1HNVB

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 91
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB03
4J9RA 4ZPDA 2D41A 3KLHB 4NLVA 3KHGA 3CDEA 1HQEA 3KJVA 4KHRA 4NLOA 4IDKB 4IRCA 4ID5A 1N5YA 4NLGA 2R2SA 1RTJA 1RT7B 4ED7A 3RAXA 3KK1B 1EETB 2IM3A 4O3RA 4G1QA 3H59A 1DLOA 1IKVB 3C6UA 2XCAA 3IN5A 3IRXB 3DLGB 3KHHA 4TQRA 3QO9A 3ISNC 4MKAA 4H4MA 1LW0B 3V4IB 1MMLA 2HWHA 3FRZA 5KFUA 2JC0A 3E01A 3GIMA 2W9CA 2RF2B 2BE2A 4NLXA 1C0TB 2JEFA 4IR9A 4NRTA 1N56A 1TVRA 3TAMA 4YR0A 2BQRA 2IC3A 2D7SA 3KLFB 3BREA 2GC8A 4FBUA 3CJ0A 4DL7A 3N6NA 4GC6A 4WFXA 1S1VA 4G3IA 4ZVGA 2BANA 1C0UA 2YNGB 1C0UB 3KK3A 2CKWA 1SUQA 3DOLB 1FKPB 4KFBB 1SH2A 3CIZA 2W7PA 4EBCA 4MH8A 5KFWA 2FJVA 2YNGA 4K4WA 5CYMB 3M8PA 1T05B 2GIRA 3NKYA 3RB3A 5DGAA 1EETA 3KMQA 3HKWA 5L1JA 2ASDA 4IFVA 4K4YA 2FLLA 5F8JA 4TY9A 1NHVA 3KJVB 4RW4A 5DLGA 3TAMB 5DLFA 1TL3B 2R2UA 4XPEA 4IH5A 4Q8FA 3QGGA 5KG6A 4GC7A 2RDJA 3E01B 4NLYA 1NHUA 2W9CB 3LAMA 4F50A 1KHVA 2VG6A 1S48A 1RAJA 4RNFA 4J9OA 4MK8A 2OH2A 2ZE2B 2IMWP 3OL7A 1RT4A 1Z4UA 1RTIB 4RW9B 4NLWA 5HP1A 4ICLB 1HNVA 1RT2B 3DOKA 3PW5A 2FJWA 5J2NA 1JLAB 3Q8SB 3M8QA 1J5OA 3BGRA 2XCPA 5KT5A 3DRSA 1LW2A 3NGDA 1JKHA 2V4RA 3MR2A 5J2NB 1EP4B 2B5JB 5I3UA 1S0MA 1HQEB 4KO0B 4EO8A 3KMSA 1RTIA 2ALZA 4IQXA 3CDWA 4ECYA 4PQUB 3KNAA 3HVWA 3V6DB 2YKMB 3IG1A 3NBPA 2WK4A 5KFFA 5EWGA 3PR4A 4ED1A 4ZP8A 5KFYA 1S9EB 4J9PA 3NAIA 1RTDB 4URSA 4IR1A 2B6AB 4O3OA 3RAQA 1RT3B 2HNZA 5L9XA 4DL3A 1SV5A 3DRPA 5KG4A 5DQGA 1VRTB 1KLMA 4RZRA 1HPZB 2IAJB 3MECB 3H5UA 1LWCB 4Q44A 3ITHB 3OSNA 2VG5A 1FK9A 3KLEA 5HP1B 4DEZA 4FS1A 2BQUA 2YKNA 2C2EA 1ZETA 4RW8A 1RDRA 2ZE2A 3LP0B 1RA7A 3MEEA 1SUQB 3DOLA 2YNHA 2BRKA 2W9AA 3RBEA 2AGPA 3HVAA 4LSLA 4LSLB 2WRMA 2YNIA 4ZHRB 5KFLA 2OPSB 1N48A 2R8GA 1NNDA 3JSMB 5J2MA 4RNNA 4Q43A 4K4SA 3BSCA 3D28A 3BSAA 4J9KA 3DDKA 1C1CB 4K50A 5HLFB 2R8KA 4O44A 1JLGB 5EDWA 1IKYA 2C28A 1C2PA 4R8UB 3DRRA 2GIQA 5CYQB 2ZD1B 4JV2A 4EEYA 4B3OA 5HBMB 1QE1B 3JYTA 4QWAA 4M95A 4NLQA 4K4XA 4WZMA 4KKOA 4YP3A 3E51A 5J2PA 2UUTA 2XC9A 3GV7B 4ED8A 4PUOA 1IKXB 2OPRB 3KHRA 4RW8B 1K1QA 1XR5A 5C5JA 1FKOB 3N6LA 5L1LA 4MIBA 1FK9B 3KLEB 3LP2B 2AX0A 2D3UA 5KT6A 3KLHA 5DGBA 2ASLA 1JKHB 2YNFA 2YNFB 4NLUA 4RW7A 2E9TA 3QO9B 3IS9A 3DYAA 2JLEA 4ECVA 3BQ0A 4R5PA 2HMIB 1TKZB 3HHKA 1RT6A 3EPIA 3I0SB 4ZVFA 4O3NA 1TKXA 5KT3A 4ID5B 2UVUA 3NBPB 4Y3CA 2FVSA 1HQUB 3T5KA 1TKZA 4JV1A 1S1WB 3RB4A 2FJXA 5EWEA 4F4YA 4ZVHA 2BQ3A 4IG3B 4ECQA 3NAHA 3KK2B 5CYQA 4Q8EA 4MFBB 1JXLA 1S9GB 1DTQA 2I5JA 2OPQA 1FKOA 4U7CA 2DPJA 4NLSA 4TN2A 5KG7A 5DG7A 1JLEB 2EC0A 3MEGB 3QYYA 1VRUB 1QUVA 2HWIA 3DLEB 2FVPA 1MU2A 4MK7A 4ICLA 4WE1A 5J1EB 4PWDA 1JLBB 1S4FA 4YQWA 2JC1A 3NL0A 3LP1A 4H4OA 3Q8QB 1S6PB 3FSIA 4TLRA 4DL4A 4ZP7A 2YNHB 3GIJA 1REVA 1LWEA 4QWCA 4NRUA 3LP2A 5C25B 3DI6A 3DMJA 3OSPA 1HARA 4J9SA 4ED2A 3DM2A 5J2QA 1JX4A 4J9NA 2C22A 5KG3A 4WXWA 4ZPBA 4ZPCA 4EBDA 3QIPA 5KG2A 3BJYA 3PW4A 1REVB 1HPZA 1S97A 2UUWA 1JLFB 3M8PB 4J9QA 1QE1A 4ZP6A 2W7OA 1LW0A 3V4IA 3QZ8A 4MIAA 1HNIB 1S1UA 3M9MB 2FLPA 3LP1B 5C24B 3LP0A 4RW6A 1R0AB 1TQLA 4U6PA 4ZP9A 5F8MA 1VRUA 3T5HA 3DLKA 3ITHA 2JEIA 4Q0BA 2AGQA 1RT1B 3FFIB 4I2PA 1T03B 1DTTB 3EZUA 3BSOA 5EUHA 2WOMB 4MK9A 3I0RA 5C25A 4ECZA 4HKQA 4JUZA 5FDLB 4XPCA 3QGIA 4QWDA 3OLBA 1LW2B 4ZHRA 4URQU 5KFTA 2JEGA 2IJFA 3CJ2A 2UVVA 3I5CA 3OHBA 3OHAA 1J5OB 1ZTWA 3CJ3A 5EWFA 1BQNA 5KFIA 3LAKA 1RT6B 1TV6A 2AWZA 3IG1B 3ICLA 3T1AA 4Y2CA 4JV0A 3GIIA 4ECUA 4IG0B 5KFGA 4ED0A 1DLOB 1JLQA 3C6TA 3PJWA 5F8NA 3KK1A 4RNMA 3QLHB 5KFBA 1U09A 5I3UB 2YKMA 3MR5A 4KBIA 2IM1A 1S9GA 5KFZA 4DG1A 1SV5B 3DOKB 5F9LA 2B6AA 2FLNA 5KFJA 3QIDA 4KHMA 4EO6A 3V6JA 1DTTA 1T03A 1S0OA 1RT2A 4YMEA 3RBDA 2J6SA 2R8HA 3V81A 5KG0A 2QV6A 4PQUA 4QPXA 1N6QB 1TV6B 5F9NA 4ED3A 1RYRA 4LQ3A 2ILZA 4NZ0A 1S6QB 3GYNA 3QZ7A 4KSEB 2W9BA 3RB6A 2BANB 3DRSB 1IKYB 3KK3B 4J9MA 5C42B 2CJQA 3I5BA 1XR7A 3M8QB 5HLFA 4EYHB 5KFKA 3I5AA 2V4QA 2WONA 1HNVB 4Y2AA 5KFDA 4F4WA 3Q8PB 3NMAA 3BQ1A 2WONB 4IFVB 5KFMA 4KKOB 5KFPA 1OS5A 4R0EA 3GIKA 2VG6B 5C42A 3PHEA 4RNHA 3PR5B 4J9LA 2XI3A 2RDIA 3FQLA 5C24A 3SFGA 5F8HA 3DRRB 5K14B 1IKVA 4RU9A 4H4OB 2IC3B 3V81B 3G6XA 1IKWB 5KFXA 2VG5B 5KT2A 1K1SA 1TVRB 1D1UA 2ATLA 2WHOA 3DLEA 4ECWA 4RUCA 3PW0A 3V6KA 2R8IA 3DRPB 3GV5B 2C2DA 5K14A 3DI6B 1CSJA 3KLGB 2OPSA 1SH0A 5KFAA 4ECSA 2R2TA 2J6UA 1LWEB 3OL6A 1RTHA 3GQCA 4F4ZA 3T5JA 1ZTTA 2VA3A 4IRKA 4QW8A 3H4DA 4H4MB 3MEDA 1S1VB 1GX5A 4DL6A 4O3PA 1RT7A 3IRXA 1JLQB 3C6TB 5L1KA 3I0SA 4ED6A 2XWYA 3BR9A 3PW2A 4G1QB 1S1TB 2IM0A 4LQ9A 4XO0A 1RTJB 3UPFA 1MU2B 1LWCA 4KV8A 2ZKUA 5DG8A 1JLEA 2F8EX 5DQIA 3MR3A 2WB4A 3BSNA 2RF2A 1LWFA 3TQ1A 2I5JB 3KHLA 3SI8A 1RT3A 4Q45A 1T94A 4DG1B 1UWBB 3KK2A 1S1TA 1GX6A 2WOMA 1S1XA 2BRLA 1RT5A 5KFVA 3C6UB 3RB0A 3HVTB 1IKXA 2OPRA 2JEJA 4NLRA 4ZMMA 4QWEA 2V0NA 4I7FB 2IJNA 4MKBA 3SFUA 4WFZA 4ECRA 3HVTA 4K4ZA 4RW6B 4R5PB 5KFOA 1UWBA 1BQNB 3D5MA 1D0EA 2IBKA 3DYAB 3H5SA 3IS9B 2AGOA 2FVQA 2W8KA 4KV8B 1JLAA 2BR0A 5KFNA 1HYSA 5KG1A 4IH7A 2E9ZA 5J2QB 5KFRA 1QAJA 4H54A 1T05A 1C1BA 5CYMA 4WYWA 3H5XA 1R0AA 5KFQA 