1HNVB

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 91
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB03
3IRXA 4KSEB 2ZE2B 3LALA 4KV8B 4ICLA 3Q8SB 2UVWA 5KG2A 3KHRA 2XI2A 1S1XB 4KFBA 3JYTA 4ECYA 1RTIA 3MR6A 4ECWA 2C2DA 4DG1B 2ZKUA 5DG8A 3E01A 5I3UB 3OSNA 5KG4A 4RW8A 3QGIA 2OH2A 3FSIA 2R8JA 2OPPA 3DLGB 4NLRA 4TYBA 2BRKA 4ED6A 1DLOA 3BSOA 2YKNA 4NYZA 2HNZA 1JLEB 1S6QA 3QZ8A 1LWFB 5J2NA 4EYIB 1HNIA 3TAMB 2ASJA 3DYAB 1HPZB 5C24B 3SFGA 1JLGA 1JLAB 3QLHA 3BQ0A 4ECUA 4IR9A 3FDSA 4FS1A 4NLWA 4RW7B 3RAQA 4F4WA 2FVRA 4J9SA 3KLFB 1OS5A 1S9EB 3KK2A 4TQSA 3NKYA 3CJ3A 1JKHA 4NRUA 3N6LA 5HBMA 1SUQB 4I2PB 1S1WB 5HLFA 2C22A 1MMLA 3CDUA 1EP4B 5F9NA 4RZRA 3MEEB 5F8IA 5J1EA 1IKXA 4NCGA 4IFYA 1T05A 2YKMA 4TLRA 1SH3A 4IH6A 4IDKA 2EC0A 1JLFB 2RKIA 4ZPDA 3MEDA 3DOKA 2YNIA 3KLIA 3PW2A 5KG7A 4RUAA 1RTHA 1MU2A 1FKOA 3LP2B 2HMIB 4PUOB 5HP1B 2CJQA 5KT2A 4IRKA 2GC8A 1RTJA 1QUVA 2B43A 4TQRA 3BQ2A 5F8JA 3DLEB 4R5PB 3V81A 1SH0A 4ZVEA 4QWBA 4ECVA 1S97A 3DRSB 1KHWA 1C1CA 3IS9A 2GIRA 4IR1A 2FJWA 4ED7A 3M9OB 1LWEA 1S1VB 2R8HA 5J2MA 1JLCB 1TKZA 1RT5B 3T5JA 1RDRA 1QE1A 3FFIB 3DM2A 3MECB 2UVRA 1RA7A 2XI3A 3KNAA 3NBPB 4KV8A 1S1XA 4K4ZA 4H4OB 2IBKA 3EZUA 3H4BA 3DRRB 1W25A 2E9ZA 4RNOA 2W9BB 2AU0A 4DG1A 2O5DA 2B6AB 5I3UA 2ALZA 5KFWA 1C1BB 4RNMA 4IFVB 2RDIA 1S10A 3PR4A 3DLGA 2YNFB 4ZP7A 3KHLA 1VRTB 5KFRA 3V6DA 3MR3A 3IGVA 2VG7B 2BQRA 3NAHA 3T5LA 3ITHB 4ED8A 4IH7A 1JLEA 3QGGA 1RT4B 4KE5A 1REVB 4YP3A 4ECZA 1LWCB 3DYAA 1HPZA 2WRMA 5C24A 4NLPA 4U6PA 1JLAA 4KO0A 2BR0A 5KFHA 5C5JA 4YMEA 3KLVA 3G6YA 4RW7A 2XCPA 3KLFA 4EBEA 1S9EA 3NAIA 3OLAA 2HWHA 3GV8B 2UVVA 3Q8RB 3Q8QB 4O3PA 2XGPA 1SUQA 3IG1B 1S1WA 4I2PA 2IJFA 4RU9A 2WB4A 3DI6B 4RW6B 4M95A 4WXOA 5DGBA 1RAJA 1J5OA 2W7PA 4EEYA 4WZMA 1VRUA 3N6NA 2HAIA 4Q43A 4HYKA 3DDKA 5KFUA 2AWZA 1JLFA 5KFSA 2AGQA 4DL6A 1C0UB 1GX5A 4Q8FA 3LP2A 2HMIA 4PUOA 1JLBB 4NLOA 4ZP9A 5J2QB 5HP1A 5KG5A 2IM2A 5EDWA 1N56A 4WZQA 3SFUA 5CYQB 2W9CB 4X2BA 2ILYA 4R5PA 1KLMB 1ZTWA 3DRSA 2I1RA 1I6JA 2W9AA 1NNDA 4JV1A 1ZETA 2FLNA 5KG6A 1NHUA 4R8UB 3H5XA 5KT7A 1JLCA 4O44B 4I7FB 3PW0A 5KG3A 3FFIA 4LSNB 3MECA 4ECRA 3CWJA 3NBPA 3V4IA 4LQ3A 2UVUA 5DG9A 2JEGA 4H4OA 3H5SA 3DRRA 5KFFA 4J9QA 2W9BA 4FS2A 1BQMA 2HNYB 3KLEB 5KFYA 4QWAA 4QWEA 4WXWA 4WE1B 4IOBA 1C1BA 3V6JA 4IFVA 3PZPA 2AGOA 2DPJA 2GIQA 2YNFA 4Y3CA 2ASLA 4KAIA 2VG7A 5KFEA 3ITHA 4NZ0A 1WNEA 3G6XA 1RT4A 4WFXA 1REVA 1RT1B 1SV5B 5F9LA 1LWCA 1TP7A 1N4LA 2IJNA 1S9GB 2VA2A 2J6TA 2XCAA 2IM3A 3RB6A 4EBCA 4O3SA 4XO0A 2IA6A 2VG5B 4EBDA 4IG0B 3RAXA 5KFAA 3V6HA 2BANB 2IAJB 5C25B 4LSLB 3MF5A 3IN5A 4FBUA 4MK9A 3IG1A 3BREA 1HMVB 4NLSA 1IKWB 4QW8A 3DI6A 4I2QB 4RW6A 3OL7A 3VQSA 4QWDA 3SI8A 2D41A 3G86A 3JSMB 4EO6A 3NGDA 4K4XA 4J9NA 3EPIA 5L1IA 3I5BA 3GIKA 2HWIA 1C0UA 4DL5A 1RT6B 1HQUB 2R2UA 1JLBA 5J2QA 1BQNB 1HQEB 4IG3B 5CYQA 3CO9A 3MEGB 5KFJA 1KLMA 3ISNC 5EUHA 1TKTA 3KLHB 3BQ1A 3I0SB 3CJ2A 4MK8A 2DPIA 4GC6A 4O4RA 2CKWA 4R8UA 5HROB 5I42A 2R8GA 4NLUA 4O44A 1IM4A 4I7FA 2XWYA 4TY9A 2WHOA 3I5AA 5KFTA 4LSNA 4NLQA 5KFKA 1T3NA 3MFHA 4K4SA 4Q45A 1NHVA 4ZPCA 1S0NA 4RNFA 3LP0B 3M8QB 4R0EA 2HNYA 3KLEA 4K50A 2ZE2A 5F8MA 4WE1A 4YR2A 3V6KA 4RNNA 3MR5A 2YNGB 2JC1A 5KFMA 2R2SA 3BSAA 4JV2A 2C28A 1R0AB 4GC7A 1D0EA 4JUZA 3RBEA 3T19A 4QW9A 2AQ4A 1UWBB 2JEIA 2FVQA 1RT1A 1SV5A 3KJVB 1IKVB 1JIHA 4NLDA 3BSCA 1JXLA 4NRTA 2ILZA 1T03B 4B3OB 2WK4A 5KT6A 3CJ4A 2VG5A 1LWFA 3BJYA 4IG0A 3T5KA 3KLGB 2D7SA 1RTDB 3TAMA 3H98A 2IM1A 2BANA 2IAJA 2WONB 5C25A 4YQWA 2BQUA 2FLLA 4URSA 1S1UB 4O4GB 3RB4A 1FKPB 3LAMA 4ZP6A 5KFVA 1QAIA 1S1TB 4K4TA 1TQLA 3H5UA 2V4RA 4I2QA 3PJWA 4J9OA 4KHMA 2W8LA 3CVKA 3GYNA 4KFBB 4NLXA 2RF2B 2UUWA 4Y2CA 4NLVA 5JUMA 2OPRB 3H40A 5L1LA 2W7OA 4DL4A 4YR0A 1XR7A 4Y2AA 1EP4A 1RT6A 1TV6B 3MEEA 1HQUA 5T14A 2BRLA 4EYHB 3KMQA 3HVTB 1BQNA 3DMJB 3H2LA 5KT4A 4IG3A 4H4MB 1JX4A 1DTQB 3MEGA 3PVXA 2J6SA 3KOAA 5L9XA 1DLOB 1RT7B 4ID5B 3KLHA 5F8HA 3I0SA 3Q8PB 2R2RA 2ZD1B 4O3QA 4WYWA 3H59A 4K4YA 1CSJA 4XPCA 1RYRA 1TL1B 5HROA 3DLEA 3G6VA 1JLQB 2JLEA 3C6TB 5KFBA 2R8KA 3MR2A 3D28A 4IH5A 1JLGB 4DL2A 4OL8A 3HHKA 3GILA 1K1SA 4EO8A 1S1VA 4ECXA 3HKWA 1U09A 1RT5A 3ISND 3EPGA 2C2EA 3LP0A 3M8QA 4HKQA 4ZPAA 1IKYB 4ZVFA 3FQKA 3HVWA 5KFXA 4F50A 5FDLB 3QYYA 2VG6B 5KFZA 3LP1B 5F8GA 4LQ9A 2YNGA 5J1EB 3UDLA 4ZHRB 4F4XA 4NCGB 1DTTB 4F4ZA 1C2PA 4RW9B 1S9FA 2B6AA 4WFZA 3DLKB 3TQ1A 2FVPA 1R0AA 2W8KA 2XGQA 4ZPBA 2R8IA 3RBDA 4URQU 3BGRB 1UWBA 3CJ5A 1VRTA 5F8NA 3KJVA 1IKVA 1LW2B 5D3GB 4Q0BB 5EWEA 3LAKA 3GIMA 1T94A 4ED3A 4O3OA 1S0OA 1N6QB 1T03A 2FVSA 4B3OA 4Q44A 1N5YB 3I0RB 4MKAA 1S6PB 2OPSB 3KLGA 4J9KA 1RTDA 5DLGA 1FK9B 2AX0A 1S48A 1SH2A 1S1UA 4O4GA 1TKZB 3D5MA 1FKPA 4URGA 3GIJA 1S1TA 4YR3A 1S0MA 3FRZA 4U7CA 3OL9A 2I5JB 2IMWP 2RF2A 2OPRA 3NMAA 4RNHA 2BQ3A 4ZVHA 2FLPA 4G3IA 3RB0A 1HNVB 1TV6A 1XR6A 4J9MA 2IC3B 3T1AA 4MKBA 2V4QA 3HVTA 4ED2A 3DMJA 4Y34A 4H4MA 1DTQA 3M9MB 5KFCA 5F8LA 4RUCA 4KHRA 2RDJA 1RT7A 4G1QB 4ID5A 3V6DB 2FJVA 4ECSA 1TVRB 2ZD1A 5KT5A 4IRDA 3M8PB 3OLBA 2W9CA 5DG7A 4TY8B 1TL1A 1HYSB 2HNDB 4ZMMA 1JLQA 3C6TA 