1NHKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
b'AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The 1.9 A crystal structure of a nucleoside diphosphate kinase complex with adenosine 3',5'-cyclic monophosphate: evidence for competitive inhibition.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Phosphotransferase
total genus 41
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nhkL00
3BBBA 3G2XA 2HVEA 1MN9A 3VGSA 3VVUA 2NCKL 1BHNA 3EJMA 3JS9A 3Q83A 1ZS6A 4ANDA 3PJ9A 4DI6A 3BBFA 1UCNA 3ZTSA 1XIQA 4HR2A 1U8WA 1B99A 4FKXA 3ETMA 4C6AA 1MN7A 3B6BA 1KDNA 3NGSA 1BUXA 3Q89A 3ZTPA 3B54A 5BXIA 1B4SA 1HHQA 4UOFA 2DYAA 1NB2A 3EM1A 1PAEX 1EHWA 1NSPA 3FBEA 5CAAA 1NCLA 2CWKA 2B8QA 1LWXA 2DXDA 3DDIA 3FCWA 3ZTQA 3BH6B 1NSKL 3ELHA 4FKYA 4S0MA 4ENOA 1NUEA 3VGUA 3PRVA 1NLKL 1LEOA 2HVDA 5CABA 1NSQA 3ZTOA 4O0NA 4ANCA 4EK2A 1NDCA 2DXEA 2ZUAA 1S5ZA 1BE4A 4F4AA 3FC9A 1W7WA 4ANEA 3Q8YA 3BBCA 3DKDA 3Q8VA 1NDLA 3GP9A 4UOHA 1F3FA 1S57A 1WKKA 3EVMA 3NGRA 1XQIA 2DY9A 3Q86A 2VU5A 3R9LA 4CP5A 3EVOA 4KPCA 1PKUA 4DUTA 3NGTA 3MPDA 4UOGA 1NDPA 2AZ3A 3Q8UA 4W98A 3VGVA 3ZTRA 1JXVA 1HIYA 3GPAA 5IOLA 3FKBA 1S59A 4WBFA 3EMTA 3ENAA 3EE3A 1F6TA 3VVTA 1NHKL 1VYAA 3BH7B 4DZ6A 3L7UA 2AZ1A 4F36A 2BX6A 3EICA 3WX8A 3VGTA 1NPKA 2B8PA 2BEFA 1NDKA 1HLWA 1WKLA 3FBFA 3FBCA 3FBBA 5C7PA 1WKJA 3NGUA 2HURA 3EVWA 1K44A 3FCVA 2DXFA
chains in the Genus database with same CATH superfamily
4X84A 3TA2A 2ZDPA 3D66A 3JS9A 2DGWA 4TY8B 3EYZA 2LVWA 1GT8A 3TP2A 3TARA 2HKEA 2QL5B 2MY7A 5CYJA 5F8IA 1SCJB 2BVZA 4JI8J 2QEXS 5EUHA 4ILMA 2LLZA 4ECUA 2V8VA 1NB2A 2YXLA 2IFXA 1PAEX 1EARA 3JYTB 2I9SA 2CWKA 5KG5A 1KLMA 4Q43A 3I4HX 1ZPVA 2GJFA 3G8QA 5L1KA 2KN4A 3M05A 2I1RA 4JI3F 3UN2A 2ZOFA 3PIPQ 1F60B 1FEHA 4J9PA 2V34A 3EVMA 3TZXA 1NJZA 5EWGA 3GONA 3TZYA 4PXEA 4F4WA 5F9NA 5HJYA 5F3ZA 4LRDA 2J0QD 1NDPA 2OP5A 2B9WA 1Q16B 2HK2A 3GTYX 2NSCA 4FBUA 4RJVA 1VC6A 4DX6A 1QVGR 1K0TA 3B78A 3BGRA 5C7PA 2E7VA 3BN7A 2NYHA 2Q3PA 1HWLA 3PHEA 3QLHA 2GVZA 3US5A 3H8YA 4FS2A 3IRWP 2XY6A 2QC3A 3H40A 4WIIA 1V3RA 5ETSA 3B82A 1TL4A 4CI0B 4H54A 1VHFA 2EFQA 2C2EA 4WFAQ 3Q24A 3ZNUA 5IM0B 3A3PB 2R8JA 1EETB 2V9WA 1IBLJ 2Z56B 3BSNA 1KQFB 3EGNA 5BYQA 3IC1A 2BQUA 1SXLA 2V8DA 3EDQB 5CYQA 2Y0SD 4XPEA 1NKCA 4KGMA 2FD2A 5LMNF 3HSGA 4CH1A 4RW6B 4FNIA 2AJ4A 3QQCD 4GC6A 4DFJA 3N6NA 1Y0HA 3TX0A 3HDSA 5DO2A 1YJRA 1NK9A 2BW7A 2RQMA 1QD1A 3D4JA 3BGLA 2H51B 1A0OB 4OX9J 4WPAA 1U4BA 4I6YA 3I82A 4DSIA 1RWKB 3RAXA 4MIAA 4RNFA 5A2QU 5EHHA 5HROA 2DGVA 2J7WA 1QTNB 3LH2S 5KFJA 5JVHQ 1LQ9A 2FVCA 3EZ5A 3O8WA 4LF9F 4CIOA 3B54A 2MGZA 1X9SA 3HP6A 5KFLA 3M8PB 1NCLA 2YNGA 1X9WA 3IFEA 1KC8T 1U0HA 1WOSA 1TL7B 2A18A 4M5DB 3K58A 4PRFA 1DBDA 5IFMA 4Q7AA 3H5XA 4DQIA 4LT6A 1HR0F 1FJ7A 1D09B 2RIJA 3VAKA 1VRUB 3K5PA 2HEKA 4C8NA 4CO1A 4DQRA 1ZH5A 2KYZA 1F6TA 3KLVA 3T1AA 3DU6A 2ZM6J 4ECXA 2LEPA 3D6MB 4DLGA 4UW2A 3W5YA 3LPYA 1X31C 2AYEA 3M2RB 1XMOJ 4MMOA 2DEIA 2J5AA 2DGSA 1TL1B 1F9FA 3WHIA 4ZLNA 1VS3A 2MJNA 3EJMA 1N33F 1ZS6A 3U1MA 2RS2A 3M6UA 8RUCA 3FSYA 4LSZB 2FHJD 1DRZA 3R7NB 3N4WA 2V8HA 1VLOA 3GFYA 3UVJA 1B4SA 1RWWB 4I56A 3BR8A 4DXLA 4O3OA 4A48A 1S9EA 2B5JA 4LRAA 3GR1A 5CABA 5HQMA 1GMWA 4ZCKA 2O01C 2P6SA 3BSAA 4B9LA 4DR2F 2DGUA 3OVBA 1RWUA 3A3NB 2MQLA 1M5HA 2ZHAA 1S0VA 2V67A 1NAQA 1UFKA 3UR3C 2AP6A 3EMTA 1FESA 3POTB 2BABA 2P2CB 5F3TA 2YPYA 3MCNA 1RQ0A 2FTRA 2QL7B 2NQPA 4B3SJ 1RYRA 5T14A 1QE1B 2CA9A 1BQNB 2NCKL 3RB4A 2DGOA 4USIA 4LIRA 3SCKE 3CSKA 1RT1B 4DF4A 2VDHA 4X4OA 2DY1A 3DC2A 2RDDA 3EPIA 1GAOA 3PRDA 1S6QB 2UUBF 1WOPA 4TU7A 3N5FA 4ZCMA 4LBIA 2WONB 2MQNA 4MIWA 3FC9A 1FFWB 2IJNA 4JP8A 4ZVFA 4ES1A 1NM2A 3NGRA 3TJ9A 4FF1A 1G4CA 2P8IA 3R3TA 3OL8A 4NLPA 4UY8T 1S1UA 4LF1A 2E1AA 1R7IA 2WVBA 5HBMB 2ZWPA 4ELTA 1T03A 1D9FA 1WSVA 1SH2A 2W4PA 3BO2A 4AL5A 4I64A 2MTLA 2VFTA 4OJ3A 4DL4A 1JLAA 5IV4A 5KAKA 4PQUB 4B3MJ 3CC2S 1WOOA 3TZWA 4FKXA 1X9MA 2RDJA 2XLJA 2JZ5A 3ZTPA 5C25B 2E9TA 1QAIA 4RW7A 1NSPA 3K5NA 5CZXA 3BH6B 2YNFB 4PWUA 1FKOA 4DR7J 3TUIC 4I1TA 1VQKS 3GCWP 1LK5A 3SYZA 4UQGA 5DRKA 4GRSA 4ZLJA 2FY8A 1K1SA 3H4DA 3ZZRA 1L5UA 4F4XA 1D8ZA 1YQHA 2V2VA 5E33A 1PC4A 4MKYA 2LFVA 1H2TZ 3PJXA 4ZIWA 1HBOB 4CM0A 1DY3A 4HL9A 4OYWA 3LTOA 3R8YA 1XMQF 1TUGB 1CEZA 1N6QA 1R8BA 4LFCF 1J27A 4DV5F 2LKZA 4I2PB 3OFFA 3R6GB 4ED0A 3W8PA 4Y3CA 5IT9U 1U1RA 3P3DA 3AOAA 1M5VC 1IJFB 1KDNA 2R8HA 2ILYA 2UXCF 3UQSA 3G8TA 2ZVSA 4MH8A 4ED4A 3TRGA 1SV5A 3I96A 4JI0F 4DN0A 4FPIA 1Q7YT 3C19A 3BB5A 1NDCA 4OYMA 2ZH9A 1E6VB 3PJWA 1W7WA 1J5EF 2GMLA 1N48A 2H48B 3TX8A 3HSDA 1EP4A 3TQEA 3HFZB 3EGZA 3IRXB 1D3WA 1PYOB 4ZP8A 3HF5A 3R5JB 2D74B 3BKFA 3SQGB 4YR3A 2ROEA 1JNRB 4WP9A 2DH9A 2J0SD 4A4JA 4B17A 3MR2A 2CJYB 1LFPA 1RP5A 4EFAC 1KBRA 4BC7A 2BJ9A 5GVQA 2WW4A 1RT7B 1I6JA 4HACB 3E8OA 3UCZP 1U0SA 4R8UA 3SCLE 4LIWA 4NLWA 4DR4J 3JSMA 1N5YA 3ETMA 2GJIA 3NGSA 1QSYA 2WOMB 3H5UA 4X4QA 1RT2B 3TAMA 3KLHB 2RB7A 3KHHA 4YB7A 4NYZA 2DISA 3KWMA 1MSWD 1NRKA 3FZ2A 1ULRA 4GKJJ 2W25A 3RBZA 3KNAA 3HVWA 2MKYA 3AB4B 3N28A 1KWMA 3PRVA 3H98A 1HQEA 4QCLA 2X1BA 1HBUA 4CLLA 3C16A 2CJBA 1T05A 5F8JA 4ZLLA 1WSRA 1OWXA 3HVTA 2C3OA 1GFWB 1HBNB 4CP5A 3PKMA 4LR8A 4PXCA 2IRXA 1M1HA 4IDKB 1Q5YA 3GJRB 1PYSB 2NPFA 2ZH2A 3M30B 4F26A 1X0FA 2KJWA 2ZM6F 3T1YF 5I3QA 2AW0A 4OLOA 2MZJA 4QPTA 3CMES 3BSOA 3QRPA 3OR2A 4BBYA 3CJ2A 1YJTA 1ZM4A 1DTQA 2B9EA 2GQCA 2IYIA 1U25A 2DD8S 2EI5A 3OTBA 5AE1A 4R5PB 3CO0P 2PI4A 5C5JA 2YWEA 2N3OA 3RAMA 2BACA 3DLEB 5F8NA 4O3PA 5ETNA 3H2UB 3CGIA 2CZ4A 2KFZA 5CYMA 4FBTA 3Q86A 6FDRA 3W1YC 5E3QA 3DLHA 2KDOA 2BJ8A 3HHNB 2WTFA 1DTTA 5L9NA 2B4OA 1EB0A 2V6AA 2XY5A 3UDEA 1JLQA 3IM9A 1TL5A 1TK5A 1VRTA 4NE9C 2L9DA 4NA1A 3QT6A 1K44A 5F9LA 4NI2B 1N56A 2VC0A 1F9HA 3Q0AA 2HLUA 4FP9A 4RW8B 2E1CA 1WACA 2PN6A 1R89A 3J80Y 1FKPB 4OZLA 3A1YG 2J8AA 3NS5A 1U1NA 1MW7A 3I0SB 3VZIA 3HCXA 2I5JB 3GJQB 4DSEA 4GO7X 3G71S 1N5SA 4FXWA 3HVAA 3MCMA 3D67A 3CT9A 1RKIA 1EQMA 3GIJA 4IQMA 4A8WA 4LSLA 3QT5A 1IKXB 2YQ0A 4B3OB 4LMZA 2L9WA 2DCLA 3CIZA 4FYYB 3TVYA 2RE1A 2KG1A 1P1TA 2CJKA 2DR5A 3MMAA 4P2XA 2KZZA 3M7VA 5KFTA 2A6OA 2O1PA 3EE3A 1URNA 1PCAA 2DNZA 1Y10A 1YRXA 1YX2A 5J1EB 3IP0A 1RI7A 7FD1A 3G9CA 3I9ZA 3OL7A 1D9DA 4XDCA 3HJVA 1AZSB 2BUNA 2A3JA 3Q8PB 3F0NA 5A0YA 1KQSR 2EC0A 2IRYA 1Y9OA 2C2RA 2G2YA 1LWCB 2ZVIA 4U8VA 1XERA 2XMMA 2LU1A 5AXNA 2RU3A 3HLUA 3QYYA 2BANB 2K1RB 4A8XA 3M8WA 1SC6A 2WCXA 1CJTA 2P9CA 3L3CA 4PG6A 3VHQA 2ZD1B 1HA1A 3E51A 1RYSA 4DR7F 2XI3A 2E5HA 3PTWA 2AX1A 4ZPAA 3BZQA 1V9OA 3G6YA 2BQRA 4AYBD 1SPBP 3LQVA 2DGXA 3GMGA 4J5OA 3CJKB 2FC8A 1A6LA 4ILLA 4BCAA 3OTOF 5KFIA 1GX5A 3KYLA 5G0RA 3OFEA 2OEJA 5HN0A 2LA6A 2X1AA 4HI2A 1L3VA 3K0JA 1X4AA 4E0DA 1P9QC 5L38A 2WSEC 2GO9A 5D8HB 2DIUA 2AGPA 4URQU 1LFWA 2B6AA 1S1WB 3IA0A 5KT4A 2LEBA 1N54B 3AAWB 2E1MC 1SJ3P 1J5OA 2HNYA 2QLFB 3HHLD 3HMJG 2EBEA 4N5SA 3MAAA 1Q53A 3W2WB 2IC3A 1H2VZ 2M2BA 4CDIA 3BJYA 4QIEA 2V5HG 3ETOA 1OPIA 4G65A 3HHEA 4LUBA 2D9PA 3DFEA 1MU2B 2DHGA 3O2IA 1K8AT 1FRLA 1XN9A 3DRSB 1XR7A 2Y8YA 3W8GA 4YHHF 1UPPA 4DL5A 2KFYA 2JEGA 3OVSA 4DPUA 4MYTA 1K47A 4MFBB 3AXKA 1M5KC 2FHMA 1FVSA 2E5IA 3B8HA 1RTHA 2QL9B 2YKPA 2XSFA 4ZP6A 5K8MA 1DFDA 2QLWA 4DOZA 5D4NA 2OIHA 2QLJB 2MXYA 1U2FA 2HBYB 3ITHA 4D3HA 2X1GA 2B3TB 2HG4A 2G4BA 5KFDA 3PVXA 1X8DA 5IWAJ 2M88A 4KGKA 4JI5J 1WTFA 2QSFA 1YBUA 2DJWA 4AD6A 1K9MT 1HBMA 4DHVA 1F9EB 3RB0A 1OQ6A 3QRRA 2CPZA 5JVGQ 5I3UB 4LBHA 4CTAA 3NGDA 1F2HA 2AGOA 4WK1A 2NZ4A 3NGTA 1TKZB 2DNQA 2QYGA 4Q8FA 3OXFA 5IOLA 1S59A 3IR6B 3FEXB 5KFEA 2BM1A 4G1IA 4NLVA 1KS2A 3MM9A 2Y9HA 4NYPA 5IV3A 4LF7F 4DL6A 4ZCLA 4OZ1A 1CJUA 4LFBJ 4AQYF 4XK8C 4KO0A 2V50A 1A7GE 4OYXA 1RT6A 3MMBB 5A8RA 5M2RA 2PI5A 4JI7J 4TYAA 2U2FA 1YSJA 4FZVA 2OPSB 2VB6A 1ZETA 2RQKA 3A3OB 2XNRA 5K8OA 5AJ3J 1ZA2B 2ADCA 2IMWP 2NZCA 2LYVA 2O66A 1DQ8A 4ZVHA 4C98A 1FNXH 1LV5A 2GW8A 4LF4J 1KHVA 3CMAS 4N8OA 4LSNA 3I6PA 3PW7A 8AT1B 4K5RA 2Z30B 1WORA 4DV1J 2LP4A 1WC1A 1VGYA 2B4PA 3VAMA 4X4VA 4MK7A 1LW2B 3FCHA 4EK2A 2LA4A 1CLFA 2OKQA 3KK3B 3Q2TC 1SC4B 1YVFA 4F2RA 4KYZA 3AD9C 4B9MA 4ELVA 5F8GA 1KQGB 2EFVA 1BWEA 1D8YA 5EDWA 4EWTA 2GNKA 1T9YA 1NHVA 1OYDA 1KVKA 2C1EB 2CVIA 3MEGB 1UETA 2HWTA 1ZPWX 1VRQC 4PQAA 1N34F 4EBEA 4F4ZA 1FNOA 1FO1A 3MD3A 4QIGA 2COLA 3ZZYA 4UF4A 1E6YB 5KFFA 4HH0A 4X4RA 5E3AA 2MDAA 1OYEA 4FYVB 2K8GA 1N32F 4M95A 4XDDA 5L1IA 1HHTP 2GV1A 2HZCA 4HVZA 5MAOA 2G2OA 1UJ5A 3BGUA 4X66J 5DDQC 3VQTA 3GIIA 3MMCB 4RL1A 3IN5A 4C3KA 3THPA 3KHLA 5FDLB 2OSRA 2PD1A 1YGYA 2W8LA 3T5LA 2FVRA 3LWLA 3LGNA 5GAEU 1XQIA 2H5EA 3R5DA 4UOGA 1FJCA 4TKTA 2OAUA 1IM4A 4O44A 3LALA 3VR1A 2EFGA 3BDPA 4J9MA 2CIMA 2YH1A 1U1KA 4K4XA 4FF2A 1QUPA 4V19J 1GMWD 5ETVA 1LXNA 4I7FA 3NCQA 1H0HB 2C2OB 2MQOA 1PILA 1D1UA 1YRTA 1YZ7A 4J9KA 1UVMA 2FC9A 3PYFA 1NMEB 2UZAA 2QN6B 4QW8A 3ZTSA 5KFYA 1IKWA 1RBOB 2CPIA 2ZHOA 4GKKJ 3GFHA 4C97A 1FDDA 2HHXA 1JLBA 4NCBA 1X5TA 4ZVGA 2XYPB 2CQ4A 4IG3A 3HPOA 5C42B 1T9UA 3H2LA 3P5BP 4WJBA 1GEHA 4U7UD 5GADI 1M5PC 4JB8B 4J37A 1I1GA 2W24A 1F3VA 3BDEA 4DJBA 4CYUA 1RKJA 1NB7A 2VV5A 4PAAA 4CH7A 2JNJA 2XCAA 2B0GA 3UN3A 4CLTA 1MROA 2CQ0A 5ITHA 2VA2A 1RHMB 3DOKB 2HPUA 4DQSA 5LSLA 1O6XA 2FB0A 2VFRA 1RTJB 4PPZA 2XLKA 5A8KB 1RB0A 2CRLA 2GGPA 3WX8A 4TQRA 3CJTA 3HZGA 4WE1B 1WJ9A 2DRAA 1BD6A 3KUEA 3T5JA 3A8KA 3THTA 4G1PA 4FXDA 2HNZA 4TLRA 4ECVA 5KFUA 4XTTA 4PXDA 3BBFA 3KMQA 3AT1B 3CMQA 2K3KA 3P6YC 1T94A 3V6DA 1H3DA 4ZVPB 1FWKA 1JKHA 4ZHRA 3D0HE 4ED2A 2NREA 2IYGA 3VQSA 2V2KA 4NLTA 2YY3A 3U02A 2ZE2A 4JYAF 1F1BB 4KKOB 4ZJLA 3ZZPA 2ZJPQ 3C6UB 4NMLA 2M8HA 4DR3J 2FZKB 2GQQA 4RW4B 2GVDB 2MY8A 3MGJA 1FTCA 3KHGA 4URSA 3P4UB 5LXRA 1I94F 2QMWA 1C0UA 1WTBA 4YR0A 2CNNB 1EQ0A 3W66A 3Q8VA 1VHIA 4Q0BB 3P8BB 4OV1A 4PXBA 3M8YA 2KVIA 2MQ8A 1NJIT 2VBYA 5I4MA 5KG7A 1LWFA 4ELUA 3UNYA 4E2FB 1MG7A 3PW2A 2ASJA 1U49A 1RBLA 1KKHA 4TY8A 2VJVA 1NDKA 2FYXA 1HLWA 2BOAA 4NX9A 5DDPC 2HHSA 2MSSA 3GSIA 2QLXA 5L39A 2A0FB 3TUZC 2Z2MA 3JYTA 3QNWB 1CULB 4OYZA 3PV8A 4XPCA 3KG0A 4CNYA 2HWIA 4J9UE 2OSQA 5KFZA 3N9UC 4U9RA 1VOMA 2RMLA 3NKYA 5M2PA 4DMZA 2FHKA 4C0OC 3N0VA 5LL6d 4YB1P 3OSNA 2BE2A 3O1LA 5IWAF 4JI5F 3KUHA 1BXNA 2VKZG 2DXEA 2UP1A 3JSYA 1AA1B 2XS2A 3ET6B 3CJ0A 1S57A 3OJUA 2ROPA 4DR1F 3S8SA 5AE2A 1JXEA 1KONA 3M9MB 4K0KF 5D3GB 4C8KA 2H5JB 4YS2A 4JV5J 4Q2MA 2JL9A 5KT3A 3ISZA 2F63A 4YY3J 2AT1B 2ZC3A 4OHVA 5FLXY 1RCXB 2RT3A 4B9VA 2N82B 3FBCA 2EG1A 4FPRA 1I3OB 2GZOA 4OIXA 5C24B 2N4DA 2JJ4D 5IT9Y 3SCIE 3GV8B 4JI1J 2B7BB 2ZDOA 2ZZNA 2OELA 2BE7D 3PEHA 5HANA 3BS9A 5IM0A 1RJJA 3WIVA 2ZJRQ 1EETA 2D1CA 1U2CA 4QQBA 1HHQA 1JNZB 4CT9A 1U1QA 3EM1A 4PPDA 4P2MA 4K4VA 3D6TB 2NUUG 1Z4UA 2ZBCA 2XO6A 4LF4F 1S79A 2F9DA 1IQTA 2FHJA 