3R7SB

Crystal structure of apo caspase2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7sB00
3R7BB 3KJNB 1RWWB 2H54B 1I51B 4ZVRB 4LSZB 3GJQB 5IC4B 2C2ZB 2XZTB 1RWVB 4DCPB 2QL7B 3SIPB 3GJRB 2DKOB 2QL9B 3IBCB 2Y0BB 2H5IB 2QLFB 1I3OB 3R6GB 3R7NB 4DCOB 3GJSB 2QLJB 1SC1B 1RWPB 1RWXB 2XYGB 3P45B 5IC6B 2XZDB 3R5JB 2C2KB 3P4UB 1RE1B 2H51B 2CJYB 1NMEB 1SC4B 2H4WB 2H5JB 3R6LB 1ICEB 1IBCB 1GFWB 3KJQB 3EDQB 5K20B 2QLBB 2CNKB 2H4YB 1PAUB 2XYHB 4DCJB 3D6FB 2HBRB 3QNWB 2HBZB 1PYOB 1SC3B 1F9EB 2H65B 4ZVQB 1RWKB 3KJFB 1QTNB 2CNLB 2Y1LB 1RWNB 3D6HB 1RHQB 1RWOB 2HBQB 2CDRB 3GJTB 2C2MB 4ZVSB 4ZVUB 2P2CB 2C2OB 1RHRB 1RHKB 2FQQB 4JB8B 4ZVTB 1BMQB 2C1EB 1RWMB 2XYPB 2HBYB 1RHMB 3RJMB 3NS7B 2H48B 2CJXB 2CNNB 3D6MB 2QL5B 4ZVOB 4ZVPB 3EDRB 2CNOB 3R7SB 1RHUB 3IBFB 1RHJB 1QDUB
chains in the Genus database with same CATH superfamily
4F0MA 1DZ5A 1LWEA 3HHLC 4HHHA 4DCPB 4LT6A 1Y11A 2DKOB 5HQLA 4X64F 1SKRA 2ZOGA 4X4PA 1RYRA 2Z4PA 2J76E 2KKHA 3WZ0A 4DCOB 3MR5A 1T3NA 3CD0A 2K7JA 3ET6B 3PW2A 4IFVB 3Q89A 1NMEB 3RBDA 3O8WA 2ZH1A 1ZTWA 4NCGB 3ZNUA 3OTOJ 4YR0A 3C6UB 3TR5A 4USMA 2AMCB 5DO2A 4A8XA 1UA1A 2CZVC 1SJ1A 1VC5A 1NCLA 2EWHA 3SV4A 1YTYA 2JC0A 2QA2A 1IWAA 2HQFA 4YOEA 4ECVA 1WTFA 3UD4P 2HYIB 2KT2A 2X1BA 5A8RB 2FVQA 4IOAQ 4LF6J 2U2FA 4F3MA 4P73A 2ABYA 2ZC4A 4JYAJ 2MQMA 1H98A 2YQ1A 2KB2A 3DI6A 3OTCA 1HBUB 2G2OA 4R8UB 1N33J 1YHQS 3W2WA 2N3LA 4ZP8A 4QWAA 2NXCA 4NXMF 1F3VA 2PT0A 1D3WA 3M2VB 3AD9C 1SC1B 1TL3B 1FJGF 1R6VA 2Z8QA 2GA7A 2KG0A 3CCRS 1FKPB 4OLPA 3EZOA 4K4ZA 3N01A 2RKIB 1DLOB 5KFVA 4NLWA 2JNJA 4FDFA 2FC9A 4B3OA 5D4OA 2HK3A 4J9RA 4CM2A 5GAEU 2HGLA 5LMUF 3RYLA 2CVEA 2FY8A 1PKUA 3ZC4A 3HO1A 3T19A 3UWTA 1TKTB 1NPPA 2LEPA 1FRKA 3HFZB 4EU0A 3MMBA 2IYIA 4LF9F 1SC6A 3K8VA 2VG7B 4G6VB 1UEVA 4ZHRA 1FFSB 3MM7A 2EFOA 2GMHA 1K73T 3N6NA 3IP0A 1RHJB 1UW4A 1M1KT 4B3MJ 5EX3A 3DLLQ 2XEXA 3W5ZA 2C2ZB 3GR0A 1WG4A 5H9FJ 4X65J 2F63A 1X4DA 1FTRA 4B02A 4Q5VA 1IR1A 4ZJLA 3BGLA 4DL2A 1RXOB 2A6MA 3OV7A 2E1PA 2HFUA 2GIFA 5DG8A 2C2DA 4RUAA 5B0BA 1EX8A 2L3MA 2WVFA 1FDAA 2MHEA 1MMNA 1R43A 4JI6F 1HD0A 2VPZB 2E66A 2ALZA 2MSTA 4I69A 2HQDA 4C3KA 1ZA2B 2B0GA 2Y8YA 1C1CB 5F9LA 2C22A 4XK8C 2RRBA 5LJ5Y 5HMXA 1NRKA 3W2WB 1EAYC 3MR2A 4UUXA 3GR1A 1VK8A 3FEYB 5M2RA 4MJKA 3MCOA 3O2IA 2DITA 2RF2A 4RNHA 3C16B 3RUBL 4F26A 4K7QA 1R6YA 4Q8EA 3DHXA 4WYWA 4KRWA 4N41A 4EZ6A 3GE9A 4B3OB 5CYJA 2DNYA 4C4WA 1NU4A 4YN3B 2RILA 4E0DA 3VGUA 2BW2A 1WF0A 3MM8A 3D2WA 2VFVA 4O4GA 2WW4A 1YJUA 4IR9A 1UWBA 3PKMA 3D66A 3BYPA 3M32A 4Y2IA 4Q43A 5F8LA 1JLGB 2BRLA 3QAEA 2G4BA 2MY8A 3MM7B 1G2EA 3PRBA 4PKDB 5HI7A 1FXRA 2ZM6F 4GKJJ 1AA1B 2J9DE 4FF1A 2KFYA 2AW0A 5B0AA 2SXLA 4J90A 4ZP6A 2CJAA 4NLRA 2JZ5A 4B3TJ 3R5GA 4Y00A 1X5TA 5HBMB 1NZAA 1URNA 3TW0A 4IQXA 3IS9B 3QT6A 1UJ5A 3KLFB 1T0TV 1W25A 1RWVB 4OX8A 1DTQB 4QBUA 3LPEA 3A8KA 5DM6Q 4ZLLA 2B9EA 4XAKA 4PEOA 4NLXA 4DR6F 4OI6A 1VBYA 1FRHA 2EBGA 1M0SA 2GGPB 4LSNA 1HIYA 5DDQC 4LR8A 2QA1A 4CRJA 3R6LB 4NOHA 1HYSB 4RUBA 2NYHA 1U1QA 5H1SV 4JI3F 5C24A 4L3KA 4WTYA 2J7WA 2AGOA 4NLOA 2HQ3A 5E3AA 2J9CA 1RU1A 2J7UA 3TUPA 2VOPA 3OHBA 4F3QA 4YDDB 3WX8A 4A8MP 2XCPA 1ZTTA 2RF2B 5L46A 1VGYA 1X0FA 2V6AA 2UUAF 3NCQA 2BE9B 1FVQA 2C28A 5E2QA 2WBRA 5J1EA 4C0OC 1CEZA 3CDEA 1MROA 5K9FA 2FZKB 3MM8B 5DDPC 2DIVA 2FYXA 1TKXB 3I96A 5JMNA 4MYUA 1CS4B 4L3NA 1VBKA 4WXOA 1U47A 1ZH5A 1IKXB 4WE1A 4N56A 4EMDA 3ITHB 2V8VA 2ZNZA 3BKFA 3F73A 1JJCB 1OPIA 1SL0A 5K20B 2HURA 1Q82T 3UN3A 2UV8A 4NLGA 2B56A 4MYTA 2VQFJ 1IKVA 5C42B 2R7SA 2X7IA 5DLFA 3MCSA 4JI2J 2CQBA 2JVOA 4IDKA 3PG9A 1VC6A 1WHYA 2YKMA 3NWGA 2E5LF 4PYDA 2HLUA 4GC6A 4QYRA 1HKAA 5D6GA 3N4WA 2CQGA 4B9VA 1SL1A 2MKJA 2GQCA 2WW8A 3LP1A 5DETA 3GZ7A 4OV6A 5IC4B 3I9ZA 2VU5A 1KP6A 3PY8A 3AH6A 3DRXA 4OJGA 1WELA 3DM2A 4N8OA 3G6XA 3DYAA 2V8GA 1R0AB 1CSJA 2Z2LA 4ZJOA 4RR5A 2BQUA 4GVBB 4G1QA 1D8ZA 4BBYA 2JWNA 3W9JA 3R8YA 3AY0A 3VGVA 2AU0A 1UVNA 1AB8A 4PG8A 1T05B 3EDQB 5L39A 3TRGA 1J5EJ 4USUA 5L38A 2UP1A 8RUCA 4AL6A 2B9WA 3OD2A 3DGVA 1HNWJ 2RRNA 5KG6A 3B78A 2YBVA 3ZO7A 1RAIB 2MKIA 2HQIA 4JBCA 3TVZA 1AUDA 1RCXB 3CB4A 2JHEA 1NO8A 1UL3A 2LQJA 3DLBA 3MR3A 1PG5B 4Y6IA 1I94J 1ZPWX 3EDRB 1RTHA 2EI5A 2PDAA 5KFWA 5EDWA 3IAM9 3H4BA 5DQHA 3R5CA 2WSFC 1XMOF 2V9WA 3H2UB 3LP0B 1SIZA 2ASLA 1LW2A 2MEWA 1YLXA 1R8AA 1RA6A 2W2MP 2R7RA 2O1PA 5F3ZA 3ENQA 3UQSA 5DM7Q 2DT9A 2GW8A 1APSA 4TYAA 4WU2A 1Z2ZA 2OFHX 2LKZA 2RT3A 2HRUA 4AYBD 3KUGA 1IBCB 3J7Z5 1FVSA 2QRRA 4ZLNA 2MLZA 5D78A 3KWMA 2AYEA 4ED8A 1BD6A 4LF2A 5EGYA 2YNIA 1RAGB 4N77A 1KQFB 4ES3A 3FKBA 2VBXA 1NM2A 4FF2A 3TWZA 3NRBA 3O6QA 1OSDA 4F04B 1PSDA 3BDPA 2L9WA 4YDXA 1FX4A 1R0BG 1GTEA 3TZZA 2F3JA 4ID8A 4XTTA 4L73A 4DV3F 4ID5B 1XBWA 2LU1A 3BN4A 4LQ3A 1RTZA 1TU0B 2MKHA 4UUWA 2V2KA 3JAMU 1RT3A 4I7FA 1MN7A 4NLVA 1CJTB 3GFZA 4R5PB 1IBLF 1KTQA 4OJ1A 4EUVA 4A8QA 2QL9B 2AJ0A 1NBEB 3NAHA 1B0VA 5I3QA 2QLJB 5C5JA 4B9UA 2B9YA 2KM8C 2JEFA 2ZBIA 2AGQA 1UFLA 3BBCA 3RBXA 1B0TA 5HMZA 2AYGA 5J2PB 1N5YA 1X8DA 2LXUA 1I1GA 4Y2CA 3GMGA 5KFYA 1WKLA 1WACA 5AXLA 2DXFA 4DPOA 4F36A 3GFXA 2C3OA 1QAYA 1MG7A 2YKPA 3LTOA 3TUIC 1T9VA 5CD4H 4HACA 2W2OP 4KHRA 3TANA 5GADI 1U1NA 3HHLD 2DVIA 2X51A 1DQAA 4KY3A 3P49B 1S1VA 1YJ7A 5IT9Y 4K59A 4DG1A 2ZHOA 2DH8A 3I32A 5ETMA 2ATLA 1KWMA 4EZ9A 1H7XA 1LXNA 5D15A 1S5ZA 2DR8A 2P5VA 2FUG9 1CVJA 3CD7A 1QY7A 3MCNA 5T41A 1RK8A 3FFIB 4LF5F 4LRBA 1JLAA 3AOBA 1VISA 3ILJA 3AQOA 2QE5A 5AT1B 2UUBJ 2LU2A 3NS5A 1U8WA 3OHAA 1PIEA 1GFWB 1WDDA 2LQBA 3SYZA 5D0RA 1T11A 3UD3P 2LP4A 3T1YF 3GTYX 2DPJA 4KO0B 3KJFB 4IRDA 3JQKA 1YZ6A 2R7TA 3ICLA 1NHVA 2HQGA 3PEJA 1IBKF 1RBOB 4J9SA 5GAGI 4I68A 1REGX 5CD4A 2ZH7A 3C6TB 4DLEA 1SQGA 1U0HA 3ONQA 5ETTA 2GJFA 3T6BA 2ZKTA 2R8GA 2MKKA 1IKYB 4YB6A 4JV5F 2MZ1A 4RNNA 1D9FA 2W9BA 4M5IA 2HQCA 1VQPS 2XBPA 2F8MA 1TAUA 3IAS9 4UOHA 3ZXWA 3X3UA 2BJ8A 2G13A 2VJUA 3KHHA 1SC4B 1QE1A 4A8OA 2BE7D 3D1HA 5F3TA 3DXBA 1SQFA 1ZZFA 2Z30B 2OSQA 1LK5A 3PNIA 4OHVA 3OT9A 3I0SA 1I5OB 3BN7A 5DQGA 4KKOB 4QIEA 1LWCA 2RMLA 4ZN1A 2KYZA 1T02A 3NL0A 4LF4F 1H2VZ 1FDDA 1XC9A 1V3SA 1ZOTA 3EWGA 1YX2A 3D6MB 3KLGA 1SJQA 2DHSA 4IFYA 2I9SA 3HJVA 2VPYB 2XSFA 2Z2ZA 5LOQA 1HQ2A 3R9LA 1FF2A 1YJ9S 5CA5A 4H4OB 5HJYA 3RAMA 3B8HA 3ZTSA 2ROPA 1D1UA 3W2VA 4ES2A 2U1AA 4FVMA 1NAQA 5KFQA 1NB2A 4M95A 3TJ8A 3RBZA 1QTMA 2BA9A 1HI0P 5K8OA 4KHPF 4OI3A 2Q66A 5HATA 3O1LA 5KG5A 2HHHJ 3BBFA 2NXJA 4KV8A 3H2VE 1TAQA 2BACA 5IQQA 2LA4A 4M5DB 3JS9A 3LUYA 2HHVA 1RT5A 4X4NA 2CKWA 5JXSA 2QFJA 2JC1A 3MTKA 4YB5A 1YJRA 1K1QA 1EJ7L 2XYPB 2LFVA 3QJLA 2DH7A 4W98A 2RQMA 2CNNB 1FEEA 3DN9A 3TQ1A 4FYYB 1AXQA 4DR7F 3Q83A 3IM8A 2XHWA 1V5IB 3GILA 5KFEA 1U45A 1SXLA 4DFPA 2YNFA 4TVAB 4ZS6A 1TL7A 3I82A 2DRAA 2PA8D 3DRYA 4QYZK 1KEKA 4YMEA 4YR3A 1M5HA 1WOPA 2YPZA 1YI2S 3MPYA 5I3UB 4DR4F 4B9MA 5HSPA 1RAFB 4O3RA 2J0SD 3I0SB 5L9NA 2VPWB 1UAWA 4NZ7A 5THWA 3UNYA 3UPFA 2ZBQA 4YEAA 1LWCB 1OWXA 3GCXP 1G1XA 1MWYA 4P10A 4PXEA 3OXLA 4U95A 3KLGB 3PX0A 1RT1B 4QR0A 5K8PA 2PGCA 3RRKA 2M3DA 3U1NA 2OTLS 4ZVSB 4J9MA 1RBLA 4IR1A 4LBIA 1HW9A 1P9YA 4RW7A 4Y2MA 1GQEA 4EI2A 4PQAA 3ZZ0A 3OR1A 1SH3A 1WSVA 3Q8SB 3W9IA 2FLLA 2HFNA 3DMJA 1RB0A 2H54B 3W2VB 1Q0NA 2CJ9A 3UDCA 3SQGA 1HBOA 1BHNA 2WCXA 3KLIB 2HMIB 1VQOS 5L9XA 1NKEA 2E5HA 4A47A 2CG8A 3EZ5A 3HHNB 3N6LA 4OI4A 3QRPA 2ZITA 1S1TA 1RWPB 1Q4RA 1N5TA 5FJ4A 3QO9A 5GMDA 2Z0GA 3K8WA 4NYZA 3MR6A 1M90T 3QATA 3HXMA 4X62J 2YQ3A 3J80Y 4QWBA 3FEZA 1BWVA 4IG0A 4N47A 5CZVA 1RT2A 2DGTA 4ZVQB 2PIIA 3QZ8A 3OW2R 4HT5A 1HWUA 4C2MA 3PJ9A 1U24A 4NXMJ 3BJYA 1RAAB 2YNFB 3T5JA 2XMKA 2Y3YA 1S6PA 4ZPCA 2CJXB 2DR5A 3AXMA 5F8GA 1AFJA 5KFAA 2X3GA 3Q2TC 3TAPA 3LH2S 2NPFA 2YWKA 1MN9A 3B4MA 2DIUA 1RT7A 5LMUJ 2A1BA 1ITPA 4LUBA 3RBEA 3MPUB 1FNXH 2CPFA 4WKRA 3PO4A 5KFFA 4MAKA 2HHSA 2NUUG 3EE3A 3IG1B 1X9MA 4GVLA 1MMLA 1YITS 1EETA 4MKBA 3C15B 4LF9J 5G0RB 1XNQF 4JV1A 2XMMA 3KOAA 5ETVA 2MHNA 2E1CA 2AD9A 4NWBA 2HAIA 1UFKA 2HHPA 2W9CB 1DQ9A 2PFFB 3I5CA 1U1PA 3LGHA 3MHYA 5LXYA 4I2QB 5KFRA 3NG8A 2H5EA 1FRXA 4PG6A 4P2FA 3Q24A 2DH9A 3V4IB 1RHRB 3BQ2A 1H72C 4LQ9A 4DV0J 1Q8LA 3FBBA 3PACA 1ZAWA 4TY8A 5CCMA 2Z2YB 1JXLA 1PILA 3CIZA 1FNMA 1U02A 6FD1A 2M4MA 2AV5A 4DSJA 1VQ5S 2FC8A 4DQIA 4ITSA 3D1QA 1X60A 4JI6J 4RO0A 5KT4A 3T6JA 4ES1A 2E7XA 3H5SA 1N88A 4O23A 2B4OA 4TLQA 3HHLB 2Y1IA 1PGZA 1S76D 5A8WB 1RE1B 4TQSA 5D77A 2ZH8A 5IOLA 2NXEA 1LFWA 3G87A 3SFGA 2B5JA 4DQPA 3RB3A 5H9EJ 3HJFA 2IC3A 1UEUA 3DLKB 3HSJA 1TTHB 4U6PA 3NS6A 2N82B 1B70B 2YY3A 3WDOA 2JX2A 2XLJA 3DLEB 2ZFHA 1V3RA 3DLGA 2EK6A 1WOOA 4J37A 5C7PA 3PHTA 4JI8F 2RUGA 2HLTA 2ADCA 2JJ4D 4EO8A 4RU2A 4EEYA 4LSZB 2DO4A 2ILYA 1U26A 3VWSA 2YXLA 3T9NA 2GZOA 2ZM6J 4KFBB 1UFWA 2EXUA 4ENOA 2CQCA 2QA4S 3IN5A 1K44A 2JFDA 3DLJA 2XS5A 1OSCA 1FE4A 1NJIT 1EHWA 1IXKA 1KQSR 2I2YA 1UVIA 2DHXA 4HR2A 1L5UA 1S79A 3W9HA 2E7WA 4WCEQ 2E1RA 1X9WA 3TEGA 3PW0A 3LWMA 4TY9A 2E7VA 1JB0C 4UTGA 2GHPA 3SCJE 3V2UC 2C2OB 4DR6J 2W24A 3MI7X 2NZCA 2V0NA 4F4YA 1TK0A 2HBYB 1VI7A 2FJBB 1YJWS 1U0SA 4TLRA 5E3CA 5L1LA 2QL5B 4RW4B 3OXGA 1XEZA 3KLEB 4ECXA 2VICA 1S97A 2FB0A 2XLIA 1FWLA 4NLDA 1F9HA 1H2TZ 1R31A 2W25A 1Q5YA 1UA0A 1G3OA 2QLFB 1CJUA 2AJ2A 2ZZMA 3NBPB 1DAXA 2IC3B 3V4MA 1HNIB 2CPIA 2VBZA 4OHWA 1NK4A 3DOKB 3HKWA 2XSJB 1Q7YT 4YR2A 2UUAJ 3W8GA 3MWBA 5LSLA 2V5HG 1KLMA 4E8UA 4DCJB 1HBMB 1R8CA 2CXEA 4DI6A 3DLGB 1F9EB 3M8PB 2WB1D 2C3MA 3EICA 1HQEB 4EBDA 4LJMA 3PJWA 1C0UA 2GO9A 5KOWA 3CCWA 4W92B 3H90A 1ZETA 8AT1B 2R9LA 4U8VA 4K4XA 5DGBA 3TAMA 2IY5B 1SV5A 2F4FA 2RS2A 4B9SA 4UT4A 1FKOB 4UY85 2MSSA 2IA6A 3QYYA 1Q79A 1NJWA 3FMBA 3KJNB 2UVWA 4HI2A 2DNPA 5E7OB 1R27B 3F0NA 1OMSA 2QSFA 4P75A 4BDPA 2EK1A 2DNZA 1DURA 2AHOB 4V19X 2VG6A 2HRYA 3UCZP 1FERA 2XULA 1KS2A 3QBCA 1FRLA 1SPBP 2Q79A 1B99A 3V5RA 4OYAA 3OFHA 1B3TA 5HAOA 4K4TA 2Z57B 4NZ0A 5E3QA 5GAGU 3CMQA 4LF7J 2DCUB 3DRSB 2AJ4A 2CAJA 1R0CB 3PIOQ 3T5HA 3PFOA 4ZDNA 1VJWA 4I2PA 1IVZA 3QPIA 4ILRA 1YSJA 2GMJA 5F8IA 3AA9A 3KG4A 1WEZA 2CPHA 3G8SA 2VC0A 3BPSP 4DLGA 3R2DJ 4MIAA 3R7SB 4DF8A 1WI8A 3US5A 5J2MB 2R2SA 3P5TL 2LA6A 4HDGA 2B3TB 1EZZB 1D9AA 4U9RA 5B7WA 5AJ3F 1Y9OA 4JI1F 2HNDA 1HWKA 2J5AA 3MM5B 3U1MA 3MURP 2BXJA 3MXHP 4Q2LA 1KONA 4DL6A 2NXUA 4MTPA 5HVHA 1XN9A 2LQ5A 3LGMA 1ZM3A 1S9GB 1C0UB 3QWUA 2DXEA 4C48A 4DV4F 3NGUA 2ZWPA 4DS4A 4NXNF 4OFZA 1YK9A 4LR7A 2XG8A 1RTDA 3LAKA 4G1PA 2JEGA 1XMOJ 2CWXA 3I0RA 2NPIA 1J27A 3NCRA 2VV5A 1VC0A 3PV8A 3NCPA 4LFCF 1S4FA 3TJAA 4C3MA 2HHTA 4O3QA 4DL5A 1KQGB 4NA2A 2BX6A 3FBCA 1Y4ZB 2P9EA 