4DR2J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr2J00
4JI3J 4DR5J 4DUZJ 4NEZA 4LFAJ 1N34J 4KHPJ 4OX9J 1HR0J 4DR7J 5IT9U 2MQ8A 1XMOJ 4DV6J 2UXBJ 1IBLJ 1XNRJ 4DV7J 4KYZA 2UUBJ 4B3TJ 4DR6J 3R2DJ 3W1YC 4JI4J 4DV3J 4NEYA 4DV5J 3D3CJ 4JI7J 4DV1J 4JI0J 2E5LJ 4YY3J 4B3MJ 5LMNJ 4RJVA 5LM7E 4K0KJ 4AQYJ 1FJGJ 4LF9J 4LF4J 4JI2J 2MEWA 4GKJJ 4JI6J 5AJ3J 1HNXJ 3T1YJ 4PWWA 2KVQE 4LF6J 4X64J 3J81U 5FLXU 4DV2J 5IWAJ 4DV4J 3J80U 3T1HJ 1XNQJ 1J5EJ 4DV0J 3OTOJ 3JAMU 1N33J 2UXCJ 2VQEJ 1HNZJ 2UUAJ 4DR2J 4JI5J 2F4VJ 2UU9J 4KY3A 1HNWJ 2MTLA 4NXNJ 2KL8A 1XMQJ 4GKKJ 4V1Ak 5A2QU 4JYAJ 3J7AN 4LF5J 4DUYJ 4JI1J 4X65J 4LF7J 1IBKJ 4YHHJ 2ZM6J 3D3BJ 4LF8J 4JI8J 4HHUA 4LFBJ 4B3SJ 1IBMJ 4DR1J 4B3RJ 4LFCJ 4JV5J 2VQFJ 4NXMJ 1N36J 3IMQJ 4DR4J 1N32J 2UXDJ 5BR8J 2UUCJ 5LMUJ 4X62J 1I94J 4X66J 3R2CJ 2HHHJ 4DR3J
chains in the Genus database with same CATH superfamily
2GQQA 5KFGA 1X4CA 1Q8LA 1RACB 3KKFA 1NSQA 2HIYA 4CRJA 4ZLLA 1FJ7A 1KS2A 4EYHB 2OLWA 4ALZA 3DLHA 4CDIA 3QYYA 5HVFA 4C0HA 3C2PA 3H5XA 2Z2LA 4M5MA 1A6LA 1B64A 3CNQP 1UVMA 4M5HA 4LF9J 2YNGB 3GPAA 4DV5F 3PR5B 3CD7A 2CPYA 5BXIA 3W61A 1S49A 3CJSA 4FKXA 3SDEB 2HHPA 5FDLA 1HW8A 1FE4A 1GT8A 2P8IA 1U1KA 3FZ2A 3TUPA 4CH7A 3MUTP 3R6LB 1BUXA 4NYPA 5A8KB 1QM9A 2HNDB 1R6VA 3UD4P 3BBCA 3OTOF 2UXCF 3MPWA 2JOQA 1T9YA 4ZP6A 1VQPS 3PW4A 1PJ7A 5KFTA 1ROFA 4ATNA 4NLPA 3I32A 3MXHP 4GVLA 1UMJA 3KG0A 4OIXA 1RWOB 1HNIB 4NLVA 1HI1A 2ASLA 4O3OA 2R2UA 2G1DA 3J81Y 3KK3A 2F5GA 5J1PA 2IIHA 1QUPA 3JAMY 5F8MA 5JXSA 3A8JA 3RR8A 5FIIA 4OZ3A 3G87A 2DTJA 1XEZA 2GIQA 2KFNA 4K0KJ 1REGX 2R9LA 1XK8A 3ZZZA 4O3NA 5LXYA 1FRKA 2OI2A 1RTHB 1FRIA 1S7IA 3D6FB 3F0NA 4DPUA 2Y8WA 1S0OA 1HBNA 3FMBA 3IO1A 3KDOA 1EKSA 5EN1A 1EJ7L 1VGYA 2IA0A 3PX0A 2CAJA 5F9LA 3TW0A 5B0AA 2KB2A 3IG1A 4OLOA 5LSRA 4QWDA 3M6XA 4QR2A 4HR2A 3FVYA 5G4DA 5A8RB 3W5XA 2W8LA 4YHHF 3MMJA 5DO2A 5DETA 3TARA 2AX1A 2UZAA 3RW6A 4ZITA 2J0XA 2R8JA 4L75A 1S0VA 1N4LA 4X62F 4KE5A 2E1CA 1S79A 4RJVA 4ETZA 3VAJA 4M94A 2ZH3A 1KVKA 5IV3A 5C7PA 4TY8B 2DIUA 5ITHA 1OWXA 4PG5A 5D8HB 2WBMA 4L76A 1PAUB 1FDAA 2QT7A 2XY7A 2CYYA 5KFCA 1UA1A 2UV8G 1PGZA 2AV5A 2HAIA 1E6YB 2CQCA 2CZVC 5C5JA 3PFEA 5EWFA 3CXCR 1H72C 5JVHQ 2ZH1A 3QMQA 1PBAA 3TA1A 1KHVA 1QAIA 3KJFB 3IS9A 4QBUA 1UCNA 1U4BA 1NK8A 4EFAC 1FK9B 2XNQA 3W7BA 1B70B 3GV7B 4FYYB 4N8NA 2LKZA 4NASA 3AJDA 4DSLA 5DLFA 1PO6A 4DV6J 2ZKUA 4FPIA 2XO7A 3FEYB 2IM1A 3DLEB 2ABYA 3D28A 3CF5Q 2CNKB 2AJ4A 4CO4A 2BJ8A 3IGVA 4CIOA 4ED2A 7FD1A 3FSIA 4ZVGA 3CDEA 1S97A 1BHNA 4C8KA 4J7CA 3FCWA 3DRPB 5LJ5Y 2WB4A 2U1AA 1YGYA 4WE1A 1JK9B 2QN6B 2QMUB 4KC5A 2JH3A 4WCEQ 4LSNB 1FRJA 3HI9A 1ZETA 1VBZA 1H2UX 1U6BA 4DV4F 4IRDA 5DQHA 2W4DA 2HS3A 2M0GB 2BACA 3MEEA 2FZGB 3AHPA 3ZZRA 2B5JA 2KG0A 3S01A 4ERDA 1S4EA 2EFGA 5KAKA 1Q5VA 2W9BA 4NOHA 3SBMA 3OLAA 1SKSA 3A12A 3CC7S 2DH9A 3UCZP 1I6JA 1U1NA 3KMQA 4NYZA 4U7UK 3KJQB 1NSAA 3MOJB 1AROP 2UVVA 1XNRF 3FQLA 2YKNA 1D0EA 2QG9B 2MXYA 4QIVA 3J7ZT 2ZEJA 1N52B 1RWNB 4R0JA 3T5KA 3TI0A 2F7VA 5HROB 2MZRA 2KVQE 2CXEA 1T03A 1XN9A 4O3SA 2WTFA 1C1BA 3M9NB 4KY3A 2GMLA 3DKDA 1CEZA 3W3SA 3NNCA 2CNOB 2RIJA 2K1RB 1P27B 3LWLA 3HHLD 2W9CA 2AJFE 4JI5F 1W26A 4JI8J 1T7PA 4ECQA 1GX5A 3KLGA 3HHNB 5BJRA 1WI8A 2FC8A 4AUKA 3K57A 4KGZB 3D1OA 5GAHI 1UVJA 2XMVA 2ZWPA 4Y28C 2EFQA 1U1LA 4DSIA 2AX0A 4NXMF 1CJUB 5T41A 1ELOA 3VZHA 2H9ZA 2ZVSA 3P49B 1TKDA 1U0HB 3BV8A 1HARA 4LBPA 3FFIB 2CPEA 2AW0A 4FS1A 3POTB 2W4CA 1NNDA 3D1QA 5EHHA 1L3TA 3T1YJ 1S6QB 4XO0A 4HI2A 2HYIB 4C11A 3OPKA 5E2QA 1W2IA 2RUSA 4MFBB 1KTVA 2MYFA 1L3VA 4OX8A 1EQ0A 1EB0A 1LW2A 4ZVRB 1T05A 3WX8A 1IBKJ 2M8HA 5A6WA 2B9YA 1NO8A 1CVJA 2X7IA 3QLHA 4KGXB 2DXEA 1GQEA 3Q2SC 2CQDA 4YR2A 4ELUA 1HWKA 3ILLA 2HHQA 4O44B 4M5DA 2HNYB 3DU5A 3GILA 4Y0FA 1CG2A 3FQKA 3PKYA 2VA2A 2W2MP 3QJPA 3FGVA 4KHMA 3H4BA 2WRMA 3PJWA 3JSMA 1RT6A 1RAEB 3T9ZA 2DYAA 5LMNF 3R5BA 5IM0B 2J8AA 3OTEA 1C1CA 1VMBA 3CULA 1MNEA 1E6VB 1P9QC 2BXJA 5DZ7A 1S6PB 3R97A 2ILZA 2H51B 5IOLA 4PCQA 1M5PC 2VG6A 2QJ3A 1QSYA 2OMOA 5HQMA 2DXFA 1IUJA 3KLIA 3KK2A 4DR2F 1TK8A 5HLFA 3LPEA 3TA2A 3NS5A 2ZH4A 1NHUA 1OMSA 2C22A 2M8DB 2ASDA 1RHKB 3B4MA 4QW9A 3CO0P 4LR8A 3OL6A 2BBEA 3L7UA 2IJFA 3ENQA 1VI7A 2LYVA 5B7WA 3T9NA 1EETA 1WTBA 3H90A 5L1KA 4DL3A 4KTQA 3CGIA 3OFFA 1S6UA 5KFOA 9ATCB 1XC9A 2XZTB 3R7SB 2YPYA 1X60A 5B0GA 2DY1A 1MMNA 1KC8T 2QYCA 2J6TA 1H38A 1U26A 2LEPA 3GFXA 2XMUA 2NYIA 2X3DA 2QMXA 3D54A 3UDLA 4DUTA 2QE5A 3MD1A 3J80U 2E9RX 1WTFA 2YNGA 2GMHA 4LF4F 3QBCA 1APSA 1U2CA 3OSNA 5E3QA 1UW4A 5HJYA 2YKPA 3Q8YA 1U6FA 3EXYA 2HBRB 2IYGA 3SDEA 3KHHA 4HH1A 4IDKB 5B0BA 2CNLB 3SIPB 3TANA 2UP1A 3T6BA 4JB8B 4ZVEA 2DNRA 5A8KA 3IBWA 2HNDA 5KFFA 1F2GA 5ETVA 4ZIWA 1JJCB 2NREA 2UUCJ 3GB0A 3N0VA 1FRMA 4W90B 3TVZA 2WW4A 3CCTA 1X5TA 3DOMA 2VOOA 4ECZA 1DAXA 2IM0A 3EWGA 1HNIA 2WVBA 2DCUB 1F1BB 3OD2A 4U95A 3TQ1A 3I4PA 3D0IE 5HMZA 1DY3A 3I0SB 2YQ0A 4PPDA 1YKWA 5AXKA 2C3OA 4IG3B 2CQHA 3QWUA 3H2VE 5H1SV 3GIIA 4FXVA 4N7TA 3G96A 1FDDA 4ZK7M 4JI2F 2UUAJ 3N01A 1SBRA 2K2PA 1RTHA 1KFSA 3HZGA 5EX3A 2G0CA 4OZ0A 2W9AA 3PRVA 3WHIA 2U2FA 3ILJA 1SKRA 4IFYB 8ATCB 2DPIA 1WOSA 2MLXA 3OTBA 3G82B 2V0NA 3NMRA 4CO1A 4DSEA 3H59A 1P6TA 1YITS 4PRFA 2V2VA 2F1FA 2KRRA 2ACYA 3I31A 4LFBF 3RB4A 2ZOGA 3AB4B 3FRYA 2MZJA 4GC7A 3D67A 4F4AA 4NLSA 5HVHA 2BJ9A 4F3QA 2BVZA 2KZMA 4YMEA 4XPCA 3T6JA 4JI0J 2JEGA 3X3UA 3M2VB 2F4FA 4G65A 2NSCA 4DQIA 2OEMA 4F02A 1GFWB 4OJ1A 2MZ1A 2J0QD 2Z8QA 3MM9B 5KT4A 3F44A 4RUAA 2EC0A 4HHHA 3VQSA 2NYHA 5CZVA 4YB6A 4K59A 3CCES 3O2IA 1CS4B 2JLGA 1XR6A 4J9KA 1S6OA 4KO0B 1E6YA 4WKYA 2D3UA 3G6VA 1R3NA 3RAMA 1HLWA 4H4OB 3ETMA 3EE3A 4WFZA 1FI4A 2VU5A 2OD6A 1ZM2A 1VQ4S 4ZLPA 4EEYA 1NKCA 1JXVA 3AJ2A 3R7NB 1FK9A 4A8FA 2UXDF 3MD3A 1KRPA 4DX8H 1X8DA 4Q5VA 2MKYA 1GEHA 2GMJA 1HBMB 3EGZA 5EWEA 2KT2A 2ZVIA 3H98A 3I6PA 1C0TA 3IGNA 2ZC4A 2DR8A 1SQEA 5AT1B 3U02A 2Z2YB 5BYRA 4P10A 2YWEA 4MT1A 4ZLJA 4I6YA 4Z7YA 2OPSA 2KFZA 3BGUA 1SPBP 2NXJA 2YKQA 1WSRA 4BS2A 4DBQA 2BMBA 2Y0SD 1WG4A 3DRPA 2PMWA 1NJZA 3VVTA 3SSSA 1YJRA 2D3OR 4LSNA 4DV2F 2YH0A 3R7BB 4B9VA 2JSXA 3W2WA 4YS2A 1C0UB 3PJXA 2R8GA 1VS3A 2V4QA 2R7RA 1LFWA 1FJCA 3CCMS 2FHKA 5I4MA 3RBDA 3E01A 3MPDA 4I67A 3FK4A 2OGUA 2BV3A 1S72S 4NLXA 1Y00A 1RWVB 2XWYA 1FFSB 4DEZA 3THTA 2V4JB 4UT4A 3H25A 2PI4A 5KFRA 2WSFC 4PWUA 2F8EX 3HSJA 4W92B 2PDAA 4JI7J 5IT0A 2MQOA 2RDDA 4DR7F 4ZP7A 4A8KA 3HZEA 3HO1A 1FDBA 2R7TA 3PCOB 1MWYA 1EAYC 4ECXA 3CCWA 4DV1F 2CDQA 5IFMA 1UETA 2FIUA 4YY3F 2FC9A 2FHJA 1WKJA 1TR0A 1QUVA 1RAAB 4I2QA 1LWFB 2R7UA 1FD2A 1S1WB 1JMTA 1D8YA 5HROA 1RQ0A 1WHXA 4JOUA 3D9BA 1SJFA 4B9SA 1X4BA 3NWGA 2A1BA 2XS5A 2E5HA 2CVEA 2ADCA 2BYCA 4TYBA 2ZHAA 2H3EB 2K1RA 1U0SA 5CYJA 4BC7A 2J7UA 4ZPDA 4TLRA 1Q95G 4USVA 5KFUA 2C2RA 1HNVB 2G2ZA 1NDCA 1X5SA 3TAMB 2B3TB 2OKQA 1X9WA 2GW8A 1U1PA 3CEDA 2LQ5A 2C42A 2J6SA 8AT1B 2C2KB 1CBKA 3M32B 2Y0BB 1CJUA 3BPSP 2ROPA 2DGVA 3JSRA 2E1MC 1JJHA 2B51A 4QW8A 3Q8QB 3EX7B 1WOOA 3MCMA 4L73A 1U0HA 2VICA 4Q43A 3UNYA 1R7IA 2DNYA 2WB1D 2MEWA 2GGPB 3FFIA 2DRAA 3HHLC 1BD6A 2XMJA 4K5SA 3POTA 5HBMA 4M63A 1NDKA 5D0RA 4MH8A 2QGFB 5GAEU 4IOAQ 3W8PA 3GP9A 2C2OB 3BJYA 4CLUA 1KTQA 4ED0A 3Q8RB 2MTLA 2KL8A 1S6QA 2ZKTA 3KLEB 1CSJA 4DV0F 3CJTA 4WXWA 2QEXS 4Q8EA 1FXDA 3GE9A 1OY9A 3Q23A 2PO4A 4Y2KA 4I2PA 4MFBA 4D3GA 4Y34A 4M5IA 1VJQA 5AXNA 2E7VA 4F25A 5DDQC 4CLPA 1AXQA 4DPOA 1HHQA 4IRKA 3NGDA 1GXTA 4ZP8A 2YWHA 1MW7A 5LJ3Y 4KHPJ 5E3AA 2NQPA 1VK8A 1TK0A 4QYRA 4ZVFA 4ZHRA 3ZZYA 2ZJPQ 1WELA 3ET6B 3CMAS 1RCXB 4Y2CA 3VTIA 1R8HA 2ZOFA 3OXLA 4DU7A 1MLAA 1R8AA 4O44A 3QJJA 3CWJA 2HNYA 2P2CB 5M2RA 2DH7A 1HI0P 2OD4A 2RD5C 5C2CA 4F3MA 1RJJA 2CUYA 1Q7LB 3I56S 1B99A 4EGLA 4O3QA 4LF6F 4GKKJ 3NBPB 2V6AA 5IM0A 3BGFA 3MI7X 4I4BA 5D4PA 1FKOA 1J5EF 4AD6A 3QT6A 2BANB 1JLCB 1S6PA 2VDHA 1Y0HA 3VAKA 4QJVA 4CTAB 4W4MA 2ZDOA 4EZ9A 1S99A 2Z56B 3V6HA 2DBBA 2R42A 1N8RT 4UQTA 2W8KA 2WVFA 3UO0A 3ICLA 4MKVA 4CNYA 1N32F 4PYAA 3MMCB 4JI1F 4DR6J 4A48A 4NEYA 3ENAA 4DSJA 3WZ0A 2BJEA 1PBUA 2WSEC 2QLBB 1RA6A 3P96A 5F0WA 3KHRA 1Q16B 2YX4A 1FHTA 2HVIA 1U2RA 3EZUA 2JNJA 2HZVA 1FFWB 4DX5A 5CD4A 1V3SA 3L3CA 2EKNA 1VQKS 3MEGB 2A0FB 1BWEA 4URGA 2L08A 3U1NA 5KFSA 4LBHA 4AL7A 1W7WA 3LOUA 3RRHA 3KUGA 3EXCX 2Z58B 5HAOA 3QRRA 1WF1A 2AU0A 4OJHA 5IC4B 5K8PA 5J2PB 2O5DA 9RUBA 2MQPA 3QRPA 5L9NA 3L7OA 2PN6A 2H4WB 3H4DA 4IDKA 3PX6A 5CCLA 1S9EB 1WF2A 4LRFA 4F4KA 1VBKA 2YKMB 2XQCA 3M6VA 4DR1F 2QL9B 1RWUA 4KQZA 2B7BB 4FP9A 1YRUA 3ELHA 3A1YG 2C2NA 1RZMA 2DR6A 3AA9A 4HEA9 3Q8UA 4X84A 3IRXB 2DNHA 1SC4B 4ZLNA 1UZDA 2NXEA 4ZVSB 4DX7A 2JC1A 3PO4A 2HK3A 2V34A 3AQPA 3SV3A 4AQYJ 4F04B 3MECB 1M1KT 3OVSA 3QNWB 1XMBA 1XJWB 2OHDA 4NI2A 2W1BA 3W5ZA 2DNPA 3I0SA 3TAQA 2WAQD 4GKJF 1VLOA 1ZM9A 4KFBB 4IG3A 2E66A 3L4BC 4X64F 4DLGA 2JJ4D 5C42B 3NKYA 3PW7A 5DS7A 3NCRA 4N41A 4QPXA 3RW7A 1Q4RA 5F9NA 4GC6A 1IJEB 4QIGA 4RNFA 3QFWA 4IFYA 2DR7A 2CIMA 4LF8F 3G82A 1VISA 3J81j 1EX8A 1HL6A 3GR1A 1G3OA 3VALA 4C7QA 1RT7A 2D3ZA 4OHXA 4DPTA 1OQ6A 2ACMA 5LMUF 1KP6A 4A46A 3TVKA 2GS8A 2RVJA 1X4FA 3THVA 5HATA 3C6UB 2B0GA 1WC0A 2R7VA 2LECA 1WORA 1JLQB 4TKTA 1AFIA 5J2NB 3WC2A 1TKTB 4NLQA 3ISZA 3RB0A 3M2VA 2BOAA 1HWJA 3O44A 3GSDA 3N28A 2DNLA 2WVEA 4JI6F 5DDPC 3RB6A 3D68A 3Q0AA 3BEGB 1PYTA 3MM9A 5CAAA 3OL9A 4YUDA 4EBDA 2GCFA 4DFJA 4X65J 1LFPA 3M8ZA 2AJ1A 4RNNA 2HQCA 1CS4A 3PX4A 2JEJA 2XYHB 4CM0A 4DR4J 3GV5B 3CDWA 2LXFA 2DISA 4ZP9A 4E98A 1TP7A 3SFGA 4ED6A 2A3JA 5F0UA 4DQPA 2F40A 4H4OA 1SVDA 4LFAJ 1HQEB 2RU9A 4F7VA 2G0JA 3JYTB 3KJVA 2AP6A 2KXHA 2CA9A 3M9MB 1N5YB 2R7QA 3KK1B 1RWWB 4LUBA 5KT3A 2UXBF 4RBUA 5A0YA 3VCDA 1HBMA 1FKAF 2I6WA 1SL0A 1PKUA 3K59A 1S9FA 2CFXA 3I55S 1QAYA 1BQNB 3EICA 5EWGA 3CD0A 2AKWB 2LEBA 1X9MA 2FLLA 4DPWA 4OHVA 1URNA 4J9NA 2UU9J 1QAXA 4RNOA 3L9ZA 4OI6A 1ZBTA 2Y3YA 1TFWA 4Y2MA 1Q0NA 3GZ7A 1JNZB 1RHMB 2OPPB 2DGSA 2W2PP 3UN3A 2IMWP 2XMKA 1Q79A 5D78A 1V6HA 4ZVQB 1U25A 3SCLE 2MQLA 1C0UA 4QWEA 5ETLA 4JYAF 3NOGA 4F67A 4WFNQ 3HHLB 1CC8A 4DPYA 4Q2LA 3VAFA 5B08A 2NXCA 1VRUB 2BE9B 5KFEA 2K3KA 2VFRA 2VQFF 1FF2A 2JFKA 1U1QA 3D4JA 1T02A 4UY85 1YK9A 5A6PA 4IH6A 2V4JA 5E3PA 3V2UC 3EDRB 1RHQB 1RHRB 1YJNS 3HF5A 4DV5J 1YJ9S 1FCAA 4QOTA 2FD2A 2HWTA 3PVXA 2HPUA 5HQLA 2RUGA 4HT7A 2PFFB 1TMJA 3MTJA 1NJIT 1H98A 2XG8A 3DGVA 3H7HB 1KDNA 3MR3A 3AOBA 2G2YA 3Q86A 4K4UA 3GJQB 3MZIA 5HANA 2IFXA 2NUUG 1B0PA 4N5SA 3OTOJ 3W66A 2UXCJ 2ZH5A 2CPZA 4GVBB 2ZHBA 4AYBD 2COLA 3MMBB 2AJ0A 4B9NA 3KNAA 4FYWB 3F41A 1S1WA 4ZDNA 2HSEB 2P9EA 5L8RC 1U1MA 3AFGA 4C8MA 4QIEA 