1NHKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The 1.9 A crystal structure of a nucleoside diphosphate kinase complex with adenosine 3',5'-cyclic monophosphate: evidence for competitive inhibition.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Phosphotransferase
total genus 41
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nhkL00
1BE4A 1NDCA 2CWKA 3VVUA 5IOLA 1NLKL 3NGUA 3Q83A 3EJMA 1S5ZA 3EE3A 4CP5A 3EMTA 3Q8VA 3VGSA 3ZTQA 2VU5A 2DYAA 3VGUA 2HURA 3FCWA 2B8PA 3ENAA 1K44A 1NCLA 1UCNA 1HIYA 3NGRA 2DXDA 4ANEA 4F4AA 4UOFA 4UOGA 3VGTA 1WKKA 3GP9A 3FBBA 1LWXA 1HHQA 3BBCA 3DDIA 3PJ9A 1PKUA 3NGTA 3Q86A 1WKJA 3R9LA 3Q89A 2HVDA 1ZS6A 3BBBA 3ETMA 1NDPA 4F36A 3VGVA 4WBFA 5CAAA 4S0MA 5CABA 4O0NA 3ZTPA 4ENOA 3Q8YA 1BUXA 1HLWA 1F6TA 2DXFA 3BBFA 3WX8A 3ZTSA 3B54A 2AZ1A 1VYAA 4KPCA 5BXIA 2BEFA 1U8WA 1W7WA 3VVTA 3FBEA 4HR2A 1PAEX 3Q8UA 3ZTRA 2BX6A 3FBFA 1MN7A 3MPDA 3BH6B 1NUEA 1NSQA 4ANDA 3GPAA 3BH7B 1LEOA 3B6BA 3ELHA 1MN9A 3EM1A 3FC9A 2HVEA 4FKXA 1NSKL 1KDNA 1NHKL 3EVMA 2ZUAA 1B4SA 2NCKL 1NDKA 3G2XA 1BHNA 2DY9A 1B99A 1NSPA 4EK2A 4FKYA 3FCVA 2B8QA 3EICA 4DUTA 1NPKA 4ANCA 3EVOA 1S59A 1JXVA 4DZ6A 3EVWA 3ZTOA 3PRVA 4W98A 1EHWA 3FBCA 3NGSA 2DXEA 1F3FA 3JS9A 2AZ3A 4UOHA 4DI6A 3FKBA 1WKLA 3DKDA 1XIQA 4C6AA 5C7PA 1NB2A 1S57A 3L7UA 1XQIA 1NDLA
chains in the Genus database with same CATH superfamily
3TZXA 3TA0A 3TANA 2X3DA 2B7CB 1X4HA 4BCAA 5D6GA 4I56A 3M1VB 2E1AA 3TNVA 2L08A 2YKQA 5E7OB 4RBVA 3H40A 4Y65A 1HBOA 1PYOB 3CE8A 2CXEA 2H54B 2AYBA 4JI3F 2DHHA 1IKWB 1M5PC 4PG5A 2RMLA 4DCJB 1FK9B 4RW8A 1SJ4P 1EKSA 4NOHA 3ISND 3R5GA 1NJZA 2M0GB 4ELUA 1F1BB 5CYJA 2XI3A 4NMLA 4CLWA 3BM7A 1T3OA 5DZ6A 2HVZA 2A10A 3PYGA 4ILRA 2XNQA 2CRLA 1TL7A 4OZLA 5HO4A 2EW9A 4ANCA 3ZO7A 3PW0A 4ZLPA 4GMKA 1H2TZ 2GMJA 4K4ZA 1T95A 3DOLB 4OYOA 1K8AT 1TV6A 3SCLE 2JEFA 3C14B 5E3RA 2HHUA 1L3KA 2OPSA 4RNFA 2VPZB 1NMEB 2UUBF 5IFMA 2XYGB 5D3GB 2ZNYA 4IOBA 2A2DA 2E9RX 5L8RC 4KJIA 1WI8A 5HMZA 3MDFA 2GVDB 1PBAA 2DR8A 1Y5IB 4FN5A 4NCAA 1ZM4A 4FVCA 2BJ7A 1H0HB 1AB8A 1RDRA 4O0NA 3DRSB 2CZ4A 2NS1B 1X60A 3I9V9 4CTAA 3K5PA 2WAQD 1YJTA 1MU2A 1RT6B 1RSCA 2QTWA 5J2PB 2HVEA 2ZHOA 1N36J 1HNIB 2C3PA 5F8GA 1SC4B 4IO1A 4DR7J 3W60A 1LK7A 1HI8A 2KH9A 4YHHJ 3JTOA 1CQMA 4WU3A 1FESA 2YH0A 4OYXA 4DI6A 4A8SA 4B3MF 3PW7A 2GAHC 1U1RA 3T5HA 4F3MA 3BV8A 4NLWA 1YQHA 2HBRB 4RU9A 1CSJA 1D09B 2YKMB 3ZTQA 1FRLA 3RRGA 2X3GA 2NXNA 3JSRA 5HI7A 1MROB 4ID8A 4LF6F 1X8DA 3TOQA 4F3QA 4DN0A 2BQ3A 3ILLA 3GQCA 3Q89A 2DD8S 3CJ5A 3SCIE 1IBLJ 2DXFA 5HROB 4RZRA 4X4RA 1RTIB 3P4UB 2VB6A 1OWXA 3PYEA 2HBQB 2OPRA 4I4BA 2VG6A 4UW2A 2AX1A 2FHMA 1TUVA 1DQ8A 5GMKa 3MD1A 5CYQA 1NPKA 1WC1A 4U7CA 2VPYB 1T03B 3MMCA 3KYLA 4B3SF 3ZTOA 1FCAA 3UDVA 2QGFB 5IC6B 2BRLA 1EHWA 3ZZYA 3ET6A 5EWFA 4A8WA 2DRBA 4RBTA 1JQGA 2OMOA 1UAWA 3CB4A 3OVAA 2CWKA 1JJ4A 1S1WA 1JMTA 2LXIA 3G86A 2P9CA 4BS2A 4R0JA 4USIA 3PRDA 4IQMA 4UOFA 3DC2A 2BMBA 4DR3F 4OX6A 2KVIA 2VA2A 1JLFB 4CLZA 1RLDA 2JC1A 2CZVC 3NEKA 1YZ6A 1TAUA 2GGPB 2GJIA 4N56A 2QLJB 2YTCA 1FKOB 3LP2A 2AMCB 3FBFA 2WHOA 3BH6B 2ZC3A 3H0PA 2G0JA 3RU0A 1R0BG 4ZLNA 2ZH4A 5C25A 2HHQA 2FLOA 3BSNA 4LSNB 1WF2A 1SH3A 4AQYJ 1B7YB 5DJBA 4IFVA 2QC3A 4J9SA 1F9FA 2AZ3A 5AXMA 3OXFA 3ZZUA 3RUBL 3DLEB 2E1MC 3K57A 5DLFA 4DUYJ 4K2XA 4ECSA 4MKVA 3UQSA 3OFGA 2VQFJ 4RUCA 3CCUS 4DR6J 2HHTA 2VH7A 1KS2A 2NREA 2XYHB 3UVJA 1TVRA 1ZPWX 1WUUA 3QMQA 1U7LA 1R0CB 1RTJA 4BLGA 4ID5A 1VQ5S 5HQLA 1S79A 3BDEA 3ZTPA 4DS4A 2RSQA 1B0TA 1TKTB 2BEFA 4MT1A 2V8GA 4H4OA 1YJWS 3D67A 5KT6A 1PG5B 4F26A 4DUZF 4ZP8A 4A4JA 2BJEA 3NS6A 1NSKL 4NXNJ 1YIJS 5E3QA 5CYMA 2OAUA 1NU4A 4LFAF 4KV8B 1PAUB 5ADZA 1BGXT 3CCZA 1IUJA 2ZKUA 4XDCA 4TQSA 2FQQB 4QW8A 5I3UB 3PIPQ 1N0VC 2LXUA 3D28A 1S99A 4DSIA 4E0DA 2PFDA 1UEUA 2VBWA 1IXKA 2J6SA 2ERRA 3RBZA 2EFQA 4NYOA 4G1QA 1NZ8A 3CCWA 2HHHJ 4LFCJ 1N5YB 1NJYA 4ZP6A 2ASYA 4OYBA 4OYIA 3TX0A 4CLTA 2EBGA 4XK8C 4JI4F 4A8FA 1Q7YT 4DV4J 3OVSA 3BO3A 1BMQB 2KVQE 5IZHA 1H38A 1R0AB 1N0UA 3B54A 1GX6A 2I0XA 2DNGA 3OR1B 1F2HA 3IC1A 1F9HA 1NJWA 2K3IA 1LEOA 2O3DA 3LUYA 1D3WA 2JH3A 1HI0P 1DZ5A 1M1HA 4PRFA 3KLIA 3C16A 1WG4A 4I7FB 2W8LA 4J9NA 1T8EA 3IG1A 4JYAF 1G6BA 1JWWA 3N6LA 2VG7B 1RT4B 1OIAA 5MLCV 2Y1JA 3M8WA 1XTZA 1XBWA 2QMUB 2HVIA 4AXIA 5KT2A 1JLBA 1KKHA 3DLJA 2VUGA 4IH7A 4WFZA 3KJFB 3JTPA 3O5TB 4ED7A 1FDNA 2YWEA 1T9VA 4PZVA 5ETTA 4RNOA 2ZOMA 5LSLA 3RAMA 4WFNQ 5LMNF 4X64F 2GC8A 2PO4A 1S1UA 2BJDA 1GMWD 2CAJA 1P8GA 2CNKB 3M8PB 2GA7A 3H59A 2AZ1A 4LF9J 4B3OA 2W2NP 4ZVSB 3VCDA 1R3NA 1QE1A 2ZH3A 4J9OA 1FI4A 1VQ8S 3K89A 3CWJA 4ZJQA 3C19A 1BD6A 2IJNA 4YQWA 3EM1A 3HD1A 1Y11A 2YNGB 3TEHB 4X66J 4UQTA 2XC9A 5HLFB 5CZVA 1NSPA 1LXJA 3SCJE 3BB5A 1RT1A 2XBPA 4GVBA 3OFEA 2F8MA 3CMQA 2H48B 3FKBA 4O44A 1S0OA 4CH0S 2RHQB 3M6UA 5T7LB 1FRMA 2ZDOA 1F60B 4DSFA 3R5BA 4LF1A 4TU8A 3VVUA 2HLUA 3IRWP 5L1LA 4Y00A 2QYGA 3IMQJ 1CJTA 2C2MB 2OP5A 5D77A 1IQZA 3T19A 4HKQA 1GXLA 5KFKA 4X4QA 2EKNA 1AFJA 3TQ1A 4KBIA 1R89A 1HNXF 1TKZA 1LWCB 3HSGA 2B56A 4OHXA 3MCNA 5IV3A 3MPVA 2W2OP 3PNIA 1OQ6A 2YPZA 2QL5B 4C11B 3S01A 4PWDA 3R5CA 1DFDA 2FVSA 1VI7A 2HZAA 2DR5A 3IBWA 3LPYA 3D68A 5AT1B 4NRUA 4CLPA 3JSMA 4OYMA 4U8YA 2DNMA 3FZBA 1X0PA 1LXNA 3N5FA 4XTTA 2X1GA 4PQAA 4ETZA 4M95A 4DPWA 4XPEA 1CG2A 4JI1J 2KJWA 2QO3A 1I1GA 1OO0B 1PBUA 4N8NA 1JB0C 2K1RB 1CEZA 2V4JA 1R8PA 1C1CA 2JLEA 1YHQS 3QRRA 2YQ3A 4QZVB 3U02A 2OPPB 2H51B 2LKZA 4ZP9A 4DHVA 1S1VA 3TAMA 2Y1LB 2WCXA 2GIFA 2CPDA 5KG3A 2YNFA 1RWXB 3WC2A 1RT7B 1YRXA 3T5KA 4EYHB 2W9BA 4ZIVA 2QL9B 4CH1A 3US5A 4RNNA 1HNVB 6FDRA 2DITA 2YWWA 2UXBF 5JXSA 3PY8A 1UJ5A 2BABA 2IYGA 1U26A 2JNJA 1DTQA 2J8SA 1OSCA 1JKHA 1Q53A 1N6QA 5ETRA 1X9SA 2XZDB 3MCOA 3MMJA 2ZD1B 4J9PA 5HJXA 3G87A 4LF5F 4YP3A 4HI2A 4N77A 2Z58B 1F3FA 3TR5A 3MOZA 1FRHA 4KR0B 5C2GA 4O3RA 3M8QA 5IQQA 1IKVA 2UUCF 3CDAA 1RTHA 1T7PA 2UXCF 1N54B 3VALA 2DNHA 4YR2A 1SI9A 3W63A 1NLKL 2N7YA 1H7WA 4FPRA 3MM5A 2VPWB 4IDKB 2XG8A 4BHQA 1BWEA 3R7BB 1Q1KA 3IAM9 1CJUA 3MWBA 2WBRA 4A48A 5F8NA 5LMUJ 2XULA 4M5IA 5BYQA 4NI2B 2ZWOA 1HQUB 1FXRA 1YWXA 4PWUA 3WBZA 5B09A 3ZTSA 3BGOP 3AQOA 1EETA 2N4CA 4OI3A 1LKZA 3H7HB 4AL7A 5EN1A 2UUTA 3VAFA 2AEFA 3O8WA 1VGYA 4HH1A 2RQCA 5C2CA 4ZPWR 2XHWA 2J0XA 3F73A 3TZWA 1B7FA 2IAJB 2DISA 3GG1A 3W8PA 4OHYA 3FK4A 3KJVB 4EWTA 1QDUB 1ZPVA 3W2WA 1WNEA 2MSTA 1R8BA 3MAHA 2MKJA 1U1QA 1U0HA 3BYPA 1QUPA 1NK7A 4A8KA 3NXZA 3DLHA 3VHQA 3LWLA 4PXCA 1RKJA 5ITHA 3HVAA 2V2ZA 2MZRA 2DY1A 2EFGA 3LW5C 2J76E 3PW4A 4PXDA 1NJIT 4DV6J 3U1LA 1N5VA 4FYWB 3PX0A 2PMHA 4EFAC 3SSSA 1QTMA 1GAOA 4HHJA 1HQEA 4DL7A 3U1MA 3Q22A 4PXBA 2LXFA 5U47A 2ZOFA 1P6TA 2XGPA 5E0OA 1JLEA 2BKNA 3K5NA 2EEYA 1BQMA 2WK4A 2DH8A 3DMJB 3ZZPA 5H9EJ 3B82A 4JP8A 4DQIA 2AJ1A 4ICLB 1HD0A 1DTTA 2QA1A 4X65J 3N28A 3CDUA 3EDQB 1ZH5A 2OPQA 3G82A 4WK1A 5B0EA 4NRTA 4NA3A 1RWWB 1BXNA 4DV3J 3DRRB 4ES1A 3MURP 1NB2A 5C5JA 2CADA 2EI5A 2MKCA 1BE4A 5IT9U 2JDJA 2FHKA 2B8PA 3MPWA 5B0FA 1PO6A 3QGIA 1I3OB 4WFXA 4H4MB 4PQUB 1LWXA 4LR8A 3AJ2A 3KK3A 1KP6A 3Q23A 3BBBA 2VOOA 2FTRA 5KT7A 2ZH5A 1S1XA 4RW6B 1KQSR 4JI0J 2DEIA 2GIRA 4AFFA 2NXEA 2D74B 2KZZA 4LF7F 3P96A 4IYQA 5F0UA 5KFGA 3T1HJ 2VODA 1JLQA 1N36F 4ZHRB 3S7RA 4NLTA 1Z2LA 4DR7F 3Q8SB 2EVZA 2YWKA 4QIWD 3PX4A 1WWHA 3IWNC 1U1MA 3B8HA 1EQ0A 1HBMB 2UV8A 2HLTA 1FWKA 2QEXS 1VJWA 4YB5A 2EFNA 4LQ9A 4ED2A 4NZ6A 2OELA 2NLWA 2WOMA 1MWQA 4WIQA 2NUUG 4USMA 3T1YF 2V50A 4IRDA 1TQLA 2LEAA 2GZOA 4WWSA 2D3UA 5BR8J 1Y3KA 1UCNA 3NP5A 2CJYB 3BDPA 3V6KA 4GKKJ 3E2EA 2CQ3A 4IKAA 2XCAA 3V81A 3HO1A 5AE3A 3OTDA 3R7SB 4IR9A 1KLMA 5BXIA 1N34J 1IM6A 3T5JA 3DOKA 1WD6A 4IFYA 2RU3A 2IY5B 2R7VA 2GHPA 3H5UA 3FNNA 4WYLA 3FC9A 3A8EA 4K8RA 3QT5A 4JV1A 3PKMA 4G65A 4G6VB 5IQ6A 3LAKA 3R2DJ 5L1IA 1B3TA 4OZJA 1SV5B 3UR3C 3AOBA 4R5PB 3IM9A 1JNZB 4K4YA 1F5AA 1PILA 4PABA 3SFGA 2YKNB 4RJVA 4K5RA 4WE1A 5D0GA 1H72C 4Q5VA 3A8JA 3OTCA 1CS4A 1WELA 2CIMA 5KOWA 4I2PB 2Z2MA 5DGAA 4CP5A 2E66A 1RAEB 4L76A 3MM9B 1FKPB 2DXDA 1FTRA 1Q7LB 2X1BA 4K4SA 4CIOA 3BSOA 3EYZA 1QAJA 3BGRB 2ZBIA 1REVB 5FDLB 2GNKA 3M30A 1Y4ZB 4GC7A 2NPFA 4DG1B 1RZMA 1L3VA 1VYAA 4JI7J 2AHOB 3KK1A 2X7IA 4DSEA 2JZ5A 1UETA 3CD0A 4QYZJ 2CQPA 4YN3B 1YTYA 1LWFA 3CPWR 5THWA 4ZVQB 2GVZA 1KNZA 1F3VA 2CJBA 3GYGA 4QWAA 1UVNA 2V94A 3MD3A 1TR0A 2DPIA 3FDSA 3PZPA 2FLNA 4M5JA 1SQEA 2XB2D 3EZUA 3WHIA 1ROFA 4OFZA 3J7A1 6AT1B 4QCLA 4DR6F 4I2QB 1CC8A 3CJKB 2ZNZA 4ED5A 2A6OA 3D9BA 3QLHA 2KTQA 3C6TB 1L3TA 4I67A 2I5JB 3C6UA 3VGUA 2C3OA 2AJ4A 3M2VB 3TAQA 2VBYA 1HNZJ 4KGKA 1M1GA 4Q2LA 1S77D 2OTJS 3HHLC 3PM9A 4LVNP 2GX8A 3CW2C 5A2QY 1NK9A 3QGHA 1RAJA 1TAQA 1ZOTA 2CJAA 2HNDB 4HYKA 1Z2ZA 4ED3A 2KB2A 1S9GB 3P49B 4E8UA 2D3OR 3SV3A 1EIYB 2MMYA 4ZN1A 4QIVA 4QQBA 2ZBPA 1Z1ZA 5F9LA 1DHMA 4NXNF 1U4BA 1JX4A 1RB0A 4KT0C 4ELTA 3FCVA 2QLBB 1ACMB 4LFBF 1I94J 4HI1A 2HHSA 5DDRC 2UU9J 1T9XA 4F50A 3JQMA 2GW8A 5D4NA 1X31C 4R0EA 2ZJPQ 4H54A 5IWAF 8RUCA 5CQGA 1AROP 1Q78A 3HVRA 2QE5A 4ZVOB 1TP7A 4Y2MA 2YNIA 1XJWB 2YX4A 4V19J 1XNQF 3MCMA 4ZJLA 1AUSL 2R7SA 3DI6A 4NASA 2YKOA 2MZTA 5CH7B 1EAYC 4LF4F 1UZHA 3UDLA 1Y5LB 4CT8A 3DLKB 2BE2B 4KPCA 3RB6A 1UA0A 1UW4A 5J1EA 2DGXA 2VBZA 4HR2A 1PAEX 2EG1A 4W92B 4OJ1A 2E5JA 3MECA 2R2TA 3IRXA 1RWUA 2J9CA 4Q0BB 2XYPB 4QU7A 3M32B 1PJ6A 3PKYA 4TYAA 3OLBA 3KLEA 4PUOB 4OJ3A 2WVDA 1EP4B 2F9DA 2D9OA 3NOGA 3QSYB 2CPEA 2OD6A 1S10A 2R3VA 2BOAA 4NCGB 2IRYA 4M5NA 1ZM9A 2AJQA 3F0NA 2BJ8A 4IG3B 5KT4A 3CULA 1NDLA 4FZVA 4NXMJ 2FJEB 3HKWA 3M6XA 3TX8A 1S1TB 2DTJA 2FB0A 2VU5A 1QSSA 5ETVA 2A6MA 1S9FA 2QLXA 4HT5A 5KFFA 4M5DA 3RZAA 5A8WB 2MHNA 2HAFA 3G6YA 1VQMS 2FY1A 2L9WA 1TFYA 4OZ0A 3KXDA 3BGLA 1YBUA 5ETSA 4K4UA 1WKJA 3BSCA 3A3PB 3FFIA 2QFIA 3I9ZA 4IH5A 4C3KA 4O4RA 1B0VA 1JLGB 3T6BA 4LF9F 4R25A 2IVFB 3MFHA 3UFCX 2LQ5A 5HAOA 2J8AA 4ZA1A 3JSYA 1KSPA 1VRUB 4YR3A 4DV0J 3KNGA 2RVJA 2R42A 4WP3A 2ZUAA 3QO9A 3OTEA 3BZQA 4LQ3A 2B9WA 5IM0A 1GMVA 2JL9A 2DH9A 2RE1A 3HCXA 1X0FA 1RKIA 3CUNA 1VC6A 4RW7A 1TL1B 2EFPA 3NCPA 1X4GA 4F0MA 3CIMA 5EX3A 3W66A 2DR6A 2FJVA 1FNMA 1HBNB 3SYZA 3EGZA 4RUAA 1TUGB 1DLOB 5F41A 3M05A 1LW2A 3LGMA 3DYAA 1SUQA 4EBEA 2QN6B 2HMIA 1RU2A 4RUHA 2B0GA 5D0RA 2M7SA 3Q86A 3I0RA 3QT6A 3CTRA 3E01B 1BUXA 3I4HX 3AB2B 1FHTA 2NZCA 3H20A 1VBYA 5EHHA 2CVEA 3P45B 5KFWA 3CGIA 1HWUA 3A13A 4O4GB 4FPIA 4JUZA 2JFDA 4JI6J 4KHPF 1LFPA 3GG0A 4TVAB 5KFNA 2ZWPA 4EZ9A 3AAWB 2A1BA 4X4UA 1VK3A 2QMWA 2VL1A 3ZNUA 5SZTA 3LQVA 4HACA 2OHDA 2BDPA 2G9OA 4USVA 3TI0A 3KHLA 1M90T 1FJGF 2DIUA 4DR1J 2UXDF 3W1YC 2B4OA 3OJUA 5GAGI 1KFSA 2WVFA 4U7UK 4KC5A 1IVZA 2ZE2B 1URRA 2XTJP 4LT6A 1BQNA 2Z57B 4DR2F 5E3PA 3TUZC 1RISA 1NBEB 3MR7A 2ZKTA 4JV5J 5HBMA 1FE0A 1FWLA 3SIPB 