2NLWA

Solution structure of the rrm domain of human eukaryotic initiation factor 3b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
GDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 3 subunit 9
publication title Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nlwA01
2FC9A 3IWNC 2DNLA 3CULA 3BS9A 2KRRA 4IOAQ 3CCES 2DO0A 2DGUA 1Q81T 1URNA 2LA6A 2M70A 1VC0A 1ZZFA 1YJ9S 1HA1A 3BEGB 2DH8A 2N7CA 3CXCR 1VQ9S 3Q2SC 1G2EA 2UP1A 1VQLS 3MUTP 3CD6S 2DNOA 1KOHA 1UP1A 2KH9A 1WF0A 5H1SV 2DGTA 2DK2A 2SXLA 4LJMA 2ZJQQ 1DZ5A 5GMKa 1WI6A 2M88A 1WEYA 1N52B 3IRWP 5MLCV 3VAIA 2F9JA 2LXUA 2CPXA 3BO3A 1NO8A 2DGOA 3UCGA 1Q7YT 2I2YA 2O3DA 1QVFR 1YTYA 2MQNA 1D8ZA 3CC2S 3CCJS 1H2UX 2MQPA 1A7GE 2RU3A 2AYGA 2HGLA 2LMIA 5LJ5Y 2L41A 1WI8A 3LPYA 5IFMA 2M8DB 4PR6A 2VOPA 3CTRA 2LXIA 3HI9A 3G96A 1FJCA 2E5IA 2CQ4A 3UCUP 4TU8A 1DBDA 1X4GA 3CC4S 1YHQS 2KXFA 2JWNA 1DHMA 4EGLA 3J7YU 1L3KA 3U1MA 2N3LA 1M5VC 2YKAA 3THTA 2JX2A 2CQCA 1VQNS 1WWHA 1R8PA 1KQSR 2ERRA 4ERDA 1ZZNA 2QEXS 2DNRA 3VAFA 4ED5A 1U1NA 2VODA 4QQBA 4LIRA 2DNNA 2E5GA 3MUVP 1K73T 3RW7A 4PRFA 1WELA 4IO9Q 2KI2A 1VBZA 2MY7A 3EX7B 3CCUS 1FJ7A 2Q79A 2RRAA 3EGZA 2ZJPQ 4QU6A 1H6KX 2HVZA 2CQGA 2GO9A 1QM9A 5GADU 3S7RA 2FHOB 4WF9Q 4WFAQ 2RS8A 1M5PC 5FJ4A 4PKDB 5LJ3Y 1KD1T 3CCVS 4FXVA 4C0OC 2M4MA 4C4WA 1N54B 4V19X 2U1AA 2DGSA 1X4HA 2MPUA 2DGXA 4CH1A 3VAKA 5LSLA 1VQOS 4UQTA 2DB1A 2G4BA 2KG1A 1QVGR 3PIPQ 2DH9A 1U1QA 2ADCA 3V4MA 1VC6A 1YI2S 2DNZA 3BO4A 3FEYB 2LKZA 3EGNA 2LEBA 1SJ4P 2I38A 1WHXA 2AYBA 2J0QD 3MURP 4WFNQ 4WKRA 3DXBA 3G8SA 3UD3P 1U2FA 2MGZA 2CPHA 1SJQA 2CPFA 2ZJRQ 1X4CA 3TO8A 1HD1A 4CH0S 2YH0A 3SDEA 5HL7Q 4WCEQ 1HD0A 2MSSA 2K8GA 2CQ2A 1VBXA 5CA5A 2M7SA 1VQ8S 2XB2D 1OWXA 3J7ZT 2HYIB 1X4BA 5GAGU 1VQ4S 2PEHA 2E44A 3H2VE 1X5PA 2RNEA 3VAHA 2EVZA 3CC7S 2LCWA 1Q82T 2MZ1A 4W92B 2CQPA 2LECA 1U1LA 2NZ4A 1FHTA 1P27B 2MZRA 2J76E 2MKCA 3P6YC 1M5KC 2F9DA 5JVGQ 4ZKAA 1KC8T 3LQVA 5LXRA 2KG0A 1WHWA 2DHAA 2CPDA 2MHNA 1ZH5A 4F26A 3MI7X 3TYTA 3CCSS 3JB9k 4Y00A 3OW2R 1U6FA 1RKJA 2FC8A 1K9MT 1WG1A 2CPYA 3THPA 1S72S 2M9KA 2GHPA 3L3CA 4IUFA 2XNRA 2ADBA 3FEXB 3NNAA 2MZJA 1FNXH 4F02A 5DM7Q 4OZ0A 2LEAA 2KM8B 2VOOA 1U1KA 2OIHA 1VQKS 3UE2A 1U1RA 5GVQA 2EK6A 1K8AT 2CQBA 4QU7A 1WEXA 1VQPS 1YITS 1WHVA 1X4AA 2NLWA 2XNQA 2MQQA 3K0JA 2OTJS 5DDPC 1WG4A 2RT3A 1UAWA 4Y0FA 2QFJA 2CPIA 3SXLA 2X1FA 2VONA 4YOEA 4YUDA 1X4DA 3D2WA 2DH7A 4C7QA 2X1BA 2CJKA 2CQHA 1NJIT 3NMRA 2KXHA 2DO4A 1XN9A 3I56S 1A9NB 2KU7A 2BZ2A 1YJWS 3CMAS 5GAHU 3CCQS 3VAJA 2KRBA 4P6QA 2B0GA 2DGVA 3G9CA 1D9AA 4CIOA 1VQMS 1DRZA 1SXLA 3S8SA 1YJNS 3UD4P 4TU7A 2JVOA 3MUMP 2RUGA 1WHYA 3P3DA 1M5OC 3US5A 2CQ1A 1BY9A 4BS2A 2MKHA 4W90B 3SMZA 3MOJB 3G4SS 2HGNA 3R1LA 1M90T 1FXLA 5IM0A 2KFYA 2N82B 2DITA 2DNHA 5DDOC 2MGZB 1YIJS 2MKKA 2YWKA 2DNYA 1F9FA 1H2VZ 2MQMA 4M5DB 2MKIA 3SDEB 3CCLS 4J5OA 2DNKA 5LSOA 1JMTA 2MQLA 2MJNA 2MYFA 4QPTA 1OPIA 2MMYA 5CYJA 3N9UC 2AYMA 2AD9A 4F25A 3VAMA 2G0CA 3CMES 3ZZYA 4RU2A 2J8AA 1H2TZ 3MD1A 2DNQA 2KN4A 5DM6Q 2KHCA 2L9WA 2DNGA 5GAEU 3NNCA 2N3OA 1U1MA 2KT5A 3G71S 1WF1A 2CPZA 2DNMA 1VBYA 1U6BA 1YWXA 3BO2A 2DHGA 1VQ7S 2RVJA 2E5HA 2M0GB 2MSTA 4LMZA 1RK8A 2OSRA 5BJRA 2D9OA 2CPEA 5DDRC 1KOOA 2MXYA 1P1TA 1SJ3P 1PGZA 3TP2A 2OSQA 3G6ES 2J0SD 1UFWA 4WIIA 2D3OR 2X1AA 2CQIA 3CF5Q 2HGMA 1X5TA 2RQ4A 3MD3A 2OTLS 5IQQA 1X5SA 2K3KA 3S01A 1X4EA 1VQ6S 1R8HA 2MQOA 2DISA 2KYXA 3G8TA 3H2UB 5EN1A 1WG5A 2XS5A 1Q86T 3MDFA 5CXTA 2F3JA 2JRSA 5HO4A 2DGQA 3VF0B 3CCRS 2YH1A 2X1GA 2JVRA 2DGWA 2MB0B 2FPHX 1VQ5S 3R1HA 1WTBA 3NNHA 2WBRA 2HZCA 3NS5A 2XSFA 2CQDA 2DHXA 1U1OA 1B7FA 2MKSA 3PIOQ 2DNPA 1AUDA 2U2FA 4FXWA 3S6EA 3U1LA 2A3JA 1SJRA 1NU4A 1O0PA 2M52A 3Q2TC 2M2BA 4A8XA 1W2BR 5LXYA 1PO6A 2EK1A 2MZQA 1FO1A 2MY8A 2CQ0A 1M1KT 2V94A 2DIUA 2G1DA 5IM0B 1S79A 2L08A 3VAGA 4U67Q 1OIAA 2CPJA 1FT8A 1WF2A 2KM8C 1JJ2R 3HHNB 2RQCA 3UCZP 2XS2A 5JVHQ 2PE8A 3CCMS 4UY8T 5D78A 3CPWR 1JJHA 5DETA 2D9PA 1VC5A 1JJ4A 2RRBA 2MZTA 3P5TL 3R27A 2OJ3A 1OO0B 5DDQC 3P49B 4OZ1A 1UW4A 1X5OA 4TU9A 4Z2XA 3CUNA 1IQTA 1N8RT 3B4DA 1CVJA 2DIVA 1WEZA 2MJUA 2YTCA 3ULHA 4IOCQ 2DHSA 3VALA 1X0FA 3ZZZA 4YB1P 2AYEA 2QA4S 2LYVA 3UWTA 2KVIA 5ITHA 3I55S 2E5JA 2RS2A 1U1PA 4TLQA 4CQ1A 1FJEB 2M8HA 3NS6A 1SJFA 5D77A 2MKJA 3B4MA 2KXNB 3DLLQ 2BOPA 2CQ3A 2XS7A 1N88A 2LA4A 2MZSA 1HL6A 2FY1A 1X4FA 3MXHP 2LQ5A 4WFBQ 3RW6A
chains in the Genus database with same CATH superfamily
