3R7SB

Crystal structure of apo caspase2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7sB00
1RHRB 2XYPB 2QL5B 2H5IB 2QL7B 2HBYB 1IBCB 3D6HB 3IBFB 4JB8B 1RWVB 1QDUB 3GJQB 3R7SB 2CNOB 1I3OB 1RWXB 2C2KB 2C1EB 2CDRB 4ZVUB 1QTNB 1RHQB 3IBCB 2H4WB 4ZVPB 1PAUB 1RHJB 1RHMB 2CJYB 1F9EB 1SC3B 3R5JB 2H54B 2XYGB 3R6LB 2XYHB 2QL9B 3GJSB 1I51B 2Y0BB 4DCPB 4ZVOB 2HBZB 1ICEB 4LSZB 4ZVQB 3R7NB 3EDQB 2QLFB 1RE1B 2CNLB 5IC4B 5IC6B 1SC4B 3R7BB 1RWKB 2H65B 3KJFB 3KJNB 2CJXB 2DKOB 3R6GB 1RWWB 2CNKB 2Y1LB 1RHUB 3SIPB 1GFWB 1BMQB 4ZVTB 2QLJB 3P4UB 3NS7B 2C2MB 5K20B 1RWNB 3RJMB 3D6FB 4ZVSB 3GJTB 2C2ZB 3QNWB 1RWOB 3D6MB 2HBQB 2FQQB 2H48B 2XZDB 3EDRB 1RWMB 4DCOB 1RHKB 3GJRB 4ZVRB 2P2CB 2C2OB 1PYOB 3P45B 3KJQB 1RWPB 1SC1B 2H51B 2H5JB 2QLBB 2HBRB 2CNNB 4DCJB 2H4YB 2XZTB 1NMEB
chains in the Genus database with same CATH superfamily
4LF7J 5CYJA 2BE9B 4LFBJ 2W2MP 3PJXA 4U8VA 3EWGA 1RJJA 3IO1A 2XC9A 1HI1A 4I64A 1RCOB 4XTTA 3K7RA 1JLAA 4P72A 5J2NA 3IWXA 3UW1A 3CIZA 3DI6A 3EZUA 2MY8A 2DH8A 1C1BA 5DM7Q 4FKXA 1TMMA 4KKOA 2LECA 3BYPA 1T03B 1PYTA 1WJ9A 2RHQB 2QG9B 2VDIA 3NMRA 3RAQA 1S1TA 5A0YA 1F2GA 4DSJA 5LM7E 1MWYA 4DF8A 4FDFA 1XNRJ 2RKIB 1IXKA 1NSQA 2KI2A 3TAQA 4CT8A 5E3PA 5H1SV 2Y3YA 1IBLF 2HHPA 3VAGA 5EGYA 1N34J 4FNHA 4F25A 4OZ3A 3R2DJ 3C8YA 2HVIA 2D9OA 5AJ3J 1MG7A 4CH0S 4Z37A 1T0TV 2VFRA 2CAJA 3ONQA 1MMDA 1H72C 2R2UA 4OZ5A 3J81Y 1Y5IB 2PD1A 1RA7A 3QBCA 5E3AA 2VICA 3U7JA 1R0CB 1V3SA 1MLAA 3C19A 4RW9B 1XEZA 3M8PB 1WOOA 2HMIB 2HK3A 2XNQA 4MIBA 1NHUA 1RHMB 3U1LA 4M63A 1VQOS 5DETA 2B9WA 5GMDA 1ZH5A 4NE9C 4WU3A 3KG1A 4XDCA 2LU2A 3JSYA 3DXSX 4EMDA 4DFKA 4O4RA 4BHQA 1R6VA 2Y1JA 1K8AT 1TL4A 3K17A 1E6VA 3NGDA 4PQUB 3CJRA 1NNDA 1WWHA 3I4PA 3VF0B 2VH7A 1U0HB 4X66J 5BYRA 3DRYA 3ZO7A 4J9UE 3UCGA 3PEHA 1Q53A 3LWLA 4J9SA 3TI0A 4IH5A 1H3DA 5L1LA 2QZ8A 3NWGA 2CDQA 2GVZB 1NKEA 2WRMA 2UU9J 2WOMA 3TUIC 3CJ3A 2V9KA 3HI9A 1SIZA 4DS4A 2P6SA 2OELA 5DLFA 3KK2A 4O44A 1JLEA 4X4UA 1BE4A 4Q2LA 4QR0A 1RWXB 4QIFA 5CABA 4AQYF 4UQGA 4I68A 2DR9A 2B8QA 1I51B 2QE5A 3W2VB 1NJYA 1LNQA 3DOMA 4LF5J 1ICEB 2VG6B 2QLFB 4PYDA 4NA1A 3R5CA 4MK8A 3FZ2A 2HNDB 5IWAF 2JSXA 3DOLA 1SXLA 4H4OB 2DO0A 4ITSA 4ZPTR 4NCGB 1QAIA 4X4NA 1HBUB 2JH3A 5LJ3Y 2UZAA 3KNGA 2DY1A 5KFEA 2VOOA 4EI2A 2QMUB 2KHCA 3RZAA 2HS3A 4KHMA 2HVEA 1SUQB 1HQEB 3RRGA 1C0TB 1FJGJ 3P45B 3I31A 3R27A 1MNEA 5DZ7A 5D4NA 2RRAA 1CJTA 3LOUA 1JX4A 2OMOA 5I4MA 4DV4F 3W60A 4BC7A 3MPWA 1NHVA 3CMES 4C8YA 2QL5B 1UL3A 2Z0GA 2RNEA 3SCJE 5EDWA 2MZTA 3BB5A 4UW2A 2UP1A 2NREA 2GIRA 3VQSA 2CDRB 5DG9A 1B4SA 1RHJB 1HQUB 4H4MA 3NY0A 4KT0C 2CG8A 2V5HG 3Q89A 1XIQA 2DNKA 3CB4A 1V9OA 1WC3A 4E2FB 5E0OA 2CPFA 4P52A 5C5JA 3KJVB 4EBEA 2EWHA 4KC5A 4DQIA 3UFCX 2QLJB 2M8DB 5AXLA 1UVJA 3TX8A 4KO0A 1VQ6S 3R5DA 1ZZNA 4K50A 3GSDA 4LIWA 1MW7A 3WDOA 4X65J 4G1PA 2XYPB 3OHAA 2LQJA 3O3LA 4OI1A 2RQKA 2D7SA 2HYIB 1QE1B 4LR8A 4DG1A 4M1KA 3KYLA 5GAHI 3LW5C 3V81A 4QPXA 2FGCA 1S1XB 1ZAVA 2PA3A 2XHWA 2NSCA 4IKAA 3FDSA 3HZGA 4EK2A 3Q2SC 2B7BB 5HMYA 2IY5B 4QIVA 4C8LA 3MM8A 1HA1A 3SDEB 4AL5A 2HHTA 2AEJA 1UW4A 2GZOA 2FC9A 2R7QA 3TA2A 3SQGA 1CJKB 1TV6B 1SKWA 1RA6A 4DR1J 1TU0B 4OL8A 4PWDA 1HBNA 5DJBA 4X62J 2VU5A 3OR1B 1JLCA 3NBPB 4C0HA 1K73T 2IM1A 3MWBA 4CI0B 3S8SA 5KFLA 1B99A 3VGVA 4DS5A 3MEEA 2FVSA 1WHYA 4RBUA 1GQEA 2VG7A 2MQOA 4LF8J 2YX7A 1S1UB 1RWMB 1VMBA 2XGPA 3HFVA 2R7VA 1V5IB 1RAGB 2BVZA 3EM1A 3Q8YA 1QLNA 4NLTA 3G2XA 3KLFA 3NS5A 2MQ8A 1T03A 3TAMA 5KFGA 2A0FB 4R8UB 1YIJS 1Y7PA 1FNOA 1FWKA 3QFWA 4P2SA 2F8EX 1TK8A 3J80U 1DURA 1WF2A 2RKIA 2O1PA 4KGVB 5A8KA 4HI2A 5A8RA 2JEIA 2DNNA 5GMEA 4YR0A 3HZEA 2BA9A 3ADAC 3CJTA 3BS9A 3LPYA 3DKDA 1A9NB 1W26A 1JQGA 4DBQA 2XMJA 4YB6A 3PY8A 4UT4A 5B0EA 3MFIA 3QSIA 2X1FA 1U45A 3J7ZT 3NCQA 3BZQA 4QWEA 4M5JA 2WBRA 4DR6F 4YQWA 3D6MB 4EGLA 2HMIA 1BQMB 4BS2A 1QAXA 4ILRA 1UA0A 1H74A 8AT1B 3W5ZA 1JIHA 1X4GA 4YS2A 1J5OB 1TAUA 3A3PB 5DGBA 1WKJA 2DXFA 3ENQA 1S0OA 3AB2B 2V8GA 2GJFA 3DC2A 3K8WA 5J1NA 4DR7J 3M2VA 2K06A 3RB6A 4HTIA 4LQ3A 4B3SJ 3R2CJ 1RCXB 1WDDA 4HTJA 3MTKA 2EKNA 4K4VA 1TELA 2FPHX 2I9SA 1DY3A 5U47A 4GO5X 5L8RC 1BXNA 2RS2A 2JOQA 1IVZA 5KT7A 4Y34A 3ENVA 4R25A 1LK5A 3PW5A 2C3MA 3DLJA 1JLBA 4JV5J 2UXBF 3MMBB 3QGHA 2DTJA 4IG0A 5KT2A 1HYSA 2YKQA 4RW8A 2ROGA 4O0IA 3GONA 1K1QA 3QFHA 2ERRA 2V63A 5F8GA 1C2PA 3RGIA 2E1PA 2FQQB 2Z8QA 1T3OA 3PNIA 1NSAA 4ERDA 2ZZTA 2OAUA 1CQNA 1GTEA 3N6NA 3BGRB 2HIQA 1FRKA 1GX5A 4OIXA 4YEAA 4BBYA 3QLHA 2FLPA 3I0SB 4ZLNA 1LWCB 1R8BA 1RXOB 1UVNA 1FX4A 2I0XA 5LSOA 1WOPA 2HNDA 3FGVA 1KVJA 3RRKA 4F4YA 1OQ3A 5JMNA 1GXUA 3K59A 4NCGA 1VC5A 2HNZB 4ZN3A 4M5DA 2V8VA 1XC9A 3ISND 3O2IA 1FJCA 3PYDA 3DLLQ 4P7TA 3C6TB 5IC6B 3SCKE 5HLFA 2EFPA 4PUOA 4ER8A 4HL9A 2MMYA 3MM5B 3H0PA 3GG0A 4GVBA 3IRXB 1Q8KA 3CMQA 1TUVA 2UUBF 2OEKA 4CO2A 4RJVA 4MIWA 1EP4B 2N4CA 4GKKJ 3BSAA 2Z4PA 1M1KT 1TR0A 1S1VA 2HSEB 5K14B 2HBYB 1YGYA 2CQPA 3FFIA 2CQHA 4WKYA 2KT2A 1K0TA 2G9OA 4PQAA 2LLZA 3MM7B 1W2BR 5F0UA 3K57A 2W24A 3JAMY 2XZWA 2E5JA 2PO4A 3JSMB 4KR0B 3THTA 3HP6A 2WVBA 2PI4A 4UOHA 4C0OC 4YB1P 4DL0C 3QZ8A 3ISZA 3HD2A 1F2HA 1UZDA 2LA4A 2VFSA 2WVCA 2Q66A 1U02A 2RB7A 2MHEA 3CCLS 4J9NA 1EAYC 3EUNA 5GVQA 2HLUA 1APSA 1KN6A 1HW9A 3X3UA 2KM8C 2W8LA 3IWNC 3IA0A 3UVJB 1S1XA 4RLEA 4QOTA 1IBMJ 1UWBB 2HWIA 5F3ZA 2ZH9A 2Y1RI 3TX0A 5IZHA 1HD0A 3RUBL 5KT5A 1RT6B 4CO3A 3Q86A 2VASA 2ZHBA 1GMWA 1Z2ZA 2YPYA 3AD7C 5HMZA 3MM9A 4O4GB 5B08A 2XSFA 4A47A 3TUZC 2VPZB 2HQIA 3BH7B 2VD3A 4FYVB 4OI3A 4KTQA 3KLGB 1VRQC 4M5KA 4XO0A 3GIMA 1WEXA 3HF5A 2BUNA 3CCVS 2RHSB 3GP9A 3BJYA 3HVRA 4J9MA 5BXIA 5SZTA 3DN9A 3G4SS 2XLKA 2J76E 4B3OB 2IFXA 4WYWA 4ZN1A 1YRUA 1W7WA 4DR3F 2IVFB 4R0JA 1F0XA 1XK8A 5B0AA 2X7IA 2MLZA 2DRDA 1KWMA 2NXUA 5BR8J 3PVXA 3NGKA 3W61A 4JI0J 3WC0A 3IBFB 2WONA 1KVIA 3IWLA 2FZCB 2BJEA 1U1OA 1OPIA 3WHIA 4X4OA 2OJ3A 4OZJA 1RLDA 2FJDB 1X5PA 2OPRB 2RAQA 4H54A 3C15B 3HVTB 1OY9A 1I94J 2J6SA 2CQDA 4NLWA 1CG2A 2RT3A 3RBXA 1VDHA 4JI8J 1VRUA 4DL5A 2BACA 1EQ0A 3EDQB 3MCNA 3OJUA 3MCMA 1TL7A 1N5YB 4JI6J 1BQMA 2H65B 1FO1A 3CCTA 3DM2B 4LSLB 1CJUB 3DLGB 3SQOP 2POKA 1FXLA 3BR8A 2DGTA 1LW2B 5CD4H 3SXLA 2EVZA 5A6WA 4XK8C 3O8WA 4P7VA 1AZSA 1KTQA 1V3RA 4F0HA 1T94A 3CPWR 3WZ0A 2DHHA 2C3PA 3BREA 2NQPA 4DV0F 3N5FA 3OUYB 2BX6A 1Y0HA 5M2RA 1PYOB 4WFBQ 2OPPB 1NJXA 4EUVA 4ZVFA 2PN6A 4RBVA 1QM9A 2YNHB 3M6VA 2QT7A 2DYAA 3OL6A 3GJQB 4RPFA 5C24B 1RBLA 2VG5B 4K4YA 2OLWA 2D3ZA 1RT2B 1UKUA 3KLIA 2AGOA 1TL5A 3DRXA 4DV7F 1IQTA 1UCNA 1G1XA 2VBWA 2DNPA 3I32A 2ZM6J 1N32F 1U1PA 1CULB 4ZJOA 5K8PA 4C3LA 1LQ9A 1X4HA 1BWEA 3QO9B 2FYXA 3IRWP 4ID5B 1LV5A 4DPOA 4X84A 3T19A 5B0FA 3M32B 2NXEA 1KSPA 1RTHA 4DSEA 2W7OA 4GC6A 3O5TB 4FN5A 3I0SA 4ECWA 4USHA 2DNLA 1L3TA 1VQMS 1T9VA 3W2WA 4DHVA 3V6DB 3PDNA 3GQCA 4HKQA 5KAKA 4C97A 2HFNA 4RU9A 3G8SA 2VC0A 4DR5F 1SJQA 3M1VA 1YHQS 2IM2A 2MZSA 1Q0NA 4I6YA 3AH6A 1U25A 3DRSA 4L74A 2QA4G 3K5NA 2KM8B 2OFHX 5F9NA 3DLKA 3IRXA 3W5XA 3CD0A 2B4UA 3AAWB 2DNGA 4FVCA 1RAHB 2KKHA 2B3TB 2E29A 4MFBB 2MPUA 4NXMF 4OJ3A 4OLPA 5ETOA 4F04B 3FBCA 3PW4A 1YBUA 1WSRA 1XN9A 3BKTA 4PR6A 3I5AA 2CZ9A 1SJ4P 4GRSA 3CJ4A 3R97A 3CCWA 3MMAB 4DQPA 2LQ9A 5IQQA 5CAAA 5DDRC 1UMJA 1TL3A 3NOGA 3JSMA 5H9EK 2DT9A 3T1YF 1AB8A 2W8KA 3M8QA 1KHVA 5JVGQ 1IM4A 4M5GA 2IPOB 2CQ1A 3N6MA 1IQZA 4LF2A 2R4FA 2QEXS 4DFMA 1GTHA 1VQ5S 2L3MA 2DHXA 2AZ3A 4NASA 4ZP9A 1NH7A 4RUHA 3KLEB 3PIOQ 2ZWPA 2LDIA 4USVA 1QAYA 1FA0A 1WKKA 2DKOB 5ETVA 4TY8A 2YTCA 1UJ6A 3PRVA 4JV0A 2GIQA 2XB2D 1KFDA 5HROB 2IIHA 1C0UB 2W4PA 3MEKA 3D1QA 2Z2ZA 4O4GA 2HAFA 2HFSA 3CJKA 4N47A 2R8JA 2GJIA 1JXVA 3BSNA 1Q8LA 1P1LA 1MU2B 4DQRA 2EG1A 4MT1A 5DRKA 2HNYA 2E5HA 3ETOA 2F3JA 2UUAF 1RTDA 5E5NA 1ZPWX 2K1RA 1Q78A 3MPDA 5GAEU 1W25A 1IBLJ 1NKCA 2G0JA 1TUGB 5A76A 3AD8C 3VZHA 2EFVA 5IC4B 2KT3A 3OD2A 3DOKA 2DB1A 2A3JA 1F5AA 1QVGR 1WI8A 1UWAA 2IBOA 5E3RA 5J1PA 3V4IB 3PV8A 5F8NA 3J7Z5 2V4JB 3EGVA 3HX9A 1SI9A 5KFDA 2HBQB 3HT3A 3QRRA 9ATCB 2C2OB 4D3HA 4UZBA 3TARA 4DV2F 1L3VA 1S6OA 2LU1A 3IMQJ 4F7VA 1RT5A 4TQRA 2BKPA 4QU7A 1N5YA 2AZ1A 3DHXA 4PWWA 2F4VF 2C2KB 4U6PA 3T6JA 4CH7A 4NYZA 4ELUA 3M2UB 4B3RF 4FPRA 2X51A 1UZHA 1RBOB 2QL9B 4U7CA 1KQGB 1MMNA 2P6TA 4MKBA 3SI8A 1AW0A 5AE2A 1N5SA 1FEEA 3VGTA 1U1LA 3HKZD 1G4CA 3FK4A 3OUYA 3B4DA 1TK5A 2CWKA 2W7PA 4G6VB 3GYXB 2VQFF 4YR3A 2KTQA 3DNCA 1QSYA 2YNHA 4KIAA 1JLQB 4F0KA 3US5A 5DGAA 2Q1LA 3VVTA 5IT9Y 3T1HF 4EU0A 4AQYJ 4PG4A 1FDNA 4DCOB 2KG1A 3H90A 2FDNA 3D28A 3MD1A 3UR0A 2ABYA 3I87A 2WHOA 1RT2A 3KFWX 1HNVA 2LYVA 1JJ2R 3DU5A 4IFYB 3BO4A 4DN0A 4ECUA 3QWPA 2H5IB 4WZMA 2YKPA 4ELTA 1WKLA 1CULA 5D4PA 1OSCA 3PIPQ 3PFOA 4X4RA 2BM0A 1SKUB 1SQGA 5IWAJ 3BGOP 2CNOB 4L73A 3CW2C 1Y9OA 5EWEA 1DQ9A 3M32A 5A2QU 4NLRA 4H4KC 3BSCA 4K7QA 3R6LB 3T6BA 4KPCA 4I1TA 3QJLA 3GB0A 4N7TA 1ZTWA 1IKVA 1JXEA 4IR1A 5L1IA 4KHPF 4RW6B 1Q5VA 4ZIVA 1KKHA 1VQLS 2FIUA 4ZLPA 2CJAA 3R6GB 4DPUA 2W25A 4ECRA 3P8BB 5G0RB 4FF3A 4ZPDA 5LMUF 3PG9A 3PR5B 4K4XA 1NH8A 5HJYA 2HQCA 2V8HA 5E3CA 2CPJA 2I8EA 1EJ7L 4CZCA 1U26A 2W9AA 3DLEA 1DTTB 4M5NA 4O3OA 3PW0A 1NK8A 5DQGA 2BANB 2AKWB 1H98A 2AQ4A 4U96A 2J0SD 2BKNA 2ASLA 4JBCA 3IFEA 1LEOA 2WZ1A 1Q79A 3DRRA 3JYTA 1WHVA 2XY6A 1B7FA 4QWDA 3BQ1A 1QTNB 1RHQB 2LQ8A 2HGLA 1KHWA 1TKZB 2AHOB 4C8OA 2ZHOA 4QCLA 4MYTA 2MJNA 3QT8A 4ED8A 5E41A 1AFJA 3IC1A 3QGGA 4NRUA 4YR2A 5HAOA 3M9NB 3GIRA 1PIEA 3OLAA 2JEGA 1EX8A 1C1CB 2PFFB 3V6HA 3CUNA 4DUZF 3PYGA 4PWUA 2GQQA 2XSJA 4CH1A 1HIYA 5LOQA 1S57A 2MEWA 1R89A 3IR7B 1SJRA 2HFUA 4A8XA 2RH3A 3H40A 4QJVA 4URQU 5T7LB 4K4WA 2CUYA 8RUCA 2KN4A 4DQQA 3AY0A 3TVKA 2WTFA 2CJKA 1FDDA 1NMEB 3KK1B 1CBKA 1IBKF 4WK1A 3LPEA 5DQHA 2QL7B 2QLWA 3ZZOA 1WOSA 4A8QA 1AUSL 3GLJA 2GS8A 4LF1A 2LMIA 3O6QA 2JJ4D 2RUGA 3W1YC 2CPDA 2YWKA 3T5KA 2YX4A 4EYIB 2PT0A 1MROB 5A8WB 3R5GA 5HROA 1YVFA 4NZ6A 1LXJA 1B0VA 2J6TA 5CCMA 2QGFB 2F4FA 4R0EA 1U6FA 2QJ3A 4NLUA 1WC4A 5GAGU 1E6YA 3KUEA 1MWQA 4LREA 3HHDA 1V6HA 1OMSA 5B7WA 2NXCA 2W4DA 2OEMA 2WSFC 2E9RX 2FY1A 2M2BA 3JTPA 4TLRA 2HFVA 4ZPWR 5E33A 3M8SA 2CPYA 4Y2AA 2R7UA 1FTCA 3GFYA 2NS1B 2L41A 1N5VA 3H25A 3L4BC 1FNMA 3NNAA 4X4TA 1RU2A 4NLXA 1WG1A 1CS4B 3H2LA 2O3DA 4DL3A 2HHWA 4FXWA 2AJFE 4FPIA 4UZCA 5D8HB 1PSDA 2XY5A 3NGSA 3V4IA 1XQIA 1UEKA 3DHWC 4DR6J 1F6TA 3D9BA 1XTZA 3L95X 1FVQA 4JP8A 3QIPA 1RT7A 4ZCMA 4CO0A 2KVIA 3KG4A 1YZ6A 1PJ5A 1AUDA 3GV5B 1N88A 4Q2MA 2RE1A 4M94A 2I5JB 3M6WA 5D0GA 3PKYA 5JVHQ 1U1MA 4K8RA 2ZH2A 2RDIA 2VKZG 1XMBA 4DPXA 4CO1A 3G6ES 1QVFR 3BQ2A 1ACMB 4HACB 