3AHPA 2IPOB 1R8CA 3TJ8A 3JAMY 1S97A 5J2QB 5CABA 1RT2A 4HVZA 2BRKA 3T5LA 3C15B 4FP9A 1KVKA 1UA1A 3E51A 5CD4A 1C4CA 1SJQA 4ER8A 3HLUA 1X5PA 2BW2A 3AFGA 1VMBA 3HVTA 5KFEA 3KUEA 4CRJA 4PG8A 3RJMB 3TRGA 3MEGA 5T41A 1RGVA 4F7VA 2ILYA 2B5JB 2FHJD 2OEKA 5FIIA 2NXUA 4DF4A 5LXRA 2W01A 1T05A 1JLAB 2V9WA 1HFEL 3HSZA 2GMHA 5H9FJ 2Q6BA 2KT3A 2LEPA 3DGPB 3ITHB 2F63A 3H5SA 2IHR1 3VAHA 2HRTA 4Y2KA 2OI2A 1NZAA 3CJ3A 3W9HA 4YUDA 1VS3A 1H6KX 3VR1A 1P9YA 1VQLS 3Q0AA 3TZZA 1JJHA 2BVZA 1IKXB 2F65A 1FX4A 4NLGA 5DLGA 4E98A 4P7TA 4CO4A 5LMUF 2VG5B 1ZS6A 3HZGA 3W5YA 1HBUA 2VJUA 2NYHA 3MM7B 3QWPA 2IM0A 3B4DA 1NPPA 3C3LA 2RRAA 3PEHA 3QATA 3DOMB 3IWXA 3D7SB 3M1VA 2B9XA 3SQGA 5H1SV 2IDLA 3PXGa 1HWLA 4FKXA 5AXLA 1FRIA 4B9VA 1S49A 2WVEA 5KT3A 3N4WA 2R8JA 1AFIA 5HVFA 1IKWA 4A8XA 2KL8A 1FK9A 5DG8A 1KQKA 4DV7F 1Q81T 2HQDA 2XO7A 2GJ2A 1S4EA 5A6WA 4D3GA 4OZNA 2HQFA 3Q83A 2PEBA 4DSKA 4RWWA 1A6LA 4LMZA 4DV6F 1S4FA 1LV5A 3M9OB 3KNAA 2HQCA 4F4KA 2Q3PA 4KPYA 4EI2A 4ZLJA 1PKUA 3DOLA 1HR0J 4G3IA 5D78A 2W9CB 4WBFA 1F6TA 1WC5A 4LR7A 3TARA 5D3GA 1U1PA 2AT1B 4PAAA 2XLIA 3LGNA 2RU9A 1APSA 3BJYA 3MMBB 2P9GA 1WOOA 2J0SD 1LOUA 2H5EA 5CYQB 3LA0A 2COLA 4MJKA 2B9EA 3DU5A 2G0IA 4TNOA 1EX8A 3W9JA 2DNOA 1TK8A 2FVCA 3OW2R 3X3UA 1KBRA 1RT6A 5CZXA 3SCKE 4AE5A 5KFCA 4KKOB 1V3RA 1T3NA 2ILZA 2B6AB 1HNIA 4WPAA 2X1FA 4LRCA 4L74A 4X2BA 1FJ7A 2CQ1A 3ISZA 2VZ9A 4C8OA 3Q24A 4ANEA 2JC0A 2KFZA 2V67A 3PVXA 1IQTA 1X4FA 4UUXA 4OV6A 2L41A 5HMYA 4PG7A 4DSLA 3OXGA 4DZDA 3Q8PB 1OY9A 2IVYA 1VR6A 2V8PA 2YKMA 3IS9B 1V5VA 3CJ8A 1MROA 3JYTB 2MDAA 1XR5A 3G9CA 4OL8A 3HVWA 5C25B 2DRDA 4KH0B 4OJGA 1TL5A 5HMXA 2FGOA 2E5LF 4OZ1A 5K8PA 5DQGA 2MZJA 4NPOA 3R97A 4KRWA 2KXNB 1KQFB 1U1NA 1MW7A 2MGZB 4HDHA 3CJ0A 1RTIA 3HD2A 1U6BA 2HAIA 4BC7A 4CNYA 2D7SA 4AL5A 4Q7AA 2YWGA 4RL1A 3JB9k 1VQ7S 1NK4A 2DHGA 1GTEA 3HULA 3D3CJ 5B08A 1WSVA 4TY8B 1T03A 2Z2YB 3M8YA 1GFWB 2EC2A 2Q43A 2QL7B 2CYYA 1KN6A 3OHAA 2C3MA 1C4AA 5A0YB 1FO1A 4KQZA 4YB1P 3UDEA 4LREA 1RT5B 4M1KA 2JEIA 1ZTTA 1WTBA 3CCLS 3BBFA 1RLCL 3CSKA 2HK3A 3GIJA 1RWKB 2HHXA 1AYEA 1FXDA 2HNYB 4OJHA 3M8RA 2AD9A 2Z2ZA 2BOPA 5CYMB 1CULB 3OSPA 1JLFA 2XO6A 2HW3A 5KFQA 1T9UA 4FKYA 1N32F 4L6V3 3T3FA 4USUA 4WKYA 3HHNB 4ZIWA 1W26A 2CKWA 3W5ZA 3GFXA 1ZYQA 1FKOA 4CLKA 1N8RT 2MQ8A 4UT4A 2F4VF 2D9PA 3LP1A 1RAHB 1GQEA 3BQ1A 1YBAA 1UJ6A 3W7BA 5IOLA 4GVLA 3BN4A 4LSNA 3FQLA 1U0SA 2I9SA 2UUWA 2ACMA 3W2VB 2LFVA 3M6VA 3R1LA 3KHGA 3DLEA 4Z7YA 3KHRA 5ETMA 3CIZA 3BGUA 5A8KB 4DV5J 1WC3A 2QZ8A 4CLFA 4M63A 2AYEA 1RAAB 1H2VZ 2KRRA 3P3DA 2DR7A 4HTJA 1IR0A 3CCRS 1D1UA 2NCKL 2LECA 2A0FB 1U45A 2ZJQQ 1EJ7L 1SIWB 3L4BC 3R27A 4KO0B 3UI3A 4NA1A 1JLBB 4MK8A 3FZ2A 4ES2A 2ZM6F 4OX8A 2ROGA 4ZN3A 2HK2A 2BM0A 3L7UA 3BN7A 4MKBA 2MB0B 1KHWA 5EWEA 3H4BA 3PHEA 3C46A 1J5OA 4WFBQ 1NCLA 4PYDA 2PD1A 1UFWA 3TP2A 1Q82T 2YNHB 2QMXA 3EGWB 3CO0P 1KONA 3O3LA 4A47A 1U6ZA 4FXDA 4FNIA 3KK2B 3IP0A 2LLZA 5BYRA 1R6YA 4RLEA 5CCMA 3NMAA 3CVKA 1DQ9A 1GX5A 3N01A 4WU2A 4MK7A 1AT1B 4F8RA 3VQSA 3A8IA 1R0AA 1RT1B 1LQ9A 1CJKB 1S59A 1SXLA 2W24A 2DNPA 2AGQA 1ZAVA 3I96A 2UU9F 1A9NB 4O44B 3OR1A 2V63A 1TKDA 4USJC 4DX7A 4RU2A 2KU7A 5F8HA 2EBEA 5L9NA 1XEZA 2G13A 2AGOA 4ED4A 4J9UE 2DO0A 1CJTB 4I7FA 1MG7A 4WCEQ 2L9NA 3R6LB 4L73A 2VG7A 3UD5A 1RT4A 5GAHU 2XSFA 3DCAA 1G7CB 3R2CJ 4Q2MA 3ETMA 1BY9A 2L9DA 2KT2A 1OY8A 1SCJB 1N33F 3HKZD 5HATA 1MSWD 3Q8YA 3SBMA 5E41A 1TL3B 1DJ0A 4A8OA 3QIPA 3NGKA 3QT8A 2CPXA 2HFSA 4QWBA 5I3PA 4ECVA 3CCTA 5J2MA 2CQGA 3JSMB 3PYFA 1VQSA 3M8PA 4GO7X 2RKIB 5M2PA 2DIVA 2LDYA 4YDXA 2VFRA 3MFIA 1PSDA 4HT7A 1N5TA 5B0BA 6FD1A 3KLVA 2ADBA 4CYUB 3GV7B 2YNGA 2RILA 4NXMF 4RX6A 4RW9B 5L1JA 4I69A 5HLFA 5FJ4A 1XNRF 3I82A 2R7WA 2H5IB 1XERA 2RQKA 2KI2A 2DEJA 3GB0A 5A6PA 1S1VB 1K44A 2C22A 4LJMA 2CPFA 2PI4A 4AXJA 3LF0A 3BBCA 4IRCA 3PJ9A 4KY3A 2VKZG 3NOCA 1RE1B 1ICEB 2IM3A 2W9BB 3Q8QB 4UY8T 1UVMA 1IWGA 1P1LA 2Y1RI 1RYRA 1DTQB 2BX6A 1RXOB 4K0KJ 4FXVA 1PYSB 4LBHA 4QR1A 1HPZB 1MLAA 2HRYA 4QJVA 3DLBA 4ZVGA 5ETPA 2QA2A 5F3TA 2FDNA 2XMJA 2QIFA 5GAEU 4YDDB 2ASJA 1U2FA 1LWCA 5EGYA 4UZCA 3TQEA 3C66A 1LNQA 1UFLA 2GIQA 1YITS 1R27B 1RTHB 1WHXA 4J91A 1HD1A 1W25A 4A8QA 1SJ1A 5KFHA 3MR6A 1KFDA 2XLJA 5LJ5Y 4QWEA 4DV1F 1VIOA 4F4ZA 3OSNA 4I64A 4ZCLA 2WRMA 4KYZA 1HHSA 2CJQA 1U1KA 2OH2A 3VZIA 5FLXU 3UW1A 1JNRB 1EETB 2DGTA 4YS2A 2R8HA 2BUNA 4Z37A 3G8TA 1C1BB 4YMEA 1FX2A 1S0VA 1SPBP 2K1RA 1VQKS 1SH2A 3G96A 1T0TV 5IV4A 3DM2B 2OPPA 1FFWB 2P6SA 4JI6F 4CLUA 2RD5C 3V2UC 3P6YC 4KGMA 4PR6A 3W2WB 3GTYX 3JTNA 3OLAA 3EICA 3AODA 3G4SS 1UP1A 4URQU 4QOTA 3V6DB 1RT7A 3CDEA 3IN5A 4WK3A 2M2BA 7FD1A 5GADU 3GIRA 5HJYA 1QY7A 1HNVA 3PCOB 4P2FA 2FC9A 2QLWA 5IS2A 1VLYA 4OX9F 2PA8D 2HGMA 3HHEA 4QIGA 5J2NB 4HTIA 3V6HA 3RR8A 3B78A 4M5GA 2ZD1A 1Q79A 2GO8A 2LA4A 2MSSA 3GP9A 3EZOA 3RRHA 1RADB 3N79A 3THPA 4NLRA 3PRBA 3W8GA 1RUSA 3QGPA 4OHZA 3S6EA 2UUBJ 3SMZA 4MFBB 1NK8A 5FD1A 1HLWA 1LFWA 3PX6A 4DPYA 1SJFA 3D6MB 1BQMB 4IDKA 2E44A 1S76D 4KGZB 4LF8F 3G6XA 5JVHQ 2CJ9A 2R8KA 3GV5B 1PJ7A 2H5JB 2RRNA 4DL6A 1HQUA 1K1QA 2BACA 3Q2TC 2FPHX 1RABB 1CPZA 4DWIA 2H4WB 2H65B 2OTLS 3OBIA 5F8LA 3T41A 2LU2A 2VFVA 3JS9A 3FMBA 1O8BA 4C97A 2OO4A 2Z2LA 2XS7A 4DQQA 2IAJA 4K2JA 4RNHA 2AJ0A 3KJVA 1FJCA 1U2CA 1KVJA 4BDPA 4U9RA 2Z8QA 4C98A 5K8OA 2C3UA 2FVRA 4RR5A 4DX8H 1CJVB 3R8YA 3J81j 1X4AA 1IN0A 5L46A 3AB4B 5LJ3Y 7FDRA 4TU9A 2E9ZA 3MZIA 1H98A 3GR0A 3V4MA 2VJVA 2PFFB 1FKAF 1U8WA 3I5CA 1K1SA 1F9EB 1UEVA 4N7TA 2KKHA 3HK2A 1NK0A 4WJBA 1M5VC 5L38A 3D5MA 4P73A 3UNGC 3ZTRA 1I5OB 2A2CA 3RTVA 3I5AA 3DRPA 1IJFB 2KN4A 1FRXA 3AA8A 3ZZTA 3UWTA 3O6QA 3CD6S 1LK5A 2HBZB 5BYSA 3W5XA 2VASA 3WDOA 2OEJA 2OD4A 2ROEA 3DMJA 4DL3A 3N6MA 4N5SA 2GV1A 1FVSA 2DJWA 4ILMA 4B3SJ 2FLLA 2CQBA 1V6HA 2ADCA 4F4WA 1HIYA 2NZ4A 1Y7PA 1M5KC 3FBBA 4K4WA 5AE1A 2IFXA 3Q8RB 3IXQA 1RBLA 3DRRA 5L1KA 9RUBA 5KFIA 4PKDB 5CHCB 1VC5A 3DOKB 3ONQA 3HDSA 1QAXA 4RPFA 1RBOB 3OT9A 2D1CA 1QM9A 2ZJRQ 1S0NA 4DR3J 1S0MA 3K7RA 4H4MA 4C9DA 4PQUA 1NSQA 3OV7A 1VQ9S 3N5BA 4PG6A 2ZC4A 3TO8A 1X7VA 3P5TL 2G2ZA 4LVOP 4D3HA 2AEMA 4IOAQ 3NCRA 4RW6A 1HQ2A 3N0VA 3KWMA 1TZ0A 4O3QA 4R8UB 1IBKJ 1M5HA 1CS4B 3UCZP 1KTVA 2AIRB 4P2SA 2XLKA 2AEJA 2NXJA 3CF5Q 1U09A 2HNZA 3M8ZA 3MHYA 4FF2A 3HHLD 4ZHRA 2W1BA 2LQJA 4GC6A 4XAKA 1LWEB 4DBQA 2DYAA 3C8YA 5K20B 3ILOA 3VTIA 4G1IA 5HP1A 1IBMJ 1V3ZA 2MQPA 1HBMA 1GEHA 1SIZA 3H2VE 1ZBTA 5DG7A 4BC9A 3FRZA 5KG0A 2KXFA 3AOCA 3J7YU 4ZPVR 1NK5A 4B02A 3RAQA 4TLRA 4HDGA 2KM8B 5A8RA 3FMWA 4MYUA 1O6XA 2C3YA 2MLYA 2ZH7A 1XR6A 3QZ7A 4ECRA 2CVIA 2HGLA 2YY3A 2PE8A 2FJDB 2J7KA 4Q45A 3F41A 2MZ1A 2C2NA 5LOQA 1TL4A 2MKSA 2FJBB 4Q8FA 4C7QA 1S6QB 4ED1A 1HL6A 1IBCB 2O67A 3NGSA 5D15A 2XCPA 4DUZJ 2ASDA 3CD5A 3TA2A 2OKQA 1FFGB 2QSFA 4WTYA 2V5HG 3FEZA 1X5SA 3QRPA 3RW6A 4LFAJ 2PMZD 2AKWB 1L3UA 2W4DA 1HARA 2E1PA 4C8NA 3QWUA 4JV0A 4B3RF 1SV5A 1V5IB 4R5PA 3BKUA 2YKNA 4UF4A 4ZS6A 1BQXA 2Q79A 5KAKA 1HWJA 2UVUA 2OEMA 1QSLA 4NLDA 3BSAA 1C0UB 4I2PA 3WQPA 5HVHA 5EUHA 5KFYA 2K7JA 1T9TA 3UPFA 4J9MA 4DR5J 4OZ2A 5KFZA 3MM9A 4JI4J 4JBCA 4QIFA 4YB7A 1FKPA 3LP0B 1FRJA 4CO2A 3CC4S 3R5DA 1GK8A 1SB6A 4F2SA 3MEEB 3E8OA 3BGRA 1KDNA 4X62J 1REVA 5DM7Q 1YJUA 5FDLA 1OYDA 1Q95G 2BA9A 5AJ3J 2MZSA 4DG1A 3HMJG 2LP4A 1TMJA 2MQOA 1B0PA 3IGVA 1HW8A 4QBUA 4JB8B 2QJ3A 4IR1A 4OYAA 2KFYA 2K06A 1RCOB 2V9KA 2MZQA 2MQMA 2DNNA 2C42A 1WF0A 4JYAJ 5E5NA 3PIOQ 4F3OA 3GCXP 3ENAA 3SZ2A 2A3JA 3QAEA 3VGTA 2D3ZA 4JI2F 1NB7A 4OHVA 1R31A 1HI1A 1AZSB 2FGCA 3CXCR 4NEZA 1WC0A 3MEKA 4I2QA 2I38A 3CJKA 2FY8A 4W90B 3WZ0A 3J81U 3C6TA 2I5JA 4J9RA 4DV5F 3DU6A 3M2VA 5LMNJ 1WSRA 3NWRA 2QFJA 3H5YA 4C4WA 2HHWA 2XSJB 4X64J 1N5SA 4WZQA 2AU0A 1MN9A 3MMAB 3PJXA 4QU6A 2BE7D 2HWTA 2CJKA 2P9EA 4A8YA 2J9DA 2HNDA 3EVWA 3K58A 4CO0A 3TWZA 1HWIA 2H3EB 1S9GA 4DLEA 2GJFA 1N5QA 3M4XA 4KGXB 2W2MP 2RB7A 3GLJA 4HHHA 4M5DB 4CDIA 3G6ES 3Q8VA 3DXSX 3J7ZT 3I31A 4ED6A 3J7Z5 3IO1A 2Y3YA 4ECUA 2B3TB 2VFTA 4NLPA 3KHHA 1S6OA 4NCBA 2V4QA 2LU1A 4RNMA 4ECQA 4P10A 3GE9A 2V2KA 1YJRA 3SSRA 3NS7B 4ZVFA 1RHQB 2KJVA 4M8LA 3K2YA 2QG9B 2JX2A 2MQNA 4FS1A 4I1TA 3E3XA 4DMZA 3GPAA 2R7OA 2RT3A 5IM0B 4JV2A 2IVMA 4EMDA 2Q6CA 2XM3A 3OHBA 2RDJA 3DLKA 2BE2A 4PYAA 2NR0A 2DT9A 4B3TF 5KFTA 3PFOA 4CLSA 3CT9A 4LRFA 4Q0BA 4BWMA 2WTFA 2HBYB 2IC3B 1FD2A 5DO2A 4C3LA 3MM6B 4NL5A 1R7IA 1TMMA 1L3SA 5K14A 1EP4A 1WDTA 1RWPB 2E5IA 4X4PA 2F40A 3HSDA 4ZKAA 2RJZA 4LIRA 1H2UX 2XQCA 4NLUA 4NCGA 4ILLA 1ZZFA 1HYSB 2ABYA 2Y8WA 4IG3A 5B0AA 2E29A 4DL4A 2DPJA 4HLBA 4ED0A 2RHSB 1S1TA 3H2LA 1KTQA 4GRSA 5A8WA 1XN9A 4O3NA 1KOOA 4WYWA 1MWYA 2POKA 2HIYA 3D54A 1JLGA 2ZZNA 2HFZA 1TKXB 2VQEF 5KFMA 2CQHA 2UXBJ 4KFBB 1VRUA 3IAS9 5HK4A 1WHVA 3SI8A 4FDFA 1XIQA 4DFMA 2BE9B 3MR3A 2VDIA 3DLGB 4RBUA 4ECTA 2UUAF 1REGX 1EB0A 4U8VA 3OTOJ 3T1AA 1K0VA 5E3AA 1NKCA 4KSEB 3LO3A 3SEOA 3V5RA 5HBMB 1TL1A 2HHPA 2DBBA 2FC8A 3LPEA 5KFSA 1WEXA 1SBRA 2UXCJ 2IJRA 4OI2A 4ZMMA 3EX7B 1FVQA 3H90A 1TELA 3EGNA 4QPXA 2ZH8A 4ENOA 2E9TA 4J5OA 4ES3A 1YJ9S 1HBNA 4WXWA 1NO8A 5D4LA 4TY9A 2K7KA 1DLOA 2O1PA 3OUYB 2DNLA 4DL2A 3Q8UA 3HHLA 1JLCA 2BZ2A 3AJ1A 3MF5A 1E6VA 3LANA 1OS5A 4XO0A 4O3PA 4XPCA 2QT7A 3KLHB 2DGQA 2ZBCA 3KLFA 1NPRA 1VCTA 3ENVA 2OMLA 3FJ2A 1WHWA 5HANA 2R2SA 2CWXA 3UCUP 1YX2A 1OPZA 4O4GA 4DU7A 2W7OA 1UVKA 4X4SA 2KT5A 4ZCMA 1S5ZA 4M94A 4FYDA 3PDNA 1GMUA 3L95X 1RHMB 4IOCQ 2Z0GA 1MMNA 3AQPA 2HZVA 4F4AA 2H9ZA 4UOGA 1OYEA 2BXJA 4EO8A 1HBUB 1NK6A 3KMSA 2HVDA 3M2RA 2O01C 5CD4H 4F02A 1NEEA 2BKPA 4MKYA 2RF2B 4USKA 3CJTA 2ZE2A 3FVYA 3SQGB 1RTDB 3W64A 3D3BJ 3DDNA 2DHAA 1VQNS 2E5HA 1UW9A 5DDPC 5J2QA 4O3OA 3C15A 4ZCKA 2OSRA 3BQ0A 4NMXA 3FBCA 3R5AA 4X84A 1UFKA 2MEWA 3CJQA 3AT1B 1SJRA 3SXLA 5KFLA 2EKYA 3UN2A 2B5JA 4U96A 1U8SA 2OUGA 1S12A 3AXMA 3VGSA 1JLAA 1RYSA 3BO4A 2ZITA 2VKRA 3QJJA 1WDDA 3NBPB 5F8MA 3K17A 3H5XA 3DGPA 3ITHA 2N4DA 4YOEA 3MUVP 1Q5VA 2OIHA 2BANB 1SC6A 1MNEA 5EDWA 4WP8A 3D4JA 4CH7A 1H3DA 3HPOA 1C2PA 2WVCA 3WIVA 3HI9A 4HEA9 2NSBA 1IKXA 4C48A 1O5JA 4YHHF 3QGGA 1MN7A 2VONA 3V4IB 2F8HA 2XMTA 4J9LA 2HZCA 4UTGA 5GVQA 2VG5A 3RYLA 2VHGA 3MM7A 3HHKA 1IKYA 2W7AA 3HF5A 1VQPS 4LF7J 4OLPA 1LW0B 2WSFC 3QBCA 3DOMA 5IT9Y 1SVDA 5G0RB 4WFAQ 2DNZA 3M2UB 4B08A 1IBLF 3RW7A 1WOSA 1VBZA 2JEGA 2ALYB 1RAIB 2HRUA 4TYBA 4LRDA 1HHTP 4M5HA 1I51B 2WVBA 4ERDA 3LH2S 4DL5A 1Q16B 3UD3P 2HHVA 2MLZA 4GO5X 5LSOA 1YK9A 4M5MA 3T1YJ 4ZDNA 4A8MP 3R7NB 5I42B 4NZ0A 3M6WA 2VF3A 1UVLA 2XGQA 3BKTA 2FIUA 1RI7A 4YY3J 3S8SA 2Z56B 2W9CA 1NDKA 1N48A 3ZXWA 4EGLA 2HG4A 3GJRB 3OVBA 5J1PA 4JI5J 3UD4P 3QIDA 4UUWA 3MMBA 4P2MA 3HFKA 1C0TA 3WC0A 2FJWA 3GJTB 4O3SA 2MJNA 2E7WA 1AXQA 1KRPA 3PTWA 1Q0NA 1Y00A 2BM1A 5BJRA 1VRTB 2J5AA 3I32A 1F5BA 