5HVHA 3MAQA 5ETPA 4CLSA 1S0MA 4DV1F 4FYDA 2M9KA 2IA6A 4NA3A 3BEGB 4B3TJ 3MEEB 1PG5B 4KV8A 1YDLA 4YP3A 3G6ES 3BF4A 1NHKL 1X4GA 2CWXA 4Y28C 5M2UA 3O44A 3IS9A 1QM9A 3TNVA 1N5VA 1WKLA 4K4TA 3GIMA 3NGUA 2GIRA 1QAJA 4ECYA 4OYAA 2ADBA 3NNAA 2MQPA 3M8PA 2RQ4A 2XMUA 2UUCJ 1UL3A 3PG9A 2ATCB 4ZVEA 1TL7A 4M5DA 1Y4ZB 4HT5A 3FJ2A 4DL2A 1WC5A 2F3JA 2ZNZA 3V4IB 2C3YA 3FCWA 3DLGB 3ZC4A 1T7PA 4FKYA 3BQ1A 3LPEA 5J2QA 4OZJA 3PEJA 4U7UK 4DSLA 1I51B 2UXDF 2IVMA 1VRUA 2YNHA 1X4DA 3M9OB 2HVZA 1UVNA 4X66F 4ZOSA 1SIZA 4IFYB 4LF5J 1PYTA 3M2RA 5CH7B 2AZ3A 3R2DJ 2RKIB 2HYIB 1BMQB 4DSJA 1TL1A 1M90T 5IT4A 4DZ6A 2I8EA 5HMWA 5AE3A 1MLAA 4PUOB 2VOPA 2HQDA 1R31A 4UY85 1BY9A 4ZKAA 2KT5A 4F3OA 1YK9A 4OHZA 1J2VA 2VPXB 5HVGA 3W2VB 5KFWA 1HQ2A 1VMBA 3PFOA 1VBXA 2D3UA 1CS4B 3LWMA 4UUWA 3WDOA 2I38A 1ICEB 2JC0A 3W9JA 3OLBA 2ZZTA 3UE2A 4X64F 1TELA 3N01A 4NA2A 4JOUA 2OTLS 5IT0A 1U1LA 3KTQA 2RUGA 2IVFB 3G8SA 1R27B 4DR5F 5KT6A 2HBZB 5J2MB 4OI2A 4EZ6A 1T02A 4EUVA 3TUPA 3JSBA 3POTA 5L46A 2IDEA 3AOBA 4J90A 1X5OA 3KMSA 4AE5A 3CDUA 1FD8A 3HSJA 4FYWB 2C3MA 4W98A 3D9BA 2C2MB 3SFGA 2HGNA 1JJ2R 1C2PA 1QE1A 2V8PA 3MD1A 3NNHA 4FF4A 4ZPWR 4FS1A 3ONQA 1RT1A 4F0KA 3L95X 4RNNA 1FERA 3RW7A 5KFOA 1HHSA 2UU9J 1DLOB 4BWJA 3SDEB 3HULA 4ID8A 2FQQB 3GIRA 3CCTA 2DNYA 3UW1A 5E41A 1S6QA 1KN6A 5CQGA 2M5YA 5HMYA 3I5BA 1FRHA 4Y00A 3PM9A 2HRYA 1ZM2A 2YWHA 4F3MA 2WONA 3MFHA 1RWVB 2XMVA 3F73A 3PW5A 2J7KA 3BQ2A 1EHWA 5CAAA 3H5YA 3K5OA 3SSQA 2CZVC 4C11B 3MPUB 1TU0B 3A13A 1TL3B 2EWHA 3OR1B 3QWPA 3MCOA 4DR3F 1RBAA 3G4SS 3M6WA 2OI2A 1VDHA 2VU5A 2AF6A 2QJ3A 5B08A 4K4YA 1VJWA 1MMLA 3T41A 2I0XA 1B64A 1UAWA 1F5AA 1F5BA 4PQUA 4DF8A 1RAJA 3RRGA 3K59A 4PG4A 5SZTA 5GMDA 3RG6A 2QLBB 4J9VA 2D9OA 5JXSA 3K89A 2LXUA 4JI3J 2Y1LB 4OX8A 5C25A 1UP1A 3T9ZA 2KHDA 1MMNA 2F7VA 4DR6F 1R0AA 3H4BA 2YNFA 2HWHA 2IM2A 1SL1A 1F0XA 2FJAB 3TVKA 5KG4A 3UCGA 3NGKA 3MR6A 3J7ZT 1WNEA 1HI1A 1X5PA 1RE1B 1WC3A 2DXDA 1Q4RA 2J6SA 1UVLA 5IQQA 5LM7E 2CKWA 2JLFA 3C66A 3PYDA 2RRBA 2ATLA 4BHQA 1HBOA 5CA5A 2IY5B 4UT4A 2MKSA 2VHGA 4MKAA 2LQ9A 4WTYA 1UFLA 5ETRA 4MAKA 2FIUA 3PCOB 4I2PA 3CC7S 2KT3A 4AFFA 2IM0A 1U0HB 5F8LA 2DIVA 4QWDA 4RNMA 3VGSA 2ROGA 4OLPA 4ILRA 3DNCA 2QFIA 2EBGA 1WC6A 4N8NA 2XYHB 3M1VB 5LMNJ 2EK1A 3L4BC 4C9DA 2V0NA 4YDXA 3JQKA 1VQLS 2F4VJ 1E6VA 3EZOA 1T95A 2A6MA 1TR0A 5ETMA 1JLFA 4PABA 3MUTP 2OH2A 4DFKA 1OQ3A 4LREA 4DV4F 3SQGA 5RUBA 4UOHA 1HWJA 3VALA 2OPQB 2XTJP 1RWPB 4NYOA 2D7SA 1FHTA 4IR9A 3LANA 1P6TA 4A47A 3FKBA 5J2PA 4LF9J 1RT7A 4TY9A 1QVFR 4HACA 3QIPB 3C14A 3CCES 3AJ2A 1S9EB 2GHVC 3QGPA 3RR7A 2AU0A 2AEMA 2FJXA 4OQJA 2WOMA 4OZNA 4CZCA 1RT2A 4O3NA 4WYWA 3KLHA 3PW0A 3UD3P 1OMSA 1S99A 4KFBA 2PO4A 4ZVUB 1O5JA 5CCMA 2VG7B 3VWSA 1HR0J 4OYPA 2VL1A 3D0GE 4ZPVR 3NBPB 4YFUA 3ISNC 1PC5A 3H2VE 4J9SA 1IQZA 1Q1KA 1RT4B 1HBNA 4NCAA 1NBEB 4P73A 2RVJA 4KGVB 2BJDA 3V2UC 1HARA 5A8WA 3Q8YA 1VBZA 3VV2B 4IDKA 5K8NA 1H7WA 1N33J 4UTGA 3HVRA 2HHTA 4HDHA 4BC9A 3M4XA 2WW8A 4R25A 5KG2A 3M8QB 1HIYA 3M30A 3R7BB 2BKOA 1IXKA 2ZOMA 5DQIA 1LW0B 3HJFA 2E7WA 4RX6A 1WG1A 1VBYA 4QR0A 2GQ2A 2JEJA 4NPOA 4LVNP 1UA0A 2HURA 4I6WA 1OS5A 1WI6A 2J0WA 2LU2A 2Z2YB 3K17A 1S0NA 4TU8A 1XR5A 4DR2J 3H25A 2PFFB 1RTIB 1S1UB 1WHYA 4H4MB 2HSEB 4R5PA 1RHQB 2IBKA 2C2ZB 4CLPA 4J9RA 2ZJQQ 3DN9A 1VJQA 3AJDA 4N76A 3DLEA 4NXNJ 4CLKA 4IR1A 4USHA 3MF5A 3DLLQ 1H7XA 2AX0A 4M5HA 4LQ9A 4NOHA 2HHWA 2G0CA 1TMJA 2HFVA 3AH6A 2DVIA 3AA8A 1ZAXA 1JLEA 4AUKA 2FLLA 1CBKA 3MECB 1IBKJ 4PYDA 3ZZ0A 3JB9k 4F0MA 2J9CA 2BJ3A 5KTQA 3W64A 4X4UA 4AXJA 2YKMA 4AL7A 4GO5X 2UVUA 2HK3A 1NK8A 4NI2A 3JXOA 3ISND 4F25A 3NY0A 2UUBJ 1OY8A 2V4QA 4QWAA 1FKOB 3FNNA 3M6XA 1XWLA 3WC0A 4RW8A 3S1TA 3PW4A 1FKPA 4RUHA 2XC9A 1L3TA 1MN9A 3EXCX 3I0SA 3PJ9A 4DI6A 4DWIA 2I5JA 3K7RA 3FRZA 3RBDA 4NLUA 3QSYB 4CO5A 2PA8D 4JI6J 1P8GA 4DV3J 4P74A 4RNOA 3EGWB 3FUYA 4B3OA 4C8OA 4KJIA 3UCUP 2LDIA 1KFSA 3OL9A 1S0OA 5DM6Q 2B9YA 3R6LB 2M3DA 3FMBA 2D3O1 4DV0J 2ALYB 4X4NA 5DQHA 1WKKA 1AFJA 3R5AA 8ATCB 3NRBA 1XNRF 5T7LB 2HHQA 1VQ4S 3IGVA 5J1EA 2QFJA 1RK8A 1AXQA 2QMUB 4DFPA 5C2GA 1SV5B 2OMOA 5KG1A 2VH7A 1AZSA 4YB5A 4NASA 3U27A 5I42B 1LWCA 3W9IA 4WFXA 3IG1A 1R8CA 3NCPA 1S77D 3WX4A 4JI4F 1Q5VA 2BANA 2K1RA 4ZLPA 4XAKA 4C0HA 2JRSA 4F04B 1R8AA 2E29A 1SC1B 2JWNA 4KQZA 2QA1A 3AD7C 2ILZA 3CJ3A 1S76D 1NSKL 2KFNA 4I0WA 2WZ1A 2BZ2A 1XR6A 4WKRA 2WVFA 1XMQJ 2NPIA 3CJRA 1U09A 4LFCJ 2BYCA 3NL0A 4DV5J 4TU9A 4ANEA 3CJKA 4R8UB 3PX4A 4AT1B 1CSJA 2HVIA 2X3DA 3JSMB 4OI1A 2R42A 2R4FA 1MMDA 4Q5VA 1CC7A 3Q8UA 2CPHA 3U7JA 2Y1JA 1RLCL 2QX0A 4DS5A 2UXCJ 4NL5A 4NZ7A 2XYGB 3H0PA 4IFVB 1X4BA 3WC2A 4KY3A 1FJEB 1IUJA 4JI0J 2MKIA 4N56A 2DB1A 1S1WA 2Z2LA 4X65F 2DHAA 4ED8A 2HVEA 2KYXA 1J5EJ 4ZS6A 1YTYA 2QYCA 4HR2A 3CCZA 4GVLA 1GNKA 2DNMA 2ACMA 3BYRA 3KXDA 4CO2A 1ITPA 5ETQA 1SKUB 2FGOA 2NXCA 2BRKA 3CD6S 3I0RB 3M2UB 1KOOA 2G0JA 3PACA 1UVJA 2DR6A 3J81Y 4CO0A 2F4VF 4GVBA 1MU2A 3RGIA 4KH0B 2GIFA 3NOGA 3KLGB 4JUZA 4OZ0A 3FMWA 4MFBA 1UWAA 1FX4A 2EPIA 2M52A 1DTQB 2CAJA 5HATA 3J7A1 3KJVB 2CFXA 2VFUA 3VF0B 4EO6A 4CO4A 1U6ZA 4O3SA 1PJ6A 4DX5A 1S1TA 3KDOA 1R6VA 2KJVA 2OPPB 5GMEA 1TKTB 2RD5C 1URRA 1C4AA 4PWDA 5BR8J 4I2QB 2HBQB 3D6FB 4P9SA 3D3BJ 2YQ3A 2QE5A 5BYSA 3TANA 4KPYA 3W9HA 1S6PB 5I3PA 2XB2D 4O3RA 1YJVA 4M5GA 2W2MP 3DDIA 5I3UA 1JLQB 4LR9A 3GE9A 1TKZA 3EPGA 1HPZB 1CJKB 5LT5A 4RLEA 4ZCIA 3CCMS 2VBWA 4ER8A 4EO8A 2FJDB 3K57A 1IBCB 3T1YJ 1R0CB 4ZPDA 4LF2A 4QWBA 3TZZA 3G82B 2L08A 4NLQA 5U47A 2KB2A 2UUAF 3MMBA 1KD1T 2CQ3A 2KRBA 5BYRA 1P1LA 1W2IA 2OPSA 3CDBA 4Q44A 3DLBA 2YKNB 5DJBA 3TYTA 1Y3KA 2V68A 4N41A 1UZDA 1FXDA 1UFWA 4HHJA 4BLGA 1QAYA 3J7YI 3FFIB 4DQPA 3DYAB 4ALZA 3D68A 4ECTA 3GQCA 3QAUA 1X60A 4C48A 1SKWA 1LW2A 3DGPB 3KK3A 3C15B 2GCFA 1R3NA 1G1XA 2RUSA 3ZTQA 1NPPA 2X3GA 5H9FK 2FDNA 3VGUA 4LRFA 3BKUA 4NXNF 1QAXA 3GYGA 3HSZA 2RH3A 1DAXA 2HW3A 2UXBF 3QZ8A 3NOCA 3PR5B 3M6VA 5JUMA 4DUTA 2PDAA 3C3LA 4ECZA 4PR6A 1YKWA 1W2BR 1IBKF 2DRBA 2KH9A 4B9UA 4P2FA 1VYAA 1IR0A 2MLYA 2IHR1 2WBMA 2F5GA 2G9OA 1YHQS 2CDRB 4YOEA 4DU7A 2W4CA 3W65A 1E6YA 1GH8A 1O51A 1FD2A 3GJTB 4DCJB 3Q23A 3PXGa 1ZZNA 3UFCX 2V2QA 3MTKA 2EXUA 2Y8WA 1JMTA 1HWKA 1HNZF 1LOUA 2KXFA 3S6EA 1P9YA 1CPZA 3OQ2A 1Y5NB 4JI2J 5FDLA 3G6XA 1VC0A 1SQFA 1CQMA 1Q8IA 2HZVA 3FDSA 3JTPA 1Q79A 4M5MA 3CJQA 4JI6F 2HFUA 4DV3F 2BOPA 4ECQA 4KR0B 4WKYA 4RW9B 4IYQA 2ZBQA 3GLJA 3KLIB 1CVJA 1VQMS 2FLPA 4C8YA 3L09A 4RUCA 2HNDB 3WIUA 3D1QA 3H90A 4DV0F 3ZTRA 1C4CA 2XSJB 3ENAA 2W4DA 1SJFA 5LOQA 2BW2A 3SEOA 3QGGA 2HNYB 4DL0C 3ZNJ1 2WK4A 4K7QA 1VQOS 1FVQA 1RWOB 4OX6A 2ZH6A 4USMA 2IAJB 5C42A 1B0PA 2CNLB 4F0HA 1AUDA 2VJUA 5HO4A 1RAEB 4OFZA 5DDOC 3I87A 1C0TB 5DGAA 1S48A 2N4CA 2MEWA 1CJVB 3A8EA 3V4MA 3GU0A 1OIAA 1ZTTA 4USTA 1YWXA 1RWXB 3OTOJ 1M1GA 5KOWA 1VQSA 4O3QA 3W7BA 1NK6A 4B3RJ 2KG0A 2QMXA 3CD7A 2NXUA 1RTJA 2VPYB 4ES3A 1WC0A 1HD0A 3LUYA 2VQEF 1F3FA 5A8KA 4J91A 3LGMA 1QY7A 2WAQD 4YQWA 2MLXA 3Q2SC 4F2SA 4ITSA 4WE1A 2ZKUA 1XTZA 3CCRS 4NLSA 4EYIB 2CG8A 3DOMB 3FSXA 3IGNA 2UV8G 2HFNA 1ZA1B 3QIDA 1GXTA 1U6BA 5DETA 2CQ2A 3E01A 1RAHB 3LGHA 4NCGB 3SV3A 2VG5A 2CJQA 1PJ5A 1HD1A 4AXIA 4Y2AA 2ZZMA 4KKOA 1OSCA 3NNCA 2HHPA 1UCNA 4FF3A 5DG7A 1U8WA 3BN4A 4QYZJ 3NAHA 2GVDA 4DV7F 4DS4A 4DV2J 5KG0A 3TJAA 3CJSA 4YHHJ 2R3VA 4YR2A 3TAQA 4Q0BA 2CXEA 2CJXB 3TO8A 3I56S 1WELA 4EI2A 3DM2B 4KO0B 5D4OA 2A10A 2KM8C 4NRTA 3RB3A 3Q8QB 4X62F 2KM8B 4NEZA 4MK8A 4CQ1A 2RF2A 3HXMA 1V3ZA 4PYAA 2PEHA 3R97A 1VK3A 1Y5IB 3KKFA 4RWWA 4RBTA 1YIJS 1SL2A 3CF5Q 1Q78A 5KFHA 3BPSP 5CHCB 3UPFA 2HGLA 2YWGA 2IJRA 1JLCA 1BC6A 1CULA 1S49A 2E66A 4LF8J 2N3LA 2YNIB 1YJWS 2NSBA 1TUWA 3P96A 4CLFA 5KT2A 3MM8B 4CCHA 3UR0A 2XMAA 4FNHA 1U26A 5BR8F 4ED1A 3DRPB 1SUQB 3GILA 2VBZA 3D2WA 3R1HA 1G7CB 2DGQA 3MPWA 3CD0A 4ID5B 2GA7A 1HKAA 1WUUA 1NK7A 4NLDA 3P45B 3IAS9 4N7TA 2M70A 2M8DB 3J80U 2HVDA 4LF7J 4J7CA 1NSQA 4EMDA 5D3GA 3VTIA 3CDWA 4AQYJ 1NJYA 1KHWA 1IKYB 2RHSB 4BWMA 1PJ7A 2CADA 2VIHA 1GMVA 1S1XB 5F0UA 1OY9A 3B4MA 4FVCA 1NJXA 3NAIA 3D0IE 5IQ6A 4C2MA 1SH3A 4ZDNA 2JSXA 5C24A 1NKEA 1RTDB 5GAGU 2FJWA 3RUBL 2FJEB 5DLGA 4HLBA 2VDIA 5HJXA 5K14A 2KI2A 3DXBA 5L8RC 3D7SB 2F65A 2KXHA 1BHNA 2AGQA 4ANDA 4NZ0A 2N7YA 4NXMF 1PO6A 4I69A 1OY6A 1L3UA 1APSA 4H4OB 4WCEQ 2C2DA 2ZWOA 3D3CJ 5KG3A 1RT5A 3DRYA 2FHOB 2F40A 4I6AA 2IIHA 4TQSA 1RGVA 3AB2B 5E2QA 3MEEA 3HD2A 3KK2A 2LMIA 5GMKa 1KR4A 1BE4A 3D6HB 5E0OA 2XZDB 1REVB 1N34J 2ZH5A 4LR7A 4WFZA 4D3GA 5LJ5Y 3RJMB 7AT1B 3MPDA 4O4GA 2JLEA 3T1HF 2L48A 1RHJB 3IAM9 4RBVA 2KT2A 2E5LF 1N32J 1DQAA 2B8PA 3DI6A 3QZ7A 2R2TA 2ACYA 1EAYC 1SQGA 1GTHA 5A6WA 3L7OA 1KVJA 2HQFA 3Q83A 1S1VB 3QJLA 1MROB 4ZPBA 1QSSA 2Q6CA 1YJ7A 3PNIA 4P2SA 3MR7A 4F02A 4OI3A 3AQPA 4CM2A 1MNEA 2JFDA 3CJ8A 5D0GA 4CLZA 3UDVA 3RRKA 4OYOA 4CNZA 3MM5A 2VQFF 3FEZA 2CQIA 2VA3A 1RDRA 3VAGA 3ZZTA 2E1RA 1X5SA 3ADAC 4JI2F 4IFYA 2DBBA 1Q8KA 3OTCA 1WF0A 2RKIA 5LSRA 4QOTA 4UZBA 3LO3A 2YKQA 1JIHA 4KBIA 3M32B 1HNWF 1UZHA 1UMJA 5MLCV 4DV6J 3G96A 4M94A 2ZHBA 5D0HA 2AZ1A 4K4ZA 1TFYA 3W2VA 4AL6A 4J9QA 1KNZA 3T6JA 5HLFA 1SQEA 5B0EA 1CS4A 4O23A 2BKPA 1VK8A 3G2XA 1Y00A 3DDNA 1KQKA 2I6WA 3QPIA 4OJHA 4TLQA 3D1HA 2CUYA 2IA0A 3BO4A 3DDKA 1JJHA 4L75A 1W26A 4PWWA 2XHWA 5J2MA 4WFNQ 3BSCA 5AXMA 1LK7A 5B0BA 3RZAA 3EXYA 3D1OA 2Z4PA 3SQOP 3DMJB 2HMIB 4K8RA 4QJVA 5E3RA 3OD2A 3BV8A 3J7Z5 2APOA 3FEYB 1TVRB 4KHPJ 4B3RF 1HW9A 4IRDA 3QO9B 2QT7A 3KG4A 3SBMA 1DLOA 1KTVA 3SDEA 1U6FA 1RT3B 2J7UA 4JYAJ 1XNQF 5HP1A 1N5QA 4N47A 5B0CA 3UO0A 2QA4S 4FXVA 1HNXJ 2BE2B 4ICLB 2VASA 2W2NP 4RNHA 3CIMA 2OJ3A 1I94J 3UI3A 4JV2A 1YJUA 5KFPA 4Z7YA 3MEDB 1O8BA 2VG6A 4OI4A 4C11A 3OHBA 3OV7A 2QO3A 1TL3A 3SI8A 3KDNA 1XEZA 3SSRA 1KRPA 5KOXA 2ZH3A 1UTAA 1SJQA 4EYHB 1NK5A 4LJMA 2HQIA 4ZVQB 5EWEA 3OR1A 3M8ZA 3FBEA 4FVMA 2J6UA 4Q45A 2AQ4A 4I68A 4DV2F 1SL0A 1JLGB 4USUA 2R7UA 4RU2A 1VR6A 3R5GA 4ZN1A 1LWEB 3ENVA 2BV3A 2GS8A 3C6TA 2QGFB 2IRUA 1KTQA 4QU7A 2JVRA 1WF2A 4F67A 3LP0B 1T8EA 3BR9A 1FRKA 3X1LB 2YKOA 1VIXA 3UD5A 1XMBA 3MI7X 1NPKA 2J9EA 3D5MA 2UVRA 3PX6A 4YMEA 1OO0B 4NRUA 3P49B 2G0IA 5H1SV 5K5MA 4I67A 1RAFB 1IKVB 1RCOB 1HNVB 1WG4A 4LF8F 2BRLA 1FDAA 4DR1J 1JJ4A 4QYRA 2HQ3A 1TP7A 1QLNA 4K0KJ 4M5KA 3TVZA 3MHYA 4KV8B 2Q66A 4ZJQA 2WSFC 1M5OC 3LP1A 1N5TA 1DURA 4ES2A 5KT5A 4TN2A 3IS9B 2RJZA 4A8QA 3FQKA 1X7VA 4EZ9A 3I55S 2Y3YA 2YWKA 2BR0A 4PG7A 5DS7A 4IG0A 1Y3JA 2VZ9A 1ZZFA 2DHSA 3T19A 4C8ZA 4WZMA 3QT7A 2HLTA 2F1FA 2AJ0A 1HQUB 4O4RA 2VOOA 2ZOGA 1ZAVA 5J2QB 1IBMJ 3I4PA 3RB6A 3M1VA 2SXLA 2FJVA 4YB6A 3G6VA 5J2NB 3B4DA 3CCWA 3W62A 1YRUA 2YNHB 2E5GA 5DG8A 2FUG9 4LFAJ 1C1BB 4C0BA 1S7IA 2ASDA 2HIYA 2VC1A 3PR4A 3I31A 1FKAF 2B51A 2FLOA 1U47A 1U1MA 3OBIA 2J0XA 5IC4B 