1J5OB

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
total genus 99
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oB03
4EBDA 5HROB 4K4SA 3HHKA 2IJFA 5HLFA 4KFBB 4WYLA 4G1QB 1TQLA 4KFBA 1GX6A 3LP1B 1HPZA 4TYAA 3H4BA 2DPJA 4IH6A 4ID5A 4NCGB 4K4XA 1FKOB 4ZVFA 3NBPA 1IM4A 3KHRA 1RT5A 4RUCA 1TVRA 2YNFB 5KFEA 3KHLA 2BQRA 3V81B 5L1LA 4TY8A 3TQ1A 5J2QB 1S1TA 2HNZA 2FVPA 1S1XB 2ILZA 4YP3A 1JIHA 1IKXA 1CSJA 5KFWA 2OPQA 3KLEB 5KT3A 1S0OA 2R2RA 5F8NA 3PR4A 2J6SA 2ATLA 4RW4B 4IFVB 4U6PA 5J1EB 1C0TA 1TP7A 3QGIA 1TL1A 3KOAA 2W8KA 1D0EA 4KV8B 5DQIA 3T5LA 3KK1A 1JLAA 1HNVA 4I2PB 2OPRA 3BREA 4J9SA 2OPSB 4I2PA 1HNVB 1QE1B 3SFGA 3DLEB 3OL6A 4HYKA 4J9NA 2FLNA 2R8KA 1NHUA 4O3RA 2E9RX 1C0TB 1DLOB 2R8HA 4H4OB 4RU9A 3OLBA 3DRPB 4KAIA 3T19A 3V6HA 3ISNC 2HMIA 4RW7A 5JXSA 4JV1A 4LSNA 3MEGB 1RT3A 1R0AA 1IKXB 5C25B 3V4IB 1JLQB 3DRRB 5KFRA 5KFJA 1OS5A 4TQSA 5KFPA 1S10A 3H2LA 3V81A 3EPIA 4DL3A 3M8PA 3IRXA 3KK2A 3RBDA 1S1VA 2IAJA 5CYQA 3CO9A 4RW9B 3PW5A 3N6LA 2ZE2A 1S0MA 3FRZA 2XCPA 4YR0A 5F8IA 4GC6A 3PW7A 1S48A 4JUZA 3C6UB 3KLGB 3DRSB 3LP0A 5K14A 4RW6A 4NLUA 3I0RB 5KFXA 3BQ0A 4XPEA 4TQRA 4ED2A 2FVSA 3V6DA 1JLAB 4H4MB 2IM3A 4O3OA 4NRTA 3I5AA 4ZPDA 3OLAA 4QWBA 3GV7B 4K4YA 2R2UA 4ECZA 4R5PA 5F9LA 4LQ3A 4ZPCA 4NLSA 2YNIA 1FK9B 1EETA 1JX4A 1RT1A 3KLGA 3DOLB 4IG3A 4IG0B 3MEDA 5J2MB 1JLQA 3E01A 4ED1A 3LAKA 1KHVA 2QV6A 4NLTA 4YMEA 3H40A 3CJ5A 4DEZA 4Y2CA 1QAJA 3BQ2A 4KKOB 3QLHA 4ED6A 2WCXA 4WXOA 1S1XA 1C0UA 4EO8A 4ZP6A 1GX5A 5KFVA 1S6PA 3Q8QB 5C24A 1MU2B 1TKTA 3FFIB 3I0SB 4KO0B 1HYSA 1JKHB 2XWYA 3KK3A 4MKBA 3GV8B 3QO9B 1N56A 3MEDB 1HMVA 5J2MA 2W9AA 3EZUA 4R0EA 2HNYB 2ASDA 3IS9A 4WZQA 4WFZA 3MEEB 3KNAA 4MIBA 5JUMA 2XGPA 1C1CB 2XI3A 3N6NA 2VG6B 3KK1B 4H4MA 4ECYA 1S6QA 1TKXB 2VG6A 1D1UA 4ED7A 3N6MA 1REVA 4ZMMA 4RW4A 3SI8A 2JLEA 1T05B 1N5YB 3E51A 3RAQA 2ASLA 5HLFB 4FS1A 2IJNA 1JLCA 3SFUA 4J9RA 2J6TA 4MIAA 1J5OB 4RNFA 1HNIB 3VQSA 1S0NA 3HKWA 4R8UB 2EC0A 3PVXA 2HWHA 4QWCA 3CDEA 5J2NB 5KFKA 3FDSA 4ECRA 2VG7A 1WNEA 1S9GB 2YKNA 3MR3A 3DI6A 5KFTA 1LW2A 1RYRA 4LSLB 2C22A 5FDLA 4H54A 2R2SA 1TV6A 4KBIA 3NBPB 3MTKA 1BQNA 2FJWA 5J2QA 1T94A 1HQUB 3CDUA 5F8MA 3RB3A 3V6JA 4MK8A 2HWIA 1DTTB 2B5JB 4LSNB 1N4LA 4OL8A 1S1TB 1JLEB 2HNZB 3DLGA 1RA7A 1SH2A 5KT7A 5EDWA 4ECTA 5HBMA 4KHMA 1SH0A 5C42B 4M94A 4Y3CA 4QW8A 3I5BA 3EPGA 1W25A 2V0NA 3MECB 2WTFA 5J1EA 2XGQA 5J2PB 3LP0B 2WRMA 2HNDB 2JEIA 4NLQA 4IQXA 4PQUB 1S97A 1IKYB 4NLYA 4ED8A 4IH7A 1SH3A 5KFDA 2ZD1B 2WK4A 4TLRA 5HP1B 1TKZB 1JLBA 5KFNA 4XO0A 2W9CA 4NYZA 4LSLA 3M8QB 3NGDA 4NRUA 4QWAA 3BSAA 3E01B 4K4UA 1SV5B 5KG4A 4IR1A 3Q8SB 2R2TA 1QUVA 2HAIA 3BJYA 5KFYA 3RB6A 3H59A 3NKYA 2YKNB 2ZD1A 4RW7B 2C2RA 4ZVEA 4RW8A 5FDLB 5KFQA 4EBCA 5KT4A 4YR3A 2W9CB 4TXSA 4MFBB 2D3UA 2IM1A 1RA6A 5KG6A 4WZMA 1C2PA 3H98A 1HQEA 4IDKA 4IFYB 3BGRB 1N6QA 3H5SA 2R8JA 1LW0B 1JLEA 4LQ9A 4O3PA 3JYTA 1SUQA 2W7PA 1LW0A 2RF2A 4B3OB 4HKQA 4ZP9A 3TAMB 2ZE2B 4KE5A 3MECA 2BE2B 4EYIB 2WONB 4FBTA 5F8LA 3QZ7A 2C28A 2RKIB 3KJVA 4O44B 4ECWA 2C2DA 3NL0A 3QLHB 2OPPA 5J2NA 4ZPAA 2D3ZA 4O3NA 4WXWA 4ZP8A 4DL4A 1EETB 3Q8PB 5EWFA 3T5JA 4IRDA 3OHBA 2E9ZA 1TVRB 1SV5A 3GQCA 4NLWA 4K4TA 3GIJA 5L1IA 2BQ3A 2VG7B 2D41A 2E9TA 1HPZB 3QZ8A 3KHGA 2YNHA 2XI2A 4QWDA 4MKAA 4O4GB 2WOMB 5KFLA 4URQU 4B3OA 5KG2A 4O3SA 3Q8RB 2HNYA 5F8GA 2GIQA 5KFOA 2QE5A 4WYWA 3QO9A 3DMJB 5HROA 5KFZA 5F9NA 4IFVA 3FQLA 5K14B 5DQGA 5CYQB 5KT2A 4O4RA 4FS2A 1VRTA 3MEEA 3HVTA 2BRLA 2OPQB 1RT2B 3KLEA 2D7SA 5C5JA 5C24B 1JLGA 4QW9A 3G6XA 2R8IA 4ZPBA 1IKVA 1HMVB 3OHAA 1RTHB 3KLIB 1TL3A 2AWZA 3GIMA 5D3GA 1TV6B 3KMQA 1KLMA 4IH5A 4EEYA 3LANA 2RKIA 1LWCA 3KJVB 3NAHA 1JLFA 4QWEA 1N48A 3ICLA 3DI6B 1RT6B 4I7FB 1YVFA 2FVRA 1RTIB 5EWGA 2XCAA 2ALZA 1S9GA 1IKVB 3OSPA 4RNMA 3DOLA 4IG0A 4NLXA 4J9LA 3M9OB 4Q8FA 4O3QA 3IGVA 2I1RA 3IGNA 1RTJB 4ZHRB 1S9EA 3OL8A 4EO6A 1RTJA 4ZHRA 1RT7A 1S1VB 2IAJB 3M9MB 3DM2A 3RB0A 2UVRA 5KFHA 1HARA 1NHVA 3D5MA 3PW0A 5L1KA 2AX0A 3T5KA 5KG5A 3C6UA 2R8GA 1DTQA 3FSIA 5DG8A 4IFYA 1S49A 4WFYA 4RNHA 3UR0A 3OL7A 5KFGA 4WFXA 4RW9A 4K4ZA 3KHHA 1LWEA 1TL1B 2AQ4A 3MR5A 1LWCB 2HMIB 4RZRA 3PW2A 5KFMA 3MEGA 1JLBB 3CJ0A 1RTHA 1Z4UA 5L9XA 3TVKA 5DG9A 5C25A 4Q45A 3V4IA 4ID5B 4NCGA 3G6YA 4IG3B 4EYHB 1XR6A 4ECUA 2YNFA 4ZVHA 1IKYA 4DL2A 3CVKA 5KFAA 4TY8B 1N6QB 3DRPA 1S4FA 4Q0BA 4F4YA 2OPSA 4F4ZA 3MR6A 3KLHA 2CJQA 4MFBA 3CDWA 5HBMB 4JV0A 3OSNA 4K4VA 3IS9B 1DTTA 2B5JA 2HNDA 2FVCA 3CJ3A 4DG1A 4NLPA 4ZP7A 4IDKB 5KG1A 5KFBA 2JEJA 2IM2A 3IRXB 3KK2B 3PHEA 1JKHA 2FLPA 1IKWA 3KLFA 3BQ1A 3PW4A 2VA3A 2IMWP 4PUOB 3GYNA 4IR9A 1KLMB 2XC9A 2IC3B 3UQSA 3GV5B 4IRCA 4ED3A 3LALA 3D28A 2B43A 4M95A 3TAMA 2RDJA 5DG7A 2AGOA 3CJ4A 2IBKA 1TKZA 2AGPA 2WB4A 1FKOA 3ITHA 5KT5A 4YR2A 2AU0A 4ZVGA 3IN5A 3ITHB 3DMJA 2FJVA 3IG1A 4I2QA 4ED0A 4DL7A 4TN2A 4YQWA 1RAJA 3G86A 2VG5A 3G6VA 3H5YA 2VG5B 2WOMA 4O4GA 3OL9A 1S9FA 3JYTB 3DM2B 3KLHB 3LP2A 2YNHB 4Q43A 2FJXA 3I5CA 3BSNA 4J9KA 5C42A 2BANB 1TKTB 2YKMB 1HYSB 5KFIA 3RBEA 1FKPA 2B6AA 3M8PB 2JC1A 4ECVA 2UVVA 3BSOA 4KKOA 2CKWA 4TYBA 2JEFA 1JLFB 2YNGB 1QAIA 