4DR2J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr2J00
4DR5J 4GKKJ 1IBKJ 4DR2J 4DR4J 4X65J 1N32J 2UUCJ 4LF7J 2E5LJ 4LF4J 4DV4J 1IBLJ 1HNZJ 4LFAJ 1XNQJ 4X62J 1XMOJ 4DUYJ 3JAMU 4KHPJ 5LMNJ 3IMQJ 2VQEJ 4LF5J 4AQYJ 2MQ8A 4V1Ak 5A2QU 4B3RJ 4JYAJ 3OTOJ 4LF8J 3W1YC 4DR7J 3T1HJ 4JV5J 4B3TJ 2UUAJ 4LFCJ 4PWWA 1FJGJ 1J5EJ 4DV5J 4NEZA 2UXCJ 4DV0J 4JI4J 4KYZA 1N33J 4DV3J 4JI1J 5LM7E 4DV2J 2MTLA 4DR3J 3J81U 2HHHJ 1IBMJ 4KY3A 4NEYA 4HHUA 2KVQE 4NXMJ 4DR1J 4K0KJ 2UU9J 4LFBJ 1N34J 1HNXJ 2UXDJ 2KL8A 4NXNJ 4B3MJ 4DV6J 5AJ3J 3R2DJ 5FLXU 4JI7J 1XNRJ 4JI5J 1HNWJ 1XMQJ 4X64J 3D3CJ 4LF6J 4B3SJ 3T1YJ 4DV7J 4JI6J 1HR0J 4OX9J 5LMUJ 4GKJJ 4JI3J 4DR6J 3D3BJ 5IWAJ 4JI2J 1N36J 2ZM6J 3J7AN 2F4VJ 2MEWA 3R2CJ 4YHHJ 1I94J 5IT9U 2UXBJ 4YY3J 4JI0J 4DV1J 2VQFJ 4DUZJ 2UUBJ 5BR8J 4X66J 4JI8J 4RJVA 4LF9J 3J80U
chains in the Genus database with same CATH superfamily
3GJRB 3TAMB 4DR5J 3UWTA 4ZVOB 3IWNC 2K06A 2BRKA 2CJYB 1Z4UA 2DNQA 2KFZA 3PVXA 4NRTA 5DRKA 1Q82T 1VRTB 2DHGA 1LWEA 1NM2A 1LW2A 3I5CA 2BJ3A 3NL0A 1D9DA 5J2QA 3C14A 4RLEA 4UQTA 1BQMA 1D3WA 1J5EJ 3F56A 4C8LA 1S1TB 2KVIA 1AB8A 1L3SA 4JI3F 4IG0A 2ZFHA 4L76A 4EMDA 3CCES 2QLWA 4PR6A 5GMDA 1U2CA 2HQCA 2I5JB 2H4YB 2AT1B 3AHPA 3S01A 1VLOA 5KT5A 4NEYA 1AYEA 4HHUA 1RT6A 3GV7B 3LGMA 1CC8A 2W4DA 5HMWA 2OPSA 2FVRA 3W2VA 4OX6A 4IRKA 1FXRA 1NB7A 3CD7A 1RTDB 3D3CJ 2NYHA 2MQOA 1BHNA 3VAHA 5IOLA 3NMRA 2HVHA 1K9MT 1FKPB 3R6GB 5BYQA 2BABA 2DYAA 5HMXA 3KLHA 2ROPA 1NHVA 1MROB 2ZKTA 5HBMB 3VZIA 4ED8A 5GAHI 3TRGA 5DETA 4JI2F 1WKJA 1VRUA 4X4RA 1M5SA 3P49B 3OR2A 4ZHRB 1SJ4P 3VAFA 2KG1A 4I2QB 1R31A 4FF2A 5K5MA 1S1WA 2AYGA 1B70B 3K5LA 3L9ZA 5DDOC 2IYIA 1SUQA 4DV2J 3CCQS 4JBCA 2CJXB 2IBOA 2SXLA 2BOAA 1HFEL 1I1GA 4RUHA 2YNIB 3MZIA 4I0WA 3BEGB 2AZ3A 4I7FA 4B9MA 1RT5B 2YWEA 4BLGA 1HYSA 1UETA 1X0FA 1MN7A 3PNIA 3EXCX 1HBUA 2MB0B 2YY3A 3SV4A 5IT9U 2MZJA 3GSIA 3CJ2A 1VQNS 4PUOB 3JYTB 1KS2A 2EG2A 2K8GA 5KFDA 3AFGA 5JUMA 2YKNB 4M5JA 1QJHA 4F2RA 5E3RA 5IC6B 7FD1A 3IA0A 4WTOB 2CG4A 2KHCA 4KGZB 4M63A 1T02A 2LYVA 4PG6A 1KQKA 4I6WA 4WPAA 2ACMA 4DV5J 2E5GA 4ID8A 2RT3A 2FJDB 2PMHA 1YJNS 2PT0A 1TKZB 4NLDA 2V8DA 2YWFA 4P9SA 2Y8YA 1DFDA 2V2ZA 4USWA 1Y9OA 2X7IA 1VJWA 2CPHA 2ZOMA 1CJKA 2OPPA 2HHWA 5C42B 2AGQA 4WKRA 2IHR1 4C98A 1BUXA 4ZITA 5GVQA 2G4BA 2VL1A 4CLUA 1PGZA 2K1RA 5KFTA 1NK8A 2LP4A 2KKHA 1C1CA 5CH7B 1U0SA 3BV8A 5KG5A 3ZTOA 4R25A 3A8EA 3CO0P 2ZE2A 2JX2A 2VQFJ 3KHHA 1EKSA 2AV5A 2F65A 2Z58B 3IAM9 4GKKJ 5AE3A 3EZUA 3UE2A 4CRJA 4Q8EA 3UW1A 4X4NA 1M5KC 2HLUA 3VAKA 2XQCA 5KOXA 4C8MA 2BZ2A 3M8SA 5LJ5Y 5DLFA 4URGA 1TL3A 2VOPA 1T3NA 1PSDA 3AB4B 3DMJB 3ITHA 4WK1A 3WC0A 3LP1B 1HHSA 1VC5A 2MQMA 2OMLA 3MM8A 4USHA 2L9DA 2VG7B 1ZPWX 4DR3J 3O5TB 5MLCV 3LF0A 1AXQA 2NSCA 3DOKB 4IRDA 1CULA 1RAIB 2Z2LA 1H38A 2X51A 5KFCA 1UA0A 1F2HA 3R6LB 1S59A 3H25A 2HHXA 5KTQA 4DX7A 4TU8A 3SQGB 4B9TA 2VFUA 1R27B 4Y0FA 1RU1A 2CAJA 3MM6A 5LJ3Y 1YITS 5KFIA 3PKYA 1NLKL 2FZGB 3M6WA 2M4MA 3GIJA 4R5PA 3H98A 2D74B 4TU7A 5GADI 2FVQA 1ZM9A 1U8SA 4OQJA 1EARA 1NZAA 1FCAA 3I82A 3NLCA 2BE7D 1RBAA 3OHAA 4N8OA 1IJFB 2KB2A 4NRUA 3DLEB 2UV8A 3ENQA 4LF8J 3PY8A 5CYQA 4KGKA 1QSYA 3PX6A 3CMES 4N76A 1Q7YT 1G4CA 3J7Z5 4CNZA 3D9BA 5A8WB 3I56S 5GAHU 3RGIA 3PYDA 2HFUA 1Q7LB 3W5ZA 4LF5F 3KK2A 4QZVB 4U95A 2DNOA 1OSCA 2Y8WA 1UWAA 1NZ8A 1VQKS 2HWTA 3EGWB 4DS4A 2ZNZA 1KEKA 4DZ6A 3A1YG 2FHMA 1GNKA 4DU7A 1Q95G 1R0BG 2R7RA 4WFXA 2RRNA 4DL4A 2Q6CA 3GJTB 4ED1A 1T9VA 4YY3J 3ONQA 1UKUA 4QYRA 1UPPA 2CQPA 3M9OB 1AUDA 1WC3A 4C3KA 1UVKA 2I0XA 3NWGA 3NBPB 4FDFA 4RNHA 4WIQA 1U1LA 1F5BA 4OYPA 1X5PA 1FRXA 5HVFA 5ETTA 1LWFB 1L5UA 2VPWB 4ZVQB 3I0RB 2DHHA 3AXKA 3Q24A 3R1LA 4HL9A 1YGYA 2NR0A 1X4FA 2MTLA 3KDOA 1PG5B 4IKAA 4QOTA 2WOMB 1ZZNA 4KY3A 4LQ3A 3ET6B 3TUZC 2ASDA 1BC6A 1T9WA 2X3DA 4F4XA 3QT6A 3UNGC 3RAQA 2W8LA 3F0NA 2B7BB 2QT7A 4LIWA 2F9JA 4K4ZA 1PIEA 3HK2A 3V4IA 3T5LA 4P2SA 4QWEA 2A3JA 2DBBA 3FNNA 1JLBA 3LP2A 4I64A 2G1DA 3BQ0A 3K17A 4OHVA 3CDBA 3NGRA 1Y5IB 2UUAF 2J9DA 4A8FA 4NLUA 3HKWA 5H9EK 4DSKA 3PW7A 3PR4A 3DNCA 5GAEU 4J9VA 5LMNJ 5KFYA 1A7GE 5ETRA 1S1VA 4J9SA 2R4FA 2BEFA 4NLTA 2P6TA 1QAJA 1FVQA 2HS0A 4HKQA 4WXOA 1N36F 3OT9A 5D4NA 2QA4S 4DX6A 2OPRB 3G6XA 2X1BA 2BKOA 3NGSA 2XMJA 4LRBA 1N5TA 1WC0A 2A10A 1B0PA 4TXSA 2E29A 1SPBP 2MKKA 4ZPBA 1VR6A 1ZA1B 3Q8SB 2QZ8A 1EKRA 2J7KA 1U4BA 4ZMMA 4HTIA 8AT1B 1VOMA 3HVAA 5K8OA 2ZDPA 3V6JA 1N33F 4DU8A 1YX2A 2BJEA 4ZS6A 5ETQA 3KG1A 1VYAA 1RABB 4C0OC 1C0UB 1K47A 1RKIA 5KG2A 4KC5A 2DCUB 1YJVA 3CCWA 3JXOA 1W26A 1NDLA 3HZEA 2HQIA 3GU0A 1Y3JA 3OVSA 1G3OA 5JXSA 1X0PA 1KP6A 2DXFA 4PWDB 4JI0F 1NO8A 3FBFA 2ZD1B 3GTYX 5C25A 2YH0A 5GADU 5FDLB 3ISZA 2HWIA 3HHLD 2HGLA 1Y5LB 2DRAA 2ZVIA 2DNZA 5D4PA 3M2UA 2V94A 4RU9A 2VC0A 3IS9A 1E6YB 3HT0A 4O3PA 5KT3A 1TK8A 2HHVA 2YNHA 4LF4F 2UVRA 3D3BJ 3M8WA 2GVDB 2H4WB 1RT3A 4CYUB 5KFQA 4OLOA 5KFGA 3NCQA 2JFKA 2CPXA 4K5SA 2AGPA 4JYAF 3QGPA 1OPIA 2F3JA 2RKIA 3QLHA 4NCGA 3HULA 2HNYB 2JWNA 2FHKA 4ZLJA 4IDKA 2XZWA 4B3SF 2KZMA 3PR5B 1FXDA 4QBUA 2ZH4A 4IFYA 3FVYA 4C6AA 1KSPA 2Z57B 3GFZA 4DUYJ 1F60B 1E6VB 3TNVA 2Z0GA 3D6FB 1RAFB 2W4PA 2DNMA 2D3O1 3TZWA 1RCXB 1HD1A 1UWBB 2DH7A 3ZZUA 3FCHA 3U1LA 3DRPB 1Y5NB 3IR7B 5ETKA 4DFPA 3AODA 3E8OA 4FNHA 2DNGA 2AQ4A 3H5YA 1NSQA 4F4ZA 1DJ0A 3D0GE 2JSXA 2HHSA 3SMZA 3G86A 5KG4A 4ILMA 4CH7A 1I5OB 1TVRA 2CJAA 4DR7F 2CPYA 1BXNA 4OIXA 4Y28C 2HK3A 4FPIA 3J80U 2HNDA 2BQ3A 3KJNB 2HHHF 2ZZMA 5AE1A 4X62J 3AA9A 3BYRA 1KQSR 4O44B 2IVMA 4QIGA 4ECSA 5KFLA 2ZHAA 4F3QA 2XLJA 4B3RJ 3V2UC 5G4DA 2DH8A 2I38A 4LF9F 2RRAA 1D8ZA 3BZQA 2VFTA 2RSQA 4ETXA 2E1CA 2EXUA 3D1HA 3SEOA 2RU3A 2YPYA 2V69A 1AA1B 4MK7A 3DLGA 4RUBA 1SH3A 5BR8F 2FHJA 3IXQA 4URSA 2DIVA 3L3CA 3THVA 3R5CA 4MKVA 2DNPA 3M6VA 1FVSA 4PZVA 4JP8A 4P2XA 4WP9A 1H2VZ 3J7A1 3HT3A 2DR5A 2IFXA 5KG1A 3EVWA 2HZVA 4JB8B 3UD4P 1I94J 1WEYA 4PG8A 2MKYA 2NUHA 5A2QY 3AOBA 2QTWA 2R2SA 4Z7YA 1VQ6S 1IR2A 1NPPA 3C16A 3QAUA 4ED2A 3LWMA 1F6TA 3TVYA 5KFWA 2BE2B 5DQHA 5GAGI 2BMBA 1B3TA 1IN0A 2DR8A 1IKXB 1RAAB 1U1NA 1FT8A 2EG1A 4YB6A 2WTFA 3PYEA 1FHTA 1RT2A 2M3DA 1FA0A 1TV6B 3DYAB 3EX7B 4HEA9 3FQKA 3TJ8A 3B78A 4I56A 3ZTQA 3UDEA 4CLTA 2Y1JA 4YHHF 2MZRA 4YB7A 2F5GA 3IC1A 4WP8A 1HWJA 2H1YA 1PKUA 3AH6A 1OQ6A 4R8UB 2IM0A 3ZZZA 4J37A 4O3SA 4OX9J 3W9HA 3V6DA 1C4AA 4Y2CA 5L1KA 2HIQA 2C2DA 4LRDA 2BJ8A 2M8DB 5KFEA 4LFBF 3T9ZA 5K9FA 4QW9A 5U47A 4LVNP 2WRMA 4KB7A 4GC7A 5CQGA 5C2CA 1UEUA 1C1BB 2FVSA 3EYZA 4DL7A 1YBTA 5A2QU 5KFPA 3M1VB 2L9WA 1N0VC 3NP5A 3SSSA 3GV8B 3MWBA 4I67A 2RF2A 3UCUP 2CQDA 2XS2A 5HP1B 3PIPQ 4C4WA 1DBDA 5F41A 4PXCA 1ZETA 3R8YA 1NRKA 4EZ6A 4RNOA 1MWQA 2MMYA 1T9UA 2QLFB 3M30B 4YDXA 4L3KA 5FLXU 1H74A 4QYZJ 1BGXT 4ZA1A 5KFNA 2YNFB 5J2NA 3CJTA 4IH5A 5E41A 4IQXA 5K14B 4H4KC 5A8KB 1ZM3A 4DL3A 5LSRA 2OGUA 2POKA 4C97A 3OR1A 5E3QA 4AUKA 3RG6A 3HHKA 4QW8A 3UR0A 3KLIA 1LW0A 3KG0A 5FIIA 2AEJA 2W1BA 1N6QB 2QLJB 4C8ZA 4K59A 1HNZJ 3AJDA 1CS4A 4B9VA 2FLNA 4O3OA 4YMEA 2RHSB 4DPTA 5BYSA 2B4OA 3J81j 2RQKA 4M8LA 1S99A 4WXWA 2RDDA 2DGUA 2FIUA 1FJGJ 4YEAA 4ERDA 2OPQA 3CMAS 2XLIA 3P3DA 1TTHB 3L7PA 2IPOB 5HVHA 4A8MP 1S0NA 2QJ3A 3QFWA 3VR1A 4I69A 2XY6A 1RK8A 4DUZF 1KQFB 2UU9J 3Q8VA 3TAMA 4U7CA 1RB0A 4WZMA 4MT1A 4KV8B 4CI0B 4CLFA 1XR5A 3JSBA 1H3DA 1VRTA 2ILZA 3V81B 1S4FA 4TU9A 5LMUJ 3QRRA 1X4BA 5D77A 1R0AB 3OXGA 2K3KA 3P5TL 1S0VA 3GE9A 1Y10A 3GIMA 2CVEA 3TAQA 5DM7Q 3SDEB 2E9RX 1S1TA 1LWXA 3M8ZA 2ZZNA 1JB0C 2QL9B 1J5EF 1VQOS 3OTDA 4YR2A 5D6GA 3I96A 2I5JA 3QT8A 1N32J 5AXLA 5C5JA 3NAIA 2V0NA 2HGNA 4DR6F 2FB0A 2AEMA 2DGQA 1XERA 1VBKA 1RTIB 4OYZA 1RTDA 2CJKA 4QU7A 4LSLB 1Z2LA 2XMTA 3OFGA 2XMKA 4ELVA 4JI8F 3MXHP 3C3LA 4GMKA 1FKPA 4F04B 2BXJA 1N54B 4DL0C 5D78A 2C3PA 2FC8A 5GAGU 1X9WA 2EPIA 4UTGA 2MYFA 1MROA 5HBMA 3PEHA 4JI7J 1IKWB 5CZVA 4LF6J 2M9KA 2QX0A 2YTCA 4XTTA 4ZHRA 1X4CA 4I2QA 3KHLA 1PO6A 2KYXA 1JNRB 2ZWOA 1RISA 3SSQA 3A8IA 2MXYA 3EUNA 2PMZD 1CJUB 4IG3B 2CNNB 1GFWB 3O8WA 2UUBJ 5DDQC 4DFMA 3MR5A 4EEYA 1T8EA 2KG0A 3TUIC 2DY9A 2MQPA 3NCRA 3M32B 4DV2F 2Y9HA 2MLZA 4DL2A 3Q0AA 4MIBA 4FN5A 2YNIA 2BQUA 2C1EB 4F7VA 3GILA 1KR4A 1VIOA 1RT5A 3N4WA 1V5IB 1JLQB 2I2YA 3GJQB 4OI4A 4GO7X 3TX0A 4USVA 1QAIA 2XMMA 4E2FB 4IH6A 3M7VA 3PFOA 5LM7E 3UN3A 2PA8D 1B64A 2E5JA 2NXUA 1IR1A 4RPFA 4PUOA 2R7SA 3JYTA 2OHDA 5IV3A 4OYWA 3U1MA 3GYXB 4DOZA 4DLGA 3J7YI 2YKNA 2LKZA 3CF5Q 1REGX 2VF3A 4FS1A 3QMQA 3DDKA 4HH0A 1M0SA 4G1PA 1S72S 3KKFA 1PYSB 1M5HA 3O2IA 2ALZA 4DQRA 2HBQB 4DPXA 4DXLA 1S97A 2VB6A 4DV5F 3OD2A 3HVRA 2P9GA 1TKZA 3KDNA 1NCLA 3HO1A 2FC9A 4GRSA 1GTEA 2OO4A 2ZH1A 2W2NP 3JQKA 3UR3C 3VWSA 3FGVA 2F1FA 4OZ5A 4UOGA 1N88A 5C42A 3IR6B 3HHEA 4OZJA 4LBPA 1WI6A 1NJIT 2W2QP 4UY8T 3AB2B 3Q2TC 3A12A 4FPRA 1YRTA 4AD6A 1EZZB 3R5AA 5FJ4A 4KO0B 2FDNA 4RX6A 4OHZA 1AT1B 2DGVA 2N4CA 1TFYA 3HZGA 1NK6A 2F9DA 4P2FA 2HHTA 3HMJG 4DN0A 2VQFF 4K0KJ 3EZ5A 1FX4A 2FJXA 3OXLA 4GKKF 1HA1A 3RJMB 1S1XB 2ZOFA 7FDRA 2AZ1A 1UVMA 2CXEA 4LSNA 3QJJA 3R9LA 3KK1B 3TA0A 3RB3A 1UEKA 3DMJA 4ES2A 2HBYB 3RBZA 1DAXA 2NS1B 3B54A 3LP1A 2UUTA 2VG7A 3G6VA 1T11A 2E1RA 2HBRB 4MFBB 4X65J 3DOKA 2XGPA 2DXEA 1NUEA 4MMOA 2IA6A 4ZJQA 1KOHA 1RP5A 4ED4A 3TZXA 4H4MB 1O51A 4LRAA 3DLJA 4ZKAA 2XC9A 2RDJA 2QMWA 1U6ZA 3W8GA 1DY3A 2YWWA 1PJ7A 2XMAA 2E44A 4KYZA 2QG9B 2HPUA 1B4SA 2DHSA 2WHOA 4WJBA 1TKTB 4JV2A 3K58A 1G2EA 2QA1A 2BM1A 2R42A 1T3OA 2PIIA 4JI5J 1XMQJ 2DGWA 2WBMA 1HR0J 4WWSA 2VG6B 4JI1F 4FZVA 3DLEA 2OIHA 3HSGA 3BGOP 1N48A 4LF8F 4MH8A 3ZTRA 1F9FA 5A8WA 4PG5A 4LUBA 1YTYA 2M7SA 3G6ES 1H7XA 5KT2A 2WVFA 5A0YB 3JAMY 2GAHC 4UT4A 1Z1ZA 4KHPJ 2B9WA 3TUPA 1APSA 1RHRB 2DISA 2QRRA 3X3UA 1QVFR 2AJ0A 1RSCA 1J2VA 1RTZA 2BJDA 3N6MA 3PFEA 2GNKA 1GXTA 2L08A 1RHQB 3KK3B 3K5OA 4DR1J 5ETVA 3NGDA 4E98A 5KFSA 3I0SB 3QIDA 4BC9A 3CNQP 4ECZA 3PACA 3DI6B 3PG9A 3TQ1A 4X64J 2MLXA 3LGHA 1WKLA 3BR9A 3NBPA 1R7IA 2CJQA 1RHUB 1LWFA 2DGXA 1P8GA 5BYRA 3K8VA 2PI4A 4P72A 3U02A 3AXMA 3I0RA 1KVKA 3IN5A 2Z30B 3QT7A 2KT5A 2RUGA 1LQ9A 5I3QA 4TYAA 1NKEA 3J7YU 2WOMA 2H5JB 4E0DA 3CJ5A 3ET6A 1SCJB 2XMVA 2JRSA 3K5PA 1NHKL 2GGPB 4ZK7M 2W7AA 3CCTA 2QYGA 4DI6A 1PCAA 3F44A 3BSCA 4CO0A 5M2PA 5CYMB 2B51A 3LPYA 2CRLA 3UFCX 1CEZA 1YJWS 2B0GA 1VK8A 1GK8A 3D66A 5F3TA 2JFDA 2ZH3A 1F3FA 2YQ3A 4IUFA 4LQ9A 2DK2A 1UP1A 4AT1B 4ZJOA 1BLUA 1Z2ZA 3ZC4A 4NYZA 2FYXA 3D0IE 4QIVA 4QCLA 4ATNA 4ECWA 2FGOA 4PXEA 5HQMA 2JLFA 5LMNF 4RW8B 2CQIA 1FTCA 5I3UB 3A13A 1EETB 3GCWP 4ZVEA 1W2IA 1JWWA 1UCNA 2V8PA 1Y0HA 4BBYA 2OPRA 3CXCR 1WC1A 1TL4A 3NNCA 5SUHA 1XQIA 4NYPA 