1Q86T 2KRRA 2WHOA 3M8RA 3DXSX 2OPQA 4EBCA 2R8KA 3EZUA 3SCJE 3GR0A 4ANCA 2RS8A 2O67A 4QZVB 1HYSB 5GADU 5IC6B 4WP3A 2F8HA 4M5NA 4DUZF 3QIPA 3AA9A 2PMHA 1RSCA 4F4KA 4TNOA 4G1QB 1PKUA 1R43A 3RBEA 4KT0C 1TKXB 4WXOA 2L3MA 3GZ7A 3OXGA 3PRBA 2AD9A 1Y7PA 4DCOB 5A2QY 5SUHA 4OHXA 1JJCB 3FBFA 3AXMA 2OFGX 2VG7A 3F41A 2HZAA 3MAHA 2CG4A 3A8JA 1QUVA 5DZ6A 1IN0A 3T5HA 4QR1A 4P7VA 2UXDJ 3CEDA 3NBPA 2C2NA 4IRKA 4HH1A 2BE9B 3FVYA 4OI0A 1UA1A 2IMOA 1RT4A 1C1CB 4MKBA 4ZP9A 3MTJA 2V4JA 5A6PA 1G2EA 3HK2A 3C2PA 2ZBPA 2YWWA 2YH0A 1VQ6S 3MR3A 2CVEA 3OPKA 3AQOA 2W2PP 1HNIB 2IVYA 4B9SA 2H4WB 4BDPA 2H5IB 3M8QA 3KLFB 2CZ9A 3UN5A 2WSCC 4F50A 4NZ6A 5D0EA 1FK9B 1LW0A 2HRUA 1B7YB 5A76A 3EVOA 2DGTA 1D0EA 2K7KA 2AMCB 4K2JA 3IO1A 3MUVP 1S7HA 5K8PA 3J7AN 5KFAA 2YBVA 5EWFA 2JX2A 2AEFA 1U2RA 2GHPA 2OPRB 5ETKA 3CULA 4X64J 2Z58B 4L3KA 1RTIA 5LXYA 4OZ2A 2H4YB 4DV6F 4H4MA 2BXJA 4DR5J 5GAHU 1AB8A 4H4KC 2VPZB 4DUYF 4X2BA 2XI2A 3K5MA 1SVDA 2CPJA 3CB4A 1NXIA 1FRIA 1DHMA 3OTDA 4L76A 5BXIA 3LAMA 2HS0A 2YX4A 1LNQA 3BO3A 1LWXA 3MECA 5CZVA 1WHVA 4A8OA 3CDEA 4WFYA 2DO4A 1D9AA 3Q22A 2H9ZA 1ZM3A 2F9JA 1FE4A 1BQMB 1FX2A 3DKDA 2H1YA 3RU0A 3OL6A 4R0JA 1K0VA 2CQDA 2W7AA 1R0AB 3NWGA 1YG0A 3AHPA 2NLWA 1EKSA 4JI8F 3PFEA 2XMTA 3AFGA 2MQMA 4WBFA 1RUSA 4KHPF 1WC4A 1SH0A 1X4EA 1PAUB 4DX7A 2O5DA 5EX3A 5DZ7A 4TYBA 3MM6A 3GG0A 3DOLA 3CE8A 4OZ3A 2UV8A 3TUJC 3H20A 4OMFG 2HAIA 5AXKA 3OFGA 5HQLA 4M63A 2W9BB 1BLUA 2VICA 3MM7B 1RABB 1HNXF 5FLXU 2DNRA 3AJ1A 1TK0A 4L73A 4GMKA 1M0SA 1TKDA 3DLJA 3M2VB 3UDLA 3HFKA 5IXUA 5ETTA 3VZHA 5H9FJ 4P75A 3QAEA 1HWIA 5HI7A 2JEFA 4S0MA 4DL7A 1T9VA 3D28A 3WZ0A 4O0NA 5T7LA 5E7OB 4JV1A 2B56A 4OI6A 2WVEA 3ZFVA 1N88A 3OUYB 2QTWA 2EKNA 5L9XA 4DR6J 1JK9B 3HX9A 2PC6A 2MZSA 3FQLA 1S10A 1B70B 2RRAA 3NG8A 3BM7A 4U67Q 2DNOA 4ED3A 5I42A 5KG6A 4Y6IA 3GSDA 3VCDA 3PHTA 2JLGA 2K06A 1PBAA 3HI9A 1IBLF 1ROFA 4KE5A 1JLFB 4Q2LA 1ZAWA 3VAHA 1FFSB 5HSPA 2DH8A 1TV6B 1S9GB 2IDLA 2KTQA 3RAQA 2CQCA 5H9EK 2HFSA 2KO1A 3CWJA 3TOQA 2G2ZA 4DZDA 1FRMA 5J2PB 1VI7A 3MMJA 2HS3A 3C14B 4ZMMA 1Z1ZA 1TK8A 1VQNS 3S01A 2U1AA 4BS2A 3IR7B 3CJ5A 4OX9F 2X7IA 1WD6A 2VUGA 4OV6A 2MZQA 1UVIA 2K7JA 4RZRA 2D3ZA 2HHHJ 4HTIA 1RZMA 3DRRB 2C22A 1FXLA 2GHWA 2XGQA 4KFBB 4K5SA 1HI8A 4IFVA 3NS7B 2ZC4A 2E5JA 3OFHA 3F44A 1V5IB 5EGYA 3KK1B 9ATCB 5CCLA 2XWYA 4QWCA 3LA0A 4NLXA 1V5VA 4WIQA 4ZVTB 1UEVA 2BBEA 1UWBB 2I2YA 1MWYA 2C2KB 3QT8A 4EU0A 2DXFA 4L72B 1XK8A 4WXWA 5A8WB 4M5JA 2OD6A 1RU2A 2W9CB 4IRCA 2VD3A 2DNGA 1IBMF 3DLKB 1Y11A 4DV4J 2LEAA 1ZOTA 3I0RA 3M2UA 2L41A 4RW6A 2WBRA 3VAFA 1S4FA 4Y34A 4ED7A 3MCSA 2RHQB 1RACB 4UOFA 4LFAF 4RUAA 1Q8BA 4M8LA 1UEUA 3KLGA 2DK2A 1XMOF 2MZTA 5F8MA 3H59A 3CCJS 4X4PA 4IKAA 4PCQA 2ZH1A 3RR8A 5KFQA 2EKYA 3KJVA 3EX7B 2H54B 2WVDA 5DLFA 1CC8A 4KPCA 3SIPB 1SKSA 2OPPA 1FDNA 1M1KT 1TKTA 5KFKA 5DM7Q 4I2QA 2MKJA 4K59A 2MLZA 3V81B 1T9XA 5HVFA 1NO8A 4LRBA 1CG2A 2MB0B 3OJSA 1JLEB 2XMJA 3ICLA 1S6PA 1TMMA 4USVA 2EFOA 1M5SA 3W3SA 2MYFA 5J1NA 1V6HA 4UQTA 1S97A 5KFMA 3KLEB 2Y1RI 4A8YA 1HPZA 3I5CA 3JTNA 1CJKA 2YKMB 4IO1A 3CUNA 4YN3B 1NPRA 2Y1IA 4MJKA 1JQGA 1Q7LB 3ZXWA 4B3SF 1KVIA 3DCAA 4DG1B 4RO0A 4WFBQ 3G82A 2GJ2A 2XGPA 2B4VA 4N77A 1NSAA 3S7RA 4WF9Q 3CCSS 2K2PA 2GC8A 2YKNA 3KG1A 1VQ8S 2O3DA 3CCQS 1NEEA 3UD4P 3LP2B 1X0PA 4DFMA 1HMVB 3FFIA 1YI2S 2DKOB 3DYAA 4F36A 1N52B 1N8RT 4Y2IA 4PKDB 3PX0A 4QIWD 5GAGI 2KKHA 3VAIA 1R6YA 1YBTA 1FWPA 2UUTA 3DGPA 3C15A 3FK4A 3HT3A 1KP6A 2IM1A 3NS6A 1VQPS 4Q8EA 1B99A 4KHMA 3HHLC 2B4UA 1A9NB 2ZNYA 4P52A 1RAIB 3HHLB 3QFHA 2FY1A 5B09A 3QJJA 2JH3A 4F4YA 1VQ9S 2CPFA 2D3OR 2W1BA 3RRHA 3W5ZA 1FA0A 1TTHB 3HT0A 1LEOA 2XZTB 2XZWA 4DN9A 3OHAA 5FIIA 4OX7A 3IBCB 3IG1B 4B3MF 1WG5A 1BQNA 3CNQP 2CQ1A 1KLMB 3L9ZA 2DNKA 3OXLA 2D41A 2M4MA 5ADZA 3J81j 1FCAA 2JFKA 1U02A 4QPXA 1U1PA 3UNGC 5LMUJ 2M7SA 1PSDA 1QJHA 2H3EB 1WI8A 2P9GA 2W2QP 1N0UA 4C4WA 2OMLA 1XJWB 2VONA 1HW8A 1GTEA 4DL3A 2ERRA 4LVOP 2MZ1A 3TI0A 4K50A 3O5TB 4A8SA 3W5XA 1RWNB 3BGRB 4ZVSB 2F4FA 3AODA 2BJ7A 4CLYA 1XNRJ 3FRYA 4RW9A 5HBMA 3KLIA 3QLHB 1GK8A 2GVZB 3FGVA 2CNKB 3CVKA 2LXFA 1KOHA 3R27A 2HNDA 2J8SA 2E7XA 2R9LA 4KC5A 1SC3B 2XSJA 1RHRB 4USKA 3O3LA 2W8KA 5K9FA 3BREA 1U8SA 2VFSA 2Z2ZA 4JI4J 3PKYA 4CH0S 3VGVA 4HT7A 5D77A 5CYQB 1FWLA 2HRTA 2RDIA 2Z8QA 3HKWA 3KOAA 1WHXA 2IAJA 3TW0A 2P6TA 2CQBA 2OUGA 2MJUA 1GXUA 4GVBB 3QFWA 3GIKA 1NHUA 3EVWA 3OLAA 4QR2A 1C0TA 1WEYA 2BJEA 4RU9A 2XNQA 4NMXA 1SJ4P 1CJVA 4CLWA 2AYGA 4QU6A 4HEA9 4CT8A 1T11A 3RW6A 1Q8LA 5E5NA 5HROB 4QWEA 4U96A 3GV7B 3X3UA 1S1TB 3F56A 2HBRB 3GFXA 2KXNB 2LECA 4DBQA 2MGZB 4PWDB 1FXRA 2Q43A 2ABYA 1OPZA 2J76E 3DOMA 3BBCA 2MKKA 2G13A 4DR4F 4X65J 2YNGB 1RAAB 4QIFA 2AIRB 2ZKTA 4RBUA 3KFWX 2HHHF 3SZ2A 2AJ1A 2XLIA 3R1LA 4NCGA 4GKJF 1Q0NA 1UKUA 3R7SB 4KTQA 3NMRA 2BX6A 4Y2CA 1U1OA 3ILJA 2CQHA 1B7FA 4QIVA 2ZH7A 5KFGA 1S6UA 3ZZZA 3MOZA 5KT7A 1PGZA 3HD1A 2V4RA 4C6AA 3TA1A 4WYLA 2FVPA 2GX8A 3IRXA 5G4DA 5THWA 4IOCQ 3DM2A 3EUNA 1TAUA 3QMQA 2W01A 3L7PA 3DHXA 4C3MA 5KFXA 2LQ8A 1GMUA 1YJNS 2YX7A 2HFOA 2VKRA 3PY8A 2CQGA 1WF1A 2DR7A 2ZFHA 2PMZD 3UVJB 1ZM9A 2XQCA 1F2GA 4C3LA 4P10A 2DPIA 3MPVA 2JOQA 4YDDB 4M1KA 4X4SA 2B5JB 5FJ4A 2PFDA 4KGXB 2BM0A 1VISA 2YNIA 3DGVA 4RKUC 2HGMA 3NWRA 3JAMU 3KNGA 3EICA 3BQ0A 3MM8A 5CD4H 2YKAA 3FSIA 4JV0A 5HK4A 4C8LA 4W90B 3JQJA 4ZP7A 3DRPA 1SUQA 3FCVA 5DDRC 5F8HA 2XBPA 4Z37A 1H73A 4NLYA 1AROP 4ID5A 2V94A 1SBRA 1N4LA 1SJ1A 4KGZB 2J6TA 1UVKA 1TQLA 3PDNA 1IKYA 4LBPA 2UUAJ 3NXZA 4WU3A 1SI9A 4MIBA 4RPFA 3JSRA 2J9DA 2XCPA 1S1XA 3UDCA 2BMBA 4RR5A 5D4PA 5CD4A 2R2SA 1UEKA 1RTDA 2R7OA 1FFGB 3R9LA 3V6KA 3OSPA 5IS2A 2POKA 3T3FA 2HHVA 1N36J 2CPXA 1RHUB 3ZZUA 1RAGB 2PMWA 2R7TA 2H65B 2EC2A 2XEXA 2NYIA 5AXLA 4Y65A 4QBUA 2BEFA 2B9XA 3SXLA 4L3NA 4H4OA 5JJBA 1T03B 2IM3A 1O0PA 2XG8A 4IQXA 5LSOA 2WVCA 2UXBJ 4A8KA 2FVSA 2A2CA 3RYLA 2HIQA 1FTRA 4UZCA 3GYXB 3Q89A 1JLAB 4K4UA 1GX6A 4CLUA 1REVA 4F3QA 2EW9A 4ED6A 2PIIA 2ZBIA 1NUEA 4ZITA 2GAHC 2CPYA 3GWCA 1WEZA 4RW7B 1HL6A 4HI1A 4GC7A 4WU2A 1RA6A 1AFIA 1B3TA 1FI4A 1EX8A 3EGVA 3NP5A 3TA0A 4Z7CA 2DY9A 3IBWA 1YITS 2Z0GA 2FZGB 4ZPCA 1VCTA 4IH5A 1IWGA 2E9ZA 1EJ7L 4A8MP 2NS1B 4ETZA 6FD1A 3R2CJ 5B0FA 1G3OA 1HNZJ 3T9NA 1JWWA 3QSIA 4MT1A 1S1VA 4URGA 1H72C 1U45A 4FYXB 2A2DA 4L74A 2PGCA 4V1Ak 3QBCA 2EEYA 2QG9B 2KL8A 5LMUF 3QWUA 4HHHA 2GMJA 1IKXA 2FLNA 2AWZA 2DR8A 3E2EA 3A4TA 2CJAA 2JDJA 1N6QB 5AT1B 2OTJS 3TAPA 1Y5LB 2F8MA 3MEKA 4XIUA 3PIOQ 2RRNA 2LQJA 2GO8A 2YQ1A 3I32A 3IWXA 4ECWA 4B02A 2R8GA 3H7HB 5D0RA 4KAIA 4K4WA 4B9TA 4V19X 1VQ5S 3M32A 3ZZOA 5KFVA 4MKVA 3E01B 3QGIA 5GAEI 1P27B 4TXSA 3IMQJ 2VG5B 2ASLA 2XS7A 1NDLA 1UJ6A 3TJ8A 2KU7A 5HAOA 1EIYB 3BYPA 3J81U 2C3PA 1U48A 2DH7A 4M5IA 2V2ZA 3G86A 1FNMA 2DRDA 4ZIVA 1EP4B 1VFJA 2N7CA 2BKNA 3PO5A 3U1NA 1VIOA 1EZZB 2DEJA 3QRQA 2OD4A 1DQ9A 4PZVA 3IXQA 3LF0A 5FD1A 1WEXA 2DNPA 2ZD1A 1VLYA 2VQEJ 5DGBA 2RF2B 2R7VA 4F7VA 5GAHI 3DMJA 2HMIA 4LQ3A 2OEMA 1VC5A 1FEEA 1TVRA 4J9NA 3MXHP 3M9NB 2B8QA 1UW4A 3KJQB 1N5YB 1NKBA 1JLCB 3R5CA 3TR5A 2VFVA 6AT1B 4WTOB 5E3PA 3TAMB 4KB7A 3QO9A 2AJQA 2AJ2A 3CPWR 1I5OB 4JBCA 4U95A 4ECSA 4KH1B 3T5KA 1RISA 1RT3A 1B0TA 2HHUA 4ICLA 1HQEB 3GPAA 7FDRA 1HBUB 4DV7J 3C16B 1T05B 2JVOA 1BGXT 3MPYA 1H98A 3BH7B 3E3XA 2AHOB 3HVTB 3MDFA 3CTRA 4B08A 3MEDA 2C42A 4DLEA 1UJ4A 5D78A 1WWHA 3DRXA 4ZK7M 3H5SA 4DPTA 2DNHA 4PEOA 3W2WA 2MHEA 2AEJA 3BKTA 4HHUA 2NUHA 1FT8A 3CO9A 3J7YU 2Q1LA 4X62J 3DHWC 2UVVA 3GJSB 2HAFA 1REGX 2AJFE 1JLGA 1DJ0A 1GXLA 3DRSA 4HTJA 3MWBA 1YZ6A 1LWEA 3PYGA 3MR5A 3SMZA 3ENWA 4LFBF 2DHHA 5K14B 2FGCA 3OR2B 4XO0A 2KHCA 5KFCA 3LP0A 4JI7F 1RU1A 3GP9A 3MZIA 5AJ3F 3OVAA 4DPOA 2CNOB 2R7RA 4MYUA 1UW9A 3T6BA 2FJBB 1RT5B 5CYMB 4UOCA 2AV5A 4X4TA 1MWQA 1IKVA 2M0GB 3I5AA 1HNVA 3H42A 5B0GA 1DZ5A 4OHYA 2RNEA 2HS4A 2NXEA 3KK2B 1ZTWA 3CC4S 1DTTB 3TQ1A 5ETOA 5D6GA 3HHDA 1RXOB 3BBBA 3VVUA 2BA9A 1WDTA 4MTPA 3IWLA 3ENQA 3AY0A 4P7TA 3VAJA 4CWBA 1H74A 4WP8A 2B7CB 2OHDA 1TZ0A 5B0DA 5EN1A 2OGUA 1VRTB 3W63A 2UVWA 4O4GB 4LF6J 4K4SA 1W25A 4MK9A 1QSLA 3MURP 3N79A 3RTVA 4ERDA 3M8SA 4NLRA 2DYAA 3LOUA 2HQGA 1X4HA 3DI6B 1B0VA 1JXLA 2XULA 3GG1A 4LRCA 2AKWB 3KHRA 1S5ZA 2PA3A 5D4LA 1HQUA 1IVZA 1NK4A 1VBKA 4NXMJ 1T3NA 4ECRA 3JQMA 1IR2A 3PZPA 2A1BA 4LSLB 3MM5B 5J2NA 2ZUGA 4ETXA 1IM6A 1X4FA 3Q8RB 2W9AA 1C1BA 4ZN3A 1T0TV 5JMNA 1N36F 1KLNA 2LCWA 3KJNB 3MMAB 1KSPA 5H9EJ 1PIEA 1FJGJ 1OJ4A 2FPHX 4CRJA 1YJ9S 2MHNA 3WBZA 3B6BA 3ZO7A 2DITA 4E8UA 2E1PA 2YPZA 2RILA 4EGLA 3GCXP 3NEKA 3K8VA 5DG9A 4DSFA 3T1HJ 2IBOA 1HYSA 2QRRA 3MEGA 2VPWB 2E5LJ 4E98A 5A0YB 4ENOA 3K5LA 4FDFA 4Y2MA 1G6BA 4G1QA 5HLFB 4U8YA 3D54A 1TKXA 3QGHA 1KFDA 1NNDA 4QYZK 2G1HA 4GKKF 4A46A 3CDAA 3HM9A 3BGFA 2JEIA 4DPYA 3HHKA 2W7OA 2PT0A 2XY7A 1CJTB 2YWFA 3CXCR 1U7LA 4USWA 1WHWA 2VQFJ 4EBDA 1S4EA 4P72A 2YVSA 2CJ9A 3QJPA 3SFUA 4NLOA 2DTJA 2JHEA 4HKQA 4ZVOB 1RADB 3MMCA 1C1CA 1MWZA 2XMWA 3K8WA 2HFZA 1X4CA 3GFZA 2UUWA 2B43A 4DSKA 5G0RB 4WK3A 1K73T 2LXIA 2NXJA 3KUGA 1IR1A 1HNIA 1HNWJ 1K1QA 5T41A 1HI0P 3LW5C 2JC1A 1FRXA 3KLFA 5HP1B 2Q79A 1FK9A 1H38A 2B6AB 4OL8A 1IWAA 1N0VC 3TEHB 3AD8C 3ZTOA 3TEGA 2R7QA 2V8GA 1NK0A 1R8PA 1YBAA 2IPOB 1J5OB 2L9NA 4ZVRB 3IR5B 2LQBA 4I4BA 2OPRA 2VODA 2VG6B 2AYMA 5K20B 3MAAB 2DHXA 2ASYA 2EK6A 2DNNA 3BPDA 1TFWA 2IC3B 2DCUB 2LQ5A 2MPUA 9RUBA 4Y2KA 3CCVS 5J1PA 4KRWA 1Z2ZA 2OEKA 4K2XA 4H4KA 4OHWA 4YUDA 1HWUA 4KIAA 4IO9Q 3MUMP 2R2RA 2CQPA 3C6TB 2R7XA 3MOJB 4Z2XA 3DOKA 1MN7A 4G6VB 4CO3A 3C8YA 4DPXA 1BWVA 3PO4A 2RQCA 4B9NA 1DARA 1RTHB 3THVA 1Q82T 4R0EA 1BQMA 3WQPA 3G87A 1AYEA 2OO4A 2MQQA 3CJ4A 1XNQJ 3ITHB 4IUFA 4P71A 4J9OA 4RWXA 1F5CA 2QIFA 4USJC 4C8MA 5F0WA 2G1DA 3OW2R 1HBMB 3FZBA 1Z2LA 2X1FA 2YTCA 5LJ3Y 2PEBA 5C2CA 3LP1B 1XBWA 5KFRA 2EFPA 2GMHA 4CTAB 2W9BA 2R8IA 3MM7A 3C6UA 2MKHA 3HKZD 4RW4A 1NU4A 4DQQA 4NLGA 1WKJA 3M2VA 3V6JA 2GFFA 4IG0B 4KHRA 2E9RX 3MM9B 2F8EX 2QV6A 4U6PA 4W4MA 1CJUB 4HDGA 1S9FA 4JV5F 3OT9A 2ZH8A 1BUXA 1RT6B 1NZ8A 5A8RB 1BQXA 4YY3F 2QZ8A 1L3KA 4PG5A 1FE0A 4O0IA 4QW9A 3V6HA 1Q81T 2AYBA 3N5BA 3OUYA 1RLDA 1S6OA 1U24A 2P5VA 4ZJOA 3SV4A 3N6LA 3O6QA 2ZBRA 2CPEA 2EVZA 4IH6A 4OZ5A 2W7PA 4JI1F 1TUVA 3JTOA 4LSNB 3AOCA 3N6MA 1UPMB 5B7WA 2WB1D 4G3IA 4DEZA 1AT1B 3VVTA 1TV6A 1S9GA 3HO1A 2PE8A 2QSWA 1ZYQA 3GYNA 5B0AA 2EG2A 4KSEB 2Y0BB 3IBFB 3OTEA 2GIQA 1RWMB 1FF2A 4WZQA 1T3OA 3NLCA 5HMXA 4OJ1A 2PSZA 2V9KA 3ET6A 5BJRA 1RAOA 2ALZA 4ED5A 4B3TF 1XIQA 2XHCA 3ILOA 2DR9A 2C3UA 1SKRA 4FN5A 5CXTA 4EEYA 1T9WA 3ILIA 1HFEL 3LAKA 2VBXA 2DNLA 3DRRA 4ZA1A 5D15A 3ELHA 4LF6F 3HFVA 1QTMA 3K2YA 5ETLA 3KK1A 4DDFA 2NXNA 2MKCA 4OYBA 1NH7A 1OSDA 4WWSA 1KEKA 2CDQA 4M5LA 2UUCF 4DU8A 3GV5B 2BQ3A 2YX1A 2RU9A 2Z57B 2V4JB 1JX4A 1JXVA 1LXJA 3I9V9 2BJ1A 4F8RA 1UWBA 1YLXA 4NWBA 1QDUB 2CYYA 4YEAA 1ELOA 2C28A 2W9CA 2MZRA 4DCPB 4C7QA 3DLKA 3CD5A 2DT9A 3VGTA 1GQEA 5EX0A 2GAGC 3NCRA 3C46A 4Y0FA 2KVQE 4NEYA 4DPWA 4O44B 2OLWA 2X51A 1FRJA 2IJFA 3A12A 2MSTA 3SSSA 4I7FB 4DUZJ 1TAQA 2V69A 2XM3A 4LF5F 1AW0A 4OJGA 4IH7A 5KFNA 5L1LA 1FJGF 2W2OP 2J9DE 2FZCB 1RTZA 4W92B 2R7SA 3W61A 2XO7A 2XS5A 1ACMB 3EWGA 3RBXA 1IKWB 2V63A 3UWTA 4IOBA 1NLKL 2Q6BA 4UUXA 1JLBB 3W60A 3ULHA 4F4AA 4IG3B 1SJRA 2XMKA 3IWNC 1T9TA 1Q95G 1R0BG 1S12A 2KZMA 3R5BA 3V81A 4L6V3 1LKZA 4ATNA 4J9LA 4TVAB 4CYUB 1L3SA 3MFIA 3A8IA 1RHKB 4A8FA 1H2UX 3V4IA 3JAMY 1WDDA 1EKRA 2DO0A 3DLGA 1IJEB 3CW2C 2BDPA 3FBBA 3IM8A 1XC9A 3GB0A 2D69A 3U1LA 5KFBA 2CPDA 2WRMA 3KLEA 2LDYA 4DX8H 1RA7A 3P5TL 2GGPB 4ZPTR 3CCUS 2EFNA 5DQGA 1S72S 2OFHX 4U7CA 1H6KX 2P9EA 2WB4A 4IOAQ 4DG1A 5KFSA 2DPJA 1NZAA 2HNZB 2RSQA 2ZITA 2K3IA 4P6QA 2R2UA 4RUBA 1FDBA 3V5RA 1CQNA 1R8HA 4PG8A 1AUSL 3V6DB 5F41A 1JKHB 3MM6B 4PUOA 3BGOP 4ZHRB 3DOLB 2UU9F 4OYIA 3HZEA 2ZE2B 2ZUAA 2ZEJA 1ZBTA 2QA4G 3CCLS 3LP2A 2RAQA 1NJWA 1NH8A 4HYKA 1HMVA 5HL7Q 3Q8SB 2FVQA 4DUYJ 1SB6A 1V3SA 2HQCA 3NMAA 5HMZA 2NR0A 3TWZA 3QATA 1VQYA 5HQ8A 1C0UB 1JB0C 5E3CA 2HVHA 3EDRB 3KJFB 2E44A 2XWXA 5IZHA 3L7UA 1SIWB 2ZH4A 5L1JA 1PBUA 2MMYA 1VQ7S 2R7WA 3ILLA 1LWFB 2VF3A 3DU5A 2QA2A 3HHLA 3PYEA