5KFLA 2AGPA 4KKOB 4KO0B 4FBTA 3KK3B 3M9NB 4XPEA 5L1JA 4MFBB 2R2TA 5K14B 3E51A 2OPQB 4WYLA 5DLFA 1IKYA 1TKXB 2FVCA 3UPFA 3BR9A 2WOMB 2YNHB 5EWGA 1TL3B 5FDLA 5C42B 2VG6A 3PW7A 3LP1A 3RB3A 4MK7A 2FJXA 4PWDB 4TYAA 1J5OB 4ZHRA 1RA6A 5KFGA 3OL8A 1DTTA 1VRUB 3QIDA 3I5CA 3OL6A 3BSNA 2V0NA 4RW9A 4J9LA 3KHGA 2VA3A 4KB7A 3MTKA 3DLKA 1KHVA 3PW4A 5KFNA 5KFPA 3C6UB 4JV0A 1RYSA 3BGRA 3DRPB 5CYMB 3OSPA 1RT3B 1QAJA 2E9TA 1LW2A 5D3GA 4Q0BA 2JC0A 2XC9A 5J2PB 3FQLA 3CDWA 4ED0A 1N6QA 2BE2B 4QPXA 3KK1B 1N5YA 3I0RA 3IGNA 1S6PA 2OPSA 1LW0B 5DQGA 1GX6A 3DOLB 1FK9A 1XR5A 4M94A 2AX1A 1S9GA 4J9RA 3GIIA 3GQCA 2WCXA 4DL3A 1EETB 1D1UA 4K4WA 5EWFA 5KG1A 1HARA 1RT2B 3QIPB 4PQUB 4IQXA 1C0TB 3V4IB 3GV5B 2I5JA 3QO9B 4LSLA 4RW4B 5L1KA 4ECQA 1S4FA 3HVAA 3TVKA 2B5JB 4TXSA 4MIAA 5DGAA 1HMVA 3CIZA 1BQMB 4DEZA 3IRXB 1IKWA 3KMSA 1HNVA 1ZTTA 2IC3A 4TN2A 4ICLB 3OHAA 5KFIA 3JSMA 3JYTB 2QV6A 1RTIB 5DQHA 1Z4UA 4J9PA 3UR0A 2D3UA 3N6MA 4QWCA 2JEFA 4G1QA 3KHHA 3E01B 1TVRA 3OHBA 3CJ0A 4RW8B 4O3NA 3M8PA 3PW5A 4NLGA 1HQEA 2OPPB 4TY8A 1HYSA 2HNDA 3T5HA 5KT3A 3UQSA 3LANA 1K1QA 4KKOA 3QZ7A 2YKNB 3KK3A 2HNZB 3CDEA 4NLTA 1S6QB 4MFBA 5J2NB 5K14A 1HNIB 2OPQA 2WTFA 3PJXA 1YVFA 1TKXA 3QLHB 4H54A 4ECTA 4O3RA 3NL0A 2WOMA 2YNHA 1TL3A 5C42A 2D3ZA 3PHEA 2IM0A 4KBIA 4PWDA 3KK2B 3QGHA 1JKHB 4K4VA 5KFDA 1N48A 5HBMB 5HLFB 4MIBA 4ZP8A 3C6UA 4IRCA 1S49A 2J6UA 4Q8EA 5KFQA 3DRPA 2JEJA 5CYMA 2E9RX 1IKXB 1RT3A 4IFYB 1T05B 2YKMB 3PR5B 4IDKB 4MH8A 5J2PA 2ASDA 2RKIB 3MEDB 3DOKB 2YNIB 3H5YA 3KLIB 1TKTB 2BE2A 1RTHB 1MU2B 1FKOB 3KK1A 4DL7A 2C2RA 1LW0A 1RTJB 3DOLA 2F8EX 2UUTA 3ICLA 5KG0A 2ATLA 5I42B 3GV7B 3V81B 2QE5A 1EETA 4WFYA 4F4YA 5JXSA 1C1CB 4ED1A 3IS9B 4K4UA 1RT2A 3QIPA 4PQUA 4IKAA 4ZVGA 5KFOA 1C0TA 2WONA 4NLYA 3QO9A 1LWEB 4RW4A 3MFIA 5J2MB 3H4DA 2V9WA 2B5JA 5DQIA 1QE1B 3DM2B
chains in the Genus database with same CATH superfamily
4DPOA 3BBBA 3HDSA 5THWA 3W64A 1WOSA 3HFVA 2GO8A 4USTA 2HS0A 4J37A 3QGPA 4B3SF 1PAEX 2GJ2A 1HNIA 1H6KX 4M5IA 2ASJA 4EMDA 2J8SA 1Y10A 4JP8A 2K7KA 2ZITA 4L3NA 4W92B 3N6LA 1KFDA 2X3DA 3MMCB 1N5SA 1SH3A 3N28A 3U1NA 5HP1B 3BQ2A 5D0EA 2RU9A 5MLCV 4YUDA 4CZCA 2W2MP 4HI1A 2L08A 2W4CA 1Y7PA 4YB5A 3FZBA 5I3UA 3EZOA 4RNMA 3ONQA 2CPXA 2IVFB 2ZWPA 4NLPA 4U6PA 3SQGB 4L75A 2G4BA 3PO4A 4ZVSB 2OEKA 2H54B 2DT9A 4ANCA 4OYXA 1T9WA 4ATNA 4L74A 1Q5YA 1BD6A 1GMVA 3QATA 3T1YJ 3FZ2A 3BKUA 3CWJA 2V50A 2FGOA 2J9CA 1N34J 1FFSB 1BQMA 3A3PB 4Z2XA 4QWAA 4OX6A 2EFPA 4DV4F 2GIQA 1ZZNA 3Q2TC 4KAIA 4C98A 4KGVB 3O3LA 5KFEA 3IO1A 1VCTA 3RU0A 4Z7YA 5F9LA 2DIVA 2EFNA 5B0AA 3KUHA 1NK6A 3MAQA 4F0HA 4CO0A 3WX8A 3VQSA 2DVIA 2UXCJ 3GIKA 1X9WA 5KFJA 1RSCA 2DITA 2XWYA 4OX9F 1Q8LA 2AYEA 5C7PA 1VQ7S 4DZ6A 2ZE2A 1P27B 1TU0B 2J9DA 1FJCA 1YJUA 4MMOA 5GAEU 2OMLA 1VC5A 1IKVB 3BSCA 5GAEI 2RQMA 2YQ3A 4IRKA 2YH0A 2IRUA 1HLWA 2DB1A 2C3PA 2R7WA 3JTOA 3KJNB 4IO1A 3N9UC 3L3CA 4DZDA 4YR0A 1XR7A 2CPIA 4DR3F 1MMDA 2BW7A 1JX4A 2OO4A 4GO7X 2JJ4D 1M0SA 3HVRA 1MG7A 3EPGA 4F50A 3KYLA 4YDXA 4W4MA 3ZZZA 1VHIA 1S9FA 3DLKB 4KHPJ 1RKJA 4FF4A 3CDBA 3VV2B 1T94A 4OZ1A 4B3OA 4QIVA 2BKNA 4MKAA 1CQNA 3C8YA 3BO2A 1RWMB 2FTRA 4JI4F 1SQFA 2OPRA 3AJ1A 2BBEA 2F7VA 4MKBA 1Q53A 3DMJA 2DGTA 2CQ3A 1JXEA 3LPEA 2ZHAA 1K9MT 5FD1A 3DXBA 2HFZA 1J5OB 3BSNA 3BBCA 2AT1B 1TAUA 5L8RC 2EK1A 2D9OA 5AE1A 1HIYA 3IGNA 1U45A 2DNMA 2AX1A 1S9GA 1MN7A 4P2XA 2WCXA 4NCBA 1ZOTA 1FRJA 3H42A 5IQ6A 3TVKA 1OYEA 3OV7A 4DV7F 3B4MA 4RX6A 4LFAF 4G1QA 1T95A 2KVIA 2HNDA 2OFHX 4RUBA 4MFBA 4QCLA 3QLHB 2CJAA 4KPCA 1V3ZA 2EKYA 2CQIA 1RAFB 4I6WA 1F3VA 4G1IA 4A8YA 1IKXB 5EX3A 3LUYA 2F3JA 2C2RA 3WBZA 3AD8C 5KG0A 2XLKA 1WC5A 1CJUB 3H4DA 3ZC4A 3HI9A 3MPYA 4S0MA 2OPPA 3ZNJ1 1I94F 1EQ0A 1JLEB 1U4BA 2XNQA 3TAMB 2YQ0A 1HPZB 3BQ0A 1UA1A 2QMXA 2Y1RI 2N3OA 2NYIA 3KK2A 1JKHA 5GMKa 1HBMB 1ITPA 3MUMP 2AV5A 1V9OA 3C66A 4DUZJ 2VD3A 1FNOA 4PUOB 2HAFA 4HHUA 4ZVEA 1DBDA 5K5MA 2MPUA 2EFOA 2OGUA 4RPFA 2XI3A 3U27A 2NLWA 1R3NA 1YJ9S 3NWGA 2VG7B 1KOHA 1T9VA 3T9ZA 1RT4B 2FHOB 1U2RA 1TK8A 3X3UA 1VGYA 1OY9A 3K5LA 1UW9A 3OLAA 5GMEA 2FY1A 1U1OA 3DI6B 2ZH4A 4Q43A 3PO5A 3L95X 4H4KA 4TLQA 5K9FA 2N3LA 5LXYA 4USUA 1GNKA 1U26A 3C19A 4DR1F 2VFTA 3BH7B 4WFBQ 1PG5B 5A8RB 2HRTA 2G0IA 2JEGA 3DRRA 3K5PA 4J9QA 2HEKA 2C2ZB 3IBFB 2K3IA 1Q0NA 3EICA 1WNEA 2DXEA 4C8ZA 5DZ7A 1RAOA 2P9GA 1MNEA 2IM3A 3MMAB 3RAXA 1VIOA 4RR5A 2GJIA 1U1PA 4GKKJ 3OVBA 3QRRA 5L1IA 1HBUA 3MMBA 3TX0A 1BQNB 2J8AA 3CO9A 3JXOA 2HBRB 1QVFR 1KVIA 2P5VA 3BB5A 2HBQB 3CEDA 3ILIA 4B9MA 2MKSA 5I42A 3P3DA 2R3VA 3I5AA 3JB9k 1YDLA 5HATA 1FVSA 1Q16B 3UN2A 2RVJA 1RACB 4GO5X 2BXJA 3KG4A 1URRA 4W98A 4Q7AA 1T03B 3TZYA 1BWEA 4IG0A 3B78A 2ZEJA 1AUSL 4K4TA 3A1YG 2ROEA 2RJZA 3M1VA 2HPUA 4FF1A 1Z2LA 2BRLA 5IT9U 5BYSA 2IIHA 4DR5J 4H4MB 3FC9A 3MEGA 7AT1B 4TNOA 2LEAA 3H59A 1FO1A 5KFBA 2YKAA 1T8EA 3DLLQ 1XMQF 1X0PA 4OL8A 4ECXA 3SCJE 4ZVFA 3FQKA 3SDEA 4OYAA 2E1RA 3MHYA 4NCGB 4B9NA 2C2OB 4F04B 4RW9B 2NXEA 4CLKA 3UDCA 3K57A 5F8NA 3GIMA 1EAYC 4O3OA 2HQIA 1J5EJ 4HACB 1AFJA 3ZZPA 4F0MA 2Z8QA 2VQFJ 2HS4A 2R7QA 2FD2A 2B4PA 4M5JA 4ZA1A 4X64J 1YJWS 1Q79A 