1HNVB

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 91
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvB03
1S1WB 2OH2A 4F4XA 4WZMA 3IG1B 4IDKB 3HVWA 1LWFB 4Q45A 4DL2A 3DM2A 1NNDA 4RZRA 2YNHA 2YNGA 4RW6B 3BSAA 2D3ZA 1K1QA 3MEEB 3RAQA 2I1RA 3H98A 1LWEA 1TL3B 4IFYB 4H4MA 3DOLB 1T03B 2HMIA 3QGGA 2BRKA 4F4ZA 2AGPA 1S6QB 1S1UB 5KFQA 5KT5A 5CYMB 4U7CA 3BSOA 1TKXB 4RW7A 4EBCA 1RT2A 1HPZB 1S9GA 5KFHA 3QYYA 3ISND 4O4GB 2QV6A 2VG6A 2R2UA 4ECWA 4Q43A 1HQUA 2JEJA 2ZD1B 1SH0A 2YKMA 1S9EA 3MEDB 2IAJA 3DLEB 3DRPA 3ISNC 5HLFB 4LSLB 2IM3A 2I5JA 3DRRB 3D28A 5J2PA 3NAHA 4K4YA 3HVTA 4LSNB 2WTFA 1GX5A 3M9NB 2ASLA 3H59A 4KB7A 1RAJA 3KNAA 3DI6A 4MK9A 3IG1A 2CKWA 4IDKA 1LWFA 1HQEB 3V4IB 3MR6A 2FJWA 4R8UB 2E9RX 4RW6A 4EYIB 1N4LA 5HROB 4NLSA 5KFEA 4ZPDA 3MFHA 1IM4A 2YKNB 1VRTB 3QLHA 3QO9B 4YR0A 1SH2A 3QZ7A 3C6UA 1T03A 5L1IA 3LP0A 5DG7A 1TVRB 2HNZA 4KO0A 1RT3B 2AWZA 3DOKB 5EDWA 1C0TB 1S1TB 4J9QA 1TKXA 3UR0A 5KFFA 1T05A 3PW0A 4WE1B 2WONB 2R8KA 2J6UA 4RNFA 5K14A 4PQUB 4MK7A 5KT6A 1HYSB 5KFJA 3CVKA 4URQU 2JEIA 4IR9A 3DYAA 3LP1B 2XWYA 1W25A 3DLEA 5KFVA 2XCAA 3CJ0A 5HLFA 4ECQA 3EPIA 3DRRA 1S0NA 3BSCA 4KFBB 5KFRA 4ZP9A 5KFXA 4LQ3A 2C28A 4LSNA 2YNIA 4Y2AA 3PZPA 3KLHB 4U6PA 2V0NA 1KHWA 1XR7A 4NLXA 3RAXA 3T5HA 1EETB 3DLKB 4RW9A 1S49A 2JEGA 4NLTA 2WOMB 2C2DA 1FKOB 3CDWA 3EZUA 3V4IA 1RTDB 1HMVA 4R0EA 4K4TA 4J9LA 4R8UA 2W9AA 2WB4A 1ZTWA 3IRXB 3ITHA 5HROA 3I5BA 4URSA 4RW4B 4ZVGA 5KG1A 4FS1A 2C2RA 2YKNA 1IKVA 1FK9B 1MU2B 1TKTA 3DDKA 3E51A 4K4ZA 1TL1A 4O4RA 3DLGA 3DOKA 2VA2A 3H5UA 1S1TA 2GIRA 1N6QB 3EPGA 3IS9B 3FSIA 4IH6A 1JX4A 5KFWA 1S1XA 4PQUA 5I3UB 4TQRA 3PJWA 1JLBA 3LP1A 5DGAA 3D5MA 3KHLA 4DL3A 2YNFA 4YR3A 2XC9A 4KFBA 3KLGB 2ZE2A 3QIDA 2RDIA 4NLOA 5DQIA 3H4DA 1SUQB 2UVVA 1D0EA 4WYLA 4PUOA 5JXSA 2R8GA 3DLKA 3KK2A 2WOMA 5KG0A 3CDUA 1FKOA 3BREA 2AX1A 5KG3A 3DM2B 2FVSA 1QUVA 3IRXA 1BQMA 3V81A 5DG8A 1BQNA 2IM1A 5FDLB 4M95A 1IKWA 3MTKA 4IH5A 1FK9A 1T94A 1C1CA 1MU2A 4KKOA 4O3OA 5KFIA 1DTQA 2HMIB 4IG3A 4RUAA 3M9MB 3MR5A 4NYZA 2W9BA 3OL9A 3I5AA 1JLCB 1N6QA 3OL8A 3IN5A 3MR3A 5HBMA 1RT2B 1S9GB 3GILA 4Y34A 3GIIA 2ZKUA 2R2TA 3LANA 2W8KA 1JLGB 1N5YB 3H5SA 5DG9A 1HQUB 3LP2A 2IAJB 3DRPB 3KK1A 1RT6B 5J2PB 3HVTB 4TY9A 5KFDA 3PVXA 4QWDA 3PW7A 5C5JA 3QZ8A 1RT7B 5KG6A 3T5KA 4QWAA 1JIHA 3DI6B 2D7SA 2GIQA 4NLDA 3PW5A 1S9FA 2QE5A 3OHBA 4I2PB 5FDLA 3QLHB 2AGQA 4QPXA 3G6VA 3V6KA 2F8EX 2IC3B 1HNIB 3C6UB 3GIJA 1RTJB 5F8NA 3LP0B 4B3OA 2HNZB 4KO0B 1JLCA 5C25A 1KLMA 1T05B 1JLAB 4K4VA 3NGDA 4NRTA 4YP3A 3CWJA 3T5LA 5K14B 2OPRA 1RYRA 2W7OA 5KFGA 1JLGA 1N5YA 2FVCA 3ICLA 4WXOA 4RNMA 1JLFA 1Z4UA 5KFZA 1XR5A 1LW0B 1YVFA 4KAIA 2HNYB 3DYAB 2B6AB 4QWCA 2IBKA 3CJ3A 4QWBA 1RT6A 3KMQA 1RT4A 4MKBA 3UQSA 2WK4A 3RB4A 3V6DB 1GX6A 3CO9A 4WFZA 5KT3A 2YNIB 4ED6A 3JYTA 1RT7A 2XI2A 4ED3A 3E01A 5I42B 4RW9B 4YMEA 2ILZA 3RB3A 1S0OA 4ECUA 3Q8QB 1MMLA 2W9CA 4HYKA 1HMVB 4O3QA 5F9LA 4YR2A 3RBDA 2UVWA 2R2RA 4O3PA 3ITHB 4I2PA 1U09A 3KLIA 1TQLA 2IMWP 3PR4A 1IKVB 2J6TA 1TKTB 2B43A 2IC3A 3MECA 1HNIA 2ASJA 1RTJA 4JV1A 1TL1B 3DMJA 5EUHA 3DLGB 3NBPA 4YQWA 5KFPA 5L1JA 2IJNA 1JLAA 1S1XB 4WFYA 3BSNA 1K1SA 5F9NA 1QAJA 3GIMA 2AU0A 5KG2A 4H4OA 3GYNA 1LW0A 3T1AA 1JLBB 2HNYA 2ILYA 2B6AA 2JC0A 4GC6A 1T3NA 2YNFB 4ZVEA 3RB0A 2ZE2B 4ED8A 3M8PA 3V6DA 4IG0A 1S97A 4G3IA 4J9NA 5KFKA 4O3NA 1JLQA 4Q0BB 4PUOB 5KFTA 4ECYA 5I42A 2OPQB 3KK2B 5KG7A 4WFXA 1TV6B 5J2QB 2B5JB 4MKAA 4X2BA 1BQMB 3V81B 2IJFA 4F50A 4RU9A 2IA6A 1BQNB 4K4UA 4Y2CA 1IKWB 2V4QA 4F4YA 4ECXA 1C1CB 4KKOB 4TN2A 4ZVFA 1DTQB 3QGHA 4IG3B 5KFYA 1S0MA 1IKXB 2W9BB 4XPEA 5EWEA 3KHGA 1SV5B 4ECRA 2J6SA 4IQXA 1D1UA 4FS2A 5HBMB 3KLFA 3KJVA 4RUCA 2HWHA 3N6MA 1IKYB 2BANB 2WRMA 3GV7B 2UVRA 4QW8A 1NHVA 3KLEB 4NLYA 4JV2A 3LP2B 2JLEA 3KK1B 3GQCA 5J2MB 4IH7A 5EWFA 3BQ1A 2XCPA 4I2QA 5KG4A 5F8HA 4NLWA 2VG5B 4Q0BA 2OPQA 1TV6A 5J2QA 2B5JA 4EYHB 2W8LA 2DPIA 1CSJA 4H54A 3CJ4A 1RTIA 5CYQA 1J5OB 1SH3A 2ASDA 3NKYA 3BQ2A 4IRDA 1VRUA 3NL0A 2R8JA 1S1VB 4ICLA 5C24A 1IKXA 2FLPA 4B3OB 4DG1A 1SV5A 5DLFA 3NAIA 2FVRA 5C25B 3QGIA 1KLMB 3MEGB 4DL4A 2JC1A 4NLGA 3TVKA 2FLNA 4G1QA 4IOBA 4NLPA 1HNVA 2OPRB 4ED7A 4XPCA 2GC8A 2FJXA 1IKYA 2BANA 4MK8A 4KSEB 3PJXA 1JLFB 5J2NB 4KV8A 3RBEA 3KLEA 2FLLA 2BQ3A 3DRSB 4ID5B 4RW8B 3OSPA 2ALZA 3PHEA 3C6TA 5L1KA 1QAIA 3BQ0A 5J2MA 1RT4B 1RT1A 4TYBA 4KBIA 3N6NA 1RA6A 5JUMA 2VG5A 3JYTB 3E01B 1REVA 4NCGB 4NRUA 2BQUA 4K4XA 1UWBA 1DTTA 2W9CB 1JLEB 4LQ9A 1DLOB 3G6YA 1J5OA 5KG5A 3KOAA 4TYAA 3KLIB 4ECZA 3GV5B 2R8IA 2VA3A 3MECB 2D3UA 2RKIB 1S1VA 5T14A 1S6PA 3M9OB 3DMJB 4Q44A 3NBPB 3H5YA 4DEZA 2C2EA 2OPSA 4J9KA 3FQLA 4K4WA 3I0SA 3MEGA 2W7PA 3FQKA 4ECSA 1TKZB 3MF5A 3Q8RB 3GV8B 3M8QB 4QW9A 4FBUA 5J2NA 4PWDA 4H4OB 3FFIA 5F8IA 3DRSA 4ID5A 4RW8A 4I7FA 4Y3CA 1ZETA 3PR5B 4WZQA 4J9SA 2FJVA 4ED0A 3BR9A 5C42A 1S4FA 3FDSA 3M8PB 3N6LA 4IG0B 3CIZA 3MR2A 2AGOA 1JLQB 1RTHB 4TLRA 3H40A 1LWCA 4NCGA 2UVUA 5DQHA 4J9PA 4MIBA 1EP4B 2CJQA 1JLEA 1RA7A 1DLOA 5KFSA 5KFOA 4MFBA 5KFBA 5KFUA 3NMAA 3UDLA 1RDRA 1RYSA 1C0UA 4NLVA 5L9XA 4EEYA 2RKIA 3I0RA 5D3GA 2OPPB 