3R7SB

Crystal structure of apo caspase2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-2 subunit p18
total genus 21
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7sB00
2XYGB 3KJQB 1RHUB 5IC4B 2C2MB 1F9EB 3IBFB 2H51B 4ZVUB 1RWVB 2HBYB 2QLFB 5K20B 2C2ZB 3QNWB 4DCOB 2CNKB 1RHMB 1SC3B 2CJXB 2CDRB 2CNOB 2QL7B 2H65B 2HBZB 3GJQB 4JB8B 1RWNB 2C1EB 2XYPB 3GJSB 3GJRB 3P45B 2H48B 4ZVPB 1RWKB 1ICEB 2QL5B 3SIPB 2XZDB 3NS7B 1BMQB 1RHQB 4ZVQB 2QL9B 3D6MB 3RJMB 3EDRB 1RHKB 3EDQB 1SC1B 3GJTB 2CNLB 2H54B 3P4UB 1IBCB 3R7BB 1NMEB 2H4WB 2H4YB 2H5JB 1RWPB 2Y1LB 4ZVRB 4DCJB 2HBRB 3R6GB 3R7SB 2P2CB 3KJNB 1RHJB 2FQQB 2QLJB 1SC4B 1RE1B 5IC6B 1RWWB 1I3OB 3D6FB 3IBCB 4ZVSB 2XZTB 1QDUB 1RWOB 1PYOB 4ZVTB 3R5JB 3D6HB 4LSZB 2XYHB 4DCPB 2H5IB 3R7NB 2C2OB 2Y0BB 1RHRB 1GFWB 1PAUB 2DKOB 2QLBB 2C2KB 1I51B 4ZVOB 2CNNB 3KJFB 1RWXB 3R6LB 2HBQB 2CJYB 1RWMB 1QTNB
chains in the Genus database with same CATH superfamily
2RQKA 3JAMU 4IUFA 2WB1D 2XSJB 4OI1A 2LQJA 3KLGA 3H90A 1FEHA 4HHJA 4K4XA 2Y1IA 4IFVB 2FHMA 4LFCF 2VG5A 4LR7A 4ZCKA 3DU5A 3G8SA 2LEAA 2ILYA 3QGPA 3W5YA 2GJIA 5L9NA 1N5VA 2MZTA 2DYAA 1HA1A 2RHQB 3E8OA 4YR3A 3TRGA 4NX9A 2R8GA 3CJKB 1JLEB 4YB5A 4WXWA 4KQZA 1DURA 3MECB 4Z7CA 4KH0B 4U95A 4B9NA 2VPZB 4GVBA 2J0XA 4Y2AA 2N3LA 2KXNB 1CLFA 2XULA 2VG6B 1XEZA 1SH2A 1UFKA 1FTRA 3NS5A 3TANA 1FKOA 2XMMA 1VHFA 1K73T 1WHYA 1SKSA 1H6KX 4TYBA 1WKKA 4NEYA 1FERA 4JI8F 2A6MA 2LKZA 4F3MA 2W9BA 1FVSA 2KKHA 4JB8B 1RWNB 2QG9B 5ETOA 4Z37A 1U1NA 1W2BR 1SL2A 1IBMF 2M52A 2WSCC 4ED3A 3T5JA 4G3IA 2XYPB 1GXUA 2C3UA 4HACA 3PJXA 4ZVPB 4AQYF 3RR7A 2RKIA 1K1SA 2ZVIA 2B43A 3MPYA 3Q8VA 3G6VA 1XNQJ 2J9CA 3BGLA 1KVIA 2J0QD 3SIPB 4KHPJ 3T9NA 3K7RA 2UXDJ 1B7YB 4DR5J 2CXEA 1NHKL 2M3DA 5J2NA 4Q2LA 1MNEA 1NK6A 2UUCF 5GMEA 4PRFA 4DR1F 4IQXA 2QL9B 2OPPA 5ITHA 4K4YA 4A47A 2M2BA 2ZNYA 4NL5A 1E6YA 1HBUB 2NYIA 2RRNA 3US5A 2CQGA 4BCAA 4DPUA 2E5JA 5B09A 3GIIA 2FLNA 2GJFA 5GADU 2E5HA 2SXLA 3FFIA 2N3OA 5MLCV 4FVCA 2V8PA 4NPOA 2HSEB 2QA1A 1FE0A 3DHWC 4Q2MA 2J0WA 1QSYA 4ZLJA 3C3LA 1EARA 4OV1A 1HNXJ 1S0VA 2ZZMA 1HD1A 2FZCB 3KG1A 3V5RA 4MIBA 1M90T 3QJJA 4WFNQ 3C16A 2HHTA 5J2NB 1J5EF 2JZ5A 2MJNA 2R8IA 1IJFB 1CJKA 1KLMB 4DCJB 4GC7A 1U6ZA 2UUWA 3MM5A 3RU0A 2QEXS 2V5HG 1SH3A 3D5MA 2E5LF 3HHNB 2U1AA 3AXKA 4YB1P 1IN0A 1S9EA 2M5YA 1RAHB 4DV1F 2QN6B 2F4VJ 1HLWA 3ELHA 3IC1A 1U2CA 4HL9A 5JUMA 1HBNB 3ZTSA 2VFUA 2HRTA 2K8GA 4DQQA 2N7YA 1B0TA 2Q43A 3H8YA 3IBCB 2VFVA 4BLGA 1QDUB 5H9EK 1UWBB 4QYZK 3H59A 4LR8A 4PUOB 1HMVA 5CAAA 3CMES 3RBXA 2YPYA 4GKJF 3C46A 3IWNC 4NLTA 2O67A 3LGNA 4CDIA 5J1EA 5CD4H 1N54B 3QGGA 4O44A 4AXJA 1C4AA 4Q5VA 2OD6A 2L9WA 1VQPS 1RADB 2OLWA 4X62F 4IH6A 2GQQA 3LA0A 1WSVA 2X51A 3MCNA 3P5TL 2I9SA 3QJLA 2RAQA 2ALZA 2XY7A 1S72S 2C2KB 4ZJOA 1S9GA 2UU9F 1G4CA 1HD0A 2LU2A 3M2RB 3M1VB 2WVDA 4YB7A 5CXTA 4M5HA 1HW9A 2FGCA 2YWHA 2DNQA 2JFDA 3J7Z5 1TP7A 4JI8J 3OT9A 4KAIA 2HHXA 1F5BA 4PABA 4FN5A 3VVUA 4DBQA 1R43A 2V69A 2V94A 5A8RA 5C2CA 3I55S 4JV2A 3V6KA 3AFGA 4N7TA 1R0AB 3C16B 2BKOA 1CC8A 3BQ2A 3E2EA 3LP1A 4DPOA 4XPCA 1FRXA 4JI5J 1BLUA 3QT8A 1OS5A 3I32A 3J80Y 1RA6A 1FJGJ 3GFHA 4BWJA 1YK9A 3UVJB 4DV7F 2YWKA 3NWRA 3KWMA 2E7XA 4B9UA 2CPZA 1TL7A 4F4KA 5CCLA 3SZ2A 1RTJB 2QSWA 3RRGA 4KGMA 2AIRB 2R42A 1AFJA 1EKRA 3VAJA 2AGOA 4LBHA 1RT6A 4WCEQ 4LFCJ 3GYXB 2DCUB 3CDWA 3WC0A 1C2PA 2W9AA 2RU9A 1V5VA 3RB3A 2P6TA 4NXMJ 3BS9A 4OYIA 2DNKA 1OIAA 1WF1A 3IAS9 1RT1B 3J7ZT 1RLCL 3OPKA 1D09B 3M30A 4PWDB 2D3UA 4Y3CA 4A8QA 2P8IA 3OL8A 1HQ2A 2DITA 2O66A 2BKNA 3EGNA 4CLYA 2UUBJ 5SUHA 1KQGB 4V19X 2E1MC 4BHQA 5KT2A 1O5JA 2OPRA 2HQFA 1F3FA 4N8NA 4RLEA 3ZNUA 3R1HA 2Y9HA 1UFWA 3LPYA 3QYYA 1JLCA 4NRTA 4USJC 3JYTB 3CCMS 1NB2A 5DGAA 1C0UA 1FESA 1C1CA 1Y0HA 3G71S 4PAAA 4XAKA 3RRHA 2BOPA 4PWDA 2HKEA 2DXFA 1HHSA 1NU4A 2UXCF 2CQDA 5KAKA 1EIYB 3GYGA 2VONA 4OX8A 1IJEB 3MPUB 3IN5A 2F8MA 4BC7A 3EDQB 4Q0BA 1F9FA 4NCBA 4DL2A 2Y8YA 5HMXA 4USUA 2LMIA 3SYZA 4RW7A 4CIOA 4ED1A 1RTDB 1MW7A 4PG7A 4DPTA 1QD1A 2DEJA 2DB1A 2MKHA 5B7WA 2JVOA 1AA1B 1CJVA 1E6VA 2IDEA 2YNHB 2W9BB 3QZ8A 1Q86T 3C19A 1SXLA 2DTJA 1EQ0A 2GQ2A 4DR6J 2CA9A 3H5XA 3BR8A 4UOGA 2RIJA 2ASJA 4K0KJ 2G0CA 1MROB 1WI8A 3NGSA 5EX0A 4CO1A 4DR7J 3LH2S 1BQXA 1LWCB 1SC4B 1A0OB 2OSQA 3D1OA 4OI4A 5T41A 3FBCA 5C7PA 5DDQC 2VA3A 3BF4A 4X84A 4JI0F 4DLGA 1RXOB 4DG1A 1RTDA 3GCXP 4ZVSB 2O3DA 3DN9A 3DOLB 4CLZA 4DWIA 4KO0B 1HPZA 2JEIA 3VAGA 4ID8A 2FYXA 2FHJA 3FEYB 2YH1A 4DN9A 4LFAJ 2A2CA 1N33F 5A8WB 5B0DA 4GO7X 1BQNB 4ZHRB 3TA1A 1U0HB 2HMIB 2E9RX 5C2GA 3D3BJ 1HBOA 1SV5A 2E7VA 1TR0A 2CDQA 4EEYA 1NK0A 2UXDF 1BXNA 1S48A 3W60A 5AE2A 1HW8A 3QPIA 2APOA 4WP9A 2BE2B 2RMLA 4UQTA 4J9QA 2O5DA 3KK2B 2OI2A 3EZOA 3QSYB 1X9WA 4PYAA 2DHXA 4ZLPA 4B3RF 4Z2XA 3N5BA 1Y10A 1GQEA 1UP1A 5ETTA 2IDLA 1R8HA 4Y6IA 1C4CA 5K5MA 4WFBQ 4RW4A 4RW8B 1RACB 1X4DA 3TZXA 4DV0F 3P49B 1GMWD 2OEMA 3K8VA 2CPFA 2YH0A 3HJFA 3ITHA 3CO0P 4QCLA 3NOCA 4RW7B 1IR2A 3ENWA 3KDNA 3P96A 1FT8A 3V6DB 3D1QA 3KK2A 3H0PA 3MWBA 1VQ8S 1Q8LA 4F0HA 4DX5A 2A0FB 2MZJA 2JFKA 4DHVA 3CJ2A 2IRXA 3B4DA 3HZGA 5ETPA 3MEDA 5A2QY 1UMJA 3DI6A 3OR1A 4HDHA 4DUYF 2HHSA 1UVLA 4IFYB 2R7RA 4O44B 2V50A 1JXLA 4LF2A 5ETRA 4RU9A 1HR0F 3SBMA 2BE7D 4NOHA 4J90A 4K7QA 4YS2A 4LQ3A 2V4QA 3UI3A 4DR3F 3K5MA 4B3RJ 5KFLA 3GIRA 2C3YA 3WQPA 3OQ2A 4Y34A 1D0EA 4LRFA 2OUGA 4JI2J 4IDKA 5LOQA 5KFBA 4NA2A 3DLGA 2HK3A 3TEGA 3W65A 5A8WA 4F4YA 1ACMB 1G3OA 5EHHA 4MKVA 1NK5A 4ECQA 1DHMA 1GH8A 1WHVA 1XBWA 2MSSA 4ATNA 5IM0B 3MEKA 1VBXA 4R25A 2MGZA 2VIHA 1UEVA 2RKIB 1YZ6A 4YP3A 1YWXA 3TZWA 1KTQA 1OYDA 2VFRA 2ASDA 2HURA 2Z56B 2VICA 1FDNA 4WK3A 3PG9A 3W66A 4ZPAA 2XNQA 4O0IA 1WSRA 2JC0A 2EK1A 4C7QA 1IBLJ 4LF5J 3LO3A 2OKQA 2FJDB 5D3GB 1D1UA 4KHMA 1RTZA 2GA7A 4NI2B 3A13A 1PC4A 4UOCA 4WFZA 4HLBA 4ZVQB 4DR2F 2WZ1A 1EP4A 1NEEA 3RB4A 2QA4S 1LK5A 4MAKA 3ZC4A 4DSIA 1FRHA 1RHKB 3DDNA 1LW0A 1RB0A 4OZ0A 2PMHA 3HLUA 3GFXA 3OSPA 4UTGA 2CQ2A 3M32B 1YJRA 2QYCA 2EI5A 3BSAA 5HQMA 1H2UX 1VI7A 2VBZA 2R7OA 4PKDB 2MY8A 5IT0A 3DRPB 4N76A 2IVFB 2H4WB 3VGVA 2YQ3A 1LFWA 2CFXA 2MLZA 3DMJA 5HLFA 1MWZA 4DSKA 1CVJA 2OIHA 2UVRA 2YX7A 5KFOA 4ECYA 2KHCA 3MEEA 4JI7J 1KDNA 1VHIA 2W2OP 2HIQA 5C42B 3KJNB 1FD8A 5I3QA 5DDPC 4K4ZA 1JNZB 1RA7A 3OUYB 1MG7A 4ZMMA 1KVJA 1WEZA 3T5KA 1YSJA 2JDJA 3ZZRA 3M8SA 4DR5F 1U6BA 1HNZJ 3HO1A 3FZ2A 3FRYA 3J81j 2D3O1 4RWWA 2GHWA 5LSLA 2ZBIA 4TU9A 2I1RA 2CZ9A 3L95X 4KRWA 1WDTA 3E51A 3JQJA 3NBPB 1SQGA 1HHTP 1AT1B 1VC5A 1Q16B 3W5ZA 3A8IA 5L39A 4EBEA 1LK7A 1T0TV 4PG5A 5F9LA 3CCJS 4FF4A 1DJ0A 1IBLF 4P73A 4LF5F 2C2OB 2M4MA 3NKYA 1DTTA 4ILRA 2UVWA 2AJFE 2J8AA 4B17A 2IJRA 4NXMF 1SQEA 1UTAA 4QIGA 4IRDA 5JVHQ 3SDEB 3ILLA 1K44A 1VRUB 1X0PA 3WDOA 1YJTA 4ZK7M 4NCAA 2HBQB 2V2ZA 3QQCD 2W4DA 2B4UA 3W8PA 2J0SD 1IKYB 1W26A 2BJ1A 2F63A 4IOCQ 4FF3A 2PDAA 2XMVA 3CD0A 4A8MP 2XSFA 2Y1JA 2GX8A 2KJVA 5HO4A 2D9PA 1T9XA 2FVQA 5A6WA 3KJVA 5KFKA 4O3PA 1IKWB 4F26A 4B3OB 1RCOB 3FMBA 5BR8J 1ZZNA 3BN7A 2IA0A 2OFHX 1F9EB 3AA9A 4R0JA 4FBUA 3FEZA 4DV4J 1NH7A 9RUBA 3JSMB 2B56A 3IO1A 1FNMA 2QLFB 2C2ZB 3HM9A 4E98A 4PWUA 2ZDOA 4EBCA 3PZPA 1OPZA 1U2FA 7AT1B 2V9WA 1W25A 2WRMA 4IH5A 2ZUGA 5B0EA 4H4MA 4USKA 1X7VA 4LBPA 2ZZTA 3OTOF 1TL3B 2XS2A 4LFAF 4HYKA 3C6TB 4X4SA 4DOZA 2CPEA 2NZCA 2RJZA 2WVCA 3QWPA 5KFXA 3QIPB 2BJ3A 2J5AA 3CD7A 5CCMA 2ADCA 2BW2A 2JEFA 4X66F 3MECA 1NZAA 1CC7A 2OPRB 5GAEU 2GFFA 4OZ2A 2CPHA 4CLUA 2HQ3A 2FJVA 4RBUA 4UUXA 3BSNA 1WC0A 2HQIA 2B6AB 1R6VA 2QTWA 1HWKA 1WUUA 1VIOA 1SKUB 2LVWA 1V9OA 2WBRA 4QR0A 4U7UK 2NPFA 4A4JA 5LJ3Y 3VQTA 1SI9A 1U6FA 3NGRA 4B3MF 2AJ2A 1ZA1B 1RAIB 1ZM4A 4UF4A 4F02A 3AD7C 1MWQA 4M5MA 2RVJA 4NMLA 4X64F 4TQRA 3HK2A 4DV5J 3BZQA 5BYQA 3SEOA 4ECTA 5DLFA 2LECA 3KOAA 5B0BA 1J27A 5H9FJ 4ED7A 2Z0GA 2CQ0A 5KG2A 2UUAF 4WF9Q 4FKYA 3HMJG 3TAPA 2RF2A 3BKFA 2UXCJ 3QRPA 3BO2A 1HIYA 2KZZA 1DLOA 4ES2A 5BYRA 1U8SA 2IMOA 5D15A 1VQSA 1N32J 1MROA 3WX4A 2JLEA 2GZOA 3CEDA 3CULA 3D0IE 5KFCA 2F4VF 2QLJB 1QSLA 3GV8B 5FJ4A 1LXNA 1NKEA 2K1RB 2QC3A 4NLOA 1D9FA 2GIFA 5HMYA 3I0SB 2OMLA 4DU7A 4EI2A 3MMBA 3QIPA 3PW4A 3DOMB 1CJKB 2BJ7A 2WSFC 2NUUG 3C15B 1PYOB 1RAEB 1YHQS 2JEJA 5A6PA 1AFIA 5KFUA 3D0HE 3R5JB 3TR5A 3IBWA 4CTAB 3SFUA 2V0NA 1RWUA 1TKTB 3HHLC 4KBIA 4OYXA 3UN3A 2ABYA 3PXGa 3KMQA 4OI6A 1HBMB 4H4OB 2IC3A 2M8DB 3V4IB 2IPOB 1NHVA 3HDSA 1TKZA 3VWSA 4HI1A 1NK7A 2GHVC 5DJBA 5KT3A 2DKOB 1QVGR 3TUPA 1FE4A 1U47A 1KNZA 3SCKE 1U26A 5JXSA 3NMRA 1X8DA 4FYWB 2EG2A 4ZP8A 1LW2B 2NXJA 2LCWA 5KG1A 3FMWA 3OTCA 3TUZC 1PYSB 1REVB 2VD3A 3EMTA 3JXOA 5EWEA 5KFNA 2R8HA 4N56A 5KFEA 2ZOFA 3I5BA 3N28A 3OXLA 1JB0C 5D78A 2XC9A 1S1XB 2GO9A 4MKAA 5IZHA 1VBYA 1F2GA 3MAHA 4M5GA 5GAGU 3KJQB 2OHDA 3D3CJ 2W7AA 1PBUA 4QYRA 4AUKA 3QMQA 4CH0S 4ZCMA 1Q78A 1AW0A 2NSCA 1SIZA 3HSGA 4DQIA 3MHYA 4DSFA 2IM0A 3MMCA 5J2MA 1J2VA 4LQ9A 1ZAWA 1VQKS 1JLBB 1NHUA 1TUWA 1ZM9A 2KDOA 2WONA 5D4PA 4CRJA 4QWDA 4OFZA 4GKKJ 4ZCLA 4ZJQA 4ECXA 2VPWB 4DCOB 2VQEJ 1RAAB 2XS7A 4K5SA 2XNRA 5CYMA 1U7LA 5F3TA 4TQSA 2PMWA 3A8EA 2FHJD 1QAIA 2CJXB 3HFVA 1TUGB 4L6V3 1FO1A 4HEA9 4OYOA 3RUBL 3T9ZA 2VOPA 5KFPA 5DETA 5F0WA 4DS5A 2NQPA 4GO5X 4KFBA 4W4MA 4WYLA 4F8RA 2V34A 3GJQB 2QGFB 3NGTA 4LF4J 4W98A 1JLFB 5F8LA 1TL7B 4FXVA 2OPSB 5A76A 1RTJA 3CTRA 3HSJA 2VA2A 2C42A 3OUYA 3HP6A 1VDHA 4FDFA 5EWGA 2F5GA 4CO3A 3MM8B 1S99A 1X4EA 2PT0A 4OQJA 1ICEB 5K14B 4RNFA 2R4FA 2E5GA 3JQMA 4MTPA 5AE3A 1FNOA 3CDAA 1L5UA 2NREA 3W3SA 1UEKA 1HYSA 4LF9F 2QX0A 1NLKL 5E3AA 2RQCA 1YDLA 1YG0A 3KLEA 2G9OA 1T9VA 3W61A 1ZA2B 1FWKA 5HMZA 4C97A 3BBBA 2HGMA 3IGNA 2PC6A 4F7VA 1ELOA 2ZBRA 3HCXA 1MU2A 2NPIA 3AJ1A 3HKZD 3BJYA 3CC4S 2GAGC 2BZ2A 2NCKL 3CGIA 4QOTA 1V5IB 2EBGA 3GE9A 3MFIA 3UQSA 4C2MA 4DL5A 1KN6A 3JYTA 5SZTA 2GS8A 3NNAA 2YKAA 1AXQA 1KP6A 2FIUA 4F3QA 3G82B 4G6VB 1MMNA 5ETLA 3EX7B 4DV1J 1CS4A 3CDUA 5LMNF 4OHVA 4DFJA 2UUCJ 4R5PB 1HWLA 2LQ8A 1IKYA 3R6GB 4OHWA 4UOFA 4F2RA 1S79A 4W92B 3PY8A 1TTHB 2D3ZA 2MKYA 2KXHA 3R2DJ 4CO0A 3LP0A 4KJIA 3MR3A 2KT5A 4M5DA 3DU6A 1Q7LB 2V8HA 3DGVA 4ZKAA 2JSXA 1RAGB 2J76E 1WNEA 2PD1A 3EE3A 2JRSA 1WC1A 4F4AA 1S1WA 5L1KA 1ZH5A 4M1KA 2CQ1A 4DQSA 4OJ3A 2F9JA 4DUTA 3HVTA 4P2MA 4C11B 3R9LA 1TELA 2YNHA 4OYAA 2ROEA 4X4NA 1X5PA 3VAHA 4LT6A 4DI6A 1FFGB 3KHHA 1S49A 2DGOA 2YKNA 1U1QA 3H25A 4P7VA 1R8BA 3V6JA 2KM8B 3KK1B 3ZFVA 1R7IA 3ISZA 2VB6A 5FDLB 4FF1A 5DGBA 1BQNA 2HGNA 1U8WA 3AJDA 4MYUA 1I5OB 4A48A 4C3KA 3LUYA 2YPZA 5E3CA 1VMBA 3PO5A 4JI1F 1RHRB 4USMA 1IKXB 3BPSP 3U02A 4AQYJ 1TK8A 3HHLD 5HBMA 