4E98A 4G1QA 3RW7A 1KNZA 3UO0A 4N5SA 1U49A 3TO8A 3HM9A 2ZKUA 2JWNA 2UXBJ 2NUHA 4K2XA 4TKTA 4QR1A 5E7OB 1NSKL 1YJTA 1YTYA 1VFJA 1S79A 4NLVA 5J2QB 3PKMA 1VBYA 5DM6Q 1BD6A 2HBZB 3KLVA 5KFIA 4LSNA 3RU0A 1TMJA 3P49B 3W9IA 5HN0A 5HMWA 3UDLA 1YQHA 3DRPA 4G65A 1T8EA 4WCEQ 1YJVA 5HJXA 3OHBA 2RQMA 1N36F 4YHHF 2XO7A 3N79A 5HVGA 2OPQB 4B9MA 4ZVSB 2HURA 4CLLA 5J1EA 3J7A1 1NO8A 2BJ1A 1LW0A 5HBMB 2H5JB 4CDIA 4GKJJ 3D0HE 1T05A 3KWMA 1R0AB 3CCES 5IM0B 1B70B 5AXNA 2H3EB 1TVRB 1UJ5A 2M9KA 4DR4J 1O8BA 2MKKA 2RU9A 3ILIA 3HKWA 3N0VA 3KLHB 2PMWA 1S59A 2VPYB 2PFDA 1YBTA 1S6QA 3OTEA 1X4DA 3HO1A 4RNMA 5G0RA 2BJ7A 2XWYA 2UUBJ 4R5PA 4JOUA 2VQEF 2L9NA 1RE1B 2R8IA 2E1MC 3KJFB 3VHQA 5D0RA 4I4BA 4LFCF 2BANA 2KJWA 3SFUA 1Y3JA 2A2DA 4UOGA 1HD1A 2FLOA 4M8LA 1YITS 3D6TB 2DR7A 2N3OA 2UV8A 3VVUA 5L9XA 1RHKB 3CCZA 1SH0A 5I3UB 2OMLA 1TKZA 1EQMA 2CADA 2NUUG 3NOCA 1NK0A 2OHDA 2HWHA 4NXNF 1UP1A 3WX4A 1AYEA 3OTOF 3RW6A 4F50A 3M8YA 1D3WA 3OTCA 4WBFA 2I2YA 4AT1B 4HT7A 4N56A 1HR0F 4M5MA 1VQPS 4DN9A 2QO3A 2MQLA 1JLAB 5J2NB 4CRJA 1K0VA 2L08A 4CP5A 2XMTA 3DI6B 2YNGA 4P73A 2LXUA 1C1BB 1SJ1A 4LF6F 1PJ7A 4KKOB 1Z1ZA 3FEXB 2GX8A 2HHVA 2MSSA 3L7OA 1YRTA 1S1TB 4YY3F 3MMCA 3VR1A 5A0YB 4MKYA 2B7CB 7FD1A 4JI5F 1FE0A 5LL6d 2PIIA 1TTHB 4UF4A 4PPZA 1HQ2A 2OTJS 3W3SA 2G2YA 3MURP 3G6VA 2SXLA 4JI4F 2DGUA 4AYBD 2EC2A 2AEFA 3UNGC 4EZ6A 1SC1B 4BWJA 1O51A 3TW0A 4A8SA 1MROA 5A8WA 3LAMA 1K47A 4C8KA 1U8SA 2KJVA 2AGQA 1HPZA 4Y00A 1S7HA 1HWLA 2YH0A 1H7XA 2YKNA 5KFKA 1X5SA 2QLXA 5BYSA 2Z57B 3U02A 1WHXA 3UN3A 5KT3A 3EVOA 4NYOA 4DR3J 1RADB 4WYLA 2ZBQA 3E01B 3C16A 3CXCR 4MK9A 2DHSA 2QMXA 5CZVA 1G7CB 3SCIE 2AJ1A 1N0VC 4O3PA 2JX2A 5F3TA 1CJVA 3HCXA 1T7PA 1U47A 1K44A 3G86A 2HVZA 2YPZA 4LF7F 5L1KA 2Q6BA 3FEZA 1C4AA 1NK9A 1VQ4S 1BQNA 2YKMA 3FVYA 2FC8A 2W2PP 4IRKA 2M52A 5I42A 4N41A 4U7UD 4F36A 1GEHA 4GC7A 3PXGa 1LWEA 4WFZA 1RWPB 1A6LA 2W9BA 3H4DA 3I5CA 2XZTB 1VQKS 3KUHA 3PM9A 2RMLA 3UDEA 3PRBA 4NL5A 4UY8T 4HH1A 4O3SA 4F4KA 1QY7A 2WOMB 4M5LA 4DZDA 3MDFA 3J80Y 3KK2B 3I4HX 4O44B 2C1EB 1JLEB 3MM6A 3X1LB 1XR5A 2DHAA 1FEHA 4Q8FA 2R3VA 1LKZA 3CC4S 3OVAA 2RU3A 3BGFA 1S48A 3AOAA 3ZC4A 2GA7A 4DX6A 4DV0J 1S10A 2CNLB 1M5VC 3DOMB 1BWVA 4RW4B 3PR4A 1S49A 2DO4A 1P1TA 2V4RA 5EUHA 1UVIA 5K8NA 3TZZA 4HR2A 2HQ3A 1FKOA 3DOLB 1CPZA 3OXFA 1VI7A 1HWJA 2HHHF 4Q43A 1UVLA 5HVHA 3FJ2A 3IM8A 2YNFA 1I6JA 1U1QA 2RQ4A 2LXFA 1PKUA 2HZAA 3G6YA 4DR2F 4DPYA 5K8OA 2C2DA 1N32J 1CJTB 3G82A 2OFGX 1Y3KA 3GE9A 5I3PA 3PHEA 4JB8B 3TA0A 2P5VA 1EKSA 1YRXA 3MD3A 4FF2A 1JJCB 5M2PA 1OYDA 4L6V3 1WI6A 2K2PA 4QWAA 1Y5NB 2DNMA 9RUBA 2K7JA 1X0FA 2JVRA 4YB5A 2OGUA 3BGUA 5EX3A 3PHTA 4WFYA 2JRSA 2M88A 4F67A 2G2OA 4H4MB 4WJBA 2F63A 2OPQA 1QTMA 2X1GA 1U7LA 1RK8A 2DCLA 4KPYA 2IDLA 5D6GA 1NXIA 1ZZFA 3SSRA 4QQBA 5HBMA 2YH1A 1WG4A 4URSA 2BXJA 4DR5J 4NLGA 4NZ7A 2AJQA 4AFFA 1VQSA 4F0MA 2PDAA 1XMOF 2B43A 5J2PA 2MGZA 1HNXF 4C98A 2HHSA 2QSFA 3SMZA 3LTOA 4KO0B 5B0GA 2EFNA 5EWFA 2QLBB 4DCJB 2IBKA 3OBIA 1HWKA 3UWTA 1BLUA 4CCHA 4CLYA 2VDHA 5KFBA 2PEHA 2UVWA 4G3IA 1WACA 4DG1B 5CHCB 2YQ1A 3MR2A 4NXMJ 3V81B 3NS6A 2YNIA 5LT5A 3KHRA 1EZZB 1Q95G 2IYIA 3HMJG 3ETMA 3CCSS 3IGVA 3QJPA 3QJJA 1R43A 3MM8B 2DBBA 3W64A 1IM6A 1MMLA 3SQGB 2GC8A 5CXTA 3H42A 1Q82T 4PWDB 4Y2MA 2W2QP 3ZZTA 5ETKA 2ZOGA 1JLCB 3PCOB 4YOEA 5KOWA 1N54B 1RTIB 3CJ0A 4C8NA 2EEYA 3LUYA 2YWGA 4ED2A 3MEEB 3DGPA 2IC3A 2VG7B 4NZ0A 4Y3CA 4B02A 2IMWP 5C25B 1JLFB 2KYXA 1VJQA 3CT9A 2ALZA 1VK3A 4OX7A 3CDWA 4FYXB 1XBWA 2C3OA 3KLFB 4QIGA 2KFZA 1ZM4A 3UN5A 2GW8A 3TAMB 4HDGA 3D7SB 5DLGA 2E7WA 4YP3A 1VJWA 4USJC 2ZUGA 3GR1A 1DHMA 3WC2A 5AXKA 4PG7A 2DGOA 2O66A 1N5QA 3BQ0A 5A8KB 5A8RB 4TU9A 1KS2A 1RT4A 2DJWA 1FRLA 4Y2IA 1X0PA 3A12A 1FD8A 2DH9A 3TANA 5C42A 1S6PA 1XMQF 4F26A 3U1NA 1OO0B 1ZM2A 3M30A 1RU1A 1VHFA 2UUCF 3WX8A 2EK6A 5CQGA 5CH7B 5T41A 4O3QA 4DUYF 3QQCD 2UUAJ 2N3LA 4DPWA 3QNWB 2FVPA 2Q43A 2ROEA 4B3TF 4ZVRB 2E5IA 3HHKA 3MFHA 2RQCA 1GXLA 3J7YU 4K4SA 3SBMA 3LP1A 4ILLA 3OVSA 1N5TA 3GFXA 1O6XA 4ZS6A 2V50A 3DU6A 1D09B 1CSJA 5LXRA 1NEEA 3E01A 2XMMA 4Y2CA 2AD9A 4IRCA 4LF9F 1WC1A 2R8HA 2HVHA 2X3DA 1AA1B 3FSXA 3LALA 3M2VB 2ZH3A 1Y00A 1R31A 3QT6A 3Q8UA 1WEYA 1VQ8S 3C6UB 1BHNA 3MPYA 2ZITA 3W65A 4F4XA 1HKAA 2C3YA 5ETQA 1ZM3A 4CLUA 4A4JA 5F8JA 2AX1A 2Q79A 2WB1D 5LXYA 4EZ9A 4DV2J 1L5UA 2NXJA 1OSDA 3P3DA 5L38A 1M1GA 1Y11A 1NK4A 3I9ZA 1JLBB 3VZIA 1M90T 4IG0B 1R8AA 3R8YA 2KZMA 3Q8SB 1HYSB 2D1CA 2G0IA 4RW8B 4RW7A 2QV6A 2F4VJ 3TJAA 3BEGB 5KFYA 2D41A 4B3RJ 2ZBIA 4TNOA 3T5LA 3QMQA 2BR0A 3RAMA 1IR2A 4OZ0A 2ZOFA 2JEJA 3QLHB 2ZBRA 3HHEA 5HP1A 1HNWF 1SL1A 3C14B 3ENWA 4I56A 1U09A 1U1RA 1U8WA 2V2KA 1WC0A 4RW4A 2VQFJ 2DVIA 1V5VA 2CQ4A 2KZZA 2BEFA 3MHYA 3ITHB 3T1HJ 4AL6A 2Z56B 1EB0A 1NJZA 4IH7A 3KNAA 1T95A 4ZVOB 2YBVA 2DNQA 4M5DB 3NGTA 1UJ4A 3CDEA 1AT1B 3GIIA 4OYAA 4U95A 4PZVA 3UD4P 4I2PA 4WPAA 3KJNB 5GADU 1KDNA 3KHHA 2XMWA 4KBIA 3KKFA 1SC6A 3HHLA 2AYBA 5HLFB 1NB7A 2LEAA 5L39A 2Y1LB 5KFUA 1RHUB 1RT3A 1FFGB 3FMWA 4PUOB 1G3OA 3H59A 4DOZA 3GJTB 4GVBB 2KH9A 1X7VA 4JI7F 2QYCA 4S0MA 4OV1A 1UFKA 3TYTA 3VAJA 3SSQA 4FZVA 3A13A 1X9WA 3OXLA 1BQXA 4DPTA 2NXNA 2XWXA 5FLXU 5KFZA 4WE1A 4C8ZA 3SCLE 1S7IA 2W2NP 1M0SA 3HHLD 1N48A 1S1VB 2QA1A 4B9VA 2GAHC 4KHPJ 3NNHA 4TVAB 2VBZA 3LGNA 1UVKA 4ED4A 1I5OB 2NLWA 1IKXA 3AT1B 2C42A 4PAAA 4PG8A 5F9LA 2F9JA 3FFIB 4PPDA 3C2PA 5KFNA 5LMUJ 3MEDB 2M8HA 1P9QC 2W1BA 2HZVA 4I2QA 5FDLA 1CC7A 4LSZB 4IYQA 1REVA 1RZMA 1NZAA 2FGOA 2M70A 1YK9A 4XAKA 1IKWA 3I5BA 4ZOSA 5AT1B 3K5LA 3IS9B 5F0WA 1OIAA 3M7VA 4TU8A 1CEZA 1URRA 3D5MA 2AGPA 1GFWB 3AA8A 3D3CJ 2PGCA 4M95A 1GH8A 4PKDB 4WP8A 4NRTA 1YJ7A 5C2CA 1G6BA 5H9FJ 2VFVA 4UOCA 4I69A 1NLKL 2GFFA 4B9UA 3RBEA 1UW9A 1TKDA 3H5XA 3CCQS 1S9FA 4BLGA 4HHJA 4HYKA 1S0MA 2ZH1A 2OH2A 5D4OA 3V5RA 4DUZJ 1DQAA 2ZE2B 2W7AA 3FCVA 3MM9B 1SIWB 4WXOA 3PEJA 2JFDA 5HANA 4HI1A 4IOBA 2CRLA 4GO7X 2J8AA 3ICLA 4CNYA 1RTIA 1S9EA 2RRNA 4WKRA 3OQ2A 1RACB 3QT5A 3AJ1A 4UUWA 2WCXA 3OFGA 3UNYA 4OHXA 4WK3A 3WIUA 4ZLJA 4WZQA 1AROP 1U6BA 2MZQA 3I56S 2Z2YB 3LP0A 1D9FA 4ANCA 5C25A 1JLFA 5EHHA 1YJNS 3OT9A 3LANA 2D3OR 3P5BP 3BDPA 2MQQA 2C2MB 5K20B 1F5CA 2YY3A 2QFJA 2CPEA 2C2NA 4TY9A 4OX6A 1YX2A 1HNIB 5HQMA 2JLFA 3GYNA 2WSEC 1OJ4A 1IKYB 3HSGA 4OHVA 4B9LA 4NLDA 3W7BA 3HULA 2FZKB 5D3GB 5IT0A 4ECXA 2DNYA 1N33F 4HT5A 2RIJA 2MZRA 3JTNA 2Z30B 3ZTOA 3GFZA 4I6AA 2UVRA 3HFKA 2F9DA 4OHYA 2WONB 4NI2B 4FS2A 2H4WB 3VQTA 2KXNB 1B64A 1F60B 4B3MF 4ECSA 3LWMA 1ZA1B 4ID8A 3R1LA 4A8OA 2DGQA 1Q8BA 2FUG9 3CO9A 2CYYA 4NYPA 2B0GA 2EK1A 2Z58B 1VRUB 1JLGA 1ZPVA 4ALZA 3TZYA 4OJ1A 1TL7B 2P9GA 2ALYB 3OVBA 2B5JA 2A10A 4Q7AA 5DDOC 2ATLA 2MQNA 1AZSB 2B6AA 5ITHA 2D3O1 4FXVA 2E44A 4KQZA 3W9JA 2VIHA 1S77D 4DV5F 3C6UA 4NA3A 2IYGA 2V2QA 1F5BA 5GAEI 3AOBA 5H9FK 3B4MA 3A1YG 3C66A 1PYSB 3ZZUA 3UCUP 4PCQA 1GXTA 2D9PA 3I6PA 3B82A 1PBUA 5HSPA 5IS2A 2ZVIA 2JNJA 3KLIB 1U1NA 2LP4A 2IM3A 2EXUA 3QZ7A 2D69A 1H2TZ 1S12A 1HHQA 4FBUA 3DLBA 1RDRA 3D54A 3PFEA 4IG3A 2ZH7A 1XWLA 4JI2F 2RSQA 3GIJA 3F44A 5BR8F 4RZRA 1HBMA 3MAAA 5MLCV 1RTHB 3C14A 4A48A 5HI7A 1FX2A 3ZFVA 1TL1B 3BBFA 1L3UA 3Q22A 3OL9A 3W2WB 1TFYA 4HDHA 3SEOA 4ZPCA 4IUFA 3ITHA 2BKOA 1RWUA 3CO0P 4W90B 3FZBA 1FDBA 1FF2A 5AXMA 2UUTA 4WXWA 3D6HB 5I3QA 1IJFB 2JC1A 3IBWA 2J6UA 2OSQA 4DV1F 1NKBA 1RAIB 2FHOB 4DSLA 1SJ3P 3M1VB 3OLBA 3I0RA 3GV8B 2AV5A 5F41A 1N36J 3FRZA 4YHHJ 2DNOA 2CKWA 2G2ZA 2XBPA 4KRWA 3OXGA 3DRSB 5LSRA 2IJNA 4AE5A 5AE1A 3DLKB 2VL1A 4N77A 3ET6A 2W4CA 2E1AA 5B09A 2ZC3A 4KFBA 3PX4A 4K5RA 4DFPA 1N56A 3SSSA 3L09A 4NCBA 1R0BG 2ZKTA 2G4BA 4K4UA 4K4ZA 3T5HA 2K3IA 3GU0A 3T9NA 1RQ0A 1TKXA 1HBOA 2QMWA 3DYAA 3H8YA 3CJQA 2B4OA 3MEDA 2CIMA 2ZH4A 3GV7B 3F41A 2VQEJ 1TL3B 3W66A 2R7SA 1QDUB 2GGPA 2BQUA 1OYEA 3MI7X 4LFCJ 4XPCA 4JYAF 1F3FA 1RTJA 5A2QY 2EKYA 2DD8S 3IS9A 1ELOA 4I7FA 3M8QB 3CJSA 1KLMA 3H5UA 3CD5A 3I55S 1PJ6A 2W2OP 1IN0A 2PC6A 1EARA 2JFKA 4QIWD 1BY9A 3CD7A 3MAQA 3B78A 1X9SA 2UVUA 4F4ZA 4ILMA 4NXNJ 4ZPAA 4LQ9A 5MAOA 3OFFA 1FRHA 3MZIA 3OTOJ 2FJAB 5CZXA 4TY8B 4NCAA 4LUBA 3PO5A 1J2VA 1HR0J 2J9DE 3KDOA 1ZM9A 2ZE2A 1KOOA 1RYRA 4JUZA 5FJ4A 2KFYA 3OL8A 3CJKB 5K8MA 1D1UA 4LF6J 1KRPA 5LMNF 2VONA 4B17A 4YY3J 5B0CA 4RL1A 3D3BJ 2GJ2A 3VTIA 2HNYB 2ZFHA 4JI5J 1RTDB 4DZ6A 4G1IA 4DUTA 1JNZB 2FJVA 4ENOA 2K1RB 2MLXA 1U0SA 4JI4J 1UPMB 1LFPA 2MKJA 2RD5C 4LRCA 4Q0BA 3QWUA 5EWGA 2XY7A 5L46A 4NEZA 4FVMA 2O67A 4CO4A 1NPRA 2YWFA 3D0IE 7AT1B 1HNIA 3EMTA 1ZBTA 2H5EA 1IKYA 3MR5A 3TUJC 4MIAA 4FYWB 3R5AA 4UTGA 3DOKB 3QATA 1SKSA 5D3GA 2XO6A 2GMHA 1MN7A 2VHGA 1NZ8A 2ZEJA 1BGXT 1N8RT 4LF4F 2ZH5A 5IV4A 4NI2A 5DO2A 3MECA 2I1RA 5BYQA 4K0KF 1P27B 2ZH6A 2ZDPA 2AJ0A 1M5HA 1RBAA 4OZ2A 1SBRA 4OYXA 5FIIA 4JV1A 1RT5B 4ATNA 1UFWA 4OHWA 4WIQA 3TZWA 1CQMA 1VRTB 2GMLA 4C7QA 5KFXA 1WG5A 2HRYA 5GAGI 5EX0A 3KXDA 4K2JA 5C2GA 1PC4A 1NAQA 3F56A 4IR9A 4X64F 2J7WA 2DISA 2FLNA 2ZZNA 5DDQC 1JKHA 3TWZA 2QFIA 3BGLA 3IGNA 4ED0A 2BYCA 4ZA1A 5H9EJ 3RB0A 2ADCA 3G6XA 2XI3A 2RILA 4DJBA 3FRYA 2V8PA 5KG5A 2DGSA 1Q7LB 2OD4A 2FJEB 3IG1A 4KHRA 2VF3A 2C2ZB 2ZBCA 4CLZA 4NLPA 4J9VA 4DV3F 5ETRA 1F9FA 2ZD1B 3ZTRA 2EBEA 1R8CA 1HNVB 1LK7A 3ZNJ1 2P9CA 1M5SA 1WF1A 1HHSA 2OPSA 2R2SA 4DSFA 1P8GA 1JJ4A 4Q44A 3E8OA 4KY3A 4F4WA 1VLYA 3MUVP 1KTVA 1LWFA 2EPIA 2VODA 1FKAF 2AF6A 2HHHJ 1YJUA 2KB2A 2R2TA 5DDPC 4CLSA 1Y5LB 2F5GA 1JNRB 4BDPA 5ETLA 2XMVA 3M05A 2CPIA 5HQ8A 4C3MA 1TL1A 2E9ZA 4DR2J 1V3ZA 4ICLA 2QSWA 4C4WA 2DPJA 1IKVB 4RUAA 2ASJA 3G96A 4DLEA 2E1CA 4NLQA 4UOFA 3DDIA 3BO3A 3MPVA 2GVDA 4P10A 2H48B 2XZDB 2CPZA 1RT1A 4ES3A 3RBZA 1F3VA 3K0JA 5HMXA 2F7VA 2WBMA 3DLEB 2KHDA 5IQ6A 1RAFB 3JQJA 3NKYA 2L48A 3RYLA 2HW3A 2QA2A 2EBGA 4TU7A 4OQJA 1FI4A 5RUBA 2V68A 2RF2A 4A46A 3DRRB 3JYTB 2P9EA 4W4MA 4U7UK 1U2RA 5BJRA 1FXRA 2NPFA 2H54B 5KFMA 3TEHB 1XMOJ 4QWCA 4FXDA 3AQPA 3HT0A 1HNXJ 4L75A 3TZXA 2HHQA 2VPXB 2D3UA 4O3NA 4DX8H 1VGYA 1R3NA 1UEVA 5F8LA 4DF4A 4C11A 4ED5A 2B9XA 2E7VA 2MYFA 1VK8A 5JJBA 3I9V9 5F8IA 3P4UB 3V4MA 5J2MA 2MKYA 3R9LA 2XSJB 1S0NA 1VQYA 3FMBA 4TYBA 3HHNB 2HVDA 1YJRA 4WWSA 2LQ5A 2JLGA 2ZWOA 4J90A 6FDRA 4X4SA 4KSEB 2MB0B 1LFWA 4HVZA 4P2FA 3THVA 1TKTA 2B56A 5LJ5Y 3KUGA 3K2YA 3C3LA 1SL0A 3CSKA 2PI5A 3UI3A 2XEXA 2IM0A 4QW8A 1HHTP 3GZ7A 3JSBA 3LQVA 4WP3A 4ECVA 4ZHRA 4LMZA 3POTB 4E8UA 2DNHA 3MCOA 2RDJA 2O5DA 3T1AA 1XJWB 3NAHA 3QYYA 3F0NA 3HLUA 1RAAB 1UETA 3MEGA 4RNFA 3RRHA 1E6YB 5IFMA 3P5TL 1H73A 2OP5A 3HJFA 2HS0A 3CJ8A 3NS7B 4UQTA 1JK9B 1DJ0A 3CJ5A 3C46A 1JB0C 3JS9A 