3UCGA 2XHWA 2ZWOA 3A13A 3TUJC 1RGVA 5I3QA 2MKCA 1VJWA 4CLSA 4XK8C 1H7XA 1D9DA 3TJ9A 1WDDA 4RBVA 2N3LA 3MM7B 4J9VA 2F9DA 5C25B 2MJNA 3JTOA 4EK2A 2MQ8A 1T95A 2X3GA 4DZ6A 2H1YA 1NDLA 3NWRA 4KYZA 4Y6IA 1HNVA 2B6AB 3TAMA 2KHDA 4FNIA 1HQ2A 5RUBA 3OJUA 3N6LA 2DJWA 1Q7YT 3AXMA 2DY9A 1DQ9A 3VV2B 4BCAA 3M32A 1WDTA 2OH2A 4ED5A 3ONQA 3G8TA 3CO9A 4NCGB 4WK1A 2Y8YA 3FZBA 3HVAA 5AXLA 1X4AA 3PYEA 3HJFA 1HKAA 3SSRA 2W7AA 4X4VA 2GGPA 2KXNB 3Q22A 3S1TA 2MZSA 4P2SA 3MWBA 1R0BG 3CMQA 4ZCIA 4C48A 4NMLA 3S6EA 2JWNA 1KVIA 4YHHJ 1AYEA 1AZSB 2QC3A 4NXNF 3QT7A 4ID8A 1VQYA 3KG1A 3KLEA 2NZ4A 1F5BA 2DO4A 4LJMA 2IMOA 2IDEA 1BE4A 4X62J 3K89A 4IR1A 4IFVB 1UEKA 4YFUA 4OYPA 3T1AA 1IWAA 2RRBA 2GAGC 2AGQA 5CZXA 4LMZA 1VLYA 1FDNA 1FESA 4OFZA 1N56A 3D3CJ 4AFFA 4KGKA 3HDSA 2YNFB 3IWNC 1DHMA 3ET6A 2HRUA 4OJGA 2DNGA 3CCSS 1M90T 3TZYA 3EVOA 2CG8A 5IXUA 3CTRA 2AT1B 2LQ9A 4USHA 4PAAA 2ZITA 4J9PA 1YBTA 5F8IA 3IAS9 3BQ2A 1FVSA 1KFDA 1TUWA 3TWZA 3NBPA 1RTJB 3OHAA 1UFKA 1EP4B 2BANA 1JLCA 1U09A 4K4SA 4ANCA 3FC9A 3NNHA 1RTZA 4ZA1A 4CTAA 1FNMA 2PSZA 1EHWA 3MAHA 3IFEA 1YBUA 3PZPA 5IQ6A 1U24A 4LSZB 4OYXA 3FBFA 3R2DJ 4JI3F 1PJ5A 2FLPA 4DF8A 4I64A 1F0XA 3B4DA 4C2MA 5A2QY 3MMCA 1IBLF 1CC7A 2LQBA 3PO5A 4WXOA 1S77D 2XM3A 1R8BA 3OJSA 3U7JA 2OO4A 2B4PA 2AWZA 4B3MF 3AY0A 4DV4J 2CJBA 2VFTA 5D0HA 2LXUA 2PFDA 4DLEA 1WWHA 2JEFA 5B0EA 3QJLA 4L72B 2HQGA 3KDNA 4H4MB 4QPTA 3ZZPA 3V4MA 2RU3A 2JC0A 1KQKA 3N6NA 2GFFA 4OYZA 2LA4A 2FJVA 5DJBA 1NZAA 3MEGA 4GRSA 2Z2ZA 5H9FK 2W2NP 3J7YU 2YX1A 4WZMA 1YI2S 1HPZB 1WSVA 1JX4A 5GAEI 5DGAA 1IXKA 2BKOA 1S9EA 3LANA 1JLBB 5CABA 3MPUB 1XNRJ 4I0WA 1PIEA 1DFDA 2YKMA 3ENWA 4P74A 3HFZB 4Q2MA 1TL4A 1MU2B 1G4CA 1SQGA 2CQ2A 2LDIA 4EUVA 4IYQA 4AXIA 1CLFA 1DARA 5FJ4A 3IRXA 5KFQA 1NDPA 1Y5NB 2CADA 3A8IA 1A7GE 3NGUA 2GIFA 3NXZA 2IYIA 4WP9A 3MECA 4OMFG 4DG1A 2C2ZB 2V2ZA 3DRXA 4JI5J 3DC2A 3I4HX 1N5TA 2ZH9A 5KT7A 3QZ7A 4XTTA 3SCIE 3WBZA 4KBIA 4ER8A 1X0FA 4J9SA 1K0TA 4KFBA 5ETRA 3K17A 6AT1B 2B8QA 5C42A 1XQIA 5CYMB 4NXMJ 3JSBA 4FDFA 2W7PA 1FKPB 2MGZB 1QVGR 2KJVA 3IRWP 2VOPA 2AMCB 2YX7A 3UR3C 2XY5A 1SIZA 4LRDA 4ENOA 4ZPCA 3MTKA 3M2RB 2GHPA 2FZKB 4WP8A 4J91A 3V6JA 2FJXA 1J5OB 5ETQA 2GHVC 4NZ7A 4JV2A 3HP6A 2L9NA 5HO4A 3KG4A 2VPZB 2N82B 1Z4UA 2DNOA 3QGPA 4DCOB 4UUWA 3C6UA 2KYZA 1NJXA 2KU7A 1JLQA 3M30B 4USKA 3TUZC 2XWXA 1DRZA 4Y2IA 2EFPA 5J2NA 1W25A 1TKTA 2UUWA 3AAWB 2XY6A 4FVMA 3MM6B 2D3O1 2ZUAA 1K73T 2HKEA 2XMAA 2M88A 2OPRB 2DHSA 3KTQA 2LDYA 4P75A 3JTPA 4LT6A 2VH7A 4HHUA 2MHEA 1AUSL 2J9DE 1XMQF 1FRLA 3IMQJ 3G6ES 3DM2B 1NK4A 2HURA 2ROGA 2HS4A 4B17A 3KUHA 3P45B 2WZ1A 4F8RA 4LF2A 4ZCMA 3QT8A 2VPWB 4FYXB 3IR5B 3TP2A 1CULB 1HWLA 1VRQC 1IM4A 1HQEA 3G6XA 3CC2S 3BYRA 4OX9F 1HR0F 4DDFA 3JYTA 3UD3P 5LMNJ 3PEJA 2VB6A 3GYGA 3OFEA 1N5YA 1Y4ZB 3KK1A 2BRKA 3V4IB 2BOPA 3W65A 1X4EA 2POKA 4I7FB 4B3OB 4PG7A 4KKOB 3BN4A 2J5AA 1VC0A 1LKZA 2CQ0A 5GMKa 4DR2J 4OJ3A 2DHGA 3P5TL 3LGHA 1BQNA 2KN4A 1UW9A 4ED7A 1GMVA 3H40A 1OJ4A 5HL7Q 3NAIA 1TFYA 3CIZA 4S0MA 1NSPA 4XIUA 2OPPA 4H4KC 1HHSA 3EZ5A 5KG1A 2P9CA 4EO8A 1LXNA 1R27B 1IBMF 1IKXB 5MLCV 4ES2A 2KKHA 2R7XA 3UDVA 4PWDB 1RK8A 3HHLA 1JWWA 1NM2A 1V3RA 1VRUA 1F6TA 3GONA 4Y00A 3BDEA 2W24A 1HWIA 2H5IB 3OR2B 4HLBA 1FXRA 1FXLA 5LSOA 1UJ6A 2A2CA 2M52A 3BF4A 2HZAA 2HRYA 4CNZA 4LF4J 1YIJS 4DV3F 4U7UD 2KXFA 1W2BR 3SMZA 1Q53A 3LUYA 1RHUB 1NBEB 5IWAJ 5DQIA 1A0OB 3I0RB 3W2VB 2HBYB 4NLTA 3BQ0A 4DHVA 2Q66A 3PM9A 4QYZK 1T9UA 3D66A 1YSJA 4CCHA 1FJEB 1TQLA 2DRBA 3FMWA 4GVBA 1SH0A 3IAM9 4A4JA 3MMBA 2FLNA 3K7RA 2CPIA 1RYSA 4NLGA 3BS9A 4OI2A 4M8LA 4WFAQ 2XYGB 5F8NA 4LF7F 1HWUA 1B3TA 1DQ8A 5KFJA 5HI7A 3ZC4A 4MMOA 1FNXH 1HBOB 1RT5B 4URQU 2VKRA 2VC0A 3EYZA 2FYXA 4ILLA 3IWXA 4LRBA 2KI2A 3SCJE 1T94A 3MM7A 5DG7A 3AQOA 5C25A 1FJGF 5EDWA 2BQUA 2KDOA 4RU2A 1S0MA 2B6AA 4YQWA 2RF2B 4JI2J 2PA3A 4RW8B 3CCRS 5KFVA 5ETOA 3UE2A 4C8LA 1DQAA 3M1VB 1LWXA 4NCGA 4C8OA 1T11A 1HNXF 3LALA 1AW0A 2VZ9A 1QTNB 1WEXA 1TVRB 2ZZTA 2FVPA 3C46A 2ZH6A 2XI3A 2Y1JA 3O8WA 2WVDA 2K7JA 4LFBJ 3BO3A 2KTQA 3HK2A 2B4UA 2ROEA 5ETSA 3HT3A 1C2PA 2J8SA 1BY9A 4ZJOA 1TAUA 6FD1A 1AZSA 2LXIA 5KT2A 3HHEA 4P73A 4B3SF 2R3VA 2V9WA 4M95A 3BH7B 1MN9A 4M5JA 2CWKA 4IFVA 2JLFA 3OXGA 2EXUA 2J7KA 1T3OA 3GJRB 1NXIA 3IP0A 3W63A 1WKLA 2J9DA 3R5CA 1QSLA 1TL3B 3UN2A 4Z2XA 1JXLA 2D69A 3PYFA 2YNFA 1RAFB 3NRBA 3MM5B 2ADBA 3HD1A 1IQTA 2MKIA 1TUVA 4USIA 4RLEA 1NAQA 2APOA 4U9RA 1VC6A 1RWKB 2BX6A 3DRSB 2KO1A 3C15B 2RILA 2IC3B 5KT6A 1IM6A 4KHRA 1X5OA 2AEMA 2VBXA 3PHEA 3VVUA 3MF5A 1RWXB 1PC4A 3LW5C 5SUHA 4OZ2A 2BJ7A 1WC6A 3CC4S 2V8PA 2UXDJ 2V8HA 3DLJA 5I3PA 2VFUA 5J1NA 1O5JA 2B9EA 3LP1B 3R27A 2CG4A 4UW2A 3PIOQ 2KM8C 2J0WA 5FLXY 3C6TB 3A8EA 2QX0A 2JVOA 1VCTA 2HHHF 1G2EA 2Z30B 1Q82T 4ZVUB 3F56A 3L7PA 5THWA 1P1TA 2DEIA 1ZPWX 1QJHA 3GV8B 3IM8A 2C2EA 1T8EA 1Y3JA 2BA9A 3R5DA 3FNNA 3FDSA 4RUHA 1U47A 1UWBB 4DV2J 1NJWA 3Q8VA 3FEZA 3MFIA 3OV7A 4UOFA 1S12A 4KGVB 4LF1A 2ZH2A 3ZTOA 4NLDA 1B0TA 3PACA 1KEKA 4H4MA 3JTNA 4F0KA 1X9SA 4OZLA 4WZQA 1IKWB 1TELA 3B78A 3CJ3A 2FB0A 2MKJA 3VHQA 4C3KA 2YNIB 5ETPA 2ZOMA 4LF5F 2NR0A 4CWBA 4DUYF 2X1FA 1RKIA 1D8ZA 5I42B 3B8HA 4XPEA 2BE2B 5G0RB 1FVQA 4K4TA 1MN7A 4DR7J 2CJAA 5J2MB 5U47A 1HPZA 1PSDA 1KN6A 1RE1B 3TEHB 1EKRA 2OP5A 3V81B 3W1YC 5E7OB 5HJXA 3CJQA 1JLBA 4DV1J 1XMOF 4YY3J 1K44A 2JX2A 2DNNA 2IHR1 1MU2A 1RT2B 5DGBA 1TKXA 2R2TA 3CCJS 4RW9B 3M8RA 4J9OA 3H0PA 2VBZA 1YJUA 5SZTA 4FXDA 2YWWA 2HMIB 2X1AA 5GMEA 1BC6A 4DU8A 1VC5A 2R7WA 3EM1A 3FSYA 3DI6B 3MR5A 2OMLA 3BQ1A 4FF2A 1PYSB 5ETTA 2VJUA 4OYOA 2DGTA 4PKDB 4FBUA 2CQPA 2CPHA 5LL6d 5J1EA 4F4WA 3DDNA 4A47A 2RSQA 2L9DA 5F8JA 2ZHOA 1RCOB 4M5LA 3D6MB 2MSTA 5CYMA 2EPIA 1FKPA 3DMJB 2MGZA 4EWTA 1R0AB 1YRXA 1KOHA 1U45A 1K1SA 4NRUA 2C28A 2P5VA 2VJVA 2LU1A 4ZVPB 3JXOA 4PQAA 3CJ5A 1RKJA 1UPMB 4RZRA 3TZXA 3DRRB 2UUBF 1MMDA 1J5OA 4JI4F 3LF0A 2VASA 1DTTA 4DPXA 4R25A 1OO0B 4WKRA 2V69A 2GJ2A 5L1LA 2E1PA 3CJ2A 4ECWA 2AEFA 3ZTPA 4DV0J 1FTRA 4NE9C 1L5UA 1BWVA 2LMIA 3M30A 2V2KA 5IV4A 1Z2ZA 4RUBA 4B9LA 2JFDA 4PG4A 3M8WA 4TQSA 1KR4A 4WIQA 2GVDB 4PZVA 2NPIA 1H2VZ 4AT1B 1YQHA 4ZVTB 2Q79A 3MM6A 2AGPA 2VPYB 2EFNA 2ZZMA 3O1LA 3H5YA 3PNIA 3DN9A 1OS5A 2OPRA 1OPIA 4WWSA 5D77A 1VQMS 4JP8A 3GJSB 4BLGA 2XTJP 1S48A 1WC3A 2QA2A 4DFPA 3DM2A 3IBFB 4ZKAA 4DXLA 2DGXA 1M1GA 2B43A 1VQNS 1NK5A 3BGRB 4F36A 4DR3F 1SC3B 1U49A 1NCLA 3GFZA 1UAWA 3J7YI 1JLFB 5D0EA 1CULA 7AT1B 1OSCA 1ZTTA 3EZOA 4PXBA 2PMZD 4UOCA 3SV4A 2DO0A 4LF6J 3AOAA 1UZHA 2OTJS 2H5EA 1J5EJ 2XMWA 4P2MA 1NPRA 4M5NA 3I5BA 3G4SS 1YJ7A 3V4IA 3LP0A 4A8MP 2IVMA 3D5MA 3HFVA 1S5ZA 4U6PA 2XCAA 4I7FA 4G6VB 3BR8A 1YG0A 4KKOA 5EUHA 3O6QA 1M5OC 5ETNA 4ELTA 1NPKA 4CLTA 4HH0A 3NS7B 5L1IA 1HW9A 1JLAA 3DLGA 3HCXA 1CJKB 1UA0A 1RT4B 2FY1A 4RNHA 4XDCA 3LAMA 1N32J 4ILMA 1HA1A 5DM6Q 1IBCB 4LVOP 3HVRA 1NKBA 1JB0C 1WUUA 2AYMA 3MDFA 1G7CB 2W2QP 3H2LA 4NA3A 1FWLA 2FVRA 1IKXA 1RTDA 2NXNA 2HWIA 4PWDA 5FD1A 4A8XA 4DL4A 4USMA 2FJEB 3Q2TC 4P2FA 1QSSA 4CLWA 1NK0A 1Q8BA 3K5MA 1X5PA 1O51A 1L3SA 4EMDA 3OR2A 3RYLA 5DG8A 4ECVA 3J81U 3OLBA 4NZ6A 4WBFA 2XMMA 4ZN1A 4PR6A 4LIWA 3P4UB 3JAMU 2GVZB 2PGCA 1TKZB 1U1RA 2K8GA 3I0RA 3W2VA 4CH0S 1VQ7S 2V50A 3KLHA 2FHMA 2NLWA 1Q81T 4N47A 1VK3A 2BEFA 4DR1J 2G0IA 4HI1A 1AA1B 3CCUS 2E1AA 2PI5A 5KFMA 2L48A 1ZAVA 2XSJB 2VIHA 3RTVA 2C3UA 4HACB 5L1JA 4IO9Q 2V67A 4A8SA 1HBOA 4K4XA 1RT5A 3ULHA 2ZBQA 1QTMA 5KG4A 2X1BA 4V19J 1U6ZA 3ZTRA 3GR0A 2HHXA 3W9HA 2MLZA 1QDUB 3JQKA 3Q24A 4GKJJ 2VHGA 2O01C 1MROB 1NRKA 4X64J 4PPZA 4HHJA 4IRCA 1Y3KA 2RF2A 1NK9A 3JQMA 2KM8B 2HAFA 1RTIB 3UWTA 2FLOA 4ID5B 2WVCA 2MPUA 3OXFA 4UOHA 4C8YA 2B56A 5T14A 4O3PA 3M1VA 1NK6A 3BBFA 1IKYB 1FO1A 4LF8J 1YVFA 1U8SA 2XULA 4R8UB 4KGMA 2C1EB 3DDKA 1TVRA 1C4CA 2QRRA 3GIJA 4MYTA 5LMUJ 3D2WA 3FCHA 5IC6B 2PEHA 1N36F 3TOQA 2R7SA 2HFUA 2L9WA 3HSDA 1I94F 5DG9A 4IOCQ 4A8QA 1AFJA 2EG1A 3MCSA 2O3DA 4DR5F 4DL2A 1SXLA 1NPPA 2AGOA 3MCNA 4LR9A 4OV1A 4CT9A 2CPDA 3W64A 1HHTP 5AE1A 4JI6J 4LQ9A 4DZDA 3ZNUA 2VC1A 2QL7B 2GJFA 2V8DA 1UFWA 5HP1B 2ZH8A 1GH8A 1KWMA 1TL3A 3Q8SB 3V6DB 2I9SA 3MM5A 3MUMP 3TZZA 4J5OA 3K5LA 3H5SA 4RW4B 4FF4A 2DR9A 1SJQA 2J0SD 3DRSA 3C15A 2H4YB 2IC3A 4ED4A 2M70A 2F9JA 1R6YA 4DOZA 2VODA 2CQ1A 3UPFA 2B8PA 1V5VA 3GMGA 3LP2B 2BABA 3CMES 3CJRA 1KHWA 2UXBJ 5BR8F 3G9CA 4C0OC 4I69A 3LP1A 4B02A 3BZQA 1N34F 1X31C 3C6TA 3ZZ0A 2FY8A 2W4PA 4MIBA 3CCLS 2HHTA 1RSCA 2QLXA 1BQXA 2ZBPA 2XC9A 2MZTA 4PYDA 1T0TV 4I6AA 3SSQA 4QWAA 1HI8A 1R43A 3KHLA 5HN0A 1S10A 3BSOA 3TRGA 2GNKA 2XGQA 2OIHA 4JYAJ 2EI5A 1XNQF 4ZIVA 2D9PA 3OW2R 2W7OA 1HNZF 3M7VA 5A8RA 3GQCA 2IPOB 1JJ4A 4OI4A 4X4UA 4U67Q 2VQFJ 4Q0BB 2HLUA 2HWHA 2QL5B 5HQ8A 2BM1A 5IZHA 3DLBA 1TL5A 4RWWA 2SXLA 4E8UA 2KT5A 1IKWA 3G6YA 4DQRA 2PE8A 3I96A 1ITPA 2YNIA 5D15A 2CJ9A 3KMSA 5K5MA 3G86A 3OUYB 2Z4PA 1FE0A 3K5OA 1DZ5A 4UZBA 1LV5A 1OSDA 5G0RA 1T9TA 4TY8A 5J2MA 4DV7F 3MR2A 4B3TF 2AQ4A 4FYDA 3TEGA 2N3OA 5DZ6A 1QVFR 1UP1A 3NLCA 4IOBA 4HTJA 5KG5A 1IN0A 1PC5A 1RT2A 3JSMB 3PIPQ 4RW9A 3HULA 3TX8A 1NH8A 2RQCA 2HFSA 2HMIA 2ZFHA 1IKVB 3BBBA 3Q83A 1WNEA 2HFNA 3DI6A 3R5JB 4DN9A 1XIQA 5F3ZA 1WD6A 2D7SA 2BZ2A 3KLIB 1FRHA 2EG2A 1R89A 2ZD1B 1Y5IB 2DGQA 1TL7B 2QA4S 3PDNA 1RXOB 3ADAC 5KFKA 3DLEA 4P7VA 4IQMA 1KLMB 3H8YA 4K4ZA 3FJ2A 3DMJA 5LSLA 3TX0A 2CQBA 2QLWA 3AT1B 1R0AA 2HGLA 2X51A 5DDOC 1LWCB 3HX9A 4WPAA 4DJBA 1RDRA 3RZAA 1U48A 4L3KA 2Q43A 4ECSA 2EBEA 3R1LA 2DD8S 2KZZA 2PT0A 3DRRA 3FBBA 2E5LF 1K47A 4CI0B 4K7QA 1JXEA 4LREA 4H4KA 2JL9A 2F8MA 2CKWA 4NXNJ 2CJQA 4PUOB 3TA0A 2QMWA 2HFOA 1TL1B 1FD8A 1G1XA 3T5HA 2GX8A 3RRGA 3UVJB 1H7WA 3BYPA 3AH6A 2GVDA 4XDDA 1ZPVA 3MOZA 1FT8A 1I3OB 1YX2A 3NOCA 2ATLA 5JMNA 5CYQB 3UI3A 1TAQA 5CH7B 5HSPA 2RRNA 5A76A 3PYGA 2ZJQQ 3DOMB 4EU0A 2M2BA 2R4FA 4TY9A 4DMZA 5HMXA 5AXMA 3BGRA 4ECTA 4MIAA 4QZVB 3RBEA 4OYBA 3DNCA 1T3NA 1UL3A 2HQFA 1JLFA 3ISNC 2XGPA 4OHZA 4CQ1A 1NUEA 5KG7A 1VQ9S 2DVIA 3RUBL 2J76E 4UF4A 4P7TA 3OR1B 2HVDA 3LAKA 2WBRA 3WX4A 1X7VA 3GU0A 5IT4A 2ERRA 3TJAA 5H9EK 1MWQA 1UEVA 3RG6A 3IR7B 1B7FA 5K20B 2XHCA 1EIYB 3GSIA 4RR5A 1WG1A 1TMMA 3KWMA 1CJKA 1GNKA 2H5JB 4K2XA 5M2PA 1RT4A 2Z2MA 3IC1A 4WU2A 3HXMA 4JI3J 4URSA 3G2XA 3CDAA 2PA8D 2DB1A 4Q8FA 4OI1A 2R7OA 1IBLJ 4X66F 2ATCB 4FKYA 4ED3A 3T5JA 4CH1A 4CM2A 2AYBA 3N79A 1FTCA 4ECRA 4B3MJ 4CO0A 1F5AA 1JLEB 4HVZA 1LXJA 3A3NB 4BHQA 3D0HE 1IJFB 2MKHA 3BR9A 4OI0A 4AXJA 3TVYA 3OBIA 3NMAA 5E33A 1N33J 1D9FA 1S57A 3UQSA 2WONB 3CJKB 3E51A 3CVKA 1N0UA 4B9TA 4DS5A 2WOMB 2YH1A 2LEAA 4KT0C 3CJ4A 2GVZA 2VQEF 