1C4CA 4PG5A 4MJKA 3FBFA 5F8LA 1VQ6S 1X4FA 3D3BJ 2QO3A 4DR7J 4C3MA 3EVOA 4ZMMA 3CC7S 3C6TA 2FLOA 1WD6A 3KK3B 3M9NB 2R7UA 1RWKB 3E51A 2RRAA 3FK4A 2XMWA 4GKJF 4PWDB 3WQPA 3I5CA 1OPIA 3MTKA 2ZHOA 4JV0A 3EVMA 2GV1A 2L3MA 2J7UA 2UZAA 3FQLA 2HGLA 4OYWA 4ED0A 4I6YA 1N5YA 4LF9F 2GQCA 1RBAA 4ZLJA 1HARA 4PQUB 3MM9B 2LYVA 5L1KA 4RW4B 3PM9A 4C8KA 4FPIA 4OV6A 1HNVA 4UY85 4CLPA 3JYTB 2QV6A 1MMNA 4C8OA 1FWLA 4KH1B 2ZH6A 3E8OA 4X4NA 2JFKA 3OD2A 4OHVA 4TVAB 2QRRA 3GYXB 2KI2A 2DGVA 4DPUA 1Z1ZA 2RS8A 3OTEA 3DRPA 3C16A 3NWRA 1WF0A 3PX4A 2BE2A 3GV7B 3MURP 1R6YA 2W01A 4ZVGA 5KFOA 3HHLD 2AJ0A 2UUBF 3I9V9 4DUTA 3DM2B 1RABB 5JVGQ 4KSEB 3DGPA 4HH0A 2MQPA 1DRZA 4ECWA 2PFDA 3ZFVA 2KH9A 2QX0A 3P49B 2CQCA 2KB2A 3IXQA 1TR0A 3THVA 1M1KT 2Y1JA 2MJNA 5K8OA 1S9EB 4QOTA 5HLFA 1EP4B 5F9NA 3BGLA 2EC0A 4IDKA 3T6JA 3KLIA 5IOLA 4R5PB 3V81A 3A8IA 1C1CA 2XSJA 1LWEA 4N8NA 3ZTOA 4ELUA 1JLCB 5GVQA 2KDOA 1RDRA 1FRLA 1F3FA 2HBYB 1RU1A 2VV5A 1R8PA 4K2XA 3PRVA 4GRSA 1M1GA 4DG1A 5KTQA 4YY3F 4DN0A 1FDAA 1PILA 1S10A 2YNFB 4EGLA 4Y65A 3R8YA 1RCOB 2BKPA 4IH7A 1RBLA 2E66A 2G1DA 4ECZA 4M8LA 2G9OA 3KDOA 2PA8D 2B7BB 3KLFA 4OYOA 3OUYB 1SUQA 2WB4A 1FNMA 4Q2MA 4DPWA 2DH8A 5LJ3Y 3FEXB 1ZPVA 1F5CA 2I1RA 1I6JA 2EFGA 2GVDB 1T02A 5LSLA 5DO2A 3UNYA 3KXDA 1HBNB 3JTNA 1N32J 3H5SA 1UCNA 3EUNA 1KBRA 1YJTA 2E1CA 1PAUB 4CLSA 3LTOA 2J0WA 3F41A 2W7AA 2WVDA 3RTVA 4WU3A 5KFAA 5C25B 3GB0A 1RK8A 3IA0A 1XNQF 4RW6A 4I2QB 2NPIA 2QJ3A 4QWDA 2HS3A 1Q1KA 2DNGA 2OD6A 1DJ0A 2RU3A 1VQSA 1QD1A 4YHHJ 2BW2A 5ETNA 1SCJB 2L9NA 2ZOGA 1U6ZA 2DPIA 3J81U 1RB0A 2LQ9A 4TY9A 4LSNA 4A48A 4LF5F 4F4AA 2YKPA 1L5UA 5B0GA 1FE4A 3MR5A 4OZLA 4V1Ak 2AEFA 2CAJA 1CS4B 4DL0C 1UWBB 2FVQA 1LFPA 3KJVB 2G0CA 2D7SA 2WONB 3K7RA 2FLLA 4URSA 1SC6A 4OI3A 5KFVA 3F73A 2VPZB 1HNWJ 5A0YB 4KHMA 5ITHA 4FZVA 3M6WA 3H40A 4LQ3A 2VIHA 5JUMA 2W7OA 1TK5A 3D67A 2NUHA 2R7RA 3ULHA 2IHR1 4DFJA 3ILLA 5CCLA 1FX4A 1DY3A 4XPCA 5HROA 2GW8A 3OTCA 4X65J 2AKWB 2MKJA 3SCIE 5C2CA 1VFJA 3QYYA 1X0FA 2HG4A 2VFRA 1V3RA 5ETMA 4JI8J 1C2PA 3TQ1A 1PO6A 1RHRB 2ZNYA 1VRTA 3MAHA 5AXMA 3A4TA 4JI7J 1NJYA 1U8WA 3FRZA 1GXUA 3OL9A 2I5JB 1TV6A 1DURA 4RUCA 4R0JA 2YPZA 2OTLS 8RUCA 1Q7LB 1IR1A 4PKDB 4KKOB 3S1TA 4C3KA 3V4MA 3PFEA 1EKRA 1K0VA 1VI7A 2RQKA 1RWNB 2FVCA 3MXHP 3G6ES 5D0GA 5D15A 1VBXA 1M90T 3A3OB 1QLNA 3QIDA 2RE1A 4LF8F 3PW4A 1YK9A 1RYSA 3NGTA 1GTEA 2W2OP 5CD4A 5DM7Q 3POTA 3HMJG 1D1UA 5E3PA 1SQGA 4U8YA 3UVJB 4MIAA 1BQMB 1F2HA 3KMSA 2EXUA 1Q5VA 4ICLB 1FT8A 3DHXA 3UR0A 2J5AA 1YTYA 5ETOA 2ZFHA 4ZLLA 1H0HB 3D1QA 2GZOA 2IDLA 2ZVIA 3QJJA 4OHWA 1LXJA 3DNCA 2G13A 1F5BA 3DLBA 3BYRA 3B4DA 4K4VA 1IBKF 1JQGA 3QWUA 2JVRA 4OZ3A 4Q8EA 3EZ5A 1T05B 3ETMA 4K2JA 4CIOA 3D4JA 2X1BA 4P75A 2UUTA 5AT1B 3ICLA 3F0NA 4USWA 3PYFA 2DH9A 4NLYA 3G8TA 3QO9A 4Y2MA 2WSFC 4FPRA 2ZE2B 1RHKB 1GMWD 2R9LA 1WDDA 1NPRA 3X1LB 2DHSA 5DETA 4EZ6A 2ZKUA 5DG8A 3C14A 2R8JA 1NJZA 3MM8B 4P2FA 1KVJA 2B3TB 3HSGA 1D09B 1G3OA 2Y9HA 5D8HB 4I67A 1JLGA 1KN6A 1ZS6A 3NKYA 2L9WA 2YKMA 2ZZNA 4IH6A 2B8QA 4AFFA 3T9NA 1KEKA 2NR0A 1FKOA 1S97A 1UKUA 2AMCB 3G96A 5A8KB 3MD1A 1TKZA 1UFKA 1SIZA 3VVTA 2MXYA 4JB8B 3W1YC 4CTAA 1HR0F 2IBKA 2E9ZA 1SJFA 2RNEA 4U9RA 3ET6A 3PG9A 2RDIA 5HMXA 4ZOSA 1XMOF 3NGSA 4KO0A 4IO9Q 3W2VB 4YMEA 3PNIA 1NXIA 4I2PA 1NEEA 2A18A 2HQDA 5M2RA 4ZP9A 3I31A 2VQEF 3CGIA 3MWBA 2P6TA 2DNYA 1V6HA 2HK3A 2V2QA 1YZ7A 5KG6A 5F0WA 2MKYA 4L6V3 3A13A 3ZO7A 4QZVB 3V6JA 2AJFE 3T1YF 3G6XA 1DQ9A 1S9GB 2UU9F 2IA6A 4JI0J 3M32B 4ETXA 2LECA 3BGFA 2F4VJ 1XBWA 3G8QA 3ZZOA 1H73A 4OZ0A 1RT6B 1JLBA 2LQJA 3W65A 4JYAF 1RHQB 4R8UA 3TX8A 5E3QA 3TJAA 5B0BA 2ABYA 1BY9A 5D77A 2VUGA 4OI6A 1TFYA 5HI7A 1HL6A 3NLCA 2ZOFA 4NLDA 3OR2B 1LWFA 3F56A 5E3RA 3LAMA 1XC9A 4J9OA 1WEYA 4NLXA 2RF2B 2JX2A 3DC2A 1HQUA 3BDEA 5T14A 5ETLA 4ID5B 2H65B 1KQGB 4DV5J 1TL1B 4JV5J 3G82B 2MQQA 3HKWA 4DOZA 1KD1T 3LP0A 3M8QA 1O6XA 1IKYB 3HVWA 5FDLB 3A8EA 2PEBA 2RQCA 2HZAA 2FVSA 3ZTPA 2XHWA 1C4AA 3OPKA 4CDIA 3D6MB 4QPTA 3VAIA 3T1AA 5E2QA 4Y34A 3CXCR 1DTQA 2W2PP 1R8AA 2RDJA 1RT7A 2ZD1A 2KRBA 4DV3J 2N7YA 2NXJA 3BGUA 3CTRA 2IMOA 4V19X 2LXFA 1HHTP 3TJ8A 1Y4ZB 5DLFA 3UPFA 1IBLJ 2VH7A 2VFUA 4LF7J 3RB3A 3LA0A 4ZHRA 1FTCA 1SKUB 3C6UB 1F2GA 2MDAA 1RT3B 3PKYA 2PEHA 4QIEA 2ZH1A 3BKFA 3DLJA 2OPSA 4DSFA 3GIIA 3GQCA 3OTDA 1RT2B 4ER8A 2FJAB 2GS8A 5L9NA 5DGAA 2UUAF 5ETRA 1BGXT 4J9PA 3WHIA 4RW8B 4TY8A 3W8GA 3BBFA 2HGMA 3PXGa 2DGUA 4NLTA 1TL4A 4A8QA 2CQ0A 2WOMA 1SL0A 3CJKB 2FQQB 1HNXF 3QBCA 1AZSB 3RBXA 5KFDA 1YJVA 4DCJB 3NNHA 1S49A 3D66A 3TZZA 2K8GA 4RO0A 4KPYA 4OFZA 4X4TA 1CULB 3IR7B 5I42B 2IFXA 4AD6A 1NRKA 5E41A 2AJQA 1LWXA 2W2NP 3HJFA 4USJC 1ZYQA 1U48A 3D6FB 5KAKA 3UCGA 2XZTB 4DMZA 2XYPB 3OFFA 4MKVA 3JTPA 4ECUA 5BR8F 3M2RA 1H72C 2H4WB 6FDRA 5HBMA 2E7WA 3TEHB 4ES3A 3GG0A 4WK1A 1RTJA 2C42A 1PCAA 3AHPA 4ZJLA 1X60A 4QWBA 4ECVA 3HHLA 2FY8A 3IAS9 3FFIB 2U2FA 2MKKA 2I8EA 1TL5A 1S59A 1U25A 1W25A 2XM3A 5JJBA 5KFWA 3BKTA 2V8PA 4FYYB 1VC0A 2BQRA 4ED8A 1VQNS 1REVB 3VAHA 4KGZB 3TW0A 3IR5B 1Q8KA 3MMCA 3AB4B 5KFUA 2AGQA 1GX5A 4NLOA 5EDWA 4B3RJ 5HP1A 2V63A 2W9AA 2COLA 