1I51B 1PAUB 1Q0NA 1RAEB 2DJWA 1FWLA 3VZHA 3KHGA 2F8HA 2GJFA 3TAPA 4YB1P 3BBCA 1NK0A 3PW2A 3T19A 4RNMA 4DJBA 2LVWA 5DDPC 3QIPB 2RH3A 3VQSA 2R9LA 2GCFA 4NEZA 2LQBA 2CQ4A 1ACMB 1H2TZ 1C0UA 4LFAF 1M5OC 3QQCD 1RT4B 2WCXA 3HFKA 5HSPA 2B43A 1T7PA 2YQ0A 3LGNA 3C46A 3DRYA 2V67A 5DG8A 3W5YA 2VV5A 2L48A 1OQ3A 1RTHB 3I55S 4PWDA 3Q8RB 2ZD1A 1U48A 3B82A 3ZZ0A 2VPZB 4ECTA 4U67Q 1L3VA 4Q2LA 2DNLA 5FDLA 2PEHA 4KBIA 4LREA 5B08A 5J1NA 1Q8LA 1EHWA 5J2MA 4QR2A 1O5JA 2AYEA 1RWMB 3R7BB 2L9NA 2FTRA 1DQ8A 1HD0A 1E6YA 1M5VC 2MHNA 2DNRA 4ZCIA 4USIA 4BCAA 3IWXA 2WVDA 2R7TA 2GVDA 2IM3A 4CYUA 4CLWA 1FD2A 4G6VB 2A2CA 2EFGA 4ZPWR 1S1UB 1VCTA 2J9EA 2HNYA 3DLLQ 5LXYA 1HNXJ 4DFJA 2UXDJ 4DV6J 4EYHB 1WUUA 3PW5A 2FVPA 2KT2A 1FE0A 1ZA2B 3W60A 3AOAA 3TARA 4ZIWA 4RBTA 4ZPDA 2B5JB 1UWBA 1J5OB 4CLKA 2HSEB 4ANEA 3QPIA 2LECA 4B02A 5KFAA 1R3NA 2JEIA 1NKBA 5AJ3F 3E51A 2HURA 1PBUA 2NSBA 1RWNB 4P52A 2E5LJ 1K1SA 3FRYA 1UJ6A 1FRMA 2RB7A 1SIZA 3MM7B 1UFWA 3ILLA 2M88A 3D4JA 4ANDA 2XSFA 2QV6A 4W98A 4HVZA 1R89A 3CULA 2UXCJ 3MD1A 3FC9A 3PEJA 3D6MB 2VA2A 2BV3A 4NXMJ 5H9FJ 3RBDA 2DRBA 3ZTPA 5DZ7A 3SIPB 1X31C 2YVSA 3PV8A 4O44A 1GMWD 3D1QA 3HVTA 1RWVB 3SQOP 4FYVB 4M5IA 5A8RB 4Q45A 2DHXA 2AJ1A 3CJQA 4QWCA 4LJMA 3DGVA 2B9EA 1HARA 3DHWC 3D28A 2I1RA 4Y00A 1KHVA 3M8PB 5GMEA 3IRXB 4FVMA 4DQIA 4O3QA 3EDQB 4UQGA 4Q5VA 1UW4A 4C8OA 2BX6A 3BGUA 3K89A 2YKAA 1K44A 1KWMA 1HHTP 4TQSA 3CEDA 2ZKUA 2C3YA 2Y0BB 3K8WA 4TLQA 3CDWA 4RNNA 1LFPA 3IBCB 1I94F 3BQ2A 2ASJA 5J1PA 3VCDA 1JXLA 3HSZA 3MMBB 4XK8C 2LQJA 2PDAA 2IBKA 1S57A 2BE2A 3BSAA 1SBRA 4DPOA 2H48B 1JKHB 4USMA 5DDRC 4PABA 3NKYA 1IKXA 2Z4PA 4RW4B 2X3GA 2R8KA 4CTAB 2IAJB 5IS2A 5IM0B 1TV6A 2LFVA 3DYAA 1XWLA 2LQ9A 1RKJA 1JK9B 1Q4RA 4B9LA 1XIQA 2CUYA 4Y2MA 1YRXA 4ZPTR 2XM3A 1ZAXA 2YKOA 3KNAA 4P71A 4U7UD 2HFZA 2RS2A 1J27A 2GC8A 5CD4A 5IWAF 2HW3A 5DG9A 2F8EX 2O01C 1KRPA 3BO2A 2XHWA 2WONB 1S10A 3UN2A 2CPZA 3A8KA 1R8PA 3V4MA 5L1LA 2GO8A 4DCJB 4K2XA 1CLFA 3JTOA 5A6PA 4CLPA 4C3MA 3OJSA 4NCBA 2G13A 2ZHBA 3TR5A 3HSJA 2AYMA 1VHIA 4L72B 4P6QA 1TAQA 4XPEA 4K4VA 2YX1A 2MZTA 4LT6A 3NNAA 2MLYA 4F8RA 1KFSA 2ATLA 2RS8A 1C1BA 3CCMS 1WSRA 3CGIA 2Q1LA 2CPEA 1RI7A 3M1VA 1V3SA 2WSEC 4F4YA 3IWLA 3LANA 4ILRA 3MCSA 1VGYA 2ZH9A 2JVRA 2YPZA 5HP1A 2X1AA 3W63A 5IT0A 4I2PB 3LAMA 1WI8A 1L3TA 2RRBA 4Z37A 3KFWX 1KLMB 2V8HA 4DN9A 1ZYQA 1HIYA 2B56A 1HWUA 1GAOA 4IOCQ 2YNFA 3OPKA 1VQ9S 5F8JA 2G2YA 5K14A 3CCJS 1D8YA 5DO2A 4KH0B 4NZ6A 5A8KA 2E1MC 3ELHA 3LALA 4OHXA 5HJYA 4X4SA 3J81Y 4IO1A 4MK9A 1OY8A 3GG0A 4IR1A 4KIAA 1S49A 2W8KA 1N6QA 4W92B 1V9OA 2BOPA 4J9RA 4UUWA 1HNZF 4QPTA 3WC2A 1TUVA 5IC4B 2AX1A 1EX8A 2DH9A 1ZH5A 2DD8S 4DQSA 5IXUA 2XSJB 1U0HB 3H40A 3UPFA 3CC4S 3FUYA 4F0KA 1XEZA 1Y00A 1Q8BA 2AW0A 2HFSA 2N7YA 2YWGA 4CH1A 4IG0B 1CVJA 1OO0B 1U6BA 3FBEA 1QSLA 2IIHA 3BR8A 3MM5B 4A46A 4PQUB 2DGTA 2UU9F 4KV8A 4EFAC 2Y1LB 1YJUA 2K7JA 1X4AA 4DWIA 3GJSB 3V81A 2KFNA 2R7OA 2FGCA 1R0AA 3IP0A 3G6YA 2WVBA 3W2VB 5LMUF 3BYPA 3WIVA 4DV0J 1FX2A 3SDEA 4RW7B 4XO0A 3M2RB 2VBZA 2HRTA 4HYKA 1OIAA 1OSDA 4AL5A 2I8EA 1NSPA 1Q79A 4WFAQ 4OL8A 5E3PA 2Y1IA 2IYGA 2E1PA 1X4DA 1RTIA 4ZCKA 3GR1A 4A4JA 4JI2J 2MDAA 4LSLA 2VKRA 2OI2A 2W25A 2CPIA 1FJCA 5EX3A 1NU4A 1RLDA 2IDEA 1FDNA 2EFVA 3E01B 1CQMA 1AUSL 4KH1B 1OJ4A 1UAWA 3DRSB 1VRQC 3L4BC 4OZNA 3GQCA 5BXIA 2R8JA 3GR0A 1GMVA 3HKZD 9ATCB 2APOA 1X4GA 1HQ2A 4QWAA 1IKWA 2J8AA 5E33A 4JI7F 4XPCA 1YIJS 2XS7A 3CWJA 2G2OA 4TYBA 3EXYA 3RRKA 4Y2AA 3K7RA 3MOJB 2UZAA 1CJUA 4DL5A 1VQ4S 2ZDOA 4IG3A 1IBMJ 3UQSA 2CADA 3DN9A 3EPIA 5F0WA 5KFKA 1GMUA 3N79A 2UUBF 1RU2A 3I4HX 4P2MA 1PYTA 1S6UA 4CNYA 4KSEB 3SSRA 2NZ4A 3PXGa 3CCSS 4O23A 2CPJA 1JLQA 1YLXA 2AHOB 2GIQA 4V19X 1QM9A 5DG7A 2BDPA 1DQ9A 5K20B 2EVZA 4U7UK 1VC6A 3MEDB 1ITPA 4L73A 4U8YA 3KLVA 4ITSA 1GQEA 2R2RA 4LR7A 3ILOA 1SV5A 1RLCL 1XNQJ 2QMXA 3MECA 4OI1A 3HJVA 2NLWA 1YJ7A 4AXIA 3V5RA 1RT7B 2D9PA 1L3UA 2QC3A 3BBFA 1CJKB 4V19J 2HFOA 3IG1B 4ZP9A 2KU7A 2BANA 2OSQA 1WKKA 2P6SA 3CJSA 2CPDA 3CD5A 1SXLA 4BS2A 3MR6A 5L38A 3ILJA 1FFWB 4OYXA 4Y6IA 1IQZA 2H65B 2KRBA 1ZOTA 3A4TA 2ZE2B 3ZXWA 1LWCB 4O4GB 1S6PB 3HD2A 1F3VA 4TQRA 2X1FA 3DXBA 4F36A 5ETSA 1SKUB 5F9NA 2Y0SD 2B4UA 1ZS6A 3FCVA 2W2OP 2MKCA 2RMLA 4F67A 1HBOB 3LTOA 5E5NA 1TL3B 4KO0A 3BBBA 2VJUA 2KH9A 4ALZA 3HSDA 1FESA 2J7WA 4WFNQ 3PO5A 2PA3A 1QUPA 2XYGB 2Z2MA 1RZMA 5ADZA 4K0KF 2JC0A 1S1XA 2M70A 3M05A 1S48A 3BO3A 4NLVA 3QATA 2OH2A 4AL7A 2XZDB 3KK1A 3DDNA 3VAGA 2BW7A 1SL2A 4M5KA 1N5VA 3BH7B 1F9HA 2CQ2A 3K5MA 2HGMA 4H4OB 2IC3B 3EGNA 1F2GA 5E7OB 5E0OA 2LEPA 4OMFG 4MFBA 2DNHA 4C2MA 1RUSA 4ECYA 3OTOF 4EYIB 2DIUA 1URNA 3OSNA 1SJ3P 1P6TA 4DV7J 4OYOA 3R7SB 3UVJB 4R5PB 4H4MA 1RCOB 3R1HA 1X8DA 2RE1A 4OZ3A 2NREA 1WORA 3D2WA 1U24A 2MKSA 3QT5A 2R2UA 2OLWA 3QAEA 2DO0A 3QGGA 3N0VA 2F4FA 4GVBB 1TKTA 2MSSA 3KMSA 2XULA 3MEKA 1FWKA 3P4UB 1HQEB 4QJVA 5T7LA 1VMBA 3CSKA 3QRPA 3MTJA 4LF5J 2WW8A 3HHLA 3MR7A 3NCPA 3ZO7A 1AFJA 4JI5F 2KXHA 2VG6A 4DPUA 5KOWA 3G87A 5B0DA 1HR0F 1IKVA 4J91A 4RNFA 1TAUA 4Y2IA 2IMOA 3L95X 1V6HA 3N5BA 1NAQA 1S76D 3CJ8A 3HP6A 3W2WB 3UN5A 4CLYA 1U1MA 1X9MA 3N5FA 1S9GB 1NK5A 1OYDA 2HIYA 5A0YA 5KFRA 3BPSP 5F8MA 1Q8KA 2JOQA 3Q83A 1LNQA 2ZBQA 4KHPF 2MKJA 2V5HG 1MNEA 2AKWB 3TA2A 4MKAA 4HLBA 2Q6BA 3I9V9 2ZC4A 2KZZA 2V2KA 3T3FA 3DRRB 4KPCA 4NLSA 2GQQA 3KLEB 4UF4A 1U1OA 3Q86A 4RW9B 1VBXA 2EFQA 2JNJA 3KK3A 2CDQA 4OJ1A 5C2GA 3I0SA 4DR1F 1LK7A 3DI6A 3DOMB 2HNZB 4ZVGA 1X9SA 2FLLA 2N3LA 2MJUA 4KGXB 3NXZA 4NLPA 3AD9C 1OPZA 3IBWA 1NJZA 2G2ZA 2Z56B 3T5JA 1VI7A 2C42A 4NLOA 4I68A 4IO9Q 3MI7X 4WFBQ 2HAFA 2LMIA 5F8LA 4RW6B 2A0FB 4PWUA 1IR0A 1JLCB 4DBQA 2PGCA 4J9OA 2GGPA 4X4UA 1RTJB 3LOUA 3KLFB 1QTNB 3TA1A 4N8NA 2WBRA 3RRGA 4C8KA 5CYMA 4QYZK 1RACB 1MN9A 3BS9A 4L6V3 1WF1A 3TJAA 2NXEA 3MGJA 4NMLA 3E2EA 4C11B 1OY9A 2CWKA 4HACB 4O4RA 4KAIA 4J7CA 3JTPA 1FEHA 5DGAA 2CZ4A 2ASYA 3POTB 2MQLA 3JS9A 3QGHA 5JJBA 4ZPCA 4U96A 2HVDA 3LPEA 4NA3A 5IT4A 2OTJS 1FXLA 2LXFA 4MKYA 2DVIA 2M8HA 3G8TA 1S7IA 2J0XA 3GV5B 1N33J 3VTIA 1TP7A 5I3UA 1DARA 2J0SD 1TUWA 1EETA 1IM4A 3JSYA 2ZITA 3PJWA 3NGUA 2H9ZA 3HDSA 1P1LA 4HI1A 2XY7A 3LQVA 2PE8A 2OUGA 3GLJA 3FRZA 3MPYA 3MMAB 4GKJJ 2WVCA 1VC0A 3MCOA 4OLPA 1JLEB 1H98A 4DG1B 2JVOA 4DSIA 2LCWA 1WG1A 3QIPA 4KR0B 5K8MA 1YDLA 3HHDA 4D3GA 2N7CA 4JI0J 2W01A 3AJ2A 4PYDA 2GHPA 3A3PB 3AD7C 4NLYA 3C6UB 5C25B 1RT4A 4RBUA 3FEYB 5C24B 3RRHA 1TMJA 4QIWD 3R97A 2C3OA 2RJZA 2HBZB 2ATCB 4ECQA 4FKYA 1PYOB 1JLFB 3M2VB 4KGMA 3H7HB 3GFYA 5CXTA 1JNZB 2IRUA 3F41A 3W3SA 4F2SA 1K73T 1RTHA 2JDJA 4PCQA 3R7NB 2EW9A 3J7ZT 4A8QA 2DRDA 1IBLF 2OD4A 5KG3A 4F02A 2WW4A 1JXEA 3MEGA 4PAAA 1YKWA 2ABYA 4R0JA 3MUMP 1T94A 1HPZA 4FF3A 1DTTB 4QIEA 4B3SJ 1BE4A 1MMLA 1NDCA 4NCAA 1B0VA 1HI1A 2M5YA 2GVZB 4KFBB 1FWPA 1ZZFA 1WTFA 3RZAA 1RWUA 3NY0A 1Q81T 4M5DB 1WHXA 2NXCA 4P75A 5L9NA 4N7TA 1QUVA 5DGBA 3ICLA 2BQRA 1OMSA 4CM2A 2KYZA 1IUJA 1S1UA 4F4WA 3RAXA 2IJRA 3C66A 1RA7A 1SC1B 3PW4A 2GAGC 1T0TV 1WF0A 3GMGA 3GFHA 4RWXA 2UXDF 4DV6F 2OFGX 4ECRA 1VHFA 3WQPA 2QLBB 1WSVA 2B5JA 2MJNA 1J5OA 3GB0A 4C9DA 4C0HA 1EJ7L 1SJQA 5KFZA 2JLGA 3K57A 2E9TA 3WX8A 4BC7A 4NZ7A 2LA4A 2RDIA 1AROP 2RQMA 2DEIA 2CZ9A 4KHRA 4OFZA 4U6PA 2E5LF 2FJWA 5D15A 1H73A 3OW2R 1DQAA 3H59A 4MKBA 1NJYA 4LBHA 2V34A 3MD3A 1NB2A 4KHMA 2MEWA 3GP9A 1W2BR 3CJ3A 2HEKA 5M2UA 5G0RA 1QE1B 5HVGA 3VF0B 5KFXA 1EP4B 2OP5A 4PG4A 2UVUA 1PC5A 1FK9B 4LF9J 2W4CA 2B4PA 1SQEA 2QGFB 1JX4A 1MMNA 3KXDA 2VKZG 4K4XA 3S6EA 2XI2A 2QFJA 4U8VA 1SQFA 1RYRA 3O44A 2UV8G 3R27A 3CVKA 1FRLA 4NMXA 5J1EA 4N47A 1S0OA 1NEEA 4KE5A 1K1QA 3D5MA 2VA3A 2A2DA 2YKQA 5D0HA 4YR0A 2MZ1A 5FD1A 3EGZA 5A8RA 2JHEA 4A8SA 5MAOA 4JOUA 1VQMS 2XO6A 3JQJA 2EKNA 1C2PA 2WSCC 3WBZA 2R7UA 3MR3A 1LK5A 3IRXA 4J9MA 3C16B 1X60A 3OFHA 4IQMA 2ZBIA 4CLLA 2V2VA 1HW8A 1WC5A 1RBLA 1ZBTA 4DX5A 3KOAA 1RT2B 2VU5A 3HPOA 1UVJA 3AD8C 4HT7A 4TN2A 5DS7A 4G1QB 4MIWA 3AQPA 2DITA 2CQCA 2YKPA 3GYGA 5AXMA 2VIHA 3C6TB 4LVOP 1PILA 4ER8A 3CDEA 1KBRA 1RADB 4IYQA 3FMWA 1TK5A 1FDDA 4RW4A 5ETMA 4CTAA 2IAJA 2QO3A 4K2JA 4U9RA 5IM0A 3R5JB 4G3IA 1ZPVA 5IFMA 3IGVA 3Q22A 4J9LA 2RHQB 3L7UA 4AQYF 3PJXA 2FJVA 1QD1A 4LFBJ 2KL8A 3AY0A 2MY7A 2NCKL 5L9XA 1JJCB 1WACA 2WONA 2XCPA 4DCOB 2ZM6J 5KFUA 4J9QA 1R8CA 3ILIA 4QR1A 2YX7A 4RBVA 4UZBA 1N8RT 1WELA 3SCLE 1U6FA 2LQ5A 2IM2A 1FJEB 3T41A 3FEZA 4ZN1A 2R7QA 3T5HA 5D0EA 1BQNB 1JXVA 1Q16B 4F3OA 1DTQA 3Q8PB 2IY5B 2GA7A 1DLOB 5HJXA 4EBDA 2YKMB 2OKQA 3M6XA 4ZVPB 4B9UA 3BKFA 4OJ3A 1VDHA 1IQTA 2HK2A 1XMBA 3BSNA 1X5SA 3IGNA 4QR0A 2CFXA 3W5XA 2B7CB 2OMOA 3MURP 3FMBA 2O67A 2UVVA 3H5SA 2OEMA 4BWMA 4EUVA 4WZQA 2J7UA 5IQ6A 3MEEB 1CJTA 5B0CA 4I2PA 1BQXA 3KLGB 2B9XA 3D6HB 1KLMA 1HBMB 1XTZA 3MUTP 2OJ3A 2LEBA 2Q3PA 3SZ2A 1FFSB 3H4DA 1DURA 1B0TA 3H90A 4ELUA 2R8IA 4N5SA 2IJFA 2QN6B 5JVGQ 3Q8UA 4X4PA 2F63A 3R2CJ 1WOPA 2O1PA 1CS4B 6FDRA 5KT7A 3SCKE 2QA4G 2X1GA 1N34F 4EO8A 5F8NA 5D4LA 4UUXA 4NYOA 1PJ6A 5CHCB 3KHRA 1LOUA 4EBEA 3TI0A 1FDAA 3L7OA 5EUHA 4DZDA 3SCJE 4Q43A 4C7QA 3BDPA 5DZ6A 5DM6Q 2Y1RI 1TL7B 3RYLA 1FKOB 1MG7A 3BN4A 3FZBA 1CJVB 3CIMA 1BD6A 2MZSA 1T95A 3M8YA 4ZCLA 3LO3A 4OZ0A 4WK3A 1FI4A 2ACYA 2WSFC 2XSJA 4HT5A 1U0HA 4O0NA 4W4MA 4QU6A 3JQMA 2UP1A 4YB5A 3S8SA 1SKRA 4WTYA 5L1IA 2C2OB 3IM9A 3DXSX 4TNOA 3DOLB 3MM5A 1LEOA 2G0JA 4PQUA 3S7RA 3ENWA 4JI4F 1T9YA 4DR6J 4F4AA 4CLSA 2KM8C 5IT9Y 3QWPA 4M5GA 4DUTA 5I42B 4ILLA 5E2QA 3K0JA 3TO8A 3KJVB 4JI8J 4DV0F 4RW7A 3I32A 3RR8A 1KONA 2DPIA 3M2RA 3T9NA 2BW2A 4JI6F 4ZVFA 2DO4A 1WG5A 1VBYA 3N9UC 4FBUA 3RB4A 2W7PA 3FSXA 3R5DA 4V1Ak 4I1TA 2BRLA 1T9TA 5K8PA 1IWAA 2L3MA 2FY8A 2CG8A 2P2CB 4DR4F 1NSAA 3PM9A 3O3LA 1SJRA 3AQOA 4B17A 3SFGA 3OVBA 3E01A 4OZ1A 4NLWA 2HQGA 4OV1A 3DRSA 3PO4A 3IRWP 3DRXA 1X7VA 3R2DJ 1KFDA 1SJFA 2GJIA 4B3TF 2R8HA 3G96A 4M95A 1RWWB 2AYBA 3MAAB 4WU3A 1UVNA 1QY7A 2ASLA 2CQ0A 1MWYA 3FFIB 5DJBA 1TZ0A 3UNYA 1VISA 5E3CA 3E3XA 2D41A 1U49A 3OBIA 2YNGB 4X66J 3Q89A 4ZVRB 1N5QA 2GW8A 4HDHA 4DV4J 1IBMF 3DHXA 1O0PA 1HL6A 2KJWA 3R5BA 3EMTA 2DXDA 1RGVA 3CJ0A 1S77D 4JV5J 3BM7A 1I6JA 1NDPA 2F7VA 4HHHA 2VZ9A 4DR5F 4DSJA 4USTA 1YI2S 3PW0A 4NLQA 4ZPAA 2XI3A 2GO9A 2J0WA 2KM8B 2DGOA 1U2RA 1A9NB 1TR0A 2HFVA 2C2NA 5I3PA 2GV1A 3MEDA 1PAEX 1PJ5A 3DLKB 4FBTA 1HMVB 2PD1A 3OUYB 4G65A 3HX9A 3T1YJ 3CCLS 1XNQF 3B4MA 2KO1A 3ZZOA 3OTCA 2ZNYA 5ETLA 1RT7A 1HQUB 2P9EA 5EGYA 3IG1A 1WOOA 3UCGA 5AT1B 4F26A 3M8RA 2AEFA 1OS5A 2VDHA 2XWYA 1K0TA 1GTHA 3EVMA 2EWHA 1SJ1A 1SC4B 5HK4A 5GAEI 2CNOB 2J6SA 5BJRA 4ED7A 4G1IA 4RUCA 2H51B 3HD1A 1FJ7A 