2NLWA

Solution structure of the rrm domain of human eukaryotic initiation factor 3b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
GDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 3 subunit 9
total genus 17
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nlwA01
2QFJA 1WG4A 1OIAA 4CIOA 2FHOB 3G8SA 1OWXA 2LCWA 3I55S 4WFBQ 3MURP 5HO4A 4ERDA 1UP1A 2DHAA 1KOOA 4TU7A 1U1NA 3CCJS 4WF9Q 2XSFA 3U1MA 2KT5A 1YJNS 3CCUS 1M5OC 4BS2A 2Q79A 2DH7A 2GHPA 2MYFA 4TU9A 4EGLA 4PRFA 1HA1A 2MPUA 3OW2R 3ZZYA 2F9DA 3BS9A 3MUMP 3G8TA 4QU7A 2DGTA 5CYJA 1WHWA 3NS5A 2MHNA 3S8SA 1X4GA 3IWNC 2CPIA 5GADU 5H1SV 5DDPC 2MB0B 4F26A 2OTJS 2KM8C 3ZZZA 2MZTA 1VC5A 3G4SS 1BY9A 1S79A 2ZJRQ 3DXBA 3SDEA 1B7FA 4P6QA 3J7YU 1M90T 1R8HA 2KU7A 3RW6A 1KD1T 1YJWS 1K73T 4OZ1A 5GAHU 2JVOA 2L08A 1P1TA 3D2WA 3MD3A 3K0JA 3EX7B 2YWKA 1VBZA 2JVRA 3G6ES 1OO0B 1G2EA 2AYMA 2CPEA 5GAEU 2LXIA 1U1QA 1A7GE 1YJ9S 2J8AA 4CH0S 2DNPA 2LA6A 2LMIA 4CH1A 2ADBA 2HYIB 2D9OA 4PR6A 4U67Q 5HL7Q 2MGZB 2DISA 1JJ2R 2M4MA 4LMZA 2DGUA 5DDOC 2CPFA 2V94A 3R1HA 1W2BR 2RUGA 5MLCV 5GAGU 1Q81T 5D78A 2MJUA 1OPIA 1KQSR 2X1FA 2ERRA 4QQBA 2DHGA 3VALA 1N52B 1YI2S 2DGQA 2AYBA 1H6KX 2M8HA 1U6FA 2X1BA 1RK8A 2DGXA 3B4MA 2CQ4A 2M70A 4WCEQ 2MGZA 3CXCR 2DNZA 3CCQS 2LEBA 3NNAA 1L3KA 2MKKA 1X4CA 4F02A 2LQ5A 1FHTA 2YH0A 2RQCA 2OSRA 5GMKa 3MOJB 3P6YC 1WG5A 3VAHA 3G71S 1X5SA 1WI8A 1NU4A 2KG1A 2OTLS 4C0OC 4YUDA 2I2YA 5BJRA 3EGZA 3UCGA 1WEYA 1UAWA 5ITHA 2MXYA 2NLWA 1M5VC 2MJNA 2CQ3A 4WFAQ 3SDEB 2LYVA 3UWTA 4LJMA 1SJ4P 1WF0A 2CQBA 1U1MA 4FXWA 2QA4S 4WIIA 3HI9A 1VQLS 2J76E 2OSQA 3PIOQ 2MZQA 3ULHA 2DO4A 1VQNS 2PEHA 2HVZA 1PGZA 2G1DA 2MKCA 2M0GB 2EVZA 3UCUP 2AYEA 2CQIA 2MZJA 2YH1A 2AYGA 2MKHA 1X0FA 2DITA 1Q86T 1FT8A 2MMYA 3H2VE 5JVGQ 2KXNB 3JB9k 4C7QA 1WF1A 3G9CA 3SMZA 3CMAS 1M5KC 2KXHA 2CQGA 3VF0B 2G4BA 1X4AA 2CQ1A 2RRBA 1ZH5A 2E5IA 3UD3P 2DGVA 2FY1A 2DGWA 3HHNB 3NS6A 2MQNA 1D8ZA 4M5DB 2CQPA 2VOOA 4UQTA 2N3OA 3U1LA 1UFWA 2WBRA 2DNMA 3G96A 2MQQA 1WEZA 3TYTA 3H2UB 4ED5A 2GO9A 3CF5Q 5JVHQ 4F25A 2KH9A 3S01A 2CPXA 4TU8A 5LSLA 4QPTA 2K8GA 2DNHA 5DDQC 1M1KT 2DNNA 1SJFA 2KRBA 1XN9A 1DBDA 1R8PA 2MKSA 3FEXB 1U1OA 2L41A 2CJKA 2VOPA 2FC8A 5LJ3Y 1VC6A 1FXLA 4W92B 4IOCQ 2CPHA 2M2BA 2MZRA 1QVFR 1F9FA 1ZZNA 3J7ZT 2XB2D 4OZ0A 3MUTP 1WELA 3N9UC 2E44A 3P3DA 2KG0A 2CPJA 1QM9A 1X4HA 2DHXA 1VQMS 1N8RT 3DLLQ 2DH8A 1VQ9S 1U1LA 3FEYB 2FC9A 3V4MA 1WTBA 4Z2XA 2K3KA 3CC4S 1X5PA 2M8DB 3IRWP 2MY7A 2M88A 1SXLA 1WG1A 5CXTA 2MQMA 3Q2SC 2LKZA 1M5PC 4Y0FA 3P49B 1SJQA 2SXLA 3CUNA 3MUVP 2RQ4A 1VBXA 3UD4P 3PIPQ 1S72S 2MSTA 2MZ1A 2LXUA 2DNGA 2LEAA 2DNKA 2OJ3A 2DH9A 2U2FA 3BEGB 3S6EA 1WHVA 2DIUA 3UCZP 5CA5A 2U1AA 3CCVS 2EK6A 2ZJPQ 2E5HA 1X4DA 4IOAQ 4QU6A 3CD6S 4YB1P 2M7SA 2O3DA 2DNLA 2MKIA 3CC7S 2VONA 2MY8A 3THTA 3TO8A 2OIHA 2KN4A 2BZ2A 2M9KA 2MZSA 2UP1A 2MQOA 2A3JA 1U2FA 2N82B 1Q7YT 2HGNA 2JX2A 2KXFA 2XNQA 1AUDA 1X4BA 5FJ4A 2X1AA 3UE2A 1VBYA 3CC2S 1ZZFA 2MQLA 2CQCA 2PE8A 5IQQA 1X4EA 2AD9A 2HGLA 1VQOS 1JJHA 1A9NB 1SJ3P 1VQ4S 2DGOA 1FJEB 3LQVA 2J0QD 2JWNA 2N7CA 5DDRC 3CCSS 2DIVA 4CQ1A 1IQTA 3EGNA 2CPZA 1X4FA 3SXLA 2KI2A 5LXYA 4WKRA 4IO9Q 5LJ5Y 4UY8T 2CPYA 1K8AT 2CPDA 1HD0A 2XS2A 2DGSA 3BO4A 2F9JA 1VQ6S 3CCES 1YTYA 2CQDA 3LPYA 1FJ7A 2RT3A 5IM0B 1U1PA 2KHCA 1CVJA 2CQ0A 2LA4A 5EN1A 2DNYA 2F3JA 1DRZA 1U1KA 3P5TL 3CULA 2KRRA 1PO6A 3CTRA 3R27A 2KFYA 2HGMA 2YKAA 2EK1A 5LXRA 2RU3A 1P27B 4V19X 3CMES 2RRAA 2ADCA 1JMTA 4C4WA 2DO0A 2N3LA 4RU2A 1WI6A 1FO1A 3CPWR 3B4DA 3BO3A 2B0GA 1Q82T 2KVIA 2HZCA 3US5A 3CCRS 2MQPA 1WHXA 2G0CA 2JRSA 2XS5A 2KM8B 5IFMA 3MI7X 2YTCA 5DETA 1DZ5A 1URNA 2RS8A 5D77A 2DNOA 1WF2A 1X5TA 4W90B 3NMRA 3VAKA 1D9AA 1WWHA 1VQKS 4J5OA 2MKJA 2RS2A 1O0PA 3Q2TC 4WFNQ 4FXVA 3VAGA 1YIJS 1N88A 3TP2A 1YITS 2XS7A 1WEXA 1WHYA 1JJ4A 5LSOA 1YHQS 3MDFA 2BOPA 3S7RA 1N54B 1VQ8S 2FPHX 2E5GA 5GVQA 3NNHA 5DM7Q 1FJCA 2DK2A 2LECA 3MD1A 3THPA 5DM6Q 2RVJA 1HL6A 3I56S 1SJRA 2XNRA 1VQ5S 2DB1A 3VAMA 1DHMA 5IM0A 3VAIA 1QVGR 1NO8A 4PKDB 3CCMS 2L9WA 2X1GA 2QEXS 4LIRA 2DNRA 2I38A 1VQ7S 1X5OA 2DHSA 2D9PA 4ZKAA 2ZJQQ 3NNCA 1U1RA 4TLQA 1UW4A 2CQ2A 4Y00A 1RKJA 1H2TZ 1VQPS 2VODA 2DNQA 1HD1A 3CCLS 1FNXH 3RW7A 2M52A 4A8XA 2RNEA 2D3OR 1U6BA 1H2VZ 2KYXA 1VC0A 1K9MT 1KC8T 2MSSA 1KOHA 1YWXA 3L3CA 3VAJA 3VAFA 3R1LA 4IUFA 2NZ4A 1NJIT 3MXHP 1H2UX 4YOEA 2CQHA 2J0SD 2E5JA 3BO2A
chains in the Genus database with same CATH superfamily