1OY9A 2FHOB 1ZAXA 8RUCA 3TI0A 1KSPA 4H4KC 1KVKA 1S7HA 1F2HA 1RKIA 3T41A 2E1PA 4DFMA 3RB0A 2VBYA 1OPIA 2OPPB 1U0HA 1JXVA 3G8QA 4Y2MA 1E6YB 1NK4A 4JBCA 1LXJA 2W2NP 1D3WA 1S7IA 5KFIA 3HPOA 2ZH6A 1VQ4S 1NSQA 2DNOA 3R5BA 2VH7A 3SSQA 2QJ3A 1ZM3A 2JC1A 3ZXWA 4AT1B 3VALA 2ZEJA 3L3CA 6AT1B 4OX9J 3M9MB 1E6VB 3TQ1A 2EWHA 2H51B 2RNEA 4QIFA 1NJXA 5HVGA 3ULHA 2BYCA 2ZC4A 3DRYA 2BABA 3LW5C 1KLMA 2VZ9A 1FKAF 1AROP 4CLFA 4DX6A 4I68A 4H4MB 1ZPVA 1NK9A 2W2MP 2YKMA 2AYGA 3MPVA 3CCUS 4NYOA 1FKOB 2IM2A 1LOUA 4Y2IA 1UJ5A 2CNOB 1HBNA 2BACA 2H5EA 4RZRA 5KG0A 1X5TA 3ETOA 4J9SA 3HT0A 4DSLA 3CF5Q 1LQ9A 2ZD1A 4N47A 3TOQA 5DQIA 3JTOA 3NCPA 4NLQA 1DARA 1JLGB 3C14B 1TU0B 1Y3JA 1U1KA 4DPWA 2EKNA 2CZVC 3OBIA 2QA4G 2QT7A 5F0UA 4B08A 2VFTA 1B7FA 1D9DA 1TFWA 4CQ1A 1SJRA 1BD6A 2Y0SD 2YKPA 4I7FA 4P75A 4JI0J 5E41A 3DOMA 6FDRA 2XCPA 2F7VA 1N34J 2ZH3A 2CQ4A 2XI3A 3MOZA 2EFPA 2ALYB 2KN4A 3DC2A 4FYVB 3VGSA 4M63A 1VK8A 3HULA 3ISNC 3OTBA 4DLEA 3H5SA 3M1VA 4L3KA 1FX2A 4OYMA 4B9LA 2DGSA 4LRBA 3EJMA 4XTTA 3FRZA 4PZVA 3PR4A 1X9SA 2DT9A 3AHPA 5KFHA 2C22A 4RW9B 1WC4A 1BQMB 2B5JA 3EICA 2CQIA 3ICLA 3PEJA 4FPRA 1V6HA 1SC1B 3VZIA 3W63A 3ZZZA 2HHHJ 3TAMB 2L9NA 1YJUA 1UW4A 2Q6BA 2ZNZA 3Q2SC 3SSRA 3KLHB 1N6QB 1PC5A 4WFYA 2MQ8A 4MK9A 4X64J 1XR5A 2EFGA 2CG8A 3S7RA 1ULRA 2H4YB 2BJEA 1S10A 4UY85 5DO2A 5KT6A 2CZ4A 1Q0NA 5DDRC 2C28A 2HBRB 2ZBCA 2BEFA 1B99A 3BSCA 1NDKA 3CB4A 3PNIA 2IFXA 2AF6A 2QLWA 3QFWA 4UOHA 4BBYA 2XGQA 4RNMA 1EZZB 1QE1A 3GMGA 3F0NA 3MM8A 4O3OA 3R5AA 3V81B 2FY8A 3TX0A 3ZZPA 1R6YA 3IG1A 1UA0A 2B3TB 1RT5A 4PUOA 2HAIA 1UJ4A 2DGUA 1WDDA 2EBEA 5IM0A 3J80U 1R89A 2MKJA 3RAQA 1C1BA 3CC2S 3OVSA 2WONB 2IAJB 4NZ7A 2C2EA 1L3KA 1N56A 3IFEA 2OAUA 1GEHA 4J9LA 3IR7B 2UUAJ 1N5SA 1PKUA 4FYYB 1BC6A 1EETA 1RUSA 2RUGA 2LDYA 3CCWA 4LRCA 1T05B 1N5TA 1R3NA 3K89A 1VQMS 2PFFB 2D3OR 2MHNA 2WW4A 2Y1RI 1DTQB 4ZOSA 3F44A 2Y0BB 3HF5A 2V4RA 4CH7A 3IG1B 1MWYA 5D4LA 5HP1A 3M2RA 3LALA 4QWEA 2AX0A 2RUSA 2XEXA 2LYVA 5JJBA 4DF8A 2WOMB 2HAFA 1BY9A 5GMKa 1CS4B 1F6TA 1WHXA 1K9MT 1JLFA 3KUGA 4G1IA 1WI6A 2KYZA 2OO4A 2QLXA 2CPJA 2R2SA 3X1LB 4HT7A 4LR9A 3ZTQA 5RUBA 1FFSB 5C24A 2C3MA 3BO4A 4DV3J 3PV8A 3NL0A 2HVEA 4Y28C 1Q8BA 1JMTA 3UD3P 2C3PA 3JTNA 4H54A 5HL7Q 1NAQA 4RNNA 4KC5A 5EUHA 4DV0J 2UXBJ 3Q86A 4KGKA 3FDSA 5F8IA 2DGQA 4QR2A 4TKTA 2YKQA 3MFHA 5U47A 2V8DA 4NCGB 4QPTA 2GVDA 4ZVGA 1XR7A 4KYZA 2E29A 3CDEA 5ETVA 3KXDA 5EWFA 1RYSA 4PG4A 4X4TA 2DR8A 2W2QP 3K8WA 3OXGA 2CQHA 1UVNA 2VUGA 2YNFA 4FS1A 1RP5A 5J2PA 2AGQA 3QFHA 1SKWA 4Q0BB 2KG1A 2LA4A 1NUEA 4OZ3A 1CBKA 1YIJS 1XERA 1LWCA 1OSCA 4P2FA 1OJ4A 3CJ0A 4CH1A 2DPIA 3PVXA 1B4SA 3DCAA 4IG3B 3H40A 5D0GA 2UXBF 1A6LA 2GC8A 5GAHU 3J81U 4B3SF 3ILIA 4C8ZA 1S6PA 4IRKA 3MM6B 3SSSA 4DL6A 4PPZA 2E9TA 2HVDA 2HS3A 4O23A 1KR4A 1WOSA 3BKTA 2V4JA 1UETA 3BYPA 3F56A 4NMXA 4F36A 5KFMA 1HL6A 3PEHA 2X1FA 2GGPB 1PYTA 2VDIA 3GJRB 2XG8A 3N6MA 3P45B 2WSEC 1RBAA 4G1QB 4RL1A 3EYZA 2LQ5A 3C66A 2YWWA 4NYPA 1OQ6A 3S8SA 5A2QU 4C0HA 3DLJA 2XWXA 5AJ3J 2IVYA 3KLEB 4PQUA 5KG6A 3HD1A 2VJUA 4TXSA 5C25A 3OHAA 2DNZA 4BC9A 4QW8A 2Q1LA 2R9LA 2QFIA 3OFHA 1IKVB 1NKCA 2DEIA 3W2WA 4EGLA 4DL0C 2IM1A 2NSBA 3KLFA 1HKAA 2DPJA 4CT8A 2AZ3A 1HNVA 1O6XA 3CJSA 4F3OA 3EVMA 4ECUA 3UNGC 4WU2A 5FLXU 2YWEA 3GJTB 3P6YC 2K3KA 2ADBA 3BB5A 2ZWOA 3NWGA 1Y5IB 5C25B 4X4QA 2RDIA 3J81Y 1CJVB 3TJ9A 3G87A 2HFSA 5KFSA 5LM7E 5LXRA 4C4WA 1CJTB 1TKXB 3KK3B 1QUVA 1P1TA 2QYGA 5J2PB 4LF7F 1F9HA 3PDNA 1JQGA 1RHJB 3VTIA 3BO3A 3G9CA 1H0HB 2F3JA 1RDRA 3PFOA 4LVOP 1S57A 3T6BA 2G4BA 2UUBF 1GX5A 3OFEA 2ASYA 2GNKA 4TU8A 1WKJA 3CE8A 2KFNA 3TP2A 2FHKA 1ZOTA 3MM9B 1IBKJ 1XNQF 1IWAA 1VQNS 4OHXA 2Z58B 1RWOB 1VC0A 2MZRA 3NNCA 3NEKA 3D68A 2HGLA 2GCFA 3PYFA 4CO5A 2Q66A 1BWEA 1FD2A 1X9MA 4BWMA 2RB7A 4JOUA 3S6EA 4ERDA 2LEPA 1SV5B 2GGPA 4M5LA 4GVBB 3HHLB 1RT2A 1T9YA 2UP1A 5KG4A 2YQ0A 2B5JB 2BQRA 3RRKA 3G6XA 1S1TA 1HI8A 3Q8UA 2RD5C 1TAUA 2V6AA 2CAJA 1MMDA 1JJ2R 4PQAA 1G7CB 4L76A 1FTCA 5D4NA 4WFAQ 4RNHA 4YQWA 1U1OA 1I6JA 3M8YA 2UVUA 4WKRA 2X1BA 1T9TA 3Q8SB 1MMLA 4BS2A 4JI4F 4ZLNA 2ZJPQ 3MCSA 3PYGA 4O3SA 5HANA 3TO8A 4UQGA 1RI7A 2OD4A 2BM0A 4NLRA 1EP4B 3GB0A 2HVZA 2MJUA 1T11A 1VYAA 4MT1A 4JV1A 1JIHA 3IA0A 4IO9Q 2N4CA 2CJQA 2MKIA 3ENQA 1NDPA 1OY8A 1P8GA 1RJJA 3VVTA 3CDBA 1DLOB 1P6TA 2QO3A 2BA9A 2FJXA 2ZOMA 2AD9A 4NA1A 1M5VC 3CJQA 2CQ3A 1U45A 4NRUA 2AJ0A 3TVYA 1WTFA 4JI2F 5JMNA 3NGKA 2JL9A 4R8UA 3SXLA 3TVZA 4C98A 2YNIA 4U8VA 4E0DA 3ZZOA 5A0YB 4DR3J 1YRXA 2B51A 4IQMA 1SIWB 2RQ4A 2VC0A 3B6BA 3MPDA 5THWA 1JLBA 2LQBA 2XI2A 5DZ6A 2BJDA 4RW9A 1HR0J 4JYAF 2V67A 4Y65A 3G6ES 1N5YB 2RILA 3OFFA 2CNKB 3W1YC 3DRRA 2Q6CA 1FDDA 3DLKB 4QIEA 1U1PA 1FJ7A 2CWXA 3BPDA 3P8BB 3MR2A 4EO6A 3T5LA 4NLDA 5KFWA 1KKHA 4S0MA 2VV5A 2IJFA 2CQBA 2BQ3A 4OX9F 2HNYB 2POKA 1SQFA 3DGPA 5KFJA 1O51A 2ACYA 3MM5B 5HROA 4DR4J 2ERRA 2IJNA 1S6OA 2E5IA 1QLNA 3GIMA 3AQOA 1X31C 3D67A 2HZVA 1U09A 2ZZNA 1WF0A 1N0VC 4YOEA 5HJYA 4L72B 2R7QA 5A8RB 3SQGB 3G8TA 1VQ9S 1HWIA 2PFDA 4ELVA 2QRRA 2O1PA 2MKCA 1H2TZ 3ZTPA 5HJXA 1VJWA 4P6QA 2VF3A 3OL6A 3KUEA 1C0UB 3QO9A 1VC6A 3PYDA 3BDEA 2DVIA 5IQ6A 4EYHB 5G0RB 1QUPA 3EVWA 4OZ1A 5T7LB 1HQUA 4ID5B 5KFDA 2VKRA 3M8RA 2WCXA 2VQFJ 5AXMA 2GQCA 1P27B 4W90B 4KKOB 4EWTA 1Q4RA 2Z57B 3R2CJ 1N36F 1FRIA 4TVAB 2BM1A 1NJWA 5JVGQ 2L08A 2GMLA 4N5SA 3UN5A 5L1LA 4K4SA 1ZM2A 2YBVA 1N0UA 3CIZA 4IO1A 4RUHA 2DGWA 4ZPDA 3TVKA 3AOBA 5KFQA 3HHKA 4B3OA 4WZMA 4ZVRB 3OR2B 3CVKA 1X4GA 3NY0A 4ANDA 1RLDA 3DFEA 1XMBA 5K8PA 2NR0A 3GU0A 4ILMA 1YJ7A 1FDAA 4NZ6A 1RTIA 2WB4A 3BN4A 3GZ7A 3QGIA 4KKOA 4C9DA 2VL1A 1N8RT 1UJ6A 3JSBA 1VOMA 3Q2TC 1R31A 2AJ4A 4FNIA 3PX4A 4DR6F 5KFAA 5E33A 4M5DB 1RWWB 1I3OB 2GVZA 5IC6B 1XNRF 1T9UA 3DOKA 2DIUA 1NXIA 2EFNA 1KHWA 4AXIA 2C2DA 4DEZA 5C5JA 1C1CB 5ETQA 3NBPA 5KTQA 3C6TA 2WK4A 3Q8PB 4HDGA 3ZO7A 1SJ1A 3HVRA 3NP5A 2MZSA 3MDFA 4O4GA 3HSDA 2G0JA 2AEJA 2XMWA 4NASA 2XYHB 5AXKA 1FWPA 4YR0A 5HI7A 2RDJA 4AL5A 3FBBA 4QWCA 3UDCA 3HVAA 1DTTB 2YVSA 3S01A 1CJUA 3KG0A 1HNVB 2V2QA 3TUIC 4MYTA 3OW2R 4NLPA 4KPCA 3KMSA 1FJEB 5F8HA 3DOKB 2LU1A 1SB6A 2PO4A 1H2VZ 1NPPA 1PAUB 2MHEA 3FSXA 4USVA 1RT3B 2KT3A 4OZ5A 3CJ3A 2ILZA 5KT4A 2EC2A 2B8QA 1F0XA 5DDOC 1U25A 4DF4A 1YRUA 2CQPA 2D1CA 4RR5A 4ELTA 4O4GB 4JI5F 3TARA 2MQLA 3JTPA 1RT4A 5T14A 4RW8A 3KK1A 4G1PA 4PG8A 2YTCA 4JI6J 1LWFB 2NXNA 4G1QA 1KLNA 5IC4B 4YHHF 2DH8A 3Q8RB 5DLGA 2MKSA 3ITHB 2R7VA 2KYXA 3CC7S 5HBMB 1NRKA 2DY1A 5J1PA 1GMUA 3LP2A 4R5PA 2K06A 5LMUJ 5DG7A 2XS5A 2I2YA 1RTIB 1S4FA 1S4EA 2ZC3A 1TQLA 2HWIA 3MMAB 3T1AA 2HBYB 1VR6A 4J9PA 1A9NB 4ZN1A 2CKWA 3QT5A 4DL3A 2QFJA 4KGXB 3G2XA 1QAJA 4ETZA 3KHLA 4ECVA 1XN9A 2I8EA 5EX3A 3U1MA 2ZH9A 2XSJA 3I6PA 1S9EB 2HHQA 3IP0A 3O1LA 3Q23A 1H98A 4WE1B 1JJHA 2E9ZA 1DAXA 3HVTB 2AYBA 4XK8C 2NXUA 1OY6A 1VJQA 2H65B 3IR5B 1YBUA 3MCOA 2QIFA 3PHEA 4HVZA 4KE5A 2W24A 4YDXA 4I1TA 3SCIE 1I94J 2MQOA 2W2PP 2HHUA 3DLGB 1IQZA 2COLA 4ZA1A 4WJBA 4ETXA 3NNHA 1HNIB 2ZJRQ 1URRA 2C1EB 5FDLA 3T19A 2K3IA 3CXCR 3DNCA 3GPAA 1UEUA 1YJNS 2W4CA 4DPYA 4ZLLA 1RWKB 3H42A 2K7KA 1WEXA 2KO1A 2LLZA 1GX6A 1N32F 3CCLS 3NCRA 3W5XA 1HFEL 4Y2CA 3N6LA 3L7PA 3IXQA 2XZDB 3UE2A 2L9DA 3DRXA 4ER8A 1Q5VA 1J5EJ 2DHHA 2O01C 4IKAA 2NZ4A 2IMWP 1LW2A 1YLXA 4FYXB 2R2TA 4WK1A 4C3LA 4Q43A 1TFYA 4X62J 1HNXF 1RT2B 3CCVS 5F8NA 1UA1A 4HACB 1V3ZA 4B9SA 1Q8KA 1M5PC 3M2UB 3AOAA 3BKUA 3G86A 4QIWD 1S0NA 5K8MA 4B02A 4DJBA 3MTKA 1BQMA 3MR6A 4LF8J 1RT7A 1C0TA 1K0VA 3CMAS 2QMWA 4DR1J 3PJWA 3OFGA 2XY5A 2CPIA 4O3QA 4YEAA 3HSZA 5LL6d 1S0OA 4NLGA 4U6PA 2DRAA 3QRRA 4Y2KA 3PX0A 1RBLA 1IM4A 2JHEA 2Z2MA 4KH1B 4J9OA 1BUXA 1WACA 3A4TA 1Z2ZA 1LFPA 5J1EB 1WOPA 2GJ2A 4HHHA 2KVIA 3M9OB 3K57A 1O8BA 1WHWA 4RPFA 3FZBA 1FRKA 4QWBA 3LWLA 3BEGB 4LF8F 4Q8FA 2YX1A 1CG2A 2QV6A 2HHHF 3K0JA 1RT7B 1YJWS 1IVZA 2EW9A 3QSIA 2XZTB 4HH1A 4NLVA 4TLRA 4LRDA 1WG4A 1PILA 4ZPCA 3C14A 5CABA 1T9WA 3A3OB 1S97A 3GLJA 5A0YA 3GQCA 3LQVA 4ED2A 4QIVA 1WORA 3RBEA 3ENAA 4H4OA 4USHA 4EZ6A 2DGTA 3A3PB 1N34F 3O5TB 5EN1A 5L9XA 1N5YA 3HHDA 3I31A 1EETB 3SQOP 1Y9OA 1WWHA 3ZZUA 4DV5F 2XWYA 2AMCB 2DR5A 4LFBJ 2N4DA 2Y3YA 2MLXA 5ADZA 3SV4A 5CH7B 1GFWB 2E7WA 3K5PA 2D74B 1B64A 2MMYA 5BJRA 2IM3A 5KFTA 3IS9B 3QBCA 2HNDB 2M8HA 1SCJB 2PA3A 1PAEX 2MQNA 4CI0B 5HROB 4KHRA 4CP5A 3UVJA 2DHSA 2KRBA 4FZVA 1VRUA 1QTNB 2HLTA 3ET6A 4I2PB 1NBEB 3W2VA 4EMDA 2KU7A 2MGZB 5DM7Q 4L73A 1NJYA 2WHOA 1FK9A 3EXCX 2BR0A 2ZKUA 8AT1B 2C2MB 1HWJA 5D77A 3LTOA 1C0TB 1P9QC 3U7JA 2OFGX 4X66J 4M94A 4DR4F 1N4LA 1VQ5S 4U7UD 1BHNA 1VQLS 1NCLA 4CLKA 4J9NA 1B0VA 3D0GE 3M30B 1TAQA 4PEOA 2HEKA 2B9EA 4MFBB 1RWVB 3JS9A 2R8JA 2H1YA 3MM7A 4QZVB 4JV5J 2HVIA 1SUQB 2DO0A 1QE1B 2FTRA 3AA8A 4L75A 2AZ1A 2RRBA 3ZTOA 3J7YU 2NLWA 4MKYA 3I82A 2AYMA 4PYDA 4ED4A 1FXLA 3NXZA 3QAUA 1R0AA 4CZCA 2V2KA 4LSNA 3GP9A 4GKKF 1RHMB 3N0VA 1VIXA 4B3TJ 3OXFA 4RUCA 4LF1A 3FBFA 2MKKA 5IT9Y 3ADAC 2BV3A 2EXUA 2IY5B 4WP8A 1KQFB 1K47A 1K8AT 3KTQA 3PTWA 3ZNJ1 1WF2A 1HNZF 1T05A 2R3VA 1X5SA 1HI0P 1RT4B 1S6PB 2YKOA 1YJVA 1RT6B 4LVNP 1K0TA 1S1UA 3GV5B 5I3UA 5KFGA 3Q8QB 2L41A 3QZ7A 3D2WA 3CWJA 1KFDA 2G1DA 2UZAA 3O3LA 4Q45A 1U49A 1S0MA 5HSPA 2WOMA 3KG4A 3MCMA 4IFVA 2MZ1A 1U2RA 2HFNA 3JB9k 4ILLA 1Q95G 4Y0FA 3OV7A 2OTJS 4DV2F 1XK8A 1UPMB 4OZNA 2IRUA 3QWUA 1JKHB 1KONA 5C24B 2YY3A 2CG4A 2J9DE 4RW4B 4GRSA 4CLWA 4EK2A 1XJWB 4PWWA 1NM2A 2DNLA 4RWXA 2FVRA 1DFDA 3IWLA 4OZJA 1NPRA 1YRTA 3IM8A 1YJ9S 1TVRB 3CJ8A 3POTA 2ZOGA 3MF5A 3D6TB 2PE8A 4WE1A 1RQ0A 1VRQC 5ETNA 1FHTA 3V6DA 1DRZA 3R7BB 3B4MA 4C0OC 2NS1B 5KFYA 4NWBA 3CJTA 3I9V9 1RWPB 1TMJA 1VLOA 2V8GA 3QAEA 4M5NA 2N82B 1S6QB 5IWAJ 1Z4UA 3QLHB 4DU8A 2Z8QA 2ZH2A 1F1BB 5KT5A 2Q79A 3CJ4A 3M6WA 4X65F 1DY3A 3FVYA 5ETMA 2HK2A 1U24A 2CPYA 4WIIA 2GMHA 4GVLA 2WBMA 1TK0A 1Q82T 5E3QA 2HFVA 4I64A 2I5JB 1XWLA 3QJPA 2JLFA 3GG0A 4FNHA 4P52A 5B0CA 6FD1A 1ZYQA 3MM9A 3Q24A 2ROPA 3CD5A 4DUZF 4QWAA 5BXIA 3AD9C 3FKBA 1X4CA 1JX4A 2DR7A 3NG8A 4OI3A 4B3SJ 1UL3A 2XMUA 2ZBQA 4OJGA 1UVMA 4K4UA 3ZZTA 2DJWA 1SJ4P 2KM8C 1M5SA 1ITPA 4CLTA 1SL1A 2CQCA 4K2XA 2XHCA 2QLBB 2FJBB 2FC8A 2X1GA 3V4IA 3C8YA 3KKFA 4B3TF 2CNNB 2UV8A 2KRRA 4RX6A 3B78A 3UW1A 3WHIA 5H9FK 1LNQA 1UAWA 5DS7A 3GYNA 2ZE2A 3M4XA 4NLYA 2WW8A 3AD8C 2W25A 4OI0A 2MY7A 2GIQA 3HHLA 4ZDNA 4X4PA 2FPHX 1HI1A 1SJQA 1DQ8A 2FZGB 2L48A 3KLIA 3S1TA 5B08A 3KLGB 3IR6B 3D66A 3PO4A 1VQ6S 3F41A 4USWA 3F73A 2BE2A 3P3DA 3MD3A 2ROGA 5KOXA 1B3TA 2G2YA 2HWTA 3TJ8A 4EU0A 4U67Q 2HRUA 3MMAA 2ZBPA 4CT9A 2HYIB 3CJKA 1OYEA 2PA8D 3SCLE 