A3PB 1UVJA 1H7WA 2LDIA 1U26A 5KFJA 1DFDA 3I4PA 2UVRA 4ER8A 1U25A 3EDQB 4PG4A 4RW6B 3AH6A 1C1BA 4YR2A 4MKBA 2GVZA 4PQUA 1WNEA 4N8NA 3AOBA 4NLQA 3CDWA 3S7RA 1MROB 1U1OA 1ZM4A 3A12A 3RRGA 4JI3J 1K1SA 1X8DA 1I94F 4FXWA 3P96A 5K8MA 5LOQA 3M9NB 2H3EB 2J0XA 4H4KC 3ZZRA 3MAAA 1FFWB 3GB0A 1JXLA 2W2MP 3L7UA 2G2YA 3TVYA 4YY3J 3OTOF 2CRLA 5DS7A 3LPEA 2ZH8A 4IUFA 1UJ4A 3OL9A 3B4DA 3D68A 3NOCA 2XHWA 3E51A 1RWVB 5FLXY 3NEKA 2KVIA 4OI0A 4QWDA 4ECUA 3PX4A 4CQ1A 5E0OA 2HNDA 3QPIA 2A18A 2CNLB 1IBLJ 4I2QA 1MU2A 1RGVA 1RTIB 2M5YA 3CD6S 1SQGA 4ZP7A 2PEHA 4EBEA 2AJ1A 1RWKB 4YR3A 4P6QA 1HNIB 1NDLA 4Q2MA 1JXVA 5ETMA 2VBXA 2XS5A 3T5JA 1ZBTA 3KHGA 4CH0S 3O6QA 2JEFA 2DNKA 3BSOA 2HNZB 1T7PA 3DM2A 2FVPA 4A46A 4B02A 5ETLA 1SBRA 2E9TA 4MH8A 3NRBA 2FUG9 2FJBB 1UPPA 2DKOB 3CW2C 2XTJP 3US5A 5B0GA 1RT3A 4DN0A 3DOKB 3QAUA 1XNRJ 4LFCF 2KM8B 4USWA 2VQEJ 4RBVA 3UCGA 4NXMJ 4NA1A 2BV3A 2AMCB 3NCPA 1KLMA 3M8PA 3EX7B 4EO6A 1WHXA 3EVOA 1RWNB 2Y1IA 1QJHA 4I64A 5LMNF 4E98A 4ERDA 1OY9A 2H65B 1Q0NA 4TU9A 5DLGA 1NUEA 1KFDA 1BWVA 4NCAA 1TVRB 2VV5A 1BQNA 1Q5YA 4N5SA 1T0TV 3SSSA 3JSMB 3DRYA 4FF3A 3MEEB 2FDNA 1L3UA 3TUIC 3FCWA 2HGLA 2LU1A 5ETTA 5L1KA 4FP9A 1KC8T 2IYGA 3HHKA 4OI6A 1ZZFA 3PW5A 4LF7F 2XO6A 5HJYA 5BYQA 2PI5A 1CJVB 2XZWA 1YGYA 1R31A 1FRMA 3EPGA 1F5AA 2LQJA 2YNFA 3OXGA 3B6BA 4JI1F 1DQ8A 1GH8A 4BDPA 1KVIA 1IBMF 5HI7A 1UETA 4EZ9A 4ANCA 3PJWA 1NHKL 4USUA 3WBZA 1UEKA 3DMJB 2KO1A 4CNZA 1QM9A 2YKQA 1C0TA 1MMNA 5A8RB 1HWLA 2QN6B 3R5CA 4M5IA 5EGYA 4JUZA 1R0BG 3JTPA 5KFBA 4PG7A 4B9UA 2AGPA 4B9LA 4I56A 4UQGA 3J81U 3CE8A 3BF4A 4PUOB 1S72S 1JLEA 5I4MA 4EWTA 4QBUA 3CCUS 4OYXA 4DR5F 4WFXA 2G2OA 2HBZB 