4DSKA 1PG5B 2OKQA 4Y65A 4LT6A 3V2UC 4ZITA 4RNNA 2KT5A 2JLEA 3OJSA 2B9EA 5KFVA 2G0CA 1AFIA 3MPUB 2JZ5A 1B7YB 2G1DA 2CZVC 3HDSA 3G87A 8ATCB 3AJ2A 1XMQJ 2AJ2A 1I3OB 2DITA 2XLIA 2UUCJ 2A6MA 1WC5A 3PRDA 4CWBA 4DUYJ 4LRDA 1SV5A 1FK9A 2PEBA 2HHXA 4OYWA 2AP6A 1OY6A 4Z7CA 2MKIA 1U1KA 2U1AA 4J91A 3L7PA 1FESA 3EPGA 4B3TJ 3TVYA 2KO1A 4PXBA 3D4JA 5D77A 4YN3B 2KFNA 1VC0A 4DU8A 1SC4B 4ED6A 3CULA 4KH0B 1X4AA 4OI2A 3VGSA 2IHR1 2AMCB 3QIPB 2ADBA 1RT7B 4GMKA 4USTA 2N82B 1X60A 2YWWA 3UD5A 4LF9J 1OPZA 3BV8A 2D74B 3OR2A 2DH7A 3O44A 3K89A 2M3DA 2AU0A 1VRTA 3NNCA 2CNNB 1S4FA 4LVOP 5IOLA 1RAOA 3Q8PB 4F3OA 1PGZA 2RUSA 1VISA 3TQ1A 2HGNA 2BBEA 4G1QB 4O3RA 4J5OA 2PA8D 3HSDA 2BDPA 3CWJA 1VCTA 5AE3A 1GNKA 4DX7A 3TJ9A 4F8RA 3Q8RB 4C48A 3DLHA 4MH8A 3QIDA 5JXSA 2OIHA 2HIYA 1IR0A 4Z7YA 5KFQA 4PXDA 1WDTA 2J7KA 2EFOA 4OYPA 4L76A 2K7KA 3EGNA 2E5LF 3NP5A 5D0HA 1S9GB 1FRMA 2J7UA 1O0PA 1VBZA 2XMKA 4AL7A 3CF5Q 4LSNB 2GO8A 4ZK7M 2M4MA 2ZD1A 1ROFA 1FNXH 2A2CA 1U48A 3PJWA 4WFNQ 1O5JA 2ZNZA 3DRPB 3OSPA 3AXKA 1VQ7S 3G8QA 1HNWJ 4J7CA 3R1HA 1XNQF 3A8JA 2DR5A 1KP6A 2IA6A 1L3KA 1WC6A 3BBCA 4ANEA 2XI2A 1VBKA 5J1EB 4NMLA 5KG7A 4NLSA 3BO2A 1LW0B 2BOAA 1RP5A 4OV6A 3KMQA 3U1MA 2ZDOA 4LRBA 1S76D 3MAHA 1T05B 1KQFB 4HEA9 1NBEB 4CT9A 4RW9A 5E2QA 2GCFA 3M8PA 3FSIA 3AXMA 2WK4A 1IR1A 4Y0FA 5KFWA 3I82A 4WTYA 5HVFA 4DFJA 4DV4J 2OI2A 3NRBA 5KFOA 2XYGB 4ZP6A 2MHNA 4A8YA 3EZOA 2JDJA 3H7HB 3QAEA 1S6QB 2Y8WA 4JI7J 4J9OA 4GVLA 1UPPA 4NEYA 3MR6A 2V2ZA 1FRIA 3GIKA 1SCJB 4R5PB 4PQUA 2CJXB 1WTBA 3PACA 2OTLS 4ZP7A 2PE8A 1FKPB 2ASDA 1M1HA 3MTJA 3S6EA 4LFAF 1U0HA 4NX9A 1YDLA 2F1FA 2FB0A 1S72S 2RDDA 3K8VA 1HLWA 4PG6A 4TXSA 3Q24A 4J37A 3ZXWA 5E3QA 1HMVB 1U24A 4KYZA 2GVZA 2R8KA 2H51B 4O23A 1NJWA 5CYQB 4F4AA 1GX6A 1ZETA 7FDRA 2RS8A 1TAQA 2AEMA 4LJMA 2CVIA 5CCLA 1SQFA 2LA6A 1ZAXA 4M5HA 2NR0A 3QPIA 1N0UA 2ASYA 1FFSB 1GMUA 3CDAA 1HI8A 3KHLA 3W2VA 3EXCX 1SH3A 2VG6A 3AB4B 3H5YA 3G9CA 2YNGB 2FJWA 2ZJPQ 2YX1A 2BABA 2HFOA 3NLCA 4H4OA 1DBDA 2YKAA 4ANDA 1XR7A 3BKUA 1DTQB 2AYMA 1HBUA 4GKJF 3MMCB 3RTVA 2LDYA 1VQ9S 1T9UA 1YI2S 1ZOTA 5C7PA 3M8WA 1SUQA 1HQEA 4DR4F 1C0TA 3CE8A 2DY9A 3QRQA 2XQCA 2XCPA 4X4VA 3DDKA 5ADZA 1T3NA 4ZVHA 4ES1A 3EJMA 3SV4A 1M5OC 4OX8A 3DFEA 5JUMA 4RNOA 3DMJB 2DNRA 3POTA 2KG0A 2N7CA 4ED1A 1HPZB 1HQUA 2EFQA 1FWLA 3D2WA 1JWWA 4IDKB 4OI6A 2YKNB 2FHMA 4NPOA 4FP9A 1VIXA 2ZNYA 1IUJA 3HVWA 3EYZA 1UEUA 3MF5A 2VB6A 3H2VE 2LFVA 4C3KA 4RWXA 3IR5B 2HG4A 3EX7B 4A8FA 3KJVA 3CMAS 2WW4A 4NLOA 1X5OA 3C16B 3D68A 2MQPA 1KQSR 2OUGA 1RB0A 2FHKA 1N33J 2IMOA 1UFLA 4N76A 1CJVB 2LVWA 2ZH8A 3FUYA 5DG7A 4DEZA 1BQNB 2YKMB 4PABA 3QRPA 4B3MJ 3CCRS 5I42B 1RGVA 2C2EA 1W2IA 2I38A 5DZ6A 1FT8A 1T02A 3VV2B 1GMVA 1QE1A 1LWEB 3CIMA 1NCLA 1CC8A 4P2MA 2W9BB 2MTLA 2PSZA 4C6AA 4QZVB 3SFGA 1GAOA 1WELA 2NYIA 2VFTA 3J81U 3T3FA 4MKVA 1X4BA 4KV8B 3RAXA 2MKSA 1CLFA 3MM6B 4C8MA 3SDEA 3CTRA 1KOHA 2XS2A 1CJKA 2BJ9A 1TV6A 4ZIWA 4IRDA 5ETMA 3VAMA 1RWKB 4JI3F 4DLGA 3OR1A 3I96A 3NBPA 3NCRA 4DV5J 3GWCA 2FJXA 3KG0A 3IP0A 5IV3A 3J7YI 1FKOB 1NRKA 2NZ4A 5KFFA 4YFUA 1RWNB 1M5PC 1S1UA 1FE4A 2FD2A 2F65A 1GMWD 4OHZA 1JMTA 2YNFB 5CA5A 2FJBB 5D4LA 3W63A 1X5TA 5KFCA 4FBTA 2DGVA 3BBBA 4R8UA 4JV2A 4BWMA 2BZ2A 3G82B 1S9GA 5KFHA 4Q8EA 3JB9k 4QWBA 4JI2J 3H2UB 1D8YA 3CGIA 4B9NA 1YWXA 2E66A 3BN7A 4ECQA 4RNHA 2OEJA 2KRRA 1MWZA 2CXEA 2PMZD 4V19X 1WNEA 3R7BB 5KT4A 1Q86T 4DV6F 2MJUA 4I6WA 4DQSA 1KQKA 5D0EA 4MYUA 4OZLA 5HL7Q 4RU2A 2CPXA 4DV1J 1NB2A 3HVAA 3D1HA 3VGUA 2K8GA 1RI7A 5J2PB 2MGZB 3EICA 3CEDA 2BJ8A 2Z2MA 2GAGC 4DL4A 4OJGA 3R3TA 4TN2A 2YKOA 2A1BA 1J5OA 2XCAA 3BSOA 3JXOA 2CZ4A 2J9EA 1HNZF 3HHLC 1KVKA 3KMSA 3LF0A 3T41A 1YZ7A 1UAWA 2J9DA 4Y2KA 2DCUB 1DFDA 1R7IA 2XTJP 3E2EA 4KGMA 1DARA 1FKPA 3DGVA 1RAJA 1TK0A 4ETXA 1VIOA 5GADI 3MR7A 1SVDA 2FHJA 5CYMB 2YNIB 2IRUA 3TJ8A 1F9HA 4JI1F 3Q0AA 2UXCF 3LGMA 1VS3A 1VC6A 1HMVA 4KB7A 3W62A 3MMBA 4N8OA 2E5GA 5CYQA 4QPTA 2UXDF 4LRFA 2Y9HA 2HQDA 3BR9A 3LO3A 1HWUA 3TRGA 4LVNP 2CJBA 2RJZA 3OW2R 4JYAJ 2FHJD 1D9AA 1KBRA 4CLKA 3BGRA 3R5BA 1OY8A 4ZVGA 2KRBA 3H98A 5FLXY 4XDDA 1GT8A 2HBRB 3FBEA 3DGPB 3D0GE 2IC3B 1Y4ZB 1RHRB 4YDDB 5GMKa 1LWCA 4URGA 1NPPA 3GPAA 4OYBA 4CQ1A 5ETTA 1KC8T 2BMBA 3UE2A 5CD4A 1TP7A 4A8KA 3FCHA 2BOPA 1DTQA 2HNZA 3GYGA 2UVVA 2GV1A 3TNVA 3ZTQA 3TR5A 1WORA 4F2SA 5THWA 1N52B 5GAHU 2AT1B 1K9MT 2R7TA 3ILLA 3C6TA 1BC6A 2ATCB 1RT4B 4QU6A 1A0OB 3VAIA 2QRRA 3CCUS 3OTBA 3MM5A 4YMEA 5LMNJ 5C42B 1S6PB 4CYUB 1OWXA 1Z4UA 3M30B 3RB3A 4J9QA 4PG5A 3DMJA 3IXQA 3VALA 3UR3C 4WTOB 1H0HB 2MZJA 2HRUA 1EP4A 2CQGA 3N01A 4DSIA 5KFJA 1FWPA 1FTRA 4IDKA 1F1BB 4NA2A 1S4EA 4YDXA 3PYEA 5K14A 2HWTA 3KK3B 3LP1B 4X4QA 4KH1B 4OX9F 1IBCB 3A3OB 4IO1A 2FVRA 1J5EF 3R7SB 4YB7A 4XPEA 3MM7A 5G4DA 1D8ZA 2HZCA 1NK7A 3MOZA 2QA4S 4FYYB 4FF4A 3RBDA 3IAS9 4U9RA 1OQ6A 2VA2A 2M7SA 1RABB 2IJRA 5L1JA 2IRXA 3IAM9 4LF4J 4LFBF 2B4VA 4A8WA 1BUXA 2CQ2A 2HAIA 2FVCA 3N4WA 4K0KJ 4NWBA 3TOQA 2OSRA 1YKWA 2VV5A 3CNQP 4P75A 1SQEA 5L9NA 2CNKB 4ETZA 3BPDA 1NSPA 3PX6A 3MMJA 2Q6CA 3AFGA 2VJUA 3UVJA 1S0VA 4RW7B 4KV8A 2MZ1A 2EFGA 3EDRB 1UWBA 3AQOA 2XULA 4D3GA 1A7GE 4ECYA 1RT6A 1XNRF 4LBPA 4X64J 2MQMA 2DNZA 4B9TA 4ZPBA 2HGMA 3NGRA 5HP1B 1SL2A 1U2FA 2ROPA 5ETSA 3KLGA 1SC3B 1N34F 3R5JB 5K5MA 1X8DA 3M9OB 4DL6A 2BW2A 3V6JA 4OYZA 5AJ3F 2P8IA 3EPIA 3CCMS 3AA9A 4U8YA 2W9CB 1U6ZA 1FXDA 3NXZA 4DV3J 4P74A 4BCAA 1DQ8A 3PX0A 1CVJA 1WUUA 1RKJA 2Y8YA 4I2PB 2XNRA 2YQ3A 4B3OA 1FFWB 4DV7J 4F02A 3MGJA 3PO4A 3HHLB 1FHTA 1B0PA 4RBTA 1URNA 1RT3B 3D6FB 3NAIA 4OI0A 4HH0A 4PXEA 1U2CA 1NK5A 1MSWD 3H20A 3VWSA 4C0BA 2ILYA 2XHCA 3GJRB 3MR3A 2B9YA 1YJWS 1NUEA 4OYIA 2R7RA 2MLYA 2HLTA 4QYZJ 3AJDA 3CVKA 1QUVA 4MAKA 4FF1A 2EC0A 4OZ1A 2XMAA 3JQMA 4WE1B 4MK7A 3NG8A 2V9WA 6AT1B 3ISNC 5KFRA 2GO9A 2GIFA 2OPRA 2GMJA 3BH6B 4X66F 4F3QA 3C15A 3HVTA 2VPWB 2FZGB 5DS7A 1N6QB 1EKRA 1F9EB 2V34A 2B51A 1IKXB 4DL7A 2BE7D 2CWXA 2NPIA 3B54A 2HFZA 2UU9F 2J0WA 3NL0A 3NMAA 4I2QB 2AYEA 5FDLB 3DM2A 4LSLA 4CM0A 1CJUA 3DLGA 2WAQD 3T5JA 3BF4A 1REVB 2ZBPA 4B9SA 2M5YA 2ZJRQ 1LW2A 2XS5A 1IKWB 2J0XA 1EIYB 2JL9A 4LRAA 4J9PA 4KJIA 3P6YC 1C4CA 5LSLA 2BQRA 2CG4A 2DGWA 5KG6A 1N4LA 1VR6A 2OPPA 4LF5F 5KFTA 2QX0A 1Y10A 3S7RA 3GCXP 3KJQB 2LEPA 3PYFA 2J5AA 3TEGA 5M2UA 5CYMA 2MXYA 4EFAC 2NSBA 5C24A 2IAJB 2VG5A 1DRZA 2E9TA 2ZVSA 4RO0A 4K4TA 6FD1A 2R7WA 4QBUA 1JJHA 1RUSA 3DDNA 4QW9A 3O1LA 2CJYB 3N28A 2OO4A 1FJGF 4AXJA 2IA0A 4J9RA 1ULRA 4MMOA 1L3SA 4MTPA 4P71A 4F3MA 3A8KA 3JAMU 3QO9A 3N9UC 3G71S 3T1YJ 5HATA 4ID5A 4Y6IA 3GG1A 3TA1A 1S9EB 4N8NA 4TYAA 2DR6A 2UUWA 1TFWA 2J9CA 1HFEL 1KEKA 3M8RA 5KG1A 3K58A 1S5ZA 1VQNS 3LP0B 4P9SA 3M6XA 2EW9A 3THPA 1G2EA 4OMFG 2NZCA 3UPFA 1RWOB 3V6DA 1B3TA 2C28A 2AX0A 1H2VZ 2P2CB 1UA1A 2DIVA 2N7YA 2F8HA 3UCZP 1SJFA 2VBXA 1FRJA 2R7OA 4AD6A 1R8PA 3QSYB 1RTZA 3BPSP 1ITPA 3N5BA 1HWIA 4OFZA 3SV3A 4QYZK 2GHPA 4MKAA 5HK4A 3EE3A 2VC1A 4ZVUB 1IWAA 3LH2S 3QAUA 3M2RB 2MSTA 2DRAA 3EVWA 4CYUA 3CC2S 4WP9A 4X65F 1S97A 2YWEA 3A8IA 4DCPB 4QR2A 4P6QA 4QYRA 4A8MP 4MFBA 1JLGB 3OPKA 2BRKA 3AODA 1NDKA 1H7WA 2F8MA 2EG2A 1NM2A 3KK3A 2B5JB 3UD3P 2U2FA 4X2BA 4L3NA 3Q8QB 3MMAA 3KOAA 5KFSA 5B0BA 4MJKA 2DRBA 4EYHB 4O0NA 1FVSA 2JHEA 3FC9A 4KAIA 2KXFA 2J0QD 5EN1A 2H4YB 4DR1F 2GQCA 3M8ZA 3UN2A 2B6AB 2NCKL 4X62F 4J9KA 2OD6A 3DXBA 4EO6A 2EI5A 2O01C 3GR0A 4IO9Q 4KGZB 1R27B 2YXLA 2CQ3A 4LF8F 3CJ2A 4ZCKA 3M9MB 2W01A 4IFVB 3S01A 4UUXA 3IR6B 3KLEA 3ILOA 1PAEX 2R42A 3RR8A 3JSRA 1X31C 1S1WB 5DG8A 1Q4RA 1NJIT 1KD1T 3S1TA 2HQGA 3D1OA 4IG3B 4Q5VA 3SIPB 1YG0A 2B8PA 5KOXA 1C0UA 2IVYA 4WIIA 1PILA 4DU7A 2C2RA 4WU2A 1HBMB 3MAAB 2ZC4A 3ZTPA 3KDNA 3AOCA 3NGUA 4W92B 1D9DA 1FERA 3MXHP 1MU2A 1REGX 1TUWA 3ZZYA 3Q23A 1FJ7A 3FKBA 2AYGA 4WF9Q 2GHVC 2E5LJ 4EWTA 4CLWA 3BYRA 2W9CA 3RR7A 2LCWA 3EGWB 4IQXA 2IRYA 4Y28C 2CPHA 1U4BA 3LP2B 3PZPA 4CM2A 3EGZA 1LWXA 3FNNA 2QTWA 3I0RB 3RG6A 1XNQJ 2VOPA 2WB4A 5ETPA 4HHUA 2ZUAA 2QIFA 1QUPA 3OL7A 3R7NB 3H4BA 1KLNA 4OJHA 3IM9A 4OI4A 3EXYA 2VBYA 3VAFA 1D0EA 1I1GA 4DXLA 3Q2TC 4DR7F 2CQCA 1X4CA 1NDPA 3FBFA 1RAEB 3ET6B 1KFSA 4B3SF 2QC3A 4KFBB 2V4JA 3D66A 4TLQA 2YVSA 2WW8A 1M5KC 3WQPA 2MDAA 4FKYA 3MCSA 3GFHA 2HS4A 1ZYQA 1S6UA 1N6QA 4EEYA 1JXLA 2M0GB 1TKXB 1EHWA 1HBOB 3M6UA 2FLLA 3DYAB 1LOUA 4LIRA 4JV5F 3BM7A 1ZS6A 1UVMA 1SKRA 2E1RA 1P9YA 4LBHA 3OV7A 2C3UA 2Q3PA 2JC0A 2KL8A 5KG3A 1R8HA 1YJ9S 3JQKA 2XS7A 4W98A 4NOHA 3ELHA 3M2UA 2GGPB 3PW7A 3HSZA 2BE2B 2R9LA 4LFAJ 1RTJB 1Q81T 1VLOA 3UDCA 2V2VA 4EBDA 1EETB 3BKFA 1Q7YT 2XYHB 4CTAB 4I7FB 2DR8A 1X4FA 1T9TA 1KLMB 4ES2A 3W8PA 3HJVA 1IJEB 1RSCA 1SH2A 4QIEA 4CIOA 3GCWP 3GILA 4K59A 3OSNA 1YSJA 1JLQA 2DXDA 2X1BA 3E51A 3SZ2A 1BMQB 3J81j 4ED3A 3OFEA 3SYZA 2ZOMA 2MY7A 2DXEA 3JTOA 1HI0P 2IAJA 2DPIA 2CQ0A 3W5YA 2V8DA 1DLOB 5SUHA 4LBIA 4IFYA 1S99A 1VOMA 2WVFA 3CD6S 1HW8A 1T9WA 3A8EA 3L7UA 2HPUA 1FRXA 2C22A 1LXNA 4ED7A 2LKZA 2VKRA 4DDFA 3QGPA 3ENAA 1TQLA 4NLYA 5ETNA 4Q45A 4FYDA 2ILZA 3HFZB 4ECZA 4ZVPB 2ZHAA 1J27A 3OTDA 3A3NB 1T11A 3TP2A 1IBKJ 2PMHA 1AXQA 2ZJQQ 4GKKF 2XG8A 3TUPA 4Q0BB 2X1AA 4RW6A 4ZP8A 4KE5A 4USWA 3UQSA 2HRTA 2Z2LA 4DMZA 4IH6A 4DL2A 3FBBA 4IOAQ 4USIA 2YQ0A 1WEZA 2XLJA 1WSVA 1DTTA 3OFHA 1NU4A 3FEYB 3M2RA 1VHIA 1UTAA 4IQMA 4RUCA 3MECB 1NDLA 3ZZ0A 3UDVA 2G13A 2I6WA 3GMGA 3DCAA 3B8HA 1NHKL 1RWVB 2V69A 3WIVA 1H6KX 2BV3A 4BC9A 2XM3A 4E0DA 3FQLA 3P96A 4WFXA 4OYOA 2A18A 1VBXA 4TQSA 2GNKA 3K5MA 1NPKA 1IBMF 2KU7A 1Z2LA 3VCDA 4ZVQB 4J9LA 1C1CA 2H1YA 3T9ZA 1IWGA 1PCAA 1QSSA 1JKHB 5D15A 3ZZPA 2A6OA 2K3KA 1SPBP 4I0WA 1XR6A 4USMA 4M5IA 2MKCA 1MN9A 2WVEA 4CLFA 4ELVA 3PW2A 3RJMB 1HL6A 2F40A 3V6KA 4UY85 5T7LA 2Y1IA 3IG1B 1Q8IA 2XMUA 4U67Q 1Q1KA 2DGXA 3KK1A 3KHGA 4ZPVR 4OYMA 3J7AN 3HSJA 2CJQA 3U27A 4ZJLA 1RYSA 1DAXA 4IFVA 4ZLLA 1X4EA 4ZMMA 1NK6A 4JI3J 4ZDNA 3AHPA 2DHGA 2OPSB 3ULHA 4Z2XA 1DZ5A 2Y0SD 3MUMP 1B0TA 4EBCA 1SB6A 5HO4A 2CJ9A 1S1WA 2V94A 4ZCIA 4CO5A 1RLCL 1LWFB 2ZZMA 4RR5A 5A6PA 4HLBA 2V0NA 4FS1A 4JI0F 1QJHA 3KTQA 2V6AA 4USUA 3MUTP 1K1SA 2LXIA 3LA0A 2B4PA 2HK2A 1T9YA 5KTQA 2R2RA 4ICLB 3K5PA 2J8SA 2HQFA 4XIUA 3FSYA 2RRBA 4L72B 1I94F 1H38A 1FD2A 2H9ZA 1FDAA 2AWZA 2CQIA 4JI8F 3EZ5A 3W9HA 2IDEA 2FTRA 5IT9U 2AW0A 4X4PA 4RWWA 4LR7A 2CVEA 3BDEA 3LP2A 3FQKA 3ZZRA 4JI6F 2GVDB 2VA3A 5KFPA 1E6VB 1RT1B 1RISA 3NCPA 4DX5A 2JEFA 2JVOA 5FD1A 5KFAA 2UV8G 5K9FA 2V67A 1FJEB 1CS4A 4ZKAA 3CCJS 4DV6J 2KYZA 1ZTTA 2QN6B 1KR4A 1WTFA 3A4TA 5D78A 3HK2A 4CNZA 4OZNA 2RF2B 2R8GA 5KG2A 3CDUA 3Q8VA 4ZVEA 3CDBA 4ECTA 2KDOA 2AIRB 3Q83A 2YWHA 5HQLA 3QGIA 2R7XA 1R6YA 2CA9A 4V19J 2KXHA 2BW7A 2CQBA 2DEJA 2RVJA 2BM1A 1QSLA 5IXUA 1HARA 1VYAA 2VUGA 5F8MA 1Q5YA 2APOA 2CFXA 2HHUA 3N6LA 1QD1A 1HNZJ 3HD1A 4C11B 4HHHA 2QYGA 4KGXB 4ZVTB 3F73A 3ZNUA 4RX6A 2VZ9A 2V4QA 3WBZA 2HEKA 2I5JA 3VAHA 5F8HA 2ZM6F 2XGQA 1FCAA 1YLXA 5J2MB 4H4KA 4C9DA 1XERA 2BE2A 3RB4A 3VAKA 4WFAQ 3NWRA 1PO6A 1WF0A 3TQEA 4HACA 4IOCQ 1EETA 4JI1J 4CTAA 2UXCJ 3B6BA 3QT7A 3W8GA 4NMXA 2DIUA 3M4XA 4PEOA 2L9WA 1TKTB 4LR9A 1YBAA 3PTWA 2UXDJ 4L3KA 2DK2A 2ACMA 1P6TA 1PAUB 2BQ3A 1WHWA 2VJVA 5J2QA 2VFUA 4RUBA 3HXMA 2KVQE 1TZ0A 3TAPA 3GJSB 2X3GA 2E7XA 5KT6A 4PYAA 4ZHRB 5B0DA 1DLOA 3L9ZA 3ZZZA 1QAJA 3BN4A 1WD6A 1H2UX 3LAKA 2BRLA 1RWWB 1PBAA 2BJDA 4YUDA 3MEGB 1KONA 2G1HA 2BJ3A 5IT4A 3L3CA 2FVQA 3FCWA 2FY8A 4OLOA 4PXCA 4EO8A 1T9XA 2GHWA 4K5SA 1NDCA 1R0AA 3EVMA 1ZA2B 2WSCC 5IM0A 4FNIA 1ZAWA 1TVRA 4AXIA 5KG4A 2ACYA 3K5OA 3PJ9A 1Q16B 2GQ2A 4DWIA 3GTYX 3H5SA 2HKEA 2LEBA 2L9DA 1X9MA 5DQIA 3KLHA 3E3XA 4V1Ak 4P2XA 3IBCB 3AD9C 5KG0A 1PC5A 4USKA 3G8TA 3MOJB 3CC7S 1SV5B 1FK9B 4ZJQA 3TVZA 1OS5A 5T14A 2IVMA 2Y0BB 2DEIA 4ZCLA 4CLTA 2MKHA 4DI6A 4AUKA 3ILJA 2AJ4A 2NYHA 1RKIA 3LGHA 4F2RA 3IN5A 1GK8A 3D67A 3ZTSA 4OX9J 2IJFA 3NEKA 4CLPA 2COLA 1J5EJ 4KGKA 4B08A 2LQBA 4I67A 5I3UA 2WVDA 3OR2B 2N4DA 4PRFA 4C2MA 3GSIA 3HPOA 1HBNB 4RKUC
