3R7SB

Crystal structure of apo caspase2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-2 subunit p18
total genus 21
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7sB00
3SIPB 1RWPB 1RHUB 2QLFB 2XZTB 1RE1B 1RHJB 2H65B 2H51B 1RHQB 1NMEB 3KJQB 3R7SB 2XYPB 3R5JB 1RWMB 2C2OB 2P2CB 4DCOB 3P45B 2C1EB 2C2KB 1GFWB 2Y0BB 3P4UB 2HBZB 2XYGB 3IBCB 1RWXB 2CNNB 2DKOB 5IC4B 3NS7B 1I3OB 1ICEB 1QDUB 2HBQB 2XYHB 2CDRB 2XZDB 5IC6B 1SC3B 2H54B 1F9EB 1PAUB 1I51B 1SC1B 1QTNB 4ZVRB 2H5IB 2QL5B 1RWKB 4ZVSB 3R6LB 1SC4B 3GJRB 4DCPB 2QL9B 2C2ZB 3QNWB 2CNLB 2C2MB 3GJSB 4ZVOB 3R7NB 3GJTB 3RJMB 3EDQB 1RWVB 2QL7B 1RWOB 2HBRB 4ZVUB 2HBYB 2CNKB 3D6MB 3D6HB 1RWNB 3EDRB 4ZVPB 2QLJB 3R6GB 3KJFB 1RHMB 1PYOB 3R7BB 2H4WB 1RWWB 2QLBB 3D6FB 4JB8B 2CJXB 2H48B 1RHRB 2CNOB 2H5JB 2FQQB 4ZVTB 2Y1LB 3IBFB 2CJYB 4DCJB 3KJNB 1BMQB 2H4YB 4ZVQB 5K20B 1IBCB 3GJQB 1RHKB 4LSZB
chains in the Genus database with same CATH superfamily
2PEBA 4RNFA 4K8RA 5ADZA 2FTRA 1F5CA 4B3OA 5HROB 2AYMA 1C0UB 3BDEA 4GVBA 1KHVA 4PXEA 5LXYA 3OFHA 2VJUA 4B9MA 2AEJA 5KFMA 2LMIA 2RS8A 3W63A 3SCKE 1TL4A 3IRXB 3ZTRA 4ZVEA 5B0FA 3I4HX 2Z58B 2KFYA 4GKKJ 1X9SA 4IFYA 3HVRA 1RU1A 2AYGA 2FLPA 2Q66A 4R8UB 3GIRA 2FJVA 3Q89A 3IFEA 1OMSA 2KFZA 1G6BA 4F7VA 3V6HA 2IA0A 1CC8A 2BEFA 1RAIB 3NGDA 4NRUA 1RP5A 4CO1A 4YR2A 2DNRA 3Q2TC 1NSKL 3TX8A 1XN9A 5KOXA 4JI4F 1GXUA 3LOUA 3A8JA 1VRTB 2AV5A 2GW8A 2DGOA 2LU2A 3DNCA 4KR0B 5CZXA 2VJVA 4KY3A 1Q8BA 4MFBA 1FJGJ 2O5DA 3UD5A 4DR4J 3DRSA 4HR2A 4EFAC 1R8AA 2CDRB 5GAEI 4DOZA 4CWBA 1PYTA 1D9DA 2BE9B 5D0GA 3KNAA 1X4AA 2YKPA 4J7CA 4DX6A 3KKFA 3V6DB 2YY3A 4QOTA 3S01A 2UUAJ 4Q8FA 2R2TA 2RQKA 1DHMA 4X4QA 2R7TA 1VQ5S 2VA2A 3EICA 3BYPA 4K7QA 4KB7A 1TL3A 3I9ZA 3H20A 1HIYA 2PEHA 1N36F 1UW9A 3DRRA 2GMJA 1QTNB 2EFPA 3DRXA 1S1XA 5L39A 2CG4A 4LR9A 4OV6A 1RYSA 4LF4F 4NLDA 4RLEA 2AGOA 2IRXA 1HNVA 4NYOA 1EP4B 2OMOA 3HHNB 1U0HB 1JLAA 4WFAQ 1RAFB 3RB0A 1NPPA 1YIJS 1T9WA 3FBBA 2QA1A 3PVXA 1ZAWA 1SB6A 1F0XA 2HVZA 3IG1B 2IBOA 2RHQB 3EXYA 1BE4A 1WC3A 3I5AA 4C2MA 4HL9A 3AXMA 2ZH5A 2F65A 3O8WA 3PO5A 3DKDA 3L3CA 1VIXA 5JUMA 1MWZA 1ZA1B 2RT3A 3HJVA 3DHWC 5D4OA 1NH7A 4C0HA 5KT3A 3NMAA 2JRSA 2KN4A 2EC2A 5EWGA 4DSLA 3GFYA 1N88A 3NWGA 4A8MP 4AL7A 2JWNA 2V69A 1RWUA 4FBTA 5ITHA 3C15B 5CHCB 4HYKA 4B9NA 3HHLB 3FGVA 1AZSA 2IYGA 2OEMA 4EK2A 1S4EA 1HA1A 2KVIA 4HLBA 3THPA 2N82B 4B17A 2QFJA 3GIMA 4DUYJ 5D78A 2KTQA 2DHXA 3OL7A 3R7BB 1X60A 5HI7A 1S9EA 1G3OA 3UVJB 3HSZA 3OV7A 1U2RA 3J7ZT 3VZIA 1VQYA 3N6NA 1QAYA 2KVQE 1W7WA 3LF0A 3ZZPA 2YXLA 2VOPA 2CPEA 1Q5YA 3H90A 2JC0A 3CGIA 1EHWA 2W4DA 4NLGA 2EKYA 2EKNA 1HR0J 2DHSA 2VF3A 2DEIA 2GS8A 4DG1A 2ZOMA 2G0IA 3M2RB 3MM6A 2DIVA 3B82A 3FZBA 4IFVA 4ECQA 4OJGA 2E44A 2JSXA 3CNQP 3K57A 4EZ9A 3OBIA 3R3TA 5K20B 4WKRA 3FDSA 5IV3A 4QU6A 1VQLS 1GT8A 4QQBA 4IO9Q 1IN0A 5HAOA 2PT0A 5IM0B 2XQCA 3KLGB 4IR9A 4IRCA 3NBPB 1UVJA 2JDJA 4P2XA 3CO9A 1V6HA 2BE2A 2C28A 4LSZB 3MEKA 1DTTA 1KQSR 2DR9A 4IG0A 4CIOA 1LW2B 2G0CA 4NLTA 4AYBD 1EAYC 4I2PA 4KGKA 4PYAA 5KG3A 5GADI 1H74A 2LKZA 4FS2A 3J81U 4IOCQ 1RWMB 3OPKA 1KQFB 3ILJA 2CPYA 4ZPVR 3Q24A 2XTJP 1W2IA 2XB2D 1LWXA 2R3VA 3ILIA 2HHTA 2N4DA 2QGFB 2ZVSA 1IJFB 5ETKA 5T14A 2FY8A 3OHAA 3BO4A 2RDIA 4L75A 3HSDA 2HBZB 4LRDA 5B0EA 5A0YB 2V8GA 1RDRA 2ZH2A 4J9RA 5IWAF 5B0BA 3G82B 1S10A 2OH2A 2WW4A 1NLKL 1D8YA 2CJQA 2E9RX 1KVJA 1HWKA 4OHXA 4ZA1A 4DR5F 1HNZJ 1VRQC 2NZCA 3IBCB 1QUPA 1DARA 2I5JB 3QGGA 4NI2A 5BXIA 1CQNA 4URQU 2V2KA 1RAHB 4QWEA 2X1FA 3DYAB 1HQEB 2FVSA 1UAWA 2HZAA 3F41A 3MMBA 2LA4A 4QIGA 4DV4F 3CD0A 4KTQA 1G1XA 3Q8YA 2MQOA 3D3BJ 5IC6B 1X9MA 2XLKA 1TL7B 2DH7A 4KFBB 1I94J 1HBMB 4YDXA 2ZHOA 3G86A 4YFUA 5A8WA 4LUBA 1LWEB 4IH5A 2VG6A 3NKYA 5A8KB 5K8MA 2M8DB 2NSCA 2YWKA 2PD1A 5J2PA 4I2QB 4UT4A 2UP1A 1CJKB 1IBKJ 2DNPA 2VV5A 1MWYA 1R0AB 4DS4A 1AYEA 4J9UE 4EYIB 2YNHB 3CDAA 2BQUA 1DTQA 1IQTA 2V67A 3A4TA 1A9NB 2HEKA 3BDPA 4OJ1A 3C6TB 1BUXA 2CADA 2VBWA 1T9UA 2CQ1A 4DQPA 2WONB 2CZ9A 1V5IB 3V6KA 4C4WA 3GJSB 3E01A 2XWYA 3KYLA 2MPUA 3EZUA 5C42A 3HM9A 2PFFB 1XC9A 1RQ0A 2G2OA 5AXMA 2C2EA 4A8FA 5KFLA 1HL6A 4Q7AA 2DRDA 2QFIA 4M5NA 1H7WA 3U1NA 4TY9A 3J7YU 2CQHA 2FDNA 2BYCA 4ZN3A 4LFBJ 5GMDA 1E6YA 5HN0A 4OV1A 4QWCA 3ZTPA 2QN6B 3FCVA 3MD1A 4TXSA 1RCXB 2CPIA 4OQJA 1RLDA 3AQOA 1VK3A 4OI3A 4OYMA 4OMFG 9ATCB 2OEJA 1ZPWX 3I5BA 2HW3A 1WJ9A 1QUVA 3N5BA 4ZVPB 1YBAA 5KFSA 3R6GB 4X64J 1C1CA 2HGNA 5FLXU 5FD1A 1JLBA 1R3NA 2Q43A 3BQ1A 2UVWA 5DDQC 3NNAA 1N0UA 1RISA 4CQ1A 3GYGA 1MN9A 1WHXA 1FTRA 3FQKA 3MI7X 8AT1B 1KONA 1XMOF 1RA7A 3DOMB 3QJJA 1VQNS 1FFWB 4Q43A 2WVFA 3BJYA 4H4OB 2RAQA 3RBZA 1SH3A 3BZQA 4PEOA 3DLJA 1LWCB 2WAQD 2LU1A 3VVUA 3B6BA 2GA7A 4KKOA 4DF4A 1NK0A 2RMLA 3EVMA 7FDRA 2U2FA 4O0IA 4I1TA 1C4CA 3D1OA 5BYRA 1PBAA 1XWLA 1SH2A 2GMHA 3TVYA 4CH1A 3DOKA 2K1RA 5ETVA 4WF9Q 3M2UA 1U2FA 5ETSA 4Y00A 2GHPA 3ZZTA 2PN6A 1HD0A 1RB0A 4BCAA 2B43A 2EFGA 3TA2A 4YUDA 3IWNC 2HHXA 4DV5F 1VQ9S 1TL1A 2HNYA 2HURA 4USVA 3PACA 4GVLA 5GMEA 1NSAA 4RNNA 4J90A 4HHJA 5CYQB 1SJQA 1IBKF 3SDEA 3ELHA 1HPZA 1T0TV 2XZTB 3UFCX 6FD1A 2G1HA 3HCXA 3TARA 1SCJB 1RT6A 3FRYA 3KJQB 4IUFA 3O1LA 1JB0C 2OSRA 2MKYA 4URSA 4DFMA 4L3NA 6AT1B 1S0OA 3CO0P 2NREA 4B9UA 2XULA 5DRKA 1VQ6S 1XMQF 4Q0BA 4AQYJ 4OZ2A 2XCAA 1OYEA 1JK9B 2YX4A 1AA1B 2JL9A 4N76A 2Y8WA 5HATA 1EQMA 5CD4A 1S72S 1UPMB 2B51A 2DNQA 1L3VA 2FC9A 4JOUA 2V6AA 3G71S 3CF5Q 1X0PA 4P2SA 4PPDA 2OFGX 3FEZA 3LW5C 2YWFA 1ROFA 2LYVA 5KFEA 2CQ0A 4MJKA 5AJ3F 4DSKA 3I87A 3QRQA 4CLYA 2KZZA 5E5NA 2Z8QA 1M5VC 3OTDA 1R8CA 5D6GA 1VQOS 2CRLA 4JI1J 3QIDA 1QE1A 5CD4H 1FD8A 1MNEA 3B54A 5F3ZA 3OXLA 2VPZB 3AH6A 4CT8A 1QDUB 3TQEA 2J6SA 2YWGA 3PCOB 3VAGA 3HVWA 3NOGA 1B3TA 4UZBA 3PR4A 2NXUA 2RF2A 2RD5C 3DLKA 4U9RA 5LL6d 5KFDA 4DV0J 3WZ0A 2VKZG 2HQIA 2IFXA 1I51B 3BH7B 3WHIA 2VQEJ 1ZAXA 4C8OA 1U6FA 1LWFB 1WC5A 1S6QA 2ZFHA 4C7QA 4C6AA 5L1IA 2VH7A 4JV0A 1N52B 3AA8A 1N32J 4ZJLA 3HHDA 3Q8QB 1NJXA 4EWTA 2EXUA 2ERRA 3MM5A 4AD6A 5BR8J 4MAKA 1CS4B 3SSSA 1L5UA 1HQUB 3IR5B 3NS5A 4YHHF 4WFZA 3TANA 3N6MA 2KDOA 1Z2LA 2B5JA 2Z30B 1S48A 2B9YA 1VMBA 4LREA 2BOAA 1ACMB 1S7HA 1IBMF 1QSLA 4ANDA 4F4KA 2WOMB 3LQVA 3KHHA 1TVRB 4USHA 1YRUA 4H4KC 2AJ0A 1LW0A 5HJXA 2RHSB 2NS1B 4QPXA 5C25B 2HGLA 4P72A 4TKTA 2MGZB 1U1MA 1UZHA 1HWUA 2FY1A 3B78A 4N8NA 4JI7J 1SUQB 3M6XA 2OGUA 3FBEA 3L09A 5KFYA 1SQGA 3N6LA 4NMXA 3T5HA 1AUDA 3J7A1 4DL4A 2CPZA 2GQCA 4NL5A 2J5AA 4RW4B 3T6JA 1FA0A 2AGQA 1A6LA 3I0SA 3KUGA 4A47A 1U1KA 4CYUB 3EZ5A 3Q0AA 4JI2J 4HH0A 1Q79A 5EGYA 3C3LA 3KMQA 3FC9A 4F0KA 3JYTA 2AYBA 1HLWA 4GO7X 4HH1A 1PYOB 2GVZA 1E6VA 1NB2A 1VJWA 3W9HA 1H98A 5K9FA 4IO1A 1PKUA 4RW7B 4DPOA 2GVZB 3G8TA 2X51A 3CCRS 4DLGA 8ATCB 4Y34A 4KGVB 5D4LA 2ILZA 1UCNA 2E66A 3H59A 2XS7A 2XHCA 4DL2A 1FFSB 2J7UA 2AZ1A 1KN6A 4F3OA 4CO3A 2V2VA 4TYAA 2DXEA 2CVEA 2DXDA 2XC9A 4QPTA 4LRCA 1U6BA 1LXNA 2JX2A 1HNWF 1NH8A 3DLEB 3NEKA 4ZP7A 3VGUA 5DLFA 3IN5A 2HSEB 2DGQA 4DDFA 2VA3A 3G8SA 3JQKA 3RAQA 3QFWA 4DN9A 4ECYA 1BD6A 1KTQA 4MKBA 2D9OA 3DXSX 2HLTA 1S1TA 1FXRA 3CC2S 4DV1J 1TV6A 4USTA 2B5JB 4LF2A 1S1TB 1BHNA 3CW2C 3W64A 3M8SA 1RHJB 3KFWX 4IG3A 1HI1A 4DSJA 2B4OA 1OSCA 4ZN1A 4ZDNA 1QLNA 3PJXA 5CH7B 4LVNP 2CPHA 1ZM4A 3CJ8A 2B6AB 3PJWA 2IAJA 3NXZA 2DO0A 1SBRA 1N34F 1WOOA 3BBBA 3QGIA 1UFLA 5DLGA 3VAJA 4EBEA 3RR7A 2B3TB 1HKAA 2BQRA 3HZGA 1CG2A 2DNHA 3OLAA 3W62A 3M9MB 2QV6A 3UNYA 2KFNA 3FMBA 1JQGA 3DM2B 3ZZRA 3CCUS 2QT7A 1FJ7A 1Q8IA 2P6TA 3H8YA 3QWPA 2YQ3A 3FZ2A 3CCWA 2OFHX 2V9KA 5GAGI 1TKZA 4DV4J 2YVSA 2ZH1A 1P6TA 2K3IA 3BKTA 3MEGB 3ZZUA 1H2VZ 1ICEB 2UUWA 3P5TL 4P75A 4Y0FA 1QD1A 2BOPA 1C0TA 1VQ8S 3MEGA 1CSJA 2HQFA 1FEHA 3A8EA 4LF7F 4DU8A 2GAHC 2HFOA 2UUCJ 4RPFA 4NMLA 4O4GA 1YITS 3MCNA 4U7CA 3CWJA 3RB6A 1T9TA 4BHQA 4WP3A 2J6TA 5DS7A 4OHVA 4ZCLA 2ZH4A 3RBDA 3S7RA 1ZTWA 5EWEA 5KFBA 2E5JA 1RTHB 1PYSB 2C2ZB 2RKIA 2DGVA 4AUKA 3QNWB 4O23A 4DR2F 2XS5A 2B6AA 4F4WA 3GJTB 2VG5A 5CYQA 4ES1A 3CT9A 3RJMB 2QL7B 1RT3B 1Y3KA 2HRTA 5ETRA 1NDKA 3QYYA 4O3PA 2UUAF 4TYBA 1BLUA 4Y28C 5EWFA 5DDPC 2MQMA 1TK8A 2XSJB 3MEDA 4DR3J 4QU7A 2FHMA 1LWFA 1K0VA 1V5VA 2FHKA 2O1PA 4U7UK 1WOPA 4MH8A 2W2MP 4J9QA 3HHLC 3M4XA 2DRBA 3TVZA 1WC6A 4KE5A 4ZP9A 4EO6A 3MMCB 1V3SA 2XY5A 4X4UA 2X1GA 5EDWA 2IM2A 4O3SA 2DT9A 4OIXA 5I3UB 1IJEB 1DAXA 2QLJB 3SV4A 3KJFB 4RNHA 2V50A 3LAMA 4UOCA 2V8PA 3TOQA 4ATNA 2VHGA 4LF9F 4RBVA 3O44A 2KU7A 1S4FA 1RABB 2BVZA 4H4OA 2J0SD 2ZC3A 1JNRB 3TA0A 1XMOJ 1U45A 1SL1A 4NA2A 2LQ5A 1PAEX 1YX2A 2AMCB 4USUA 4ECVA 1TL5A 2J8AA 2D3UA 3N01A 4B3MJ 2BA9A 4A8QA 4RR5A 1UWBB 2MLXA 1YKWA 2VFVA 4FKXA 5B0AA 3SSRA 4ECWA 2ZWPA 5F9LA 2GGPB 2CYYA 3U7JA 1CULA 4M5DB 2RNEA 3MM7A 1CVJA 4LF6J 4G1IA 3OTOJ 3DHXA 3A13A 1FT8A 4MIBA 2WVEA 2ZD1A 3NGUA 1ITPA 3H0PA 2MJNA 2QSFA 5GAEU 1JLCA 4QIEA 2N3LA 1FRHA 3ZTOA 3AA9A 4ZITA 4PWWA 1YJVA 2KYZA 4G1QB 4JI8J 4M1KA 1VQKS 4FVCA 3TZWA 4PKDB 1F9HA 2FC8A 1TVRA 3SMZA 3UW1A 1FX4A 2AHOB 2CWXA 3WIUA 3BPDA 2KJWA 4DFPA 3PR5B 1JLGA 2MKSA 4CI0B 5F8HA 2YQ1A 4WE1A 4DHVA 5ETPA 1HQUA 3ISZA 2K1RB 2H9ZA 4B08A 2EG1A 3GSDA 1RKIA 2XLJA 1IKVB 1FE4A 1IKWB 2GNKA 3PX0A 3LH2S 3KTQA 1HNZF 4G65A 2W01A 1BC6A 2VG6B 3DI6B 1YZ7A 2C3MA 1RI7A 3IA0A 1D8ZA 3ZXWA 5HMXA 1RT7A 2W9BA 5AXKA 2FGCA 3P5BP 2HNDB 2DHGA 3NGKA 1JLQA 2YKMB 1IBLF 4EBCA 3NNCA 1U1QA 1B4SA 1TL7A 3HF5A 2PA3A 4CH0S 4A8SA 1U4BA 4RU2A 5K8PA 3U1LA 1MMDA 3Q8PB 2CQGA 2Q79A 2WW8A 3BGUA 3MPYA 4EU0A 3T6BA 1RT4A 2OEKA 1KOOA 2D74B 4NYPA 4Q2MA 1RT4B 2HWTA 4NLVA 3CJRA 1UFKA 4K4VA 4ED2A 3DXBA 3QGHA 1QTMA 1QE1B 2H54B 4P74A 1EQ0A 3CDUA 1JLQB 2YKMA 2OD6A 3W5YA 2R8IA 1I6JA 2HFUA 1RT7B 1PAUB 1YGYA 2KO1A 2C42A 5LXRA 5F8LA 2W9BB 4C8ZA 1VISA 4WPAA 2FVCA 2L3MA 1E6YB 2CPFA 4BLGA 5C2CA 5B0GA 3W8GA 4KT0C 4XTTA 4CRJA 5B08A 1Q82T 3K5NA 2AW0A 4QBUA 3FEXB 1J5EJ 2IJFA 4K5RA 1NKEA 2JEJA 1N33J 3R7NB 2BJ3A 2E1RA 1M5HA 1DTTB 4AT1B 3EDQB 4LF5J 2VD3A 1FO1A 4J9LA 2CFXA 1RT2A 1UP1A 2NYIA 3H2LA 4DR4F 1Y0HA 4IKAA 2ZWOA 2AEMA 4JV1A 3W9IA 3M8YA 4F2RA 3HX9A 1S9FA 4MYUA 2HNYB 2R7SA 4JV5F 4NCGA 5F8GA 5J1PA 5SZTA 3THTA 4DR7F 4JI4J 3M30B 3PX4A 1JXEA 2JEGA 1YQHA 2CQ2A 8RUCA 1XIQA 3OT9A 4OZJA 4CTAA 2ZHBA 4J9VA 2CQDA 1CBKA 5KFPA 2GGPA 3N79A 4QJVA 1VJQA 1VCTA 1WG1A 4LVOP 1V3ZA 2B9WA 5D3GA 2QEXS 4DMZA 3IRWP 3V5RA 2BJDA 3B4DA 2X7IA 2HVIA 4K4SA 4TY8B 2FHJA 2M2BA 2M52A 2YKQA 3BKFA 3R1LA 4NLUA 3MZIA 3CCJS 4X4VA 2Y1LB 2D9PA 2YWWA 3GU0A 1TK5A 2QC3A 4KPCA 3TJAA 2KG1A 1FKOA 1Q7LB 1T95A 2CJYB 3QSYB 3MXHP 4BWMA 4JI0J 1RSCA 2R7QA 1U7LA 3H5YA 4AL6A 4WU3A 