4K8RA 3ILOA 1D9DA 3SBMA 4HACB 1EHWA 3CB4A 4R8UB 2JLGA 1AYEA 3CSKA 4U7UK 5B09A 4F3OA 1BD6A 2AEMA 2C3OA 4QR2A 3AA8A 3C19A 5EWEA 3PFOA 1KOOA 1NSPA 1T95A 2YWFA 4M5MA 3CCJS 4H54A 2OHDA 1U1NA 4JI1F 5IOLA 1R89A 3HXMA 3ZFVA 3TAQA 4B9UA 4X62J 2QA1A 1Y11A 4ZVEA 3A3PB 4BS2A 3I0RA 4K5SA 1GQEA 1IWAA 4CO3A 4PRFA 1VHIA 2J5AA 1EP4A 1S49A 2YQ1A 3DOMA 4TY8A 1KQKA 4C3MA 5HVGA 5KFMA 1HWLA 4LF5J 5B7WA 2CA9A 3ZZYA 3EXYA 5CYJA 4JI5F 4JI7F 1TKXA 5IC4B 3E3XA 2Z2LA 4ID5B 2YX7A 3HZEA 3OTCA 4RX6A 1BE4A 4WFYA 2MHNA 2B4UA 2HVHA 3S8SA 4H4OB 3QAUA 1PAEX 3BPSP 3IWNC 2BOAA 2C2DA 3I82A 1JX4A 1NAQA 2G1HA 2MB0B 1WOSA 1Q8IA 4H4OA 1RU1A 2KM8C 3ZZZA 3KUGA 1JB0C 1AFIA 1KQGB 1S79A 3TJAA 1EB0A 2R4FA 2YKNB 1F3VA 4LR8A 3W1YC 4CI0B 3DXBA 3SDEA 3RBEA 1N32J 4DDFA 3G82B 4J9UE 3FMBA 4FDFA 4NLYA 3Q89A 4CH7A 5HMZA 4RNNA 3TUIC 4P10A 2J9CA 2R3VA 5BXIA 1TTHB 4ZLJA 5A2QU 5EWGA 2KU7A 2Q6CA 2B9WA 4OJHA 2EFVA 1RBOB 4JV2A 2Z2YB 2OFHX 3RB4A 3TX8A 2L08A 1P1TA 1PYOB 1CULA 4HT7A 5HI7A 4ECRA 1SCJB 1PSDA 3ZXWA 1T7PA 3MD3A 1VQYA 2UXBJ 4KV8B 3EX7B 4DS5A 1RAAB 1CULB 1OO0B 4ZPCA 1T9VA 1RA7A 2AX0A 2LQJA 1V5VA 1UCNA 5B0BA 2DYAA 4NCBA 2A18A 2UXBF 4EO6A 2C2OB 3J81Y 2KT2A 4UW2A 1NK9A 4Z37A 1MW7A 2N4CA 2J8AA 2F40A 3C6UA 1NKEA 2WCXA 2HBQB 5F0WA 2HYIB 3OV7A 3I6PA 2XCPA 3TRGA 3QIPB 3M2RA 3SCLE 2D9OA 5FDLA 4QW9A 1IBLJ 2KVQE 4RUHA 5KFUA 1CJTB 3MECB 4YR0A 3KMSA 2DISA 2EPIA 4ICLB 4LMZA 7AT1B 3K8WA 1NB2A 2ZVSA 1W2BR 3B78A 4B9NA 2P6SA 4LRAA 4J9NA 4LBIA 2OEKA 4ZVTB 4PG5A 3W9HA 1F1BB 2BE2A 5D78A 3HO1A 2ZC4A 2K06A 3JS9A 3HVAA 3M8QA 3N0VA 3D5MA 1OPIA 1WKKA 1EX8A 3PRBA 1Z1ZA 3KKFA 1KQSR 2X1FA 2O1PA 4JI6F 1T03B 1N52B 4TN2A 1RKIA 1FX4A 1WDDA 2J9DA 3DLKB 3MHYA 1JLAA 2A2DA 1H6KX 3FMWA 5HJXA 1ZTWA 3R2DJ 1HMVB 1U6FA 2W1BA 2X1BA 1RK8A 2BJ7A 3FSXA 5KFLA 4IRCA 2DGXA 2FUG9 1RJJA 3B4MA 4X66F 4JB8B 1UZDA 3HFKA 3W63A 3NNAA 4JYAF 4M1KA 1FJGJ 2ZC3A 3JSMB 4O0IA 4DPOA 2OPRB 4K4WA 2NS1B 1N0VC 1FHTA 5LT5A 1S9EA 1VQSA 2RQCA 3M30A 2RKIB 5J1PA 2ZKTA 3QRQA 1WG5A 2RH3A 1FESA 2XZDB 1BGXT 2DXEA 1M1HA 2OD6A 5IXUA 3PV8A 3D1OA 2FVRA 4CM2A 2C2RA 1KWMA 2H9ZA 2YKPA 4MYTA 2VV5A 3O3LA 4OHZA 5L1KA 2KG1A 4YP3A 3R5CA 3R1HA 1REVA 4P7TA 1SUQA 3LP2B 4NLUA 1YJUA 4DUYJ 1KVJA 5CZXA 4MYUA 4NLQA 2KHDA 5KFZA 3LH2S 3LP0A 2P8IA 2ZBRA 5BJRA 1P9QC 3Q8RB 1VR6A 2J8SA 5BYRA 1WEYA 2RILA 3ENVA 1UAWA 3MM6A 5ITHA 3KLEB 1PAUB 1S6QA 2W25A 3D68A 3OLBA 1SB6A 2EFPA 3AJ2A 4JI3F 1RAEB 4JI2F 4RW7A 6FD1A 3MGJA 4LJMA 4URGA 3M9MB 4A4JA 1SKUB 2UUBF 1IQZA 4FXWA 1TMMA 3LUYA 2HQIA 2LEPA 4C8LA 3OSNA 1NXIA 4F4AA 5DG8A 3HFVA 3QBCA 2IVYA 4FYXB 4JI4F 4CZCA 4MAKA 2B5JB 5A8RA 5J2PA 3V6DA 3D0HE 2MZQA 3ULHA 3QGGA 3OPKA 2GAGC 4IRDA 1RTJB 3FZ2A 4WXWA 4YR2A 2WVDA 2ZH2A 1XNQJ 2WB1D 2YQ3A 4ECWA 1DQ9A 4Y28C 1HNXJ 3KMQA 2OGUA 3ET6B 1MU2B 1UWBB 2AYEA 2CQIA 2VDHA 3JTPA 4DV3J 3UCUP 2IA0A 3FGVA 2DJWA 3GIMA 3H42A 3OT9A 4I64A 1X0FA 1WC1A 2QT7A 1D3WA 2QO3A 3QT6A 1ZETA 1BQXA 5KFVA 3P45B 3DM2B 2E1PA 4OI1A 2VFTA 2UUTA 1E6VA 1MSWD 1C0TB 4P2SA 3CDWA 2XLIA 5IT9U 4P2MA 4PABA 2NPIA 4PXDA 4DCPB 3CJTA 4E0DA 2GAHC 5F8MA 4WZMA 3E01A 1P1LA 3HFZB 3RBZA 2CQGA 4C8OA 1HPZA 2P9GA 2A0FB 5KT7A 3QZ7A 1ZH5A 4YB7A 3UD3P 4DBQA 2AZ1A 2DGWA 1LFWA 2HEKA 3NS6A 4K2JA 4QOTA 2XY6A 1VCTA 3NL0A 1HBMB 4BC7A 3O5TB 1RHJB 2CQPA 2VOOA 5E3AA 2DXDA 1JNRB 1AFJA 3TVZA 3BQ2A 5KT3A 3GE9A 4EK2A 2H1YA 3K5PA 1U02A 5K14A 3MR5A 1YRTA 3PR5B 1RHQB 1TL7B 2IDEA 3G96A 2C2NA 2LXFA 4R0EA 4FPIA 4ZCIA 1WSVA 4LF7F 4DUTA 4QWBA 3BBFA 3Q24A 4DR2F 2B7BB 2B51A 1TV6B 2PT0A 4KR0B 4MK8A 2AU0A 2EC2A 1V9OA 3DHWC 4HR2A 3OUYB 2VHGA 1LXJA 1NHUA 5DO2A 4RBVA 1VRUA 2CPXA 4ZVUB 4TU8A 4ED2A 4ZP8A 1F6TA 1Y5IB 1HI0P 5A6WA 3NCPA 1SL1A 2QGFB 4K4ZA 3UDVA 1XMOJ 1SV5A 3MMCB 3QGHA 5C7PA 6AT1B 2W9CB 1IBMF 4GVLA 5DZ6A 4F4YA 1XN9A 1U25A 1W25A 1DBDA 2Z2MA 1B0PA 4ETXA 4WP8A 2QLJB 1PC5A 4RWXA 2L41A 2I9SA 3HHLD 2X3DA 5L9NA 2ZH5A 3KLGB 3PO5A 2FC8A 3BR8A 5SUHA 3V4IA 1RTDB 1GMUA 2P6TA 1RTIA 4QW8A 2K1RA 2CPHA 1FA0A 1TVRA 2MZRA 1F9FA 2C1EB 3LWLA 3JQMA 3HZGA 1GMVA 4ID5A 3J7ZT 1NHKL 4IQMA 4K59A 2XMVA 1IKWA 3AODA 2CKWA 1NZAA 3ZC4A 1W7WA 3PO4A 2VFUA 1UKUA 3ENQA 2KG0A 2ZH1A 2AEFA 3UR3C 1QM9A 1X4HA 3BGUA 2OH2A 2H51B 2IBKA 5F8IA 3W5ZA 5C24A 4I6WA 3AT1B 4QIFA 5J2MA 1J5OA 2VKRA 4JBCA 1RABB 4I2QB 2HBZB 1ZAXA 4DV5J 4C48A 4DL6A 2Z4PA 2M8DB 2R7SA 1N33F 2R7TA 4NMLA 4UOFA 3DM2A 2MY7A 5J2NA 2M88A 2MQMA 3D1HA 4HTJA 1FKPB 2BRLA 3A13A 3HMJG 1RT1B 2PA8D 1HNWF 2HS3A 1EETA 4QYZJ 3SCIE 3J7Z5 4I69A 5GAEI 3X3UA 1FTRA 1N5YB 1NBEB 1B64A 5KFXA 1S72S 2QA2A 3ETMA 3ZNUA 2MZ1A 1SIZA 3KLHA 1QVFR 4RW9A 3BN7A 5L1JA 2NXCA 4USWA 2IDLA 2LXUA 4NI2A 1TL3B 4LFAJ 3TA1A 4N56A 2DPJA 2DNKA 2FVPA 2UU9F 4WIQA 2U2FA 4B3MJ 4RW9B 2QX0A 4USMA 1FF2A 1QSSA 1UVMA 3H25A 3VR1A 1XMQF 2LQ8A 1TKZA 1PC4A 3MM8B 3T41A 2EK6A 2CVEA 2E5HA 2G0JA 3VZIA 4F0KA 4FP9A 5LM7E 3J81U 1VJWA 5HP1A 4RPFA 2HNDA 4IQXA 4ZLLA 3IN5A 4IOAQ 4QU6A 2O3DA 2DNLA 2MKIA 1U8SA 3KLVA 3GWCA 1SC3B 4TXSA 5J2NB 4CNZA 3EUNA 3NOCA 1IBKF 3UFCX 5C2GA 2VPYB 4LF8J 3TJ9A 4HTIA 1FXDA 3THTA 3NLCA 4ANDA 1TV6A 3KLFA 1MN9A 4DLEA 3FK4A 1ICEB 3PHEA 4WF9Q 4YDDB 2M9KA 2MZSA 3M8RA 1U2FA 1Q7YT 1NB7A 3UQSA 3EVMA 4OYIA 1ZAVA 4F0MA 5FJ4A 1TUWA 5F3TA 3U02A 3PACA 3TJ8A 2CQCA 3WDOA 3T19A 4DR4F 5KFAA 4J91A 3HT3A 3I0SA 1OQ3A 5E3PA 3HHLB 4KC5A 4IH6A 1DTQB 2YWWA 2ZH6A 4ZK7M 2ATCB 2OPRA 2V8DA 3MM6B 1VQ4S 2OPSB 2B8PA 1P6TA 3DLGB 3Q8PB 3ZO7A 3L4BC 1R7IA 4U9RA 4WJBA 4KJIA 1S5ZA 3ILLA 4L74A 1OY9A 4ZVSB 1U8WA 1P9YA 5B08A 3MR3A 1SL2A 2CAJA 2CPZA 1VIXA 1BMQB 2YX4A 4A48A 2AJFE 4DWIA 2YKMB 5LXYA 5HAOA 3ZZOA 1N36F 4UZCA 4LF6F 1S9EB 4ECZA 1X8DA 3KK2A 2QSWA 4QIEA 2XS2A 1Q78A 2HIQA 2P5VA 3IM9A 1HNIA 3MMBB 3BO4A 3PW0A 1Y9OA 2MQ8A 1VQ6S 2O01C 3UDCA 2Y0BB 4FVMA 2A6OA 4OJ1A 2HQDA 3T5KA 2AJQA 1XERA 3PW2A 3MPDA 2J6SA 1NDKA 1QTMA 3I4PA 3DOKA 3MAQA 1S9GB 2KHCA 1RBAA 