chains in the Genus database with same CATH topology
1RHRB 2XYPB 2QL5B 2H5IB 2QL7B 2HBYB 1IBCB 3D6HB 3IBFB 4JB8B 1RWVB 1QDUB 3GJQB 3R7SB 2CNOB 1I3OB 1RWXB 2C2KB 2C1EB 2CDRB 4ZVUB 1QTNB 1RHQB 3IBCB 2H4WB 4ZVPB 1PAUB 1RHJB 1RHMB 2CJYB 1F9EB 1SC3B 3R5JB 2H54B 2XYGB 3R6LB 2XYHB 2QL9B 3GJSB 1I51B 2Y0BB 4DCPB 4ZVOB 2HBZB 1ICEB 4LSZB 4ZVQB 3R7NB 3EDQB 2QLFB 1RE1B 2CNLB 5IC4B 5IC6B 1SC4B 3R7BB 1RWKB 2H65B 3KJFB 3KJNB 2CJXB 2DKOB 3R6GB 1RWWB 2CNKB 2Y1LB 1RHUB 3SIPB 1GFWB 1BMQB 4ZVTB 2QLJB 3P4UB 3NS7B 2C2MB 5K20B 1RWNB 3RJMB 3D6FB 4ZVSB 3GJTB 2C2ZB 3QNWB 1RWOB 3D6MB 2HBQB 2FQQB 2H48B 2XZDB 3EDRB 1RWMB 4DCOB 1RHKB 3GJRB 4ZVRB 2P2CB 2C2OB 1PYOB 3P45B 3KJQB 1RWPB 1SC1B 2H51B 2H5JB 2QLBB 2HBRB 2CNNB 4DCJB 2H4YB 2XZTB 1NMEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHR B;  2XYP B;  2QL5 B;  2H5I B;  2QL7 B;  2HBY B;  1IBC B;  3D6H B;  3IBF B;  4JB8 B;  1RWV B;  1QDU B;  3GJQ B;  3R7S B;  2CNO B;  1I3O B;  1RWX B;  2C2K B;  2C1E B;  2CDR B;  4ZVU B;  1QTN B;  1RHQ B;  3IBC B;  2H4W B;  4ZVP B;  1PAU B;  1RHJ B;  1RHM B;  2CJY B;  1F9E B;  1SC3 B;  3R5J B;  2H54 B;  2XYG B;  3R6L B;  2XYH B;  2QL9 B;  3GJS B;  1I51 B;  2Y0B B;  4DCP B;  4ZVO B;  2HBZ B;  1ICE B;  4LSZ B;  4ZVQ B;  3R7N B;  3EDQ B;  2QLF B;  1RE1 B;  2CNL B;  5IC4 B;  5IC6 B;  1SC4 B;  3R7B B;  1RWK B;  2H65 B;  3KJF B;  3KJN B;  2CJX B;  2DKO B;  3R6G B;  1RWW B;  2CNK B;  2Y1L B;  1RHU B;  3SIP B;  1GFW B;  1BMQ B;  4ZVT B;  2QLJ B;  3P4U B;  3NS7 B;  2C2M B;  5K20 B;  1RWN B;  3RJM B;  3D6F B;  4ZVS B;  3GJT B;  2C2Z B;  3QNW B;  1RWO B;  3D6M B;  2HBQ B;  2FQQ B;  2H48 B;  2XZD B;  3EDR B;  1RWM B;  4DCO B;  1RHK B;  3GJR B;  4ZVR B;  2P2C B;  2C2O B;  1PYO B;  3P45 B;  3KJQ B;  1RWP B;  1SC1 B;  2H51 B;  2H5J B;  2QLB B;  2HBR B;  2CNN B;  4DCJ B;  2H4Y B;  2XZT B;  1NME B; 
#chains in the Genus database with same CATH topology
 4LF7 J;  5CYJ A;  2BE9 B;  4LFB J;  2W2M P;  3PJX A;  4U8V A;  3EWG A;  1RJJ A;  3IO1 A;  2XC9 A;  1HI1 A;  4I64 A;  1RCO B;  4XTT A;  3K7R A;  1JLA A;  4P72 A;  5J2N A;  3IWX A;  3UW1 A;  3CIZ A;  3DI6 A;  3EZU A;  2MY8 A;  2DH8 A;  1C1B A;  5DM7 Q;  4FKX A;  1TMM A;  4KKO A;  2LEC A;  3BYP A;  1T03 B;  1PYT A;  1WJ9 A;  2RHQ B;  2QG9 B;  2VDI A;  3NMR A;  3RAQ A;  1S1T A;  5A0Y A;  1F2G A;  4DSJ A;  5LM7 E;  1MWY A;  4DF8 A;  4FDF A;  1XNR J;  2RKI B;  1IXK A;  1NSQ A;  2KI2 A;  3TAQ A;  4CT8 A;  5E3P A;  5H1S V;  2Y3Y A;  1IBL F;  2HHP A;  3VAG A;  5EGY A;  1N34 J;  4FNH A;  4F25 A;  4OZ3 A;  3R2D J;  3C8Y A;  2HVI A;  2D9O A;  5AJ3 J;  1MG7 A;  4CH0 S;  4Z37 A;  1T0T V;  2VFR A;  2CAJ A;  3ONQ A;  1MMD A;  1H72 C;  2R2U A;  4OZ5 A;  3J81 Y;  1Y5I B;  2PD1 A;  1RA7 A;  3QBC A;  5E3A A;  2VIC A;  3U7J A;  1R0C B;  1V3S A;  1MLA A;  3C19 A;  4RW9 B;  1XEZ A;  3M8P B;  1WOO A;  2HMI B;  2HK3 A;  2XNQ A;  4MIB A;  1NHU A;  1RHM B;  3U1L A;  4M63 A;  1VQO S;  5DET A;  2B9W A;  5GMD A;  1ZH5 A;  4NE9 C;  4WU3 A;  3KG1 A;  4XDC A;  2LU2 A;  3JSY A;  3DXS X;  4EMD A;  4DFK A;  4O4R A;  4BHQ A;  1R6V A;  2Y1J A;  1K8A T;  1TL4 A;  3K17 A;  1E6V A;  3NGD A;  4PQU B;  3CJR A;  1NND A;  1WWH A;  3I4P A;  3VF0 B;  2VH7 A;  1U0H B;  4X66 J;  5BYR A;  3DRY A;  3ZO7 A;  4J9U E;  3UCG A;  3PEH A;  1Q53 A;  3LWL A;  4J9S A;  3TI0 A;  4IH5 A;  1H3D A;  5L1L A;  2QZ8 A;  3NWG A;  2CDQ A;  2GVZ B;  1NKE A;  2WRM A;  2UU9 J;  2WOM A;  3TUI C;  3CJ3 A;  2V9K A;  3HI9 A;  1SIZ A;  4DS4 A;  2P6S A;  2OEL A;  5DLF A;  3KK2 A;  4O44 A;  1JLE A;  4X4U A;  1BE4 A;  4Q2L A;  4QR0 A;  1RWX B;  4QIF A;  5CAB A;  4AQY F;  4UQG A;  4I68 A;  2DR9 A;  2B8Q A;  1I51 B;  2QE5 A;  3W2V B;  1NJY A;  1LNQ A;  3DOM A;  4LF5 J;  1ICE B;  2VG6 B;  2QLF B;  4PYD A;  4NA1 A;  3R5C A;  4MK8 A;  3FZ2 A;  2HND B;  5IWA F;  2JSX A;  3DOL A;  1SXL A;  4H4O B;  2DO0 A;  4ITS A;  4ZPT R;  4NCG B;  1QAI A;  4X4N A;  1HBU B;  2JH3 A;  5LJ3 Y;  2UZA A;  3KNG A;  2DY1 A;  5KFE A;  2VOO A;  4EI2 A;  2QMU B;  2KHC A;  3RZA A;  2HS3 A;  4KHM A;  2HVE A;  1SUQ B;  1HQE B;  3RRG A;  1C0T B;  1FJG J;  3P45 B;  3I31 A;  3R27 A;  1MNE A;  5DZ7 A;  5D4N A;  2RRA A;  1CJT A;  3LOU A;  1JX4 A;  2OMO A;  5I4M A;  4DV4 F;  3W60 A;  4BC7 A;  3MPW A;  1NHV A;  3CME S;  4C8Y A;  2QL5 B;  1UL3 A;  2Z0G A;  2RNE A;  3SCJ E;  5EDW A;  2MZT A;  3BB5 A;  4UW2 A;  2UP1 A;  2NRE A;  2GIR A;  3VQS A;  2CDR B;  5DG9 A;  1B4S A;  1RHJ B;  1HQU B;  4H4M A;  3NY0 A;  4KT0 C;  2CG8 A;  2V5H G;  3Q89 A;  1XIQ A;  2DNK A;  3CB4 A;  1V9O A;  1WC3 A;  4E2F B;  5E0O A;  2CPF A;  4P52 A;  5C5J A;  3KJV B;  4EBE A;  2EWH A;  4KC5 A;  4DQI A;  3UFC X;  2QLJ B;  2M8D B;  5AXL A;  1UVJ A;  3TX8 A;  4KO0 A;  1VQ6 S;  3R5D A;  1ZZN A;  4K50 A;  3GSD A;  4LIW A;  1MW7 A;  3WDO A;  4X65 J;  4G1P A;  2XYP B;  3OHA A;  2LQJ A;  3O3L A;  4OI1 A;  2RQK A;  2D7S A;  2HYI B;  1QE1 B;  4LR8 A;  4DG1 A;  4M1K A;  3KYL A;  5GAH I;  3LW5 C;  3V81 A;  4QPX A;  2FGC A;  1S1X B;  1ZAV A;  2PA3 A;  2XHW A;  2NSC A;  4IKA A;  3FDS A;  3HZG A;  4EK2 A;  3Q2S C;  2B7B B;  5HMY A;  2IY5 B;  4QIV A;  4C8L A;  3MM8 A;  1HA1 A;  3SDE B;  4AL5 A;  2HHT A;  2AEJ A;  1UW4 A;  2GZO A;  2FC9 A;  2R7Q A;  3TA2 A;  3SQG A;  1CJK B;  1TV6 B;  1SKW A;  1RA6 A;  4DR1 J;  1TU0 B;  4OL8 A;  4PWD A;  1HBN A;  5DJB A;  4X62 J;  2VU5 A;  3OR1 B;  1JLC A;  3NBP B;  4C0H A;  1K73 T;  2IM1 A;  3MWB A;  4CI0 B;  3S8S A;  5KFL A;  1B99 A;  3VGV A;  4DS5 A;  3MEE A;  2FVS A;  1WHY A;  4RBU A;  1GQE A;  2VG7 A;  2MQO A;  4LF8 J;  2YX7 A;  1S1U B;  1RWM B;  1VMB A;  2XGP A;  3HFV A;  2R7V A;  1V5I B;  1RAG B;  2BVZ A;  3EM1 A;  3Q8Y A;  1QLN A;  4NLT A;  3G2X A;  3KLF A;  3NS5 A;  2MQ8 A;  1T03 A;  3TAM A;  5KFG A;  2A0F B;  4R8U B;  1YIJ S;  1Y7P A;  1FNO A;  1FWK A;  3QFW A;  4P2S A;  2F8E X;  1TK8 A;  3J80 U;  1DUR A;  1WF2 A;  2RKI A;  2O1P A;  4KGV B;  5A8K A;  4HI2 A;  5A8R A;  2JEI A;  2DNN A;  5GME A;  4YR0 A;  3HZE A;  2BA9 A;  3ADA C;  3CJT A;  3BS9 A;  3LPY A;  3DKD A;  1A9N B;  1W26 A;  1JQG A;  4DBQ A;  2XMJ A;  4YB6 A;  3PY8 A;  4UT4 A;  5B0E A;  3MFI A;  3QSI A;  2X1F A;  1U45 A;  3J7Z T;  3NCQ A;  3BZQ A;  4QWE A;  4M5J A;  2WBR A;  4DR6 F;  4YQW A;  3D6M B;  4EGL A;  2HMI A;  1BQM B;  4BS2 A;  1QAX A;  4ILR A;  1UA0 A;  1H74 A;  8AT1 B;  3W5Z A;  1JIH A;  1X4G A;  4YS2 A;  1J5O B;  1TAU A;  3A3P B;  5DGB A;  1WKJ A;  2DXF A;  3ENQ A;  1S0O A;  3AB2 B;  2V8G A;  2GJF A;  3DC2 A;  3K8W A;  5J1N A;  4DR7 J;  3M2V A;  2K06 A;  3RB6 A;  4HTI A;  4LQ3 A;  4B3S J;  3R2C J;  1RCX B;  1WDD A;  4HTJ A;  3MTK A;  2EKN A;  4K4V A;  1TEL A;  2FPH X;  2I9S A;  1DY3 A;  5U47 A;  4GO5 X;  5L8R C;  1BXN A;  2RS2 A;  2JOQ A;  1IVZ A;  5KT7 A;  4Y34 A;  3ENV A;  4R25 A;  1LK5 A;  3PW5 A;  2C3M A;  3DLJ A;  1JLB A;  4JV5 J;  2UXB F;  3MMB B;  3QGH A;  2DTJ A;  4IG0 A;  5KT2 A;  1HYS A;  2YKQ A;  4RW8 A;  2ROG A;  4O0I A;  3GON A;  1K1Q A;  3QFH A;  2ERR A;  2V63 A;  5F8G A;  1C2P A;  3RGI A;  2E1P A;  2FQQ B;  2Z8Q A;  1T3O A;  3PNI A;  1NSA A;  4ERD A;  2ZZT A;  2OAU A;  1CQN A;  1GTE A;  3N6N A;  3BGR B;  2HIQ A;  1FRK A;  1GX5 A;  4OIX A;  4YEA A;  4BBY A;  3QLH A;  2FLP A;  3I0S B;  4ZLN A;  1LWC B;  1R8B A;  1RXO B;  1UVN A;  1FX4 A;  2I0X A;  5LSO A;  1WOP A;  2HND A;  3FGV A;  1KVJ A;  3RRK A;  4F4Y A;  1OQ3 A;  5JMN A;  1GXU A;  3K59 A;  4NCG A;  1VC5 A;  2HNZ B;  4ZN3 A;  4M5D A;  2V8V A;  1XC9 A;  3ISN D;  3O2I A;  1FJC A;  3PYD A;  3DLL Q;  4P7T A;  3C6T B;  5IC6 B;  3SCK E;  5HLF A;  2EFP A;  4PUO A;  4ER8 A;  4HL9 A;  2MMY A;  3MM5 B;  3H0P A;  3GG0 A;  4GVB A;  3IRX B;  1Q8K A;  3CMQ A;  1TUV A;  2UUB F;  2OEK A;  4CO2 A;  4RJV A;  4MIW A;  1EP4 B;  2N4C A;  4GKK J;  3BSA A;  2Z4P A;  1M1K T;  1TR0 A;  1S1V A;  2HSE B;  5K14 B;  2HBY B;  1YGY A;  2CQP A;  3FFI A;  2CQH A;  4WKY A;  2KT2 A;  1K0T A;  2G9O A;  4PQA A;  2LLZ A;  3MM7 B;  1W2B R;  5F0U A;  3K57 A;  2W24 A;  3JAM Y;  2XZW A;  2E5J A;  2PO4 A;  3JSM B;  4KR0 B;  3THT A;  3HP6 A;  2WVB A;  2PI4 A;  4UOH A;  4C0O C;  4YB1 P;  4DL0 C;  3QZ8 A;  3ISZ A;  3HD2 A;  1F2H A;  1UZD A;  2LA4 A;  2VFS A;  2WVC A;  2Q66 A;  1U02 A;  2RB7 A;  2MHE A;  3CCL S;  4J9N A;  1EAY C;  3EUN A;  5GVQ A;  2HLU A;  1APS A;  1KN6 A;  1HW9 A;  3X3U A;  2KM8 C;  2W8L A;  3IWN C;  3IA0 A;  3UVJ B;  1S1X A;  4RLE A;  4QOT A;  1IBM J;  1UWB B;  2HWI A;  5F3Z A;  2ZH9 A;  2Y1R I;  3TX0 A;  5IZH A;  1HD0 A;  3RUB L;  5KT5 A;  1RT6 B;  4CO3 A;  3Q86 A;  2VAS A;  2ZHB A;  1GMW A;  1Z2Z A;  2YPY A;  3AD7 C;  5HMZ A;  3MM9 A;  4O4G B;  5B08 A;  2XSF A;  4A47 A;  3TUZ C;  2VPZ B;  2HQI A;  3BH7 B;  2VD3 A;  4FYV B;  4OI3 A;  4KTQ A;  3KLG B;  1VRQ C;  4M5K A;  4XO0 A;  3GIM A;  1WEX A;  3HF5 A;  2BUN A;  3CCV S;  2RHS B;  3GP9 A;  3BJY A;  3HVR A;  4J9M A;  5BXI A;  5SZT A;  3DN9 A;  3G4S S;  2XLK A;  2J76 E;  4B3O B;  2IFX A;  4WYW