4DR2J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr2J00
2F4VJ 4LFAJ 1HNZJ 5LM7E 4B3TJ 3IMQJ 5IWAJ 2UUAJ 4B3MJ 4NEZA 5BR8J 4HHUA 1HNWJ 1HNXJ 4JI6J 4DV7J 3R2DJ 5AJ3J 4JI7J 2KL8A 4YHHJ 1N33J 4NXNJ 1XMOJ 1FJGJ 4JI2J 3W1YC 4DV6J 5FLXU 3JAMU 4PWWA 4LFCJ 4B3RJ 4DUYJ 4LF8J 3T1HJ 4NEYA 4DV1J 4X65J 2UU9J 1IBMJ 4DR1J 1XMQJ 1IBKJ 1J5EJ 4JYAJ 4DV2J 2UUCJ 4KY3A 4B3SJ 2MTLA 4X66J 5LMNJ 5A2QU 5LMUJ 4JI5J 3OTOJ 4JI8J 4DR6J 2VQEJ 3J81U 4X62J 4JI4J 2UXDJ 3R2CJ 4DR3J 1XNQJ 3J80U 4DR7J 2UUBJ 4JV5J 2MEWA 4KYZA 3J7AN 2VQFJ 4DR4J 4LF7J 4DR5J 1N34J 4LF4J 4JI0J 4JI1J 2E5LJ 4DR2J 4K0KJ 4GKKJ 1N36J 2ZM6J 4V1Ak 4AQYJ 4LF6J 2KVQE 4RJVA 4LF9J 4OX9J 5IT9U 4DV0J 4KHPJ 2UXCJ 4LFBJ 2UXBJ 3D3BJ 3D3CJ 1IBLJ 4JI3J 4LF5J 2HHHJ 4YY3J 1HR0J 4GKJJ 3T1YJ 4DUZJ 2MQ8A 4X64J 4DV3J 4DV4J 4NXMJ 1N32J 1I94J 4DV5J 1XNRJ
chains in the Genus database with same CATH superfamily
4J9OA 4LFAJ 4LRBA 2D9PA 1H7WA 1F2GA 1HNXJ 2XNRA 1DQ8A 5HP1A 4IH6A 3IA0A 2LLZA 1XC9A 1FDBA 1XNQF 2HZCA 3J80Y 5MLCV 4URGA 3BZQA 5SZTA 1RAEB 3OHAA 4ANCA 1W2BR 1UP1A 1R0BG 2NXCA 2VKRA 7FD1A 3KMSA 4RR5A 1F60B 2N82B 4HKQA 1LWCA 2WSEC 1NK5A 5DGBA 4KY3A 4B3SJ 4NA2A 4CZCA 4Q43A 2Q43A 3J80U 5JVHQ 3A3OB 1Y5NB 1IKXB 4DR5J 3ZZOA 4CQ1A 1FNXH 4TYAA 3M7VA 1YJUA 5F3ZA 2WAQD 3AT1B 2BRLA 2XBPA 3GV7B 3V5RA 2KI2A 2VUGA 5D77A 2P6TA 2CZ4A 4URSA 3LF0A 1TKZB 3ENVA 4KQZA 1IKXA 1SH0A 2DXFA 1QSSA 2HHUA 3MM8B 1VDHA 3RAQA 2J6TA 1NKEA 4C11A 5B08A 2ROGA 1NJZA 4LJMA 1KHVA 3V4MA 1U25A 4O0NA 5BYRA 3MM8A 4DV6J 1YHQS 4LFCJ 3D0HE 3VAHA 1I3OB 2E44A 3V6JA 4K0KF 2E66A 4OHYA 1F9HA 3D2WA 4RO0A 2CPIA 3QIPA 3IR7B 2IBOA 4QJVA 3KJNB 3CWJA 4TU7A 2EBGA 3OTOJ 1OSDA 4F2SA 5F8MA 4I69A 3E51A 3HJFA 2B5JA 4JOUA 3TJ8A 1H38A 1DFDA 3HULA 2DH7A 5KOXA 4CYUB 2KHDA 3BBCA 1ZM2A 3ILJA 3EGVA 2DXDA 3PX4A 2QA2A 5J1EA 1X4BA 3CCES 2MZSA 2FY1A 2RE1A 3PG9A 1REGX 4CYUA 4O3SA 3OPKA 1RAGB 1WUUA 3BN7A 1R0AB 3I6PA 2ZJQQ 4OX8A 3MOJB 3MXHP 5DDRC 4NZ6A 3H98A 2L41A 2DISA 3C14A 4F04B 1UA0A 4X2BA 4PWDA 2BRKA 2AX1A 4LF8J 2MY8A 1RUSA 1DZ5A 1WI8A 1U8SA 2XS5A 3W62A 2C2OB 4ALZA 4F2RA 3HZEA 3FSYA 3RGIA 3VAIA 1YI2S 3T6BA 2RDIA 3DLLQ 4DUZF 1JQGA 2AJ0A 4MMOA 1GAOA 5KFEA 4PXEA 2LXIA 2WVDA 2RU9A 4O3QA 2ZUAA 2DNMA 4OHVA 1YJRA 4HTIA 5HO4A 3N6NA 4ECZA 3DYAB 1YJWS 3NMRA 2ZDOA 3SV3A 3FBCA 2W9CA 2IRYA 2E7XA 1SH2A 2RDDA 1Y7PA 1RWXB 2MQLA 4UUWA 2VBXA 2XEXA 7FDRA 5DS7A 2CQ3A 4RPFA 3DYAA 3D6TB 1WSVA 5IZHA 4NASA 3QJPA 2FHJD 4RUBA 1F9EB 3Q8QB 1UVNA 3KLVA 2KM8B 1UPMB 3BGOP 4JI4F 4PRFA 2Y8YA 4CRJA 4Q0BA 3ZNJ1 2XQCA 3G4SS 5LXRA 2BJ7A 4LBHA 2DNOA 5C24B 2CJKA 3CULA 1WD6A 2XMUA 2FHKA 1Q82T 2VBWA 4PYAA 2ILZA 2MTLA 4LFBF 1FVSA 3JYTB 5C24A 3CCQS 2HWTA 4NYOA 4PG7A 2ZBRA 4HI1A 4ZK7M 3C2PA 1CJUB 1FWKA 3H8YA 1NNDA 3TAPA 2CPHA 4Y2KA 4OI0A 4ANEA 3PV8A 1P27B 1FKPB 2MB0B 1OIAA 3FCHA 1UA1A 3CJ4A 1CG2A 3BGRB 4LSNB 3TA1A 3M8ZA 2GHVC 4M8LA 1RWMB 3GJRB 1VISA 1S1WA 3B4MA 1FKPA 2YVSA 4TLQA 1LW0A 4USUA 1XMQF 2MZ1A 2MY7A 2VODA 5K8NA 4A8YA 4LSNA 3HHNB 5D8HB 5IWAJ 2XS7A 4B3MJ 3PM9A 1S10A 2GA7A 3TWZA 2UUBF 3FZBA 2VQFF 1RE1B 1NSKL 4CM0A 2J5AA 2FJBB 2YXLA 3W60A 4CTAB 1AXQA 1FT8A 1TELA 1BD6A 1WJ9A 1IBMJ 1TL1B 2KU7A 3IGVA 2DRAA 3S8SA 1EARA 1VQ6S 1KQFB 3GILA 4C0HA 2CQ4A 3CCJS 2OELA 2YKPA 4F4XA 1XMBA 4KB7A 2LU2A 4CTAA 4OZ3A 2I8EA 1NK7A 2IVMA 4M94A 1OQ3A 1JNRB 3THTA 1KBRA 4YB1P 4Y0FA 1TL1A 4OQJA 2W25A 3R1HA 3CD6S 1RHMB 1KOOA 4M5DB 1XR7A 4N41A 3I5BA 2GVDB 3GPAA 1CQNA 2KHCA 1HARA 4FF2A 4A46A 1X9WA 4FS2A 3KUEA 1SJ3P 1N33F 4M5DA 1YLXA 3NOGA 4F7VA 1RU2A 2VF3A 3H5XA 3S01A 2GVDA 5JVGQ 1XMOJ 4MK7A 1S1XB 3HXMA 5B0DA 2DGWA 1RCOB 2M88A 2JEIA 2AEJA 3FC9A 2AP6A 2AIRB 4PEOA 3IRXA 3QT8A 1XK8A 1N6QB 1X4FA 2E9ZA 3EXCX 1RAIB 1VRUA 1LFWA 2HHHF 4LMZA 1G7CB 1VQ8S 2LXUA 3SCJE 3MCOA 2LU1A 1UFWA 1KWMA 1G1XA 1FK9B 2RDJA 3DM2B 2YWGA 3GIRA 4FYWB 3X1LB 3SYZA 4OV1A 2ASDA 1N6QA 4ZHRB 2A6MA 3LGNA 2OSRA 4MIAA 2NXEA 1JNZB 1VQSA 1RDRA 2UUTA 2KVQE 3RU0A 4JV2A 3D1OA 1FK9A 4FF1A 5KT6A 4I6WA 3DM2A 3QZ7A 3MCNA 4TY8B 4ZHRA 1FF2A 2E5HA 4QQBA 1RT5B 1QAIA 3OHBA 4WYLA 2KFZA 2UVUA 3HHEA 4JI8F 1NPKA 4NI2B 2OI2A 4GRSA 2X1BA 3J81Y 1C4CA 3TJ9A 4GO7X 4ED7A 5F9LA 3GONA 1HPZB 4TY8A 1VOMA 2D3ZA 1RT5A 2Q6BA 3PEJA 2KH9A 3VAFA 4ES3A 3OXFA 1WORA 1FVQA 4FXWA 2EG1A 2XLIA 4AD6A 5J2NA 4L3KA 5KG2A 1HPZA 1GTHA 3J81U 1TKTA 4CNYA 3W8GA 1UVJA 4NXMF 2K7JA 4DR7J 2CPEA 2MEWA 1Q86T 2OPQB 4P7VA 3FFIB 1WHXA 4ZCIA 2P9CA 1U0SA 2G2YA 1VK3A 2EEYA 4UZCA 5E2QA 2ZEJA 1OPZA 2EK1A 6FDRA 5A76A 3HHKA 1U09A 4LUBA 3RBEA 2B4UA 3ETOA 2OPQA 3FFIA 1CJTB 3VGTA 1UEUA 3OTEA 2C2MB 4WFBQ 1NSAA 1XN9A 2VPZB 1YVFA 1T9UA 4DR6F 2WB4A 1AFJA 4ECSA 1CJTA 2HK2A 3TI0A 3VHQA 5T7LA 2OKQA 4PG6A 2N4CA 5J1NA 2DGUA 2H4WB 3AFGA 4P72A 4WXWA 4ED5A 2FZKB 3OL7A 3W2VB 2YWHA 5J2MB 3MUMP 2EFQA 3G82B 2IYIA 1ICEB 5GADU 2GIQA 2YKMA 2E1PA 4O44B 3H0PA 2O3DA 4BHQA 1N0UA 1U2FA 3QLHA 2KKHA 3W2VA 5J2MA 3VQSA 2EK6A 2F9DA 5D0GA 1PBAA 4ED0A 4IRDA 4LBPA 3G82A 3S7RA 1P6TA 1FHTA 4O3PA 3VAKA 3ISNC 1HNIB 1VR6A 4O44A 4UZBA 1KLNA 1K47A 5F8LA 2VJVA 3ADAC 2CKWA 4OZLA 3ZZTA 3GE9A 3H20A 1WC5A 3MPVA 3GIKA 3PFEA 4JV0A 2LECA 1YX2A 4USWA 1EIYB 1HNIA 3L09A 5MAOA 5T41A 1ZM9A 4QR1A 3ITHB 3W1YC 4WFAQ 4IQXA 3VAGA 2UUWA 1X4EA 1GXLA 3DGVA 1NK9A 3SSQA 1U1LA 3EICA 2MKIA 1JLCB 2DYAA 2WOMA 4OJGA 2CPFA 4OYMA 1Y5LB 3R5JB 3RW7A 1DLOB 4KTQA 3ITHA 2CIMA 4RW4B 1HLWA 5GADI 1UKUA 3HT3A 2D74B 1Q16B 3V4IB 2KJWA 4YDXA 1ZETA 5F3TA 2XI2A 4USIA 2Z2ZA 3E01B 1JLCA 2NS1B 2UVRA 1QAYA 3UD5A 1DLOA 2PN6A 2QLFB 5KFCA 4N56A 2JLFA 3BR8A 2IPOB 3V4IA 4KJIA 2YKAA 3BYPA 4R5PB 5L1IA 3K7RA 4ES1A 3H25A 3OTDA 1YITS 3H90A 5A8KA 3KHRA 1NK8A 3F56A 2CFXA 4DV5J 3BR9A 4YR3A 3IGNA 5LM7E 2BV3A 5D0HA 3N0VA 2GJFA 1ZA2B 4R5PA 1FKOB 4V19X 4NLVA 2E7VA 4JI6J 4BBYA 4H4OB 2KXHA 4N7TA 3NCRA 5LSRA 1RWUA 1TVRB 1YZ7A 2BMBA 3TARA 3SQOP 2WBMA 2Z56B 4AUKA 4ZP7A 5G4DA 2HFOA 2OSQA 2V2QA 4Y2MA 3U1LA 1TVRA 3H4DA 3GFYA 2CNKB 5E3AA 2IM1A 2XLJA 1ZM4A 1LWEB 2JC0A 4U96A 3FUYA 3K5NA 4JI0J 2E5LJ 4K2JA 4DLGA 2V2KA 1KN6A 2N3LA 3ILOA 2DR6A 1RKJA 5BXIA 1UJ5A 5BYQA 1LWEA 4UQTA 4QBUA 1HL6A 3MEGB 4ZJOA 3CPWR 2BDPA 3ONQA 2AQ4A 1QDUB 3D0IE 1SV5B 1N5QA 4NMXA 2RRBA 2W7OA 4HL9A 2QT7A 3EZUA 1TP7A 3MEGA 4P74A 2KFYA 4A47A 4NCAA 3MECA 4ECQA 3LP1A 2V4QA 2ADBA 3EVOA 4MH8A 4Y65A 2DNZA 1H2VZ 1U48A 4DQPA 2VDIA 5I3UB 1YIJS 2A1BA 2CJXB 3QWPA 4J9VA 2FYXA 3AB2B 1X31C 4ZP9A 3D68A 1NSQA 2GGPB 1XR5A 1QY7A 3HKZD 1RAJA 5I3UA 5L46A 3Q24A 2R8IA 1MNEA 1WKKA 1IR1A 2JDJA 2GGPA 1UAWA 3I9ZA 1EKRA 4TN2A 4DLEA 2ZNYA 3Q23A 1ROFA 3TEGA 4CLSA 1WOOA 2CPDA 4FYVB 3JSMA 4KBIA 2POKA 1NZAA 1R6VA 1TKDA 1NLKL 2WB1D 1W2IA 1PSDA 2XC9A 4J9QA 4B9UA 2RHSB 4EZ6A 4C8LA 4PXDA 4WPAA 3PW2A 3TUJC 1OQ6A 2R8JA 3MPDA 1S0OA 2HGNA 1VBZA 2V9KA 3D6FB 5FDLB 2HW3A 3BKTA 3QRQA 3BPSP 3CMAS 1L3KA 2B56A 1IJFB 2YX1A 5K5MA 1HFEL 2ZH6A 2MJUA 1G3OA 1YRTA 3OXGA 1TMJA 5FDLA 2PI5A 2XS2A 3GG1A 1YDLA 2OPRA 5DDOC 2LQBA 3CC2S 1EJ7L 2COLA 2XO6A 2VFRA 3BSOA 3R6GB 2BZ2A 2ZWPA 2AJQA 5KG6A 5HROB 4ZPAA 3JAMY 4X64J 1RCXB 4NYPA 2Y0SD 2QA4G 4X65F 1SJRA 2U2FA 3UQSA 2KB2A 1RTHA 4NPOA 1SUQA 3DXSX 2HPUA 4Z7CA 5HROA 1YJ9S 3M2VB 2DKOB 4Q5VA 2G0IA 1YKWA 3FCWA 5KFRA 3JAMU 3PW4A 4ERDA 2XMAA 5HSPA 2VOPA 4ZVRB 3PZPA 1LEOA 2CJBA 3M2VA 2HLTA 2DTJA 3OV7A 3OD2A 3T5LA 4M5MA 3DOMB 4OZJA 4F8RA 5KG3A 1J2VA 2QL5B 1T0TV 2Z2MA 1KTVA 3TUZC 3TR5A 1RACB 3M8SA 4IRCA 2I1RA 2OEMA 3SFUA 5ETVA 1P8GA 1KS2A 2GX8A 2LDIA 2J6UA 5KFVA 2R7OA 3D7SB 3KUHA 2B9EA 3PJWA 1VBKA 2IJFA 1FJEB 2HS3A 1HHQA 3CJ3A 5FIIA 3CDAA 4J9KA 1K1QA 4U67Q 4CP5A 2JVOA 4DSIA 5A8WB 3H5YA 5KG1A 4O3NA 4QWAA 1KRPA 3A8JA 3GJSB 1UWBB 3TANA 3NKYA 2MSTA 4RNFA 2WVBA 1RT2B 4MK9A 4P10A 2ZH5A 4DL7A 3LP2B 5A8WA 1LKZA 2VH7A 4DWIA 4PYDA 2G0CA 1UWBA 1RU1A 2KJVA 5G0RB 4GVBA 3VGUA 3WIVA 3T6JA 3POTB 4DV0F 2F40A 2MGZB 1RT2A 2DGVA 1NBEB 2AKWB 4I56A 1HWUA 2FIUA 4LF5F 2KG1A 2YKNB 4QIVA 3LP2A 2NLWA 2Z2YB 2HGLA 3MCSA 3HDSA 4GC6A 1R43A 2KYXA 4C4WA 2W8KA 1KQSR 3GU0A 4RWWA 5KFXA 4MIBA 3POTA 2BJEA 3GFXA 2H5IB 1JJCB 2YKNA 1HHTP 2VFVA 1FJGF 1VQ4S 5GMEA 1WTFA 1TZ0A 3T1HF 4WYWA 4Y28C 1S9FA 2E5GA 4B9LA 1IUJA 3HI9A 2MQQA 4U9RA 1N5TA 4DHVA 2Y1JA 2RKIB 2DR9A 5C25B 1TUGB 5KFTA 1N33J 4CLFA 3DU6A 2JZ5A 3MPWA 3T19A 1S48A 1JWWA 3LAKA 3PHEA 2RKIA 4WFYA 3IN5A 2GS8A 4EYHB 1PG5B 5IV3A 1DURA 3GQCA 4RW8B 3LQVA 4E0DA 4MYTA 1NHKL 4DSKA 2M3DA 3KNAA 4H4KC 4O0IA 2MKKA 3UN2A 1KLMA 3MUVP 2ZJPQ 2APOA 4A48A 4P2XA 3K57A 2IAJB 1N34J 5CD4A 3NMAA 3HFKA 3EX7B 1L3SA 4OYPA 3KG0A 4RW8A 4PR6A 2ZHBA 2WW8A 4Y2CA 4DCOB 3G8SA 5J1PA 1JMTA 3V6HA 1ZYQA 1J5OB 4IO1A 4HT5A 1C0UA 2IAJA 5B7WA 3QO9B 2NPFA 4DZ6A 2I9SA 1HNZJ 4PG4A 3OFFA 4USHA 2WSFC 4DCPB 2CVEA 1KR4A 3R7SB 4OYWA 3V6KA 4PUOA 2BJ9A 4WE1B 2HLUA 2ZH4A 1WOSA 2GAGC 4KH1B 4OI1A 2VZ9A 3LUYA 2O66A 1BQNA 2B8QA 3AY0A 3CNQP 4MFBA 4WE1A 3DMJB 4LF1A 3KFWX 3TYTA 2WSCC 4M5JA 3OVSA 1DTTA 2VHGA 4F3QA 1OYEA 3VAMA 4YR0A 3VZHA 3DLEB 1H6KX 2MQNA 2FZGB 5IQ6A 2QLWA 4OHZA 3EPIA 4AL5A 3BGUA 3DFEA 1OMSA 5K8OA 3PX0A 4IQMA 3DLEA 5JXSA 3C6TB 1TUWA 3GV5B 2F9JA 4OYBA 4DS4A 3UNYA 1U7LA 2DNPA 3FSXA 2YX4A 3TX8A 1A7GE 5IFMA 1MN7A 2AU0A 1SKRA 3FRZA 3LPEA 1S12A 2ZH7A 4AYBD 2OIHA 3HHLB 1FTRA 2E1AA 2ZH2A 3C8YA 2RD5C 2C2NA 2H65B 4JBCA 2JFDA 2RF2B 3Q86A 1S79A 2LDYA 5DRKA 2SXLA 3CF5Q 3FCVA 3HP6A 4QR0A 5D3GB 3T1YF 1WF0A 1WHWA 2JEFA 2RF2A 2F4VF 1ZA1B 2F1FA 3I4HX 4CDIA 5D3GA 4OX9J 1M5KC 2EKYA 3KWMA 2QFJA 2V4JB 2C28A 2P6SA 4B3RF 2FLNA 1PYTA 1JJ4A 1GMVA 4ZVQB 4YMEA 2HAFA 2NSCA 4FKXA 2ZFHA 1G2EA 1ZH5A 2GC8A 3TX0A 3WC2A 1QUVA 1ZPVA 2CNNB 4E2FB 2QTWA 1IXKA 1N56A 2V5HG 2MLXA 1T8EA 5EHHA 3CUNA 3TZZA 2CYYA 3QT5A 3R7NB 3KK1B 4MKBA 3QGGA 4XK8C 3MWBA 2Y8WA 3UD3P 2Q66A 3NAHA 1HBMB 3FK4A 3M8QB 4JI5F 2B4VA 4JYAJ 1V3RA 3HSJA 3JSRA 3QGIA 3JSBA 5ETRA 2R7VA 3NEKA 5K14B 4FYDA 1WACA 3OUYB 2DD8S 1HBMA 5HANA 3M8QA 3HSZA 3N79A 3FZ2A 4LFAF 5B0FA 2UZAA 1N54B 1HNXF 4C98A 1U1OA 2ADCA 5L1LA 5K14A 3M8PB 3W5XA 1VQ9S 4DL5A 3D3BJ 3M6WA 4UOHA 2YNFA 2LEBA 3CVKA 3IXQA 1G4CA 4JV1A 3CJ8A 1BXNA 1M5OC 3M8PA 3K5PA 4O3RA 4B3SF 2GMHA 3ELHA 1HQ2A 1B3TA 1A9NB 3T41A 3CGIA 4ZIWA 3L95X 5DJBA 2EFNA 5KT2A 4DR5F 2HURA 1X4DA 4NZ7A 1TFYA 1IBKJ 1NHUA 1VQMS 1RK8A 3ET6A 3CJSA 3I0SB 2CQPA 1S9GB 3KG1A 1FKAF 2JNJA 2K8GA 5F0WA 3LW5C 1NK4A 5F8HA 3NY0A 4HHJA 2UV8A 1S9GA 2EKNA 3GZ7A 2B9YA 2OD4A 3HVTA 2QE5A 4QIEA 4DV6F 3R27A 3SI8A 4LFCF 1FDDA 1EHWA 4I2PB 2B9XA 1L3VA 1LWXA 1PO6A 1VGYA 2LQ8A 2C1EB 1KVJA 3OTOF 1B4SA 4I2PA 3R7BB 2ROPA 4KE5A 4L72B 4DFPA 1VC0A 1WOPA 2HWIA 3OTCA 3K59A 4L6V3 5KOWA 2UV8G 2IIHA 