2AX1A 5KFCA 1S1UB 4K4UA 1TL1A 4WZQA 4TY8B 1HMVB 1HMVA 5L1IA 1HNIA 5HBMA 4B3OB 5F8LA 5FDLA 3MFIA 1S9FA 4TQSA 3KLFA 1JIHA 2FVCA 3H5YA 3N6MA 4PWDB 2RKIA 4O4GA 5F8IA 4DL5A 4KE5A 1SH3A 4URGA 1RT1A 3FFIA 4Q0BB 4YR2A 3QGHA 1IKWA 2B43A 1TP7A 2IAJA 2BE2B 3MECA 4TXSA 4K4TA 5JXSA 2O5DA 2W9BB 1S0NA 4IRDA 1BQMA 2HNYB 1S6PA 1TKTB 3FDSA 1FKPA 4KFBA 4Y34A 5KT7A 5KFHA 1HQUA 2OPPA 5J1EA 3CVKA 2R2RA 4TYBA 3Q8RB 2XGQA 3MEEB 3H40A 5HROB 3QIPB 4IDKA 4WFYA 2WTFA 3PZPA 4NYZA 3T5LA 2HMIA 3DM2B 3IGNA 1C1BB 4EYIB 3DMJB 4M94A 2AU0A 4KO0A 4NCGA 3MEGA 3CWJA 1W25A 1C0TA 4IG3A 1N4LA 1I6JA 5DG9A 4RNOA 4MFBA 4IFYB 4NCGB 4QW9A 2C2RA 2HNZB 3G86A 4QWBA 3DLGA 3CJ4A 3MR6A 1T3NA 4RW9A 4FBTA 1RTDA 1RA6A 3OLAA 3G6VA 1JLBA 2VG7A 5KFEA 3PVXA 2HAIA 3LANA 1JLCA 1JLCB 4I7FA 4NLPA 2OPPB 3V6DA 3LALA 3CDUA 4O3QA 1RTHB 2XGPA 1QAIA 4FS2A 3MF5A 2IA6A 4RW7B 3KLGA 1EP4A 2B5JA 3I0RB 3H98A 4R8UA 4RW4B 4I2PB 3BGRB 1XR6A 2AQ4A 3EPGA 4EBEA 2HNDA 3OL9A 3QLHA 3FQKA 3M9NB 1C1CA 3H2LA 5KG5A 2J6TA 2UVRA 4IG0A 1KHWA 3GILA 5J2MB 3JSMA 3GV8B 4ECTA 1S10A 2IM2A 5DQHA 3OL8A 3JYTB 5J2PB 3TVKA 5HROA 5F8GA 3G6YA 3V6HA 4IKAA 4ECXA 4IFYA 1JLFA 4LSNB 3ISND 5I42B 4OL8A 4WYLA 2UVWA 3KLVA 4O3SA 2ZD1A 1TL3A 2ILYA 5JUMA 5T14A 4IOBA 4O4GB 2RKIB 2YKNB 4PUOB 3CJ5A 4O4RA 4ZPAA 3DLKB 3UR0A 3MTKA 2R8JA 5D3GB 1S49A 3M9OB 3BQ2A 2YNIB 1VRTA 4HYKA 1WNEA 1S6QA 3UDLA 1TKTA 2DPIA 3T19A 4X2BA 1BQMB 2HNYA 2XI2A 1N6QA 2QE5A 2ASJA 1S9EA 3PJXA 2W8LA 4F4XA 4IH6A 5D3GA 1TL1B 1JLGA 4O44B 2HNDB 1RYSA 1YVFA 3IGVA 1IM4A 2I1RA 4NLDA 3CO9A 4YR3A 4DL2A 4K4VA 2V9WA 1DTQB 2OPQB 3PW7A 3KOAA 3VQSA 2E9RX 5KT4A 2FVRA 1LWFB 4NLTA 2VA2A 1KLMB 1S1WA 4LSNA 5I42A 5KFSA 4TY8A 3UQSA 4KB7A 4KAIA 1TKXB 4I2QA 3KLIA 2VG7B 1RT4B 2WCXA 4TYAA 4RUAA 3MFHA 4WE1B 1RT5B 1S1XB 3H4BA 4WXOA 2D3ZA 3KLIB 4I2QB 4ZVEA 3MEDB 1HYSB 1N5YB
chains in the Genus database with same CATH superfamily
2RMLA 2LDIA 4NLVA 4OHXA 4BWMA 3KHGA 1WHWA 4WJBA 4I6AA 4LF7F 2HHWA 2KKHA 2YY3A 4Y2KA 3OV7A 4KGVB 2QSWA 4KHRA 3MCNA 4IDKB 4DR2J 3GWCA 1N88A 3N79A 4PEOA 1F2HA 2IYGA 2P6TA 3CJRA 4M5DA 4ED7A 3KK1B 2QC3A 1NK8A 2IM3A 3TJAA 4G1QA 1M5VC 4LF8J 1DLOA 2DRDA 3PV8A 5IT9U 2K8GA 1IKVB 1D8ZA 3PFOA 2QLXA 3IRXB 1ZM9A 2ADCA 2E1AA 2L3MA 1GEHA 1NPPA 2GMJA 2VFVA 2HWHA 2XHCA 2XMAA 1NDCA 1HBNA 1UP1A 2J9CA 3CGIA 4G6VB 3GIMA 2JEFA 1XN9A 3PXGa 4YDXA 4ILLA 4W90B 2J5AA 5AE2A 5DZ6A 3OVSA 2PI5A 3TAMA 3EUNA 4XDDA 4HHUA 4W4MA 3CC2S 4DLGA 4Q2LA 4J7CA 2IC3A 4LVOP 4NX9A 4PG6A 1P1LA 3EDRB 4ATNA 4C11A 4DV4J 1D9DA 1BLUA 4DL7A 1VHIA 3EZ5A 1GTHA 3ZC4A 4DV2J 4OYAA 4GC6A 1FXRA 4G3IA 1TFWA 2K3IA 2OJ3A 4ZVGA 3MAAB 4ZDNA 1C0UB 2CKWA 3E3XA 3HX9A 4ANCA 1FKPB 3GLJA 3W65A 1IQZA 3W8PA 2CJAA 1YGYA 2CZ4A 2DNGA 1HI8A 3EMTA 1NJIT 4HTIA 1URRA 3GCWP 2QGFB 4F67A 4U8VA 2FHJA 5G0RB 2K3KA 2XO6A 2Y1RI 1QAYA 1RK8A 2DGOA 1J27A 4NOHA 1PAEX 2ZHOA 3R5GA 1ELOA 3WBZA 4RW4A 2VBXA 1U02A 5DLGA 5DLFA 3D0GE 2KI2A 1Q1KA 1TUGB 3AB4B 1HNZJ 2QSFA 5B0DA 2E1CA 5ETPA 5KG6A 1RI7A 2ZNZA 3VR1A 3IWLA 2RDJA 2IA0A 1NHUA 1RU1A 1WEXA 4A4JA 1VYAA 4BHQA 4F50A 1EKRA 2KXNB 3IWNC 1S48A 2AHOB 3M30A 2RILA 3QBCA 5AXLA 2I0XA 1RTIB 1S99A 3HO1A 5HP1A 4ICLB 1NO8A 3NS5A 3VZIA 3CUNA 1JLAB 2KDOA 2MHNA 2O1PA 2B9EA 2JVOA 5GAHI 1Q86T 1NDLA 2DO4A 1Q7YT 3BGRA 4C0HA 3BBFA 3DRSA 2KT2A 2KU7A 1MWYA 2YQ3A 2WVDA 5KT5A 3MR2A 2LEPA 2J6UA 3UNGC 4DR6J 3DN9A 1OJ4A 4B3SF 4KO0B 1RTIA 4OHZA 1KP6A 1WSVA 4IQXA 1SC3B 2QMUB 2IDEA 4JI8J 1EHWA 4XK8C 3IRWP 4FNHA 1HNWF 3HULA 2J7KA 4FNIA 4LSZB 2OTJS 3P3DA 5KFYA 4OV1A 4AFFA 4URSA 4PXCA 4IR1A 4O3OA 2NPFA 1SKUB 1RT3B 1PBUA 1F9HA 2F63A 1SV5A 4M5JA 4Y2IA 4DU7A 4EK2A 1F6TA 1HPZB 2IAJB 2DCUB 3WZ0A 5I3PA 4Q44A 3ITHB 4DQIA 4DSIA 5HP1B 2Q6CA 4MT1A 4DEZA 1R8PA 4H4KA 2YKNA 1R27B 1LKZA 1URNA 1WC1A 2HBZB 4DPTA 2HHTA 2E5IA 4LFAJ 2CYYA 3I55S 1RA7A 3NY0A 2YTCA 3MEEA 2AGPA 3HT3A 4QQBA 3P8BB 2W9AA 1FNOA 1YJWS 1DZ5A 2C1EB 3HSJA 1FJGF 2UXBJ 2H9ZA 1WKLA 2W2PP 4PCQA 1VQ9S 2CPXA 1P6TA 1NNDA 1HNWJ 2H5JB 3P49B 4NA1A 3BBCA 3I4HX 2KHCA 2IVFB 4CO2A 4J9KA 1C1CB 2QYGA 4KHPJ 1NDPA 1WI8A 3QMQA 2XO7A 3OFFA 1JLGB 1UJ4A 4USMA 1RLCL 3SSRA 2C28A 1X60A 4CLFA 2GIQA 2CIMA 2ZD1B 1Y5IB 4EEYA 1FESA 2EK6A 3QT5A 1QE1B 4QWAA 4K4XA 1YKWA 4K59A 1PYOB 1RAEB 4KC5A 2XC9A 3GYGA 1HWKA 2AT1B 3EZOA 4FYWB 3JSYA 3KHRA 4RW8B 1K1QA 4CLZA 1FKOB 3F0NA 1DQ8A 1W26A 2JLFA 4OHWA 1FK9B 2DH7A 3GFZA 4DV6J 5GMKa 3ET6A 4OZLA 5D0GA 1SIWB 3FEZA 3MCMA 2H48B 4PPZA 1H72C 1Q8IA 4ZCKA 2ZH8A 2ZH3A 2C3PA 1WUUA 2NXJA 2JLEA 4OYBA 4OZ0A 5ETMA 2GV1A 1OY9A 1EQ0A 2ZWOA 2XBPA 3AODA 3MM9B 4ZPWR 1RT6A 5GVQA 3Q8YA 2IBOA 3CCWA 4JI2F 3FUYA 3TWZA 2BJ8A 1HW9A 1C4CA 2ZUAA 1EZZB 4RL1A 4A47A 4JV1A 2VQEJ 4F4KA 2CNKB 3ZZUA 1RWWB 1RLDA 3GONA 4UQGA 4ECQA 4DQSA 2R7UA 4CO1A 1O8BA 1U1PA 3NCQA 3TJ9A 3OVAA 2XNQA 3MURP 1M5PC 1M0SA 5H9FK 3QYYA 4L76A 1SKRA 4B9UA 2HQCA 4DR7F 2OSQA 2ACMA 1D3WA 3QGPA 1QSYA 2NQPA 5J1EB 3H7HB 3UD5A 2GHVC 2JC1A 3LP1A 1TL4A 3ZO7A 1NZ8A 4OYZA 1S6PB 1UPPA 3CD6S 5JJBA 3OUYA 3G87A 1AUSL 1A0OB 3FSIA 1TL7B 4LBPA 4TLRA 3NLCA 5B0BA 3GIJA 2Y1IA 2HHVA 4ED5A 1NXIA 4NPOA 4OHVA 4EUVA 2UXCF 2DCLA 