4LIRA 5AJ3F 2QFJA 3RBXA 1KTVA 3MZIA 3V5RA 3D3BJ 4PXCA 1S1TB 1IKXB 2EBGA 3HVWA 3O8WA 3BPSP 3ZZUA 2MQOA 5LJ5Y 3SMZA 2CQ4A 1YJ7A 2ACMA 4WFZA 3GJTB 3MTKA 1HNXJ 4B9VA 4ZPWR 1NJXA 3DOLA 3JQKA 1KHWA 2GIQA 4CP5A 1VFJA 4F26A 4R5PA 4P10A 1XN9A 2UUTA 3KK3A 3MUMP 4MFBA 4JV5F 4ZVPB 4YUDA 3RTVA 1IQZA 3GU0A 3TA2A 3TW0A 1FKPB 2VFVA 4HH0A 5E3CA 2WSEC 2VU5A 2HHWA 5HK4A 3MD3A 2W2QP 4OJ1A 2PMZD 1R8BA 4LUBA 2ZJQQ 3RAQA 3BKTA 3MUVP 4ZP6A 1KD1T 3BGFA 4WKYA 4O4GA 3SDEB 4CLUA 1U1PA 2AV5A 1NRKA 4QIFA 4P9SA 2DGVA 2QL7B 3FBCA 3Q8UA 2CA9A 1RBAA 1YRXA 3MURP 4CLYA 4MKAA 1VLYA 1UZDA 2LQBA 2RJZA 4DU8A 3GV8B 3I0SA 3HHLB 3L95X 1KDNA 2FPHX 1FJ7A 1X0FA 1SV5B 4DBQA 1FNMA 3EICA 2QL9B 3DDIA 4F4XA 4YY3F 5T14A 1VQ5S 1HHSA 2KHCA 4Z2XA 1S1XB 1FE4A 2UVUA 3O3LA 4IG0B 2EFNA 1RE1B 4EUVA 4RBTA 4ZKAA 4DSLA 4USVA 3EMTA 3JAMY 4I7FA 4LRAA 2VDIA 5ETRA 2LEBA 2JLEA 2D3UA 1ZPVA 1WDTA 3IA0A 1YBAA 2HGMA 3HVTB 1IBLF 1VHIA 5E41A 5L8RC 3P45B 4PWDB 1RT1B 4JYAJ 4DSIA 2DR6A 4ECRA 1NPKA 1JJ4A 4Q8FA 3GR1A 4E2FB 3A3NB 4UUWA 3LW5C 5IT4A 2LEPA 4RUBA 2I38A 1X31C 2QA4G 1CPZA 3BDPA 1JLGA 3KMSA 2X1FA 3M2VA 3PRBA 3BO3A 1RQ0A 2RB7A 3DLJA 3V6HA 4ZPVR 3QT6A 2EKNA 1XNRF 3VVUA 2VQEF 1D8YA 2E1AA 5J1NA 1F0XA 4CI0B 4NXMF 3H5YA 3N6LA 2D74B 2E29A 3CSKA 2IA6A 2WW8A 5J2PA 2CQDA 3LWLA 5A2QY 4IRDA 3TA1A 4MIWA 4DFMA 4IKAA 1YZ7A 5LSRA 4LBPA 4K59A 4NLWA 4QZVB 2IC3B 2DCUB 5JXSA 4F7VA 3AT1B 2RSQA 1AYEA 1YHQS 2UVWA 4NASA 1LK5A 1JLAA 1U2FA 4GKKJ 1G4CA 4V19J 2XHCA 2V4JB 4OZNA 1MLAA 1TL1A 3M6XA 3DXSX 2BJ9A 1EQMA 2CQGA 3TAMB 4ANDA 2E5IA 1JMTA 2QE5A 3QGHA 1PYSB 3MR5A 1CJTB 5E3QA 2DR8A 1WC5A 4DOZA 3S6EA 3HULA 1UP1A 4UQTA 3G82B 2XMAA 4ZMMA 