4QWEA 1ACMB 1FX2A 4OZ5A 5C24A 3OFGA 2B6AA 1CS4A 4OHZA 4ETZA 3BSAA 3H98A 4P7VA 4B08A 3DLGA 3PG9A 3MCOA 3IS9B 4NMLA 5EDWA 2HWTA 5FIIA 5F3TA 4C9DA 3MM9A 2RJZA 4FN5A 2X3GA 2VG5A 2ZBCA 5BYRA 4DPWA 3AA9A 4QYZK 4E2FB 2CKWA 1NK8A 1S10A 1M5VC 2YQ0A 1IKYA 3JSBA 3FCHA 2CDRB 1D9DA 1G7CB 1VRQC 3MEEB 2HVZA 4BC9A 2GO9A 2H48B 1RAJA 4QPXA 3IBWA 2ZWPA 4FXVA 1EAYC 3NGTA 2E5LF 2RH3A 1C0UA 3KKFA 4CH1A 5A8WA 4LRCA 3C14A 2LQ9A 3OQ2A 1V6HA 4NLTA 3MPUB 4DLEA 2D41A 1X4CA 5IWAJ 3QSIA 5KT5A 4IFVA 3SDEA 1IJFB 3ITHB 4WCEQ 4ITSA 4B9TA 3R6GB 1SKRA 1WOOA 4WWSA 3HSGA 1H38A 2EVZA 3CC7S 3CJ4A 2MZ1A 2VQEF 2RF2B 2NZ4A 1O5JA 3PHTA 2J0XA 3MEGA 2B56A 2J9CA 3R97A 3D0HE 3TYTA 4IG3A 1T9WA 5L1IA 4IDKA 2B5JB 3BH7B 3MFIA 3FEXB 5F8JA 3DU6A 2VOOA 2XHCA 1U1RA 3NGSA 4Q5VA 5CZXA 2RHSB 2QFJA 3QMQA 4DN9A 3SXLA 1FRIA 1WKLA 5EWFA 3JTNA 1DAXA 3IA0A 2HBYB 1HNIB 1U8SA 1N5SA 4ELUA 1GMVA 1U7LA 4DPTA 3UD4P 2YNGB 4PG5A 5M2PA 4BWMA 2PIIA 5KFGA 1Q5VA 4C6AA 4W90B 4A48A 4WYLA 4KE5A 1XWLA 4CYUA 1YIJS 5A6WA 5L1LA 2I1RA 5D4NA 3CCLS 2DNKA 4USMA 4HT7A 1SVDA 3PM9A 2MYFA 2MMYA 1IN0A 2BVZA 1FXRA 5DQIA 2NZCA 1TL7A 4PUOA 5J2MB 1R0BG 2KO1A 2KHCA 1BWVA 1S7HA 4ED3A 4LSNA 3PYFA 3PVXA 4A8SA 4QCLA 3OFEA 1JLEA 3M8YA 4HKQA 1JWWA 4PG6A 4IQMA 1R8CA 2QT7A 3W1YC 3JQJA 3TUIC 4LSLA 1SH0A 1UA0A 2L9NA 2KT2A 3V81A 4KIAA 3N5BA 4RX6A 2HNYA 2IMOA 1F5CA 1RT6B 3VQTA 5I42A 3SV4A 2DGQA 2YH1A 2JZ5A 4GC7A 2AEJA 2EFPA 1JLGB 3UD5A 3KHRA 5C25A 3SCJE 3JAMY 1LWEB 3MAAA 1DTQB 2J5AA 4EZ6A 2GIQA 1RBLA 4A8XA 1JQGA 2P6SA 2VF3A 4ZN1A 1DTTB 2PE8A 4UY8T 3N6MA 3QZ7A 3HO1A 4ID8A 1S6QB 2VC0A 2CNLB 3TI0A 3TUJC 1M0SA 3M7VA 5DZ6A 4TU9A 2C2NA 2YBVA 1VK8A 5E0OA 3AOBA 4CLLA 3DOLB 4MFBA 4RW4B 5HBMB 4USWA 2Y0BB 5HMZA 2FY1A 1X4FA 2P9EA 2BKNA 4A8MP 1ROFA 1I51B 5C42A 3CULA 4J9OA 1Q81T 4B9UA 3L09A 4K4SA 1N5TA 3TQEA 3A8IA 5L9NA 4UF4A 2J8SA 1GTEA 6FD1A 4GO7X 3J81Y 1NNDA 2HNZA 3FRYA 5KFSA 1AZSB 2UUWA 4JI3F 2HQFA 4OYOA 2C3UA 4LIWA 4WTOB 2LU2A 2QLXA 3PX0A 3R5GA 4C11A 2B8QA 5CYMB 2PT0A 1HQEA 2E5IA 4DV0J 4UQGA 2W8KA 3C6UB 2FLNA 3T1AA 1WSVA 4RO0A 4Q43A 2ERRA 3HVWA 2ZH4A 3VAFA 1IBLJ 3GV7B 3KJQB 4C2MA 2VH7A 1FD2A 4IR9A 3D5MA 3R9LA 1P8GA 3UPFA 4WF9Q 5KFWA 2V4RA 3SSRA 1L5UA 2UVRA 2A2DA 3AQOA 4P73A 3MM8A 5F0WA 5B7WA 2HK3A 1W25A 3RB0A 1RTHA 1F2GA 2CJXB 5M2UA 2QIFA 1VBXA 4ZVPB 2J7KA 3K17A 4DU7A 4ZVHA 1FKOB 4GKKJ 1JXLA 1FWLA 3AAWB 3M2VA 4CLPA 1VHIA 3OVBA 4ZVGA 3R7BB 3KLHA 3E01A 1IM6A 4GVBA 1K1SA 2WB1D 3D28A 2CG8A 3ILOA 1KVJA 2M9KA 3L3CA 3HKWA 2JOQA 1SL2A 2Y0SD 3DOMB 5LM7E 1R89A 1QAXA 2HHVA 4RW8A 4U9RA 1HMVA 1WC6A 4LF5J 1VQSA 2XNQA 3FCWA 4DQPA 3CO9A 2VU5A 2RIJA 1R27B 4LRBA 3GIRA 3D2WA 2V2QA 3J80U 4FXDA 3R7SB 4ELVA 2KU7A 1YJWS 2B0GA 1FESA 4ECZA 3ISND 3UN5A 3S8SA 1K44A 3T1YF 3I31A 3JTOA 3DN9A 2QJ3A 4NE9C 4ZPAA 1YDLA 5AXLA 1OYEA 3KYLA 5B0FA 3OTCA 2FLLA 4CM0A 3MAHA 4DQQA 3FQKA 2QLWA 1N5YA 4P75A 1IKXA 1DY3A 4LBPA 1HNVB 3RB3A 1U2RA 5K14B 3N28A 3R6LB 1VRUA 4HDGA 3G71S 2YQ1A 3OXGA 4XK8C 4QR0A 1RT4A 1KR4A 3L4BC 2WSFC 4WE1B 2FVPA 2MXYA 2I8EA 2D74B 4ECWA 4JV5J 1NK9A 1WORA 5DG8A 5F8GA 3FBEA 9ATCB 3CF5Q 4C8LA 4DSIA 2ZH9A 4E8UA 4GRSA 3I5BA 4ZVUB 1X5SA 1VQ6S 2GO8A 3G8TA 2PI4A 1F6TA 2GVDB 3ENAA 3CE8A 4OV1A 3IG1B 1U26A 1AROP 4GVLA 2ZD1B 3DGVA 4B9VA 2W2OP 3ZNUA 3NS5A 2DXDA 3D6HB 4ZP7A 1AUDA 1G6BA 2YXLA 4ZK7M 3Q23A 2XO6A 2R7UA 2M52A 1W2BR 3TRGA 3D6FB 2V94A 5CD4A 4GKKF 4RNNA 2R7TA 3CCMS 4HHUA 5DETA 1VC5A 4EBEA 2BKPA 3IXQA 1DQ9A 1UTAA 4NWBA 1EJ7L 4ER8A 2WAQD 3BBCA 3Q0AA 5IT9Y 4JV0A 2IRYA 3B4DA 3NP5A 1UVNA 2LQJA 2ZH8A 3VALA 2HHXA 2HBRB 4QIFA 2Z58B 4LSZB 1F9HA 1ZBTA 4TLQA 2IFXA 2HMIA 2M8HA 5H9FK 4I68A 3W2VA 2QTWA 4X4SA 1UJ6A 2DPJA 2CQ3A 3HVTA 3EZ5A 1MMNA 3T9ZA 1X0PA 3GZ7A 1HL6A 3KG4A 1Z4UA 2IAJA 4CZCA 2LQ5A 1BQMA 5A76A 4U6PA 2YX1A 2E7VA 4IOAQ 2DO0A 3FZ2A 3AQPA 2LA6A 3PYEA 4OFZA 3PZPA 3TW0A 3BGUA 1RWOB 1UP1A 2KH9A 4X66J 1TKZA 1MNEA 1CJKA 2ROGA 5GMKa 4QYRA 2DRBA 4X4UA 1HWUA 2VPWB 4ZCMA 3BO3A 2JFKA 3NCPA 3AOCA 1B0TA 3P5BP 4UUXA 3L7PA 2KYZA 3KJVA 2GVZB 2MQPA 2VG5B 1T9TA 3GJTB 2ZH2A 2YKNA 1SUQA 3KK1A 1O6XA 2CQ4A 1BUXA 1UWAA 2KXFA 4W98A 3G87A 3MECB 5KG6A 1VISA 5GMEA 1F3VA 5M2RA 4F0HA 1T03A 1I6JA 3PTWA 1VQNS 1U1NA 3VHQA 4WP9A 2BJDA 3TAPA 2Q6CA 5HROA 5A0YA 1SC4B 3KG1A 1J5EF 3DRRA 1CJVB 5B0EA 1C0UB 3DGPA 4TQSA 1RZMA 3SBMA 3OJUA 4OLPA 4C0OC 2ZKTA 2CADA 4DU8A 1Q8BA 4Y2CA 1T02A 2XMUA 3GP9A 4EUVA 2AP6A 3KK3A 5L8RC 2CPHA 3GR1A 1RWMB 3RZAA 1RT2A 2ZBIA 1S1WA 5IS2A 3SQGA 3RBXA 1L3UA 3NBPA 1G3OA 2V8GA 2VDHA 4UY85 4NLRA 4RW6B 5DLGA 2F7VA 4DL6A 1GXUA 4N5SA 2DHAA 3R8YA 2F4VJ 3ZTOA 1NJZA 3MMAA 1YJRA 5A8RB 3HVAA 5H9EJ 4ECTA 1Y11A 2OIHA 4A8QA 4DCOB 4K4WA 4QU7A 1NSPA 1WHVA 3M4XA 3PO4A 3M32B 3QLHA 3H5YA 1REGX 3BR8A 2DH7A 2VL1A 2C2EA 4BLGA 2YWHA 1XN9A 1YRXA 1RT7A 3CB4A 2UUTA 2VBZA 3Q22A 3FUYA 4DV3J 4ED2A 2CJQA 4X66F 1O8BA 1GTHA 3KLFA 4C8OA 3OUYB 2V4JA 3HD2A 3IAS9 3U27A 3HXMA 5KG0A 2BM0A 4JBCA 3WHIA 3GFHA 2QA2A 4IG0B 2BXJA 2VG7A 2NREA 3BN4A 4M5DA 4F25A 2BQRA 2JHEA 2KKHA 2WTFA 4B3MJ 4ED7A 2YNFA 5GAEU 1C1BB 4ZPDA 5A2QY 4DR4J 2OSRA 2K1RA 1PJ5A 5IT4A 1M5HA 1FKPA 5J2NA 2F8MA 1XNRF 1KS2A 1R6VA 4DG1A 5I42B 4MYTA 1X4EA 3IC1A 2B9WA 4OHXA 4Z7YA 2XG8A 4G3IA 2G2OA 1UEKA 3OVSA 3KHLA 1SIZA 5BYSA 3Q24A 3HX9A 4EK2A 1QE1B 1ZETA 1LW2B 1X9MA 3PX4A 1U8WA 1MU2B 2Z8QA 2P8IA 3X3UA 4DUTA 2MY8A 4WFZA 4TY8A 2VASA 3QT7A 4F3QA 2XS2A 2F4VF 2MZTA 3BGFA 4KKOA 2VBXA 3M9MB 3MPDA 1NUEA 1NH7A 2ZVSA 1X5OA 2VV5A 1MWQA 3HLUA 4MFBB 3SFUA 3TR5A 1LXNA 4EWTA 2DHHA 2UUCJ 3OTBA 2B8PA 2QA1A 1UCNA 1WC0A 4C8ZA 4KBIA 1QAJA 5HMXA 3A3NB 4DL0C 5FD1A 2QMWA 2DNLA 1K1QA 4K8RA 1O51A 8RUCA 4WFYA 4HT5A 3DHWC 2XLIA 3BR9A 4M5HA 4NLQA 4WU2A 4RL1A 1RQ0A 4LF8J 2GV1A 2OPRA 1WEYA 1OY8A 2I9SA 3EICA 4PQUA 2LXUA 1EP4A 2W2MP 4C11B 1EQ0A 1NO8A 2XI2A 1QVFR 1JLFA 1RI7A 1HWIA 1HPZA 1DURA 4USJC 4ATNA 1H72C 