1NPRA 1PBUA 2PN6A 3PRVA 2LA4A 5CYQA 4X64F 1HNZF 3T6BA 1R8CA 3HHLC 4JUZA 1NK4A 2EWHA 2KRRA 4O4RA 3EMTA 5AXKA 2L9DA 2ROEA 5CAAA 5CCLA 3KTQA 1K1QA 2YNFB 4JI0F 4ZPVR 3KHRA 1KFDA 2YKAA 4RU9A 2EK1A 2RU3A 1P27B 4V19X 3NAHA 2RRAA 2GA7A 2EBGA 1HI8A 3OTEA 3AJ1A 1D09B 4YDXA 4ZJOA 4U8YA 3ET6A 5KG1A 5SZTA 4RU2A 1LNQA 1OYEA 3VCDA 3HSGA 1HYSB 4UUWA 3FCVA 2NSCA 4GMKA 2B0GA 3SSSA 4ZHRA 1YQHA 2Z8QA 5GMDA 1QAJA 5IC6B 1EKSA 1HW9A 4P7VA 3US5A 3SI8A 2CZ4A 4J7CA 3W2VA 4ZPDA 3KNAA 2W9BB 3SYZA 4DV0F 3W60A 4OZNA 1VMBA 3T1AA 3W8GA 2XS5A 2A1BA 2KM8B 1H74A 4RKUC 2RD5C 4XO0A 4HHJA 5DETA 1DY3A 3PJWA 2DCLA 4A46A 1Y3JA 3KHHA 1URNA 5D77A 1VK3A 2RMLA 4CIOA 4WTYA 4W90B 3G8QA 2RIJA 3PY8A 1X0PA 4QBUA 1RBLA 1S1VB 2EBEA 4ZITA 2AGQA 3EXCX 3GYGA 2DT9A 2HAIA 3K57A 3BZQA 5AE1A 2XMAA 1LWFB 1RHMB 2BM0A 2E7WA 2VFRA 5KFSA 1WHYA 3DDKA 3A8EA 1N5SA 1GXLA 3W2WA 1YHQS 3V5RA 3NG8A 5HVFA 3FKBA 1HNVA 1KP6A 4M5JA 3S7RA 5KG2A 4DR6J 3PM9A 3VVUA 1VRTA 2FPHX 2WVCA 2R2RA 4DL4A 2E5GA 4KH1B 2ZEJA 3EE3A 4QJVA 3GFZA 5KFBA 3NNHA 4ED7A 1SQGA 5LMUF 1DTTA 1JLQA 2DK2A 3KHGA 3THPA 4DXLA 3UR0A 3I56S 3D6HB 2ZBQA 3QT7A 5I42B 4TNOA 1REVB 5C25B 3SIPB 1U4BA 2PIIA 3IR5B 4DV7F 1RAHB 1UPMB 5KOXA 3QFHA 1RLCL 3DGVA 3VAMA 3N5BA 2GIQA 4V1Ak 2ZH8A 5IM0A 4LSLB 5E3CA 1SPBP 5C5JA 3OFHA 3R2CJ 3M6XA 1WNEA 2W7PA 3CCMS 1S6QB 4FKXA 1RYSA 2L9WA 5L1LA 4HKQA 2QE5A 3GIJA 3CJ5A 1CLFA 2A2CA 2FGOA 4DCJB 1A0OB 3C16B 4NXNJ 1IKVA 2GJ2A 4LF9F 3DN9A 1JXLA 2HHTA 3DI6A 4M5GA 1FI4A 4O23A 3BGLA 2F4FA 4NLPA 3D6FB 1U1RA 1YBAA 2HZAA 3PX0A 2DPIA 4KGXB 1W26A 2UV8A 1OY6A 3VWSA 1S1UA 4QWDA 3QRRA 4K7QA 2CIMA 2DNQA 2H5EA 1TL5A 1HD1A 2QA4G 3PYGA 3JTNA 3MEGB 3CJ2A 1FD8A 2F5GA 3RBXA 3GIKA 4DQRA 4GKKF 1FWLA 3I32A 4GRSA 1U45A 1YJ7A 1CSJA 2HLTA 4MH8A 3A8KA 3HHDA 3P5BP 4JP8A 2KO1A 4RR5A 4BLGA 4UOGA 2XGQA 2E1MC 2DY1A 3KK3A 4Y3CA 2BQRA 1CJKB 2MSSA 1VLOA 3JTOA 3OBIA 2XULA 4ED6A 2YPZA 1N56A 3IS9B 1WC6A 2BACA 3JQKA 1U47A 3FUYA 4DV7J 1RWMB 3OQ2A 4DU7A 4YOEA 3RBDA 3ITHB 3K89A 4KE5A 3N01A 1RCOB 5IQ6A 4CLYA 1XR5A 3EICA 4OHWA 2R2UA 3BO2A 1T11A 1C1BA 3IAS9 3QIPA 4KGMA 1OIAA 4OLPA 2FHOB 2Q3PA 4RNHA 5D0EA 3WC0A 2XG8A 1ULRA 4UOHA 4WFBQ 3L7PA 1DURA 2DHHA 2DR8A 4B9VA 2VQFF 3QFWA 5J1EB 2WTFA 5HO4A 1N33J 1GTHA 1E6YA 1UTAA 4KSEB 3T9NA 4DPWA 4TU7A 1LOUA 1HQUA 2GX8A 2XSFA 2Z56B 3AQOA 3MR7A 3VQTA 1FKAF 1FJGF 4F2SA 1YJNS 4WE1B 3CCUS 1M5OC 3NP5A 2MYFA 4DV6F 2Y9HA 2BYCA 2WB4A 4EGLA 1F5BA 2GVDA 3BR9A 1XK8A 4M5DA 1HA1A 3F73A 1R6VA 1KTVA 3TZYA 1VI7A 2RKIA 4OZ3A 4NXMJ 2F9DA 3BS9A 3G8TA 4QU7A 5KT4A 3GLJA 4JI8F 4LREA 1C1CB 2CG8A 2VICA 3HM9A 4CRJA 4FZVA 2R8JA 2HFSA 3OVSA 4LSLA 1G3OA 1VOMA 2HAFA 1GXUA 2GQQA 3A4TA 4B3RJ 4JV5J 3AOAA 1I1GA 4X4NA 1B0TA 1S0VA 1XTZA 4I68A 3BF4A 4H4KA 1LWFA 5M2RA 2GHWA 1JIHA 3UDEA 2OTJS 1DLOB 1JLGA 4U96A 4C3KA 3G4SS 5EGYA 3ELHA 2HMIB 2ACYA 5C42A 3H5SA 3QT8A 3FQLA 3J7YU 1XJWB 3T5HA 1IBLF 1R8HA 4NEYA 2HFUA 1H98A 1EETB 3R8YA 1HNIB 3MMBA 2NSBA 3PHTA 4NLXA 3S1TA 3DYAA 3ZZPA 2BEFA 4A8SA 1RT6B 3DRSB 2KL8A 5GAHU 5J2QB 5T14A 3ENWA 1ZM4A 3PTWA 3H5YA 2UZAA 4NYZA 1WKLA 3PYEA 1MWZA 3K0JA 2AW0A 2YWKA 2QEXS 2FY1A 2JVRA 4UQGA 2BW7A 1KR4A 5DZ7A 1IKXA 3L7UA 4DUZF 2F63A 2IPOB 2IIHA 4OYZA 5GAEU 3NGKA 1A7GE 1JJCB 3ILIA 4HT5A 3W5YA 3UPFA 5L39A 4EFAC 2XHWA 4ECTA 4FS2A 1RHKB 4DV4J 1RT1A 3MWBA 1YGYA 1T9TA 1Q4RA 2DNPA 2KKHA 2LA6A 4CH1A 2E1CA 2ZWPA 2FJWA 4R8UA 2KFZA 4DX7A 3PW4A 3JYTA 1NCLA 2WSCC 3DU6A 4FYWB 3J81j 3C2PA 5F8GA 1NSAA 3M9OB 2FVSA 2LU2A 3FCWA 3IAM9 1H7WA 4U67Q 1Q5YA 1QSYA 5DJBA 4O3PA 3RB6A 4D3GA 2UUAF 5DQIA 3LOUA 3Q8QB 1FRLA 4OYAA 2A10A 1APSA 2XBPA 2IA6A 1CJVB 5MLCV 2JEFA 5GAGU 4F04B 2EC0A 1XR6A 4K0KF 1T05B 2H5JB 1ZA2B 4TVAB 4Y2KA 2BRKA 3I87A 3IBWA 3BGFA 2MJUA 3BV8A 4LRBA 1BQMB 4NZ0A 4ZP6A 2V6AA 1JLFA 5HSPA 3CD7A 2QV6A 1FFGB 4UUXA 3KNGA 4QQBA 1XQIA 1K47A 2WZ1A 3VALA 1YI2S 4R25A 4PXCA 2AYBA 5AJ3J 1IM6A 1XWLA 4IOBA 3HVWA 4O3QA 5I3QA 1WTFA 5KG3A 2YNIB 3LWMA 1JNZB 2FLOA 4BDPA 1TFWA 1LWCB 1S1TB 1OS5A 2BJ9A 2X3GA 3ISZA 2C3MA 3PYFA 1L3KA 4NEZA 1YRXA 2NUHA 4L75A 2V4RA 1X4CA 3I31A 2RSQA 4EBDA 1XNQF 3GJTB 3IR6B 4AUKA 3HHLA 2WOMB 1FRJA 3BYPA 4UY85 3MOJB 1SIWB 1VRTB 1GNKA 2FYXA 5GMKa 3SZ2A 1AA1B 4ZLNA 3P6YC 3C15A 1AUSL 3H8YA 3VAHA 3CD6S 1KHVA 3HSDA 3B82A 3RB0A 2X1AA 3THVA 3QYYA 2DRAA 1NU4A 4EU0A 3OXGA 1NSKL 4G6VB 1LKZA 3B8HA 1H3DA 3FFIB 2BE7D 3I4HX 2B8QA 3M7VA 4DG1A 4YUDA 4DU8A 4LFCJ 4BBYA 2ASLA 3MM5A 4PPDA 1TK8A 3OSPA 2MXYA 1IJFB 2FZCB 2XM3A 2IYIA 1M5VC 4CNYA 4WFAQ 2D74B 2LYVA 4BWMA 1WF0A 4WFXA 1PIEA 2CQBA 1YZ6A 1WKJA 1JLCB 2KB2A 3CO0P 4KFBA 4WKYA 5L8RC 2AHOB 4J9SA 3ADAC 3IFEA 1F9EB 3NCQA 1LW0A 4RO0A 3KG0A 4QYRA 5KTQA 4PG4A 1UL3A 2OI2A 4DQIA 2OSQA 1WOPA 1K44A 4PQAA 2OMOA 2PEHA 3OTBA 4I6AA 2H5IB 3AXKA 4LRFA 2OP5A 1LW0B 4GKJF 4UZBA 4OIXA 2Y0SD 2O5DA 4X4OA 2GC8A 2BANB 1IR1A 5HQ8A 3MFIA 2KJVA 2FJVA 4HH0A 3BH6B 5DGBA 3CD5A 4KKOA 2AYGA 2GJIA 4K50A 1FK9A 1R0CB 3H2LA 4ZJLA 4YR3A 4ED4A 1YX2A 4FYDA 3JSBA 2JOQA 3H2VE 3D0IE 1MMLA 3JSYA 2J0WA 3JB9k 5ETVA 3GG1A 2R7XA 4C7QA 4CDIA 3L09A 3BDPA 4O4GA 4B3RF 4FNIA 4I1TA 4B3TJ 3MEDB 1Y0HA 3A3NB 5CHCB 2LQ9A 3SMZA 3CMAS 3MEEB 