5CH7B 1FA0A 5KT7A 4O44B 5IT0A 4ECRA 4U7UD 2H3EB 1NPKA 2Z30B 2DGOA 3VGTA 4WE1B 4PG6A 4KJIA 2JH3A 2MGZB 4LT6A 1U2CA 4Y3CA 4DLEA 2VKZG 2HHWA 1IUJA 2MQOA 3SQGA 4EBDA 3FCWA 3IFEA 2IAJB 5DJBA 4J7CA 4X66F 3R2CJ 1IVZA 3BREA 1HHQA 2FGCA 4QW8A 2QA4S 3OL7A 2FJEB 3W9IA 4J9NA 3EXCX 3N79A 2HRYA 2BJ7A 3CJ2A 2C2NA 2YPYA 4I69A 3ZTSA 4D3HA 3P5BP 2YXLA 2IJRA 3DOMB 3HCXA 1D8ZA 3R5BA 1KFSA 4JI5J 4DV1J 1U1KA 1S0NA 2EKNA 1UPMB 1YWXA 3CPWR 1RWVB 1VBYA 3ENAA 2CQ1A 4LBHA 5SZTA 3RBEA 2BJEA 2GJFA 2EK6A 2MQLA 2JLGA 1YRXA 3T1HF 3TUIC 1S1UB 2DCLA 4OZ5A 3R97A 3LPYA 5L1LA 2QN6B 4WJBA 3GJTB 1UFWA 1T7PA 1YHQS 3NCRA 3KDNA 2Y8WA 4WP9A 4FF3A 1JLQB 3MM6B 1U24A 1JJ2R 2HFUA 3ZTQA 4CLFA 1RT5A 4DR5F 2QEXS 2EBEA 4OI0A 3QFHA 4J9VA 4WFZA 1W2IA 2W8KA 2XGQA 4ZPBA 1GXLA 1VOMA 1B0PA 1OQ3A 1IKVA 3W61A 1U7LA 4DX8H 1W2BR 3S6EA 1KKHA 4J9KA 1WG5A 3W60A 3RG6A 2FLPA 1IWGA 3OVSA 3Q0AA 3M9MB 1J5EF 3I55S 4ECSA 1TVRB 2MZRA 2W9CA 3MPDA 4CT8A 1B7YB 4X4QA 2GQQA 5D6GA 1UA0A 3B82A 2DGXA 1VISA 3BR9A 2XYHB 1VQ9S 2V0NA 4DQQA 3DLKA 2M4MA 5CYMB 1QAJA 3K8VA 4DX5A 1DQAA 5DQGA 4DL3A 3FUYA 4EI2A 1H38A 3QIPB 2IVMA 3WC2A 1RWUA 3D1OA 1X4BA 2MYFA 4B3MF 5F3TA 3EM1A 3GLJA 1FJEB 4QWCA 3JSRA 5ETSA 2BOAA 3CJ0A 1MW7A 3UWTA 2YKNB 2CNOB 4CO4A 1YVFA 2D3ZA 2ACMA 1EIYB 2JOQA 2BJ1A 1TUGB 1RKIA 2GIFA 4DR2F 3DXSX 4IFYB 1X7VA 1X5SA 4UY8T 2DHGA 1UJ6A 2ATLA 2UUCJ 4CNYA 1N88A 1ZAVA 4N41A 2R8HA 1TTHB 3CT9A 3GFXA 4JI1F 3PHTA 4N5SA 2BRKA 2JFDA 2DY1A 1QJHA 1RAAB 3IRWP 3DYAB 3QLHA 1T0TV 2VBYA 5E7OB 2FVRA 3AOAA 4OHXA 2LQ8A 1CJKA 4QIWD 4B3TF 1RHUB 2GX8A 1IKXA 3O44A 3CCZA 3TI0A 4DFMA 1KHWA 4LJMA 2KZMA 1N54B 1CJUA 4KIAA 1YBTA 3ZZYA 3MECB 1GMWA 2FHJD 1K44A 2W9BB 1FDNA 2O5DA 2OIHA 4F2RA 2HSEB 2CJ9A 1J2VA 4IFVB 1G2EA 1VRTB 2FYXA 5KFRA 3MR3A 5GAGU 1FDDA 3NAHA 2B7CB 1JLEA 3QQCD 2L9DA 1HPZA 1N33F 3GTYX 3MPVA 2G2YA 5LOQA 1PKUA 3A8KA 3SCLE 2CQDA 4OLPA 2ASYA 3IG1B 3MTJA 4WZMA 3W66A 2HAIA 1IXKA 4PUOA 3S01A 5J2QB 4UUWA 3FKBA 2IM2A 3AODA 4WTOB 2Z57B 2B9YA 2KT2A 1NB2A 4M5HA 3H0PA 2V2ZA 3PV8A 4E98A 1B3TA 3OXLA 4PQAA 2CYYA 4DSEA 1S57A 1SI9A 2APOA 1XIQA 2DPJA 2ZH5A 2HHTA 5A2QU 2VG7A 2KU7A 1HNZJ 3N0VA 2RRBA 1GAOA 4ES1A 1RT4A 3EMTA 2VBWA 1RT1B 2MSSA 3FEZA 5ETTA 1A6LA 2RHSB 2J6TA 1OIAA 4X62J 3V6HA 1JNRB 3MCMA 4C0BA 4FBUA 3DI6A 1WTBA 3CCJS 1M5VC 3SEOA 3G86A 3N4WA 2KM8B 1CEZA 2BM0A 4DQSA 2J9EA 3HT0A 4NLUA 2HHQA 3HLUA 4NMLA 1NDLA 1CJTB 5A8RA 3VAMA 3CB4A 3CCVS 4F4KA 2LP4A 4UW2A 1FRIA 3NOGA 2YNGB 2JC1A 4ILLA 2R7OA 3GFHA 1OJ4A 3VAGA 2FHMA 3KKFA 3MMAA 2VASA 2LEPA 4IOCQ 4QU6A 2O01C 4KT0C 2LQ5A 2BM1A 4C8MA 1BQNA 3H2LA 3KOAA 4L72B 7FDRA 3DLEA 2R8KA 5SUHA 3LGHA 1JLGB 4OV1A 1K1SA 4UZCA 3OTOJ 1K0TA 3HP6A 2WW4A 4HKQA 5KFXA 3LOUA 3LP1B 1DTTB 2V6AA 2FVPA 4X65F 1FESA 2C3UA 1VYAA 1HHSA 3NY0A 1T03A 2DNLA 2D9PA 2XY5A 3HT3A 2YY3A 1TKZB 3T3FA 1NM2A 2I9SA 3GSIA 2R42A 1KDNA 4ED2A 4X4OA 4NXMJ 4M1KA 4H4MA 2EFVA 2FJVA 4JI7F 1GK8A 3GE9A 1XMBA 5KFLA 4EFAC 3J7YI 2AGPA 4KO0B 2KT5A 1TKXB 4C97A 5EWGA 1TL3B 4NXNF 4RW9A 3KHGA 1LEOA 3JQMA 5J2PB 3H8YA 4USHA 3KK1B 4HACA 2XY7A 1M5OC 2DH7A 1ROFA 1LXNA 2V8VA 4K0KJ 2ZBIA 4LSLA 3I6PA 2DKOB 1HMVA 2K2PA 1ZM9A 4ZN1A 4YDDB 3CD6S 3AXKA 2ZM6J 2QL9B 3JQKA 3KK3A 3PYGA 2ADCA 1UL3A 3PYDA 4JI2J 2LFVA 5AJ3F 2O1PA 4PWDA 2AYBA 4CLYA 3AY0A 2ACYA 2CVEA 1RCXB 4DL7A 4P10A 1UFLA 4OIXA 2E7VA 2XSFA 4EWTA 3SSRA 2RUSA 3G9CA 5JXSA 3RYLA 4K4UA 5A76A 4PQUA 3MEKA 3MM9A 4RW4A 2JL9A 5DQIA 1NMEB 3M8SA 4DV2F 4KQZA 3JYTA 3MCSA 4USIA 3MR6A 3PY8A 4NLRA 1N5VA 6AT1B 1T9UA 5CQGA 1L3KA 1LWFB 1OSDA 4XK8C 1NPPA 1PYSB 2B51A 4ZK7M 1JLAB 3FDSA 1R7IA 3ADAC 1V3SA 4LRAA 1A7GE 4OJ1A 4PABA 3SV4A 5F0UA 3JSYA 4YOEA 5J1EA 1RLDA 1WTFA 3HHEA 2W24A 3LP2B 2HMIB 1SJ1A 3FMWA 2E1AA 3JS9A 1V5IB 2GIRA 4IR1A 2LDIA 4A47A 3DM2A 1L3TA 3AFGA 3HSDA 2X1FA 2MHNA 3H4BA 2IDEA 3VAKA 3FRYA 3V6DA 1HWLA 1K73T 1KTQA 1FE0A 1LWCB 1QVGR 1NH8A 1S4EA 5HO4A 2OELA 2B4UA 2KHCA 4UOFA 2XQCA 1S9EA 1I5OB 3Q8QB 1YGYA 2CZVC 3RUBL 4AXIA 4HEA9 2IA0A 2JRSA 2CG4A 4MT1A 2RDDA 2AWZA 2E5HA 1NSAA 1PYTA 2GQ2A 4R5PA 1FVQA 1KP6A 1JLCA 1U49A 2WB1D 3CCSS 2CNLB 5DG9A 3BPSP 4DLGA 1U1NA 5KFYA 5IFMA 2AGOA 2YNFA 1JWWA 2F4FA 3CJQA 2DNRA 1ZM4A 3VGSA 2WVFA 4TU7A 2VG5B 4HLBA 3OUYA 2J7KA 3O8WA 4NLSA 4C7QA 1UZDA 3CF5Q 2LU2A 3SI8A 3HXMA 5D4LA 2ZH7A 4Y6IA 3LW5C 2BX6A 4IG3B 2ATCB 3OR1B 3I0SB 2GVDA 2EW9A 4O0IA 2R8GA 1G7CB 4ETZA 1NHVA 3E3XA 2XMMA 2HRUA 3HF5A 4FN5A 3GFYA 1KS2A 1NK8A 3Q2SC 3PFOA 3GU0A 2VHGA 2C28A 2KJWA 3T19A 5F3ZA 1B7FA 3SCKE 5C25A 3HX9A 1FD2A 1URNA 3R9LA 3SQOP 3UW1A 1TQLA 4I2QA 1NCLA 2AF6A 2W8LA 4NLVA 1JJ4A 4KGKA 3MEEA 5E0OA 1FFGB 2B9XA 5F8HA 2W1BA 4N47A 1RYRA 3EGWB 3TUZC 3RR7A 2XS2A 2NXUA 4BWJA 3DN9A 4LQ9A 1P9QC 4C8LA 1YIJS 4JV5F 1CS4A 3TANA 2OLWA 2LCWA 1UWBA 3KJVA 4X4RA 1QDUB 4NI2B 2VJVA 3D5MA 4KH0B 4URGA 4DQRA 5A0YA 3ETOA 1D9DA 3TR5A 2J0QD 4OX9J 1N36F 3MM5B 2E5GA 2R7VA 1HW8A 2MEWA 3KJQB 4HL9A 2DISA 1BE4A 5DDQC 4FBTA 1W26A 3Q86A 1CBKA 1FTRA 2YNHB 2KO1A 3PW7A 2DRBA 3L7PA 2VA3A 4CH1A 1NK7A 4MAKA 1IWAA 2BEFA 2YQ1A 5A6PA 3QSIA 2BUNA 4C3LA 1R0CB 2YX7A 1UVNA 1Y00A 2BABA 3MM7B 3SBMA 5EWFA 