1HNVB

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 91
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB03
1DTQA 4YR0A 5HLFA 3DI6A 3DI6B 1QAJA 3V81A 2FVCA 3CDUA 1TVRA 2WONA 2AX0A 5KFAA 3PR5B 4DL4A 1RTDA 1JLEB 3IRXA 3FSIA 1S1TB 2QV6A 5DQGA 1T03B 5L1LA 2HNYB 4PWDB 5JUMA 1VRTB 5J2QA 4ECTA 2R8GA 3KOAA 4K4TA 3DYAB 3T5LA 4XPCA 3C6TB 4Q43A 5KT3A 1N6QA 2VG5A 2FJXA 3KLEB 2IJFA 4ZVFA 3DRSA 5KFPA 1C1BA 3DRSB 2WOMA 2R8HA 3NBPA 1UWBA 2XI3A 2B5JA 3T5JA 1JLBB 1S6PB 4NZ0A 3IG1A 2DPJA 1LW2B 2WRMA 4DG1B 1KLMB 3UDLA 5C42B 2UVVA 3ICLA 1JLEA 2BE2A 5JXSA 2IBKA 1RTJB 4ICLB 5HROA 4IFYB 4Q0BB 2HMIA 4EBCA 3MTKA 5D3GB 2B6AB 2W9CA 4RW8A 4WZQA 3RAXA 3Q8PB 3OLAA 4WYWA 4LSNA 2YNGB 2XGPA 5C25A 4QW8A 4IDKB 2FLLA 3HVTA 4KFBB 4H4MA 3I5BA 3QGIA 4TY8A 3KMQA 3JYTA 3V6HA 1JLCB 3LAMA 1NHVA 2IMWP 4TN2A 1FKOB 4IG3A 2JC0A 4YQWA 2IM2A 4NYZA 3H5SA 2XCPA 1EETB 3EPIA 4RZRA 3EPGA 1GX5A 1SV5B 4QWAA 3M9MB 1TKTA 4K4YA 5C42A 3SI8A 2AWZA 2C2RA 4O3NA 3GV8B 2BRLA 2ZKUA 3V6KA 1C1CA 3IGVA 4DG1A 2AGQA 3KLFA 2R2TA 1RT3A 2YKMB 4MK8A 3BQ2A 2VA3A 3CVKA 4R0EA 1HNVA 3ITHB 3PW5A 1S0MA 4YR2A 2YNHA 3NGDA 5KFTA 4K4WA 5C5JA 4KAIA 4TXSA 3KK2B 3KK3B 1TQLA 4J9PA 3IS9A 1OS5A 2BR0A 2IA6A 5KFNA 5J2NA 5FDLB 2FVRA 4WFYA 3FDSA 4ECUA 4ECVA 2HAIA 1S1TA 1RYRA 4KO0B 3KMSA 2WK4A 3FFIB 2B43A 5KFEA 1S0NA 2RF2A 5DG7A 3V6DA 3PW7A 1IKVB 4B3OB 1C2PA 5I3UA 4KKOB 5EWFA 5F8GA 4NLWA 2RDIA 3DRPB 5HBMB 1SUQB 4O3PA 4TQRA 4K4ZA 2JLEA 3KLHA 3M8QB 3KLFB 4ED2A 1JLBA 5KFYA 4F4YA 3RBDA 3I0RB 3M8PB 3DDKA 1SH2A 2GIQA 3H2LA 5DLGA 5KFCA 1HNVB 1LWFB 1C0UB 3I0SA 2OPRA 2ASLA 3LANA 3DMJB 4I2QA 2YKNA 3JYTB 3DYAA 1S1UB 3MECA 3TAMB 3GYNA 1LWCB 4WE1A 4G3IA 3IRXB 1RT2A 4URGA 2R2UA 2I5JB 2W9AA 3KLIA 3MFIA 4FBTA 4NLYA 3HHKA 3MEGA 1IKYA 3DLGA 3CJ3A 4DL7A 1IKYB 5KFQA 3QZ7A 2ZE2B 3I5AA 3PHEA 4F4ZA 4H4MB 4KFBA 2D3ZA 1TL3A 3PW0A 1TKXB 3QIPB 3KJVB 1KHWA 1SH0A 3TVKA 2W9BA 4RNOA 3Q8QB 4NLSA 2ZD1B 2HWIA 3DOKB 2XCAA 2YNHB 2AQ4A 1RT1A 4IOBA 1S49A 5KG7A 2HMIB 5L1IA 5I42A 3CWJA 3RB3A 1HYSB 4IQXA 4Q44A 5F8JA 1EP4A 3KHRA 4ECRA 3BSNA 3UPFA 4DEZA 4MKBA 2ALZA 2V4RA 5K14B 3QGGA 2RDJA 4ZHRB 1J5OA 3H4DA 1I6JA 1DLOA 1HQEB 2D41A 3OSNA 3BSCA 4LQ9A 2JEFA 1S4FA 4IDKA 4EBEA 2V4QA 3M8QA 4MIBA 5KFRA 4PQUB 3FFIA 2FVPA 3H40A 4URSA 3HKWA 4ZP9A 3GV5B 3LAKA 2OPQB 4ZPBA 5I3UB 2GC8A 3Q8RB 1RTDB 1DTTA 4I7FA 1JLQA 3BGRA 4IFYA 5KFIA 1RT4B 1RTHA 5KT4A 4J9SA 1S10A 4KSEB 5J1EA 4JV2A 2CJQA 4WE1B 5EWEA 5F8NA 5KFMA 2VG6A 1RT2B 4ED1A 2FJVA 1RTIA 2VG7A 2I5JA 1N56A 3MEEB 2UVRA 3LP2B 5DG8A 4ECQA 3NMAA 3E51A 3OL7A 4Q8FA 4J9OA 1JX4A 2J6UA 3NBPB 4ED0A 2JEJA 4MFBB 1IKXB 4WZMA 4ID5B 1LW0A 1QUVA 3KLGA 4RU9A 3KLGB 3MEDA 3QO9B 1T3NA 1EETA 3MEDB 3QO9A 1N4LA 2AX1A 5KG1A 4J9RA 2WOMB 1S1WB 1D0EA 1S6QA 1TL1A 1JLQB 3MFHA 4R8UB 3HVWA 5KG6A 5J2PB 3VQSA 4FS1A 4RNMA 2AU0A 1TL3B 2D7SA 4IG0B 4WYLA 3QIPA 3KJVA 4NLOA 5L1JA 2VG6B 3BJYA 4WXWA 3OL6A 1RTHB 3DOKA 1S9FA 5EUHA 1RT6A 4K4UA 1HNIA 5C24A 2IM0A 3CJ4A 1FK9B 2OH2A 3TAMA 3H4BA 2FLNA 4DL5A 1RAJA 3N6NA 1JLFA 4RW7A 3KNAA 1BQNA 5T14A 3QIDA 4J9KA 3JSMA 3PJWA 4ZPCA 2VG5B 2HNZB 3DLEB 1N5YA 2C28A 1K1SA 3FQKA 3TQ1A 4LSLB 5KG0A 4F4WA 4O44A 3V6JA 1S1XA 1LWEB 3DOLB 4ZVHA 1NHUA 4URQU 2BQUA 3I0RA 2VG7B 3M8PA 2HNDA 1CSJA 3EZUA 4RW6A 1QAIA 4NLDA 1JKHA 4U6PA 3OL9A 2VA2A 1U09A 1BQNB 3HVTB 1SH3A 3DM2B 1RT4A 3DM2A 3GV7B 4M95A 4RW9B 3KHHA 5J2NB 2HWHA 4ECZA 1WNEA 1JLAB 4O4GB 4IFVB 1T94A 4F4XA 1RDRA 2XGQA 3DLGB 5CYQB 3BSAA 4J9MA 1S1VB 4ZPDA 1Z4UA 4JV1A 2UVWA 5F8IA 4OL8A 3UQSA 2IM1A 3LP0A 4IG0A 2DPIA 4IR9A 1N5YB 4O3SA 3LALA 1MU2A 3LP1B 3G6VA 1UWBB 5DQHA 4LSLA 3RAQA 1TKTB 1YVFA 1S6QB 1S6PA 3I0SB 5KFLA 4K4SA 4TQSA 4MK9A 2ATLA 1VRUA 5I42B 3DRRA 3NAHA 4LQ3A 1RT3B 2UUWA 1HPZB 1RA6A 1HYSA 3H5YA 4IR1A 4HYKA 3BGRB 3IN5A 1T03A 5KFZA 4LSNB 3BREA 3CJ2A 5L1KA 2YNGA 3C6TA 4RW9A 1RT6B 2XI2A 3M9NB 3IS9B 4J9QA 1FKPA 3MEGB 1FKPB 4YP3A 4FBUA 4RW4A 1DTQB 2ZE2A 4Q45A 3T5HA 4KO0A 3I5CA 4ZP6A 1LWEA 1HARA 4Y2AA 3KHGA 2R8IA 2OPQA 3OHAA 3E01A 2YKMA 2CKWA 1ZTWA 1JKHB 4JV0A 4EO8A 5KFOA 4IRCA 4K50A 2OPRB 3SFUA 1RTJA 5KFBA 4XO0A 3CIZA 3DMJA 2XC9A 1VRUB 4O44B 4I2PA 2ILZA 5KFJA 2JC1A 3BR9A 4ZHRA 1J5OB 1N6QB 3MEEA 1S48A 1RTIB 1S9GB 4DL2A 5J2QB 5KFKA 2OPSA 4TYAA 1IKWB 1S9EA 4NLRA 1FK9A 5KFVA 4ZMMA 3GIJA 3LP0B 3RB4A 2BQRA 4IRDA 2RF2B 2XWYA 3QYYA 1FKOA 4IG3B 4NLXA 1REVA 1JLFB 4RW7B 3D5MA 5HLFB 5DLFA 3ISNC 3KLIB 2E9RX 4K4XA 4R5PA 1HQUB 4R5PB 1HQUA 4KV8B 4IH7A 3G6YA 1TKXA 3KK1A 1D1UA 4QWEA 5KT7A 5HROB 2WCXA 1C0UA 2BQ3A 5F8MA 4NLVA 5HP1B 4O4RA 2R8JA 1IKWA 3QZ8A 1W25A 2C2EA 1DLOB 1HQEA 4ZVGA 3KLEA 1HMVB 4H4OB 2C2DA 4K4VA 1S9GA 2IM3A 4ZP8A 2B5JB 1EP4B 1VRTA 5CYMA 1R0AB 1LW0B 3QGHA 4KHMA 1JLCA 1S1VA 2FVQA 2V0NA 3HVAA 4B3OA 2FJWA 4WFZA 3PW2A 5EDWA 3MR2A 4IFVA 3G86A 1S0OA 2IAJA 5KT5A 3DRPA 5HBMA 2BRKA 2AGPA 3LP1A 1JLGB 1RT7A 5DQIA 2ASJA 2IJNA 4NCGB 5KG4A 4DL3A 2V9WA 2JEIA 5HP1A 1HNIB 2R2RA 4RW8B 3PVXA 4RW6B 4ZVEA 1TVRB 2WONB 5KT6A 4DL6A 4O3QA 2C22A 3Q8SB 3BQ0A 2YKNB 4ICLA 4I2QB 4Q0BA 1S97A 3RBEA 3NL0A 5F9NA 5L9XA 5K14A 4NLUA 1K1QA 4U7CA 3DLKA 1LWCA 2I1RA 