3KLVA 3GIKA 4EO8A 4ECVA 2XGQA 3LAKA 3KLFB 1TKZA 3BGRB 5KFMA 2BE2A 3KJVB 2VG7A 2IM2A 4URGA 4KHMA 5KFNA 4NLRA 3MFIA 1OS5A 4TY8B 1WNEA 3M8QA 3PW4A 1S1WA 2FVQA 4ZMMA 1RT5B 5J1EB 3PW2A 2HWIA 3TAMB 3KHRA 3OL6A 2BRLA 3OLAA 3MEEA 4R5PB 1ZTTA 4I2QB 1NHUA 5KT7A 4DL7A 4IRCA 4KE5A 3I5CA 1TL3A 4IFYA 1RTHA 4EO6A 3DOLA 3KK3B 2EC0A 1C2PA 1S6QA 4O3SA 1S1UA 4NLUA 5CYMA 4DL5A 1EP4A 4ZP7A 1FKPB 1LW2B 3OL7A 3OSNA 4WXWA 2BQRA 3UPFA 1RTIB 5CYQB 1HPZA 4ECTA 2C22A 1VRUB 2D41A 3CJ2A 3HVAA 4O4GA 4J9MA 4ZP8A 5F8LA 3SFUA 2E9ZA 1HARA 4F4WA 2OPPA 4IFVB 4ICLB 5C24B 3H2LA 5DGBA 3G6XA 4DG1B 2ZD1A 4ZP6A 3MEDA 3Q8PB 4J9OA 5DQGA 1JKHB 1JXLA 3IGNA 4LSLA 4IKAA 5EWGA 2HAIA 2RF2B 4O44B 3KMSA 3BGRA 3JSMB 2AX0A 5KT2A 4G1QB 3G86A 1HNVB 1XR6A 3CDEA 4TY8A 5F8MA 4RNHA 1RT5A 5J1EA 4KV8B 4TQSA 3T19A 2XGPA 4ED1A 2RDJA 1HQEA 5HP1B 3TAMA 4KHRA 4ZVHA 3C6TB 2UUWA 4K50A 1R0AB 1RT1B 4R5PA 4JUZA 3VQSA 1VRTA 4DL6A 3QO9A 2BR0A 4ZPBA 3V6JA 4Q8EA 2V4RA 3BJYA 5KFAA 4WYWA 3KK3A 1REVB 2WCXA 1TVRA 4ZHRB 1S48A 1UWBB 1DTTB 1RT3A 3LALA 1KHVA 1C0TA 5F8JA 1FKPA 1LW2A 4WE1A 2WONA 3V6HA 4FBTA 3H5XA 2ATLA 4IRKA 3CJ5A 4M94A 4EBEA 4K4SA 4MH8A 1C1BB 4RNNA 1HYSA 4O3RA 4XO0A 5F8GA 3Q8SB 2HNDB 1S6PB 4IFVA 3FRZA 4NLQA 2IM0A 3T5JA 1N56A 3SI8A 1JKHA 2OPSB 3I0SB 2RF2A 3QIPB 4O44A 3JSMA 4ZPAA 3KLHA 1QE1B 4Q8FA 2V9WA 1I6JA 3LAMA 1EETA 5KFLA 4PWDB 3FFIB 4RNOA 1RTDA 5HP1A 4I7FB 2XI3A 3IGVA 3OHAA 4ZPCA 2JEFA 2YNHB 2YNGB 4NZ0A 1R0AA 2E9TA 3HKWA 4RW4A 5C42B 3RB6A 2AQ4A 2UUTA 1LWEB 3H4BA 2O5DA 3OLBA 4EBDA 3HHKA 4H4MB 1LWCB 4ZHRA 5L1LA 4QWEA 1TP7A 3KHHA 4GC7A 4RW7B 4TXSA 3IS9A 4MFBB 5I3UA 4OL8A 2DPJA 1C1BA 1C0UB 2VG6B 3I0RB 1S10A 5D3GB 1N48A 2HNDA 4JV0A 2FVPA 3TQ1A 4ED2A 2YKMB 1S9EB 5DLGA 5KT4A 2R8HA 2R2SA 2I5JB 3KLGA 3QIPA 4MIAA 4HKQA 3SFGA 2WHOA 2BE2B 1SUQA 2VG7B 5KFCA 4J9RA 4IR1A 1QE1A
chains in the Genus database with same CATH superfamily
2BOAA 2GO9A 1RU1A 1KS2A 2IPOB 4DL2A 3MAAB 4RW6B 4CLKA 1H3DA 1QVFR 2XTJP 4JI4J 4D3HA 3MOJB 1JJ4A 3MM8B 4DR7J 2YKMA 1NH8A 3ISNC 2YH0A 2NSBA 3IM9A 1QSSA 2ZKTA 1RAJA 3V2UC 4LBPA 4PG5A 4EYIB 1EZZB 2F65A 3BO2A 2QTWA 3RW7A 3R7SB 3G4SS 1RT3B 2VFTA 1ZZFA 1OYDA 3TW0A 1MN7A 1K47A 4N77A 4ZP9A 1VBZA 2XS5A 4R0EA 2W2NP 4FS1A 3P5TL 2UXCJ 2ZOFA 1OY8A 1N6QB 1WHVA 4ZVPB 1ICEB 4PQUA 4TQRA 2MSTA 3ONQA 3EGVA 5HK4A 5K8NA 2YNFA 2FZGB 2XC9A 4TU9A 3GFYA 5HATA 4OYZA 1JJCB 3IRXA 2MKIA 1SBRA 1FXDA 2IM1A 4M95A 3IMQJ 1MU2A 2PI5A 2HMIB 2YWKA 4OHXA 3OL9A 2HRTA 1QLNA 4F02A 4DV5J 5HBMA 1KSPA 3GIIA 1VFJA 3LP2A 3GZ7A 3KK1A 4Y6IA 4F25A 5KFDA 3T5KA 2FHOB 4I2PB 5D0HA 1HNXJ 5F8NA 3VHQA 2H48B 4A8MP 5C25A 4OZLA 4RNMA 1Z4UA 1XR5A 4ANEA 4KAIA 3TARA 2BVZA 4MKBA 4DSIA 1GX6A 2Z0GA 1F3VA 2W2PP 1YWXA 3E01A 3VGTA 3MMCA 4CI0B 1HMVB 5LJ3Y 6FD1A 1TUGB 2O3DA 3B6BA 6FDRA 2ASJA 1OSCA 3KDOA 3GMGA 1NSQA 2HFOA 5J2QB 4NZ7A 3E2EA 4BS2A 3RR8A 1UTAA 4RU9A 1BQNB 1VK8A 1R8BA 4KKOB 5E2QA 3SBMA 5EWEA 1X5OA 2H5IB 1UETA 2J6SA 2I6WA 1S79A 3PRBA 1HL6A 4NLYA 1V6HA 4JI0J 2BXJA 5F8HA 2RVJA 4F04B 3PY8A 1X4AA 2P8IA 2G2OA 1K9MT 4LFCJ 2FZKB 3I96A 3PJ9A 1NK6A 1WI6A 4NLGA 5DETA 4PPDA 4IOBA 4KSEB 3PJXA 5CXTA 1QAIA 4OV1A 4LF5J 4ZOSA 1RA6A 4EFAC 4DV2J 1ZM2A 3QT6A 1DLOB 2KTQA 2DGVA 3G6ES 3JAMU 1UZHA 5C2GA 4DF4A 1M5KC 4KGVB 3NG8A 2VB6A 2MQMA 3LGNA 3PG9A 3HD1A 2CPJA 4ILLA 4JYAJ 3ZTPA 4USTA 4USKA 2CPYA 1WOPA 2N82B 2IDLA 1RDRA 2RUGA 1WHWA 2FD2A 4ZPTR 1KRPA 4WKRA 2BX6A 5A6WA 3FUYA 3DU6A 1G7CB 1TU0B 4TVAB 1VR6A 4LREA 3PW2A 2CPFA 2XMUA 1DZ5A 5KT7A 4KE5A 3FRYA 2BJDA 4J5OA 1FWPA 4B9TA 3DGPB 1RAHB 8ATCB 5F8LA 1SQEA 4ICLB 1E6YA 2WSEC 4J9OA 3PX6A 2GMLA 1W26A 3NRBA 4J37A 5F8MA 3MPUB 2B8PA 2AJ2A 2WVCA 4Z7CA 5HMXA 2AW0A 1HNZJ 5KFAA 2W7AA 1L3UA 3CCUS 4F3QA 4OZ2A 3U02A 2HHTA 3R27A 3AODA 3I0SB 3I31A 3NS6A 2DR6A 1Q8KA 3IWXA 1APSA 1N36F 5IM0B 3BGFA 3BDPA 4CT9A 1I1GA 3NS7B 4XDCA 4CO1A 4JI8F 2DPJA 3EGZA 2A18A 4E0DA 4CLUA 2J0XA 2FVPA 3TQ1A 5DM7Q 2QL7B 2XNRA 1EARA 1TELA 3ZTOA 3MEEB 1NAQA 1MW7A 3SMZA 4IFYB 1FRKA 1M1KT 5KT5A 1R89A 1S9GA 3ISND 2AKWB 2C3MA 4ZLJA 4ECWA 4ED1A 3DRPA 3NGDA 2I5JA 3DRRB 2DNNA 2FGCA 2CJAA 3H59A 3TQEA 4BC9A 2HBZB 2QL9B 2GHPA 1R6YA 4DN0A 1C0TB 3PW0A 1KQSR 3C15B 5GAHI 2DYAA 5DM6Q 5MAOA 3QT7A 5ETTA 4TNOA 1NSPA 1SI9A 2C2RA 2R4FA 1VGYA 2GMJA 1M5HA 1PC4A 1QTNB 2XBPA 5IT4A 3CCQS 5AE1A 1JLBA 2E7XA 1OSDA 1SUQB 3AA9A 1HHSA 4PWWA 5KG3A 3V81A 5FDLB 5L39A 5F41A 5KFIA 2ADCA 3SCKE 2G13A 2W9BA 1NK4A 3GJTB 3OTEA 7FD1A 1AXQA 2DR8A 2KB2A 2W8KA 4XIUA 3N79A 5CH7B 4QQBA 4AYBD 2DR5A 2QLWA 4HR2A 1YJ7A 1A9NB 3IP0A 3DKDA 4NRTA 1LV5A 2HNYB 3DYAB 4EMDA 3CO9A 1GMWD 1X0FA 4RW9B 3D2WA 1HIYA 2HHVA 2UV8A 3PR4A 3FEYB 2DNYA 1FJGF 1SCJB 4KGKA 5AT1B 2MKYA 1KVJA 3CMQA 4IG0A 1C4AA 4ECYA 5LSLA 2V8VA 1QM9A 4B9UA 1SL1A 3MM9B 1PKUA 1SC3B 2MQPA 3KHGA 1DAXA 1YSJA 2FUG9 3EM1A 1S6UA 3DXSX 1NHVA 1Q82T 4EUVA 4WBFA 3J81j 3DOMB 3CJ4A 1SH3A 5A8KB 3CCJS 1KFDA 4B3OB 1KVKA 3TOQA 4G1QA 3ENWA 1KN6A 2AYBA 4RX6A 4AXIA 4DXLA 2XZTB 2R42A 4NRUA 1UWBA 2NXUA 1KQGB 1JLEB 1J5OA 2XO7A 3GV5B 2B9WA 1ZAWA 3E8OA 1U1PA 2C2EA 2F63A 1F6TA 3NXZA 5E33A 1DFDA 2E1MC 3EYZA 1ZETA 1BHNA 