4L3KA 2GFFA 2I5JA 1R31A 4PWWA 2M8HA 3FVYA 4QJVA 4CQ1A 3D1HA 3IRXB 2UXDJ 1WC0A 2OD4A 4NMXA 2IRYA 3OHBA 1VJQA 4NLGA 5MAOA 3LANA 4KKOA 3Q8VA 3PX0A 2N4DA 2WTFA 5H9EJ 2XG8A 4RBVA 2PE8A 3PHEA 4YB7A 2MKHA 4BHQA 1VQ5S 4MIBA 1FEHA 4ZP8A 2VOPA 3RW7A 2P9EA 3NCPA 3PR5B 2YWKA 3U7JA 4JI4J 3D54A 3H5YA 1RTHB 1MU2B 2E5JA 1FERA 3M8RA 2QFJA 5IC6B 1U1QA 4FDFA 2RT3A 2DGSA 4IKAA 4YFUA 3ZTRA 2ZH9A 2V9WA 3UVJA 1SC4B 2XS7A 2KL8A 4KV8B 4ICLA 1Q8IA 2O66A 1S1XB 3GP9A 4ZCMA 3ZZUA 2Z2ZA 4QBUA 2C2DA 1RWWB 5DDOC 3QGIA 2CZ4A 4RBUA 3PIPQ 1XWLA 2CVIA 5K8PA 1OMSA 1CC8A 2FIUA 5B09A 3CCLS 4LMZA 4RW7B 1HWKA 1TMMA 2CRLA 4OHZA 2VODA 3CDUA 3OXFA 3M6XA 3DGVA 2A1BA 1T05A 4TLRA 2ZZTA 4WKYA 4ZPDA 5LSRA 2DR5A 4DV7J 5KT2A 5BYQA 1NSKL 4TQRA 3DHWC 2HHHF 4LFAJ 2LKZA 2KKHA 4UZBA 1RT5B 3LF0A 4KTQA 2M5YA 3DDIA 3KNAA 2N4CA 4ZIVA 3EZUA 2AU0A 3MM8A 4ZP7A 2BVZA 1IJFB 2DEJA 3PEHA 1UEUA 3WZ0A 4HTIA 1VC6A 3R5DA 2HW3A 6FD1A 3NP5A 2G2ZA 2AZ1A 2DO4A 2CPDA 5DGBA 4H4KC 4UQGA 1VRUA 2FUG9 4DL6A 1H2VZ 4X2BA 2W9CB 2B8PA 2DNZA 1KLMB 5A8KA 2K1RB 4JI3F 2FHJA 5ETPA 1I94J 4DUYF 2J7WA 5KFFA 4IUFA 2RD5C 1X4AA 3ENWA 4ELVA 4USVA 4B9UA 3W7BA 1FWKA 4CCHA 3W2VA 2V9KA 2HWTA 2BANB 4BBYA 3MF5A 1F6TA 4MK9A 1HWJA 1XNRF 4ZIWA 1NUEA 2QMUB 2WVBA 1TUWA 3NGDA 5M2UA 3O1LA 5T7LB 5T41A 2R2UA 2MY7A 3QMQA 3Q23A 1NZAA 3BQ1A 1EKSA 3T6BA 4P74A 2MY8A 2NREA 2QT7A 1WACA 1IBCB 1D3WA 1EHWA 1UVMA 3D68A 4RNNA 5I4MA 3PACA 1S99A 4WF9Q 2LEBA 2FZGB 3B8HA 4JI5F 3HM9A 2DO0A 4F3QA 1WC3A 2EPIA 3M32A 5CZXA 4J90A 2CJKA 3MZIA 3PJWA 3CVKA 4M5KA 4DR1J 2I38A 1Y5NB 4ZPWR 1RT6A 1UVIA 2BKOA 5L9XA 4DF8A 4K59A 2BYCA 4WYWA 5A6WA 3NS6A 4AL7A 3LGNA 4P52A 1S1VA 1CJKB 1E6VB 1YLXA 1FWPA 3H20A 2GHVC 2B6AA 3J7A1 4C8YA 2NS1B 5J1PA 3CJ5A 3OR2A 5D3GB 5LMNF 1RWPB 1S6PB 4PG4A 1X5PA 2XB2D 3ILOA 4UF4A 1FD8A 2RF2A 2QLFB 4J9MA 3L7OA 3IAM9 5IT9Y 3NGUA 4ID5A 1SKWA 1TL1A 4DSLA 4PRFA 3O5TB 4CLZA 3A3NB 3G82A 2GO9A 3OTBA 1OY6A 5K14B 2OPQB 2FB0A 1KQSR 3HZEA 1IKYA 5FDLA 3MR7A 8ATCB 3W5XA 5I3QA 2BACA 2K3KA 3JSBA 1RWXB 3I87A 2VONA 2QA2A 2XC9A 3R6LB 1ZAXA 4JOUA 2Y0BB 3DLHA 3R5CA 3OVAA 2ALYB 1IQTA 4K4WA 4AYBD 1MROB 2KT3A 3M2VB 3NRBA 2OHDA 1IKWA 3LO3A 3EWGA 4C8NA 4W90B 3VAJA 5HN0A 3SMZA 1IBMJ 3IP0A 1FJ7A 1XEZA 2DTJA 1WC1A 2HNZB 1EZZB 3PJXA 2CPYA 2XMVA 2FC9A 1TMJA 2Q6BA 3R6GB 3CJRA 3J7AN 5FLXU 2Z2LA 2L48A 3JAMY 3C6UA 2MMYA 1RT3A 3EX7B 3DOKB 5EHHA 1M5HA 3IS9B 1RT2A 1WKLA 2XZDB 2PA3A 3MFIA 5J2MB 1QE1B 3ZZ0A 4A4JA 2GVZB 3CCMS 3JQJA 4RW8A 1S77D 2KG1A 3MUTP 4GKJJ 1VJWA 2FPHX 2VC1A 2OEJA 3QZ8A 3SFGA 3CJKA 4J9SA 2V4JB 1AZSA 4N77A 4LF9J 4N56A 1X31C 4NEZA 4DR4J 4WFNQ 3GR1A 3GJQB 2V8GA 4DFPA 1X9MA 1CULA 1EJ7L 3DLEB 5RUBA 2JDJA 1X4CA 3DRSB 4LF6F 3D6TB 3T5JA 3NBPB 4K4ZA 1Y3JA 4H4OB 1XQIA 2LXIA 4BDPA 3THPA 3FJ2A 4WP8A 2BE9B 2UXBF 4FNIA 2X1AA 5DZ6A 2F63A 4C48A 3SSSA 4YP3A 2WRMA 1WSVA 1QSLA 3MAAB 2Z58B 2W7PA 3AQOA 4HT7A 4HYKA 2F1FA 1QM9A 3G2XA 3QRQA 1H74A 3SFUA 3P45B 3SV3A 1UP1A 1PJ5A 2VFSA 4I7FB 1HD1A 3UO0A 3FFIA 2XULA 2OSQA 2UV8A 4CO5A 2HNYB 3KLEB 4QWEA 1WI6A 4I68A 5AXKA 2H4YB 3U02A 2BA9A 3P8BB 2GAHC 4WFXA 1REVA 1TP7A 4OYIA 3RBZA 1ZAWA 4I4BA 4G6VB 5AE3A 4LSLB 3THTA 4M5DA 4GMKA 1HMVB 1R27B 2VICA 4X4VA 5EX0A 1Y3KA 3AQPA 2CPZA 3RW6A 2QFIA 3CNQP 5K8MA 5EUHA 4ZVPB 5IWAF 1S5ZA 2HIYA 4JI6F 1YSJA 3UD3P 2EBGA 2B9WA 4O44A 1Q4RA 3BS9A 1OY8A 1RE1B 3KWMA 1HFEL 4FNHA 4RNFA 3W5YA 4WE1A 5HJYA 2MGZA 3K59A 1ZH5A 4DCPB 2BDPA 4WWSA 4QW9A 2F9JA 5B08A 3FSYA 4ZN3A 4DU8A 4M5MA 2E1MC 3IWXA 1Q7YT 2IAJA 2BQUA 1BWVA 4O4GB 3M05A 1FKPB 2DHHA 2X7IA 1S1TB 3BGOP 2B4VA 3GYNA 3CW2C 3CIMA 3HVTB 4OX7A 2NUUG 2CXEA 2DR6A 4OZNA 1DARA 1WORA 3VGUA 4A8KA 3MR2A 3D28A 3DOMA 4OQJA 3J81Y 4EO8A 1KONA 4OJ3A 5D78A 1U6FA 1YI2S 5J1EB 3AOBA 2HYIB 1XNQJ 1N0UA 1U0HB 1LW2B 3M30B 3LAKA 1FF2A 3OTOF 1HI0P 2XHCA 4X4PA 4R25A 1S1UA 4WPAA 2VPYB 4PAAA 4YB6A 4LBIA 3NMAA 4ZVHA 3VAFA 1LK5A 2DXFA 5KFCA 4KHRA 1F9EB 3V6DB 1VQYA 1HYSB 1JLQA 3MM6A 1VK8A 4LF1A 4KC5A 1YZ6A 4WYLA 4X84A 1QTNB 2ZKTA 4MK7A 1VLOA 1HWUA 4FF2A 2LDYA 2MB0B 2E9TA 4PXBA 4KGXB 1LW0B 4RL1A 3G4SS 1MWQA 3H90A 1CJVB 2Q6CA 5KG1A 2GNKA 1O51A 1OO0B 2G2OA 3OBIA 1R8HA 2CQPA 3ELHA 3GR0A 1TVRA 1HQEA 2H5IB 2H5JB 3B54A 1K1QA 1HW9A 4I64A 1VQOS 2QA4G 4O3RA 1VQKS 4NYOA 2ZM6F 1ZM3A 3OT9A 2OP5A 2EWHA 3CD0A 4QYZJ 5CYMA 2DNHA 1NKEA 2MZJA 2HVEA 1Q78A 2W25A 4Z7CA 1NSQA 3EJMA 3QIPA 2XS5A 2AZ3A 4KYZA 5CHCB 2XTJP 4ZLNA 3W9HA 2RUGA 1UVLA 2XI2A 1RJJA 1WUUA 1RHJB 1IN0A 5DS7A 3DLGB 1WG4A 2LQBA 1XN9A 3IBWA 2YKNA 3I4PA 4NYZA 1S6OA 1LOUA 4IR9A 3TYTA 2EG1A 3BO4A 4OZJA 2CPJA 1S1WB 4ZKAA 3MEEB 4IFYA 3EGVA 3QRPA 1SIWB 4RUAA 2HGNA 4LRFA 2OFGX 2QYCA 2FHKA 1RA7A 3H2UB 5I3PA 2PD1A 4NYPA 4CM0A 1BHNA 3VQTA 1PC5A 1L3SA 3A12A 1IBKJ 4KE5A 3DYAA 4CP5A 4NE9C 4ZPTR 2DGWA 3EVWA 1S6UA 1Y0HA 4RUHA 2JNJA 3J80Y 4WXOA 1TK0A 4F36A 4F67A 2D1CA 5LMUJ 1NK0A 1C0UB 4NWBA 2J0XA 1FJGJ 2ILYA 3SXLA 1RAHB 1O5JA 1YQHA 4JV1A 4I1TA 5IZHA 3WC0A 3CC2S 2KXFA 3MECA 5JMNA 2UVUA 1ZA2B 2M9KA 3FCHA 2W9BA 4LVNP 2QTWA 1QUPA 3PRBA 4F7VA 4IFVA 1E6YA 5HQMA 3BDPA 2CWKA 3W2WB 4AXJA 3NNCA 1SV5B 2F8MA 2OJ3A 1BUXA 2VA2A 