4KT0C 2OMOA 2XHWA 4ZCMA 1N0VC 2D3O1 3EDRB 3TQEA 1MG7A 1Q8KA 4ZVGA 3PDNA 2OH2A 2QGFB 1TU0B 4KSEB 4PXCA 4F02A 1TV6B 4FS1A 3CXCR 4KV8A 1V9OA 3SQGA 2DHHA 1GTEA 4JI3F 2DEIA 3AOAA 2QSWA 1TV6A 3QRPA 1R8CA 2K1RB 4CT8A 3KUGA 1AT1B 4LF8F 1KD1T 4WP9A 1WKLA 4LSLB 4OZ0A 3W65A 5J2QB 4LQ3A 2PDAA 1T9TA 4L3NA 4QWCA 2F8EX 4DV7J 4USKA 3PX6A 2DO4A 2ATLA 4ECRA 2BQ3A 4ELTA 3NGUA 4LSLA 2DY9A 3P45B 1WHYA 3BGLA 2IRUA 4ILRA 2LQJA 3CSKA 1HI1A 2UUCJ 3RR7A 3PY8A 1S77D 2JRSA 4FF3A 4C8OA 5DG8A 4F4KA 1JJHA 5DDPC 2VQEJ 3DNCA 1B99A 4U8YA 3TZYA 5CA5A 3EZOA 2HVHA 1Z4UA 3ENWA 1SKWA 4DL0C 4OZNA 3FKBA 3U02A 4AQYJ 2OUGA 4I4BA 1KKHA 4HDGA 3ICLA 2AX0A 1RBAA 2UXBJ 2DB1A 4C8YA 1NAQA 2AEFA 2CZ9A 4ED3A 2MKSA 5E33A 1T3NA 4A8MP 1WSRA 2CUYA 5GAEU 3Q8UA 2VG7B 3DOKA 2LA4A 2DNGA 3NL0A 1VRQC 2DK2A 3FSIA 1U02A 5JJBA 2V8DA 4LBIA 4ZIVA 4ZMMA 3KKFA 2XZTB 2VG7A 4N76A 3AQOA 4X84A 4OYXA 4ANDA 2AJ2A 2R4FA 1WF2A 4NWBA 5KFZA 4ZCKA 2PEHA 4G6VB 1WC1A 4ZLPA 1QLNA 3KLEB 2C22A 2AYMA 4KYZA 2W8LA 2ZVIA 5KFYA 2ZNZA 2NZ4A 3S6EA 3CDWA 5IWAF 4B3MF 2PA3A 1NCLA 2CAJA 1RWPB 4CLZA 1RGVA 2BQRA 2BJ1A 3NCPA 2W1BA 4ED8A 4NLPA 1IBLJ 4KHRA 4DEZA 3ZXWA 2ZWOA 1SQGA 2DHXA 4KGVB 3BSCA 4ICLB 1IBMF 3MR5A 4EI2A 3CD7A 1F3VA 1U1KA 4I1TA 5K8MA 3ETMA 3IR6B 3K8WA 2OLWA 2C2RA 4W4MA 1UVMA 3EGZA 3UVJB 4ICLA 3MMBB 2DR8A 3M2RB 2QV6A 4C8NA 4QPXA 2BUNA 4S0MA 3UVJA 6FD1A 2OHDA 5SUHA 3FBBA 3GFHA 4OL8A 1FD8A 3UW1A 4C7QA 2RRAA 3M8RA 1WG5A 3UNGC 3MMCB 3NGRA 3M2RA 4XTTA 1MWQA 2QZ8A 5CCLA 1MLAA 2HNZB 4RNHA 2AT1B 3MD3A 1S7HA 1HA1A 1QUPA 4QIFA 3R5GA 1Q5VA 2VICA 4NLXA 9RUBA 1SIZA 3MMCA 1XMOF 3UR3C 3GSDA 1U2CA 2GZOA 3PRDA 2HNZA 2BKNA 3P5TL 3PW0A 3HHLC 1J27A 4LR7A 2ZOFA 3CO0P 1HW8A 3J7A1 2HQCA 2PC6A 3EVWA 2DNKA 4FYXB 4CLYA 2UUAJ 3L4BC 1QAJA 4N47A 4L74A 1OY8A 3R5CA 3NS7B 4DX5A 4Q7AA 3CJKB 5KAKA 4J9NA 3NNAA 4K4YA 1Q7LB 4DPOA 3OBIA 2R3VA 1X4CA 3G96A 2LMIA 1VFJA 1IKYB 5C2GA 1S72S 5CABA 3KJFB 3FEYB 1HNVB 3CJKA 2R2TA 1LOUA 1B64A 1SKUB 1X4GA 2M4MA 4OLOA 1IKYA 1VHFA 2EFOA 1Z1ZA 3SSSA 2C2EA 1HNVA 1U6FA 1NPPA 2GCFA 2R2RA 3R1LA 2VA2A 1FX4A 4RW7A 2GMLA 4EBDA 2VV5A 2ZE2B 3FDSA 3MI7X 4YS2A 2DNQA 2LA6A 1H72C 3D54A 2IJNA 4LIWA 1SBRA 5GAGU 2Z2LA 4DR7F 5KFDA 5EN1A 2MHNA 1NM2A 4NEYA 3TVYA 4F4WA 1GQEA 3GIJA 2AEMA 3RRHA 2AYEA 3HMJG 5AE3A 3DC2A 1PBUA 2BKOA 2IMWP 1AA1B 1D8YA 2MLZA 1D3WA 2RAQA 4FBUA 2QX0A 3OVAA 3H4BA 3O1LA 1F9FA 1H2TZ 3FQKA 1WDDA 2HFSA 4RUCA 1IKWA 1T03B 2QL7B 4TU8A 5IS2A 4X4SA 4C3MA 2ZM6J 3MD1A 1E6VA 1PJ5A 2E1CA 4AL7A 1MROB 2BACA 3GSIA 4E98A 3GR1A 2M9KA 3KXDA 1T03A 5FLXY 3ZZ0A 1U1PA 4DCJB 1HWIA 3ILLA 3L7OA 4WWSA 3L7UA 1FFGB 1YBTA 2WTFA 1YJNS 3LGMA 1S6QB 1YG0A 5GAGI 1NJIT 2IY5B 1IVZA 1VC5A 1HWKA 3IAM9 5FLXU 2ZH9A 1RWNB 1SL2A 1FO1A 3A13A 3GR0A 1EKSA 5HQLA 5C5JA 3VV2B 1Y9OA 2MSSA 1DJ0A 1OWXA 3OLAA 3H2VE 2LVWA 2DCUB 2QMUB 1S1UB 2DEJA 3FMWA 2QL9B 2LXFA 4DFJA 3TUPA 3IO1A 3NGSA 1U0HA 2Y9HA 4ZPCA 4OI4A 4ECYA 1T95A 2AF6A 2FVPA 3J7AN 4DR4J 5IC4B 2MZTA 1N5SA 2GHPA 3MMAB 4QYRA 3WC0A 2QEXS 4B02A 2CDQA 3AD9C 2R2SA 3MEDB 4HLBA 4DJBA 1IKVB 1EAYC 4DSEA 4CO1A 4NLQA 1HYSB 2B6AB 3TRGA 3MTJA 2R7QA 1S0MA 1YJVA 2W4PA 3MMAA 2PIIA 2HEKA 3MPYA 2EFVA 1D0EA 2WW4A 3MEDA 1IKVA 4DQQA 3W61A 3MFIA 1NJXA 1X60A 3AODA 1CS4B 4G3IA 3CMQA 2B6AA 5GVQA 2WVEA 4FPRA 3KOAA 4UOFA 1FESA 1ELOA 1O6XA 2JEJA 1CPZA 3Q2SC 2AYBA 2L9DA 3PNIA 2CRLA 3TUIC 4ED2A 2HQ3A 5ETLA 3JXOA 2JH3A 3QSYB 5KFSA 3M2UA 3CJ2A 3KLIB 3ZTPA 4JI5J 3NP5A 2FJAB 2QC3A 3OR1A 3M8WA 5KG7A 3JQMA 1RI7A 1U24A 1QAXA 4WFXA 4DV5F 4EFAC 2XY5A 2E1MC 2QA4S 4UY8T 1M5PC 3AJ1A 5H9EJ 3KLIA 1KDNA 1LXJA 8AT1B 4JI6F 3FQLA 2IVFB 2UP1A 4Y2IA 4J37A 1LWCB 3DI6B 2R7WA 1KONA 2VU5A 4YB5A 5DQHA 5D4NA 2ACYA 3PRBA 3QSIA 3NS6A 3BH7B 3TA0A 1KEKA 3GG0A 3B6BA 5KFFA 5JUMA 4PG8A 4JI7J 1S4EA 4IOBA 3DI6A 1FWPA 4RU9A 4Q2LA 4RU2A 4OYAA 3G8QA 5CZXA 3NXZA 2W9AA 3GIMA 4DX7A 4IOAQ 3R5AA 2P9GA 4JI0F 2E5LF 4K2XA 1SQFA 4TXSA 3UDLA 2Q1LA 3EUNA 1VQYA 2HHSA 3TZXA 2IYGA 3A8KA 5E3RA 2HS0A 1VCTA 4DN0A 3HKWA 1X9MA 2FLLA 4C11B 2VC0A 3N9UC 3U1NA 4DQRA 2MZRA 2ZUGA 2H5JB 1JLBB 1FCAA 4V1Ak 2HRTA 4OJ1A 1SIWB 3E3XA 1X5PA 2ZDPA 3G2XA 3QIPB 3LTOA 1O5JA 3HJVA 2BVZA 3PVXA 2UVWA 1PAUB 1RA7A 1ZBTA 3EDQB 1JLBA 1OSCA 1U45A 2FJXA 4USVA 1HNWF 1QVFR 3TVZA 1HWLA 1NZ8A 4ELUA 2R7XA 4OJ3A 2B5JB 1RA6A 3MUTP 4YQWA 3DRSA 3PR4A 2VONA 1AFIA 4ZVPB 2IDLA 3Q22A 1EQMA 5J1EB 4DV1J 4OI3A 2ASLA 4ECXA 2CQ0A 4QWBA 5LXYA 5K9FA 4WBFA 4X62J 1VC6A 2IM3A 2GW8A 5GAHU 3K8VA 1GEHA 2ZOMA 4YUDA 1LXNA 2IVYA 2MKJA 1S4FA 4N8OA 4TYBA 3C14B 2FVCA 4G1PA 1PIEA 4PWDB 1JJ2R 1K0TA 1S97A 5L39A 5DM6Q 1PGZA 5EX0A 3MF5A 1ZM3A 5IT9U 2FHMA 2CQDA 1R31A 2BOAA 1A6LA 1MMLA 1WG4A 4JI3J 1NRKA 1RTIB 5ETQA 2ZHAA 5KFMA 4XO0A 4KPCA 2R42A 2NUUG 1AZSB 1DAXA 3BB5A 1U47A 4R25A 2CNOB 5FJ4A 1WEYA 1FNOA 2YWFA 2QG9B 1RT3B 3TAQA 1RTIA 3T9NA 2VFTA 3I31A 2AGPA 4C6AA 2D41A 2W9CB 1N5YA 1AZSA 3CCMS 2B7BB 3RR8A 3FBEA 1FRXA 2CDRB 2FHOB 3H42A 3M6XA 1RT3A 1ZPWX 1R8PA 1SXLA 4K4XA 3UDEA 3QYYA 2I38A 1MWYA 5GAHI 1UJ6A 3CE8A 2J76E 2DH8A 3IRWP 4WU2A 4X64F 3PCOB 3CC7S 1R27B 1VHIA 4Q0BB 1RJJA 4E8UA 2Y1IA 2ZBCA 2A18A 3KLFB 2WVFA 3US5A 1KVIA 4TU9A 2KO1A 4ZVOB 1RHQB 4DV3J 4H4MB 1FJCA 4K4ZA 2JFKA 2R8GA 2BABA 3RBXA 3KLFA 3P3DA 1PCAA 1FEEA 5CYQA 1T9YA 2JEGA 3VVUA 2W9BB 4H4MA 2Z57B 3O44A 3W2WB 1W25A 2AZ1A 1NKCA 1KOHA 1P1LA 1PKUA 4DR1J 1S1WB 1UW9A 2W9BA 4KO0A 4OYIA 1NKBA 2XSJA 1LW0B 4ZP8A 3OJSA 5LMNJ 2QJ3A 3W2WA 2RILA 4LVNP 1MN9A 3WHIA 5AXMA 4FZVA 4IFVB 2X51A 2PI4A 3AA8A 5H9FK 3CTRA 3DKDA 4ZJLA 3J81j 2CADA 3DLKB 5HK4A 4K7QA 3W8PA 3DLHA 2J0QD 2V8PA 1ZTTA 4IFVA 2MQ8A 1AW0A 5CYJA 3FVYA 3AQPA 5KFQA 3DLKA 2FLPA 3W9IA 5HMXA 2M7SA 1RT7A 4DI6A 5L38A 4IR9A 5AE2A 5CAAA 4WF9Q 5AXKA 2BW2A 1S0NA 2K06A 3ZZZA 2BEFA 1FEHA 4CLTA 1RISA 2NQPA 3OT9A 3U27A 4B3OB 2I6WA 4CH1A 3A4TA 2HHWA 4ZPWR 2W7PA 3BM7A 1VIXA 4ID5A 4LRDA 1RADB 1M1KT 1BQXA 2C42A 4X4QA 3C3LA 3K2YA 3NWRA 5E3QA 4M63A 3IWXA 4LR8A 1GH8A 2B0GA 3L9ZA 3I55S 1HD1A 1EB0A 4B3OA 1JLQB 3NNCA 2KZMA 2AJ4A 4X4NA 4FKYA 1WC3A 2XSFA 2ZD1B 3TNVA 2KYZA 5LSOA 3CCLS 3BKFA 3D66A 3OFGA 4O4RA 1NB2A 1EQ0A 4NRTA 3IRXB 1JLQA 3UWTA 1S7IA 4DL6A 1VRUB 1FRHA 1RLCL 2XNQA 2ZD1A 3K5MA 3IM9A 1FE4A 2JVRA 4DZDA 5DZ7A 1N4LA 1LQ9A 5BR8J 2W4CA 2ZKUA 4Z7YA 5KT3A 3SXLA 2RNEA 2I5JB 2N7CA 3NS5A 4M95A 4A8KA 4ENOA 1VRTB 1H98A 1Z2ZA 3MM7B 1FJ7A 4DPTA 1GK8A 1RAFB 1GX5A 2NZCA 3SZ2A 3VAJA 3J7ZT 1N34F 1OY9A 2BJ8A 3W5ZA 2I5JA 2OAUA 3CD0A 5AXLA 3N6LA 3BO2A 1VRTA 3MM7A 3SSRA 3ZTRA 3GCXP 3I4PA 1OJ4A 3N5BA 3GMGA 5L8RC 4DR3J 1WKJA 2ILYA 5IV4A 4TY9A 4DQIA 4Y6IA 1R3NA 5DZ6A 3UDVA 1HNZF 1UMJA 2OMLA 4WCEQ 2DGQA 2D9OA 2HFUA 4XDCA 5B0AA 4MJKA 4KHPJ 2HKEA 1VBYA 2A6OA 3JQJA 4DL3A 1WNEA 2RS8A 3KHHA 3N4WA 4I6YA 1R89A 1AUSL 4A4JA 2NXNA 1OYDA 5J2NB 2CQIA 1FERA 1UZDA 5M2UA 1Q7YT 4R8UB 1CSJA 1CC8A 1TKTB 4KGXB 4RLEA 2YQ3A 2CXEA 3MR3A 1T7PA 2KL8A 1TR0A 3KMQA 3QPIA 1HBNB 1KC8T 4YDDB 2Q3PA 5KFWA 4R8UA 3M1VB 2KZZA 5U47A 2C3UA 2ALYB 2DRDA 4A8OA 4NCGB 2AJFE 3AA9A 5JMNA 4XAKA 1HBNA 2H5EA 4K50A 2ZZTA 5DG7A 3P4UB 1HD0A 3PHTA 4EWTA 4NYZA 4TLRA 3M1VA 4A8QA 1S49A 1WEXA 3C16A 1RABB 4KGMA 3D0GE 2XMVA 1CQMA 2O1PA 1YJTA 5T7LB 1VLOA 4NCGA 2HVIA 3BF4A 3O2IA 3LO3A 3GIIA 1XWLA 4LF9J 1SH3A 2Z0GA 1BGXT 2RS2A 4HYKA 4RNOA 2V69A 4EU0A 2J8AA 3Q8RB 4LRAA 4TKTA 4ID8A 1X0FA 2YKMB 1CVJA 2V0NA 1ZZNA 1FI4A 3QLHB 1JK9B 3H5UA 4YHHJ 1ZS6A 2EWHA 4JI2J 3J7YI 1URNA 3G6VA 2WBRA 4DUYJ 1MSWD 4CIOA 3AAWB 5KFLA 1TAUA 1D1UA 1RWWB 3Q8YA 2HZAA 1JKHB 1HHSA 4OX9F 3DRXA 2OD6A 3UCGA 4U7UK 2DIUA 1R6YA 3MHYA 1CBKA 4J7CA 1UJ4A 4C3LA 5IOLA 3QAUA 4K4SA 1V3ZA 3N5FA 4UW2A 2NYHA 4IG0B 3BBBA 1X4HA 4L76A 4OI2A 1JKHA 5LJ5Y 5A8RB 2E9TA 2HS4A 4NZ0A 1N36J 3H2LA 1WWHA 2HHPA 2OGUA 3QJLA 2WK4A 2XGPA 2AV5A 4ZPTR 4CLWA 2YNGB 2WOMB 1U4BA 5F8JA 4IG0A 2DNHA 4X4OA 5THWA 4P75A 5A8RA 1BY9A 3RTVA 4B3TJ 3MDFA 4JYAF 2AMCB 1V5IB 2UVVA 3HLUA 2YNGA 1DHMA 3R2DJ 2M8DB 3MEEB 2HQGA 4NL5A 2DRBA 4UF4A 5B0BA 2IBKA 3HD2A 5I4MA 5ADZA 2ASJA 5F8GA 4OYOA 2HBQB 1JB0C 5A8KB 2PMZD 3TO8A 1JLFB 3MEEA 2MQOA 2DJWA 3JB9k 4F4AA 3TW0A 3MGJA 2OPPA 4A8SA 5BJRA 4NLRA 3RRKA 1JLFA 1H7XA 3OL9A 3OQ2A 3QT7A 1VMBA 3VZIA 5KFNA 2OJ3A 3B4DA 4NLGA 3NG8A 2MKYA 1GMWD 1JX4A 3M4XA 2ZBIA 1EZZB 4KKOB 4YFUA 1TK5A 2YH0A 2AHOB 1IBKF 4DPWA 3HPOA 2X1FA 4QW9A 3RB4A 2LP4A 2F3JA 4HH1A 4QIWD 4KKOA 4DPYA 3EWGA 2OTJS 1P9QC 1JLAA 5I3PA 5E41A 4O3OA 5E0OA 1C0TB 2Z58B 3D1QA 3JSYA 1QSYA 4ZVUB 3NBPB 2KG0A 3I82A 2WRMA 2KDOA 4TQRA 1VK8A 1K9MT 2FUG9 3L7PA 5DQGA 1C0TA 2YWWA 3W5YA 1I5OB 2KM8C 3GV8B 5D78A 2I0XA 3D28A 1S5ZA 2IA0A 3PR5B 4CM2A 2G13A 3MECB 3RBDA 1VQ5S 4DR2J 4KGKA 2F7VA 3LP1B 3HVWA 3NBPA 4URQU 4ER8A 1NSPA 4Y34A 4DU7A 1GXTA 2XLKA 3I0RB 2XWYA 3QWUA 4MYUA 2O01C 4QCLA 2G2ZA 2IDEA 5K20B 4GVLA 3MM5A 5DG9A 1Y5IB 5B0GA 1X4AA 1X7VA 4K4TA 3I0RA 1HNWJ 1IWAA 3K0JA 1RHKB 1NDCA 2DPJA 1ZZFA 4ZPVR 2YNIB 3CCTA 4F36A 3GCWP 3I96A 3RAMA 4PPDA 1S57A 2ZH3A 1APSA 2XHCA 1PC4A 2F8MA 4Q44A 2KT3A 2CZVC 3FGVA 1VQKS 5EUHA 3BO4A 3JSMB 2HNDB 2YNIA 2BW7A 3UD4P 1SL1A 3IR5B 4OZ2A 2ZZNA 1OPIA 4WKYA 3DHWC 2XCAA 1BQMB 1RHRB 5EGYA 4F26A 2XMJA 4JI1J 4RW6B 3BN4A 4DV7F 2HNDA 4J9UE 5AE1A 2B9WA 2XMMA 2GNKA 1BQMA 2KRRA 1HMVB 5GMDA 2LQ9A 4DV4J 2QN6B 1K44A 3VQTA 3ZZUA 4RW6A 4I6AA 4USTA 3W66A 5F0UA 1CJKB 1DTQB 1Q5YA 3M9MB 2ZHOA 4IRKA 2UUCF 4KH0B 2RRNA 2V8HA 3B82A 2DIVA 3C15B 5AJ3J 2NYIA 1TL4A 2VQEF 2ACMA 1HMVA 3PIOQ 2OPRB 3PKMA 2YWEA 1SC4B 1CJKA 1DTQA 3HCXA 1VI7A 4RL1A 3RG6A 4X4RA 4OJHA 2M52A 1UCNA 4W90B 3UDCA 1TKZA 4AQYF 2NR0A 3C15A 5HVFA 1B0PA 3MZIA 4ED6A 1VS3A 5LJ3Y 1ZTWA 5H9EK 2GO8A 4MIWA 2UXBF 1UZHA 1RTHB 4P2FA 2UXDJ 1SUQB 3KLGB 3GLJA 5DQIA 3R2CJ 3KNGA 5KT7A 2XGQA 1C1BB 2N7YA 4F0MA 3OW2R 2BYCA 5ETPA 3QZ8A 4QR2A 1Q78A 4RW9B 2DVIA 4LF6J 1IM4A 4FN5A 3HX9A 3KLGA 3M8YA 1C1BA 5CCMA 1RHUB 1D9AA 4WXOA 2C3PA 2FQQB 5L9NA 3CJ0A 1WC6A 3SIPB 2XWXA 1X5SA 4RW9A 4USMA 3OL6A 1T3OA 2EBEA 2NCKL 1RAHB 3SEOA 2HK3A 2R7SA 1QJHA 5RUBA 1FXLA 2NXUA 2XB2D 3DDNA 4U6PA 4QU6A 1QTMA 5ITHA 3K5LA 3RBZA 4NA3A 4K4UA 3T5HA 3RJMB 3AHPA 5LT5A 5HAOA 2EFGA 1B7FA 4PABA 1U2RA 3BJYA 1PJ6A 2EI5A 1IBLF 3MM6B 1M5SA 2DNLA 5EDWA 3ISZA 2ZZMA 2YH1A 1R0AA 2GIRA 4AL6A 4HH0A 4CH7A 5KFKA 4L75A 1X9SA 3CJTA 1LWFB 5EX3A 4GKKJ 2GV1A 4PZVA 3MM6A 1M5VC 3KK3B 1WG1A 2OEKA 3NCQA 4MKVA 4QOTA 4GVBB 2VFSA 1Q1KA 1RZMA 3HD1A 2ZBPA 2E5JA 2ABYA 1N48A 1RBLA 1LWFA 3B54A 3BDPA 4DUTA 3BQ0A 3KK3A 1NDPA 2FB0A 4X4PA 3Q0AA 2F8HA 1DARA 2BE7D 2DNYA 4F0HA 3OLBA 1WC4A 4FXVA 3G87A 1TAQA 2M2BA 3M32B 4W92B 2Y3YA 2Y0BB 3GP9A 4OIXA 