4FVCA 2XYPB 3H5XA 3IM8A 1LWCA 2BUNA 4O4GA 1S6PA 5T14A 4OJGA 3D54A 4RU2A 2MKIA 4L3NA 2KHDA 5B0GA 1U1PA 4CO4A 4HR2A 2HMIB 4LSNB 2N3OA 1HBOA 2QL5B 1FNMA 3QFHA 1CPZA 1FD8A 3W66A 2NUUG 4IFVB 3MMJA 2PMWA 5AXKA 1HWLA 4ZPVR 1SQGA 3EE3A 2EC0A 3HFZB 3DFEA 3CPWR 1HNWJ 3CCUS 3GZ7A 2OTLS 2LEAA 5AXNA 2PFDA 5H9FK 2XB2D 4PRFA 4B9SA 1NK9A 1U2FA 4ES3A 2VICA 2JC1A 4L74A 2RILA 2DNYA 3MOZA 2VG5B 3ISNC 1TU0B 4DV1J 1HNVB 4ED0A 1EIYB 3OXFA 4H4OA 1GXLA 2BBEA 2DB1A 4XIUA 5ETNA 2IC3A 1QAYA 2IVYA 3ENAA 4UOHA 3GWCA 3M8QB 4X4OA 2OD6A 4DF4A 4WKYA 4P10A 2XGQA 1RAHB 1D09B 3FK4A 3I87A 2YX4A 3W62A 3LP0B 5K8NA 3UVJA 2AIRB 3V6HA 4DFKA 4DV7F 5KG0A 3NG8A 3Q8QB 2O3DA 5HL7Q 4JI1J 3BGLA 4URQU 1XR6A 1NHUA 1VQSA 3W65A 2GHWA 2DTJA 2W9CB 5ETPA 4GVBA 3RBXA 2QSFA 1KHWA 1YVFA 2C2ZB 3NS7B 1XNRJ 4F0MA 1HQEA 5J2PB 1N56A 2ZJQQ 2FD2A 2HRYA 1U8WA 2VASA 2ADCA 2AGOA 3TW0A 4ZLNA 5IZHA 1XBWA 3WHIA 1NDKA 3VGVA 4HTJA 4HDGA 2EK6A 2V4JB 4IOBA 4F4KA 3W2WA 1JMTA 3W61A 4ZOSA 4KTQA 4B9NA 2CDRB 1S9GA 4O0IA 5F8HA 2NZCA 3UDCA 1HNIB 2EK1A 1RAJA 1UA1A 3M9NB 4P74A 1RJJA 2K7KA 4EGLA 1Q8IA 2Q79A 3DRRA 4HH1A 4MYUA 4KPYA 4DQPA 3KLEA 3W8PA 2EC2A 3C15B 3CW2C 4RW9A 3T5KA 2YQ1A 1HI0P 4B3OB 4Z7CA 2V2QA 3JSMB 4CDIA 2HQ3A 3QGIA 1WG4A 2WZ1A 3TZZA 3LW5C 2HWHA 3DOMA 2HNZA 3EDRB 3QYYA 3NGTA 2EFPA 2LQ8A 4DR3F 5HAOA 1Q5YA 2WAQD 3CB4A 2AJ2A 4ZLPA 5HN0A 5H1SV 2OFHX 1NKCA 2XNQA 2OEKA 2ADBA 1IWGA 2HHPA 3SQGA 3CJKB 3U7JA 1XC9A 2XY5A 4S0MA 3B8HA 3B6BA 4RW6A 4WE1B 4EO6A 4M1KA 2AWZA 1JLCA 1QLNA 3RB0A 3O6QA 1RTJA 3KLFA 1DHMA 1GX5A 3HI9A 1ULRA 1MU2B 3BGFA 3TWZA 4CIOA 2HHQA 2VPYB 1M90T 1RHJB 1U26A 5EWGA 3CDAA 1WDDA 4LBIA 1GMWA 1BWEA 4C11A 2LU1A 2B4VA 4HACA 3VVTA 3W7BA 4ELTA 1U47A 4NXNJ 5B0EA 2J6TA 5AE2A 1H2UX 1WC4A 3POTA 3IO1A 2IMWP 2CQGA 2XBPA 5F8IA 1JLAB 4CM0A 1IXKA 2G1HA 4WP3A 4AE5A 3SFUA 5DQIA 4A48A 1P9YA 4KKOB 2A18A 2BR0A 4ICLB 1EQ0A 2FUG9 4NI2B 2BE9B 1UPMB 4LFAJ 2C2KB 2CQBA 1N5YB 3PTWA 4YY3F 3MMAA 4USUA 1JLEA 2ZH8A 3W9IA 4DG1A 4GKJF 3FKBA 2HHUA 1ZTTA 3I6PA 5D8HB 4C3LA 2AJ4A 2NXNA 3OVAA 5EWFA 2R2TA 1SVDA 1GT8A 4QWBA 1X4HA 2J8SA 4ZDNA 3C6UA 3FZ2A 2RAQA 1T03B 1ZTWA 5CD4H 1B99A 3D68A 4CCHA 5C24A 2GQCA 2FLPA 4N56A 3I31A 2YWKA 5J2MB 4X4QA 2KXFA 2RD5C 4NE9C 2IRXA 1JLFA 3M2VA 5CYJA 2M2BA 3C8YA 3HLUA 1RXOB 2JEJA 4RR5A 2FJAB 4KGVB 4OYAA 2UXBJ 2CIMA 3J80Y 1T05B 1U1KA 2HVZA 4NA1A 4KJIA 2J9DE 2FJEB 3KG4A 3PHEA 1MW7A 1HBNB 2VD3A 3VAMA 5EWEA 1VLYA 2D3ZA 1FNOA 3JAMU 1PC4A 5HQLA 2HG4A 1DTTA 4FYWB 4O3NA 4AYBD 1NSKL 2KN4A 1GXUA 5F3ZA 3HVWA 4CLZA 2GVZA 4RZRA 4KFBA 3TVKA 2ZUAA 5HO4A 2W7OA 4FKXA 3DKDA 4M5DA 1VQYA 3DGPB 2YH1A 2CVIA 2D3OR 5LL6d 5KT4A 1XN9A 3TJ9A 5HQ8A 2M52A 1S5ZA 2KT3A 5AJ3J 3PIOQ 1H72C 4KQZA 1U02A 4J9KA 1KNZA 1SL0A 3BH6B 2LDYA 2XEXA 2VJVA 4WFYA 1O8BA 5CAAA 5KFJA 2V8GA 3BN7A 1L3KA 1SKWA 2CWXA 3I5AA 5D0GA 3WZ0A 2E9ZA 2J76E 4ID5B 2KXNB 3PX4A 4N41A 1LXJA 3TUJC 1WEXA 5ITHA 3M9MB 2DR9A 4D3HA 3GFXA 1RHKB 4DF8A 1NH8A 4XDDA 3CCZA 3GCXP 2COLA 1JJHA 2RU9A 1WD6A 3OL9A 1QE1A 1R0CB 1QTMA 1EP4A 3MM9B 3KYLA 4FF4A 1FK9A 3OHBA 1WWHA 3HVTB 2IJNA 4XAKA 3AOCA 1S9EB 1JLGB 2CQ3A 4HHJA 3NOCA 2B8PA 1UFKA 2ROGA 5LT5A 2BA9A 4DS5A 3MMCB 9RUBA 4J9NA 2CNLB 3TZYA 3H5UA 1RWOB 1MWZA 4ZVUB 2CKWA 3ZZPA 1S6OA 2FZKB 2CZVC 2I6WA 2DR7A 1IKYB 1YJRA 5HATA 2DNNA 1HLWA 3HJFA 1O6XA 2K3IA 2VBXA 2JZ5A 2Z2ZA 1ZM4A 5KFVA 3H8YA 1MSWD 3W64A 1E6VA 2WK4A 4DUYF 5SZTA 3NWRA 2OAUA 3D6TB 5FLXY 3D0HE 4G1QA 2V8VA 3DRPA 1T9XA 1NK4A 3C6TA 1C0TB 5IWAJ 3TEHB 3X1LB 1FDBA 3QO9B 1LV5A 2U1AA 1RT1B 2W9BB 5CCMA 1S9FA 3LA0A 1H0HB 1UZHA 3QRQA 4ZLLA 2D1CA 4EI2A 1WHWA 1N5SA 2A6OA 5I4MA 1TL1B 4M5MA 4DMZA 2VFSA 1ICEB 3SBMA 2QEXS 2VQEJ 2C28A 4W90B 2A6MA 5EX0A 2LXIA 1YHQS 4LFCJ 3THTA 3OL6A 4UW2A 3H4BA 1D9FA 5KFBA 3JTNA 4DV3J 2VBWA 2ZM6F 4YOEA 3NEKA 4X62F 2XNRA 2E66A 2ZBRA 3KWMA 1VQ5S 2RIJA 3WIUA 4B3RF 1BQNA 1MLAA 3G4SS 5HMYA 4FXVA 3A8JA 1DLOA 2QFIA 2PC6A 2VOOA 2YKMA 2RVJA 2KJVA 4BWJA 4LRCA 3VVUA 5B09A 3MFIA 4M5NA 2BVZA 2GMJA 5D0RA 1TL5A 2D69A 2JL9A 1FRJA 2HKEA 3CD6S 3OQ2A 2IDLA 2J0QD 1FF2A 1FO1A 1R8HA 4Z2XA 4X84A 3MEEA 1HW9A 2EFNA 5HROB 2XS5A 1TKXB 4FF1A 2UUCJ 1R8AA 3FBCA 4OX7A 3RBEA 2F8MA 2V9KA 3KLGA 1Y3KA 2DNKA 5HLFB 1HBMA 4NLRA 3FSIA 3EGVA 4I6AA 2E5IA 3PZPA 1A0OB 3MAHA 4YDDB 2BJ9A 1AZSB 4PKDB 3TANA 3TP2A 3C19A 4CH0S 3OLBA 3PYFA 1KN6A 4P7VA 2PEBA 5D4OA 4B3MJ 4LF1A 3OL8A 4FS2A 1U45A 2MKHA 4K50A 2DEJA 2YXLA 3DU6A 2ZH6A 1VQLS 4Q0BB 2DT9A 3DC2A 1TL7A 1FKOA 2MGZB 2F4VJ 3KJFB 1CJVA 3M4XA 2EKYA 2Q66A 4R8UA 4JV0A 2R7XA 3N6LA 1NXIA 3GYNA 3MAQA 2QE5A 4TY8B 2C2EA 4OX9F 2GMLA 1XMOJ 2F40A 2EFOA 2HZCA 2J6UA 2B9YA 2Z8QA 3DOLA 2W2PP 1K8AT 2YWHA 4FYDA 1RAOA 3BREA 3T1HJ 4OI2A 4DDFA 1U25A 2ZHOA 3OSPA 4C8YA 5I42A 4N77A 4IR9A 1TFWA 1RAGB 2V9WA 2CYYA 3JSRA 4ZJLA 2B6AB 2QIFA 3KJVA 4YFUA 5A6WA 2C2MB 4Y65A 3ZNJ1 3BGRB 4NOHA 5D3GB 3QWUA 2D3UA 1JQGA 2V68A 2PI5A 3CC2S 4F25A 5H9EJ 2HYIB 1KOOA 1VBZA 4MTPA 3ENVA 1NPKA 3P8BB 1F5AA 3D1OA 3PRBA 3M30A 4C8NA 2WVEA 4M94A 4QPXA 3DM2B 1XK8A 2KFYA 5KFOA 1CQNA 4CZCA 1YSJA 1CC7A 1YZ7A 1IBKJ 4DR2J 4LF7J 1PBAA 4ED5A 2HS4A 3G82B 1B7FA 2QMUB 2LDIA 2IA0A 4X4VA 1WEZA 4UY85 3B4DA 3MAAA 1S79A 1REVB 3PDNA 2CQHA 1SH2A 2EEYA 3UD3P 1S6QB 5HI7A 3FFIA 3EJMA 2M0GB 4GC6A 4LMZA 4M5LA 2CQ1A 2VPXB 1D1UA 1KKHA 2AP6A 2OELA 2ZUGA 2H5IB 3T1AA 2YNGA 2DGSA 3HFVA 4CP5A 4TY9A 1Y11A 3T6BA 4X66F 2FZCB 1LWEB 1S12A 1LW2B 4OZLA 2HZAA 1FJGF 2VODA 3GONA 3CCRS 4DV4F 5J2QB 3C14B 1OY6A 4DX8H 4JI3J 1BQMB 1X5TA 1SV5B 3CJRA 3TX8A 2XO7A 1JIHA 2FHJD 2ZWPA 4E8UA 3MECB 1KVJA 4C0BA 2C22A 1SIWB 4JV5F 1R6VA 3FDSA 4TKTA 3RU0A 2ZH5A 1RT6B 3KMQA 4LR8A 3DDIA 3QJLA 2OPSB 1VJQA 4K4UA 2BANB 2R7VA 1EAYC 4USJC 1YRUA 1IJEB 5B0FA 2FLOA 2QA2A 4DEZA 5KFHA 2VUGA 1KD1T 3DLKA 1HMVA 4MIAA 5F9LA 3OUYA 3HM9A 1HI8A 4I4BA 4IRCA 1TK0A 3MPVA 3NAHA 3WX4A 2UVWA 1FRHA 3HHLC 3T1YF 1HWKA 3US5A 2ZC3A 2RUSA 1HQUA 3CIZA 3KLHB 3P6YC 1N32F 4CWBA 1VQ7S 8ATCB 5IQQA 3J81U 1Q5VA 3CMQA 3H0PA 2ZBCA 1WNEA 4ZCMA 2Z2YB 4WCEQ 3DU5A 1NNDA 3NNHA 1VRUB 3OR2B 1UVIA 1IBCB 3O1LA 3OLAA 6FD1A 4H4KA 3QSYB 2EBGA 3RR7A 3ZTSA 1Y4ZB 2ZZTA 3BB5A 2VONA 1S1WB 2LU2A 2ZVSA 1N0UA 5LSLA 1SUQB 4K7QA 4ECUA 1YWXA 2AF6A 1S7HA 1S0MA 2HMIA 3CD0A 1NMEB 3N01A 4LF6F 4CO3A 4Q2MA 4IFVA 1WHYA 3R3TA 4I7FB 4J9PA 1RYSA 5EHHA 5F0UA 2E5HA 4NA2A 1HYSB 1DRZA 3LUYA 3VAJA 4A8WA 3NS6A 1HBUB 1YJ9S 1NK7A 3MPDA 3OTOJ 1HNWF 3EM1A 1W25A 3M32A 1G6BA 2XMUA 3G2XA 4IOAQ 2XWXA 5LXRA 4ZVHA 2VG5A 4OI3A 1HNVA 3OTEA 4DV1F 4WFZA 2E7WA 3H20A 2HS3A 1AW0A 2HVIA 3MPUB 2O66A 3M8QA 1UJ4A 4QWDA 3G71S 2IVFB 2U2FA 1RWXB 4OYIA 3Q2SC 5C7PA 5GMKa 4A8OA 3MF5A 3LP0A 5T7LB 1UL3A 4YN3B 1SC6A 1P27B 2EBEA 1CG2A 1NBEB 2G0CA 3HHLB 4P7TA 2VFVA 3UDLA 2OPPB 3FQLA 4UOCA 1WF2A 1IKVB 4JUZA 2XYHB 3BO4A 1K0VA 4IH7A 1GEHA 2W9CA 2NYIA 2HQDA 2BKNA 1TQLA 5KFFA 1SKSA 1V3ZA 2K1RB 3NGKA 5J2PA 3KUGA 1XNRF 4ANCA 1C1CB 3W1YC 3P45B 1WC6A 2H5EA 1R8BA 1RWKB 3K2YA 1U7LA 1NJWA 1Q86T 4HI2A 3EPGA 1QAXA 3FJ2A 4CO1A 4YQWA 2XTJP 1FTRA 3FSYA 4FNIA 2FHOB 2VC1A 5L39A 2MQQA 1D0EA 1RWPB 2V4JA 3P96A 2V63A 1KC8T 3CC7S 3H42A 1HHQA 2ZOGA 4ECXA 4RKUC 3ITHB 2V4RA 1M1HA 3BQ1A 2CJ9A 1HNIA 3DLHA 3MM8B 1SH0A 2MPUA 3ZZRA 1RE1B 3TEGA 3MFHA 4JV1A 4A8XA 1ELOA 1CULB 4EBCA 4WYLA 3C15A 2AU0A 3RB6A 2W24A 3ULHA 1XJWB 1VQPS 4DLEA 4B3OA 1C4CA 3JSMA 4F3MA 3AT1B 2MQ8A 3W9JA 1Y7PA 3ADAC 4MAKA 4OI0A 1D9AA 4EZ9A 3MM6B 3UCZP 2K2PA 4X65F 1FE4A 5L8RC 2DY1A 4LIRA 2O5DA 1IVZA 4BHQA 3BPDA 2AJFE 4OX8A 5F8GA 3NMAA 1UVLA 1LKZA 3IAS9 1YQHA 3RW7A 4WYWA 3QZ7A 5HANA 3BKTA 3CJKA 2HQFA 3T6JA 2PSZA 4Y3CA 1WDTA 2DR6A 2MQNA 4WBFA 4WE1A 3AJ1A 4ZVSB 2QYCA 5CYQB 4CQ1A 2E7XA 1MU2A 1FRKA 3ZZTA 4NLGA 3CO9A 2A1BA 4RJVA 3OL7A 2WB1D 2KDOA 1KTVA 1XMQF 3KK2B 2N82B 1R6YA 4PEOA 4ED3A 2FVCA 2GIRA 3TQEA 5B7WA 2FPHX 5DLGA 1ZAVA 3EVOA 1KTQA 3OTBA 4NXNF 1JLAA 4LRFA 4TVAB 3VGTA 1G7CB 4QQBA 2LLZA 4DPWA 2NPIA 4LF2A 4KKOA 1KQGB 3VHQA 4ICLA 2GHVC 3K59A 3RW6A 4A47A 3PJ9A 4NI2A 1VS3A 3SYZA 5CCLA 2XG8A 4RWWA 2ZEJA 2RQCA 2RNEA 1YK9A 2DCLA 2P8IA 4DCPB 4PXDA 4FXDA 1N5YA 3GG1A 1SI9A 2NPFA 1F9EB 3U27A 5RUBA 1FEEA 2FJBB 4NZ0A 4J5OA 3FBBA 2I9SA 4DQQA 4X2BA 1CBKA 1YG0A 3BSOA 2XMWA 1SC3B 1W7WA 4DSFA 2PFFB 3CT9A 4X64F 4WF9Q 5EN1A 5E3AA 4FXWA 1IBLJ 3BF4A 3V4IB 1T03A 1G1XA 1JLBB 3D67A 2HLTA 3K5NA 3IMQJ 4ETZA 1TUGB 4ZIVA 1QDUB 3HF5A 1MMDA 3LP2B 4ZN3A 3S1TA 3MEGB 2KI2A 5M2RA 2UUAJ 3PRVA 3QZ8A 1HPZB 4K4WA 3JB9k 2BJ7A 3FEXB 4OJHA 4F0HA 2PN6A 3H2VE 3BJYA 4KRWA 2WB4A 2MHEA 5KT6A 2D7SA 1YJTA 2QSWA 3SXLA 1T05A 4ED6A 2UXBF 2GJ2A 2W9AA 2ZH7A 1V5VA 2JJ4D 4ZVTB 1U1QA 4OZ2A 2IM1A 1HBNA 2V6AA 5EDWA 2ROEA 2GS8A 3Q23A 2C3UA 4AFFA 1S1VB 3BDEA 3RAMA 1B7YB 3GIRA 3HCXA 1N36J 2FQQB 2C3MA 3QSIA 3J7AN 3ZFVA 1P1TA 3WDOA 3GIIA 3H2UB 3UD5A 1F1BB 2CNKB 3IBFB 4BDPA 2CJBA 3DGPA 1EB0A 4MJKA 3M6UA 4RW8A 2C2RA 1SB6A 5KG7A 2V50A 4MYTA 3VGUA 3FCWA 4NX9A 3ETOA 3A3OB 2AD9A 1UEVA 2GFFA 3U1NA 2JEFA 1H6KX 3DLBA 4USKA 2N4DA 1UZDA 1LXNA 5L46A 3VALA 5L1JA 2H3EB 4YUDA 4A8KA 4KT0C 4K4YA 1TMMA 5KAKA 4GVLA 4NL5A 4YS2A 1BMQB 1X4EA 3TOQA 4ES1A 2KVQE 5JMNA 2JEGA 1URRA 2W2MP 3N6NA 1UMJA 1YBAA 1KDNA 5G0RB 4ID5A 2JH3A 4OV6A 3VV2B 3NOGA 4NWBA 2GZOA 1ZM2A 3KUEA 1GH8A 3MR2A 4PPDA 4FYYB 4DSLA 3QJPA 1RHMB 1IM6A 2OEJA 3PCOB 1NPRA 2Y3YA 3CJ4A 3MPWA 4WU2A 2R8GA 3PX0A 4CT8A 5J1EB 1N52B 3M2UB 3MDFA 3MM9A 3A3NB 3MTKA 3IS9B 2PO4A 4LF4J 3ZNUA 5CABA 1FFGB 1HKAA 2B3TB 1AFIA 2YNHB 4AXJA 1KLNA 1S9EA 1JLGA 3VGSA 4OHWA 4JYAJ 1RT3B 1LFWA 2E1AA 3MMCA 4FP9A 3NRBA 2RKIB 3ZZYA 3QLHB 4F50A 4NCGB 1RDRA 4EWTA 4IDKB 4RO0A 2MZQA 1UTAA 4IFYB 1QVGR 2E7VA 4Q44A 3SI8A 4YP3A 2VHGA 4A8YA 3UDVA 2BYCA 4LR9A 1X5OA 1UW9A 2BKPA 2P5VA 1IKYA 2D9OA 4ECVA 2DKOB 1FKAF 4DL6A 2XCAA 2HAIA 3UO0A 1F0XA 2L41A 2XLKA 2KRRA 3VQTA 2NXJA 4Q7AA 4CO5A 1WTBA 1UJ5A 3CE8A 1CSJA 1HNXF 5DQGA 2GMHA 4P73A 4MK8A 1WHVA 4OHYA 3AAWB 3ISND 2R7WA 3N28A 4YR3A 4K4TA 4AQYJ 4PQAA 1ROFA 2G0IA 2ZJPQ 3F73A 4K5RA 1NJXA 1TVRB 2HRUA 4DR7J 1ZAWA 8RUCA 4PG7A 2CPFA 1C0TA 4Y34A 4K4SA 4NASA 4LSZB 3QO9A 3IR5B 1RT1A 4CT9A 2W9BA 2HHHJ 2HNDB 3RUBL 4RUAA 3MM7A 3G9CA 3ETMA 1NH7A 5CA5A 4J90A 3MUVP 2ZJRQ 1TL1A 3D7SB 2ALYB 2ERRA 3MCMA 2UXCF 1U09A 5JVHQ 2XHCA 5A76A 3MHYA 3P5BP 4C48A 2VQEF 1DTQB 1XR7A 4UZCA 5LOQA 1U1RA 4NXMF 2UUWA 3DCAA 6AT1B 4LFCF 2B8QA 5BR8J 3DLGB 2J9CA 2J5AA 4ENOA 3EICA 2EI5A 4DV3F 3CUNA 2HFNA 2VDIA 4OYBA 3TYTA 1UFLA 4DSEA 3C2PA 2XZTB 3RTVA 2NQPA 1SL1A 2BM0A 2VBYA 1Q53A 1CJTB 3OV7A 1V3RA 3KTQA 3AA8A 4H54A 4DHVA 3CCVS 1GX6A 3LWLA 4DPYA 3M8PA 2VH7A 1F5CA 3EWGA 2BACA 4J9UE 2GIFA 7AT1B 2ILYA 2GX8A 2R3VA 3BKUA 3EZOA 2BJ1A 4QIFA 1N34J 1Q1KA 5HROA 1TKXA 5IV4A 3KJQB 2AJQA 3HXMA 3QBCA 2ZH2A 4XDCA 2UUCF 2OSRA 1H7WA 1N4LA 1TELA 5HLFA 2HVEA 5B0BA 2CA9A 3G8SA 4GO5X 3MCNA 2Q43A 2MY8A 2JLEA 3PRDA 3SCIE 3PKMA 3KUHA 3NS5A 1M1KT 4YHHJ 3TVZA 1Q78A 3MMBA 3KNGA 3L09A 1AZSA 1FERA 1JKHA 4RL1A 1BY9A 1FNXH 1YZ6A 5CZXA 5KFMA 1YBUA 4R0EA 5LSOA 1M5PC 2G9OA 3UI3A 3GIKA 4Y2KA 3V6DB 4TLRA 1FRIA 2LXUA 4B3MF 1WOSA 2VFRA 1VK3A 1EQMA 4WIIA 3SV3A 3Q8YA 4ZP7A 4PWWA 4Q0BA 3OFFA 2MGZA 1M1GA 3CDUA 5HMZA 4JI4J 2P9CA 3IFEA 2F4VF 3V6KA 2DPJA 3R5GA 1HWIA 3THPA 2DHAA 1JJ4A 4TY8A 2ZBPA 1KVIA 4EK2A 4M5HA 4O3RA 4FYXB 2IRYA 4JI6J 1XMOF 3CTRA 2H54B 1S4EA 5KG6A 3OJUA 2RF2B 3PYGA 3I5BA 3PHTA 1WJ9A 5ETOA 3OFEA 3T1HF 1R43A 1OYEA 4B08A 4PYAA 1VFJA 3I4PA 2GQ2A 4L75A 4PXBA 5T41A 2B6AA 4DR4J 4Q8FA 2QL7B 1I3OB 2RQ4A 4EU0A 3H2LA 4NLXA 1TKDA 3BGRA 5J2NB 2YBVA 3GSDA 5D3GA 2AX0A 1P9QC 3OR1B 4B3TJ 5THWA 1VIXA 4X4TA 2AMCB 2FY1A 3KLIB 4UOFA 1LW0B 1RQ0A 2LA6A 1RA6A 4OYMA 1VQ8S 4ZP6A 3GPAA 3LAKA 3DM2A 4ZP8A 4OI6A 2MSTA 3G8QA 3I9ZA 1A6LA 2KTQA 1RBOB 1QSSA 3G82A 4DR2F 1IBKF 4LF7F 1JJ2R 4NPOA 5B0AA 4I6YA 1DZ5A 3VAIA 3HHNB 4CO2A 3LH2S 2V4QA 2OPQB 4AL6A 4K8RA 1REVA 1S6QA 4PPZA 3QNWB 4DUZJ 1BWVA 2QLXA 1OWXA
