1HNVB

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 91
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB03
1N56A 1JLEA 3MECB 4J9LA 1DTQA 1RT1A 1T05A 4M94A 4RNOA 3IG1B 1D1UA 3DYAA 4IG0B 2R8JA 3KK3A 1N5YA 4G3IA 5J2NA 5I42A 4TLRA 2V9WA 3HVTA 1KHWA 4TY8A 2AGOA 3V4IA 4MIBA 4ED0A 4EYIB 1T3NA 2DPIA 1S9EA 4H4OB 1S1UA 2W7PA 4EYHB 3IN5A 2B6AB 5FDLB 4M95A 2ZE2A 2UVRA 2HNZB 1LWFB 4JV0A 3E01B 3UR0A 5KFTA 2W8KA 4Q8FA 3RB6A 2OH2A 3C6UA 2FLLA 3MR6A 4ID5A 4ECSA 2R2TA 1DLOB 1WNEA 5KFIA 2YNHA 4LSLB 1S6QB 4NLXA 3V6DB 2C28A 4ICLB 1I6JA 3CJ3A 4QWEA 2WONB 4ED3A 2VG6A 1LWCB 4O3OA 5D3GB 4IH7A 1S9FA 4IG3A 1BQNB 3NMAA 1EP4B 3GV8B 4DL4A 1TKTA 1HYSB 1JLQA 4G1QA 1T03B 5KT5A 3GIMA 5KT7A 3GV7B 5KG5A 1TV6A 3V81A 3MR3A 4MK7A 3JYTA 3GIIA 3IS9A 1FK9B 3G6XA 4RW7B 4B3OB 2BE2A 2FVPA 1UWBB 4O3NA 1HQEA 3KLEA 3RBDA 2YKMB 5F9LA 3IG1A 3PW7A 4MFBB 3V6HA 3CIZA 4NLUA 3ISNC 4KAIA 5KFNA 1MU2B 4K4ZA 2R2SA 3HVAA 2CKWA 2IM1A 4Y34A 1JLGB 1S1TB 3CVKA 4IFVB 2B6AA 5FDLA 5KFUA 3DM2B 2UUWA 5KFEA 1LWFA 1S1WA 3E01A 4FS2A 3FFIB 4J9KA 4I2QA 5F8NA 4KO0B 3DMJB 4KHRA 3H5XA 1HNIA 3TQ1A 1IKXB 2WCXA 2HMIB 3PR4A 4YP3A 4J9RA 1DLOA 3H5UA 4EO6A 4NLQA 4NLPA 2BQUA 1ZETA 4IRKA 2FVCA 2FJWA 5DQGA 4DG1A 4U6PA 3DLGB 1S6QA 2OPSB 4KV8B 1HQUB 4QWDA 3KLHB 4F4ZA 1TVRB 2YNGA 1LWCA 4Q0BB 3T5KA 1RT4A 5HLFA 3MR5A 2JLEA 5J2QB 1BQNA 4MKAA 3EPIA 1LW0B 1ZTTA 1T03A 4K4VA 1RT7A 3T5LA 4K4WA 4WYLA 5HROB 2HWIA 5DG9A 2JEGA 4ZP6A 1GX5A 2UUTA 4O3SA 4TQRA 5I3UB 4RNHA 5KG0A 3I0SA 3M8PB 4PQUB 3GIJA 1HMVB 5HBMB 5C25B 2IJFA 3N6NA 3BREA 4URGA 2I5JB 4EBDA 3Q8PB 1JLAB 3LAKA 2AGQA 5F8IA 1TQLA 2ASLA 1S1VB 4I2PB 1R0AB 4NLWA 4K4YA 1JLGA 1RT2B 3PJWA 4Q43A 3DM2A 3N6MA 3FFIA 4MH8A 3LP2A 4URSA 4IDKB 3I5AA 1C0TB 4WZQA 4KBIA 2XI3A 1KHVA 5KFGA 5DGBA 5F8GA 2GIQA 3OLAA 4J9PA 5KT6A 4RW9B 2OPSA 2ILYA 5F8LA 4ZPDA 3QO9A 4RU9A 5KFRA 1TVRA 3GILA 3DOLA 5KFLA 3KK2A 3MTKA 2ZD1B 4RUAA 4RZRA 3OHAA 4ECRA 5C24B 5DQHA 1IKVA 4FBTA 4R5PB 3M8QA 2RKIB 3G6VA 5HROA 1JLFB 2ILZA 2VG5B 1IKYA 3MEDA 4RUCA 3PW2A 2YKNB 5KFZA 3M8PA 3QYYA 4IR1A 5KFVA 4PUOA 4WFZA 1VRUB 2IM2A 2I5JA 4NZ0A 1QE1A 4RW4B 4F4YA 2D7SA 3D5MA 1S1VA 1R0AA 4QWBA 3OHBA 2FVQA 2VG7A 1RDRA 1C1BB 2QE5A 3CO9A 1JXLA 5KFHA 2R8HA 3KHGA 3NAIA 1RT3A 5HP1B 3HHKA 1S0NA 4HYKA 1EETB 1RT5B 2B5JA 2WOMB 3KLGA 5EWGA 3KMQA 4YR3A 3CDUA 2IA6A 1FKOA 5CYQA 3BQ2A 2R8KA 3EPGA 3MEGA 4GC7A 4WFXA 5KFYA 1ZTWA 3LP0B 4RNFA 2J6TA 4LQ9A 5L1LA 5DLGA 1TKZB 1S4FA 3PJXA 4ZPCA 2W9BA 1TKXB 5J2MB 2ZD1A 4J9NA 1C1CB 2WK4A 1S49A 3H5YA 1S48A 4MK8A 2DPJA 5KFDA 2RKIA 5K14A 1TL3B 1RA6A 4ZVEA 1N4LA 2OPQA 1QAIA 2C2RA 3I0RB 2JEJA 3LP1B 4DL3A 4Y2CA 3C6TB 3KK1A 4YQWA 1RYSA 3GV5B 3IGNA 4WXOA 3M9NB 1DTTA 3TVKA 2HWHA 4DL5A 3KJVB 5KT4A 3JSMB 4I7FB 2O5DA 1LWEA 2V0NA 3M9OB 3QLHB 4R8UB 3DOKB 5KG1A 4ECWA 4K4SA 1REVA 3ICLA 1NNDA 2OPPB 2OPRB 3PHEA 1RA7A 1EETA 3RAQA 1FKPA 2B43A 1JLCB 3CDWA 2IMWP 2QV6A 1VRTA 3Q8RB 3MEEB 4DL6A 4IRDA 5KG6A 4TYAA 4NCGA 2FJVA 2YNIA 2ZKUA 3V6KA 2IC3B 2AX0A 3KLFB 3MECA 3MFIA 3H4BA 5J2MA 4IG0A 3CJ2A 4OL8A 1C1CA 4NLOA 4URQU 3QIDA 3T1AA 3BGRB 1TL3A 3H98A 4O3QA 1S97A 4IH6A 4ECYA 4H4OA 4NRTA 4NLSA 2AQ4A 2HNZA 2ASDA 2UVUA 2RF2B 3C6TA 2D3UA 4FS1A 2C2DA 3FRZA 1RT6B 5KFXA 5JXSA 1C0UB 2V4QA 2XCPA 5CYMB 4JUZA 4X2BA 3QZ7A 3NBPB 1JLBB 4LSLA 5EDWA 4Y3CA 3LAMA 3V6DA 1RYRA 4RW6B 4ICLA 2WONA 1LW2B 3IRXB 5C42B 3ITHB 3BQ1A 4O3RA 5D3GA 1SH2A 2I1RA 4IQXA 4H54A 1EP4A 1S1XB 2HNDB 1HYSA 3CDEA 2FVRA 5DG7A 4ED8A 3KNAA 4WZMA 1FK9A 4RW7A 4ED7A 1RTDB 1J5OB 3DRSB 4B3OA 1N6QB 1OS5A 3HVWA 1UWBA 4TXSA 3QIPB 5KFCA 4YR0A 1IKWB 2YKMA 1IM4A 4TY9A 5KFBA 2V4RA 4MFBA 3M9MB 2XGPA 2C22A 1MU2A 2JEFA 4LSNB 3BGRA 5EWFA 2EC0A 4NYZA 3MFHA 3H40A 1S1TA 4IFVA 1QUVA 4ZP9A 5KFMA 4KO0A 4DL7A 2HNYB 3DMJA 4KSEB 4KFBB 1XR5A 3CJ5A 3BQ0A 1RT6A 4ED6A 4WFYA 1IKXA 3FDSA 1C0UA 2HMIA 1CSJA 4U7CA 3IGVA 3BSCA 5KG3A 2FLPA 4RNMA 5KFAA 2BRKA 4NRUA 3DLGA 3PVXA 2D3ZA 4KV8A 2WTFA 3FSIA 5L1JA 3RAXA 1HQUA 4RW6A 3ISND 3KLHA 4NLTA 5KFSA 3CWJA 3BSOA 3ITHA 4Q0BA 1KLMB 5J2QA 3QGGA 1S1XA 1LW0A 3KLIB 4ECVA 1T94A 5J2PB 1HARA 1RTDA 3DRSA 5KFJA 1N6QA 4O4GB 5I3UA 5L1IA 3QIPA 4K4TA 1IKWA 1HNVB 3DLKB 4PQUA 1S9GB 1S6PB 1HMVA 5HBMA 1SV5B 4H4MB 1HPZB 5C25A 4JV2A 4WE1B 3DRRB 1JLAA 3DRPB 2IAJB 3OL6A 4I2PA 4MKBA 1RT2A 2W9CB 3DDKA 2BQ3A 4RW8B 1DTQB 1RT1B 1T05B 4R0EA 1XR6A 3DYAB 3GIKA 3KK3B 2HNYA 1N5YB 4IDKA 5J2NB 1C0TA 1JKHB 1NHVA 4ZVGA 2AU0A 4K4UA 4TY8B 1S10A 3V4IB 2XWYA 1S9EB 1JIHA 4F4XA 4RW9A 5F8MA 2ZE2B 2R8IA 4IRCA 3UPFA 3NGDA 4EEYA 2UVVA 4ZP8A 1Z4UA 3C6UB 3T19A 5C24A 1W25A 2BQRA 2YNHB 1TP7A 4R5PA 4HKQA 4EO8A 4QW9A 2BANB 1JLFA 3RB0A 4XPEA 2VG5A 4ZVFA 3NKYA 2C2EA 2YKNA 1SH0A 1S9GA 4IG3B 3BSNA 3QZ8A 1VRUA 1TKTB 4G1QB 5KT3A 4WE1A 3FQKA 2CJQA 4RW4A 3JYTB 3IS9B 4TQSA 3FQLA 2IM3A 3KLVA 5L1KA 4EBCA 3PW0A 3CJ4A 2VA2A 1HQEB 1C1BA 3KLEB 5T14A 4RW8A 1YVFA 2W8LA 2IJNA 4XPCA 5KT2A 2XI2A 3H59A 3UDLA 4QWCA 1JKHA 5HP1A 4Q45A 2UVWA 4ECXA 3I5BA 4O3PA 2XGQA 1RT5A 4KKOB 2WOMA 2WHOA 4WYWA 2W7OA 2AWZA 4J9OA 3H2LA 4F50A 3OL8A 5DGAA 1NHUA 2BR0A 3BSAA 3SI8A 1S1WB 3LP0A 4TN2A 5KG4A 