2A2DA 6AT1B 5HL7Q 1RWPB 1WTBA 3A8EA 3C14B 1JLQB 3H40A 3K5NA 2FQQB 2AJFE 1N0VC 1UKUA 5A8WA 3KLVA 5G0RA 5KFNA 2BE2A 4Q2LA 2VG7A 4URGA 2RHSB 3AT1B 1XNQF 1TAUA 4I68A 4BLGA 4C2MA 1B0PA 4O0NA 2P9CA 1S77D 3LWLA 4CO4A 2D74B 1RGVA 2OPPA 1WJ9A 2VD3A 2KH9A 3L7UA 2PO4A 5HP1B 3W5XA 4HH1A 4R5PA 3HP6A 1N34F 1VC0A 1OQ6A 4NASA 2IM0A 1KVIA 4O44A 2CADA 1PYTA 3L7OA 2HFNA 1NHKL 4FYWB 5BYRA 3PEHA 4NZ0A 2XMJA 5C42B 4PXDA 3A13A 1SJ3P 1JMTA 1N48A 4L75A 2KHDA 2WHOA 5KFCA 3A8IA 4IQMA 1TL3B 4NEYA 4OJHA 1PJ7A 5D4PA 4DX6A 4CH7A 3A4TA 1A0OB 1F5BA 2IBKA 2ZOMA 4LSLB 4JI8J 2DH7A 2F9JA 3IG1A 1HQEB 5CZXA 4DPXA 1BWVA 3QO9B 3C6UA 2HW3A 3DLLQ 1TVRB 3N4WA 1FRJA 1TKXA 1U2CA 2EEYA 2WONB 1U25A 2AIRB 4IYQA 3GFHA 1FI4A 3KFWX 3LP1B 1CULB 1AB8A 3DXBA 1S0NA 2J76E 4LQ3A 3C46A 2C28A 1CBKA 4DFMA 2V0NA 4BWJA 4A8FA 3X1LB 3DRYA 1FXLA 2PDAA 4F36A 4KPCA 1ZTWA 4ZVGA 2GVDA 3AJ1A 1FK9B 4DX7A 1RWMB 2VQFF 4KR0B 3K17A 5GADI 3KLGB 4JI2F 4B9SA 4PUOA 2X1AA 4UUXA 5DS7A 2Y8WA 1NB2A 1BQMA 5DG8A 3QRPA 4IH5A 4HI2A 1I3OB 3M9MB 2XO6A 2DR7A 2UUAF 3BGOP 3VV2B 5K8MA 2V8PA 3IO1A 3H5SA 1VQ9S 1CLFA 4NXNF 1N5SA 1Y4ZB 3NY0A 3R9LA 1Y5IB 4M8LA 1G2EA 3CWJA 2W7OA 4WXOA 3Q83A 2AHOB 5KFZA 4IO1A 3IAM9 2MB0B 3DLBA 2YPYA 2R2RA 4O3PA 3C19A 2ZBQA 4XDDA 2N4DA 1DQ9A 4OX9F 1IBKF 4DHVA 4GC6A 5D0EA 4A8XA 4L73A 3K5MA 2BM1A 5EHHA 1RAIB 3T1YF 2DEIA 2GNKA 4ZVFA 4DR6F 1SV5B 4IQXA 1RCOB 2U2FA 2K7KA 2BANB 5JVGQ 4PKDB 4QW8A 1FRLA 1LFPA 5LMNJ 2G1DA 2ZITA 1SJ4P 4AL7A 1U0HB 3KJQB 3ENAA 3W66A 1KR4A 4B3MF 3MM5B 4ELTA 4O23A 1IKXA 1WKLA 4USWA 1SJQA 2FVRA 2UXDF 2EPIA 4AL5A 3NWRA 3VAFA 1T9XA 1UVIA 3C8YA 3OJSA 4KBIA 4M5KA 1REGX 2WVFA 3Q8VA 1B3TA 2VBZA 2OMOA 2CQ2A 2DTJA 1JB0C 1DJ0A 2HQDA 3UI3A 2XY5A 3MPDA 3E3XA 4I7FA 4UY8T 3UCGA 1HD1A 4TLRA 4NCGA 3G87A 5KFOA 2AD9A 4OYOA 3M8SA 3F0NA 1M5PC 4EEYA 3I0RA 3CMAS 3TA1A 2D1CA 4BCAA 2CPHA 2VJVA 4KHMA 4WK1A 2JX2A 1HBUA 1W2IA 3MCSA 1N5TA 1WF2A 3HD2A 5ETMA 1GFWB 1GXLA 3HVAA 4O4GA 4F4WA 2NPFA 2LEPA 1JXLA 2Z58B 1HNVB 3Q22A 4KV8B 2D9OA 4ETZA 2EBEA 4B9VA 3VQSA 3W63A 1VRTA 4WYWA 2VHGA 8AT1B 2R7QA 4IRKA 2DHSA 2QMXA 2FC9A 4HHUA 1L3VA 4WIIA 1GMWA 5GAEU 3FMBA 2I38A 4PWDB 2DHGA 2VC0A 4XK8C 4YB7A 1CJKB 1QSLA 1P1LA 2AQ4A 2UUCF 2OJ3A 1TUVA 5I3UA 2VICA 1S10A 4AQYF 1N34J 3EVOA 3SFGA 3JXOA 2CA9A 2A0FB 1S1WB 1TUWA 4C0OC 3DM2A 1NNDA 4NPOA 4A48A 1K1QA 3Q8UA 1HI8A 2B3TB 2C2MB 3CGIA 2A6MA 4USUA 2ACYA 3HZEA 3LPEA 4KGMA 5DDQC 2KRRA 4LSNB 4KB7A 1LWFA 4NLSA 5HROB 2UU9F 1IM4A 1N54B 3I32A 2D9PA 4YHHJ 2XG8A 1XJWB 2LEAA 3O6QA 3JQJA 3DLEA 2N7CA 5KFRA 1X4CA 2M7SA 1RHUB 3A8JA 4NLTA 4OJ3A 3G96A 1HBMB 2MEWA 4DV3F 3K0JA 2NXCA 1CJVB 2HHXA 4NEZA 1S1TA 1ZH5A 2RE1A 2ZJRQ 3P8BB 3PJWA 2DCLA 5E0OA 3CEDA 3KHLA 2VC1A 2HK2A 3H4DA 1V9OA 4C9DA 2CAJA 4PG4A 4EGLA 1A6LA 3CDUA 3BREA 4CH0S 4W90B 1IBLF 2JLFA 1UJ5A 1DBDA 1VMBA 1KLNA 1DTQA 1RWNB 3QRQA 2DT9A 2FPHX 2MQNA 1SKSA 4EWTA 2LXFA 4C8ZA 3GILA 1FRHA 4Y2KA 4O0IA 1EKSA 3TUZC 1ZPVA 1B0TA 4QWDA 5C5JA 2OHDA 1JIHA 5ITHA 3SYZA 5FIIA 3O8WA 2NXEA 4JI2J 1SQFA 2WSFC 3MPWA 5LXYA 2OAUA 5D4LA 2P9GA 4CH1A 4K0KF 2G0IA 2N4CA 2OPRA 2BDPA 2WSCC 4DQIA 2UUAJ 3HHLC 4LVNP 1S0OA 3OR1A 1U09A 1XQIA 4YQWA 2IVMA 4X62F 1YRUA 2HZVA 4NXNJ 3TZWA 2ZWPA 1D8YA 2ILYA 2B6AA 2YNFB 3DDIA 3V6DA 2WAQD 3GG0A 3HJVA 5I42A 4ZIVA 2HQIA 4K4UA 2WBRA 3EE3A 1X8DA 1VQ4S 1VQLS 5HBMB 3CCZA 2J9DA 4OI4A 2WRMA 4DUYJ 3LP2B 1FFGB 1NJIT 2MZTA 3KK1B 4IH7A 2RD5C 1S7IA 4I2QA 3M2VA 1IBKJ 2V9KA 2QJ3A 3PRVA 4LF9F 4DR4F 1RBAA 1S1VB 4DG1A 2X1BA 5C25B 4X4TA 1T11A 2LA6A 3KLEA 4RW8B 3HJFA 3PHEA 1IQZA 3E01B 1YHQS 3AHPA 5HI7A 2ZM6J 3G6YA 1RKIA 4LRFA 3PXGa 1RZMA 3N0VA 2HRUA 3VWSA 1Z2ZA 3UCZP 1RHRB 4B3MJ 1TL7A 3FFIA 5F8IA 2CPIA 3W9HA 3PR5B 4MMOA 3SCIE 2UXDJ 3MR2A 3U1NA 1RTHB 3TVYA 2VKRA 1RA7A 7FDRA 3FBBA 1ZZNA 4B3RJ 3CB4A 5CCLA 1QDUB 2HHPA 4RUBA 4OZ0A 4CYUA 4IRCA 1XNRF 3LWMA 2G2YA 2ZHOA 3KK3B 3GU0A 1B7YB 2HHHF 1H74A 2DRBA 2JWNA 3D1OA 3SFUA 2E9ZA 2ZDOA 1HARA 1FEEA 3MEDA 2FHKA 5K8OA 1XR6A 3CDEA 1WELA 1CQMA 4RNHA 2Q66A 4BBYA 4KHRA 4OI6A 4C0BA 4UF4A 1YX2A 2C3OA 2V4RA 2V8GA 1S48A 1P9YA 1LNQA 4NZ6A 2PEHA 2VBXA 4RPFA 2Z2ZA 2KXNB 2HS4A 1NK0A 1WDTA 3MMAA 4P10A 4OZ3A 5CD4A 1VBKA 1EETA 3M8RA 2F8HA 4OYWA 4RNOA 1RTDA 4DS4A 4ZPCA 3Q2TC 3CULA 3GFXA 1UCNA 3TNVA 1GNKA 2K8GA 1HWJA 5B0GA 2G1HA 3R8YA 1T3OA 3W2VA 3SSQA 2XHWA 2R8HA 2R7OA 2VPWB 2DY1A 1RP5A 2HG4A 4DN9A 2JHEA 2BUNA 5A8RA 3TR5A 2YNGA 2EG1A 2GIFA 4PRFA 2VONA 4CP5A 1T03B 4EBCA 4ITSA 4AT1B 1XIQA 3PX0A 4ELVA 4OI3A 1E6YB 1WC4A 2A6OA 4I6YA 4QIVA 3IRWP 1GX5A 1NO8A 3W7BA 4RBUA 3DI6A 1EHWA 3I82A 4CZCA 3V4IB 4R8UB 4AQYJ 2HPUA 1JQGA 3AD7C 1KQFB 1K0TA 2XNQA 3FSYA 1I94F 1JXVA 4Z37A 1JK9B 3ILOA 5IWAF 3M6VA 5KT6A 3W8PA 3IA0A 4ES1A 2JEIA 4NA1A 5CYJA 4ZIWA 1Q5YA 3N28A 2F8MA 3EDRB 3AY0A 1FKOB 4J9LA 1RAGB 4DI6A 1IKVA 2CUYA 3MAHA 3W62A 2EFGA 4IH6A 2UU9J 3UN2A 3HMJG 4G1IA 3HSZA 2ZE2A 2KM8C 4B17A 2NREA 3KK2A 2YWEA 4QOTA 2AX1A 2CRLA 4DSLA 2G4BA 2NR0A 2JDJA 4DV3J 1S9GB 1BD6A 2MQLA 3W1YC 2FJBB 3DRPB 1H2VZ 3PW7A 4JI6F 4X4UA 2KJWA 4F67A 4MTPA 1TKDA 2RAQA 3J81Y 2V8DA 1SJRA 3OJUA 5MLCV 3GWCA 1JLCA 4K4VA 