4DR2J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr2J00
2VQEJ 4X64J 4PWWA 4LF7J 1HNZJ 4LF9J 4LF4J 4KHPJ 3R2CJ 1N34J 5A2QU 2UXBJ 3W1YC 3J7AN 4NXMJ 4LF5J 1HNWJ 2UXCJ 4V1Ak 1FJGJ 4YHHJ 4OX9J 4JI1J 4JI2J 4KY3A 5AJ3J 2UXDJ 2UU9J 3R2DJ 4JI6J 5BR8J 4LFCJ 3IMQJ 1J5EJ 4JI4J 1XNRJ 4RJVA 4JI5J 1N32J 4B3RJ 2UUCJ 1IBKJ 4KYZA 4DV1J 4DR7J 1XMOJ 2E5LJ 4LFBJ 1N36J 2F4VJ 4DV3J 4HHUA 1HNXJ 4LF8J 4JI3J 4LF6J 5FLXU 4DR2J 4DV4J 2VQFJ 2UUAJ 3T1YJ 4B3MJ 4DR4J 4X65J 4DR3J 3D3CJ 4DR6J 4JV5J 4JI0J 3JAMU 1I94J 4DR5J 4AQYJ 2UUBJ 4X62J 4NEZA 4DV7J 5IT9U 1HR0J 4GKJJ 4DV6J 5IWAJ 4LFAJ 4GKKJ 4DR1J 5LMNJ 4DUZJ 1XNQJ 4JI7J 2MEWA 4B3SJ 3T1HJ 5LMUJ 3J81U 4DV0J 2ZM6J 3OTOJ 4NEYA 4DUYJ 4K0KJ 4JYAJ 4X66J 2KVQE 4YY3J 1IBLJ 4JI8J 1IBMJ 4NXNJ 2MQ8A 4DV2J 2HHHJ 3J80U 4DV5J 2MTLA 1XMQJ 1N33J 2KL8A 3D3BJ 4B3TJ 5LM7E
chains in the Genus database with same CATH superfamily
4X4NA 5ETSA 2Z2YB 3FZBA 3B54A 3M2RB 1MROA 3AJ2A 3KJVA 4YOEA 2DXEA 1T95A 2CPYA 2W9AA 4LMZA 2I2YA 3ULHA 3KLGA 4DN9A 1Q79A 1T3NA 3I31A 1WSRA 1CJUB 4WFAQ 1H2UX 2U2FA 4EBEA 4RU2A 2WB1D 3THVA 1R0AA 5CZXA 3CIMA 4O3NA 1WKJA 2KI2A 2IPOB 4D3GA 3K7RA 1HBNB 3JQMA 4AL6A 3RW7A 2D3UA 4MMOA 2EG1A 1RA6A 5L1JA 1VHFA 2RB7A 2AKWB 3M6VA 4N47A 4XAKA 1P9YA 3W8GA 5C25B 8ATCB 4CCHA 4HDHA 2HQGA 3QYYA 1GMVA 2O3DA 3PYDA 5L38A 2XMTA 2ZD1B 2DHXA 2W9BA 1W2IA 4ZVOB 4QW8A 4JI8F 3W5ZA 2Y1IA 3IM8A 2WOMA 5AJ3J 2I8EA 3P3DA 5I3UA 1WEXA 4GO7X 4RUCA 1C1BB 1F0XA 3R5DA 5GADU 1V9OA 2ZWPA 4B3RJ 3Q89A 5EHHA 2BJ8A 3ILOA 1JLBA 3TZYA 2YWHA 1M5SA 4PWUA 1S7HA 1R8PA 4L6V3 4EBDA 3LO3A 9RUBA 4IOAQ 2OPPB 2V8PA 4ED6A 2Z30B 3OTDA 3D6FB 3MMCB 2IDEA 4C0OC 4KB7A 1BUXA 1QTNB 3MCNA 1TZ0A 3MMAB 4YMEA 4X66F 5KFKA 3PW4A 2D7SA 2IFXA 2XI3A 2F65A 3T9ZA 4J9OA 5D4NA 1PO6A 3MM5B 4WZMA 3DM2B 1YGYA 3F44A 4OHVA 4MK8A 1S6QB 1FWLA 2V68A 3PY8A 2GIFA 3K5NA 1DLOB 3N6NA 2HRYA 5KG5A 2JZ5A 2KM8C 4Q45A 1RYSA 1U8WA 3FUYA 4UUWA 3MM6B 4J91A 1HBNA 2KT2A 3DGVA 1PILA 2OKQA 2CPEA 3QQCD 1QE1A 5FDLB 1C0UB 3BYRA 3QRPA 2BKNA 4ZS6A 2CQ4A 3KJNB 5D0GA 4JI0J 3R6GB 3JAMU 4DLGA 2B4PA 1LW0A 4J9UE 3NOCA 4RNFA 2ADBA 4C4WA 2KFZA 1KFSA 2A18A 1TKTA 2Z56B 3BPSP 5HBMA 3KLHB 3LF0A 1RJJA 2OPPA 1L3SA 1U25A 1WF2A 1BE4A 3CCQS 5DZ7A 1NSPA 1WG5A 1SH3A 2CFXA 4LBPA 4LFAJ 1IBCB 3TUJC 3BGLA 5ETPA 5H9FJ 1WJ9A 3W2VA 3S01A 2RSQA 4ED7A 4DSJA 1Y9OA 3I0SB 3BV8A 4B3OB 2DT9A 1KC8T 2B4UA 3K17A 4MYTA 2HHUA 2MGZA 4HEA9 4ECWA 2P9GA 4CQ1A 4RW8A 2LU1A 3DOKB 4H54A 3PIPQ 3RAXA 2I5JA 3PRVA 4QIWD 3H5SA 1PC4A 1FDNA 2YQ0A 3GJTB 4RNHA 3CUNA 2GQQA 2JWNA 4GVBA 4RO0A 1C0TA 1ZYQA 5K5MA 2EKYA 2MLYA 4FYWB 3PEJA 1H6KX 3BGRA 4WCEQ 2HNZB 3KK2A 4O3RA 2ROPA 2ZUAA 1FDAA 3NBPA 3DMJB 4WP9A 4DQRA 3C46A 1NDKA 5ETRA 1IBMJ 4FBTA 4K7QA 1KOHA 3C15A 2UUAF 5ETQA 4DZDA 1P6TA 3BBFA 1HHSA 1M1GA 4F26A 2ZZNA 1MWYA 5A8KB 4DLEA 2HVHA 2PGCA 2NYHA 4USHA 2YKQA 4HTIA 4ETXA 2YNIA 3W60A 3AQOA 4WFNQ 5IT4A 2Y8WA 2M8HA 3ZZPA 3GR0A 1IXKA 3EM1A 3NXZA 4W98A 4ZJQA 2GQ2A 2R7RA 3R1LA 1N5YB 4WU3A 2KRBA 1R31A 4UZCA 4PWWA 1M5KC 2XWXA 2Y9HA 1JKHA 4XIUA 3W64A 5ADZA 3M9OB 1HNZJ 4LF7J 4NCBA 1K0TA 2EFVA 3M30A 5SZTA 4LIWA 4NI2A 3GFHA 2V94A 4C3MA 4MH8A 2W8KA 2BZ2A 2XWYA 2C2NA 3TI0A 1RE1B 2AHOB 3LA0A 3N5FA 3QNWB 5LXRA 2HMIB 2VA3A 4YUDA 4OI0A 1RCOB 3PJWA 2WONA 1UEKA 3BSOA 2MGZB 3QJJA 1IR2A 1YRTA 2UUTA 3BKUA 2VODA 4AFFA 1N48A 3C14B 2HURA 4V1Ak 1S1TB 2DGVA 3NS5A 3CJQA 1KNZA 1RT1B 1LWXA 5L1IA 3EZUA 4DR5F 3T6BA 1A0OB 2CJ9A 3Q22A 3PM9A 1H38A 2RKIB 1I51B 3KK3B 2H5EA 3CCJS 3PW2A 1DFDA 1FT8A 1HNIA 2CNNB 4F4AA 1EETA 4RKUC 3TYTA 3CCSS 1DTQB 1EX8A 3V4MA 4HACB 5LSRA 2R7QA 2B56A 3H25A 1WI6A 4DPOA 4WF9Q 1FRHA 1YVFA 2XG8A 4L74A 3NGRA 5K8OA 1T11A 3UR0A 1N0UA 2CRLA 2OMLA 5EX0A 3GV5B 2XZWA 2FD2A 3MEEA 4CT8A 5GAHU 1FRLA 2BKOA 2YKAA 4O44B 3TVYA 2XBPA 4DV0F 3PVXA 1NPKA 2OSQA 3E2EA 4IRKA 3BQ1A 2KFYA 4DSFA 3PKMA 3G8TA 3D68A 3AOCA 3THPA 3IN5A 2R7OA 4ED5A 2R7TA 2B9WA 2WSEC 4PYAA 3L7PA 3G6XA 5ETNA 3CJSA 4OYIA 5HK4A 2EG2A 2AGQA 4DL5A 2DGXA 1HIYA 1SKUB 4CH0S 2JLGA 1HPZB 5KFJA 2LDYA 3NWRA 5K8MA 3LP2B 3B82A 3ETMA 4TU8A 1FNOA 3KLFB 1SJQA 1EQMA 3CXCR 5KT3A 4H4OA 2C1EB 3DXSX 4DEZA 4JV5J 3ETOA 2VFUA 1KSPA 5IOLA 3W2WA 1J2VA 1NJWA 4NLPA 1RABB 2HZCA 1HYSA 2L48A 5J2NB 4CO0A 2E5IA 4X62J 1N4LA 4X2BA 5IT9U 4DV6J 4OZLA 2XS2A 3MF5A 3Q83A 2XMAA 5IWAJ 1YJ7A 4AUKA 3CCES 2LP4A 4AL5A 2YX7A 3W9HA 3M8ZA 3D7SB 4Q2MA 2UUCF 3M2UB 2RD5C 2XS7A 2ABYA 1QLNA 1B4SA 2FHJA 1M5OC 2LFVA 4L73A 2DNLA 4ELVA 2QT7A 4OL8A 2G0IA 2KZMA 4DFPA 3ZZYA 4E8UA 2UXBF 5KFFA 1RA7A 4DUYJ 1LW2A 1VQOS 4TNOA 1LK5A 2DNNA 4Y6IA 5DRKA 1CJUA 4QZVB 1D09B 2HFVA 2KJWA 3FQLA 3ZO7A 3OUYA 2WRMA 2H4YB 1VQNS 3ZZZA 3DOMB 3OR1A 4WU2A 3BGUA 1CPZA 4M5GA 4KSEB 2VKRA 2V2ZA 4USVA 5BR8F 1WSVA 3CJ0A 1CEZA 4P6QA 5D0HA 4CTAB 3GU0A 4G6VB 3LP2A 5FIIA 3RAMA 1L3TA 2AJQA 3Q8PB 4DV5J 3VGVA 4ITSA 3ISNC 2J5AA 2B51A 1NU4A 2DTJA 3QFWA 4IG3B 1WD6A 4AXIA 4IH6A 2PMZD 1FRKA 2B5JA 4QR0A 4ZCLA 4A47A 2ATLA 1JB0C 1I94F 2QMWA 1NK7A 1TTHB 4IG0A 5A8RA 5KT2A 2HQ3A 3O6QA 1NSKL 2M88A 2B9YA 2F8HA 2LXFA 3NGSA 4YFUA 1JWWA 2D3ZA 1YG0A 2G9OA 2CPHA 4WFXA 2W2NP 4RUHA 4C2MA 4ECTA 4C0HA 1TL1A 3MEGB 3KK1B 3EX7B 5B08A 3OSPA 1XNQF 3HSJA 1BHNA 4PQUA 2FC8A 2XZDB 3K8WA 3MD1A 4OYMA 4CZCA 3ENWA 4C11A 1YQHA 1ZA1B 2DISA 2EFPA 3L09A 1N6QA 4LSNB 4DDFA 2ZEJA 3W1YC 4UT4A 4KGZB 4ZPDA 4OYOA 5IFMA 4KIAA 1R8BA 2L08A 3ZFVA 3BGOP 1NEEA 1NHKL 1UETA 1RT7B 4FVMA 4OJHA 2Q1LA 4OI2A 2AJ0A 3BN7A 1O0PA 1UP1A 3B6BA 3DU6A 3GJRB 3M8PB 4USUA 5E3AA 2ASDA 2Y0BB 1HQ2A 2CNLB 2OP5A 3CB4A 1RTZA 3IR7B 4FPIA 1LWCB 1GX6A 3D6TB 5DDRC 3E01B 5BYQA 1RT4A 2FQQB 1FWKA 2F40A 1IQTA 1RT2A 1S9EA 3SQOP 1J5EJ 4WXOA 5ETMA 1NPRA 3IBWA 1HD0A 2R7UA 3W66A 1FF2A 3MMBA 3KMQA 1FE4A 1OJ4A 2BANA 4PAAA 5L9NA 4QOTA 2X7IA 4OJGA 1XMOJ 2E5LJ 1RISA 2H54B 3HHKA 1S9GA 4K2JA 1MN7A 1APSA 4CI0B 1RAAB 1CS4B 3LP0A 2Y1JA 3CCWA 3L9ZA 3M7VA 3MAHA 4ZPAA 5HMXA 2C28A 2ZH2A 4ECSA 1VBYA 2IHR1 4PPZA 4ILMA 2Q79A 3SSQA 3RTVA 2ZITA 3KHGA 2V4JB 1RAIB 4YY3F 5HLFB 4OLOA 1L3UA 1UFLA 4P2SA 5KAKA 2XLJA 1CJVA 4DV4J 1EIYB 2YH0A 2J9DA 3HFVA 3MPDA 4USIA 4B9TA 4N5SA 3AB2B 5SUHA 3BYPA 4ZCKA 1SV5B 2BE7D 2JSXA 2W24A 4U7UD 3M6WA 3SQGA 4O0IA 2LYVA 4LR9A 3CCTA 2VG7B 4M5IA 4FS1A 4ED2A 4KT0C 1Q86T 1XNRF 1BQNA 2DD8S 1FCAA 4X64F 2ZJQQ 1FKOA 2F1FA 2CNKB 3OQ2A 4WK1A 4FF2A 1DAXA 1YBUA 4CLLA 2GV1A 3J7YU 4U67Q 1UFKA 2HS0A 3KYLA 1YITS 2V8DA 4ILRA 2KHDA 2GVZB 2I1RA 4I0WA 1DZ5A 1VRUA 4LR7A 4F50A 1L3VA 4U95A 3DRPB 2XY5A 4K4TA 1F3FA 3BSCA 4RWWA 3TZXA 2IC3A 2CADA 1NSAA 2FTRA 2MQMA 1B70B 2MKCA 3FSIA 2PI5A 4LF5F 2KYXA 4H4KC 3DLBA 1R8AA 1U1MA 3MM9B 4Q0BB 2C2RA 4YN3B 1LNQA 2LQ9A 2DITA 1HBOB 3CDEA 1EP4B 4NE9C 4PCQA 2EVZA 4CLKA 4DOZA 3PHEA 3IWLA 2G2OA 4U8VA 5D77A 1F5BA 3M9NB 3UCUP 3V6DA 5F9LA 2R2TA 4TY8A 3GIKA 1YJVA 1CULB 1KVIA 3M2RA 2MQ8A 3UR3C 1H98A 3AD8C 3IS9B 4WWSA 1GH8A 3RBXA 2GVDA 1JLEB 3HXMA 2RU3A 1SV5A 1T9XA 2EBGA 2FVRA 2K2PA 3AAWB 4NLDA 4DR7F 3SV4A 4QIGA 4ETZA 4LFBF 2CPDA 1VDHA 2MQNA 4NRUA 3DDKA 3Q8QB 1F9HA 4OI3A 3UN3A 4C48A 2AEMA 4CO2A 5B7WA 3MAQA 1HR0F 1SQFA 2QO3A 3C16A 3AFGA 2HLTA 4LF9J 4OZ0A 3L7UA 3ZTSA 4PQAA 4CNYA 5KFPA 2OD4A 3QWUA 2FJBB 3IG1B 1SXLA 5DLGA 4B3SF 3BREA 1X4AA 1JXVA 1PAUB 4LVNP 1Y5LB 3UO0A 5J1EA 3CJTA 3LALA 3MR6A 6FDRA 2IVYA 1VOMA 2CAJA 2QLJB 2IA6A 3PR5B 3IS9A 4ANDA 4TU7A 3OTBA 5DJBA 2MKJA 1ZM9A 1UTAA 3H4DA 2P9CA 3JQJA 3NGKA 1RXOB 5KG2A 2UXCJ 4EWTA 2CPFA 5KFMA 3FCHA 4DV5F 4ERDA 1DQ9A 3DDNA 4OX9J 1KFDA 3IAS9 1UEVA 4EYIB 3DRYA 4LSLB 2UV8A 3AY0A 3PFOA 5CYMB 4LIRA 4USMA 2CQCA 3R2DJ 1SB6A 1RAHB 1FKAF 3J81Y 2VB6A 1N8RT 2NZ4A 3NS7B 1Q78A 3O8WA 4JI5J 3QJLA 1KTQA 2D69A 4C97A 5GAHI 2A3JA 3ICLA 1S6PA 1RADB 5ETVA 4DUZF 2QMUB 4DL7A 4KYZA 1NKEA 4ZMMA 3D5MA 3BJYA 3H98A 2LQ5A 1NK4A 1T05B 4X4QA 1OQ3A 3BB5A 3DHXA 4JV0A 1NLKL 1NKBA 4DQSA 4W90B 4DN0A 4NLVA 2JFDA 3LWMA 4A8MP 3IP0A 4I2QB 1WF1A 2BE2B 3ZC4A 3I4HX 5IC4B 1K1QA 5BYRA 1UVNA 1VISA 2BKPA 1C0TB 3GYGA 4NLOA 5E3QA 2IM1A 3SSSA 1NJIT 4CIOA 4FXDA 1FD2A 4N7TA 4MIAA 5HROA 2E9ZA 3Q0AA 1AZSA 1WHYA 1WC1A 3CE8A 4XPCA 1XR6A 1N33F 4U8YA 2CQBA 2RE1A 4IG3A 4DMZA 3G4SS 4YHHF 3DOMA 3OL9A 4CH1A 1TAUA 1EAYC 2FHKA 4I1TA 5KFSA 3V6KA 2M0GB 4L75A 2VBZA 3S1TA 1KRPA 2M5YA 2W7AA 1U1PA 2BXJA 2D3OR 3PX4A 2QA1A 1LWFA 3OR1B 4KHPF 2CYYA 2PDAA 2ZC4A 2ZH6A 4P2FA 3JSMA 2OH2A 5KT4A 2C42A 3C66A 2HKEA 2YWEA 5KTQA 5AXNA 4DFKA 3LUYA 2ZM6J 4DSEA 2VH7A 1TKZB 1ZPWX 5AXKA 4NXMF 3RBEA 1UCNA 1ROFA 1R0CB 1S6QA 1VQPS 1QAJA 2ZH3A 1LV5A 1FJGF 1MWQA 2ZWOA 4QCLA 1IQZA 1JMTA 4X4TA 2MLZA 4DPXA 1OY6A 3DLGA 2R7WA 2DHGA 2EFNA 2W7PA 4Q8EA 1SC4B 4ECUA 2VKZG 1PKUA 3GP9A 4JI6F 2J8AA 2B9XA 4R0EA 1BD6A 2ILZA 3Q23A 3M8WA 3RBDA 1N5VA 3J80U 3L4BC 2MTLA 3PJ9A 2HFSA 2HNZA 4B17A 3QFHA 1YJUA 4HDGA 4DV1F 4NLSA 3DMJA 3KJQB 4PZVA 4TKTA 4OZ5A 2BRKA 3D4JA 2WBMA 2IBOA 5KFZA 2WW8A 4F2RA 1U2FA 1OWXA 3LGHA 5IZHA 2IRYA 5FD1A 2V63A 5ETOA 5EWGA 2RRAA 1NRKA 3HX9A 4C98A 1M5HA 2HHWA 3DOKA 3GFYA 1B99A 4A8QA 4JI7F 2K8GA 4OI4A 4CO3A 3T1HF 4ZKAA 1A7GE 3A8JA 3FK4A 4W92B 4B9VA 2OPQB 5I3QA 3OTOF 3D67A 1U6FA 3BKFA 3K89A 2HGLA 3ET6B 2H4WB 1AB8A 2QA2A 3FNNA 3MECB 3BGFA 2E5GA 4KPCA 3CCVS 4EU0A 2C3OA 1URRA 2J9EA 4QYRA 2HPUA 2MY7A 4Y3CA 1TKTB 3KLHA 2M8DB 3MCOA 1HWUA 1WNEA 1B0PA 2P8IA 2HBZB 4JI1J 1RTDB 1UVLA 4BWJA 1AFIA 2HNYB 3I56S 1HQUA 1TKXB 5U47A 2UU9J 4E0DA 4RW7B 4A48A 4LFCJ 1TK8A 1KD1T 2YNGB 4FP9A 1NMEB 3FFIB 2DCLA 1U47A 2VZ9A 3FCWA 3HKWA 3VGTA 1W7WA 2H3EB 2ZUGA 3MTKA 2R9LA 5F3ZA 2VD3A 5B0AA 4CM2A 4C0BA 2R3VA 3PEHA 5LMUF 5DLFA 1QVFR 4RBVA 3O1LA 4EYHB 4DQIA 3DOLA 2EW9A 5LJ5Y 3UNYA 3VR1A 3O2IA 1PJ5A 2FLLA 4HHUA 5E41A 2JL9A 5CCLA 1MWZA 2HNDA 1S9GB 5B0DA 1G6BA 1VQ4S 3R7SB 2ZH7A 4BC9A 2GJFA 5D15A 3POTA 5A8WB 3W2WB 1X0FA 2E1AA 3N0VA 1C1BA 1GT8A 4QU6A 4F0MA 2CQDA 4EGLA 4HTJA 2AQ4A 3D1OA 3HZEA 3ET6A 2EWHA 3OSNA 1UVMA 2PN6A 4MFBB 2OD6A 3NS6A 4DU8A 3PV8A 1NCLA 3WZ0A 3FCVA 3R3TA 4I6WA 4X65J 1FK9B 4G1PA 3GIIA 1U09A 4DQPA 2PC6A 2L9NA 3CD5A 4AYBD 2AW0A 4C7QA 2HQFA 2V50A 3MM7B 4OZNA 4ES3A 4DL2A 4R25A 1ZAVA 3QGHA 3G6YA 4DV7J 1NH7A 3SCKE 2FZKB 2GJIA 3BN4A 2JJ4D 3TP2A 1K0VA 2GMJA 3SCIE 2CQPA 4HT7A 2JEFA 2B3TB 2XB2D 1ZTTA 3SFGA 3Q2TC 3AJ1A 1HNVB 1YI2S 1WKLA 4OLPA 4HR2A 3OUYB 3H5XA 2Q6BA 5E3RA 4M1KA 1VBXA 1LOUA 1RACB 4LRBA 1NZAA 1SIZA 1TL1B 3MEGA 2RS8A 4DR4F 1LFWA 2PEBA 3M32A 4FZVA 1WEZA 1MU2A 1YRXA 3CJKB 4QBUA 5LOQA 2R7SA 2ZJRQ 4B3OA 4X66J 3CEDA 3DOLB 2O1PA 2ILYA 4J37A 3RR7A 1G1XA 2B5JB 2DVIA 7FDRA 3GG1A 5FJ4A 2AJ1A 2RU9A 4M5KA 4KV8B 4ZDNA 2FVQA 4LBIA 2QFJA 2NREA 