chains in the Genus database with same CATH topology
4DR5J 4GKKJ 1IBKJ 4DR2J 4DR4J 4X65J 1N32J 2UUCJ 4LF7J 2E5LJ 4LF4J 4DV4J 1IBLJ 1HNZJ 4LFAJ 1XNQJ 4X62J 1XMOJ 4DUYJ 3JAMU 4KHPJ 5LMNJ 3IMQJ 2VQEJ 4LF5J 4AQYJ 2MQ8A 4V1Ak 5A2QU 4B3RJ 4JYAJ 3OTOJ 4LF8J 3W1YC 4DR7J 3T1HJ 4JV5J 4B3TJ 2UUAJ 4LFCJ 4PWWA 1FJGJ 1J5EJ 4DV5J 4NEZA 2UXCJ 4DV0J 4JI4J 4KYZA 1N33J 4DV3J 4JI1J 5LM7E 4DV2J 2MTLA 4DR3J 3J81U 2HHHJ 1IBMJ 4KY3A 4NEYA 4HHUA 2KVQE 4NXMJ 4DR1J 4K0KJ 2UU9J 4LFBJ 1N34J 1HNXJ 2UXDJ 2KL8A 4NXNJ 4B3MJ 4DV6J 5AJ3J 3R2DJ 5FLXU 4JI7J 1XNRJ 4JI5J 1HNWJ 1XMQJ 4X64J 3D3CJ 4LF6J 4B3SJ 3T1YJ 4DV7J 4JI6J 1HR0J 4OX9J 5LMUJ 4GKJJ 4JI3J 4DR6J 3D3BJ 5IWAJ 4JI2J 1N36J 2ZM6J 3J7AN 2F4VJ 2MEWA 3R2CJ 4YHHJ 1I94J 5IT9U 2UXBJ 4YY3J 4JI0J 4DV1J 2VQFJ 4DUZJ 2UUBJ 5BR8J 4X66J 4JI8J 4RJVA 4LF9J 3J80U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 J;  4GKK J;  1IBK J;  4DR2 J;  4DR4 J;  4X65 J;  1N32 J;  2UUC J;  4LF7 J;  2E5L J;  4LF4 J;  4DV4 J;  1IBL J;  1HNZ J;  4LFA J;  1XNQ J;  4X62 J;  1XMO J;  4DUY J;  3JAM U;  4KHP J;  5LMN J;  3IMQ J;  2VQE J;  4LF5 J;  4AQY J;  2MQ8 A;  4V1A k;  5A2Q U;  4B3R J;  4JYA J;  3OTO J;  4LF8 J;  3W1Y C;  4DR7 J;  3T1H J;  4JV5 J;  4B3T J;  2UUA J;  4LFC J;  4PWW A;  1FJG J;  1J5E J;  4DV5 J;  4NEZ A;  2UXC J;  4DV0 J;  4JI4 J;  4KYZ A;  1N33 J;  4DV3 J;  4JI1 J;  5LM7 E;  4DV2 J;  2MTL A;  4DR3 J;  3J81 U;  2HHH J;  1IBM J;  4KY3 A;  4NEY A;  4HHU A;  2KVQ E;  4NXM J;  4DR1 J;  4K0K J;  2UU9 J;  4LFB J;  1N34 J;  1HNX J;  2UXD J;  2KL8 A;  4NXN J;  4B3M J;  4DV6 J;  5AJ3 J;  3R2D J;  5FLX U;  4JI7 J;  1XNR J;  4JI5 J;  1HNW J;  1XMQ J;  4X64 J;  3D3C J;  4LF6 J;  4B3S J;  3T1Y J;  4DV7 J;  4JI6 J;  1HR0 J;  4OX9 J;  5LMU J;  4GKJ J;  4JI3 J;  4DR6 J;  3D3B J;  5IWA J;  4JI2 J;  1N36 J;  2ZM6 J;  3J7A N;  2F4V J;  2MEW A;  3R2C J;  4YHH J;  1I94 J;  5IT9 U;  2UXB J;  4YY3 J;  4JI0 J;  4DV1 J;  2VQF J;  4DUZ J;  2UUB J;  5BR8 J;  4X66 J;  4JI8 J;  4RJV A;  4LF9 J;  3J80 U; 
#chains in the Genus database with same CATH topology
 3GJR B;  3TAM B;  4DR5 J;  3UWT A;  4ZVO B;  3IWN C;  2K06 A;  2BRK A;  2CJY B;  1Z4U A;  2DNQ A;  2KFZ A;  3PVX A;  4NRT A;  5DRK A;  1Q82 T;  1VRT B;  2DHG A;  1LWE A;  1NM2 A;  1LW2 A;  3I5C A;  2BJ3 A;  3NL0 A;  1D9D A;  5J2Q A;  3C14 A;  4RLE A;  4UQT A;  1BQM A;  1D3W A;  1J5E J;  3F56 A;  4C8L A;  1S1T B;  2KVI A;  1AB8 A;  1L3S A;  4JI3 F;  4IG0 A;  2ZFH A;  4L76 A;  4EMD A;  3CCE S;  2QLW A;  4PR6 A;  5GMD A;  1U2C A;  2HQC A;  2I5J B;  2H4Y B;  2AT1 B;  3AHP A;  3S01 A;  1VLO A;  5KT5 A;  4NEY A;  1AYE A;  4HHU A;  1RT6 A;  3GV7 B;  3LGM A;  1CC8 A;  2W4D A;  5HMW A;  2OPS A;  2FVR A;  3W2V A;  4OX6 A;  4IRK A;  1FXR A;  1NB7 A;  3CD7 A;  1RTD B;  3D3C J;  2NYH A;  2MQO A;  1BHN A;  3VAH A;  5IOL A;  3NMR A;  2HVH A;  1K9M T;  1FKP B;  3R6G B;  5BYQ A;  2BAB A;  2DYA A;  5HMX A;  3KLH A;  2ROP A;  1NHV A;  1MRO B;  2ZKT A;  5HBM B;  3VZI A;  4ED8 A;  5GAH I;  3TRG A;  5DET A;  4JI2 F;  1WKJ A;  1VRU A;  4X4R A;  1M5S A;  3P49 B;  3OR2 A;  4ZHR B;  1SJ4 P;  3VAF A;  2KG1 A;  4I2Q B;  1R31 A;  4FF2 A;  5K5M A;  1S1W A;  2AYG A;  1B70 B;  3K5L A;  3L9Z A;  5DDO C;  2IYI A;  1SUQ A;  4DV2 J;  3CCQ S;  4JBC A;  2CJX B;  2IBO A;  2SXL A;  2BOA A;  1HFE L;  1I1G A;  4RUH A;  2YNI B;  3MZI A;  4I0W A;  3BEG B;  2AZ3 A;  4I7F A;  4B9M A;  1RT5 B;  2YWE A;  4BLG A;  1HYS A;  1UET A;  1X0F A;  1MN7 A;  3PNI A;  3EXC X;  1HBU A;  2MB0 B;  2YY3 A;  3SV4 A;  5IT9 U;  2MZJ A;  3GSI A;  3CJ2 A;  1VQN S;  4PUO B;  3JYT B;  1KS2 A;  2EG2 A;  2K8G A;  5KFD A;  3AFG A;  5JUM A;  2YKN B;  4M5J A;  1QJH A;  4F2R A;  5E3R A;  5IC6 B;  7FD1 A;  3IA0 A;  4WTO B;  2CG4 A;  2KHC A;  4KGZ B;  4M63 A;  1T02 A;  2LYV A;  4PG6 A;  1KQK A;  4I6W A;  4WPA A;  2ACM A;  4DV5 J;  2E5G A;  4ID8 A;  2RT3 A;  2FJD B;  2PMH A;  1YJN S;  2PT0 A;  1TKZ B;  4NLD A;  2V8D A;  2YWF A;  4P9S A;  2Y8Y A;  1DFD A;  2V2Z A;  4USW A;  1Y9O A;  2X7I A;  1VJW A;  2CPH A;  2ZOM A;  1CJK A;  2OPP A;  2HHW A;  5C42 B;  2AGQ A;  4WKR A;  2IHR 1;  4C98 A;  1BUX A;  4ZIT A;  5GVQ A;  2G4B A;  2VL1 A;  4CLU A;  1PGZ A;  2K1R A;  5KFT A;  1NK8 A;  2LP4 A;  2KKH A;  1C1C A;  5CH7 B;  1U0S A;  3BV8 A;  5KG5 A;  3ZTO A;  4R25 A;  3A8E A;  3CO0 P;  2ZE2 A;  2JX2 A;  2VQF J;  3KHH A;  1EKS A;  2AV5 A;  2F65 A;  2Z58 B;  3IAM 9;  4GKK J;  5AE3 A;  3EZU A;  3UE2 A;  4CRJ A;  4Q8E A;  3UW1 A;  4X4N A;  1M5K C;  2HLU A;  3VAK A;  2XQC A;  5KOX A;  4C8M A;  2BZ2 A;  3M8S A;  5LJ5 Y;  5DLF A;  4URG A;  1TL3 A;  2VOP A;  1T3N A;  1PSD A;  3AB4 B;  3DMJ B;  3ITH A;  4WK1 A;  3WC0 A;  3LP1 B;  1HHS A;  1VC5 A;  2MQM A;  2OML A;  3MM8 A;  4USH A;  2L9D A;  2VG7 B;  1ZPW X;  4DR3 J;  3O5T B;  5MLC V;  3LF0 A;  1AXQ A;  2NSC A;  3DOK B;  4IRD A;  1CUL A;  1RAI B;  2Z2L A;  1H38 A;  2X51 A;  5KFC A;  1UA0 A;  1F2H A;  3R6L B;  1S59 A;  3H25 A;  2HHX A;  5KTQ A;  4DX7 A;  4TU8 A;  3SQG B;  4B9T A;  2VFU A;  1R27 B;  4Y0F A;  1RU1 A;  2CAJ A;  3MM6 A;  5LJ3 Y;  1YIT S;  5KFI A;  3PKY A;  1NLK L;  2FZG B;  3M6W A;  2M4M A;  3GIJ A;  4R5P A;  3H98 A;  2D74 B;  4TU7 A;  5GAD I;  2FVQ A;  1ZM9 A;  1U8S A;  4OQJ A;  1EAR A;  1NZA A;  1FCA A;  3I82 A;  3NLC A;  2BE7 D;  1RBA A;  3OHA A;  4N8O A;  1IJF B;  2KB2 A;  4NRU A;  3DLE B;  2UV8 A;  3ENQ A;  4LF8 J;  3PY8 A;  5CYQ A;  4KGK A;  1QSY A;  3PX6 A;  3CME S;  4N76 A;  1Q7Y T;  1G4C A;  3J7Z 5;  4CNZ A;  3D9B A;  5A8W B;  3I56 S;  5GAH U;  3RGI A;  3PYD A;  2HFU A;  1Q7L B;  3W5Z A;  4LF5 F;  3KK2 A;  4QZV B;  4U95 A;  2DNO A;  1OSC A;  2Y8W A;  1UWA A;  1NZ8 A;  1VQK S;  2HWT A;  3EGW B;  4DS4 A;  2ZNZ A;  1KEK A;  4DZ6 A;  3A1Y G;  2FHM A;  1GNK A;  4DU7 A;  1Q95 G;  1R0B G;  2R7R A;  4WFX A;  2RRN A;  4DL4 A;  2Q6C A;  3GJT B;  4ED1 A;  1T9V A;  4YY3 J;  3ONQ A;  1UKU A;  4QYR A;  1UPP A;  2CQP A;  3M9O B;  1AUD A;  1WC3 A;  4C3K A;  1UVK A;  2I0X A;  3NWG A;  3NBP B;  4FDF A;  4RNH A;  4WIQ A;  1U1L A;  1F5B A;  4OYP A;  1X5P A;  1FRX A;  5HVF A;  5ETT A;  1LWF B;  1L5U A;  2VPW B;  4ZVQ B;  3I0R B;  2DHH A;  3AXK A;  3Q24 A;  3R1L A;  4HL9 A;  1YGY A;  2NR0 A;  1X4F A;  2MTL A;  3KDO A;  1PG5 B;  4IKA A;  4QOT A;  2WOM B;  1ZZN A;  4KY3 A;  4LQ3 A;  3ET6 B;  3TUZ C;  2ASD A;  1BC6 A;  1T9W A;  2X3D A;  4F4X A;  3QT6 A;  3UNG C;  3RAQ A;  2W8L A;  3F0N A;  2B7B B;  2QT7 A;  4LIW A;  2F9J A;  4K4Z A;  1PIE A;  3HK2 A;  3V4I A;  3T5L A;  4P2S A;  4QWE A;  2A3J A;  2DBB A;  3FNN A;  1JLB A;  3LP2 A;  4I64 A;  2G1D A;  3BQ0 A;  3K17 A;  4OHV A;  3CDB A;  3NGR A;  1Y5I B;  2UUA F;  2J9D A;  4A8F A;  4NLU A;  3HKW A;  5H9E K;  4DSK A;  3PW7 A;  3PR4 A;  3DNC A;  5GAE U;  4J9V A;  5LMN J;  5KFY A;  1A7G E;  5ETR A;  1S1V A;  4J9S A;  2R4F A;  2BEF A;  4NLT A;  2P6T A;  1QAJ A;  1FVQ A;  2HS0 A;  4HKQ A;  4WXO A;  1N36 F;  3OT9 A;  5D4N A;  2QA4 S;  4DX6 A;  2OPR B;  3G6X A;  2X1B A;  2BKO A;  3NGS A;  2XMJ A;  4LRB A;  1N5T A;  1WC0 A;  2A10 A;  1B0P A;  4TXS A;  2E29 A;  1SPB P;  2MKK A;  4ZPB A;  1VR6 A;  1ZA1 B;  3Q8S B;  2QZ8 A;  1EKR A;  2J7K A;  1U4B A;  4ZMM A;  4HTI A;  8AT1 B;  1VOM A;  3HVA A;  5K8O A;  2ZDP A;  3V6J A;  1N33 F;  4DU8 A;  1YX2 A;  2BJE A;  4ZS6 A;  5ETQ A;  3KG1 A;  1VYA A;  1RAB B;  4C0O C;  1C0U B;  1K47 A;  1RKI A;  5KG2 A;  4KC5 A;  2DCU B;  1YJV A;  3CCW A;  3JXO A;  1W26 A;  1NDL A;  3HZE A;  2HQI A;  3GU0 A;  1Y3J A;  3OVS A;  1G3O A;  5JXS A;  1X0P A;  1KP6 A;  2DXF A;  4PWD B;  4JI0 F;  1NO8 A;  3FBF A;  2ZD1 B;  3GTY X;  5C25 A;  2YH0 A;  5GAD U;  5FDL B;  3ISZ A;  2HWI A;  3HHL D;  2HGL A;  1Y5L B;  2DRA A;  2ZVI A;  2DNZ A;  5D4P A;  3M2U A;  2V94 A;  4RU9 A;  2VC0 A;  3IS9 A;  1E6Y B;  3HT0 A;  4O3P A;  5KT3 A;  1TK8 A;  2HHV A;  2YNH A;  4LF4 F;  2UVR A;  3D3B J;  3M8W A;  2GVD B;  2H4W B;  1RT3 A;  4CYU B;  5KFQ A;  4OLO A;  5KFG A;  3NCQ A;  2JFK A;  2CPX A;  4K5S A;  2AGP A;  4JYA F;  3QGP A;  1OPI A;  2F3J A;  2RKI A;  3QLH A;  4NCG A;  3HUL A;  2HNY B;  2JWN A;  2FHK A;  4ZLJ A;  4IDK A;  2XZW A;  4B3S F;  2KZM A;  3PR5 B;  1FXD A;  4QBU A;  2ZH4 A;  4IFY A;  3FVY A;  4C6A A;  1KSP A;  2Z57 B;  3GFZ A;  4DUY J;  1F60 B;  1E6V B;  3TNV A;  2Z0G A;  3D6F B;  1RAF B;  2W4P A;  2DNM A;  2D3O 1;  3TZW A;  1RCX B;  1HD1 A;  1UWB B;  2DH7 A;  3ZZU A;  3FCH A;  3U1L A;  3DRP B;  1Y5N B;  3IR7 B;  5ETK A;  4DFP A;  3AOD A;  3E8O A;  4FNH A;  2DNG A;  2AQ4 A;  3H5Y A;  1NSQ A;  4F4Z A;  1DJ0 A;  3D0G E;  2JSX A;  2HHS A;  3SMZ A;  3G86 A;  5KG4 A;  4ILM A;  4CH7 A;  1I5O B;  1TVR A;  2CJA A;  4DR7 F;  2CPY A;  1BXN A;  4OIX A;  4Y28 C;  2HK3 A;  4FPI A;  3J80 U;  2HND A;  2BQ3 A;  3KJN B;  2HHH F;  2ZZM A;  5AE1 A;  4X62 J;  3AA9 A;  3BYR A;  1KQS R;  4O44 B;  2IVM A;  4QIG A;  4ECS A;  5KFL A;  2ZHA A;  4F3Q A;  2XLJ A;  4B3R J;  3V2U C;  5G4D A;  2DH8 A;  2I38 A;  4LF9 F;  2RRA A;  1D8Z A;  3BZQ A;  2VFT A;  2RSQ A;  4ETX A;  2E1C A;  2EXU A;  3D1H A;  3SEO A;  2RU3 A;  2YPY A;  