1NHKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The 1.9 A crystal structure of a nucleoside diphosphate kinase complex with adenosine 3',5'-cyclic monophosphate: evidence for competitive inhibition.
pubmed doi rcsb
source organism Myxococcus xanthus
total genus 41
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nhkL00
3EVOA 3VVUA 4ANEA 3FBEA 2DXFA 3PJ9A 3FCWA 4F36A 1LWXA 1S59A 1NUEA 1UCNA 1LEOA 4KPCA 1S57A 2HURA 4W98A 4CP5A 4ANCA 1BE4A 3JS9A 3Q8VA 3FBBA 3WX8A 1MN7A 3BH7B 3ZTOA 3Q8YA 3Q89A 1KDNA 5C7PA 4C6AA 3NGUA 1EHWA 4DZ6A 1B99A 3FKBA 3PRVA 4HR2A 3BBCA 3EE3A 3FBCA 2B8PA 3B54A 3FCVA 3ETMA 1HHQA 3NGTA 1NHKL 1NLKL 2DXDA 1NDLA 1NPKA 3BH6B 3NGRA 3ZTPA 3ENAA 4FKXA 3ZTSA 3FC9A 1XQIA 2AZ3A 2CWKA 3EICA 1BHNA 4UOFA 3VGVA 1BUXA 3VGTA 1NCLA 1W7WA 3Q83A 1S5ZA 3ZTRA 4WBFA 3EM1A 2VU5A 2B8QA 4EK2A 1JXVA 2BEFA 3L7UA 3EMTA 5BXIA 1HIYA 3Q86A 3VVTA 2HVDA 5CABA 1HLWA 1NDKA 2BX6A 1K44A 3BBFA 3BBBA 2DYAA 5IOLA 1VYAA 3DDIA 1WKLA 1U8WA 2DY9A 4DI6A 3R9LA 3VGSA 4FKYA 4ENOA 2AZ1A 4ANDA 1XIQA 1F6TA 3VGUA 1NSPA 1WKKA 1B4SA 1NDCA 1ZS6A 3GP9A 5CAAA 4O0NA 1WKJA 2DXEA 3ELHA 3MPDA 3Q8UA 1NSKL 3G2XA 1F3FA 3GPAA 3FBFA 3NGSA 4DUTA 1NB2A 3ZTQA 1PAEX 3B6BA 3DKDA 3EJMA 2ZUAA 1PKUA 2NCKL 4UOHA 1NSQA 2HVEA 1MN9A 4S0MA 3EVMA 4UOGA 1NDPA 4F4AA 3EVWA
chains in the Genus database with same CATH superfamily
1GQEA 4PG6A 1Q8KA 4AL6A 3W9JA 5B7WA 4TLRA 5LMNJ 2DNLA 4W92B 2QT7A 2K3IA 2HQDA 1XERA 3CJQA 2JX2A 3LW5C 4OYMA 1HARA 2CRLA 1H2UX 2BACA 1S9EA 4FP9A 1UEKA 1Q7LB 2CQPA 1N34J 2M7SA 4WFNQ 2FVPA 3RBEA 5HVFA 1LWCA 3WC2A 2ZDOA 1DLOA 2M0GB 2BJ8A 3C8YA 1S10A 2OAUA 5E3QA 4BWMA 4C48A 4DLEA 5EWGA 4B9LA 3GG0A 3PX6A 2OIHA 5EN1A 2M8DB 5BJRA 4QYZK 1U24A 1VI7A 2MEWA 1UJ6A 2DO0A 1VOMA 3EDRB 2LA4A 2CA9A 1JLFB 3TAQA 1WC5A 3I87A 5KG5A 5CCMA 1ZPVA 2BOAA 1QM9A 1RTDB 3T5HA 1M90T 1KS2A 1N36F 1TKTA 4HTJA 4DQSA 1WHYA 3I55S 3NAIA 2YWGA 3CD0A 4DPYA 3VQSA 3MEGA 3PHTA 1S1XA 2ROPA 4CO3A 1QJHA 1G4CA 2HFUA 1YJNS 3TRGA 1ZYQA 2MKIA 4QR2A 1Y9OA 2JH3A 2MQMA 2XO6A 3VAIA 3BBCA 1DJ0A 1WHVA 3A8EA 1XK8A 4BLGA 3V81A 4NLXA 3D67A 3R8YA 1I94F 1K1QA 2J0XA 4DLGA 5B0AA 4X2BA 2XLJA 4USHA 1BD6A 3QLHB 4DPTA 4DG1A 5AXMA 2ZBPA 4MFBB 5D77A 1QY7A 2AJ1A 3KLHB 3W9IA 1N4LA 5B08A 4RKUC 4DX8H 4NLOA 2B43A 3CDBA 4WZMA 1IR0A 5D4PA 2DK2A 1VQNS 2HQ3A 2GJ2A 5KG1A 3A8KA 1SBRA 5AE2A 2XZDB 5M2UA 3E01A 4X4VA 2A6OA 2HFOA 2CPIA 5DDQC 5LSLA 3DFEA 4B3MF 1YBUA 1WELA 4B3OA 1AZSA 2VFSA 5EDWA 4F0MA 4ANEA 2D41A 2ZOGA 3K5OA 3CIMA 3JAMU 2E5LF 3DGPA 2C2DA 1LNQA 5CQGA 4C0HA 3FEXB 1HR0J 2UV8G 3CJ5A 1EX8A 2YNIA 4KKOB 4KC5A 1X0PA 4LF4F 1S6PB 4DZ6A 5HMXA 2O1PA 5KFCA 1YTYA 3M2UB 3H59A 2JZ5A 5LM7E 4P10A 1HNIB 3P45B 4Q43A 3QMQA 2VBYA 1HNWJ 3M8QB 2FHMA 2ADBA 2HRUA 3T1YF 1S0MA 2Q43A 3R5JB 3BN7A 1RHJB 1NJIT 3VVTA 1AFJA 2GMJA 1CJUA 2YBVA 2F9DA 3TJ9A 3IC1A 3N9UC 6FD1A 4DL2A 3MEGB 1IXKA 3EPIA 4KGVB 4XDCA 2VB6A 2H48B 2QMWA 1KVIA 3AY0A 4NRUA 3T5KA 3ENQA 2DKOB 1QSLA 3Q8SB 4YN3B 1C1CA 2FJAB 3NP5A 3DOKA 3TQ1A 3TAMB 2DH9A 4W4MA 2QZ8A 4PWWA 1GMVA 1PGZA 3ZZUA 1KRPA 4UQGA 1DHMA 1K0TA 2BW7A 3W2WB 5E3PA 1RZMA 1RTHA 5CYQB 3OV7A 1IKWA 3W8PA 2PMWA 4NXNJ 2KXNB 4LFCJ 1RWKB 3KUEA 1JLQB 4RNNA 2HAIA 1F1BB 2PEHA 2V4JA 2GQQA 1NJYA 2RH3A 1U1LA 1RTIA 2VU5A 2BEFA 4I7FA 2NUUG 3A3PB 2W9CB 3MEDA 4RJVA 1AT1B 2BJ3A 3N79A 2V9KA 1NH8A 4DQQA 2E66A 3OXGA 2AX1A 1PIEA 2V0NA 2PFDA 4OZ2A 1RK8A 4IFVB 2LU2A 3SV4A 4A4JA 3N0VA 5BYQA 3AOAA 2L9WA 3T6BA 3FMWA 4DSKA 5F0WA 1SJQA 1SXLA 3HDSA 3J7YU 5I42A 3R5AA 2A10A 3CEDA 5HMWA 1YBAA 2ZHBA 1M5KC 2OTJS 3BM7A 3QQCD 1WG5A 2KVQE 1U1PA 2B8PA 4RPFA 1DTQA 3M6VA 1X5PA 4C8NA 5GAEU 4MKAA 3M32A 4RUBA 4URSA 1T02A 2DNMA 3GV7B 4I2PB 2HVDA 4I69A 3PRBA 3D4JA 5HQLA 4UT4A 3A3NB 4NEZA 1C1CB 4DR6F 3M8SA 4ZLNA 2V8VA 1WC4A 2DJWA 4F4YA 4FBUA 1HBNA 2W7AA 2YH0A 5KFWA 1JK9B 3TUZC 2AEMA 4K0KF 4AXJA 4TY8B 2XC9A 3QZ8A 4G65A 2ZHOA 2HNYA 2HIQA 3C15A 4TYAA 3P6YC 3LWMA 4UOGA 2ZOFA 4EUVA 4Z2XA 3HKWA 1JLCB 4JI1F 1U0HB 4EGLA 4ECZA 2EC2A 1HWUA 4YHHJ 5DQHA 4RX6A 5KT2A 1DARA 3KMQA 4CO0A 4Q5VA 4I7FB 3DLHA 1H3DA 3IG1A 3VAFA 1VDHA 1FDBA 2JRSA 4PUOB 3FJ2A 3MD1A 4PYAA 4WK1A 4Y28C 4OYPA 2M52A 2AZ3A 2HBQB 3KNGA 3G6YA 4M95A 3D66A 2XMWA 1UEUA 3QRQA 3CE8A 3AJ1A 4ED7A 3OQ2A 3MOJB 2BE2B 3D54A 1I5OB 5HP1A 2YKAA 4KRWA 5HLFB 4C3KA 4HL9A 4OI1A 1EQ0A 5KAKA 2QRRA 3O44A 5I42B 3ADAC 1REVA 2DR6A 3QGPA 2NSCA 1VRTA 2QEXS 1PO6A 4YOEA 4GKJJ 5HO4A 3DDKA 4OQJA 3TZYA 1DQ8A 2HVIA 1DTQB 2AJQA 4GMKA 1OS5A 2BQ3A 2R3VA 4YB1P 2Q3PA 1WJ9A 1QAJA 2JFKA 3MAAA 3OW2R 3O8WA 3QJLA 2MJNA 5ETTA 2HBYB 2WVDA 1UETA 4YP3A 5C25A 1EIYB 4RNOA 1WF2A 2JDJA 2DHSA 5H9FJ 2JEIA 2VG7B 3A1YG 3ZTSA 3VAHA 3CCSS 2IYGA 5AJ3J 1LWFB 1U1KA 4UOFA 1Y5IB 4DU7A 1T9VA 4B9TA 2MPUA 2APOA 5A8WB 5IC4B 5T41A 1RWPB 5IZHA 4QIFA 2UXDF 5IT9Y 5KG2A 1IJFB 2XY6A 2ZNZA 1Y4ZB 3TO8A 4ALZA 5J1PA 2YKMA 1VGYA 4QWEA 3UDCA 2HPUA 3DRRA 3SBMA 3HJVA 3KHLA 4G1IA 2WZ1A 3HSZA 1S1UA 1LFWA 1CG2A 1U1MA 2DXFA 1WTBA 3ZZYA 2MY8A 4BS2A 5FLXU 4DSLA 1RCOB 2YWWA 3Q2TC 2BJ1A 1YIJS 1BWVA 1VBKA 2R4FA 1HNXJ 4C2MA 5T7LA 4PABA 5HP1B 3G71S 4LF8F 2EW9A 2FZGB 4FZVA 4YDXA 3KTQA 1HPZA 4YB6A 2HWTA 3KK1B 2OGUA 1YRTA 3NWRA 4BC7A 4EK2A 1DURA 4OHXA 2BDPA 4K4VA 2WCXA 5A8RB 3LGHA 2YNHA 2JEJA 1HBUA 4Q2LA 1BXNA 3RR8A 1J27A 5E33A 3DDIA 1UP1A 5A6WA 1G1XA 8ATCB 1SH3A 4FXWA 4GKKF 4J9RA 4CLUA 1Z2ZA 3MAAB 1FRJA 2ZD1B 5ETRA 2CQ1A 2OMOA 4ER8A 1F3FA 3GSDA 2KT3A 3QGGA 3RAQA 1BC6A 2RMLA 1KN6A 1RT1A 4KHMA 5GVQA 4OX9F 4P7TA 2ZJRQ 2X51A 5KFUA 2CQIA 3DLKA 1FXRA 3IN5A 5F9NA 3CJ0A 1F5AA 4J9OA 3PM9A 4IO9Q 1T05B 2U2FA 3CJ2A 1IR1A 2PDAA 3BH6B 3JTPA 2XS2A 1MMDA 1KONA 3DC2A 1TTHB 1KLNA 2CIMA 1D0EA 3HI9A 2RE1A 4X84A 4K4SA 2UXCJ 2R8GA 2F5GA 3M7VA 4N41A 2WW8A 5CHCB 1NK0A 1WUUA 4GVBB 2CNOB 3HHKA 3BPDA 2LQ9A 3BGRB 1UJ4A 3I5CA 3AODA 1WSRA 3MPWA 5KFMA 3FBFA 3MMBB 3GIKA 2DRDA 4KGZB 3GJTB 5T7LB 3BSOA 1U48A 2GW8A 2FTRA 2RRBA 2BBEA 1TV6B 4FYDA 1TL3A 2I6WA 1OSDA 2XHWA 4R5PA 3A4TA 3DNCA 2R7WA 1YK9A 3H5UA 1TMJA 2GX8A 2F4VF 4ZJQA 1CJVB 2M70A 4ECVA 1V9OA 2QV6A 3FGVA 1HBUB 2AIRB 4B3SJ 2BOPA 2X1GA 4OYBA 4Q0BB 1N33J 3PX0A 2B9YA 2ZC3A 2F40A 3KJVB 5D15A 2R2TA 2DNPA 3GONA 2XZWA 4LR7A 4ZITA 3QJJA 2UUBF 2BJ7A 3G8TA 4U7CA 2QE5A 1TKXA 3MM7A 2E9RX 3GFYA 2UVRA 2VUGA 1YI2S 4KTQA 3BF4A 1HD1A 3KK3A 4Y34A 3NCQA 2AYGA 2B56A 3IO1A 4DR5J 1LK7A 4K7QA 3TZXA 1Q16B 4ZDNA 1S1TB 3L3CA 4O4GA 3K5NA 2MZRA 2ZE2B 4DR3J 5K5MA 2VHGA 2IC3B 2YQ3A 3MUVP 4KPCA 3PO4A 1WDDA 4KO0A 2DNOA 3BQ2A 2C22A 1U6FA 1GMUA 4EU0A 2I9SA 2FHKA 3PX4A 2H4WB 1RWOB 3ETMA 2GO8A 1NSAA 1NDLA 3QNWB 4NMLA 1MLAA 1Q5YA 2FVCA 5F8IA 4OX8A 3PYDA 3ET6A 3UW1A 4JP8A 3SQOP 2DH8A 5B0GA 1OYEA 2YNGA 2JVOA 3D3BJ 3T1HJ 3IP0A 4D3GA 1G2EA 2ZEJA 4QIWD 4DI6A 4EBCA 4ID8A 2IMOA 3M2VB 3PXGa 4OFZA 2NXUA 4C0BA 3EWGA 1DRZA 1ZAXA 2D3O1 3DKDA 1UPPA 3SEOA 3M1VB 3NXZA 2HBZB 3FCVA 1C1BA 4DZDA 4USTA 4FVCA 1KBRA 3TUIC 4NLVA 1NRKA 3J81Y 3AD8C 3R2DJ 4ZCLA 3PW4A 3QO9A 4WE1B 2R2RA 4U8VA 3PHEA 1BQNA 3M30B 2MLZA 2IDLA 2XLIA 4L74A 3WDOA 2C2ZB 5EWFA 3EZOA 1VK3A 2MZQA 1N48A 4ECTA 4CNZA 1PAUB 2W7PA 3KLGA 2YKOA 3RZAA 2XTJP 1RBLA 3EPGA 5A2QY 2A3JA 3TA2A 2COLA 1OWXA 3BO2A 2UP1A 4N5SA 3GYGA 3VR1A 3GV8B 4RW9A 3MM8B 1QSYA 4B02A 3TNVA 1BQMB 2XMVA 2VFVA 1FXDA 5DM7Q 3LALA 1D9DA 3LP2A 1IKXB 2BQRA 1PG5B 4EWTA 4LBHA 2AEJA 1CJKB 2H5EA 2X1FA 5DG7A 1P9YA 2CNKB 2DISA 4GRSA 4DF8A 1ITPA 3MGJA 4J37A 2AYMA 2OEKA 4ZMMA 3WX8A 3SSSA 2CPZA 4WIQA 3O6QA 4QR0A 4X4PA 2XLKA 2VG5B 4DUZF 2DH7A 2G2OA 4J9SA 5GAHU 2H4YB 3PJWA 4DR7F 4F4KA 4QYZJ 1HBMB 1M1HA 2ZH6A 1FX2A 2E1PA 3BBBA 2AMCB 2RNEA 2V63A 2FGCA 5GMEA 1QD1A 3SDEA 3AFGA 3CD7A 1SKRA 2DXEA 2XZTB 1RTZA 4LIRA 2DHGA 2IAJB 3G82A 3AA9A 2BJ9A 4TXSA 4ES1A 3SQGB 1OMSA 1PYOB 3I96A 3NMRA 2QLBB 2BKOA 3HT0A 2HNZB 4PPDA 4UOCA 1GTHA 1WC3A 3Q8YA 4IR9A 3FUYA 2CZ4A 4EBDA 2C3YA 1NK5A 4JI7F 4I2QA 2FC8A 2XO7A 1F2GA 5D0HA 4FDFA 5SUHA 3FC9A 3VHQA 1RHKB 4DV5F 2UUCF 2Y8YA 4EO6A 3CDEA 1M5VC 4F4XA 3F0NA 2RT3A 2CJAA 3KUHA 2HBRB 2MZSA 3D9BA 3CO9A 2AJFE 4ECXA 1JXEA 1T8EA 5FD1A 4CTAA 1L3TA 4J9UE 4L6V3 5DETA 1F5CA 1U09A 5LT5A 3MAQA 1FJCA 1IKVA 5H9EK 4URGA 2GVDA 4ED2A 4HEA9 3CJKB 5DJBA 3PW7A 3JTOA 2HVEA 3THPA 2MGZB 5AXLA 4FN5A 4F4AA 3LUYA 1HNVA 3P5BP 1TUWA 4F36A 2RDIA 2W8LA 2VFUA 3QGHA 3RRKA 3L4BC 8RUCA 3I56S 3ZTOA 4DV7F 1QLNA 3D0GE 4O3RA 3I0RA 5I3PA 4OZ1A 4DV2F 3HFKA 4LSZB 2LFVA 5EGYA 1VLYA 2YVSA 4KHPF 4Y3CA 1WHXA 5CYJA 3OR1A 2PI4A 3NY0A 7FD1A 1U2RA 2B8QA 3QATA 2D3UA 1ZTTA 2H51B 2WBRA 3OL6A 2RUSA 3IWLA 1KQFB 4JI0J 4LJMA 1AXQA 5EX3A 4L3NA 2CG4A 1GXLA 5J2MA 4TKTA 2QTWA 2HHHJ 4NLRA 1RWVB 4DSIA 2OELA 4ED4A 4C0OC 2HFVA 2WRMA 2JFDA 4F4WA 2OSQA 1LWEA 2I38A 4LF6F 4WFAQ 4U7UK 4LUBA 3CCRS 1LXNA 2MSSA 3R1LA 2AGPA 2FC9A 3FMBA 2WTFA 3LWLA 2YXLA 3IR5B 2R8JA 2M8HA 4YB5A 2F4FA 1T03A 4LRAA 3PV8A 4WP9A 2QO3A 1NHKL 2B5JB 2DGOA 4IRKA 3D3CJ 5DGBA 5IM0B 4MK7A 3OD2A 4ZVTB 5EUHA 2EI5A 3B78A 1N54B 3BO4A 4A8QA 4DEZA 3MMJA 2F3JA 2JOQA 4HHJA 1T94A 2BM0A 2M5YA 4U8YA 4X4RA 5ITHA 1FRIA 2UXBF 4NPOA 4JI4F 2B6AA 3WQPA 3JAMY 4PAAA 1VC5A 1Z2LA 2DR7A 3C14A 2CQHA 1RISA 1RAOA 4DUYJ 3WC0A 1REGX 4S0MA 1IN0A 4PXCA 4QW9A 1H38A 5LJ5Y 1PJ7A 1JLBA 4GC7A 3HPOA 3AAWB 1VQSA 4WTOB 3PRDA 1Y0HA 1X0FA 2CJXB 4ZVQB 1GEHA 4NRTA 5M2PA 1UTAA 1CLFA 3P5TL 1RT5B 2XMKA 4A48A 3GIIA 3QJPA 3VAGA 1CS4A 1P1LA 1ZZFA 3UDVA 4J9PA 4DOZA 1SC1B 4WU3A 2WSEC 4MMOA 1GMWD 4QWBA 5KFYA 1RT7A 3ETOA 2ATLA 4AE5A 1U1OA 1CULA 5F8GA 4DX7A 1XNRF 3KHRA 3GP9A 3H25A 1HA1A 1FKPB 2NXEA 5HMZA 3H40A 3PVXA 3HMJG 2DO4A 4ZPWR 1URNA 3TVZA 3DYAB 1NK7A 2IYIA 1VCTA 2R7TA 5G0RA 3CCLS 1VS3A 4ILMA 1GT8A 2BJEA 2ZKTA 1X4AA 1WTFA 2BRLA 3UQSA 3PR4A 2XWXA 3C19A 4YR3A 1SQEA 5CA5A 3GFXA 3I9V9 1XJWB 1MU2A 2ZWPA 2PD1A 4C6AA 3ZNJ1 4FXVA 4BBYA 1AW0A 4LF5J 4HR2A 4ZJLA 3EE3A 3HVTA 4URQU 3KDOA 4NLQA 1LFPA 2HLTA 4OZNA 2AF6A 5L39A 5ETSA 4LF9J 4FYYB 2J0QD 2JC0A 5KOWA 4YB7A 2IRXA 3TYTA 2C1EB 1VRUA 3NKYA 4WWSA 3W63A 3WHIA 2UUAF 1APSA 2B9XA 3N6LA 4J9KA 2EPIA 2HHVA 3GMGA 4FXDA 4KBIA 1IBKJ 4RW8A 4HDHA 4A8SA 3DRPB 1SUQA 1TK0A 5A0YA 3QT6A 1XMOJ 2W9BB 3IRWP 1JWWA 3DMJB 5E41A 1RQ0A 4QR1A 4FF2A 3V6DB 4NI2B 3NBPA 4LSNA 4F0KA 1FDNA 2BKNA 2YX1A 3BPSP 1YHQS 1E6VB 2VOPA 5IC6B 1FCAA 2MJUA 4DV0J 1CS4B 2DTJA 3Q89A 2A2DA 3OFEA 3UNYA 3FKBA 4YFUA 4JI3F 3JTNA 4X65F 1RAHB 2MQOA 1XTZA 2DNQA 1NLKL 4WIIA 1RT6A 1WORA 4A8KA 1NPKA 5KFFA 4EO8A 3KHHA 1UZDA 3HHLB 3GJQB 2GAGC 2Z2ZA 4B9UA 4E0DA 4CH0S 2R7RA 3FRYA 1MMLA 1DQ9A 1SJ1A 1CC8A 4OL8A 3MPVA 3IS9B 3OFHA 2AJ0A 4KFBA 1U0SA 2I0XA 3PACA 4CLPA 3I0SB 1UMJA 1B7YB 2JJ4D 3KLIA 1QDUB 5JVHQ 3DI6B 2BANB 2B0GA 2G9OA 2LU1A 2M2BA 5LMNF 2V5HG 2WW4A 1EKSA 3G8SA 1NB7A 3M8YA 3ZTQA 2MMYA 2HFSA 