2PN6A 2V8VA 2ZE2B 1PJ6A 2DGVA 1JLGA 5F41A 2YKMB 2DR6A 2ZHAA 3FFIB 1N88A 3HX9A 2YNIB 4J5OA 3M2UA 3TX8A 3MEEB 3M8QA 2P9CA 3K5OA 2ZITA 1RTHA 4TY8B 5HATA 3FGVA 4J9UE 4DG1B 2IC3B 5F8MA 2AEFA 1SC3B 4I69A 2I38A 3VGTA 2VPXB 3EPGA 3V81A 1RZMA 4LFBF 1LWEA 5CHCB 3UNYA 2PI4A 3RZAA 2VBWA 2R2RA 3N5FA 4RUAA 4I6YA 4JI3J 2G2ZA 2KXFA 3TYTA 1KOOA 3ET6B 3AJ2A 4I2PA 3RG6A 3CCQS 2NXCA 3CNQP 4I7FB 2K1RA 4LIWA 3GIKA 3IRXB 4BDPA 3DRRB 2QL5B 2VU5A 3DYAB 4KT0C 1WG5A 1SKRA 3TAMA 1DZ5A 2ATLA 5K8OA 1R8CA 3DDKA 3DRPA 4J91A 2ZDPA 3I5AA 2EG1A 4URSA 2PI5A 2MXYA 3N6NA 4F4XA 2EC0A 1PJ5A 1UZHA 2KI2A 3EZUA 4NLXA 4QR1A 5J2QA 4X2BA 3W9JA 5H1SV 4MFBA 3QO9B 3KHGA 4E8UA 2W8LA 3CPWR 2FVPA 1VFJA 5BYSA 4R0EA 4X4UA 4YB6A 3X3UA 1MU2B 3JAMY 4DV6F 1HBMA 1R27B 2OGUA 2R7SA 4I67A 1ZTTA 2DBBA 4OHZA 5DG8A 2DR9A 3CIMA 4OMFG 3E3XA 5IT4A 3ZZYA 3LANA 2UV8G 2HFOA 3MEDB 4FPIA 4I2QB 4I6WA 4O4RA 3DI6B 3OR1B 4YUDA 2ASLA 2CJKA 1REVA 2Y1LB 2ZH8A 3T1HJ 2OP5A 2BOAA 2HZAA 5E3PA 4A8FA 1Q5YA 4MIAA 1FXRA 2BJ8A 2XB2D 3PW5A 4KY3A 7FDRA 4I4BA 4DX7A 2JH3A 2FDNA 4ZIVA 5L1IA 1KS2A 1F3VA 3M8QB 4TY8A 4K5RA 3K2YA 3JSMA 4QU7A 2X1AA 1Y11A 2FQQB 4K0KF 3EUNA 3DLKA 4C8MA 1S1UB 5I3UB 4P2XA 3MAQA 1BWVA 3L4BC 4JI7F 5D0RA 4CLPA 4WZQA 4E2FB 1GT8A 3CCSS 3R5DA 4I2QA 1S1WB 3M8WA 2L3MA 3MMCB 2J7KA 4ZN3A 1HYSB 3J7AN 4ECSA 2P9GA 3GFZA 1CULA 2OEKA 3BREA 4USTA 1NK8A 2KTQA 2F4FA 3PIPQ 1GTHA 1Q81T 3OL9A 3NLCA 3H2VE 1HWUA 2AV5A 2W4PA 3FCWA 2H5IB 1RSCA 2PGCA 3MMJA 4YN3B 3W9HA 3SQGA 1OWXA 3NGUA 1X4AA 3NMAA 1AZSB 4KV8A 3TA2A 4AD6A 2DNGA 3MUVP 1KQSR 1IR1A 3H2LA 1HQEA 2EVZA 2ACMA 3BGOP 3EM1A 5D3GA 2QMXA 2K2PA 2B9YA 4DR2J 3G82A 4F4ZA 1WJ9A 4KFBB 3LWMA 4ZVEA 4WTYA 4OI2A 1EKSA 4UT4A 1YI2S 5T7LA 2MB0B 1UVIA 1UWAA 1MN7A 2DNMA 2UUTA 4USIA 1QAXA 3HHEA 1T8EA 3EXYA 3W2VB 1REGX 1VISA 3AY0A 2AYEA 2OELA 2OPQA 4N8OA 4DQRA 2KL8A 2VHGA 2FVSA 1N52B 4C8KA 3VAFA 2W8KA 4OV6A 4ANCA 2ZM6J 4O3NA 5CYQA 1RHUB 3MTJA 1S77D 4P72A 1HQEB 3E01B 3FSIA 3H98A 4J9VA 5E7OB 2CYYA 3D1HA 3THTA 4LREA 3MUTP 4FYDA 3ENVA 4NYZA 4NEZA 3MR5A 2ZH7A 3OR2A 3LF0A 3BGUA 3PYEA 4YHHJ 2RF2B 5I4MA 4J9RA 4JYAJ 3C6UB 3L9ZA 3RBZA 1P9YA 2UU9J 4EO8A 4UY8T 4JI6F 4OZLA 5C42A 3MXHP 4PXCA 5IV3A 3CCRS 2IRYA 5B0AA 1IR0A 1A7GE 2YNFB 4M5JA 1CJTA 5A8KB 3MURP 2E1AA 1U48A 1JLEA 2R8KA 3M6XA 1RAJA 3QNWB 1KEKA 2HMIA 3MOJB 3E01A 1NKBA 1MN9A 4C8OA 2BRLA 1RYRA 1RAFB 2QL7B 3M2VB 3BSOA 3L7UA 2BJ9A 2F40A 4ES3A 4DV7J 2VG6A 1V3SA 2W7PA 1JWWA 3FSYA 4KGVB 2F1FA 3NOGA 5M2PA 3H4BA 4NZ0A 4DV3F 1YITS 1R0CB 2HBZB 1NH8A 5HN0A 2OSRA 4IR1A 4FP9A 4M8LA 1X4HA 2DK2A 2ZD1B 3BBFA 5HMWA 4JI4J 2XLKA 4YFUA 3O8WA 3FCVA 1IKVA 1OO0B 2FD2A 3NAHA 3AB2B 5GMDA 2GHPA 3UR3C 2KFZA 2J8SA 1Q53A 2AEMA 3V4MA 2VG7A 3LGHA 2ZUAA 3I9ZA 5DRKA 1VRTA 1WG1A 3MPWA 3GWCA 3H5YA 1LV5A 3WC2A 1T03B 4FBTA 2WAQD 2RSQA 5I3PA 5EGYA 1TMMA 3OTDA 2LDIA 1XNRJ 1H7WA 5IQQA 3U1NA 2JJ4D 3M8PA 1YTYA 3H5UA 5DZ7A 4HTJA 3CJRA 4DFKA 2AP6A 5D4OA 3HKWA 3BGRB 4WKYA 2A10A 2J7UA 3FJ2A 2AT1B 3OLBA 1HNIA 2DIVA 4DUZJ 3EZ5A 3DXSX 3PM9A 5CZVA 3MGJA 4PR6A 3PR5B 4A8SA 3RB6A 3PKMA 1IBKF 1SVDA 2E44A 3TW0A 3ZTRA 4DXLA 3RBDA 1VK3A 1KQKA 2ZHBA 3B8HA 1QSSA 4KPYA 5D0EA 3CT9A 4J37A 2XLIA 1H38A 4GKJJ 1B70B 3C6UA 2B7CB 3KLHA 1FFWB 1N36J 3T6JA 1GK8A 2A1BA 1JXEA 4YY3F 2BBEA 1DQAA 4ZPBA 4AE5A 3W62A 2LP4A 5LT5A 3HT3A 2BQUA 4Q8EA 4OL8A 4NLWA 2DNPA 2AGPA 3EWGA 2WVFA 1U1LA 2I5JA 2RDDA 4F0MA 3R1LA 3DDIA 3DOLA 4FVMA 2PMZD 3UCUP 2RQMA 3GR1A 3PIOQ 2HS0A 1WTBA 2RH3A 1S1VB 4ED0A 1K1QA 1RU2A 2HRYA 1AYEA 2U2FA 2DNHA 3VGUA 1MSWD 4NLUA 2X3GA 2ZH5A 2IHR1 4DL4A 2MQQA 1S6UA 2CPXA 4ZVTB 1HNWF 1SBRA 3L7OA 4M95A 5KG5A 4AL6A 3FUYA 1NSAA 3MAAA 4FXWA 5FD1A 4P10A 1ZS6A 3SFGA 1RTHB 1ZTWA 2B8PA 1EB0A 1UFLA 4ZPVR 3TWZA 3D4JA 2DXDA 2CADA 3M8PB 3TUJC 5LSRA 2R2UA 1T94A 5GADI 3UDEA 1I51B 2KH9A 2DGXA 3GV7B 2ZH1A 4LF6F 3R5CA 1UWBA 3OTEA 1NB7A 1M1KT 2FGOA 2VJVA 2KJWA 5KG3A 5J2MB 1IQTA 2V2VA 4P74A 4CM0A 1BE4A 2BRKA 3GFYA 1KOHA 1HQUB 4ID5A 2M9KA 2GO8A 4OYPA 1UCNA 3GCWP 3TZZA 1ZAVA 1RAOA 2J6UA 1QJHA 3HFZB 1CSJA 4MK8A 2MYFA 2RS2A 5CYMB 1VQOS 1P1LA 3FCHA 2JOQA 2R7XA 3AODA 5GVQA 3LAMA 2HFZA 4Q44A 1X0FA 2FJWA 4N77A 2DCLA 3U1LA 3OSNA 1Z1ZA 1NO8A 3CD6S 5CZXA 1WC6A 4HH0A 1RK8A 4LSLB 2R7WA 2FY1A 1WD6A 4OIXA 2CJBA 4ZVUB 1C1BB 4DDFA 2HHVA 1Y5LB 3M6UA 5I42A 1VBKA 1PCAA 1CPZA 2MTLA 1HHQA 3PW2A 3HFKA 4IRCA 3MI7X 2KT2A 3RW7A 2XO7A 2DHAA 2N7CA 3H2UB 3I0SA 2FB0A 5D8HB 2FZKB 3NCQA 2KG0A 1DTQA 2BANA 3WZ0A 4P71A 1N6QA 1S12A 2B0GA 1F5AA 3SCJE 4LSNB 1IM6A 3AAWB 2OEJA 7FD1A 4MMOA 1NDCA 1WC3A 1NZ8A 2XBPA 5B0GA 4O3RA 4I6AA 2AWZA 2FC9A 4Y00A 1IWGA 3PHTA 5GAHI 5G0RA 2CJ9A 3R5GA 4MH8A 1SUQA 3Q0AA 2HVHA 4DFPA 1PSDA 2YKNB 3GSIA 5L1JA 3GJSB 1TKZB 3AB4B 2V4JB 4WU3A 4ZITA 1YZ7A 1Y3KA 4EUVA 4JI1J 1CEZA 1S9GB 2FVCA 4XIUA 3QT7A 3BM7A 1Y4ZB 3AH6A 1XTZA 1IKWA 1JLCB 3M9NB 4RW6A 4QU6A 3MUMP 3NS7B 4NXNF 1JLAA 1BMQB 2HHPA 2AW0A 4QBUA 4NLSA 4RNOA 1Y5NB 2HW3A 2Z2YB 1ZZFA 3HI9A 3ETMA 1FRLA 1L3UA 3UD4P 4PXBA 3U27A 5CD4A 2D9OA 3W2WB 4IG0A 2PEBA 1W2IA 1U1MA 2Y8WA 5IT9U 4TN2A 1HARA 2JNJA 1XMQF 2CNLB 2HLUA 4CLSA 4RW6B 4U7CA 5DQGA 4LSLA 1IBCB 3Q89A 5HK4A 3RYLA 3I56S 2MPUA 4U9RA 4ED6A 4B9TA 4MJKA 3MR7A 3R3TA 4CCHA 1GXTA 1LEOA 2B9WA 4F04B 4KSEB 4DV6J 2XCAA 2RS8A 5KFRA 1UVKA 1TKXA 3KK3A 3RR8A 2BKPA 2YNGA 2HNZB 3PRBA 4UZCA 5E5NA 1YBTA 3POTB 3FQLA 4H4KA 5GAEI 1X4BA 2AJQA 1SC6A 5IV4A 2MLYA 4OX6A 3CCES 2OMOA 2NYHA 2VBXA 2M88A 4RUBA 2ZHOA 1RT3A 2V68A 3D9BA 3FNNA 4PQUB 1M0SA 2B7BB 1M1GA 4D3GA 3A8JA 1EAYC 4NA3A 1HPZB 4DN0A 3D6HB 2CPDA 4LSZB 4URQU 4WXOA 4WPAA 4DCPB 3N9UC 2RE1A 3O6QA 5LSOA 1R8AA 3QRQA 1LWFA 3A12A 4J9MA 3N4WA 4PXDA 4ZHRA 4ITSA 4GMKA 2A6OA 2A2DA 4DL7A 2J6SA 3I87A 5E0OA 3K59A 1PG5B 2PIIA 2VG5B 2YXLA 4NXNJ 1XQIA 4ZP6A 3RW6A 5LMUF 1JKHA 2HFUA 1GAOA 1RWXB 3OD2A 1VBZA 5CQGA 3G4SS 4M5IA 4B3MJ 2JX2A 2Z2LA 4Q7AA 3O44A 4EFAC 3SV3A 2Z4PA 4KHPF 1N5QA 1M1HA 1SH0A 1FRJA 2XZWA 3MZIA 3JSRA 1VCTA 3PRDA 3QIDA 3HJVA 4CM2A 4WIQA 3NAIA 1M5KC 1HBOB 1APSA 3ILOA 3KJVB 4XO0A 2ZM6F 4LBIA 1T3OA 4ANEA 1S5ZA 1VLYA 3LOUA 2CIMA 3MD1A 1IBMJ 2ZJQQ 4LMZA 1YKWA 1UPPA 4QJVA 1H72C 2WVBA 2FJAB 3OHBA 1I1GA 3BGRA 1OQ3A 4PG6A 1WOOA 4LF6J 2M7SA 5K20B 2Z2ZA 2LQ9A 5AXNA 1U1RA 2KVQE 4X4VA 2J9EA 5AXLA 3MAAB 4WP3A 1WELA 3Q8YA 2HQDA 3OL7A 1ROFA 2B4VA 3FQKA 2IIHA 2WVEA 2CDRB 3HXMA 4K8RA 4KO0A 4DV4F 1HNWJ 3H20A 3K5NA 3I5CA 5L46A 1LKZA 4IOAQ 4I0WA 2J7WA 5BR8F 2BX6A 5H9EJ 2JEGA 1JLQA 1TL1B 2E1RA 4FKXA 2ZKTA 3T5HA 2IA6A 4TLQA 3TNVA 2XTJP 4C8NA 3GR0A 1FXDA 1HBUA 2VG7B 4IFYA 2OJ3A 1VRTB 3P5BP 2DRBA 5D0HA 1U02A 2W7OA 4K2JA 4L3NA 2EEYA 1S76D 1D8ZA 2Z30B 1JK9B 2DNYA 9ATCB 1FJCA 2LEBA 3I96A 2BE9B 1KRPA 2G1HA 1XR6A 3IAM9 4ZIWA 4YY3J 3CUNA 1GMWA 2IYGA 1AUSL 2ATCB 3VAMA 4K4TA 1XC9A 1Z2LA 1U0SA 4WYWA 1L3VA 3DM2B 1JLQB 1TL1A 1YVFA 2G13A 1TZ0A 2AHOB 3IMQJ 2YX4A 3M6VA 1G6BA 1VQ7S 1RKJA 2UVVA 4F25A 4X65J 4NI2A 1UZDA 3PRVA 3KNGA 4OLPA 2F65A 3M05A 1S59A 2X3DA 3D28A 1KBRA 1EJ7L 1KTVA 3HZEA 5J1NA 1CQNA 1JJCB 1LWXA 3DYAA 1L3SA 1LW0B 1DQ9A 1NNDA 2F8HA 4IOBA 4EBDA 1AUDA 2D69A 3TQEA 4RO0A 4AFFA 4F67A 3BQ0A 2FLOA 2VFSA 5AT1B 1KD1T 2H3EB 1MLAA 2XMTA 2YWFA 2DHGA 1OSDA 2A18A 2M70A 3LP1B 4ZP7A 3KNAA 5J2QB 2JLGA 3GSDA 2PSZA 2VKZG 4V19J 1S1XA 2XO6A 1FX4A 4NCGA 4CNZA 2XM3A 2MSTA 3MM7B 4CLLA 3PW0A 3J7A1 3TAQA 2IBOA 2FUG9 2HQCA 2J9DA 4PXEA 4ZPTR 5L8RC 4C0BA 3MMBB 1TK5A 4F0KA 1PO6A 5M2UA 1S1VA 3D6FB 1VS3A 3KFWX 4A8KA 1FKPB 4OLOA 2W9CB 4ED8A 4ECWA 1FF2A 3BGFA 1GNKA 1RISA 2GVZB 1EX8A 2QA2A 5MAOA 2RU3A 1EHWA 4HT5A 2OTLS 2EPIA 2P6SA 3DKDA 4U96A 4CTAA 3FK4A 2HHWA 4IG3A 2B9XA 2D41A 2EFVA 5I42B 4KTQA 4EZ9A 3PFEA 3BH6B 1Q8IA 2XGPA 4K59A 3VZHA 4EYIB 1J5OA 4AYBD 4F4WA 1VQYA 4TNOA 3T1YJ 1XMOF 4URGA 3IRXA 4LRAA 2MQPA 4LF9J 3I4HX 1Q1KA 4IG0B 2AQ4A 3VHQA 2BANB 1PBAA 2WTFA 2JWNA 3V6HA 1FWLA 2HQGA 5KT7A 1KC8T 3HD2A 2VPYB 3IS9A 4YMEA 2D7SA 3NRBA 4ZVOB 2DISA 1G2EA 3UCGA 3KJFB 2MEWA 3N01A 4ECRA 1TKDA 2ZH4A 4ZPWR 1ZPWX 2FJEB 2YWGA 2IAJA 2G0IA 3UDLA 2C3OA 5FLXY 4DMZA 4JV5F 2IBKA 5AE1A 2RHSB 2HWHA 3BDPA 4DZDA 4DUYJ 2OPQB 2XYGB 4A8WA 2HG4A 2GAHC 5K14A 2HNZA 1T3NA 4ECZA 1QY7A 1H7XA 1UKUA 4C8LA 4F50A 3A3NB 8ATCB 1H74A 5ETKA 4ZS6A 1N48A 2CWKA 3CSKA 3VV2B 4OX7A 3SDEA 5ETSA 1JLAB 1O0PA 4XPEA 5HVHA 3SI8A 1Q79A 1NSKL 3MEGA 3WBZA 1H3DA 5HQ8A 2BDPA 4CO2A 2VDHA 3DLBA 3KUHA 4X4OA 2DY9A 3W7BA 3KLVA 1T02A 3THPA 2GMJA 4WTOB 4MKBA 2E66A 3G96A 1FKPA 4KGZB 1CJUB 2LXUA 2ZWPA 3LPEA 3UO0A 4L74A 3KYLA 2W9CA 3T1YF 3GIJA 1RT1A 1XMOJ 3WIUA 2EKYA 5K8NA 4C3MA 3BQ1A 1QTMA 4JP8A 3B82A 3M2VA 4CYUA 5DM6Q 4ZVHA 3VF0B 3DRSA 1FEEA 2C2RA 4C8YA 3MEGB 4U8YA 3IWXA 3VQSA 2QMUB 4N41A 3PCOB 2B4OA 3FC9A 4QQBA 2YNGB 2BVZA 2CJAA 2H9ZA 2JVRA 3NS6A 3PACA 1RBOB 3LGMA 1FDBA 3AXMA 4YDDB 1FRMA 3UCZP 1TVRA 4LF7J 2DH7A 5G4DA 3PKYA 2B6AA 4K50A 4ICLA 3T1HF 3DRSB 2ZVSA 4DR7F 3GONA 2R7UA 2AU0A 4K4VA 1M5HA 1IUJA 2LXIA 3DLHA 1S6QA 3D6MB 3DHXA 3CO9A 1WEYA 5KFVA 4ZCIA 1L3TA 3RJMB 4F2SA 1NJZA 2BW7A 3TEHB 4HKQA 1TV6B 2Q3PA 2X7IA 3QT6A 3Q83A 1N33J 2H54B 4I56A 4KB7A 1IKXA 1X5OA 2BMBA 2MZQA 3ZZ0A 4ELUA 1BGXT 3Q22A 4OJHA 1V3RA 1NMEB 1CQMA 1WC5A 3H7HB 2H5JB 3QLHA 3WIVA 2HPUA 5F3ZA 5B0FA 1FA0A 2W01A 4ALZA 2HIYA 1D8YA 4K4WA 2MQMA 3LP0B 3KLFB 3DLEB 3DXBA 2W1BA 3IRWP 1ZETA 4HR2A 1YGYA 4IYQA 4IH7A 3RAMA 2CUYA 4D3HA 4OYBA 3I4PA 3B54A 1TL3A 1KWMA 3UR0A 1GMVA 4P7TA 3RTVA 1S9FA 3TA0A 5EDWA 4CYUB 2V9KA 4XDCA 3C2PA 3LP2B 2KFYA 1URNA 1NJIT 4A8OA 2KHDA 2XHWA 3DM2A 4RBTA 3R8YA 3OJUA 2XLJA 4HTIA 3PX6A 2GW8A 3DLEA 1NSPA 4UUWA 3M8ZA 3K17A 1YBAA 2AX1A 2YQ1A 1ZBTA 4LIRA 4J9KA 2RRAA 2VOOA 1PIEA 1PJ7A 3GTYX 3UWTA 3KLIB 1T03A 5AJ3F 2VASA 3R7NB 4DSJA 1TKTA 1XIQA 5E2QA 4IR9A 1QM9A 3W8GA 3R27A 4ICLB 1RGVA 4ES1A 1SL0A 4KR0B 3W9IA 5KFFA 1F5CA 1F60B 2XMKA 2XMJA 3C15A 3N79A 3BR9A 2P5VA 3ONQA 4LJMA 3RGIA 2IYIA 2VQEF 3BV8A 1T7PA 3BBCA 3R6LB 3VCDA 2CVIA 4ZVFA 2DNNA 3L09A 2A3JA 5D6GA 4ZJLA 3VAIA 3OVBA 2FLLA 4C48A 4OYWA 3FEXB 3EGZA 3EVOA 4RJVA 2GIRA 5KG7A 1FJGF 1FNXH 3OTOJ 3AT1B 2LFVA 3W64A 1I94F 4JI3F 1FCAA 3RAXA 1M5OC 4A46A 2I0XA 2MDAA 5F8JA 4IDKB 2B4PA 4OJ1A 4RBVA 4WFXA 3TJAA 4ENOA 3IBFB 3OJSA 3OVAA 2ZFHA 3D54A 2EFQA 1HMVB 4WBFA 5K9FA 3UFCX 5HQLA 2LA6A 3UD5A 1QVFR 3O2IA 3AOCA 4PCQA 3ISND 4UW2A 1Y00A 4JV0A 5CA5A 3TZYA 3J7YI 3KHRA 1SPBP 3QATA 1LWEB 4CWBA 2AJ1A 3FBEA 3UN2A 1DBDA 1W7WA 2XQCA 2VODA 4ED5A 4JUZA 2EFOA 3CW2C 4QYZJ 5CYJA 1FVQA 1EQMA 1X60A 3BH7B 4QW9A 2HNDA 3G6YA 3H4DA 3M7VA 2HS4A 4YR2A 5F9NA 3KDOA 5DG9A 4M5KA 3OLAA 4J7CA 3A1YG 4OYZA 5KOWA 1IXKA 1JNRB 2F8EX 2RT3A 1S1TB 2H48B 4RKUC 5IFMA 4X4RA 3PJ9A 4A8XA 5L38A 3NGDA 1RABB 4UZBA 2BXJA 3M32A 2DXEA 2I6WA 4TU7A 2F9DA 3CCTA 3K58A 5KFZA 1WKLA 3GG1A 1YQHA 5IOLA 4FS2A 1TL5A 4MK7A 4TY9A 5LJ5Y 1RCXB 5IWAF 5GAGI 3DGPB 5F8GA 1RHQB 2G2OA 2QSFA 1GXLA 5IXUA 3DLLQ 4PPDA 4DX8H 3DMJB 3UPFA 5HAOA 1X4FA 4P2SA 1UW9A 4AL7A 3IGVA 1J5OB 3EDRB 4HI2A 2BUNA 3I0RA 4RU2A 4CNYA 2AKWB 2DD8S 4DSEA 1R0BG 3PW7A 3THVA 4DS4A 5LMNJ 3K5LA 4B9MA 2PEHA 3IM9A 2KB2A 5HP1B 3ILJA 1UVJA 5FIIA 3P4UB 4C6AA 3EPIA 2QE5A 4HHUA 3SMZA 2HZCA 2VC1A 1T95A 2GV1A 3R97A 5LXYA 2OH2A 5HLFB 4R8UB 1NDLA 4TYAA 1D9AA 2R7TA 2XMAA 3V2UC 1R8PA 3VAKA 3AQPA 4XDDA 3R7SB 5E3RA 1NPKA 4LUBA 1Y7PA 4MIWA 3MM6A 4KIAA 3JSYA 4ZP9A 4GC6A 2P2CB 5IS2A 3CMQA 1FI4A 1FK9B 1H73A 3BYRA 4O0NA 5DQHA 2VQFF 2E1CA 2DO4A 2FLPA 2J6TA 1TL4A 2LXFA 1AZSA 1RE1B 4KV8B 2E5LJ 1RT5B 2HNYA 3D7SB 2NXEA 1CULB 4DQPA 3QGHA 1QAYA 2CVEA 1YX2A 4QPXA 2OPSA 2K7JA 4DPXA 1U4BA 3A8KA 2GVDB 4DZ6A 1PGZA 4V1Ak 4NE9C 4C11A 1XMQJ 2IVMA 1JJ4A 4B9VA 2CRLA 1SJ3P 5M2RA 2KZMA 3GILA 1RU1A 3LAKA 1KFSA 1KHVA 4LF4F 1TV6A 2DNRA 5HVFA 4FF2A 1Q7YT 1B0PA 1VGYA 2DRDA 4A8YA 1G1XA 2P9EA 1AB8A 3JQKA 3EGVA 1TUVA 4Z7YA 3T3FA 1GTEA 3HVWA 4CO4A 3CCZA 4DV2J 4WWSA 3EGWB 4P9SA 4FXDA 3VR1A 2EK6A 2XY6A 3WX8A 4G65A 1OMSA 2DH9A 1SJFA 2C2NA 2QZ8A 2M0GB 2CJYB 2V63A 1RWMB 2NUHA 3I0RB 3UDVA 5CYQB 3CJ5A 5A8KA 4OHYA
