2NLWA

Solution structure of the rrm domain of human eukaryotic initiation factor 3b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
GDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 3 subunit 9
publication title Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 17
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nlwA01
1M90T 1S72S 1P27B 2FPHX 2DNHA 2DNZA 3SXLA 5CYJA 3SDEA 1X4AA 2FHOB 2MQQA 2MKHA 3CCSS 2MGZA 1YHQS 3RW7A 2KFYA 2L9WA 5BJRA 4Z2XA 3L3CA 2MQMA 3Q2TC 2KRRA 1S79A 1X5SA 2OSRA 3N9UC 3CMAS 1WF1A 2PE8A 3I56S 2DH7A 5HL7Q 1K9MT 1VQNS 2M7SA 3G8TA 4F26A 3G8SA 1F9FA 3VAKA 1YWXA 1ZZNA 1VBYA 2KU7A 2KH9A 5DDQC 2DHGA 4LIRA 4CH1A 1KC8T 5DM6Q 2ZJRQ 2CPXA 2WBRA 2AYEA 2DNLA 1P1TA 5D78A 4QQBA 2CPEA 4M5DB 1YI2S 1U2FA 2SXLA 3CPWR 3MDFA 2HGMA 3MUVP 3VALA 2RU3A 2MZRA 2O3DA 1FJ7A 3BO4A 2JVRA 3CCES 3UD3P 1DHMA 1D8ZA 1FJEB 2L41A 2BZ2A 4YOEA 4TU8A 1U1NA 3UCZP 3J7YU 4WF9Q 1D9AA 2DGUA 4U67Q 3R1HA 2QA4S 3S8SA 1JJHA 2MJUA 2N82B 2CQ3A 1BY9A 2LMIA 1U1OA 2MMYA 2ADBA 2M52A 2MPUA 3G9CA 2QFJA 1SJRA 2U2FA 1VQ6S 2CPIA 1U1QA 2KG1A 1WELA 2M2BA 4UY8T 5GAEU 1FHTA 3CC4S 2F3JA 4Y00A 2KT5A 3J7ZT 2LXUA 5IFMA 4FXVA 2DNOA 2G0CA 1WF0A 2CPZA 5IM0B 2DNGA 2HVZA 2M0GB 1R8PA 4P6QA 2UP1A 2U1AA 1K8AT 5DDRC 2CQ2A 1WEZA 1VC6A 4PRFA 2MQNA 2DGQA 5DM7Q 1SJ3P 2AYBA 2VOPA 3NNHA 4J5OA 5LJ3Y 4WIIA 1VC5A 2M8DB 2DNMA 4LJMA 3BO3A 1K73T 1G2EA 2RUGA 2X1BA 2FC9A 2J0SD 4QU7A 3VAGA 3IWNC 1X5OA 2OIHA 1UW4A 3CCRS 1VQOS 1U6BA 2VONA 3Q2SC 3CCUS 2NZ4A 4TU9A 4PKDB 2XS7A 3I55S 2ERRA 2DGSA 4CQ1A 1VQ8S 1UAWA 2X1GA 5FJ4A 2CPDA 3B4MA 2DGTA 3HHNB 3HI9A 2MKSA 3TP2A 2E5GA 2LCWA 2YTCA 1VQLS 3K0JA 1WHXA 3H2VE 5MLCV 3IRWP 1RKJA 1VC0A 5IQQA 1QM9A 3BS9A 2FC8A 3TO8A 4Y0FA 4IUFA 1U1PA 3CD6S 2MKCA 1M5KC 3MUMP 2VODA 3V4MA 5JVGQ 3P49B 2D9PA 2ZJQQ 3FEYB 5GAHU 2RRAA 1WHWA 4C4WA 1WI8A 2MGZB 2KN4A 2CPYA 2K8GA 3DXBA 2D3OR 2CQ4A 3PIPQ 3CUNA 3US5A 4IO9Q 1Q86T 2G1DA 2MSTA 1VQMS 2L08A 2J76E 2RS2A 1N54B 2MKIA 1WI6A 3MD1A 3CCVS 4V19X 2V94A 2RS8A 1WF2A 1VQ5S 2MZTA 1CVJA 1KOOA 1U1MA 1W2BR 3CCJS 2I2YA 4W90B 2XS2A 1VBZA 3NS5A 1FT8A 1B7FA 1HD0A 4WFNQ 1X4GA 2YKAA 2X1AA 1FJCA 2RNEA 5DDPC 1DBDA 1X4CA 2MJNA 2YH1A 2DIVA 3BEGB 2XNRA 2J8AA 1WHYA 2KXHA 2N7CA 1VQKS 2HZCA 5ITHA 2DNQA 2XB2D 4IOCQ 1SJQA 2JVOA 3CCQS 1WG1A 2DGXA 2RT3A 3NNAA 5LXRA 2JX2A 2GHPA 1OWXA 2DNRA 3VAMA 4RU2A 3MUTP 2DISA 2MZSA 3G71S 1N52B 2BOPA 3PIOQ 2CPFA 1H2UX 2MQPA 3VF0B 2MZ1A 2ZJPQ 4QU6A 2RQCA 1FO1A 4WFAQ 2MYFA 3ZZYA 2CQDA 2NLWA 1QVFR 2KXNB 1ZZFA 5LXYA 3UCGA 3EGNA 5D77A 1YJNS 2OTLS 2F9JA 2N3LA 5JVHQ 3NS6A 1U1LA 3D2WA 3R27A 3H2UB 3JB9k 1SJ4P 3CCLS 1X0FA 1XN9A 3B4DA 1WWHA 3CMES 3P6YC 2CQCA 3NNCA 1R8HA 3UWTA 1HD1A 1WG4A 4F02A 1NO8A 3CCMS 3G4SS 3VAJA 3SMZA 1PGZA 2DK2A 2CQHA 2DITA 2LYVA 1H2TZ 1URNA 1DRZA 1X5PA 2EVZA 3LPYA 2M4MA 4ED5A 3G6ES 2LXIA 1YIJS 3TYTA 3CULA 1JJ4A 2PEHA 2KHCA 3CC2S 2EK6A 1OIAA 5CXTA 1KQSR 3UE2A 1WHVA 4WFBQ 1Q7YT 2DHXA 3RW6A 1FXLA 1WG5A 3CF5Q 5H1SV 2XS5A 3CC7S 2MXYA 2DB1A 2DNNA 2M8HA 1H2VZ 2KYXA 4C0OC 3ZZZA 2DGVA 2K3KA 2LA6A 1M1KT 3EGZA 3UD4P 2CQ0A 5LJ5Y 2LA4A 2YH0A 5GMKa 2DNPA 4QPTA 1NJIT 1UP1A 1JJ2R 2DGOA 4CIOA 1DZ5A 1X4DA 2GO9A 1QVGR 2DH8A 5HO4A 2MSSA 2OSQA 3SDEB 1VQ7S 2DHSA 3THPA 2E5JA 1YJWS 2MZJA 4OZ0A 1U1KA 3NMRA 2MZQA 2KG0A 2M9KA 5GVQA 2HYIB 1SJFA 1VBXA 2AD9A 2JRSA 4ERDA 2LQ5A 2M70A 4YB1P 3S6EA 1WEXA 1PO6A 2LEBA 2X1FA 4A8XA 3P3DA 2MKKA 3CXCR 3G96A 2CPJA 1HL6A 3EX7B 2KM8C 3U1MA 3UCUP 1H6KX 1VQPS 3VAHA 2DO0A 4IOAQ 1OPIA 1X4HA 2DGWA 4YUDA 2XSFA 2EK1A 3P5TL 5CA5A 2FY1A 3FEXB 2I38A 3S01A 4BS2A 1Q81T 3ULHA 2VOOA 2OJ3A 2DNKA 2YWKA 1N88A 2AYGA 3MURP 3R1LA 1X5TA 5GADU 3MI7X 2E5HA 1NU4A 3VAFA 1IQTA 4EGLA 2RVJA 2HGNA 3VAIA 3BO2A 4WCEQ 2JWNA 1YTYA 1YITS 1SXLA 2QEXS 2KVIA 1A9NB 1YJ9S 1X4FA 2MY8A 2XNQA 1X4EA 1JMTA 2E5IA 5DETA 1N8RT 4UQTA 4PR6A 2HGLA 1A7GE 1X4BA 2RRBA 2MQOA 5GAGU 2CQIA 4WKRA 2LKZA 3MD3A 2DH9A 3THTA 3LQVA 1RK8A 2LEAA 1OO0B 3CTRA 5IM0A 2LECA 1VQ4S 3MOJB 1O0PA 4CH0S 4F25A 3U1LA 5DDOC 2DNYA 5LSLA 2N3OA 1UFWA 2MQLA 2MB0B 1M5PC 4C7QA 2AYMA 1Q82T 2E44A 2A3JA 4TU7A 2CQ1A 2CQPA 1VQ9S 4FXWA 2G4BA 2CQGA 2CJKA 5EN1A 1M5OC 1WTBA 2KM8B 1WEYA 2B0GA 2D9OA 3MXHP 3DLLQ 1AUDA 2DO4A 4TLQA 4ZKAA 2CQBA 2MHNA 4OZ1A 1L3KA 2M88A 1ZH5A 1FNXH 2KRBA 4LMZA 1U1RA 2CPHA 1HA1A 2MKJA 3S7RA 3OW2R 4W92B 1U6FA 2KI2A 2F9DA 2ADCA 1KOHA 2KXFA 1M5VC 2Q79A 5LSOA 1KD1T 2OTJS 2DHAA 2DIUA 2MY7A 2J0QD 2RQ4A
chains in the Genus database with same CATH superfamily