4DV4J 2HHUA 3EVWA 3MM5A 2UUWA 4ED0A 1S1WB 1N34F 1RJJA 4F4ZA 4TNOA 4CIOA 2LKZA 2UU9J 2NUHA 1OQ3A 1S9GB 1FJGJ 5LJ3Y 2MZ1A 2FVRA 5HBMA 4I67A 1AB8A 2DD8S 1FKOA 1U6ZA 2EFNA 4V19X 3ITHB 2WHOA 4LBIA 2OEMA 1UWBA 2J9EA 3UNGC 4JI6J 2VG6B 1JJ4A 4DSJA 2KFZA 4QPXA 2RS8A 2C3UA 1N5YB 4G1QB 2GVZA 2YNFB 4XDDA 1MWQA 2IA0A 2QSWA 3NMAA 4ZKAA 1M5OC 1EP4A 4M63A 3DM2A 4PWDB 4FNIA 4FBTA 2W2PP 1RHQB 4PG7A 3J7Z5 3ENVA 3V4IA 3AT1B 4C11A 2VODA 2ZM6F 3FSYA 4JOUA 1SV5A 1NU4A 4RNHA 2NCKL 4CDIA 4NCGB 2J7KA 3EVOA 3Q24A 1W25A 1FERA 1LQ9A 4F02A 3QIPA 2MZJA 1S6QB 3NGKA 3K17A 5D0EA 2VBXA 1F9HA 5AXKA 1R0BG 4H4OB 2Y0SD 2C42A 2NXJA 1EHWA 2MYFA 1UZHA 1B99A 2P6SA 2W25A 4CCHA 1VJQA 3L9ZA 5D4OA 3NGTA 5ETOA 1MWZA 3MOZA 4KPYA 3IRXA 3HZEA 1OYDA 2GHVC 2ZITA 3KOAA 3MZIA 1TELA 2XEXA 4DV6J 5L9NA 2CQ0A 3JSMB 3CIZA 3ZNUA 2XSJB 3DLBA 4ZIVA 4JV5J 3MM9B 3ONQA 1R89A 4OYXA 1WG4A 4OV6A 2N4CA 2VJUA 4LF4J 1TL7B 4FVMA 4WZQA 1RCXB 3DOMA 2ACMA 2ZUGA 3ZZRA 3W2VA 3LGMA 2POKA 2DVIA 2OHDA 3LP1B 3Q8QB 1HR0F 1N5TA 5IQ6A 5L1KA 2PFFB 2OD4A 3Q23A 3JQKA 4K5SA 3T1YJ 1VQ7S 5KG4A 2K06A 2V50A 2MSTA 4PKDB 4ZVEA 4USJC 2KXFA 1HNWF 2RU9A 3UVJB 3R5CA 1VBZA 5H9FK 2FVSA 4WFBQ 4R8UA 4QPTA 1N6QB 3PCOB 3QT8A 1X4BA 3IR6B 1S48A 3RB3A 4KR0B 2A0FB 4WFYA 1YJVA 2ZH5A 3O2IA 1PSDA 1P27B 1U47A 2AJ4A 2KFNA 2Z8QA 1RI7A 2V8GA 3BN4A 4DCPB 2IJNA 3DRSA 1RA6A 4Z7CA 2FLNA 3BDPA 2CZVC 4IO1A 3L95X 3R6GB 3IM8A 1R0AA 4ECQA 4I6AA 3RBDA 2MQ8A 2C2RA 3VF0B 4EYIB 1JLAB 5HVGA 2XYHB 3M6WA 4F7VA 1G6BA 3S01A 2NS1B 5ETNA 1I6JA 2FHJA 4Y2AA 4LFCF 2P9GA 3GV5B 2HEKA 3HHDA 4UF4A 1VK8A 1Z4UA 1B70B 3BR8A 7FDRA 3MDFA 2DGVA 4C8ZA 1XMBA 1VQKS 3Q22A 2J0SD 4CLZA 3D68A 2HZVA 2DY1A 1H0HB 3CCJS 3UPFA 4AD6A 1FRXA 2QA2A 3W64A 4PQUA 4OLPA 2R8IA 1OY6A 1JLGA 1UVJA 2OD6A 2IJFA 4XAKA 1SKWA 2I2YA 2HMIA 2HHXA 4ZN3A 3H2LA 5KFTA 2QL9B 4ICLB 3GFHA 2VC1A 1U26A 4OYZA 3TUPA 3QFHA 1HYSB 1EB0A 3DLGB 3K58A 1IWAA 4OHVA 4IRCA 2HRTA 4DMZA 2W4PA 3KUGA 3GCWP 5KFBA 2Z0GA 2XG8A 2HHQA 4WCEQ 5C42A 3H2UB 2DR9A 2DHAA 5KFVA 3JQMA 5A8KA 3HVWA 4FPRA 2MY7A 2XYPB 1GFWB 1XR7A 4IFYB 4FS2A 1NBEB 1RTJA 3AQPA 1LW0A 3GCXP 4O44A 1FX4A 2YWKA 2CQCA 4NLGA 1FVSA 1KR4A 3VGVA 4KGKA 1P1TA 2J0WA 2UV8A 2N82B 4K4TA 2LXFA 1QE1A 4JI1J 2NYIA 4J9MA 4ELUA 4HHHA 2WOMA 1X4GA 2CDRB 2F65A 4ED5A 4Y6IA 2BW2A 5J2PB 1Q1KA 1VBYA 2H5JB 2XQCA 1JLEB 1HQEA 2LP4A 3W65A 4N47A 5A76A 2DHHA 2IVYA 3GU0A 3CUNA 4YHHF 3GPAA 1HI8A 3MMCB 4ID5A 1LKZA 1CEZA 5K8MA 4OI0A 2MZTA 1RHRB 1S7IA 2V8DA 2WONA 2W2QP 1RA7A 4WYLA 1UCNA 2R8KA 2B4OA 1BE4A 2OTLS 3LP0A 4O3SA 3HSJA 3J81U 1IM4A 3A12A 2MKKA 3NG8A 5L1LA 2B7BB 6FDRA 2LXUA 2OUGA 4LR9A 4HT7A 8AT1B 4OHWA 2Q6BA 5HROA 3AQOA 1EKRA 4ZA1A 1N5SA 1KD1T 1VISA 1MNEA 1SJ4P 1Q7YT 3KFWX 2GMHA 5A2QU 4GKJF 2GGPA 3BEGB 3H90A 3MR5A 1HNZJ 1DFDA 1GX6A 2QIFA 2YH1A 1HQ2A 5LL6d 2LVWA 3F56A 1UJ5A 3FFIB 2Y1IA 3CD5A 1K0VA 5HSPA 1GXTA 1RTJB 1WSVA 2NYHA 1VQLS 1WF0A 4MK8A 2HURA 1FK9B 4OYIA 1S0NA 4P2MA 5THWA 5AJ3F 3JYTA 4BDPA 1FA0A 5HJXA 3PIOQ 2G2YA 1CJTA 1XEZA 2NPFA 5K14A 1OSCA 5ETLA 1S1VA 2YPZA 3SSQA 1UFWA 1X4EA 4CI0B 4HHUA 1UWAA 2I5JA 5C24A 5J1EA 2XULA 2VFRA 3M8PA 3ISND 4ZP7A 4YDDB 3GIMA 2EG2A 4LSLA 1LW2B 4YUDA 4C8KA 1KVKA 5KFLA 1J5OB 1U8WA 3FK4A 2ALYB 2EEYA 1NJZA 4WXOA 2AD9A 5H9EJ 2OPPB 3I5AA 1JNZB 3VAJA 2J6TA 5HK4A 4KV8B 1KTQA 2XBPA 1P6TA 4UOHA 5IWAJ 1HNXF 2VD3A 2QLFB 3BGOP 3KHGA 3NL0A 3AOBA 2X1AA 4WKRA 3G8QA 4DSFA 2PN6A 2IHR1 3HHLD 4DQRA 3SCLE 4ZPTR 5B0DA 1C0UB 1TQLA 2AP6A 1Y5NB 2PA8D 1JJCB 3JQJA 4GKKJ 3W7BA 1S77D 1IVZA 3OTEA 2P2CB 2KHCA 1BWEA 1ZBTA 2RUGA 4ZPBA 2B4PA 1XMQJ 4CO5A 2ZFHA 3E51A 4QCLA 4AYBD 4ETXA 1C4CA 3TUJC 1TKZB 3MM6A 3QFWA 2Y1JA 3EM1A 1LXJA 1C2PA 3UI3A 4C8OA 2LCWA 3C16B 3RAXA 4OX9J 4WFXA 2LDYA 3AJ2A 5KT5A 3GSIA 4NZ0A 2WBMA 3H20A 4NLUA 4P9SA 5FDLB 3K8VA 1SB6A 1R8BA 1EARA 3I4PA 2M88A 5J2NA 1EZZB 1MW7A 4KSEB 3OJUA 2KM8B 2V2KA 4HI1A 3OR2B 3G86A 2R42A 1Q0NA 1VQ8S 4I64A 2YTCA 5K14B 1PYSB 1FEEA 2RQKA 1DTTB 2ZVSA 2FJEB 5D3GA 1YDLA 3P3DA 5K8OA 2E9ZA 2UVUA 2CKWA 3MR3A 2ZZTA 3C6TA 4X62J 2UXCF 3GIRA 1MMNA 1QVGR 2HZAA 3KLFB 3OUYB 1D09B 4NXMF 2PT0A 3RR7A 3D6HB 3DLEA 2CJBA 5JXSA 1DY3A 2HSEB 1VQOS 2YWFA 1C0TA 3NGDA 3TZZA 3BSCA 3RU0A 3GJRB 1HL6A 3DGVA 2E5HA 3H98A 3W1YC 3ILIA 3EX7B 3BBFA 2YKNB 4UW2A 5KT4A 2F4VJ 3M2RB 4PG5A 4XO0A 2CNLB 2D9PA 5J2QB 2K3KA 2GO9A 2ATCB 2WK4A 2XGQA 1A9NB 3J80U 2ZZMA 3CCTA 3ZZPA 1RAFB 4DUTA 1X7VA 2GA7A 1PKUA 1FXLA 3H42A 4USWA 1F9FA 2VBZA 2KU7A 4B3SF 4WP3A 5F9LA 4RNMA 1N33F 1P9QC 3NS7B 4YR2A 4LFBJ 4I68A 3I6PA 4R25A 3CMQA 4DS4A 1ZOTA 2KRBA 2W24A 4Y2CA 2FDNA 3QSYB 4IH5A 3Q0AA 4P74A 4DCOB 2D7SA 2CWKA 2RHQB 4C8YA 2VPXB 2EXUA 4PQAA 4U9RA 1RT3A 1N5QA 5IS2A 2YQ0A 1AFIA 4CT9A 1GAOA 5K8PA 4DR5F 3UDLA 1S72S 1S9EB 3FCHA 3W5XA 2FLLA 4ZVHA 2NPIA 1CPZA 5D3GB 3BB5A 3CW2C 4DR3F 3V6JA 1LWCB 2ABYA 2MQQA 2CVEA 3DRYA 2XHCA 2OPSA 4A8MP 1DLOB 3HJFA 3ELHA 3BKUA 3C6UA 7AT1B 2BMBA 2QA4S 1TAQA 1F5BA 3O5TB 2CJ9A 1JKHA 2PE8A 3T9NA 3PJ9A 5ETPA 1MSWD 3IWXA 2VV5A 1WNEA 5MAOA 3H7HB 3R2CJ 3AXMA 2KI2A 1N32J 2P6TA 2ADCA 1IBLJ 5HI7A 2HNDA 4A8OA 4IUFA 3PZPA 4L73A 3D28A 1J5EJ 1PC4A 3BO3A 3T1HF 1TKTB 1EETA 3MI7X 2ZH1A 2E9TA 4IDKA 3F41A 1NEEA 3HSGA 1S1XB 1X5TA 1D1UA 2C28A 1Q53A 3GQCA 1Q8LA 3AD9C 3DU6A 5GADI 3OFFA 3PO5A 2QL7B 1UW9A 2DPJA 5DDOC 3V81B 1O51A 2FD2A 2GIQA 1TK5A 1X4HA 2VZ9A 2ZH4A 1ZAWA 4DG1B 1NHUA 4F0HA 3V6HA 4IR1A 1X5SA 4ZPCA 2IJRA 3DLJA 1KSPA 1RT3B 3E01B 3BH7B 3DXSX 5DGAA 4HTIA 3FBCA 2FY8A 4B3OB 1AZSB 3FEYB 3CC2S 3FRZA 1ZM9A 5DZ6A 1NCLA 2CZ9A 2M3DA 3DGPB 6AT1B 1K8AT 3C6UB 4X64F 2YNIB 3GILA 1R43A 5ETKA 2R8HA 4GO5X 1TVRA 4JV2A 1Q79A 1CQNA 3NEKA 2SXLA 3E3XA 4M5MA 2GC8A 4CLSA 2BQUA 3KJQB 1WC1A 4DUZJ 4J90A 1YSJA 2DGUA 1HBOA 2X1BA 2YX4A 1VQ9S 4LT6A 2N7CA 1X4CA 1IBMJ 1IR2A 3IR7B 2Q79A 5K20B 1CJUB 1GH8A 1YJ9S 3IGVA 1GK8A 3LA0A 4R0JA 2AU0A 1HD0A 1RWXB 1MN7A 4IDKB 3G6ES 2RQCA 3MURP 1NAQA 1D9FA 3TX0A 2YY3A 1FVQA 1W26A 1XNQJ 2VFTA 5IT0A 2GS8A 2OPQA 5D6GA 1NZ8A 2H1YA 4DR1J 1H7XA 3DOKB 4F67A 3FSIA 3PG9A 3ZTRA 3T6JA 2DCUB 1VC0A 4B9VA 1FO1A 3HZGA 4DU8A 3M6XA 3DLLQ 2CPDA 3S1TA 1FRHA 1NO8A 4DPOA 1E6YA 3KLEA 3MTJA 2A1BA 1RT2A 2MQPA 2KJVA 2V94A 1RTHB 2VDIA 1IKWB 4LIWA 2NXCA 3NNHA 3GE9A 3OTDA 2V4JB 1TU0B 1UA1A 1RTIB 4PZVA 3GB0A 2Y1RI 3MEDB 3OHAA 1HQUA 3H5SA 4LVOP 1HWIA 1KOOA 4CQ1A 2XSFA 2VQEJ 2ASLA 4AQYJ 2F8HA 5KFIA 3O1LA 4RO0A 2R2UA 3CTRA 4RBUA 1VQPS 3G96A 3NLCA 4DPXA 4NLPA 2QA1A 2A18A 1RSCA 5CYMA 3KK2A 2AW0A 2VIHA 3NGRA 3M8RA 3MFIA 2C2KB 3M8WA 2B3TB 3PY8A 2ZDPA 5KFPA 3HD2A 2Y1LB 5KG0A 3US5A 2RU3A 1HWKA 4OHYA 3PFOA 3OSPA 4C8MA 4IYQA 2EWHA 4QIEA 3THTA 1IUJA 1HBOB 3SYZA 2HVHA 2KDOA 4RR5A 2AT1B 2RHSB 4RNFA 4HLBA 4K4UA 2K1RA 5DRKA 3TJ8A 3D7SB 4Q44A 2RQMA 2A6MA 4ZHRA 2CVIA 4EMDA 3IBWA 3BYRA 3VAKA 4DV2J 4KIAA 1M5SA 4CH7A 2IM2A 3W8GA 1Q82T 4ELVA 4F2RA 4M8LA 4KB7A 3MPDA 1RAJA 4DF4A 3B82A 2QLXA 3M32B 3HT3A 1S49A 4DV3J 3SV3A 3FBEA 2EK1A 2PMZD 4ZVSB 4USKA 1SKUB 3CJRA 1HBNB 5CZXA 1HWJA 2H54B 1V5IB 2KT2A 3HM9A 3W60A 2P5VA 2AJ2A 2H5IB 4HH0A 2XNRA 2HNYB 1FWLA 3C15B 4B9SA 2C3MA 1F3VA 4NCBA 5CD4H 1RT2B 2XMMA 4JI0F 3U1MA 3CJSA 3UCZP 4IG0A 2QFIA 1ZM2A 3BQ1A 4F3OA 3DOLA 3CC7S 1ICEB 3LF0A 3R7BB 2WVFA 1N0VC 1L3UA 5BXIA 2BABA 2M4MA 3IGNA 2MLXA 2GMLA 3IG1B 3CJ3A 2XY5A 2HYIB 2G1DA 3MMAA 2ZH7A 4F2SA 1PBUA 3PDNA 1RWMB 2GV1A 1TL1A 1ZA2B 4PWUA 5D78A 3BDEA 3VVUA 5JVGQ 4M94A 3DN9A 2OPRA 2Q66A 3N5FA 3W5YA 4NYZA 3LOUA 2UVVA 4ZCKA 1REVB 3NNCA 1EJ7L 1VRTB 4UZCA 3K2YA 1OO0B 4U96A 2KL8A 2E1MC 3NOGA 2O66A 3EGWB 4B3TJ 4ZHRB 5FIIA 2IMWP 1RHMB 1HWLA 2RKIA 1IKYA 2NQPA 3GIJA 3MECA 3OLBA 4WBFA 3L7UA 4DR4J 2QJ3A 2OJ3A 4JV0A 4JI2J 2Z2YB 4RWXA 4DUYF 3K0JA 3IWNC 1T9XA 2EBGA 2DY9A 2WB1D 5C25B 1RT4A 2VJVA 4OI6A 2HQFA 3BR9A 1VRQC 1H98A 2RF2A 1SL1A 4C9DA 4M5KA 4BCAA 4PEOA 3BGUA 3OL8A 3RW6A 4ECWA 4CYUA 1UAWA 4LVNP 4ED3A 1SC4B 3FQLA 4DWIA 1HW9A 1PILA 3GWCA 4IG3A 2KKHA 4XK8C 1N56A 2VICA 3GZ7A 4Z7YA 4MIWA 3IA0A 2G4BA 4RW4A 5KT7A 1ULRA 2YKMB 2QFJA 4DPUA 2ROGA 1VFJA 3K59A 1U1QA 3THVA 4PG4A 3DRRB 4A8YA 4N8OA 5L38A 4AUKA 2MKYA 5BR8F 3KYLA 1S1UB 2HHWA 1RAEB 4UQTA 4H4KC 3MR6A 1SKSA 2F8EX 1VR6A 3PJXA 2OKQA 1FJEB 5CCLA 3BREA 3CXCR 2PMHA 4PXBA 4LRFA 2MHNA 1HHTP 2CYYA 3AHPA 1N5VA 4DX5A 5CABA 3UO0A 2DNZA 3X3UA 1WKLA 3T19A 1F6TA 2V9WA 3HVRA 3D5MA 4UY85 2CQ2A 1HPZB 2V34A 2XS7A 3N6NA 1R6YA 3K89A 3GYNA 5GAGI 4OZ3A 2B7CB 1G3OA 1YWXA 3QBCA 2ASJA 4LF5F 5H1SV 1RWUA 2YNHB 4M5GA 2RD5C 5B09A 4PRFA 4B3RJ 3CULA 4A8XA 5CXTA 5F8NA 2MDAA 1S97A 2YPYA 4LF9F 2HHSA 3TX8A 4N8NA 4JBCA 4I56A 1SPBP 4JYAJ 1T0TV 4JI8J 2KO1A 3ISZA 1JLFA 2IPOB 1V3ZA 2DGXA 2J9DE 4YS2A 1RT1B 4CRJA 4YR0A 4DR2J 3RB0A 3PW0A 1H6KX 5KFAA 5D0GA 2I1RA 3A13A 3DLKB 4IH6A 1IBKF 1V6HA 2HK3A 4F25A 1X60A 3BV8A 1FFGB 4DDFA 2BVZA 5DLGA 3TQEA 1XMOF 3RBXA 4PG8A 2R2SA 3HLUA 2AKWB 5GMKa 3E2EA 2XS5A 4JI3J 3D6TB 3UD4P 4ZP6A 2RILA 5BYSA 2DGWA 3KKFA 2MKHA 3H4BA 3B6BA 4LRBA 3QWUA 3EJMA 5AXNA 1MN9A 2ZBIA 2Y8WA 2WSCC 4KQZA 1X9MA 5E7OB 3CPWR 2CG8A 1YKWA 2W4DA 3ICLA 2FHOB 1RABB 4OLOA 2R7VA 3QLHA 2EVZA 2ZWOA 3VWSA 3K5LA 2OO4A 4KGXB 1DAXA 5K9FA 2HRYA 4MFBA 4H4KA 3KLHA 1KDNA 3PR5B 4WU2A 1VIXA 1Z1ZA 3ZXWA 1FD8A 2KG0A 4C98A 1OPIA 1YG0A 1XN9A 2XY7A 2DBBA 4LF2A 1H2VZ 2VOOA 1WHWA 1IM6A 1JQGA 1TL3B 4R5PB 3D0HE 2HVZA 4IH7A 5E3RA 1RU2A 2DEJA 4QIVA 2AEFA 3AD7C 3MCOA 2V68A 1N88A 2Z2LA 1QVFR 2F1FA 3QZ7A 4P2XA 4DFKA 4TQRA 4KJIA 2BA9A 2ASYA 4DV4F 2QSFA 4WKYA 2JLEA 1WKKA 1CBKA 2PO4A 3IBCB 4KKOA 3R5DA 1YITS 1S6PA 2QGFB 4WF9Q 3AJDA 1UFKA 2UU9F 1U4BA 1FJGF 4K5RA 3M2UA 2W01A 2CQGA 4MKVA 2ZUAA 1HNIA 4LQ3A 3CC4S 3M8QA 2FJDB 1RAGB 3L7OA 2D1CA 1LWXA 1TKXB 3MM7B 3CDUA 5DDRC 1RADB 5KFEA 2CNNB 4JI6F 3JS9A 2QLJB 3C2PA 1FFWB 3KK3B 4RUHA 4M5NA 2R7UA 1WWHA 4Y00A 1KQSR 1TL5A 2K7KA 4GVLA 2PGCA 2ZM6J 1PJ5A 1HHQA 1ROFA 1M1GA 4P52A 4NLDA 1TR0A 4O4GB 2MHEA 1KTVA 3CF5Q 3DHWC 3HFZB 3CCWA 1B64A 4Q8EA 2FZCB 2E44A 4KO0B 4OI4A 4QQBA 1D8ZA 4M1KA 4P75A 4N56A 3R5GA 2BRKA 4G3IA 2VC0A 4LBPA 3CJ4A 3S6EA 2GJIA 3TAMA 2FJVA 2FGOA 1FWPA 4ECSA 1A6LA 4LFAJ 1XR6A 4N7TA 3HKZD 1NSPA 1ZS6A 1AA1B 4WJBA 3SFUA 2XMUA 5D8HB 3W2WA 1H74A 4C3MA 3ET6B 1S99A 4ZCMA 2AYEA 1DQAA 2ZBQA 5CYQA 2IA6A 2LQ5A 5M2RA 2YNGB 1RP5A 1JLQA 1PJ6A 1NM2A 2JEFA 4X4OA 2FZKB 1IJEB 2XMJA 4HKQA 3DHXA 2FY1A 2W9CA 4ERDA 4WPAA 3OVBA 2MKCA 1R8PA 4DV6F 4QBUA 5I4MA 1JB0C 2LLZA 3W3SA 1H73A 2C2MB 4HI2A 5D0RA 4JV5F 4RW7A 4HH1A 5B0EA 3TW0A 4IFVA 1C1BB 4CT8A 4Y0FA 1Q86T 4CZCA 1MROA 3ILLA 3FQKA 4K2XA 2KFYA 2L9DA 4M5HA 3SZ2A 2BE7D 2RDJA 3QO9B 1U25A 3SCIE 2DYAA 1BQNB 4WYWA 3QGIA 2K7JA 5JJBA 2X7IA 2EFOA 3PFEA 3GTYX 3CMAS 3AXKA 3M9NB 4I6WA 4ZS6A 3KLGB 3DU5A 3U7JA 2V2QA 2BKPA 2XGPA 2HG4A 2KN4A 1H72C 1UA0A 