A;  4ZN1 A;  1YRU A;  1W7W A;  4DR3 F;  2IVF B;  4R0J A;  1F0X A;  1XK8 A;  5B0A A;  2X7I A;  2MLZ A;  2DRD A;  1KWM A;  2NXU A;  5BR8 J;  3PVX A;  3NGK A;  3W61 A;  4JI0 J;  3WC0 A;  3IBF B;  2WON A;  1KVI A;  3IWL A;  2FZC B;  2BJE A;  1U1O A;  1OPI A;  3WHI A;  4X4O A;  2OJ3 A;  4OZJ A;  1RLD A;  2FJD B;  1X5P A;  2OPR B;  2RAQ A;  4H54 A;  3C15 B;  3HVT B;  1OY9 A;  1I94 J;  2J6S A;  2CQD A;  4NLW A;  1CG2 A;  2RT3 A;  3RBX A;  1VDH A;  4JI8 J;  1VRU A;  4DL5 A;  2BAC A;  1EQ0 A;  3EDQ B;  3MCN A;  3OJU A;  3MCM A;  1TL7 A;  1N5Y B;  4JI6 J;  1BQM A;  2H65 B;  1FO1 A;  3CCT A;  3DM2 B;  4LSL B;  1CJU B;  3DLG B;  3SQO P;  2POK A;  1FXL A;  3BR8 A;  2DGT A;  1LW2 B;  5CD4 H;  3SXL A;  2EVZ A;  5A6W A;  4XK8 C;  3O8W A;  4P7V A;  1AZS A;  1KTQ A;  1V3R A;  4F0H A;  1T94 A;  3CPW R;  3WZ0 A;  2DHH A;  2C3P A;  3BRE A;  2NQP A;  4DV0 F;  3N5F A;  3OUY B;  2BX6 A;  1Y0H A;  5M2R A;  1PYO B;  4WFB Q;  2OPP B;  1NJX A;  4EUV A;  4ZVF A;  2PN6 A;  4RBV A;  1QM9 A;  2YNH B;  3M6V A;  2QT7 A;  2DYA A;  3OL6 A;  3GJQ B;  4RPF A;  5C24 B;  1RBL A;  2VG5 B;  4K4Y A;  2OLW A;  2D3Z A;  1RT2 B;  1UKU A;  3KLI A;  2AGO A;  1TL5 A;  3DRX A;  4DV7 F;  1IQT A;  1UCN A;  1G1X A;  2VBW A;  2DNP A;  3I32 A;  2ZM6 J;  1N32 F;  1U1P A;  1CUL B;  4ZJO A;  5K8P A;  4C3L A;  1LQ9 A;  1X4H A;  1BWE A;  3QO9 B;  2FYX A;  3IRW P;  4ID5 B;  1LV5 A;  4DPO A;  4X84 A;  3T19 A;  5B0F A;  3M32 B;  2NXE A;  1KSP A;  1RTH A;  4DSE A;  2W7O A;  4GC6 A;  3O5T B;  4FN5 A;  3I0S A;  4ECW A;  4USH A;  2DNL A;  1L3T A;  1VQM S;  1T9V A;  3W2W A;  4DHV A;  3V6D B;  3PDN A;  3GQC A;  4HKQ A;  5KAK A;  4C97 A;  2HFN A;  4RU9 A;  3G8S A;  2VC0 A;  4DR5 F;  1SJQ A;  3M1V A;  1YHQ S;  2IM2 A;  2MZS A;  1Q0N A;  4I6Y A;  3AH6 A;  1U25 A;  3DRS A;  4L74 A;  2QA4 G;  3K5N A;  2KM8 B;  2OFH X;  5F9N A;  3DLK A;  3IRX A;  3W5X A;  3CD0 A;  2B4U A;  3AAW B;  2DNG A;  4FVC A;  1RAH B;  2KKH A;  2B3T B;  2E29 A;  4MFB B;  2MPU A;  4NXM F;  4OJ3 A;  4OLP A;  5ETO A;  4F04 B;  3FBC A;  3PW4 A;  1YBU A;  1WSR A;  1XN9 A;  3BKT A;  4PR6 A;  3I5A A;  2CZ9 A;  1SJ4 P;  4GRS A;  3CJ4 A;  3R97 A;  3CCW A;  3MMA B;  4DQP A;  2LQ9 A;  5IQQ A;  5CAA A;  5DDR C;  1UMJ A;  1TL3 A;  3NOG A;  3JSM A;  5H9E K;  2DT9 A;  3T1Y F;  1AB8 A;  2W8K A;  3M8Q A;  1KHV A;  5JVG Q;  1IM4 A;  4M5G A;  2IPO B;  2CQ1 A;  3N6M A;  1IQZ A;  4LF2 A;  2R4F A;  2QEX S;  4DFM A;  1GTH A;  1VQ5 S;  2L3M A;  2DHX A;  2AZ3 A;  4NAS A;  4ZP9 A;  1NH7 A;  4RUH A;  3KLE B;  3PIO Q;  2ZWP A;  2LDI A;  4USV A;  1QAY A;  1FA0 A;  1WKK A;  2DKO B;  5ETV A;  4TY8 A;  2YTC A;  1UJ6 A;  3PRV A;  4JV0 A;  2GIQ A;  2XB2 D;  1KFD A;  5HRO B;  2IIH A;  1C0U B;  2W4P A;  3MEK A;  3D1Q A;  2Z2Z A;  4O4G A;  2HAF A;  2HFS A;  3CJK A;  4N47 A;  2R8J A;  2GJI A;  1JXV A;  3BSN A;  1Q8L A;  1P1L A;  1MU2 B;  4DQR A;  2EG1 A;  4MT1 A;  5DRK A;  2HNY A;  2E5H A;  3ETO A;  2F3J A;  2UUA F;  1RTD A;  5E5N A;  1ZPW X;  2K1R A;  1Q78 A;  3MPD A;  5GAE U;  1W25 A;  1IBL J;  1NKC A;  2G0J A;  1TUG B;  5A76 A;  3AD8 C;  3VZH A;  2EFV A;  5IC4 B;  2KT3 A;  3OD2 A;  3DOK A;  2DB1 A;  2A3J A;  1F5A A;  1QVG R;  1WI8 A;  1UWA A;  2IBO A;  5E3R A;  5J1P A;  3V4I B;  3PV8 A;  5F8N A;  3J7Z 5;  2V4J B;  3EGV A;  3HX9 A;  1SI9 A;  5KFD A;  2HBQ B;  3HT3 A;  3QRR A;  9ATC B;  2C2O B;  4D3H A;  4UZB A;  3TAR A;  4DV2 F;  1L3V A;  1S6O A;  2LU1 A;  3IMQ J;  4F7V A;  1RT5 A;  4TQR A;  2BKP A;  4QU7 A;  1N5Y A;  2AZ1 A;  3DHX A;  4PWW A;  2F4V F;  2C2K B;  4U6P A;  3T6J A;  4CH7 A;  4NYZ A;  4ELU A;  3M2U B;  4B3R F;  4FPR A;  2X51 A;  1UZH A;  1RBO B;  2QL9 B;  4U7C A;  1KQG B;  1MMN A;  2P6T A;  4MKB A;  3SI8 A;  1AW0 A;  5AE2 A;  1N5S A;  1FEE A;  3VGT A;  1U1L A;  3HKZ D;  1G4C A;  3FK4 A;  3OUY A;  3B4D A;  1TK5 A;  2CWK A;  2W7P A;  4G6V B;  3GYX B;  2VQF F;  4YR3 A;  2KTQ A;  3DNC A;  1QSY A;  2YNH A;  4KIA A;  1JLQ B;  4F0K A;  3US5 A;  5DGA A;  2Q1L A;  3VVT A;  5IT9 Y;  3T1H F;  4EU0 A;  4AQY J;  4PG4 A;  1FDN A;  4DCO B;  2KG1 A;  3H90 A;  2FDN A;  3D28 A;  3MD1 A;  3UR0 A;  2ABY A;  3I87 A;  2WHO A;  1RT2 A;  3KFW X;  1HNV A;  2LYV A;  1JJ2 R;  3DU5 A;  4IFY B;  3BO4 A;  4DN0 A;  4ECU A;  3QWP A;  2H5I B;  4WZM A;  2YKP A;  4ELT A;  1WKL A;  1CUL A;  5D4P A;  1OSC A;  3PIP Q;  3PFO A;  4X4R A;  2BM0 A;  1SKU B;  1SQG A;  5IWA J;  3BGO P;  2CNO B;  4L73 A;  3CW2 C;  1Y9O A;  5EWE A;  1DQ9 A;  3M32 A;  5A2Q U;  4NLR A;  4H4K C;  3BSC A;  4K7Q A;  3R6L B;  3T6B A;  4KPC A;  4I1T A;  3QJL A;  3GB0 A;  4N7T A;  1ZTW A;  1IKV A;  1JXE A;  4IR1 A;  5L1I A;  4KHP F;  4RW6 B;  1Q5V A;  4ZIV A;  1KKH A;  1VQL S;  2FIU A;  4ZLP A;  2CJA A;  3R6G B;  4DPU A;  2W25 A;  4ECR A;  3P8B B;  5G0R B;  4FF3 A;  4ZPD A;  5LMU F;  3PG9 A;  3PR5 B;  4K4X A;  1NH8 A;  5HJY A;  2HQC A;  2V8H A;  5E3C A;  2CPJ A;  2I8E A;  1EJ7 L;  4CZC A;  1U26 A;  2W9A A;  3DLE A;  1DTT B;  4M5N A;  4O3O A;  3PW0 A;  1NK8 A;  5DQG A;  2BAN B;  2AKW B;  1H98 A;  2AQ4 A;  4U96 A;  2J0S D;  2BKN A;  2ASL A;  4JBC A;  3IFE A;  1LEO A;  2WZ1 A;  1Q79 A;  3DRR A;  3JYT A;  1WHV A;  2XY6 A;  1B7F A;  4QWD A;  3BQ1 A;  1QTN B;  1RHQ B;  2LQ8 A;  2HGL A;  1KHW A;  1TKZ B;  2AHO B;  4C8O A;  2ZHO A;  4QCL A;  4MYT A;  2MJN A;  3QT8 A;  4ED8 A;  5E41 A;  1AFJ A;  3IC1 A;  3QGG A;  4NRU A;  4YR2 A;  5HAO A;  3M9N B;  3GIR A;  1PIE A;  3OLA A;  2JEG A;  1EX8 A;  1C1C B;  2PFF B;  3V6H A;  3CUN A;  4DUZ F;  3PYG A;  4PWU A;  2GQQ A;  2XSJ A;  4CH1 A;  1HIY A;  5LOQ A;  1S57 A;  2MEW A;  1R89 A;  3IR7 B;  1SJR A;  2HFU A;  4A8X A;  2RH3 A;  3H40 A;  4QJV A;  4URQ U;  5T7L B;  4K4W A;  2CUY A;  8RUC A;  2KN4 A;  4DQQ A;  3AY0 A;  3TVK A;  2WTF A;  2CJK A;  1FDD A;  1NME B;  3KK1 B;  1CBK A;  1IBK F;  4WK1 A;  3LPE A;  5DQH A;  2QL7 B;  2QLW A;  3ZZO A;  1WOS A;  4A8Q A;  1AUS L;  3GLJ A;  2GS8 A;  4LF1 A;  2LMI A;  3O6Q A;  2JJ4 D;  2RUG A;  3W1Y C;  2CPD A;  2YWK A;  3T5K A;  2YX4 A;  4EYI B;  2PT0 A;  1MRO B;  5A8W B;  3R5G A;  5HRO A;  1YVF A;  4NZ6 A;  1LXJ A;  1B0V A;  2J6T A;  5CCM A;  2QGF B;  2F4F A;  4R0E A;  1U6F A;  2QJ3 A;  4NLU A;  1WC4 A;  5GAG U;  1E6Y A;  3KUE A;  1MWQ A;  4LRE A;  3HHD A;  1V6H A;  1OMS A;  5B7W A;  2NXC A;  2W4D A;  2OEM A;  2WSF C;  2E9R X;  2FY1 A;  2M2B A;  3JTP A;  4TLR A;  2HFV A;  4ZPW R;  5E33 A;  3M8S A;  2CPY A;  4Y2A A;  2R7U A;  1FTC A;  3GFY A;  2NS1 B;  2L41 A;  1N5V A;  3H25 A;  3L4B C;  1FNM A;  3NNA A;  4X4T A;  1RU2 A;  4NLX A;  1WG1 A;  1CS4 B;  3H2L A;  2O3D A;  4DL3 A;  2HHW A;  4FXW A;  2AJF E;  4FPI A;  4UZC A;  5D8H B;  1PSD A;  2XY5 A;  3NGS A;  3V4I A;  1XQI A;  1UEK A;  3DHW C;  4DR6 J;  1F6T A;  3D9B A;  1XTZ A;  3L95 X;  1FVQ A;  4JP8 A;  3QIP A;  1RT7 A;  4ZCM A;  4CO0 A;  2KVI A;  3KG4 A;  1YZ6 A;  1PJ5 A;  1AUD A;  3GV5 B;  1N88 A;  4Q2M A;  2RE1 A;  4M94 A;  2I5J B;  3M6W A;  5D0G A;  3PKY A;  5JVH Q;  1U1M A;  4K8R A;  2ZH2 A;  2RDI A;  2VKZ G;  1XMB A;  4DPX A;  4CO1 A;  3G6E S;  1QVF R;  3BQ2 A;  1ACM B;  4HAC B;  4E98 A;  4G1Q A;  3RW7 A;  1KNZ A;  3UO0 A;  4N5S A;  1U49 A;  3TO8 A;  3HM9 A;  2ZKU A;  2JWN A;  2UXB J;  2NUH A;  4K2X A;  4TKT A;  4QR1 A;  5E7O B;  1NSK L;  1YJT A;  1YTY A;  1VFJ A;  1S79 A;  4NLV A;  5J2Q B;  3PKM A;  1VBY A;  5DM6 Q;  1BD6 A;  2HBZ B;  3KLV A;  5KFI A;  4LSN A;  3RU0 A;  1TMJ A;  3P49 B;  3W9I A;  5HN0 A;  5HMW A;  3UDL A;  1YQH A;  3DRP A;  4G65 A;  1T8E A;  4WCE Q;  1YJV A;  5HJX A;  3OHB A;  2RQM A;  1N36 F;  4YHH F;  2XO7 A;  3N79 A;  5HVG A;  2OPQ B;  4B9M A;  4ZVS B;  2HUR A;  4CLL A;  5J1E A;  3J7A 1;  1NO8 A;  2BJ1 A;  1LW0 A;  5HBM B;  2H5J B;  4CDI A;  4GKJ J;  3D0H E;  1T05 A;  3KWM A;  1R0A B;  3CCE S;  5IM0 B;  1B70 B;  5AXN A;  2H3E B;  1TVR B;  1UJ5 A;  2M9K A;  4DR4 J;  1O8B A;  2MKK A;  2RU9 A;  3ILI A;  3HKW A;  3N0V A;  3KLH B;  2PMW A;  1S59 A;  2VPY B;  2PFD A;  1YBT A;  1S6Q A;  3OTE A;  1X4D A;  3HO1 A;  4RNM A;  5G0R A;  2BJ7 A;  2XWY A;  2UUB J;  4R5P A;  4JOU A;  2VQE F;  2L9N A;  1RE1 B;  2R8I A;  2E1M C;  3KJF B;  3VHQ A;  5D0R A;  4I4B A;  4LFC F;  2BAN A;  2KJW A;  3SFU A;  1Y3J A;  2A2D A;  4UOG A;  1HD1 A;  2FLO A;  4M8L A;  1YIT S;  3D6T B;  2DR7 A;  2N3O A;  2UV8 A;  3VVU A;  5L9X A;  1RHK B;  3CCZ A;  1SH0 A;  5I3U B;  2OML A;  1TKZ A;  1EQM A;  2CAD A;  2NUU G;  3NOC A;  1NK0 A;  2OHD A;  2HWH A;  4NXN F;  1UP1 A;  3WX4 A;  1AYE A;  3OTO F;  3RW6 A;  4F50 A;  3M8Y A;  1D3W A;  3OTC A;  4WBF A;  2I2Y A;  4AT1 B;  4HT7 A;  4N56 A;  1HR0 F;  4M5M A;  1VQP S;  4DN9 A;  2QO3 A;  2MQL A;  1JLA B;  5J2N B;  4CRJ A;  1K0V A;  2L08 A;  4CP5 A;  2XMT A;  3DI6 B;  2YNG A;  4P73 A;  2LXU A;  1C1B B;  1SJ1 A;  4LF6 F;  1PJ7 A;  4KKO B;  1Z1Z A;  3FEX B;  2GX8 A;  2HHV A;  2MSS A;  3L7O A;  1YRT A;  1S1T B;  4YY3 F;  3MMC A;  3VR1 A;  5A0Y B;  4MKY A;  2B7C B;  7FD1 A;  4JI5 F;  1FE0 A;  5LL6 d;  2PII A;  1TTH B;  4UF4 A;  4PPZ A;  1HQ2 A;  2OTJ S;  3W3S A;  2G2Y A;  3MUR P;  3G6V A;  2SXL A;  4JI4 F;  2DGU A;  4AYB D;  2EC2 A;  2AEF A;  3UNG C;  4EZ6 A;  1SC1 B;  4BWJ A;  1O51 A;  3TW0 A;  4A8S A;  1MRO A;  5A8W A;  3LAM A;  1K47 A;  4C8K A;  1U8S A;  2KJV A;  2AGQ A;  1HPZ A;  4Y00 A;  1S7H A;  1HWL A;  2YH0 A;  1H7X A;  2YKN A;  5KFK A;  1X5S A;  2QLX A;  5BYS A;  2Z57 B;  3U02 A;  1WHX A;  3UN3 A;  5KT3 A;  3EVO A;  4NYO A;  4DR3 J;  1RAD B;  4WYL A;  2ZBQ A;  3E01 B;  3C16 A;  3CXC R;  4MK9 A;  2DHS A;  2QMX A;  5CZV A;  1G7C B;  3SCI E;  2AJ1 A;  1N0V C;  4O3P A;  2JX2 A;  5F3T A;  1CJV A;  3HCX A;  1T7P A;  1U47 A;  1K44 A;  3G86 A;  2HVZ A;  2YPZ A;  4LF7 F;  5L1K A;  2Q6B A;  3FEZ A;  1C4A A;  1NK9 A;  1VQ4 S;  1BQN A;  2YKM A;  3FVY A;  2FC8 A;  2W2P P;  4IRK A;  2M52 A;  5I42 A;  4N41 A;  4U7U D;  4F36 A;  1GEH A;  4GC7 A;  3PXG a;  1LWE A;  4WFZ A;  1RWP B;  1A6L A;  2W9B A;  3H4D A;  3I5C A;  2XZT B;  1VQK S;  3KUH A;  3PM9 A;  2RML A;  3UDE A;  3PRB A;  4NL5 A;  4UY8 T;  4HH1 A;  4O3S A;  4F4K A;  1QY7 A;  2WOM B;  4M5L A;  4DZD A;  3MDF A;  3J80 Y;  3KK2 B;  3I4H X;  4O44 B;  2C1E B;  1JLE B;  3MM6 A;  3X1L B;  1XR5 A;  2DHA A;  1FEH A;  4Q8F A;  2R3V A;  1LKZ A;  3CC4 S;  3OVA A;  2RU3 A;  3BGF A;  