4ECYA 4PUOA 1R0AA 4RUAA 2WTFA 3PW4A 3KLHB 1XR5A 3CJ5A 3CO9A 4WXOA 4RUCA 4ECWA 4ID5A 2RKIA 4G1QB 3NAIA 1MU2B 1TV6B 2ZD1A 3RB0A 3H98A 4FS2A 5KFXA 5KG3A 1SV5A 2BANA 2YNIB 3C6UB 4IKAA 4MK7A 4QWBA 4EO6A 1T05B 2R2SA 3NKYA 1RT1B 4TLRA 4J9NA 3V81B 5J1EB 2OPPB 1MMLA 4XPEA 2ILYA 1ZETA 4WFXA 4IRKA 3D28A 4RNHA 5KFHA 1JLAA 1DTTB 4I7FB 3OL8A 3N6LA 4NLTA 5D3GA 4M94A 2O5DA 1N48A 2B6AA 4EEYA 1BQMA 2W7PA 3KK3A 3H5XA 1C0TB 4EBDA 1TP7A 5KG2A 5F9LA 3MR5A 1C1BB 4ECXA 4O3RA 3T5KA 1IKXA 3GIIA 5CYMB 2RKIB 4G1QA 1LW2A 5J2PA 1TV6A 4Y2CA 5J2MA 2HNZA 1TL1B 3DLEA 3MR3A 4GC6A 5KFUA 3FQLA 3H59A 4NLPA 3ISND 5F8LA 5KFGA 3DLKB 4I2PB 4MH8A 3KK1B 3IGNA 4RNNA 3BSOA 2FLPA 4X2BA 4H4OA 4KE5A 2W9CB 5FDLA 2WB4A 5C25B 4H54A 5DG9A 4KHRA 3G6XA 5C24B 4RW4B 3RB6A 1RYSA 3KK2A 4TY9A 2R8KA 5KG5A 3OSPA 1C0TA 1REVB 3CDWA 3CDEA 2UVUA 3QLHB 1T05A 3BQ1A 2J6SA 2BE2B 4ED6A 4R8UA 4NCGA 1C1CB 5KFFA 1KLMA 2IC3B 3T19A 1KHVA 4MKAA 1HPZA 5DGBA 2IAJB 4QW9A 1TKZB 3PJXA 1LWFA 1TKZA 4QWDA 1JXLA 2BANB 3C6UA 4KB7A 2GIRA 4QPXA 4JUZA 1S1XB 3DOLA 3OLBA 4O3OA 4ZP7A 1QE1A 3LP2A 4ED7A 2AGOA 2W8LA 2YNFA 4ED8A 2JEGA 5F8HA 2HNYA 4PWDA 4KBIA 5CYQA 3MR6A 3GIKA 1IKVA 3JSMB 3KHLA 2W7OA 2EC0A 3V4IA 3V6DB 2WHOA 4Y34A 3V4IB 4O4GA 1JIHA 4YMEA 3PR4A 3OHBA 4ED3A 2E9TA 1XR7A 1RT5B 1RA7A 1RT5A 2FVSA 4NLQA 4ZPAA 4EYIB 1JLGA 1RT7B 2YNIA 4KV8A 3M9OB 3UR0A 4PQUA 3IG1B 2D3UA 3PZPA 3SFGA 2HNDB 5DGAA 2OPPA 1GX6A 3DRRB 4J9LA 3ITHA 3FRZA 3T1AA 5J2MB 2OPSB 3GIMA 4Q8EA 2QE5A 3GILA 2YNFB 1S9EB 2J6TA 4EYHB 4IH6A 2E9ZA 3CJ0A 1HMVA 1QE1B 1S1UA 3MECB 4NRTA 4RNFA 1IM4A 2ASDA 4IH5A 3N6MA 4TYBA 3GQCA 2W8KA 4HKQA 1S1WA 4Y3CA 4KKOA 1XR6A 2UUTA 4F50A 4ECSA 3QLHA 5KFDA 5KT2A 1ZTTA 4PUOB 3KLVA 4GC7A 5KFSA 3MF5A 5EWGA 4QWCA 4NRUA 3H5UA 4MFBA 2IC3A 1BQMB 4MIAA 4TY8B 1NNDA 5KFWA 4YR3A 4NLGA 2F8EX 3E01B 2W9BB 1SUQA
chains in the Genus database with same CATH superfamily
4N8NA 4NXMJ 2HBQB 1SQEA 4YB7A 3QRQA 2LDYA 4BC7A 1QAJA 5DDRC 3PEHA 3V81A 3CDUA 1HW9A 3PR5B 5HI7A 2FHOB 5K20B 1WORA 2CQDA 4CRJA 1JLEB 5H9EJ 4EFAC 3FSIA 1S1TB 3H20A 5HVGA 1T03B 5DQGA 5L1LA 5JUMA 3GIRA 4MYTA 5J2QA 3B78A 3WZ0A 3TAPA 1P9QC 1KKHA 3MMBA 4KT0C 1U6ZA 1P27B 2JNJA 1FXLA 1WELA 1NJZA 2FJXA 3DC2A 2C2OB 2J9DA 3OTCA 1RWMB 2D1CA 4ZJQA 3K57A 4MTPA 3ZNUA 3BO3A 2H4YB 3DRSB 2M5YA 3HDSA 4C8KA 1UWBA 4WTOB 2B5JA 4B3SJ 4W90B 1HI8A 2QLFB 3AY0A 3IG1A 4FKYA 4DUZF 4HI2A 1RWXB 1O5JA 4DUYJ 4X64J 4DG1B 2DD8S 3SMZA 3D67A 2L3MA 2EC0A 4ZIWA 5C42B 2NSCA 2HBZB 2BE2A 3ICLA 4P10A 5JXSA 4F67A 2MQPA 3PRVA 4Q0BB 2E1MC 4X4RA 2VBZA 3IWNC 1FJGF 4CLWA 2FQQB 5HANA 1V5VA 5A8RB 3MTKA 5D3GB 1ZS6A 4XDDA 3THTA 3GFHA 3SV4A 2W9CA 4RW8A 2DO0A 4ER8A 2DNMA 4IO1A 4LSNA 5DZ7A 2YNGB 1BMQB 5DS7A 2Y3YA 1NH7A 3HVTA 4KFBB 3KUEA 3KMQA 1MG7A 2F9DA 4J9UE 5IQQA 2NUHA 2VKRA 2CPEA 4O3RA 2EFGA 2IM2A 2ZBCA 3M9MB 4QWAA 4ANDA 2DHGA 1MWYA 2I38A 3TQEA 1IR1A 1LV5A 1F9HA 5H9FK 2C2RA 3HX9A 4OJHA 3M30A 2HQGA 3S01A 4KH1B 2QMUB 4DG1A 5LXYA 3GV8B 3V6KA 3KLFA 3AJDA 1NB7A 2BOPA 2IRXA 5FLXU 3BQ2A 3OR2B 2DCUB 2RAQA 3MAQA 4LF8F 3ITHB 2MKCA 1HBMB 5D0GA 1UKUA 3TUIC 3US5A 2E66A 1S0MA 2YNHA 1MWQA 1VHFA 2J0XA 2XMMA 3JS9A 4USUA 5ETSA 4TNOA 3VVUA 4K4WA 3KK3B 2MQQA 2APOA 5FDLB 3EZ5A 3D3CJ 1QVFR 2XYGB 3FDSA 5B7WA 2RILA 3NNHA 4ZS6A 1XMBA 3A3OB 3HHLB 3PW7A 1IKVB 3AD8C 2CZ4A 1OJ4A 3R5DA 2BW7A 1C2PA 4YN3B 3TWZA 2VPYB 2X51A 5T7LB 2UXBJ 1KTQA 2R4FA 1SUQB 2CPDA 3G8TA 2GQ2A 2QRRA 2YWFA 2XZTB 4K4ZA 2GMHA 3KLFB 4CLYA 1T9TA 5BYRA 5KFYA 3K0JA 2EI5A 1N8RT 2E1RA 3DDKA 1SH2A 2GIQA 2QA1A 1JNZB 2OKQA 2OLWA 3GMGA 1RKJA 1E6VB 1U1MA 1VGYA 2OPRA 2G13A 2ASLA 4GKKF 2F4VF 4NYPA 2ZBQA 2E1PA 3KDOA 3GYNA 3MECA 4AL7A 1HA1A 1FX2A 1IXKA 3TZXA 3HI9A 4OYMA 4FYVB 4P2MA 3L95X 4ZPTR 2I5JB 4DPOA 5GADI 4E0DA 4FBTA 3MFIA 4KGMA 4CH0S 3MEGA 1IKYA 2H1YA 4USJC 2FHKA 1GTHA 4LF9F 2G1HA 3I5AA 2DNPA 1FRKA 4H4MB 1VCTA 2D3ZA 4U8YA 3T1HJ 3QIPB 1SH0A 1KONA 1U1QA 2HWIA 3AJ1A 2Q6CA 1Z2LA 2RT3A 3P4UB 5RUBA 4DWIA 4GKJJ 3OT9A 1F3VA 3P8BB 2HQIA 5G0RA 1KQKA 4DV3J 1K0TA 3H0PA 4AQYF 4A8SA 2CDRB 3NOCA 3S7RA 1ZZFA 3D9BA 1KBRA 4HI1A 3JQMA 3M8WA 4OI6A 5A6PA 5D0EA 4LFAF 5ETNA 3P5BP 5IWAJ 3IBFB 1UJ4A 4PG7A 1NO8A 4FPRA 4L76A 4RX6A 1WSVA 4WP9A 5B0FA 2ZH4A 2PA3A 2VOOA 1J5EJ 4NWBA 5IT9U 3OQ2A 3H42A 4EBEA 2RJZA 2CQ4A 4FYWB 2OEMA 2FVPA 4FNHA 2V69A 1EIYB 4ID8A 3PKMA 2J0WA 4J91A 3R1HA 3LAKA 1U8WA 5IM0A 1KWMA 4ZLJA 4YHHF 1U45A 4PABA 2DNLA 1VOMA 3GG1A 3EICA 1KN6A 2LDIA 1RT4B 2R7UA 1HBUA 2AP6A 3W66A 2IDLA 3J81Y 1NSAA 2KRRA 4X4PA 4JV2A 5AJ3J 3OXGA 4DV4J 2BMBA 4G1IA 3UCGA 1D8YA 2UVRA 2CQHA 1RTIA 3LP2B 2OP5A 1VQYA 5DG8A 3AODA 4U7UD 2CVIA 1SXLA 3C66A 3QT5A 4J9OA 1JX4A 4ELUA 4ED5A 4DLGA 4MFBB 1REGX 3OTDA 1CQNA 3W60A 2QL9B 4U8VA 3LO3A 3W5XA 2J7WA 3QO9B 1NB2A 1Z2ZA 2RRAA 1N34F 4BWMA 1RZMA 4BWJA 1HQ2A 4EUVA 1U6BA 1G6BA 1X31C 4D3HA 2VQEJ 5CAAA 5ETLA 4PG5A 2Y1JA 4R8UB 3MTJA 5HQLA 2AU0A 2XLIA 1VC6A 4IG0B 4UOHA 2LCWA 4C6AA 1NPRA 5L1JA 2VG6B 2OHDA 3KFWX 3BJYA 1QVGR 2XZDB 1JXEA 4K4UA 1S9FA 2EBGA 2LFVA 2XM3A 3K2YA 2V8PA 3W64A 1FK9B 3MM9B 4LBHA 5BYSA 3A8JA 2C3PA 4H4KC 4YFUA 3NGTA 4DUTA 3W65A 