2LDIA 3SCJE 3O3LA 1YVFA 2CPYA 3CCUS 2X3DA 3B4MA 4RW9B 5EWEA 3WX4A 4YY3J 1S4FA 2Y3YA 3CCZA 1Y3JA 4I2PA 5F0UA 3HP6A 2CUYA 3QYYA 3G9CA 1BQXA 3EGZA 4GC6A 2RJZA 3LP2B 2O67A 2ACYA 2WB4A 1U1NA 1GX5A 3TVYA 2IRYA 5F8JA 3Q2SC 4TY8A 4QIGA 3RJMB 1T7PA 2C2EA 1Y00A 5ETVA 3DRXA 4Q45A 1QAIA 4K4YA 1QAYA 3H8YA 3I32A 3D1OA 2BZ2A 2BX6A 1JLCA 4J5OA 4HVZA 3N28A 1U0HA 1AUDA 4R0EA 4C8LA 2W7OA 1NK4A 2FUG9 4OJ3A 3WIUA 4EEYA 2HFZA 2VA3A 2NSBA 3GR0A 3RRGA 4PUOA 1U02A 2N3LA 3QAUA 2R7XA 1D8YA 1R27B 3W5ZA 4G6VB 2ILYA 4RW7B 1WG1A 4DS5A 1FRMA 2KJWA 3J7ZT 3GLJA 1MROB 3UD3P 2BE2A 3SDEB 3LH2S 1ZM4A 2HHPA 1RGVA 5HLFA 3RAMA 3HX9A 2KB2A 2IM1A 5IT4A 2LQ8A 4PPZA 1QTNB 4ZOSA 1FDAA 3IBFB 3N5BA 1KQKA 1YX2A 2XMTA 3G82B 3VGTA 3J80Y 3TVKA 2CDQA 1FRLA 3SFGA 3V6KA 1UVLA 5IOLA 2AHOB 2A2CA 3G87A 4I2QB 4ITSA 3U1NA 1P8GA 1XC9A 3MEKA 1SQFA 4ZLPA 5CAAA 1NK8A 3EUNA 3N4WA 4RBTA 1HFEL 2RVJA 2IM3A 2RS2A 5LSOA 2VG7A 3QWPA 2DGQA 4H4MA 1LWFA 1L3KA 1TUVA 5LMUJ 3OSNA 3NRBA 1OQ6A 3H4DA 2XNQA 5JMNA 2DNYA 1RUSA 5A8WA 4CTAB 4G1PA 5HQ8A 3HXMA 4ZK7M 4X66J 1TAUA 4BC9A 2ASDA 1IKVB 3OXFA 4ZLJA 2GVDB 1O0PA 2DEIA 2QL5B 3B4DA 1T11A 1H2TZ 1VQ4S 4I1TA 3FSXA 4M5IA 2Z56B 1X8DA 2NLWA 1HNVB 4ZVFA 2RRNA 2I8EA 4NYOA 2H9ZA 2LEBA 2BM1A 4OJGA 3NS5A 1V3SA 1FESA 4ZJOA 3LANA 2HZCA 3GYXB 4O3QA 3I0RB 2FJXA 5DLFA 3AB4B 2DR8A 2GAHC 3UCUP 1SQGA 2AZ1A 2P9CA 4O0IA 3UD5A 4O4RA 4AL5A 3OR1B 1YJTA 3CGIA 4WFZA 3R27A 1F2HA 3N6MA 3I31A 3RB6A 3OBIA 1NDPA 2DPIA 2IVMA 4ZPAA 3RUBL 2KZMA 5DDPC 3KK1A 1U1RA 1M5HA 5J2MB 2DGTA 4FS1A 3Q8VA 1Q8BA 4JI5J 5A8RA 1KWMA 4NL5A 3HULA 4A47A 2DGSA 2G0JA 4X4NA 3TANA 1AYEA 2C3OA 1WC6A 3J7YI 3U27A 4A8WA 3SSRA 2ZD1A 5HQMA 1LWEB 1HNZF 1L3SA 1RKIA 1I51B 1SL0A 4Y2MA 2P8IA 1FHTA 2IRUA 1CVJA 4P7VA 4H4MB 1WACA 4DV1J 1T03B 4PYDA 1S9FA 2J6UA 4DN9A 2MLYA 2E1RA 4MIBA 4CLKA 1VBXA 2AX0A 5U47A 3V2UC 5GAEI 3MUTP 2GHPA 2QC3A 1T05A 3MR7A 2ZHAA 2GJFA 4J9LA 4C3LA 3OTBA 5KFNA 1EAYC 3OHBA 2IDEA 1VIOA 4DL6A 2EKYA 1A7GE 1HHSA 4CO1A 3LPYA 4TU8A 5EHHA 2B6AB 4WXWA 1ELOA 4P2SA 3S8SA 2V4RA 4M5JA 5HN0A 2MXYA 3C14B 2MTLA 4GVBA 5B0CA 4OHZA 3BGRA 3PKYA 4FKXA 3MAHA 2HQIA 4IQXA 3HSDA 3MMBA 1JLBB 4CLWA 1GMWA 2VQFJ 4AFFA 2GCFA 1FNOA 4LF7F 4EI2A 1TV6A 3OTOF 1ZM3A 5DG8A 2D74B 5HL7Q 4ZPDA 1RLCL 5IWAF 3R7NB 4P6QA 1CJVA 2ZOMA 4Q2MA 2W2OP 4IOAQ 3K57A 3JSRA 4PCQA 2OSRA 2W4CA 4Q0BA 1BY9A 3UE2A 1B0PA 1G7CB 4O23A 3KJVA 2AYBA 3IAM9 3QRRA 3MF5A 1XMQF 1RT7B 3D1HA 2RDDA 1CULB 4OIXA 1ZA1B 3KJFB 2CPHA 5LOQA 4NYPA 2J7WA 1FF2A 2PEBA 2HAFA 1KP6A 1Y10A 2P9EA 4ZN1A 3UN5A 2HHTA 5DZ7A 1YJ7A 3UCGA 5G0RB 2BJDA 4C97A 4QU7A 2C3PA 4DN0A 2XCAA 2ZJQQ 1S1TA 5C2CA 3OLAA 3QPIA 1MU2B 2ZE2A 3CCES 1VC6A 3PTWA 2IC3A 3VV2B 2NR0A 1VYAA 3HVTB 3LPEA 4FKYA 3IXQA 2KT5A 4WP8A 4U6PA 1WF1A 4USUA 2F63A 3VAMA 4UUWA 3CWJA 3LTOA 5D4NA 3L09A 2UVWA 1VQMS 2GNKA 4NXMJ 2OEJA 2KXHA 1VRUB 1NSQA 4OZ0A 2L08A 2CPEA 4C7QA 4X62F 5KFOA 1KHVA 3WZ0A 2VPYB 4DBQA 3IAS9 1X9SA 1SVDA 4F3QA 4RW8B 2B4VA 5AE3A 1SUQB 5A0YB 1N36J 1R0CB 2G13A 3DDNA 2E5GA 2EFGA 4OYWA 1SI9A 3K8WA 1RU1A 3M2VA 4LQ9A 5KFKA 3ZTPA 1SC3B 1UL3A 3NBPB 2KZZA 4LSNB 1RBOB 1VJWA 4LRCA 2NZCA 4B17A 3U02A 3R97A 4NE9C 4XTTA 2WVCA 1KKHA 3MCMA 3M1VA 2JC1A 3FZBA 1I94J 4QWAA 4KYZA 1KQGB 2RRAA 4QJVA 1RT6B 4ZVUB 1KFDA 4WE1A 1SH2A 3TAPA 2IVFB 3CO0P 1NSKL 3QT5A 3M30A 3FVYA 2NREA 4MH8A 4NLWA 4LFBF 2HGNA 1FE4A 5F41A 5SZTA 3G6XA 2CPJA 1Y11A 4KFBB 4W90B 1BLUA 4PXDA 3KLIB 4W98A 4CP5A 2HS3A 4F50A 4YQWA 4B3MJ 1RXOB 4NWBA 2J8SA 2AQ4A 3NGUA 1Q4RA 3MM8A 1EQMA 2G0CA 2E29A 5CH7B 2E5LJ 3MFHA 1BQMA 4TY9A 2QX0A 3EYZA 4J9NA 2FJBB 3BKFA 3MM5B 4PR6A 1IKXA 3RYLA 3H2VE 3OL9A 2XYGB 3QRPA 2YKQA 3Q86A 3MD3A 4ILRA 1MG7A 1CJKA 2ZBCA 4X4QA 2GZOA 4ECYA 5HBMB 3WBZA 3CD6S 1FKOB 1NK6A 9RUBA 4L76A 1UWBB 3OT9A 3EZ5A 1NJXA 1YBTA 3HO1A 3G2XA 3TEGA 2CQ3A 2GVZB 1Q95G 2VG5A 4ES2A 1W2BR 1N32F 5DM6Q 4GO7X 4FYVB 1IBLF 1VHFA 1EP4B 3T41A 3DM2B 1LV5A 1SCJB 3FCWA 4NCAA 1OY9A 3TWZA 1J5EF 2CQDA 4I6YA 1HBMA 3V4IB 5IXUA 4C11B 1U8SA 1TP7A 4MKBA 1SV5B 3OXLA 1F0XA 4Q7AA 1HW8A 5ETMA 3D2WA 1ZZNA 4XIUA 2F7VA 2CFXA 4KAIA 1H7WA 4NA2A 2GQ2A 3KG0A 3L7PA 3LGNA 3W9HA 1ZAVA 3QIPB 2W8KA 2D3OR 1JXVA 2FIUA 3FNNA 4DCJB 3CMES 2IAJA 5EX0A 2LQJA 2EK6A 3SQGA 4LMZA 1B0TA 2ZBRA 2DNNA 5CZVA 3BGLA 2HNZA 3R1HA 4X4SA 3IRXB 1JJ2R 4NXNF 4FF1A 4NZ6A 2R7QA 4FPIA 1O5JA 4QWCA 3D0IE 1X9WA 4X64J 1S6OA 2UZAA 3UR0A 1ZTWA 3FBBA 3DOMB 4IKAA 5C7PA 3QT7A 3W2VB 4DXLA 3PRVA 3PEHA 2IY5B 2HK2A 2KVIA 2JLGA 4RL1A 3ILJA 2IFXA 2ZC4A 1W2IA 1R8HA 4RU2A 4OYOA 4I4BA 3SMZA 3CJKA 1B0VA 1Q5VA 4NASA 3PYEA 2MGZA 1RHUB 4EFAC 1T9TA 2CXEA 2RQ4A 1NZAA 2OMLA 4R8UB 2BE9B 2ERRA 2FYXA 5A6PA 3QSIA 3MHYA 3S7RA 1IBMF 5B0FA 5IV4A 4IOCQ 3A8JA 4WTYA 5F3TA 1R3NA 1PC5A 4CLFA 2RIJA 1TZ0A 3PYFA 4DR6J 4L3KA 4MT1A 3AH6A 2XI3A 3B8HA 3ZFVA 3DRSB 1RAIB 4K0KJ 3U1LA 1XNQF 1FEHA 4DR1F 1TKDA 1NKEA 2PC6A 2KYZA 1R0AB 3B54A 2JSXA 3ENWA 2VPZB 1T9YA 4YMEA 4ZCIA 2E7VA 4CO2A 2E5IA 5HATA 2KYXA 3VALA 3M4XA 2W9AA 1URRA 3W61A 4RUAA 4O3NA 1FRKA 5T14A 1O8BA 2G1HA 4MJKA 2OFHX 3J7AN 2J9DA 5L1IA 3LO3A 4UTGA 2G2ZA 1KC8T 4ED1A 1S79A 2ZJPQ 4NZ7A 4QW8A 1MWYA 4D3HA 2VQEF 4AQYF 1I3OB 2N3OA 2B5JA 2QYCA 3OVSA 4J9QA 4PQUB 3HFVA 5IM0A 5F8MA 4TYBA 1JLGB 4K59A 1SC6A 3T5JA 5LXYA 3P49B 1YRXA 2HMIB 3AOCA 5D4LA 1RACB 4Y2IA 5F3ZA 3MWBA 5I3QA 2VPWB 1T3OA 1T9WA 2L48A 1M1KT 1NNDA 3N01A 3MCNA 4MYTA 2F9JA 3M9OB 3LAMA 2NXNA 1XBWA 2FVQA 5C42B 4HYKA 2ZNYA 3K5MA 1RDRA 3ISNC 1BGXT 2UUTA 2J6SA 5A8KB 4K2JA 1U2CA 2R7OA 4ELTA 5GAHI 5L9XA 3JB9k 4MK9A 2CQ4A 3I5BA 1LW0B 4QYRA 4Z37A 2EFVA 4O44B 4DV3F 3TZWA 2G0IA 1YLXA 3NOCA 5J1NA 2CAJA 2UXDJ 4RWWA 1QE1B 3BZQA 1S6UA 3GR1A 1S0OA 2PIIA 2WOMB 3JXOA 3WIVA 1JX4A 2EBEA 1QSSA 5DO2A 2LEPA 2IBKA 1RT5A 3TP2A 1UPMB 1LK5A 1RAAB 3T5LA 4LF1A 2V8PA 3T9ZA 3JSBA 2F8MA 3I4HX 5AT1B 5IQQA 5E2QA 3HHLC 5E3CA 4OJ1A 3TOQA 4FYXB 1HQEB 3OVAA 3CDAA 5HVHA 2LECA 3CVKA 1TUGB 4DL0C 4JUZA 4ID5B 2DB1A 5HJYA 4ED6A 1IQZA 3EICA 3MR2A 4XPCA 4OI3A 2WONB 1FKPA 4ZP9A 2O01C 3SCKE 3EGNA 5LSRA 1JIHA 4CLLA 3ILOA 1OPZA 3LP0B 4LF8J 2YWEA 3DYAA 2HLUA 1ZETA 2Z30B 1WDTA 2EKNA 1WEXA 4BHQA 1X31C 2KH9A 4ZPVR 1VMBA 4KY3A 4NA3A 1RE1B 1LOUA 5HROB 2OH2A 4ILLA 3Q8PB 2ZVIA 2ZZNA 5KFGA 4JB8B 5HAOA 3IFEA 4AL7A 3RTVA 2JEGA 3CNQP 1ACMB 2AGOA 2GIRA 2DHXA 5HANA 5AE1A 1K1SA 2W1BA 4CLYA 1K9MT 3BQ0A 3KG1A 2GGPB 1LEOA 2PI5A 4B3TF 1X4DA 2C2NA 3Q8RB 3VCDA 3NNAA 3POTA 1HI0P 5KG3A 4KT0C 4PXEA 3BYPA 2OI2A 4DR4F 2QA4G 2U1AA 4Y2KA 4ZP8A 2QG9B 4JI2F 4B9MA 4QU6A 4OX7A 1XQIA 3DRPA 1YZ6A 1BHNA 3ZZTA 1Q81T 2J7UA 2W9BA 3DMJA 2MQLA 5KG6A 1WOPA 1NKBA 3JYTB 3MPYA 3V6DA 4NI2A 1NHVA 2VKRA 1E6VA 4NLSA 2CJYB 1CJTB 2HQCA 2BYCA 5KFJA 1S1VB 4B08A 4FNHA 1U6BA 4L75A 1L3VA 5BR8J 1D9AA 2BV3A 2I5JB 5C24B 5J1EB 5KFDA 3M8PB 1CQMA 3SXLA 3KMSA 3CT9A 1PYTA 2HKEA 3HHLA 2C2OB 2M9KA 4LSLB 2DNHA 4DHVA 3UDEA 2LA6A 4ZVGA 1JJHA 1Q78A 5FJ4A 1FT8A 3UFCX 3D1QA 3IS9A 3I0SA 1U45A 3MCSA 2BXJA 4USIA 1QAXA 5LXRA 4YEAA 2MKJA 3DI6A 2KRRA 4U67Q 2BANA 4NLTA 5GADU 2VF3A 2QMUB 2D9OA 3MUMP 1B3TA 2NZ4A 1NKCA 2GHWA 4X4UA 4OZ5A 4K8RA 2DNRA 4USVA 1B7FA 1NDKA 3D6MB 4DL7A 1S1WA 5IV3A 4RW6A 4KH1B 1YQHA 2ROEA 2HQGA 1NJWA 1S9GA 1XIQA 2WAQD 2GFFA 1B4SA 4B3RF 2D69A 3MM6B 2BR0A 3POTB 2UUBJ 2XB2D 3BSNA 3ITHA 1WOSA 4AT1B 4JYAF 4ATNA 3PEJA 2VG6A 4JI8F 2Y0BB 2FQQB 5F8LA 1N5YA 1SJ3P 4G1QA 2ZKUA 2YQ1A 2YNFA 3K5PA 4C4WA 3HHEA 4DR2F 2PSZA 1BMQB 2MKSA 4PWDA 2Z57B 3G6VA 5J2NB 4DFJA 2XCPA 1WEYA 3TJAA 3RB4A 2VA2A 3ZZOA 4UZBA 1RWWB 2CWXA 2ZH8A 2V2ZA 1VQYA 2HWHA 1SIZA 1R31A 3SIPB 4NLYA 3R7SB 3RW7A 5KFXA 1PBAA 4J7CA 4P71A 5DQIA 4NCGA 4A8FA 5B0BA 2H3EB 1VQ5S 1TFYA 3GFZA 1DZ5A 4IQMA 2E5JA 3C6TB 4IOBA 1S6QA 5E3AA 4TU7A 4FF4A 4H4OA 3FZ2A 3DLEB 1UVMA 2IBOA 1FNMA 1NK9A 5KFQA 3HHNB 1C0TB 4OZLA 1PAEX 2IM0A 4P2FA 2JNJA 4RUCA 2CPXA 1NPPA 4J91A 4M5LA 3ULHA 4HACA 3C46A 3JSMA 2V6AA 4CLTA 2XSJA 3GJSB 3MM9A 1YJUA 3T3FA 1K73T 4F04B 2XMAA 1YGYA 1R6VA 4RW6B 2GQCA 3CJ8A 4QWDA 1TL7A 3OPKA 3C3LA 4ETZA 2VKZG 3T1AA 1UKUA 1YJWS 3UN3A 1V5VA 4CM2A 1TFWA 4E2FB 1FJ7A 3LP1A 4O3OA 2HFNA 1KEKA 1UEVA 4TVAB 3E8OA 1GXUA 3KDNA 5RUBA 3EZUA 4HT5A 3DXBA 4X4TA 1U7LA 1S4EA 3ZZZA 4A46A 3R9LA 2VDHA 4MAKA 2MQNA 3UVJA 4LRDA 1WI6A 1IWGA 1O6XA 3KWMA 5KFHA 1N6QA 4MYUA 1AROP 5C5JA 5IT9U 1SJRA 2J9CA 3CCVS 1SJFA 1FE0A 4K4XA 2H65B 4JV1A 2V8HA 1FTRA 3PYGA 1M0SA 1HMVA 3NAHA 2RAQA 1NH7A 4IRDA 4MIAA 2OPSB 4UY8T 4Y65A 2HW3A 3KG4A 4DL4A 3ZZ0A 1GNKA 3QAEA 1VLOA 4NMXA 2KG1A 2W2MP 1JKHB 3I82A 3FEZA 3CJTA 3EXCX 4NX9A 3MXHP 4DFMA 2CADA 3I9ZA 3VZIA 4N76A 1WOOA 4LFAF 1R8CA 2JHEA 2VH7A 2DNGA 4ES3A 1JLAA 2J5AA 2V4QA 2B51A 1K44A 5F8HA 2HNDB 5KT3A 2HGMA 4P73A 4M5DA 2AGQA 2HGLA 1UVNA 4DR7J 4ENOA 4HACB 2X3GA 2OLWA 3BS9A 1FI4A 1RYRA 5L46A 4MKYA 1EETB 4U7UD 2Z4PA 4L72B 2LQBA 1PCAA 3AA8A 4OX6A 2OP5A 2K2PA 1IQTA 4NA1A 4B9NA 4OJHA 4CO4A 2ZH9A 4U95A 4CM0A 3VGUA 5FLXY 1RYSA 1UFLA 1FNXH 1NUEA 1QUVA 2XM3A 4OZJA 1T3NA 3BSAA 4XPEA 4CWBA 3PNIA 3OJSA 4EBEA 2DIUA 2LYVA 4CNYA 4CH1A 2JL9A 5BYRA 2FHJD 4DFPA 1T95A 2VBWA 2N7YA 2OFGX 2L3MA 2V69A 4ICLA 2E1CA 1L5UA 1UVIA 2QLWA 3V5RA 1AUSL 3R5BA 1BUXA 3A8IA 3H5XA 1HYSA 3DLGA 2JLFA 5ADZA 4BWJA 3EMTA 2DITA 4JI7J 3HD1A 5C2GA 5CD4A 4UUXA 5KFRA 1OY8A 4DV5J 3VGSA 2UUCJ 4ANDA 1HMVB 4IFYA 2MB0B 3KJNB 3CDWA 2V2VA 4KHRA 4TN2A 3HCXA 4YY3F 1NXIA 1XR5A 4TU9A 1QUPA 1KLMA 3A3OB 3AB2B 5L8RC 1RBAA 1CC7A 4KGMA 4DSEA 1JNRB 2JVRA 3W66A 1KHWA 2FPHX 2YKPA 1TVRB 9ATCB 5L1JA 3CCQS 2ZH2A 3M05A 3BGFA 5J2PA 3H5YA 4K50A 4ZIWA 1WI8A 5HMYA 2DXDA 1Q8IA 4M5DB 1JLEA 3ENAA 2K8GA 5DS7A 2DIVA 2DR5A 2DCLA 1YJRA 4DV7J 3MMCA 3G4SS 3MPUB 4HDGA 4P72A 1HIYA 4LR8A 1JXLA 5KG7A 2CPFA 3H0PA 4KHPJ 1FTCA 2ALZA 3EGVA 1T9UA 1KNZA 1TL4A 3TA0A 1SH0A 4H54A 2VL1A 5MLCV 1RLDA 2VASA 2OPQB 4OMFG 3ZC4A 1SIWB 4V1Ak 2E1AA 4RLEA 1NB2A 4QOTA 3EDQB 3HVAA 2O5DA 3M8ZA 2Q1LA 2XWYA 3EVMA 4AXIA 4LREA 1UVKA 1SL2A 2KHDA 4J9VA 3TR5A 2EFQA 1F60B 3NS6A 4OV1A 1J2VA 4DQPA 1E6YB 3KLEB 2R7SA 2L9NA 2ILZA 2AWZA 4N77A 2PA3A 3CSKA 2HHHF 3D6FB 5I3UA 1Y5LB 4LF6J 4EZ9A 5E0OA 4E8UA 1DBDA 2LXIA 4EYHB 1HQUB 1NMEB 5JUMA 2Y9HA 3Q83A 3FFIA 2WVBA 1Y7PA 4EZ6A 3BJYA 4RU9A 4O3PA 5KTQA 2HIYA 3LAKA 2QYGA 5GAGU 4USMA 1KLMB 1NPRA 4QZVB 3PKMA 2GIFA 5CYMB 4V19J 1FK9A 3KK2B 1RWNB 3KLVA 2KM8C 1RB0A 3MEEA 4WK3A 1U49A 3GG1A 5LMUF 3MTKA 1S76D 2FJWA 1HI1A 3RRHA 2YX7A 2WVEA 1KOHA 1TK8A 3SI8A 2UXBJ 4JI4J 4X66F 2IIHA 5KFZA 3RG6A 3M9MB 2K1RB 1S12A 1S59A 1FFSB 3IM9A 5IFMA 1S57A 4ANCA 2DNKA 1F9EB 2FLOA 1R8AA 2WSFC 2D3ZA 1LW2A 2B9EA 4I0WA 4DL3A 2CJQA 1ZH5A 1J5OA 1C4AA 1X5OA 1UW4A 1XWLA 4DL5A 2OPPA 1OJ4A 1S0VA 1RKJA 2BUNA 3EXYA 1CSJA 1N8RT 4FYWB 1QTMA 3VTIA 4KV8A 1S5ZA 3P96A 3RBZA 3UWTA 4ECUA 2KTQA 3NWGA 2J8AA 2RSQA 1YRUA 5KFSA 3R6LB 3ZO7A 1C0UA 4F8RA 2LEAA 5K8NA 4IG0B 1WKJA 3DOLB 3J81j 3OTCA 3J7A1 1S7HA 2HS4A 1WC0A 5G4DA 5KT6A 3X1LB 4JI5F 5GMDA 2JWNA 5I3UB 3PIPQ 3CCMS 3P8BB 3OL7A 1XNRJ 3VQTA 1TKZA 3NCRA 3HK2A 4TQSA 2DRAA 3KNAA 3UR3C 1WD6A 1FWKA 3C16A 1VQ6S 4OI2A 3MMAB 4ZVPB 1KVJA 4ZVRB 2AV5A 4NEYA 5DG9A 2CJKA 5FDLA 2EFPA 1ZPWX 1VHIA 1Y3KA 3IMQJ 4DV1F 1TL1B 1V3RA 2E7XA 3DCAA 2OPRB 3MEEB 1W7WA 3JSYA 1M5PC 2J76E 3OR2A 2O3DA 3TI0A 2FB0A 1D3WA 2W2NP 3OFGA 1DTTA 4DQIA 3K7RA 3F73A 3UN2A 3M6UA 4ECRA 3W62A 2R9LA 1GTEA 2HS0A 4ED8A 3VZHA 2EG1A 2UUAJ 1K47A 2RKIB 1IKYB 3QIDA 1I1GA 3NGSA 2Q6CA 2V67A 3MECB 1WEZA 3LQVA 1R7IA 3CB4A 1FKAF 1KFSA 3BKTA 1U2FA 1YZ7A 3OUYA 3KLFA 5KOXA 4KE5A 5E5NA 4K4ZA 2Z2MA 1FD2A 3TEHB 3HF5A 4LF7J 3F44A 4RBVA 3OTOJ 3PW2A 2EC0A 1RT4B 3NCPA 5DQGA 2B4UA 2YWHA 4E98A 2E7WA 1TMMA 4DX6A 2RF2B 4Q8FA 4KH0B 2RB7A 1N0UA 2YKNA 2VQFF 1RTDA 3M2RA 2ZH3A 4CYUB 2DT9A 1HKAA 4IG3B 4DJBA 5J2QA 3C66A 2FLPA 2B9WA 3FDSA 1N52B 4RW4B 2QN6B 3V4MA 4K4WA 5ETQA 4RZRA 4TLQA 4DPWA 2L41A 4X65J 1OIAA 3KXDA 3RGIA 2LMIA 1HLWA 2XI2A 2QMXA 3P4UB 4FF3A 4DV0F 2CQBA 1FDDA 4ZVOB 4MTPA 3R3TA 1A0OB 4OYAA 4ZLLA 2VONA 1NDCA 2HWIA 2Z58B 4O0NA 3Q8UA 1JMTA 4F3MA 3TARA 4NOHA 3TA1A 1IBCB 2N4DA 3PW5A 2DRBA 1X4FA 4F26A