5ETMA 5KFRA 3G96A 4N47A 3TAMB 3SI8A 2VKRA 4JP8A 3MTKA 4G1PA 1RAGB 1L3KA 2HG4A 4A8YA 2Y8YA 2JX2A 4HACA 5EWGA 1KQSR 4DR4F 2DNRA 2PMZD 3RW7A 2HFZA 4PPDA 1VBZA 1GMWD 1JXVA 4ZP8A 1NSAA 1QM9A 2BBEA 4OJHA 3FKBA 4LF2A 2M4MA 4CO1A 4OI4A 5LSRA 1OYDA 3MGJA 1KDNA 2GMJA 2ZE2A 5LSLA 2DB1A 2FIUA 2G4BA 3KMSA 1FJGF 1H7XA 2DNZA 3M8SA 4HH0A 2QLBB 3EGNA 4AQYJ 2K2PA 2R7OA 2PGCA 4ED8A 2G9OA 2HHTA 1HHTP 1VR6A 4ECVA 4IRDA 4KJIA 1FRKA 2GGPA 1YZ7A 3AB2B 3PYGA 3J7ZT 1VQ4S 2C42A 4M63A 3OL8A 1Q82T 3H5SA 1U6ZA 2HAIA 2IA6A 1P27B 2MZRA 1XMQJ 3SV3A 1RHKB 4YHHF 3HSJA 1S0OA 3OSPA 4NXNJ 3O6QA 3CD5A 4OI3A 3ILJA 2FC8A 5A8KA 2YNIA 1WG1A 1NKEA 2V6AA 3W64A 5FDLB 2HNDA 1HMVB 3JSMA 4IUFA 1Q8LA 1N6QA 4O3QA 1EX8A 1FNXH 3MR2A 4DPUA 3VCDA 1VQKS 3UE2A 3I4HX 4Y2MA 2E1PA 1RBAA 2BE9B 1DFDA 4PWUA 5G0RA 3DLEA 3ILLA 4ILRA 2YWFA 1UVJA 2ASLA 2CJKA 2X1BA 3MM5A 3RYLA 4I1TA 4LVOP 2NS1B 1NJXA 2CZ4A 2IMWP 3LPEA 1RTIB 3G9CA 1D9AA 1RB0A 4TU7A 2CG4A 2W2QP 3SQOP 4LF8F 2CQ1A 3D1OA 1P9QC 2HWIA 1T3OA 5IM0A 4U8YA 5F8HA 2R9LA 5GAHI 3V6HA 4C97A 2ILYA 2IIHA 1T9VA 4YB7A 4J5OA 4USKA 3D0IE 2W7AA 1G4CA 2BW2A 1QAYA 4OI1A 2UXCJ 1P1LA 2AYMA 4KFBB 3KLIB 4FPIA 3QIDA 5KFJA 5B0AA 3NNCA 1QSSA 2C1EB 1NCLA 1NRKA 4RW7A 3W9JA 1FKAF 2DHGA 1WD6A 3MM7B 2YX4A 5F9LA 2NR0A 2AZ1A 4Y2IA 1UEVA 2DD8S 2Z0GA 3R5AA 3J7A1 5KT4A 2E9TA 3QATA 4M94A 2AGOA 4HH1A 3DRPB 1SJ1A 3ZZUA 2JLEA 5DQGA 2A1BA 1Q86T 4MK7A 1EB0A 4NASA 2X1GA 5KOWA 4DUYF 4LFCJ 3HM9A 2HQDA 4YR2A 2ZKUA 4CO3A 3VGVA 2MKSA 3D9BA 3IWXA 1QUVA 4NI2A 1NDLA 2MZQA 3OTDA 1T11A 3OV7A 3BB5A 3W65A 4O0NA 2RAQA 3M05A 4O4RA 1NPPA 4HLBA 4NXNF 1JJ2R 2EWHA 1NEEA 2GFFA 1NM2A 3LWLA 2OFHX 3W66A 2YKMA 2EC0A 5AE1A 2QG9B 4B3TJ 4OYXA 4B3OB 3UNGC 4IOCQ 3AD7C 3MEDA 3IM9A 1PC5A 4OZJA 2RS2A 4H54A 4JI2J 1LW0A 1XMBA 1MSWD 1HKAA 8AT1B 5KG3A 2C2KB 3DKDA 1Q0NA 4IH7A 4BDPA 1CJKB 5C5JA 5J2QA 3CD6S 3OL9A 3JSRA 1KLMA 5H1SV 4R8UB 3Q86A 1UETA 1BWEA 4NCGA 3IFEA 3OT9A 3BREA 2YPZA 4KHPF 4Q0BA 3I6PA 4PABA 3CD0A 1RISA 2UXCF 5T14A 1F2HA 1OJ4A 1QUPA 1T03B 4EGLA 2VBYA 3KMQA 2CVIA 3GR0A 4YDDB 1TFYA 5E41A 2YKAA 3H2LA 1R0CB 1XEZA 2VODA 4LIRA 2VPXB 3JQMA 1KNZA 1H6KX 2CDQA 4OI0A 5LMNJ 1RWKB 2YNHB 1C0TA 4N7TA 2KFNA 3M9OB 2VUGA 4PKDB 5LJ3Y 3CCVS 2UVVA 3SCIE 4NEZA 2W8LA 2BJ3A 2HS4A 1XR6A 4DWIA 1OS5A 1IBKJ 4UQTA 1BE4A 1R31A 2JSXA 3ZZ0A 4LFCF 1LK7A 4WFNQ 2OEMA 3M8QA 3O3LA 3GTYX 2DRDA 3SQGB 3LGNA 3ZZOA 2VQFJ 1HD0A 2CQ2A 5B08A 4TKTA 1DLOB 1IWAA 4ENOA 1BC6A 1JK9B 5GAGU 2QMUB 4ZLLA 2FYXA 4USTA 1NSKL 2O01C 3O44A 5HP1A 4IH5A 1E6VB 3M2UA 4FNIA 2VIHA 5JVGQ 5LXRA 1UJ5A 4B3TF 3PFOA 4FVMA 3CGIA 3QAEA 4DSFA 1ZA2B 1S1VA 5D3GB 1U0HB 2HEKA 2CPYA 2FGOA 5C2CA 4AXJA 5DM7Q 1UFKA 4PEOA 1U1KA 3I96A 2JLGA 3QLHB 2WVDA 3G86A 4X4VA 1Q4RA 5GVQA 3IN5A 1HR0F 3DM2A 2NLWA 3HSDA 1S6PB 4KAIA 2HVDA 2HQGA 4DCJB 1JKHB 2XZDB 4HHHA 4C7QA 3HZGA 4FDFA 2KXHA 1RTDB 3QNWB 4P9SA 3W7BA 1FRJA 4NLPA 2JVOA 2OPPA 1XNQF 4KHRA 3WBZA 1TVRA 3V6DB 5I3UA 2R2RA 4F67A 2H4WB 3R1LA 2AHOB 2N82B 3W2WB 4JI5F 1LKZA 4M5DB 3DLHA 3L7UA 1UZHA 2AU0A 1MG7A 2YKPA 1TL1B 3ET6B 1N33J 4CH7A 1RYRA 4QIGA 3OXFA 5IQ6A 1IKWA 3B78A 4KH0B 1A0OB 2Y9HA 4EYIB 4EZ9A 4MH8A 1U0SA 2POKA 2N7YA 3BSOA 1VBYA 5J2NB 3GYGA 2LU1A 4FVCA 1PGZA 3TP2A 4E0DA 3PRDA 4DG1B 5LMNF 1VOMA 4WIIA 3JSYA 3BQ1A 2HGMA 4RUAA 1Y7PA 1R8HA 1IBKF 2GAHC 2J6SA 3BPDA 1CULB 3AXKA 5KTQA 1HBUA 4ZPTR 2CQDA 3AB4B 3IS9A 1UMJA 2ZOMA 4FYXB 3WZ0A 2GCFA 3CCZA 2BV3A 2NUUG 1Q78A 4NLDA 4FYYB 1SJRA 3AJ1A 3SZ2A 5ETTA 5KG2A 4CLZA 3IGNA 2XLKA 3EZUA 4B9NA 4FNHA 4GKJJ 2KM8C 2FHJA 5D78A 2RRBA 4RWXA 4DX6A 3P49B 2L3MA 3N5FA 2FJXA 3POTA 1D09B 5KFDA 3MEEA 1JX4A 2LQBA 2YTCA 1FDBA 1FRMA 3U02A 2B9EA 4DV7J 4C3MA 2BOPA 1PSDA 3RU0A 3GIIA 4C8MA 2X7IA 4AXIA 1SQGA 3FZBA 4QIEA 2LFVA 4C0BA 3RW6A 4OYMA 4M5MA 3CCES 3HSZA 2WK4A 3L95X 3BEGB 3J7AN 3ENWA 2VA2A 1G2EA 2IJFA 3EMTA 3ITHA 5AXMA 3VGSA 4K4XA 1QTNB 1WKKA 5KFYA 5J1EB 2DCLA 1T05B 1W26A 2RF2A 4ZVQB 2ZBRA 4NYPA 2XMJA 4HTIA 2RU3A 5LJ5Y 3EYZA 1N33F 2M8DB 3CJKB 4PR6A 5D4PA 1Y00A 2B5JA 1FJCA 4I2QB 4ILMA 4RR5A 5D0EA 4N41A 4JI1J 2BANB 4MTPA 4CNYA 4NRTA 1ZZNA 3RRKA 2QEXS 4ERDA 4CRJA 3D66A 3QRPA 4PYDA 2HSEB 4G65A 3CCUS 2Q79A 3EGZA 2ZJPQ 2J9EA 3TA1A 4U96A 3NWRA 1HNIA 3BKFA 4WFAQ 2RS8A 5ETRA 5HJYA 4ED0A 2BE2B 3OTOJ 1BGXT 1LWCB 2YNGA 1QVGR 1RAOA 5AE2A 1EARA 3BGRA 3RRGA 1RDRA 2LP4A 1TZ0A 1SJ4P 3PJWA 1VS3A 4F3OA 2VICA 1RWXB 3RTVA 3RUBL 5ETPA 3LF0A 2BRKA 1T95A 2K06A 1V5VA 2OO4A 4FS1A 1FWKA 3M1VA 1X4BA 1TK0A 3H2VE 3GB0A 5J2MA 4LF4J 4KO0A 4C3KA 1N56A 5DG9A 3PNIA 3HK2A 3R3TA 4RZRA 4DUZJ 4NLWA 4ECUA 3KLGB 2HNDB 1B0PA 3HKZD 1GMUA 4RJVA 3F0NA 5DGBA 4UZBA 3CDWA 4DBQA 2PDAA 2Z30B 3QGIA 3ONQA 4DV7F 4RW9B 4C8NA 5BR8J 4U7UD 1M5SA 3K0JA 2VA3A 3MM5B 3AHPA 5KFQA 4PZVA 4L3NA 2IRXA 4M5IA 1RT6A 4F4WA 2WONA 2D69A 4NXMJ 1RXOB 1JLGA 3EZOA 1MWYA 5LMUJ 5KFEA 2R2TA 1DRZA 3HT0A 3LOUA 4WZMA 4I0WA 1YJNS 1LWEA 1DTQA 4KB7A 5DJBA 5KFKA 1BY9A 1WACA 1XJWB 1YKWA 1JLCB 2QGFB 2VJUA 5I3QA 3ENVA 2BA9A 1P9YA 1RA6A 2V50A 5AT1B 4K4TA 2O1PA 1TMMA 2AEFA 3GFZA 4C98A 2XY6A 5KFUA 2RDDA 3D4JA 4MKVA 3NAHA 2W7PA 4RW7B 4WYWA 4X4PA 2LVWA 1YGYA 2J8AA 3TZXA 4RBTA 2XYGB 