1RT1B 2ZE2B 4C8KA 3I82A 2CJKA 1IKXA 2DYAA 3IWLA 4K2XA 3QT8A 5KFUA 1FF2A 2RQCA 4B3SJ 1S0MA 2NUHA 1FHTA 1N54B 1PC4A 1FI4A 1RZMA 4ZHRB 1LW2A 3VCDA 4KYZA 2KH9A 5D4PA 2G13A 4IG0B 4M5IA 1N48A 3UR3C 4IOAQ 3KHRA 2Y1JA 4DV5J 4DR2J 2V68A 1NK5A 2VG5B 5L8RC 4ZS6A 5CAAA 1NDLA 3OL9A 2E29A 2IRYA 2Y9HA 1KQGB 2K7JA 4RZRA 1FRIA 5C42B 4ELVA 2L9WA 3E2EA 1EP4A 2JOQA 3E01B 2UVRA 4M63A 2BJEA 2AX1A 2KJVA 1WEYA 1JLEA 2RH3A 4LSNB 2ABYA 4W4MA 2ZC4A 5ETNA 2UVUA 2WB4A 2FJBB 3DCAA 2ZKUA 1B7FA 3C6TA 3IS9B 4PYDA 3IR7B 2DGUA 2XYGB 5HJYA 5KFKA 1N4LA 3ZTSA 5IWAJ 3KG0A 3PXGa 3RUBL 3F73A 3UD4P 4DLEA 2ATLA 2JEFA 2BUNA 4DL6A 2Q3PA 4F3MA 3EUNA 2V9WA 1XMBA 2DGXA 3AD9C 2HFZA 1OIAA 4TU7A 3PG9A 4H54A 1I3OB 3HVAA 3O6QA 1P27B 3QAUA 4KFBA 1NK7A 4UQTA 2HHVA 2BJ8A 2CQIA 1X8DA 3CXCR 1PC5A 3RW6A 3QJLA 1PJ6A 3PW5A 1TKZB 1APSA 2D7SA 4LQ3A 1HQ2A 1HQEA 1UTAA 2HQDA 2W1BA 1Q16B 5HLFB 4NLOA 2DH9A 3VAHA 2VODA 5GAHU 1CEZA 1NEEA 5LMNF 1KNZA 1GXTA 3MEEB 4N47A 3K58A 3MMAB 4UOHA 2V4JA 4YY3F 3I96A 4ZVRB 3ENWA 1NK6A 1J5OB 4R8UA 4OI1A 3NMRA 1KLMA 1S99A 3EVWA 1KEKA 2DIUA 1ZOTA 4DX7A 1YBUA 4RUAA 5DQGA 4F0MA 2FZGB 4F4ZA 3IG1A 1L3SA 1KVIA 2F63A 3FMWA 4ZVOB 5AE3A 3RAMA 2XSFA 4KHPJ 2XM3A 3ZNJ1 1T8EA 4J5OA 1O8BA 2XCPA 2B4VA 1TV6B 3OJSA 5CYJA 4YDDB 3DGPB 3WIVA 1A0OB 3H5XA 3QO9B 4LRAA 2CQCA 1FJCA 2KHDA 3QPIA 1WI6A 3NBPA 3TZYA 5J2QA 1OQ6A 1R6VA 3A8KA 2ADBA 1Y5NB 5J1EA 4LF6F 1TFWA 1KC8T 4R5PA 3M8QA 3QZ8A 1K0TA 2F9JA 1Q0NA 4Q8EA 5CCMA 3TRGA 1U26A 4ITSA 1UL3A 4M5KA 4TVAB 4ED3A 3V6DA 4XDDA 3DRPB 2LQBA 1OPZA 3KK3B 2AGPA 2UU9F 2FD2A 2ZBPA 4Y2MA 3K5MA 4I68A 4DPWA 2DPIA 3NCQA 5B09A 4XPEA 4PRFA 1F3VA 1VBYA 3EGVA 5IOLA 3GPAA 2AJ2A 1XQIA 4RWXA 2HKEA 3FFIB 1NSQA 2PGCA 4X66J 1CJVA 5C5JA 3KJVB 2OTJS 1S6PB 2VUGA 5KG2A 2HWIA 2DNGA 1E6VB 1RHRB 1SKUB 3AODA 4Y2CA 2CNOB 3BGRB 4C97A 3OFFA 2IIHA 3D0GE 4E8UA 4WKYA 2ZM6J 5LJ5Y 2QLWA 1HNXJ 5J2NA 1FK9A 4P2FA 4C11B 3JQJA 5FIIA 5KFJA 2V8VA 3TEGA 3LPEA 1AZSB 3EPGA 4DJBA 3IC1A 2RB7A 5DDRC 4IFYB 1KQKA 4ZCMA 2J9CA 3GQCA 4N77A 2JVRA 4LR8A 4MK9A 3FCHA 4F67A 4X4PA 2E1CA 3MAAB 1JXVA 2IMOA 1HHTP 4BWJA 2EEYA 3CMQA 2IVYA 1FRJA 4GVBB 4NLQA 4DR1F 3QGPA 1S1VB 4HHHA 4WWSA 2UXCJ 4J9KA 5M2UA 1ZM9A 2QMXA 3CD7A 1DBDA 4ECUA 4LFBF 3MR2A 1S77D 1JJCB 2R42A 4LFCJ 1XR7A 2KRBA 2IPOB 2XYPB 4MK8A 1S76D 1N34J 3DLBA 4BDPA 5EUHA 1N6QB 2KYXA 4ZLLA 3A8IA 5LMUF 4CO4A 4EGLA 3IAS9 3W2WB 1CJUA 1N5VA 1N5YB 4RWWA 1MG7A 2R8HA 1SJ1A 1J27A 1FFGB 2V8DA 3DLGB 3UCZP 4JV2A 5KFIA 3QRPA 2DH8A 4OYPA 2B4UA 1T02A 3MR6A 1Q86T 3VF0B 4LSLA 5LM7E 2KXFA 3POTB 4WCEQ 1U09A 1UETA 5KFAA 5E2QA 2VC1A 2Y0SD 3KLVA 4DFJA 2DCUB 2ILYA 1NZ8A 4MKYA 3NL0A 2POKA 2VASA 3KG4A 3NWRA 1WKLA 5D0HA 3OLBA 4IQXA 4JI3J 4BBYA 2ROGA 3MMJA 4URGA 4KPYA 1VBXA 4QWDA 3TO8A 5M2RA 1MN7A 2MB0B 1P1TA 1RBOB 2YKOA 1DLOB 3DDIA 2FJEB 1KP6A 2CIMA 4K4YA 1DZ5A 2GVDB 3CD5A 4C8NA 4OX6A 3DMJB 2OPSA 4CZCA 2A6OA 3PJ9A 1HNXF 5D8HB 2LFVA 1NJIT 4XIUA 4GC6A 4AQYF 4M5MA 4RJVA 2ACYA 1HBUB 2W4CA 1HMVA 3D67A 3MUTP 1KOHA 2GVDA 2X3DA 1Y4ZB 3MF5A 5A2QY 4KHMA 1K73T 4P6QA 4A48A 2VG7B 1T05A 5HVFA 3BF4A 3KK2A 3KLIB 2CZVC 4DSFA 2HHHF 1JWWA 4FF2A 2B7BB 3TWZA 2XNRA 1OSDA 2D41A 2CA9A 2XY6A 2C2MB 2XO6A 1GAOA 2QX0A 3MPWA 3QT5A 4QW9A 3M9NB 1KVKA 2GV1A 1FKPA 3JSMA 2ZHAA 4CM0A 3IRXA 4O0NA 2U1AA 1RT6B 4DN0A 2YNIA 3GV8B 2P9CA 4Q2LA 3HULA 4DR3F 5GMKa 4LFCF 1HPZB 2A3JA 2XGQA 3T1HJ 2HMIB 1OY8A 1M5SA 2FJWA 5HROA 1Y11A 2B8PA 3LP2A 5BJRA 2E5HA 2K3KA 4F4YA 4LSLB 3ISND 2E5LJ 2MY8A 3SZ2A 4NASA 3KDOA 2XNQA 4ZP6A 1P1LA 4ZPTR 3SCIE 4B02A 2I2YA 1RWNB 1UEKA 1X4DA 2G9OA 4X84A 3EDRB 3OR2B 1WF2A 4UUXA 4B3SF 4MYTA 3UO0A 3K7RA 3GIJA 1NJWA 1N6QA 5HMWA 1M1HA 4UF4A 3QJPA 2PIIA 2QRRA 4RNOA 5KFXA 2XZWA 1JIHA 3QFHA 3FBFA 3ZNUA 2UV8G 1LFPA 5I42A 1S1WB 1VFJA 4IDKA 3TR5A 1LWCA 2MZTA 1HBNB 1Q5VA 5FLXY 3MUMP 3CB4A 3QIPA 2K8GA 1HW8A 3OTEA 3CCZA 2V34A 3R5GA 4ID5B 5HMZA 2KI2A 3R1HA 1R0CB 3DOMA 1RYRA 4P7TA 4ECTA 1MMNA 3G87A 2BXJA 1TKTB 1T03B 3UCGA 1TELA 2PFDA 2C2NA 4DV2F 5FDLB 2HHHJ 1C1BB 4PWDB 2OHDA 5KG5A 3IBFB 1RTDB 1N56A 2EVZA 5KFTA 3W65A 3H5UA 4DCJB 2A18A 1ZH5A 5F8NA 2K7KA 1RTIB 2HAFA 4OX9F 5JJBA 4C11A 4HI1A 4C0BA 1SC6A 3BM7A 3OSNA 1U1RA 3JSBA 1RUSA 1ZZNA 1TUWA 1Y9OA 2B56A 2YKNA 4WBFA 2L9NA 4DS5A 1AUSL 4RUBA 3ILOA 4WTOB 3M8ZA 1IKYB 4W90B 1RHUB 1JKHA 2HNZB 2XMJA 4OZNA 1FTCA 3K5OA 4RW9A 1RHQB 4R0JA 4PUOA 3LGHA 1RT5A 4A8KA 4NA3A 3T1AA 4FYWB 2HVEA 4UZCA 2WONA 4N8OA 3WC2A 2WBMA 2RRAA 4IR1A 4ANCA 4DU7A 3ITHB 3F0NA 4KBIA 1YLXA 2HG4A 4ZPDA 3M8QB 3DOLA 1EX8A 3OUYA 1F2GA 2DHHA 2VB6A 4PR6A 2Y0BB 2MHEA 4LFAF 4P7VA 2Q6BA 4MIAA 4XK8C 3QO9A 1K44A 4LF4J 1DQAA 2JFKA 1Q4RA 3PM9A 4I2QA 3TUZC 4HT5A 4B3RJ 1H3DA 3C16B 4LF8J 1LWEA 5A8KA 3OHBA 1QY7A 3UE2A 1SJFA 3TAMB 2OJ3A 2GIRA 3IO1A 2WB1D 2IM1A 3NCRA 5F9NA 2MKIA 2KXNB 3QZ7A 2BANA 3NAIA 2ZH7A 1VC5A 4W98A 3G8QA 4P73A 2BKOA 3MCMA 1CLFA 2HAIA 5SUHA 3RB3A 2DR5A 3PW0A 3VQTA 3CJKA 3MMBB 2PC6A 3VTIA 4TU8A 2BR0A 1HBOB 1SC3B 3C66A 3IMQJ 1KLMB 3RRHA 2HFSA 2VKRA 4U67Q 3HJFA 2SXLA 1X4CA 2LEBA 2UUCF 2ZKTA 2ZM6F 4N56A 3UD3P 3EWGA 2DHAA 4JP8A 4CT9A 5DG9A 2ZBRA 1G7CB 2H5IB 2O66A 4ETXA 1FNXH 3PYFA 2I0XA 2RUSA 5DQHA 3OQ2A 3K5LA 2FLOA 3CJKB 2BRLA 2ASYA 5EN1A 3TX0A 1LOUA 4YS2A 1XR5A 1GTEA 1FDNA 3R8YA 4LF1A 1QJHA 4KQZA 3FRZA 4WU2A 1O5JA 3UI3A 3JSRA 5DETA 3T1YJ 1NHVA 1ULRA 2XGPA 4WZQA 2FVQA 3V81A 2KXHA 4I2PB 2BE7D 4OYZA 4OHZA 4KHRA 2DITA 1M1KT 1GX6A 2YNGA 3MECB 2B0GA 1YWXA 5HBMA 1F60B 2ZITA 3MCOA 2WK4A 4QIVA 4K0KF 4DR7J 2BE2B 2XMUA 3AJ2A 3BGOP 3CJQA 3NG8A 4LF5F 2ALZA 5DO2A 5IM0A 3TVKA 3KLGA 5E3PA 3LWMA 1YJ7A 1DRZA 2XMAA 2WVDA 2ZUAA 4ZLJA 2Q6CA 3ITHA 5IT9Y 4LF7J 3EX7B 4O3NA 3EM1A 1S12A 3CJ4A 1BXNA 4FXVA 1WC4A 3SEOA 2RSQA 4Z2XA 4ZLNA 2XEXA 3D0HE 1YJTA 1Z2ZA 2NSBA 1D9FA 1CPZA 2ZOGA 3BV8A 4KO0A 1UJ5A 1X5TA 4ED6A 3TUJC 1IM6A 1B64A 4QZVB 3IAM9 2VDIA 4MKAA 1FXDA 2MHNA 3CCVS 3D6FB 4B9TA 4PQUA 1IR0A 4LBIA 4PG6A 1KTVA 1REVA 2HQ3A 1WORA 1K9MT 1ZPVA 2H48B 2K06A 1WD6A 4N5SA 4LRBA 2RRNA 3HD2A 1UMJA 4FNIA 1R27B 4L3KA 3L4BC 7AT1B 1RT1A 2QA4G 2LDYA 3SCLE 2W7PA 3K2YA 2I6WA 2NXEA 3KJNB 4RW6B 1RTDA 1VQPS 1FEEA 4DL0C 4EMDA 4PWDA 2YNFA 2E7VA 1Y10A 4FPIA 4OZ3A 5FDLA 2IJRA 2VPWB 2IVFB 1TKTA 2UZAA 4KV8A 1H72C 1RLCL 4JI0F 1R43A 2ZVIA 4X4TA 4DQSA 1Q8LA 2QE5A 2APOA 1Z1ZA 4HDGA 3I5CA 4ZPWR 3VAKA 3PV8A 4JI8F 3U02A 2DEJA 3VZHA 1B7YB 2W7OA 3HP6A 5KFQA 2QLFB 1T9VA 2Z2YB 1RE1B 1VBKA 4UTGA 1RU2A 2WBRA 5IQQA 1U1NA 1NMEB 1VLYA 2QMUB 3EGZA 3FBCA 3R5JB 2A1BA 2P2CB 1VRUB 3AY0A 3PKMA 1IXKA 2LXFA 3X1LB 4C9DA 1VQ7S 3OR2A 1H38A 4IRKA 1GMWD 1NM2A 2HQGA 2RILA 3E8OA 4ID8A 4KO0B 3HK2A 2DNNA 3CULA 3P4UB 1S7IA 3RYLA 4FKYA 1SVDA 1X5OA 4NLYA 4NXMJ 4NA1A 3CC4S 5U47A 1VK8A 2VPYB 4X4SA 2WSFC 2MSTA 3A3OB 3DOLB 3OUYB 5E7OB 1Q8KA 1JNZB 1JJ4A 3OVAA 4JYAJ 2DKOB 3GSIA 1MROB 3PEJA 2F4VF 1NDCA 3J80U 3T5LA 1X4EA 1SI9A 2B4PA 2MXYA 3KHGA 4O44A 3AT1B 4UUWA 2JC1A 5DG8A 4E98A 3G6YA 3W3SA 3R97A 3CJ0A 3DRSB 3PW7A 1NJYA 5IXUA 3LWLA 2ZH6A 1SH0A 4MFBB 5IT4A 3OTOF 5D0EA 2G4BA 1NCLA 1HBUA 4X65F 2F40A 5D3GB 4K4XA 3SBMA 1GMWA 2QIFA 2RQ4A 1L3UA 2ROEA 2F8HA 2XMVA 2ZBQA 4X4NA 1DQ8A 3HHLD 2Z56B 3KHLA 2J7KA 2LECA 4RBUA 2KZMA 2HGMA 4UQGA 4L72B 3R6LB 3JSYA 3UNGC 1UJ6A 3NAHA 3KNGA 3R5AA 4YB7A 3J81j 4CCHA 1SQEA 1VC6A 5DQIA 1TZ0A 3FSXA 3Q83A 4L76A 1T9YA 2JH3A 3TI0A 1C1BA 4F26A 4CDIA 4KSEB 2VPXB 2XLIA 1VHIA 5RUBA 2IA6A 5A6PA 4FZVA 2YWHA 3KDNA 4WTYA 1C0UA 1RWOB 2HBRB 2DISA 4GO5X 1FWPA 3POTA 3LO3A 1DJ0A 2N7CA 3QT7A 2ZJRQ 3DN9A 4B3OB 1FCAA 2EFOA 5D15A 1WDDA 1HR0F 2HS4A 2N4CA 3C16A 4OX7A 2MQPA 5L1LA 1X5PA 4CLSA 1IKWA 2UU9J 1IVZA 4MIWA 5I3PA 1MW7A 2J9DA 3HFKA 4B3TJ 1JJHA 3GFHA 5L1KA 4I0WA 2LLZA 1HNWJ 3IXQA 2AU0A 1T3NA 1NZAA 3VVTA 2R8JA 2HK3A 5CCLA 3AFGA 4OYBA 5AT1B 3H4DA 3PEHA 1PBUA 4ECSA 3LP2B 3UCUP 1ZETA 3LANA 4N7TA 2MLZA 2IM0A 3IR6B 4G1QA 4NX9A 3UN3A 5DGBA 3Q8SB 4GRSA 3WQPA 3I4PA 1TMMA 5LSOA 3VHQA 2H5JB 1HFEL 5H1SV 2FB0A 2IVMA 4RW4A 1FWLA 4TLRA 2E9ZA 1VIOA 1QAXA 4EYHB 4F0HA 3GFXA 1FK9B 3KK2B 3DU6A 5J2NB 2VG7A 4P10A 3MM7B 2H4YB 2KKHA 2YBVA 5KT6A 4X62J 1RTIA 2GZOA 3ETOA 1NHUA 3OFGA 4WIQA 3TUIC 3MM9A 4ICLA 1EETB 2LQ8A 3OXGA 3W5XA 3X3UA 4JI1F 1AT1B 4DUYF 4LMZA 4HEA9 1OS5A 3DFEA 4J9MA 2JLEA 4YEAA 4C98A 4C3LA 4ELTA 5JVGQ 1VDHA 2W2PP 4NZ6A 3OXFA 4Y2IA 2BKNA 3BSNA 4A8WA 1HI0P 3ENAA 3R7SB 1O51A 2C2OB 2HK2A 1YJRA 4KGZB 4USIA 4W92B 3V4IB 2ZUGA 5I3UA 3FJ2A 3C6UA 2NR0A 2DXFA 3TP2A 2XBPA 3KUEA 4DSIA 4WP9A 1X4BA 5J2QB 2WTFA 2EBEA 1F6TA 2F7VA 1YVFA 2BBEA 2DNOA 2M0GB 1VQMS 3OVBA 4Y2AA 4D3GA 3L7OA 2R2SA 3P96A 2ZH8A 4CLWA 2DRAA 4ECZA 1MMLA 3DLGA 4DV3J 1U25A 1BQNA 1DY3A 1KRPA 1NHKL 3AAWB 1CJUB 3MAQA 4M94A 2FVPA 1RAGB 2WRMA 3R27A 3DLLQ 4C3KA 4JI3F 1RT3A 2FZKB 2GHVC 1U02A 1RXOB 3MGJA 3T5KA 2FLNA 1FXLA 4Q5VA 5L1JA 4KC5A 4GKJJ 2G0JA 2XZDB 3LP0B 2RIJA 4YB1P 2W8LA 2EWHA 3HT0A 4FYVB 2UXDF 2QSWA 1RTHA 1VHFA 2GX8A 2AJFE 2O67A 3M32A 1S6OA 3JQMA 4TLQA 1BQXA 5DZ6A 5BYQA 4U95A 5C2GA 1S1VA 1M5OC 2MZQA 2L48A 2RDDA 2W4PA 3KLIA 3MMAA 4P9SA 5KG7A 2XY7A 1T05B 5J1NA 3MAAA 4JI6F 1PGZA 4F2SA 3R5CA 2QA2A 5KFWA 2CJAA 5KT7A 4LF9J 1WKJA 1SPBP 1T11A 4U8VA 4OYXA 2EFQA 4I56A 3GJRB 1JLFB 3K5PA 3G2XA 2OMLA 2OPSB 4WFYA 1LNQA 4V1Ak 2KT5A 4IH7A 5THWA 2OO4A 2E5IA 3GIKA 1DLOA 2CVIA 5KOWA 3MPVA 2P9EA 1FJGF 2HZCA 2HZVA 1SIZA 3PHTA 3BGRA 4GMKA 4ZJOA 3AOBA 2MQQA 2VICA 2XHWA 4I69A 2JZ5A 3T19A 2CQ4A 3UDEA 2Y1IA 1QAIA 1BQMB 4OHYA 1X4GA 3M6UA 1HNIB 2HQCA 1XERA 3GYXB 2VZ9A 2HS0A 4YY3J 3GV5B 1KFSA 2GO9A 2OD4A 2WZ1A 2VBZA 5CABA 1EB0A 4FNHA 5F8MA 1JLEB 3DRPA 3HLUA 5F41A 1B99A 4I4BA 4ZIWA 2MKHA 3ZFVA 1F2HA 3I31A 5H9FJ 2OPQA 1H7XA 2IAJB 3U27A 1N5YA 4ILMA 3W2WA 4UOFA 3RAXA 3M7VA 1EIYB 2L08A 5J1EB 2DR8A 3N28A 3GYNA 3H98A 1S9GA 3TYTA 4WFXA 2R2UA 3PIPQ 1OWXA 4M5HA 1FDBA 5KT5A 2A2CA 2I1RA 2UUTA 3CUNA 4MKVA 4LIRA 1UVKA 2WVBA 2P9GA 1TAQA 3D2WA 3KOAA 5HQLA 1D0EA 5JXSA 4NEZA 4OFZA 2MQNA 2EFVA 2E7XA 1U49A 4FBUA 2CG8A 4Z7CA 4QYZJ 2ZE2A 4K4TA 2E5LF 3DLEA 4FDFA 3PO4A 3F44A 2KHCA 1EZZB 3AB4B 1TKDA 2AJ1A 3M6VA 4NYZA 3U1MA 2UVVA 5C7PA 4KRWA 3PTWA 4FF1A 1IBLJ 1XBWA 2L41A 1RACB 3IM9A 1IBCB 4LJMA 5E3QA 3TJ8A 2CPJA 4DV6J 2ASJA 2V4JB 4OYAA 1VGYA 5DM6Q 1K47A 3AD7C 3CJ5A 3MEEA 1YJNS 2OP5A 4NLRA 2KB2A 1Y7PA 5HLFA 2X1AA 2FIUA 5L9XA 4H4MA 5G0RB 1HWJA 3BREA 1NJZA 1RCOB 1VC0A 4LRFA 5GAGU 4UOGA 2ACMA 3BQ2A 3JYTB 4LIWA 3BSOA 2J7WA 2R9LA 4LR7A 5L38A 3P45B 3W1YC 3I0SB 4YOEA 2NPFA 5LMUJ 2HHPA 3GE9A 3KK3A 1P9YA 2DCLA 3J80Y 4F8RA 1SL2A 1SUQA 1WC1A 3HI9A 2W8KA 3PW4A 3KLEA 