4YR2A 4I2QB 4IR9A 1TKZA 4J9MA 1TKXA 3T5JA 3NL0A 1HNIB 4KHMA 3Q8SB 1GX6A 2J6SA 2E9TA 4DG1B 1K1SA 3MR2A 2JC1A 2BANA 3I0RA 5J1EB 3LP1A 5KFQA 2JEIA 2BRLA 1JX4A 2YNGB 1RT4B 5HLFB 4NLYA 4LQ3A 3BJYA 3QGIA 4MIAA 3RBEA 4O44B 1RT7B 5KFFA 2IBKA 3KJVA 3PW4A 3JSMA 4I7FA 4Q8EA 3H5SA 4ZMMA 1QAJA 1RTJB 3QLHA 4IKAA 3KMSA 4EBEA 3I0SB 4RNNA 4R8UA 3DOKA 2R8GA 3DLEB 2OPPA 4FBUA 2OPRA 4XO0A 3GYNA 1SH3A 4K50A 5DG8A 4KKOA 3NAHA 1JLCA 2E9ZA 2AGPA 1RTIB 2RDJA 3UQSA 3MEEA 4ECUA 5KFPA 1BQMB 1SUQB 1TL1B 3G86A 4IH5A 5EWEA 4ED2A 4NLVA 3T5HA 4IFYB 2IC3A 5C5JA 1S0OA 3LP2B 3KLFA 3Q8QB 4QWAA 3HKWA 3RB3A 2WB4A 3KHLA 2GC8A 4ZP7A 2J6UA 2XC9A 3PW5A 2XCAA 2AX1A 2JC0A 2R2RA 5EUHA 3I5CA 3D28A 2W9AA 5J1EA 3QO9B 3KOAA 2YNFB 3DOLB 3KK2B 3CJ0A 3G6YA 2WRMA 2RF2A 3DI6B 4ZHRB 3RB4A 5KG2A 4O44A 4ECZA 1IKVB 3M8QB 5CYMA 3BR9A 3N6LA 3NBPA 1JLBA 3H4DA 4Q44A 1IKYB 3MEDB 5KG7A 4ECTA 1RTJA 4QPXA 3IRXA 1LW2A 5C42A 3DLEA 3OSNA 4PUOB 1QE1B 2HNDA 4ED1A 4K4XA 3GQCA 4NLGA 4O4RA 1RTIA 2ATLA 3OL9A 2VG7B 4DL2A 1BQMA 1SUQA 1RTHB 1TL1A 1J5OA 1N48A 1XR7A 4IFYA 1C2PA 5JUMA 3PZPA 1RT3B 3QGHA 4DEZA 4ZVHA 5F8HA 1S0MA 3VQSA 2B5JB 4J9QA 3TAMB 3KLGB 4PWDB 4Y2AA 3PR5B 4ECQA 1FKOB 5CYQB 1MMLA 2FLNA 4LSNA 3MEGB 2GIRA 3KHHA 5DQIA 5F9NA 4NLDA 5KFOA 2E9RX 1JLEB 2YNFA 2W9BB 2R2UA 4JV1A 3DI6A 4ZHRA 1RAJA 3MF5A 4KFBA 5KFKA 3OSPA 5I42B 3HVTB 1K1QA 3V6JA 2FVSA 4KE5A 5K14B 4KB7A 5L9XA 4IOBA 3LANA 4MK9A 2OPQB 4GC6A 4J9SA 1S1UB 2D41A 2HAIA 2FJXA 4NLRA 3KK1B 3LALA 5DLFA 1KLMA 4YMEA 3OLBA 4ZPAA 1DTTB 4ID5B 3EZUA 4F4WA 3KLIA 5F8JA 5J2PA 2ASJA 3KHRA 4QW8A 1LWEB 2VA3A 2ALZA 1RTHA 4O4GA 2VG6B 3OL7A 3SFUA 1REVB 1HNVA 3DLKA 1U09A 2F8EX 1S6PA 1FKPB 3TAMA 4PWDA 1SV5A 1JLQB 1HPZA 4H4MA 1D0EA 2RDIA 4WXWA 3DRRA 1VRTB 1TV6B 3V81B 3E51A 4TYBA 2IM0A 3DRPA 2IAJA 4NCGB 3SFGA 5KFWA 2BE2B 2YNIB 4ZPBA 2W9CA
chains in the Genus database with same CATH superfamily
3MECB 4J7CA 1WDTA 4TY8A 2UV8A 1U1QA 5I4MA 3E01B 2B9YA 3LWLA 5KFTA 4CLWA 2FLLA 4PXDA 5GAGU 4P6QA 4N47A 3C14B 3GG0A 1RXOB 4DV0F 1XK8A 1T9XA 5CD4H 4GKKF 1TV6A 4QIVA 1RWMB 2FGCA 3QFHA 1RUSA 2GGPB 4MFBB 3M32B 3SCJE 4DUTA 5T7LA 1S6UA 2XYHB 1RISA 1X4BA 1VQLS 2ZBQA 1U1NA 1HNIA 4B08A 2KM8B 1NZAA 4YP3A 2XG8A 3T1HJ 4M5HA 3SCKE 3MOJB 4QWDA 3W63A 3KLHB 1UEUA 1WC6A 3EICA 3EPIA 1T03A 4UQTA 4OYPA 2F5GA 2FZKB 4UW2A 3OR2A 3BS9A 2H3EB 3AT1B 1RWOB 2LP4A 4I2PB 4NLWA 2WB1D 3Q2TC 3DM2A 5SZTA 2KI2A 2XWXA 3OLAA 2OPSA 2ZNYA 2VH7A 4Z37A 1KTVA 2BW7A 1HFEL 1KLNA 2CZ4A 4RUCA 2XZTB 4PUOA 2BBEA 1X4GA 4F2RA 3M30A 4NMLA 1UEKA 5E2QA 2HHQA 4YR3A 1XMBA 1RWNB 3W9JA 4F7VA 3MEGA 2G2YA 1CG2A 1JB0C 4F3MA 1F2GA 5KFDA 1TL3B 1NMEB 2GV1A 5K8PA 1GMWA 3GV5B 1T9YA 1JNZB 2GAHC 3FBEA 1I51B 2V8GA 1HW9A 2F8MA 1JLCB 4TYAA 2FJVA 4JBCA 3MECA 2HS3A 3TR5A 1F5BA 5SUHA 3OTOF 1YRTA 4E0DA 5DM6Q 1AFIA 3BDEA 1KP6A 2M7SA 2RF2B 2DXDA 4GVBB 2C2DA 4JI1F 2K7KA 3NGSA 2AF6A 3L7OA 4L74A 2RE1A 2NXJA 5A6PA 3C14A 2NXCA 7FD1A 1XMQF 3DHXA 4UOFA 2GGPA 4MFBA 1W2BR 3M32A 2VFUA 1BQXA 2OTLS 5BR8J 4YFUA 2O01C 1XNRJ 4FYWB 4HDHA 5CH7B 3KLHA 3JQJA 2YPYA 2V63A 1FD2A 3UCUP 4XIUA 2QT7A 1YJVA 3PO4A 2BX6A 3R8YA 2MQNA 3TUZC 4WE1B 1XEZA 4I2PA 1D8ZA 2BQ3A 4R0EA 1UJ4A 3FVYA 1A9NB 3RW6A 1SXLA 4KIAA 1SJRA 4RO0A 4USIA 3NKYA 1SC1B 4DQSA 1CJKB 4TQSA 4EBCA 4ENOA 2C42A 2HHHJ 1X4CA 2QMXA 1X8DA 2XS7A 5KT2A 2M88A 3H20A 3TJAA 4CO3A 4KT0C 2RQKA 2ZM6F 5KG4A 1QSSA 4I2QB 2HIYA 4KR0B 1KEKA 1YG0A 4ZJQA 2A6MA 4YHHJ 2BANA 2HHWA 3O2IA 4FYVB 4LBPA 3RBZA 3OVBA 5LT5A 4C8YA 5D4LA 3LOUA 1LV5A 2N7CA 2R8GA 1RAEB 3EVWA 1JLCA 1PJ6A 1BQMB 5EWEA 2VJVA 2GC8A 1X60A 3I5CA 2YWEA 3OFHA 1RWPB 5CZVA 4M8LA 2RF2A 4GVBA 2XSFA 4PZVA 4ECZA 3H4DA 4K0KF 5LJ3Y 5GMEA 1EAYC 2GFFA 4NE9C 2P6SA 4ED1A 3A3PB 2GMHA 3OL9A 2B0GA 3BPSP 1KOHA 4XTTA 1VBYA 1F5AA 1KC8T 3MF5A 1HA1A 2I38A 4IO9Q 4J91A 3WBZA 2OPQB 3L7PA 2BM1A 3W8GA 5LXYA 1RTHA 3OTEA 4O23A 1Y11A 5C7PA 2E5LF 5H9FJ 1JLEA 1VQPS 1ZM9A 1VCTA 1NH8A 4MIBA 3DFEA 5DZ7A 4DV0J 4GKKJ 4P10A 2R7TA 3CMQA 2R7QA 3V6DB 3W2VB 1CJTA 2HK3A 1SJ3P 1EP4B 4NZ7A 2IHR1 4ZOSA 1CJKA 5HMYA 1OQ6A 4U8YA 4NLUA 1AYEA 5KFNA 2IM1A 5ETTA 1S4EA 1S1TB 3G87A 1VBKA 2C2KB 4ZVQB 4J9KA 4I2QA 2WSCC 2CJBA 3OTDA 2GCFA 4DDFA 1AUDA 1TVRB 3H25A 3O8WA 4WYLA 4IOAQ 2N4DA 1REGX 2I5JB 1NDPA 2OSQA 1M5PC 2DR5A 3GP9A 4ZLNA 2HSEB 4DF8A 5IM0A 4OFZA 3FFIA 4MH8A 3F73A 3Q0AA 1SJ4P 2ZZTA 4NI2B 2D9OA 5EX3A 5ETQA 1CJUB 3M8WA 2EFOA 4RZRA 4DV5F 4Q5VA 1VRUB 4LF2A 3E2EA 3OVSA 1NB2A 1RDRA 2YY3A 2RHSB 3KHGA 2U1AA 1X7VA 6FD1A 4DSIA 2WK4A 3M4XA 4OI0A 4ZVEA 2VKRA 2OPQA 5H9FK 3M8SA 1GXUA 2AYMA 3IR7B 4F4AA 3TVKA 3OTOJ 4RR5A 2OPRB 4ZVRB 1N5SA 1NO8A 2KT2A 1HLWA 4IRDA 3SQOP 4JI1J 3KLFB 1MN9A 4EMDA 3PX4A 2LEBA 3T1AA 3Q8UA 2DCUB 1M5SA 1XMQJ 4U67Q 2D69A 1OIAA 3N01A 3NBPB 3QJLA 1S7HA 3V6DA 3W2VA 2P2CB 3H2VE 2GMJA 4IQXA 2G0CA 1EP4A 3B54A 1PC5A 4ED8A 4U7UK 4ED7A 1N6QB 1VISA 3NG8A 4N8OA 2XHCA 5KFBA 3M9MB 3JXOA 1F9FA 4OZJA 1S1TA 1PSDA 2QLXA 2AJFE 4W98A 3CJ8A 1UP1A 3NOCA 3CCZA 1IBLJ 4DR3F 1U24A 2WTFA 1YJ7A 2RU9A 3HI9A 4CM0A 3A13A 4EGLA 3A12A 2JHEA 1HKAA 1FNOA 4P2FA 3K17A 1D9FA 3W3SA 2VPWB 3KK3B 5LSLA 