2FHJD 4DBQA 4RW6B 4USHA 4ECRA 3ZZOA 1N6QB 4KH1B 3UE2A 3QT5A 3B54A 4M94A 2EFQA 1FX2A 3DOLA 2AQ4A 1VHFA 2W8KA 3JYTA 1IBMJ 4D3HA 4P2XA 2CG4A 1RWXB 1QLNA 1SIWB 3UDVA 1HQUA 3P45B 1O6XA 2WZ1A 3V6KA 4ZCLA 2R8HA 2H51B 3BSCA 4FN5A 1QAJA 2RUSA 3HVAA 4DV3J 1MNEA 2BEFA 4DUYJ 5LMNF 1JLFA 2X3DA 3VAHA 4QPXA 1RAHB 2DNOA 3OVSA 1HMVA 4Z2XA 1JLBA 5D3GB 2IBOA 3HHDA 4OZLA 3L7OA 2VDHA 4K4VA 2N4DA 5KT2A 4DPUA 1E6YA 2OSRA 2FHKA 3EYZA 4PAAA 4ICLA 2M8HA 3BR8A 2BJ1A 4ZPAA 1RKJA 4NCAA 1XMQF 2FY1A 1XIQA 3UCGA 2O67A 2QG9B 4Y2KA 1LW0B 3OPKA 1A0OB 1DARA 5CYQB 3S7RA 5KAKA 2VDIA 4H4MA 1VQ9S 5D0EA 2G2YA 3AD7C 3QIPA 1HBNA 2AGPA 4K2XA 1HHTP 3R7NB 1VMBA 2XM3A 3M1VB 3QGHA 1N5SA 2YH0A 2FZGB 2F4VF 2BE2B 3I0RB 5B0EA 2EPIA 2PO4A 3R5AA 3AHPA 5H9FK 2IDEA 3K2YA 2Q6BA 4K4UA 2R7XA 1WF2A 4X66F 4DSKA 2HKEA 4H54A 1KSPA 1C4AA 1MU2A 2D41A 4J9PA 1BE4A 2BYCA 1I6JA 3IR7B 2VUGA 3HVRA 3LGNA 4F2SA 2LXFA 1M5KC 1RDRA 3BGRA 4LF5J 2KG1A 1J2VA 1JNZB 1RQ0A 3GPAA 2CPJA 2MLXA 2V4JB 2BJEA 1N56A 2M0GB 3GYGA 1HA1A 4NCBA 2WAQD 2QFIA 1MMDA 1YRXA 1GX6A 4C11B 5F8JA 3T1YJ 5F0WA 3M30A 2ASJA 4KE5A 3GJRB 4DS5A 4BS2A 4WTOB 4B9LA 4NI2A 1H73A 1JXEA 3SV3A 4EYHB 5K14B 2RQCA 1S6QB 3MECB 3T5KA 1IBKJ 4R0EA 1NK9A 4CO2A 2YWEA 1HMVB 4E98A 4ZPTR 1NKCA 4RZRA 2XO7A 1JLBB 2FHOB 2ZE2A 4IH7A 4CLUA 1OQ6A 3V81B 2OPQA 4RNOA 2HBZB 1SC3B 3NGSA 4ECYA 4FXVA 4NLSA 2YX7A 1S0VA 4JV5J 2FVSA 5CYMA 1PJ7A 3KK3A 3VVUA 2HG4A 4AT1B 5ETOA 4AQYJ 1VCTA 4USKA 3MGJA 3CC7S 4ECSA 2I38A 3HMJG 2WOMA 3G82A 4D3GA 1NDPA 1KFSA 3WBZA 4CLKA 1MWQA 2MQNA 1HBNB 4QOTA 2DXDA 5G4DA 3PEHA 1HI8A 1Y5NB 4MFBB 1ZBTA 5KFMA 1IM4A 3ELHA 5KFNA 1Q8KA 3E01B 4M5MA 3MDFA 1B7YB 2VONA 3L3CA 4ED5A 3QGPA 1S0NA 3QRQA 3T1HF 4LF4J 2VPXB 1O51A 3KHGA 2J8AA 1WEYA 2RE1A 3T41A 3V6HA 1M5PC 2F8EX 1NDLA 3BGRB 3DGPA 3EPGA 2ZD1B 2KM8B 4QR2A 3FBEA 3D0HE 5CHCB 5KT3A 5IT0A 3BYRA 2V8HA 4L74A 2XWYA 3T9ZA 2OPRB 1RT6B 1S12A 4ECQA 4YS2A 1JLEB 7AT1B 2XTJP 2QA4G 3SBMA 2LECA 1IKWB 4LBHA 1L3KA 3BGFA 4PR6A 3CD6S 1FRJA 5A6PA 1IUJA 2V2ZA 3SDEA 1UVJA 3H40A 1GNKA 4KHPJ 3G4SS 2EEYA 3QLHA 3BR9A 2Z2MA 3M2UA 3OL7A 2V68A 3V6DA 2ASYA 3J81Y 1FI4A 3OL9A 4K50A 2FLOA 4ATNA 4WFNQ 4ILMA 3PYGA 1PC5A 2UU9J 1F5CA 3P8BB 4J9KA 2XC9A 1NH8A 2DR7A 5CYMB 4O3PA 2PI4A 2DK2A 4ANDA 2CQ1A 3MEDA 1Q81T 1O8BA 4MKYA 5A2QY 4DR7J 1O5JA 2JEIA 3EXYA 4IRCA 2WOMB 2YX1A 3G82B 3TEHB 3M9NB 5IM0B 3VV2B 3D7SB 2AYBA 3HVTA 1HNVB 1WC6A 2ZVIA 1SKUB 3DHWC 3MEEB 1T9TA 4N76A 2CYYA 4DN9A 3WIUA 3JQMA 3UVJA 4NYPA 4QWDA 4CI0B 2OFGX 3MEKA 3EZUA 5BXIA 1F6TA 3I4HX 4DR4J 2KZZA 1RTIA 4OI0A 3MD1A 3IRXA 1C1BA 5KTQA 1BC6A 1UVKA 1FHTA 5J2NB 4KGMA 2GVDA 1BQXA 1YJNS 4PWWA 2QMUB 4ZPVR 4F02A 3ISNC 1WKJA 2BANB 2YNGB 5EWFA 4Y65A 5LJ3Y 4I6WA 1URRA 1YJVA 2RNEA 4UF4A 1TK8A 4RLEA 3DRPB 5CABA 4DPYA 1GXLA 3ZZUA 4Q44A 2HBRB 3DRRA 4WU3A 1NUEA 3MMCB 2A18A 1HWLA 2DD8S 4LF6F 1R8BA 3G6YA 4PCQA 4JYAF 3IC1A 3CJ2A 2XCAA 4QU6A 2RS8A 2G0JA 2MQOA 2MY7A 4HT7A 4OYZA 3IFEA 4U8YA 4X4RA 1N33F 5KG1A 2I8EA 3PYDA 3HFVA 2DPIA 2EW9A 4RPFA 1NJYA 4BWMA 4UZBA 1TL1B 3AFGA 2IJFA 4LVNP 3MAQA 1WG1A 3MEGA 2RH3A 1X4GA 2NSCA 3K7RA 2R2TA 2XI3A 5BYRA 2BVZA 1S6UA 3TZXA 3CEDA 4QQBA 4CO5A 3H4DA 2K06A 4DSIA 3O5TB 4URGA 1UP1A 2W4CA 5T7LB 1H2UX 4CTAB 3HX9A 4I0WA 3A8JA 4LREA 2EFGA 5KFOA 1JK9B 3FRZA 4MK8A 1J5OA 5LSOA 2DGWA 4CZCA 3FCVA 2MGZA 4LSLA 4KAIA 4IG3B 4RBUA 1OPZA 1UPMB 2UVRA 1OYEA 2RQKA 1KDNA 1RTJB 1RTIB 1U09A 3UD5A 5KT6A 1V3ZA 2DY1A 1E6VB 4ER8A 4ZKAA 2ROEA 5L1IA 5J1NA 2BKPA 1EIYB 2BJ7A 2COLA 3GV8B 1Y00A 4LFAF 4DF4A 4PWDA 5HROB 2ZH2A 3FQKA 1YDLA 4RW9A 4RWXA 2ZJPQ 1ZA1B 1U2FA 1ROFA 2FDNA 2OEKA 4TNOA 2E5JA 2GIRA 3G6VA 1JLCA 4AL5A 2BM1A 3M8WA 1TVRA 1U1LA 2LCWA 3M8QA 3VAMA 3THPA 4DL4A 2IDLA 3BSNA 1WF1A 1CPZA 1XNRF 2KT3A 4CLPA 2VBWA 2F9JA 3BREA 4ELUA 2ZBCA 1IR0A 4FYVB 2LQ8A 3NGDA 2L48A 3KLHB 2VG5A 1FA0A 3HM9A 5I3PA 5ADZA 2EFVA 2BABA 5IT4A 4K4SA 4DQQA 2B6AA 5HP1B 3ULHA 2LEBA 3K5LA 3R1HA 4CH0S 5B09A 4K0KF 2OD4A 2KRBA 4TKTA 5HANA 1NEEA 1HARA 4KQZA 5B08A 2QYGA 3NOCA 1VQSA 4DL7A 2ZDOA 4WYLA 4ZVUB 4PXCA 4CH1A 4ZLPA 1CQNA 1RWMB 3MEGB 3KHRA 2AEJA 5KFHA 5C25B 3CCTA 1NLKL 5L1JA 3EM1A 1DHMA 1RLDA 3RW7A 4C8ZA 1PO6A 4WPAA 2BOAA 3D4JA 3R7BB 5KG2A 4MIBA 4PUOB 4DFMA 1GMWD 2DRDA 3FNNA 3RTVA 1RUSA 1H3DA 1RGVA 1MWZA 1W26A 3LW5C 3QIDA 2A2CA 3JSMA 3QSYB 4ZA1A 3W66A 1PAEX 3L7PA 3BO2A 3AJ2A 5HVGA 1LKZA 2JFKA 2IJRA 2JVRA 3MM6A 3QMQA 2B4VA 4ECUA 4GKJF 3OLBA 3HPOA 4KH0B 4WBFA 4IH5A 1LWEB 1U48A 4HHJA 1JMTA 4RW8A 5E33A 5ETLA 1DRZA 1RWOB 1UZHA 2PMHA 4QIFA 3TZWA 1HW8A 4XPEA 2DHGA 3OR2A 3WC2A 2KT5A 3R5DA 4DSEA 4FZVA 3M8QB 2VHGA 1A7GE 1VK3A 3NNCA 2AEMA 1FDNA 5ETPA 1WDTA 5K8MA 3UDEA 2E1MC 3SSRA 1JXVA 1X7VA 4WWSA 4F8RA 3CDUA 3OL6A 2VG5B 1Y5LB 4OI2A 2NYIA 4Q0BA 2MB0B 4LIRA 4ZVHA 2G0CA 3OJUA 2DEJA 2BJ3A 4Z37A 2AX0A 2FZCB 2HFSA 2I6WA 1R8PA 2AJ1A 1CC7A 3FJ2A 4UQGA 3K5MA 3W63A 3FSXA 1NXIA 2L9NA 2XYHB 3CJKA 2GNKA 2DNQA 2N3OA 2ADBA 3DI6B 4USWA 1NPKA 2HNZA 2DNKA 4OYIA 5HMWA 2D3UA 1U4BA 3KXDA 2HNYA 2WHOA 1GAOA 4J91A 1AYEA 2YX4A 5E5NA 3TVYA 2NCKL 4Q8FA 4MT1A 5U47A 5J2QA 5JVGQ 1B64A 2FGCA 2Q43A 1F9FA 3RAQA 2IAJA 3C14A 4ED4A 3HSDA 4RUHA 2R42A 1WI6A 2X1GA 2AP6A 4Q7AA 1ZM2A 1F3FA 3UI3A 2HW3A 3AOCA 4PQUA 3M2RA 2FLNA 2DJWA 3ENWA 2DNNA 1HWIA 2AKWB 5E0OA 2YH1A 1T9WA 3MMBB 1NJZA 2DNRA 4KIAA 3RRHA 3R3TA 2Y1JA 4DR1F 2NR0A 2BR0A 5F8MA 4L6V3 4LF1A 1IN0A 2OPPA 4ZK7M 4ZHRB 3P4UB 1OY9A 4RW8B 3KLVA 2Y8WA 4Z7YA 2QZ8A 5HK4A 4P7VA 4O44A 1JKHA 5KOXA 2F1FA 1QUPA 3GWCA 4IO9Q 1FJEB 1NK7A 2MZTA 1UKUA 3CDAA 1VQ8S 3RZAA 4HLBA 2CPXA 3ETOA 2FJAB 2Z56B 3CCQS 2VIHA 1QDUB 1RWWB 1HR0J 3IWLA 4B17A 1VYAA 3CCZA 1C4CA 4NEZA 4EBCA 2UUWA 1RACB 2F8HA 2H5IB 4F3OA 1DTTA 3AB2B 2K7KA 5IC6B 1FDBA 3KJVA 2CQIA 2DGOA 4DSLA 4DXLA 4OZNA 5KFGA 5KFCA 3UN2A 2J8SA 1WTBA 2FJVA 4ERDA 3C14B 4XO0A 3BQ0A 1U8SA 1C0TA 1I94F 4C8OA 5AJ3J 2HZVA 3KHLA 4JI1J 3E3XA 2HWHA 4K8RA 2KVQE 3N0VA 2A2DA 1TELA 1UCNA 1K1SA 1NB7A 4PQUB 1BUXA 2RDDA 1N52B 1M5VC 1N34F 4O4GB 2HHUA 3PYFA 1UWBB 2AZ1A 3M32B 1SBRA 3KK1A 2YKAA 5ITHA 4DV4J 4CLSA 1S1WA 2YWHA 1DJ0A 1T95A 4DX5A 4LFBF 4RBTA 4NXNJ 4YHHF 3DNCA 4V1Ak 3GIMA 1JLQA 1N5VA 3CO0P 3PX6A 2VQEF 2BMBA 2MYFA 3B82A 5KFKA 4EK2A 1RKIA 3CJSA 1S1XA 1VQLS 1JQGA 2W8LA 2JL9A 4OX7A 1S9EA 3FVYA 2OIHA 2J6UA 1JKHB 4P6QA 9RUBA 1F5BA 1WJ9A 2LQ9A 5CZXA 1JWWA 1BQMA 2IVMA 1GXUA 3SCKE 1FT8A 3PR5B 2YWFA 5EN1A 4DWIA 2BW7A 3FSYA 1KVKA 4DFKA 1EP4A 2IMOA 1TFYA 2PD1A 2BV3A 4DX7A 3EJMA 1JIHA 4U7UK 3UR3C 1GMWA 5CH7B 4LSNB 3HVWA 5A6WA 5JUMA 3C3LA 2RD5C 2HS3A 2K3IA 3K58A 3ZTQA 1N4LA 1X4AA 3GIRA 3J7AN 1YRUA 2ERRA 3BQ1A 5LMNJ 5C24B 4CWBA 2KXHA 3VR1A 4H4KA 3O3LA 5CCLA 2B9XA 4KSEB 5KFTA 1KVJA 1NDKA 3M6VA 4P2MA 4QWCA 2HVDA 4MMOA 3NY0A 1SUQA 3POTA 4M5KA 1C0TB 3W64A 1FK9A 1S49A 2H4WB 4K4WA 2OGUA 5J1EB 3Q8YA 4F4WA 2CQ0A 1XMQJ 1MROB 3NNAA 1L3TA 3BSOA 1RISA 1LEOA 1CC8A 2GO8A 4M1KA 3LANA 4QR1A 4FPIA 2HBQB 3KDOA 4WIQA 3KK1B 4KPYA 1S1UA 1S1WB 4OYMA 3PR4A 2FQQB 3JSRA 4WE1B 1RHMB 2R8KA 1PBUA 1SJ3P 2CRLA 1N8RT 3FC9A 3H5YA 1Q5VA 1FWKA 2MXYA 3ISND 4GO5X 3TVKA 3FEXB 1IWGA 1NK6A 4X66J 2KJVA 1Y5IB 2V67A 2BKNA 1IKVB 1QD1A 3AD8C 4CDIA 2IRUA 2HVZA 3A3NB 2OP5A 4IDKB 4AD6A 1BQMB 1P27B 4QIWD 1NSPA 2YKMB 1WEXA 3CULA 4DU8A 2VFTA 4FNHA 2VFUA 2IHR1 3CJ0A 1ZAVA 4RWWA 3ETMA 1EP4B 1P1TA 2UUCF 1VQKS 4X2BA 1WOSA 1PAUB 2R7UA 1BQNA 3FCHA 4OHZA 3LP1B 4CM0A 5EWEA 1HPZA 1XR5A 1G4CA 4J9VA 1FKAF 2J0QD 1VFJA 3DM2B 2EKYA 1YGYA 3FRYA 2ZJQQ 3DYAB 1LFPA 1T03A 4C7QA 1RLCL 2CZ4A 4DV7F 9ATCB 2QO3A 3CJRA 3DDIA 4G1QB 1GK8A 5BYQA 2GMLA 3N28A 3Q8RB 2IJNA 4FXWA 5H9EK 1HWJA 1BGXT 3NLCA 2ROGA 2E1AA 3CCSS 4FKXA 1IR2A 1SUQB 1T94A 3O44A 1D8YA 5BR8F 1TR0A 3JTNA 2P6SA 4ZCMA 1SH0A 3KYLA 3BV8A 3W7BA 4J5OA 3C46A 2I5JA 4XIUA 2DGVA 3KUHA 2DR6A 4P72A 4QPTA 4R0JA 2JEJA 1B0PA 1RTHB 3OTEA 1SH2A 3OUYA 2ZH4A 2KHDA 1S1UB 2XHCA 1MSWD 5FLXU 1EQMA 3W5YA 2QTWA 4UOGA 4Y3CA 5B0DA 1LW2B 3JAMY 1U6ZA 2WRMA 4ZCIA 3D6TB 4F4ZA 2WB4A 3C66A 5LSRA 2ILZA 4WIIA 4HEA9 5KT7A 3ET6A 4CIOA 2NLWA 3CTRA 3T1HJ 3RU0A 1VJQA 1BWEA 4OHYA 4ZPDA 3IBFB 4RUCA 3FK4A 4NCGA 3DDNA 4ED2A 1O0PA 1FFGB 2YNIB 5L1KA 3C6UA 3CD5A 3CJTA 3VQSA 1QVGR 5BJRA 4DR2F 3D0IE 2UXCJ 1S7HA 5DG7A 1XERA 5EUHA 3CWJA 2UVUA 4WF9Q 4QW9A 4I4BA 4OX9F 1HPZB 2XZDB 4NLYA 5A76A 3PHEA 3GG1A 4JP8A 1OYDA 2VODA 1P1LA 4KGKA 2E29A 3CO9A 4YUDA 5A8RA 4JUZA 2XQCA 2YNHA 2KL8A 2FD2A 1RT3B 4DZ6A 4L72B 1MW7A 4I7FB 2V50A 3A1YG 2AT1B 1XWLA 3DXSX 2E9RX 2MQ8A 1HBUA 5D4LA 3NWRA 1TZ0A 1N48A 4QZVB 2Q3PA 2ZOMA 4DJBA 5DZ7A 1VRTA 2C1EB 5BYSA 2ZZTA 3FSIA 3M2VA 1TL3A 4NLQA 1KOOA 2HFVA 2QJ3A 3NAIA 4TU8A 2DNMA 1FKPA 1DBDA 2CNOB 2RKIA 3TA1A 1DLOA 3QJPA 2BRKA 2EKNA 4R25A 1N5YB 2J0WA 4NL5A 1U6FA 1FE0A 1PYTA 2MZJA 2AIRB 4CYUA 5HMYA 2D3OR 1VOMA 3IBWA 3M8ZA 3N5BA 1TKTA 2OAUA 4HACB 4C98A 3R5BA 4PPDA 1PBAA 3M7VA 4ZVGA 1RAJA 3P96A 4WK3A 5HJXA 3QRRA 2VG7A 4ZOSA 1N0UA 1S1VB 3CDBA 2IVFB 1CBKA 1WSRA 3IR5B 2GFFA 4DG1B 4I64A 2GV1A 5KFPA 5IXUA 1F60B 4LRFA 5LL6d 1S10A 1FJ7A 4TU9A 3G71S 1CG2A 2QLXA 5IWAF 3IWNC 3QQCD 3D3CJ 6FDRA 4ED1A 1JLAB 2HPUA 4N8NA 2R3VA 4ZVTB 3EGNA 3NS7B 3PW7A 1FRIA 4KB7A 3EGVA 4XDCA 5ETNA 1WORA 3GYXB 3TZYA 1YKWA 3FMWA 2BQRA 2M88A 1Q86T 1DY3A 2AX1A 3BH6B 2PE8A 3ZNJ1 1Y3JA 3TNVA 3UW1A 2ZOFA 2M8DB 3DOMA 2XMWA 4GO7X 5KFZA 2K8GA 2R2UA 5KFLA 5CXTA 4C8LA 2YNHB 3RGIA 4X62F 3E8OA 2W2NP 4DR5J 1YG0A 1G6BA 1YJTA 1C1CA 3NNHA 4ILLA 4DSFA 1U0HB 2GVZA 1VQYA 4ECWA 2IVYA 3FUYA 5I42A 2HK2A 2HVHA 1HI1A 2BBEA 3W65A 1RWUA 4B08A 3HK2A 2H4YB 2D1CA 2Y9HA 2OJ3A 1VRTB 2WVBA 2BKOA 2OMLA 3NGRA 3A3PB 4UW2A 1FD2A 4IQMA 3CCMS 2NXNA 3C16A 2W9BB 1K0TA 4NASA 1MLAA 1VIXA 4KPCA 3VHQA 2B8QA 1T9XA 5KG0A 3DKDA 5CAAA 3CGIA 4LRDA 3QGIA 2KHCA 4TQRA 4CYUB 2IM0A 2IM3A 3MPVA 3K0JA 4M5GA 2FPHX 2AEFA 2CPEA 1QE1B 4ZLJA 4DV2F 4OZJA 3TP2A 4BLGA 2Y1RI 4WJBA 2P8IA 3M9MB 2WBMA 2CPYA 3GJQB 1JLGA 2RB7A 3EVOA 1TV6A 3D67A 2DYAA 1AZSA 3MUVP 1QAXA 2EG1A 3Q8QB 4NE9C 4U96A 1IQTA 4P2SA 4FS2A 4XPCA 3WQPA 2M5YA 2WK4A 3M6WA 1KC8T 1Z2LA 4IFYB 2ZBPA 4LFAJ 4I67A 2G0IA 4X64J 2O5DA 1Q8IA 5HBMA 3JB9k 1KVIA 3LAMA 1NK0A 4DV0F 3IS9A 2ALYB 3CMAS 4QWEA 3KLFA 1DTQA 3CPWR 2L08A 1A6LA 1T3OA 1RT4A 3BZQA 1HLWA 3H20A 3P3DA 1BMQB 1XNRJ 1VRQC 3RR8A 2GGPA 3DOMB 3ZZRA 3P6YC 1VQ4S 2ZWOA 1OQ3A 3CC4S 2VFSA 3MD3A 1HYSA 3I5AA 2JSXA 4KV8B 4K0KJ 3IO1A 3Q22A 2HVIA 3IXQA 1FCAA 2GVZB 3THVA 4OZ1A 5HO4A 1RT5B 5D0GA 5I42B 1YBUA 1QSYA 3OBIA 4A8FA 4WFYA 3R6GB 4KHMA 2W01A 1NDCA 3NKYA 1HNXF 4Y2AA 4OZ5A 1FESA 3DU5A 3SFUA 3G8TA 