2KT3A 3OSPA 2HBQB 3MCOA 3D6FB 1HARA 3DM2A 3QFHA 4DR2F 1M5HA 5KG3A 4K8RA 4WXWA 4EBDA 4ZPCA 3PW4A 4KTQA 5KOWA 3VV2B 5KG2A 4FVCA 1HPZA 1E6YB 2IDLA 2FIUA 2QL5B 2V94A 3AH6A 3L7PA 4LRBA 4YB6A 1JLFB 3U7JA 2FHMA 1SI9A 4L72B 1QE1A 1S76D 2W7OA 1LW0A 4J91A 3WIUA 3QZ8A 2FLPA 1GAOA 2VOOA 5AT1B 5C24B 4ZA1A 3LP0A 1R0AB 4P74A 1O51A 1TQLA 4P2XA 1FCAA 4LF4J 2N4CA 3A8IA 2E7VA 2UU9J 1S9FA 3DLKA 3QWUA 4QYZJ 1S7IA 1R8CA 2HFNA 1DTTB 3BSOA 2DD8S 2KT5A 5EUHA 5HQLA 3BBBA 3I0RA 4UOFA 5C25A 1OQ3A 3CMAS 1FVQA 1X4CA 4XPCA 2LXFA 4F36A 2KG0A 2DR9A 2OP5A 2JEGA 1RE1B 3MMJA 3PJ9A 4KQZA 2ZBQA 3LPEA 4RWXA 3UCGA 2BJDA 2DGUA 2DNQA 2DNLA 5EWFA 1BQXA 2WVFA 1VQOS 2AWZA 5CHCB 1B4SA 3R27A 4ECUA 3T1AA 4WIIA 2AU0A 3BYRA 4D3HA 3MAQA 1N56A 5GAGI 3EJMA 2FHOB 3ZNUA 1FD8A 3QLHB 1NSPA 2CA9A 5KFBA 3MR5A 1BWVA 5HJXA 4EFAC 2IM1A 2DR7A 3PACA 3CF5Q 5DJBA 4M1KA 3I96A 1SV5B 3R2CJ 2FD2A 3DOKB 2B4OA 4ZN1A 5LT5A 2FLNA 4PZVA 5KFJA 1NH7A 1U2FA 3QRQA 4LFBF 1DTTA 1X5PA 4HI2A 3ZZ0A 1S0OA 2DVIA 1RT2A 2J6SA 3TAQA 3V81A 3HT0A 5KG0A 4CQ1A 3PX0A 2QV6A 3W5ZA 2PSZA 4N76A 2M52A 1Y5LB 5B0FA 3RRHA 1V3ZA 1NLKL 2NR0A 4ILRA 1B0TA 1HI1A 3DRSB 1IKYB 1RABB 1U0HB 1WG5A 3B4DA 2MTLA 3FVYA 3MAAA 3I5BA 3Q2SC 3W2VB 1H98A 5HLFA 2CJYB 3D0HE 5KFKA 3I5AA 2F65A 2VQEF 1QM9A 2G2ZA 2O67A 1VGYA 1UW4A 2Z2YB 1U49A 1Y4ZB 5C7PA 1H73A 3MDFA 2WONB 1LQ9A 2YPZA 1VC5A 4XDCA 5KFPA 3G9CA 1MSWD 4MTPA 1YDLA 3DHWC 4RNHA 5RUBA 2V8PA 1LXNA 1UEUA 2Z8QA 4NA2A 2VFUA 5F41A 1HBNB 3FQLA 5C24A 5HVFA 2E5GA 2KFZA 1CLFA 1IKVA 1X4BA 2BKOA 1OSDA 5K5MA 3WX4A 4I56A 3ZTQA 2AV5A 5KT2A 5KFXA 2VG5B 2WSCC 1K1SA 3BDPA 2R7OA 1CS4A 1A6LA 3F44A 4I4BA 1IXKA 3VHQA 4CLSA 4C8OA 4LFCJ 2PMWA 2C2DA 5K14A 3DKDA 5KFAA 4RO0A 4LJMA 4ECSA 2R2TA 3QFWA 1SPBP 4C4WA 3CEDA 1WOSA 2FY8A 2VA3A 5ETNA 3NCPA 1K0VA 2RQMA 4WCEQ 4H4MB 1G3OA 2ZUGA 4QPTA 5GMDA 1NB7A 4F02A 1JLQB 4OJHA 5C2CA 2L9NA 4WU2A 1P1TA 1GXLA 4OX6A 2XMVA 1S1TB 3NGSA 4LQ9A 3J7YU 1X5SA 4L3KA 3UPFA 1SQEA 2Z57B 4CT9A 1BC6A 3A3PB 3LH2S 3N0VA 4B3TF 3UI3A 1CVJA 1UVIA 1Z2LA 2MKSA 2H54B 3BPSP 3FBBA 2MGZA 3SI8A 5ETKA 4Q45A 1T94A 4DG1B 1FF2A 1UWBB 3BN7A 4EZ6A 4JI5J 2WOMA 1S1XA 1RT5A 2R7SA 1TUVA 3RB0A 3HVTB 2WW4A 4C2MA 1GXUA 4X65F 4QWEA 1YRXA 2WAQD 3CB4A 4CH0S 2V0NA 3W9JA 5IV4A 3SFUA 4WFZA 4QOTA 4RW6B 3FJ2A 4MAKA 2DJWA 4R0JA 1VRQC 1YG0A 2B56A 1HQ2A 1VQKS 2IBKA 3NNCA 2UUCF 5BYSA 2HBRB 1X0FA 2F7VA 3C14A 3KUEA 3MD1A 5M2PA 2FVQA 2FHJD 3CJ8A 2RH3A 4H4KC 1HNXJ 2BR0A 4DSLA 3EVWA 2CUYA 3M8YA 5KG1A 1NUEA 5L39A 4DQPA 1T05A 3W61A 4FYVB 4NMXA 3H5XA 1UKUA 4ZIWA 1S1UB 1H0HB 4K4UA 4OI0A 2CPDA 3OTDA 6FDRA 2DNHA 4C98A 2RT3A 1RHMB 1B7FA 4YUDA 1PO6A 4UY8T 2YKAA 3OQ2A 3B78A 4LIRA 4OZ5A 1HNIA 5F0UA 2HGLA 1PSDA 4AXJA 3AJ2A 4DSFA 3M32A 4OI6A 4I68A 3N6MA 4PWDB 1SC4B 2YWWA 3IWXA 3GYXB 3MHYA 4KE5A 3TZYA 1QDUB 5LMNF 4A8WA 1SJ3P 5G4DA 3UVJB 4WP3A 1T9YA 4AQYJ 1IKWA 3TNVA 2BYCA 1BXNA 2ZHAA 2IAJA 2BE2B 2PFDA 1RAGB 1UA1A 4OJ1A 4QU6A 1S0NA 4IRDA 2HNYB 1KS2A 2GJFA 3HHNB 1TKTB 4ES1A 4KFBA 3W5YA 3AQOA 2NCKL 1FFGB 3NEKA 1GT8A 2LA4A 4A48A 3HHDA 4DCJB 2ATCB 2V2KA 5KFHA 4I6WA 1T9TA 2R2RA 2XGQA 3H40A 4NWBA 3MEEB 2D9PA 4RWWA 1S4EA 4FKXA 3BO3A 4MJKA 3PZPA 2WTFA 1FHTA 3FKBA 2F4FA 1U1OA 3IGNA 1C1BB 1U24A 2CQGA 2CVIA 1HIYA 2XSJA 4L6V3 4U96A 4KO0A 8RUCA 5HATA 1SJ4P 2C3UA 3LO3A 3UCUP 2JLGA 4RLEA 4DFPA 1N4LA 5DG9A 4N8OA 2UUAJ 2RRBA 2FPHX 4IFYB 2LCWA 2VD3A 2VDHA 2B0GA 4HACB 5F0WA 3G86A 3RBXA 4XTTA 1K9MT 6AT1B 2OD6A 4DR3F 4DV3J 3OLAA 2HHHF 1JQGA 2AJ1A 2BXJA 2BM1A 3Q24A 2UU9F 2CQCA 1VK8A 3LANA 2HHUA 3MXHP 1HBUA 1GMVA 2Y8WA 1CULA 1KOOA 2GS8A 3EM1A 1IQTA 1R8HA 2MKYA 3LQVA 3CTRA 4A8FA 2ROPA 3LALA 2XSFA 2Y0SD 2D1CA 3D0IE 1VQ6S 4GKJF 2NXUA 2G2OA 3DOMA 3RW6A 4CO4A 3KLGA 2GVZB 2GZOA 3H98A 2A6OA 3CIMA 4R8UA 2CFXA 5BXIA 3CCES 1SKSA 4RW4B 1M1GA 4I2PB 3BGRB 1ZAXA 2V69A 4WKYA 4OMFG 3EPGA 1U7LA 3KJNB 3H2LA 3TVYA 1R6VA 2HW3A 5D4OA 5J2MB 3GV8B 4RBUA 3OL8A 4U7UK 1HBOA 1V6HA 3M30B 4ID8A 1X0PA 4ZJLA 3G6YA 4ZK7M 2ZJRQ 8AT1B 4LF7J 1YJVA 4OL8A 3R5BA 1YHQS 1JJ4A 1CJKA 3KLVA 4O3SA 2AYEA 2BZ2A 2Y9HA 1RISA 3CC7S 2VKRA 4ZLLA 1N5QA 1V5IB 2HURA 1YSJA 3A4TA 5T14A 2FTRA 3CJ5A 4QIEA 1FO1A 4X4RA 1KRPA 3OR2A 3M2UA 3A3NB 2R8JA 1S49A 2UUBF 1VRTA 4X4SA 2G0IA 2N3LA 3R5DA 1S6QA 1FRHA 3SCIE 2DPIA 3MCSA 1RAIB 2ASJA 2DNOA 1YRUA 2L9WA 4IH6A 4JOUA 4F7VA 1TL1B 3LA0A 4M5DB 1CJTA 5SZTA 2OFGX 1RYSA 3IGVA 4NLDA 1IM4A 4F3OA 1QAXA 2P6SA 2AEMA 2RNEA 4M5IA 4TU9A 3VQSA 2XY7A 1JB0C 4YS2A 1L3SA 1SVDA 2PA8D 4NLTA 4YDDB 4LF6J 1KLMB 1P9QC 5DM7Q 1S1WA 4YY3J 3W9HA 1KTVA 4KB7A 4KAIA 1TKXB 2A6MA 5CD4H 2M8DB 3KLIA 5FD1A 1Q8LA 3I4PA 4HTJA 1VQ7S 1UJ6A 1GMUA 4WE1B 2BE9B 3VWSA 3MFHA 1RT5B 1NAQA 1S1XB 2CPHA 2HQ3A 3IBFB 1R8AA 2D3ZA 3M6XA 4WXOA 4ZVEA 4ZIVA 3V6HA 3IAM9 1VQYA 1VQ5S 1S72S 3U1MA 1VK3A 4DOZA 1YJTA 4ZVSB 2D41A 3MM6A 4KYZA 1QVGR 2GVZA 3CDEA 3VAGA 2FZKB 1WTFA 5FLXY 1NSQA 2MJNA 5IWAJ 3LW5C 4QR1A 3PIOQ 4B9SA 2BW2A 1KQKA 1DHMA 1V3SA 4KHPF 1NKBA 4IRCA 2R2SA 1YBTA 1Y9OA 2EFQA 3F56A 1EETB 2EFGA 2NYIA 4TU8A 2V67A 1T02A 1RZMA 5B0EA 1X9SA 4KPCA 3IN5A 3CDBA 4DX7A 3ISNC 4MKAA 3EVOA 3VGTA 3FRZA 