5KG7A 2GC8A 5DLFA 3MR2A 1ZTTA 1RT6A 4KO0A 3H5UA 3HVWA 5I3UA 1JLGB 5D3GB 2UVUA 1LW2B 1RYSA 2FLLA 2VA2A 2IM0A 2B6AB 3UPFA 4KSEB 4PQUA 3QYYA 3PR5B 4K50A 1VRUA 3V6DB 4Y2AA 1C1CA 3LP1A 1HNIA 1RT4B 3RAXA 2AGQA 1ZTWA 4Q0BB 5KG0A 4ICLA 2YNIB 4MK7A 1K1QA 3CIZA 1XR5A 3GILA 4IRKA 3GIIA 2W9BB 4QPXA 5KT6A 4X2BA 3MF5A 4IKAA 1RT7B 3NMAA 1BQMB 5T14A 1C1BB 4FBUA 4JV2A 1S9EB 3KLVA 3CWJA 4URGA 5DQHA 1UWBA 3DRRA 1S1WB 1RTDB 3DYAA 4GC7A 1EP4B 1RTDA 3DYAB 3QIDA 1BQNB 3QIPA 4RNNA 4NLRA 3QIPB 4PWDB 2JC0A 1BQMA 1C1BA 3HVTB 4R8UA 1LWEB 4J9OA 1UWBB 3KMSA 4ECSA 1RT3B 2UUTA 3DRSA 4XPCA 1T05A 1FK9A 1N5YA 5DLGA 4RUAA 1DTQB 4WE1A 4KB7A 3C6TB 4NLOA 5KFSA 4G3IA 2GIRA 3PJWA 2W9BA 4F4XA 4EBEA 1HQEB 4KV8A 3DOKB 1DLOA 5I42B 1RT4A 2OH2A 3UDLA 1S1UB 3JSMB 3DOKA 5I42A 4I7FA 4ICLB 3BSCA 2V4RA 3RB4A 2RF2B 1QE1A 3MFIA 3DLGB 4KHRA 4WE1B 4K4WA 3KK3B 4Q44A 5DGBA 2W7OA 2IA6A 1HQUA 1KHWA 4PUOA 3PJXA 5KFFA 3DDKA 2BQUA 4URSA 2I5JA 5CYMB 1C0UB 4F4WA 4Q8EA 5DGAA 2C2EA 4IOBA 5F8JA 1XR7A 4PWDA 1S6PB 4TY9A 4J9PA 3QGGA 5KFCA 4F50A 3V6KA 5KG3A 1EP4A 5I3UB 2ASJA 2WONA 1IKWB 1RT1B 3KLFB 2V4QA 3DLEA 2JEGA 5HP1A 1TL3B 3KLIA 2BE2A 2J6UA 1NNDA 2DPIA 1JLCB 2BRKA 3PZPA 3M8QA 1JXLA 4RW6B 3DLKB 4DG1B 2AX1A 2OPPB 1RT2A 4H4OA 3QGHA 1SUQB 4MH8A 4R5PB 3FQKA 5EWEA 4MK9A 1S1UA 1REVB 3JSMA 4NLVA 2W8LA 1T03A 3T5HA 4DL6A 2RDIA 1T3NA 1T03B 5KFUA 1K1SA 2F8EX 3C6TA 3MFHA 3I0RA 3IG1B 2ILYA 1VRUB 2WHOA 3H4DA 3NAIA 4G1QA 3DLKA 3CJ2A 4I2QB 2FVQA 3M9NB 1RTIA 3BGRA 1MU2A 3FFIA 3I0SA 2UUWA 5L1JA 1R0AB 4J9QA 2O5DA 1RDRA 4RW8B 2BR0A 2V9WA 1LWFB 3BR9A 3H5XA 1RT5B 1U09A 5F8HA 3LAMA 1FKPB 1LWFA 3T1AA 4J9MA 4ECQA 1I6JA 5EUHA 3HVAA 2BANA 4U7CA 2I5JB 5CYMA 1MMLA 1S6QB 1J5OA 2YNGA 4NLDA 4Y34A 2IC3A 2UVWA 4NZ0A 3GIKA 4O44A 1S1WA 4DL5A 3LP2B 1ZETA 1VRTB 2ZKUA 3ISND 2OPRB 4ECXA 1TKXA 4NLGA 2YKMA 5J2PA 4RNOA
chains in the Genus database with same CATH superfamily
3OTCA 1CC7A 1CC8A 4EBDA 4K4SA 3HHKA 2ZDOA 4LBIA 3OR1B 3R5CA 3CCMS 4KFBB 3WBZA 6FD1A 3NOGA 1TQLA 2FGCA 2OEJA 4KFBA 1X5TA 3NGTA 1GX6A 3HO1A 1X4DA 2LQJA 4KY3A 3ZTOA 3SXLA 2CJAA 4ZKAA 1LV5A 1CPZA 2QMXA 4TYAA 4DSKA 4IH6A 3AQOA 4NZ7A 4CP5A 1YRTA 1BD6A 3D0IE 4DL0C 4EGLA 4YFUA 2W01A 5KFEA 5E5NA 3NS5A 2GZOA 4ES2A 1CG2A 1FFGB 2DJWA 3D1OA 1X5OA 4TY8A 3KHLA 3AJDA 1S1TA 2ILZA 4YP3A 5M2RA 4PG5A 4F7VA 1U24A 3EM1A 3QRQA 1IVZA 1U0HA 3SBMA 3BKTA 1GTHA 1CSJA 2DH7A 3M2UB 1S6OA 1U2RA 3P5BP 5K9FA 2G4BA 2J0SD 2OPQA 2DR7A 2Y8YA 1PIEA 3AHPA 3CMQA 3DLJA 2VODA 5LOQA 2ATLA 4E0DA 3G8TA 1HHSA 2CUYA 4WP9A 2H4WB 5KOXA 5J1EB 2IHR1 1TP7A 4DU8A 1TL1A 5K8MA 5H1SV 3RJMB 4A48A 3L4BC 1D0EA 3MMBA 3TUJC 5DQIA 1NB2A 4DCPB 3CC7S 1BXNA 3GYXB 2LEAA 2YKAA 3ENVA 3HHLD 2OFHX 4J9SA 4DOZA 4FVCA 4I2PA 1HNVB 3OL6A 2E1PA 1GK8A 4AQYJ 1T02A 1V6HA 2E66A 4FN5A 5E0OA 3HHDA 2GX8A 4O3RA 2RD5C 3R5BA 2VIHA 3MAHA 4H4OB 1VS3A 3TZYA 3OLBA 3DRPB 4JI8J 2CJ9A 3ISNC 5CABA 1L3VA 4UT4A 5JXSA 1N52B 3ZXWA 1GNKA 1AUDA 5LJ5Y 1Q95G 5E33A 1IKXB 1HW8A 1OQ6A 1X4EA 3BBBA 1BY9A 3M2UA 1V5VA 1JLQB 2MJNA 3K17A 2I0XA 1K47A 4J5OA 5G0RA 4C6AA 2WSEC 3KWMA 5F3TA 4DXLA 4ZLLA 3H2LA 2CQ3A 2ZH5A 3ILOA 1U02A 3MM5B 3M8PA 5CQGA 4OYBA 1MLAA 2NZ4A 2ZE2A 2G0JA 3FRZA 4GC6A 2KXHA 1VC0A 3JAMY 2OP5A 3C6UB 3HP6A 1WI6A 3DRSB 1VQ5S 3LP0A 3IWLA 4RW6A 3BQ0A 3I0RB 2OLWA 3EMTA 4TQRA 1SIZA 3IFEA 2V4RA 1RHMB 3V6DA 1QSSA 2VUGA 1HD0A 2DNRA 4OYAA 2IPOB 1UL3A 4NRTA 1YJUA 3OLAA 1HIYA 1O0PA 4QWBA 4OI1A 4F0HA 5F9LA 4NX9A 3QJJA 4NLSA 2VKRA 2HIYA 3DOLB 1YJTA 3MEDA 5J2MB 2HGNA 3E01A 4ED1A 3MM9A 4E2FB 1KHVA 3OTEA 4U7UK 1FD8A 2WCXA 2CJXB 1S1XA 1H72C 4OLPA 2LVWA 4EK2A 4EO8A 5L9NA 4ZP6A 3T1YF 5KFVA 1ZA1B 3Q8QB 3I0SB 1HYSA 1FD2A 2DR6A 4G1PA 4MKBA 5T7LB 3KK3A 3V2UC 3W5ZA 3ZTRA 3MEDB 1HMVA 5J2MA 2WVEA 4V1Ak 3U1LA 2PD1A 3EZUA 3MURP 3RUBL 2HHXA 2RU9A 2KVIA 1FESA 4CO2A 4WFZA 1G1XA 4NMLA 1I5OB 5JUMA 1JXEA 1C1CB 3E8OA 2XI3A 3PHTA 1NJZA 1FJ7A 4ECYA 1D1UA 2VG6A 2V5HG 5HQLA 2CQBA 2YPYA 4W90B 1RBOB 1R8HA 4U8YA 1VQOS 4OX9J 4B9LA 1T05B 1ACMB 2MHNA 2RE1A 3E51A 2ASLA 4B3TF 2XO6A 2DYAA 1JLCA 2VPWB 1AW0A 1J5OB 1RE1B 4B3MF 1HNIB 3VQSA 3CD7A 1S0NA 1SC3B 2J0WA 2EC2A 2PMHA 5D4LA 5KFKA 3FDSA 4I64A 5K5MA 1S9GB 2ZZTA 3VAIA 3UCUP 1S77D 1P1LA 2GGPB 4FYDA 2B4OA 2KB2A 3DI6A 2B7BB 1LW2A 4I1TA 3HT3A 3OFFA 4NCAA 1ZA2B 4KBIA 4ZLNA 3NBPB 3ILIA 3MTKA 5ETTA 4OYZA 1HQUB 4CH1A 2ZM6J 3RB3A 2GVDA 4LSZB 1R27B 1MN7A 4OL8A 2M5YA 2KXFA 3GFYA 1U1MA 3T41A 1RA7A 3ZC4A 3DLGA 3EZ5A 1SH2A 3S01A 3CD5A 3M30A 1JK9B 1RAEB 3ZZOA 3EPGA 4M94A 3AT1B 4LFAF 1YRUA 1LFPA 4EMDA 2LU1A 2XGQA 1M5OC 2ZBPA 3WQPA 4WKYA 3BBCA 2WRMA 3K5NA 3RW6A 4FXDA 2JEIA 3IAS9 1YKWA 4NLQA 3DOMA 4IQXA 4NCBA 4QR2A 4TLQA 5E3AA 3ULHA 1XMOF 4EZ6A 2DNGA 1SC1B 2VFUA 3ENQA 2L9DA 3S7RA 4NLYA 4DX7A 3RTVA 4IH7A 4JI4F 2V2VA 1Q7YT 5KFDA 2OI2A 2EFGA 2RT3A 3WC2A 3LTOA 5HP1B 3ZTPA 1TAQA 2CQPA 2DCUB 3D6TB 3M8RA 3GFZA 2KT5A 4H4KA 4NRUA 4QWAA 2QLFB 2JLFA 4K4UA 5L8RC 2W24A 2DEJA 2VBXA 5KG4A 4HTIA 2HAIA 4M5LA 4ENOA 1YITS 1UVLA 1H3DA 2HVEA 3NKYA 2XEXA 3SSRA 3VQTA 4RW8A 3SQGB 3UD4P 2W9CB 3W2WB 4MJKA 1HWIA 2IM1A 5ETLA 2PA3A 2MQQA 2DTJA 2HRTA 