2FPHX 1OMSA 1TVRA 2B9XA 3LANA 2F40A 3H20A 1FRXA 3OV7A 2MQQA 4FF3A 2HNDA 2KFYA 3T6BA 4Z2XA 3MECB 2QLXA 3MAAB 2E7XA 1TK0A 5KT3A 2H5JB 3VHQA 1IBLJ 5AJ3F 4KIAA 2HHTA 1FKPA 2CJBA 3BPDA 3M6WA 2IIHA 2QX0A 2ZHAA 1OYEA 2R7OA 4WJBA 4HI2A 1EP4A 3GG0A 4ZJQA 5KFBA 4I7FA 2BE9B 5CZVA 2HGMA 4M5LA 2YQ3A 3CCES 1FDBA 2BZ2A 1U1NA 4Y65A 1KBRA 3QRPA 1U1OA 4MKYA 4IFVA 3HZGA 1AB8A 1VQ6S 4FP9A 2HHXA 3KLHB 3KUHA 4MIWA 5D0HA 3ITHA 1FHTA 4ANCA 3I0SA 3K89A 5DJBA 3DNCA 2UP1A 1YJVA 2WOMB 4NL5A 1C0UA 4HYKA 2HBYB 2AYBA 1KKHA 5GMDA 4O3QA 1K73T 2J0SD 3BM7A 3R6GB 1L3UA 4GO5X 2C2KB 4BC7A 4A46A 3D5MA 4PWDB 3H42A 2ATCB 2BYCA 1VBKA 1FDNA 1UAWA 3N6LA 4ED4A 4K4ZA 1U2CA 1RCXB 1AFIA 2MKSA 4DPUA 3CMQA 4K4YA 4QW9A 4ES2A 2W24A 3OT9A 5IQQA 2C1EB 4IG0A 1RISA 4P2XA 2GO8A 1WOSA 4J9NA 3FEYB 3VWSA 4CYUA 4J9OA 1CPZA 1TL1B 3US5A 3ICLA 1Q16B 1R8BA 2VA2A 4FPIA 2RUSA 1CVJA 3DLGA 4X66J 3O3LA 4LF7J 1VBZA 3QIPA 1QSYA 3KK2B 2V50A 4JI6F 4ZP8A 2XB2D 2IVYA 3QJJA 2OFGX 1WOPA 1FK9A 3TRGA 1OY9A 4F4KA 2R8JA 2LEPA 4F8RA 4RU9A 3VF0B 2BQUA 4JV5F 4K2XA 5LXYA 1RTDB 4C3MA 2YPZA 4PUOA 1OPZA 4L72B 2F9JA 4QZVB 5JVHQ 2V4RA 1U1LA 1VCTA 2XMAA 2CQCA 3W2WA 3CW2C 5KFDA 2DRBA 1NO8A 2V8DA 5HROA 2UV8A 1KSPA 4YN3B 5HLFB 2IY5B 1L3SA 2IJNA 1X60A 3IGNA 3JS9A 1JLCA 4J7CA 4ED3A 3GFZA 5BYRA 4Q0BB 3POTB 4EO8A 4ELUA 3LP2A 2LA4A 1O8BA 5DQHA 4O0NA 2EC2A 3SDEB 3DC2A 3BSOA 5KFYA 4DSFA 2CFXA 1HNZJ 2K1RA 2QL9B 4HH1A 2JRSA 1RAAB 1YJUA 1FWLA 3NL0A 3OHBA 1MSWD 1U8WA 1QSLA 1SKRA 1LV5A 1S6OA 1N32J 1C4AA 4LT6A 2I38A 4FF4A 4BS2A 3KJQB 4DCJB 2RF2A 1HBMB 1HW9A 1WC5A 2BDPA 1YK9A 1YJ9S 3D7SB 2XNQA 2GVZA 1ROFA 2E5IA 1N34F 2HFZA 3NBPA 2FIUA 2DT9A 4DS5A 3JQMA 2A18A 2R4FA 1WSRA 2CYYA 1XK8A 4F25A 2WONA 3EM1A 1TMJA 2AU0A 2MQLA 3M8QA 4E98A 1UW9A 4WIQA 4TU7A 4DR5F 1UTAA 1VQ9S 5ETNA 4P7TA 3PM9A 3EJMA 4NEZA 3LF0A 1Y0HA 4Y34A 1WEYA 2PN6A 5HP1B 2NXCA 1H72C 4ZKAA 3D4JA 1FNXH 3UN3A 2OKQA 2F8HA 3RB4A 3AB4B 2CKWA 4WYLA 2OTJS 2KFNA 2J0QD 4DMZA 4MT1A 4BHQA 4J91A 2L9WA 2E9RX 1IBKJ 2NPIA 4NZ6A 2HG4A 2PE8A 4ZVRB 2V68A 1HYSA 1F9HA 2LQBA 2VJUA 3FMWA 3T9NA 3K5OA 2J6SA 5DDQC 3MCNA 4LIRA 2KO1A 1B99A 2XHCA 3EVMA 3MMCB 3CPWR 2JEGA 4LF6J 2O3DA 1U2RA 4DR1J 2BJ7A 2ZVSA 3SCJE 6FDRA 2B7BB 4KV8B 4TXSA 4B9NA 1U6ZA 2OP5A 3SV4A 2LQ8A 3CJKB 4Q8FA 5H9FK 4EK2A 2FQQB 3CC4S 1VK3A 1FFWB 4LR9A 2AWZA 5KFHA 1HWKA 3FEZA 4ZVQB 5J2PB 5IM0B 2DNGA 2R8IA 3V4IA 4UQGA 1XMOJ 2UVRA 3BQ2A 3PYFA 4ZVEA 3QFHA 4CNYA 4FS1A 1IXKA 3CCUS 1NHVA 2AJ1A 4DV3J 2XM3A 2G2YA 3E51A 1S6PA 4NCAA 3M7VA 2W4DA 1S48A 5K14A 3HKZD 2YTCA 2OPPB 2HQIA 4G1IA 3FVYA 3M2RB 2RKIB 2VQEF 3FRYA 2AHOB 5A2QY 4FXDA 2N7YA 1LKZA 4E0DA 2HRTA 3A13A 1WI6A 2NPFA 3GR0A 2RS8A 1LWCB 2QO3A 3AOBA 4I56A 3UNGC 4DSIA 2RMLA 3KJFB 4RLEA 4NI2A 1X4CA 2MJNA 3HVRA 5DZ6A 1N5SA 4FZVA 1KVIA 4ZLLA 1WUUA 3JSRA 2WAQD 5ITHA 5K5MA 3FCHA 2BV3A 3LPEA 1KQFB 1RWMB 3DLEA 1SQGA 4USJC 2R7RA 2BRKA 1XN9A 4KH0B 1IM4A 4G65A 4OYZA 4DL4A 2KZZA 2QFIA 3VAJA 3SMZA 1Q53A 3LTOA 1FERA 2CQHA 1LEOA 3SZ2A 1M1GA 4RNHA 3AAWB 2Z2ZA 1RHUB 1L5UA 1RTHB 5J1EB 3T5HA 2QLFB 5C2CA 5H1SV 4P2MA 4PPZA 1IKWB 4OX7A 2JC1A 3PX4A 1XJWB 1NLKL 4LUBA 2YH0A 4ED6A 4IDKB 2AEFA 2GZOA 3AA8A 3KLFB 1CEZA 2KG0A 4MKBA 3J7YI 2HYIB 3BGLA 3Q86A 3PX6A 1WTFA 4NPOA 4A8XA 3V81A 1JKHA 2GFFA 3TJAA 2KM8C 5F8MA 4M5DA 1NXIA 2XSFA 4LF1A 3CB4A 1EAYC 3EZUA 1G3OA 3MM9A 1NU4A 3H59A 5KFNA 5GMEA 2E7WA 5K20B 3PYDA 4KBIA 3TI0A 1Q0NA 4X66F 4JV1A 1WACA 3NGDA 5ETQA 3NMAA 4IYQA 2DXFA 1T03B 2XMVA 5LSLA 4O23A 1Q79A 3AOAA 3JAMU 2CXEA 3M2VA 1UVKA 3LP1B 1Q4RA 1M5OC 1UZHA 1U24A 5B7WA 3CJQA 2M88A 2HURA 3RGIA 1EQMA 1VI7A 1UA0A 1BUXA 2VBXA 2DYAA 1OJ4A 2Q79A 4TN2A 2CJQA 2DIUA 4FVCA 3CJSA 2EFQA 4C6AA 4DR3F 2XTJP 4TYAA 2MKHA 3PHEA 3SQOP 4NASA 1VRUA 3A12A 1ZAWA 4ANEA 4RUCA 5K8MA 4U9RA 2R7XA 3PRVA 5GAEI 2RHQB 3N4WA 3D68A 1T8EA 3B6BA 4QQBA 4R8UB 3PDNA 4RBUA 2QYCA 1XERA 1P9QC 4FKXA 3MUVP 1HNZF 1IKXB 3I9V9 4DX8H 4IH7A 2K3IA 2XLIA 1ZOTA 4WF9Q 3A8JA 4KHPJ 2LMIA 1HHTP 2IRXA 3CJRA 2MPUA 7FD1A 5KT7A 5AXLA 1RT5B 3U1NA 2HVIA 2Y0SD 2J6TA 3MFHA 1VJWA 2G0CA 4UTGA 1HMVA 4M8LA 3KFWX 3UDLA 1X9WA 4K5RA 3C6TA 1HPZB 1Y5NB 1YKWA 4PRFA 1S1XA 4NMXA 5L46A 4RR5A 1E6VA 2J5AA 1RWVB 4N41A 4A8MP 2DNMA 3BO3A 1S0VA 1K44A 1QD1A 2NYIA 3V6DA 4QU7A 4P2SA 3N5FA 5ETSA 4C8ZA 2CPDA 4DX6A 3LAMA 4Y2MA 1YBAA 2LCWA 3SQGA 3D6HB 3IRWP 2ZBPA 4FKYA 4EWTA 3I0RA 3DGPA 1JLQA 1PYOB 1LW2B 2J9CA 4A48A 1RAHB 4YDDB 2FLOA 1TKXB 5GAGI 4KKOB 1WF2A 2Z4PA 4NXMJ 1U1MA 1F9EB 1IBMF 1HNIB 4WZMA 2HIYA 3IP0A 4ZIVA 2YKAA 3BBFA 3JYTA 1MWYA 1UWAA 4O4GA 3AFGA 2IJRA 2JX2A 1S7HA 2POKA 4NLXA 2QMXA 2DISA 3P4UB 2YNGB 2ZBIA 1SKWA 2KXNB 2DY9A 2CVIA 2M3DA 4GKKJ 4K4XA 3Q8PB 2AQ4A 3I32A 2FY8A 2PI4A 2E1RA 2RQMA 2WVFA 3W65A 2CRLA 4LF6F 1PGZA 3PEHA 3D1HA 1RAFB 3M32A 3BV8A 1Q8LA 4FBTA 4KE5A 2Y8WA 2YQ0A 3W9IA 4PG4A 3X3UA 1R0BG 1T02A 1UEKA 3KKFA 1HI8A 3AB2B 4N77A 2PEBA 4ID5A 3I6PA 3SFUA 4WBFA 2BJDA 4BLGA 5H9EK 2YNHA 1PIEA 4R0EA 8AT1B 3UVJB 4EI2A 1X4DA 1PG5B 1UA1A 1XWLA 1B70B 3M30B 4Q5VA 3Q8UA 3KHGA 4TY9A 4WKYA 4BWMA 3FFIB 3QLHA 3S1TA 4NX9A 2LEBA 3C16B 3D3CJ 2F5GA 2CPJA 3O5TB 1ZM4A 3TWZA 1CJKB 4IOAQ 1OPIA 3NRBA 3D3BJ 5JJBA 4HHHA 4KGXB 4EBCA 3HPOA 1LWXA 3M8YA 2V34A 2DR5A 1ZYQA 2UU9J 1H7XA 3SEOA 1YITS 1SXLA 3IRXB 3NGKA 2MY8A 1S1VB 3DN9A 1H0HB 1X4BA 2ZH1A 3DHWC 1YBTA 4CT8A 3GIIA 3E01B 2BQRA 3M4XA 9ATCB 2Y1RI 2BRLA 3HK2A 2FZKB 4I2PB 2N4CA 2R42A 2RU9A 2DNYA 2UUAF 4DUZF 4MJKA 2JH3A 2XGQA 1V5IB 3QT5A 2GV1A 1FD8A 1HWLA 3FMBA 2GW8A 3FSXA 2R7TA 2HRUA 2DO4A 3J81j 4MH8A 4GO7X 3JSMB 2HWIA 3V2UC 3UQSA 2LU1A 1KOHA 4K2JA 3HSGA 3I87A 2CDRB 3ENAA 1M90T 1N48A 1P27B 3LGHA 4CDIA 1TFYA 1IR0A 5KFSA 4QW8A 5CYJA 3FDSA 5KT2A 3QJLA 1S5ZA 5E33A 3P5BP 4ZOSA 1UETA 5BJRA 1CLFA 4CLTA 4U95A 5EDWA 1S12A 1U0HB 1SC4B 2I0XA 3UDVA 1NDPA 3O1LA 