1S48 A;  3AOA A;  3ZC4 A;  2GA7 A;  4DX6 A;  4DV0 J;  1S10 A;  2CNL B;  1M5V C;  3DOM B;  1BWV A;  4RW4 B;  3PR4 A;  1S49 A;  2DO4 A;  1P1T A;  2V4R A;  5EUH A;  1UVI A;  5K8N A;  3TZZ A;  4HR2 A;  2HQ3 A;  1FKO A;  3DOL B;  1CPZ A;  3OXF A;  1VI7 A;  1HWJ A;  2HHH F;  4Q43 A;  1UVL A;  5HVH A;  3FJ2 A;  3IM8 A;  2YNF A;  1I6J A;  1U1Q A;  2RQ4 A;  2LXF A;  1PKU A;  2HZA A;  3G6Y A;  4DR2 F;  4DPY A;  5K8O A;  2C2D A;  1N32 J;  1CJT B;  3G82 A;  2OFG X;  1Y3K A;  3GE9 A;  5I3P A;  3PHE A;  4JB8 B;  3TA0 A;  2P5V A;  1EKS A;  1YRX A;  3MD3 A;  4FF2 A;  1JJC B;  5M2P A;  1OYD A;  4L6V 3;  1WI6 A;  2K2P A;  4QWA A;  1Y5N B;  2DNM A;  9RUB A;  2K7J A;  1X0F A;  2JVR A;  4YB5 A;  2OGU A;  3BGU A;  5EX3 A;  3PHT A;  4WFY A;  2JRS A;  2M88 A;  4F67 A;  2G2O A;  4H4M B;  4WJB A;  2F63 A;  2OPQ A;  1QTM A;  2X1G A;  1U7L A;  1RK8 A;  2DCL A;  4KPY A;  2IDL A;  5D6G A;  1NXI A;  1ZZF A;  3SSR A;  4QQB A;  5HBM A;  2YH1 A;  1WG4 A;  4URS A;  2BXJ A;  4DR5 J;  4NLG A;  4NZ7 A;  2AJQ A;  4AFF A;  1VQS A;  4F0M A;  2PDA A;  1XMO F;  2B43 A;  5J2P A;  2MGZ A;  1HNX F;  4C98 A;  2HHS A;  2QSF A;  3SMZ A;  3LTO A;  4KO0 B;  5B0G A;  2EFN A;  5EWF A;  2QLB B;  4DCJ B;  2IBK A;  3OBI A;  1HWK A;  3UWT A;  1BLU A;  4CCH A;  4CLY A;  2VDH A;  5KFB A;  2PEH A;  2UVW A;  4G3I A;  1WAC A;  4DG1 B;  5CHC B;  2YQ1 A;  3MR2 A;  4NXM J;  3V81 B;  3NS6 A;  2YNI A;  5LT5 A;  3KHR A;  1EZZ B;  1Q95 G;  2IYI A;  3HMJ G;  3ETM A;  3CCS S;  3IGV A;  3QJP A;  3QJJ A;  1R43 A;  3MM8 B;  2DBB A;  3W64 A;  1IM6 A;  1MML A;  3SQG B;  2GC8 A;  5CXT A;  3H42 A;  1Q82 T;  4PWD B;  4Y2M A;  2W2Q P;  3ZZT A;  5ETK A;  2ZOG A;  1JLC B;  3PCO B;  4YOE A;  5KOW A;  1N54 B;  1RTI B;  3CJ0 A;  4C8N A;  2EEY A;  3LUY A;  2YWG A;  4ED2 A;  3MEE B;  3DGP A;  2IC3 A;  2VG7 B;  4NZ0 A;  4Y3C A;  4B02 A;  2IMW P;  5C25 B;  1JLF B;  2KYX A;  1VJQ A;  3CT9 A;  2ALZ A;  1VK3 A;  4OX7 A;  3CDW A;  4FYX B;  1XBW A;  2C3O A;  3KLF B;  4QIG A;  2KFZ A;  1ZM4 A;  3UN5 A;  2GW8 A;  3TAM B;  4HDG A;  3D7S B;  5DLG A;  2E7W A;  4YP3 A;  1VJW A;  4USJ C;  2ZUG A;  3GR1 A;  1DHM A;  3WC2 A;  5AXK A;  4PG7 A;  2DGO A;  2O66 A;  1N5Q A;  3BQ0 A;  5A8K B;  5A8R B;  4TU9 A;  1KS2 A;  1RT4 A;  2DJW A;  1FRL A;  4Y2I A;  1X0P A;  3A12 A;  1FD8 A;  2DH9 A;  3TAN A;  5C42 A;  1S6P A;  1XMQ F;  4F26 A;  3U1N A;  1OO0 B;  1ZM2 A;  3M30 A;  1RU1 A;  1VHF A;  2UUC F;  3WX8 A;  2EK6 A;  5CQG A;  5CH7 B;  5T41 A;  4O3Q A;  4DUY F;  3QQC D;  2UUA J;  2N3L A;  4DPW A;  3QNW B;  2FVP A;  2Q43 A;  2ROE A;  4B3T F;  4ZVR B;  2E5I A;  3HHK A;  3MFH A;  2RQC A;  1GXL A;  3J7Y U;  4K4S A;  3SBM A;  3LP1 A;  4ILL A;  3OVS A;  1N5T A;  3GFX A;  1O6X A;  4ZS6 A;  2V50 A;  3DU6 A;  1D09 B;  1CSJ A;  5LXR A;  1NEE A;  3E01 A;  2XMM A;  4Y2C A;  2AD9 A;  4IRC A;  4LF9 F;  1WC1 A;  2R8H A;  2HVH A;  2X3D A;  1AA1 B;  3FSX A;  3LAL A;  3M2V B;  2ZH3 A;  1Y00 A;  1R31 A;  3QT6 A;  3Q8U A;  1WEY A;  1VQ8 S;  3C6U B;  1BHN A;  3MPY A;  2ZIT A;  3W65 A;  4F4X A;  1HKA A;  2C3Y A;  5ETQ A;  1ZM3 A;  4CLU A;  4A4J A;  5F8J A;  2AX1 A;  2Q79 A;  2WB1 D;  5LXY A;  4EZ9 A;  4DV2 J;  1L5U A;  2NXJ A;  1OSD A;  3P3D A;  5L38 A;  1M1G A;  1Y11 A;  1NK4 A;  3I9Z A;  1JLB B;  3VZI A;  1M90 T;  4IG0 B;  1R8A A;  3R8Y A;  2KZM A;  3Q8S B;  1HYS B;  2D1C A;  2G0I A;  4RW8 B;  4RW7 A;  2QV6 A;  2F4V J;  3TJA A;  3BEG B;  5KFY A;  2D41 A;  4B3R J;  2ZBI A;  4TNO A;  3T5L A;  3QMQ A;  2BR0 A;  3RAM A;  1IR2 A;  4OZ0 A;  2ZOF A;  2JEJ A;  3QLH B;  2ZBR A;  3HHE A;  5HP1 A;  1HNW F;  1SL1 A;  3C14 B;  3ENW A;  4I56 A;  1U09 A;  1U1R A;  1U8W A;  2V2K A;  1WC0 A;  4RW4 A;  2VQF J;  2DVI A;  1V5V A;  2CQ4 A;  2KZZ A;  2BEF A;  3MHY A;  3ITH B;  3T1H J;  4AL6 A;  2Z56 B;  1EB0 A;  1NJZ A;  4IH7 A;  3KNA A;  1T95 A;  4ZVO B;  2YBV A;  2DNQ A;  4M5D B;  3NGT A;  1UJ4 A;  3CDE A;  1AT1 B;  3GII A;  4OYA A;  4U95 A;  4PZV A;  3UD4 P;  4I2P A;  4WPA A;  3KJN B;  5GAD U;  1KDN A;  3KHH A;  2XMW A;  4KBI A;  3KKF A;  1SC6 A;  3HHL A;  2AYB A;  5HLF B;  1NB7 A;  2LEA A;  5L39 A;  2Y1L B;  5KFU A;  1RHU B;  1RT3 A;  1FFG B;  3FMW A;  4PUO B;  1G3O A;  3H59 A;  4DOZ A;  3GJT B;  4GVB B;  2KH9 A;  1X7V A;  4JI7 F;  2QYC A;  4S0M A;  4OV1 A;  1UFK A;  3TYT A;  3VAJ A;  3SSQ A;  4FZV A;  3A13 A;  1X9W A;  3OXL A;  1BQX A;  4DPT A;  2NXN A;  2XWX A;  5FLX U;  5KFZ A;  4WE1 A;  4C8Z A;  3SCL E;  1S7I A;  2W2N P;  1M0S A;  3HHL D;  1N48 A;  1S1V B;  2QA1 A;  4B9V A;  2GAH C;  4KHP J;  3NNH A;  4TVA B;  2VBZ A;  3LGN A;  1UVK A;  4ED4 A;  1I5O B;  2NLW A;  1IKX A;  3AT1 B;  2C42 A;  4PAA A;  4PG8 A;  5F9L A;  2F9J A;  3FFI B;  4PPD A;  3C2P A;  5KFN A;  5LMU J;  3MED B;  2M8H A;  1P9Q C;  2W1B A;  2HZV A;  4I2Q A;  5FDL A;  1CC7 A;  4LSZ B;  4IYQ A;  1REV A;  1RZM A;  1NZA A;  2FGO A;  2M70 A;  1YK9 A;  4XAK A;  1IKW A;  3I5B A;  4ZOS A;  5AT1 B;  3K5L A;  3IS9 B;  5F0W A;  1OIA A;  3M7V A;  4TU8 A;  1CEZ A;  1URR A;  3D5M A;  2AGP A;  1GFW B;  3AA8 A;  3D3C J;  2PGC A;  4M95 A;  1GH8 A;  4PKD B;  4WP8 A;  4NRT A;  1YJ7 A;  5C2C A;  1G6B A;  5H9F J;  2VFV A;  4UOC A;  4I69 A;  1NLK L;  2GFF A;  4B9U A;  3RBE A;  1UW9 A;  1TKD A;  3H5X A;  3CCQ S;  1S9F A;  4BLG A;  4HHJ A;  4HYK A;  1S0M A;  2ZH1 A;  2OH2 A;  5D4O A;  3V5R A;  4DUZ J;  1DQA A;  2ZE2 B;  2W7A A;  3FCV A;  3MM9 B;  1SIW B;  4WXO A;  3PEJ A;  2JFD A;  5HAN A;  4HI1 A;  4IOB A;  2CRL A;  4GO7 X;  2J8A A;  3ICL A;  4CNY A;  1RTI A;  1S9E A;  2RRN A;  4WKR A;  3OQ2 A;  1RAC B;  3QT5 A;  3AJ1 A;  4UUW A;  2WCX A;  3OFG A;  3UNY A;  4OHX A;  4WK3 A;  3WIU A;  4ZLJ A;  4WZQ A;  1ARO P;  1U6B A;  2MZQ A;  3I56 S;  2Z2Y B;  3LP0 A;  1D9F A;  4ANC A;  5C25 A;  1JLF A;  5EHH A;  1YJN S;  3OT9 A;  3LAN A;  2D3O R;  3P5B P;  3BDP A;  2MQQ A;  2C2M B;  5K20 B;  1F5C A;  2YY3 A;  2QFJ A;  2CPE A;  2C2N A;  4TY9 A;  4OX6 A;  1YX2 A;  1HNI B;  5HQM A;  2JLF A;  3GYN A;  2WSE C;  1OJ4 A;  1IKY B;  3HSG A;  4OHV A;  4B9L A;  4NLD A;  3W7B A;  3HUL A;  2FZK B;  5D3G B;  5IT0 A;  4ECX A;  2DNY A;  1N33 F;  4HT5 A;  2RIJ A;  2MZR A;  3JTN A;  2Z30 B;  3ZTO A;  3GFZ A;  4I6A A;  2UVR A;  3HFK A;  2F9D A;  4OHY A;  2WON B;  4NI2 B;  4FS2 A;  2H4W B;  3VQT A;  2KXN B;  1B64 A;  1F60 B;  4B3M F;  4ECS A;  3LWM A;  1ZA1 B;  4ID8 A;  3R1L A;  4A8O A;  2DGQ A;  1Q8B A;  2FUG 9;  3CO9 A;  2CYY A;  4NYP A;  2B0G A;  2EK1 A;  2Z58 B;  1VRU B;  1JLG A;  1ZPV A;  4ALZ A;  3TZY A;  4OJ1 A;  1TL7 B;  2P9G A;  2ALY B;  3OVB A;  2B5J A;  2A10 A;  4Q7A A;  5DDO C;  2ATL A;  2MQN A;  1AZS B;  2B6A A;  5ITH A;  2D3O 1;  4FXV A;  2E44 A;  4KQZ A;  3W9J A;  2VIH A;  1S77 D;  4DV5 F;  3C6U A;  4NA3 A;  2IYG A;  2V2Q A;  1F5B A;  5GAE I;  3AOB A;  5H9F K;  3B4M A;  3A1Y G;  3C66 A;  1PYS B;  3ZZU A;  3UCU P;  4PCQ A;  1GXT A;  2D9P A;  3I6P A;  3B82 A;  1PBU A;  5HSP A;  5IS2 A;  2ZVI A;  2JNJ A;  3KLI B;  1U1N A;  2LP4 A;  2IM3 A;  2EXU A;  3QZ7 A;  2D69 A;  1H2T Z;  1S12 A;  1HHQ A;  4FBU A;  3DLB A;  1RDR A;  3D54 A;  3PFE A;  4IG3 A;  2ZH7 A;  1XWL A;  4JI2 F;  2RSQ A;  3GIJ A;  3F44 A;  5BR8 F;  4RZR A;  1HBM A;  3MAA A;  5MLC V;  1RTH B;  3C14 A;  4A48 A;  5HI7 A;  1FX2 A;  3ZFV A;  1TL1 B;  3BBF A;  1L3U A;  3Q22 A;  3OL9 A;  3W2W B;  1TFY A;  4HDH A;  3SEO A;  4ZPC A;  4IUF A;  3ITH A;  2BKO A;  1RWU A;  3CO0 P;  4W90 B;  3FZB A;  1FDB A;  1FF2 A;  5AXM A;  2UUT A;  4WXW A;  3D6H B;  5I3Q A;  1IJF B;  2JC1 A;  3IBW A;  2J6U A;  2OSQ A;  4DV1 F;  1NKB A;  1RAI B;  2FHO B;  4DSL A;  1SJ3 P;  3M1V B;  3OLB A;  3I0R A;  3GV8 B;  2AV5 A;  5F41 A;  1N36 J;  3FRZ A;  4YHH J;  2DNO A;  2CKW A;  2G2Z A;  2XBP A;  4KRW A;  3OXG A;  3DRS B;  5LSR A;  2IJN A;  4AE5 A;  5AE1 A;  3DLK B;  2VL1 A;  4N77 A;  3ET6 A;  2W4C A;  2E1A A;  5B09 A;  2ZC3 A;  4KFB A;  3PX4 A;  4K5R A;  4DFP A;  1N56 A;  3SSS A;  3L09 A;  4NCB A;  1R0B G;  2ZKT A;  2G4B A;  4K4U A;  4K4Z A;  3T5H A;  2K3I A;  3GU0 A;  3T9N A;  1RQ0 A;  1TKX A;  1HBO A;  2QMW A;  3DYA A;  3H8Y A;  3CJQ A;  2B4O A;  3MED A;  2CIM A;  2ZH4 A;  3GV7 B;  3F41 A;  2VQE J;  1TL3 B;  3W66 A;  2R7S A;  1QDU B;  2GGP A;  2BQU A;  1OYE A;  3MI7 X;  4LFC J;  4XPC A;  4JYA F;  1F3F A;  1RTJ A;  5A2Q Y;  2EKY A;  2DD8 S;  3IS9 A;  1ELO A;  4I7F A;  3M8Q B;  3CJS A;  1KLM A;  3H5U A;  3CD5 A;  3I55 S;  1PJ6 A;  2W2O P;  1IN0 A;  2PC6 A;  1EAR A;  2JFK A;  4QIW D;  1BY9 A;  3CD7 A;  3MAQ A;  3B78 A;  1X9S A;  2UVU A;  4F4Z A;  4ILM A;  4NXN J;  4ZPA A;  4LQ9 A;  5MAO A;  3OFF A;  1FRH A;  3MZI A;  3OTO J;  2FJA B;  5CZX A;  4TY8 B;  4NCA A;  4LUB A;  3PO5 A;  1J2V A;  1HR0 J;  2J9D E;  3KDO A;  1ZM9 A;  2ZE2 A;  1KOO A;  1RYR A;  4JUZ A;  5FJ4 A;  2KFY A;  3OL8 A;  3CJK B;  5K8M A;  1D1U A;  4LF6 J;  1KRP A;  5LMN F;  2VON A;  4B17 A;  4YY3 J;  5B0C A;  4RL1 A;  3D3B J;  2GJ2 A;  3VTI A;  2HNY B;  2ZFH A;  4JI5 J;  1RTD B;  4DZ6 A;  4G1I A;  4DUT A;  1JNZ B;  2FJV A;  4ENO A;  2K1R B;  2MLX A;  1U0S A;  4JI4 J;  1UPM B;  1LFP A;  2MKJ A;  2RD5 C;  4LRC A;  4Q0B A;  3QWU A;  5EWG A;  2XY7 A;  5L46 A;  4NEZ A;  4FVM A;  2O67 A;  4CO4 A;  1NPR A;  2YWF A;  3D0I E;  7AT1 B;  1HNI A;  3EMT A;  1ZBT A;  2H5E A;  1IKY A;  3MR5 A;  3TUJ C;  4MIA A;  4FYW B;  3R5A A;  4UTG A;  3DOK B;  3QAT A;  1SKS A;  5D3G A;  2XO6 A;  2GMH A;  1MN7 A;  2VHG A;  1NZ8 A;  2ZEJ A;  1BGX T;  1N8R T;  4LF4 F;  2ZH5 A;  5IV4 A;  4NI2 A;  5DO2 A;  3MEC A;  2I1R A;  5BYQ A;  4K0K F;  1P27 B;  2ZH6 A;  2ZDP A;  2AJ0 A;  1M5H A;  1RBA A;  4OZ2 A;  1SBR A;  4OYX A;  5FII A;  4JV1 A;  1RT5 B;  4ATN A;  1UFW A;  4OHW A;  4WIQ A;  3TZW A;  1CQM A;  1VRT B;  2GML A;  4C7Q A;  5KFX A;  1WG5 A;  2HRY A;  5GAG I;  5EX0 A;  3KXD A;  4K2J A;  5C2G A;  1PC4 A;  1NAQ A;  3F56 A;  4IR9 A;  4X64 F;  2J7W A;  2DIS A;  2FLN A;  2ZZN A;  5DDQ C;  1JKH A;  3TWZ A;  2QFI A;  3BGL A;  3IGN A;  4ED0 A;  2BYC A;  4ZA1 A;  5H9E J;  3RB0 A;  2ADC A;  3G6X A;  2XI3 A;  2RIL A;  4DJB A;  3FRY A;  2V8P A;  5KG5 A;  2DGS A;  1Q7L B;  2OD4 A;  2FJE B;  3IG1 A;  4KHR A;  2VF3 A;  2C2Z B;  2ZBC A;  4CLZ A;  4NLP A;  4J9V A;  4DV3 F;  5ETR A;  1F9F A;  2ZD1 B;  3ZTR A;  2EBE A;  1R8C A;  1HNV B;  1LK7 A;  3ZNJ 