1UMJA 1KONA 1FRXA 3MTJA 1D3WA 1NPRA 2Q6CA 2A2CA 3HHLD 3CD5A 5M2RA 2WK4A 2FZCB 3TAPA 4DUZJ 1Y11A 2B4UA 3Q8QB 4YR2A 3QNWB 2IC3A 3ILLA 3TYTA 3T9NA 4CTAA 1VQ6S 1L3KA 1WTFA 2G0JA 1FNXH 3MURP 4H4OA 1JLBB 1U6ZA 4KYZA 4K0KJ 4ZVQB 2JFDA 1U1LA 3PYFA 2MXYA 4OX7A 3AAWB 4WFXA 1DY3A 4X2BA 4I69A 3V81B 2BA9A 4Y2CA 1SC4B 4DWIA 4LRDA 3M1VB 2R7UA 2XMAA 2E5IA 2W9BB 1R27B 3JS9A 2XM3A 1RCXB 2QYGA 1ZAXA 4NMXA 2UVRA 1UW4A 3CD0A 3BQ1A 4X62J 4NLWA 3R1LA 4UZBA 1ACMB 4NYPA 2W8LA 5CYQA 4OHVA 1VRUA 3WQPA 1QY7A 1VK3A 2DNPA 4ED7A 3DFEA 2WZ1A 2WW8A 3LA0A 3N01A 2CQ4A 3JSYA 2QT7A 3EICA 2H51B 5K5MA 3SQOP 2OPSA 1NBEB 3I9V9 1ZM4A 4LF9J 4DR4J 4ZA1A 4ID5A 4IG0B 1PAEX 1NKEA 2HQGA 1X5TA 1LWCA 3J7YI 4MIBA 1RWXB 2CJQA 3PM9A 2N3OA 1ZA1B 4WU2A 3VAJA 1RAFB 1Y0HA 4WU3A 1F60B 3FCVA 2HS3A 3A3NB 9ATCB 4B3SF 4C98A 3ZO7A 1S7HA 1RT5B 3CJ8A 2AF6A 1KTVA 1AZSA 4DDFA 3NGTA 1FJEB 3D0IE 3MMBB 2A1BA 1GT8A 3ZZTA 2VFSA 5CHCB 3THVA 5EWGA 1FE0A 3JSMB 4G1QB 3G86A 2RMLA 4P2XA 2B7CB 3W9IA 2BKNA 3US5A 2EI5A 2XYPB 5ETSA 4ZHRB 1UWBB 3GE9A 1IR0A 4MYUA 1O5JA 1NRKA 1MROA 1C1BB 2HNDB 3VZIA 1NB7A 4FZVA 2DGUA 1JKHA 4PPZA 3QIPB 4DJBA 2HHHJ 1QE1B 4USIA 2E1AA 1XMOJ 1UW9A 1LWEB 3AFGA 5CCMA 3HHKA 2OGUA 4NCBA 1YK9A 3IS9A 3CCTA 1FDBA 1FJ7A 2LU2A 3IWLA 5HQ8A 4JI3F 5A8WB 5IV4A 1U2FA 4HHJA 2BE2B 2VG7B 1Y7PA 2DR9A 3IC1A 5KFQA 1VQMS 2HFZA 2QZ8A 4DS5A 4DSKA 4Q43A 3D28A 3R7NB 4MK9A 2AP6A 2RNEA 3TJAA 1TFWA 3S6EA 2YKNB 1WF0A 4YR0A 1T8EA 4KO0A 4B3TF 2E1CA 2VASA 1HNWF 2PFDA 3W65A 4DV0F 3CJ0A 2XHCA 1RISA 3M2RB 2FHJD 1N88A 2GJIA 4D3GA 4K4ZA 3HX9A 2DO0A 2GIRA 1N5VA 2HBYB 4L74A 2NUHA 3WX8A 1CJTA 5M2PA 5DGAA 3D5MA 1I94J 3QJPA 2B4OA 5IWAJ 1W2BR 3VAGA 3RRKA 1QUVA 4V19X 2F1FA 4M5DB 4UQTA 2VFUA 2CQIA 3IN5A 1AFJA 3OFEA 1X4GA 1DHMA 2AYMA 5CD4H 4F4KA 1DQAA 4ZK7M 2GIQA 3UDEA 2KXFA 3J7YU 1HNIB 3C6UB 2PGCA 4PCQA 1KLMA 4YP3A 3GJSB 1JLGA 2FVCA 3H90A 3T41A 2CJ9A 2D3OR 2GMHA 1RHJB 3RB3A 2W9CA 3R7BB 2COLA 5CA5A 2B43A 2PD1A 2HFUA 4JI6J 3BSNA 3UFCX 3GIMA 1N32F 4C3MA 3L4BC 1GH8A 5IV3A 1RWWB 4PUOB 1R8CA 3HFZB 1M5SA 2CPZA 1PAUB 2HEKA 3H2UB 4PEOA 1BQMB 2V4QA 3TANA 3D7SB 3QGHA 1FF2A 4ECRA 1D1UA 1IR2A 2HWHA 2WB1D 3N6MA 1WC5A 1JJHA 1NH7A 3OTOF 3QT5A 5J2MB 1B0VA 2LLZA 4OI0A 1ZAVA 1GAOA 1D09B 2B5JA 4ZJOA 2Z8QA 3NKYA 1VQKS 1SB6A 4C0HA 1K8AT 5T7LB 4CLZA 3QATA 1WEYA 2FJXA 2RQKA 3MUTP 2RRBA 2QL5B 4JB8B 2CJYB 2M88A 2VG5A 2LQ9A 3PYDA 1DTTA 2UZAA 2IFXA 1N52B 4E98A 4LIRA 3T6JA 3W61A 1S6PA 1PBUA 3Q89A 4C11A 4WF9Q 2UP1A 3MEGA 1FDDA 2MPUA 4FBUA 3DRSA 1FJCA 5DO2A 5D8HB 3CIZA 3HT0A 4C3LA 3J7AN 2MY7A 2ZBIA 1B4SA 2CYYA 4JI5J 1RYSA 3P49B 2YKAA 4NA3A 2AU0A 1TKZA 4MAKA 1P6TA 2XYGB 2DRDA 2BRLA 3EXCX 4DV7F 5GAGU 1S1UA 4NLUA 1VI7A 1VYAA 3UN5A 3Q2SC 2HYIB 1HPZA 4J9MA 1JNZB 2H54B 3MUMP 4IFVB 3KUHA 3BGRA 3J81U 1O51A 5J1EA 4OZJA 4TQSA 2BJ9A 3TAMA 2CQGA 4B9LA 1U1OA 4DSEA 2RS8A 4Q8EA 5LM7E 4B3SJ 4H4KC 1ITPA 1LW2A 4QJVA 1NZ8A 5K9FA 4X4NA 4G1PA 3VGUA 3HHLA 3Q8SB 3RAMA 1BWEA 1UZDA 4JOUA 4I64A 1HNXF 4I7FB 2BJ7A 1F2GA 4MJKA 2YNHB 4K59A 3H4BA 2CQPA 1VJQA 2QIFA 3I0RB 4CDIA 4JV0A 2CZ9A 1PJ6A 1CJUA 4FVCA 2OH2A 4F2RA 1UWAA 1IJEB 3HVWA 1RAOA 3HSGA 3H98A 2YWGA 3FBCA 4A46A 3M6XA 3W2WA 3BB5A 2EVZA 3QYYA 1KBRA 4O4GB 4WKYA 2DHXA 1Y5LB 3HVTA 2DIUA 3UWTA 3HHDA 2WTFA 2ASLA 1T9UA 3OXLA 4JI3J 5EGYA 4CLTA 2PMWA 4RW6A 3L7PA 2HQFA 4ZPDA 1VRTB 3QZ7A 3NWGA 1DARA 5L1IA 3DOKB 4HEA9 4N47A 1S0VA 2W4PA 2O66A 3D3BJ 3CVKA 3MM8A 3FBEA 1GEHA 1FWLA 2BYCA 3AH6A 3MD3A 1XR7A 2CQHA 2JEGA 4DQPA 5CABA 4DMZA 4C7QA 1UEKA 2DGXA 1X4EA 2YKQA 1YJ9S 3DDKA 3E51A 2Y1IA 4WTOB 2HLTA 4P2FA 5HVHA 3R6GB 3IAS9 5I3UB 3R5AA 4DV2F 4CRJA 5RUBA 4B3TJ 3BKFA 5JXSA 3DNCA 3DM2B 5JMNA 1C1CA 1XMQF 2X7IA 4RWWA 1UP1A 1R8AA 4WWSA 1N6QA 4W92B 1NK8A 1Q79A 1N5YB 1D8ZA 2QG9B 3DLHA 1NLKL 1RT6B 2G9OA 3PVXA 2W2MP 4OV6A 4P2SA 1YZ7A 4OFZA 3FKBA 3OUYA 3SXLA 4X65F 3C3LA 2DNKA 4UT4A 1JLAB 2KL8A 2XYHB 1GMVA 1WG4A 2JFKA 2HAFA 1NDLA 1E6VB 4OX8A 4I4BA 4ED6A 2IRXA 2NUUG 2UVWA 4M5NA 4FPRA 2DGSA 4DV4F 4I2PA 4EZ6A 1TQLA 2J6TA 4IOCQ 3X3UA 4MIWA 2K06A 5KFPA 1RB0A 2IJNA 1PYSB 1QAJA 3TA0A 4OX6A 3S7RA 4FXDA 2EFVA 4J9NA 5KFKA 3HPOA 4Q0BB 1XN9A 3BBBA 2OPQB 3PNIA 3FZ2A 4U96A 4CIOA 5M2UA 1GQEA 3R3TA 2O1PA 4YEAA 3RUBL 2BABA 1DTQB 4OYIA 3VZHA 2KZMA 4FS2A 1IKYB 3R2CJ 2LXUA 4JV2A 2JLEA 1RHQB 1WC3A 1URRA 3D1QA 5I3PA 1N32J 5J2QA 3QRRA 4UY85 3MCMA 2HQ3A 2VPXB 4K7QA 3RTVA 5A2QY 2OPRB 4XPCA 3VCDA 4MK8A 3RBEA 5H1SV 2ZBCA 3C6TA 2R3VA 5L1KA 5IZHA 5JUMA 4LF1A 3OR1B 1JXEA 2UXBF 1NZAA 3FQLA 4OMFG 3RU0A 2FHJA 2HGNA 4WZQA 2OMLA 3O5TB 4HTJA 5EN1A 4AFFA 4PG7A 4OYAA 4LF7F 1DLOA 5L9XA 4QR0A 3KUEA 1FHTA 3D4JA 4NLRA 1OS5A 2R7VA 2CG8A 5LMUF 4ZVTB 1XEZA 4NCAA 4Y2MA 4I2QB 3M2VB 2O67A 3BF4A 2L41A 2ATCB 4DQSA 3QWPA 3OL7A 3OSNA 3CJ2A 2PT0A 1M5OC 4DG1B 2LECA 4ED5A 1IBMJ 1M5VC 4C97A 2M9KA 3W60A 2ZH9A 4ZLPA 2Y3YA 2AYEA 2XGPA 4ZVHA 1UAWA 4NA2A 1R0AB 1MN9A 3N9UC 1G3OA 3TEGA 4ZPBA 1SJ1A 4WP9A 4DV6F 2Q6BA 3H5XA 3DGPA 2XY7A 2PA8D 3CJ5A 1Q7LB 4M94A 4MH8A 1AUDA 4U8YA 5LXRA 4DV7J 5HQMA 1LK7A 2GW8A 2E7WA 2V9WA 1TL7B 3FFIB 2LQJA 2MHEA 2VFRA 3THTA 2LQ8A 3LPYA 