2XZTB 3M6XA 3GIMA 1OQ6A 3CJTA 1TV6A 4H4MB 2CWXA 2XY5A 1VLYA 3RAQA 4QR1A 1GMVA 2DRAA 1NZAA 3LAKA 5F8IA 1IKVA 1VGYA 2B56A 5C2GA 3LP0A 3HFZB 2LU2A 1KP6A 4LQ9A 2GVDB 1D8ZA 2W7PA 3RBZA 5KFJA 2QA4S 2AF6A 4DUTA 1ZM3A 3EPGA 3ZXWA 2U2FA 3IGVA 2R7SA 1RA6A 4YB7A 1ZAVA 5GAEU 5IQ6A 4DX7A 2LXUA 3IAM9 3MM5A 3QSYB 2Y3YA 3D66A 2DR9A 4LVOP 2DJWA 3TAMA 2NUUG 1RHQB 4F50A 3GU0A 2R7WA 4OLOA 5E0OA 3LW5C 4OQJA 1GMWD 3M9NB 2PT0A 1RHJB 1TKTB 3H98A 5DS7A 5FJ4A 4RUAA 4N8OA 2GJIA 3KDNA 2ILYA 3DMJB 4RW8B 3L95X 1DQ9A 4OYIA 3HP6A 2AV5A 4FVMA 1TVRB 3CIMA 3DOMB 1XMQJ 3EXYA 3MECA 4C8NA 4M5IA 3MAAA 1WHWA 3BKFA 3DXBA 3KYLA 2BE7D 4JI7F 3HDSA 4EBDA 2ZDOA 1MN7A 3MEDA 2MZTA 3SFGA 2ZH2A 2YPYA 2QE5A 1TP7A 1Z2LA 3NS5A 2EC0A 4WFNQ 4CLKA 4HHUA 1EB0A 3RR7A 1S49A 2OD6A 3MHYA 3ISND 3IG1A 4WXWA 2KXHA 2ACMA 4LF8J 2W2MP 3UD5A 4ZDNA 4I7FB 3HCXA 2UVWA 4A8KA 2OMLA 5I3UB 2CPFA 2MZ1A 1ZBTA 4QU6A 5D3GA 3WC2A 2J9DA 2FB0A 2APOA 2OLWA 1BWVA 4L73A 3PRDA 3BJYA 1S7IA 4IFVB 1RWNB 4ID8A 3UWTA 3GYGA 3D6TB 4NA2A 3W60A 4CLLA 2BX6A 3I0SB 2WOMA 3HVTA 2LXIA 3MM8B 2MLYA 4URQU 4KHPF 2F1FA 1C0UB 5RUBA 1T95A 1BLUA 1MU2A 1U7LA 1NPPA 2CVEA 1Q5YA 2FVSA 4DV7J 3SCIE 3CF5Q 4ES3A 1HNXJ 1DJ0A 5LJ5Y 3VGTA 5J2NA 3K5LA 3Q24A 3U7JA 1OSDA 2V4JA 3PG9A 2YKOA 1NUEA 2J7UA 3TZWA 1U25A 1TL1A 2OEJA 4ZCIA 4DR7J 4CYUB 1KVJA 4DV4J 2H4YB 3EX7B 3HHLD 3U1MA 2JEFA 3UCUP 2NR0A 3IBWA 1DTTA 4JUZA 3ZTPA 3OTCA 5D4PA 4ZVHA 1XNQF 4AUKA 4P2FA 1SJ1A 2H4WB 3TEHB 3R1LA 1APSA 2HHSA 3GB0A 4F4YA 1X4EA 5B0CA 3M8ZA 2PGCA 1FK9B 2W4PA 3C15A 4DU8A 3H5SA 2PA3A 4CZCA 2FLLA 4CO1A 2HVEA 3VQSA 4LFBJ 3TA2A 4NMLA 1VQ4S 2ASLA 2IM2A 3TX8A 5DDOC 3W2WB 4ED0A 3RBXA 5HLFA 4OJ1A 3PACA 2CQBA 1UJ6A 4E8UA 1E6YB 1G4CA 5CQGA 4DSJA 1L3VA 2KI2A 3OSPA 3QPIA 4I2QA 1ZETA 3R7SB 4LRBA 4OHYA 4ZIWA 4B9MA 3MR2A 3LP2B 2JLGA 3SDEA 1BQMA 3SSRA 4WE1B 4JYAF 3ETOA 2FGCA 3VZIA 1S79A 1FRIA 2GIQA 5L8RC 2K1RB 3MZIA 3EGVA 4F26A 5EX3A 3QWPA 3VAKA 1TUGB 2E1AA 3GWCA 5LT5A 2ZJRQ 5G0RA 4ZLNA 1S9GA 3OR1A 3W5XA 2B43A 1GQEA 4RL1A 1U2FA 1HBMA 2I6WA 2RF2B 4A47A 1FJEB 4TU8A 4ATNA 2DGUA 3CSKA 1OY6A 3HD1A 4U67Q 3DOLB 2KB2A 2GAGC 2N82B 3TQ1A 2AT1B 1IR1A 2QFJA 4DFKA 2KT5A 4I6YA 2ZBRA 5J2MA 4EU0A 1K8AT 5DDRC 3DXSX 5F3ZA 2EKNA 3N0VA 2WONB 3DOKA 2J7WA 2AW0A 4C48A 3PW2A 4KO0B 3M8QB 2MQNA 1AZSB 4NRUA 4KYZA 3NNHA 2LDIA 3EVOA 4CM0A 3T3FA 4FNHA 3CCZA 5J2QA 4U7CA 2W8KA 1FTRA 2X1BA 3CD0A 1FKOA 3UFCX 3ZNJ1 2NZ4A 4PKDB 2DGSA 3M8PB 3C8YA 3HI9A 1VOMA 4ZP9A 1WHXA 4IUFA 2B7CB 5GADI 2MLXA 3CEDA 1TELA 3M8RA 2D9PA 5GAHU 1IWAA 4Q2MA 1N6QA 4CTAA 1T11A 4RUHA 4IO9Q 4FYWB 5HQLA 2PMHA 3HF5A 2EFVA 2CZ9A 1WKKA 5CD4A 5I42A 4W90B 5KFXA 3LGMA 4CRJA 4H4OA 1X4GA 2HS0A 3ZC4A 5K8OA 2RJZA 2NXEA 1PYSB 2DIVA 3R6LB 4DXLA 2DNQA 4KV8A 4ECQA 5L1LA 1UFKA 4LR7A 3QQCD 3G6VA 1S9FA 1MNEA 4G1QB 1SJ4P 2O5DA 2QLJB 5A6WA 3G8QA 4B3RF 2R2UA 1QSSA 2V5HG 1LQ9A 3OXLA 3ZZUA 4K4WA 3V4IB 3HLUA 2AGOA 3CC2S 1KQSR 3UE2A 2FJWA 2JDJA 3DU6A 3ETMA 2ZUAA 4OYMA 2L9DA 1N0VC 2EFGA 4CWBA 2XS5A 4LSZB 2YX4A 3BR9A 1MW7A 5E3RA 4I6WA 5ETPA 3OSNA 2P9EA 2OPPA 1S6PB 5KTQA 3H4DA 5K14B 5C25A 4ZHRA 2EFNA 3FBEA 3ET6A 2IC3B 5M2RA 3M2RA 4O44A 1VK8A 3FKBA 2MZQA 2VPWB 3IO1A 2M9KA 3K5PA 4HEA9 3P3DA 2Y8YA 3CXCR 3IFEA 1LWCA 3PKYA 4LSLB 4HKQA 4FYYB 1SKSA 2C28A 1B7YB 4YUDA 2FVCA 2EK1A 1RABB 1P6TA 3ZTSA 4DOZA 4NI2B 2XYGB 4YS2A 4OI4A 2E5HA 2JWNA 2QEXS 1S4EA 3P45B 1HQ2A 2RILA 4Y6IA 4LF4J 1N8RT 4XDDA 1A7GE 4ES1A 5FIIA 3ENWA 4NRTA 1NCLA 3MD3A 3DCAA 2ZM6J 4V19J 3ELHA 3G6XA 4DCOB 4U7UK 3DLEB 1IM6A 2XMWA 4FYDA 3OTOF 3KDOA 2JEIA 2XSJA 3MOJB 4K8RA 3RB0A 3U1LA 3OFEA 2ZZTA 4LF8F 4FBUA 1Q82T 4UY85 2UUTA 5BXIA 2KKHA 4ZCMA 1AT1B 2IBOA 2GHVC 3MAHA 1NDCA 3HD2A 4X64J 4IRDA 4JI4F 1NK9A 1KD1T 3MPYA 4PABA 3D6MB 3PW0A 4IDKA 4O3NA 2HNZB 2KTQA 3PRBA 3OHAA 5KG4A 2KRRA 1ZA1B 5F9NA 3CWJA 1S1UA 3G8TA 1YWXA 2JLFA 4V1Ak 1HHQA 1MROA 2VFUA 4EYIB 2DXDA 3RTVA 3V81B 1JKHB 3QT7A 3V6HA 4N7TA 1LW0A 1S9EB 4M5DB 1YI2S 1EX8A 2R8KA 2VB6A 2D41A 2HQFA 3PR4A 3Q0AA 4NLRA 2P9GA 2RU3A 4JI2J 4IQMA 4DJBA 1PC4A 3MR6A 2UXDF 1RA7A 2H5EA 2FHMA 3L7UA 3R2DJ 3R1HA 2A0FB 3VQTA 2M52A 4DV4F 1UCNA 2HHQA 1VQYA 3KHRA 3KTQA 3R5GA 3Q23A 2ZKUA 1W2IA 3F56A 3C14A 1S0NA 5EWFA 3J7ZT 3PHTA 2P9CA 1T03A 3SV3A 2BJ9A 2HVZA 2WB4A 2HKEA 3V5RA 2B4UA 3JAMY 2CQ2A 3J7Z5 4KRWA 1HNWF 1SBRA 1WD6A 1SJ3P 2H48B 4DL7A 1U4BA 4HL9A 1EARA 2C3PA 3ZTRA 1T05A 1VRTA 3IWNC 2OIHA 2FHJD 1QE1B 1T9YA 2ERRA 4CM2A 1JLBA 1NZ8A 4LFBF 2X1GA 5KFZA 3TP2A 5KOXA 3BKUA 3MMJA 4QYRA 1RKJA 1RWKB 5DG7A 5ADZA 4DS4A 3IWXA 3MUMP 2PDAA 2AJ2A 2VC0A 1GFWB 3CUNA 4MK7A 1VS3A 5KFFA 1CS4A 2CUYA 4LSNB 3Q22A 2HBQB 1WC6A 1LNQA 1RGVA 2XO7A 3RBDA 1HR0J 2O1PA 1D09B 3H2LA 3OLBA 1MWZA 4OI6A 4DF8A 1RWXB 2K06A 2HEKA 2UXCF 5D0GA 3TAQA 3OVSA 5C42A 1WHYA 1IKXA 3D0HE 5HSPA 1HKAA 4IOCQ 3CCQS 1FEEA 4OHZA 4ECUA 3WIUA 3GPAA 4IRKA 1VDHA 2RQCA 1FO1A 4WFAQ 1HFEL 4KGZB 4ALZA 3OXFA 1RT5A 1Y00A 2Z56B 3UDCA 1OYDA 2DKOB 1AROP 1WWHA 4DN0A 4K5SA 3NNCA 4ZVFA 2EEYA 4UOGA 1TAQA 1EKSA 3G4SS 2HS4A 2DITA 2ZFHA 2Y1IA 1U09A 3PY8A 4NLYA 4WWSA 2KHCA 2EK6A 1S1XB 1RCOB 4UZCA 4USMA 3I4HX 3EE3A 2DHXA 1E6VB 3PR5B 1Q7YT 3TVYA 2HAFA 4F0MA 