4NI2A 1J2VA 2BZ2A 1PBAA 4F4XA 1XJWB 1CJUA 2BDPA 4LF7F 3JSRA 4MYUA 3FBCA 4H4KA 3DGPA 1LXJA 4ZVFA 4B9UA 4IG3B 1VRUA 1TKTB 3FSYA 2ZM6J 3A4TA 2XM3A 1WOOA 3PW0A 3OD2A 1TELA 1OWXA 3E8OA 2QGFB 2WHOA 2NYIA 2FPHX 2AYBA 1NHKL 2OD4A 2E9TA 3MR2A 1FFSB 4CLKA 2CIMA 2VQFJ 4DR7F 4Y2MA 1RT7B 3DC2A 1Y5IB 3M6VA 4HR2A 3HCXA 5L38A 1IQZA 3LGMA 3FNNA 3DLEB 2OPRA 3GYNA 5CZXA 2FJDB 4ECUA 1RAOA 2RNEA 3K5MA 5C5JA 3KLFA 3K7RA 4GRSA 4K0KJ 4QIEA 2WBMA 3FJ2A 3D28A 2L9DA 4PPDA 2C2MB 2JJ4D 1O5JA 2RSQA 4KGZB 2VD3A 3I6PA 4PRFA 3PRBA 4M63A 4OJGA 3NBPA 3RUBL 1WI8A 4ECTA 1RTJA 4P72A 1HNXF 3THPA 4XAKA 3NCQA 2VG7B 5B0EA 1KFDA 3AXMA 4HT7A 3R97A 4L75A 2W25A 1IM6A 4V1Ak 4ZHRA 3CIMA 1K1QA 5L9XA 3D2WA 2E5LJ 3AY0A 1FE0A 1LWEB 3LW5C 5K8OA 5RUBA 2MZSA 1FRLA 4DU8A 3KK3A 3HVTA 5FDLB 4M95A 1LWFB 5HMZA 4ZVSB 4MTPA 2WVBA 1AB8A 5KFIA 2KG0A 3KJNB 1H38A 3WZ0A 2RS8A 4IG3A 2KZMA 1TKTA 1HYSB 4M5NA 2CQ0A 1UZHA 4FNIA 4QIGA 4MYTA 5F9LA 4ZS6A 4P9SA 1HBMA 2F1FA 2V34A 1TAUA 4IFVB 2B6AA 3SQGB 4NMXA 1NSAA 3D67A 4L3KA 4OZ5A 1ZETA 1FERA 4ANEA 1GMVA 2E66A 3LGHA 4Q0BB 4CNYA 3GIRA 1RT7A 3T5LA 1NJZA 2LDYA 2NYHA 3S6EA 3BREA 4DF4A 2ASLA 4K4YA 1W7WA 4DV5J 2DGWA 3JTOA 2PC6A 1HD1A 2MTLA 5KT6A 2VQEJ 4M5MA 3MTJA 3CC2S 2Z56B 3EDRB 2VG5B 3R2CJ 2KJVA 2YKNB 3QYYA 3UDCA 2IM2A 1SC3B 2GJFA 5DDQC 2F4FA 1KKHA 2VG7A 2Z2ZA 2N7YA 4CO5A 4JI5F 2XYPB 5F3ZA 5KFYA 4V19X 5L1LA 2DPJA 2BJEA 1S57A 1LWEA 2K7JA 2B4UA 3ISZA 3HHLC 3BKUA 1XERA 4CO0A 1YJTA 4I56A 2DNOA 2AX0A 3PHTA 4KGMA 1FJCA 3SSQA 3P8BB 1T02A 1RB0A 1WC0A 4NA2A 4CT9A 4NA3A 2XCPA 1LFWA 3QJPA 1TZ0A 3MPUB 1HHTP 1S1XB 1HYSA 4Y0FA 1W26A 1P6TA 4Q7AA 4DR3J 1X4HA 5FJ4A 3TOQA 4IFVA 3SQGA 3UR3C 1C0UA 2XS5A 4EWTA 1P1TA 1YJ9S 4Q0BA 4ETZA 2QZ8A 2EK1A 2ZBCA 5DZ6A 1MROB 3DOMB 3W61A 5L1IA 3CCJS 3QIPA 3BZQA 2J0SD 1HNVB 4H4MB 3CCVS 4CLUA 1DTQB 3CC4S 2HNYA 5J2NB 1NHVA 2M8HA 4YOEA 4N77A 1NJXA 4IRCA 2E7VA 4ZP8A 5FLXY 1WWHA 2BQRA 3T41A 1TP7A 2YWGA 1KTQA 2VG5A 5HVGA 2YKNA 3BSNA 3OR1B 2DNNA 2FJEB 2CJ9A 3IFEA 2W8LA 1A7GE 1RAAB 2KJWA 4WYWA 2KZZA 4F3QA 4DR7J 3SI8A 1P9QC 5U47A 1EB0A 2BE7D 4HTIA 1UVLA 2IMOA 2IRYA 1OJ4A 3QGIA 4MIAA 5IV4A 1UFKA 2VASA 3NXZA 3R6GB 3MM7A 4DQRA 1PCAA 3GJSB 3ETOA 4K50A 3NAHA 1NAQA 2MQOA 1Y10A 3UQSA 2ADCA 2CRLA 4BCAA 3HKWA 1R43A 3HHEA 1L3VA 2E7WA 2W9AA 2ZHBA 1UETA 2NZ4A 2P9EA 1HNXJ 5B0BA 3ILOA 3W5ZA 2Y1IA 4KYZA 1HI8A 3VCDA 5EN1A 2CWKA 5IOLA 1U02A 2V2ZA 1PC4A 4A8SA 2GQQA 2BJ1A 1IJEB 2YPZA 4DZ6A 2KH9A 1FXRA 3FGVA 2L08A 2PFFB 3KHHA 1IVZA 2VPYB 1NDLA 2BJ7A 3W1YC 4ZN3A 3CC7S 4ANCA 1KBRA 4JP8A 1XQIA 3PIOQ 3MCNA 2DY9A 2G13A 2J0XA 4E8UA 4F4WA 4J9UE 1MROA 3DOMA 1UFLA 5F0WA 2VG6B 1HNVA 3I31A 5IFMA 2AGOA 3H42A 4ED0A 1JLQB 4H4MA 4TYBA 3PW7A 4NWBA 1DTQA 4RNOA 4DU7A 5J2NA 2HHXA 1PJ7A 1WOPA 3CDBA 4P75A 3P45B 4OI4A 4F36A 2GA7A 3RB6A 2B56A 4ID5A 1G4CA 4C8ZA 2JRSA 3BPDA 4ICLB 4O3OA 4PWUA 3OR1A 4DL4A 3GIMA 3V81A 1T7PA 2ZZMA 3CIZA 4CLZA 2I2YA 3U7JA 2W7AA 1RK8A 5AT1B 1IKXB 4OHYA 2OJ3A 1K0VA 4A47A 1FJEB 2CQBA 2UU9F 3MR5A 4K4VA 2XNRA 3CDAA 2VOPA 3B6BA 4TQRA 2M5YA 3O3LA 4LRDA 3N79A 5B08A 1S1VB 3TX8A 5DDOC 4X4PA 4OYOA 1KS2A 2LEAA 3I5AA 2KB2A 3RR8A 1GFWB 1TUWA 2HBRB 4WKRA 3G82A 1WC3A 4RU2A 5KFLA 3BB5A 1GNKA 2ZD1B 4RUAA 4R5PB 2R4FA 1DBDA 2DRDA 1QTMA 2BA9A 2C2NA 1RWKB 3TYTA 5ETSA 2D7SA 1RBAA 1ZS6A 2CQIA 3HHKA 5AXKA 1B7FA 2P6TA 4ZJOA 5H9EJ 2IA6A 1R7IA 1TKXB 5J2MB 2IY5B 1S49A 2EKYA 2D9PA 1RA6A 5BYQA 1X5TA 1J5EF 3AJ2A 4PYAA 2KYZA 2AW0A 2AZ3A 1KVKA 2WSFC 2O1PA 3JSMB 1S6OA 3CDWA 1V6HA 3KYLA 1ACMB 1QD1A 1C1CA 4DFMA 4LRCA 4LBIA 4DSLA 1U47A 1H72C 3SYZA 3MPVA 2ZBIA 2KTQA 1RT6B 2J7KA 3F41A 4X2BA 1C4CA 1X4AA 4W90B 1URRA 3LAMA 1HHSA 1FD8A 4ICLA 1F5CA 3IRXB 2MY8A 2I1RA 1SIZA 2Y3YA 1G2EA 2WZ1A 3MPWA 3D0GE 1Y4ZB 1UJ5A 2NPIA 1SPBP 3FEYB 2DNMA 1FRJA 4X4UA 4ZP9A 4DV3F 1IKXA 1WC1A 1NSKL 4EI2A 1Y5LB 1RBLA 3ITHA 2ZITA 4HH1A 2Y0BB 3DRSA 4O4GB 5G0RB 4K4TA 4K8RA 3CJQA 1HPZB 2WVDA 4A8YA 2EFQA 2AKWB 1RT1B 4F67A 1JWWA 1WORA 2MHEA 4MT1A 2BM0A 2N3LA 5F8MA 2MXYA 2GMLA 1VR6A 2PMWA 3TUPA 3R7SB 3MHYA 3T19A 1KRPA 5H9EK 4R5PA 3BBFA 2V2VA 4RL1A 2YWHA 2VF3A 4DUYF 2EXUA 2RHQB 5KT3A 3JTNA 3FK4A 3FQLA 3KLVA 2LQ8A 5ETLA 4N5SA 5D77A 4A8QA 4O3PA 4KKOB 2OP5A 4F0HA 1HNZJ 2L9NA 1S1WB 1TKXA 2Z30B 3A1YG 2JC1A 3ZZOA 4FKXA 1H3DA 1U1RA 3TA2A 3JSMA 3R6LB 4PXEA 4ZMMA 4RNNA 3NNAA 5DG8A 2EFGA 1TL1B 2IBOA 4CCHA 1VQSA 4QWAA 2R7RA 2H4YB 3RB3A 3QRQA 2JZ5A 3EVMA 3DU5A 1OQ3A 3KK2B 2WRMA 2VHGA 5C2GA 1HR0F 2J76E 4CP5A 5IT9U 2GAGC 4ITSA 1OSCA 3IRXA 2V9KA 4NCAA 2GQCA 1B0PA 2W2MP 2HLTA 4IFYA 4C98A 8RUCA 4AXJA 5JUMA 1RT3B 3T6BA 4X62F 1MMLA 4CTAB 4UOGA 2R2UA 1D9DA 4E98A 3SMZA 4KE5A 3PO5A 4A8FA 4P2MA 3V4MA 5GADI 2FJXA 1UVNA 2OD6A 1W2IA 3UFCX 1WKJA 3K5PA 1ICEB 4O4GA 4B3SF 5D6GA 1Q16B 1HPZA 3TVYA 3TA1A 2PEHA 1RT1A 1GXLA 1PBUA 4EYIB 3AOAA 1S1UA 4OZ3A 2CQPA 3FSXA 3MCMA 3MR6A 4AYBD 4DX8H 4B17A 4NLXA 2UV8G 4IH7A 5CQGA 1GTEA 2C3YA 3UO0A 3GCXP 2G0JA 5KT5A 2HURA 3ET6B 4CLFA 3MR3A 2WVEA 5GMDA 4ZLLA 3IG1A 2HPUA 1UJ6A 3ISNC 4KAIA 4FXDA 2UU9J 2VA2A 1S1WA 3DMJB 4HEA9 4C3KA 2B7CB 4EO6A 2JH3A 3MZIA 4EZ9A 2EG2A 4PYDA 5DG9A 