2GVZB 5D4OA 4FNIA 5B0EA 3THPA 3RRGA 2EFPA 3MURP 2DNNA 5E5NA 2XTJP 2B43A 1Q8BA 3M32A 3QNWB 3VVTA 4ZA1A 5LMUJ 2JSXA 2GVZA 1XTZA 4ZS6A 1CJVB 3BBFA 2V6AA 2HFVA 4Y3CA 4JV5J 1FFSB 2XMWA 3DHXA 2V4RA 4UQGA 3G86A 2UUAF 4DSFA 4WFNQ 2JC1A 3ENQA 1PYOB 1CJVA 3FEZA 4OX6A 2HQIA 3LPYA 4CO0A 4ZN1A 3QIDA 3CD5A 3WQPA 5DETA 2HQDA 4BWMA 3JQKA 2A2DA 4YN3B 2OFHX 2DNRA 3JYTA 3K58A 3F0NA 1KLMB 1QSLA 1SC1B 1Q53A 1CJUA 1KFSA 1QM9A 3H40A 5D0EA 2QYGA 1IR0A 2OO4A 4NXNJ 1WELA 4I68A 3A8EA 3Q8SB 5D15A 2KFNA 3BGRA 4Z37A 1F5CA 1B0VA 3PFOA 3LALA 3UR0A 1C0UB 3BH6B 4OX7A 3R97A 4X66J 2OTLS 2JHEA 1RQ0A 2BX6A 1TQLA 1U49A 3GJQB 4ZVFA 4PUOB 1NXIA 5D4LA 1MW7A 4BLGA 3P96A 2BR0A 1T94A 3DDKA 2W2QP 4C0OC 4NLWA 4DMZA 1Q8IA 3T1AA 4UY85 1BQNB 2D1CA 2PT0A 2UXCJ 3C46A 2XYHB 1SVDA 4MFBB 3TEHB 4ZITA 1RT6B 1Y0HA 3CCUS 2CPXA 3KTQA 1DTTB 4GC7A 4C9DA 2AGOA 4NOHA 4WP8A 3JS9A 1LV5A 1X5TA 2V68A 5F9NA 3ISND 4QYZJ 1RT6A 2BXJA 4BCAA 1YBUA 3VCDA 1BUXA 2HHXA 3BQ1A 2DXEA 1S1VB 2PSZA 3WZ0A 4DL4A 5ETOA 1RYSA 4FDFA 4HVZA 2ZM6F 4CNZA 1TUVA 2HZVA 4C8KA 2L9WA 4HACB 4GO5X 5D4PA 1FTCA 3Q2TC 1J5EJ 4DV2J 1C1CB 4R0EA 5IM0B 3O6QA 4KPYA 4OHXA 3PW7A 2HSEB 5IT0A 5KT5A 4CLPA 2NUHA 1S1VA 1KFDA 1D8ZA 4PKDB 1W26A 1NUEA 4HACA 4ZPDA 4YR2A 2HVEA 5EWGA 4LF4J 3EZ5A 4KGZB 4F3MA 1S1XA 1C1CA 1WTBA 4L73A 5IM0A 4U95A 2CQBA 2IM2A 3HVAA 4KHMA 3WDOA 3AXKA 3P8BB 1H73A 3LGHA 2D3UA 4RUAA 1A0OB 4G1QB 4IKAA 3R8YA 4H54A 1I94J 3R5DA 2GQCA 4EO8A 5E3CA 3QATA 2CPZA 2RQKA 2ZVSA 4OZ5A 2DITA 5HVHA 2FGOA 3TOQA 1YWXA 4G1QA 3VGSA 3ZTOA 5KFPA 4X4VA 1CULB 1F0XA 3W9HA 4DR4F 1R7IA 3GYXB 1S6PB 2L9NA 4AXIA 3CJQA 3ZFVA 4CO2A 2QO3A 3FEXB 4C97A 1VQPS 2R7UA 2MKHA 3CMES 1OY6A 4MKYA 5HL7Q 1KHWA 1QD1A 5HMZA 5HBMB 1CULA 4G65A 2QIFA 1S6PA 2QMXA 3BSNA 4X4UA 2KTQA 2RQCA 4NI2A 1NEEA 3CEDA 1S0VA 4ZKAA 4NLTA 4G1IA 2IHR1 5HBMA 3AOCA 2FGCA 4KIAA 4HTJA 2P8IA 3CT9A 3D3CJ 1TMMA 3EXYA 2Z8QA 2YX7A 3IC1A 5HQMA 5D0RA 1N32J 1UTAA 1KTQA 2FVQA 2MYFA 2DCLA 4JUZA 3MMJA 3T9ZA 1F1BB 1U8WA 3Q8PB 4JP8A 5A2QY 1SC6A 2FC8A 3HSGA 5HJXA 2KXFA 5DGAA 3OVBA 1L5UA 4UTGA 5AT1B 4XPCA 3UFCX 1GFWB 3SFGA 2YNFB 2CJAA 2H54B 3N28A 3I5CA 2YQ1A 3Q83A 2C2ZB 4PPZA 1H0HB 5A2QU 5KT4A 4PXBA 3CO9A 2J9DE 1UL3A 3V2UC 1T9XA 2J7WA 4FBTA 2VJUA 2J9CA 4WK3A 1RWOB 4C8MA 4I67A 5HVGA 1SJ1A 2IA6A 4JI7F 4RJVA 2VD3A 3MAQA 3OJUA 2DY1A 1MMNA 3I5AA 2I2YA 2HRYA 4GMKA 4QU7A 5A6WA 4LIRA 3ET6B 3Q89A 4ATNA 4PQUB 4WIQA 4ZCLA 4F3OA 2DGXA 2FTRA 1HI8A 4A8WA 4PQUA 3HVTB 2WONB 1FA0A 4H4KA 1AB8A 1AYEA 4EBEA 2ALZA 2HBZB 2K3IA 3TJAA 3CC4S 1VQOS 3RB6A 2VDHA 2EXUA 1OO0B 4JB8B 3OXLA 3HM9A 1R8BA 3NGTA 1O51A 1N88A 3SCKE 2GO9A 1F2HA 4B17A 2WONA 3P6YC 1DQAA 3ZC4A 4LF7J 3PYDA 2HHQA 4DF4A 5H9FJ 2V63A 2BE2B 4OMFG 2YKOA 4FVMA 3SV4A 3F73A 5L9XA 2P5VA 2PMWA 5KFUA 2ZITA 3MR6A 5KTQA 1NPRA 5K8PA 5A6PA 4YY3J 4GKJJ 2GHWA 1SKSA 2JL9A 4O4GB 1Y3KA 4DV1F 2BE2A 3HHDA 4RW4A 4ZLLA 3TQ1A 1ITPA 2G1DA 2YPZA 4EBCA 1L3TA 4DS5A 4WTYA 4EUVA 2NREA 4KV8B 3CB4A 4M5LA 2X7IA 3E01A 4X62F 1U1QA 3UO0A 2A2CA 4O4GA 3SQGB 1JLGB 2MLYA 1H2UX 1RYRA 1GX6A 1UFLA 3JTNA 4TNOA 5KFIA 2RJZA 2FVSA 4J9SA 3THVA 2PE8A 2U1AA 4NRUA 2AGQA 2XY6A 2XI3A 1TTHB 1S76D 3WX8A 1XR6A 5DLGA 4DXLA 1JLGA 2DHGA 5L1KA 1XNQJ 3DDIA 1FKOA 4H4OA 4LREA 2CQGA 4BC7A 4K5RA 4V19J 2WHOA 2RH3A 3KHLA 1FDNA 1XNRF 2K2PA 2YWKA 5F8NA 4WFZA 2HNYB 3PYFA 4YP3A 1HWJA 1LK5A 1IBCB 2GJ2A 2CG4A 1VYAA 3DN9A 4KRWA 5C7PA 3IWLA 3EYZA 1ZOTA 2V8VA 3ZTQA 2V2ZA 1RTJB 5I42B 1NHVA 2HNYA 2X1AA 3G71S 4M5GA 5HMWA 3NOCA 3EPGA 5I3QA 4QW8A 2PEBA 3AB4B 4DG1B 4PCQA 5HJYA 2EW9A 1RAOA 3I87A 3J7Z5 4N77A 3A8IA 1RTJA 5I42A 2BM0A 4ITSA 1YRUA 4ILLA 2FZCB 2HGMA 1JXLA 5KG4A 1SV5A 3DOKB 4MK8A 4DV3F 3FJ2A 4DG1A 3WIUA 5BYSA 4P73A 4K0KJ 1KQGB 2C2DA 3UPFA 1Y11A 4O23A 5GMKa 4RKUC 1DBDA 2PFFB 4EYIB 1X0PA 4B08A 1TFWA 4CLKA 4M5NA 4DR1F 1NH8A 5HATA 2G9OA 1BMQB 2RMLA 1VLYA 4NEZA 1VQNS 2JLGA 2QYCA 5LMNF 2HFNA 4DDFA 4ETZA 5CYMB 4Q8EA 4Q8FA 1GNKA 3BDEA 2P9EA 2KT2A 2LFVA 1MMDA 4UT4A 3PTWA 2CQCA 3QRRA 1RB0A 2GJIA 1FRIA 5CYMA 3NGDA 3IBWA 1FD2A 2N4DA 4ES2A 1GMUA 2ZBQA 1YJ7A 1B7YB 3IBFB 2VBYA 1X5OA 4DQSA 1YGYA 2KT5A 1PILA 3CIZA 4NA1A 1Y3JA 2IC3B 4WP3A 3O8WA 3LWLA 4ZDNA 3TP2A 1RWKB 4D3HA 4HI2A 4C3KA 1NJYA 2NSBA 2R7TA 3MOZA 3V6DB 2Q6CA 2KN4A 1VQLS 1KP6A 2OEJA 2IC3A 3LA0A 1Q0NA 3I56S 4DUZJ 5L1JA 2EC0A 4Q45A 1RAAB 2VPXB 2CVIA 3BREA 3GWCA 2W2OP 3V6DA 1F6TA 2CJYB 2OP5A 3SMZA 1UFKA 4C2MA 1FWLA 2YPYA 1SCJB 1LFPA 3D1HA 1SC3B 3BPDA 2HHVA 4PAAA 3A3NB 1YQHA 4J9MA 4WJBA 2ERRA 2CPJA 3MCMA 2JWNA 2BOPA 4B9VA 3NRBA 4JI4J 1CLFA 2XMKA 2RU3A 2J9EA 2CJQA 2H3EB 2M70A 1VBXA 5BR8F 1FRMA 4ECVA 2V50A 5CQGA 2R7RA 2BJ3A 4LFBJ 4C0BA 4CO5A 1JXVA 2RQ4A 1YK9A 5KFOA 2IFXA 3X3UA 3MR7A 1Z2LA 3W63A 2A0FB 4RBTA 3DOMA 4RBUA 5H1SV 4EK2A 1NK0A 1NO8A 4DX6A 1CEZA 1IWGA 4NLDA 1U6ZA 3D4JA 3OL8A 4DR3F 3PO5A 4RZRA 2PO4A 4M1KA 2W01A 4ED4A 3FMBA 3K5OA 2GFFA 1XMQJ 2VB6A 4CLLA 4CWBA 3KYLA 3NWGA 1LW2B 4RW7B 1TL5A 3CCRS 4KHPF 1B70B 3CCSS 4M5KA 4LRCA 4ZVEA 2E9RX 2ZC3A 1PJ7A 3VTIA 4OFZA 2XZDB 2UUBJ 4RUHA 2VQFJ 3BO3A 2AD9A 3GYGA 2MQPA 4XDDA 1LW2A 5E7OB 5HN0A 2R2UA 2Z4PA 2BE9B 3UN5A 2HYIB 5KFHA 1QTNB 4PWUA 1T9VA 5G0RA 1SQEA 3AH6A 5LSLA 2KXNB 3LWMA 5ETKA 3CCZA 4HT7A 3OSPA 3M30B 3W9JA 2MGZA 1UVKA 3GTYX 1K1SA 1B0TA 2W2MP 2YNHB 4P7TA 2VA3A 3IAS9 1CC7A 1IKWB 2E1RA 3KG4A 3EJMA 4EGLA 2M0GB 4P52A 4CH0S 1RTDB 4FNHA 5DLFA 2L08A 3EGWB 1E6VB 3H5SA 3BS9A 5CHCB 3M30A 2M8HA 1VQ7S 5HMYA 2FJEB 1IN0A 2YNHA 3M05A 1RWVB 2E29A 4IR1A 1HIYA 3UE2A 4LF9F 4P9SA 1R0CB 1RTDA 2R9LA 4ECUA 2V8GA 2ZJRQ 3IS9B 2J7KA 4HDHA 1AROP 5C25A 3I32A 4X4TA 4YHHF 1HR0F 4FP9A 5HLFB 3IS9A 4QWDA 2AWZA 4CI0B 4JI2F 2BM1A 1BHNA 2HHHJ 3JTOA 2VBZA 4DUYF 3E2EA 3VWSA 4WTOB 4K59A 1IQZA 3PIPQ 2YTCA 5HLFA 1U0HB 2LQ5A 1IR2A 2JLEA 4LVOP 2J0XA 1F5AA 4P2SA 3ZZPA 4F4YA 2GQQA 3ZTSA 1M90T 4D3GA 3UN3A 2QLBB 1OS5A 3UI3A 3JTPA 1N36F 3E8OA 2HBRB 2PGCA 1J5OA 2BA9A 5CH7B 1V6HA 2EC2A 3QO9A 3OSNA 2KVIA 4JI8J 4NCBA 1SPBP 3RB3A 2VIHA 2A10A 4KC5A 2FDNA 3DLBA 1QVGR 4QWEA 4U7CA 4B3TF 2DR5A 3QBCA 1E6YB 4DN9A 2B8PA 2FC9A 8RUCA 4LRFA 3PKYA 4BS2A 2WVCA 1TL7B 4RNMA 1UW4A 3O5TB 2RSQA 4NXMJ 3DMJA 2YY3A 3M2UB 1RT1B 2C3YA 4FPIA 3PACA 3CCVS 1E6YA 4TQSA 2JJ4D 3OR1B 1WF1A 3A1YG 3KHGA 3QGPA 1T02A 7AT1B 1UEKA 4WK1A 3I9V9 1TL7A 2V2VA 5IXUA 4ZN3A 3DCAA 2X3GA 1RT1A 1Q79A 1VJWA 3M6VA 2E5IA 3UCUP 4ZLNA 4WZQA 1ULRA 2MKCA 4CT9A 1ZAXA 2W4DA 3K17A 4I7FB 3C6TA 2H51B 1M1HA 2BKPA 3R5BA 4DR6J 2HHTA 2OPSB 4KFBB 2F5GA 1HI0P 5CXTA 2F65A 1NDKA 4NMLA 1RHJB 2DT9A 4WKRA 2K7KA 2HIQA 4I7FA 3WX4A 1FX2A 3HHLA 2DHAA 1ACMB 4IH5A 1NB7A 1I6JA 2OPSA 4KFBA 4NLSA 4EMDA 2VL1A 1URRA 1BE4A 4B9SA 1N52B 4QYZK 4UOGA 2HMIB 1PAEX 2J0WA 1Q8LA 1BLUA 1M5HA 2HBYB 4NX9A 3RW6A 4LF2A 3NGKA 3KLHB 3D67A 4XPEA 1SL0A 2HMIA 4C48A 2UU9F 1N8RT 4PWWA 1Y10A 4DR2F 1RKIA 2B3TB 2V4JA 3PRVA 3KLHA 1XBWA 4CCHA 3CJRA 1S6UA 3NLCA 2MJNA 3D6HB 2HG4A 5M2PA 5F8IA 2DGOA 4LT6A 4K4WA 5KG5A 5IT4A 4YOEA 3G6ES 2JOQA 3CCWA 6AT1B 2RUSA 4J91A 2H9ZA 3MPUB 3IWNC 1BWEA 3SBMA 3DRSB 4OHWA 1EX8A 3KK1A 2YBVA 2MZQA 2LYVA 3C66A 1RLDA 2B4PA 4P2MA 3NAIA 4J5OA 3VR1A 1BWVA 1NJWA 2PD1A 3TVKA 3BEGB 1SI9A 3FNNA 2HQFA 4AT1B 2Q79A 4WZMA 4PQAA 4IDKB 2YQ0A 3MTKA 3OUYA 3LAMA 4R0JA 5KFAA 5IT9Y 1FE0A 1U1MA 4K4VA 2B51A 2V9WA 2EPIA 1U26A 1G6BA 3IBCB 5M2RA 1S1TB 4JI1F 4IDKA 2VKZG 5EWEA 3IM8A 4ETXA 4WIIA 2MMYA 2LEPA 4Y2AA 1FDAA 5C42B 5T14A 4DV4F 1S1TA 4DFMA 1U1RA 9ATCB 1LNQA 3R3TA 1DRZA 2QSFA 2HIYA 4I64A 4J9RA 1JIHA 1N5YB 1NK6A 4M5HA 4B9TA 3QFHA 3C19A 3GB0A 5AJ3F 1FXRA 4DPUA 3IFEA 2G1HA 4YB7A 5C42A 1KVKA 1KQKA 2BBEA 3L3CA 1SJ4P 1RTZA 4C8ZA 2H4YB 1XNRJ 3D9BA 3I0SA 3AD7C 2L48A 1HW9A 2FY8A 4J90A 4U8VA 3VGVA 1WHVA 2V67A 4DSJA 2FVRA 2UXDF 2XM3A 3Q8VA 3RZAA 2FD2A 5AXNA 1M1GA 3M9OB 2F4FA 5HQ8A 4CLUA 3A12A 3ZO7A 4ELVA 4LF6F 3P5BP 1T11A 1NMEB 3EM1A 1MWZA 4CO4A 1UPPA 3TAMB 1H74A 3KK2B 1FRJA 3OTBA 1R8AA 4ZJQA 5CYQB 2ZKTA 2RIJA 1S59A 4HHHA 1T05B 3PW5A 2HRUA 3TAMA 2G0JA 2DR7A 2C3MA 4MKAA 3KK2A 3U1MA 1XJWB 5E3PA 3D5MA 3DRRB 2D3OR 1JLEB 4RX6A 3CIMA 2CQHA 2XCPA 4KO0B 1UETA 2XSJB 3OFEA 2QLXA 1T05A 2MPUA 1TK0A 3CW2C 1BC6A 2MXYA 4N5SA 2PMHA 2E7WA 3U7JA 4IG3B 3RB0A 3DRRA 1JLEA 4NLOA 1PYSB 3HHLD 4IOCQ 4F50A 3F41A 4J9PA 2RB7A 3NNHA 4J9LA 4IG3A 4GKKF 1I1GA 4EO6A 3B8HA 2DBBA 2K1RA 3GFZA 3G6YA 4N8NA 5J2QA 1JXEA 2VPWB 4A8XA 1WC0A 2XG8A 3B78A 1U6BA 1UVLA 1QE1B 1RBOB 2ASYA 1RT7B 4F67A 2AJ1A 3G8TA 4Q2MA 1REVB 2DGSA 3MEKA 4OYZA 2L3MA 4LQ9A 1FNMA 4DX8H 3H7HB 2O67A 1QE1A 3QAEA 1AUDA 2MDAA 4ID5B 4MTPA 4NLYA 2J9DA 2W7AA 4OLPA 1U1NA 1TK8A 1REVA 3DLJA 2CA9A 2FJDB 4DL2A 3VF0B 3CDBA 4M5IA 5LMUF 3AJ2A 1WDTA 2J7UA 2EVZA 4F0KA 4QIGA 4JV5F 2IJRA 1EP4B 3V81B 4ZLJA 4X65J 1KNZA 1P9YA 3GJTB 3VALA 3T5JA 1K0VA 1K8AT 4BWJA 2VC1A 4FXDA 4B9MA 2FPHX 2ZH8A 4RWXA 1KSPA 1D09B 3PXGa 4F4ZA 3TA2A 3M6UA 2RUGA 5F41A 1EP4A 3HT0A 5EWFA 3V81A 4LSZB 2XULA 1S9EB 3CDUA 1NH7A 2QMWA 2O5DA 3W7BA 1O0PA 4NXNF 1DQ9A 3QFWA 4OV6A 1H3DA 2Z30B 4NLUA 1S9EA 4CO3A 1YRXA 2X1GA 2VFUA 3MM9B 1YTYA 1GMWA 2A3JA 2LKZA 1I51B 4USJC 3KLEA 2C3OA 4X66F 4FYYB 3IG1B 3EMTA 1C4AA 4FVCA 3ENAA 2DH9A 4QZVB 2XO7A 5CZVA 2WZ1A 3AJDA 2ROEA 3T5KA 5GAEI 3MM9A 4RBVA 2V34A 3QMQA 1FXDA 1YZ6A 2CJ9A 2DPIA 3BV8A 1V5VA 3IG1A 4K8RA 3QJJA 4IUFA 4DPXA 2F63A 2UXCF 3K89A 3HZGA 2DGTA 3BQ2A 4ECTA 4DOZA 1Q4RA 2R8KA 2OFGX 4AXJA 2PA8D 1TL3B 1XEZA 3DRPB 3MAHA 4BDPA 2H48B 3BKUA 3N6MA 4PG5A 2HVZA 3FRYA 3LP0B 3EE3A 1WEZA 1FRLA 3MFHA 1DY3A 3MMBA 4DV0J 2RHQB 1IM6A 2RT3A 1YBAA 1Q81T 1TL3A 4HEA9 4LF5J 3DRPA 5IC6B 2VG5B 2CG8A 2HVDA 2W2NP 3F44A 2CQ1A 3GYNA 2D69A 2D7SA 5B0CA 3LP0A 1T9WA 3ULHA 3J7YU 1Q95G 4P71A 1J5EF 2QA1A 2IRXA 5DO2A 4DV2F 3PJXA 1XIQA 3SCLE 1C2PA 3C16B 4HHUA 1UVIA 1RT4B 1K73T 1O8BA 2FLOA 2VG5A 4ZP6A 4EZ9A 3PEHA 2IM0A 1HKAA 1FJGJ 3PYEA 4P6QA 4ZVTB 1R8HA 2CWXA 3T1HJ 4LF4F 2DHSA 5B09A 1W7WA 4ZPBA 1RT4A 1XQIA 2J0SD 3D6MB 1NDLA 4OI6A 2V94A 1HBUB 4DFKA 2GMJA 3ZZRA 4ED1A 1IQTA 5ETSA 1I94F 2CNLB 4I2QB 3HK2A 4MT1A 4ECWA 5KFBA 4Y00A 3DGPB 5DM7Q 2XMTA 4UUXA 1HBUA 2GQ2A 4AE5A 3S1TA 2RQMA 1WI6A 3LANA 2QLJB 3KJVB 1ZAWA 1XERA 5KG0A 1HR0J 1D9FA 2IMOA 3T3FA 1GT8A 4I2QA 3CDEA 2G4BA 3DGPA 1X8DA 3HVRA 3HF5A 2FJWA 3SDEB 4B9NA 3IMQJ 2B7CB 4IO9Q 3H59A 3DXBA 4HR2A 3KJVA 2VPYB 2AW0A 1HBOB 1Y4ZB 3SDEA 2EG2A 4KAIA 2GAHC 3PYGA 3P49B 1HBOA 3A3PB 4KR0B 5DDQC 2JX2A 2FJVA 2GIFA 1NU4A 2QFIA 2LCWA 3LH2S 3IP0A 2ZE2A 2ATCB 3HFZB 2XYPB 3DLGB 1N32F 4DU8A 2CPYA 4Z2XA 5LL6d 1PC5A 3BYRA 4ZVHA 2MQMA 1YSJA 1RSCA 2XZWA 2W24A 4UOCA 4WU3A 3SCIE 3HSDA 2W2PP 3EVMA 2DO0A 2ZC4A 1N5VA 2MHEA 3DLGA 4U7UD 2HFZA 1EETB 2VASA 4RNNA 1F5BA 1SB6A 1F3FA 3ILIA 3ZNUA 2OPPB 1S99A 4F25A 4OZ1A 2BJDA 1M0SA 5ETMA 2NXJA 3RYLA 3W64A 3C6UB 1EETA 2R8HA 2ZH1A 3N01A 1VIOA 3EGNA 5ETTA 1SJFA 1FFWB 3R9LA 2YKQA 2K3KA 3QGHA 1MROA 4MAKA 3LOUA 4DSLA 2HAIA 5KFJA 2N3OA 3BSAA 3C6UA 3UCZP 4IFYB 2H1YA 4NE9C 2Y1LB 5KFGA 2AZ3A 4IH7A 1D9DA 3G9CA 4EEYA 1HQUB 1S6QA 4IYQA 4YEAA 4ZOSA 1L3UA 1Y00A 4IFYA 4K5SA 3OR2B 2AYGA 1JLAB 2NPIA 5FD1A 5J2PB 2XY7A 2J8SA 2QRRA 1RP5A 1HQUA 3RUBL 3TZWA 5A0YB 8ATCB 3DOLB 2RVJA 3O3LA 5C2CA 4ILMA 2WCXA 1UEVA 5IQQA 3T1YJ 4QPTA 3MR2A 2M5YA 4DBQA 2B4OA 3OR2A 2VOOA 2CWKA 1S1UA 2VG6B 5J2PA 2F4VJ 1TKXB 1P1TA 2BQUA 1V3SA 2X3DA 2CQ2A 4DF8A 5A0YA 3ZZYA 2ZOGA 3DOLA 3AOBA 3R6LB 1FRKA 1LK7A 1RXOB 4TVAB 1GXUA 2VG6A 1UWAA 5HI7A 3DU5A 4B3RJ 1TKXA 4LF7F 2BANB 2UU9J 2KRBA 3MAAB 4W98A 3PO4A 1IJEB 4I0WA 1SJQA 3AD8C 3QT6A 5CD4H 1MU2B 1HQEB 3W3SA 3MM5B 3CJ5A 1HYSA 2Y1RI 3G6XA 3BGFA 2C2KB 4BC9A 4YY3F 4GKJF 3OFHA 2FHJA 3QQCD 3HO1A 2BANA 1VJQA 3MAAA 4XIUA 2LEAA 5LOQA 4A8FA 3DRYA 3KJQB 4LR9A 3AXMA 1CS4A 2HWHA 2J6SA 3M9NB 1MU2A 5ETNA 1HQEA 1S6OA 3KDNA 4AFFA 2PFDA 3WBZA 2XYGB 4FF4A 3FBFA 3HFVA 3H2UB 1ZAVA 5HP1B 4ZVSB 3RAXA 2G2OA 3KDOA 4YB6A 2MZJA 2P2CB 3PJ9A 5D6GA