1TKZA 4USWA 4BBYA 3DCAA 2CDRB 1H6KX 3Q89A 3QGGA 1X4DA 1DLOB 3EPGA 3HHKA 2KRBA 4DL6A 3FRZA 5CHCB 3IXQA 5E5NA 4YEAA 4WFXA 4ZVOB 1KOOA 1N54B 4W98A 1N48A 2BQ3A 8RUCA 1FERA 5H9FJ 3J80Y 1O0PA 4TU9A 2XSJA 3I5CA 4MKAA 3D6HB 1WEYA 1NLKL 4XAKA 4HACA 5KFBA 5CXTA 2V63A 4E0DA 2JZ5A 3VWSA 1C0TB 3HFKA 3W9JA 2W2OP 3R9LA 3B82A 2OPSB 3VZIA 1E6VA 1QLNA 1Q78A 1WOPA 3CUNA 3BH6B 3LQVA 2VD3A 4CLZA 1MROA 3GFHA 3BO2A 2WK4A 5KG2A 1RTIA 5DLGA 4ID5A 4WJBA 1K0VA 2R8IA 4I1TA 1NB7A 2ZM6J 3NAHA 4NZ0A 3W2WB 4GO5X 2ALZA 4FS2A 3W60A 3M8QB 4ZPTR 3TNVA 1IKYA 1S9GB 1RADB 4IR9A 3GIRA 1K9MT 1VHFA 1VQ5S 1PCAA 3E01B 1KSPA 5K9FA 3J7Z5 4JV0A 4R8UA 1UTAA 5F8LA 4B3RF 4GO7X 5DRKA 1GMWD 2DNMA 4EI2A 3NG8A 4J90A 4OX6A 2XS2A 3AD9C 3H2UB 3K2YA 4O3RA 1YBAA 2PMHA 2X1GA 4ZPWR 3NS6A 5D4OA 1A9NB 2NUHA 2FZCB 3E2EA 4TN2A 2MJUA 3GLJA 3CD5A 4ICLB 2LA6A 2N4CA 4RW7B 2LU2A 2MB0B 2OUGA 2FQQB 1SC6A 1KVJA 3C19A 1H74A 3DOKB 2CNNB 2J6UA 2BJ3A 2DNKA 4X4OA 1H73A 2EK1A 3D7SB 2YKOA 4I2QB 1XMQJ 2Y1LB 4V1Ak 5HP1A 1EQMA 2IAJB 3QWPA 3V6DA 1U1OA 2FJDB 1HNWF 1B0VA 3ILIA 1FWKA 3B6BA 4RW4A 3ZZTA 2XB2D 5LT5A 1YLXA 4LIRA 2N7YA 2Y1IA 3QIPB 2YPZA 3GTYX 3IN5A 4NMXA 4ETXA 3UR0A 4FYVB 2YNHB 4OX9J 2ZE2B 1HR0J 2BM0A 2HNZB 4QCLA 5L9XA 2HHWA 2IM3A 3LP2A 4WTOB 4USJC 1XBWA 1VDHA 1RYRA 3DU6A 2DHXA 3FCVA 4IG0B 3X1LB 5LM7E 4CO5A 2RNEA 4IQXA 4EBEA 4FZVA 1ZM3A 5KG3A 2QFIA 7FDRA 4OHWA 4NWBA 3MAAB 4RX6A 4C9DA 3DDIA 2CVIA 1M5SA 4FPRA 3GIMA 1LK7A 2Z0GA 4X2BA 2F4VJ 3OHBA 5HBMB 2IRUA 2DEJA 3P5BP 1LWEB 3ZZOA 4HDGA 3TQEA 1WHYA 3UW1A 3EJMA 1IBMJ 3H20A 2FGOA 3MPYA 4I2PB 3MPVA 1RLDA 2BUNA 1NK7A 1Z2LA 5L38A 1UVLA 2OELA 2IY5B 4Q0BA 2FHOB 2C2MB 2V94A 5J2QB 5JVGQ 1Q86T 3QRQA 1FX2A 1VIXA 4MK7A 3BPDA 4WTYA 2AYEA 3KOAA 2AIRB 1I5OB 5GMDA 3TYTA 2QZ8A 4DV3J 2MKSA 2NXUA 3NCPA 4DUZF 1HD1A 3OUYA 3R1HA 4ZHRB 4YB1P 1OYDA 4LRCA 2HQIA 2DIVA 4DI6A 3PW0A 5ETMA 1RAGB 3KNGA 1K8AT 4FF3A 2BR0A 4F4XA 1HBUB 4ZJQA 1FNOA 5AE2A 2KJWA 4KO0A 4OZJA 1RWPB 4LF7J 3D6TB 1FKOB 1S1XB 1IKVA 1IR1A 2J9EA 1Q1KA 4RBTA 4PXDA 1TTHB 4M1KA 4QYZJ 1F3VA 2F63A 4I6WA 2VA3A 2BKPA 2MDAA 1FJGJ 1Y7PA 3KHGA 2ZD1A 3KFWX 3HPOA 2I5JB 1UEUA 1TL7A 3NNAA 2EFVA 2VF3A 4FXWA 3MUVP 4F4YA 1H3DA 4OYIA 2G9OA 3U27A 4A8WA 2FPHX 1KLMA 2K06A 2K3IA 1YZ6A 4Q45A 1S4FA 4H54A 5KT5A 4ZCLA 2AZ1A 1HNXJ 3LH2S 2IJRA 1AB8A 3K8WA 4PWWA 2OAUA 4NRTA 4MJKA 1LWCA 5F8HA 4KPCA 3P6YC 2KH9A 1RBOB 2V68A 3K5NA 1HMVB 4OYMA 4P6QA 5AJ3F 5I3UB 5E0OA 1D9AA 5GADU 2P6TA 4P52A 4D3HA 3R5GA 3J7AN 1MMLA 1U2FA 3NCQA 3MR7A 2DGWA 3NY0A 4OL8A 3T5LA 3NGKA 5KOXA 3VQTA 4KIAA 2E7WA 2UVWA 4B3SJ 2VPXB 4PUOA 2E5JA 1L3UA 1Y5LB 3PV8A 2RMLA 2Q6CA 1TL1A 2B4OA 3LO3A 4QIWD 3G8SA 5IWAF 3AODA 5K8MA 3FUYA 2FJWA 3UVJA 3BKTA 2J7WA 4QWCA 1KQSR 3JSYA 3QAUA 4DSKA 2O66A 4JV5F 4LQ3A 1RWMB 2A10A 1VIOA 5CYQA 4HYKA 3DLKB 2H48B 1QY7A 2A18A 1JNRB 2F8HA 5IQQA 4JUZA 1LWFA 3DYAB 4OLPA 3OL7A 4NL5A 4UY8T 4JV1A 1S1TB 2E9ZA 5D3GB 2F3JA 1RUSA 4NLWA 2MMYA 4NI2B 3VF0B 4ECYA 1N6QB 3T1HF 2O67A 3OFGA 2HS0A 1J2VA 5JUMA 1PYOB 4B9UA 3BSAA 3OVAA 4L6V3 2AJQA 2FGCA 3AOCA 3OR1A 3M2UB 3GCWP 1D3WA 1S1UB 2YTCA 3ETOA 4I56A 2BJ1A 3EMTA 2RQKA 1VQLS 5KOWA 4F0MA 2HHHJ 1SH3A 1R0CB 2V9KA 4LFCF 3KYLA 3U1LA 4A8YA 5KTQA 1LQ9A 4G1IA 3RU0A 4ITSA 2DNQA 2MLYA 2DHHA 1RT7B 2LQJA 4MK9A 2CPJA 1MWZA 3BSNA 2CQGA 3C3LA 2EFOA 2K7KA 4ZMMA 2QYGA 5GVQA 4DWIA 2BW2A 5CQGA 3TJ8A 2UVUA 2ZH7A 4TQRA 3QGHA 2YQ3A 1JLEA 2I8EA 2M7SA 5EX0A 3RBXA 1V3ZA 4LF9F 4J9LA 1RAOA 5BYQA 1Q8KA 2CQ4A 2HFVA 2ZC3A 4NLYA 4YN3B 1KNZA 4LF5J 4BWJA 4DUYJ 2VDIA 4DQQA 1VFJA 2WONA 1DBDA 3CJKA 4J37A 2HQ3A 4E2FB 3GWCA 3SCKE 4J9RA 1RI7A 2WOMA 4MIWA 2AHOB 2DGUA 2PC6A 4WU3A 1SJ4P 2HHSA 3AD8C 3TUIC 3PTWA 4X4RA 3ZZUA 4B08A 1OY6A 3SXLA 1SJRA 4X4SA 1XMOJ 1EARA 1DLOA 3O3LA 3QGIA 1VQOS 1DURA 4K4VA 4MK8A 3ZNJ1 2YVSA 1VOMA 2QA4G 3KJVB 2B9XA 1I1GA 2J9CA 4C6AA 3BSCA 4OZ5A 3GG1A 4N56A 3BKFA 4TLQA 5A0YB 2IVFB 1HD0A 2B4VA 2C2DA 3W62A 5L46A 2WCXA 4K5RA 1RB0A 3WIVA 4WP3A 4K0KF 1ZA2B 5EGYA 3BN7A 1SUQB 4ES3A 2DXDA 2MHNA 4YR3A 1X0PA 2BE7D 3B54A 2BJDA 3FBEA 1WC1A 1RT3B 1YDLA 3HKWA 3I9ZA 1V9OA 4C0BA 2R2RA 3SEOA 2XS7A 3HD2A 3R8YA 1GXLA 2L3MA 1YHQS 1VQ8S 3M8QA 2GV1A 3HLUA 1S9GA 1SH2A 4ZJLA 4KRWA 1PJ6A 1NSKL 3TR5A 2UUBJ 4OQJA 1JJ2R 3PR4A 2VG7B 4JI4J 3FSXA 4G3IA 1M5KC 3DOLB 4Y65A 3SQGB 3C14B 3QZ8A 2G13A 1SIWB 3PRBA 5K14B 4NA2A 2Z57B 4ICLA 4PQUB 2V5HG 4RW7A 4K2JA 2C3YA 1Q5YA 1Y11A 2VL1A 3QATA 4NX9A 3QO9B 3N5FA 4O4RA 3QSYB 2CJKA 3DOKA 2JEIA 5J2PA 4MKBA 2V8VA 4R0EA 1NU4A 1F5CA 2OFHX 3R6GB 5IS2A 2BKNA 1WI6A 2IDLA 4Z7CA 4ZCKA 2IAJA 2XNRA 4DL7A 1SJ1A 4O0IA 3HVTB 2O1PA 2AF6A 4CYUB 4DR3J 2HLTA 1GX6A 4IUFA 2HVEA 3OVBA 4ZVHA 3QIPA 2YY3A 4IO1A 4CLLA 2YNHA 2ZE2A 3A3OB 1FRXA 2HNZA 4RO0A 4WIIA 3US5A 4DV6F 1JKHB 1QE1B 2CJYB 4C98A 1S1VB 1BGXT 1N5QA 4IG0A 1WACA 2G2OA 2NCKL 1U7LA 2GO8A 2BRLA 1PILA 3QIDA 2RE1A 3PHTA 3CCVS 3MAAA 3O5TB 1QD1A 3W8GA 1YJTA 2OFGX 1TZ0A 3M8PB 2N4DA 1BQMB 2HW3A 2PIIA 2CZ9A 2RJZA 3VAIA 2ZJRQ 3UN5A 1LWEA 2I38A 4X4PA 2DHAA 1P1LA 2HGNA 5F3TA 2JVRA 1IR0A 1UVIA 3FBCA 3FEXB 5L39A 3VGUA 4C97A 4JBCA 1REVB 4RW6B 5B09A 1R31A 4NA1A 3I82A 4CO3A 2B7CB 2YKAA 2CPXA 1RAIB 2LCWA 5J2QA 4R5PB 2E1RA 5A8WB 4ES1A 3SZ2A 3WIUA 4ZPBA 1FFGB 1JIHA 2XEXA 1C4AA 2UVRA 4F50A 4NPOA 1YZ7A 2HRTA 2MZQA 3P3DA 2RB7A 2RDJA 4LRAA 2DGOA 3DGPB 3M6WA 1T9WA 2UUTA 2CPFA 4LSLB 2JRSA 1HBUA 3NP5A 5D4LA 3J7A1 1N5SA 1RBAA 1M5HA 4NLRA 1M0SA 3CT9A 3ZTQA 4MAKA 3THPA 2QLJB 5KFYA 4LR7A 2RKIB 3A8KA 3NL0A 1S1XA 1OQ3A 4AE5A 4JI8F 4HT5A 2DNZA 2XLJA 2ZBCA 1DJ0A 4TXSA 1O6XA 4QQBA 2P6SA 4IKAA 5KFWA 4MKYA 1JQGA 1WKKA 4I68A 4DL5A 2E44A 2I5JA 2HQDA 2XSFA 3PKMA 3HHDA 4ZN3A 1S7HA 2FVQA 2MY8A 4EYIB 2GHWA 3VAHA 3G71S 5DDRC 4ZPAA 1SKWA 2I1RA 1VQSA 2ILYA 3OT9A 4KH1B 5B0DA 2KFYA 3T1YF 3LGMA 1Q8IA 5HK4A 3ILOA 1HMVA 2XLKA 2FJAB 5I3UA 3CDBA 1P9YA 5E41A 2BQRA 4F26A 2QO3A 1ZTWA 2FVSA 3SQOP 1N36J 2BW7A 3MGJA 1IBKF 2ZUGA 5B0FA 1I94J 3EPIA 3EUNA 5K8NA 4DR5J 2DRDA 4C8ZA 3MMAB 5IT9U 3TO8A 2HVHA 4HKQA 3LWMA 2E9TA 3E8OA 1TV6B 3KLFB 2ZBIA 3VGVA 5ADZA 3W9IA 2AEJA 2W01A 2G4BA 5K8OA 3NGRA 3DLKA 2XI2A 3DHXA 4IH7A 1BXNA 3QPIA 3RRKA 2LLZA 4X4NA 1NJYA 4LBIA 3HM9A 3M8SA 1NMEB 3TAPA 2CQIA 1SL1A 5C24B 2XBPA 3DYAA 3EGVA 4BC9A 4UZCA 3BKUA 3L09A 3VAMA 4DG1B 2GQCA 1S1TA 2YWKA 5A2QU 1KONA 5D3GA 4KV8B 5BYSA 1MSWD 1N6QA 5CD4H 1ZM4A 1VQ6S 3IWLA 2C3PA 1GTHA 3GYNA 2B9WA 1FEHA 5BR8J 1RT1B 2DITA 1ZH5A 4USUA 4PG6A 4PXEA 4FNHA 3M2UA 1N34J 4C4WA 1S1UA 1YJVA 2JLEA 5M2UA 1GAOA 3HJVA 2HIQA 4OZ1A 4N8OA 1WC5A 2RDIA 2IRYA 3C66A 1PG5B 3CCZA 2WHOA 4QR0A 2I0XA 4RUCA 2FDNA 5HVGA 3SYZA 3CCQS 2EBGA 1KD1T 3HSGA 4M5KA 3V6KA 4K4YA 1RA7A 3AD7C 5GAGU 1IWGA 4P9SA 1XNQJ 4RNMA 1S76D 1VRTB 1HNZJ 2IM2A 3MR6A 1V5IB 2V2QA 2ZNYA 2GAHC 3G8QA 1WG5A 3DRYA 1UPPA 3IA0A 4CLYA 1X4GA 4Z37A 2RHQB 2D74B 3GG0A 5LOQA 3WQPA 2VUGA 5KFAA 4AL5A 3LA0A 4ZS6A 4IH5A 4QIFA 4DCPB 2D9OA 2HEKA 4KR0B 4K4WA 1SCJB 4X4TA 4ED8A 3BREA 4OZNA 5GADI 5E3RA 3MEDB 1HQUB 3M9OB 4DV7J 2C3MA 2UUCF 4F3OA 4F0HA 4B3TJ 2LFVA 4DFMA 2DT9A 2EW9A 2R2SA 1HFEL 1F9EB 1GK8A 3I9V9 5KFHA 4TU7A 4UUXA 3BGLA 1BLUA 3GJTB 2W25A 2IBKA 4UQGA 1VR6A 1ZZNA 3BGOP 3D1HA 2HGMA 4RKUC 2GJIA 4WYLA 1M5VC 2XZWA 4TVAB 1NB2A 5T7LB 1HYSB 2OPQB 5HMYA 3TZWA 3PY8A 2HK2A 4L3NA 2YBVA 3PXGa 3CD6S 1SC1B 1XWLA 4O4GB 1DTQB 1RTJA 4C8NA 2N7CA 1EP4A 2UUAF 4YP3A 2DCLA 1SUQA 3NEKA 3CDUA 2HBQB 4QU7A 2RRAA 3C16B 2KVIA 3ZTSA 1AUDA 2GIRA 1SI9A 2JDJA 1D09B 1ZOTA 3CJ8A 1XERA 1MG7A 1JLGB 1RT3A 4J9QA 3MURP 2YXLA 2E5GA 1F9FA 2G1HA 3CPWR 2AD9A 4U8YA 4RL1A 3ITHB 2V8GA 4USTA 2FTRA 3HSZA 2ALYB 2FHJD 3ZO7A 1GTEA 3HT0A 4YB5A 3V5RA 4KPYA 1SV5B 1RHJB 2E5LJ 3HKZD 1XR5A 3N5BA 2EWHA 2VG7A 4CO2A 3UD5A 2LP4A 4QR1A 3K0JA 2VFSA 2P9GA 4KB7A 4JI0F 2MY7A 3DOLA 3E3XA 3RJMB 4KH0B 3SQGA 1UJ4A 3C14A 4CZCA 4NCAA 4MTPA 3MHYA 5K14A 1N0VC 1UJ5A 2A6MA 5JJBA 4FVCA 4PQUA 3UCUP 2EEYA 5D6GA 4EZ6A 3LTOA 2VG5B 4DL0C 3CJ0A 3MCOA 4DQSA 1WHWA 3D3BJ 4DS4A 1KLNA 4NLOA 3QO9A 5B0CA 2H65B 2IRXA 1I51B 4BDPA 5KFZA 3RGIA 3MM8B 4FN5A 4G1QB 3HVTA 5AE3A 3CW2C 1FA0A 4CYUA 1LEOA 1LW0B 3PFOA 3PW5A 4U8VA 1U02A 1RP5A 4WF9Q 4HDHA 1CJTB 3VGSA 4WYWA 5KFDA 2RAQA 1JKHA 5CA5A 1QE1A 4O0NA 3K8VA 3AB2B 4WK3A 1YWXA 1BMQB 4P72A 1S1VA 1OPZA 1SQFA 2CZ4A 3P8BB 1FEEA 3S7RA 4K50A 3I87A 5F41A 4Q44A 3BDPA 1CJVB 2UV8A 2FUG9 1RU2A 3M8PA 4OYAA 4DX6A 5DQGA 3W5YA 3IBCB 1BQMA 3Q8PB 2M3DA 1H0HB 1Y10A 3S8SA 4WFBQ 4X66J 3UDCA 2A6OA 1M1HA 3M2RA 1ACMB 3RR7A 3IR6B 1IVZA 1TUGB 2Y1RI 1ZYQA 5H9EJ 4ZOSA 1IQZA 4BWMA 3MEKA 2V4RA 2HVZA 2YQ1A 5KG6A 2IVYA 1NEEA 4PXCA 1REVA 4RW6A 1ZA1B 2Q6BA 2E5IA 3M4XA 4ZPVR 2M9KA 2OEJA 3LGNA 4R5PA 2DPJA 5A8WA 5FDLB 4JI7F 2M5YA 2EK6A 4DCJB 3N4WA 4N77A 3DFEA 1GMUA 3ISND 3WDOA 1O8BA 1S59A 1X4HA 2VQEJ 4KSEB 2GZOA 2DKOB 5ETKA 1HIYA 3CSKA 3DGPA 2AZ3A 4UTGA 3PJ9A 4Q7AA 2F65A 4MYUA 3N9UC 3RAQA 3SI8A 4YB7A 4LSLA 3IM9A 2RT3A 4P2XA 2D1CA 5HMWA 3OTDA 3KK3B 2HHVA 2VKZG 5IT9Y 4KJIA 1N5VA 2QSFA 2OSRA 3T41A 4NEZA 2RKIA 3NGSA 1NH7A 3RB3A 2DR5A 2E29A 4EO6A 1TK5A 2EC2A 2RQMA 1YJWS 3QSIA 4B9MA 5KFXA 1KKHA 2OEKA 3AA8A 1SKUB 4B3OA 3PW2A 2FJBB 1HBNB 2QLFB 4QWBA 2NZCA 1L3KA 3BO4A 4G1PA 2NPFA 2Y9HA 3IG1B 3I5AA 2H54B 2I2YA 4NLUA 3ZFVA 1D1UA 1VYAA 1XR7A 1OIAA 4TU8A 4JI1J 3VAGA 4RPFA 4WFYA 4B3RJ 4YOEA 4OHYA 2KT3A 4CT8A 3RBZA 4DSFA 1T9VA 2JHEA 3R2CJ 4PABA 3DXSX 1F60B 3UNGC 1RLCL 1VBXA 5LXRA 1N33F 5DM7Q 3EGWB 1WF0A 3GYXB 1LK5A 1NHVA 1LNQA 1URRA 4NCBA 2KG1A 2GO9A 1H2TZ 2ZBRA 4CP5A 1NKEA 1YRTA 3MMAA 4KHPF 3CIMA 3NGTA 1B4SA 4P71A 1TV6A 1PAEX 2RS8A 3VGTA 1OY8A 1FWPA 5CCMA 3KLFA 3OQ2A 5FLXU 4U96A 4A8OA 4OV6A 1TKXB 2GQ2A 5GAHU 3PYDA 3EGNA 2LVWA 1F9HA 3L95X 1HNWJ 3F73A 3IS9B 1RAJA 4HL9A 5C24A 1N88A 3T19A 2HZCA 2R8KA 3PRDA 4TNOA 4KAIA 1YTYA 3CB4A 4GKKF 5D0GA 3R3TA 1EZZB 4KV8A 4GMKA 2L41A 5J1EB 2RH3A 1RU1A 2HBZB 2MQMA 2VFVA 3M6UA 4O23A 2OSQA 4J9MA 3VR1A 3D0GE 3QT5A 2IBOA 4DN0A 1RT1A 1WHVA 2M4MA 2ASJA 3U1MA 4C3LA 4RU9A 3ENVA 2ZM6F 4UOGA 1ULRA 3A3PB 1RABB 4RW8A 2XO6A 4WE1B 4N76A 1S0NA 3EVWA 1U8WA 4DR6F 1SJ3P 3N6MA 2XZDB 4RWXA 4FF1A 3M05A 3A4TA 3OL8A 1IR2A 1DTTB 1QAJA 4C3MA 3QAEA 5KFIA 2XMTA 3KUEA 3MEEB 4OYWA 2DK2A 2B5JB 1VRTA 2W9BB 4Y2AA 4X4QA 2A2DA 2BDPA 1P8GA 3GCXP 4PG8A 1CQNA 4PEOA 2ASYA 3JQJA 1R8PA 1Z1ZA 1RISA 2AJ2A 2NSBA 4HTIA 2CQ3A 5KFLA 3AXKA 4DUZJ 1FX4A 4EBCA 3K5PA 2DH8A 4CLKA 1ZAWA 1F2HA 2YKNB 2ZDPA 4AL6A 2RQ4A 3MEDA 1HQUA 3OTCA 3OFHA 1T03B 4F2RA 4ANEA 4U7CA 2QIFA 1GMWA 2FVCA 2WW8A 1C1BB 1B7YB 5E3CA 1UKUA 2VBYA 4AQYF 1G6BA 1K1QA 3WC0A 2OTLS 2CJXB 2W9CB 2IJNA 1GXUA 1AT1B 3RAXA 1UVNA 5T7LA 1HYSA 4ELVA 2OPQA 1UVKA 3KLGB 2YWGA 3LP0B 2ZZNA 2LQ8A 2MQQA 3BM7A 4M5GA 4O4GA 1DTQA 3R5AA 4J9UE 3EDQB 3OSPA 2QV6A 4YDDB 3T3FA 1JLAB 3DLGB 4OX7A 4ED1A 3PG9A 3JS9A 3MFHA 1WEZA 1RAHB 4DFKA 3C16A 2E7XA 2F4VF 4ILRA 1R8CA 4NYOA 2NS1B 1UFLA 1JLGA 3H5UA 2EKYA 4YDXA 1LOUA 1UWAA 2PD1A 3ITHA 3M8YA 2HG4A 1RTDB 1J27A 4V19X 1UWBA 5AJ3J 3ZXWA 1SV5A 2D41A 4FBTA 4ANDA 4C11B 5KFPA 2IA6A 2HHUA 2MKKA 4DF4A 3UDEA 3QQCD 1ICEB 1LW2B 1VHIA 1T05B 2XYPB 5C2GA 3BB5A 5MAOA 4CLFA 1KQFB 4OI3A 3UFCX 2RHSB 3QFHA 3HMJG 2XCPA 1KQGB 1XTZA 1SL2A 2QA1A 3QLHB 4ECUA 4K8RA 3KLHB 1Y9OA 3JB9k 5I42A 4JV5J 3EVMA 1RBLA 2VG5A 4X65F 5GAGI 2BE2A 2PEBA 4F2SA 2EVZA 2RS2A 2HFZA 2GC8A 2XLIA 5KG0A 1KBRA 1VBYA 4M5DB 1WC4A 2YWFA 5F8GA 4QU6A 3V81A 4DR4F 2QFJA 3GIKA 1ZS6A 1TU0B 2KHCA 1F3FA 1SB6A 3MAQA 3AJ1A 2MQNA 2KYXA 2AYGA 1ZAXA 3C8YA 4LFAF 5KFNA 3H42A 3MM8A 3DXBA 4G1QA 3PEHA 1RT6B 2R8HA 4Y3CA 6FDRA 2VONA 1T9XA 1LW0A 2Q1LA 1C1CB 2ZNZA 2QSWA 3FKBA 2CRLA 3CE8A 4TYAA 3SFUA 3KLVA 1CJTA 3T1HJ 2Q3PA 1NZ8A 4LVNP 2VG6B 4L74A 2QTWA 5D4NA 3KK2B 4F4ZA 3HVWA 5HLFB 3LPYA 3GFYA 1OYEA 2WSCC 1WJ9A 3DLLQ 2VBWA 1CQMA 1ZZFA 2UU9F 2GA7A 2MSSA 4LFCJ 4YR0A 3K58A 2CWXA 2VV5A 1CJVA 3KJNB 1EETB 2OJ3A 1CPZA 3DHWC 1NHKL 3KXDA