3FSXA 3AD8C 1WTFA 4V1Ak 2G1HA 2XZWA 5DG9A 5JJBA 2GHWA 2GS8A 3HJVA 3GILA 2G2YA 1S6PB 2AGPA 4F36A 1KQGB 4KKOA 3OR2A 3PYDA 2B6AA 2VIHA 1FDBA 1KD1T 4LBIA 4Z7CA 2CJXB 3A1YG 2G1DA 1HMVB 4AQYF 2OJ3A 2PDAA 4I68A 4FXWA 4J9QA 4MKAA 1DAXA 1DARA 2J9EA 3IR6B 3SQOP 3BREA 1VISA 1URNA 3IGNA 1UVIA 4DUYF 3G2XA 2AQ4A 4LSLB 2VQFF 3G8QA 2LA6A 2ATLA 1IBKF 4NZ7A 4MK9A 2KFNA 3IS9A 3IFEA 1P27B 3JYTA 3LP1B 3UCGA 2KHCA 2KYZA 2WONA 1XK8A 3O44A 1E6YB 2IMOA 3MPYA 2HGNA 5IXUA 5K8MA 2XMKA 2DCUB 1J27A 2KG1A 2MGZA 1IBMF 4WXOA 1R43A 3CJRA 1RACB 5J1NA 5KFJA 2OSQA 1D0EA 3ULHA 3G71S 1G1XA 3UN3A 5LM7E 3IR7B 1IJEB 2GQ2A 3MEDB 3GJSB 1RAFB 5CCLA 4LIWA 2UP1A 1CLFA 3DXBA 1OPIA 4TY8A 2FLPA 2AJ2A 4C0BA 4QR2A 1UWBA 2HS4A 4ANDA 2MLXA 3HX9A 1SC3B 3H98A 5A0YA 1RT5A 4KB7A 1Q4RA 3I0SB 1JIHA 1U1OA 1S7HA 2DO4A 4ZPBA 3AOAA 2HHHF 1ELOA 4LFCF 2IDEA 3TW0A 2HNYA 1WKLA 5HVGA 2M8DB 4DV4F 5EWGA 2C28A 2E1CA 1CULA 4DU8A 1J5OB 3D0IE 4TXSA 4LFBJ 4F4YA 2EC0A 3MM8A 1A7GE 3POTB 3IR5B 3OQ2A 2C2EA 1WC6A 1NKBA 3NAIA 3D6HB 5C42A 1TUWA 5IWAJ 4RUBA 4IO9Q 2MKKA 2JLFA 3VV2B 4EZ6A 1R8AA 3EWGA 3SV4A 1RCXB 5KG6A 2ALZA 1ZM2A 1ZA1B 3L3CA 4DR5F 4P52A 3I5BA 4UZBA 4BBYA 3UR0A 3QFHA 1XNQJ 3NL0A 1SL1A 4ATNA 3W2VA 3TVKA 2H1YA 1PJ5A 1NNDA 2BQUA 3ELHA 4X62F 2RH3A 1VIXA 4ZVUB 4LF4J 2IRUA 1H73A 4WKRA 1SKSA 5AJ3F 2B8QA 4URSA 3AH6A 3CMES 3GYXB 4DR4J 2EXUA 3RAXA 3EXYA 5A8KA 4DV2J 2KXHA 5JUMA 2XMUA 1T02A 3ZZOA 5ETLA 3NY0A 1SKRA 1XMBA 2MKYA 5KFPA 4P71A 2Y0SD 3ICLA 1M0SA 4MIWA 1VQ6S 4KO0A 4P74A 2V4RA 2DHXA 1RT3A 5KTQA 1Y9OA 4NE9C 4ECXA 3DHXA 5KFAA 2R2UA 3M9MB 2JVOA 1S9EB 2WW8A 4X4NA 4DLGA 3T6JA 4X66F 2F3JA 3QIPB 4EO6A 1FXLA 1UPMB 3GONA 3CCQS 3NS5A 3F56A 5KG4A 2XMAA 2R7XA 2B7BB 1V3SA 4ZOSA 3OL6A 4Z2XA 3BKFA 2GQQA 2YNHA 5J2MB 3MAAA 2AP6A 4O23A 1SQGA 2FD2A 1Z4UA 2AWZA 4U95A 1B99A 3KK2A 3CDBA 2IBOA 4RW4A 3SFUA 4E2FB 1UMJA 4B17A 2HS0A 2HWIA 4NLVA 4IG0A 2XNRA 2YXLA 2FZKB 4FF4A 3IBCB 4I0WA 4ZVTB 3IA0A 2XY6A 1CJKA 2JLGA 4FS2A 2ZEJA 2CPIA 3GSDA 1F0XA 2GCFA 4LSZB 3TUPA 2FJAB 3OL7A 4FBTA 3R9LA 5KFUA 5F0WA 3DGVA 1GNKA 2Q66A 3VZHA 3QPIA 4Y2CA 4P72A 4AYBD 2IMWP 5C24B 1ZAXA 3JQJA 2CZ9A 3GSIA 1G4CA 1G3OA 3SDEB 3THVA 2CNOB 3K5OA 5HQ8A 4GKJJ 5B0GA 3K8VA 4C0HA 2CPHA 5DM6Q 3BH7B 2ZBQA 5LXYA 3DDKA 4DQSA 2RAQA 4FF3A 4EBDA 1YBTA 5A76A 4K59A 4JI1F 2Y8YA 1TL3A 3NNCA 3MTKA 4ED8A 3PW2A 2A18A 2UVVA 3CJSA 3BGFA 1VHIA 1HBOB 3NLCA 5RUBA 4KHPJ 3DRYA 2DCLA 3A3OB 3OD2A 2RIJA 3MGJA 1KC8T 4DPTA 4RW8B 2LYVA 4C0OC 2RKIA 2VV5A 4KTQA 3NGRA 4M5LA 5KFOA 3LOUA 2G4BA 1FJGJ 2J6TA 3GIKA 2K8GA 5KFVA 2P5VA 5DDOC 1TL7B 3I56S 2UXDJ 3MPUB 4CYUA 3KUGA 1YG0A 2WSEC 3TVYA 4RW9A 1FT8A 1RHRB 1Y10A 1Q5YA 4DR2J 5L9XA 4MH8A 1TV6B 1VC0A 3GIMA 2EG2A 2KZMA 2OPSB 4LR9A 3NNAA 2BJ9A 4ZPDA 2ASLA 5ETKA 3OPKA 2IRXA 3KG1A 2J7UA 3KLGA 5F8JA 1PC5A 4QPTA 4PWWA 3QJPA 2ZVIA 2RNEA 1HPZA 4DFJA 3T9NA 4URGA 3K8WA 1QAIA 2MKHA 1NDCA 3OTOF 3KG0A 4CTAB 1PGZA 1MU2B 2HURA 1XMQJ 3BPDA 4NWBA 1DQAA 3M7VA 3MI7X 2CDQA 4DF8A 3L09A 1KLNA 2BW7A 3MUMP 1YVFA 1HNWJ 3LAMA 1QUVA 1NSAA 4TQRA 5HQMA 3RBDA 5HN0A 2JFKA 2DNRA 2QSWA 4CT9A 1U25A 1RWOB 1FNOA 4KE5A 3FBEA 1W2BR 4OYPA 1UEKA 2RRBA 3RRKA 3CCMS 1AA1B 3MCSA 2V6AA 4ZVPB 5E3CA 1K9MT 1TU0B 4OHWA 1JJCB 4L75A 4X4VA 4DL0C 3FQKA 2VC1A 2WSCC 3PEJA 3ZZRA 1WORA 3L7PA 1UZDA 4TU7A 1C1BA 2O5DA 1PYTA 4PG4A 3RGIA 3EDRB 2IA6A 3GJQB 3MUTP 5G4DA 3DM2A 1S57A 5KOXA 5LL6d 4LRBA 1SH0A 3C14A 1RHJB 4DX5A 1NHVA 3V6DA 1TTHB 2OPRB 4DV7J 1HHQA 2VG6B 4Q44A 2GVDA 1HWKA 3VAJA 3NWGA 5DRKA 1GTHA 4J7CA 3F44A 5KFDA 4X65F 5J2NA 3TZYA 3MMCB 4B9SA 2ZHBA 1TK0A 3DRSA 5D0HA 3HJFA 3ET6B 1KOHA 3MAQA 3A8KA 3DRPB 1RK8A 3RR7A 4DEZA 2EFOA 2C2ZB 4DV3F 3BPSP 1MWZA 5J2PA 1S1WB 3IWLA 4MFBA 3EVOA 2CQ2A 3ISNC 2DGVA 5KFBA 4ZVHA 4TLQA 2LQ9A 3PV8A 4B9LA 1FDAA 1IR2A 2DGOA 3W9IA 2RS8A 4J9VA 3S1TA 4HL9A 1YRUA 5B0DA 3ZFVA 2B51A 2MKIA 2BJ1A 3R1HA 2O66A 1PCAA 4P2XA 3GWCA 3EJMA 3T9ZA 4DQRA 4Q43A 4DX6A 4JI0F 4DCOB 4MIAA 4FVMA 2L3MA 3PG9A 3LP2B 3KG4A 2VC0A 4C3MA 2LDIA 3U27A 8AT1B 2UZAA 2QA4G 2X51A 3T1HF 3R6GB 2DNQA 1ZETA 1WEZA 4ALZA 2NPIA 2XHCA 2XMMA 2EK6A 2W7PA 3M9NB 7AT1B 2R4FA 4IFVB 2OLWA 3D1OA 5HROA 1RA7A 1CJVA 1CC7A 4MIBA 2QV6A 4OYWA 1VOMA 2NYIA 3OJSA 1SC1B 1L5UA 5E2QA 2XMWA 1D8ZA 4DFPA 3HFZB 3PACA 3UVJB 2MJUA 3K0JA 1TVRB 2I2YA 2HNZB 5BR8F 1RTJB 4KHMA 4ID5B 4GKKF 3VAIA 2HYIB 3RBEA 2PSZA 1XQIA 2E5LJ 1M5OC 4ZPCA 4RKUC 2C2RA 2Q1LA 4H4OB 3WX4A 1NAQA 2AYMA 2L48A 5HP1B 4QR0A 4LF2A 1N34F 1GMWA 1FWPA 4ECYA 2BQRA 2MYFA 1F2GA 2OGUA 5AXNA 2J6UA 4CQ1A 1A0OB 4QIEA 4EUVA 3D0HE 1D8YA 3MTJA 5A8RB 5KT5A 2VICA 5DS7A 3JQKA 2HSEB 1X4EA 1ZTWA 5B7WA 2RQ4A 4B9UA 4XIUA 2ZH9A 5HSPA 4YY3F 2M52A 2HVHA 3IBFB 1Y5NB 4NLXA 2F8EX 2GGPA 3AA9A 3X1LB 3B6BA 4M5KA 4ZP7A 4OV1A 3TVZA 4OI4A 4YR0A 2YPYA 3I87A 2BYCA 1B4SA 3CJ4A 4DQPA 2AX0A 2DH7A 3HXMA 3HZEA 4G1QB 4NLOA 5K9FA 2PC6A 1FEHA 4Y2AA 5M2UA 2E1RA 2LCWA 1T9WA 5IT4A 4JI5F 3HT3A 1VBKA 1X4CA 2W8KA 3PO4A 1EZZB 5D0EA 4G1PA 2HEKA 1YJNS 1QAYA 4NYZA 4ZCIA 2ATCB 1N32J 1UWAA 2B43A 4CLLA 3RB3A 2V2QA 2CA9A 1UKUA 2CG4A 2FUG9 2DGUA 3CC2S 3KDOA 1JXLA 2U1AA 4JI7F 4R8UA 1K0TA 2YBVA 2C2DA 2F4VJ 1SL2A 3N6NA 2IJFA 3KLIB 2QRRA 3C16B 5GAGU 2BV3A 1DY3A 2DVIA 2FYXA 2HS3A 3D1HA 4F04B 4QWCA 4CCHA 2GO9A 2JVRA 3IG1B 1F5CA 1VJQA 4F2RA 1LWEA 5A2QU 4JI8J 2CQ4A 1P9QC 2M3DA 5K8NA 1TKTA 4CZCA 3GFYA 2CPZA 1ZAWA 3OXLA 3BQ2A 1OSDA 5DETA 4PPZA 3DHWC 1NH8A 2V69A 1O0PA 4B9TA 4DOZA 4KV8A 4HH0A 4OYZA 3B4MA 1HNZF 2UV8G 1S1UB 1X5TA 2PT0A 3W65A 4C6AA 5I3UA 4DPOA 3QNWB 2U2FA 3MPDA 2N3LA 3CC7S 1NKEA 2MY8A 2HKEA 4B3OB 2DHSA 4WIIA 1CQNA 2WB1D 3FRYA 3D66A 4K4TA 1YZ7A 2DK2A 1QE1B 4YEAA 1S6QA 2ZM6J 1WHYA 2DNYA 1N5YA 1RWVB 4P9SA 2MHEA 2C1EB 2RUSA 3DNCA 4DN9A 2M8HA 3LALA 1XMOJ 3ZNJ1 1TFWA 4AD6A 1W7WA 4WFYA 4RWXA 5KG1A 1I94F 2JSXA 4GVBB 3FEXB 4AT1B 2F7VA 1FFSB 1R6VA 1FE4A 5KG7A 1N56A 3K5LA 3BF4A 2D3O1 2XZTB 2GAGC 3J7AN 4FNHA 3C2PA 4DS5A 4J9KA 5DQHA 1OQ3A 1FD8A 1C0UA 4CO5A 2CQIA 4OQJA 3ZZ0A 2DB1A 1QJHA 1QSYA 1Q8BA 4LRAA 5EX0A 4N41A 1GH8A 4ZITA 3LP0A 4IUFA 3AJDA 2D41A 3CJ2A 2J0QD 2VFSA 1Y3JA 1U48A 3MEEA 2VFUA 1UVJA 4QW9A 4F67A 2Y9HA 1TKZB 3EE3A 4N76A 3ILJA 2R9LA 1DBDA 2AF6A 3UE2A 3VAGA 3LGHA 3AXKA 3THTA 1J5EJ 1H74A 2CDRB 2D69A 1U24A 4PWDB 2VDHA 4OI6A 3A12A 2ZH6A 3PJWA 3PO5A 4FF1A 2DRAA 4QYRA 2IIHA 1Q86T 4NX9A 2XY5A 3ETOA 4PCQA 5ETQA 2E7XA 3QZ8A 2LVWA 1T11A 1NH7A 3NNHA 2R7RA 3I55S 2B4UA 1N33J 3TJAA 1AZSA 2WZ1A 1TK5A 1WEYA 1RU1A 2XY7A 4YB6A 1BLUA 1EARA 4DR4F 2NXCA 2V4JB 1JXVA 3FSIA 1C1CB 2QYCA 3P8BB 5D4PA 2V8VA 4DV2F 3TAMB 4BWJA 2XSJA 3OFFA 3DKDA 5K14B 2M88A 3HHDA 2HFNA 2YNFB 3H4DA 5MAOA 4LBPA 2M70A 3MMAA 1VFJA 3EPIA 2XWYA 3AD9C 5T7LA 4ZJOA 5DDQC 3K59A 5CXTA 2LMIA 2CQCA 3D6TB 1MMDA 2C2KB 4K50A 2YWHA 1OMSA 1YGYA 4WF9Q 2R2RA 5KFXA 2WB4A 3DDIA 1RTZA 2MY7A 4DV0F 4C8MA 1NXIA 1JKHB 3VGVA 1N6QB 2XMVA 4DJBA 1XNRJ 1N88A 1P1TA 1X4DA 1YI2S 2CNNB 4ZK7M 4FYVB 4CM0A 1M5SA 2H4YB 1QTNB 3M8QB 1T9YA 1IKVB 2MQLA 2FZGB 1SL0A 3PFEA 3TUJC 3D6FB 1BHNA 2GQCA 2DY9A 2SXLA 1X9MA 2J0WA 3D2WA 4C11A 2R7UA 3MM5B 2R7QA 4OIXA 2N3OA 1CJUB 4Y3CA 4P6QA 2YKAA 1U2RA 3QJLA 1IM4A 4L3KA 2ACYA 2F5GA 4USWA 3CCSS 3K5MA 3EUNA 3NMRA 1HKAA 4P75A 1JJ2R 5D8HB 2CUYA 2HPUA 4WP9A 3IM8A 2XS2A 1N4LA 2RQMA 4NYPA 2JOQA 3CMAS 3KKFA 1KHVA 1YSJA 1FA0A 1S6UA 5DQIA 4C8LA 1J2VA 4K5SA 4IQXA 2J7WA 2Z4PA 2IC3A 4DV1J 3MM6A 4K7QA 1BWVA 2R8GA 4JI3J 4MYTA 4DPUA 3HHLB 2B4VA 2EK1A 1JLCB 1RAOA 2BBEA 1E6VB 2RDDA 2J9DE 5H9EK 1U0HB 1XR7A 1AUDA 3UDCA 3JAMU 4GKJF 3AY0A 4C8ZA 2IM1A 1FEEA 3GU0A 4F0HA 1HYSA 3KLFB 1Q8KA 4EK2A 2GHVC 4DR1F 3LWMA 1OJ4A 1IR1A 2JJ4D 4Y0FA 4C2MA 1YKWA 1HQEB 4UOHA 2E7VA 4J90A 4JV5F 3D0GE 4NLYA 4ECWA 1YJ7A 2V2VA 5FLXY 3R3TA 1JLEB 3FCWA 4W4MA 1WI6A 1TKXA 2K2PA 4NLQA 3M2RB 2I1RA 3FUYA 2KM8C 5F9NA 3Q2SC 4KFBA 2HFUA 3HFVA 3TYTA 4OX9J 2P6TA 4AL6A 1DTTB 3ILIA 3DLGA 3KMQA 2OPQB 3G82B 1SKWA 4NI2A 3KDNA 3VAMA 4L72B 1YDLA 4DCPB 2HFVA 1WC4A 2HQIA 1UJ4A 4MAKA 3GV8B 3RBXA 4KHRA 4EYIB 2PIIA 2WW4A 2YQ1A 1D9FA 2UVWA 1QVGR 4LF8J 1WG1A 3OUYA 3QT7A 1RQ0A 1RHUB 4DFKA 3KK3B 3CDWA 4X4TA 4B3MJ 5LT5A 5IT0A 3NGDA 3MR2A 3NRBA 2PGCA 1S1XB 3QQCD 5SUHA 3KLHA 3NAHA 3WIUA 3EMTA 1RA6A 1XMQF 4PEOA 4FYYB 2GFFA 1D9AA 5L39A 4LF6J 1JLQB 2ZZTA 4IRKA 4ELVA 4AUKA 1HNWF 3VWSA 1GXUA 2NQPA 1JK9B 1NJXA 2M9KA 3W61A 1RBAA 3PR5B 3OL8A 1XWLA 1VBXA 2Y1IA 1VQYA 2AV5A 2OFHX 2QA4S 3QSIA 3LTOA 3GCWP 1U47A 2Z30B 2LEBA 2WOMB 4U7UD 1EKRA 1IKYB 3UO0A 5B0CA 4Y6IA 4OZ5A 3DN9A 2FVPA 2NSCA 2RF2A 3ADAC 1SKUB 2HQGA 4ICLA 2APOA 4I6WA 1W2IA 5F8IA 2GMLA 3ENWA 1RTDA 2V8DA 2DNKA 3V81B 5GAHI 2N7CA 3SSQA 1HR0F 2PN6A 3NKYA 4CWBA 2AYGA 1NHUA 5DGBA 1KLMB 1WG5A 2HIQA 1RAGB 2LQBA 3CCES 3CO9A 3ZC4A 2RS2A 4IFYB 3FEYB 4FBUA 1WKKA 4KGVB 1FDDA 4ZPAA 2DGWA 2ZDPA 2EFVA 4K4VA 1NRKA 2VD3A 1VLOA 3M8SA 2FHOB 1Q8LA 1KWMA 4MMOA 5GMEA 3G8SA 4USHA 4OMFG 1ZZNA 1RP5A 4QYZK 5ETOA 1ZM3A 4PPDA 1Q8IA 2ZUGA 1U1LA 3P5BP 4WE1B 3MOJB 3NBPA 2ZOGA 3HP6A 2ZBRA 4OLOA 4OI1A 4WTOB 1S7IA 2BANA 5CA5A 2JRSA 2IBKA 4DDFA 4DZ6A 4Y28C 1VK8A 1C0TB 1UTAA 1JXEA 2CPJA 4TKTA 2R7TA 3QRQA 4DSJA 3CCJS 1FRKA 4ZPTR 1X5OA 2X1AA 3V4IA 4NEYA 3M30B 2LQ8A 4IH6A 3OTBA 3NGUA 3KK1B 4N47A 1K73T 3BR8A 1LW0A 3TUIC 1LWFB 2M4MA 3OR2B 2GVZB 4K4XA 4B9NA 1O51A 5G0RA 2VOPA 3RB0A 3OFHA 1KR4A 3M2UA 4CNZA 3DFEA 2JHEA 2MPUA 3G6VA 2KHDA 4OZ3A 3OL9A 3O2IA 2VA3A 2IYIA 5GAEI 3U7JA 2B4PA 1QD1A 1M1KT 2V0NA 1RHKB 2CNLB 2ZZMA 3UNYA 2G2OA 3KJQB 3QLHB 3MR5A 1D9DA 2KG0A 1VHFA 4DUTA 4B9MA 3GFHA 5I42A 3C6UB 4V19X 3DRXA 3QAUA 4U6PA 5KG5A 3PRVA 2KDOA 2WONB 1KVIA 4KH1B 5T14A 2W4CA 4ECZA 1YRTA 2YKPA 1H7XA 3HT0A 2RDIA 1GT8A 5M2RA 2DKOB 2JEJA 4UOCA 2KRBA 1QVFR 2E5GA 4I6YA 2ZFHA 4Y2IA 2YX1A 1ULRA 1OY6A 4H4KA 4ITSA 2NUHA 5I3QA 2QLFB 3NGTA 1BC6A 2V68A 5HL7Q 1AW0A 5CAAA 4PXEA 3HSJA 2EWHA 2W2QP 3EGVA 5GMDA 3NCQA 4B3RJ 1VRTA 1UWBB 3CD7A 3W3SA 1WJ9A 3I6PA 1FTCA 3R5JB 2W9AA 2B9YA 2F9JA 1HW9A 5GADI 1S6PA 3PW5A 2KO1A 2IM2A 1CBKA 2C2OB 2EPIA 2CG8A 4J37A 2YH1A 2V8HA 3PR4A 2YNIB 2AJFE 5D4OA 2DGSA 3NG8A 1HMVA 3DI6B 3GZ7A 1UPPA 4EBCA 2V34A 3MM8B 5C7PA 1B70B 1K47A 4USTA 2DR9A 4UQGA 4LSLA 5J1EB 5C42B 3BR9A 2I6WA 2OFGX 3I4PA 1SJ3P 3MECB 3IRXB 4X4OA 4EEYA 1U6FA 1DRZA 3KLEB 3GYNA 1NDPA 4S0MA 4CLYA 4QWDA 1X9WA 4KIAA 1YJVA 3CCVS 5F3ZA 1E6YA 4JI8F 4I6AA 2VPXB 4JI2J 2ZH2A 3L9ZA 3PHTA 1FERA 1NUEA 3BO2A 4XDDA 3N9UC 3EVMA 1VRQC 2FVQA 3MEDA 2YX7A 1FNXH 4OX7A 1R8HA 2BKOA 8ATCB 3MXHP 1RWMB 4W98A 3H25A 2AW0A 2K3KA 2HWHA 1MMLA 4P7VA 5JVGQ 3FFIB 4JOUA 2N82B 2FJXA 4OI0A 1SQFA 1IWAA 2G0CA 2W2PP 3EXCX 2MXYA 4ETXA 1RT3B 3BS9A 3D1QA 3I0SA 1G2EA 3FSYA 4TN2A 3FGVA 4C8KA 2YWFA 3CEDA 3J81Y 2XWXA 2CPYA 3QO9B 1NM2A 4N8OA 5E33A 4YFUA 1XMOF 4KAIA 2FZCB 3V6JA 1HNXJ 3ENQA 3POTA 4RW7B 5HMWA 2FHJA 1GXTA 3MAAB 5ETNA 3FCHA 2I8EA 2W4PA 2P8IA 1S48A 1ITPA 3EZ5A 3RB4A 5AE2A 4RW4B 3EPGA 2CQDA 3TA1A 2VBXA 3M32A 3ZZZA 1LW2B 3DYAB 1SUQB 4PUOA 2HMIB 3L7OA 2WBMA 2QX0A 1S72S 2R8IA 1FJEB 2PA3A 4IG0B 3I0RB 3U1NA 4NA2A 1I6JA 5LSRA 4WZMA 4MTPA 2XI2A 2XS5A 3GR1A 4CM2A 4F0KA 4B3TJ 5AXKA 3KUHA 1FF2A 2M5YA 3DLLQ 2YVSA 4ZVRB 3KTQA 4HHUA 3JXOA 1EQMA 1Y0HA 3W62A 1J5EF 2PMWA 3TAPA 1VQOS 2KYXA 2ZH1A 2PEHA 4CO3A 4U67Q 5K5MA 3A3NB 2CQ0A 9ATCB 2ZVSA 1YLXA 1VQ4S 3WX8A 2IA0A 5KG2A 1WF1A 5JMNA 2Y0BB 3VVTA 5IC4B 1T94A 4C8YA 4LUBA 4HACB 3J80U 1ZA2B 4Q8EA 1VDHA 3VAKA 2PI5A 4RO0A 3H42A 3RG6A 3QFWA 1CVJA 1S9EA 1NHKL 5H9FK 3QYYA 3AD7C 3BYRA 1X4BA 2HFOA 1BQNB 2DXEA 1WOPA 4LF5J 4L3NA 2UVRA 5I4MA 3GMGA 1HA1A 2HQ3A 1B64A 4CI0B 3GFZA 4F4XA 1RT2B 2UUCJ 1KEKA 2BJ3A 1U02A 3KFWX 4O0IA 3J7YI 2F1FA 2XEXA 2VQEJ 2MQQA 2ZHAA 1RJJA 3HVTB 1WACA 1DURA 3MEGB 4K0KF 3H2UB 3TJ9A 2UUAJ 3KOAA 2JWNA 1T05B 1N52B 4CO1A 2F4FA 3H8YA 3HM9A 5DZ7A 4ZVEA 3E01A 1QLNA 4A46A 3BEGB 3J80Y 2CFXA 3TEGA 1PIEA 4H4KC 4F25A 3VF0B 4ZLLA 3CNQP 1XC9A 2MTLA 4DXLA 4DPXA 1U49A 3UN5A 2RUGA 5C24A 2W25A 4UY85 3GIIA 2ROPA 1V9OA 3KJNB 3KLGB 2BR0A 5KFRA 2P2CB 3SDEA 1UL3A 3JSBA 4EU0A 4Y34A 3A4TA 3VQTA 1PC4A 4FYXB 4NLSA 3O1LA 2YQ0A 1RWNB