3KK3A 1MG7A 2LA6A 4MIBA 1JK9B 3RYLA 2HHVA 1S1WA 4QPTA 4DPOA 2ZH3A 5D4NA 1YBUA 3A1YG 3TVKA 1SH2A 3E2EA 1VQ7S 3HT3A 3SQGB 1Y7PA 2V6AA 4PAAA 5LMUF 1YGYA 2ZBCA 1F5BA 2V2ZA 4KKOA 1FA0A 4CLUA 2V2QA 2B4PA 5L9NA 1HNIA 3GSDA 2BM1A 3AT1B 2G1HA 5CA5A 3KLEB 1JXEA 3IR6B 4DF4A 4YR2A 1U26A 4IH6A 4Q2LA 4RW4B 1RYRA 3MURP 3MI7X 3AJ2A 4RW9A 2EKYA 2P2CB 4IO1A 4AL7A 2RRNA 1T7PA 2F8EX 3JYTB 4O4GB 4UQTA 1ZA2B 5A8WA 2DH9A 1RK8A 1NB7A 2YWGA 4AYBD 1NBEB 1VISA 4ED2A 1IR2A 1UKUA 2RHSB 5B09A 4F3MA 4U96A 1BQNA 1RQ0A 2ZITA 4C7QA 1T3NA 1YRTA 4FF1A 1TK5A 2WSCC 5CD4H 3CD5A 2D9OA 4DV1F 4CCHA 2EG2A 4DN9A 3QO9A 4KT0C 3NWRA 3BREA 4QIVA 4DV0J 2KXFA 2KVQE 1NSPA 2YBVA 2RQ4A 4RZRA 1GXLA 4N47A 4ID5B 4P7VA 1ICEB 1RXOB 1BXNA 2YNHB 5L1IA 3M30A 1SQEA 3PEJA 1W7WA 1WF1A 1LXNA 4ZN3A 3BYRA 2ZOGA 1NB2A 4EZ9A 4HDHA 5IC6B 1VBYA 3C16A 5F0UA 1N34J 2KU7A 3QLHB 1CJKA 2AIRB 4CH1A 1RDRA 2HQ3A 1FF2A 2FJXA 2C2NA 4IG3A 5K8NA 1LK7A 3TARA 3KJVB 3GLJA 2XI2A 5JUMA 5A8RA 4KY3A 3EDQB 1Y9OA 3IRXA 2OUGA 1S1VA 3DRRB 4KSEB 3S8SA 2MJUA 1FKAF 1YG0A 1ZTWA 5A0YA 5F9LA 2JOQA 3B8HA 4LBIA 4RX6A 2C3OA 4QWEA 3CNQP 3M6VA 1RWPB 4Y00A 4I2PA 1U45A 2DNOA 2Z30B 2DR8A 1R8PA 4DV6J 5DQIA 4UOCA 4LRAA 3FBFA 3OUYA 3T5KA 5BYQA 5KG6A 2VOPA 4UOFA 4DDFA 2G2OA 1RKIA 4LF4F 3AXKA 1S59A 4USWA 1X9MA 2OEMA 1X0PA 3CCRS 1I51B 3I55S 1SH3A 4ETZA 4CQ1A 1NJYA 4USHA 2BKPA 1S6UA 3B4MA 4WK1A 2DGTA 2AJFE 4B3SJ 2E5GA 1J5EF 2R7UA 2L9NA 1SVDA 4Y2IA 1AXQA 2AGQA 5JVGQ 3FNNA 3J80Y 1U0HA 4P9SA 1X7VA 4W98A 1YVFA 1VQMS 3PX0A 4Z7CA 1XTZA 2BJ1A 4Y2CA 1UVIA 3NG8A 4ECSA 3ZZRA 3Q83A 1ZAXA 2E1MC 2FLNA 4LFAJ 4QIEA 1TL7B 3ZTOA 3HFKA 3ILIA 3UNYA 2VFVA 2DPJA 3B82A 1TV6B 1DTQA 3TJ8A 5DDPC 1UPPA 5D15A 3BEGB 3GG1A 2XNRA 2VG7B 2HZCA 1WG1A 2LFVA 1IKVB 1CJVB 1RTIB 4I68A 3GTYX 1P8GA 4DWIA 4PEOA 1N56A 2OI2A 2MYFA 2VBWA 2NLWA 4PCQA 2X3GA 4B02A 3BPSP 4IFYA 2N3LA 4Y3CA 3DLHA 3QNWB 2FVRA 3ZZOA 2QMUB 1N33F 1SV5B 3HJFA 2DK2A 4K59A 4C9DA 3GONA 1DRZA 2M4MA 3G6ES 2ZDPA 3MM5B 1VHIA 3UN2A 5D0RA 2GHWA 3BSAA 2XO6A 2WVCA 3K57A 2VQEJ 4DQQA 2HLUA 3BSCA 1H2VZ 1M1KT 2CNOB 3UD4P 3TUZC 1I1GA 3DMJA 4RW8A 5A8KB 1NJIT 4M1KA 1FWKA 3QGIA 2Z2YB 3NAHA 2XGPA 2E9ZA 1JLAA 1FRKA 1PBUA 5KFMA 3PYEA 1RTJA 3DOMA 2OPRA 2CJXB 4FYVB 2CIMA 4DL5A 5EGYA 4XIUA 3RB6A 5ETRA 1NRKA 5KG0A 1FESA 4DPXA 1WEXA 1FX2A 2VQFF 4YB5A 3HHLC 1RI7A 3MEDB 1F6TA 2W8LA 1K1SA 4MKAA 2PI5A 1WC1A 2AEJA 3IXQA 4PQAA 4UOHA 4OI1A 2JL9A 3FQLA 2PMZD 2WSFC 3IG1B 3OVAA 5I3UA 5IZHA 4N56A 1JMTA 1FNMA 1GMWA 3V6KA 1ZM2A 2MQOA 4WFZA 2CQIA 4WKRA 5D3GB 1I6JA 1ULRA 1HR0F 2Y0BB 5CYQA 1IJEB 2CNNB 2X3DA 1O0PA 2H54B 4X4SA 2HSEB 2N3OA 5IXUA 4KGMA 4PXEA 3DLBA 2YKQA 1LWEA 1XR5A 3MM8A 3EUNA 2ABYA 3N6NA 3HVTB 3N6MA 2ZZNA 4ETXA 1MU2B 2KRBA 4LMZA 4W92B 3OL7A 3JXOA 2KFZA 2A6MA 2C3MA 2OMOA 4USKA 4R25A 1YSJA 3HXMA 1YRXA 1F1BB 1YX2A 3EMTA 2DNZA 2WTFA 4YP3A 1HLWA 5M2PA 1M5HA 1GX5A 5J2NB 4FN5A 2V4JB 2OSRA 3CMAS 1BMQB 4DV5F 4PG8A 1IVZA 2KT3A 3C46A 4DSEA 3G8SA 2DEJA 2QL5B 2CDQA 1TTHB 2V8VA 4P10A 5F8LA 2XBPA 3W9HA 4JI0F 4IR9A 4O3RA 5E5NA 2ZH7A 1CG2A 1DTTB 1HBUB 2BOAA 2UUWA 2D3O1 3VVUA 4OV6A 4CO0A 2DR7A 4B3OB 3NCRA 4AQYF 4RJVA 1QAJA 5JMNA 2CZ4A 3AD8C 1UWBA 4C2MA 2FYXA 4EMDA 3C15B 3IM8A 3D54A 9RUBA 1U02A 4CH7A 3QAUA 1Q5VA 4F3OA 4NEYA 2U1AA 3HHEA 3RRKA 4DR6J 3DHXA 4DR3J 1FRJA 1H98A 3KLGA 1TMMA 4LQ3A 1HQEA 2DEIA 5LJ3Y 5F0WA 2M8DB 2G0JA 3HHLA 3AH6A 3NS7B 1E6YA 1IWGA 1QDUB 1J5OA 4B17A 2Q6BA 2ZWPA 3KLVA 1VQ8S 3QGGA 2F4VJ 3MMBB 5E41A 2Z2LA 3VZHA 1UEVA 4OJGA 4QJVA 4I2QB 3IMQJ 2FC8A 2B3TB 1SL1A 3EICA 4WE1A 1QY7A 2IVMA 3MM7B 1XR7A 4QIFA 6AT1B 1BQMB 4C11A 4OJHA 2CPYA 2MSTA 4DL6A 2J76E 2RS2A 2IYGA 2C2MB 5ETLA 4V19X 3MAQA 3R3TA 2HK3A 1J27A 1HNVA 4DV0F 4PG7A 3CCJS 1KS2A 2I2YA 1YLXA 8ATCB 1B7FA 5ETVA 4CO2A 5G0RB 1DBDA 4HTJA 4P75A 1S9GB 3OR1B 1U8SA 3PW7A 4J90A 2JNJA 3W9JA 1F3VA 4NLSA 2JFDA 3EZ5A 1REVA 3DOLA 5DLGA 3PIOQ 4OFZA 4O0IA 1Y11A 3C6UA 3WX4A 2YQ1A 1HHSA 1FRLA 1R31A 1TL5A 4R5PA 4ZVUB 1VJQA 4J9RA 1CJUB 4DLEA 4KO0A 5J2MB 1AZSA 3WQPA 4K4TA 3RU0A 2PEHA 3MEEA 3DOKB 2B8QA 2I5JA 2RIJA 4QOTA 4PG5A 2E1CA 2BANA 4WYWA 2LDYA 5K9FA 5J2QB 3CC7S 2DB1A 1FKOB 4C0OC 3M8PA 2LVWA 1RBOB 3OBIA 1HBOA 2RE1A 1IBMJ 4ZPTR 3C3LA 1QVGR 1RAOA 3OTDA 5HO4A 1JLFA 4DV6F 1T0TV 2VPZB 2B8PA 1C1BB 2MZJA 3IBFB 4J9SA 4HI1A 4MYUA 2VICA 4DUYJ 2ATLA 3R5AA 4RO0A 4J9MA 1N6QB 1PO6A 2CNKB 4CTAB 4KHRA 1NSKL 1H6KX 1R27B 4MK9A 3PW4A 1GMUA 3CCWA 4IKAA 2DGWA 3DRSA 1ZPWX 2FY1A 2CJYB 2VUGA 4B3SF 2R7VA 5I42B 5THWA 1RT4A 3N01A 4FDFA 2BM0A 4DL2A 2ZEJA 1DQAA 1R8CA 4H4OB 2AYGA 1X5TA 5F41A 3OFGA 1V3RA 3VAIA 1JX4A 4JP8A 1NPRA 2IVFB 1SKUB 3RB3A 5DETA 2XMMA 5F8JA 1MLAA 5KFGA 2H9ZA 4USUA 5KFOA 4LFAF 2XLJA 5BYSA 4G1QA 2CJAA 3QT8A 2ZH9A 3QIDA 3CTRA 4CH0S 1QJHA 4X62F 4RNNA 4IQXA 1D9FA 4F2SA 2DR6A 1UFWA 1S77D 2W4CA 4AXJA 2A3JA 4J9LA 2CQ1A 2D69A 2CJKA 3K8VA 2K7JA 3MXHP 1N4LA 5DGBA 2HWTA 2AJ0A 3LALA 2DCLA 1ZH5A 1NH7A 4ZVOB 3OFFA 2ADCA 5HK4A 2HHHF 3UO0A 1V3SA 4TY8B 2NSCA 1FVSA 3W1YC 3KJNB 1X4AA 3GMGA 2IC3A 1WDDA 2VG5B 3RW7A 3CO9A 5C25B 1CQNA 1TQLA 4ZHRB 3ET6B 5HQ8A 3CDBA 1PJ7A 4O44B 2LQJA 5L38A 4GVBA 3MCSA 4M5GA 1NHUA 2VBZA 3OQ2A 