2G4BA 1X4AA 2RRBA 5AE2A 1SVDA 1WSRA 2DGVA 2FJEB 2G2YA 1UFLA 1RWWB 2VZ9A 3M8YA 3OLAA 4D3HA 1RA6A 4HI1A 2NUUG 1D8ZA 4XDDA 4M5DB 1UVNA 4DFKA 4DFJA 4UQTA 5KFKA 2E29A 4RNFA 2V4JA 1LWXA 1S1TA 3GTYX 1IR0A 1C0UA 4G65A 1UFWA 4IFYA 5ETOA 3U1LA 4LF2A 3ENAA 2WBRA 5DG9A 3KJVA 4DSKA 4OI0A 3DOLB 2ZKUA 4C3LA 2FD2A 3R5AA 5KFOA 2CDRB 3TYTA 3KJVB 4RL1A 3ISND 3ZTQA 5LSRA 1T8EA 1JLAB 4Q7AA 1K0TA 2GO9A 2PMWA 1TK0A 4MKYA 3DHXA 4CYUB 1HLWA 1H38A 4KQZA 4NCGB 1AW0A 2F4VF 4N8OA 1JLEB 1OY8A 1S6PA 4DPXA 4IR1A 1WUUA 2D7SA 1UEUA 3TUZC 2DVIA 3L95X 2B43A 3BBBA 1KS2A 2K8GA 4QPTA 1M1KT 3M2UA 2QMWA 3TARA 2FZKB 4EBEA 2IMWP 3VV2B 2KRBA 2JEGA 1IKYB 2ILYA 3J80U 1OPZA 1V3ZA 3HP6A 2VD3A 1XMQJ 4NLVA 4FNHA 5KFJA 2E9TA 2BV3A 2O67A 1VC6A 3BSAA 1I51B 4W92B 5MAOA 4DV1J 1JLCA 2IC3A 2M2BA 3MAHA 5GAHI 4IDKA 1N6QA 1ZZNA 2BQ3A 4B3SJ 4QPXA 4JI7J 1K0VA 4MFBA 4OZ0A 3EPIA 3G2XA 1RT2A 4K4TA 3KOAA 2V67A 4WYLA 5GAGI 2NCKL 3GV7B 1YRUA 4F50A 2IVMA 2V5HG 4DN0A 2HIYA 4X4UA 3DLLQ 2DH8A 3BPDA 5FIIA 1FWKA 4Y2IA 3U27A 2FB0A 1U1LA 1DLOA 1JLGB 3LO3A 3FEYB 3OL7A 2R7VA 2NZCA 3Q83A 2CDQA 3CCTA 3OVBA 4OYWA 1ACMB 3GR1A 3V2UC 2K3KA 2KZMA 2BQUA 3LAMA 2JC0A 2JZ5A 1E6VB 4KFBB 5HANA 3BH7B 1H0HB 1VLYA 5HQLA 1ITPA 2GCFA 2Q6BA 3RR7A 2QZ8A 1SXLA 3E2EA 4PG7A 4W98A 5L1IA 4ANEA 4XPEA 3MTKA 4JI3J 2HHSA 4LFBJ 1HPZB 1T94A 1SJQA 3NGRA 1H7XA 4P73A 2HFVA 3UD4P 1KVIA 5DLFA 4OLOA 2G13A 3H7HB 1T3NA 2IJRA 2I6WA 2AGOA 2HS4A 1MROB 3S6EA 2DIUA 2IBOA 2Q66A 3HD2A 2OAUA 2U1AA 3E51A 4NPOA 3PVXA 1DARA 2OPPB 3OR2B 2IM2A 1B7YB 2CJ9A 2V2QA 2YKQA 1GMWA 2XMMA 1S57A 5B0GA 1KQFB 5IS2A 3QWUA 3BSNA 4WYWA 3BYRA 3C6UB 2HHPA 4F3QA 4C8ZA 3J7YI 4XPCA 1HWKA 4WP9A 2GZOA 1WOOA 1LFPA 4A8WA 1S4EA 2NXUA 4FF4A 3W3SA 2MY8A 5AXMA 2GFFA 3HKZD 3BQ0A 2BKOA 2YWHA 2BZ2A 2LP4A 2Y3YA 3HVTB 5F9NA 2A3JA 3IC1A 4RJVA 3MPWA 3OHAA 2QRRA 1RWNB 4CM0A 1AUDA 2D3ZA 3HVTA 4YN3B 4Y2MA 1RYRA 2WK4A 2QLBB 1UEKA 2RHSB 4QIVA 2I1RA 3SQGA 2DCUB 3PRDA 5DLGA 4R5PA 4ZCLA 2CNNB 1SQEA 1X4EA 3PEJA 1JLFB 1S7HA 5IQQA 3ZZUA 1J5EJ 1KHWA 1H73A 4FN5A 8AT1B 3M9NB 2JL9A 3AD8C 3G87A 3M8QB 4OZJA 2HGLA 5I3PA 4O3NA 4CLFA 4DX5A 4ZMMA 3EM1A 3R97A 4HDHA 2DGOA 1FJEB 4DL3A 1IWGA 3RG6A 4MKAA 2KJWA 3W7BA 4GC7A 3NBPB 2JWNA 4CO0A 1CC8A 5DDRC 4RNMA 2WVEA 3CCSS 2VPWB 2FHKA 2FDNA 2B6AA 1FERA 2WONA 3KG4A 1RWKB 3D66A 3M8WA 4NLSA 4NZ6A 5EUHA 1RT3B 2IFXA 2KI2A 4I56A 1RAFB 1RT5B 1T9YA 3FRYA 3Q8UA 4RW8B 4DOZA 2WONB 5LMUJ 4C0HA 5LJ5Y 4IO9Q 3PW5A 4UY8T 1R0BG 2BXJA 2Y8WA 2CPDA 2PO4A 4JV5F 1HD0A 3HPOA 2XMTA 1RU2A 3GJRB 2XYGB 3OTDA 1NPPA 1UPPA 2NYIA 3EGVA 1IR2A 1DQ8A 4CLPA 4MMOA 2CQDA 5K5MA 3H90A 2UXDJ 2B9YA 1O5JA 1AB8A 3NCRA 5C42B 2QYCA 1WC4A 1S1UB 4RUCA 1JK9B 2DNYA 5H9EK 2WAQD 2HPUA 2QL5B 3FBBA 1GX5A 5L46A 3OJSA 1SKSA 4Q8FA 4ILMA 1HNZJ 1EQMA 3NBPA 3W65A 1NEEA 1R8BA 5THWA 1HHSA 1RB0A 3CJ4A 3WHIA 3VGTA 5LXRA 4JI6J 3CMES 4GVBA 4AXIA 1JMTA 1NDCA 1OQ6A 4LRDA 3RRGA 4DFPA 3HCXA 1UVLA 1BXNA 4C4WA 3ZTRA 3OHBA 1Q8BA 3GIRA 1MMDA 2E1AA 3CPWR 5HMYA 1N5TA 1HBUA 2WVFA 1Q82T 3HULA 1LW2B 2R8IA 2HZCA 4M63A 1MMNA 4J9QA 4F4ZA 2V2KA 2B5JA 5J2PB 5EWFA 3KLIA 4EO8A 1KLMB 2BJ8A 1WHXA 2MQPA 1F0XA 5KT6A 4USKA 1MLAA 3MR6A 2JRSA 3RAQA 1SQFA 3K59A 4DR3F 1RZMA 5IFMA 2D3O1 5E0OA 3MI7X 1Y3KA 5IZHA 2POKA 1ZM3A 3K5OA 1DZ5A 3FQKA 4J9OA 2RS8A 7FDRA 4LF4J 4MKBA 3TX0A 2BJ3A 1IJEB 1ZYQA 3NMRA 4NLTA 1B4SA 3NEKA 4CYUA 3Q86A 1S10A 3I0SB 2OPPA 2QG9B 3GV5B 2ZBIA 2MKJA 4JI0J 3KUHA 2RS2A 3PKMA 2PFFB 1C2PA 1GXTA 3GB0A 5ETLA 5U47A 3WIUA 4DSLA 3IXQA 4FXVA 4NCAA 1IXKA 2ZM6J 2GVDB 4EMDA 7FD1A 2XS7A 3BGOP 3UD5A 3KLFB 3KUEA 1WEXA 1ROFA 4ZCKA 4DCOB 1RQ0A 4TQRA 3PZPA 4CLWA 1NM2A 2BOPA 1GAOA 1YSJA 4LF8F 1FFWB 3PKYA 3VGUA 2N7YA 3R3TA 3QPIA 4M5KA 2ZNZA 4C0BA 1HQEB 4U7UD 2W4DA 1HQUB 5GVQA 4QWAA 3BSOA 3M05A 1JKHA 2Y1IA 4EYIB 4I0WA 4ED0A 4LF9J 1HHTP 2VFSA 1CPZA 4Q0BA 4RW6B 4DMZA 1HR0F 1TP7A 4OMFG 4ZLPA 2D3UA 2RVJA 1U0HA 1NJWA 2FJAB 2AP6A 1HBNA 3QIDA 4PWDA 3H5UA 3DRPB 3MAAB 4OQJA 1IKYA 2DB1A 2W2NP 4FVCA 5E33A 3FSYA 2ZZNA 2CJXB 2GNKA 2V8HA 2GHVC 3VAIA 2ZDPA 1QVGR 4ES2A 4A8KA 1X9MA 4OZLA 3DRRB 2J7WA 4AT1B 2IJFA 3N79A 4ZPWR 2X1GA 3CDAA 1BUXA 1VBYA 4LIRA 3UDLA 1X60A 2VBZA 4LF5F 5KFTA 1TKTA 3CVKA 4Y65A 4L76A 2D9PA 1U6ZA 2H54B 4DV5F 3SFUA 2VA3A 3NNCA 3ZNJ1 3QJPA 2CVIA 2CQ2A 3F56A 4Y00A 1F2HA 3A1YG 1H2TZ 1RT3A 3SV4A 1VQPS 2ASJA 2VODA 2Z30B 3CCLS 4JI1J 3MEKA 2HHHF 2XGPA 1RTHB 4OV1A 4PCQA 2VKZG 4HDGA 1YJTA 4CLZA 2P9CA 5KG6A 2Q43A 2RNEA 4JV0A 1FKPA 1FWPA 4LSNA 1H2VZ 1K9MT 1VC0A 1RWPB 1SL0A 4NZ7A 1MN7A 3HJVA 1OMSA 1TQLA 4DV1F 2AEJA 5LL6d 4PKDB 3L3CA 4QYZK 2VG6B 1AROP 3KDOA 3VAFA 4DL2A 3CJ3A 1GX6A 3QQCD 1NJIT 4O4GB 5ADZA 2HFNA 2F7VA 2MLZA 2JH3A 5K8NA 4YY3F 1L3TA 1RHUB 1ZA1B 3TEHB 2C3YA 3M32B 2ZHBA 1XC9A 3VGVA 2C28A 5D0GA 1HNWJ 2ZVIA 2DY9A 4CT9A 4RUBA 3MM7B 1WG4A 1SC6A 1OWXA 4IG3B 4L72B 3I55S 3LA0A 1MWQA 1SKRA 1L3UA 2R7QA 2FVCA 1KTQA 3E8OA 3DLEB 4H4MB 4PPZA 4F36A 1UP1A 4MKVA 4OI4A 4RNOA 1U48A 4ERDA 4AQYF 3FNNA 3EDRB 1KONA 2QSFA 4FF2A 4KHPJ 2KT5A 5KFIA 1GFWB 3DLJA 3M2VA 2ZITA 2FVQA 1PCAA 2Q1LA 4OYPA 3CJ0A 2GHPA 2V8VA 4TY9A 5D0RA 2CJBA 2AJ4A 2V4JB 4QWCA 2B4PA 1X31C 2HBRB 