chains in the Genus database with same CATH topology
3EVOA 3VVUA 4ANEA 3FBEA 2DXFA 3PJ9A 3FCWA 4F36A 1LWXA 1S59A 1NUEA 1UCNA 1LEOA 4KPCA 1S57A 2HURA 4W98A 4CP5A 4ANCA 1BE4A 3JS9A 3Q8VA 3FBBA 3WX8A 1MN7A 3BH7B 3ZTOA 3Q8YA 3Q89A 1KDNA 5C7PA 4C6AA 3NGUA 1EHWA 4DZ6A 1B99A 3FKBA 3PRVA 4HR2A 3BBCA 3EE3A 3FBCA 2B8PA 3B54A 3FCVA 3ETMA 1HHQA 3NGTA 1NHKL 1NLKL 2DXDA 1NDLA 1NPKA 3BH6B 3NGRA 3ZTPA 3ENAA 4FKXA 3ZTSA 3FC9A 1XQIA 2AZ3A 2CWKA 3EICA 1BHNA 4UOFA 3VGVA 1BUXA 3VGTA 1NCLA 1W7WA 3Q83A 1S5ZA 3ZTRA 4WBFA 3EM1A 2VU5A 2B8QA 4EK2A 1JXVA 2BEFA 3L7UA 3EMTA 5BXIA 1HIYA 3Q86A 3VVTA 2HVDA 5CABA 1HLWA 1NDKA 2BX6A 1K44A 3BBFA 3BBBA 2DYAA 5IOLA 1VYAA 3DDIA 1WKLA 1U8WA 2DY9A 4DI6A 3R9LA 3VGSA 4FKYA 4ENOA 2AZ1A 4ANDA 1XIQA 1F6TA 3VGUA 1NSPA 1WKKA 1B4SA 1NDCA 1ZS6A 3GP9A 5CAAA 4O0NA 1WKJA 2DXEA 3ELHA 3MPDA 3Q8UA 1NSKL 3G2XA 1F3FA 3GPAA 3FBFA 3NGSA 4DUTA 1NB2A 3ZTQA 1PAEX 3B6BA 3DKDA 3EJMA 2ZUAA 1PKUA 2NCKL 4UOHA 1NSQA 2HVEA 1MN9A 4S0MA 3EVMA 4UOGA 1NDPA 4F4AA 3EVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVO A;  3VVU A;  4ANE A;  3FBE A;  2DXF A;  3PJ9 A;  3FCW A;  4F36 A;  1LWX A;  1S59 A;  1NUE A;  1UCN A;  1LEO A;  4KPC A;  1S57 A;  2HUR A;  4W98 A;  4CP5 A;  4ANC A;  1BE4 A;  3JS9 A;  3Q8V A;  3FBB A;  3WX8 A;  1MN7 A;  3BH7 B;  3ZTO A;  3Q8Y A;  3Q89 A;  1KDN A;  5C7P A;  4C6A A;  3NGU A;  1EHW A;  4DZ6 A;  1B99 A;  3FKB A;  3PRV A;  4HR2 A;  3BBC A;  3EE3 A;  3FBC A;  2B8P A;  3B54 A;  3FCV A;  3ETM A;  1HHQ A;  3NGT A;  1NHK L;  1NLK L;  2DXD A;  1NDL A;  1NPK A;  3BH6 B;  3NGR A;  3ZTP A;  3ENA A;  4FKX A;  3ZTS A;  3FC9 A;  1XQI A;  2AZ3 A;  2CWK A;  3EIC A;  1BHN A;  4UOF A;  3VGV A;  1BUX A;  3VGT A;  1NCL A;  1W7W A;  3Q83 A;  1S5Z A;  3ZTR A;  4WBF A;  3EM1 A;  2VU5 A;  2B8Q A;  4EK2 A;  1JXV A;  2BEF A;  3L7U A;  3EMT A;  5BXI A;  1HIY A;  3Q86 A;  3VVT A;  2HVD A;  5CAB A;  1HLW A;  1NDK A;  2BX6 A;  1K44 A;  3BBF A;  3BBB A;  2DYA A;  5IOL A;  1VYA A;  3DDI A;  1WKL A;  1U8W A;  2DY9 A;  4DI6 A;  3R9L A;  3VGS A;  4FKY A;  4ENO A;  2AZ1 A;  4AND A;  1XIQ A;  1F6T A;  3VGU A;  1NSP A;  1WKK A;  1B4S A;  1NDC A;  1ZS6 A;  3GP9 A;  5CAA A;  4O0N A;  1WKJ A;  2DXE A;  3ELH A;  3MPD A;  3Q8U A;  1NSK L;  3G2X A;  1F3F A;  3GPA A;  3FBF A;  3NGS A;  4DUT A;  1NB2 A;  3ZTQ A;  1PAE X;  3B6B A;  3DKD A;  3EJM A;  2ZUA A;  1PKU A;  2NCK L;  4UOH A;  1NSQ A;  2HVE A;  1MN9 A;  4S0M A;  3EVM A;  4UOG A;  1NDP A;  4F4A A;  3EVW A; 
#chains in the Genus database with same CATH topology
 1GQE A;  4PG6 A;  1Q8K A;  4AL6 A;  3W9J A;  5B7W A;  4TLR A;  5LMN J;  2DNL A;  4W92 B;  2QT7 A;  2K3I A;  2HQD A;  1XER A;  3CJQ A;  2JX2 A;  3LW5 C;  4OYM A;  1HAR A;  2CRL A;  1H2U X;  2BAC A;  1S9E A;  4FP9 A;  1UEK A;  1Q7L B;  2CQP A;  1N34 J;  2M7S A;  4WFN Q;  2FVP A;  3RBE A;  5HVF A;  1LWC A;  3WC2 A;  2ZDO A;  1DLO A;  2M0G B;  2BJ8 A;  3C8Y A;  1S10 A;  2OAU A;  5E3Q A;  4BWM A;  4C48 A;  4DLE A;  5EWG A;  4B9L A;  3GG0 A;  3PX6 A;  2OIH A;  5EN1 A;  2M8D B;  5BJR A;  4QYZ K;  1U24 A;  1VI7 A;  2MEW A;  1UJ6 A;  2DO0 A;  1VOM A;  3EDR B;  2LA4 A;  2CA9 A;  1JLF B;  3TAQ A;  1WC5 A;  3I87 A;  5KG5 A;  5CCM A;  1ZPV A;  2BOA A;  1QM9 A;  1RTD B;  3T5H A;  1M90 T;  1KS2 A;  1N36 F;  1TKT A;  4HTJ A;  4DQS A;  1WHY A;  3I55 S;  3NAI A;  2YWG A;  3CD0 A;  4DPY A;  3VQS A;  3MEG A;  3PHT A;  1S1X A;  2ROP A;  4CO3 A;  1QJH A;  1G4C A;  2HFU A;  1YJN S;  3TRG A;  1ZYQ A;  2MKI A;  4QR2 A;  1Y9O A;  2JH3 A;  2MQM A;  2XO6 A;  3VAI A;  3BBC A;  1DJ0 A;  1WHV A;  3A8E A;  1XK8 A;  4BLG A;  3V81 A;  4NLX A;  3D67 A;  3R8Y A;  1I94 F;  1K1Q A;  2J0X A;  4DLG A;  5B0A A;  4X2B A;  2XLJ A;  4USH A;  1BD6 A;  3QLH B;  4DPT A;  4DG1 A;  5AXM A;  2ZBP A;  4MFB B;  5D77 A;  1QY7 A;  2AJ1 A;  3KLH B;  3W9I A;  1N4L A;  5B08 A;  4RKU C;  4DX8 H;  4NLO A;  2B43 A;  3CDB A;  4WZM A;  1IR0 A;  5D4P A;  2DK2 A;  1VQN S;  2HQ3 A;  2GJ2 A;  5KG1 A;  3A8K A;  1SBR A;  5AE2 A;  2XZD B;  5M2U A;  3E01 A;  4X4V A;  2A6O A;  2HFO A;  2CPI A;  5DDQ C;  5LSL A;  3DFE A;  4B3M F;  1YBU A;  1WEL A;  4B3O A;  1AZS A;  2VFS A;  5EDW A;  4F0M A;  4ANE A;  2D41 A;  2ZOG A;  3K5O A;  3CIM A;  3JAM U;  2E5L F;  3DGP A;  2C2D A;  1LNQ A;  5CQG A;  4C0H A;  3FEX B;  1HR0 J;  2UV8 G;  3CJ5 A;  1EX8 A;  2YNI A;  4KKO B;  4KC5 A;  1X0P A;  4LF4 F;  1S6P B;  4DZ6 A;  5HMX A;  2O1P A;  5KFC A;  1YTY A;  3M2U B;  3H59 A;  2JZ5 A;  5LM7 E;  4P10 A;  1HNI B;  3P45 B;  4Q43 A;  3QMQ A;  2VBY A;  1HNW J;  3M8Q B;  2FHM A;  2ADB A;  2HRU A;  3T1Y F;  1S0M A;  2Q43 A;  3R5J B;  3BN7 A;  1RHJ B;  1NJI T;  3VVT A;  1AFJ A;  2GMJ A;  1CJU A;  2YBV A;  2F9D A;  3TJ9 A;  3IC1 A;  3N9U C;  6FD1 A;  4DL2 A;  3MEG B;  1IXK A;  3EPI A;  4KGV B;  4XDC A;  2VB6 A;  2H48 B;  2QMW A;  1KVI A;  3AY0 A;  4NRU A;  3T5K A;  3ENQ A;  2DKO B;  1QSL A;  3Q8S B;  4YN3 B;  1C1C A;  2FJA B;  3NP5 A;  3DOK A;  3TQ1 A;  3TAM B;  2DH9 A;  4W4M A;  2QZ8 A;  4PWW A;  1GMV A;  1PGZ A;  3ZZU A;  1KRP A;  4UQG A;  1DHM A;  1K0T A;  2BW7 A;  3W2W B;  5E3P A;  1RZM A;  1RTH A;  5CYQ B;  3OV7 A;  1IKW A;  3W8P A;  2PMW A;  4NXN J;  2KXN B;  4LFC J;  1RWK B;  3KUE A;  1JLQ B;  4RNN A;  2HAI A;  1F1B B;  2PEH A;  2V4J A;  2GQQ A;  1NJY A;  2RH3 A;  1U1L A;  1RTI A;  2VU5 A;  2BEF A;  4I7F A;  2NUU G;  3A3P B;  2W9C B;  3MED A;  4RJV A;  1AT1 B;  2BJ3 A;  3N79 A;  2V9K A;  1NH8 A;  4DQQ A;  2E66 A;  3OXG A;  2AX1 A;  1PIE A;  2V0N A;  2PFD A;  4OZ2 A;  1RK8 A;  4IFV B;  2LU2 A;  3SV4 A;  4A4J A;  3N0V A;  5BYQ A;  3AOA A;  2L9W A;  3T6B A;  3FMW A;  4DSK A;  5F0W A;  1SJQ A;  1SXL A;  3HDS A;  3J7Y U;  5I42 A;  3R5A A;  2A10 A;  3CED A;  5HMW A;  1YBA A;  2ZHB A;  1M5K C;  2OTJ S;  3BM7 A;  3QQC D;  1WG5 A;  2KVQ E;  1U1P A;  2B8P A;  4RPF A;  1DTQ A;  3M6V A;  1X5P A;  4C8N A;  5GAE U;  4MKA A;  3M32 A;  4RUB A;  4URS A;  1T02 A;  2DNM A;  3GV7 B;  4I2P B;  2HVD A;  4I69 A;  3PRB A;  3D4J A;  5HQL A;  4UT4 A;  3A3N B;  4NEZ A;  1C1C B;  4DR6 F;  3M8S A;  4ZLN A;  2V8V A;  1WC4 A;  2DJW A;  4F4Y A;  4FBU A;  1HBN A;  2W7A A;  2YH0 A;  5KFW A;  1JK9 B;  3TUZ C;  2AEM A;  4K0K F;  4AXJ A;  4TY8 B;  2XC9 A;  3QZ8 A;  4G65 A;  2ZHO A;  2HNY A;  2HIQ A;  3C15 A;  4TYA A;  3P6Y C;  3LWM A;  4UOG A;  2ZOF A;  4EUV A;  4Z2X A;  3HKW A;  1JLC B;  4JI1 F;  1U0H B;  4EGL A;  4ECZ A;  2EC2 A;  1HWU A;  4YHH J;  5DQH A;  4RX6 A;  5KT2 A;  1DAR A;  3KMQ A;  4CO0 A;  4Q5V A;  4I7F B;  3DLH A;  1H3D A;  3IG1 A;  3VAF A;  1VDH A;  1FDB A;  2JRS A;  4PUO B;  3FJ2 A;  3MD1 A;  4PYA A;  4WK1 A;  4Y28 C;  4OYP A;  2M52 A;  2AZ3 A;  2HBQ B;  3KNG A;  3G6Y A;  4M95 A;  3D66 A;  2XMW A;  1UEU A;  3QRQ A;  3CE8 A;  3AJ1 A;  4ED7 A;  3OQ2 A;  3MOJ B;  2BE2 B;  3D54 A;  1I5O B;  5HP1 A;  2YKA A;  4KRW A;  5HLF B;  4C3K A;  4HL9 A;  4OI1 A;  1EQ0 A;  5KAK A;  2QRR A;  3O44 A;  5I42 B;  3ADA C;  1REV A;  2DR6 A;  3QGP A;  2NSC A;  1VRT A;  2QEX S;  1PO6 A;  4YOE A;  4GKJ J;  5HO4 A;  3DDK A;  4OQJ A;  3TZY A;  1DQ8 A;  2HVI A;  1DTQ B;  2AJQ A;  4GMK A;  1OS5 A;  2BQ3 A;  2R3V A;  4YB1 P;  2Q3P A;  1WJ9 A;  1QAJ A;  2JFK A;  3MAA A;  3OW2 R;  3O8W A;  3QJL A;  2MJN A;  5ETT A;  2HBY B;  2WVD A;  1UET A;  4YP3 A;  5C25 A;  1EIY B;  4RNO A;  1WF2 A;  2JDJ A;  2DHS A;  5H9F J;  2JEI A;  2VG7 B;  3A1Y G;  3ZTS A;  3VAH A;  3CCS S;  2IYG A;  5AJ3 J;  1LWF B;  1U1K A;  4UOF A;  1Y5I B;  4DU7 A;  1T9V A;  4B9T A;  2MPU A;  2APO A;  5A8W B;  5IC4 B;  5T41 A;  1RWP B;  5IZH A;  4QIF A;  2UXD F;  5IT9 Y;  5KG2 A;  1IJF B;  2XY6 A;  2ZNZ A;  1Y4Z B;  3TO8 A;  4ALZ A;  5J1P A;  2YKM A;  1VGY A;  4QWE A;  3UDC A;  2HPU A;  3DRR A;  3SBM A;  3HJV A;  3KHL A;  4G1I A;  2WZ1 A;  3HSZ A;  1S1U A;  1LFW A;  1CG2 A;  1U1M A;  2DXF A;  1WTB A;  3ZZY A;  2MY8 A;  4BS2 A;  5FLX U;  4DSL A;  1RCO B;  2YWW A;  3Q2T C;  2BJ1 A;  1YIJ S;  1BWV A;  1VBK A;  2R4F A;  1HNX J;  4C2M A;  5T7L A;  4PAB A;  5HP1 B;  3G71 S;  4LF8 F;  2EW9 A;  2FZG B;  4FZV A;  4YDX A;  3KTQ A;  1HPZ A;  4YB6 A;  2HWT A;  3KK1 B;  2OGU A;  1YRT A;  3NWR A;  4BC7 A;  4EK2 A;  1DUR A;  4OHX A;  2BDP A;  4K4V A;  2WCX A;  5A8R B;  3LGH A;  2YNH A;  2JEJ A;  1HBU A;  4Q2L A;  1BXN A;  3RR8 A;  1J27 A;  5E33 A;  3DDI A;  1UP1 A;  5A6W A;  1G1X A;  8ATC B;  1SH3 A;  4FXW A;  4GKK F;  4J9R A;  4CLU A;  1Z2Z A;  3MAA B;  1FRJ A;  2ZD1 B;  5ETR A;  2CQ1 A;  2OMO A;  4ER8 A;  1F3F A;  3GSD A;  2KT3 A;  3QGG A;  3RAQ A;  1BC6 A;  2RML A;  1KN6 A;  1RT1 A;  4KHM A;  5GVQ A;  4OX9 F;  4P7T A;  2ZJR Q;  2X51 A;  5KFU A;  2CQI A;  3DLK A;  1FXR A;  3IN5 A;  5F9N A;  3CJ0 A;  1F5A A;  4J9O A;  3PM9 A;  4IO9 Q;  1T05 B;  2U2F A;  3CJ2 A;  1IR1 A;  2PDA A;  3BH6 B;  3JTP A;  2XS2 A;  1MMD A;  1KON A;  3DC2 A;  1TTH B;  1KLN A;  2CIM A;  1D0E A;  3HI9 A;  2RE1 A;  4X84 A;  4K4S A;  2UXC J;  2R8G A;  2F5G A;  3M7V A;  4N41 A;  2WW8 A;  5CHC B;  1NK0 A;  1WUU A;  4GVB B;  2CNO B;  3HHK A;  3BPD A;  2LQ9 A;  3BGR B;  1UJ4 A;  3I5C A;  3AOD A;  1WSR A;  3MPW A;  5KFM A;  3FBF A;  3MMB B;  3GIK A;  2DRD A;  4KGZ B;  3GJT B;  5T7L B;  3BSO A;  1U48 A;  2GW8 A;  