4NZ0A 5FLXU 3NP5A 4LSLA 4C98A 4OHWA 1KC8T 4LBHA 2VBYA 2FLPA 4NZ7A 2NZCA 4X4UA 1F60B 3MDFA 1JLEA 4OHVA 4ENOA 4BCAA 1NH8A 5HBMB 3EVWA 2UUAJ 4DUZJ 3TA1A 4ZPCA 3MCMA 1PSDA 2EXUA 3RAXA 4WU3A 1A0OB 5L1KA 3NGRA 1NK8A 2RDDA 1S1TA 2EW9A 4ZJLA 2ILZA 2PD1A 3HKWA 4MKVA 1U1QA 2R9LA 4C3KA 4DEZA 3N5BA 3QFWA 2ZE2A 2XSJB 4OI2A 4HHJA 1SI9A 4CO3A 4JBCA 4XPEA 4WIIA 1V6HA 2HWHA 1L3TA 2F4FA 4DR2J 2NUHA 2FGOA 5BR8F 2Z57B 5D6GA 5DZ7A 3IBCB 2VZ9A 5KG2A 1MMDA 3KMSA 2HNZA 2C22A 4X4TA 4DQPA 2QSWA 2L48A 2QTWA 1RUSA 2K8GA 2GC8A 1Q86T 2VFRA 3HO1A 1S1UB 2GNKA 3BZQA 2EFOA 5IWAF 4CNZA 1MROB 5KOWA 2GX8A 2XYPB 1GT8A 3OL9A 5D4OA 4C8LA 1S9EA 2X1AA 4ITSA 1FXDA 4LFCF 4ZPWR 2QV6A 2DBBA 3C2PA 1LW0B 1W25A 2N7CA 1TL4A 4K0KF 3SBMA 2G13A 1UJ4A 3UN5A 1KQGB 2PFDA 1UEUA 2DD8S 5CZXA 3GYXB 3W5ZA 5E3AA 3VGVA 4BDPA 1ZZFA 3WC0A 3NS6A 1IBCB 2D74B 1B0TA 3D1OA 4NWBA 2WVDA 3H5UA 5A76A 3C14B 3CCMS 3W5YA 2LYVA 1KDNA 5KFPA 5D0EA 1URNA 4ED5A 1RHKB 2YKNA 2E5LJ 4KFBA 1XMBA 2QA4G 1R6YA 1M5SA 4ZN1A 3TR5A 4B3TJ 1QE1A 1WG5A 3J81Y 1T05B 1VRTB 4JI7J 4NYOA 5GMKa 2B6AA 1Q8IA 1JLBB 3DDNA 4CO5A 3R5CA 3M1VA 3MGJA 2MSSA 4J9PA 2H65B 3GCWP 3NCQA 1XR6A 2E5JA 4DR6F 5IT4A 2UVVA 2IBKA 2FVQA 2VHGA 1N5VA 1DURA 1P9YA 4LF9F 4LSNA 1URRA 2ZH4A 3NY0A 3IR7B 4JI5J 2AP6A 1H38A 4Q7AA 2VV5A 2DTJA 1CS4B 2F4VF 5AT1B 2MQ8A 4WPAA 1HI1A 3MFIA 2HAIA 3ILLA 2VOOA 2V2VA 5C42B 2B9EA 2FHJA 3VGSA 1RT6B 5F8HA 1M1HA 2GQCA 2HGLA 1HBNB 3Q8VA 3QJPA 4EFAC 1JJCB 3IS9A 2B9YA 2LEAA 5D8HB 2GQQA 3FBBA 3R9LA 3IR5B 4EBEA 4ZP7A 4DU7A 2GGPA 3H90A 1M5PC 1B3TA 4G1PA 2CQPA 2W25A 4CO4A 3DI6B 4FXWA 2A10A 3MR3A 2XEXA 3OR2A 2QA1A 2OD4A 2BA9A 3DYAB 4JV0A 1WORA 3MR5A 4ECVA 2OPSB 2MKJA 5F8GA 2C2ZB 5C5JA 3DRXA 4OYAA 3KK3B 3DM2B 2GS8A 1YZ7A 2FJAB 1S1WB 4ECWA 4F0HA 4D3GA 1XNQJ 1NDKA 4A8OA 4EUVA 3Q2TC 4I67A 1WNEA 2BVZA 2BJEA 2QLWA 1RHRB 4NLVA 3GV7B 3ZO7A 5J1PA 4WU2A 5DM6Q 3OL8A 2XCPA 4QWCA 3KLEA 5JXSA 5B08A 1Q7LB 3I5BA 2CPEA 2SXLA 4OX9F 3UR3C 1GTEA 4RW4A 2W9BA 5L39A 4TKTA 4G6VB 4RW9B 4DUYF 3GR1A 3C66A 2QC3A 3G9CA 1DAXA 1H73A 2CG8A 1FWPA 5A8WB 2A2CA 3ZTQA 5FDLA 2HBRB 2F65A 2M2BA 1UZDA 1WF0A 4ZLPA 2GIFA 3AY0A 1G7CB 3D67A 3K17A 1BQNB 4G3IA 3W8GA 4WP8A 2QG9B 4QIWD 4LREA 4LJMA 4JYAJ 5SZTA 2BACA 1RBLA 3FSIA 1RLCL 2FJEB 4RW6B 4EYHB 2G9OA 3FCVA 2EG1A 3QO9B 3BR8A 5ETOA 2ACYA 4WZQA 3K0JA 1RT2A 3TO8A 3RAMA 3IM9A 3P8BB 1FE4A 2C2DA 2IHR1 2ZJQQ 4ZVPB 2NREA 3BKTA 1T9VA 3L09A 2L08A 4YR0A 1N54B 4RPFA 4M63A 1FNOA 5HMXA 2W9CA 3MD1A 3CCVS 2V94A 4YQWA 4HACB 1TK8A 2J0XA 2HFOA 2F63A 4M94A 4JV2A 1FT8A 1X9SA 5EWGA 1UVMA 5B0DA 3KHLA 1BQXA 3KJVA 4IG3B 4EEYA 5E2QA 1S6QB 4ECTA 3MOZA 2RDIA 2YNIB 2D3ZA 3PFOA 5A8RB 1RT7A 3DRRA 1N5YA 1N52B 2VKZG 2MQPA 2ZJPQ 2KHDA 4Y2KA 1PJ6A 3QAEA 1EJ7L 5A0YB 3IC1A 3HULA 3N79A 4AFFA 4P52A 1RAJA 3H2UB 3JB9k 4AT1B 3HT0A 1Y3KA 3P6YC 3UW1A 2OGUA 1CC8A 2HFUA 1D8YA 2F8MA 2WW8A 1HD1A 5CHCB 1RE1B 3A8KA 3DU5A 2IYIA 3JQKA 2EVZA 1R89A 2FVPA 2BQ3A 3MEKA 4A8SA 1K0VA 2E66A 2QA2A 2OEKA 1BWEA 4PWUA 3OUYB 1C1CA 1WHVA 2JHEA 3W63A 2UUBF 2WVEA 2YXLA 3THVA 3TNVA 1SL2A 2ZZMA 2MXYA 2QL7B 2XY6A 1JIHA 5AXNA 4BWJA 3VCDA 1S0MA 3Q8RB 2GAHC 1TZ0A 2CWKA 1RHMB 2ZOFA 1TU0B 4NA1A 1FCAA 1RJJA 1Q8KA 3NMRA 2HHUA 3M6UA 4ZPAA 2AD9A 4HTIA 4DR2F 3DLKA 4YB1P 3S6EA 1HQUB 4DV2F 2MKKA 4P74A 4M5NA 4I0WA 1UMJA 5EX0A 1AYEA 1TL7A 3FEXB 3KNGA 2NQPA 1VIOA 4M95A 2HLTA 1DTQB 2VG7A 4F4AA 2HGNA 4B3RJ 1CJVA 1RTIA 1YTYA 1A9NB 2F7VA 3GIRA 5C24A 4L76A 3FUYA 2V9KA 2VA3A 3BN7A 1HIYA 5LM7E 3CD7A 4IFYB 3CJ4A 3R5JB 1SV5A 3G87A 4OV1A 2ZNZA 2MB0B 1PCAA 5F3TA 1PBAA 4AD6A 3W62A 3DGVA 2G4BA 5GAHI 3FBCA 1RT3B 3DLLQ 4NLOA 3CJ8A 3D9BA 3QRRA 1CJTA 3M9OB 1HA1A 3OW2R 2ZWOA 3LOUA 2F9DA 2AJQA 4RNOA 4DZDA 4NLGA 2DHAA 2DNKA 5A8KA 3BH7B 2DNHA 3CDUA 4ZJOA 4I1TA 3CDWA 2MGZA 4TLRA 2E5LF 4UZBA 1JLAB 2FHKA 1RTJB 1ELOA 2OPRB 1EETB 5I3QA 4KTQA 4OYWA 1PILA 2B5JA 4ZVSB 4B3TF 5H9EJ 2I9SA 3Q8SB 3FGVA 1KLMA 3PO4A 3RRGA 3MEGA 4OZLA 3AOCA 4PWWA 1HWIA 2AYEA 1FX4A 5HVHA 1RT1A 1FJGF 3OTOJ 4OYBA 3D0GE 2EI5A 3QGPA 2MZRA 3C19A 1DHMA 4MFBB 3BBCA 1PJ5A 4CP5A 2V9WA 1BY9A 1T9UA 4JI5F 1UVNA 4NLUA 2CPIA 4GVLA 1WELA 3GFXA 3UR0A 2CZVC 2F3JA 4LVNP 4JI4J 5DGAA 3TX0A 4A8YA 3NLCA 5CYQB 2M0GB 4RBVA 2W2PP 3T19A 4K4VA 4NOHA 4NA3A 1RZMA 2PO4A 2E1PA 1LWEB 1G2EA 3EZOA 3J7AN 3H40A 1GEHA 4TYBA 1OSCA 2YKMB 1UW4A 1VQOS 2VONA 4L6V3 3TUJC 2JC0A 3MTKA 4DG1A 4C8YA 4ICLB 3SYZA 4X65J 3HSDA 1TKZB 5DG9A 1LFWA 3WDOA 3PJWA 2E9TA 4X4QA 2XMTA 3TZXA 4FPRA 4NLDA 3SCKE 2MLZA 3DDIA 5IT9U 2UXDJ 2G1DA 3RJMB 2DRDA 3LWMA 4ZPVR 2KJWA 5HJXA 1V3ZA 1S97A 1W2BR 3G2XA 1FJCA 3I31A 3UDEA 1HBUA 3OTBA 4RNMA 4WTOB 5HMYA 3ZZ0A 2BMBA 1Z1ZA 3PTWA 5LXRA 4B3OA 2DNRA 1XIQA 4X4PA 1H2UX 3BGOP 1HNWJ 1S76D 1NK4A 1T3OA 2CQDA 3A3NB 4CLZA 4F7VA 1C4CA 4OL8A 1OS5A 5D4LA 1UWBB 4X4RA 3GJQB 3AD9C 1CSJA 5IV4A 4O4RA 3L7PA 4UF4A 4KPYA 1KRPA 1PAUB 5E3CA 4R0JA 3JQJA 2XG8A 4K50A 3KLGB 3L9ZA 2COLA 1HQEB 4ECRA 3HHLB 4HH0A 2P6SA 3QWUA 4YHHJ 3MMBA 4KJIA 1J5OB 4QYZJ 1JJ2R 2GO9A 4CLPA 2OSQA 3FCWA 4B9LA 4I4BA 3WIVA 1X31C 3MM7A 4DPTA 3KK1A 2UXCJ 3GJTB 1U1KA 1G1XA 3CO0P 4I6AA 2BEFA 1CULA 2LP4A 4C11B 5I3PA 1Y4ZB 3BSNA 3CCTA 