chains in the Genus database with same CATH topology
2XYGB 3KJQB 1RHUB 5IC4B 2C2MB 1F9EB 3IBFB 2H51B 4ZVUB 1RWVB 2HBYB 2QLFB 5K20B 2C2ZB 3QNWB 4DCOB 2CNKB 1RHMB 1SC3B 2CJXB 2CDRB 2CNOB 2QL7B 2H65B 2HBZB 3GJQB 4JB8B 1RWNB 2C1EB 2XYPB 3GJSB 3GJRB 3P45B 2H48B 4ZVPB 1RWKB 1ICEB 2QL5B 3SIPB 2XZDB 3NS7B 1BMQB 1RHQB 4ZVQB 2QL9B 3D6MB 3RJMB 3EDRB 1RHKB 3EDQB 1SC1B 3GJTB 2CNLB 2H54B 3P4UB 1IBCB 3R7BB 1NMEB 2H4WB 2H4YB 2H5JB 1RWPB 2Y1LB 4ZVRB 4DCJB 2HBRB 3R6GB 3R7SB 2P2CB 3KJNB 1RHJB 2FQQB 2QLJB 1SC4B 1RE1B 5IC6B 1RWWB 1I3OB 3D6FB 3IBCB 4ZVSB 2XZTB 1QDUB 1RWOB 1PYOB 4ZVTB 3R5JB 3D6HB 4LSZB 2XYHB 4DCPB 2H5IB 3R7NB 2C2OB 2Y0BB 1RHRB 1GFWB 1PAUB 2DKOB 2QLBB 2C2KB 1I51B 4ZVOB 2CNNB 3KJFB 1RWXB 3R6LB 2HBQB 2CJYB 1RWMB 1QTNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYG B;  3KJQ B;  1RHU B;  5IC4 B;  2C2M B;  1F9E B;  3IBF B;  2H51 B;  4ZVU B;  1RWV B;  2HBY B;  2QLF B;  5K20 B;  2C2Z B;  3QNW B;  4DCO B;  2CNK B;  1RHM B;  1SC3 B;  2CJX B;  2CDR B;  2CNO B;  2QL7 B;  2H65 B;  2HBZ B;  3GJQ B;  4JB8 B;  1RWN B;  2C1E B;  2XYP B;  3GJS B;  3GJR B;  3P45 B;  2H48 B;  4ZVP B;  1RWK B;  1ICE B;  2QL5 B;  3SIP B;  2XZD B;  3NS7 B;  1BMQ B;  1RHQ B;  4ZVQ B;  2QL9 B;  3D6M B;  3RJM B;  3EDR B;  1RHK B;  3EDQ B;  1SC1 B;  3GJT B;  2CNL B;  2H54 B;  3P4U B;  1IBC B;  3R7B B;  1NME B;  2H4W B;  2H4Y B;  2H5J B;  1RWP B;  2Y1L B;  4ZVR B;  4DCJ B;  2HBR B;  3R6G B;  3R7S B;  2P2C B;  3KJN B;  1RHJ B;  2FQQ B;  2QLJ B;  1SC4 B;  1RE1 B;  5IC6 B;  1RWW B;  1I3O B;  3D6F B;  3IBC B;  4ZVS B;  2XZT B;  1QDU B;  1RWO B;  1PYO B;  4ZVT B;  3R5J B;  3D6H B;  4LSZ B;  2XYH B;  4DCP B;  2H5I B;  3R7N B;  2C2O B;  2Y0B B;  1RHR B;  1GFW B;  1PAU B;  2DKO B;  2QLB B;  2C2K B;  1I51 B;  4ZVO B;  2CNN B;  3KJF B;  1RWX B;  3R6L B;  2HBQ B;  2CJY B;  1RWM B;  1QTN B; 
#chains in the Genus database with same CATH topology
 2RQK A;  3JAM U;  4IUF A;  2WB1 D;  2XSJ B;  4OI1 A;  2LQJ A;  3KLG A;  3H90 A;  1FEH A;  4HHJ A;  4K4X A;  2Y1I A;  4IFV B;  2FHM A;  4LFC F;  2VG5 A;  4LR7 A;  4ZCK A;  3DU5 A;  3G8S A;  2LEA A;  2ILY A;  3QGP A;  3W5Y A;  2GJI A;  5L9N A;  1N5V A;  2MZT A;  2DYA A;  1HA1 A;  2RHQ B;  3E8O A;  4YR3 A;  3TRG A;  4NX9 A;  2R8G A;  3CJK B;  1JLE B;  4YB5 A;  4WXW A;  4KQZ A;  1DUR A;  3MEC B;  4Z7C A;  4KH0 B;  4U95 A;  4B9N A;  2VPZ B;  4GVB A;  2J0X A;  4Y2A A;  2N3L A;  2KXN B;  1CLF A;  2XUL A;  2VG6 B;  1XEZ A;  1SH2 A;  1UFK A;  1FTR A;  3NS5 A;  3TAN A;  1FKO A;  2XMM A;  1VHF A;  1K73 T;  1WHY A;  1SKS A;  1H6K X;  4TYB A;  1WKK A;  4NEY A;  1FER A;  4JI8 F;  2A6M A;  2LKZ A;  4F3M A;  2W9B A;  1FVS A;  2KKH A;  4JB8 B;  1RWN B;  2QG9 B;  5ETO A;  4Z37 A;  1U1N A;  1W2B R;  1SL2 A;  1IBM F;  2M52 A;  2WSC C;  4ED3 A;  3T5J A;  4G3I A;  2XYP B;  1GXU A;  2C3U A;  4HAC A;  3PJX A;  4ZVP B;  4AQY F;  3RR7 A;  2RKI A;  1K1S A;  2ZVI A;  2B43 A;  3MPY A;  3Q8V A;  3G6V A;  1XNQ J;  2J9C A;  3BGL A;  1KVI A;  2J0Q D;  3SIP B;  4KHP J;  3T9N A;  3K7R A;  2UXD J;  1B7Y B;  4DR5 J;  2CXE A;  1NHK L;  2M3D A;  5J2N A;  4Q2L A;  1MNE A;  1NK6 A;  2UUC F;  5GME A;  4PRF A;  4DR1 F;  4IQX A;  2QL9 B;  2OPP A;  5ITH A;  4K4Y A;  4A47 A;  2M2B A;  2ZNY A;  4NL5 A;  1E6Y A;  1HBU B;  2NYI A;  2RRN A;  3US5 A;  2CQG A;  4BCA A;  4DPU A;  2E5J A;  5B09 A;  3GII A;  2FLN A;  2GJF A;  5GAD U;  2E5H A;  2SXL A;  3FFI A;  2N3O A;  5MLC V;  4FVC A;  2V8P A;  4NPO A;  2HSE B;  2QA1 A;  1FE0 A;  3DHW C;  4Q2M A;  2J0W A;  1QSY A;  4ZLJ A;  3C3L A;  1EAR A;  4OV1 A;  1HNX J;  1S0V A;  2ZZM A;  1HD1 A;  2FZC B;  3KG1 A;  3V5R A;  4MIB A;  1M90 T;  3QJJ A;  4WFN Q;  3C16 A;  2HHT A;  5J2N B;  1J5E F;  2JZ5 A;  2MJN A;  2R8I A;  1IJF B;  1CJK A;  1KLM B;  4DCJ B;  4GC7 A;  1U6Z A;  2UUW A;  3MM5 A;  3RU0 A;  2QEX S;  2V5H G;  1SH3 A;  3D5M A;  2E5L F;  3HHN B;  2U1A A;  3AXK A;  4YB1 P;  1IN0 A;  1S9E A;  2M5Y A;  1RAH B;  4DV1 F;  2QN6 B;  2F4V J;  1HLW A;  3ELH A;  3IC1 A;  1U2C A;  4HL9 A;  5JUM A;  1HBN B;  3ZTS A;  2VFU A;  2HRT A;  2K8G A;  4DQQ A;  2N7Y A;  1B0T A;  2Q43 A;  3H8Y A;  3IBC B;  2VFV A;  4BLG A;  1QDU B;  5H9E K;  1UWB B;  4QYZ K;  3H59 A;  4LR8 A;  4PUO B;  1HMV A;  5CAA A;  3CME S;  3RBX A;  2YPY A;  4GKJ F;  3C46 A;  3IWN C;  4NLT A;  2O67 A;  3LGN A;  4CDI A;  5J1E A;  5CD4 H;  1N54 B;  3QGG A;  4O44 A;  4AXJ A;  1C4A A;  4Q5V A;  2OD6 A;  2L9W A;  1VQP S;  1RAD B;  2OLW A;  4X62 F;  4IH6 A;  2GQQ A;  3LA0 A;  1WSV A;  2X51 A;  3MCN A;  3P5T L;  2I9S A;  3QJL A;  2RAQ A;  2ALZ A;  2XY7 A;  1S72 S;  2C2K B;  4ZJO A;  1S9G A;  2UU9 F;  1G4C A;  1HD0 A;  2LU2 A;  3M2R B;  3M1V B;  2WVD A;  4YB7 A;  5CXT A;  4M5H A;  1HW9 A;  2FGC A;  2YWH A;  2DNQ A;  2JFD A;  3J7Z 5;  1TP7 A;  4JI8 J;  3OT9 A;  4KAI A;  2HHX A;  1F5B A;  4PAB A;  4FN5 A;  3VVU A;  4DBQ A;  1R43 A;  2V69 A;  2V94 A;  5A8R A;  5C2C A;  3I55 S;  4JV2 A;  3V6K A;  3AFG A;  4N7T A;  1R0A B;  3C16 B;  2BKO A;  1CC8 A;  3BQ2 A;  3E2E A;  3LP1 A;  4DPO A;  4XPC A;  1FRX A;  4JI5 J;  1BLU A;  3QT8 A;  1OS5 A;  3I32 A;  3J80 Y;  1RA6 A;  1FJG J;  3GFH A;  4BWJ A;  1YK9 A;  3UVJ B;  4DV7 F;  2YWK A;  3NWR A;  3KWM A;  2E7X A;  4B9U A;  2CPZ A;  1TL7 A;  4F4K A;  5CCL A;  3SZ2 A;  1RTJ B;  2QSW A;  3RRG A;  4KGM A;  2AIR B;  2R42 A;  1AFJ A;  1EKR A;  3VAJ A;  2AGO A;  4LBH A;  1RT6 A;  4WCE Q;  4LFC J;  3GYX B;  2DCU B;  3CDW A;  3WC0 A;  1C2P A;  2W9A A;  2RU9 A;  1V5V A;  3RB3 A;  2P6T A;  4NXM J;  3BS9 A;  4OYI A;  2DNK A;  1OIA A;  1WF1 A;  3IAS 9;  1RT1 B;  3J7Z T;  1RLC L;  3OPK A;  1D09 B;  3M30 A;  4PWD B;  2D3U A;  4Y3C A;  4A8Q A;  2P8I A;  3OL8 A;  1HQ2 A;  2DIT A;  2O66 A;  2BKN A;  3EGN A;  4CLY A;  2UUB J;  5SUH A;  1KQG B;  4V19 X;  2E1M C;  4BHQ A;  5KT2 A;  1O5J A;  2OPR A;  2HQF A;  1F3F A;  4N8N A;  4RLE A;  3ZNU A;  3R1H A;  2Y9H A;  1UFW A;  3LPY A;  3QYY A;  1JLC A;  4NRT A;  4USJ C;  3JYT B;  3CCM S;  1NB2 A;  5DGA A;  1C0U A;  1FES A;  1C1C A;  1Y0H A;  3G71 S;  4PAA A;  4XAK A;  3RRH A;  2BOP A;  4PWD A;  2HKE A;  2DXF A;  1HHS A;  1NU4 A;  2UXC F;  2CQD A;  5KAK A;  1EIY B;  3GYG A;  2VON A;  4OX8 A;  1IJE B;  3MPU B;  3IN5 A;  2F8M A;  4BC7 A;  3EDQ B;  4Q0B A;  1F9F A;  4NCB A;  4DL2 A;  2Y8Y A;  5HMX A;  4USU A;  2LMI A;  3SYZ A;  4RW7 A;  4CIO A;  4ED1 A;  1RTD B;  1MW7 A;  4PG7 A;  4DPT A;  1QD1 A;  2DEJ A;  2DB1 A;  2MKH A;  5B7W A;  2JVO A;  1AA1 B;  1CJV A;  1E6V A;  2IDE A;  2YNH B;  2W9B B;  3QZ8 A;  1Q86 T;  3C19 A;  1SXL A;  2DTJ A;  1EQ0 A;  2GQ2 A;  4DR6 J;  2CA9 A;  3H5X A;  3BR8 A;  4UOG A;  2RIJ A;  2ASJ A;  4K0K J;  2G0C A;  1MRO B;  1WI8 A;  3NGS A;  5EX0 A;  4CO1 A;  4DR7 J;  3LH2 S;  1BQX A;  1LWC B;  1SC4 B;  1A0O B;  2OSQ A;  3D1O A;  4OI4 A;  5T41 A;  3FBC A;  5C7P A;  5DDQ C;  2VA3 A;  3BF4 A;  4X84 A;  4JI0 F;  4DLG A;  1RXO B;  4DG1 A;  1RTD A;  3GCX P;  4ZVS B;  2O3D A;  3DN9 A;  3DOL B;  4CLZ A;  4DWI A;  4KO0 B;  1HPZ A;  2JEI A;  3VAG A;  4ID8 A;  2FYX A;  2FHJ A;  3FEY B;  2YH1 A;  4DN9 A;  4LFA J;  2A2C A;  1N33 F;  5A8W B;  5B0D A;  4GO7 X;  1BQN B;  4ZHR B;  3TA1 A;  1U0H B;  2HMI B;  2E9R X;  5C2G A;  3D3B J;  1HBO A;  1SV5 A;  2E7V A;  1TR0 A;  2CDQ A;  4EEY A;  1NK0 A;  2UXD F;  1BXN A;  1S48 A;  3W60 A;  5AE2 A;  1HW8 A;  3QPI A;  2APO A;  4WP9 A;  2BE2 B;  2RML A;  4UQT A;  4J9Q A;  2O5D A;  3KK2 B;  2OI2 A;  3EZO A;  3QSY B;  1X9W A;  4PYA A;  2DHX A;  4ZLP A;  4B3R F;  4Z2X A;  3N5B A;  1Y10 A;  1GQE A;  1UP1 A;  5ETT A;  2IDL A;  1R8H A;  4Y6I A;  1C4C A;  5K5M A;  4WFB Q;  4RW4 A;  4RW8 B;  1RAC B;  1X4D A;  3TZX A;  4DV0 F;  3P49 B;  1GMW D;  2OEM A;  3K8V A;  2CPF A;  2YH0 A;  3HJF A;  3ITH A;  3CO0 P;  4QCL A;  3NOC A;  4RW7 B;  1IR2 A;  3ENW A;  3KDN A;  3P96 A;  1FT8 A;  3V6D B;  3D1Q A;  3KK2 A;  3H0P A;  3MWB A;  1VQ8 S;  1Q8L A;  4F0H A;  4DX5 A;  2A0F B;  2MZJ A;  2JFK A;  4DHV A;  3CJ2 A;  2IRX A;  3B4D A;  3HZG A;  5ETP A;  3MED A;  5A2Q Y;  1UMJ A;  3DI6 A;  3OR1 A;  4HDH A;  4DUY F;  2HHS A;  1UVL A;  4IFY B;  2R7R A;  4O44 B;  2V50 A;  1JXL A;  4LF2 A;  5ETR A;  4RU9 A;  1HR0 F;  3SBM A;  2BE7 D;  4NOH A;  4J90 A;  4K7Q A;  4YS2 A;  4LQ3 A;  2V4Q A;  3UI3 A;  4DR3 F;  3K5M A;  4B3R J;  5KFL A;  3GIR A;  2C3Y A;  3WQP A;  3OQ2 A;  4Y34 A;  1D0E A;  4LRF A;  2OUG A;  4JI2 J;  4IDK A;  5LOQ A;  5KFB A;  4NA2 A;  3DLG A;  2HK3 A;  3TEG A;  3W65 A;  5A8W A;  4F4Y A;  1ACM B;  1G3O A;  5EHH A;  4MKV A;  1NK5 A;  4ECQ A;  1DHM A;  1GH8 A;  1WHV A;  1XBW A;  2MSS A;  4ATN A;  5IM0 B;  3MEK A;  1VBX A;  4R25 A;  2MGZ A;  2VIH A;  1UEV A;  2RKI B;  1YZ6 A;  4YP3 A;  1YWX A;  3TZW A;  1KTQ A;  1OYD A;  2VFR A;  2ASD A;  2HUR A;  2Z56 B;  2VIC A;  1FDN A;  4WK3 A;  3PG9 A;  3W66 A;  4ZPA A;  2XNQ A;  4O0I A;  1WSR A;  2JC0 A;  2EK1 A;  4C7Q A;  1IBL J;  4LF5 J;  