4WXOA 4F4KA 3CJKA 2LXIA 1HBUA 3G9CA 1B7FA 4C8LA 1LWEA 3AXMA 1NKCA 2ZC3A 2WVBA 3JSBA 5E2QA 3U1NA 1EQ0A 3ET6B 3C6TB 3OTDA 3EJMA 2X7IA 2XSFA 1N4LA 4TY9A 2JNJA 1TKDA 3OTEA 1R7IA 3TZWA 3FNNA 4ECXA 1XBWA 1RTHB 2DHHA 4KO0A 2VG7B 3TOQA 4O3OA 3V2UC 1JNZB 1JNRB 2GCFA 1IJEB 3CD0A 4H4OA 5B0AA 4Y34A 2XB2D 2OEKA 4OMFG 1P27B 4F3QA 3IRXA 5KG1A 4F2SA 2PDAA 4DL6A 1C4CA 4QPXA 1HNXF 1GTEA 4TKTA 3PYFA 3W62A 4RO0A 1HNZJ 4NI2A 2YVSA 3HVRA 1ZA1B 3D1QA 3VAGA 1SKSA 1U0SA 3VZIA 1RU2A 2A6MA 1D09B 4JOUA 3DYAA 2KJWA 3OVSA 4NYPA 4K8RA 3PHEA 2BA9A 2HHQA 2YQ1A 4BS2A 2DVIA 4WP8A 1RKJA 3BBBA 4CNYA 2FHJD 5CD4H 4ECYA 4O0NA 3PYEA 4YDXA 3VF0B 5J1EB 1M5PC 4CTAB 2PFDA 3CCLS 1H7XA 3TI0A 4KPYA 5E3AA 3N79A 5CQGA 5DQHA 1MG7A 4DPUA 1OPZA 3DRRB 2QLWA 1VIXA 3C15B 4QW8A 2DNPA 3TRGA 1QSYA 1FEHA 3DLKA 4DV2J 5KFWA 1HI0P 1HFEL 2KHDA 2D3O1 3VZHA 1S9GA 1R6YA 2J9CA 1TKTA 1S7HA 2WRMA 2QMXA 1S0NA 1QTNB 1Q16B 4B3MJ 3IXQA 3G4SS 3Q22A 4Y2KA 2FHJA 2OP5A 5D0GA 1I6JA 2VFRA 4KBIA 4N77A 4DPWA 2B5JA 2MQMA 3F73A 2OPQB 1NLKL 2DEJA 4PR6A 3IR6B 1C1BB 3HVAA 2GJ2A 2GVZB 4ED2A 3T1YJ 4JI5J 4PQUB 3ZNUA 2J8SA 2CWXA 2HVEA 1H3DA 2FIUA 1OIAA 3FBFA 4DI6A 3O44A 3QO9A 4URQU 1O8BA 4HEA9 3K5MA 3DDKA 1WOOA 3AY0A 2RILA 3HF5A 5D4NA 3G8TA 3GIKA 4JYAF 3MAAB 2GGPA 2HWTA 4JI0J 2ZJPQ 2NSCA 2B7CB 1FE0A 1OS5A 2EC2A 4AL7A 1HBMA 2KYXA 2IYIA 3MWBA 2VJVA 3C3LA 2HMIB 2EW9A 5IXUA 3BQ1A 1CEZA 2GS8A 5HAOA 2N3OA 2WVEA 2ZBPA 2OKQA 4ZPAA 3WX4A 3Q8RB 2XMMA 1PC4A 3Q2TC 2HNDB 2LKZA 2AQ4A 2F9JA 4I2QB 2VF3A 3EVWA 3K2YA 4EO8A 1HI1A 1V3RA 2HQDA 4LJMA 1MU2B 2GMLA 1FXDA 3NNAA 2CADA 4PKDB 2AWZA 2GIRA 3R2DJ 1F9EB 3J81j 2B9EA 4ID5A 5K5MA 5K20B 2L48A 4NOHA 1WKLA 