2OEJA 4UT4A 3EZ5A 1FDDA 3KJNB 2MPUA 3OW2R 3JAMY 1XNRJ 3PDNA 2DGTA 4OHXA 4OYBA 1U26A 3D6MB 4TLRA 1TAUA 1F5CA 2RF2A 3A8IA 4ER8A 4K4SA 2H4WB 1O51A 5CYMA 4F3MA 3D9BA 2QL9B 3FFIA 4NA2A 3P8BB 2V69A 2VG7A 1N36J 4DV0J 5DDPC 4ANCA 2JLFA 2VU5A 3ONQA 2XMWA 3IWLA 5C24B 3EDQB 4OJGA 2BE9B 1U09A 3F44A 3C14A 3M2UB 1RT6A 2ZH3A 5A8KB 4B9LA 1MWYA 1B7FA 1PYSB 4P6QA 2HFOA 4Q2LA 1FRIA 1CJUB 5G4DA 4MK7A 2IM0A 3L9ZA 5A8KA 1S1WA 3UO0A 4QR1A 3J80Y 5FLXU 3FSIA 3UVJA 4DR2J 2W4PA 2OMLA 1ZOTA 3DC2A 4ZS6A 1K73T 2HZVA 4GKJJ 2ZUGA 2D41A 3GMGA 3SSQA 1NDLA 4OL8A 3V4IB 4I2QA 1RTDA 3G86A 2YPYA 1CQNA 2IM1A 4X4TA 5L9XA 4ZPTR 2ZBPA 4AFFA 2W4CA 3MOZA 2YNFA 1O8BA 1YG0A 2NXEA 2W2PP 4N77A 5CYMB 3KLHB 3G6ES 2YWEA 4OI2A 3TANA 3WC2A 1RCXB 1G2EA 1B3TA 3DRSA 3GFXA 5IV3A 4Q8EA 2AYMA 2CPEA 4JI2J 3QMQA 3H5XA 2ZDOA 4Q2MA 2JC1A 4HVZA 2G2OA 4CH0S 1C4AA 3K8VA 5KG0A 4HH1A 2LMIA 4P74A 4LSZB 2ADBA 1KRPA 3BGRB 2D1CA 3M1VB 3GIIA 4PUOB 1HBOA 4I7FB 2XY5A 1QJHA 3CT9A 1S0NA 1G1XA 4PR6A 1KBRA 3OFFA 5HL7Q 4ZJQA 2MGZB 2AMCB 3QNWB 4DQPA 1TL7A 2HQ3A 4I2PA 4A47A 1QAIA 2DGUA 1QAYA 2CPFA 3UN3A 5DDOC 2XQCA 1EAYC 1SBRA 3DMJA 3JYTB 1URRA 2W01A 2B7CB 4MIWA 2RUGA 3MCMA 5KT2A 3QO9A 4K4YA 2QLXA 3D7SB 5F41A 4AXJA 5HMWA 5CQGA 3OL8A 3IR7B 1Q81T 5F8JA 1HNXF 4P2XA 1HW8A 3MM9A 2JEJA 3NS7B 4LBHA 1I6JA 2AD9A 3D4JA 2PMZD 3M32A 5E7OB 2DR9A 2AX1A 4M94A 1R8AA 2DHGA 2XO7A 5ETMA 2QC3A 4X66J 4DZ6A 2V0NA 3D67A 2DGQA 2YKOA 4KB7A 1SH3A 3TVYA 2GO8A 2LU1A 4DSEA 1GMWD 2ROGA 3TZWA 4X4QA 4DF4A 2AGPA 2NYHA 1SKWA 5A76A 1VS3A 3CJRA 2H65B 2CQ4A 2MGZA 4WCEQ 1S6UA 3LGNA 2LEBA 4DPYA 2ZE2B 2W9CA 2V2ZA 2MKKA 2CG4A 2B9EA 3M30B 2JFKA 5HLFB 2W7AA 5HN0A 3CDEA 2XZWA 2EFQA 4ECSA 1CBKA 2YH0A 2OSRA 2XWXA 3PNIA 1JKHB 2CWKA 1G6BA 5HMXA 5ETPA 1YDLA 3W9IA 5HROB 1HKAA 1RTJA 2JEIA 4DHVA 3VGSA 2WSFC 1U24A 4ZIWA 2A6MA 2R7OA 1VBKA 2RJZA 3NGSA 4L73A 4DSFA 2R42A 4C0OC 3DLKA 1HBNB 4F0HA 4YY3J 1RAGB 1HARA 2I2YA 4DI6A 4B17A 5KFPA 3DI6B 4ZVRB 3IGVA 3O6QA 5B0CA 4OYXA 4FPRA 4FBUA 2WW4A 3T6JA 2N4DA 2MJNA 3MCSA 2V4QA 1OSDA 3DNCA 3UWTA 3HK2A 5IWAF 3A8JA 3AFGA 3BSCA 4B9MA 3GJQB 3U1NA 3C14B 2WRMA 2QIFA 4C8MA 1KN6A 3LGHA 4DZDA 3IG1A 1CC7A 1RACB 4QCLA 2PA3A 2F8EX 1Q0NA 2J76E 1WORA 1HHQA 5C25A 3PIOQ 5KFQA 5IV4A 3KG1A 5J2QA 2EFGA 1VQNS 1PJ7A 2HVZA 3MTJA 5K8MA 3NGDA 1PGZA 1HFEL 1NUEA 2VA2A 3FDSA 3D28A 1L3SA 3M2RB 4ZPBA 2HHUA 2QFIA 3RJMB 1KVKA 2M0GB 1RXOB 1JLBB 2EVZA 2MZJA 3NGUA 2YH1A 1L3VA 2AWZA 4OHVA 2MKHA 1LXNA 2DITA 1MU2A 1UWBA 3WIVA 5KOWA 1S59A 2MMYA 3D0GE 5F3ZA 2YNHB 2ATLA 4Y6IA 1FX2A 3FZBA 1TZ0A 3DXSX 1NK8A 3R5DA 2KTQA 4C98A 2HHWA 2XI3A 2KXNB 2HNYA 2R7RA 2ZD1B 4PYAA 1NSQA 5HQMA 3CMQA 3SEOA 5KFEA 1M5HA 4ED8A 4KTQA 3W64A 1ZPVA 3M2VB 1HBUB 2KXHA 3VF0B 1T03A 2VDIA 1IBMJ 1EARA 5A6PA 2E5IA 1FNMA 5LOQA 4ALZA 3AHPA 3AY0A 4ENOA 8ATCB 3HHNB 2MQNA 3NRBA 3T1YJ 1HR0J 4OYOA 3DCAA 2M5YA 5E3QA 3N28A 4KPYA 4YHHJ 2VFVA 5EX3A 1P8GA 1RWOB 2N3OA 5DGAA 2CRLA 4X2BA 5D8HB 1VRQC 3AD7C 1N34J 2CNKB 4DV6J 3UW1A 1YZ7A 3H4DA 2EXUA 4ZDNA 1QUPA 2V8GA 3CD0A 4LF7J 2IRUA 1WEZA 4AL5A 4PWDB 1FEEA 3H2UB 5K14B 1HIYA 1PJ5A 1S1XB 3T9ZA 1C4CA 1Y4ZB 3CF5Q 4OJ3A 3KXDA 4F25A 2VBYA 4PYDA 2KH9A 2VQFJ 3MMAB 4O44B 3TR5A 2OD4A 3N6LA 3TZXA 5B0FA 3EYZA 2VF3A 2W2MP 4O44A 3RB3A 4DL0C 1XMBA 2CNLB 3TNVA 4C11B 4EWTA 2NQPA 2J9EA 3I9V9 4RW8A 2BABA 2KZZA 2HLUA 4DR5J 2ROPA 2MKSA 1U1OA 3FEXB 4OHYA 3ETOA 5ETRA 2CJKA 5HATA 4DR3J 4IO1A 2EFOA 3M4XA 1F9HA 5A8WB 2VG7B 5LJ3Y 3TZZA 4TQSA 3BKTA 2MLXA 4AYBD 1FXLA 4ILLA 2Y1RI 4IOCQ 2VJUA 3BDEA 3RR8A 1S9GA 1WDTA 2RU9A 1SH0A 4TKTA 3FBCA 2DKOB 3KYLA 1X9WA 2JDJA 3AOBA 2XB2D 1IKVB 1Q8KA 1WELA 3GZ7A 2PMHA 2F8HA 3CJQA 3R6GB 3TAPA 2CPJA 3MMAA 3KK1B 2RQMA 2DHXA 1VQMS 4DR6F 3M6VA 3T1HF 3FJ2A 1VQ9S 4NA1A 5EX0A 2VC1A 3TA0A 2V8PA 2CJAA 4M8LA 2W24A 1T9UA 5JXSA 2EG1A 3NWRA 1TKDA 3R5JB 4U6PA 2HS0A 1TL1B 4RUAA 1JXVA 4WP3A 3ZZ0A 2W2OP 4IG0B 2ZM6F 2ILZA 5E5NA 4USHA 4Z7CA 3O44A 2HHVA 3NOGA 3PXGa 3M6WA 2DEIA 1CG2A 3TUPA 3I5CA 4R0JA 4MIBA 1JWWA 4ECXA 2FHMA 5H9FJ 4X4VA 1WG1A 1LK5A 3IM8A 3Q2SC 1TMJA 1M5PC 4KHMA 2XYPB 2UXDF 4B3SF 2ZH4A 4DL7A 2B3TB 1VK8A 1S0OA 4B3TF 4F8RA 3GR0A 4ZVQB 1BQNA 3LPEA 2AF6A 4MK9A 1C1BB 5ETSA 3CUNA 4WXOA 5D0HA 1VBXA 4USJC 2MHEA 2MSTA 3O2IA 1KEKA 3N6NA 2VIHA 2XTJP 4NWBA 5DG7A 2WVBA 3TW0A 2DNGA 1V6HA 1FRMA 1TL4A 3CCWA 2NPFA 2OJ3A 1KDNA 5AT1B 1QE1A 1TFYA 1WHVA 3HKWA 4K4VA 5CA5A 1I5OB 3I96A 3O8WA 4DX8H 3JSMA 2UVWA 4NLGA 4ZHRB 4LBPA 4DLGA 2ZJPQ 1X4DA 2KT3A 4DN9A 4E2FB 2R8GA 3G6VA 3CJKA 1CQMA 2CUYA 2EEYA 4J9PA 2XYHB 1VFJA 1XIQA 1N5VA 3CC7S 2VONA 1DFDA 1Q79A 4LIWA 2HVDA 3W5XA 4XK8C 3W2WB 4DV4F 3CJKB 3Q8VA 4ZVOB 2ZZMA 2FHJA 4P2FA 1FTCA 4JYAJ 4P71A 3K5MA 2KN4A 2OIHA 5E3RA 1TU0B 3DGPB 3R7NB 2UP1A 1D8YA 5C2CA 1KNZA 1L5UA 3D6TB 1K1SA 2KXFA 2XNQA 2E66A 3VVTA 3H4BA 3I0RB 5D3GA 2R2SA 3QLHA 1X4BA 4DSIA 2XY7A 4HHUA 4FBTA 2RDJA 3D1QA 4X64J 2MQLA 4XIUA 4JI5J 2JLEA 5HBMA 1UFKA 1S4FA 1LEOA 4S0MA 1TKXB 1CJUA 4X84A 5LMNJ 1VQOS 4OX8A 5G0RA 5D4LA 1S12A 4RBUA 1SJ3P 1EP4B 3DOMB 3HHKA 2GMLA 2E7VA 1HNVB 3RGIA 3LQVA 5HK4A 3QJLA 1LWEA 2FGCA 3PJ9A 4KHRA 4NASA 3G9CA 2GMJA 4CLSA 2N7CA 4DS4A 3CGIA 