1N6QA 2E5IA 3C8YA 4I69A 4PXDA 4Y28C 5D77A 2IYGA 2FPHX 1SUQA 3L9ZA 5IT4A 4RBTA 3CXCR 4HKQA 1RWVB 2CFXA 4MMOA 1HI1A 4RUHA 2EK1A 2K7KA 2BJEA 4DCJB 2RMLA 4DQQA 4EYIB 2WONB 2DO4A 4USIA 1KTQA 2KI2A 3FKBA 1NJWA 1MW7A 3AOBA 2C28A 3KJVA 4ECWA 4O44B 2QA1A 3F41A 4ZS6A 3QLHB 2C2DA 4DQPA 2OPPA 1RCOB 1VQPS 1KN6A 2O1PA 3I82A 4ZPAA 3MUMP 1GXLA 2V68A 3OTBA 1KOOA 1QAYA 3EUNA 3EXYA 2V2KA 4OHWA 3HFKA 1SPBP 5FIIA 3MUTP 2VQEJ 4DL4A 1WF0A 1EETB 3MCOA 5IS2A 3Q8PB 3ZTQA 2LU2A 3T5JA 3PX4A 1TVRB 1SV5A 3NGUA 5AE3A 4ANCA 4DSFA 1AFJA 4MTPA 2RAQA 1GT8A 3G8SA 3GIJA 4DSJA 2ZH2A 3MXHP 1UJ6A 4PXBA 4WK1A 1R89A 3G4SS 4QZVB 4DSLA 1TL4A 2QC3A 2CIMA 4GKJJ 1F60B 4QR1A 5KFLA 5KG2A 2AJ2A 1XMQJ 4A47A 3MPDA 4M5DB 5KFZA 5F9NA 4ZLPA 4DFPA 2AV5A 4DR7J 2OIHA 2AZ3A 5LM7E 1U1KA 1REGX 1KVKA 1VRTA 4DPTA 4WWSA 3KLEA 5KAKA 1OSDA 1JLGA 3I31A 4QBUA 3VAKA 1IKVA 2EI5A 2HQDA 3OHAA 2AP6A 3KLIB 3NGRA 1ZOTA 3TR5A 5D3GA 4FKYA 2J0QD 1SJ1A 1KLMA 4IO1A 1WACA 2CADA 3PFEA 3RG6A 4EEYA 1PJ6A 3KJVB 3NAHA 4C9DA 1JLFA 5IXUA 1N0UA 1KFDA 1WDTA 5DJBA 2GS8A 1RT6B 2FVRA 1UMJA 1HHQA 3GFXA 3MPWA 4FNIA 3AB2B 8AT1B 2HBQB 3GG0A 4HACB 2KFYA 2DGUA 4J9LA 4Q8FA 3FBEA 4O3QA 3OJSA 1Q8IA 2UV8G 2CJYB 1NHKL 3Q0AA 1CEZA 1RTJB 3CTRA 3VVUA 2F63A 3M8WA 2VQFF 2HHHJ 2OJ3A 2K1RB 4EO6A 3OL8A 1NH8A 4ELTA 2IAJB 2KFNA 2XMUA 2UVRA 1PBAA 4ZVQB 1ZBTA 5ETOA 2RRAA 1TL5A 1FTRA 3VZHA 3T5KA 4FNHA 2QG9B 2IA0A 3MM5A 4ZVSB 1U1PA 1S49A 3OL7A 8ATCB 4XDCA 3DN9A 4RW9A 3KHHA 1LWEA 1LWCB 5LXRA 1VK3A 2HMIB 4RZRA 1UA0A 3NXZA 1W26A 3HXMA 4DR4J 3RR8A 1N5SA 1RTHA 1Z4UA 3BGLA 4Q45A 4OI6A 3G6YA 3V4IA 4NCGA 1IBLF 1KWMA 2X1BA 4B08A 4F4KA 4GKKJ 4ZVHA 3VAHA 1BQXA 3BDEA 1PBUA 5BR8J 1VJWA 4PYDA 4UUWA 1TK5A 4CLKA 1S4FA 1FRXA 2UZAA 2FB0A 4J7CA 3HI9A 4WIQA 3W61A 2GW8A 1KVJA 3KLHA 3CGIA 4JV0A 3OSNA 1Z2ZA 3PRVA 2QLJB 1TR0A 2B9WA 1FEEA 3M7VA 3OXFA 2XZTB 4OZ5A 3SZ2A 4IDKB 4DR3J 3PHEA 3QSIA 3QT6A 3SYZA 3AAWB 1IKWA 3KLFA 4LT6A 3BQ1A 2YXLA 2GV1A 3UFCX 2KVQE 4X66F 4JI1F 2LFVA 3GPAA 2C2ZB 2VA3A 3HHNB 3GYNA 1GMVA 4TNOA 1KLMB 3VAFA 1EB0A 2C3MA 1RWXB 2JJ4D 3UQSA 3L7UA 4OYPA 2XC9A 1K8AT 4Y2IA 2NLWA 3BYPA 5B0EA 3SEOA 2JZ5A 2ZZMA 2MKSA 1R6YA 1GXTA 4X65J 2HHPA 2HEKA 1UZDA 3F44A 2WB4A 3OUYB 1RHJB 2DR9A 2OD6A 4AT1B 1YDLA 3M6UA 1Y3KA 4X4PA 1TELA 2NS1B 5KT5A 2UUCJ 2VFVA 3TYTA 3IN5A 2AU0A 2ZJPQ 4X4UA 4ZIWA 4DL7A 1U2FA 4YQWA 2ZWPA 2NUUG 4AXIA 5K8OA 3MMJA 2MQPA 1Z2LA 2VG5B 1KP6A 1IBCB 3JYTB 3DM2B 1NMEB 3LP2A 3LW5C 4OQJA 3BPDA 5EX0A 4N8OA 4J9KA 2VV5A 5C42A 3CCRS 2BANB 1HYSB 1T9XA 2M70A 1OY9A 3FBCA 1NRKA 3HSJA 2H5EA 2YTCA 5T7LA 5KFIA 4FYYB 4DPOA 2B6AA 3X1LB 4MYUA 1U6ZA 1IBMF 1HBNB 1M0SA 2AMCB 4K59A 4OJGA 2CKWA 2W7AA 2Q6CA 1WF1A 2XZWA 3M32A 5KG7A 4FZVA 1KBRA 4QYZK 3H5UA 3DGPA 1HFEL 2FLLA 4ZCLA 2IM0A 1I94F 2VA2A 1IQZA 3DOMB 2FC8A 2F3JA 3H90A 4USHA 3PR5B 3OPKA 3V6DB 4NWBA 1FVSA 5ETNA 2ROEA 2R7RA 3HMJG 2RQKA 2E29A 2K1RA 2IDLA 4B9NA 2YNIB 3M30B 4L76A 7FDRA 3H5XA 3T1HF 3D4JA 3ZNUA 4DV1F 3Q86A 1H7XA 4K8RA 2DHSA 2DD8S 2KYXA 5CCLA 4WFAQ 4A8KA 2NPIA 4X2BA 1YGYA 2QZ8A 4FF3A 4OJHA 3NMAA 2ERRA 3C16A 5T14A 1I94J 4JV2A 1R31A 3CWJA 4BC7A 4C3KA 4URGA 5IC4B 2J9DE 2W25A 4RO0A 2GHPA 4ED4A 4JI3J 3T9ZA 4GC7A 1X9WA 3ENWA 1RTDA 3QIDA 1BQNB 2GMJA 4Q5VA 2XS5A 2I6WA 3P8BB 4NLRA 3QIPB 4FF4A 3IBWA 4PWDB 2JC0A 3UNGC 1KQSR 2HBZB 2LA6A 4LF4J 4C8YA 2OELA 2CPFA 2XMKA 3A3OB 4Y2KA 4KRWA 4R8UA 4B9SA 1UWBB 4CO1A 3KMSA 4WKRA 4WIIA 2AEMA 1RT3B 4DV6J 2Z0GA 4L72B 1N5YA 1FK9A 1VDHA 5AE1A 3CUNA 1W2BR 3E2EA 4K0KF 3TO8A 2BOAA 4NA3A 2IIHA 3G82A 3GP9A 2HVDA 3BGUA 3PJWA 3PYDA 5KFSA 4C8LA 3UR3C 1HQEB 2V69A 3K89A 1DLOA 3MMBB 1RT4A 2NXEA 2XULA 4CRJA 1PO6A 2DXFA 1T9UA 2G2OA 1FXRA 2KJWA 4I7FA 4WJBA 5E3RA 5JVHQ 3D6FB 3BSCA 3RB4A 2RF2B 1QE1A 3DLGB 1ICEB 2R7OA 3IP0A 4WU2A 4DF8A 4Q44A 2CNNB 2V34A 3R9LA 5DGBA 1V3ZA 3RYLA 3Q22A 1HQUA 3OV7A 4A8MP 1DARA 4ELUA 1NZAA 2I5JA 1C0UB 3CCUS 3Q83A 3RZAA 5F8JA 4F25A 1FRJA 3ELHA 1H38A 1IN0A 4UUXA 4YUDA 2O3DA 5KFCA 4M5HA 5B08A 2AYGA 1XERA 2HZCA 2Z8QA 2P2CB 3EGNA 3H7HB 2ZZNA 5D0RA 5I3UB 4QPTA 2WONA 3EZOA 2C3YA 2FD2A 4HTJA 5GAEI 3FRYA 4NL5A 2V2ZA 1NNDA 1SJRA 4XAKA 1JLCB 2BRKA 2Z58B 1JXLA 4ZDNA 4RW6B 4DG1B 3M8ZA 4M8LA 2OPPB 4X66J 1VQ8S 2B8PA 1RT2A 1R43A 1DQ8A 1SUQB 3HJVA 3QGHA 4R5PB 2ZOFA 1VCTA 2XQCA 2AJ4A 1S1UA 2DBBA 3MPYA 2CZ4A 2GHWA 3J81j 3GSIA 3H25A 1VJQA 3T5HA 3MMCB 3TJAA 1P8GA 3MFHA 4Q7AA 3W60A 3G71S 1K0VA 1U1LA 1F9EB 3R3TA 3EGWB 4JI6F 3NAIA 1GFWB 5FD1A 3H4DA 1TKDA 1QY7A 4BLGA 2E5LJ 5B0GA 4AQYF 2HZVA 1A9NB 4I2QB 2RSQA 5ETPA 2E1AA 4DQRA 3SCKE 1U25A 3LGNA 2ZH3A 3I0SA 2JLGA 2E9ZA 4FPIA 3ZZYA 3J7AN 3QRRA 1RDRA 2BA9A 4I56A 1YSJA 1DAXA 3LAMA 2OMOA 4ECQA 1G6BA 3JQJA 1I6JA 2BANA 1NEEA 3VR1A 2JH3A 4NLDA 2YNGA 4Y34A 3MCMA 5M2UA 2IJRA 1XQIA 2CPIA 3OBIA 5A2QU 4NZ0A 1FI4A 1TL7A 1GAOA 1H2VZ 1XEZA 2UVWA 4CM2A 1S1WA 2ZHOA 2IVFB 1RHKB 2W2PP 1AA1B 5IWAF 3ISND 1NK8A 4FXVA 1X0PA 1XIQA 4URSA 4UOGA 5A8WB 2HGMA 5IT0A 2XSJB 2BE9B 5A6WA 1VFJA 4UTGA 2XG8A 5CD4H 3R1LA 1YG0A 4WYLA 3OJUA 3KDOA 4P7TA 3W7BA 1EAYC 3DLBA 1HPZA 4DR5J 2FYXA 2ZNZA 3Q8YA 3BKFA 4ID5A 2HHHF 1FKOB 3NBPA 4ZVTB 