2G0CA 1DHMA 4G1IA 2Q66A 2BJ3A 1VRQC 3Q8UA 5AXLA 1R89A 4NLWA 4J7CA 1QAYA 1FERA 4PWDB 2AX0A 3FMWA 2G13A 3M6UA 3OPKA 4G1QA 1N32F 3TOQA 5K8NA 1MG7A 3NOGA 4USTA 5HQ8A 2VPXB 4L76A 1QSSA 2VONA 3BEGB 2O67A 2Y8YA 5IS2A 4TN2A 2F9DA 5CD4H 3G71S 2G0JA 3KOAA 2DGQA 4NMXA 2HBRB 1JLAA 1GXTA 3ZZUA 1VLYA 1RHUB 3CJ4A 4KR0B 2FVPA 4FN5A 1N34J 1K73T 2E66A 3X1LB 4Q44A 1H2VZ 2NPIA 4IFVA 3H59A 5T7LA 5GAEU 1UA1A 2IBKA 4FBUA 2UXBJ 4N8OA 3DRRB 4MKAA 1S6PB 1VQ6S 4F0HA 3H42A 1N88A 3BR8A 4LR8A 1Q53A 1NUEA 2HW3A 4OYPA 4ZPVR 2ERRA 3DDIA 3T1YF 2KRRA 3FBEA 1IWAA 3KFWX 2I6WA 4NLTA 2V67A 2GZOA 4DHVA 5F8IA 1O51A 1NZ8A 2RILA 1FVSA 4IO9Q 2GAHC 2A10A 2HQDA 2ZVIA 1JLFB 5A6WA 4P75A 3UWTA 3CDAA 3Q86A 5K9FA 4AQYF 3J7YI 1IBMF 5CYQB 1V5IB 3IRXB 4ID8A 3B78A 4K5RA 2A2DA 4NZ7A 4OZ3A 1R6YA 4OYWA 3SMZA 3OL8A 1FX2A 5ETTA 3EYZA 4ALZA 3JXOA 4ED0A 1SCJB 2H65B 1XNRJ 2HAFA 3UD5A 2AJ4A 4IG0B 1LFPA 5A8RB 3IAM9 1NB2A 3AODA 5I42A 4NLRA 2RT3A 4IH5A 4I6AA 4QIFA 5JUMA 1CJKA 2VG5A 3JTOA 3GMGA 4KKOA 1VC5A 2R2SA 2EFOA 2CQGA 3PACA 4F4KA 4WP8A 1MNEA 2J7UA 4EO6A 2EI5A 2WONB 4O3SA 3HI9A 1V3ZA 1YJRA 2MDAA 2RH3A 2V8HA 1U4BA 2VL1A 2IJNA 3CIZA 1BGXT 2B43A 4KHMA 4NMLA 4ZCIA 5KG3A 4JI3J 5EGYA 2MKHA 4I7FA 2RQKA 4PXDA 3JB9k 3LGMA 3PXGa 4QWAA 1LWFB 4I67A 2DYAA 1TL5A 1CC8A 3D54A 2NQPA 2OI2A 5GAGU 5KT7A 5J2PA 1OSDA 2R8JA 1X31C 4URGA 3GPAA 1C4AA 5HATA 2VQFJ 3MAAB 1HNIB 2GQCA 4Y65A 2IRXA 2EKNA 4OMFG 4ZVPB 2VICA 1RT4B 1PYOB 2KT5A 4DR6J 2I9SA 4B08A 2BM0A 3VQTA 2UUBJ 3JYTB 4DR5J 4W4MA 1IKXA 5B0BA 2ZE2A 3RR8A 4ED3A 4L72B 1JLEA 2XSFA 1U0HA 4A8KA 2W2QP 1FXLA 2BJ1A 4LVOP 3I55S 1TV6A 3GCXP 3SXLA 3IRXA 4PG4A 2RF2A 4LF4F 2IY5B 1HYSB 2XMWA 1UJ5A 4A8OA 1SL0A 4X4UA 4OHZA 3GYNA 5KFNA 4XK8C 4M94A 1DARA 1PIEA 3KLIA 4I2PA 2DR8A 3ZXWA 2OUGA 1ZM4A 3KLFA 4J5OA 4DV0J 4NCGA 1Z4UA 3CMAS 5KFLA 3EPIA 4ES2A 2VUGA 3G6ES 3HMJG 2QG9B 2KB2A 1R8CA 4OFZA 1ELOA 2XSJA 4IQXA 2WOMB 1RHJB 4DL0C 5KFDA 2PD1A 1C1CA 3Q8YA 2W9BB 5F9NA 3QJPA 2C3MA 1HWLA 2QLXA 3NCQA 4RX6A 1Z2ZA 1S7IA 1VFJA 2MJUA 4KE5A 2J0XA 3PW7A 2VOPA 3CC2S 2CZ9A 1S12A 2M3DA 4N41A 4G65A 3GFZA 4LRAA 4RR5A 3H40A 4AD6A 3PIOQ 3SQGB 1M1KT 2CQHA 4D3HA 4CYUA 4RUAA 3OW2R 3MOZA 5KG4A 4MT1A 4FVCA 2JEJA 4JV5F 2E1MC 2MSSA 4N8NA 2PT0A 4DPTA 5F8GA 4B3TJ 2DH7A 2LEAA 4P71A 2KKHA 1EB0A 2OPSB 4BLGA 2HGMA 2VF3A 1FJ7A 2E9RX 4DV6F 3R7NB 2D3O1 1NHUA 3FGVA 3W9JA 2G2ZA 3GE9A 3V5RA 3D9BA 3R2CJ 4K4ZA 4AT1B 5K20B 2M4MA 3GTYX 1RWKB 2B4VA 1BQMA 1DQAA 2VFSA 4RLEA 1VK8A 4M5DA 3M8YA 5E2QA 1VHIA 3DKDA 4OV6A 4DWIA 5D3GB 4WIQA 3EMTA 2HS3A 4RWXA 2XQCA 3NRBA 1RDRA 4NZ0A 2PMHA 5HMZA 4GC7A 1RKJA 2CVIA 4C8OA 1FFSB 5F0WA 1HNWJ 5H9FK 3RUBL 2ZKTA 3TUIC 1X9SA 3HLUA 3VVTA 1IKVA 2IJRA 2XC9A 1KBRA 2BE9B 4OYBA 3MR5A 4RW9A 1U45A 1NK9A 3M9MB 1BXNA 3U1MA 1VRTB 2CJBA 2EPIA 2LDIA 3TVKA 3WC0A 5BR8J 4DL6A 2KO1A 2JOQA 2RHQB 4O4RA 4P2XA 4FXVA 3C2PA 5F8JA 1S48A 2FLOA 2BRLA 2WK4A 4A4JA 3T5KA 1B0TA 3FBCA 2NXEA 2BUNA 6AT1B 2HBYB 1IBKJ 4DSIA 2GGPB 3AXMA 4XDCA 1T7PA 1RWPB 1SQEA 1S0OA 1U8SA 3NAHA 3OJSA 1JK9B 1WOOA 3J7A1 1SJRA 1WACA 3VAIA 3MM9A 3WDOA 4LSNA 4OYZA 5C25A 2E5HA 4IOBA 2XY7A 4PUOB 4P73A 1JQGA 1UWBB 2CA9A 4K0KF 1U24A 2DK2A 1E6VB 3AOAA 1IKVB 3TANA 4RNOA 4MKYA 1AFJA 3E51A 2B7BB 2XS5A 2BA9A 1VC0A 3A4TA 3KLGB 4C8KA 2QRRA 1XN9A 2IVMA 3PYGA 3EXCX 4X84A 2V5HG 2LXUA 4XO0A 4ZVFA 3J81j 4C6AA 2YNHA 5C42B 2AIRB 2DGOA 1Q8LA 2JLEA 3MI7X 4QW9A 3MR3A 2QTWA 1FKPA 2D74B 4CRJA 1EZZB 5CHCB 3VVUA 3WX8A 5DDPC 1GTEA 3T9NA 3J7Z5 2FUG9 4DR4J 5RUBA 3PZPA 3TO8A 1PJ7A 2DH9A 2J0SD 3VGSA 5MLCV 2BJ9A 3QGPA 4U7UK 1VI7A 3KHLA 3MR7A 3ITHB 3QWPA 2ZH1A 1J5EF 3KG1A 3NMAA 3JQKA 1OYEA 1TP7A 1MN9A 1WHVA 5DG9A 1VQLS 5L8RC 5KFTA 2XEXA 3M32B 2ZKUA 3UCGA 5EN1A 3G2XA 2R8KA 1FRIA 5G0RA 4RPFA 5KFHA 4PXEA 1SJ4P 4HH1A 2W01A 4WYWA 3TR5A 4ECYA 4MAKA 1NM2A 2FYXA 2XY6A 5CAAA 3MM6A 3BBBA 2LCWA 2VFRA 2X1BA 2IYIA 3IR6B 3PYFA 3TZWA 3HDSA 2J6SA 3H5UA 3OR2A 4YY3J 2YWWA 2HQIA 2ZBQA 1ZZFA 3A3PB 1X4EA 3IA0A 3QLHB 4H4MB 2W2MP 2DIUA 4LQ9A 4IDKB 3MMAA 3KNGA 4WE1B 1U1KA 2HBQB 2N82B 1JLQB 1RTJA 1CC7A 3KWMA 5E0OA 4HHHA 1HBMA 4V19X 2NZCA 4NA1A 1UAWA 4Z7CA 2DCUB 1V6HA 2CQ3A 5D4LA 1VQSA 4DCOB 2JC1A 4U7CA 1NK0A 3N79A 2BDPA 1AYEA 5KOWA 2ZBRA 1S6UA 4DSKA 1FESA 1X7VA 4TYAA 1T0TV 2XHCA 5C7PA 1SPBP 2GVZA 2M9KA 2B7CB 1D0EA 5J1PA 3HM9A 2I5JB 1D9FA 2GO8A 3KG0A 4X64J 1FKOB 3BS9A 5D0EA 3CD6S 2DRDA 3V6DB 2MLXA 5GAEI 4LF8F 5CYQA 3W5XA 1A9NB 1G3OA 1J5OB 1HBOA 5DETA 1X5SA 1F5CA 3HCXA 3WHIA 2H5JB 4X4VA 1FWPA 2VDIA 2Y1LB 3QIDA 1Q5VA 4KH1B 4PXBA 4HI2A 2ZHAA 1FVQA 2ZHOA 2QLWA 1KVJA 2OELA 3I0SA 1KQSR 4E98A 3HPOA 1TUGB 1X4FA 2Z2ZA 4FDFA 2MZJA 4Q2LA 5AXMA 3W62A 3EVOA 3I6PA 3LQVA 4LF5J 4H4KA 3US5A 4DBQA 2MQLA 2XHWA 2FDNA 4DR3F 1RB0A 5BYSA 1HL6A 3SEOA 4J9PA 4K2XA 3BPDA 2JVRA 3G9CA 4C8ZA 2IM0A 3N5BA 1NXIA 1T9TA 4PR6A 2GIRA 2ASLA 2WVCA 3WX4A 4ATNA 2XMKA 2HHTA 1M1HA 2DR7A 1AW0A 1IKYB 1C4CA 1WTFA 5E5NA 1X0PA 4RW6A 3MEDA 3PYEA 4NYOA 2V4QA 1B0VA 3DI6A 1NB7A 4DQQA 1M90T 2EBEA 3ZTRA 3HVRA 2W4CA 3T1AA 1HQEA 2WTFA 4QPXA 5KT6A 1RAEB 4DR7J 2HMIA 2LEBA 3I9ZA 3VF0B 5F41A 2C2EA 2NR0A 4LFBJ 1AUSL 2L9DA 4FPRA 4TYBA 1XJWB 2VBWA 3MR2A 2ZH8A 3FBBA 3CCLS 2XNQA 2YH1A 2V8GA 1VBZA 1HNXJ 4JYAF 1G4CA 4WFYA 2KVIA 2BJ7A 4ZP6A 5GAGI 4FF1A 1HW9A 1RWMB 2VFVA 4LF6J 4O3PA 1W25A 3H0PA 3LP1B 4Y2IA 5LM7E 2HZVA 2Q43A 3GV7B 1FO1A 2R4FA 4F25A 5MAOA 4CO5A 1WC0A 1Q16B 2CJQA 1F2GA 3F41A 3KTQA 3P5TL 3MMJA 2D1CA 2Z8QA 2ZC3A 1CSJA 3AB4B 3O5TB 1LKZA 4OJ1A 3SSRA 4CO4A 4FS2A 2HVDA 4J9VA 1SVDA 2DRAA 1XMQF 2MZSA 2BW2A 1NAQA 1U1OA 1OQ6A 4OX9F 2A2CA 2X1GA 4ENOA 5DQGA 2VHGA 2QL7B 4U96A 1F2HA 1JJ2R 4F02A 5A0YA 4DU7A 2FVCA 2B8PA 3HO1A 2B8QA 2XSJB 1GFWB 2QA4G 3OLAA 2RS2A 1RU1A 4P9SA 3WC2A 4MK7A 4Q0BA 1WDTA 1JXLA 4UQGA 1W2BR 2RRNA 1RBLA 2ZBIA 4JI5F 1QD1A 1RHRB 4CM0A 5HMWA 4DUZJ 3DU5A 4TLRA 1HHQA 1EKSA 2IMOA 2X3GA 4DX6A 3OXGA 4DV2J 2JEGA 1JJHA 2EC0A 1UKUA 1S1WB 2E5JA 5M2RA 2YWFA 1HLWA 2RF2B 4DCPB 3W61A 4K4UA 3JSMB 2E1PA 1R0BG 2YQ1A 2GFFA 1PSDA 3MEEB 3BR9A 3CTRA 4DS5A 1XWLA 3NG8A 5B0FA 1S9FA 3QT7A 5HI7A 3NWGA 1FFWB 4WPAA 4NLYA 2D41A 2N4CA 5G0RB 1AA1B 2BQ3A 1GTHA 4ECVA 3CCUS 3AA9A 4ZVRB 3HK2A 2BABA 2CDQA 4OI1A 4TU9A 3UDEA 2D9OA 1U1QA 1C0UA 4M5JA 5T14A 2C22A 3T5HA 2HZAA 5F8MA 2HRTA 2LA6A 4FNIA 2AJ2A 3CJKA 1OY9A 4MYUA 1TVRA 4KFBA 3EGZA 3MM8A 1KLMA 1N33J 2CJXB 2ROGA 1F60B 2KL8A 2HRUA 2FC9A 3IBCB 4P7VA 4UOFA 2H1YA 3ILLA 3C6UB 3OXFA 3ZNUA 3V4IA 4ELUA 5JVGQ 2XO7A 2X1FA 4HHJA 2W2PP 3P6YC 1MSWD 3SDEB 2DNRA 1MMDA 5CA5A 3TJ8A 1IVZA 1HBUA 2MQOA 1N54B 1NJZA 4KHPJ 2AYEA 1GAOA 3TUZC 4NA3A 5DQIA 3TRGA 1VQKS 4DCJB 1R8HA 2DNQA 2GCFA 3TJ9A 2LVWA 4RUBA 4ED1A 1SJ3P 1ZTWA 3CD0A 3LH2S 4UUXA 3VQSA 4ZVSB 3W65A 2ZM6F 3V2UC 3D1QA 3IGVA 1N5YA 2HFZA 4PUOA 4NXMJ 1JLBB 1RAOA 4IKAA 3PX6A 1S0NA 5I3UB 1VLOA 5ETKA 3CDUA 3NLCA 4RW4B 3UNGC 1FJGJ 3RW6A 2OO4A 2DR6A 3PX0A 1DURA 1CJTB 1HHTP 1UW4A 5GMKa 5K14B 1VQ7S 3O3LA 3D66A 1QUVA 1Y7PA 3CJRA 3TEHB 5A8KA 2QSFA 4UOGA 3HD1A 4JI6J 3VAKA 2M70A 4Z2XA 1RCXB 2ZZMA 2VJVA 1S79A 4ZHRB 5HP1A 4GKKF 1T9VA 2OAUA 4EBCA 2C2KB 2DHAA 3DLKB 5D6GA 1H7WA 2DRBA 2UP1A 4DV1J 4IR1A 5IV3A 1TL3A 3HSZA 4KHRA 5KFWA 4F2SA 2IIHA 2FB0A 2K1RA 3MPYA 5HMYA 2NUUG 1P1TA 4CLTA 1EETB 1LWEA 3H4BA 1TAQA 1WDDA 3CSKA 5T7LB 3K57A 2R8GA 4PKDB 2W1BA 4DXLA 2IMWP 3UDCA 1HQEB 1CJTA 3QAUA 3ENQA 4H4MA 4OI6A 3UFCX 1RKIA 3GJQB 3UQSA 3QBCA 4QU7A 1AT1B 2MZRA 2ZDPA 2M52A 2WAQD 3GB0A 4IR9A 1UVKA 2FZCB 2CIMA 2CPIA 2FHOB 3EXYA 3MWBA 2QL5B 3AA8A 3R5JB 1DQ8A 3VAFA 3DHWC 3VALA 4WJBA 4RNMA 1PAEX 2YNGA 3OHAA 3LPYA 1UJ4A 1RAGB 4GRSA 4WTYA 4NRTA 4WZQA 1CQNA 3HHLA 4P7TA 2RDJA 2CQIA 3ZZRA 4JI1F 4O4GB 3H2UB 3GZ7A 4HACA 1V3SA 2ALZA 2OFHX 2OEMA 2ZBCA 3WBZA 4ILLA 1S1UB 2DB1A 2KHCA 3KUEA 2A0FB 2O66A 4RW7A 1QE1B 5KFIA 4Q43A 3T5LA 4LFCF 3PO4A 1CULA 1FD8A 2MMYA 1OIAA 2J0QD 3DM2A 1RUSA 3G6VA 3EPGA 1PGZA 2XNRA 1S77D 4OV1A 4J9KA 4LSZB 2C2MB 4NA2A 2QV6A 3LAKA 3N9UC 3F56A 1C1CB 5KFYA 9ATCB 3KNAA 2QMXA 4OIXA 4J9RA 2DPJA 4AE5A 5LMUJ 2JRSA 1OYDA 1K8AT 3GONA 3MCMA 4X4SA 2YKNB 4F67A 2AX1A 3M4XA 1PBUA 4ECRA 5DM7Q 2LMIA 4NL5A 3UI3A 1EARA 1Q95G 1MW7A 1NPPA 3MD3A 1RU2A 3NCRA 3RRKA 4EMDA 2W9CB 4HKQA 2HHQA 2KVQE 1S72S 2YNFB 5KFVA 3L3CA 4PG8A 1JKHB 3GG0A 1RHQB 1RBOB 4HI1A 1K1SA 3P96A 1RGVA 2RAQA 2ACYA 2Z57B 3N4WA 2F8MA 2Z58B 4NYZA 1FTRA 3QT6A 3MPUB 2IAJB 1KKHA 3QATA 4UOHA 4E2FB 1Y00A 3HKZD 4KO0A 2X1AA 1P8GA 3QLHA 3BM7A 3D0GE 4GMKA 2MKKA 3VAJA 1T05A 1UZHA 4X65F 2OHDA 4YR2A 4ECZA 1FK9A 2NPFA 2ZOGA 4ZPCA 2WSFC 1K44A 4CLPA 3QT8A 4Y34A 2BJEA 5KFGA 3R8YA 2R7XA 3HVAA 4LSLA 5KFUA 2POKA 3QSIA 4X4PA 3OVSA 1N36F 3H2VE 4Y28C 3ZZ0A 4DV7F 1VIOA 3PCOB 4MIWA 4DX5A 2YKMB 1D8YA 2WVFA 3DFEA 1HI0P 4DV3F 3IFEA 4MIBA 4F8RA 4S0MA 4RBTA 1WOSA 2YNFA 4Y2MA 1Q82T 2COLA 2L9WA 3MZIA 3K5MA 3KJFB 4UF4A 5A2QU 3KHRA 4X4OA 3OD2A 4IFYA 2DHHA 4DG1A 4USWA 2GAGC 4Z37A 4QIVA 3T41A 4YP3A 1VCTA 1S5ZA 2PFDA 4ZOSA 1SJFA 1Q81T 3PRDA 1SH2A 4ZPWR 4JUZA 3DLLQ 4IRCA 4FXWA 2ZH9A 3RB6A 5E3PA 2ZE2B 4EI2A 1QSYA 2DNMA 1X4CA 2XYHB 3M1VB 8RUCA 2G1DA 1NJYA 1OO0B 2QFIA 4BWMA 3N6MA 3GIMA 3DLEB 4OX7A 2DGUA 4KGVB 2IA0A 1KHWA 2AT1B 2VBYA 1KR4A 4NLQA 3GR1A 2FY8A 3K2YA 3W9IA 1ULRA 1X5PA 1AUDA 4NLXA 2CJAA 2YPZA 4FYVB 1JXEA 3UPFA 2FJXA 3K5LA 3LPEA 1N32J 3CC4S 1S49A 1FE0A 1FEEA 1UL3A 3IXQA 1GX5A 2UVUA 5K8PA 3K59A 4U6PA 2YX1A 4C8YA 4MTPA 3TA1A 3D28A 1BQXA 1RT3A 2HSEB 4TY9A 4CLWA 4F4XA 2YNHB 5C42A 4K5SA 2EFGA 3FMBA 2MY8A 3FZ2A 3G82A 2DR5A 3OJUA 1FI4A 2E44A 3HF5A 1EJ7L 1WI8A 4R0JA 1RWUA 4TQSA 1N34F 2DNYA 2E1RA 1XMBA 2R2UA 2FJWA 2IVFB 4DR2J 1HD1A 2N7YA 5L46A 3U02A 3HHNB 1EKRA 2A6MA 4NWBA 4URQU 4NXNF 5AE1A 5EDWA 1ZZNA 1X5OA 4OQJA 1UVJA 1E6YA 2HGNA 3CWJA 4O23A 2JEIA 2V2VA 4USKA 1S1VB 3TUPA 3T1YJ 1IM6A 3AD9C 4K4YA 2XGPA 5M2PA 1VRTA 1JLQA 1RTJB 2ZDOA 4PG6A 5CH7B 4DI6A 5JVHQ 2M2BA 4KGMA 5DG8A 2BOAA 4DL3A 5HANA 1TU0B 2F8EX 2EEYA 4F7VA 5C24B 4AQYJ 3B4DA 1KS2A 3BDEA 1U48A 3U27A 2GMLA 5IQ6A 2UXDJ 2J7WA 1YJ9S 1L3KA 1S57A 3D0HE 3IGNA 3F0NA 4KH0B 2NXUA 3MTJA 5F3TA 1H0HB 1RK8A 5L9XA 4DR1J 1IKXB 3LOUA 1JJ4A 1S4EA 5LMNJ 3TAPA 2KM8B 4JV1A 4IUFA 3V81B 3JS9A 1I6JA 3LANA 4LRFA 1KHVA 2BQRA 3G86A 3HHDA 3CCRS 1N0VC 3AQPA 2F4FA 3K5PA 5J1EB 3QRRA 1ZAXA 1PYSB 4JI3F 1X4DA 2HNYA 4WTOB 4ID5A 2Z2LA 2W7OA 2JFKA 2GIQA 3CC7S 1FTCA 5C24A 4JI2F 3OFHA 3LTOA 3M8QA 3MM8B 1ZBTA 5GVQA 1BWEA 1LW2B 2YPYA 2ZOMA 4HVZA 2ZFHA 2FZGB 1I3OB 1Q5YA 1RTIB 2YWKA 3B8HA 2HVZA 3MECA 1N5TA 3DRXA 3NP5A 4IQMA 5KFOA 2E7XA 3PR4A 3I5BA 5KFXA 2VQFF 3SZ2A 2HHHJ 4ZVQB 2VPWB 