1S9FA 1TR0A 4CQ1A 1CEZA 2HQGA 2HKEA 1QAXA 1OSCA 2WW8A 1AT1B 3EGNA 4GO5X 1X4FA 4F4WA 3SXLA 1IUJA 2R7WA 4WKRA 2JJ4D 3DGPA 4KT0C 4C11A 3AJDA 3QATA 4BC9A 1K8AT 4B9SA 4Q0BB 3I5BA 2DGSA 4CWBA 2C42A 3F41A 1F5AA 3AA9A 3IBFB 2F9JA 4L6V3 1OYDA 4Y2AA 4RBTA 4C8NA 1N6QB 2CNOB 1YBTA 1FE0A 2E7XA 3KK2B 1NJYA 2I0XA 4MFBB 4NMXA 4G3IA 1J5EF 2XEXA 3QGIA 2RDDA 2FY8A 1TVRB 2Z2ZA 2YKNA 4NA3A 5IM0B 2FIUA 2CQ0A 5AJ3F 4N5SA 4LQ3A 5EN1A 2GIRA 3P5TL 3D3CJ 4I6YA 5DS7A 3CULA 1HWJA 3KLGA 2EW9A 3CTRA 5D4NA 1IVZA 2HGMA 2W7OA 3GG0A 5E2QA 2ZD1A 4HHHA 5AXLA 3M8ZA 2H4YB 4ZPAA 1AZSA 3T1HJ 4IKAA 2ACMA 2R2TA 3FBFA 4USIA 5D15A 1IKWB 4DQSA 2V9WA 1R0AA 2E9ZA 3MM9B 1WJ9A 2N3LA 3K58A 4EZ9A 1WI6A 1FO1A 2J0XA 4ES3A 4M95A 3B4DA 4DFMA 3MCNA 1TKZB 4O3OA 2KVIA 4C9DA 1EJ7L 3PJXA 4NLRA 4CTAA 3TEGA 1XBWA 1PKUA 1Q1KA 4P75A 3IO1A 4USVA 3CCRS 4JOUA 3QT5A 3RAXA 1D9FA 3NAIA 2G0CA 2GQCA 2RRNA 3M1VA 4QWEA 2YTCA 2ZOFA 3I9ZA 4ZVGA 1FD2A 3T3FA 2HURA 4K2XA 2DNOA 4O3RA 3K5NA 4LFBF 1FK9B 1X5TA 2OLWA 4L3KA 4NYOA 5B0DA 2C2ZB 3LANA 2KDOA 3OUYA 3VAKA 1D9AA 1WWHA 2IMOA 4N7TA 1LK7A 3CCZA 5ETQA 5T7LA 3V6JA 1YJVA 1FRKA 1O0PA 3IA0A 4EUVA 2PDAA 3C6TB 4WFNQ 2GVZA 2DR5A 2AV5A 1TL3A 1NNDA 4NRUA 4TY8B 3OD2A 1YIJS 3H20A 3DOLA 3TP2A 1FXRA 5LSOA 2HHHJ 4ED1A 2BKPA 3MDFA 2C2MB 4B3OA 4PZVA 2ASDA 1NH8A 4IR9A 1CS4A 2LVWA 4KAIA 3IRXA 4TYBA 5GMEA 2HWTA 2RUSA 1GH8A 2DEJA 2EKYA 4G1IA 4C97A 3GYXB 4DPUA 5F8LA 2V68A 3IRXB 1FE4A 4LR7A 1WC5A 4Q45A 4ZOSA 5DM7Q 2MEWA 2AT1B 4OYMA 4WFZA 5CABA 3QAEA 2XCAA 1IQTA 4C8KA 1FJCA 3RAMA 4B08A 3DKDA 5K8PA 1V3SA 4IDKB 1HL6A 1RT4A 1NK0A 2HRYA 2XNRA 4NL5A 4ELTA 1YK9A 4B3MF 3RUBL 5A8RB 1T02A 4ZVFA 3V6DB 1VQ5S 2YWGA 1RT4B 3GYNA 1QD1A 3R5BA 5FD1A 9ATCB 2XMKA 3NGTA 4HL9A 1DHMA 3LP1A 3SCKE 1JXEA 3DOKB 2D69A 1B99A 1RI7A 3TOQA 5KFWA 4GC6A 1NO8A 4YFUA 2BJEA 2ZOGA 1FRXA 2RF2B 2PSZA 3CW2C 5CYQB 3C15B 1RGVA 3GFHA 3FC9A 1SV5B 2MKYA 1JLEA 2DBBA 2HWHA 3MMCA 1DTQA 4U7CA 2NREA 4W4MA 2DNRA 2I38A 4DUZJ 1RT2B 1FKOA 2F4VJ 2OELA 1X5OA 4LF1A 4F7VA 2DHSA 1RT7A 1T9WA 1RDRA 1D1UA 2AIRB 2G0IA 3LP0B 4ZIVA 2ZJQQ 1HWUA 5IT4A 3OTOJ 4KGZB 1NRKA 3QJJA 4TLQA 1UW4A 2OKQA 2J6TA 3H59A 3KWMA 2UUCJ 3HSZA 1IBCB 3CO9A 2L48A 3VZHA 1RKJA 2BR0A 4IFVA 1J5OB 2OTLS 2UUCF 2BJDA 2HVEA 2RHQB 4ZVHA 3BJYA 4AQYJ 2XLKA 1S99A 1FNXH 4I4BA 3HDSA 1I94F 4UOCA 3KJQB 2M52A 3P96A 4M5IA 4LVNP 2VBXA 4A8XA 1I3OB 3DFEA 4DV2J 2ALZA 3TA2A 1T05A 1NJXA 3K7RA 4EBCA 2KYXA 4RW4B 1LV5A 1FEHA 5HP1B 2J6UA 2VJVA 1VYAA 2H48B 1BWVA 1KOHA 3OR2A 1RTHA 3K5LA 3VAJA 1UWAA 4EYHB 1CJVA 3R1LA 3QRPA 2NZ4A 3MEDA 3DMJB 4PWWA 1J27A 1ZAWA 4LVOP 5F8HA 3MXHP 1UJ4A 1W2IA 2CXEA 2BVZA 1H2UX 2G9OA 4AE5A 3FBEA 5CD4H 4OZ5A 4IFYB 2FJXA 2CQHA 3AAWB 3PEHA 3SQOP 5JUMA 3GILA 3JAMU 4YB5A 2CJQA 3P4UB 2QMUB 5J1EA 1N5YA 2QFJA 1HBMA 2IJNA 4YEAA 3N5FA 2LCWA 2WOMA 3G8SA 1BC6A 3MURP 1PJ6A 2UVUA 4ZVPB 3DDIA 5DQGA 4Y2CA 2V9KA 2DHAA 2IY5B 4MTPA 4F67A 1O6XA 3GSIA 4I2PB 2HRUA 3U1MA 2OUGA 3PR4A 4EZ6A 2H3EB 3N4WA 1RWVB 3EVWA 4B02A 1VGYA 1UVIA 1U2CA 2ZHOA 2Q79A 2DH7A 1LWEB 3CC2S 2APOA 5ETNA 2IRXA 4TU9A 3IBCB 3ZZTA 1UA0A 4U8VA 4C2MA 1Y7PA 3NWGA 2HBYB 4DX6A 2C2EA 4DR1J 5RUBA 3JQJA 1Z2ZA 1T0TV 3ZTPA 2OPQB 2XHCA 3IMQJ 2OEMA 2IM3A 4CO1A 3DYAB 5A2QY 3MUMP 5M2UA 3GFYA 1WHWA 2OPQA 4OFZA 3N6MA 5H9FK 4WK1A 1UA1A 3NS5A 4LR9A 4V19J 5D3GB 4YB6A 1Q5VA 3W61A 1X4GA 2CPIA 4I67A 4WTOB 5H1SV 1Q8LA 5GADU 4F4XA 4IH5A 2CFXA 4LF6J 4DR5F 2K2PA 4LFCF 3DRXA 4F26A 2XMJA 1S7IA 3CNQP 1VC5A 2MZTA 1UJ5A 2VASA 3FVYA 2QLFB 3LW5C 1BY9A 1DQAA 4GO7X 4WE1A 3UVJB 2ZJRQ 3H98A 4RW7B 2GW8A 1GT8A 5G0RB 4P52A 4IH7A 4USUA 1M90T 2HWIA 3OFGA 4DV3F 2I5JA 4K4XA 4G1PA 5BR8F 2V2VA 1Z2LA 3RW6A 1KD1T 3ICLA 1RTIB 1YJWS 2CWXA 4OZ1A 1UVKA 2JVOA 1SUQB 2PFDA 2YX1A 3LP2A 2VBWA 3MM5B 3OR1B 4ILRA 4OX9F 3OL6A 3D2WA 3G6YA 3C3LA 1YKWA 3HVRA 5I42A 1N34F 3BKFA 1G4CA 4YQWA 1YVFA 3TVKA 3W8PA 4CTAB 5KG4A 3Q8SB 1FRHA 2UUBJ 3H40A 1U1QA 3PX4A 2LXIA 3VTIA 2Y8YA 2B56A 1IN0A 2PGCA 3FEZA 8RUCA 5K20B 1YJ9S 5AE3A 1QTNB 2YQ0A 4ECYA 3FCHA 4CO4A 3MCOA 3GSDA 4X65F 1BHNA 1NK7A 1R27B 3MF5A 3MM7A 2FLNA 3QWPA 5FLXY 1WC0A 2EKNA 2YNIA 3E01B 3TQEA 4CLLA 3Q0AA 2B4VA 4Q43A 4A8MP 1JJ2R 2RB7A 3KLIB 2M4MA 3GV8B 2UUAJ 4JV1A 3BBCA 1N5QA 2VG6A 4OZ2A 4PXBA 3KHLA 1RTZA 1V5IB 1CJKA 1E6YB 2V94A 3GCXP 3O1LA 5FDLB 4E8UA 5DQHA 1SC4B 2VQEJ 2UU9J 4LFAF 3NY0A 1CJTA 3UI3A 3DU5A 2J7KA 4CP5A 1DJ0A 3W9JA 5IT0A 5K8OA 4MJKA 2PEBA 1V3RA 3M8PA 1VJQA 2NXJA 2ERRA 3JSRA 2V63A 5AXNA 1RLDA 2HSEB 1S6OA 3LF0A 4WZQA 2XMUA 3POTB 2BDPA 3AD9C 4LRCA 5CH7B 1S1XA 3TAMB 2M8HA 1F3FA 2ZUAA 1NLKL 1DAXA 2XSJA 3QLHB 4RWWA 4WU3A 2GVZB 4OI6A 3ZTSA 4J9RA 3V6HA 3IGNA 3CXCR 2M70A 4OV6A 1PG5B 2DNZA 3CCQS 1N4LA 1M5SA 3GPAA 2QLWA 2VPXB 1HI1A 4XDCA 4LF4F 4KHPF 1MNEA 4CLUA 2UVRA 2PC6A 5D6GA 2YNGA 2V34A 2NR0A 1RAIB 4F02A 2LQ5A 5CCMA 5CZVA 5KFNA 4ETZA 2DRBA 1BWEA 3KFWX 4Y34A 5F0UA 3RZAA 2MDAA 3A3OB 2VQEF 2VUGA 4ZA1A 3TUJC 3G71S 1EIYB 2HMIA 1N32F 1GTEA 1WC3A 1X5SA 2ZH7A 2GJFA 4PQUA 1WI8A 5A8WA 2P9EA 4DG1B 4Z7YA 1HWIA 2BM1A 4URQU 5A0YA 2VC0A 1UW9A 3DRPA 4X4RA 3POTA 4ECUA 5HVHA 4A8FA 4FXDA 3EJMA 1Z4UA 4NLWA 1UVJA 3EGZA 1FDAA 4PWUA 