chains in the Genus database with same CATH topology
1BE4A 1NDCA 2CWKA 3VVUA 5IOLA 1NLKL 3NGUA 3Q83A 3EJMA 1S5ZA 3EE3A 4CP5A 3EMTA 3Q8VA 3VGSA 3ZTQA 2VU5A 2DYAA 3VGUA 2HURA 3FCWA 2B8PA 3ENAA 1K44A 1NCLA 1UCNA 1HIYA 3NGRA 2DXDA 4ANEA 4F4AA 4UOFA 4UOGA 3VGTA 1WKKA 3GP9A 3FBBA 1LWXA 1HHQA 3BBCA 3DDIA 3PJ9A 1PKUA 3NGTA 3Q86A 1WKJA 3R9LA 3Q89A 2HVDA 1ZS6A 3BBBA 3ETMA 1NDPA 4F36A 3VGVA 4WBFA 5CAAA 4S0MA 5CABA 4O0NA 3ZTPA 4ENOA 3Q8YA 1BUXA 1HLWA 1F6TA 2DXFA 3BBFA 3WX8A 3ZTSA 3B54A 2AZ1A 1VYAA 4KPCA 5BXIA 2BEFA 1U8WA 1W7WA 3VVTA 3FBEA 4HR2A 1PAEX 3Q8UA 3ZTRA 2BX6A 3FBFA 1MN7A 3MPDA 3BH6B 1NUEA 1NSQA 4ANDA 3GPAA 3BH7B 1LEOA 3B6BA 3ELHA 1MN9A 3EM1A 3FC9A 2HVEA 4FKXA 1NSKL 1KDNA 1NHKL 3EVMA 2ZUAA 1B4SA 2NCKL 1NDKA 3G2XA 1BHNA 2DY9A 1B99A 1NSPA 4EK2A 4FKYA 3FCVA 2B8QA 3EICA 4DUTA 1NPKA 4ANCA 3EVOA 1S59A 1JXVA 4DZ6A 3EVWA 3ZTOA 3PRVA 4W98A 1EHWA 3FBCA 3NGSA 2DXEA 1F3FA 3JS9A 2AZ3A 4UOHA 4DI6A 3FKBA 1WKLA 3DKDA 1XIQA 4C6AA 5C7PA 1NB2A 1S57A 3L7UA 1XQIA 1NDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE4 A;  1NDC A;  2CWK A;  3VVU A;  5IOL A;  1NLK L;  3NGU A;  3Q83 A;  3EJM A;  1S5Z A;  3EE3 A;  4CP5 A;  3EMT A;  3Q8V A;  3VGS A;  3ZTQ A;  2VU5 A;  2DYA A;  3VGU A;  2HUR A;  3FCW A;  2B8P A;  3ENA A;  1K44 A;  1NCL A;  1UCN A;  1HIY A;  3NGR A;  2DXD A;  4ANE A;  4F4A A;  4UOF A;  4UOG A;  3VGT A;  1WKK A;  3GP9 A;  3FBB A;  1LWX A;  1HHQ A;  3BBC A;  3DDI A;  3PJ9 A;  1PKU A;  3NGT A;  3Q86 A;  1WKJ A;  3R9L A;  3Q89 A;  2HVD A;  1ZS6 A;  3BBB A;  3ETM A;  1NDP A;  4F36 A;  3VGV A;  4WBF A;  5CAA A;  4S0M A;  5CAB A;  4O0N A;  3ZTP A;  4ENO A;  3Q8Y A;  1BUX A;  1HLW A;  1F6T A;  2DXF A;  3BBF A;  3WX8 A;  3ZTS A;  3B54 A;  2AZ1 A;  1VYA A;  4KPC A;  5BXI A;  2BEF A;  1U8W A;  1W7W A;  3VVT A;  3FBE A;  4HR2 A;  1PAE X;  3Q8U A;  3ZTR A;  2BX6 A;  3FBF A;  1MN7 A;  3MPD A;  3BH6 B;  1NUE A;  1NSQ A;  4AND A;  3GPA A;  3BH7 B;  1LEO A;  3B6B A;  3ELH A;  1MN9 A;  3EM1 A;  3FC9 A;  2HVE A;  4FKX A;  1NSK L;  1KDN A;  1NHK L;  3EVM A;  2ZUA A;  1B4S A;  2NCK L;  1NDK A;  3G2X A;  1BHN A;  2DY9 A;  1B99 A;  1NSP A;  4EK2 A;  4FKY A;  3FCV A;  2B8Q A;  3EIC A;  4DUT A;  1NPK A;  4ANC A;  3EVO A;  1S59 A;  1JXV A;  4DZ6 A;  3EVW A;  3ZTO A;  3PRV A;  4W98 A;  1EHW A;  3FBC A;  3NGS A;  2DXE A;  1F3F A;  3JS9 A;  2AZ3 A;  4UOH A;  4DI6 A;  3FKB A;  1WKL A;  3DKD A;  1XIQ A;  4C6A A;  5C7P A;  1NB2 A;  1S57 A;  3L7U A;  1XQI A;  1NDL A; 
#chains in the Genus database with same CATH topology
 3TZX A;  3TA0 A;  3TAN A;  2X3D A;  2B7C B;  1X4H A;  4BCA A;  5D6G A;  4I56 A;  3M1V B;  2E1A A;  3TNV A;  2L08 A;  2YKQ A;  5E7O B;  4RBV A;  3H40 A;  4Y65 A;  1HBO A;  1PYO B;  3CE8 A;  2CXE A;  2H54 B;  2AYB A;  4JI3 F;  2DHH A;  1IKW B;  1M5P C;  4PG5 A;  2RML A;  4DCJ B;  1FK9 B;  4RW8 A;  1SJ4 P;  1EKS A;  4NOH A;  3ISN D;  3R5G A;  1NJZ A;  2M0G B;  4ELU A;  1F1B B;  5CYJ A;  2XI3 A;  4NML A;  4CLW A;  3BM7 A;  1T3O A;  5DZ6 A;  2HVZ A;  2A10 A;  3PYG A;  4ILR A;  2XNQ A;  2CRL A;  1TL7 A;  4OZL A;  5HO4 A;  2EW9 A;  4ANC A;  3ZO7 A;  3PW0 A;  4ZLP A;  4GMK A;  1H2T Z;  2GMJ A;  4K4Z A;  1T95 A;  3DOL B;  4OYO A;  1K8A T;  1TV6 A;  3SCL E;  2JEF A;  3C14 B;  5E3R A;  2HHU A;  1L3K A;  2OPS A;  4RNF A;  2VPZ B;  1NME B;  2UUB F;  5IFM A;  2XYG B;  5D3G B;  2ZNY A;  4IOB A;  2A2D A;  2E9R X;  5L8R C;  4KJI A;  1WI8 A;  5HMZ A;  3MDF A;  2GVD B;  1PBA A;  2DR8 A;  1Y5I B;  4FN5 A;  4NCA A;  1ZM4 A;  4FVC A;  2BJ7 A;  1H0H B;  1AB8 A;  1RDR A;  4O0N A;  3DRS B;  2CZ4 A;  2NS1 B;  1X60 A;  3I9V 9;  4CTA A;  3K5P A;  2WAQ D;  1YJT A;  1MU2 A;  1RT6 B;  1RSC A;  2QTW A;  5J2P B;  2HVE A;  2ZHO A;  1N36 J;  1HNI B;  2C3P A;  5F8G A;  1SC4 B;  4IO1 A;  4DR7 J;  3W60 A;  1LK7 A;  1HI8 A;  2KH9 A;  4YHH J;  3JTO A;  1CQM A;  4WU3 A;  1FES A;  2YH0 A;  4OYX A;  4DI6 A;  4A8S A;  4B3M F;  3PW7 A;  2GAH C;  1U1R A;  3T5H A;  4F3M A;  3BV8 A;  4NLW A;  1YQH A;  2HBR B;  4RU9 A;  1CSJ A;  1D09 B;  2YKM B;  3ZTQ A;  1FRL A;  3RRG A;  2X3G A;  2NXN A;  3JSR A;  5HI7 A;  1MRO B;  4ID8 A;  4LF6 F;  1X8D A;  3TOQ A;  4F3Q A;  4DN0 A;  2BQ3 A;  3ILL A;  3GQC A;  3Q89 A;  2DD8 S;  3CJ5 A;  3SCI E;  1IBL J;  2DXF A;  5HRO B;  4RZR A;  4X4R A;  1RTI B;  3P4U B;  2VB6 A;  1OWX A;  3PYE A;  2HBQ B;  2OPR A;  4I4B A;  2VG6 A;  4UW2 A;  2AX1 A;  2FHM A;  1TUV A;  1DQ8 A;  5GMK a;  3MD1 A;  5CYQ A;  1NPK A;  1WC1 A;  4U7C A;  2VPY B;  1T03 B;  3MMC A;  3KYL A;  4B3S F;  3ZTO A;  1FCA A;  3UDV A;  2QGF B;  5IC6 B;  2BRL A;  1EHW A;  3ZZY A;  3ET6 A;  5EWF A;  4A8W A;  2DRB A;  4RBT A;  1JQG A;  2OMO A;  1UAW A;  3CB4 A;  3OVA A;  2CWK A;  1JJ4 A;  1S1W A;  1JMT A;  2LXI A;  3G86 A;  2P9C A;  4BS2 A;  4R0J A;  4USI A;  3PRD A;  4IQM A;  4UOF A;  3DC2 A;  2BMB A;  4DR3 F;  4OX6 A;  2KVI A;  2VA2 A;  1JLF B;  4CLZ A;  1RLD A;  2JC1 A;  2CZV C;  3NEK A;  1YZ6 A;  1TAU A;  2GGP B;  2GJI A;  4N56 A;  2QLJ B;  2YTC A;  1FKO B;  3LP2 A;  2AMC B;  3FBF A;  2WHO A;  3BH6 B;  2ZC3 A;  3H0P A;  2G0J A;  3RU0 A;  1R0B G;  4ZLN A;  2ZH4 A;  5C25 A;  2HHQ A;  2FLO A;  3BSN A;  4LSN B;  1WF2 A;  1SH3 A;  4AQY J;  1B7Y B;  5DJB A;  4IFV A;  2QC3 A;  4J9S A;  1F9F A;  2AZ3 A;  5AXM A;  3OXF A;  3ZZU A;  3RUB L;  3DLE B;  2E1M C;  3K57 A;  5DLF A;  4DUY J;  4K2X A;  4ECS A;  4MKV A;  3UQS A;  3OFG A;  2VQF J;  4RUC A;  3CCU S;  4DR6 J;  2HHT A;  2VH7 A;  1KS2 A;  2NRE A;  2XYH B;  3UVJ A;  1TVR A;  1ZPW X;  1WUU A;  3QMQ A;  1U7L A;  1R0C B;  1RTJ A;  4BLG A;  4ID5 A;  1VQ5 S;  5HQL A;  1S79 A;  3BDE A;  3ZTP A;  4DS4 A;  2RSQ A;  1B0T A;  1TKT B;  2BEF A;  4MT1 A;  2V8G A;  4H4O A;  1YJW S;  3D67 A;  5KT6 A;  1PG5 B;  4F26 A;  4DUZ F;  4ZP8 A;  4A4J A;  2BJE A;  3NS6 A;  1NSK L;  4NXN J;  1YIJ S;  5E3Q A;  5CYM A;  2OAU A;  1NU4 A;  4LFA F;  4KV8 B;  1PAU B;  5ADZ A;  1BGX T;  3CCZ A;  1IUJ A;  2ZKU A;  4XDC A;  4TQS A;  2FQQ B;  4QW8 A;  5I3U B;  3PIP Q;  1N0V C;  2LXU A;  3D28 A;  1S99 A;  4DSI A;  4E0D A;  2PFD A;  1UEU A;  2VBW A;  1IXK A;  2J6S A;  2ERR A;  3RBZ A;  2EFQ A;  4NYO A;  4G1Q A;  1NZ8 A;  3CCW A;  2HHH J;  4LFC J;  1N5Y B;  1NJY A;  4ZP6 A;  2ASY A;  4OYB A;  4OYI A;  3TX0 A;  4CLT A;  2EBG A;  4XK8 C;  4JI4 F;  4A8F A;  1Q7Y T;  4DV4 J;  3OVS A;  3BO3 A;  1BMQ B;  2KVQ E;  5IZH A;  1H38 A;  1R0A B;  1N0U A;  3B54 A;  1GX6 A;  2I0X A;  2DNG A;  3OR1 B;  1F2H A;  3IC1 A;  1F9H A;  1NJW A;  2K3I A;  1LEO A;  2O3D A;  3LUY A;  1D3W A;  2JH3 A;  1HI0 P;  1DZ5 A;  1M1H A;  4PRF A;  3KLI A;  3C16 A;  1WG4 A;  4I7F B;  2W8L A;  4J9N A;  1T8E A;  3IG1 A;  4JYA F;  1G6B A;  1JWW A;  3N6L A;  2VG7 B;  1RT4 B;  1OIA A;  5MLC V;  2Y1J A;  3M8W A;  1XTZ A;  1XBW A;  2QMU B;  2HVI A;  4AXI A;  5KT2 A;  1JLB A;  1KKH A;  3DLJ A;  2VUG A;  4IH7 A;  4WFZ A;  3KJF B;  3JTP A;  3O5T B;  4ED7 A;  1FDN A;  2YWE A;  1T9V A;  4PZV A;  5ETT A;  4RNO A;  2ZOM A;  5LSL A;  3RAM A;  4WFN Q;  5LMN F;  4X64 F;  2GC8 A;  2PO4 A;  1S1U A;  2BJD A;  1GMW D;  2CAJ A;  1P8G A;  2CNK B;  3M8P B;  2GA7 A;  3H59 A;  2AZ1 A;  4LF9 J;  4B3O A;  2W2N P;  4ZVS B;  3VCD A;  1R3N A;  1QE1 A;  2ZH3 A;  4J9O A;  1FI4 A;  1VQ8 S;  3K89 A;  3CWJ A;  4ZJQ A;  3C19 A;  1BD6 A;  2IJN A;  4YQW A;  3EM1 A;  3HD1 A;  1Y11 A;  2YNG B;  3TEH B;  4X66 J;  4UQT A;  2XC9 A;  5HLF B;  5CZV A;  1NSP A;  1LXJ A;  3SCJ E;  3BB5 A;  1RT1 A;  2XBP A;  4GVB A;  3OFE A;  2F8M A;  3CMQ A;  2H48 B;  3FKB A;  4O44 A;  1S0O A;  4CH0 S;  2RHQ B;  3M6U A;  5T7L B;  1FRM A;  2ZDO A;  1F60 B;  4DSF A;  3R5B A;  4LF1 A;  4TU8 A;  3VVU A;  2HLU A;  3IRW P;  5L1L A;  4Y00 A;  2QYG A;  3IMQ J;  1CJT A;  2C2M B;  2OP5 A;  5D77 A;  1IQZ A;  3T19 A;  4HKQ A;  1GXL A;  5KFK A;  4X4Q A;  2EKN A;  1AFJ A;  3TQ1 A;  4KBI A;  1R89 A;  1HNX F;  1TKZ A;  1LWC B;  3HSG A;  2B56 A;  4OHX A;  3MCN A;  5IV3 A;  3MPV A;  2W2O P;  3PNI A;  1OQ6 A;  2YPZ A;  2QL5 B;  4C11 B;  3S01 A;  4PWD A;  3R5C A;  1DFD A;  2FVS A;  1VI7 A;  2HZA A;  2DR5 A;  3IBW A;  3LPY A;  3D68 A;  5AT1 B;  4NRU A;  4CLP A;  3JSM A;  4OYM A;  4U8Y A;  2DNM A;  3FZB A;  1X0P A;  1LXN A;  3N5F A;  4XTT A;  2X1G A;  4PQA A;  4ETZ A;  4M95 A;  4DPW A;  4XPE A;  1CG2 A;  4JI1 J;  2KJW A;  2QO3 A;  1I1G A;  1OO0 B;  1PBU A;  4N8N A;  1JB0 C;  2K1R B;  1CEZ A;  2V4J A;  1R8P A;  1C1C A;  2JLE A;  1YHQ S;  3QRR A;  2YQ3 A;  4QZV B;  3U02 A;  2OPP B;  2H51 B;  2LKZ A;  4ZP9 A;  4DHV A;  1S1V A;  3TAM A;  2Y1L B;  2WCX A;  2GIF A;  2CPD A;  5KG3 A;  2YNF A;  1RWX B;  3WC2 A;  1RT7 B;  1YRX A;  3T5K A;  4EYH B;  2W9B A;  4ZIV A;  2QL9 B;  4CH1 A;  3US5 A;  4RNN A;  1HNV B;  6FDR A;  2DIT A;  2YWW A;  2UXB F;  5JXS A;  3PY8 A;  1UJ5 A;  2BAB A;  2IYG A;  1U26 A;  2JNJ A;  1DTQ A;  2J8S A;  1OSC A;  1JKH A;  1Q53 A;  1N6Q A;  5ETR A;  1X9S A;  2XZD B;  3MCO A;  3MMJ A;  2ZD1 B;  4J9P A;  5HJX A;  3G87 A;  4LF5 F;  4YP3 A;  4HI2 A;  4N77 A;  2Z58 B;  1F3F A;  3TR5 A;  3MOZ A;  1FRH A;  4KR0 B;  5C2G A;  4O3R A;  3M8Q A;  5IQQ A;  1IKV A;  2UUC F;  3CDA A;  1RTH A;  1T7P A;  2UXC F;  1N54 B;  3VAL A;  2DNH A;  4YR2 A;  1SI9 