3T3FA 4ZLPA 2XMWA 5LL6d 2O66A 3BDPA 2F65A 1L3TA 4R25A 5F8GA 3U1LA 2ILYA 4DSEA 1NSPA 2VICA 4ZA1A 3KK2A 1YKWA 4PABA 3CCUS 4F25A 1B70B 1VK8A 3GG1A 2DNZA 4ALZA 3MPDA 1XN9A 1RT3A 2H9ZA 5LSRA 1J5EJ 4E2FB 1G1XA 4WP9A 2LFVA 2DHHA 2MGZB 2FD2A 1TU0B 2RKIA 2KXFA 1NZ8A 2B3TB 4Y2CA 3L95X 2XHWA 4YQWA 1RYSA 3M9NB 5HN0A 1K0TA 3HHNB 2DVIA 3QAEA 4Y65A 2B43A 4D3HA 2QV6A 2HVZA 3NY0A 1RHMB 2LU2A 1R8PA 1JJHA 1RAHB 2WAQD 3BEGB 4YEAA 1BMQB 3R5BA 1U2CA 1EHWA 1SH2A 3M1VB 2IDLA 2NXUA 4OZ2A 1KOOA 3K8WA 4I69A 3ET6A 1L3UA 1J5OB 3A3NB 4DV3J 3BGUA 5A2QY 4BWMA 3VZHA 3GLJA 4QU7A 1PYOB 2IYIA 2UXDF 4KPYA 2ZOMA 2IA0A 2XMTA 1ZAWA 3DMJA 1XR5A 4KSEB 4N41A 3D54A 4WFYA 5IT9Y 1OMSA 1JNRB 3Q8VA 3RAXA 2C2OB 3CWJA 1Q1KA 3EDQB 3NWGA 2HFUA 3ULHA 2N82B 1K8AT 2BACA 2LLZA 3MAHA 5KOWA 2A6OA 1YJRA 4F04B 1XR6A 3DYAB 3W62A 2AU0A 1B3TA 3QWUA 4DUYJ 3KNGA 3UPFA 3LPEA 3OUYB 4JI8F 2DGTA 4C11B 2BKOA 3FZBA 3H7HB 3H8YA 3CJTA 1KN6A 1WF0A 1Q53A 1HQEB 2DNYA 3CSKA 4RW8A 1TL5A 4TNOA 1F0XA 4QWCA 1JKHA 1SI9A 4QIFA 5DGAA 1UMJA 2FJAB 1ZZFA 4UTGA 4YR2A 4OQJA 3NL0A 2CNNB 2MGZA 1GX6A 1DAXA 2RU3A 3TEHB 3TVZA 2ZBRA 2XLJA 4L6V3 2LEPA 3RBEA 1FESA 3P6YC 1SH3A 3AAWB 1HWIA 3WIUA 2KG1A 1HR0J 1V5VA 1NSQA 4OHZA 1Y7PA 3KXDA 3KOAA 3G6YA 2DGUA 3DI6B 3HO1A 1D9AA 3IAS9 2PDAA 4C0BA 5KG7A 4X62J 3HSDA 2I9SA 3W65A 4KGKA 1J5OA 5L9NA 1IWGA 3C66A 1IUJA 1R89A 2PA3A 1NK6A 2CG4A 2PO4A 2W9BB 3I55S 2KT5A 3TNVA 2NSBA 4MK9A 4B3SJ 2LU1A 1GQEA 3ZZUA 3R5AA 1Q5YA 1U2RA 2HYIB 2CQHA 5LOQA 4DR5F 1R8BA 1RLDA 2HGMA 3EM1A 3W5YA 5AXMA 2ERRA 2BE2B 2H51B 3DYAA 1VQ5S 1VQ6S 2FC8A 5I42A 2DH9A 2H5JB 3HSGA 3J7ZT 3CO0P 1H73A 3D0HE 2AJQA 2CNOB 3OUYA 3GFZA 1PGZA 4LF4J 2FHJD 1TFYA 4ED3A 2R42A 4C11A 1JK9B 4HACA 3GV8B 2DHAA 3GV7B 1JX4A 5KT7A 1VQMS 4MK7A 2BJDA 1HQEA 1FWLA 4WTYA 2YKMB 5GAEI 2CQ2A 3VF0B 1JLGB 4IR9A 4FYXB 1VMBA 4J9RA 1DLOA 3WC0A 4FXVA 3T1YF 5A76A 1YJNS 4ZP6A 1FDDA 3JB9k 1KQGB 3N6NA 2IJFA 2AJ1A 3WX8A 1CQMA 2YQ0A 2JFKA 5F8IA 4B3MF 2HQCA 2VB6A 4IDKB 2W2QP 4AL6A 3RG6A 3UNYA 2W2PP 2XO6A 1DY3A 1RWUA 3PW2A 4QCLA 3M2VB 1SQFA 4WFZA 2CFXA 4F4YA 3W66A 3D5MA 4QWBA 2KN4A 4ZPTR 1UPMB 4OYBA 2QLBB 5HP1B 2HQDA 2HHPA 2I6WA 1SKWA 3BQ2A 4GC7A 4RNFA 2W9BA 5D15A 3PYFA 4J9NA 3H5YA 1S48A 1U45A 5B0CA 1N4LA 4L72B 4M5JA 1FRHA 1ZAXA 2O5DA 4LIRA 3VHQA 1VI7A 5HANA 3R3TA 4C8MA 4ELTA 4RX6A 2HBYB 5LSOA 2DR7A 3BGRB 1JJCB 4ECYA 2ASDA 3DLBA 2D3UA 5JXSA 2V4QA 2P9GA 3QZ7A 3DDNA 4OX8A 2UXDJ 4ES1A 5DDPC 4ILLA 2HNDB 3J7A1 1VQ9S 3HVWA 1P27B 2YKMA 1WEZA 4TY9A 4X4TA 4DN9A 3BYPA 4DS5A 4LREA 1QUVA 3RGIA 3FRYA 5C2CA 3O5TB 1CSJA 4U7CA 4RNMA 2DGXA 4RW6A 2FIUA 4ZCIA 3HT0A 3S7RA 1FA0A 1OPIA 1FXLA 1SKUB 2E1PA 3DLKB 1S9GB 4JV2A 1QVFR 3ZZRA 2G4BA 1NKCA 3GJTB 4JI8J 4IDKA 3EGVA 1S9EB 1JIHA 5IZHA 2R3VA 5D8HB 5J1PA 1GMWD 1U48A 4QW9A 4XPEA 3PFEA 3JSYA 3M2VA 4U95A 3DXSX 2MLYA 4N7TA 3KG1A 5HP1A 1SJQA 4ECXA 4ZIWA 2ZH2A 1YTYA 1NHUA 4UOHA 2RILA 4TN2A 1NK8A 2KRRA 4AE5A 3MUVP 3D6FB 4RWWA 4ZCKA 2LKZA 4JYAF 2MDAA 5B7WA 1HWKA 1NEEA 6AT1B 1M1GA 4I6YA 3T6JA 1RTZA 1CVJA 2HHSA 4WWSA 3D6HB 1CC8A 4FBUA 1WTFA 1U1KA 4D3GA 1HI1A 3GFYA 4HDGA 5GAGI 2P8IA 2XC9A 4MJKA 2B9WA 3BYRA 3GYGA 5A6WA 5A0YA 5D0RA 4ZKAA 4HHUA 3PM9A 1IKVB 3UVJA 4OYXA 3MEDB 2HNDA 4NX9A 2QFJA 1SUQA 2DT9A 3VQSA 2KU7A 3JTPA 4FVMA 1FKOB 4QQBA 2EFPA 4PG7A 3OSPA 2B4PA 2DRBA 4P7TA 2D41A 3DHWC 3TANA 4CDIA 2QRRA 4UOCA 3GU0A 3Q86A 1OSDA 1HW8A 4YDXA 1U1LA 4W4MA 3UI3A 3DLKA 3LWMA 2MZTA 2F8EX 4PWDA 3CD7A 1YI2S 3M2UB 1H2VZ 4G1PA 2OIHA 3N4WA 2DPIA 1S9EA 3IN5A 4MKVA 4X4VA 2PMHA 1N88A 2WONB 3I9V9 4C0OC 1V5IB 2DGOA 2KRBA 1SQEA 3G6XA 2MKCA 1HWLA 4ZJLA 3RBDA 3W2WA 1UVJA 1OY6A 2DEIA 3V6HA 3T1YJ 3FBFA 4IYQA 2X1FA 3HK2A 5KFUA 3D1QA 5CCLA 3AA9A 1LWCA 1WEXA 3T5KA 2JLEA 4WK1A 3D7SB 4B3MJ 1K73T 1T95A 2UUTA 1TK5A 2XMKA 9RUBA 2E7XA 5HBMB 5C25B 1KQSR 3B4DA 2EC2A 5ETOA 4RLEA 3PJWA 4Q43A 2PFDA 1HBUB 3I87A 1M5HA 5HK4A 3CD0A 1VC5A 1AW0A 4RW9B 2Q1LA 2DD8S 3HZEA 4ZPDA 4LF8F 2GX8A 5HL7Q 3OHAA 1IKVA 1WC5A 2RRAA 3MEDA 3M8PA 3BGLA 2OEMA 2OLWA 3Q83A 1VLYA 2MEWA 1Q7YT 3R1LA 2CDQA 1FKOA 3D6TB 3AB4B 1TKZB 5AE3A 3UWTA 5K20B 3OTBA 1S5ZA 3LP1B 4AT1B 3OTCA 4F4KA 1QSLA 3HDSA 5JJBA 3TZZA 5LM7E 2CQCA 2YQ3A 2FQQB 3ZNUA 3KJVB 4L73A 4DL5A 3QLHB 4PWWA 2Z58B 3UCZP 3GSDA 1EETA 1ZPVA 1Z2ZA 1LEOA 2HHVA 3M2UA 4NL5A 2QX0A 2HHHF 3MM9B 1FKAF 1SL0A 2VUGA 3GB0A 4LRBA 2KO1A 2DY1A 4CYUB 4FNHA 3KWMA 1FXDA 2FHJA 2XBPA 2WONA 3MDFA 1MW7A 3CDEA 4C2MA 1RHKB 3R9LA 1Q95G 4ZCMA 4DCJB 1RWVB 2M3DA 4AL7A 2AEJA 3O6QA 2ZH1A 2B51A 4DSKA 4JI2F 1D8YA 1DARA 5HMWA 4ED6A 2HFZA 5KFAA 4MMOA 3J7YU 2Y1JA 1P8GA 4CZCA 2JOQA 3A8KA 3KUEA 3OBIA 2HS4A 1IKWA 5IXUA 5HBMA 5C25A 3W64A 3AHPA 1HBUA 3GIKA 2MYFA 2ZNZA 3A3OB 1FX4A 4RW9A 2R8IA 2V69A 3AOCA 4W92B 1O51A 3M8YA 4DR4F 4RPFA 3NWRA 1PG5B 5DM7Q 5J1NA 1Z2LA 1U8WA 2RIJA 3OQ2A 2IIHA 2J7WA 4I4BA 2UVWA 1QY7A 3QT6A 2LA6A 4JYAJ 3OL8A 3IWLA 3X1LB 3MUMP 1T3OA 1TKZA 1A6LA 4KHMA 2J6SA 2ZH8A 3AODA 3BH7B 3LP1A 1FX2A 3M2RB 3BJYA 1BWEA 1AA1B 2MHNA 3MM5B 3K89A 3KJVA 3EUNA 3QLHA 4WU3A 1XBWA 4OIXA 1RACB 5D0HA 1RTIB 5KFPA 3HJFA 2XSJB 3MM9A 3NNHA 3PW5A 1VYAA 