2FTR A;  2RRB A;  2BBE A;  1TV6 B;  4FYD A;  1TL3 A;  2I6W A;  1OSD A;  2XHW A;  4R5P A;  3A4T A;  3DNC A;  2R7W A;  1YK9 A;  3H5U A;  1TMJ A;  2GX8 A;  2F4V F;  4ZJQ A;  1CJV B;  2M70 A;  4ECV A;  1V9O A;  2QV6 A;  3FGV A;  1HBU B;  2AIR B;  4B3S J;  2BOP A;  2X1G A;  4OYB A;  4Q0B B;  1N33 J;  3PX0 A;  2B9Y A;  2ZC3 A;  2F40 A;  3KJV B;  5D15 A;  2R2T A;  2DNP A;  3GON A;  2XZW A;  4LR7 A;  4ZIT A;  3QJJ A;  2UUB F;  2BJ7 A;  3G8T A;  4U7C A;  2QE5 A;  1TKX A;  3MM7 A;  2E9R X;  3GFY A;  2UVR A;  2VUG A;  1YI2 S;  4KTQ A;  3BF4 A;  1HD1 A;  3KK3 A;  4Y34 A;  3NCQ A;  2AYG A;  2B56 A;  3IO1 A;  4DR5 J;  1LK7 A;  4K7Q A;  3TZX A;  1Q16 B;  4ZDN A;  1S1T B;  3L3C A;  4O4G A;  3K5N A;  2MZR A;  2ZE2 B;  4DR3 J;  5K5M A;  2VHG A;  2IC3 B;  2YQ3 A;  3MUV P;  4KPC A;  3PO4 A;  1WDD A;  4KO0 A;  2DNO A;  3BQ2 A;  2C22 A;  1U6F A;  1GMU A;  4EU0 A;  2I9S A;  2FHK A;  3PX4 A;  2H4W B;  1RWO B;  3ETM A;  2GO8 A;  1NSA A;  1NDL A;  3QNW B;  4NML A;  1MLA A;  1Q5Y A;  2FVC A;  5F8I A;  4OX8 A;  3PYD A;  3ET6 A;  3UW1 A;  4JP8 A;  3SQO P;  2DH8 A;  5B0G A;  1OYE A;  2YNG A;  2JVO A;  3D3B J;  3T1H J;  3IP0 A;  4D3G A;  1G2E A;  2ZEJ A;  4QIW D;  4DI6 A;  4EBC A;  4ID8 A;  2IMO A;  3M2V B;  3PXG a;  4OFZ A;  2NXU A;  4C0B A;  3EWG A;  1DRZ A;  1ZAX A;  2D3O 1;  3DKD A;  1UPP A;  3SEO A;  3M1V B;  3NXZ A;  2HBZ B;  3FCV A;  1C1B A;  4DZD A;  4UST A;  4FVC A;  1KBR A;  3TUI C;  4NLV A;  1NRK A;  3J81 Y;  3AD8 C;  3R2D J;  4ZCL A;  3PW4 A;  3QO9 A;  4WE1 B;  2R2R A;  4U8V A;  3PHE A;  1BQN A;  3M30 B;  2MLZ A;  2IDL A;  2XLI A;  4L74 A;  3WDO A;  2C2Z B;  5EWF A;  3EZO A;  1VK3 A;  2MZQ A;  1N48 A;  4ECT A;  4CNZ A;  1PAU B;  2W7P A;  3KLG A;  2YKO A;  3RZA A;  2XTJ P;  1RBL A;  3EPG A;  5A2Q Y;  2A3J A;  3TA2 A;  2COL A;  1OWX A;  3BO2 A;  2UP1 A;  4N5S A;  3GYG A;  3VR1 A;  3GV8 B;  4RW9 A;  3MM8 B;  1QSY A;  4B02 A;  3TNV A;  1BQM B;  2XMV A;  2VFV A;  1FXD A;  5DM7 Q;  3LAL A;  1D9D A;  3LP2 A;  1IKX B;  2BQR A;  1PG5 B;  4EWT A;  4LBH A;  2AEJ A;  1CJK B;  2H5E A;  2X1F A;  5DG7 A;  1P9Y A;  2CNK B;  2DIS A;  4GRS A;  4DF8 A;  1ITP A;  3MGJ A;  4J37 A;  2AYM A;  2OEK A;  4ZMM A;  3WX8 A;  3SSS A;  2CPZ A;  4WIQ A;  3O6Q A;  4QR0 A;  4X4P A;  2XLK A;  2VG5 B;  4DUZ F;  2DH7 A;  2G2O A;  4J9S A;  5GAH U;  2H4Y B;  3PJW A;  4DR7 F;  4F4K A;  4QYZ J;  1HBM B;  1M1H A;  2ZH6 A;  1FX2 A;  2E1P A;  3BBB A;  2AMC B;  2RNE A;  2V63 A;  2FGC A;  5GME A;  1QD1 A;  3SDE A;  3AFG A;  3CD7 A;  1SKR A;  2DXE A;  2XZT B;  1RTZ A;  4LIR A;  2DHG A;  2IAJ B;  3G82 A;  3AA9 A;  2BJ9 A;  4TXS A;  4ES1 A;  3SQG B;  1OMS A;  1PYO B;  3I96 A;  3NMR A;  2QLB B;  2BKO A;  3HT0 A;  2HNZ B;  4PPD A;  4UOC A;  1GTH A;  1WC3 A;  3Q8Y A;  4IR9 A;  3FUY A;  2CZ4 A;  4EBD A;  2C3Y A;  1NK5 A;  4JI7 F;  4I2Q A;  2FC8 A;  2XO7 A;  1F2G A;  5D0H A;  4FDF A;  5SUH A;  3FC9 A;  3VHQ A;  1RHK B;  4DV5 F;  2UUC F;  2Y8Y A;  4EO6 A;  3CDE A;  1M5V C;  4F4X A;  3F0N A;  2RT3 A;  2CJA A;  3KUH A;  2HBR B;  2MZS A;  3D9B A;  3CO9 A;  2AJF E;  4ECX A;  1JXE A;  1T8E A;  5FD1 A;  4CTA A;  1L3T A;  4J9U E;  4L6V 3;  5DET A;  1F5C A;  1U09 A;  5LT5 A;  3MAQ A;  1FJC A;  1IKV A;  5H9E K;  4URG A;  2GVD A;  4ED2 A;  4HEA 9;  3CJK B;  5DJB A;  3PW7 A;  3JTO A;  2HVE A;  3THP A;  2MGZ B;  5AXL A;  4FN5 A;  4F4A A;  3LUY A;  1HNV A;  3P5B P;  1TUW A;  4F36 A;  2RDI A;  2W8L A;  2VFU A;  3QGH A;  3RRK A;  3L4B C;  8RUC A;  3I56 S;  3ZTO A;  4DV7 F;  1QLN A;  3D0G E;  4O3R A;  3I0R A;  5I3P A;  4OZ1 A;  4DV2 F;  3HFK A;  4LSZ B;  2LFV A;  5EGY A;  1VLY A;  2YVS A;  4KHP F;  4Y3C A;  1WHX A;  5CYJ A;  3OR1 A;  2PI4 A;  3NY0 A;  7FD1 A;  1U2R A;  2B8Q A;  3QAT A;  2D3U A;  1ZTT A;  2H51 B;  2WBR A;  3OL6 A;  2RUS A;  3IWL A;  1KQF B;  4JI0 J;  4LJM A;  1AXQ A;  5EX3 A;  4L3N A;  2CG4 A;  1GXL A;  5J2M A;  4TKT A;  2QTW A;  2HHH J;  4NLR A;  1RWV B;  4DSI A;  2OEL A;  4ED4 A;  4C0O C;  2HFV A;  2WRM A;  2JFD A;  4F4W A;  2OSQ A;  1LWE A;  2I38 A;  4LF6 F;  4WFA Q;  4U7U K;  4LUB A;  3CCR S;  1LXN A;  2MSS A;  3R1L A;  2AGP A;  2FC9 A;  3FMB A;  2WTF A;  3LWL A;  2YXL A;  3IR5 B;  2R8J A;  2M8H A;  4YB5 A;  2F4F A;  1T03 A;  4LRA A;  3PV8 A;  4WP9 A;  2QO3 A;  1NHK L;  2B5J B;  2DGO A;  4IRK A;  3D3C J;  5DGB A;  5IM0 B;  4MK7 A;  3OD2 A;  4ZVT B;  5EUH A;  2EI5 A;  3B78 A;  1N54 B;  3BO4 A;  4A8Q A;  4DEZ A;  3MMJ A;  2F3J A;  2JOQ A;  4HHJ A;  1T94 A;  2BM0 A;  2M5Y A;  4U8Y A;  4X4R A;  5ITH A;  1FRI A;  2UXB F;  4NPO A;  4JI4 F;  2B6A A;  3WQP A;  3JAM Y;  4PAA A;  1VC5 A;  1Z2L A;  2DR7 A;  3C14 A;  2CQH A;  1RIS A;  1RAO A;  4DUY J;  3WC0 A;  1REG X;  4S0M A;  1IN0 A;  4PXC A;  4QW9 A;  1H38 A;  5LJ5 Y;  1PJ7 A;  1JLB A;  4GC7 A;  3HPO A;  3AAW B;  1VQS A;  4WTO B;  3PRD A;  1Y0H A;  1X0F A;  2CJX B;  4ZVQ B;  1GEH A;  4NRT A;  5M2P A;  1UTA A;  1CLF A;  3P5T L;  1RT5 B;  2XMK A;  4A48 A;  3GII A;  3QJP A;  3VAG A;  1CS4 A;  1P1L A;  1ZZF A;  3UDV A;  4J9P A;  4DOZ A;  1SC1 B;  4WU3 A;  2WSE C;  4MMO A;  1GMW D;  4QWB A;  5KFY A;  1RT7 A;  3ETO A;  2ATL A;  4AE5 A;  1U1O A;  1CUL A;  5F8G A;  4DX7 A;  1XNR F;  3KHR A;  3GP9 A;  3H25 A;  1HA1 A;  1FKP B;  2NXE A;  5HMZ A;  3H40 A;  3PVX A;  3HMJ G;  2DO4 A;  4ZPW R;  1URN A;  3TVZ A;  3DYA B;  1NK7 A;  2IYI A;  1VCT A;  2R7T A;  5G0R A;  3CCL S;  1VS3 A;  4ILM A;  1GT8 A;  2BJE A;  2ZKT A;  1X4A A;  1WTF A;  2BRL A;  3UQS A;  3PR4 A;  2XWX A;  3C19 A;  4YR3 A;  1SQE A;  5CA5 A;  3GFX A;  3I9V 9;  1XJW B;  1MU2 A;  2ZWP A;  2PD1 A;  4C6A A;  3ZNJ 1;  4FXV A;  4BBY A;  1AW0 A;  4LF5 J;  4HR2 A;  4ZJL A;  3EE3 A;  3HVT A;  4URQ U;  3KDO A;  4NLQ A;  1LFP A;  2HLT A;  4OZN A;  2AF6 A;  5L39 A;  5ETS A;  4LF9 J;  4FYY B;  2J0Q D;  2JC0 A;  5KOW A;  4YB7 A;  2IRX A;  3TYT A;  2C1E B;  1VRU A;  3NKY A;  4WWS A;  3W63 A;  3WHI A;  2UUA F;  1APS A;  2B9X A;  3N6L A;  4J9K A;  2EPI A;  2HHV A;  3GMG A;  4FXD A;  4KBI A;  1IBK J;  4RW8 A;  4HDH A;  4A8S A;  3DRP B;  1SUQ A;  1TK0 A;  5A0Y A;  3QT6 A;  1XMO J;  2W9B B;  3IRW P;  1JWW A;  3DMJ B;  5E41 A;  1RQ0 A;  4QR1 A;  4FF2 A;  3V6D B;  4NI2 B;  3NBP A;  4LSN A;  4F0K A;  1FDN A;  2BKN A;  2YX1 A;  3BPS P;  1YHQ S;  1E6V B;  2VOP A;  5IC6 B;  1FCA A;  2MJU A;  4DV0 J;  1CS4 B;  2DTJ A;  3Q89 A;  2A2D A;  3OFE A;  3UNY A;  3FKB A;  4YFU A;  4JI3 F;  3JTN A;  4X65 F;  1RAH B;  2MQO A;  1XTZ A;  2DNQ A;  1NLK L;  4WII A;  1RT6 A;  1WOR A;  4A8K A;  1NPK A;  5KFF A;  4EO8 A;  3KHH A;  1UZD A;  3HHL B;  3GJQ B;  2GAG C;  2Z2Z A;  4B9U A;  4E0D A;  4CH0 S;  2R7R A;  3FRY A;  1MML A;  1DQ9 A;  1SJ1 A;  1CC8 A;  4OL8 A;  3MPV A;  3IS9 B;  3OFH A;  2AJ0 A;  4KFB A;  1U0S A;  2I0X A;  3PAC A;  4CLP A;  3I0S B;  1UMJ A;  1B7Y B;  2JJ4 D;  3KLI A;  1QDU B;  5JVH Q;  3DI6 B;  2BAN B;  2B0G A;  2G9O A;  2LU1 A;  2M2B A;  5LMN F;  2V5H G;  2WW4 A;  1EKS A;  3G8S A;  1NB7 A;  3M8Y A;  3ZTQ A;  2MMY A;  2HFS A;  4DV4 J;  2HHU A;  3EVW A;  3MM5 A;  2UUW A;  4ED0 A;  1S1W B;  1N34 F;  1RJJ A;  4F4Z A;  4TNO A;  4CIO A;  2LKZ A;  2UU9 J;  2NUH A;  1OQ3 A;  1S9G B;  1FJG J;  5LJ3 Y;  2MZ1 A;  2FVR A;  5HBM A;  4I67 A;  1AB8 A;  2DD8 S;  1FKO A;  1U6Z A;  2EFN A;  4V19 X;  3ITH B;  2WHO A;  4LBI A;  2OEM A;  1UWB A;  2J9E A;  3UNG C;  4JI6 J;  2VG6 B;  1JJ4 A;  4DSJ A;  2KFZ A;  4QPX A;  2RS8 A;  2C3U A;  1N5Y B;  4G1Q B;  2GVZ A;  2YNF B;  4XDD A;  1MWQ A;  2IA0 A;  2QSW A;  3NMA A;  4ZKA A;  1M5O C;  1EP4 A;  4M63 A;  3DM2 A;  4PWD B;  4FNI A;  4FBT A;  2W2P P;  1RHQ B;  4PG7 A;  3J7Z 5;  3ENV A;  3V4I A;  3AT1 B;  4C11 A;  2VOD A;  2ZM6 F;  3FSY A;  4JOU A;  1SV5 A;  1NU4 A;  4RNH A;  2NCK L;  4CDI A;  4NCG B;  2J7K A;  3EVO A;  3Q24 A;  1W25 A;  1FER A;  1LQ9 A;  4F02 A;  3QIP A;  2MZJ A;  1S6Q B;  3NGK A;  3K17 A;  5D0E A;  2VBX A;  1F9H A;  5AXK A;  1R0B G;  4H4O B;  2Y0S D;  2C42 A;  2NXJ A;  1EHW A;  2MYF A;  1UZH A;  1B99 A;  2P6S A;  2W25 A;  4CCH A;  1VJQ A;  3L9Z A;  5D4O A;  3NGT A;  5ETO A;  1MWZ A;  3MOZ A;  4KPY A;  3IRX A;  3HZE A;  1OYD A;  2GHV C;  2ZIT A;  3KOA A;  3MZI A;  1TEL A;  2XEX A;  4DV6 J;  5L9N A;  2CQ0 A;  3JSM B;  3CIZ A;  3ZNU A;  2XSJ B;  3DLB A;  4ZIV A;  4JV5 J;  3MM9 B;  3ONQ A;  1R89 A;  4OYX A;  1WG4 A;  4OV6 A;  2N4C A;  2VJU A;  4LF4 J;  1TL7 B;  4FVM A;  4WZQ A;  1RCX B;  3DOM A;  2ACM A;  2ZUG A;  3ZZR A;  3W2V A;  3LGM A;  2POK A;  2DVI A;  2OHD A;  3LP1 B;  3Q8Q B;  1HR0 F;  1N5T A;  5IQ6 A;  5L1K A;  2PFF B;  2OD4 A;  3Q23 A;  3JQK A;  4K5S A;  3T1Y J;  1VQ7 S;  5KG4 A;  2K06 A;  2V50 A;  2MST A;  4PKD B;  4ZVE A;  4USJ C;  2KXF A;  1HNW F;  2RU9 A;  3UVJ B;  3R5C A;  1VBZ A;  5H9F K;  2FVS A;  4WFB Q;  4R8U A;  4QPT A;  1N6Q B;  3PCO B;  3QT8 A;  1X4B A;  3IR6 B;  1S48 A;  3RB3 A;  4KR0 B;  2A0F B;  4WFY A;  1YJV A;  2ZH5 A;  3O2I A;  1PSD A;  1P27 B;  1U47 A;  2AJ4 A;  2KFN A;  2Z8Q A;  1RI7 A;  2V8G A;  3BN4 A;  4DCP B;  2IJN A;  3DRS A;  1RA6 A;  4Z7C A;  2FLN A;  3BDP A;  2CZV C;  4IO1 A;  3L95 X;  3R6G B;  3IM8 A;  1R0A A;  4ECQ A;  4I6A A;  3RBD A;  2MQ8 A;  2C2R A;  3VF0 B;  4EYI B;  1JLA B;  5HVG A;  2XYH B;  3M6W A;  4F7V A;  1G6B A;  3S01 A;  2NS1 B;  5ETN A;  1I6J A;  2FHJ A;  4Y2A A;  4LFC F;  2P9G A;  3GV5 B;  2HEK A;  3HHD A;  4UF4 A;  1VK8 A;  1Z4U A;  1B70 B;  3BR8 A;  7FDR A;  3MDF A;  2DGV A;  4C8Z A;  1XMB A;  1VQK S;  3Q22 A;  2J0S D;  4CLZ A;  3D68 A;  2HZV A;  2DY1 A;  1H0H B;  3CCJ S;  3UPF A;  4AD6 A;  1FRX A;  2QA2 A;  3W64 A;  4PQU A;  4OLP A;  2R8I A;  1OY6 A;  1JLG A;  1UVJ A;  2OD6 A;  2IJF A;  4XAK A;  1SKW A;  2I2Y A;  2HMI A;  2HHX A;  4ZN3 A;  3H2L A;  5KFT A;  2QL9 B;  4ICL B;  3GFH A;  2VC1 A;  1U26 A;  4OYZ A;  3TUP A;  3QFH A;  1HYS B;  1EB0 A;  3DLG B;  3K58 A;  1IWA A;  4OHV A;  4IRC A;  2HRT A;  4DMZ A;  2W4P A;  3KUG A;  3GCW P;  5KFB A;  2Z0G A;  2XG8 A;  2HHQ A;  4WCE Q;  5C42 A;  3H2U B;  2DR9 A;  2DHA A;  5KFV A;  3JQM A;  5A8K A;  3HVW A;  4FPR A;  2MY7 A;  2XYP B;  1GFW B;  1XR7 A;  4IFY B;  4FS2 A;  1NBE B;  1RTJ A;  3AQP A;  1LW0 A;  3GCX P;  4O44 A;  1FX4 A;  2YWK A;  2CQC A;  4NLG A;  1FVS A;  1KR4 A;  3VGV A;  4KGK A;  1P1T A;  2J0W A;  2UV8 A;  2N82 B;  4K4T A;  2LXF A;  1QE1 A;  4JI1 J;  2NYI A;  4J9M A;  4ELU A;  4HHH A;  2WOM A;  1X4G A;  2CDR B;  2F65 A;  4ED5 A;  4Y6I A;  2BW2 A;  5J2P B;  1Q1K A;  1VBY A;  2H5J B;  2XQC A;  