A;  3W63 A;  1NLK L;  2N7Y A;  1H7W A;  4FPR A;  3MM5 A;  2VPW B;  4IDK B;  2XG8 A;  4BHQ A;  1BWE A;  3R7B B;  1Q1K A;  3IAM 9;  1CJU A;  3MWB A;  2WBR A;  4A48 A;  5F8N A;  5LMU J;  2XUL A;  4M5I A;  5BYQ A;  4NI2 B;  2ZWO A;  1HQU B;  1FXR A;  1YWX A;  4PWU A;  3WBZ A;  5B09 A;  3ZTS A;  3BGO P;  3AQO A;  1EET A;  2N4C A;  4OI3 A;  1LKZ A;  3H7H B;  4AL7 A;  5EN1 A;  2UUT A;  3VAF A;  2AEF A;  3O8W A;  1VGY A;  4HH1 A;  2RQC A;  5C2C A;  4ZPW R;  2XHW A;  2J0X A;  3F73 A;  3TZW A;  1B7F A;  2IAJ B;  2DIS A;  3GG1 A;  3W8P A;  4OHY A;  3FK4 A;  3KJV B;  4EWT A;  1QDU B;  1ZPV A;  3W2W A;  1WNE A;  2MST A;  1R8B A;  3MAH A;  2MKJ A;  1U1Q A;  1U0H A;  3BYP A;  1QUP A;  1NK7 A;  4A8K A;  3NXZ A;  3DLH A;  3VHQ A;  3LWL A;  4PXC A;  1RKJ A;  5ITH A;  3HVA A;  2V2Z A;  2MZR A;  2DY1 A;  2EFG A;  3LW5 C;  2J76 E;  3PW4 A;  4PXD A;  1NJI T;  4DV6 J;  3U1L A;  1N5V A;  4FYW B;  3PX0 A;  2PMH A;  4EFA C;  3SSS A;  1QTM A;  1GAO A;  4HHJ A;  1HQE A;  4DL7 A;  3U1M A;  3Q22 A;  4PXB A;  2LXF A;  5U47 A;  2ZOF A;  1P6T A;  2XGP A;  5E0O A;  1JLE A;  2BKN A;  3K5N A;  2EEY A;  1BQM A;  2WK4 A;  2DH8 A;  3DMJ B;  3ZZP A;  5H9E J;  3B82 A;  4JP8 A;  4DQI A;  2AJ1 A;  4ICL B;  1HD0 A;  1DTT A;  2QA1 A;  4X65 J;  3N28 A;  3CDU A;  3EDQ B;  1ZH5 A;  2OPQ A;  3G82 A;  4WK1 A;  5B0E A;  4NRT A;  4NA3 A;  1RWW B;  1BXN A;  4DV3 J;  3DRR B;  4ES1 A;  3MUR P;  1NB2 A;  5C5J A;  2CAD A;  2EI5 A;  2MKC A;  1BE4 A;  5IT9 U;  2JDJ A;  2FHK A;  2B8P A;  3MPW A;  5B0F A;  1PO6 A;  3QGI A;  1I3O B;  4WFX A;  4H4M B;  4PQU B;  1LWX A;  4LR8 A;  3AJ2 A;  3KK3 A;  1KP6 A;  3Q23 A;  3BBB A;  2VOO A;  2FTR A;  5KT7 A;  2ZH5 A;  1S1X A;  4RW6 B;  1KQS R;  4JI0 J;  2DEI A;  2GIR A;  4AFF A;  2NXE A;  2D74 B;  2KZZ A;  4LF7 F;  3P96 A;  4IYQ A;  5F0U A;  5KFG A;  3T1H J;  2VOD A;  1JLQ A;  1N36 F;  4ZHR B;  3S7R A;  4NLT A;  1Z2L A;  4DR7 F;  3Q8S B;  2EVZ A;  2YWK A;  4QIW D;  3PX4 A;  1WWH A;  3IWN C;  1U1M A;  3B8H A;  1EQ0 A;  1HBM B;  2UV8 A;  2HLT A;  1FWK A;  2QEX S;  1VJW A;  4YB5 A;  2EFN A;  4LQ9 A;  4ED2 A;  4NZ6 A;  2OEL A;  2NLW A;  2WOM A;  1MWQ A;  4WIQ A;  2NUU G;  4USM A;  3T1Y F;  2V50 A;  4IRD A;  1TQL A;  2LEA A;  2GZO A;  4WWS A;  2D3U A;  5BR8 J;  1Y3K A;  1UCN A;  3NP5 A;  2CJY B;  3BDP A;  3V6K A;  4GKK J;  3E2E A;  2CQ3 A;  4IKA A;  2XCA A;  3V81 A;  3HO1 A;  5AE3 A;  3OTD A;  3R7S B;  4IR9 A;  1KLM A;  5BXI A;  1N34 J;  1IM6 A;  3T5J A;  3DOK A;  1WD6 A;  4IFY A;  2RU3 A;  2IY5 B;  2R7V A;  2GHP A;  3H5U A;  3FNN A;  4WYL A;  3FC9 A;  3A8E A;  4K8R A;  3QT5 A;  4JV1 A;  3PKM A;  4G65 A;  4G6V B;  5IQ6 A;  3LAK A;  3R2D J;  5L1I A;  1B3T A;  4OZJ A;  1SV5 B;  3UR3 C;  3AOB A;  4R5P B;  3IM9 A;  1JNZ B;  4K4Y A;  1F5A A;  1PIL A;  4PAB A;  3SFG A;  2YKN B;  4RJV A;  4K5R A;  4WE1 A;  5D0G A;  1H72 C;  4Q5V A;  3A8J A;  3OTC A;  1CS4 A;  1WEL A;  2CIM A;  5KOW A;  4I2P B;  2Z2M A;  5DGA A;  4CP5 A;  2E66 A;  1RAE B;  4L76 A;  3MM9 B;  1FKP B;  2DXD A;  1FTR A;  1Q7L B;  2X1B A;  4K4S A;  4CIO A;  3BSO A;  3EYZ A;  1QAJ A;  3BGR B;  2ZBI A;  1REV B;  5FDL B;  2GNK A;  3M30 A;  1Y4Z B;  4GC7 A;  2NPF A;  4DG1 B;  1RZM A;  1L3V A;  1VYA A;  4JI7 J;  2AHO B;  3KK1 A;  2X7I A;  4DSE A;  2JZ5 A;  1UET A;  3CD0 A;  4QYZ J;  2CQP A;  4YN3 B;  1YTY A;  1LWF A;  3CPW R;  5THW A;  4ZVQ B;  2GVZ A;  1KNZ A;  1F3V A;  2CJB A;  3GYG A;  4QWA A;  1UVN A;  2V94 A;  3MD3 A;  1TR0 A;  2DPI A;  3FDS A;  3PZP A;  2FLN A;  4M5J A;  1SQE A;  2XB2 D;  3EZU A;  3WHI A;  1ROF A;  4OFZ A;  3J7A 1;  6AT1 B;  4QCL A;  4DR6 F;  4I2Q B;  1CC8 A;  3CJK B;  2ZNZ A;  4ED5 A;  2A6O A;  3D9B A;  3QLH A;  2KTQ A;  3C6T B;  1L3T A;  4I67 A;  2I5J B;  3C6U A;  3VGU A;  2C3O A;  2AJ4 A;  3M2V B;  3TAQ A;  2VBY A;  1HNZ J;  4KGK A;  1M1G A;  4Q2L A;  1S77 D;  2OTJ S;  3HHL C;  3PM9 A;  4LVN P;  2GX8 A;  3CW2 C;  5A2Q Y;  1NK9 A;  3QGH A;  1RAJ A;  1TAQ A;  1ZOT A;  2CJA A;  2HND B;  4HYK A;  1Z2Z A;  4ED3 A;  2KB2 A;  1S9G B;  3P49 B;  4E8U A;  2D3O R;  3SV3 A;  1EIY B;  2MMY A;  4ZN1 A;  4QIV A;  4QQB A;  2ZBP A;  1Z1Z A;  5F9L A;  1DHM A;  4NXN F;  1U4B A;  1JX4 A;  1RB0 A;  4KT0 C;  4ELT A;  3FCV A;  2QLB B;  1ACM B;  4LFB F;  1I94 J;  4HI1 A;  2HHS A;  5DDR C;  2UU9 J;  1T9X A;  4F50 A;  3JQM A;  2GW8 A;  5D4N A;  1X31 C;  4R0E A;  2ZJP Q;  4H54 A;  5IWA F;  8RUC A;  5CQG A;  1ARO P;  1Q78 A;  3HVR A;  2QE5 A;  4ZVO B;  1TP7 A;  4Y2M A;  2YNI A;  1XJW B;  2YX4 A;  4V19 J;  1XNQ F;  3MCM A;  4ZJL A;  1AUS L;  2R7S A;  3DI6 A;  4NAS A;  2YKO A;  2MZT A;  5CH7 B;  1EAY C;  4LF4 F;  1UZH A;  3UDL A;  1Y5L B;  4CT8 A;  3DLK B;  2BE2 B;  4KPC A;  3RB6 A;  1UA0 A;  1UW4 A;  5J1E A;  2DGX A;  2VBZ A;  4HR2 A;  1PAE X;  2EG1 A;  4W92 B;  4OJ1 A;  2E5J A;  3MEC A;  2R2T A;  3IRX A;  1RWU A;  2J9C A;  4Q0B B;  2XYP B;  4QU7 A;  3M32 B;  1PJ6 A;  3PKY A;  4TYA A;  3OLB A;  3KLE A;  4PUO B;  4OJ3 A;  2WVD A;  1EP4 B;  2F9D A;  2D9O A;  3NOG A;  3QSY B;  2CPE A;  2OD6 A;  1S10 A;  2R3V A;  2BOA A;  4NCG B;  2IRY A;  4M5N A;  1ZM9 A;  2AJQ A;  3F0N A;  2BJ8 A;  4IG3 B;  5KT4 A;  3CUL A;  1NDL A;  4FZV A;  4NXM J;  2FJE B;  3HKW A;  3M6X A;  3TX8 A;  1S1T B;  2DTJ A;  2FB0 A;  2VU5 A;  1QSS A;  5ETV A;  2A6M A;  1S9F A;  2QLX A;  4HT5 A;  5KFF A;  4M5D A;  3RZA A;  5A8W B;  2MHN A;  2HAF A;  3G6Y A;  1VQM S;  2FY1 A;  2L9W A;  1TFY A;  4OZ0 A;  3KXD A;  3BGL A;  1YBU A;  5ETS A;  4K4U A;  1WKJ A;  3BSC A;  3A3P B;  3FFI A;  2QFI A;  3I9Z A;  4IH5 A;  4C3K A;  4O4R A;  1B0V A;  1JLG B;  3T6B A;  4LF9 F;  4R25 A;  2IVF B;  3MFH A;  3UFC X;  2LQ5 A;  5HAO A;  2J8A A;  4ZA1 A;  3JSY A;  1KSP A;  1VRU B;  4YR3 A;  4DV0 J;  3KNG A;  2RVJ A;  2R42 A;  4WP3 A;  2ZUA A;  3QO9 A;  3OTE A;  3BZQ A;  4LQ3 A;  2B9W A;  5IM0 A;  1GMV A;  2JL9 A;  2DH9 A;  2RE1 A;  3HCX A;  1X0F A;  1RKI A;  3CUN A;  1VC6 A;  4RW7 A;  1TL1 B;  2EFP A;  3NCP A;  1X4G A;  4F0M A;  3CIM A;  5EX3 A;  3W66 A;  2DR6 A;  2FJV A;  1FNM A;  1HBN B;  3SYZ A;  3EGZ A;  4RUA A;  1TUG B;  1DLO B;  5F41 A;  3M05 A;  1LW2 A;  3LGM A;  3DYA A;  1SUQ A;  4EBE A;  2QN6 B;  2HMI A;  1RU2 A;  4RUH A;  2B0G A;  5D0R A;  2M7S A;  3Q86 A;  3I0R A;  3QT6 A;  3CTR A;  3E01 B;  1BUX A;  3I4H X;  3AB2 B;  1FHT A;  2NZC A;  3H20 A;  1VBY A;  5EHH A;  2CVE A;  3P45 B;  5KFW A;  3CGI A;  1HWU A;  3A13 A;  4O4G B;  4FPI A;  4JUZ A;  2JFD A;  4JI6 J;  4KHP F;  1LFP A;  3GG0 A;  4TVA B;  5KFN A;  2ZWP A;  4EZ9 A;  3AAW B;  2A1B A;  4X4U A;  1VK3 A;  2QMW A;  2VL1 A;  3ZNU A;  5SZT A;  3LQV A;  4HAC A;  2OHD A;  2BDP A;  2G9O A;  4USV A;  3TI0 A;  3KHL A;  1M90 T;  1FJG F;  2DIU A;  4DR1 J;  2UXD F;  3W1Y C;  2B4O A;  3OJU A;  5GAG I;  1KFS A;  2WVF A;  4U7U K;  4KC5 A;  1IVZ A;  2ZE2 B;  1URR A;  2XTJ P;  4LT6 A;  1BQN A;  2Z57 B;  4DR2 F;  5E3P A;  3TUZ C;  1RIS A;  1NBE B;  3MR7 A;  2ZKT A;  4JV5 J;  5HBM A;  1FE0 A;  1FWL A;  3SIP B;  3AHP A;  2IPO B;  1R8C A;  3TJ8 A;  3JAM Y;  1S97 A;  5J2Q B;  5CAB A;  1RT2 A;  4HVZ A;  2BRK A;  3T5L A;  3C15 B;  4FP9 A;  1KVK A;  1UA1 A;  3E51 A;  5CD4 A;  1C4C A;  1SJQ A;  4ER8 A;  3HLU A;  1X5P A;  2BW2 A;  3AFG A;  1VMB A;  3HVT A;  5KFE A;  3KUE A;  4CRJ A;  4PG8 A;  3RJM B;  3TRG A;  3MEG A;  5T41 A;  1RGV A;  4F7V A;  2ILY A;  2B5J B;  2FHJ D;  2OEK A;  5FII A;  2NXU A;  4DF4 A;  5LXR A;  2W01 A;  1T05 A;  1JLA B;  2V9W A;  1HFE L;  3HSZ A;  2GMH A;  5H9F J;  2Q6B A;  2KT3 A;  2LEP A;  3DGP B;  3ITH B;  2F63 A;  3H5S A;  2IHR 1;  3VAH A;  2HRT A;  4Y2K A;  2OI2 A;  1NZA A;  3CJ3 A;  3W9H A;  4YUD A;  1VS3 A;  1H6K X;  3VR1 A;  1P9Y A;  1VQL S;  3Q0A A;  3TZZ A;  1JJH A;  2BVZ A;  1IKX B;  2F65 A;  1FX4 A;  4NLG A;  5DLG A;  4E98 A;  4P7T A;  4CO4 A;  5LMU F;  2VG5 B;  1ZS6 A;  3HZG A;  3W5Y A;  1HBU A;  2VJU A;  2NYH A;  3MM7 B;  3QWP A;  2IM0 A;  3B4D A;  1NPP A;  3C3L A;  2RRA A;  3PEH A;  3QAT A;  3DOM B;  3IWX A;  3D7S B;  3M1V A;  2B9X A;  3SQG A;  5H1S V;  2IDL A;  3PXG a;  1HWL A;  4FKX A;  5AXL A;  1FRI A;  4B9V A;  1S49 A;  2WVE A;  5KT3 A;  3N4W A;  2R8J A;  1AFI A;  5HVF A;  1IKW A;  4A8X A;  2KL8 A;  1FK9 A;  5DG8 A;  1KQK A;  4DV7 F;  1Q81 T;  2HQD A;  2XO7 A;  2GJ2 A;  1S4E A;  5A6W A;  4D3G A;  4OZN A;  2HQF A;  3Q83 A;  2PEB A;  4DSK A;  4RWW A;  1A6L A;  4LMZ A;  4DV6 F;  1S4F A;  1LV5 A;  3M9O B;  3KNA A;  2HQC A;  4F4K A;  2Q3P A;  4KPY A;  4EI2 A;  4ZLJ A;  1PKU A;  3DOL A;  1HR0 J;  4G3I A;  5D78 A;  2W9C B;  4WBF A;  1F6T A;  1WC5 A;  4LR7 A;  3TAR A;  5D3G A;  1U1P A;  2AT1 B;  4PAA A;  2XLI A;  3LGN A;  2RU9 A;  1APS A;  3BJY A;  3MMB B;  2P9G A;  1WOO A;  2J0S D;  1LOU A;  2H5E A;  5CYQ B;  3LA0 A;  2COL A;  4MJK A;  2B9E A;  3DU5 A;  2G0I A;  4TNO A;  1EX8 A;  3W9J A;  2DNO A;  1TK8 A;  2FVC A;  3OW2 R;  3X3U A;  1KBR A;  1RT6 A;  5CZX A;  3SCK E;  4AE5 A;  5KFC A;  4KKO B;  1V3R A;  1T3N A;  2ILZ A;  2B6A B;  1HNI A;  4WPA A;  2X1F A;  4LRC A;  4L74 A;  4X2B A;  1FJ7 A;  2CQ1 A;  3ISZ A;  2VZ9 A;  4C8O A;  3Q24 A;  4ANE A;  2JC0 A;  2KFZ A;  2V67 A;  3PVX A;  1IQT A;  1X4F A;  4UUX A;  4OV6 A;  2L41 A;  5HMY A;  4PG7 A;  4DSL A;  3OXG A;  4DZD A;  3Q8P B;  1OY9 A;  2IVY A;  1VR6 A;  2V8P A;  2YKM A;  3IS9 B;  1V5V A;  3CJ8 A;  1MRO A;  3JYT B;  2MDA A;  1XR5 A;  3G9C A;  4OL8 A;  3HVW A;  5C25 B;  2DRD A;  4KH0 B;  4OJG A;  1TL5 A;  5HMX A;  2FGO A;  2E5L F;  4OZ1 A;  5K8P A;  5DQG A;  2MZJ A;  4NPO A;  3R97 A;  4KRW A;  2KXN B;  1KQF B;  1U1N A;  1MW7 A;  2MGZ B;  4HDH A;  3CJ0 A;  1RTI A;  3HD2 A;  1U6B A;  2HAI A;  4BC7 A;  4CNY A;  2D7S A;  4AL5 A;  4Q7A A;  2YWG A;  4RL1 A;  3JB9 k;  1VQ7 S;  1NK4 A;  2DHG A;  1GTE A;  3HUL A;  3D3C J;  5B08 A;  1WSV A;  4TY8 B;  1T03 A;  2Z2Y B;  3M8Y A;  1GFW B;  2EC2 A;  2Q43 A;  2QL7 B;  2CYY A;  1KN6 A;  3OHA A;  2C3M A;  1C4A A;  5A0Y B;  1FO1 A;  4KQZ A;  4YB1 P;  3UDE A;  4LRE A;  1RT5 B;  4M1K A;  2JEI A;  1ZTT A;  1WTB A;  3CCL S;  3BBF A;  1RLC L;  3CSK A;  2HK3 A;  3GIJ A;  1RWK B;  2HHX A;  1AYE A;  1FXD A;  2HNY B;  4OJH A;  3M8R A;  2AD9 A;  2Z2Z A;  2BOP A;  5CYM B;  1CUL B;  3OSP A;  1JLF A;  2XO6 A;  2HW3 A;  5KFQ A;  1T9U A;  4FKY A;  1N32 F;  4L6V 3;  3T3F A;  4USU A;  4WKY A;  3HHN B;  4ZIW A;  1W26 A;  2CKW A;  3W5Z A;  3GFX A;  1ZYQ A;  1FKO A;  4CLK A;  1N8R T;  2MQ8 A;  4UT4 A;  2F4V F;  2D9P A;  3LP1 A;  1RAH B;  1GQE A;  3BQ1 A;  