2PMWA 1BXNA 2VJVA 1FJGJ 1TL7B 2VL1A 1S0OA 4DN0A 1OO0B 1U1OA 3HDSA 1LQ9A 3TOQA 1LV5A 4ZN3A 4DPWA 1TKXA 4ECTA 2R7QA 4Y28C 1CS4A 2O01C 4W4MA 2BQ3A 1IKXA 3MR7A 1TV6B 5HL7Q 3ITHA 4X4SA 1AZSB 3GV5B 3Q8PB 2UXBF 1JJ4A 3QFWA 3H5UA 2KVIA 3TO8A 2EVZA 5F9NA 3G96A 3IBCB 3SCIE 1K0VA 5C42A 4C9DA 1EKSA 2KFNA 4CH7A 2OKQA 4KGVB 4RW7B 1YBTA 3G9CA 4QJVA 1SCJB 3CF5Q 4J9UE 3ZZPA 2JRSA 3AAWB 3OR1B 4WK1A 1H7WA 4NRTA 1RT4B 3ILIA 3DMJB 4ZPBA 1IJEB 3QNWB 3SQGB 1HBOB 2DGSA 3ZTOA 2H9ZA 4FVCA 2ZKUA 4DMZA 4RU9A 2HWTA 2B4PA 3GJTB 1R0AA 3EUNA 1IQZA 4AXJA 5AE2A 1YIJS 1S1TB 2YKNA 1YRTA 4JI0F 1FXLA 4TU7A 4GVBA 3QO9B 5IQ6A 2H3EB 4K2JA 2CA9A 5K5MA 2NS1B 2XLKA 3MFHA 2VBYA 1RHUB 3MCMA 1X4BA 5SZTA 4NPOA 2APOA 1T05A 2HZAA 3T1AA 3W61A 4IG0B 2IYGA 1RT2B 2EFPA 3MAHA 2DGXA 3TARA 1X4CA 4K5RA 2GC8A 1P9QC 3QAUA 2W1BA 2KN4A 2ZVSA 3VQTA 3CC2S 3TX0A 4WZMA 3MAAA 3QSIA 3IGVA 2M52A 1S6PB 3WHIA 3ZTRA 2RU3A 1ULRA 3BSAA 2XZWA 3BBBA 1VQ7S 3EX7B 3GFYA 3DC2A 2CQPA 4DV1F 1JJ2R 1FD8A 3DFEA 4GKKF 2MTLA 2ZJRQ 1RT7B 3HSGA 4OYPA 2B51A 2LYVA 5J1PA 4A8SA 3LP0A 3Q86A 1RHQB 1XR6A 2WSCC 4KGZB 3MUTP 3CJ5A 4X84A 1EETB 1W2IA 4DR1J 2H48B 2MQQA 3H59A 1S99A 1S0MA 2BOPA 5RUBA 4B9NA 4RL1A 3KG1A 5KFBA 2F7VA 1LNQA 4JI5F 4QCLA 4URQU 2A6OA 2V4QA 4A48A 3KG0A 3ZZYA 1VDHA 3EGZA 3B4DA 2XGPA 4LF7F 5DLGA 4FF3A 2V2QA 1ACMB 3TAQA 2Y0BB 1VQ6S 3J7YU 2R7VA 3PVXA 3BKTA 3AQPA 4FNIA 2B4UA 2POKA 3N5FA 2BZ2A 2UZAA 4BWJA 2FLPA 3V6JA 4TY8B 1Y7PA 2J7KA 4ID5A 2BM0A 2F9DA 1FEHA 4J9NA 2YKNB 2I1RA 3TA2A 3I6PA 1ZS6A 1CJTA 1SKWA 3PRDA 2M9KA 4R5PA 2YWGA 4QU7A 4DUZF 3HULA 2DRBA 3M6UA 4CLTA 4JI3J 1RA7A 3KNGA 3K57A 4ED6A 3GV7B 1QUVA 2FVCA 3EGWB 4IH6A 1HL6A 4QW8A 2B5JB 3MTJA 3MAAB 4ED7A 2R8IA 2QN6B 3PTWA 1Q1KA 4DHVA 2QC3A 4LIWA 2UXDF 5J2PA 2ACMA 2OPSA 4Z7CA 3A8EA 1OJ4A 3AXKA 3WX4A 3BDEA 3GB0A 2GCFA 1SKSA 2XB2D 2PSZA 2D9OA 2XMAA 1KHWA 2KDOA 1FWPA 1N34J 1GMVA 2Z58B 3BGUA 3MZIA 4OYBA 4URSA 3HI9A 3S1TA 1U2CA 2OH2A 2LEAA 1UZDA 1PYOB 4A8WA 4LFBJ 3VVTA 3OTBA 1QVFR 1HFEL 4IO1A 3VZIA 2PI5A 4YHHJ 4FYXB 2CIMA 1W7WA 1H6KX 2VQEJ 3TYTA 3CIMA 4FF4A 5IV4A 4DDFA 3N9UC 4CO4A 3FFIA 3GCWP 4PG7A 1U1RA 2PA3A 2RQ4A 3I56S 3I4PA 5LT5A 5AXMA 2XMJA 4RKUC 1IBMF 4J9OA 5EHHA 3GG0A 2OEJA 1X9SA 5IS2A 4YFUA 1ZM4A 5HLFA 3K5NA 3G86A 4KO0A 4B3RF 2E5LJ 4DUYF 3ENVA 4DQRA 1Q8BA 3MM9A 3HHKA 3F44A 2HS0A 2YPYA 4X4OA 2OUGA 2FVRA 1F2GA 2MLYA 3C6TA 5IT9U 2HS4A 2CQ2A 3RAXA 1X0PA 3VAFA 2AZ3A 3CT9A 2XWXA 4DEZA 3HT3A 1Q78A 3VGSA 1IKYA 1W2BR 3J7ZT 1Q7LB 2NUHA 1TUGB 3W5XA 3RR7A 1F0XA 1S6OA 1CJUB 3SSSA 1U2RA 1QSSA 3LALA 4I1TA 2CDQA 3CMES 4CO1A 4U7UD 2LMIA 2OPSB 2KZMA 3R27A 4ZITA 4KYZA 3MUMP 4FYWB 3ADAC 3CDWA 1KLMB 1XJWB 4C8KA 4O0NA 1FJCA 1OS5A 4BCAA 5D8HB 1LXJA 1NPRA 1KOHA 3TJ9A 1KD1T 5FIIA 4HKQA 1WG5A 2HZCA 1RI7A 1RSCA 3OFGA 1UVLA 2VOOA 4KKOA 3H8YA 1JNRB 2XI2A 3K89A 5HQMA 4YB1P 3KK2A 4ETZA 4OQJA 3TAMB 4I6AA 2VF3A 1SV5B 4H4KC 4KC5A 3GIJA 4HHUA 3NP5A 4JI4F 4ZCKA 1VBXA 1X31C 1AROP 2AJQA 2XMUA 1M5OC 5DDOC 1EQ0A 2KU7A 3JQJA 2HWIA 4GMKA 3OJSA 4F4KA 2XGQA 3FBFA 3R97A 1HNZF 1NK5A 1V9OA 2KYXA 2QT7A 2VG6B 2BJ9A 4H4OA 4B3SF 3M4XA 4DU7A 1GXTA 1LK7A 2QSWA 4NYOA 3MPDA 4IRKA 4X4VA 5HLFB 2IMWP 4RX6A 5K8NA 3LOUA 5DGAA 4NX9A 3MM9B 3AJ1A 2LXIA 2MZSA 2BUNA 2UUCJ 1SVDA 2XY6A 4OX6A 2DHHA 1X5OA 3I9V9 4I2PB 2KRRA 3RB4A 3LP2A 4OZ2A 1F1BB 3GFHA 2C3UA 5DRKA 3SIPB 4M5DA 1TUWA 2NZ4A 2CFXA 3AT1B 3VCDA 1Q16B 2V4RA 3ZZTA 4LF8F 1GH8A 4WZQA 5ETKA 4DV7J 4F4AA 3GSIA 4DZDA 2RVJA 4AQYF 1IBLJ 4A46A 3K5OA 2J0XA 4M5NA 4YP3A 3VZHA 1REVA 3W8PA 1N0VC 3A12A 3HSZA 1KQKA 1YBAA 2GJ2A 4JI7F 5BR8J 2O66A 1PJ5A 2HNDB 3H5XA 3U02A 4YY3F 3X1LB 5FD1A 2R7OA 5I3UA 3BM7A 2K1RA 5KG4A 4ZVOB 2AWZA 4OHXA 2CQ3A 2XY7A 2KFZA 2E9TA 2UV8G 3KK2B 1N36F 3SI8A 3AODA 2ACYA 2IM2A 2P9CA 1NNDA 1OY8A 1L3SA 1RTDB 1EARA 2UUTA 3MOJB 1NZ8A 4O3SA 3PKYA 2D7SA 4DX6A 3L9ZA 3MPWA 5KFDA 1RT1A 3KTQA 3BO3A 3FGVA 3AOAA 3H42A 2XYGB 4DUTA 4KGXB 3LA0A 2PMZD 4FBTA 3CJ8A 2CJKA 2EG2A 1NHKL 2C42A 2M7SA 3HD1A 1M5SA 2A3JA 1NH7A 4C97A 1JX4A 2HHXA 3BPDA 5EWGA 3UCUP 2X1AA 2JDJA 1UW9A 4PWUA 3Q8VA 3H7HB 1LWXA 4NA1A 4Q2MA 4DR2J 2CQHA 3DOLB 3KLIA 5E41A 2HMIA 2RHSB 2DBBA 3JYTB 4KT0C 4KR0B 4A8YA 2C2EA 1N32F 1HQUB 2YKOA 3LP2B 3OL8A 4OX9J 3THTA 2ZH3A 4DR3F 3NXZA 3I55S 3RG6A 4DQSA 1JLFB 4Y34A 2RSQA 2BDPA 2DNLA 4A4JA 1K8AT 2UU9F 3VAJA 1TMJA 3CW2C 3QGGA 5ETQA 1SL2A 3G6ES 3U1LA 2A10A 1NHUA 2HHWA 4UOCA 1E6YB 4AXIA 3LQVA 1REVB 4ICLB 4HTIA 1RP5A 1RCOB 1RYSA 2XMTA 3BH7B 3SEOA 1S4EA 5HQ8A 5HVFA 1ZM9A 4JV0A 3G2XA 2N4CA 4ZP9A 2K1RB 4MK7A 3TA0A 3HCXA 3QWPA 2FJWA 3OSPA 1FO1A 3JXOA 4EGLA 2DNHA 3GP9A 2IIHA 4L75A 2OO4A 4H4MB 3RB6A 3QIPB 1WHXA 4M5HA 2CDRB 3MMAA 4RNMA 4RJVA 4NMXA 2P2CB 1UJ4A 2C2RA 4F67A 3IG1A 4DV5F 3C15A 5G0RA 4P9SA 1FRMA 1KNZA 4DFJA 3CUNA 3J80U 1TKDA 3TI0A 3C2PA 7FDRA 2E9ZA 3JSBA 3N79A 2V34A 1H38A 2W9CA 5E3PA 4MK9A 4NMLA 5DDRC 2MKCA 4IYQA 3PW4A 4I2QA 3FZBA 1MU2B 1D0EA 2P6TA 4P7TA 5IWAJ 1WC1A 3V4IA 2VA2A 1VQMS 2V69A 2N7CA 3H98A 4MKVA 3A3OB 2FGOA 3Q23A 3CCLS 2IRXA 3NEKA 2HAFA 3PZPA 1OIAA 4WFZA 3PXGa 1UWAA 4CLWA 2OELA 3M30B 1M1GA 4ALZA 2Q1LA 1B7FA 2OD6A 2W7AA 4NI2B 3L09A 2Y0SD 3IGNA 2ZUGA 4IOBA 3E51A 1GT8A 3HHLA 4EFAC 2ZE2B 1V5VA 4W90B 3KKFA 5A8WA 4RNFA 3MOZA 2CPDA 2QGFB 2UVVA 1GMUA 2NSBA 2OPQB 4DV6F 3UR0A 3PCOB 1KFDA 1C2PA 4C0BA 2HIQA 5GAHI 1GTHA 2IRYA 3DLKA 2KTQA 3KK3B 3UDLA 1KRPA 4A8KA 3NMAA 3EMTA 2JH3A 3QT8A 3DCAA 4EWTA 2EFNA 4HDHA 4OJHA 3DLEA 2IPOB 2C2KB 1SJ4P 5KFUA 2ZC3A 1VLOA 1BY9A 3HP6A 4BHQA 3MMAB 3HZGA 5ETSA 2HGNA 4DV2J 1NSQA 2HFZA 3D6FB 1Y3KA 1CULA 3C19A 4CO3A 1VIOA 2RAQA 4ZMMA 4FYDA 3C8YA 3IRWP 2DY9A 1TL5A 4ZVFA 2DB1A 1QTNB 4X4TA 2ZH9A 3RB0A 4WKYA 2AYMA 4KFBA 4GRSA 4CLYA 2YTCA 3BF4A 2XS2A 4EO6A 4WXWA 3OSNA 4ANEA 2R8JA 4ZVEA 1RZMA 1N54B 3GLJA 3KDNA 3OTOF 1QSLA 3QZ7A 3DGPB 2R4FA 1TUVA 4OIXA 4ANCA 2G9OA 2XZTB 4MKAA 4OJ3A 5ETRA 2D3O1 4F0HA 4OYOA 4HH0A 2EBEA 5HN0A 1WHWA 2OTJS 3PIPQ 1H0HB 4GC7A 2E5IA 4O4RA 1Z1ZA 3SDEB 2LVWA 4RW4A 4ED0A 1WC5A 2HEKA 5B0FA 4WP8A 3VF0B 3QLHB 1QJHA 3M2UB 3KLEA 3V6DB 4G1IA 3CCES 3HT0A 1BLUA 4I56A 2GAHC 1GEHA 2FJEB 2WVCA 4HL9A 3D28A 1WKKA 2ZNYA 3NBPA 4EBEA 3BB5A 1HNIA 3DOKA 1U1MA 2B7BB 1S77D 1DQ8A 3MEDB 4N7TA 1HNXJ 3CNQP 2CZ9A 2XSJA 3OQ2A 3ZZZA 4P52A 3CCUS 3HVTB 4C3LA 4PXDA 1HBMA 3M8SA 4HTJA 2QMXA 3M8PA 2XS7A 5JVHQ 1HQEA 3ENAA 4CO0A 3UVJB 1HHSA 3T3FA 2G1DA 3NGKA 4USVA 1YZ7A 1CULB 2RHQB 4XDDA 3TX8A 1T9UA 3KNAA 3OLAA 3UNGC 4G65A 3IRXB 1FKOA 4IOCQ 2H5JB 4OMFG 2UXBJ 1QM9A 2CNKB 4B3MF 3SQOP 2CPZA 1C1BB 1WC3A 4NLTA 4O3NA 1QAIA 3E2EA 3QT7A 5SUHA 4X65F 1XNQJ 2GVDB 2NREA 1RWKB 4HH1A 4PG5A 4Y0FA 1S9FA 1H74A 2W7OA 1UPPA 1VHIA 1SQEA 1T9YA 2JLGA 5DS7A 4J9QA 1Q53A 2YQ0A 4PYAA 5KG3A 4U67Q 4C8NA 2W2PP 1JJHA 2HRTA 5KFSA 3QJJA 3U7JA 2CJQA 3IA0A 3DRSA 2YKQA 2HFOA 3DRRB 1WC4A 1NKBA 2QIFA 2AF6A 4U7CA 1X5SA 2VKZG 4OZ3A 4DPXA 1PC4A 2VA3A 2J6SA 2C3YA 2XMVA 1FFWB 3HLUA 4JI0J 2LDYA 3R5JB 2MMYA 2OI2A 2CJYB 2JOQA 1TFWA 5C2CA 3S8SA 3ILOA 1ICEB 4Q45A 3R2CJ 3BEGB 4LMZA 1R8HA 5KG7A 4CNZA 5J2MA 4ZIWA 2HHQA 4M63A 2BJDA 1SI9A 2V63A 3D54A 2D9PA 1S59A 3IWXA 2C2NA 5GADU 1IJFB 4LRCA 2V9KA 1S7IA 3MM5A 3SXLA 3ZTPA 2CADA 4HYKA 2DO0A 3L4BC 4JB8B 1P8GA 1CQMA 1J5OB 2J6TA 4UQTA 1L3VA 2OMOA 2MGZB 2KXNB 4LSLB 2E5GA 1SB6A 4K5SA 4M8LA 1S9GA 1AFIA 3CXCR 4PG4A 1A9NB 4NA3A 2GQ2A 5F8NA 5GMKa 4DV1J 1KHVA 4BC9A 4WP9A 4GKKJ 1I51B 2B8PA 2B43A 4LRAA 4JI8J 4P71A 1R7IA 3AB4B 3S01A 4O0IA 2DEIA 3GJSB 2W4PA 2M2BA 3HHEA 4B3TF 1KN6A 1FTCA 4PWDB 3VAKA 1KBRA 4P74A 2ZDPA 4CQ1A 4RW9B 2QLBB 3UN5A 4JI5J 3SMZA 4RW6A 2W7PA 3DDKA 1VR6A 1JLCB 4WFBQ 1N6QA 1TVRB 1X4HA 2QV6A 4M5LA 4ZP7A 3DU6A 3WC0A 1NK8A 4USJC 4WP3A 1VLYA 1YVFA 1HR0F 5FDLA 4NLUA 1LOUA 4F4XA 1LWFA 4C8MA 2ATCB 2B6AB 3L7UA 3CVKA 3B6BA 4J7CA 2DR9A 5MLCV 2MQPA 2VZ9A 4WFXA 1XK8A 4UY8T 2W4DA 3H0PA 3N6MA 3H2LA 1TL4A 4E2FB 2RDIA 2VB6A 2DISA 4ETXA 5D3GA 4QIGA 4DUZJ 1WC0A 1D9DA 1U1KA 1WWHA 1KKHA 1VRUA 5AE1A 4KTQA 4TYBA 3U27A 2OLWA 3KJQB 5GVQA 5IZHA 4J9LA 3FQLA 3BKUA 2A0FB 1LW0A 2UXDJ 3JSMB 5CYQA 2O3DA 2R7WA 3AA8A 3CCJS 5C2GA 2GJIA 3A8IA 2ZZNA 4QYZJ 4UOFA 4ZJQA 3M05A 1UVMA 1Y0HA 3M1VA 4OV1A 2FJDB 1SJRA 3MM6B 3S6EA 2BE2A 5AXKA 5GAEI 1TMMA 1TK5A 3D68A 1VS3A 4AL7A 4WFAQ 2XNRA 4ZVRB 1RAEB 2CVIA 2FHMA 2VQFF 2ZHAA 1Y10A 4L76A 3LO3A 4TXSA 3HZEA 2E44A 4JI2F 3JTPA 5B0CA 1OY6A 3OR2B 2FVPA 5MAOA 3RW6A 3GIIA 2MJUA 2XY5A 4CLFA 2CUYA 2HVEA 2HIYA 5T14A 2V4JA 5DZ6A 4PPZA 1S72S 2GHWA 3J81j 3VGTA 3LPYA 1XMBA 3W60A 5FDLB 1HD1A 2XO6A 1LWFB 3K17A 4JV2A 3HFKA 4C11A 2QLWA 4F0KA 4AFFA 2Y1LB 2P9GA 3BS9A 2H1YA 4B3RJ 8ATCB 4Q0BB 1X5PA 4CP5A 2C2MB 4ECZA 3OXFA 5K14A 3ISZA 1S6QA 3D1OA 1WUUA 3MECA 5F8HA 2VFRA 2CWKA 3KMQA 2KXFA 2VD3A 2DCLA 2PN6A 3M8YA 2MJNA 2GS8A 5B0GA 2D69A 2VC1A 2R2RA 4FXDA 1SJFA 3CJKB 2PEHA 3L95X 1J5EF 4ELVA 4USIA 3V81A 2RIJA 1T7PA 5IFMA 2RU9A 2HNZB 2MKSA 3PFEA 4I6YA 1UTAA 2KH9A 6AT1B 1VRUB 1HNWF 2HNYB 3M6XA 4JOUA 2QEXS 1KR4A 5J2QB 3GQCA 3W3SA 4ZIVA 4F50A 1PCAA 3PYEA 1WD6A 2IAJB 2JLEA 2X1FA 1VQNS 3OVAA 2EC0A 3PDNA 2VASA 1Z4UA 2QYCA 3SZ2A 4MFBA 4F25A 2C3PA 3M2RB 4FBUA 4FP9A 4QIVA 1IM6A 4PXBA 3E01A 3I31A 2IBKA 3MMJA 3H25A 4EYIB 3Q0AA 2M70A 3SSQA 5LXRA 1RHKB 3ILLA 4F7VA 4M5JA 2OPPB 3CJ4A 3QFHA 1CLFA 4YB7A 1AT1B 4K4YA 1TKZA 2IFXA 2K2PA 4JI4J 4X4QA 2QMWA 3KUEA 1GX5A 2I0XA 3LF0A 4B9TA 2ZD1A 4DPTA 4LFCJ 4O44B 4OYWA 2PC6A 3NOGA 1HNZJ 3IM9A 1AUSL 2V94A 1RU2A 3FDSA 2K3KA 5GMEA 4LVOP 4CCHA 3EXCX 4NLPA 4B3SJ 4KBIA 2OPRA 1RT6A 5JJBA 2FTRA 3G8QA 1JLEA 2JLFA 1K47A 4S0MA 1IKWA 5M2UA 2VH7A 2YVSA 2J9EA 3PX4A 1U7LA 3Q8UA 2IM1A 4X4UA 3VAIA 1B4SA 3SCLE 3I5BA 3KFWX 2L41A 5GAHU 4IKAA 3MF5A 2D3ZA 2WTFA 3CJQA 4PRFA 1R3NA 3BGOP 1DTTB 3KMSA 1PJ6A 1T8EA 4IUFA 4LF8J 2GIQA 3RJMB 1RABB 3D5MA 3KJVB 3NGTA 1ZZNA 3FCWA 4HI1A 1NJXA 3M9OB 3W62A 3BO4A 2V2VA 4N5SA 1TQLA 5I4MA 5IM0A 1HNVA 1X4EA 2WVDA 2MQLA 4JI7J 4CLZA 2ZUAA 3MEEA 3PJXA 3EVMA 2L9DA 4TN2A 1ZYQA 4ZPWR 4YY3J 1RAOA 4DL3A 3J7A1 3OFFA 4KJIA 4HVZA 3M8RA 1U49A 2WSEC 5KFXA 4PABA 1F5AA 3PO5A 1UJ6A 3CJ3A 4G3IA 2YWWA 3EPIA 3GU0A 1M1HA 1N36J 5DJBA 4NRUA 3J81U 2RDJA 2F40A 1JLQB 3D9BA 3W1YC 3CE8A 5KFIA 2F4VJ 5J2NA 2CNLB 1TKZB 1XTZA 3CSKA 4OLOA 2IA0A 2CQ4A 5F41A 3RRGA 1CJKA 3IR6B 2FJXA 3F56A 1S1XB 2CQDA 5EX0A 1S9EB 3K59A 5A2QU 4F2RA 2BANA 1FNOA 2KI2A 2UUBF 2YNGA 3LWLA 4LBPA 2ZH6A 2UXCF 4RBVA 1CJVA 2ZHBA 2OHDA 2GAGC 2AJFE 4DOZA 1F2HA 3GIKA 3UO0A 3DRPA 3D3BJ 2WONA 1Q95G 3VALA 3MFIA 2LDIA 2EC2A 5A0YA 5LM7E 3MMCA 2FIUA 1WHVA 1U25A 2RRAA 2DTJA 3FZ2A 1K9MT 1ZAXA 1X4FA 1WNEA 2HGMA 2XNQA 1N32J 3CCVS 5DG9A 3J7YI 4DR3J 2GQQA 5E3RA 4OZ0A 3ZFVA 1U6BA 3HD2A 5KT5A 4ELTA 1RBAA 4FKYA 2QX0A 1TL1A 1G7CB 3EVWA 2W2QP 2H65B 4AE5A 2DHAA 3F41A 1VBZA 3OVBA 4DX8H 3HF5A 5T7LA 2J9DA 4CTAA 1XR7A 2V8PA 3POTB 5F0UA 3A4TA 4YQWA 1YQHA 1FK9B 2DNGA 2KO1A 2CJBA 3T5LA 3IMQJ 2FHJA 2ASDA 4IG3A 2HSEB 1HHQA 4FPRA 4LR9A 4NEYA 3JTOA 1UEKA 2GX8A 5A8KA 1RTJA 2W9AA 2N7YA 1FXDA 4UZCA 2Q6CA 4CT9A 3GSDA 2WVEA 7FD1A 1L3UA 4ED3A 5D4NA 1E6VA 4V19J 1YWXA 1I3OB 2VKRA 4CT8A 3GYNA 4DV5J 1ZPVA 1KLNA 3HKZD 2D74B 1CJKB 4DL0C 5HROA 5AE3A 1P6TA 2F5GA 5AXNA 2MPUA 5L8RC 1AW0A 3OTDA 5M2PA 3K5PA 1UMJA 4IFVA 2MKYA 1CJVB 2B7CB 4OYXA 2RJZA 3AJDA 1R89A 2F65A 4C0HA 4OI1A 2WONB 4O3OA 2MDAA 3VTIA 1S48A 1NSAA 3D0GE 5A0YB 5DQIA 2LLZA 3KLHA 4NZ6A 3PW5A 2DGUA 1N5QA 4BC7A 5IV3A 1ELOA 2MZQA 5CQGA 3P5BP 1BQNB 5HP1A 2HHHF 3GONA 2NQPA 4DR5F 1UETA 5KFJA 1RADB 3VAGA 5D0HA 2GHVC 5FLXY 1T03B 2QL7B 3TUZC 4C8YA 2ZH5A 3NMRA 4USTA 1XQIA 4AUKA 5D4PA 4CLLA 1V6HA 3PM9A 2V8DA 5C25A 2OEMA 2KJWA 3TUJC 4OL8A 4R8UA 2PFDA 3OFEA 1EB0A 2PEBA 4C6AA 1EKRA 1D09B 4MIWA 3UFCX 2ZEJA 1KTVA 4DV6J 4PUOA 2MZRA 1DFDA 3R1LA 2DGQA 1RJJA 2G1HA 4PZVA 3Q2SC 3PRVA 1RWNB 4MH8A 3D6HB 2G2ZA 1PYSB 2I5JB 3TQEA 3A13A 4CNYA 5A8KB 3WIVA 3DLHA 1TP7A 4FS1A 3JSYA 3OUYB 3I87A 4ZVPB 1S57A 2ZBRA 1NSKL