1B0TA 3LUYA 4WZMA 3KUHA 4R5PB 3PNIA 2DNZA 2W2NP 3IS9A 3K59A 3CIZA 2NPIA 4I6YA 3KK1A 3CMAS 1B70B 3HHEA 4KAIA 3LGMA 2CJ9A 3DGPA 3Q8VA 1CJTA 4YHHJ 4YR3A 2E1AA 4XDCA 2QYCA 4DX5A 4QW8A 3GR0A 5F3TA 3S6EA 1IBMJ 1CS4A 4XAKA 2N3OA 4QR2A 3VR1A 1WI8A 2NLWA 4PG7A 4DPUA 4EUVA 1RKJA 1Q7YT 3BSCA 2VQFJ 2QMWA 1LFWA 4NOHA 1PJ5A 1FRXA 1DURA 3FCWA 5DG7A 2IJNA 3NS6A 3L95X 4RL1A 4I7FB 3NNHA 4ZHRA 4DI6A 3PZPA 4OI0A 1SC1B 2NXNA 3RGIA 1J5OA 4OZ1A 4ZVSB 5F8IA 2LQJA 3KLHB 4IRDA 3SFUA 2FJXA 2UXCF 3GFZA 2A2DA 5A6WA 1FKOB 1F3FA 3BGLA 2ZDOA 3L9ZA 3W2VA 2J0XA 1YRXA 1GEHA 3CSKA 5J2MB 4JUZA 2DY1A 2EG2A 4ALZA 3GG1A 2BV3A 4OJHA 3HFZB 1F9FA 2PO4A 3HT3A 3C14A 1RTJB 4M5GA 5KFZA 1SV5B 2Z57B 3FVYA 4BC7A 5K8OA 2E1PA 4RNMA 4DQRA 2CNKB 3CC7S 3HFVA 2MLYA 3PFOA 4S0MA 2ZH3A 3RTVA 4JI5J 1S0VA 2E7WA 4NZ7A 4OLPA 1MU2B 2OPPB 3CDWA 4K4UA 1TUVA 3D6HB 2KT3A 3SFGA 4ED7A 2F8MA 4ZMMA 2NYHA 4DR6J 3VGSA 3CE8A 4CLFA 4AFFA 2LXUA 1U1PA 3J7Z5 4DUTA 3KMSA 4B9LA 1N32F 1F5AA 2AD9A 2GFFA 4LSNA 2PMZD 3GIIA 2W9AA 3HPOA 4NCGB 4QWAA 4QWBA 2F8EX 2FHOB 3R5DA 4DV1F 3SI8A 2BM0A 1KHWA 3AJ1A 3HSJA 3M05A 1X4HA 5T7LB 2R7UA 4JB8B 5T7LA 5MLCV 1RAEB 3TZXA 2CJXB 2OSQA 1YG0A 4BS2A 4QR0A 4DQQA 3D28A 5C24B 1XEZA 1S5ZA 1Q53A 3M2VB 3VV2B 5IQ6A 1NDPA 1WUUA 1YJWS 3K8VA 1S6UA 3BGFA 1YK9A 2ZD1B 1RJJA 3K89A 4F04B 1QSYA 4NCAA 1URNA 4JI7F 1IKXB 1CULB 5ETOA 3M8PA 3C2PA 4HTIA 5F0WA 2HVHA 2CJBA 1LK5A 2MZRA 3D0IE 5ETQA 5EX0A 4ZVQB 4HT7A 5AXLA 5IFMA 1UWBA 2MEWA 3GP9A 4OZLA 5AXNA 2HYIB 3GJQB 2IC3B 5A76A 2JFDA 4PXCA 2NXJA 2GJFA 3I9V9 1RTJA 4U8YA 3W5ZA 4U7UD 5E3CA 1WOSA 3EE3A 4TY8A 2VONA 3E51A 2D1CA 2J76E 4JV5J 1N0VC 2J0WA 5L9NA 3ULHA 3W2VB 1YZ6A 4WYWA 2C3YA 1N5TA 3D1HA 4ENOA 2VFSA 4DX8H 4Q44A 4HHUA 5DM7Q 4ZJQA 2ZH9A 4WXWA 4F25A 3CCLS 2H3EB 4QYZK 4CTAB 2DB1A 1Q95G 2HNDA 3L7PA 3GV7B 2DNMA 5F8JA 3TEHB 3J7YI 3MEDB 5KT2A 3JTOA 5KG6A 1RAAB 3M30A 3NGSA 4PPZA 3ENVA 2R7WA 3CCMS 2BZ2A 1QAJA 1ZAVA 3MM8B 3OR1A 1AROP 1H2UX 4DL3A 1PJ7A 4FN5A 3PDNA 1T7PA 3G9CA 3R5BA 3CCES 1WNEA 3HKWA 4B9VA 4KJIA 3QQCD 1WG5A 3RB4A 1XNQJ 4OHWA 1URRA 1RT2B 3GTYX 3QLHA 4P71A 1DQ9A 4WE1B 2JNJA 2XYHB 3ZZYA 4ZPBA 1LEOA 1Y5IB 5HQ8A 4Q45A 1SJRA 3BBFA 3D66A 1VS3A 2MJUA 2BJ1A 2VC0A 5I3QA 4DUZJ 3JXOA 3TQ1A 1U1LA 4EZ6A 1H0HB 4KHPF 1DTQB 2HPUA 3Q2SC 3T3FA 3ISNC 3P8BB 2VFUA 4RUHA 3JS9A 3MM8A 2WVCA 3OR1B 3J81Y 2DBBA 1JLCB 2BMBA 4Z37A 1XR6A 5KFOA 2F4VJ 4V19J 1NSPA 2IYIA 2FYXA 1PILA 1KKHA 3BPSP 2ALYB 4RX6A 5IV4A 1C0TB 2O3DA 3IGVA 3GCWP 4MT1A 4DCPB 5CXTA 4O3QA 3C14B 4ERDA 2Q1LA 2VU5A 3UDCA 2BABA 3IM8A 2CPXA 3Q86A 4IOBA 4NWBA 5EX3A 4CO0A 3JTPA 4EI2A 4ED0A 3DDKA 2DTJA 4MTPA 2W9CB 3C46A 4R0EA 1S97A 4O3RA 4DF8A 3ET6B 4WK1A 1FERA 4TQSA 4NI2B 4M5LA 4A8OA 2HRYA 3KLHA 2AWZA 1OQ3A 2DNKA 3CJSA 4V19X 1SKSA 2IM3A 1KWMA 5JVHQ 1BWEA 1OO0B 3B4MA 1AFJA 2H5EA 5LJ3Y 1OY9A 2IC3A 1WC0A 3DI6A 3G96A 1UEVA 1WTFA 4A8XA 4YN3B 2KM8C 4I6AA 1HHSA 1I5OB 1TMJA 2RU9A 3BN4A 2MQ8A 3MMCA 4DR5J 1IKVA 3M8PB 3RR8A 1RGVA 1WG4A 4XO0A 4IG3B 4WIIA 1XNQF 3NGRA 3TJ9A 1IQZA 5I4MA 1JLGB 4PAAA 5KFVA 3PRDA 2QLBB 1W2BR 3WX8A 5C24A 4O4RA 3H40A 4DEZA 1WF0A 1IWGA 1NUEA 5AE1A 1MWQA 1ZM3A 1NK9A 5CYMA 2ZNZA 3EGWB 4X2BA 2GHWA 1KFDA 2AT1B 3FEYB 3WX4A 1LQ9A 3KLEB 2OUGA 4ZVTB 3CMES 2GMLA 2XMTA 1KDNA 2OPQB 4DBQA 3JAMY 1G4CA 2BRKA 3G6VA 2RKIB 2C3PA 2WSCC 4PG5A 4WP8A 3OL6A 3MD3A 1T3OA 4DPYA 4LBPA 2R8GA 1VQ4S 3NLCA 1TR0A 1S79A 1U24A 3H42A 4GC7A 2R4FA 4OYWA 3RRGA 2ROPA 1HHQA 2YPYA 2F1FA 2RRBA 3CCTA 4M5DA 4FXDA 4WFNQ 4MK7A 2M8HA 4YB6A 1UVIA 3SCJE 2XMMA 5EHHA 1BQMA 4EEYA 4USKA 4H4MB 5G0RA 4YQWA 2IHR1 2RE1A 3SIPB 2AQ4A 5K8NA 1RWPB 2V2QA 3BS9A 2LVWA 4C3MA 1F1BB 1RA6A 1L3KA 1REGX 4CYUA 4TQRA 3O5TB 4LQ9A 3G4SS 4CLUA 2VFRA 3H2VE 3T5JA 2DD8S 1X7VA 4PZVA 1GFWB 3CJ2A 3OL8A 2PMWA 1GX5A 4HVZA 1VI7A 3DM2A 4XPCA 1M5PC 1M0SA 2MKJA 3UDLA 3K0JA 2HHWA 2HRUA 2MGZA 4CLLA 1LW0B 4OLOA 1EARA 1WWHA 2EFNA 5DGAA 3UR0A 1Q78A 2WOMA 2CQ3A 1FRMA 1H73A 2IRUA 3DGVA 2PA8D 1NU4A 5HK4A 5LT5A 4I7FA 5IS2A 1OPIA 1SXLA 1D3WA 2XSJA 3IGNA 2NCKL 4FF3A 4GKJF 2J8SA 1HW9A 4HTJA 5E3AA 3OTCA 5H9EJ 2I8EA 2X1BA 5IC4B 1N33F 3N9UC 2MKCA 3PRVA 3Q8UA 4NLWA 1N5SA 1PSDA 2HBQB 1S9GB 3MM5B 4WK3A 3GWCA 3ZZ0A 2BW2A 4N41A 1OY6A 1GNKA 3HHKA 5HBMB 3P3DA 1LKZA 1BQNB 1FJEB 1HNVB 1H2TZ 4NXMF 1W25A 4HDHA 2M88A 3FQLA 2V5HG 4LBHA 3CCQS 1CQMA 1H6KX 3BKUA 3US5A 2A6MA 3Q23A 2XI3A 3KK1B 2ZJPQ 1TL3B 3MTKA 3BSAA 4LT6A 2DPJA 1HARA 2RF2B 3PKYA 4Y2KA 3C6UB 2XMWA 4TNOA 2J9EA 4CH7A 4WFBQ 1GMUA 1OYDA 2OTLS 1RAOA 2GO8A 1GK8A 4O4GB 5HANA 4K4WA 1AXQA 3DU5A 2QL9B 3E3XA 2HHSA 2M70A 3ETMA 5AE2A 5D4NA 1U47A 3ILLA 3AXKA 5KFRA 4KH1B 2M3DA 1UEUA 2V4QA 4DSEA 5AJ3J 2MTLA 4OI4A 4FYDA 2BKPA 1Y5LB 3IBWA 4ZVUB 3PFEA 1EETA 1WELA 3BR8A 4TU9A 2HWHA 4RW7A 1VBZA 1KS2A 1PCAA 3H5SA 3DLHA 4NXNJ 2CQPA 4NCBA 5HMYA 4CO5A 3W7BA 1L3TA 2NUUG 2P6SA 4RBTA 2DVIA 1D9AA 2BM1A 5F0UA 3FUYA 4F3QA 1RBLA 2DR6A 3M6WA 4FP9A 3GILA 1UW4A 1BGXT 4F36A 5E41A 3VGVA 2GQQA 1NPRA 2YWEA 1UJ4A 4J9NA 1D1UA 3UN2A 4X4RA 2OAUA 2DO4A 4OX9J 1MSWD 1NK4A 5KG1A 4IQMA 1RAJA 5B0CA 1J5EF 2ZDPA 5HQMA 5CYMB 2VFTA 2H4WB 4AXIA 3KWMA 4ZCIA 5HL7Q 2MYFA 5C25A 1GH8A 4FXWA 1JXLA 2AJ4A 1TL1B 2V8HA 3TNVA 4X65J 3BB5A 3VWSA 3MTJA 1A7GE 2LEPA 3ZZZA 3QMQA 4NLPA 1S1UB 3LP1A 4DWIA 5IT9U 1PIEA 3M2UB 4LFAJ 2J9DE 2EI5A 2W24A 1WHVA 3CD6S 3WDOA 4ELUA 2LA6A 2DK2A 4F4AA 1YDLA 2BW7A 5KTQA 4DUZF 4DV7J 4JI2F 3B8HA 4KKOB 3NP5A 3M8WA 2GIFA 4OI6A 3PIOQ 1S6QB 2ZOFA 3V2UC 2HHQA 2CPDA 4B3RF 2Y3YA 2ZBIA 3GB0A 1FNOA 3DDNA 3T41A 2DGTA 1TP7A 3V4MA 2QYGA 3DLKB 1YBTA 4TN2A 3I32A 4YB5A 4WJBA 3W61A 1KLNA 1GTHA 1TQLA 3JTNA 4USJC 3ICLA 3ET6A 4RO0A 3BYRA 4CNYA 2CDQA 4LF8F 4ECXA 4GKKF 2H65B 3MM9B 1WDTA 2W9CA 4DZDA 3C19A 4QYRA 3QWUA 2V63A 2MZSA 5IZHA 4RUCA 2KM8B 2KT2A 4PXDA 2FHJD 2ZNYA 4ILRA 4RU9A 3LPYA 3FSIA 2E9TA 4FF4A 1NO8A 3GMGA 2GCFA 3NCPA 4DXLA 1TK0A 1UZDA 1JMTA 5B0DA 2UUBJ 5HVGA 3I55S 3ZTQA 4B3TF 1JLFA 5H9EK 2CZ4A 2E5GA 3S1TA 3IWXA 1KR4A 1VYAA 3PX6A 1PG5B 1U2CA 1GMVA 3VAFA 2OLWA 1U6ZA 4D3HA 1YJUA 2QG9B 1UPPA 1SKRA 3LA0A 2CNNB 3N4WA 1UVNA 2UXBJ 4Q0BB 1XTZA 1WTBA 3QAEA 2LXIA 3CJ3A 1K1SA 5ETMA 3M32B 4FYXB 3ENQA 3NS7B 4K0KJ 2OIHA 5H9FK 3EVOA 2XO7A 5IT0A 1MROA 1FVSA 3VAIA 1WEXA 2GJIA 3NY0A 2P5VA 3QLHB 4WXOA 3VAMA 3SDEB 2MZJA 3H2UB 4JBCA 1FE0A 2DY9A 2M9KA 1LXJA 2C3OA 2YNHA 4K2JA 4MMOA 1R0AA 1N8RT 1U1OA 1UWAA 3D3CJ 3D7SB 1CJKA 2RDJA 4USWA 2ZBCA 4ZVGA 1NKCA 1XJWB 1B0VA 5KFCA 1KSPA 1ZYQA 3W9JA 2WHOA 5DZ7A 2QJ3A 5A8RB 2QL5B 1RWKB 1HBMA 1M1GA 2YQ0A 3DOKB 4OL8A 5HVHA 1C4AA 3FSYA 3N5FA 2B9EA 3VALA 1I1GA 4K50A 1UVLA 2N7YA 3KLFB 5MAOA 3RZAA 3HDSA 3V4IA 4ZPCA 1WACA 4IH6A 5DJBA 3G6ES 2FLLA 3SQOP 3R2CJ 1NBEB 5KFFA 1TU0B 1FD2A 2HBYB 2KRRA 2M5YA 3D54A 2GQ2A 1X9WA 1WF1A 4ZOSA 1UA1A 3NGTA 5A0YA 1R6YA 1S49A 2DNYA 2RUGA 1VOMA 3D6MB 2AP6A 4M8LA 3RG6A 1P8GA 5BYSA 4ES2A 4ICLB 5DDOC 3Q8RB 3EPIA 3VQSA 2MY7A 3W66A 3V6JA 1JLBB 2AJQA 4PABA 2F3JA 5LSLA 4K59A 4DFKA 3P49B 1AFIA 1IUJA 3I0RA 3LGNA 3EXCX 4ZLPA 3CCSS 2W2QP 3PHEA 3AJDA 2OPRB 4YP3A 4O44B 3R9LA 1Y3JA 3M2VA 1REVB 4Y3CA 2XWXA 4ZVHA 1NKBA 2BJ9A 4BC9A 2VOOA 2NZ4A 2LP4A 3D68A 4I64A 3MUVP 3OW2R 4J91A 4CNZA 3GG0A 3GLJA 3O3LA 1KD1T 4B9SA 2QA4S 3QATA 4K4ZA 5G4DA 2M4MA 1M90T 2CAJA 4JI6J 2CUYA 1ZA2B 2AKWB 2Z0GA 3MFHA 4IFVB 1TUGB 1SKWA 4JI5F 1UA0A 4ED4A 1YRTA 1YHQS 3CEDA 3VGTA 1BMQB 2ZZNA 4AL5A 3T9ZA 4DQIA 3D5MA 3HVTB 2FJDB 1IR1A 3HZEA 3UDVA 3ONQA 4OI2A 4USMA 2YTCA 3ADAC 1MU2A 1YSJA 2OPPA 1HD1A 2RJZA 4KH0B 4L73A 2COLA 2YNGB 3MECA 4OJ3A 4OZ0A 4C0OC 1XK8A 2D69A 4NRTA 1K1QA 1O0PA 1SV5A 3D6TB 1Q1KA 3HKZD 1WSRA 2W25A 4OYIA 5A8WB 4FS1A 3C8YA 2WCXA 5BR8F 5A2QU 2FGOA 2GC8A 2H51B 3A3NB 4F02A 4L6V3 2BX6A 3FNNA 1X31C 3WBZA 9RUBA 1EKSA 3MDFA 4KV8B 2VQEF 4DCOB 4F50A 5J2MA 4NZ0A 5E3RA 1YI2S 2YNFB 3DYAA 1LK7A 1M5KC 3R2DJ 4HACA 4P2MA 1U0SA 3OFEA 1R8PA 4PQAA 2I5JA 3AHPA 1C1CB 2JLGA 2RS2A 3RU0A 5L46A 1TKXB 2AIRB 2JLFA 2BJ7A 2P8IA 2UV8A 3EJMA 3G82A 4ZP8A 4DV0F 3CJTA 4PWUA 2D3O1 4Y65A 1DFDA 4I6WA 3D9BA 3L7UA 4NLSA 2L9DA 1ZM2A 3RW7A 3TAPA 2EK6A 1IM4A 1RWXB 5KT4A 2LDIA 2YX1A 4EO8A 1NK8A 1NB7A 4PQUB 1Z4UA 2QO3A 1LV5A 2R7OA 4CLZA 2HFNA 5CZVA 3T1YF 2C2DA 1R8BA 3GZ7A 4UY8T 1I94F 4Y6IA 3MR5A 1XNRF 3TAMA 3T1HF 3MOZA 2CXEA 4C8MA 4CLTA 1U0HA 1ZBTA 1FESA 1N5QA 3AQPA 2HVDA 2YH1A 1CJTB 1FDAA 1PO6A 4RKUC 1S1XB 2XI2A 1JJ2R 4OYOA 2QTWA 2EBGA 3O2IA 3SV3A 1F9EB 1U8SA 4CO2A 1QSSA 1ZS6A 3A12A 2FVRA 2R7XA 3EMTA 1TFYA 2R7VA 1V3RA 1GQEA 2C22A 5E33A 1YJ9S 3HXMA 2ZJQQ 3SYZA 1SC4B 2PI5A 3BBCA 2B9XA 4X64F 1IR2A 2Z2LA 5J2PB 3MM6B 2MSSA 4DG1B 1SJ3P 1RT5B 4WYLA 3P6YC 2XS2A 1QVGR 1EKRA 2VBYA 4RW9B 1JX4A 4C48A 1JKHB 2HNZA 4NEYA 1VRUA 2G1DA 2GJ2A 3BR9A 2WSEC 2VQFF 3JAMU 3CVKA 4NE9C 3CDEA 2QLXA 1VRTA 2M7SA 4NPOA 1RWVB 4CLPA 1AW0A 5KAKA 2YKNB 3CDBA 3MURP 2V4RA 2Y1RI 4R25A 3MR7A 3BQ0A 1S9EB 3UVJA 2HIQA 2OELA 3FK4A 2AEFA 1IWAA 4KGMA 1FDDA 1AB8A 2F9DA 4F4XA 1K8AT 2LCWA 4J9SA 2C2RA 2DGSA 3H4BA 5LMNJ 4AE5A 3OD2A 1TKXA 4DV7F 3KG1A 2HLUA 2RVJA 2IDLA 1SL0A 3HHLA 1ELOA 3LALA 2EPIA 1CC7A 2RU3A 3C15A 2IDEA 3MCSA 4HACB 4YMEA 1HWIA 2W2OP 2JJ4D 3OJUA 1S59A 3JB9k 1Q81T 2ZEJA 4RW6A 2LEAA 3W8PA 2O01C 5HO4A 2G2ZA 1Y00A 2B8QA 1J2VA 4FPRA 2V94A 4FYYB 1TTHB 4A4JA 5M2PA 4ECRA 1F5BA 2BANB 2VIHA 2JVOA 1VLOA 3CPWR 2VL1A 1GXLA 3DC2A 1S1WA 3H25A 2CWKA 1NRKA 1T9XA 1V9OA 2ZZTA 3AOAA 5D0RA 2UXDJ 2XG8A 3EYZA 2PI4A 5D77A 4L74A 4P52A 2FZCB 2FQQB 2W7AA 5KG4A 2NXCA 4ED1A 1N36J 4K5SA 4DR6F 5FJ4A 2YKAA 1C2PA 2MKKA 3HVTA 1SIWB 2R2RA 4DV2J 4FVMA 2K2PA 3ZO7A 3HO1A 1NNDA 4C8YA 1X0FA 2DR7A 5KFNA 3TAQA 2AX0A 1HYSA 3IP0A 4J37A 2EK1A 2ASDA 2IBKA 3D4JA 3RRKA 4UY85 3SSQA 1G2EA 2HS3A 3M2RA 4OZ5A 4CLKA 2JHEA 2J6UA 3DRRB 3KXDA 5ETLA 3S8SA 3EZOA 3MHYA 3PYGA 3F56A 5CQGA 3TZZA 1WEZA 4NLXA 2CKWA 4E2FB 4J9OA 2HMIA 3QRRA 2UXBF 3BN7A 1IKYA 3A1YG 2I9SA 3W60A 4JYAF 1MLAA 2YNIB 3TW0A 3H7HB 1HNIA 1UKUA 2Z2MA 5ETTA 1FKPB 3PY8A 4G6VB 3JSMB 4DL7A 2X3GA 1XMQJ 2HHUA 2PMHA 2OPRA 4PG4A 1FWKA 4H4KA 1R7IA 1B0PA 3MPUB 3NOCA 4PCQA 4PXBA 1FNMA 3CIMA 3V81B 1UFWA 2C1EB 3FKBA 3K17A 2F5GA 2C2KB 3I0RB 1HMVB 5CA5A 4ED5A 3BEGB 4DL5A 4ILLA 4OX8A 2MDAA 2MZ1A 3HD1A 3PYDA 4KIAA 3MAHA 5K5MA 2F4FA 3RBXA 4CP5A 2BDPA 4QCLA 2IY5B 2VDHA 5GAHI 2Z4PA 2DNLA 3BO3A 3DMJA 2IMWP 2CQBA 3AOCA 4EBDA 1TAUA 1W26A 4ED8A 1O6XA 1RBAA 2MQLA 3G6XA 4J9PA 2GIQA 3T9NA 4ID5A 3QIPB 4DR1J 4O3OA 1HBNA 5GADU 2D3OR 1WHWA 5B7WA 1HBOA 1FX2A 2A0FB 4PG8A 5I42B 2YH0A 3LP0A 5KG0A 2EW9A 3GR1A 3MR3A 3Q22A 3BO2A 3OSPA 3TUPA 3KLFA 4ER8A 3K8WA 1FKAF 1KBRA 4IYQA 3QBCA 4ETZA 2Y8YA 3GCXP 5LOQA 1NAQA 5LSRA 6FDRA 2DJWA 4Z7YA 4G3IA 2RQMA 3HSGA 4ZPAA 2ADCA 2DGWA 1NXIA 1WHYA 1JLAB 1BY9A 3CTRA 3DRYA 5A8RA 4CM2A 7FD1A 4YR0A 2KG0A 3A3PB 2GAGC 1HI8A 3MPDA 3SQGA 3THVA 1ZZFA 4DZ6A 1FRLA 5KFGA 3RBEA 2AYEA 4HI2A 5K14A 3TA1A 4DV6F 1U48A 4NXNF 2C3UA 3LTOA 3QT6A 4RW8A 4ZIVA 1ZTTA 1VR6A 3ZZOA 1EJ7L 3UQSA 2CNLB 2AZ3A 2UUBF 2NQPA 2LQ9A 3MFIA 2XMKA 2Z2ZA 2YX7A 4A46A 4DPTA 4QIWD 4ES3A 4ZVFA 3WC0A 4A8YA 1S0NA 4HKQA 4PUOB 2FJAB 2OKQA 3LAKA 2QZ8A 1X5SA 2FUG9 3UWTA 2MMYA 2JEIA 3AB2B 2OI2A 2ATCB 3PRBA 1D09B 4ZCKA 3OVSA 5KFHA 4M95A 4B3MF 1SQFA 2PSZA 5HP1A 1RADB 4X4OA 3M9OB 4ZK7M 1S57A 1R89A 4I67A 2HFVA 1FVQA 1YTYA 2J0QD 3BH6B 2E1MC 3AD8C 5E0OA 5T41A 4AXJA 4X62F 1R8HA 2R7RA 2HIYA 2YPZA 5HSPA 1RHMB 1R31A 2ASLA 5JMNA 1S6PA 2R8KA 2V0NA 2VBXA 1CJVB 2B7CB 3MWBA 4QIFA 2BACA 3EGNA 1U8WA 1OJ4A 1WKKA 1RWWB 3FFIA 3KJVA 1T03A 4QR1A 3UN5A 3N0VA 2D3ZA 3QSIA 5GVQA 2EC0A 2ZZMA 1P9QC 4G1PA 3M8RA 5HP1B 1RK8A 3J7AN 3I56S 2G2YA 4ANEA 4ZKAA 3HMJG 4IDKB 2PE8A 4DPXA 1HYSB 1XNRJ 1FRKA 1RTZA 4UW2A 1VQSA 2BQ3A 2V2ZA 1QVFR 2AF6A 1NPKA 3D1QA 3ZC4A 1BWVA 3OTBA 3M1VA 3NRBA 4RW8B 1SJ4P 3MOJB 2H1YA 2I38A 3UPFA 5K14B 2A10A 4U6PA 2KL8A 3M1VB 3SQGB 3GONA 4DV3F 3I6PA 4E0DA 1UVMA 3SXLA 1S1UA 1WSVA 3LP1B 4KGXB 4C8LA 4M5JA 4X66F 1R0BG 3PW2A 1T94A 1QM9A 1HWLA 4U96A 2PDAA 1RHKB 1X4FA 3PYEA 2FPHX