chains in the Genus database with same CATH topology
2F4VJ 4LFAJ 1HNZJ 5LM7E 4B3TJ 3IMQJ 5IWAJ 2UUAJ 4B3MJ 4NEZA 5BR8J 4HHUA 1HNWJ 1HNXJ 4JI6J 4DV7J 3R2DJ 5AJ3J 4JI7J 2KL8A 4YHHJ 1N33J 4NXNJ 1XMOJ 1FJGJ 4JI2J 3W1YC 4DV6J 5FLXU 3JAMU 4PWWA 4LFCJ 4B3RJ 4DUYJ 4LF8J 3T1HJ 4NEYA 4DV1J 4X65J 2UU9J 1IBMJ 4DR1J 1XMQJ 1IBKJ 1J5EJ 4JYAJ 4DV2J 2UUCJ 4KY3A 4B3SJ 2MTLA 4X66J 5LMNJ 5A2QU 5LMUJ 4JI5J 3OTOJ 4JI8J 4DR6J 2VQEJ 3J81U 4X62J 4JI4J 2UXDJ 3R2CJ 4DR3J 1XNQJ 3J80U 4DR7J 2UUBJ 4JV5J 2MEWA 4KYZA 3J7AN 2VQFJ 4DR4J 4LF7J 4DR5J 1N34J 4LF4J 4JI0J 4JI1J 2E5LJ 4DR2J 4K0KJ 4GKKJ 1N36J 2ZM6J 4V1Ak 4AQYJ 4LF6J 2KVQE 4RJVA 4LF9J 4OX9J 5IT9U 4DV0J 4KHPJ 2UXCJ 4LFBJ 2UXBJ 3D3BJ 3D3CJ 1IBLJ 4JI3J 4LF5J 2HHHJ 4YY3J 1HR0J 4GKJJ 3T1YJ 4DUZJ 2MQ8A 4X64J 4DV3J 4DV4J 4NXMJ 1N32J 1I94J 4DV5J 1XNRJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V J;  4LFA J;  1HNZ J;  5LM7 E;  4B3T J;  3IMQ J;  5IWA J;  2UUA J;  4B3M J;  4NEZ A;  5BR8 J;  4HHU A;  1HNW J;  1HNX J;  4JI6 J;  4DV7 J;  3R2D J;  5AJ3 J;  4JI7 J;  2KL8 A;  4YHH J;  1N33 J;  4NXN J;  1XMO J;  1FJG J;  4JI2 J;  3W1Y C;  4DV6 J;  5FLX U;  3JAM U;  4PWW A;  4LFC J;  4B3R J;  4DUY J;  4LF8 J;  3T1H J;  4NEY A;  4DV1 J;  4X65 J;  2UU9 J;  1IBM J;  4DR1 J;  1XMQ J;  1IBK J;  1J5E J;  4JYA J;  4DV2 J;  2UUC J;  4KY3 A;  4B3S J;  2MTL A;  4X66 J;  5LMN J;  5A2Q U;  5LMU J;  4JI5 J;  3OTO J;  4JI8 J;  4DR6 J;  2VQE J;  3J81 U;  4X62 J;  4JI4 J;  2UXD J;  3R2C J;  4DR3 J;  1XNQ J;  3J80 U;  4DR7 J;  2UUB J;  4JV5 J;  2MEW A;  4KYZ A;  3J7A N;  2VQF J;  4DR4 J;  4LF7 J;  4DR5 J;  1N34 J;  4LF4 J;  4JI0 J;  4JI1 J;  2E5L J;  4DR2 J;  4K0K J;  4GKK J;  1N36 J;  2ZM6 J;  4V1A k;  4AQY J;  4LF6 J;  2KVQ E;  4RJV A;  4LF9 J;  4OX9 J;  5IT9 U;  4DV0 J;  4KHP J;  2UXC J;  4LFB J;  2UXB J;  3D3B J;  3D3C J;  1IBL J;  4JI3 J;  4LF5 J;  2HHH J;  4YY3 J;  1HR0 J;  4GKJ J;  3T1Y J;  4DUZ J;  2MQ8 A;  4X64 J;  4DV3 J;  4DV4 J;  4NXM J;  1N32 J;  1I94 J;  4DV5 J;  1XNR J; 
#chains in the Genus database with same CATH topology
 4J9O A;  4LFA J;  4LRB A;  2D9P A;  1H7W A;  1F2G A;  1HNX J;  2XNR A;  1DQ8 A;  5HP1 A;  4IH6 A;  3IA0 A;  2LLZ A;  1XC9 A;  1FDB A;  1XNQ F;  2HZC A;  3J80 Y;  5MLC V;  4URG A;  3BZQ A;  5SZT A;  1RAE B;  3OHA A;  4ANC A;  1W2B R;  1UP1 A;  1R0B G;  2NXC A;  2VKR A;  7FD1 A;  3KMS A;  4RR5 A;  1F60 B;  2N82 B;  4HKQ A;  1LWC A;  2WSE C;  1NK5 A;  5DGB A;  4KY3 A;  4B3S J;  4NA2 A;  4CZC A;  4Q43 A;  2Q43 A;  3J80 U;  5JVH Q;  3A3O B;  1Y5N B;  1IKX B;  4DR5 J;  3ZZO A;  4CQ1 A;  1FNX H;  4TYA A;  3M7V A;  1YJU A;  5F3Z A;  2WAQ D;  3AT1 B;  2BRL A;  2XBP A;  3GV7 B;  3V5R A;  2KI2 A;  2VUG A;  5D77 A;  2P6T A;  2CZ4 A;  4URS A;  3LF0 A;  1TKZ B;  3ENV A;  4KQZ A;  1IKX A;  1SH0 A;  2DXF A;  1QSS A;  2HHU A;  3MM8 B;  1VDH A;  3RAQ A;  2J6T A;  1NKE A;  4C11 A;  5B08 A;  2ROG A;  1NJZ A;  4LJM A;  1KHV A;  3V4M A;  1U25 A;  4O0N A;  5BYR A;  3MM8 A;  4DV6 J;  1YHQ S;  4LFC J;  3D0H E;  3VAH A;  1I3O B;  2E44 A;  3V6J A;  4K0K F;  2E66 A;  4OHY A;  1F9H A;  3D2W A;  4RO0 A;  2CPI A;  3QIP A;  3IR7 B;  2IBO A;  4QJV A;  3KJN B;  3CWJ A;  4TU7 A;  2EBG A;  3OTO J;  1OSD A;  4F2S A;  5F8M A;  4I69 A;  3E51 A;  3HJF A;  2B5J A;  4JOU A;  3TJ8 A;  1H38 A;  1DFD A;  3HUL A;  2DH7 A;  5KOX A;  4CYU B;  2KHD A;  3BBC A;  1ZM2 A;  3ILJ A;  3EGV A;  2DXD A;  3PX4 A;  2QA2 A;  5J1E A;  1X4B A;  3CCE S;  2MZS A;  2FY1 A;  2RE1 A;  3PG9 A;  1REG X;  4CYU A;  4O3S A;  3OPK A;  1RAG B;  1WUU A;  3BN7 A;  1R0A B;  3I6P A;  2ZJQ Q;  4OX8 A;  3MOJ B;  3MXH P;  5DDR C;  4NZ6 A;  3H98 A;  2L41 A;  2DIS A;  3C14 A;  4F04 B;  1UA0 A;  4X2B A;  4PWD A;  2BRK A;  2AX1 A;  4LF8 J;  2MY8 A;  1RUS A;  1DZ5 A;  1WI8 A;  1U8S A;  2XS5 A;  3W62 A;  2C2O B;  4ALZ A;  4F2R A;  3HZE A;  3FSY A;  3RGI A;  3VAI A;  1YI2 S;  3T6B A;  2RDI A;  3DLL Q;  4DUZ F;  1JQG A;  2AJ0 A;  4MMO A;  1GAO A;  5KFE A;  4PXE A;  2LXI A;  2WVD A;  2RU9 A;  4O3Q A;  2ZUA A;  2DNM A;  4OHV A;  1YJR A;  4HTI A;  5HO4 A;  3N6N A;  4ECZ A;  3DYA B;  1YJW S;  3NMR A;  2ZDO A;  3SV3 A;  3FBC A;  2W9C A;  2IRY A;  2E7X A;  1SH2 A;  2RDD A;  1Y7P A;  1RWX B;  2MQL A;  4UUW A;  2VBX A;  2XEX A;  7FDR A;  5DS7 A;  2CQ3 A;  4RPF A;  3DYA A;  3D6T B;  1WSV A;  5IZH A;  4NAS A;  3QJP A;  2FHJ D;  4RUB A;  1F9E B;  3Q8Q B;  1UVN A;  3KLV A;  2KM8 B;  1UPM B;  3BGO P;  4JI4 F;  4PRF A;  2Y8Y A;  4CRJ A;  4Q0B A;  3ZNJ 1;  2XQC A;  3G4S S;  5LXR A;  2BJ7 A;  4LBH A;  2DNO A;  5C24 B;  2CJK A;  3CUL A;  1WD6 A;  2XMU A;  2FHK A;  1Q82 T;  2VBW A;  4PYA A;  2ILZ A;  2MTL A;  4LFB F;  1FVS A;  3JYT B;  5C24 A;  3CCQ S;  2HWT A;  4NYO A;  4PG7 A;  2ZBR A;  4HI1 A;  4ZK7 M;  3C2P A;  1CJU B;  1FWK A;  3H8Y A;  1NND A;  3TAP A;  2CPH A;  4Y2K A;  4OI0 A;  4ANE A;  3PV8 A;  1P27 B;  1FKP B;  2MB0 B;  1OIA A;  3FCH A;  1UA1 A;  3CJ4 A;  1CG2 A;  3BGR B;  4LSN B;  3TA1 A;  3M8Z A;  2GHV C;  4M8L A;  1RWM B;  3GJR B;  1VIS A;  1S1W A;  3B4M A;  1FKP A;  2YVS A;  4TLQ A;  1LW0 A;  4USU A;  1XMQ F;  2MZ1 A;  2MY7 A;  2VOD A;  5K8N A;  4A8Y A;  4LSN A;  3HHN B;  5D8H B;  5IWA J;  2XS7 A;  4B3M J;  3PM9 A;  1S10 A;  2GA7 A;  3TWZ A;  2UUB F;  3FZB A;  2VQF F;  1RE1 B;  1NSK L;  4CM0 A;  2J5A A;  2FJB B;  2YXL A;  3W60 A;  4CTA B;  1AXQ A;  1FT8 A;  1TEL A;  1BD6 A;  1WJ9 A;  1IBM J;  1TL1 B;  2KU7 A;  3IGV A;  2DRA A;  3S8S A;  1EAR A;  1VQ6 S;  1KQF B;  3GIL A;  4C0H A;  2CQ4 A;  3CCJ S;  2OEL A;  2YKP A;  4F4X A;  1XMB A;  4KB7 A;  2LU2 A;  4CTA A;  4OZ3 A;  2I8E A;  1NK7 A;  2IVM A;  4M94 A;  1OQ3 A;  1JNR B;  3THT A;  1KBR A;  4YB1 P;  4Y0F A;  1TL1 A;  4OQJ A;  2W25 A;  3R1H A;  3CD6 S;  1RHM B;  1KOO A;  4M5D B;  1XR7 A;  4N41 A;  3I5B A;  2GVD B;  3GPA A;  1CQN A;  2KHC A;  1HAR A;  4FF2 A;  4A46 A;  1X9W A;  4FS2 A;  3KUE A;  1SJ3 P;  1N33 F;  4M5D A;  1YLX A;  3NOG A;  4F7V A;  1RU2 A;  2VF3 A;  3H5X A;  3S01 A;  2GVD A;  5JVG Q;  1XMO J;  4MK7 A;  1S1X B;  3HXM A;  5B0D A;  2DGW A;  1RCO B;  2M88 A;  2JEI A;  2AEJ A;  3FC9 A;  2AP6 A;  2AIR B;  4PEO A;  3IRX A;  3QT8 A;  1XK8 A;  1N6Q B;  1X4F A;  2E9Z A;  3EXC X;  1RAI B;  1VRU A;  1LFW A;  2HHH F;  4LMZ A;  1G7C B;  1VQ8 S;  2LXU A;  3SCJ E;  3MCO A;  2LU1 A;  1UFW A;  1KWM A;  1G1X A;  1FK9 B;  2RDJ A;  3DM2 B;  2YWG A;  3GIR A;  4FYW B;  3X1L B;  3SYZ A;  4OV1 A;  2ASD A;  1N6Q A;  4ZHR B;  2A6M A;  3LGN A;  2OSR A;  4MIA A;  2NXE A;  1JNZ B;  1VQS A;  1RDR A;  2UUT A;  2KVQ E;  3RU0 A;  4JV2 A;  3D1O A;  1FK9 A;  4FF1 A;  5KT6 A;  4I6W A;  3DM2 A;  3QZ7 A;  3MCN A;  4TY8 B;  4ZHR A;  1FF2 A;  2E5H A;  4QQB A;  1RT5 B;  1QAI A;  3OHB A;  4WYL A;  2KFZ A;  2UVU A;  3HHE A;  4JI8 F;  1NPK A;  4NI2 B;  2OI2 A;  4GRS A;  2X1B A;  3J81 Y;  1C4C A;  3TJ9 A;  4GO7 X;  4ED7 A;  5F9L A;  3GON A;  1HPZ B;  4TY8 A;  1VOM A;  2D3Z A;  1RT5 A;  2Q6B A;  3PEJ A;  2KH9 A;  3VAF A;  4ES3 A;  3OXF A;  1WOR A;  1FVQ A;  4FXW A;  2EG1 A;  2XLI A;  4AD6 A;  5J2N A;  4L3K A;  5KG2 A;  1HPZ A;  1GTH A;  3J81 U;  1TKT A;  4CNY A;  3W8G A;  1UVJ A;  4NXM F;  2K7J A;  4DR7 J;  2CPE A;  2MEW A;  1Q86 T;  2OPQ B;  4P7V A;  3FFI B;  1WHX A;  4ZCI A;  2P9C A;  1U0S A;  2G2Y A;  1VK3 A;  2EEY A;  4UZC A;  5E2Q A;  2ZEJ A;  1OPZ A;  2EK1 A;  6FDR A;  5A76 A;  3HHK A;  1U09 A;  4LUB A;  3RBE A;  2B4U A;  3ETO A;  2OPQ A;  3FFI A;  1CJT B;  3VGT A;  1UEU A;  3OTE A;  2C2M B;  4WFB Q;  1NSA A;  1XN9 A;  2VPZ B;  1YVF A;  1T9U A;  4DR6 F;  2WB4 A;  1AFJ A;  4ECS A;  1CJT A;  2HK2 A;  3TI0 A;  3VHQ A;  5T7L A;  2OKQ A;  4PG6 A;  2N4C A;  5J1N A;  2DGU A;  2H4W B;  3AFG A;  4P72 A;  4WXW A;  4ED5 A;  2FZK B;  3OL7 A;  3W2V B;  2YWH A;  5J2M B;  3MUM P;  2EFQ A;  3G82 B;  2IYI A;  1ICE B;  5GAD U;  2GIQ A;  2YKM A;  2E1P A;  4O44 B;  3H0P A;  2O3D A;  4BHQ A;  1N0U A;  1U2F A;  3QLH A;  2KKH A;  3W2V A;  5J2M A;  3VQS A;  2EK6 A;  2F9D A;  5D0G A;  1PBA A;  4ED0 A;  4IRD A;  4LBP A;  3G82 A;  3S7R A;  1P6T A;  1FHT A;  4O3P A;  3VAK A;  3ISN C;  1HNI B;  1VR6 A;  4O44 A;  4UZB A;  1KLN A;  1K47 A;  5F8L A;  2VJV A;  3ADA C;  2CKW A;  4OZL A;  3ZZT A;  3GE9 A;  3H20 A;  1WC5 A;  3MPV A;  3GIK A;  3PFE A;  4JV0 A;  2LEC A;  1YX2 A;  4USW A;  1EIY B;  1HNI A;  3L09 A;  5MAO A;  5T41 A;  1ZM9 A;  4QR1 A;  3ITH B;  3W1Y C;  4WFA Q;  4IQX A;  3VAG A;  2UUW A;  1X4E A;  1GXL A;  3DGV A;  1NK9 A;  3SSQ A;  1U1L A;  3EIC A;  2MKI A;  1JLC B;  2DYA A;  2WOM A;  4OJG A;  2CPF A;  4OYM A;  1Y5L B;  3R5J B;  3RW7 A;  1DLO B;  4KTQ A;  3ITH A;  2CIM A;  4RW4 B;  1HLW A;  5GAD I;  1UKU A;  3HT3 A;  2D74 B;  1Q16 B;  3V4I B;  2KJW A;  4YDX A;  1ZET A;  5F3T A;  2XI2 A;  4USI A;  2Z2Z A;  3E01 B;  1JLC A;  2NS1 B;  2UVR A;  1QAY A;  3UD5 A;  1DLO A;  2PN6 A;  2QLF B;  5KFC A;  4N56 A;  2JLF A;  3BR8 A;  2IPO B;  3V4I A;  4KJI A;  2YKA A;  3BYP A;  4R5P B;  5L1I A;  3K7R A;  4ES1 A;  3H25 A;  3OTD A;  1YIT S;  3H90 A;  5A8K A;  3KHR A;  1NK8 A;  3F56 A;  2CFX A;  