chains in the Genus database with same CATH topology
4JI3J 4DR5J 4DUZJ 4NEZA 4LFAJ 1N34J 4KHPJ 4OX9J 1HR0J 4DR7J 5IT9U 2MQ8A 1XMOJ 4DV6J 2UXBJ 1IBLJ 1XNRJ 4DV7J 4KYZA 2UUBJ 4B3TJ 4DR6J 3R2DJ 3W1YC 4JI4J 4DV3J 4NEYA 4DV5J 3D3CJ 4JI7J 4DV1J 4JI0J 2E5LJ 4YY3J 4B3MJ 5LMNJ 4RJVA 5LM7E 4K0KJ 4AQYJ 1FJGJ 4LF9J 4LF4J 4JI2J 2MEWA 4GKJJ 4JI6J 5AJ3J 1HNXJ 3T1YJ 4PWWA 2KVQE 4LF6J 4X64J 3J81U 5FLXU 4DV2J 5IWAJ 4DV4J 3J80U 3T1HJ 1XNQJ 1J5EJ 4DV0J 3OTOJ 3JAMU 1N33J 2UXCJ 2VQEJ 1HNZJ 2UUAJ 4DR2J 4JI5J 2F4VJ 2UU9J 4KY3A 1HNWJ 2MTLA 4NXNJ 2KL8A 1XMQJ 4GKKJ 4V1Ak 5A2QU 4JYAJ 3J7AN 4LF5J 4DUYJ 4JI1J 4X65J 4LF7J 1IBKJ 4YHHJ 2ZM6J 3D3BJ 4LF8J 4JI8J 4HHUA 4LFBJ 4B3SJ 1IBMJ 4DR1J 4B3RJ 4LFCJ 4JV5J 2VQFJ 4NXMJ 1N36J 3IMQJ 4DR4J 1N32J 2UXDJ 5BR8J 2UUCJ 5LMUJ 4X62J 1I94J 4X66J 3R2CJ 2HHHJ 4DR3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 J;  4DR5 J;  4DUZ J;  4NEZ A;  4LFA J;  1N34 J;  4KHP J;  4OX9 J;  1HR0 J;  4DR7 J;  5IT9 U;  2MQ8 A;  1XMO J;  4DV6 J;  2UXB J;  1IBL J;  1XNR J;  4DV7 J;  4KYZ A;  2UUB J;  4B3T J;  4DR6 J;  3R2D J;  3W1Y C;  4JI4 J;  4DV3 J;  4NEY A;  4DV5 J;  3D3C J;  4JI7 J;  4DV1 J;  4JI0 J;  2E5L J;  4YY3 J;  4B3M J;  5LMN J;  4RJV A;  5LM7 E;  4K0K J;  4AQY J;  1FJG J;  4LF9 J;  4LF4 J;  4JI2 J;  2MEW A;  4GKJ J;  4JI6 J;  5AJ3 J;  1HNX J;  3T1Y J;  4PWW A;  2KVQ E;  4LF6 J;  4X64 J;  3J81 U;  5FLX U;  4DV2 J;  5IWA J;  4DV4 J;  3J80 U;  3T1H J;  1XNQ J;  1J5E J;  4DV0 J;  3OTO J;  3JAM U;  1N33 J;  2UXC J;  2VQE J;  1HNZ J;  2UUA J;  4DR2 J;  4JI5 J;  2F4V J;  2UU9 J;  4KY3 A;  1HNW J;  2MTL A;  4NXN J;  2KL8 A;  1XMQ J;  4GKK J;  4V1A k;  5A2Q U;  4JYA J;  3J7A N;  4LF5 J;  4DUY J;  4JI1 J;  4X65 J;  4LF7 J;  1IBK J;  4YHH J;  2ZM6 J;  3D3B J;  4LF8 J;  4JI8 J;  4HHU A;  4LFB J;  4B3S J;  1IBM J;  4DR1 J;  4B3R J;  4LFC J;  4JV5 J;  2VQF J;  4NXM J;  1N36 J;  3IMQ J;  4DR4 J;  1N32 J;  2UXD J;  5BR8 J;  2UUC J;  5LMU J;  4X62 J;  1I94 J;  4X66 J;  3R2C J;  2HHH J;  4DR3 J; 
#chains in the Genus database with same CATH topology
 2GQQ A;  5KFG A;  1X4C A;  1Q8L A;  1RAC B;  3KKF A;  1NSQ A;  2HIY A;  4CRJ A;  4ZLL A;  1FJ7 A;  1KS2 A;  4EYH B;  2OLW A;  4ALZ A;  3DLH A;  4CDI A;  3QYY A;  5HVF A;  4C0H A;  3C2P A;  3H5X A;  2Z2L A;  4M5M A;  1A6L A;  1B64 A;  3CNQ P;  1UVM A;  4M5H A;  4LF9 J;  2YNG B;  3GPA A;  4DV5 F;  3PR5 B;  3CD7 A;  2CPY A;  5BXI A;  3W61 A;  1S49 A;  3CJS A;  4FKX A;  3SDE B;  2HHP A;  5FDL A;  1HW8 A;  1FE4 A;  1GT8 A;  2P8I A;  1U1K A;  3FZ2 A;  3TUP A;  4CH7 A;  3MUT P;  3R6L B;  1BUX A;  4NYP A;  5A8K B;  1QM9 A;  2HND B;  1R6V A;  3UD4 P;  3BBC A;  3OTO F;  2UXC F;  3MPW A;  2JOQ A;  1T9Y A;  4ZP6 A;  1VQP S;  3PW4 A;  1PJ7 A;  5KFT A;  1ROF A;  4ATN A;  4NLP A;  3I32 A;  3MXH P;  4GVL A;  1UMJ A;  3KG0 A;  4OIX A;  1RWO B;  1HNI B;  4NLV A;  1HI1 A;  2ASL A;  4O3O A;  2R2U A;  2G1D A;  3J81 Y;  3KK3 A;  2F5G A;  5J1P A;  2IIH A;  1QUP A;  3JAM Y;  5F8M A;  5JXS A;  3A8J A;  3RR8 A;  5FII A;  4OZ3 A;  3G87 A;  2DTJ A;  1XEZ A;  2GIQ A;  2KFN A;  4K0K J;  1REG X;  2R9L A;  1XK8 A;  3ZZZ A;  4O3N A;  5LXY A;  1FRK A;  2OI2 A;  1RTH B;  1FRI A;  1S7I A;  3D6F B;  3F0N A;  4DPU A;  2Y8W A;  1S0O A;  1HBN A;  3FMB A;  3IO1 A;  3KDO A;  1EKS A;  5EN1 A;  1EJ7 L;  1VGY A;  2IA0 A;  3PX0 A;  2CAJ A;  5F9L A;  3TW0 A;  5B0A A;  2KB2 A;  3IG1 A;  4OLO A;  5LSR A;  4QWD A;  3M6X A;  4QR2 A;  4HR2 A;  3FVY A;  5G4D A;  5A8R B;  3W5X A;  2W8L A;  4YHH F;  3MMJ A;  5DO2 A;  5DET A;  3TAR A;  2AX1 A;  2UZA A;  3RW6 A;  4ZIT A;  2J0X A;  2R8J A;  4L75 A;  1S0V A;  1N4L A;  4X62 F;  4KE5 A;  2E1C A;  1S79 A;  4RJV A;  4ETZ A;  3VAJ A;  4M94 A;  2ZH3 A;  1KVK A;  5IV3 A;  5C7P A;  4TY8 B;  2DIU A;  5ITH A;  1OWX A;  4PG5 A;  5D8H B;  2WBM A;  4L76 A;  1PAU B;  1FDA A;  2QT7 A;  2XY7 A;  2CYY A;  5KFC A;  1UA1 A;  2UV8 G;  1PGZ A;  2AV5 A;  2HAI A;  1E6Y B;  2CQC A;  2CZV C;  5C5J A;  3PFE A;  5EWF A;  3CXC R;  1H72 C;  5JVH Q;  2ZH1 A;  3QMQ A;  1PBA A;  3TA1 A;  1KHV A;  1QAI A;  3KJF B;  3IS9 A;  4QBU A;  1UCN A;  1U4B A;  1NK8 A;  4EFA C;  1FK9 B;  2XNQ A;  3W7B A;  1B70 B;  3GV7 B;  4FYY B;  4N8N A;  2LKZ A;  4NAS A;  3AJD A;  4DSL A;  5DLF A;  1PO6 A;  4DV6 J;  2ZKU A;  4FPI A;  2XO7 A;  3FEY B;  2IM1 A;  3DLE B;  2ABY A;  3D28 A;  3CF5 Q;  2CNK B;  2AJ4 A;  4CO4 A;  2BJ8 A;  3IGV A;  4CIO A;  4ED2 A;  7FD1 A;  3FSI A;  4ZVG A;  3CDE A;  1S97 A;  1BHN A;  4C8K A;  4J7C A;  3FCW A;  3DRP B;  5LJ5 Y;  2WB4 A;  2U1A A;  1YGY A;  4WE1 A;  1JK9 B;  2QN6 B;  2QMU B;  4KC5 A;  2JH3 A;  4WCE Q;  4LSN B;  1FRJ A;  3HI9 A;  1ZET A;  1VBZ A;  1H2U X;  1U6B A;  4DV4 F;  4IRD A;  5DQH A;  2W4D A;  2HS3 A;  2M0G B;  2BAC A;  3MEE A;  2FZG B;  3AHP A;  3ZZR A;  2B5J A;  2KG0 A;  3S01 A;  4ERD A;  1S4E A;  2EFG A;  5KAK A;  1Q5V A;  2W9B A;  4NOH A;  3SBM A;  3OLA A;  1SKS A;  3A12 A;  3CC7 S;  2DH9 A;  3UCZ P;  1I6J A;  1U1N A;  3KMQ A;  4NYZ A;  4U7U K;  3KJQ B;  1NSA A;  3MOJ B;  1ARO P;  2UVV A;  1XNR F;  3FQL A;  2YKN A;  1D0E A;  2QG9 B;  2MXY A;  4QIV A;  3J7Z T;  2ZEJ A;  1N52 B;  1RWN B;  4R0J A;  3T5K A;  3TI0 A;  2F7V A;  5HRO B;  2MZR A;  2KVQ E;  2CXE A;  1T03 A;  1XN9 A;  4O3S A;  2WTF A;  1C1B A;  3M9N B;  4KY3 A;  2GML A;  3DKD A;  1CEZ A;  3W3S A;  3NNC A;  2CNO B;  2RIJ A;  2K1R B;  1P27 B;  3LWL A;  3HHL D;  2W9C A;  2AJF E;  4JI5 F;  1W26 A;  4JI8 J;  1T7P A;  4ECQ A;  1GX5 A;  3KLG A;  3HHN B;  5BJR A;  1WI8 A;  2FC8 A;  4AUK A;  3K57 A;  4KGZ B;  3D1O A;  5GAH I;  1UVJ A;  2XMV A;  2ZWP A;  4Y28 C;  2EFQ A;  1U1L A;  4DSI A;  2AX0 A;  4NXM F;  1CJU B;  5T41 A;  1ELO A;  3VZH A;  2H9Z A;  2ZVS A;  3P49 B;  1TKD A;  1U0H B;  3BV8 A;  1HAR A;  4LBP A;  3FFI B;  2CPE A;  2AW0 A;  4FS1 A;  3POT B;  2W4C A;  1NND A;  3D1Q A;  5EHH A;  1L3T A;  3T1Y J;  1S6Q B;  4XO0 A;  4HI2 A;  2HYI B;  4C11 A;  3OPK A;  5E2Q A;  1W2I A;  2RUS A;  4MFB B;  1KTV A;  2MYF A;  1L3V A;  4OX8 A;  1EQ0 A;  1EB0 A;  1LW2 A;  4ZVR B;  1T05 A;  3WX8 A;  1IBK J;  2M8H A;  5A6W A;  2B9Y A;  1NO8 A;  1CVJ A;  2X7I A;  3QLH A;  4KGX B;  2DXE A;  1GQE A;  3Q2S C;  2CQD A;  4YR2 A;  4ELU A;  1HWK A;  3ILL A;  2HHQ A;  4O44 B;  4M5D A;  2HNY B;  3DU5 A;  3GIL A;  4Y0F A;  1CG2 A;  3FQK A;  3PKY A;  2VA2 A;  2W2M P;  3QJP A;  3FGV A;  4KHM A;  3H4B A;  2WRM A;  3PJW A;  3JSM A;  1RT6 A;  1RAE B;  3T9Z A;  2DYA A;  5LMN F;  3R5B A;  5IM0 B;  2J8A A;  3OTE A;  1C1C A;  1VMB A;  3CUL A;  1MNE A;  1E6V B;  1P9Q C;  2BXJ A;  5DZ7 A;  1S6P B;  3R97 A;  2ILZ A;  2H51 B;  5IOL A;  4PCQ A;  1M5P C;  2VG6 A;  2QJ3 A;  1QSY A;  2OMO A;  5HQM A;  2DXF A;  1IUJ A;  3KLI A;  3KK2 A;  4DR2 F;  1TK8 A;  5HLF A;  3LPE A;  3TA2 A;  3NS5 A;  2ZH4 A;  1NHU A;  1OMS A;  2C22 A;  2M8D B;  2ASD A;  1RHK B;  3B4M A;  4QW9 A;  3CO0 P;  4LR8 A;  3OL6 A;  2BBE A;  3L7U A;  2IJF A;  3ENQ A;  1VI7 A;  2LYV A;  5B7W A;  3T9N A;  1EET A;  1WTB A;  3H90 A;  5L1K A;  4DL3 A;  4KTQ A;  3CGI A;  3OFF A;  1S6U A;  5KFO A;  9ATC B;  1XC9 A;  2XZT B;  3R7S B;  2YPY A;  1X60 A;  5B0G A;  2DY1 A;  1MMN A;  1KC8 T;  2QYC A;  2J6T A;  1H38 A;  1U26 A;  2LEP A;  3GFX A;  2XMU A;  2NYI A;  2X3D A;  2QMX A;  3D54 A;  3UDL A;  4DUT A;  2QE5 A;  3MD1 A;  3J80 U;  2E9R X;  1WTF A;  2YNG A;  2GMH A;  4LF4 F;  3QBC A;  1APS A;  1U2C A;  3OSN A;  5E3Q A;  1UW4 A;  5HJY A;  2YKP A;  3Q8Y A;  1U6F A;  3EXY A;  2HBR B;  2IYG A;  3SDE A;  3KHH A;  4HH1 A;  4IDK B;  5B0B A;  2CNL B;  3SIP B;  3TAN A;  2UP1 A;  3T6B A;  4JB8 B;  4ZVE A;  2DNR A;  5A8K A;  3IBW A;  2HND A;  5KFF A;  1F2G A;  5ETV A;  4ZIW A;  1JJC B;  2NRE A;  2UUC J;  3GB0 A;  3N0V A;  1FRM A;  4W90 B;  3TVZ A;  2WW4 A;  3CCT A;  1X5T A;  3DOM A;  2VOO A;  4ECZ A;  1DAX A;  2IM0 A;  3EWG A;  1HNI A;  2WVB A;  2DCU B;  1F1B B;  3OD2 A;  4U95 A;  3TQ1 A;  3I4P A;  3D0I E;  5HMZ A;  1DY3 A;  3I0S B;  2YQ0 A;  4PPD A;  1YKW A;  5AXK A;  2C3O A;  4IG3 B;  2CQH A;  3QWU A;  3H2V E;  5H1S V;  3GII A;  4FXV A;  4N7T A;  3G96 A;  1FDD A;  4ZK7 M;  4JI2 F;  2UUA J;  3N01 A;  1SBR A;  2K2P A;  1RTH A;  1KFS A;  3HZG A;  5EX3 A;  2G0C A;  4OZ0 A;  2W9A A;  3PRV A;  3WHI A;  2U2F A;  3ILJ A;  1SKR A;  4IFY B;  8ATC B;  2DPI A;  1WOS A;  2MLX A;  3OTB A;  3G82 B;  2V0N A;  3NMR A;  4CO1 A;  4DSE A;  3H59 A;  1P6T A;  1YIT S;  4PRF A;  2V2V A;  2F1F A;  2KRR A;  2ACY A;  3I31 A;  4LFB F;  3RB4 A;  2ZOG A;  3AB4 B;  3FRY A;  2MZJ A;  4GC7 A;  3D67 A;  4F4A A;  4NLS A;  5HVH A;  2BJ9 A;  4F3Q A;  2BVZ A;  2KZM A;  4YME A;  4XPC A;  3T6J A;  4JI0 J;  2JEG A;  3X3U A;  3M2V B;  2F4F A;  4G65 A;  2NSC A;  4DQI A;  2OEM A;  4F02 A;  1GFW B;  4OJ1 A;  2MZ1 A;  2J0Q D;  2Z8Q A;  3MM9 B;  5KT4 A;  3F44 A;  4RUA A;  2EC0 A;  4HHH A;  3VQS A;  2NYH A;  5CZV A;  4YB6 A;  4K59 A;  3CCE S;  3O2I A;  1CS4 B;  2JLG A;  1XR6 A;  4J9K A;  1S6O A;  4KO0 B;  1E6Y A;  4WKY A;  2D3U A;  3G6V A;  1R3N A;  3RAM A;  1HLW A;  4H4O B;  3ETM A;  3EE3 A;  4WFZ A;  