1BGXT 2QLXA 3KKFA 1JJCB 2YNFB 3CCZA 1B3TA 1CS4A 3HHLA 4HDHA 2BQRA 3V81B 4C8NA 5L1LA 5J2QB 1F2GA 2JL9A 5LL6d 4AL5A 1IKXA 3QFHA 2GJFA 3KNGA 5KFWA 1DRZA 1NPPA 3KLEB 1RAGB 2RJZA 1A6LA 2EXUA 2HURA 4YY3F 2HHWA 3R2DJ 4DMZA 1QM9A 3AQPA 1O6XA 3AD7C 3ZZZA 2U1AA 4U6PA 1HWLA 2XLKA 3ONQA 3OFHA 3QGIA 1K73T 2RVJA 2WVBA 4KV8B 3R27A 1WWHA 3CJ8A 2EFNA 3M6XA 1JLAA 1X4GA 4LR8A 3OXLA 3RU0A 5J1PA 1HNVA 4I2PB 1NKEA 2OPRA 4C3LA 4USWA 1VISA 3TZWA 4AL7A 2NR0A 3DXBA 2R7VA 1QE1B 3QGPA 3DLEB 3C15A 3SFGA 3J81Y 3Q23A 1X4AA 1EQMA 2AYMA 2WSFC 3TUZC 1SKWA 2BUNA 2D9OA 1DLOB 3CJRA 5D15A 4XTTA 4RU9A 3A8JA 1FERA 4KAIA 4U9RA 2NZCA 3FVYA 3VGSA 1E6VA 4OHZA 2HMIA 3V6HA 1HBUB 1DFDA 3D0GE 1FDNA 4JV1A 5HAOA 4I6AA 1RT3A 1R0AA 1Q53A 4RJVA 4LF4F 1APSA 3V4IB 4WFBQ 2ZH9A 5KFPA 3B82A 1S10A 2WVDA 4QU7A 2LKZA 3I4HX 2AT1B 5GMKa 2IVMA 2O66A 3J7ZT 2XLIA 4ZVPB 3RW7A 4N56A 3GYGA 2MMYA 4I6YA 2IAJA 1CJTB 4E98A 4RW9B 2J9CA 3UE2A 2VU5A 1VHIA 2LLZA 4M5JA 5F8IA 3PW7A 2M88A 5AXLA 3LQVA 5D0EA 3AD9C 4N5SA 4IOAQ 1WKLA 1VBZA 4HHUA 1N88A 4J37A 2ZJQQ 3TAPA 4A8QA 4DWIA 2FJBB 3ZZPA 3JB9k 4U96A 1IR0A 2MB0B 3CO0P 4PXEA 1HWKA 1N33F 2YH1A 1JLAB 4H4MB 1FF2A 2CPYA 2LEPA 5IM0A 1YTYA 3I5AA 4KGZB 1TZ0A 4K4YA 4DHVA 4R5PA 4LFCF 4ES3A 2ZH8A 2XY5A 2XY6A 2YNIA 1YHQS 1RWMB 5AJ3F 2LP4A 4KH0B 2Z2ZA 1EIYB 1OMSA 1NJYA 3Q89A 3PY8A 1JLQA 1F5BA 3EX7B 1HL6A 4M63A 4NLTA 3H40A 3SMZA 1RJJA 4ZOSA 1JMTA 1GXUA 2X51A 3BQ2A 4LRFA 2CQIA 2DNOA 3NNAA 4CNZA 2BW7A 4MKYA 1IUJA 4GVBA 2QX0A 1MU2B 3FFIB 1CULA 2XWYA 3NCRA 3US5A 1JKHB 1G7CB 3M8SA 1L3TA 1IR1A 2I2YA 2W9AA 1S7IA 1Y5NB 3IR7B 2N4DA 5E3CA 4DV3J 2ASDA 2KDOA 2GQCA 2DH9A 4AL6A 3O6QA 3KNAA 4DR1J 3HFZB 2FGOA 1FA0A 4CLTA 5AT1B 1TKXB 1R8CA 4JOUA 1REVA 4U8VA 2EWHA 3R97A 4DR5F 2MLYA 3DGVA 3KUHA 4EFAC 4GVLA 1RP5A 1D9AA 2YX7A 4FS1A 2J6TA 1VIOA 4MIAA 3UDEA 2LYVA 1VQNS 2IRUA 4A4JA 1V9OA 1N54B 1VMBA 2AJFE 1O8BA 2YY3A 3HKWA 4ECRA 1HA1A 4YOEA 4BBYA 5DZ6A 2F9JA 4I6WA 1SL2A 2H9ZA 3MR3A 2HPUA 5KFTA 3DDIA 4LSLB 2XNRA 5HANA 2KU7A 1CQNA 3N4WA 2R2SA 3DCAA 4H54A 1U49A 2PE8A 5ITHA 1BQNA 1T94A 5J2QA 1V3RA 5F8MA 3RRGA 4GKKF 4M5NA 3HHLB 1U0HB 1FFSB 1DTTB 3NWGA 1OPIA 1S1TB 5EDWA 4JYAJ 3DDNA 3O8WA 5F41A 1Y9OA 2DGSA 2W2OP 3G8QA 1VRQC 3K7RA 4GO7X 1W25A 4NZ6A 2W2QP 1XBWA 5JMNA 2WTFA 9RUBA 3QQCD 5J2PB 1UW4A 4JB8B 4CTAB 2N3LA 3AH6A 4CLPA 4OZ0A 2E5LF 3F56A 1IKYB 2DIUA 3R6LB 3UDCA 4JI6J 4DBQA 1D09B 1FNMA 3N79A 2XBPA 2MSTA 2PFDA 3KDNA 1U1RA 3O2IA 1AUSL 1BWVA 1FWPA 4TVAB 3J7YI 3PEHA 3A3NB 3PRDA 1TKZB 1JLBA 2HS4A 4XO0A 5KFNA 2W9CA 2EKYA 4LSLA 3IXQA 1NDLA 3M8QB 1WC0A 4NYZA 1H74A 2VBZA 1WHYA 5CAAA 3BSAA 3E01B 2J9DA 2YVSA 1HLWA 2YWKA 1S99A 3Q8SB 2U2FA 1RAAB 3UCGA 2F7VA 2GO8A 2ACYA 3F0NA 3M6WA 3R1HA 2YKNB 3CCES 1NK9A 4ELVA 1HBUA 1KNZA 2DHAA 2F4VJ 3MMAB 1ZZFA 3T1YJ 5FDLB 1OYEA 4LF7F 2J7UA 5KT4A 4YR3A 1UVJA 3R7BB 4MFBB 2D3UA 5IZHA 4HVZA 5KG6A 2D3O1 2RUSA 2CJKA 2BJ7A 4N76A 1H98A 3ILJA 1HWUA 1VQYA 2MZRA 1RLCL 2J76E 4KQZA 5HL7Q 3J80Y 1T8EA 2X3DA 4LQ9A 3JYTA 5LSOA 3C14A 2I8EA 3CEDA 3ZO7A 2ZE2B 1P9YA 4OZJA 4Z7YA 4Z2XA 2DCLA 2MPUA 5HO4A 1FJGF 4PRFA 4X4VA 3B6BA 2KO1A 2QA2A 2DNLA 3HDSA 5EGYA 4FBTA 3EGVA 1RZMA 1U6FA 5CD4A 5HJXA 5BJRA 2DR5A 4OYOA 3FC9A 2PSZA 2FTRA 3RRKA 2Y8WA 3D67A 2XTJP 4K0KJ 1UVNA 2BM1A 3JSYA 4NEYA 1S59A 4WXWA 3WIUA 4DV6F 1XNRF 2XYHB 2V8DA 1QVFR 3OFGA 4OFZA 2CWXA 4IRDA 3OHBA 1XC9A 1EARA 3GQCA 4NLWA 1YZ7A 4K4TA 2GMHA 5L1IA 2BQ3A 1Q86T 2G1DA 3IM9A 1UVKA 5IM0B 1WTFA 1HPZB 3IAM9 4F67A 3HPOA 1WC1A 2CRLA 3TUIC 1F3VA 2WOMB 2B4PA 5MLCV 2ZOGA 2YKOA 1KQGB 1A7GE 4QJVA 5F8GA 1RKJA 2B9EA 1T9YA 3S1TA 2QE5A 3CJKA 2KL8A 3W66A 1B7FA 3DMJB 4JV5F 1ZM3A 3D3CJ 4ILLA 2MKJA 2E1MC 5DQGA 3PM9A 4ZJOA 1CJTA 2PIIA 2OSRA 1YJ7A 3RAMA 3K57A 4FS2A 2BRLA 2D7SA 4QW9A 2OPQB 4K2XA 5C24B 1VIXA 1XMBA 3TNVA 1HNWJ 3IR5B 1HMVB 5SZTA 1N32F 4LR9A 2CQ1A 3NWRA 1RAOA 2MY8A 2AF6A 1WOSA 3MWBA 3KMQA 1UA1A 4IH5A 3PYFA 3LANA 1DY3A 2W4DA 2VJUA 3FGVA 4JI2J 2YBVA 2Q66A 3M32B 1WOPA 2B4UA 2E7VA 1G3OA 4QWEA 5HQMA 1N48A 2HW3A 1RKIA 1YVFA 2WZ1A 4X62F 2CQ0A 2MKYA 3DRYA 4OX8A 3PTWA 4NLXA 4OI2A 3R8YA 1PYTA 3NGDA 3OSPA 3M9OB 1QD1A 2R9LA 3EVOA 3OR1A 3R5DA 4CO3A 5A8KB 2AYEA 3IGNA 4CO5A 4IO9Q 1TMMA 3LPEA 4D3GA 3N28A 5B7WA 1ZM4A 4DX5A 1SIWB 2HLTA 1VK8A 4X62J 3MTJA 3RB0A 4DUTA 1LXNA 3CCLS 1X8DA 2J7WA 2C3OA 5CH7B 5L1KA 2AX0A 3ZZTA 1BE4A 3C6UA 2CNLB 4L3NA 2JX2A 3L95X 3FSIA 2ZWOA 5DG8A 4WFYA 3PNIA 1XWLA 3UR0A 1T95A 2VBYA 5HATA 4WFXA 2C2OB 3WZ0A 3K59A 1SBRA 5H9EK 1U0SA 4NXNF 3HULA 2BABA 1KRPA 4RX6A 3HCXA 3KXDA 2V63A 3O5TB 5L9XA 3ZTSA 1L3UA 1U7LA 2GAHC 4IG3B 1URNA 4P74A 2PEHA 3OR2B 4DR2J 3P45B 1RTZA 3DHWC 5D4PA 5KFAA 1F9HA 1U2CA 1CJVA 3TEGA 4ILMA 1NSQA 2QL5B 3R2CJ 2DNMA 2OPSA 4PPZA 2VPXB 3PEJA 2QA4S 3MM6A 2VQFJ 1WTBA 1DURA 1NK0A 2D3OR 4X64F 2IY5B 4K5SA 3UN3A 3QJPA 3AA9A 2MKCA 3R6GB 1WC6A 5M2PA 2ZC4A 4KPCA 4DPYA 2B5JA 5GAHU 2A10A 1Q81T 2DY9A 3IRXB 3P5TL 1JKHA 1WC5A 3HD2A 2FLPA 3EJMA 1U4BA 1AZSA 3PW4A 1GTEA 2ZBCA 4I4BA 4O0IA 3JQKA 1WDDA 3GR1A 2JVOA 1EZZB 2IMWP 3D66A 3GSDA 2H51B 2RS2A 5HMXA 3GV5B 4J90A 3PKMA 3D28A 1WEYA 2B43A 1N32J 