chains in the Genus database with same CATH topology
3R7BB 3KJNB 1RWWB 2H54B 1I51B 4ZVRB 4LSZB 3GJQB 5IC4B 2C2ZB 2XZTB 1RWVB 4DCPB 2QL7B 3SIPB 3GJRB 2DKOB 2QL9B 3IBCB 2Y0BB 2H5IB 2QLFB 1I3OB 3R6GB 3R7NB 4DCOB 3GJSB 2QLJB 1SC1B 1RWPB 1RWXB 2XYGB 3P45B 5IC6B 2XZDB 3R5JB 2C2KB 3P4UB 1RE1B 2H51B 2CJYB 1NMEB 1SC4B 2H4WB 2H5JB 3R6LB 1ICEB 1IBCB 1GFWB 3KJQB 3EDQB 5K20B 2QLBB 2CNKB 2H4YB 1PAUB 2XYHB 4DCJB 3D6FB 2HBRB 3QNWB 2HBZB 1PYOB 1SC3B 1F9EB 2H65B 4ZVQB 1RWKB 3KJFB 1QTNB 2CNLB 2Y1LB 1RWNB 3D6HB 1RHQB 1RWOB 2HBQB 2CDRB 3GJTB 2C2MB 4ZVSB 4ZVUB 2P2CB 2C2OB 1RHRB 1RHKB 2FQQB 4JB8B 4ZVTB 1BMQB 2C1EB 1RWMB 2XYPB 2HBYB 1RHMB 3RJMB 3NS7B 2H48B 2CJXB 2CNNB 3D6MB 2QL5B 4ZVOB 4ZVPB 3EDRB 2CNOB 3R7SB 1RHUB 3IBFB 1RHJB 1QDUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7B B;  3KJN B;  1RWW B;  2H54 B;  1I51 B;  4ZVR B;  4LSZ B;  3GJQ B;  5IC4 B;  2C2Z B;  2XZT B;  1RWV B;  4DCP B;  2QL7 B;  3SIP B;  3GJR B;  2DKO B;  2QL9 B;  3IBC B;  2Y0B B;  2H5I B;  2QLF B;  1I3O B;  3R6G B;  3R7N B;  4DCO B;  3GJS B;  2QLJ B;  1SC1 B;  1RWP B;  1RWX B;  2XYG B;  3P45 B;  5IC6 B;  2XZD B;  3R5J B;  2C2K B;  3P4U B;  1RE1 B;  2H51 B;  2CJY B;  1NME B;  1SC4 B;  2H4W B;  2H5J B;  3R6L B;  1ICE B;  1IBC B;  1GFW B;  3KJQ B;  3EDQ B;  5K20 B;  2QLB B;  2CNK B;  2H4Y B;  1PAU B;  2XYH B;  4DCJ B;  3D6F B;  2HBR B;  3QNW B;  2HBZ B;  1PYO B;  1SC3 B;  1F9E B;  2H65 B;  4ZVQ B;  1RWK B;  3KJF B;  1QTN B;  2CNL B;  2Y1L B;  1RWN B;  3D6H B;  1RHQ B;  1RWO B;  2HBQ B;  2CDR B;  3GJT B;  2C2M B;  4ZVS B;  4ZVU B;  2P2C B;  2C2O B;  1RHR B;  1RHK B;  2FQQ B;  4JB8 B;  4ZVT B;  1BMQ B;  2C1E B;  1RWM B;  2XYP B;  2HBY B;  1RHM B;  3RJM B;  3NS7 B;  2H48 B;  2CJX B;  2CNN B;  3D6M B;  2QL5 B;  4ZVO B;  4ZVP B;  3EDR B;  2CNO B;  3R7S B;  1RHU B;  3IBF B;  1RHJ B;  1QDU B; 
#chains in the Genus database with same CATH topology
 4F0M A;  1DZ5 A;  1LWE A;  3HHL C;  4HHH A;  4DCP B;  4LT6 A;  1Y11 A;  2DKO B;  5HQL A;  4X64 F;  1SKR A;  2ZOG A;  4X4P A;  1RYR A;  2Z4P A;  2J76 E;  2KKH A;  3WZ0 A;  4DCO B;  3MR5 A;  1T3N A;  3CD0 A;  2K7J A;  3ET6 B;  3PW2 A;  4IFV B;  3Q89 A;  1NME B;  3RBD A;  3O8W A;  2ZH1 A;  1ZTW A;  4NCG B;  3ZNU A;  3OTO J;  4YR0 A;  3C6U B;  3TR5 A;  4USM A;  2AMC B;  5DO2 A;  4A8X A;  1UA1 A;  2CZV C;  1SJ1 A;  1VC5 A;  1NCL A;  2EWH A;  3SV4 A;  1YTY A;  2JC0 A;  2QA2 A;  1IWA A;  2HQF A;  4YOE A;  4ECV A;  1WTF A;  3UD4 P;  2HYI B;  2KT2 A;  2X1B A;  5A8R B;  2FVQ A;  4IOA Q;  4LF6 J;  2U2F A;  4F3M A;  4P73 A;  2ABY A;  2ZC4 A;  4JYA J;  2MQM A;  1H98 A;  2YQ1 A;  2KB2 A;  3DI6 A;  3OTC A;  1HBU B;  2G2O A;  4R8U B;  1N33 J;  1YHQ S;  3W2W A;  2N3L A;  4ZP8 A;  4QWA A;  2NXC A;  4NXM F;  1F3V A;  2PT0 A;  1D3W A;  3M2V B;  3AD9 C;  1SC1 B;  1TL3 B;  1FJG F;  1R6V A;  2Z8Q A;  2GA7 A;  2KG0 A;  3CCR S;  1FKP B;  4OLP A;  3EZO A;  4K4Z A;  3N01 A;  2RKI B;  1DLO B;  5KFV A;  4NLW A;  2JNJ A;  4FDF A;  2FC9 A;  4B3O A;  5D4O A;  2HK3 A;  4J9R A;  4CM2 A;  5GAE U;  2HGL A;  5LMU F;  3RYL A;  2CVE A;  2FY8 A;  1PKU A;  3ZC4 A;  3HO1 A;  3T19 A;  3UWT A;  1TKT B;  1NPP A;  2LEP A;  1FRK A;  3HFZ B;  4EU0 A;  3MMB A;  2IYI A;  4LF9 F;  1SC6 A;  3K8V A;  2VG7 B;  4G6V B;  1UEV A;  4ZHR A;  1FFS B;  3MM7 A;  2EFO A;  2GMH A;  1K73 T;  3N6N A;  3IP0 A;  1RHJ B;  1UW4 A;  1M1K T;  4B3M J;  5EX3 A;  3DLL Q;  2XEX A;  3W5Z A;  2C2Z B;  3GR0 A;  1WG4 A;  5H9F J;  4X65 J;  2F63 A;  1X4D A;  1FTR A;  4B02 A;  4Q5V A;  1IR1 A;  4ZJL A;  3BGL A;  4DL2 A;  1RXO B;  2A6M A;  3OV7 A;  2E1P A;  2HFU A;  2GIF A;  5DG8 A;  2C2D A;  4RUA A;  5B0B A;  1EX8 A;  2L3M A;  2WVF A;  1FDA A;  2MHE A;  1MMN A;  1R43 A;  4JI6 F;  1HD0 A;  2VPZ B;  2E66 A;  2ALZ A;  2MST A;  4I69 A;  2HQD A;  4C3K A;  1ZA2 B;  2B0G A;  2Y8Y A;  1C1C B;  5F9L A;  2C22 A;  4XK8 C;  2RRB A;  5LJ5 Y;  5HMX A;  1NRK A;  3W2W B;  1EAY C;  3MR2 A;  4UUX A;  3GR1 A;  1VK8 A;  3FEY B;  5M2R A;  4MJK A;  3MCO A;  3O2I A;  2DIT A;  2RF2 A;  4RNH A;  3C16 B;  3RUB L;  4F26 A;  4K7Q A;  1R6Y A;  4Q8E A;  3DHX A;  4WYW A;  4KRW A;  4N41 A;  4EZ6 A;  3GE9 A;  4B3O B;  5CYJ A;  2DNY A;  4C4W A;  1NU4 A;  4YN3 B;  2RIL A;  4E0D A;  3VGU A;  2BW2 A;  1WF0 A;  3MM8 A;  3D2W A;  2VFV A;  4O4G A;  2WW4 A;  1YJU A;  4IR9 A;  1UWB A;  3PKM A;  3D66 A;  3BYP A;  3M32 A;  4Y2I A;  4Q43 A;  5F8L A;  1JLG B;  2BRL A;  3QAE A;  2G4B A;  2MY8 A;  3MM7 B;  1G2E A;  3PRB A;  4PKD B;  5HI7 A;  1FXR A;  2ZM6 F;  4GKJ J;  1AA1 B;  2J9D E;  4FF1 A;  2KFY A;  2AW0 A;  5B0A A;  2SXL A;  4J90 A;  4ZP6 A;  2CJA A;  4NLR A;  2JZ5 A;  4B3T J;  3R5G A;  4Y00 A;  1X5T A;  5HBM B;  1NZA A;  1URN A;  3TW0 A;  4IQX A;  3IS9 B;  3QT6 A;  1UJ5 A;  3KLF B;  1T0T V;  1W25 A;  1RWV B;  4OX8 A;  1DTQ B;  4QBU A;  3LPE A;  3A8K A;  5DM6 Q;  4ZLL A;  2B9E A;  4XAK A;  4PEO A;  4NLX A;  4DR6 F;  4OI6 A;  1VBY A;  1FRH A;  2EBG A;  1M0S A;  2GGP B;  4LSN A;  1HIY A;  5DDQ C;  4LR8 A;  2QA1 A;  4CRJ A;  3R6L B;  4NOH A;  1HYS B;  4RUB A;  2NYH A;  1U1Q A;  5H1S V;  4JI3 F;  5C24 A;  4L3K A;  4WTY A;  2J7W A;  2AGO A;  4NLO A;  2HQ3 A;  5E3A A;  2J9C A;  1RU1 A;  2J7U A;  3TUP A;  2VOP A;  3OHB A;  4F3Q A;  4YDD B;  3WX8 A;  4A8M P;  2XCP A;  1ZTT A;  2RF2 B;  5L46 A;  1VGY A;  1X0F A;  2V6A A;  2UUA F;  3NCQ A;  2BE9 B;  1FVQ A;  2C28 A;  5E2Q A;  2WBR A;  5J1E A;  4C0O C;  1CEZ A;  3CDE A;  1MRO A;  5K9F A;  2FZK B;  3MM8 B;  5DDP C;  2DIV A;  2FYX A;  1TKX B;  3I96 A;  5JMN A;  4MYU A;  1CS4 B;  4L3N A;  1VBK A;  4WXO A;  1U47 A;  1ZH5 A;  1IKX B;  4WE1 A;  4N56 A;  4EMD A;  3ITH B;  2V8V A;  2ZNZ A;  3BKF A;  3F73 A;  1JJC B;  1OPI A;  1SL0 A;  5K20 B;  2HUR A;  1Q82 T;  3UN3 A;  2UV8 A;  4NLG A;  2B56 A;  4MYT A;  2VQF J;  1IKV A;  5C42 B;  2R7S A;  2X7I A;  5DLF A;  3MCS A;  4JI2 J;  2CQB A;  2JVO A;  4IDK A;  3PG9 A;  1VC6 A;  1WHY A;  2YKM A;  3NWG A;  2E5L F;  4PYD A;  2HLU A;  4GC6 A;  4QYR A;  1HKA A;  5D6G A;  3N4W A;  2CQG A;  4B9V A;  1SL1 A;  2MKJ A;  2GQC A;  2WW8 A;  3LP1 A;  5DET A;  3GZ7 A;  4OV6 A;  5IC4 B;  3I9Z A;  2VU5 A;  1KP6 A;  3PY8 A;  3AH6 A;  3DRX A;  4OJG A;  1WEL A;  3DM2 A;  4N8O A;  3G6X A;  3DYA A;  2V8G A;  1R0A B;  1CSJ A;  2Z2L A;  4ZJO A;  4RR5 A;  2BQU A;  4GVB B;  4G1Q A;  1D8Z A;  4BBY A;  2JWN A;  3W9J A;  3R8Y A;  3AY0 A;  3VGV A;  2AU0 A;  1UVN A;  1AB8 A;  4PG8 A;  1T05 B;  3EDQ B;  5L39 A;  3TRG A;  1J5E J;  4USU A;  5L38 A;  2UP1 A;  8RUC A;  4AL6 A;  2B9W A;  3OD2 A;  3DGV A;  1HNW J;  2RRN A;  5KG6 A;  3B78 A;  2YBV A;  3ZO7 A;  1RAI B;  2MKI A;  2HQI A;  4JBC A;  3TVZ A;  1AUD A;  1RCX B;  3CB4 A;  2JHE A;  1NO8 A;  1UL3 A;  2LQJ A;  3DLB A;  3MR3 A;  1PG5 B;  4Y6I A;  1I94 J;  1ZPW X;  3EDR B;  1RTH A;  2EI5 A;  2PDA A;  5KFW A;  5EDW A;  3IAM 9;  3H4B A;  5DQH A;  3R5C A;  2WSF C;  1XMO F;  2V9W A;  3H2U B;  3LP0 B;  1SIZ A;  2ASL A;  1LW2 A;  2MEW A;  1YLX A;  1R8A A;  1RA6 A;  2W2M P;  2R7R A;  2O1P A;  5F3Z A;  3ENQ A;  3UQS A;  5DM7 Q;  2DT9 A;  2GW8 A;  1APS A;  4TYA A;  4WU2 A;  1Z2Z A;  2OFH X;  2LKZ A;  2RT3 A;  2HRU A;  4AYB D;  3KUG A;  1IBC B;  3J7Z 5;  1FVS A;  2QRR A;  4ZLN A;  2MLZ A;  5D78 A;  3KWM A;  2AYE A;  4ED8 A;  1BD6 A;  4LF2 A;  5EGY A;  2YNI A;  1RAG B;  4N77 A;  1KQF B;  4ES3 A;  3FKB A;  2VBX A;  1NM2 A;  4FF2 A;  3TWZ A;  3NRB A;  3O6Q A;  1OSD A;  4F04 B;  1PSD A;  3BDP A;  2L9W A;  4YDX A;  1FX4 A;  1R0B G;  1GTE A;  3TZZ A;  2F3J A;  4ID8 A;  4XTT A;  4L73 A;  4DV3 F;  4ID5 B;  1XBW A;  2LU1 A;  3BN4 A;  4LQ3 A;  1RTZ A;  1TU0 B;  2MKH A;  4UUW A;  2V2K A;  3JAM U;  1RT3 A;  4I7F A;  1MN7 A;  4NLV A;  1CJT B;  3GFZ A;  4R5P B;  1IBL F;  1KTQ A;  4OJ1 A;  4EUV A;  4A8Q A;  2QL9 B;  2AJ0 A;  1NBE B;  3NAH A;  1B0V A;  5I3Q A;  2QLJ B;  5C5J A;  4B9U A;  2B9Y A;  2KM8 C;  2JEF A;  2ZBI A;  2AGQ A;  1UFL A;  3BBC A;  3RBX A;  1B0T A;  5HMZ A;  2AYG A;  5J2P B;  1N5Y A;  1X8D A;  2LXU A;  1I1G A;  4Y2C A;  3GMG A;  5KFY A;  1WKL A;  1WAC A;  5AXL A;  2DXF A;  4DPO A;  4F36 A;  3GFX A;  2C3O A;  1QAY A;  1MG7 A;  2YKP A;  3LTO A;  3TUI C;  1T9V A;  5CD4 H;  4HAC A;  2W2O P;  4KHR A;  3TAN A;  5GAD I;  1U1N A;  3HHL D;  2DVI A;  2X51 A;  1DQA A;  4KY3 A;  3P49 B;  1S1V A;  1YJ7 A;  5IT9 Y;  4K59 A;  4DG1 A;  2ZHO A;  2DH8 A;  3I32 A;  5ETM A;  2ATL A;  1KWM A;  4EZ9 A;  1H7X A;  1LXN A;  5D15 A;  1S5Z A;  2DR8 A;  2P5V A;  2FUG 9;  1CVJ A;  3CD7 A;  1QY7 A;  3MCN A;  5T41 A;  1RK8 A;  3FFI B;  4LF5 F;  4LRB A;  1JLA A;  3AOB A;  1VIS A;  3ILJ A;  3AQO A;  2QE5 A;  5AT1 B;  2UUB J;  2LU2 A;  3NS5 A;  1U8W A;  3OHA A;  1PIE A;  1GFW B;  1WDD A;  2LQB A;  3SYZ A;  5D0R A;  1T11 A;  3UD3 P;  2LP4 A;  3T1Y F;  3GTY X;  2DPJ A;  4KO0 B;  3KJF B;  4IRD A;  3JQK A;  1YZ6 A;  2R7T A;  3ICL A;  1NHV A;  2HQG A;  3PEJ A;  1IBK F;  1RBO B;  4J9S A;  5GAG I;  4I68 A;  1REG