1RT5A 2HIYA 2OPQA 3VTIA 4A8YA 3EDQB 3R5GA 1WWHA 4DR6F 1UPPA 4MKBA 1KEKA 2KH9A 4K8RA 1LWCA 1YZ7A 3D3BJ 2UUBF 3C8YA 2BOPA 4C8LA 4OZJA 4DF8A 2VQEJ 3M8PA 2F4VF 4PABA 1RP5A 4NCGB 4BDPA 1LXJA 1LWEB 3EICA 2F3JA 2QLBB 2QYCA 3C19A 2W4DA 5CD4A 2VU5A 1U1LA 4M95A 4LF4J 3X3UA 2K3IA 3CDWA 4YEAA 4CWBA 4O44A 3GLJA 2DO0A 1FX4A 3POTB 5A8WA 2OSRA 4KAIA 2HWHA 4OZ1A 1FDDA 4O3QA 2KG0A 3KLIB 4I2PB 2AGPA 2C3UA 3DYAB 3J7ZT 1OPZA 2DXFA 1JLCA 4R5PA 4J9SA 4DPWA 2OTLS 5KFRA 1QUPA 5J2MA 2CPXA 2P6SA 1JNZB 3GYXB 3BO2A 1JX4A 3PG9A 2NLWA 1ZA2B 4C11B 3MM7A 3GSDA 2K06A 1GNKA 3VZIA 5H1SV 1IN0A 1D8ZA 4NOHA 2VV5A 5C5JA 1X4GA 3QO9A 3GIJA 2NSCA 5J2QB 5HLFA 1RTHA 1XK8A 4OX6A 4NASA 2OIHA 1P27B 3W2VB 2CWXA 4GKJF 4FYYB 3IMQJ 1N5QA 3EGNA 1IKWA 4RJVA 4J9LA 1CS4A 1YWXA 2ZJPQ 4F4WA 1UA0A 2JLFA 3CJ5A 2QGFB 3MURP 4YDDB 1IR0A 4N76A 5CZVA 1NO8A 4A8FA 1OS5A 2GNKA 4QR1A 5B0GA 5CYMA 2EK1A 3R1HA 3D0IE 3I96A 4B3TF 2C2DA 4EZ9A 3MMBB 2CQ1A 4NI2B 3SV3A 2HYIB 3I32A 2WW4A 1YRUA 1U0SA 2NXCA 4PXCA 1MROB 4CT9A 3KJVB 1REVB 1SC3B 2P5VA 3MUVP 1GMUA 4RW9B 3E01A 4KV8A 1KP6A 3PFEA 2OGUA 1VQ8S 4EEYA 3M2VB 4KBIA 3SI8A 1L5UA 7AT1B 5FLXU 2IYGA 2JNJA 2X3DA 2GHVC 2EFQA 2LEPA 3C14A 2OFGX 5E7OB 2J9DE 1F1BB 1RWWB 3FVYA 3ZTQA 3GV8B 4DS4A 2M7SA 3TARA 1IKWB 1RHKB 1Z2LA 2HAIA 1Y4ZB 1RT6B 1Y3KA 3A3NB 4KO0B 4U9RA 1JLCB 4LJMA 4B3MJ 3SCJE 1TL4A 3CVKA 1HNWF 3KUHA 4CLFA 2FHJD 4Y0FA 3M8SA 2BANB 1R6VA 2PSZA 1VK3A 1Y5IB 1SC6A 2FIUA 2N3LA 3QPIA 2Q3PA 5D78A 2R42A 3CCMS 4B9SA 1A6LA 3I0RA 2BMBA 1B3TA 5HJXA 3QSYB 4HL9A 4NEZA 3I9V9 2DEJA 1VIXA 2IAJA 1TQLA 3KUGA 4J9NA 2KDOA 3AD7C 1WC3A 4X4RA 1Y11A 2KZZA 1F9FA 2FJAB 2CZVC 2DJWA 3FJ2A 2MQPA 3DRRA 2CXEA 1E6VA 3WIUA 3Q24A 1IBKF 1BMQB 2GGPA 3TA2A 1RWOB 4IFVB 1IJFB 2W9CA 4CO1A 2DY9A 1CVJA 4DJBA 2E29A 3I4PA 1F9EB 1GMWA 2FLPA 1I5OB 3FEZA 3PHTA 4NEYA 2GW8A 3VCDA 5C2CA 4P74A 2KXFA 4K0KJ 4PG5A 2AEJA 2RHSB 3HVTB 3M6XA 1Q1KA 4EK2A 1T8EA 5F8NA 2FGCA 3NGTA 4Z7YA 3QIPB 4LQ3A 1WC5A 2V2QA 1LW0B 3A8EA 4KQZA 3TAQA 1WC4A 2NCKL 2RDDA 1DTQA 3KXDA 3M05A 4C3LA 5KOXA 5I4MA 3RB3A 1GXUA 3BH6B 3D1HA 1ZS6A 3WIVA 5EWEA 3MEKA 4DX7A 1BLUA 3R27A 2QSWA 2XMJA 1RSCA 4FKYA 4F36A 4Q5VA 4FNHA 4JI4F 1UVIA 1W26A 3A3OB 1VR6A 2V69A 2XULA 2DGTA 3DLJA 3RYLA 3UDVA 1WTBA 2GHWA 3FSXA 3M1VA 2ASJA 2J6UA 4ID5B 3NKYA 4FKXA 5IV4A 2ZVSA 1FJCA 3DLEA 3CMQA 5DGBA 4DZ6A 3K58A 3BQ2A 2DIVA 4WFBQ 1RTIA 4MK9A 2WVDA 2N7CA 5CQGA 2D9PA 4DG1B 4NLGA 5HBMB 2YVSA 3OR2B 3W5YA 1U49A 1YK9A 3BKTA 4ZP8A 5C2GA 3CNQP 4NYPA 3DLHA 1LEOA 1CJKB 3SCLE 4P10A 4FYDA 3HZGA 1WORA 4LRDA 5I42B 2NXJA 5E3CA 4ZVGA 5L39A 3OV7A 3J7AN 3JSBA 4ZHRA 1Q7LB 1X60A 1YX2A 3GWCA 4HLBA 4JOUA 4KKOB 4CLYA 2DH8A 3QRQA 3P5BP 1WEYA 4OX8A 3ZZTA 3IWXA 4KGKA 2DR9A 1RLCL 2NXNA 3CJ3A 1FRJA 4I7FB 2J0WA 1Q7YT 1SQGA 2HG4A 2XZTB 2YNIB 1RHMB 4I68A 1RQ0A 3MPWA 3WQPA 5EWFA 1PYTA 3PJXA 5HROB 2SXLA 4DV2F 4UZBA 2HHXA 1Q8BA 1V5VA 3OT9A 4K4WA 1Y5NB 2MKYA 3FSYA 1R27B 5KG6A 4DFJA 2KTQA 2ZNYA 3DRSA 3R5CA 3UN5A 4RW6B 2PA3A 2PA8D 5DS7A 3TW0A 1VQYA 4DUTA 3JAMY 1S1VA 2MKIA 3EZOA 5HJYA 3BO4A 4I2QA 3PO5A 3KK1A 1ACMB 2AF6A 2E7WA 2GJ2A 1IM4A 5HAOA 3ISZA 4QWBA 3SBMA 3BSNA 2E9TA 5D8HB 2R8IA 3VWSA 4ZLLA 3G8SA 4ICLA 5A76A 5DDQC 4LF8J 1FEHA 3ENAA 3MOJB 2Z2MA 4ZP7A 3TEGA 2YKNA 3KHHA 5DM6Q 1RT3B 2ZNZA 2HFOA 3VV2B 2XCPA 4BBYA 1FDBA 4UW2A 1IBLF 1KWMA 1YDLA 2WVEA 3OVBA 3LW5C 1D9AA 2DNZA 2EXUA 3R6LB 2VPZB 1TKZA 4LREA 2RNEA 1FXRA 2WHOA 3QZ7A 2HHPA 1S1XA 2R2RA 4F04B 1RZMA 1OMSA 3DGPA 2DNPA 2OJ3A 1U02A 2F63A 2PEHA 4DR3J 4B9MA 1MLAA 4L3NA 1VS3A 3HT3A 2V34A 1MMLA 2FGOA 4OZ2A 2J8SA 2V6AA 2Y0SD 4WYLA 2CDRB 4B02A 2AP6A 1HBUB 1TKDA 2J7KA 4L3KA 1CQMA 4ZA1A 4BHQA 4QJVA 4YS2A 1IKYA 4I69A 1B7FA 2V9KA 1O8BA 1H2TZ 3J80Y 3KLEA 2PFFB 4QYZJ 4M5DB 2OMOA 4ZJLA 3UVJB 3VZHA 4M5LA 5KFQA 1EP4A 3T6JA 1NKCA 2F5GA 2ASYA 2QN6B 1QTMA 1DTTA 4J9MA 2A6OA 2DBBA 4NCAA 4M63A 1S1XB 2Z0GA 1UW9A 4F4YA 1QSLA 3S6EA 3UD4P 5T41A 2MZTA 4RL1A 3KLVA 1HNXF 4KTQA 4JYAJ 5J2NA 2CKWA 5HQMA 4LF6F 3G96A 1U7LA 3QO9B 4PG7A 3R97A 5A0YB 4YR0A 4JI8J 2AJFE 3TX0A 2ADCA 5HP1B 3L95X 2WVBA 5AJ3F 2CG8A 3H2LA 3RZAA 2W2OP 1VMBA 1MU2B 5J2MB 1HPZA 2WSCC 3HSDA 2V0NA 1VJQA 2VG7A 4JV2A 5DQHA 5IM0A 3TNVA 2ZD1A 1JNRB 3OLBA 3F73A 1O5JA 2C2ZB 2F7VA 2DXDA 2XO6A 4B3RF 4K59A 4ZVTB 2NS1B 2CJKA 3ZNJ1 3PRBA 4YB1P 2K3KA 1VGYA 3R7BB 4IO1A 4ZJOA 4YB6A 3LGNA 1S10A 4K4SA 5B0EA 3TVZA 3ZTPA 1XMQJ 3OTEA 5D4OA 3HP6A 2LQ8A 1JLGB 1FXDA 1D1UA 2LA4A 2XMVA 1PG5B 3CCZA 3KLEB 4DL4A 3G82B 1S76D 3AOBA 1TMJA 2G1HA 2GHPA 4WP3A 3MFHA 4QWEA 2H9ZA 4CTAA 3CJ8A 3C6UA 4UQTA 3TA0A 4O4GA 4YQWA 2DNOA 4F3QA 1XR7A 2B4OA 3NCPA 3DC2A 3ONQA 2P9EA 1S1UA 4ZP9A 1KLMB 2IRUA 1WKKA 4CH7A 4JI0F 1TFYA 4OJ3A 4PWDA 5DDOC 1RWVB 2RJZA 5HL7Q 2NUHA 3H90A 1SI9A 3QAEA 1DLOA 3ITHA 3SDEA 1GXLA 2JX2A 3OXLA 4LFAF 3V6HA 2FY1A 3JYTA 1TMMA 3HHLC 5KFCA 1NK6A 1RTDA 4ED4A 1XQIA 2WBRA 4ZVHA 1HQUB 1NDLA 1TKXA 5FDLA 2AYMA 5IT0A 1PCAA 1F6TA 1NJXA 3MMCA 1YJTA 4TQRA 2BR0A 1UZDA 3GSIA 3FFIA 2CJYB 2OLWA 1T9WA 2ATCB 1T9YA 3NGUA 3OVAA 5IT9Y 1AROP 1YIJS 1HMVB 3GIRA 3OFEA 2U1AA 3VAGA 2MYFA 1KQFB 4EFAC 1TL3B 5LSOA 1QM9A 2LXIA 1OY8A 2GA7A 2PI4A 2J9CA 3M8RA 3DRSB 1JLGA 2K1RB 3VAHA 1RLDA 3AHPA 2IM3A 4CP5A 2K7JA 6FD1A 1X4BA 2HHVA 3CW2C 3GFXA 4DF4A 4GC6A 4URSA 4I4BA 2HEKA 1HNVA 1JIHA 3DLKA 4UOCA 2HS4A 4YB5A 2YBVA 3UCZP 1YTYA 3C15B 3OFGA 2IC3B 5ETLA 1RT2B 1NDCA 1S9EB 1XTZA 1VJWA 2H48B 2K7KA 2UUAJ 3E3XA 2CPZA 2DNHA 3HHEA 3MGJA 4J9QA 4LT6A 4RW4A 3NBPB 1FJEB 2RIJA 4IDKA 4WE1A 1N5SA 4CNZA 2C3YA 3EUNA 1HFEL 4ZN1A 1T03B 1RT5B 2VASA 2AGOA 1GQEA 2DGWA 4TVAB 4GKKJ 3B4MA 2C2OB 3CDBA 1HKAA 2RUGA 4QIEA 1HNZF 2CQ2A 4LF7F 2Z4PA 1OPIA 2NYIA 2QYGA 3RG6A 2AU0A 2R8HA 1T94A 5HVHA 3VHQA 3R5BA 4GVBB 3DLGB 1IUJA 2KXHA 3PDNA 4ANCA 3TAMB 1HW8A 1SL1A 3J81U 4G1QB 1PBAA 1FNMA 1EHWA 2MPUA 3C6TB 3HD2A 2IJFA 4R8UB 1JLAB 2LKZA 2QA4S 1TELA 3Q2SC 3P49B 2RVJA 2HFUA 3A13A 3MUTP 1S0VA 3NMRA 1VBKA 2QC3A 3K8VA 1R3NA 4OHXA 4XDDA 3UVJA 3D2WA 2MKSA 4CLUA 4QYZK 4WKRA 2JC0A 3HHLB 3MEDB 4KGXB 2WZ1A 1IR1A 3KKFA 2HHSA 2MJNA 2HK2A 4OHWA 5JMNA 3AXKA 2VA2A 4GO5X 1WC6A 3FEYB 1TK0A 3HHLD 1DBDA 4ZLJA 2PIIA 3CO9A 1X5TA 4LF1A 1HA1A 5ITHA 2PO4A 3UE2A 4B9UA 5J1NA 2L41A 3M30B 2RUSA 3VAMA 3H8YA 3BDPA 4DFMA 3MDFA 4P72A 2B6AA 1GEHA 1Q8IA 2ZBPA 1SKSA 3HVWA 2KU7A 2LU2A 1YJNS 1U6BA 4Y2AA 4A8XA 2ZH4A 4ER8A 4RNNA 1IWGA 2VG5B 1ZM3A 5J2QA 1PC5A 4WBFA 3TQEA 1VRUB 2CQ0A 5A2QY 1QDUB 1AZSB 1SC1B 2KFNA 2LQJA 3KDNA 3C6TA 4ZITA 2LQBA 3W8PA 5IQQA 5AE2A 2MZQA 4ZVEA 3TAMA 4RU9A 1ICEB 1LQ9A 1SUQB 1WF0A 2AV5A 2FJDB 2IDLA 1KQKA 2ZH5A 4K50A 2FJVA 2O01C 2BW7A 1RT6A 1QVGR 2AMCB 4HT5A 4KY3A 2KN4A 3HFZB 3KK2B 4X62F 3V6JA 2QZ8A 4Y00A 1HARA 2CWKA 4P2MA 1S6OA 2JHEA 5IWAF 4F3MA 2OEKA 2AZ3A 3LAMA 3QMQA 3I0RB 3RAQA 2NSBA 1Q4RA 3ILJA 1VC6A 2UUCJ 3E8OA 3TZZA 1UFWA 1SKRA 3CULA 1YKWA 2Y3YA 1ZPVA 2QX0A 4V19J 3G8QA 1N36J 3ILIA 2XCAA 5LSLA 2QL9B 5B0CA 4PRFA 3OL7A 2BX6A 3QT5A 4C8MA 4CLSA 5CABA 3BQ0A 4DV3J 1LK7A 4USJC 3S7RA 4DUYF 5J2PB 3NNAA 1KN6A 4JB8B 4O3OA 4DPYA 1JJCB 2RDIA 3M8QB 2VOOA 3CT9A 3NL0A 2ZHBA 3JTNA 4A46A 3K0JA 3SYZA 1M5VC 2YXLA 3CF5Q 3T3FA 2H51B 3EZ5A 2BACA 2VG6A 4A8WA 5I3PA 1YJWS 3DI6B 3G87A 1TL7B 2P2CB 1RTHB 2X51A 2AYGA 4IRDA 4UY85 1IJEB 5EX3A 2AZ1A 3IO1A 3HSGA 3IBFB 2V2KA 3U1LA 4PPDA 3D3CJ 1BY9A 4JBCA 4M5HA 2LLZA 4I64A 4UTGA 5B09A 3A1YG 1D3WA 3MM5A 3I5AA 5LJ3Y 1I94J 1P1LA 4O0NA 4F3OA 2UXDF 2VC0A 2OPRA 2DO4A 5D0RA 1B64A 1YLXA 3FBFA 3N6LA 2EC2A 5JJBA 3ADAC 2FLNA 2DEIA 3R5AA 1P9QC 2YKPA 3R9LA 3P8BB 2XLIA 4KJIA 1FRXA 2GO9A 1ZOTA 2HWTA 3HFKA 1D9DA 4FF4A 1XNQJ 1WELA 2BE2A 3C3LA 3EGVA 2DHSA 1NNDA 1U6ZA 2CG4A 3A8IA 2HK3A 3ENVA 1CLFA 4CYUB 4ANEA 4NZ6A 1XIQA 2EK6A 2DGSA 4MJKA 3CJ2A 5LT5A 5GADI 3MFIA 1TK5A 2HVIA 1E6YB 3EVMA 2XYPB 1HWKA 2XLKA 1XR5A 1S4FA 4IH7A 2G4BA 5DO2A 2ZZTA 3IM9A 5K14A 5KFBA 1DRZA 2XTJP 3PKYA 2PMWA 1M5PC 3NAIA 3H7HB 4DR2F 4KPYA 2VFTA 3S8SA 4LUBA 4NXNJ 2RQ4A 1CBKA 2GC8A 1H7XA 1U0HB 3NNHA 5L1KA 1TL7A 3ISND 1M0SA 1WG4A 2HIQA 1HWJA 2VG6B 1T03A 3RGIA 1KOOA 1TR0A 3JTPA 2MB0B 2J6TA 2WCXA 2YWGA 5F0UA 1NHVA 3MUMP 1XMOF 4RZRA 2E5LF 4B9NA 5KG0A 1TFWA 1N52B 2HNDB 3D6HB 4PYDA 2HVEA 2VPYB 5HSPA 1HMVA 2JDJA 1UEUA 2L3MA 1NSQA 1Z1ZA 3NNCA 1QJHA 2OPRB 3D6MB 4DR1F 1NK5A 5LL6d 4M8LA 5LMNF 2W25A 1CG2A 2A1BA 1VYAA 2BBEA 1UWAA 2H5IB 4Q7AA 2AYBA 2UVVA 1RBAA 4DSLA 1FRMA 2QIFA 2MSTA 2FVSA 4DX8H 4YB7A 3SFUA 1SIWB 3HULA 3JSYA 3M2UA 3MPVA 4QQBA 1RWNB 4DV4F 1VQ5S 1RAJA 5KFAA 4ZN3A 1HWIA 3W63A 4FF3A 5HO4A 2E1CA 4QPTA 3EGWB 3LP0B 2VBXA 2B9EA 2RQMA 1TUWA 2KXNB 2V4JA 5IXUA 3QZ8A 1FNXH 4JI2J 2P6TA 1H74A 3L7OA 2JVOA 3RJMB 3GILA 1X9MA 1G7CB 2UVRA 4H4OB 4C8NA 3RRHA 3BH7B 4I56A 3UD3P 3IWNC 1FHTA 3UN2A 1RAFB 1FKPB 3THTA 2W8LA 3I82A 2HHHF 1S97A 4ED8A 3BO3A 1URNA 3ZTOA 1U1NA 3BZQA 3EDRB 1X8DA 2FPHX 2HWIA 4JP8A 3W7BA 4ZIWA 2BEFA 3AH6A 5KG1A 3FC9A 3EVWA 3H20A 1ZAWA 4ZIVA 4K4XA 2IM2A 1RYRA 4ZCMA 3OL6A 2VQEF 7FD1A 2KG1A 2F4VJ 3HVTA 1HI8A 1LXNA 3KDOA 4R5PB 5BJRA 4ECXA 3P4UB 4QWCA 4K4VA 2YX4A 3EE3A 2HLUA 2RQCA 4KRWA 5F8LA 2F9JA 1XERA 2V9WA 1ZETA 3IC1A 2J76E 4NPOA 5JXSA 3NEKA 4DPUA 1QAIA 3DCAA 4HH0A 4XPEA 3H5YA 4MKVA 2XYGB 1BWVA 3QGGA 2CNOB 4ZK7M 2ZOFA 2V4RA 4ZPTR 3GJSB 1N6QB 4GVLA 1H3DA 4J90A 5G4DA 1BQNB 3FRYA 3I5CA 3K5OA 2VJUA 4EO8A 2CUYA 2BM1A 1DJ0A 3EWGA 3O44A 1K47A 3LP1A 1KQGB 3IR5B 5LXYA 5AT1B 1SKWA 1U2CA 3MHYA 1WOPA 2ALYB 5DZ6A 2R7VA 2BYCA 2DY1A 5GMEA 3IRWP 3U1NA 3DNCA 1HBMB 1HR0J 3ZZOA 4GKJJ 1REVA 1T9UA 5F8HA 2VC1A 3C16B 2AWZA 3T19A 1AXQA 4LF9F 2ROEA 4YDXA 4G3IA 1XEZA 2OPSA 1S99A 3CGIA 2I38A 3M2VA 5EUHA 3MXHP 4M5NA 1YSJA 2OEJA 1V3RA 2CPJA 4F4ZA 3FRZA 3MCSA 1X9WA 4B3SJ 3Q8VA 3RU0A 1ITPA 5GMDA 1NDPA 1R43A 2LECA 3UW1A 2UVWA 4KC5A 4OYXA 4TY8B 2UXCF 4WK3A 2N4DA 1H73A 3IG1A 4NX9A 1Y0HA 3Q8RB 2YY3A 3A12A 2Q6CA 5H9EK 2GVDB 4N56A 5DG7A 2AEFA 4ES1A 3CO0P 5DGAA 1J27A 5A6PA 3KG4A 2XI2A 3NGDA 2DNKA 3JSRA 5E33A 2Y1RI 3FQKA 4MFBA 1HI1A 1PJ6A 2KT3A 2GX8A 1R7IA 4B3MF 3PNIA 1T3OA 1KLNA 2QLFB 5IC6B 4PQUB 1SJ1A 2AD9A 1F5AA 2QJ3A 1J5OA 1ZH5A 2GMHA 3N01A 5KG7A 4Q8FA 4ICLB 3TX8A 1NH8A 3BGRB 5THWA 1VQ9S 3RB4A 4FYXB 4RW8B 4ZLNA 2BV3A 2VDHA 2XMUA 3HJVA 5AE3A 2ACMA 2JH3A 2RMLA 3EJMA 3QIPA 4LRCA 5HQLA 4C3KA 2MHEA 4WFZA 3UDLA 4ECQA 5HVGA 1KONA 1UWBA 1SUQA 4UY8T 1B7YB 2DPIA 3W3SA 1YBAA 1T02A 1U1RA 3DRPA 3DXBA 4AXJA 2CVEA 4I6YA 1BC6A 2XM3A 2BJDA 3T5JA 2I0XA 4Y2KA 5CCMA 4ZVUB 1X4HA 2UV8G 4IYQA 4PEOA 3FKBA 4YHHJ 1H72C 1KVKA 1EQ0A 5BXIA 3Q8SB 4WIIA 1RI7A 1YZ6A 2OTJS 2DNGA 3RRGA 2BVZA 4JI4J 2MQQA 1Y10A 2RRBA 3MAAA 1OSCA 1RT1A 3VGUA 1K9MT 1G2EA 4YR3A 1KDNA 2DKOB 4BCAA 3V81A 2RKIA 3KK3A 2XMMA 1C2PA 4OHYA 2W4PA 5KFEA 4IFYB 2UUWA 4ELTA 5CYJA 2PE8A 1F3VA 3I87A 1TUVA 4Y2CA 1REGX 1XBWA 1S1TA 4BS2A 1CJVB 2O5DA 1SL2A 1QAXA 3HT0A 2XGQA 1KTVA 1BQMB 4CLZA 2E7VA 2G2YA 1UJ6A 1WG1A 2YKMA 2KYZA 3CD7A 4R8UA 5D3GA 1JLFA 4HYKA 2WB4A 1I1GA 4QWDA 1Y3JA 2FHMA 3QGIA 3P45B 1SH0A 2N3OA 1RT7A 4OYAA 4ZLPA 3AJDA 3OTCA 5IM0B 3OBIA 2CZ4A 1Q0NA 1WHXA 1ZM2A 1FA0A 3SIPB 5M2UA 5H9EJ 2BQUA 2MHNA 3LWLA 1XC9A 1S1WA 3TJAA 3PW5A 4TXSA 1RWXB 4LBHA 3U7JA 2B0GA 2YQ3A 2YTCA 4XTTA 2QEXS 1S0MA 2KJVA 4B9LA 3KMSA 1SBRA 1WUUA 2GS8A 2APOA 4N77A 2VIHA 3NY0A 5HVFA 1FFGB 1UPMB 1NBEB 2V8VA 3FEXB 4TLQA 3BBCA 1R0AB 3DYAA 4C9DA 2C3PA 2MXYA 2YKOA 4JI7J 1NK8A 1DY3A 2MEWA 4NLUA 3TWZA 1WHWA 3A8KA 5FLXY 3T1HJ 3PW0A 2HFNA 4QR2A 1QY7A 3DN9A 3OFFA 3OTOJ 4ZPBA 3CPWR 3GQCA 1VQMS 4BC7A 4A8SA 3RBZA 1U2RA 4LF2A 3OHBA 1YHQS 1O6XA 4F0KA 3CMES 1DTTB 2UZAA 5HN0A 2QE5A 4EUVA 5CXTA 4RBUA 3N28A 1U26A 1IBLJ 2MZ1A 4KFBB 3PTWA 1S59A 1TV6B 3HJFA 1YBTA 2HQCA 3RB0A 2UU9F 1Q8KA 2FJEB 2B6AB 4AL7A 1MMNA 3ELHA 5KT5A 4M5MA 3FDSA 3DGPB 5L1LA 3V4IB 1N56A 8AT1B 4CDIA 4EZ6A 1UMJA 1GK8A 4IOCQ 3GCWP 4WXWA 4WKYA 4P52A 3TQ1A 5D4PA 3BSAA 1GMWD 3AT1B 3BF4A 1TVRB