2XY6A 4UUWA 3SQGA 3J7A1 3DGVA 4OL8A 3CUNA 1H0HB 4M5GA 5KT4A 1S9EB 1LK5A 1MMDA 2HFSA 2B0GA 5IM0A 1AUSL 1EKRA 4LF6F 3BSAA 4KGXB 1IN0A 5LSRA 3SSSA 3QGGA 2GO8A 1VC5A 3G82B 2CQ0A 3MEDB 5HLFB 3OR2B 1H7XA 2Z4PA 5J2PA 2C3PA 1WKJA 2U1AA 4L3NA 2PMZD 1ROFA 4FPIA 1N4LA 3QLHA 5ETOA 2CVIA 4A8SA 1WHYA 1TL5A 1AA1B 1BLUA 1NMEB 5KFFA 1SKRA 4MKYA 2QMWA 2W4CA 5K14A 3SCLE 4IR9A 3DRRA 4KFBB 4Y2AA 3A1YG 4NLXA 3T5HA 1EETB 1KQKA 1OIAA 2WOMB 2C3YA 4HT7A 1RTDB 5GVQA 3W8GA 4NYOA 3BYPA 2WB4A 1YJNS 4QYZJ 4N8NA 4U8VA 3TZZA 3A3PB 3FSIA 2XMTA 2P6SA 2HVZA 2NXJA 4DL3A 3C15A 4DLEA 3NS5A 1HBNB 2UVVA 3TZYA 1W7WA 2G0CA 1U6BA 1NK7A 1HA1A 4JI7F 2MJUA 3MR5A 1IQTA 2ZEJA 1YQHA 3Q8YA 1WC0A 4CLLA 2CPDA 5DG9A 3TRGA 3VAMA 2J0QD 2GGPB 4FF3A 4GO5X 2L08A 3RGIA 1HR0F 3DI6B 2HBRB 3OTCA 1IUJA 1GK8A 2MQQA 5KOWA 3QSYB 2MKSA 5FDLA 1KOHA 4QPXA 4AL6A 5IOLA 3D1HA 1KC8T 4ZCMA 3D6TB 5ETPA 1XMQJ 1R0CB 2DB1A 1LW0B 1UL3A 1Q8IA 3G9CA 3D6FB 3BH6B 2YX1A 3GYGA 2V69A 5LL6d 4ED3A 2ZHAA 2W4DA 3AJDA 1V3ZA 1MMLA 3NNAA 2QC3A 3AOBA 3FK4A 1IKVB 3PACA 1WUUA 4X64F 2ROGA 3PO4A 3U27A 1K1SA 2HNYA 4X65J 2ZE2B 4ER8A 1L3SA 2V34A 2CQ1A 3KK2B 1X5SA 2EW9A 5IT0A 2NPIA 3IBFB 2GZOA 2M3DA 5ETKA 1N5QA 1Q7YT 1CG2A 3C16A 2ERRA 2J7UA 4FKXA 4M5LA 1U0SA 2KDOA 1TMMA 1FX2A 3H2VE 3GCXP 4ZS6A 4DV4J 3UDVA 3RYLA 3FNNA 4PABA 2KZZA 1YI2S 3AB4B 2Z56B 2CWKA 2DISA 1UJ6A 2QFJA 1BY9A 2MKCA 4OYPA 2W01A 1MWYA 3IBCB 4NLPA 3NNCA 4PYAA 2HZCA 5J2NB 3CJQA 3NCPA 3OXGA 2BQ3A 4U7UD 1RJJA 3TZXA 4C4WA 4B02A 5ETRA 1VC6A 3AXKA 3LF0A 4LQ9A 3KOAA 1RWOB 1LXNA 2VA3A 2RKIB 4DPOA 3HF5A 5JVHQ 3CCMS 3CTRA 4CTAB 5L9NA 3M8QB 4H4OB 2F4VJ 2M0GB 1VLYA 2RIJA 4JV5F 3D54A 5D0RA 1EP4B 5BR8F 2V4JA 1JLEA 3PV8A 5KFSA 4MFBA 3IXQA 5D3GA 3IR6B 1KTQA 1X4FA 2GQQA 1U48A 2LP4A 2UXBJ 2BJEA 3L95X 4TU7A 3I5CA 2RU9A 2M8HA 3T9ZA 1FKPB 3K89A 5CYQB 1VRUB 2EKYA 1FX4A 1Z1ZA 1WDDA 1RKJA 4LF7J 2RF2B 3OVBA 4ZCLA 4LR8A 2QLFB 2V2QA 4WP8A 4LF2A 5LMUJ 1M1GA 5A0YB 2DNQA 2GJ2A 3PYEA 4X66F 3CJTA 1QAXA 2V5HG 2EC2A 2OPSB 3PFOA 3UNYA 2NZCA 2ZH5A 4KT0C 2ZH8A 4Q8FA 2KT3A 2MKJA 5HP1A 2E9TA 4OZ5A 1AW0A 2HLUA 4J90A 2Q1LA 2O5DA 3OLBA 2FY1A 1MLAA 2ZBRA 4H4MB 1LWCB 2V6AA 1TP7A 3OFFA 4RW7B 1CS4B 4KPYA 3D68A 3CC2S 2KJVA 4WTYA 1ZA2B 4MIAA 2X3GA 4DV6J 3P3DA 4IR1A 4LSZB 4JI1F 4IDKB 3PDNA 3R1HA 3RAQA 4CM2A 3KDNA 2XZDB 1AZSB 4F4ZA 3S8SA 4U9RA 3NGKA 5GMDA 2W24A 2YKPA 3PFEA 2QV6A 2PI4A 4ZN3A 1RABB 3ILJA 2LKZA 2Z30B 3JQMA 5A2QU 1PSDA 4BWMA 4RL1A 2J7KA 4OYXA 1MG7A 1R31A 3FGVA 5LMNF 2UV8G 5DG7A 1YJRA 4LF6J 2R8KA 4ID8A 2H5JB 2A3JA 2GFFA 3KG1A 4A8QA 3RAXA 1KHWA 3RG6A 3DLKB 3SDEB 1TKTA 4NXMJ 1TL1A 3DLGA 3H5UA 3IS9B 3EXYA 4ELUA 1O0PA 3MMJA 4DPWA 3LP1A 1CULA 4Y2IA 2MKHA 4HT5A 2V50A 1FK9A 3N5FA 2DEJA 5D6GA 4NYZA 4ES2A 1ZPWX 1Q78A 5D78A 2AZ3A 2FHMA 2ZNZA 2HS0A 1UEVA 4HHHA 5BXIA 4QWAA 2M5YA 5SUHA 4WP3A 3JTNA 2EXUA 1K73T 5J1PA 1Q95G 3KG4A 2AGQA 4USVA 1FNOA 1NDKA 2KFNA 4KO0B 3TJ8A 2BE7D 2CQCA 4GKKJ 1RYRA 4JI7J 3CJSA 4H4KA 3H20A 1RT4A 3NOGA 3JYTA 1YLXA 3QBCA 2ILZA 4I1TA 5ETNA 4O3QA 5F9LA 3CC4S 3KLIA 3CNQP 2IMWP 4OJGA 4P52A 1HR0J 5L1JA 4K5SA 3O44A 5F9NA 1CJTB 5ADZA 2OFHX 2QMUB 2AJ1A 2OKQA 3DN9A 3GJRB 5KG7A 3FSXA 2F7VA 1RLCL 2CPXA 1LWXA 5KFYA 1S0MA 1HFEL 2VIHA 3W5YA 1NUEA 1KEKA 3KJVA 1Q53A 4J9UE 1J5EF 1SXLA 1T9TA 2RH3A 4C48A 5GMKa 4N8OA 1RADB 4X64J 5H9FK 1Y9OA 2DNMA 4E8UA 3SIPB 4AUKA 2DPIA 4IRDA 1K44A 3ZTRA 2F4FA 1FVSA 2R8JA 1NK5A 1SV5A 3NAIA 1KLMB 1QVGR 2I2YA 3BPSP 2QA4G 1BE4A 2BANA 3CT9A 2V68A 4WK3A 2RRAA 1U0HA 2VL1A 3N6NA 1N0UA 5B0EA 2YBVA 2W9CB 2NSCA 3GLJA 4TYAA 1ZM9A 1U26A 3FEXB 4BDPA 3MF5A 4YHHF 5DDRC 2IJRA 2GA7A 3O2IA 2LQ5A 2YPZA 4DQRA 4Y00A 2W1BA 4JP8A 5DQHA 1TTHB 2BACA 3BGUA 1C0UA 3WBZA 3L9ZA 2HHUA 1VDHA 4FXWA 1U7LA 3PW4A 2HWIA 3OLAA 1B99A 2EBGA 1EQ0A 1S6QA 2VF3A 3BKUA 4O3SA 7AT1B 2J0SD 3M2UA 1S76D 2C22A 2D41A 3I4HX 2QRRA 2HKEA 5DGBA 4JV5J 2JH3A 1FEHA 5BR8J 5KT2A 2F40A 3QFHA 2RDJA 5E41A 4K50A 3P4UB 3UD4P 3VAKA 1DTTB 1KHVA 5FJ4A 1WORA 3WIVA 4B9NA 1S6PB 4C11B 3SI8A 2GVZA 1FVQA 4CLYA 3ETOA 1IWAA 1VBXA 2E5HA 3G8QA 2XI3A 1KWMA 4ANCA 2JEFA 3MCOA 2UUTA 2DNLA 1HBOA 3KG0A 1EX8A 2XZWA 4GC7A 1VS3A 5GAEI 2VG6B 3K5OA 1TK5A 4J9RA 1JJ2R 4BC7A 4ZVOB 4ZVRB 4X66J 3D66A 2CZ4A 2KXHA 1CJKA 4YB6A 2FJEB 2XULA 3WDOA 2BW2A 2P6TA 1S1UB 5AJ3F 2C1EB 4HTIA 3BH7B 3GP9A 3POTA 4DZDA 1SL2A 4HACA 1HPZB 1SL0A 4M63A 5B0DA 3R2DJ 1SH0A 5KFEA 2ZBPA 5J1NA 4EZ9A 3M30A 2DIVA 1HWLA 2CKWA 4DFJA 2X1GA 5E5NA 4KGZB 2ALYB 2J9EA 1N33F 4QBUA 2R7XA 3J7ZT 4DUYF 3H42A 3UD5A 1K0VA 4JI1J 4L72B 2XEXA 4AE5A 4ZJQA 4FYDA 3BSCA 4LSNA 1RLDA 2CNKB 2W2QP 1QSYA 2GAGC 5HROA 1S6OA 5AXKA 3O3LA 2DCUB 4DFKA 1UPPA 2MKKA 5G4DA 4M5HA 3GONA 2W25A 2ZM6F 1BMQB 3QPIA 1Q16B 4N7TA 4NLOA 3HKZD 1UA1A 4TU8A 1D0EA 2QFIA 4CM0A 3IM8A 4NI2A 5HMZA 2IRYA 2F3JA 3ETMA 1HBMA 2FVSA 1S57A 1WHXA 3MTKA 3H25A 2HHQA 1T94A 1TAQA 4RUAA 1ULRA 3W2WB 3LANA 3T3FA 4OHZA 2ROPA 1WEZA 1GXTA 3HVTB 3RRGA 3PCOB 3QZ8A 4B3RF 1RT7B 5CQGA 2QE5A 4P74A 2KVQE 5ETVA 2OSQA 1RTJB 4DF8A 3T5LA 2RQCA 3BS9A 2R7SA 3HHEA 5T41A 4DX5A 2VDHA 2XI2A 4YMEA 4YFUA 3IR7B 2YY3A 1RAAB 5B0FA 3MM6A 