1FI4 A;  2VU5 A;  2OD6 A;  1ZM2 A;  1VQ4 S;  4ZLP A;  4EEY A;  1NKC A;  1JXV A;  3AJ2 A;  3R7N B;  1FK9 A;  4A8F A;  2UXD F;  3MD3 A;  1KRP A;  4DX8 H;  1X8D A;  4Q5V A;  2MKY A;  1GEH A;  2GMJ A;  1HBM B;  3EGZ A;  5EWE A;  2KT2 A;  2ZVI A;  3H98 A;  3I6P A;  1C0T A;  3IGN A;  2ZC4 A;  2DR8 A;  1SQE A;  5AT1 B;  3U02 A;  2Z2Y B;  5BYR A;  4P10 A;  2YWE A;  4MT1 A;  4ZLJ A;  4I6Y A;  4Z7Y A;  2OPS A;  2KFZ A;  3BGU A;  1SPB P;  2NXJ A;  2YKQ A;  1WSR A;  4BS2 A;  4DBQ A;  2BMB A;  2Y0S D;  1WG4 A;  3DRP A;  2PMW A;  1NJZ A;  3VVT A;  3SSS A;  1YJR A;  2D3O R;  4LSN A;  4DV2 F;  2YH0 A;  3R7B B;  4B9V A;  2JSX A;  3W2W A;  4YS2 A;  1C0U B;  3PJX A;  2R8G A;  1VS3 A;  2V4Q A;  2R7R A;  1LFW A;  1FJC A;  3CCM S;  2FHK A;  5I4M A;  3RBD A;  3E01 A;  3MPD A;  4I67 A;  3FK4 A;  2OGU A;  2BV3 A;  1S72 S;  4NLX A;  1Y00 A;  1RWV B;  2XWY A;  1FFS B;  4DEZ A;  3THT A;  2V4J B;  4UT4 A;  3H25 A;  2PI4 A;  5KFR A;  2WSF C;  4PWU A;  2F8E X;  3HSJ A;  4W92 B;  2PDA A;  4JI7 J;  5IT0 A;  2MQO A;  2RDD A;  4DR7 F;  4ZP7 A;  4A8K A;  3HZE A;  3HO1 A;  1FDB A;  2R7T A;  3PCO B;  1MWY A;  1EAY C;  4ECX A;  3CCW A;  4DV1 F;  2CDQ A;  5IFM A;  1UET A;  2FIU A;  4YY3 F;  2FC9 A;  2FHJ A;  1WKJ A;  1TR0 A;  1QUV A;  1RAA B;  4I2Q A;  1LWF B;  2R7U A;  1FD2 A;  1S1W B;  1JMT A;  1D8Y A;  5HRO A;  1RQ0 A;  1WHX A;  4JOU A;  3D9B A;  1SJF A;  4B9S A;  1X4B A;  3NWG A;  2A1B A;  2XS5 A;  2E5H A;  2CVE A;  2ADC A;  2BYC A;  4TYB A;  2ZHA A;  2H3E B;  2K1R A;  1U0S A;  5CYJ A;  4BC7 A;  2J7U A;  4ZPD A;  4TLR A;  1Q95 G;  4USV A;  5KFU A;  2C2R A;  1HNV B;  2G2Z A;  1NDC A;  1X5S A;  3TAM B;  2B3T B;  2OKQ A;  1X9W A;  2GW8 A;  1U1P A;  3CED A;  2LQ5 A;  2C42 A;  2J6S A;  8AT1 B;  2C2K B;  1CBK A;  3M32 B;  2Y0B B;  1CJU A;  3BPS P;  2ROP A;  2DGV A;  3JSR A;  2E1M C;  1JJH A;  2B51 A;  4QW8 A;  3Q8Q B;  3EX7 B;  1WOO A;  3MCM A;  4L73 A;  1U0H A;  2VIC A;  4Q43 A;  3UNY A;  1R7I A;  2DNY A;  2WB1 D;  2MEW A;  2GGP B;  3FFI A;  2DRA A;  3HHL C;  1BD6 A;  2XMJ A;  4K5S A;  3POT A;  5HBM A;  4M63 A;  1NDK A;  5D0R A;  4MH8 A;  2QGF B;  5GAE U;  4IOA Q;  3W8P A;  3GP9 A;  2C2O B;  3BJY A;  4CLU A;  1KTQ A;  4ED0 A;  3Q8R B;  2MTL A;  2KL8 A;  1S6Q A;  2ZKT A;  3KLE B;  1CSJ A;  4DV0 F;  3CJT A;  4WXW A;  2QEX S;  4Q8E A;  1FXD A;  3GE9 A;  1OY9 A;  3Q23 A;  2PO4 A;  4Y2K A;  4I2P A;  4MFB A;  4D3G A;  4Y34 A;  4M5I A;  1VJQ A;  5AXN A;  2E7V A;  4F25 A;  5DDQ C;  4CLP A;  1AXQ A;  4DPO A;  1HHQ A;  4IRK A;  3NGD A;  1GXT A;  4ZP8 A;  2YWH A;  1MW7 A;  5LJ3 Y;  4KHP J;  5E3A A;  2NQP A;  1VK8 A;  1TK0 A;  4QYR A;  4ZVF A;  4ZHR A;  3ZZY A;  2ZJP Q;  1WEL A;  3ET6 B;  3CMA S;  1RCX B;  4Y2C A;  3VTI A;  1R8H A;  2ZOF A;  3OXL A;  4DU7 A;  1MLA A;  1R8A A;  4O44 A;  3QJJ A;  3CWJ A;  2HNY A;  2P2C B;  5M2R A;  2DH7 A;  1HI0 P;  2OD4 A;  2RD5 C;  5C2C A;  4F3M A;  1RJJ A;  2CUY A;  1Q7L B;  3I56 S;  1B99 A;  4EGL A;  4O3Q A;  4LF6 F;  4GKK J;  3NBP B;  2V6A A;  5IM0 A;  3BGF A;  3MI7 X;  4I4B A;  5D4P A;  1FKO A;  1J5E F;  4AD6 A;  3QT6 A;  2BAN B;  1JLC B;  1S6P A;  2VDH A;  1Y0H A;  3VAK A;  4QJV A;  4CTA B;  4W4M A;  2ZDO A;  4EZ9 A;  1S99 A;  2Z56 B;  3V6H A;  2DBB A;  2R42 A;  1N8R T;  4UQT A;  2W8K A;  2WVF A;  3UO0 A;  3ICL A;  4MKV A;  4CNY A;  1N32 F;  4PYA A;  3MMC B;  4JI1 F;  4DR6 J;  4A48 A;  4NEY A;  3ENA A;  4DSJ A;  3WZ0 A;  2BJE A;  1PBU A;  2WSE C;  2QLB B;  1RA6 A;  3P96 A;  5F0W A;  3KHR A;  1Q16 B;  2YX4 A;  1FHT A;  2HVI A;  1U2R A;  3EZU A;  2JNJ A;  2HZV A;  1FFW B;  4DX5 A;  5CD4 A;  1V3S A;  3L3C A;  2EKN A;  1VQK S;  3MEG B;  2A0F B;  1BWE A;  4URG A;  2L08 A;  3U1N A;  5KFS A;  4LBH A;  4AL7 A;  1W7W A;  3LOU A;  3RRH A;  3KUG A;  3EXC X;  2Z58 B;  5HAO A;  3QRR A;  1WF1 A;  2AU0 A;  4OJH A;  5IC4 B;  5K8P A;  5J2P B;  2O5D A;  9RUB A;  2MQP A;  3QRP A;  5L9N A;  3L7O A;  2PN6 A;  2H4W B;  3H4D A;  4IDK A;  3PX6 A;  5CCL A;  1S9E B;  1WF2 A;  4LRF A;  4F4K A;  1VBK A;  2YKM B;  2XQC A;  3M6V A;  4DR1 F;  2QL9 B;  1RWU A;  4KQZ A;  2B7B B;  4FP9 A;  1YRU A;  3ELH A;  3A1Y G;  2C2N A;  1RZM A;  2DR6 A;  3AA9 A;  4HEA 9;  3Q8U A;  4X84 A;  3IRX B;  2DNH A;  1SC4 B;  4ZLN A;  1UZD A;  2NXE A;  4ZVS B;  4DX7 A;  2JC1 A;  3PO4 A;  2HK3 A;  2V34 A;  3AQP A;  3SV3 A;  4AQY J;  4F04 B;  3MEC B;  1M1K T;  3OVS A;  3QNW B;  1XMB A;  1XJW B;  2OHD A;  4NI2 A;  2W1B A;  3W5Z A;  2DNP A;  3I0S A;  3TAQ A;  2WAQ D;  4GKJ F;  1VLO A;  1ZM9 A;  4KFB B;  4IG3 A;  2E66 A;  3L4B C;  4X64 F;  4DLG A;  2JJ4 D;  5C42 B;  3NKY A;  3PW7 A;  5DS7 A;  3NCR A;  4N41 A;  4QPX A;  3RW7 A;  1Q4R A;  5F9N A;  4GC6 A;  1IJE B;  4QIG A;  4RNF A;  3QFW A;  4IFY A;  2DR7 A;  2CIM A;  4LF8 F;  3G82 A;  1VIS A;  3J81 j;  1EX8 A;  1HL6 A;  3GR1 A;  1G3O A;  3VAL A;  4C7Q A;  1RT7 A;  2D3Z A;  4OHX A;  4DPT A;  1OQ6 A;  2ACM A;  5LMU F;  1KP6 A;  4A46 A;  3TVK A;  2GS8 A;  2RVJ A;  1X4F A;  3THV A;  5HAT A;  3C6U B;  2B0G A;  1WC0 A;  2R7V A;  2LEC A;  1WOR A;  1JLQ B;  4TKT A;  1AFI A;  5J2N B;  3WC2 A;  1TKT B;  4NLQ A;  3ISZ A;  3RB0 A;  3M2V A;  2BOA A;  1HWJ A;  3O44 A;  3GSD A;  3N28 A;  2DNL A;  2WVE A;  4JI6 F;  5DDP C;  3RB6 A;  3D68 A;  3Q0A A;  3BEG B;  1PYT A;  3MM9 A;  5CAA A;  3OL9 A;  4YUD A;  4EBD A;  2GCF A;  4DFJ A;  4X65 J;  1LFP A;  3M8Z A;  2AJ1 A;  4RNN A;  2HQC A;  1CS4 A;  3PX4 A;  2JEJ A;  2XYH B;  4CM0 A;  4DR4 J;  3GV5 B;  3CDW A;  2LXF A;  2DIS A;  4ZP9 A;  4E98 A;  1TP7 A;  3SFG A;  4ED6 A;  2A3J A;  5F0U A;  4DQP A;  2F40 A;  4H4O A;  1SVD A;  4LFA J;  1HQE B;  2RU9 A;  4F7V A;  2G0J A;  3JYT B;  3KJV A;  2AP6 A;  2KXH A;  2CA9 A;  3M9M B;  1N5Y B;  2R7Q A;  3KK1 B;  1RWW B;  4LUB A;  5KT3 A;  2UXB F;  4RBU A;  5A0Y A;  3VCD A;  1HBM A;  1FKA F;  2I6W A;  1SL0 A;  1PKU A;  3K59 A;  1S9F A;  2CFX A;  3I55 S;  1QAY A;  1BQN B;  3EIC A;  5EWG A;  3CD0 A;  2AKW B;  2LEB A;  1X9M A;  2FLL A;  4DPW A;  4OHV A;  1URN A;  4J9N A;  2UU9 J;  1QAX A;  4RNO A;  3L9Z A;  4OI6 A;  1ZBT A;  2Y3Y A;  1TFW A;  4Y2M A;  1Q0N A;  3GZ7 A;  1JNZ B;  1RHM B;  2OPP B;  2DGS A;  2W2P P;  3UN3 A;  2IMW P;  2XMK A;  1Q79 A;  5D78 A;  1V6H A;  4ZVQ B;  1U25 A;  3SCL E;  2MQL A;  1C0U A;  4QWE A;  5ETL A;  4JYA F;  3NOG A;  4F67 A;  4WFN Q;  3HHL B;  1CC8 A;  4DPY A;  4Q2L A;  3VAF A;  5B08 A;  2NXC A;  1VRU B;  2BE9 B;  5KFE A;  2K3K A;  2VFR A;  2VQF F;  1FF2 A;  2JFK A;  1U1Q A;  3D4J A;  1T02 A;  4UY8 5;  1YK9 A;  5A6P A;  4IH6 A;  2V4J A;  5E3P A;  3V2U C;  3EDR B;  1RHQ B;  1RHR B;  1YJN S;  3HF5 A;  4DV5 J;  1YJ9 S;  1FCA A;  4QOT A;  2FD2 A;  2HWT A;  3PVX A;  2HPU A;  5HQL A;  2RUG A;  4HT7 A;  2PFF B;  1TMJ A;  3MTJ A;  1NJI T;  1H98 A;  2XG8 A;  3DGV A;  3H7H B;  1KDN A;  3MR3 A;  3AOB A;  2G2Y A;  3Q86 A;  4K4U A;  3GJQ B;  3MZI A;  5HAN A;  2IFX A;  2NUU G;  1B0P A;  4N5S A;  3OTO J;  3W66 A;  2UXC J;  2ZH5 A;  2CPZ A;  4GVB B;  2ZHB A;  4AYB D;  2COL A;  3MMB B;  2AJ0 A;  4B9N A;  3KNA A;  4FYW B;  3F41 A;  1S1W A;  4ZDN A;  2HSE B;  2P9E A;  5L8R C;  1U1M A;  3AFG A;  4C8M A;  4QIE A;  3UCG A;  2XHW A;  2ZWO A;  3A13 A;  3TUJ C;  1RGV A;  5I3Q A;  2MKC A;  1VJW A;  4CLS A;  4XK8 C;  1H7X A;  1D9D A;  3TJ9 A;  1WDD A;  4RBV A;  2N3L A;  3MM7 B;  4J9V A;  2F9D A;  5C25 B;  2MJN A;  3JTO A;  4EK2 A;  2MQ8 A;  1T95 A;  2X3G A;  4DZ6 A;  2H1Y A;  1NDL A;  3NWR A;  4KYZ A;  4Y6I A;  1HNV A;  2B6A B;  3TAM A;  2KHD A;  4FNI A;  1HQ2 A;  5RUB A;  3OJU A;  3N6L A;  2DJW A;  1Q7Y T;  3AXM A;  2DY9 A;  1DQ9 A;  3VV2 B;  4BCA A;  3M32 A;  1WDT A;  2OH2 A;  4ED5 A;  3ONQ A;  3G8T A;  3CO9 A;  4NCG B;  4WK1 A;  2Y8Y A;  3FZB A;  3HVA A;  5AXL A;  1X4A A;  3PYE A;  3HJF A;  1HKA A;  3SSR A;  2W7A A;  4X4V A;  2GGP A;  2KXN B;  3Q22 A;  3S1T A;  2MZS A;  4P2S A;  3MWB A;  1R0B G;  3CMQ A;  4ZCI A;  4C48 A;  4NML A;  3S6E A;  2JWN A;  1KVI A;  4YHH J;  1AYE A;  1AZS B;  2QC3 A;  4NXN F;  3QT7 A;  4ID8 A;  1VQY A;  3KG1 A;  3KLE A;  2NZ4 A;  1F5B A;  2DO4 A;  4LJM A;  2IMO A;  2IDE A;  1BE4 A;  4X62 J;  3K89 A;  4IR1 A;  4IFV B;  1UEK A;  4YFU A;  4OYP A;  3T1A A;  1IWA A;  2RRB A;  2GAG C;  2AGQ A;  5CZX A;  4LMZ A;  1VLY A;  1FDN A;  1FES A;  4OFZ A;  1N56 A;  3D3C J;  4AFF A;  4KGK A;  3HDS A;  2YNF B;  3IWN C;  1DHM A;  3ET6 A;  2HRU A;  4OJG A;  2DNG A;  3CCS S;  1M90 T;  3TZY A;  3EVO A;  2CG8 A;  5IXU A;  3CTR A;  2AT1 B;  2LQ9 A;  4USH A;  4PAA A;  2ZIT A;  4J9P A;  1YBT A;  5F8I A;  3IAS 9;  3BQ2 A;  1FVS A;  1KFD A;  1TUW A;  3TWZ A;  3NBP A;  1RTJ B;  3OHA A;  1UFK A;  1EP4 B;  2BAN A;  1JLC A;  1U09 A;  4K4S A;  4ANC A;  3FC9 A;  3NNH A;  1RTZ A;  4ZA1 A;  4CTA A;  1FNM A;  2PSZ A;  1EHW A;  3MAH A;  3IFE A;  1YBU A;  3PZP A;  5IQ6 A;  1U24 A;  4LSZ B;  4OYX A;  3FBF A;  3R2D J;  4JI3 F;  1PJ5 A;  2FLP A;  4DF8 A;  4I64 A;  1F0X A;  3B4D A;  4C2M A;  5A2Q Y;  3MMC A;  1IBL F;  1CC7 A;  2LQB A;  3PO5 A;  4WXO A;  1S77 D;  2XM3 A;  1R8B A;  3OJS A;  3U7J A;  2OO4 A;  2B4P A;  2AWZ A;  4B3M F;  3AY0 A;  4DV4 J;  2CJB A;  2VFT A;  5D0H A;  2LXU A;  2PFD A;  4DLE A;  1WWH A;  2JEF A;  5B0E A;  3QJL A;  4L72 B;  2HQG A;  3KDN A;  4H4M B;  4QPT A;  3ZZP A;  3V4M A;  2RU3 A;  2JC0 A;  1KQK A;  3N6N A;  2GFF A;  4OYZ A;  2LA4 A;  2FJV A;  5DJB A;  1NZA A;  3MEG A;  4GRS A;  2Z2Z A;  5H9F K;  2W2N P;  3J7Y U;  2YX1 A;  4WZM A;  1YI2 S;  1HPZ B;  1WSV A;  1JX4 A;  5GAE I;  5DGA A;  1IXK A;  2BKO A;  1S9E A;  3LAN A;  1JLB B;  5CAB A;  3MPU B;  1XNR J;  4I0W A;  1PIE A;  1DFD A;  2YKM A;  3ENW A;  4P74 A;  3HFZ B;  4Q2M A;  1TL4 A;  1MU2 B;  1G4C A;  1SQG A;  2CQ2 A;  2LDI A;  4EUV A;  4IYQ A;  4AXI A;  1CLF A;  1DAR A;  5FJ4 A;  3IRX A;  5KFQ A;  1NDP A;  1Y5N B;  2CAD A;  3A8I A;  1A7G E;  3NGU A;  2GIF A;  3NXZ A;  2IYI A;  4WP9 A;  3MEC A;  4OMF G;  4DG1 A;  2C2Z B;  2V2Z A;  3DRX A;  4JI5 J;  3DC2 A;  3I4H X;  1N5T A;  2ZH9 A;  5KT7 A;  3QZ7 A;  4XTT A;  3SCI E;  3WBZ A;  4KBI A;  4ER8 A;  1X0F A;  4J9S A;  1K0T A;  4KFB A;  5ETR A;  3K17 A;  6AT1 B;  2B8Q A;  5C42 A;  1XQI A;  5CYM B;  4NXM J;  3JSB A;  4FDF A;  2W7P A;  1FKP B;  2MGZ B;  1QVG R;  2KJV A;  3IRW P;  2VOP A;  2AMC B;  2YX7 A;  3UR3 C;  2XY5 A;  1SIZ A;  4LRD A;  4ENO A;  