2PI4A 1CULA 4CZCA 3WIVA 2QT7A 3MUTP 3G96A 1NZ8A 4LRCA 2BZ2A 3MM8A 4EU0A 2GX8A 2BOAA 4KHRA 7AT1B 3X1LB 1FJGJ 3GIJA 3DM2B 4Q0BA 4ILRA 1CJKB 1PYTA 5AXNA 4GKKF 2MZRA 3W63A 2CJBA 1PCAA 3W2WA 5JVGQ 1SL1A 4ZDNA 4I1TA 4WFNQ 3AOAA 3KK1A 1SL2A 1RT4B 4I69A 1RT3B 4NLGA 3WX8A 3AXKA 5JJBA 4Y65A 1IWAA 2MYFA 1VC0A 3DGPA 2HWIA 1TL3A 1VQNS 2MKIA 2CWKA 1N5TA 3HSJA 4WYLA 1RWWB 4KR0B 1KLMB 3M8PB 2I0XA 1HWKA 3D67A 5J2NA 5AXMA 3W3SA 4XDDA 5GAEI 4MK9A 1S59A 2ZD1A 3RYLA 4URGA 3BR8A 4EK2A 4USKA 2IVMA 5L46A 2OPRB 3R5GA 2OIHA 1FTRA 2IHR1 3SXLA 1HW8A 4Q5VA 2AGOA 4OZJA 3HFKA 5DZ6A 3DN9A 3D3CJ 4ZP8A 3H40A 1CSJA 4PG5A 2QYCA 2HRUA 3K17A 2MQPA 4RW9A 3VAIA 1RCOB 1S49A 1Y10A 2KFYA 1JK9B 4J9PA 3EZOA 2B9XA 4FPRA 4OV6A 4XAKA 3N6MA 5DDRC 2DRBA 4Y00A 2DGUA 2I5JA 2XMKA 4QWCA 2JDJA 2ERRA 3PM9A 2LLZA 1S5ZA 1U49A 2K8GA 3U1LA 5HMZA 5CXTA 2BE7D 4F4ZA 2Q6CA 2R2RA 5CYJA 1S4EA 5KTQA 3NP5A 3HHDA 2RQKA 2V4QA 4C97A 3NGSA 5C25B 4PG8A 2J7UA 1LNQA 5AE3A 3AD7C 4ZN3A 2VICA 1C0TB 3ZTRA 4ZCIA 3NAHA 5H9FK 2DBBA 4FVMA 4Y6IA 1LV5A 3AQPA 4NEYA 4S0MA 3LP1A 1HNZF 1MMLA 3PVXA 1U24A 5RUBA 4Y28C 5BXIA 4J7CA 3GSIA 4PXEA 2ALYB 3CD5A 2C2EA 4IH5A 1JLEB 1S7IA 1RT5B 1YJRA 2VKZG 1YI2S 2NXCA 3PW2A 2F63A 2F9DA 4M5GA 4OJGA 3TR5A 3MCSA 1DHMA 3OLBA 2J9DA 4DR4F 3KG0A 2DNMA 2BE9B 3D54A 2BABA 2VOPA 2OD4A 2EBEA 4J9QA 2XWYA 2ROGA 4DCOB 2MZJA 3N9UC 2AEJA 5EX3A 1UA1A 5F3ZA 1Q8BA 4P52A 4WWSA 1N0UA 1P1LA 1T02A 4KHPJ 2MJNA 4DV2F 2HS3A 3DOLB 3A3OB 1S0VA 1UA0A 3IRWP 1JKHB 2P6TA 2J0QD 4R5PB 3W5XA 4N76A 3KK3B 2DHSA 4MFBB 2FJEB 2Z8QA 4B3MF 2W4PA 1VBXA 1ELOA 3ENVA 5IQQA 1NEEA 1NSQA 3I82A 5IT9U 5I42B 2UV8G 4CRJA 2XYGB 3HPOA 3OVAA 2BQRA 2AYMA 