4DV5 J;  3BR9 A;  4YR3 A;  3IGN A;  5LM7 E;  2BV3 A;  5D0H A;  3N0V A;  2GJF A;  1ZA2 B;  4R5P A;  1FKO B;  4V19 X;  4NLV A;  2E7V A;  4JI6 J;  4BBY A;  4H4O B;  2KXH A;  4N7T A;  3NCR A;  5LSR A;  1RWU A;  1TVR B;  1YZ7 A;  2BMB A;  3TAR A;  3SQO P;  2WBM A;  2Z56 B;  4AUK A;  4ZP7 A;  5G4D A;  2HFO A;  2OSQ A;  2V2Q A;  4Y2M A;  3U1L A;  1TVR A;  3H4D A;  3GFY A;  2CNK B;  5E3A A;  2IM1 A;  2XLJ A;  1ZM4 A;  1LWE B;  2JC0 A;  4U96 A;  3FUY A;  3K5N A;  4JI0 J;  2E5L J;  4K2J A;  4DLG A;  2V2K A;  1KN6 A;  2N3L A;  3ILO A;  2DR6 A;  1RKJ A;  5BXI A;  1UJ5 A;  5BYQ A;  1LWE A;  4UQT A;  4QBU A;  1HL6 A;  3MEG B;  4ZJO A;  3CPW R;  2BDP A;  3ONQ A;  2AQ4 A;  1QDU B;  3D0I E;  1SV5 B;  1N5Q A;  4NMX A;  2RRB A;  2W7O A;  4HL9 A;  2QT7 A;  3EZU A;  1TP7 A;  3MEG A;  4P74 A;  2KFY A;  4A47 A;  4NCA A;  3MEC A;  4ECQ A;  3LP1 A;  2V4Q A;  2ADB A;  3EVO A;  4MH8 A;  4Y65 A;  2DNZ A;  1H2V Z;  1U48 A;  4DQP A;  2VDI A;  5I3U B;  1YIJ S;  2A1B A;  2CJX B;  3QWP A;  4J9V A;  2FYX A;  3AB2 B;  1X31 C;  4ZP9 A;  3D68 A;  1NSQ A;  2GGP B;  1XR5 A;  1QY7 A;  3HKZ D;  1RAJ A;  5I3U A;  5L46 A;  3Q24 A;  2R8I A;  1MNE A;  1WKK A;  1IR1 A;  2JDJ A;  2GGP A;  1UAW A;  3I9Z A;  1EKR A;  4TN2 A;  4DLE A;  2ZNY A;  3Q23 A;  1ROF A;  3TEG A;  4CLS A;  1WOO A;  2CPD A;  4FYV B;  3JSM A;  4KBI A;  2POK A;  1NZA A;  1R6V A;  1TKD A;  1NLK L;  2WB1 D;  1W2I A;  1PSD A;  2XC9 A;  4J9Q A;  4B9U A;  2RHS B;  4EZ6 A;  4C8L A;  4PXD A;  4WPA A;  3PW2 A;  3TUJ C;  1OQ6 A;  2R8J A;  3MPD A;  1S0O A;  2HGN A;  1VBZ A;  2V9K A;  3D6F B;  5FDL B;  2HW3 A;  3BKT A;  3QRQ A;  3BPS P;  3CMA S;  1L3K A;  2B56 A;  1IJF B;  2YX1 A;  5K5M A;  1HFE L;  2ZH6 A;  2MJU A;  1G3O A;  1YRT A;  3OXG A;  1TMJ A;  5FDL A;  2PI5 A;  2XS2 A;  3GG1 A;  1YDL A;  2OPR A;  5DDO C;  2LQB A;  3CC2 S;  1EJ7 L;  2COL A;  2XO6 A;  2VFR A;  3BSO A;  3R6G B;  2BZ2 A;  2ZWP A;  2AJQ A;  5KG6 A;  5HRO B;  4ZPA A;  3JAM Y;  4X64 J;  1RCX B;  4NYP A;  2Y0S D;  2QA4 G;  4X65 F;  1SJR A;  2U2F A;  3UQS A;  2KB2 A;  1RTH A;  4NPO A;  1SUQ A;  3DXS X;  2HPU A;  4Z7C A;  5HRO A;  1YJ9 S;  3M2V B;  2DKO B;  4Q5V A;  2G0I A;  1YKW A;  3FCW A;  5KFR A;  3JAM U;  3PW4 A;  4ERD A;  2XMA A;  5HSP A;  2VOP A;  4ZVR B;  3PZP A;  1LEO A;  2CJB A;  3M2V A;  2HLT A;  2DTJ A;  3OV7 A;  3OD2 A;  3T5L A;  4M5M A;  3DOM B;  4OZJ A;  4F8R A;  5KG3 A;  1J2V A;  2QL5 B;  1T0T V;  2Z2M A;  1KTV A;  3TUZ C;  3TR5 A;  1RAC B;  3M8S A;  4IRC A;  2I1R A;  2OEM A;  3SFU A;  5ETV A;  1P8G A;  1KS2 A;  2GX8 A;  2LDI A;  2J6U A;  5KFV A;  2R7O A;  3D7S B;  3KUH A;  2B9E A;  3PJW A;  1VBK A;  2IJF A;  1FJE B;  2HS3 A;  1HHQ A;  3CJ3 A;  5FII A;  3CDA A;  4J9K A;  1K1Q A;  4U67 Q;  4CP5 A;  2JVO A;  4DSI A;  5A8W B;  3H5Y A;  5KG1 A;  4O3N A;  4QWA A;  1KRP A;  3A8J A;  3GJS B;  1UWB B;  3TAN A;  3NKY A;  2MST A;  4RNF A;  2WVB A;  1RT2 B;  4MK9 A;  4P10 A;  2ZH5 A;  4DL7 A;  3LP2 B;  5A8W A;  1LKZ A;  2VH7 A;  4DWI A;  4PYD A;  2G0C A;  1UWB A;  1RU1 A;  2KJV A;  5G0R B;  4GVB A;  3VGU A;  3WIV A;  3T6J A;  3POT B;  4DV0 F;  2F40 A;  2MGZ B;  1RT2 A;  2DGV A;  1NBE B;  2AKW B;  4I56 A;  1HWU A;  2FIU A;  4LF5 F;  2KG1 A;  2YKN B;  4QIV A;  3LP2 A;  2NLW A;  2Z2Y B;  2HGL A;  3MCS A;  3HDS A;  4GC6 A;  1R43 A;  2KYX A;  4C4W A;  2W8K A;  1KQS R;  3GU0 A;  4RWW A;  5KFX A;  4MIB A;  3POT A;  2BJE A;  3GFX A;  2H5I B;  1JJC B;  2YKN A;  1HHT P;  2VFV A;  1FJG F;  1VQ4 S;  5GME A;  1WTF A;  1TZ0 A;  3T1H F;  4WYW A;  4Y28 C;  1S9F A;  2E5G A;  4B9L A;  1IUJ A;  3HI9 A;  2MQQ A;  4U9R A;  1N5T A;  4DHV A;  2Y1J A;  2RKI B;  2DR9 A;  5C25 B;  1TUG B;  5KFT A;  1N33 J;  4CLF A;  3DU6 A;  2JZ5 A;  3MPW A;  3T19 A;  1S48 A;  1JWW A;  3LAK A;  3PHE A;  2RKI A;  4WFY A;  3IN5 A;  2GS8 A;  4EYH B;  1PG5 B;  5IV3 A;  1DUR A;  3GQC A;  4RW8 B;  3LQV A;  4E0D A;  4MYT A;  1NHK L;  4DSK A;  2M3D A;  3KNA A;  4H4K C;  4O0I A;  2MKK A;  3UN2 A;  1KLM A;  3MUV P;  2ZJP Q;  2APO A;  4A48 A;  4P2X A;  3K57 A;  2IAJ B;  1N34 J;  5CD4 A;  3NMA A;  3HFK A;  3EX7 B;  1L3S A;  4OYP A;  3KG0 A;  4RW8 A;  4PR6 A;  2ZHB A;  2WW8 A;  4Y2C A;  4DCO B;  3G8S A;  5J1P A;  1JMT A;  3V6H A;  1ZYQ A;  1J5O B;  4IO1 A;  4HT5 A;  1C0U A;  2IAJ A;  5B7W A;  3QO9 B;  2NPF A;  4DZ6 A;  2I9S A;  1HNZ J;  4PG4 A;  3OFF A;  4USH A;  2WSF C;  4DCP B;  2CVE A;  1KR4 A;  3R7S B;  4OYW A;  3V6K A;  4PUO A;  2BJ9 A;  4WE1 B;  2HLU A;  2ZH4 A;  1WOS A;  2GAG C;  4KH1 B;  4OI1 A;  2VZ9 A;  3LUY A;  2O66 A;  1BQN A;  2B8Q A;  3AY0 A;  3CNQ P;  4MFB A;  4WE1 A;  3DMJ B;  4LF1 A;  3KFW X;  3TYT A;  2WSC C;  4M5J A;  3OVS A;  1DTT A;  2VHG A;  4F3Q A;  1OYE A;  3VAM A;  4YR0 A;  3VZH A;  3DLE B;  1H6K X;  2MQN A;  2FZG B;  5IQ6 A;  2QLW A;  4OHZ A;  3EPI A;  4AL5 A;  3BGU A;  3DFE A;  1OMS A;  5K8O A;  3PX0 A;  4IQM A;  3DLE A;  5JXS A;  3C6T B;  1TUW A;  3GV5 B;  2F9J A;  4OYB A;  4DS4 A;  3UNY A;  1U7L A;  2DNP A;  3FSX A;  2YX4 A;  3TX8 A;  1A7G E;  5IFM A;  1MN7 A;  2AU0 A;  1SKR A;  3FRZ A;  3LPE A;  1S12 A;  2ZH7 A;  4AYB D;  2OIH A;  3HHL B;  1FTR A;  2E1A A;  2ZH2 A;  3C8Y A;  2RD5 C;  2C2N A;  2H65 B;  4JBC A;  2JFD A;  2RF2 B;  3Q86 A;  1S79 A;  2LDY A;  5DRK A;  2SXL A;  3CF5 Q;  3FCV A;  3HP6 A;  4QR0 A;  5D3G B;  3T1Y F;  1WF0 A;  1WHW A;  2JEF A;  2RF2 A;  2F4V F;  1ZA1 B;  2F1F A;  3I4H X;  4CDI A;  5D3G A;  4OX9 J;  1M5K C;  2EKY A;  3KWM A;  2QFJ A;  2V4J B;  2C28 A;  2P6S A;  4B3R F;  2FLN A;  1PYT A;  1JJ4 A;  1GMV A;  4ZVQ B;  4YME A;  2HAF A;  2NSC A;  4FKX A;  2ZFH A;  1G2E A;  1ZH5 A;  2GC8 A;  3TX0 A;  3WC2 A;  1QUV A;  1ZPV A;  2CNN B;  4E2F B;  2QTW A;  1IXK A;  1N56 A;  2V5H G;  2MLX A;  1T8E A;  5EHH A;  3CUN A;  3TZZ A;  2CYY A;  3QT5 A;  3R7N B;  3KK1 B;  4MKB A;  3QGG A;  4XK8 C;  3MWB A;  2Y8W A;  3UD3 P;  2Q66 A;  3NAH A;  1HBM B;  3FK4 A;  3M8Q B;  4JI5 F;  2B4V A;  4JYA J;  1V3R A;  3HSJ A;  3JSR A;  3QGI A;  3JSB A;  5ETR A;  2R7V A;  3NEK A;  5K14 B;  4FYD A;  1WAC A;  3OUY B;  2DD8 S;  1HBM A;  5HAN A;  3M8Q A;  3HSZ A;  3N79 A;  3FZ2 A;  4LFA F;  5B0F A;  2UZA A;  1N54 B;  1HNX F;  4C98 A;  1U1O A;  2ADC A;  5L1L A;  5K14 A;  3M8P B;  3W5X A;  1VQ9 S;  4DL5 A;  3D3B J;  3M6W A;  4UOH A;  2YNF A;  2LEB A;  3CVK A;  3IXQ A;  1G4C A;  4JV1 A;  3CJ8 A;  1BXN A;  1M5O C;  3M8P A;  3K5P A;  4O3R A;  4B3S F;  2GMH A;  3ELH A;  1HQ2 A;  1B3T A;  1A9N B;  3T41 A;  3CGI A;  4ZIW A;  3L95 X;  5DJB A;  2EFN A;  5KT2 A;  4DR5 F;  2HUR A;  1X4D A;  4NZ7 A;  1TFY A;  1IBK J;  1NHU A;  1VQM S;  1RK8 A;  3ET6 A;  3CJS A;  3I0S B;  2CQP A;  1S9G B;  3KG1 A;  1FKA F;  2JNJ A;  2K8G A;  5F0W A;  3LW5 C;  1NK4 A;  5F8H A;  3NY0 A;  4HHJ A;  2UV8 A;  1S9G A;  2EKN A;  3GZ7 A;  2B9Y A;  2OD4 A;  3HVT A;  2QE5 A;  4QIE A;  4DV6 F;  3R27 A;  3SI8 A;  4LFC F;  1FDD A;  1EHW A;  4I2P B;  2B9X A;  1L3V A;  1LWX A;  1PO6 A;  1VGY A;  2LQ8 A;  2C1E B;  1KVJ A;  3OTO F;  1B4S A;  4I2P A;  3R7B B;  2ROP A;  4KE5 A;  4L72 B;  4DFP A;  1VC0 A;  1WOP A;  2HWI A;  3OTC A;  3K59 A;  4L6V 3;  5KOW A;  2UV8 G;  2IIH A;  4KT0 C;  2OMO A;  2XHW A;  4ZCM A;  1N0V C;  2D3O 1;  3EDR B;  3TQE A;  1MG7 A;  1Q8K A;  4ZVG A;  3PDN A;  2OH2 A;  2QGF B;  1TU0 B;  4KSE B;  4PXC A;  4F02 A;  1TV6 B;  4FS1 A;  3CXC R;  4KV8 A;  1V9O A;  3SQG A;  2DHH A;  1GTE A;  4JI3 F;  2DEI A;  3AOA A;  2QSW A;  1TV6 A;  3QRP A;  1R8C A;  2K1R B;  4CT8 A;  3KUG A;  1AT1 B;  4LF8 F;  1KD1 T;  4WP9 A;  1WKL A;  4LSL B;  4OZ0 A;  3W65 A;  5J2Q B;  4LQ3 A;  2PDA A;  1T9T A;  4L3N A;  4QWC A;  2F8E X;  4DV7 J;  4USK A;  3PX6 A;  2DO4 A;  2ATL A;  4ECR A;  2BQ3 A;  4ELT A;  3NGU A;  4LSL A;  2DY9 A;  3P45 B;  1WHY A;  3BGL A;  2IRU A;  4ILR A;  2LQJ A;  3CSK A;  1HI1 A;  2UUC J;  3RR7 A;  3PY8 A;  1S77 D;  2JRS A;  4FF3 A;  4C8O A;  5DG8 A;  4F4K A;  1JJH A;  5DDP C;  2VQE J;  3DNC A;  1B99 A;  4U8Y A;  3TZY A;  5CA5 A;  3EZO A;  2HVH A;  1Z4U A;  3ENW A;  1SKW A;  4DL0 C;  4OZN A;  3FKB A;  3U02 A;  4AQY J;  2OUG A;  4I4B A;  1KKH A;  4HDG A;  3ICL A;  2AX0 A;  1RBA A;  2UXB J;  2DB1 A;  4C8Y A;  1NAQ A;  2AEF A;  2CZ9 A;  4ED3 A;  2MKS A;  5E33 A;  1T3N A;  4A8M P;  1WSR A;  2CUY A;  5GAE U;  3Q8U A;  2VG7 B;  3DOK A;  2LA4 A;  2DNG A;  3NL0 A;  1VRQ C;  2DK2 A;  3FSI A;  1U02 A;  5JJB A;  2V8D A;  4LBI A;  4ZIV A;  4ZMM A;  3KKF A;  2XZT B;  2VG7 A;  4N76 A;  3AQO A;  4X84 A;  4OYX A;  4AND A;  2AJ2 A;  2R4F A;  1WF2 A;  4NWB A;  5KFZ A;  4ZCK A;  2PEH A;  4G6V B;  1WC1 A;  4ZLP A;  1QLN A;  3KLE B;  2C22 A;  2AYM A;  4KYZ A;  2W8L A;  2ZVI A;  5KFY A;  2ZNZ A;  2NZ4 A;  3S6E A;  3CDW A;  5IWA F;  4B3M F;  2PA3 A;  1NCL A;  2CAJ A;  1RWP B;  4CLZ A;  1RGV A;  2BQR A;  2BJ1 A;  3NCP A;  2W1B A;  4ED8 A;  4NLP A;  1IBL J;  4KHR A;  4DEZ A;  3ZXW A;  2ZWO A;  1SQG A;  2DHX A;  4KGV B;  3BSC A;  4ICL B;  1IBM F;  3MR5 A;  4EI2 A;  3CD7 A;  1F3V A;  1U1K A;  4I1T A;  5K8M A;  3ETM A;  3IR6 B;  3K8W A;  2OLW A;  2C2R A;  4W4M A;  1UVM A;  3EGZ A;  3UVJ B;  4ICL A;  3MMB B;  2DR8 A;  3M2R B;  2QV6 A;  4C8N A;  4QPX A;  2BUN A;  4S0M A;  3UVJ A;  6FD1 A;  2OHD A;  5SUH A;  3FBB A;  3GFH A;  4OL8 A;  1FD8 A;  3UW1 A;  4C7Q A;  2RRA A;  3M8R A;  1WG5 A;  3UNG C;  3MMC B;  3NGR A;  3M2R A;  4XTT A;  1MWQ A;  2QZ8 A;  5CCL A;  1MLA A;  2HNZ B;  4RNH A;  2AT1 B;  3MD3 A;  1S7H A;  1HA1 A;  1QUP A;  4QIF A;  3R5G A;  1Q5V A;  2VIC A;  4NLX A;  9RUB A;  1SIZ A;  3MMC A;  1XMO F;  3UR3 C;  3GSD A;  1U2C A;  2GZO A;  3PRD A;  2HNZ A;  2BKN A;  3P5T L;  3PW0 A;  3HHL C;  1J27 A;  4LR7 A;  2ZOF A;  3CO0 P;  1HW8 A;  3J7A 1;  2HQC A;  2PC6 A;  3EVW A;  2DNK A;  4FYX B;  4CLY A;  2UUA J;  3L4B C;  1QAJ A;  4N47 A;  4L74 A;  1OY8 A;  3R5C A;  3NS7 B;  4DX5 A;  4Q7A A;  3CJK B;  5KAK A;  4J9N A;  3NNA A;  4K4Y A;  1Q7L B;  4DPO A;  3OBI A;  2R3V A;  1X4C A;  3G96 A;  2LMI A;  1VFJ A;  1IKY B;  5C2G A;  1S72 S;  5CAB A;  3KJF B;  3FEY B;  1HNV B;  3CJK A;  2R2T A;  1LOU A;  1B64 A;  1SKU B;  1X4G A;  2M4M A;  4OLO A;  1IKY A;  1VHF A;  2EFO A;  1Z1Z A;  3SSS A;  2C2E A;  1HNV A;  1U6F A;  1NPP A;  2GCF A;  2R2R A;  3R1L A;  2VA2 A;  1FX4 A;  4RW7 A;  2GML A;  4EBD A;  2VV5 A;  2ZE2 B;  3FDS A;  3MI7 X;  