3VAGA 1H73A 3KNAA 5T14A 2H4WB 1VQKS 5BR8J 4J9KA 3LH2S 2C42A 2QZ8A 4OYZA 2VG5B 2V8HA 3DGVA 4KGXB 1N33J 1N5YA 1X0PA 1RHQB 2G1DA 3GYGA 1K1SA 2K7JA 2Z4PA 4P6QA 4DS4A 5KG0A 5CZXA 4F4WA 4DQRA 1ZZNA 1L3UA 4O44A 4KHPJ 5F0WA 3BZQA 3EVMA 1NHUA 1WHYA 2KM8C 1CSJA 5GVQA 4GO5X 1QAYA 4ZVRB 1X9MA 3OTBA 2J7KA 4WFBQ 5M2RA 3AD7C 1RBOB 5LJ3Y 4C4WA 4L3KA 3DM2B 1FT8A 4IYQA 1P1LA 1X4FA 4ZA1A 4M95A 1E6YB 4RW9B 5B0BA 3KHHA 2X1FA 3VAKA 4ECZA 2DKOB 1X9SA 3QFWA 1YX2A 4Q2MA 4IFVB 2LU1A 3A1YG 1WI8A 1RDRA 4J9MA 1WF2A 1HNWJ 3R3TA 2DIUA 3PHTA 4OZJA 4WJBA 4CLFA 4KRWA 1X4EA 2DPIA 4IR9A 1N5YB 1PIEA 4A48A 4DN9A 2WSCC 4NI2A 4PRFA 2P2CB 3R5GA 1B64A 3HHLC 1S76D 1YVFA 2VH7A 3ZTOA 3I0SB 1YZ7A 4NCAA 1I1GA 2B51A 2RE1A 2GQCA 2E44A 3QFHA 2Y1LB 2DR7A 1CULA 1H2VZ 4J5OA 1VRUA 3K8VA 4DF4A 2I0XA 2JFKA 3F41A 4NL5A 5AE2A 4WU2A 5HK4A 5K8OA 3M2UB 2KG0A 5L1KA 1CLFA 4RW9A 3QQCD 2MQMA 1I51B 3HKZD 3IAS9 7FDRA 3M8SA 3RBXA 1FD2A 1GFWB 2XI2A 3M9NB 4J9QA 2HK3A 2VDIA 4GMKA 2F9JA 3FMWA 3J7YU 4LUBA 4YP3A 1WOPA 3FGVA 4KO0A 4CT8A 3BEGB 1HARA 3KHGA 2B4PA 2R8IA 4F3QA 4F8RA 2HGNA 4LR7A 5M2PA 5JJBA 2JHEA 4F2RA 3BPDA 4JV0A 1WG5A 4EO8A 4DR2J 3SFUA 3EGWB 4XO0A 1B0TA 2ZHOA 3Q83A 2EXUA 4C8MA 2XC9A 2JLGA 1VRUB 5H9EK 3A4TA 4FYXB 5KFJA 1NSPA 2JC1A 1XERA 3RG6A 1J5OB 4DX7A 2CZ9A 4OLOA 4F4KA 1S48A 4NA2A 1YJNS 2NYIA 2QA2A 5CQGA 5F3TA 2NZCA 1CJKA 4RBTA 4NLRA 4ZMMA 1FK9A 1T95A 1W26A 2K7KA 3LP0B 3D6FB 3MM9A 4E8UA 3GIJA 4IRDA 4IG3B 4CYUB 3D5MA 4DV5F 2E5IA 1X5OA 2ATCB 2K8GA 5THWA 4CNYA 1ZAWA 2MYFA 4K4XA 1HQUB 2CJYB 4R5PB 1SC6A 2DB1A 2DEIA 3AOAA 4B3RJ 5B0EA 2OFHX 2VBYA 2XEXA 3D66A 3O8WA 4X65F 3G6YA 2QFJA 2AJQA 3PY8A 2FZCB 1Q53A 4JI5J 1UJ5A 1B0VA 3L09A 3R27A 2ADCA 1VQ7S 1M1HA 4B3TF 2I8EA 1HHTP 4NLVA 1V3SA 4O4RA 3B54A 2XMAA 2LQJA 1W25A 4DV3F 3IMQJ 2IIHA 2J7UA 3KLEA 1HMVB 4H4OB 1L3KA 1U02A 2JJ4D 2OELA 3KWMA 3NGUA 2IM3A 2DH9A 4CH1A 2C3MA 2ZC3A 1VQPS 4JI6J 2PN6A 2KXNB 2FTRA 3TAQA 2CPYA 3FBCA 4KHMA 1JLCA 2FVQA 3LQVA 2M2BA 3X1LB 1WC4A 4DJBA 2HS4A 2BJ3A 4KYZA 2ALYB 4IFVA 1R8PA 2DIVA 5AXMA 1EKSA 2IAJA 3R5AA 2Z2LA 1CJVB 1M1KT 2AV5A 1NKBA 3CB4A 4I64A 1S5ZA 4LT6A 2GHVC 4C3LA 2UUCF 1HWKA 2E7VA 2IPOB 5HAOA 4JI8J 3EPIA 2HSEB 2RQ4A 1IM6A 4XTTA 4ZVEA 1H2TZ 5KT6A 4BBYA 3MCNA 4A8WA 2C22A 2VL1A 2HHHJ 4F2SA 1GK8A 1ELOA 2FC8A 3CD0A 3QJJA 4ICLA 2FB0A 2R42A 1BC6A 5LSOA 5F9NA 1NPPA 5K14A 3RGIA 2AEMA 3ULHA 4U7CA 3DLKA 1FO1A 5DDPC 4DSFA 2MGZB 3PV8A 2UU9F 2GMJA 2GNKA 3NGRA 1PJ6A 1FFWB 2AF6A 3JAMU 1YZ6A 2QG9B 1UZHA 3MWBA 2DGUA 1ICEB 3CXCR 2GVZA 2M3DA 2PEHA 3CJ5A 5F0UA 2IY5B 1XJWB 4ECWA 2GIFA 3PRDA 3OFEA 2ZD1A 4HL9A 4X66J 2X1AA 4B9LA 1BWEA 1HNXF 1SV5A 3C6UB 4IKAA 4OX8A 5K8NA 2AW0A 2DTJA 2HLUA 1T05B 2KM8B 3JXOA 2OD4A 5FIIA 1F6TA 2ZEJA 3FSXA 2OJ3A 4J9NA 2ZDOA 4LF7F 1UVNA 4ZLNA 5AE3A 2HVEA 1N88A 2Y8WA 4WFXA 3S6EA 4IRKA 3M1VB 2PGCA 5KFHA 1DY3A 1DTTB 4I7FB 4C3MA 2UUBF 3K5OA 4EWTA 4LSZB 1F60B 3O5TB 1N48A 2KU7A 2B6AA 2Y8YA 1MN9A 1IBLJ 3EMTA 3H5XA 1TP7A 4L75A 4WTYA 5JVGQ 4CTAA 3J7YI 4DR7J 1KVIA 3MR5A 1C1BB 4ECXA 3I31A 3T5KA 1IKXA 4G65A 5CYMB 2CDQA 5B0CA 3FBBA 1PYTA 2MKKA 3VV2B 4NYOA 2QX0A 1Q4RA 3X3UA 1UP1A 3RZAA 1J27A 2XY7A 2XNQA 4BC9A 4GC6A 1N0UA 2KKHA 3SCJE 1Y5IB 3QGPA 2QA4G 1RK8A 3LGHA 4I2PB 5KFGA 2J5AA 2M4MA 3ENWA 3PX0A 4ELTA 1CQMA 2K1RA 4PR6A 2PA8D 4CM2A 4JI4F 5HQ8A 1CBKA 3Q0AA 4QZVB 2ERRA 5FDLA 2GGPA 5AE1A 2H3EB 5DG9A 1R8HA 2VD3A 5C24B 1SVDA 3UVJA 1RYSA 1YBAA 3KK2A 3MPWA 4TY9A 5CH7B 3R7SB 5BXIA 4TLQA 3OSPA 2KN4A 4CYUA 4JI7F 1RP5A 4DR1J 4W92B 2E5LF 5C2GA 1RHRB 1M0SA 1U2CA 1X5PA 3CDEA 3GFXA 3LWMA 4EK2A 2OD6A 2DYAA 3BN7A 4ED6A 3KYLA 2X1GA 4YDXA 3VHQA 3LPEA 4D3GA 2IC3B 3T19A 3NCQA 5ETOA 1HPZA 2JZ5A 2IAJB 4KQZA 4QIFA 5DGBA 1M5OC 4X4NA 3P3DA 3MHYA 4RU2A 4KB7A 4QPXA 1DURA 2GIRA 2P9GA 1S1XB 3DOLA 3H2VE 3MCSA 4JUZA 5ETVA 4Y28C 5BYQA 1SKUB 4ZP7A 3VGSA 4DR4J 1MROA 2AGOA 2FLOA 3IBCB 2W8LA 2N7YA 4NA3A 2VJVA 1U1OA 4LRBA 2FJDB 2JEGA 4DR6J 4ILLA 3NLCA 5IT4A 1HL6A 1QDUB 3FUYA 4B3MF 2EFPA 3AQPA 3D4JA 3GIKA 1KD1T 2GAGC 3KJNB 3KHLA 1WEYA 2IA0A 3V4IA 3FZ2A 3QWPA 2VASA 3C16B 2LQBA 1JIHA 3Q8YA 4MYUA 3RYLA 2MGZA 5KTQA 1S59A 1RA7A 4CLLA 2PMZD 1RT5A 2DO4A 1RAGB 2IVFB 3PIOQ 4DCPB 1RT7B 2UZAA 2YNIA 1NSKL 2W2NP 4GO7X 2DISA 5EX0A 1Q78A 3D0GE 3L7OA 3IG1B 3PZPA 4A8MP 2UXDF 2DGTA 4Q7AA 3CCZA 3M8YA 4LVNP 4RUHA 4F3OA 2P6SA 1KFSA 1QJHA 3RJMB 3ITHA 1HBMA 3CC4S 1T9UA 3NOGA 2OPSB 4N77A 1PO6A 1F2GA 1RWVB 1R0BG 2PT0A 2DR9A 1S1UA 4NRTA 4X84A 3TEHB 2DXFA 4TYBA 2VFSA 2W1BA 2G9OA 4HKQA 1S1WA 1BXNA 1XR6A 3TUJC 2W8KA 3TVZA 3QLHA 3ISZA 3K5LA 1KSPA 2AZ3A 2H48B 3MEKA 5EWGA 4NRUA 3H5UA 4F02A 1UPMB 1NNDA 3DOMB 3TARA 3CJQA 2F8EX 2IMOA 3UN2A 4AYBD 5F3ZA 2IHR1 3J7A1 1X4DA 2YKOA 1SUQA 4OYWA 2L9WA 5HLFA 3Q86A 3QJPA 1ZAVA 2POKA 2PFDA 3OJSA 3DI6B 4DZDA 2NQPA 1CJTB 2FVCA 5KFAA 2AX0A 3M1VA 3CIMA 1SL2A 1RTDA 4B17A 3IRXA 2E1CA 1BWVA 3PDNA 2HNYB 3G8SA 2R8GA 2PDAA 4ECTA 3JSRA 4K4TA 4YUDA 2JFDA 4OYBA 4DV6J 3T5LA 4N76A 2MJNA 3C6TB 2MSSA 3HSJA 5HVFA 4Q43A 1UWAA 2RIJA 1HWIA 3HULA 3JQKA 2IJFA 2VDHA 3PACA 1BHNA 1PGZA 3DRSA 1VBKA 2LQ8A 1C1BA 5KFPA 2R7SA 2R8HA 