chains in the Genus database with same CATH topology
3BBBA 3G2XA 2HVEA 1MN9A 3VGSA 3VVUA 2NCKL 1BHNA 3EJMA 3JS9A 3Q83A 1ZS6A 4ANDA 3PJ9A 4DI6A 3BBFA 1UCNA 3ZTSA 1XIQA 4HR2A 1U8WA 1B99A 4FKXA 3ETMA 4C6AA 1MN7A 3B6BA 1KDNA 3NGSA 1BUXA 3Q89A 3ZTPA 3B54A 5BXIA 1B4SA 1HHQA 4UOFA 2DYAA 1NB2A 3EM1A 1PAEX 1EHWA 1NSPA 3FBEA 5CAAA 1NCLA 2CWKA 2B8QA 1LWXA 2DXDA 3DDIA 3FCWA 3ZTQA 3BH6B 1NSKL 3ELHA 4FKYA 4S0MA 4ENOA 1NUEA 3VGUA 3PRVA 1NLKL 1LEOA 2HVDA 5CABA 1NSQA 3ZTOA 4O0NA 4ANCA 4EK2A 1NDCA 2DXEA 2ZUAA 1S5ZA 1BE4A 4F4AA 3FC9A 1W7WA 4ANEA 3Q8YA 3BBCA 3DKDA 3Q8VA 1NDLA 3GP9A 4UOHA 1F3FA 1S57A 1WKKA 3EVMA 3NGRA 1XQIA 2DY9A 3Q86A 2VU5A 3R9LA 4CP5A 3EVOA 4KPCA 1PKUA 4DUTA 3NGTA 3MPDA 4UOGA 1NDPA 2AZ3A 3Q8UA 4W98A 3VGVA 3ZTRA 1JXVA 1HIYA 3GPAA 5IOLA 3FKBA 1S59A 4WBFA 3EMTA 3ENAA 3EE3A 1F6TA 3VVTA 1NHKL 1VYAA 3BH7B 4DZ6A 3L7UA 2AZ1A 4F36A 2BX6A 3EICA 3WX8A 3VGTA 1NPKA 2B8PA 2BEFA 1NDKA 1HLWA 1WKLA 3FBFA 3FBCA 3FBBA 5C7PA 1WKJA 3NGUA 2HURA 3EVWA 1K44A 3FCVA 2DXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBB A;  3G2X A;  2HVE A;  1MN9 A;  3VGS A;  3VVU A;  2NCK L;  1BHN A;  3EJM A;  3JS9 A;  3Q83 A;  1ZS6 A;  4AND A;  3PJ9 A;  4DI6 A;  3BBF A;  1UCN A;  3ZTS A;  1XIQ A;  4HR2 A;  1U8W A;  1B99 A;  4FKX A;  3ETM A;  4C6A A;  1MN7 A;  3B6B A;  1KDN A;  3NGS A;  1BUX A;  3Q89 A;  3ZTP A;  3B54 A;  5BXI A;  1B4S A;  1HHQ A;  4UOF A;  2DYA A;  1NB2 A;  3EM1 A;  1PAE X;  1EHW A;  1NSP A;  3FBE A;  5CAA A;  1NCL A;  2CWK A;  2B8Q A;  1LWX A;  2DXD A;  3DDI A;  3FCW A;  3ZTQ A;  3BH6 B;  1NSK L;  3ELH A;  4FKY A;  4S0M A;  4ENO A;  1NUE A;  3VGU A;  3PRV A;  1NLK L;  1LEO A;  2HVD A;  5CAB A;  1NSQ A;  3ZTO A;  4O0N A;  4ANC A;  4EK2 A;  1NDC A;  2DXE A;  2ZUA A;  1S5Z A;  1BE4 A;  4F4A A;  3FC9 A;  1W7W A;  4ANE A;  3Q8Y A;  3BBC A;  3DKD A;  3Q8V A;  1NDL A;  3GP9 A;  4UOH A;  1F3F A;  1S57 A;  1WKK A;  3EVM A;  3NGR A;  1XQI A;  2DY9 A;  3Q86 A;  2VU5 A;  3R9L A;  4CP5 A;  3EVO A;  4KPC A;  1PKU A;  4DUT A;  3NGT A;  3MPD A;  4UOG A;  1NDP A;  2AZ3 A;  3Q8U A;  4W98 A;  3VGV A;  3ZTR A;  1JXV A;  1HIY A;  3GPA A;  5IOL A;  3FKB A;  1S59 A;  4WBF A;  3EMT A;  3ENA A;  3EE3 A;  1F6T A;  3VVT A;  1NHK L;  1VYA A;  3BH7 B;  4DZ6 A;  3L7U A;  2AZ1 A;  4F36 A;  2BX6 A;  3EIC A;  3WX8 A;  3VGT A;  1NPK A;  2B8P A;  2BEF A;  1NDK A;  1HLW A;  1WKL A;  3FBF A;  3FBC A;  3FBB A;  5C7P A;  1WKJ A;  3NGU A;  2HUR A;  3EVW A;  1K44 A;  3FCV A;  2DXF A; 
#chains in the Genus database with same CATH topology
 4X84 A;  3TA2 A;  2ZDP A;  3D66 A;  3JS9 A;  2DGW A;  4TY8 B;  3EYZ A;  2LVW A;  1GT8 A;  3TP2 A;  3TAR A;  2HKE A;  2QL5 B;  2MY7 A;  5CYJ A;  5F8I A;  1SCJ B;  2BVZ A;  4JI8 J;  2QEX S;  5EUH A;  4ILM A;  2LLZ A;  4ECU A;  2V8V A;  1NB2 A;  2YXL A;  2IFX A;  1PAE X;  1EAR A;  3JYT B;  2I9S A;  2CWK A;  5KG5 A;  1KLM A;  4Q43 A;  3I4H X;  1ZPV A;  2GJF A;  3G8Q A;  5L1K A;  2KN4 A;  3M05 A;  2I1R A;  4JI3 F;  3UN2 A;  2ZOF A;  3PIP Q;  1F60 B;  1FEH A;  4J9P A;  2V34 A;  3EVM A;  3TZX A;  1NJZ A;  5EWG A;  3GON A;  3TZY A;  4PXE A;  4F4W A;  5F9N A;  5HJY A;  5F3Z A;  4LRD A;  2J0Q D;  1NDP A;  2OP5 A;  2B9W A;  1Q16 B;  2HK2 A;  3GTY X;  2NSC A;  4FBU A;  4RJV A;  1VC6 A;  4DX6 A;  1QVG R;  1K0T A;  3B78 A;  3BGR A;  5C7P A;  2E7V A;  3BN7 A;  2NYH A;  2Q3P A;  1HWL A;  3PHE A;  3QLH A;  2GVZ A;  3US5 A;  3H8Y A;  4FS2 A;  3IRW P;  2XY6 A;  2QC3 A;  3H40 A;  4WII A;  1V3R A;  5ETS A;  3B82 A;  1TL4 A;  4CI0 B;  4H54 A;  1VHF A;  2EFQ A;  2C2E A;  4WFA Q;  3Q24 A;  3ZNU A;  5IM0 B;  3A3P B;  2R8J A;  1EET B;  2V9W A;  1IBL J;  2Z56 B;  3BSN A;  1KQF B;  3EGN A;  5BYQ A;  3IC1 A;  2BQU A;  1SXL A;  2V8D A;  3EDQ B;  5CYQ A;  2Y0S D;  4XPE A;  1NKC A;  4KGM A;  2FD2 A;  5LMN F;  3HSG A;  4CH1 A;  4RW6 B;  4FNI A;  2AJ4 A;  3QQC D;  4GC6 A;  4DFJ A;  3N6N A;  1Y0H A;  3TX0 A;  3HDS A;  5DO2 A;  1YJR A;  1NK9 A;  2BW7 A;  2RQM A;  1QD1 A;  3D4J A;  3BGL A;  2H51 B;  1A0O B;  4OX9 J;  4WPA A;  1U4B A;  4I6Y A;  3I82 A;  4DSI A;  1RWK B;  3RAX A;  4MIA A;  4RNF A;  5A2Q U;  5EHH A;  5HRO A;  2DGV A;  2J7W A;  1QTN B;  3LH2 S;  5KFJ A;  5JVH Q;  1LQ9 A;  2FVC A;  3EZ5 A;  3O8W A;  4LF9 F;  4CIO A;  3B54 A;  2MGZ A;  1X9S A;  3HP6 A;  5KFL A;  3M8P B;  1NCL A;  2YNG A;  1X9W A;  3IFE A;  1KC8 T;  1U0H A;  1WOS A;  1TL7 B;  2A18 A;  4M5D B;  3K58 A;  4PRF A;  1DBD A;  5IFM A;  4Q7A A;  3H5X A;  4DQI A;  4LT6 A;  1HR0 F;  1FJ7 A;  1D09 B;  2RIJ A;  3VAK A;  1VRU B;  3K5P A;  2HEK A;  4C8N A;  4CO1 A;  4DQR A;  1ZH5 A;  2KYZ A;  1F6T A;  3KLV A;  3T1A A;  3DU6 A;  2ZM6 J;  4ECX A;  2LEP A;  3D6M B;  4DLG A;  4UW2 A;  3W5Y A;  3LPY A;  1X31 C;  2AYE A;  3M2R B;  1XMO J;  4MMO A;  2DEI A;  2J5A A;  2DGS A;  1TL1 B;  1F9F A;  3WHI A;  4ZLN A;  1VS3 A;  2MJN A;  3EJM A;  1N33 F;  1ZS6 A;  3U1M A;  2RS2 A;  3M6U A;  8RUC A;  3FSY A;  4LSZ B;  2FHJ D;  1DRZ A;  3R7N B;  3N4W A;  2V8H A;  1VLO A;  3GFY A;  3UVJ A;  1B4S A;  1RWW B;  4I56 A;  3BR8 A;  4DXL A;  4O3O A;  4A48 A;  1S9E A;  2B5J A;  4LRA A;  3GR1 A;  5CAB A;  5HQM A;  1GMW A;  4ZCK A;  2O01 C;  2P6S A;  3BSA A;  4B9L A;  4DR2 F;  2DGU A;  3OVB A;  1RWU A;  3A3N B;  2MQL A;  1M5H A;  2ZHA A;  1S0V A;  2V67 A;  1NAQ A;  1UFK A;  3UR3 C;  2AP6 A;  3EMT A;  1FES A;  3POT B;  2BAB A;  2P2C B;  5F3T A;  2YPY A;  3MCN A;  1RQ0 A;  2FTR A;  2QL7 B;  2NQP A;  4B3S J;  1RYR A;  5T14 A;  1QE1 B;  2CA9 A;  1BQN B;  2NCK L;  3RB4 A;  2DGO A;  4USI A;  4LIR A;  3SCK E;  3CSK A;  1RT1 B;  4DF4 A;  2VDH A;  4X4O A;  2DY1 A;  3DC2 A;  2RDD A;  3EPI A;  1GAO A;  3PRD A;  1S6Q B;  2UUB F;  1WOP A;  4TU7 A;  3N5F A;  4ZCM A;  4LBI A;  2WON B;  2MQN A;  4MIW A;  3FC9 A;  1FFW B;  2IJN A;  4JP8 A;  4ZVF A;  4ES1 A;  1NM2 A;  3NGR A;  3TJ9 A;  4FF1 A;  1G4C A;  2P8I A;  3R3T A;  3OL8 A;  4NLP A;  4UY8 T;  1S1U A;  4LF1 A;  2E1A A;  1R7I A;  2WVB A;  5HBM B;  2ZWP A;  4ELT A;  1T03 A;  1D9F A;  1WSV A;  1SH2 A;  2W4P A;  3BO2 A;  4AL5 A;  4I64 A;  2MTL A;  2VFT A;  4OJ3 A;  4DL4 A;  1JLA A;  5IV4 A;  5KAK A;  4PQU B;  4B3M J;  3CC2 S;  1WOO A;  3TZW A;  4FKX A;  1X9M A;  2RDJ A;  2XLJ A;  2JZ5 A;  3ZTP A;  5C25 B;  2E9T A;  1QAI A;  4RW7 A;  1NSP A;  3K5N A;  5CZX A;  3BH6 B;  2YNF B;  4PWU A;  1FKO A;  4DR7 J;  3TUI C;  4I1T A;  1VQK S;  3GCW P;  1LK5 A;  3SYZ A;  4UQG A;  5DRK A;  4GRS A;  4ZLJ A;  2FY8 A;  1K1S A;  3H4D A;  3ZZR A;  1L5U A;  4F4X A;  1D8Z A;  1YQH A;  2V2V A;  5E33 A;  1PC4 A;  4MKY A;  2LFV A;  1H2T Z;  3PJX A;  4ZIW A;  1HBO B;  4CM0 A;  1DY3 A;  4HL9 A;  4OYW A;  3LTO A;  3R8Y A;  1XMQ F;  1TUG B;  1CEZ A;  1N6Q A;  1R8B A;  4LFC F;  1J27 A;  4DV5 F;  2LKZ A;  4I2P B;  3OFF A;  3R6G B;  4ED0 A;  3W8P A;  4Y3C A;  5IT9 U;  1U1R A;  3P3D A;  3AOA A;  1M5V C;  1IJF B;  1KDN A;  2R8H A;  2ILY A;  2UXC F;  3UQS A;  3G8T A;  2ZVS A;  4MH8 A;  4ED4 A;  3TRG A;  1SV5 A;  3I96 A;  4JI0 F;  4DN0 A;  4FPI A;  1Q7Y T;  3C19 A;  3BB5 A;  1NDC A;  4OYM A;  2ZH9 A;  1E6V B;  3PJW A;  1W7W A;  1J5E F;  2GML A;  1N48 A;  2H48 B;  3TX8 A;  3HSD A;  1EP4 A;  3TQE A;  3HFZ B;  3EGZ A;  3IRX B;  1D3W A;  1PYO B;  4ZP8 A;  3HF5 A;  3R5J B;  2D74 B;  3BKF A;  3SQG B;  4YR3 A;  2ROE A;  1JNR B;  4WP9 A;  2DH9 A;  2J0S D;  4A4J A;  4B17 A;  3MR2 A;  2CJY B;  1LFP A;  1RP5 A;  4EFA C;  1KBR A;  4BC7 A;  2BJ9 A;  5GVQ A;  2WW4 A;  1RT7 B;  1I6J A;  4HAC B;  3E8O A;  3UCZ P;  1U0S A;  4R8U A;  3SCL E;  4LIW A;  4NLW A;  4DR4 J;  3JSM A;  1N5Y A;  3ETM A;  2GJI A;  3NGS A;  1QSY A;  2WOM B;  3H5U A;  4X4Q A;  1RT2 B;  3TAM A;  3KLH B;  2RB7 A;  3KHH A;  4YB7 A;  4NYZ A;  2DIS A;  3KWM A;  1MSW D;  1NRK A;  3FZ2 A;  1ULR A;  4GKJ J;  2W25 A;  3RBZ A;  3KNA A;  3HVW A;  2MKY A;  3AB4 B;  3N28 A;  1KWM A;  3PRV A;  3H98 A;  1HQE A;  4QCL A;  2X1B A;  1HBU A;  4CLL A;  3C16 A;  2CJB A;  1T05 A;  5F8J A;  4ZLL A;  1WSR A;  1OWX A;  3HVT A;  2C3O A;  1GFW B;  1HBN B;  4CP5 A;  3PKM A;  4LR8 A;  4PXC A;  2IRX A;  1M1H A;  4IDK B;  1Q5Y A;  3GJR B;  1PYS B;  2NPF A;  2ZH2 A;  3M30 B;  4F26 A;  1X0F A;  2KJW A;  2ZM6 F;  3T1Y F;  5I3Q A;  2AW0 A;  4OLO A;  2MZJ A;  4QPT A;  3CME S;  3BSO A;  3QRP A;  3OR2 A;  4BBY A;  3CJ2 A;  1YJT A;  1ZM4 A;  1DTQ A;  2B9E A;  2GQC A;  2IYI A;  1U25 A;  2DD8 S;  2EI5 A;  3OTB A;  5AE1 A;  4R5P B;  3CO0 P;  2PI4 A;  5C5J A;  2YWE A;  2N3O A;  3RAM A;  2BAC A;  3DLE B;  5F8N A;  4O3P A;  5ETN A;  3H2U B;  3CGI A;  2CZ4 A;  2KFZ A;  5CYM A;  4FBT A;  3Q86 A;  6FDR A;  3W1Y C;  5E3Q A;  3DLH A;  2KDO A;  2BJ8 A;  3HHN B;  2WTF A;  1DTT A;  5L9N A;  2B4O A;  1EB0 A;  2V6A A;  2XY5 A;  3UDE A;  1JLQ A;  3IM9 A;  1TL5 A;  1TK5 A;  1VRT A;  4NE9 C;  2L9D A;  4NA1 A;  3QT6 A;  1K44 A;  5F9L A;  4NI2 B;  1N56 A;  2VC0 A;  1F9H A;  3Q0A A;  2HLU A;  4FP9 A;  4RW8 B;  2E1C A;  1WAC A;  2PN6 A;  1R89 A;  3J80 Y;  1FKP B;  4OZL A;  3A1Y G;  2J8A A;  3NS5 A;  1U1N A;  1MW7 A;  3I0S B;  3VZI A;  3HCX A;  2I5J B;  3GJQ B;  4DSE A;  4GO7 X;  3G71 S;  1N5S A;  4FXW A;  3HVA A;  3MCM A;  3D67 A;  3CT9 A;  1RKI A;  1EQM