3LO3 A;  2OKQ A;  2FJD B;  5D3G B;  1D1U A;  4KHM A;  1RTZ A;  2GA7 A;  4NI2 B;  3A13 A;  1PC4 A;  4UOC A;  4WFZ A;  4HLB A;  4ZVQ B;  4DR2 F;  2WZ1 A;  1EP4 A;  1NEE A;  3RB4 A;  2QA4 S;  1LK5 A;  4MAK A;  3ZC4 A;  4DSI A;  1FRH A;  1RHK B;  3DDN A;  1LW0 A;  1RB0 A;  4OZ0 A;  2PMH A;  3HLU A;  3GFX A;  3OSP A;  4UTG A;  2CQ2 A;  3M32 B;  1YJR A;  2QYC A;  2EI5 A;  3BSA A;  5HQM A;  1H2U X;  1VI7 A;  2VBZ A;  2R7O A;  4PKD B;  2MY8 A;  5IT0 A;  3DRP B;  4N76 A;  2IVF B;  2H4W B;  3VGV A;  2YQ3 A;  1LFW A;  2CFX A;  2MLZ A;  3DMJ A;  5HLF A;  1MWZ A;  4DSK A;  1CVJ A;  2OIH A;  2UVR A;  2YX7 A;  5KFO A;  4ECY A;  2KHC A;  3MEE A;  4JI7 J;  1KDN A;  1VHI A;  2W2O P;  2HIQ A;  5C42 B;  3KJN B;  1FD8 A;  5I3Q A;  5DDP C;  4K4Z A;  1JNZ B;  1RA7 A;  3OUY B;  1MG7 A;  4ZMM A;  1KVJ A;  1WEZ A;  3T5K A;  1YSJ A;  2JDJ A;  3ZZR A;  3M8S A;  4DR5 F;  1U6B A;  1HNZ J;  3HO1 A;  3FZ2 A;  3FRY A;  3J81 j;  2D3O 1;  4RWW A;  2GHW A;  5LSL A;  2ZBI A;  4TU9 A;  2I1R A;  2CZ9 A;  3L95 X;  4KRW A;  1WDT A;  3E51 A;  3JQJ A;  3NBP B;  1SQG A;  1HHT P;  1AT1 B;  1VC5 A;  1Q16 B;  3W5Z A;  3A8I A;  5L39 A;  4EBE A;  1LK7 A;  1T0T V;  4PG5 A;  5F9L A;  3CCJ S;  4FF4 A;  1DJ0 A;  1IBL F;  4P73 A;  4LF5 F;  2C2O B;  2M4M A;  3NKY A;  1DTT A;  4ILR A;  2UVW A;  2AJF E;  2J8A A;  4B17 A;  2IJR A;  4NXM F;  1SQE A;  1UTA A;  4QIG A;  4IRD A;  5JVH Q;  3SDE B;  3ILL A;  1K44 A;  1VRU B;  1X0P A;  3WDO A;  1YJT A;  4ZK7 M;  4NCA A;  2HBQ B;  2V2Z A;  3QQC D;  2W4D A;  2B4U A;  3W8P A;  2J0S D;  1IKY B;  1W26 A;  2BJ1 A;  2F63 A;  4IOC Q;  4FF3 A;  2PDA A;  2XMV A;  3CD0 A;  4A8M P;  2XSF A;  2Y1J A;  2GX8 A;  2KJV A;  5HO4 A;  2D9P A;  1T9X A;  2FVQ A;  5A6W A;  3KJV A;  5KFK A;  4O3P A;  1IKW B;  4F26 A;  4B3O B;  1RCO B;  3FMB A;  5BR8 J;  1ZZN A;  3BN7 A;  2IA0 A;  2OFH X;  1F9E B;  3AA9 A;  4R0J A;  4FBU A;  3FEZ A;  4DV4 J;  1NH7 A;  9RUB A;  3JSM B;  2B56 A;  3IO1 A;  1FNM A;  2QLF B;  2C2Z B;  3HM9 A;  4E98 A;  4PWU A;  2ZDO A;  4EBC A;  3PZP A;  1OPZ A;  1U2F A;  7AT1 B;  2V9W A;  1W25 A;  2WRM A;  4IH5 A;  2ZUG A;  5B0E A;  4H4M A;  4USK A;  1X7V A;  4LBP A;  2ZZT A;  3OTO F;  1TL3 B;  2XS2 A;  4LFA F;  4HYK A;  3C6T B;  4X4S A;  4DOZ A;  2CPE A;  2NZC A;  2RJZ A;  2WVC A;  3QWP A;  5KFX A;  3QIP B;  2BJ3 A;  2J5A A;  3CD7 A;  5CCM A;  2ADC A;  2BW2 A;  2JEF A;  4X66 F;  3MEC A;  1NZA A;  1CC7 A;  2OPR B;  5GAE U;  2GFF A;  4OZ2 A;  2CPH A;  4CLU A;  2HQ3 A;  2FJV A;  4RBU A;  4UUX A;  3BSN A;  1WC0 A;  2HQI A;  2B6A B;  1R6V A;  2QTW A;  1HWK A;  1WUU A;  1VIO A;  1SKU B;  2LVW A;  1V9O A;  2WBR A;  4QR0 A;  4U7U K;  2NPF A;  4A4J A;  5LJ3 Y;  3VQT A;  1SI9 A;  1U6F A;  3NGR A;  4B3M F;  2AJ2 A;  1ZA1 B;  1RAI B;  1ZM4 A;  4UF4 A;  4F02 A;  3AD7 C;  1MWQ A;  4M5M A;  2RVJ A;  4NML A;  4X64 F;  4TQR A;  3HK2 A;  4DV5 J;  3BZQ A;  5BYQ A;  3SEO A;  4ECT A;  5DLF A;  2LEC A;  3KOA A;  5B0B A;  1J27 A;  5H9F J;  4ED7 A;  2Z0G A;  2CQ0 A;  5KG2 A;  2UUA F;  4WF9 Q;  4FKY A;  3HMJ G;  3TAP A;  2RF2 A;  3BKF A;  2UXC J;  3QRP A;  3BO2 A;  1HIY A;  2KZZ A;  1DLO A;  4ES2 A;  5BYR A;  1U8S A;  2IMO A;  5D15 A;  1VQS A;  1N32 J;  1MRO A;  3WX4 A;  2JLE A;  2GZO A;  3CED A;  3CUL A;  3D0I E;  5KFC A;  2F4V F;  2QLJ B;  1QSL A;  3GV8 B;  5FJ4 A;  1LXN A;  1NKE A;  2K1R B;  2QC3 A;  4NLO A;  1D9F A;  2GIF A;  5HMY A;  3I0S B;  2OML A;  4DU7 A;  4EI2 A;  3MMB A;  3QIP A;  3PW4 A;  3DOM B;  1CJK B;  2BJ7 A;  2WSF C;  2NUU G;  3C15 B;  1PYO B;  1RAE B;  1YHQ S;  2JEJ A;  5A6P A;  1AFI A;  5KFU A;  3D0H E;  3R5J B;  3TR5 A;  3IBW A;  4CTA B;  3SFU A;  2V0N A;  1RWU A;  1TKT B;  3HHL C;  4KBI A;  4OYX A;  3UN3 A;  2ABY A;  3PXG a;  3KMQ A;  4OI6 A;  1HBM B;  4H4O B;  2IC3 A;  2M8D B;  3V4I B;  2IPO B;  1NHV A;  3HDS A;  1TKZ A;  3VWS A;  4HI1 A;  1NK7 A;  2GHV C;  5DJB A;  5KT3 A;  2DKO B;  1QVG R;  3TUP A;  1FE4 A;  1U47 A;  1KNZ A;  3SCK E;  1U26 A;  5JXS A;  3NMR A;  1X8D A;  4FYW B;  2EG2 A;  4ZP8 A;  1LW2 B;  2NXJ A;  2LCW A;  5KG1 A;  3FMW A;  3OTC A;  3TUZ C;  1PYS B;  1REV B;  2VD3 A;  3EMT A;  3JXO A;  5EWE A;  5KFN A;  2R8H A;  4N56 A;  5KFE A;  2ZOF A;  3I5B A;  3N28 A;  3OXL A;  1JB0 C;  5D78 A;  2XC9 A;  1S1X B;  2GO9 A;  4MKA A;  5IZH A;  1VBY A;  1F2G A;  3MAH A;  4M5G A;  5GAG U;  3KJQ B;  2OHD A;  3D3C J;  2W7A A;  1PBU A;  4QYR A;  4AUK A;  3QMQ A;  4CH0 S;  4ZCM A;  1Q78 A;  1AW0 A;  2NSC A;  1SIZ A;  3HSG A;  4DQI A;  3MHY A;  4DSF A;  2IM0 A;  3MMC A;  5J2M A;  1J2V A;  4LQ9 A;  1ZAW A;  1VQK S;  1JLB B;  1NHU A;  1TUW A;  1ZM9 A;  2KDO A;  2WON A;  5D4P A;  4CRJ A;  4QWD A;  4OFZ A;  4GKK J;  4ZCL A;  4ZJQ A;  4ECX A;  2VPW B;  4DCO B;  2VQE J;  1RAA B;  2XS7 A;  4K5S A;  2XNR A;  5CYM A;  1U7L A;  5F3T A;  4TQS A;  2PMW A;  3A8E A;  2FHJ D;  1QAI A;  2CJX B;  3HFV A;  1TUG B;  4L6V 3;  1FO1 A;  4HEA 9;  4OYO A;  3RUB L;  3T9Z A;  2VOP A;  5KFP A;  5DET A;  5F0W A;  4DS5 A;  2NQP A;  4GO5 X;  4KFB A;  4W4M A;  4WYL A;  4F8R A;  2V34 A;  3GJQ B;  2QGF B;  3NGT A;  4LF4 J;  4W98 A;  1JLF B;  5F8L A;  1TL7 B;  4FXV A;  2OPS B;  5A76 A;  1RTJ A;  3CTR A;  3HSJ A;  2VA2 A;  2C42 A;  3OUY A;  3HP6 A;  1VDH A;  4FDF A;  5EWG A;  2F5G A;  4CO3 A;  3MM8 B;  1S99 A;  1X4E A;  2PT0 A;  4OQJ A;  1ICE B;  5K14 B;  4RNF A;  2R4F A;  2E5G A;  3JQM A;  4MTP A;  5AE3 A;  1FNO A;  3CDA A;  1L5U A;  2NRE A;  3W3S A;  1UEK A;  1HYS A;  4LF9 F;  2QX0 A;  1NLK L;  5E3A A;  2RQC A;  1YDL A;  1YG0 A;  3KLE A;  2G9O A;  1T9V A;  3W61 A;  1ZA2 B;  1FWK A;  5HMZ A;  4C97 A;  3BBB A;  2HGM A;  3IGN A;  2PC6 A;  4F7V A;  1ELO A;  2ZBR A;  3HCX A;  1MU2 A;  2NPI A;  3AJ1 A;  3HKZ D;  3BJY A;  3CC4 S;  2GAG C;  2BZ2 A;  2NCK L;  3CGI A;  4QOT A;  1V5I B;  2EBG A;  3GE9 A;  3MFI A;  3UQS A;  4C2M A;  4DL5 A;  1KN6 A;  3JYT A;  5SZT A;  2GS8 A;  3NNA A;  2YKA A;  1AXQ A;  1KP6 A;  2FIU A;  4F3Q A;  3G82 B;  4G6V B;  1MMN A;  5ETL A;  3EX7 B;  4DV1 J;  1CS4 A;  3CDU A;  5LMN F;  4OHV A;  4DFJ A;  2UUC J;  4R5P B;  1HWL A;  2LQ8 A;  1IKY A;  3R6G B;  4OHW A;  4UOF A;  4F2R A;  1S79 A;  4W92 B;  3PY8 A;  1TTH B;  2D3Z A;  2MKY A;  2KXH A;  3R2D J;  4CO0 A;  3LP0 A;  4KJI A;  3MR3 A;  2KT5 A;  4M5D A;  3DU6 A;  1Q7L B;  2V8H A;  3DGV A;  4ZKA A;  2JSX A;  1RAG B;  2J76 E;  1WNE A;  2PD1 A;  3EE3 A;  2JRS A;  1WC1 A;  4F4A A;  1S1W A;  5L1K A;  1ZH5 A;  4M1K A;  2CQ1 A;  4DQS A;  4OJ3 A;  2F9J A;  4DUT A;  3HVT A;  4P2M A;  4C11 B;  3R9L A;  1TEL A;  2YNH A;  4OYA A;  2ROE A;  4X4N A;  1X5P A;  3VAH A;  4LT6 A;  4DI6 A;  1FFG B;  3KHH A;  1S49 A;  2DGO A;  2YKN A;  1U1Q A;  3H25 A;  4P7V A;  1R8B A;  3V6J A;  2KM8 B;  3KK1 B;  3ZFV A;  1R7I A;  3ISZ A;  2VB6 A;  5FDL B;  4FF1 A;  5DGB A;  1BQN A;  2HGN A;  1U8W A;  3AJD A;  4MYU A;  1I5O B;  4A48 A;  4C3K A;  3LUY A;  2YPZ A;  5E3C A;  1VMB A;  3PO5 A;  4JI1 F;  1RHR B;  4USM A;  1IKX B;  3BPS P;  3U02 A;  4AQY J;  1TK8 A;  3HHL D;  5HBM A;  1OY9 A;  2FHO B;  1ZAX A;  8RUC A;  3TI0 A;  1KSP A;  4H4K C;  1KVK A;  1S7H A;  1F2H A;  1RKI A;  3T41 A;  2E1P A;  4DFM A;  3RB0 A;  2VBY A;  1OPI A;  2OPP B;  1U0H A;  1JXV A;  3G8Q A;  4Y2M A;  1E6Y B;  1NK4 A;  4JBC A;  1LXJ A;  2W2N P;  1D3W A;  1S7I A;  5KFI A;  3HPO A;  2ZH6 A;  1VQ4 S;  1NSQ A;  2DNO A;  3R5B A;  2VH7 A;  3SSQ A;  2QJ3 A;  1ZM3 A;  2JC1 A;  3ZXW A;  4AT1 B;  3VAL A;  2ZEJ A;  3L3C A;  6AT1 B;  4OX9 J;  3M9M B;  1E6V B;  3TQ1 A;  2EWH A;  2H51 B;  2RNE A;  4QIF A;  1NJX A;  5HVG A;  3ULH A;  2BYC A;  2ZC4 A;  3DRY A;  2BAB A;  3LW5 C;  1KLM A;  2VZ9 A;  1FKA F;  1ARO P;  4CLF A;  4DX6 A;  4I68 A;  4H4M B;  1ZPV A;  1NK9 A;  2W2M P;  2YKM A;  2AYG A;  3MPV A;  3CCU S;  4NYO A;  1FKO B;  2IM2 A;  1LOU A;  4Y2I A;  1UJ5 A;  2CNO B;  1HBN A;  2BAC A;  2H5E A;  4RZR A;  5KG0 A;  1X5T A;  3ETO A;  4J9S A;  3HT0 A;  4DSL A;  3CF5 Q;  1LQ9 A;  2ZD1 A;  4N47 A;  3TOQ A;  5DQI A;  3JTO A;  3NCP A;  4NLQ A;  1DAR A;  1JLG B;  3C14 B;  1TU0 B;  1Y3J A;  1U1K A;  4DPW A;  2EKN A;  2CZV C;  3OBI A;  2QA4 G;  2QT7 A;  5F0U A;  4B08 A;  2VFT A;  1B7F A;  1D9D A;  1TFW A;  4CQ1 A;  1SJR A;  1BD6 A;  2Y0S D;  2YKP A;  4I7F A;  4P75 A;  4JI0 J;  5E41 A;  3DOM A;  6FDR A;  2XCP A;  2F7V A;  1N34 J;  2ZH3 A;  2CQ4 A;  2XI3 A;  3MOZ A;  2EFP A;  2ALY B;  2KN4 A;  3DC2 A;  4FYV B;  3VGS A;  4M63 A;  1VK8 A;  3HUL A;  3ISN C;  3OTB A;  4DLE A;  3H5S A;  3M1V A;  4L3K A;  1FX2 A;  4OYM A;  4B9L A;  2DGS A;  4LRB A;  3EJM A;  4XTT A;  3FRZ A;  4PZV A;  3PR4 A;  1X9S A;  2DT9 A;  3AHP A;  5KFH A;  2C22 A;  4RW9 B;  1WC4 A;  1BQM B;  2B5J A;  3EIC A;  2CQI A;  3ICL A;  3PEJ A;  4FPR A;  1V6H A;  1SC1 B;  3VZI A;  3W63 A;  3ZZZ A;  2HHH J;  3TAM B;  2L9N A;  1YJU A;  1UW4 A;  2Q6B A;  2ZNZ A;  3Q2S C;  3SSR A;  3KLH B;  1N6Q B;  1PC5 A;  4WFY A;  2MQ8 A;  4MK9 A;  4X64 J;  1XR5 A;  2EFG A;  2CG8 A;  3S7R A;  1ULR A;  2H4Y B;  2BJE A;  1S10 A;  4UY8 5;  5DO2 A;  5KT6 A;  2CZ4 A;  1Q0N A;  5DDR C;  2C28 A;  2HBR B;  2ZBC A;  2BEF A;  1B99 A;  3BSC A;  1NDK A;  3CB4 A;  3PNI A;  2IFX A;  2AF6 A;  2QLW A;  3QFW A;  4UOH A;  4BBY A;  2XGQ A;  4RNM A;  1EZZ B;  1QE1 A;  3GMG A;  3F0N A;  3MM8 A;  4O3O A;  3R5A A;  3V81 B;  2FY8 A;  3TX0 A;  3ZZP A;  1R6Y A;  3IG1 A;  1UA0 A;  2B3T B;  1RT5 A;  4PUO A;  2HAI A;  1UJ4 A;  2DGU A;  1WDD A;  2EBE A;  5IM0 A;  3J80 U;  1R89 A;  2MKJ A;  3RAQ A;  1C1B A;  3CC2 S;  3OVS A;  2WON B;  2IAJ B;  4NZ7 A;  2C2E A;  1L3K A;  1N56 A;  3IFE A;  2OAU A;  1GEH A;  4J9L A;  3IR7 B;  2UUA J;  1N5S A;  1PKU A;  4FYY B;  1BC6 A;  1EET A;  1RUS A;  2RUG A;  2LDY A;  3CCW A;  4LRC A;  1T05 B;  1N5T A;  1R3N A;  3K89 A;  1VQM S;  2PFF B;  2D3O R;  2MHN A;  2WW4 A;  2Y1R I;  1DTQ B;  4ZOS A;  3F44 A;  2Y0B B;  3HF5 A;  2V4R A;  4CH7 A;  3IG1 B;  1MWY A;  5D4L A;  5HP1 A;  3M2R A;  3LAL A;  4QWE A;  2AX0 A;  2RUS A;  2XEX A;  2LYV A;  5JJB A;  4DF8 A;  2WOM B;  2HAF A;  1BY9 A;  5GMK a;  1CS4 B;  1F6T A;  1WHX A;  1K9M T;  1JLF A;  3KUG A;  4G1I A;  1WI6 A;  2KYZ A;  2OO4 A;  2QLX A;  2CPJ A;  2R2S A;  3X1L B;  4HT7 A;  4LR9 A;  3ZTQ A;  5RUB A;  1FFS B;  5C24 A;  2C3M A;  3BO4 A;  4DV3 J;  3PV8 A;  3NL0 A;  2HVE A;  4Y28 