2M88A 2OAUA 4OI3A 1RWUA 4PYDA 3ILOA 3E01A 3PDNA 4PG8A 3K5NA 4FP9A 4K0KF 2KFNA 3R7BB 1NPKA 2NYHA 4LT6A 3ENAA 4NRTA 3S8SA 1GNKA 1MROB 3PG9A 4LFAF 2MLYA 2ZH1A 1KD1T 2HWTA 4WWSA 1TAQA 5A8RA 2P8IA 3HFKA 4CO0A 4DS4A 2D7SA 3KLFB 2GC8A 3KKFA 3WX8A 3AOAA 3CJ0A 4DR1F 2NREA 5DZ7A 3KFWX 1UWAA 2QA1A 3OXFA 2Z2MA 4ZVRB 2W4DA 2EFNA 2CJXB 1VHFA 3KK3A 2PC6A 3C16B 4UZBA 3LGMA 3DOLB 2ZHBA 4KFBB 1N5TA 1ZA1B 4AE5A 5KFWA 2FJVA 3FCWA 4X62F 3RB3A 5CYMB 3M8PA 3FGVA 4FPRA 2CPZA 5EX0A 1EETA 3N5BA 3KMQA 1LFPA 1M90T 4IFVA 4K4YA 3TUZC 1U1QA 3JSBA 1LV5A 4TY9A 4QU7A 1NHVA 3M7VA 4HVZA 2GFFA 2MZQA 2HKEA 2H5EA 1TL3B 3P5BP 3AA8A 1OSCA 4IH5A 4PXDA 2GVDA 5CABA 2LEAA 3H2VE 3E01B 4NLYA 3VF0B 5HMWA 2HZVA 2MB0B 3I56S 4CDIA 1E6VB 1KHVA 1FWPA 1NSKL 4KH0B 4F0MA 5JVHQ 4RNFA 2FC8A 3VALA 4JV5F 1FTCA 3ZTRA 2CPEA 2Q79A 9RUBA 3BR8A 4NLWA 4RW9B 4B02A 3TZXA 1HNVA 4KGMA 3DOKA 3PW5A 5J2NA 3Q8SB 1J5OA 2X1AA 3Q2TC 1WKKA 5E3CA 4DPXA 3NGDA 1JKHA 1NB2A 2MQ8A 2WSFC 5IFMA 2QL7B 1YQHA 2DYAA 3KMSA 3JS9A 2ALZA 4ZKAA 1NJWA 3GQCA 4A46A 4EI2A 4Z2XA 3V6DB 4DV7F 1TU0B 1ULRA 2CPIA 1R0CB 3NBPA 2B3TB 2WK4A 3ONQA 5KFFA 3VGSA 2XM3A 3RGIA 2FLOA 4HLBA 1N8RT 4GKKJ 4GVLA 3HFVA 2RJZA 1VBYA 3DDNA 1VBKA 2BOAA 1WC5A 3RAQA 4DR4F 2HNZA 5L9XA 2ZBIA 1YJ7A 3MTJA 2MGZB 3PW7A 3DRPA 4X4OA 5AXKA 5KG4A 4DUZJ 1VRTB 1OPZA 1KLMA 3SCJE 3I9V9 3MECB 5FLXU 3CCQS 1SL1A 3THTA 1Y00A 4J9VA 1SC6A 3KLEA 2HIQA 3BPDA 1NDKA 1X5OA 2C2EA 4U7UD 3FCVA 1R6YA 3OR1B 4F3MA 4WK3A 2IVMA 3BO4A 2CQ1A 3LP0B 1PILA 5DM6Q 1KTQA 1SC1B 3JTNA 3EGNA 3M2RB 4DUZF 4DR3J 1FI4A 2HHHJ 1VLYA 2Z58B 3RBEA 4OX8A 4LSLA 1MWQA 2WRMA 2IYIA 2C3OA 3B8HA 5KFLA 2B51A 2BKNA 5HJYA 2R8GA 2EG2A 2DNZA 3AY0A 3ENQA 5DDRC 4LF8F 3C46A 1FXLA 5J2MA 2G1HA 3TR5A 3SCLE 3D28A 3NXZA 1X31C 2VPXB 3DDKA 1VQ4S 3GB0A 3MUVP 2DHGA 2MQMA 2R8KA 4O44A 3NGRA 5EDWA 2DGSA 2A1BA 2M5YA 4R8UB 2HS0A 2WBRA 1TTHB 1XWLA 3SQGA 3C15B 3ETOA 4AL6A 4YFUA 3PEHA 3W7BA 4M95A 3AJ1A 1UA0A 3O6QA 4NLQA 1NBEB 4WZMA 1M1HA 4YP3A 4N41A 2B9WA 3L9ZA 4L75A 1WC0A 4PUOA 2AZ1A 2OPRB 3MEKA 3MMAA 4CRJA 1Y3JA 2L48A 1PIEA 3HXMA 5L1LA 4MIBA 3KLEB 4J37A 2AX0A 5KT6A 1H3DA 2JJ4D 3KLHA 3OFGA 4N77A 1RTZA 2ASLA 3M8RA 2YNFA 1FRKA 1I94F 2ZZMA 1Q95G 2HHSA 4NLUA 3QAUA 2E1MC 3CJTA 2E9TA 3DOMB 3QO9B 4P2SA 1CQMA 4P72A 5B09A 3CCLS 2DNMA 4ECVA 4TLQA 1BGXT 1U6FA 1JJCB 2EKNA 3MM9A 3MR7A 4LMZA 3EPIA 3I0SB 4OI1A 2VKZG 3TUJC 4NEYA 4X4VA 3NBPB 2FVSA 4HH0A 1TKZA 2G13A 2PD1A 2ZKTA 2FJXA 3D68A 5EWEA 4ZVHA 2BQ3A 3KK2B 1GMWA 4ETZA 5CYQA 2DNKA 4OYMA 2F4VF 2LLZA 1FKOA 2YXLA 3D66A 4O0IA 2DPJA 4NXNJ 1X5TA 5DG7A 1NPRA 2HWIA 4DL0C 2UXCJ 3DLEB 2FVPA 3CD0A 3D6TB 3MGJA 5MAOA 1S0VA 4PWDA 1JLBB 1D09B 1WHVA 2CQPA 4YQWA 2M2BA 1Q4RA 3Q8QB 3RRKA 4DN9A 3K2YA 1Q82T 5BR8F 3ZFVA 1U2CA 1KC8T 2NUUG 3QT8A 2MZSA 4ES3A 3D54A 4ZP7A 2YNHB 1REVA 4NA3A 2DXFA 4J90A 4V1Ak 4WFAQ 5C25B 1L3TA 1XJWB 2DK2A 4ENOA 3O8WA 2GA7A 1RADB 1FNXH 4DSJA 4LF5J 4J9NA 2C22A 4YB1P 1HBMB 2BJ3A 2C2ZB 3QIPA 2LU2A 3NWRA 1REVB 1S77D 1REGX 4OJGA 3GG1A 1S59A 2UUWA 4KIAA 5ITHA 3M8PB 2IMOA 3V2UC 4ZP6A 3V4IA 1M5KC 4MIAA 1HNIB 1FX4A 2AZ3A 3M9MB 4W92B 5FJ4A 1PBAA 1U45A 2J7WA 4RW6A 3GZ7A 3FEXB 1FRIA 3GFYA 4HH1A 3WQPA 3C16A 3ENWA 4TU7A 4FYDA 3CCMS 4ZP9A 4M5HA 3FBCA 3TZZA 5F8MA 3T5HA 2YBVA 3ITHA 2GQCA 2J8SA 3FFIB 2BACA 1T03B 2AGQA 5GAGU 2WOMB 4MK9A 4HHJA 3AB2B 2V2ZA 5A8RB 4HKQA 2X3GA 2XMWA 3EVMA 5FDLB 4OV6A 4FN5A 3QGIA 5CH7B 4JUZA 1MROA 1LW2B 2C2KB 4FDFA 4URQU 3SDEA 2MQQA 2ZH9A 1WOOA 2F8HA 2KXHA 2UVVA 2EEYA 2W1BA 2Y0BB 1B0VA 4WK1A 4P71A 3AQPA 1IBKF 1FA0A 1HHQA 3GIIA 1AB8A 5E2QA 2PEBA 1EAYC 4IG0B 1JLQA 4HI1A 1TMJA 2VH7A 3PO4A 5F8NA 4I1TA 1U09A 2AJ4A 2YKMA 1WC3A 1U6BA 2OI2A 2Z30B 1T9WA 2F1FA 2LQJA 4NZ7A 4RPFA 3EXCX 5M2UA 2QLJB 1UCNA 4DG1A 5KFZA 1WG4A 1F60B 2ROGA 2X1GA 1Q5YA 3AOCA 1R43A 2YX4A 3GFHA 3HMJG 5F9LA 2VZ9A 2YWEA 5CYJA 3DGVA 4KHMA 4EO6A 3ILLA 3MPDA 3W5XA 2LQBA 2GMHA 3I6PA 1KWMA 1S6UA 1YBUA 3CCVS 1FDNA 5K9FA 2OFHX 5THWA 4PQUA 2E1RA 3L7OA 2BUNA 1RYRA 2ILZA 2HVIA 4NZ0A 4DXLA 1UFKA 3QZ7A 3RB6A 4KSEB 2M3DA 1FFWB 5E7OB 1ZM4A 2HIYA 1KQGB 4QYRA 3BN4A 4J9MA 4YHHF 3K89A 3Q89A 4JI3F 1N32J 3M8QB 4LBIA 1RACB 1X4FA 4L3NA 3DRXA 2WONA 5EX3A 2V4QA 2HRUA 1KLNA 1YWXA 2MQLA 3Q8PB 4JI6J 3B82A 1RHRB 2ZH5A 3BS9A 4Y00A 3DFEA 1VJWA 3CW2C 4DCPB 5LJ5Y 3R8YA 3BQ1A 4DS5A 2CPFA 2KM8C 5B0GA 1CJTB 1RWOB 2IRYA 1SL2A 2VG6B 1IM6A 2P5VA 1LK5A 4Q7AA 4KH1B 1UPMB 4USJC 4PWUA 2PT0A 2V2VA 1YZ7A 2ZBPA 1HLWA 2V8DA 2Q43A 4RJVA 3SFGA 3CCUS 2G0CA 2VJVA 2R7VA 2DH9A 2RQKA 4H4OB 1K47A 4OYOA 3S6EA 2IC3B 3V81B 2QEXS 2B4PA 2P9EA 2F3JA 2JNJA 1HI0P 1RSCA 2QLWA 3L4BC 4ECWA 3G4SS 2R8IA 5I3QA 3DRPB 4LF4F 2LQ5A 2QX0A 2XMTA 5D6GA 2MXYA 3DI6B 3TARA 1IBMJ 4DF4A 1XNQF 2SXLA 2R7QA 4USKA 2F9JA 2Z4PA 5E41A 1LWEB 3OL6A 1RTHA 1FRJA 3G96A 2KB2A 2ZM6F 1ZTTA 3EGWB 4HEA9 2QJ3A 1G6BA 2MQOA 4DUTA 1QSLA 3H4DA 4IRKA 2UXDF 2M4MA 3MEDA 1S1VB 1G7CB 4DL6A 4B9VA 4OYPA 5T41A 1MMNA 3MI7X 1KSPA 1XNQJ 3GMGA 3TANA 3K58A 2XWYA 3BR9A 5HL7Q 2HQFA 1RJJA 1ROFA 3K7RA 2IM0A 5A8WB 4P75A 1Y10A 1RTJB 1CJUB 1YBAA 4KV8A 4C0OC 5LM7E 3JQJA 3FZ2A 1NK9A 4LUBA 