4WP3A 2HRUA 4ZVUB 3TJ8A 3MPVA 5DG7A 2AGOA 2HGLA 3CJ4A 2M0GB 3NNHA 2VFSA 1TMJA 2ACMA 2CJBA 1Z1ZA 4KYZA 1FKOA 1UZHA 2AW0A 4R0JA 3ITHA 1KSPA 3SSQA 3CJTA 2Q79A 4YR2A 4B3MJ 4ZVGA 1RLDA 1UFLA 3ITHB 2CQGA 3ENAA 2FJVA 1UAWA 1XMQF 3OQ2A 3J7A1 3JSRA 4DLGA 4OYIA 1NBEB 1X4BA 3G6VA 1SB6A 3H5YA 3D6HB 4DN0A 2DEIA 4C8KA 4O4GA 1MROB 1NJIT 1Q82T 3KLHB 1MN9A 2YNHB 2P5VA 2FJXA 4OX6A 3T6BA 4Q43A 4LMZA 3DU5A 1Y11A 1F3FA 3BH7B 3KYLA 2DNKA 3K8VA 3BO3A 4P9SA 1FKPA 1FWKA 2H4YB 3CD0A 2JC1A 5GMEA 5IT9U 4RWXA 2UVVA 4KKOA 1TL7B 3DKDA 4TYBA 2LMIA 1FKAF 1TAUA 1HI8A 1JLFB 2YNGB 1QAIA 3LO3A 3POTA 2DXDA 2MKIA 5DLFA 2UUBF 5IQQA 5IV4A 2V2QA 4C98A 4M5GA 5D3GB 2M9KA 1RQ0A 1U48A 4LF5F 4OI0A 3VWSA 2HZAA 2RNEA 2B6AB 1RAIB 2DHHA 2XMVA 3BS9A 5BYSA 2A6OA 2OTJS 4K50A 2VKZG 4DV1J 1VRUA 3UVJB 3M05A 4HHHA 5A6PA 2H54B 1S72S 2YKQA 3NNCA 2Z56B 2QMWA 4X64J 2AGQA 2VBWA 5E7OB 1DQAA 1ZTWA 3E3XA 3C15B 1XN9A 2QMUB 4ZCMA 1FCAA 1K1QA 1NUEA 1KFSA 1RGVA 2CA9A 1R7IA 3BN7A 3MD3A 4PABA 2RRNA 3K58A 1FFWB 1P9QC 2X1AA 2XZDB 1NSPA 3EE3A 3FBFA 4JI8F 5HSPA 4QPXA 5KT6A 2G2YA 2W9BB 1HNXF 5IT9Y 3MF5A 5DETA 1SL1A 2HQ3A 2HHUA 1BQMB 3ZFVA 2L9WA 4FBUA 1YWXA 1QDUB 2G2ZA 2V9KA 4LJMA 5KTQA 2BEFA 1HBMB 2F4VF 3DRRA 1RAFB 4ZVOB 5K8PA 4NEZA 5I3QA 4ID8A 2BVZA 4XDDA 4ZVRB 4DUYJ 1AXQA 4RNNA 4JI7F 2XYPB 3UW1A 3AJ1A 2UV8A 3EVMA 1BQMA 4LF1A 5B0FA 4C7QA 4C8ZA 3GCWP 4PG4A 3A13A 1EJ7L 1WSRA 2E5GA 1BUXA 2XYGB 4XPCA 5DLGA 4P10A 1KTVA 1DTQB 2ZBIA 2P9GA 3C6TB 2L48A 4DV3F 4TU8A 2HBYB 1MNEA 2HBRB 2O67A 3D7SB 4OI3A 2Q3PA 4P71A 5H9FJ 3WHIA 4EBEA 4ER8A 3JSMB 4P75A 4RU2A 5I42A 1SQFA 4USKA 4ICLB 2CG4A 4NMXA 2BMBA 4YB6A 3IR6B 5F0WA 3BR8A 5EN1A 2SXLA 4OZ1A 4WTYA 2DXEA 2JHEA 4HDGA 2QYGA 4X4QA 2Z4PA 2ZM6F 2QSWA 1ZAWA 1H2TZ 3AXKA 5F3ZA 2VFTA 1E6YB 3TA2A 1HBOB 3MM7B 2KG0A 1YBAA 4NPOA 4JI2F 4A8XA 4FKXA 4Q8EA 2MKHA 4F4WA 2VFRA 4P72A 3PX0A 2C2EA 4PWDA 4ED5A 3QGGA 1PAUB 4KT0C 5IQ6A 2CG8A 4NYOA 2ASJA 3MM8B 4C11B 3VAJA 2QSFA 5HP1A 1TL3B 5EX3A 4BCAA 2BE2A 2J6UA 3OVBA 5HN0A 5GAHI 1EQ0A 1P6TA 1WKJA 4DV7J 2AX1A 1Q79A 1FNXH 2Y3YA 1GMWD 1NLKL 5EWEA 5LMUJ 3G2XA 1ZPVA 4NLVA 4DL6A 1S0OA 3MMCA 1VC6A 5THWA 2XWXA 4PXCA 3IC1A 4OYXA 2IDEA 2MZJA 2MSSA 3OUYA 3I0RA 3IG1B 3BM7A 2IVYA 5IC6B 2CQ2A 3FK4A 4C4WA 1R0BG 1JJ4A 4LFBJ 2QLWA 3CC4S 4KJIA 1QVGR 2ZH1A 2NUHA 2CDQA 3W9HA 3M9NB 2XS2A 4J9QA 4KGMA 2QA4G 1XNQF 4RW8B 3U02A 4DLEA 1XNRJ 1NH7A 1RT5B 2C2NA 1LWFA 1LXJA 2ZBQA 2HHTA 2V8VA 5T41A 1YQHA 5EUHA 3SDEA 1F2HA 1F6TA 2OSQA 2RIJA 2EFOA 1UPMB 4KC5A 4U7CA 2I5JB 3A1YG 4RKUC 3T3FA 4X84A 4L75A 5DRKA 4DN9A 2ATCB 3LH2S 4B3SJ 1FXDA 1N36F 2GNKA 4F0MA 2K3IA 2MZQA 4HI1A 1NB7A 2UP1A 2H5JB 2FIUA 2VONA 2OO4A 4BS2A 1VRTB 4QCLA 2OAUA 1VR6A 3MCNA 3KTQA 4ZITA 4B9VA 3KJQB 1TKXA 3ETMA 4NLGA 2AJQA 1FXLA 3W3SA 2Z57B 4JI5J 4QYRA 2ADCA 5HLFA 1LK7A 2YKPA 4G1QB 3KUGA 1FHTA 2EVZA 4USTA 4X4RA 3DHXA 2GVZA 2JSXA 2BJDA 2CVEA 4WU3A 2XMMA 1W7WA 4N47A 3LP1B 4OX9F 3NRBA 4CT8A 2DPJA 4GO5X 1NZ8A 1M1KT 1I1GA 2HKEA 2FHKA 4K4XA 4ETXA 1IM4A 3KHRA 1RXOB 1RT5A 3I87A 4RUCA 1CLFA 1TVRA 2MGZA 4FF2A 1LK5A 1YJWS 3TQ1A 1Y7PA 1R8BA 2G9OA 4YS2A 2HNZA 2FVPA 4KHPJ 1S1XB 4QIGA 1PAEX 2EW9A 2A6MA 1JIHA 1BMQB 5I4MA 2CPXA 5D78A 1PC5A 1VI7A 3IBFB 3U27A 2FLOA 3TEHB 1VQSA 1EX8A 2R2RA 3D1QA 3I9V9 4YEAA 3W2VA 4CM0A 2W7OA 5A8RA 4RW4B 3SV3A 2AEFA 2MYFA 1RWPB 2GIFA 4LUBA 4OYMA 1UPPA 1UEVA 2A18A 2W8KA 5K20B 3KOAA 1KLNA 1URRA 3KK1A 1RU2A 1XK8A 2HK3A 2HG4A 4DDFA 3FZ2A 2A2CA 4PG6A 3QT5A 3BREA 4UOHA 1FE4A 3WDOA 2IRYA 3W9JA 4HYKA 2FLNA 3MCSA 1NHUA 4ALZA 2C2KB 3GU0A 2E9RX 1C0TB 1YJRA 4WBFA 4Y00A 1PSDA 2DNZA 3QT8A 3TW0A 5C2CA 3T19A 1YJVA 3K5LA 2UUCF 1MSWD 2JVRA 4DZDA 2UU9J 5U47A 2UUAF 4LSNA 1TU0B 2G13A 4X4NA 3MEGB 4KTQA 4X65F 2C42A 2YWWA 3ZNJ1 2EFQA 4TQSA 3GWCA 1C4CA 4X4SA 1WJ9A 2CWKA 4MIWA 3S8SA 1DZ5A 4X4OA 1OY6A 3MGJA 5ETKA 3VAGA 4DL3A 2OHDA 1SVDA 2N7CA 3KK2A 2LXFA 2KT3A 3CO9A 1S0MA 1YX2A 3N6LA 4YN3B 1S7HA 1U8WA 5HVHA 4DPXA 2EK6A 4YR0A 2M8HA 4OIXA 4JUZA 2HFVA 4HHJA 3HM9A 2KRBA 3KJFB 1IWGA 4UOFA 3KLGB 4F3OA 4DR1F 1S76D 5K14A 2ROGA 5LSLA 5KFXA 4XPEA 1FDDA 5RUBA 4CLFA 2KH9A 4DR2F 2FVSA 2ZUGA 4PAAA 5FLXU 2IM3A 2KHCA 3AD8C 4BWJA 3LA0A 2P9EA 4ZPDA 1B99A 2R2UA 2QL9B 3CULA 1ZAXA 4CNYA 4LQ3A 4ZPCA 3CT9A 2DGQA 4G1IA 4B9MA 1Q7LB 4LVOP 2J8AA 3GTYX 4FXWA 3SCIE 2UU9F 2BE7D 3CC2S 2UXCF 1HNZF 1JQGA 2QV6A 2KTQA 4OZ3A 2HFSA 3CJ5A 4Y2CA 1QAJA 1U1OA 1QLNA 3QLHA 1S6UA 2DNYA 3PYEA 1R8AA 4RPFA 1C0UA 2GGPA 2MQLA 4WXOA 3PYGA 4ZCIA 2X1FA 1GX5A 1TUVA 3HX9A 2MZ1A 2B51A 1TKTA 2M8DB 1Y0HA 1N56A 4WF9Q 2FY1A 5HJYA 1YRXA 2GHVC 3SV4A 2HNYB 5GMDA 4DV4F 4J9VA 4CH0S 4D3HA 4WZQA 3HSDA 4P52A 4MIBA 2XGPA 3UVJA 4AUKA 2VG6B 1RWUA 3QSYB 2KFZA 5LMNF 4ED7A 3N6MA 5HMYA 2HVIA 1RACB 1W2IA 3SI8A 1N5YB 1KEKA 3O3LA 3D2WA 5HLFB 3OD2A 3X3UA 1EKSA 5A8KA 1SC4B 4G6VB 5K8NA 4R8UB 2KHDA 3PVXA 2HWHA 1WNEA 2CQDA 5J2NB 2VG7A 3MEKA 1S4EA 3CB4A 3CJQA 3ISZA 3H20A 5FDLA 3UWTA 3TUPA 1TV6A 4DFJA 2VICA 1I3OB 1UP1A 2VPZB 3BKUA 1FVQA 2FJWA 2WVFA 3GFHA 3CDUA 3SDEB 4JI5F 3V6JA 2COLA 1NPKA 2HWIA 4WP8A 3T1HJ 4LSNB 2XLJA 1ITPA 1T11A 1OO0B 5KT7A 4NA2A 3WX4A 