1YBA A;  1UJ6 A;  3W7B A;  5IOL A;  4GVL A;  3BN4 A;  4LSN A;  3FQL A;  1U0S A;  2I9S A;  2UUW A;  2ACM A;  3W2V B;  2LFV A;  3M6V A;  3R1L A;  3KHG A;  3DLE A;  4Z7Y A;  3KHR A;  5ETM A;  3CIZ A;  3BGU A;  5A8K B;  4DV5 J;  1WC3 A;  2QZ8 A;  4CLF A;  4M63 A;  2AYE A;  1RAA B;  1H2V Z;  2KRR A;  3P3D A;  2DR7 A;  4HTJ A;  1IR0 A;  3CCR S;  1D1U A;  2NCK L;  2LEC A;  2A0F B;  1U45 A;  2ZJQ Q;  1EJ7 L;  1SIW B;  3L4B C;  3R27 A;  4KO0 B;  3UI3 A;  4NA1 A;  1JLB B;  4MK8 A;  3FZ2 A;  4ES2 A;  2ZM6 F;  4OX8 A;  2ROG A;  4ZN3 A;  2HK2 A;  2BM0 A;  3L7U A;  3BN7 A;  4MKB A;  2MB0 B;  1KHW A;  5EWE A;  3H4B A;  3PHE A;  3C46 A;  1J5O A;  4WFB Q;  1NCL A;  4PYD A;  2PD1 A;  1UFW A;  3TP2 A;  1Q82 T;  2YNH B;  2QMX A;  3EGW B;  3CO0 P;  1KON A;  3O3L A;  4A47 A;  1U6Z A;  4FXD A;  4FNI A;  3KK2 B;  3IP0 A;  2LLZ A;  5BYR A;  1R6Y A;  4RLE A;  5CCM A;  3NMA A;  3CVK A;  1DQ9 A;  1GX5 A;  3N01 A;  4WU2 A;  4MK7 A;  1AT1 B;  4F8R A;  3VQS A;  3A8I A;  1R0A A;  1RT1 B;  1LQ9 A;  1CJK B;  1S59 A;  1SXL A;  2W24 A;  2DNP A;  2AGQ A;  1ZAV A;  3I96 A;  2UU9 F;  1A9N B;  4O44 B;  3OR1 A;  2V63 A;  1TKD A;  4USJ C;  4DX7 A;  4RU2 A;  2KU7 A;  5F8H A;  2EBE A;  5L9N A;  1XEZ A;  2G13 A;  2AGO A;  4ED4 A;  4J9U E;  2DO0 A;  1CJT B;  4I7F A;  1MG7 A;  4WCE Q;  2L9N A;  3R6L B;  4L73 A;  2VG7 A;  3UD5 A;  1RT4 A;  5GAH U;  2XSF A;  3DCA A;  1G7C B;  3R2C J;  4Q2M A;  3ETM A;  1BY9 A;  2L9D A;  2KT2 A;  1OY8 A;  1SCJ B;  1N33 F;  3HKZ D;  5HAT A;  1MSW D;  3Q8Y A;  3SBM A;  5E41 A;  1TL3 B;  1DJ0 A;  4A8O A;  3QIP A;  3NGK A;  3QT8 A;  2CPX A;  2HFS A;  4QWB A;  5I3P A;  4ECV A;  3CCT A;  5J2M A;  2CQG A;  3JSM B;  3PYF A;  1VQS A;  3M8P A;  4GO7 X;  2RKI B;  5M2P A;  2DIV A;  2LDY A;  4YDX A;  2VFR A;  3MFI A;  1PSD A;  4HT7 A;  1N5T A;  5B0B A;  6FD1 A;  3KLV A;  2ADB A;  4CYU B;  3GV7 B;  2YNG A;  2RIL A;  4NXM F;  4RX6 A;  4RW9 B;  5L1J A;  4I69 A;  5HLF A;  5FJ4 A;  1XNR F;  3I82 A;  2R7W A;  2H5I B;  1XER A;  2RQK A;  2KI2 A;  2DEJ A;  3GB0 A;  5A6P A;  1S1V B;  1K44 A;  2C22 A;  4LJM A;  2CPF A;  2PI4 A;  4AXJ A;  3LF0 A;  3BBC A;  4IRC A;  3PJ9 A;  4KY3 A;  2VKZ G;  3NOC A;  1RE1 B;  1ICE B;  2IM3 A;  2W9B B;  3Q8Q B;  4UY8 T;  1UVM A;  1IWG A;  1P1L A;  2Y1R I;  1RYR A;  1DTQ B;  2BX6 A;  1RXO B;  4K0K J;  4FXV A;  1PYS B;  4LBH A;  4QR1 A;  1HPZ B;  1MLA A;  2HRY A;  4QJV A;  3DLB A;  4ZVG A;  5ETP A;  2QA2 A;  5F3T A;  2FDN A;  2XMJ A;  2QIF A;  5GAE U;  4YDD B;  2ASJ A;  1U2F A;  1LWC A;  5EGY A;  4UZC A;  3TQE A;  3C66 A;  1LNQ A;  1UFL A;  2GIQ A;  1YIT S;  1R27 B;  1RTH B;  1WHX A;  4J91 A;  1HD1 A;  1W25 A;  4A8Q A;  1SJ1 A;  5KFH A;  3MR6 A;  1KFD A;  2XLJ A;  5LJ5 Y;  4QWE A;  4DV1 F;  1VIO A;  4F4Z A;  3OSN A;  4I64 A;  4ZCL A;  2WRM A;  4KYZ A;  1HHS A;  2CJQ A;  1U1K A;  2OH2 A;  3VZI A;  5FLX U;  3UW1 A;  1JNR B;  1EET B;  2DGT A;  4YS2 A;  2R8H A;  2BUN A;  4Z37 A;  3G8T A;  1C1B B;  4YME A;  1FX2 A;  1S0V A;  1SPB P;  2K1R A;  1VQK S;  1SH2 A;  3G96 A;  1T0T V;  5IV4 A;  3DM2 B;  2OPP A;  1FFW B;  2P6S A;  4JI6 F;  4CLU A;  2RD5 C;  3V2U C;  3P6Y C;  4KGM A;  4PR6 A;  3W2W B;  3GTY X;  3JTN A;  3OLA A;  3EIC A;  3AOD A;  3G4S S;  1UP1 A;  4URQ U;  4QOT A;  3V6D B;  1RT7 A;  3CDE A;  3IN5 A;  4WK3 A;  2M2B A;  7FD1 A;  5GAD U;  3GIR A;  5HJY A;  1QY7 A;  1HNV A;  3PCO B;  4P2F A;  2FC9 A;  2QLW A;  5IS2 A;  1VLY A;  4OX9 F;  2PA8 D;  2HGM A;  3HHE A;  4QIG A;  5J2N B;  4HTI A;  3V6H A;  3RR8 A;  3B78 A;  4M5G A;  2ZD1 A;  1Q79 A;  2GO8 A;  2LA4 A;  2MSS A;  3GP9 A;  3EZO A;  3RRH A;  1RAD B;  3N79 A;  3THP A;  4NLR A;  3PRB A;  3W8G A;  1RUS A;  3QGP A;  4OHZ A;  3S6E A;  2UUB J;  3SMZ A;  4MFB B;  1NK8 A;  5FD1 A;  1HLW A;  1LFW A;  3PX6 A;  4DPY A;  1SJF A;  3D6M B;  1BQM B;  4IDK A;  2E44 A;  1S76 D;  4KGZ B;  4LF8 F;  3G6X A;  5JVH Q;  2CJ9 A;  2R8K A;  3GV5 B;  1PJ7 A;  2H5J B;  2RRN A;  4DL6 A;  1HQU A;  1K1Q A;  2BAC A;  3Q2T C;  2FPH X;  1RAB B;  1CPZ A;  4DWI A;  2H4W B;  2H65 B;  2OTL S;  3OBI A;  5F8L A;  3T41 A;  2LU2 A;  2VFV A;  3JS9 A;  3FMB A;  1O8B A;  4C97 A;  2OO4 A;  2Z2L A;  2XS7 A;  4DQQ A;  2IAJ A;  4K2J A;  4RNH A;  2AJ0 A;  3KJV A;  1FJC A;  1U2C A;  1KVJ A;  4BDP A;  4U9R A;  2Z8Q A;  4C98 A;  5K8O A;  2C3U A;  2FVR A;  4RR5 A;  4DX8 H;  1CJV B;  3R8Y A;  3J81 j;  1X4A A;  1IN0 A;  5L46 A;  3AB4 B;  5LJ3 Y;  7FDR A;  4TU9 A;  2E9Z A;  3MZI A;  1H98 A;  3GR0 A;  3V4M A;  2VJV A;  2PFF B;  1FKA F;  1U8W A;  3I5C A;  1K1S A;  1F9E B;  1UEV A;  4N7T A;  2KKH A;  3HK2 A;  1NK0 A;  4WJB A;  1M5V C;  5L38 A;  3D5M A;  4P73 A;  3UNG C;  3ZTR A;  1I5O B;  2A2C A;  3RTV A;  3I5A A;  3DRP A;  1IJF B;  2KN4 A;  1FRX A;  3AA8 A;  3ZZT A;  3UWT A;  3O6Q A;  3CD6 S;  1LK5 A;  2HBZ B;  5BYS A;  3W5X A;  2VAS A;  3WDO A;  2OEJ A;  2OD4 A;  2ROE A;  3DMJ A;  4DL3 A;  3N6M A;  4N5S A;  2GV1 A;  1FVS A;  2DJW A;  4ILM A;  4B3S J;  2FLL A;  2CQB A;  1V6H A;  2ADC A;  4F4W A;  1HIY A;  2NZ4 A;  1Y7P A;  1M5K C;  3FBB A;  4K4W A;  5AE1 A;  2IFX A;  3Q8R B;  3IXQ A;  1RBL A;  3DRR A;  5L1K A;  9RUB A;  5KFI A;  4PKD B;  5CHC B;  1VC5 A;  3DOK B;  3ONQ A;  3HDS A;  1QAX A;  4RPF A;  1RBO B;  3OT9 A;  2D1C A;  1QM9 A;  2ZJR Q;  1S0N A;  4DR3 J;  1S0M A;  3K7R A;  4H4M A;  4C9D A;  4PQU A;  1NSQ A;  3OV7 A;  1VQ9 S;  3N5B A;  4PG6 A;  2ZC4 A;  3TO8 A;  1X7V A;  3P5T L;  2G2Z A;  4LVO P;  4D3H A;  2AEM A;  4IOA Q;  3NCR A;  4RW6 A;  1HQ2 A;  3N0V A;  3KWM A;  1TZ0 A;  4O3Q A;  4R8U B;  1IBK J;  1M5H A;  1CS4 B;  3UCZ P;  1KTV A;  2AIR B;  4P2S A;  2XLK A;  2AEJ A;  2NXJ A;  3CF5 Q;  1U09 A;  2HNZ A;  3M8Z A;  3MHY A;  4FF2 A;  3HHL D;  4ZHR A;  2W1B A;  2LQJ A;  4GC6 A;  4XAK A;  1LWE B;  4DBQ A;  2DYA A;  3C8Y A;  5K20 B;  3ILO A;  3VTI A;  4G1I A;  5HP1 A;  1IBM J;  1V3Z A;  2MQP A;  1HBM A;  1GEH A;  1SIZ A;  3H2V E;  1ZBT A;  5DG7 A;  4BC9 A;  3FRZ A;  5KG0 A;  2KXF A;  3AOC A;  3J7Y U;  4ZPV R;  1NK5 A;  4B02 A;  3RAQ A;  4TLR A;  4HDG A;  2KM8 B;  5A8R A;  3FMW A;  4MYU A;  1O6X A;  2C3Y A;  2MLY A;  2ZH7 A;  1XR6 A;  3QZ7 A;  4ECR A;  2CVI A;  2HGL A;  2YY3 A;  2PE8 A;  2FJD B;  2J7K A;  4Q45 A;  3F41 A;  2MZ1 A;  2C2N A;  5LOQ A;  1TL4 A;  2MKS A;  2FJB B;  4Q8F A;  4C7Q A;  1S6Q B;  4ED1 A;  1HL6 A;  1IBC B;  2O67 A;  3NGS A;  5D15 A;  2XCP A;  4DUZ J;  2ASD A;  3CD5 A;  3TA2 A;  2OKQ A;  1FFG B;  2QSF A;  4WTY A;  2V5H G;  3FEZ A;  1X5S A;  3QRP A;  3RW6 A;  4LFA J;  2PMZ D;  2AKW B;  1L3U A;  2W4D A;  1HAR A;  2E1P A;  4C8N A;  3QWU A;  4JV0 A;  4B3R F;  1SV5 A;  1V5I B;  4R5P A;  3BKU A;  2YKN A;  4UF4 A;  4ZS6 A;  1BQX A;  2Q79 A;  5KAK A;  1HWJ A;  2UVU A;  2OEM A;  1QSL A;  4NLD A;  3BSA A;  1C0U B;  4I2P A;  3WQP A;  5HVH A;  5EUH A;  5KFY A;  2K7J A;  1T9T A;  3UPF A;  4J9M A;  4DR5 J;  4OZ2 A;  5KFZ A;  3MM9 A;  4JI4 J;  4JBC A;  4QIF A;  4YB7 A;  1FKP A;  3LP0 B;  1FRJ A;  4CO2 A;  3CC4 S;  3R5D A;  1GK8 A;  1SB6 A;  4F2S A;  3MEE B;  3E8O A;  3BGR A;  1KDN A;  4X62 J;  1REV A;  5DM7 Q;  1YJU A;  5FDL A;  1OYD A;  1Q95 G;  2BA9 A;  5AJ3 J;  2MZS A;  4DG1 A;  3HMJ G;  2LP4 A;  1TMJ A;  2MQO A;  1B0P A;  3IGV A;  1HW8 A;  4QBU A;  4JB8 B;  2QJ3 A;  4IR1 A;  4OYA A;  2KFY A;  2K06 A;  1RCO B;  2V9K A;  2MZQ A;  2MQM A;  2DNN A;  2C42 A;  1WF0 A;  4JYA J;  5E5N A;  3PIO Q;  4F3O A;  3GCX P;  3ENA A;  3SZ2 A;  2A3J A;  3QAE A;  3VGT A;  2D3Z A;  4JI2 F;  1NB7 A;  4OHV A;  1R31 A;  1HI1 A;  1AZS B;  2FGC A;  3CXC R;  4NEZ A;  1WC0 A;  3MEK A;  4I2Q A;  2I38 A;  3CJK A;  2FY8 A;  4W90 B;  3WZ0 A;  3J81 U;  3C6T A;  2I5J A;  4J9R A;  4DV5 F;  3DU6 A;  3M2V A;  5LMN J;  1WSR A;  3NWR A;  2QFJ A;  3H5Y A;  4C4W A;  2HHW A;  2XSJ B;  4X64 J;  1N5S A;  4WZQ A;  2AU0 A;  1MN9 A;  3MMA B;  3PJX A;  4QU6 A;  2BE7 D;  2HWT A;  2CJK A;  2P9E A;  4A8Y A;  2J9D A;  2HND A;  3EVW A;  3K58 A;  4CO0 A;  3TWZ A;  1HWI A;  2H3E B;  1S9G A;  4DLE A;  2GJF A;  1N5Q A;  3M4X A;  4KGX B;  2W2M P;  2RB7 A;  3GLJ A;  4HHH A;  4M5D B;  4CDI A;  3G6E S;  3Q8V A;  3DXS X;  3J7Z T;  3I31 A;  4ED6 A;  3J7Z 5;  3IO1 A;  2Y3Y A;  4ECU A;  2B3T B;  2VFT A;  4NLP A;  3KHH A;  1S6O A;  4NCB A;  2V4Q A;  2LU1 A;  4RNM A;  4ECQ A;  4P10 A;  3GE9 A;  2V2K A;  1YJR A;  3SSR A;  3NS7 B;  4ZVF A;  1RHQ B;  2KJV A;  4M8L A;  3K2Y A;  2QG9 B;  2JX2 A;  2MQN A;  4FS1 A;  4I1T A;  3E3X A;  4DMZ A;  3GPA A;  2R7O A;  2RT3 A;  5IM0 B;  4JV2 A;  2IVM A;  4EMD A;  2Q6C A;  2XM3 A;  3OHB A;  2RDJ A;  3DLK A;  2BE2 A;  4PYA A;  2NR0 A;  2DT9 A;  4B3T F;  5KFT A;  3PFO A;  4CLS A;  3CT9 A;  4LRF A;  4Q0B A;  4BWM A;  2WTF A;  2HBY B;  2IC3 B;  1FD2 A;  5DO2 A;  4C3L A;  3MM6 B;  4NL5 A;  1R7I A;  1TMM A;  1L3S A;  5K14 A;  1EP4 A;  1WDT A;  1RWP B;  2E5I A;  4X4P A;  2F40 A;  3HSD A;  4ZKA A;  2RJZ A;  4LIR A;  1H2U X;  2XQC A;  4NLU A;  4NCG A;  4ILL A;  1ZZF A;  1HYS B;  2ABY A;  2Y8W A;  4IG3 A;  5B0A A;  2E29 A;  4DL4 A;  2DPJ A;  4HLB A;  4ED0 A;  2RHS B;  1S1T A;  3H2L A;  1KTQ A;  4GRS A;  5A8W A;  1XN9 A;  4O3N A;  1KOO A;  4WYW A;  1MWY A;  2POK A;  2HIY A;  3D54 A;  1JLG A;  2ZZN A;  2HFZ A;  1TKX B;  2VQE F;  5KFM A;  2CQH A;  2UXB J;  4KFB B;  1VRU A;  3IAS 9;  5HK4 A;  1WHV A;  3SI8 A;  4FDF A;  1XIQ A;  4DFM A;  2BE9 B;  3MR3 A;  2VDI A;  3DLG B;  4RBU A;  4ECT A;  2UUA F;  1REG X;  1EB0 A;  4U8V A;  3OTO J;  3T1A A;  1K0V A;  5E3A A;  1NKC A;  4KSE B;  3LO3 A;  3SEO A;  3V5R A;  5HBM B;  1TL1 A;  2HHP A;  2DBB A;  2FC8 A;  3LPE A;  5KFS A;  1WEX A;  1SBR A;  2UXC J;  2IJR A;  4OI2 A;  4ZMM A;  3EX7 B;  1FVQ A;  3H90 A;  1TEL A;  3EGN A;  4QPX A;  2ZH8 A;  4ENO A;  2E9T A;  4J5O A;  4ES3 A;  1YJ9 S;  1HBN A;  4WXW A;  1NO8 A;  5D4L A;  4TY9 A;  2K7K A;  1DLO A;  2O1P A;  3OUY B;  2DNL A;  4DL2 A;  3Q8U A;  3HHL A;  1JLC A;  2BZ2 A;  3AJ1 A;  3MF5 A;  1E6V A;  3LAN A;  1OS5 A;  4XO0 A;  4O3P A;  4XPC A;  2QT7 A;  3KLH B;  2DGQ A;  2ZBC A;  3KLF A;  1NPR A;  1VCT A;  3ENV A;  2OML A;  3FJ2 A;  1WHW A;  5HAN A;  2R2S A;  2CWX A;  3UCU P;  1YX2 A;  1OPZ A;  4O4G A;  4DU7 A;  2W7O A;  1UVK A;  4X4S A;  2KT5 A;  4ZCM A;  1S5Z A;  4M94 A;  4FYD A;  3PDN A;  1GMU A;  3L95 X;  1RHM B;  4IOC Q;  2Z0G A;  1MMN A;  3AQP A;  2HZV A;  4F4A A;  2H9Z A;  4UOG A;  1OYE A;  2BXJ A;  4EO8 A;  1HBU B;  1NK6 A;  3KMS A;  2HVD A;  3M2R A;  2O01 C;  5CD4 H;  4F02 A;  1NEE A;  2BKP A;  4MKY