2V69 A;  1AA1 B;  4MK7 A;  3DLG A;  4RUB A;  1SH3 A;  5BR8 F;  2FHJ A;  3IXQ A;  4URS A;  2DIV A;  3L3C A;  3THV A;  3R5C A;  4MKV A;  2DNP A;  3M6V A;  1FVS A;  4PZV A;  4JP8 A;  4P2X A;  4WP9 A;  1H2V Z;  3J7A 1;  3HT3 A;  2DR5 A;  2IFX A;  5KG1 A;  3EVW A;  2HZV A;  4JB8 B;  3UD4 P;  1I94 J;  1WEY A;  4PG8 A;  2MKY A;  2NUH A;  5A2Q Y;  3AOB A;  2QTW A;  2R2S A;  4Z7Y A;  1VQ6 S;  1IR2 A;  1NPP A;  3C16 A;  3QAU A;  4ED2 A;  3LWM A;  1F6T A;  3TVY A;  5KFW A;  2BE2 B;  5DQH A;  5GAG I;  2BMB A;  1B3T A;  1IN0 A;  2DR8 A;  1IKX B;  1RAA B;  1U1N A;  1FT8 A;  2EG1 A;  4YB6 A;  2WTF A;  3PYE A;  1FHT A;  1RT2 A;  2M3D A;  1FA0 A;  1TV6 B;  3DYA B;  3EX7 B;  4HEA 9;  3FQK A;  3TJ8 A;  3B78 A;  4I56 A;  3ZTQ A;  3UDE A;  4CLT A;  2Y1J A;  4YHH F;  2MZR A;  4YB7 A;  2F5G A;  3IC1 A;  4WP8 A;  1HWJ A;  2H1Y A;  1PKU A;  3AH6 A;  1OQ6 A;  4R8U B;  2IM0 A;  3ZZZ A;  4J37 A;  4O3S A;  4OX9 J;  3W9H A;  3V6D A;  1C4A A;  4Y2C A;  5L1K A;  2HIQ A;  2C2D A;  4LRD A;  2BJ8 A;  2M8D B;  5KFE A;  4LFB F;  3T9Z A;  5K9F A;  4QW9 A;  5U47 A;  4LVN P;  2WRM A;  4KB7 A;  4GC7 A;  5CQG A;  5C2C A;  1UEU A;  1C1B B;  2FVS A;  3EYZ A;  4DL7 A;  1YBT A;  5A2Q U;  5KFP A;  3M1V B;  2L9W A;  1N0V C;  3NP5 A;  3SSS A;  3GV8 B;  3MWB A;  4I67 A;  2RF2 A;  3UCU P;  2CQD A;  2XS2 A;  5HP1 B;  3PIP Q;  4C4W A;  1DBD A;  5F41 A;  4PXC A;  1ZET A;  3R8Y A;  1NRK A;  4EZ6 A;  4RNO A;  1MWQ A;  2MMY A;  1T9U A;  2QLF B;  3M30 B;  4YDX A;  4L3K A;  5FLX U;  1H74 A;  4QYZ J;  1BGX T;  4ZA1 A;  5KFN A;  2YNF B;  5J2N A;  3CJT A;  4IH5 A;  5E41 A;  4IQX A;  5K14 B;  4H4K C;  5A8K B;  1ZM3 A;  4DL3 A;  5LSR A;  2OGU A;  2POK A;  4C97 A;  3OR1 A;  5E3Q A;  4AUK A;  3RG6 A;  3HHK A;  4QW8 A;  3UR0 A;  3KLI A;  1LW0 A;  3KG0 A;  5FII A;  2AEJ A;  2W1B A;  1N6Q B;  2QLJ B;  4C8Z A;  4K59 A;  1HNZ J;  3AJD A;  1CS4 A;  4B9V A;  2FLN A;  4O3O A;  4YME A;  2RHS B;  4DPT A;  5BYS A;  2B4O A;  3J81 j;  2RQK A;  4M8L A;  1S99 A;  4WXW A;  2RDD A;  2DGU A;  2FIU A;  1FJG J;  4YEA A;  4ERD A;  2OPQ A;  3CMA S;  2XLI A;  3P3D A;  1TTH B;  3L7P A;  2IPO B;  5HVH A;  4A8M P;  1S0N A;  2QJ3 A;  3QFW A;  3VR1 A;  4I69 A;  2XY6 A;  1RK8 A;  4DUZ F;  1KQF B;  2UU9 J;  3Q8V A;  3TAM A;  4U7C A;  1RB0 A;  4WZM A;  4MT1 A;  4KV8 B;  4CI0 B;  4CLF A;  1XR5 A;  3JSB A;  1H3D A;  1VRT A;  2ILZ A;  3V81 B;  1S4F A;  4TU9 A;  5LMU J;  3QRR A;  1X4B A;  5D77 A;  1R0A B;  3OXG A;  2K3K A;  3P5T L;  1S0V A;  3GE9 A;  1Y10 A;  3GIM A;  2CVE A;  3TAQ A;  5DM7 Q;  3SDE B;  2E9R X;  1S1T A;  1LWX A;  3M8Z A;  2ZZN A;  1JB0 C;  2QL9 B;  1J5E F;  1VQO S;  3OTD A;  4YR2 A;  5D6G A;  3I96 A;  2I5J A;  3QT8 A;  1N32 J;  5AXL A;  5C5J A;  3NAI A;  2V0N A;  2HGN A;  4DR6 F;  2FB0 A;  2AEM A;  2DGQ A;  1XER A;  1VBK A;  1RTI B;  4OYZ A;  1RTD A;  2CJK A;  4QU7 A;  4LSL B;  1Z2L A;  2XMT A;  3OFG A;  2XMK A;  4ELV A;  4JI8 F;  3MXH P;  3C3L A;  4GMK A;  1FKP A;  4F04 B;  2BXJ A;  1N54 B;  4DL0 C;  5D78 A;  2C3P A;  2FC8 A;  5GAG U;  1X9W A;  2EPI A;  4UTG A;  2MYF A;  1MRO A;  5HBM A;  3PEH A;  4JI7 J;  1IKW B;  5CZV A;  4LF6 J;  2M9K A;  2QX0 A;  2YTC A;  4XTT A;  4ZHR A;  1X4C A;  4I2Q A;  3KHL A;  1PO6 A;  2KYX A;  1JNR B;  2ZWO A;  1RIS A;  3SSQ A;  3A8I A;  2MXY A;  3EUN A;  2PMZ D;  1CJU B;  4IG3 B;  2CNN B;  1GFW B;  3O8W A;  2UUB J;  5DDQ C;  4DFM A;  3MR5 A;  4EEY A;  1T8E A;  2KG0 A;  3TUI C;  2DY9 A;  2MQP A;  3NCR A;  3M32 B;  4DV2 F;  2Y9H A;  2MLZ A;  4DL2 A;  3Q0A A;  4MIB A;  4FN5 A;  2YNI A;  2BQU A;  2C1E B;  4F7V A;  3GIL A;  1KR4 A;  1VIO A;  1RT5 A;  3N4W A;  1V5I B;  1JLQ B;  2I2Y A;  3GJQ B;  4OI4 A;  4GO7 X;  3TX0 A;  4USV A;  1QAI A;  2XMM A;  4E2F B;  4IH6 A;  3M7V A;  3PFO A;  5LM7 E;  3UN3 A;  2PA8 D;  1B64 A;  2E5J A;  2NXU A;  1IR1 A;  4RPF A;  4PUO A;  2R7S A;  3JYT A;  2OHD A;  5IV3 A;  4OYW A;  3U1M A;  3GYX B;  4DOZ A;  4DLG A;  3J7Y I;  2YKN A;  2LKZ A;  3CF5 Q;  1REG X;  2VF3 A;  4FS1 A;  3QMQ A;  3DDK A;  4HH0 A;  1M0S A;  4G1P A;  1S72 S;  3KKF A;  1PYS B;  1M5H A;  3O2I A;  2ALZ A;  4DQR A;  2HBQ B;  4DPX A;  4DXL A;  1S97 A;  2VB6 A;  4DV5 F;  3OD2 A;  3HVR A;  2P9G A;  1TKZ A;  3KDN A;  1NCL A;  3HO1 A;  2FC9 A;  4GRS A;  1GTE A;  2OO4 A;  2ZH1 A;  2W2N P;  3JQK A;  3UR3 C;  3VWS A;  3FGV A;  2F1F A;  4OZ5 A;  4UOG A;  1N88 A;  5C42 A;  3IR6 B;  3HHE A;  4OZJ A;  4LBP A;  1WI6 A;  1NJI T;  2W2Q P;  4UY8 T;  3AB2 B;  3Q2T C;  3A12 A;  4FPR A;  1YRT A;  4AD6 A;  1EZZ B;  3R5A A;  5FJ4 A;  4KO0 B;  2FDN A;  4RX6 A;  4OHZ A;  1AT1 B;  2DGV A;  2N4C A;  1TFY A;  3HZG A;  1NK6 A;  2F9D A;  4P2F A;  2HHT A;  3HMJ G;  4DN0 A;  2VQF F;  4K0K J;  3EZ5 A;  1FX4 A;  2FJX A;  3OXL A;  4GKK F;  1HA1 A;  3RJM B;  1S1X B;  2ZOF A;  7FDR A;  2AZ1 A;  1UVM A;  2CXE A;  4LSN A;  3QJJ A;  3R9L A;  3KK1 B;  3TA0 A;  3RB3 A;  1UEK A;  3DMJ A;  4ES2 A;  2HBY B;  3RBZ A;  1DAX A;  2NS1 B;  3B54 A;  3LP1 A;  2UUT A;  2VG7 A;  3G6V A;  1T11 A;  2E1R A;  2HBR B;  4MFB B;  4X65 J;  3DOK A;  2XGP A;  2DXE A;  1NUE A;  4MMO A;  2IA6 A;  4ZJQ A;  1KOH A;  1RP5 A;  4ED4 A;  3TZX A;  4H4M B;  1O51 A;  4LRA A;  3DLJ A;  4ZKA A;  2XC9 A;  2RDJ A;  2QMW A;  1U6Z A;  3W8G A;  1DY3 A;  2YWW A;  1PJ7 A;  2XMA A;  2E44 A;  4KYZ A;  2QG9 B;  2HPU A;  1B4S A;  2DHS A;  2WHO A;  4WJB A;  1TKT B;  4JV2 A;  3K58 A;  1G2E A;  2QA1 A;  2BM1 A;  2R42 A;  1T3O A;  2PII A;  4JI5 J;  1XMQ J;  2DGW A;  2WBM A;  1HR0 J;  4WWS A;  2VG6 B;  4JI1 F;  4FZV A;  3DLE A;  2OIH A;  3HSG A;  3BGO P;  1N48 A;  4LF8 F;  4MH8 A;  3ZTR A;  1F9F A;  5A8W A;  4PG5 A;  4LUB A;  1YTY A;  2M7S A;  3G6E S;  1H7X A;  5KT2 A;  2WVF A;  5A0Y B;  3JAM Y;  2GAH C;  4UT4 A;  1Z1Z A;  4KHP J;  2B9W A;  3TUP A;  1APS A;  1RHR B;  2DIS A;  2QRR A;  3X3U A;  1QVF R;  2AJ0 A;  1RSC A;  1J2V A;  1RTZ A;  2BJD A;  3N6M A;  3PFE A;  2GNK A;  1GXT A;  2L08 A;  1RHQ B;  3KK3 B;  3K5O A;  4DR1 J;  5ETV A;  3NGD A;  4E98 A;  5KFS A;  3I0S B;  3QID A;  4BC9 A;  3CNQ P;  4ECZ A;  3PAC A;  3DI6 B;  3PG9 A;  3TQ1 A;  4X64 J;  2MLX A;  3LGH A;  1WKL A;  3BR9 A;  3NBP A;  1R7I A;  2CJQ A;  1RHU B;  1LWF A;  2DGX A;  1P8G A;  5BYR A;  3K8V A;  2PI4 A;  4P72 A;  3U02 A;  3AXM A;  3I0R A;  1KVK A;  3IN5 A;  2Z30 B;  3QT7 A;  2KT5 A;  2RUG A;  1LQ9 A;  5I3Q A;  4TYA A;  1NKE A;  3J7Y U;  2WOM A;  2H5J B;  4E0D A;  3CJ5 A;  3ET6 A;  1SCJ B;  2XMV A;  2JRS A;  3K5P A;  1NHK L;  2GGP B;  4ZK7 M;  2W7A A;  3CCT A;  2QYG A;  4DI6 A;  1PCA A;  3F44 A;  3BSC A;  4CO0 A;  5M2P A;  5CYM B;  2B51 A;  3LPY A;  2CRL A;  3UFC X;  1CEZ A;  1YJW S;  2B0G A;  1VK8 A;  1GK8 A;  3D66 A;  5F3T A;  2JFD A;  2ZH3 A;  1F3F A;  2YQ3 A;  4IUF A;  4LQ9 A;  2DK2 A;  1UP1 A;  4AT1 B;  4ZJO A;  1BLU A;  1Z2Z A;  3ZC4 A;  4NYZ A;  2FYX A;  3D0I E;  4QIV A;  4QCL A;  4ATN A;  4ECW A;  2FGO A;  4PXE A;  5HQM A;  2JLF A;  5LMN F;  4RW8 B;  2CQI A;  1FTC A;  5I3U B;  3A13 A;  1EET B;  3GCW P;  4ZVE A;  1W2I A;  1JWW A;  1UCN A;  2V8P A;  1Y0H A;  4BBY A;  2OPR A;  3CXC R;  1WC1 A;  1TL4 A;  3NNC A;  5SUH A;  1XQI A;  4NYP A;  1I51 B;  1PAU B;  1Q0N A;  1RAE B;  2DJW A;  1FWL A;  3VZH A;  3KHG A;  2F8H A;  2GJF A;  3TAP A;  4YB1 P;  3BBC A;  1NK0 A;  3PW2 A;  3T19 A;  4RNM A;  4DJB A;  2LVW A;  5DDP C;  3QIP B;  2RH3 A;  3VQS A;  2R9L A;  2GCF A;  4NEZ A;  2LQB A;  2CQ4 A;  1ACM B;  1H2T Z;  1C0U A;  4LFA F;  1M5O C;  3QQC D;  1RT4 B;  2WCX A;  3HFK A;  5HSP A;  2B43 A;  1T7P A;  2YQ0 A;  3LGN A;  3C46 A;  3DRY A;  2V67 A;  5DG8 A;  3W5Y A;  2VV5 A;  2L48 A;  1OQ3 A;  1RTH B;  3I55 S;  4PWD A;  3Q8R B;  2ZD1 A;  1U48 A;  3B82 A;  3ZZ0 A;  2VPZ B;  4ECT A;  4U67 Q;  1L3V A;  4Q2L A;  2DNL A;  5FDL A;  2PEH A;  4KBI A;  4LRE A;  5B08 A;  5J1N A;  1Q8L A;  1EHW A;  5J2M A;  4QR2 A;  1O5J A;  2AYE A;  1RWM B;  3R7B B;  2L9N A;  2FTR A;  1DQ8 A;  1HD0 A;  1E6Y A;  1M5V C;  2MHN A;  2DNR A;  4ZCI A;  4USI A;  4BCA A;  3IWX A;  2WVD A;  2R7T A;  2GVD A;  2IM3 A;  4CYU A;  4CLW A;  1FD2 A;  4G6V B;  2A2C A;  2EFG A;  4ZPW R;  1S1U B;  1VCT A;  2J9E A;  2HNY A;  3DLL Q;  5LXY A;  1HNX J;  4DFJ A;  2UXD J;  4DV6 J;  4EYH B;  1WUU A;  3PW5 A;  2FVP A;  2KT2 A;  1FE0 A;  1ZA2 B;  3W60 A;  3AOA A;  3TAR A;  4ZIW A;  4RBT A;  4ZPD A;  2B5J B;  1UWB A;  1J5O B;  4CLK A;  2HSE B;  4ANE A;  3QPI A;  2LEC A;  4B02 A;  5KFA A;  1R3N A;  2JEI A;  1NKB A;  5AJ3 F;  3E51 A;  2HUR A;  1PBU A;  2NSB A;  1RWN B;  4P52 A;  2E5L J;  1K1S A;  3FRY A;  1UJ6 A;  1FRM A;  2RB7 A;  1SIZ A;  3MM7 B;  1UFW A;  3ILL A;  2M88 A;  3D4J A;  4AND A;  2XSF A;  2QV6 A;  4W98 A;  4HVZ A;  1R89 A;  3CUL A;  2UXC J;  3MD1 A;  3FC9 A;  3PEJ A;  3D6M B;  2VA2 A;  2BV3 A;  4NXM J;  5H9F J;  3RBD A;  2DRB A;  3ZTP A;  5DZ7 A;  3SIP B;  1X31 C;  2YVS A;  3PV8 A;  4O44 A;  1GMW D;  3D1Q A;  3HVT A;  1RWV B;  3SQO P;  4FYV B;  4M5I A;  5A8R B;  4Q45 A;  2DHX A;  2AJ1 A;  3CJQ A;  4QWC A;  4LJM A;  3DGV A;  2B9E A;  1HAR A;  3DHW C;  3D28 A;  2I1R A;  4Y00 A;  1KHV A;  3M8P B;  5GME A;  3IRX B;  4FVM A;  4DQI A;  4O3Q A;  3EDQ B;  4UQG A;  4Q5V A;  1UW4 A;  4C8O A;  2BX6 A;  3BGU A;  3K89 A;  2YKA A;  1K44 A;  1KWM A;  1HHT P;  4TQS A;  3CED A;  2ZKU A;  2C3Y A;  2Y0B B;  3K8W A;  4TLQ A;  3CDW A;  4RNN A;  1LFP A;  3IBC B;  1I94 F;  3BQ2 A;  2ASJ A;  5J1P A;  3VCD A;  1JXL A;  3HSZ A;  3MMB B;  4XK8 C;  2LQJ A;  2PDA A;  2IBK A;  1S57 A;  2BE2 A;  3BSA A;  1SBR A;  4DPO A;  2H48 B;  1JKH B;  4USM A;  5DDR C;  4PAB A;  3NKY A;  1IKX A;  2Z4P A;  4RW4 B;  2X3G A;  2R8K A;  4CTA B;  2IAJ B;  5IS2 A;  5IM0 B;  1TV6 A;  2LFV A;  3DYA A;  1XWL A;  2LQ9 A;  1RKJ A;  1JK9 B;  1Q4R A;  4B9L A;  1XIQ A;  2CUY A;  4Y2M A;  1YRX A;  4ZPT R;  2XM3 A;  1ZAX A;  2YKO A;  3KNA A;  4P71 A;  4U7U D;  2HFZ A;  2RS2 A;  1J27 A;  2GC8 A;  5CD4 A;  5IWA F;  2HW3 A;  5DG9 A;  2F8E X;  2O01 C;  1KRP A;  3BO2 A;  2XHW A;  2WON B;  1S10 A;  3UN2 A;  2CPZ A;  3A8K A;  1R8P A;  3V4M A;  5L1L A;  2GO8 A;  4DCJ B;  4K2X A;  1CLF A;  3JTO A;  5A6P A;  4CLP A;  4C3M A;  3OJS A;  4NCB A;  2G13 A;  2ZHB A;  3TR5 A;  3HSJ A;  2AYM A;  1VHI A;  4L72 B;  4P6Q A;  1TAQ A;  4XPE A;  4K4V A;  2YX1 A;  2MZT A;  4LT6 A;  3NNA A;  2MLY A;  4F8R A;  1KFS A;  