4YS2 A;  2DNQ A;  2LA6 A;  1H72 C;  3D54 A;  2IJN A;  4LIW A;  1SBR A;  5GAG U;  2Z2L A;  4DR7 F;  5KFD A;  5EN1 A;  2MHN A;  1NM2 A;  4NEY A;  3TVY A;  4F4W A;  1GQE A;  3GIJ A;  2AEM A;  3RRH A;  2AYE A;  3HMJ G;  5AE3 A;  3DC2 A;  1PBU A;  2BKO A;  2IMW P;  1AA1 B;  1D8Y A;  2MLZ A;  1D3W A;  2RAQ A;  4FBU A;  2QX0 A;  3OVA A;  3H4B A;  3O1L A;  1F9F A;  1H2T Z;  3FQK A;  1WDD A;  2HFS A;  4RUC A;  1IKW A;  1T03 B;  2QL7 B;  4TU8 A;  5IS2 A;  4X4S A;  4C3M A;  2ZM6 J;  3MD1 A;  1E6V A;  1PJ5 A;  2E1C A;  4AL7 A;  1MRO B;  2BAC A;  3GSI A;  4E98 A;  3GR1 A;  2M9K A;  3KXD A;  1T03 A;  5FLX Y;  3ZZ0 A;  1U1P A;  4DCJ B;  1HWI A;  3ILL A;  3L7O A;  4WWS A;  3L7U A;  1FFG B;  1YBT A;  2WTF A;  1YJN S;  3LGM A;  1S6Q B;  1YG0 A;  5GAG I;  1NJI T;  2IY5 B;  1IVZ A;  1VC5 A;  1HWK A;  3IAM 9;  5FLX U;  2ZH9 A;  1RWN B;  1SL2 A;  1FO1 A;  3A13 A;  3GR0 A;  1EKS A;  5HQL A;  5C5J A;  3VV2 B;  1Y9O A;  2MSS A;  1DJ0 A;  1OWX A;  3OLA A;  3H2V E;  2LVW A;  2DCU B;  2QMU B;  1S1U B;  2DEJ A;  3FMW A;  2QL9 B;  2LXF A;  4DFJ A;  3TUP A;  3IO1 A;  3NGS A;  1U0H A;  2Y9H A;  4ZPC A;  4OI4 A;  4ECY A;  1T95 A;  2AF6 A;  2FVP A;  3J7A N;  4DR4 J;  5IC4 B;  2MZT A;  1N5S A;  2GHP A;  3MMA B;  4QYR A;  3WC0 A;  2QEX S;  4B02 A;  2CDQ A;  3AD9 C;  2R2S A;  3MED B;  4HLB A;  4DJB A;  1IKV B;  1EAY C;  4DSE A;  4CO1 A;  4NLQ A;  1HYS B;  2B6A B;  3TRG A;  3MTJ A;  2R7Q A;  1S0M A;  1YJV A;  2W4P A;  3MMA A;  2PII A;  2HEK A;  3MPY A;  2EFV A;  1D0E A;  2WW4 A;  3MED A;  1IKV A;  4DQQ A;  3W61 A;  3MFI A;  1NJX A;  1X60 A;  3AOD A;  1CS4 B;  4G3I A;  3CMQ A;  2B6A A;  5GVQ A;  2WVE A;  4FPR A;  3KOA A;  4UOF A;  1FES A;  1ELO A;  1O6X A;  2JEJ A;  1CPZ A;  3Q2S C;  2AYB A;  2L9D A;  3PNI A;  2CRL A;  3TUI C;  4ED2 A;  2HQ3 A;  5ETL A;  3JXO A;  2JH3 A;  3QSY B;  5KFS A;  3M2U A;  3CJ2 A;  3KLI B;  3ZTP A;  4JI5 J;  3NP5 A;  2FJA B;  2QC3 A;  3OR1 A;  3M8W A;  5KG7 A;  3JQM A;  1RI7 A;  1U24 A;  1QAX A;  4WFX A;  4DV5 F;  4EFA C;  2XY5 A;  2E1M C;  2QA4 S;  4UY8 T;  1M5P C;  3AJ1 A;  5H9E J;  3KLI A;  1KDN A;  1LXJ A;  8AT1 B;  4JI6 F;  3FQL A;  2IVF B;  2UP1 A;  4Y2I A;  4J37 A;  1LWC B;  3DI6 B;  2R7W A;  1KON A;  2VU5 A;  4YB5 A;  5DQH A;  5D4N A;  2ACY A;  3PRB A;  3QSI A;  3NS6 A;  3BH7 B;  3TA0 A;  1KEK A;  3GG0 A;  3B6B A;  5KFF A;  5JUM A;  4PG8 A;  4JI7 J;  1S4E A;  4IOB A;  3DI6 A;  1FWP A;  4RU9 A;  4Q2L A;  4RU2 A;  4OYA A;  3G8Q A;  5CZX A;  3NXZ A;  2W9A A;  3GIM A;  4DX7 A;  4IOA Q;  3R5A A;  2P9G A;  4JI0 F;  2E5L F;  4K2X A;  1SQF A;  4TXS A;  3UDL A;  2Q1L A;  3EUN A;  1VQY A;  2HHS A;  3TZX A;  2IYG A;  3A8K A;  5E3R A;  2HS0 A;  1VCT A;  4DN0 A;  3HKW A;  1X9M A;  2FLL A;  4C11 B;  2VC0 A;  3N9U C;  3U1N A;  4DQR A;  2MZR A;  2ZUG A;  2H5J B;  1JLB B;  1FCA A;  4V1A k;  2HRT A;  4OJ1 A;  1SIW B;  3E3X A;  1X5P A;  2ZDP A;  3G2X A;  3QIP B;  3LTO A;  1O5J A;  3HJV A;  2BVZ A;  3PVX A;  2UVW A;  1PAU B;  1RA7 A;  1ZBT A;  3EDQ B;  1JLB A;  1OSC A;  1U45 A;  2FJX A;  4USV A;  1HNW F;  1QVF R;  3TVZ A;  1HWL A;  1NZ8 A;  4ELU A;  2R7X A;  4OJ3 A;  2B5J B;  1RA6 A;  3MUT P;  4YQW A;  3DRS A;  3PR4 A;  2VON A;  1AFI A;  4ZVP B;  2IDL A;  3Q22 A;  1EQM A;  5J1E B;  4DV1 J;  4OI3 A;  2ASL A;  4ECX A;  2CQ0 A;  4QWB A;  5LXY A;  5K9F A;  4WBF A;  4X62 J;  1VC6 A;  2IM3 A;  2GW8 A;  5GAH U;  3K8V A;  1GEH A;  2ZOM A;  4YUD A;  1LXN A;  2IVY A;  2MKJ A;  1S4F A;  4N8O A;  4TYB A;  3C14 B;  2FVC A;  4G1P A;  1PIE A;  4PWD B;  1JJ2 R;  1K0T A;  1S97 A;  5L39 A;  5DM6 Q;  1PGZ A;  5EX0 A;  3MF5 A;  1ZM3 A;  5IT9 U;  2FHM A;  2CQD A;  1R31 A;  2BOA A;  1A6L A;  1MML A;  1WG4 A;  4JI3 J;  1NRK A;  1RTI B;  5ETQ A;  2ZHA A;  5KFM A;  4XO0 A;  4KPC A;  2R42 A;  2NUU G;  1AZS B;  1DAX A;  3BB5 A;  1U47 A;  4R25 A;  2CNO B;  5FJ4 A;  1WEY A;  1FNO A;  2YWF A;  2QG9 B;  1RT3 B;  3TAQ A;  1RTI A;  3T9N A;  2VFT A;  3I31 A;  2AGP A;  4C6A A;  2D41 A;  2W9C B;  1N5Y A;  1AZS A;  3CCM S;  2B7B B;  3RR8 A;  3FBE A;  1FRX A;  2CDR B;  2FHO B;  3H42 A;  3M6X A;  1RT3 A;  1ZPW X;  1R8P A;  1SXL A;  4K4X A;  3UDE A;  3QYY A;  2I38 A;  1MWY A;  5GAH I;  1UJ6 A;  3CE8 A;  2J76 E;  2DH8 A;  3IRW P;  4WU2 A;  4X64 F;  3PCO B;  3CC7 S;  1R27 B;  1VHI A;  4Q0B B;  1RJJ A;  4E8U A;  2Y1I A;  2ZBC A;  2A18 A;  3KLF B;  2WVF A;  3US5 A;  1KVI A;  4TU9 A;  2KO1 A;  4ZVO B;  1RHQ B;  4DV3 J;  4H4M B;  1FJC A;  4K4Z A;  2JFK A;  2R8G A;  2BAB A;  3RBX A;  3KLF A;  3P3D A;  1PCA A;  1FEE A;  5CYQ A;  1T9Y A;  2JEG A;  3VVU A;  2W9B B;  4H4M A;  2Z57 B;  3O44 A;  3W2W B;  1W25 A;  2AZ1 A;  1NKC A;  1KOH A;  1P1L A;  1PKU A;  4DR1 J;  1S1W B;  1UW9 A;  2W9B A;  4KO0 A;  4OYI A;  1NKB A;  2XSJ A;  1LW0 B;  4ZP8 A;  3OJS A;  5LMN J;  2QJ3 A;  3W2W A;  2RIL A;  4LVN P;  1MN9 A;  3WHI A;  5AXM A;  4FZV A;  4IFV B;  2X51 A;  2PI4 A;  3AA8 A;  5H9F K;  3CTR A;  3DKD A;  4ZJL A;  3J81 j;  2CAD A;  3DLK B;  5HK4 A;  4K7Q A;  3W8P A;  3DLH A;  2J0Q D;  2V8P A;  1ZTT A;  4IFV A;  2MQ8 A;  1AW0 A;  5CYJ A;  3FVY A;  3AQP A;  5KFQ A;  3DLK A;  2FLP A;  3W9I A;  5HMX A;  2M7S A;  1RT7 A;  4DI6 A;  5L38 A;  4IR9 A;  5AE2 A;  5CAA A;  4WF9 Q;  5AXK A;  2BW2 A;  1S0N A;  2K06 A;  3ZZZ A;  2BEF A;  1FEH A;  4CLT A;  1RIS A;  2NQP A;  3OT9 A;  3U27 A;  4B3O B;  2I6W A;  4CH1 A;  3A4T A;  2HHW A;  4ZPW R;  2W7P A;  3BM7 A;  1VIX A;  4ID5 A;  4LRD A;  1RAD B;  1M1K T;  1BQX A;  2C42 A;  4X4Q A;  3C3L A;  3K2Y A;  3NWR A;  5E3Q A;  4M63 A;  3IWX A;  4LR8 A;  1GH8 A;  2B0G A;  3L9Z A;  3I55 S;  1HD1 A;  1EB0 A;  4B3O A;  1JLQ B;  3NNC A;  2KZM A;  2AJ4 A;  4X4N A;  4FKY A;  1WC3 A;  2XSF A;  2ZD1 B;  3TNV A;  2KYZ A;  5LSO A;  3CCL S;  3BKF A;  3D66 A;  3OFG A;  4O4R A;  1NB2 A;  1EQ0 A;  4NRT A;  3IRX B;  1JLQ A;  3UWT A;  1S7I A;  4DL6 A;  1VRU B;  1FRH A;  1RLC L;  2XNQ A;  2ZD1 A;  3K5M A;  3IM9 A;  1FE4 A;  2JVR A;  4DZD A;  5DZ7 A;  1N4L A;  1LQ9 A;  5BR8 J;  2W4C A;  2ZKU A;  4Z7Y A;  5KT3 A;  3SXL A;  2RNE A;  2I5J B;  2N7C A;  3NS5 A;  4M95 A;  4A8K A;  4ENO A;  1VRT B;  1H98 A;  1Z2Z A;  3MM7 B;  1FJ7 A;  4DPT A;  1GK8 A;  1RAF B;  1GX5 A;  2NZC A;  3SZ2 A;  3VAJ A;  3J7Z T;  1N34 F;  1OY9 A;  2BJ8 A;  3W5Z A;  2I5J A;  2OAU A;  3CD0 A;  5AXL A;  3N6L A;  3BO2 A;  1VRT A;  3MM7 A;  3SSR A;  3ZTR A;  3GCX P;  3I4P A;  1OJ4 A;  3N5B A;  3GMG A;  5L8R C;  4DR3 J;  1WKJ A;  2ILY A;  5IV4 A;  4TY9 A;  4DQI A;  4Y6I A;  1R3N A;  5DZ6 A;  3UDV A;  1HNZ F;  1UMJ A;  2OML A;  4WCE Q;  2DGQ A;  2D9O A;  2HFU A;  4XDC A;  5B0A A;  4MJK A;  4KHP J;  2HKE A;  1VBY A;  2A6O A;  3JQJ A;  4DL3 A;  1WNE A;  2RS8 A;  3KHH A;  3N4W A;  4I6Y A;  1R89 A;  1AUS L;  4A4J A;  2NXN A;  1OYD A;  5J2N B;  2CQI A;  1FER A;  1UZD A;  5M2U A;  1Q7Y T;  4R8U B;  1CSJ A;  1CC8 A;  1TKT B;  4KGX B;  4RLE A;  2YQ3 A;  2CXE A;  3MR3 A;  1T7P A;  2KL8 A;  1TR0 A;  3KMQ A;  3QPI A;  1HBN B;  1KC8 T;  4YDD B;  2Q3P A;  5KFW A;  4R8U A;  3M1V B;  2KZZ A;  5U47 A;  2C3U A;  2ALY B;  2DRD A;  4A8O A;  4NCG B;  2AJF E;  3AA9 A;  5JMN A;  4XAK A;  1HBN A;  2H5E A;  4K50 A;  2ZZT A;  5DG7 A;  3P4U B;  1HD0 A;  3PHT A;  4EWT A;  4NYZ A;  4TLR A;  3M1V A;  4A8Q A;  1S49 A;  1WEX A;  3C16 A;  1RAB B;  4KGM A;  3D0G E;  2XMV A;  1CQM A;  2O1P A;  1YJT A;  5T7L B;  1VLO A;  4NCG A;  2HVI A;  3BF4 A;  3O2I A;  3LO3 A;  3GII A;  1XWL A;  4LF9 J;  1SH3 A;  2Z0G A;  1BGX T;  2RS2 A;  4HYK A;  4RNO A;  2V69 A;  4EU0 A;  2J8A A;  3Q8R B;  4LRA A;  4TKT A;  4ID8 A;  1X0F A;  2YKM B;  1CVJ A;  2V0N A;  1ZZN A;  1FI4 A;  3QLH B;  1JK9 B;  3H5U A;  4YHH J;  1ZS6 A;  2EWH A;  4JI2 J;  3J7Y I;  1URN A;  3G6V A;  2WBR A;  4DUY J;  1MSW D;  4CIO A;  3AAW B;  5KFL A;  1TAU A;  1D1U A;  1RWW B;  3Q8Y A;  2HZA A;  1JKH B;  1HHS A;  4OX9 F;  3DRX A;  2OD6 A;  3UCG A;  4U7U K;  2DIU A;  1R6Y A;  3MHY A;  1CBK A;  4J7C A;  1UJ4 A;  4C3L A;  5IOL A;  3QAU A;  4K4S A;  1V3Z A;  3N5F A;  4UW2 A;  2NYH A;  4IG0 B;  3BBB A;  1X4H A;  4L76 A;  4OI2 A;  1JKH A;  5LJ5 Y;  5A8R B;  2E9T A;  2HS4 A;  4NZ0 A;  1N36 J;  3H2L A;  1WWH A;  2HHP A;  2OGU A;  3QJL A;  2WK4 A;  2XGP A;  2AV5 A;  4ZPT R;  4CLW A;  2YNG B;  2WOM B;  1U4B A;  5F8J A;  4IG0 A;  2DNH A;  4X4O A;  5THW A;  4P75 A;  5A8R A;  1BY9 A;  3RTV A;  4B3T J;  3MDF A;  4JYA F;  2AMC B;  1V5I B;  2UVV A;  3HLU A;  2YNG A;  1DHM A;  3R2D J;  2M8D B;  3MEE B;  2HQG A;  4NL5 A;  2DRB A;  4UF4 A;  5B0B A;  2IBK A;  3HD2 A;  5I4M A;  5ADZ A;  2ASJ A;  5F8G A;  4OYO A;  2HBQ B;  1JB0 C;  5A8K B;  2PMZ D;  3TO8 A;  1JLF B;  3MEE A;  2MQO A;  2DJW A;  3JB9 k;  4F4A A;  3TW0 A;  3MGJ A;  2OPP A;  4A8S A;  5BJR A;  4NLR A;  3RRK A;  1JLF A;  1H7X A;  3OL9 A;  3OQ2 A;  3QT7 A;  1VMB A;  3VZI A;  5KFN A;  2OJ3 A;  3B4D A;  4NLG A;  3NG8 A;  2MKY A;  1GMW D;  1JX4 A;  3M4X A;  2ZBI A;  1EZZ B;  4KKO B;  4YFU A;  1TK5 A;  2YH0 A;  2AHO B;  1IBK F;  4DPW A;  3HPO A;  2X1F A;  4QW9 A;  3RB4 A;  2LP4 A;  2F3J A;  4HH1 A;  4QIW D;  4KKO A;  4DPY A;  3EWG A;  2OTJ S;  1P9Q C;  1JLA A;  5I3P A;  5E41 A;  4O3O A;  5E0O A;  1C0T B;  2Z58 B;  3D1Q A;  3JSY A;  1QSY A;  4ZVU B;  3NBP B;  2KG0 A;  3I82 A;  2WRM A;  2KDO A;  4TQR A;  1VK8 A;  1K9M T;  2FUG 9;  3L7P A;  5DQG A;  1C0T A;  2YWW A;  3W5Y A;  1I5O B;  2KM8 C;  3GV8 B;  5D78 A;  2I0X A;  3D28 A;  1S5Z A;  2IA0 A;  3PR5 B;  4CM2 A;  2G13 A;  3MEC B;  3RBD A;  1VQ5 S;  4DR2 J;  4KGK A;  2F7V A;  3LP1 B;  3HVW A;  3NBP A;  4URQ U;  4ER8 A;  1NSP A;  4Y34 A;  4DU7 A;  1GXT A;  2XLK A;  3I0R B;  2XWY A;  3QWU A;  4MYU A;  2O01 C;  4QCL A;  2G2Z A;  2IDE A;  5K20 B;  4GVL A;  3MM5 A;  5DG9 A;  1Y5I B;  5B0G A;  1X4A A;  1X7V A;  4K4T A;  3I0R A;  1HNW J;  1IWA A;  3K0J A;  1RHK B;  1NDC A;  2DPJ A;  1ZZF A;  4ZPV R;  2YNI B;  3CCT A;  4F36 A;  3GCW P;  3I96 A;  3RAM A;  4PPD A;  1S57 A;  2ZH3 A;  1APS A;  2XHC A;  1PC4 A;  2F8M A;  4Q44 A;  2KT3 A;  2CZV C;  3FGV A;  1VQK S;  5EUH A;  3BO4 A;  3JSM B;  2HND B;  2YNI A;  2BW7 A;  3UD4 P;  1SL1 A;  3IR5 B;  4OZ2 A;  2ZZN A;  1OPI A;  4WKY A;  3DHW C;  2XCA A;  1BQM B;  1RHR B;  5EGY A;  4F26 A;  2XMJ A;  4JI1 J;  4RW6 B;  3BN4 A;  4DV7 F;  2HND A;  4J9U E;  5AE1 A;  2B9W A;  2XMM A;  2GNK A;  