chains in the Genus database with same CATH topology
2VQEJ 4X64J 4PWWA 4LF7J 1HNZJ 4LF9J 4LF4J 4KHPJ 3R2CJ 1N34J 5A2QU 2UXBJ 3W1YC 3J7AN 4NXMJ 4LF5J 1HNWJ 2UXCJ 4V1Ak 1FJGJ 4YHHJ 4OX9J 4JI1J 4JI2J 4KY3A 5AJ3J 2UXDJ 2UU9J 3R2DJ 4JI6J 5BR8J 4LFCJ 3IMQJ 1J5EJ 4JI4J 1XNRJ 4RJVA 4JI5J 1N32J 4B3RJ 2UUCJ 1IBKJ 4KYZA 4DV1J 4DR7J 1XMOJ 2E5LJ 4LFBJ 1N36J 2F4VJ 4DV3J 4HHUA 1HNXJ 4LF8J 4JI3J 4LF6J 5FLXU 4DR2J 4DV4J 2VQFJ 2UUAJ 3T1YJ 4B3MJ 4DR4J 4X65J 4DR3J 3D3CJ 4DR6J 4JV5J 4JI0J 3JAMU 1I94J 4DR5J 4AQYJ 2UUBJ 4X62J 4NEZA 4DV7J 5IT9U 1HR0J 4GKJJ 4DV6J 5IWAJ 4LFAJ 4GKKJ 4DR1J 5LMNJ 4DUZJ 1XNQJ 4JI7J 2MEWA 4B3SJ 3T1HJ 5LMUJ 3J81U 4DV0J 2ZM6J 3OTOJ 4NEYA 4DUYJ 4K0KJ 4JYAJ 4X66J 2KVQE 4YY3J 1IBLJ 4JI8J 1IBMJ 4NXNJ 2MQ8A 4DV2J 2HHHJ 3J80U 4DV5J 2MTLA 1XMQJ 1N33J 2KL8A 3D3BJ 4B3TJ 5LM7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE J;  4X64 J;  4PWW A;  4LF7 J;  1HNZ J;  4LF9 J;  4LF4 J;  4KHP J;  3R2C J;  1N34 J;  5A2Q U;  2UXB J;  3W1Y C;  3J7A N;  4NXM J;  4LF5 J;  1HNW J;  2UXC J;  4V1A k;  1FJG J;  4YHH J;  4OX9 J;  4JI1 J;  4JI2 J;  4KY3 A;  5AJ3 J;  2UXD J;  2UU9 J;  3R2D J;  4JI6 J;  5BR8 J;  4LFC J;  3IMQ J;  1J5E J;  4JI4 J;  1XNR J;  4RJV A;  4JI5 J;  1N32 J;  4B3R J;  2UUC J;  1IBK J;  4KYZ A;  4DV1 J;  4DR7 J;  1XMO J;  2E5L J;  4LFB J;  1N36 J;  2F4V J;  4DV3 J;  4HHU A;  1HNX J;  4LF8 J;  4JI3 J;  4LF6 J;  5FLX U;  4DR2 J;  4DV4 J;  2VQF J;  2UUA J;  3T1Y J;  4B3M J;  4DR4 J;  4X65 J;  4DR3 J;  3D3C J;  4DR6 J;  4JV5 J;  4JI0 J;  3JAM U;  1I94 J;  4DR5 J;  4AQY J;  2UUB J;  4X62 J;  4NEZ A;  4DV7 J;  5IT9 U;  1HR0 J;  4GKJ J;  4DV6 J;  5IWA J;  4LFA J;  4GKK J;  4DR1 J;  5LMN J;  4DUZ J;  1XNQ J;  4JI7 J;  2MEW A;  4B3S J;  3T1H J;  5LMU J;  3J81 U;  4DV0 J;  2ZM6 J;  3OTO J;  4NEY A;  4DUY J;  4K0K J;  4JYA J;  4X66 J;  2KVQ E;  4YY3 J;  1IBL J;  4JI8 J;  1IBM J;  4NXN J;  2MQ8 A;  4DV2 J;  2HHH J;  3J80 U;  4DV5 J;  2MTL A;  1XMQ J;  1N33 J;  2KL8 A;  3D3B J;  4B3T J;  5LM7 E; 
#chains in the Genus database with same CATH topology
 4X4N A;  5ETS A;  2Z2Y B;  3FZB A;  3B54 A;  3M2R B;  1MRO A;  3AJ2 A;  3KJV A;  4YOE A;  2DXE A;  1T95 A;  2CPY A;  2W9A A;  4LMZ A;  2I2Y A;  3ULH A;  3KLG A;  4DN9 A;  1Q79 A;  1T3N A;  3I31 A;  1WSR A;  1CJU B;  4WFA Q;  1H2U X;  2U2F A;  4EBE A;  4RU2 A;  2WB1 D;  3THV A;  1R0A A;  5CZX A;  3CIM A;  4O3N A;  1WKJ A;  2KI2 A;  2IPO B;  4D3G A;  3K7R A;  1HBN B;  3JQM A;  4AL6 A;  3RW7 A;  2D3U A;  4MMO A;  2EG1 A;  1RA6 A;  5L1J A;  1VHF A;  2RB7 A;  2AKW B;  3M6V A;  4N47 A;  4XAK A;  1P9Y A;  3W8G A;  5C25 B;  8ATC B;  4CCH A;  4HDH A;  2HQG A;  3QYY A;  1GMV A;  2O3D A;  3PYD A;  5L38 A;  2XMT A;  2ZD1 B;  2DHX A;  2W9B A;  1W2I A;  4ZVO B;  4QW8 A;  4JI8 F;  3W5Z A;  2Y1I A;  3IM8 A;  2WOM A;  5AJ3 J;  2I8E A;  3P3D A;  5I3U A;  1WEX A;  4GO7 X;  4RUC A;  1C1B B;  1F0X A;  3R5D A;  5GAD U;  1V9O A;  2ZWP A;  4B3R J;  3Q89 A;  5EHH A;  2BJ8 A;  3ILO A;  1JLB A;  3TZY A;  2YWH A;  1M5S A;  4PWU A;  1S7H A;  1R8P A;  4L6V 3;  4EBD A;  3LO3 A;  9RUB A;  4IOA Q;  2OPP B;  2V8P A;  4ED6 A;  2Z30 B;  3OTD A;  3D6F B;  3MMC B;  2IDE A;  4C0O C;  4KB7 A;  1BUX A;  1QTN B;  3MCN A;  1TZ0 A;  3MMA B;  4YME A;  4X66 F;  5KFK A;  3PW4 A;  2D7S A;  2IFX A;  2XI3 A;  2F65 A;  3T9Z A;  4J9O A;  5D4N A;  1PO6 A;  3MM5 B;  4WZM A;  3DM2 B;  1YGY A;  3F44 A;  4OHV A;  4MK8 A;  1S6Q B;  1FWL A;  2V68 A;  3PY8 A;  2GIF A;  3K5N A;  1DLO B;  3N6N A;  2HRY A;  5KG5 A;  2JZ5 A;  2KM8 C;  4Q45 A;  1RYS A;  1U8W A;  3FUY A;  4UUW A;  3MM6 B;  4J91 A;  1HBN A;  2KT2 A;  3DGV A;  1PIL A;  2OKQ A;  2CPE A;  3QQC D;  1QE1 A;  5FDL B;  1C0U B;  3BYR A;  3QRP A;  2BKN A;  4ZS6 A;  2CQ4 A;  3KJN B;  5D0G A;  4JI0 J;  3R6G B;  3JAM U;  4DLG A;  2B4P A;  1LW0 A;  4J9U E;  3NOC A;  4RNF A;  2ADB A;  4C4W A;  2KFZ A;  1KFS A;  2A18 A;  1TKT A;  2Z56 B;  3BPS P;  5HBM A;  3KLH B;  3LF0 A;  1RJJ A;  2OPP A;  1L3S A;  1U25 A;  1WF2 A;  1BE4 A;  3CCQ S;  5DZ7 A;  1NSP A;  1WG5 A;  1SH3 A;  2CFX A;  4LBP A;  4LFA J;  1IBC B;  3TUJ C;  3BGL A;  5ETP A;  5H9F J;  1WJ9 A;  3W2V A;  3S01 A;  2RSQ A;  4ED7 A;  4DSJ A;  1Y9O A;  3I0S B;  3BV8 A;  4B3O B;  2DT9 A;  1KC8 T;  2B4U A;  3K17 A;  4MYT A;  2HHU A;  2MGZ A;  4HEA 9;  4ECW A;  2P9G A;  4CQ1 A;  4RW8 A;  2LU1 A;  3DOK B;  4H54 A;  3PIP Q;  3RAX A;  2I5J A;  3PRV A;  4QIW D;  3H5S A;  1PC4 A;  1FDN A;  2YQ0 A;  3GJT B;  4RNH A;  3CUN A;  2GQQ A;  2JWN A;  4GVB A;  4RO0 A;  1C0T A;  1ZYQ A;  5K5M A;  2EKY A;  2MLY A;  4FYW B;  3PEJ A;  1H6K X;  3BGR A;  4WCE Q;  2HNZ B;  3KK2 A;  4O3R A;  2ROP A;  2ZUA A;  1FDA A;  3NBP A;  3DMJ B;  4WP9 A;  4DQR A;  3C46 A;  1NDK A;  5ETR A;  1IBM J;  4FBT A;  4K7Q A;  1KOH A;  3C15 A;  2UUA F;  5ETQ A;  4DZD A;  1P6T A;  3BBF A;  1HHS A;  1M1G A;  4F26 A;  2ZZN A;  1MWY A;  5A8K B;  4DLE A;  2HVH A;  2PGC A;  2NYH A;  4USH A;  2YKQ A;  4HTI A;  4ETX A;  2YNI A;  3W60 A;  3AQO A;  4WFN Q;  5IT4 A;  2Y8W A;  2M8H A;  3ZZP A;  3GR0 A;  1IXK A;  3EM1 A;  3NXZ A;  4W98 A;  4ZJQ A;  2GQ2 A;  2R7R A;  3R1L A;  1N5Y B;  4WU3 A;  2KRB A;  1R31 A;  4UZC A;  4PWW A;  1M5K C;  2XWX A;  2Y9H A;  1JKH A;  4XIU A;  3W64 A;  5ADZ A;  3M9O B;  1HNZ J;  4LF7 J;  4NCB A;  1K0T A;  2EFV A;  3M30 A;  5SZT A;  4LIW A;  4NI2 A;  3GFH A;  2V94 A;  4C3M A;  4MH8 A;  2W8K A;  2BZ2 A;  2XWY A;  2C2N A;  3TI0 A;  1RE1 B;  2AHO B;  3LA0 A;  3N5F A;  3QNW B;  5LXR A;  2HMI B;  2VA3 A;  4YUD A;  4OI0 A;  1RCO B;  3PJW A;  2WON A;  1UEK A;  3BSO A;  2MGZ B;  3QJJ A;  1IR2 A;  1YRT A;  2UUT A;  3BKU A;  2VOD A;  4AFF A;  1N48 A;  3C14 B;  2HUR A;  4V1A k;  1S1T B;  2DGV A;  3NS5 A;  3CJQ A;  1KNZ A;  1RT1 B;  1LWX A;  5L1I A;  3EZU A;  4DR5 F;  3T6B A;  1A0O B;  2CJ9 A;  3Q22 A;  3PM9 A;  1H38 A;  2RKI B;  1I51 B;  3KK3 B;  2H5E A;  3CCJ S;  3PW2 A;  1DFD A;  1FT8 A;  1HNI A;  2CNN B;  4F4A A;  1EET A;  4RKU C;  3TYT A;  3CCS S;  1DTQ B;  1EX8 A;  3V4M A;  4HAC B;  5LSR A;  2R7Q A;  2B56 A;  3H25 A;  1WI6 A;  4DPO A;  4WF9 Q;  1FRH A;  1YVF A;  2XG8 A;  4L74 A;  3NGR A;  5K8O A;  1T11 A;  3UR0 A;  1N0U A;  2CRL A;  2OML A;  5EX0 A;  3GV5 B;  2XZW A;  2FD2 A;  3MEE A;  4CT8 A;  5GAH U;  1FRL A;  2BKO A;  2YKA A;  4O44 B;  3TVY A;  2XBP A;  4DV0 F;  3PVX A;  1NPK A;  2OSQ A;  3E2E A;  4IRK A;  3BQ1 A;  2KFY A;  4DSF A;  3PKM A;  3G8T A;  3D68 A;  3AOC A;  3THP A;  3IN5 A;  2R7O A;  4ED5 A;  2R7T A;  2B9W A;  2WSE C;  4PYA A;  3L7P A;  3G6X A;  5ETN A;  3CJS A;  4OYI A;  5HK4 A;  2EG2 A;  2AGQ A;  4DL5 A;  2DGX A;  1HIY A;  1SKU B;  4CH0 S;  2JLG A;  1HPZ B;  5KFJ A;  2LDY A;  3NWR A;  5K8M A;  3LP2 B;  3B82 A;  3ETM A;  4TU8 A;  1FNO A;  3KLF B;  1SJQ A;  1EQM A;  3CXC R;  5KT3 A;  4H4O A;  2C1E B;  3DXS X;  4DEZ A;  4JV5 J;  3ETO A;  2VFU A;  1KSP A;  5IOL A;  3W2W A;  1J2V A;  1NJW A;  4NLP A;  1RAB B;  2HZC A;  1HYS A;  2L48 A;  5J2N B;  4CO0 A;  2E5I A;  4X62 J;  1N4L A;  4X2B A;  5IT9 U;  4DV6 J;  4OZL A;  2XS2 A;  3MF5 A;  3Q83 A;  2XMA A;  5IWA J;  1YJ7 A;  4AUK A;  3CCE S;  2LP4 A;  4AL5 A;  2YX7 A;  3W9H A;  3M8Z A;  3D7S B;  4Q2M A;  2UUC F;  3M2U B;  2RD5 C;  2XS7 A;  2ABY A;  1QLN A;  1B4S A;  2FHJ A;  1M5O C;  2LFV A;  4L73 A;  2DNL A;  4ELV A;  2QT7 A;  4OL8 A;  2G0I A;  2KZM A;  4DFP A;  3ZZY A;  4E8U A;  2UXB F;  5KFF A;  1RA7 A;  4DUY J;  1LW2 A;  1VQO S;  4TNO A;  1LK5 A;  2DNN A;  4Y6I A;  5DRK A;  1CJU A;  4QZV B;  1D09 B;  2HFV A;  2KJW A;  3FQL A;  3ZO7 A;  3OUY A;  2WRM A;  2H4Y B;  1VQN S;  3ZZZ A;  3DOM B;  3OR1 A;  4WU2 A;  3BGU A;  1CPZ A;  4M5G A;  4KSE B;  2VKR A;  2V2Z A;  4USV A;  5BR8 F;  1WSV A;  3CJ0 A;  1CEZ A;  4P6Q A;  5D0H A;  4CTA B;  3GU0 A;  4G6V B;  3LP2 A;  5FII A;  3RAM A;  1L3T A;  2AJQ A;  3Q8P B;  4DV5 J;  3VGV A;  4ITS A;  3ISN C;  2J5A A;  2B51 A;  1NU4 A;  2DTJ A;  3QFW A;  4IG3 B;  1WD6 A;  4AXI A;  4IH6 A;  2PMZ D;  1FRK A;  2B5J A;  4QR0 A;  4ZCL A;  4A47 A;  2ATL A;  1JB0 C;  1I94 F;  2QMW A;  1NK7 A;  1TTH B;  4IG0 A;  5A8R A;  5KT2 A;  2HQ3 A;  3O6Q A;  1NSK L;  2M88 A;  2B9Y A;  2F8H A;  2LXF A;  3NGS A;  4YFU A;  1JWW A;  2D3Z A;  1YG0 A;  2G9O A;  2CPH A;  4WFX A;  2W2N P;  4RUH A;  4C2M A;  4ECT A;  4C0H A;  1TL1 A;  3MEG B;  3KK1 B;  3EX7 B;  5B08 A;  3OSP A;  1XNQ F;  3HSJ A;  1BHN A;  4PQU A;  2FC8 A;  2XZD B;  3K8W A;  3MD1 A;  4OYM A;  4CZC A;  3ENW A;  4C11 A;  1YQH A;  1ZA1 B;  2DIS A;  2EFP A;  3L09 A;  1N6Q A;  4LSN B;  4DDF A;  2ZEJ A;  3W1Y C;  4UT4 A;  4KGZ B;  4ZPD A;  4OYO A;  5IFM A;  4KIA A;  1R8B A;  2L08 A;  3ZFV A;  3BGO P;  1NEE A;  1NHK L;  1UET A;  1RT7 B;  4FVM A;  4OJH A;  2Q1L A;  4OI2 A;  2AJ0 A;  3BN7 A;  1O0P A;  1UP1 A;  3B6B A;  3DU6 A;  3GJR B;  3M8P B;  4USU A;  5E3A A;  2ASD A;  2Y0B B;  1HQ2 A;  2CNL B;  2OP5 A;  3CB4 A;  1RTZ A;  3IR7 B;  4FPI A;  1LWC B;  1GX6 A;  3D6T B;  5DDR C;  3E01 B;  5BYQ A;  1RT4 A;  2FQQ B;  1FWK A;  2F40 A;  1IQT A;  1RT2 A;  1S9E A;  3SQO P;  1J5E J;  