3J7Z5 4GO7X 3QO9B 1CBKA 4CYUA 2OGUA 2C3UA 2IJRA 4O44A 3BR8A 1OY9A 3N6LA 1IKYB 1HIYA 3R7NB 2ZUAA 1U1MA 2EBGA 4K4XA 1H98A 4DPYA 3QWPA 2B5JB 3TZWA 4Y2AA 1F2HA 2AD9A 1LK7A 4X4OA 1YBUA 5KFOA 3PJ9A 2YH1A 2F9JA 2V4JB 2ZBPA 3OFFA 5E3QA 4TKTA 4C7QA 3ENAA 1U6BA 5M2RA 3LALA 4RBUA 4ZPAA 2G1HA 5DETA 4HL9A 4QOTA 1T9VA 3UD3P 4QW8A 2ALZA 4DPOA 2CPEA 3OL7A 3D6MB 3RRHA 1UKUA 4QR0A 3TAMA 2KDOA 2CA9A 4LIWA 4NCGB 3P49B 5DGBA 4J9LA 3TJ8A 1D1UA 1FE4A 1DQAA 2UVRA 1X9WA 2HGNA 4PG4A 2DGVA 3C15B 1TAQA 1Y3JA 1S6QB 2QSWA 2C28A 3HF5A 1I6JA 5G4DA 3FUYA 4UZBA 4PR6A 4WFNQ 2CZ9A 1X9MA 5JMNA 1MU2B 3D68A 3HVAA 1KR4A 4DFKA 3E01A 2WCXA 2ZFHA 4K4SA 2BQUA 1FCAA 2FVCA 5DQGA 3DLGB 3VR1A 4F4ZA 2HVIA 1RGVA 3GWCA 1B0VA 3M2RA 1IBMF 3MM5A 4S0MA 5HROB 2XNQA 1Q82T 2YX4A 3KDOA 4RNHA 4FF2A 2OFGX 1FRXA 4X84A 1RZMA 4RBVA 1J27A 4LF8J 1R0AB 1TFWA 2H5IB 2XSJA 4ZVPB 4V19J 3OXGA 5KTQA 4J9PA 3QO9A 5KFRA 3ZZ0A 1FDAA 4DPTA 1Y0HA 5JVGQ 3D0IE 2XEXA 1IBLF 1IKYA 2AT1B 2OELA 4RW4B 1B99A 2OHDA 2FVQA 3IXQA 5M2PA 4HYKA 1YZ7A 2B5JA 3NGTA 1NBEB 4JB8B 4USWA 3F44A 3O1LA 4QU6A 5EGYA 3TO8A 3BGOP 2HIQA 4QIWD 2YQ1A 4LFAF 1DURA 2XMUA 2OKQA 2V5HG 4HI2A 2OPPB 3PHEA 1TR0A 3RAQA 4K5RA 5KG6A 4NCGA 2M9KA 2PIIA 4OL8A 4NLOA 3QIDA 2ZH7A 1TL3A 4IH6A 3OPKA 5MLCV 2KFZA 3C15A 2CQ4A 2XLKA 4XDDA 1UWAA 5HSPA 4J90A 2VQFF 4I64A 4JI2J 1FDBA 3K8VA 3VQTA 1R8AA 1UW9A 1SL1A 4BDPA 2Q66A 2DRAA 2NLWA 5GADU 1MU2A 2VZ9A 4YS2A 4YY3F 4USMA 3TRGA 5KG3A 3FBBA 1ZYQA 2LQJA 3DLGA 3PV8A 1KVIA 1DZ5A 5L1JA 3BSOA 1KLMB 4EZ6A 1MMNA 5A8WB 3KLIB 1NJYA 1RWWB 5D4OA 4DLGA 2KKHA 1OYEA 1BUXA 1U25A 1FWPA 2EKNA 2OTJS 2W9CB 1OO0B 1RQ0A 4OJ1A 4DR4J 4CWBA 1NPPA 1MSWD 3NEKA 3RJMB 2ZE2B 4OZLA 3HJVA 3K2YA 1WC4A 2FB0A 4EEYA 2HRTA 4Q2LA 1Z4UA 2V50A 1NKEA 2PSZA 3EXYA 2XULA 1HQ2A 4WE1A 2CJQA 4RW4A 2UXBF 2IVFB 2IJNA 3EX7B 3MMBB 2DIVA 3I5BA 2XYGB 3TA0A 4USTA 3MMAB 5CAAA 4J9MA 4DR2F 3DXBA 2AYEA 2BRLA 2FDNA 5HLFB 3IO1A 1MG7A 2JLGA 2J7UA 1QAJA 3TQEA 3P3DA 2LQ5A 2Q43A 2OPPA 1PAUB 2DKOB 4XO0A 5E3CA 2YX7A 1TL7B 5D4PA 4CLTA 2MQLA 2J6UA 4OI2A 1UVKA 3AJ1A 3NP5A 5EUHA 4CLPA 4B3TF 2YNFB 2POKA 2IFXA 3RB4A 3NNCA 3BH6B 4DPWA 3I96A 3IA0A 3BR9A 1NK0A 1RWXB 2MY7A 1BQMA 4CLYA 4B9MA 2PEBA 4CRJA 3PRVA 4ZCLA 1PAEX 4ECQA 4PAAA 2FLNA 4DV4F 2MKIA 1F60B 1RAJA 4KGXB 2XLIA 2CPZA 2YX1A 2VQEF 1HD0A 3KK1B 1KLMA 4GVLA 5A8WA 3I32A 2AHOB 3KLIA 4F0MA 3CCES 2ATCB 3NS7B 5KG0A 5L1KA 1RI7A 2GVDB 2W9CA 4M5IA 4M94A 4Q8EA 4IG0B 3DU6A 2RD5C 5AXLA 2DIUA 3VAKA 2ZE2A 2ASYA 3IWNC 1QSYA 4WP8A 2OH2A 2Q79A 1RE1B 2DK2A 5FIIA 1RP5A 2R9LA 1YJUA 1B4SA 1TUGB 1S9FA 1BQNB 1G6BA 4FZVA 3LF0A 1WG5A 3LA0A 4O3NA 3BO2A 3MMBA 4WIQA 1T9TA 2E5HA 3MMAA 3AD7C 1IBMJ 2X1AA 2QLWA 4KHRA 3JSBA 1FRKA 3TQ1A 2HMIB 1NXIA 2W2OP 3DCAA 3HHLB 4X4QA 4IRKA 3O44A 3PYEA 2DR8A 4PCQA 2HRYA 1HQUB 1BD6A 1R27B 5HLFA 4MKAA 4DQPA 5D4NA 1M0SA 1R0CB 2L9WA 2LCWA 4LRAA 1RAFB 2DNRA 4OI3A 2V67A 1TL7A 1TQLA 4HLBA 2EEYA 3UDEA 2V6AA 3MD3A 3MEKA 5D0GA 2ACMA 4RU9A 1TVRA 3ZO7A 3MTKA 5THWA 5DQHA 3NLCA 1VQYA 2DISA 2CPXA 2ILZA 4OI6A 5KFZA 2FC9A 4KPCA 3HLUA 2I5JA 3EXCX 3IWXA 1C1BB 2DCLA 1VC0A 5KFHA 1UCNA 4WF9Q 1KWMA 1RT5B 3CDUA 4LR8A 1S4FA 4ZPCA 1DFDA 4LFAJ 3BGFA 2RQ4A 3KDNA 3AQPA 4A8WA 2CJXB 4C8KA 3I0RB 4OMFG 1VC6A 3CF5Q 4WU2A 3C6TB 3KK1A 1UL3A 2YWWA 4ES3A 3OFGA 2AZ1A 2XTJP 2XMMA 1NB7A 4CLSA 1AFJA 4R8UB 1IXKA 1PIEA 3IMQJ 3VGUA 1NDCA 1QTNB 2FZCB 4M5GA 4IG0A 2ZHOA 3PACA 2RH3A 2MJNA 2H54B 2X7IA 3RR7A 2BJ8A 1M5KC 3RTVA 4DR1J 1YIJS 2R7XA 4B02A 1ZA1B 2IVYA 1APSA 4NXNF 5B0GA 4PG5A 4WZMA 2B9EA 4YY3J 1RTDB 2IDEA 2VKZG 3MPYA 2EC0A 4NYZA 5IS2A 3D4JA 5E3AA 4R0JA 2HMIA 2FHMA 2FLPA 3PVXA 1HQUA 1WF1A 4PEOA 2DB1A 3QRPA 1H6KX 2DHSA 1M1HA 2V8HA 1P1LA 1N6QA 2KFYA 3GONA 1RABB 3DRRB 1VBZA 4FYYB 1N36F 2RJZA 1QVGR 2QLFB 1XWLA 1SC6A 2XWYA 3QT7A 2K3KA 2UVVA 3J81U 3CCLS 2UXBJ 5FLXU 2YNHB 4HKQA 2MKKA 4OX6A 3CCSS 3JYTB 3IS9B 3PX0A 1SCJB 4WK3A 1C1BA 1YVFA 4DR2J 4USHA 4XPCA 3BBBA 2XI2A 1NK5A 2DTJA 2XGQA 1RT5A 4UUXA 5HQMA 1WD6A 3ZZYA 2MZJA 3I0RA 5J1EB 2F7VA 4IOCQ 3UW1A 4NASA 1U49A 2M70A 4NPOA 4R8UA 5IC4B 2A2DA 4B3TJ 1KFSA 4I6WA 4I1TA 2ZH6A 2R2RA 4FVCA 4PG8A 1V3SA 2V8DA 3TEGA 5KG2A 2X3DA 2HHUA 3G8QA 3M8QB 3ZC4A 4OYIA 4N56A 2V8VA 1QLNA 1E6VB 3DLEA 3OSNA 2HHTA 5AJ3F 3PXGa 4DV4J 4O4RA 1TMJA 1UPPA 3PG9A 2DBBA 3TARA 2LXIA 1LFPA 1AXQA 1WACA 4X65F 2J9EA 5K14B 5IC6B 4GC6A 4J9SA 1SKRA 1UVMA 2ZC4A 2VFRA 1U26A 3W5XA 4F02A 1S79A 4CO2A 3DRYA 3TW0A 1YHQS 1PO6A 1U09A 1KDNA 2RDIA 3DRRA 3EWGA 1TV6B 3LQVA 5KFWA 2W1BA 3VWSA 2MQ8A 3SCLE 2JSXA 1JXVA 1UTAA 2W8KA 2RS2A 3SBMA 2J9CA 5EHHA 3P5BP 2R2TA 1WNEA 2YNHA 1LXNA 4B9LA 2L3MA 3US5A 5D3GB 1T03B 1ZM3A 1V3ZA 3QGPA 4DOZA 3JYTA 3IS9A 1U6FA 3RYLA 4X4RA 1RSCA 3OR2B 1ELOA 2A2CA 2G1DA 4J5OA 4P7VA 5CA5A 2R2SA 5A8RB 2DJWA 5FDLA 3S8SA 3CPWR 3DM2B 1LWFA 3ETMA 4NLQA 4U6PA 2OPSB 4P74A 3PYDA 1HHQA 3GR1A 2BXJA 2I8EA 3FKBA 1UEVA 2E5JA 2J5AA 2B4VA 4Y2KA 4OYWA 1K47A 4OYZA 1YJWS 4RBTA 4AFFA 4CO4A 3AQOA 3RZAA 4U7UD 4KBIA 2XI3A 2DXFA 3QSYB 2FUG9 2GIQA 5KOXA 5KAKA 1LNQA 5C24B 1NRKA 3M8QA 5IV3A 1BHNA 5K8NA 2CVEA 3FMWA 2Y9HA 1E6VA 5KFVA 