A;  2RF2 B;  4USK A;  3CJT A;  2ZE2 A;  3FVY A;  3SQG B;  1RTD B;  3W64 A;  3D3B J;  3DDN A;  2DHA A;  1VQN S;  2E5H A;  1UW9 A;  5DDP C;  5J2Q A;  4O3O A;  3C15 A;  4ZCK A;  2OSR A;  3BQ0 A;  4NMX A;  3FBC A;  3R5A A;  4X84 A;  1UFK A;  2MEW A;  3CJQ A;  3AT1 B;  1SJR A;  3SXL A;  5KFL A;  2EKY A;  3UN2 A;  2B5J A;  4U96 A;  1U8S A;  2OUG A;  1S12 A;  3AXM A;  3VGS A;  1JLA A;  1RYS A;  3BO4 A;  2ZIT A;  2VKR A;  3QJJ A;  1WDD A;  3NBP B;  5F8M A;  3K17 A;  3H5X A;  3DGP A;  3ITH A;  2N4D A;  4YOE A;  3MUV P;  1Q5V A;  2OIH A;  2BAN B;  1SC6 A;  1MNE A;  5EDW A;  4WP8 A;  3D4J A;  4CH7 A;  1H3D A;  3HPO A;  1C2P A;  2WVC A;  3WIV A;  3HI9 A;  4HEA 9;  2NSB A;  1IKX A;  4C48 A;  1O5J A;  4YHH F;  3QGG A;  1MN7 A;  2VON A;  3V4I B;  2F8H A;  2XMT A;  4J9L A;  2HZC A;  4UTG A;  5GVQ A;  2VG5 A;  3RYL A;  2VHG A;  3MM7 A;  3HHK A;  1IKY A;  2W7A A;  3HF5 A;  1VQP S;  4LF7 J;  4OLP A;  1LW0 B;  2WSF C;  3QBC A;  3DOM A;  5IT9 Y;  1SVD A;  5G0R B;  4WFA Q;  2DNZ A;  3M2U B;  4B08 A;  1IBL F;  3RW7 A;  1WOS A;  1VBZ A;  2JEG A;  2ALY B;  1RAI B;  2HRU A;  4TYB A;  4LRD A;  1HHT P;  4M5H A;  1I51 B;  2WVB A;  4ERD A;  3LH2 S;  4DL5 A;  1Q16 B;  3UD3 P;  2HHV A;  2MLZ A;  4GO5 X;  5LSO A;  1YK9 A;  4M5M A;  3T1Y J;  4ZDN A;  4A8M P;  3R7N B;  5I42 B;  4NZ0 A;  3M6W A;  2VF3 A;  1UVL A;  2XGQ A;  3BKT A;  2FIU A;  1RI7 A;  4YY3 J;  3S8S A;  2Z56 B;  2W9C A;  1NDK A;  1N48 A;  3ZXW A;  4EGL A;  2HG4 A;  3GJR B;  3OVB A;  5J1P A;  4JI5 J;  3UD4 P;  3QID A;  4UUW A;  3MMB A;  4P2M A;  3HFK A;  1C0T A;  3WC0 A;  2FJW A;  3GJT B;  4O3S A;  2MJN A;  2E7W A;  1AXQ A;  1KRP A;  3PTW A;  1Q0N A;  1Y00 A;  2BM1 A;  5BJR A;  1VRT B;  2J5A A;  3I32 A;  1F5B A;  3FSX A;  3AD8 C;  1WTF A;  4V1A k;  2G1H A;  2XZW A;  5DG9 A;  5JJB A;  2GHW A;  2GS8 A;  3HJV A;  3GIL A;  2G2Y A;  1S6P B;  2AGP A;  4F36 A;  1KQG B;  4KKO A;  3OR2 A;  3PYD A;  2B6A A;  2VIH A;  1FDB A;  1KD1 T;  4LBI A;  4Z7C A;  2CJX B;  3A1Y G;  2G1D A;  1HMV B;  4AQY F;  2OJ3 A;  2PDA A;  4I68 A;  4FXW A;  4J9Q A;  4MKA A;  1DAX A;  1DAR A;  2J9E A;  3IR6 B;  3SQO P;  3BRE A;  1VIS A;  1URN A;  3IGN A;  1UVI A;  4DUY F;  3G2X A;  2AQ4 A;  4LSL B;  2VQF F;  3G8Q A;  2LA6 A;  2ATL A;  1IBK F;  4NZ7 A;  4MK9 A;  2KFN A;  3IS9 A;  3IFE A;  1P27 B;  3JYT A;  3LP1 B;  3UCG A;  2KHC A;  2KYZ A;  2WON A;  1XK8 A;  3O44 A;  1E6Y B;  2IMO A;  3MPY A;  2HGN A;  5IXU A;  5K8M A;  2XMK A;  2DCU B;  1J27 A;  2KG1 A;  2MGZ A;  1IBM F;  4WXO A;  1R43 A;  3CJR A;  1RAC B;  5J1N A;  5KFJ A;  2OSQ A;  1D0E A;  3ULH A;  3G71 S;  1G1X A;  3UN3 A;  5LM7 E;  3IR7 B;  1IJE B;  2GQ2 A;  3MED B;  3GJS B;  1RAF B;  5CCL A;  4LIW A;  2UP1 A;  1CLF A;  3DXB A;  1OPI A;  4TY8 A;  2FLP A;  2AJ2 A;  4C0B A;  4QR2 A;  1UWB A;  2HS4 A;  4AND A;  2MLX A;  3HX9 A;  1SC3 B;  3H98 A;  5A0Y A;  1RT5 A;  4KB7 A;  1Q4R A;  3I0S B;  1JIH A;  1U1O A;  1S7H A;  2DO4 A;  4ZPB A;  3AOA A;  2HHH F;  1ELO A;  4LFC F;  2IDE A;  3TW0 A;  2HNY A;  1WKL A;  5HVG A;  2M8D B;  4DV4 F;  5EWG A;  2C28 A;  2E1C A;  1CUL A;  4DU8 A;  1J5O B;  3D0I E;  4TXS A;  4LFB J;  4F4Y A;  2EC0 A;  3MM8 A;  1A7G E;  3POT B;  3IR5 B;  3OQ2 A;  2C2E A;  1WC6 A;  1NKB A;  3NAI A;  3D6H B;  5C42 A;  1TUW A;  5IWA J;  4RUB A;  4IO9 Q;  2MKK A;  2JLF A;  3VV2 B;  4EZ6 A;  1R8A A;  3EWG A;  3SV4 A;  1RCX B;  5KG6 A;  2ALZ A;  1ZM2 A;  1ZA1 B;  3L3C A;  4DR5 F;  4P52 A;  3I5B A;  4UZB A;  4BBY A;  3UR0 A;  3QFH A;  1XNQ J;  3NL0 A;  1SL1 A;  4ATN A;  3W2V A;  3TVK A;  2H1Y A;  1PJ5 A;  1NND A;  2BQU A;  3ELH A;  4X62 F;  2RH3 A;  1VIX A;  4ZVU B;  4LF4 J;  2IRU A;  1H73 A;  4WKR A;  1SKS A;  5AJ3 F;  2B8Q A;  4URS A;  3AH6 A;  3CME S;  3GYX B;  4DR4 J;  2EXU A;  3RAX A;  3EXY A;  5A8K A;  4DV2 J;  2KXH A;  5JUM A;  2XMU A;  1T02 A;  3ZZO A;  5ETL A;  3NY0 A;  1SKR A;  1XMB A;  2MKY A;  5KFP A;  4P71 A;  2Y0S D;  3ICL A;  1M0S A;  4MIW A;  1VQ6 S;  4KO0 A;  4P74 A;  2V4R A;  2DHX A;  1RT3 A;  5KTQ A;  1Y9O A;  4NE9 C;  4ECX A;  3DHX A;  5KFA A;  2R2U A;  3M9M B;  2JVO A;  1S9E B;  2WW8 A;  4X4N A;  4DLG A;  3T6J A;  4X66 F;  2F3J A;  3QIP B;  4EO6 A;  1FXL A;  1UPM B;  3GON A;  3CCQ S;  3NS5 A;  3F56 A;  5KG4 A;  2XMA A;  2R7X A;  2B7B B;  1V3S A;  4ZOS A;  3OL6 A;  4Z2X A;  3BKF A;  2GQQ A;  2YNH A;  5J2M B;  3MAA A;  2AP6 A;  4O23 A;  1SQG A;  2FD2 A;  1Z4U A;  2AWZ A;  4U95 A;  1B99 A;  3KK2 A;  3CDB A;  2IBO A;  4RW4 A;  3SFU A;  4E2F B;  1UMJ A;  4B17 A;  2HS0 A;  2HWI A;  4NLV A;  4IG0 A;  2XNR A;  2YXL A;  2FZK B;  4FF4 A;  3IBC B;  4I0W A;  4ZVT B;  3IA0 A;  2XY6 A;  1CJK A;  2JLG A;  4FS2 A;  2ZEJ A;  2CPI A;  3GSD A;  1F0X A;  2GCF A;  4LSZ B;  3TUP A;  2FJA B;  3OL7 A;  4FBT A;  3R9L A;  5KFU A;  5F0W A;  3DGV A;  1GNK A;  2Q66 A;  3VZH A;  3QPI A;  4Y2C A;  4P72 A;  4AYB D;  2IMW P;  5C24 B;  1ZAX A;  3JQJ A;  2CZ9 A;  3GSI A;  1G4C A;  1G3O A;  3SDE B;  3THV A;  2CNO B;  3K5O A;  5HQ8 A;  4GKJ J;  5B0G A;  3K8V A;  4C0H A;  2CPH A;  5DM6 Q;  3BH7 B;  2ZBQ A;  5LXY A;  3DDK A;  4DQS A;  2RAQ A;  4FF3 A;  4EBD A;  1YBT A;  5A76 A;  4K59 A;  4JI1 F;  2Y8Y A;  1TL3 A;  3NNC A;  3MTK A;  4ED8 A;  3PW2 A;  2A18 A;  2UVV A;  3CJS A;  3BGF A;  1VHI A;  1HBO B;  3NLC A;  5RUB A;  4KHP J;  3DRY A;  2DCL A;  3A3O B;  3OD2 A;  2RIJ A;  3MGJ A;  1KC8 T;  4DPT A;  4RW8 B;  2LYV A;  4C0O C;  2RKI A;  2VV5 A;  4KTQ A;  3NGR A;  4M5L A;  5KFO A;  3LOU A;  2G4B A;  1FJG J;  2J6T A;  3GIK A;  2K8G A;  5KFV A;  2P5V A;  5DDO C;  1TL7 B;  3I56 S;  2UXD J;  3MPU B;  4CYU A;  3KUG A;  1YG0 A;  2WSE C;  3TVY A;  4RW9 A;  1FT8 A;  1RHR B;  1Y10 A;  1Q5Y A;  4DR2 J;  5L9X A;  4MH8 A;  1TV6 B;  1VC0 A;  3GIM A;  2EG2 A;  2KZM A;  2OPS B;  4LR9 A;  3NNA A;  2BJ9 A;  4ZPD A;  2ASL A;  5ETK A;  3OPK A;  2IRX A;  3KG1 A;  2J7U A;  3KLG A;  5F8J A;  1PC5 A;  4QPT A;  4PWW A;  3QJP A;  2ZVI A;  2RNE A;  1HPZ A;  4DFJ A;  3T9N A;  4URG A;  3K8W A;  1QAI A;  2MKH A;  1NDC A;  3OTO F;  3KG0 A;  4CTA B;  1PGZ A;  1MU2 B;  2HUR A;  1XMQ J;  3BPD A;  4NWB A;  1DQA A;  3M7V A;  3MI7 X;  2CDQ A;  4DF8 A;  3L09 A;  1KLN A;  2BW7 A;  3MUM P;  1YVF A;  1HNW J;  3LAM A;  1QUV A;  1NSA A;  4TQR A;  5HQM A;  3RBD A;  5HN0 A;  2JFK A;  2DNR A;  2QSW A;  4CT9 A;  1U25 A;  1RWO B;  1FNO A;  4KE5 A;  3FBE A;  1W2B R;  4OYP A;  1UEK A;  2RRB A;  3RRK A;  3CCM S;  1AA1 B;  3MCS A;  2V6A A;  4ZVP B;  5E3C A;  1K9M T;  1TU0 B;  4OHW A;  1JJC B;  4L75 A;  4X4V A;  4DL0 C;  3FQK A;  2VC1 A;  2WSC C;  3PEJ A;  3ZZR A;  1WOR A;  3L7P A;  1UZD A;  4TU7 A;  1C1B A;  2O5D A;  1PYT A;  4PG4 A;  3RGI A;  3EDR B;  2IA6 A;  3GJQ B;  3MUT P;  5G4D A;  3DM2 A;  1S57 A;  5KOX A;  5LL6 d;  4LRB A;  1SH0 A;  3C14 A;  1RHJ B;  4DX5 A;  1NHV A;  3V6D A;  1TTH B;  2OPR B;  4DV7 J;  1HHQ A;  2VG6 B;  4Q44 A;  2GVD A;  1HWK A;  3VAJ A;  3NWG A;  5DRK A;  1GTH A;  4J7C A;  3F44 A;  5KFD A;  4X65 F;  5J2N A;  3TZY A;  3MMC B;  4B9S A;  2ZHB A;  1TK0 A;  3DRS A;  5D0H A;  3HJF A;  3ET6 B;  1KOH A;  3MAQ A;  3A8K A;  3DRP B;  1RK8 A;  3RR7 A;  4DEZ A;  2EFO A;  2C2Z B;  4DV3 F;  3BPS P;  1MWZ A;  5J2P A;  1S1W B;  3IWL A;  4MFB A;  3EVO A;  2CQ2 A;  3ISN C;  2DGV A;  5KFB A;  4ZVH A;  4TLQ A;  2LQ9 A;  3PV8 A;  4B9L A;  1FDA A;  1IR2 A;  2DGO A;  3W9I A;  2RS8 A;  4J9V A;  3S1T A;  4HL9 A;  1YRU A;  5B0D A;  3ZFV A;  2B51 A;  2MKI A;  2BJ1 A;  3R1H A;  2O66 A;  1PCA A;  4P2X A;  3GWC A;  3EJM A;  3T9Z A;  4DQR A;  4Q43 A;  4DX6 A;  4JI0 F;  4DCO B;  4MIA A;  4FVM A;  2L3M A;  3PG9 A;  3LP2 B;  3KG4 A;  2VC0 A;  4C3M A;  2LDI A;  3U27 A;  8AT1 B;  2UZA A;  2QA4 G;  2X51 A;  3T1H F;  3R6G B;  2DNQ A;  1ZET A;  1WEZ A;  4ALZ A;  2NPI A;  2XHC A;  2XMM A;  2EK6 A;  2W7P A;  3M9N B;  7AT1 B;  2R4F A;  4IFV B;  2OLW A;  3D1O A;  5HRO A;  1RA7 A;  1CJV A;  1CC7 A;  4MIB A;  2QV6 A;  4OYW A;  1VOM A;  2NYI A;  3OJS A;  1SC1 B;  1L5U A;  5E2Q A;  2XMW A;  1D8Z A;  4DFP A;  3HFZ B;  3PAC A;  3UVJ B;  2MJU A;  3K0J A;  1TVR B;  2I2Y A;  2HNZ B;  5BR8 F;  1RTJ B;  4KHM A;  4ID5 B;  4GKK F;  3VAI A;  2HYI B;  3RBE A;  2PSZ A;  1XQI A;  2E5L J;  1M5O C;  4ZPC A;  4RKU C;  2C2R A;  2Q1L A;  4H4O B;  3WX4 A;  1NAQ A;  2AYM A;  2L48 A;  5HP1 B;  4QR0 A;  4LF2 A;  1N34 F;  1GMW A;  1FWP A;  4ECY A;  2BQR A;  2MYF A;  1F2G A;  2OGU A;  5AXN A;  2J6U A;  4CQ1 A;  1A0O B;  4QIE A;  4EUV A;  3D0H E;  1D8Y A;  3MTJ A;  5A8R B;  5KT5 A;  2VIC A;  5DS7 A;  3JQK A;  2HSE B;  1X4E A;  1ZTW A;  5B7W A;  2RQ4 A;  4B9U A;  4XIU A;  2ZH9 A;  5HSP A;  4YY3 F;  2M52 A;  2HVH A;  3IBF B;  1Y5N B;  4NLX A;  2F8E X;  2GGP A;  3AA9 A;  3X1L B;  3B6B A;  4M5K A;  4ZP7 A;  4OV1 A;  3TVZ A;  4OI4 A;  4YR0 A;  2YPY A;  3I87 A;  2BYC A;  1B4S A;  3CJ4 A;  4DQP A;  2AX0 A;  2DH7 A;  3HXM A;  3HZE A;  4G1Q B;  4NLO A;  5K9F A;  2PC6 A;  1FEH A;  4Y2A A;  5M2U A;  2E1R A;  2LCW A;  1T9W A;  5IT4 A;  4JI5 F;  3HT3 A;  1VBK A;  1X4C A;  2W8K A;  3PO4 A;  1EZZ B;  5D0E A;  4G1P A;  2HEK A;  1YJN S;  1QAY A;  4NYZ A;  4ZCI A;  2ATC B;  1N32 J;  1UWA A;  2B43 A;  4CLL A;  3RB3 A;  2V2Q A;  2CA9 A;  1UKU A;  2CG4 A;  2FUG 9;  2DGU A;  3CC2 S;  3KDO A;  1JXL A;  2U1A A;  4JI7 F;  4R8U A;  1K0T A;  2YBV A;  2C2D A;  2F4V J;  1SL2 A;  3N6N A;  2IJF A;  3KLI B;  2QRR A;  3C16 B;  5GAG U;  2BV3 A;  1DY3 A;  2DVI A;  2FYX A;  2HS3 A;  3D1H A;  4F04 B;  4QWC A;  4CCH A;  2GO9 A;  2JVR A;  3IG1 B;  1F5C A;  1VJQ A;  4F2R A;  1LWE A;  5A2Q U;  4JI8 J;  2CQ4 A;  1P9Q C;  2M3D A;  5K8N A;  1TKT A;  4CZC A;  3GFY A;  2CPZ A;  1ZAW A;  3OXL A;  3BQ2 A;  1OSD A;  5DET A;  4PPZ A;  3DHW C;  1NH8 A;  2V69 A;  1O0P A;  4B9T A;  4DOZ A;  4KV8 A;  4HH0 A;  4OYZ A;  3B4M A;  1HNZ F;  2UV8 G;  1S1U B;  1X5T A;  2PT0 A;  3W65 A;  4C6A A;  5I3U A;  4DPO A;  3QNW B;  2U2F A;  3MPD A;  2N3L A;  3CC7 S;  1NKE A;  2MY8 A;  2HKE A;  4B3O B;  2DHS A;  4WII A;  1CQN A;  2WB1 D;  3FRY A;  3D66 A;  4K4T A;  1YZ7 A;  2DK2 A;  1QE1 B;  4YEA A;  1S6Q A;  2ZM6 J;  1WHY A;  2DNY A;  1N5Y A;  1RWV B;  4P9S A;  2MHE A;  2C1E B;  2RUS A;  3DNC A;  4DN9 A;  2M8H A;  3LAL A;  1XMO J;  3ZNJ 1;  1TFW A;  4AD6 A;  1W7W A;  4WFY A;  4RWX A;  5KG1 A;  1I94 F;  2JSX A;  4GVB B;  3FEX B;  4AT1 B;  2F7V A;  1FFS B;  1R6V A;  1FE4 A;  5KG7 A;  1N56 A;  3K5L A;  3BF4 A;  2D3O 1;  2XZT B;  2GAG C;  3J7A N;  4FNH A;  3C2P A;  4DS5 A;  4J9K A;  