4WXO A;  5ETM A;  1NPR A;  3IBW A;  1HD0 A;  2R7U A;  3W66 A;  1FF2 A;  3MMB A;  3KMQ A;  1FE4 A;  1OJ4 A;  2BAN A;  4PAA A;  5L9N A;  4QOT A;  2X7I A;  4OJG A;  1XMO J;  2E5L J;  1RIS A;  2H54 B;  3HHK A;  1S9G A;  4K2J A;  1MN7 A;  1APS A;  4CI0 B;  1RAA B;  1CS4 B;  3LP0 A;  2Y1J A;  3CCW A;  3L9Z A;  3M7V A;  3MAH A;  4ZPA A;  5HMX A;  2C28 A;  2ZH2 A;  4ECS A;  1VBY A;  2IHR 1;  4PPZ A;  4ILM A;  2Q79 A;  3SSQ A;  3RTV A;  2ZIT A;  3KHG A;  2V4J B;  1RAI B;  4YY3 F;  5HLF B;  4OLO A;  1L3U A;  1UFL A;  4P2S A;  5KAK A;  2XLJ A;  1CJV A;  4DV4 J;  1EIY B;  2YH0 A;  2J9D A;  3HFV A;  3MPD A;  4USI A;  4B9T A;  4N5S A;  3AB2 B;  5SUH A;  3BYP A;  4ZCK A;  1SV5 B;  2BE7 D;  2JSX A;  2W24 A;  4U7U D;  3M6W A;  3SQG A;  4O0I A;  2LYV A;  4LR9 A;  3CCT A;  2VG7 B;  4M5I A;  4FS1 A;  4ED2 A;  4KT0 C;  1Q86 T;  1XNR F;  1BQN A;  2DD8 S;  1FCA A;  4X64 F;  2ZJQ Q;  1FKO A;  2F1F A;  2CNK B;  3OQ2 A;  4WK1 A;  4FF2 A;  1DAX A;  1YBU A;  4CLL A;  2GV1 A;  3J7Y U;  4U67 Q;  1UFK A;  2HS0 A;  3KYL A;  1YIT S;  2V8D A;  4ILR A;  2KHD A;  2GVZ B;  2I1R A;  4I0W A;  1DZ5 A;  1VRU A;  4LR7 A;  4F50 A;  1L3V A;  4U95 A;  3DRP B;  2XY5 A;  4K4T A;  1F3F A;  3BSC A;  4RWW A;  3TZX A;  2IC3 A;  2CAD A;  1NSA A;  2FTR A;  2MQM A;  1B70 B;  2MKC A;  3FSI A;  2PI5 A;  4LF5 F;  2KYX A;  4H4K C;  3DLB A;  1R8A A;  1U1M A;  3MM9 B;  4Q0B B;  2C2R A;  4YN3 B;  1LNQ A;  2LQ9 A;  2DIT A;  1HBO B;  3CDE A;  1EP4 B;  4NE9 C;  4PCQ A;  2EVZ A;  4CLK A;  4DOZ A;  3PHE A;  3IWL A;  2G2O A;  4U8V A;  5D77 A;  1F5B A;  3M9N B;  3UCU P;  3V6D A;  5F9L A;  2R2T A;  4TY8 A;  3GIK A;  1YJV A;  1CUL B;  1KVI A;  3M2R A;  2MQ8 A;  3UR3 C;  1H98 A;  3AD8 C;  3IS9 B;  4WWS A;  1GH8 A;  3RBX A;  2GVD A;  1JLE B;  3HXM A;  2RU3 A;  1SV5 A;  1T9X A;  2EBG A;  2FVR A;  2K2P A;  3AAW B;  4NLD A;  4DR7 F;  3SV4 A;  4QIG A;  4ETZ A;  4LFB F;  2CPD A;  1VDH A;  2MQN A;  4NRU A;  3DDK A;  3Q8Q B;  1F9H A;  4OI3 A;  3UN3 A;  4C48 A;  2AEM A;  4CO2 A;  5B7W A;  3MAQ A;  1HR0 F;  1SQF A;  2QO3 A;  3C16 A;  3AFG A;  2HLT A;  4LF9 J;  4OZ0 A;  3L7U A;  3ZTS A;  4PQA A;  4CNY A;  5KFP A;  2OD4 A;  3QWU A;  2FJB B;  3IG1 B;  1SXL A;  5DLG A;  4B3S F;  3BRE A;  1X4A A;  1JXV A;  1PAU B;  4LVN P;  1Y5L B;  3UO0 A;  5J1E A;  3CJT A;  3LAL A;  3MR6 A;  6FDR A;  2IVY A;  1VOM A;  2CAJ A;  2QLJ B;  2IA6 A;  3PR5 B;  3IS9 A;  4AND A;  4TU7 A;  3OTB A;  5DJB A;  2MKJ A;  1ZM9 A;  1UTA A;  3H4D A;  2P9C A;  3JQJ A;  3NGK A;  1RXO B;  5KG2 A;  2UXC J;  4EWT A;  2CPF A;  5KFM A;  3FCH A;  4DV5 F;  4ERD A;  1DQ9 A;  3DDN A;  4OX9 J;  1KFD A;  3IAS 9;  1UEV A;  4EYI B;  3DRY A;  4LSL B;  2UV8 A;  3AY0 A;  3PFO A;  5CYM B;  4LIR A;  4USM A;  2CQC A;  3R2D J;  1SB6 A;  1RAH B;  1FKA F;  3J81 Y;  2VB6 A;  1N8R T;  2NZ4 A;  3NS7 B;  1Q78 A;  3O8W A;  4JI5 J;  3QJL A;  1KTQ A;  2D69 A;  4C97 A;  5GAH I;  2A3J A;  3ICL A;  1S6P A;  1RAD B;  5ETV A;  4DUZ F;  2QMU B;  4DL7 A;  4KYZ A;  1NKE A;  4ZMM A;  3D5M A;  3BJY A;  3H98 A;  2LQ5 A;  1NK4 A;  1T05 B;  4X4Q A;  1OQ3 A;  3BB5 A;  3DHX A;  4JV0 A;  1NLK L;  1NKB A;  4DQS A;  4W90 B;  4DN0 A;  4NLV A;  2JFD A;  3LWM A;  4A8M P;  3IP0 A;  4I2Q B;  1WF1 A;  2BE2 B;  3ZC4 A;  3I4H X;  5IC4 B;  1K1Q A;  5BYR A;  1UVN A;  1VIS A;  2BKP A;  1C0T B;  3GYG A;  4NLO A;  5E3Q A;  2IM1 A;  3SSS A;  1NJI T;  4CIO A;  4FXD A;  1FD2 A;  4N7T A;  4MIA A;  5HRO A;  2E9Z A;  3Q0A A;  1AZS A;  1WHY A;  1WC1 A;  3CE8 A;  4XPC A;  1XR6 A;  1N33 F;  4U8Y A;  2CQB A;  2RE1 A;  4IG3 A;  4DMZ A;  3G4S S;  4YHH F;  3DOM A;  3OL9 A;  4CH1 A;  1TAU A;  1EAY C;  2FHK A;  4I1T A;  5KFS A;  3V6K A;  2M0G B;  4L75 A;  2VBZ A;  3S1T A;  1KRP A;  2M5Y A;  2W7A A;  1U1P A;  2BXJ A;  2D3O R;  3PX4 A;  2QA1 A;  1LWF A;  3OR1 B;  4KHP F;  2CYY A;  2PDA A;  2ZC4 A;  2ZH6 A;  4P2F A;  3JSM A;  2OH2 A;  5KT4 A;  2C42 A;  3C66 A;  2HKE A;  2YWE A;  5KTQ A;  5AXN A;  4DFK A;  3LUY A;  2ZM6 J;  4DSE A;  2VH7 A;  1TKZ B;  1ZPW X;  5AXK A;  4NXM F;  3RBE A;  1UCN A;  1ROF A;  1R0C B;  1S6Q A;  1VQP S;  1QAJ A;  2ZH3 A;  1LV5 A;  1FJG F;  1MWQ A;  2ZWO A;  4QCL A;  1IQZ A;  1JMT A;  4X4T A;  2MLZ A;  4DPX A;  1OY6 A;  3DLG A;  2R7W A;  2DHG A;  2EFN A;  2W7P A;  4Q8E A;  1SC4 B;  4ECU A;  2VKZ G;  1PKU A;  3GP9 A;  4JI6 F;  2J8A A;  2B9X A;  4R0E A;  1BD6 A;  2ILZ A;  3Q23 A;  3M8W A;  3RBD A;  1N5V A;  3J80 U;  3L4B C;  2MTL A;  3PJ9 A;  2HFS A;  2HNZ A;  4B17 A;  3QFH A;  1YJU A;  4HDG A;  4DV1 F;  4NLS A;  3DMJ A;  3KJQ B;  4PZV A;  4TKT A;  4OZ5 A;  2BRK A;  3D4J A;  2WBM A;  2IBO A;  5KFZ A;  2WW8 A;  4F2R A;  1U2F A;  1OWX A;  3LGH A;  5IZH A;  2IRY A;  5FD1 A;  2V63 A;  5ETO A;  5EWG A;  2RRA A;  1NRK A;  3HX9 A;  4C98 A;  1M5H A;  2HHW A;  3DOK A;  3GFY A;  1B99 A;  4A8Q A;  4JI7 F;  2K8G A;  4OI4 A;  4CO3 A;  3T1H F;  4ZKA A;  1A7G E;  3A8J A;  3FK4 A;  4W92 B;  4B9V A;  2OPQ B;  5I3Q A;  3OTO F;  3D67 A;  1U6F A;  3BKF A;  3K89 A;  2HGL A;  3ET6 B;  2H4W B;  1AB8 A;  2QA2 A;  3FNN A;  3MEC B;  3BGF A;  2E5G A;  4KPC A;  3CCV S;  4EU0 A;  2C3O A;  1URR A;  2J9E A;  4QYR A;  2HPU A;  2MY7 A;  4Y3C A;  1TKT B;  3KLH A;  2M8D B;  3MCO A;  1HWU A;  1WNE A;  1B0P A;  2P8I A;  2HBZ B;  4JI1 J;  1RTD B;  1UVL A;  4BWJ A;  1AFI A;  2HNY B;  3I56 S;  1HQU A;  1TKX B;  5U47 A;  2UU9 J;  4E0D A;  4RW7 B;  4A48 A;  4LFC J;  1TK8 A;  1KD1 T;  2YNG B;  4FP9 A;  1NME B;  3FFI B;  2DCL A;  1U47 A;  2VZ9 A;  3FCW A;  3HKW A;  3VGT A;  1W7W A;  2H3E B;  2ZUG A;  3MTK A;  2R9L A;  5F3Z A;  2VD3 A;  5B0A A;  4CM2 A;  4C0B A;  2R3V A;  3PEH A;  5LMU F;  5DLF A;  1QVF R;  4RBV A;  3O1L A;  4EYH B;  4DQI A;  3DOL A;  2EW9 A;  5LJ5 Y;  3UNY A;  3VR1 A;  3O2I A;  1PJ5 A;  2FLL A;  4HHU A;  5E41 A;  2JL9 A;  5CCL A;  1MWZ A;  2HND A;  1S9G B;  5B0D A;  1G6B A;  1VQ4 S;  3R7S B;  2ZH7 A;  4BC9 A;  2GJF A;  5D15 A;  3POT A;  5A8W B;  3W2W B;  1X0F A;  2E1A A;  3N0V A;  1C1B A;  1GT8 A;  4QU6 A;  4F0M A;  2CQD A;  4EGL A;  4HTJ A;  2AQ4 A;  3D1O A;  3HZE A;  3ET6 A;  2EWH A;  3OSN A;  1UVM A;  2PN6 A;  4MFB B;  2OD6 A;  3NS6 A;  4DU8 A;  3PV8 A;  1NCL A;  3WZ0 A;  3FCV A;  3R3T A;  4I6W A;  4X65 J;  1FK9 B;  4G1P A;  3GII A;  1U09 A;  4DQP A;  2PC6 A;  2L9N A;  3CD5 A;  4AYB D;  2AW0 A;  4C7Q A;  2HQF A;  2V50 A;  3MM7 B;  4OZN A;  4ES3 A;  4DL2 A;  4R25 A;  1ZAV A;  3QGH A;  3G6Y A;  4DV7 J;  1NH7 A;  3SCK E;  2FZK B;  2GJI A;  3BN4 A;  2JJ4 D;  3TP2 A;  1K0V A;  2GMJ A;  3SCI E;  2CQP A;  4HT7 A;  2JEF A;  2B3T B;  2XB2 D;  1ZTT A;  3SFG A;  3Q2T C;  3AJ1 A;  1HNV B;  1YI2 S;  1WKL A;  4OLP A;  4HR2 A;  3OUY B;  3H5X A;  2Q6B A;  5E3R A;  4M1K A;  1VBX A;  1LOU A;  1RAC B;  4LRB A;  1NZA A;  1SIZ A;  1TL1 B;  3MEG A;  2RS8 A;  4DR4 F;  1LFW A;  2PEB A;  3M32 A;  4FZV A;  1WEZ A;  1MU2 A;  1YRX A;  3CJK B;  4QBU A;  5LOQ A;  2R7S A;  2ZJR Q;  4B3O A;  4X66 J;  3CED A;  3DOL B;  2O1P A;  2ILY A;  4J37 A;  3RR7 A;  1G1X A;  2B5J B;  2DVI A;  7FDR A;  3GG1 A;  5FJ4 A;  2AJ1 A;  2RU9 A;  4M5K A;  4KV8 B;  4ZDN A;  2FVQ A;  4LBI A;  2QFJ A;  2NRE A;  2G0C A;  1DHM A;  4G1I A;  2Q66 A;  2BJ3 A;  1VRQ C;  3Q8U A;  5AXL A;  1R89 A;  4NLW A;  4J7C A;  1QAY A;  1FER A;  4PWD B;  2AX0 A;  3FMW A;  2G13 A;  3M6U A;  3OPK A;  4G1Q A;  1N32 F;  3TOQ A;  5K8N A;  1MG7 A;  3NOG A;  4UST A;  5HQ8 A;  2VPX B;  4L76 A;  1QSS A;  2VON A;  3BEG B;  2O67 A;  2Y8Y A;  5IS2 A;  4TN2 A;  2F9D A;  5CD4 H;  3G71 S;  2G0J A;  3KOA A;  2DGQ A;  4NMX A;  2HBR B;  1JLA A;  1GXT A;  3ZZU A;  1VLY A;  1RHU B;  3CJ4 A;  4KR0 B;  2FVP A;  4FN5 A;  1N34 J;  1K73 T;  2E66 A;  3X1L B;  4Q44 A;  1H2V Z;  2NPI A;  4IFV A;  3H59 A;  5T7L A;  5GAE U;  1UA1 A;  2IBK A;  4FBU A;  2UXB J;  4N8O A;  3DRR B;  4MKA A;  1S6P B;  1VQ6 S;  4F0H A;  3H42 A;  1N88 A;  3BR8 A;  4LR8 A;  1Q53 A;  1NUE A;  2HW3 A;  4OYP A;  4ZPV R;  2ERR A;  3DDI A;  3T1Y F;  2KRR A;  3FBE A;  1IWA A;  3KFW X;  2I6W A;  4NLT A;  2V67 A;  2GZO A;  4DHV A;  5F8I A;  1O51 A;  1NZ8 A;  2RIL A;  1FVS A;  4IO9 Q;  2GAH C;  2A10 A;  2HQD A;  2ZVI A;  1JLF B;  5A6W A;  4P75 A;  3UWT A;  3CDA A;  3Q86 A;  5K9F A;  4AQY F;  3J7Y I;  1IBM F;  5CYQ B;  1V5I B;  3IRX B;  4ID8 A;  3B78 A;  4K5R A;  2A2D A;  4NZ7 A;  4OZ3 A;  1R6Y A;  4OYW A;  3SMZ A;  3OL8 A;  1FX2 A;  5ETT A;  3EYZ A;  4ALZ A;  3JXO A;  4ED0 A;  1SCJ B;  2H65 B;  1XNR J;  2HAF A;  3UD5 A;  2AJ4 A;  4IG0 B;  1LFP A;  5A8R B;  3IAM 9;  1NB2 A;  3AOD A;  5I42 A;  4NLR A;  2RT3 A;  4IH5 A;  4I6A A;  4QIF A;  5JUM A;  1CJK A;  2VG5 A;  3JTO A;  3GMG A;  4KKO A;  1VC5 A;  2R2S A;  2EFO A;  2CQG A;  3PAC A;  4F4K A;  4WP8 A;  1MNE A;  2J7U A;  4EO6 A;  2EI5 A;  2WON B;  4O3S A;  3HI9 A;  1V3Z A;  1YJR A;  2MDA A;  2RH3 A;  2V8H A;  1U4B A;  2VL1 A;  2IJN A;  3CIZ A;  1BGX T;  2B43 A;  4KHM A;  4NML A;  4ZCI A;  5KG3 A;  4JI3 J;  5EGY A;  2MKH A;  4I7F A;  2RQK A;  4PXD A;  3JB9 k;  3LGM A;  3PXG a;  4QWA A;  1LWF B;  4I67 A;  2DYA A;  1TL5 A;  1CC8 A;  3D54 A;  2NQP A;  2OI2 A;  5GAG U;  5KT7 A;  5J2P A;  1OSD A;  2R8J A;  1X31 C;  4URG A;  3GPA A;  1C4A A;  5HAT A;  2VQF J;  3MAA B;  1HNI B;  2GQC A;  4Y65 A;  2IRX A;  2EKN A;  4OMF G;  4ZVP B;  2VIC A;  1RT4 B;  1PYO B;  2KT5 A;  4DR6 J;  2I9S A;  4B08 A;  2BM0 A;  3VQT A;  2UUB J;  3JYT B;  4DR5 J;  4W4M A;  1IKX A;  5B0B A;  2ZE2 A;  3RR8 A;  4ED3 A;  4L72 B;  1JLE A;  2XSF A;  1U0H A;  4A8K A;  2W2Q P;  1FXL A;  2BJ1 A;  4LVO P;  3I55 S;  1TV6 A;  3GCX P;  3SXL A;  3IRX A;  4PG4 A;  2RF2 A;  4LF4 F;  2IY5 B;  1HYS B;  2XMW A;  1UJ5 A;  4A8O A;  1SL0 A;  4X4U A;  4OHZ A;  3GYN A;  5KFN A;  4XK8 C;  4M94 A;  1DAR A;  1PIE A;  3KLI A;  4I2P A;  2DR8 A;  3ZXW A;  2OUG A;  1ZM4 A;  3KLF A;  4J5O A;  4DV0 J;  4NCG A;  1Z4U A;  3CMA S;  5KFL A;  3EPI A;  4ES2 A;  2VUG A;  3G6E S;  3HMJ G;  2QG9 B;  2KB2 A;  1R8C A;  4OFZ A;  1ELO A;  2XSJ A;  4IQX A;  2WOM B;  1RHJ B;  4DL0 C;  5KFD A;  2PD1 A;  1C1C A;  3Q8Y A;  2W9B B;  5F9N A;  3QJP A;  2C3M A;  1HWL A;  2QLX A;  3NCQ A;  4RX6 A;  1Z2Z A;  1S7I A;  1VFJ A;  2MJU A;  4KE5 A;  2J0X A;  3PW7 A;  2VOP A;  3CC2 S;  2CZ9 A;  1S12 A;  2M3D A;  4N41 A;  4G65 A;  3GFZ A;  4LRA A;  4RR5 A;  3H40 A;  4AD6 A;  3PIO Q;  