3NBPA 2XULA 2XI3A 1F5AA 1BY9A 4OI4A 1OSCA 1WF0A 3AA9A 3ILIA 4DU7A 1Y5LB 2OTLS 1PYSB 2VPWB 1NK7A 1F0XA 1NJXA 5L38A 2R7WA 2XHWA 2Y0SD 1RAIB 3UDLA 1GH8A 4I67A 2L08A 5T7LA 4N56A 2IBKA 2Z8QA 3CJKB 3EGZA 4DPXA 5HROA 4IFYB 1FE4A 3Q2SC 3TRGA 1U4BA 2LKZA 4EBCA 1AUSL 3THVA 3D6HB 2BX6A 4WPAA 3P49B 1M90T 2DNYA 2MQNA 1PBAA 1PC5A 3DGPA 3GJSB 4E2FB 4P2SA 1EKRA 3FRYA 4UQGA 5C25A 4IDKB 5AXKA 2FLLA 4H4MA 3GCXP 3I5BA 4TY8A 2C3UA 5E3PA 4CH7A 4Y2KA 3BGOP 2C2MB 1UW4A 1H74A 1NHVA 3MPVA 5AT1B 2V67A 4TN2A 4ZVOB 5GAHI 4YQWA 1VDHA 1UEKA 3H5SA 5B0GA 1EETB 2V34A 2XCPA 2VPXB 3EPGA 4K4YA 2UUAF 1TKTA 3SI8A 2AWZA 1XNRF 2ZKUA 2AGQA 1I5OB 1U48A 1YQHA 3T6BA 1V3ZA 4RO0A 5FLXY 2R2TA 5LMNJ 2YKMB 1XN9A 2CNKB 3BH7B 3GP9A 3N4WA 1X0FA 1TTHB 4DV1F 2VA3A 3CVKA 1RWPB 1V6HA 4LF4F 2VPZB 2XY6A 4USKA 2E5HA 3LF0A 4M8LA 4TXSA 3SQGB 2DNQA 2HHPA 2QLBB 3KJFB 1U0HB 4ETXA 3GLJA 1E6YA 2DNZA 5ETMA 4JI2F 1UAWA 4F3MA 4J9PA 1Q82T 2HHQA 2O66A 4WFYA 1MW7A 1T02A 1WEZA 2JSXA 1FX4A 3N79A 2IA6A 3ILJA 4TKTA 2B43A 5I3QA 2RF2A 3N0VA 1DQAA 1U47A 4M5IA 4NZ7A 3AFGA 3BGUA 4B3OB 3HVRA 4UF4A 2EFQA 1GQEA 3VF0B 5F8GA 3J81U 3TJAA 5HBMB 2ABYA 4CI0B 1Y3JA 3DLBA 2JLEA 3KLHA 3EYZA 1JLBA 1UETA 1KRPA 3HD1A 3RBDA 3I0RB 3M8PB 3HK2A 2HGLA 3H2LA 5KFCA 3ZZPA 1RQ0A 1NK8A 1HI1A 4B9SA 2X3DA 1C0UB 4J7CA 1FESA 1PILA 3LW5C 4RBVA 2ZITA 3LANA 4H4KA 4WKRA 3DMJB 1VC0A 4I2QA 2YKNA 1WACA 3MR7A 3DYAA 1S1UB 2L9NA 4CWBA 2GAHC 1LWCB 3IRXB 3MAHA 1W7WA 3ZZUA 4DCJB 2O1PA 2W9AA 1IBKF 3KLIA 1RWWB 1PKUA 2AT1B 2ZVSA 4LF6F 1OQ6A 3QZ7A 5A8KA 4I56A 1TKXB 1FERA 1KHWA 1XTZA 3GJRB 4NLSA 4Z37A 2EFNA 2AJ4A 1RBLA 1IJFB 3LUYA 3BDPA 5B09A 4OLPA 1AT1B 3R2DJ 3K89A 1S49A 1F3FA 2HMIB 2RUGA 5I42A 4I4BA 5KG7A 3OTOJ 5L1IA 5LMUF 4DV2J 4OYOA 3POTA 2CJKA 4EGLA 4MKVA 1NK0A 2CQ1A 4ZVUB 3AXMA 1SKRA 5GADU 5FD1A 1YTYA 2GQQA 5ITHA 3UPFA 4MKBA 2UUBJ 4DV7J 3QGGA 2K3KA 4USTA 2YH0A 5HATA 4FKXA 1HFEL 1HQEB 3GG0A 2C2ZB 4C98A 4QYZK 1D3WA 5LL6d 3UFCX 1CJUB 2DHXA 1Q5YA 1XIQA 3NG8A 4IDKA 2V4QA 3E3XA 3M8QA 3G4SS 1RHJB 5DO2A 3Q23A 4PQUB 1TUVA 3CTRA 2MQLA 3HFZB 4DMZA 5GAGI 3GV5B 5E41A 1UVKA 2HG4A 1SJ3P 4NEYA 1NAQA 3BB5A 4I0WA 3OUYB 2DEJA 4NMLA 4XDCA 1B70B 1VYAA 2ZUAA 4GRSA 1XNQJ 3UD4P 4DS5A 1YITS 5EN1A 3B6BA 1DTTA 4I7FA 2RQMA 1X5SA 4IFYA 2DBBA 3HT0A 4FP9A 4RUBA 3T41A 2MLXA 5KT4A 1UA0A 5J1EA 1VQNS 1AYEA 4WE1B 2NXCA 4NE9C 5EWEA 5F8NA 2G4BA 2VG6A 1RT2B 3OD2A 3MEEB 2OSRA 1HLWA 3OL7A 2IVYA 3M2UA 1SJFA 2J6UA 1SB6A 4ED0A 1NUEA 3JB9k 1IKXB 2K3IA 4ZCMA 4X4UA 2RDDA 4BDPA 3A8KA 4HVZA 2VJUA 2KL8A 3W8PA 3OL9A 1EETA 3MEDB 1EJ7L 2AX1A 2E7XA 2YQ1A 1C4CA 4KPCA 1ZM4A 3NRBA 1TK5A 1N36J 2F4FA 2A6MA 2GMLA 3KG4A 3J7AN 4KIAA 3W9JA 1M5PC 2G2ZA 1OY8A 1YBUA 4DUYF 3MMCB 4X64F 4QR0A 5J2PB 2YKQA 2XO7A 4F7VA 4X4QA 1TL3B 2BEFA 2M8HA 2JWNA 3NMAA 1NZ8A 3CUNA 1NXIA 4Z7CA 1P6TA 1R8CA 2ZH6A 1KEKA 3SEOA 1HNIA 5C24A 4PXDA 2IM0A 3CJ4A 5C2CA 3UD3P 1QSYA 3RR8A 1IWAA 3TAMA 1AW0A 1CS4A 3HSDA 4RBUA 1AZSB 2FLNA 3U7JA 1RAJA 2H9ZA 3D68A 4LF6J 4XIUA 1TAUA 3VALA 2HVIA 4V1Ak 2GA7A 5E7OB 1A9NB 3QIDA 1Q8IA 3MM8B 3VR1A 4ZVTB 4K0KF 4ANEA 2KXHA 1LEOA 3ZFVA 1UMJA 2DXDA 2VFTA 3PJWA 5DRKA 2NXJA 2F7VA 2RQKA 2RS8A 3G6ES 3ZNJ1 4PXEA 3NCRA 2HLTA 2ZZMA 4C9DA 3V6JA 1T9WA 1S1XA 3DOLB 2HGMA 3IO1A 3JSYA 4OIXA 2XMVA 5GMDA 2XS7A 2HNDA 2RSQA 1DQ8A 2V50A 1QAIA 4ZPWR 4LFCJ 3K5MA 3NNAA 1JWWA 1RAAB 4YB5A 1U1LA 4F04B 1U8SA 4UT4A 1BQNB 1YGYA 3N9UC 4DFJA 2KH9A 3IR5B 1CS4B 3LOUA 4OYIA 2HWHA 2RNEA 1UEUA 1JLAB 3W1YC 4PXCA 2B3TB 1T94A 3AOBA 3ILLA 3HHNB 3S8SA 4Y0FA 5CYQB 4O23A 1R6VA 4V19J 3QPIA 3UQSA 2KT3A 3LP0A 3GSIA 4P73A 3K58A 2UXBF 1JQGA 3NWRA 2A0FB 2Z0GA 4X4TA 3FZBA 1VQLS 2HKEA 5DQHA 4PWUA 3D2WA 5KFLA 1RABB 1S6QB 1S6PA 2HFNA 2WVBA 2CJ9A 5E3RA 4MK9A 5CYJA 3IRWP 2LXIA 5ETRA 2XWXA 4AD6A 2K06A 4LQ3A 1RT3B 1F5BA 1T9XA 2CPHA 1RA6A 1HYSA 2WVEA 3KG0A 2ZWOA 3VZHA 1RLDA 4LJMA 3TZYA 2ZM6F 4HYKA 3SZ2A 4LFBJ 3ET6B 1T03A 3G8QA 3BREA 3CJ2A 3KDNA 3OPKA 2ZH9A 1KLNA 1OYDA 2J8SA 4R25A 4DSJA 2XBPA 4ZOSA 3SSQA 3IS9B 2V8VA 5CD4H 1S6OA 1RU1A 2MY8A 3MPDA 3R9LA 1EB0A 3CCJS 3O2IA 1FJCA 2KG1A 2QC3A 4AT1B 4RW4A 2W4PA 2ZE2A 1SPBP 3T5HA 3WC2A 4DF8A 1RGVA 3GFZA 4Y2AA 1FFSB 3LWLA 2MKHA 3AH6A 3U27A 3OHAA 2V9KA 2CKWA 1ZTWA 1JKHB 2CWKA 3PYDA 1RU2A 2W2PP 4FN5A 4PG8A 4K50A 2J0SD 2YWKA 1RTJA 5KFBA 2LEBA 1SKWA 2G2YA 2DGXA 1UFLA 2E5GA 2H5IB 2WVCA 2ILZA 2CNOB 2CQIA 2KVQE 2XMUA 3BR9A 3NS5A 2VKZG 3O44A 4FZVA 4OHWA 5J1PA 4Y65A 3MEEA 4UUXA 3K8WA 1HBNA 4LFAJ 5J2QB 3OR1A 5IWAF 4TYAA 4OZNA 1TAQA 3AAWB 3OXFA 1S9EA 5ETQA 2LECA 4OX9J 2B7BB 3F44A 3ILOA 1FKOA 2KRBA 3H2UB 4NLXA 5ETKA 3N28A 4K7QA 1REVA 2V5HG 3FBEA 1RAFB 3BBFA 2PEBA 3NGKA 3FC9A 2GJFA 2XMWA 1KOOA 1R3NA 4R5PA 3PCOB 3WDOA 2AD9A 1HNZF 2YH1A 4LR9A 1OY6A 1X9WA 2WB1D 3R7NB 1R7IA 4YHHJ 2R7RA 1SQGA 2LP4A 3HZEA 2PFFB 3HLUA 3OR2A 6FDRA 5KT7A 1OSDA 2WCXA 2HZVA 2FHJA 2CPXA 2JVRA 5LSLA 4IQMA 2DK2A 2ROGA 2C2EA 1TKDA 1DLOB 4ZVGA 3WQPA 2YXLA 2QMWA 2KFZA 3CCTA 1ZA2B 4AXJA 1TU0B 5L9NA 1L3SA 4A47A 2CJBA 2YWWA 4FXVA 2B5JB 1EP4B 5CYMA 3B4MA 1LW0B 4QIEA 3DRYA 5IZHA 1NDLA 2FHJD 3GPAA 4DX5A 1F2HA 1HWUA 2F8MA 