A;  3GIJ A;  4IQM A;  4A8W A;  4LSL A;  3QT5 A;  1IKX B;  2YQ0 A;  4B3O B;  4LMZ A;  2L9W A;  2DCL A;  3CIZ A;  4FYY B;  3TVY A;  2RE1 A;  2KG1 A;  1P1T A;  2CJK A;  2DR5 A;  3MMA A;  4P2X A;  2KZZ A;  3M7V A;  5KFT A;  2A6O A;  2O1P A;  3EE3 A;  1URN A;  1PCA A;  2DNZ A;  1Y10 A;  1YRX A;  1YX2 A;  5J1E B;  3IP0 A;  1RI7 A;  7FD1 A;  3G9C A;  3I9Z A;  3OL7 A;  1D9D A;  4XDC A;  3HJV A;  1AZS B;  2BUN A;  2A3J A;  3Q8P B;  3F0N A;  5A0Y A;  1KQS R;  2EC0 A;  2IRY A;  1Y9O A;  2C2R A;  2G2Y A;  1LWC B;  2ZVI A;  4U8V A;  1XER A;  2XMM A;  2LU1 A;  5AXN A;  2RU3 A;  3HLU A;  3QYY A;  2BAN B;  2K1R B;  4A8X A;  3M8W A;  1SC6 A;  2WCX A;  1CJT A;  2P9C A;  3L3C A;  4PG6 A;  3VHQ A;  2ZD1 B;  1HA1 A;  3E51 A;  1RYS A;  4DR7 F;  2XI3 A;  2E5H A;  3PTW A;  2AX1 A;  4ZPA A;  3BZQ A;  1V9O A;  3G6Y A;  2BQR A;  4AYB D;  1SPB P;  3LQV A;  2DGX A;  3GMG A;  4J5O A;  3CJK B;  2FC8 A;  1A6L A;  4ILL A;  4BCA A;  3OTO F;  5KFI A;  1GX5 A;  3KYL A;  5G0R A;  3OFE A;  2OEJ A;  5HN0 A;  2LA6 A;  2X1A A;  4HI2 A;  1L3V A;  3K0J A;  1X4A A;  4E0D A;  1P9Q C;  5L38 A;  2WSE C;  2GO9 A;  5D8H B;  2DIU A;  2AGP A;  4URQ U;  1LFW A;  2B6A A;  1S1W B;  3IA0 A;  5KT4 A;  2LEB A;  1N54 B;  3AAW B;  2E1M C;  1SJ3 P;  1J5O A;  2HNY A;  2QLF B;  3HHL D;  3HMJ G;  2EBE A;  4N5S A;  3MAA A;  1Q53 A;  3W2W B;  2IC3 A;  1H2V Z;  2M2B A;  4CDI A;  3BJY A;  4QIE A;  2V5H G;  3ETO A;  1OPI A;  4G65 A;  3HHE A;  4LUB A;  2D9P A;  3DFE A;  1MU2 B;  2DHG A;  3O2I A;  1K8A T;  1FRL A;  1XN9 A;  3DRS B;  1XR7 A;  2Y8Y A;  3W8G A;  4YHH F;  1UPP A;  4DL5 A;  2KFY A;  2JEG A;  3OVS A;  4DPU A;  4MYT A;  1K47 A;  4MFB B;  3AXK A;  1M5K C;  2FHM A;  1FVS A;  2E5I A;  3B8H A;  1RTH A;  2QL9 B;  2YKP A;  2XSF A;  4ZP6 A;  5K8M A;  1DFD A;  2QLW A;  4DOZ A;  5D4N A;  2OIH A;  2QLJ B;  2MXY A;  1U2F A;  2HBY B;  3ITH A;  4D3H A;  2X1G A;  2B3T B;  2HG4 A;  2G4B A;  5KFD A;  3PVX A;  1X8D A;  5IWA J;  2M88 A;  4KGK A;  4JI5 J;  1WTF A;  2QSF A;  1YBU A;  2DJW A;  4AD6 A;  1K9M T;  1HBM A;  4DHV A;  1F9E B;  3RB0 A;  1OQ6 A;  3QRR A;  2CPZ A;  5JVG Q;  5I3U B;  4LBH A;  4CTA A;  3NGD A;  1F2H A;  2AGO A;  4WK1 A;  2NZ4 A;  3NGT A;  1TKZ B;  2DNQ A;  2QYG A;  4Q8F A;  3OXF A;  5IOL A;  1S59 A;  3IR6 B;  3FEX B;  5KFE A;  2BM1 A;  4G1I A;  4NLV A;  1KS2 A;  3MM9 A;  2Y9H A;  4NYP A;  5IV3 A;  4LF7 F;  4DL6 A;  4ZCL A;  4OZ1 A;  1CJU A;  4LFB J;  4AQY F;  4XK8 C;  4KO0 A;  2V50 A;  1A7G E;  4OYX A;  1RT6 A;  3MMB B;  5A8R A;  5M2R A;  2PI5 A;  4JI7 J;  4TYA A;  2U2F A;  1YSJ A;  4FZV A;  2OPS B;  2VB6 A;  1ZET A;  2RQK A;  3A3O B;  2XNR A;  5K8O A;  5AJ3 J;  1ZA2 B;  2ADC A;  2IMW P;  2NZC A;  2LYV A;  2O66 A;  1DQ8 A;  4ZVH A;  4C98 A;  1FNX H;  1LV5 A;  2GW8 A;  4LF4 J;  1KHV A;  3CMA S;  4N8O A;  4LSN A;  3I6P A;  3PW7 A;  8AT1 B;  4K5R A;  2Z30 B;  1WOR A;  4DV1 J;  2LP4 A;  1WC1 A;  1VGY A;  2B4P A;  3VAM A;  4X4V A;  4MK7 A;  1LW2 B;  3FCH A;  4EK2 A;  2LA4 A;  1CLF A;  2OKQ A;  3KK3 B;  3Q2T C;  1SC4 B;  1YVF A;  4F2R A;  4KYZ A;  3AD9 C;  4B9M A;  4ELV A;  5F8G A;  1KQG B;  2EFV A;  1BWE A;  1D8Y A;  5EDW A;  4EWT A;  2GNK A;  1T9Y A;  1NHV A;  1OYD A;  1KVK A;  2C1E B;  2CVI A;  3MEG B;  1UET A;  2HWT A;  1ZPW X;  1VRQ C;  4PQA A;  1N34 F;  4EBE A;  4F4Z A;  1FNO A;  1FO1 A;  3MD3 A;  4QIG A;  2COL A;  3ZZY A;  4UF4 A;  1E6Y B;  5KFF A;  4HH0 A;  4X4R A;  5E3A A;  2MDA A;  1OYE A;  4FYV B;  2K8G A;  1N32 F;  4M95 A;  4XDD A;  5L1I A;  1HHT P;  2GV1 A;  2HZC A;  4HVZ A;  5MAO A;  2G2O A;  1UJ5 A;  3BGU A;  4X66 J;  5DDQ C;  3VQT A;  3GII A;  3MMC B;  4RL1 A;  3IN5 A;  4C3K A;  3THP A;  3KHL A;  5FDL B;  2OSR A;  2PD1 A;  1YGY A;  2W8L A;  3T5L A;  2FVR A;  3LWL A;  3LGN A;  5GAE U;  1XQI A;  2H5E A;  3R5D A;  4UOG A;  1FJC A;  4TKT A;  2OAU A;  1IM4 A;  4O44 A;  3LAL A;  3VR1 A;  2EFG A;  3BDP A;  4J9M A;  2CIM A;  2YH1 A;  1U1K A;  4K4X A;  4FF2 A;  1QUP A;  4V19 J;  1GMW D;  5ETV A;  1LXN A;  4I7F A;  3NCQ A;  1H0H B;  2C2O B;  2MQO A;  1PIL A;  1D1U A;  1YRT A;  1YZ7 A;  4J9K A;  1UVM A;  2FC9 A;  3PYF A;  1NME B;  2UZA A;  2QN6 B;  4QW8 A;  3ZTS A;  5KFY A;  1IKW A;  1RBO B;  2CPI A;  2ZHO A;  4GKK J;  3GFH A;  4C97 A;  1FDD A;  2HHX A;  1JLB A;  4NCB A;  1X5T A;  4ZVG A;  2XYP B;  2CQ4 A;  4IG3 A;  3HPO A;  5C42 B;  1T9U A;  3H2L A;  3P5B P;  4WJB A;  1GEH A;  4U7U D;  5GAD I;  1M5P C;  4JB8 B;  4J37 A;  1I1G A;  2W24 A;  1F3V A;  3BDE A;  4DJB A;  4CYU A;  1RKJ A;  1NB7 A;  2VV5 A;  4PAA A;  4CH7 A;  2JNJ A;  2XCA A;  2B0G A;  3UN3 A;  4CLT A;  1MRO A;  2CQ0 A;  5ITH A;  2VA2 A;  1RHM B;  3DOK B;  2HPU A;  4DQS A;  5LSL A;  1O6X A;  2FB0 A;  2VFR A;  1RTJ B;  4PPZ A;  2XLK A;  5A8K B;  1RB0 A;  2CRL A;  2GGP A;  3WX8 A;  4TQR A;  3CJT A;  3HZG A;  4WE1 B;  1WJ9 A;  2DRA A;  1BD6 A;  3KUE A;  3T5J A;  3A8K A;  3THT A;  4G1P A;  4FXD A;  2HNZ A;  4TLR A;  4ECV A;  5KFU A;  4XTT A;  4PXD A;  3BBF A;  3KMQ A;  3AT1 B;  3CMQ A;  2K3K A;  3P6Y C;  1T94 A;  3V6D A;  1H3D A;  4ZVP B;  1FWK A;  1JKH A;  4ZHR A;  3D0H E;  4ED2 A;  2NRE A;  2IYG A;  3VQS A;  2V2K A;  4NLT A;  2YY3 A;  3U02 A;  2ZE2 A;  4JYA F;  1F1B B;  4KKO B;  4ZJL A;  3ZZP A;  2ZJP Q;  3C6U B;  4NML A;  2M8H A;  4DR3 J;  2FZK B;  2GQQ A;  4RW4 B;  2GVD B;  2MY8 A;  3MGJ A;  1FTC A;  3KHG A;  4URS A;  3P4U B;  5LXR A;  1I94 F;  2QMW A;  1C0U A;  1WTB A;  4YR0 A;  2CNN B;  1EQ0 A;  3W66 A;  3Q8V A;  1VHI A;  4Q0B B;  3P8B B;  4OV1 A;  4PXB A;  3M8Y A;  2KVI A;  2MQ8 A;  1NJI T;  2VBY A;  5I4M A;  5KG7 A;  1LWF A;  4ELU A;  3UNY A;  4E2F B;  1MG7 A;  3PW2 A;  2ASJ A;  1U49 A;  1RBL A;  1KKH A;  4TY8 A;  2VJV A;  1NDK A;  2FYX A;  1HLW A;  2BOA A;  4NX9 A;  5DDP C;  2HHS A;  2MSS A;  3GSI A;  2QLX A;  5L39 A;  2A0F B;  3TUZ C;  2Z2M A;  3JYT A;  3QNW B;  1CUL B;  4OYZ A;  3PV8 A;  4XPC A;  3KG0 A;  4CNY A;  2HWI A;  4J9U E;  2OSQ A;  5KFZ A;  3N9U C;  4U9R A;  1VOM A;  2RML A;  3NKY A;  5M2P A;  4DMZ A;  2FHK A;  4C0O C;  3N0V A;  5LL6 d;  4YB1 P;  3OSN A;  2BE2 A;  3O1L A;  5IWA F;  4JI5 F;  3KUH A;  1BXN A;  2VKZ G;  2DXE A;  2UP1 A;  3JSY A;  1AA1 B;  2XS2 A;  3ET6 B;  3CJ0 A;  1S57 A;  3OJU A;  2ROP A;  4DR1 F;  3S8S A;  5AE2 A;  1JXE A;  1KON A;  3M9M B;  4K0K F;  5D3G B;  4C8K A;  2H5J B;  4YS2 A;  4JV5 J;  4Q2M A;  2JL9 A;  5KT3 A;  3ISZ A;  2F63 A;  4YY3 J;  2AT1 B;  2ZC3 A;  4OHV A;  5FLX Y;  1RCX B;  2RT3 A;  4B9V A;  2N82 B;  3FBC A;  2EG1 A;  4FPR A;  1I3O B;  2GZO A;  4OIX A;  5C24 B;  2N4D A;  2JJ4 D;  5IT9 Y;  3SCI E;  3GV8 B;  4JI1 J;  2B7B B;  2ZDO A;  2ZZN A;  2OEL A;  2BE7 D;  3PEH A;  5HAN A;  3BS9 A;  5IM0 A;  1RJJ A;  3WIV A;  2ZJR Q;  1EET A;  2D1C A;  1U2C A;  4QQB A;  1HHQ A;  1JNZ B;  4CT9 A;  1U1Q A;  3EM1 A;  4PPD A;  4P2M A;  4K4V A;  3D6T B;  2NUU G;  1Z4U A;  2ZBC A;  2XO6 A;  4LF4 F;  1S79 A;  2F9D A;  1IQT A;  2FHJ A;  5HVH A;  3MAQ A;  5ETP A;  4CLS A;  1S0M A;  4DV1 F;  4FYD A;  2M9K A;  2IA6 A;  4NA3 A;  3BEG B;  4B3T J;  3MEE B;  1PG5 B;  4KV8 A;  1YDL A;  4YP3 A;  3G6E S;  3BF4 A;  1NHK L;  1X4G A;  2CWX A;  4Y28 C;  5M2U A;  3O44 A;  3IS9 A;  1QM9 A;  3TNV A;  1N5V A;  1WKL A;  4K4T A;  3GIM A;  3NGU A;  2GIR A;  1QAJ A;  4ECY A;  4OYA A;  2ADB A;  3NNA A;  2MQP A;  3M8P A;  2RQ4 A;  2XMU A;  2UUC J;  1UL3 A;  3PG9 A;  2ATC B;  4ZVE A;  1TL7 A;  4M5D A;  1Y4Z B;  4HT5 A;  3FJ2 A;  4DL2 A;  1WC5 A;  2F3J A;  2ZNZ A;  3V4I B;  2C3Y A;  3FCW A;  3DLG B;  3ZC4 A;  1T7P A;  4FKY A;  3BQ1 A;  3LPE A;  5J2Q A;  4OZJ A;  3PEJ A;  4U7U K;  4DSL A;  1I51 B;  2UXD F;  2IVM A;  1VRU A;  2YNH A;  1X4D A;  3M9O B;  2HVZ A;  1UVN A;  4X66 F;  4ZOS A;  1SIZ A;  4IFY B;  4LF5 J;  1PYT A;  3M2R A;  5CH7 B;  2AZ3 A;  3R2D J;  2RKI B;  2HYI B;  1BMQ B;  4DSJ A;  1TL1 A;  1M90 T;  5IT4 A;  4DZ6 A;  2I8E A;  5HMW A;  5AE3 A;  1MLA A;  4PUO B;  2VOP A;  2HQD A;  1R31 A;  4UY8 5;  1BY9 A;  4ZKA A;  2KT5 A;  4F3O A;  1YK9 A;  4OHZ A;  1J2V A;  2VPX B;  5HVG A;  3W2V B;  5KFW A;  1HQ2 A;  1VMB A;  3PFO A;  1VBX A;  2D3U A;  1CS4 B;  3LWM A;  4UUW A;  3WDO A;  2I38 A;  1ICE B;  2JC0 A;  3W9J A;  3OLB A;  2ZZT A;  3UE2 A;  4X64 F;  1TEL A;  3N01 A;  4NA2 A;  4JOU A;  2OTL S;  5IT0 A;  1U1L A;  3KTQ A;  2RUG A;  2IVF B;  3G8S A;  1R27 B;  4DR5 F;  5KT6 A;  2HBZ B;  5J2M B;  4OI2 A;  4EZ6 A;  1T02 A;  4EUV A;  3TUP A;  3JSB A;  3POT A;  5L46 A;  2IDE A;  3AOB A;  4J90 A;  1X5O A;  3KMS A;  4AE5 A;  3CDU A;  1FD8 A;  3HSJ A;  4FYW B;  2C3M A;  4W98 A;  3D9B A;  2C2M B;  3SFG A;  2HGN A;  1JJ2 R;  1C2P A;  1QE1 A;  2V8P A;  3MD1 A;  3NNH A;  4FF4 A;  4ZPW R;  4FS1 A;  3ONQ A;  1RT1 A;  4F0K A;  3L95 X;  4RNN A;  1FER A;  3RW7 A;  5KFO A;  1HHS A;  2UU9 J;  1DLO B;  4BWJ A;  3SDE B;  3HUL A;  4ID8 A;  2FQQ B;  3GIR A;  3CCT A;  2DNY A;  3UW1 A;  5E41 A;  1S6Q A;  1KN6 A;  5CQG A;  2M5Y A;  5HMY A;  3I5B A;  1FRH A;  4Y00 A;  3PM9 A;  2HRY A;  1ZM2 A;  2YWH A;  4F3M A;  2WON A;  3MFH A;  1RWV B;  2XMV A;  3F73 A;  3PW5 A;  2J7K A;  3BQ2 A;  1EHW A;  5CAA A;  3H5Y A;  3K5O A;  3SSQ A;  2CZV C;  4C11 B;  3MPU B;  1TU0 B;  3A13 A;  1TL3 B;  2EWH A;  3OR1 B;  3QWP A;  3MCO A;  4DR3 F;  1RBA A;  3G4S S;  3M6W A;  2OI2 A;  1VDH A;  2VU5 A;  2AF6 A;  2QJ3 A;  5B08 A;  4K4Y A;  1VJW A;  1MML A;  3T41 A;  2I0X A;  1B64 A;  1UAW A;  1F5A A;  1F5B A;  4PQU A;  4DF8 A;  1RAJ A;  3RRG A;  3K59 A;  4PG4 A;  5SZT A;  5GMD A;  3RG6 A;  2QLB B;  4J9V A;  2D9O A;  5JXS A;  3K89 A;  2LXU A;  4JI3 J;  2Y1L B;  4OX8 A;  5C25 A;  1UP1 A;  3T9Z A;  2KHD A;  1MMN A;  2F7V A;  4DR6 F;  1R0A A;  3H4B A;  2YNF A;  2HWH A;  2IM2 A;  1SL1 A;  1F0X A;  2FJA B;  3TVK A;  5KG4 A;  3UCG A;  3NGK A;  3MR6 A;  3J7Z T;  1WNE A;  1HI1 A;  1X5P A;  1RE1 B;  1WC3 A;  2DXD A;  1Q4R A;  2J6S A;  1UVL A;  5IQQ A;  5LM7 E;  2CKW A;  2JLF A;  3C66 A;  3PYD A;  2RRB A;  2ATL A;  4BHQ A;  1HBO A;  5CA5 A;  2IY5 B;  4UT4 A;  2MKS A;  2VHG A;  4MKA A;  2LQ9 A;  4WTY A;  1UFL A;  5ETR A;  4MAK A;  2FIU A;  3PCO B;  4I2P A;  3CC7 S;  2KT3 A;  4AFF A;  2IM0 A;  1U0H B;  5F8L A;  2DIV A;  4QWD A;  4RNM A;  3VGS A;  2ROG A;  4OLP A;  4ILR A;  3DNC A;  2QFI A;  2EBG A;  1WC6 A;  4N8N A;  2XYH B;  3M1V B;  5LMN J;  2EK1 A;  3L4B C;  4C9D A;  2V0N A;  4YDX A;  3JQK A;  1VQL S;  2F4V J;  1E6V A;  3EZO A;  1T95 A;  2A6M A;  1TR0 A;  5ETM A;  1JLF A;  4PAB A;  3MUT P;  2OH2 A;  4DFK A;  