2F8EX 3BSNA 3EWGA 2WB4A 3KNGA 2RF2A 1LWFA 3UW1A 4WKRA 5CAAA 2I5JB 2XMJA 3KHLA 1RT3A 1U48A 1WF0A 2WBMA 1TKDA 1GX6A 4AUKA 4C8LA 2H1YA 1IJEB 2RAQA 3C6UB 5KFVA 4C48A 5JMNA 1NSAA 1EARA 4NCAA 1W2IA 4ZMMA 3IBCB 2IJNA 3PIPQ 4PRFA 4LF1A 4WU3A 4R5PB 3OD2A 4B3RJ 2V6AA 3CJQA 1D0EA 1RAFB 1X4HA 3H5SA 2AGOA 3JTPA 2GHWA 1U1RA 2E7WA 1XTZA 4QIFA 2DBBA 4LF6F 3I82A 6FD1A 3HM9A 2PFFB 1JLAA 2H3EB 3M2VB 4PYAA 1EJ7L 2E9ZA 1HYSA 2JFKA 3TO8A 2R7XA 1VISA 1C1BA 5CYMA 3D6HB 3PYFA 1T9VA 4RBVA 1Q78A 2H4YB 1G1XA 5ETVA 1HWLA 4O0NA 4DZDA 3KTQA 1O5JA 2XG8A 4BWJA 1HMVB 3GPAA 1HMVA 5L1IA 5HBMA 1SIZA 3D7SB 3MM8B 5J1PA 4X4TA 5FDLA 3UN2A 3MFIA 3KLFA 2FVCA 1JK9B 3I31A 3M05A 3T6BA 5HMZA 4DL5A 3UR3C 3FFIA 2A18A 5CCLA 2B43A 3K8WA 4UOGA 3MM7A 1VIXA 2V8GA 2AD9A 1H38A 2W9BB 4DX5A 1BQMA 1BE4A 4B3TJ 2KJWA 1FKPA 1U1MA 3M1VB 1RQ0A 2AMCB 2FDNA 3DDIA 3HLUA 3R5CA 4USUA 3V5RA 4DV5F 4X66F 3CVKA 4DV0F 3CXCR 2LU1A 4OLOA 2CJ9A 4USIA 3QIPB 2LYVA 4PR6A 7AT1B 4PABA 4CYUB 1U4BA 5D4NA 4NYZA 3CCRS 3CD7A 1S12A 1Q5VA 4EYIB 3H25A 1NK4A 2ACYA 2LMIA 2RHQB 2RSQA 5T7LB 1S5ZA 3A8KA 1W25A 2YH0A 3H20A 4B17A 2DGXA 4CO3A 5DDPC 2J9DE 4NCGB 1RAHB 2C2RA 5IQ6A 2JWNA 4P2MA 4QWBA 5L38A 2CNNB 2OUGA 1RTDA 1RA6A 2X3DA 1RWXB 2M8HA 1JLBA 1I3OB 2KL8A 3UWTA 3G6VA 3PVXA 1RUSA 4ELVA 3QQCD 1JLCA 1JLCB 1LK7A 2I6WA 2OPPB 2HAFA 5EHHA 2HG4A 2MQNA 2EC2A 4R25A 3HJVA 4QIWD 3C3LA 2HFZA 4B9TA 2XGPA 1RTHB 2E5LJ 1QAIA 1YJNS 1HD1A 4NI2B 1EP4A 1RB0A 3ZTOA 2EBGA 1WC4A 2HRTA 2MPUA 2GIFA 4P73A 4USTA 4F8RA 1XR6A 1KVIA 3GE9A 1GQEA 3HK2A 3OL9A 1C1CA 1U1KA 3CCJS 3W2WB 3G8QA 4F0KA 5L9NA 2VFRA 1L3VA 2UVRA 3D2WA 1UEVA 1S10A 4DWIA 3RBZA 2IM2A 2CWXA 4C9DA 2YX7A 3C15A 4C3KA 3L09A 4ECXA 4B3SJ 4JI1J 3RRGA 2HFSA 1PYTA 2VONA 1Y7PA 2F8MA 4HDGA 2CQ0A 4BC7A 3MUTP 1AXQA 3QJLA 3WDOA 2ZD1A 3OR2B 5A2QU 3LWMA 1NMEB 5JUMA 4CI0B 4IOBA 2RKIB 2YKNB 4PUOB 2DGTA 2VBZA 4O4RA 3U1LA 4CLWA 3SV3A 3ZZOA 4ES2A 2E5HA 3MTKA 2VUGA 1RXOB 1ZPWX 3AD8C 2AJFE 5ETRA 4U95A 3SIPB 2J9DA 4N5SA 3M9OB 3BQ2A 2F4VJ 1WELA 2E1PA 2LQ8A 4RUBA 3RG6A 4JI7F 1WNEA 2PN6A 1YZ6A 3UDLA 4CTAB 4X2BA 2YX1A 1HHSA 2IFXA 2QT7A 4NYOA 1PJ5A 5E3PA 3PJXA 2W8LA 4F4XA 5DO2A 4IO9Q 5D3GA 1PKUA 4P9SA 2K2PA 4O44B 1BD6A 2E66A 2NUHA 2M9KA 1XEZA 3OJUA 1BY9A 1R0BG 3S01A 3G2XA 1OY6A 2WW8A 3CO9A 3VCDA 2GGPA 4O23A 2BJ7A 2HK2A 1OY8A 2V9WA 1DTQB 2OPQB 3R3TA 3HHLD 2GMLA 2OGUA 2YWFA 4GRSA 2GAGC 5HANA 3T1YF 5D15A 3OPKA 5A8KA 5LMUJ 1H7WA 1SJQA 5CZVA 1NHKL 4JI0F 1U1LA 3UQSA 3HHLC 1FJ7A 4TY8A 1B3TA 3OXGA 3PKYA 1PAUB 3PCOB 2HVEA 3FZBA 3IR7B 3M2RA 4DDFA 2JX2A 3OXLA 1UFWA 3W66A 5ADZA 2D3OR 1IN0A 4RUAA 4U9RA 2EI5A 2ZDOA 1NH8A 1CG2A 5LJ3Y 3H4BA 4DUYJ 4I2QB 4B9LA 4E0DA 4PXEA 4LQ3A 5B0AA 3M8ZA 1DFDA 3RR7A 1XK8A 4ANDA 2VDIA 4F26A 3U1NA 4ZPDA 3SDEB 3HHLA 3NGUA 4EWTA 1F0XA 1NK0A 2RIJA 3CO0P 2NZ4A 2ROEA 2CQ2A 4ID5A 1N5YA 1RTJA 1RT7B 1CJUA 3A1YG 1KBRA 3HD2A 1G4CA 2KFYA 1SQGA 2WVBA 3RAXA 3H59A 2DB1A 4O3RA 1R31A 2XCAA 1ZPVA 2QN6B 2D9OA 2ZH7A 4OZ3A 3V4IB 2DGWA 3HZEA 4F4ZA 2JC0A 2BVZA 4NLXA 2BE2A 5D4PA 4IR9A 1VI7A 3P5TL 1NZAA 2CDQA 2KO1A 2QA4S 5IT4A 2UP1A 2ADBA 1TVRA 3VQTA 3AOBA 2W2MP 4DHVA 4YR0A 2KM8B 2BQRA 5KT7A 3BREA 3M32B 4ERDA 4LR7A 4FBUA 4F4AA 5LXRA 4EMDA 4JI4F 2HZCA 2BANA 2W7PA 1SUQA 4DR4J 1SH2A 5DRKA 2IRUA 3ETMA 4X4PA 3OT9A 5CZXA 1DRZA 3HJFA 4MH8A 1ZM3A 2B8PA 2RU3A 1XMQJ 5HI7A 1N5VA 2B7CB 1WJ9A 2GIRA 1T05B 2KH9A 3NKYA 4QIVA 5FIIA 3T1YJ 2D3O1 4Q8EA 3HCXA 3PTWA 4ZVOB 4QBUA 3HKWA 4CNZA 5L1JA 2ASDA 1CPZA 3J81j 5L8RC 5CXTA 2MZJA 3FNNA 4J9UE 3D4JA 3C14B 1FXDA 4IOAQ 3TAMB 1UJ5A 3W9IA 4Q8FA 4XPEA 4BCAA 2DGVA 3T6JA 1H2UX 4GC7A 1SJRA 1SL0A 3A3OB 3N28A 4YEAA 3JTOA 4YN3B 4CLTA 2IRXA 3LAMA 3KUGA 3DLBA 3N01A 1ITPA 2MDAA 1RAJA 2MHEA 4J9OA 1GH8A 4JV5J 4M63A 3MUMP 1ZAWA 2ZE2B 1Q7LB 1S57A 5E0OA 3OL7A 2MZ1A 1RP5A 3AXKA 7FD1A 3T1HJ 1WHYA 4M5MA 3OVBA 4E98A 2FJWA 1WDTA 4A8QA 2K1RA 2QL9B 2DY1A 2JL9A 2XCPA 2OMLA 4ZLNA 1H2VZ 4FPIA 2APOA 2B5JB 1T7PA 5I3UA 2BJ1A 1S0MA 2HVHA 4CH7A 5HO4A 1FJEB 2M70A 4ECYA 4Y6IA 2JDJA 1W7WA 3SXLA 2YKMB 2OEJA 1TMMA 4F2RA 3DHXA 4EU0A 5EWGA 1N36F 3PR4A 5ETTA 4ED1A 4ZP8A 1O0PA 2LVWA 3NAIA 2MMYA 3GCXP 3EXYA 5F3ZA 2B6AB 1FJGJ 4RX6A 2XLIA 3P96A 4ETXA 2W7AA 4DL3A 1S6OA 3RR8A 5IC6B 4ILMA 2AIRB 2MY7A 4RZRA 2XZTB 2ZDPA 3H5UA 3PRBA 1LWCB 2CNLB 3SEOA 3OSNA 2VG5A 1FK9A 2XNRA 4UF4A 1ZETA 4RW8A 3CE8A 2ZE2A 3BZQA 3D1OA 2KVQE 4X65J 3UD3P 1HWUA 3HSDA 2YPYA 1OMSA 3BH6B 2FJDB 4F25A 5A6PA 1SUQB 1V9OA 3VZHA 5M2RA 4ER8A 3BGOP 3GSDA 4B08A 4JI5F 4LSLB 3HKZD 1Q81T 2V5HG 2XTJP 3IBWA 1ZZNA 4ZHRB 2OPSB 3VGVA 2C2NA 4NEZA 1MN7A 2DISA 1PYSB 3JSMB 4B3MJ 2PGCA 4Q43A 2DT9A 2VPZB 2MKKA 4DV3F 3X1LB 1VR6A 2C42A 4N56A 3LGNA 2KYXA 5HLFB 2YQ0A 3UDVA 4K50A 3M6UA 4C6AA 1IKYA 4MKYA 3ENVA 1D9FA 2L9DA 4X84A 4X66J 4LR9A 3QATA 1TAUA 4B3OA 2CG8A 4I6YA 2E7XA 1GFWB 5E3RA 4YOEA 3K17A 3AFGA 5IT9Y 1N5SA 3BDEA 4KKOA 3C66A 3TA1A 3E51A 4LFCF 3GV7B 2CQDA 4ED8A 1IKXB 2HEKA 2DHXA 1AROP 2VL1A 3HI9A 1XR5A 3HZGA 1FFSB 3RU0A 2JOQA 3LP2B 2WZ1A 3GR1A 3D1HA 3O3LA 3HDSA 1JKHB 4GMKA 2RU9A 3WC2A 4JYAF 2MJUA 4RW7A 5HAOA 4LRCA 3VAFA 4F3QA 3IS9A 