2CFXA 3M05A 1EQMA 2D9PA 3KKFA 3UI3A 4LR8A 4DX6A 4K5SA 2QFIA 3PKYA 1RCXB 3ZO7A 3DRPA 1RWNB 5CZVA 2MKIA 2AGPA 1JLGB 1IWGA 1DHMA 2ASJA 2ZBPA 2IJNA 3BF4A 5KG4A 4DL3A 2DGSA 1YI2S 1LNQA 1RKIA 2D9OA 2V9WA 5K8MA 2R2RA 3SQGA 2AMCB 4I68A 4RW8B 4ETZA 1O0PA 3PVXA 1VBXA 1TK8A 2FHMA 1PG5B 2DHAA 2H51B 9ATCB 3U1LA 3K17A 5A2QU 2DH7A 2ZBIA 4C97A 4JI3F 3W2WA 4Q0BA 2WW4A 1S97A 2DRAA 1LFPA 3NL0A 4M5DA 2XYHB 3HD2A 1HHQA 2X3GA 4DHVA 1LK7A 2MMYA 2J9EA 3I32A 2I1RA 1U26A 1VK8A 2FZGB 3H8YA 1IQZA 1RE1B 2RU3A 4RUAA 4KPYA 4JV5J 2GVZB 4ELVA 3KLHB 2ZH5A 2W4DA 1X4AA 4ZVSB 4ID5A 1HWJA 2RKIA 4C7QA 1KTVA 1TV6B 1RI7A 1VQ5S 4FS2A 2XY5A 1S72S 2YNIB 4QWBA 2D69A 1YJWS 2R2SA 1U0SA 4F36A 1RCOB 1FJGJ 1HWLA 3V81B 1FTRA 4XPEA 1MMLA 1IBMF 2M8DB 4HH1A 2YPYA 4M5GA 5L8RC 3MUVP 2P6TA 2DNKA 2KHCA 4WF9Q 4M63A 3DLLQ 1RWOB 3N6LA 3CCQS 4IOCQ 4K59A 2QMXA 4ZDNA 3W2VA 4CO2A 2W01A 4JI1J 3H25A 2BABA 5M2UA 2K1RB 1BQMA 1M5SA 3KK3A 2W7PA 4EEYA 4EBDA 1YHQS 1A7GE 2Y9HA 4Z2XA 3TEGA 3A8IA 3TNVA 4P2XA 1YG0A 1YJVA 1C4AA 4OX7A 1L3VA 2X1BA 4PG4A 3JTNA 2QLJB 3T3FA 2DNGA 2RKIB 3TOQA 1FXRA 1TV6A 2MKJA 3PNIA 2QLXA 2RRNA 2HNZA 1TL1B 3DLEA 1HIYA 3D6MB 5CA5A 5CABA 3FQLA 2IRUA 1Q95G 3MR3A 3I56S 2RS2A 3Q2TC 3H59A 2VHGA 3CNQP 1VK3A 2HZCA 3DKDA 4NLPA 1FKAF 2VB6A 3ISND 5F8LA 4LRFA 4DI6A 1J2VA 4A8QA 2XG8A 4A46A 3EDQB 3R8YA 3UVJB 4WIQA 4KHRA 4DR3F 3TUZC 2BXJA 1MN7A 4OZ1A 3DU6A 1VFJA 1REVB 2Q66A 1V5IB 3FNNA 3UNGC 2ZJRQ 1FRLA 2HFSA 3QAEA 1Q0NA 4B02A 1DARA 3QLHB 3EE3A 2RVJA 4UQTA 1FEEA 4PQAA 3C15B 3EWGA 4LVOP 4DQSA 1N0VC 4FPIA 4R8UA 4MKAA 4RKUC 3MM5B 3DOMA 3K7RA 3NY0A 2OIHA 4OJ1A 1CC8A 1WDTA 3RRHA 4JI0F 2VODA 2YKAA 3VVTA 4DPUA 3SXLA 1WEXA 2LVWA 2MKYA 4HDHA 3RRGA 2F4VJ 5B0AA 2GS8A 3Q89A 3ZTRA 3TX8A 2CIMA 3LP2A 2R7QA 4ZCIA 2HVDA 2VBXA 3H7HB 4GVBA 1PJ7A 4EZ9A 1XMQJ 3GFYA 1R6YA 2HNYA 2GJ2A 1N5VA 3IM9A 3TR5A 1TFYA 1IBCB 1IKVA 5D77A 2IJRA 3V6DB 4YB1P 5EHHA 4LF9J 4O4GA 4W98A 1U25A 1G2EA 3CW2C 5HMWA 1XR7A 1H7WA 3TJ8A 1RT5B 4YS2A 1Y9OA 3BS9A 4B3RF 1Y5NB 4NLQA 3VWSA 2RMLA 4N8OA 3M9OB 3UR0A 1TR0A 4I6AA 3ZTQA 5ETPA 1NDPA 3DRRB 4AQYJ 1R8BA 3FRZA 4J9LA 3T1AA 2ZVIA 5J2MB 1BE4A 1WC3A 2QL5B 2XMKA 2BJ7A 3NS7B 4NPOA 4Q8EA 3G96A 2AKWB 5G4DA 3UW1A 2VONA 1NLKL 1YSJA 5I3PA 2HPUA 3O1LA 4UOCA 4RNFA 2ASDA 1IM4A 3TW0A 3FEZA 1PYOB 5D0HA 2UUTA 4C3KA 5BJRA 5IC6B 2BE9B 4C48A 4USHA 1AFIA 1ZTTA 4PUOB 1MLAA 4C0BA 5KFSA 3MF5A 1FXDA 2ZOGA 2HVHA 4MFBA 3GR0A 1BQMB 3LPYA 2UV8G 4TY8B 5A8WA 4CP5A 2ZKTA 2BM0A 5D4LA 1RB0A 1XEZA 3E01B 3AHPA 3PG9A 2DNRA 1DTQA 1NCLA 2GV1A 2KHDA 3Q8VA 5DZ6A 2PMWA 3PX4A 2DRBA 3HSZA 5HMXA 4CLPA 3DI6A 1YK9A 4C0HA 1VS3A 2CADA 1VQ6S 4DL4A 2WONA 1SIWB 5AJ3F 1MSWD 4N7TA 2QV6A 4ALZA 1VRTB 2CJAA 3A3PB 3UE2A 3DYAB 3GTYX 5GMKa 4YY3J 4XPCA 3FCHA 1QM9A 5KT3A 4N41A 1N6QA 2VG5A 1N5TA 2PMHA 2U2FA 3CULA 4ZVFA 2PI5A 3AD9C 4LBIA 3PIPQ 2HQFA 1RAOA 3LA0A 3OTEA 4DX8H 1N34J 3D54A 4I69A 1N32F 3CCLS 2XS5A 1JLBB 1S6PB 1VISA 2BM1A 2DHHA 4HT5A 3TJ9A 1W2IA 2WRMA 5D15A 4DR5F 4C8OA 2WBRA 2XS2A 4XK8C 4FF4A 3PYEA 3EXYA 1HNXJ 2CQGA 1RHMB 1UCNA 1WC0A 2DJWA 3UCUP 2C3OA 2OTJS 1Q86T 2VBWA 3GZ7A 2FIUA 1HBUB 2O3DA 2HMIA 1HBOA 3EM1A 3UO0A 5MLCV 2GHWA 3HP6A 2HURA 3BYRA 2B6AB 4WZQA 3UDCA 1Y00A 2QGFB 3OLAA 4WYWA 2RU9A 1VLOA 4U95A 2XGPA 2WSFC 4F26A 2ZOMA 1KS2A 2EC2A 3QGIA 1IBLF 1DBDA 1FEHA 2LXUA 5E33A 3LAMA 5BR8F 3V6HA 3MPUB 4DFPA 2LQ9A 1XMOF 4IG3A 2JC0A 3K59A 1B7FA 2UXCJ 1ULRA 1GX5A 2ASYA 2KFYA 3MCMA 4RWWA 3ZZTA 4CLKA 3A3NB 5L39A 3U1NA 2HFZA 2BRLA 3VAFA 2QSFA 3IGVA 4KR0B 4KHPF 2HFUA 3FKBA 2VZ9A 1BUXA 2NXEA 4MK8A 4I6YA 5E5NA 1S7IA 2EKNA 2NCKL 5HL7Q 2XLJA 2J9CA 4R0EA 4BHQA 2MB0B 1HNVA 3PW5A 1WOOA 2E29A 2B7CB 2XNRA 3HXMA 4PCQA 2BDPA 3BO2A 3KK2B 1B4SA 1TQLA 3HHDA 4QCLA 4L73A 2R7XA 5EGYA 1WHVA 2V6AA 3LGNA 2EWHA 2FVRA 2OFGX 4FF3A 1JB0C 1TUGB 4ECVA 1RYRA 1I94F 4KO0B 5E3QA 1TZ0A 2M70A 2VC0A 3V6DA 1HNWF 2M88A 1I3OB 4HTJA 3PFOA 1G4CA 3ZZRA 1HD1A 4ERDA 4X4OA 2OAUA 1OY9A 4YDDB 4ILMA 2RDIA 4JB8B 1JJCB 2HHHF 1KP6A 4O3PA 4TQRA 2V4JA 3M8QB 1VMBA 1Z1ZA 3HCXA 4CDIA 4S0MA 2DNHA 3D0IE 2KYZA 3KNGA 5A8WB 1AROP 4DSKA 3CD5A 5HO4A 4CT9A 1HNVB 3R5CA 2FD2A 1SBRA 1UW9A 2FY8A 1KVJA 2RB7A 1H7XA 3MMJA 3MD3A 3AA8A 4PPDA 3JYTB 3QSYB 3SYZA 3TAMB 1XK8A 4WE1A 3C2PA 2ZHAA 1GTEA 4ZKAA 1RT2A 4DR6F 2R2UA 2NREA 1IJEB 2CQ3A 2YTCA 5GMEA 2HEKA 4ZCKA 4DL7A 3FEXB 3ONQA 1TMJA 1GEHA 2ZE2B 3PHEA 4OQJA 5A8KB 1RHKB 4F4ZA 4AE5A 1NDKA 1TL3A 2FJBB 3PW0A 1HR0J 3QATA 1CJVA 2CWXA 3TVKA 4RNOA 3Q8QB 4LF5F 3OVBA 2ZD1B 3CJ8A 5A6WA 2XCAA 2HS3A 2ROPA 4QR2A 2PC6A 2AQ4A 1RT1A 3MI7X 4IOBA 1CULB 1UVJA 4UZBA 2KTQA 2PD1A 4DCOB 4NOHA 3RB3A 1NJIT 2AZ1A 4HTIA 2Z58B 2WAQD 4OI3A 2Q43A 4Q44A 4NXNJ 4JYAF 1HBNB 2WSEC 4ES2A 3KHRA 2ZFHA 3OR1B 4DEZA 4F25A 4X62J 3VAMA 4ECRA 3T1YJ 5K14B 1FRJA 2QLWA 1FVSA 1S79A 3E2EA 4ZHRB 2BE7D 3H4DA 1I6JA 3W62A 2DHSA 1QSSA 2ZZNA 2D41A 3HHLD 2W25A 2YKPA 3BSCA 2MQOA 4LQ9A 3AXKA 3BN4A 4CTAB 1S4FA 4A8YA 1K8AT 3TI0A 1KDNA 2ZNZA 4MIBA 2QEXS 1ZA1B 5KFRA 3T9ZA 3MZIA 3FFIA 2ZHBA 3H40A 2ZH2A 4URSA 3HKWA 3NNCA 2NLWA 4ILRA 4OJ3A 4NXMF 2BA9A 4ZPBA 2AYMA 5I3UB 2GC8A 1GAOA 