2DNHA 4I68A 5ETPA 1U2FA 4ZN1A 1X0FA 5HQLA 2QE5A 3POTB 3NAIA 2NPFA 5EWGA 2D74B 2VPZB 3GSIA 3J81Y 2WW8A 2JFDA 1S12A 5K14A 3WX4A 2QIFA 2ZHAA 3N0VA 1QDUB 4OJHA 1V9OA 1XNQJ 3N28A 1RA7A 3G9CA 2ZC3A 2HQIA 2LXUA 5LMNF 4TU8A 3KKFA 3J81j 4F8RA 2DYAA 2Q3PA 4PXBA 3H98A 4NXNJ 1ZA2B 3GCWP 1HNZF 2MQQA 1F1BB 2B4OA 2OUGA 1UVIA 1U7LA 4B9SA 2QL9B 5D3GA 2GS8A 1OS5A 3QSIA 3SCIE 3D66A 1BWVA 4OV1A 4LSNB 1EIYB 5A8RA 2BABA 3CJ5A 2X1BA 2FJBB 3SDEB 4NRUA 3TAQA 4JV5F 3GYXB 4EU0A 3SXLA 3DLHA 3QGGA 1S1XA 3U1NA 1N36J 4B9VA 4M5KA 3N5BA 1SV5B 1XTZA 1IR0A 3DLJA 1ROFA 4JI0F 2QL5B 3RBXA 2QEXS 3W60A 3ZTQA 2F3JA 4K4UA 1FJGF 3FCWA 5GAHI 3PDNA 5C24A 1RJJA 4PPZA 2BANB 1QAXA 2QJ3A 3QZ8A 4G1QB 4NCBA 3I9ZA 3POTA 3FMBA 3ENVA 4C6AA 2AWZA 1JQGA 1Q4RA 4I67A 4DZDA 1WSVA 3Q8SB 2ADBA 1SQGA 5KFQA 3MD1A 5JVHQ 4NLYA 4LQ3A 4XDCA 1VQ4S 2AJ0A 5KFFA 4DS4A 3H5SA 3I0SB 1IR2A 1IN0A 1S0OA 4OHWA 2DXEA 3C8YA 2XCAA 2AX1A 2IPOB 4KY3A 2CQ3A 1BLUA 5AJ3J 4WTOB 3H0PA 4X64J 1X31C 3AXKA 1VK3A 3IP0A 3MMJA 3TJ9A 1QE1B 1RTHB 1EZZB 4X65J 4KHPF 4Z2XA 4O0IA 1RCOB 4LSNA 1B0TA 3JQKA 1JLEB 2GZOA 2UUAF 5GVQA 4DV6F 1WTBA 3B82A 1ITPA 2OAUA 3SDEA 3NGRA 1IJFB 2APOA 5DRKA 1FNMA 3X3UA 5F8JA 1AUSL 2ASJA 4NA1A 1NCLA 3EGWB 1CJTB 3NMRA 4A46A 4FKYA 1SV5A 1VRTB 3SFGA 2ROPA 3G4SS 2KXHA 4ZITA 1Z1ZA 4FF3A 2W7PA 2EFNA 4YB6A 2KHCA 4YB7A 4DPXA 1TK8A 5HVHA 4LSLB 4QWEA 2DNGA 2VG6A 4ZPVR 3OW2R 3I56S 1JLQA 4G1QA 5HQ8A 1H74A 1NJIT 2COLA 2NCKL 2LMIA 1HBNB 2F4VF 2YWFA 3CJKB 4DLEA 4LF5F 1T9WA 3GFHA 3CMAS 2CKWA 2Y1LB 3CVKA 5IM0B 3FFIB 1RU1A 4U8VA 2VFVA 3U27A 4IQMA 1SB6A 2A18A 5ETNA 1HWJA 3K5NA 1BE4A 4DUZF 3I0SA 1X5PA 1HMVB 2HVEA 3Q89A 3LAKA 1PJ5A 2HVHA 1PKUA 4CH1A 4DX6A 4WZQA 2CNLB 1TKDA 5K8MA 1GH8A 2DNLA 1RADB 3PKYA 2KFNA 1VQKS 4DI6A 4OHXA 3QRRA 4X4NA 4F3OA 1X4DA 2MQPA 1HBOB 4NZ0A 1QE1A 1S1VA 4U9RA 3VGSA 2VPXB 1N5TA 3RU0A 3K5OA 2F8HA 2NREA 1U1PA 3FZ2A 1M5OC 3CCMS 1ZTWA 4ZVOB 4A8MP 2ZD1A 1AZSB 2CQ1A 1S72S 1MWYA 3M8RA 1EQMA 3VALA 3VTIA 3ZXWA 2ROGA 5LMNJ 3UNGC 2EPIA 5KT4A 4I7FB 2AEMA 3M7VA 3QJJA 1WHXA 2KM8C 3CD6S 1VRTA 1DRZA 2ZJPQ 3MCOA 2E44A 4CLLA 3EZ5A 4OZNA 5J2MA 1T11A 3WC2A 4NRTA 1S0VA 2AQ4A 2ZJRQ 2OFHX 2XMVA 4X66F 2WBRA 4JUZA 1R8HA 4LSLA 2WVCA 1LW2B 1WHYA 1X4EA 3PNIA 1N8RT 2VOOA 2RUSA 2HKEA 4ERDA 1HBNA 5A2QU 4ELVA 4FP9A 2V4RA 3CJKA 5AE1A 1UA1A 4GKJF 2XGPA 4JV5J 1N54B 4C8NA 1K9MT 4ILRA 2WVFA 4C97A 2E1AA 1RT6A 3CW2C 3CCQS 3FDSA 1KQKA 1FEEA 3Q24A 4JI0J 4ATNA 1EKRA 3DGPB 5KFJA 1RCXB 1FJGJ 1NPKA 1S6PB 1HMVA 3ELHA 3OL6A 3L4BC 2HQGA 3CT9A 4BBYA 2HFSA 2WSEC 5L46A 3A8IA 1FDNA 4JI7F 3DKDA 3UDVA 3C6UB 3Q23A 1HL6A 1ZH5A 2FY1A 4UF4A 1SIWB 1VOMA 3VAHA 5G0RA 1DJ0A 1HBOA 3QATA 4FDFA 2LECA 3R1HA 3IAM9 3KLEB 3KUHA 5T14A 5B0FA 3UDLA 2HQ3A 3Q22A 2GQ2A 4FPRA 3EE3A 3T5JA 1AZSA 4USVA 1K1SA 2VBWA 2JEIA 2H65B 2JDJA 4C3MA 1TK0A 4I7FA 1RHRB 2H48B 4LF4F 1RTJB 3KMSA 2EW9A 3KTQA 3BV8A 5I3QA 2D1CA 4KKOA 4DPUA 2RDJA 4DL0C 1NPRA 2UZAA 3G86A 2LDIA 4KGVB 1KNZA 2QYCA 4ZP7A 2CQDA 3KJFB 1WUUA 4ZHRB 5BYRA 1R6YA 4KHPJ 1LW2A 3ZTRA 4B3RF 1FWKA 3FEZA 4QR1A 2UUAJ 1TL1A 1SVDA 1N48A 4DV6J 1GTHA 5F8HA 1S0MA 2CZVC 3B4MA 4KC5A 2GIRA 3CE8A 1MLAA 5DJBA 2KT3A 2ACYA 3HVTB 1I1GA 2DR9A 2FY8A 2YXLA 2NQPA 4Y2IA 2ZOFA 8ATCB 1S6PA 3NRBA 1FKPB 3E51A 4CTAA 2VL1A 4DV2F 3BN7A 1VQ8S 2R8JA 4OHVA 1Q78A 3U1MA 1HBMB 1KHWA 2A10A 2BOAA 4BWJA 3E3XA 1K44A 2B6AB 2JVRA 2ROEA 3UR0A 3NS5A 3C6UA 2F4VJ 2EWHA 3R7BB 4RJVA 4LF5J 1WJ9A 1U6ZA 3WDOA 5KG5A 3W8PA 2K1RB 1P9YA 3KLEA 2E1RA 1U0SA 4LF6F 1WEYA 3CTRA 2GJ2A 5F8NA 3H5XA 1CQNA 3G6ES 2CXEA 4DUZJ 2CPDA 4DXLA 3AD9C 3KFWX 1LW0B 2JLFA 6FDRA 1G3OA 2Z8QA 3EGZA 4LMZA 4QZVB 5I3UB 3W7BA 1FEHA 2BOPA 2HFVA 3F56A 3K59A 3Q8PB 1JLAB 3FEXB 2E5GA 1RT2B 1L3SA 4C0HA 5T41A 3GILA 3GPAA 2J9DA 4FBTA 1CPZA 4UT4A 2CADA 4A4JA 3P4UB 2HEKA 4HH0A 1NKBA 3OHBA 1F3VA 5BJRA 1H2TZ 2WOMB 3B8HA 1VJWA 2G2OA 3UE2A 4LSZB 2AEFA 5D78A 1N5QA 2C2RA 2HK2A 2BKNA 3M8ZA 4OZ0A 4K7QA 5L39A 4QYZJ 2ZDPA 2R7VA 1RAGB 4CO1A 3ICLA 1FKPA 3LGNA 1HI0P 2UP1A 3I82A 2JL9A 2XMAA 4X66J 1LKZA 2A3JA 4URQU 3TI0A 1Q0NA 2QO3A 1S97A 2CPFA 2Y8YA 1PILA 2ZJQQ 1RKJA 1C0UB 1SKSA 2DGQA 2RT3A 3C19A 4GKJJ 4C8LA 3CUNA 2CPJA 2PI4A 2DR6A 2K1RA 2J8SA 2QA4G 3QIPB 4YR0A 3PIPQ 1C4AA 3SV4A 4H4KC 4YUDA 2RQMA 4DL7A 2HNYB 1FI4A 1GAOA 4CH0S 2CJAA 2BRKA 1JJ2R 4NLTA 1Y9OA 3M1VA 2XS2A 1LW0A 3VAGA 5F3TA 1T94A 1HARA 5I3UA 3IR5B 2RB7A 3LH2S 5IT0A 2L41A 2DGSA 1JLAA 4RWXA 3DRPB 2QMUB 4JI7J 1RT2A 2HRUA 2HLUA 3DDKA 2ZVSA 3K57A 1T05B 2LA4A 4LR9A 2XO7A 3LUYA 2G0IA 4MIWA 2J0WA 2MKJA 1ZM2A 5IQ6A 3L7UA 3D3BJ 3F0NA 4EFAC 4AQYF 1H7WA 3MM7B 4OJ3A 3HX9A 1FO1A 1F9HA 5ETMA 2WOMA 3LTOA 2BKPA 2QA2A 4HHHA 2BR0A 4QYZK 3NOGA 3L9ZA 2CNKB 1UAWA 3AJDA 1H7XA 1MMDA 3UCGA 1VIOA 2DNQA 3GR0A 2IBKA 3UN2A 5B09A 1L5UA 2DEJA 4RUHA 1DQ8A 2ABYA 3ZTOA 2VODA 1FJ7A 3LP2B 3S1TA 1VQOS 2O3DA 3ZZZA 3DOLB 4B3RJ 3H90A 4OX9F 3HP6A 2BV3A 2HZCA 2MZ1A 3SIPB 2GO8A 1S7IA 1QM9A 4NLGA 4NXMF 1XR7A 1FF2A 5CYQB 1FTRA 4B9NA 1FVQA 1RHQB 5ETVA 5E41A 5DQIA 5F9NA 4LF7J 2YKPA 2E9RX 3MAAB 4QBUA 2LQBA 3DI6A 2GNKA 1I94F 1GXTA 2FYXA 2HVDA 4KH0B 3PX6A 4DV2J 