2B56A 5HBMA 4KHMA 3GG1A 5A0YA 1YJNS 3NEKA 4Y3CA 3I5BA 4MT1A 5HVGA 4LRAA 1N36J 2QLBB 3C66A 4NA1A 2DNPA 3LP0B 2MJUA 2HNDB 2GAGC 3A8IA 4ZPVR 3UN5A 3RGIA 1RWOB 4PQUB 1PG5B 2YX4A 4QW8A 2J9EA 4DPWA 5KOWA 2BJ8A 4LREA 4I0WA 1WI8A 2W4CA 1KR4A 2GJ2A 4ED8A 1SH3A 5HI7A 1VBYA 4C0OC 2ZD1B 4LRDA 2WK4A 3THVA 2E1CA 4PWUA 5A8RB 3MAQA 3W8GA 1IJFB 1CJUB 2NCKL 4EU0A 1WEZA 2K7JA 3N5BA 3R7NB 1VQMS 1SCJB 4IR1A 2EKNA 5LT5A 2R2TA 3FMWA 4L73A 1JJHA 2CZVC 3BYRA 2ALYB 2PEBA 1WG5A 3BJYA 1FJGJ 3H59A 1RBAA 2XHCA 1SKUB 2ZD1A 1LEOA 2AJ1A 4YDDB 3IM8A 3NGKA 1K9MT 4USMA 4ZVEA 1RK8A 2V8PA 4EBCA 1EHWA 1F9FA 1AZSB 3GMGA 5GAGI 5DDRC 3Q2TC 2GFFA 2F1FA 3MI7X 4ZN3A 4WZMA 3H98A 1D9DA 2Q1LA 3M2RA 4CWBA 1HQEA 1E6YA 2IMOA 3BGRB 1CJVB 1QTMA 1RI7A 1LW0B 3M4XA 2R8JA 1JLEA 4ZPWR 1BHNA 2HFOA 5HVFA 1LW0A 9ATCB 4ZP9A 4DR6J 4OYWA 3KG1A 3TAMB 2H5IB 5ADZA 3FBBA 1Q5YA 2X1GA 2BKPA 3MECA 4KE5A 4JBCA 2BACA 3M8YA 2OEKA 1Y5LB 2OGUA 3OXGA 2HHVA 3T9NA 1DQ9A 3QZ7A 3PO5A 1X4FA 2ZITA 2RKIB 4KR0B 5JVGQ 3WIVA 1JNRB 3NL0A 2A3JA 1N8RT 3TVYA 2LQ9A 2MEWA 2HVHA 2D3ZA 7AT1B 3PIOQ 2RQ4A 3A3PB 3SCLE 4CCHA 2IRXA 2GO9A 4NXMJ 3I55S 1SL0A 4GMKA 3P96A 5EWFA 1X9MA 1RISA 1UJ4A 4F04B 2E9TA 3CDBA 4FPRA 2RH3A 3TQEA 2YWFA 1MWYA 3NS6A 4OZNA 5IWAJ 2BZ2A 2JNJA 1HQ2A 3AXMA 2XI2A 4FP9A 4MKAA 5HK4A 4O4GB 1MROA 4OHXA 4URQU 4DUYF 2H65B 2B7CB 3BN4A 4O0NA 2AHOB 5KFOA 1R0CB 2NSCA 2OKQA 5I3PA 4WYWA 3QO9A 2JFKA 4CLWA 4C0HA 2ZVIA 1HNZJ 4DI6A 4IFVA 2ZC3A 5K14B 4AYBD 2Z2MA 1R6VA 2HYIB 2UXCJ 1N34J 4J9RA 3MEEA 3HVTA 3S6EA 4E8UA 4LBHA 5HMWA 3NOCA 2IYIA 5KFFA 4B9TA 3BF4A 2AIRB 3TJ9A 1X0FA 2NYHA 3GJRB 3IBCB 1Q8BA 4ZPBA 5DDOC 1NK6A 1FTCA 1VLOA 1RTHB 1TL3A 2AWZA 2EBEA 2KT2A 3NS7B 1TV6B 1YJ9S 4A8FA 3QJLA 3TAQA 3PFOA 5D4NA 1HNXJ 2RKIA 1LWCA 4LF9F 4KH1B 5GAEU 3CCJS 1Q8LA 1RSCA 4W4MA 1M5KC 3SQOP 3AODA 3BGOP 4I7FB 4J9UE 2ALZA 1RTIB 5EWGA 1SJ4P 1T9VA 3LGMA 5DM6Q 2CXEA 2IFXA 4RNMA 3DOLA 2KJVA 2AZ1A 3DXSX 5ETQA 5LXYA 3DLLQ 1FX2A 3THPA 3I96A 2MDAA 4LF2A 3IGVA 3J81U 2X3GA 3G87A 1E6VB 3GJSB 3IRWP 1S9EA 2POKA 4M5KA 1KQKA 4U7UD 3LWMA 4K7QA 1RTJA 3NCQA 1RT7A 1S1VB 4AE5A 1RWWB 2KN4A 2DGVA 3BB5A 4CLUA 1HARA 1NHVA 5KFHA 5D0HA 4FYXB 4PEOA 4HACA 4Q2MA 3U7JA 1OY8A 5LSRA 3JAMU 2UUBJ 2R8GA 1DTQA 4MKVA 3FSYA 2BKNA 4IFYA 3GIRA 1F1BB 3JTOA 4RNHA 1WF2A 2HS3A 1H7WA 1RABB 3B4MA 3C2PA 1B64A 4DV0F 3P6YC 4YB5A 2YQ0A 2VZ9A 3IO1A 3QWUA 3MEGA 4UQGA 2CZ9A 3MD1A 4LFCJ 1RHRB 1S5ZA 1GQEA 2LQBA 3CJ0A 3OFEA 5DG9A 1HHTP 4ID5B 1FT8A 2QJ3A 5L46A 3K5OA 3ET6A 2J8SA 3DNCA 4UZCA 2C2MB 2ZHAA 1R8PA 1MG7A 4DL2A 3CVKA 4LRCA 3VGUA 2LXUA 5E3QA 3W8PA 3DRPA 1UW9A 3GLJA 2WBMA 4UW2A 4USVA 4C3MA 4ZK7M 2HHQA 2LECA 3CDWA 4MFBA 3O1LA 6AT1B 2DVIA 5HBMB 5A0YB 1XJWB 2NXUA 3H8YA 3LUYA 1S79A 4KHPF 4K4VA 2HQFA 2CPZA 4UZBA 3QMQA 2B4VA 4WK3A 1UETA 2FVCA 5KG1A 4NLPA 2GCFA 4CT9A 5GVQA 4OZLA 2IM2A 3KK2B 1PJ5A 1RWNB 1IBKJ 1IQTA 1D9FA 5CYJA 5B09A 4K5RA 5HQ8A 2XB2D 1CQMA 3QAUA 2YWHA 3CCSS 1PILA 2ZJRQ 1QJHA 4PUOB 4U95A 8RUCA 3CCVS 1KDNA 2J0XA 1NKCA 2ABYA 4IR9A 4OI4A 1JWWA 4IRCA 3AOAA 3B4DA 2A0FB 4ED3A 1P27B 3BGFA 1NK4A 3GONA 4M95A 1YK9A 4J91A 3TAMA 2RDJA 2B3TB 2IBKA 4DCOB 1TKZA 3L7OA 2AGPA 4CH7A 5B0AA 4BWMA 3GJQB 2FC9A 3T6JA 5CA5A 4P7VA 1WC4A 1VC5A 1NK5A 2MLZA 1VQ9S 3FUYA 3IG1A 4I2QA 1VOMA 4ED0A 1KC8T 2CNKB 1RAJA 2APOA 2FHMA 4JP8A 4CO0A 1V3SA 1OQ3A 3KG0A 2WOMA 3OL9A 1WELA 1S9FA 5D8HB 3CMAS 4DV2F 1EKRA 4V19X 3AFGA 3W2WA 4LFBF 1WHVA 1TKTB 2YKMB 2F65A 4NXNJ 3W2VB 3RBEA 2NQPA 2VASA 1YBTA 3M8PB 4ECVA 3M1VB 4YHHF 3PV8A 2NXNA 4OHYA 1X4HA 3W9IA 2JEFA 5H9FK 5MAOA 1UTAA 4KO0A 3D3BJ 4GRSA 4QU6A 3HVWA 5DDQC 5I3UA 1JLGB 2UVUA 1HD1A 1J2VA 2R7XA 4KGVB 3VF0B 4PQUA 2BDPA 3QYYA 1SQEA 4Z7CA 1CS4B 4EI2A 4DV7F 4R25A 2QRRA 3LP1A 3H0PA 1RT4B 3RAXA 5GADI 6FDRA 4ICLA 2MHEA 2P6SA 3GZ7A 3HKZD 4MK7A 1UFKA 1T0TV 3CIZA 5DS7A 1HR0F 1XR5A 3WX8A 3GILA 3C46A 2YPZA 3GIIA 5SUHA 2UXBJ 4RBVA 2K3KA 1LWXA 1WD6A 4IKAA 1LKZA 2FJAB 1RT7B 2M2BA 3BEGB 3FEYB 3HFVA 1C1BB 2GVDB 4DUZJ 1S9EB 1LOUA 2W2MP 3HZGA 3KLVA 2ZKTA 2EG2A 1WC3A 2MZSA 3EDQB 3MHYA 4F8RA 4LF8J 1SKRA 4UF4A 1S1WB 2Y0SD 4DR4F 1RTDB 2B8QA 4TKTA 3VCDA 1EP4B 3TARA 1RADB 3DYAB 2F40A 4DSEA 5DO2A 4DQIA 1ZM2A 5E2QA 1M1HA 3TZZA 4OX7A 2G0CA 3C16B 1ROFA 3EGZA 3HVTB 2DO0A 2K06A 1SJFA 2DY1A 2L9NA 2F5GA 4P2XA 1RAHB 4J9OA 2F4FA 4NASA 3OTDA 3J80U 2AJ0A 3NLCA 2EFVA 3VZIA 2PMWA 2VB6A 5BR8F 1T05A 4B17A 1GMWA 1HWJA 4WE1A 4OJ3A 3UD3P 2ZOMA 4NLOA 4JI7J 4G3IA 1HKAA 2GIRA 1Q0NA 3PCOB 2W1BA 4FVMA 1B7YB 5E41A 2W9BA 4CLZA 2OH2A 3DOKB 4NI2B 3UDLA 4Y0FA 7FD1A 4Y6IA 1H73A 1S0VA 4P2SA 1LFWA 2FJDB 3BV8A 3C14B 2MQMA 3SQGA 1NXIA 1M1GA 5LJ3Y 4KHRA 2ZVSA 3MFIA 2BXJA 4WE1B 3KK3B 1FWLA 4C11A 2IA6A 4B02A 2Y1LB 2DKOB 1U47A 2N7YA 3DFEA 5G0RB 4PUOA 3PJXA 5L38A 3DU6A 1G2EA 2R7TA 2Z2LA 3I9ZA 3CW2C 2PN6A 4OLOA 1RHQB 1S6PB 2G1HA 4TY9A 2V8HA 4J9PA 2MQ8A 5ETSA 1HBMA 1T3OA 2ZDPA 2XS7A 4IUFA 4F50A 3AA8A 4WPAA 3CDAA 3DGPB 4HT7A 1Y10A 4L6V3 5AXKA 2V4QA 3DLEA 1N5TA 2R7WA 4ATNA 2WW4A 4K2JA 2DPIA 4F36A 3PZPA 3M8QA 1PCAA 1H0HB 5CZXA 4RWWA 3A8KA 1X4CA 3FQKA 2HAFA 3JSMA 1REVB 3KUEA 1WHWA 4MK9A 