3SQG B;  1M1K T;  2CQH A;  4D3H A;  4CYU A;  4RUA A;  3OW2 R;  3MOZ A;  5KG4 A;  4MT1 A;  4FVC A;  2JEJ A;  4JV5 F;  2E1M C;  2MSS A;  4N8N A;  2PT0 A;  4DPT A;  5F8G A;  4B3T J;  2DH7 A;  2LEA A;  4P71 A;  2KKH A;  1EB0 A;  2OPS B;  4BLG A;  2HGM A;  2VF3 A;  1FJ7 A;  2E9R X;  4DV6 F;  3R7N B;  2D3O 1;  1NHU A;  3FGV A;  3W9J A;  2G2Z A;  3GE9 A;  3V5R A;  3D9B A;  3R2C J;  4K4Z A;  4AT1 B;  5K20 B;  2M4M A;  3GTY X;  1RWK B;  2B4V A;  1BQM A;  1DQA A;  2VFS A;  4RLE A;  1VK8 A;  4M5D A;  3M8Y A;  5E2Q A;  1VHI A;  3DKD A;  4OV6 A;  4DWI A;  5D3G B;  4WIQ A;  3EMT A;  2HS3 A;  4RWX A;  2XQC A;  3NRB A;  1RDR A;  4NZ0 A;  2PMH A;  5HMZ A;  4GC7 A;  1RKJ A;  2CVI A;  4C8O A;  1FFS B;  5F0W A;  1HNW J;  5H9F K;  3RUB L;  2ZKT A;  3TUI C;  1X9S A;  3HLU A;  3VVT A;  1IKV A;  2IJR A;  2XC9 A;  1KBR A;  2BE9 B;  4OYB A;  3MR5 A;  4RW9 A;  1U45 A;  1NK9 A;  3M9M B;  1BXN A;  3U1M A;  1VRT B;  2CJB A;  2EPI A;  2LDI A;  3TVK A;  3WC0 A;  5BR8 J;  4DL6 A;  2KO1 A;  2JOQ A;  2RHQ B;  4O4R A;  4P2X A;  4FXV A;  3C2P A;  5F8J A;  1S48 A;  2FLO A;  2BRL A;  2WK4 A;  4A4J A;  3T5K A;  1B0T A;  3FBC A;  2NXE A;  2BUN A;  6AT1 B;  2HBY B;  1IBK J;  4DSI A;  2GGP B;  3AXM A;  4XDC A;  1T7P A;  1RWP B;  1SQE A;  1S0O A;  1U8S A;  3NAH A;  3OJS A;  1JK9 B;  1WOO A;  3J7A 1;  1SJR A;  1WAC A;  3VAI A;  3MM9 A;  3WDO A;  4LSN A;  4OYZ A;  5C25 A;  2E5H A;  4IOB A;  2XY7 A;  4PUO B;  4P73 A;  1JQG A;  1UWB B;  2CA9 A;  4K0K F;  1U24 A;  2DK2 A;  1E6V B;  3AOA A;  1IKV B;  3TAN A;  4RNO A;  4MKY A;  1AFJ A;  3E51 A;  2B7B B;  2XS5 A;  2BA9 A;  1VC0 A;  3A4T A;  3KLG B;  4C8K A;  2QRR A;  1XN9 A;  2IVM A;  3PYG A;  3EXC X;  4X84 A;  2V5H G;  2LXU A;  4XO0 A;  4ZVF A;  3J81 j;  4C6A A;  2YNH A;  5C42 B;  2AIR B;  2DGO A;  1Q8L A;  2JLE A;  3MI7 X;  4QW9 A;  3MR3 A;  2QTW A;  1FKP A;  2D74 B;  4CRJ A;  1EZZ B;  5CHC B;  3VVU A;  3WX8 A;  5DDP C;  1GTE A;  3T9N A;  3J7Z 5;  2FUG 9;  4DR4 J;  5RUB A;  3PZP A;  3TO8 A;  1PJ7 A;  2DH9 A;  2J0S D;  3VGS A;  5MLC V;  2BJ9 A;  3QGP A;  4U7U K;  1VI7 A;  3KHL A;  3MR7 A;  3ITH B;  3QWP A;  2ZH1 A;  1J5E F;  3KG1 A;  3NMA A;  3JQK A;  1OYE A;  1TP7 A;  1MN9 A;  1WHV A;  5DG9 A;  1VQL S;  5L8R C;  5KFT A;  2XEX A;  3M32 B;  2ZKU A;  3UCG A;  5EN1 A;  3G2X A;  2R8K A;  1FRI A;  5G0R A;  4RPF A;  5KFH A;  4PXE A;  1SJ4 P;  4HH1 A;  2W01 A;  4WYW A;  3TR5 A;  4ECY A;  4MAK A;  1NM2 A;  2FYX A;  2XY6 A;  5CAA A;  3MM6 A;  3BBB A;  2LCW A;  2VFR A;  2X1B A;  2IYI A;  3IR6 B;  3PYF A;  3TZW A;  3HDS A;  2J6S A;  3H5U A;  3OR2 A;  4YY3 J;  2YWW A;  2HQI A;  2ZBQ A;  1ZZF A;  3A3P B;  1X4E A;  3IA0 A;  3QLH B;  4H4M B;  2W2M P;  2DIU A;  4LQ9 A;  4IDK B;  3MMA A;  3KNG A;  4WE1 B;  1U1K A;  2HBQ B;  2N82 B;  1JLQ B;  1RTJ A;  1CC7 A;  3KWM A;  5E0O A;  4HHH A;  1HBM A;  4V19 X;  2NZC A;  4NA1 A;  1UAW A;  4Z7C A;  2DCU B;  1V6H A;  2CQ3 A;  5D4L A;  1VQS A;  4DCO B;  2JC1 A;  4U7C A;  1NK0 A;  3N79 A;  2BDP A;  1AYE A;  5KOW A;  2ZBR A;  1S6U A;  4DSK A;  1FES A;  1X7V A;  4TYA A;  1T0T V;  2XHC A;  5C7P A;  1SPB P;  2GVZ A;  2M9K A;  2B7C B;  1D0E A;  5J1P A;  3HM9 A;  2I5J B;  1D9F A;  2GO8 A;  3KG0 A;  4X64 J;  1FKO B;  3BS9 A;  5D0E A;  3CD6 S;  2DRD A;  3V6D B;  2MLX A;  5GAE I;  4LF8 F;  5CYQ A;  3W5X A;  1A9N B;  1G3O A;  1J5O B;  1HBO A;  5DET A;  1X5S A;  1F5C A;  3HCX A;  3WHI A;  2H5J B;  4X4V A;  1FWP A;  2VDI A;  2Y1L B;  3QID A;  1Q5V A;  4KH1 B;  4PXB A;  4HI2 A;  2ZHA A;  1FVQ A;  2ZHO A;  2QLW A;  1KVJ A;  2OEL A;  3I0S A;  1KQS R;  4E98 A;  3HPO A;  1TUG B;  1X4F A;  2Z2Z A;  4FDF A;  2MZJ A;  4Q2L A;  5AXM A;  3W62 A;  3EVO A;  3I6P A;  3LQV A;  4LF5 J;  4H4K A;  3US5 A;  4DBQ A;  2MQL A;  2XHW A;  2FDN A;  4DR3 F;  1RB0 A;  5BYS A;  1HL6 A;  3SEO A;  4J9P A;  4K2X A;  3BPD A;  2JVR A;  3G9C A;  4C8Z A;  2IM0 A;  3N5B A;  1NXI A;  1T9T A;  4PR6 A;  2GIR A;  2ASL A;  2WVC A;  3WX4 A;  4ATN A;  2XMK A;  2HHT A;  1M1H A;  2DR7 A;  1AW0 A;  1IKY B;  1C4C A;  1WTF A;  5E5N A;  1X0P A;  4RW6 A;  3MED A;  3PYE A;  4NYO A;  2V4Q A;  1B0V A;  3DI6 A;  1NB7 A;  4DQQ A;  1M90 T;  2EBE A;  3ZTR A;  3HVR A;  2W4C A;  3T1A A;  1HQE A;  2WTF A;  4QPX A;  5KT6 A;  1RAE B;  4DR7 J;  2HMI A;  2LEB A;  3I9Z A;  3VF0 B;  5F41 A;  2C2E A;  2NR0 A;  4LFB J;  1AUS L;  2L9D A;  4FPR A;  4TYB A;  1XJW B;  2VBW A;  3MR2 A;  2ZH8 A;  3FBB A;  3CCL S;  2XNQ A;  2YH1 A;  2V8G A;  1VBZ A;  1HNX J;  4JYA F;  1G4C A;  4WFY A;  2KVI A;  2BJ7 A;  4ZP6 A;  5GAG I;  4FF1 A;  1HW9 A;  1RWM B;  2VFV A;  4LF6 J;  4O3P A;  1W25 A;  3H0P A;  3LP1 B;  4Y2I A;  5LM7 E;  2HZV A;  2Q43 A;  3GV7 B;  1FO1 A;  2R4F A;  4F25 A;  5MAO A;  4CO5 A;  1WC0 A;  1Q16 B;  2CJQ A;  1F2G A;  3F41 A;  3KTQ A;  3P5T L;  3MMJ A;  2D1C A;  2Z8Q A;  2ZC3 A;  1CSJ A;  3AB4 B;  3O5T B;  1LKZ A;  4OJ1 A;  3SSR A;  4CO4 A;  4FS2 A;  2HVD A;  4J9V A;  1SVD A;  2DRA A;  1XMQ F;  2MZS A;  2BW2 A;  1NAQ A;  1U1O A;  1OQ6 A;  4OX9 F;  2A2C A;  2X1G A;  4ENO A;  5DQG A;  2VHG A;  2QL7 B;  4U96 A;  1F2H A;  1JJ2 R;  4F02 A;  5A0Y A;  4DU7 A;  2FVC A;  2B8P A;  3HO1 A;  2B8Q A;  2XSJ B;  1GFW B;  2QA4 G;  3OLA A;  2RS2 A;  1RU1 A;  4P9S A;  3WC2 A;  4MK7 A;  4Q0B A;  1WDT A;  1JXL A;  4UQG A;  1W2B R;  2RRN A;  1RBL A;  2ZBI A;  4JI5 F;  1QD1 A;  1RHR B;  4CM0 A;  5HMW A;  4DUZ J;  3DU5 A;  4TLR A;  1HHQ A;  1EKS A;  2IMO A;  2X3G A;  4DX6 A;  3OXG A;  4DV2 J;  2JEG A;  1JJH A;  2EC0 A;  1UKU A;  1S1W B;  2E5J A;  5M2R A;  2YWF A;  1HLW A;  2RF2 B;  4DCP B;  3W61 A;  4K4U A;  3JSM B;  2E1P A;  1R0B G;  2YQ1 A;  2GFF A;  1PSD A;  3MEE B;  3BR9 A;  3CTR A;  4DS5 A;  1XWL A;  3NG8 A;  5B0F A;  1S9F A;  3QT7 A;  5HI7 A;  3NWG A;  1FFW B;  4WPA A;  4NLY A;  2D41 A;  2N4C A;  5G0R B;  1AA1 B;  2BQ3 A;  1GTH A;  4ECV A;  3CCU S;  3AA9 A;  4ZVR B;  3HK2 A;  2BAB A;  2CDQ A;  4OI1 A;  4TU9 A;  3UDE A;  2D9O A;  1U1Q A;  1C0U A;  4M5J A;  5T14 A;  2C22 A;  3T5H A;  2HZA A;  5F8M A;  2HRT A;  2LA6 A;  4FNI A;  2AJ2 A;  3CJK A;  1OY9 A;  4MYU A;  1TVR A;  4KFB A;  3EGZ A;  3MM8 A;  1KLM A;  1N33 J;  2CJX B;  2ROG A;  1F60 B;  2KL8 A;  2HRU A;  2FC9 A;  3IBC B;  4P7V A;  4UOF A;  2H1Y A;  3ILL A;  3C6U B;  3OXF A;  3ZNU A;  3V4I A;  4ELU A;  5JVG Q;  2XO7 A;  2X1F A;  4HHJ A;  2W2P P;  3P6Y C;  1MSW D;  3SDE B;  2DNR A;  1MMD A;  5CA5 A;  3TJ8 A;  1IVZ A;  1HBU A;  2MQO A;  1N54 B;  1NJZ A;  4KHP J;  2AYE A;  1GAO A;  3TUZ C;  4NA3 A;  5DQI A;  3TRG A;  1VQK S;  4DCJ B;  1R8H A;  2DNQ A;  2GCF A;  3TJ9 A;  2LVW A;  4RUB A;  4ED1 A;  1SJ3 P;  1ZTW A;  3CD0 A;  3LH2 S;  4UUX A;  3VQS A;  4ZVS B;  3W65 A;  2ZM6 F;  3V2U C;  3D1Q A;  3IGV A;  1N5Y A;  2HFZ A;  4PUO A;  4NXM J;  1JLB B;  1RAO A;  4IKA A;  3PX6 A;  1S0N A;  5I3U B;  1VLO A;  5ETK A;  3CDU A;  3NLC A;  4RW4 B;  3UNG C;  1FJG J;  3RW6 A;  2OO4 A;  2DR6 A;  3PX0 A;  1DUR A;  1CJT B;  1HHT P;  1UW4 A;  5GMK a;  5K14 B;  1VQ7 S;  3O3L A;  3D66 A;  1QUV A;  1Y7P A;  3CJR A;  3TEH B;  5A8K A;  2QSF A;  4UOG A;  3HD1 A;  4JI6 J;  3VAK A;  2M70 A;  4Z2X A;  1RCX B;  2ZZM A;  2VJV A;  1S79 A;  4ZHR B;  5HP1 A;  4GKK F;  1T9V A;  2OAU A;  4EBC A;  2C2K B;  2DHA A;  3DLK B;  5D6G A;  1H7W A;  2DRB A;  2UP1 A;  4DV1 J;  4IR1 A;  5IV3 A;  1TL3 A;  3HSZ A;  4KHR A;  5KFW A;  4F2S A;  2IIH A;  2FB0 A;  2K1R A;  3MPY A;  5HMY A;  2NUU G;  1P1T A;  4CLT A;  1EET B;  1LWE A;  3H4B A;  1TAQ A;  1WDD A;  3CSK A;  5T7L B;  3K57 A;  2R8G A;  4PKD B;  2W1B A;  4DXL A;  2IMW P;  3UDC A;  1HQE B;  1CJT A;  3QAU A;  3ENQ A;  4H4M A;  4OI6 A;  3UFC X;  1RKI A;  3GJQ B;  3UQS A;  3QBC A;  4QU7 A;  1AT1 B;  2MZR A;  2ZDP A;  2M52 A;  2WAQ D;  3GB0 A;  4IR9 A;  1UVK A;  2FZC B;  2CIM A;  2CPI A;  2FHO B;  3EXY A;  3MWB A;  2QL5 B;  3AA8 A;  3R5J B;  1DQ8 A;  3VAF A;  3DHW C;  3VAL A;  4WJB A;  4RNM A;  1PAE X;  2YNG A;  3OHA A;  3LPY A;  1UJ4 A;  1RAG B;  4GRS A;  4WTY A;  4NRT A;  4WZQ A;  1CQN A;  3HHL A;  4P7T A;  2RDJ A;  2CQI A;  3ZZR A;  4JI1 F;  4O4G B;  3H2U B;  3GZ7 A;  4HAC A;  1V3S A;  2ALZ A;  2OFH X;  2OEM A;  2ZBC A;  3WBZ A;  4ILL A;  1S1U B;  2DB1 A;  2KHC A;  3KUE A;  2A0F B;  2O66 A;  4RW7 A;  1QE1 B;  5KFI A;  4Q43 A;  3T5L A;  4LFC F;  3PO4 A;  1CUL A;  1FD8 A;  2MMY A;  1OIA A;  2J0Q D;  3DM2 A;  1RUS A;  3G6V A;  3EPG A;  1PGZ A;  2XNR A;  1S77 D;  4OV1 A;  4J9K A;  4LSZ B;  2C2M B;  4NA2 A;  2QV6 A;  3LAK A;  3N9U C;  3F56 A;  1C1C B;  5KFY A;  9ATC B;  3KNA A;  2QMX A;  4OIX A;  4J9R A;  2DPJ A;  4AE5 A;  5LMU J;  2JRS A;  1OYD A;  1K8A T;  3GON A;  3MCM A;  4X4S A;  2YKN B;  4F67 A;  2AX1 A;  3M4X A;  1PBU A;  4ECR A;  5DM7 Q;  2LMI A;  4NL5 A;  3UI3 A;  1EAR A;  1Q95 G;  1MW7 A;  1NPP A;  3MD3 A;  1RU2 A;  3NCR A;  3RRK A;  4EMD A;  2W9C B;  4HKQ A;  2HHQ A;  2KVQ E;  1S72 S;  2YNF B;  5KFV A;  3L3C A;  4PG8 A;  1JKH B;  3GG0 A;  1RHQ B;  1RBO B;  4HI1 A;  1K1S A;  3P96 A;  1RGV A;  2RAQ A;  2ACY A;  2Z57 B;  3N4W A;  2F8M A;  2Z58 B;  4NYZ A;  1FTR A;  3QT6 A;  3MPU B;  2IAJ B;  1KKH A;  3QAT A;  4UOH A;  4E2F B;  1Y00 A;  3HKZ D;  4KO0 A;  2X1A A;  1P8G A;  3QLH A;  3BM7 A;  3D0G E;  4GMK A;  2MKK A;  3VAJ A;  1T05 A;  1UZH A;  4X65 F;  2OHD A;  4YR2 A;  4ECZ A;  1FK9 A;  2NPF A;  2ZOG A;  4ZPC A;  2WSF C;  1K44 A;  4CLP A;  3QT8 A;  4Y34 A;  2BJE A;  5KFG A;  3R8Y A;  2R7X A;  3HVA A;  4LSL A;  5KFU A;  2POK A;  3QSI A;  4X4P A;  3OVS A;  1N36 F;  3H2V E;  4Y28 C;  3ZZ0 A;  4DV7 F;  1VIO A;  3PCO B;  4MIW A;  4DX5 A;  2YKM B;  1D8Y A;  2WVF A;  3DFE A;  1HI0 P;  4DV3 F;  3IFE A;  4MIB A;  4F8R A;  4S0M A;  4RBT A;  1WOS A;  2YNF A;  4Y2M A;  1Q82 T;  2COL A;  2L9W A;  3MZI A;  3K5M A;  3KJF B;  4UF4 A;  5A2Q U;  3KHR A;  4X4O A;  3OD2 A;  4IFY A;  2DHH A;  4DG1 A;  4USW A;  2GAG C;  4Z37 A;  4QIV A;  3T41 A;  4YP3 A;  1VCT A;  1S5Z A;  2PFD A;  4ZOS A;  1SJF A;  1Q81 T;  3PRD A;  1SH2 A;  4ZPW R;  4JUZ A;  3DLL Q;  4IRC A;  4FXW A;  2ZH9 A;  3RB6 A;  5E3P A;  2ZE2 B;  4EI2 A;  1QSY A;  2DNM A;  1X4C A;  2XYH B;  3M1V B;  8RUC A;  2G1D A;  1NJY A;  1OO0 B;  2QFI A;  4BWM A;  3N6M A;  3GIM A;  3DLE B;  4OX7 A;  2DGU A;  4KGV B;  2IA0 A;  1KHW A;  2AT1 B;  2VBY A;  1KR4 A;  4NLQ A;  3GR1 A;  2FY8 A;  