1AT1B 2AYMA 3OXGA 2A2DA 2B0GA 3IG1A 3BF4A 5A8WB 2HVDA 3EPIA 4AQYF 4USKA 5J2QA 2DR7A 4D3GA 3RRHA 3ISNC 4HVZA 1HR0J 2HLUA 1TKTA 1NDKA 2V5HG 5KFKA 5DDRC 4Q45A 2M8DB 1VBKA 1BXNA 4RLEA 5IC4B 2M70A 1XMOJ 1AYEA 1P1LA 3HHNB 5L46A 4JV2A 2XZWA 1R0AB 4GC7A 4FYDA 2AJ1A 2PN6A 1RT1A 4ZCIA 2X1GA 2N7CA 3BJYA 3KLGB 2VFVA 2IM1A 4HHJA 2YVSA 2W4DA 2GMHA 2VQEJ 3CCTA 3RRKA 9RUBA 3ZZRA 4Y2CA 5G0RB 1TELA 1HBOA 4E0DA 4DHVA 3AA8A 3CMQA 2C3OA 4KR0B 2QLXA 1CJTA 4TKTA 2YWWA 1U09A 2PI5A 4DR6F 5ETKA 1UPPA 3M6VA 2UU9J 2YNGA 2IPOB 4DV0J 3M8YA 1FX2A 2HQGA 4Q0BB 3DRYA 1N6QB 4LFBF 1FK9B 1SH2A 1RP5A 4PXEA 4JYAJ 2HKEA 4K7QA 1XR6A 1UW4A 3C15B 3D0IE 2F9DA 3M7VA 5KT5A 2J76E 3QT6A 4XPEA 5L1JA 2F5GA 5H1SV 2DYAA 1FEEA 5C42B 3LP1A 3PIOQ 2FJXA 1NHKL 2QL7B 1DTTA 1VRUB 1FI4A 2ZJPQ 5G4DA 1NKBA 1B0VA 1SJQA 1Y11A 2GHWA 1X4GA 4M94A 3EE3A 3HULA 3UD4P 3R7BB 1F9HA 3W62A 1QY7A 3BYPA 5D4OA 2A2CA 2VJUA 3JSMA 2ZWOA 1RTIB 5CAAA 5DQHA 1B70B 4O3NA 2O3DA 3M6UA 5J2NB 4KRWA 2UXDF 3RGIA 2CDQA 1TKXA 1QAYA 2H5EA 3MOZA 3BO3A 4ECTA 4NX9A 1TL3A 4UOCA 2OSRA 4KBIA 3R7SB 4LF4J 4V19J 2AIRB 3F44A 5IM0B 2PO4A 1J27A 4YN3B 1WKJA 5J2PA 5LL6d 2RKIB 2ASDA 2YNIB 3KK1A 2BOPA 2HFVA 2YH1A 5DM6Q 3CCQS 4L73A 4AUKA 2KFZA 4P2MA 4CH0S 4ALZA 2R7XA 3LALA 2UVWA 4KFBA 1RGVA 3GMGA 1NAQA 3FSIA 2F8HA 1VDHA 1N34F 4NOHA 3NXZA 1CQMA 1FRXA 1VQPS 4F25A 4NLWA 3TAQA 2XLJA 1ELOA 4C0OC 1VQ4S 4F8RA 3P4UB 3CCWA 4OMFG 3W8PA 4CI0B 3LWMA 2RAQA 4ITSA 4AE5A 1JLFB 1NH7A 3TNVA 1PSDA 2UUAJ 3MDFA 2BJ3A 3HHLC 4K5RA 3TZXA 4GVBA 2VB6A 1X9SA 2V2VA 3Q8UA 2FJWA 2UXCF 1SJ3P 1S1VB 2LLZA 1NZ8A 4ZS6A 3D3CJ 3TRGA 1ZM2A 5KOXA 2XMAA 3I4HX 4OYPA 4QQBA 2LVWA 5B0CA 2B6AB 1C1BB 4LFCJ 4X4SA 3AJ2A 1HNXJ 1WF1A 2CPEA 1SKSA 3IGVA 1NBEB 2D3OR 3K5OA 2ZH8A 1JLAA 2BR0A 2XO6A 1H3DA 1IJEB 1SC3B 4EBEA 3NAIA 2HWHA 4BWMA 2V94A 2VC0A 3RJMB 2MTLA 3L4BC 2Z2YB 3DDKA 1VBZA 1S7HA 2RB7A 3LP2A 2HMIA 4WZQA 1HD0A 2HHVA 5CYQB 4NA2A 1KVKA 1PYOB 1ZETA 4QIFA 3VZIA 3AAWB 4DS5A 3H5XA 1G1XA 4WU2A 5KG3A 1KRPA 3V4IA 2AJ2A 1P6TA 2ZBRA 1BMQB 2PMHA 1WWHA 4A8XA 5BR8J 1JJHA 1VR6A 1JK9B 1FKAF 2EC2A 1LWCA 3RB6A 1ZZFA 4KHPF 1CPZA 2H1YA 1IKWB 3BPDA 1T9YA 3D7SB 2ZUAA 4A8OA 2VDHA 4ZCKA 3ENVA 4PR6A 3OQ2A 4BC7A 1T9TA 3KLHB 4OYZA 3UDVA 2I2YA 1A0OB 1F1BB 3MFHA 2P2CB 5E3CA 1MSWD 2ROPA 5U47A 5GADU 4QYZK 5HJXA 5GADI 1JIHA 3NMRA 2VG5A 2DHXA 3CCES 2HVIA 3TA0A 2XLIA 1AFIA 2LA4A 1X5OA 4HH1A 1FCAA 2CJYB 5LJ5Y 1NK4A 2UUWA 4DL4A 4Y2AA 2CQGA 4PYDA 1PGZA 2GMLA 5KT4A 4IG3A 5B0EA 3OR1A 2ZH3A 4CYUB 3I0SA 4IH5A 1LK7A 3KUGA 1UJ4A 4BC9A 1GH8A 3ISND 2C2EA 1UEKA 3PYEA 3MD3A 4Q5VA 5K8NA 3R2DJ 2VG6B 1JB0C 2HHSA 4DFKA 3H25A 4IYQA 2DR9A 4X66J 2N82B 3CMAS 3Q83A 5B7WA 2KRRA 1CVJA 3ZXWA 2C2KB 4EUVA 3GYGA 5K20B 5DLGA 3UE2A 5J1NA 1LFWA 1VS3A 2KFNA 3B6BA 4WBFA 3CE8A 1TKDA 4DU7A 4U7CA 4CO2A 4PG8A 3Q22A 2V8HA 4F2SA 1SVDA 2BQ3A 4A8FA 4G3IA 2IC3B 1RLCL 4RWWA 1PJ6A 4IRDA 1M5PC 3QPIA 3TP2A 1U02A 3NS7B 4A8WA 4DV6J 3C46A 4NPOA 2HQ3A 4J5OA 2P9CA 5IV4A 1HQ2A 1CG2A 3T1HJ 4KB7A 1UMJA 3K5NA 3CDWA 5DRKA 4NI2A 1DAXA 1XR5A 2ZBPA 3HSJA 4NZ6A 2ZC4A 4IQXA 4C11A 4DUZF 1C0TB 4TXSA 1TL7B 4N76A 1LNQA 4TN2A 4O23A 5KFIA 3MM5A 1Z4UA 2JEFA 2V68A 3ZNUA 1PBUA 3E01B 4TU9A 3PW5A 1DFDA 1UAWA 1KC8T 1T11A 1S6QB 4NA1A 4LBPA 1G6BA 2RSQA 4ES2A 4NEYA 4M5DB 2YNHA 1AA1B 2IM0A 4ID8A 1IBMF 2YKQA 2IVYA 3MEDB 1XERA 1CLFA 2Q66A 2WSCC 3MM7A 1GFWB 3UN5A 5L38A 5EGYA 2VPXB 2CIMA 2KYZA 3IRXA 1H2TZ 3D2WA 3IMQJ 5L39A 2NQPA 1U1RA 4M5GA 3ILJA 4PCQA 3EDRB 2OH2A 4E2FB 1DLOA 4PPDA 5AE2A 5H9FJ 5C24B 1PBAA 2CDRB 1L3VA 4DI6A 4LVOP 1YRTA 4P72A 3G71S 4DBQA 3CJ3A 1LKZA 1H7WA 1NDPA 4O0NA 5CZVA 4HDGA 5E3AA 4F3OA 3JAMU 4K5SA 1O8BA 2YKOA 4UQTA 4DXLA 1SB6A 1RTHA 1MU2A 2CJQA 1WI8A 2GC8A 4B3MJ 2NYHA 5CABA 3TAPA 2P6SA 2L41A 4GKKF 2GMJA 4DR4F 3CO0P 4B9LA 1F60B 1WHXA 1KTVA 4P7VA 2UVRA 4KV8A 4HR2A 5CD4H 1S1XA 1VIXA 3PCOB 4J91A 2KG0A 2MQMA 3NNAA 4BLGA 2HURA 3KHLA 3QT7A 4B9VA 2IY5B 3OJUA 5LM7E 3ITHB 1D8YA 2GGPB 4DR2J 4C4WA 1RAGB 3RZAA 3G6YA 4RW7A 4U67Q 3NG8A 2XGPA 4CNZA 3M2UB 1N8RT 1DHMA 1H98A 4OI1A 4CT9A 1F0XA 3GPAA 2DNNA 1B99A 1NNDA 1Y5LB 1VLYA 2ZBQA 1HWIA 3QJLA 1NHUA 4JI1J 2ZJRQ 4FYWB 4MYUA 3FBEA 4OHYA 5ETQA 3R5GA 4EZ9A 2ZUGA 2HQFA 4NZ0A 4B3TJ 4WFAQ 4EBCA 1P8GA 1R89A 1UJ5A 2MLXA 3SSQA 2HFNA 2D41A 3DDNA 2HWIA 3BEGB 2VQFF 1HQEB 1KLMA 4FVMA 3R3TA 1NDCA 4X64F 1Q86T 4MK8A 2K1RA 4YS2A 4LR7A 1KR4A 4WKRA 2XO7A 2WVEA 1KSPA 2QMWA 2LU1A 4R0EA 4DR7F 4YR2A 2ZDPA 2CQ2A 1X4DA 3IM9A 1N33J 4Z37A 2R2SA 1FXLA 2AHOB 4ED4A 4JUZA 3UCZP 5A2QY 3CUNA 2C3MA 4CO1A 1RTDB 1TAQA 2BANA 4YQWA 4QR0A 3RB4A 4DQIA 1QAIA 1REGX 3PTWA 2GCFA 3H5UA 1GQEA 1AB8A 2Q79A 5T7LA 2YWEA 3M8WA 4QIGA 4EYHB 3KMQA 2V69A 3W3SA 3Q8PB 3DU6A 1Z2ZA 1CSJA 2Z4PA 1RISA 2MKCA 1AW0A 2VDIA 3CD7A 1A9NB 5FJ4A 5F8GA 5D0HA 2WAQD 4ZVTB 1KWMA 3RBDA 2VPWB 3BGRB 1KOOA 2MSTA 5CXTA 3I0RB 1OYDA 4YR3A 2FC8A 2IMWP 1LQ9A 4RNHA 1WOPA 1HKAA 2V4QA 3Q89A 1SQEA 2YTCA 1RI7A 1UVJA 3H2VE 3M8PB 3OLBA 4U95A 2BJDA 4E8UA 2W4PA 3CJTA 2DGQA 2OEMA 1E6VA 4ED5A 4K8RA 2JSXA 1RA6A 1YJ7A 3IR6B 4FP9A 2RILA 2FJDB 1ZPWX 2OAUA 1IR0A 3OSPA 3HZGA 5D3GA 