chains in the Genus database with same CATH topology
3SIPB 1RWPB 1RHUB 2QLFB 2XZTB 1RE1B 1RHJB 2H65B 2H51B 1RHQB 1NMEB 3KJQB 3R7SB 2XYPB 3R5JB 1RWMB 2C2OB 2P2CB 4DCOB 3P45B 2C1EB 2C2KB 1GFWB 2Y0BB 3P4UB 2HBZB 2XYGB 3IBCB 1RWXB 2CNNB 2DKOB 5IC4B 3NS7B 1I3OB 1ICEB 1QDUB 2HBQB 2XYHB 2CDRB 2XZDB 5IC6B 1SC3B 2H54B 1F9EB 1PAUB 1I51B 1SC1B 1QTNB 4ZVRB 2H5IB 2QL5B 1RWKB 4ZVSB 3R6LB 1SC4B 3GJRB 4DCPB 2QL9B 2C2ZB 3QNWB 2CNLB 2C2MB 3GJSB 4ZVOB 3R7NB 3GJTB 3RJMB 3EDQB 1RWVB 2QL7B 1RWOB 2HBRB 4ZVUB 2HBYB 2CNKB 3D6MB 3D6HB 1RWNB 3EDRB 4ZVPB 2QLJB 3R6GB 3KJFB 1RHMB 1PYOB 3R7BB 2H4WB 1RWWB 2QLBB 3D6FB 4JB8B 2CJXB 2H48B 1RHRB 2CNOB 2H5JB 2FQQB 4ZVTB 2Y1LB 3IBFB 2CJYB 4DCJB 3KJNB 1BMQB 2H4YB 4ZVQB 5K20B 1IBCB 3GJQB 1RHKB 4LSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIP B;  1RWP B;  1RHU B;  2QLF B;  2XZT B;  1RE1 B;  1RHJ B;  2H65 B;  2H51 B;  1RHQ B;  1NME B;  3KJQ B;  3R7S B;  2XYP B;  3R5J B;  1RWM B;  2C2O B;  2P2C B;  4DCO B;  3P45 B;  2C1E B;  2C2K B;  1GFW B;  2Y0B B;  3P4U B;  2HBZ B;  2XYG B;  3IBC B;  1RWX B;  2CNN B;  2DKO B;  5IC4 B;  3NS7 B;  1I3O B;  1ICE B;  1QDU B;  2HBQ B;  2XYH B;  2CDR B;  2XZD B;  5IC6 B;  1SC3 B;  2H54 B;  1F9E B;  1PAU B;  1I51 B;  1SC1 B;  1QTN B;  4ZVR B;  2H5I B;  2QL5 B;  1RWK B;  4ZVS B;  3R6L B;  1SC4 B;  3GJR B;  4DCP B;  2QL9 B;  2C2Z B;  3QNW B;  2CNL B;  2C2M B;  3GJS B;  4ZVO B;  3R7N B;  3GJT B;  3RJM B;  3EDQ B;  1RWV B;  2QL7 B;  1RWO B;  2HBR B;  4ZVU B;  2HBY B;  2CNK B;  3D6M B;  3D6H B;  1RWN B;  3EDR B;  4ZVP B;  2QLJ B;  3R6G B;  3KJF B;  1RHM B;  1PYO B;  3R7B B;  2H4W B;  1RWW B;  2QLB B;  3D6F B;  4JB8 B;  2CJX B;  2H48 B;  1RHR B;  2CNO B;  2H5J B;  2FQQ B;  4ZVT B;  2Y1L B;  3IBF B;  2CJY B;  4DCJ B;  3KJN B;  1BMQ B;  2H4Y B;  4ZVQ B;  5K20 B;  1IBC B;  3GJQ B;  1RHK B;  4LSZ B; 
#chains in the Genus database with same CATH topology
 2PEB A;  4RNF A;  4K8R A;  5ADZ A;  2FTR A;  1F5C A;  4B3O A;  5HRO B;  2AYM A;  1C0U B;  3BDE A;  4GVB A;  1KHV A;  4PXE A;  5LXY A;  3OFH A;  2VJU A;  4B9M A;  2AEJ A;  5KFM A;  2LMI A;  2RS8 A;  3W63 A;  3SCK E;  1TL4 A;  3IRX B;  3ZTR A;  4ZVE A;  5B0F A;  3I4H X;  2Z58 B;  2KFY A;  4GKK J;  1X9S A;  4IFY A;  3HVR A;  1RU1 A;  2AYG A;  2FLP A;  2Q66 A;  4R8U B;  3GIR A;  2FJV A;  3Q89 A;  3IFE A;  1OMS A;  2KFZ A;  1G6B A;  4F7V A;  3V6H A;  2IA0 A;  1CC8 A;  2BEF A;  1RAI B;  3NGD A;  4NRU A;  1RP5 A;  4CO1 A;  4YR2 A;  2DNR A;  3Q2T C;  1NSK L;  3TX8 A;  1XN9 A;  5KOX A;  4JI4 F;  1GXU A;  3LOU A;  3A8J A;  1VRT B;  2AV5 A;  2GW8 A;  2DGO A;  2LU2 A;  3DNC A;  4KR0 B;  5CZX A;  2VJV A;  4KY3 A;  1Q8B A;  4MFB A;  1FJG J;  2O5D A;  3UD5 A;  4DR4 J;  3DRS A;  4HR2 A;  4EFA C;  1R8A A;  2CDR B;  5GAE I;  4DOZ A;  4CWB A;  1PYT A;  1D9D A;  2BE9 B;  5D0G A;  3KNA A;  1X4A A;  2YKP A;  4J7C A;  4DX6 A;  3KKF A;  3V6D B;  2YY3 A;  4QOT A;  3S01 A;  2UUA J;  4Q8F A;  2R2T A;  2RQK A;  1DHM A;  4X4Q A;  2R7T A;  1VQ5 S;  2VA2 A;  3EIC A;  3BYP A;  4K7Q A;  4KB7 A;  1TL3 A;  3I9Z A;  3H20 A;  1HIY A;  2PEH A;  1N36 F;  1UW9 A;  3DRR A;  2GMJ A;  1QTN B;  2EFP A;  3DRX A;  1S1X A;  5L39 A;  2CG4 A;  4LR9 A;  4OV6 A;  1RYS A;  4LF4 F;  4NLD A;  4RLE A;  2AGO A;  2IRX A;  1HNV A;  4NYO A;  1EP4 B;  2OMO A;  3HHN B;  1U0H B;  1JLA A;  4WFA Q;  1RAF B;  3RB0 A;  1NPP A;  1YIJ S;  1T9W A;  3FBB A;  2QA1 A;  3PVX A;  1ZAW A;  1SB6 A;  1F0X A;  2HVZ A;  3IG1 B;  2IBO A;  2RHQ B;  3EXY A;  1BE4 A;  1WC3 A;  3I5A A;  4C2M A;  4HL9 A;  3AXM A;  2ZH5 A;  2F65 A;  3O8W A;  3PO5 A;  3DKD A;  3L3C A;  1VIX A;  5JUM A;  1MWZ A;  1ZA1 B;  2RT3 A;  3HJV A;  3DHW C;  5D4O A;  1NH7 A;  4C0H A;  5KT3 A;  3NMA A;  2JRS A;  2KN4 A;  2EC2 A;  5EWG A;  4DSL A;  3GFY A;  1N88 A;  3NWG A;  4A8M P;  4AL7 A;  2JWN A;  2V69 A;  1RWU A;  4FBT A;  5ITH A;  3C15 B;  5CHC B;  4HYK A;  4B9N A;  3HHL B;  3FGV A;  1AZS A;  2IYG A;  2OEM A;  4EK2 A;  1S4E A;  1HA1 A;  2KVI A;  4HLB A;  3THP A;  2N82 B;  4B17 A;  2QFJ A;  3GIM A;  4DUY J;  5D78 A;  2KTQ A;  2DHX A;  3OL7 A;  3R7B B;  1X60 A;  5HI7 A;  1S9E A;  1G3O A;  3UVJ B;  3HSZ A;  3OV7 A;  1U2R A;  3J7Z T;  3VZI A;  1VQY A;  3N6N A;  1QAY A;  2KVQ E;  1W7W A;  3LF0 A;  3ZZP A;  2YXL A;  2VOP A;  2CPE A;  1Q5Y A;  3H90 A;  2JC0 A;  3CGI A;  1EHW A;  2W4D A;  4NLG A;  2EKY A;  2EKN A;  1HR0 J;  2DHS A;  2VF3 A;  2DEI A;  2GS8 A;  4DG1 A;  2ZOM A;  2G0I A;  3M2R B;  3MM6 A;  2DIV A;  3B82 A;  3FZB A;  4IFV A;  4ECQ A;  4OJG A;  2E44 A;  2JSX A;  3CNQ P;  3K57 A;  4EZ9 A;  3OBI A;  3R3T A;  5K20 B;  4WKR A;  3FDS A;  5IV3 A;  4QU6 A;  1VQL S;  1GT8 A;  4QQB A;  4IO9 Q;  1IN0 A;  5HAO A;  2PT0 A;  5IM0 B;  2XQC A;  3KLG B;  4IR9 A;  4IRC A;  3NBP B;  1UVJ A;  2JDJ A;  4P2X A;  3CO9 A;  1V6H A;  2BE2 A;  2C28 A;  4LSZ B;  3MEK A;  1DTT A;  1KQS R;  2DR9 A;  4IG0 A;  4CIO A;  1LW2 B;  2G0C A;  4NLT A;  4AYB D;  1EAY C;  4I2P A;  4KGK A;  4PYA A;  5KG3 A;  5GAD I;  1H74 A;  2LKZ A;  4FS2 A;  3J81 U;  4IOC Q;  1RWM B;  3OPK A;  1KQF B;  3ILJ A;  2CPY A;  4ZPV R;  3Q24 A;  2XTJ P;  1W2I A;  2XB2 D;  1LWX A;  2R3V A;  3ILI A;  2HHT A;  2N4D A;  2QGF B;  2ZVS A;  1IJF B;  5ETK A;  5T14 A;  2FY8 A;  3OHA A;  3BO4 A;  2RDI A;  4L75 A;  3HSD A;  2HBZ B;  4LRD A;  5B0E A;  5A0Y B;  2V8G A;  1RDR A;  2ZH2 A;  4J9R A;  5IWA F;  5B0B A;  3G82 B;  1S10 A;  2OH2 A;  2WW4 A;  1NLK L;  1D8Y A;  2CJQ A;  2E9R X;  1KVJ A;  1HWK A;  4OHX A;  4ZA1 A;  4DR5 F;  1HNZ J;  1VRQ C;  2NZC A;  3IBC B;  1QUP A;  1DAR A;  2I5J B;  3QGG A;  4NI2 A;  5BXI A;  1CQN A;  4URQ U;  2V2K A;  1RAH B;  4QWE A;  2X1F A;  3DYA B;  1HQE B;  2FVS A;  1UAW A;  2HZA A;  3F41 A;  3MMB A;  2LA4 A;  4QIG A;  4DV4 F;  3CD0 A;  4KTQ A;  1G1X A;  3Q8Y A;  2MQO A;  3D3B J;  5IC6 B;  1X9M A;  2XLK A;  1TL7 B;  2DH7 A;  4KFB B;  1I94 J;  1HBM B;  4YDX A;  2ZHO A;  3G86 A;  4YFU A;  5A8W A;  4LUB A;  1LWE B;  4IH5 A;  2VG6 A;  3NKY A;  5A8K B;  5K8M A;  2M8D B;  2NSC A;  2YWK A;  2PD1 A;  5J2P A;  4I2Q B;  4UT4 A;  2UP1 A;  1CJK B;  1IBK J;  2DNP A;  2VV5 A;  1MWY A;  1R0A B;  4DS4 A;  1AYE A;  4J9U E;  4EYI B;  2YNH B;  3CDA A;  2BQU A;  1DTQ A;  1IQT A;  2V67 A;  3A4T A;  1A9N B;  2HEK A;  3BDP A;  4OJ1 A;  3C6T B;  1BUX A;  2CAD A;  2VBW A;  1T9U A;  2CQ1 A;  4DQP A;  2WON B;  2CZ9 A;  1V5I B;  3V6K A;  4C4W A;  3GJS B;  3E01 A;  2XWY A;  3KYL A;  2MPU A;  3EZU A;  5C42 A;  3HM9 A;  2PFF B;  1XC9 A;  1RQ0 A;  2G2O A;  5AXM A;  2C2E A;  4A8F A;  5KFL A;  1HL6 A;  4Q7A A;  2DRD A;  2QFI A;  4M5N A;  1H7W A;  3U1N A;  4TY9 A;  3J7Y U;  2CQH A;  2FDN A;  2BYC A;  4ZN3 A;  4LFB J;  5GMD A;  1E6Y A;  5HN0 A;  4OV1 A;  4QWC A;  3ZTP A;  2QN6 B;  3FCV A;  3MD1 A;  4TXS A;  1RCX B;  2CPI A;  4OQJ A;  1RLD A;  3AQO A;  1VK3 A;  4OI3 A;  4OYM A;  4OMF G;  9ATC B;  2OEJ A;  1ZPW X;  3I5B A;  2HW3 A;  1WJ9 A;  1QUV A;  3N5B A;  4ZVP B;  1YBA A;  5KFS A;  3R6G B;  4X64 J;  1C1C A;  2HGN A;  5FLX U;  5FD1 A;  1JLB A;  1R3N A;  2Q43 A;  3BQ1 A;  2UVW A;  5DDQ C;  3NNA A;  1N0U A;  1RIS A;  4CQ1 A;  3GYG A;  1MN9 A;  1WHX A;  1FTR A;  3FQK A;  3MI7 X;  8AT1 B;  1KON A;  1XMO F;  1RA7 A;  3DOM B;  3QJJ A;  1VQN S;  1FFW B;  4Q43 A;  2WVF A;  3BJY A;  4H4O B;  2RAQ A;  3RBZ A;  1SH3 A;  3BZQ A;  4PEO A;  3DLJ A;  1LWC B;  2WAQ D;  2LU1 A;  3VVU A;  3B6B A;  2GA7 A;  4KKO A;  4DF4 A;  1NK0 A;  2RML A;  3EVM A;  7FDR A;  2U2F A;  4O0I A;  4I1T A;  1C4C A;  3D1O A;  5BYR A;  1PBA A;  1XWL A;  1SH2 A;  2GMH A;  3TVY A;  4CH1 A;  3DOK A;  2K1R A;  5ETV A;  4WF9 Q;  3M2U A;  1U2F A;  5ETS A;  4Y00 A;  2GHP A;  3ZZT A;  2PN6 A;  1HD0 A;  1RB0 A;  4BCA A;  2B43 A;  2EFG A;  3TA2 A;  4YUD A;  3IWN C;  2HHX A;  4DV5 F;  1VQ9 S;  1TL1 A;  2HNY A;  2HUR A;  4USV A;  3PAC A;  4GVL A;  5GME A;  1NSA A;  4RNN A;  4J90 A;  4HHJ A;  5CYQ B;  1SJQ A;  1IBK F;  3SDE A;  3ELH A;  1HPZ A;  1T0T V;  2XZT B;  3UFC X;  6FD1 A;  2G1H A;  3HCX A;  3TAR A;  1SCJ B;  1RT6 A;  3FRY A;  3KJQ B;  4IUF A;  3O1L A;  1JB0 C;  2OSR A;  2MKY A;  4URS A;  4DFM A;  4L3N A;  6AT1 B;  1S0O A;  3CO0 P;  2NRE A;  4B9U A;  2XUL A;  5DRK A;  1VQ6 S;  1XMQ F;  4Q0B A;  4AQY J;  4OZ2 A;  2XCA A;  1OYE A;  1JK9 B;  2YX4 A;  1AA1 B;  2JL9 A;  4N76 A;  2Y8W A;  5HAT A;  1EQM A;  5CD4 A;  1S72 S;  1UPM B;  2B51 A;  2DNQ A;  1L3V A;  2FC9 A;  4JOU A;  2V6A A;  3G71 S;  3CF5 Q;  1X0P A;  4P2S A;  4PPD A;  2OFG X;  3FEZ A;  3LW5 C;  2YWF A;  1ROF A;  2LYV A;  5KFE A;  2CQ0 A;  4MJK A;  5AJ3 F;  4DSK A;  3I87 A;  3QRQ A;  4CLY A;  2KZZ A;  5E5N A;  2Z8Q A;  1M5V C;  3OTD A;  1R8C A;  5D6G A;  1VQO S;  2CRL A;  4JI1 J;  3QID A;  1QE1 A;  5CD4 H;  1FD8 A;  1MNE A;  3B54 A;  5F3Z A;  3OXL A;  2VPZ B;  3AH6 A;  4CT8 A;  1QDU B;  3TQE A;  2J6S A;  2YWG A;  3PCO B;  3VAG A;  3HVW A;  3NOG A;  1B3T A;  4UZB A;  