2L9WA 1WF1A 3GCXP 1X9SA 2DR9A 1YWXA 3DOLA 4UOGA 1U02A 4RW4A 4FKXA 5HBMA 1AB8A 5HVGA 2UXBJ 2DKOB 2CJYB 2QN6B 3DDNA 3CMQA 1BQNB 2HS3A 5KFIA 5J2PB 4F36A 2VC1A 1GEHA 1KQFB 3VVTA 1JNZB 3OTOF 2RQ4A 2XY7A 2OTLS 5B0DA 3D67A 4CM2A 3ETOA 2G0JA 4AE5A 1AZSA 2DGWA 1VQ5S 1R8BA 2WZ1A 3HZEA 4CT8A 4CCHA 3U1LA 1RWWB 2OPSB 2AGPA 1NU4A 2YKQA 5CYMA 5CAAA 4J9RA 4LF4F 1IVZA 3IWLA 3QT6A 1WC1A 2DBBA 2CNNB 4LF1A 3UCZP 3HHLD 4IR1A 4Y2KA 3CCWA 1NK0A 5IOLA 1U25A 2AF6A 2EKYA 4N8OA 1IQTA 1KWMA 1CVJA 7FDRA 4I64A 5KFNA 1WEZA 1X0FA 2LYVA 5BR8F 3I55S 4JI4J 1N88A 1FDAA 1IBCB 2H9ZA 1U09A 4LT6A 3GG0A 4NXMF 4CO0A 3DRSB 2J7WA 2F65A 3B54A 3UDCA 1BHNA 3CXCR 5MAOA 3HPOA 4PG8A 5E3PA 3MUTP 2ZC4A 2HHUA 3H5UA 1RHUB 4M5LA 3CVKA 1WF0A 1Y5IB 4ZHRB 3FFIB 2MKYA 2HFOA 2VHGA 3RR7A 3FSYA 4OIXA 4FF4A 2R8KA 1FKOA 5CCLA 1J27A 2Z57B 2MQNA 3R5JB 2XSJB 1YRTA 2YPYA 2LMIA 4USIA 4ZJQA 2L41A 3NGRA 4ECRA 2VOPA 3WQPA 2Y1LB 2FHMA 1DBDA 2JDJA 1DHMA 4DFPA 3DOMA 3SCLE 4FF3A 4M5KA 2UXBF 1WELA 3MR6A 1RAEB 1J2VA 3ISNC 5KFAA 1FJ7A 4O3OA 3UN3A 2FD2A 2WVCA 3D54A 1F3FA 1LOUA 2C22A 2OD4A 1UPMB 1RKIA 2CIMA 1YBTA 3GYNA 3TUZC 2ZH6A 3CT9A 2B7CB 2RE1A 2Z2YB 3GYXB 1SJQA 4F0MA 4CLWA 2IM3A 4R25A 2BACA 3Q8YA 1VRTA 1Y5LB 1VQ8S 2RKIA 1HNVA 3H7HB 2LCWA 5AJ3J 4W92B 5K14A 3RB4A 4DL3A 3LW5C 2PEBA 4NZ7A 4YS2A 4K50A 1PYSB 4QYZJ 1EZZB 4QWBA 1RSCA 2O5DA 2W9BB 5EUHA 2A6MA 1ZAVA 2QSWA 5DQHA 3UDVA 4RKUC 3FK4A 2FJBB 4JI4F 1ZA1B 3PEHA 2R2SA 3BYPA 2GVDA 4WP8A 2Y3YA 2OHDA 4LRFA 1HHQA 2ZD1A 4HI2A 4Y3CA 2WBMA 2A18A 2CWKA 3ZNJ1 1Y5NB 3A8EA 1VQMS 1TVRB 2DEJA 4OZ2A 1C1CB 3P3DA 1I5OB 1YJUA 2VQEJ 4K4VA 2HGNA 4NLOA 1NK6A 4LREA 3K89A 3MCNA 1VQYA 3WC2A 2MQMA 2RILA 5CCMA 4WTYA 1JMTA 3D3CJ 1JB0C 5CYJA 4QIWD 1MLAA 2C3OA 4J9UE 4J9QA 1FF2A 2HLUA 1HYSB 2A6OA 2UUBF 1S77D 4OZ3A 2AIRB 4DFMA 2M0GB 5BJRA 2J6TA 3C19A 1TP7A 2WSCC 4NA2A 2OSQA 3OTEA 3T5JA 4KTQA 4KGKA 2FZGB 2COLA 2D3OR 4HEA9 2AZ3A 1T3NA 2GIFA 1HBNB 2AJQA 1TU0B 5IQQA 3TOQA 4DQIA 2DISA 4FS2A 3H2UB 3N0VA 1KVIA 1HBUB 2XS5A 1FK9A 3GG1A 5L39A 2F3JA 3TAQA 1M1GA 2HVEA 3PXGa 3BGOP 2WBRA 2HFSA 4P10A 3DCAA 2GVZA 2PMWA 4QWDA 5T7LA 1RHRB 2MLZA 1D8YA 2PD1A 3D7SB 4TLRA 3HP6A 4ILLA 2CQ0A 5AJ3F 2O67A 3KWMA 3QAUA 3EGVA 3VAGA 2R8HA 3MECA 2R3VA 3NRBA 4R0EA 3POTB 1CC8A 2FZCB 1UFLA 3P5TL 4X84A 1B7YB 2DCUB 3U1NA 5J1NA 3WIVA 4RBUA 3WIUA 2ROPA 1CJVA 4G1QB 5IV3A 2F8HA 1DQ8A 4ZMMA 1CEZA 4LUBA 2E5JA 2ILZA 3S1TA 1SJFA 1Y10A 3HFKA 1UW9A 4NEYA 4QR2A 2RMLA 3MXHP 4IRCA 2V8DA 4PG4A 3TJAA 5ETVA 2AJ4A 4J9SA 4QW9A 3PYDA 4DR1F 2DRAA 1Y9OA 4DV2J 1S1UB 2MDAA 2DK2A 3OBIA 2ZJQQ 1UL3A 3IRWP 4NPOA 1UA1A 4RW6A 1N48A 1QSLA 4ANCA 1YTYA 2OGUA 3FBCA 5EX3A 3FNNA 2CWXA 2HW3A 1GMWA 5A8RA 1TKXA 3UQSA 1X4GA 1N32J 3DLKB 9RUBA 2JWNA 1SV5B 3U1MA 1FA0A 4ZVSB 4F8RA 2C3MA 4OLOA 4FF1A 4ZP6A 5KFPA 4HYKA 1L3VA 3M32A 3PW5A 2MHEA 4PXCA 4UOFA 4E98A 1KD1T 2JEGA 4F04B 4MKBA 3BGRB 4DSKA 4MAKA 2B4PA 2MLYA 5JMNA 1Y3KA 4WPAA 5BXIA 4JV2A 2B9XA 4JI3J 3H90A 2H4YB 2QE5A 3OUYA 2KJVA 2BEFA 5CD4H 3M1VB 4ID5B 4HI1A 3K5OA 1OMSA 5LL6d 4IG0A 4QZVB 1EQMA 4KO0B 2FGCA 5ETKA 3I82A 3DLJA 4Z37A 4DL2A 4LR9A 4AT1B 2PEHA 3JS9A 1FNMA 1RACB 4LF9J 2CQPA 5B09A 2E66A 1C1BA 2J76E 4ZPCA 1M5KC 1TK8A 3LQVA 2KG0A 1HBOB 1KQGB 5KT3A 2R8JA 5E3AA 3OFHA 1SC3B 2XNRA 3SIPB 4Q8FA 3O8WA 2KJWA 1VQPS 1D1UA 2AEMA 2WONB 3TJ8A 4KGZB 3O1LA 4YUDA 4RWWA 5IZHA 2CQHA 2IVYA 4YR0A 2ZITA 1QE1A 4A8FA 1VI7A 4A4JA 1LW2A 3FGVA 5KFBA 3MEKA 1GNKA 1QD1A 1MU2A 4OX8A 4DV2F 1RT5B 5AE3A 3OSNA 1RLCL 3ZTQA 4MKYA 1U49A 5KT7A 2VKZG 3GQCA 1M90T 1FXLA 2LQ8A 5SUHA 2XULA 5DDOC 2MGZB 2EKNA 5C7PA 4Y28C 3BH6B 3EPIA 4NZ6A 4QJVA 1C4CA 3G82B 4ZCKA 1QDUB 2V8HA 3ZTSA 3M8RA 3VV2B 3N79A 1NHKL 2XTJP 4PCQA 3FC9A 1N32F 3VAMA 2KN4A 4DR7J 1V3RA 4IYQA 2PO4A 3BSNA 3MR3A 4K4YA 1SBRA 2OMLA 2C2DA 4Y65A 2XWXA 1LQ9A 5HI7A 3W5YA 2Q6BA 4EFAC 4F4ZA 3D1QA 4MIWA 1UWBB 1ZS6A 2DR7A 3EDQB 2IA0A 2ALYB 3T1YJ 2AWZA 4EO6A 2PA8D 4A8KA 2JRSA 2I0XA 2QRRA 3KK2B 4LF7J 2G2YA 2UUAF 1S76D 2Q3PA 2L9DA 2JEIA 2RU9A 2P6TA 2GJ2A 3H42A 2PA3A 4LF9F 3K58A 5DO2A 1RBOB 3A3OB 3TAMA 3ZFVA 2CRLA 2L08A 5KG4A 1OIAA 2CPJA 4DCPB 5FLXU 5KFLA 1ULRA 3TZWA 3M8PB 4PYAA 2YQ3A 2QL5B 2Z2ZA 2VG6A 1FRHA 3KDNA 4B17A 3ILIA 3EVMA 1N8RT 2QA4S 1NPKA 3SFGA 3A8JA 1N4LA 4K5RA 2XZTB 1U45A 2FLOA 3AH6A 2H1YA 3R7NB 3TWZA 2DVIA 3GJRB 1LFPA 2FC9A 3BS9A 2V68A 2IVFB 1SQFA 2XGQA 3QJPA 2GJIA 2M70A 1VC0A 3LP1B 2YWWA 2XCPA 1CJUB 1Y4ZB 3AY0A 3T6JA 2W4DA 3MMCA 1ZAWA 4DDFA 5EWEA 3I0SB 4XO0A 2F9JA 1Q95G 3CDEA 4CLKA 3OFFA 4M5GA 1RT3B 4NCBA 5HQ8A 1KTQA 1Q53A 3LUYA 4DV4F 2ZVIA 1PJ6A 3W9HA 1B64A 3K8VA 2FZKB 5FDLA 4DR7F 3UCUP 2BRLA 3TJ9A 2V67A 1DJ0A 4ZPVR 4ZJLA 1RT1B 1R8PA 2PN6A 3MMJA 4QQBA 1NJYA 2HFUA 3VZIA 3CO0P 4DS4A 4HR2A 3W63A 5H9FJ 5GADU 1CQMA 4O3RA 3CJSA 5KFMA 1AUSL 4I56A 2WVFA 1RTIA 3DFEA 5I4MA 1S9GB 2XYHB 1K0TA 1I3OB 4LF7F 4TYAA 1WHXA 2J0QD 1S0MA 1REVB 3E2EA 2YX7A 3UD3P 2Z2MA 2FHKA 4B3SJ 1VRTB 3TEGA 3KHHA 1EETB 2RKIB 2NXNA 4C3LA 2K8GA 2M7SA 1MN9A 3QFHA 3PW2A 4MJKA 1D0EA 3M8WA 4KFBA 3KLIA 1FDDA 4BCAA 2PFFB 1QTMA 1BLUA 4IRKA 2O66A 4HDHA 4ZKAA 1S99A 1ZAXA 1S0VA 1J5EJ 3MM7A 4CP5A 4H4MA 4F26A 4KY3A 