1DTTB 4ID5B 3EZUA 4ZIVA 2SXLA 3HT3A 3KHRA 3BKFA 1REVB 1CJVB 1IQTA 3M6WA 3P96A 4WXWA 1D0EA 4WFBQ 3V81B 1WG1A 3GJRB 3DRPA 1T05A 4CNZA 1S59A 5LMUF 4JV0A 3PTWA 3VAFA 4DSJA 3NGKA 3CJ3A 3OVAA 4LF6J 2XY7A 3GIIA 3PEHA 4B3OB 2BE2A 1LOUA 2W4CA 1O6XA 3VGVA 3QT5A 4K4ZA 5I3PA 5HJXA 2R7WA 5KFEA 4DCPB 2NR0A 3EJMA 4HTJA 2V94A 3G71S 2BJ3A 3G82B 4UQGA 1EJ7L 3W9IA 3G8SA 2VJUA 2CVIA 4K4WA 4USKA 4MKYA 2MJUA 1BXNA 2EI5A 4LJMA 4PQUB 2UUBF 4Z7CA 5MAOA 4AXIA 1JLGA 4ED4A 5HJYA 3N6MA 3LP2A 3TUIC 5GMKa 2AJ2A 4WBFA 2Z2MA 2X3GA 4LFCF 3DOLA 1H0HB 2K06A 2V2QA 3R27A 3G6VA 1YK9A 2XY6A 3VAIA 4K59A 2IVMA 4IR1A 5IWAF 1D09B 3CO9A 1JXLA 5E3PA 4WFAQ 2BMBA 3J7YI 5CYQA 4TU9A 2R8KA 1YRXA 3MAAA 3M05A 1C1CB 2GHVC 4MK8A 1NU4A 4I0WA 2ALYB 5L8RC 2N4CA 4OLOA 9ATCB 3IGNA 1DTTA 1XC9A 3ZTPA 1REVA 1CJVA 3HFZB 3FC9A 3HSZA 1GT8A 3GE9A 2ZWPA 2W01A 3DN9A 1Q8LA 1VQNS 2ZWOA 1ZM4A 1AROP 1WKKA 4KQZA 4FS1A 4Y28C 4BC7A 2IYGA 2LVWA 1NJWA 5EDWA 4Y3CA 3ITHB 2OI2A 3BQ1A 5HO4A 4BHQA 4H54A 2Y1RI 4DV1F 4B3OA 3DRSB 2DO4A 1IBCB 4ZVTB 2C1EB 2IRUA 7FDRA 3BGRA 1MNEA 2DITA 2QTWA 2BE9B 3D3CJ 5KFMA 2ZH9A 3QPIA 2FGOA 3BF4A 4UZCA 4F26A 3FSIA 2F40A 4ZLJA 3TWZA 1BY9A 4NOHA 4DX5A 4PQUA 1MWQA 1VHIA 4JI5J 4DX7A 1IWAA 4CI0B 4P2XA 3QBCA 2EG1A 2JVOA 2HBZB 5DO2A 3NGDA 4AQYJ 4CM2A 5E7OB 1S9GA 3K58A 3FQKA 1FTCA 2GW8A 2UXCF 3H59A 1R0BG 2XQCA 2W7OA 2ZH4A 3BSAA 3DRXA 3J7AN 3SZ2A 4LUBA 4DFJA 5IT4A 5B0AA 3PFOA 2YNGB 4JI4F 1RT4B 1N5VA 2E1MC 2HWTA 2FHOB 3MMCB 2NSCA 1FRMA 3PW4A 4PG6A 1FVSA 2PT0A 2MLZA 3BBCA 4OX9J 5F41A 4NLVA 4IFYB 5CHCB 4LFBF 2M0GB 2JC0A 2E5IA 4NXMJ 4X4SA 3PRDA 3PKMA 1R6VA 2YKAA 1OYDA 3GQCA 2ATLA 4B9TA 1EQ0A 3BKTA 1C2PA 2RRNA 2GO9A 1I94J 3QGHA 4ZVHA 3BO4A 3D9BA 3Q2SC 1LQ9A 3TP2A 5KFKA 1S1UB 2HAIA 5CYJA 5DLFA 3RW7A 1I5OB 2JWNA 4YMEA 2CAJA 2VA3A 1VHFA 3MGJA 5LMUJ 1D3WA 4USUA 2IM0A 2YNIB 3CCTA 2P5VA 3IG1B 2ZZNA 4TLRA 2L48A 4Q2MA 2V9WA 3QAUA 1VIXA 4Q8FA 1H2UX 3OJSA 4LRFA 4WPAA 4A8OA 1VS3A 1NK4A 1GK8A 3ENWA 1FK9B 2FVPA 1UWBB 2XMJA 3ZZTA 4M1KA 3R5CA 2VC0A 3PR4A 3BM7A 2PGCA 2YNGA 2UUBJ 1RT4A 1WSRA 5J2QB 2KVIA 4PQAA 3B78A 3GTYX 4C3LA 3MMCA 2I0XA 2HWIA 2CPHA 2HAFA 4MAKA 2RAQA 1GX5A 4PKDB 1RHUB 3OV7A 4YDDB 1Q5VA 4EBDA 3NCRA 5GAHU 2MKYA 2CPYA 4LFCJ 1GMUA 2CJKA 4URSA 4DFPA 1KHVA 4UY8T 3ILIA 3C3LA 3UN5A 4USJC 3SEOA 5IWAJ 2RKIB 4GO5X 1Q81T 4FF4A 2R7SA 1R3NA 4P2SA 5HI7A 5F0UA 1ZBTA 2R8HA 1XMOF 1S0NA 5HMXA 1B64A 4HVZA 4YB1P 2VV5A 3EPGA 4QYRA 1YSJA 4WFXA 4LQ9A 3ILLA 1BC6A 3AH6A 3UN3A 2EVZA 3HFKA 3MXHP 2VFSA 4WXOA 1VLOA 2HWHA 4U96A 1FRIA 1N52B 4KH1B 2IMWP 1WHWA 1UFWA 3MEEB 4DL6A 2MKSA 5D0EA 2YNIA 2ZKUA 1VBXA 2X1GA 3CJ2A 3KG4A 1LWXA 4O3QA 4NLSA 4KRWA 4DV1J 4XK8C 2AYGA 1JLBB 3D1OA 4ZPWR 3SSRA 4O3RA 1CLFA 4HI1A 1NM2A 4A8KA 3KNAA 1FK9A 2KXNB 4KTQA 4NYPA 1UWBA 5KFCA 1NH7A 1IM4A 1YZ6A 4G65A 2EFVA 2RMLA 1OY8A 1S99A 2JEFA 5EWFA 2PMZD 3MFHA 4PXCA 1V3RA 3BQ0A 3BSCA 2D3ZA 3NGUA 2O67A 5J2QA 1FHTA 4ECVA 4FF1A 4DMZA 3OT9A 3CCRS 1ULRA 2DNKA 4RW8B 2BUNA 2W2NP 3P5TL 4J37A 1N5YB 3RAMA 1JKHB 4ZVGA 4LBHA 3V4IB 5CCMA 1RBOB 4DBQA 3PY8A 5DDRC 3RRKA 1FFWB 2UXCJ 2J9DE 4ZK7M 3RB0A 2NUHA 2C2EA 1SH0A 1SBRA 3KG0A 2BYCA 2K3IA 3CJ4A 2MLXA 4Y6IA 3IRWP 4Q45A 3T9ZA 3THVA 4JI4J 1KSPA 2YVSA 8AT1B 1KD1T 1UA0A 4DG1B 5HVFA 1WHVA 3K5LA 3CNQP 2H4WB 4N76A 3DDIA 4LFBJ 3ZNJ1 3JS9A 3SSSA 5M2UA 4BS2A 1UW4A 2KHDA 4K2XA 3MEEA 1X9SA 1YWXA 2QMWA 1N33F 2WW4A 1YRUA 3I4PA 3HHLD 4C9DA 1JMTA 1JLBA 4KJIA 4NZ6A 4QPXA 4GMKA 3MM6B 3N9UC 1YBTA 3T9NA 5CD4A 4JI3F 2OMLA 1RTIA 3GMGA 2Y8WA 1HNWF 4FN5A 3PZPA 2Y0SD 2K8GA 3LPYA 1YQHA 4NLDA 4JV1A 4FYDA 3HVRA 1R8CA 2MSTA 5I42B 2V8PA 1YLXA 3R5GA 4JI6F 2ZH3A 4FXWA 5ETRA 3VVTA 3SFUA 4AL5A 4ANDA 4HACB 2Z2LA 3R5DA 1WF2A 1Q8BA 5H1SV 4ELUA 2G9OA 4L76A 4M5DB 2GIFA 5EX0A 4WCEQ 1SC4B 1KONA 1N5YA 2V4JA 3HD1A 3HFVA 4G3IA 3V4IA 4TVAB 4H4OB 3C46A 4EYHB 1X0PA 1YGYA 1YITS 1FFGB 1U1OA 3EMTA 3HXMA 2OEJA 4ECSA 1DLOB 2Z2YB 4OYAA 3TUJC 2GVZB 1SL2A 3ZTSA 2YH0A 3CEDA 3GFXA 3NMAA 1QAYA 3T5HA 2M4MA 2NXEA 2ZDOA 2VFTA 4IUFA 4RW7B 3IBWA 4JOUA 1M5VC 2DHGA 2YKQA 2PN6A 3C16B 4DR6F 1ZAVA 3OJUA 5E3RA 3VAJA 4FS2A 3AOBA 2V68A 2OO4A 1YX2A 4EUVA 1MWZA 3CGIA 4DG1A 1S6QA 4KV8B 2BW2A 3CB4A 2JNJA 3ILJA 2ZH5A 2EK6A 1ZTTA 3VGTA 2JEGA 4DR1F 4CT8A 4O3SA 2EBEA 3GIJA 1Y3KA 1X4FA 4OYMA 2DH7A 5AE2A 2AGQA 4P71A 1PYSB 2QC3A 2D3O1 4ED5A 5KFGA 3FCHA 4LT6A 1AT1B 3VV2B 1IBKF 3PCOB 2LYVA 3GJQB 2PE8A 2AP6A 2CG8A 5HROA 1XMOJ 4CH7A 3MM6A 3L3CA 5E33A 1R0AA 1F6TA 1RLCL 1G7CB 4OI1A 2XZDB 3KMQA 1RKIA 2VDIA 3HKZD 1NUEA 4IO1A 4YN3B 3BO3A 5DLGA 3PJXA 3MAQA 1QAIA 4DL3A 4AD6A 2FZGB 2F9DA 4OZ1A 4ZDNA 2V0NA 2NS1B 2QA1A 1FT8A 5CABA 5KG1A 3Q8RB 3R5JB 1CC7A 3S01A 2HZAA 3V6KA 4M5DA 2IC3B 3H4BA 3MURP 3HSJA 3MUTP 1WI6A 3GZ7A 7AT1B 4H4OA 4A48A 5FD1A 5E5NA 2UVUA 2JX2A 5DS7A 5KFXA 2XY5A 1U8SA 2YBVA 3FCVA 3M6UA 1RYRA 1QJHA 4RW6B 2GVZA 3EGNA 5C42B 1DQ9A 3J80U 1YBAA 2PI5A 3VZIA 5DG7A 3NS6A 4RW7A 4ETXA 2E1CA 4BC9A 3SV3A 3C16A 4P52A 1RU2A 2C22A 2YKOA 4EK2A 1NK7A 4KFBB 2QLJB 4A8XA 2U2FA 1EX8A 4KV8A 5KFSA 4C4WA 2QA4S 3QQCD 2HFOA 2HZVA 1CS4B 3HMJG 5A8KB 1Q86T 4UUWA 3KUGA 2IAJB 