1;  2P9C A;  1M5S A;  1WF1 A;  1HHS A;  2OPS A;  2R2S A;  4DSF A;  1P8G A;  1JJ4 A;  4Q44 A;  3E8O A;  4KY3 A;  4F4W A;  1VLY A;  3MUV P;  1KTV A;  1LWF A;  2EPI A;  2VOD A;  1FKA F;  2AF6 A;  2HHH J;  1YJU A;  2KB2 A;  2R2T A;  5DDP C;  4CLS A;  1Y5L B;  2F5G A;  1JNR B;  4BDP A;  5ETL A;  2XMV A;  3M05 A;  2CPI A;  5HQ8 A;  4C3M A;  1TL1 A;  2E9Z A;  4DR2 J;  1V3Z A;  4ICL A;  2QSW A;  4C4W A;  2DPJ A;  1IKV B;  4RUA A;  2ASJ A;  3G96 A;  4DLE A;  2E1C A;  4NLQ A;  4UOF A;  3DDI A;  3BO3 A;  3MPV A;  2GVD A;  4P10 A;  2H48 B;  2XZD B;  2CPZ A;  1RT1 A;  4ES3 A;  3RBZ A;  1F3V A;  3K0J A;  5HMX A;  2F7V A;  2WBM A;  3DLE B;  2KHD A;  5IQ6 A;  1RAF B;  3JQJ A;  3NKY A;  2L48 A;  3RYL A;  2HW3 A;  2QA2 A;  2EBG A;  4TU7 A;  4OQJ A;  1FI4 A;  5RUB A;  2V68 A;  2RF2 A;  4A46 A;  3DRR B;  3JYT B;  2P9E A;  4W4M A;  4U7U K;  1U2R A;  5BJR A;  1FXR A;  2NPF A;  2H54 B;  5KFM A;  3TEH B;  1XMO J;  4QWC A;  4FXD A;  3AQP A;  3HT0 A;  1HNX J;  4L75 A;  3TZX A;  2HHQ A;  2VPX B;  2D3U A;  4O3N A;  4DX8 H;  1VGY A;  1R3N A;  1UEV A;  5F8L A;  4DF4 A;  4C11 A;  4ED5 A;  2B9X A;  2E7V A;  2MYF A;  1VK8 A;  5JJB A;  3I9V 9;  5F8I A;  3P4U B;  3V4M A;  5J2M A;  2MKY A;  3R9L A;  2XSJ B;  1S0N A;  1VQY A;  3FMB A;  4TYB A;  3HHN B;  2HVD A;  1YJR A;  4WWS A;  2LQ5 A;  2JLG A;  2ZWO A;  4J90 A;  6FDR A;  4X4S A;  4KSE B;  2MB0 B;  1LFW A;  4HVZ A;  4P2F A;  3THV A;  1TKT A;  2B56 A;  5LJ5 Y;  3KUG A;  3K2Y A;  3C3L A;  1SL0 A;  3CSK A;  2PI5 A;  3UI3 A;  2XEX A;  2IM0 A;  4QW8 A;  1HHT P;  3GZ7 A;  3JSB A;  3LQV A;  4WP3 A;  4ECV A;  4ZHR A;  4LMZ A;  3POT B;  4E8U A;  2DNH A;  3MCO A;  2RDJ A;  2O5D A;  3T1A A;  1XJW B;  3NAH A;  3QYY A;  3F0N A;  3HLU A;  1RAA B;  1UET A;  3MEG A;  4RNF A;  3RRH A;  1E6Y B;  5IFM A;  3P5T L;  1H73 A;  2OP5 A;  3HJF A;  2HS0 A;  3CJ8 A;  3NS7 B;  4UQT A;  1JK9 B;  1DJ0 A;  3CJ5 A;  3C46 A;  1JB0 C;  3JS9 A;  4DSK A;  1PG5 B;  2OKQ A;  4Y65 A;  4LT6 A;  3V2U C;  4ZIT A;  4RNN A;  2KT5 A;  2JLE A;  3OJS A;  2B9E A;  5KFV A;  2G0C A;  1AFI A;  3MPU B;  2JZ5 A;  1B7Y B;  2G1D A;  2CZV C;  3HDS A;  3G87 A;  8ATC B;  3AJ2 A;  1XMQ J;  2AJ2 A;  1I3O B;  2DIT A;  2XLI A;  2UUC J;  2A6M A;  1WC5 A;  3PRD A;  4CWB A;  4DUY J;  4LRD A;  1SV5 A;  1FK9 A;  2PEB A;  2HHX A;  4OYW A;  2AP6 A;  1OY6 A;  4Z7C A;  2MKI A;  1U1K A;  2U1A A;  4J91 A;  3L7P A;  1FES A;  3EPG A;  4B3T J;  3TVY A;  2KO1 A;  4PXB A;  3D4J A;  5D77 A;  4YN3 B;  2KFN A;  1VC0 A;  4DU8 A;  1SC4 B;  4ED6 A;  3CUL A;  4KH0 B;  1X4A A;  4OI2 A;  3VGS A;  2IHR 1;  2AMC B;  3QIP B;  2ADB A;  1RT7 B;  4GMK A;  4UST A;  2N82 B;  1X60 A;  2YWW A;  3UD5 A;  4LF9 J;  1OPZ A;  3BV8 A;  2D74 B;  3OR2 A;  2DH7 A;  3O44 A;  3K89 A;  2M3D A;  2AU0 A;  1VRT A;  3NNC A;  2CNN B;  1S4F A;  4LVO P;  5IOL A;  1RAO A;  3Q8P B;  4F3O A;  1PGZ A;  2RUS A;  1VIS A;  3TQ1 A;  2HGN A;  2BBE A;  4G1Q B;  4O3R A;  4J5O A;  2PA8 D;  3HSD A;  2BDP A;  3CWJ A;  1VCT A;  5AE3 A;  1GNK A;  4DX7 A;  3TJ9 A;  4F8R A;  3Q8R B;  4C48 A;  3DLH A;  4MH8 A;  3QID A;  5JXS A;  2OIH A;  2HIY A;  1IR0 A;  4Z7Y A;  5KFQ A;  4PXD A;  1WDT A;  2J7K A;  2EFO A;  4OYP A;  4L76 A;  2K7K A;  3EGN A;  2E5L F;  3NP5 A;  5D0H A;  1S9G B;  1FRM A;  2J7U A;  1O0P A;  1VBZ A;  2XMK A;  4AL7 A;  3CF5 Q;  4LSN B;  2GO8 A;  4ZK7 M;  2M4M A;  2ZD1 A;  1ROF A;  1FNX H;  2A2C A;  1U48 A;  3PJW A;  4WFN Q;  1O5J A;  2ZNZ A;  3DRP B;  3OSP A;  3AXK A;  1VQ7 S;  3G8Q A;  1HNW J;  4J7C A;  3R1H A;  1XNQ F;  3A8J A;  2DR5 A;  1KP6 A;  2IA6 A;  1L3K A;  1WC6 A;  3BBC A;  4ANE A;  2XI2 A;  1VBK A;  5J1E B;  4NML A;  5KG7 A;  4NLS A;  3BO2 A;  1LW0 B;  2BOA A;  1RP5 A;  4OV6 A;  3KMQ A;  3U1M A;  2ZDO A;  4LRB A;  1S76 D;  3MAH A;  1T05 B;  1KQF B;  4HEA 9;  1NBE B;  4CT9 A;  4RW9 A;  5E2Q A;  2GCF A;  3M8P A;  3FSI A;  3AXM A;  2WK4 A;  1IR1 A;  4Y0F A;  5KFW A;  3I82 A;  4WTY A;  5HVF A;  4DFJ A;  4DV4 J;  2OI2 A;  3NRB A;  5KFO A;  2XYG B;  4ZP6 A;  2MHN A;  4A8Y A;  3EZO A;  2JDJ A;  3H7H B;  3QAE A;  1S6Q B;  2Y8W A;  4JI7 J;  4J9O A;  4GVL A;  1UPP A;  4NEY A;  3MR6 A;  2V2Z A;  1FRI A;  3GIK A;  1SCJ B;  4R5P B;  4PQU A;  2CJX B;  1WTB A;  3PAC A;  2OTL S;  4ZP7 A;  2PE8 A;  1FKP B;  2ASD A;  1M1H A;  3MTJ A;  3S6E A;  4LFA F;  1U0H A;  4NX9 A;  1YDL A;  2F1F A;  2FB0 A;  1S72 S;  2RDD A;  3K8V A;  1HLW A;  4PG6 A;  4TXS A;  3Q24 A;  4J37 A;  3ZXW A;  5E3Q A;  1HMV B;  1U24 A;  4KYZ A;  2GVZ A;  2R8K A;  2H51 B;  4O23 A;  1NJW A;  5CYQ B;  4F4A A;  1GX6 A;  1ZET A;  7FDR A;  2RS8 A;  1TAQ A;  2AEM A;  4LJM A;  2CVI A;  5CCL A;  1SQF A;  2LA6 A;  1ZAX A;  4M5H A;  2NR0 A;  3QPI A;  1N0U A;  2ASY A;  1FFS B;  1GMU A;  3CDA A;  1HI8 A;  3KHL A;  3W2V A;  3EXC X;  1SH3 A;  2VG6 A;  3AB4 B;  3H5Y A;  3G9C A;  2YNG B;  2FJW A;  2ZJP Q;  2YX1 A;  2BAB A;  2HFO A;  3NLC A;  4H4O A;  1DBD A;  2YKA A;  4AND A;  1XR7 A;  3BKU A;  1DTQ B;  2AYM A;  1HBU A;  4GKJ F;  3MMC B;  3RTV A;  2LDY A;  1VQ9 S;  1T9U A;  1YI2 S;  1ZOT A;  5C7P A;  3M8W A;  1SUQ A;  1HQE A;  4DR4 F;  1C0T A;  3CE8 A;  2DY9 A;  3QRQ A;  2XQC A;  2XCP A;  4X4V A;  3DDK A;  5ADZ A;  1T3N A;  4ZVH A;  4ES1 A;  3EJM A;  3SV4 A;  1M5O C;  4OX8 A;  3DFE A;  5JUM A;  4RNO A;  3DMJ B;  2DNR A;  3POT A;  2KG0 A;  2N7C A;  4ED1 A;  1HPZ B;  1HQU A;  2EFQ A;  1FWL A;  3D2W A;  1JWW A;  4IDK B;  4OI6 A;  2YKN B;  2FHM A;  4NPO A;  4FP9 A;  1VIX A;  2ZNY A;  1IUJ A;  3HVW A;  3EYZ A;  1UEU A;  3MF5 A;  2VB6 A;  3H2V E;  2LFV A;  4C3K A;  4RWX A;  3IR5 B;  2HG4 A;  3EX7 B;  4A8F A;  3KJV A;  3CMA S;  2WW4 A;  4NLO A;  1X5O A;  3C16 B;  3D68 A;  2MQP A;  1KQS R;  2OUG A;  1RB0 A;  2FHK A;  1N33 J;  2IMO A;  1UFL A;  4N76 A;  1CJV B;  2LVW A;  2ZH8 A;  3FUY A;  5DG7 A;  4DEZ A;  1BQN B;  2YKM B;  4PAB A;  3QRP A;  4B3M J;  3CCR S;  5I42 B;  1RGV A;  2C2E A;  1W2I A;  2I38 A;  5DZ6 A;  1FT8 A;  1T02 A;  3VV2 B;  1GMV A;  1QE1 A;  1LWE B;  3CIM A;  1NCL A;  1CC8 A;  4P2M A;  2W9B B;  2MTL A;  2PSZ A;  4C6A A;  4QZV B;  3SFG A;  1GAO A;  1WEL A;  2NYI A;  2VFT A;  3J81 U;  3T3F A;  4MKV A;  1X4B A;  4KV8 B;  3RAX A;  2MKS A;  1CLF A;  3MM6 B;  4C8M A;  3SDE A;  3CTR A;  1KOH A;  2XS2 A;  1CJK A;  2BJ9 A;  1TV6 A;  4ZIW A;  4IRD A;  5ETM A;  3VAM A;  1RWK B;  4JI3 F;  4DLG A;  3OR1 A;  3I96 A;  3NBP A;  3NCR A;  4DV5 J;  3GWC A;  2FJX A;  3KG0 A;  3IP0 A;  5IV3 A;  3J7Y I;  1FKO B;  1NRK A;  2NZ4 A;  5KFF A;  4YFU A;  1RWN B;  1M5P C;  1S1U A;  1FE4 A;  2FD2 A;  2F65 A;  1GMW D;  4OHZ A;  1JMT A;  2YNF B;  5CA5 A;  2FJB B;  5D4L A;  3W63 A;  1X5T A;  5KFC A;  4FBT A;  2DGV A;  3BBB A;  4R8U A;  4JV2 A;  4BWM A;  2BZ2 A;  3G82 B;  1S9G A;  5KFH A;  4Q8E A;  3JB9 k;  4QWB A;  4JI2 J;  3H2U B;  1D8Y A;  3CGI A;  4B9N A;  1YWX A;  2E66 A;  3BN7 A;  4ECQ A;  4RNH A;  2OEJ A;  2KRR A;  1MWZ A;  2CXE A;  2PMZ D;  4V19 X;  1WNE A;  3R7B B;  5KT4 A;  1Q86 T;  4DV6 F;  2MJU A;  4I6W A;  4DQS A;  1KQK A;  5D0E A;  4MYU A;  4OZL A;  5HL7 Q;  4RU2 A;  2CPX A;  4DV1 J;  1NB2 A;  3HVA A;  3D1H A;  3VGU A;  2K8G A;  1RI7 A;  5J2P B;  2MGZ B;  3EIC A;  3CED A;  2BJ8 A;  2Z2M A;  2GAG C;  4DL4 A;  4OJG A;  3R3T A;  4TN2 A;  2YKO A;  2A1B A;  1J5O A;  2XCA A;  3BSO A;  3JXO A;  2CZ4 A;  2J9E A;  1HNZ F;  3HHL C;  1KVK A;  3KMS A;  3LF0 A;  3T41 A;  1YZ7 A;  1UAW A;  2J9D A;  4Y2K A;  2DCU B;  1DFD A;  1R7I A;  2XTJ P;  3E2E A;  4KGM A;  1DAR A;  1FKP A;  3DGV A;  1RAJ A;  1TK0 A;  4ETX A;  1VIO A;  5GAD I;  3MR7 A;  1SVD A;  2FHJ A;  5CYM B;  2YNI B;  2IRU A;  3TJ8 A;  1F9H A;  4JI1 F;  3Q0A A;  2UXC F;  3LGM A;  1VS3 A;  1VC6 A;  1HMV A;  4KB7 A;  3W62 A;  3MMB A;  4N8O A;  2E5G A;  5CYQ A;  4QPT A;  2UXD F;  4LRF A;  2Y9H A;  2HQD A;  3BR9 A;  3LO3 A;  1HWU A;  3TRG A;  4LVN P;  2CJB A;  2RJZ A;  3OW2 R;  4JYA J;  2FHJ D;  1D9A A;  1KBR A;  4CLK A;  3BGR A;  3R5B A;  1OY8 A;  4ZVG A;  2KRB A;  3H98 A;  5FLX Y;  4XDD A;  1GT8 A;  2HBR B;  3FBE A;  3DGP B;  3D0G E;  2IC3 B;  1Y4Z B;  1RHR B;  4YDD B;  5GMK a;  1LWC A;  4URG A;  1NPP A;  3GPA A;  4OYB A;  4CQ1 A;  5ETT A;  1KC8 T;  2BMB A;  3UE2 A;  5CD4 A;  1TP7 A;  4A8K A;  3FCH A;  2BOP A;  1DTQ A;  2HNZ A;  3GYG A;  2UVV A;  2GV1 A;  3TNV A;  3ZTQ A;  3TR5 A;  1WOR A;  4F2S A;  5THW A;  1N52 B;  5GAH U;  2AT1 B;  1K9M T;  2R7T A;  3ILL A;  3C6T A;  1BC6 A;  2ATC B;  1RT4 B;  4QU6 A;  1A0O B;  3VAI A;  2QRR A;  3CCU S;  3OTB A;  3MM5 A;  4YME A;  5LMN J;  5C42 B;  1S6P B;  4CYU B;  1OWX A;  1Z4U A;  3M30 B;  3RB3 A;  4J9Q A;  4PG5 A;  3DMJ A;  3IXQ A;  3VAL A;  3UR3 C;  4WTO B;  1H0H B;  2MZJ A;  2HRU A;  1EP4 A;  2CQG A;  3N01 A;  4DSI A;  5KFJ A;  1FWP A;  1FTR A;  4IDK A;  1F1B B;  4NA2 A;  1S4E A;  4YDX A;  3PYE A;  5K14 A;  2HWT A;  3KK3 B;  3LP1 B;  4X4Q A;  4KH1 B;  4OX9 F;  1IBC B;  3A3O B;  4IO1 A;  2FVR A;  1J5E F;  3R7S B;  4YB7 A;  4XPE A;  3MM7 A;  5G4D A;  1D8Z A;  2HZC A;  1NK7 A;  3MOZ A;  2QA4 S;  4FYY B;  4FF4 A;  3RBD A;  3IAS 9;  4U9R A;  1OQ6 A;  2VA2 A;  2M7S A;  1RAB B;  2IJR A;  5L1J A;  2IRX A;  3IAM 9;  4LF4 J;  4LFB F;  2B4V A;  4A8W A;  1BUX A;  2CQ2 A;  2HAI A;  2FVC A;  3N4W A;  4K0K J;  4NWB A;  3TOQ A;  2OSR A;  1YKW A;  2VV5 A;  3CNQ P;  4P75 A;  1SQE A;  5L9N A;  2CNK B;  4ETZ A;  3BPD A;  1NSP A;  3PX6 A;  3MMJ A;  2Q6C A;  3AFG A;  2VJU A;  3UVJ A;  1S0V A;  4RW7 B;  4KV8 A;  2MZ1 A;  2EFG A;  3EDR B;  1UWB A;  3AQO A;  2XUL A;  4D3G A;  1A7G E;  4ECY A;  1RT6 A;  1XNR F;  4LBP A;  4X64 J;  2MQM A;  2DNZ A;  4B9T A;  4ZPB A;  2HGM A;  3NGR A;  5HP1 B;  1SL2 A;  1U2F A;  2ROP A;  5ETS A;  3KLG A;  1SC3 B;  1N34 F;  3R5J B;  5K5M A;  1X8D A;  3M9O B;  4DL6 A;  2BW2 A;  3V6J A;  4OYZ A;  5AJ3 F;  2P8I A;  3EPI A;  3CCM S;  3AA9 A;  4U8Y A;  2W9C B;  1U6Z A;  1FXD A;  3NXZ A;  4DV3 J;  4P74 A;  4BCA A;  1DQ8 A;  3PX0 A;  1CVJ A;  1WUU A;  1RKJ A;  2Y8Y A;  4I2P B;  2XNR A;  2YQ3 A;  4B3O A;  1FFW B;  4DV7 J;  4F02 A;  3MGJ A;  3PO4 A;  3HHL B;  1FHT A;  1B0P A;  4RBT A;  1URN A;  1RT3 B;  3D6F B;  3NAI A;  4OI0 A;  4HH0 A;  4PXE A;  1U2C A;  1NK5 A;  1MSW D;  3H20 A;  3VWS A;  4C0B A;  2ILY A;  2XHC A;  3GJR B;  3MR3 A;  2B9Y A;  1YJW S;  1NUE