2P2CB 2V2QA 1VRUB 3TUJC 2DCLA 4KKOB 4ZVOB 4U6PA 2YWWA 2ADBA 3LTOA 1OMSA 2DR7A 4JI5F 2YQ0A 2MLXA 1PIEA 1NK7A 3UQSA 1XNQJ 4O4GB 3CJ8A 5D77A 2KRBA 4I0WA 2N3LA 2AYGA 2ZVIA 1K73T 2BXJA 4AE5A 3FEXB 1O51A 1NPPA 1HQEB 1OO0B 4X4PA 3I0SB 1UFLA 2Z56B 3MAHA 3GFYA 2YKAA 2WSCC 4PWUA 2JEIA 1FNOA 1LFWA 4DR2J 2WZ1A 4JI0F 1FXRA 3TJ8A 2BVZA 4ZIWA 2APOA 2VQFJ 3BSAA 1PBAA 1BHNA 1YJWS 5F8JA 1R89A 3D6FB 4J5OA 2ZBQA 1XMBA 1FI4A 3QIPA 2XSJA 1N5YB 1Y3JA 3GIIA 4O44A 1HBNA 2PA3A 2LECA 4BBYA 2HGNA 4K5RA 1U09A 4KV8A 1ZM9A 2BKPA 4ID8A 1CS4A 2KZMA 4QIWD 4GKJJ 3GYXB 3FMWA 4DFPA 3THPA 1TK0A 5C2CA 4HDHA 5FLXU 3J7A1 3DC2A 1QLNA 3OFEA 2Q1LA 3Q24A 2AEMA 1BE4A 2JRSA 2WONA 2V8VA 4QWAA 3Q89A 2PGCA 3H42A 4DZ6A 1N48A 1HARA 1IUJA 4RW7A 4LSLA 3K5OA 5LL6d 1FJGF 1JLGB 1RAOA 4RUAA 2B51A 2FQQB 2B4UA 1APSA 2YPZA 3RU0A 1DZ5A 4IOBA 3M2VB 2H5IB 2C3UA 2XLKA 2NCKL 3RW7A 3MFIA 3Q0AA 3QT8A 4CLLA 2R7TA 2W8LA 3CPWR 2H1YA 1CJUA 3OT9A 3C19A 4ZVEA 5ETOA 2YNHB 4W98A 4NZ0A 1TK8A 2R2SA 4DHVA 5J2PB 1B70B 2P8IA 3JYTA 2FHOB 2VUGA 3UN3A 3T5LA 3QGIA 2R2TA 4USHA 3J81Y 2Z58B 2CPYA 1G1XA 4JI6J 1RHMB 3IC1A 3BGUA 2KT2A 1JLAB 3C14A 1GEHA 1HNVB 3DLHA 2VFSA 4HI2A 1TL1B 4DU7A 2GNKA 2JSXA 1LWFA 2AYBA 5AE1A 1MN9A 1VRQC 4DL2A 4CO1A 1OYEA 5BJRA 1IKVA 1N88A 2G0JA 1C4AA 3CCQS 3KG1A 4UW2A 4A8KA 3V81A 2GVDA 1S6OA 1T05B 2NUHA 1R27B 4WP3A 3CJKB 3H25A 2KM8C 2IFXA 1WEXA 3TO8A 1HBUB 1IBCB 3CJ0A 4CM0A 4K7QA 3DXBA 1LW2A 3QLHA 1RAJA 3ILJA 1Q78A 2QL5B 1WC1A 3NOGA 1VDHA 3M8YA 1N56A 4F2RA 2J6TA 2E9RX 1J5EJ 1WUUA 2RNEA 5KT3A 1X4HA 1DQAA 3DHWC 2KB2A 4QYRA 3CCSS 1WOPA 1X9MA 4KO0B 4ZVFA 3TAQA 3LP0B 1GNKA 3DRPB 2W9CA 1X9WA 3P4UB 2HK2A 4AUKA 