3PR4 A;  2NXU A;  2RF2 A;  2RD5 C;  3DLK A;  4U9R A;  5LL6 d;  5KFD A;  4DV0 J;  3WZ0 A;  2VKZ G;  2HQI A;  2IFX A;  1I51 B;  3BH7 B;  3WHI A;  2VQE J;  1ZAX A;  4C8O A;  1U6F A;  1LWF B;  1WC5 A;  1S6Q A;  2ZFH A;  4C7Q A;  4C6A A;  5L1I A;  2VH7 A;  4JV0 A;  1N52 B;  3AA8 A;  1N32 J;  4ZJL A;  3HHD A;  3Q8Q B;  1NJX A;  4EWT A;  2EXU A;  2ERR A;  3MM5 A;  4AD6 A;  5BR8 J;  4MAK A;  1CS4 B;  3SSS A;  1L5U A;  1HQU B;  3IR5 B;  3NS5 A;  4YHH F;  4WFZ A;  3TAN A;  3N6M A;  2KDO A;  1Z2L A;  2B5J A;  2Z30 B;  1S48 A;  2B9Y A;  1VMB A;  4LRE A;  2BOA A;  1ACM B;  1S7H A;  1IBM F;  1QSL A;  4AND A;  4F4K A;  2WOM B;  3LQV A;  3KHH A;  1TVR B;  4USH A;  1YRU A;  4H4K C;  2AJ0 A;  1LW0 A;  5HJX A;  2RHS B;  2NS1 B;  4QPX A;  5C25 B;  2HGL A;  4P72 A;  4TKT A;  2MGZ B;  1U1M A;  1UZH A;  1HWU A;  2FY1 A;  3B78 A;  4N8N A;  4JI7 J;  1SUQ B;  3M6X A;  2OGU A;  3FBE A;  3L09 A;  5KFY A;  1SQG A;  3N6L A;  4NMX A;  3T5H A;  1AUD A;  3J7A 1;  4DL4 A;  2CPZ A;  2GQC A;  4NL5 A;  2J5A A;  4RW4 B;  3T6J A;  1FA0 A;  2AGQ A;  1A6L A;  3I0S A;  3KUG A;  4A47 A;  1U1K A;  4CYU B;  3EZ5 A;  3Q0A A;  4JI2 J;  4HH0 A;  1Q79 A;  5EGY A;  3C3L A;  3KMQ A;  3FC9 A;  4F0K A;  3JYT A;  2AYB A;  1HLW A;  4GO7 X;  4HH1 A;  1PYO B;  2GVZ A;  1E6V A;  1NB2 A;  1VJW A;  3W9H A;  1H98 A;  5K9F A;  4IO1 A;  1PKU A;  4RW7 B;  4DPO A;  2GVZ B;  3G8T A;  2X51 A;  3CCR S;  4DLG A;  8ATC B;  4Y34 A;  4KGV B;  5D4L A;  2ILZ A;  1UCN A;  2E66 A;  3H59 A;  2XS7 A;  2XHC A;  4DL2 A;  1FFS B;  2J7U A;  2AZ1 A;  1KN6 A;  4F3O A;  4CO3 A;  2V2V A;  4TYA A;  2DXE A;  2CVE A;  2DXD A;  2XC9 A;  4QPT A;  4LRC A;  1U6B A;  1LXN A;  2JX2 A;  1HNW F;  1NH8 A;  3DLE B;  3NEK A;  4ZP7 A;  3VGU A;  5DLF A;  3IN5 A;  2HSE B;  2DGQ A;  4DDF A;  2VA3 A;  3G8S A;  3JQK A;  3RAQ A;  3QFW A;  4DN9 A;  4ECY A;  1BD6 A;  1KTQ A;  4MKB A;  2D9O A;  3DXS X;  2HLT A;  1S1T A;  1FXR A;  3CC2 S;  4DV1 J;  1TV6 A;  4UST A;  2B5J B;  4LF2 A;  1S1T B;  1BHN A;  3CW2 C;  3W64 A;  3M8S A;  1RHJ B;  3KFW X;  4IG3 A;  1HI1 A;  4DSJ A;  2B4O A;  1OSC A;  4ZN1 A;  4ZDN A;  1QLN A;  3PJX A;  5CH7 B;  4LVN P;  2CPH A;  1ZM4 A;  3CJ8 A;  2B6A B;  3PJW A;  2IAJ A;  3NXZ A;  2DO0 A;  1SBR A;  1N34 F;  1WOO A;  3BBB A;  3QGI A;  1UFL A;  5DLG A;  3VAJ A;  4EBE A;  3RR7 A;  2B3T B;  1HKA A;  2BQR A;  3HZG A;  1CG2 A;  2DNH A;  3OLA A;  3W62 A;  3M9M B;  2QV6 A;  3UNY A;  2KFN A;  3FMB A;  1JQG A;  3DM2 B;  3ZZR A;  3CCU S;  2QT7 A;  1FJ7 A;  1Q8I A;  2P6T A;  3H8Y A;  3QWP A;  2YQ3 A;  3FZ2 A;  3CCW A;  2OFH X;  2V9K A;  5GAG I;  1TKZ A;  4DV4 J;  2YVS A;  2ZH1 A;  1P6T A;  2K3I A;  3BKT A;  3MEG B;  3ZZU A;  1H2V Z;  1ICE B;  2UUW A;  3P5T L;  4P75 A;  4Y0F A;  1QD1 A;  2BOP A;  1C0T A;  1VQ8 S;  3MEG A;  1CSJ A;  2HQF A;  1FEH A;  3A8E A;  4LF7 F;  4DU8 A;  2GAH C;  2HFO A;  2UUC J;  4RPF A;  4NML A;  4O4G A;  1YIT S;  3MCN A;  4U7C A;  3CWJ A;  3RB6 A;  1T9T A;  4BHQ A;  4WP3 A;  2J6T A;  5DS7 A;  4OHV A;  4ZCL A;  2ZH4 A;  3RBD A;  3S7R A;  1ZTW A;  5EWE A;  5KFB A;  2E5J A;  1RTH B;  1PYS B;  2C2Z B;  2RKI A;  2DGV A;  4AUK A;  3QNW B;  4O23 A;  4DR2 F;  2XS5 A;  2B6A A;  4F4W A;  3GJT B;  2VG5 A;  5CYQ A;  4ES1 A;  3CT9 A;  3RJM B;  2QL7 B;  1RT3 B;  1Y3K A;  2HRT A;  5ETR A;  1NDK A;  3QYY A;  4O3P A;  2UUA F;  4TYB A;  1BLU A;  4Y28 C;  5EWF A;  5DDP C;  2MQM A;  1TK8 A;  2XSJ B;  3MED A;  4DR3 J;  4QU7 A;  2FHM A;  1LWF A;  1K0V A;  1V5V A;  2FHK A;  2O1P A;  4U7U K;  1WOP A;  4MH8 A;  2W2M P;  4J9Q A;  3HHL C;  3M4X A;  2DRB A;  3TVZ A;  1WC6 A;  4KE5 A;  4ZP9 A;  4EO6 A;  3MMC B;  1V3S A;  2XY5 A;  4X4U A;  2X1G A;  5EDW A;  2IM2 A;  4O3S A;  2DT9 A;  4OIX A;  5I3U B;  1IJE B;  1DAX A;  2QLJ B;  3SV4 A;  3KJF B;  4RNH A;  2V50 A;  3LAM A;  4UOC A;  2V8P A;  3TOQ A;  4ATN A;  2VHG A;  4LF9 F;  4RBV A;  3O44 A;  2KU7 A;  1S4F A;  1RAB B;  2BVZ A;  4H4O A;  2J0S D;  2ZC3 A;  1JNR B;  3TA0 A;  1XMO J;  1U45 A;  1SL1 A;  4NA2 A;  2LQ5 A;  1PAE X;  1YX2 A;  2AMC B;  4USU A;  4ECV A;  1TL5 A;  2J8A A;  2D3U A;  3N01 A;  4B3M J;  2BA9 A;  4A8Q A;  4RR5 A;  1UWB B;  2MLX A;  1YKW A;  2VFV A;  4FKX A;  5B0A A;  3SSR A;  4ECW A;  2ZWP A;  5F9L A;  2GGP B;  2CYY A;  3U7J A;  1CUL A;  4M5D B;  2RNE A;  3MM7 A;  1CVJ A;  4LF6 J;  4G1I A;  3OTO J;  3DHX A;  3A13 A;  1FT8 A;  4MIB A;  2WVE A;  2ZD1 A;  3NGU A;  1ITP A;  3H0P A;  2MJN A;  2QSF A;  5GAE U;  1JLC A;  4QIE A;  2N3L A;  1FRH A;  3ZTO A;  3AA9 A;  4ZIT A;  4PWW A;  1YJV A;  2KYZ A;  4G1Q B;  4JI8 J;  4M1K A;  1VQK S;  4FVC A;  3TZW A;  4PKD B;  1F9H A;  2FC8 A;  1TVR A;  3SMZ A;  3UW1 A;  1FX4 A;  2AHO B;  2CWX A;  3WIU A;  3BPD A;  2KJW A;  4DFP A;  3PR5 B;  1JLG A;  2MKS A;  4CI0 B;  5F8H A;  2YQ1 A;  4WE1 A;  4DHV A;  5ETP A;  1HQU A;  3ISZ A;  2K1R B;  2H9Z A;  4B08 A;  2EG1 A;  3GSD A;  1RKI A;  2XLJ A;  1IKV B;  1FE4 A;  1IKW B;  2GNK A;  3PX0 A;  3LH2 S;  3KTQ A;  1HNZ F;  4G65 A;  2W01 A;  1BC6 A;  2VG6 B;  3DI6 B;  1YZ7 A;  2C3M A;  1RI7 A;  3IA0 A;  1D8Z A;  3ZXW A;  5HMX A;  1RT7 A;  2W9B A;  5AXK A;  2FGC A;  3P5B P;  2HND B;  2DHG A;  3NGK A;  1JLQ A;  2YKM B;  1IBL F;  4EBC A;  3NNC A;  1U1Q A;  1B4S A;  1TL7 A;  3HF5 A;  2PA3 A;  4CH0 S;  4A8S A;  1U4B A;  4RU2 A;  5K8P A;  3U1L A;  1MMD A;  3Q8P B;  2CQG A;  2Q79 A;  2WW8 A;  3BGU A;  3MPY A;  4EU0 A;  3T6B A;  1RT4 A;  2OEK A;  1KOO A;  2D74 B;  4NYP A;  4Q2M A;  1RT4 B;  2HWT A;  4NLV A;  3CJR A;  1UFK A;  4K4V A;  4ED2 A;  3DXB A;  3QGH A;  1QTM A;  1QE1 B;  2H54 B;  4P74 A;  1EQ0 A;  3CDU A;  1JLQ B;  2YKM A;  2OD6 A;  3W5Y A;  2R8I A;  1I6J A;  2HFU A;  1RT7 B;  1PAU B;  1YGY A;  2KO1 A;  2C42 A;  5LXR A;  5F8L A;  2W9B B;  4C8Z A;  1VIS A;  4WPA A;  2FVC A;  2L3M A;  1E6Y B;  2CPF A;  4BLG A;  5C2C A;  5B0G A;  3W8G A;  4KT0 C;  4XTT A;  4CRJ A;  5B08 A;  1Q82 T;  3K5N A;  2AW0 A;  4QBU A;  3FEX B;  1J5E J;  2IJF A;  4K5R A;  1NKE A;  2JEJ A;  1N33 J;  3R7N B;  2BJ3 A;  2E1R A;  1M5H A;  1DTT B;  4AT1 B;  3EDQ B;  4LF5 J;  2VD3 A;  1FO1 A;  4J9L A;  2CFX A;  1RT2 A;  1UP1 A;  2NYI A;  3H2L A;  4DR4 F;  1Y0H A;  4IKA A;  2ZWO A;  2AEM A;  4JV1 A;  3W9I A;  3M8Y A;  4F2R A;  3HX9 A;  1S9F A;  4MYU A;  2HNY B;  2R7S A;  4JV5 F;  4NCG A;  5F8G A;  5J1P A;  5SZT A;  3THT A;  4DR7 F;  4JI4 J;  3M30 B;  3PX4 A;  1JXE A;  2JEG A;  1YQH A;  2CQ2 A;  8RUC A;  1XIQ A;  3OT9 A;  4OZJ A;  4CTA A;  2ZHB A;  4J9V A;  2CQD A;  1CBK A;  5KFP A;  2GGP A;  3N79 A;  4QJV A;  1VJQ A;  1VCT A;  1WG1 A;  4LVO P;  1V3Z A;  2B9W A;  5D3G A;  2QEX S;  4DMZ A;  3IRW P;  3V5R A;  2BJD A;  3B4D A;  2X7I A;  2HVI A;  4K4S A;  4TY8 B;  2FHJ A;  2M2B A;  2M52 A;  2YKQ A;  3BKF A;  3R1L A;  4NLU A;  3MZI A;  3CCJ S;  4X4V A;  2Y1L B;  2D9P A;  2YWW A;  3GU0 A;  1TK5 A;  2QC3 A;  4KPC A;  3TJA A;  2KG1 A;  1FKO A;  1Q7L B;  1T95 A;  2CJY B;  3QSY B;  3MXH P;  4BWM A;  4JI0 J;  1RSC A;  2R7Q A;  1U7L A;  3H5Y A;  4AL6 A;  4WU3 A;  1RT1 B;  2ZE2 B;  4C8K A;  3I82 A;  2CJK A;  1IKX A;  2DYA A;  3IWL A;  4K2X A;  3QT8 A;  5KFU A;  1FF2 A;  2RQC A;  4B3S J;  1S0M A;  2NUH A;  1FHT A;  1N54 B;  1PC4 A;  1FI4 A;  1RZM A;  4ZHR B;  1LW2 A;  3VCD A;  4KYZ A;  2KH9 A;  5D4P A;  2G13 A;  4IG0 B;  4M5I A;  1N48 A;  3UR3 C;  4IOA Q;  3KHR A;  2Y1J A;  4DV5 J;  4DR2 J;  2V68 A;  1NK5 A;  2VG5 B;  5L8R C;  4ZS6 A;  5CAA A;  1NDL A;  3OL9 A;  2E29 A;  2IRY A;  2Y9H A;  1KQG B;  2K7J A;  4RZR A;  1FRI A;  5C42 B;  4ELV A;  2L9W A;  3E2E A;  1EP4 A;  2JOQ A;  3E01 B;  2UVR A;  4M63 A;  2BJE A;  2AX1 A;  2KJV A;  1WEY A;  1JLE A;  2RH3 A;  4LSN B;  2ABY A;  4W4M A;  2ZC4 A;  5ETN A;  2UVU A;  2WB4 A;  2FJB B;  3DCA A;  2ZKU A;  1B7F A;  3C6T A;  3IS9 B;  4PYD A;  3IR7 B;  2DGU A;  2XYG B;  5HJY A;  5KFK A;  1N4L A;  3ZTS A;  5IWA J;  3KG0 A;  3PXG a;  3RUB L;  3F73 A;  3UD4 P;  4DLE A;  2ATL A;  2JEF A;  2BUN A;  4DL6 A;  2Q3P A;  4F3M A;  3EUN A;  2V9W A;  1XMB A;  2DGX A;  3AD9 C;  2HFZ A;  1OIA A;  4TU7 A;  3PG9 A;  4H54 A;  1I3O B;  3HVA A;  3O6Q A;  1P27 B;  3QAU A;  4KFB A;  1NK7 A;  4UQT A;  2HHV A;  2BJ8 A;  2CQI A;  1X8D A;  3CXC R;  1PC5 A;  3RW6 A;  3QJL A;  1PJ6 A;  3PW5 A;  1TKZ B;  1APS A;  2D7S A;  4LQ3 A;  1HQ2 A;  1HQE A;  1UTA A;  2HQD A;  2W1B A;  1Q16 B;  5HLF B;  4NLO A;  2DH9 A;  3VAH A;  2VOD A;  5GAH U;  1CEZ A;  1NEE A;  5LMN F;  1KNZ A;  1GXT A;  3MEE B;  4N47 A;  3K58 A;  3MMA B;  4UOH A;  2V4J A;  4YY3 F;  3I96 A;  4ZVR B;  3ENW A;  1NK6 A;  1J5O B;  4R8U A;  4OI1 A;  3NMR A;  1KLM A;  1S99 A;  3EVW A;  1KEK A;  2DIU A;  1ZOT A;  4DX7 A;  1YBU A;  4RUA A;  5DQG A;  4F0M A;  2FZG B;  4F4Z A;  3IG1 A;  1L3S A;  1KVI A;  2F63 A;  3FMW A;  4ZVO B;  5AE3 A;  3RAM A;  2XSF A;  4KHP J;  2XM3 A;  3ZNJ 1;  1T8E A;  4J5O A;  1O8B A;  2XCP A;  2B4V A;  1TV6 B;  3OJS A;  5CYJ A;  4YDD B;  3DGP B;  3WIV A;  1A0O B;  3H5X A;  3QO9 B;  4LRA A;  2CQC A;  1FJC A;  2KHD A;  3QPI A;  1WI6 A;  3NBP A;  3TZY A;  5J2Q A;  1OQ6 A;  1R6V A;  3A8K A;  2ADB A;  1Y5N B;  5J1E A;  4LF6 F;  1TFW A;  1KC8 T;  4R5P A;  3M8Q A;  3QZ8 A;  1K0T A;  2F9J A;  1Q0N A;  4Q8E A;  5CCM A;  3TRG A;  1U26 A;  4ITS A;  1UL3 A;  4M5K A;  4TVA B;  4ED3 A;  3V6D A;  4XDD A;  3DRP B;  2LQB A;  1OPZ A;  3KK3 B;  2AGP A;  2UU9 F;  2FD2 A;  2ZBP A;  4Y2M A;  3K5M A;  4I68 A;  4DPW A;  2DPI A;  3NCQ A;  5B09 A;  4XPE A;  4PRF A;  1F3V A;  1VBY A;  3EGV A;  5IOL A;  3GPA A;  2AJ2 A;  1XQI A;  4RWX A;  2HKE A;  3FFI B;  1NSQ A;  2PGC A;  4X66 J;  1CJV A;  5C5J A;  3KJV B;  2OTJ S;  1S6P B;  2VUG A;  5KG2 A;  2HWI A;  2DNG A;  1E6V B;  1RHR B;  1SKU B;  3AOD A;  4Y2C A;  2CNO B;  3BGR B;  4C97 A;  3OFF A;  2IIH A;  3D0G E;  4E8U A;  4WKY A;  2ZM6 J;  5LJ5 Y;  2QLW A;  1HNX J;  5J2N A;  1FK9 A;  4P2F A;  4C11 B;  3JQJ A;  5FII A;  5KFJ A;  2V8V A;  3TEG A;  3LPE A;  1AZS B;  3EPG A;  4DJB A;  3IC1 A;  2RB7 A;  5DDR C;  4IFY B;  1KQK A;  4ZCM A;  2J9C A;  3GQC A;  4N77 A;  2JVR A;  4LR8 A;  4MK9 A;  3FCH A;  4F67 A;  4X4P A;  2E1C A;  3MAA B;  1JXV A;  2IMO A;  1HHT P;  4BWJ A;  2EEY A;  3CMQ A;  2IVY A;  1FRJ A;  4GVB B;  4NLQ A;  4DR1 F;  3QGP A;  1S1V B;  4HHH A;  4WWS A;  2UXC J;  4J9K A;  5M2U A;  1ZM9 