4Y00A 1YJ7A 1Z2ZA 3MPYA 2W9AA 2OELA 1ZOTA 5ETQA 4AD6A 1CPZA 3RAXA 1IM4A 1S9EB 3PV8A 3VZHA 2IJRA 2DYAA 3N6NA 2CQBA 3VQSA 4LR7A 2OH2A 2B4UA 3DRPA 1XERA 4QIVA 2BDPA 3QFWA 3C15B 1VDHA 2OAUA 1OQ3A 3SEOA 3R5DA 4ZLJA 2C2RA 2DO4A 3VGTA 3CMAS 4PG7A 4N8NA 4P6QA 1HNZF 5GMDA 2VPZB 1YBAA 5T41A 4B9MA 1S5ZA 3KLEB 1JLAB 1Q16B 2HAFA 1H3DA 1YX2A 3TUPA 4UUWA 4ZDNA 4O3SA 1RADB 2G13A 3K5PA 4ALZA 6FDRA 1NLKL 1U4BA 3C16B 2ZM6J 2XC9A 2ZHAA 2AW0A 2VDIA 3ZZYA 1R0AB 5DM6Q 4B3OA 1KSPA 2H5JB 4PAAA 1NB2A 3NWGA 3RAMA 2R42A 4GO5X 1XIQA 1N36J 2VZ9A 1I94F 1F9EB 4I7FB 2XWYA 4ZITA 1FK9B 2ZEJA 1X5TA 1CJTB 1TL3A 3DRYA 4LRDA 2V8VA 1RP5A 4OI6A 5CXTA 3FBBA 2BJ7A 5CHCB 5L9XA 4I2PA 4R8UA 3V4IA 1NPRA 4B3SF 1S6OA 3KJFB 4DJBA 5T7LB 2C3YA 4ZS6A 4HL9A 4CLYA 1TKTA 1SH3A 3KUEA 3GSIA 3BBFA 3MPVA 1R6YA 4J9MA 1W2IA 2OFGX 3AXMA 1SIWB 4DV5F 4PXEA 1FE4A 4ANEA 2KB2A 2VFUA 2FVSA 1KEKA 3DI6B 4CLUA 4DFJA 2RQCA 1KHVA 1NB7A 5HJXA 2XI3A 5CH7B 1OO0B 3NGUA 4Q2LA 4OZ1A 1XNRJ 2HQ3A 4KPYA 2F63A 2AT1B 2ZHOA 3BQ2A 4C8KA 3CUNA 1YRUA 2YNHA 1Z2LA 2XCAA 2E1AA 3OVAA 4NYOA 1FJEB 5D77A 2J6UA 5GADI 4CO4A 4P2XA 1OY9A 4A46A 1HIYA 1I1GA 2R7XA 4P71A 1VMBA 4WFBQ 2RDJA 1PAUB 1HA1A 2OLWA 4M95A 3GCWP 1DLOA 3QIPB 4ZP9A 1HW8A 1DZ5A 3I5AA 3DOKA 1SC6A 3RG6A 4FF2A 6AT1B 3UR0A 4U7UK 2O3DA 4O3NA 1E6VA 4AFFA 2HHQA 2ZM6F 1TKXB 1RUSA 1H2UX 1GAOA 2ZNZA 1CQNA 1WI8A 3NCQA 4P74A 3D3BJ 3A12A 5KG1A 5D3GA 1U0HA 2OEJA 5I3PA 4M1KA 1N0UA 2BYCA 3UVJB 3JAMU 5CQGA 3CC4S 1YHQS 3KNGA 2VJVA 4ZOSA 4OYPA 2KL8A 3PX6A 3J80Y 2DNNA 3ADAC 3GV8B 1N36F 1S6PA 3TZYA 1GFWB 1CC7A 1VLOA 3KNAA 1JKHA 4B3RJ 1HNXF 5F41A 2WW4A 1M5PC 2IBKA 1RTDA 2AJ1A 1RTJB 2OPQB 1LWXA 3IR6B 1OQ6A 1CBKA 1CG2A 1DQAA 2U1AA 2QL9B 2DXFA 2EEYA 3WX4A 2KG1A 3PIPQ 2ADCA 2LKZA 3V6DA 2NYIA 3MURP 4WKRA 1IQZA 3W2WA 4AUKA 3PEJA 1Q5YA 2ZHBA 1YLXA 4NLYA 4K2XA 2UU9J 1YSJA 3T1HF 2C3PA 3DYAA 2WW8A 2BJEA 3GILA 1TL1A 3ET6A 1C4AA 1TUVA 3PHEA 3TVZA 3J81U 2XYPB 2V0NA 4X4OA 2H5IB 1WHWA 4HVZA 3FSXA 2FB0A 1K9MT 1VBKA 3QWPA 2PSZA 4J91A 4N77A 1NMEB 3KXDA 3JQKA 1CSJA 5DGAA 3M6XA 2W9CB 4JYAF 1JLQB 4DR5J 3EUNA 3CIZA 1FJGJ 3BSCA 4OHYA 2RUSA 4UTGA 5DDPC 3MR5A 1TMJA 1HWKA 2CPIA 1CULA 3HULA 1WOSA 1FTCA 3ICLA 1NJIT 4QWAA 3FBFA 5JJBA 3FSIA 3I56S 3CCTA 3MOZA 2VD3A 5GAHU 4R5PB 2V34A 1KTVA 1Y0HA 4DX8H 2XLJA 2WRMA 4FYVB 1WDDA 1M5OC 3I0RB 4DXLA 4EBDA 2XY5A 1S7IA 3SMZA 1X7VA 4YHHJ 5E3QA 2I5JB 2JLFA 5K20B 2DNHA 3A1YG 5KG5A 2ZH7A 2XGPA 2MJNA 3F44A 3TA0A 3N9UC 2IVMA 4OZNA 2BX6A 8ATCB 1LXJA 4Y2AA 4J7CA 3CJ8A 2NSCA 3IRXB 1Q8KA 4QBUA 4FBUA 1UPPA 2HHWA 5DDRC 1KOOA 4M8LA 3W8PA 4DMZA 3G2XA 4B3RF 1P1TA 4IFYB 2HZVA 2RSQA 2BW7A 5CYQB 3LH2S 3HVRA 1HLWA 4J9LA 1S57A 1GQEA 2ZWOA 1WG5A 1C2PA 3FCVA 2JEFA 4ZPWR 2JVRA 5J1EA 3R1HA 1T05A 5DLFA 3JYTB 4I6AA 2HZCA 2D3UA 2UU9F 4DN0A 3OL7A 3HHLA 2DNPA 4LBIA 1VLYA 3S6EA 1SC1B 4J9VA 4F0KA 2A3JA 4X65J 3CJKA 4ELTA 3GFXA 3K2YA 4YEAA 4XDDA 2M2BA 2F1FA 2EK1A 1RAFB 2PMHA 4I2QA 1RLDA 2DIUA 5DZ7A 1FXDA 1S1TB 2VG6B 1WC3A 3FVYA 1FT8A 2BANA 4CDIA 2LEPA 1HHSA 4OMFG 4LBHA 2CZVC 1VIOA 3QGPA 3TVKA 5DS7A 5DDQC 1UW4A 1LWFA 5F9NA 2ZNYA 2DIVA 2MJUA 1Q7LB 1S97A 4YB1P 4DR5F 4EO8A 3GJQB 1FX4A 1UVMA 3EVOA 2BE2A 2MKJA 4QWCA 1FWPA 2OI2A 1LWCA 2LA4A 1U47A 4DUYJ 1NDPA 3Q8PB 3T3FA 2E9ZA 3MPWA 1H7WA 2KRRA 4J37A 3R5BA 2DGUA 3MMCB 1Y3JA 3KG0A 4FPRA 1NDCA 4F7VA 1VQ9S 4PXBA 4F4XA 4D3GA 4KGMA 1VIXA 1JLBB 4A8WA 2SXLA 3D0GE 1WI6A 2XBPA 4NL5A 3CD7A 5KAKA 3VAIA 4DL5A 5HVFA 4B02A 5D0HA 3QO9B 3UCGA 1Q7YT 4USUA 1D8ZA 5K9FA 3KLGA 1A7GE 2AYGA 2HGLA 5IWAF 1LK5A 3HI9A 5K5MA 1HWLA 4TU8A 3EWGA 3C66A 1E6YB 3THTA 1VK3A 4RW9A 4FZVA 4HTJA 1WWHA 4ED5A 1U48A 3V5RA 4PRFA 4XPCA 4H4OA 2NQPA 4DF4A 2Q43A 2A2CA 4ZJOA 3A4TA 1SKSA 4KYZA 5FJ4A 3UI3A 5IT9U 3B6BA 3LP2B 4V19X 2MPUA 3I4PA 4WXWA 4EEYA 1SKWA 2FHJD 3CEDA 3HHEA 4NLUA 4ANDA 1RWVB 5D0GA 3OR1B 3V4MA 3W5XA 2FJDB 5K8OA 1JLCA 1MMDA 4KHPJ 2B4OA 2CPFA 1PKUA 3V6KA 1U24A 4RNHA 4X65F 1G1XA 5JXSA 4ICLB 4J9PA 3QPIA 1UEUA 1KHWA 2RNEA 2A10A 2JC0A 3D68A 3MMBB 3A3PB 2DTJA 4H4MB 2FDNA 1IBMJ 3OLBA 2VFRA 4G1IA 1QLNA 4OL8A 1S48A 1X31C 2EW9A 3I5CA 3H4DA 3QJJA 4NLGA 3Q8UA 2HHPA 4WIQA 4OHWA 4TYBA 3K5MA 2V2ZA 3PJ9A 1Q79A 1RKJA 1U6FA 4BHQA 3QYYA 3B82A 5K8PA 1BQNA 5J2PA 3NOGA 4DSLA 2MLXA 1PAEX 3K59A 4O44B 3U7JA 2W01A 3V6JA 4Y6IA 1S6UA 2XMWA 3WC0A 4L72B 2OTJS 4P52A 4QOTA 2X1FA 2ZOGA 5F8LA 3NMRA 1TKDA 1YZ6A 5IT0A 3C6TB 3OD2A 3VAJA 4B9LA 1MROB 1OSCA 3R5CA 4ETXA 4K0KJ 2DGVA 2IDEA 3T9NA 4CIOA 3GIKA 4P2FA 3DMJB 3HHLC 4YMEA 3CW2C 2OPSA 2AMCB 3HJFA 4ZVRB 3US5A 5HMYA 4CO2A 4BS2A 4LR8A 3N4WA 1LNQA 2DY1A 4K2JA 3QGGA 3BDEA 5LSOA 1S49A 2MQLA 1FDNA 3I87A 4NX9A 1OPIA 1LV5A 2BMBA 1RA7A 4MT1A 4F50A 3IBCB 2XMAA 3PDNA 2IC3A 4QR1A 1HR0J 4I6WA 2J9DA 4MMOA 1VQ7S 4CTAB 2D9OA 2H54B 2EC2A 4RNMA 5HLFB 4PWDB 1SJ3P 3CIMA 1TL3B 1V9OA 3C46A 1PYTA 3DRSA 2CQIA 2WVEA 1RCXB 2HURA 1PILA 2BJ9A 1XNQJ 3S01A 4I2PB 2MQOA 4BC7A 3V4IB 3IO1A 1NHUA 1NAQA 4IOBA 4UOHA 4ZHRA 3FFIA 2EFOA 3NXZA 4JI5J 3D1HA 3CCRS 3TQ1A 1TKTB 3KFWX 1FERA 2DHXA 5E3CA 2XSJA 1RAIB 4KHMA 2CFXA 4LFBJ 4YDXA 3H20A 1O0PA 3OR2B 2HK2A 3LALA 1S79A 1YJVA 1IBMF 2DEIA 2FVCA 2EI5A 