2BV3A 2PSZA 2B8PA 2BW2A 1RTDB 3Q8RB 3CCWA 2KO1A 2AHOB 5KFIA 3BGRA 2GJIA 2EG1A 4JI5F 2ZH3A 3MM7A 2MJUA 1ZAXA 4KSEB 3TA1A 3Q8UA 2QL7B 4NZ6A 1Y0HA 1X60A 3J81j 4M5NA 1WJ9A 3GWCA 4ED1A 2FJVA 1OO0B 1RSCA 2N3LA 2B56A 3BPSP 1S7HA 1N5SA 1UTAA 3ET6A 4ZVPB 4AXIA 1LXNA 2CQPA 1X5TA 3BH6B 3KJQB 2MHNA 1FA0A 4ZLLA 4C2MA 3NBPB 4CNZA 2ZJQQ 3GCWP 4LMZA 1LW0A 3QRPA 4UOGA 1WC6A 3KLGB 3MEDA 2BZ2A 2IBOA 3UR3C 4X4SA 3MDFA 1R31A 1T3NA 3HFKA 1ZOTA 2WOMB 1SJ1A 1M1GA 1D0EA 2O01C 4B3SF 3N5FA 1S6QA 1TL1A 1F9FA 2GO9A 4OZ2A 4OI1A 3B82A 5HSPA 4DUZJ 1JLQB 1WC1A 2DGVA 1WF1A 1VI7A 2I9SA 2HQDA 3GONA 4J90A 3W63A 3M2VA 4DPYA 2GVDB 4FS1A 3F56A 4RNMA 2D3OR 2XMTA 2D7SA 5IOLA 2VF3A 2R7TA 3KJVA 2BKNA 1FRHA 4NLOA 3ZXWA 3PJ9A 4WXWA 4JI8F 5A76A 2UXCF 3OL6A 1XWLA 2R7VA 1SC4B 3DOKA 2XLKA 3RR7A 2DY1A 2DT9A 4PXBA 3DLJA 5CHCB 1T9VA 2CPIA 2X7IA 2F40A 3G82B 4Z7YA 3VTIA 3HT3A 3H4BA 1UPPA 2RQCA 4DL5A 3JTOA 5IS2A 2CYYA 1JLFA 4RW7A 4NASA 5ADZA 1BQNA 5AXLA 2DR5A 1UVLA 3J7Z5 4Y2MA 3JSMA 2KZZA 1AA1B 2M9KA 2MZJA 3SSSA 1JXVA 4ZPCA 2IVMA 4LF8J 2ZH7A 3CMES 1Q1KA 2Z30B 1CPZA 3FQKA 4I6WA 4P7VA 2AYBA 3ETOA 1JK9B 2MSTA 5LMNF 4NX9A 4PEOA 5GAGU 4DV1J 4ZVHA 2A3JA 2VG7B 2P9CA 1U1KA 2C1EB 4G1PA 5D8HB 4NLDA 1JKHA 3VGTA 1K73T 2QJ3A 2BKOA 2JH3A 3AB4B 1PBUA 2OMOA 3HVTB 1SH3A 3NS6A 3D7SB 4WK1A 3GV7B 3CE8A 3QAUA 3G82A 2CJXB 5J2NB 1FE0A 5A8RA 3QT7A 1BQXA 4O4GB 4U67Q 1O8BA 4WCEQ 4F4XA 5HVHA 3TA2A 1QSLA 2B9EA 2IYGA 3BSAA 4FVMA 2AEFA 3EDRB 3W8GA 4DQQA 1Z4UA 4JV1A 1ZPWX 2BKPA 2HAFA 2Z2YB 3C16A 4OL8A 1U2FA 2E7WA 3PEJA 2ROEA 4FVCA 2XYPB 4JP8A 1RWUA 3GJTB 4O3SA 1YJRA 2EPIA 1MU2A 3E8OA 2C2KB 2XSFA 3UD5A 4TQSA 1WWHA 2ZUGA 1T8EA 4WP8A 1U7LA 1R43A 2ZWPA 5G0RB 3C14B 2B9XA 2F63A 1UJ6A 3IR7B 1SCJB 2M0GB 2UUWA 1HPZB 2G2OA 3NXZA 4AFFA 2R9LA 4ES3A 2FYXA 2QSWA 3BGRB 3G87A 4MIWA 3RUBL 1IR2A 5KFZA 1N54B 4LSNB 2XHCA 2C3YA 2YNGA 1FDAA 4OHZA 2N4CA 4QU7A 1RT6B 4KGVB 5HMYA 1RBAA 1HD0A 4DQIA 2W7AA 3VCDA 4B9UA 1OYEA 3LGMA 3DDNA 4HHHA 5D0RA 1D9FA 3HJVA 3IWLA 3UDVA 2DR8A 1FKPB 4JOUA 3OFFA 4HACB 3ZZZA 5LXRA 1DTQB 3MMAA 1WTBA 4HT7A 2E5JA 4KH0B 1ZH5A 3T1HF 3I5CA 5IQ6A 1LWEA 2YX1A 3CGIA 4EU0A 3FCWA 4KGKA 4CLSA 5A2QY 5KFOA 4IRCA 4OI0A 1AXQA 3QSIA 4CQ1A 4CO5A 2OPRB 1FVQA 4GKJF 3CIZA 1LXJA 4FYYB 3CJKA 2EFVA 2LA6A 3S1TA 2QO3A 4B9VA 1N33F 1K0VA 3C14A 4I2PA 3ZC4A 1LK5A 1HHSA 2B4OA 1BLUA 4K8RA 4L72B 1HI0P 2VOPA 1SL0A 1N6QB 3TYTA 1LQ9A 1RTIB 1WKJA 1S9GB 4DL2A 5KFKA 4DR4F 2QYGA 4UUWA 2OPSA 3CC7S 4ATNA 1S12A 1VQSA 3IA0A 5KAKA 3EX7B 4DV0F 5L46A 1U1RA 3RB4A 4M5LA 1GMVA 3QYYA 3HM9A 2J76E 1U24A 1JLFB 4RW7B 2F1FA 1L5UA 2HHVA 2KFNA 1EARA 5HLFB 1KFDA 2JDJA 3GE9A 1PAUB 4FNIA 5DLFA 4DQPA 1R89A 8AT1B 3N01A 3M2VB 4TU8A 2GHPA 4IH7A 2WVFA 3VAHA 2YQ3A 3D1HA 5SZTA 2YQ0A 1F1BB 3I9ZA 2Q1LA 3W9IA 2NS1B 3R6LB 5HROB 2V2QA 1VJQA 2BQ3A 5F8MA 3KTQA 1H98A 2JLFA 4DV4F 4QIWD 1IKWA 3M2RB 1WSRA 3PM9A 1Y3KA 4K4VA 2PO4A 2NPIA 5LM7E 1MROB 1S9GA 5HQMA 2VQFF 1KR4A 1G3OA 4WIIA 4IUFA 4ED4A 2QA4S 2HHSA 2YX7A 1R0AB 3QGHA 1BGXT 3HVAA 1S1VA 2KVIA 1SJQA 2V63A 3PW2A 3R5BA 1GT8A 4WFZA 4ZJLA 3CJRA 3MR2A 2VUGA 2OI2A 4FF1A 5KT5A 2RH3A 2VQEF 2BRKA 2DITA 1VLYA 3CO0P 3LP1A 1URRA 1RT7A 2FJEB 3UN3A 5DQIA 3V4MA 3M6UA 1QAXA 2LXFA 5C7PA 5HP1A 1HW8A 1HNIB 4KGZB 4A8OA 2Z2ZA 4F0HA 3HSGA 1Y4ZB 2DRDA 1RTZA 2WONB 1NZAA 1T9YA 2M7SA 4O3QA 4DL6A 3Q8SB 1OMSA 1H72C 3ENQA 5DM7Q 2ZOFA 3RBEA 3JTPA 1U0HA 3DHWC 4USMA 4NLUA 5LJ5Y 1LWCA 4QBUA 3CT9A 1FTCA 2JOQA 4GVLA 3WX4A 3RRKA 4ECYA 4ZK7M 1R0AA 1PC4A 1G7CB 4OZLA 1OIAA 2WTFA 3EXCX 3PW4A 2K2PA 2LEAA 4FXDA 2V4JB 4RUCA 1FDNA 1NEEA 3MM5A 2MXYA 4G1QB 2KB2A 3DNCA 3NAIA 3QBCA 2HQCA 2UP1A 2L41A 1MU2B 1APSA 1M5HA 1MWZA 2CG4A 5IT0A 5KFXA 5IV4A 5KG3A 3JSBA 4P71A 1FD8A 4MK7A 4RJVA 2V2ZA 4WP3A 4EO6A 3CCMS 2EVZA 4F0KA 5HMZA 1AUDA 4EZ6A 4I1TA 1CJTA 1X7VA 2ILYA 2ZBRA 3QMQA 4LFCF 2PE8A 1K47A 3MOJB 3D0HE 1JLAA 2ZZTA 3OL8A 1G1XA 1NRKA 5T41A 4UY8T 4ZLPA 3SCLE 3W2VB 1CC7A 3VQTA 1URNA 2RHQB 4JBCA 4CO4A 2ACYA 4OZ5A 5D3GA 2O5DA 3D3BJ 4F4AA 2QT7A 1H0HB 3NP5A 5GAHU 1R8AA 3KUHA 1NJYA 1TELA 5KG2A 5EX3A 4PYDA 4USVA 5MAOA 5F9LA 1WG4A 4F0MA 6FD1A 2VIHA 2L48A 5LSRA 4DFKA 1SC1B 1FRXA 3GIIA 3PYFA 4G1QA 5K8PA 1XNRJ 1LW2A 2FZKB 1IN0A 3SCIE 3LTOA 1PCAA 5J2MA 1NK5A 1YJUA 4O0IA 2LU2A 1RUSA 1P1TA 3C15A 2BJ9A 3UDEA 4WFNQ 2XQCA 3MUTP 1DRZA 1TFWA 1NPKA 1BD6A 1S77D 2KI2A 1YBTA 2HBYB 4MH8A 2BBEA 3IGNA 4HLBA 4N47A 3BSOA 1FJ7A 3DGPB 2HIYA 1FWLA 3MPYA 4KE5A 5KOXA 2WB4A 1IUJA 5C25B 3J7ZT 1EHWA 1YJTA 3A8EA 3G6XA 3RB6A 4RW4B 2ZNYA 2LMIA 3FMBA 5HJYA 5FJ4A 3MUMP 4OZ0A 2J8AA 3BDEA 4HHUA 3W61A 1CJUA 3C3LA 2MZRA 3CDBA 2NXUA 7FD1A 3OVAA 2UVUA 2ZDPA 1M5VC 4OFZA 3OUYA 4NCGA 1C1CB 2PI4A 1B7YB 1KHVA 3DU5A 4AL6A 2MZQA 1N52B 4NA1A 3QT6A 2B0GA 1VRQC 1TKZA 2CNNB 3B8HA 2Y1RI 2BANB 2F3JA 2H5JB 4GKKJ 2OEKA 3BYPA 2CPZA 4WWSA 3TA0A 1QE1A 4ED7A 1SI9A 4PZVA 4C11A 1VC5A 1XBWA 2B9WA 4ED8A 4OX9F 2Y1IA 5F8HA 1VQMS 1EQ0A 4KBIA 1WHXA 1IBKJ 3QJLA 2Z2MA 3T9NA 2P9EA 3MR6A 3MM8A 1WD6A 2HWTA 1NSQA 2WHOA 4YMEA 3OHBA 3ZZ0A 2ZH8A 3TO8A 1IR0A 2JL9A 3OBIA 3EZOA 4YB6A 5A0YB 4DSEA 3I9V9 2FVSA 2KYXA 