2ATL A;  2RS8 A;  1C1B A;  3CCM S;  1WSR A;  3CGI A;  2Q1L A;  2CPE A;  1RI7 A;  3M1V A;  1V3S A;  2WSE C;  4F4Y A;  3IWL A;  3LAN A;  4ILR A;  3MCS A;  1VGY A;  2ZH9 A;  2JVR A;  2YPZ A;  5HP1 A;  2X1A A;  3W63 A;  5IT0 A;  4I2P B;  3LAM A;  1WI8 A;  1L3T A;  2RRB A;  4Z37 A;  3KFW X;  1KLM B;  2V8H A;  4DN9 A;  1ZYQ A;  1HIY A;  2B56 A;  1HWU A;  1GAO A;  4IOC Q;  2YNF A;  3OPK A;  1VQ9 S;  5F8J A;  2G2Y A;  5K14 A;  3CCJ S;  1D8Y A;  5DO2 A;  4KH0 B;  4NZ6 A;  5A8K A;  2E1M C;  3ELH A;  3LAL A;  4OHX A;  5HJY A;  4X4S A;  3J81 Y;  4IO1 A;  4MK9 A;  1OY8 A;  3GG0 A;  4IR1 A;  4KIA A;  1S49 A;  2W8K A;  1N6Q A;  4W92 B;  1V9O A;  2BOP A;  4J9R A;  4UUW A;  1HNZ F;  4QPT A;  3WC2 A;  1TUV A;  5IC4 B;  2AX1 A;  1EX8 A;  2DH9 A;  1ZH5 A;  2DD8 S;  4DQS A;  5IXU A;  2XSJ B;  1U0H B;  3H40 A;  3UPF A;  3CC4 S;  3FUY A;  4F0K A;  1XEZ A;  1Y00 A;  1Q8B A;  2AW0 A;  2HFS A;  2N7Y A;  2YWG A;  4CH1 A;  4IG0 B;  1CVJ A;  1OO0 B;  1U6B A;  3FBE A;  1QSL A;  2IIH A;  3BR8 A;  3MM5 B;  4A46 A;  4PQU B;  2DGT A;  2UU9 F;  4KV8 A;  4EFA C;  2Y1L B;  1YJU A;  2K7J A;  1X4A A;  4DWI A;  3GJS B;  3V81 A;  2KFN A;  2R7O A;  2FGC A;  1R0A A;  3IP0 A;  3G6Y A;  2WVB A;  3W2V B;  5LMU F;  3BYP A;  3WIV A;  4DV0 J;  1FX2 A;  3SDE A;  4RW7 B;  4XO0 A;  3M2R B;  2VBZ A;  2HRT A;  4HYK A;  1OIA A;  1OSD A;  4AL5 A;  2I8E A;  1NSP A;  1Q79 A;  4WFA Q;  4OL8 A;  5E3P A;  2Y1I A;  2IYG A;  2E1P A;  1X4D A;  1RTI A;  4ZCK A;  3GR1 A;  4A4J A;  4JI2 J;  2MDA A;  4LSL A;  2VKR A;  2OI2 A;  2W25 A;  2CPI A;  1FJC A;  5EX3 A;  1NU4 A;  1RLD A;  2IDE A;  1FDN A;  2EFV A;  3E01 B;  1CQM A;  1AUS L;  4KH1 B;  1OJ4 A;  1UAW A;  3DRS B;  1VRQ C;  3L4B C;  4OZN A;  3GQC A;  5BXI A;  2R8J A;  3GR0 A;  1GMV A;  3HKZ D;  9ATC B;  2APO A;  1X4G A;  1HQ2 A;  4QWA A;  1IKW A;  2J8A A;  5E33 A;  4JI7 F;  4XPC A;  1YIJ S;  2XS7 A;  3CWJ A;  2G2O A;  4TYB A;  3EXY A;  3RRK A;  4Y2A A;  3K7R A;  3MOJ B;  2UZA A;  1CJU A;  4DL5 A;  1VQ4 S;  2ZDO A;  4IG3 A;  1IBM J;  3UQS A;  2CAD A;  3DN9 A;  3EPI A;  5F0W A;  5KFK A;  1GMU A;  3N79 A;  2UUB F;  1RU2 A;  3I4H X;  4P2M A;  1PYT A;  1S6U A;  4CNY A;  4KSE B;  3SSR A;  2NZ4 A;  3PXG a;  3CCS S;  4O23 A;  2CPJ A;  1JLQ A;  1YLX A;  2AHO B;  2GIQ A;  4V19 X;  1QM9 A;  5DG7 A;  2BDP A;  1DQ9 A;  5K20 B;  2EVZ A;  4U7U K;  1VC6 A;  3MED B;  1ITP A;  4L73 A;  4U8Y A;  3KLV A;  4ITS A;  1GQE A;  2R2R A;  4LR7 A;  3ILO A;  1SV5 A;  1RLC L;  1XNQ J;  2QMX A;  3MEC A;  4OI1 A;  3HJV A;  2NLW A;  1YJ7 A;  4AXI A;  3V5R A;  1RT7 B;  2D9P A;  1L3U A;  2QC3 A;  3BBF A;  1CJK B;  4V19 J;  2HFO A;  3IG1 B;  4ZP9 A;  2KU7 A;  2BAN A;  2OSQ A;  1WKK A;  2P6S A;  3CJS A;  2CPD A;  3CD5 A;  1SXL A;  4BS2 A;  3MR6 A;  5L38 A;  3ILJ A;  1FFW B;  4OYX A;  4Y6I A;  1IQZ A;  2H65 B;  2KRB A;  1ZOT A;  3A4T A;  2ZE2 B;  3ZXW A;  1LWC B;  4O4G B;  1S6P B;  3HD2 A;  1F3V A;  4TQR A;  2X1F A;  3DXB A;  4F36 A;  5ETS A;  1SKU B;  5F9N A;  2Y0S D;  2B4U A;  1ZS6 A;  3FCV A;  2W2O P;  2MKC A;  2RML A;  4F67 A;  1HBO B;  3LTO A;  5E5N A;  1TL3 B;  4KO0 A;  3BBB A;  2VJU A;  2KH9 A;  4ALZ A;  3HSD A;  1FES A;  2J7W A;  4WFN Q;  3PO5 A;  2PA3 A;  1QUP A;  2XYG B;  2Z2M A;  1RZM A;  5ADZ A;  4K0K F;  2JC0 A;  1S1X A;  2M70 A;  3M05 A;  1S48 A;  3BO3 A;  4NLV A;  3QAT A;  2OH2 A;  4AL7 A;  2XZD B;  3KK1 A;  3DDN A;  3VAG A;  2BW7 A;  1SL2 A;  4M5K A;  1N5V A;  3BH7 B;  1F9H A;  2CQ2 A;  3K5M A;  2HGM A;  4H4O B;  2IC3 B;  3EGN A;  1F2G A;  5E7O B;  5E0O A;  2LEP A;  4OMF G;  4MFB A;  2DNH A;  4C2M A;  1RUS A;  4ECY A;  3OTO F;  4EYI B;  2DIU A;  1URN A;  3OSN A;  1SJ3 P;  1P6T A;  4DV7 J;  4OYO A;  3R7S B;  3UVJ B;  4R5P B;  4H4M A;  1RCO B;  3R1H A;  1X8D A;  2RE1 A;  4OZ3 A;  2NRE A;  1WOR A;  3D2W A;  1U24 A;  2MKS A;  3QT5 A;  2R2U A;  2OLW A;  3QAE A;  2DO0 A;  3QGG A;  3N0V A;  2F4F A;  4GVB B;  1TKT A;  2MSS A;  3KMS A;  2XUL A;  3MEK A;  1FWK A;  3P4U B;  1HQE B;  4QJV A;  5T7L A;  1VMB A;  3CSK A;  3QRP A;  3MTJ A;  4LF5 J;  2WW8 A;  3HHL A;  3MR7 A;  3NCP A;  3ZO7 A;  1AFJ A;  4JI5 F;  2KXH A;  2VG6 A;  4DPU A;  5KOW A;  3G87 A;  5B0D A;  1HR0 F;  1IKV A;  4J91 A;  4RNF A;  1TAU A;  4Y2I A;  2IMO A;  3L95 X;  1V6H A;  3N5B A;  1NAQ A;  1S76 D;  3CJ8 A;  3HP6 A;  3W2W B;  3UN5 A;  4CLY A;  1U1M A;  1X9M A;  3N5F A;  1S9G B;  1NK5 A;  1OYD A;  2HIY A;  5A0Y A;  5KFR A;  3BPS P;  5F8M A;  1Q8K A;  2JOQ A;  3Q83 A;  1LNQ A;  2ZBQ A;  4KHP F;  2MKJ A;  2V5H G;  1MNE A;  2AKW B;  3TA2 A;  4MKA A;  4HLB A;  2Q6B A;  3I9V 9;  2ZC4 A;  2KZZ A;  2V2K A;  3T3F A;  3DRR B;  4KPC A;  4NLS A;  2GQQ A;  3KLE B;  4UF4 A;  1U1O A;  3Q86 A;  4RW9 B;  1VBX A;  2EFQ A;  2JNJ A;  3KK3 A;  2CDQ A;  4OJ1 A;  5C2G A;  3I0S A;  4DR1 F;  1LK7 A;  3DI6 A;  3DOM B;  2HNZ B;  4ZVG A;  1X9S A;  2FLL A;  2N3L A;  2MJU A;  4KGX B;  3NXZ A;  4NLP A;  3AD9 C;  1OPZ A;  3IBW A;  1NJZ A;  2G2Z A;  2Z56 B;  3T5J A;  1VI7 A;  2C42 A;  4NLO A;  4I68 A;  4IO9 Q;  3MI7 X;  4WFB Q;  2HAF A;  2LMI A;  5F8L A;  4RW6 B;  2A0F B;  4PWU A;  1IR0 A;  1JLC B;  4DBQ A;  2PGC A;  4J9O A;  2GGP A;  4X4U A;  1RTJ B;  3LOU A;  3KLF B;  1QTN B;  3TA1 A;  4N8N A;  2WBR A;  3RRG A;  4C8K A;  5CYM A;  4QYZ K;  1RAC B;  1MN9 A;  3BS9 A;  4L6V 3;  1WF1 A;  3TJA A;  2NXE A;  3MGJ A;  4NML A;  3E2E A;  4C11 B;  1OY9 A;  2CWK A;  4HAC B;  4O4R A;  4KAI A;  4J7C A;  3JTP A;  1FEH A;  5DGA A;  2CZ4 A;  2ASY A;  3POT B;  2MQL A;  3JS9 A;  3QGH A;  5JJB A;  4ZPC A;  4U96 A;  2HVD A;  3LPE A;  4NA3 A;  5IT4 A;  2OTJ S;  1FXL A;  2LXF A;  4MKY A;  2DVI A;  2M8H A;  3G8T A;  1S7I A;  2J0X A;  3GV5 B;  1N33 J;  3VTI A;  1TP7 A;  5I3U A;  1DAR A;  2J0S D;  1TUW A;  1EET A;  1IM4 A;  3JSY A;  2ZIT A;  3PJW A;  3NGU A;  2H9Z A;  3HDS A;  1P1L A;  4HI1 A;  2XY7 A;  3LQV A;  2PE8 A;  2OUG A;  3GLJ A;  3FRZ A;  3MPY A;  3MMA B;  4GKJ J;  2WVC A;  1VC0 A;  3MCO A;  4OLP A;  1JLE B;  1H98 A;  4DG1 B;  2JVO A;  4DSI A;  2LCW A;  1WG1 A;  3QIP A;  4KR0 B;  5K8M A;  1YDL A;  3HHD A;  4D3G A;  2N7C A;  4JI0 J;  2W01 A;  3AJ2 A;  4PYD A;  2GHP A;  3A3P B;  3AD7 C;  4NLY A;  3C6U B;  5C25 B;  1RT4 A;  4RBU A;  3FEY B;  5C24 B;  3RRH A;  1TMJ A;  4QIW D;  3R97 A;  2C3O A;  2RJZ A;  2HBZ B;  2ATC B;  4ECQ A;  4FKY A;  1PYO B;  1JLF B;  3M2V B;  4KGM A;  3H7H B;  3GFY A;  5CXT A;  1JNZ B;  2IRU A;  3F41 A;  3W3S A;  4F2S A;  1K73 T;  1RTH A;  2JDJ A;  4PCQ A;  3R7N B;  2EW9 A;  3J7Z T;  4A8Q A;  2DRD A;  1IBL F;  2OD4 A;  5KG3 A;  4F02 A;  2WW4 A;  1JXE A;  3MEG A;  4PAA A;  1YKW A;  2ABY A;  4R0J A;  3MUM P;  1T94 A;  1HPZ A;  4FF3 A;  1DTT B;  4QIE A;  4B3S J;  1BE4 A;  1MML A;  1NDC A;  4NCA A;  1B0V A;  1HI1 A;  2M5Y A;  2GVZ B;  4KFB B;  1FWP A;  1ZZF A;  1WTF A;  3RZA A;  1RWU A;  3NY0 A;  1Q81 T;  4M5D B;  1WHX A;  2NXC A;  4P75 A;  5L9N A;  4N7T A;  1QUV A;  5DGB A;  3ICL A;  2BQR A;  1OMS A;  4CM2 A;  2KYZ A;  1IUJ A;  1S1U A;  4F4W A;  3RAX A;  2IJR A;  3C66 A;  1RA7 A;  1SC1 B;  3PW4 A;  2GAG C;  1T0T V;  1WF0 A;  3GMG A;  3GFH A;  4RWX A;  2UXD F;  4DV6 F;  2OFG X;  4ECR A;  1VHF A;  3WQP A;  2QLB B;  1WSV A;  2B5J A;  2MJN A;  1J5O A;  3GB0 A;  4C9D A;  4C0H A;  1EJ7 L;  1SJQ A;  5KFZ A;  2JLG A;  3K57 A;  2E9T A;  3WX8 A;  4BC7 A;  4NZ7 A;  2LA4 A;  2RDI A;  1ARO P;  2RQM A;  2DEI A;  2CZ9 A;  4KHR A;  4OFZ A;  4U6P A;  2E5L F;  2FJW A;  5D15 A;  1H73 A;  3OW2 R;  1DQA A;  3H59 A;  4MKB A;  1NJY A;  4LBH A;  2V34 A;  3MD3 A;  1NB2 A;  4KHM A;  2MEW A;  3GP9 A;  1W2B R;  3CJ3 A;  2HEK A;  5M2U A;  5G0R A;  1QE1 B;  5HVG A;  3VF0 B;  5KFX A;  1EP4 B;  2OP5 A;  4PG4 A;  2UVU A;  1PC5 A;  1FK9 B;  4LF9 J;  2W4C A;  2B4P A;  1SQE A;  2QGF B;  1JX4 A;  1MMN A;  3KXD A;  2VKZ G;  4K4X A;  3S6E A;  2XI2 A;  2QFJ A;  4U8V A;  1SQF A;  1RYR A;  3O44 A;  2UV8 G;  3R27 A;  3CVK A;  1FRL A;  4NMX A;  5J1E A;  4N47 A;  1S0O A;  1NEE A;  4KE5 A;  1K1Q A;  3D5M A;  2VA3 A;  2A2D A;  2YKQ A;  5D0H A;  4YR0 A;  2MZ1 A;  5FD1 A;  3EGZ A;  5A8R A;  2JHE A;  4A8S A;  5MAO A;  4JOU A;  1VQM S;  2XO6 A;  3JQJ A;  2EKN A;  1C2P A;  2WSC C;  3WBZ A;  2R7U A;  3MR3 A;  1LK5 A;  3IRX A;  4J9M A;  3C16 B;  1X60 A;  3OFH A;  4IQM A;  2ZBI A;  4CLL A;  2V2V A;  1HW8 A;  1WC5 A;  1RBL A;  1ZBT A;  4DX5 A;  3KOA A;  1RT2 B;  2VU5 A;  3HPO A;  1UVJ A;  3AD8 C;  4HT7 A;  4TN2 A;  5DS7 A;  4G1Q B;  4MIW A;  3AQP A;  2DIT A;  2CQC A;  2YKP A;  3GYG A;  5AXM A;  2VIH A;  3C6T B;  4LVO P;  1PIL A;  4ER8 A;  3CDE A;  1KBR A;  1RAD B;  4IYQ A;  3FMW A;  1TK5 A;  1FDD A;  4RW4 A;  5ETM A;  4CTA A;  2IAJ A;  2QO3 A;  4K2J A;  4U9R A;  5IM0 A;  3R5J B;  4G3I A;  1ZPV A;  5IFM A;  3IGV A;  3Q22 A;  4J9L A;  2RHQ B;  3L7U A;  4AQY F;  3PJX A;  2FJV A;  1QD1 A;  4LFB J;  2KL8 A;  3AY0 A;  2MY7 A;  2NCK L;  5L9X A;  1JJC B;  1WAC A;  2WON A;  2XCP A;  4DCO B;  2ZM6 J;  5KFU A;  4J9Q A;  1R8C A;  3ILI A;  4QR1 A;  2YX7 A;  4RBV A;  4UZB A;  1N8R T;  1WEL A;  3SCL E;  1U6F A;  2LQ5 A;  2IM2 A;  1FJE B;  3T41 A;  3FEZ A;  4ZN1 A;  2R7Q A;  3T5H A;  5D0E A;  1BQN B;  1JXV A;  1Q16 B;  4F3O A;  1DTQ A;  3Q8P B;  2IY5 B;  2GA7 A;  1DLO B;  5HJX A;  4EBD A;  2YKM B;  2OKQ A;  3M6X A;  4ZVP B;  4B9U A;  3BKF A;  4OJ3 A;  1VDH A;  1IQT A;  2HK2 A;  1XMB A;  3BSN A;  1X5S A;  3IGN A;  4QR0 A;  2CFX A;  3W5X A;  2B7C B;  2OMO A;  3MUR P;  3FMB A;  2O67 A;  2UVV A;  3H5S A;  2OEM A;  4BWM A;  4EUV A;  4WZQ A;  2J7U A;  5IQ6 A;  3MEE B;  1CJT A;  5B0C A;  4I2P A;  1BQX A;  3KLG B;  2B9X A;  3D6H B;  1KLM A;  1HBM B;  1XTZ A;  3MUT P;  2OJ3 A;  2LEB A;  2Q3P A;  3SZ2 A;  1FFS B;  3H4D A;  1DUR A;  1B0T A;  3H90 A;  4ELU A;  2R8I A;  4N5S A;  2IJF A;  2QN6 B;  5JVG Q;  3Q8U A;  4X4P A;  2F63 A;  3R2C J;  1WOP A;  2O1P A;  1CS4 B;  6FDR A;  5KT7 A;  3SCK E;  2QA4 G;  2X1G A;  1N34 F;  4EO8 A;  5F8N A;  5D4L A;  4UUX A;  4NYO A;  1PJ6 A;  5CHC B;  3KHR A;  1LOU A;  4EBE A;  3TI0 A;  1FDA A;  3L7O A;  5EUH A;  4DZD A;  3SCJ E;  4Q43 A;  4C7Q A;  3BDP A;  5DZ6 A;  5DM6 Q;  2Y1R I;  1TL7 B;  3RYL A;  1FKO B;  1MG7 A;  3BN4 A;  3FZB A;  1CJV B;  3CIM A;  1BD6 A;  2MZS A;  1T95 A;  3M8Y A;  4ZCL A;  3LO3 A;  4OZ0 A;  4WK3 A;  1FI4 A;  2ACY A;  2WSF C;  2XSJ A;  