3BYPA 3TZYA 2OELA 1HL6A 3GJRB 2ZUGA 3SI8A 2DO0A 4WFXA 2YKPA 4Q43A 4EO6A 1HNVB 2WZ1A 3S01A 2IMOA 4OLPA 2OJ3A 2YWKA 1H7WA 3MR7A 4HDGA 2LLZA 1HARA 5MAOA 1EKRA 4JB8B 3EPIA 2RH3A 3FZBA 1SIZA 1IBLF 3GIJA 3PO5A 2KJVA 1UVLA 5E7OB 2YX1A 5T7LA 3I5AA 3GV5B 1REVB 1NJWA 1RBAA 1NKCA 3E8OA 3C6UB 2E7VA 4WP3A 5HMWA 2LECA 1FRMA 2H1YA 4R5PB 3OFHA 4GC7A 1CJUA 1IUJA 1KFDA 4AXIA 5EHHA 4UUXA 3GJSB 3AJ1A 1YQHA 3O6QA 2DCUB 1R0AA 2HZAA 5LMUJ 3PV8A 2OPQB 3MEEB 2I5JB 2HS3A 3S7RA 1R3NA 3J7A1 5F8NA 1S99A 2BANB 2ZKTA 3WZ0A 2BE2A 1WSVA 4NYZA 4FS2A 3MPDA 4XTTA 2YNFA 2QMWA 1F0XA 4YR3A 5IV3A 1HBOB 3UI3A 2WBMA 3O44A 1C1BA 3QMQA 1JLFB 2I8EA 5HL7Q 1VQNS 2M7SA 2ZHOA 3UPFA 3D1QA 4U6PA 2H5IB 2WB1D 1ZZNA 1SC1B 2KL8A 2CADA 1LWFB 4YMEA 4OZ3A 4PZVA 2C3UA 5KFWA 2DNLA 3DRSB 1KTQA 4ZS6A 5HI7A 5LSRA 3VALA 1RT4B 1C0TB 5LOQA 5AE1A 2O01C 1D9AA 1IN0A 2CG4A 1JJHA 3VGUA 3VV2B 3IN5A 1JLGA 4OZJA 2VG6B 4LF7F 4F36A 1I5OB 4DV1J 1SJRA 4Q44A 3NEKA 4IH5A 5CH7B 1B4SA 2H3EB 1BGXT 5IFMA 3K58A 3WHIA 3DDKA 1FXRA 2J7KA 2IA6A 2BR0A 2DGQA 1PYTA 3MMAA 3T5JA 2AX0A 5B0AA 5EWEA 4J9KA 4DX5A 4PXBA 2W2QP 3K5MA 5HMZA 5FD1A 4TY8A 2Y1LB 5KG1A 2MKYA 3CE8A 1VC0A 1GTHA 2E29A 1HWJA 1GX6A 2VG5A 3GFHA 1NKBA 3W2VA 2RRAA 3DRPA 2CQ4A 2W9AA 4FF2A 3PJXA 1W26A 5FLXY 1KHVA 4F04B 4HVZA 4ZLJA 4ECXA 4GVBB 2WCXA 2XWYA 2FJDB 4HT7A 4U8YA 3CJ3A 2JEJA 2RNEA 3LH2S 4H54A 2YH1A 2W7AA 4Y28C 3HZEA 3NKYA 4F3QA 5HBMA 5KFVA 1SJQA 1JLEB 4NCGA 1OWXA 4RU2A 4RUBA 3RR8A 2N4DA 3A8IA 1N32F 1SCJB 2FDNA 1S1TB 4IOBA 1IKYA 3CCLS 3CMES 1FDAA 3RBEA 5KFRA 2A1BA 2HQCA 3AODA 4HLBA 2ZE2B 1J5EJ 3MM6A 4PYAA 1S57A 1T9TA 1Q78A 4WP9A 3EXCX 4WFBQ 1Y3JA 1YZ6A 2RSQA 4LRDA 1RU1A 2QLBB 2GQ2A 4YFUA 4A8FA 4QWDA 2KYXA 4IRCA 3ZZZA 2K3KA 2OFHX 3MPWA 2CQ0A 4ANDA 3O8WA 4CIOA 4OZ5A 1KWMA 2RD5C 1PC5A 2GJ2A 1YJWS 1R43A 3GIKA 1DLOA 1N36J 1SJFA 4PYDA 4ERDA 2LQ5A 3AD7C 2HNYA 2IDEA 3G96A 3VR1A 1WC4A 2ZHBA 2XHWA 2IDLA 4X65F 2VPYB 4LIWA 2WHOA 3PW5A 1MWQA 5E3QA 3AJDA 1RLDA 2UUCJ 2BBEA 4PPDA 5KFEA 4Z37A 4USVA 1IBKF 1N33J 3BGRB 4ZVTB 3ONQA 3VAFA 1IQTA 4EGLA 4DSLA 1GNKA 1GK8A 1MMLA 5DO2A 3AA9A 4KGKA 1B0PA 5CYMA 2ZD1B 4XDCA 3H5XA 3KMQA 3KUGA 4I69A 4WFYA 1ZTTA 4A8QA 4HR2A 4XK8C 4OYXA 4DR1F 3KUEA 4J9VA 1RWWB 2A6OA 1H74A 5EN1A 4OZ2A 2YKNB 3TUPA 1BE4A 1N5TA 4HT5A 1V9OA 4KFBB 4TLQA 4L3NA 2MHNA 3HX9A 1D9DA 1UPMB 2CPHA 1U6FA 1H3DA 1D1UA 2VQFJ 3B78A 4ZPDA 4ZCLA 1JB0C 2VC1A 1XMOF 1KN6A 3KOAA 4PQUA 4C0HA 3BGFA 2B6AB 2YVSA 2FHOB 7FDRA 3M1VB 5DQGA 3PNIA 2MQMA 4FNIA 1X5SA 1UFLA 1RYSA 1QUPA 4DV3F 3O2IA 4QR0A 2HVDA 2GA7A 1DFDA 2V0NA 4YHHF 3LO3A 5B0FA 3NCPA 5KFCA 3BF4A 2OH2A 2Y9HA 3KG0A 3JSBA 2CPXA 2RQKA 4S0MA 1P1TA 4TNOA 2Z8QA 5E3PA 1M0SA 1FJ7A 4WXOA 2YWFA 2YWHA 3UD3P 4YOEA 3J7YU 1RT6A 4NXNJ 5L9XA 3R7BB 1HBNA 2MMYA 4RW7A 2AGPA 2FZGB 3IS9B 3ZZTA 2VH7A 4OYOA 1SUQA 1K47A 4OX8A 1BC6A 1IJFB 4M5KA 2OO4A 2HQDA 3QZ8A 2GGPB 3DI6A 1S0OA 4J5OA 4ZMMA 2KT2A 3TA0A 2FC9A 2RB7A 2XULA 3MPUB 4DV5J 3VAGA 2PIIA 3DYAA 1U6BA 2A2DA 4OIXA 3OR2B 2OPSA 1J2VA 2C2OB 4KGVB 3DM2A 4JI0J 2WW4A 3M2UA 3JTNA 3RG6A 4Y0FA 2C3YA 1U1PA 3CD6S 1BHNA 3W64A 4MIAA 3NGSA 2AJ4A 4W4MA 2QT7A 1YJ7A 3J80U 3V4MA 3P49B 4C4WA 4H4KC 2IAJA 4QPXA 4GMKA 3R8YA 2D3OR 2AEMA 2HMIA 4K4SA 3ADAC 2GMHA 4AQYJ 4C8KA 2XZWA 2GMLA 1OQ3A 3T6JA 1HD0A 3KLIA 5B0GA 1TL3B 3KHHA 3ENVA 1ITPA 4YB6A 4B9UA 3CJ5A 4I64A 4B08A 2W9BB 2DGXA 2RT3A 4DFMA 3MUTP 2MZSA 3OTEA 2BOPA 1RB0A 2R2TA 3ISZA 3G86A 5KG3A 2BW7A 2D3UA 3EGNA 5D77A 1TR0A 3M05A 1B64A 4BC9A 4GKJJ 1X0FA 5FDLB 4AE5A 4F02A 3TZZA 3WBZA 4QYZK 1H2TZ 4U7UD 2IM0A 4DBQA 3LWLA 4B3MJ 3GCXP 3L4BC 3L7OA 1LXJA 3G82A 1FVQA 3QATA 2BXJA 3LGNA 4ECZA 4RW6A 3CJ2A 3ZZPA 4KHMA 1Y10A 4A8WA 3D28A 4WK3A 4DI6A 4B9SA 1NM2A 3PVXA 4LF5J 2W2NP 4QWBA 3HM9A 2FTRA 1A6LA 2HNDB 1RT2B 2QGFB 2WVBA 1D0EA 4OI0A 1JXLA 5U47A 3TVZA 4CT9A 1FKPB 2FJBB 8RUCA 4HACA 3QT6A 2J9DE 3IWLA 1VQPS 3VAHA 2W9CB 1X4HA 4F67A 1IQZA 5CCLA 5KFAA 2W1BA 1EP4B 1N88A 1S6QA 4OJ3A 2ASDA 1JNRB 3W3SA 2YNIA 4JI3J 2ZBQA 3MPVA 2PMWA 3DFEA 1OY8A 4O3OA 2CJ9A 2UZAA 1RT7B 3KLHA 1ZM9A 5GAGU 1FFSB 1N5YB 3HVAA 3VTIA 5KFIA 4UUWA 2Z0GA 2KZMA 1VHFA 3ITHB 4JI1J 1OO0B 4H4KA 3HHDA 3I5CA 3HSJA 3CJ0A 2OHDA 3ILOA 5ETMA 1LOUA 2B51A 4PWDA 3G6YA 1L3KA 1NJXA 1C1CB 1WDTA 4N76A 4OZNA 4X4VA 3PXGa 1SC6A 1S72S 2O67A 4ILRA 4ELVA 2W7OA 3D0IE 3GZ7A 4IG0B 2V4QA 1YHQS 3L3CA 5B0BA 4NLQA 2BJ8A 1PKUA 4NE9C 3F41A 1VRQC 3TEGA 2L3MA 2VPXB 2IM3A 1HQUA 3T1HJ 2KDOA 2Q6CA 2KYZA 1NMEB 2RAQA 3DLKB 1O6XA 4TQSA 3KK2A 3DLGB 5AE2A 3QIPB 2GIRA 2WBRA 2DHHA 5D78A 1NAQA 3GE9A 4F0KA 4URSA 3EWGA 2FZCB 4X62J 3BO4A 2JVRA 5CCMA 4URGA 1R8AA 4K4UA 1N36F 1NPKA 2NYHA 1AUSL 4DR4J 1RTDA 3QGHA 2CQ3A 4NXMF 2JZ5A 1I94J 5T14A 5CABA 4PUOB 5C24B 2NXUA 3CDAA 4DFJA 1NDLA 1V5VA 4RWWA 3TUIC 2UUCF 4FXVA 2HHHJ 4P6QA 5HROB 2AZ1A 3RRHA 3BQ0A 2HFVA 1RT3A 4DQRA 2HW3A 4GKKF 4Q0BA 3POTA 1Q8BA 1Q1KA 1JLCB 4JI8J 2LQ9A 3BGUA 4YY3J 1GH8A 1CJTB 3DKDA 4ILMA 2IRYA 4RNFA 3QZ7A 2ZH5A 4OYPA 3U02A 3H8YA 1SB6A 4LR8A 1VQLS 5MLCV 1QAIA 3BS9A 3HMJG 1XEZA 1RACB 2CAJA 1M5KC 5HVFA 3KNAA 3KG4A 2B4OA 3GILA 2MGZB 1EETA 1WKLA 3PIPQ 2K7KA 1GAOA 3B54A 3FZ2A 2B5JB 1VQ5S 2VKRA 