1BQM A;  2KRR A;  1HMV B;  5GMD A;  2LQ9 A;  4DV4 J;  2QN6 B;  1K44 A;  3VQT A;  3ZZU A;  4RW6 A;  4I6A A;  4UST A;  3W66 A;  5F0U A;  1CJK B;  1DTQ B;  1Q5Y A;  3M9M B;  2ZHO A;  4IRK A;  2UUC F;  4KH0 B;  2RRN A;  2V8H A;  3B82 A;  2DIV A;  3C15 B;  5AJ3 J;  2NYI A;  1TL4 A;  2VQE F;  2ACM A;  1HMV A;  3PIO Q;  2OPR B;  3PKM A;  2YWE A;  1SC4 B;  1CJK A;  1DTQ A;  3HCX A;  1VI7 A;  4RL1 A;  3RG6 A;  4X4R A;  4OJH A;  2M52 A;  1UCN A;  4W90 B;  3UDC A;  1TKZ A;  4AQY F;  2NR0 A;  3C15 A;  5HVF A;  1B0P A;  3MZI A;  4ED6 A;  1VS3 A;  5LJ3 Y;  1ZTW A;  5H9E K;  2GO8 A;  4MIW A;  2UXB F;  1UZH A;  1RTH B;  4P2F A;  2UXD J;  1SUQ B;  3KLG B;  3GLJ A;  5DQI A;  3R2C J;  3KNG A;  5KT7 A;  2XGQ A;  1C1B B;  2N7Y A;  4F0M A;  3OW2 R;  2BYC A;  5ETP A;  3QZ8 A;  4QR2 A;  1Q78 A;  4RW9 B;  2DVI A;  4LF6 J;  1IM4 A;  4FN5 A;  3HX9 A;  3KLG A;  3M8Y A;  1C1B A;  5CCM A;  1RHU B;  1D9A A;  4WXO A;  2C3P A;  2FQQ B;  5L9N A;  3CJ0 A;  1WC6 A;  3SIP B;  2XWX A;  1X5S A;  4RW9 A;  4USM A;  3OL6 A;  1T3O A;  2EBE A;  2NCK L;  1RAH B;  3SEO A;  2HK3 A;  2R7S A;  1QJH A;  5RUB A;  1FXL A;  2NXU A;  2XB2 D;  3DDN A;  4U6P A;  4QU6 A;  1QTM A;  5ITH A;  3K5L A;  3RBZ A;  4NA3 A;  4K4U A;  3T5H A;  3RJM B;  3AHP A;  5LT5 A;  5HAO A;  2EFG A;  1B7F A;  4PAB A;  1U2R A;  3BJY A;  1PJ6 A;  2EI5 A;  1IBL F;  3MM6 B;  1M5S A;  2DNL A;  5EDW A;  3ISZ A;  2ZZM A;  2YH1 A;  1R0A A;  2GIR A;  4AL6 A;  4HH0 A;  4CH7 A;  5KFK A;  4L75 A;  1X9S A;  3CJT A;  1LWF B;  5EX3 A;  4GKK J;  2GV1 A;  4PZV A;  3MM6 A;  1M5V C;  3KK3 B;  1WG1 A;  2OEK A;  3NCQ A;  4MKV A;  4QOT A;  4GVB B;  2VFS A;  1Q1K A;  1RZM A;  3HD1 A;  2ZBP A;  2E5J A;  2ABY A;  1N48 A;  1RBL A;  1LWF A;  3B54 A;  3BDP A;  4DUT A;  3BQ0 A;  3KK3 A;  1NDP A;  2FB0 A;  4X4P A;  3Q0A A;  2F8H A;  1DAR A;  2BE7 D;  2DNY A;  4F0H A;  3OLB A;  1WC4 A;  4FXV A;  3G87 A;  1TAQ A;  2M2B A;  3M32 B;  4W92 B;  2Y3Y A;  2Y0B B;  3GP9 A;  4OIX A;  2GVZ B;  5D4O A;  4FNI A;  5B0E A;  3THP A;  3RRG A;  2EFP A;  3MUR P;  2DNN A;  5E5N A;  2XTJ P;  2B43 A;  1Q8B A;  3M32 A;  3QNW B;  3VVT A;  4ZA1 A;  5LMU J;  2JSX A;  2GVZ A;  1XTZ A;  4ZS6 A;  1CJV B;  3BBF A;  2V6A A;  2HFV A;  4Y3C A;  4JV5 J;  1FFS B;  2XMW A;  3DHX A;  2V4R A;  4UQG A;  3G86 A;  2UUA F;  4DSF A;  4WFN Q;  2JC1 A;  3ENQ A;  1PYO B;  1CJV A;  3FEZ A;  4OX6 A;  2HQI A;  3LPY A;  4CO0 A;  4ZN1 A;  3QID A;  3CD5 A;  3WQP A;  5DET A;  2HQD A;  4BWM A;  3JQK A;  2A2D A;  4YN3 B;  2OFH X;  2DNR A;  3JYT A;  3K58 A;  3F0N A;  1KLM B;  1QSL A;  1SC1 B;  1Q53 A;  1CJU A;  1KFS A;  1QM9 A;  3H40 A;  5D0E A;  2QYG A;  1IR0 A;  2OO4 A;  4NXN J;  1WEL A;  4I68 A;  3A8E A;  3Q8S B;  5D15 A;  2KFN A;  3BGR A;  4Z37 A;  1F5C A;  1B0V A;  3PFO A;  3LAL A;  3UR0 A;  1C0U B;  3BH6 B;  4OX7 A;  3R97 A;  4X66 J;  2OTL S;  2JHE A;  1RQ0 A;  2BX6 A;  1TQL A;  1U49 A;  3GJQ B;  4ZVF A;  4PUO B;  1NXI A;  5D4L A;  1MW7 A;  4BLG A;  3P96 A;  2BR0 A;  1T94 A;  3DDK A;  2W2Q P;  4C0O C;  4NLW A;  4DMZ A;  1Q8I A;  3T1A A;  4UY8 5;  1BQN B;  2D1C A;  2PT0 A;  2UXC J;  3C46 A;  2XYH B;  1SVD A;  4MFB B;  3TEH B;  4ZIT A;  1RT6 B;  1Y0H A;  3CCU S;  2CPX A;  3KTQ A;  1DTT B;  4GC7 A;  4C9D A;  2AGO A;  4NOH A;  4WP8 A;  3JS9 A;  1LV5 A;  1X5T A;  2V68 A;  5F9N A;  3ISN D;  4QYZ J;  1RT6 A;  2BXJ A;  4BCA A;  1YBU A;  3VCD A;  1BUX A;  2HHX A;  3BQ1 A;  2DXE A;  1S1V B;  2PSZ A;  3WZ0 A;  4DL4 A;  5ETO A;  1RYS A;  4FDF A;  4HVZ A;  2ZM6 F;  4CNZ A;  1TUV A;  2HZV A;  4C8K A;  2L9W A;  4HAC B;  4GO5 X;  5D4P A;  1FTC A;  3Q2T C;  1J5E J;  4DV2 J;  1C1C B;  4R0E A;  5IM0 B;  3O6Q A;  4KPY A;  4OHX A;  3PW7 A;  2HSE B;  5IT0 A;  5KT5 A;  4CLP A;  2NUH A;  1S1V A;  1KFD A;  1D8Z A;  4PKD B;  1W26 A;  1NUE A;  4HAC A;  4ZPD A;  4YR2 A;  2HVE A;  5EWG A;  4LF4 J;  3EZ5 A;  4KGZ B;  4F3M A;  1S1X A;  1C1C A;  1WTB A;  4L73 A;  5IM0 A;  4U95 A;  2CQB A;  2IM2 A;  3HVA A;  4KHM A;  3WDO A;  3AXK A;  3P8B B;  1H73 A;  3LGH A;  2D3U A;  4RUA A;  1A0O B;  4G1Q B;  4IKA A;  3R8Y A;  4H54 A;  1I94 J;  3R5D A;  2GQC A;  4EO8 A;  5E3C A;  3QAT A;  2CPZ A;  2RQK A;  2ZVS A;  4OZ5 A;  2DIT A;  5HVH A;  2FGO A;  3TOQ A;  1YWX A;  4G1Q A;  3VGS A;  3ZTO A;  5KFP A;  4X4V A;  1CUL B;  1F0X A;  3W9H A;  4DR4 F;  1R7I A;  3GYX B;  1S6P B;  2L9N A;  4AXI A;  3CJQ A;  3ZFV A;  4CO2 A;  2QO3 A;  3FEX B;  4C97 A;  1VQP S;  2R7U A;  2MKH A;  3CME S;  1OY6 A;  4MKY A;  5HL7 Q;  1KHW A;  1QD1 A;  5HMZ A;  5HBM B;  1CUL A;  4G65 A;  2QIF A;  1S6P A;  2QMX A;  3BSN A;  4X4U A;  2KTQ A;  2RQC A;  4NI2 A;  1NEE A;  3CED A;  1S0V A;  4ZKA A;  4NLT A;  4G1I A;  2IHR 1;  5HBM A;  3AOC A;  2FGC A;  4KIA A;  4HTJ A;  2P8I A;  3CT9 A;  3D3C J;  1TMM A;  3EXY A;  2Z8Q A;  2YX7 A;  3IC1 A;  5HQM A;  5D0R A;  1N32 J;  1UTA A;  1KTQ A;  2FVQ A;  2MYF A;  2DCL A;  4JUZ A;  3MMJ A;  3T9Z A;  1F1B B;  1U8W A;  3Q8P B;  4JP8 A;  5A2Q Y;  1SC6 A;  2FC8 A;  3HSG A;  5HJX A;  2KXF A;  5DGA A;  3OVB A;  1L5U A;  4UTG A;  5AT1 B;  4XPC A;  3UFC X;  1GFW B;  3SFG A;  2YNF B;  2CJA A;  2H54 B;  3N28 A;  3I5C A;  2YQ1 A;  3Q83 A;  2C2Z B;  4PPZ A;  1H0H B;  5A2Q U;  5KT4 A;  4PXB A;  3CO9 A;  2J9D E;  1UL3 A;  3V2U C;  1T9X A;  2J7W A;  4FBT A;  2VJU A;  2J9C A;  4WK3 A;  1RWO B;  4C8M A;  4I67 A;  5HVG A;  1SJ1 A;  2IA6 A;  4JI7 F;  4RJV A;  2VD3 A;  3MAQ A;  3OJU A;  2DY1 A;  1MMN A;  3I5A A;  2I2Y A;  2HRY A;  4GMK A;  4QU7 A;  5A6W A;  4LIR A;  3ET6 B;  3Q89 A;  4ATN A;  4PQU B;  4WIQ A;  4ZCL A;  4F3O A;  2DGX A;  2FTR A;  1HI8 A;  4A8W A;  4PQU A;  3HVT B;  2WON B;  1FA0 A;  4H4K A;  1AB8 A;  1AYE A;  4EBE A;  2ALZ A;  2HBZ B;  2K3I A;  3TJA A;  3CC4 S;  1VQO S;  3RB6 A;  2VDH A;  2EXU A;  1OO0 B;  4JB8 B;  3OXL A;  3HM9 A;  1R8B A;  3NGT A;  1O51 A;  1N88 A;  3SCK E;  2GO9 A;  1F2H A;  4B17 A;  2WON A;  3P6Y C;  1DQA A;  3ZC4 A;  4LF7 J;  3PYD A;  2HHQ A;  4DF4 A;  5H9F J;  2V63 A;  2BE2 B;  4OMF G;  2YKO A;  4FVM A;  3SV4 A;  3F73 A;  5L9X A;  2P5V A;  2PMW A;  5KFU A;  2ZIT A;  3MR6 A;  5KTQ A;  1NPR A;  5K8P A;  5A6P A;  4YY3 J;  4GKJ J;  2GHW A;  1SKS A;  2JL9 A;  4O4G B;  1Y3K A;  4DV1 F;  2BE2 A;  3HHD A;  4RW4 A;  4ZLL A;  3TQ1 A;  1ITP A;  2G1D A;  2YPZ A;  4EBC A;  1L3T A;  4DS5 A;  4WTY A;  4EUV A;  2NRE A;  4KV8 B;  3CB4 A;  4M5L A;  2X7I A;  3E01 A;  4X62 F;  1U1Q A;  3UO0 A;  2A2C A;  4O4G A;  3SQG B;  1JLG B;  2MLY A;  1H2U X;  1RYR A;  1GX6 A;  1UFL A;  3JTN A;  4TNO A;  5KFI A;  2RJZ A;  2FVS A;  4J9S A;  3THV A;  2PE8 A;  2U1A A;  4NRU A;  2AGQ A;  2XY6 A;  2XI3 A;  1TTH B;  1S76 D;  3WX8 A;  1XR6 A;  5DLG A;  4DXL A;  1JLG A;  2DHG A;  5L1K A;  1XNQ J;  3DDI A;  1FKO A;  4H4O A;  4LRE A;  2CQG A;  4BC7 A;  4K5R A;  4V19 J;  2WHO A;  2RH3 A;  3KHL A;  1FDN A;  1XNR F;  2K2P A;  2YWK A;  5F8N A;  4WFZ A;  2HNY B;  3PYF A;  4YP3 A;  1HWJ A;  1LK5 A;  1IBC B;  2GJ2 A;  2CG4 A;  1VYA A;  3DN9 A;  4KRW A;  5C7P A;  3IWL A;  3EYZ A;  1ZOT A;  2V8V A;  3ZTQ A;  2V2Z A;  1RTJ B;  5I42 B;  1NHV A;  2HNY A;  2X1A A;  3G71 S;  4M5G A;  5HMW A;  3NOC A;  3EPG A;  5I3Q A;  4QW8 A;  2PEB A;  3AB4 B;  4DG1 B;  4PCQ A;  5HJY A;  2EW9 A;  1RAO A;  3I87 A;  3J7Z 5;  4N77 A;  3A8I A;  1RTJ A;  5I42 A;  2BM0 A;  4ITS A;  1YRU A;  4ILL A;  2FZC B;  2HGM A;  1JXL A;  5KG4 A;  1SV5 A;  3DOK B;  4MK8 A;  4DV3 F;  3FJ2 A;  4DG1 A;  3WIU A;  5BYS A;  4P73 A;  4K0K J;  1KQG B;  2C2D A;  3UPF A;  1Y11 A;  4O23 A;  5GMK a;  4RKU C;  1DBD A;  2PFF B;  4EYI B;  1X0P A;  4B08 A;  1TFW A;  4CLK A;  4M5N A;  4DR1 F;  1NH8 A;  5HAT A;  2G9O A;  1BMQ B;  2RML A;  1VLY A;  4NEZ A;  1VQN S;  2JLG A;  2QYC A;  5LMN F;  2HFN A;  4DDF A;  4ETZ A;  5CYM B;  4Q8E A;  4Q8F A;  1GNK A;  3BDE A;  2P9E A;  2KT2 A;  2LFV A;  1MMD A;  4UT4 A;  3PTW A;  2CQC A;  3QRR A;  1RB0 A;  2GJI A;  1FRI A;  5CYM A;  3NGD A;  3IBW A;  1FD2 A;  2N4D A;  4ES2 A;  1GMU A;  2ZBQ A;  1YJ7 A;  1B7Y B;  3IBF B;  2VBY A;  1X5O A;  4DQS A;  1YGY A;  2KT5 A;  1PIL A;  3CIZ A;  4NA1 A;  1Y3J A;  2IC3 B;  4WP3 A;  3O8W A;  3LWL A;  4ZDN A;  3TP2 A;  1RWK B;  4D3H A;  4HI2 A;  4C3K A;  1NJY A;  2NSB A;  2R7T A;  3MOZ A;  3V6D B;  2Q6C A;  2KN4 A;  1VQL S;  1KP6 A;  2OEJ A;  2IC3 A;  3LA0 A;  1Q0N A;  3I56 S;  4DUZ J;  5L1J A;  2EC0 A;  4Q45 A;  1RAA B;  2VPX B;  2CVI A;  3BRE A;  3GWC A;  2W2O P;  3V6D A;  1F6T A;  2CJY B;  2OP5 A;  3SMZ A;  1UFK A;  4C2M A;  1FWL A;  2YPY A;  1SCJ B;  1LFP A;  3D1H A;  1SC3 B;  3BPD A;  2HHV A;  4PAA A;  3A3N B;  1YQH A;  4J9M A;  4WJB A;  2ERR A;  2CPJ A;  3MCM A;  2JWN A;  2BOP A;  4B9V A;  3NRB A;  4JI4 J;  1CLF A;  2XMK A;  2RU3 A;  2J9E A;  2CJQ A;  2H3E B;  2M70 A;  1VBX A;  5BR8 F;  1FRM A;  4ECV A;  2V50 A;  5CQG A;  2R7R A;  2BJ3 A;  4LFB J;  4C0B A;  4CO5 A;  1JXV A;  2RQ4 A;  1YK9 A;  5KFO A;  2IFX A;  3X3U A;  3MR7 A;  1Z2L A;  3W63 A;  2A0F B;  4RBT A;  3DOM A;  4RBU A;  5H1S V;  4EK2 A;  1NK0 A;  1NO8 A;  4DX6 A;  1CEZ A;  1IWG A;  4NLD A;  1U6Z A;  3D4J A;  3OL8 A;  4DR3 F;  3PO5 A;  4RZR A;  2PO4 A;  4M1K A;  2W01 A;  4ED4 A;  3FMB A;  3K5O A;  2GFF A;  1XMQ J;  2VB6 A;  4CLL A;  4CWB A;  3KYL A;  3NWG A;  1LW2 B;  4RW7 B;  1TL5 A;  3CCR S;  4KHP F;  1B70 B;  3CCS S;  4M5K A;  4LRC A;  4ZVE A;  2E9R X;  2ZC3 A;  1PJ7 A;  3VTI A;  4OFZ A;  2XZD B;  2UUB J;  4RUH A;  2VQF J;  3BO3 A;  2AD9 A;  3GYG A;  2MQP A;  4XDD A;  1LW2 A;  5E7O B;  5HN0 A;  2R2U A;  2Z4P A;  2BE9 B;  3UN5 A;  2HYI B;  5KFH A;  1QTN B;  4PWU A;  1T9V A;  5G0R A;  1SQE A;  3AH6 A;  5LSL A;  2KXN B;  3LWM A;  5ETK A;  3CCZ A;  4HT7 A;  3OSP A;  3M30 B;  3W9J A;  2MGZ A;  1UVK A;  3GTY X;  1K1S A;  1B0T A;  2W2M P;  2YNH B;  4P7T A;  2VA3 A;  3IAS 9;  1CC7 A;  1IKW B;  2E1R A;  3KG4 A;  3EJM A;  4EGL A;  2M0G B;  4P52 A;  4CH0 S;  1RTD B;  4FNH A;  5DLF A;  2L08 A;  3EGW B;  1E6V B;  3H5S A;  3BS9 A;  5CHC B;  3M30 A;  2M8H A;  1VQ7 S;  5HMY A;  2FJE B;  1IN0 A;  2YNH A;  3M05 A;  1RWV B;  2E29 A;  4IR1 A;  1HIY A;  3UE2 A;  4LF9 F;  4P9S A;  1R0C B;  1RTD A;  2R9L A;  4ECU A;  2V8G A;  2ZJR Q;  3IS9 B;  2J7K A;  4HDH A;  1ARO P;  5C25 A;  3I32 A;  4X4T A;  4YHH F;  1HR0 F;  4FP9 A;  5HLF B;  3IS9 A;  4QWD A;  2AWZ A;  4CI0 B;  