4HT5 A;  1U0H A;  4O0N A;  4W4M A;  4QU6 A;  3JQM A;  2UP1 A;  4YB5 A;  3S8S A;  1SKR A;  4WTY A;  5L1I A;  2C2O B;  3IM9 A;  3DXS X;  4TNO A;  3DOL B;  3MM5 A;  1LEO A;  2G0J A;  4PQU A;  3S7R A;  3ENW A;  4JI4 F;  1T9Y A;  4DR6 J;  4F4A A;  4CLS A;  2KM8 C;  5IT9 Y;  3QWP A;  4M5G A;  4DUT A;  5I42 B;  4ILL A;  5E2Q A;  3K0J A;  3TO8 A;  3KJV B;  4JI8 J;  4DV0 F;  4RW7 A;  3I32 A;  3RR8 A;  1KON A;  2DPI A;  3M2R A;  3T9N A;  2BW2 A;  4JI6 F;  4ZVF A;  2DO4 A;  1WG5 A;  1VBY A;  3N9U C;  4FBU A;  3RB4 A;  2W7P A;  3FSX A;  3R5D A;  4V1A k;  4I1T A;  2BRL A;  1T9T A;  5K8P A;  1IWA A;  2L3M A;  2FY8 A;  2CG8 A;  2P2C B;  4DR4 F;  1NSA A;  3PM9 A;  3O3L A;  1SJR A;  3AQO A;  4B17 A;  3SFG A;  3OVB A;  3E01 A;  4OZ1 A;  4NLW A;  2HQG A;  4OV1 A;  3DRS A;  3PO4 A;  3IRW P;  3DRX A;  1X7V A;  3R2D J;  1KFD A;  1SJF A;  2GJI A;  4B3T F;  2R8H A;  3G96 A;  4M95 A;  1RWW B;  2AYB A;  3MAA B;  4WU3 A;  1UVN A;  1QY7 A;  2ASL A;  2CQ0 A;  1MWY A;  3FFI B;  5DJB A;  1TZ0 A;  3UNY A;  1VIS A;  5E3C A;  3E3X A;  2D41 A;  1U49 A;  3OBI A;  2YNG B;  4X66 J;  3Q89 A;  4ZVR B;  1N5Q A;  2GW8 A;  4HDH A;  4DV4 J;  1IBM F;  3DHX A;  1O0P A;  1HL6 A;  2KJW A;  3R5B A;  3EMT A;  2DXD A;  1RGV A;  3CJ0 A;  1S77 D;  4JV5 J;  3BM7 A;  1I6J A;  1NDP A;  2F7V A;  4HHH A;  2VZ9 A;  4DR5 F;  4DSJ A;  4UST A;  1YI2 S;  3PW0 A;  4NLQ A;  4ZPA A;  2XI3 A;  2GO9 A;  2J0W A;  2KM8 B;  2DGO A;  1U2R A;  1A9N B;  1TR0 A;  2HFV A;  2C2N A;  5I3P A;  2GV1 A;  3MED A;  1PAE X;  1PJ5 A;  3DLK B;  4FBT A;  1HMV B;  2PD1 A;  3OUY B;  4G65 A;  3HX9 A;  3T1Y J;  3CCL S;  1XNQ F;  3B4M A;  2KO1 A;  3ZZO A;  3OTC A;  2ZNY A;  5ETL A;  1RT7 A;  1HQU B;  2P9E A;  5EGY A;  3IG1 A;  1WOO A;  3UCG A;  5AT1 B;  4F26 A;  3M8R A;  2AEF A;  1OS5 A;  2VDH A;  2XWY A;  1K0T A;  1GTH A;  3EVM A;  2EWH A;  1SJ1 A;  1SC4 B;  5HK4 A;  5GAE I;  2CNO B;  2J6S A;  5BJR A;  4ED7 A;  4G1I A;  4RUC A;  2H51 B;  3HD1 A;  1FJ7 A;  4FVC A;  2XYP B;  3H5X A;  3IM8 A;  1LWC A;  2BUN A;  4O4G A;  1S6P A;  5T14 A;  4OJG A;  3D54 A;  4RU2 A;  2MKI A;  4L3N A;  2KHD A;  5B0G A;  1U1P A;  4CO4 A;  4HR2 A;  2HMI B;  4LSN B;  2N3O A;  1HBO A;  2QL5 B;  1FNM A;  3QFH A;  1CPZ A;  1FD8 A;  3W66 A;  2NUU G;  4IFV B;  3MMJ A;  2PMW A;  5AXK A;  1HWL A;  4ZPV R;  1SQG A;  3EE3 A;  2EC0 A;  3HFZ B;  3DFE A;  3CPW R;  1HNW J;  3CCU S;  3GZ7 A;  2OTL S;  2LEA A;  5AXN A;  2PFD A;  5H9F K;  2XB2 D;  4PRF A;  4B9S A;  1NK9 A;  1U2F A;  4ES3 A;  2VIC A;  2JC1 A;  4L74 A;  2RIL A;  2DNY A;  3MOZ A;  2VG5 B;  3ISN C;  1TU0 B;  4DV1 J;  1HNV B;  4ED0 A;  1EIY B;  3OXF A;  4H4O A;  1GXL A;  2BBE A;  2DB1 A;  4XIU A;  5ETN A;  2IC3 A;  1QAY A;  2IVY A;  3ENA A;  4UOH A;  3GWC A;  3M8Q B;  4X4O A;  2OD6 A;  4DF4 A;  4WKY A;  4P10 A;  2XGQ A;  1RAH B;  1D09 B;  3FK4 A;  3I87 A;  2YX4 A;  3W62 A;  3LP0 B;  5K8N A;  3UVJ A;  2AIR B;  3V6H A;  4DFK A;  4DV7 F;  5KG0 A;  3NG8 A;  3Q8Q B;  2O3D A;  5HL7 Q;  4JI1 J;  3BGL A;  4URQ U;  1XR6 A;  1NHU A;  1VQS A;  3W65 A;  2GHW A;  2DTJ A;  2W9C B;  5ETP A;  4GVB A;  3RBX A;  2QSF A;  1KHW A;  1YVF A;  2C2Z B;  3NS7 B;  1XNR J;  4F0M A;  1HQE A;  5J2P B;  1N56 A;  2ZJQ Q;  2FD2 A;  2HRY A;  1U8W A;  2VAS A;  2ADC A;  2AGO A;  3TW0 A;  4ZLN A;  5IZH A;  1XBW A;  3WHI A;  1NDK A;  3VGV A;  4HTJ A;  4HDG A;  2EK6 A;  2V4J B;  4IOB A;  4F4K A;  3W2W A;  1JMT A;  3W61 A;  4ZOS A;  4KTQ A;  4B9N A;  2CDR B;  1S9G A;  4O0I A;  5F8H A;  2NZC A;  3UDC A;  1HNI B;  2EK1 A;  1RAJ A;  1UA1 A;  3M9N B;  4P74 A;  1RJJ A;  2K7K A;  4EGL A;  1Q8I A;  2Q79 A;  3DRR A;  4HH1 A;  4MYU A;  4KPY A;  4DQP A;  3KLE A;  3W8P A;  2EC2 A;  3C15 B;  3CW2 C;  4RW9 A;  3T5K A;  2YQ1 A;  1HI0 P;  4B3O B;  4Z7C A;  2V2Q A;  3JSM B;  4CDI A;  2HQ3 A;  3QGI A;  1WG4 A;  2WZ1 A;  3TZZ A;  3LW5 C;  2HWH A;  3DOM A;  2HNZ A;  3EDR B;  3QYY A;  3NGT A;  2EFP A;  2LQ8 A;  4DR3 F;  5HAO A;  1Q5Y A;  2WAQ D;  3CB4 A;  2AJ2 A;  4ZLP A;  5HN0 A;  5H1S V;  2OFH X;  1NKC A;  2XNQ A;  2OEK A;  2ADB A;  1IWG A;  2HHP A;  3SQG A;  3CJK B;  3U7J A;  1XC9 A;  2XY5 A;  4S0M A;  3B8H A;  3B6B A;  4RW6 A;  4WE1 B;  4EO6 A;  4M1K A;  2AWZ A;  1JLC A;  1QLN A;  3RB0 A;  3O6Q A;  1RTJ A;  3KLF A;  1DHM A;  1GX5 A;  3HI9 A;  1ULR A;  1MU2 B;  3BGF A;  3TWZ A;  4CIO A;  2HHQ A;  2VPY B;  1M90 T;  1RHJ B;  1U26 A;  5EWG A;  3CDA A;  1WDD A;  4LBI A;  1GMW A;  1BWE A;  4C11 A;  2LU1 A;  2B4V A;  4HAC A;  3VVT A;  3W7B A;  4ELT A;  1U47 A;  4NXN J;  5B0E A;  2J6T A;  5AE2 A;  1H2U X;  1WC4 A;  3POT A;  3IO1 A;  2IMW P;  2CQG A;  2XBP A;  5F8I A;  1JLA B;  4CM0 A;  1IXK A;  2G1H A;  4WP3 A;  4AE5 A;  3SFU A;  5DQI A;  4A48 A;  1P9Y A;  4KKO B;  2A18 A;  2BR0 A;  4ICL B;  1EQ0 A;  2FUG 9;  4NI2 B;  2BE9 B;  1UPM B;  4LFA J;  2C2K B;  2CQB A;  1N5Y B;  3PTW A;  4YY3 F;  3MMA A;  4USU A;  1JLE A;  2ZH8 A;  3W9I A;  4DG1 A;  4GKJ F;  3FKB A;  2HHU A;  1ZTT A;  3I6P A;  5D8H B;  4C3L A;  2AJ4 A;  2NXN A;  3OVA A;  5EWF A;  2R2T A;  1SVD A;  1GT8 A;  4QWB A;  1X4H A;  2J8S A;  4ZDN A;  3C6U A;  3FZ2 A;  2RAQ A;  1T03 B;  1ZTW A;  5CD4 H;  1B99 A;  3D68 A;  4CCH A;  5C24 A;  2GQC A;  2FLP A;  4N56 A;  3I31 A;  2YWK A;  5J2M B;  4X4Q A;  2KXF A;  2RD5 C;  4NE9 C;  2IRX A;  1JLF A;  3M2V A;  5CYJ A;  2M2B A;  3C8Y A;  3HLU A;  1RXO B;  2JEJ A;  4RR5 A;  2FJA B;  4KGV B;  4OYA A;  2UXB J;  2CIM A;  3J80 Y;  1T05 B;  1U1K A;  2HVZ A;  4NA1 A;  4KJI A;  2J9D E;  2FJE B;  3KG4 A;  3PHE A;  1MW7 A;  1HBN B;  2VD3 A;  3VAM A;  5EWE A;  1VLY A;  2D3Z A;  1FNO A;  3JAM U;  1PC4 A;  5HQL A;  2HG4 A;  1DTT A;  4FYW B;  4O3N A;  4AYB D;  1NSK L;  2KN4 A;  1GXU A;  5F3Z A;  3HVW A;  4CLZ A;  2GVZ A;  4RZR A;  4KFB A;  3TVK A;  2ZUA A;  5HO4 A;  2W7O A;  4FKX A;  3DKD A;  4M5D A;  1VQY A;  3DGP B;  2YH1 A;  2CVI A;  2D3O R;  5LL6 d;  5KT4 A;  1XN9 A;  3TJ9 A;  5HQ8 A;  2M52 A;  1S5Z A;  2KT3 A;  5AJ3 J;  3PIO Q;  1H72 C;  4KQZ A;  1U02 A;  4J9K A;  1KNZ A;  1SL0 A;  3BH6 B;  2LDY A;  2XEX A;  2VJV A;  4WFY A;  1O8B A;  5CAA A;  5KFJ A;  2V8G A;  3BN7 A;  1L3K A;  1SKW A;  2CWX A;  3I5A A;  5D0G A;  3WZ0 A;  2E9Z A;  2J76 E;  4ID5 B;  2KXN B;  3PX4 A;  4N41 A;  1LXJ A;  3TUJ C;  1WEX A;  5ITH A;  3M9M B;  2DR9 A;  4D3H A;  3GFX A;  1RHK B;  4DF8 A;  1NH8 A;  4XDD A;  3CCZ A;  3GCX P;  2COL A;  1JJH A;  2RU9 A;  1WD6 A;  3OL9 A;  1QE1 A;  1R0C B;  1QTM A;  1EP4 A;  3MM9 B;  3KYL A;  4FF4 A;  1FK9 A;  3OHB A;  1WWH A;  3HVT B;  2IJN A;  4XAK A;  3AOC A;  1S9E B;  1JLG B;  2CQ3 A;  4HHJ A;  3NOC A;  2B8P A;  1UFK A;  2ROG A;  5LT5 A;  2BA9 A;  4DS5 A;  3MMC B;  9RUB A;  4J9N A;  2CNL B;  3TZY A;  3H5U A;  1RWO B;  1MWZ A;  4ZVU B;  2CKW A;  3ZZP A;  1S6O A;  2FZK B;  2CZV C;  2I6W A;  2DR7 A;  1IKY B;  1YJR A;  5HAT A;  2DNN A;  1HLW A;  3HJF A;  1O6X A;  2K3I A;  2VBX A;  2JZ5 A;  2Z2Z A;  1ZM4 A;  5KFV A;  3H8Y A;  1MSW D;  3W64 A;  1E6V A;  2WK4 A;  4DUY F;  5SZT A;  3NWR A;  2OAU A;  3D6T B;  5FLX Y;  3D0H E;  4G1Q A;  2V8V A;  3DRP A;  1T9X A;  1NK4 A;  3C6T A;  1C0T B;  5IWA J;  3TEH B;  3X1L B;  1FDB A;  3QO9 B;  1LV5 A;  2U1A A;  1RT1 B;  2W9B B;  5CCM A;  1S9F A;  3LA0 A;  1H0H B;  1UZH A;  3QRQ A;  4ZLL A;  2D1C A;  4EI2 A;  1WHW A;  1N5S A;  2A6O A;  5I4M A;  1TL1 B;  4M5M A;  4DMZ A;  2VFS A;  1ICE B;  3SBM A;  2QEX S;  2VQE J;  2C28 A;  4W90 B;  2A6M A;  5EX0 A;  2LXI A;  1YHQ S;  4LFC J;  3THT A;  3OL6 A;  4UW2 A;  3H4B A;  1D9F A;  5KFB A;  3JTN A;  4DV3 J;  2VBW A;  2ZM6 F;  4YOE A;  3NEK A;  4X62 F;  2XNR A;  2E66 A;  2ZBR A;  3KWM A;  1VQ5 S;  2RIJ A;  3WIU A;  4B3R F;  1BQN A;  1MLA A;  3G4S S;  5HMY A;  4FXV A;  3A8J A;  1DLO A;  2QFI A;  2PC6 A;  2VOO A;  2YKM A;  2RVJ A;  2KJV A;  4BWJ A;  4LRC A;  3VVU A;  5B09 A;  3MFI A;  4M5N A;  2BVZ A;  2GMJ A;  5D0R A;  1TL5 A;  2D69 A;  2JL9 A;  1FRJ A;  2HKE A;  3CD6 S;  3OQ2 A;  2IDL A;  2J0Q D;  1FF2 A;  1FO1 A;  1R8H A;  4Z2X A;  4X84 A;  3MEE A;  1HW9 A;  2EFN A;  5HRO B;  2XS5 A;  1TKX B;  4FF1 A;  2UUC J;  1R8A A;  3FBC A;  4OX7 A;  3RBE A;  2F8M A;  2V9K A;  3KLG A;  1Y3K A;  2DNK A;  5HLF B;  1HBM A;  4NLR A;  3FSI A;  3EGV A;  4I6A A;  2E5I A;  3PZP A;  1A0O B;  3MAH A;  4YDD B;  2BJ9 A;  1AZS B;  4PKD B;  3TAN A;  3TP2 A;  3C19 A;  4CH0 S;  3OLB A;  3PYF A;  1KN6 A;  4P7V A;  2PEB A;  5D4O A;  4B3M J;  4LF1 A;  3OL8 A;  4FS2 A;  1U45 A;  2MKH A;  4K50 A;  2DEJ A;  2YXL A;  3DU6 A;  2ZH6 A;  1VQL S;  4Q0B B;  2DT9 A;  3DC2 A;  1TL7 A;  1FKO A;  2MGZ B;  2F4V J;  3KJF B;  1CJV A;  3M4X A;  2EKY A;  2Q66 A;  4R8U A;  4JV0 A;  2R7X A;  3N6L A;  1NXI A;  3GYN A;  3MAQ A;  2QE5 A;  4TY8 B;  2C2E A;  4OX9 F;  2GML A;  1XMO J;  2F40 A;  2EFO A;  2HZC A;  2J6U A;  2B9Y A;  2Z8Q A;  3DOL A;  2W2P P;  1K8A T;  2YWH A;  4FYD A;  1RAO A;  3BRE A;  3T1H J;  4OI2 A;  4DDF A;  1U25 A;  2ZHO A;  3OSP A;  4C8Y A;  5I42 A;  4N77 A;  4IR9 A;  1TFW A;  1RAG B;  2V9W A;  2CYY A;  3JSR A;  4ZJL A;  2B6A B;  2QIF A;  3KJV A;  4YFU A;  5A6W A;  2C2M B;  4Y65 A;  3ZNJ 1;  3BGR B;  4NOH A;  5D3G B;  3QWU A;  2D3U A;  1JQG A;  2V68 A;  2PI5 A;  3CC2 S;  4F25 A;  5H9E J;  2HYI B;  1KOO A;  1VBZ A;  4MTP A;  3ENV A;  1NPK A;  3P8B B;  1F5A A;  3D1O A;  3PRB A;  3M30 A;  4C8N A;  2WVE A;  4M94 A;  4QPX A;  3DM2 B;  1XK8 A;  2KFY A;  5KFO A;  1CQN A;  4CZC A;  1YSJ A;  1CC7 A;  1YZ7 A;  1IBK J;  4DR2 J;  4LF7 J;  1PBA A;  4ED5 A;  2HS4 A;  3G82 B;  1B7F A;  2QMU B;  2LDI A;  2IA0 A;  4X4V A;  1WEZ A;  4UY8 5;  3B4D A;  3MAA A;  1S79 A;  1REV B;  3PDN A;  2CQH A;  1SH2 A;  2EEY A;  3UD3 P;  1S6Q B;  5HI7 A;  3FFI A;  3EJM A;  2M0G B;  4GC6 A;  4LMZ A;  4M5L A;  2CQ1 A;  2VPX B;  1D1U A;  1KKH A;  2AP6 A;  2OEL A;  2ZUG A;  2H5I B;  3T1A A;  2YNG A;  2DGS A;  3HFV A;  4CP5 A;  4TY9 A;  1Y11 A;  3T6B A;  4X66 F;  2FZC B;  1LWE B;  1S12 A;  1LW2 B;  4OZL A;  2HZA A;  1FJG F;  2VOD A;  3GON A;  3CCR S;  4DV4 F;  5J2Q B;  3C14 B;  1OY6 A;  4DX8 H;  4JI3 J;  1BQM B;  1X5T A;  1SV5 B;  3CJR A;  3TX8 A;  2XO7 A;  1JIH A;  2FHJ D;  2ZWP A;  4E8U A;  3MEC B;  1KVJ A;  4C0B A;  2C22 A;  1SIW B;  4JV5 F;  1R6V A;  3FDS A;  4TKT A;  3RU0 A;  2ZH5 A;  1RT6 B;  3KMQ A;  4LR8 A;  3DDI A;  3QJL A;  2OPS B;  