3UCGA 3VQSA 1NHVA 1DTTB 1JLQB 1PYTA 5KFRA 2HK3A 2IAJB 2NLWA 2GGPA 3ISNC 4H4KC 2CQ3A 2ZFHA 1XMOF 2E5LF 3SDEB 3U7JA 3WBZA 5ETKA 2LDIA 3HX9A 2EI5A 3G82A 3MPVA 3OXFA 4IYQA 2IAJA 1SJ4P 2C3PA 3M6UA 1U1MA 9RUBA 2GMHA 3W66A 2QA4S 4WIIA 3C8YA 1RT5A 3HI9A 3HF5A 4IG0A 1VQLS 2HVIA 1SH2A 2P2CB 2AJ2A 2BMBA 2HG4A 2QTWA 2RE1A 1KFSA 1MROA 1PBAA 2DO4A 2W9BA 4PQUB 1LW2A 3IS9A 5BYQA 2G1DA 4X62F 2DR7A 2DR6A 3ZZRA 1QUVA 3IG1B 2YNHA 1BQNB 2Y1LB 3V81B 2MKCA 3KK1A 1GK8A 3C16A 1QDUB 3PYDA 1R43A 2F65A 1ZM2A 4KO0B 2RQKA 3CDBA 2UV8G 5BR8J 1R0AB 2R9LA 3MPUB 4ZP7A 2I5JB 3V81A 3AB2B 1S97A 1Y5LB 1Q86T 4KO0A 1FT8A 5BYSA 2ZH9A 3OVAA 2RDIA 2IRYA 1QE1B 4HEA9 4QIGA 2CJYB 1TELA 2HW3A 2HHXA 3NXZA 5JVGQ 3LAKA 3BQ1A 1Y00A 3UN2A 1FVSA 1WF1A 2FJBB 3AXMA 1ZS6A 2E1RA 2GV1A 3PG9A 4KRWA 1Y10A 3W2VB 4EI2A 3GU0A 3MECA 3UNGC 1TK5A 1M5KC 5KT5A 1VDHA 4HI2A 5T41A 2O66A 2FHJD 2CQ1A 3BN4A 4YMEA 2Z57B 2Z58B 3AB4B 1BLUA 4WWSA 4MT1A 5EHHA 2KFNA 3LALA 4CLKA 2LDYA 4C6AA 5JJBA 3CEDA 4FYYB 2YVSA 3R7SB 3B54A 2LFVA 2F8MA 4DR1F 4RLEA 5HLFA 4GKKJ 1KLMA 4R5PB 5EDWA 3ITHA 3K17A 1B70B 1RAOA 2DNMA 4OX6A 1S76D 2B6AB 3K2YA 3CIMA 4OX9J 2MQQA 4EEYA 2QL7B 2CZVC 1U0HB 4ED5A 2HK2A 4N47A 1F2GA 1S1VA 5JVHQ 2BKNA 4BHQA 3ZTOA 4J9KA 1D0EA 1S6PB 1NMEB 3DLGA 5KG5A 4NXNF 4ZN1A 2OPSA 3S01A 1GEHA 3DLBA 2ZE2A 5LSLA 2IYGA 4NCGA 3PW7A 2DNHA 3SQGB 5DDQC 2E5LJ 2DNNA 2VPZB 1SJFA 1R6YA 2YKMA 3EPGA 4N76A 1KKHA 3C46A 2HHQA 2W8KA 1R8PA 2Y1JA 3MPYA 2XSJB 1TUGB 4CO5A 2W9AA 2VOPA 3AOCA 4YS2A 3RTVA 4XAKA 1NDPA 1TAQA 4UTGA 5HROA 2XLJA 3RRHA 5KFFA 3M8SA 1UZHA 4CT8A 5I4MA 2W2QP 4F4KA 2R7UA 1EZZB 2UXCJ 3RU0A 3MUTP 5E41A 2HNZB 4DV2F 4RZRA 4NLDA 3SSRA 3GJSB 3N9UC 1SJ1A 2E44A 3P3DA 2BBEA 3C66A 1I94J 2BW2A 4FYVB 2FTRA 4NOHA 1R3NA 2ZOMA 4ECQA 1Q53A 2K1RB 1N8RT 1WD6A 2VG5A 3HJFA 4NE9C 3DRYA 4K4UA 2FC9A 4PEOA 3V4MA 4ATNA 3V6KA 1WTBA 4IRKA 4Z2XA 1NKCA 5A0YB 4DR7F 1X7VA 2HQCA 4KYZA 3OTOF 3CC4S 1X9SA 3G6XA 4NRTA 4PUOA 1U2RA 1X5PA 2HNYB 2UUWA 4FKYA 2ZWOA 2CADA 3EZUA 4HYKA 4YHHF 3EVOA 3A12A 3IRWP 4BWJA 4KBIA 5CXTA 1EQ0A 2LKZA 4KGVB 5B0EA 3T1YF 5IWAJ 4Y0FA 2GGPB 4OX7A 1VIOA 4DEZA 1S1WB 3GQCA 3P49B 3ILJA 3DLHA 2SXLA 2KYZA 2IHR1 4HACA 1VISA 2RQ4A 1JQGA 4ZP9A 2ZNYA 1JLBA 3PIPQ 3MUVP 4P72A 2BANA 4ZCMA 2FQQB 4FS1A 4DF8A 1NPKA 3W62A 4AD6A 3MR2A 1RADB 2LEAA 2AJ1A 1RHRB 2QMXA 2VH7A 2DH9A 1ELOA 1SC1B 3BEGB 3UCZP 4WK3A 1KLNA 1WACA 3D54A 3HT0A 1H72C 2GQ2A 3CCVS 3B6BA 3MFHA 2MTLA 2C22A 1FVQA 1Q95G 2B4OA 3AH6A 4WBFA 4F2RA 3CJ8A 2AQ4A 4YB1P 4USTA 2M7SA 2QJ3A 1U0SA 4X65J 4A8QA 1FDNA 3MMJA 5KFCA 4FF1A 1YBUA 4QIWD 3OL9A 3MEEA 2YNGB 5JMNA 5M2PA 3MZIA 1UJ6A 3TO8A 2GS8A 3OJUA 2MQOA 2HRTA 4DR4J 2N82B 2XC9A 2HGNA 2JSXA 2JX2A 2OO4A 1RE1B 1YJRA 2W8LA 5GADI 4AL6A 4CO2A 4CLTA 3KDNA 3PCOB 3TAMA 4PXEA 2DXFA 1C0UB 1Q16B 3UE2A 1ZZFA 2BX6A 4E98A 2PE8A 3M8PB 4G1QA 5T7LB 1EKRA 1SI9A 4ELUA 5K9FA 4BCAA 2C3UA 3JXOA 1JJHA 3R6LB 3GP9A 1A9NB 4ITSA 2J0QD 2IC3B 3BB5A 2L3MA 3D3BJ 1QY7A 2PI5A 1LWCA 3WX8A 4C8YA 2DIVA 1XR7A 1AXQA 3R7BB 5HJYA 1QSLA 5DRKA 1KSPA 2ABYA 4ED3A 2B9XA 3CJSA 4DL5A 2LLZA 3HHEA 4L3NA 2X51A 3QZ8A 3EWGA 2CPYA 2VG5B 1U49A 1G7CB 4PAAA 1FKOB 4DQQA 2PI4A 3CE8A 3TQ1A 3NMAA 4Q44A 2L9NA 3CCES 1YTYA 4G1QB 1RWUA 4CCHA 4N41A 3LPYA 3QGPA 1FJ7A 1Q7LB 2RT3A 4J37A 3BREA 3IWXA 1U1PA 2FZGB 1NK5A 1CVJA 2GIFA 4IFVB 1RUSA 2F3JA 1FNOA 2EG2A 4URSA 1U1KA 1DRZA 2CYYA 3LP1B 3SFGA 1PO6A 2X7IA 3T5JA 4AL7A 4NYPA 2PD1A 2QYGA 3R27A 2KFYA 4M5NA 2DRDA 3SV3A 2M3DA 2CZ9A 4DJBA 5J2MB 4J90A 2COLA 5I3UA 4X4SA 2FLLA 1UETA 2ADCA 3OR1A 3TI0A 3LTOA 4M5LA 1FCAA 1RT7B 1Y5NB 2NXNA 4RW4A 4ZN3A 3Q22A 1VBZA 2FLPA 2DO0A 4IG3A 3HSJA 2DD8S 3FRZA 1NK6A 3QO9B 1IBKJ 2UXCF 2HQFA 3X1LB 4K0KJ 2XZTB 4M5HA 5KFGA 1N48A 3BM7A 4KKOB 1IKXB 1PILA 4DUYF 3BO3A 4LT6A 1NJZA 2MLYA 1FDBA 3RRKA 3UNYA 3H0PA 2ZHAA 3R9LA 5F8NA 4ES1A 3EZOA 2AJ0A 1A6LA 3WX4A 5B0AA 1J2VA 1RP5A 1T3OA 2ZBCA 4NI2B 5KAKA 3BGRA 4NX9A 4O0NA 4U95A 4RW6A 4TYAA 4WU2A 5LMNF 2VL1A 2XWYA 1S48A 1WF2A 3GCWP 1M0SA 1XEZA 1XNRF 1LQ9A 2WSEC 3CDUA 5KFYA 4J5OA 4NLOA 2HNDB 3RYLA 1VQKS 2I8EA 3MAAA 1CS4B 3QSIA 3Q2TC 3Q8YA 4P9SA 1C0TA 2WHOA 3VAGA 2E9RX 3J7A1 4N8NA 1UMJA 1N88A 2K7KA 5KFDA 1YITS 2V50A 3OFEA 2J7UA 2IVFB 1JJ4A 1YLXA 4J9MA 1NZ8A 4ELVA 3CIZA 5F9LA 5J1NA 1N54B 2EFNA 2RAQA 1VQ8S 3TWZA 4KIAA 1ZTTA 5D4PA 4PG8A 5L38A 1S77D 1C1CA 3J7AN 4LUBA 3OXLA 1VRUB 4HLBA 2R8HA 1M1GA 5HBMB 4B9TA 4O3SA 4X4PA 1HQEA 2ASYA 1T9XA 2UVVA 4DSJA 3KLEA 5KFHA 2LECA 4B3OB 1RWXB 2HNZA 2OFGX 1MG7A 2QN6B 3F0NA 3MD1A 5DM6Q 1ZPWX 1B0VA 4ID8A 1RAJA 1SJRA 1F60B 2J9DE 4KV8A 4PG6A 4KH0B 2YBVA 3WQPA 4MIAA 2BA9A 4KPCA 5D4OA 3HLUA 4UF4A 4WPAA 1UEVA 3QSYB 4A8OA 1NKBA 2WBMA 4K5RA 2BJ1A 1NH7A 2BUNA 4JI8J 4A8YA 1TKTB 4KY3A 3T5LA 3I5AA 2YY3A 3CWJA 4LQ9A 3PFEA 2F1FA 4NXMF 4KGKA 3Q23A 1VQ7S 1RISA 1FFSB 1ZBTA 3PX6A 1AZSB 2VB6A 5I3UB 3GONA 1R31A 4ZKAA 4ECVA 2XI2A 1TUVA 3LGMA 2K3IA 1S0MA 5ETTA 4DR7J 1QLNA 2AKWB 3BKUA 2C2KB 4DPTA 2FJDB 2JNJA 3NKYA 4ICLA 3VHQA 5IT9Y 1HQ2A 2JFDA 3R5GA 6FDRA 3KK3B 1HBOB 4I7FA 4JI4J 2LQBA 2R8KA 3RW7A 4LSNB 3SCJE 2G2ZA 1RSCA 4FF3A 4Q5VA 3DLEA 1IM4A 1VHFA 1ZM9A 2Z0GA 2HFZA 2BE2B 4H4MA 5H9EJ 1OJ4A 2D3OR 1U6BA 3DRRA 4J9VA 2ALYB 4QR0A 1REGX 1KC8T 4GVBB 2AZ3A 3UN5A 1YWXA 3EGWB 3MEGA 3MM8A 5KG7A 4IUFA 3DDNA 4J9LA 1U7LA 3WZ0A 3KJFB 3AQPA 1TL1A 2DTJA 2JHEA 1HMVA 1N0UA 3L7OA 4QZVB 3HD1A 3IP0A 5CD4A 3C6TA 2XO6A 1HYSA 2ZZTA 2E5JA 2J0SD 2K7JA 4XTTA 1BQMA 2YXLA 4OI3A