1OQ3 A;  4LRE A;  4DV4 F;  3SQG A;  5RUB A;  4UOH A;  1HWJ A;  3VAL A;  2OPQ B;  2XTJ P;  1RWP B;  4NYO A;  2D7S A;  1FHT A;  4IR9 A;  3LAN A;  1P6T A;  4A47 A;  3FKB A;  5J2P A;  4LF9 J;  1RT7 A;  4TY9 A;  1QVF R;  4HAC A;  3QIP B;  3C14 A;  3CCE S;  3AJ2 A;  1S9E B;  2GHV C;  3QGP A;  3RR7 A;  2AU0 A;  2AEM A;  2FJX A;  4OQJ A;  2WOM A;  4OZN A;  4CZC A;  1RT2 A;  4O3N A;  4WYW A;  3KLH A;  3PW0 A;  3UD3 P;  1OMS A;  1S99 A;  4KFB A;  2PO4 A;  4ZVU B;  1O5J A;  5CCM A;  2VG7 B;  3VWS A;  1HR0 J;  4OYP A;  2VL1 A;  3D0G E;  4ZPV R;  3NBP B;  4YFU A;  3ISN C;  1PC5 A;  3H2V E;  4J9S A;  1IQZ A;  1Q1K A;  1RT4 B;  1HBN A;  4NCA A;  1NBE B;  4P73 A;  2RVJ A;  4KGV B;  2BJD A;  3V2U C;  1HAR A;  5A8W A;  3Q8Y A;  1VBZ A;  3VV2 B;  4IDK A;  5K8N A;  1H7W A;  1N33 J;  4UTG A;  3HVR A;  2HHT A;  4HDH A;  4BC9 A;  3M4X A;  2WW8 A;  4R25 A;  5KG2 A;  3M8Q B;  1HIY A;  3M30 A;  3R7B B;  2BKO A;  1IXK A;  2ZOM A;  5DQI A;  1LW0 B;  3HJF A;  2E7W A;  4RX6 A;  1WG1 A;  1VBY A;  4QR0 A;  2GQ2 A;  2JEJ A;  4NPO A;  4LVN P;  1UA0 A;  2HUR A;  4I6W A;  1OS5 A;  1WI6 A;  2J0W A;  2LU2 A;  2Z2Y B;  3K17 A;  1S0N A;  4TU8 A;  1XR5 A;  4DR2 J;  3H25 A;  2PFF B;  1RTI B;  1S1U B;  1WHY A;  4H4M B;  2HSE B;  4R5P A;  1RHQ B;  2IBK A;  2C2Z B;  4CLP A;  4J9R A;  2ZJQ Q;  3DN9 A;  1VJQ A;  3AJD A;  4N76 A;  3DLE A;  4NXN J;  4CLK A;  4IR1 A;  4USH A;  3MF5 A;  3DLL Q;  1H7X A;  2AX0 A;  4M5H A;  4LQ9 A;  4NOH A;  2HHW A;  2G0C A;  1TMJ A;  2HFV A;  3AH6 A;  2DVI A;  3AA8 A;  1ZAX A;  1JLE A;  4AUK A;  2FLL A;  1CBK A;  3MEC B;  1IBK J;  4PYD A;  3ZZ0 A;  3JB9 k;  4F0M A;  2J9C A;  2BJ3 A;  5KTQ A;  3W64 A;  4X4U A;  4AXJ A;  2YKM A;  4AL7 A;  4GO5 X;  2UVU A;  2HK3 A;  1NK8 A;  4NI2 A;  3JXO A;  3ISN D;  4F25 A;  3NY0 A;  2UUB J;  1OY8 A;  2V4Q A;  4QWA A;  1FKO B;  3FNN A;  3M6X A;  1XWL A;  3WC0 A;  4RW8 A;  3S1T A;  3PW4 A;  1FKP A;  4RUH A;  2XC9 A;  1L3T A;  1MN9 A;  3EXC X;  3I0S A;  3PJ9 A;  4DI6 A;  4DWI A;  2I5J A;  3K7R A;  3FRZ A;  3RBD A;  4NLU A;  3QSY B;  4CO5 A;  2PA8 D;  4JI6 J;  1P8G A;  4DV3 J;  4P74 A;  4RNO A;  3EGW B;  3FUY A;  4B3O A;  4C8O A;  4KJI A;  3UCU P;  2LDI A;  1KFS A;  3OL9 A;  1S0O A;  5DM6 Q;  2B9Y A;  3R6L B;  2M3D A;  3FMB A;  2D3O 1;  4DV0 J;  2ALY B;  4X4N A;  5DQH A;  1WKK A;  1AFJ A;  3R5A A;  8ATC B;  3NRB A;  1XNR F;  5T7L B;  2HHQ A;  1VQ4 S;  3IGV A;  5J1E A;  2QFJ A;  1RK8 A;  1AXQ A;  2QMU B;  4DFP A;  5C2G A;  1SV5 B;  2OMO A;  5KG1 A;  2VH7 A;  1AZS A;  4YB5 A;  4NAS A;  3U27 A;  5I42 B;  1LWC A;  3W9I A;  4WFX A;  3IG1 A;  1R8C A;  3NCP A;  1S77 D;  3WX4 A;  4JI4 F;  1Q5V A;  2BAN A;  2K1R A;  4ZLP A;  4XAK A;  4C0H A;  2JRS A;  4F04 B;  1R8A A;  2E29 A;  1SC1 B;  2JWN A;  4KQZ A;  2QA1 A;  3AD7 C;  2ILZ A;  3CJ3 A;  1S76 D;  1NSK L;  2KFN A;  4I0W A;  2WZ1 A;  2BZ2 A;  1XR6 A;  4WKR A;  2WVF A;  1XMQ J;  2NPI A;  3CJR A;  1U09 A;  4LFC J;  2BYC A;  3NL0 A;  4DV5 J;  4TU9 A;  4ANE A;  3CJK A;  4R8U B;  3PX4 A;  4AT1 B;  1CSJ A;  2HVI A;  2X3D A;  3JSM B;  4OI1 A;  2R42 A;  2R4F A;  1MMD A;  4Q5V A;  1CC7 A;  3Q8U A;  2CPH A;  3U7J A;  2Y1J A;  1RLC L;  2QX0 A;  4DS5 A;  2UXC J;  4NL5 A;  4NZ7 A;  2XYG B;  3H0P A;  4IFV B;  1X4B A;  3WC2 A;  4KY3 A;  1FJE B;  1IUJ A;  4JI0 J;  2MKI A;  4N56 A;  2DB1 A;  1S1W A;  2Z2L A;  4X65 F;  2DHA A;  4ED8 A;  2HVE A;  2KYX A;  1J5E J;  4ZS6 A;  1YTY A;  2QYC A;  4HR2 A;  3CCZ A;  4GVL A;  1GNK A;  2DNM A;  2ACM A;  3BYR A;  3KXD A;  4CO2 A;  1ITP A;  5ETQ A;  1SKU B;  2FGO A;  2NXC A;  2BRK A;  3CD6 S;  3I0R B;  3M2U B;  1KOO A;  2G0J A;  3PAC A;  1UVJ A;  2DR6 A;  3J81 Y;  4CO0 A;  2F4V F;  4GVB A;  1MU2 A;  3RGI A;  4KH0 B;  2GIF A;  3NOG A;  3KLG B;  4JUZ A;  4OZ0 A;  3FMW A;  4MFB A;  1UWA A;  1FX4 A;  2EPI A;  2M52 A;  1DTQ B;  2CAJ A;  5HAT A;  3J7A 1;  3KJV B;  2CFX A;  2VFU A;  3VF0 B;  4EO6 A;  4CO4 A;  1U6Z A;  4O3S A;  1PJ6 A;  4DX5 A;  1S1T A;  3KDO A;  1R6V A;  2KJV A;  2OPP B;  5GME A;  1TKT B;  2RD5 C;  1URR A;  1C4A A;  4PWD A;  5BR8 J;  4I2Q B;  2HBQ B;  3D6F B;  4P9S A;  3D3B J;  2YQ3 A;  2QE5 A;  5BYS A;  3TAN A;  4KPY A;  3W9H A;  1S6P B;  5I3P A;  2XB2 D;  4O3R A;  1YJV A;  4M5G A;  2W2M P;  3DDI A;  5I3U A;  1JLQ B;  4LR9 A;  3GE9 A;  1TKZ A;  3EPG A;  1HPZ B;  1CJK B;  5LT5 A;  4RLE A;  4ZCI A;  3CCM S;  2VBW A;  4ER8 A;  4EO8 A;  2FJD B;  3K57 A;  1IBC B;  3T1Y J;  1R0C B;  4ZPD A;  4LF2 A;  4QWB A;  3TZZ A;  3G82 B;  2L08 A;  4NLQ A;  5U47 A;  2KB2 A;  2UUA F;  3MMB A;  1KD1 T;  2CQ3 A;  2KRB A;  5BYR A;  1P1L A;  1W2I A;  2OPS A;  3CDB A;  4Q44 A;  3DLB A;  2YKN B;  5DJB A;  3TYT A;  1Y3K A;  2V68 A;  4N41 A;  1UZD A;  1FXD A;  1UFW A;  4HHJ A;  4BLG A;  1QAY A;  3J7Y I;  3FFI B;  4DQP A;  3DYA B;  4ALZ A;  3D68 A;  4ECT A;  3GQC A;  3QAU A;  1X60 A;  4C48 A;  1SKW A;  1LW2 A;  3DGP B;  3KK3 A;  3C15 B;  2GCF A;  1R3N A;  1G1X A;  2RUS A;  3ZTQ A;  1NPP A;  2X3G A;  5H9F K;  2FDN A;  3VGU A;  4LRF A;  3BKU A;  4NXN F;  1QAX A;  3GYG A;  3HSZ A;  2RH3 A;  1DAX A;  2HW3 A;  2UXB F;  3QZ8 A;  3NOC A;  3PR5 B;  3M6V A;  5JUM A;  4DUT A;  2PDA A;  3C3L A;  4ECZ A;  4PR6 A;  1YKW A;  1W2B R;  1IBK F;  2DRB A;  2KH9 A;  4B9U A;  4P2F A;  1VYA A;  1IR0 A;  2MLY A;  2IHR 1;  2WBM A;  2F5G A;  2G9O A;  1YHQ S;  2CDR B;  4YOE A;  4DU7 A;  2W4C A;  3W65 A;  1E6Y A;  1GH8 A;  1O51 A;  1FD2 A;  3GJT B;  4DCJ B;  3Q23 A;  3PXG a;  1ZZN A;  3UFC X;  2V2Q A;  3MTK A;  2EXU A;  2Y8W A;  1JMT A;  1HWK A;  1HNZ F;  1LOU A;  2KXF A;  3S6E A;  1P9Y A;  1CPZ A;  3OQ2 A;  1Y5N B;  4JI2 J;  5FDL A;  3G6X A;  1VC0 A;  1SQF A;  1CQM A;  1Q8I A;  2HZV A;  3FDS A;  3JTP A;  1Q79 A;  4M5M A;  3CJQ A;  4JI6 F;  2HFU A;  4DV3 F;  2BOP A;  4ECQ A;  4KR0 B;  4WKY A;  4RW9 B;  4IYQ A;  2ZBQ A;  3GLJ A;  3KLI B;  1CVJ A;  1VQM S;  2FLP A;  4C8Y A;  3L09 A;  4RUC A;  2HND B;  3WIU A;  3D1Q A;  3H90 A;  4DV0 F;  3ZTR A;  1C4C A;  2XSJ B;  3ENA A;  2W4D A;  1SJF A;  5LOQ A;  2BW2 A;  3SEO A;  3QGG A;  2HNY B;  4DL0 C;  3ZNJ 1;  2WK4 A;  4K7Q A;  1VQO S;  1FVQ A;  1RWO B;  4OX6 A;  2ZH6 A;  4USM A;  2IAJ B;  5C42 A;  1B0P A;  2CNL B;  4F0H A;  1AUD A;  2VJU A;  5HO4 A;  1RAE B;  4OFZ A;  5DDO C;  3I87 A;  1C0T B;  5DGA A;  1S48 A;  2N4C A;  2MEW A;  1CJV B;  3A8E A;  3V4M A;  3GU0 A;  1OIA A;  1ZTT A;  4UST A;  1YWX A;  1RWX B;  3OTO J;  1M1G A;  5KOW A;  1VQS A;  4O3Q A;  3W7B A;  1NK6 A;  4B3R J;  2KG0 A;  2QMX A;  3CD7 A;  2NXU A;  1RTJ A;  2VPY B;  4ES3 A;  1WC0 A;  1HD0 A;  3LUY A;  2VQE F;  1F3F A;  5A8K A;  4J91 A;  3LGM A;  1QY7 A;  2WAQ D;  4YQW A;  2MLX A;  3Q2S C;  4F2S A;  4ITS A;  4WE1 A;  2ZKU A;  1XTZ A;  3CCR S;  4NLS A;  4EYI B;  2CG8 A;  3DOM B;  3FSX A;  3IGN A;  2UV8 G;  2HFN A;  1ZA1 B;  3QID A;  1GXT A;  1U6B A;  5DET A;  2CQ2 A;  3E01 A;  1RAH B;  3LGH A;  4NCG B;  3SV3 A;  2VG5 A;  2CJQ A;  1PJ5 A;  1HD1 A;  4AXI A;  4Y2A A;  2ZZM A;  4KKO A;  1OSC A;  3NNC A;  2HHP A;  1UCN A;  4FF3 A;  5DG7 A;  1U8W A;  3BN4 A;  4QYZ J;  3NAH A;  2GVD A;  4DV7 F;  4DS4 A;  4DV2 J;  5KG0 A;  3TJA A;  3CJS A;  4YHH J;  2R3V A;  4YR2 A;  3TAQ A;  4Q0B A;  2CXE A;  2CJX B;  3TO8 A;  3I56 S;  1WEL A;  4EI2 A;  3DM2 B;  4KO0 B;  5D4O A;  2A10 A;  2KM8 C;  4NRT A;  3RB3 A;  3Q8Q B;  4X62 F;  2KM8 B;  4NEZ A;  4MK8 A;  4CQ1 A;  2RF2 A;  3HXM A;  1V3Z A;  4PYA A;  2PEH A;  3R97 A;  1VK3 A;  1Y5I B;  3KKF A;  4RWW A;  4RBT A;  1YIJ S;  1SL2 A;  3CF5 Q;  1Q78 A;  5KFH A;  3BPS P;  5CHC B;  3UPF A;  2HGL A;  2YWG A;  2IJR A;  1JLC A;  1BC6 A;  1CUL A;  1S49 A;  2E66 A;  4LF8 J;  2N3L A;  2YNI B;  1YJW S;  2NSB A;  1TUW A;  3P96 A;  4CLF A;  5KT2 A;  3MM8 B;  4CCH A;  3UR0 A;  2XMA A;  4FNH A;  1U26 A;  5BR8 F;  4ED1 A;  3DRP B;  1SUQ B;  3GIL A;  2VBZ A;  3D2W A;  3R1H A;  1G7C B;  2DGQ A;  3MPW A;  3CD0 A;  4ID5 B;  2GA7 A;  1HKA A;  1WUU A;  1NK7 A;  4NLD A;  3P45 B;  3IAS 9;  4N7T A;  2M70 A;  2M8D B;  3J80 U;  2HVD A;  4LF7 J;  4J7C A;  1NSQ A;  4EMD A;  5D3G A;  3VTI A;  3CDW A;  4AQY J;  1NJY A;  1KHW A;  1IKY B;  2RHS B;  4BWM A;  1PJ7 A;  2CAD A;  2VIH A;  1GMV A;  1S1X B;  5F0U A;  1OY9 A;  3B4M A;  4FVC A;  1NJX A;  3NAI A;  3D0I E;  5IQ6 A;  4C2M A;  1SH3 A;  4ZDN A;  2JSX A;  5C24 A;  1NKE A;  1RTD B;  5GAG U;  2FJW A;  3RUB L;  2FJE B;  5DLG A;  4HLB A;  2VDI A;  5HJX A;  5K14 A;  2KI2 A;  3DXB A;  5L8R C;  3D7S B;  2F65 A;  2KXH A;  1BHN A;  2AGQ A;  4AND A;  4NZ0 A;  2N7Y A;  4NXM F;  1PO6 A;  4I69 A;  1OY6 A;  1L3U A;  1APS A;  4H4O B;  4WCE Q;  2C2D A;  2ZWO A;  3D3C J;  5KG3 A;  1RT5 A;  3DRY A;  2FHO B;  2F40 A;  4I6A A;  2IIH A;  4TQS A;  1RGV A;  3AB2 B;  5E2Q A;  3MEE A;  3HD2 A;  3KK2 A;  2LMI A;  5GMK a;  1KR4 A;  1BE4 A;  3D6H B;  5E0O A;  2XZD B;  1REV B;  1N34 J;  2ZH5 A;  4LR7 A;  4WFZ A;  4D3G A;  5LJ5 Y;  3RJM B;  7AT1 B;  3MPD A;  4O4G A;  2JLE A;  3T1H F;  2L48 A;  1RHJ B;  3IAM 9;  4RBV A;  2KT2 A;  2E5L F;  1N32 J;  1DQA A;  2B8P A;  3DI6 A;  3QZ7 A;  2R2T A;  2ACY A;  1EAY C;  1SQG A;  1GTH A;  5A6W A;  3L7O A;  1KVJ A;  2HQF A;  3Q83 A;  1S1V B;  3QJL A;  1MRO B;  4ZPB A;  1QSS A;  2Q6C A;  1YJ7 A;  3PNI A;  4P2S A;  3MR7 A;  4F02 A;  4OI3 A;  3AQP A;  4CM2 A;  1MNE A;  2JFD A;  3CJ8 A;  5D0G A;  4CLZ A;  3UDV A;  3RRK A;  4OYO A;  4CNZ A;  3MM5 A;  2VQF F;  3FEZ A;  2CQI A;  2VA3 A;  1RDR A;  3VAG A;  3ZZT A;  2E1R A;  1X5S A;  3ADA C;  4JI2 F;  4IFY A;  2DBB A;  1Q8K A;  3OTC A;  1WF0 A;  2RKI A;  5LSR A;  4QOT A;  4UZB A;  3LO3 A;  2YKQ A;  1JIH A;  4KBI A;  3M32 B;  1HNW F;  1UZH A;  1UMJ A;  5MLC V;  4DV6 J;  3G96 A;  4M94 A;  2ZHB A;  5D0H A;  2AZ1 A;  4K4Z A;  1TFY A;  3W2V A;  4AL6 A;  4J9Q A;  1KNZ A;  3T6J A;  5HLF A;  1SQE A;  5B0E A;  1CS4 A;  4O23 A;  2BKP A;  1VK8 A;  3G2X A;  1Y00 A;  3DDN A;  1KQK A;  2I6W A;  3QPI A;  4OJH A;  4TLQ A;  3D1H A;  2CUY A;  2IA0 A;  3BO4 A;  3DDK A;  1JJH A;  4L75 A;  1W26 A;  4PWW A;  2XHW A;  5J2M A;  4WFN Q;  3BSC A;  5AXM A;  1LK7 A;  5B0B A;  3RZA A;  3EXY A;  3D1O A;  2Z4P A;  3SQO P;  3DMJ B;  2HMI B;  4K8R A;  4QJV A;  5E3R A;  3OD2 A;  3BV8 A;  3J7Z 5;  2APO A;  3FEY B;  1TVR B;  4KHP J;  4B3R F;  1HW9 A;  4IRD A;  3QO9 B;  2QT7 A;  3KG4 A;  3SBM A;  1DLO A;  1KTV A;  3SDE A;  1U6F A;  1RT3 B;  2J7U A;  4JYA J;  1XNQ F;  5HP1 A;  1N5Q A;  4N47 A;  5B0C A;  3UO0 A;  2QA4 S;  4FXV A;  1HNX J;  2BE2 B;  4ICL B;  