3K2Y A;  3W9I A;  1ULR A;  1X5P A;  1AUD A;  4NLX A;  2CJA A;  2YPZ A;  4FYV B;  1JXE A;  3UPF A;  2FJX A;  3K5L A;  3LPE A;  1N32 J;  3CC4 S;  1S49 A;  1FE0 A;  1FEE A;  1UL3 A;  3IXQ A;  1GX5 A;  2UVU A;  5K8P A;  3K59 A;  4U6P A;  2YX1 A;  4C8Y A;  4MTP A;  3TA1 A;  3D28 A;  1BQX A;  1RT3 A;  2HSE B;  4TY9 A;  4CLW A;  4F4X A;  2YNH B;  5C42 A;  4K5S A;  2EFG A;  3FMB A;  2MY8 A;  3FZ2 A;  3G82 A;  2DR5 A;  3OJU A;  1FI4 A;  2E44 A;  3HF5 A;  1EJ7 L;  1WI8 A;  4R0J A;  1RWU A;  4TQS A;  1N34 F;  2DNY A;  2E1R A;  1XMB A;  2R2U A;  2FJW A;  2IVF B;  4DR2 J;  1HD1 A;  2N7Y A;  5L46 A;  3U02 A;  3HHN B;  1EKR A;  2A6M A;  4NWB A;  4URQ U;  4NXN F;  5AE1 A;  5EDW A;  1ZZN A;  1X5O A;  4OQJ A;  1UVJ A;  1E6Y A;  2HGN A;  3CWJ A;  4O23 A;  2JEI A;  2V2V A;  4USK A;  1S1V B;  3TUP A;  3T1Y J;  1IM6 A;  3AD9 C;  4K4Y A;  2XGP A;  5M2P A;  1VRT A;  1JLQ A;  1RTJ B;  2ZDO A;  4PG6 A;  5CH7 B;  4DI6 A;  5JVH Q;  2M2B A;  4KGM A;  5DG8 A;  2BOA A;  4DL3 A;  5HAN A;  1TU0 B;  2F8E X;  2EEY A;  4F7V A;  5C24 B;  4AQY J;  3B4D A;  1KS2 A;  3BDE A;  1U48 A;  3U27 A;  2GML A;  5IQ6 A;  2UXD J;  2J7W A;  1YJ9 S;  1L3K A;  1S57 A;  3D0H E;  3IGN A;  3F0N A;  4KH0 B;  2NXU A;  3MTJ A;  5F3T A;  1H0H B;  1RK8 A;  5L9X A;  4DR1 J;  1IKX B;  3LOU A;  1JJ4 A;  1S4E A;  5LMN J;  3TAP A;  2KM8 B;  4JV1 A;  4IUF A;  3V81 B;  3JS9 A;  1I6J A;  3LAN A;  4LRF A;  1KHV A;  2BQR A;  3G86 A;  3HHD A;  3CCR S;  1N0V C;  3AQP A;  2F4F A;  3K5P A;  5J1E B;  3QRR A;  1ZAX A;  1PYS B;  4JI3 F;  1X4D A;  2HNY A;  4WTO B;  4ID5 A;  2Z2L A;  2W7O A;  2JFK A;  2GIQ A;  3CC7 S;  1FTC A;  5C24 A;  4JI2 F;  3OFH A;  3LTO A;  3M8Q A;  3MM8 B;  1ZBT A;  5GVQ A;  1BWE A;  1LW2 B;  2YPY A;  2ZOM A;  4HVZ A;  2ZFH A;  2FZG B;  1I3O B;  1Q5Y A;  1RTI B;  2YWK A;  3B8H A;  2HVZ A;  3MEC A;  1N5T A;  3DRX A;  3NP5 A;  4IQM A;  5KFO A;  2E7X A;  3PR4 A;  3I5B A;  5KFX A;  2VQF F;  3SZ2 A;  2HHH J;  4ZVQ B;  2VPW B;  1RT5 A;  2HIY A;  2OPQ A;  3VTI A;  4A8Y A;  3EDQ B;  3R5G A;  1WWH A;  4DR6 F;  1UPP A;  4MKB A;  1KEK A;  2KH9 A;  4K8R A;  1LWC A;  1YZ7 A;  3D3B J;  2UUB F;  3C8Y A;  2BOP A;  4C8L A;  4OZJ A;  4DF8 A;  2VQE J;  3M8P A;  2F4V F;  4PAB A;  1RP5 A;  4NCG B;  4BDP A;  1LXJ A;  1LWE B;  3EIC A;  2F3J A;  2QLB B;  2QYC A;  3C19 A;  2W4D A;  5CD4 A;  2VU5 A;  1U1L A;  4M95 A;  4LF4 J;  3X3U A;  2K3I A;  3CDW A;  4YEA A;  4CWB A;  4O44 A;  3GLJ A;  2DO0 A;  1FX4 A;  3POT B;  5A8W A;  2OSR A;  4KAI A;  2HWH A;  4OZ1 A;  1FDD A;  4O3Q A;  2KG0 A;  3KLI B;  4I2P B;  2AGP A;  2C3U A;  3DYA B;  3J7Z T;  1OPZ A;  2DXF A;  1JLC A;  4R5P A;  4J9S A;  4DPW A;  2OTL S;  5KFR A;  1QUP A;  5J2M A;  2CPX A;  2P6S A;  1JNZ B;  3GYX B;  3BO2 A;  1JX4 A;  3PG9 A;  2NLW A;  1ZA2 B;  4C11 B;  3MM7 A;  3GSD A;  2K06 A;  1GNK A;  3VZI A;  5H1S V;  1IN0 A;  1D8Z A;  4NOH A;  2VV5 A;  5C5J A;  1X4G A;  3QO9 A;  3GIJ A;  2NSC A;  5J2Q B;  5HLF A;  1RTH A;  1XK8 A;  4OX6 A;  4NAS A;  2OIH A;  1P27 B;  3W2V B;  2CWX A;  4GKJ F;  4FYY B;  3IMQ J;  1N5Q A;  3EGN A;  1IKW A;  4RJV A;  4J9L A;  1CS4 A;  1YWX A;  2ZJP Q;  4F4W A;  1UA0 A;  2JLF A;  3CJ5 A;  2QGF B;  3MUR P;  4YDD B;  1IR0 A;  4N76 A;  5CZV A;  1NO8 A;  4A8F A;  1OS5 A;  2GNK A;  4QR1 A;  5B0G A;  5CYM A;  2EK1 A;  3R1H A;  3D0I E;  3I96 A;  4B3T F;  2C2D A;  4EZ9 A;  3MMB B;  2CQ1 A;  4NI2 B;  3SV3 A;  2HYI B;  3I32 A;  2WW4 A;  1YRU A;  1U0S A;  2NXC A;  4PXC A;  1MRO B;  4CT9 A;  3KJV B;  1REV B;  1SC3 B;  2P5V A;  3MUV P;  1GMU A;  4RW9 B;  3E01 A;  4KV8 A;  1KP6 A;  3PFE A;  2OGU A;  1VQ8 S;  4EEY A;  3M2V B;  4KBI A;  3SI8 A;  1L5U A;  7AT1 B;  5FLX U;  2IYG A;  2JNJ A;  2X3D A;  2GHV C;  2EFQ A;  2LEP A;  3C14 A;  2OFG X;  5E7O B;  2J9D E;  1F1B B;  1RWW B;  3FVY A;  3ZTQ A;  3GV8 B;  4DS4 A;  2M7S A;  3TAR A;  1IKW B;  1RHK B;  1Z2L A;  2HAI A;  1Y4Z B;  1RT6 B;  1Y3K A;  3A3N B;  4KO0 B;  4U9R A;  1JLC B;  4LJM A;  4B3M J;  3SCJ E;  1TL4 A;  3CVK A;  1HNW F;  3KUH A;  4CLF A;  2FHJ D;  4Y0F A;  3M8S A;  2BAN B;  1R6V A;  2PSZ A;  1VK3 A;  1Y5I B;  1SC6 A;  2FIU A;  2N3L A;  3QPI A;  2Q3P A;  5D78 A;  2R42 A;  3CCM S;  4B9S A;  1A6L A;  3I0R A;  2BMB A;  1B3T A;  5HJX A;  3QSY B;  4HL9 A;  4NEZ A;  3I9V 9;  2DEJ A;  1VIX A;  2IAJ A;  1TQL A;  3KUG A;  4J9N A;  2KDO A;  3AD7 C;  1WC3 A;  4X4R A;  1Y11 A;  2KZZ A;  1F9F A;  2FJA B;  2CZV C;  2DJW A;  3FJ2 A;  2MQP A;  3DRR A;  2CXE A;  1E6V A;  3WIU A;  3Q24 A;  1IBK F;  1BMQ B;  2GGP A;  3TA2 A;  1RWO B;  4IFV B;  1IJF B;  2W9C A;  4CO1 A;  2DY9 A;  1CVJ A;  4DJB A;  2E29 A;  3I4P A;  1F9E B;  1GMW A;  2FLP A;  1I5O B;  3FEZ A;  3PHT A;  4NEY A;  2GW8 A;  3VCD A;  5C2C A;  4P74 A;  2KXF A;  4K0K J;  4PG5 A;  2AEJ A;  2RHS B;  3HVT B;  3M6X A;  1Q1K A;  4EK2 A;  1T8E A;  5F8N A;  2FGC A;  3NGT A;  4Z7Y A;  3QIP B;  4LQ3 A;  1WC5 A;  2V2Q A;  1LW0 B;  3A8E A;  4KQZ A;  3TAQ A;  1WC4 A;  2NCK L;  2RDD A;  1DTQ A;  3KXD A;  3M05 A;  4C3L A;  5KOX A;  5I4M A;  3RB3 A;  1GXU A;  3BH6 B;  3D1H A;  1ZS6 A;  3WIV A;  5EWE A;  3MEK A;  4DX7 A;  1BLU A;  3R27 A;  2QSW A;  2XMJ A;  1RSC A;  4FKY A;  4F36 A;  4Q5V A;  4FNH A;  4JI4 F;  1UVI A;  1W26 A;  3A3O B;  1VR6 A;  2V69 A;  2XUL A;  2DGT A;  3DLJ A;  3RYL A;  3UDV A;  1WTB A;  2GHW A;  3FSX A;  3M1V A;  2ASJ A;  2J6U A;  4ID5 B;  3NKY A;  4FKX A;  5IV4 A;  2ZVS A;  1FJC A;  3DLE A;  3CMQ A;  5DGB A;  4DZ6 A;  3K58 A;  3BQ2 A;  2DIV A;  4WFB Q;  1RTI A;  4MK9 A;  2WVD A;  2N7C A;  5CQG A;  2D9P A;  4DG1 B;  4NLG A;  5HBM B;  2YVS A;  3OR2 B;  3W5Y A;  1U49 A;  1YK9 A;  3BKT A;  4ZP8 A;  5C2G A;  3CNQ P;  4NYP A;  3DLH A;  1LEO A;  1CJK B;  3SCL E;  4P10 A;  4FYD A;  3HZG A;  1WOR A;  4LRD A;  5I42 B;  2NXJ A;  5E3C A;  4ZVG A;  5L39 A;  3OV7 A;  3J7A N;  3JSB A;  4ZHR A;  1Q7L B;  1X60 A;  1YX2 A;  3GWC A;  4HLB A;  4JOU A;  4KKO B;  4CLY A;  2DH8 A;  3QRQ A;  3P5B P;  1WEY A;  4OX8 A;  3ZZT A;  3IWX A;  4KGK A;  2DR9 A;  1RLC L;  2NXN A;  3CJ3 A;  1FRJ A;  4I7F B;  2J0W A;  1Q7Y T;  1SQG A;  2HG4 A;  2XZT B;  2YNI B;  1RHM B;  4I68 A;  1RQ0 A;  3MPW A;  3WQP A;  5EWF A;  1PYT A;  3PJX A;  5HRO B;  2SXL A;  4DV2 F;  4UZB A;  2HHX A;  1Q8B A;  1V5V A;  3OT9 A;  4K4W A;  1Y5N B;  2MKY A;  3FSY A;  1R27 B;  5KG6 A;  4DFJ A;  2KTQ A;  2ZNY A;  3DRS A;  3R5C A;  3UN5 A;  4RW6 B;  2PA3 A;  2PA8 D;  5DS7 A;  3TW0 A;  1VQY A;  4DUT A;  3JAM Y;  1S1V A;  2MKI A;  3EZO A;  5HJY A;  3BO4 A;  4I2Q A;  3PO5 A;  3KK1 A;  1ACM B;  2AF6 A;  2E7W A;  2GJ2 A;  1IM4 A;  5HAO A;  3ISZ A;  4QWB A;  3SBM A;  3BSN A;  2E9T A;  5D8H B;  2R8I A;  3VWS A;  4ZLL A;  3G8S A;  4ICL A;  5A76 A;  5DDQ C;  4LF8 J;  1FEH A;  3ENA A;  3MOJ B;  2Z2M A;  4ZP7 A;  3TEG A;  2YKN A;  3KHH A;  5DM6 Q;  1RT3 B;  2ZNZ A;  2HFO A;  3VV2 B;  2XCP A;  4BBY A;  1FDB A;  4UW2 A;  1IBL F;  1KWM A;  1YDL A;  2WVE A;  3OVB A;  3LW5 C;  1D9A A;  2DNZ A;  2EXU A;  3R6L B;  2VPZ B;  1TKZ A;  4LRE A;  2RNE A;  1FXR A;  2WHO A;  3QZ7 A;  2HHP A;  1S1X A;  2R2R A;  4F04 B;  1RZM A;  1OMS A;  3DGP A;  2DNP A;  2OJ3 A;  1U02 A;  2F63 A;  2PEH A;  4DR3 J;  4B9M A;  1MLA A;  4L3N A;  1VS3 A;  3HT3 A;  2V34 A;  1MML A;  2FGO A;  4OZ2 A;  2J8S A;  2V6A A;  2Y0S D;  4WYL A;  2CDR B;  4B02 A;  2AP6 A;  1HBU B;  1TKD A;  2J7K A;  4L3K A;  1CQM A;  4ZA1 A;  4BHQ A;  4QJV A;  4YS2 A;  1IKY A;  4I69 A;  1B7F A;  2V9K A;  1O8B A;  1H2T Z;  3J80 Y;  3KLE A;  2PFF B;  4QYZ J;  4M5D B;  2OMO A;  4ZJL A;  3UVJ B;  3VZH A;  4M5L A;  5KFQ A;  1EP4 A;  3T6J A;  1NKC A;  2F5G A;  2ASY A;  2QN6 B;  1QTM A;  1DTT A;  4J9M A;  2A6O A;  2DBB A;  4NCA A;  4M63 A;  1S1X B;  2Z0G A;  1UW9 A;  4F4Y A;  1QSL A;  3S6E A;  3UD4 P;  5T41 A;  2MZT A;  4RL1 A;  3KLV A;  1HNX F;  4KTQ A;  4JYA J;  5J2N A;  2CKW A;  5HQM A;  4LF6 F;  3G96 A;  1U7L A;  3QO9 B;  4PG7 A;  3R97 A;  5A0Y B;  4YR0 A;  4JI8 J;  2AJF E;  3TX0 A;  2ADC A;  5HP1 B;  3L95 X;  2WVB A;  5AJ3 F;  2CG8 A;  3H2L A;  3RZA A;  2W2O P;  1VMB A;  1MU2 B;  5J2M B;  1HPZ A;  2WSC C;  3HSD A;  2V0N A;  1VJQ A;  2VG7 A;  4JV2 A;  5DQH A;  5IM0 A;  3TNV A;  2ZD1 A;  1JNR B;  3OLB A;  3F73 A;  1O5J A;  2C2Z B;  2F7V A;  2DXD A;  2XO6 A;  4B3R F;  4K59 A;  4ZVT B;  2NS1 B;  2CJK A;  3ZNJ 1;  3PRB A;  4YB1 P;  2K3K A;  1VGY A;  3R7B B;  4IO1 A;  4ZJO A;  4YB6 A;  3LGN A;  1S10 A;  4K4S A;  5B0E A;  3TVZ A;  3ZTP A;  1XMQ J;  3OTE A;  5D4O A;  3HP6 A;  2LQ8 A;  1JLG B;  1FXD A;  1D1U A;  2LA4 A;  2XMV A;  1PG5 B;  3CCZ A;  3KLE B;  4DL4 A;  3G82 B;  1S76 D;  3AOB A;  1TMJ A;  2G1H A;  2GHP A;  4WP3 A;  3MFH A;  4QWE A;  2H9Z A;  4CTA A;  3CJ8 A;  3C6U A;  4UQT A;  3TA0 A;  4O4G A;  4YQW A;  2DNO A;  4F3Q A;  1XR7 A;  2B4O A;  3NCP A;  3DC2 A;  3ONQ A;  2P9E A;  1S1U A;  4ZP9 A;  1KLM B;  2IRU A;  1WKK A;  4CH7 A;  4JI0 F;  1TFY A;  4OJ3 A;  4PWD A;  5DDO C;  1RWV B;  2RJZ A;  5HL7 Q;  2NUH A;  3H90 A;  1SI9 A;  3QAE A;  1DLO A;  3ITH A;  3SDE A;  1GXL A;  2JX2 A;  3OXL A;  4LFA F;  3V6H A;  2FY1 A;  3JYT A;  1TMM A;  3HHL C;  5KFC A;  1NK6 A;  1RTD A;  4ED4 A;  1XQI A;  2WBR A;  4ZVH A;  1HQU B;  1NDL A;  1TKX A;  5FDL A;  2AYM A;  5IT0 A;  1PCA A;  1F6T A;  1NJX A;  3MMC A;  1YJT A;  4TQR A;  2BR0 A;  1UZD A;  3GSI A;  3FFI A;  2CJY B;  2OLW A;  1T9W A;  2ATC B;  1T9Y A;  3NGU A;  3OVA A;  5IT9 Y;  1ARO P;  1YIJ S;  1HMV B;  3GIR A;  3OFE A;  2U1A A;  3VAG A;  2MYF A;  1KQF B;  4EFA C;  1TL3 B;  5LSO A;  1QM9 A;  2LXI A;  1OY8 A;  2GA7 A;  2PI4 A;  2J9C A;  3M8R A;  3DRS B;  1JLG A;  2K1R B;  3VAH A;  1RLD A;  3AHP A;  2IM3 A;  4CP5 A;  2K7J A;  6FD1 A;  1X4B A;  2HHV A;  3CW2 C;  3GFX A;  4DF4 A;  4GC6 A;  4URS A;  4I4B A;  2HEK A;  1HNV A;  1JIH A;  3DLK A;  4UOC A;  2HS4 A;  4YB5 A;  2YBV A;  3UCZ P;  1YTY A;  3C15 B;  3OFG A;  2IC3 B;  5ETL A;  1RT2 B;  1NDC A;  1S9E B;  1XTZ A;  1VJW A;  2H48 B;  2K7K A;  2UUA J;  3E3X A;  2CPZ A;  2DNH A;  3HHE A;  3MGJ A;  4J9Q A;  4LT6 A;  4RW4 A;  3NBP B;  1FJE B;  2RIJ A;  4IDK A;  4WE1 A;  1N5S A;  4CNZ A;  2C3Y A;  3EUN A;  1HFE L;  4ZN1 A;  1T03 B;  1RT5 B;  2VAS A;  2AGO A;  1GQE A;  2DGW A;  4TVA B;  4GKK J;  3B4M A;  2C2O B;  3CDB A;  1HKA A;  2RUG A;  4QIE A;  1HNZ F;  2CQ2 A;  4LF7 F;  