1N5QA 4OI4A 1S6PA 2BJ8A 5IQQA 3DOLB 2DY9A 3CMES 1EETB 1S4FA 2NZCA 2B5JB 3SYZA 2XYGB 1E6YB 4A8MP 2D3UA 1CC7A 3T5HA 2NXNA 2EFQA 5K14A 3GONA 1HNIB 2OPQA 4HTJA 1ULRA 3P5TL 2EVZA 2CJBA 2DNQA 2KJVA 3I32A 2E9RX 3WX4A 2MLZA 4MH8A 1OSCA 4CLTA 1EX8A 2CQBA 4PYAA 1BC6A 1TKTB 5HVFA 4TU8A 2DD8S 4DX7A 4B17A 3J7Z5 4ED1A 1MROA 1WHYA 3M2VA 2E7XA 2VU5A 1YJNS 4DPTA 2MZ1A 2NSCA 2RMLA 4P7TA 1HA1A 4XO0A 5KG2A 4HI2A 2V2KA 3SZ2A 3MOJB 1YX2A 5I3UB 1FFWB 1RTZA 5HMZA 2CA9A 1N32F 1WC4A 2A0FB 4XDDA 1VHFA 2HNZA 4NXNJ 1JNZB 4QR2A 2XBPA 3RAQA 1OS5A 3UR3C 1WJ9A 2Z0GA 1FHTA 5F8IA 1HBOB 1T3OA 2HHPA 2E5LJ 3DOKA 1VRQC 5ETVA 1U1LA 3IS9A 4UT4A 4ZCLA 4ED7A 3K0JA 3FEYB 3K8WA 3PRDA 2VKRA 5J2MA 4YHHF 1QE1A 1R8CA 2I0XA 2GVZA 4F0KA 2Y1LB 2CNKB 5AJ3J 4B9SA 1WDTA 3T5LA 4UUXA 3UN3A 2PMZD 1X4EA 5HMYA 1Q82T 4OX8A 4U7UK 5KFHA 4ZVRB 3RR8A 3WDOA 5C5JA 2V4JA 4F26A 4RU9A 4RBTA 4M95A 1RAJA 4P6QA 2BE7D 1YITS 1GXTA 4ANEA 4P71A 4DV2J 1ZTWA 4M5NA 1HNWF 3DRSA 2M7SA 3R5AA 2DHAA 3NBPA 3PDNA 5LMUF 2ZHBA 4H4OA 2DBBA 4FS2A 1AROP 1FJGF 4WXWA 2PT0A 4ZITA 1SXLA 2Y0SD 2IYIA 2CWXA 2ASLA 3UDEA 4KY3A 2X51A 2UP1A 1B4SA 2V34A 2XCAA 3MMJA 3UD5A 4B02A 4DWIA 4JI8F 3MAAA 4DS4A 3JSMB 3J80U 1WF2A 5HSPA 2AW0A 4DL5A 3J7YU 4ZJQA 5IXUA 1SBRA 2JWNA 3FCVA 4I7FA 4LUBA 4UTGA 1T3NA 5HAOA 5HL7Q 2ZZMA 3BZQA 2HNYA 3KLEA 3V6KA 2DRDA 2NSBA 3FGVA 1GEHA 4CLLA 3OFEA 4DX6A 2K06A 5HMWA 3K17A 3N5FA 4RU2A 3J81j 1NJIT 2FDNA 3TOQA 1VMBA 4B3OB 2WK4A 3H98A 1B64A 1K47A 3NS5A 1NK9A 4KFBB 2OPRB 2DIUA 3DMJB 3CSKA 1RHMB 3MI7X 2W2QP 4DSKA 5FIIA 5H9FK 1YBAA 3VHQA 3DU5A 2BMBA 1MWZA 2JVOA 2PSZA 3D9BA 1AUDA 1S72S 2I6WA 4LRCA 4OJGA 2YWFA 4USMA 2R8IA 1Q8BA 4ZDNA 4Y2KA 1S0OA 2AEMA 4GVBB 1XK8A 1DZ5A 4ZJOA 1APSA 2MJUA 3NEKA 4O4GA 1FKPA 3GIJA 1S1TA 5M2PA 4DF4A 4DV0F 4WIQA 2M3DA 1U2FA 2RHQB 2PI4A 2HLTA 3RB0A 5D0RA 3HVTA 5B0FA 1JJCB 3CD5A 1YKWA 4FVCA 4G1QB 2M52A 2U1AA 4YB1P 3P6YC 1ICEB 2HNDB 4LF2A 2QLJB 3L7UA 2E29A 3HK2A 4MFBB 2R2TA 3KG0A 4HHHA 4Y0FA 2OTJS 2QSFA 2HVZA 4G65A 2QLBB 4TYAA 3OL8A 1NO8A 3VWSA 3OL6A 2VL1A 4J9LA 5KFNA 3MCOA 5GAHU 1U0HA 3M30A 1LW2A 1VK3A 4LRDA 1N5TA 5GAHI 4OLOA 1GX6A 2ZOMA 3KFWX 3BH6B 2YWHA 5IS2A 4FYVB 1QAXA 3V4IB 1EARA 3CCRS 3N01A 5B0DA 1I1GA 3OHAA 2WW8A 3KHHA 4F3MA 2OPPB 1HYSA 2RQ4A 4ILRA 1NKCA 3US5A 2QIFA 1H7XA 3GSDA 4DDFA 4H54A 3QSYB 1WEZA 2HFOA 2E1PA 3KK2B 3P96A 1RU2A 1JKHB 4MYTA 3HD1A 1TFWA 5KFQA 2JEJA 3TUJC 1LW0A 2F8EX 2QE5A 2JZ5A 1N36J 1CJVA 4WFYA 4F4YA 4LF4F 4YEAA 3FBBA 4B3SJ 4FXVA 3G8SA 1UTAA 3TJ9A 2ROGA 2G0JA 2MZTA 2X3GA 3V2UC 1JMTA 1PJ7A 3VGVA 5LXRA 1S0VA 1S7IA 2D74B 2IYGA 3UCUP 2Y1IA 2J9DE 2WSEC 4EYIB 2YX4A 3O6QA 4F4WA 4TQSA 4DSIA 1EQMA 1D9AA 2J0SD 1MLAA 5BJRA 1MMLA 1P9YA 2IBOA 1X4HA 1FRMA 4JI0F 3DCAA 2DCUB 5F8JA 4ZVUB 4P73A 1UWAA 1SH0A 2F4VF 4J9UE 3QAEA 3PKMA 3NOCA 3DRRB 2GHPA 2PDAA 2ADBA 1S79A 3PR4A 3DLGA 2B56A 2QC3A 5BYRA 4DN9A 2EEYA 1SJ4P 2MLYA 2M88A 3CCUS 2NCKL 3IWNC 3TUPA 3KLVA 3VVUA 3GV8B 3Q8RB 4LFCF 2JHEA 4O3PA 1S1WA 3QWPA 2IJFA 4NCAA 3N6NA 3AXMA 1HBUB 3MMBB 4Q8FA 2NZ4A 4PEOA 5KG5A 4LRBA 3T41A 4Y28C 2Y3YA 4DV4J 3EYZA 2FLNA 3GJRB 4QR1A 3M8ZA 2MZSA 5F41A 1H2UX 3C2PA 1L3UA 4DV5F 5LT5A 3GCXP 1N4LA 2IJNA 3PJ9A 4WIIA 4O3SA 4IG0B 4C11B 2DK2A 3R1LA 3IN5A 2HHHJ 3M1VB 4EO6A 4CO3A 2F40A 1RXOB 1C0UA 1U1MA 3MUVP 3MEGB 3TVYA 2MHEA 3M4XA 2FZCB 2LA6A 4GC6A 4O4RA 1IM4A 4NLQA 2BZ2A 2DXDA 4DV3F 3SDEB 1SL2A 1S12A 4U8VA 1I3OB 3BSAA 3EXYA 1Y9OA 3W2WA 4XAKA 4UOGA 3A8JA 1IBLF 2JEIA 1SV5A 3KJFB 2FJBB 3I56S 4DR3J 1JXLA 4LF7F 5KT6A 3T5KA 3W63A 3HFZB 2WBRA 2HK2A 2V4RA 2WBMA 4JI3J 5A8WA 4XIUA 3NCQA 4G1PA 1YBUA 1HI8A 2J6SA 2QLWA 4DUYJ 2UV8G 1DLOB 1UZHA 2R2RA 2QG9B 2JLEA 3C6TB 2KHDA 4C9DA 2KXHA 1PC4A 3GILA 2VBXA 1XJWB 4IQMA 1GTHA 2V67A 3R5JB 2B9EA 4N8OA 3GCWP 2RRNA 2HZCA 5KFZA 2RS2A 1IM6A 4F4XA 1R0AA 2POKA 2HBZB 1I51B 2Y8YA 1XNRJ 4OYBA 4ED3A 4Q44A 1N5YB 3KLGA 2KXNB 2DRAA 2RH3A 3TVZA 3RRGA 3D6HB 1SKRA 1S76D 4DQPA 2LXUA 1HNVB 5G0RA 2CNNB 5HVGA 4FYXB 3UFCX 2H48B 3OFGA 3GWCA 1NJWA 2GAGC 4L76A 5AXLA 3KNGA 2AJ4A 4RKUC 2DJWA 4FKYA 3IBCB 3TA2A 1O0PA 3BM7A 2QGFB 1WELA 1F5AA 3I96A 4XDCA 5HQ8A 5KOWA 3D0HE 4DV6F 3DRPB 3C16B 3OJSA 4Q0BA 2QZ8A 1GMUA 1RWOB 1N6QA 2BE2B 1NB7A 4QYRA 2EI5A 1FK9A 1RUSA 2XMUA 4J9RA 1OQ6A 4LIRA 4ECQA 2CZ9A 1IQZA 4EK2A 1ZTTA 4MTPA 3DGPB 1RBOB 3DKDA 3C15A 3E2EA 1BQXA 1HI1A 4BS2A 1M5SA 5KT3A 1RZMA 3QZ7A 3FMBA 4LR9A 1G4CA 3DRXA 4WK3A 4LREA 3LWLA 5C42A 5LMNJ 3QGHA 3G87A 5HLFB 3TARA 4FXDA 2R7SA 4IDKB 1NSPA 3KLIB 2D69A 4CM2A 4F02A 3UI3A 3V81B 1KLNA 2OMOA 1C1CB 2XSJB 1LWEB 4DPXA 4B3RF 1FRKA 3KG1A 3ENQA 3KHRA 2QYGA 1RTIA 2DNKA 3CJ8A 4MIWA 4DG1B 3K58A 5KG4A 4ED6A 2MQ8A 2O67A 3BSOA 3HJVA 5J2NA 2ZNZA 5IT4A 3KLFB 1NLKL 4NRUA 1SUQB 5IM0A 4RZRA 1R8BA 3UNGC 5FLXY 4OJHA 2RKIA 1ZA1B 2YNIA 3PW2A 2D3O1 4OI2A 2YBVA 1B0TA 1QUVA 2B43A 2JLFA 2VBZA 1RAIB 2CPFA 4CRJA 3VF0B 3HSZA 3M9OB 2VF3A 2VZ9A 3FNNA 4NZ7A 1SPBP 4CWBA 3QAUA 4RNOA 1P1TA 2ALZA 2R7TA 2GA7A 2ZC3A 3K5MA 4DV1F 2HHUA 4C0HA 3QGGA 3SIPB 1OWXA 5E5NA 3AT1B 3S8SA 4RW6B 4LR8A 3V5RA 1J5OA 1JLFA 3O2IA 1K8AT 5KFSA 4DPYA 1QSYA 1N56A 1Y5IB 2MQNA 