4ZPC A;  3MTK A;  3M2R B;  2GHP A;  2FZK B;  4WP8 A;  4J91 A;  3V6J A;  2FJX A;  1J5O B;  5ETQ A;  2GHV C;  4NZ7 A;  4JV2 A;  3HP6 A;  2L9N A;  5HO4 A;  3KG4 A;  2VPZ B;  2N82 B;  1Z4U A;  2DNO A;  3QGP A;  4DCO B;  4UUW A;  3C6U A;  2KYZ A;  1NJX A;  2KU7 A;  1JLQ A;  3M30 B;  4USK A;  3TUZ C;  2XWX A;  1DRZ A;  4Y2I A;  2EFP A;  5J2N A;  1W25 A;  1TKT A;  2UUW A;  3AAW B;  2XY6 A;  4FVM A;  3MM6 B;  2D3O 1;  2ZUA A;  1K73 T;  2HKE A;  2XMA A;  2M88 A;  2OPR B;  2DHS A;  3KTQ A;  2LDY A;  4P75 A;  3JTP A;  4LT6 A;  2VH7 A;  4HHU A;  2MHE A;  1AUS L;  2J9D E;  1XMQ F;  1FRL A;  3IMQ J;  3G6E S;  3DM2 B;  1NK4 A;  2HUR A;  2ROG A;  2HS4 A;  4B17 A;  3KUH A;  3P45 B;  2WZ1 A;  4F8R A;  4LF2 A;  4ZCM A;  3QT8 A;  2VPW B;  4FYX B;  3IR5 B;  3TP2 A;  1CUL B;  1HWL A;  1VRQ C;  1IM4 A;  1HQE A;  3G6X A;  3CC2 S;  3BYR A;  4OX9 F;  1HR0 F;  4DDF A;  3JYT A;  3UD3 P;  5LMN J;  3PEJ A;  2VB6 A;  3GYG A;  3OFE A;  1N5Y A;  1Y4Z B;  3KK1 A;  2BRK A;  3V4I B;  2BOP A;  3W65 A;  1X4E A;  2POK A;  4I7F B;  4B3O B;  4PG7 A;  4KKO B;  3BN4 A;  2J5A A;  1VC0 A;  1LKZ A;  2CQ0 A;  5GMK a;  4DR2 J;  4OJ3 A;  2DHG A;  3P5T L;  3LGH A;  1BQN A;  2KN4 A;  1UW9 A;  4ED7 A;  1GMV A;  3H40 A;  1OJ4 A;  5HL7 Q;  3NAI A;  1TFY A;  3CIZ A;  4S0M A;  1NSP A;  4XIU A;  2OPP A;  4H4K C;  1HHS A;  3EZ5 A;  5KG1 A;  2P9C A;  4EO8 A;  1LXN A;  1R27 B;  1IBM F;  1IKX B;  5MLC V;  4ES2 A;  2KKH A;  2R7X A;  3UDV A;  4PWD B;  1RK8 A;  3HHL A;  1JWW A;  1NM2 A;  1V3R A;  1VRU A;  1F6T A;  3GON A;  4Y00 A;  3BDE A;  2W24 A;  1HWI A;  2H5I B;  3OR2 B;  4HLB A;  1FXR A;  1FXL A;  5LSO A;  1UJ6 A;  2A2C A;  2M52 A;  3BF4 A;  2HZA A;  2HRY A;  4CNZ A;  4LF4 J;  1YIJ S;  4DV3 F;  4U7U D;  2KXF A;  1W2B R;  3SMZ A;  1Q53 A;  3LUY A;  1RHU B;  1NBE B;  5IWA J;  5DQI A;  1A0O B;  3I0R B;  3W2V B;  2HBY B;  4NLT A;  3BQ0 A;  4DHV A;  2Q66 A;  3PM9 A;  4QYZ K;  1T9U A;  3D66 A;  1YSJ A;  4CCH A;  1FJE B;  1TQL A;  2DRB A;  3FMW A;  4GVB A;  1SH0 A;  3IAM 9;  4A4J A;  3MMB A;  2FLN A;  3K7R A;  2CPI A;  1RYS A;  4NLG A;  3BS9 A;  4OI2 A;  4M8L A;  4WFA Q;  2XYG B;  5F8N A;  4LF7 F;  1HWU A;  1B3T A;  1DQ8 A;  5KFJ A;  5HI7 A;  3ZC4 A;  4MMO A;  1FNX H;  1HBO B;  1RT5 B;  4URQ U;  2VKR A;  2VC0 A;  3EYZ A;  2FYX A;  4ILL A;  3IWX A;  4LRB A;  2KI2 A;  3SCJ E;  1T94 A;  3MM7 A;  5DG7 A;  3AQO A;  5C25 A;  1FJG F;  5EDW A;  2BQU A;  2KDO A;  4RU2 A;  1S0M A;  2B6A A;  4YQW A;  2RF2 B;  4JI2 J;  2PA3 A;  4RW8 B;  3CCR S;  5KFV A;  5ETO A;  3UE2 A;  4C8L A;  1DQA A;  3M1V B;  1LWX A;  4NCG A;  4C8O A;  1T11 A;  1HNX F;  3LAL A;  1AW0 A;  2VZ9 A;  1QTN B;  1WEX A;  1TVR B;  2ZZT A;  2FVP A;  3C46 A;  2ZH6 A;  2XI3 A;  2Y1J A;  3O8W A;  2WVD A;  2K7J A;  4LFB J;  3BO3 A;  2KTQ A;  3HK2 A;  2B4U A;  2ROE A;  5ETS A;  3HT3 A;  1C2P A;  2J8S A;  1BY9 A;  4ZJO A;  1TAU A;  6FD1 A;  1AZS A;  2LXI A;  5KT2 A;  3HHE A;  4P73 A;  4B3S F;  2R3V A;  2V9W A;  4M95 A;  3BH7 B;  1MN9 A;  4M5J A;  2CWK A;  4IFV A;  2JLF A;  3OXG A;  2EXU A;  2J7K A;  1T3O A;  3GJR B;  1NXI A;  3IP0 A;  3W63 A;  1WKL A;  2J9D A;  3R5C A;  1QSL A;  1TL3 B;  3UN2 A;  4Z2X A;  1JXL A;  2D69 A;  3PYF A;  2YNF A;  1RAF B;  3NRB A;  3MM5 B;  2ADB A;  3HD1 A;  1IQT A;  2MKI A;  1TUV A;  4USI A;  4RLE A;  1NAQ A;  2APO A;  4U9R A;  1VC6 A;  1RWK B;  2BX6 A;  3DRS B;  2KO1 A;  3C15 B;  2RIL A;  2IC3 B;  5KT6 A;  1IM6 A;  4KHR A;  1X5O A;  2AEM A;  2VBX A;  3PHE A;  3VVU A;  3MF5 A;  1RWX B;  1PC4 A;  3LW5 C;  5SUH A;  4OZ2 A;  2BJ7 A;  1WC6 A;  3CC4 S;  2V8P A;  2UXD J;  2V8H A;  3DLJ A;  5I3P A;  2VFU A;  5J1N A;  1O5J A;  2B9E A;  3LP1 B;  3R27 A;  2CG4 A;  4UW2 A;  3PIO Q;  2KM8 C;  2J0W A;  5FLX Y;  3C6T B;  3A8E A;  2QX0 A;  2JVO A;  1VCT A;  2HHH F;  1G2E A;  2Z30 B;  1Q82 T;  4ZVU B;  3F56 A;  3L7P A;  5THW A;  1P1T A;  2DEI A;  1ZPW X;  1QJH A;  3GV8 B;  3IM8 A;  2C2E A;  1T8E A;  1Y3J A;  2BA9 A;  3R5D A;  3FNN A;  3FDS A;  4RUH A;  1U47 A;  1UWB B;  4DV2 J;  1NJW A;  3Q8V A;  3FEZ A;  3MFI A;  3OV7 A;  4UOF A;  1S12 A;  4KGV B;  4LF1 A;  2ZH2 A;  3ZTO A;  4NLD A;  1B0T A;  3PAC A;  1KEK A;  4H4M A;  3JTN A;  4F0K A;  1X9S A;  4OZL A;  4WZQ A;  1IKW B;  1TEL A;  3B78 A;  3CJ3 A;  2FB0 A;  2MKJ A;  3VHQ A;  4C3K A;  2YNI B;  5ETP A;  2ZOM A;  4LF5 F;  2NR0 A;  4CWB A;  4DUY F;  2X1F A;  1RKI A;  1D8Z A;  5I42 B;  3B8H A;  4XPE A;  2BE2 B;  5G0R B;  1FVQ A;  4K4T A;  1MN7 A;  4DR7 J;  2CJA A;  5J2M B;  5U47 A;  1HPZ A;  1PSD A;  1KN6 A;  1RE1 B;  3TEH B;  1EKR A;  2OP5 A;  3V81 B;  3W1Y C;  5E7O B;  5HJX A;  3CJQ A;  1JLB A;  4DV1 J;  1XMO F;  4YY3 J;  1K44 A;  2JX2 A;  2DNN A;  2IHR 1;  1MU2 A;  1RT2 B;  5DGB A;  1TKX A;  2R2T A;  3CCJ S;  4RW9 B;  3M8R A;  4J9O A;  3H0P A;  2VBZ A;  1YJU A;  5SZT A;  4FXD A;  2YWW A;  2HMI B;  2X1A A;  5GME A;  1BC6 A;  4DU8 A;  1VC5 A;  2R7W A;  3EM1 A;  3FSY A;  3DI6 B;  3MR5 A;  2OML A;  3BQ1 A;  4FF2 A;  1PYS B;  5ETT A;  2VJU A;  4OYO A;  2DGT A;  4PKD B;  4FBU A;  2CQP A;  2CPH A;  5LL6 d;  5J1E A;  4F4W A;  3DDN A;  4A47 A;  2RSQ A;  2L9D A;  5F8J A;  2ZHO A;  1RCO B;  4M5L A;  3D6M B;  2MST A;  5CYM A;  2EPI A;  1FKP A;  3DMJ B;  2MGZ A;  4EWT A;  1R0A B;  1YRX A;  1KOH A;  1U45 A;  1K1S A;  4NRU A;  2C28 A;  2P5V A;  2VJV A;  2LU1 A;  4ZVP B;  3JXO A;  4PQA A;  3CJ5 A;  1RKJ A;  1UPM B;  4RZR A;  3TZX A;  3DRR B;  2UUB F;  1MMD A;  1J5O A;  4JI4 F;  3LF0 A;  2VAS A;  1DTT A;  4DPX A;  4R25 A;  1OO0 B;  4WKR A;  2V69 A;  2GJ2 A;  5L1L A;  2E1P A;  3CJ2 A;  4ECW A;  2AEF A;  3ZTP A;  4DV0 J;  1FTR A;  4NE9 C;  1L5U A;  1BWV A;  2LMI A;  3M30 A;  2V2K A;  5IV4 A;  1Z2Z A;  4RUB A;  4B9L A;  2JFD A;  4PG4 A;  3M8W A;  4TQS A;  1KR4 A;  4WIQ A;  2GVD B;  4PZV A;  2NPI A;  1H2V Z;  4AT1 B;  1YQH A;  4ZVT B;  2Q79 A;  3MM6 A;  2AGP A;  2VPY B;  2EFN A;  2ZZM A;  3O1L A;  3H5Y A;  3PNI A;  3DN9 A;  1OS5 A;  2OPR A;  1OPI A;  4WWS A;  5D77 A;  1VQM S;  4JP8 A;  3GJS B;  4BLG A;  2XTJ P;  1S48 A;  1WC3 A;  2QA2 A;  4DFP A;  3DM2 A;  3IBF B;  4ZKA A;  4DXL A;  2DGX A;  1M1G A;  2B43 A;  1VQN S;  1NK5 A;  3BGR B;  4F36 A;  4DR3 F;  1SC3 B;  1U49 A;  1NCL A;  3GFZ A;  1UAW A;  3J7Y I;  1JLF B;  5D0E A;  1CUL A;  7AT1 B;  1OSC A;  1ZTT A;  3EZO A;  4PXB A;  2PMZ D;  4UOC A;  3SV4 A;  2DO0 A;  4LF6 J;  3AOA A;  1UZH A;  2OTJ S;  2H5E A;  1J5E J;  2XMW A;  4P2M A;  1NPR A;  4M5N A;  3I5B A;  3G4S S;  1YJ7 A;  3V4I A;  3LP0 A;  4A8M P;  2IVM A;  3D5M A;  3HFV A;  1S5Z A;  4U6P A;  2XCA A;  4I7F A;  4G6V B;  3BR8 A;  1YG0 A;  4KKO A;  5EUH A;  3O6Q A;  1M5O C;  5ETN A;  4ELT A;  1NPK A;  4CLT A;  4HH0 A;  3NS7 B;  5L1I A;  1HW9 A;  1JLA A;  3DLG A;  3HCX A;  1CJK B;  1UA0 A;  1RT4 B;  2FY1 A;  4RNH A;  4XDC A;  3LAM A;  1N32 J;  4ILM A;  1HA1 A;  5DM6 Q;  1IBC B;  4LVO P;  3HVR A;  1NKB A;  1JB0 C;  1WUU A;  2AYM A;  3MDF A;  1G7C B;  2W2Q P;  3H2L A;  4NA3 A;  1FWL A;  2FVR A;  1IKX A;  1RTD A;  2NXN A;  2HWI A;  4PWD A;  5FD1 A;  4A8X A;  4DL4 A;  4USM A;  2FJE B;  3Q2T C;  4P2F A;  1QSS A;  4CLW A;  1NK0 A;  1Q8B A;  3K5M A;  1X5P A;  1O51 A;  1L3S A;  4EMD A;  3OR2 A;  3RYL A;  5DG8 A;  4ECV A;  3J81 U;  3OLB A;  4NZ6 A;  4WBF A;  2XMM A;  4ZN1 A;  4PR6 A;  4LIW A;  3P4U B;  3JAM U;  2GVZ B;  2PGC A;  1TKZ B;  1U1R A;  2K8G A;  3I0R A;  3W2V A;  4CH0 S;  1VQ7 S;  2V50 A;  3KLH A;  2FHM A;  2NLW A;  1Q81 T;  4N47 A;  1VK3 A;  2BEF A;  4DR1 J;  2G0I A;  4HI1 A;  1AA1 B;  3CCU S;  2E1A A;  2PI5 A;  5KFM A;  2L48 A;  1ZAV A;  2XSJ B;  2VIH A;  3RTV A;  2C3U A;  4HAC B;  5L1J A;  4IO9 Q;  2V67 A;  4A8S A;  1HBO A;  4K4X A;  1RT5 A;  3ULH A;  2ZBQ A;  1QTM A;  5KG4 A;  2X1B A;  4V19 J;  1U6Z A;  3ZTR A;  3GR0 A;  2HHX A;  3W9H A;  2MLZ A;  1QDU B;  3JQK A;  3Q24 A;  4GKJ J;  2VHG A;  2O01 C;  1MRO B;  1NRK A;  4X64 J;  4PPZ A;  4HHJ A;  4IRC A;  1Y3K A;  2RF2 A;  1NK9 A;  3JQM A;  2KM8 B;  2HAF A;  1RTI B;  3UWT A;  2FLO A;  4ID5 B;  2WVC A;  2MPU A;  3OXF A;  4UOH A;  4C8Y A;  2B56 A;  5T14 A;  4O3P A;  3M1V A;  1NK6 A;  3BBF A;  1IKY B;  1FO1 A;  4LF8 J;  1YVF A;  1U8S A;  2XUL A;  4R8U B;  4KGM A;  2C1E B;  3DDK A;  1TVR A;  1C4C A;  2QRR A;  3GIJ A;  4MYT A;  5LMU J;  3D2W A;  3FCH A;  5IC6 B;  2PEH A;  1N36 F;  3TOQ A;  2R7S A;  2HFU A;  2L9W A;  3HSD A;  1I94 F;  5DG9 A;  4IOC Q;  4A8Q A;  1AFJ A;  2EG1 A;  3MCS A;  2O3D A;  4DR5 F;  4DL2 A;  1SXL A;  1NPP A;  2AGO A;  3MCN A;  4LR9 A;  4OV1 A;  4CT9 A;  2CPD A;  3W64 A;  1HHT P;  5AE1 A;  4JI6 J;  4LQ9 A;  4DZD A;  3ZNU A;  2VC1 A;  2QL7 B;  2GJF A;  2V8D A;  1UFW A;  5HP1 B;  2ZH8 A;  1GH8 A;  1KWM A;  1TL3 A;  3Q8S B;  3V6D B;  2I9S A;  3MM5 A;  3MUM P;  3TZZ A;  4J5O A;  3K5L A;  3H5S A;  4RW4 B;  4FF4 A;  2DR9 A;  1SJQ A;  2J0S D;  3DRS A;  3C15 A;  2H4Y B;  2IC3 A;  4ED4 A;  2M70 A;  2F9J A;  1R6Y A;  4DOZ A;  2VOD A;  2CQ1 A;  3UPF A;  2B8P A;  1V5V A;  3GMG A;  3LP2 B;  2BAB A;  3CME S;  3CJR A;  1KHW A;  2UXB J;  5BR8 F;  3G9C A;  4C0O C;  4I69 A;  3LP1 A;  4B02 A;  3BZQ A;  1N34 F;  1X31 C;  3C6T A;  3ZZ0 A;  2FY8 A;  2W4P A;  4MIB A;  3CCL S;  2HHT A;  1RSC A;  2QLX A;  1BQX A;  2ZBP A;  2XC9 A;  2MZT A;  4PYD A;  1T0T V;  4I6A A;  3SSQ A;  4QWA A;  1HI8 A;  1R43 A;  3KHL A;  5HN0 A;  1S10 A;  3BSO A;  3TRG A;  2GNK A;  2XGQ A;  2OIH A;  4JYA J;  2EI5 A;  1XNQ F;  4ZIV A;  2D9P A;  3OW2 R;  2W7O A;  1HNZ F;  3M7V A;  5A8R A;  3GQC A;  2IPO B;  1JJ4 A;  4OI4 A;  4X4U A;  4U67 Q;  2VQF J;  4Q0B B;  2HLU A;  2HWH A;  2QL5 B;  5HQ8 A;  2BM1 A;  5IZH A;  3DLB A;  1TL5 A;  4RWW A;  2SXL A;  4E8U A;  2KT5 A;  1IKW A;  3G6Y A;  4DQR A;  2PE8 A;  3I96 A;  1ITP A;  2YNI A;  5D15 A;  2CJ9 A;  3KMS A;  5K5M A;  3G86 A;  3OUY B;  2Z4P A;  1FE0 A;  3K5O A;  1DZ5 A;  4UZB A;  1LV5 A;  1OSD A;  5G0R A;  1T9T A;  4TY8 A;  5J2M A;  4DV7 F;  3MR2 A;  4B3T F;  2AQ4 A;  4FYD A;  3TEG A;  2N3O A;  5DZ6 A;  1QVF R;  1UP1 A;  3NLC A;  4IOB A;  4HTJ A;  5KG5 A;  1IN0 A;  1PC5 A;  1RT2 A;  3JSM B;  3PIP Q;  4RW9 A;  3HUL A;  3TX8 A;  1NH8 A;  2RQC A;  2HFS A;  2HMI A;  2ZFH A;  1IKV B;  3BBB A;  3Q83 A;  1WNE A;  2HFN A;  3DI6 A;  3R5J B;  4DN9 A;  1XIQ A;  5F3Z A;  1WD6 A;  2D7S A;  2BZ2 A;  3KLI B;  1FRH A;  2EG2 A;  