1F60B 4G1IA 5EWEA 2LXUA 4IDKA 1FA0A 1P6TA 1WC0A 5D0EA 3OXFA 1AB8A 4H4OB 5IS2A 1LWXA 2RU3A 2BM0A 3IRXB 2HFOA 1C2PA 3DDNA 1T8EA 1X4GA 3PRVA 3BH6B 1T9WA 2WTFA 2B8QA 1D3WA 4KHPF 3BYRA 4HTIA 3DRSA 4BCAA 3MGJA 2EKYA 4IH7A 1HHQA 1KLNA 1VQKS 5KFMA 3UCUP 1QVFR 3A13A 5HQLA 3DYAB 2ZBIA 2HS4A 2GW8A 2UP1A 4YMEA 1X4CA 4K4ZA 4N47A 4LF4J 2BJ1A 5KOXA 3JTOA 1HR0J 1H0HB 3IP0A 3F44A 5KFZA 2JOQA 1FXLA 2CJXB 5HMWA 4L75A 4LRBA 3V6JA 1FCAA 1N36F 4LSZB 4WFYA 5A6WA 4M8LA 1FKOA 2IM2A 4DUYJ 3IAS9 3RAMA 1XNQF 3FBEA 5KAKA 4L3NA 1J5OA 4JB8B 5L9XA 3DLKB 3RAXA 4DPXA 2FVQA 4C98A 3WQPA 3G87A 4F8RA 1FWPA 3SCKE 3MCMA 5DZ7A 4QPTA 2V8HA 4ANEA 2PC6A 1CG2A 2QC3A 5CCLA 5LSLA 3VAKA 1TKTB 5LSOA 2L9WA 3NMRA 5IM0A 1PBUA 2IJFA 3BQ2A 1U8SA 1PC5A 4OL8A 2HHTA 4AQYJ 4FNHA 4DR2F 4WXWA 3C16A 2ZWPA 3ZTSA 2B5JB 4UF4A 3EDRB 2VQFF 1WTBA 3E01A 1V5VA 1SL0A 1K47A 2L9NA 4MKVA 2FJDB 4GO7X 4DV3J 2IJNA 1JJCB 4KGZB 1TUGB 4A4JA 2OI2A 3AB4B 3QO9B 3DLLQ 3QRQA 4CLTA 4ZVGA 3ZC4A 4CLPA 2YXLA 3QAEA 3K7RA 5E3RA 4OFZA 1HLWA 4OI2A 1EX8A 1NHUA 2C42A 4HVZA 4GKJF 2QRRA 1VQMS 2MSSA 4RNOA 2MMYA 1UWBB 5LJ3Y 1ZAWA 3JAMU 1NJIT 3HO1A 3HHLC 1X5SA 3OXLA 2HIQA 4NE9C 2HRTA 3GQCA 2C22A 4NLYA 1BUXA 5LM7E 2DISA 3U02A 3G8QA 3J7YU 1B0VA 1PO6A 2KZZA 1GX6A 2BQUA 3KDNA 1H2VZ 4P72A 3OJUA 1SQEA 4X64J 1OY8A 2QEXS 2ZEJA 1M5OC 2BANB 3HJFA 3HCXA 1W2BR 3MR3A 1P9QC 5KG7A 4DUZJ 3CWJA 3ZTOA 4ZVUB 4J91A
chains in the Genus database with same CATH topology