1T9XA 3D6MB 2D3O1 2H3EB 2OUGA 1S4FA 4CNZA 1KFSA 1NZAA 4KV8B 4NLVA 4URSA 2W2PP 4MKAA 1V3ZA 3MR7A 4DV0F 4YQWA 2ZH5A 2CNOB 2CJAA 5IXUA 2BJ1A 2FJWA 2XS7A 1IR0A 3CJRA 4Q8EA 3GLJA 1IBLF 4DSJA 4Y34A 3SCKE 5A2QU 1L3SA 2ATLA 3QBCA 4LF6J 4YP3A 4OZLA 4K0KF 4L73A 1S1XB 3BPSP 2IYIA 1UJ4A 3GU0A 4ZLNA 1YJ9S 1AA1B 3SSSA 2DH8A 1R3NA 1Z1ZA 3DOKB 2YY3A 2DNOA 4KH1B 5D4LA 4DQRA 4IO1A 3IMQJ 4ED4A 5LT5A 2DGOA 2I2YA 1APSA 3G6XA 3QGHA 2PC6A 2BKOA 4RU9A 2UV8G 5KFFA 2ZH1A 5EGYA 3LPYA 4O4GB 4KPCA 2Z4PA 1HQ2A 4CO5A 2HHSA 2W9BA 4DPYA 1PCAA 3UN2A 1HQUB 4ZIWA 1LFWA 3M30B 4DL4A 4DX7A 4KR0B 3GV5B 2GC8A 4LFAJ 4LVNP 3WX8A 3JTPA 3S7RA 4EI2A 3OPKA 3PFEA 1RHJB 3X1LB 2QSFA 2X3DA 1NZ8A 2DGXA 3EDRB 4UW2A 2LDIA 1C1CA 4LF5F 3T6BA 3M2RB 5KFHA 1WJ9A 3PO5A 2R7VA 2GA7A 2AYBA 2Y1RI 3PR5B 4K5SA 5C24B 3DYAB 1RWNB 5K8NA 4RUCA 4JI0J 2B6AB 4W4MA 2HVHA 4CH0S 4LFBF 4UOCA 2MSSA 1CS4B 1TTHB 4FYDA 1XTZA 2C2OB 2HYIB 1YK9A 1B70B 1HYSA 3DLGB 3BGLA 3NMAA 2R8IA 2LECA 1U1LA 3CWJA 2V4QA 1RGVA 2HFNA 2EFVA 3MM9B 3K57A 4Z7CA 3OW2R 4OX9J 2JFDA 3AODA 5L46A 2D7SA 4L3KA 5LOQA 2MZJA 5IC6B 1LEOA 2RB7A 4RNOA 1PBUA 1HBNA 3M8ZA 1IKYB 3HHDA 2ASJA 2HRUA 1YITS 4DQSA 3MFHA 1F1BB 2RT3A 2VONA 2WB4A 3W9IA 4NZ0A 4LF6F 4ES1A 1PIEA 4JV5F 1A9NB 3LAKA 1KKHA 2XM3A 3AT1B 1SXLA 4X4QA 5A8WB 3C14B 5B0CA 2BE7D 3ZZTA 3NAIA 1ZPWX 2GQQA 3MOJB 3F41A 1NH8A 2ZFHA 4ZVFA 3ZTRA 3Q8SB 4DV6J 2P9GA 2GX8A 4TXSA 4OQJA 4OJGA 3GIMA 4NCAA 4IFVB 2MKIA 3SDEB 2EBEA 3R2DJ 2ZZMA 1IXKA 3FJ2A 4NLSA 1MMLA 1HW9A 3CMES 4G1QA 1RCOB 3AJDA 2DNQA 3LAMA 5RUBA 2N3OA 2ACMA 5D6GA 3MEGB 3Q8QB 5A6PA 1SL1A 3H0PA 4LFAF 2ZDPA 3KUGA 4IG3B 3OHBA 1L3TA 4IDKB 3NS7B 4J90A 5JUMA 2J0SD 1VJQA 1UKUA 1UFWA 1HI8A 3TANA 3LA0A 4USHA 3AOAA 2J0WA 3G6VA 2APOA 2DR6A 3HCXA 1CLFA 5HK4A 3PY8A 4P2SA 1S1UA 3VTIA 2AKWB 3Q8VA 2HZAA 3HHLB 5F0UA 1RABB 3BN7A 1TELA 2FPHX 1RE1B 4O0IA 4JI0F 3CJTA 1KP6A 1MWZA 2ZZNA 3Q89A 1B7FA 3CJ3A 2U2FA 1VGYA 2W4CA 2ROEA 4X4TA 1FO1A 1AXQA 4U95A 3DLKA 1GXLA 4CYUB 1SV5A 1LWFB 2D9PA 4NMXA 3QWUA 4OX9F 1NK5A 1UZDA 3KDOA 2JEJA 4Z2XA 1TL7B 1VJWA 4PUOB 3RAQA 3ULHA 2DHSA 3ZZZA 2AYEA 3UWTA 5SZTA 5ADZA 4LSNB 4DX5A 4XIUA 2KXNB 1JLEB 4OJ1A 2JH3A 1FEEA 2W1BA 2JNJA 4V1Ak 3T5HA 1IKVA 4FYWB 4LSLB 2UV8A 4DPOA 1URNA 4ID5A 4MK8A 3V81B 2N7CA 3Q2SC 1A6LA 2UP1A 2HNYB 1VQLS 3FMBA 1J5OA 4ZVOB 5HATA 2DGTA 3ZXWA 4DOZA 4CLFA 2M88A 2QYCA 4DV6F 4I69A 3W5ZA 3QZ8A 5C25B 3RBDA 3CCJS 4OHVA 3PCOB 1FI4A 1HBOA 3DU5A 3MAAB 5IFMA 3JXOA 3EPGA 1WTFA 2B9YA 1FE0A 1URRA 2W2NP 3BJYA 1WC4A 3TX8A 5D4OA 2MTLA 2JC1A 4H4OB 2CQCA 5ETLA 1HNWJ 1KN6A 3GE9A 3CJQA 5H9EK 1K73T 5F3ZA 2KTQA 5C2GA 2RRNA 1OY6A 2QMXA 2ASYA 2QLJB 2FHOB 4DZ6A 1RTZA 3C2PA 3O2IA 2BUNA 4WJBA 1X4HA 3QRQA 2R7WA 5CABA 4EBCA 4ZIVA 1RT5A 4NA1A 1VC6A 3T19A 3MZIA 3OLAA 4YY3J 2CUYA 5C42B 1YG0A 3DXBA 2X51A 1FNOA 2N4DA 4ZLPA 2MGZA 3ISZA 2ZJRQ 2YKOA 2C2ZB 2AX0A 1HBMA 2KZMA 3G82A 2W24A 4DV3F 5CA5A 3I9ZA 4F4AA 2HNZB 3UDLA 4DV1J 4QW8A 4OI2A 3VAHA 5DRKA 4DSEA 3BZQA 3W8GA 4ED1A 3KJNB 2QLFB 3P6YC 2WHOA 2Z56B 3G8QA 1KC8T 1HFEL 2CPDA 2ATCB 2MHNA 1ZH5A 3CCSS 4DPXA 1HQEB 2WSEC 3HJVA 4OZ0A 2BQUA 1TAUA 3OXLA 1T9UA 1UWBA 2DR5A 2EBGA 4B3MF 4NYZA 2AQ4A 1FFWB 4NRUA 4KC5A 1H98A 1WG4A 3RR8A 4RPFA 1AW0A 4FKYA 4WK1A 2LXFA 2CAJA 1T7PA 3KK2A 1EHWA 5ETNA 3CCQS 1TR0A 3HF5A 1VCTA 4U8VA 1IUJA 2DXEA 4EU0A 2V9KA 3MM8B 4ZCIA 3DNCA 2V69A 3M6WA 2MKHA 3A13A 3LGMA 2KFYA 2DITA 1RTHB 2V8PA 2QFIA 2K7KA 2MKKA 2NYHA 4J9NA 1H2VZ 3RBZA 5IC4B 3M8PA 3NCRA 2NSBA 3AD9C 2IC3B 4JI7J 2MEWA 3PRVA 3QT8A 4BWJA 3G6YA 4JV1A 4RU2A 2OMOA 2XZWA 4Q2MA 2CZ9A 2ZBPA 1U1MA 1HNWF 4A47A 1GX6A 3M2VB 2DNMA 4ES3A 1BMQB 3KLHB 4LMZA 2MSTA 3E01B 1XMOJ 4I67A 2OKQA 4GVBB 3MTJA 5KOXA 1RAHB 3KHGA 2GAGC 4IKAA 3PKYA 5GAEI 2C2MB 2X1AA 3OHAA 1TQLA 2V9WA 4RW8B 3LP1A 2ZOFA 3C3LA 4XPEA 1CJUA 2FQQB 2UUCF 3CJ0A 4YY3F 3ELHA 2K3IA 3I0SA 4YFUA 2UVUA 4OJ3A 1RT3A 3RJMB 1U1OA 4L75A 2E29A 1VFJA 1GXTA 5KFOA 4DV1F 1Q8IA 1YVFA 1XK8A 3Q2TC 4F4KA 3DHXA 5LXYA 2UUBJ 3AFGA 1WNEA 5IV4A 5ETSA 2WOMA 3QRRA 3KLVA 3BDPA 2B3TB 1WF2A 4P72A 1RT1A 3EGWB 2W4PA 1IR1A 1N5YB 3PACA 1IKXB 1HARA 2UVWA 2IM0A 1PG5B 3LP0A 4FP9A 2QZ8A 2HS0A 1K0VA 4WU3A 1VRUB 1U1PA 3K5LA 4CQ1A 2GQ2A 1RT4B 1YBUA 3B4MA 2MQ8A 4KRWA 3QT5A 1S9GA 1SB6A 3IR5B 2CNKB 2QC3A 5D0RA 3NLCA 1RJJA 2IRUA 4OYBA 4DR3J 1REVA 2B51A 4Q7AA 2HKEA 3OJSA 3RBEA 3GONA 1ZZFA 1EETA 5CZVA 4OX7A 3F73A 1X60A 1FVSA 4CLSA 2Q1LA 3PW7A 4JI8J 1KOHA 3VWSA 1F5AA 1QJHA 1HI0P 4PXDA 1SQEA 2UXDJ 2AJ0A 1TL5A 3GPAA 2NXUA 4AQYF 2LLZA 3EXYA 1DARA 3W62A 2P9CA 3KTQA 2QV6A 2RDIA 3LANA 5E3RA 4JI7F 3CDUA 3CTRA 3HD1A 2D1CA 1ITPA 1BXNA 2XMKA 1S9EA 2N3LA 1AYEA 3L7OA 1AFIA 4TN2A 3GFYA 1XMOF 1GX5A 1XMQF 4IO9Q 4AYBD 2RQMA 3C15A 1ZM2A 1SH2A 4D3HA 1H73A 3R2CJ 4QU6A 3FMWA 1P6TA 5HQLA 4DR1J 3BM7A 1WOPA 3NY0A 2HMIB 2FTRA 4ZA1A 2CA9A 3W2VB 4ZVTB 1FRXA 3HVTB 3KLEA 1JLAA 2FVQA 2IAJB 1YI2S 1BQMB 3FEYB 2LEBA 3G8SA 2HLTA 2KZZA 2GMHA 4ZCLA 4TNOA 4ECYA 3DXSX 4KGXB 1M1HA 2F4FA 2GNKA 1HD1A 4V19J 3C16A 3D6TB 4F3MA 4TVAB 1OWXA 3MHYA 1TKZB 2GHWA 1RHMB 2PFDA 1T94A 1R0AA 3W3SA 3BKUA 1FHTA 4MIAA 1KVKA 3KJVB 2B43A 4ECSA 2F9DA 4DR6J 2G2ZA 