X;  5CD4 A;  2ZH7 A;  3C6T B;  4DLE A;  1SQG A;  1U0H A;  3ONQ A;  5ETT A;  2GJF A;  3T6B A;  2ZKT A;  2R8G A;  2MKK A;  1IKY B;  4YB6 A;  4JV5 F;  2MZ1 A;  4RNN A;  1D9F A;  2W9B A;  4M5I A;  2HQC A;  1VQP S;  2XBP A;  2F8M A;  1TAU A;  3IAS 9;  4UOH A;  3ZXW A;  3X3U A;  2BJ8 A;  2G13 A;  2VJU A;  3KHH A;  1SC4 B;  1QE1 A;  4A8O A;  2BE7 D;  3D1H A;  5F3T A;  3DXB A;  1SQF A;  1ZZF A;  2Z30 B;  2OSQ A;  1LK5 A;  3PNI A;  4OHV A;  3OT9 A;  3I0S A;  1I5O B;  3BN7 A;  5DQG A;  4KKO B;  4QIE A;  1LWC A;  2RML A;  4ZN1 A;  2KYZ A;  1T02 A;  3NL0 A;  4LF4 F;  1H2V Z;  1FDD A;  1XC9 A;  1V3S A;  1ZOT A;  3EWG A;  1YX2 A;  3D6M B;  3KLG A;  1SJQ A;  2DHS A;  4IFY A;  2I9S A;  3HJV A;  2VPY B;  2XSF A;  2Z2Z A;  5LOQ A;  1HQ2 A;  3R9L A;  1FF2 A;  1YJ9 S;  5CA5 A;  4H4O B;  5HJY A;  3RAM A;  3B8H A;  3ZTS A;  2ROP A;  1D1U A;  3W2V A;  4ES2 A;  2U1A A;  4FVM A;  1NAQ A;  5KFQ A;  1NB2 A;  4M95 A;  3TJ8 A;  3RBZ A;  1QTM A;  2BA9 A;  1HI0 P;  5K8O A;  4KHP F;  4OI3 A;  2Q66 A;  5HAT A;  3O1L A;  5KG5 A;  2HHH J;  3BBF A;  2NXJ A;  4KV8 A;  3H2V E;  1TAQ A;  2BAC A;  5IQQ A;  2LA4 A;  4M5D B;  3JS9 A;  3LUY A;  2HHV A;  1RT5 A;  4X4N A;  2CKW A;  5JXS A;  2QFJ A;  2JC1 A;  3MTK A;  4YB5 A;  1YJR A;  1K1Q A;  1EJ7 L;  2XYP B;  2LFV A;  3QJL A;  2DH7 A;  4W98 A;  2RQM A;  2CNN B;  1FEE A;  3DN9 A;  3TQ1 A;  4FYY B;  1AXQ A;  4DR7 F;  3Q83 A;  3IM8 A;  2XHW A;  1V5I B;  3GIL A;  5KFE A;  1U45 A;  1SXL A;  4DFP A;  2YNF A;  4TVA B;  4ZS6 A;  1TL7 A;  3I82 A;  2DRA A;  2PA8 D;  3DRY A;  4QYZ K;  1KEK A;  4YME A;  4YR3 A;  1M5H A;  1WOP A;  2YPZ A;  1YI2 S;  3MPY A;  5I3U B;  4DR4 F;  4B9M A;  5HSP A;  1RAF B;  4O3R A;  2J0S D;  3I0S B;  5L9N A;  2VPW B;  1UAW A;  4NZ7 A;  5THW A;  3UNY A;  3UPF A;  2ZBQ A;  4YEA A;  1LWC B;  1OWX A;  3GCX P;  1G1X A;  1MWY A;  4P10 A;  4PXE A;  3OXL A;  4U95 A;  3KLG B;  3PX0 A;  1RT1 B;  4QR0 A;  5K8P A;  2PGC A;  3RRK A;  2M3D A;  3U1N A;  2OTL S;  4ZVS B;  4J9M A;  1RBL A;  4IR1 A;  4LBI A;  1HW9 A;  1P9Y A;  4RW7 A;  4Y2M A;  1GQE A;  4EI2 A;  4PQA A;  3ZZ0 A;  3OR1 A;  1SH3 A;  1WSV A;  3Q8S B;  3W9I A;  2FLL A;  2HFN A;  3DMJ A;  1RB0 A;  2H54 B;  3W2V B;  1Q0N A;  2CJ9 A;  3UDC A;  3SQG A;  1HBO A;  1BHN A;  2WCX A;  3KLI B;  2HMI B;  1VQO S;  5L9X A;  1NKE A;  2E5H A;  4A47 A;  2CG8 A;  3EZ5 A;  3HHN B;  3N6L A;  4OI4 A;  3QRP A;  2ZIT A;  1S1T A;  1RWP B;  1Q4R A;  1N5T A;  5FJ4 A;  3QO9 A;  5GMD A;  2Z0G A;  3K8W A;  4NYZ A;  3MR6 A;  1M90 T;  3QAT A;  3HXM A;  4X62 J;  2YQ3 A;  3J80 Y;  4QWB A;  3FEZ A;  1BWV A;  4IG0 A;  4N47 A;  5CZV A;  1RT2 A;  2DGT A;  4ZVQ B;  2PII A;  3QZ8 A;  3OW2 R;  4HT5 A;  1HWU A;  4C2M A;  3PJ9 A;  1U24 A;  4NXM J;  3BJY A;  1RAA B;  2YNF B;  3T5J A;  2XMK A;  2Y3Y A;  1S6P A;  4ZPC A;  2CJX B;  2DR5 A;  3AXM A;  5F8G A;  1AFJ A;  5KFA A;  2X3G A;  3Q2T C;  3TAP A;  3LH2 S;  2NPF A;  2YWK A;  1MN9 A;  3B4M A;  2DIU A;  1RT7 A;  5LMU J;  2A1B A;  1ITP A;  4LUB A;  3RBE A;  3MPU B;  1FNX H;  2CPF A;  4WKR A;  3PO4 A;  5KFF A;  4MAK A;  2HHS A;  2NUU G;  3EE3 A;  3IG1 B;  1X9M A;  4GVL A;  1MML A;  1YIT S;  1EET A;  4MKB A;  3C15 B;  4LF9 J;  5G0R B;  1XNQ F;  4JV1 A;  2XMM A;  3KOA A;  5ETV A;  2MHN A;  2E1C A;  2AD9 A;  4NWB A;  2HAI A;  1UFK A;  2HHP A;  2W9C B;  1DQ9 A;  2PFF B;  3I5C A;  1U1P A;  3LGH A;  3MHY A;  5LXY A;  4I2Q B;  5KFR A;  3NG8 A;  2H5E A;  1FRX A;  4PG6 A;  4P2F A;  3Q24 A;  2DH9 A;  3V4I B;  1RHR B;  3BQ2 A;  1H72 C;  4LQ9 A;  4DV0 J;  1Q8L A;  3FBB A;  3PAC A;  1ZAW A;  4TY8 A;  5CCM A;  2Z2Y B;  1JXL A;  1PIL A;  3CIZ A;  1FNM A;  1U02 A;  6FD1 A;  2M4M A;  2AV5 A;  4DSJ A;  1VQ5 S;  2FC8 A;  4DQI A;  4ITS A;  3D1Q A;  1X60 A;  4JI6 J;  4RO0 A;  5KT4 A;  3T6J A;  4ES1 A;  2E7X A;  3H5S A;  1N88 A;  4O23 A;  2B4O A;  4TLQ A;  3HHL B;  2Y1I A;  1PGZ A;  1S76 D;  5A8W B;  1RE1 B;  4TQS A;  5D77 A;  2ZH8 A;  5IOL A;  2NXE A;  1LFW A;  3G87 A;  3SFG A;  2B5J A;  4DQP A;  3RB3 A;  5H9E J;  3HJF A;  2IC3 A;  1UEU A;  3DLK B;  3HSJ A;  1TTH B;  4U6P A;  3NS6 A;  2N82 B;  1B70 B;  2YY3 A;  3WDO A;  2JX2 A;  2XLJ A;  3DLE B;  2ZFH A;  1V3R A;  3DLG A;  2EK6 A;  1WOO A;  4J37 A;  5C7P A;  3PHT A;  4JI8 F;  2RUG A;  2HLT A;  2ADC A;  2JJ4 D;  4EO8 A;  4RU2 A;  4EEY A;  4LSZ B;  2DO4 A;  2ILY A;  1U26 A;  3VWS A;  2YXL A;  3T9N A;  2GZO A;  2ZM6 J;  4KFB B;  1UFW A;  2EXU A;  4ENO A;  2CQC A;  2QA4 S;  3IN5 A;  1K44 A;  2JFD A;  3DLJ A;  2XS5 A;  1OSC A;  1FE4 A;  1NJI T;  1EHW A;  1IXK A;  1KQS R;  2I2Y A;  1UVI A;  2DHX A;  4HR2 A;  1L5U A;  1S79 A;  3W9H A;  2E7W A;  4WCE Q;  2E1R A;  1X9W A;  3TEG A;  3PW0 A;  3LWM A;  4TY9 A;  2E7V A;  1JB0 C;  4UTG A;  2GHP A;  3SCJ E;  3V2U C;  2C2O B;  4DR6 J;  2W24 A;  3MI7 X;  2NZC A;  2V0N A;  4F4Y A;  1TK0 A;  2HBY B;  1VI7 A;  2FJB B;  1YJW S;  1U0S A;  4TLR A;  5E3C A;  5L1L A;  2QL5 B;  4RW4 B;  3OXG A;  1XEZ A;  3KLE B;  4ECX A;  2VIC A;  1S97 A;  2FB0 A;  2XLI A;  1FWL A;  4NLD A;  1F9H A;  1H2T Z;  1R31 A;  2W25 A;  1Q5Y A;  1UA0 A;  1G3O A;  2QLF B;  1CJU A;  2AJ2 A;  2ZZM A;  3NBP B;  1DAX A;  2IC3 B;  3V4M A;  1HNI B;  2CPI A;  2VBZ A;  4OHW A;  1NK4 A;  3DOK B;  3HKW A;  2XSJ B;  1Q7Y T;  4YR2 A;  2UUA J;  3W8G A;  3MWB A;  5LSL A;  2V5H G;  1KLM A;  4E8U A;  4DCJ B;  1HBM B;  1R8C A;  2CXE A;  4DI6 A;  3DLG B;  1F9E B;  3M8P B;  2WB1 D;  2C3M A;  3EIC A;  1HQE B;  4EBD A;  4LJM A;  3PJW A;  1C0U A;  2GO9 A;  5KOW A;  3CCW A;  4W92 B;  3H90 A;  1ZET A;  8AT1 B;  2R9L A;  4U8V A;  4K4X A;  5DGB A;  3TAM A;  2IY5 B;  1SV5 A;  2F4F A;  2RS2 A;  4B9S A;  4UT4 A;  1FKO B;  4UY8 5;  2MSS A;  2IA6 A;  3QYY A;  1Q79 A;  1NJW A;  3FMB A;  3KJN B;  2UVW A;  4HI2 A;  2DNP A;  5E7O B;  1R27 B;  3F0N A;  1OMS A;  2QSF A;  4P75 A;  4BDP A;  2EK1 A;  2DNZ A;  1DUR A;  2AHO B;  4V19 X;  2VG6 A;  2HRY A;  3UCZ P;  1FER A;  2XUL A;  1KS2 A;  3QBC A;  1FRL A;  1SPB P;  2Q79 A;  1B99 A;  3V5R A;  4OYA A;  3OFH A;  1B3T A;  5HAO A;  4K4T A;  2Z57 B;  4NZ0 A;  5E3Q A;  5GAG U;  3CMQ A;  4LF7 J;  2DCU B;  3DRS B;  2AJ4 A;  2CAJ A;  1R0C B;  3PIO Q;  3T5H A;  3PFO A;  4ZDN A;  1VJW A;  4I2P A;  1IVZ A;  3QPI A;  4ILR A;  1YSJ A;  2GMJ A;  5F8I A;  3AA9 A;  3KG4 A;  1WEZ A;  2CPH A;  3G8S A;  2VC0 A;  3BPS P;  4DLG A;  3R2D J;  4MIA A;  3R7S B;  4DF8 A;  1WI8 A;  3US5 A;  5J2M B;  2R2S A;  3P5T L;  2LA6 A;  4HDG A;  2B3T B;  1EZZ B;  1D9A A;  4U9R A;  5B7W A;  5AJ3 F;  1Y9O A;  4JI1 F;  2HND A;  1HWK A;  2J5A A;  3MM5 B;  3U1M A;  3MUR P;  2BXJ A;  3MXH P;  4Q2L A;  1KON A;  4DL6 A;  2NXU A;  4MTP A;  5HVH A;  1XN9 A;  2LQ5 A;  3LGM A;  1ZM3 A;  1S9G B;  1C0U B;  3QWU A;  2DXE A;  4C48 A;  4DV4 F;  3NGU A;  2ZWP A;  4DS4 A;  4NXN F;  4OFZ A;  1YK9 A;  4LR7 A;  2XG8 A;  1RTD A;  3LAK A;  4G1P A;  2JEG A;  1XMO J;  2CWX A;  3I0R A;  2NPI A;  1J27 A;  3NCR A;  2VV5 A;  1VC0 A;  3PV8 A;  3NCP A;  4LFC F;  1S4F A;  3TJA A;  4C3M A;  2HHT A;  4O3Q A;  4DL5 A;  1KQG B;  4NA2 A;  2BX6 A;  3FBC A;  1Y4Z B;  2P9E A;  2FHJ D;  4DBQ A;  4RW6 B;  4USH A;  4ECR A;  3ZZO A;  1N6Q B;  4KH1 B;  3UE2 A;  3QT5 A;  3B54 A;  4M94 A;  2EFQ A;  1FX2 A;  3DOL A;  2AQ4 A;  1VHF A;  2W8K A;  3JYT A;  1IBM J;  4D3H A;  4P2X A;  2CG4 A;  1RWX B;  1QLN A;  1SIW B;  3UDV A;  1HQU A;  3P45 B;  1O6X A;  2WZ1 A;  3V6K A;  4ZCL A;  2R8H A;  2H51 B;  3BSC A;  4FN5 A;  1QAJ A;  2RUS A;  3HVA A;  4DV3 J;  1MNE A;  2BEF A;  4DUY J;  5LMN F;  1JLF A;  2X3D A;  3VAH A;  4QPX A;  1RAH B;  2DNO A;  3OVS A;  1HMV A;  4Z2X A;  1JLB A;  5D3G B;  2IBO A;  3HHD A;  4OZL A;  3L7O A;  2VDH A;  4K4V A;  2N4D A;  5KT2 A;  4DPU A;  1E6Y A;  2OSR A;  2FHK A;  3EYZ A;  4PAA A;  4ICL A;  2M8H A;  3BR8 A;  2BJ1 A;  4ZPA A;  1RKJ A;  4NCA A;  1XMQ F;  2FY1 A;  1XIQ A;  3UCG A;  2O67 A;  2QG9 B;  4Y2K A;  1LW0 B;  3OPK A;  1A0O B;  1DAR A;  5CYQ B;  3S7R A;  5KAK A;  2VDI A;  4H4M A;  1VQ9 S;  5D0E A;  2G2Y A;  3AD7 C;  3QIP A;  1HBN A;  2AGP A;  4K2X A;  1HHT P;  3R7N B;  1VMB A;  2XM3 A;  3M1V B;  3QGH A;  1N5S A;  2YH0 A;  2FZG B;  2F4V F;  2BE2 B;  3I0R B;  5B0E A;  2EPI A;  2PO4 A;  3R5A A;  3AHP A;  5H9F K;  2IDE A;  3K2Y A;  2Q6B A;  4K4U A;  2R7X A;  1WF2 A;  4X66 F;  4DSK A;  2HKE A;  4H54 A;  1KSP A;  1C4A A;  1MU2 A;  2D41 A;  4J9P A;  1BE4 A;  2BYC A;  1I6J A;  3IR7 B;  2VUG A;  3HVR A;  3LGN A;  4F2S A;  2LXF A;  1M5K C;  1RDR A;  3BGR A;  4LF5 J;  2KG1 A;  1J2V A;  1JNZ B;  1RQ0 A;  3GPA A;  2CPJ A;  2MLX A;  2V4J B;  2BJE A;  1N56 A;  2M0G B;  3GYG A;  1HA1 A;  4NCB A;  2WAQ D;  2QFI A;  1MMD A;  1YRX A;  1GX6 A;  4C11 B;  5F8J A;  3T1Y J;  5F0W A;  3M30 A;  2ASJ A;  4KE5 A;  3GJR B;  4DS5 A;  4BS2 A;  4WTO B;  4B9L A;  4NI2 A;  1H73 A;  1JXE A;  3SV3 A;  4EYH B;  5K14 B;  2RQC A;  1S6Q B;  3MEC B;  3T5K A;  1IBK J;  4R0E A;  1NK9 A;  4CO2 A;  2YWE A;  1HMV B;  4E98 A;  4ZPT R;  1NKC A;  4RZR A;  2XO7 A;  1JLB B;  2FHO B;  2ZE2 A;  4IH7 A;  4CLU A;  1OQ6 A;  3V81 B;  2OPQ A;  4RNO A;  2HBZ B;  1SC3 B;  3NGS A;  4ECY A;  4FXV A;  4NLS A;  2YX7 A;  1S0V A;  4JV5 J;  2FVS A;  5CYM A;  1PJ7 A;  3KK3 A;  3VVU A;  2HG4 A;  4AT1 B;  5ETO A;  4AQY J;  1VCT A;  4USK A;  3MGJ A;  3CC7 S;  4ECS A;  2I38 A;  3HMJ G;  2WOM A;  3G82 A;  4D3G A;  1NDP A;  1KFS A;  3WBZ A;  4CLK A;  1MWQ A;  2MQN A;  1HBN B;  4QOT A;  2DXD A;  5G4D A;  3PEH A;  1HI8 A;  1Y5N B;  4MFB B;  1ZBT A;  5KFM A;  1IM4 A;  3ELH A;  5KFN A;  1Q8K A;  3E01 B;  4M5M A;  3MDF A;  1B7Y B;  2VON A;  3L3C A;  4ED5 A;  3QGP A;  1S0N A;  3QRQ A;  3T1H F;  4LF4 J;  2VPX B;  1O51 A;  3KHG A;  2J8A A;  1WEY A;  2RE1 A;  3T41 A;  3V6H A;  1M5P C;  2F8E X;  1NDL A;  3BGR B;  3DGP A;  3EPG A;  2ZD1 B;  2KM8 B;  4QR2 A;  3FBE A;  3D0H E;  5CHC B;  5KT3 A;  5IT0 A;  3BYR A;  2V8H A;  4L74 A;  2XWY A;  3T9Z A;  2OPR B;  1RT6 B;  1S12 A;  4ECQ A;  4YS2 A;  1JLE B;  7AT1 B;  2XTJ P;  2QA4 G;  3SBM A;  2LEC A;  1IKW B;  4LBH A;  1L3K A;  3BGF A;  4PR6 A;  3CD6 S;  1FRJ A;  5A6P A;  1IUJ A;  2V2Z A;  3SDE A;  1UVJ A;  3H40 A;  1GNK A;  4KHP J;  3G4S S;  2EEY A;  3QLH A;  3BR9 A;  2Z2M A;  3M2U A;  3OL7 A;  2V68 A;  3V6D A;  2ASY A;  3J81 Y;  1FI4 A;  3OL9 A;  4K50 A;  