1R89 A;  2ZD1 B;  1Y5I B;  2DGQ A;  1TL7 B;  2QA4 S;  3PDN A;  1RXO B;  3ADA C;  5KFK A;  3DLE A;  4P7V A;  4IQM A;  1KLM B;  3H8Y A;  4K4Z A;  3FJ2 A;  3DMJ A;  5LSL A;  3TX0 A;  2CQB A;  2QLW A;  3AT1 B;  1R0A A;  2HGL A;  2X51 A;  5DDO C;  1LWC B;  3HX9 A;  4WPA A;  4DJB A;  1RDR A;  3RZA A;  1U48 A;  4L3K A;  2Q43 A;  4ECS A;  2EBE A;  3R1L A;  2DD8 S;  2KZZ A;  2PT0 A;  3DRR A;  3FBB A;  2E5L F;  1K47 A;  4CI0 B;  4K7Q A;  1JXE A;  4LRE A;  4H4K A;  2JL9 A;  2F8M A;  2CKW A;  4NXN J;  2CJQ A;  4PUO B;  3TA0 A;  2QMW A;  2HFO A;  1TL1 B;  1FD8 A;  1G1X A;  3T5H A;  2GX8 A;  3RRG A;  3UVJ B;  1H7W A;  3BYP A;  3AH6 A;  2GVD A;  4XDD A;  1ZPV A;  3MOZ A;  1FT8 A;  1I3O B;  1YX2 A;  3NOC A;  2ATL A;  5JMN A;  5CYQ B;  3UI3 A;  1TAQ A;  5CH7 B;  5HSP A;  2RRN A;  5A76 A;  3PYG A;  2ZJQ Q;  3DOM B;  4EU0 A;  2M2B A;  2R4F A;  4TY9 A;  4DMZ A;  5HMX A;  5AXM A;  3BGR A;  4ECT A;  4MIA A;  4QZV B;  3RBE A;  4OYB A;  3DNC A;  1T3N A;  1UL3 A;  2HQF A;  1JLF A;  3ISN C;  2XGP A;  4OHZ A;  4CQ1 A;  1NUE A;  5KG7 A;  1VQ9 S;  2DVI A;  3RUB L;  2J76 E;  4UF4 A;  4P7T A;  3OR1 B;  2HVD A;  3LAK A;  2WBR A;  3WX4 A;  1X7V A;  3GU0 A;  5IT4 A;  2ERR A;  3TJA A;  5H9E K;  1MWQ A;  1UEV A;  3RG6 A;  3IR7 B;  1B7F A;  5K20 B;  2XHC A;  1EIY B;  3GSI A;  4RR5 A;  1WG1 A;  1TMM A;  3KWM A;  1CJK A;  1GNK A;  2H5J B;  4K2X A;  5M2P A;  1RT4 A;  2Z2M A;  3IC1 A;  4WU2 A;  3HXM A;  4JI3 J;  4URS A;  3G2X A;  3CDA A;  2PA8 D;  2DB1 A;  4Q8F A;  4OI1 A;  2R7O A;  1IBL J;  4X66 F;  2ATC B;  4FKY A;  4ED3 A;  3T5J A;  4CH1 A;  4CM2 A;  2AYB A;  3N79 A;  1FTC A;  4ECR A;  4B3M J;  4CO0 A;  1F5A A;  1JLE B;  4HVZ A;  1LXJ A;  3A3N B;  4BHQ A;  3D0H E;  1IJF B;  2MKH A;  3BR9 A;  4OI0 A;  4AXJ A;  3TVY A;  3OBI A;  3NMA A;  5E33 A;  1N33 J;  1D9F A;  1S57 A;  3UQS A;  2WON B;  3CJK B;  3E51 A;  3CVK A;  1N0U A;  4B9T A;  4DS5 A;  2WOM B;  2YH1 A;  2LEA A;  4KT0 C;  3CJ4 A;  2GVZ A;  2VQE F;  1TKZ A;  4USW A;  4BBY A;  3DCA A;  2CDR B;  1H6K X;  3Q89 A;  3QGG A;  1X4D A;  1DLO B;  3EPG A;  3HHK A;  2KRB A;  4DL6 A;  3FRZ A;  5CHC B;  3IXQ A;  5E5N A;  4YEA A;  4WFX A;  4ZVO B;  1KOO A;  1N54 B;  4W98 A;  1N48 A;  2BQ3 A;  8RUC A;  1FER A;  5H9F J;  3J80 Y;  1O0P A;  4TU9 A;  2XSJ A;  3I5C A;  4MKA A;  3D6H B;  1WEY A;  1NLK L;  4XAK A;  4HAC A;  5KFB A;  5CXT A;  2V63 A;  4E0D A;  2JZ5 A;  3VWS A;  1C0T B;  3HFK A;  3W9J A;  2W2O P;  3R9L A;  3B82 A;  2OPS B;  3VZI A;  1E6V A;  1QLN A;  1Q78 A;  1WOP A;  3CUN A;  3BH6 B;  3LQV A;  2VD3 A;  4CLZ A;  1MRO A;  3GFH A;  3BO2 A;  2WK4 A;  5KG2 A;  1RTI A;  5DLG A;  4ID5 A;  4WJB A;  1K0V A;  2R8I A;  4I1T A;  1NB7 A;  2ZM6 J;  3NAH A;  4NZ0 A;  3W2W B;  4GO5 X;  2ALZ A;  4FS2 A;  3W60 A;  3M8Q B;  4ZPT R;  3TNV A;  1IKY A;  1S9G B;  1RAD B;  4IR9 A;  3GIR A;  1K9M T;  1VHF A;  1VQ5 S;  1PCA A;  3E01 B;  1KSP A;  5K9F A;  3J7Z 5;  4JV0 A;  4R8U A;  1UTA A;  5F8L A;  4B3R F;  4GO7 X;  5DRK A;  1GMW D;  2DNM A;  4EI2 A;  3NG8 A;  4J90 A;  4OX6 A;  2XS2 A;  3AD9 C;  3H2U B;  3K2Y A;  4O3R A;  1YBA A;  2PMH A;  2X1G A;  4ZPW R;  3NS6 A;  5D4O A;  1A9N B;  2NUH A;  2FZC B;  3E2E A;  4TN2 A;  2MJU A;  3GLJ A;  3CD5 A;  4ICL B;  2LA6 A;  2N4C A;  4RW7 B;  2LU2 A;  2MB0 B;  2OUG A;  2FQQ B;  1SC6 A;  1KVJ A;  3C19 A;  1H74 A;  3DOK B;  2CNN B;  2J6U A;  2BJ3 A;  2DNK A;  4X4O A;  1H73 A;  2EK1 A;  3D7S B;  2YKO A;  4I2Q B;  1XMQ J;  2Y1L B;  4V1A k;  5HP1 A;  1EQM A;  2IAJ B;  3QWP A;  3V6D A;  1U1O A;  2FJD B;  1HNW F;  1B0V A;  3ILI A;  1FWK A;  3B6B A;  4RW4 A;  3ZZT A;  2XB2 D;  5LT5 A;  1YLX A;  4LIR A;  2N7Y A;  2Y1I A;  3QIP B;  2YPZ A;  3GTY X;  3IN5 A;  4NMX A;  4ETX A;  3UR0 A;  4FYV B;  2YNH B;  4OX9 J;  2ZE2 B;  1HR0 J;  2BM0 A;  2HNZ B;  4QCL A;  5L9X A;  2HHW A;  2IM3 A;  3LP2 A;  4WTO B;  4USJ C;  1XBW A;  1VDH A;  1RYR A;  3DU6 A;  2DHX A;  3FCV A;  4IG0 B;  3X1L B;  5LM7 E;  4CO5 A;  2RNE A;  4IQX A;  4EBE A;  4FZV A;  1ZM3 A;  5KG3 A;  2QFI A;  7FDR A;  4OHW A;  4NWB A;  3MAA B;  4RX6 A;  4C9D A;  3DDI A;  2CVI A;  1M5S A;  4FPR A;  3GIM A;  1LK7 A;  2Z0G A;  4X2B A;  2F4V J;  3OHB A;  5HBM B;  2IRU A;  2DEJ A;  3P5B P;  1LWE B;  3ZZO A;  4HDG A;  3TQE A;  1WHY A;  3UW1 A;  3EJM A;  1IBM J;  3H20 A;  2FGO A;  3MPY A;  4I2P B;  3MPV A;  1RLD A;  2BUN A;  1NK7 A;  1Z2L A;  5L38 A;  1UVL A;  2OEL A;  2IY5 B;  4Q0B A;  2FHO B;  2C2M B;  2V94 A;  5J2Q B;  5JVG Q;  1Q86 T;  3QRQ A;  1FX2 A;  1VIX A;  4MK7 A;  3BPD A;  4WTY A;  2AYE A;  3KOA A;  2AIR B;  1I5O B;  5GMD A;  3TYT A;  2QZ8 A;  4DV3 J;  2MKS A;  2NXU A;  3NCP A;  4DUZ F;  1HD1 A;  3OUY A;  3R1H A;  4ZHR B;  4YB1 P;  1OYD A;  4LRC A;  2HQI A;  2DIV A;  4DI6 A;  3PW0 A;  5ETM A;  1RAG B;  3KNG A;  1K8A T;  4FF3 A;  2BR0 A;  4F4X A;  1HBU B;  4ZJQ A;  1FNO A;  5AE2 A;  2KJW A;  4KO0 A;  4OZJ A;  1RWP B;  4LF7 J;  3D6T B;  1FKO B;  1S1X B;  1IKV A;  1IR1 A;  2J9E A;  1Q1K A;  4RBT A;  4PXD A;  1TTH B;  4M1K A;  4QYZ J;  1F3V A;  2F63 A;  4I6W A;  2VA3 A;  2BKP A;  2MDA A;  1FJG J;  1Y7P A;  3KHG A;  2ZD1 A;  3KFW X;  3HPO A;  2I5J B;  1UEU A;  1TL7 A;  3NNA A;  2EFV A;  2VF3 A;  4FXW A;  3MUV P;  4F4Y A;  1H3D A;  4OYI A;  2G9O A;  3U27 A;  4A8W A;  2FPH X;  1KLM A;  2K06 A;  2K3I A;  1YZ6 A;  4Q45 A;  1S4F A;  4H54 A;  5KT5 A;  4ZCL A;  2AZ1 A;  1HNX J;  3LH2 S;  2IJR A;  1AB8 A;  3K8W A;  4PWW A;  2OAU A;  4NRT A;  4MJK A;  1LWC A;  5F8H A;  4KPC A;  3P6Y C;  2KH9 A;  1RBO B;  2V68 A;  3K5N A;  1HMV B;  4OYM A;  4P6Q A;  5AJ3 F;  5I3U B;  5E0O A;  1D9A A;  5GAD U;  2P6T A;  4P52 A;  4D3H A;  3R5G A;  3J7A N;  1MML A;  1U2F A;  3NCQ A;  3MR7 A;  2DGW A;  3NY0 A;  4OL8 A;  3T5L A;  3NGK A;  5KOX A;  3VQT A;  4KIA A;  2E7W A;  2UVW A;  4B3S J;  2VPX B;  4PUO A;  2E5J A;  1L3U A;  1Y5L B;  3PV8 A;  2RML A;  2Q6C A;  1TL1 A;  2B4O A;  3LO3 A;  4QIW D;  3G8S A;  5IWA F;  3AOD A;  5K8M A;  3FUY A;  2FJW A;  3UVJ A;  3BKT A;  2J7W A;  4QWC A;  1KQS R;  3JSY A;  3QAU A;  4DSK A;  2O66 A;  4JV5 F;  4LQ3 A;  1RWM B;  2A10 A;  1VIO A;  5CYQ A;  4HYK A;  3DLK B;  2H48 B;  1QY7 A;  2A18 A;  1JNR B;  2F8H A;  5IQQ A;  4JUZ A;  1LWF A;  3DYA B;  4OLP A;  3OL7 A;  4NL5 A;  4UY8 T;  4JV1 A;  1S1T B;  2E9Z A;  5D3G B;  2F3J A;  1RUS A;  4NLW A;  2MMY A;  4NI2 B;  3VF0 B;  4ECY A;  1N6Q B;  3T1H F;  2O67 A;  3OFG A;  2HS0 A;  1J2V A;  5JUM A;  1PYO B;  4B9U A;  3BSA A;  3OVA A;  4L6V 3;  2AJQ A;  2FGC A;  3AOC A;  3OR1 A;  3M2U B;  3GCW P;  1D3W A;  1S1U B;  2YTC A;  3ETO A;  4I56 A;  2BJ1 A;  3EMT A;  2RQK A;  1VQL S;  5KOW A;  4F0M A;  2HHH J;  1SH3 A;  1R0C B;  2V9K A;  4LFC F;  3KYL A;  3U1L A;  4A8Y A;  5KTQ A;  1LQ9 A;  4G1I A;  3RU0 A;  4ITS A;  2DNQ A;  2MLY A;  2DHH A;  1RT7 B;  2LQJ A;  4MK9 A;  2CPJ A;  1MWZ A;  3BSN A;  2CQG A;  3C3L A;  2EFO A;  2K7K A;  4ZMM A;  2QYG A;  5GVQ A;  4DWI A;  2BW2 A;  5CQG A;  3TJ8 A;  2UVU A;  2ZH7 A;  4TQR A;  3QGH A;  2YQ3 A;  1JLE A;  2I8E A;  2M7S A;  5EX0 A;  3RBX A;  1V3Z A;  4LF9 F;  4J9L A;  1RAO A;  5BYQ A;  1Q8K A;  2CQ4 A;  2HFV A;  2ZC3 A;  4NLY A;  4YN3 B;  1KNZ A;  4LF5 J;  4BWJ A;  4DUY J;  2VDI A;  4DQQ A;  1VFJ A;  2WON A;  1DBD A;  3CJK A;  4J37 A;  2HQ3 A;  4E2F B;  3GWC A;  3SCK E;  4J9R A;  1RI7 A;  2WOM A;  4MIW A;  2AHO B;  2DGU A;  2PC6 A;  4WU3 A;  1SJ4 P;  2HHS A;  3AD8 C;  3TUI C;  3PTW A;  4X4R A;  3ZZU A;  4B08 A;  1OY6 A;  3SXL A;  1SJR A;  4X4S A;  1XMO J;  1EAR A;  1DLO A;  3O3L A;  3QGI A;  1VQO S;  1DUR A;  4K4V A;  4MK8 A;  3ZNJ 1;  2YVS A;  1VOM A;  2QA4 G;  3KJV B;  2B9X A;  1I1G A;  2J9C A;  4C6A A;  3BSC A;  4OZ5 A;  3GG1 A;  4N56 A;  3BKF A;  4TLQ A;  5A0Y B;  2IVF B;  1HD0 A;  2B4V A;  2C2D A;  3W62 A;  5L46 A;  2WCX A;  4K5R A;  1RB0 A;  3WIV A;  4WP3 A;  4K0K F;  1ZA2 B;  5EGY A;  3BN7 A;  1SUQ B;  4ES3 A;  2DXD A;  2MHN A;  4YR3 A;  1X0P A;  2BE7 D;  3B54 A;  2BJD A;  3FBE A;  1WC1 A;  1RT3 B;  1YDL A;  3HKW A;  3I9Z A;  1V9O A;  4C0B A;  2R2R A;  3SEO A;  2XS7 A;  3HD2 A;  3R8Y A;  1GXL A;  2L3M A;  1YHQ S;  1VQ8 S;  3M8Q A;  2GV1 A;  3HLU A;  1S9G A;  1SH2 A;  4ZJL A;  4KRW A;  1PJ6 A;  1NSK L;  3TR5 A;  2UUB J;  4OQJ A;  1JJ2 R;  3PR4 A;  2VG7 B;  4JI4 J;  3FSX A;  4G3I A;  1M5K C;  3DOL B;  4Y65 A;  3SQG B;  3C14 B;  3QZ8 A;  2G13 A;  1SIW B;  3PRB A;  5K14 B;  4NA2 A;  2Z57 B;  4ICL A;  4PQU B;  2V5H G;  4RW7 A;  4K2J A;  2C3Y A;  1Q5Y A;  1Y11 A;  2VL1 A;  3QAT A;  4NX9 A;  3QO9 B;  3N5F A;  4O4R A;  3QSY B;  2CJK A;  3DOK A;  2JEI A;  5J2P A;  4MKB A;  2V8V A;  4R0E A;  1NU4 A;  1F5C A;  2OFH X;  3R6G B;  5IS2 A;  2BKN A;  1WI6 A;  2IDL A;  4Z7C A;  4ZCK A;  2IAJ A;  2XNR A;  4DL7 A;  1SJ1 A;  4O0I A;  3HVT B;  2O1P A;  2AF6 A;  4CYU B;  4DR3 J;  2HLT A;  1GX6 A;  4IUF A;  2HVE A;  3OVB A;  4ZVH A;  3QIP A;  2YY3 A;  4IO1 A;  4CLL A;  2YNH A;  2ZE2 A;  3A3O B;  1FRX A;  2HNZ A;  4RO0 A;  4WII A;  3US5 A;  4DV6 F;  1JKH B;  1QE1 B;  2CJY B;  4C98 A;  1S1V B;  1BGX T;  1N5Q A;  4IG0 A;  1WAC A;  2G2O A;  2NCK L;  1U7L A;  2GO8 A;  2BRL A;  1PIL A;  3QID A;  2RE1 A;  3PHT A;  3CCV S;  3MAA A;  3O5T B;  1QD1 A;  3W8G A;  1YJT A;  2OFG X;  1TZ0 A;  3M8P B;  2N4D A;  1BQM B;  2HW3 A;  2PII A;  2CZ9 A;  2RJZ A;  3VAI A;  2ZJR Q;  3UN5 A;  1LWE A;  2I38 A;  4X4P A;  2DHA A;  1P1L A;  2HGN A;  5F3T A;  2JVR A;  1IR0 A;  1UVI A;  3FBC A;  3FEX B;  5L39 A;  3VGU A;  4C97 A;  4JBC A;  1REV B;  4RW6 B;  5B09 A;  1R31 A;  4NA1 A;  3I82 A;  4CO3 A;  2B7C B;  2YKA A;  2CPX A;  1RAI B;  2LCW A;  5J2Q A;  4R5P B;  2E1R A;  5A8W B;  4ES1 A;  3SZ2 A;  3WIU A;  4ZPB A;  1FFG B;  1JIH A;  2XEX A;  1C4A A;  2UVR A;  4F50 A;  4NPO A;  1YZ7 A;  2HRT A;  2MZQ A;  3P3D A;  2RB7 A;  2RDJ A;  4LRA A;  2DGO A;  3DGP B;  3M6W A;  1T9W A;  2UUT A;  2CPF A;  4LSL B;  2JRS A;  1HBU A;  3NP5 A;  5D4L A;  3J7A 1;  1N5S A;  1RBA A;  1M5H A;  4NLR A;  1M0S A;  3CT9 A;  3ZTQ A;  4MAK A;  3THP A;  2QLJ B;  5KFY A;  4LR7 A;  2RKI B;  3A8K A;  3NL0 A;  1S1X A;  1OQ3 A;  4AE5 A;  4JI8 F;  4HT5 A;  2DNZ A;  2XLJ A;  2ZBC A;  1DJ0 A;  4TXS A;  1O6X A;  4QQB A;  2P6S A;  4IKA A;  5KFW A;  4MKY A;  1JQG A;  1WKK A;  4I68 A;  4DL5 A;  2E44 A;  2I5J A;  2HQD A;  2XSF A;  3PKM A;  3HHD A;  