2VAS A;  2W2N P;  4RNH A;  3CIM A;  2OJ3 A;  1I94 J;  3UI3 A;  4JV2 A;  1YJU A;  5KFP A;  4Z7Y A;  3MED B;  1O8B A;  2VG6 A;  4OI4 A;  4C11 A;  3OHB A;  3OV7 A;  2QO3 A;  1TL3 A;  3SI8 A;  3KDN A;  1XEZ A;  3SSR A;  1KRP A;  5KOX A;  2ZH3 A;  1UTA A;  1SJQ A;  4EYH B;  1NK5 A;  4LJM A;  2HQI A;  4ZVQ B;  5EWE A;  3OR1 A;  3M8Z A;  3FBE A;  4FVM A;  2J6U A;  4Q45 A;  2AQ4 A;  4I68 A;  4DV2 F;  1SL0 A;  1JLG B;  4USU A;  2R7U A;  4RU2 A;  1VR6 A;  3R5G A;  4ZN1 A;  1LWE B;  3ENV A;  2BV3 A;  2GS8 A;  3C6T A;  2QGF B;  2IRU A;  1KTQ A;  4QU7 A;  2JVR A;  1WF2 A;  4F67 A;  3LP0 B;  1T8E A;  3BR9 A;  1FRK A;  3X1L B;  2YKO A;  1VIX A;  3UD5 A;  1XMB A;  3MI7 X;  1NPK A;  2J9E A;  3D5M A;  2UVR A;  3PX6 A;  4YME A;  1OO0 B;  4NRU A;  3P49 B;  2G0I A;  5H1S V;  5K5M A;  4I67 A;  1RAF B;  1IKV B;  1RCO B;  1HNV B;  1WG4 A;  4LF8 F;  2BRL A;  1FDA A;  4DR1 J;  1JJ4 A;  4QYR A;  2HQ3 A;  1TP7 A;  1QLN A;  4K0K J;  4M5K A;  3TVZ A;  3MHY A;  4KV8 B;  2Q66 A;  4ZJQ A;  2WSF C;  1M5O C;  3LP1 A;  1N5T A;  1DUR A;  4ES2 A;  5KT5 A;  4TN2 A;  3IS9 B;  2RJZ A;  4A8Q A;  3FQK A;  1X7V A;  4EZ9 A;  3I55 S;  2Y3Y A;  2YWK A;  2BR0 A;  4PG7 A;  5DS7 A;  4IG0 A;  1Y3J A;  2VZ9 A;  1ZZF A;  2DHS A;  3T19 A;  4C8Z A;  4WZM A;  3QT7 A;  2HLT A;  2F1F A;  2AJ0 A;  1HQU B;  4O4R A;  2VOO A;  2ZOG A;  1ZAV A;  5J2Q B;  1IBM J;  3I4P A;  3RB6 A;  3M1V A;  2SXL A;  2FJV A;  4YB6 A;  3G6V A;  5J2N B;  3B4D A;  3CCW A;  3W62 A;  1YRU A;  2YNH B;  2E5G A;  5DG8 A;  2FUG 9;  4LFA J;  1C1B B;  4C0B A;  1S7I A;  2ASD A;  2HIY A;  2VC1 A;  3PR4 A;  3I31 A;  1FKA F;  2B51 A;  2FLO A;  1U47 A;  1U1M A;  3OBI A;  2J0X A;  5IC4 B;  1Q86 T;  2KRR A;  2WHO A;  3M8R A;  3DXS X;  2OPQ A;  4EBC A;  2R8K A;  3EZU A;  3SCJ E;  3GR0 A;  4ANC A;  2RS8 A;  2O67 A;  4QZV B;  1HYS B;  5GAD U;  5IC6 B;  4WP3 A;  2F8H A;  4M5N A;  4DUZ F;  3QIP A;  3AA9 A;  2PMH A;  1RSC A;  4F4K A;  4TNO A;  4G1Q B;  1PKU A;  1R43 A;  3RBE A;  4KT0 C;  1TKX B;  4WXO A;  2L3M A;  3GZ7 A;  3OXG A;  3PRB A;  2AD9 A;  1Y7P A;  4DCO B;  5A2Q Y;  5SUH A;  4OHX A;  1JJC B;  3FBF A;  3AXM A;  2OFG X;  2VG7 A;  3F41 A;  2HZA A;  3MAH A;  2CG4 A;  3A8J A;  1QUV A;  5DZ6 A;  1IN0 A;  3T5H A;  4QR1 A;  4P7V A;  2UXD J;  3CED A;  3NBP A;  2C2N A;  4IRK A;  4HH1 A;  2BE9 B;  3FVY A;  4OI0 A;  1UA1 A;  2IMO A;  1RT4 A;  1C1C B;  4MKB A;  4ZP9 A;  3MTJ A;  2V4J A;  5A6P A;  1G2E A;  3HK2 A;  3C2P A;  2ZBP A;  2YWW A;  2YH0 A;  1VQ6 S;  3MR3 A;  2CVE A;  3OPK A;  3AQO A;  2W2P P;  1HNI B;  2IVY A;  4B9S A;  2H4W B;  4BDP A;  2H5I B;  3M8Q A;  3KLF B;  2CZ9 A;  3UN5 A;  2WSC C;  4F50 A;  4NZ6 A;  5D0E A;  1FK9 B;  1LW0 A;  2HRU A;  1B7Y B;  5A76 A;  3EVO A;  2DGT A;  1D0E A;  2K7K A;  2AMC B;  4K2J A;  3IO1 A;  3MUV P;  1S7H A;  5K8P A;  3J7A N;  5KFA A;  2YBV A;  5EWF A;  2JX2 A;  2AEF A;  1U2R A;  2GHP A;  2OPR B;  5ETK A;  3CUL A;  4X64 J;  2Z58 B;  4L3K A;  1RTI A;  5LXY A;  4OZ2 A;  2H4Y B;  4DV6 F;  4H4M A;  2BXJ A;  4DR5 J;  5GAH U;  1AB8 A;  4H4K C;  2VPZ B;  4DUY F;  4X2B A;  2XI2 A;  3K5M A;  1SVD A;  2CPJ A;  3CB4 A;  1NXI A;  1FRI A;  1DHM A;  3OTD A;  4L76 A;  5BXI A;  3LAM A;  2HS0 A;  2YX4 A;  1LNQ A;  3BO3 A;  1LWX A;  3MEC A;  5CZV A;  1WHV A;  4A8O A;  3CDE A;  4WFY A;  2DO4 A;  1D9A A;  3Q22 A;  2H9Z A;  1ZM3 A;  2F9J A;  1FE4 A;  1BQM B;  1FX2 A;  3DKD A;  2H1Y A;  3RU0 A;  3OL6 A;  4R0J A;  1K0V A;  2CQD A;  2W7A A;  1R0A B;  3NWG A;  1YG0 A;  3AHP A;  2NLW A;  1EKS A;  4JI8 F;  3PFE A;  2XMT A;  3AFG A;  2MQM A;  4WBF A;  1RUS A;  4KHP F;  1WC4 A;  1SH0 A;  1X4E A;  1PAU B;  4DX7 A;  2O5D A;  5EX3 A;  5DZ7 A;  4TYB A;  3MM6 A;  3GG0 A;  3DOL A;  3CE8 A;  4OZ3 A;  2UV8 A;  3TUJ C;  3H20 A;  4OMF G;  2HAI A;  5AXK A;  3OFG A;  5HQL A;  4M63 A;  2W9B B;  1BLU A;  2VIC A;  3MM7 B;  1RAB B;  1HNX F;  5FLX U;  2DNR A;  3AJ1 A;  1TK0 A;  4L73 A;  4GMK A;  1M0S A;  1TKD A;  3DLJ A;  3M2V B;  3UDL A;  3HFK A;  5IXU A;  5ETT A;  3VZH A;  5H9F J;  4P75 A;  3QAE A;  1HWI A;  5HI7 A;  2JEF A;  4S0M A;  4DL7 A;  1T9V A;  3D28 A;  3WZ0 A;  4O0N A;  5T7L A;  5E7O B;  4JV1 A;  2B56 A;  4OI6 A;  2WVE A;  3ZFV A;  1N88 A;  3OUY B;  2QTW A;  2EKN A;  5L9X A;  4DR6 J;  1JK9 B;  3HX9 A;  2PC6 A;  2MZS A;  3FQL A;  1S10 A;  1B70 B;  2RRA A;  3NG8 A;  3BM7 A;  4U67 Q;  2DNO A;  4ED3 A;  5I42 A;  5KG6 A;  4Y6I A;  3GSD A;  3VCD A;  3PHT A;  2JLG A;  2K06 A;  1PBA A;  3HI9 A;  1IBL F;  1ROF A;  4KE5 A;  1JLF B;  4Q2L A;  1ZAW A;  3VAH A;  1FFS B;  5HSP A;  2DH8 A;  1TV6 B;  1S9G B;  2IDL A;  2KTQ A;  3RAQ A;  2CQC A;  5H9E K;  2HFS A;  2KO1 A;  3CWJ A;  3TOQ A;  2G2Z A;  4DZD A;  1FRM A;  5J2P B;  1VI7 A;  3MMJ A;  2HS3 A;  3C14 B;  4ZMM A;  1Z1Z A;  1TK8 A;  1VQN S;  3S01 A;  2U1A A;  4BS2 A;  3IR7 B;  3CJ5 A;  4OX9 F;  2X7I A;  1WD6 A;  2VUG A;  4OV6 A;  2MZQ A;  1UVI A;  2K7J A;  4RZR A;  2D3Z A;  2HHH J;  4HTI A;  1RZM A;  3DRR B;  2C22 A;  1FXL A;  2GHW A;  2XGQ A;  4KFB B;  4K5S A;  1HI8 A;  4IFV A;  3NS7 B;  2ZC4 A;  2E5J A;  3OFH A;  3F44 A;  1V5I B;  5EGY A;  3KK1 B;  9ATC B;  5CCL A;  2XWY A;  4QWC A;  3LA0 A;  4NLX A;  1V5V A;  4WIQ A;  4ZVT B;  1UEV A;  2BBE A;  1UWB B;  2I2Y A;  1MWY A;  2C2K B;  3QT8 A;  4EU0 A;  2DXF A;  4L72 B;  1XK8 A;  4WXW A;  5A8W B;  4M5J A;  2OD6 A;  1RU2 A;  2W9C B;  4IRC A;  2VD3 A;  2DNG A;  1IBM F;  3DLK B;  1Y11 A;  4DV4 J;  2LEA A;  1ZOT A;  3I0R A;  3M2U A;  2L41 A;  4RW6 A;  2WBR A;  3VAF A;  1S4F A;  4Y34 A;  4ED7 A;  3MCS A;  2RHQ B;  1RAC B;  4UOF A;  4LFA F;  4RUA A;  1Q8B A;  4M8L A;  1UEU A;  3KLG A;  2DK2 A;  1XMO F;  2MZT A;  5F8M A;  3H59 A;  3CCJ S;  4X4P A;  4IKA A;  4PCQ A;  2ZH1 A;  3RR8 A;  5KFQ A;  2EKY A;  3KJV A;  3EX7 B;  2H54 B;  2WVD A;  5DLF A;  1CC8 A;  4KPC A;  3SIP B;  1SKS A;  2OPP A;  1FDN A;  1M1K T;  1TKT A;  5KFK A;  5DM7 Q;  4I2Q A;  2MKJ A;  4K59 A;  2MLZ A;  3V81 B;  1T9X A;  5HVF A;  1NO8 A;  4LRB A;  1CG2 A;  2MB0 B;  3OJS A;  1JLE B;  2XMJ A;  3ICL A;  1S6P A;  1TMM A;  4USV A;  2EFO A;  1M5S A;  3W3S A;  2MYF A;  5J1N A;  1V6H A;  4UQT A;  1S97 A;  5KFM A;  3KLE B;  2Y1R I;  4A8Y A;  1HPZ A;  3I5C A;  3JTN A;  1CJK A;  2YKM B;  4IO1 A;  3CUN A;  4YN3 B;  1NPR A;  2Y1I A;  4MJK A;  1JQG A;  1Q7L B;  3ZXW A;  4B3S F;  1KVI A;  3DCA A;  4DG1 B;  4RO0 A;  4WFB Q;  3G82 A;  2GJ2 A;  2XGP A;  2B4V A;  4N77 A;  1NSA A;  3S7R A;  4WF9 Q;  3CCS S;  2K2P A;  2GC8 A;  2YKN A;  3KG1 A;  1VQ8 S;  2O3D A;  3CCQ S;  1NEE A;  3UD4 P;  3LP2 B;  1X0P A;  4DFM A;  1HMV B;  3FFI A;  1YI2 S;  2DKO B;  3DYA A;  4F36 A;  1N52 B;  1N8R T;  4Y2I A;  4PKD B;  3PX0 A;  4QIW D;  5GAG I;  2KKH A;  3VAI A;  1R6Y A;  1YBT A;  1FWP A;  2UUT A;  3DGP A;  3C15 A;  3FK4 A;  3HT3 A;  1KP6 A;  2IM1 A;  3NS6 A;  1VQP S;  4Q8E A;  1B99 A;  4KHM A;  3HHL C;  2B4U A;  1A9N B;  2ZNY A;  4P52 A;  1RAI B;  3HHL B;  3QFH A;  2FY1 A;  5B09 A;  3QJJ A;  2JH3 A;  4F4Y A;  1VQ9 S;  2CPF A;  2D3O R;  2W1B A;  3RRH A;  3W5Z A;  1FA0 A;  1TTH B;  3HT0 A;  1LEO A;  2XZT B;  2XZW A;  4DN9 A;  3OHA A;  5FII A;  4OX7 A;  3IBC B;  3IG1 B;  4B3M F;  1WG5 A;  1BQN A;  3CNQ P;  2CQ1 A;  1KLM B;  3L9Z A;  2DNK A;  3OXL A;  2D41 A;  2M4M A;  5ADZ A;  3J81 j;  1FCA A;  2JFK A;  1U02 A;  4QPX A;  1U1P A;  3UNG C;  5LMU J;  2M7S A;  1PSD A;  1QJH A;  2H3E B;  1WI8 A;  2P9G A;  2W2Q P;  1N0U A;  4C4W A;  2OML A;  1XJW B;  2VON A;  1HW8 A;  1GTE A;  4DL3 A;  2ERR A;  4LVO P;  2MZ1 A;  3TI0 A;  4K50 A;  3O5T B;  4A8S A;  3W5X A;  1RWN B;  3BGR B;  4ZVS B;  2F4F A;  3AOD A;  2BJ7 A;  4CLY A;  1XNR J;  3FRY A;  4RW9 A;  5HBM A;  3KLI A;  3QLH B;  1GK8 A;  2GVZ B;  3FGV A;  2CNK B;  3CVK A;  2LXF A;  1KOH A;  3R27 A;  2HND A;  2J8S A;  2E7X A;  2R9L A;  4KC5 A;  1SC3 B;  2XSJ A;  1RHR B;  4USK A;  3O3L A;  2W8K A;  5K9F A;  3BRE A;  1U8S A;  2VFS A;  2Z2Z A;  4JI4 J;  3PKY A;  4CH0 S;  3VGV A;  4HT7 A;  5D77 A;  5CYQ B;  1FWL A;  2HRT A;  2RDI A;  2Z8Q A;  3HKW A;  3KOA A;  1WHX A;  2IAJ A;  3TW0 A;  2P6T A;  2CQB A;  2OUG A;  2MJU A;  1GXU A;  4GVB B;  3QFW A;  3GIK A;  1NHU A;  3EVW A;  3OLA A;  4QR2 A;  1C0T A;  1WEY A;  2BJE A;  4RU9 A;  2XNQ A;  4NMX A;  1SJ4 P;  1CJV A;  4CLW A;  2AYG A;  4QU6 A;  4HEA 9;  4CT8 A;  1T11 A;  3RW6 A;  1Q8L A;  5E5N A;  5HRO B;  4QWE A;  4U96 A;  3GV7 B;  3X3U A;  1S1T B;  3F56 A;  2HBR B;  3GFX A;  2KXN B;  2LEC A;  4DBQ A;  2MGZ B;  4PWD B;  1FXR A;  2Q43 A;  2ABY A;  1OPZ A;  2J76 E;  3DOM A;  3BBC A;  2MKK A;  2G13 A;  4DR4 F;  4X65 J;  2YNG B;  1RAA B;  4QIF A;  2AIR B;  2ZKT A;  4RBU A;  3KFW X;  2HHH F;  3SZ2 A;  2AJ1 A;  2XLI A;  3R1L A;  4NCG A;  4GKJ F;  1Q0N A;  1UKU A;  3R7S B;  4KTQ A;  3NMR A;  2BX6 A;  4Y2C A;  1U1O A;  3ILJ A;  2CQH A;  1B7F A;  4QIV A;  2ZH7 A;  5KFG A;  1S6U A;  3ZZZ A;  3MOZ A;  5KT7 A;  1PGZ A;  3HD1 A;  2V4R A;  4C6A A;  3TA1 A;  4WYL A;  2FVP A;  2GX8 A;  3IRX A;  5G4D A;  5THW A;  4IOC Q;  3DM2 A;  3EUN A;  1TAU A;  3QMQ A;  2W01 A;  3L7P A;  3DHX A;  4C3M A;  5KFX A;  2LQ8 A;  1GMU A;  1YJN S;  2YX7 A;  2HFO A;  2VKR A;  3PY8 A;  2CQG A;  1WF1 A;  2DR7 A;  2ZFH A;  2PMZ D;  3UVJ B;  1ZM9 A;  2XQC A;  1F2G A;  4C3L A;  4P10 A;  2DPI A;  3MPV A;  2JOQ A;  4YDD B;  4M1K A;  4X4S A;  2B5J B;  5FJ4 A;  2PFD A;  4KGX B;  2BM0 A;  1VIS A;  2YNI A;  3DGV A;  4RKU C;  2HGM A;  3NWR A;  3JAM U;  3KNG A;  3EIC A;  3BQ0 A;  3MM8 A;  5CD4 H;  2YKA A;  3FSI A;  4JV0 A;  5HK4 A;  4C8L A;  4W90 B;  3JQJ A;  4ZP7 A;  3DRP A;  1SUQ A;  3FCV A;  5DDR C;  5F8H A;  2XBP A;  4Z37 A;  1H73 A;  4NLY A;  1ARO P;  4ID5 A;  2V94 A;  1SBR A;  1N4L A;  1SJ1 A;  4KGZ B;  2J6T A;  1UVK A;  1TQL A;  3PDN A;  1IKY A;  4LBP A;  2UUA J;  3NXZ A;  4WU3 A;  1SI9 A;  4MIB A;  4RPF A;  3JSR A;  2J9D A;  2XCP A;  1S1X A;  3UDC A;  2BMB A;  4RR5 A;  5D4P A;  5CD4 A;  2R2S A;  1UEK A;  1RTD A;  2R7O A;  1FFG B;  3R9L A;  3V6K A;  3OSP A;  5IS2 A;  2POK A;  3T3F A;  2HHV A;  1N36 J;  2CPX A;  1RHU B;  3ZZU A;  1RAG B;  2PMW A;  2R7T A;  2H65 B;  2EC2 A;  2XEX A;  2NYI A;  5AXL A;  4Y65 A;  4QBU A;  2BEF A;  2B9X A;  3SXL A;  4L3N A;  4H4O A;  5JJB A;  1T03 B;  2IM3 A;  1O0P A;  2XG8 A;  4IQX A;  5LSO A;  2WVC A;  2UXB J;  4A8K A;  2FVS A;  2A2C A;  3RYL A;  2HIQ A;  1FTR A;  4UZC A;  3GYX B;  3Q89 A;  1JLA B;  4K4U A;  1GX6 A;  4CLU A;  1REV A;  4F3Q A;  2EW9 A;  4ED6 A;  2PII A;  2ZBI A;  1NUE