3DYAA 1HBOB 2YVSA 3BQ0A 4DFKA 4C0BA 5ETSA 3MPYA 3DU6A 1TKZB 2RHSB 3HHKA 1GXTA 4X64F 1IBLF 4ZVFA 1FRMA 1LEOA 4O3NA 3E2EA 4ID5B 1D8YA 2OMOA 3AA9A 1JMTA 2RS8A 3GJQB 4LRDA 4PWWA 4Y3CA 1XMQF 3RB4A 2WB1D 5IT0A 4F4YA 2EKYA 2L08A 1FE0A 5IV3A 2FZGB 2XEXA 1U6ZA 2AP6A 1S9GB 5HQMA 1DTQA 2OPQA 2VFTA 5HVGA 4U7CA 2XLJA 4DV2F 2W2NP 1IUJA 5KG7A 2KZZA 2QFJA 1JLEB 1X4GA 2VB6A 3Q8VA 4LF9F 2EC0A 1A9NB 1QUVA 4QR0A 4MK7A 1MU2A 2BM0A 1HBUB 3PHTA 3QAEA 3TX0A 3RAMA 3HP6A 4ICLA 1F3VA 4DV1J 3MPVA 4FF2A 1S4FA 3N4WA 1U2RA 4YB7A 2DNRA 2ZC3A 1RWMB 2KJVA 3A12A 4CCHA 1V5VA 4CWBA 2MSTA 1B99A 1ZA2B 4ZVQB 2OHDA 2XHWA 3MOZA 3DU5A 4PG4A 2DHSA 5HN0A 5A0YA 3J7YI 4QWCA 3LP2A 3EYZA 1BWEA 3Q8UA 3QT6A 2DXDA 1IBCB 4AL7A 1JNRB 3QSIA 1U1NA 5J2QA 1MLAA 4DU8A 2EWHA 4ZPBA 2Q1LA 3BJYA 3GG0A 4LR8A 1ZS6A 4IUFA 2JH3A 4OLPA 1S97A 1SBRA 4WP8A 2O66A 3FCHA 2DH8A 4GKJJ 3CJKA 4ALZA 5AJ3F 2CRLA 3FSYA 3F41A 4J9QA 2ZH2A 2XZWA 2LFVA 1S1UA 4N7TA 3W3SA 3LP1B 4DPUA 2AJ2A 2BV3A 3MWBA 5HMXA 4DUYF 2J0SD 2D74B 4U6PA 3L7UA 4OQJA 3BB5A 2JEIA 1HD0A 4ZCIA 3EZUA 1WD6A 4CH1A 5K8PA 4USWA 4ECZA 2EXUA 4C8KA 2CADA 1LWXA 4P10A 1OPIA 5E33A 3OLBA 3J7AN 4DBQA 4ZHRA 1KVJA 4PPDA 5KFTA 3ULHA 2IJFA 3CJ2A 5CQGA 5LMUF 4Q5VA 3OHBA 3CJ3A 1ZTWA 5D77A 5AJ3J 1VQPS 1KDNA 3AD7C 5KFIA 1RT6B 1TV6A 3ICLA 3IG1B 2FHKA 2LXUA 3FMWA 4J5OA 5J1NA 4JV0A 5CCMA 5KFGA 4ED0A 1DLOB 2W2QP 3PJWA 3KK1A 3UD4P 3O2IA 4IO1A 4NE9C 1FTRA 1NKEA 3JAMY 3S1TA 4RU2A 2HQGA 4JI7J 2RE1A 3H42A 2DIVA 1TK0A 4A8YA 1BMQB 2FUG9 1TR0A 1TELA 2GAHC 2B6AA 1VMBA 2CZ9A 1RCXB 3VVTA 2DIUA 3QIDA 4DMZA 3MZIA 1YRTA 2W01A 3K5MA 4AQYF 1YTYA 1P8GA 3M8SA 4YMEA 3NNAA 3ELHA 2XYHB 2R8HA 2ZVIA 4CLUA 1N54B 4ZCLA 1YJRA 4ZPTR 4DR7J 3FBFA 1TV6B 4ED3A 3R9LA 2J8AA 1NJZA 1JXVA 1S6QB 3GYNA 4IQMA 1Y3KA 2M7SA 2W9BA 2ZBCA 5F3TA 2BANB 4DR5F 2CJQA 3CDAA 4DPYA 1XR7A 3QSYB 5LOQA 3WC0A 1GTEA 3GIRA 5H9FJ 1B64A 2CQIA 5C2GA 5KFDA 2QYCA 2Y8YA 2CJKA 1R8BA 4EZ9A 2EG1A 1YI2S 3HSZA 3MPUB 4K5SA 3TOQA 1VQNS 1T9UA 4IFVB 2V63A 1OS5A 4R0EA 3P6YC 2BBEA 5C42A 3PHEA 5ETLA 1CJKB 3PR5B 3FEYB 2XI3A 3AD9C 2X1FA 2E5LF 2ZFHA 3CPWR 2UUCJ 3R7NB 2Y1LB 4USVA 2VJUA 2RD5C 2WVEA 5F8HA 3DRRB 3P4UB 4PAAA 5K14B 4RU9A 4CLLA 5LSLA 3AHPA 1XIQA 3G6XA 2Y1JA 2J7UA 4JB8B 5DDQC 5LXYA 1D1UA 3DXBA 3HVRA 1JJHA 2EFOA 2HBYB 3HPOA 1DARA 1RWKB 3OTEA 3PW0A 1U47A 4ELTA 3V6KA 1ZBTA 3OBIA 3MMBA 3GV5B 2V34A 2XMUA 3KLGB 1NRKA 1FDBA 3CT9A 1IJFB 3R6LB 5GMEA 2ZOFA 1CC7A 4KGZB 3IR6B 1U26A 4QW8A 2VQFJ 1QD1A 5HSPA 1GX5A 1T3OA 2W4CA 4PG7A 3L3CA 2BW7A 4ITSA 3C6TB 1EB0A 5L1KA 4ED6A 1S79A 4JBCA 4G1IA 3OFHA 2R7RA 5IQQA 4DV0J 3TP2A 3DCAA 3FMBA 3VTIA 2VQFF 2K7KA 4YB5A 4MMOA 4OZ2A 1MU2B 2JFDA 2RQ4A 2DHHA 1WHXA 5HK4A 1JLEA 4TNOA 2DO0A 1AZSB 4I69A 3QWPA 3ZTPA 5DQIA 3MR3A 1ZZFA 2W4PA 2VBWA 3TQ1A 5H9EK 1H74A 3B6BA 1N34J 2HYIB 1KN6A 5A8WA 1U8SA 1I51B 2GGPB 2PIIA 4K2XA 1IKXA 2AYBA 2GQQA 4I7FB 4MKBA 4OYIA 4V19X 4NMLA 4WTOB 5IM0B 4ECRA 3QT7A 4Z37A 4KJIA 3CJSA 1L5UA 2I9SA 1DY3A 1BQNB 3TRGA 1MN9A 3D5MA 4KR0B 1VDHA 4NXNF 3DYAB 1CEZA 3IS9B 1F1BB 2B4UA 5GAEI 1IVZA 1UZDA 2NXNA 4AYBD 3BKFA 5H1SV 2W8KA 3GFXA 4KV8B 1FWKA 1Y0HA 4IH7A 3NS7B 4OX9F 4GO7X 5KFRA 4H54A 2BMBA 4WYWA 3J81U 1R0AA 4UUXA 4W98A 5HVHA 5KFQA 2XS2A 2VF3A 3HF5A 1AT1B 5LL6d 2HQIA 3THPA 3TUPA 4JI8F 1TL1A 2MLZA 1F9EB 1KKHA 2HLTA 3G82B 1K8AT 1HFEL 4WFBQ 4Q2MA 4WZQA 4TY8B 2MKCA 2V2QA 3MPWA 4LRAA 2PMZD 2CQ3A 1E6YA 2LECA 5A2QY 1I94J 4OX7A 4B3OB 5F8LA 5KOXA 1FVSA 4TQSA 1NCLA 1PC5A 4C11B 3G71S 3H5YA 2K7JA 2V8HA 4DX8H 4O4GA 5F8IA 1UL3A 3GSIA 4HDHA 1Q16B 1SH3A 3D1QA 3KDOA 3G8SA 3T1HF 4YR2A 1HR0F 3D3CJ 3JSRA 2VODA 1RBAA 1VOMA 3F73A 1TP7A 2WVCA 3PEJA 2E44A 2NSBA 4TXSA 1HW8A 4K4TA 2XY5A 2O5DA 3BKUA 4UY85 4K2JA 1S6PA 3O5TB 2AEJA 3FDSA 3TVZA 8ATCB 1YJUA 4CLKA 2HGMA 2UZAA 2XLKA 1TZ0A 3EICA 2JSXA 1HQUA 4KGKA 2OPPA 5J1EA 4TYBA 5D0RA 3TYTA 2HRYA 2ZH6A 1YITS 4CLYA 4IDKA 4NL5A 2DRBA 5D8HB 1PJ6A 3T5LA 2HMIA 3DM2B 3I32A 5EN1A 1FERA 1KEKA 4M5NA 4Z7YA 4X4NA 4M94A 2J0QD 2PI4A 1DAXA 4NCGA 3MEGA 3ZZTA 2RUSA 3CWJA 4EGLA 1C0TA 2FQQB 2W2OP 1IBMF 4MFBA 2C3MA 2F5GA 4QW9A 2K1RB 1LNQA 3A13A 3DLGA 1F3FA 1VIOA 4OI2A 4JI4J 2H5IB 5BYQA 1ACMB 3THVA 2C2OB 2VG7A 2V4JB 2HAIA 3NWGA 4LRFA 5KFEA 2BE7D 4C8YA 2O01C 5GAHU 3KXDA 3DLLQ 4P7TA 4NLPA 4ED4A 3CULA 2Z2ZA 3M1VA 3TA2A 3CDUA 3WIVA 1R7IA 2BDPA 4FS2A 3N9UC 2JVRA 2W24A 1EQMA 4NI2A 4P6QA 4CP5A 2B5JA 1WEYA 3NGTA 4USHA 1VQSA 4MKVA 5LSOA 2RRNA 1AUDA 3HD1A 2AQ4A 2BOPA 4RR5A 3UO0A 3A8EA 2LEBA 5KG5A 2J6TA 2XSJB 3HSGA 4IG0A 4IYQA 2U1AA 3TQEA 3GILA 4ECTA 5LSRA 3RZAA 2RQCA 4GKKF 1RHJB 2EK1A 3O1LA 3CNQP 5J2PB 4KT0C 4LREA 4DPWA 5DQHA 5F8GA 4YHHJ 2R7WA 1N33F 4IKAA 4I0WA 4LSNB 3ISND 5I42B 1XNRF 3PNIA 3OFEA 4WYLA 3U27A 1H2TZ 2DR8A 1QY7A 3PFEA 5T7LA 4V19J 2HGNA 2IJRA 3WHIA 1W2BR 4BS2A 3UNYA 4NCBA 4FXVA 2F9DA 4DV1F 4O4GB 4DN0A 3UR0A 2HVZA 1EKSA 3LUYA 4LF9J 1RAOA 3UVJA 4RBTA 3M4XA 1T9XA 2KZMA 1OYDA 1U8WA 2G1DA 2Q6BA 4LF2A 1G2EA 1CJVA 1ZYQA 2PEHA 5CD4A 2MKJA 1U0HA 4HYKA 2B9XA 1DJ0A 3KG0A 4WTYA 3W8GA 3M6VA 5GADI 4I64A 1HL6A 3T3FA 1Q0NA 3AJDA 1BQMB 2XI2A 2YKPA 1RU2A 2QE5A 