4ZN3 A;  1S7H A;  2FVQ A;  2MY8 A;  4EYI B;  2GHW A;  3VAH A;  3G71 S;  5DDR C;  4ZPA A;  1SKW A;  2I1R A;  1VQS A;  2ILY A;  3OT9 A;  4KH1 B;  5B0D A;  2KFY A;  3T1Y F;  3LGM A;  1Q8I A;  5HK4 A;  3ILO A;  1HMV A;  2XLK A;  2FJA B;  5I3U A;  3CDB A;  1P9Y A;  5E41 A;  2BQR A;  4F26 A;  2QO3 A;  1ZTW A;  2FVS A;  3SQO P;  1N36 J;  2BW7 A;  3MGJ A;  1IBK F;  2ZUG A;  5B0F A;  1I94 J;  3EPI A;  3EUN A;  5K8N A;  4DR5 J;  2DRD A;  4C8Z A;  3MMA B;  5IT9 U;  3TO8 A;  2HVH A;  4HKQ A;  3LWM A;  2E9T A;  3E8O A;  1TV6 B;  3KLF B;  2ZBI A;  3VGV A;  5ADZ A;  3W9I A;  2AEJ A;  2W01 A;  2G4B A;  5K8O A;  3NGR A;  3DLK A;  2XI2 A;  3DHX A;  4IH7 A;  1BXN A;  3QPI A;  3RRK A;  2LLZ A;  4X4N A;  1NJY A;  4LBI A;  3HM9 A;  3M8S A;  1NME B;  3TAP A;  2CQI A;  1SL1 A;  5C24 B;  2XBP A;  3DYA A;  3EGV A;  4BC9 A;  4UZC A;  3BKU A;  3L09 A;  3VAM A;  4DG1 B;  2GQC A;  1S1T A;  2YWK A;  5A2Q U;  1KON A;  5D3G A;  4KV8 B;  5BYS A;  1MSW D;  1N6Q A;  5CD4 H;  1ZM4 A;  1VQ6 S;  3IWL A;  2C3P A;  1GTH A;  3GYN A;  2B9W A;  1FEH A;  5BR8 J;  1RT1 B;  2DIT A;  1ZH5 A;  4USU A;  4PG6 A;  4PXE A;  4FNH A;  3M2U A;  1N34 J;  4C4W A;  1S1U A;  1YJV A;  2JLE A;  5M2U A;  1GAO A;  3HJV A;  2HIQ A;  4OZ1 A;  4N8O A;  1WC5 A;  2RDI A;  2IRY A;  3C66 A;  1PG5 B;  3CCZ A;  2WHO A;  4QR0 A;  2I0X A;  4RUC A;  2FDN A;  5HVG A;  3SYZ A;  3CCQ S;  2EBG A;  1KD1 T;  3HSG A;  4M5K A;  3V6K A;  4K4Y A;  1RA7 A;  3AD7 C;  5GAG U;  1IWG A;  4P9S A;  1XNQ J;  4RNM A;  1S76 D;  1VRT B;  1HNZ J;  2IM2 A;  3MR6 A;  1V5I B;  2V2Q A;  2ZNY A;  2GAH C;  3G8Q A;  1WG5 A;  3DRY A;  1UPP A;  3IA0 A;  4CLY A;  1X4G A;  4Z37 A;  2RHQ B;  2D74 B;  3GG0 A;  5LOQ A;  3WQP A;  2VUG A;  5KFA A;  4AL5 A;  3LA0 A;  4ZS6 A;  4IH5 A;  4QIF A;  4DCP B;  2D9O A;  2HEK A;  4KR0 B;  4K4W A;  1SCJ B;  4X4T A;  4ED8 A;  3BRE A;  4OZN A;  5GAD I;  5E3R A;  3MED B;  1HQU B;  3M9O B;  4DV7 J;  2C3M A;  2UUC F;  4F3O A;  4F0H A;  4B3T J;  2LFV A;  4DFM A;  2DT9 A;  2EW9 A;  2R2S A;  1HFE L;  1F9E B;  1GK8 A;  3I9V 9;  5KFH A;  4TU7 A;  4UUX A;  3BGL A;  1BLU A;  3GJT B;  2W25 A;  2IBK A;  4UQG A;  1VR6 A;  1ZZN A;  3BGO P;  3D1H A;  2HGM A;  4RKU C;  2GJI A;  4WYL A;  1M5V C;  2XZW A;  4TVA B;  1NB2 A;  5T7L B;  1HYS B;  2OPQ B;  5HMY A;  3TZW A;  3PY8 A;  2HK2 A;  4L3N A;  2YBV A;  3PXG a;  3CD6 S;  1SC1 B;  1XWL A;  4O4G B;  1DTQ B;  1RTJ A;  4C8N A;  2N7C A;  1EP4 A;  2UUA F;  4YP3 A;  2DCL A;  1SUQ A;  3NEK A;  3CDU A;  2HBQ B;  4QU7 A;  2RRA A;  3C16 B;  2KVI A;  3ZTS A;  1AUD A;  2GIR A;  1SI9 A;  2JDJ A;  1D09 B;  1ZOT A;  3CJ8 A;  1XER A;  1MG7 A;  1JLG B;  1RT3 A;  4J9Q A;  3MUR P;  2YXL A;  2E5G A;  1F9F A;  2G1H A;  3CPW R;  2AD9 A;  4U8Y A;  4RL1 A;  3ITH B;  2V8G A;  4UST A;  2FTR A;  3HSZ A;  2ALY B;  2FHJ D;  3ZO7 A;  1GTE A;  3HT0 A;  4YB5 A;  3V5R A;  4KPY A;  1SV5 B;  1RHJ B;  2E5L J;  3HKZ D;  1XR5 A;  3N5B A;  2EWH A;  2VG7 A;  4CO2 A;  3UD5 A;  2LP4 A;  4QR1 A;  3K0J A;  2VFS A;  2P9G A;  4KB7 A;  4JI0 F;  2MY7 A;  3DOL A;  3E3X A;  3RJM B;  4KH0 B;  3SQG A;  1UJ4 A;  3C14 A;  4CZC A;  4NCA A;  4MTP A;  3MHY A;  5K14 A;  1N0V C;  1UJ5 A;  2A6M A;  5JJB A;  4FVC A;  4PQU A;  3UCU P;  2EEY A;  5D6G A;  4EZ6 A;  3LTO A;  2VG5 B;  4DL0 C;  3CJ0 A;  3MCO A;  4DQS A;  1WHW A;  3D3B J;  4DS4 A;  1KLN A;  4NLO A;  3QO9 A;  5B0C A;  2H65 B;  2IRX A;  1I51 B;  4BDP A;  5KFZ A;  3RGI A;  3MM8 B;  4FN5 A;  4G1Q B;  3HVT A;  5AE3 A;  3CW2 C;  1FA0 A;  4CYU A;  1LEO A;  1LW0 B;  3PFO A;  3PW5 A;  4U8V A;  1U02 A;  1RP5 A;  4WF9 Q;  4HDH A;  1CJT B;  3VGS A;  4WYW A;  5KFD A;  2RAQ A;  1JKH A;  5CA5 A;  1QE1 A;  4O0N A;  3K8V A;  3AB2 B;  4WK3 A;  1YWX A;  1BMQ B;  4P72 A;  1S1V A;  1OPZ A;  1SQF A;  2CZ4 A;  3P8B B;  1FEE A;  3S7R A;  4K50 A;  3I87 A;  5F41 A;  4Q44 A;  3BDP A;  1CJV B;  2UV8 A;  2FUG 9;  1RU2 A;  3M8P A;  4OYA A;  4DX6 A;  5DQG A;  3W5Y A;  3IBC B;  1BQM A;  3Q8P B;  2M3D A;  1H0H B;  1Y10 A;  3S8S A;  4WFB Q;  4X66 J;  3UDC A;  2A6O A;  1M1H A;  3M2R A;  1ACM B;  3RR7 A;  3IR6 B;  1IVZ A;  1TUG B;  2Y1R I;  1ZYQ A;  5H9E J;  4ZOS A;  1IQZ A;  4BWM A;  3MEK A;  2V4R A;  2HVZ A;  2YQ1 A;  5KG6 A;  2IVY A;  1NEE A;  4PXC A;  1REV A;  4RW6 A;  1ZA1 B;  2Q6B A;  2E5I A;  3M4X A;  4ZPV R;  2M9K A;  2OEJ A;  3LGN A;  4R5P A;  2DPJ A;  5A8W A;  5FDL B;  4JI7 F;  2M5Y A;  2EK6 A;  4DCJ B;  3N4W A;  4N77 A;  3DFE A;  1GMU A;  3ISN D;  3WDO A;  1O8B A;  1S59 A;  1X4H A;  2VQE J;  4KSE B;  2GZO A;  2DKO B;  5ETK A;  1HIY A;  3CSK A;  3DGP A;  2AZ3 A;  4UTG A;  3PJ9 A;  4Q7A A;  2F65 A;  4MYU A;  3N9U C;  3RAQ A;  3SI8 A;  4YB7 A;  4LSL A;  3IM9 A;  2RT3 A;  4P2X A;  2D1C A;  5HMW A;  3OTD A;  3KK3 B;  2HHV A;  2VKZ G;  5IT9 Y;  4KJI A;  1N5V A;  2QSF A;  2OSR A;  3T41 A;  4NEZ A;  2RKI A;  3NGS A;  1NH7 A;  3RB3 A;  2DR5 A;  2E29 A;  4EO6 A;  1TK5 A;  2EC2 A;  2RQM A;  1YJW S;  3QSI A;  4B9M A;  5KFX A;  1KKH A;  2OEK A;  3AA8 A;  1SKU B;  4B3O A;  3PW2 A;  2FJB B;  1HBN B;  2QLF B;  4QWB A;  2NZC A;  1L3K A;  3BO4 A;  4G1P A;  2NPF A;  2Y9H A;  3IG1 B;  3I5A A;  2H54 B;  2I2Y A;  4NLU A;  3ZFV A;  1D1U A;  1VYA A;  1XR7 A;  1OIA A;  4TU8 A;  4JI1 J;  3VAG A;  4RPF A;  4WFY A;  4B3R J;  4YOE A;  4OHY A;  2KT3 A;  4CT8 A;  3RBZ A;  4DSF A;  1T9V A;  2JHE A;  3R2C J;  4PAB A;  3DXS X;  1F60 B;  3UNG C;  1RLC L;  1VBX A;  5LXR A;  1N33 F;  5DM7 Q;  3EGW B;  1WF0 A;  3GYX B;  1LK5 A;  1NHV A;  1LNQ A;  1URR A;  4NCB A;  2KG1 A;  2GO9 A;  1H2T Z;  2ZBR A;  4CP5 A;  1NKE A;  1YRT A;  3MMA A;  4KHP F;  3CIM A;  3NGT A;  1B4S A;  4P71 A;  1TV6 A;  1PAE X;  2RS8 A;  3VGT A;  1OY8 A;  1FWP A;  5CCM A;  3KLF A;  3OQ2 A;  5FLX U;  4U96 A;  4A8O A;  4OV6 A;  1TKX B;  2GQ2 A;  5GAH U;  3PYD A;  3EGN A;  2LVW A;  1F9H A;  3L95 X;  1HNW J;  3F73 A;  3IS9 B;  1RAJ A;  4HL9 A;  5C24 A;  1N88 A;  3T19 A;  2HZC A;  2R8K A;  3PRD A;  4TNO A;  4KAI A;  1YTY A;  3CB4 A;  4GKK F;  5D0G A;  3R3T A;  1EZZ B;  4KV8 A;  4GMK A;  2L41 A;  5J1E B;  2RH3 A;  1RU1 A;  2HBZ B;  2MQM A;  2VFV A;  3M6U A;  4O23 A;  2OSQ A;  4J9M A;  3VR1 A;  3D0G E;  3QT5 A;  2IBO A;  4DN0 A;  1RT1 A;  1WHV A;  2M4M A;  2ASJ A;  3U1M A;  4C3L A;  4RU9 A;  3ENV A;  2ZM6 F;  4UOG A;  1ULR A;  3A3P B;  1RAB B;  4RW8 A;  2XO6 A;  4WE1 B;  4N76 A;  1S0N A;  3EVW A;  1U8W A;  4DR6 F;  1SJ3 P;  3N6M A;  2XZD B;  4RWX A;  4FF1 A;  3M05 A;  3A4T A;  3OL8 A;  1IR2 A;  1DTT B;  1QAJ A;  4C3M A;  3QAE A;  5KFI A;  2XMT A;  3KUE A;  3MEE B;  4OYW A;  2DK2 A;  2B5J B;  1VRT A;  2W9B B;  4Y2A A;  4X4Q A;  2A2D A;  2BDP A;  1P8G A;  3GCX P;  4PG8 A;  1CQN A;  4PEO A;  2ASY A;  3JQJ A;  1R8P A;  1Z1Z A;  1RIS A;  2AJ2 A;  2NSB A;  4HTI A;  2CQ3 A;  5KFL A;  3AXK A;  4DUZ J;  1FX4 A;  4EBC A;  3K5P A;  2DH8 A;  4CLK A;  1ZAW A;  1F2H A;  2YKN B;  2ZDP A;  4AL6 A;  2RQ4 A;  3MED A;  1HQU A;  3OTC A;  3OFH A;  1T03 B;  4F2R A;  4ANE A;  4U7C A;  2QIF A;  1GMW A;  2FVC A;  2WW8 A;  1C1B B;  1B7Y B;  5E3C A;  1UKU A;  2VBY A;  4AQY F;  1G6B A;  1K1Q A;  3WC0 A;  2OTL S;  2CJX B;  2W9C B;  2IJN A;  1GXU A;  1AT1 B;  3RAX A;  1UVN A;  5T7L A;  1HYS A;  4ELV A;  2OPQ A;  1UVK A;  3KLG B;  2YWG A;  3LP0 B;  2ZZN A;  2LQ8 A;  2MQQ A;  3BM7 A;  4M5G A;  4O4G A;  1DTQ A;  3R5A A;  4J9U E;  3EDQ B;  3OSP A;  2QV6 A;  4YDD B;  3T3F A;  1JLA B;  3DLG B;  4OX7 A;  4ED1 A;  3PG9 A;  3JS9 A;  3MFH A;  1WEZ A;  1RAH B;  4DFK A;  3C16 A;  2E7X A;  2F4V F;  4ILR A;  1R8C A;  4NYO A;  2NS1 B;  1UFL A;  1JLG A;  3H5U A;  2EKY A;  4YDX A;  1LOU A;  1UWA A;  2PD1 A;  3ITH A;  3M8Y A;  2HG4 A;  1RTD B;  1J27 A;  4V19 X;  1UWB A;  5AJ3 J;  3ZXW A;  1SV5 A;  2D41 A;  4FBT A;  4AND A;  4C11 B;  5KFP A;  2IA6 A;  2HHU A;  2MKK A;  4DF4 A;  3UDE A;  3QQC D;  1ICE B;  1LW2 B;  1VHI A;  1T05 B;  2XYP B;  5C2G A;  3BB5 A;  5MAO A;  4CLF A;  1KQF B;  4OI3 A;  3UFC X;  2RHS B;  3QFH A;  3HMJ G;  2XCP A;  1KQG B;  1XTZ A;  1SL2 A;  2QA1 A;  3QLH B;  4ECU A;  4K8R A;  3KLH B;  1Y9O A;  3JB9 k;  5I42 A;  4JV5 J;  3EVM A;  1RBL A;  2VG5 A;  4X65 F;  5GAG I;  2BE2 A;  2PEB A;  4F2S A;  2EVZ A;  2RS2 A;  2HFZ A;  2GC8 A;  2XLI A;  5KG0 A;  1KBR A;  1VBY A;  4M5D B;  1WC4 A;  2YWF A;  5F8G A;  4QU6 A;  3V81 A;  4DR4 F;  2QFJ A;  3GIK A;  1ZS6 A;  1TU0 B;  2KHC A;  1F3F A;  1SB6 A;  3MAQ A;  3AJ1 A;  2MQN A;  2KYX A;  2AYG A;  1ZAX A;  3C8Y A;  4LFA F;  5KFN A;  3H42 A;  3MM8 A;  3DXB A;  4G1Q A;  3PEH A;  1RT6 B;  2R8H A;  4Y3C A;  6FDR A;  2VON A;  1T9X A;  1LW0 A;  2Q1L A;  1C1C B;  2ZNZ A;  2QSW A;  3FKB A;  2CRL A;  3CE8 A;  4TYA A;  3SFU A;  3KLV A;  1CJT A;  3T1H J;  2Q3P A;  1NZ8 A;  4LVN P;  2VG6 B;  4L74 A;  2QTW A;  5D4N A;  3KK2 B;  4F4Z A;  3HVW A;  5HLF B;  3LPY A;  3GFY A;  1OYE A;  2WSC C;  1WJ9 A;  3DLL Q;  2VBW A;  1CQM A;  1ZZF A;  2UU9 F;  2GA7 A;  2MSS A;  4LFC J;  4YR0 A;  3K58 A;  2CWX A;  2VV5 A;  1CJV A;  3KJN B;  1EET B;  2OJ3 A;  1CPZ A;  3DHW C;  1NHK L;  3KXD A; 
#chains in the Genus database with same CATH homology
 4JI3 J;  4DR5 J;  4DUZ J;  4NEZ A;  4LFA J;  1N34 J;  4KHP J;  4OX9 J;  1HR0 J;  4DR7 J;  5IT9 U;  2MQ8 A;  1XMO J;  4DV6 J;  2UXB J;  1IBL J;  1XNR J;  4DV7 J;  4KYZ A;  2UUB J;  4B3T J;  4DR6 J;  3R2D J;  3W1Y C;  4JI4 J;  4DV3 J;  4NEY A;  4DV5 J;  3D3C J;  4JI7 J;  4DV1 J;  4JI0 J;  2E5L J;  4YY3 J;  4B3M J;  5LMN J;  4RJV A;  5LM7 E;  4K0K J;  4AQY J;  1FJG J;  4LF9 J;  4LF4 J;  4JI2 J;  2MEW A;  4GKJ J;  4JI6 J;  5AJ3 J;  1HNX J;  3T1Y J;  4PWW A;  2KVQ E;  4LF6 J;  4X64 J;  3J81 U;  5FLX U;  4DV2 J;  5IWA J;  4DV4 J;  3J80 U;  3T1H J;  1XNQ J;  1J5E J;  4DV0 J;  3OTO J;  3JAM U;  1N33 J;  2UXC J;  2VQE J;  1HNZ J;  2UUA J;  4DR2 J;  4JI5 J;  2F4V J;  2UU9 J;  4KY3 A;  1HNW J;  2MTL A;  4NXN J;  2KL8 A;  1XMQ J;  4GKK J;  4V1A k;  5A2Q U;  4JYA J;  3J7A N;  4LF5 J;  4DUY J;  4JI1 J;  4X65 J;  4LF7 J;  1IBK J;  4YHH J;  2ZM6 J;  3D3B J;  4LF8 J;  4JI8 J;  4HHU A;  4LFB J;  4B3S J;  1IBM J;  4DR1 J;  4B3R J;  4LFC J;  4JV5 J;  2VQF J;  4NXM J;  1N36 J;  3IMQ J;  4DR4 J;  1N32 J;  2UXD J;  5BR8 J;  2UUC J;  5LMU J;  4X62 J;  1I94 J;  4X66 J;  3R2C J;  2HHH J;  4DR3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...