1S12A 2CQBA 1AFIA 3DMJA 2L9WA 5EUHA 1U45A 1VHIA 3ZFVA 1BGXT 3NGSA 2ZC4A 3TJ9A 2I9SA 2JC0A 4RKUC 1V3RA 4G3IA 1U24A 1TMJA 3KTQA 5E3AA 1TV6B 4Q7AA 2PC6A 2IA6A 4DR2F 1C1CB 4USMA 1IVZA 3G8SA 1M90T 1UJ4A 1U8WA 3CSKA 3K8WA 1UPMB 3AJ2A 3GV7B 2OD4A 1WOOA 1QD1A 1CSJA 4U67Q 1XK8A 3MR7A 4DV1F 3OUYB 5C24A 3VGSA 4V1Ak 3K5PA 4DL4A 4NL5A 4DCOB 5IS2A 3PYGA 4NOHA 2WBMA 2XLIA 4RJVA 1J5EJ 2IYGA 4DSFA 4ZDNA 3TUIC 2BQUA 2YKOA 1S1VA 1NKBA 3Q8RB 3G2XA 4QW9A 1XC9A 4RW8A 2HHSA 4ED0A 3GSDA 4P75A 2UVUA 2RS2A 2QLBB 4OZ1A 2QO3A 3T1HF 4N41A 4X4OA 2B8QA 2BKOA 3MI7X 4WJBA 4ECVA 3MFIA 4TY8B 1T95A 1WNEA 2B7BB 2B9EA 4WIQA 4DL7A 5F0WA 1RTHA 3OBIA 2EC0A 4DL5A 4UQGA 1NSAA 2JVOA 5IC4B 3B8HA 2ZZNA 1SVDA 5DRKA 2ZD1A 4OZNA 4DPUA 3IGNA 4IKAA 3ADAC 3KMSA 2AX0A 4RR5A 5HVFA 3C6TB 1QJHA 4JUZA 3V6JA 1M0SA 3KK3A 1O6XA 2WCXA 3LALA 4QIFA 3LGHA 4WE1A 4QCLA 2QLJB 3M8YA 2FB0A 4NLQA 1N56A 2OTJS 1ZOTA 1S99A 3SEOA 4LFAF 3KLHA 1I6JA 4E2FB 5KFLA 4OLOA 4PYDA 3UW1A 4RW4A 5THWA 3PIOQ 1WKKA 5L1LA 3KHHA 5D0GA 2HFVA 4DUZF 3ULHA 2KM8B 2IBOA 3VGVA 3D6MB 2YKMB 2HVEA 2IIHA 2R2SA 3JQKA 3IWNC 2DY9A 2G2ZA 4F4XA 4Q45A 3GR0A 2E5JA 2I1RA 4U7CA 4DR3J 5IFMA 4KY3A 2YVSA 3W64A 4TLQA 2E44A 2IAJA 4OLPA 2OIHA 3KNAA 3CCVS 3BM7A 2FJWA 1G1XA 2FDNA 2HIYA 2ZZMA 3HCXA 3EWGA 1T03A 5EDWA 4PR6A 2L9NA 3WC2A 4PQUB 3CC7S 2CJKA 1YIJS 5KFVA 5AJ3J 2ZDPA 5AXMA 3QQCD 3CDWA 3V4IA 4R8UA 2W9AA 1F1BB 3IRXB 2RJZA 3RR7A 3OPKA 2R7TA 5B0CA 1MU2B 1Q81T 4P73A 1BUXA 3SQGB 1NKCA 1HD0A 1IJFB 3PTWA 1S1XA 2DNOA 3H0PA 1N33J 2DNRA 4OYMA 4ZCIA 3BYRA 1FDNA 2AT1B 2ZH1A 1NJYA 2J9CA 1NCLA 1FKOA 4J91A 2C42A 3D0HE 1VIOA 1IKWA 1V5VA 3WC0A 3I5AA 3QAUA 2V94A 3OL8A 3MR3A 4C8NA 4M5IA 5KTQA 1UFLA 1U6FA 3A3OB 1KDNA 4ERDA 5HJYA 5J2PB 5H9FJ 4LIWA 4TY9A 5KG6A 2IA0A 3MMCB 5FD1A 1H72C 3S1TA 2FJDB 3PW5A 2CQ3A 3QLHB 4ZVSB 1R0BG 5K14B 1RACB 4HDHA 3TUPA 5H9EK 1IXKA 2KKHA 4C8MA 1J2VA 2E29A 3RB4A 5HMWA 1TK8A 1KNZA 4CLFA 3LOUA 3MM7A 4DR5F 2YX4A 4EK2A 2CVEA 2HBQB 1PO6A 2XMMA 3GCWP 2DVIA 3RZAA 4M1KA 4ZVUB 3B82A 3WZ0A 3TX8A 2B9YA 2MTLA 2KU7A 1RTZA 4CO3A 1SQGA 4CT8A 4LJMA 1XMOF 5LJ5Y 4OQJA 1VOMA 4GRSA 2HWTA 4UOGA 2ZJPQ 5E7OB 3GR1A 3CJKA 3BO4A 1WEXA 1YRXA 3UVJA 3AXMA 3M1VA 2Q3PA 2JC1A 2FLNA 4A4JA 2ADBA 3D67A 2GCFA 4DR2J 3AOAA 1RT1A 4DUTA 3LUYA 3J80Y 1REVA 4Y65A 3K5LA 1LKZA 5KG5A 2R8IA 1T02A 2CNNB 3R6LB 5B08A 3AQOA 1UVKA 4DEZA 3FCHA 2BMBA 3P96A 2VFVA 1Q8LA 4AD6A 2OFGX 4DV1J 3PEJA 2OD6A 1Z2LA 2NCKL 1U1RA 4J9PA 4F4AA 5DDPC 4LUBA 4DCPB 1WG5A 5KFUA 1F9EB 2AJ0A 3F56A 1B64A 3AD8C 3TUJC 1U1NA 3IBWA 4ILRA 3C16B 1CPZA 3GIKA 2MZRA 1R6VA 3GJQB 1D9FA 3ET6A 2IM2A 2XLJA 3TO8A 1PJ5A 1OPZA 4EO6A 3DOLA 5CYMA 2BQRA 4P2MA 2LDYA 4C8OA 1NM2A 1U1MA 3VAHA 1R3NA 5F0UA 2D3O1 2XSJA 3T1HJ 1RT5A 1NK9A 3RBXA 3I6PA 3VVTA 2UUWA 2MQOA 2V2ZA 3KNGA 4LRCA 3MXHP 1CC7A 3R97A 2ABYA 3OVAA 3MMBA 5IQ6A 4EBEA 3KUGA 2ASYA 4F0HA 3CIMA 3JSMA 4ZPAA 4S0MA 2XMWA 2OTLS 4TKTA 3HKWA 5FLXY 3R5GA 4EBDA 2PEBA 4ZHRA 5C7PA 1S72S 1FESA 2V4JB 4TXSA 4MFBB 3HDSA 1C1BA 4P72A 1Q0NA 5D3GB 2HNDA 1NEEA 2I5JB 3QIPA 3IFEA 2Z2LA 4HKQA 3DC2A 1X4HA 1QE1A 4IUFA 3GSIA 2E1RA 4RZRA 4X4VA 4YB5A 1LWEA 4LFAJ 2QEXS 2ZC3A 2DNZA 2AZ1A 2BRKA 4DZ6A 2CIMA 2HGLA 2RQMA 3NAHA 4K4YA 3WIUA 1LEOA 1F9FA 1Y5NB 2YQ0A 3JTOA 2M2BA 5GAHU 3WHIA 1PCAA 2R7RA 4USHA 2CNLB 2QGFB 1VJWA 2D69A 2HNZA 2QA1A 4A8WA 2AWZA 4J9QA 1T05A 2DBBA 3JSBA 4RNFA 3CCES 3ZZPA 2XWYA 1W25A 4ECQA 3PZPA 3T6BA 3FCWA 3DHWC 2KT5A 3UD3P 3ITHA 1U1KA 3I5BA 5KG1A 2YKNA 1FE4A 2HRYA 3HO1A 4QR1A 3Q86A 2VJUA 4NE9C 2DXFA 1RHMB 3BBFA 2RDIA 2R7WA 1U02A 4WPAA 3M2RA 4WYLA 2LEBA 5KG0A 3HFKA 2GAHC 2DKOB 2CNOB 3OV7A 2KHCA 4DPYA 2HURA 1R43A 1RI7A 4ZPVR 3EDQB 2Z2MA 4JI5F 5L46A 3MCNA 3H8YA 1YTYA 1S9FA 4M5DA 4DCJB 2N7YA 3N5BA 1X4DA 1N36J 4ZN1A 5SZTA 2OO4A 4FNHA 5IXUA 1JLFA 3A8KA 3L3CA 2MZSA 4ALZA 3CJ3A 1HHQA 3KMQA 2C3UA 5KT3A 4K5RA 4UW2A 3M8WA 3QSIA 5B0BA 4L76A 2RT3A 2LFVA 1TKTB 1HNIA 3UE2A 3F44A 1TL1B 3DLGB 1AROP 4I67A 3EVWA 1YG0A 1FRMA 1HQ2A 3HULA 3I55S 2MZJA 4WCEQ 3TX0A 3M8PA 4EI2A 2DNGA 3ZZRA 3EVMA 1RBLA 4OI1A 2XLKA 4ECXA 4TN2A 4EU0A 4DR5J 1QTMA 3KLFA 3PRDA 4RUCA 4B9MA 1SIZA 5BYSA 3ZNJ1 2DITA 3Q23A 2FY8A 4J9VA 4EYHB 1NDPA 4H54A 4JBCA 1RTIA 1J5OB 3JSRA 2KO1A 4FXVA 2RUSA 2IVYA 4X4QA 2FLPA 1F3FA 1PGZA 3DLJA 1NJZA 1VQPS 5B7WA 2IMOA 2FLLA 4LR7A 1VQ7S 1R8PA 3K7RA 5J2MA 1RT4B 1NPKA 2GJFA 2SXLA 1CC8A 3JYTB 4K4XA 2L48A 2E5LF 3KLIB 2MMYA 3M7VA 5T7LA 1XMBA 5HN0A 4K4WA 5G0RB 1LOUA 1Q86T 2NYHA 2P9EA 2FJVA 3BR9A 3MAQA 4WFNQ 4X4RA 3FVYA 1X5PA 3BZQA 3UO0A 1U47A 3VQTA 5C2CA 4YN3B 2OPPB 8RUCA 3QT8A 3NGRA 1IWGA 2FGOA 3LAKA 3KJVB 2YWFA 2YWHA 2DGWA 3OL6A 1YBUA 4R5PB 3CD6S 4ETXA 1C2PA 2PE8A 3HZGA 2JJ4D 4FVMA 1UVLA 3H2LA 3G6XA 2NYIA 4ZP6A 4O44B 1QUPA 3DRXA 4KRWA 2Q43A 3ILIA 3T19A 2Y8YA 5GAGI 1UVNA 4P7TA 4F26A 2BW7A 2HVDA 1FJGJ 2PA3A 1FKAF 4RBVA 2NZ4A 2YWWA 5F8JA 2X51A 2MYFA 5DZ7A 2ATLA 4RNNA 1HWKA 1HYSA 4IFVA 3FRZA 1O8BA 3T5JA 4F8RA 2QA4S 3ENVA 3LAMA 1NXIA 2H4WB 3LQVA 1SIWB 4CNZA 1T9WA 2POKA 3MWBA 4C8LA 3ISZA 3O1LA 1R8HA 1FCAA 1C0UB 5D4NA 5DLGA 2VODA 1F5CA 3M32A 3GB0A 2ZVSA 4WZMA 