A;  2QMX A;  3CD7 A;  1DBD A;  4ECU A;  4LFB F;  3MR2 A;  1S77 D;  1JJC B;  2R42 A;  4LFC J;  1XR7 A;  2KRB A;  2IPO B;  2XYP B;  4MK8 A;  1S76 D;  1N34 J;  3DLB A;  4BDP A;  5EUH A;  1N6Q B;  2KYX A;  4ZLL A;  3A8I A;  5LMU F;  4CO4 A;  4EGL A;  3IAS 9;  3W2W B;  1CJU A;  1N5V A;  1N5Y B;  4RWW A;  1MG7 A;  2R8H A;  1SJ1 A;  1J27 A;  1FFG B;  2V8D A;  3DLG B;  3UCZ P;  4JV2 A;  5KFI A;  3QRP A;  2DH8 A;  4OYP A;  2B4U A;  1T02 A;  3MR6 A;  1Q86 T;  3VF0 B;  4LSL A;  5LM7 E;  2KXF A;  3POT B;  4WCE Q;  1U09 A;  1UET A;  5KFA A;  5E2Q A;  2VC1 A;  2Y0S D;  3KLV A;  4DFJ A;  2DCU B;  2ILY A;  1NZ8 A;  4MKY A;  3NL0 A;  2POK A;  2VAS A;  3KG4 A;  3NWR A;  1WKL A;  5D0H A;  3OLB A;  4IQX A;  4JI3 J;  4BBY A;  2ROG A;  3MMJ A;  4URG A;  4KPY A;  1VBX A;  4QWD A;  3TO8 A;  5M2R A;  1MN7 A;  2MB0 B;  1P1T A;  1RBO B;  2YKO A;  1DLO B;  3DDI A;  2FJE B;  1KP6 A;  2CIM A;  4K4Y A;  1DZ5 A;  2GVD B;  3CD5 A;  4C8N A;  4OX6 A;  3DMJ B;  2OPS A;  4CZC A;  2A6O A;  3PJ9 A;  1HNX F;  5D8H B;  2LFV A;  1NJI T;  4XIU A;  4GC6 A;  4AQY F;  4M5M A;  4RJV A;  2ACY A;  1HBU B;  2W4C A;  1HMV A;  3D67 A;  3MUT P;  1KOH A;  2GVD A;  2X3D A;  1Y4Z B;  3MF5 A;  5A2Q Y;  4KHM A;  1K73 T;  4P6Q A;  4A48 A;  2VG7 B;  1T05 A;  5HVF A;  3BF4 A;  3KK2 A;  3KLI B;  2CZV C;  4DSF A;  2HHH F;  1JWW A;  4FF2 A;  2B7B B;  3TWZ A;  2XNR A;  1OSD A;  2D41 A;  2CA9 A;  2XY6 A;  2C2M B;  2XO6 A;  1GAO A;  2QX0 A;  3MPW A;  3QT5 A;  4QW9 A;  3M9N B;  1KVK A;  2GV1 A;  1FKP A;  3JSM A;  2ZHA A;  4CM0 A;  3IRX A;  4O0N A;  2U1A A;  1RT6 B;  4DN0 A;  2YNI A;  3GV8 B;  2P9C A;  4Q2L A;  3HUL A;  4DR3 F;  5GMK a;  4LFC F;  1HPZ B;  2A3J A;  2XGQ A;  3T1H J;  2HMI B;  1OY8 A;  1M5S A;  2FJW A;  5HRO A;  1Y11 A;  2B8P A;  3LP2 A;  5BJR A;  2E5H A;  2K3K A;  4F4Y A;  4LSL B;  3ISN D;  2E5L J;  2MY8 A;  3SZ2 A;  4NAS A;  3KDO A;  2XNQ A;  4ZP6 A;  1P1L A;  4ZPT R;  3SCI E;  4B02 A;  2I2Y A;  1RWN B;  1UEK A;  1X4D A;  2G9O A;  4X84 A;  3EDR B;  3OR2 B;  1WF2 A;  4UUX A;  4B3S F;  4MYT A;  3UO0 A;  3K7R A;  3GIJ A;  1NJW A;  1N6Q A;  5HMW A;  1M1H A;  4UF4 A;  3QJP A;  2PII A;  2QRR A;  4RNO A;  5KFX A;  2XZW A;  1JIH A;  3QFH A;  3FBF A;  3ZNU A;  2UV8 G;  1LFP A;  5I42 A;  1S1W B;  1VFJ A;  4IDK A;  3TR5 A;  1LWC A;  2MZT A;  1HBN B;  1Q5V A;  5FLX Y;  3MUM P;  3CB4 A;  3QIP A;  2K8G A;  1HW8 A;  3OTE A;  3CCZ A;  2V34 A;  3R5G A;  4ID5 B;  5HMZ A;  2KI2 A;  3R1H A;  1R0C B;  3DOM A;  1RYR A;  4P7T A;  4ECT A;  1MMN A;  3G87 A;  2BXJ A;  1TKT B;  1T03 B;  3UCG A;  1TEL A;  2PFD A;  2C2N A;  4DV2 F;  5FDL B;  2HHH J;  1C1B B;  4PWD B;  2OHD A;  5KG5 A;  3IBF B;  1RTD B;  1N56 A;  2EVZ A;  5KFT A;  3W65 A;  3H5U A;  4DCJ B;  2A18 A;  1ZH5 A;  5F8N A;  2K7K A;  1RTI B;  2HAF A;  4OX9 F;  5JJB A;  4C11 A;  4HI1 A;  4C0B A;  1SC6 A;  3BM7 A;  3OSN A;  1U1R A;  3JSB A;  1RUS A;  1ZZN A;  1TUW A;  1Y9O A;  2B56 A;  2YKN A;  4WBF A;  2L9N A;  4DS5 A;  1AUS L;  4RUB A;  3ILO A;  4WTO B;  3M8Z A;  1IKY B;  4W90 B;  1RHU B;  1JKH A;  2HNZ B;  2XMJ A;  4OZN A;  1FTC A;  3K5O A;  4RW9 A;  1RHQ B;  4R0J A;  4PUO A;  3LGH A;  1RT5 A;  4A8K A;  4NA3 A;  3T1A A;  4FYW B;  2HVE A;  4UZC A;  2WON A;  4N8O A;  3WC2 A;  2WBM A;  2RRA A;  4IR1 A;  4ANC A;  4DU7 A;  3ITH B;  3F0N A;  4KBI A;  1YLX A;  2HG4 A;  4ZPD A;  3M8Q B;  3DOL A;  1EX8 A;  3OUY A;  1F2G A;  2DHH A;  2VB6 A;  4PR6 A;  2Y0B B;  2MHE A;  4LFA F;  4P7V A;  2Q6B A;  4MIA A;  4XK8 C;  3QO9 A;  1K44 A;  4LF4 J;  1DQA A;  2JFK A;  1Q4R A;  3PM9 A;  4I2Q A;  3TUZ C;  4HT5 A;  4B3R J;  1H3D A;  3C16 B;  4LF8 J;  1LWE A;  5A8K A;  3OHB A;  1QY7 A;  3UE2 A;  1SJF A;  3TAM B;  2OJ3 A;  2GIR A;  3IO1 A;  2WB1 D;  2IM1 A;  3NCR A;  5F9N A;  2MKI A;  2KXN B;  3QZ7 A;  2BAN A;  3NAI A;  2ZH7 A;  1VC5 A;  4W98 A;  3G8Q A;  4P73 A;  2BKO A;  3MCM A;  1CLF A;  2HAI A;  5SUH A;  3RB3 A;  2DR5 A;  3PW0 A;  3VQT A;  3CJK A;  3MMB B;  2PC6 A;  3VTI A;  4TU8 A;  2BR0 A;  1HBO B;  1SC3 B;  3C66 A;  3IMQ J;  1KLM B;  3RRH A;  2HFS A;  2VKR A;  4U67 Q;  3HJF A;  2SXL A;  1X4C A;  2LEB A;  2UUC F;  2ZKT A;  2ZM6 F;  4N56 A;  3UD3 P;  3EWG A;  2DHA A;  4JP8 A;  4CT9 A;  5DG9 A;  2ZBR A;  1G7C B;  2H5I B;  2O66 A;  4ETX A;  1FNX H;  3PYF A;  2I0X A;  2RUS A;  5DQH A;  3OQ2 A;  3K5L A;  2FLO A;  3CJK B;  2BRL A;  2ASY A;  5EN1 A;  3TX0 A;  1LOU A;  4YS2 A;  1XR5 A;  1GTE A;  1FDN A;  3R8Y A;  4LF1 A;  1QJH A;  4KQZ A;  3FRZ A;  4WU2 A;  1O5J A;  3UI3 A;  3JSR A;  5DET A;  3T1Y J;  1NHV A;  1ULR A;  2XGP A;  4WZQ A;  2FVQ A;  3V81 A;  2KXH A;  4I2P B;  2BE7 D;  4OYZ A;  4OHZ A;  4KHR A;  2DIT A;  1M1K T;  1GX6 A;  2YNG A;  3MEC B;  2B0G A;  1YWX A;  5HBM A;  1F60 B;  2ZIT A;  3MCO A;  2WK4 A;  4QIV A;  4K0K F;  4DR7 J;  2BE2 B;  2XMU A;  3AJ2 A;  3BGO P;  3CJQ A;  3NG8 A;  4LF5 F;  2ALZ A;  5DO2 A;  5IM0 A;  3TVK A;  3KLG A;  5E3P A;  3LWM A;  1YJ7 A;  1DRZ A;  2XMA A;  2WVD A;  2ZUA A;  4ZLJ A;  2Q6C A;  3ITH A;  5IT9 Y;  4LF7 J;  3EX7 B;  4O3N A;  3EM1 A;  1S12 A;  3CJ4 A;  1BXN A;  4FXV A;  1WC4 A;  3SEO A;  2RSQ A;  4Z2X A;  4ZLN A;  2XEX A;  3D0H E;  1YJT A;  1Z2Z A;  2NSB A;  1D9F A;  1CPZ A;  2ZOG A;  3BV8 A;  4KO0 A;  1UJ5 A;  1X5T A;  4ED6 A;  3TUJ C;  1IM6 A;  1B64 A;  4QZV B;  3IAM 9;  2VDI A;  4MKA A;  1FXD A;  2MHN A;  3CCV S;  3D6F B;  4B9T A;  4PQU A;  1IR0 A;  4LBI A;  4PG6 A;  1KTV A;  1REV A;  2HQ3 A;  1WOR A;  1K9M T;  1ZPV A;  2H48 B;  2K06 A;  1WD6 A;  4N5S A;  4LRB A;  2RRN A;  3HD2 A;  1UMJ A;  4FNI A;  1R27 B;  4L3K A;  3L4B C;  7AT1 B;  1RT1 A;  2QA4 G;  2LDY A;  3SCL E;  2W7P A;  3K2Y A;  2I6W A;  2NXE A;  3KJN B;  4RW6 B;  1RTD A;  1VQP S;  1FEE A;  4DL0 C;  4EMD A;  4PWD A;  2YNF A;  2E7V A;  1Y10 A;  4FPI A;  4OZ3 A;  5FDL A;  2IJR A;  2VPW B;  2IVF B;  1TKT A;  2UZA A;  4KV8 A;  1H72 C;  1RLC L;  4JI0 F;  1R43 A;  2ZVI A;  4X4T A;  4DQS A;  1Q8L A;  2QE5 A;  2APO A;  1Z1Z A;  4HDG A;  3I5C A;  4ZPW R;  3VAK A;  3PV8 A;  4JI8 F;  3U02 A;  2DEJ A;  3VZH A;  1B7Y B;  2W7O A;  3HP6 A;  5KFQ A;  2QLF B;  1T9V A;  2Z2Y B;  1RE1 B;  1VBK A;  4UTG A;  1RU2 A;  2WBR A;  5IQQ A;  1U1N A;  1NME B;  1VLY A;  2QMU B;  3EGZ A;  3FBC A;  3R5J B;  2A1B A;  2P2C B;  1VRU B;  3AY0 A;  3PKM A;  1IXK A;  2LXF A;  3X1L B;  4C9D A;  1VQ7 S;  3OR2 A;  1H38 A;  4IRK A;  1GMW D;  1NM2 A;  2HQG A;  2RIL A;  3E8O A;  4ID8 A;  4KO0 B;  3HK2 A;  2DNN A;  3CUL A;  3P4U B;  1S7I A;  3RYL A;  4FKY A;  1SVD A;  1X5O A;  4NLY A;  4NXM J;  4NA1 A;  3CC4 S;  5U47 A;  1VK8 A;  2VPY B;  4X4S A;  2WSF C;  2MST A;  3A3O B;  3DOL B;  3OUY B;  5E7O B;  1Q8K A;  1JNZ B;  1JJ4 A;  3OVA A;  4JYA J;  2DKO B;  3GSI A;  1MRO B;  3PEJ A;  2F4V F;  1NDC A;  3J80 U;  3T5L A;  1X4E A;  1SI9 A;  2B4P A;  2MXY A;  3KHG A;  4O44 A;  3AT1 B;  4UUW A;  2JC1 A;  5DG8 A;  4E98 A;  3G6Y A;  3W3S A;  3R97 A;  3CJ0 A;  3DRS B;  3PW7 A;  1NJY A;  5IXU A;  3LWL A;  2ZH6 A;  1SH0 A;  4MFB B;  5IT4 A;  3OTO F;  5D0E A;  2G4B A;  1NCL A;  1HBU A;  4X65 F;  2F40 A;  5D3G B;  4K4X A;  3SBM A;  1GMW A;  2QIF A;  2RQ4 A;  1L3U A;  2ROE A;  2F8H A;  2XMV A;  2ZBQ A;  4X4N A;  1DQ8 A;  3HHL D;  2Z56 B;  3KHL A;  2J7K A;  2LEC A;  4RBU A;  2KZM A;  2HGM A;  4UQG A;  4L72 B;  3R6L B;  3JSY A;  3UNG C;  1UJ6 A;  3NAH A;  3KNG A;  3R5A A;  4YB7 A;  3J81 j;  4CCH A;  1SQE A;  1VC6 A;  5DQI A;  1TZ0 A;  3FSX A;  3Q83 A;  4L76 A;  1T9Y A;  2JH3 A;  3TI0 A;  1C1B A;  4F26 A;  4CDI A;  4KSE B;  2VPX B;  2XLI A;  1VHI A;  5RUB A;  2IA6 A;  5A6P A;  4FZV A;  2YWH A;  3KDN A;  4WTY A;  1C0U A;  1RWO B;  2HBR B;  2DIS A;  4GO5 X;  1FWP A;  3POT A;  3LO3 A;  1DJ0 A;  2N7C A;  3QT7 A;  2ZJR Q;  3DN9 A;  4B3O B;  1FCA A;  2EFO A;  5D15 A;  1WDD A;  1HR0 F;  2HS4 A;  2N4C A;  3C16 A;  4OX7 A;  2MQP A;  5L1L A;  1X5P A;  4CLS A;  1IKW A;  2UU9 J;  1IVZ A;  4MIW A;  5I3P A;  1MW7 A;  2J9D A;  3HFK A;  4B3T J;  1JJH A;  3GFH A;  5L1K A;  4I0W A;  2LLZ A;  1HNW J;  3IXQ A;  2AU0 A;  1T3N A;  1NZA A;  3VVT A;  2R8J A;  2HK3 A;  5CCL A;  3AFG A;  4OYB A;  5AT1 B;  3H4D A;  3PEH A;  1PBU A;  4ECS A;  3LP2 B;  3UCU P;  1ZET A;  3LAN A;  4N7T A;  2MLZ A;  2IM0 A;  3IR6 B;  4G1Q A;  4NX9 A;  3UN3 A;  5DGB A;  3Q8S B;  4GRS A;  3WQP A;  3I4P A;  1TMM A;  5LSO A;  3VHQ A;  2H5J B;  1HFE L;  5H1S V;  2FB0 A;  2IVM A;  4RW4 A;  1FWL A;  4TLR A;  2E9Z A;  1VIO A;  1QAX A;  4EYH B;  4F0H A;  3GFX A;  1FK9 B;  3KK2 B;  3DU6 A;  5J2N B;  2VG7 A;  4P10 A;  3MM7 B;  2H4Y B;  2KKH A;  2YBV A;  5KT6 A;  4X62 J;  1RTI A;  2GZO A;  3ETO A;  1NHU A;  3OFG A;  4WIQ A;  3TUI C;  3MM9 A;  4ICL A;  1EET B;  2LQ8 A;  3OXG A;  3W5X A;  3X3U A;  4JI1 F;  1AT1 B;  4DUY F;  4LMZ A;  4HEA 9;  1OS5 A;  3DFE A;  4J9M A;  2JLE A;  4YEA A;  4C98 A;  4C3L A;  4ELT A;  5JVG Q;  1VDH A;  2W2P P;  4NZ6 A;  3OXF A;  4Y2I A;  2BKN A;  3BSN A;  4A8W A;  1HI0 P;  3ENA A;  3R7S B;  1O51 A;  2C2O B;  2HK2 A;  1YJR A;  4KGZ B;  4USI A;  4W92 B;  3V4I B;  2ZUG A;  5I3U A;  3FJ2 A;  3C6U A;  2NR0 A;  2DXF A;  3TP2 A;  2XBP A;  3KUE A;  4DSI A;  4WP9 A;  1X4B A;  5J2Q B;  2WTF A;  2EBE A;  1F6T A;  2F7V A;  1YVF A;  2BBE A;  2DNO A;  2M0G B;  1VQM S;  3OVB A;  4Y2A A;  4D3G A;  3L7O A;  2R2S A;  3P96 A;  2ZH8 A;  4CLW A;  2DRA A;  4ECZ A;  1MML A;  3DLG A;  4DV3 J;  1U25 A;  1BQN A;  1DY3 A;  1KRP A;  1NHK L;  3AAW B;  1CJU B;  3MAQ A;  4M94 A;  2FVP A;  1RAG B;  2WRM A;  3R27 A;  3DLL Q;  4C3K A;  4JI3 F;  1RT3 A;  2FZK B;  2GHV C;  1U02 A;  1RXO B;  3MGJ A;  3T5K A;  2FLN A;  1FXL A;  4Q5V A;  5L1J A;  4KC5 A;  4GKJ J;  2G0J A;  2XZD B;  3LP0 B;  2RIJ A;  4YB1 P;  2W8L A;  2EWH A;  3HT0 A;  4FYV B;  2UXD F;  2QSW A;  1RTH A;  1VHF A;  2GX8 A;  2AJF E;  2O67 A;  3M32 A;  1S6O A;  3JQM A;  4TLQ A;  1BQX A;  5DZ6 A;  5BYQ A;  4U95 A;  5C2G A;  1S1V A;  1M5O C;  2MZQ A;  2L48 A;  2RDD A;  2W4P A;  3KLI A;  3MMA A;  4P9S A;  5KG7 A;  2XY7 A;  1T05 B;  5J1N A;  3MAA A;  4JI6 F;  1PGZ A;  4F2S A;  3R5C A;  2QA2 A;  5KFW A;  2CJA A;  5KT7 A;  4LF9 J;  1WKJ A;  1SPB P;  1T11 A;  4U8V A;  4OYX A;  2EFQ A;  4I56 A;  3GJR B;  1JLF B;  3K5P A;  3G2X A;  2OML A;  2OPS B;  4WFY A;  1LNQ A;  4V1A k;  2KT5 A;  4IH7 A;  5THW A;  