2Z4P A;  1OPI A;  2NYI A;  2QYG A;  3RG6 A;  2AU0 A;  2R8H A;  1T94 A;  5HVH A;  3VHQ A;  3R5B A;  4GVB B;  3DLG B;  1IUJ A;  2KXH A;  3PDN A;  4ANC A;  3TAM B;  1HW8 A;  1SL1 A;  3J81 U;  4G1Q B;  1PBA A;  1FNM A;  1EHW A;  2MPU A;  3C6T B;  3HD2 A;  2IJF A;  4R8U B;  1JLA B;  2LKZ A;  2QA4 S;  1TEL A;  3Q2S C;  3P49 B;  2RVJ A;  2HFU A;  3A13 A;  3MUT P;  1S0V A;  3NMR A;  1VBK A;  2QC3 A;  3K8V A;  1R3N A;  4OHX A;  4XDD A;  3UVJ A;  3D2W A;  2MKS A;  4CLU A;  4QYZ K;  4WKR A;  2JC0 A;  3HHL B;  3MED B;  4KGX B;  2WZ1 A;  1IR1 A;  3KKF A;  2HHS A;  2MJN A;  2HK2 A;  4OHW A;  5JMN A;  3AXK A;  2VA2 A;  4GO5 X;  1WC6 A;  3FEY B;  1TK0 A;  3HHL D;  1DBD A;  4ZLJ A;  2PII A;  3CO9 A;  1X5T A;  4LF1 A;  1HA1 A;  5ITH A;  2PO4 A;  3UE2 A;  4B9U A;  5J1N A;  2L41 A;  3M30 B;  2RUS A;  3VAM A;  3H8Y A;  3BDP A;  4DFM A;  3MDF A;  4P72 A;  2B6A A;  1GEH A;  1Q8I A;  2ZBP A;  1SKS A;  3HVW A;  2KU7 A;  2LU2 A;  1YJN S;  1U6B A;  4Y2A A;  4A8X A;  2ZH4 A;  4ER8 A;  4RNN A;  1IWG A;  2VG5 B;  1ZM3 A;  5J2Q A;  1PC5 A;  4WBF A;  3TQE A;  1VRU B;  2CQ0 A;  5A2Q Y;  1QDU B;  1AZS B;  1SC1 B;  2KFN A;  2LQJ A;  3KDN A;  3C6T A;  4ZIT A;  2LQB A;  3W8P A;  5IQQ A;  5AE2 A;  2MZQ A;  4ZVE A;  3TAM A;  4RU9 A;  1ICE B;  1LQ9 A;  1SUQ B;  1WF0 A;  2AV5 A;  2FJD B;  2IDL A;  1KQK A;  2ZH5 A;  4K50 A;  2FJV A;  2O01 C;  2BW7 A;  1RT6 A;  1QVG R;  2AMC B;  4HT5 A;  4KY3 A;  2KN4 A;  3HFZ B;  3KK2 B;  4X62 F;  3V6J A;  2QZ8 A;  4Y00 A;  1HAR A;  2CWK A;  4P2M A;  1S6O A;  2JHE A;  5IWA F;  4F3M A;  2OEK A;  2AZ3 A;  3LAM A;  3QMQ A;  3I0R B;  3RAQ A;  2NSB A;  1Q4R A;  3ILJ A;  1VC6 A;  2UUC J;  3E8O A;  3TZZ A;  1UFW A;  1SKR A;  3CUL A;  1YKW A;  2Y3Y A;  1ZPV A;  2QX0 A;  4V19 J;  3G8Q A;  1N36 J;  3ILI A;  2XCA A;  5LSL A;  2QL9 B;  5B0C A;  4PRF A;  3OL7 A;  2BX6 A;  3QT5 A;  4C8M A;  4CLS A;  5CAB A;  3BQ0 A;  4DV3 J;  1LK7 A;  4USJ C;  3S7R A;  4DUY F;  5J2P B;  3NNA A;  1KN6 A;  4JB8 B;  4O3O A;  4DPY A;  1JJC B;  2RDI A;  3M8Q B;  2VOO A;  3CT9 A;  3NL0 A;  2ZHB A;  3JTN A;  4A46 A;  3K0J A;  3SYZ A;  1M5V C;  2YXL A;  3CF5 Q;  3T3F A;  2H51 B;  3EZ5 A;  2BAC A;  2VG6 A;  4A8W A;  5I3P A;  1YJW S;  3DI6 B;  3G87 A;  1TL7 B;  2P2C B;  1RTH B;  2X51 A;  2AYG A;  4IRD A;  4UY8 5;  1IJE B;  5EX3 A;  2AZ1 A;  3IO1 A;  3HSG A;  3IBF B;  2V2K A;  3U1L A;  4PPD A;  3D3C J;  1BY9 A;  4JBC A;  4M5H A;  2LLZ A;  4I64 A;  4UTG A;  5B09 A;  3A1Y G;  1D3W A;  3MM5 A;  3I5A A;  5LJ3 Y;  1I94 J;  1P1L A;  4O0N A;  4F3O A;  2UXD F;  2VC0 A;  2OPR A;  2DO4 A;  5D0R A;  1B64 A;  1YLX A;  3FBF A;  3N6L A;  2EC2 A;  5JJB A;  3ADA C;  2FLN A;  2DEI A;  3R5A A;  1P9Q C;  2YKP A;  3R9L A;  3P8B B;  2XLI A;  4KJI A;  1FRX A;  2GO9 A;  1ZOT A;  2HWT A;  3HFK A;  1D9D A;  4FF4 A;  1XNQ J;  1WEL A;  2BE2 A;  3C3L A;  3EGV A;  2DHS A;  1NND A;  1U6Z A;  2CG4 A;  3A8I A;  2HK3 A;  3ENV A;  1CLF A;  4CYU B;  4ANE A;  4NZ6 A;  1XIQ A;  2EK6 A;  2DGS A;  4MJK A;  3CJ2 A;  5LT5 A;  5GAD I;  3MFI A;  1TK5 A;  2HVI A;  1E6Y B;  3EVM A;  2XYP B;  1HWK A;  2XLK A;  1XR5 A;  1S4F A;  4IH7 A;  2G4B A;  5DO2 A;  2ZZT A;  3IM9 A;  5K14 A;  5KFB A;  1DRZ A;  2XTJ P;  3PKY A;  2PMW A;  1M5P C;  3NAI A;  3H7H B;  4DR2 F;  4KPY A;  2VFT A;  3S8S A;  4LUB A;  4NXN J;  2RQ4 A;  1CBK A;  2GC8 A;  1H7X A;  1U0H B;  3NNH A;  5L1K A;  1TL7 A;  3ISN D;  1M0S A;  1WG4 A;  2HIQ A;  1HWJ A;  2VG6 B;  1T03 A;  3RGI A;  1KOO A;  1TR0 A;  3JTP A;  2MB0 B;  2J6T A;  2WCX A;  2YWG A;  5F0U A;  1NHV A;  3MUM P;  1XMO F;  4RZR A;  2E5L F;  4B9N A;  5KG0 A;  1TFW A;  1N52 B;  2HND B;  3D6H B;  4PYD A;  2HVE A;  2VPY B;  5HSP A;  1HMV A;  2JDJ A;  1UEU A;  2L3M A;  1NSQ A;  1Z1Z A;  3NNC A;  1QJH A;  2OPR B;  3D6M B;  4DR1 F;  1NK5 A;  5LL6 d;  4M8L A;  5LMN F;  2W25 A;  1CG2 A;  2A1B A;  1VYA A;  2BBE A;  1UWA A;  2H5I B;  4Q7A A;  2AYB A;  2UVV A;  1RBA A;  4DSL A;  1FRM A;  2QIF A;  2MST A;  2FVS A;  4DX8 H;  4YB7 A;  3SFU A;  1SIW B;  3HUL A;  3JSY A;  3M2U A;  3MPV A;  4QQB A;  1RWN B;  4DV4 F;  1VQ5 S;  1RAJ A;  5KFA A;  4ZN3 A;  1HWI A;  3W63 A;  4FF3 A;  5HO4 A;  2E1C A;  4QPT A;  3EGW B;  3LP0 B;  2VBX A;  2B9E A;  2RQM A;  1TUW A;  2KXN B;  2V4J A;  5IXU A;  3QZ8 A;  1FNX H;  4JI2 J;  2P6T A;  1H74 A;  3L7O A;  2JVO A;  3RJM B;  3GIL A;  1X9M A;  1G7C B;  2UVR A;  4H4O B;  4C8N A;  3RRH A;  3BH7 B;  4I56 A;  3UD3 P;  3IWN C;  1FHT A;  3UN2 A;  1RAF B;  1FKP B;  3THT A;  2W8L A;  3I82 A;  2HHH F;  1S97 A;  4ED8 A;  3BO3 A;  1URN A;  3ZTO A;  1U1N A;  3BZQ A;  3EDR B;  1X8D A;  2FPH X;  2HWI A;  4JP8 A;  3W7B A;  4ZIW A;  2BEF A;  3AH6 A;  5KG1 A;  3FC9 A;  3EVW A;  3H20 A;  1ZAW A;  4ZIV A;  4K4X A;  2IM2 A;  1RYR A;  4ZCM A;  3OL6 A;  2VQE F;  7FD1 A;  2KG1 A;  2F4V J;  3HVT A;  1HI8 A;  1LXN A;  3KDO A;  4R5P B;  5BJR A;  4ECX A;  3P4U B;  4QWC A;  4K4V A;  2YX4 A;  3EE3 A;  2HLU A;  2RQC A;  4KRW A;  5F8L A;  2F9J A;  1XER A;  2V9W A;  1ZET A;  3IC1 A;  2J76 E;  4NPO A;  5JXS A;  3NEK A;  4DPU A;  1QAI A;  3DCA A;  4HH0 A;  4XPE A;  3H5Y A;  4MKV A;  2XYG B;  1BWV A;  3QGG A;  2CNO B;  4ZK7 M;  2ZOF A;  2V4R A;  4ZPT R;  3GJS B;  1N6Q B;  4GVL A;  1H3D A;  4J90 A;  5G4D A;  1BQN B;  3FRY A;  3I5C A;  3K5O A;  2VJU A;  4EO8 A;  2CUY A;  2BM1 A;  1DJ0 A;  3EWG A;  3O44 A;  1K47 A;  3LP1 A;  1KQG B;  3IR5 B;  5LXY A;  5AT1 B;  1SKW A;  1U2C A;  3MHY A;  1WOP A;  2ALY B;  5DZ6 A;  2R7V A;  2BYC A;  2DY1 A;  5GME A;  3IRW P;  3U1N A;  3DNC A;  1HBM B;  1HR0 J;  3ZZO A;  4GKJ J;  1REV A;  1T9U A;  5F8H A;  2VC1 A;  3C16 B;  2AWZ A;  3T19 A;  1AXQ A;  4LF9 F;  2ROE A;  4YDX A;  4G3I A;  1XEZ A;  2OPS A;  1S99 A;  3CGI A;  2I38 A;  3M2V A;  5EUH A;  3MXH P;  4M5N A;  1YSJ A;  2OEJ A;  1V3R A;  2CPJ A;  4F4Z A;  3FRZ A;  3MCS A;  1X9W A;  4B3S J;  3Q8V A;  3RU0 A;  1ITP A;  5GMD A;  1NDP A;  1R43 A;  2LEC A;  3UW1 A;  2UVW A;  4KC5 A;  4OYX A;  4TY8 B;  2UXC F;  4WK3 A;  2N4D A;  1H73 A;  3IG1 A;  4NX9 A;  1Y0H A;  3Q8R B;  2YY3 A;  3A12 A;  2Q6C A;  5H9E K;  2GVD B;  4N56 A;  5DG7 A;  2AEF A;  4ES1 A;  3CO0 P;  5DGA A;  1J27 A;  5A6P A;  3KG4 A;  2XI2 A;  3NGD A;  2DNK A;  3JSR A;  5E33 A;  2Y1R I;  3FQK A;  4MFB A;  1HI1 A;  1PJ6 A;  2KT3 A;  2GX8 A;  1R7I A;  4B3M F;  3PNI A;  1T3O A;  1KLN A;  2QLF B;  5IC6 B;  4PQU B;  1SJ1 A;  2AD9 A;  1F5A A;  2QJ3 A;  1J5O A;  1ZH5 A;  2GMH A;  3N01 A;  5KG7 A;  4Q8F A;  4ICL B;  3TX8 A;  1NH8 A;  3BGR B;  5THW A;  1VQ9 S;  3RB4 A;  4FYX B;  4RW8 B;  4ZLN A;  2BV3 A;  2VDH A;  2XMU A;  3HJV A;  5AE3 A;  2ACM A;  2JH3 A;  2RML A;  3EJM A;  3QIP A;  4LRC A;  5HQL A;  4C3K A;  2MHE A;  4WFZ A;  3UDL A;  4ECQ A;  5HVG A;  1KON A;  1UWB A;  1SUQ A;  4UY8 T;  1B7Y B;  2DPI A;  3W3S A;  1YBA A;  1T02 A;  1U1R A;  3DRP A;  3DXB A;  4AXJ A;  2CVE A;  4I6Y A;  1BC6 A;  2XM3 A;  2BJD A;  3T5J A;  2I0X A;  4Y2K A;  5CCM A;  4ZVU B;  1X4H A;  2UV8 G;  4IYQ A;  4PEO A;  3FKB A;  4YHH J;  1H72 C;  1KVK A;  1EQ0 A;  5BXI A;  3Q8S B;  4WII A;  1RI7 A;  1YZ6 A;  2OTJ S;  2DNG A;  3RRG A;  2BVZ A;  4JI4 J;  2MQQ A;  1Y10 A;  2RRB A;  3MAA A;  1OSC A;  1RT1 A;  3VGU A;  1K9M T;  1G2E A;  4YR3 A;  1KDN A;  2DKO B;  4BCA A;  3V81 A;  2RKI A;  3KK3 A;  2XMM A;  1C2P A;  4OHY A;  2W4P A;  5KFE A;  4IFY B;  2UUW A;  4ELT A;  5CYJ A;  2PE8 A;  1F3V A;  3I87 A;  1TUV A;  4Y2C A;  1REG X;  1XBW A;  1S1T A;  4BS2 A;  1CJV B;  2O5D A;  1SL2 A;  1QAX A;  3HT0 A;  2XGQ A;  1KTV A;  1BQM B;  4CLZ A;  2E7V A;  2G2Y A;  1UJ6 A;  1WG1 A;  2YKM A;  2KYZ A;  3CD7 A;  4R8U A;  5D3G A;  1JLF A;  4HYK A;  2WB4 A;  1I1G A;  4QWD A;  1Y3J A;  2FHM A;  3QGI A;  3P45 B;  1SH0 A;  2N3O A;  1RT7 A;  4OYA A;  4ZLP A;  3AJD A;  3OTC A;  5IM0 B;  3OBI A;  2CZ4 A;  1Q0N A;  1WHX A;  1ZM2 A;  1FA0 A;  3SIP B;  5M2U A;  5H9E J;  2BQU A;  2MHN A;  3LWL A;  1XC9 A;  1S1W A;  3TJA A;  3PW5 A;  4TXS A;  1RWX B;  4LBH A;  3U7J A;  2B0G A;  2YQ3 A;  2YTC A;  4XTT A;  2QEX S;  1S0M A;  2KJV A;  4B9L A;  3KMS A;  1SBR A;  1WUU A;  2GS8 A;  2APO A;  4N77 A;  2VIH A;  3NY0 A;  5HVF A;  1FFG B;  1UPM B;  1NBE B;  2V8V A;  3FEX B;  4TLQ A;  3BBC A;  1R0A B;  3DYA A;  4C9D A;  2C3P A;  2MXY A;  2YKO A;  4JI7 J;  1NK8 A;  1DY3 A;  2MEW A;  4NLU A;  3TWZ A;  1WHW A;  3A8K A;  5FLX Y;  3T1H J;  3PW0 A;  2HFN A;  4QR2 A;  1QY7 A;  3DN9 A;  3OFF A;  3OTO J;  4ZPB A;  3CPW R;  3GQC A;  1VQM S;  4BC7 A;  4A8S A;  3RBZ A;  1U2R A;  4LF2 A;  3OHB A;  1YHQ S;  1O6X A;  4F0K A;  3CME S;  1DTT B;  2UZA A;  5HN0 A;  2QE5 A;  4EUV A;  5CXT A;  4RBU A;  3N28 A;  1U26 A;  1IBL J;  2MZ1 A;  4KFB B;  3PTW A;  1S59 A;  1TV6 B;  3HJF A;  1YBT A;  2HQC A;  3RB0 A;  2UU9 F;  1Q8K A;  2FJE B;  2B6A B;  4AL7 A;  1MMN A;  3ELH A;  5KT5 A;  4M5M A;  3FDS A;  3DGP B;  5L1L A;  3V4I B;  1N56 A;  8AT1 B;  4CDI A;  4EZ6 A;  1UMJ A;  1GK8 A;  4IOC Q;  3GCW P;  4WXW A;  4WKY A;  4P52 A;  3TQ1 A;  5D4P A;  3BSA A;  1GMW D;  3AT1 B;  3BF4 A;  1TVR B; 
#chains in the Genus database with same CATH homology
 2VQE J;  4X64 J;  4PWW A;  4LF7 J;  1HNZ J;  4LF9 J;  4LF4 J;  4KHP J;  3R2C J;  1N34 J;  5A2Q U;  2UXB J;  3W1Y C;  3J7A N;  4NXM J;  4LF5 J;  1HNW J;  2UXC J;  4V1A k;  1FJG J;  4YHH J;  4OX9 J;  4JI1 J;  4JI2 J;  4KY3 A;  5AJ3 J;  2UXD J;  2UU9 J;  3R2D J;  4JI6 J;  5BR8 J;  4LFC J;  3IMQ J;  1J5E J;  4JI4 J;  1XNR J;  4RJV A;  4JI5 J;  1N32 J;  4B3R J;  2UUC J;  1IBK J;  4KYZ A;  4DV1 J;  4DR7 J;  1XMO J;  2E5L J;  4LFB J;  1N36 J;  2F4V J;  4DV3 J;  4HHU A;  1HNX J;  4LF8 J;  4JI3 J;  4LF6 J;  5FLX U;  4DR2 J;  4DV4 J;  2VQF J;  2UUA J;  3T1Y J;  4B3M J;  4DR4 J;  4X65 J;  4DR3 J;  3D3C J;  4DR6 J;  4JV5 J;  4JI0 J;  3JAM U;  1I94 J;  4DR5 J;  4AQY J;  2UUB J;  4X62 J;  4NEZ A;  4DV7 J;  5IT9 U;  1HR0 J;  4GKJ J;  4DV6 J;  5IWA J;  4LFA J;  4GKK J;  4DR1 J;  5LMN J;  4DUZ J;  1XNQ J;  4JI7 J;  2MEW A;  4B3S J;  3T1H J;  5LMU J;  3J81 U;  4DV0 J;  2ZM6 J;  3OTO J;  4NEY A;  4DUY J;  4K0K J;  4JYA J;  4X66 J;  2KVQ E;  4YY3 J;  1IBL J;  4JI8 J;  1IBM J;  4NXN J;  2MQ8 A;  4DV2 J;  2HHH J;  3J80 U;  4DV5 J;  2MTL A;  1XMQ J;  1N33 J;  2KL8 A;  3D3B J;  4B3T J;  5LM7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...