3M9NB 4YR3A 2YKNB 3MI7X 2ZZTA 3JB9k 3DDKA 1SUQB 3KK1B 2R2UA 3THPA 1F60B 4ECXA 3IGVA 2ZUAA 2DPIA 4I7FA 2RQKA 3MWBA 4M5NA 5U47A 3GIJA 1NKCA 1WEXA 1CJTA 1ZPVA 2ALZA 3N6LA 5HROB 5A0YB 1KFDA 3DRRB 3E8OA 2JJ4D 4DR3F 3DGPB 1R7IA 2EFQA 2HIQA 2VFTA 4DFKA 2GHVC 3CDBA 4PQAA 3UR3C 2E1CA 3I32A 3M6VA 3DRXA 3ZZPA 4F2SA 2QYGA 4JI8F 1WHYA 3UO0A 1IR2A 3G4SS 2UXDF 2HBQB 4NOHA 3A8KA 3KK3B 2P2CB 2EFGA 3CDAA 2VFSA 3DI6A 1ZYQA 2AX1A 3BYRA 3I9V9 5F8IA 4FBTA 1N0VC 1RT2B 3HMJG 2IBOA 4QPTA 1S1WB 1NK4A 4DS5A 5THWA 1NXIA 2HIYA 4XAKA 3NBPB 4OX6A 3MD1A 3H25A 1FVQA 1TUWA 2DNGA 5L1JA 1V3SA 3BKTA 2OP5A 2IM1A 2KVQE 1MN7A 2B4VA 2WCXA 2E5HA 2WVBA 1RK8A 1VYAA 4PWWA 3MMAB 2ABYA 3NGDA 4HHJA 2DT9A 4H4KA 4JI6J 3MD3A 2K3KA 4NLXA 2G1HA 3RRHA 4JI2F 2CVEA 3QIPA 1NBEB 3GJSB 2XQCA 3SSQA 1B99A 1RT7B 1WSRA 3NNHA 1FRLA 2H5EA 2FY8A 4L76A 3OL6A 4UT4A 1ICEB 2HQCA 1KRPA 4IH6A 3VVUA 3KLFB 4OYWA 4YB5A 2V4JB 1FFGB 3TX0A 3UVJA 2A0FB 3T41A 2JL9A 3N01A 5E5NA 1NKBA 3UDEA 3GWCA 4DR6F 5D15A 2VG7B 1AT1B 1SCJB 2OJ3A 3HFZB 5B0GA 4DEZA 1TFWA 2HRYA 4ZVEA 2HVIA 3PW4A 3EVWA 2YNFB 1RTJA 2OPQA 1TUGB 1QSYA 3NS6A 1IKVB 3ZZRA 1TV6A 2K1RB 3DLLQ 1PYOB 3UFCX 3O5TB 1T9YA 2UUAJ 1FKPB 2R7RA 4K4ZA 3MM6A 3IBFB 2F40A 1J5OB 3H4BA 2FJEB 2I6WA 2AGQA 5K8MA 2GQCA 5G4DA 5ETOA 4LJMA 4LQ9A 1N52B 2G0IA 1FFSB 4F2RA 5MLCV 2CPXA 2H51B 2XMVA 1SI9A 1KQKA 1QY7A 1F5BA 1N34J 4B9SA 3CC2S 3ZO7A 2R4FA 4MYUA 2LXIA 2RD5C 3FQLA 2P5VA 2VQFF 4R0JA 1RYSA 3H59A 3QQCD 4TY8B 3J7Z5 1OPZA 2VPYB 2IY5B 4DF8A 1MW7A 2W9CA 1JLQA 2V2VA 2IHR1 4KKOB 2BABA 2H65B 1UVLA 4ES2A 4DR2J 2MY7A 7FD1A 4JI6F 5KG7A 1PC4A 2IM2A 1WKJA 5E7OB 2ZDOA 2E7WA 4WKYA 4RNFA 4X64J 1Q1KA 4R5PA 5F8NA 1PBAA 3B8HA 1H74A 2Q66A 3MAQA 4L6V3 3K7RA 4TQRA 3VAKA 1VQOS 1TK5A 3I0RA 2DH9A 2YWGA 3FDSA 1HBMB 2I38A 3LTOA 3TZZA 5EX0A 2I5JA 4WZQA 4DV4J 3VR1A 3KOAA 4OYAA 2YH0A 5HL7Q 1NK7A 3LGHA 1W7WA 2YVSA 3K5NA 3UW1A 1T8EA 2QO3A 3CSKA 2OPRB 5F8MA 3HFVA 3PR4A 3EJMA 4PQUB 1EP4B 1S59A 4O3PA 3IRXA 1XR5A 1JLFB 2W7OA 2MKCA 3IP0A 4OV6A 2DY9A 1HPZB 3GMGA 3BQ0A 3T5LA 2J7UA 3DDIA 5GAGI 3GSDA 2AJFE 1QAIA 4H4KC 2ADBA 1X8DA 4IFYA 4F02A 1F0XA 2LEAA 1ZM3A 5CYQA 1B0VA 1N5QA 3WDOA 2EK6A 4HACB 2NCKL 5HVHA 4IQXA 1X4AA 4AL5A 3H8YA 2MQQA 1EIYB 2E1RA 1UAWA 3SYZA 1XBWA 3MF5A 4YB6A 4YOEA 2E1MC 1ZM4A 2R7QA 2IJNA 4WXOA 3JYTA 3AA8A 2HHHJ 2GMLA 1YQHA 1D9FA 2ZE2B 3MUMP 2RUGA 2Y8WA 2EPIA 4AL6A 2OD6A 2ZUGA 2HFVA 3FEZA 1JXEA 4A8OA 1S1TA 2FLPA 4JB8B 1N34F 3AD8C 3T5KA 1S9FA 2XEXA 4K7QA 4CLTA 4C0HA 2GGPB 2EFNA 2QX0A 3TNVA 1R8AA 1VHFA 5KT6A 4WFXA 2G0CA 3P4UB 4M5JA 2Z2LA 2QL7B 4S0MA 2F5GA 2KT5A 4TY9A 2CPZA 3BO2A 1B4SA 4GKJF 4DR2F 3HDSA 5AXKA 5A8KB 4ECQA 2YNIB 3JSMB 4CT9A 1HNZJ 4X64F 1N6QB 2BJ8A 4ZPBA 1RWPB 1SKUB 2N4CA 4RUHA 4YN3B 3IM8A 2IDLA 2KYXA 3BF4A 5G0RB 3DLEB 5KFZA 2B7BB 4I4BA 1JLBA 5HO4A 4KT0C 3EXCX 5KFTA 2MB0B 1TL4A 3PKMA 3QO9A 4WBFA 5J1PA 3PIOQ 1FEHA 4FXWA 2KDOA 2J9DE 5HSPA 4O23A 1S0NA 4X4NA 2WOMB 5EHHA 4I6YA 3HT3A 3C8YA 5IM0B 2NPFA 1E6YA 4U67Q 4PPZA 1GH8A 3HHNB 1V5IB 3CNQP 1S12A 1FD8A 1JJ4A 1I94J 2L48A 1HI1A 3LP0B 2BOAA 2FJVA 3R27A 1DTTA 1ZM9A 4DZDA 1PJ7A 1S6QA 3ZTPA 2IPOB 2KVIA 1OSDA 2K7JA 4JI1F 2UZAA 3LP2A 2Y1JA 3PRBA 1JJCB 4USVA 1KBRA 2DJWA 3TA2A 3OR1A 1WUUA 4C48A 1RU2A 5KFCA 3KUHA 5HAOA 3IWNC 1WDTA 1K47A 1S4EA 2HHHF 1B3TA 2W25A 2CJBA 3EM1A 4X4RA 2LDYA 4UZCA 1BQXA 4DV5J 4ICLA 3J81j 1ZTTA 2FVRA 2CJ9A 4WK3A 4X62J 3QSYB 1WC5A 3MMBA 1H0HB 4AL7A 3Q8RB 2E9RX 2HBZB 4KSEB 4OYIA 4NI2B 5D8HB 3F56A 4DHVA 1GK8A 3P8BB 2NXCA 2NPIA 4DL7A 4N76A 5KT2A 3LWMA 4F4YA 3J7YU 3ZC4A 1XC9A 4BBYA 4O44A 2NUHA 2YKMB 2E5GA 4ZN3A 3MUVP 3ENQA 1XQIA 3C6UA 2KI2A 2VFVA 4DUZF 3EX7B 2RRAA 2GS8A 2CQGA 2XMTA 1NJWA 2HRTA 3MEDB 2PI5A 1IJEB 4GMKA 3C6TA 1MROA 4C4WA 1N54B 5L1KA 2DGSA 1LW0B 1SPBP 3DMJA 4P2MA 3VGUA 4URGA 1U2CA 4EMDA 1U1QA 2M3DA 3BO4A 4CI0B 4WP3A 3K8WA 1IWGA 4KGVB 4JUZA 1U2FA 2OEKA 3TO8A 1UVIA 2E7XA 1KLNA 5J2QB 4EYHB 5E33A 5LMUF 3AJ2A 5HANA 1KLMB 2XB2D 1FTRA 2AV5A 3W61A 2E44A 3L9ZA 1X5PA 3LO3A 4NCGB 3V2UC 4GC6A 3H5XA 3IR7B 2V63A 4Q0BB 3Q83A 4ED6A 4CTAA 2IYGA 2M5YA 1HNXJ 5HLFA 4PWDA 1S72S 2GHPA 4N56A 2XHWA 3NNAA 4XDCA 2KM8B 2FJAB 5KFVA 1K8AT 1HWJA 2R8GA 1JNRB 2BQ3A 1ZTWA 4Y0FA 3FRZA 2Y1IA 1AFJA 4OYZA 1RU1A 5HQMA 1X4DA 4G6VB 4J9KA 2HWHA 1NSQA 1EKSA 2FUG9 1C0TB 2BZ2A 5HMWA 3MCSA 3RB6A 2KRBA 2GZOA 3T1HJ 2EG2A 2KT3A 4XTTA 5HN0A 2GJFA 4RUBA 2QA4G 3CJ2A 3OR2A 2V5HG 5FLXY 4X62F 2NXEA 4K4UA 4KQZA 3M8QB 3MCMA 1EKRA 2F8EX 1YJTA 2YWKA 2DNYA 4JOUA 1F9FA 4U7CA 2HPUA 3E51A 1NHVA 4X2BA 1UVKA 4C8YA 3NL0A 3UNYA 5KFXA 2V2KA 5L38A 1T0TV 3P96A 3E3XA 3QJLA 3P45B 4P7TA 4KV8A 2ZH3A 1JIHA 2AD9A 1KONA 1RHQB 4JYAJ 1H2TZ 4L74A 3DC2A 5HP1B 3M2UB 3EE3A 1U6BA 3ETMA 2RVJA 1RWUA 2GW8A 3NGKA 4DLGA 3M6UA 2CPEA 2BR0A 1S1VB 2C28A 3TVYA 4DI6A 1BD6A 3G6ES 1N5VA 2EG1A 1SL0A 3CJ5A 3W60A 4WE1A 2ZBQA 3PJXA 2XO7A 3BBBA 1S1XA 1TAQA 5DG7A 3NG8A 2YWEA 3DM2B 3HHKA 2E5LJ 3THVA 5EN1A 4LQ3A 4Q45A 3MDFA 3BV8A 2NXJA 3VF0B 1XR7A 2ACYA 5BYQA 2KFZA 2VBWA 4NA3A 2BM1A 1WTBA 2GIRA 3NEKA 2XSFA 3IG1A 2DR8A 4MK9A 3H40A 2CXEA 2EXUA 4CWBA 2D3ZA 3TARA 2CYYA 3DLBA 4O4GA 4RLEA 2OPPB 1PO6A 3TEHB 5I3UB 1M1KT 2G1DA 1HQUA 4K59A 2R7SA 3M30A 5AXNA 2ASDA 5JVHQ 3CPWR 1JJHA 5E2QA 2KHDA 1ELOA 3J7YI 2RHQB 3NKYA 1GT8A 4Q44A 1IKWB 7AT1B 1D3WA 1R43A 1TV6B 5ITHA 3PW0A 2XMMA 2ZC3A 3MM6B 1NDKA 2AJ2A 2HQIA 5B0BA 2VB6A 1X9WA 1FCAA 3IAM9 4URQU 1RAAB 3NOCA 3RGIA 4RBVA 4MIBA 3M2RA 2MZSA 4LRAA