2FLO A;  4ATN A;  4WFN Q;  4ILM A;  3PYG A;  1PC5 A;  2UU9 J;  1F5C A;  3P8B B;  4J9K A;  2XC9 A;  1NH8 A;  2DR7 A;  5CYM B;  4O3P A;  2PI4 A;  2DK2 A;  4AND A;  2CQ1 A;  3MED A;  1Q81 T;  1O8B A;  4MKY A;  5A2Q Y;  4DR7 J;  1O5J A;  2JEI A;  3EXY A;  4IRC A;  2WOM B;  2YX1 A;  3G82 B;  3TEH B;  3M9N B;  5IM0 B;  3VV2 B;  3D7S B;  2AYB A;  3HVT A;  1HNV B;  1WC6 A;  2ZVI A;  1SKU B;  3DHW C;  3MEE B;  1T9T A;  4N76 A;  2CYY A;  4DN9 A;  3WIU A;  3JQM A;  3UVJ A;  4NYP A;  4QWD A;  4CI0 B;  2OFG X;  3MEK A;  3EZU A;  5BXI A;  1F6T A;  3I4H X;  4DR4 J;  2KZZ A;  1RTI A;  4OI0 A;  3MD1 A;  3IRX A;  1C1B A;  5KTQ A;  1BC6 A;  1UVK A;  1FHT A;  5J2N B;  4KGM A;  2GVD A;  1BQX A;  1YJN S;  4PWW A;  2QMU B;  4ZPV R;  4F02 A;  3ISN C;  1WKJ A;  2BAN B;  2YNG B;  5EWF A;  4Y65 A;  5LJ3 Y;  4I6W A;  1URR A;  1YJV A;  2RNE A;  4UF4 A;  1TK8 A;  4RLE A;  3DRP B;  5CAB A;  4DPY A;  1GXL A;  3ZZU A;  4Q44 A;  2HBR B;  3DRR A;  4WU3 A;  1NUE A;  3MMC B;  2A18 A;  1HWL A;  2DD8 S;  4LF6 F;  1R8B A;  3G6Y A;  4PCQ A;  4JYA F;  3IC1 A;  3CJ2 A;  2XCA A;  4QU6 A;  2RS8 A;  2G0J A;  2MQO A;  2MY7 A;  4HT7 A;  4OYZ A;  3IFE A;  4U8Y A;  4X4R A;  1N33 F;  5KG1 A;  2I8E A;  3PYD A;  3HFV A;  2DPI A;  2EW9 A;  4RPF A;  1NJY A;  4BWM A;  4UZB A;  1TL1 B;  3AFG A;  2IJF A;  4LVN P;  3MAQ A;  1WG1 A;  3MEG A;  2RH3 A;  1X4G A;  2NSC A;  3K7R A;  2R2T A;  2XI3 A;  5BYR A;  2BVZ A;  1S6U A;  3TZX A;  3CED A;  4QQB A;  4CO5 A;  3H4D A;  2K06 A;  4DSI A;  3O5T B;  4URG A;  1UP1 A;  2W4C A;  5T7L B;  1H2U X;  4CTA B;  3HX9 A;  4I0W A;  3A8J A;  4LRE A;  2EFG A;  5KFO A;  1JK9 B;  3FRZ A;  4MK8 A;  1J5O A;  5LSO A;  2DGW A;  4CZC A;  3FCV A;  2MGZ A;  4LSL A;  4KAI A;  4IG3 B;  4RBU A;  1OPZ A;  1UPM B;  2UVR A;  1OYE A;  2RQK A;  1KDN A;  1RTJ B;  1RTI B;  1U09 A;  3UD5 A;  5KT6 A;  1V3Z A;  2DY1 A;  1E6V B;  4ER8 A;  4ZKA A;  2ROE A;  5L1I A;  5J1N A;  2BKP A;  1EIY B;  2BJ7 A;  2COL A;  3GV8 B;  1Y00 A;  4LFA F;  4DF4 A;  4PWD A;  5HRO B;  2ZH2 A;  3FQK A;  1YDL A;  4RW9 A;  4RWX A;  2ZJP Q;  1ZA1 B;  1U2F A;  1ROF A;  2FDN A;  2OEK A;  4TNO A;  2E5J A;  2GIR A;  3G6V A;  1JLC A;  4AL5 A;  2BM1 A;  3M8W A;  1TVR A;  1U1L A;  2LCW A;  3M8Q A;  3VAM A;  3THP A;  4DL4 A;  2IDL A;  3BSN A;  1WF1 A;  1CPZ A;  1XNR F;  2KT3 A;  4CLP A;  2VBW A;  2F9J A;  3BRE A;  4ELU A;  2ZBC A;  1IR0 A;  4FYV B;  2LQ8 A;  3NGD A;  2L48 A;  3KLH B;  2VG5 A;  1FA0 A;  3HM9 A;  5I3P A;  5ADZ A;  2EFV A;  2BAB A;  5IT4 A;  4K4S A;  4DQQ A;  2B6A A;  5HP1 B;  3ULH A;  2LEB A;  3K5L A;  3R1H A;  4CH0 S;  5B09 A;  4K0K F;  2OD4 A;  2KRB A;  4TKT A;  5HAN A;  1NEE A;  1HAR A;  4KQZ A;  5B08 A;  2QYG A;  3NOC A;  1VQS A;  4DL7 A;  2ZDO A;  4WYL A;  4ZVU B;  4PXC A;  4CH1 A;  4ZLP A;  1CQN A;  1RWM B;  3MEG B;  3KHR A;  2AEJ A;  5KFH A;  5C25 B;  3CCT A;  1NLK L;  5L1J A;  3EM1 A;  1DHM A;  1RLD A;  3RW7 A;  4C8Z A;  1PO6 A;  4WPA A;  2BOA A;  3D4J A;  3R7B B;  5KG2 A;  4MIB A;  4PUO B;  4DFM A;  1GMW D;  2DRD A;  3FNN A;  3RTV A;  1RUS A;  1H3D A;  1RGV A;  1MWZ A;  1W26 A;  3LW5 C;  3QID A;  2A2C A;  3JSM A;  3QSY B;  4ZA1 A;  3W66 A;  1PAE X;  3L7P A;  3BO2 A;  3AJ2 A;  5HVG A;  1LKZ A;  2JFK A;  2IJR A;  2JVR A;  3MM6 A;  3QMQ A;  2B4V A;  4ECU A;  4GKJ F;  3OLB A;  3HPO A;  4KH0 B;  4WBF A;  4IH5 A;  1LWE B;  1U48 A;  4HHJ A;  1JMT A;  4RW8 A;  5E33 A;  5ETL A;  1DRZ A;  1RWO B;  1UZH A;  2PMH A;  4QIF A;  3TZW A;  1HW8 A;  4XPE A;  2DHG A;  3OR2 A;  3WC2 A;  2KT5 A;  3R5D A;  4DSE A;  4FZV A;  3M8Q B;  2VHG A;  1A7G E;  1VK3 A;  3NNC A;  2AEM A;  1FDN A;  5ETP A;  1WDT A;  5K8M A;  3UDE A;  2E1M C;  3SSR A;  1JXV A;  1X7V A;  4WWS A;  4F8R A;  3CDU A;  3OL6 A;  2VG5 B;  1Y5L B;  4OI2 A;  2NYI A;  4Q0B A;  2MB0 B;  4LIR A;  4ZVH A;  2G0C A;  3OJU A;  2DEJ A;  2BJ3 A;  4Z37 A;  2AX0 A;  2FZC B;  2HFS A;  2I6W A;  1R8P A;  2AJ1 A;  1CC7 A;  3FJ2 A;  4UQG A;  3K5M A;  3W63 A;  3FSX A;  1NXI A;  2L9N A;  2XYH B;  3CJK A;  2GNK A;  2DNQ A;  2N3O A;  2ADB A;  3DI6 B;  4USW A;  1NPK A;  2HNZ A;  2DNK A;  4OYI A;  5HMW A;  2D3U A;  1U4B A;  3KXD A;  2HNY A;  2WHO A;  1GAO A;  4J91 A;  1AYE A;  2YX4 A;  5E5N A;  3TVY A;  2NCK L;  4Q8F A;  4MT1 A;  5U47 A;  5J2Q A;  5JVG Q;  1B64 A;  2FGC A;  2Q43 A;  1F9F A;  3RAQ A;  2IAJ A;  3C14 A;  4ED4 A;  3HSD A;  4RUH A;  2R42 A;  1WI6 A;  2X1G A;  2AP6 A;  4Q7A A;  1ZM2 A;  1F3F A;  3UI3 A;  2HW3 A;  3AOC A;  4PQU A;  3M2R A;  2FLN A;  2DJW A;  3ENW A;  2DNN A;  1HWI A;  2AKW B;  5E0O A;  2YH1 A;  1T9W A;  3MMB B;  1NJZ A;  2DNR A;  4KIA A;  3RRH A;  3R3T A;  2Y1J A;  4DR1 F;  2NR0 A;  2BR0 A;  5F8M A;  4L6V 3;  4LF1 A;  1IN0 A;  2OPP A;  4ZK7 M;  4ZHR B;  3P4U B;  1OY9 A;  4RW8 B;  3KLV A;  2Y8W A;  4Z7Y A;  2QZ8 A;  5HK4 A;  4P7V A;  4O44 A;  1JKH A;  5KOX A;  2F1F A;  1QUP A;  3GWC A;  4IO9 Q;  1FJE B;  1NK7 A;  2MZT A;  1UKU A;  3CDA A;  1VQ8 S;  3RZA A;  4HLB A;  2CPX A;  3ETO A;  2FJA B;  2Z56 B;  3CCQ S;  2VIH A;  1QDU B;  1RWW B;  1HR0 J;  3IWL A;  4B17 A;  1VYA A;  3CCZ A;  1C4C A;  4NEZ A;  4EBC A;  2UUW A;  1RAC B;  2F8H A;  2H5I B;  4F3O A;  1DTT A;  3AB2 B;  2K7K A;  5IC6 B;  1FDB A;  3KJV A;  2CQI A;  2DGO A;  4DSL A;  4DXL A;  4OZN A;  5KFG A;  5KFC A;  3UN2 A;  2J8S A;  1WTB A;  2FJV A;  4ERD A;  3C14 B;  4XO0 A;  3BQ0 A;  1U8S A;  1C0T A;  1I94 F;  4C8O A;  5AJ3 J;  2HZV A;  3KHL A;  4JI1 J;  3E3X A;  2HWH A;  4K8R A;  2KVQ E;  3N0V A;  2A2D A;  1TEL A;  1UCN A;  1K1S A;  1NB7 A;  4PQU B;  1BUX A;  2RDD A;  1N52 B;  1M5V C;  1N34 F;  4O4G B;  2HHU A;  3PYF A;  1UWB B;  2AZ1 A;  3M32 B;  1SBR A;  3KK1 A;  2YKA A;  5ITH A;  4DV4 J;  4CLS A;  1S1W A;  2YWH A;  1DJ0 A;  1T95 A;  4DX5 A;  4LFB F;  4RBT A;  4NXN J;  4YHH F;  3DNC A;  4V1A k;  3GIM A;  1JLQ A;  1N5V A;  3CO0 P;  3PX6 A;  2VQE F;  2BMB A;  2MYF A;  3B82 A;  5KFK A;  4EK2 A;  1RKI A;  3CJS A;  1S1X A;  1VQL S;  1JQG A;  2W8L A;  2JL9 A;  4OX7 A;  1S9E A;  3FVY A;  2OIH A;  2J6U A;  1JKH B;  4P6Q A;  9RUB A;  1F5B A;  1WJ9 A;  2LQ9 A;  5CZX A;  1JWW A;  1BQM A;  2IVM A;  1GXU A;  3SCK E;  1FT8 A;  3PR5 B;  2YWF A;  5EN1 A;  4DWI A;  2BW7 A;  3FSY A;  1KVK A;  4DFK A;  1EP4 A;  2IMO A;  1TFY A;  2PD1 A;  2BV3 A;  4DX7 A;  3EJM A;  1JIH A;  4U7U K;  3UR3 C;  1GMW A;  5CH7 B;  4LSN B;  3HVW A;  5A6W A;  5JUM A;  3C3L A;  2RD5 C;  2HS3 A;  2K3I A;  3K58 A;  3ZTQ A;  1N4L A;  1X4A A;  3GIR A;  3J7A N;  1YRU A;  2ERR A;  3BQ1 A;  5LMN J;  5C24 B;  4CWB A;  2KXH A;  3VR1 A;  4H4K A;  3O3L A;  5CCL A;  2B9X A;  4KSE B;  5KFT A;  1KVJ A;  1NDK A;  3M6V A;  4P2M A;  4QWC A;  2HVD A;  4MMO A;  3NY0 A;  1SUQ A;  3POT A;  4M5K A;  1C0T B;  3W64 A;  1FK9 A;  1S49 A;  2H4W B;  4K4W A;  2OGU A;  5J1E B;  3Q8Y A;  4F4W A;  2CQ0 A;  1XMQ J;  1MRO B;  3NNA A;  1L3T A;  3BSO A;  1RIS A;  1LEO A;  1CC8 A;  2GO8 A;  4M1K A;  3LAN A;  4QR1 A;  4FPI A;  2HBQ B;  3KDO A;  4WIQ A;  3KK1 B;  4KPY A;  1S1U A;  1S1W B;  4OYM A;  3PR4 A;  2FQQ B;  3JSR A;  4WE1 B;  1RHM B;  2R8K A;  1PBU A;  1SJ3 P;  2CRL A;  1N8R T;  3FC9 A;  3H5Y A;  1Q5V A;  1FWK A;  2MXY A;  3ISN D;  4GO5 X;  3TVK A;  3FEX B;  1IWG A;  1NK6 A;  4X66 J;  2KJV A;  1Y5I B;  2V67 A;  2BKN A;  1IKV B;  1QD1 A;  3AD8 C;  4CDI A;  2IRU A;  2HVZ A;  3A3N B;  2OP5 A;  4IDK B;  4AD6 A;  1BQM B;  1P27 B;  4QIW D;  1NSP A;  2YKM B;  1WEX A;  3CUL A;  4DU8 A;  2VFT A;  4FNH A;  2VFU A;  2IHR 1;  3CJ0 A;  1ZAV A;  4RWW A;  3ETM A;  1EP4 B;  1P1T A;  2UUC F;  1VQK S;  4X2B A;  1WOS A;  1PAU B;  2R7U A;  1BQN A;  3FCH A;  4OHZ A;  3LP1 B;  4CM0 A;  5EWE A;  1HPZ A;  1XR5 A;  1G4C A;  4J9V A;  1FKA F;  2J0Q D;  1VFJ A;  3DM2 B;  2EKY A;  1YGY A;  3FRY A;  2ZJQ Q;  3DYA B;  1LFP A;  1T03 A;  4C7Q A;  1RLC L;  2CZ4 A;  4DV7 F;  9ATC B;  2QO3 A;  3CJR A;  3DDI A;  4G1Q B;  1GK8 A;  5BYQ A;  2GML A;  3N28 A;  3Q8R B;  2IJN A;  4FXW A;  5H9E K;  1HWJ A;  1BGX T;  3NLC A;  2ROG A;  2E1A A;  3CCS S;  4FKX A;  1IR2 A;  1SUQ B;  1T94 A;  3O44 A;  1D8Y A;  5BR8 F;  1TR0 A;  3JTN A;  2P6S A;  4ZCM A;  1SH0 A;  3KYL A;  3BV8 A;  3W7B A;  4J5O A;  3C46 A;  2I5J A;  4XIU A;  2DGV A;  3KUH A;  2DR6 A;  4P72 A;  4QPT A;  4R0J A;  2JEJ A;  1B0P A;  1RTH B;  3OTE A;  1SH2 A;  3OUY A;  2ZH4 A;  2KHD A;  1S1U B;  2XHC A;  1MSW D;  5FLX U;  1EQM A;  3W5Y A;  2QTW A;  4UOG A;  4Y3C A;  5B0D A;  1LW2 B;  3JAM Y;  1U6Z A;  2WRM A;  4ZCI A;  3D6T B;  4F4Z A;  2WB4 A;  3C66 A;  5LSR A;  2ILZ A;  4WII A;  4HEA 9;  5KT7 A;  3ET6 A;  4CIO A;  2NLW A;  3CTR A;  3T1H J;  3RU0 A;  1VJQ A;  1BWE A;  4OHY A;  4ZPD A;  3IBF B;  4RUC A;  3FK4 A;  4NCG A;  3DDN A;  4ED2 A;  1O0P A;  1FFG B;  2YNI B;  5L1K A;  3C6U A;  3CD5 A;  3CJT A;  3VQS A;  1QVG R;  5BJR A;  4DR2 F;  3D0I E;  2UXC J;  1S7H A;  5DG7 A;  1XER A;  5EUH A;  3CWJ A;  2UVU A;  4WF9 Q;  4QW9 A;  4I4B A;  4OX9 F;  1HPZ B;  2XZD B;  4NLY A;  5A76 A;  3PHE A;  3GG1 A;  4JP8 A;  1OYD A;  2VOD A;  1P1L A;  4KGK A;  2E29 A;  3CO9 A;  4YUD A;  5A8R A;  4JUZ A;  2XQC A;  2YNH A;  2KL8 A;  2FD2 A;  1RT3 B;  4DZ6 A;  4L72 B;  1MW7 A;  4I7F B;  2V50 A;  3A1Y G;  2AT1 B;  1XWL A;  3DXS X;  2E9R X;  2MQ8 A;  1HBU A;  5D4L A;  3NWR A;  1TZ0 A;  1N48 A;  4QZV B;  2Q3P A;  2ZOM A;  4DJB A;  5DZ7 A;  1VRT A;  2C1E B;  5BYS A;  2ZZT A;  3FSI A;  3M2V A;  1TL3 A;  4NLQ A;  1KOO A;  2HFV A;  2QJ3 A;  3NAI A;  4TU8 A;  2DNM A;  1FKP A;  1DBD A;  2CNO B;  2RKI A;  3TA1 A;  1DLO A;  3QJP A;  2BRK A;  2EKN A;  4R25 A;  1N5Y B;  2J0W A;  4NL5 A;  1U6F A;  1FE0 A;  1PYT A;  2MZJ A;  2AIR B;  4CYU A;  5HMY A;  2D3O R;  1VOM A;  3IBW A;  3M8Z A;  3N5B A;  1TKT A;  2OAU A;  4HAC B;  4C98 A;  3R5B A;  4PPD A;  1PBA A;  3M7V A;  4ZVG A;  1RAJ A;  3P96 A;  4WK3 A;  5HJX A;  3QRR A;  2VG7 A;  4ZOS A;  1N0U A;  1S1V B;  3CDB A;  2IVF B;  1CBK A;  1WSR A;  3IR5 B;  2GFF A;  4DG1 B;  4I64 A;  2GV1 A;  5KFP A;  5IXU A;  1F60 B;  4LRF A;  5LL6 d;  1S10 A;  1FJ7 A;  4TU9 A;  3G71 S;  1CG2 A;  2QLX A;  5IWA F;  3IWN C;  3QQC D;  3D3C J;  6FDR A;  4ED1 A;  1JLA B;  2HPU A;  4N8N A;  2R3V A;  4ZVT B;  3EGN A;  3NS7 B;  3PW7 A;  1FRI A;  4KB7 A;  3EGV A;  4XDC A;  5ETN A;  1WOR A;  3GYX B;  3TZY A;  