2H1YA 1TK8A 1VQKS 2Y9HA 2OUGA 2RDIA 1F5AA 2QT7A 1T03B 1PYSB 1T3NA 3Q2SC 1M90T 1IWAA 1K1SA 2F8MA 3C6TA 1DJ0A 2DITA 2F8EX 2D1CA 2LQ8A 3AJ2A 1JJ2R 2WHOA 1VRUB 4XK8C 3G9CA 2YWGA 3FMBA 1D3WA 3DLKA 2BW2A 4HL9A 3W64A 2VOPA 4F0KA 2DHGA 1VLYA 1UKUA 1OIAA 3BGRA 2WVCA 3TVZA 4YB1P 5L1JA 2BR0A 2V9WA 1NKBA 2EPIA 3K5PA 1Q16B 1LWFB 1H2UX 3QBCA 4N7TA 5IFMA 5AXNA 1U09A 5F8HA 1U1NA 4F02A 4ANEA 4J9MA 2M7SA 1AB8A 1OSCA 1CJKA 1FDBA 2KRRA 3R5GA 1WG1A 5CYMA 2DIVA 2MXYA 1J5OA 1FRIA 5DZ7A 3IWNC 5GAGU 3A12A 1N5QA 3EWGA 3HHEA 4DL5A 4PR6A 5J1NA 4PWWA 3HD1A 2E7XA 2R7UA 1D8ZA 2LDYA 1DHMA 2MKKA 4RNOA 2ROPA 2Z30B 5CHCB 4ZPTR 5B0CA 5HROB 2GQ2A 2CPJA 3PACA 3WC0A 4YDXA 5FLXY 3GJTB 2IJFA 4PZVA 4JI0J 2RHQB 2VQEF 2DR8A 4C0BA 1RCXB 3H4BA 3BO4A 3UNYA 1RU1A 4RL1A 4NCGB 5A8WA 3FSXA 4USUA 4ZVFA 1JXVA 2L41A 4C8OA 4LVNP 1NSAA 3I4PA 4BHQA 2MGZB 1OPZA 4OMFG 1QSYA 1SI9A 1FJCA 4GVBB 1PKUA 1A0OB 4B9UA 2B0GA 5KT3A 3TOQA 4B3SF 3MAAA 5D0GA 4OJ1A 3RBXA 5F8NA 3PR4A 1TTHB 2R7QA 4LIWA 2J6SA 1U6BA 5D6GA 4IFVB 2KG1A 1HBNA 2HK2A 1C0TA 1B0TA 4LBPA 3VGTA 2YWEA 3T5LA 4CLLA 1M5PC 3EVWA 3HHLC 4DFKA 1C4AA 2C1EB 2CAJA 3TP2A 4LFAJ 3TI0A 1F0XA 2BX6A 4ZJLA 2B9YA 3KJNB 4EWTA 2OPSB 3UDVA 1FJEB 3HT0A 4ZCKA 4LF8F 1FE0A 2RB7A 4XIUA 4J9NA 2R8KA 3ET6B 2DNHA 2XMJA 3Q24A 2CPEA 1KD1T 2NREA 2GMLA 4LR7A 2KZZA 3K5MA 5H9EJ 3SSSA 2R8HA 1PGZA 3C19A 5CCMA 3P4UB 2OTLS 2VDIA 4RW7A 1L3KA 5EHHA 1RUSA 2QEXS 2JFDA 3PDNA 4A46A 2QIFA 4CYUB 2C3UA 2XMTA 2H3EB 5CZVA 5C25B 5KFJA 5KFRA 3DRRB 1OS5A 2GQQA 1NDPA 2NSBA 3W5XA 2R42A 1KKHA 3FJ2A 3V81A 5BXIA 2OFGX 3EPIA 2VHGA 2ADBA 3JXOA 1QAXA 4DPUA 3IRXA 3RBDA 3W1YC 1S1VA 5CYQA 1ELOA 5L39A 3PW5A 3DLHA 2EG1A 3EDRB 1M5SA 2HRYA 1KS2A 3B8HA 3H42A 1M5HA 5KFUA 4BC9A 2XCPA 3HVRA 1S48A 3NCPA 4ERDA 2V94A 5IOLA 2DRDA 2KM8C 3CCQS 1U1QA 4O23A 4USJC 3ADAC 3BBFA 4NLUA 4ED2A 3CCWA 2P6TA 3G96A 1IBLJ 1SC6A 1HNWF 4N8NA 4O3OA 3IMQJ 3GV7B 4ECZA 2FQQB 2WB1D 1ZZNA 2DT9A 3LOUA 1VQ6S 1FRMA 4CDIA 3OVSA 1JX4A 1FK9B 1EETA 3QNWB 4N41A 1RT1A 3KLGA 1HW9A 4IG0B 4IG3A 3MMAA 4C48A 2PGCA 4A8WA 4JV5J 1CVJA 3CJSA 2RQMA 3LAKA 4YMEA 3C3LA 1HBOA 3VTIA 4DEZA 5C2GA 4KKOB 4ED6A 2ASYA 4QIWD 2V50A 3LF0A 2FZKB 4BDPA 1S6PA 5C24A 1YIJS 4DSIA 4KO0B 3OVAA 3GV8B 3QO9B 4ANDA 1AFIA 2DGOA 4R0EA 2QFIA 1NU4A 4QQBA 3IS9A 2WBRA 1L5UA 4U67Q 4UQTA 2AYBA 4G65A 3MEEB 1YBUA 1ZYQA 1SJ3P 2PI4A 3N6NA 3JQMA 2VPYB 3KK1B 2RILA 1UEKA 4H4MA 1AYEA 1KONA 1S6QA 1S12A 2KKHA 3D6MB 4LF6F 2XNQA 4ZMMA 2ZHBA 4F3QA 4DV5F 2RU3A 4RW4A 3RAQA 2JLEA 1NDCA 2DRAA 4UY85 2IJNA 1FEHA 3SFUA 1RB0A 4RNFA 2WSCC 2EC0A 4UY8T 4QWCA 2PA8D 3CDEA 4CQ1A 1WHXA 3MUVP 3D68A 2HLUA 2YKNA 3W65A 4DFMA 1RYRA 1H6KX 3VALA 2C22A 2Y1RI 1BWEA 4LRBA 3VV2B 2HQCA 3MM7A 4CLYA 2XHWA 4S0MA 3HZEA 4MK8A 3LWLA 2B5JB 1N4LA 4LF7J 4DR7F 2HNZB 1JLEB 2QN6B 4ECTA 4P6QA 2DGWA 3CSKA 3NGSA 1SH0A 5C42B 3V5RA 3PRBA 3RRHA 1Q5VA 2V0NA 3CJKB 3MECB 2M3DA 5J1EA 2FY8A 3FCHA 2BJ1A 4FYWB 1NK7A 1FO1A 4Z37A 1QTNB 4FYVB 3HLUA 1S97A 3M2VB 2PC6A 3L3CA 3UI3A 2BJ9A 1Y00A 1Q1KA 1X60A 4IOCQ 4WCEQ 3AOCA 1JNZB 1GEHA 4TLRA 1SXLA 3MPUB 2BOPA 2VOOA 1WOOA 1MWZA 3RBZA 4DV4J 1UVMA 1SV5B 3L09A 2VD3A 4RUBA 4CO4A 4L74A 1QUVA 2D74B 1U8SA 4CYUA 5KFYA 4HR2A 2HQIA 2C3PA 2L3MA 2Y0BB 3H2VE 4DX8H 3J7YU 4NOHA 4RW7B 3RB6A 3U1NA 2C2RA 2YQ1A 5KFQA 4OHVA 4C8MA 3R7SB 4TXSA 4H4KC 3BO2A 1RA6A 3NG8A 1L3SA 1C2PA 2G0IA 2RS8A 4N77A 4ZIVA 1UCNA 1J5EJ 2JRSA 4IDKA 2WAQD 4IFYB 4HI2A 1ZPWX 3H5SA 2DHXA 2DISA 2X7IA 3M2VA 4O3PA 2XMWA 5A2QY 2W7PA 2XMAA 2RF2A 3P3DA 4B3OB 4Y65A 5JJBA 3UD5A 3SIPB 3OW2R 4ZA1A 1MWQA 2BE2B 3K8WA 2HS0A 1N34F 2XSJA 1WG4A 3MOZA 5F8LA 1Q4RA 3G82B 1YZ6A 2YX1A 1T7PA 2A1BA 1ULRA 2ZFHA 3FCVA 2DGTA 3P49B 4P73A 1RBLA 5J2NA 2DB1A 2PO4A 5F0UA 3FEXB 4O3NA 4ZP8A 5ETMA 3TX8A 1SKSA 4LF9J 2JOQA 3JTPA 5BYRA 1IM6A 2MQOA 4YHHJ 1OJ4A 4IYQA 4JI4J 3QWPA 1B70B 3H2UB 1VBKA 4QIVA 2YH0A 3MDFA 3A4TA 1B0VA 1NAQA 2VG7B 1SJQA 1X7VA 2AEJA 2D41A 3QZ8A 5BYQA 3N5FA 2YNHA 3BZQA 5E3PA 1TUWA 3KHGA 3MM6B 2V6AA 1Q78A 4NYPA 4PYAA 4QWDA 2E5JA 1MMDA 4O3SA 4B3OA 3Q8RB 2HNYA 4ZJQA 1F5CA 2GIQA 2OMLA 3D1HA 4DUZF 3PX6A 1NM2A 1XMOJ 4B3RF 3NMRA 5HROA 2CDRB 3FQLA 3GB0A 4CIOA 1R3NA 3OTOF 4PKDB 3N01A 5CYQB 2PDAA 4PG8A 4O4RA 1WUUA 5KT2A 2PT0A 2BYCA 2VC0A 2UXBF 4HT5A 1RT2B 5C5JA 2CVIA 3G6XA 4JI3F 1V5IB 1HR0J 1KOHA 1FRLA 2CQCA 2NXJA 5ETVA 2R8IA 4DZ6A 2ZH6A 3IA0A 1N33J 2MZTA 2VH7A 2FHOB 1FRHA 1FDAA 2FZGB 2I38A 3Q8VA 3QPIA 1CJKB 4M5IA 2D69A 3KG4A 3GIMA 2M4MA 2FHJA 5DDPC 2ZH7A 3B54A 2R3VA 1TK0A 4B3TJ 3PXGa 1IBKF 3ICLA 3I56S 2VC1A 3DI6B 2XCAA 1N5VA 1IJEB 1WKKA 3I32A 1S9GA 4QIFA 1IKVB 4IG0A 4JI0F 2CPHA 3QFWA 5C7PA 4RBUA 3K2YA 2I1RA 3CNQP 4ZLJA 4ZHRB 3R5JB 2RUGA 3JTNA 4ZHRA 3M9MB 3BPSP 4RR5A 1LQ9A 3TA0A 3DM2A 3UO0A 4A8OA 4F4AA 1X5PA 3D5MA 5HMZA 4DV2J 3PW0A 3GCXP 1QUPA 2HFUA 1GMUA 5KG5A 3MAAB 3UN2A 2CYYA 2EFPA 2HWTA 2I9SA 4QOTA 4C2MA 1TFWA 2HVZA 5KFGA 5B0BA 1M5VC 4K4ZA 3DRXA 2AQ4A 1TL1B 3POTB 3MR5A 5DM7Q 2CQHA 5ETRA 1NJXA 3PW2A 5KFMA 4A8YA 3CIMA 1JLBB 3W5YA 4DV0J 1UEUA 3TVKA 4EYHB 5C25A 1Y5IB 1OWXA 2YQ3A 4Y2MA 3MOJB 4TU7A 4MYTA 3LGHA 1KVIA 2BJ3A 1XR6A 