4JI2 F;  2BM1 A;  1BHN A;  2HHH J;  3JTO A;  2VBZ A;  4DUY F;  3E2E A;  3VWS A;  4WTO B;  4K59 A;  1IQZ A;  3PIP Q;  2YTC A;  5HLF A;  1U0H B;  2LQ5 A;  1IR2 A;  2JLE A;  4LVO P;  2J0X A;  1F5A A;  4P2S A;  3ZZP A;  4F4Y A;  2GQQ A;  3ZTS A;  1M90 T;  4D3G A;  3UN3 A;  2QLB B;  1OS5 A;  3UI3 A;  3JTP A;  1N36 F;  3E8O A;  2HBR B;  2PGC A;  1J5O A;  2BA9 A;  5CH7 B;  1V6H A;  2EC2 A;  3QO9 A;  3OSN A;  2KVI A;  4JI8 J;  4NCB A;  1SPB P;  3RB3 A;  2VIH A;  2A10 A;  4KC5 A;  2FDN A;  3DLB A;  1QVG R;  4QWE A;  4U7C A;  4B3T F;  2DR5 A;  3QBC A;  1E6Y B;  4DN9 A;  2B8P A;  2FC9 A;  8RUC A;  4LRF A;  3PKY A;  4BS2 A;  2WVC A;  1TL7 B;  4RNM A;  1UW4 A;  3O5T B;  2RSQ A;  4NXM J;  3DMJ A;  2YY3 A;  3M2U B;  1RT1 B;  2C3Y A;  4FPI A;  3PAC A;  3CCV S;  1E6Y A;  4TQS A;  2JJ4 D;  3OR1 B;  1WF1 A;  3A1Y G;  3KHG A;  3QGP A;  1T02 A;  7AT1 B;  1UEK A;  4WK1 A;  3I9V 9;  1TL7 A;  2V2V A;  5IXU A;  4ZN3 A;  3DCA A;  2X3G A;  1RT1 A;  1Q79 A;  1VJW A;  3M6V A;  2E5I A;  3UCU P;  4ZLN A;  4WZQ A;  1ULR A;  2MKC A;  4CT9 A;  1ZAX A;  2W4D A;  3K17 A;  4I7F B;  3C6T A;  2H51 B;  1M1H A;  2BKP A;  3R5B A;  4DR6 J;  2HHT A;  2OPS B;  4KFB B;  2F5G A;  1HI0 P;  5CXT A;  2F65 A;  1NDK A;  4NML A;  1RHJ B;  2DT9 A;  4WKR A;  2K7K A;  2HIQ A;  4I7F A;  3WX4 A;  1FX2 A;  3HHL A;  2DHA A;  1ACM B;  4IH5 A;  1NB7 A;  1I6J A;  2OPS A;  4KFB A;  4NLS A;  4EMD A;  2VL1 A;  1URR A;  1BE4 A;  4B9S A;  1N52 B;  4QYZ K;  4UOG A;  2HMI B;  1PAE X;  2J0W A;  1Q8L A;  1BLU A;  1M5H A;  2HBY B;  4NX9 A;  3RW6 A;  4LF2 A;  3NGK A;  3KLH B;  3D67 A;  4XPE A;  1SL0 A;  2HMI A;  4C48 A;  2UU9 F;  1N8R T;  4PWW A;  1Y10 A;  4DR2 F;  1RKI A;  2B3T B;  2V4J A;  3PRV A;  3KLH A;  1XBW A;  4CCH A;  3CJR A;  1S6U A;  3NLC A;  2MJN A;  3D6H B;  2HG4 A;  5M2P A;  5F8I A;  2DGO A;  4LT6 A;  4K4W A;  5KG5 A;  5IT4 A;  4YOE A;  3G6E S;  2JOQ A;  3CCW A;  6AT1 B;  2RUS A;  4J91 A;  2H9Z A;  3MPU B;  3IWN C;  1BWE A;  3SBM A;  3DRS B;  4OHW A;  1EX8 A;  3KK1 A;  2YBV A;  2MZQ A;  2LYV A;  3C66 A;  1RLD A;  2B4P A;  4P2M A;  3NAI A;  4J5O A;  3VR1 A;  1BWV A;  1NJW A;  2PD1 A;  3TVK A;  3BEG B;  1SI9 A;  3FNN A;  2HQF A;  4AT1 B;  2Q79 A;  4WZM A;  4PQA A;  4IDK B;  2YQ0 A;  3MTK A;  3OUY A;  3LAM A;  4R0J A;  5KFA A;  5IT9 Y;  1FE0 A;  1U1M A;  4K4V A;  2B51 A;  2V9W A;  2EPI A;  1U26 A;  1G6B A;  3IBC B;  5M2R A;  1S1T B;  4JI1 F;  4IDK A;  2VKZ G;  5EWE A;  3IM8 A;  4ETX A;  4WII A;  2MMY A;  2LEP A;  4Y2A A;  1FDA A;  5C42 B;  5T14 A;  4DV4 F;  1S1T A;  4DFM A;  1U1R A;  9ATC B;  1LNQ A;  3R3T A;  1DRZ A;  2QSF A;  2HIY A;  4I64 A;  4J9R A;  1JIH A;  1N5Y B;  1NK6 A;  4M5H A;  4B9T A;  3QFH A;  3C19 A;  3GB0 A;  5AJ3 F;  1FXR A;  4DPU A;  3IFE A;  2G1H A;  4YB7 A;  5C42 A;  1KVK A;  1KQK A;  2BBE A;  3L3C A;  1SJ4 P;  1RTZ A;  4C8Z A;  2H4Y B;  1XNR J;  3D9B A;  3I0S A;  3AD7 C;  2L48 A;  1HW9 A;  2FY8 A;  4J90 A;  4U8V A;  3VGV A;  1WHV A;  2V67 A;  4DSJ A;  2FVR A;  2UXD F;  2XM3 A;  3Q8V A;  3RZA A;  2FD2 A;  5AXN A;  1M1G A;  3M9O B;  2F4F A;  5HQ8 A;  4CLU A;  3A12 A;  3ZO7 A;  4ELV A;  4LF6 F;  3P5B P;  1T11 A;  1NME B;  3EM1 A;  1MWZ A;  4CO4 A;  1UPP A;  3TAM B;  1H74 A;  3KK2 B;  1FRJ A;  3OTB A;  1R8A A;  4ZJQ A;  5CYQ B;  2ZKT A;  2RIJ A;  1S59 A;  4HHH A;  1T05 B;  3PW5 A;  2HRU A;  3TAM A;  2G0J A;  2DR7 A;  2C3M A;  4MKA A;  3KK2 A;  3U1M A;  1XJW B;  5E3P A;  3D5M A;  3DRR B;  2D3O R;  1JLE B;  4RX6 A;  3CIM A;  2CQH A;  2XCP A;  4KO0 B;  1UET A;  2XSJ B;  3OFE A;  2QLX A;  1T05 A;  2MPU A;  1TK0 A;  3CW2 C;  1BC6 A;  2MXY A;  4N5S A;  2PMH A;  2E7W A;  3U7J A;  4IG3 B;  3RB0 A;  3DRR A;  1JLE A;  4NLO A;  1PYS B;  3HHL D;  4IOC Q;  4F50 A;  3F41 A;  4J9P A;  2RB7 A;  3NNH A;  4J9L A;  4IG3 A;  4GKK F;  1I1G A;  4EO6 A;  3B8H A;  2DBB A;  2K1R A;  3GFZ A;  3G6Y A;  4N8N A;  5J2Q A;  1JXE A;  2VPW B;  4A8X A;  1WC0 A;  2XG8 A;  3B78 A;  1U6B A;  1UVL A;  1QE1 B;  1RBO B;  2ASY A;  1RT7 B;  4F67 A;  2AJ1 A;  3G8T A;  4Q2M A;  1REV B;  2DGS A;  3MEK A;  4OYZ A;  2L3M A;  4LQ9 A;  1FNM A;  4DX8 H;  3H7H B;  2O67 A;  1QE1 A;  3QAE A;  1AUD A;  2MDA A;  4ID5 B;  4MTP A;  4NLY A;  2J9D A;  2W7A A;  4OLP A;  1U1N A;  1TK8 A;  1REV A;  3DLJ A;  2CA9 A;  2FJD B;  4DL2 A;  3VF0 B;  3CDB A;  4M5I A;  5LMU F;  3AJ2 A;  1WDT A;  2J7U A;  2EVZ A;  4F0K A;  4QIG A;  4JV5 F;  2IJR A;  1EP4 B;  3V81 B;  4ZLJ A;  4X65 J;  1KNZ A;  1P9Y A;  3GJT B;  3VAL A;  3T5J A;  1K0V A;  1K8A T;  4BWJ A;  2VC1 A;  4FXD A;  4B9M A;  2FPH X;  2ZH8 A;  4RWX A;  1KSP A;  1D09 B;  3PXG a;  4F4Z A;  3TA2 A;  3M6U A;  2RUG A;  5F41 A;  1EP4 A;  3HT0 A;  5EWF A;  3V81 A;  4LSZ B;  2XUL A;  1S9E B;  3CDU A;  1NH7 A;  2QMW A;  2O5D A;  3W7B A;  1O0P A;  4NXN F;  1DQ9 A;  3QFW A;  4OV6 A;  1H3D A;  2Z30 B;  4NLU A;  1S9E A;  4CO3 A;  1YRX A;  2X1G A;  2VFU A;  3MM9 B;  1YTY A;  1GMW A;  2A3J A;  2LKZ A;  1I51 B;  4USJ C;  3KLE A;  2C3O A;  4X66 F;  4FYY B;  3IG1 B;  3EMT A;  1C4A A;  4FVC A;  3ENA A;  2DH9 A;  4QZV B;  2XO7 A;  5CZV A;  2WZ1 A;  3AJD A;  2ROE A;  3T5K A;  5GAE I;  3MM9 A;  4RBV A;  2V34 A;  3QMQ A;  1FXD A;  1YZ6 A;  2CJ9 A;  2DPI A;  3BV8 A;  1V5V A;  3IG1 A;  4K8R A;  3QJJ A;  4IUF A;  4DPX A;  2F63 A;  2UXC F;  3K89 A;  3HZG A;  2DGT A;  3BQ2 A;  4ECT A;  4DOZ A;  1Q4R A;  2R8K A;  2OFG X;  4AXJ A;  2PA8 D;  1TL3 B;  1XEZ A;  3DRP B;  3MAH A;  4BDP A;  2H48 B;  3BKU A;  3N6M A;  4PG5 A;  2HVZ A;  3FRY A;  3LP0 B;  3EE3 A;  1WEZ A;  1FRL A;  3MFH A;  1DY3 A;  3MMB A;  4DV0 J;  2RHQ B;  1IM6 A;  2RT3 A;  1YBA A;  1Q81 T;  1TL3 A;  4HEA 9;  4LF5 J;  3DRP A;  5IC6 B;  2VG5 B;  2CG8 A;  2HVD A;  2W2N P;  3F44 A;  2CQ1 A;  3GYN A;  2D69 A;  2D7S A;  5B0C A;  3LP0 A;  1T9W A;  3ULH A;  3J7Y U;  1Q95 G;  4P71 A;  1J5E F;  2QA1 A;  2IRX A;  5DO2 A;  4DV2 F;  3PJX A;  1XIQ A;  3SCL E;  1C2P A;  3C16 B;  4HHU A;  1UVI A;  1RT4 B;  1K73 T;  1O8B A;  2FLO A;  2VG5 A;  4ZP6 A;  4EZ9 A;  3PEH A;  2IM0 A;  1HKA A;  1FJG J;  3PYE A;  4P6Q A;  4ZVT B;  1R8H A;  2CWX A;  3T1H J;  4LF4 F;  2DHS A;  5B09 A;  1W7W A;  4ZPB A;  1RT4 A;  1XQI A;  2J0S D;  3D6M B;  1NDL A;  4OI6 A;  2V94 A;  1HBU B;  4DFK A;  2GMJ A;  3ZZR A;  4ED1 A;  1IQT A;  5ETS A;  1I94 F;  2CNL B;  4I2Q B;  3HK2 A;  4MT1 A;  4ECW A;  5KFB A;  4Y00 A;  3DGP B;  5DM7 Q;  2XMT A;  4UUX A;  1HBU A;  2GQ2 A;  4AE5 A;  3S1T A;  2RQM A;  1WI6 A;  3LAN A;  2QLJ B;  3KJV B;  1ZAW A;  1XER A;  5KG0 A;  1HR0 J;  1D9F A;  2IMO A;  3T3F A;  1GT8 A;  4I2Q A;  3CDE A;  2G4B A;  3DGP A;  1X8D A;  3HVR A;  3HF5 A;  2FJW A;  3SDE B;  4B9N A;  3IMQ J;  2B7C B;  4IO9 Q;  3H59 A;  3DXB A;  4HR2 A;  3KJV A;  2VPY B;  2AW0 A;  1HBO B;  1Y4Z B;  3SDE A;  2EG2 A;  4KAI A;  2GAH C;  3PYG A;  3P49 B;  1HBO A;  3A3P B;  4KR0 B;  5DDQ C;  2JX2 A;  2FJV A;  2GIF A;  1NU4 A;  2QFI A;  2LCW A;  3LH2 S;  3IP0 A;  2ZE2 A;  2ATC B;  3HFZ B;  2XYP B;  3DLG B;  1N32 F;  4DU8 A;  2CPY A;  4Z2X A;  5LL6 d;  1PC5 A;  3BYR A;  4ZVH A;  2MQM A;  1YSJ A;  1RSC A;  2XZW A;  2W24 A;  4UOC A;  4WU3 A;  3SCI E;  3HSD A;  2W2P P;  3EVM A;  2DO0 A;  2ZC4 A;  1N5V A;  2MHE A;  3DLG A;  4U7U D;  2HFZ A;  1EET B;  2VAS A;  4RNN A;  1F5B A;  1SB6 A;  1F3F A;  3ILI A;  3ZNU A;  2OPP B;  1S99 A;  4F25 A;  4OZ1 A;  2BJD A;  1M0S A;  5ETM A;  2NXJ A;  3RYL A;  3W64 A;  3C6U B;  1EET A;  2R8H A;  2ZH1 A;  3N01 A;  1VIO A;  3EGN A;  5ETT A;  1SJF A;  1FFW B;  3R9L A;  2YKQ A;  2K3K A;  3QGH A;  1MRO A;  4MAK A;  3LOU A;  4DSL A;  2HAI A;  5KFJ A;  2N3O A;  3BSA A;  3C6U A;  3UCZ P;  4IFY B;  2H1Y A;  4NE9 C;  2Y1L B;  5KFG A;  2AZ3 A;  4IH7 A;  1D9D A;  3G9C A;  4EEY A;  1HQU B;  1S6Q A;  4IYQ A;  4YEA A;  4ZOS A;  1L3U A;  1Y00 A;  4IFY A;  4K5S A;  3OR2 B;  2AYG A;  1JLA B;  2NPI A;  5FD1 A;  5J2P B;  2XY7 A;  2J8S A;  2QRR A;  1RP5 A;  1HQU A;  3RUB L;  3TZW A;  5A0Y B;  8ATC B;  3DOL B;  2RVJ A;  3O3L A;  5C2C A;  4ILM A;  2WCX A;  1UEV A;  5IQQ A;  3T1Y J;  4QPT A;  3MR2 A;  2M5Y A;  4DBQ A;  2B4O A;  3OR2 A;  2VOO A;  2CWK A;  1S1U A;  2VG6 B;  5J2P A;  2F4V J;  1TKX B;  1P1T A;  2BQU A;  1V3S A;  2X3D A;  2CQ2 A;  4DF8 A;  5A0Y A;  3ZZY A;  2ZOG A;  3DOL A;  3AOB A;  3R6L B;  1FRK A;  1LK7 A;  1RXO B;  4TVA B;  1GXU A;  2VG6 A;  1UWA A;  5HI7 A;  3DU5 A;  4B3R J;  1TKX A;  4LF7 F;  2BAN B;  2UU9 J;  2KRB A;  3MAA B;  4W98 A;  3PO4 A;  1IJE B;  4I0W A;  1SJQ A;  3AD8 C;  3QT6 A;  5CD4 H;  1MU2 B;  1HQE B;  3W3S A;  3MM5 B;  3CJ5 A;  1HYS A;  2Y1R I;  3G6X A;  3BGF A;  2C2K B;  4BC9 A;  4YY3 F;  4GKJ F;  3OFH A;  2FHJ A;  3QQC D;  3HO1 A;  2BAN A;  1VJQ A;  3MAA A;  4XIU A;  2LEA A;  5LOQ A;  4A8F A;  3DRY A;  3KJQ B;  4LR9 A;  3AXM A;  1CS4 A;  2HWH A;  2J6S A;  3M9N B;  1MU2 A;  5ETN A;  1HQE A;  1S6O A;  3KDN A;  4AFF A;  2PFD A;  3WBZ A;  2XYG B;  4FF4 A;  3FBF A;  3HFV A;  3H2U B;  1ZAV A;  5HP1 B;  4ZVS B;  3RAX A;  2G2O A;  3KDO A;  4YB6 A;  2MZJ A;  2P2C B;  3PJ9 A;  5D6G A; 
#chains in the Genus database with same CATH homology
 2F4V J;  4LFA J;  1HNZ J;  5LM7 E;  4B3T J;  3IMQ J;  5IWA J;  2UUA J;  4B3M J;  4NEZ A;  5BR8 J;  4HHU A;  1HNW J;  1HNX J;  4JI6 J;  4DV7 J;  3R2D J;  5AJ3 J;  4JI7 J;  2KL8 A;  4YHH J;  1N33 J;  4NXN J;  1XMO J;  1FJG J;  4JI2 J;  3W1Y C;  4DV6 J;  5FLX U;  3JAM U;  4PWW A;  4LFC J;  4B3R J;  4DUY J;  4LF8 J;  3T1H J;  4NEY A;  4DV1 J;  4X65 J;  2UU9 J;  1IBM J;  4DR1 J;  1XMQ J;  1IBK J;  1J5E J;  4JYA J;  4DV2 J;  2UUC J;  4KY3 A;  4B3S J;  2MTL A;  4X66 J;  5LMN J;  5A2Q U;  5LMU J;  4JI5 J;  3OTO J;  4JI8 J;  4DR6 J;  2VQE J;  3J81 U;  4X62 J;  4JI4 J;  2UXD J;  3R2C J;  4DR3 J;  1XNQ J;  3J80 U;  4DR7 J;  2UUB J;  4JV5 J;  2MEW A;  4KYZ A;  3J7A N;  2VQF J;  4DR4 J;  4LF7 J;  4DR5 J;  1N34 J;  4LF4 J;  4JI0 J;  4JI1 J;  2E5L J;  4DR2 J;  4K0K J;  4GKK J;  1N36 J;  2ZM6 J;  4V1A k;  4AQY J;  4LF6 J;  2KVQ E;  4RJV A;  4LF9 J;  4OX9 J;  5IT9 U;  4DV0 J;  4KHP J;  2UXC J;  4LFB J;  2UXB J;  3D3B J;  3D3C J;  1IBL J;  4JI3 J;  4LF5 J;  2HHH J;  4YY3 J;  1HR0 J;  4GKJ J;  3T1Y J;  4DUZ J;  2MQ8 A;  4X64 J;  4DV3 J;  4DV4 J;  4NXM J;  1N32 J;  1I94 J;  4DV5 J;  1XNR J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...