1JLE B;  1HQE A;  2LP4 A;  3W65 A;  4N47 A;  5A76 A;  2DHH A;  2IVY A;  3GU0 A;  3CUN A;  4YHH F;  3GPA A;  1HI8 A;  3MMC B;  4ID5 A;  1LKZ A;  1CEZ A;  5K8M A;  4OI0 A;  2MZT A;  1RHR B;  1S7I A;  2V8D A;  2WON A;  2W2Q P;  1RA7 A;  4WYL A;  1UCN A;  2R8K A;  2B4O A;  1BE4 A;  2OTL S;  3LP0 A;  4O3S A;  3HSJ A;  3J81 U;  1IM4 A;  3A12 A;  2MKK A;  3NG8 A;  5L1L A;  2B7B B;  6FDR A;  2LXU A;  2OUG A;  4LR9 A;  4HT7 A;  8AT1 B;  4OHW A;  2Q6B A;  5HRO A;  3AQO A;  1EKR A;  4ZA1 A;  1N5S A;  1KD1 T;  1VIS A;  1MNE A;  1SJ4 P;  1Q7Y T;  3KFW X;  2GMH A;  5A2Q U;  4GKJ F;  2GGP A;  3BEG B;  3H90 A;  3MR5 A;  1HNZ J;  1DFD A;  1GX6 A;  2QIF A;  2YH1 A;  1HQ2 A;  5LL6 d;  2LVW A;  3F56 A;  1UJ5 A;  3FFI B;  2Y1I A;  3CD5 A;  1K0V A;  5HSP A;  1GXT A;  1RTJ B;  1WSV A;  2NYH A;  1VQL S;  1WF0 A;  4MK8 A;  2HUR A;  1FK9 B;  4OYI A;  1S0N A;  4P2M A;  5THW A;  5AJ3 F;  3JYT A;  4BDP A;  1FA0 A;  5HJX A;  3PIO Q;  2G2Y A;  1CJT A;  1XEZ A;  2NPF A;  5K14 A;  1OSC A;  5ETL A;  1S1V A;  2YPZ A;  3SSQ A;  1UFW A;  1X4E A;  4CI0 B;  4HHU A;  1UWA A;  2I5J A;  5C24 A;  5J1E A;  2XUL A;  2VFR A;  3M8P A;  3ISN D;  4ZP7 A;  4YDD B;  3GIM A;  2EG2 A;  4LSL A;  1LW2 B;  4YUD A;  4C8K A;  1KVK A;  5KFL A;  1J5O B;  1U8W A;  3FK4 A;  2ALY B;  2EEY A;  1NJZ A;  4WXO A;  2AD9 A;  5H9E J;  2OPP B;  3I5A A;  1JNZ B;  3VAJ A;  2J6T A;  5HK4 A;  4KV8 B;  1KTQ A;  2XBP A;  1P6T A;  4UOH A;  5IWA J;  1HNX F;  2VD3 A;  2QLF B;  3BGO P;  3KHG A;  3NL0 A;  3AOB A;  2X1A A;  4WKR A;  3G8Q A;  4DSF A;  2PN6 A;  2IHR 1;  3HHL D;  4DQR A;  3SCL E;  4ZPT R;  5B0D A;  1C0U B;  1TQL A;  2AP6 A;  1Y5N B;  2PA8 D;  1JJC B;  3JQJ A;  4GKK J;  3W7B A;  1S77 D;  1IVZ A;  3OTE A;  2P2C B;  2KHC A;  1BWE A;  1ZBT A;  2RUG A;  4ZPB A;  2B4P A;  1XMQ J;  4CO5 A;  2ZFH A;  3E51 A;  4QCL A;  4AYB D;  4ETX A;  1C4C A;  3TUJ C;  1TKZ B;  3MM6 A;  3QFW A;  2Y1J A;  3EM1 A;  1LXJ A;  1C2P A;  3UI3 A;  4C8O A;  2LCW A;  3C16 B;  3RAX A;  4OX9 J;  4WFX A;  2LDY A;  3AJ2 A;  5KT5 A;  3GSI A;  4NZ0 A;  2WBM A;  3H20 A;  4NLU A;  4P9S A;  5FDL B;  3K8V A;  1SB6 A;  1R8B A;  1EAR A;  3I4P A;  2M88 A;  5J2N A;  1EZZ B;  1MW7 A;  4KSE B;  3OJU A;  2KM8 B;  2V2K A;  4HI1 A;  3OR2 B;  3G86 A;  2R42 A;  1Q0N A;  1VQ8 S;  4I64 A;  2YTC A;  5K14 B;  1PYS B;  1FEE A;  2RQK A;  1DTT B;  2ZVS A;  2FJE B;  5D3G A;  1YDL A;  3P3D A;  5K8O A;  2E9Z A;  2UVU A;  2CKW A;  3MR3 A;  2ZZT A;  3C6T A;  4X62 J;  2UXC F;  3GIR A;  1MMN A;  1QVG R;  2HZA A;  3KLF B;  3OUY B;  1D09 B;  4NXM F;  2PT0 A;  3RR7 A;  3D6H B;  3DLE A;  2CJB A;  5JXS A;  1DY3 A;  2HSE B;  1VQO S;  2YWF A;  1C0T A;  3NGD A;  3TZZ A;  3BSC A;  3RU0 A;  3GJR B;  1HL6 A;  3DGV A;  2E5H A;  3H98 A;  3W1Y C;  3ILI A;  3EX7 B;  3BBF A;  2YKN B;  4UW2 A;  5KT4 A;  2F4V J;  3M2R B;  4PG5 A;  4XO0 A;  2CNL B;  2D9P A;  5J2Q B;  2K3K A;  2GO9 A;  2ATC B;  2WK4 A;  2XGQ A;  1A9N B;  3J80 U;  2ZZM A;  3CCT A;  3ZZP A;  1RAF B;  4DUT A;  1X7V A;  2GA7 A;  1PKU A;  1FXL A;  3H42 A;  4USW A;  1F9F A;  2VBZ A;  2KU7 A;  4B3S F;  4WP3 A;  5F9L A;  4RNM A;  1N33 F;  1P9Q C;  3NS7 B;  4YR2 A;  4LFB J;  4I68 A;  3I6P A;  4R25 A;  3CMQ A;  4DS4 A;  1ZOT A;  2KRB A;  2W24 A;  4Y2C A;  2FDN A;  3QSY B;  4IH5 A;  3Q0A A;  4P74 A;  4DCO B;  2D7S A;  2CWK A;  2RHQ B;  4C8Y A;  2VPX B;  2EXU A;  4PQA A;  4U9R A;  1RT3 A;  1N5Q A;  5IS2 A;  2YQ0 A;  1AFI A;  4CT9 A;  1GAO A;  5K8P A;  4DR5 F;  3UDL A;  1S72 S;  1S9E B;  3FCH A;  3W5X A;  2FLL A;  4ZVH A;  2NPI A;  1CPZ A;  5D3G B;  3BB5 A;  3CW2 C;  4DR3 F;  3V6J A;  1LWC B;  2ABY A;  2MQQ A;  2CVE A;  3DRY A;  2XHC A;  2OPS A;  4A8M P;  1DLO B;  3HJF A;  3ELH A;  3BKU A;  3C6U A;  7AT1 B;  2BMB A;  2QA4 S;  1TAQ A;  1F5B A;  3O5T B;  2CJ9 A;  1JKH A;  2PE8 A;  3T9N A;  3PJ9 A;  5ETP A;  1MSW D;  3IWX A;  2VV5 A;  1WNE A;  5MAO A;  3H7H B;  3R2C J;  3AXM A;  2KI2 A;  1N32 J;  2P6T A;  2ADC A;  1IBL J;  5HI7 A;  2HND A;  4A8O A;  4IUF A;  3PZP A;  4L73 A;  3D28 A;  1J5E J;  1PC4 A;  3BO3 A;  3T1H F;  1TKT B;  1EET A;  3MI7 X;  2ZH1 A;  2E9T A;  4IDK A;  3F41 A;  1NEE A;  3HSG A;  1S1X B;  1X5T A;  1D1U A;  2C28 A;  1Q53 A;  3GQC A;  1Q8L A;  3AD9 C;  3DU6 A;  5GAD I;  3OFF A;  3PO5 A;  2QL7 B;  1UW9 A;  2DPJ A;  5DDO C;  3V81 B;  1O51 A;  2FD2 A;  2GIQ A;  1TK5 A;  1X4H A;  2VZ9 A;  2ZH4 A;  1ZAW A;  4DG1 B;  1NHU A;  4F0H A;  3V6H A;  4IR1 A;  1X5S A;  4ZPC A;  2IJR A;  3DLJ A;  1KSP A;  1RT3 B;  3E01 B;  3BH7 B;  3DXS X;  5DGA A;  4HTI A;  3FBC A;  2FY8 A;  4B3O B;  1AZS B;  3FEY B;  3CC2 S;  3FRZ A;  1ZM9 A;  5DZ6 A;  1NCL A;  2CZ9 A;  2M3D A;  3DGP B;  6AT1 B;  1K8A T;  3C6U B;  4X64 F;  2YNI B;  3GIL A;  1R43 A;  5ETK A;  2R8H A;  4GO5 X;  1TVR A;  4JV2 A;  1Q79 A;  1CQN A;  3NEK A;  2SXL A;  3E3X A;  4M5M A;  2GC8 A;  4CLS A;  2BQU A;  3KJQ B;  1WC1 A;  4DUZ J;  4J90 A;  1YSJ A;  2DGU A;  1HBO A;  2X1B A;  2YX4 A;  1VQ9 S;  4LT6 A;  2N7C A;  1X4C A;  1IBM J;  1IR2 A;  3IR7 B;  2Q79 A;  5K20 B;  1CJU B;  1GH8 A;  1YJ9 S;  3IGV A;  1GK8 A;  3LA0 A;  4R0J A;  2AU0 A;  1HD0 A;  1RWX B;  1MN7 A;  4IDK B;  3G6E S;  2RQC A;  3MUR P;  1NAQ A;  1D9F A;  3TX0 A;  2YY3 A;  1FVQ A;  1W26 A;  1XNQ J;  2VFT A;  5IT0 A;  2GS8 A;  2OPQ A;  5D6G A;  1NZ8 A;  2H1Y A;  4DR1 J;  1H7X A;  3DOK B;  4F67 A;  3FSI A;  3PG9 A;  3ZTR A;  3T6J A;  2DCU B;  1VC0 A;  4B9V A;  1FO1 A;  3HZG A;  4DU8 A;  3M6X A;  3DLL Q;  2CPD A;  3S1T A;  1FRH A;  1NO8 A;  4DPO A;  1E6Y A;  3KLE A;  3MTJ A;  2A1B A;  1RT2 A;  2MQP A;  2KJV A;  2V94 A;  1RTH B;  2VDI A;  1IKW B;  4LIW A;  2NXC A;  3NNH A;  3GE9 A;  3OTD A;  2V4J B;  1TU0 B;  1UA1 A;  1RTI B;  4PZV A;  3GB0 A;  2Y1R I;  3MED B;  3OHA A;  1HQU A;  3H5S A;  4LVO P;  1HWI A;  1KOO A;  4CQ1 A;  2XSF A;  2VQE J;  2ASL A;  4AQY J;  2F8H A;  5KFI A;  3O1L A;  4RO0 A;  2R2U A;  3CTR A;  4RBU A;  1VQP S;  3G96 A;  3NLC A;  4DPX A;  4NLP A;  2QA1 A;  2A18 A;  1RSC A;  5CYM A;  3KK2 A;  2AW0 A;  2VIH A;  3NGR A;  3M8R A;  3MFI A;  2C2K B;  3M8W A;  2B3T B;  3PY8 A;  2ZDP A;  5KFP A;  3HD2 A;  2Y1L B;  5KG0 A;  3US5 A;  2RU3 A;  1HWK A;  4OHY A;  3PFO A;  3OSP A;  4C8M A;  4IYQ A;  2EWH A;  4QIE A;  3THT A;  1IUJ A;  1HBO B;  3SYZ A;  2HVH A;  2KDO A;  4RR5 A;  2AT1 B;  2RHS B;  4RNF A;  4HLB A;  4K4U A;  2K1R A;  5DRK A;  3TJ8 A;  3D7S B;  4Q44 A;  2RQM A;  2A6M A;  4ZHR A;  2CVI A;  4EMD A;  3IBW A;  3BYR A;  3VAK A;  4DV2 J;  4KIA A;  1M5S A;  4CH7 A;  2IM2 A;  3W8G A;  1Q82 T;  4ELV A;  4F2R A;  4M8L A;  4KB7 A;  3MPD A;  1RAJ A;  4DF4 A;  3B82 A;  2QLX A;  3M32 B;  3HT3 A;  1S49 A;  4DV3 J;  3SV3 A;  3FBE A;  2EK1 A;  2PMZ D;  4ZVS B;  4USK A;  1SKU B;  3CJR A;  1HBN B;  5CZX A;  1HWJ A;  2H54 B;  1V5I B;  2KT2 A;  3HM9 A;  3W60 A;  2P5V A;  2AJ2 A;  2H5I B;  4HH0 A;  2XNR A;  2HNY B;  1FWL A;  3C15 B;  4B9S A;  2C3M A;  1F3V A;  4NCB A;  5CD4 H;  1RT2 B;  2XMM A;  4JI0 F;  3U1M A;  3CJS A;  3UCZ P;  4IG0 A;  2QFI A;  1ZM2 A;  3BQ1 A;  4F3O A;  3DOL A;  3CC7 S;  1ICE B;  3LF0 A;  3R7B B;  2WVF A;  1N0V C;  1L3U A;  5BXI A;  2BAB A;  2M4M A;  3IGN A;  2MLX A;  2GML A;  3IG1 B;  3CJ3 A;  2XY5 A;  2HYI B;  2G1D A;  3MMA A;  2ZH7 A;  4F2S A;  1PBU A;  3PDN A;  1RWM B;  2GV1 A;  1TL1 A;  1ZA2 B;  4PWU A;  5D78 A;  3BDE A;  3VVU A;  5JVG Q;  4M94 A;  3DN9 A;  2OPR A;  2Q66 A;  3N5F A;  3W5Y A;  4NYZ A;  3LOU A;  2UVV A;  4ZCK A;  1REV B;  3NNC A;  1EJ7 L;  1VRT B;  4UZC A;  3K2Y A;  1OO0 B;  4U96 A;  2KL8 A;  2E1M C;  3NOG A;  2O66 A;  3EGW B;  4B3T J;  4ZHR B;  5FII A;  2IMW P;  1RHM B;  1HWL A;  2RKI A;  1IKY A;  2NQP A;  3GIJ A;  3MEC A;  3OLB A;  4WBF A;  3L7U A;  4DR4 J;  2QJ3 A;  2OJ3 A;  4JV0 A;  4JI2 J;  2Z2Y B;  4RWX A;  4DUY F;  3K0J A;  3IWN C;  1T9X A;  2EBG A;  2DY9 A;  2WB1 D;  5C25 B;  1RT4 A;  2VJV A;  4OI6 A;  2HQF A;  3BR9 A;  1VRQ C;  1H98 A;  2RF2 A;  1SL1 A;  4C9D A;  4M5K A;  4BCA A;  4PEO A;  3BGU A;  3OL8 A;  3RW6 A;  4ECW A;  4CYU A;  1UAW A;  4LVN P;  4ED3 A;  1SC4 B;  3FQL A;  4DWI A;  1HW9 A;  1PIL A;  3GWC A;  4IG3 A;  2KKH A;  4XK8 C;  1N56 A;  2VIC A;  3GZ7 A;  4Z7Y A;  4MIW A;  3IA0 A;  2G4B A;  4RW4 A;  5KT7 A;  1ULR A;  2YKM B;  2QFJ A;  4DPU A;  2ROG A;  1VFJ A;  3K59 A;  1U1Q A;  3THV A;  4PG4 A;  3DRR B;  4A8Y A;  4N8O A;  5L38 A;  4AUK A;  2MKY A;  5BR8 F;  3KYL A;  1S1U B;  2HHW A;  1RAE B;  4UQT A;  4H4K C;  3MR6 A;  1SKS A;  2F8E X;  1VR6 A;  3PJX A;  2OKQ A;  1FJE B;  5CCL A;  3BRE A;  3CXC R;  2PMH A;  4PXB A;  4LRF A;  2MHN A;  1HHT P;  2CYY A;  3AHP A;  1N5V A;  4DX5 A;  5CAB A;  3UO0 A;  2DNZ A;  3X3U A;  1WKL A;  3T19 A;  1F6T A;  2V9W A;  3HVR A;  3D5M A;  4UY8 5;  2CQ2 A;  1HPZ B;  2V34 A;  2XS7 A;  3N6N A;  1R6Y A;  3K89 A;  3GYN A;  5GAG I;  4OZ3 A;  2B7C B;  1G3O A;  1YWX A;  3QBC A;  2ASJ A;  4LF5 F;  5H1S V;  1RWU A;  2YNH B;  4M5G A;  2RD5 C;  5B09 A;  4PRF A;  4B3R J;  3CUL A;  4A8X A;  5CXT A;  5F8N A;  2MDA A;  1S97 A;  2YPY A;  4LF9 F;  2HHS A;  3TX8 A;  4N8N A;  4JBC A;  4I56 A;  1SPB P;  4JYA J;  1T0T V;  4JI8 J;  2KO1 A;  3ISZ A;  1JLF A;  2IPO B;  1V3Z A;  2DGX A;  2J9D E;  4YS2 A;  1RT1 B;  4CRJ A;  4YR0 A;  4DR2 J;  3RB0 A;  3PW0 A;  1H6K X;  5KFA A;  5D0G A;  2I1R A;  3A13 A;  3DLK B;  4IH6 A;  1IBK F;  1V6H A;  2HK3 A;  4F25 A;  1X60 A;  3BV8 A;  1FFG B;  4DDF A;  2BVZ A;  5DLG A;  3TQE A;  1XMO F;  3RBX A;  4PG8 A;  2R2S A;  3HLU A;  2AKW B;  5GMK a;  3E2E A;  2XS5 A;  4JI3 J;  3D6T B;  3UD4 P;  4ZP6 A;  2RIL A;  5BYS A;  2DGW A;  3KKF A;  2MKH A;  3H4B A;  3B6B A;  4LRB A;  3QWU A;  3EJM A;  5AXN A;  1MN9 A;  2ZBI A;  2Y8W A;  2WSC C;  4KQZ A;  1X9M A;  5E7O B;  3CPW R;  2CG8 A;  1YKW A;  2W4D A;  3ICL A;  2FHO B;  1RAB B;  4OLO A;  2R7V A;  3QLH A;  2EVZ A;  2ZWO A;  3VWS A;  3K5L A;  2OO4 A;  4KGX B;  1DAX A;  5K9F A;  2HRY A;  4MFB A;  4H4K A;  3KLH A;  1KDN A;  3PR5 B;  4WU2 A;  1VIX A;  1Z1Z A;  3ZXW A;  1FD8 A;  2KG0 A;  4C98 A;  1OPI A;  1YG0 A;  1XN9 A;  2XY7 A;  2DBB A;  4LF2 A;  1H2V Z;  2VOO A;  1WHW A;  1IM6 A;  1JQG A;  1TL3 B;  4R5P B;  3D0H E;  2HVZ A;  4IH7 A;  5E3R A;  1RU2 A;  2DEJ A;  4QIV A;  2AEF A;  3AD7 C;  3MCO A;  2V68 A;  1N88 A;  2Z2L A;  1QVF R;  2F1F A;  3QZ7 A;  4P2X A;  4DFK A;  4TQR A;  4KJI A;  2BA9 A;  2ASY A;  4DV4 F;  2QSF A;  4WKY A;  2JLE A;  1WKK A;  1CBK A;  2PO4 A;  3IBC B;  4KKO A;  3R5D A;  1YIT S;  