1RAGB 3T1YJ 2Z58B 3TAPA 1KLMB 2XLKA 2ZNYA 4DCPB 1JXVA 3MEGB 2XMJA 4DPYA 3PYGA 5HJYA 3BDEA 2J8AA 1QAYA 3GQCA 1RT1B 2HVHA 3U27A 2JVOA 3NNAA 3MTJA 4MFBA 2UV8G 2O66A 1VIXA 2GVZB 5DRKA 1TFWA 3NBPB 2C42A 2J6UA 2QN6B 3NOCA 2OTLS 4MAKA 3R27A 2IRUA 2YWEA 3B4DA 5BR8J 3BDPA 5DLFA 2HPUA 4YEAA 5T41A 4ZK7M 1F5AA 2UU9F 1F2GA 3PJ9A 5HANA 4ZITA 1RADB 3LPYA 5HP1A 3TYTA 4NXNF 3NGTA 5CXTA 4F4WA 3AHPA 3RW6A 2YKMA 4NLTA 1KQKA 1LFPA 2DNNA 2Q43A 3H7HB 4KB7A 3EGZA 4ICLA 3W66A 2IA0A 2VDIA 1TKZA 2DNPA 1CQMA 4F2RA 4DG1B 5IWAJ 3R2CJ 3A3OB 1RTZA 4USTA 2IJFA 2DHSA 4LFCJ 2HK2A 5M2UA 2YY3A 4ZVGA 3RZAA 2C2EA 5IT9Y 4K0KJ 4IR1A 3TJ9A 5GVQA 3NOGA 2VIHA 4QR2A 1JQGA 2M70A 1HYSB 2Q66A 5IS2A 1LK5A 5ETTA 3H25A 4KH1B 3R97A 2LXFA 1XQIA 3MMCA 2VD3A 2R3VA 2QZ8A 2W01A 4B9TA 1NSQA 2XMUA 3ULHA 4ZP6A 5LL6d 1RAEB 4OMFG 2K2PA 1K0TA 2M5YA 3CVKA 1G6BA 2P6TA 2HFNA 2KVIA 2AMCB 5HATA 1X4FA 1F5CA 4PR6A 1S10A 3CJKA 2RRBA 4ED1A 3HFVA 1WC3A 5KT6A 2LKZA 3PZPA 2UXBJ 5J2PA 5IM0A 2X51A 1VQSA 5LMNJ 3FQKA 4F4ZA 1YJRA 1U0SA 2CQGA 5IC4B 2B0GA 4M5HA 5EUHA 2EFPA 1AUDA 2ZC4A 3IA0A 5KFQA 1T9WA 1RWOB 2ASYA 1JWWA 2R8HA 2EWHA 4LF9J 4GKJF 2EBGA 1FE0A 3OJSA 4ER8A 5KAKA 5KG7A 2R8GA 3BQ1A 1NK0A 5HQMA 4FYXB 5KFUA 3BH6B 1HI0P 2RKIA 4O3PA 3GFYA 3CCSS 1FRHA 2ASJA 4C3LA 4B3MF 2DH7A 1K9MT 3KK1B 5A2QU 2Q3PA 2V69A 5ETKA 4C8OA 2QRRA 1F9FA 4DFPA 1CULB 1XNRJ 2DHGA 4DQIA 2ROEA 4OHXA 1FI4A 4LF5F 5I4MA 3Q8QB 2ROGA 4C8MA 1XMQF 3MWBA 2D7SA 4CLFA 2NSBA 4LF2A 1VFJA 2L41A 3UCZP 2R2SA 5J1NA 3K5NA 1RAIB 2BABA 2NXJA 3KG1A 3K8WA 2ADBA 2G0IA 5T7LB 2KG1A 3ENQA 4UY8T 2WSEC 3K2YA 5KFLA 4TVAB 3SSSA 2IM1A 2NXNA 2CPZA 2XMKA 2FD2A 4JI3F 3EGWB 1WEZA 1RTHA 2PSZA 5J1EA 2BKOA 3FJ2A 3CIZA 4AL5A 1VMBA 4Z7YA 2RUGA 2DXEA 1IKWA 2OPQA 2B4VA 1XBWA 3Q2SC 1EQ0A 1R0AB 4TU9A 4RBTA 2XS7A 2V8GA 4JI1F 3AQOA 2ZC3A 3HHNB 1DQ8A 3KLFA 5KT5A 1U47A 4ELTA 2BE2B 1EZZB 5B0EA 2ZH6A 3A3PB 2Y1JA 1DY3A 3FSYA 4A4JA 2MKCA 5CAAA 2YNFB 4OX9J 1C2PA 2VODA 3F73A 2BUNA 1NEEA 1SH0A 1WI8A 3ILJA 2HHWA 2KN4A 4DV7F 3VVTA 4PXCA 4P72A 2MTLA 3V6JA 1HNXF 4DL0C 3I9ZA 3HJVA 1KOOA 1LWFA 2QYGA 3OXGA 4KAIA 3OD2A 4OI3A 3KXDA 1EIYB 1VLOA 2MEWA 4WTYA 4CLSA 3IAS9 2IPOB 1QLNA 3M8WA 1C0TA 3MM9B 1YJTA 2FUG9 4DR7F 5A6PA 2ALYB 4ZCKA 4KPCA 2BJ3A 3T1HF 4ECYA 2BW2A 3ZZYA 2VG6A 2IMWP 1YJNS 4U8VA 1JLGB 4UT4A 2XC9A 4DHVA 2XI3A 2RDJA 2ZVIA 3EYZA 1MMNA 4YDXA 4CLYA 1R8HA 3CGIA 1WG4A 2UVUA 2BKNA 1S4FA 1SQFA 1X5PA 4CLWA 3LP1A 1D3WA 3TW0A 3CULA 2HIQA 1T94A 3M2VB 4DR4F 5HAOA 1OIAA 1TKDA 3MMAB 6FD1A 2H51B 2WRMA 1I94F 5AJ3J 1FXLA 3J81U 4GRSA 1VR6A 2M8HA 2VFTA 4Q8EA 3JTPA 4LBPA 3T9ZA 2DGOA 1SL0A 2DH8A 1N0UA 5AXKA 2HFSA 4ED8A 2MHEA 4E2FB 2V63A 1R7IA 4OZ0A 1NHKL 2IFXA 1NK5A 1TUWA 1VRUB 2ZOMA 4PXDA 3W2VB 4DL3A 1VBXA 3DRPB 2MDAA 4JI8F 4MK8A 4ZPBA 5HVGA 4YY3F 2DPIA 4DPWA 2CNLB 2XZDB 4R8UA 3P5TL 3BB5A 2R7QA 2HBZB 2P5VA 5KFKA 2VFSA 4ZA1A 4XPCA 2PA8D 3ZFVA 4J9UE 5GADU 4DQSA 1WJ9A 3I4PA 1KR4A 5KG5A 3AXMA 4NCGB 2VASA 3F0NA 4L74A 3SSQA 3BBBA 2WK4A 3THTA 3LQVA 3T1YF 2UUBJ 3JSYA 4NLWA 1RSCA 1IKYB 4L75A 3R5DA 3H0PA 4M5MA 3TOQA 1HPZA 1HMVB 3TQEA 1KTVA 1Y5LB 4NLPA 2V8HA 5AE3A 3M8SA 2Z2MA 2CA9A 4B9VA 4GC6A 2AYMA 2E44A 4ILLA 3C6TB 2X7IA 1KEKA 1U49A 2KM8B 1WKJA 4MYTA 1U48A 3MM6B 3V6DB 3W8PA 1QUVA 3WX8A 4OZ1A 1KLNA 5AXMA 3T1AA 4DV2J 1M5VC 2VU5A 1XC9A 4DSKA 2MY7A 1N5QA 1KFSA 3NXZA 1RP5A 3SXLA 1SIWB 3KWMA 4JI6J 1UL3A 3I82A 1GXTA 3OVBA 1QTNB 1ZS6A 1FD2A 1LW2A 2I1RA 2QJ3A 3N9UC 3I0RB 3I56S 1VYAA 2JSXA 3HHKA 3DGPB 5IOLA 3E3XA 4OX6A 1JLQB 4QBUA 1TKXA 2XYHB 2R2RA 2HZVA 3DLJA 1DLOB 4JV5J 3R7NB 1NKEA 2KH9A 1HW8A 2HNYB 1Y5IB 3HSZA 4NYPA 3GSIA 4RKUC 4KR0B 2QIFA 3A4TA 1YRUA 2YWWA 1YDLA 4PG6A 3BGRA 3HVWA 4KQZA 4L3KA 2HRYA 2JFKA 4C0BA 2YNGA 2ALZA 2GMJA 3OPKA 2ZD1A 3NAIA 3M9MB 1R6VA 2PC6A 3EDRB 5CYMB 1R0CB 3SCLE 1MN9A 2XY7A 2XCAA 1X8DA 1BD6A 2NS1B 1F2HA 4M5JA 2QSFA 1PAEX 3SIPB 3OJUA 4ED7A 1Q95G 3BN4A 3M32B 1VC6A 5DM7Q 1TAUA 3AQPA 1NSAA 3CT9A 2Q1LA 2G2ZA 1ACMB 1VC5A 1DARA 4MMOA 1K1QA 5H9FJ 1X5OA 5IT0A 4JOUA 4K7QA 2UXBF 4LRFA 3CDEA 1FFGB 3UVJA 3Q89A 1QTMA 4J37A 2C2RA 4C97A 1UJ5A 3ZNUA 3A8EA 5LMNF 3H2VE 1QM9A 1Z4UA 1KHWA 4PQUB 5HN0A 1FJGJ 3FFIA 5L1JA 1KVKA 2JLEA 3FC9A 2HQGA 2MKIA 3R5BA 4P73A 1NJZA 2EPIA 2XS2A 3T5LA 3P96A 1ZPVA 3D6FB 5K8PA 3LA0A 1RWUA 1SC3B 1VQKS 4X84A 2EBEA 2ROPA 3K7RA 4X2BA 1QAXA 2ZH8A 3T41A 4DR5J 3OLAA 2GHPA 3VAMA 4J9QA 4DZ6A 4RWXA 3GP9A 3N28A 3G71S 1I3OB 5KFTA 4EZ6A 3FK4A 1REGX 3F44A 3E01A 1QVFR 1WC0A 3QYYA 1FEHA 3UCGA 1XNRF 3K59A 4RW7B 1KONA 3D2WA 1FDDA 3NWGA 5G4DA 5SUHA 2W2OP 4MTPA 3QSIA 3MCOA 3H5YA 4XO0A 1SUQB 4Y2AA 2XWXA 1T9XA 1YIJS 4P71A 1UVJA 3W7BA 1JJ4A 3Q8YA 4QWAA 3RUBL 2GJFA 1NNDA 3JSMA 1NK7A 2ZM6F 1O51A 3W61A 3H4BA 1O5JA 1AA1B 1FTCA 2DGVA 4X4OA 1AFJA 1GXUA 1UP1A 1DZ5A 2J8SA 4CI0B 4DLGA 3M2UB 3X1LB 4NCBA 3THPA 2V8PA 3DRYA 1EHWA 4X64F 1NK6A 2AZ3A 3I96A 4X4NA 2B9WA 2DY1A 2IAJB 4H4MA 2X1FA 2HHPA 1AW0A 2HMIB 3QRQA 2OAUA 2YX7A 3JTOA 1CBKA 2VL1A 4LRCA 1SPBP 2V2KA 5C7PA 4O3SA 1TL3A 1Q81T 3ISNC 3LUYA 4N8NA 5KT4A 1TUVA 3FRZA 2GVDA 4QIGA 3KLIB 3MF5A 4KC5A 3LP0B 2RVJA 3BO2A 2AX1A 3PFEA 4TQRA 2GCFA 4WCEQ 5DG8A 1WOOA 1KNZA 1B0VA 4BBYA 1JNZB 7AT1B 1Z2ZA 2JJ4D 1HWUA 3OL6A 2NCKL 3PKMA 2J9EA 1F3FA 2VDHA 2J0WA 4JI2F 4QCLA 1P1LA 3NGUA 1CC7A 2V67A 2VJVA 3PCOB 2XQCA 2D1CA 4UW2A 1RU2A 4Q45A 2FJVA 4D3HA 2AKWB 3TAMB 3QBCA 2VF3A 1WTBA 4XAKA 4F4XA 3GYNA 2PFFB 4USIA 3TANA 1TKTA 3G82B 1U1RA 4AL6A 2P8IA 4N5SA 5LSOA 2DVIA 3GV8B