3HFKA 3K2YA 3PW0A 1WOOA 2P8IA 4LSNB 4LSZB 1T9XA 4AL5A 5D4NA 3IC1A 4DSJA 4QU7A 1C1BA 2CJXB 1D9FA 3NGKA 4PWUA 4MKYA 1N52B 2B4OA 2ERRA 5HQLA 4IOAQ 2KN4A 4LF6J 4K4XA 3R7NB 1EB0A 5CYQA 2K7JA 5C2GA 4ANDA 2E5IA 3BN7A 4X4UA 3PEJA 4FKXA 5HROB 2H9ZA 2ZVSA 2WHOA 5KFTA 1RADB 2UXBJ 4K4SA 3TZWA 4ZPCA 4K50A 4I6AA 5F8MA 1X5TA 5KFMA 3RAMA 4BCAA 3VZHA 1D0EA 1VQ8S 2XWXA 1ZBTA 1Q95G 3QFWA 4NRTA 2QL5B 1JXVA 1NJXA 2DNOA 5GAGI 3TAMA 1YG0A 4PXCA 4RJVA 1R6VA 3R1HA 1XMQJ 3KTQA 3LQVA 1HBMA 1TV6B 4NASA 5E33A 1AXQA 3VTIA 1ACMB 3PVXA 4WTYA 1TUVA 3KLHA 4O3QA 4K4YA 2CPHA 3G6VA 1FRHA 3HHKA 4DCOB 5GMDA 2PGCA 3R27A 4F4ZA 4ENOA 4GVLA 4URQU 1YRUA 5IV3A 5EWEA 3EGNA 1U6BA 1S48A 3LH2S 3POTB 3EGZA 1S0MA 5IWAJ 4JI6J 3VR1A 1IR2A 1W7WA 2CQ4A 2Z56B 9ATCB 2UUCF 2Z2MA 3AH6A 5D4PA 4I56A 4CYUA 2A10A 3H7HB 2LMIA 5DG7A 4AT1B 1UETA 2CQHA 3GG1A 3OW2R 5DDPC 3GFZA 2WZ1A 2VG6A 1SJRA 2C3YA 4UOHA 5KFGA 1RAEB 1KHVA 5KFPA 1VQLS 3BN4A 1FDBA 3MGJA 2SXLA 4C6AA 1UVKA 2KTQA 1WHWA 4DJBA 4CLWA 3GV5B 3QO9B 3HVAA 2QSWA 4B08A 3CIZA 1M1HA 2IC3A 1U8SA 2V8DA 4CH7A 4ELTA 3C14B 1F9FA 2OKQA 2YWGA 2MKIA 1UEVA 3NL0A 8AT1B 1GT8A 1M5KC 3U1MA 4AL6A 2UUBJ 2J6UA 1X8DA 2YKMB 3TQEA 1FKOB 3GJSB 2KZZA 2AYGA 1R0BG 5LSOA 1QTMA 1C0TA 1NU4A 1TL7A 3Q8SB 3U1LA 2C2MB 4CTAB 4ECYA 3GIRA 3ET6B 3E01A 3OSNA 3CC4S 3LGMA 5HANA 4P9SA 1FNXH 4TYBA 1S6QA 2Q43A 3MPWA 3VALA 2RIJA 4KGMA 2CADA 1FXDA 4FS1A 1FXRA 3TEGA 1HNZF 3J7ZT 4U96A 3QT8A 5BXIA 4I2PB 2C22A 2M2BA 2NPFA 4ERDA 3AA9A 4NCGA 2XMKA 4X62F 2BJ9A 3MEDA 2Q1LA 5KG7A 2R4FA 4YY3J 1WC6A 5H9EK 3HKZD 3C3LA 5JVHQ 2E5LF 3WIVA 1WKKA 4B9TA 3CULA 3BR8A 1WEXA 4ILMA 2XNRA 5HK4A 2BV3A 2ZH2A 1N0VC 1KNZA 4XTTA 5C24A 4PG7A 4C2MA 4ZVQB 3L09A 2XCPA 2UVVA 3ISZA 4EEYA 4WP3A 5CA5A 3IWLA 4WCEQ 2E44A 3I82A 1TZ0A 1JLBB 3D0GE 4RWXA 2MZQA 3HO1A 4R8UB 2A6OA 1PIEA 5CYJA 4HDHA 3CDAA 3AB2B 4IOBA 3HPOA 1WHVA 3PZPA 4PXDA 3MPUB 3FSXA 3PX6A 3ITHA 2GGPA 4FXWA 3AJDA 2KYXA 1WG1A 4HT5A 2HFSA 1BLUA 4NL5A 3MCNA 3AOCA 1XTZA 1U47A 3M2UA 4LF5J 3TWZA 1LV5A 3I5BA 3QJPA 2YX1A 1HQUB 2XMTA 3EDQB 2HHXA 4OYMA 2FZKB 1KQKA 2CKWA 2CFXA 3HD2A 4LIWA 1Q81T 1RQ0A 4NXMF 3OFHA 1KQFB 3LP0B 3M8QB 1MWYA 5EN1A 3WIUA 3TO8A 2H51B 4Y00A 3W9JA 2DNPA 2AQ4A 4N7TA 2ILZA 3CJ4A 3VCDA 2Q3PA 3QT5A 1V5VA 4ZP6A 4Q2LA 2KFYA 3KUEA 2KM8C 1EP4A 5HVHA 2PIIA 1DTQB 2HQCA 3GZ7A 4K0KF 1DQ8A 3N5BA 1RT7B 1YJRA 3W5ZA 2PFFB 2ZD1B 3AD9C 3TA1A 3L9ZA 4M63A 4DL2A 4ZVOB 2ZBCA 4Y2IA 2ZJQQ 4ZPAA 5CCMA 2DEIA 4P2SA 3S7RA 3UDLA 4ZHRB 1U0SA 5ADZA 2G1HA 5AXNA 4JI2F 2C1EB 2A6MA 2AP6A 1OPZA 4M5LA 1SL1A 2WVCA 3FBCA 2OPSB 1RTDA 4AQYJ 2AX0A 2OI2A 4EU0A 2EG2A 2XEXA 3Q24A 2XY6A 1NK5A 2M0GB 2HZVA 3ZZTA 4TY8B 4LF8J 4A46A 2HVHA 2NXCA 3NGRA 2VOOA 1HBNA 4CLUA 2PC6A 2PMWA 2WOMB 4PPZA 4ZLPA 2KVQE 2QA1A 2AD9A 3BV8A 3BGRA 3K89A 2CG8A 2JC0A 2OUGA 4QPXA 3I0RA 2CUYA 1SC1B 3HHDA 4NA3A 2XMJA 4I0WA 3QNWB 2A3JA 4DEZA 2DR8A 2IRXA 2AEJA 3Q8YA 3N6MA 3AD7C 3M8PA 1QSSA 4DR6J 3UQSA 1WSRA 3I9ZA 3CDEA 4A8SA 3M2RB 4PZVA 7FD1A 4ZPVR 1N48A 4LFBJ 5HBMB 4IRCA 2F65A 4JBCA 3DFEA 1RTJB 3DOLA 1VQMS 4OZ2A 1EETA 2ZDOA 3IM8A 3HHLB 1R43A 2WONA 1MN9A 2B5JA 3CJSA 2HIQA
chains in the Genus database with same CATH topology
1ZYQA 4DPOA 3HDSA 5THWA 5KG2A 4HI2A 2V2KA 3SZ2A 4A4JA 2GO8A 1U48A 3MOJB 2HS0A 4J37A 5KAKA 3CCMS 5I3UB 4RW8A 3QGPA 1S77D 2KG1A 3MUTP 3UCGA 4B3SF 5HMZA 1N32F 1VJWA 2FPHX 2VC1A 4XDDA 4DMZA 1VHFA 2HNZA 2GJ2A 3OFFA 3QZ8A 3NNCA 1HNIA 1H6KX 3JTPA 2ASJA 3SFGA 4ECUA 1JNZB 5BR8F 3CJKA 4QR2A 2XBPA 3M2RA 3RAQA 2K7KA 4J9SA 1OS5A 2V4JB 4N77A 3UR3C 2ZITA 6FDRA 4L3NA 4N56A 4W92B 3N6LA 5HBMA 1KFDA 4WFNQ 2Z0GA 1FHTA 3MMCB 1N5SA 3GR1A 5F8IA 2E7WA 1HBOB 1T3OA 1SH3A 2HHPA 4ES3A 3GG0A 3N28A 3DOKA 3U1NA 5HP1B 4WK1A 2V8GA 4DFPA 1U1LA 1RTJA 1X9MA 3BQ2A 2C42A 3AHPA 3DLEB 4QWBA 2JDJA 4ECVA 2RU9A 1X4CA 3DRSB 5MLCV 4YUDA 3HHLA 3IS9A 4CZCA 4LF6F 4ZCLA 4HI1A 2L08A 4ED7A 3K0JA 3FEYB 3K8WA 3PRDA 2VKRA 5J2MA 2W4CA 4YHHF 3T5JA 1Y7PA 3IAS9 1QE1A 3FFIB 2U2FA 4YB5A 2I8EA 2MKKA 1TL5A 1R8CA 3NBPB 4K4ZA 1U25A 1Y3JA 4H4OB 2I0XA 1W25A 3FZBA 5JJBA 2LXIA 4BDPA 5I3UA 3THPA 3FJ2A 5KFWA 4B9SA 4RNMA 3ONQA 2UXBF 2CPXA 4FNIA 2X1AA 1VC0A 2IVFB 2BQRA 3T5LA 4ED8A 4UUXA 1VQNS 1REVB 2PMZD 3SSSA 4YP3A 1X4EA 3VAHA 5HMYA 2WRMA 4NLPA 4U6PA 3SQGB 4OX8A 1Q82T 4U7UK 5KFHA 3RR8A 3WDOA 5C5JA 1QSLA 2G4BA 3PO4A 2V4JA 3TW0A 3IR5B 4F26A 3MMCA 4RU9A 4RBTA 4M95A 2W7PA 1RAJA 3AQOA 2DT9A 4HT7A 3AB4B 4P6QA 4HYKA 5KFUA 2F1FA 1QM9A 2AGQA 1GX5A 4NLOA 4ATNA 5EDWA 5HP1A 1YITS 3SFUA 1GXTA 1BD6A 1ZTWA 1HNWF 3DRSA 2W9AA 3SV3A 1UP1A 2M7SA 2COLA 5CH7B 3R5AA 1FA0A 2DHAA 2VFSA 5KT7A 4O44B 3FZ2A 4I7FB 5IT0A 1HD1A 3FFIA 2XULA 4ECRA 2OSQA 3CWJA 3NBPA 3PDNA 2FGOA 2J9CA 2UV8A 5LMUF 2ZHBA 4CO5A 4H4OA 2DBBA 4FS2A 1BQMA 1AROP 2HNYB 3KLEB 2DGOA 4Z2XA 4QWAA 1WI6A 4I68A 4OX6A 4WXWA 4WE1B 2EFPA 4PG6A 5AXKA 2BA9A 3U02A 4KJIA 2PT0A 2JH3A 1SXLA 2MGZB 4LT6A 4DV4F 2GIQA 2Y0SD 4Y3CA 4DLEA 2IYIA 1ZZNA 2ASLA 3Q2TC 4KAIA 2VKZG 4C98A 3O3LA 5KFEA 2X51A 3IO1A 2UP1A 4WFXA 1REVA 3RU0A 2HHWA 1IUJA 5F9LA 2DIVA 1TP7A 2MQOA 3SQGA 2XCAA 1ZAWA 2EFNA 4I4BA 3MMJA