1S6P A;  2QGF B;  4WF9 Q;  3AJD A;  1UFK A;  2UU9 F;  1U4B A;  1FJG F;  4K5R A;  3M2U A;  2W01 A;  2CQG A;  4MKV A;  2ZUA A;  1HNI A;  4LQ3 A;  3CC4 S;  3M8Q A;  2FJD B;  1RAG B;  3L7O A;  2D1C A;  1LWX A;  1TKX B;  3MM7 B;  3CDU A;  5DDR C;  1RAD B;  5KFE A;  2CNN B;  4JI6 F;  3JS9 A;  2QLJ B;  3C2P A;  1FFW B;  3KK3 B;  4RUH A;  4M5N A;  2R7U A;  1WWH A;  4Y00 A;  1KQS R;  1TL5 A;  2K7K A;  4GVL A;  2PGC A;  2ZM6 J;  1PJ5 A;  1HHQ A;  1ROF A;  1M1G A;  4P52 A;  4NLD A;  1TR0 A;  4O4G B;  2MHE A;  1KTV A;  3CF5 Q;  3DHW C;  3HFZ B;  3CCW A;  1B64 A;  4Q8E A;  2FZC B;  2E44 A;  4KO0 B;  4OI4 A;  4QQB A;  1D8Z A;  4M1K A;  4P75 A;  4N56 A;  3R5G A;  2BRK A;  4G3I A;  2VC0 A;  4LBP A;  3CJ4 A;  3S6E A;  2GJI A;  3TAM A;  2FJV A;  2FGO A;  1FWP A;  4ECS A;  1A6L A;  4LFA J;  1XR6 A;  4N7T A;  3HKZ D;  1NSP A;  1ZS6 A;  1AA1 B;  4WJB A;  3SFU A;  2XMU A;  5D8H B;  3W2W A;  1H74 A;  4C3M A;  3ET6 B;  1S99 A;  4ZCM A;  2AYE A;  1DQA A;  2ZBQ A;  5CYQ A;  2IA6 A;  2LQ5 A;  5M2R A;  2YNG B;  1RP5 A;  1JLQ A;  1PJ6 A;  1NM2 A;  2JEF A;  4X4O A;  2FZK B;  1IJE B;  2XMJ A;  4HKQ A;  3DHX A;  2FY1 A;  2W9C A;  4ERD A;  4WPA A;  3OVB A;  2MKC A;  1R8P A;  4DV6 F;  4QBU A;  5I4M A;  1JB0 C;  2LLZ A;  3W3S A;  1H73 A;  2C2M B;  4HI2 A;  5D0R A;  4JV5 F;  4RW7 A;  4HH1 A;  5B0E A;  3TW0 A;  4IFV A;  1C1B B;  4CT8 A;  4Y0F A;  1Q86 T;  4CZC A;  1MRO A;  3ILL A;  3FQK A;  4K2X A;  2KFY A;  2L9D A;  4M5H A;  3SZ2 A;  2BE7 D;  2RDJ A;  3QO9 B;  1U25 A;  3SCI E;  2DYA A;  1BQN B;  4WYW A;  3QGI A;  2K7J A;  5JJB A;  2X7I A;  2EFO A;  3PFE A;  3GTY X;  3CMA S;  3AXK A;  3M9N B;  4I6W A;  4ZS6 A;  3KLG B;  3DU5 A;  3U7J A;  2V2Q A;  2BKP A;  2XGP A;  2HG4 A;  2KN4 A;  1H72 C;  1UA0 A;  2LDI A;  3SCJ E;  3O3L A;  1YVF A;  2CPY A;  3CCU S;  2X3D A;  3B4M A;  4RW9 B;  5EWE A;  3WX4 A;  4YY3 J;  1S4F A;  2Y3Y A;  3CCZ A;  1Y3J A;  4I2P A;  5F0U A;  3HP6 A;  2CUY A;  3QYY A;  3G9C A;  1BQX A;  3EGZ A;  4GC6 A;  2RJZ A;  3LP2 B;  2O67 A;  2ACY A;  2WB4 A;  1U1N A;  1GX5 A;  3TVY A;  2IRY A;  5F8J A;  3Q2S C;  4TY8 A;  4QIG A;  3RJM B;  1T7P A;  2C2E A;  1Y00 A;  5ETV A;  3DRX A;  4Q45 A;  1QAI A;  4K4Y A;  1QAY A;  3H8Y A;  3I32 A;  3D1O A;  2BZ2 A;  2BX6 A;  1JLC A;  4J5O A;  4HVZ A;  3N28 A;  1U0H A;  1AUD A;  4R0E A;  4C8L A;  2W7O A;  1NK4 A;  2FUG 9;  4OJ3 A;  3WIU A;  4EEY A;  2HFZ A;  2VA3 A;  2NSB A;  3GR0 A;  3RRG A;  4PUO A;  1U02 A;  2N3L A;  3QAU A;  2R7X A;  1D8Y A;  1R27 B;  3W5Z A;  4G6V B;  2ILY A;  4RW7 B;  1WG1 A;  4DS5 A;  1FRM A;  2KJW A;  3J7Z T;  3GLJ A;  1MRO B;  3UD3 P;  2BE2 A;  3SDE B;  3LH2 S;  1ZM4 A;  2HHP A;  1RGV A;  5HLF A;  3RAM A;  3HX9 A;  2KB2 A;  2IM1 A;  5IT4 A;  2LQ8 A;  4PPZ A;  1QTN B;  4ZOS A;  1FDA A;  3IBF B;  3N5B A;  1KQK A;  1YX2 A;  2XMT A;  3G82 B;  3VGT A;  3J80 Y;  3TVK A;  2CDQ A;  1FRL A;  3SFG A;  3V6K A;  1UVL A;  5IOL A;  2AHO B;  2A2C A;  3G87 A;  4I2Q B;  4ITS A;  3U1N A;  1P8G A;  1XC9 A;  3MEK A;  1SQF A;  4ZLP A;  5CAA A;  1NK8 A;  3EUN A;  3N4W A;  4RBT A;  1HFE L;  2RVJ A;  2IM3 A;  2RS2 A;  5LSO A;  2VG7 A;  3QWP A;  2DGQ A;  4H4M A;  1LWF A;  1L3K A;  1TUV A;  5LMU J;  3OSN A;  3NRB A;  1OQ6 A;  3H4D A;  2XNQ A;  5JMN A;  2DNY A;  1RUS A;  5A8W A;  4CTA B;  4G1P A;  5HQ8 A;  3HXM A;  4ZK7 M;  4X66 J;  1TAU A;  4BC9 A;  2ASD A;  1IKV B;  3OXF A;  4ZLJ A;  2GVD B;  1O0P A;  2DEI A;  2QL5 B;  3B4D A;  1T11 A;  1H2T Z;  1VQ4 S;  4I1T A;  3FSX A;  4M5I A;  2Z56 B;  1X8D A;  2NLW A;  1HNV B;  4ZVF A;  2RRN A;  2I8E A;  4NYO A;  2H9Z A;  2LEB A;  2BM1 A;  4OJG A;  3NS5 A;  1V3S A;  1FES A;  4ZJO A;  3LAN A;  2HZC A;  3GYX B;  4O3Q A;  3I0R B;  2FJX A;  5DLF A;  3AB4 B;  2DR8 A;  2GAH C;  3UCU P;  1SQG A;  2AZ1 A;  2P9C A;  4O0I A;  3UD5 A;  4O4R A;  4AL5 A;  3OR1 B;  1YJT A;  3CGI A;  4WFZ A;  3R27 A;  1F2H A;  3N6M A;  3I31 A;  3RB6 A;  3OBI A;  1NDP A;  2DPI A;  2IVM A;  4ZPA A;  3RUB L;  2KZM A;  5DDP C;  3KK1 A;  1U1R A;  1M5H A;  5J2M B;  2DGT A;  4FS1 A;  3Q8V A;  1Q8B A;  4JI5 J;  5A8R A;  1KWM A;  4NL5 A;  3HUL A;  4A47 A;  2DGS A;  2G0J A;  4X4N A;  3TAN A;  1AYE A;  2C3O A;  1WC6 A;  3J7Y I;  3U27 A;  4A8W A;  3SSR A;  2ZD1 A;  5HQM A;  1LWE B;  1HNZ F;  1L3S A;  1RKI A;  1I51 B;  1SL0 A;  4Y2M A;  2P8I A;  1FHT A;  2IRU A;  1CVJ A;  4P7V A;  4H4M B;  1WAC A;  4DV1 J;  1T03 B;  4PYD A;  1S9F A;  2J6U A;  4DN9 A;  2MLY A;  2E1R A;  4MIB A;  4CLK A;  1VBX A;  2AX0 A;  5U47 A;  3V2U C;  5GAE I;  3MUT P;  2GHP A;  2QC3 A;  1T05 A;  3MR7 A;  2ZHA A;  2GJF A;  4J9L A;  4C3L A;  3OTB A;  5KFN A;  1EAY C;  3OHB A;  2IDE A;  1VIO A;  4DL6 A;  2EKY A;  1A7G E;  1HHS A;  4CO1 A;  3LPY A;  4TU8 A;  5EHH A;  2B6A B;  4WXW A;  1ELO A;  4P2S A;  3S8S A;  2V4R A;  4M5J A;  5HN0 A;  2MXY A;  3C14 B;  2MTL A;  4GVB A;  5B0C A;  4OHZ A;  3BGR A;  3PKY A;  4FKX A;  3MAH A;  2HQI A;  4IQX A;  3HSD A;  3MMB A;  1JLB B;  4CLW A;  1GMW A;  2VQF J;  4AFF A;  2GCF A;  1FNO A;  4LF7 F;  4EI2 A;  1TV6 A;  3OTO F;  1ZM3 A;  5DG8 A;  2D74 B;  5HL7 Q;  4ZPD A;  1RLC L;  5IWA F;  3R7N B;  4P6Q A;  1CJV A;  2ZOM A;  4Q2M A;  2W2O P;  4IOA Q;  3K57 A;  3JSR A;  4PCQ A;  2OSR A;  2W4C A;  4Q0B A;  1BY9 A;  3UE2 A;  1B0P A;  1G7C B;  4O23 A;  3KJV A;  2AYB A;  3IAM 9;  3QRR A;  3MF5 A;  1XMQ F;  1RT7 B;  3D1H A;  2RDD A;  1CUL B;  4OIX A;  1ZA1 B;  3KJF B;  2CPH A;  5LOQ A;  4NYP A;  2J7W A;  1FF2 A;  2PEB A;  2HAF A;  1KP6 A;  1Y10 A;  2P9E A;  4ZN1 A;  3UN5 A;  2HHT A;  5DZ7 A;  1YJ7 A;  3UCG A;  5G0R B;  2BJD A;  4C97 A;  4QU7 A;  2C3P A;  4DN0 A;  2XCA A;  2ZJQ Q;  1S1T A;  5C2C A;  3OLA A;  3QPI A;  1MU2 B;  2ZE2 A;  3CCE S;  1VC6 A;  3PTW A;  2IC3 A;  3VV2 B;  2NR0 A;  1VYA A;  3HVT B;  3LPE A;  4FKY A;  3IXQ A;  2KT5 A;  4WP8 A;  4U6P A;  1WF1 A;  4USU A;  2F63 A;  3VAM A;  4UUW A;  3CWJ A;  3LTO A;  5D4N A;  3L09 A;  2UVW A;  1VQM S;  2GNK A;  4NXM J;  2OEJ A;  2KXH A;  1VRU B;  1NSQ A;  4OZ0 A;  2L08 A;  2CPE A;  4C7Q A;  4X62 F;  5KFO A;  1KHV A;  3WZ0 A;  2VPY B;  4DBQ A;  3IAS 9;  1X9S A;  1SVD A;  4F3Q A;  4RW8 B;  2B4V A;  5AE3 A;  1SUQ B;  5A0Y B;  1N36 J;  1R0C B;  2G13 A;  3DDN A;  2E5G A;  2EFG A;  4OYW A;  1SI9 A;  3K8W A;  1RU1 A;  3M2V A;  4LQ9 A;  5KFK A;  3ZTP A;  1SC3 B;  1UL3 A;  3NBP B;  2KZZ A;  4LSN B;  1RBO B;  1VJW A;  4LRC A;  2NZC A;  4B17 A;  3U02 A;  3R97 A;  4NE9 C;  4XTT A;  2WVC A;  1KKH A;  3MCM A;  3M1V A;  2JC1 A;  3FZB A;  1I94 J;  4QWA A;  4KYZ A;  1KQG B;  2RRA A;  4QJV A;  1RT6 B;  4ZVU B;  1KFD A;  4WE1 A;  1SH2 A;  3TAP A;  2IVF B;  3CO0 P;  1NSK L;  3QT5 A;  3M30 A;  3FVY A;  2NRE A;  4MH8 A;  4NLW A;  4LFB F;  2HGN A;  1FE4 A;  5F41 A;  5SZT A;  3G6X A;  2CPJ A;  1Y11 A;  4KFB B;  4W90 B;  1BLU A;  4PXD A;  3KLI B;  4W98 A;  4CP5 A;  2HS3 A;  4F50 A;  4YQW A;  4B3M J;  1RXO B;  4NWB A;  2J8S A;  2AQ4 A;  3NGU A;  1Q4R A;  3MM8 A;  1EQM A;  2G0C A;  2E29 A;  5CH7 B;  2E5L J;  3MFH A;  1BQM A;  4TY9 A;  2QX0 A;  3EYZ A;  4J9N A;  2FJB B;  3BKF A;  3MM5 B;  4PR6 A;  1IKX A;  3RYL A;  3H2V E;  3OL9 A;  2XYG B;  3QRP A;  2YKQ A;  3Q86 A;  3MD3 A;  4ILR A;  1MG7 A;  1CJK A;  2ZBC A;  4X4Q A;  2GZO A;  4ECY A;  5HBM B;  3WBZ A;  3CD6 S;  1FKO B;  1NK6 A;  9RUB A;  4L76 A;  1UWB B;  3OT9 A;  3EZ5 A;  1NJX A;  1YBT A;  3HO1 A;  3G2X A;  3TEG A;  2CQ3 A;  2GVZ B;  1Q95 G;  2VG5 A;  4ES2 A;  1W2B R;  1N32 F;  5DM6 Q;  4GO7 X;  4FYV B;  1IBL F;  1VHF A;  1EP4 B;  3T41 A;  3DM2 B;  1LV5 A;  1SCJ B;  3FCW A;  4NCA A;  1OY9 A;  3TWZ A;  1J5E F;  2CQD A;  4I6Y A;  1HBM A;  3V4I B;  5IXU A;  4C11 B;  1U8S A;  1TP7 A;  4MKB A;  1SV5 B;  3OXL A;  1F0X A;  4Q7A A;  1HW8 A;  5ETM A;  3D2W A;  1ZZN A;  4XIU A;  2F7V A;  2CFX A;  4KAI A;  1H7W A;  4NA2 A;  2GQ2 A;  3KG0 A;  3L7P A;  3LGN A;  3W9H A;  1ZAV A;  3QIP B;  2W8K A;  2D3O R;  1JXV A;  2FIU A;  3FNN A;  4DCJ B;  3CME S;  2IAJ A;  5EX0 A;  2LQJ A;  2EK6 A;  3SQG A;  4LMZ A;  1B0T A;  2ZBR A;  2DNN A;  5CZV A;  3BGL A;  2HNZ A;  3R1H A;  4X4S A;  3IRX B;  1JJ2 R;  4NXN F;  4FF1 A;  4NZ6 A;  2R7Q A;  4FPI A;  1O5J A;  4QWC A;  3D0I E;  1X9W A;  4X64 J;  1S6O A;  2UZA A;  3UR0 A;  1ZTW A;  3FBB A;  3DOM B;  4IKA A;  5C7P A;  3QT7 A;  3W2V B;  4DXL A;  3PRV A;  3PEH A;  2IY5 B;  2HK2 A;  2KVI A;  2JLG A;  4RL1 A;  3ILJ A;  2IFX A;  2ZC4 A;  1W2I A;  1R8H A;  4RU2 A;  4OYO A;  4I4B A;  3SMZ A;  3CJK A;  1B0V A;  1Q5V A;  4NAS A;  3PYE A;  2MGZ A;  1RHU B;  4EFA C;  1T9T A;  2CXE A;  2RQ4 A;  1NZA A;  2OML A;  4R8U B;  2BE9 B;  2ERR A;  2FYX A;  5A6P A;  3QSI A;  3MHY A;  3S7R A;  1IBM F;  5B0F A;  5IV4 A;  4IOC Q;  3A8J A;  4WTY A;  5F3T A;  1R3N A;  1PC5 A;  4CLF A;  2RIJ A;  1TZ0 A;  3PYF A;  4DR6 J;  4L3K A;  4MT1 A;  3AH6 A;  2XI3 A;  3B8H A;  3ZFV A;  3DRS B;  1RAI B;  4K0K J;  3U1L A;  1XNQ F;  1FEH A;  4DR1 F;  1TKD A;  1NKE A;  2PC6 A;  2KYZ A;  1R0A B;  3B54 A;  2JSX A;  3ENW A;  2VPZ B;  1T9Y A;  4YME A;  4ZCI A;  2E7V A;  4CO2 A;  2E5I A;  5HAT A;  2KYX A;  3VAL A;  3M4X A;  2W9A A;  1URR A;  3W61 A;  4RUA A;  4O3N A;  1FRK A;  5T14 A;  1O8B A;  2G1H A;  4MJK A;  2OFH X;  3J7A N;  2J9D A;  5L1I A;  3LO3 A;  4UTG A;  2G2Z A;  1KC8 T;  4ED1 A;  1S79 A;  2ZJP Q;  4NZ7 A;  4QW8 A;  1MWY A;  4D3H A;  2VQE F;  4AQY F;  1I3O B;  2N3O A;  2B5J A;  2QYC A;  3OVS A;  4J9Q A;  4PQU B;  3HFV A;  5IM0 A;  5F8M A;  4TYB A;  1JLG B;  4K59 A;  1SC6 A;  3T5J A;  5LXY A;  3P49 B;  1YRX A;  2HMI B;  3AOC A;  5D4L A;  1RAC B;  4Y2I A;  5F3Z A;  3MWB A;  5I3Q A;  2VPW B;  1T3O A;  1T9W A;  2L48 A;  1M1K T;  1NND A;  3N01 A;  3MCN A;  4MYT A;  2F9J A;  3M9O B;  3LAM A;  2NXN A;  1XBW A;  2FVQ A;  5C42 B;  4HYK A;  2ZNY A;  3K5M A;  1RDR A;  3ISN C;  1BGX T;  2UUT A;  2J6S A;  5A8K B;  4K2J A;  1U2C A;  2R7O A;  4ELT A;  5GAH I;  5L9X A;  3JB9 k;  4MK9 A;  2CQ4 A;  3I5B A;  1LW0 B;  4QYR A;  4Z37 A;  2EFV A;  4O44 B;  4DV3 F;  3TZW A;  2G0I A;  1YLX A;  3NOC A;  5J1N A;  2CAJ A;  2UXD J;  4RWW A;  1QE1 B;  3BZQ A;  1S6U A;  3GR1 A;  1S0O A;  2PII A;  2WOM B;  3JXO A;  3WIV A;  1JX4 A;  2EBE A;  1QSS A;  5DO2 A;  2LEP A;  2IBK A;  1RT5 A;  3TP2 A;  1UPM B;  1LK5 A;  1RAA B;  3T5L A;  4LF1 A;  2V8P A;  3T9Z A;  3JSB A;  2F8M A;  3I4H X;  5AT1 B;  5IQQ A;  5E2Q A;  3HHL C;  5E3C A;  4OJ1 A;  3TOQ A;  4FYX B;  1HQE B;  3OVA A;  3CDA A;  5HVH A;  2LEC A;  3CVK A;  1TUG B;  4DL0 