2OO4 A;  2E5I A;  3GIK A;  1DLO A;  2CVI A;  5KOW A;  3MPV A;  2P9E A;  1FJG F;  2HZC A;  2HZV A;  1SIZ A;  3PHT A;  3BGR A;  4GMK A;  4ZJO A;  3AOB A;  2MQQ A;  2VIC A;  2XHW A;  4I69 A;  2JZ5 A;  3T19 A;  2CQ4 A;  3UDE A;  2Y1I A;  1QAI A;  1BQM B;  4OHY A;  1X4G A;  3M6U A;  1HNI B;  2HQC A;  1XER A;  3GYX B;  2VZ9 A;  2HS0 A;  4YY3 J;  3GV5 B;  1KFS A;  2GO9 A;  2OD4 A;  2WZ1 A;  2VBZ A;  5CAB A;  1EB0 A;  4FNH A;  5F8M A;  1JLE B;  3DRP A;  3HLU A;  5F41 A;  1B99 A;  4I4B A;  4ZIW A;  2MKH A;  3ZFV A;  1F2H A;  3I31 A;  5H9F J;  2OPQ A;  1H7X A;  2IAJ B;  3U27 A;  1N5Y A;  4ILM A;  3W2W A;  4UOF A;  3RAX A;  3M7V A;  1EIY B;  2L08 A;  5J1E B;  2DR8 A;  3N28 A;  3GYN A;  3H98 A;  1S9G A;  3TYT A;  4WFX A;  2R2U A;  3PIP Q;  1OWX A;  4M5H A;  1FDB A;  5KT5 A;  2A2C A;  2I1R A;  2UUT A;  3CUN A;  4MKV A;  4LIR A;  1UVK A;  2WVB A;  2P9G A;  1TAQ A;  3D2W A;  3KOA A;  5HQL A;  1D0E A;  5JXS A;  4NEZ A;  4OFZ A;  2MQN A;  2EFV A;  2E7X A;  1U49 A;  4FBU A;  2CG8 A;  4Z7C A;  4QYZ J;  2ZE2 A;  4K4T A;  2E5L F;  3DLE A;  4FDF A;  3PO4 A;  3F44 A;  2KHC A;  1EZZ B;  3AB4 B;  1TKD A;  2AJ1 A;  3M6V A;  4NYZ A;  3U1M A;  2UVV A;  5C7P A;  4KRW A;  3PTW A;  4FF1 A;  1IBL J;  1XBW A;  2L41 A;  1RAC B;  3IM9 A;  1IBC B;  4LJM A;  5E3Q A;  3TJ8 A;  2CPJ A;  4DV6 J;  2ASJ A;  2V4J B;  4OYA A;  1VGY A;  5DM6 Q;  1K47 A;  3AD7 C;  3CJ5 A;  3MEE A;  1YJN S;  2OP5 A;  4NLR A;  2KB2 A;  1Y7P A;  5HLF A;  2X1A A;  2FIU A;  5L9X A;  4H4M A;  5G0R B;  1HWJ A;  3BRE A;  1NJZ A;  1RCO B;  1VC0 A;  4LRF A;  5GAG U;  4UOG A;  2ACM A;  3BQ2 A;  3JYT B;  4LIW A;  3BSO A;  2J7W A;  2R9L A;  4LR7 A;  5L38 A;  3P45 B;  3W1Y C;  3I0S B;  4YOE A;  2NPF A;  5LMU J;  2HHP A;  3GE9 A;  3KK3 A;  1P9Y A;  2DCL A;  3J80 Y;  4F8R A;  1SL2 A;  1SUQ A;  1WC1 A;  3HI9 A;  2W8K A;  3PW4 A;  3KLE A;  1B0T A;  3LUY A;  4WZM A;  3KUH A;  4R5P B;  3PNI A;  2DNZ A;  2W2N P;  3IS9 A;  3K59 A;  3CIZ A;  2NPI A;  4I6Y A;  3KK1 A;  3CMA S;  1B70 B;  3HHE A;  4KAI A;  3LGM A;  2CJ9 A;  3DGP A;  3Q8V A;  1CJT A;  4YHH J;  4YR3 A;  2E1A A;  4XDC A;  2QYC A;  4DX5 A;  4QW8 A;  3GR0 A;  5F3T A;  3S6E A;  1IBM J;  1CS4 A;  4XAK A;  2N3O A;  4QR2 A;  3VR1 A;  1WI8 A;  2NLW A;  4PG7 A;  4DPU A;  4EUV A;  1RKJ A;  1Q7Y T;  3BSC A;  2VQF J;  2QMW A;  1LFW A;  4NOH A;  1PJ5 A;  1FRX A;  1DUR A;  3FCW A;  5DG7 A;  2IJN A;  3NS6 A;  3L95 X;  4RL1 A;  4I7F B;  3NNH A;  4ZHR A;  4DI6 A;  3PZP A;  4OI0 A;  1SC1 B;  2NXN A;  3RGI A;  1J5O A;  4OZ1 A;  4ZVS B;  5F8I A;  2LQJ A;  3KLH B;  4IRD A;  3SFU A;  2FJX A;  2UXC F;  3GFZ A;  2A2D A;  5A6W A;  1FKO B;  1F3F A;  3BGL A;  2ZDO A;  3L9Z A;  3W2V A;  2J0X A;  1YRX A;  1GEH A;  3CSK A;  5J2M B;  4JUZ A;  2DY1 A;  2EG2 A;  4ALZ A;  3GG1 A;  2BV3 A;  4OJH A;  3HFZ B;  1F9F A;  2PO4 A;  3HT3 A;  3C14 A;  1RTJ B;  4M5G A;  5KFZ A;  1SV5 B;  2Z57 B;  3FVY A;  4BC7 A;  5K8O A;  2E1P A;  4RNM A;  4DQR A;  2CNK B;  3CC7 S;  3HFV A;  2MLY A;  3PFO A;  4S0M A;  2ZH3 A;  3RTV A;  4JI5 J;  1S0V A;  2E7W A;  4NZ7 A;  4OLP A;  1MU2 B;  2OPP B;  3CDW A;  4K4U A;  1TUV A;  3D6H B;  2KT3 A;  3SFG A;  4ED7 A;  2F8M A;  4ZMM A;  2NYH A;  4DR6 J;  3VGS A;  3CE8 A;  4CLF A;  4AFF A;  2LXU A;  1U1P A;  3J7Z 5;  4DUT A;  3KMS A;  4B9L A;  1N32 F;  1F5A A;  2AD9 A;  2GFF A;  4LSN A;  2PMZ D;  3GII A;  2W9A A;  3HPO A;  4NCG B;  4QWA A;  4QWB A;  2F8E X;  2FHO B;  3R5D A;  4DV1 F;  3SI8 A;  2BM0 A;  1KHW A;  3AJ1 A;  3HSJ A;  3M05 A;  1X4H A;  5T7L B;  2R7U A;  4JB8 B;  5T7L A;  5MLC V;  1RAE B;  3TZX A;  2CJX B;  2OSQ A;  1YG0 A;  4BS2 A;  4QR0 A;  4DQQ A;  3D28 A;  5C24 B;  1XEZ A;  1S5Z A;  1Q53 A;  3M2V B;  3VV2 B;  5IQ6 A;  1NDP A;  1WUU A;  1YJW S;  3K8V A;  1S6U A;  3BGF A;  1YK9 A;  2ZD1 B;  1RJJ A;  3K89 A;  4F04 B;  1QSY A;  4NCA A;  1URN A;  4JI7 F;  1IKX B;  1CUL B;  5ETO A;  3M8P A;  3C2P A;  4HTI A;  5F0W A;  2HVH A;  2CJB A;  1LK5 A;  2MZR A;  3D0I E;  5ETQ A;  5EX0 A;  4ZVQ B;  4HT7 A;  5AXL A;  5IFM A;  1UWB A;  2MEW A;  3GP9 A;  4OZL A;  5AXN A;  2HYI B;  3GJQ B;  2IC3 B;  5A76 A;  2JFD A;  4PXC A;  2NXJ A;  2GJF A;  3I9V 9;  1RTJ A;  4U8Y A;  3W5Z A;  4U7U D;  5E3C A;  1WOS A;  3EE3 A;  4TY8 A;  2VON A;  3E51 A;  2D1C A;  2J76 E;  4JV5 J;  1N0V C;  2J0W A;  5L9N A;  3ULH A;  3W2V B;  1YZ6 A;  4WYW A;  2C3Y A;  1N5T A;  3D1H A;  4ENO A;  2VFS A;  4DX8 H;  4Q44 A;  4HHU A;  5DM7 Q;  4ZJQ A;  2ZH9 A;  4WXW A;  4F25 A;  3CCL S;  2H3E B;  4QYZ K;  4CTA B;  2DB1 A;  1Q95 G;  2HND A;  3L7P A;  3GV7 B;  2DNM A;  5F8J A;  3TEH B;  3J7Y I;  3MED B;  5KT2 A;  3JTO A;  5KG6 A;  1RAA B;  3M30 A;  3NGS A;  4PPZ A;  3ENV A;  2R7W A;  3CCM S;  2BZ2 A;  1QAJ A;  1ZAV A;  3MM8 B;  3OR1 A;  1ARO P;  1H2U X;  4DL3 A;  1PJ7 A;  4FN5 A;  3PDN A;  1T7P A;  3G9C A;  3R5B A;  3CCE S;  1WNE A;  3HKW A;  4B9V A;  4KJI A;  3QQC D;  1WG5 A;  3RB4 A;  1XNQ J;  4OHW A;  1URR A;  1RT2 B;  3GTY X;  3QLH A;  4P71 A;  1DQ9 A;  4WE1 B;  2JNJ A;  2XYH B;  3ZZY A;  4ZPB A;  1LEO A;  1Y5I B;  5HQ8 A;  4Q45 A;  1SJR A;  3BBF A;  3D66 A;  1VS3 A;  2MJU A;  2BJ1 A;  2VC0 A;  5I3Q A;  4DUZ J;  3JXO A;  3TQ1 A;  1U1L A;  4EZ6 A;  1H0H B;  4KHP F;  1DTQ B;  2HPU A;  3Q2S C;  3T3F A;  3ISN C;  3P8B B;  2VFU A;  4RUH A;  3JS9 A;  3MM8 A;  2WVC A;  3OR1 B;  3J81 Y;  2DBB A;  1JLC B;  2BMB A;  4Z37 A;  1XR6 A;  5KFO A;  2F4V J;  4V19 J;  1NSP A;  2IYI A;  2FYX A;  1PIL A;  1KKH A;  3BPS P;  2ALY B;  4RX6 A;  5IV4 A;  1C0T B;  2O3D A;  3IGV A;  3GCW P;  4MT1 A;  4DCP B;  5CXT A;  4O3Q A;  3C14 B;  4ERD A;  2Q1L A;  2VU5 A;  3UDC A;  2BAB A;  3IM8 A;  2CPX A;  3Q86 A;  4IOB A;  4NWB A;  5EX3 A;  4CO0 A;  3JTP A;  4EI2 A;  4ED0 A;  3DDK A;  2DTJ A;  4MTP A;  2W9C B;  3C46 A;  4R0E A;  1S97 A;  4O3R A;  4DF8 A;  3ET6 B;  4WK1 A;  1FER A;  4TQS A;  4NI2 B;  4M5L A;  4A8O A;  2HRY A;  3KLH A;  2AWZ A;  1OQ3 A;  2DNK A;  3CJS A;  4V19 X;  1SKS A;  2IM3 A;  1KWM A;  5JVH Q;  1BWE A;  1OO0 B;  3B4M A;  1AFJ A;  2H5E A;  5LJ3 Y;  1OY9 A;  2IC3 A;  1WC0 A;  3DI6 A;  3G96 A;  1UEV A;  1WTF A;  4A8X A;  4YN3 B;  2KM8 C;  4I6A A;  1HHS A;  1I5O B;  1TMJ A;  2RU9 A;  3BN4 A;  2MQ8 A;  3MMC A;  4DR5 J;  1IKV A;  3M8P B;  3RR8 A;  1RGV A;  1WG4 A;  4XO0 A;  4IG3 B;  4WII A;  1XNQ F;  3NGR A;  3TJ9 A;  1IQZ A;  5I4M A;  1JLG B;  4PAA A;  5KFV A;  3PRD A;  2QLB B;  1W2B R;  3WX8 A;  5C24 A;  4O4R A;  3H40 A;  4DEZ A;  1WF0 A;  1IWG A;  1NUE A;  5AE1 A;  1MWQ A;  1ZM3 A;  1NK9 A;  5CYM A;  2ZNZ A;  3EGW B;  4X2B A;  2GHW A;  1KFD A;  2AT1 B;  3FEY B;  3WX4 A;  1LQ9 A;  3KLE B;  2OUG A;  4ZVT B;  3CME S;  2GML A;  2XMT A;  1KDN A;  2OPQ B;  4DBQ A;  3JAM Y;  1G4C A;  2BRK A;  3G6V A;  2RKI B;  2C3P A;  2WSC C;  4PG5 A;  4WP8 A;  3OL6 A;  3MD3 A;  1T3O A;  4DPY A;  4LBP A;  2R8G A;  1VQ4 S;  3NLC A;  1TR0 A;  1S79 A;  1U24 A;  3H42 A;  4GC7 A;  2R4F A;  4OYW A;  3RRG A;  2ROP A;  1HHQ A;  2YPY A;  2F1F A;  2RRB A;  3CCT A;  4M5D A;  4FXD A;  4WFN Q;  4MK7 A;  2M8H A;  4YB6 A;  1UVI A;  3SCJ E;  2XMM A;  5EHH A;  1BQM A;  4EEY A;  4USK A;  4H4M B;  5G0R A;  4YQW A;  2IHR 1;  2RE1 A;  3SIP B;  2AQ4 A;  5K8N A;  1RWP B;  2V2Q A;  3BS9 A;  2LVW A;  4C3M A;  1F1B B;  1RA6 A;  1L3K A;  1REG X;  4CYU A;  4TQR A;  3O5T B;  4LQ9 A;  3G4S S;  4CLU A;  2VFR A;  3H2V E;  3T5J A;  2DD8 S;  1X7V A;  4PZV A;  1GFW B;  3CJ2 A;  3OL8 A;  2PMW A;  1GX5 A;  4HVZ A;  1VI7 A;  3DM2 A;  4XPC A;  1M5P C;  1M0S A;  2MKJ A;  3UDL A;  3K0J A;  2HHW A;  2HRU A;  2MGZ A;  4CLL A;  1LW0 B;  4OLO A;  1EAR A;  1WWH A;  2EFN A;  5DGA A;  3UR0 A;  1Q78 A;  2WOM A;  2CQ3 A;  1FRM A;  1H73 A;  2IRU A;  3DGV A;  2PA8 D;  1NU4 A;  5HK4 A;  5LT5 A;  4I7F A;  5IS2 A;  1OPI A;  1SXL A;  1D3W A;  2XSJ A;  3IGN A;  2NCK L;  4FF3 A;  4GKJ F;  2J8S A;  1HW9 A;  4HTJ A;  5E3A A;  3OTC A;  5H9E J;  2I8E A;  2X1B A;  5IC4 B;  1N33 F;  3N9U C;  2MKC A;  3PRV A;  3Q8U A;  4NLW A;  1N5S A;  1PSD A;  2HBQ B;  1S9G B;  3MM5 B;  4WK3 A;  3GWC A;  3ZZ0 A;  2BW2 A;  4N41 A;  1OY6 A;  1GNK A;  3HHK A;  5HBM B;  3P3D A;  1LKZ A;  1BQN B;  1FJE B;  1HNV B;  1H2T Z;  4NXM F;  1W25 A;  4HDH A;  2M88 A;  3FQL A;  2V5H G;  4LBH A;  3CCQ S;  1CQM A;  1H6K X;  3BKU A;  3US5 A;  2A6M A;  3Q23 A;  2XI3 A;  3KK1 B;  2ZJP Q;  1TL3 B;  3MTK A;  3BSA A;  4LT6 A;  2DPJ A;  1HAR A;  2RF2 B;  3PKY A;  4Y2K A;  3C6U B;  2XMW A;  4TNO A;  2J9E A;  4CH7 A;  4WFB Q;  1GMU A;  1OYD A;  2OTL S;  1RAO A;  2GO8 A;  1GK8 A;  4O4G B;  5HAN A;  4K4W A;  1AXQ A;  3DU5 A;  2QL9 B;  3E3X A;  2HHS A;  2M70 A;  3ETM A;  5AE2 A;  5D4N A;  1U47 A;  3ILL A;  3AXK A;  5KFR A;  4KH1 B;  2M3D A;  1UEU A;  2V4Q A;  4DSE A;  5AJ3 J;  2MTL A;  4OI4 A;  4FYD A;  2BKP A;  1Y5L B;  3IBW A;  4ZVU B;  3PFE A;  1EET A;  1WEL A;  3BR8 A;  4TU9 A;  2HWH A;  4RW7 A;  1VBZ A;  1KS2 A;  1PCA A;  3H5S A;  3DLH A;  4NXN J;  2CQP A;  4NCB A;  5HMY A;  4CO5 A;  3W7B A;  1L3T A;  2NUU G;  2P6S A;  4RBT A;  2DVI A;  1D9A A;  2BM1 A;  5F0U A;  3FUY A;  4F3Q A;  1RBL A;  2DR6 A;  3M6W A;  4FP9 A;  3GIL A;  1UW4 A;  1BGX T;  4F36 A;  5E41 A;  3VGV A;  2GQQ A;  1NPR A;  2YWE A;  1UJ4 A;  4J9N A;  1D1U A;  3UN2 A;  4X4R A;  2OAU A;  2DO4 A;  4OX9 J;  1MSW D;  1NK4 A;  5KG1 A;  4IQM A;  1RAJ A;  5B0C A;  1J5E F;  2ZDP A;  5HQM A;  5CYM B;  2VFT A;  2H4W B;  4AXI A;  3KWM A;  4ZCI A;  5HL7 Q;  2MYF A;  5C25 A;  1GH8 A;  4FXW A;  1JXL A;  2AJ4 A;  1TL1 B;  2V8H A;  3TNV A;  4X65 J;  3BB5 A;  3VWS A;  3MTJ A;  1A7G E;  2LEP A;  3ZZZ A;  3QMQ A;  4NLP A;  1S1U B;  3LP1 A;  4DWI A;  5IT9 U;  1PIE A;  3M2U B;  4LFA J;  2J9D E;  2EI5 A;  2W24 A;  1WHV A;  3CD6 S;  3WDO A;  4ELU A;  2LA6 A;  2DK2 A;  4F4A A;  1YDL A;  2BW7 A;  5KTQ A;  4DUZ F;  4DV7 J;  4JI2 F;  3B8H A;  4KKO B;  3NP5 A;  3M8W A;  2GIF A;  4OI6 A;  3PIO Q;  1S6Q B;  2ZOF A;  3V2U C;  2HHQ A;  2CPD A;  4B3R F;  2Y3Y A;  2ZBI A;  3GB0 A;  1FNO A;  3DDN A;  3T41 A;  2DGT A;  1TP7 A;  3V4M A;  2QYG A;  3DLK B;  1YBT A;  4TN2 A;  3I32 A;  4YB5 A;  4WJB A;  3W61 A;  1KLN A;  1GTH A;  1TQL A;  3JTN A;  4USJ C;  3ICL A;  3ET6 A;  4RO0 A;  3BYR A;  4CNY A;  2CDQ A;  4LF8 F;  4ECX A;  4GKK F;  2H65 B;  3MM9 B;  1WDT A;  2W9C A;  