chains in the Genus database with same CATH topology
2FC9A 4QWEA 3BS9A 2IVFB 4LSLB 4OZ5A 2UV8A 5C24A 2XGQA 3OFGA 3QJPA 4DPOA 1URNA 2B6AA 2GJIA 2M70A 1VC0A 4ID5A 3LP1B 4MK8A 3V81B 4IH7A 4BDPA 2N7CA 3Q2SC 1A6LA 2UP1A 2HNYB 2XCPA 1VQLS 5C5JA 3FMBA 5J2QA 3CD6S 1J5OA 1Y4ZB 3AY0A 4OHZA 3T6JA 2W4DA 3MMCA 3OL9A 3JSRA 4ETZA 1KLMA 1ZAWA 5H1SV 2DGTA 3BSAA 4DDFA 5EWEA 4DOZA 3H98A 2M88A 4P7VA 4B08A 3I0SB 2QYCA 4R8UB 4XO0A 4I69A 4DV6F 2F9JA 1UETA 3DLGA 1BWEA 4NCGA 3IFEA 3CDEA 3QZ8A 3OFFA 1RT3B 4NCBA 3BREA 5C25B 3IS9B 5HQ8A 1KTQA 1Q53A 4NMLA 4KHPF 3RBDA 3LUYA 4Q0BA 3CCJS 4DV4F 5EDWA 2HWTA 3I6PA 4OHVA 1HBOA 3DU5A 5FIIA 5F3TA 4C9DA 1SKWA 3MM9A 5IFMA 3CD0A 2RJZA 1RISA 2UXCF 5T14A 3EPGA 1WTFA 1QUPA 2B9YA 1T03B 1FE0A 1B64A 3K8VA 5FDLA 4DR7F 4FN5A 3UCUP 2X3GA 2VG5A 2ZBCA 5BYRA 2BRLA 3AA9A 1URRA 2CKWA 3BJYA 3TX8A 1NK8A 4EGLA 2VBYA 3KMQA 2CVIA 3GR0A 4YDDB 5D4OA 1TFYA 1DJ0A 5E41A 4ZPVR 1S10A 1RT1B 1M5VC 2YKAA 3H2LA 2JC1A 4H4OB 2CQCA 1IKYA 1R8PA 1KN6A 3GE9A 1XEZA 2PN6A 3MMJA 2VODA 4QQBA 3JSBA 3FCHA 4LIRA 1NJYA 3VZIA 1K73T 1D9DA 5F3ZA 2KTQA 2RRNA 2VPXB 4DS4A 1G7CB 2QMXA 1KNZA 3MEEB 1H6KX 2ASYA 2HVZA 2CDQA 4BC9A 4OI0A 2GO9A 5H9FJ 5GADU 1CQMA 4O3RA 2FHOB 5KFMA 2YNHB 1C0TA 1RAJA 2KFNA 4QPXA 3M9OB 2VUGA 4PKDB 5LJ3Y 3C2PA 3IBWA 3O2IA 2BUNA 4I56A 3CCVS 4FXVA 2UVVA 1RTIA 3DFEA 2E5LF 3SCIE 2W8LA 2RH3A 1C0UA 4WJBA 3KKFA 1X4HA 2R7WA 5I4MA 4EBCA 4CH1A 2HS4A 5A8WA 1XR6A 4DWIA 1RT5A 1OS5A 1S9GB 4UQTA 1K0TA 1R31A 4NA1A 2JSXA 1VC6A 4LF7F 3T19A 3MZIA 2LQ9A 3OLAA 3ZZ0A 4TYAA 1WHXA 2J0QD 5C42B 1LK7A 4LFCF 3OQ2A 1YG0A 1V6HA 4NLTA 4WFNQ 1REVB 3DXBA 1S0MA 3M8QA 3E2EA 2X51A 2YX7A 2Z2MA 1FNOA 3O3LA 2N4DA 4DLEA 3UD3P 2FHKA 4ZLPA 2MGZA 1VRTB 2D41A 3ISZA 2ZJRQ 1X4CA 2YKOA 3KHHA 3SQGB 1EETB 2AX0A 5KT5A 1HBMA 2KZMA 3LGNA 4IFVA 3SDEA 2RKIB 1IJFB 3ZZOA 3ITHB 4C3LA 2W24A 4WCEQ 4ITSA 1HD0A 2K8GA 2CQ2A 4B9TA 4DV3F 5B08A 4TKTA 1DLOB 5CA5A 2M7SA 1BC6A 1JK9B 3PW2A 3I9ZA 2HNZB 3UDLA 1SKRA 4QW8A 5GAGU 4MJKA 4OI2A 1D0EA 4KFBA 3VAHA 1H38A 2EVZA 5DRKA 3CC7S 3KLIA 4DSEA 1FDDA 4BCAA 3CJ4A 2MZ1A 2VQEF 2PFFB 3BZQA 4NCAA 2RF2B 1QTMA 4ED1A 2NZ4A 2O01C 3O44A 1BLUA 5HP1A 1O5JA 4IRKA 4IH5A 1E6VB 3M2UA 2O66A 2J0XA 3MEGA 4FNIA 2B56A 3P6YC 2WHOA 4HDHA 3G8QA 5JVGQ 4ZKAA 1KC8T 5LXRA 1S99A 2J9CA 1ZAXA 3D0HE 1UJ5A 1S0VA 4B3TF 1HFEL 3MM7A 3PFOA 2CPDA 4H4MA 2MHNA 3CGIA 3QAEA 4FVMA 3TYTA 4F26A 4IG3A 3CCSS 4DSFA 5L1IA 4Y00A 4IDKA 2B5JB 1S1VA 5D3GB 1ZH5A 1Z2ZA 1HQEB 3MPYA 2W9AA 2CPYA 1ZOTA 3MFIA 2FGOA 2WSEC 3FEXB 5F8JA 4AXJA 1CPZA 3DU6A 4OZ0A 5DM7Q 2BQUA 2VOOA 1TAUA 3OXLA 1IM4A 1S9EB 3I96A 1UWBA 3RAXA 1U1KA 2JLGA 3PV8A 3QLHB 3VZHA 2DR5A 4X4VA 3G86A 2EBGA 1Q4RA 3N6NA 5GVQA 3IN5A 1U1RA 2CQBA 3VQSA 4B3MF 2OH2A 2B4UA 4NYZA 3DRPA 4Q5VA 2AQ4A 1XERA 1HR0F 3DM2A 2NLWA 4NRUA 4KC5A 4QIVA 1S6PB 2BDPA 5CZXA 1H98A 1WG4A 4KAIA 3RR8A 2QFJA 3QMQA 1AW0A 4DN9A 3SXLA 4WK1A 2LXFA 1FRIA 1T7PA 2OAUA 1JKHB 3KK2A 5EWFA 3JTNA 1DAXA 4C7QA 3HZGA 3IA0A 1OQ3A 3SEOA 1HNIB 3R5DA 2C2RA 2KXHA 1U8SA 2DO4A 1RTDB 1N5SA 3CMAS 4PG7A 3CCQS 1TR0A 3HF5A 4N8NA 4P6QA 1HNZF 2VPZB 3W7BA 1FRJA 1YBAA 5T41A 4ELUA 4B9MA 1U7LA 3UD4P 2YNGB 4NLPA 2JVOA 4PG5A 5M2PA 3KLEB 1JLAB 1IUJA 2OPPA 4EU0A 4BWMA 2V9KA 1Q16B 1XNQF 1H3DA 3MM8B 4ZCIA 2PIIA 4KHRA 5KFGA 3WBZA 3DNCA 1TVRA 3M6WA 2MKHA 3V6DB 4UUWA 2R2RA 5I3UA 4W90B 4F67A 4A48A 4WYLA 3R1LA 3LGMA 4KE5A 1XWLA 2KFYA 4ZDNA 4O3SA 2N82B 2DITA 1RTHB 3W2WB 1YIJS 2G13A 2K7KA 3K5PA 5A6WA 2MKKA 4JI5F 4J9NA 5L1LA 4ALZA 1LKZA 1H2VZ 6FDRA 4M5DB 2I1RA 5D4NA 3CCLS 2DNKA 3M8PA 1U4BA 3DLHA 4HT7A 3NCRA 2NSBA 2AU0A 3PM9A 2IC3B 2YKPA 2MYFA 2XC9A 2ZHAA 1TL1B 2MMYA 1IN0A 2BVZA 1FXRA 4CH7A 5DQIA 1RYRA 4BWJA 3G6YA 4QIGA 2AW0A 3OXFA 4PUOA 5J2MB 3ZZYA 1R0AB 4RU2A 4JV1A 5IQ6A 2OMOA 1IKWA 2KO1A 2XZWA 3B78A 4Q2MA 5DM6Q 4B3OA 2KHCA 1KSPA 4EYIB 4EZ9A 1S7HA 4MH8A 1U1MA 1HNWF 4A47A 3NWGA 2POKA 1GX6A 2N7YA 3M2VB 3BSOA 4ED3A 2DNMA 4LSNA 3RAMA 1VBYA 5J2NB 3PVXA 4ES3A 4A8SA 4QCLA 3KLHB 2LU1A 3OFEA 4LMZA 1JLEA 2MSTA 3E01B 4HKQA 4I67A 4GO5X 1JWWA 2OKQA 3MTJA 5KOXA 2VZ9A 4PG6A 1I94F 4FVCA 4IQMA 1PGZA 1R8CA 2QT7A 3TP2A 4E0DA 3KHGA 3PRDA 4DG1B 5LMNF 1VOMA 3TUIC 4I7FB 4IKAA 2XWYA 4WIIA 3PKYA 3JSYA 4LSLA 5GAEI 2X1AA 1SH0A 3BQ1A 2HGMA 1FK9B 3OHAA 1X5TA 1TQLA 1UA0A 2V9WA 4RW8B 2L9NA 2KT2A 4RUAA 3LP1A 3V81A 4KIAA 1TL3A 3DRYA 3N5BA 1Y7PA 4RX6A 2V8VA 2ZOFA 1R8HA 2HNYA 1IBKF 3C3LA 4XPEA 2IMOA 1RP5A 2UUCF 2J6SA 1F5CA 4OI6A 1RT6B 3VQTA 5I42A 5CXTA 3CJ0A 4YY3F 3SV4A 5CHCB 2DGQA 5L9XA 4I2PA 2K3IA 5KTQA 3I0SA 2YH1A 4R8UA 3V4IA 4YFUA 4B3SF 2JZ5A 1S6OA 1HBUA 4DJBA 4ZPTR 4GC7A 2UVUA 2EFPA 5T7LB 1JLGB 4OJ3A 3KHRA 1RT3A 2C3YA 5C25A 2CQDA 3AB4B 3IS9A 1UMJA 2ZOMA 4ZS6A 4HL9A 3SCJE 1U1OA 3WZ0A 2GCFA 3CCZA 2BV3A 1TKTA 1SH3A 3JAMY 2NUUG 1LWEB 1Q78A 2E29A 1DTQB 1VFJA 4NLDA 2J5AA