C;  4JUZ A;  4ID5 B;  2DB1 A;  5HJY A;  4ED6 A;  1IQZ A;  3EIC A;  3MR2 A;  4XPC A;  4OI3 A;  2WON B;  1FKP A;  4ZP9 A;  2O01 C;  3SCK E;  3EGN A;  5LSR A;  1JIH A;  4CLL A;  3ILO A;  1OPZ A;  3LP0 B;  4LF8 J;  2YWE A;  3DYA A;  2HLU A;  1ZET A;  2Z30 B;  1WDT A;  2EKN A;  1WEX A;  4BHQ A;  1X31 C;  2KH9 A;  4ZPV R;  1VMB A;  4KY3 A;  4NA3 A;  1RE1 B;  1LOU A;  5HRO B;  2OH2 A;  4ILL A;  3Q8P B;  2ZVI A;  2ZZN A;  5KFG A;  4JB8 B;  5HAO A;  3IFE A;  4AL7 A;  3RTV A;  2JEG A;  3CNQ P;  1ACM B;  2AGO A;  2GIR A;  2DHX A;  5HAN A;  5AE1 A;  1K1S A;  2W1B A;  4CLY A;  1K9M T;  3BQ0 A;  3KG1 A;  2GGP B;  1LEO A;  2PI5 A;  4B3T F;  1X4D A;  2C2N A;  3Q8R B;  3VCD A;  3NNA A;  3POT A;  1HI0 P;  5KG3 A;  4KT0 C;  4PXE A;  3BYP A;  2OI2 A;  4DR4 F;  2QA4 G;  2U1A A;  4Y2K A;  4ZP8 A;  2QG9 B;  4JI2 F;  4B9M A;  4QU6 A;  4OX7 A;  1XQI A;  3DRP A;  1YZ6 A;  1BHN A;  3ZZT A;  1Q81 T;  2J7U A;  2W9B A;  3DMJ A;  2MQL A;  5KG6 A;  1WOP A;  1NKB A;  3JYT B;  3MPY A;  3V6D A;  4NI2 A;  1NHV A;  2VKR A;  1E6V A;  4NLS A;  2CJY B;  1CJT B;  2HQC A;  2BYC A;  5KFJ A;  1S1V B;  4B08 A;  4FNH A;  1U6B A;  4L75 A;  1L3V A;  5BR8 J;  1D9A A;  2BV3 A;  2I5J B;  5C24 B;  5J1E B;  5KFD A;  3M8P B;  1CQM A;  3SXL A;  3KMS A;  3CT9 A;  1PYT A;  2HKE A;  3HHL A;  2C2O B;  2M9K A;  4LSL B;  2DNH A;  4DHV A;  3UDE A;  2LA6 A;  4ZVG A;  1JJH A;  1Q78 A;  5FJ4 A;  1FT8 A;  3UFC X;  3D1Q A;  3IS9 A;  3I0S A;  1U45 A;  3MCS A;  2BXJ A;  4USI A;  1QAX A;  5LXR A;  4YEA A;  2MKJ A;  3DI6 A;  2KRR A;  4U67 Q;  2BAN A;  4NLT A;  5GAD U;  2VF3 A;  2QMU B;  2D9O A;  3MUM P;  1B3T A;  2NZ4 A;  1NKC A;  2GHW A;  4X4U A;  4OZ5 A;  4K8R A;  2DNR A;  4USV A;  1B7F A;  1NDK A;  3D6M B;  4DL7 A;  1S1W A;  5IV3 A;  4RW6 A;  4KH1 B;  1YQH A;  2ROE A;  2HQG A;  1NJW A;  1S9G A;  1XIQ A;  2WAQ D;  2GFF A;  1B4S A;  4B3R F;  2D69 A;  3MM6 B;  2BR0 A;  3POT B;  2UUB J;  2XB2 D;  3BSN A;  3ITH A;  1WOS A;  4AT1 B;  4JYA F;  4ATN A;  3PEJ A;  2VG6 A;  4JI8 F;  2Y0B B;  2FQQ B;  5F8L A;  1N5Y A;  1SJ3 P;  4G1Q A;  2ZKU A;  2YQ1 A;  2YNF A;  3K5P A;  4C4W A;  3HHE A;  4DR2 F;  2PSZ A;  1BMQ B;  2MKS A;  4PWD A;  2Z57 B;  3G6V A;  5J2N B;  4DFJ A;  2XCP A;  1WEY A;  3TJA A;  3RB4 A;  2VA2 A;  3ZZO A;  4UZB A;  1RWW B;  2CWX A;  2ZH8 A;  2V2Z A;  1VQY A;  2HWH A;  1SIZ A;  1R31 A;  3SIP B;  4NLY A;  3R7S B;  3RW7 A;  5KFX A;  1PBA A;  4J7C A;  4P71 A;  5DQI A;  4NCG A;  4A8F A;  5B0B A;  2H3E B;  1VQ5 S;  1TFY A;  3GFZ A;  1DZ5 A;  4IQM A;  2E5J A;  3C6T B;  4IOB A;  1S6Q A;  5E3A A;  4TU7 A;  4FF4 A;  4H4O A;  3FZ2 A;  3DLE B;  1UVM A;  2IBO A;  1FNM A;  1NK9 A;  5KFQ A;  3HHN B;  1C0T B;  4OZL A;  1PAE X;  2IM0 A;  4P2F A;  2JNJ A;  4RUC A;  2CPX A;  1NPP A;  4J91 A;  4M5L A;  3ULH A;  4HAC A;  3C46 A;  3JSM A;  2V6A A;  4CLT A;  2XSJ A;  3GJS B;  3MM9 A;  1YJU A;  3T3F A;  1K73 T;  4F04 B;  2XMA A;  1YGY A;  1R6V A;  4RW6 B;  2GQC A;  3CJ8 A;  4QWD A;  1TL7 A;  3OPK A;  3C3L A;  4ETZ A;  2VKZ G;  3T1A A;  1UKU A;  1YJW S;  3UN3 A;  1V5V A;  4CM2 A;  1TFW A;  4E2F B;  1FJ7 A;  3LP1 A;  4O3O A;  2HFN A;  1KEK A;  1UEV A;  4TVA B;  3E8O A;  1GXU A;  3KDN A;  5RUB A;  3EZU A;  4HT5 A;  3DXB A;  4X4T A;  1U7L A;  1S4E A;  3ZZZ A;  4A46 A;  3R9L A;  2VDH A;  4MAK A;  2MQN A;  3UVJ A;  4LRD A;  1WI6 A;  1IWG A;  1O6X A;  3KWM A;  5KFH A;  1N6Q A;  4MYU A;  1ARO P;  5C5J A;  5IT9 U;  1SJR A;  2J9C A;  3CCV S;  1SJF A;  1FE0 A;  4K4X A;  2H65 B;  4JV1 A;  2V8H A;  1FTR A;  3PYG A;  1M0S A;  1HMV A;  3NAH A;  2RAQ A;  1NH7 A;  4IRD A;  4MIA A;  2OPS B;  4UY8 T;  4Y65 A;  2HW3 A;  3KG4 A;  4DL4 A;  3ZZ0 A;  1GNK A;  3QAE A;  1VLO A;  4NMX A;  2KG1 A;  2W2M P;  1JKH B;  3I82 A;  3FEZ A;  3CJT A;  3EXC X;  4NX9 A;  3MXH P;  4DFM A;  2CAD A;  3I9Z A;  3VZI A;  4N76 A;  1WOO A;  4LFA F;  1R8C A;  2JHE A;  2VH7 A;  2DNG A;  4ES3 A;  1JLA A;  2J5A A;  2V4Q A;  2B51 A;  1K44 A;  5F8H A;  2HND B;  5KT3 A;  2HGM A;  4P73 A;  4M5D A;  2AGQ A;  2HGL A;  1UVN A;  4DR7 J;  4ENO A;  4HAC B;  2X3G A;  2OLW A;  3BS9 A;  1FI4 A;  1RYR A;  5L46 A;  4MKY A;  1EET B;  4U7U D;  2Z4P A;  4L72 B;  2LQB A;  1PCA A;  3AA8 A;  4OX6 A;  2OP5 A;  2K2P A;  1IQT A;  4NA1 A;  4B9N A;  4OJH A;  4CO4 A;  2ZH9 A;  4U95 A;  4CM0 A;  3VGU A;  5FLX Y;  1RYS A;  1UFL A;  1FNX H;  1NUE A;  1QUV A;  2XM3 A;  4OZJ A;  1T3N A;  3BSA A;  4XPE A;  4CWB A;  3PNI A;  3OJS A;  4EBE A;  2DIU A;  2LYV A;  4CNY A;  4CH1 A;  2JL9 A;  5BYR A;  2FHJ D;  4DFP A;  1T95 A;  2VBW A;  2N7Y A;  2OFG X;  2L3M A;  2V69 A;  4ICL A;  2E1C A;  1L5U A;  1UVI A;  2QLW A;  3V5R A;  1AUS L;  3R5B A;  1BUX A;  3A8I A;  3H5X A;  1HYS A;  3DLG A;  2JLF A;  5ADZ A;  4BWJ A;  3EMT A;  2DIT A;  4JI7 J;  3HD1 A;  5C2G A;  5CD4 A;  4UUX A;  5KFR A;  1OY8 A;  4DV5 J;  3VGS A;  2UUC J;  4AND A;  1HMV B;  4IFY A;  2MB0 B;  3KJN B;  3CDW A;  2V2V A;  4KHR A;  4TN2 A;  3HCX A;  4YY3 F;  1NXI A;  1XR5 A;  4TU9 A;  1QUP A;  1KLM A;  3A3O B;  3AB2 B;  5L8R C;  1RBA A;  1CC7 A;  4KGM A;  4DSE A;  1JNR B;  2JVR A;  3W66 A;  1KHW A;  2FPH X;  2YKP A;  1TVR B;  9ATC B;  5L1J A;  3CCQ S;  2ZH2 A;  3M05 A;  3BGF A;  5J2P A;  3H5Y A;  4K50 A;  4ZIW A;  1WI8 A;  5HMY A;  2DXD A;  1Q8I A;  4M5D B;  1JLE A;  3ENA A;  2K8G A;  5DS7 A;  2DIV A;  2DR5 A;  2DCL A;  1YJR A;  4DV7 J;  3MMC A;  3G4S S;  3MPU B;  4HDG A;  4P72 A;  1HIY A;  4LR8 A;  1JXL A;  5KG7 A;  2CPF A;  3H0P A;  4KHP J;  1FTC A;  2ALZ A;  3EGV A;  1T9U A;  1KNZ A;  1TL4 A;  3TA0 A;  1SH0 A;  4H54 A;  2VL1 A;  5MLC V;  1RLD A;  2VAS A;  2OPQ B;  4OMF G;  3ZC4 A;  1SIW B;  4V1A k;  2E1A A;  4RLE A;  1NB2 A;  4QOT A;  3EDQ B;  3HVA A;  2O5D A;  3M8Z A;  2Q1L A;  2XWY A;  3EVM A;  4AXI A;  4LRE A;  1UVK A;  1SL2 A;  2KHD A;  4J9V A;  3TR5 A;  2EFQ A;  1F60 B;  3NS6 A;  4OV1 A;  1J2V A;  4DQP A;  1E6Y B;  3KLE B;  2R7S A;  2L9N A;  2ILZ A;  2AWZ A;  4N77 A;  2PA3 A;  3CSK A;  2HHH F;  3D6F B;  5I3U A;  1Y5L B;  4LF6 J;  4EZ9 A;  5E0O A;  4E8U A;  1DBD A;  2LXI A;  4EYH B;  1HQU B;  1NME B;  5JUM A;  2Y9H A;  3Q83 A;  3FFI A;  2WVB A;  1Y7P A;  4EZ6 A;  3BJY A;  4RU9 A;  4O3P A;  5KTQ A;  2HIY A;  3LAK A;  2QYG A;  5GAG U;  4USM A;  1KLM B;  1NPR A;  4QZV B;  3PKM A;  2GIF A;  5CYM B;  4V19 J;  1FK9 A;  3KK2 B;  1RWN B;  3KLV A;  2KM8 C;  1RB0 A;  3MEE A;  4WK3 A;  1U49 A;  3GG1 A;  5LMU F;  3MTK A;  1S76 D;  2FJW A;  1HI1 A;  3RRH A;  2YX7 A;  2WVE A;  1KOH A;  1TK8 A;  3SI8 A;  2UXB J;  4JI4 J;  4X66 F;  2IIH A;  5KFZ A;  3RG6 A;  3M9M B;  2K1R B;  1S12 A;  1S59 A;  1FFS B;  3IM9 A;  5IFM A;  1S57 A;  4ANC A;  2DNK A;  1F9E B;  2FLO A;  1R8A A;  2WSF C;  2D3Z A;  1LW2 A;  2B9E A;  4I0W A;  4DL3 A;  2CJQ A;  1ZH5 A;  1J5O A;  1C4A A;  1X5O A;  1UW4 A;  1XWL A;  4DL5 A;  2OPP A;  1OJ4 A;  1S0V A;  1RKJ A;  2BUN A;  3EXY A;  1CSJ A;  1N8R T;  4FYW B;  1QTM A;  3VTI A;  4KV8 A;  1S5Z A;  3P96 A;  3RBZ A;  3UWT A;  4ECU A;  2KTQ A;  3NWG A;  2J8A A;  2RSQ A;  1YRU A;  5KFS A;  3R6L B;  3ZO7 A;  1C0U A;  4F8R A;  2LEA A;  5K8N A;  4IG0 B;  1WKJ A;  3DOL B;  3J81 j;  3OTC A;  3J7A 1;  1S7H A;  2HS4 A;  1WC0 A;  5G4D A;  5KT6 A;  3X1L B;  4JI5 F;  5GMD A;  2JWN A;  5I3U B;  3PIP Q;  3CCM S;  3P8B B;  3OL7 A;  1XNR J;  3VQT A;  1TKZ A;  3NCR A;  3HK2 A;  4TQS A;  2DRA A;  3KNA A;  3UR3 C;  1WD6 A;  1FWK A;  3C16 A;  1VQ6 S;  4OI2 A;  3MMA B;  4ZVP B;  1KVJ A;  4ZVR B;  2AV5 A;  4NEY A;  5DG9 A;  2CJK A;  5FDL A;  2EFP A;  1ZPW X;  1VHI A;  1Y3K A;  3IMQ J;  4DV1 F;  1TL1 B;  1V3R A;  2E7X A;  3DCA A;  2OPR B;  3MEE B;  1W7W A;  3JSY A;  1M5P C;  2J76 E;  3OR2 A;  2O3D A;  3TI0 A;  2FB0 A;  1D3W A;  2W2N P;  3OFG A;  1DTT A;  4DQI A;  3K7R A;  3F73 A;  3UN2 A;  3M6U A;  4ECR A;  3W62 A;  2R9L A;  1GTE A;  2HS0 A;  4ED8 A;  3VZH A;  2EG1 A;  2UUA J;  1K47 A;  2RKI B;  1IKY B;  3QID A;  1I1G A;  3NGS A;  2Q6C A;  2V67 A;  3MEC B;  1WEZ A;  3LQV A;  1R7I A;  3CB4 A;  1FKA F;  1KFS A;  3BKT A;  1U2F A;  1YZ7 A;  3OUY A;  3KLF A;  5KOX A;  4KE5 A;  5E5N A;  4K4Z A;  2Z2M A;  1FD2 A;  3TEH B;  3HF5 A;  4LF7 J;  3F44 A;  4RBV A;  3OTO J;  3PW2 A;  2EC0 A;  1RT4 B;  3NCP A;  5DQG A;  2B4U A;  2YWH A;  4E98 A;  2E7W A;  1TMM A;  4DX6 A;  2RF2 B;  4Q8F A;  4KH0 B;  2RB7 A;  1N0U A;  2YKN A;  2VQF F;  1RTD A;  3M2R A;  2ZH3 A;  4CYU B;  2DT9 A;  1HKA A;  4IG3 B;  4DJB A;  5J2Q A;  3C66 A;  2FLP A;  2B9W A;  3FDS A;  1N52 B;  4RW4 B;  2QN6 B;  3V4M A;  4K4W A;  5ETQ A;  4RZR A;  4TLQ A;  4DPW A;  2L41 A;  4X65 J;  1OIA A;  3KXD A;  3RGI A;  2LMI A;  1HLW A;  2XI2 A;  2QMX A;  3P4U B;  4FF3 A;  4DV0 F;  2CQB A;  1FDD A;  4ZVO B;  4MTP A;  3R3T A;  1A0O B;  4OYA A;  4ZLL A;  2VON A;  1NDC A;  2HWI A;  2Z58 B;  4O0N A;  3Q8U A;  1JMT A;  4F3M A;  3TAR A;  4NOH A;  3TA1 A;  1IBC B;  2N4D A;  3PW5 A;  2DRB A;  1X4F A;  4F26 A; 
#chains in the Genus database with same CATH homology
 3EVO A;  3VVU A;  4ANE A;  3FBE A;  2DXF A;  3PJ9 A;  3FCW A;  4F36 A;  1LWX A;  1S59 A;  1NUE A;  1UCN A;  1LEO A;  4KPC A;  1S57 A;  2HUR A;  4W98 A;  4CP5 A;  4ANC A;  1BE4 A;  3JS9 A;  3Q8V A;  3FBB A;  3WX8 A;  1MN7 A;  3BH7 B;  3ZTO A;  3Q8Y A;  3Q89 A;  1KDN A;  5C7P A;  4C6A A;  3NGU A;  1EHW A;  4DZ6 A;  1B99 A;  3FKB A;  3PRV A;  4HR2 A;  3BBC A;  3EE3 A;  3FBC A;  2B8P A;  3B54 A;  3FCV A;  3ETM A;  1HHQ A;  3NGT A;  1NHK L;  1NLK L;  2DXD A;  1NDL A;  1NPK A;  3BH6 B;  3NGR A;  3ZTP A;  3ENA A;  4FKX A;  3ZTS A;  3FC9 A;  1XQI A;  2AZ3 A;  2CWK A;  3EIC A;  1BHN A;  4UOF A;  3VGV A;  1BUX A;  3VGT A;  1NCL A;  1W7W A;  3Q83 A;  1S5Z A;  3ZTR A;  4WBF A;  3EM1 A;  2VU5 A;  2B8Q A;  4EK2 A;  1JXV A;  2BEF A;  3L7U A;  3EMT A;  5BXI A;  1HIY A;  3Q86 A;  3VVT A;  2HVD A;  5CAB A;  1HLW A;  1NDK A;  2BX6 A;  1K44 A;  3BBF A;  3BBB A;  2DYA A;  5IOL A;  1VYA A;  3DDI A;  1WKL A;  1U8W A;  2DY9 A;  4DI6 A;  3R9L A;  3VGS A;  4FKY A;  4ENO A;  2AZ1 A;  4AND A;  1XIQ A;  1F6T A;  3VGU A;  1NSP A;  1WKK A;  1B4S A;  1NDC A;  1ZS6 A;  3GP9 A;  5CAA A;  4O0N A;  1WKJ A;  2DXE A;  3ELH A;  3MPD A;  3Q8U A;  1NSK L;  3G2X A;  1F3F A;  3GPA A;  3FBF A;  3NGS A;  4DUT A;  1NB2 A;  3ZTQ A;  1PAE X;  3B6B A;  3DKD A;  3EJM A;  2ZUA A;  1PKU A;  2NCK L;  4UOH A;  1NSQ A;  2HVE A;  1MN9 A;  4S0M A;  3EVM A;  4UOG A;  1NDP A;  4F4A A;  3EVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...