3IG1B 1AT1B 5I3QA 2YNHA 1RHKB 3LO3A 4GVBA 3CE8A 4YY3F 2AGPA 1S6QB 3MZIA 3M2UB 3BSOA 4DR1F 1TKXB 2JZ5A 1RT2A 3UR3C 3CDAA 1HQUA 4AXJA 3CMES 3HVRA 2GHVC 3I56S 1WSVA 5B09A 1V3SA 1OQ3A 2GVDB 1WI8A 4HI1A 3LP0A 2UUBF 3DU5A 3J80U 1HLWA 1F0XA 1OMSA 1IBCB 5H9EJ 2LQBA 5KFXA 2GVZB 2YNIA 2KT2A 5GADU 2V63A 3M05A 3QJJA 1HBOB 3PX4A 1XNQJ 1MWZA 2L9DA 3DOKA 2VA2A 3HM9A 4U7UK 1LXJA 5KFWA 2F9DA 3BGLA 4M5JA 3MGJA 4YR3A 3QIDA 5DQIA 4KTQA 2K1RA 3H7HB 4LMZA 2EWHA 4IO9Q 3HSDA 3FJ2A 2OLWA 5B0AA 3K59A 4O3OA 3RRHA 1FXRA 2EFNA 4IG3A 3EUNA 1WD6A 3POTB 1RQ0A 3NMRA 4HACB 4Y34A 4FYVB 1YBAA 1UFKA 3B4DA 3M30B 1HI0P 2V2KA 1WOSA 5U47A 3D6HB 3K58A 2GQ2A 4B08A 3G6VA 2CDRB 1OWXA 4I6WA 4PXBA 1N5YA 2VKZG 2J5AA 2VZ9A 4W98A 1RT6A 5EX0A 2BJ3A 1L5UA 3NCQA 4FF1A 1JNRB 1IBMF 4ECUA 3RBDA 4GKJF 2N3LA 2OELA 2HK3A 3EMTA 3MECA 3TEHB 1OY9A 4JV1A 4ENOA 3NBPA 3LW5C 4OYBA 5FLXU 1JLAA 2J0WA 3C2PA 2FLOA 4FNIA 1E6VA 1URNA 1U2RA 3MD1A 4ED8A 2KG1A 4NI2B 1BC6A 4MKAA 2LXIA 1KOOA 2VPYB 1TZ0A 1IKXB 3F41A 3EGWB 2XS7A 1H2TZ 3UNGC 1TR0A 3GQCA 4K8RA 1RXOB 1RWKB 4Q0BA 1EB0A 2OPQA 4PWUA 3ZZUA 5KOXA 2M52A 5E3CA 2CZVC 5DLFA 1VHFA 5K20B 3TVKA 1Q1KA 4F3MA 1IKYA 1FT8A 1SPBP 4WFAQ 2ALZA 2VQFJ 2DNHA 3TP2A 3VR1A 3I4PA 3QFWA 4NCGB 1I5OB 1SC6A 3MM6B 2IY5B 5T14A 3M9OB 4QIGA 3DMJB 4PG8A 1KP6A 4J9KA 4LRAA 3FQKA 2RSQA 1SC1B 1HBUB 2JRSA 2MGZA 1NJXA 4DSJA 2GV1A 2IDEA 4LRBA 2H4YB 3U7JA 4KH1B 1UVMA 1WSRA 3NMAA 3UDLA 5IC6B 4CLPA 4NLVA 2EG2A 3SZ2A 4EO8A 4KJIA 5KFMA 5CZVA 2E5LJ 4DU7A 5L8RC 4QU6A 3GYXB 3MAAA 3KHRA 2VDIA 1BXNA 3FBFA 3NOCA 2ZH4A 2B4PA 3I9ZA 2KFYA 2RHQB 1WC6A 5C24B 3KJNB 2V67A 4OHWA 2HGMA 4Y0FA 2APOA 1EAYC 2ZH2A 1SKUB 2M70A 3M4XA 2VUGA 3HI9A 4CNYA 3P6YC 1HW9A 2E7VA 4OX9J 1RT3A 4G65A 1T9VA 3MDFA 4CLSA 4F0KA 2DGTA 1X60A 4J7CA 5HJXA 5AXNA 4ILMA 2VV5A 1P27B 3CDBA 3T1YJ 1D9DA 1RAEB 3BKTA 1GMUA 1FD2A 1R0AA 4DR6J 4CO2A 4C6AA 4U95A 1MNEA 4QWEA 3J7Z5 4ED4A 4ED2A 1RWUA 2IVFB 1T9YA 2VPZB 1HWIA 2MSSA 1ZBTA 2H65B 1CEZA 2E1PA 2H9ZA 1LWFB 5E3QA 4ZITA 2HMIA 1P8GA 4ZLLA 1LQ9A 4BHQA 3B54A 3KXDA 2DXEA 3I87A 2PFFB 1DURA 2ZD1B 1S9EA 3DLEB 4Z2XA 2BKPA 4QYRA 5HSPA 1YBTA 2P2CB 3QJLA 1XERA 1S4EA 2MLYA 1S59A 3MR6A 3MFHA 2KI2A 4C8KA 2MJNA 4UZCA 1T7PA 1HI1A 1S1TB 3UR0A 4WE1B 2J6UA 4URQU 3NP5A 3G82A 4YY3J 2XCAA 5HLFA 3OR2A 3AQPA 4DR1J 5LT5A 2DJWA 3KLHB 4M5MA 2HHWA 2C2DA 2LYVA 2Z2YB 3EZUA 1HMVA 4RW4B 4P7VA 1XBWA 3RJMB 2XMVA 2QLXA 1JX4A 1MWQA 4DPTA 3W9JA 4Q5VA 3QAEA 1OYEA 4CCHA 4OHYA 4KFBA 4HLBA 2UUBJ 3ZNUA 2Y9HA 3KKFA 1KD1T 2VBWA 5AE3A 2WOMA 1YKWA 4FKYA 1BQNA 4KKOA 3CJRA 2XS2A 2F4VF 4RU2A 2K3IA 2J8AA 2Q79A 1N8RT 3NLCA 2ZKUA 2R2TA 3S01A 2IAJB 2ZH3A 1HBNA 3K57A 4NLDA 5HAOA 4KHPF 1YJTA 3OHBA 1WWHA 3CF5Q 3OVSA 1VLOA 2JNJA 4QU7A 3GIRA 3TI0A 2KG0A 1VRQC 2UUCJ 2B6AB 4KQZA 2DH8A 3LGMA 2CG4A 2GGPA 3L09A 3V6DB 4DU8A 1FTRA 5I42B 4P9SA 4MT1A 2K2PA 4HH0A 3VVUA 1ZS6A 2MZ1A 3P45B 1S1XB 4ES3A 1M1HA 5IT9Y 3UN3A 4K2XA 1LW0A 3T1AA 3SV4A 2GHWA 4ZVEA 2KN4A 3RB0A 4DBQA 3BO3A 1S97A 3U1MA 2WVEA 2QN6B 4GO7X 4PXCA 2NS1B 1F9HA 1IKWB 1TK0A 4ZCKA 4Z7YA 2IRUA 5L38A 3VAIA 2JOQA 4GKJJ 1UEUA 1NSKL 4NX9A 3KLEB 2DGQA 1RE1B 5IQQA 5KG4A 3PKMA 4C8YA 2OSRA 3DHXA 2GS8A 2BV3A 3CCRS 3OW2R 4ICLA 4PG6A 3W3SA 3EZ5A 2CFXA 3PO5A 1UFWA 4RO0A 4QZVB 3BQ0A 4TYBA 1FNMA 5HVGA 1H7WA 2YQ1A 3MM7B 2HSEB 1Q8BA 3NEKA 3PKYA 1WC1A 2HVIA 2D3UA 2JSXA 1X9MA 5HO4A 5D4OA 3GG1A 3I0SA 1IBLJ 2B51A 3LTOA 5J2NA 3MHYA 1NPPA 3MOZA 2H1YA 4CYUB 1S4FA 3N6LA 1GTEA 1X31C 2HQCA 3W5ZA 4QPTA 1R7IA 2AYGA 2F5GA 2Y0SD 1VQNS 3WX4A 4CWBA 5KFBA 3VALA 1H6KX 1H98A 4Y28C 2RKIA 3BEGB 3LH2S 4YB1P 3C66A 4NXMF 3M8QA 1B7FA 2ZWOA 5E3RA 2PSZA 3MEEA 1A7GE 4FYYB 2Y1RI 3HT3A 4IFYA 2DHAA 3CJKB 1T0TV 1EP4A 1TL4A 4WXWA 3R5DA 4ECTA 1FD8A 1G6BA 3UVJB 2B56A 2EFPA 1QAYA 2MLZA 3MMAB 4RLEA 3CW2C 2JVRA 4G6VB 3M6UA 4A8OA 2FYXA 3D0GE 1VBYA 1RT1B 4ZLNA 2O01C 3NGUA 3BJYA 2FIUA 1REVB 1C0TA 4QR2A 1FKPA 4PQAA 3V6HA 1FRIA 1C4CA 2OEMA 1VQOS 2E5GA 4O3RA 2DD8S 3W2VB 4I6AA 2RF2A 1GXUA 4F0MA 1YZ6A 4OI2A 1SJFA 5DZ6A 2QA2A 3OXFA 5A8RB 4DOZA 4GKKF 2YNGB 1U1QA 2PMHA 2RU3A 1AYEA 1X9SA 3OFGA 1FFSB 1XWLA 1Q4RA 5A0YA 3BR8A 3CCSS 3ZXWA 1BQXA 2MHNA 4PZVA 1EQMA 3ET6B 1SUQA 2AEFA 2DXDA 5HANA 1MSWD 1U8SA 4H4MA 3DOLB 4CLWA 4DQQA 1MMNA 5CYMB 1OJ4A 2Y0BB 4LR9A 3OT9A 4RW7A 2YTCA 1CS4A 2R2UA 2JEJA 2IM3A 4ZPWR 2MQ8A 1FA0A 4NMLA 4R25A 2MY8A 3JTPA 2XSJB 1Y00A 2OP5A 4IDKA 1FDAA 2B4VA 3DDNA 1IR1A 4KC5A 4N5SA 5CAAA 2WVDA 4USJC 1OPIA 4MK7A 4MYTA 3BN4A 2PIIA 1J27A 1KKHA 2BJ1A 3DYAA 3EPIA 3R5JB 2OEKA 5JJBA 3OTDA 5F3ZA 4RW9A 1S49A 4FF2A 4URSA 3ZZOA 4CO0A 1YJUA 4XTTA 2MLXA 3TAQA 4X4SA 4V19J 3ZZZA 3RBZA 2Z57B 1DQ8A 4LBIA 3CCLS 1XNRJ 1NJWA 3K8VA 3GFZA 1RU2A 3DLKA 2BZ2A 1B70B 3SDEA 3OTBA 3MM9A 2ZOGA 1VQSA 1JLCB 1PG5B 3CPWR 2J9DE 1WF1A 3PIPQ 3BN7A 3M6WA 4Q2MA 2BEFA 3GPAA 1YJVA 2V8HA 3ZC4A 3DOMA 1H73A 3OQ2A 5A76A 5A8KA 3PHTA 2IC3B 4B3OA 2HNZB 4PXEA 1T05B 4LT6A 5KFGA 1YITS 3D3CJ 1VIXA 2P5VA 1YVFA 2LU1A 3EX7B 4HVZA 3B4MA 2RRNA 5BJRA 2EK6A 2AMCB 3ITHB 3M8ZA 5LOQA 2KVIA 1SKWA 5A6PA 5DJBA 2YX7A 4X4PA 4KHPJ 5ETLA 2CJBA 1VQYA 4WFYA 1H38A 