4DZD A;  3C19 A;  4QYR A;  3QWU A;  2V63 A;  2MZS A;  5IZH A;  4RUC A;  2KM8 B;  2KT2 A;  4PXD A;  2FHJ D;  2ZNY A;  4ILR A;  4RU9 A;  3LPY A;  3FSI A;  2E9T A;  4FF4 A;  1NO8 A;  3GMG A;  2GCF A;  3NCP A;  4DXL A;  1TK0 A;  1UZD A;  1JMT A;  5B0D A;  2UUB J;  5HVG A;  3I55 S;  3ZTQ A;  4B3T F;  1JLF A;  5H9E K;  2CZ4 A;  2E5G A;  3S1T A;  3IWX A;  1KR4 A;  1VYA A;  3PX6 A;  1PG5 B;  1U2C A;  1GMV A;  3VAF A;  2OLW A;  1U6Z A;  4D3H A;  1YJU A;  2QG9 B;  1UPP A;  1SKR A;  3LA0 A;  2CNN B;  3N4W A;  1UVN A;  2UXB J;  4Q0B B;  1XTZ A;  1WTB A;  3QAE A;  2LXI A;  3CJ3 A;  1K1S A;  5ETM A;  3M32 B;  4FYX B;  3ENQ A;  3NS7 B;  4K0K J;  2OIH A;  5H9F K;  3EVO A;  2XO7 A;  5IT0 A;  1MRO A;  1FVS A;  3VAI A;  1WEX A;  2GJI A;  3NY0 A;  2P5V A;  3QLH B;  4WXO A;  3VAM A;  3SDE B;  2MZJ A;  3H2U B;  4JBC A;  1FE0 A;  2DY9 A;  2M9K A;  1LXJ A;  2C3O A;  2YNH A;  4K2J A;  4MMO A;  1R0A A;  1N8R T;  1U1O A;  1UWA A;  3D3C J;  3D7S B;  1CJK A;  2RDJ A;  4USW A;  2ZBC A;  4ZVG A;  1NKC A;  1XJW B;  1B0V A;  5KFC A;  1KSP A;  1ZYQ A;  3W9J A;  2WHO A;  5DZ7 A;  2QJ3 A;  5A8R B;  2QL5 B;  1RWK B;  1HBM A;  1M1G A;  2YQ0 A;  3DOK B;  4OL8 A;  5HVH A;  1C4A A;  3FSY A;  3N5F A;  2B9E A;  3VAL A;  1I1G A;  4K50 A;  1UVL A;  2N7Y A;  3KLF B;  5MAO A;  3RZA A;  3HDS A;  3V4I A;  4ZPC A;  1WAC A;  4IH6 A;  5DJB A;  3G6E S;  2FLL A;  3SQO P;  3R2C J;  1NBE B;  5KFF A;  1TU0 B;  1FD2 A;  2HBY B;  2KRR A;  2M5Y A;  3D54 A;  2GQ2 A;  1X9W A;  1WF1 A;  4ZOS A;  1UA1 A;  3NGT A;  5A0Y A;  1R6Y A;  1S49 A;  2DNY A;  2RUG A;  1VOM A;  3D6M B;  2AP6 A;  4M8L A;  3RG6 A;  1P8G A;  5BYS A;  4ES2 A;  4ICL B;  5DDO C;  3Q8R B;  3EPI A;  3VQS A;  2MY7 A;  3W66 A;  3V6J A;  1JLB B;  2AJQ A;  4PAB A;  2F3J A;  5LSL A;  4K59 A;  4DFK A;  3P49 B;  1AFI A;  1IUJ A;  3I0R A;  3LGN A;  3EXC X;  4ZLP A;  3CCS S;  2W2Q P;  3PHE A;  3AJD A;  2OPR B;  4YP3 A;  4O44 B;  3R9L A;  1Y3J A;  3M2V A;  1REV B;  4Y3C A;  2XWX A;  4ZVH A;  1NKB A;  2BJ9 A;  4BC9 A;  2VOO A;  2NZ4 A;  2LP4 A;  3D68 A;  4I64 A;  3MUV P;  3OW2 R;  4J91 A;  4CNZ A;  3GG0 A;  3GLJ A;  3O3L A;  1KD1 T;  4B9S A;  2QA4 S;  3QAT A;  4K4Z A;  5G4D A;  2M4M A;  1M90 T;  2CAJ A;  4JI6 J;  2CUY A;  1ZA2 B;  2AKW B;  2Z0G A;  3MFH A;  4IFV B;  1TUG B;  1SKW A;  4JI5 F;  1UA0 A;  4ED4 A;  1YRT A;  1YHQ S;  3CED A;  3VGT A;  1BMQ B;  2ZZN A;  4AL5 A;  3T9Z A;  4DQI A;  3D5M A;  3HVT B;  2FJD B;  1IR1 A;  3HZE A;  3UDV A;  3ONQ A;  4OI2 A;  4USM A;  2YTC A;  3ADA C;  1MU2 A;  1YSJ A;  2OPP A;  1HD1 A;  2RJZ A;  4KH0 B;  4L73 A;  2COL A;  2YNG B;  3MEC A;  4OJ3 A;  4OZ0 A;  4C0O C;  1XK8 A;  2D69 A;  4NRT A;  1K1Q A;  1O0P A;  1SV5 A;  3D6T B;  1Q1K A;  3HKZ D;  1WSR A;  2W25 A;  4OYI A;  5A8W B;  4FS1 A;  3C8Y A;  2WCX A;  5BR8 F;  5A2Q U;  2FGO A;  2GC8 A;  2H51 B;  3A3N B;  4F02 A;  4L6V 3;  2BX6 A;  3FNN A;  1X31 C;  3WBZ A;  9RUB A;  1EKS A;  3MDF A;  4KV8 B;  2VQE F;  4DCO B;  4F50 A;  5J2M A;  4NZ0 A;  5E3R A;  1YI2 S;  2YNF B;  3DYA A;  1LK7 A;  1M5K C;  3R2D J;  4HAC A;  4P2M A;  1U0S A;  3OFE A;  1R8P A;  4PQA A;  2I5J A;  3AHP A;  1C1C B;  2JLG A;  2RS2 A;  3RU0 A;  5L46 A;  1TKX B;  2AIR B;  2JLF A;  2BJ7 A;  2P8I A;  2UV8 A;  3EJM A;  3G82 A;  4ZP8 A;  4DV0 F;  3CJT A;  4PWU A;  2D3O 1;  4Y65 A;  1DFD A;  4I6W A;  3D9B A;  3L7U A;  4NLS A;  2L9D A;  1ZM2 A;  3RW7 A;  3TAP A;  2EK6 A;  1IM4 A;  1RWX B;  5KT4 A;  2LDI A;  2YX1 A;  4EO8 A;  1NK8 A;  1NB7 A;  4PQU B;  1Z4U A;  2QO3 A;  1LV5 A;  2R7O A;  4CLZ A;  2HFN A;  5CZV A;  3T1Y F;  2C2D A;  1R8B A;  3GZ7 A;  4UY8 T;  1I94 F;  4Y6I A;  3MR5 A;  1XNR F;  3TAM A;  3T1H F;  3MOZ A;  2CXE A;  4C8M A;  4CLT A;  1U0H A;  1ZBT A;  1FES A;  1N5Q A;  3AQP A;  2HVD A;  2YH1 A;  1CJT B;  1FDA A;  1PO6 A;  4RKU C;  1S1X B;  2XI2 A;  1JJ2 R;  4OYO A;  2QTW A;  2EBG A;  3O2I A;  3SV3 A;  1F9E B;  1U8S A;  4CO2 A;  1QSS A;  1ZS6 A;  3A12 A;  2FVR A;  2R7X A;  3EMT A;  1TFY A;  2R7V A;  1V3R A;  1GQE A;  2C22 A;  5E33 A;  1YJ9 S;  3HXM A;  2ZJQ Q;  3SYZ A;  1SC4 B;  2PI5 A;  3BBC A;  2B9X A;  4X64 F;  1IR2 A;  2Z2L A;  5J2P B;  3MM6 B;  2MSS A;  4DG1 B;  1SJ3 P;  1RT5 B;  4WYL A;  3P6Y C;  2XS2 A;  1QVG R;  1EKR A;  2VBY A;  4RW9 B;  1JX4 A;  4C48 A;  1JKH B;  2HNZ A;  4NEY A;  1VRU A;  2G1D A;  2GJ2 A;  3BR9 A;  2WSE C;  2VQF F;  3JAM U;  3CVK A;  4NE9 C;  3CDE A;  2QLX A;  1VRT A;  2M7S A;  4NPO A;  1RWV B;  4CLP A;  1AW0 A;  5KAK A;  2YKN B;  3CDB A;  3MUR P;  2V4R A;  2Y1R I;  4R25 A;  3MR7 A;  3BQ0 A;  1S9E B;  3UVJ A;  2HIQ A;  2OEL A;  3FK4 A;  2AEF A;  1IWA A;  4KGM A;  1FDD A;  1AB8 A;  2F9D A;  4F4X A;  1K8A T;  2LCW A;  4J9S A;  2C2R A;  2DGS A;  3H4B A;  5LMN J;  4AE5 A;  3OD2 A;  1TKX A;  4DV7 F;  3KG1 A;  2HLU A;  2RVJ A;  2IDL A;  1SL0 A;  3HHL A;  1ELO A;  3LAL A;  2EPI A;  1CC7 A;  2RU3 A;  3C15 A;  2IDE A;  3MCS A;  4HAC B;  4YME A;  1HWI A;  2W2O P;  2JJ4 D;  3OJU A;  1S59 A;  3JB9 k;  1Q81 T;  2ZEJ A;  4RW6 A;  2LEA A;  3W8P A;  2O01 C;  5HO4 A;  2G2Z A;  1Y00 A;  2B8Q A;  1J2V A;  4FPR A;  2V94 A;  4FYY B;  1TTH B;  4A4J A;  5M2P A;  4ECR A;  1F5B A;  2BAN B;  2VIH A;  2JVO A;  1VLO A;  3CPW R;  2VL1 A;  1GXL A;  3DC2 A;  1S1W A;  3H25 A;  2CWK A;  1NRK A;  1T9X A;  1V9O A;  2ZZT A;  3AOA A;  5D0R A;  2UXD J;  2XG8 A;  3EYZ A;  2PI4 A;  5D77 A;  4L74 A;  4P52 A;  2FZC B;  2FQQ B;  2W7A A;  5KG4 A;  2NXC A;  4ED1 A;  1N36 J;  4K5S A;  4DR6 F;  5FJ4 A;  2YKA A;  1C2P A;  2MKK A;  3HVT A;  1SIW B;  2R2R A;  4DV2 J;  4FVM A;  2K2P A;  3ZO7 A;  3HO1 A;  1NND A;  4C8Y A;  1X0F A;  2DR7 A;  5KFN A;  3TAQ A;  2AX0 A;  1HYS A;  3IP0 A;  4J37 A;  2EK1 A;  2ASD A;  2IBK A;  3D4J A;  3RRK A;  4UY8 5;  3SSQ A;  1G2E A;  2HS3 A;  3M2R A;  4OZ5 A;  4CLK A;  2JHE A;  2J6U A;  3DRR B;  3KXD A;  5ETL A;  3S8S A;  3EZO A;  3MHY A;  3PYG A;  3F56 A;  5CQG A;  3TZZ A;  1WEZ A;  4NLX A;  2CKW A;  4E2F B;  4J9O A;  2HMI A;  3QRR A;  2UXB F;  3BN7 A;  1IKY A;  3A1Y G;  2I9S A;  3W60 A;  4JYA F;  1MLA A;  2YNI B;  3TW0 A;  3H7H B;  1HNI A;  1UKU A;  2Z2M A;  5ETT A;  1FKP B;  3PY8 A;  4G6V B;  3JSM B;  4DL7 A;  2X3G A;  1XMQ J;  2HHU A;  2PMH A;  2OPR A;  4PG4 A;  1FWK A;  4H4K A;  1R7I A;  1B0P A;  3MPU B;  3NOC A;  4PCQ A;  4PXB A;  1FNM A;  3CIM A;  3V81 B;  1UFW A;  2C1E B;  3FKB A;  3K17 A;  2F5G A;  2C2K B;  3I0R B;  1HMV B;  5CA5 A;  4ED5 A;  3BEG B;  4DL5 A;  4ILL A;  4OX8 A;  2MDA A;  2MZ1 A;  3HD1 A;  3PYD A;  4KIA A;  3MAH A;  5K5M A;  2F4F A;  3RBX A;  4CP5 A;  2BDP A;  4QCL A;  2IY5 B;  2VDH A;  5GAH I;  2Z4P A;  2DNL A;  3BO3 A;  3DMJ A;  2IMW P;  2CQB A;  3AOC A;  4EBD A;  1TAU A;  1W26 A;  4ED8 A;  1O6X A;  1RBA A;  2MQL A;  3G6X A;  4J9P A;  2GIQ A;  3T9N A;  4ID5 A;  3QIP B;  4DR1 J;  4O3O A;  1HBN A;  5GAD U;  2D3O R;  1WHW A;  5B7W A;  1HBO A;  1FX2 A;  2A0F B;  4PG8 A;  5I42 B;  2YH0 A;  3LP0 A;  5KG0 A;  2EW9 A;  3GR1 A;  3MR3 A;  3Q22 A;  3BO2 A;  3OSP A;  3TUP A;  3KLF A;  4ER8 A;  3K8W A;  1FKA F;  1KBR A;  4IYQ A;  3QBC A;  4ETZ A;  2Y8Y A;  3GCX P;  5LOQ A;  1NAQ A;  5LSR A;  6FDR A;  2DJW A;  4Z7Y A;  4G3I A;  2RQM A;  3HSG A;  4ZPA A;  2ADC A;  2DGW A;  1NXI A;  1WHY A;  1JLA B;  1BY9 A;  3CTR A;  3DRY A;  5A8R A;  4CM2 A;  7FD1 A;  4YR0 A;  2KG0 A;  3A3P B;  2GAG C;  1HI8 A;  3MPD A;  3SQG A;  3THV A;  1ZZF A;  4DZ6 A;  1FRL A;  5KFG A;  3RBE A;  2AYE A;  4HI2 A;  5K14 A;  3TA1 A;  4DV6 F;  1U48 A;  4NXN F;  2C3U A;  3LTO A;  3QT6 A;  4RW8 A;  4ZIV A;  1ZTT A;  1VR6 A;  3ZZO A;  1EJ7 L;  3UQS A;  2CNL B;  2AZ3 A;  2UUB F;  2NQP A;  2LQ9 A;  3MFI A;  2XMK A;  2Z2Z A;  2YX7 A;  4A46 A;  4DPT A;  4QIW D;  4ES3 A;  4ZVF A;  3WC0 A;  4A8Y A;  1S0N A;  4HKQ A;  4PUO B;  2FJA B;  2OKQ A;  3LAK A;  2QZ8 A;  1X5S A;  2FUG 9;  3UWT A;  2MMY A;  2JEI A;  3AB2 B;  2OI2 A;  2ATC B;  3PRB A;  1D09 B;  4ZCK A;  3OVS A;  5KFH A;  4M95 A;  4B3M F;  1SQF A;  2PSZ A;  5HP1 A;  1RAD B;  4X4O A;  3M9O B;  4ZK7 M;  1S57 A;  1R89 A;  4I67 A;  2HFV A;  1FVQ A;  1YTY A;  2J0Q D;  3BH6 B;  2E1M C;  3AD8 C;  5E0O A;  5T41 A;  4AXJ A;  4X62 F;  1R8H A;  2R7R A;  2HIY A;  2YPZ A;  5HSP A;  1RHM B;  1R31 A;  2ASL A;  5JMN A;  1S6P A;  2R8K A;  2V0N A;  2VBX A;  1CJV B;  2B7C B;  3MWB A;  4QIF A;  2BAC A;  3EGN A;  1U8W A;  1OJ4 A;  1WKK A;  1RWW B;  3FFI A;  3KJV A;  1T03 A;  4QR1 A;  3UN5 A;  3N0V A;  2D3Z A;  3QSI A;  5GVQ A;  2EC0 A;  2ZZM A;  1P9Q C;  4G1P A;  3M8R A;  5HP1 B;  1RK8 A;  3J7A N;  3I56 S;  2G2Y A;  4ANE A;  4ZKA A;  3HMJ G;  4IDK B;  2PE8 A;  4DPX A;  1HYS B;  1XNR J;  1FRK A;  1RTZ A;  4UW2 A;  1VQS A;  2BQ3 A;  2V2Z A;  1QVF R;  2AF6 A;  1NPK A;  3D1Q A;  3ZC4 A;  1BWV A;  3OTB A;  3M1V A;  3NRB A;  4RW8 B;  1SJ4 P;  3MOJ B;  2H1Y A;  2I38 A;  3UPF A;  5K14 B;  2A10 A;  4U6P A;  2KL8 A;  3M1V B;  3SQG B;  3GON A;  4DV3 F;  3I6P A;  4E0D A;  1UVM A;  3SXL A;  1S1U A;  1WSV A;  3LP1 B;  4KGX B;  4C8L A;  4M5J A;  4X66 F;  1R0B G;  3PW2 A;  1T94 A;  1QM9 A;  1HWL A;  4U96 A;  2PDA A;  1RHK B;  1X4F A;  3PYE A;  2FPH X; 
#chains in the Genus database with same CATH homology
 3SIP B;  1RWP B;  1RHU B;  2QLF B;  2XZT B;  1RE1 B;  1RHJ B;  2H65 B;  2H51 B;  1RHQ B;  1NME B;  3KJQ B;  3R7S B;  2XYP B;  3R5J B;  1RWM B;  2C2O B;  2P2C B;  4DCO B;  3P45 B;  2C1E B;  2C2K B;  1GFW B;  2Y0B B;  3P4U B;  2HBZ B;  2XYG B;  3IBC B;  1RWX B;  2CNN B;  2DKO B;  5IC4 B;  3NS7 B;  1I3O B;  1ICE B;  1QDU B;  2HBQ B;  2XYH B;  2CDR B;  2XZD B;  5IC6 B;  1SC3 B;  2H54 B;  1F9E B;  1PAU B;  1I51 B;  1SC1 B;  1QTN B;  4ZVR B;  2H5I B;  2QL5 B;  1RWK B;  4ZVS B;  3R6L B;  1SC4 B;  3GJR B;  4DCP B;  2QL9 B;  2C2Z B;  3QNW B;  2CNL B;  2C2M B;  3GJS B;  4ZVO B;  3R7N B;  3GJT B;  3RJM B;  3EDQ B;  1RWV B;  2QL7 B;  1RWO B;  2HBR B;  4ZVU B;  2HBY B;  2CNK B;  3D6M B;  3D6H B;  1RWN B;  3EDR B;  4ZVP B;  2QLJ B;  3R6G B;  3KJF B;  1RHM B;  1PYO B;  3R7B B;  2H4W B;  1RWW B;  2QLB B;  3D6F B;  4JB8 B;  2CJX B;  2H48 B;  1RHR B;  2CNO B;  2H5J B;  2FQQ B;  4ZVT B;  2Y1L B;  3IBF B;  2CJY B;  4DCJ B;  3KJN B;  1BMQ B;  2H4Y B;  4ZVQ B;  5K20 B;  1IBC B;  3GJQ B;  1RHK B;  4LSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...