chains in the Genus database with same CATH topology
4TY8B 1XMOF 2FPHX 4OHYA 1KN6A 1TVRA 2B9XA 3KOAA 2NSCA 3LANA 3MR2A 4B9MA 4PQUA 2F40A 3LP2B 4C0HA 1FVSA 2JLGA 3BGFA 2B6AB 3H20A 1FRXA 3SDEA 1X4AA 3GMGA 3OV7A 2YVSA 2FHOB 7FDRA 2IC3A 1BQMA 3SSRA 2MQQA 4FF3A 2HNDA 2VG5B 3M1VB 3CO9A 4WE1B 3RW7A 3T6BA 2KFYA 3ETOA 2FGCA 4Z2XA 5C25B 5DQGA 3MECB 3PNIA 1CQNA 1TQLA 2MQMA 2QLXA 1S79A 1FRIA 1X5SA 4FNIA 3VZIA 4ZHRB 5HQ8A 2GIQA 2E7XA 1TK0A 5KT3A 1UFLA 1RYSA 5L8RC 1QUPA 2K1RB 3MZIA 3CDBA 4O44B 4F26A 5EX3A 3QWPA 5AJ3F 4DV3F 3O2IA 2LQJA 4QR0A 4KIAA 5L38A 3VAKA 2HHTA 1FKPA 2CJBA 2E1AA 3MCSA 2GA7A 3M6WA 2V0NA 4YHHF 3LO3A 1DFDA 1NHUA 2VBZA 3OQ2A 3NCPA 4NZ0A 5B0FA 3BF4A 5KFCA 3NP5A 4LSLA 3GWCA 4C98A 2OH2A 4OHWA 1KC8T 5LT5A 2ZHAA 2ZJRQ 5G0RA 3KG0A 2VBYA 3JSBA 1S9GA 3OR1A 2CPXA 2RQKA 2R7OA 4WJBA 2B43A 1GQEA 4NZ7A 2FLPA 1P1TA 4HI2A 4X4UA 1U2FA 1EP4A 3GG0A 1F60B 4TNOA 3MDFA 2Z8QA 1JLEA 5KFBA 1HBMA 4I7FA 4OHVA 5CZVA 5E3PA 2HGMA 4BCAA 1NH8A 1M0SA 1FJ7A 4WXOA 2YWFA 2YQ3A 2YWHA 5HBMB 3CCES 1FDBA 3UD3P 4A47A 2RF2B 3TA1A 1FJEB 2BZ2A 4YOEA 4TU8A 4ATNA 4ZPCA 3J7YU 1RT6A 1U1NA 2DGUA 1PSDA 3CSKA 5L9XA 4U67Q 3RAXA 3DOLB 4WU3A 2KB2A 4Y65A 2N82B 5L1KA 3TQ1A 1U1OA 1HBNA 2MMYA 1NK8A 4RW7A 1S1TA 2EW9A 4MKYA 4IFVA 3HZGA 2ILZA 2PD1A 3HKWA 2QFJA 1VQ6S 1U1QA 2AGPA 4FP9A 2HHXA 3KLHB 2R9LA 4MIWA 4C3KA 4DFKA 4DEZA 3ITHA 1FHTA 3IS9B 3ZZTA 3N5BA 2VH7A 1SUQA 2KT5A 4I6YA 3I0SA 4OX8A 5DJBA 5J2MA 1BC6A 2ZE2A 1IJFB 3DNCA 2OO4A 2XSJB 4EU0A 4OI2A 2UP1A 1YJVA 1K8AT 5DDRC 3DXSX 5F3ZA 2WOMB 4HHJA 3N0VA 2WONB 3DOKA 4NL5A 2J7WA 1SI9A 4CO3A 1C0UA 2AW0A 3QZ8A 3PW2A 4KO0B 2GGPB 3M8QB 2MQNA 4HYKA 4JBCA 2AYBA 3DI6A 4NRUA 1S0OA 4XPEA 3NNHA 4J5OA 2LDIA 4WIIA 1V6HA 4ZMMA 3T3FA 2KT2A 2HWHA 4O3QA 1K73T 3TA0A 4FNHA 3CCZA 5J2QA 1L3TA 4U7CA 2W8KA 1FTRA 2FC9A 2X1BA 2RB7A 2XULA 3CD0A 2J0SD 1FKOA 3VAGA 3BM7A 3UFCX 4JYAF 1L3UA 2NUHA 2PIIA 3DYAA 2A2DA 1U6BA 4GO5X 2NZ4A 2FGOA 4OIXA 3OR2B 4PKDB 4BC7A 4A46A 2OPSA 5BR8F 3D5MA 4PWDB 1J2VA 2DGSA 2BYCA 3M8PB 3C8YA 1FDNA 1UAWA 3N6LA 5D6GA 4K4ZA 3DM2A 2VZ9A 5KG2A 1MMDA 3HI9A 1AFIA 2MKSA 3M2UA 1VOMA 4ZP9A 3KMSA 3JTNA 1WHXA 2HNZA 4K4YA 4QW9A 4ES2A 2W24A 2C3YA 5IQQA 4Y0FA 4IUFA 1U1PA 2C22A 2B7CB 3CD6S 4IG0A 4MIAA 1RISA 2AJ4A 5GADI 4X4TA 2QT7A 4DQPA 2GO8A 3CEDA 3V4MA 3M8RA 4J9NA 3P49B 2D9PA 2QSWA 3FEYB 5GAHU 4Q2MA 2L48A 3VWSA 4C4WA 4H4KC 2IAJA 1N6QA 4QPXA 4GMKA 4J9OA 1CPZA 1TL1B 2K8GA 2D3OR 4CTAA 2GC8A 3US5A 4RUHA 4IO9Q 3ICLA 1Q86T 1S76D 2VFRA 2HMIA 3HO1A 1Q16B 1R8BA 1S1UB 4K4SA 2VA2A 2GNKA 2PMHA 2GMHA 3HF5A 2EFVA 3BZQA 4C8KA 2XZWA 2EFOA 1CVJA 3DLGA 5IWAF 5I42A 2GMLA 1OQ3A 4CNZA 1MROB 3O3LA 3T6JA 4W90B 5KFXA 5KOWA 1VBZA 2GX8A 3LGMA 3QIPA 1HD0A 1QSYA 1GT8A 3KLIA 5B0GA 4H4OA 3KK2B 1X4GA 5D4OA 3OL9A 2HS0A 3ZC4A 4C8LA 1S9EA 1TL3B 4ITSA 2X1AA 1FXDA 5K8OA 4LFCF 4ZPWR 2QV6A 3KHHA 2DBBA 2RJZA 3C2PA 4JI6F 1LW0B 3ENVA 4ZP8A 2DIVA 4YB6A 1W25A 2N7CA 3CJ5A 4B9UA 4I64A 1TL4A 4K0KF 2DNQA 2XB2D 4B08A 2G13A 2IVYA 1UJ4A 3QJJA 2OFGX 2W9BB 2DGXA 1FK9A 2RT3A 3TRGA 1KQGB 4F4KA 1UEUA 4DFMA 4KV8A 2LEPA 2R8JA 4F8RA 4RU9A 2DD8S 3MUTP 4ECQA 5CZXA 2MZSA 3OTEA 2BOPA 3VF0B 3GYXB 2BQUA 5E3AA 4JV5F 5L1LA 2R2TA 4K2XA 4BDPA 1ZZFA 5LXYA 3ISZA 1RTDB 3G86A 5KG3A 4C3MA 4PUOA 1OPZA 2D3UA 3G6VA 3EGNA 4L72B 5D77A 3WC0A 1TR0A 2F9JA 4QZVB 3M05A 5JVHQ 2V4RA 3NS6A 1S9FA 1MNEA 1U1LA 1B64A 4BC9A 4G1QB 1SJ4P 2O5DA 2D74B 1X0FA 5A6WA 1B0TA 3D1OA 4NWBA 5FDLB 2CQCA 3W2WA 4AE5A 5KFDA 3G8QA 2DRBA 3H5UA 4F02A 1NO8A 3CCMS 2V8DA 4B3RF 2R2UA 1QSSA 3WBZA 2LYVA 5HROA 5KFPA 1H2TZ 2UV8A 1URNA 4ED5A 2IM0A 4DBQA 2V5HG 1KSPA 2YKNA 1LQ9A 5HLFB 3OXLA 3ZZUA 4K4WA 3V4IB 3HLUA 3LWLA 2AGOA 4KFBA 1L3SA 1XMBA 2IJNA 3CC2S 1KQSR 2QA4G 3UE2A 1R6YA 1M5SA 3L7OA 2FJWA 1LXJA 3IGNA 1FVQA 2JDJA 3DU6A 3TR5A 2L9DA 1JLCA 1N0VC 2EFGA 4ED3A 1QE1A 1WG5A 2BXJA 3LGNA 3GFZA 4ECZA 4RW6A 3CJ2A 5BYRA 2XS5A 3J81Y 4Q0BB 3ZZPA 3POTB 4KHMA 1T05B 1VRTB 2YX4A 3BR9A 4EO8A 1MW7A 4A8WA 3D28A 4WK3A 5E3RA 4ELUA 3LP2A 2LA4A 4I6WA 1O8BA 4NYOA 4B9SA 5GMKa 2B6AA 5DQHA 1Q8IA 1JLBB 3PVXA 3DDNA 4CO5A 3OSNA 2P9EA 3R5CA 2OPPA 4QWBA 1S6PB 3M1VA 5KTQA 3HM9A 3H4DA 2FTRA 3MGJA 2MSSA 5K14B 5C25A 4J9PA 3SDEB 4ZHRA 2EFNA 3DC2A 3NCQA 5KFYA 2IC3B 3BSOA 4DSFA 1XR6A 5M2RA 2CFXA 1A6LA 2E5JA 3M2RA 2HNDB 2K1RA 5IT4A 4DR6F 2UVVA 1RT2B 4O44A 2IBKA 2FVQA 1VK8A 1N5VA 2MZQA 2VPWB 1DURA 4HH1A 3IO1A 2M9KA 1D0EA 4OI0A 2JRSA 3K5PA 1JXLA 5U47A 4LF9F 3TVZA 4HEA9 1YJUA 4LSNA 4CT9A 1URRA 1FKPB 3P3DA 2FJBB 3NL0A 3CXCR 2ZH4A 3IR7B 3IFEA 1LWCA 2AP6A 3PKYA 4Q7AA 2J9DE 3OHBA 1H38A 1MSWD 3IWLA 2VV5A 2DTJA 4LSLB 1VQPS 3VAHA 1SKSA 1SKRA 1QSLA 4HKQA 2C28A 1LV5A 2F4VF 1S6OA 2W9CB 1X4HA 4YUDA 1C4AA 2FVCA 2EK1A 4LT6A 4F67A 2I38A 1HI1A 4FF4A 3MFIA 2HAIA 4BS2A 1P6TA 1IQZA 4DOZA 5CCLA 5KFAA 2VOOA 1EP4B 1N88A 1S6QA