4PPDA 1FNOA 3MM9B 2YNFA 2E44A 4CLSA 4ECUA 1IKYA 4HLBA 1BC6A 2LDIA 5AXMA 4TY8B 1N6QB 4AD6A 3ILLA 1UVIA 2AD9A 4Q0BA 2JDJA 4KIAA 4F4YA 4F4ZA 3MR6A 2MY7A 2CJQA 1Y4ZB 4QYZJ 3AY0A 1YLXA 2NXCA 3N9UC 3QT7A 1NSKL 1G4CA 2JWNA 3EICA 4HH1A 2KXNB 2LEBA 3Q8UA 3TRGA 1KQFB 3IS9B 1DTTA 3CJ3A 2HNDA 4ZP7A 3QAEA 4DG1A 2VF3A 2JEJA 5KFBA 4GKJF 4I67A 3CE8A 5D4OA 4JI1J 2J7KA 3QATA 3M6VA 1HI0P 5LMUF 1I51B 3FEZA 2DGXA 2V4JA 3LPYA 4DR3F 1QSLA 4DU7A 1X31C 1VBXA 2E1RA 4QR0A 1B0PA 1MMNA 2N4CA 4HEA9 2IC3B 1U26A 2HQGA 1OYDA 3LALA 2HHSA 2OEMA 2GVZB 4DS5A 2DNNA 3PIPQ 4K4WA 2FHJD 5A76A 2W2NP 1T9WA 1VHFA 2LXIA 2GA7A 3FNNA 3HSGA 3PKYA 1S57A 3AB4B 4P2FA 5AE2A 3FCWA 2Y1JA 4CI0B 3IWXA 3DMJA 2BM0A 1ZM9A 2FUG9 4TN2A 1TUGB 2L08A 2VG5A 2VL1A 3G86A 1NDKA 3ZZRA 2A2DA 4DS4A 4B3RJ 1PYOB 5LMNJ 3PG9A 2QFJA 3BSNA 2DH8A 4UOCA 2XY7A 3I5CA 2BV3A 4F3MA 4F2RA 3HSZA 3TA1A 1CULB 3D0HE 3CMES 1ZAVA 3N0VA 1U45A 3M2RB 1P1TA 2V8GA 4A8SA 3L7PA 3BSOA 3GR0A 4ITSA 2Y1IA 4NXMF 4RLEA 4P2MA 3VGVA 2E7WA 2N3OA 2GC8A 4PQAA 3MR2A 4JYAF 1ZTTA 4F26A 1RT6A 2WW8A 2IBOA 2QL7B 5G4DA 1UFWA 2HFZA 4ES1A 1LW2B 1RYSA 2QTWA 1CBKA 2DRBA 2KYZA 2V67A 3SCJE 4KSEB 3UPFA 1GH8A 1CJUA 1IR2A 2RHSB 1VQ7S 4W98A 4LIRA 1AT1B 3K0JA 4Y2AA 3VVTA 3GE9A 1C1CA 2MTLA 1HNIA 3JS9A 4NI2A 4YB7A 3W63A 1PJ7A 4M5MA 2LCWA 3UCZP 4KPYA 1J27A 2XSFA 4Q0BB 2ZUAA 5KG0A 3FZBA 2DK2A 2PFFB 1WORA 4WFNQ 2XO7A 2KZMA 4HH0A 3ZZUA 4IRKA 2R4FA 2P8IA 4Q2LA 4NE9C 3G6ES 2QGFB 3KFWX 1O51A 1B4SA 2KM8B 2PI5A 4M5DA 4EUVA 2M52A 1VYAA 4ZN1A 1N0VC 3MZIA 2OD4A 2NYIA 1J5EF 1IXKA 3ETOA 2B9XA 3F73A 4DF4A 4C97A 3DC2A 5DQHA 1UWBA 1SQGA 3D9BA 3I6PA 4F2SA 4W92B 2E5HA 3ZZ0A 3DYAA 3HF5A 1NPRA 3TWZA 3HK2A 1Q8KA 3MM8A 2UXDJ 2W4PA 4CZCA 3CF5Q 3QIPA 1O5JA 3EYZA 3RR7A 2DNQA 1NCLA 3OT9A 5FJ4A 4MAKA 4IQMA 2ZNYA 2XM3A 3CD6S 4LF5J 1C1BA 2RQCA 4LF6J 2Z2YB 1X9SA 2RDDA 1LWEB 3TZXA 2UUAJ 4ECSA 3THTA 2UUTA 3DRSA 2BBEA 1UJ5A 3NY0A 4FDFA 4RUAA 2ZEJA 2HFNA 4KB7A 2ZH4A 1FX4A 2EEYA 3PJ9A 4CTAA 1X5SA 4ILRA 4DJBA 4F4XA 2BKOA 4KV8A 5I42B 1VGYA 5AJ3J 3U1MA 1S1UB 3MR7A 3O44A 3DOKA 2HIQA 4KGXB 2CPDA 4KGKA 4OV1A 2P9CA 5B0DA 2R7SA 4V19J 4DR6F 1T9TA 1K0TA 4OV6A 3NP5A 1TFYA 2J5AA 2GJIA 1YI2S 3QRPA 4PCQA 2FZCB 2D9PA 3J7Z5 1KHWA 4FF1A 4OZ2A 1DBDA 3DDKA 2BQUA 5CYMB 4AFFA 2VJVA 5DGAA 2CNOB 4IOBA 4TU9A 1XR7A 1ZS6A 2QYCA 3W62A 1RWKB 3TANA 2MQNA 2FDNA 3VAMA 2Q6BA 1AROP 4WTOB 2PMZD 4EZ9A 3V6KA 5KG3A 2K2PA 1EP4A 2F8HA 1IKWB 1RT1B 3KLFB 2JEGA 3HJFA 3KLIA 1K44A 2RRBA 3V4MA 3OTOJ 2CQ4A 3JSBA 1JB0C 3DLKB 1Y3JA 2N82B 4H4OA 3B78A 4MH8A 2W8LA 4DV5J 1T03A 4DQSA 5IV3A 5GADU 2FJEB 2ZBRA 3A8EA 3TX0A 4ETZA 2ILYA 2VDHA 2QO3A 3EXCX 3OR2A 4G1QA 3CJ2A 1IBMJ 2H48B 3VHQA 3BH6B 1NO8A 2FVQA 2HSEB 4I68A 1RTIA 4DX6A 4X4TA 2UXDF 1MU2A 3FFIA 2O01C 2UUWA 3D54A 1R0AB 1FRKA 2O5DA 4PG7A 4AXJA 3BR9A 1RHUB 2AKWB 2F9DA 1XTZA 1FKPB 3T1AA 2K8GA 2MLXA 1VQ4S 1LNQA 1D8YA 4L3KA 3HVAA 4M1KA 5CXTA 2NPFA 2LQ5A 2LA4A 2Q43A 1MMLA 3CCTA 4YY3J 2IC3A 1WSVA 3BDPA 3GIKA 3M1VA 1ZH5A 1VQLS 1XNQJ 4O44A 2EBGA 3LP2B 4QIEA 2ZKUA 1ZETA 3R5AA 2OPRB 1WEXA 4ECXA 1BLUA 1PC4A 1UWAA 1S6QB 2V4JB 2YKMA 3CPWR 5J2PA 3PO4A
chains in the Genus database with same CATH topology
3OTCA 1CC7A 1CC8A 4EBDA 4K4SA 3HHKA 2ZDOA 3OR1B 3R5CA 3CCMS 4KFBB 3WBZA 6FD1A 1TQLA 2FGCA 4KFBA 1X5TA 3HO1A 1GX6A 1X4DA 2LQJA 1LV5A 3SXLA 2CJAA 4ZKAA 1CPZA 2QMXA 4TYAA 4DSKA 4IH6A 3AQOA 4NZ7A 1YRTA 1BD6A 3D0IE 4DL0C 4EGLA 4YFUA 5KFEA 5E5NA 3NS5A 4ES2A 3KHLA 1CG2A 2DJWA 3D1OA 4TY8A 1X5OA 1TKDA 4YP3A 1S1TA 2ILZA 5M2RA 4PG5A 1U24A 2ZH9A 5K9FA 1GTHA 1CSJA 2DH7A 3M2UB 1S6OA 1U2RA 2J0SD 2G4BA 2OPQA 2DR7A 3AHPA 3DLJA 2VODA 2ATLA 4E0DA 3G8TA 1HHSA 5KOXA 5J1EB 2IHR1 1TP7A 5K8MA 1TL1A 5H1SV 4A48A 1D0EA 3MMBA 3TUJC 5DQIA 3CC7S 3GYXB 2LEAA 2YKAA 3ENVA 3HHLD 2OFHX 4J9SA 4DOZA 4FVCA 4I2PA 1HNVB 3OL6A 1T02A 1V6HA 2E66A 4FN5A 5E0OA 3HHDA 2GX8A 4O3RA 2RD5C 3R5BA 3MAHA 4H4OB 1VS3A 3OLBA 3DRPB 2CJ9A 3ISNC 1L3VA 5JXSA 1N52B 1GNKA 1AUDA 5LJ5Y 5E33A 1IKXB 1HW8A 1OQ6A 1X4EA 3M2UA 1BY9A 1JLQB 2MJNA 2I0XA 4J5OA 5G0RA 2WSEC 3KWMA 5F3TA 3H2LA 2CQ3A 2ZH5A 3MM5B 3M8PA 5CQGA 2NZ4A 2ZE2A 3FRZA 4GC6A 2KXHA 1VC0A 3JAMY 2OP5A 3C6UB 3HP6A 1WI6A 3DRSB 1VQ5S 3LP0A 3IWLA 4RW6A 3BQ0A 3I0RB 2OLWA 4TQRA 1SIZA 3IFEA 3V6DA 1QSSA 2VUGA 1HD0A 2DNRA 1UL3A 4NRTA 1YJUA 3OLAA 1O0PA 4QWBA 4OI1A 5F9LA 3QJJA 4NX9A 4NLSA 2VKRA 3DOLB 1YJTA 3MEDA 5J2MB 2HGNA 3E01A 4ED1A 3MM9A 1KHVA 3OTEA 4U7UK 1FD8A 2WCXA 4OLPA 1S1XA 3T1YF 2LVWA 4EO8A 5L9NA 4ZP6A 5KFVA 3Q8QB 3I0SB 1HYSA 1FD2A 4G1PA 4MKBA 5T7LB 3KK3A 3V2UC 3MEDB 1HMVA 5J2MA 3U1LA 3MURP 2HHXA 2PD1A 3EZUA 2RU9A 2KVIA 1FESA 4CO2A 4WFZA 1G1XA 4NMLA 5JUMA 1NJZA 1JXEA 1C1CB 3E8OA 2XI3A 1FJ7A 4ECYA 1D1UA 2VG6A 2V5HG 4W90B 2CQBA 1R8HA 1VQOS 4B9LA 1T05B 2RE1A 2MHNA 3E51A 2ASLA 4B3TF 2VPWB 1JLCA 1AW0A 1J5OB 4B3MF 1HNIB 3VQSA 3CD7A 1S0NA 2J0WA 2PMHA 5D4LA 5KFKA 3FDSA 4I64A 5K5MA 1S9GB 3VAIA 1S77D 3UCUP 4FYDA 1P1LA 2GGPB 2B4OA 2KB2A 3DI6A 2B7BB 1LW2A 4I1TA 3HT3A 3OFFA 4NCAA 4KBIA 3NBPB 3MTKA 1HQUB 4CH1A 3RB3A 1R27B 2M5YA 4OL8A 3GFYA 2KXFA 1U1MA 3ZC4A 1RA7A 3DLGA</