C;  1Q8B A;  1JMT A;  3UD3 P;  2C3P A;  3JTN A;  4H54 A;  5HL7 Q;  1NAQ A;  4RNN A;  4KC5 A;  5EUH A;  4DV0 J;  2UXB J;  3Q86 A;  4KGK A;  3FDS A;  5F8I A;  2DGQ A;  4QR2 A;  4TKT A;  2YKQ A;  3MFH A;  5U47 A;  2V8D A;  4NCG B;  4QPT A;  2GVD A;  4ZVG A;  1XR7 A;  4KYZ A;  2E29 A;  3CDE A;  5ETV A;  3KXD A;  5EWF A;  1RYS A;  4PG4 A;  4X4T A;  2DR8 A;  2W2Q P;  3K8W A;  3OXG A;  2CQH A;  1UVN A;  2VUG A;  2YNF A;  4FS1 A;  1RP5 A;  5J2P A;  2AGQ A;  3QFH A;  1SKW A;  4Q0B B;  2KG1 A;  2LA4 A;  1NUE A;  4OZ3 A;  1CBK A;  1YIJ S;  1XER A;  1LWC A;  1OSC A;  4P2F A;  1OJ4 A;  3CJ0 A;  4CH1 A;  2DPI A;  3PVX A;  1B4S A;  3DCA A;  4IG3 B;  3H40 A;  5D0G A;  2UXB F;  1A6L A;  2GC8 A;  5GAH U;  3J81 U;  4B3S F;  3ILI A;  4C8Z A;  1S6P A;  4IRK A;  3MM6 B;  3SSS A;  4DL6 A;  4PPZ A;  2E9T A;  2HVD A;  2HS3 A;  4O23 A;  1KR4 A;  1WOS A;  3BKT A;  2V4J A;  1UET A;  3BYP A;  3F56 A;  4NMX A;  4F36 A;  5KFM A;  1HL6 A;  3PEH A;  2X1F A;  2GGP B;  1PYT A;  2VDI A;  3GJR B;  2XG8 A;  3N6M A;  3P45 B;  2WSE C;  1RBA A;  4G1Q B;  4RL1 A;  3EYZ A;  2LQ5 A;  3C66 A;  2YWW A;  4NYP A;  1OQ6 A;  3S8S A;  5A2Q U;  4C0H A;  3DLJ A;  2XWX A;  5AJ3 J;  2IVY A;  3KLE B;  4PQU A;  5KG6 A;  3HD1 A;  2VJU A;  4TXS A;  5C25 A;  3OHA A;  2DNZ A;  4BC9 A;  4QW8 A;  2Q1L A;  2R9L A;  2QFI A;  3OFH A;  1IKV B;  1NKC A;  2DEI A;  3W2W A;  4EGL A;  4DL0 C;  2IM1 A;  2NSB A;  3KLF A;  1HKA A;  2DPJ A;  4CT8 A;  2AZ3 A;  1HNV A;  1O6X A;  3CJS A;  4F3O A;  3EVM A;  4ECU A;  3UNG C;  4WU2 A;  5FLX U;  2YWE A;  3GJT B;  3P6Y C;  2K3K A;  2ADB A;  3BB5 A;  2ZWO A;  3NWG A;  1Y5I B;  5C25 B;  4X4Q A;  2RDI A;  3J81 Y;  1CJV B;  3TJ9 A;  3G87 A;  2HFS A;  5KFS A;  5LM7 E;  5LXR A;  4C4W A;  1CJT B;  1TKX B;  3KK3 B;  1QUV A;  1P1T A;  2QYG A;  5J2P B;  4LF7 F;  1F9H A;  3PDN A;  1JQG A;  1RHJ B;  3VTI A;  3BO3 A;  3G9C A;  1H0H B;  2F3J A;  1RDR A;  3PFO A;  4LVO P;  1S57 A;  3T6B A;  2G4B A;  2UUB F;  1GX5 A;  3OFE A;  2ASY A;  2GNK A;  4TU8 A;  1WKJ A;  3CE8 A;  2KFN A;  3TP2 A;  2FHK A;  1ZOT A;  3MM9 B;  1IBK J;  1XNQ F;  1IWA A;  1VQN S;  4OHX A;  2Z58 B;  1RWO B;  1VC0 A;  2MZR A;  3NNC A;  3NEK A;  3D68 A;  2HGL A;  2GCF A;  3PYF A;  4CO5 A;  2Q66 A;  1BWE A;  1FD2 A;  1X9M A;  4BWM A;  2RB7 A;  4JOU A;  3S6E A;  4ERD A;  2LEP A;  1SV5 B;  2GGP A;  4M5L A;  4GVB B;  3HHL B;  1RT2 A;  1T9Y A;  2UP1 A;  5KG4 A;  2YQ0 A;  2B5J B;  2BQR A;  3RRK A;  3G6X A;  1S1T A;  1HI8 A;  3Q8U A;  2RD5 C;  1TAU A;  2V6A A;  2CAJ A;  1MMD A;  1JJ2 R;  4PQA A;  1G7C B;  4L76 A;  1FTC A;  5D4N A;  4WFA Q;  4RNH A;  4YQW A;  1U1O A;  1I6J A;  3M8Y A;  2UVU A;  4WKR A;  2X1B A;  1T9T A;  3Q8S B;  1MML A;  4BS2 A;  4JI4 F;  4ZLN A;  2ZJP Q;  3MCS A;  3PYG A;  4O3S A;  5HAN A;  3TO8 A;  4UQG A;  1RI7 A;  2OD4 A;  2BM0 A;  4NLR A;  1EP4 B;  3GB0 A;  2HVZ A;  2MJU A;  1T11 A;  1VYA A;  4MT1 A;  4JV1 A;  1JIH A;  3IA0 A;  4IO9 Q;  2N4C A;  2CJQ A;  2MKI A;  3ENQ A;  1NDP A;  1OY8 A;  1P8G A;  1RJJ A;  3VVT A;  3CDB A;  1DLO B;  1P6T A;  2QO3 A;  2BA9 A;  2FJX A;  2ZOM A;  2AD9 A;  4NA1 A;  1M5V C;  3CJQ A;  2CQ3 A;  1U45 A;  4NRU A;  2AJ0 A;  3TVY A;  1WTF A;  4JI2 F;  5JMN A;  3NGK A;  2JL9 A;  4R8U A;  3SXL A;  3TVZ A;  4C98 A;  2YNI A;  4U8V A;  4E0D A;  3ZZO A;  5A0Y B;  4DR3 J;  1YRX A;  2B51 A;  4IQM A;  1SIW B;  2RQ4 A;  2VC0 A;  3B6B A;  3MPD A;  5THW A;  1JLB A;  2LQB A;  2XI2 A;  5DZ6 A;  2BJD A;  4RW9 A;  1HR0 J;  4JYA F;  2V67 A;  4Y65 A;  3G6E S;  1N5Y B;  2RIL A;  3OFF A;  2CNK B;  3W1Y C;  3DRR A;  2Q6C A;  1FDD A;  3DLK B;  4QIE A;  1U1P A;  1FJ7 A;  2CWX A;  3BPD A;  3P8B B;  3MR2 A;  4EO6 A;  3T5L A;  4NLD A;  5KFW A;  1KKH A;  4S0M A;  2VV5 A;  2IJF A;  2CQB A;  2BQ3 A;  4OX9 F;  2HNY B;  2POK A;  1SQF A;  3DGP A;  5KFJ A;  1O51 A;  2ACY A;  3MM5 B;  5HRO A;  4DR4 J;  2ERR A;  2IJN A;  1S6O A;  2E5I A;  1QLN A;  3GIM A;  3AQO A;  1X31 C;  3D67 A;  2HZV A;  1U09 A;  2ZZN A;  1WF0 A;  1N0V C;  4YOE A;  5HJY A;  4L72 B;  2R7Q A;  5A8R B;  3SQG B;  3G8T A;  1VQ9 S;  1HWI A;  2PFD A;  4ELV A;  2QRR A;  2O1P A;  2MKC A;  1H2T Z;  3ZTP A;  5HJX A;  1VJW A;  4P6Q A;  2VF3 A;  3OL6 A;  3KUE A;  1C0U B;  3QO9 A;  1VC6 A;  3PYD A;  3BDE A;  2DVI A;  5IQ6 A;  4EYH B;  5G0R B;  1QUP A;  3EVW A;  4OZ1 A;  5T7L B;  1HQU A;  4ID5 B;  5KFD A;  2VKR A;  3M8R A;  2WCX A;  2VQF J;  5AXM A;  2GQC A;  1P27 B;  4W90 B;  4KKO B;  4EWT A;  1Q4R A;  2Z57 B;  3R2C J;  1N36 F;  1FRI A;  4TVA B;  2BM1 A;  1NJW A;  5JVG Q;  2L08 A;  2GML A;  4N5S A;  3UN5 A;  5L1L A;  4K4S A;  1ZM2 A;  2YBV A;  1N0U A;  3CIZ A;  4IO1 A;  4RUH A;  2DGW A;  4ZPD A;  3TVK A;  3AOB A;  5KFQ A;  3HHK A;  4B3O A;  4WZM A;  4ZVR B;  3OR2 B;  3CVK A;  1X4G A;  3NY0 A;  4AND A;  1RLD A;  3DFE A;  1XMB A;  5K8P A;  2NR0 A;  3GU0 A;  4ILM A;  1YJ7 A;  1FDA A;  4NZ6 A;  1RTI A;  2WB4 A;  3BN4 A;  3GZ7 A;  3QGI A;  4KKO A;  4C9D A;  2VL1 A;  1N8R T;  1UJ6 A;  3JSB A;  1VOM A;  3Q2T C;  1R31 A;  2AJ4 A;  4FNI A;  3PX4 A;  4DR6 F;  5KFA A;  5E33 A;  4M5D B;  1RWW B;  1I3O B;  2GVZ A;  5IC6 B;  1XNR F;  1T9U A;  3DOK A;  2DIU A;  1NXI A;  2EFN A;  1KHW A;  4AXI A;  2C2D A;  4DEZ A;  5C5J A;  1C1C B;  5ETQ A;  3NBP A;  5KTQ A;  3C6T A;  2WK4 A;  3Q8P B;  4HDG A;  3ZO7 A;  1SJ1 A;  3HVR A;  3NP5 A;  2MZS A;  3MDF A;  4O4G A;  3HSD A;  2G0J A;  2AEJ A;  2XMW A;  4NAS A;  2XYH B;  5AXK A;  1FWP A;  4YR0 A;  5HI7 A;  2RDJ A;  4AL5 A;  3FBB A;  4QWC A;  3UDC A;  3HVA A;  1DTT B;  2YVS A;  3S01 A;  1CJU A;  3KG0 A;  1HNV B;  2V2Q A;  3TUI C;  4MYT A;  3OW2 R;  4NLP A;  4KPC A;  3KMS A;  1FJE B;  5F8H A;  3DOK B;  2LU1 A;  1SB6 A;  2PO4 A;  1H2V Z;  1NPP A;  1PAU B;  2MHE A;  3FSX A;  4USV A;  1RT3 B;  2KT3 A;  4OZ5 A;  3CJ3 A;  2ILZ A;  5KT4 A;  2EC2 A;  2B8Q A;  1F0X A;  5DDO C;  1U25 A;  4DF4 A;  1YRU A;  2CQP A;  2D1C A;  4RR5 A;  4ELT A;  4O4G B;  4JI5 F;  3TAR A;  2MQL A;  3JTP A;  1RT4 A;  5T14 A;  4RW8 A;  3KK1 A;  4G1P A;  4PG8 A;  2YTC A;  4JI6 J;  1LWF B;  2NXN A;  4G1Q A;  1KLN A;  5IC4 B;  4YHH F;  2DH8 A;  3Q8R B;  5DLG A;  2MKS A;  3ITH B;  2R7V A;  2KYX A;  3CC7 S;  5HBM B;  1NRK A;  2DY1 A;  5J1P A;  1GMU A;  3LP2 A;  4R5P A;  2K06 A;  5LMU J;  5DG7 A;  2XS5 A;  2I2Y A;  1RTI B;  1S4F A;  1S4E A;  2ZC3 A;  1TQL A;  2HWI A;  3MMA B;  3T1A A;  2HBY B;  1VR6 A;  4J9P A;  1A9N B;  4ZN1 A;  2CKW A;  3QT5 A;  4DL3 A;  2QFJ A;  4KGX B;  3G2X A;  1QAJ A;  4ETZ A;  3KHL A;  4ECV A;  1XN9 A;  2I8E A;  5EX3 A;  3U1M A;  2ZH9 A;  2XSJ A;  3I6P A;  1S9E B;  2HHQ A;  3IP0 A;  3O1L A;  3Q23 A;  1H98 A;  4WE1 B;  1JJH A;  2E9Z A;  1DAX A;  3HVT B;  2AYB A;  4XK8 C;  2NXU A;  1OY6 A;  1VJQ A;  2H65 B;  3IR5 B;  1YBU A;  3MCO A;  2QIF A;  3PHE A;  4HVZ A;  4KE5 A;  2W24 A;  4YDX A;  4I1T A;  3SCI E;  1I94 J;  2MQO A;  2W2P P;  2HHU A;  3DLG B;  1IQZ A;  2COL A;  4ZA1 A;  4WJB A;  4ETX A;  3NNH A;  1HNI B;  2ZJR Q;  1URR A;  2C1E B;  5FDL A;  3T19 A;  2K3I A;  3CXC R;  3DNC A;  3GPA A;  1UEU A;  1YJN S;  2W4C A;  4DPY A;  4ZLL A;  1RWK B;  3H42 A;  2K7K A;  1WEX A;  2KO1 A;  2LLZ A;  1GX6 A;  1N32 F;  3CCL S;  3NCR A;  3W5X A;  1HFE L;  4Y2C A;  3N6L A;  3L7P A;  3IXQ A;  2XZD B;  3UE2 A;  2L9D A;  3DRX A;  4ER8 A;  1Q5V A;  1J5E J;  2DHH A;  2O01 C;  4IKA A;  2NZ4 A;  2IMW P;  1LW2 A;  1YLX A;  4FYX B;  2R2T A;  4WK1 A;  4C3L A;  4Q43 A;  1TFY A;  4X62 J;  1HNX F;  1RT2 B;  3CCV S;  5F8N A;  1UA1 A;  4HAC B;  1V3Z A;  4B9S A;  1Q8K A;  1M5P C;  3M2U B;  3AOA A;  3BKU A;  3G86 A;  4QIW D;  1S0N A;  5K8M A;  4B02 A;  4DJB A;  3MTK A;  1BQM A;  3MR6 A;  4LF8 J;  1RT7 A;  1C0T A;  1K0V A;  3CMA S;  2QMW A;  4DR1 J;  3PJW A;  3OFG A;  2XY5 A;  2CPI A;  4O3Q A;  4YEA A;  3HSZ A;  5LL6 d;  1S0O A;  4NLG A;  4U6P A;  2DRA A;  3QRR A;  4Y2K A;  3PX0 A;  1RBL A;  1IM4 A;  2JHE A;  2Z2M A;  4KH1 B;  4J9O A;  1BUX A;  1WAC A;  3A4T A;  1Z2Z A;  1LFP A;  5J1E B;  1WOP A;  2GJ2 A;  4HHH A;  2KVI A;  3M9O B;  3K57 A;  1O8B A;  1WHW A;  4RPF A;  3FZB A;  1FRK A;  4QWB A;  3LWL A;  3BEG B;  4LF8 F;  4Q8F A;  2YX1 A;  1CG2 A;  2QV6 A;  2HHH F;  3K0J A;  1RT7 B;  1YJW S;  1IVZ A;  2EW9 A;  3QSI A;  2XZT B;  4HH1 A;  4NLV A;  4TLR A;  4LRD A;  1WG4 A;  1PIL A;  4ZPC A;  3C14 A;  5CAB A;  1T9W A;  3A3O B;  1S97 A;  3GLJ A;  5A0Y A;  3GQC A;  3LQV A;  4ED2 A;  4QIV A;  1WOR A;  3RBE A;  3ENA A;  4H4O A;  4USH A;  4EZ6 A;  2DGT A;  3A3P B;  1N34 F;  3O5T B;  5EN1 A;  5L9X A;  1N5Y A;  3HHD A;  3I31 A;  1EET B;  3SQO P;  1Y9O A;  1WWH A;  3ZZU A;  4DV5 F;  2XWY A;  2AMC B;  2DR5 A;  4LFB J;  2N4D A;  2Y3Y A;  2MLX A;  5ADZ A;  3SV4 A;  5CH7 B;  1GFW B;  2E7W A;  3K5P A;  2D74 B;  1B64 A;  2MMY A;  5BJR A;  2IM3 A;  5KFT A;  3IS9 B;  3QBC A;  2HND B;  2M8H A;  1SCJ B;  2PA3 A;  1PAE X;  2MQN A;  4CI0 B;  5HRO B;  4KHR A;  4CP5 A;  3UVJ A;  2DHS A;  2KRB A;  4FZV A;  1VRU A;  1QTN B;  2HLT A;  3ET6 A;  4I2P B;  1NBE B;  3W2V A;  4EMD A;  2KU7 A;  2MGZ B;  5DM7 Q;  4L73 A;  1NJY A;  2WHO A;  1FK9 A;  3EXC X;  2BR0 A;  2ZKU A;  8AT1 B;  2C2M B;  1HWJ A;  5D77 A;  3LTO A;  1C0T B;  1P9Q C;  3U7J A;  2OFG X;  4X66 J;  4M94 A;  4DR4 F;  1N4L A;  1VQ5 S;  4U7U D;  1BHN A;  1VQL S;  1NCL A;  4CLK A;  4J9N A;  1B0V A;  3D0G E;  3M30 B;  1TAQ A;  4PEO A;  2HEK A;  2B9E A;  4MFB B;  1RWV B;  3JS9 A;  2R8J A;  2H1Y A;  3MM7 A;  4QZV B;  4JV5 J;  2HVI A;  1SUQ B;  2DO0 A;  1QE1 B;  2FTR A;  3AA8 A;  4L75 A;  2AZ1 A;  2RRB A;  3ZTO A;  3J7Y U;  2NLW A;  4MKY A;  3I82 A;  2AYM A;  4PYD A;  4ED4 A;  1FXL A;  3NXZ A;  3QAU A;  1R0A A;  4CZC A;  2V2K A;  4LSN A;  3GP9 A;  4GKK F;  1RHM B;  3N0V A;  1VIX A;  4B3T J;  3OXF A;  4RUC A;  4LF1 A;  3FBF A;  2MKK A;  5IT9 Y;  3ADA C;  2BV3 A;  2EXU A;  2IY5 B;  4WP8 A;  1KQF B;  1K47 A;  1K8A T;  3KTQ A;  3PTW A;  3ZNJ 1;  1WF2 A;  1HNZ F;  1T05 A;  2R3V A;  1X5S A;  1HI0 P;  1RT4 B;  1S6P B;  2YKO A;  1YJV A;  1RT6 B;  4LVN P;  1K0T A;  1S1U A;  3GV5 B;  5I3U A;  5KFG A;  3Q8Q B;  2L41 A;  3QZ7 A;  3D2W A;  3CWJ A;  1KFD A;  2G1D A;  2UZA A;  3O3L A;  4Q45 A;  1U49 A;  1S0M A;  5HSP A;  2WOM A;  3KG4 A;  3MCM A;  4IFV A;  2MZ1 A;  1U2R A;  2HFN A;  3JB9 k;  4ILL A;  1Q95 G;  4Y0F A;  