1VJQ A;  4K4U A;  2BAN B;  2R7V A;  1EAY C;  4USJ C;  1YRU A;  1IJE B;  5B0F A;  2FLO A;  2QA2 A;  4DEZ A;  5KFH A;  2VUG A;  1KD1 T;  3DLK A;  1HMV A;  4MIA A;  5F9L A;  3OUY A;  3HM9 A;  1HI8 A;  4I4B A;  4IRC A;  1TK0 A;  3MPV A;  3NAH A;  3WX4 A;  2UVW A;  1FRH A;  3HHL C;  3T1Y F;  1HWK A;  3US5 A;  2ZC3 A;  2RUS A;  1HQU A;  3CIZ A;  3KLH B;  3P6Y C;  1N32 F;  4CWB A;  1VQ7 S;  8ATC B;  5IQQ A;  3J81 U;  1Q5V A;  3CMQ A;  3H0P A;  2ZBC A;  1WNE A;  4ZCM A;  2Z2Y B;  4WCE Q;  3DU5 A;  1NND A;  3NNH A;  1VRU B;  3OR2 B;  1UVI A;  1IBC B;  3O1L A;  3OLA A;  6FD1 A;  4H4K A;  3QSY B;  2EBG A;  3RR7 A;  3ZTS A;  1Y4Z B;  2ZZT A;  3BB5 A;  2VON A;  1S1W B;  2LU2 A;  2ZVS A;  1N0U A;  5LSL A;  1SUQ B;  4K7Q A;  4ECU A;  1YWX A;  2AF6 A;  1S7H A;  1S0M A;  2HMI A;  3CD0 A;  1NME B;  3N01 A;  4LF6 F;  4CO3 A;  4Q2M A;  4IFV A;  1WHY A;  3R3T A;  4I7F B;  4J9P A;  1RYS A;  5EHH A;  5F0U A;  2E5H A;  4NA2 A;  1HYS B;  1DRZ A;  3LUY A;  3VAJ A;  4A8W A;  3NS6 A;  1HBU B;  1YJ9 S;  1NK7 A;  3MPD A;  3OTO J;  1HNW F;  3EM1 A;  1W25 A;  3M32 A;  1G6B A;  2XMU A;  3G2X A;  4IOA Q;  2XWX A;  5LXR A;  4ZVH A;  2VG5 A;  4OI3 A;  1HNV A;  3OTE A;  4DV1 F;  4WFZ A;  2E7W A;  3H20 A;  2HS3 A;  1AW0 A;  2HVI A;  3MPU B;  2O66 A;  3M8Q A;  1UJ4 A;  4QWD A;  3G71 S;  2IVF B;  2U2F A;  1RWX B;  4OYI A;  3Q2S C;  5C7P A;  5GMK a;  4A8O A;  3MF5 A;  3LP0 A;  5T7L B;  1UL3 A;  4YN3 B;  1SC6 A;  1P27 B;  2EBE A;  1CG2 A;  1NBE B;  2G0C A;  3HHL B;  4P7T A;  2VFV A;  3UDL A;  2OPP B;  3FQL A;  4UOC A;  1WF2 A;  1IKV B;  4JUZ A;  2XYH B;  3BO4 A;  1K0V A;  4IH7 A;  1GEH A;  2W9C A;  2NYI A;  2HQD A;  2BKN A;  1TQL A;  5KFF A;  1SKS A;  1V3Z A;  2K1R B;  3NGK A;  5J2P A;  3KUG A;  1XNR F;  4ANC A;  1C1C B;  3W1Y C;  3P45 B;  1WC6 A;  2H5E A;  1R8B A;  1RWK B;  3K2Y A;  1U7L A;  1NJW A;  1Q86 T;  4HI2 A;  3EPG A;  1QAX A;  3FJ2 A;  4CO1 A;  4YQW A;  2XTJ P;  1FTR A;  3FSY A;  4FNI A;  2FHO B;  2VC1 A;  5L39 A;  2MQQ A;  1D0E A;  1RWP B;  2V4J A;  3P96 A;  2V63 A;  1KC8 T;  3CC7 S;  3H42 A;  1HHQ A;  2ZOG A;  4ECX A;  4RKU C;  3ITH B;  2V4R A;  1M1H A;  3BQ1 A;  2CJ9 A;  1HNI A;  3DLH A;  3MM8 B;  1SH0 A;  2MPU A;  3ZZR A;  1RE1 B;  3TEG A;  3MFH A;  4JV1 A;  4A8X A;  1ELO A;  1CUL B;  4EBC A;  4WYL A;  3C15 A;  2AU0 A;  3RB6 A;  2W24 A;  3ULH A;  1XJW B;  1VQP S;  4DLE A;  4B3O A;  1C4C A;  3JSM A;  4F3M A;  3AT1 B;  2MQ8 A;  3W9J A;  1Y7P A;  3ADA C;  4MAK A;  4OI0 A;  1D9A A;  4EZ9 A;  3MM6 B;  3UCZ P;  2K2P A;  4X65 F;  1FE4 A;  5L8R C;  2DY1 A;  4LIR A;  2O5D A;  1IVZ A;  4BHQ A;  3BPD A;  2AJF E;  4OX8 A;  5F8G A;  3NMA A;  1UVL A;  1LKZ A;  3IAS 9;  1YQH A;  3RW7 A;  4WYW A;  3QZ7 A;  5HAN A;  3BKT A;  3CJK A;  2HQF A;  3T6J A;  2PSZ A;  4Y3C A;  1WDT A;  2DR6 A;  2MQN A;  4WBF A;  4WE1 A;  3AJ1 A;  4ZVS B;  2QYC A;  5CYQ B;  4CQ1 A;  2E7X A;  1MU2 A;  1FRK A;  3ZZT A;  4NLG A;  3CO9 A;  2A1B A;  4RJV A;  3OL7 A;  2WB1 D;  2KDO A;  1KTV A;  1XMQ F;  3KK2 B;  2N82 B;  1R6Y A;  4PEO A;  4ED3 A;  2FVC A;  2GIR A;  3TQE A;  5B7W A;  2FPH X;  5DLG A;  1ZAV A;  3EVO A;  1KTQ A;  3OTB A;  4NXN F;  1JLA A;  4LRF A;  4TVA B;  3VGT A;  1G7C B;  4QQB A;  2LLZ A;  4DPW A;  2NPI A;  4LF2 A;  4KKO A;  1KQG B;  3VHQ A;  4ICL A;  2GHV C;  3K59 A;  3RW6 A;  4A47 A;  3PJ9 A;  4NI2 A;  1VS3 A;  3SYZ A;  5CCL A;  2XG8 A;  4RWW A;  2ZEJ A;  2RQC A;  2RNE A;  1YK9 A;  2DCL A;  2P8I A;  4DCP B;  4PXD A;  4FXD A;  1N5Y A;  3GG1 A;  1SI9 A;  2NPF A;  1F9E B;  3U27 A;  5RUB A;  1FEE A;  2FJB B;  4NZ0 A;  4J5O A;  3FBB A;  2I9S A;  4DQQ A;  4X2B A;  1CBK A;  1YG0 A;  3BSO A;  2XMW A;  1SC3 B;  1W7W A;  4DSF A;  2PFF B;  3CT9 A;  4X64 F;  4WF9 Q;  5EN1 A;  5E3A A;  4FXW A;  1IBL J;  3BF4 A;  3V4I B;  1T03 A;  1G1X A;  1JLB B;  3D67 A;  2HLT A;  3K5N A;  3IMQ J;  4ETZ A;  1TUG B;  4ZIV A;  1QDU B;  3HF5 A;  1MMD A;  3LP2 B;  4ZN3 A;  3S1T A;  3MEG B;  2KI2 A;  5M2R A;  2UUA J;  3PRV A;  3QZ8 A;  1HPZ B;  4K4W A;  3JB9 k;  2BJ7 A;  3FEX B;  4OJH A;  4F0H A;  2PN6 A;  3H2V E;  3BJY A;  4KRW A;  2WB4 A;  2MHE A;  5KT6 A;  2D7S A;  1YJT A;  2QSW A;  3SXL A;  1T05 A;  4ED6 A;  2UXB F;  2GJ2 A;  2W9A A;  2ZH7 A;  1V5V A;  2JJ4 D;  4ZVT B;  1U1Q A;  4OZ2 A;  2IM1 A;  1HBN A;  2V6A A;  5EDW A;  2ROE A;  2GS8 A;  3Q23 A;  2C3U A;  4AFF A;  1S1V B;  3BDE A;  3RAM A;  1B7Y B;  3GIR A;  3HCX A;  1N36 J;  2FQQ B;  2C3M A;  3QSI A;  3J7A N;  3ZFV A;  1P1T A;  3WDO A;  3GII A;  3H2U B;  3UD5 A;  1F1B B;  2CNK B;  3IBF B;  4BDP A;  2CJB A;  3DGP A;  1EB0 A;  4MJK A;  3M6U A;  4RW8 A;  2C2R A;  1SB6 A;  5KG7 A;  2V50 A;  4MYT A;  3VGU A;  3FCW A;  4NX9 A;  3ETO A;  3A3O B;  2AD9 A;  1UEV A;  2GFF A;  3U1N A;  2JEF A;  1H6K X;  3DLB A;  4USK A;  2N4D A;  1UZD A;  1LXN A;  5L46 A;  3VAL A;  5L1J A;  2H3E B;  4YUD A;  4A8K A;  4KT0 C;  4K4Y A;  1TMM A;  5KAK A;  4GVL A;  4NL5 A;  4YS2 A;  1BMQ B;  1X4E A;  3TOQ A;  4ES1 A;  2KVQ E;  5JMN A;  2JEG A;  1URR A;  2W2M P;  3N6N A;  1UMJ A;  1YBA A;  1KDN A;  5G0R B;  4ID5 A;  2JH3 A;  4OV6 A;  3VV2 B;  3NOG A;  4NWB A;  2GZO A;  1ZM2 A;  3KUE A;  1GH8 A;  3MR2 A;  4PPD A;  4FYY B;  4DSL A;  3QJP A;  1RHM B;  1IM6 A;  2OEJ A;  3PCO B;  1NPR A;  2Y3Y A;  3CJ4 A;  3MPW A;  4WU2 A;  2R8G A;  3PX0 A;  4CT8 A;  5J1E B;  1N52 B;  3M2U B;  3MDF A;  3MM9 A;  3A3N B;  3MTK A;  3IS9 B;  2PO4 A;  4LF4 J;  3ZNU A;  5CAB A;  1FFG B;  1HKA A;  2B3T B;  1AFI A;  2YNH B;  4AXJ A;  1KLN A;  1S9E A;  1JLG A;  3VGS A;  4OHW A;  4JYA J;  1RT3 B;  1LFW A;  2E1A A;  3MMC A;  4FP9 A;  3NRB A;  2RKI B;  3ZZY A;  3QLH B;  4F50 A;  4NCG B;  1RDR A;  4EWT A;  4IDK B;  4RO0 A;  2MZQ A;  1UTA A;  4IFY B;  1QVG R;  2E7V A;  4Q44 A;  3SI8 A;  4YP3 A;  2VHG A;  4A8Y A;  3UDV A;  2BYC A;  4LR9 A;  1X5O A;  1UW9 A;  2BKP A;  2P5V A;  1IKY A;  2D9O A;  4ECV A;  2DKO B;  1FKA F;  4DL6 A;  2XCA A;  2HAI A;  3UO0 A;  1F0X A;  2L41 A;  2XLK A;  2KRR A;  3VQT A;  2NXJ A;  4Q7A A;  4CO5 A;  1WTB A;  1UJ5 A;  3CE8 A;  1CSJ A;  1HNX F;  5DQG A;  2GMH A;  4P73 A;  4MK8 A;  1WHV A;  4OHY A;  3AAW B;  3ISN D;  2R7W A;  3N28 A;  4YR3 A;  4K4T A;  4AQY J;  4PQA A;  1ROF A;  2G0I A;  2ZJP Q;  3F73 A;  4K5R A;  1NJX A;  1TVR B;  2HRU A;  4DR7 J;  1ZAW A;  8RUC A;  4PG7 A;  2CPF A;  1C0T A;  4Y34 A;  4K4S A;  4NAS A;  4LSZ B;  3QO9 A;  3IR5 B;  1RT1 A;  4CT9 A;  2W9B A;  2HHH J;  2HND B;  3RUB L;  4RUA A;  3MM7 A;  3G9C A;  3ETM A;  1NH7 A;  5CA5 A;  4J90 A;  3MUV P;  2ZJR Q;  1TL1 A;  3D7S B;  2ALY B;  2ERR A;  3MCM A;  2UXC F;  1U09 A;  5JVH Q;  2XHC A;  5A76 A;  3MHY A;  3P5B P;  4C48 A;  2VQE F;  1DTQ B;  1XR7 A;  4UZC A;  5LOQ A;  1U1R A;  4NXM F;  2UUW A;  3DCA A;  6AT1 B;  4LFC F;  2B8Q A;  5BR8 J;  3DLG B;  2J9C A;  2J5A A;  4ENO A;  3EIC A;  2EI5 A;  4DV3 F;  3CUN A;  2HFN A;  2VDI A;  4OYB A;  3TYT A;  1UFL A;  4DSE A;  3C2P A;  2XZT B;  3RTV A;  2NQP A;  1SL1 A;  2BM0 A;  2VBY A;  1Q53 A;  1CJT B;  3OV7 A;  1V3R A;  3KTQ A;  3AA8 A;  4H54 A;  4DHV A;  3CCV S;  1GX6 A;  3LWL A;  4DPY A;  3M8P A;  2VH7 A;  1F5C A;  3EWG A;  2BAC A;  4J9U E;  2GIF A;  7AT1 B;  2ILY A;  2GX8 A;  2R3V A;  3BKU A;  3EZO A;  2BJ1 A;  4QIF A;  1N34 J;  1Q1K A;  5HRO A;  1TKX A;  5IV4 A;  3KJQ B;  2AJQ A;  3HXM A;  3QBC A;  2ZH2 A;  4XDC A;  2UUC F;  2OSR A;  1H7W A;  1N4L A;  1TEL A;  5HLF A;  2HVE A;  5B0B A;  2CA9 A;  3G8S A;  4GO5 X;  3MCN A;  2Q43 A;  2MY8 A;  2JLE A;  3PRD A;  3SCI E;  3PKM A;  3KUH A;  3NS5 A;  1M1K T;  4YHH J;  3TVZ A;  1Q78 A;  3MMB A;  3KNG A;  3L09 A;  1AZS A;  1FER A;  1JKH A;  4RL1 A;  1BY9 A;  1FNX H;  1YZ6 A;  5CZX A;  5KFM A;  1YBU A;  4R0E A;  5LSO A;  1M5P C;  2G9O A;  3UI3 A;  3GIK A;  4Y2K A;  3V6D B;  4TLR A;  1FRI A;  2LXU A;  4B3M F;  1WOS A;  2VFR A;  1VK3 A;  1EQM A;  4WII A;  3SV3 A;  3Q8Y A;  4ZP7 A;  4PWW A;  4Q0B A;  3OFF A;  2MGZ A;  1M1G A;  3CDU A;  5HMZ A;  4JI4 J;  2P9C A;  3IFE A;  2F4V F;  3V6K A;  2DPJ A;  3R5G A;  1HWI A;  3THP A;  2DHA A;  1JJ4 A;  4TY8 A;  2ZBP A;  1KVI A;  4EK2 A;  4M5H A;  4O3R A;  4FYX B;  2IRY A;  4JI6 J;  1XMO F;  3CTR A;  2H54 B;  1S4E A;  5KG6 A;  3OJU A;  2RF2 B;  3PYG A;  3I5B A;  3PHT A;  1WJ9 A;  5ETO A;  3OFE A;  3T1H F;  1R43 A;  1OYE A;  4B08 A;  4PYA A;  1VFJ A;  3I4P A;  2GQ2 A;  4L75 A;  4PXB A;  5T41 A;  2B6A A;  4DR4 J;  4Q8F A;  2QL7 B;  1I3O B;  2RQ4 A;  4EU0 A;  3H2L A;  4NLX A;  1TKD A;  3BGR A;  5J2N B;  2YBV A;  3GSD A;  5D3G A;  2AX0 A;  1P9Q C;  3OR1 B;  4B3T J;  5THW A;  1VIX A;  4X4T A;  2AMC B;  2FY1 A;  3KLI B;  4UOF A;  1LW0 B;  1RQ0 A;  2LA6 A;  1RA6 A;  4OYM A;  1VQ8 S;  4ZP6 A;  3GPA A;  3LAK A;  3DM2 A;  4ZP8 A;  4OI6 A;  2MST A;  3G8Q A;  3I9Z A;  1A6L A;  2KTQ A;  1RBO B;  1QSS A;  3G82 A;  4DR2 F;  1IBK F;  4LF7 F;  1JJ2 R;  4NPO A;  5B0A A;  4I6Y A;  1DZ5 A;  3VAI A;  3HHN B;  4CO2 A;  3LH2 S;  2V4Q A;  2OPQ B;  4AL6 A;  4K8R A;  1REV A;  1S6Q A;  4PPZ A;  3QNW B;  4DUZ J;  1BWV A;  2QLX A;  1OWX A; 
#chains in the Genus database with same CATH homology
 4DR5 J;  4GKK J;  1IBK J;  4DR2 J;  4DR4 J;  4X65 J;  1N32 J;  2UUC J;  4LF7 J;  2E5L J;  4LF4 J;  4DV4 J;  1IBL J;  1HNZ J;  4LFA J;  1XNQ J;  4X62 J;  1XMO J;  4DUY J;  3JAM U;  4KHP J;  5LMN J;  3IMQ J;  2VQE J;  4LF5 J;  4AQY J;  2MQ8 A;  4V1A k;  5A2Q U;  4B3R J;  4JYA J;  3OTO J;  4LF8 J;  3W1Y C;  4DR7 J;  3T1H J;  4JV5 J;  4B3T J;  2UUA J;  4LFC J;  4PWW A;  1FJG J;  1J5E J;  4DV5 J;  4NEZ A;  2UXC J;  4DV0 J;  4JI4 J;  4KYZ A;  1N33 J;  4DV3 J;  4JI1 J;  5LM7 E;  4DV2 J;  2MTL A;  4DR3 J;  3J81 U;  2HHH J;  1IBM J;  4KY3 A;  4NEY A;  4HHU A;  2KVQ E;  4NXM J;  4DR1 J;  4K0K J;  2UU9 J;  4LFB J;  1N34 J;  1HNX J;  2UXD J;  2KL8 A;  4NXN J;  4B3M J;  4DV6 J;  5AJ3 J;  3R2D J;  5FLX U;  4JI7 J;  1XNR J;  4JI5 J;  1HNW J;  1XMQ J;  4X64 J;  3D3C J;  4LF6 J;  4B3S J;  3T1Y J;  4DV7 J;  4JI6 J;  1HR0 J;  4OX9 J;  5LMU J;  4GKJ J;  4JI3 J;  4DR6 J;  3D3B J;  5IWA J;  4JI2 J;  1N36 J;  2ZM6 J;  3J7A N;  2F4V J;  2MEW A;  3R2C J;  4YHH J;  1I94 J;  5IT9 U;  2UXB J;  4YY3 J;  4JI0 J;  4DV1 J;  2VQF J;  4DUZ J;  2UUB J;  5BR8 J;  4X66 J;  4JI8 J;  4RJV A;  4LF9 J;  3J80 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...