3H2UB 3HPOA 4LVNP 1S10A 4HT5A 1CULB 2XB2D 2AJ4A 4N8NA 1M90T 3CMES 3PYGA 3IBFB 1TUVA 2DO0A 1W25A 3CJRA 1XIQA 1I3OB 1TL4A 1TTHB 4TLQA 3CCWA 2IM3A 5HATA 3TX0A 3MR7A 2XZWA 1QUPA 2B7BB 3CD5A 2A0FB 4F50A 2ZOGA 5CXTA 1RAIB 3ZFVA 2VBZA 5ETKA 4G1IA 3L09A 4CIOA 2VBYA 5A0YB 1NDKA 4I6AA 4OX7A 4DHVA 3UVJB 1LK5A 5ADZA 4EBEA 3WIVA 4IKAA 1N33J 3HULA 1WELA 3HZGA 2OSRA 2AMCB 3UD5A 1SUQB 4ED2A 1N34F 2IC3A 2FHKA 3Q8QB 2MB0B 2CPIA 2H5EA 5E0OA 3KHLA 1TMMA 4RUBA 3AFGA 1PYTA 3CJ0A 4JI3J 1EKSA 4Z7YA 1X5SA 2OMOA 3MWBA 1T0TV 1HNWJ 5LJ5Y 3HD2A 3M6XA 4YB5A 1L3KA 5C42A 2KYXA 4CQ1A 4FPIA 4ID8A 1ZOTA 4LF9F 2CDRB 4DL2A 2UUCF 3KJQB 1Y00A 4LR7A 2B8PA 4ZVUB 3TAPA 4J9QA 3KLGB 4PWDB 3PR5B 3LO3A 1ZPWX 2R7OA 2HGLA 2YNFA 2F63A 4JI6J 4NEZA 3I4HX 4KFBA 4QPTA 4DV7F 3V6JA 2LXFA 2C3MA 4KB7A 1N32F 4IOBA 3LANA 2VU5A 2GJIA 2A1BA 4QR2A 3OLBA 1VGYA 2QL7B 1Q8KA 1YDLA 1JXEA 1CS4A 2RRBA 5A8KA 4NEYA 3G96A 3ONQA 2IAJA 1RHJB 2D3OR 3W2WB 4ZPBA 1N56A 3G2XA 4WKYA 1URNA 4UY85 1CULA 1T3NA 1U0HB 3IR6B 2HNZB 3JAMU 3W9HA 3EZOA 1Y5NB 2ZKTA 4WIIA 1WDDA 2NZCA 4K5SA 4DR6J 3QT8A 1LWCB 3Q8YA 2Z0GA 2HW3A 2BVZA 2GVDA 4K2JA 1VQ7S 2IRXA 2AV5A 2PA8D 2K2PA 2MZQA 3OXFA 1XNQF 4Y34A 1VDHA 2UUWA 1JJ4A 4KO0B 1OPZA 3H5UA 4NLPA 3ENQA 2FJWA 2GHWA 4WP3A 2ZVIA 2HFNA 4DQIA 1NLKL 3IC1A 1BQNA 3J80Y 1IR1A 3K0JA 3MOZA 3T1HF 2AIRB 3CJSA 1N0VC 3M8PB 4DSFA 4URGA 2Z4PA 1IBKJ 2CWXA 1ZZNA 2Q6BA 2ZEJA 1C0TB 3MM8B 3HHLA 1A0OB 3VVUA 5F8LA 3V5RA 2NUUG 4J9VA 4ECRA 3UD4P 2R7UA 4DR5J 1JLFB 4DQQA 4L3NA 2Z57B 3R2DJ 2KL8A 1FNXH 5K9FA 1KQFB 2CYYA 4HHJA 1VFJA 1KVJA 2H1YA 1VRQC 2Q6CA 3EYZA 1EETB 2HQFA 3KLGA 2B9XA 1T8EA 2RVJA 1Q7LB 3LP0B 2J6TA 3QNWB 2M2BA 3HM9A 3G8TA 4AUKA 5GAEU 3MI7X 5BYSA 2JEJA 3ZZPA 3DLLQ 3VAMA 5K5MA 2QFIA 1CEZA 2N3OA 3DGVA 3M9OB 2W4DA 2VDHA 1WOSA 4G6VB 3DOKB 4ECWA 1NNDA 4C48A 1X5OA 4QJVA 1NK9A 4ILMA 2YTCA 3MFIA 4F0KA 1T9UA 1VJQA 3HHDA 1M1KT 1U0HA 3CULA 2HNZA 2VONA 3C6TA 1DHMA 1E6YB 4C8OA 3FRZA 5CYMB 3IM9A 2VC1A 1R31A 3RRGA 3A8JA 1MN7A 2PD1A 1S77D 1Q79A 2M52A 2VIHA 2FVRA 2FTRA 3A8EA 4TXSA 5ITHA 5HAOA 1IKWB 3QMQA 2RQCA 2CJYB 1BGXT 2BJ9A 3H40A 3JQMA 4KO0A 2MKHA 2MSSA 3PEJA 3IGVA 3ISND 5BR8F 2C2ZB 2J0QD 1XNRF 5J2PB 4ER8A 1RTDA 2V2KA 4X64F 2W24A 1UZDA 3CXCR 3MCSA 3OFEA 4MKBA 4DCOB 3AD8C 1F9EB 2C3PA 1C0TA 3MM8A 3EVOA 4TY8B 2E29A 1B7YB 2QSFA 5B0DA 3TZYA 4OLPA 3IBCB 4Y00A 1WKLA 3NCPA 4EO8A 1JLFA 3AB2B 2KVQE 2CQGA 1O0PA 4LF1A 5LXRA 4TU7A 2MMYA 5T7LB 4J9OA 3H2LA 4DN0A 3JAMY 2DNPA 3LP0A 2B8QA 2NXNA 4NYOA 2MQMA 3U02A 1HNIB 4F2SA 2G2ZA 2HBQB 2QYGA 1U4BA 4O44B 2RDDA 5BXIA 3AA8A 2LQ9A 1N34J 3DNCA 2HG4A 4YHHF 4DWIA 3DOKA 2J8AA 5AXNA 2M8DB 2E9ZA 2AGPA 2ZUGA 4IH5A 2DH8A 2WB4A 4BLGA 4DJBA 2HS0A 2QN6B 2X51A 5J1EA 3BN4A 1E6YA 4LF9J 5CYMA 2UUCJ 2YWKA 3QFWA 3TZXA 4Q44A 2C3OA 2BEFA 1S76D 1N0UA 4PUOB 4WJBA 1O8BA 2P9CA 2W4PA 4P73A 3OXLA 1GEHA 2GHPA 3M30B 4DEZA 4DV7J 1N32J 3TAMB 2FLOA 3MEGB 2QG9B 3ADAC 2VBXA 3N5FA 4O0NA 1SJ1A 1EARA 2FVSA 4OV6A 1WG4A 3C2PA 2MPUA 3V2UC 3IM8A 2MZRA 4NLRA 5IQQA 4ES2A 3WHIA 5J2PA 1SJFA 3D1HA 2CUYA 3THTA 1HWUA 2DHXA 1F3FA 4LVOP 1Q8IA 4M5LA 2OEKA 2RUGA 4RKUC 3WQPA
chains in the Genus database with same CATH topology
3MECB 4M94A 1RT1A 1T05A 1GXLA 2PEHA 4Q8EA 4IG0B 3DU6A 2RD5C 5AXLA 4CNZA 4TY8A 4EYIB 2DIUA 3VAKA 1S1UA 2UV8A 1U1QA 5LMUF 2ZE2A 5I4MA 2CQPA 4JV0A 3E01B 2B9YA 3LWLA 2ASYA 5KFTA 3IWNC 3FSXA 1QSYA 2OH2A 2FLLA 3MR6A 4AYBD 4PXDA 5GAGU 3VAFA 4P6QA 2Q79A 4N47A 4DX8H 2DK2A 4B17A 5FIIA 4DSJA 4NLXA 2UV8G 3CJ3A 3NGKA 1RP5A 2R9LA 3GG0A 3OVAA 1YJUA 4IH7A 1S9FA 4DV0F 1BQNB 5CQGA 1XK8A 1GTEA 2C3YA 1G6BA 4FZVA 3LF0A 5KT5A 5CD4H 2XY7A 1WG5A 4GKKF 3GIIA 1TV6A 3MR3A 3PEHA 4QIVA 4B3OB 2BE2A 4O3NA 3BO2A 2FGCA 1LOUA 2W4CA 3IG1A 2HPUA 2GGPB 4MFBB 1UJ6A 3MMBA 3M32B 3ISNC 3SCJE 4KAIA 5T7LA 4FXDA 1S6UA 4K4ZA 1RISA 2E5HA 1X4BA 5I3PA 2R7WA 2VA2A 3MMAA 5KFEA 1S1WA 1VQLS 2NR0A 1U1NA 3DMJB 2QLWA 4HEA9 4KHRA 2X1AA 1HNIA 4HTJA 3JSBA 1FRKA 2V94A 4B08A 4C3KA 2HMIB 1NZAA 2B7CB 3DCAA 3HHLB 4EO6A 2XG8A 4X4QA 3SCKE 3O44A 4YP3A 3G71S 2DR8A 4IRKA 3MOJB 2JH3A 4PCQA 2HRYA 1HQUB 1BD6A 4QWDA 3KLHB 1UEUA 4UQGA 1R27B 3G8SA 5HLFA 4MKAA 3EPIA 3MZIA 4DQPA 4EZ9A 1T03A 4UQTA 2CVIA 1M0SA 5D4NA 4K4WA 2EG2A 5DG9A 4MKYA 4UW2A 2L9WA 2LCWA 2MJUA 3T3FA 4ZLPA 2EI5A 4LJMA 4PQUB 3OR2A 3BS9A 2UUBF 2XMWA 2DNRA 5LL6d 4OI3A 2O66A 3BDPA 5MAOA 1TQLA 4I2PB 4NLWA 2WB1D 4R25A 4AXIA 1JLGA 1L3TA 3Q2TC 4HLBA 3DM2A 3N6MA 5SZTA 3LP2A 2KI2A 3TUIC 5GMKa 3MD3A 3MEKA 2XWXA 5F8GA 3U1LA 3OLAA 2Z2MA 2OPSA 2ILYA 2VH7A 2ZNYA 1KTVA 4Z37A 4DSEA 2X3GA 4RU9A 1TVRA 4LFCF 4ZA1A 3DOLA 3KK2A 1H0HB 1HFEL 3MTKA 1KLNA 5THWA 3CCUS 5DQHA 3R27A 3NLCA 3G6VA 1VQYA 2DISA 4F25A 1VK8A 2CPXA 2CZ4A 2ILZA 3GG1A 2XY6A 4RUCA 3VAIA 4K59A 4OI6A 5KFZA 2DNZA 2FC9A 2IVMA 4IR1A 4PUOA 2BBEA 3HLUA 1X4GA 2I5JA 4F2RA 5IWAF 3EXCX 3IWXA 4ALZA 1C1BB 2DCLA 1VC0A 3CO9A 1JXLA 1XN9A 5E3PA 5KFHA 3M30A 1RT3A 2H9ZA 4NMLA 4WFAQ 5LSRA 4WF9Q 5E2QA 1RT5B 2HHQA 4YR3A 1XMBA 3CDUA 5CYQA 3J7YI 4TU9A 2R8KA 1G1XA 3MEGA 1CG2A 1S4FA 1YRXA 4ZPCA 1DFDA 3BGFA 2FD2A 3M05A 2MGZB 1C1CB 1JB0C