3HSJA 3GYNA 1ZYQA 2BOPA 4LF4F 4L6V3 4UOFA 4X84A 2LVWA 3C14A 1JLQA 3BPDA 5KFTA 2CWXA 2IJFA 4F50A 2NLWA 4F4YA 5HQLA 2OEJA 2VQEF 4XPEA 2W2OP 4I56A 2AV5A 4ATNA 4FF4A 3EJMA 5EWFA 3IR5B 1G4CA 5F3TA 2CXEA 2Y1LB 2VH7A 4DX8H 2YQ3A 3HXMA 2ASDA 1EJ7L 2B9XA 1WG1A 3V5RA 3QGIA 4R0JA 1JLFB 1TFYA 4ID5B 3OSPA 2ZHBA 1YRTA 1X7VA 2LDIA 1ELOA 1VISA 3MPYA 1HHTP 3HLUA 1CVJA 4OIXA 4ECZA 2K3KA 4CQ1A 2ZH6A 2KYXA 2I8EA 2QYCA 2FTRA 4QIEA 3BBCA 3CO0P 4UOCA 4Y3CA 1YDLA 4J9SA 5C42A 3FDSA 3M8PB 3EZOA 2DK2A 1X4BA 1RBOB 4F7VA 2JLGA 2QX0A 2OI2A 3HHNB 2ZNYA 2XMKA 4K2JA 4QYZK 2C2NA 5ETQA 3TVZA 2C2KB 2XGQA 3KLFB 3JB9k 4RBTA 1FWKA 4LFBF 3OD2A 4L3KA 1ZTTA 1FFWB 1TL3A 3KWMA 3NCRA 1UA0A 2C2OB 4ZP7A 2HVHA 2NXNA 4P71A 1RTIB 1MROB 2GX8A 4ZP8A 2IYIA 5DQGA 1JKHB 4LSLA 4F3OA 2HAIA 2RILA 1NU4A 1HQEA 4GMKA 3ZTSA 3QO9A 4LF8F 1LFWA 4ZKAA 1U4BA 4KH0B 1TVRA 3SV3A 4KIAA 2WONA 2LA4A 3RW6A 1H2UX 4XO0A 1P9QC 1F2HA 4PAAA 3P5BP 2QSWA 2HZAA 4A8KA 3FZBA 1U49A 2ZUGA 1RSCA 2ACMA 3IGVA 2WVBA 3OHAA 5E3PA 4JI4F 4QIWD 3VTIA 5IT9U 3Q0AA 3TWZA 1EIYB 9RUBA 3G8TA 4DR7F 1D9AA 2J8SA 4P6QA 3QGPA 1VCTA 3EGNA 2ZJQQ 1RUSA 2FC8A 3D9BA 4RUHA 3KLGA 1IM6A 4LVOP 4MKVA 1VQ8S 1PILA 2CPEA 4FN5A 3FC9A 2X1FA 3U1LA 2D3ZA 3A12A 4NWBA 1PIEA 1JWWA 3FMWA 3G71S 5KFHA 2VG6A 2I0XA 1Q5VA 3ZZYA 2UXCF 2DHHA 3M9NB 5BYQA 2WW4A 4DLGA 2VOOA 2E9RX 4A8YA 3CD7A 3AD9C 1KFSA 1S5ZA 1SH2A 2RDDA 2ZUAA 1HWUA 2RB7A 4HL9A 2AJQA 2AEJA 2KYZA 1PYOB 1HYSB 5KFJA 3OFHA 3SSRA 2QSFA 4F2SA 3UDCA 4U6PA 1FO1A 3JAMY 4DV5F 4K4TA 1X9WA 1PBAA 4HDGA 2DH9A 2Y1JA 5AE2A 4O4RA 2BM0A 3EPGA 3AOCA 5KAKA 4DFPA 4DL0C 2M4MA 3NNHA 3QWUA 5DDOC 3M32B 2ZZTA 1V5IB 2R8GA 4GVBB 1RWVB 2ZVIA 2E66A 3R5BA 1RT2B 2L3MA 1HW8A 1JLGB 4FDFA 1HQUB 2ZFHA 4YDDB 1OO0B 3AB2B 1L3TA 2D7SA 3BV8A 2VOPA 3MM5A 3FEZA 3ELHA 3V6KA 2F8EX 3GIJA 4YUDA 2KFZA 3LP0B 4I0WA 3ZTQA 1YJWS 3ICLA 4YOEA 4QWCA 4QWBA 4ZJLA 3UQSA 4WFZA 2YNIB 1RT7A 4CO5A 4HYKA 2PN6A 4W4MA 1HKAA 1RTJA 4JI0F 1FERA 4FYXB 1XTZA 1VQ5S 2YXLA 5HMYA 5EX3A 5KG2A 2RQ4A 3B78A 1T3NA 2VU5A 4WFBQ 2K7JA 3TA2A 1DRZA 2K1RB 4LFCF 4O3NA 1GTHA 5GMEA 2B5JB 5D77A 2V2VA 2H3EB 2MZQA 3VF0B 2YH1A 4IG3B 5LSOA 2XQCA 2OUGA 4LF5F 1WACA 1Y3KA 2J7WA 2LCWA 2EK1A 4IOAQ 3CXCR 3UCUP 4UOHA 2XCPA 3DCAA 2VG5B 3GTYX 3MPVA 3Q24A 1HNWJ 2AJ4A 1TV6A 4DV0J 4LF4J 4OJ1A 3NL0A 3BQ2A 3F73A 2GQCA 4JYAF 5D15A 3MEGB 1HNVA 1Y10A 2GC8A 4DR3F 4KV8A 3DRSB 2VQEJ 4N76A 4GVLA 1OY6A 1I51B 2BBEA 4ANDA 1UVJA 4FP9A 2MDAA 4LBHA 2LMIA 2DO4A 5K8PA 3MECB 2HIQA 3KYLA 4Q44A 1RK8A 3NBPB 3H5YA 2CDQA 1PC5A 2W7PA 2EFOA 4ECSA 1P1TA 1TKZB 2H5EA 3ENQA 3GV8B 4PWDA 2XB2D 5AXLA 2XSFA 2KRBA 2AGOA 2DRAA 3CCWA 3HK2A 3MUVP 1F5AA 1Y3JA 1YGYA 4N56A 1HNZF 3BGRB 1S1WA 2FVQA 4ZMMA 2CQDA 5J1EB 4YDXA 2EFQA 3TAMB 2XWXA 3BDEA 1NHUA 1LW2B 3UPFA 2CJXB 3HHLB 3KJFB 3Q8PB 3SCJE 3AA8A 4TY8A 1FTCA 2X3DA 2ROEA 2EKNA 4DL6A 2BR0A 4A47A 4UTGA 4FBTA 2BE9B 3K2YA 2ZH7A 4LFBJ 4K4SA 2FJAB 1CQNA 5F8GA 3R5CA 4RWXA 3THPA 3QMQA 3HFVA 3ZZ0A 1CJUB 2A10A 2DGOA 2MGZB 1CJVA 2C2ZB 3RB6A 2VBYA 1X0PA 3V4MA 2NQPA 4YS2A 2JL9A 3OTOJ 5I4MA 1ZM3A 2M8DB 4C3KA 2BJ8A 4XAKA 4LF8J 2AEMA 1NDCA 2R9LA 2IHR1 3MEKA
chains in the Genus database with same CATH topology
2ZVSA 2JHEA 4DN9A 2GO9A 4WZMA 3IG1B 2BUNA 4JI1F 1KS2A 5A8RA 4IDKB 3TR5A 3PDNA 4DL2A 5I3QA 2YNHA 2YNGA 4RW6B 2EG1A 3R1HA 3RAQA 1H3DA 3LO3A 4PRFA 2VONA 3CE8A 4YY3F 1T03B 4F4ZA 3S8SA 2AGPA 1S6QB 3NGKA 4U9RA 3MZIA 3M2UB 3BSOA 4DR1F 1TKXB 2W24A 4EBCA 1QVFR 4ITSA 2JZ5A 2YKPA 1RT2A 3UR3C 3PFEA 4D3HA 3MOJB 2QV6A 3PX0A 4ELVA 1JJ4A 2PI4A 3CDAA 1HQUA 4OI3A 4AXJA 1E6YB 3MM8B 2YKMA 1NH8A 3ISNC 2YH0A 2NSBA 3CMES 4I6YA 2LKZA 4QIVA 1QSSA 3HVRA 3IRWP 2GHVC 1GX5A 1NO8A 2ZKTA 3I56S 3W7BA 5B09A 1V3SA 1RAJA 4RBUA 3DI6A 3I82A 4CZCA 3V2UC 1PSDA 4BWMA 3V4IB 4PG5A 4R8UB 2HPUA 4EYIB 2J7KA 1KQFB 1OQ3A 3BO2A 3RW7A 1WI8A 1R31A 4HI1A 3FGVA 5LMNF 1K0TA 2UV8G 3G4SS 3LP0A 1YJRA 5DG7A 2XNQA 1RT3B 2VFTA 2UUBF 3FSYA 1ZZFA 1I94F 3DU5A 2R8KA 3TW0A 4ID8A 4Z37A 1JK9B 4N77A 1F0XA 5IWAF 3M6VA 5KT6A 3IA0A 4ES1A 2JEIA 4NA1A 5CYJA 2LQBA 5H9EJ 4ZP9A 5KFXA 2A3JA 1VBZA 2GFFA 2F8MA 3N28A 2YNIA 2KT2A 3KG1A 4A8QA 3RAXA 1KHWA 5GADU 3DLKB 3AY0A 1FKOB 3SDEB 3M05A 4J9LA 2XS5A 4R0EA 4FS1A 3P5TL 1IKVA 2ZOFA 3QJJA 1TKTA 1HBOB 3MAHA 3PX4A 1TL1A 1MWZA 3DLGA 2EFGA 2L9DA 3DOKA 2VA2A 3H5UA 1N6QB 3HM9A 3IS9B 3EXYA 4IH6A 1WHVA 1O0PA 4ELUA 4U7UK 1LXJA 5KFWA 2F9DA 4PQUA 3MMJA 4TQRA 2MSTA 3BGLA 3HMJG 4G1IA 3LP1A 3MGJA 3ONQA 5K8NA 2YNFA 4YR3A 2XC9A 4TU9A 2ZE2A 3GFYA 3QIDA 5DQIA 2KM8C 4B17A 4KTQA 4Y2IA 2K1RA 4LMZA 2NREA 3KK2A 2EWHA 2YWEA 2MKHA 4IO9Q 4QOTA 2AX1A 2CRLA 4DSLA 2G4BA 2NR0A 3IRXA 3FJ2A 2MKIA 2OLWA 4HT5A 1SBRA 1FXDA 5B0AA 2IM1A 4M95A 3K59A 4O3OA 1FK9A 3RRHA 1MU2A 1FXRA 3N5FA 2EFNA 2PI5A 2HMIB 4IG3A 3EUNA 2YWKA 5D6GA 1WD6A 4NYZA 4ES2A 4OHXA 3OL9A 1ZPWX 1Q78A 1QLNA 4F02A 5D78A 3POTB 1RQ0A 5HBMA 2JDJA 3NMRA 1S9GB 1BD6A 1KSPA 4Y34A 3GIIA 2FHMA 1YBAA 1VFJA 2ZNZA 2MQLA 3LP2A 2HS0A 3GZ7A 2FJBB 3DRPB 1UEVA 3KK1A 4Y6IA 4F25A 1H2VZ 5KFDA 3B4DA 3M30B 3PW7A 4JI6F 1HI0P 2V2KA 2KJWA 4X4UA 5U47A 3T5KA 4QWAA 2M5YA 4F67