3OV7 A;  2OTJ S;  4DV2 F;  1XK8 A;  1UPM B;  4OZN A;  2IRU A;  3QWU A;  1JKH B;  1KON A;  5C24 B;  2YY3 A;  2CG4 A;  2J9D E;  4RW4 B;  4GRS A;  4CLW A;  4EK2 A;  1XJW B;  4PWW A;  1NM2 A;  2DNL A;  4RWX A;  2FVR A;  1DFD A;  3IWL A;  4OZJ A;  1NPR A;  1YRT A;  3IM8 A;  1YJ9 S;  1TVR B;  3CJ8 A;  3POT A;  2ZOG A;  3MF5 A;  3D6T B;  2PE8 A;  4WE1 A;  1RQ0 A;  1VRQ C;  5ETN A;  1FHT A;  3V6D A;  1DRZ A;  3R7B B;  3B4M A;  4C0O C;  2NS1 B;  5KFY A;  4NWB A;  3CJT A;  3I9V 9;  1RWP B;  1TMJ A;  1VLO A;  2V8G A;  3QAE A;  4M5N A;  2N82 B;  1S6Q B;  5IWA J;  1Z4U A;  3QLH B;  4DU8 A;  2Z8Q A;  2ZH2 A;  1F1B B;  5KT5 A;  2Q79 A;  3CJ4 A;  3M6W A;  4X65 F;  1DY3 A;  3FVY A;  5ETM A;  2HK2 A;  1U24 A;  2CPY A;  4WII A;  2GMH A;  4GVL A;  2WBM A;  1TK0 A;  1Q82 T;  5E3Q A;  2HFV A;  4I64 A;  2I5J B;  1XWL A;  3QJP A;  2JLF A;  3GG0 A;  4FNH A;  4P52 A;  5B0C A;  6FD1 A;  1ZYQ A;  3MM9 A;  3Q24 A;  2ROP A;  3CD5 A;  4DUZ F;  4QWA A;  5BXI A;  3AD9 C;  3FKB A;  1X4C A;  1JX4 A;  2DR7 A;  3NG8 A;  4OI3 A;  4B3S J;  1UL3 A;  2XMU A;  2ZBQ A;  4OJG A;  1UVM A;  4K4U A;  3ZZT A;  2DJW A;  1SJ4 P;  2KM8 C;  1M5S A;  1ITP A;  4CLT A;  1SL1 A;  2CQC A;  4K2X A;  2XHC A;  2QLB B;  2FJB B;  2FC8 A;  2X1G A;  3V4I A;  3C8Y A;  3KKF A;  4B3T F;  2CNN B;  2UV8 A;  2KRR A;  4RX6 A;  3B78 A;  3UW1 A;  3WHI A;  5H9F K;  1LNQ A;  1UAW A;  5DS7 A;  3GYN A;  2ZE2 A;  3M4X A;  4NLY A;  2WW8 A;  3AD8 C;  2W25 A;  4OI0 A;  2MY7 A;  2GIQ A;  3HHL A;  4ZDN A;  4X4P A;  2FPH X;  1HI1 A;  1SJQ A;  1DQ8 A;  2FZG B;  2L48 A;  3KLI A;  3S1T A;  5B08 A;  3KLG B;  3IR6 B;  3D66 A;  3PO4 A;  1VQ6 S;  3F41 A;  4USW A;  3F73 A;  2BE2 A;  3P3D A;  3MD3 A;  2ROG A;  5KOX A;  1B3T A;  2G2Y A;  2HWT A;  3TJ8 A;  4EU0 A;  4U67 Q;  2HRU A;  3MMA A;  2ZBP A;  4CT9 A;  2HYI B;  3CJK A;  1OYE A;  2PA8 D;  3SCL E;  2PN6 A;  2V8V A;  2ZE2 B;  1PJ6 A;  2DGV A;  1JLG A;  5F41 A;  2YKM B;  2DR6 A;  2ZHA A;  3FFI B;  1N88 A;  3HX9 A;  2YNI B;  4J5O A;  3M2U A;  3TX8 A;  3MEE B;  3M8Q A;  2P9C A;  3K5O A;  2ZIT A;  1RTH A;  4TY8 B;  5HAT A;  3FGV A;  4J9U E;  4DG1 B;  2IC3 B;  5F8M A;  2AEF A;  1SC3 B;  4I69 A;  2I38 A;  3VGT A;  2VPX B;  3EPG A;  3V81 A;  1RZM A;  4LFB F;  1LWE A;  5CHC B;  3UNY A;  2PI4 A;  3RZA A;  2VBW A;  2R2R A;  3N5F A;  4RUA A;  4I6Y A;  4JI3 J;  2G2Z A;  2KXF A;  3TYT A;  1KOO A;  3ET6 B;  3AJ2 A;  4I2P A;  3RG6 A;  3CCQ S;  2NXC A;  3CNQ P;  4I7F B;  2K1R A;  4LIW A;  3GIK A;  3IRX B;  4BDP A;  3DRR B;  2QL5 B;  2VU5 A;  3DYA B;  4KT0 C;  1WG5 A;  1SKR A;  3TAM A;  1DZ5 A;  2ATL A;  5K8O A;  1R8C A;  3DDK A;  3DRP A;  4J91 A;  2ZDP A;  3I5A A;  2EG1 A;  4URS A;  2PI5 A;  2MXY A;  3N6N A;  4F4X A;  2EC0 A;  1PJ5 A;  1UZH A;  2KI2 A;  3EZU A;  4NLX A;  4QR1 A;  5J2Q A;  4X2B A;  3W9J A;  5H1S V;  4MFB A;  3QO9 B;  3KHG A;  4E8U A;  2W8L A;  3CPW R;  2FVP A;  1VFJ A;  5BYS A;  4R0E A;  4X4U A;  4YB6 A;  3X3U A;  1MU2 B;  3JAM Y;  4DV6 F;  1HBM A;  1R27 B;  2OGU A;  2R7S A;  4I67 A;  1ZTT A;  2DBB A;  4OHZ A;  5DG8 A;  2DR9 A;  3CIM A;  4OMF G;  3E3X A;  5IT4 A;  3ZZY A;  3LAN A;  2UV8 G;  2HFO A;  3MED B;  4FPI A;  4I2Q B;  4I6W A;  4O4R A;  3DI6 B;  3OR1 B;  4YUD A;  2ASL A;  2CJK A;  1REV A;  2Y1L B;  2ZH8 A;  3T1H J;  2OP5 A;  2BOA A;  2HZA A;  5E3P A;  4A8F A;  1Q5Y A;  4MIA A;  1FXR A;  2BJ8 A;  2XB2 D;  3PW5 A;  4KY3 A;  7FDR A;  4I4B A;  4DX7 A;  2JH3 A;  2FDN A;  4ZIV A;  5L1I A;  1KS2 A;  1F3V A;  3M8Q B;  4TY8 A;  4K5R A;  3K2Y A;  3JSM A;  4QU7 A;  2X1A A;  1Y11 A;  2FQQ B;  4K0K F;  3EUN A;  3DLK A;  4C8M A;  1S1U B;  5I3U B;  4P2X A;  3MAQ A;  1BWV A;  3L4B C;  4JI7 F;  5D0R A;  4CLP A;  4WZQ A;  4E2F B;  1GT8 A;  3CCS S;  3R5D A;  4I2Q A;  1S1W B;  3M8W A;  2L3M A;  3MMC B;  2J7K A;  4ZN3 A;  1HYS B;  3J7A N;  4ECS A;  2P9G A;  3GFZ A;  1CUL A;  2OEK A;  3BRE A;  4UST A;  1NK8 A;  2KTQ A;  2F4F A;  3PIP Q;  1GTH A;  1Q81 T;  3OL9 A;  3NLC A;  3H2V E;  1HWU A;  2AV5 A;  2W4P A;  3FCW A;  2H5I B;  1RSC A;  2PGC A;  3MMJ A;  4YN3 B;  3W9H A;  3SQG A;  1OWX A;  3NGU A;  1X4A A;  3NMA A;  1AZS B;  4KV8 A;  3TA2 A;  4AD6 A;  2DNG A;  3MUV P;  1KQS R;  1IR1 A;  3H2L A;  1HQE A;  2EVZ A;  2ACM A;  3BGO P;  3EM1 A;  5D3G A;  2QMX A;  2K2P A;  2B9Y A;  4DR2 J;  3G82 A;  4F4Z A;  1WJ9 A;  4KFB B;  3LWM A;  4ZVE A;  4WTY A;  4OI2 A;  1EKS A;  4UT4 A;  1YI2 S;  5T7L A;  2MB0 B;  1UVI A;  1UWA A;  1MN7 A;  2DNM A;  2UUT A;  4USI A;  1QAX A;  3HHE A;  1T8E A;  3EXY A;  3W2V B;  1REG X;  1VIS A;  3AY0 A;  2AYE A;  2OEL A;  2OPQ A;  4N8O A;  4DQR A;  2KL8 A;  2VHG A;  2FVS A;  1N52 B;  4C8K A;  3VAF A;  2W8K A;  4OV6 A;  4ANC A;  2ZM6 J;  4O3N A;  5CYQ A;  1RHU B;  3MTJ A;  1S77 D;  4P72 A;  1HQE B;  3E01 B;  3FSI A;  3H98 A;  4J9V A;  5E7O B;  2CYY A;  3D1H A;  3THT A;  4LRE A;  3MUT P;  4FYD A;  3ENV A;  4NYZ A;  4NEZ A;  3MR5 A;  2ZH7 A;  3OR2 A;  3LF0 A;  3BGU A;  3PYE A;  4YHH J;  2RF2 B;  5I4M A;  4J9R A;  4JYA J;  3C6U B;  3L9Z A;  3RBZ A;  1P9Y A;  2UU9 J;  4EO8 A;  4UY8 T;  4JI6 F;  4OZL A;  5C42 A;  3MXH P;  4PXC A;  5IV3 A;  3CCR S;  2IRY A;  5B0A A;  1IR0 A;  1A7G E;  2YNF B;  4M5J A;  1CJT A;  5A8K B;  3MUR P;  2E1A A;  1U48 A;  1JLE A;  2R8K A;  3M6X A;  1RAJ A;  3QNW B;  1KEK A;  2HMI A;  3MOJ B;  3E01 A;  1NKB A;  1MN9 A;  4C8O A;  2BRL A;  1RYR A;  1RAF B;  2QL7 B;  3M2V B;  3BSO A;  3L7U A;  2BJ9 A;  2F40 A;  4ES3 A;  4DV7 J;  2VG6 A;  1V3S A;  2W7P A;  1JWW A;  3FSY A;  4KGV B;  2F1F A;  3NOG A;  5M2P A;  3H4B A;  4NZ0 A;  4DV3 F;  1YIT S;  1R0C B;  2HBZ B;  1NH8 A;  5HN0 A;  2OSR A;  4IR1 A;  4FP9 A;  4M8L A;  1X4H A;  2DK2 A;  2ZD1 B;  3BBF A;  5HMW A;  4JI4 J;  2XLK A;  4YFU A;  3O8W A;  3FCV A;  1IKV A;  1OO0 B;  2FD2 A;  3NAH A;  3AB2 B;  5GMD A;  2GHP A;  3UR3 C;  2KFZ A;  2J8S A;  1Q53 A;  2AEM A;  3V4M A;  2VG7 A;  3LGH A;  2ZUA A;  3I9Z A;  5DRK A;  1VRT A;  1WG1 A;  3MPW A;  3GWC A;  3H5Y A;  1LV5 A;  3WC2 A;  1T03 B;  4FBT A;  2WAQ D;  2RSQ A;  5I3P A;  5EGY A;  1TMM A;  3OTD A;  2LDI A;  1XNR J;  1H7W A;  5IQQ A;  3U1N A;  2JJ4 D;  3M8P A;  1YTY A;  3H5U A;  5DZ7 A;  4HTJ A;  3CJR A;  4DFK A;  2AP6 A;  5D4O A;  3HKW A;  3BGR B;  4WKY A;  2A10 A;  2J7U A;  3FJ2 A;  2AT1 B;  3OLB A;  1HNI A;  2DIV A;  4DUZ J;  3EZ5 A;  3DXS X;  3PM9 A;  5CZV A;  3MGJ A;  4PR6 A;  3PR5 B;  4A8S A;  3RB6 A;  3PKM A;  1IBK F;  1SVD A;  2E44 A;  3TW0 A;  3ZTR A;  4DXL A;  3RBD A;  1VK3 A;  1KQK A;  2ZHB A;  3B8H A;  1QSS A;  4KPY A;  5D0E A;  3CT9 A;  4J37 A;  2XLI A;  1H38 A;  4GKJ J;  1B70 B;  3C6U A;  2B7C B;  3KLH A;  1FFW B;  1N36 J;  3T6J A;  1GK8 A;  2A1B A;  1JXE A;  4YY3 F;  2BBE A;  1DQA A;  4ZPB A;  4AE5 A;  3W62 A;  2LP4 A;  5LT5 A;  3HT3 A;  2BQU A;  4Q8E A;  4OL8 A;  4NLW A;  2DNP A;  2AGP A;  3EWG A;  2WVF A;  1U1L A;  2I5J A;  2RDD A;  4F0M A;  3R1L A;  3DDI A;  3DOL A;  4FVM A;  2PMZ D;  3UCU P;  2RQM A;  3GR1 A;  3PIO Q;  2HS0 A;  1WTB A;  2RH3 A;  1S1V B;  4ED0 A;  1K1Q A;  1RU2 A;  2HRY A;  1AYE A;  2U2F A;  2DNH A;  3VGU A;  1MSW D;  4NLU A;  2X3G A;  2ZH5 A;  2IHR 1;  4DL4 A;  2MQQ A;  1S6U A;  2CPX A;  4ZVT B;  1HNW F;  1SBR A;  3L7O A;  4M95 A;  5KG5 A;  4AL6 A;  3FUY A;  1NSA A;  3MAA A;  4FXW A;  5FD1 A;  4P10 A;  1ZS6 A;  3SFG A;  1RTH B;  1ZTW A;  2B8P A;  1EB0 A;  1UFL A;  4ZPV R;  3TWZ A;  3D4J A;  2DXD A;  2CAD A;  3M8P B;  3TUJ C;  5LSR A;  2R2U A;  1T94 A;  5GAD I;  3UDE A;  1I51 B;  2KH9 A;  2DGX A;  3GV7 B;  2ZH1 A;  4LF6 F;  3R5C A;  1UWB A;  3OTE A;  1NB7 A;  1M1K T;  2FGO A;  2VJV A;  2KJW A;  5KG3 A;  5J2M B;  1IQT A;  2V2V A;  4P74 A;  4CM0 A;  1BE4 A;  2BRK A;  3GFY A;  1KOH A;  1HQU B;  4ID5 A;  2M9K A;  2GO8 A;  4OYP A;  1UCN A;  3GCW P;  3TZZ A;  1ZAV A;  1RAO A;  2J6U A;  1QJH A;  3HFZ B;  1CSJ A;  4MK8 A;  2MYF A;  2RS2 A;  5CYM B;  1VQO S;  1P1L A;  3FCH A;  2JOQ A;  2R7X A;  3AOD A;  5GVQ A;  3LAM A;  2HFZ A;  4Q44 A;  1X0F A;  2FJW A;  4N77 A;  2DCL A;  3U1L A;  3OSN A;  1Z1Z A;  1NO8 A;  3CD6 S;  5CZX A;  1WC6 A;  4HH0 A;  1RK8 A;  4LSL B;  2R7W A;  2FY1 A;  1WD6 A;  4OIX A;  2CJB A;  4ZVU B;  1C1B B;  4DDF A;  2HHV A;  1Y5L B;  3M6U A;  5I42 A;  1VBK A;  1PCA A;  1CPZ A;  2MTL A;  1HHQ A;  3PW2 A;  3HFK A;  4IRC A;  3MI7 X;  2KT2 A;  3RW7 A;  2XO7 A;  2DHA A;  2N7C A;  3H2U B;  3I0S A;  2FB0 A;  5D8H B;  2FZK B;  3NCQ A;  2KG0 A;  1DTQ A;  2BAN A;  3WZ0 A;  4P71 A;  1N6Q A;  1S12 A;  2B0G A;  1F5A A;  3SCJ E;  4LSN B;  1IM6 A;  3AAW B;  2OEJ A;  7FD1 A;  4MMO A;  1NDC A;  1WC3 A;  1NZ8 A;  2XBP A;  5B0G A;  4O3R A;  4I6A A;  2AWZ A;  2FC9 A;  4Y00 A;  1IWG A;  3PHT A;  5GAH I;  5G0R A;  2CJ9 A;  3R5G A;  4MH8 A;  1SUQ A;  3Q0A A;  2HVH A;  4DFP A;  1PSD A;  2YKN B;  3GSI A;  5L1J A;  3GJS B;  1TKZ B;  3AB4 B;  2V4J B;  4WU3 A;  4ZIT A;  1YZ7 A;  1Y3K A;  4EUV A;  4JI1 J;  1CEZ A;  1S9G B;  2FVC A;  4XIU A;  3QT7 A;  3BM7 A;  1Y4Z B;  3AH6 A;  1XTZ A;  1IKW A;  1JLC B;  3M9N B;  4RW6 A;  4QU6 A;  3MUM P;  3NS7 B;  4NXN F;  1JLA A;  1BMQ B;  2HHP A;  2AW0 A;  4QBU A;  4NLS A;  4RNO A;  1Y5N B;  2HW3 A;  2Z2Y B;  1ZZF A;  3HI9 A;  3ETM A;  1FRL A;  1L3U A;  3UD4 P;  4PXB A;  3U27 A;  5CD4 A;  2D9O A;  3W2W B;  4IG0 A;  2PEB A;  1W2I A;  1U1M A;  2Y8W A;  5IT9 U;  4TN2 A;  1HAR A;  2JNJ A;  1XMQ F;  2CNL B;  2HLU A;  4CLS A;  4RW6 B;  4U7C A;  5DQG A;  4LSL A;  1IBC B;  3Q89 A;  5HK4 A;  3RYL A;  3I56 S;  2MPU A;  4U9R A;  4ED6 A;  4B9T A;  4MJK A;  3MR7 A;  3R3T A;  4CCH A;  1GXT A;  1LEO A;  2B9W A;  4F04 B;  4KSE B;  4DV6 J;  2XCA A;  2RS8 A;  5KFR A;  1UVK A;  1TKX A;  3KK3 A;  3RR8 A;  2BKP A;  2YNG A;  2HNZ B;  3PRB A;  4UZC A;  5E5N A;  1YBT A;  3POT B;  3FQL A;  4H4K A;  5GAE I;  1X4B A;  2AJQ A;  1SC6 A;  5IV4 A;  2MLY A;  4OX6 A;  3CCE S;  2OMO A;  2NYH A;  2VBX A;  2M88 A;  4RUB A;  2ZHO A;  1RT3 A;  2V68 A;  3D9B A;  3FNN A;  4PQU B;  1M0S A;  2B7B B;  1M1G A;  4D3G A;  3A8J A;  1EAY C;  4NA3 A;  1HPZ B;  4DN0 A;  3D6H B;  2CPD A;  4LSZ B;  4URQ U;  4WXO A;  4WPA A;  4DCP B;  3N9U C;  2RE1 A;  3O6Q A;  5LSO A;  1R8A A;  3QRQ A;  1LWF A;  3A12 A;  4J9M A;  3N4W A;  4PXD A;  4ZHR A;  4ITS A;  4GMK A;  2A6O A;  2A2D A;  4DL7 A;  2J6S A;  3I87 A;  5E0O