1YKW A;  3FMW A;  2BQR A;  2M88 A;  1Q86 T;  1DY3 A;  2AX1 A;  3BH6 B;  2PE8 A;  3ZNJ 1;  1Y3J A;  3TNV A;  3UW1 A;  2ZOF A;  2M8D B;  3DOM A;  2XMW A;  4GO7 X;  5KFZ A;  2K8G A;  2R2U A;  5KFL A;  5CXT A;  4C8L A;  2YNH B;  3RGI A;  4X62 F;  3E8O A;  2W2N P;  4DR5 J;  1YG0 A;  1G6B A;  1YJT A;  1C1C A;  3NNH A;  4ILL A;  4DSF A;  1U0H B;  2GVZ A;  1VQY A;  4ECW A;  2IVY A;  3FUY A;  5I42 A;  2HK2 A;  2HVH A;  1HI1 A;  2BBE A;  3W65 A;  1RWU A;  4B08 A;  3HK2 A;  2H4Y B;  2D1C A;  2Y9H A;  2OJ3 A;  1VRT B;  2WVB A;  2BKO A;  2OML A;  3NGR A;  3A3P B;  4UW2 A;  1FD2 A;  4IQM A;  3CCM S;  2NXN A;  3C16 A;  2W9B B;  1K0T A;  4NAS A;  1MLA A;  1VIX A;  4KPC A;  3VHQ A;  2B8Q A;  1T9X A;  5KG0 A;  3DKD A;  5CAA A;  3CGI A;  4LRD A;  3QGI A;  2KHC A;  4TQR A;  4CYU B;  2IM0 A;  2IM3 A;  3MPV A;  3K0J A;  4M5G A;  2FPH X;  2AEF A;  2CPE A;  1QE1 B;  4ZLJ A;  4DV2 F;  4OZJ A;  3TP2 A;  4BLG A;  2Y1R I;  4WJB A;  2P8I A;  3M9M B;  2WBM A;  2CPY A;  3GJQ B;  1JLG A;  2RB7 A;  3EVO A;  1TV6 A;  3D67 A;  2DYA A;  1AZS A;  3MUV P;  1QAX A;  2EG1 A;  3Q8Q B;  4NE9 C;  4U96 A;  1IQT A;  4P2S A;  4FS2 A;  4XPC A;  3WQP A;  2M5Y A;  2WK4 A;  3M6W A;  1KC8 T;  1Z2L A;  4IFY B;  2ZBP A;  4LFA J;  4I67 A;  2G0I A;  4X64 J;  2O5D A;  1Q8I A;  5HBM A;  3JB9 k;  1KVI A;  3LAM A;  1NK0 A;  4DV0 F;  3IS9 A;  2ALY B;  3CMA S;  4QWE A;  3KLF A;  1DTQ A;  3CPW R;  2L08 A;  1A6L A;  1T3O A;  1RT4 A;  3BZQ A;  1HLW A;  3H20 A;  3P3D A;  1BMQ B;  1XNR J;  1VRQ C;  3RR8 A;  2GGP A;  3DOM B;  3ZZR A;  3P6Y C;  1VQ4 S;  2ZWO A;  1OQ3 A;  3CC4 S;  2VFS A;  3MD3 A;  1HYS A;  3I5A A;  2JSX A;  4KV8 B;  4K0K J;  3IO1 A;  3Q22 A;  2HVI A;  3IXQ A;  1FCA A;  2GVZ B;  3THV A;  4OZ1 A;  5HO4 A;  1RT5 B;  5D0G A;  5I42 B;  1YBU A;  1QSY A;  3OBI A;  4A8F A;  4WFY A;  3R6G B;  4KHM A;  2W01 A;  1NDC A;  3NKY A;  1HNX F;  4Y2A A;  4OZ5 A;  1FES A;  3DU5 A;  3SFU A;  3G8T A;  2PMW A;  1BXN A;  2VJV A;  1FJG J;  1TL7 B;  2VL1 A;  1S0O A;  4DN0 A;  1OO0 B;  1U1O A;  3HDS A;  1LQ9 A;  3TOQ A;  1LV5 A;  4ZN3 A;  4DPW A;  1TKX A;  4ECT A;  2R7Q A;  4Y28 C;  1CS4 A;  2O01 C;  4W4M A;  2BQ3 A;  1IKX A;  3MR7 A;  1TV6 B;  5HL7 Q;  3ITH A;  4X4S A;  1AZS B;  3GV5 B;  3Q8P B;  2UXB F;  1JJ4 A;  3QFW A;  3H5U A;  2KVI A;  3TO8 A;  2EVZ A;  5F9N A;  3G96 A;  3IBC B;  3SCI E;  1K0V A;  5C42 A;  4C9D A;  1EKS A;  2KFN A;  4CH7 A;  2OKQ A;  4KGV B;  4RW7 B;  1YBT A;  3G9C A;  4QJV A;  1SCJ B;  3CF5 Q;  4J9U E;  3ZZP A;  2JRS A;  3AAW B;  3OR1 B;  4WK1 A;  1H7W A;  4NRT A;  1RT4 B;  3ILI A;  3DMJ B;  4ZPB A;  1IJE B;  3QNW B;  3SQG B;  1HBO B;  2DGS A;  3ZTO A;  2H9Z A;  4FVC A;  2ZKU A;  4DMZ A;  4RU9 A;  2HWT A;  2B4P A;  3GJT B;  1R0A A;  3EUN A;  1IQZ A;  4AXJ A;  5AE2 A;  1YIJ S;  1S1T B;  2YKN A;  1YRT A;  4JI0 F;  1FXL A;  4TU7 A;  4GVB A;  3QO9 B;  5IQ6 A;  2H3E B;  4K2J A;  2CA9 A;  5K5M A;  2NS1 B;  2XLK A;  3MFH A;  2VBY A;  1RHU B;  3MCM A;  1X4B A;  5SZT A;  4NPO A;  2APO A;  1T05 A;  2HZA A;  3T1A A;  3W61 A;  4IG0 B;  2IYG A;  1RT2 B;  2EFP A;  3MAH A;  2DGX A;  3TAR A;  1X4C A;  4K5R A;  2GC8 A;  1P9Q C;  3QAU A;  2W1B A;  2KN4 A;  2ZVS A;  3VQT A;  3CC2 S;  3TX0 A;  4WZM A;  3MAA A;  3QSI A;  3IGV A;  2M52 A;  1S6P B;  3WHI A;  3ZTR A;  2RU3 A;  1ULR A;  3BSA A;  2XZW A;  3BBB A;  1VQ7 S;  3EX7 B;  3GFY A;  3DC2 A;  2CQP A;  4DV1 F;  1JJ2 R;  1FD8 A;  3DFE A;  4GKK F;  2MTL A;  2ZJR Q;  1RT7 B;  3HSG A;  4OYP A;  2B51 A;  2LYV A;  5J1P A;  4A8S A;  3LP0 A;  3Q86 A;  1RHQ B;  1XR6 A;  2WSC C;  4KGZ B;  3MUT P;  3CJ5 A;  4X84 A;  1EET B;  1W2I A;  4DR1 J;  2H48 B;  2MQQ A;  3H59 A;  1S99 A;  1S0M A;  2BOP A;  5RUB A;  4B9N A;  4RL1 A;  3KG1 A;  5KFB A;  2F7V A;  1LNQ A;  4JI5 F;  4QCL A;  4URQ U;  2A6O A;  2V4Q A;  4A48 A;  3KG0 A;  3ZZY A;  1VDH A;  3EGZ A;  3B4D A;  2XGP A;  4LF7 F;  5DLG A;  4FF3 A;  2V2Q A;  1ACM B;  3TAQ A;  2Y0B B;  1VQ6 S;  3J7Y U;  2R7V A;  3PVX A;  3BKT A;  3AQP A;  4FNI A;  2B4U A;  2POK A;  3N5F A;  2BZ2 A;  2UZA A;  4BWJ A;  2FLP A;  3V6J A;  4TY8 B;  1Y7P A;  2J7K A;  4ID5 A;  2BM0 A;  2F9D A;  1FEH A;  4J9N A;  2YKN B;  2I1R A;  3TA2 A;  3I6P A;  1ZS6 A;  1CJT A;  1SKW A;  3PRD A;  2M9K A;  4R5P A;  2YWG A;  4QU7 A;  4DUZ F;  3HUL A;  2DRB A;  3M6U A;  4CLT A;  4JI3 J;  1RA7 A;  3KNG A;  3K57 A;  4ED6 A;  3GV7 B;  1QUV A;  2FVC A;  3EGW B;  4IH6 A;  1HL6 A;  4QW8 A;  2B5J B;  3MTJ A;  3MAA B;  4ED7 A;  2R8I A;  2QN6 B;  3PTW A;  1Q1K A;  4DHV A;  2QC3 A;  4LIW A;  2UXD F;  5J2P A;  2ACM A;  2OPS A;  4Z7C A;  3A8E A;  1OJ4 A;  3AXK A;  3WX4 A;  3BDE A;  3GB0 A;  2GCF A;  1SKS A;  2XB2 D;  2PSZ A;  2D9O A;  2XMA A;  1KHW A;  2KDO A;  1FWP A;  1N34 J;  1GMV A;  2Z58 B;  3BGU A;  3MZI A;  4OYB A;  4URS A;  3HI9 A;  3S1T A;  1U2C A;  2OH2 A;  2LEA A;  1UZD A;  1PYO B;  4A8W A;  4LFB J;  3VVT A;  3OTB A;  1QVF R;  1HFE L;  4IO1 A;  3VZI A;  2PI5 A;  4YHH J;  4FYX B;  2CIM A;  1W7W A;  1H6K X;  2VQE J;  3TYT A;  3CIM A;  4FF4 A;  5IV4 A;  4DDF A;  3N9U C;  4CO4 A;  3FFI A;  3GCW P;  4PG7 A;  1U1R A;  2PA3 A;  2RQ4 A;  3I56 S;  3I4P A;  5LT5 A;  5AXM A;  2XMJ A;  4RKU C;  1IBM F;  4J9O A;  5EHH A;  3GG0 A;  2OEJ A;  1X9S A;  5IS2 A;  4YFU A;  1ZM4 A;  5HLF A;  3K5N A;  3G86 A;  4KO0 A;  4B3R F;  2E5L J;  4DUY F;  3ENV A;  4DQR A;  1Q8B A;  3MM9 A;  3HHK A;  3F44 A;  2HS0 A;  2YPY A;  4X4O A;  2OUG A;  2FVR A;  1F2G A;  2MLY A;  3C6T A;  5IT9 U;  2HS4 A;  2CQ2 A;  3RAX A;  1X0P A;  3VAF A;  2AZ3 A;  3CT9 A;  2XWX A;  4DEZ A;  3HT3 A;  1Q78 A;  3VGS A;  1IKY A;  1W2B R;  3J7Z T;  1Q7L B;  2NUH A;  1TUG B;  3W5X A;  3RR7 A;  1F0X A;  1S6O A;  1CJU B;  3SSS A;  1U2R A;  1QSS A;  3LAL A;  4I1T A;  2CDQ A;  3CME S;  4CO1 A;  4U7U D;  2LMI A;  2OPS B;  2KZM A;  3R27 A;  4ZIT A;  4KYZ A;  3MUM P;  4FYW B;  3ADA C;  3CDW A;  1KLM B;  1XJW B;  4C8K A;  4O0N A;  1FJC A;  1OS5 A;  4BCA A;  5D8H B;  1LXJ A;  1NPR A;  1KOH A;  3TJ9 A;  1KD1 T;  5FII A;  4HKQ A;  1WG5 A;  2HZC A;  1RI7 A;  1RSC A;  3OFG A;  1UVL A;  2VOO A;  4KKO A;  3H8Y A;  1JNR B;  2XI2 A;  3K89 A;  5HQM A;  4YB1 P;  3KK2 A;  4ETZ A;  4OQJ A;  3TAM B;  4I6A A;  2VF3 A;  1SV5 B;  4H4K C;  4KC5 A;  3GIJ A;  4HHU A;  3NP5 A;  4JI4 F;  4ZCK A;  1VBX A;  1X31 C;  1ARO P;  2AJQ A;  2XMU A;  1M5O C;  5DDO C;  1EQ0 A;  2KU7 A;  3JQJ A;  2HWI A;  4GMK A;  3OJS A;  4F4K A;  2XGQ A;  3FBF A;  3R97 A;  1HNZ F;  1NK5 A;  1V9O A;  2KYX A;  2QT7 A;  2VG6 B;  2BJ9 A;  4H4O A;  4B3S F;  3M4X A;  4DU7 A;  1GXT A;  1LK7 A;  2QSW A;  4NYO A;  3MPD A;  4IRK A;  4X4V A;  5HLF B;  2IMW P;  4RX6 A;  5K8N A;  3LOU A;  5DGA A;  4NX9 A;  3MM9 B;  3AJ1 A;  2LXI A;  2MZS A;  2BUN A;  2UUC J;  1SVD A;  2XY6 A;  4OX6 A;  2DHH A;  1X5O A;  3I9V 9;  4I2P B;  2KRR A;  3RB4 A;  3LP2 A;  4OZ2 A;  1F1B B;  3GFH A;  2C3U A;  5DRK A;  3SIP B;  4M5D A;  1TUW A;  2NZ4 A;  2CFX A;  3AT1 B;  3VCD A;  1Q16 B;  2V4R A;  3ZZT A;  4LF8 F;  1GH8 A;  4WZQ A;  5ETK A;  4DV7 J;  4F4A A;  3GSI A;  4DZD A;  2RVJ A;  4AQY F;  1IBL J;  4A46 A;  3K5O A;  2J0X A;  4M5N A;  4YP3 A;  3VZH A;  1REV A;  3W8P A;  1N0V C;  3A12 A;  3HSZ A;  1KQK A;  1YBA A;  2GJ2 A;  4JI7 F;  5BR8 J;  2O66 A;  1PJ5 A;  2HND B;  3H5X A;  3U02 A;  4YY3 F;  3X1L B;  5FD1 A;  2R7O A;  5I3U A;  3BM7 A;  2K1R A;  5KG4 A;  4ZVO B;  2AWZ A;  4OHX A;  2CQ3 A;  2XY7 A;  2KFZ A;  2E9T A;  2UV8 G;  3KK2 B;  1N36 F;  3SI8 A;  3AOD A;  2ACY A;  2IM2 A;  2P9C A;  1NND A;  1OY8 A;  1L3S A;  1RTD B;  1EAR A;  2UUT A;  3MOJ B;  1NZ8 A;  4O3S A;  3PKY A;  2D7S A;  4DX6 A;  3L9Z A;  3MPW A;  5KFD A;  1RT1 A;  3KTQ A;  3BO3 A;  3FGV A;  3AOA A;  3H42 A;  2XYG B;  4DUT A;  4KGX B;  3LA0 A;  2PMZ D;  4FBT A;  3CJ8 A;  2CJK A;  2EG2 A;  1NHK L;  2C42 A;  2M7S A;  3HD1 A;  1M5S A;  2A3J A;  1NH7 A;  4C97 A;  1JX4 A;  2HHX A;  3BPD A;  5EWG A;  3UCU P;  2X1A A;  2JDJ A;  1UW9 A;  4PWU A;  3Q8V A;  3H7H B;  1LWX A;  4NA1 A;  4Q2M A;  4DR2 J;  2CQH A;  3DOL B;  3KLI A;  5E41 A;  2HMI A;  2RHS B;  2DBB A;  3JYT B;  4KT0 C;  4KR0 B;  4A8Y A;  2C2E A;  1N32 F;  1HQU B;  2YKO A;  3LP2 B;  3OL8 A;  4OX9 J;  3THT A;  2ZH3 A;  4DR3 F;  3NXZ A;  3I55 S;  3RG6 A;  4DQS A;  1JLF B;  4Y34 A;  2RSQ A;  2BDP A;  2DNL A;  4A4J A;  1K8A T;  2UU9 F;  3VAJ A;  1TMJ A;  3CW2 C;  3QGG A;  5ETQ A;  1SL2 A;  3G6E S;  3U1L A;  2A10 A;  1NHU A;  2HHW A;  4UOC A;  1E6Y B;  4AXI A;  3LQV A;  1REV B;  4ICL B;  4HTI A;  1RP5 A;  1RCO B;  1RYS A;  2XMT A;  3BH7 B;  3SEO A;  1S4E A;  5HQ8 A;  5HVF A;  1ZM9 A;  4JV0 A;  3G2X A;  2N4C A;  4ZP9 A;  2K1R B;  4MK7 A;  3TA0 A;  3HCX A;  3QWP A;  2FJW A;  3OSP A;  1FO1 A;  3JXO A;  4EGL A;  2DNH A;  3GP9 A;  2IIH A;  4L75 A;  2OO4 A;  4H4M B;  3RB6 A;  3QIP B;  1WHX A;  4M5H A;  2CDR B;  3MMA A;  4RNM A;  4RJV A;  4NMX A;  2P2C B;  1UJ4 A;  2C2R A;  4F67 A;  3IG1 A;  4DV5 F;  3C15 A;  5G0R A;  4P9S A;  1FRM A;  1KNZ A;  4DFJ A;  3CUN A;  3J80 U;  1TKD A;  3TI0 A;  3C2P A;  7FDR A;  2E9Z A;  3JSB A;  3N79 A;  2V34 A;  1H38 A;  2W9C A;  5E3P A;  4MK9 A;  4NML A;  5DDR C;  2MKC A;  4IYQ A;  3PW4 A;  4I2Q A;  3FZB A;  1MU2 B;  1D0E A;  2P6T A;  4P7T A;  5IWA J;  1WC1 A;  3V4I A;  2VA2 A;  1VQM S;  2V69 A;  2N7C A;  3H98 A;  4MKV A;  3A3O B;  2FGO A;  3Q23 A;  3CCL S;  2IRX A;  3NEK A;  2HAF A;  3PZP A;  1OIA A;  4WFZ A;  3PXG a;  1UWA A;  4CLW A;  2OEL A;  3M30 B;  1M1G A;  4ALZ A;  2Q1L A;  1B7F A;  2OD6 A;  2W7A A;  4NI2 B;  3L09 A;  2Y0S D;  3IGN A;  2ZUG A;  4IOB A;  3E51 A;  1GT8 A;  3HHL A;  4EFA C;  2ZE2 B;  1V5V A;  4W90 B;  3KKF A;  5A8W A;  4RNF A;  3MOZ A;  2CPD A;  2QGF B;  2UVV A;  1GMU A;  2NSB A;  2OPQ B;  4DV6 F;  3UR0 A;  3PCO B;  1KFD A;  1C2P A;  4C0B A;  2HIQ A;  5GAH I;  1GTH A;  2IRY A;  3DLK A;  2KTQ A;  3KK3 B;  3UDL A;  1KRP A;  4A8K A;  3NMA A;  3EMT A;  2JH3 A;  3QT8 A;  3DCA A;  4EWT A;  2EFN A;  4HDH A;  4OJH A;  3DLE A;  2IPO B;  2C2K B;  1SJ4 P;  5KFU A;  2ZC3 A;  1VLO A;  1BY9 A;  3HP6 A;  4BHQ A;  3MMA B;  3HZG A;  5ETS A;  2HGN A;  4DV2 J;  1NSQ A;  2HFZ A;  3D6F B;  1Y3K A;  1CUL A;  3C19 A;  4CO3 A;  1VIO A;  2RAQ A;  4ZMM A;  4FYD A;  3C8Y A;  3IRW P;  2DY9 A;  1TL5 A;  4ZVF A;  2DB1 A;  1QTN