chains in the Genus database with same CATH topology
2JLGA 3CB4A 4R8UB 3CSKA 4U7UK 5B09A 4F3OA 1BD6A 2C3OA 4QR2A 3AA8A 5EWEA 3PFOA 1KOOA 1T95A 2YWFA 3CCJS 1U1NA 4JI1F 4H54A 1R89A 3HXMA 3ZFVA 3TAQA 4B9UA 2QA1A 4ZVEA 4BS2A 3I0RA 4K5SA 1GQEA 4CO3A 4PRFA 2J5AA 1EP4A 1S49A 3DOMA 4TY8A 4C3MA 1KQKA 5KFMA 1HWLA 5B7WA 3ZZYA 3EXYA 5CYJA 4JI5F 4JI7F 1TKXA 3E3XA 2Z2LA 4ID5B 2YX7A 3HZEA 3OTCA 4RX6A 4WFYA 2MHNA 2B4UA 2HVHA 3S8SA 4H4OB 3QAUA 3IWNC 2C2DA 3I82A 1JX4A 1NAQA 2MB0B 1Q8IA 4H4OA 2KM8C 3ZZZA 1JB0C 1AFIA 1KQGB 1S79A 2YKNB 2R4FA 4CI0B 3DXBA 3SDEA 3RBEA 4DDFA 3FMBA 4NLYA 4RNNA 4CH7A 5HMZA 4Q8EA 3TUIC 2J9CA 5EWGA 2KU7A 2Q6CA 2B9WA 4OJHA 2EFVA 4JV2A 2OFHX 3RB4A 3TX8A 2L08A 1P1TA 4HT7A 5HI7A 4ECRA 1T7PA 1PSDA 3MD3A 1VQYA 4KV8B 3EX7B 4DS5A 1OO0B 4ZPCA 1RA7A 2AX0A 2LQJA 4NCBA 5B0BA 2A18A 2UXBF 4EO6A 3J81Y 2KT2A 4UW2A 1NK9A 4Z37A 1MW7A 2N4CA 2J8AA 2F40A 3C6UA 1NKEA 2WCXA 5F0WA 2HYIB 3OV7A 3I6PA 2XCPA 3TRGA 3QIPB 3M2RA 3SCLE 2D9OA 5FDLA 4QW9A 4RUHA 5KFUA 3MECB 4YR0A 3KMSA 2DISA 2EPIA 4ICLB 4LMZA 3K8WA 2ZVSA 1W2BR 4B9NA 3B78A 2P6SA 4J9NA 4PG5A 2BE2A 5D78A 3HO1A 2ZC4A 3M8QA 3HVAA 3N0VA 3PRBA 3D5MA 1OPIA 1Z1ZA 3KKFA 1KQSR 2X1FA 2O1PA 4JI6F 1T03B 1N52B 4TN2A 1RKIA 2J9DA 3DLKB 3MHYA 1JLAA 2A2DA 1H6KX 3FMWA 1ZTWA 1HMVB 1U6FA 2X1BA 3FSXA 1RK8A 4IRCA 5KFLA 2DGXA 2FUG9 1RJJA 3B4MA 4X66F 3HFKA 3NNAA 4JYAF 4M1KA 2ZC3A 3JSMB 4O0IA 4DPOA 2OPRB 4K4WA 2NS1B 1N0VC 1FHTA 5LT5A 1S9EA 1VQSA 2RQCA 3M30A 2RKIB 5J1PA 2ZKTA 1WG5A 2RH3A 1FESA 5IXUA 1BGXT 2OD6A 3PV8A 3D1OA 2FVRA 2C2RA 2H9ZA 2YKPA 4MYTA 5L1KA 2VV5A 3O3LA 4OHZA 2KG1A 4YP3A 3R5CA 2OTLS 1REVA 4P7TA 1SUQA 3LP2B 4NLUA 1YJUA 1KVJA 5CZXA 4MYUA 4NLQA 2KHDA 5KFZA 3LH2S 3LP0A 5BJRA 3Q8RB 3KYLA 1P9QC 1BWEA 4E0DA 5BYRA 1WEYA 2RILA 3ENVA 1UAWA 3MM6A 5ITHA 3KLEB 2W25A 1S6QA 3OLBA 1SB6A 2EFPA 3AJ2A 4JI3F 4JI2F 4RW7A 6FD1A 3MGJA 4LJMA 4URGA 3M9MB 4A4JA 2UUBF 1IQZA 4FXWA 3LUYA 2HQIA 2LEPA 4C8LA 3OSNA 5DG8A 2IVYA 4JI4F 4CZCA 4MAKA 2B5JB 5A8RA 5J2PA 3V6DA 3D0HE 2MZQA 3ULHA 3QGGA 3OPKA 4IRDA 1RTJB 3FZ2A 4WXWA 4YR2A 2ZH2A 2WB1D 2YQ3A 1DQ9A 3KMQA 1MU2B 1UWBB 2AYEA 2CQIA 3JTPA 3UCUP 2IA0A 3FGVA 2DJWA 3GIMA 1X0FA 4I64A 2QT7A 1D3WA 2QO3A 1ZETA 1BQXA 5KFVA 4OI1A 3DM2B 2VFTA 2UUTA 1E6VA 1MSWD 1C0TB 4P2SA 3CDWA 2XLIA 2NPIA 4PXDA 5F8MA 4WZMA 3E01A 1P1LA 2CQGA 4C8OA 1HPZA 2P9GA 5KT7A 3QZ7A 1ZH5A 4YB7A 3UD3P 4DBQA 2DGWA 2FY1A 1LFWA 4QOTA 3NS6A 2XY6A 3NL0A 1HBMB 4BC7A 3O5TB 2CQPA 2VOOA 5E3AA 1JNRB 1AFJA 3TVZA 3BQ2A 5KT3A 3GE9A 3K5PA 5K14A 3MR5A 1YRTA 3PR5B 3G96A 2LXFA 4R0EA 4ZCIA 4LF7F 4QWBA 3Q24A 4DR2F 2B7BB 2B51A 1TV6B 2PT0A 4KR0B 4MK8A 2AU0A 1V9OA 3DHWC 3OUYB 1LXJA 1NHUA 5DO2A 4RBVA 1VRUA 2CPXA 4TU8A 4ED2A 4ZP8A 1Y5IB 1HI0P 5A6WA 3NCPA 1SL1A 4K4ZA 1SV5A 3MMCB 3QGHA 2W9CB 1IBMF 4F4YA 1XN9A 1U25A 1W25A 1DBDA 2Z2MA 1B0PA 4ETXA 4IRKA 4RWXA 1PC5A 2L41A 2I9SA 3HHLD 5L9NA 2ZH5A 3PO5A 3KLGB 2FC8A 3BR8A 3V4IA 1RTDB 2P6TA 1RTIA 4QW8A 2K1RA 2CPHA 1FA0A 1TVRA 2MZRA 1F9FA 3LWLA 3HZGA 4ID5A 3J7ZT 4IQMA 4K59A 2XMVA 1IKWA 3ZC4A 2CKWA 1NZAA 3PO4A 2VFUA 1UKUA 3ENQA 2KG0A 2ZH1A 3UR3C 1QM9A 1X4HA 3BGUA 2OH2A 2IBKA 5F8IA 5J2MA 5C24A 4I6WA 4QIFA 1J5OA 2VKRA 4JBCA 4I2QB 1ZAXA 4DL6A 2Z4PA 2M8DB 2R7SA 1N33F 2R7TA 4NMLA 3DM2A 2MY7A 5J2NA 2M88A 2MQMA 3D1HA 4HTJA 1FKPB 2BRLA 3HMJG 4QYZJ 1RT1B 2PA8D 1HNWF 2HS3A 1EETA 3SCIE 3J7Z5 4I69A 5GAEI 3X3UA 1FTRA 1N5YB 5KFXA 1S72S 2QA2A 2MZ1A 1SIZA 3KLHA 4RW9A 3BN7A 5L1JA 2LXUA 3TA1A 4N56A 1TL3B 2FVPA 4OI0A 2UU9F 2DPJA 2DNKA 2U2FA 4RW9B 1FF2A 1QSSA 1UVMA 3H25A 3VR1A 1XMQF 1TKZA 1PC4A 3MM8B 3VZIA 2EK6A 2CVEA 2E5HA 4FP9A 4IOAQ 1VJWA 5HP1A 4IQXA 2HNDA 4QU6A 3IN5A 2O3DA 2DNLA 2MKIA 1U8SA 3KLVA 3GWCA 4TXSA 5J2NB 4CNZA 1IBKF 3EUNA 3UFCX 2VPYB 4HTIA 1FXDA 3THTA 3NLCA 3KLFA 1TV6A 4DLEA 3PHEA 4YDDB 2M9KA 2MZSA 3M8RA 1U2FA 1Q7YT 1NB7A 3UQSA 1ZAVA 5FJ4A 5F3TA 3U02A 3WDOA 3PACA 4DR4F 2CQCA 3T19A 5KFAA 3HT3A 3I0SA 1OQ3A 5E3PA 3HHLB 4KC5A 4IH6A 1DTQB 2ZH6A 4ZK7M 2OPRA 2V8DA 3MM6B 1VQ4S 2OPSB 1P6TA 3DLGB 3Q8PB 1R7IA 4U9RA 4WJBA 4KJIA 5B08A 3MR3A 1SL2A 2CPZA 1VIXA 2YX4A 4A48A 2AJFE 4DWIA 2YKMB 5LXYA 3ZZOA 1N36F 4LF6F 1S9EB 4ECZA 1X8DA 3KK2A 2QSWA 4QIEA 2XS2A 1Q78A 2HIQA 2P5VA 3BO4A 1HNIA 3MMBB 3PW0A 1Y9OA 1VQ6S 2O01C 3UDCA 4FVMA 4OJ1A 3T5KA 2AJQA 1XERA 3PW2A 2J6SA 1QTMA 3I4PA 3DOKA 3MAQA 1S9GB 2KHCA 2BQ3A 1D9DA 2PN6A 4X64F 1XNQF 2LA4A 5CYQA 1HNZF 3T6BA 1R8CA 3HHLC 4JUZA 1NK4A 2EWHA 2KRRA 4O4RA 5AXKA 2L9DA 2ROEA 5CCLA 3KTQA 1K1QA 2YNFB 4JI0F 4ZPVR 3KHRA 1KFDA 2YKAA 4RU9A 2EK1A 2RU3A 1P27B 4V19X 3NAHA 2RRAA 2GA7A 2EBGA 1HI8A 3OTEA 3AJ1A 4YDXA 5KG1A 5SZTA 4RU2A 3VCDA 1HYSB 4UUWA 2NSCA 4GMKA 2B0GA 3SSSA 4ZHRA 1YQHA 2Z8QA 1QAJA 1HW9A 3US5A 4P7VA 3SI8A 2CZ4A 3W2VA 4ZPDA 3KNAA 2W9BB 3SYZA 4DV0F 4OZNA 1VMBA 3T1AA 2XS5A 2A1BA 2KM8B 4RKUC