1JWWA 1KHWA 2W7OA 5EHHA 3JSYA 4IFVA 1FESA 2GIQA 2C3MA 1VFJA 4F26A 2VFTA 4HTJA 4R5PA 5IZHA 2W4DA 4C11A 4DMZA 4ECSA 1XN9A 4F25A 1VC6A 2UUTA 3KK3A 3WC0A 5K8OA 1AFIA 3MUMP 2WHOA 4MFBA 3W2VA 2IAJA 2EPIA 3KG4A 2AP6A 5EDWA 4QU6A 4JV5F 5J2QB 1F5BA 2QSWA 4YUDA 1IQZA 3RTVA 3RRKA 3KNAA 1X4AA 3TA2A 3TW0A 1FKPB 2VFVA 4HH0A 5DO2A 5E3CA 1GT8A 4QIVA 1AW0A 4ICLB 1DJ0A 3BS9A 3HHEA 2V0NA 2GQ2A 3G71S 1LKZA 5JVHQ 1ZTTA 5IFMA 5CZVA 2WSEC 3AA8A 3UDLA 4XPCA 2HHWA 3MD3A 5IQ6A 2FD2A 4OJ1A 2PMZD 1KQKA 1R8BA 4JI6F 3CGIA 4LUBA 2DNLA 2ZJQQ 1X0PA 3DMJA 1U1KA 2DNNA 1G3OA 4BWMA 2CPXA 3RAQA 5KFCA 2VODA 3MUVP 4W92B 5HLFB 3K5PA 2ZDPA 4ZP6A 3RR8A 1KD1T 2VH7A 3OQ2A 3MMBB 3IG1B 4GMKA 3BGFA 3CCTA 1XC9A 2KXNB 4WKYA 3Q8SB 1URNA 4O4GA 3SDEB 4C7QA 4Q8EA 1UJ5A 5G4DA 2CPFA 2P9GA 1U1PA 2AV5A 1NRKA 2CVEA 4YB5A 4O3RA 1M5KC 4QIFA 5KG6A 1TL3B 2DGVA 2V4RA 2RRBA 3PR5B 4C8MA 1ROFA 2FJAB 1GXLA 3G86A 3NLCA 3AHPA 5KT5A 1DLOA 5E3PA 5CYQB 2DIUA 1P8GA 4F4YA 1UWBA 1YRXA 3MURP 4PUOA 1DTQB 4MKAA 1YJTA 1GXUA 3OSPA 3ZZTA 1VLYA 1SH3A 1TQLA 2LQBA 2O1PA 2YWGA 4ES2A 4PRFA 2J9EA 1A9NB 5J2NB 2N82B 2RJZA 3UR3C 3GV8B 1N6QA 2MHNA 3CXCR 3I0SA 2PD1A 4I6WA 3KLFB 3HHLB 4L6V3 2ZD1B 3QWPA 4OJHA 3L95X 4IFYA 4TU7A 2COLA 1V3SA 2QA1A 3OFGA 2FPHX 2KT3A 2PA8D 1FJ7A 1X0FA 1SV5B 1Y4ZB 2PO4A 4O0IA 4RU2A 3FQKA 4MYTA 1CC8A 3DOMA 2VC1A 2MJUA 4DBQA 1JB0C 1T03B 1FNMA 1VRTB 1HWUA 4JBCA 2QLXA 4NPOA 3T9ZA 4F4XA 4YY3F 5T14A 1NK4A 4NLUA 4ED7A 3MFHA 5GADI 3GILA 3H5XA 1VQ5S 4KFBA 1HHSA 4WCEQ 2KHCA 4C8ZA 4Z2XA 1S1XB 4OX6A 1FE4A 1UVKA 1KVJA 1VK3A 4UY8T 2G13A 2UVUA 3O3LA 3GR0A 3MR2A 2BJDA 2VPYB 1U2RA 2V9KA 3QJJA 4IG0B 5IWAF 1S6PA 2EFNA 2JLGA 2D1CA 2JFDA 1H38A 2UVVA 4EUVA 1QUPA 4RBTA 3CJ3A 4ZKAA 1N5SA 3KYLA 2BANA 4DSLA 5D6GA 2VB6A 3I5CA 1R3NA 1J5EF 4KGKA 4WK3A 5L1LA 2CPHA 3ENQA 1UEUA 1WELA 2JC1A 3CDUA 2AJQA 4AYBD 2RUGA 3JAMY 3NBPB 4I7FA 2LEBA