B;  4X4T A;  2ZH9 A;  3RB0 A;  4WKY A;  2AYM A;  4KFB A;  4GRS A;  4CLY A;  2YTC A;  3BF4 A;  2XS2 A;  4EO6 A;  4WXW A;  3OSN A;  4ANE A;  2R8J A;  4ZVE A;  1RZM A;  1N54 B;  3GLJ A;  3KDN A;  3OTO F;  1QSL A;  3QZ7 A;  3DGP B;  2R4F A;  1TUV A;  4OIX A;  4ANC A;  2G9O A;  2XZT B;  4MKA A;  4OJ3 A;  5ETR A;  2D3O 1;  4F0H A;  4OYO A;  4HH0 A;  2EBE A;  5HN0 A;  1WHW A;  2OTJ S;  3PIP Q;  1H0H B;  4GC7 A;  2E5I A;  4O4R A;  1Z1Z A;  3SDE B;  2LVW A;  4RW4 A;  4ED0 A;  1WC5 A;  2HEK A;  5B0F A;  4WP8 A;  3VF0 B;  3QLH B;  1QJH A;  3M2U B;  3KLE A;  3V6D B;  4G1I A;  3CCE S;  3HT0 A;  1BLU A;  4I56 A;  2GAH C;  1GEH A;  2FJE B;  2WVC A;  4HL9 A;  3D28 A;  1WKK A;  2ZNY A;  3NBP A;  4EBE A;  3BB5 A;  1HNI A;  3DOK A;  1U1M A;  2B7B B;  1S77 D;  1DQ8 A;  3MED B;  4N7T A;  1HNX J;  3CNQ P;  2CZ9 A;  2XSJ A;  3OQ2 A;  3ZZZ A;  4P52 A;  3CCU S;  3HVT B;  4C3L A;  4PXD A;  1HBM A;  3M8S A;  4HTJ A;  2QMX A;  3M8P A;  2XS7 A;  5JVH Q;  1HQE A;  3ENA A;  4CO0 A;  3UVJ B;  1HHS A;  3T3F A;  2G1D A;  3NGK A;  4USV A;  1YZ7 A;  1CUL B;  2RHQ B;  4XDD A;  3TX8 A;  1T9U A;  3KNA A;  3OLA A;  3UNG C;  4G65 A;  3IRX B;  1FKO A;  4IOC Q;  2H5J B;  4OMF G;  2UXB J;  1QM9 A;  2CNK B;  4B3M F;  3SQO P;  2CPZ A;  1C1B B;  1WC3 A;  4NLT A;  4O3N A;  1QAI A;  3E2E A;  3QT7 A;  5SUH A;  4X65 F;  1XNQ J;  2GVD B;  2NRE A;  1RWK B;  4HH1 A;  4PG5 A;  4Y0F A;  1S9F A;  1H74 A;  2W7O A;  1UPP A;  1VHI A;  1SQE A;  1T9Y A;  2JLG A;  5DS7 A;  4J9Q A;  1Q53 A;  2YQ0 A;  4PYA A;  5KG3 A;  4U67 Q;  4C8N A;  2W2P P;  1JJH A;  2HRT A;  5KFS A;  3QJJ A;  3U7J A;  2CJQ A;  3IA0 A;  3DRS A;  2YKQ A;  2HFO A;  3DRR B;  1WC4 A;  1NKB A;  2QIF A;  2AF6 A;  4U7C A;  1X5S A;  2VKZ G;  4OZ3 A;  4DPX A;  1PC4 A;  2VA3 A;  2J6S A;  2C3Y A;  2XMV A;  1FFW B;  3HLU A;  4JI0 J;  2LDY A;  3R5J B;  2MMY A;  2OI2 A;  2CJY B;  2JOQ A;  1TFW A;  5C2C A;  3S8S A;  3ILO A;  1ICE B;  4Q45 A;  3R2C J;  3BEG B;  4LMZ A;  1R8H A;  5KG7 A;  4CNZ A;  5J2M A;  4ZIW A;  2HHQ A;  4M63 A;  2BJD A;  1SI9 A;  2V63 A;  3D54 A;  2D9P A;  1S59 A;  3IWX A;  2C2N A;  5GAD U;  1IJF B;  4LRC A;  2V9K A;  1S7I A;  3MM5 A;  3SXL A;  3ZTP A;  2CAD A;  4HYK A;  2DO0 A;  3L4B C;  4JB8 B;  1P8G A;  1CQM A;  1J5O B;  2J6T A;  4UQT A;  1L3V A;  2OMO A;  2MGZ B;  2KXN B;  4LSL B;  2E5G A;  1SB6 A;  4K5S A;  4M8L A;  1S9G A;  1AFI A;  3CXC R;  4PG4 A;  1A9N B;  4NA3 A;  2GQ2 A;  5F8N A;  5GMK a;  4DV1 J;  1KHV A;  4BC9 A;  4WP9 A;  4GKK J;  1I51 B;  2B8P A;  2B43 A;  4LRA A;  4JI8 J;  4P71 A;  1R7I A;  3AB4 B;  3S01 A;  4O0I A;  2DEI A;  3GJS B;  2W4P A;  2M2B A;  3HHE A;  4B3T F;  1KN6 A;  1FTC A;  4PWD B;  3VAK A;  1KBR A;  4P74 A;  2ZDP A;  4CQ1 A;  4RW9 B;  2QLB B;  3UN5 A;  4JI5 J;  3SMZ A;  4RW6 A;  2W7P A;  3DDK A;  1VR6 A;  1JLC B;  4WFB Q;  1N6Q A;  1TVR B;  1X4H A;  2QV6 A;  4M5L A;  4ZP7 A;  3DU6 A;  3WC0 A;  1NK8 A;  4USJ C;  4WP3 A;  1VLY A;  1YVF A;  1HR0 F;  5FDL A;  4NLU A;  1LOU A;  4F4X A;  1LWF A;  4C8M A;  2ATC B;  2B6A B;  3L7U A;  3CVK A;  3B6B A;  4J7C A;  2DR9 A;  5MLC V;  2MQP A;  2VZ9 A;  4WFX A;  1XK8 A;  4UY8 T;  2W4D A;  3H0P A;  3N6M A;  3H2L A;  1TL4 A;  4E2F B;  2RDI A;  2VB6 A;  2DIS A;  4ETX A;  5D3G A;  4QIG A;  4DUZ J;  1WC0 A;  1D9D A;  1U1K A;  1WWH A;  1KKH A;  1VRU A;  5AE1 A;  4KTQ A;  4TYB A;  3U27 A;  2OLW A;  3KJQ B;  5GVQ A;  5IZH A;  4J9L A;  3FQL A;  3BKU A;  2A0F B;  1LW0 A;  2UXD J;  3JSM B;  5CYQ A;  2O3D A;  2R7W A;  3AA8 A;  3CCJ S;  5C2G A;  2GJI A;  3A8I A;  2ZZN A;  4QYZ J;  4UOF A;  4ZJQ A;  3M05 A;  1UVM A;  1Y0H A;  3M1V A;  4OV1 A;  2FJD B;  1SJR A;  3MM6 B;  3S6E A;  2BE2 A;  5AXK A;  5GAE I;  1TMM A;  1TK5 A;  3D68 A;  1VS3 A;  4AL7 A;  4WFA Q;  2XNR A;  4ZVR B;  1RAE B;  2CVI A;  2FHM A;  2VQF F;  2ZHA A;  1Y10 A;  4L76 A;  3LO3 A;  4TXS A;  3HZE A;  2E44 A;  4JI2 F;  3JTP A;  5B0C A;  1OY6 A;  3OR2 B;  2FVP A;  5MAO A;  3RW6 A;  3GII A;  2MJU A;  2XY5 A;  4CLF A;  2CUY A;  2HVE A;  2HIY A;  5T14 A;  2V4J A;  5DZ6 A;  4PPZ A;  1S72 S;  2GHW A;  3J81 j;  3VGT A;  3LPY A;  1XMB A;  3W60 A;  5FDL B;  1HD1 A;  2XO6 A;  1LWF B;  3K17 A;  4JV2 A;  3HFK A;  4C11 A;  2QLW A;  4F0K A;  4AFF A;  2Y1L B;  2P9G A;  3BS9 A;  2H1Y A;  4B3R J;  8ATC B;  4Q0B B;  1X5P A;  4CP5 A;  2C2M B;  4ECZ A;  3OXF A;  5K14 A;  3ISZ A;  1S6Q A;  3D1O A;  1WUU A;  3MEC A;  5F8H A;  2VFR A;  2CWK A;  3KMQ A;  2KXF A;  2VD3 A;  2DCL A;  2PN6 A;  3M8Y A;  2MJN A;  2GS8 A;  5B0G A;  2D69 A;  2VC1 A;  2R2R A;  4FXD A;  1SJF A;  3CJK B;  2PEH A;  3L95 X;  1J5E F;  4ELV A;  4USI A;  3V81 A;  2RIJ A;  1T7P A;  5IFM A;  2RU9 A;  2HNZ B;  2MKS A;  3PFE A;  4I6Y A;  1UTA A;  2KH9 A;  6AT1 B;  1VRU B;  1HNW F;  2HNY B;  3M6X A;  4JOU A;  2QEX S;  1KR4 A;  5J2Q B;  3GQC A;  3W3S A;  4ZIV A;  4F50 A;  1PCA A;  3PYE A;  1WD6 A;  2IAJ B;  2JLE A;  2X1F A;  1VQN S;  3OVA A;  2EC0 A;  3PDN A;  2VAS A;  1Z4U A;  2QYC A;  3SZ2 A;  4MFB A;  4F25 A;  2C3P A;  3M2R B;  4FBU A;  4FP9 A;  4QIV A;  1IM6 A;  4PXB A;  3E01 A;  3I31 A;  2IBK A;  3MMJ A;  3H25 A;  4EYI B;  3Q0A A;  2M70 A;  3SSQ A;  5LXR A;  1RHK B;  3ILL A;  4F7V A;  4M5J A;  2OPP B;  3CJ4 A;  3QFH A;  1CLF A;  4YB7 A;  1AT1 B;  4K4Y A;  1TKZ A;  2IFX A;  2K2P A;  4JI4 J;  4X4Q A;  2QMW A;  3KUE A;  1GX5 A;  2I0X A;  3LF0 A;  4B9T A;  2ZD1 A;  4DPT A;  4LFC J;  4O44 B;  4OYW A;  2PC6 A;  3NOG A;  1HNZ J;  3IM9 A;  1AUS L;  2V94 A;  1RU2 A;  3FDS A;  2K3K A;  5GME A;  4LVO P;  4CCH A;  3EXC X;  4NLP A;  4B3S J;  4KBI A;  2OPR A;  1RT6 A;  5JJB A;  2FTR A;  3G8Q A;  1JLE A;  2JLF A;  1K47 A;  4S0M A;  1IKW A;  5M2U A;  2VH7 A;  2YVS A;  2J9E A;  3PX4 A;  1U7L A;  3Q8U A;  2IM1 A;  4X4U A;  3VAI A;  1B4S A;  3SCL E;  3I5B A;  3KFW X;  2L41 A;  5GAH U;  4IKA A;  3MF5 A;  2D3Z A;  2WTF A;  3CJQ A;  4PRF A;  1R3N A;  3BGO P;  1DTT B;  3KMS A;  1PJ6 A;  1T8E A;  4IUF A;  4LF8 J;  2GIQ A;  3RJM B;  1RAB B;  3D5M A;  3KJV B;  3NGT A;  1ZZN A;  3FCW A;  4HI1 A;  1NJX A;  3M9O B;  3W62 A;  3BO4 A;  2V2V A;  4N5S A;  1TQL A;  5I4M A;  5IM0 A;  1HNV A;  1X4E A;  2WVD A;  2MQL A;  4JI7 J;  4CLZ A;  2ZUA A;  3MEE A;  3PJX A;  3EVM A;  2L9D A;  4TN2 A;  1ZYQ A;  4ZPW R;  4YY3 J;  1RAO A;  4DL3 A;  3J7A 1;  3OFF A;  4KJI A;  4HVZ A;  3M8R A;  1U49 A;  2WSE C;  5KFX A;  4PAB A;  1F5A A;  3PO5 A;  1UJ6 A;  3CJ3 A;  4G3I A;  2YWW A;  3EPI A;  3GU0 A;  1M1H A;  1N36 J;  5DJB A;  4NRU A;  3J81 U;  2RDJ A;  2F40 A;  1JLQ B;  3D9B A;  3W1Y C;  3CE8 A;  5KFI A;  2F4V J;  5J2N A;  2CNL B;  1TKZ B;  1XTZ A;  3CSK A;  4OLO A;  2IA0 A;  2CQ4 A;  5F41 A;  3RRG A;  1CJK A;  3IR6 B;  2FJX A;  3F56 A;  1S1X B;  2CQD A;  5EX0 A;  1S9E B;  3K59 A;  5A2Q U;  4F2R A;  2BAN A;  1FNO A;  2KI2 A;  2UUB F;  2YNG A;  3LWL A;  4LBP A;  2ZH6 A;  2UXC F;  4RBV A;  1CJV A;  2ZHB A;  2OHD A;  2GAG C;  2AJF E;  4DOZ A;  1F2H A;  3GIK A;  3UO0 A;  3DRP A;  3D3B J;  2WON A;  1Q95 G;  3VAL A;  3MFI A;  2LDI A;  2EC2 A;  5A0Y A;  5LM7 E;  3MMC A;  2FIU A;  1WHV A;  1U25 A;  2RRA A;  2DTJ A;  3FZ2 A;  1K9M T;  1ZAX A;  1X4F A;  1WNE A;  2HGM A;  2XNQ A;  1N32 J;  3CCV S;  5DG9 A;  3J7Y I;  4DR3 J;  2GQQ A;  5E3R A;  4OZ0 A;  3ZFV A;  1U6B A;  3HD2 A;  5KT5 A;  4ELT A;  1RBA A;  4FKY A;  2QX0 A;  1TL1 A;  1G7C B;  3EVW A;  2W2Q P;  2H65 B;  4AE5 A;  2DHA A;  3F41 A;  1VBZ A;  3OVB A;  4DX8 H;  3HF5 A;  5T7L A;  2J9D A;  4CTA A;  1XR7 A;  2V8P A;  3POT B;  5F0U A;  3A4T A;  4YQW A;  1YQH A;  1FK9 B;  2DNG A;  2KO1 A;  2CJB A;  3T5L A;  3IMQ J;  2FHJ A;  2ASD A;  4IG3 A;  2HSE B;  1HHQ A;  4FPR A;  4LR9 A;  4NEY A;  3JTO A;  1UEK A;  2GX8 A;  5A8K A;  1RTJ A;  2W9A A;  2N7Y A;  1FXD A;  4UZC A;  2Q6C A;  4CT9 A;  3GSD A;  2WVE A;  7FD1 A;  1L3U A;  4ED3 A;  5D4N A;  1E6V A;  4V19 J;  1YWX A;  1I3O B;  2VKR A;  4CT8 A;  3GYN A;  4DV5 J;  1ZPV A;  1KLN A;  3HKZ D;  2D74 B;  1CJK B;  4DL0 C;  5HRO A;  5AE3 A;  1P6T A;  2F5G A;  5AXN A;  2MPU A;  5L8R C;  1AW0 A;  3OTD A;  5M2P A;  3K5P A;  1UMJ A;  4IFV A;  2MKY A;  1CJV B;  2B7C B;  4OYX A;  2RJZ A;  3AJD A;  1R89 A;  2F65 A;  4C0H A;  4OI1 A;  2WON B;  4O3O A;  2MDA A;  3VTI A;  1S48 A;  1NSA A;  3D0G E;  5A0Y B;  5DQI A;  2LLZ A;  3KLH A;  4NZ6 A;  3PW5 A;  2DGU A;  1N5Q A;  4BC7 A;  5IV3 A;  1ELO A;  2MZQ A;  5CQG A;  3P5B P;  1BQN B;  5HP1 A;  2HHH F;  3GON A;  2NQP A;  4DR5 F;  1UET A;  5KFJ A;  1RAD B;  3VAG A;  5D0H A;  2GHV C;  5FLX Y;  1T03 B;  2QL7 B;  3TUZ C;  4C8Y A;  2ZH5 A;  3NMR A;  4UST A;  1XQI A;  4AUK A;  5D4P A;  4CLL A;  1V6H A;  3PM9 A;  2V8D A;  5C25 A;  2OEM A;  2KJW A;  3TUJ C;  4OL8 A;  4R8U A;  2PFD A;  3OFE A;  1EB0 A;  2PEB A;  4C6A A;  1EKR A;  1D09 B;  4MIW A;  3UFC X;  2ZEJ A;  1KTV A;  4DV6 J;  4PUO A;  2MZR A;  1DFD A;  3R1L A;  2DGQ A;  1RJJ A;  2G1H A;  4PZV A;  3Q2S C;  3PRV A;  1RWN B;  4MH8 A;  3D6H B;  2G2Z A;  1PYS B;  2I5J B;  3TQE A;  3A13 A;  4CNY A;  5A8K B;  3WIV A;  3DLH A;  1TP7 A;  4FS1 A;  3JSY A;  3OUY B;  3I87 A;  4ZVP B;  1S57 A;  2ZBR A;  1NSK L; 
#chains in the Genus database with same CATH homology
 3R7B B;  3KJN B;  1RWW B;  2H54 B;  1I51 B;  4ZVR B;  4LSZ B;  3GJQ B;  5IC4 B;  2C2Z B;  2XZT B;  1RWV B;  4DCP B;  2QL7 B;  3SIP B;  3GJR B;  2DKO B;  2QL9 B;  3IBC B;  2Y0B B;  2H5I B;  2QLF B;  1I3O B;  3R6G B;  3R7N B;  4DCO B;  3GJS B;  2QLJ B;  1SC1 B;  1RWP B;  1RWX B;  2XYG B;  3P45 B;  5IC6 B;  2XZD B;  3R5J B;  2C2K B;  3P4U B;  1RE1 B;  2H51 B;  2CJY B;  1NME B;  1SC4 B;  2H4W B;  2H5J B;  3R6L B;  1ICE B;  1IBC B;  1GFW B;  3KJQ B;  3EDQ B;  5K20 B;  2QLB B;  2CNK B;  2H4Y B;  1PAU B;  2XYH B;  4DCJ B;  3D6F B;  2HBR B;  3QNW B;  2HBZ B;  1PYO B;  1SC3 B;  1F9E B;  2H65 B;  4ZVQ B;  1RWK B;  3KJF B;  1QTN B;  2CNL B;  2Y1L B;  1RWN B;  3D6H B;  1RHQ B;  1RWO B;  2HBQ B;  2CDR B;  3GJT B;  2C2M B;  4ZVS B;  4ZVU B;  2P2C B;  2C2O B;  1RHR B;  1RHK B;  2FQQ B;  4JB8 B;  4ZVT B;  1BMQ B;  2C1E B;  1RWM B;  2XYP B;  2HBY B;  1RHM B;  3RJM B;  3NS7 B;  2H48 B;  2CJX B;  2CNN B;  3D6M B;  2QL5 B;  4ZVO B;  4ZVP B;  3EDR B;  2CNO B;  3R7S B;  1RHU B;  3IBF B;  1RHJ B;  1QDU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...