5DQH A;  1OQ3 A;  1FD8 A;  1C0U A;  4CO5 A;  2CQI A;  4OQJ A;  3ZZ0 A;  2DB1 A;  1QJH A;  1QSY A;  1Q8B A;  4LRA A;  5EX0 A;  4N41 A;  1GH8 A;  4ZIT A;  3LP0 A;  4IUF A;  3AJD A;  2D41 A;  3CJ2 A;  2J0Q D;  2VFS A;  1Y3J A;  1U48 A;  3MEE A;  2VFU A;  1UVJ A;  4QW9 A;  4F67 A;  2Y9H A;  1TKZ B;  3EE3 A;  4N76 A;  3ILJ A;  2R9L A;  1DBD A;  2AF6 A;  3UE2 A;  3VAG A;  3LGH A;  3AXK A;  3THT A;  1J5E J;  1H74 A;  2CDR B;  2D69 A;  1U24 A;  4PWD B;  2VDH A;  4OI6 A;  3A12 A;  2ZH6 A;  3PJW A;  3PO5 A;  4FF1 A;  2DRA A;  4QYR A;  2IIH A;  1Q86 T;  4NX9 A;  2XY5 A;  3ETO A;  4PCQ A;  5ETQ A;  2E7X A;  3QZ8 A;  2LVW A;  1T11 A;  1NH7 A;  3NNH A;  2R7R A;  3I55 S;  2B4U A;  1N33 J;  3TJA A;  1AZS A;  2WZ1 A;  1TK5 A;  1WEY A;  1RU1 A;  2XY7 A;  4YB6 A;  1BLU A;  1EAR A;  4DR4 F;  2NXC A;  2V4J B;  1JXV A;  3FSI A;  1C1C B;  2QYC A;  3P8B B;  5D4P A;  2V8V A;  4DV2 F;  3TAM B;  4BWJ A;  2XSJ A;  3OFF A;  3DKD A;  5K14 B;  2M88 A;  3HHD A;  2HFN A;  2YNF B;  3H4D A;  5MAO A;  4LBP A;  2M70 A;  3MMA A;  1VFJ A;  3EPI A;  2XWY A;  3AD9 C;  5T7L A;  4ZJO A;  5DDQ C;  3K59 A;  5CXT A;  2LMI A;  2CQC A;  3D6T B;  1MMD A;  2C2K B;  4K50 A;  2YWH A;  1OMS A;  1YGY A;  4WF9 Q;  2R2R A;  5KFX A;  2WB4 A;  3DDI A;  1RTZ A;  2MY7 A;  4DV0 F;  4C8M A;  1NXI A;  1JKH B;  3VGV A;  1N6Q B;  2XMV A;  4DJB A;  1XNR J;  1N88 A;  1P1T A;  1X4D A;  1YI2 S;  2CNN B;  4ZK7 M;  4FYV B;  4CM0 A;  1M5S A;  2H4Y B;  1QTN B;  3M8Q B;  1T9Y A;  1IKV B;  2MQL A;  2FZG B;  1SL0 A;  3PFE A;  3TUJ C;  3D6F B;  1BHN A;  2GQC A;  2DY9 A;  2SXL A;  1X9M A;  2J0W A;  3D2W A;  4C11 A;  2R7U A;  3MM5 B;  2R7Q A;  4OIX A;  2N3O A;  1CJU B;  4Y3C A;  4P6Q A;  2YKA A;  1U2R A;  3QJL A;  1IM4 A;  4L3K A;  2ACY A;  2F5G A;  4USW A;  3CCS S;  3K5M A;  3EUN A;  3NMR A;  1HKA A;  4P75 A;  1JJ2 R;  5D8H B;  2CUY A;  2HPU A;  4WP9 A;  3IM8 A;  2XS2 A;  1N4L A;  2RQM A;  4NYP A;  2JOQ A;  3CMA S;  3KKF A;  1KHV A;  1YSJ A;  1FA0 A;  1S6U A;  5DQI A;  4C8L A;  1J2V A;  4K5S A;  4IQX A;  2J7W A;  2Z4P A;  2IC3 A;  4DV1 J;  3MM6 A;  4K7Q A;  1BWV A;  2R8G A;  4JI3 J;  4MYT A;  4DPU A;  3HHL B;  2B4V A;  2EK1 A;  1JLC B;  1RAO A;  2BBE A;  1E6V B;  2RDD A;  2J9D E;  5H9E K;  1U0H B;  1XR7 A;  1AUD A;  3UDC A;  3JAM U;  4GKJ F;  3AY0 A;  4C8Z A;  2IM1 A;  1FEE A;  3GU0 A;  4F0H A;  1HYS A;  3KLF B;  1Q8K A;  4EK2 A;  2GHV C;  4DR1 F;  3LWM A;  1OJ4 A;  1IR1 A;  2JJ4 D;  4Y0F A;  4C2M A;  1YKW A;  1HQE B;  4UOH A;  2E7V A;  4J90 A;  4JV5 F;  3D0G E;  4NLY A;  4ECW A;  1YJ7 A;  2V2V A;  5FLX Y;  3R3T A;  1JLE B;  3FCW A;  4W4M A;  1WI6 A;  1TKX A;  2K2P A;  4NLQ A;  3M2R B;  2I1R A;  3FUY A;  2KM8 C;  5F9N A;  3Q2S C;  4KFB A;  2HFU A;  3HFV A;  3TYT A;  4OX9 J;  2P6T A;  4AL6 A;  1DTT B;  3ILI A;  3DLG A;  3KMQ A;  2OPQ B;  3G82 B;  1SKW A;  4NI2 A;  3KDN A;  3VAM A;  4L72 B;  1YDL A;  4DCP B;  2HFV A;  1WC4 A;  2HQI A;  1UJ4 A;  4MAK A;  3GV8 B;  3RBX A;  4KHR A;  4EYI B;  2PII A;  2WW4 A;  2YQ1 A;  1D9F A;  2UVW A;  1QVG R;  4LF8 J;  1WG1 A;  3OUY A;  3QT7 A;  1RQ0 A;  1RHU B;  4DFK A;  3KK3 B;  3CDW A;  4X4T A;  4B3M J;  5LT5 A;  5IT0 A;  3NGD A;  3MR2 A;  3NRB A;  2PGC A;  1S1X B;  3QQC D;  5SUH A;  3KLH A;  3NAH A;  3WIU A;  3EMT A;  1RA6 A;  1XMQ F;  4PEO A;  4FYY B;  2GFF A;  1D9A A;  5L39 A;  4LF6 J;  1JLQ B;  2ZZT A;  4IRK A;  4ELV A;  4AUK A;  1HNW F;  3VWS A;  1GXU A;  2NQP A;  1JK9 B;  1NJX A;  2M9K A;  3W61 A;  1RBA A;  3PR5 B;  3OL8 A;  1XWL A;  1VBX A;  2Y1I A;  1VQY A;  2AV5 A;  2OFH X;  2QA4 S;  3QSI A;  3LTO A;  3GCW P;  1U47 A;  2Z30 B;  2LEB A;  2WOM B;  4U7U D;  1EKR A;  1IKY B;  3UO0 A;  5B0C A;  4Y6I A;  4OZ5 A;  3DN9 A;  2FVP A;  2NSC A;  2RF2 A;  3ADA C;  1SKU B;  2HQG A;  4ICL A;  2APO A;  4I6W A;  1W2I A;  5F8I A;  2GML A;  3ENW A;  1RTD A;  2V8D A;  2DNK A;  3V81 B;  5GAH I;  2N7C A;  3SSQ A;  1HR0 F;  2PN6 A;  3NKY A;  4CWB A;  2AYG A;  1NHU A;  5DGB A;  1KLM B;  1WG5 A;  2HIQ A;  1RAG B;  2LQB A;  3CCE S;  3CO9 A;  3ZC4 A;  2RS2 A;  4IFY B;  3FEY B;  4FBU A;  1WKK A;  4KGV B;  1FDD A;  4ZPA A;  2DGW A;  2ZDP A;  2EFV A;  4K4V A;  1NRK A;  2VD3 A;  1VLO A;  3M8S A;  2FHO B;  1Q8L A;  1KWM A;  4MMO A;  5GME A;  3G8S A;  4USH A;  4OMF G;  1ZZN A;  1RP5 A;  4QYZ K;  5ETO A;  1ZM3 A;  4PPD A;  1Q8I A;  2ZUG A;  1U1L A;  3P5B P;  4WE1 B;  3MOJ B;  3NBP A;  2ZOG A;  3HP6 A;  2ZBR A;  4OLO A;  4OI1 A;  4WTO B;  1S7I A;  2BAN A;  5CA5 A;  2JRS A;  2IBK A;  4DDF A;  4DZ6 A;  4Y28 C;  1VK8 A;  1C0T B;  1UTA A;  1JXE A;  2CPJ A;  4TKT A;  2R7T A;  3QRQ A;  4DSJ A;  3CCJ S;  1FRK A;  4ZPT R;  1X5O A;  2X1A A;  3V4I A;  4NEY A;  3M30 B;  2LQ8 A;  4IH6 A;  3OTB A;  3NGU A;  3KK1 B;  4N47 A;  1K73 T;  3BR8 A;  1LW0 A;  3TUI C;  1LWF B;  2M4M A;  3OR2 B;  2GVZ B;  4K4X A;  4B9N A;  1O51 A;  5G0R A;  2VOP A;  3RB0 A;  3OFH A;  1KR4 A;  3M2U A;  4CNZ A;  3DFE A;  2JHE A;  2MPU A;  3G6V A;  2KHD A;  4OZ3 A;  3OL9 A;  3O2I A;  2VA3 A;  2IYI A;  5GAE I;  3U7J A;  2B4P A;  1QD1 A;  1M1K T;  2V0N A;  1RHK B;  2CNL B;  2ZZM A;  3UNY A;  2G2O A;  3KJQ B;  3QLH B;  3MR5 A;  1D9D A;  2KG0 A;  1VHF A;  4DUT A;  4B9M A;  3GFH A;  5I42 A;  3C6U B;  4V19 X;  3DRX A;  3QAU A;  4U6P A;  5KG5 A;  3PRV A;  2KDO A;  2WON B;  1KVI A;  4KH1 B;  5T14 A;  2W4C A;  4ECZ A;  1YRT A;  2YKP A;  1H7X A;  3HT0 A;  2RDI A;  1GT8 A;  5M2R A;  2DKO B;  2JEJ A;  4UOC A;  2KRB A;  1QVF R;  2E5G A;  4I6Y A;  2ZFH A;  4Y2I A;  2YX1 A;  1ULR A;  1OY6 A;  4H4K A;  4ITS A;  2NUH A;  5I3Q A;  2QLF B;  3NGT A;  1BC6 A;  2V68 A;  5HL7 Q;  1AW0 A;  5CAA A;  4PXE A;  3HSJ A;  2EWH A;  2W2Q P;  3EGV A;  5GMD A;  3NCQ A;  4B3R J;  1VRT A;  1UWB B;  3CD7 A;  3W3S A;  1WJ9 A;  3I6P A;  1FTC A;  3R5J B;  2W9A A;  2B9Y A;  2F9J A;  1HW9 A;  5GAD I;  1S6P A;  3PW5 A;  2KO1 A;  2IM2 A;  1CBK A;  2C2O B;  2EPI A;  2CG8 A;  4J37 A;  2YH1 A;  2V8H A;  3PR4 A;  2YNI B;  2AJF E;  5D4O A;  2DGS A;  3NG8 A;  1HMV A;  3DI6 B;  3GZ7 A;  1UPP A;  4EBC A;  2V34 A;  3MM8 B;  5C7P A;  1B70 B;  1K47 A;  4UST A;  2DR9 A;  4UQG A;  4LSL A;  5J1E B;  5C42 B;  3BR9 A;  2I6W A;  2OFG X;  3I4P A;  1SJ3 P;  3MEC B;  3IRX B;  4X4O A;  4EEY A;  1U6F A;  1DRZ A;  3KLE B;  3GYN A;  1NDP A;  4S0M A;  4CLY A;  4QWD A;  1X9W A;  4KIA A;  1YJV A;  3CCV S;  5F3Z A;  1E6Y A;  4JI8 F;  4I6A A;  2VPX B;  4JI2 J;  2ZH2 A;  3L9Z A;  3PHT A;  1FER A;  1NUE A;  3BO2 A;  4XDD A;  3N9U C;  3EVM A;  1VRQ C;  2FVQ A;  3MED A;  2YX7 A;  1FNX H;  4OX7 A;  1R8H A;  2BKO A;  8ATC B;  3MXH P;  1RWM B;  4W98 A;  3H25 A;  2AW0 A;  2K3K A;  2HWH A;  1MML A;  4P7V A;  5JVG Q;  3FFI B;  4JOU A;  2N82 B;  2FJX A;  4OI0 A;  1SQF A;  1IWA A;  2G0C A;  2W2P P;  3EXC X;  2MXY A;  4ETX A;  1RT3 B;  3BS9 A;  3D1Q A;  3I0S A;  1G2E A;  3FSY A;  4TN2 A;  3FGV A;  4C8K A;  2YWF A;  3CED A;  3J81 Y;  2XWX A;  2CPY A;  3QO9 B;  1NM2 A;  4N8O A;  5E33 A;  4YFU A;  1XMO F;  4KAI A;  2FZC B;  3V6J A;  1HNX J;  3ENQ A;  3POT A;  4RW7 B;  5HMW A;  2FHJ A;  1GXT A;  3MAA B;  5ETN A;  3FCH A;  2I8E A;  2W4P A;  2P8I A;  1S48 A;  1ITP A;  3EZ5 A;  3RB4 A;  5AE2 A;  4RW4 B;  3EPG A;  2CQD A;  3TA1 A;  2VBX A;  3M32 A;  3ZZZ A;  1LW2 B;  3DYA B;  1SUQ B;  4PUO A;  2HMI B;  3L7O A;  2WBM A;  2QX0 A;  1S72 S;  2R8I A;  1FJE B;  2PA3 A;  4IG0 B;  3I0R B;  3U1N A;  4NA2 A;  1I6J A;  5LSR A;  4WZM A;  4MTP A;  2XI2 A;  2XS5 A;  3GR1 A;  4CM2 A;  4F0K A;  4B3T J;  5AXK A;  3KUH A;  1FF2 A;  2M5Y A;  3DLL Q;  2YVS A;  4ZVR B;  3KTQ A;  4HHU A;  3JXO A;  1EQM A;  1Y0H A;  3W62 A;  1J5E F;  2PMW A;  3TAP A;  1VQO S;  2KYX A;  2ZH1 A;  2PEH A;  4CO3 A;  4U67 Q;  5K5M A;  3A3N B;  2CQ0 A;  9ATC B;  2ZVS A;  1YLX A;  1VQ4 S;  3WX8 A;  2IA0 A;  5KG2 A;  1WF1 A;  5JMN A;  2Y0B B;  3VVT A;  5IC4 B;  1T94 A;  4C8Y A;  4LUB A;  4HAC B;  3J80 U;  1ZA2 B;  4Q8E A;  1VDH A;  3VAK A;  2PI5 A;  4RO0 A;  3H42 A;  3RG6 A;  3QFW A;  1CVJ A;  1S9E A;  1NHK L;  5H9F K;  3QYY A;  3AD7 C;  3BYR A;  1X4B A;  2HFO A;  1BQN B;  2DXE A;  1WOP A;  4LF5 J;  4L3N A;  2UVR A;  5I4M A;  3GMG A;  1HA1 A;  2HQ3 A;  1B64 A;  4CI0 B;  3GFZ A;  4F4X A;  1RT2 B;  2UUC J;  1KEK A;  2BJ3 A;  1U02 A;  3KFW X;  4O0I A;  3J7Y I;  2F1F A;  2XEX A;  2VQE J;  2MQQ A;  2ZHA A;  1RJJ A;  3HVT B;  1WAC A;  1DUR A;  3MEG B;  4K0K F;  3H2U B;  3TJ9 A;  2UUA J;  3KOA A;  2JWN A;  1T05 B;  1N52 B;  4CO1 A;  2F4F A;  3H8Y A;  3HM9 A;  5DZ7 A;  4ZVE A;  3E01 A;  1QLN A;  4A46 A;  3BEG B;  3J80 Y;  2CFX A;  3TEG A;  1PIE A;  4H4K C;  4F25 A;  3VF0 B;  4ZLL A;  3CNQ P;  1XC9 A;  2MTL A;  4DXL A;  4DPX A;  1U49 A;  3UN5 A;  2RUG A;  5C24 A;  2W25 A;  4UY8 5;  3GII A;  2ROP A;  1V9O A;  3KJN B;  3KLG B;  2BR0 A;  5KFR A;  2P2C B;  3SDE A;  1UL3 A;  3JSB A;  4EU0 A;  4Y34 A;  3A4T A;  3VQT A;  1PC4 A;  4FYX B;  4NLS A;  3O1L A;  2YQ0 A;  1RWN B; 
#chains in the Genus database with same CATH homology
 1BE4 A;  1NDC A;  2CWK A;  3VVU A;  5IOL A;  1NLK L;  3NGU A;  3Q83 A;  3EJM A;  1S5Z A;  3EE3 A;  4CP5 A;  3EMT A;  3Q8V A;  3VGS A;  3ZTQ A;  2VU5 A;  2DYA A;  3VGU A;  2HUR A;  3FCW A;  2B8P A;  3ENA A;  1K44 A;  1NCL A;  1UCN A;  1HIY A;  3NGR A;  2DXD A;  4ANE A;  4F4A A;  4UOF A;  4UOG A;  3VGT A;  1WKK A;  3GP9 A;  3FBB A;  1LWX A;  1HHQ A;  3BBC A;  3DDI A;  3PJ9 A;  1PKU A;  3NGT A;  3Q86 A;  1WKJ A;  3R9L A;  3Q89 A;  2HVD A;  1ZS6 A;  3BBB A;  3ETM A;  1NDP A;  4F36 A;  3VGV A;  4WBF A;  5CAA A;  4S0M A;  5CAB A;  4O0N A;  3ZTP A;  4ENO A;  3Q8Y A;  1BUX A;  1HLW A;  1F6T A;  2DXF A;  3BBF A;  3WX8 A;  3ZTS A;  3B54 A;  2AZ1 A;  1VYA A;  4KPC A;  5BXI A;  2BEF A;  1U8W A;  1W7W A;  3VVT A;  3FBE A;  4HR2 A;  1PAE X;  3Q8U A;  3ZTR A;  2BX6 A;  3FBF A;  1MN7 A;  3MPD A;  3BH6 B;  1NUE A;  1NSQ A;  4AND A;  3GPA A;  3BH7 B;  1LEO A;  3B6B A;  3ELH A;  1MN9 A;  3EM1 A;  3FC9 A;  2HVE A;  4FKX A;  1NSK L;  1KDN A;  1NHK L;  3EVM A;  2ZUA A;  1B4S A;  2NCK L;  1NDK A;  3G2X A;  1BHN A;  2DY9 A;  1B99 A;  1NSP A;  4EK2 A;  4FKY A;  3FCV A;  2B8Q A;  3EIC A;  4DUT A;  1NPK A;  4ANC A;  3EVO A;  1S59 A;  1JXV A;  4DZ6 A;  3EVW A;  3ZTO A;  3PRV A;  4W98 A;  1EHW A;  3FBC A;  3NGS A;  2DXE A;  1F3F A;  3JS9 A;  2AZ3 A;  4UOH A;  4DI6 A;  3FKB A;  1WKL A;  3DKD A;  1XIQ A;  4C6A A;  5C7P A;  1NB2 A;  1S57 A;  3L7U A;  1XQI A;  1NDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...