1S9EA 1FEHA 4HL9A 4RKUC 4X4QA 4JI0J 3AAWB 3SZ2A 2LQ9A 1UW9A 1UVKA 1JLGA 2QRRA 1P27B 3K57A 2ZJPQ 1HBMA 1IBLJ 2HNDB 1HWIA 2I8EA 1YVFA 3GJRB 1HKAA 2I1RA 2VPWB 3IM8A 4YR3A 1IBKJ 3NNHA 2A2DA 3UDEA 2MSSA 3IP0A 3OTOJ 4OZNA 5KT4A 2QO3A 3QJJA 5CA5A 1IWGA 2FVRA 1LWFB 1B70B 3RTVA 4JYAJ 2XZDB 2WSEC 5A76A 1AFIA 2J0WA 4LSNA 5I42A 3PRVA 5KFSA 4UT4A 4DV6F 1OQ6A 3QRPA 3C8YA 3KG4A 2W25A 5JVGQ 4I2QA 3BEGB 3R6GB 4G1PA 2MKHA 1RT4B 4NYPA 2U2FA 4TYAA 4ZPVR 4ZVPB 3RJMB 4DR1J 1YIJS 4ZJQA 3TAPA 2XY6A 2NS1B 3MEDB 1HYSB 2F40A 4KY3A 4ZITA 1N5YB 2VU5A 1J5EJ 2OEKA 4J9RA 4C8ZA 1LFWA 2EBEA 1FWLA 2M0GB 5A6WA 3KLHB 2HVDA 3V4MA 1RWVB 1HQEA 2XULA 2RDDA 4CNYA 1RKIA 3HHLB 2BJ9A 1RWPB 4NZ6A 2AW0A 3MMAB 3KJVA 2V8VA 3SYZA 4NLOA 3GP9A 4LF5F 2COLA 4NLGA 1MMDA 1WOPA 4GVBA 2H51B 1RKJA 4B3MF 4MYTA 3EGZA 2CDRB 3M8WA 3C6UA 3CCZA 4GO5X 3DLGB 3U02A 4TQRA 3KHHA 3QO9A 2KTQA 1ZH5A 2HHXA 2DITA 4H4MA 1LW0B 1RHUB 1MMLA 5KFUA 5B7WA 7FDRA 3DXSX 2DNYA 3US5A 2RF2B 3VGUA 2W9CA 1C0TB 3BH7B 2UV8A 1IR1A 3JQKA 2RRAA 1IWAA 2QA2A 1U0SA 4UZCA 3UN3A 5A8KB 3POTA 3K0JA 2XS5A 4TKTA 4OIXA 5AE3A 3Q0AA 1XMOJ 4C8NA 3PO5A 1CS4B 3POTB 3N6NA 1F9FA 4WFXA 2QMWA 1S1VA 1U25A 4Y2MA 4CT8A 5K20B 2DKOB 3DLHA 1WWHA 2EFPA 1C0UA 2YNGB 4P7VA 3ZZRA 1QVFR 2Q66A 1TL7A 4EBCA 3B4MA 3CIZA 3KUHA 1T8EA 1WF1A 4CTAA 4A8KA 4C7QA 2VBYA 2YNGA 4K4WA 2HHQA 4JP8A 5K8OA 3OTOF 2ZWPA 5DGAA 1F5AA 1RHQB 1FRXA 5AXNA 1TFYA 3T9NA 2FLLA 5F8JA 3KJVB 2C3YA 1Z2ZA 5G0RA 2FC9A 3RUBL 1IR0A 3QJPA 2KN4A 2GO8A 2R2UA 4DPOA 4DV5J 4DFMA 3Q22A 3QGGA 3NP5A 3MOJB 1Y11A 3TZWA 1HWJA 1KR4A 3D6MB 4PXBA 2W9CB 3VAIA 1UVJA 3ZZZA 2VG6A 1FRLA 4MK8A 2O3DA 2KG1A 2OH2A 2CAJA 1F5BA 2JHEA 2IMWP 1X4AA 1NU4A 1WDDA 1RT4A 1Z4UA 2JZ5A 3SSQA 1RT2B 1UAWA 2P2CB 3ZTSA 1V3RA 4XIUA 1CQNA 3M8QA 3TUIC 1WKJA 2D69A 2E5JA 1HNZF 4FZVA 1LW2A 3ET6B 2V4RA 5J2NB 1EP4B 1Q53A 1XNRJ 1HQEB 4EO8A 2A10A 4BLGA 3CDWA 1UMJA 2A2CA 4PQUB 1WEZA 1ZOTA 3HVWA 2Z56B 4DSKA 3KNAA 3IG1A 4M5GA 4CYUA 3IXQA 2P9GA 3NOCA 4BDPA 2A0FB 1R3NA 1N0UA 3D3BJ 1S9EB 4J9PA 1RTDB 2NZCA 4N8NA 1L3UA 4ZVTB 4K7QA 4NASA 1UVMA 4Z7CA 2OO4A 1XMBA 5KTQA 1AZSA 5DQGA 1TK5A 3PKMA 3MMCA 3MM7B 3VAKA 1Q8KA 1A7GE 4B3RF 4FS1A 2BQUA 1NJXA 4CIOA 2Z0GA 4DFJA 1RDRA 1LOUA 1QJHA 2OD4A 1F5CA 2QG9B 4G65A 4FF3A 3TX8A 4ANEA 3GJTB 3DOLA 2BRKA 2YNHA 3DC2A 3HVAA 3EDQB 2QTWA 2ZITA 2YNIA 1C4AA 3R5JB 3BGFA 1VC6A 2KRBA 2UUAF 1N48A 3CMES 2E9RX 5HQ8A 1MW7A 4WBFA 4RNNA 4OZ1A 1UVLA 1CJVB 2ATLA 3QRRA 3BSCA 4K4SA 3BSAA 4DV7J 2XB2D 3IMQJ 3PYDA 4UQTA 2NXCA 5AXMA 3D9BA 4AXIA 2PDAA 2CVEA 3W60A 3IFEA 1PG5B 2P9CA 2PMHA 1C2PA 3DRRA 3W62A 1WC6A 5CYQB 3VVUA 4JV2A 4A8MP 3BV8A 5HBMB 3MM8A 4E8UA 3O44A 3JYTA 5IZHA 4U67Q 4A8SA 1VQLS 2DR5A 1J2VA 2AEFA 4WF9Q 2HLUA 5J2PA 2GX8A 2UUTA 4F0HA 1HR0J 3IR5B 4UW2A 4Y0FA 4PKDB 5C5JA 1FE4A 2KYZA 2FJEB 2IIHA 1T0TV 3N6LA 4FYXB 4LVNP 2D3UA 4U8YA 3NMRA 2H65B 5DGBA 1QTNB 3M2VA 3MM6B 2RUGA 2VIHA 3ZNJ1 2NLWA 2YNFB 2GCFA 2B4VA 1RCOB 2K06A 3W64A 3BGUA 2N7CA 2POKA 3R7SB 1H6KX 2KVIA 3NRBA 4R5PA 2HMIB 1BHNA 3ADAC 2MZTA 3ZZYA 4C3MA 4M8LA 4P52A 4DI6A 2VICA 3EGVA 2N82B 2FYXA 4UOHA 1TKXA 1O6XA 5KT3A 2UVUA 1HQUB 3T5KA 4I67A 1S1WB 1KOHA 1M5OC 1FKAF 1HNXF 2VPYB 3EX7B 4IG3B 4DZ6A 3NAHA 3TW0A 2HFOA 4JI3J 4MFBB 3LF0A 1JXLA 1RGVA 5HMYA 2I5JA 3KYLA 4Y65A 4NXMF 5IXUA 2MEWA 4NLSA 4TN2A 1AFJA 2OKQA 3IA0A 4HR2A 1QTMA 3MEGB 3EE3A 1VRUB 2N3OA 1NKCA 4FXDA 2I2YA 4IOCQ 2ZZTA 4HT7A 1DQAA 2BKPA 4WE1A 1IR2A 4CLPA 1X9MA 4ZLJA 5IOLA 3NL0A 4H4OA 2CWKA 1RBOB 4K0KJ 2J9EA 3K5PA 3KWMA 3ZZPA 1FNMA 3KJFB 4WIQA 1NM2A 4P2FA 4JI1F 1YJ9S 2UXDJ 4X4UA 4DL4A 1CBKA 1FD2A 2KRRA 2OELA 4QJVA 3UCZP 1LWEA 3W1YC 4B9MA 3NOGA 4NRUA 3H8YA 5U47A 2CPYA 4ZVUB 3DI6A 3DMJA 1P9YA 1X7VA 4N47A 2B8QA 1Q79A 5IS2A 4J9SA 4ED2A 3PRDA 1JX4A 4ELUA 4DR6F 4FYYB 2MQPA 3OTBA 2ZOGA 4TVAB 3PX6A 3DGPA 3H2UB 1SXLA 4BC9A 3FC9A 2KHDA 2XYGB 5I4MA 3JB9k 2NSCA 2V9KA 1PCAA 2OIHA 2HS3A 4UTGA 2VV5A 1KONA 1UFLA 3DRYA 3SQGB 1QLNA 2XS7A 2ZEJA 1EX8A 1K0TA 3LTOA 1UEKA 3LOUA 2MZRA 3M2UB 1VRUA 2YKOA 3TI0A 4Q0BA 1RT1B 4I2PA 2LA6A 2MY8A 3K8VA 2QLBB 1TUWA 2UV8G 3BKTA 3T41A 1NK7A 2OSRA 1OWXA 1SQFA 4YY3F 4QWDA 2XMMA 2DNNA 2HPUA 1WORA 3I5CA 1MNEA 3Q86A 1J5OB 3IM9A 3R5AA 9ATCB 3OHAA 3GTYX 3ILJA 1AA1B 4DSEA 1BQNA 2CPJA 3LAKA 2LKZA 2PA3A 2FJAB 2ASYA 2HQDA 4Y2CA 4ZS6A 3VAHA 3BF4A 3C6TA 1VQ8S 1DQ9A 1FX2A 1TL5A 4RNMA 2DRAA 4Y28C 1E6VA 3PYGA 1N32F 5I3UB 3D67A 4KBIA 1WF2A 2GVDB 2HFVA 1SB6A 1S9GA 1T11A 4QYZK 4OYXA 2L41A 2G0JA 2N7YA 1RWNB 4FXWA 4F2SA 2XWXA 5BR8J 2G9OA 3V6JA 1T03A 3ZXWA 1MWZA 2FGOA 1UTAA 2ZBRA 1M1KT 1VQMS 3RBDA 2AKWB 3HFZB 2FB0A 3KJQB 1Y5NB 3A8JA 2ZJQQ 1WTBA 2VC1A 3X3UA 5K8MA 4K5RA 2MKIA 2CJBA 2GO9A 4QPXA 1N6QB 2E29A 5F9NA 4LFBJ 1FEEA 4PQAA 5IC4B 3RW7A 2GJ2A 3H0PA 3KK3B 2FGCA 4NXMJ 1N33J 5C42B 2MLXA 4AD6A 5D0HA 4E2FB 4EYHB 4A8OA 3OW2R 1HNVB 2AJQA 4Y2AA 3TEGA 4F4WA 2LP4A 3CMQA 3NMAA 2QFIA 2YWKA 5D4LA 3C2PA 5KFMA 4KKOB 1TK8A 1NK6A 3VAJA 1XBWA 4XAKA 5AE1A 3GIKA 4KGXB 4J9LA 4QCLA 1RHKB 5E5NA 3J7Z5 2RDIA 2CQBA 2HSEB 3ISZA 3N5FA 4CM2A 4PG5A 1KQSR 3R2DJ 2OLWA 3DLJA 4ZJOA 1NK5A 2DEIA 2DY9A 2YKQA 