A;  3K59 A;  1PG5 B;  2PII A;  2VG5 B;  2YXL A;  4NXN J;  1XQI A;  4ZP6 A;  3RW6 A;  5LMU F;  1JKH A;  2HFU A;  1GAO A;  1RWX B;  3OD2 A;  1VBZ A;  5CQG A;  3G4S S;  4M5I A;  4B3M J;  2JX2 A;  2Z2L A;  4Q7A A;  3O44 A;  4EFA C;  3SV3 A;  2Z4P A;  4KHP F;  1N5Q A;  1M1H A;  1SH0 A;  1FRJ A;  2XZW A;  3MZI A;  3JSR A;  1VCT A;  3PRD A;  3QID A;  3HJV A;  4CM2 A;  4WIQ A;  3NAI A;  1M5K C;  1HBO B;  1APS A;  3ILO A;  3KJV B;  4XO0 A;  2ZM6 F;  4LBI A;  1T3O A;  4ANE A;  1S5Z A;  1VLY A;  3LOU A;  2CIM A;  3MD1 A;  1IBM J;  2ZJQ Q;  4LMZ A;  1YKW A;  1UPP A;  4QJV A;  1H72 C;  2WVB A;  2FJA B;  3OHB A;  1I1G A;  3BGR A;  1OQ3 A;  4PG6 A;  1WOO A;  4LF6 J;  2M7S A;  5K20 B;  2Z2Z A;  2LQ9 A;  5AXN A;  1U1R A;  2KVQ E;  4X4V A;  2J9E A;  5AXL A;  3MAA B;  4WP3 A;  1WEL A;  3Q8Y A;  2HQD A;  3OL7 A;  1ROF A;  2B4V A;  3FQK A;  2IIH A;  2WVE A;  2CDR B;  3HXM A;  4K8R A;  4KO0 A;  4DV4 F;  1HNW J;  3H20 A;  3K5N A;  3I5C A;  5L46 A;  1LKZ A;  4IOA Q;  4I0W A;  2J7W A;  5BR8 F;  2BX6 A;  5H9E J;  2JEG A;  1JLQ A;  1TL1 B;  2E1R A;  4FKX A;  2ZKT A;  3T5H A;  2IA6 A;  4TLQ A;  3TNV A;  2XTJ P;  4C8N A;  3GR0 A;  1FXD A;  1HBU A;  2VG7 B;  4IFY A;  2OJ3 A;  1VRT B;  3P5B P;  2DRB A;  5D0H A;  1U02 A;  2W7O A;  4K2J A;  4L3N A;  2EEY A;  1S76 D;  1D8Z A;  2Z30 B;  1JK9 B;  2DNY A;  9ATC B;  1FJC A;  2LEB A;  3I96 A;  2BE9 B;  1KRP A;  2G1H A;  1XR6 A;  3IAM 9;  4ZIW A;  4YY3 J;  3CUN A;  1GMW A;  2IYG A;  1AUS L;  2ATC B;  3VAM A;  4K4T A;  1XC9 A;  1Z2L A;  1U0S A;  4WYW A;  1L3V A;  3DM2 B;  1JLQ B;  1TL1 A;  1YVF A;  2G13 A;  1TZ0 A;  2AHO B;  3IMQ J;  2YX4 A;  3M6V A;  1G6B A;  1VQ7 S;  1RKJ A;  2UVV A;  4F25 A;  4X65 J;  4NI2 A;  1UZD A;  3PRV A;  3KNG A;  4OLP A;  2F65 A;  3M05 A;  1S59 A;  2X3D A;  3D28 A;  1KBR A;  1EJ7 L;  1KTV A;  3HZE A;  5J1N A;  1CQN A;  1JJC B;  1LWX A;  3DYA A;  1L3S A;  1LW0 B;  1DQ9 A;  1NND A;  2F8H A;  4IOB A;  4EBD A;  1AUD A;  2D69 A;  3TQE A;  4RO0 A;  4AFF A;  4F67 A;  3BQ0 A;  2FLO A;  2VFS A;  5AT1 B;  1KD1 T;  2H3E B;  1MLA A;  2XMT A;  2YWF A;  2DHG A;  1OSD A;  2A18 A;  2M70 A;  3LP1 B;  4ZP7 A;  3KNA A;  5J2Q B;  2JLG A;  3GSD A;  2PSZ A;  2VKZ G;  4V19 J;  1S1X A;  2XO6 A;  1FX4 A;  4NCG A;  4CNZ A;  2XM3 A;  2MST A;  3MM7 B;  4CLL A;  3PW0 A;  3J7A 1;  3TAQ A;  2IBO A;  2FUG 9;  2HQC A;  2J9D A;  4PXE A;  4ZPT R;  5L8R C;  4C0B A;  3MMB B;  1TK5 A;  4F0K A;  1PO6 A;  5M2U A;  1S1V A;  3D6F B;  1VS3 A;  3KFW X;  4A8K A;  1FKP B;  4OLO A;  2W9C B;  4ED8 A;  4ECW A;  1FF2 A;  3BGF A;  1GNK A;  1RIS A;  2GVZ B;  1EX8 A;  2QA2 A;  5MAO A;  2RU3 A;  1EHW A;  4HT5 A;  2OTL S;  2EPI A;  2P6S A;  3DKD A;  4U96 A;  4CTA A;  3FK4 A;  2HHW A;  4IG3 A;  2B9X A;  2D41 A;  2EFV A;  5I42 B;  4KTQ A;  4EZ9 A;  3PFE A;  3BH6 B;  1Q8I A;  2XGP A;  4K59 A;  3VZH A;  4EYI B;  1J5O A;  4AYB D;  4F4W A;  1VQY A;  4TNO A;  3T1Y J;  1XMO F;  4URG A;  3IRX A;  4LRA A;  2MQP A;  4LF9 J;  3I4H X;  1Q1K A;  4IG0 B;  2AQ4 A;  3VHQ A;  2BAN B;  1PBA A;  2WTF A;  2JWN A;  3V6H A;  1FWL A;  2HQG A;  5KT7 A;  1KC8 T;  3HD2 A;  2VPY B;  3IS9 A;  4YME A;  2D7S A;  3NRB A;  4ZVO B;  2DIS A;  1G2E A;  3UCG A;  3KJF B;  2MEW A;  3N01 A;  4ECR A;  1TKD A;  2ZH4 A;  4ZPW R;  1ZPW X;  2FJE B;  2YWG A;  2IAJ A;  2G0I A;  3UDL A;  2C3O A;  5FLX Y;  4DMZ A;  4JV5 F;  2IBK A;  5AE1 A;  2RHS B;  2HWH A;  3BDP A;  4DZD A;  4DUY J;  2OPQ B;  2XYG B;  4A8W A;  2HG4 A;  2GAH C;  5K14 A;  2HNZ A;  1T3N A;  4ECZ A;  1QY7 A;  1H7X A;  1UKU A;  4C8L A;  4F50 A;  3A3N B;  8ATC B;  1H74 A;  5ETK A;  4ZS6 A;  1N48 A;  2CWK A;  3CSK A;  3VV2 B;  4OX7 A;  3SDE A;  5ETS A;  1JLA B;  1O0P A;  4XPE A;  5HVH A;  3SI8 A;  1Q79 A;  1NSK L;  3MEG A;  3WBZ A;  1H3D A;  5HQ8 A;  2BDP A;  4CO2 A;  2VDH A;  3DLB A;  3KUH A;  4X4O A;  2DY9 A;  3W7B A;  3KLV A;  1T02 A;  3THP A;  2GMJ A;  4WTO B;  4MKB A;  2E66 A;  3G96 A;  1FKP A;  4KGZ B;  1CJU B;  2LXU A;  2ZWP A;  3LPE A;  3UO0 A;  4L74 A;  3KYL A;  2W9C A;  3T1Y F;  3GIJ A;  1RT1 A;  1XMO J;  3WIU A;  2EKY A;  5K8N A;  4C3M A;  3BQ1 A;  1QTM A;  4JP8 A;  3B82 A;  3M2V A;  4CYU A;  5DM6 Q;  4ZVH A;  3VF0 B;  3DRS A;  1FEE A;  2C2R A;  4C8Y A;  3MEG B;  4U8Y A;  3IWX A;  3VQS A;  2QMU B;  4N41 A;  3PCO B;  2B4O A;  3FC9 A;  4QQB A;  2YNG B;  2BVZ A;  2CJA A;  2H9Z A;  2JVR A;  3NS6 A;  3PAC A;  1RBO B;  3LGM A;  1FDB A;  3AXM A;  4YDD B;  1FRM A;  3UCZ P;  1TVR A;  4LF7 J;  2DH7 A;  5G4D A;  3PKY A;  2B6A A;  4K50 A;  4ICL A;  3T1H F;  3DRS B;  2ZVS A;  4DR7 F;  3GON A;  2R7U A;  2AU0 A;  4K4V A;  1M5H A;  1IUJ A;  2LXI A;  3DLH A;  1S6Q A;  3D6M B;  3DHX A;  3CO9 A;  1WEY A;  5KFV A;  4ZCI A;  1L3T A;  3RJM B;  4F2S A;  1NJZ A;  2BW7 A;  3TEH B;  4HKQ A;  1TV6 B;  2Q3P A;  2X7I A;  3QT6 A;  3Q83 A;  1N33 J;  2H54 B;  4I56 A;  4KB7 A;  1IKX A;  1X5O A;  2BMB A;  2MZQ A;  3ZZ0 A;  4ELU A;  1BGX T;  3Q22 A;  4OJH A;  1V3R A;  1NME B;  1CQM A;  1WC5 A;  3H7H B;  2H5J B;  3QLH A;  3WIV A;  2HPU A;  5F3Z A;  5B0F A;  1FA0 A;  2W01 A;  4ALZ A;  2HIY A;  1D8Y A;  4K4W A;  2MQM A;  3LP0 B;  3KLF B;  3DLE B;  3DXB A;  2W1B A;  3IRW P;  1ZET A;  4HR2 A;  1YGY A;  4IYQ A;  4IH7 A;  3RAM A;  2CUY A;  4D3H A;  4OYB A;  3I4P A;  3B54 A;  1TL3 A;  1KWM A;  3UR0 A;  1GMV A;  4P7T A;  3RTV A;  1S9F A;  3TA0 A;  5EDW A;  4CYU B;  2V9K A;  4XDC A;  3C2P A;  3LP2 B;  2KFY A;  1URN A;  1NJI T;  4A8O A;  2KHD A;  2XHW A;  3DM2 A;  4RBT A;  3R8Y A;  3OJU A;  2XLJ A;  4HTI A;  3PX6 A;  2GW8 A;  3DLE A;  1NSP A;  4UUW A;  3M8Z A;  3K17 A;  1YBA A;  2AX1 A;  2YQ1 A;  1ZBT A;  4LIR A;  4J9K A;  2RRA A;  2VOO A;  1PIE A;  1PJ7 A;  3GTY X;  3UWT A;  3KLI B;  1T03 A;  5AJ3 F;  2VAS A;  3R7N B;  4DSJ A;  1TKT A;  1XIQ A;  5E2Q A;  4IR9 A;  1QM9 A;  3W8G A;  3R27 A;  4ICL B;  1RGV A;  4ES1 A;  1SL0 A;  4KR0 B;  3W9I A;  5KFF A;  1F5C A;  1F60 B;  2XMK A;  2XMJ A;  3C15 A;  3N79 A;  3BR9 A;  2P5V A;  3ONQ A;  4LJM A;  3RGI A;  2IYI A;  2VQE F;  3BV8 A;  1T7P A;  3BBC A;  3R6L B;  3VCD A;  2CVI A;  4ZVF A;  2DNN A;  3L09 A;  2A3J A;  5D6G A;  4ZJL A;  3VAI A;  3OVB A;  2FLL A;  4C48 A;  4OYW A;  3FEX B;  3EGZ A;  3EVO A;  4RJV A;  2GIR A;  5KG7 A;  1FJG F;  1FNX H;  3OTO J;  3AT1 B;  2LFV A;  3W64 A;  1I94 F;  4JI3 F;  1FCA A;  3RAX A;  1M5O C;  4A46 A;  2I0X A;  2MDA A;  5F8J A;  4IDK B;  2B4P A;  4OJ1 A;  4RBV A;  4WFX A;  3TJA A;  4ENO A;  3IBF B;  3OJS A;  3OVA A;  2ZFH A;  3D54 A;  2EFQ A;  1HMV B;  4WBF A;  5K9F A;  3UFC X;  5HQL A;  2LA6 A;  3UD5 A;  1QVF R;  3O2I A;  3AOC A;  4PCQ A;  3ISN D;  4UW2 A;  1Y00 A;  4JV0 A;  5CA5 A;  3TZY A;  3J7Y I;  3KHR A;  1SPB P;  3QAT A;  1LWE B;  4CWB A;  2AJ1 A;  3FBE A;  3UN2 A;  1DBD A;  1W7W A;  2XQC A;  2VOD A;  4ED5 A;  4JUZ A;  2EFO A;  3CW2 C;  4QYZ J;  5CYJ A;  1FVQ A;  1EQM A;  1X60 A;  3BH7 B;  4QW9 A;  2HND A;  3G6Y A;  3H4D A;  3M7V A;  2HS4 A;  4YR2 A;  5F9N A;  3KDO A;  5DG9 A;  4M5K A;  3OLA A;  4J7C A;  3A1Y G;  4OYZ A;  5KOW A;  1IXK A;  1JNR B;  2F8E X;  2RT3 A;  1S1T B;  2H48 B;  4RKU C;  5IFM A;  4X4R A;  3PJ9 A;  4A8X A;  5L38 A;  3NGD A;  1RAB B;  4UZB A;  2BXJ A;  3M32 A;  2DXE A;  2I6W A;  4TU7 A;  2F9D A;  3CCT A;  3K58 A;  5KFZ A;  1WKL A;  3GG1 A;  1YQH A;  5IOL A;  4FS2 A;  1TL5 A;  4MK7 A;  4TY9 A;  5LJ5 Y;  1RCX B;  5IWA F;  5GAG I;  3DGP B;  5F8G A;  1RHQ B;  2G2O A;  2QSF A;  1GXL A;  5IXU A;  3DLL Q;  4PPD A;  4DX8 H;  3DMJ B;  3UPF A;  5HAO A;  1X4F A;  4P2S A;  1UW9 A;  4AL7 A;  3IGV A;  1J5O B;  3EDR B;  4HI2 A;  2BUN A;  3I0R A;  4RU2 A;  4CNY A;  2AKW B;  2DD8 S;  4DSE A;  1R0B G;  3PW7 A;  3THV A;  4DS4 A;  5LMN J;  3K5L A;  4B9M A;  2PEH A;  3IM9 A;  2KB2 A;  5HP1 B;  3ILJ A;  1UVJ A;  5FII A;  3P4U B;  4C6A A;  3EPI A;  2QE5 A;  4HHU A;  3SMZ A;  2HZC A;  2VC1 A;  1T95 A;  2GV1 A;  3R97 A;  5LXY A;  2OH2 A;  5HLF B;  4R8U B;  1NDL A;  4TYA A;  1D9A A;  2R7T A;  2XMA A;  3V2U C;  1R8P A;  3VAK A;  3AQP A;  4XDD A;  3R7S B;  5E3R A;  1NPK A;  4LUB A;  1Y7P A;  4MIW A;  3MM6 A;  4KIA A;  3JSY A;  4ZP9 A;  4GC6 A;  2P2C B;  5IS2 A;  3CMQ A;  1FI4 A;  1FK9 B;  1H73 A;  3BYR A;  4O0N A;  5DQH A;  2VQF F;  2E1C A;  2DO4 A;  2FLP A;  2J6T A;  1TL4 A;  2LXF A;  1AZS A;  1RE1 B;  4KV8 B;  2E5L J;  1RT5 B;  2HNY A;  3D7S B;  2NXE A;  1CUL B;  4DQP A;  3QGH A;  1QAY A;  2CVE A;  1YX2 A;  4QPX A;  2OPS A;  2K7J A;  4DPX A;  1U4B A;  3A8K A;  2GVD B;  4DZ6 A;  1PGZ A;  4V1A k;  4NE9 C;  4C11 A;  1XMQ J;  2IVM A;  1JJ4 A;  4B9V A;  2CRL A;  1SJ3 P;  5M2R A;  2KZM A;  3GIL A;  1RU1 A;  3LAK A;  1KFS A;  1KHV A;  4LF4 F;  1TV6 A;  2DNR A;  5HVF A;  4FF2 A;  1Q7Y T;  1B0P A;  1VGY A;  2DRD A;  4A8Y A;  1G1X A;  2P9E A;  1AB8 A;  3JQK A;  3EGV A;  1TUV A;  4Z7Y A;  3T3F A;  1GTE A;  3HVW A;  4CO4 A;  3CCZ A;  4DV2 J;  4WWS A;  3EGW B;  4P9S A;  4FXD A;  3VR1 A;  2EK6 A;  2XY6 A;  3WX8 A;  4G65 A;  1OMS A;  2DH9 A;  1SJF A;  2C2N A;  2QZ8 A;  2M0G B;  2CJY B;  2V63 A;  1RWM B;  2NUH A;  3I0R B;  3UDV A;  5CYQ B;  3CJ5 A;  5A8K A;  4OHY A; 
#chains in the Genus database with same CATH homology
 2XYG B;  3KJQ B;  1RHU B;  5IC4 B;  2C2M B;  1F9E B;  3IBF B;  2H51 B;  4ZVU B;  1RWV B;  2HBY B;  2QLF B;  5K20 B;  2C2Z B;  3QNW B;  4DCO B;  2CNK B;  1RHM B;  1SC3 B;  2CJX B;  2CDR B;  2CNO B;  2QL7 B;  2H65 B;  2HBZ B;  3GJQ B;  4JB8 B;  1RWN B;  2C1E B;  2XYP B;  3GJS B;  3GJR B;  3P45 B;  2H48 B;  4ZVP B;  1RWK B;  1ICE B;  2QL5 B;  3SIP B;  2XZD B;  3NS7 B;  1BMQ B;  1RHQ B;  4ZVQ B;  2QL9 B;  3D6M B;  3RJM B;  3EDR B;  1RHK B;  3EDQ B;  1SC1 B;  3GJT B;  2CNL B;  2H54 B;  3P4U B;  1IBC B;  3R7B B;  1NME B;  2H4W B;  2H4Y B;  2H5J B;  1RWP B;  2Y1L B;  4ZVR B;  4DCJ B;  2HBR B;  3R6G B;  3R7S B;  2P2C B;  3KJN B;  1RHJ B;  2FQQ B;  2QLJ B;  1SC4 B;  1RE1 B;  5IC6 B;  1RWW B;  1I3O B;  3D6F B;  3IBC B;  4ZVS B;  2XZT B;  1QDU B;  1RWO B;  1PYO B;  4ZVT B;  3R5J B;  3D6H B;  4LSZ B;  2XYH B;  4DCP B;  2H5I B;  3R7N B;  2C2O B;  2Y0B B;  1RHR B;  1GFW B;  1PAU B;  2DKO B;  2QLB B;  2C2K B;  1I51 B;  4ZVO B;  2CNN B;  3KJF B;  1RWX B;  3R6L B;  2HBQ B;  2CJY B;  1RWM B;  1QTN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...