A;  4ZIT A;  2GAH C;  2CPY A;  3GWC A;  1WEZ A;  4RW7 B;  1HL6 A;  4HI1 A;  4GC7 A;  4WU2 A;  1RA6 A;  1AFI A;  1B3T A;  1FI4 A;  1EX8 A;  3EGV A;  3NP5 A;  3TA0 A;  4Z7C A;  2DY9 A;  3IBW A;  1YIT S;  2Z0G A;  2FZG B;  4ZPC A;  1VCT A;  4IH5 A;  1IWG A;  2E9Z A;  1EJ7 L;  4A8M P;  2NS1 B;  4ETZ A;  6FD1 A;  3R2C J;  5B0F A;  1G3O A;  1HNZ J;  3T9N A;  1JWW A;  3QSI A;  4MT1 A;  1S1V A;  4URG A;  1H72 C;  1U45 A;  4FYX B;  2A2D A;  4L74 A;  2PGC A;  4V1A k;  3QBC A;  2EEY A;  2QG9 B;  2KL8 A;  5LMU F;  3QWU A;  4HHH A;  2GMJ A;  1IKX A;  2FLN A;  2AWZ A;  2DR8 A;  3E2E A;  3A4T A;  2CJA A;  2JDJ A;  1N6Q B;  5AT1 B;  2OTJ S;  3TAP A;  1Y5L B;  2F8M A;  3MEK A;  4XIU A;  3PIO Q;  2RRN A;  2LQJ A;  2GO8 A;  2YQ1 A;  3I32 A;  3IWX A;  4ECW A;  4B02 A;  2R8G A;  3H7H B;  5D0R A;  4KAI A;  4K4W A;  4B9T A;  4V19 X;  1VQ5 S;  3M32 A;  3ZZO A;  5KFV A;  4MKV A;  3E01 B;  3QGI A;  5GAE I;  1P27 B;  4TXS A;  3IMQ J;  2VG5 B;  2ASL A;  2XS7 A;  1NDL A;  1UJ6 A;  3TJ8 A;  2KU7 A;  5HAO A;  1EIY B;  3BYP A;  3J81 U;  2C3P A;  1U48 A;  2DH7 A;  4M5I A;  2V2Z A;  3G86 A;  1FNM A;  2DRD A;  4ZIV A;  1EP4 B;  1VFJ A;  2N7C A;  2BKN A;  3PO5 A;  3U1N A;  1VIO A;  1EZZ B;  2DEJ A;  3QRQ A;  2OD4 A;  1DQ9 A;  4PZV A;  3IXQ A;  3LF0 A;  5FD1 A;  1WEX A;  2DNP A;  2ZD1 A;  1VLY A;  2VQE J;  5DGB A;  2RF2 B;  2R7V A;  4F7V A;  5GAH I;  3DMJ A;  2HMI A;  4LQ3 A;  2OEM A;  1VC5 A;  1FEE A;  1TVR A;  4J9N A;  3MXH P;  3M9N B;  2B8Q A;  1UW4 A;  3KJQ B;  1N5Y B;  1NKB A;  1JLC B;  3R5C A;  3TR5 A;  2VFV A;  6AT1 B;  4WTO B;  5E3P A;  3TAM B;  4KB7 A;  3QO9 A;  2AJQ A;  2AJ2 A;  3CPW R;  1I5O B;  4JBC A;  4U95 A;  4ECS A;  4KH1 B;  3T5K A;  1RIS A;  1RT3 A;  1B0T A;  2HHU A;  4ICL A;  1HQE B;  3GPA A;  7FDR A;  1HBU B;  4DV7 J;  3C16 B;  1T05 B;  2JVO A;  1BGX T;  3MPY A;  1H98 A;  3BH7 B;  3E3X A;  2AHO B;  3HVT B;  3MDF A;  3CTR A;  4B08 A;  3MED A;  2C42 A;  4DLE A;  1UJ4 A;  5D78 A;  1WWH A;  3DRX A;  4ZK7 M;  3H5S A;  4DPT A;  2DNH A;  4PEO A;  3W2W A;  2MHE A;  2AEJ A;  3BKT A;  4HHU A;  2NUH A;  1FT8 A;  3CO9 A;  3J7Y U;  2Q1L A;  4X62 J;  3DHW C;  2UVV A;  3GJS B;  2HAF A;  1REG X;  2AJF E;  1JLG A;  1DJ0 A;  1GXL A;  3DRS A;  4HTJ A;  3MWB A;  1YZ6 A;  1LWE A;  3PYG A;  3MR5 A;  3SMZ A;  3ENW A;  4LFB F;  2DHH A;  5K14 B;  2FGC A;  3OR2 B;  4XO0 A;  2KHC A;  5KFC A;  3LP0 A;  4JI7 F;  1RU1 A;  3GP9 A;  3MZI A;  5AJ3 F;  3OVA A;  4DPO A;  2CNO B;  2R7R A;  4MYU A;  1UW9 A;  3T6B A;  2FJB B;  1RT5 B;  5CYM B;  4UOC A;  2AV5 A;  4X4T A;  1MWQ A;  1IKV A;  2M0G B;  3I5A A;  1HNV A;  3H42 A;  5B0G A;  1DZ5 A;  4OHY A;  2RNE A;  2HS4 A;  2NXE A;  3KK2 B;  1ZTW A;  3CC4 S;  1DTT B;  3TQ1 A;  5ETO A;  5D6G A;  3HHD A;  1RXO B;  3BBB A;  3VVU A;  2BA9 A;  1WDT A;  4MTP A;  3IWL A;  3ENQ A;  3AY0 A;  4P7T A;  3VAJ A;  4CWB A;  1H74 A;  4WP8 A;  2B7C B;  2OHD A;  1TZ0 A;  5B0D A;  5EN1 A;  2OGU A;  1VRT B;  3W63 A;  2UVW A;  4O4G B;  4LF6 J;  4K4S A;  1W25 A;  4MK9 A;  1QSL A;  3MUR P;  3N79 A;  3RTV A;  4ERD A;  3M8S A;  4NLR A;  2DYA A;  3LOU A;  2HQG A;  1X4H A;  3DI6 B;  1B0V A;  1JXL A;  2XUL A;  3GG1 A;  4LRC A;  2AKW B;  3KHR A;  1S5Z A;  2PA3 A;  5D4L A;  1HQU A;  1IVZ A;  1NK4 A;  1VBK A;  4NXM J;  1T3N A;  4ECR A;  3JQM A;  1IR2 A;  3PZP A;  2A1B A;  4LSL B;  3MM5 B;  5J2N A;  2ZUG A;  4ETX A;  1IM6 A;  1X4F A;  3Q8R B;  2W9A A;  1C1B A;  4ZN3 A;  1T0T V;  5JMN A;  1N36 F;  1KLN A;  2LCW A;  3KJN B;  3MMA B;  1KSP A;  5H9E J;  1PIE A;  1FJG J;  1OJ4 A;  2FPH X;  4CRJ A;  1YJ9 S;  2MHN A;  3WBZ A;  3B6B A;  3ZO7 A;  2DIT A;  4E8U A;  2E1P A;  2YPZ A;  2RIL A;  4EGL A;  3GCX P;  3NEK A;  3K8V A;  5DG9 A;  4DSF A;  3T1H J;  2IBO A;  1HYS A;  2QRR A;  3MEG A;  2VPW B;  2E5L J;  4E98 A;  5A0Y B;  4ENO A;  3K5L A;  4FDF A;  4Y2M A;  1G6B A;  4G1Q A;  5HLF B;  4U8Y A;  3D54 A;  1TKX A;  3QGH A;  1KFD A;  1NND A;  4QYZ K;  2G1H A;  4GKK F;  4A46 A;  3CDA A;  3HM9 A;  3BGF A;  2JEI A;  4DPY A;  3HHK A;  2W7O A;  2PT0 A;  2XY7 A;  1CJT B;  2YWF A;  3CXC R;  1U7L A;  4USW A;  1WHW A;  2VQF J;  4EBD A;  1S4E A;  4P72 A;  2YVS A;  2CJ9 A;  3QJP A;  3SFU A;  4NLO A;  2DTJ A;  2JHE A;  4HKQ A;  4ZVO B;  1RAD B;  3MMC A;  1C1C A;  1MWZ A;  2XMW A;  3K8W A;  2HFZ A;  1X4C A;  3GFZ A;  2UUW A;  2B43 A;  4DSK A;  5G0R B;  4WK3 A;  1K73 T;  2LXI A;  2NXJ A;  3KUG A;  1IR1 A;  1HNI A;  1HNW J;  1K1Q A;  5T41 A;  1HI0 P;  3LW5 C;  2JC1 A;  1FRX A;  3KLF A;  5HP1 B;  2Q79 A;  1FK9 A;  1H38 A;  2B6A B;  4OL8 A;  1IWA A;  1N0V C;  3TEH B;  3AD8 C;  3ZTO A;  3TEG A;  2R7Q A;  2V8G A;  1NK0 A;  1R8P A;  1YBA A;  2IPO B;  1J5O B;  2L9N A;  4ZVR B;  3IR5 B;  2LQB A;  4I4B A;  2OPR A;  2VOD A;  2VG6 B;  2AYM A;  5K20 B;  3MAA B;  2DHX A;  2ASY A;  2EK6 A;  2DNN A;  3BPD A;  1TFW A;  2IC3 B;  2DCU B;  2LQ5 A;  2MPU A;  9RUB A;  4Y2K A;  3CCV S;  5J1P A;  4KRW A;  1Z2Z A;  2OEK A;  4K2X A;  4H4K A;  4OHW A;  4YUD A;  1HWU A;  4KIA A;  4IO9 Q;  3MUM P;  2R2R A;  2CQP A;  3C6T B;  2R7X A;  3MOJ B;  4Z2X A;  3DOK A;  1MN7 A;  4G6V B;  4CO3 A;  3C8Y A;  4DPX A;  1BWV A;  3PO4 A;  2RQC A;  4B9N A;  1DAR A;  1RTH B;  3THV A;  1Q82 T;  4R0E A;  1BQM A;  3WQP A;  3G87 A;  1AYE A;  2OO4 A;  2MQQ A;  3CJ4 A;  1XNQ J;  3ITH B;  4IUF A;  4P71 A;  4J9O A;  4RWX A;  1F5C A;  2QIF A;  4USJ C;  4C8M A;  5F0W A;  2G1D A;  3OW2 R;  1HBM B;  3FZB A;  1Z2L A;  2X1F A;  2YTC A;  5LJ3 Y;  2PEB A;  5C2C A;  3LP1 B;  1XBW A;  5KFR A;  2EFP A;  2GMH A;  4CTA B;  2W9B A;  2R8I A;  3MM7 A;  3C6U A;  2MKH A;  3HKZ D;  4RW4 A;  1NU4 A;  4DQQ A;  4NLG A;  1WKJ A;  3M2V A;  3V6J A;  2GFF A;  4IG0 B;  4KHR A;  2E9R X;  3MM9 B;  2F8E X;  2QV6 A;  4U6P A;  4W4M A;  1CJU B;  4HDG A;  1S9F A;  4JV5 F;  3OT9 A;  2ZH8 A;  1BUX A;  1RT6 B;  1NZ8 A;  5A8R B;  1BQX A;  4YY3 F;  2QZ8 A;  1L3K A;  4PG5 A;  1FE0 A;  4O0I A;  4QW9 A;  3V6H A;  1Q81 T;  2AYB A;  3N5B A;  3OUY A;  1RLD A;  1S6O A;  1U24 A;  2P5V A;  4ZJO A;  3SV4 A;  3N6L A;  3O6Q A;  2ZBR A;  2CPE A;  2EVZ A;  4IH6 A;  4OZ5 A;  2W7P A;  4JI1 F;  1TUV A;  3JTO A;  4LSN B;  3AOC A;  3N6M A;  1UPM B;  5B7W A;  2WB1 D;  4G3I A;  4DEZ A;  1AT1 B;  3VVT A;  1TV6 A;  1S9G A;  3HO1 A;  2PE8 A;  2QSW A;  1ZYQ A;  3GYN A;  5B0A A;  2EG2 A;  4KSE B;  2Y0B B;  3IBF B;  3OTE A;  2GIQ A;  1RWM B;  1FF2 A;  4WZQ A;  1T3O A;  3NLC A;  5HMX A;  4OJ1 A;  2PSZ A;  2V9K A;  3ET6 A;  5BJR A;  1RAO A;  2ALZ A;  4ED5 A;  4B3T F;  1XIQ A;  2XHC A;  3ILO A;  2DR9 A;  2C3U A;  1SKR A;  4FN5 A;  5CXT A;  4EEY A;  1T9W A;  3ILI A;  1HFE L;  3LAK A;  2VBX A;  2DNL A;  3DRR A;  4ZA1 A;  5D15 A;  3ELH A;  4LF6 F;  3HFV A;  1QTM A;  3K2Y A;  5ETL A;  3KK1 A;  4DDF A;  2NXN A;  2MKC A;  4OYB A;  1NH7 A;  1OSD A;  4WWS A;  1KEK A;  2CDQ A;  4M5L A;  2UUC F;  4DU8 A;  3GV5 B;  2BQ3 A;  2YX1 A;  2RU9 A;  2Z57 B;  2V4J B;  1JX4 A;  1JXV A;  1LXJ A;  3I9V 9;  2BJ1 A;  4F8R A;  1UWB A;  1YLX A;  4NWB A;  1QDU B;  2CYY A;  4YEA A;  1ELO A;  2C28 A;  2W9C A;  2MZR A;  4DCP B;  4C7Q A;  3DLK A;  3CD5 A;  2DT9 A;  3VGT A;  1GQE A;  5EX0 A;  2GAG C;  3NCR A;  3C46 A;  4Y0F A;  2KVQ E;  4NEY A;  4DPW A;  4O44 B;  2OLW A;  2X51 A;  1FRJ A;  2IJF A;  3A12 A;  2MST A;  3SSS A;  4I7F B;  4DUZ J;  1TAQ A;  2V69 A;  2XM3 A;  4LF5 F;  1AW0 A;  4OJG A;  4IH7 A;  5KFN A;  5L1L A;  1FJG F;  2W2O P;  2J9D E;  2FZC B;  1RTZ A;  4W92 B;  2R7S A;  3W61 A;  2XO7 A;  2XS5 A;  1ACM B;  3EWG A;  3RBX A;  1IKW B;  2V63 A;  3UWT A;  4IOB A;  1NLK L;  2Q6B A;  4UUX A;  1JLB B;  3W60 A;  3ULH A;  4F4A A;  4IG3 B;  1SJR A;  2XMK A;  3IWN C;  1T9T A;  1Q95 G;  1R0B G;  1S12 A;  2KZM A;  3R5B A;  3V81 A;  4L6V 3;  1LKZ A;  4ATN A;  4J9L A;  4TVA B;  4CYU B;  1L3S A;  3MFI A;  3A8I A;  1RHK B;  4A8F A;  1H2U X;  3V4I A;  3JAM Y;  1WDD A;  1EKR A;  2DO0 A;  3DLG A;  1IJE B;  3CW2 C;  2BDP A;  3FBB A;  3IM8 A;  1XC9 A;  3GB0 A;  2D69 A;  3U1L A;  5KFB A;  2CPD A;  2WRM A;  3KLE A;  2LDY A;  4DX8 H;  1RA7 A;  3P5T L;  2GGP B;  4ZPT R;  3CCU S;  2EFN A;  5DQG A;  1S72 S;  2OFH X;  4U7C A;  1H6K X;  2P9E A;  2WB4 A;  4IOA Q;  4DG1 A;  5KFS A;  2DPJ A;  1NZA A;  2HNZ B;  2RSQ A;  2ZIT A;  2K3I A;  4P6Q A;  2R2U A;  4RUB A;  1FDB A;  3V5R A;  1CQN A;  1R8H A;  4PG8 A;  1AUS L;  3V6D B;  5F41 A;  1JKH B;  3MM6 B;  4PUO A;  3BGO P;  4ZHR B;  3DOL B;  2UU9 F;  4OYI A;  3HZE A;  2ZE2 B;  2ZUA A;  2ZEJ A;  1ZBT A;  2QA4 G;  3CCL S;  3LP2 A;  2RAQ A;  1NJW A;  1NH8 A;  4HYK A;  1HMV A;  5HL7 Q;  3Q8S B;  2FVQ A;  4DUY J;  1SB6 A;  1V3S A;  2HQC A;  3NMA A;  5HMZ A;  2NR0 A;  3TWZ A;  3QAT A;  1VQY A;  5HQ8 A;  1C0U B;  1JB0 C;  5E3C A;  2HVH A;  3EDR B;  3KJF B;  2E44 A;  2XWX A;  5IZH A;  3L7U A;  1SIW B;  2ZH4 A;  5L1J A;  1PBU A;  2MMY A;  1VQ7 S;  2R7W A;  3ILL A;  1LWF B;  2VF3 A;  3DU5 A;  2QA2 A;  3HHL A;  3PYE A; 
#chains in the Genus database with same CATH homology
 3BBB A;  3G2X A;  2HVE A;  1MN9 A;  3VGS A;  3VVU A;  2NCK L;  1BHN A;  3EJM A;  3JS9 A;  3Q83 A;  1ZS6 A;  4AND A;  3PJ9 A;  4DI6 A;  3BBF A;  1UCN A;  3ZTS A;  1XIQ A;  4HR2 A;  1U8W A;  1B99 A;  4FKX A;  3ETM A;  4C6A A;  1MN7 A;  3B6B A;  1KDN A;  3NGS A;  1BUX A;  3Q89 A;  3ZTP A;  3B54 A;  5BXI A;  1B4S A;  1HHQ A;  4UOF A;  2DYA A;  1NB2 A;  3EM1 A;  1PAE X;  1EHW A;  1NSP A;  3FBE A;  5CAA A;  1NCL A;  2CWK A;  2B8Q A;  1LWX A;  2DXD A;  3DDI A;  3FCW A;  3ZTQ A;  3BH6 B;  1NSK L;  3ELH A;  4FKY A;  4S0M A;  4ENO A;  1NUE A;  3VGU A;  3PRV A;  1NLK L;  1LEO A;  2HVD A;  5CAB A;  1NSQ A;  3ZTO A;  4O0N A;  4ANC A;  4EK2 A;  1NDC A;  2DXE A;  2ZUA A;  1S5Z A;  1BE4 A;  4F4A A;  3FC9 A;  1W7W A;  4ANE A;  3Q8Y A;  3BBC A;  3DKD A;  3Q8V A;  1NDL A;  3GP9 A;  4UOH A;  1F3F A;  1S57 A;  1WKK A;  3EVM A;  3NGR A;  1XQI A;  2DY9 A;  3Q86 A;  2VU5 A;  3R9L A;  4CP5 A;  3EVO A;  4KPC A;  1PKU A;  4DUT A;  3NGT A;  3MPD A;  4UOG A;  1NDP A;  2AZ3 A;  3Q8U A;  4W98 A;  3VGV A;  3ZTR A;  1JXV A;  1HIY A;  3GPA A;  5IOL A;  3FKB A;  1S59 A;  4WBF A;  3EMT A;  3ENA A;  3EE3 A;  1F6T A;  3VVT A;  1NHK L;  1VYA A;  3BH7 B;  4DZ6 A;  3L7U A;  2AZ1 A;  4F36 A;  2BX6 A;  3EIC A;  3WX8 A;  3VGT A;  1NPK A;  2B8P A;  2BEF A;  1NDK A;  1HLW A;  1WKL A;  3FBF A;  3FBC A;  3FBB A;  5C7P A;  1WKJ A;  3NGU A;  2HUR A;  3EVW A;  1K44 A;  3FCV A;  2DXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...