4ZPAA 2OO4A 4KV8A 3AB2B 4EI2A 2ZH1A 3FSYA 4PQUA 4MJKA 4USWA 3Q22A 3CCRS 2MDAA 3PO5A 2OPPA 5E3AA 4OV6A 4DV2F 3N5BA 3GIMA 3IBWA 2CQBA 3GILA 1WKKA 2YNFB 3IC1A 5IXUA 5J1NA 4IH6A 5K9FA 1WKLA 2FDNA 1QE1B 3WHIA 4CO0A 1ACMB 3VAIA 4DV7F 4U9RA 4IH5A 3G2XA 1QUPA 4JI6F 2A2DA 4KKOA 3KUGA 4ECSA 1CEZA 1NU4A 4X4VA 3T6JA 5KT2A 1GXTA 3FEYB 4GC7A 3HHEA 1J5EF 1RAEB 2NUUG 4QWCA 2I2YA 3TX0A 5KFWA 4NLGA 2CA9A 3M6VA 4L74A 2AYEA 3G71S 1DJ0A 5A0YA 2HBRB 1UFWA 3MURP 2NZ4A 4HDGA 2W9BB 2O67A 4P74A 5IV3A 4YR0A 1LOUA 1XNQF 4USIA 4N5SA 3TUPA 5CCLA 1FNMA 1WDDA 3U1MA 1TVRA 3BM7A 3TZZA 2BJDA 1TUWA 1YRXA 4M1KA 1GMWA 2GW8A 2WZ1A 2CG8A 3BO4A 2F5GA 4CO1A 4OHYA 2MLYA 4PWDB 9RUBA 2VFVA 3KOAA 3W5ZA 2HFVA 3C8YA 3PYGA 4TU9A 4L3NA 3VGUA 3QWUA 3KLEB 4ZN3A 4DU8A 2L9DA 4WKYA 1GXLA 3BKTA 4DBQA 4G6VB 4JV5F 2BYCA 3KG1A 2WOMA 4PWWA 4QOTA 3T5JA 2EW9A 4M5MA 3BBCA 4NZ0A 3DN9A 1LW2B 2DPJA 7AT1B 1MMNA 4WBFA 1NH8A 1YWXA 1KLMB 3RW6A 3ZTPA 3IAM9 4OX6A 3RAMA 2XSJB 2UVVA 1JLEA 2RRBA 1RTJB 4ICLB 1H3DA 5JMNA 1HBOB 3CMAS 4LF7J 1IBMJ 3KXDA 2DVIA 2BVZA 1GNKA 4DOZA 3RBZA 1IQTA 3RW7A 3DRXA 2YWGA 2WVDA 5DJBA 3I4PA 3OJUA 3I96A 4BLGA 3RTVA 3RAXA 1WOSA 3BBBA 3IM8A 3WIUA 3Q8PB 1Q7LB 3UWTA 4HH0A 1VBZA 2F8HA 4HACA 4QW8A 4FF2A 1WUUA 3ENAA 1Q7YT 3JYTA 2VC1A 1JLCB 4MMOA 3BKFA 1FDDA 2MZ1A 2IMWP 4DR7F 1FKOB 2V8GA 2IFXA 4K0KJ 4NYZA 4P7TA 4HR2A 3SIPB 4RZRA 1SV5B 2HVZA 3MAAB 2MTLA 4PYAA 4BCAA 5C42A 1YDLA 1KQGB 3MMCA 4O3NA 8ATCB 1C1CA 3M30B 3UN5A 1GXUA 1U1NA 1FNXH 1RT3A 4C8YA 4OJGA 2AEJA 1IVZA 1FFGB 2DY9A 3MM7B 4OHVA 5D4OA 3QRRA 2Q3PA 1H6KX 3GB0A 1WG1A 4LRDA 2MLZA 5KFTA 4YR2A 3NGDA 4ZITA 4KAIA 3H90A 4OV1A 5C5JA 3IS9A 1OS5A 2BR0A 2XB2D 5KFNA 4ZN1A 5J2NA 1DQ9A 2DGOA 1YIJS 3O3LA 4ECUA 2HAIA 1S1TA 1NK6A 4ZVQB 3KMSA 4CO3A 2H65B 3FFIB 2WK4A 2YY3A 2Y0BB 5KFEA 3CF5Q 3VAJA 5DG7A 1S0NA 5GAEI 4JI7J 4Y00A 1NJWA 2M52A 3SDEB 2E5LJ 1VIOA 5EWFA 5I3UA 4KKOB 1X4BA 2HS0A 4NLWA 2YX4A 1KC8T 3DRPB 2AJFE 2DH8A 1FCAA 1UVIA 3ENVA 4DPWA 2CVEA 3UCZP 2NPFA 3R97A 4ED2A 1NDCA 1LKZA 4F4YA 2A2CA 2EG2A 3K5PA 4OI2A 2A6OA 3M2RA 1RHUB 1GMWD 1YRTA 1U1PA 5DLGA 1B3TA 4JI0J 1LWFB 4B9NA 1E6VA 3I0SA 1NM2A 1ZM3A 2JX2A 4LF1A 2Q79A 5DETA 2GX8A 2ZM6J 1XC9A 1VJWA 4DN0A 3OW2R 3W2WB 1W2BR 3L9ZA 2HHTA 3MMBB 5H1SV 2I6WA 3NMRA 1NHKL 4G3IA 2LEPA 1XMQF 1F5CA 3HO1A 4URGA 8RUCA 1YLXA 2MEWA 2WW8A 4NLYA 3HHKA 4RPFA 3DLGA 3CJ3A 1IKYB 5KFQA 2CPJA 2EEYA 3MMAB 3SDEA 4KFBA 5CCMA 1JJ4A 3BGLA 1VIXA 3KJVB 1Q8LA 2NXNA 2W9BA 2JRSA 2BJ8A 1FDBA 1YRUA 3DOKB 2W24A 4ES1A 2YNHB 4DR2F 2RHSB 3I87A 4RL1A 2UXDJ 3CC2S 2XO6A 3FBFA 1D9AA 1S99A 3CWJA 3TZWA 3VGVA 1HYSB 1O6XA 4MKYA 4FYDA 2XSJA 1Q81T 4IQXA 1JMTA 3GU0A 4OZ3A 4LF2A 1EP4A 5F8JA 1KVKA 3BSNA 2ALZA 3M32A 4TVAB 2V4RA 4M5DB 5U47A 2VICA 2EK6A 1D9DA 2RDJA 2AYGA 1J5OA 2IRYA 4FXWA 1DLOA 1TL7B 4LRCA 3OSNA 1UVMA 2MY7A 2FUG9 2HRYA 2JEFA 3OV7A 2MHEA 4DV5J 3DFEA 4K2XA 2GFFA 4NMXA 5CXTA 4ZP9A 1HNZJ 1DFDA 2Q6BA 1KQFB 2OPQB 4LIRA 3V5RA 3H5YA 3CEDA 2MZTA 3I4HX 4PKDB 3WC0A 2YPZA 3R2CJ 3P45B 2EK1A 1JLQA 4J9SA 3I55S 1RTHA 4CCHA 4M5KA 1S10A 1KNZA 2XMJA 4B3TJ 1A0OB 1FRMA 2CJQA 4Q2LA 5HN0A 5KFMA 3P5TL 1NMEB 4PPZA 2VG7A 2I5JA 4RLEA 3ZZYA 1N56A 4ECQA 2GGPB 3M8RA 3E51A 4DV6F 2J0QD 1D8ZA 4YY3F 4QJVA 4Q8FA 1ROFA 2D3O1 1EAYC 1XQIA 3M7VA 3TP2A 2JEJA 4CZCA 4ID5B 1NK9A 1QUVA 4WZMA 1TL7A 2ZJPQ 3KLGA 4RU9A 1Q8KA 1VQOS 3QO9A 1N4LA 2PIIA 5KG1A 4B9MA 4J9RA 2HQ3A 1S1WB 4DFMA 4QIGA 1N32J 3BR8A 3IWXA 2KJWA 3HVWA 5KG6A 4QPTA 3VQSA 3GYXB 3ZZOA 3C46A 4P72A 4WYLA 3QIPA 1U6FA 2G0CA 2UUCJ 4A4JA 1RTHB 2JVOA 3A12A 2QTWA 5EUHA 1RT6A 1M5KC 3D6TB 1S6UA 3NWGA 4JI3J 3FVYA 1KOHA 2OH2A 2XZWA 2LYVA 1YJ9S 2RD5C 3AOCA 3O6QA 3U02A 3D1QA 2MQ8A 3N6NA 2UU9J 1TL5A 4GVBB 3HJFA 4C0OC 5AXNA 2CZVC 2A10A 3IFEA 1VQ4S 1ZPVA 4Q5VA 2QN6B 2V94A 1XMOJ 3CCES 2FY1A 4QW9A 2UUAJ 2HHXA 1V9OA 4FDFA 2N3OA 3MFHA 2HNZB 3DLEB 2R7OA 2CQ2A 2GZOA 2AJ0A 1S4EA 1T3OA 2DGWA 2YBVA 4P75A 4UOFA 5E2QA 5CD4A 2C28A 3R6GB 4R0JA 4LSLB 2ZC4A 2J9DE 3SQOP 4X66F 3TQ1A 4RWXA 1X4GA 3WX8A 1LWEB 2BUNA 2XTJP 4URQU 4LRAA 4P2FA 2BQUA 3I0RA 3M8PA 2DNNA 2FPHX 2N4DA 3EZUA 3L7PA 2LLZA 4RW6A 3EJMA 1SIZA 4OMFG 4ZJOA 4U6PA 5DDOC 2A18A 2VA2A 3P6YC 1U09A 4W4MA 1NKEA 3ETMA 4A8FA 1RT4A 3DM2A 3ZTSA 4IO9Q 3DDIA 4CIOA 4JI2J 1R27B 4U96A 2SXLA 4JI1F 1WNEA 3EUNA 1VQ9S 5DM6Q 4LREA 4ZIVA 2ADBA 1Q16B 4DDFA 1KQSR 4B08A 1I94J 4PG6A 2XGQA 1Y11A 3DLGB 2EFOA 1YJ7A 4AL5A 1S1VB 1FRIA 4ZPDA 4ZCLA 3W7BA 2QYCA 5F8IA 1TK0A 2UVWA 2IM1A 4IG0A 2B8QA 3VZIA 3DHXA 2D74B 3JAMY 2NYHA 2YWHA 4BS2A 3LALA 3LP1B 3I6PA 1PSDA 1UWBB 4XAKA 4LSLA 3G6VA 3RAQA 1TKTB 4K4SA 2A1BA 2W2OP 2B4UA 2CUYA 2ATLA 2G0IA 2OEJA 5I42B 3DRRA 1FNOA 2ACMA 2YVSA 3NAHA 3NCPA 3POTB 3BKUA 4PAAA 2DCLA 4IR1A 4U7UK 3MXHP 1EZZB 3IN5A 4Y2IA 4JI4J 1MMDA 3DXSX 1X4HA 1PJ5A 4QIVA 3C6TA 2KXFA 2KT5A 1F9EB 4DR3J 3MGJA 1D09B 3V2UC 3CD7A 3OFHA 1X4CA 4B9TA 1QLNA 2N7CA 1FKPA 3MEGB 1OPZA 4DR1F 3EVOA 3RU0A 4FBUA 1ZM9A 4A8XA 4NCBA 3BV8A 4Q45A 1CG2A 4ZP6A 4P9SA 4TU7A 1HR0F 2FJAB 4K5RA 4DXLA 2OPQA 1UZDA 4Y6IA 4E98A 5F41A 3E01A 2YKMA 1AB8A 4ANCA 2Z57B 4L6V3 1ZM2A 1FJEB 2W2QP 3DMJA 