A;  4OYI A;  2R7R A;  2MLY A;  2HLT A;  4QYZ J;  3AJD A;  3CVK A;  1QUV A;  4MAK A;  4FF1 A;  2EC0 A;  4OZ1 A;  2XMA A;  3JQM A;  4WE1 B;  4MK7 A;  3NG8 A;  2V9W A;  6AT1 B;  3ISN C;  5KFR A;  2GO9 A;  2GIF A;  2OPR A;  2GMJ A;  3BH6 B;  4X66 F;  4F3Q A;  3C15 A;  3HVT A;  2VPW B;  2FZG B;  5DS7 A;  1N6Q B;  1EKR A;  1F9E B;  2V34 A;  2B51 A;  1IKX B;  4DL7 A;  2BE7 D;  2CWX A;  2NPI A;  3B54 A;  2HFZ A;  2UU9 F;  2J0W A;  3NL0 A;  3NMA A;  4I2Q B;  2AYE A;  5FDL B;  3DM2 A;  4LSL A;  4CM0 A;  1CJU A;  3DLG A;  2WAQ D;  3T5J A;  3BF4 A;  1REV B;  2ZBP A;  4B9S A;  2M5Y A;  2ZJR Q;  1LW2 A;  2XS5 A;  1IKW B;  2J0X A;  1EIY B;  2JL9 A;  4LRA A;  4J9P A;  4KJI A;  3P6Y C;  1C4C A;  5LSL A;  2BQR A;  2CG4 A;  2DGW A;  5KG6 A;  1N4L A;  1VR6 A;  2OPP A;  4LF5 F;  5KFT A;  2QX0 A;  1Y10 A;  3S7R A;  3GCX P;  3KJQ B;  2LEP A;  3PYF A;  2J5A A;  3TEG A;  5M2U A;  5CYM A;  2MXY A;  4EFA C;  2NSB A;  5C24 A;  2IAJ B;  2VG5 A;  1DRZ A;  2E9T A;  2ZVS A;  4RO0 A;  4K4T A;  6FD1 A;  2R7W A;  4QBU A;  1JJH A;  1RUS A;  3DDN A;  4QW9 A;  3O1L A;  2CJY B;  3N28 A;  2OO4 A;  1FJG F;  4AXJ A;  2IA0 A;  4J9R A;  1ULR A;  4MMO A;  1L3S A;  4MTP A;  4P71 A;  4F3M A;  3A8K A;  3JAM U;  3QO9 A;  3N9U C;  3G71 S;  3T1Y J;  5HAT A;  4ID5 A;  4Y6I A;  3GG1 A;  3TA1 A;  1S9E B;  4N8N A;  4TYA A;  2DR6 A;  2UUW A;  1TFW A;  2J9C A;  1HFE L;  1KEK A;  3M8R A;  5KG1 A;  3K58 A;  1S5Z A;  1VQN S;  3LP0 B;  4P9S A;  3M6X A;  2EW9 A;  3THP A;  1G2E A;  4OMF G;  2NZC A;  3UPF A;  1RWO B;  3V6D A;  1B3T A;  2C28 A;  2AX0 A;  1H2V Z;  2P2C B;  1UA1 A;  2DIV A;  2N7Y A;  2F8H A;  3UCZ P;  1SJF A;  2VBX A;  1FRJ A;  2R7O A;  4AD6 A;  1R8P A;  3QSY B;  1RTZ A;  3BPS P;  1ITP A;  3N5B A;  1HWI A;  4OFZ A;  3SV3 A;  4QYZ K;  2GHP A;  4MKA A;  5HK4 A;  3EE3 A;  2VC1 A;  4ZVU B;  1IWA A;  3LH2 S;  3QAU A;  3M2R B;  2MST A;  2DRA A;  3EVW A;  4CYU A;  3CC2 S;  4WP9 A;  4X65 F;  1S97 A;  2YWE A;  3A8I A;  4DCP B;  4QR2 A;  4P6Q A;  4QYR A;  4A8M P;  4MFB A;  1JLG B;  3OPK A;  2BRK A;  3AOD A;  1NDK A;  1H7W A;  2F8M A;  2EG2 A;  1NM2 A;  3KK3 A;  2B5J B;  3UD3 P;  2U2F A;  4X2B A;  4L3N A;  3Q8Q B;  3MMA A;  3KOA A;  5KFS A;  5B0B A;  4MJK A;  2DRB A;  4EYH B;  4O0N A;  1FVS A;  2JHE A;  3FC9 A;  4KAI A;  2KXF A;  2J0Q D;  5EN1 A;  2H4Y B;  4DR1 F;  2GQC A;  3M8Z A;  3UN2 A;  2B6A B;  2NCK L;  4X62 F;  4J9K A;  2OD6 A;  3DXB A;  4EO6 A;  2EI5 A;  2O01 C;  3GR0 A;  4IO9 Q;  4KGZ B;  1R27 B;  2YXL A;  2CQ3 A;  4LF8 F;  3CJ2 A;  4ZCK A;  3M9M B;  2W01 A;  4IFV B;  3S01 A;  4UUX A;  3IR6 B;  3KLE A;  3ILO A;  1PAE X;  2R42 A;  3RR8 A;  3JSR A;  1X31 C;  1S1W B;  5DG8 A;  1Q4R A;  1NJI T;  1KD1 T;  3S1T A;  2HQG A;  3D1O A;  4IG3 B;  4Q5V A;  3SIP B;  1YG0 A;  2B8P A;  5KOX A;  1C0U A;  2IVY A;  4WII A;  1PIL A;  4DU7 A;  2C2R A;  4WU2 A;  1HBM B;  3MAA B;  2ZC4 A;  3ZTP A;  3KDN A;  3AOC A;  3NGU A;  4W92 B;  1D9D A;  1FER A;  3MXH P;  1MU2 A;  1REG X;  1TUW A;  3ZZY A;  3Q23 A;  1FJ7 A;  3FKB A;  2AYG A;  4WF9 Q;  2GHV C;  2E5L J;  4EWT A;  4CLW A;  3BYR A;  2W9C A;  3RR7 A;  2LCW A;  3EGW B;  4IQX A;  2IRY A;  4Y28 C;  2CPH A;  1U4B A;  3LP2 B;  3PZP A;  4CM2 A;  3EGZ A;  1LWX A;  3FNN A;  2QTW A;  3I0R B;  3RG6 A;  1XNQ J;  2VOP A;  2WB4 A;  5ETP A;  4HHU A;  2ZUA A;  2QIF A;  1QUP A;  3OL7 A;  3R7N B;  3H4B A;  1KLN A;  4OJH A;  3IM9 A;  4OI4 A;  3EXY A;  2VBY A;  3VAF A;  1D0E A;  1I1G A;  4DXL A;  3Q2T C;  4DR7 F;  2CQC A;  1X4C A;  1NDP A;  3FBF A;  1RAE B;  3ET6 B;  1KFS A;  4B3S F;  2QC3 A;  4KFB B;  2V4J A;  3D66 A;  4TLQ A;  2YVS A;  2WW8 A;  1M5K C;  3WQP A;  2MDA A;  4FKY A;  3MCS A;  3GFH A;  2HS4 A;  1ZYQ A;  1S6U A;  1N6Q A;  4EEY A;  1JXL A;  2M0G B;  1TKX B;  1EHW A;  1HBO B;  3M6U A;  2FLL A;  3DYA B;  1LOU A;  4LIR A;  4JV5 F;  3BM7 A;  1ZS6 A;  1UVM A;  1SKR A;  2E1R A;  1P9Y A;  4LBH A;  3OV7 A;  2C3U A;  2Q3P A;  2JC0 A;  2KL8 A;  5KG3 A;  1R8H A;  1YJ9 S;  3JQK A;  2XS7 A;  4W98 A;  4NOH A;  3ELH A;  3M2U A;  2GGP B;  3PW7 A;  3HSZ A;  2BE2 B;  2R9L A;  4LFA J;  1RTJ B;  1Q81 T;  1VLO A;  3UDC A;  2V2V A;  4EBD A;  1EET B;  3BKF A;  1Q7Y T;  2XYH B;  4CTA B;  4I7F B;  2DR8 A;  1X4F A;  1T9T A;  1KLM B;  4ES2 A;  3W8P A;  3HJV A;  1IJE B;  1RSC A;  1SH2 A;  4QIE A;  4CIO A;  3GCW P;  3GIL A;  4K59 A;  3OSN A;  1YSJ A;  1JLQ A;  2DXD A;  2X1B A;  3E51 A;  3SZ2 A;  1BMQ B;  3J81 j;  4ED3 A;  3OFE A;  3SYZ A;  2ZOM A;  2MY7 A;  2DXE A;  3JTO A;  1HI0 P;  2IAJ A;  2DPI A;  2CQ0 A;  3W5Y A;  2V8D A;  1DLO B;  5SUH A;  4LBI A;  4IFY A;  1S99 A;  1VOM A;  2WVF A;  3CD6 S;  1HW8 A;  1T9W A;  3A8E A;  3L7U A;  2HPU A;  1FRX A;  2C22 A;  1LXN A;  4ED7 A;  2LKZ A;  2VKR A;  4DDF A;  3QGP A;  3ENA A;  1TQL A;  4NLY A;  5ETN A;  4Q45 A;  4FYD A;  2ILZ A;  3HFZ B;  4ECZ A;  4ZVP B;  2ZHA A;  1J27 A;  3OTD A;  3A3N B;  1T11 A;  3TP2 A;  1IBK J;  2PMH A;  1AXQ A;  2ZJQ Q;  4GKK F;  2XG8 A;  3TUP A;  4Q0B B;  2X1A A;  4RW6 A;  4ZP8 A;  4KE5 A;  4USW A;  3UQS A;  2HRT A;  2Z2L A;  4DMZ A;  4IH6 A;  4DL2 A;  3FBB A;  4IOA Q;  4USI A;  2YQ0 A;  1WEZ A;  2XLJ A;  1WSV A;  1DTT A;  3OFH A;  1NU4 A;  3FEY B;  3M2R A;  1VHI A;  1UTA A;  4IQM A;  4RUC A;  3MEC B;  1NDL A;  3ZZ0 A;  3UDV A;  2G13 A;  2I6W A;  3GMG A;  3DCA A;  3B8H A;  1NHK L;  1RWV B;  2V69 A;  3WIV A;  1H6K X;  2BV3 A;  4BC9 A;  2XM3 A;  4E0D A;  3FQL A;  3P96 A;  4WFX A;  4OYO A;  2A18 A;  1VBX A;  4TQS A;  2GNK A;  3K5M A;  1NPK A;  1IBM F;  2KU7 A;  1Z2L A;  3VCD A;  4ZVQ B;  4J9L A;  1C1C A;  2H1Y A;  3T9Z A;  1IWG A;  1PCA A;  1QSS A;  1JKH B;  5D15 A;  3ZZP A;  2A6O A;  2K3K A;  1SPB P;  4I0W A;  1XR6 A;  4USM A;  4M5I A;  2MKC A;  1MN9 A;  2WVE A;  4CLF A;  4ELV A;  3PW2 A;  3RJM B;  1HL6 A;  2F40 A;  3V6K A;  4UY8 5;  5T7L A;  2Y1I A;  3IG1 B;  1Q8I A;  2XMU A;  4U67 Q;  1Q1K A;  2DGX A;  3KK1 A;  3KHG A;  4ZPV R;  4OYM A;  3J7A N;  3HSJ A;  2CJQ A;  3U27 A;  4ZJL A;  1RYS A;  1DAX A;  4IFV A;  4ZLL A;  1X4E A;  4ZMM A;  1NK6 A;  4JI3 J;  4ZDN A;  3AHP A;  2DHG A;  2OPS B;  3ULH A;  4Z2X A;  1DZ5 A;  2Y0S D;  3MUM P;  1B0T A;  4EBC A;  1SB6 A;  5HO4 A;  2CJ9 A;  1S1W A;  2V94 A;  4ZCI A;  4CO5 A;  1RLC L;  1LWF B;  2ZZM A;  4RR5 A;  5A6P A;  4HLB A;  2V0N A;  4FS1 A;  4JI0 F;  1QJH A;  3KTQ A;  2V6A A;  4USU A;  3MUT P;  1K1S A;  2LXI A;  3LA0 A;  2B4P A;  2HK2 A;  1T9Y A;  5KTQ A;  2R2R A;  4ICL B;  3K5P A;  2J8S A;  2HQF A;  4XIU A;  3FSY A;  2RRB A;  4L72 B;  1I94 F;  1H38 A;  1FD2 A;  2H9Z A;  1FDA A;  2AWZ A;  2CQI A;  4JI8 F;  3EZ5 A;  3W9H A;  2IDE A;  2FTR A;  5IT9 U;  2AW0 A;  4X4P A;  4RWW A;  4LR7 A;  2CVE A;  3BDE A;  3LP2 A;  3FQK A;  3ZZR A;  4JI6 F;  2GVD B;  2VA3 A;  5KFP A;  1E6V B;  1RT1 B;  1RIS A;  3NCP A;  4DX5 A;  2JEF A;  2JVO A;  5FD1 A;  5KFA A;  2UV8 G;  5K9F A;  2V67 A;  1FJE B;  1CS4 A;  4ZKA A;  3CCJ S;  4DV6 J;  2KYZ A;  1ZTT A;  2QN6 B;  1KR4 A;  1WTF A;  3A4T A;  5D78 A;  3HK2 A;  4CNZ A;  4OZN A;  2RF2 B;  2R8G A;  5KG2 A;  3CDU A;  3Q8V A;  4ZVE A;  3CDB A;  4ECT A;  2KDO A;  2AIR B;  3Q83 A;  2YWH A;  5HQL A;  3QGI A;  2R7X A;  1R6Y A;  2CA9 A;  4V19 J;  2KXH A;  2BW7 A;  2CQB A;  2DEJ A;  2RVJ A;  2BM1 A;  1QSL A;  5IXU A;  1HAR A;  1VYA A;  2VUG A;  5F8M A;  1Q5Y A;  2APO A;  2CFX A;  2HHU A;  3N6L A;  1QD1 A;  1HNZ J;  3HD1 A;  4C11 B;  4HHH A;  2QYG A;  4KGX B;  4ZVT B;  3F73 A;  3ZNU A;  4RX6 A;  2VZ9 A;  2V4Q A;  3WBZ A;  2HEK A;  2I5J A;  3VAH A;  5F8H A;  2ZM6 F;  2XGQ A;  1FCA A;  1YLX A;  5J2M B;  4H4K A;  4C9D A;  1XER A;  2BE2 A;  3RB4 A;  3VAK A;  4WFA Q;  3NWR A;  1PO6 A;  1WF0 A;  3TQE A;  4HAC A;  4IOC Q;  1EET A;  4JI1 J;  4CTA A;  2UXC J;  3B6B A;  3QT7 A;  3W8G A;  4NMX A;  2DIU A;  3M4X A;  4PEO A;  2L9W A;  1TKT B;  4LR9 A;  1YBA A;  3PTW A;  2UXD J;  4L3K A;  2DK2 A;  2ACM A;  1P6T A;  1PAU B;  2BQ3 A;  1WHW A;  2VJV A;  5J2Q A;  2VFU A;  4RUB A;  3HXM A;  2KVQ E;  1TZ0 A;  3TAP A;  3GJS B;  2X3G A;  2E7X A;  5KT6 A;  4PYA A;  4ZHR B;  5B0D A;  1DLO A;  3L9Z A;  3ZZZ A;  1QAJ A;  3BN4 A;  1WD6 A;  1H2U X;  3LAK A;  2BRL A;  1RWW B;  1PBA A;  2BJD A;  4YUD A;  3MEG B;  1KON A;  2G1H A;  2BJ3 A;  5IT4 A;  3L3C A;  2FVQ A;  3FCW A;  2FY8 A;  4OLO A;  4PXC A;  4EO8 A;  1T9X A;  2GHW A;  4K5S A;  1NDC A;  1R0A A;  3EVM A;  1ZA2 B;  2WSC C;  5IM0 A;  4FNI A;  1ZAW A;  1TVR A;  4AXI A;  5KG4 A;  2ACY A;  3K5O A;  3PJ9 A;  1Q16 B;  2GQ2 A;  4DWI A;  3GTY X;  3H5S A;  2HKE A;  2LEB A;  2L9D A;  1X9M A;  5DQI A;  3KLH A;  3E3X A;  4V1A k;  4P2X A;  3IBC B;  3AD9 C;  5KG0 A;  1PC5 A;  4USK A;  3G8T A;  3MOJ B;  3CC7 S;  1SV5 B;  1FK9 B;  4ZJQ A;  3TVZ A;  1OS5 A;  5T14 A;  2IVM A;  2Y0B B;  2DEI A;  4ZCL A;  4CLT A;  2MKH A;  4DI6 A;  4AUK A;  3ILJ A;  2AJ4 A;  2NYH A;  1RKI A;  3LGH A;  4F2R A;  3IN5 A;  1GK8 A;  3D67 A;  3ZTS A;  4OX9 J;  2IJF A;  3NEK A;  4CLP A;  2COL A;  1J5E J;  4KGK A;  4B08 A;  2LQB A;  4I67 A;  5I3U A;  2WVD A;  3OR2 B;  2N4D A;  4PRF A;  4C2M A;  3GSI A;  3HPO A;  1HBN B;  4RKU C; 
#chains in the Genus database with same CATH homology
 1RHR B;  2XYP B;  2QL5 B;  2H5I B;  2QL7 B;  2HBY B;  1IBC B;  3D6H B;  3IBF B;  4JB8 B;  1RWV B;  1QDU B;  3GJQ B;  3R7S B;  2CNO B;  1I3O B;  1RWX B;  2C2K B;  2C1E B;  2CDR B;  4ZVU B;  1QTN B;  1RHQ B;  3IBC B;  2H4W B;  4ZVP B;  1PAU B;  1RHJ B;  1RHM B;  2CJY B;  1F9E B;  1SC3 B;  3R5J B;  2H54 B;  2XYG B;  3R6L B;  2XYH B;  2QL9 B;  3GJS B;  1I51 B;  2Y0B B;  4DCP B;  4ZVO B;  2HBZ B;  1ICE B;  4LSZ B;  4ZVQ B;  3R7N B;  3EDQ B;  2QLF B;  1RE1 B;  2CNL B;  5IC4 B;  5IC6 B;  1SC4 B;  3R7B B;  1RWK B;  2H65 B;  3KJF B;  3KJN B;  2CJX B;  2DKO B;  3R6G B;  1RWW B;  2CNK B;  2Y1L B;  1RHU B;  3SIP B;  1GFW B;  1BMQ B;  4ZVT B;  2QLJ B;  3P4U B;  3NS7 B;  2C2M B;  5K20 B;  1RWN B;  3RJM B;  3D6F B;  4ZVS B;  3GJT B;  2C2Z B;  3QNW B;  1RWO B;  3D6M B;  2HBQ B;  2FQQ B;  2H48 B;  2XZD B;  3EDR B;  1RWM B;  4DCO B;  1RHK B;  3GJR B;  4ZVR B;  2P2C B;  2C2O B;  1PYO B;  3P45 B;  3KJQ B;  1RWP B;  1SC1 B;  2H51 B;  2H5J B;  2QLB B;  2HBR B;  2CNN B;  4DCJ B;  2H4Y B;  2XZT B;  1NME B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...