2ZVSA 1IKWB 3SBMA 2VC0A 3QNWB 1TVRB 1OO0B 2QLFB 3KDNA 2WHOA 3Q83A 3DLEA 3IO1A 4OFZA 3MMCB 1KQFB 2RB7A 4RUCA 1VC0A 3FBEA 1UZHA 3SQOP 2VHGA 3KG1A 1KFDA 1SH0A 1CSJA 2OPSA 5BJRA 2AF6A 1K73T 1JJ2R 3T5JA 1LXJA 1RBLA 3JXOA 2PE8A 1M5SA 4FF1A 3G8TA 1MG7A 3JQMA 4O3PA 4KRWA 1RT7A 3IRXA 2HHPA 5GAEU 3PW2A 3I0SA 2OEMA 1I1GA 3GR0A 2HS4A 3W63A 3GJSB 4G1QB 1Q8BA 2Y3YA 3TJ8A 4WFNQ 4ZLPA 2IPOB 2IVYA 1NJYA 4XO0A 2CZVC 1LWCA 1JXEA 1Z1ZA 2ZKUA 5DG8A 1X9WA 2ZM6J 5B0CA 3OTCA 1ZAVA 3E8OA 3I9ZA 3R97A 2ZZNA 2B7BB 3VAMA 4OHYA 3KK2A 1S1TA 2BRLA 3H90A 3SV4A 1VBXA 1RAAB 2OPRA 1N52B 2JEJA 5LMNJ 1EIYB 1FJCA 2ZOMA 4NLRA 4CZCA 5K8NA 2KXFA 4L73A 4WPAA 3HVTA 4K4ZA 2DGQA 2ZC4A 1FDDA 1UWBA 3RYLA 5KFOA 2R7TA 2ZH4A 2Z2LA 2BJEA 3MD3A 4QIGA 1QSSA 3BO2A 1BUXA 3IC1A 3MM5A 4QR2A 4ZOSA 1OYEA 2N4DA 2QIFA 3UFCX 1B7YB 1VLOA 3PM9A 2OTLS 1GMWD 2H4WB 3T9ZA 5KFNA 1N0VC 4JI6F 4HT5A 5J2QB 2Q3PA 1QAJA 4DLEA 4JI2J 4OX9J 5DDOC 2VOPA 2EVZA 2QZ8A 2AX1A 4X64J 4OI4A 5KFCA 3R1HA 2CNOB 2G2YA 2NXEA 1DBDA 2G4BA 1SJFA 3SCKE 3CSKA 3FSXA 4DX6A 1CC8A 2X51A 4CM0A 1S7HA 3UN5A 2DXEA 2BABA 4C8MA 2BEFA 3CJKB 5H9EJ 2CXEA 1JIHA 2BA9A 5ETOA 3OJSA 4CO5A 2RKIA 1B0PA 3HHEA 3OR1A 1XERA 2RVJA 5B08A 3G6ES 1I5OB 4URGA 1RT1A 1VS3A 4Q0BB 1HA1A 4C97A 2HK3A 2ERRA 3QGHA 4LBHA 3K5LA 2YWGA 1KFSA 3P45B 3K5OA 2EFVA 3MECA 3W2VA 1KVKA 4ZCMA 1N34F 1FDAA 4HHHA 3FK4A 5JXSA 3MM5B 3GU0A 1ICEB 2DR6A 5A0YB 2DEJA 1L3KA 2XMKA 2CQHA 1WSRA 4DF8A 2YH1A 4Y34A 1X4EA 3IAS9 4FVMA 5DS7A 2XQCA 1APSA 1SKWA 3Q8RB 2A3JA 3G82A 1OIAA 3LPYA 4GVBB 4WP9A 5HROB 1R89A 2NPIA 3DGPB 4OJ3A 3W2WA 3LWLA 4OZJA 4WFYA 2RS2A 1YK9A 3QPIA 3PX4A 1ZM2A 5D78A 2FY1A 4MYUA 1WACA 2PO4A 3DMJB 1X4DA 4X62J 1DURA 4L74A 4IG3A 1I6JA 2X7IA 4ZN3A 3B54A 4M5KA 3J80Y 4RNOA 2CG4A 4MIWA 2UXBF 2JRSA 2V68A 2I38A 2HNZB 4OYWA 4UOCA 5BYRA 3CJ4A 3SMZA 3MR6A 2EPIA 1T3NA 4RW9A 1YLXA 2R9LA 4FBTA 3BGLA 1PC4A 1VCTA 5IM0A 1VJQA 1XMOF 1H7XA 2LDYA 3NG8A 3NCRA 2GW8A 4I7FA 2LXIA 2YWHA 3BYPA 4RUHA 2X1BA 1AW0A 2FJBB 2DTJA 3V6DA 3LGHA 5EGYA 4O3QA 2AYGA 2IY5B 3MF5A 3C19A 3S7RA 2ZNYA 4RW7B 3TA0A 2IA6A 2CQ4A 3I0RB 2GNKA 2AJ0A 1WI6A 1T95A 2R4FA 2DNPA 5GADU 5MLCV 2HFUA 1AYEA 3UE2A 1CULB 2HNDA 1WG1A 3QLHA 2GJIA 3FQKA 3J80U 3M9NB 4EBEA 2GHPA 3Q23A 1YX2A 1KHWA 2VASA 3JSMA 3BM7A 4DQRA 1N36J 3JYTB 1UETA 2ABYA 3TVKA 5HROA 3NS6A 5ETQA 4DR5J 3FRYA 2GQ2A 4DCOB 4IFYA 1JLFA 4HACA 5IWAF 3K59A 2UVWA 3CCTA 3L95X 1SCJB 2BX6A 2VFSA 2V50A 1VFJA 3JAMU 2J76E 1TL3A 1J5EF 1X8DA 2ILYA 3MMBB 4ZPAA 4DQQA 4BBYA 4F04B 3DLKB 2B9YA 1KNZA 4LIWA 3PY8A 1JWWA 5D3GB 4FF4A 2YNIB 2YQ1A 3J81Y 3CCSS 1UVNA 3J7ZT 1K44A 3OUYB 1QUPA 2MYFA 5DETA 1XC9A 3J7A1 2IHR1 2AYMA 1JNZB 2XYPB 1TKTA 1GK8A 3T19A 2J0XA 2HNYA 4M5LA 1N6QA 2R3VA 3ILIA 3M6WA 5E3AA 4C3LA 4B9NA 2C2MB 2DHAA 2EW9A 3R1LA 3SSSA 3AT1B 2FZCB 4DJBA 2ALYB 4DL2A 3TEHB 4K4VA 3I87A 1HHTP 1VBZA 3AXMA 3KOAA 3UDCA 1XQIA 2R42A 3CD5A 3PYEA 1SJ1A 5KAKA 2VA2A 1PGZA 2QMXA 5E3QA 4D3GA 3CC4S 3NGKA 4FKYA 5L46A 1NEEA 2VG7B 2V4JA 3MAHA 2WCXA 4AL5A 2UUBJ 1PJ7A 5SUHA 1F2GA 1FT8A 4DV4F 4S0MA 2QA4G 4QZVB 4AT1B 4UUWA 3KLIB 3DNCA 4A8XA 2HZAA 5D0EA 4KPYA 1D9AA
chains in the Genus database with same CATH topology
2RMLA 2LDIA 4NLVA 4OHXA 4BWMA 3KHGA 1WHWA 4WJBA 4I6AA 4LF7F 2HHWA 2KKHA 2YY3A 4Y2KA 3OV7A 2QSWA 4KHRA 4IDKB 3GWCA 1N88A 3N79A 2IYGA 2P6TA 1NK8A 4M5DA 4ED7A 3KK1B 1M5VC 2IM3A 4G1QA 1DLOA 3PV8A 2K8GA 1IKVB 1D8ZA 3PFOA 2QLXA 3IRXB 1ZM9A 2ADCA 2E1AA 2L3MA 2GMJA 2VFVA 2HWHA 1UP1A 1HBNA 2J9CA 3CGIA 4G6VB 3GIMA 2JEFA 1XN9A 3PXGa 4YDXA 4ILLA 4W90B 2J5AA 5AE2A 3OVSA 2PI5A 3TAMA 3EUNA 4XDDA 3CC2S 4DLGA 4Q2LA 2IC3A 4LVOP 4NX9A 4PG6A 1P1LA 4C11A 4ATNA 1D9DA 1BLUA 4DL7A 3EZ5A 1GTHA 3ZC4A 4GC6A 1FXRA 4G3IA 1TFWA 2K3IA 2OJ3A 4ZVGA 4ZDNA 1C0UB 2CKWA 3E3XA 3HX9A 1FKPB 1IQZA 2CJAA 1YGYA 2CZ4A 2DNGA 1HI8A 1NJIT 4HTIA 1URRA 4F67A 2FHJA 5G0RB 2K3KA 2Y1RI 1QAYA 1RK8A 2DGOA 4NOHA 2ZHOA 1ELOA 3WBZA 4RW4A 2VBXA 5DLGA 5DLFA 3D0GE 2KI2A 1Q1KA 3AB4B 2QSFA 5B0DA 2E1CA 5KG6A 1RI7A 2ZNZA 3VR1A 3IWLA 2RDJA 2IA0A 1NHUA 1WEXA 4A4JA 4BHQA 4F50A 3IWNC 2KXNB 1S48A 3M30A 2RILA 5AXLA 2I0XA 1RTIB 1S99A 3HO1A 5HP1A 4ICLB 1NO8A 3NS5A 3VZIA 3CUNA 1JLAB 2KDOA 2MHNA 2O1PA 5GAHI 2JVOA 1Q86T 2DO4A 1Q7YT 3BGRA 4C0HA 5KT5A 3DRSA 2KT2A 2KU7A 1MWYA 2YQ3A 3MR2A 2J6UA 2LEPA 3UNGC 3DN9A 4B3SF 4KO0B 1RTIA 4OHZA 4IQXA 4XK8C 3IRWP 4FNHA 1HNWF 4FNIA 2J7KA 2OTJS 3P3DA 5KFYA 4OV1A 4AFFA 4URSA 4PXCA 4IR1A 4O3OA 2NPFA 1RT3B 1SV5A 4Y2IA 1HPZB 2IAJB 2DCUB 3WZ0A 5I3PA 4Q44A 3ITHB 4DQIA 4DSIA 5HP1B 2Q6CA 4DEZA 1R8PA 4H4KA 2YKNA 1R27B 1LKZA 1URNA 2HHTA 2E5IA 2CYYA 3I55S 1RA7A 2YTCA 3MEEA 2AGPA 3HT3A 4QQBA 1DZ5A 2W9AA 1FNOA 1YJWS 1FJGF 2H9ZA 4PCQA 1VQ9S 2CPXA 1P6TA 1NNDA 3P49B 4NA1A 3I4HX 2KHCA 2IVFB 4CO2A 4J9KA 1C1CB 3QMQA 1WI8A 2XO7A 3OFFA 1JLGB 1UJ4A 3SSRA 2C28A 2GIQA 2CIMA 2ZD1B 1Y5IB 4EEYA 1FESA 2EK6A 1QE1B 4QWAA 4K4XA 4K59A 4KC5A 2XC9A 1HWKA 3KHRA 3JSYA 4RW8B 1K1QA 1FKOB 1DQ8A 2JLFA 4OHWA 1FK9B 2DH7A 3GFZA 5GMKa 4OZLA 4DFKA 1SIWB 3FEZA 4PPZA 4ZCKA 2ZH8A 2ZH3A 1Q8IA 4LF6F 3NNHA 2C3PA 2JLEA 4OZ0A 2GV1A 2XBPA