2COLA 2E1AA 3OTOF 4M5JA 4O44B 3GJQB 1QY7A 4QU6A 1WI6A 2HZAA 1QD1A 4ZHRA 3M4XA 4KY3A 2V8DA 4M5HA 3SV3A 1U2RA 1OQ3A 2DGQA 3T1YF 4C8ZA 4X62F 2OGUA 2HYIB 1IKWB 1WC5A 2MZSA 5KFVA 2CRLA 2BQRA 4UZCA 1QTMA 1O51A 2BJEA 2RF2B 2XWYA 3AT1B 4B3MJ 1DAXA 3FK4A 3EVWA 5B08A 1VBYA 4EMDA 3D1OA 3ISNC 3KLIB 3HFVA 4ITSA 4DZ6A 2E9RX 1Q5VA 1HQUA 4KV8B 2F65A 4CLTA 5IM0B 2FGCA 1ZBTA 1TKXA 2QIFA 1TL4A 4HHJA 4WK3A 3KK1A 1RJJA 2HIQA 1D1UA 4J9VA 5LOQA 4QWEA 1X8DA 2VFRA 2DXEA 1C0UA 3FJ2A 3NGSA 5KOWA 5HP1B 4KJIA 2R8JA 1CJKB 2IDEA 3OFGA 1MNEA 3QZ8A 3SSRA 1RISA 2KT2A 1HQEA 3A13A 1GMUA 3DCAA 3TVYA 3R1LA 2N82B 2C2DA 4P52A 3ELHA 1FWKA 5B0DA 4ZP8A 1RADB 3MD1A 1VRTA 4OYAA 4AUKA 2U1AA 1QTNB 2V0NA 2UV8A 1B99A 4B3OA 2FJWA 2BACA 1OPIA 6AT1B 5GAEU 5EDWA 1N36F 1H38A 3G86A 1S0OA 5IT9Y 5D4PA 3R7BB 3W5YA 5HBMA 2LQ5A 4WFAQ 4NI2B 1FF2A 4QYRA 3M6WA 2HRTA 2AJ1A 4NCGB 2CQCA 2NSBA 3ADAC 3L7UA 4OYPA 1L3TA 1T0TV 1WHWA 4O0NA 2JEIA 2IYIA 4MT1A 4RW6B 1TVRB 1N5QA 3B4DA 2VU5A 3BQ0A 2YKNB 4I2QB 2DNOA 5L9XA 1P8GA 1AFJA 1K1QA 4C11B 3CD6S 1NK4A 1UEVA 5DDQC 1S57A 2W2MP 2FC9A 3IP0A 4CM0A 4PUOA 3QNWB 5D6GA 1SC3B 1JJ2R 3QT8A 4K2JA 1V3RA 3W9HA 1XR5A 2OMLA 3CO9A 4MAKA 4WXOA 3OVSA 2MKSA 2H54B 3GR1A 1LWXA 3J80Y 4DR5J 3AQOA 3PX6A 3RB0A 3IR6B 3UNYA 3H98A 3CCUS 3CJTA 2W4CA 2GCFA 2BANA 2BJ1A 1TMMA 3NKYA 1RT1B 4TLRA 3C19A 1Q79A 5J1EB 2OPPB 2OSQA 3BGFA 1ZETA 4X65J 1RWKB 3D28A 4RNHA 3CCVS 2HHUA 2CQ0A 2KJVA 4NLTA 3HF5A 2G0JA 4C8NA 1CVJA 2CPFA 4DLEA 4V19X 4NEZA 4M94A 3SCKE 4UY85 1SKSA 3MM6B 1NBEB 1C0TB 3OXLA 3M8ZA 1K9MT 3DLHA 5LT5A 2P8IA 3CDAA 2KZMA 2CNLB 3WIVA 4C8LA 5JVHQ 2WBMA 3CSKA 1T11A 1H2UX 2VV5A 3I82A 3SBMA 5J2PA 3CMQA 3L3CA 4CLUA 3PFEA 4Y2CA 4J37A 3DXBA 5E0OA 1UA1A 2YWEA 1SQFA 2Z56B 5KFUA 5IC4B 4LF4J 1FI4A 2CXEA 4OHXA 3DLKB 1EX8A 4LFBF 3KK1B 1PAEX 4RNNA 2FLPA 4X2BA 4HEA9 3HZGA 4H4OA 1Q8BA 2W9CB 1AZSA 1VR6A 2V2VA 3GSDA 4H54A 1YKWA 3PRBA 2R8KA 2V68A 5KG5A 1VHIA 1ZYQA 4YOEA 3CPWR 1C0TA 5IFMA 3CCSS 5E3CA 4ENOA 3HMJG 3CDWA 4LIWA 2HFOA 1T05A 5H9FJ 3BQ1A 2BE2B 1RAHB 2J6SA 1JJHA 4DPTA 4DSLA 5KFFA 3EGNA 1KLMA 5HJXA 4DSIA 1S0VA 4LBPA 3M6XA 5D4NA 1RACB 3J80U 2R3VA 4QR1A 5SUHA 5I4MA 1TKZB 1WTFA 2B9YA 1LWFA 2OUGA 2EBEA 3EGVA 3PJXA 3C6UA 2FGOA 2MPUA 4WU3A 4QWDA 1JXLA 2B4VA 2HW3A 5ETTA 3OLBA 4O3OA 3P96A 1SJ4P 2RUSA 2HRUA 4QQBA 1SJRA 1B0PA 3R5JB 1LFWA 3F73A 4IOAQ 5K5MA 2YNFA 4DV0J 3L4BC 1UFKA 1SL1A 4RR5A 4PWDA 1RXOB 5CYQA 3F0NA 3JSMB 4OYXA 2W7OA 3HHLA 4Y34A 3V4IB 2HK2A 2C2NA 2LA4A 3PR4A 4ED3A 1NKCA 1DZ5A 2E9TA 2HHWA 1U49A 4UTGA 1P9YA 3PO4A 3IXQA 5D78A 2AIRB 1RLCL 4DL0C 3THPA 3W3SA 4EYIB 4LF5J 1JLGA 2DR6A 3JQJA 1K44A 2GVDA 1A6LA 2BOAA 4ZPVR 1OWXA 2D3UA 2GO8A 4UW2A 3SFGA 2HNDB 1R0CB 1Y7PA 5LMUJ 2CAJA 1GX6A 3PXGa 5DGAA 4YEAA 2AJ2A 3Q24A 3MOZA 3MCOA 1Y10A 2H5EA 2QE5A 2VFUA 3HPOA 1VQ8S 1S9EB 1UL3A 4NXNF 2J6TA 4JYAJ 1ITPA 2KDOA 4EYHB 2E9ZA 3CJ0A 3M32B 1HMVA 3AJ2A 2NR0A 3MECB 2V2KA 4QYZJ 1FHTA 2VQFJ 3CJSA 3N6MA 1HKAA 3GQCA 3NEKA 4KTQA 4Y3CA 4F50A 3MAAA 3PTWA 5KFDA 1T7PA 3WBZA 3KLVA 3FCVA 3TANA 3K5NA 1JNRB 2P5VA 4KC5A 4YR3A 2IC3A 3MM6A 4MIAA 3G9CA 4CLZA 4A8KA 1FWPA 2EKYA
chains in the Genus database with same CATH topology
4N8NA 1SQEA 4YB7A 2LDYA 4BC7A 1QAJA 5DDRC 3PEHA 3V81A 3CDUA 1HW9A 3PR5B 5HI7A 2FHOB 2CQDA 1JLEB 5H9EJ 4EFAC 3FSIA 1S1TB 3H20A 5DQGA 1T03B 5L1LA 3TAPA 5JUMA 4MYTA 5J2QA 3B78A 3WZ0A 1P9QC 3MMBA 4KT0C 1U6ZA 1P27B 1FXLA 1WELA 1NJZA 2FJXA 3DC2A 2J9DA 3OTCA 2D1CA 3K57A 3BO3A 4MTPA 4C8KA 3HDSA 3DRSB 2M5YA 1UWBA 4W90B 2B5JA 1HI8A 3AY0A 3IG1A 4DUZF 4HI2A 1O5JA 4DG1B 2DD8S 3SMZA 2L3MA 5C42B 2NSCA 3ICLA 2BE2A 5JXSA 4F67A 2MQPA 3IWNC 1FJGF 4Q0BB 2E1MC 4X4RA 2VBZA 5A8RB 3MTKA 5D3GB 3THTA 4XDDA 3GFHA 3SV4A 2W9CA 4RW8A 2DO0A 2DNMA 4IO1A 4LSNA 2YNGB 5DS7A 1NH7A 3HVTA 4KFBB 3KMQA 2F9DA 5IQQA 2NUHA 2VKRA 2CPEA 4O3RA 2EFGA 2IM2A 2ZBCA 3M9MB 4QWAA 2DHGA 1MWYA 2I38A 1LV5A 2C2RA 3HX9A 4OJHA 3M30A 3S01A 5LXYA 3GV8B 3V6KA 4DG1A 1NB7A 2HHVA 3KLFA 2BOPA 2IRXA 3BQ2A 3OR2B 2DCUB 3MAQA 4LF8F 3ITHB 2MKCA 1HBMB 3TUIC 1UKUA 3US5A 1S0MA 2E66A 2YNHA 1VHFA 2J0XA 2XMMA 4K4WA 4TNOA 3KK3B 2MQQA 2APOA 5FDLB 3EZ5A 1QVFR 3FDSA 5B7WA 2RILA 3NNHA 4ZS6A 1XMBA 3HHLB 3PW7A 1IKVB 2CZ4A 3R5DA 1C2PA 2VPYB 2X51A 5T7LB 1KTQA 2R4FA 1SUQB 2CPDA 3G8TA 2GQ2A 2QRRA 2YWFA 4K4ZA 2GMHA 3KLFB 3K0JA 5BYRA 5KFYA 2EI5A 1N8RT 2E1RA 3DDKA 1SH2A 2GIQA 2QA1A 2OKQA 1JNZB 2OLWA 3GMGA 1RKJA 1E6VB 1U1MA 1VGYA 2OPRA 2G13A 2ASLA 4GKKF 2F4VF 4NYPA 3GYNA 3MECA 4AL7A 1HA1A 1IXKA 3HI9A 4ZPTR 5GADI 4E0DA 3L95X 4DPOA 2I5JB 4FBTA 3MFIA 4KGMA 4CH0S 3MEGA 1IKYA 4USJC 2FHKA 1GTHA 4LF9F 3I5AA 2DNPA 1FRKA 4H4MB 2D3ZA 3QIPB 1SH0A 1KONA 1U1QA 2HWIA 3AJ1A 2Q6CA 1Z2LA 2RT3A 4DWIA 2HQIA 5G0RA 1KQKA 1K0TA 4AQYF 4A8SA 3S7RA 1ZZFA 4HI1A 4OI6A 4LFAF 5A6PA 1UJ4A 4PG7A 1NO8A 4FPRA 4RX6A 5B0FA 2ZH4A 2PA3A 2VOOA 4NWBA 3OQ2A 4EBEA 2RJZA 2CQ4A 2FVPA 4FNHA 3PKMA 4ID8A 2J0WA 3R1HA 3LAKA 5IM0A 4YHHF 1U45A 2DNLA 1VOMA 3GG1A 1KN6A 2LDIA 1RT4B 2R7UA 1HBUA 2AP6A 3J81Y 2KRRA 4X4PA 4JV2A 3OXGA 4G1IA 3UCGA 1D8YA 2UVRA 2CQHA 1RTIA 2OP5A 3LP2B 1VQYA 5DG8A